2RGFA

Rbd of ral guanosine-nucleotide exchange factor (protein), nmr, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
b'ALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALGEF-RBD
molecule tags Ras-binding domain
source organism Homo sapiens
publication title Structure of the Ras-binding domain of RalGEF and implications for Ras binding and signalling.
pubmed doi rcsb
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1997-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rgfA00
2O6VD 2HE7A 4LDTB 1YX5B 2N1WA 2NR2A 2DAFA 3P2BA 2KVRA 2MBBB 5AZHA 5G55A 5KHQA 4EUTA 3APCA 2KANA 2MBHA 2PE9A 5D94A 3PT2B 1WMHB 3PHXB 2RPQA 3APDA 1V6EA 2DZIA 1ZW7A 2PEAA 2WX1A 4XZ4A 4PYUA 1WI0A 3DQVA 2KFKA 1KM7A 2KJRA 4AOFA 3TJPA 1WX7A 2CU1A 3QAQA 3ZKJC 1WJUA 3IFWB 2I1JA 2KK8A 3PPAA 4GB9A 4DHJB 1WJ4A 1WJNA 5CHWA 1WXAA 2L0TA 1WIAA 1MG8A 4NJ6A 3TCAA 2K8CA 1LM8B 2GBKA 3QARA 4MM3A 3UF8A 2NVUI 3GOEA 1V2YA 4W9KA 2LRUA 2GBRA 4PS3A 3VUWA 1A5RA 3PS6A 4GGQA 3DCGA 4KVGB 3UINB 2I1KA 1XD3B 2JVCA 3KUDB 4KZ0A 3SU8X 3MHSD 1EF5A 2XK5A 3V6EB 2DHZA 1XT9B 2G45B 4CHKA 1TTNA 1XQQA 1P3QU 2AEHA 2V4LA 1J0GA 4MGIE 2DZKA 5EDSA 4PS7A 4MGKE 2CKHB 4M8NA 2ZZPB 3UIPB 2VRRB 2DX5B 2MCNB 3WAMA 4ICUA 5IAAC 3AI5A 2K6DB 4BOZB 3ZO5B 1OEYA 5JHBA 1SIFA 1OGWA 4WJOA 4G0NB 1OQYA 3NZUA 5GMVA 1EUVB 3L13A 2MLBA 2JZZA 3ENEA 3OAWA 4ANXA 4MGZE 2JUOA 2MX2A 3RD2A 2L05A 2IO2B 2HJ8A 1M94A 1WR6E 2NCNA 2KC1A 3IG3A 4P7IA 5CHFA 5AEKB 3H7PB 4HCPB 4DWFA 3AULA 4NQLB 1V49A 2D07B 3N30A 5FR6A 4RM9A 5L95C 3DBSA 2L00B 4K81A 3H9DA 2ZNVC 3ZNHB 5J18A 3T8MA 2KOXA 3U7DA 3X23A 4AJWA 3HIZA 2N1VA 4G50A 5D7GA 2D3GA 1WRDB 1NI2A 2MRPA 4IWOA 5DPRA 4II3B 2MBQA 1TGZB 5CHVC 2ZPNA 3PHWB 3RZFA 2NPTA 4EKUA 5LXIB 4OVVA 4W9JA 2IY0B 2IO0B 3DBRI 4ASWC 3IHPC 1UBQA 4LJOB 4MH0E 4FJVB 4EEWA 5BO4B 1UH6A 3EC8A 2KWUB 1YX6B 2Z0DB 3PSEB 4IM0A 5C23A 2FAZA 4IWPA 4HK2A 3OLMD 4DDGD 4BBNC 4BBNF 3A9JB 2KKCA 3DDCB 1NDDA 3KW5B 2KDBA 1R4NI 4K1RB 2ZCBA 4GMVA 4GXBA 5G2NA 3A9KA 2LVQA 2R2OA 3A33B 4I6PA 4DXAB 4KDIC 2XK5B 2EKEC 2PJHA 1FXTB 1GG3A 3ZNGC 2FNJB 4GSWA 5J17A 1LFDA 3LDZE 4GU2A 2KX0A 1WXMA 3NOBA 3A1QA 3ML9A 3RCZA 2FCMA 3H6NA 2XBBC 1UBIA 5E6NA 3ZTDA 1WJ6A 1BT0A 1RFAA 1WM2A 2DZMA 2V1YA 1WZ0A 2XEWA 4AJYB 2KO3A 4FA6A 2LGXA 3WAPA 1EF1A 1E8XA 4WJQA 2M4NA 3AXCA 1I35A 1F9JA 3NZSA 2J0KA 3WA0A 3DVGX 2JPHA 4MSMB 2BYFA 3H7SA 4GOCA 1YQBA 3DPDA 4XC2A 3VH4B 1KOTA 1V81A 2LI5A 2MBOA 2V3SA 2DYOA 4GN1A 4NY0A 1IPGA 4B95A 3I3TB 5E6OA 4GDKB 5J2RA 2ZCCA 3BINA 2MWSB 2JY6A 2BYVE 3ZLZA 2KC2A 3QWZB 2NBVB 1WE6A 2KX3A 2KTRB 4ANVA 4DHZE 1C1YB 1UZXB 2UYZB 3PTFC 1WMHA 2N7EA 3R7RA 1V5TA 2DENB 3N3KB 3IVFA 3JYUA 5LXHA 2KZRA 1H8CA 2IYDB 2QHOA 1V5OA 2JWZA 1GNUA 4W9FA 1JRUA 3B0AA 3PRPB 3VHTC 1L2NA 1ZGUB 4TQ1A 4F8CB 4JLCA 2D2QA 1P1AA 4BKSD 3UIOB 2KXJA 3VXWA 3QX1A 1WGDA 1E5WA 4DDID 4K7SA 2N9EB 2GBJA 2M0XA 1WYWB 1X1MA 3NHEB 3A1QB 3NY5A 3RUIB 4NNJB 2DAJA 3K9PB 4HXDA 5D2MB 2DYMA 3QA8A 3M95A 2KNBA 3APFA 3HK0A 4A3OA 4TQ0A 2J0JA 3GZNI 2M1MA 2LUEA 2KMAA 3H1UA 4JQWC 2L3ZA 3VUYA 3R3MA 5DCNA 4NAWA 1GC6A 1VD2A 1WX8A 2AL6A 4KZCA 2FCSA 1Z5SB 4N9F4 3VVWB 4GIVA 3A9JA 2N9XA 4DBGA 4BOSC 2LVOA 1Q5WB 4ICVA 4JGHB 2CS4A 4K7UA 2GBMA 4LCDE 3CSFA 4I6LB 2C9WB 2LXCA 3A9KB 4IG7B 3VAWA 2J7QB 4DHZB 3UQBA 1D3ZA 2O6VA 5E6PA 1OTRB 2LWPA 1WR1A 2A4ZA 4HVBA 4E3CA 4WWNA 2MSED 4FLHA 4GDLA 2JXXA 3KVFB 3PREA 4OVUA 4KSLC 2C5LC 2IY1B 2KHWB 2D11A 2MA9B 1IP9A 2UWQA 4MGYE 4KIKB 2KLGA 2EMSA 3T9LA 3TL5A 3ZNID 4IM2A 3DBLI 2N7DA 4HWIB 2RGFA 3AU4A 3WALA 2KJHB 1KLVA 1U4AA 2Z0EB 1E8ZA 4PS8A 2LXAA 4E74A 2JRIB 5DPWA 2C60A 3QC8B 2LGDA 4FADA 3ZRFA 1ZKHA 4ZYNA 3WANA 2MW5A 1G6JA 3V61A 2WYQA 3MJWA 4IUMB 3RT3B 3ZUNA 2KWCA 1E8YA 2JT4B 3KYDD 1GC7A 4PYZA 4X57B 5DPSA 4EZKA 2ASQA 1GUAB 4FJYA 1LQBA 1S1QB 3JVZX 3CF6E 3VTVA 1C3TA 2BKFA 1IYFA 3L08A 1Z2MA 3CMMB 4EFOA 2LASA 3M63B 1TZ1A 4JL9A 3L0WB 3QCAA 4GDKA 2KJ6A 3RZWC 2BKRB 3ECIA 1T0YA 1LXDA 2K25A 2LZ6A 1WZ3A 4RMAA 1WE7A 2AL3A 3JSVA 2NBUA 2ZVNA 2MP2A 5CX3A 1K8RB 4MJSB 1AARA 2CHZA 4DHJD 4B9KA 1WF9A 4J6IA 2CHXA 4TV3A 4E71A 2HD5B 1WXVA 4II2B 1EO6A 2Z59B 3TMPB 4MDKE 1SE9A 2NPTB 3PVLA 4BKTA 4YL8A 2K8HA 2R2QA 4WQOB 2O6VB 3DBHI 3QJZA 2G4DB 5JH5C 3S2AA 1TBEA 4W9LA 1KJTA 3ZIMA 3KYCD 2C7MB 1RRBA 2OOBB 2G3QB 5KHOA 3WAOA 2IBIB 3A4SC 2L0FA 3TIXA 3A4RA 2REXA 4W9CA 5DPTA 3KH0A 1E7VA 2YLMA 4EZJA 4HPLB 1V9JA 4MELA 1YD8U 2KTRA 2NS5A 2LGYA 3HM6X 2JRHA 4MEMA 1WGGA 4W9IA 4TUUA 5IA7A 2K8BA 1WX9A 3DOWA 4ZRKA 4W9DA 1OEYJ 2ZNVB 2BYEA 2KQ7A 2IO1B 4WAAA 5AZFA 1UELA 1P9DU 1WGHA 2HTHA 1GJZA 4GDLB 1WGYA 3SHQA 4BKGA 4IM3A 4M0WB 2BGFA 3MTNB 2KDEB 4LDTD 3JW0X 4TKNA 1Q1OA 4WWOA 2AWTA 3DVNV 4HLEA 3U8ZA 2O2VA 4BKSA 1E8WA 2NBWB 3H7PA 1WY8A 5D6JB 2DYBA 2OJRA 4JIOU 2KMCA 2PE6B 4EOYA 2KN5A 2N4FA 3M3JA 3W1SC 3DVNU 2GOWA 4HDQA 2G4SA 4HPMB 3HM3A 4URKA 2ZPYA 4I6NB 4ZRJA 2KWVB 3KUCB 2RR9A 1WXSA 2ZVOA 4KDLB 2KDFB 4AP4C 2GMIC 3R66C 4BVUC 3KUZA 2M17A 2JF5A 3ML8A 2CR5A 2RD0A 5LLIA 3ONSA 2J0MA 3PLVA 2AYOB 4HJKA 4ANUA 5C1ZA 2BWES 1WFYA 3VTUA 2MP2B 3V6CB 1SGHA 2C7HA 1L7YA 3RULA 2FIDA 4DK5A 2GBNA 2L8JA 2Y5BB 1V86A 2BPSA 3PV1A 3PLUA 4K7WA 4WJNA 2A5UA 4RM8A 3VFKA 3PGEA 4CYEA 3TBLD 2WX0A 4NAWB 3VTWA 3OJ4B 3PRMB 3QHTA 3VH3B 3ZVVA 4XX5A 1I42A 4B6WA 3CSTA 3OJ3A 4F7ZA 2CHWA 5JHAA 1RAXA 4MSQB 3L54A 3ZW3A 2KFJA 4KSKC 1J19A 2L7RA 4CO7A 4FN2A 4IWQA 2BWFA 3L17A 2O2VB 4HDOA 1E7UA 5L83A 3K9OB 4KV2A 4NJ7A 2FIFA 4FHKA 3UGBB 3HHMA 5HKHA 3VQIA 4IC7B 2IZVB 2YVCA 3LJ3A 3M62B 1NBFC 1V80A 2LD9A 4A3PA 3D32A 2WWZA 4HCNB 3ZDMC 1UGMA 2KTFA 4W9GA 3U30A 3N32A 4KIKA 1ISNA 2PPHA 3SDLC 1WGRA 2K1FA 3NS8A 3O65B 3QIJA 3UQAA 2LRWA 3X0WA 2KQSA 4EZLA 3W1YA 3B08A 4FBJB 4ANWA 1RLFA 1VCBA 2DZJA 2W9NA 4WJPA 3R7QA 3Q3FA 2FCNA 2FCQA 3B1LX 3V62A 1E90A 3RYTA 4A20A 4G11A 2FUHB 1P0RA 3BY4B 4LJPB 2B3AA 2MQJA 2LJ5A 3L10B 2WDTB 3ZDTA 2K39A 3QK0A 4MJSA 3QQ8B 3JSVB 3EHVA 4FULA 3EECA 2IO3B 3C0RB 2LVPA 1J8CA 4W9HA 5TR5A 2D10A 1Q0WB 2M8SA 4FHJA 2N9PC 3DVGY 4G3XB 1YIWA 3ZRCA 4NQKE 1R4MI 2KLCA 5AZGA 1PQSA 4ZDVA 3ZTCA 1YJ1A 3ZNZB 1Y8RC 2L76A 3L16A 4F1SA 1H4RA 2BF8B 2EMTA 3PRZA 4IW0A 1P98A 1CMXB 3IBEA 3VDZA 3WIMA 4AUQC 3EFUA 3SD5A 1UD7A 2K6QA 3AU5A 2ZJDA 4AWJA 3W1SA 4FJZA 1QZEA 3VUXA 2KDIA 2C7NB 2RSUA 5JZEB 1HE8A 2MBEA 4WWPA 1S3SG 3Q3JA 4BFRA 3ALBA 4ZRIA 2KFKB 1WM3A 3V60A 1WH3A 5CTRC 4M8MA 3PZDA 4W9EA 2JZ3B 2KD0A 4NPNA 2ZEQA
chains in the Genus database with same CATH superfamily
2O6VD 4LDTB 1YX5B 2ZW0A 2NR2A 4EUTA 2K5PA 1F2RC 2PE9A 5D94A 1XLOA 2WX1A 4XZ4A 4AOFA 1T5XD 1WX7A 1NYQA 3ZKJC 2I1JA 4GB9A 1WXAA 2L0TA 1WIAA 1MG8A 4NJ6A 1LM8B 2GBKA 4MM3A 2PLPA 1V2YA 3DCGA 4KVGB 1XD3B 3KUDB 2QSDA 3MHSD 1EF5A 3C19A 2Q5WD 1VLBA 1F52A 2G45B 4OHJA 1PGAA 2DZKA 2BTEA 4M8NA 1GB1A 1EWYC 2OEDA 1ZDXA 3WAMA 2K6DB 4PK1A 1I7HA 5JHBA 1OEYA 4HROA 1CZPA 1SIFA 4WJOA 1C4PA 2JX5A 3NZUA 1VZ6A 1EUVB 3AEEB 3ENEA 3OAWA 3N1ZC 4MGZE 4L1BA 3RD2A 1L4DB 1CQVA 2IO2B 2HJ8A 4M02A 1M94A 1IBXB 1L5PA 3IG3A 5CHFA 1T0QC 2PMVA 1T6BX 2D07B 3N30A 1TY0A 2WLBA 3Q3MC 2KOXA 3B9JA 2N1VA 5T8IA 4XDDA 2MRPA 2V3NA 4II3B 2D3AA 2YEPB 4EKUA 3SFDB 3ZGZA 1I4XA 3DBRI 3IHPC 1JCKB 1YX6B 4AQ7A 5C23A 4HK2A 4KX6B 4BBNF 3A9JB 3RNBC 1NDDA 2MH7A 1R4NI 1HXYD 2ZCBA 4GXBA 5G2NA 4DXAB 4KDIC 1JALA 3BK2A 2ACZB 1FXTB 1GG3A 1HA5A 5J17A 2QJLA 1HQRD 2WXMA 3A1QA 3BYTB 2FCMA 1BT0A 1UWMA 1FM0D 2QEJC 2V1YA 2XEWA 1ET6A 1ZUD2 4FA6A 1EF1A 4S17A 1ET9A 2N9LA 3NZSA 1T3QA 1YOVB 2J0KA 3VH4B 1KOTA 1KLUD 3FC4A 2V3SA 4NY0A 1YN5A 2ZCCA 1SSNA 2JY6A 3SEBA 2NBVB 2KX3A 1UZXB 2N7EA 2KVZA 1N61A 4HRSA 1WXQA 2R61A 1H8CA 2PW9A 1GNUA 1JRUA 3PRPB 3OG5A 1JWMD 2DNFA 1R4MB 4DDID 4IKGA 2N9EB 3NHEB 1X1MA 1YJJA 3NY5A 3RNGC 4HXDA 3M95A 3APFA 4TQ0A 3GZNI 3H1UA 4M00A 1VD2A 1RFKA 1I4RA 4KZCA 1HTOA 1QF6A 2WS3B 3A9JA 2N9XA 2LVOA 1VRAB 3SR6A 3AEBB 1SJED 1WR1A 1TY2A 4WWNA 4GDLA 2VZKD 4YSXB 1ENFA 1PFDA 2D11A 1IP9A 4MM3B 2FBWB 2KLGA 2EMSA 3T9LA 4IM2A 3DBLI 2WNMA 3ZYYX 2RGFA 1D5ZC 2H89B 1XCTL 3AU4A 1D5XC 2KJHB 1C78A 1E8ZA 4PS8A 3Q8EA 2C60A 1ZKHA 4ZYNA 1G6JA 2WYQA 1ACCA 4PYZA 3HUIA 1GUAB 1TZOA 3CMMB 2LASA 3M63B 4JL9A 4GDKA 3QCAA 2MEKA 1SE2A 3RZWC 1T0YA 1LXDA 4RMAA 1WE7A 1XCQL 2AL3A 1VJKA 2MP2A 3T3OA 1WF9A 4K3CA 3TSSA 1WXVA 3AE7B 5EE3A 2K8HA 2R2QA 4WQOB 3AE6B 1TBEA 1TKEA 3GB1A 2VZKB 3KYCD 2OOBB 2WQYB 3DWGC 5KHOA 2L0FA 2REXA 2YLMA 4MELA 1YNTE 2KTRA 1XLNA 4TUUA 2FUG1 1WX9A 2WDVB 2BS3B 1L0XB 1WGHA 4GDLB 1NEKB 3MTNB 1Q1OA 1SE3A 2AWTA 4WWOA 3U8ZA 4BKSA 2PE6B 3N1XC 2N4FA 2G4SA 3TUOA 1OFFA 4I6NB 2KWVB 4LNFA 2KDFB 1JW9D 1SF0A 3ML8A 2CR5A 2RD0A 5LLIA 2L32A 2BWES 1WFYA 2MP2B 2C7HA 4US9A 2RDBC 1EWCA 4K7WA 2A5UA 4N59A 2WHIA 4ZHPA 3VTWA 3PRMB 3QHTA 3ZVVA 1I42A 3CSTA 3L54A 4KSKC 3V05A 1J19A 4FN2A 1VDVA 2GLSA 4HDOA 1E7UA 4ARIA 3HHMA 2WU2B 2Y5PA 4IC7B 2IZVB 2KMMA 3GS2A 2N9KA 2LD9A 3D32A 4W9GA 4KIKA 4ZHOA 2PPHA 1FIQA 3N1YC 1WGRA 3AMZA 1J7CA 2LRWA 1EM7A 1DOXA 3NJTA 3R7QA 2FCNA 2FCQA 4A20A 4G11A 2B3AA 4MACA 1FD6A 3AV8A 3QK0A 3NRZA 1TS4A 3EECA 1BUIC 2LVPA 1J8CA 2D10A 1JQ4A 2IGHA 1PQSA 5IOIA 1YJ1A 1DOIA 5BMIA 1JRPA 1H4RA 3VDZA 1C4CA 3PZ7A 2UU7A 4B0MA 2K6QA 4AWJA 1QZEA 5G5GA 2RSUA 2K22A 2YEPF 4WWPA 3ZJTA 1KFYB 4RCOA 5CTRC 1ZXIA 2KD0A 3LXFA 1QKZA 5G55A 1ZDVA 5KHQA 2MBBB 4CQNA 2KANA 3E9SA 5BYRA 5MPOA 3PT2B 2RPQA 2IPKD 1WI0A 3DQVA 3DBLB 2KFKA 2QIEB 3TJPA 4P1CC 2CU1A 1JWBD 1WJUA 3H8HA 2KK8A 1WJ4A 1IGDA 1FMAD 5CHWA 1FFVA 1HZ5A 4P16A 3UF8A 2NVUI 2MJEA 2IGGA 4W9KA 4RGNA 4M01A 2WP9B 4GGQA 2I1KA 4KZ0A 3MC9A 5EE1A 1MFWA 4MGIE 4YSYB 4ICUA 5IAAC 1SB3C 3AI5A 1AW7A 4KGRA 3ZO5B 2BS4B 1OGWA 4G0NB 1OQYA 1K52A 3IXSA 1D5MC 1MI0A 2WXQA 1I4HA 2MLBA 4GLSC 2JUOA 4M0WA 2L05A 4HEA1 4O1NA 3RNFC 1WR6E 2NCNA 4P7IA 5AEKB 3H7PB 4HCPB 1ZXHA 3AULA 1V49A 1KF6B 2L00B 3ZNHB 2GRIA 3T8MA 3R8BA 3X23A 4AJWA 3HIZA 5D7GA 1WRDB 1NI2A 2PVGC 5DPRA 2M19A 3AEAB 2NPTA 5FK9C 4W9JA 3BK1A 2IY0B 2IO0B 4ASWC 1UBQA 3AEDB 4ARCA 3EA6A 4EEWA 4RFBA 5BO4B 3EC8A 2LUMA 3PSEB 2HDEA 4IWPA 3WCQA 3OLMD 4DDGD 2KKCA 3SFEB 3TEYA 5HFYA 4GMVA 3A9KA 3A33B 5BMGA 1V1OA 3TEZA 5IKCM 1RYJA 1IBXA 4GSWA 3U52E 1LFDA 3NVVA 3IAS1 2WXIA 3NOBA 3ML9A 4D2KA 1WRIA 3H6NA 1NYRA 5BYSA 3AECB 3ZTDA 2DZMA 1RFAA 4C00A 1E6EB 1EU4A 4AJYB 2HTME 2LGXA 2OJWA 1E8XA 3WAPA 1F9JA 4USAA 1QQRA 2JPHA 2ON8A 2BYFA 3H7SA 4XC2A 2WXLA 3Q69A 4GN1A 3I3TB 2BBCA 4GDKB 5J2RA 1TS2A 3ZLZA 2JXTA 2KYWA 1WE6A 2QILA 4DHZE 1C1YB 2UYZB 2JQRB 4LNOA 1C76A 1GAQB 2IYDB 2KT7A 1V5OA 1Q10A 2JWZA 3VHTC 1NENB 1ZGUB 3DBRB 4F8CB 2BVCA 3B2GA 3UIOB 2KXJA 1WGDA 2LEKA 1WYWB 2V3PA 2ICIA 4NNJB 1AYFA 3K9PB 5D2MB 3MP9A 4A3OA 4JQWC 2LUEA 2KMAA 1L4ZB 2L3ZA 4NAWA 1GC6A 1FCCC 2FCSA 3P1MA 4N9F4 4GIVA 3VVWB 1MPEA 2QCZA 4DBGA 1Q5WB 4AS1A 4K7UA 2GBMA 4I6LB 2C9WB 2LXCA 4IG7B 3VAWA 1D3ZA 2J7QB 2A4ZA 4HVBA 4E3CA 3KVFB 3VR9B 4KSLC 4MGYE 2W55A 2N7DA 1KLVA 2DLBA 4FADA 3ZRFA 1ZPSA 5D3DA 3V61A 4X57B 2JT4B 4EZKA 5DPSA 1N63A 4RNAA 5AUIA 3CF6E 3VTVA 1C3TA 1IYFA 3L08A 3ZQ4A 4MT5A 2BKRB 4NAMA 1NVID 3NVYA 3Q8BA 1P7FA 4B0EA 4B9KA 4J6IA 2HD5B 1AN8A 3TMPB 4MDKE 4BKTA 1IUEA 3S2AA 4W9LA 1RRBA 2EKIA 3WAOA 3Q8AA 4A90A 3A4RA 4W9CA 1E7VA 4EZJA 1V9JA 1YD8U 1VR9A 4NZLB 5IA7A 2X8XX 2JWUA 3DOWA 2LHEA 4ZRKA 3EUB2 1OEYJ 4WAAA 5AZFA 2AQ2B 2HTHA 5D3IB 2LGIA 1WGYA 1N6ZA 4IM3A 2MJ3A 4HLEA 1E8WA 3NVWA 2DYBA 3ZXRA 3M3JA 4H2AA 2GOWA 3P42A 3E56A 1LGRA 1P7EA 1WXSA 4AP4C 4KKIA 1FNVA 2M17A 2JF5A 3ONSA 1SEBD 3PLVA 4ANUA 4KKJA 3V6CB 4LNKA 4WJNA 2WXGA 4RM8A 3DHIC 4CYEA 3TBLD 2J42A 3RFZB 1MHXA 3OJ4B 1JWAD 3NVZA 3DHHC 4MSQB 3ZW3A 2BT6A 4CO7A 2L7RA 2V4IB 3L17A 2O2VB 4NJ7A 4FHKA 3UGBB 3M62B 1NBFC 4JPSA 1YN4A 3O13A 5H92C 3W5UB 2WWZA 1FRDA 4HCNB 1UGMA 4FXCA 3N32A 1YQ3B 1QLBB 3RI7C 3NS8A 3URYA 3UQAA 3O65B 4HJGE 3P4PB 2MJDA 4EE2A 3B08A 4FBJB 4ANWA 2W9NA 4WJPA 3Q3FA 3V62A 1UF0A 1C9FA 1P0RA 4LLGM 4YWGG 2D5GA 3GP7A 2PVOD 4OZCA 3AE4B 5FR3A 2K39A 4YTPB 3JSVB 2IO3B 2JYTA 3ZJVA 5TR5A 1Q0WB 4OZAA 3DVGY 4G3XB 3ZRCA 1R4MI 5AZGA 3ZNZB 4WH4A 2L76A 4F1SA 4IW0A 1P98A 3WIMA 3EFUA 3AU5A 3W1SA 4ZOHC 1FCLA 5JZEB 1HE8A 2MBEA 2LGSA 1S3SG 3MC0B 4NPNA 5BYQA 2N1WA 3APCA 4QAYA 1WMHB 3PHXB 3APDA 2DZIA 1ZW7A 3AB5A 1KM7A 2KJRA 2CJOA 3I57A 2W54A 3IFWB 4DHJB 1WJNA 4KGSA 4WWMA 3TCAA 2K8CA 2D3BA 1L0YB 3Q8CA 3FILB 3GOEA 2LRUA 3PS6A 3FAHA 2JVCA 3V6EB 5E6JA 2DHZA 4CHKA 1TTNA 1J0GA 4PS7A 4MGKE 2CKHB 1YQ4B 3AEGB 3P4RB 2DX5B 2MCNB 1JWSD 4XWWA 2PIAA 2LJIA 1A70A 5GMVA 3L13A 3PO0A 1WWTA 3R2IA 2KC1A 4DWFA 5C3JB 1HZ6A 3IT4B 4NQLB 2WXJA 5FR6A 2KQ4X 4RM9A 5L95C 1KH0A 3H9DA 2ZNVC 1D4BA 2JSVX 2KDMA 2VH2A 1UUPA 4IDIA 1V97A 2D3GA 1TS5A 4IWOA 1XXGA 2MBQA 1FPYA 1TKYA 1QT9A 3NG0A 2ZPNA 3PHWB 3RZFA 1WSPA 1FNUA 4MH0E 4FJVB 1CJEA 2Z0DB 1XLPA 4IM0A 2FAZA 4YT0B 4BBNC 2KDBA 2KACA 1BMLC 2R2OA 4ZYSA 2PJHA 2FNJB 3I9V1 4GU2A 1WXMA 2PTLA 4C80A 2RMMA 3RCZA 3ZJUA 1UBIA 5E6NA 1WZ0A 2RDGA 2KO3A 2M4NA 3AXCA 3DVGX 4HKZE 4GOCA 3DPDA 1ZP0B 2MBOA 2DYOA 1IPGA 1M4VA 5E6OA 3BINA 1VZ8A 2BYVE 3W9CB 2KC2A 3QWZB 1XF5L 2KTRB 3BVGA 4ANVA 3PTFC 1WMHA 3MFGA 4C4VA 3IVFA 5LXHA 1F0ZA 2E6XA 2QHOA 2BYTA 3R2TA 3B0AA 1DOYA 4TQ1A 2D2QA 4BKSD 2V9HA 1E5WA 4ITKA 3RNEC 3RN9C 2GBJA 2M0XA 3A1QB 4LNIA 1TKGA 1B9RA 2DYMA 3QA8A 2I38A 3HK0A 4WURA 1AWDA 2M1MA 3VUYA 1SE4A 1Z5SB 4US8A 3NS1A 4BOSC 1FO4A 2WXPA 2ONQA 4JGHB 4LCDE 3NZ3A 3CSFA 4A6QA 3A9KB 3Q3OC 3HVDA 3UQBA 2FE8A 2O6VA 5I4DA 4REZA 4FLHA 1BXTA 3PREA 2MA9B 3CIRB 3MC8A 1FXIA 4C7ZA 4KIKB 2V0GA 5HG2A 3TL5A 4DQOC 1DGJA 2LXAA 2JRIB 2MW5A 3MJWA 3ZUNA 3RT3B 1UNSA 2KWCA 4C56C 4FJYA 1J7AA 4YXDB 3J9CA 3JVZX 2BKFA 4EFOA 2J53A 1TZ1A 3L0WB 1TYGB 2KJ6A 2E3TA 4C7YA 3IT6B 2K25A 1WZ3A 1YMHE 5CX3A 2NBUA 2ZVNA 1K8RB 4DHJD 1MJDA 4TV3A 4II2B 1EO6A 2Z59B 4N58A 2NPTB 1UWXA 2HJ1A 1KJTA 2WXHA 3NUHB 3Q14C 3ZIMA 3TIXA 3B2FA 5DPTA 4HPLB 3P4SB 2L1AA 1C79A 2NS5A 1QILA 2LGYA 3HM6X 4MEMA 1WGGA 3Q6BA 2K8BA 3W2DA 2AX5A 2GI9A 2ZNVB 4JWSC 5GXGB 1I4GA 2IO1B 1UELA 1GJZA 4OZBA 1NI3A 4L23A 2W82A 4BKGA 2BGFA 2KDEB 4LDTD 3BIID 3JW0X 4TKNA 3AN1A 3ETRA 2NBWB 3H7PA 1WY8A 3DHGC 5D6JB 3KWVA 4JIOU 1F77A 2JYEA 2KMCA 4EOYA 2KN5A 1SJHD 3W1SC 3HRDD 2WDRB 3AE8B 3DVNU 4HDQA 2AQ1B 4ZRJA 4TSSA 5EE0A 2M56B 4L2YA 2D3CA 3R66C 4BVUC 2X38A 4UDUC 5C2TB 3VTUA 3EFCA 2WXOA 3RULA 1SIJA 2GBNA 2L8JA 2WXNA 1WGKA 1WYGA 1V86A 2BPSA 3PV1A 4YTMB 2JZPA 1HEZE 2WX0A 4NAWB 3AE9B 3VH3B 4XX5A 2XN9C 2KN4A 3AH7A 3OJ3A 4F7ZA 2CHWA 1E7PB 2KFJA 3ZXVA 4DXFA 2K9XA 1T0RC 4K3BA 2LMCA 4KV2A 3VR8B 2FIFA 1F2RI 5HKHA 3VQIA 2YVCA 3LJ3A 1V80A 1HTQA 4XDCA 4DXGA 3GE8C 1ISNA 2J52A 3KWLA 4EZLA 3W1YA 1RLFA 1VCBA 2K3UA 4S0RA 3RYTA 4RF0A 1E9MA 5FKAC 3BY4B 4TMAB 2MQJA 2WDTB 3ZDTA 3AEFB 3T3NA 3QQ8B 4XYCA 4FULA 3C0RB 4W9HA 3VRBB 2SEBD 4FHJA 2N9PC 4NQKE 4A9AA 3L16A 2NTTA 2EMTA 3PRZA 1CMXB 4NJCA 3BVMA 1UD7A 1SBBB 4Q2JA 3BVZA 2KDIA 5H8YE 3N20C 4BAXA 3AE3B 3RNCC 3N9YC 5HI1A 4ZRIA 2KFKB 1WM3A 3V60A 1WH3A 4M8MA 3PZDA 4XE0A 2HE7A 5AZHA 2DAFA 3P2BA 2KVRA 1YJIA 3CWIA 2MBHA 3KLSX 1V6EA 2PEAA 4PYUA 4KGTA 3QAQA 1RM6C 3FILA 3P4QB 3PPAA 1V8CA 1QOAA 3FKYA 3RNAC 1C4AA 4P1BC 2K0PA 1J7BA 3QARA 4JWUC 1TJEA 3IAM1 3MJ5A 2GBRA 1RWSA 4PS3A 3VUWA 1A5RA 3UINB 3AE2B 3SU8X 2NMQA 2VH1A 1CK1A 2XK5A 2LFIA 1XT9B 1XQQA 2AEHA 1P3QU 2V4LA 2DWQA 5IO9A 5EDSA 2WGSA 2QMTA 2ZZPB 3UIPB 2VRRB 2W3SA 1PDXA 3U4EG 4BOZB 2B76B 1N60A 2N0SB 4RGTA 3BZDB 4IOIE 4A8XC 4LNNA 2JZZA 4ANXA 1V1PB 2MX2A 2TSSA 2WDQB 4WQMA 2GB1A 1N5WA 1TS3A 1I4PA 3BWUD 4ACFA 1OQRA 4XGAB 2J4XA 3DBSA 5IN7A 4K81A 3VRAB 5J18A 3MHZA 3U7DA 4BZAA 5AUKA 2INDC 4G50A 4RH6A 1TGZB 5CHVC 1GB4A 5LXIB 4OVVA 4LJOB 2L52A 5JXVA 3OWEB 1UH6A 2KWUB 4ZRQA 3Q2AC 3DDCB 3KW5B 1PUTA 4K1RB 2SAKA 3GZNB 2NTSA 2LVQA 4I6PA 4RGOS 1FXAA 2XK5B 1PGXA 2EKEC 1LO5D 3ZNGC 1JMLA 2G9HD 5TSSA 4LTUA 3LDZE 2KX0A 1KTKA 1L6UA 2XBBC 1WJ6A 1WM2A 2BB5A 2Y5CA 1GOZA 4PT5A 4WJQA 3V3XA 1I35A 4A55A 2INNE 3WA0A 4MSMB 1YQBA 1V81A 2M0AA 2LI5A 1R7SA 1K50A 1QOBA 1KLGD 1STEA 4B95A 2MWSB 1TIFA 2INCC 1FFUA 3PZ8A 3EGRA 1N5XA 1V1PA 3R7RA 1XO3A 1L0VB 1V5TA 2DENB 3N3KB 3JYUA 2I2YA 2KZRA 1OQQA 4WAFA 4W9FA 2QC8A 1L2NA 4HPPA 4JLCA 1I4QA 1P1AA 4JX1C 1B1ZA 3VXWA 3QX1A 4K7SA 2W3RA 5LNK1 3RUIB 1F1HA 2DAJA 2G1EA 1XEEA 3DBHB 2KNBA 2J0JA 2PKOA 3R3MA 5DCNA 1WX8A 2AL6A 1GPXA 3ABVB 3AM9A 4ICVA 2CS4A 2AQ3B 4DHZB 3W5VB 1IGCA 2BS2B 1KRHA 1OTRB 2EELA 2LWPA 1EU3A 5E6PA 2MSED 1L6VA 2N7JA 4OVUA 2JXXA 4N6EB 4P6VF 2C5LC 2IY1B 2KHWB 4J3OD 5HHDG 3DWMA 2UWQA 2RPVA 3ZNID 5IP4D 4YTNB 4HWIB 3C8YA 3WALA 4R3DA 1U4AA 2Z0EB 4E74A 5DPWA 3QC8B 2LGDA 3WANA 4RGMA 2KAJA 1ZOYB 3LB8C 4IUMB 5BMHA 1E8YA 3KYDD 1GC7A 2ASQA 1LQBA 3RPFC 1S1QB 5G5HA 1Z2MA 2JU6X 1YN3A 1TT5B 3ECIA 3UI3A 4MH8A 2LZ6A 2Y3AA 1PYWD 3JSVA 3LYYA 4MJSB 1AARA 2CHZA 1QOGA 1XLQA 2CHXA 4E71A 2WXKA 3Q3NC 1SE9A 3PVLA 4YL8A 2O6VB 3DBHI 3QJZA 2G4DB 5JH5C 4ZRPA 4HKQA 1E10A 2C7MB 1E0ZA 3HVZA 2G3QB 2MHJA 2OHFA 2IBIB 3A4SC 1FEHA 3KH0A 2QDFA 2CJNA 2JRHA 4W9IA 2BW2A 4W9DA 2BYEA 2LHDA 2KQ7A 1P9DU 4OVZA 3SHQA 4M0WB 2DBYA 1ROEA 2WU5B 2WXFA 1JWUD 3DVNV 1MG4A 2O2VA 3P63A 4RF1A 2H88B 2OJRA 3U2SC 4HPMB 4C4VB 1FNWA 3HM3A 4URKA 1VZ7A 2ZPYA 1ESFA 3KUCB 2RR9A 2ZVOA 4KDLB 1JROA 1MVKA 2GMIC 3KUZA 1R4NB 2J0MA 4HJKA 2AYOB 5C1ZA 2Z8LA 2WXRA 1SGHA 1L7YA 2XNAC 2FIDA 1SXTA 4DK5A 2Y5BB 3PLUA 3VFKA 3PGEA 3GE3C 4WIPA 1PGBA 4B6WA 4YSZB 2ZW1A 5JHAA 1RAXA 3BYYB 4IWQA 2BWFA 3I63C 4LK0M 3U7ZA 2KWDA 5L83A 3K9OB 3TEXA 2IDYA 1ZE3D 4A3PA 3ZDMC 3U30A 2KTFA 1N62A 1Y56A 1K53A 3AE5B 3SDLC 2BQQA 2K1FA 3QIJA 3X0WA 2KQSA 3I5JC 1QOFA 2CU3A 2DZJA 3B1LX 3Q8FA 2L83A 1E90A 2INPE 2FUHB 5EE9A 4LJPB 2BB6A 1T0SC 1C77A 2IJ0A 2LJ5A 3L10B 4JE3B 3KQ4A 4OW0A 4MJSA 2RDHA 1MHHE 3EHVA 2IGDA 2M8SA 1YIWA 2KLCA 4ZDVA 3ZTCA 1DYQA 3RMKC 1Y8RC 2BF8B 3IBEA 1UGJA 4AUQC 3SD5A 2ZJDA 4FJZA 4XWTA 3VUXA 2C7NB 3TEWA 1FRRA 3L4PA 3Q3JA 4BFRA 3ALBA 1K51A 3AE1B 4W9EA 2JZ3B 1D6EC 2ZEQA
chains in the Genus database with same CATH topology
2O6VD 2HE7A 4LDTB 1YX5B 2N1WA 2NR2A 2DAFA 3P2BA 2KVRA 2MBBB 5AZHA 5G55A 5KHQA 4EUTA 3APCA 2KANA 2MBHA 2PE9A 5D94A 3PT2B 1WMHB 3PHXB 2RPQA 3APDA 1V6EA 2DZIA 1ZW7A 2PEAA 2WX1A 4XZ4A 4PYUA 1WI0A 3DQVA 2KFKA 1KM7A 2KJRA 4AOFA 3TJPA 1WX7A 2CU1A 3QAQA 3ZKJC 1WJUA 3IFWB 2I1JA 2KK8A 3PPAA 4GB9A 4DHJB 1WJ4A 1WJNA 5CHWA 1WXAA 2L0TA 1WIAA 1MG8A 4NJ6A 3TCAA 2K8CA 1LM8B 2GBKA 3QARA 4MM3A 3UF8A 2NVUI 3GOEA 1V2YA 4W9KA 2LRUA 2GBRA 4PS3A 3VUWA 1A5RA 3PS6A 4GGQA 3DCGA 4KVGB 3UINB 2I1KA 1XD3B 2JVCA 3KUDB 4KZ0A 3SU8X 3MHSD 1EF5A 2XK5A 3V6EB 2DHZA 1XT9B 2G45B 4CHKA 1TTNA 1XQQA 1P3QU 2AEHA 2V4LA 1J0GA 4MGIE 2DZKA 5EDSA 4PS7A 4MGKE 2CKHB 4M8NA 2ZZPB 3UIPB 2VRRB 2DX5B 2MCNB 3WAMA 4ICUA 5IAAC 3AI5A 2K6DB 4BOZB 3ZO5B 1OEYA 5JHBA 1SIFA 1OGWA 4WJOA 4G0NB 1OQYA 3NZUA 5GMVA 1EUVB 3L13A 2MLBA 2JZZA 3ENEA 3OAWA 4ANXA 4MGZE 2JUOA 2MX2A 3RD2A 2L05A 2IO2B 2HJ8A 1M94A 1WR6E 2NCNA 2KC1A 3IG3A 4P7IA 5CHFA 5AEKB 3H7PB 4HCPB 4DWFA 3AULA 4NQLB 1V49A 2D07B 3N30A 5FR6A 4RM9A 5L95C 3DBSA 2L00B 4K81A 3H9DA 2ZNVC 3ZNHB 5J18A 3T8MA 2KOXA 3U7DA 3X23A 4AJWA 3HIZA 2N1VA 4G50A 5D7GA 2D3GA 1WRDB 1NI2A 2MRPA 4IWOA 5DPRA 4II3B 2MBQA 1TGZB 5CHVC 2ZPNA 3PHWB 3RZFA 2NPTA 4EKUA 5LXIB 4OVVA 4W9JA 2IY0B 2IO0B 3DBRI 4ASWC 3IHPC 1UBQA 4LJOB 4MH0E 4FJVB 4EEWA 5BO4B 1UH6A 3EC8A 2KWUB 1YX6B 2Z0DB 3PSEB 4IM0A 5C23A 2FAZA 4IWPA 4HK2A 3OLMD 4DDGD 4BBNC 4BBNF 3A9JB 2KKCA 3DDCB 1NDDA 3KW5B 2KDBA 1R4NI 4K1RB 2ZCBA 4GMVA 4GXBA 5G2NA 3A9KA 2LVQA 2R2OA 3A33B 4I6PA 4DXAB 4KDIC 2XK5B 2EKEC 2PJHA 1FXTB 1GG3A 3ZNGC 2FNJB 4GSWA 5J17A 1LFDA 3LDZE 4GU2A 2KX0A 1WXMA 3NOBA 3A1QA 3ML9A 3RCZA 2FCMA 3H6NA 2XBBC 1UBIA 5E6NA 3ZTDA 1WJ6A 1BT0A 1RFAA 1WM2A 2DZMA 2V1YA 1WZ0A 2XEWA 4AJYB 2KO3A 4FA6A 2LGXA 3WAPA 1EF1A 1E8XA 4WJQA 2M4NA 3AXCA 1I35A 1F9JA 3NZSA 2J0KA 3WA0A 3DVGX 2JPHA 4MSMB 2BYFA 3H7SA 4GOCA 1YQBA 3DPDA 4XC2A 3VH4B 1KOTA 1V81A 2LI5A 2MBOA 2V3SA 2DYOA 4GN1A 4NY0A 1IPGA 4B95A 3I3TB 5E6OA 4GDKB 5J2RA 2ZCCA 3BINA 2MWSB 2JY6A 2BYVE 3ZLZA 2KC2A 3QWZB 2NBVB 1WE6A 2KX3A 2KTRB 4ANVA 4DHZE 1C1YB 1UZXB 2UYZB 3PTFC 1WMHA 2N7EA 3R7RA 1V5TA 2DENB 3N3KB 3IVFA 3JYUA 5LXHA 2KZRA 1H8CA 2IYDB 2QHOA 1V5OA 2JWZA 1GNUA 4W9FA 1JRUA 3B0AA 3PRPB 3VHTC 1L2NA 1ZGUB 4TQ1A 4F8CB 4JLCA 2D2QA 1P1AA 4BKSD 3UIOB 2KXJA 3VXWA 3QX1A 1WGDA 1E5WA 4DDID 4K7SA 2N9EB 2GBJA 2M0XA 1WYWB 1X1MA 3NHEB 3A1QB 3NY5A 3RUIB 4NNJB 2DAJA 3K9PB 4HXDA 5D2MB 2DYMA 3QA8A 3M95A 2KNBA 3APFA 3HK0A 4A3OA 4TQ0A 2J0JA 3GZNI 2M1MA 2LUEA 2KMAA 3H1UA 4JQWC 2L3ZA 3VUYA 3R3MA 5DCNA 4NAWA 1GC6A 1VD2A 1WX8A 2AL6A 4KZCA 2FCSA 1Z5SB 4N9F4 3VVWB 4GIVA 3A9JA 2N9XA 4DBGA 4BOSC 2LVOA 1Q5WB 4ICVA 4JGHB 2CS4A 4K7UA 2GBMA 4LCDE 3CSFA 4I6LB 2C9WB 2LXCA 3A9KB 4IG7B 3VAWA 2J7QB 4DHZB 3UQBA 1D3ZA 2O6VA 5E6PA 1OTRB 2LWPA 1WR1A 2A4ZA 4HVBA 4E3CA 4WWNA 2MSED 4FLHA 4GDLA 2JXXA 3KVFB 3PREA 4OVUA 4KSLC 2C5LC 2IY1B 2KHWB 2D11A 2MA9B 1IP9A 2UWQA 4MGYE 4KIKB 2KLGA 2EMSA 3T9LA 3TL5A 3ZNID 4IM2A 3DBLI 2N7DA 4HWIB 2RGFA 3AU4A 3WALA 2KJHB 1KLVA 1U4AA 2Z0EB 1E8ZA 4PS8A 2LXAA 4E74A 2JRIB 5DPWA 2C60A 3QC8B 2LGDA 4FADA 3ZRFA 1ZKHA 4ZYNA 3WANA 2MW5A 1G6JA 3V61A 2WYQA 3MJWA 4IUMB 3RT3B 3ZUNA 2KWCA 1E8YA 2JT4B 3KYDD 1GC7A 4PYZA 4X57B 5DPSA 4EZKA 2ASQA 1GUAB 4FJYA 1LQBA 1S1QB 3JVZX 3CF6E 3VTVA 1C3TA 2BKFA 1IYFA 3L08A 1Z2MA 3CMMB 4EFOA 2LASA 3M63B 1TZ1A 4JL9A 3L0WB 3QCAA 4GDKA 2KJ6A 3RZWC 2BKRB 3ECIA 1T0YA 1LXDA 2K25A 2LZ6A 1WZ3A 4RMAA 1WE7A 2AL3A 3JSVA 2NBUA 2ZVNA 2MP2A 5CX3A 1K8RB 4MJSB 1AARA 2CHZA 4DHJD 4B9KA 1WF9A 4J6IA 2CHXA 4TV3A 4E71A 2HD5B 1WXVA 4II2B 1EO6A 2Z59B 3TMPB 4MDKE 1SE9A 2NPTB 3PVLA 4BKTA 4YL8A 2K8HA 2R2QA 4WQOB 2O6VB 3DBHI 3QJZA 2G4DB 5JH5C 3S2AA 1TBEA 4W9LA 1KJTA 3ZIMA 3KYCD 2C7MB 1RRBA 2OOBB 2G3QB 5KHOA 3WAOA 2IBIB 3A4SC 2L0FA 3TIXA 3A4RA 2REXA 4W9CA 5DPTA 3KH0A 1E7VA 2YLMA 4EZJA 4HPLB 1V9JA 4MELA 1YD8U 2KTRA 2NS5A 2LGYA 3HM6X 2JRHA 4MEMA 1WGGA 4W9IA 4TUUA 5IA7A 2K8BA 1WX9A 3DOWA 4ZRKA 4W9DA 1OEYJ 2ZNVB 2BYEA 2KQ7A 2IO1B 4WAAA 5AZFA 1UELA 1P9DU 1WGHA 2HTHA 1GJZA 4GDLB 1WGYA 3SHQA 4BKGA 4IM3A 4M0WB 2BGFA 3MTNB 2KDEB 4LDTD 3JW0X 4TKNA 1Q1OA 4WWOA 2AWTA 3DVNV 4HLEA 3U8ZA 2O2VA 4BKSA 1E8WA 2NBWB 3H7PA 1WY8A 5D6JB 2DYBA 2OJRA 4JIOU 2KMCA 2PE6B 4EOYA 2KN5A 2N4FA 3M3JA 3W1SC 3DVNU 2GOWA 4HDQA 2G4SA 4HPMB 3HM3A 4URKA 2ZPYA 4I6NB 4ZRJA 2KWVB 3KUCB 2RR9A 1WXSA 2ZVOA 4KDLB 2KDFB 4AP4C 2GMIC 3R66C 4BVUC 3KUZA 2M17A 2JF5A 3ML8A 2CR5A 2RD0A 5LLIA 3ONSA 2J0MA 3PLVA 2AYOB 4HJKA 4ANUA 5C1ZA 2BWES 1WFYA 3VTUA 2MP2B 3V6CB 1SGHA 2C7HA 1L7YA 3RULA 2FIDA 4DK5A 2GBNA 2L8JA 2Y5BB 1V86A 2BPSA 3PV1A 3PLUA 4K7WA 4WJNA 2A5UA 4RM8A 3VFKA 3PGEA 4CYEA 3TBLD 2WX0A 4NAWB 3VTWA 3OJ4B 3PRMB 3QHTA 3VH3B 3ZVVA 4XX5A 1I42A 4B6WA 3CSTA 3OJ3A 4F7ZA 2CHWA 5JHAA 1RAXA 4MSQB 3L54A 3ZW3A 2KFJA 4KSKC 1J19A 2L7RA 4CO7A 4FN2A 4IWQA 2BWFA 3L17A 2O2VB 4HDOA 1E7UA 5L83A 3K9OB 4KV2A 4NJ7A 2FIFA 4FHKA 3UGBB 3HHMA 5HKHA 3VQIA 4IC7B 2IZVB 2YVCA 3LJ3A 3M62B 1NBFC 1V80A 2LD9A 4A3PA 3D32A 2WWZA 4HCNB 3ZDMC 1UGMA 2KTFA 4W9GA 3U30A 3N32A 4KIKA 1ISNA 2PPHA 3SDLC 1WGRA 2K1FA 3NS8A 3O65B 3QIJA 3UQAA 2LRWA 3X0WA 2KQSA 4EZLA 3W1YA 3B08A 4FBJB 4ANWA 1RLFA 1VCBA 2DZJA 2W9NA 4WJPA 3R7QA 3Q3FA 2FCNA 2FCQA 3B1LX 3V62A 1E90A 3RYTA 4A20A 4G11A 2FUHB 1P0RA 3BY4B 4LJPB 2B3AA 2MQJA 2LJ5A 3L10B 2WDTB 3ZDTA 2K39A 3QK0A 4MJSA 3QQ8B 3JSVB 3EHVA 4FULA 3EECA 2IO3B 3C0RB 2LVPA 1J8CA 4W9HA 5TR5A 2D10A 1Q0WB 2M8SA 4FHJA 2N9PC 3DVGY 4G3XB 1YIWA 3ZRCA 4NQKE 1R4MI 2KLCA 5AZGA 1PQSA 4ZDVA 3ZTCA 1YJ1A 3ZNZB 1Y8RC 2L76A 3L16A 4F1SA 1H4RA 2BF8B 2EMTA 3PRZA 4IW0A 1P98A 1CMXB 3IBEA 3VDZA 3WIMA 4AUQC 3EFUA 3SD5A 1UD7A 2K6QA 3AU5A 2ZJDA 4AWJA 3W1SA 4FJZA 1QZEA 3VUXA 2KDIA 2C7NB 2RSUA 5JZEB 1HE8A 2MBEA 4WWPA 1S3SG 3Q3JA 4BFRA 3ALBA 4ZRIA 2KFKB 1WM3A 3V60A 1WH3A 5CTRC 4M8MA 3PZDA 4W9EA 2JZ3B 2KD0A 4NPNA 2ZEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V D;  2HE7 A;  4LDT B;  1YX5 B;  2N1W A;  2NR2 A;  2DAF A;  3P2B A;  2KVR A;  2MBB B;  5AZH A;  5G55 A;  5KHQ A;  4EUT A;  3APC A;  2KAN A;  2MBH A;  2PE9 A;  5D94 A;  3PT2 B;  1WMH B;  3PHX B;  2RPQ A;  3APD A;  1V6E A;  2DZI A;  1ZW7 A;  2PEA A;  2WX1 A;  4XZ4 A;  4PYU A;  1WI0 A;  3DQV A;  2KFK A;  1KM7 A;  2KJR A;  4AOF A;  3TJP A;  1WX7 A;  2CU1 A;  3QAQ A;  3ZKJ C;  1WJU A;  3IFW B;  2I1J A;  2KK8 A;  3PPA A;  4GB9 A;  4DHJ B;  1WJ4 A;  1WJN A;  5CHW A;  1WXA A;  2L0T A;  1WIA A;  1MG8 A;  4NJ6 A;  3TCA A;  2K8C A;  1LM8 B;  2GBK A;  3QAR A;  4MM3 A;  3UF8 A;  2NVU I;  3GOE A;  1V2Y A;  4W9K A;  2LRU A;  2GBR A;  4PS3 A;  3VUW A;  1A5R A;  3PS6 A;  4GGQ A;  3DCG A;  4KVG B;  3UIN B;  2I1K A;  1XD3 B;  2JVC A;  3KUD B;  4KZ0 A;  3SU8 X;  3MHS D;  1EF5 A;  2XK5 A;  3V6E B;  2DHZ A;  1XT9 B;  2G45 B;  4CHK A;  1TTN A;  1XQQ A;  1P3Q U;  2AEH A;  2V4L A;  1J0G A;  4MGI E;  2DZK A;  5EDS A;  4PS7 A;  4MGK E;  2CKH B;  4M8N A;  2ZZP B;  3UIP B;  2VRR B;  2DX5 B;  2MCN B;  3WAM A;  4ICU A;  5IAA C;  3AI5 A;  2K6D B;  4BOZ B;  3ZO5 B;  1OEY A;  5JHB A;  1SIF A;  1OGW A;  4WJO A;  4G0N B;  1OQY A;  3NZU A;  5GMV A;  1EUV B;  3L13 A;  2MLB A;  2JZZ A;  3ENE A;  3OAW A;  4ANX A;  4MGZ E;  2JUO A;  2MX2 A;  3RD2 A;  2L05 A;  2IO2 B;  2HJ8 A;  1M94 A;  1WR6 E;  2NCN A;  2KC1 A;  3IG3 A;  4P7I A;  5CHF A;  5AEK B;  3H7P B;  4HCP B;  4DWF A;  3AUL A;  4NQL B;  1V49 A;  2D07 B;  3N30 A;  5FR6 A;  4RM9 A;  5L95 C;  3DBS A;  2L00 B;  4K81 A;  3H9D A;  2ZNV C;  3ZNH B;  5J18 A;  3T8M A;  2KOX A;  3U7D A;  3X23 A;  4AJW A;  3HIZ A;  2N1V A;  4G50 A;  5D7G A;  2D3G A;  1WRD B;  1NI2 A;  2MRP A;  4IWO A;  5DPR A;  4II3 B;  2MBQ A;  1TGZ B;  5CHV C;  2ZPN A;  3PHW B;  3RZF A;  2NPT A;  4EKU A;  5LXI B;  4OVV A;  4W9J A;  2IY0 B;  2IO0 B;  3DBR I;  4ASW C;  3IHP C;  1UBQ A;  4LJO B;  4MH0 E;  4FJV B;  4EEW A;  5BO4 B;  1UH6 A;  3EC8 A;  2KWU B;  1YX6 B;  2Z0D B;  3PSE B;  4IM0 A;  5C23 A;  2FAZ A;  4IWP A;  4HK2 A;  3OLM D;  4DDG D;  4BBN C;  4BBN F;  3A9J B;  2KKC A;  3DDC B;  1NDD A;  3KW5 B;  2KDB A;  1R4N I;  4K1R B;  2ZCB A;  4GMV A;  4GXB A;  5G2N A;  3A9K A;  2LVQ A;  2R2O A;  3A33 B;  4I6P A;  4DXA B;  4KDI C;  2XK5 B;  2EKE C;  2PJH A;  1FXT B;  1GG3 A;  3ZNG C;  2FNJ B;  4GSW A;  5J17 A;  1LFD A;  3LDZ E;  4GU2 A;  2KX0 A;  1WXM A;  3NOB A;  3A1Q A;  3ML9 A;  3RCZ A;  2FCM A;  3H6N A;  2XBB C;  1UBI A;  5E6N A;  3ZTD A;  1WJ6 A;  1BT0 A;  1RFA A;  1WM2 A;  2DZM A;  2V1Y A;  1WZ0 A;  2XEW A;  4AJY B;  2KO3 A;  4FA6 A;  2LGX A;  3WAP A;  1EF1 A;  1E8X A;  4WJQ A;  2M4N A;  3AXC A;  1I35 A;  1F9J A;  3NZS A;  2J0K A;  3WA0 A;  3DVG X;  2JPH A;  4MSM B;  2BYF A;  3H7S A;  4GOC A;  1YQB A;  3DPD A;  4XC2 A;  3VH4 B;  1KOT A;  1V81 A;  2LI5 A;  2MBO A;  2V3S A;  2DYO A;  4GN1 A;  4NY0 A;  1IPG A;  4B95 A;  3I3T B;  5E6O A;  4GDK B;  5J2R A;  2ZCC A;  3BIN A;  2MWS B;  2JY6 A;  2BYV E;  3ZLZ A;  2KC2 A;  3QWZ B;  2NBV B;  1WE6 A;  2KX3 A;  2KTR B;  4ANV A;  4DHZ E;  1C1Y B;  1UZX B;  2UYZ B;  3PTF C;  1WMH A;  2N7E A;  3R7R A;  1V5T A;  2DEN B;  3N3K B;  3IVF A;  3JYU A;  5LXH A;  2KZR A;  1H8C A;  2IYD B;  2QHO A;  1V5O A;  2JWZ A;  1GNU A;  4W9F A;  1JRU A;  3B0A A;  3PRP B;  3VHT C;  1L2N A;  1ZGU B;  4TQ1 A;  4F8C B;  4JLC A;  2D2Q A;  1P1A A;  4BKS D;  3UIO B;  2KXJ A;  3VXW A;  3QX1 A;  1WGD A;  1E5W A;  4DDI D;  4K7S A;  2N9E B;  2GBJ A;  2M0X A;  1WYW B;  1X1M A;  3NHE B;  3A1Q B;  3NY5 A;  3RUI B;  4NNJ B;  2DAJ A;  3K9P B;  4HXD A;  5D2M B;  2DYM A;  3QA8 A;  3M95 A;  2KNB A;  3APF A;  3HK0 A;  4A3O A;  4TQ0 A;  2J0J A;  3GZN I;  2M1M A;  2LUE A;  2KMA A;  3H1U A;  4JQW C;  2L3Z A;  3VUY A;  3R3M A;  5DCN A;  4NAW A;  1GC6 A;  1VD2 A;  1WX8 A;  2AL6 A;  4KZC A;  2FCS A;  1Z5S B;  4N9F 4;  3VVW B;  4GIV A;  3A9J A;  2N9X A;  4DBG A;  4BOS C;  2LVO A;  1Q5W B;  4ICV A;  4JGH B;  2CS4 A;  4K7U A;  2GBM A;  4LCD E;  3CSF A;  4I6L B;  2C9W B;  2LXC A;  3A9K B;  4IG7 B;  3VAW A;  2J7Q B;  4DHZ B;  3UQB A;  1D3Z A;  2O6V A;  5E6P A;  1OTR B;  2LWP A;  1WR1 A;  2A4Z A;  4HVB A;  4E3C A;  4WWN A;  2MSE D;  4FLH A;  4GDL A;  2JXX A;  3KVF B;  3PRE A;  4OVU A;  4KSL C;  2C5L C;  2IY1 B;  2KHW B;  2D11 A;  2MA9 B;  1IP9 A;  2UWQ A;  4MGY E;  4KIK B;  2KLG A;  2EMS A;  3T9L A;  3TL5 A;  3ZNI D;  4IM2 A;  3DBL I;  2N7D A;  4HWI B;  2RGF A;  3AU4 A;  3WAL A;  2KJH B;  1KLV A;  1U4A A;  2Z0E B;  1E8Z A;  4PS8 A;  2LXA A;  4E74 A;  2JRI B;  5DPW A;  2C60 A;  3QC8 B;  2LGD A;  4FAD A;  3ZRF A;  1ZKH A;  4ZYN A;  3WAN A;  2MW5 A;  1G6J A;  3V61 A;  2WYQ A;  3MJW A;  4IUM B;  3RT3 B;  3ZUN A;  2KWC A;  1E8Y A;  2JT4 B;  3KYD D;  1GC7 A;  4PYZ A;  4X57 B;  5DPS A;  4EZK A;  2ASQ A;  1GUA B;  4FJY A;  1LQB A;  1S1Q B;  3JVZ X;  3CF6 E;  3VTV A;  1C3T A;  2BKF A;  1IYF A;  3L08 A;  1Z2M A;  3CMM B;  4EFO A;  2LAS A;  3M63 B;  1TZ1 A;  4JL9 A;  3L0W B;  3QCA A;  4GDK A;  2KJ6 A;  3RZW C;  2BKR B;  3ECI A;  1T0Y A;  1LXD A;  2K25 A;  2LZ6 A;  1WZ3 A;  4RMA A;  1WE7 A;  2AL3 A;  3JSV A;  2NBU A;  2ZVN A;  2MP2 A;  5CX3 A;  1K8R B;  4MJS B;  1AAR A;  2CHZ A;  4DHJ D;  4B9K A;  1WF9 A;  4J6I A;  2CHX A;  4TV3 A;  4E71 A;  2HD5 B;  1WXV A;  4II2 B;  1EO6 A;  2Z59 B;  3TMP B;  4MDK E;  1SE9 A;  2NPT B;  3PVL A;  4BKT A;  4YL8 A;  2K8H A;  2R2Q A;  4WQO B;  2O6V B;  3DBH I;  3QJZ A;  2G4D B;  5JH5 C;  3S2A A;  1TBE A;  4W9L A;  1KJT A;  3ZIM A;  3KYC D;  2C7M B;  1RRB A;  2OOB B;  2G3Q B;  5KHO A;  3WAO A;  2IBI B;  3A4S C;  2L0F A;  3TIX A;  3A4R A;  2REX A;  4W9C A;  5DPT A;  3KH0 A;  1E7V A;  2YLM A;  4EZJ A;  4HPL B;  1V9J A;  4MEL A;  1YD8 U;  2KTR A;  2NS5 A;  2LGY A;  3HM6 X;  2JRH A;  4MEM A;  1WGG A;  4W9I A;  4TUU A;  5IA7 A;  2K8B A;  1WX9 A;  3DOW A;  4ZRK A;  4W9D A;  1OEY J;  2ZNV B;  2BYE A;  2KQ7 A;  2IO1 B;  4WAA A;  5AZF A;  1UEL A;  1P9D U;  1WGH A;  2HTH A;  1GJZ A;  4GDL B;  1WGY A;  3SHQ A;  4BKG A;  4IM3 A;  4M0W B;  2BGF A;  3MTN B;  2KDE B;  4LDT D;  3JW0 X;  4TKN A;  1Q1O A;  4WWO A;  2AWT A;  3DVN V;  4HLE A;  3U8Z A;  2O2V A;  4BKS A;  1E8W A;  2NBW B;  3H7P A;  1WY8 A;  5D6J B;  2DYB A;  2OJR A;  4JIO U;  2KMC A;  2PE6 B;  4EOY A;  2KN5 A;  2N4F A;  3M3J A;  3W1S C;  3DVN U;  2GOW A;  4HDQ A;  2G4S A;  4HPM B;  3HM3 A;  4URK A;  2ZPY A;  4I6N B;  4ZRJ A;  2KWV B;  3KUC B;  2RR9 A;  1WXS A;  2ZVO A;  4KDL B;  2KDF B;  4AP4 C;  2GMI C;  3R66 C;  4BVU C;  3KUZ A;  2M17 A;  2JF5 A;  3ML8 A;  2CR5 A;  2RD0 A;  5LLI A;  3ONS A;  2J0M A;  3PLV A;  2AYO B;  4HJK A;  4ANU A;  5C1Z A;  2BWE S;  1WFY A;  3VTU A;  2MP2 B;  3V6C B;  1SGH A;  2C7H A;  1L7Y A;  3RUL A;  2FID A;  4DK5 A;  2GBN A;  2L8J A;  2Y5B B;  1V86 A;  2BPS A;  3PV1 A;  3PLU A;  4K7W A;  4WJN A;  2A5U A;  4RM8 A;  3VFK A;  3PGE A;  4CYE A;  3TBL D;  2WX0 A;  4NAW B;  3VTW A;  3OJ4 B;  3PRM B;  3QHT A;  3VH3 B;  3ZVV A;  4XX5 A;  1I42 A;  4B6W A;  3CST A;  3OJ3 A;  4F7Z A;  2CHW A;  5JHA A;  1RAX A;  4MSQ B;  3L54 A;  3ZW3 A;  2KFJ A;  4KSK C;  1J19 A;  2L7R A;  4CO7 A;  4FN2 A;  4IWQ A;  2BWF A;  3L17 A;  2O2V B;  4HDO A;  1E7U A;  5L83 A;  3K9O B;  4KV2 A;  4NJ7 A;  2FIF A;  4FHK A;  3UGB B;  3HHM A;  5HKH A;  3VQI A;  4IC7 B;  2IZV B;  2YVC A;  3LJ3 A;  3M62 B;  1NBF C;  1V80 A;  2LD9 A;  4A3P A;  3D32 A;  2WWZ A;  4HCN B;  3ZDM C;  1UGM A;  2KTF A;  4W9G A;  3U30 A;  3N32 A;  4KIK A;  1ISN A;  2PPH A;  3SDL C;  1WGR A;  2K1F A;  3NS8 A;  3O65 B;  3QIJ A;  3UQA A;  2LRW A;  3X0W A;  2KQS A;  4EZL A;  3W1Y A;  3B08 A;  4FBJ B;  4ANW A;  1RLF A;  1VCB A;  2DZJ A;  2W9N A;  4WJP A;  3R7Q A;  3Q3F A;  2FCN A;  2FCQ A;  3B1L X;  3V62 A;  1E90 A;  3RYT A;  4A20 A;  4G11 A;  2FUH B;  1P0R A;  3BY4 B;  4LJP B;  2B3A A;  2MQJ A;  2LJ5 A;  3L10 B;  2WDT B;  3ZDT A;  2K39 A;  3QK0 A;  4MJS A;  3QQ8 B;  3JSV B;  3EHV A;  4FUL A;  3EEC A;  2IO3 B;  3C0R B;  2LVP A;  1J8C A;  4W9H A;  5TR5 A;  2D10 A;  1Q0W B;  2M8S A;  4FHJ A;  2N9P C;  3DVG Y;  4G3X B;  1YIW A;  3ZRC A;  4NQK E;  1R4M I;  2KLC A;  5AZG A;  1PQS A;  4ZDV A;  3ZTC A;  1YJ1 A;  3ZNZ B;  1Y8R C;  2L76 A;  3L16 A;  4F1S A;  1H4R A;  2BF8 B;  2EMT A;  3PRZ A;  4IW0 A;  1P98 A;  1CMX B;  3IBE A;  3VDZ A;  3WIM A;  4AUQ C;  3EFU A;  3SD5 A;  1UD7 A;  2K6Q A;  3AU5 A;  2ZJD A;  4AWJ A;  3W1S A;  4FJZ A;  1QZE A;  3VUX A;  2KDI A;  2C7N B;  2RSU A;  5JZE B;  1HE8 A;  2MBE A;  4WWP A;  1S3S G;  3Q3J A;  4BFR A;  3ALB A;  4ZRI A;  2KFK B;  1WM3 A;  3V60 A;  1WH3 A;  5CTR C;  4M8M A;  3PZD A;  4W9E A;  2JZ3 B;  2KD0 A;  4NPN A;  2ZEQ A; 
#chains in the Genus database with same CATH topology
 2O6V D;  4LDT B;  1YX5 B;  2ZW0 A;  2NR2 A;  4EUT A;  2K5P A;  1F2R C;  2PE9 A;  5D94 A;  1XLO A;  2WX1 A;  4XZ4 A;  4AOF A;  1T5X D;  1WX7 A;  1NYQ A;  3ZKJ C;  2I1J A;  4GB9 A;  1WXA A;  2L0T A;  1WIA A;  1MG8 A;  4NJ6 A;  1LM8 B;  2GBK A;  4MM3 A;  2PLP A;  1V2Y A;  3DCG A;  4KVG B;  1XD3 B;  3KUD B;  2QSD A;  3MHS D;  1EF5 A;  3C19 A;  2Q5W D;  1VLB A;  1F52 A;  2G45 B;  4OHJ A;  1PGA A;  2DZK A;  2BTE A;  4M8N A;  1GB1 A;  1EWY C;  2OED A;  1ZDX A;  3WAM A;  2K6D B;  4PK1 A;  1I7H A;  5JHB A;  1OEY A;  4HRO A;  1CZP A;  1SIF A;  4WJO A;  1C4P A;  2JX5 A;  3NZU A;  1VZ6 A;  1EUV B;  3AEE B;  3ENE A;  3OAW A;  3N1Z C;  4MGZ E;  4L1B A;  3RD2 A;  1L4D B;  1CQV A;  2IO2 B;  2HJ8 A;  4M02 A;  1M94 A;  1IBX B;  1L5P A;  3IG3 A;  5CHF A;  1T0Q C;  2PMV A;  1T6B X;  2D07 B;  3N30 A;  1TY0 A;  2WLB A;  3Q3M C;  2KOX A;  3B9J A;  2N1V A;  5T8I A;  4XDD A;  2MRP A;  2V3N A;  4II3 B;  2D3A A;  2YEP B;  4EKU A;  3SFD B;  3ZGZ A;  1I4X A;  3DBR I;  3IHP C;  1JCK B;  1YX6 B;  4AQ7 A;  5C23 A;  4HK2 A;  4KX6 B;  4BBN F;  3A9J B;  3RNB C;  1NDD A;  2MH7 A;  1R4N I;  1HXY D;  2ZCB A;  4GXB A;  5G2N A;  4DXA B;  4KDI C;  1JAL A;  3BK2 A;  2ACZ B;  1FXT B;  1GG3 A;  1HA5 A;  5J17 A;  2QJL A;  1HQR D;  2WXM A;  3A1Q A;  3BYT B;  2FCM A;  1BT0 A;  1UWM A;  1FM0 D;  2QEJ C;  2V1Y A;  2XEW A;  1ET6 A;  1ZUD 2;  4FA6 A;  1EF1 A;  4S17 A;  1ET9 A;  2N9L A;  3NZS A;  1T3Q A;  1YOV B;  2J0K A;  3VH4 B;  1KOT A;  1KLU D;  3FC4 A;  2V3S A;  4NY0 A;  1YN5 A;  2ZCC A;  1SSN A;  2JY6 A;  3SEB A;  2NBV B;  2KX3 A;  1UZX B;  2N7E A;  2KVZ A;  1N61 A;  4HRS A;  1WXQ A;  2R61 A;  1H8C A;  2PW9 A;  1GNU A;  1JRU A;  3PRP B;  3OG5 A;  1JWM D;  2DNF A;  1R4M B;  4DDI D;  4IKG A;  2N9E B;  3NHE B;  1X1M A;  1YJJ A;  3NY5 A;  3RNG C;  4HXD A;  3M95 A;  3APF A;  4TQ0 A;  3GZN I;  3H1U A;  4M00 A;  1VD2 A;  1RFK A;  1I4R A;  4KZC A;  1HTO A;  1QF6 A;  2WS3 B;  3A9J A;  2N9X A;  2LVO A;  1VRA B;  3SR6 A;  3AEB B;  1SJE D;  1WR1 A;  1TY2 A;  4WWN A;  4GDL A;  2VZK D;  4YSX B;  1ENF A;  1PFD A;  2D11 A;  1IP9 A;  4MM3 B;  2FBW B;  2KLG A;  2EMS A;  3T9L A;  4IM2 A;  3DBL I;  2WNM A;  3ZYY X;  2RGF A;  1D5Z C;  2H89 B;  1XCT L;  3AU4 A;  1D5X C;  2KJH B;  1C78 A;  1E8Z A;  4PS8 A;  3Q8E A;  2C60 A;  1ZKH A;  4ZYN A;  1G6J A;  2WYQ A;  1ACC A;  4PYZ A;  3HUI A;  1GUA B;  1TZO A;  3CMM B;  2LAS A;  3M63 B;  4JL9 A;  4GDK A;  3QCA A;  2MEK A;  1SE2 A;  3RZW C;  1T0Y A;  1LXD A;  4RMA A;  1WE7 A;  1XCQ L;  2AL3 A;  1VJK A;  2MP2 A;  3T3O A;  1WF9 A;  4K3C A;  3TSS A;  1WXV A;  3AE7 B;  5EE3 A;  2K8H A;  2R2Q A;  4WQO B;  3AE6 B;  1TBE A;  1TKE A;  3GB1 A;  2VZK B;  3KYC D;  2OOB B;  2WQY B;  3DWG C;  5KHO A;  2L0F A;  2REX A;  2YLM A;  4MEL A;  1YNT E;  2KTR A;  1XLN A;  4TUU A;  2FUG 1;  1WX9 A;  2WDV B;  2BS3 B;  1L0X B;  1WGH A;  4GDL B;  1NEK B;  3MTN B;  1Q1O A;  1SE3 A;  2AWT A;  4WWO A;  3U8Z A;  4BKS A;  2PE6 B;  3N1X C;  2N4F A;  2G4S A;  3TUO A;  1OFF A;  4I6N B;  2KWV B;  4LNF A;  2KDF B;  1JW9 D;  1SF0 A;  3ML8 A;  2CR5 A;  2RD0 A;  5LLI A;  2L32 A;  2BWE S;  1WFY A;  2MP2 B;  2C7H A;  4US9 A;  2RDB C;  1EWC A;  4K7W A;  2A5U A;  4N59 A;  2WHI A;  4ZHP A;  3VTW A;  3PRM B;  3QHT A;  3ZVV A;  1I42 A;  3CST A;  3L54 A;  4KSK C;  3V05 A;  1J19 A;  4FN2 A;  1VDV A;  2GLS A;  4HDO A;  1E7U A;  4ARI A;  3HHM A;  2WU2 B;  2Y5P A;  4IC7 B;  2IZV B;  2KMM A;  3GS2 A;  2N9K A;  2LD9 A;  3D32 A;  4W9G A;  4KIK A;  4ZHO A;  2PPH A;  1FIQ A;  3N1Y C;  1WGR A;  3AMZ A;  1J7C A;  2LRW A;  1EM7 A;  1DOX A;  3NJT A;  3R7Q A;  2FCN A;  2FCQ A;  4A20 A;  4G11 A;  2B3A A;  4MAC A;  1FD6 A;  3AV8 A;  3QK0 A;  3NRZ A;  1TS4 A;  3EEC A;  1BUI C;  2LVP A;  1J8C A;  2D10 A;  1JQ4 A;  2IGH A;  1PQS A;  5IOI A;  1YJ1 A;  1DOI A;  5BMI A;  1JRP A;  1H4R A;  3VDZ A;  1C4C A;  3PZ7 A;  2UU7 A;  4B0M A;  2K6Q A;  4AWJ A;  1QZE A;  5G5G A;  2RSU A;  2K22 A;  2YEP F;  4WWP A;  3ZJT A;  1KFY B;  4RCO A;  5CTR C;  1ZXI A;  2KD0 A;  3LXF A;  1QKZ A;  5G55 A;  1ZDV A;  5KHQ A;  2MBB B;  4CQN A;  2KAN A;  3E9S A;  5BYR A;  5MPO A;  3PT2 B;  2RPQ A;  2IPK D;  1WI0 A;  3DQV A;  3DBL B;  2KFK A;  2QIE B;  3TJP A;  4P1C C;  2CU1 A;  1JWB D;  1WJU A;  3H8H A;  2KK8 A;  1WJ4 A;  1IGD A;  1FMA D;  5CHW A;  1FFV A;  1HZ5 A;  4P16 A;  3UF8 A;  2NVU I;  2MJE A;  2IGG A;  4W9K A;  4RGN A;  4M01 A;  2WP9 B;  4GGQ A;  2I1K A;  4KZ0 A;  3MC9 A;  5EE1 A;  1MFW A;  4MGI E;  4YSY B;  4ICU A;  5IAA C;  1SB3 C;  3AI5 A;  1AW7 A;  4KGR A;  3ZO5 B;  2BS4 B;  1OGW A;  4G0N B;  1OQY A;  1K52 A;  3IXS A;  1D5M C;  1MI0 A;  2WXQ A;  1I4H A;  2MLB A;  4GLS C;  2JUO A;  4M0W A;  2L05 A;  4HEA 1;  4O1N A;  3RNF C;  1WR6 E;  2NCN A;  4P7I A;  5AEK B;  3H7P B;  4HCP B;  1ZXH A;  3AUL A;  1V49 A;  1KF6 B;  2L00 B;  3ZNH B;  2GRI A;  3T8M A;  3R8B A;  3X23 A;  4AJW A;  3HIZ A;  5D7G A;  1WRD B;  1NI2 A;  2PVG C;  5DPR A;  2M19 A;  3AEA B;  2NPT A;  5FK9 C;  4W9J A;  3BK1 A;  2IY0 B;  2IO0 B;  4ASW C;  1UBQ A;  3AED B;  4ARC A;  3EA6 A;  4EEW A;  4RFB A;  5BO4 B;  3EC8 A;  2LUM A;  3PSE B;  2HDE A;  4IWP A;  3WCQ A;  3OLM D;  4DDG D;  2KKC A;  3SFE B;  3TEY A;  5HFY A;  4GMV A;  3A9K A;  3A33 B;  5BMG A;  1V1O A;  3TEZ A;  5IKC M;  1RYJ A;  1IBX A;  4GSW A;  3U52 E;  1LFD A;  3NVV A;  3IAS 1;  2WXI A;  3NOB A;  3ML9 A;  4D2K A;  1WRI A;  3H6N A;  1NYR A;  5BYS A;  3AEC B;  3ZTD A;  2DZM A;  1RFA A;  4C00 A;  1E6E B;  1EU4 A;  4AJY B;  2HTM E;  2LGX A;  2OJW A;  1E8X A;  3WAP A;  1F9J A;  4USA A;  1QQR A;  2JPH A;  2ON8 A;  2BYF A;  3H7S A;  4XC2 A;  2WXL A;  3Q69 A;  4GN1 A;  3I3T B;  2BBC A;  4GDK B;  5J2R A;  1TS2 A;  3ZLZ A;  2JXT A;  2KYW A;  1WE6 A;  2QIL A;  4DHZ E;  1C1Y B;  2UYZ B;  2JQR B;  4LNO A;  1C76 A;  1GAQ B;  2IYD B;  2KT7 A;  1V5O A;  1Q10 A;  2JWZ A;  3VHT C;  1NEN B;  1ZGU B;  3DBR B;  4F8C B;  2BVC A;  3B2G A;  3UIO B;  2KXJ A;  1WGD A;  2LEK A;  1WYW B;  2V3P A;  2ICI A;  4NNJ B;  1AYF A;  3K9P B;  5D2M B;  3MP9 A;  4A3O A;  4JQW C;  2LUE A;  2KMA A;  1L4Z B;  2L3Z A;  4NAW A;  1GC6 A;  1FCC C;  2FCS A;  3P1M A;  4N9F 4;  4GIV A;  3VVW B;  1MPE A;  2QCZ A;  4DBG A;  1Q5W B;  4AS1 A;  4K7U A;  2GBM A;  4I6L B;  2C9W B;  2LXC A;  4IG7 B;  3VAW A;  1D3Z A;  2J7Q B;  2A4Z A;  4HVB A;  4E3C A;  3KVF B;  3VR9 B;  4KSL C;  4MGY E;  2W55 A;  2N7D A;  1KLV A;  2DLB A;  4FAD A;  3ZRF A;  1ZPS A;  5D3D A;  3V61 A;  4X57 B;  2JT4 B;  4EZK A;  5DPS A;  1N63 A;  4RNA A;  5AUI A;  3CF6 E;  3VTV A;  1C3T A;  1IYF A;  3L08 A;  3ZQ4 A;  4MT5 A;  2BKR B;  4NAM A;  1NVI D;  3NVY A;  3Q8B A;  1P7F A;  4B0E A;  4B9K A;  4J6I A;  2HD5 B;  1AN8 A;  3TMP B;  4MDK E;  4BKT A;  1IUE A;  3S2A A;  4W9L A;  1RRB A;  2EKI A;  3WAO A;  3Q8A A;  4A90 A;  3A4R A;  4W9C A;  1E7V A;  4EZJ A;  1V9J A;  1YD8 U;  1VR9 A;  4NZL B;  5IA7 A;  2X8X X;  2JWU A;  3DOW A;  2LHE A;  4ZRK A;  3EUB 2;  1OEY J;  4WAA A;  5AZF A;  2AQ2 B;  2HTH A;  5D3I B;  2LGI A;  1WGY A;  1N6Z A;  4IM3 A;  2MJ3 A;  4HLE A;  1E8W A;  3NVW A;  2DYB A;  3ZXR A;  3M3J A;  4H2A A;  2GOW A;  3P42 A;  3E56 A;  1LGR A;  1P7E A;  1WXS A;  4AP4 C;  4KKI A;  1FNV A;  2M17 A;  2JF5 A;  3ONS A;  1SEB D;  3PLV A;  4ANU A;  4KKJ A;  3V6C B;  4LNK A;  4WJN A;  2WXG A;  4RM8 A;  3DHI C;  4CYE A;  3TBL D;  2J42 A;  3RFZ B;  1MHX A;  3OJ4 B;  1JWA D;  3NVZ A;  3DHH C;  4MSQ B;  3ZW3 A;  2BT6 A;  4CO7 A;  2L7R A;  2V4I B;  3L17 A;  2O2V B;  4NJ7 A;  4FHK A;  3UGB B;  3M62 B;  1NBF C;  4JPS A;  1YN4 A;  3O13 A;  5H92 C;  3W5U B;  2WWZ A;  1FRD A;  4HCN B;  1UGM A;  4FXC A;  3N32 A;  1YQ3 B;  1QLB B;  3RI7 C;  3NS8 A;  3URY A;  3UQA A;  3O65 B;  4HJG E;  3P4P B;  2MJD A;  4EE2 A;  3B08 A;  4FBJ B;  4ANW A;  2W9N A;  4WJP A;  3Q3F A;  3V62 A;  1UF0 A;  1C9F A;  1P0R A;  4LLG M;  4YWG G;  2D5G A;  3GP7 A;  2PVO D;  4OZC A;  3AE4 B;  5FR3 A;  2K39 A;  4YTP B;  3JSV B;  2IO3 B;  2JYT A;  3ZJV A;  5TR5 A;  1Q0W B;  4OZA A;  3DVG Y;  4G3X B;  3ZRC A;  1R4M I;  5AZG A;  3ZNZ B;  4WH4 A;  2L76 A;  4F1S A;  4IW0 A;  1P98 A;  3WIM A;  3EFU A;  3AU5 A;  3W1S A;  4ZOH C;  1FCL A;  5JZE B;  1HE8 A;  2MBE A;  2LGS A;  1S3S G;  3MC0 B;  4NPN A;  5BYQ A;  2N1W A;  3APC A;  4QAY A;  1WMH B;  3PHX B;  3APD A;  2DZI A;  1ZW7 A;  3AB5 A;  1KM7 A;  2KJR A;  2CJO A;  3I57 A;  2W54 A;  3IFW B;  4DHJ B;  1WJN A;  4KGS A;  4WWM A;  3TCA A;  2K8C A;  2D3B A;  1L0Y B;  3Q8C A;  3FIL B;  3GOE A;  2LRU A;  3PS6 A;  3FAH A;  2JVC A;  3V6E B;  5E6J A;  2DHZ A;  4CHK A;  1TTN A;  1J0G A;  4PS7 A;  4MGK E;  2CKH B;  1YQ4 B;  3AEG B;  3P4R B;  2DX5 B;  2MCN B;  1JWS D;  4XWW A;  2PIA A;  2LJI A;  1A70 A;  5GMV A;  3L13 A;  3PO0 A;  1WWT A;  3R2I A;  2KC1 A;  4DWF A;  5C3J B;  1HZ6 A;  3IT4 B;  4NQL B;  2WXJ A;  5FR6 A;  2KQ4 X;  4RM9 A;  5L95 C;  1KH0 A;  3H9D A;  2ZNV C;  1D4B A;  2JSV X;  2KDM A;  2VH2 A;  1UUP A;  4IDI A;  1V97 A;  2D3G A;  1TS5 A;  4IWO A;  1XXG A;  2MBQ A;  1FPY A;  1TKY A;  1QT9 A;  3NG0 A;  2ZPN A;  3PHW B;  3RZF A;  1WSP A;  1FNU A;  4MH0 E;  4FJV B;  1CJE A;  2Z0D B;  1XLP A;  4IM0 A;  2FAZ A;  4YT0 B;  4BBN C;  2KDB A;  2KAC A;  1BML C;  2R2O A;  4ZYS A;  2PJH A;  2FNJ B;  3I9V 1;  4GU2 A;  1WXM A;  2PTL A;  4C80 A;  2RMM A;  3RCZ A;  3ZJU A;  1UBI A;  5E6N A;  1WZ0 A;  2RDG A;  2KO3 A;  2M4N A;  3AXC A;  3DVG X;  4HKZ E;  4GOC A;  3DPD A;  1ZP0 B;  2MBO A;  2DYO A;  1IPG A;  1M4V A;  5E6O A;  3BIN A;  1VZ8 A;  2BYV E;  3W9C B;  2KC2 A;  3QWZ B;  1XF5 L;  2KTR B;  3BVG A;  4ANV A;  3PTF C;  1WMH A;  3MFG A;  4C4V A;  3IVF A;  5LXH A;  1F0Z A;  2E6X A;  2QHO A;  2BYT A;  3R2T A;  3B0A A;  1DOY A;  4TQ1 A;  2D2Q A;  4BKS D;  2V9H A;  1E5W A;  4ITK A;  3RNE C;  3RN9 C;  2GBJ A;  2M0X A;  3A1Q B;  4LNI A;  1TKG A;  1B9R A;  2DYM A;  3QA8 A;  2I38 A;  3HK0 A;  4WUR A;  1AWD A;  2M1M A;  3VUY A;  1SE4 A;  1Z5S B;  4US8 A;  3NS1 A;  4BOS C;  1FO4 A;  2WXP A;  2ONQ A;  4JGH B;  4LCD E;  3NZ3 A;  3CSF A;  4A6Q A;  3A9K B;  3Q3O C;  3HVD A;  3UQB A;  2FE8 A;  2O6V A;  5I4D A;  4REZ A;  4FLH A;  1BXT A;  3PRE A;  2MA9 B;  3CIR B;  3MC8 A;  1FXI A;  4C7Z A;  4KIK B;  2V0G A;  5HG2 A;  3TL5 A;  4DQO C;  1DGJ A;  2LXA A;  2JRI B;  2MW5 A;  3MJW A;  3ZUN A;  3RT3 B;  1UNS A;  2KWC A;  4C56 C;  4FJY A;  1J7A A;  4YXD B;  3J9C A;  3JVZ X;  2BKF A;  4EFO A;  2J53 A;  1TZ1 A;  3L0W B;  1TYG B;  2KJ6 A;  2E3T A;  4C7Y A;  3IT6 B;  2K25 A;  1WZ3 A;  1YMH E;  5CX3 A;  2NBU A;  2ZVN A;  1K8R B;  4DHJ D;  1MJD A;  4TV3 A;  4II2 B;  1EO6 A;  2Z59 B;  4N58 A;  2NPT B;  1UWX A;  2HJ1 A;  1KJT A;  2WXH A;  3NUH B;  3Q14 C;  3ZIM A;  3TIX A;  3B2F A;  5DPT A;  4HPL B;  3P4S B;  2L1A A;  1C79 A;  2NS5 A;  1QIL A;  2LGY A;  3HM6 X;  4MEM A;  1WGG A;  3Q6B A;  2K8B A;  3W2D A;  2AX5 A;  2GI9 A;  2ZNV B;  4JWS C;  5GXG B;  1I4G A;  2IO1 B;  1UEL A;  1GJZ A;  4OZB A;  1NI3 A;  4L23 A;  2W82 A;  4BKG A;  2BGF A;  2KDE B;  4LDT D;  3BII D;  3JW0 X;  4TKN A;  3AN1 A;  3ETR A;  2NBW B;  3H7P A;  1WY8 A;  3DHG C;  5D6J B;  3KWV A;  4JIO U;  1F77 A;  2JYE A;  2KMC A;  4EOY A;  2KN5 A;  1SJH D;  3W1S C;  3HRD D;  2WDR B;  3AE8 B;  3DVN U;  4HDQ A;  2AQ1 B;  4ZRJ A;  4TSS A;  5EE0 A;  2M56 B;  4L2Y A;  2D3C A;  3R66 C;  4BVU C;  2X38 A;  4UDU C;  5C2T B;  3VTU A;  3EFC A;  2WXO A;  3RUL A;  1SIJ A;  2GBN A;  2L8J A;  2WXN A;  1WGK A;  1WYG A;  1V86 A;  2BPS A;  3PV1 A;  4YTM B;  2JZP A;  1HEZ E;  2WX0 A;  4NAW B;  3AE9 B;  3VH3 B;  4XX5 A;  2XN9 C;  2KN4 A;  3AH7 A;  3OJ3 A;  4F7Z A;  2CHW A;  1E7P B;  2KFJ A;  3ZXV A;  4DXF A;  2K9X A;  1T0R C;  4K3B A;  2LMC A;  4KV2 A;  3VR8 B;  2FIF A;  1F2R I;  5HKH A;  3VQI A;  2YVC A;  3LJ3 A;  1V80 A;  1HTQ A;  4XDC A;  4DXG A;  3GE8 C;  1ISN A;  2J52 A;  3KWL A;  4EZL A;  3W1Y A;  1RLF A;  1VCB A;  2K3U A;  4S0R A;  3RYT A;  4RF0 A;  1E9M A;  5FKA C;  3BY4 B;  4TMA B;  2MQJ A;  2WDT B;  3ZDT A;  3AEF B;  3T3N A;  3QQ8 B;  4XYC A;  4FUL A;  3C0R B;  4W9H A;  3VRB B;  2SEB D;  4FHJ A;  2N9P C;  4NQK E;  4A9A A;  3L16 A;  2NTT A;  2EMT A;  3PRZ A;  1CMX B;  4NJC A;  3BVM A;  1UD7 A;  1SBB B;  4Q2J A;  3BVZ A;  2KDI A;  5H8Y E;  3N20 C;  4BAX A;  3AE3 B;  3RNC C;  3N9Y C;  5HI1 A;  4ZRI A;  2KFK B;  1WM3 A;  3V60 A;  1WH3 A;  4M8M A;  3PZD A;  4XE0 A;  2HE7 A;  5AZH A;  2DAF A;  3P2B A;  2KVR A;  1YJI A;  3CWI A;  2MBH A;  3KLS X;  1V6E A;  2PEA A;  4PYU A;  4KGT A;  3QAQ A;  1RM6 C;  3FIL A;  3P4Q B;  3PPA A;  1V8C A;  1QOA A;  3FKY A;  3RNA C;  1C4A A;  4P1B C;  2K0P A;  1J7B A;  3QAR A;  4JWU C;  1TJE A;  3IAM 1;  3MJ5 A;  2GBR A;  1RWS A;  4PS3 A;  3VUW A;  1A5R A;  3UIN B;  3AE2 B;  3SU8 X;  2NMQ A;  2VH1 A;  1CK1 A;  2XK5 A;  2LFI A;  1XT9 B;  1XQQ A;  2AEH A;  1P3Q U;  2V4L A;  2DWQ A;  5IO9 A;  5EDS A;  2WGS A;  2QMT A;  2ZZP B;  3UIP B;  2VRR B;  2W3S A;  1PDX A;  3U4E G;  4BOZ B;  2B76 B;  1N60 A;  2N0S B;  4RGT A;  3BZD B;  4IOI E;  4A8X C;  4LNN A;  2JZZ A;  4ANX A;  1V1P B;  2MX2 A;  2TSS A;  2WDQ B;  4WQM A;  2GB1 A;  1N5W A;  1TS3 A;  1I4P A;  3BWU D;  4ACF A;  1OQR A;  4XGA B;  2J4X A;  3DBS A;  5IN7 A;  4K81 A;  3VRA B;  5J18 A;  3MHZ A;  3U7D A;  4BZA A;  5AUK A;  2IND C;  4G50 A;  4RH6 A;  1TGZ B;  5CHV C;  1GB4 A;  5LXI B;  4OVV A;  4LJO B;  2L52 A;  5JXV A;  3OWE B;  1UH6 A;  2KWU B;  4ZRQ A;  3Q2A C;  3DDC B;  3KW5 B;  1PUT A;  4K1R B;  2SAK A;  3GZN B;  2NTS A;  2LVQ A;  4I6P A;  4RGO S;  1FXA A;  2XK5 B;  1PGX A;  2EKE C;  1LO5 D;  3ZNG C;  1JML A;  2G9H D;  5TSS A;  4LTU A;  3LDZ E;  2KX0 A;  1KTK A;  1L6U A;  2XBB C;  1WJ6 A;  1WM2 A;  2BB5 A;  2Y5C A;  1GOZ A;  4PT5 A;  4WJQ A;  3V3X A;  1I35 A;  4A55 A;  2INN E;  3WA0 A;  4MSM B;  1YQB A;  1V81 A;  2M0A A;  2LI5 A;  1R7S A;  1K50 A;  1QOB A;  1KLG D;  1STE A;  4B95 A;  2MWS B;  1TIF A;  2INC C;  1FFU A;  3PZ8 A;  3EGR A;  1N5X A;  1V1P A;  3R7R A;  1XO3 A;  1L0V B;  1V5T A;  2DEN B;  3N3K B;  3JYU A;  2I2Y A;  2KZR A;  1OQQ A;  4WAF A;  4W9F A;  2QC8 A;  1L2N A;  4HPP A;  4JLC A;  1I4Q A;  1P1A A;  4JX1 C;  1B1Z A;  3VXW A;  3QX1 A;  4K7S A;  2W3R A;  5LNK 1;  3RUI B;  1F1H A;  2DAJ A;  2G1E A;  1XEE A;  3DBH B;  2KNB A;  2J0J A;  2PKO A;  3R3M A;  5DCN A;  1WX8 A;  2AL6 A;  1GPX A;  3ABV B;  3AM9 A;  4ICV A;  2CS4 A;  2AQ3 B;  4DHZ B;  3W5V B;  1IGC A;  2BS2 B;  1KRH A;  1OTR B;  2EEL A;  2LWP A;  1EU3 A;  5E6P A;  2MSE D;  1L6V A;  2N7J A;  4OVU A;  2JXX A;  4N6E B;  4P6V F;  2C5L C;  2IY1 B;  2KHW B;  4J3O D;  5HHD G;  3DWM A;  2UWQ A;  2RPV A;  3ZNI D;  5IP4 D;  4YTN B;  4HWI B;  3C8Y A;  3WAL A;  4R3D A;  1U4A A;  2Z0E B;  4E74 A;  5DPW A;  3QC8 B;  2LGD A;  3WAN A;  4RGM A;  2KAJ A;  1ZOY B;  3LB8 C;  4IUM B;  5BMH A;  1E8Y A;  3KYD D;  1GC7 A;  2ASQ A;  1LQB A;  3RPF C;  1S1Q B;  5G5H A;  1Z2M A;  2JU6 X;  1YN3 A;  1TT5 B;  3ECI A;  3UI3 A;  4MH8 A;  2LZ6 A;  2Y3A A;  1PYW D;  3JSV A;  3LYY A;  4MJS B;  1AAR A;  2CHZ A;  1QOG A;  1XLQ A;  2CHX A;  4E71 A;  2WXK A;  3Q3N C;  1SE9 A;  3PVL A;  4YL8 A;  2O6V B;  3DBH I;  3QJZ A;  2G4D B;  5JH5 C;  4ZRP A;  4HKQ A;  1E10 A;  2C7M B;  1E0Z A;  3HVZ A;  2G3Q B;  2MHJ A;  2OHF A;  2IBI B;  3A4S C;  1FEH A;  3KH0 A;  2QDF A;  2CJN A;  2JRH A;  4W9I A;  2BW2 A;  4W9D A;  2BYE A;  2LHD A;  2KQ7 A;  1P9D U;  4OVZ A;  3SHQ A;  4M0W B;  2DBY A;  1ROE A;  2WU5 B;  2WXF A;  1JWU D;  3DVN V;  1MG4 A;  2O2V A;  3P63 A;  4RF1 A;  2H88 B;  2OJR A;  3U2S C;  4HPM B;  4C4V B;  1FNW A;  3HM3 A;  4URK A;  1VZ7 A;  2ZPY A;  1ESF A;  3KUC B;  2RR9 A;  2ZVO A;  4KDL B;  1JRO A;  1MVK A;  2GMI C;  3KUZ A;  1R4N B;  2J0M A;  4HJK A;  2AYO B;  5C1Z A;  2Z8L A;  2WXR A;  1SGH A;  1L7Y A;  2XNA C;  2FID A;  1SXT A;  4DK5 A;  2Y5B B;  3PLU A;  3VFK A;  3PGE A;  3GE3 C;  4WIP A;  1PGB A;  4B6W A;  4YSZ B;  2ZW1 A;  5JHA A;  1RAX A;  3BYY B;  4IWQ A;  2BWF A;  3I63 C;  4LK0 M;  3U7Z A;  2KWD A;  5L83 A;  3K9O B;  3TEX A;  2IDY A;  1ZE3 D;  4A3P A;  3ZDM C;  3U30 A;  2KTF A;  1N62 A;  1Y56 A;  1K53 A;  3AE5 B;  3SDL C;  2BQQ A;  2K1F A;  3QIJ A;  3X0W A;  2KQS A;  3I5J C;  1QOF A;  2CU3 A;  2DZJ A;  3B1L X;  3Q8F A;  2L83 A;  1E90 A;  2INP E;  2FUH B;  5EE9 A;  4LJP B;  2BB6 A;  1T0S C;  1C77 A;  2IJ0 A;  2LJ5 A;  3L10 B;  4JE3 B;  3KQ4 A;  4OW0 A;  4MJS A;  2RDH A;  1MHH E;  3EHV A;  2IGD A;  2M8S A;  1YIW A;  2KLC A;  4ZDV A;  3ZTC A;  1DYQ A;  3RMK C;  1Y8R C;  2BF8 B;  3IBE A;  1UGJ A;  4AUQ C;  3SD5 A;  2ZJD A;  4FJZ A;  4XWT A;  3VUX A;  2C7N B;  3TEW A;  1FRR A;  3L4P A;  3Q3J A;  4BFR A;  3ALB A;  1K51 A;  3AE1 B;  4W9E A;  2JZ3 B;  1D6E C;  2ZEQ A; 
#chains in the Genus database with same CATH homology
 2O6V D;  2HE7 A;  4LDT B;  1YX5 B;  2N1W A;  2NR2 A;  2DAF A;  3P2B A;  2KVR A;  2MBB B;  5AZH A;  5G55 A;  5KHQ A;  4EUT A;  3APC A;  2KAN A;  2MBH A;  2PE9 A;  5D94 A;  3PT2 B;  1WMH B;  3PHX B;  2RPQ A;  3APD A;  1V6E A;  2DZI A;  1ZW7 A;  2PEA A;  2WX1 A;  4XZ4 A;  4PYU A;  1WI0 A;  3DQV A;  2KFK A;  1KM7 A;  2KJR A;  4AOF A;  3TJP A;  1WX7 A;  2CU1 A;  3QAQ A;  3ZKJ C;  1WJU A;  3IFW B;  2I1J A;  2KK8 A;  3PPA A;  4GB9 A;  4DHJ B;  1WJ4 A;  1WJN A;  5CHW A;  1WXA A;  2L0T A;  1WIA A;  1MG8 A;  4NJ6 A;  3TCA A;  2K8C A;  1LM8 B;  2GBK A;  3QAR A;  4MM3 A;  3UF8 A;  2NVU I;  3GOE A;  1V2Y A;  4W9K A;  2LRU A;  2GBR A;  4PS3 A;  3VUW A;  1A5R A;  3PS6 A;  4GGQ A;  3DCG A;  4KVG B;  3UIN B;  2I1K A;  1XD3 B;  2JVC A;  3KUD B;  4KZ0 A;  3SU8 X;  3MHS D;  1EF5 A;  2XK5 A;  3V6E B;  2DHZ A;  1XT9 B;  2G45 B;  4CHK A;  1TTN A;  1XQQ A;  1P3Q U;  2AEH A;  2V4L A;  1J0G A;  4MGI E;  2DZK A;  5EDS A;  4PS7 A;  4MGK E;  2CKH B;  4M8N A;  2ZZP B;  3UIP B;  2VRR B;  2DX5 B;  2MCN B;  3WAM A;  4ICU A;  5IAA C;  3AI5 A;  2K6D B;  4BOZ B;  3ZO5 B;  1OEY A;  5JHB A;  1SIF A;  1OGW A;  4WJO A;  4G0N B;  1OQY A;  3NZU A;  5GMV A;  1EUV B;  3L13 A;  2MLB A;  2JZZ A;  3ENE A;  3OAW A;  4ANX A;  4MGZ E;  2JUO A;  2MX2 A;  3RD2 A;  2L05 A;  2IO2 B;  2HJ8 A;  1M94 A;  1WR6 E;  2NCN A;  2KC1 A;  3IG3 A;  4P7I A;  5CHF A;  5AEK B;  3H7P B;  4HCP B;  4DWF A;  3AUL A;  4NQL B;  1V49 A;  2D07 B;  3N30 A;  5FR6 A;  4RM9 A;  5L95 C;  3DBS A;  2L00 B;  4K81 A;  3H9D A;  2ZNV C;  3ZNH B;  5J18 A;  3T8M A;  2KOX A;  3U7D A;  3X23 A;  4AJW A;  3HIZ A;  2N1V A;  4G50 A;  5D7G A;  2D3G A;  1WRD B;  1NI2 A;  2MRP A;  4IWO A;  5DPR A;  4II3 B;  2MBQ A;  1TGZ B;  5CHV C;  2ZPN A;  3PHW B;  3RZF A;  2NPT A;  4EKU A;  5LXI B;  4OVV A;  4W9J A;  2IY0 B;  2IO0 B;  3DBR I;  4ASW C;  3IHP C;  1UBQ A;  4LJO B;  4MH0 E;  4FJV B;  4EEW A;  5BO4 B;  1UH6 A;  3EC8 A;  2KWU B;  1YX6 B;  2Z0D B;  3PSE B;  4IM0 A;  5C23 A;  2FAZ A;  4IWP A;  4HK2 A;  3OLM D;  4DDG D;  4BBN C;  4BBN F;  3A9J B;  2KKC A;  3DDC B;  1NDD A;  3KW5 B;  2KDB A;  1R4N I;  4K1R B;  2ZCB A;  4GMV A;  4GXB A;  5G2N A;  3A9K A;  2LVQ A;  2R2O A;  3A33 B;  4I6P A;  4DXA B;  4KDI C;  2XK5 B;  2EKE C;  2PJH A;  1FXT B;  1GG3 A;  3ZNG C;  2FNJ B;  4GSW A;  5J17 A;  1LFD A;  3LDZ E;  4GU2 A;  2KX0 A;  1WXM A;  3NOB A;  3A1Q A;  3ML9 A;  3RCZ A;  2FCM A;  3H6N A;  2XBB C;  1UBI A;  5E6N A;  3ZTD A;  1WJ6 A;  1BT0 A;  1RFA A;  1WM2 A;  2DZM A;  2V1Y A;  1WZ0 A;  2XEW A;  4AJY B;  2KO3 A;  4FA6 A;  2LGX A;  3WAP A;  1EF1 A;  1E8X A;  4WJQ A;  2M4N A;  3AXC A;  1I35 A;  1F9J A;  3NZS A;  2J0K A;  3WA0 A;  3DVG X;  2JPH A;  4MSM B;  2BYF A;  3H7S A;  4GOC A;  1YQB A;  3DPD A;  4XC2 A;  3VH4 B;  1KOT A;  1V81 A;  2LI5 A;  2MBO A;  2V3S A;  2DYO A;  4GN1 A;  4NY0 A;  1IPG A;  4B95 A;  3I3T B;  5E6O A;  4GDK B;  5J2R A;  2ZCC A;  3BIN A;  2MWS B;  2JY6 A;  2BYV E;  3ZLZ A;  2KC2 A;  3QWZ B;  2NBV B;  1WE6 A;  2KX3 A;  2KTR B;  4ANV A;  4DHZ E;  1C1Y B;  1UZX B;  2UYZ B;  3PTF C;  1WMH A;  2N7E A;  3R7R A;  1V5T A;  2DEN B;  3N3K B;  3IVF A;  3JYU A;  5LXH A;  2KZR A;  1H8C A;  2IYD B;  2QHO A;  1V5O A;  2JWZ A;  1GNU A;  4W9F A;  1JRU A;  3B0A A;  3PRP B;  3VHT C;  1L2N A;  1ZGU B;  4TQ1 A;  4F8C B;  4JLC A;  2D2Q A;  1P1A A;  4BKS D;  3UIO B;  2KXJ A;  3VXW A;  3QX1 A;  1WGD A;  1E5W A;  4DDI D;  4K7S A;  2N9E B;  2GBJ A;  2M0X A;  1WYW B;  1X1M A;  3NHE B;  3A1Q B;  3NY5 A;  3RUI B;  4NNJ B;  2DAJ A;  3K9P B;  4HXD A;  5D2M B;  2DYM A;  3QA8 A;  3M95 A;  2KNB A;  3APF A;  3HK0 A;  4A3O A;  4TQ0 A;  2J0J A;  3GZN I;  2M1M A;  2LUE A;  2KMA A;  3H1U A;  4JQW C;  2L3Z A;  3VUY A;  3R3M A;  5DCN A;  4NAW A;  1GC6 A;  1VD2 A;  1WX8 A;  2AL6 A;  4KZC A;  2FCS A;  1Z5S B;  4N9F 4;  3VVW B;  4GIV A;  3A9J A;  2N9X A;  4DBG A;  4BOS C;  2LVO A;  1Q5W B;  4ICV A;  4JGH B;  2CS4 A;  4K7U A;  2GBM A;  4LCD E;  3CSF A;  4I6L B;  2C9W B;  2LXC A;  3A9K B;  4IG7 B;  3VAW A;  2J7Q B;  4DHZ B;  3UQB A;  1D3Z A;  2O6V A;  5E6P A;  1OTR B;  2LWP A;  1WR1 A;  2A4Z A;  4HVB A;  4E3C A;  4WWN A;  2MSE D;  4FLH A;  4GDL A;  2JXX A;  3KVF B;  3PRE A;  4OVU A;  4KSL C;  2C5L C;  2IY1 B;  2KHW B;  2D11 A;  2MA9 B;  1IP9 A;  2UWQ A;  4MGY E;  4KIK B;  2KLG A;  2EMS A;  3T9L A;  3TL5 A;  3ZNI D;  4IM2 A;  3DBL I;  2N7D A;  4HWI B;  2RGF A;  3AU4 A;  3WAL A;  2KJH B;  1KLV A;  1U4A A;  2Z0E B;  1E8Z A;  4PS8 A;  2LXA A;  4E74 A;  2JRI B;  5DPW A;  2C60 A;  3QC8 B;  2LGD A;  4FAD A;  3ZRF A;  1ZKH A;  4ZYN A;  3WAN A;  2MW5 A;  1G6J A;  3V61 A;  2WYQ A;  3MJW A;  4IUM B;  3RT3 B;  3ZUN A;  2KWC A;  1E8Y A;  2JT4 B;  3KYD D;  1GC7 A;  4PYZ A;  4X57 B;  5DPS A;  4EZK A;  2ASQ A;  1GUA B;  4FJY A;  1LQB A;  1S1Q B;  3JVZ X;  3CF6 E;  3VTV A;  1C3T A;  2BKF A;  1IYF A;  3L08 A;  1Z2M A;  3CMM B;  4EFO A;  2LAS A;  3M63 B;  1TZ1 A;  4JL9 A;  3L0W B;  3QCA A;  4GDK A;  2KJ6 A;  3RZW C;  2BKR B;  3ECI A;  1T0Y A;  1LXD A;  2K25 A;  2LZ6 A;  1WZ3 A;  4RMA A;  1WE7 A;  2AL3 A;  3JSV A;  2NBU A;  2ZVN A;  2MP2 A;  5CX3 A;  1K8R B;  4MJS B;  1AAR A;  2CHZ A;  4DHJ D;  4B9K A;  1WF9 A;  4J6I A;  2CHX A;  4TV3 A;  4E71 A;  2HD5 B;  1WXV A;  4II2 B;  1EO6 A;  2Z59 B;  3TMP B;  4MDK E;  1SE9 A;  2NPT B;  3PVL A;  4BKT A;  4YL8 A;  2K8H A;  2R2Q A;  4WQO B;  2O6V B;  3DBH I;  3QJZ A;  2G4D B;  5JH5 C;  3S2A A;  1TBE A;  4W9L A;  1KJT A;  3ZIM A;  3KYC D;  2C7M B;  1RRB A;  2OOB B;  2G3Q B;  5KHO A;  3WAO A;  2IBI B;  3A4S C;  2L0F A;  3TIX A;  3A4R A;  2REX A;  4W9C A;  5DPT A;  3KH0 A;  1E7V A;  2YLM A;  4EZJ A;  4HPL B;  1V9J A;  4MEL A;  1YD8 U;  2KTR A;  2NS5 A;  2LGY A;  3HM6 X;  2JRH A;  4MEM A;  1WGG A;  4W9I A;  4TUU A;  5IA7 A;  2K8B A;  1WX9 A;  3DOW A;  4ZRK A;  4W9D A;  1OEY J;  2ZNV B;  2BYE A;  2KQ7 A;  2IO1 B;  4WAA A;  5AZF A;  1UEL A;  1P9D U;  1WGH A;  2HTH A;  1GJZ A;  4GDL B;  1WGY A;  3SHQ A;  4BKG A;  4IM3 A;  4M0W B;  2BGF A;  3MTN B;  2KDE B;  4LDT D;  3JW0 X;  4TKN A;  1Q1O A;  4WWO A;  2AWT A;  3DVN V;  4HLE A;  3U8Z A;  2O2V A;  4BKS A;  1E8W A;  2NBW B;  3H7P A;  1WY8 A;  5D6J B;  2DYB A;  2OJR A;  4JIO U;  2KMC A;  2PE6 B;  4EOY A;  2KN5 A;  2N4F A;  3M3J A;  3W1S C;  3DVN U;  2GOW A;  4HDQ A;  2G4S A;  4HPM B;  3HM3 A;  4URK A;  2ZPY A;  4I6N B;  4ZRJ A;  2KWV B;  3KUC B;  2RR9 A;  1WXS A;  2ZVO A;  4KDL B;  2KDF B;  4AP4 C;  2GMI C;  3R66 C;  4BVU C;  3KUZ A;  2M17 A;  2JF5 A;  3ML8 A;  2CR5 A;  2RD0 A;  5LLI A;  3ONS A;  2J0M A;  3PLV A;  2AYO B;  4HJK A;  4ANU A;  5C1Z A;  2BWE S;  1WFY A;  3VTU A;  2MP2 B;  3V6C B;  1SGH A;  2C7H A;  1L7Y A;  3RUL A;  2FID A;  4DK5 A;  2GBN A;  2L8J A;  2Y5B B;  1V86 A;  2BPS A;  3PV1 A;  3PLU A;  4K7W A;  4WJN A;  2A5U A;  4RM8 A;  3VFK A;  3PGE A;  4CYE A;  3TBL D;  2WX0 A;  4NAW B;  3VTW A;  3OJ4 B;  3PRM B;  3QHT A;  3VH3 B;  3ZVV A;  4XX5 A;  1I42 A;  4B6W A;  3CST A;  3OJ3 A;  4F7Z A;  2CHW A;  5JHA A;  1RAX A;  4MSQ B;  3L54 A;  3ZW3 A;  2KFJ A;  4KSK C;  1J19 A;  2L7R A;  4CO7 A;  4FN2 A;  4IWQ A;  2BWF A;  3L17 A;  2O2V B;  4HDO A;  1E7U A;  5L83 A;  3K9O B;  4KV2 A;  4NJ7 A;  2FIF A;  4FHK A;  3UGB B;  3HHM A;  5HKH A;  3VQI A;  4IC7 B;  2IZV B;  2YVC A;  3LJ3 A;  3M62 B;  1NBF C;  1V80 A;  2LD9 A;  4A3P A;  3D32 A;  2WWZ A;  4HCN B;  3ZDM C;  1UGM A;  2KTF A;  4W9G A;  3U30 A;  3N32 A;  4KIK A;  1ISN A;  2PPH A;  3SDL C;  1WGR A;  2K1F A;  3NS8 A;  3O65 B;  3QIJ A;  3UQA A;  2LRW A;  3X0W A;  2KQS A;  4EZL A;  3W1Y A;  3B08 A;  4FBJ B;  4ANW A;  1RLF A;  1VCB A;  2DZJ A;  2W9N A;  4WJP A;  3R7Q A;  3Q3F A;  2FCN A;  2FCQ A;  3B1L X;  3V62 A;  1E90 A;  3RYT A;  4A20 A;  4G11 A;  2FUH B;  1P0R A;  3BY4 B;  4LJP B;  2B3A A;  2MQJ A;  2LJ5 A;  3L10 B;  2WDT B;  3ZDT A;  2K39 A;  3QK0 A;  4MJS A;  3QQ8 B;  3JSV B;  3EHV A;  4FUL A;  3EEC A;  2IO3 B;  3C0R B;  2LVP A;  1J8C A;  4W9H A;  5TR5 A;  2D10 A;  1Q0W B;  2M8S A;  4FHJ A;  2N9P C;  3DVG Y;  4G3X B;  1YIW A;  3ZRC A;  4NQK E;  1R4M I;  2KLC A;  5AZG A;  1PQS A;  4ZDV A;  3ZTC A;  1YJ1 A;  3ZNZ B;  1Y8R C;  2L76 A;  3L16 A;  4F1S A;  1H4R A;  2BF8 B;  2EMT A;  3PRZ A;  4IW0 A;  1P98 A;  1CMX B;  3IBE A;  3VDZ A;  3WIM A;  4AUQ C;  3EFU A;  3SD5 A;  1UD7 A;  2K6Q A;  3AU5 A;  2ZJD A;  4AWJ A;  3W1S A;  4FJZ A;  1QZE A;  3VUX A;  2KDI A;  2C7N B;  2RSU A;  5JZE B;  1HE8 A;  2MBE A;  4WWP A;  1S3S G;  3Q3J A;  4BFR A;  3ALB A;  4ZRI A;  2KFK B;  1WM3 A;  3V60 A;  1WH3 A;  5CTR C;  4M8M A;  3PZD A;  4W9E A;  2JZ3 B;  2KD0 A;  4NPN A;  2ZEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...