2RGFA

Rbd of ral guanosine-nucleotide exchange factor (protein), nmr, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
ALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALGEF-RBD
publication title Structure of the Ras-binding domain of RalGEF and implications for Ras binding and signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ras-binding domain
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1997-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rgfA00
2A4ZA 2EMSA 2G4SA 2LUEA 4MJSA 3ZIMA 4PS7A 3L54A 4IW0A 1WF9A 3ZRCA 4WWNA 4K7WA 3PT2B 2KQ7A 3PS6A 1P3QU 4OVVA 1R4NI 1E8ZA 3ZVVA 1I35A 4HPMB 2BKRB 1C3TA 1UGMA 2KJHB 4HK2A 3PVLA 3NY5A 3EHVA 5AZGA 1E8XA 4E71A 5E6OA 2D07B 1Q5WB 3H9DA 2MA9B 2KMAA 2O2VB 4DDGD 2K6QA 1S1QB 2ZCBA 2GBNA 3DDCB 3AULA 2K8HA 3JSVA 2O6VA 2KLGA 2EKEC 4MM3A 2HE7A 2YLMA 1MG8A 4GXBA 2NPTA 1WXAA 4IM0A 3ML9A 4XC2A 3UIOB 4W9JA 2Z59B 3H6NA 3OJ4B 3ZNHB 2JUOA 5CHVC 1VCBA 3N32A 2MWSB 2FIFA 4GDLA 1Y8RC 5CX3A 4GDKB 3RCZA 2CKHB 1YQBA 4FHKA 4GN1A 3V6CB 4OVUA 3TL5A 4KDLB 2MQJA 4II3B 4CYEA 3ZO5B 3UQBA 2C7NB 2ZCCA 2Z0EB 4IM2A 4W9CA 4B9KA 2NR2A 3ZW3A 1C1YB 4BOSC 1K8RB 2L3ZA 3GOEA 3HIZA 2UYZB 2JZZA 4EUTA 2IO1B 3PHWB 3MJWA 1SIFA 3A4SC 2N9PC 3UF8A 4F7ZA 5JH5C 3M62B 2K8BA 2QHOA 5E6PA 1YIWA 5E6NA 2XBBC 4GU2A 2KDIA 1J0GA 2WDTB 2ZEQA 3ZKJC 4ICVA 4GSWA 1TBEA 2REXA 1IP9A 2KJRA 5AZHA 1E90A 1P9DU 3IG3A 2LVQA 4G3XB 4KV2A 4WJQA 3M95A 2ZPNA 1WJ6A 2D2QA 2J7QB 2JXXA 2C60A 2IY1B 2M1MA 1UELA 3IBEA 3ZDMC 2KDBA 3BY4B 1OQYA 2BKFA 2N1WA 3GZNI 4EOYA 1KOTA 1WZ0A 4E3CA 2JVCA 1E7UA 3QIJA 3T9LA 5JHAA 2AL6A 2D3GA 2LRWA 3N30A 3QQ8B 3QAQA 2BYVE 2ZJDA 2RSUA 4HDOA 3R66C 2K1FA 3VDZA 3APFA 1H8CA 4HXDA 4DHZE 2GMIC 4WAAA 3S2AA 5CHWA 2JRIB 1WI0A 1WRDB 2KKCA 2KX3A 4K7SA 3ZUNA 4FBJB 2IO3B 2BPSA 4FLHA 4MGKE 2XK5B 3NZSA 1KJTA 2MBBB 5G2NA 4WQOB 3PPAA 2L0TA 3I3TB 3RT3B 3NS8A 3UIPB 4WWPA 2N7EA 3SHQA 2Z0DB 4CHKA 1M94A 3KUDB 2WYQA 2KOXA 2K39A 1E8YA 2HD5B 3W1YA 4BKTA 5KHQA 4PYUA 5GMVA 1WGGA 4MELA 2O6VD 5J2RA 1LM8B 4GDLB 2CS4A 2N1VA 3X0WA 1WR6E 3WALA 1Q0WB 4NQKE 2JY6A 4NPNA 1E5WA 4F1SA 4ZRJA 3A9KA 1E8WA 1ZGUB 4NAWA 3DBLI 3L17A 2G4DB 5LXHA 1WJUA 2IY0B 3KW5B 4K1RB 3TIXA 2BYFA 2LZ6A 3RUIB 1WMHA 2KHWB 3PRPB 3A1QA 2DYOA 4DBGA 2N7DA 3OAWA 5D2MB 3HM6X 3ZTCA 2KJ6A 2G45B 3O65B 3QCAA 2JT4B 4W9GA 3CF6E 4AJYB 2MBEA 4GOCA 2MCNB 3IFWB 2BWES 2FCMA 2LVOA 3HK0A 4TQ1A 3SD5A 4AJWA 1WH3A 1V86A 1HE8A 2J0MA 3BINA 4ZRKA 3TMPB 4BOZB 2RR9A 3H7SA 2MP2A 1UD7A 5D6JB 2AWTA 1X1MA 1EF1A 3K9PB 3V61A 4M8MA 1WM2A 4ANXA 2DZMA 4EZKA 1P0RA 2K8CA 2B3AA 4GGQA 3JVZX 2LD9A 3QWZB 1WZ3A 1ISNA 3L10B 4W9IA 4B95A 4G0NB 1UBIA 4KSKC 3M63B 1YD8U 4GMVA 3WAPA 1V5TA 2MX2A 4FJZA 2KTRB 2NVUI 3A9JB 3KUZA 4FA6A 2KK8A 1TGZB 2WWZA 1BT0A 4FJVB 4BKSD 2PPHA 2C9WB 2L8JA 3DBSA 3DVNU 3H7PB 2G3QB 2OOBB 2LVPA 3V60A 1EUVB 3M3JA 2CHXA 3H1UA 2JPHA 3VTWA 1NDDA 2JWZA 4LJPB 1WIAA 2M17A 3LDZE 2KFKB 4KVGB 4JQWC 4W9DA 5AEKB 1LXDA 1D3ZA 2DX5B 2I1JA 2J0JA 2NBUA 2W9NA 3ALBA 3L08A 3N3KB 2R2OA 4BKGA 3QC8B 4WJPA 3DVNV 3VVWB 3WAMA 4XX5A 4JLCA 3Q3FA 1UH6A 4PYZA 1NI2A 4N9F4 3VAWA 4XZ4A 3OJ3A 3PGEA 1RFAA 4FJYA 2V1YA 5DPRA 3DQVA 3U30A 3B0AA 4KDIC 3PLVA 1WGYA 2MRPA 3DVGY 4I6NB 2J0KA 4W9FA 2IO0B 4W9LA 2JZ3B 2HTHA 3ENEA 4IM3A 4ZDVA 1QZEA 4MJSB 3VUYA 1WXMA 4DHZB 1EF5A 1SGHA 3A1QB 2JRHA 4A3OA 2DENB 2IBIB 2MLBA 2C7HA 3VTVA 1PQSA 4GIVA 4J6IA 2LWPA 3U7DA 3LJ3A 1JRUA 3QARA 2KWCA 4EZLA 3PV1A 1XQQA 1GNUA 2ZPYA 4NJ6A 4X57B 3W1SA 5L95C 3RZWC 1WR1A 2LGXA 4YL8A 2KX0A 2AL3A 2LRUA 2O2VA 3ZLZA 3DPDA 4TKNA 1GG3A 3PRMB 4DXAB 2C5LC 1UZXB 3MTNB 4DWFA 2LGYA 2BYEA 2MP2B 1Z2MA 2DYBA 2M4NA 3ZNZB 2L05A 3QA8A 3IVFA 4MGYE 5CTRC 2CHWA 3JYUA 3WANA 2CU1A 2R2QA 3JSVB 1I42A 2O6VB 3A4RA 2RPQA 4G11A 2IYDB 3VUWA 2L76A 1V49A 4NNJB 4WJOA 2K6DB 1KLVA 3CSTA 4JL9A 4LCDE 4RMAA 2NPTB 1G6JA 2M8SA 3CMMB 1WE6A 4TUUA 3ECIA 4I6PA 2WX0A 4E74A 3VFKA 4TQ0A 3SU8X 4GDKA 4EKUA 2IO2B 1WX9A 3ZDTA 2LI5A 1YJ1A 1V81A 3RZFA 3QJZA 3RULA 1J8CA 2RD0A 2XEWA 3VHTC 5C1ZA 2N9EB 4JGHB 2DAFA 4IG7B 4ASWC 3KYCD 3TJPA 2C7MB 5IA7A 1VD2A 1S3SG 5LXIB 2MBHA 2KLCA 2KD0A 4FADA 3NOBA 1V6EA 4AP4C 4NQLB 3VH4B 2KWUB 1EO6A 4EFOA 2ASQA 4ZRIA 1WJ4A 1WFYA 4ICUA 4NJ7A 1YX6B 2LXCA 2ZNVC 4PS3A 3T8MA 3UQAA 4IWQA 4JIOU 3VUXA 4HDQA 4HCNB 4A3PA 4M8NA 1H4RA 3V6EB 3PLUA 2IZVB 4CO7A 3ZRFA 2PEAA 2AYOB 1WXVA 2DAJA 2GBMA 3C0RB 4ZYNA 1TTNA 4KZ0A 1WYWB 3KUCB 3L16A 5G55A 3NZUA 2MBOA 3L13A 2KTFA 2CHZA 1WX7A 1AARA 2BGFA 2HJ8A 4URKA 1GUAB 4MDKE 2ZVNA 5BO4B 1OTRB 4HLEA 1WM3A 2LASA 2KVRA 4LDTB 5HKHA 4HVBA 2PE9A 4KIKA 4MSQB 2AEHA 2GOWA 3SDLC 3QX1A 3V62A 1R4MI 2FUHB 1WGDA 1V9JA 2I1KA 5C23A 2KN5A 4W9HA 5DCNA 1P98A 2DHZA 4LDTD 2NS5A 4A20A 1IPGA 2ZZPB 1WX8A 4WWOA 2RGFA 3KVFB 4HJKA 1RAXA 3DBRI 1Z5SB 2GBKA 1WE7A 2XK5A 1U4AA 4FN2A 1WGRA 4AOFA 2PE6B 2KXJA 2V4LA 3ML8A 4AWJA 3DOWA 2KNBA 4EEWA 3VTUA 3AI5A 4ANVA 3EC8A 3UGBB 2LJ5A 2V3SA 3R3MA 4MGIE 1TZ1A 3RYTA 4EZJA 1XT9B 2KC1A 1UBQA 4DHJB 1GC6A 2LXAA 5J18A 3X23A 3ONSA 3DCGA 1V2YA 1J19A 2FCSA 1NBFC 2JF5A 3WIMA 4DK5A 4HPLB 2OJRA 3PSEB 3AU4A 4BFRA 2K25A 2KO3A 2YVCA 4DHJD 3D32A 2CR5A 2DYMA 5JHBA 4IC7B 4KZCA 3WAOA 2FNJB 4MGZE 4MH0E 4LJOB 1F9JA 1XD3B 3MHSD 2KQSA 1WY8A 3A9KB 2FAZA 2ZNVB 4M0WB 4B6WA 2MW5A 4NAWB 1OEYJ 1LQBA 2WX1A 2FCQA 3IHPC 1A5RA 1FXTB 2L0FA 3QK0A 4IWOA 4TV3A 4ANWA 1V5OA 1WMHB 3P2BA 3EFUA 2NCNA 2BF8B 3L0WB 2N9XA 3JW0X 4HWIB 3KYDD 3A33B 3VH3B 1KM7A 5LLIA 2UWQA 2DZKA 3TBLD 1RRBA 4WJNA 2D11A 5AZFA 4BBNC 3NHEB 4IWPA 2ZVOA 3WA0A 5TR5A 1L2NA 3PZDA 3DBHI 5DPWA 3DVGX 2D10A 1WJNA 3OLMD 2DZJA 3W1SC 5DPSA 2KMCA 1L7YA 1V80A 1ZKHA 2KDEB 4W9KA 3R7QA 2BWFA 3KH0A 2DZIA 4HCPB 4BVUC 1LFDA 3TCAA 1T0YA 4KIKB 3CSFA 2KC2A 5J17A 1GJZA 1ZW7A 1WXSA 4PS8A 4RM8A 4GB9A 4RM9A 5JZEB 3K9OB 2KZRA 3PTFC 2GBJA 2KANA 3HHMA 1GC7A 4BKSA 5L83A 3RD2A 2LGDA 3EECA 4AUQC 4I6LB 4IUMB 4NY0A 5IAAC 5KHOA 3U8ZA 2KTRA 1Q1OA 2FCNA 3A9JA 4FHJA 1CMXB 1OGWA 4F8CB 4K81A 4MEMA 2PJHA 5FR6A 1E7VA 2L00B 4BBNF 3AXCA 3ZNID 4W9EA 4II2B 3H7PA 3PRZA 3R7RA 2MBQA 5DPTA 1WGHA 2L7RA 4G50A 3APDA 4P7IA 2NBVB 3Q3JA 3VQIA 4FULA 2KWVB 2VRRB 4K7UA 3PHXB 3PREA 1OEYA 4KSLC 2GBRA 2KFKA 2MSED 4DDID 2EMTA 2NBWB 4MSMB 3ZTDA 3B08A 5D94A 5CHFA 3UINB 3ZNGC 1YX5B 3B1LX 5EDSA 2Y5BB 3VXWA 2FIDA 1IYFA 2N4FA 2KDFB 3QHTA 4ANUA 3HM3A 2KFJA 1RLFA 5D7GA 2M0XA 3AU5A 2A5UA 3APCA 1SE9A 1P1AA
chains in the Genus database with same CATH superfamily
2EMSA 4MJSA 3L54A 3N1ZC 1FXIA 4IW0A 2E6XA 4K7WA 3PT2B 3L4PA 3Q8CA 4OVVA 4RCOA 4M02A 3ZVVA 2KJHB 2LEKA 1XEEA 5AZGA 1F0ZA 4E71A 3PO0A 1DOXA 2GBNA 2RDBC 3JSVA 2O6VA 2EKEC 3HUIA 2K22A 3BIID 1NYQA 2IDYA 1YQ3B 1I4XA 1R4NB 3N1XC 4YSYB 4JE3B 2JUOA 3N32A 2MWSB 4XYCA 5CX3A 3AH7A 3P42A 4OVUA 4KDLB 4II3B 2Z0EB 2BS4B 1C1YB 1K8RB 1TZOA 3RNBC 2IO1B 4K3BA 1NYRA 3UF8A 1JCKB 4F7ZA 2WLBA 2K8BA 2PVGC 1KLGD 4GU2A 4HJGE 1V1OA 4WAFA 1TBEA 1IP9A 1E90A 3IG3A 3M95A 4ARIA 2M1MA 3EA6A 1UELA 2KDBA 2BKFA 3NVVA 4ZHPA 2Y3AA 2R61A 2JVCA 1E7UA 3AE8B 5JHAA 1MHHE 3VR9B 1SJED 2BYVE 4HDOA 2QDFA 2JRIB 4FBJB 1WRDB 2H88B 2IO3B 3I57A 3I3TB 4ZRPA 3UIPB 1VLBA 2MJEA 3ZJTA 2KOXA 2HD5B 3U2SC 4BKTA 2IJ0A 4MELA 4JWUC 5J2RA 2CS4A 2N1VA 1WYGA 2D3BA 4NPNA 4F1SA 3A9KA 1ZGUB 3DBLI 1N63A 4K1RB 3TIXA 2LZ6A 2WHIA 2DYOA 2N7DA 1XCTL 3ZTCA 2G45B 3QCAA 2JT4B 1QOFA 4AJYB 2MBEA 4GOCA 2J53A 4AJWA 1V86A 3TMPB 4WQMA 5D6JB 1LO5D 3DHHC 1CZPA 2AWTA 2AQ2B 2IGGA 4M8MA 1WM2A 4EZKA 4GGQA 4LK0M 1ISNA 1V5TA 2NVUI 2V3PA 1NVID 3NVZA 1RYJA 2IGDA 1BT0A 4FJVB 4BKSD 3DBSA 3DVNU 2G3QB 3NG0A 3B2FA 1PFDA 3H1UA 4OW0A 4L1BA 3VTWA 4LJPB 3LDZE 2M17A 2KFKB 5FKAC 5AEKB 1TY2A 3L08A 4DXGA 4WJPA 3PZ8A 3VVWB 4RNAA 4M00A 4JLCA 4XX5A 1NI2A 3KQ4A 4N9F4 3RPFC 4FJYA 1L0YB 5DPRA 3DQVA 3ETRA 3TEYA 2MRPA 3DVGY 2KYWA 3FAHA 4W9LA 2HTHA 4IM3A 4ZDVA 1IGCA 2ACZB 1XO3A 2MLBA 3VTVA 1FFUA 2LWPA 3QARA 3PV1A 5L95C 4NJ6A 4YL8A 3ZGZA 2BB5A 4RF0A 4ZHOA 3ZLZA 3DPDA 1GG3A 3PRMB 4DXAB 2C5LC 3CWIA 1HEZE 4DWFA 2LGYA 2L05A 4MGYE 2CU1A 1I42A 3A4RA 3NUHB 2L76A 1V49A 3VUWA 1KLVA 4JL9A 4A55A 3MFGA 2NPTB 1EU4A 1N62A 2M8SA 3CMMB 1EM7A 4TUUA 3ECIA 4AQ7A 3AN1A 4E74A 1FO4A 1KTKA 3SU8X 1I4PA 1WX9A 2LI5A 3BVZA 4XDDA 3RULA 2N9EB 5I4DA 3KYCD 3ZJVA 2MBHA 2RPVA 2KD0A 1V1PB 3NOBA 4S0RA 1QQRA 4ZRIA 4P1BC 3VUXA 5G5HA 4YSXB 1JW9D 1DYQA 2JYTA 1ET9A 4CO7A 4XWTA 1TTNA 5E6JA 3L16A 3NZUA 4A90A 1ZDVA 1YJJA 4XGAB 2JZPA 1GUAB 4MDKE 3GE3C 1OTRB 2LUMA 2KVRA 4MSQB 2GOWA 4JPSA 3QX1A 1GOZA 1WGDA 1V9JA 2KN5A 1P98A 4JWSC 4WWOA 4OZCA 1RAXA 1Z5SB 1VZ8A 2GBKA 1HZ6A 2PE6B 2V4LA 2KNBA 1AW7A 3UGBB 2V3SA 1VJKA 4MGIE 5HHDG 5J18A 1T6BX 3HVDA 4YT0B 1V2YA 1NBFC 1HXYD 3SEBA 3ZXRA 1FNWA 3DBRB 2CR5A 5JHBA 1K51A 4MGZE 1XD3B 1WY8A 2FAZA 1UF0A 1IGDA 2L0FA 2ON8A 4TV3A 3EFUA 2GLSA 3L0WB 2QCZA 4HRSA 1A70A 3AECB 5IP4D 1KM7A 2WXJA 1RRBA 4WJNA 1BXTA 1I7HA 3R2IA 3MP9A 5LNK1 3MC9A 1CJEA 2D10A 3IXSA 1L7YA 2PIAA 2DZIA 2LGIA 3CSFA 4RM9A 3ZQ4A 1GC7A 4BKSA 5H8YE 3EECA 5IAAC 4NY0A 3RNAC 5FR6A 1E7VA 4B0EA 1QF6A 2MBQA 4P7IA 1OQQA 3Q3JA 2VRRB 3PREA 2KFKA 2WDRB 3E9SA 3Q3MC 4A6QA 4DDID 2EMTA 3ZNGC 1YX5B 2WXQA 3BVMA 2N4FA 1T5XD 3BK1A 4ANUA 2KFJA 2M0XA 1JWSD 1XLPA 1SE9A 3ZIMA 2LUEA 1BMLC 5IKCM 3PS6A 1P3QU 4HPMB 2BKRB 4HK2A 1L0VB 2V9HA 3PVLA 3NY5A 3EHVA 1E8XA 3ZJUA 2D07B 3H9DA 3O13A 2O2VB 3RNFC 2G9HD 4MM3A 3TEWA 2YLMA 3Q8FA 1RWSA 1MG8A 2NPTA 4MACA 3UIOB 4L2YA 2LGSA 1UWMA 3ZNHB 3MHZA 4GDLA 3AE1B 3RCZA 3V6CB 2MQJA 3ZO5B 2C7NB 4B9KA 2NR2A 4RGOS 1V1PA 1MHXA 2FE8A 2L3ZA 3HIZA 2W3SA 4EUTA 2AQ1B 3PHWB 3A4SC 2QHOA 5E6PA 1YIWA 5E6NA 2XBBC 1BUIC 2WDTB 2ZEQA 3ZKJC 4ICVA 1D5MC 5AZHA 1SJHD 1P9DU 4WJQA 1UWXA 2C60A 2IY1B 2W3RA 1C4AA 1L0XB 2WXRA 1L6VA 1KOTA 1WZ0A 4E3CA 2JYEA 3QIJA 3T9LA 1SIJA 2AL6A 3N30A 2W82A 5BYSA 3QAQA 2K1FA 3APFA 3AM9A 3S2AA 5CHWA 2KX3A 1WI0A 2KKCA 2M56B 3ZUNA 4MGKE 3DBHB 2L0TA 3RT3B 4WWPA 1JWAD 4L23A 1T0SC 4B0MA 4CHKA 3BK2A 3WCQA 1NI3A 5KHQA 1WGGA 5AUIA 2WGSA 4UDUC 3X0WA 1MG4A 1FRDA 1Q0WB 3FKYA 2WS3B 1JWUD 2BYFA 4NJCA 3RUIB 3GE8C 3V3XA 2KHWB 1KFYB 2N7JA 2QEJC 2KJ6A 1VZ6A 3O65B 1HQRD 1R7SA 1JWBD 2L83A 3SR6A 2I2YA 4O1NA 2FCMA 3HK0A 1WH3A 3EUB2 3DBLB 1ZDXA 2KAJA 3AE7B 3BINA 1SSNA 2MP2A 1UD7A 1C76A 1RM6C 1X1MA 2CU3A 3V61A 1P0RA 2K8CA 3BYYB 2PKOA 2BTEA 3QWZB 1WZ3A 3KWLA 4G0NB 1JALA 1V8CA 1YD8U 3NZ3A 1FIQA 2I38A 2KTRB 4FJZA 2KK8A 1TGZB 2C9WB 4S17A 2L8JA 4P1CC 3V60A 3Q3NC 3OWEB 4WH4A 2HJ1A 4TMAB 5BYQA 1MVKA 3AE2B 1WIAA 2KT7A 3AE3B 2NBUA 4KGSA 4BKGA 3QC8B 3Q3FA 4PYZA 3VAWA 3OJ3A 1RFAA 2XNAC 2V1YA 3U30A 4IOIE 2WXGA 3B0AA 4I6NB 2IO0B 3ENEA 1E10A 3VUYA 1VR9A 3A1QB 1TKGA 1VZ7A 3Q14C 3LJ3A 1JRUA 1XQQA 1GNUA 4X57B 2L52A 3I9V1 1FMAD 1WR1A 2LGXA 2KX0A 2WDQB 2WXMA 2AL3A 2O2VA 1QILA 3IT6B 1UZXB 3MTNB 2BYEA 1Z2MA 2M4NA 3IVFA 4C80A 3BWUD 2QJLA 1ZUD2 2PMVA 3TEZA 3P4SB 3GZNB 2UU7A 2K6DB 1I4RA 1KH0A 3HRDD 1L4DB 1N5WA 4RGTA 1WE6A 3AV8A 4TQ0A 2PW9A 4EKUA 3ZDTA 3RZFA 2SEBD 2RD0A 4N6EB 3VHTC 4JGHB 4IG7B 3TSSA 4ASWC 2C7MB 1S3SG 1XCQL 4ICUA 1WGKA 2D3AA 1QOGA 4A3PA 4NAMA 1H4RA 3Q3OC 3V6EB 3PLUA 2J42A 3ZRFA 2MJDA 4C7ZA 3C0RB 4KZ0A 1WYWB 3KUCB 3DHIC 4C00A 1WX7A 1AARA 2KACA 3T3NA 5BO4B 4P6VF 3U52E 2LASA 1UGJA 5HKHA 4HVBA 2PE9A 4KIKA 5IO9A 1FFVA 2DNFA 1XLQA 2DHZA 2EELA 2NS5A 2LJIA 2MHJA 1WE7A 1K53A 3ML8A 2LJ5A 1TZ1A 2M19A 5BMIA 1UBQA 4DHJB 3DCGA 1J19A 4KGRA 4DK5A 2BT6A 4HPLB 4ZRQA 3PSEB 3AU4A 4BFRA 2K25A 2KO3A 4DHJD 2VH2A 4KZCA 2V0GA 4MH0E 1DOIA 1F52A 1TJEA 4M0WB 4B6WA 2MW5A 4NAWB 1LQBA 2WX1A 2FCQA 3IHPC 1KF6B 1FXTB 3U4EG 1V5OA 1SE2A 1V97A 2WXFA 2NCNA 5FR3A 3JW0X 3VH3B 3Q8EA 5LLIA 2UWQA 3TBLD 1GB4A 3NHEB 1L2NA 5DPWA 3N9YC 3W1SC 2GI9A 3R8BA 1N61A 4W9KA 3R7QA 3KH0A 4HCPB 1LFDA 2FUG1 1T0YA 3TCAA 4PS8A 5JZEB 2RDHA 4RH6A 3VR8B 1XF5L 3PTFC 2KANA 2OJWA 1HTOA 3RD2A 4AUQC 1B9RA 4I6LB 5JXVA 2INCC 2KTRA 2FCNA 1CMXB 4F8CB 1PGAA 2L00B 1N5XA 3Q6BA 3R7RA 5DPTA 1WGHA 2L7RA 1FD6A 3APDA 1DGJA 2KWVB 4K7UA 1NEKB 1OEYA 4KSLC 1XLOA 4YTMB 2YEPF 5D94A 5CHFA 2JU6X 5EDSA 3SFEB 3VXWA 2FIDA 1EU3A 3HM3A 1JWMD 4BZAA 3APCA 1P1AA 2INPE 3ZRCA 1XLNA 4HPPA 1SB3C 4NZLB 2KQ7A 3W5UB 1C3TA 1UGMA 1PGXA 5E6OA 1Q5WB 2K6QA 1S1QB 3RNEC 2BS3B 4A9AA 3AULA 2K8HA 3DHGC 4KKIA 2H89B 3V05A 1FNUA 2N0SB 4IM0A 4XC2A 3H6NA 5CHVC 2BS2B 2FIFA 1Y8RC 1JMLA 4GDKB 5AUKA 2CKHB 1YQBA 4FHKA 4LTUA 3AEAB 3AE6B 2QILA 3UQBA 4BOSC 2SAKA 4LLGM 2JZZA 1IUEA 3MJWA 1SIFA 5JH5C 3NS1A 1J0GA 2KWDA 4GSWA 2REXA 1OQRA 1SE3A 2LVQA 2D2QA 1ET6A 2K9XA 5TSSA 1HTQA 2DBYA 1PDXA 4EOYA 1GAQB 3B9JA 1SEBD 2RSUA 1ENFA 3R66C 3VDZA 4HXDA 3E56A 4LNOA 2GMIC 2XN9C 1HA5A 4K7SA 2BPSA 4FLHA 2XK5B 1KJTA 2MBBB 4WQOB 2GRIA 3PPAA 3NS8A 1C4CA 1ESFA 2LHEA 3Q69A 2Z0DB 3SHQA 3KUDB 2WDVB 3NJTA 2K39A 1ZXHA 3PZ7A 1E8YA 4WIPA 4US8A 4OHJA 2O6VD 1LM8B 2PTLA 2L1AA 1WR6E 4NQKE 1EWYC 2JY6A 3OG5A 1VRAB 1E5WA 1YJIA 4M0WA 1FNVA 4NAWA 4D2KA 1F1HA 5LXHA 5D3IB 3PRPB 1T0RC 4KGTA 2QIEB 3SFDB 2D3CA 5D2MB 4BAXA 1NENB 3CIRB 4AS1A 4W9GA 4Q2JA 3IFWB 1D4BA 2BWES 2LVOA 4TQ1A 3SD5A 2J0MA 2RR9A 1GB1A 1D5XC 3K9PB 1EF1A 4IKGA 3EFCA 1FXAA 3JVZX 3L10B 4OZAA 1UBIA 4GMVA 2MJ3A 3Q2AC 2V3NA 2MX2A 3TUOA 3A9JB 4FA6A 2JX5A 2WWZA 1L6UA 2PPHA 3H7PB 2OOBB 1UUPA 2QMTA 5HFYA 2CHXA 2JPHA 2JWZA 4KVGB 2WXPA 4JQWC 4W9DA 1D3ZA 2DX5B 3N3KB 1TIFA 2R2OA 1UH6A 2IGHA 3R2TA 1UNSA 4XZ4A 3PGEA 4YSZB 3BYTB 4DQOC 2LMCA 1QZEA 2ICIA 2KN4A 1WXMA 1EF5A 1P7EA 2JRHA 2IBIB 1PQSA 4GIVA 4OVZA 4J6IA 3U7DA 2K0PA 2Y5CA 3W1SA 3VRBB 3AEFB 3RZWC 3Q8BA 5H92C 3EGRA 2HDEA 4TKNA 1E7PB 3WANA 3JYUA 5EE0A 2R2QA 3GS2A 2RPQA 4G11A 1WWTA 4WJOA 4NNJB 2WU2B 1KLUD 4USAA 4RMAA 4RF1A 3VFKA 4ZYSA 4GDKA 2IO2B 2JSVX 1V81A 3QJZA 2XEWA 2DAFA 4YTPB 3C8YA 5IA7A 1VD2A 3RFZB 5LXIB 2WXOA 2KLCA 4RGMA 2KWUB 2JQRB 4NJ7A 3T8MA 1YX6B 2LXCA 4IWQA 4JIOU 4M8NA 3LB8C 2PEAA 3RI7C 3AEGB 4HROA 2AYOB 1WXVA 4ZYNA 3U7ZA 4C7YA 2W54A 5G55A 1F77A 2MBOA 3NRZA 1MI0A 2KTFA 1TT5B 2HJ8A 4URKA 1TS4A 1FRRA 1TY0A 1QOBA 2ZVNA 1ZXIA 1WM3A 4LDTB 2AQ3B 1AYFA 3V62A 1R4MI 2I1KA 5C23A 2M0AA 4W9HA 2LFIA 2JXTA 2WXHA 4LDTD 1J7CA 1IPGA 4GLSC 2ZZPB 4A20A 1F2RI 1WX8A 3RN9C 1FM0D 2XK5A 4ARCA 4FN2A 4AOFA 2KXJA 4AWJA 3AEEB 3URYA 1ACCA 4ANVA 3AI5A 2KVZA 2K5PA 1XT9B 2LHDA 2KC1A 1GC6A 2LXAA 3W5VB 3X23A 3RNCC 1OFFA 2WP9B 3P4QB 2DLBA 2FCSA 2JF5A 2BVCA 5IOIA 1D6EC 2GB1A 2OJRA 2YVCA 2J52A 3D32A 4LJOB 2MEKA 2KQSA 2PVOD 4KKJA 1YN4A 2X38A 1OEYJ 3MC8A 4PK1A 1A5RA 3QK0A 4ANWA 1WMHB 3P2BA 4R3DA 2WU5B 4CQNA 4HWIB 3AEDB 4WURA 2CJOA 1JQ4A 1ZOYB 3BVGA 5AZFA 4BBNC 2VH1A 2ZVOA 3PZDA 3DBHI 3DVGX 1WJNA 1SBBB 2INDC 1V80A 1ZKHA 2KDEB 4BVUC 2E3TA 5J17A 2KC2A 1GJZA 1WXSA 3KLSX 4GB9A 4K3CA 1YN5A 4FXCA 5L83A 1FPYA 1IBXB 5KHOA 5T8IA 2N9KA 4FHJA 3A9JA 1JRPA 4MEMA 3UI3A 3AXCA 3ZNID 4II2B 3H7PA 3MJ5A 2ZW1A 4ACFA 1XXGA 4G50A 2NBVB 3VQIA 3PHXB 3Q8AA 1WSPA 5EE1A 4H2AA 1E6EB 2KDMA 2NBWB 1KRHA 2Y5BB 5D3DA 1IYFA 1P7FA 1EWCA 3AE9B 2KDFB 2WQYB 2D5GA 1RLFA 5D7GA 3AU5A 2A5UA 1J7AA 3HM6X 4REZA 2A4ZA 2G4SA 4YWGG 5HI1A 4PS7A 5C3JB 2K3UA 1WF9A 2V4IB 4WWNA 1R4NI 1E8ZA 3IT4B 4XE0A 1I35A 2RMMA 3AB5A 3T3OA 2MA9B 2KMAA 1T0QC 3C19A 4DDGD 1MJDA 1RFKA 2ZCBA 3DDCB 4KX6B 2KLGA 2HE7A 2Z8LA 1TKEA 4GXBA 3NVWA 1WXAA 3ML9A 4W9JA 2Z59B 5IN7A 3OJ4B 1YMHE 1VCBA 2W55A 3HVZA 4GN1A 4J3OD 3TL5A 4CYEA 2ZCCA 4IM2A 4W9CA 3ZW3A 4WWMA 5MPOA 3GOEA 2X8XX 2UYZB 4YTNB 1MFWA 1C79A 1SE4A 2N9PC 1SF0A 3M62B 2KDIA 1ZE3D 2RDGA 3DWMA 3N20C 3H8HA 2KJRA 4KV2A 4G3XB 3P4PB 2ZPNA 1WJ6A 1AN8A 2J7QB 2JXXA 3IBEA 4RGNA 3ZDMC 3BY4B 1OQYA 2N1WA 3GZNI 2D3GA 2LRWA 1YNTE 3QQ8B 3B2GA 2ZJDA 4ITKA 1H8CA 1M4VA 4DHZE 1E9MA 2BYTA 4WAAA 4C4VB 3NZSA 5G2NA 1QOAA 2ZW0A 3ZXVA 2N7EA 1VDVA 3DWGC 4MM3B 1M94A 2WYQA 2TSSA 3W1YA 1I4QA 4PYUA 5GMVA 3W2DA 2WXNA 4GDLB 2FBWB 3WALA 1MPEA 4ZRJA 1E8WA 1HZ5A 2OEDA 1PYWD 3L17A 2N9LA 2G4DB 3AMZA 2DWQA 1WJUA 2IY0B 3KW5B 1D5ZC 1WMHA 1N60A 4JX1C 3A1QA 3VRAB 1ZPSA 4TSSA 3OAWA 4DBGA 2WXKA 2IPKD 3CF6E 4OZBA 2MCNB 3I63C 2EKIA 1WXQA 4RFBA 1HE8A 4ZRKA 4BOZB 3H7SA 1QLBB 1FCLA 4A8XC 4ZOHC 1TYGB 2J4XA 1TS5A 4ANXA 2DZMA 2B76B 2B3AA 2LD9A 4W9IA 4B95A 1IBXA 2WXLA 3ABVB 4KSKC 3M63B 3WAPA 1AWDA 4DXFA 3KUZA 3FILB 3RMKC 1TS3A 2LVPA 1EUVB 3M3JA 5BMGA 2VZKB 3NVYA 4US9A 1NDDA 2AX5A 1LXDA 1YOVB 2I1JA 2J0JA 2W9NA 3ALBA 2VZKD 3DVNV 3WAMA 1Y56A 1WRIA 3I5JC 3KWVA 4KDIC 3PLVA 1WGYA 5GXGB 2J0KA 4W9FA 5BYRA 2JZ3B 3LXFA 4MJSB 3TEXA 4DHZB 1SGHA 4A3OA 2DENB 2C7HA 3BZDB 4MT5A 2KWCA 4EZLA 1E0ZA 2ZPYA 2ONQA 1TS2A 3IAM1 2NMQA 2LRUA 5EE9A 5BMHA 2MP2B 1CQVA 2DYBA 4N58A 3ZNZB 3QA8A 5CTRC 2CHWA 3RNGC 3JSVB 2O6VB 3FC4A 2IYDB 3AEBB 3CSTA 4LCDE 1PGBA 1G6JA 4I6PA 2WX0A 1Q10A 4HKZE 2WNMA 3GP7A 3AE4B 4M01A 1YJ1A 1N6ZA 1J8CA 5C1ZA 4LNKA 1F2RC 1C78A 3TJPA 4EE2A 2CJNA 4FADA 1V6EA 2QSDA 4AP4C 4NQLB 3VH4B 1EO6A 4EFOA 2L32A 2ASQA 1WJ4A 1WFYA 1STEA 4LNFA 2JWUA 2ZNVC 4N59A 4PS3A 3UQAA 4HDQA 4HCNB 2IZVB 1T3QA 2DAJA 2GBMA 2INNE 4HKQA 3L13A 2CHZA 2BGFA 2PLPA 5G5GA 4HLEA 2BBCA 1CK1A 2AEHA 1I4HA 4QAYA 3SDLC 2FUHB 1DOYA 5DCNA 1QKZA 4PT5A 2RGFA 3KVFB 4HJKA 1GPXA 3DBRI 4C4VA 1C9FA 1U4AA 1WGRA 2NTTA 3DOWA 2YEPB 3GB1A 4EEWA 1YQ4B 3VTUA 3EC8A 3R3MA 3RYTA 4EZJA 2NTSA 2KMMA 3ONSA 1R4MB 5C2TB 1QT9A 2BB6A 1K50A 3W9CB 3WIMA 1ROEA 4HEA1 1SXTA 5FK9C 4MH8A 1JROA 1C4PA 2DYMA 4IC7B 3WAOA 1I4GA 2FNJB 1K52A 1F9JA 3IAS1 3MHSD 1PUTA 3A9KB 2ZNVB 4YXDB 2G1EA 4XDCA 4P16A 4IWOA 4C56C 2BF8B 2N9XA 1J7BA 3KYDD 3A33B 2BW2A 3P63A 2DZKA 2D11A 2Y5PA 4IWPA 3WA0A 3P4RB 3N1YC 5TR5A 3OLMD 2DZJA 5DPSA 1L4ZB 2KMCA 3P1MA 4XWWA 2BWFA 4KIKB 1C77A 1ZW7A 3MC0B 4RM8A 3K9OB 5EE3A 2KZRA 1B1ZA 2GBJA 3HHMA 2LGDA 4IUMB 4IDIA 3U8ZA 1Q1OA 1OGWA 3FILA 4K81A 2PJHA 1L5PA 4BBNF 2HTME 4W9EA 1YN3A 3PRZA 2BQQA 1ZP0B 2QC8A 4FULA 1TKYA 3LYYA 1FEHA 2GBRA 2MH7A 2MSED 1LGRA 4MSMB 3ZTDA 3B08A 3UINB 2WXIA 3B1LX 3AE5B 1FCCC 3J9CA 5HG2A 4LNIA 2Q5WD 4LNNA 2KQ4X 2OHFA 3ZYYX 3QHTA
chains in the Genus database with same CATH topology
2A4ZA 2EMSA 2G4SA 2LUEA 4MJSA 3ZIMA 4PS7A 3L54A 4IW0A 1WF9A 3ZRCA 4WWNA 4K7WA 3PT2B 2KQ7A 3PS6A 1P3QU 4OVVA 1R4NI 1E8ZA 3ZVVA 1I35A 4HPMB 2BKRB 1C3TA 1UGMA 2KJHB 4HK2A 3PVLA 3NY5A 3EHVA 5AZGA 1E8XA 4E71A 5E6OA 2D07B 1Q5WB 3H9DA 2MA9B 2KMAA 2O2VB 4DDGD 2K6QA 1S1QB 2ZCBA 2GBNA 3DDCB 3AULA 2K8HA 3JSVA 2O6VA 2KLGA 2EKEC 4MM3A 2HE7A 2YLMA 1MG8A 4GXBA 2NPTA 1WXAA 4IM0A 3ML9A 4XC2A 3UIOB 4W9JA 2Z59B 3H6NA 3OJ4B 3ZNHB 2JUOA 5CHVC 1VCBA 3N32A 2MWSB 2FIFA 4GDLA 1Y8RC 5CX3A 4GDKB 3RCZA 2CKHB 1YQBA 4FHKA 4GN1A 3V6CB 4OVUA 3TL5A 4KDLB 2MQJA 4II3B 4CYEA 3ZO5B 3UQBA 2C7NB 2ZCCA 2Z0EB 4IM2A 4W9CA 4B9KA 2NR2A 3ZW3A 1C1YB 4BOSC 1K8RB 2L3ZA 3GOEA 3HIZA 2UYZB 2JZZA 4EUTA 2IO1B 3PHWB 3MJWA 1SIFA 3A4SC 2N9PC 3UF8A 4F7ZA 5JH5C 3M62B 2K8BA 2QHOA 5E6PA 1YIWA 5E6NA 2XBBC 4GU2A 2KDIA 1J0GA 2WDTB 2ZEQA 3ZKJC 4ICVA 4GSWA 1TBEA 2REXA 1IP9A 2KJRA 5AZHA 1E90A 1P9DU 3IG3A 2LVQA 4G3XB 4KV2A 4WJQA 3M95A 2ZPNA 1WJ6A 2D2QA 2J7QB 2JXXA 2C60A 2IY1B 2M1MA 1UELA 3IBEA 3ZDMC 2KDBA 3BY4B 1OQYA 2BKFA 2N1WA 3GZNI 4EOYA 1KOTA 1WZ0A 4E3CA 2JVCA 1E7UA 3QIJA 3T9LA 5JHAA 2AL6A 2D3GA 2LRWA 3N30A 3QQ8B 3QAQA 2BYVE 2ZJDA 2RSUA 4HDOA 3R66C 2K1FA 3VDZA 3APFA 1H8CA 4HXDA 4DHZE 2GMIC 4WAAA 3S2AA 5CHWA 2JRIB 1WI0A 1WRDB 2KKCA 2KX3A 4K7SA 3ZUNA 4FBJB 2IO3B 2BPSA 4FLHA 4MGKE 2XK5B 3NZSA 1KJTA 2MBBB 5G2NA 4WQOB 3PPAA 2L0TA 3I3TB 3RT3B 3NS8A 3UIPB 4WWPA 2N7EA 3SHQA 2Z0DB 4CHKA 1M94A 3KUDB 2WYQA 2KOXA 2K39A 1E8YA 2HD5B 3W1YA 4BKTA 5KHQA 4PYUA 5GMVA 1WGGA 4MELA 2O6VD 5J2RA 1LM8B 4GDLB 2CS4A 2N1VA 3X0WA 1WR6E 3WALA 1Q0WB 4NQKE 2JY6A 4NPNA 1E5WA 4F1SA 4ZRJA 3A9KA 1E8WA 1ZGUB 4NAWA 3DBLI 3L17A 2G4DB 5LXHA 1WJUA 2IY0B 3KW5B 4K1RB 3TIXA 2BYFA 2LZ6A 3RUIB 1WMHA 2KHWB 3PRPB 3A1QA 2DYOA 4DBGA 2N7DA 3OAWA 5D2MB 3HM6X 3ZTCA 2KJ6A 2G45B 3O65B 3QCAA 2JT4B 4W9GA 3CF6E 4AJYB 2MBEA 4GOCA 2MCNB 3IFWB 2BWES 2FCMA 2LVOA 3HK0A 4TQ1A 3SD5A 4AJWA 1WH3A 1V86A 1HE8A 2J0MA 3BINA 4ZRKA 3TMPB 4BOZB 2RR9A 3H7SA 2MP2A 1UD7A 5D6JB 2AWTA 1X1MA 1EF1A 3K9PB 3V61A 4M8MA 1WM2A 4ANXA 2DZMA 4EZKA 1P0RA 2K8CA 2B3AA 4GGQA 3JVZX 2LD9A 3QWZB 1WZ3A 1ISNA 3L10B 4W9IA 4B95A 4G0NB 1UBIA 4KSKC 3M63B 1YD8U 4GMVA 3WAPA 1V5TA 2MX2A 4FJZA 2KTRB 2NVUI 3A9JB 3KUZA 4FA6A 2KK8A 1TGZB 2WWZA 1BT0A 4FJVB 4BKSD 2PPHA 2C9WB 2L8JA 3DBSA 3DVNU 3H7PB 2G3QB 2OOBB 2LVPA 3V60A 1EUVB 3M3JA 2CHXA 3H1UA 2JPHA 3VTWA 1NDDA 2JWZA 4LJPB 1WIAA 2M17A 3LDZE 2KFKB 4KVGB 4JQWC 4W9DA 5AEKB 1LXDA 1D3ZA 2DX5B 2I1JA 2J0JA 2NBUA 2W9NA 3ALBA 3L08A 3N3KB 2R2OA 4BKGA 3QC8B 4WJPA 3DVNV 3VVWB 3WAMA 4XX5A 4JLCA 3Q3FA 1UH6A 4PYZA 1NI2A 4N9F4 3VAWA 4XZ4A 3OJ3A 3PGEA 1RFAA 4FJYA 2V1YA 5DPRA 3DQVA 3U30A 3B0AA 4KDIC 3PLVA 1WGYA 2MRPA 3DVGY 4I6NB 2J0KA 4W9FA 2IO0B 4W9LA 2JZ3B 2HTHA 3ENEA 4IM3A 4ZDVA 1QZEA 4MJSB 3VUYA 1WXMA 4DHZB 1EF5A 1SGHA 3A1QB 2JRHA 4A3OA 2DENB 2IBIB 2MLBA 2C7HA 3VTVA 1PQSA 4GIVA 4J6IA 2LWPA 3U7DA 3LJ3A 1JRUA 3QARA 2KWCA 4EZLA 3PV1A 1XQQA 1GNUA 2ZPYA 4NJ6A 4X57B 3W1SA 5L95C 3RZWC 1WR1A 2LGXA 4YL8A 2KX0A 2AL3A 2LRUA 2O2VA 3ZLZA 3DPDA 4TKNA 1GG3A 3PRMB 4DXAB 2C5LC 1UZXB 3MTNB 4DWFA 2LGYA 2BYEA 2MP2B 1Z2MA 2DYBA 2M4NA 3ZNZB 2L05A 3QA8A 3IVFA 4MGYE 5CTRC 2CHWA 3JYUA 3WANA 2CU1A 2R2QA 3JSVB 1I42A 2O6VB 3A4RA 2RPQA 4G11A 2IYDB 3VUWA 2L76A 1V49A 4NNJB 4WJOA 2K6DB 1KLVA 3CSTA 4JL9A 4LCDE 4RMAA 2NPTB 1G6JA 2M8SA 3CMMB 1WE6A 4TUUA 3ECIA 4I6PA 2WX0A 4E74A 3VFKA 4TQ0A 3SU8X 4GDKA 4EKUA 2IO2B 1WX9A 3ZDTA 2LI5A 1YJ1A 1V81A 3RZFA 3QJZA 3RULA 1J8CA 2RD0A 2XEWA 3VHTC 5C1ZA 2N9EB 4JGHB 2DAFA 4IG7B 4ASWC 3KYCD 3TJPA 2C7MB 5IA7A 1VD2A 1S3SG 5LXIB 2MBHA 2KLCA 2KD0A 4FADA 3NOBA 1V6EA 4AP4C 4NQLB 3VH4B 2KWUB 1EO6A 4EFOA 2ASQA 4ZRIA 1WJ4A 1WFYA 4ICUA 4NJ7A 1YX6B 2LXCA 2ZNVC 4PS3A 3T8MA 3UQAA 4IWQA 4JIOU 3VUXA 4HDQA 4HCNB 4A3PA 4M8NA 1H4RA 3V6EB 3PLUA 2IZVB 4CO7A 3ZRFA 2PEAA 2AYOB 1WXVA 2DAJA 2GBMA 3C0RB 4ZYNA 1TTNA 4KZ0A 1WYWB 3KUCB 3L16A 5G55A 3NZUA 2MBOA 3L13A 2KTFA 2CHZA 1WX7A 1AARA 2BGFA 2HJ8A 4URKA 1GUAB 4MDKE 2ZVNA 5BO4B 1OTRB 4HLEA 1WM3A 2LASA 2KVRA 4LDTB 5HKHA 4HVBA 2PE9A 4KIKA 4MSQB 2AEHA 2GOWA 3SDLC 3QX1A 3V62A 1R4MI 2FUHB 1WGDA 1V9JA 2I1KA 5C23A 2KN5A 4W9HA 5DCNA 1P98A 2DHZA 4LDTD 2NS5A 4A20A 1IPGA 2ZZPB 1WX8A 4WWOA 2RGFA 3KVFB 4HJKA 1RAXA 3DBRI 1Z5SB 2GBKA 1WE7A 2XK5A 1U4AA 4FN2A 1WGRA 4AOFA 2PE6B 2KXJA 2V4LA 3ML8A 4AWJA 3DOWA 2KNBA 4EEWA 3VTUA 3AI5A 4ANVA 3EC8A 3UGBB 2LJ5A 2V3SA 3R3MA 4MGIE 1TZ1A 3RYTA 4EZJA 1XT9B 2KC1A 1UBQA 4DHJB 1GC6A 2LXAA 5J18A 3X23A 3ONSA 3DCGA 1V2YA 1J19A 2FCSA 1NBFC 2JF5A 3WIMA 4DK5A 4HPLB 2OJRA 3PSEB 3AU4A 4BFRA 2K25A 2KO3A 2YVCA 4DHJD 3D32A 2CR5A 2DYMA 5JHBA 4IC7B 4KZCA 3WAOA 2FNJB 4MGZE 4MH0E 4LJOB 1F9JA 1XD3B 3MHSD 2KQSA 1WY8A 3A9KB 2FAZA 2ZNVB 4M0WB 4B6WA 2MW5A 4NAWB 1OEYJ 1LQBA 2WX1A 2FCQA 3IHPC 1A5RA 1FXTB 2L0FA 3QK0A 4IWOA 4TV3A 4ANWA 1V5OA 1WMHB 3P2BA 3EFUA 2NCNA 2BF8B 3L0WB 2N9XA 3JW0X 4HWIB 3KYDD 3A33B 3VH3B 1KM7A 5LLIA 2UWQA 2DZKA 3TBLD 1RRBA 4WJNA 2D11A 5AZFA 4BBNC 3NHEB 4IWPA 2ZVOA 3WA0A 5TR5A 1L2NA 3PZDA 3DBHI 5DPWA 3DVGX 2D10A 1WJNA 3OLMD 2DZJA 3W1SC 5DPSA 2KMCA 1L7YA 1V80A 1ZKHA 2KDEB 4W9KA 3R7QA 2BWFA 3KH0A 2DZIA 4HCPB 4BVUC 1LFDA 3TCAA 1T0YA 4KIKB 3CSFA 2KC2A 5J17A 1GJZA 1ZW7A 1WXSA 4PS8A 4RM8A 4GB9A 4RM9A 5JZEB 3K9OB 2KZRA 3PTFC 2GBJA 2KANA 3HHMA 1GC7A 4BKSA 5L83A 3RD2A 2LGDA 3EECA 4AUQC 4I6LB 4IUMB 4NY0A 5IAAC 5KHOA 3U8ZA 2KTRA 1Q1OA 2FCNA 3A9JA 4FHJA 1CMXB 1OGWA 4F8CB 4K81A 4MEMA 2PJHA 5FR6A 1E7VA 2L00B 4BBNF 3AXCA 3ZNID 4W9EA 4II2B 3H7PA 3PRZA 3R7RA 2MBQA 5DPTA 1WGHA 2L7RA 4G50A 3APDA 4P7IA 2NBVB 3Q3JA 3VQIA 4FULA 2KWVB 2VRRB 4K7UA 3PHXB 3PREA 1OEYA 4KSLC 2GBRA 2KFKA 2MSED 4DDID 2EMTA 2NBWB 4MSMB 3ZTDA 3B08A 5D94A 5CHFA 3UINB 3ZNGC 1YX5B 3B1LX 5EDSA 2Y5BB 3VXWA 2FIDA 1IYFA 2N4FA 2KDFB 3QHTA 4ANUA 3HM3A 2KFJA 1RLFA 5D7GA 2M0XA 3AU5A 2A5UA 3APCA 1SE9A 1P1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4Z A;  2EMS A;  2G4S A;  2LUE A;  4MJS A;  3ZIM A;  4PS7 A;  3L54 A;  4IW0 A;  1WF9 A;  3ZRC A;  4WWN A;  4K7W A;  3PT2 B;  2KQ7 A;  3PS6 A;  1P3Q U;  4OVV A;  1R4N I;  1E8Z A;  3ZVV A;  1I35 A;  4HPM B;  2BKR B;  1C3T A;  1UGM A;  2KJH B;  4HK2 A;  3PVL A;  3NY5 A;  3EHV A;  5AZG A;  1E8X A;  4E71 A;  5E6O A;  2D07 B;  1Q5W B;  3H9D A;  2MA9 B;  2KMA A;  2O2V B;  4DDG D;  2K6Q A;  1S1Q B;  2ZCB A;  2GBN A;  3DDC B;  3AUL A;  2K8H A;  3JSV A;  2O6V A;  2KLG A;  2EKE C;  4MM3 A;  2HE7 A;  2YLM A;  1MG8 A;  4GXB A;  2NPT A;  1WXA A;  4IM0 A;  3ML9 A;  4XC2 A;  3UIO B;  4W9J A;  2Z59 B;  3H6N A;  3OJ4 B;  3ZNH B;  2JUO A;  5CHV C;  1VCB A;  3N32 A;  2MWS B;  2FIF A;  4GDL A;  1Y8R C;  5CX3 A;  4GDK B;  3RCZ A;  2CKH B;  1YQB A;  4FHK A;  4GN1 A;  3V6C B;  4OVU A;  3TL5 A;  4KDL B;  2MQJ A;  4II3 B;  4CYE A;  3ZO5 B;  3UQB A;  2C7N B;  2ZCC A;  2Z0E B;  4IM2 A;  4W9C A;  4B9K A;  2NR2 A;  3ZW3 A;  1C1Y B;  4BOS C;  1K8R B;  2L3Z A;  3GOE A;  3HIZ A;  2UYZ B;  2JZZ A;  4EUT A;  2IO1 B;  3PHW B;  3MJW A;  1SIF A;  3A4S C;  2N9P C;  3UF8 A;  4F7Z A;  5JH5 C;  3M62 B;  2K8B A;  2QHO A;  5E6P A;  1YIW A;  5E6N A;  2XBB C;  4GU2 A;  2KDI A;  1J0G A;  2WDT B;  2ZEQ A;  3ZKJ C;  4ICV A;  4GSW A;  1TBE A;  2REX A;  1IP9 A;  2KJR A;  5AZH A;  1E90 A;  1P9D U;  3IG3 A;  2LVQ A;  4G3X B;  4KV2 A;  4WJQ A;  3M95 A;  2ZPN A;  1WJ6 A;  2D2Q A;  2J7Q B;  2JXX A;  2C60 A;  2IY1 B;  2M1M A;  1UEL A;  3IBE A;  3ZDM C;  2KDB A;  3BY4 B;  1OQY A;  2BKF A;  2N1W A;  3GZN I;  4EOY A;  1KOT A;  1WZ0 A;  4E3C A;  2JVC A;  1E7U A;  3QIJ A;  3T9L A;  5JHA A;  2AL6 A;  2D3G A;  2LRW A;  3N30 A;  3QQ8 B;  3QAQ A;  2BYV E;  2ZJD A;  2RSU A;  4HDO A;  3R66 C;  2K1F A;  3VDZ A;  3APF A;  1H8C A;  4HXD A;  4DHZ E;  2GMI C;  4WAA A;  3S2A A;  5CHW A;  2JRI B;  1WI0 A;  1WRD B;  2KKC A;  2KX3 A;  4K7S A;  3ZUN A;  4FBJ B;  2IO3 B;  2BPS A;  4FLH A;  4MGK E;  2XK5 B;  3NZS A;  1KJT A;  2MBB B;  5G2N A;  4WQO B;  3PPA A;  2L0T A;  3I3T B;  3RT3 B;  3NS8 A;  3UIP B;  4WWP A;  2N7E A;  3SHQ A;  2Z0D B;  4CHK A;  1M94 A;  3KUD B;  2WYQ A;  2KOX A;  2K39 A;  1E8Y A;  2HD5 B;  3W1Y A;  4BKT A;  5KHQ A;  4PYU A;  5GMV A;  1WGG A;  4MEL A;  2O6V D;  5J2R A;  1LM8 B;  4GDL B;  2CS4 A;  2N1V A;  3X0W A;  1WR6 E;  3WAL A;  1Q0W B;  4NQK E;  2JY6 A;  4NPN A;  1E5W A;  4F1S A;  4ZRJ A;  3A9K A;  1E8W A;  1ZGU B;  4NAW A;  3DBL I;  3L17 A;  2G4D B;  5LXH A;  1WJU A;  2IY0 B;  3KW5 B;  4K1R B;  3TIX A;  2BYF A;  2LZ6 A;  3RUI B;  1WMH A;  2KHW B;  3PRP B;  3A1Q A;  2DYO A;  4DBG A;  2N7D A;  3OAW A;  5D2M B;  3HM6 X;  3ZTC A;  2KJ6 A;  2G45 B;  3O65 B;  3QCA A;  2JT4 B;  4W9G A;  3CF6 E;  4AJY B;  2MBE A;  4GOC A;  2MCN B;  3IFW B;  2BWE S;  2FCM A;  2LVO A;  3HK0 A;  4TQ1 A;  3SD5 A;  4AJW A;  1WH3 A;  1V86 A;  1HE8 A;  2J0M A;  3BIN A;  4ZRK A;  3TMP B;  4BOZ B;  2RR9 A;  3H7S A;  2MP2 A;  1UD7 A;  5D6J B;  2AWT A;  1X1M A;  1EF1 A;  3K9P B;  3V61 A;  4M8M A;  1WM2 A;  4ANX A;  2DZM A;  4EZK A;  1P0R A;  2K8C A;  2B3A A;  4GGQ A;  3JVZ X;  2LD9 A;  3QWZ B;  1WZ3 A;  1ISN A;  3L10 B;  4W9I A;  4B95 A;  4G0N B;  1UBI A;  4KSK C;  3M63 B;  1YD8 U;  4GMV A;  3WAP A;  1V5T A;  2MX2 A;  4FJZ A;  2KTR B;  2NVU I;  3A9J B;  3KUZ A;  4FA6 A;  2KK8 A;  1TGZ B;  2WWZ A;  1BT0 A;  4FJV B;  4BKS D;  2PPH A;  2C9W B;  2L8J A;  3DBS A;  3DVN U;  3H7P B;  2G3Q B;  2OOB B;  2LVP A;  3V60 A;  1EUV B;  3M3J A;  2CHX A;  3H1U A;  2JPH A;  3VTW A;  1NDD A;  2JWZ A;  4LJP B;  1WIA A;  2M17 A;  3LDZ E;  2KFK B;  4KVG B;  4JQW C;  4W9D A;  5AEK B;  1LXD A;  1D3Z A;  2DX5 B;  2I1J A;  2J0J A;  2NBU A;  2W9N A;  3ALB A;  3L08 A;  3N3K B;  2R2O A;  4BKG A;  3QC8 B;  4WJP A;  3DVN V;  3VVW B;  3WAM A;  4XX5 A;  4JLC A;  3Q3F A;  1UH6 A;  4PYZ A;  1NI2 A;  4N9F 4;  3VAW A;  4XZ4 A;  3OJ3 A;  3PGE A;  1RFA A;  4FJY A;  2V1Y A;  5DPR A;  3DQV A;  3U30 A;  3B0A A;  4KDI C;  3PLV A;  1WGY A;  2MRP A;  3DVG Y;  4I6N B;  2J0K A;  4W9F A;  2IO0 B;  4W9L A;  2JZ3 B;  2HTH A;  3ENE A;  4IM3 A;  4ZDV A;  1QZE A;  4MJS B;  3VUY A;  1WXM A;  4DHZ B;  1EF5 A;  1SGH A;  3A1Q B;  2JRH A;  4A3O A;  2DEN B;  2IBI B;  2MLB A;  2C7H A;  3VTV A;  1PQS A;  4GIV A;  4J6I A;  2LWP A;  3U7D A;  3LJ3 A;  1JRU A;  3QAR A;  2KWC A;  4EZL A;  3PV1 A;  1XQQ A;  1GNU A;  2ZPY A;  4NJ6 A;  4X57 B;  3W1S A;  5L95 C;  3RZW C;  1WR1 A;  2LGX A;  4YL8 A;  2KX0 A;  2AL3 A;  2LRU A;  2O2V A;  3ZLZ A;  3DPD A;  4TKN A;  1GG3 A;  3PRM B;  4DXA B;  2C5L C;  1UZX B;  3MTN B;  4DWF A;  2LGY A;  2BYE A;  2MP2 B;  1Z2M A;  2DYB A;  2M4N A;  3ZNZ B;  2L05 A;  3QA8 A;  3IVF A;  4MGY E;  5CTR C;  2CHW A;  3JYU A;  3WAN A;  2CU1 A;  2R2Q A;  3JSV B;  1I42 A;  2O6V B;  3A4R A;  2RPQ A;  4G11 A;  2IYD B;  3VUW A;  2L76 A;  1V49 A;  4NNJ B;  4WJO A;  2K6D B;  1KLV A;  3CST A;  4JL9 A;  4LCD E;  4RMA A;  2NPT B;  1G6J A;  2M8S A;  3CMM B;  1WE6 A;  4TUU A;  3ECI A;  4I6P A;  2WX0 A;  4E74 A;  3VFK A;  4TQ0 A;  3SU8 X;  4GDK A;  4EKU A;  2IO2 B;  1WX9 A;  3ZDT A;  2LI5 A;  1YJ1 A;  1V81 A;  3RZF A;  3QJZ A;  3RUL A;  1J8C A;  2RD0 A;  2XEW A;  3VHT C;  5C1Z A;  2N9E B;  4JGH B;  2DAF A;  4IG7 B;  4ASW C;  3KYC D;  3TJP A;  2C7M B;  5IA7 A;  1VD2 A;  1S3S G;  5LXI B;  2MBH A;  2KLC A;  2KD0 A;  4FAD A;  3NOB A;  1V6E A;  4AP4 C;  4NQL B;  3VH4 B;  2KWU B;  1EO6 A;  4EFO A;  2ASQ A;  4ZRI A;  1WJ4 A;  1WFY A;  4ICU A;  4NJ7 A;  1YX6 B;  2LXC A;  2ZNV C;  4PS3 A;  3T8M A;  3UQA A;  4IWQ A;  4JIO U;  3VUX A;  4HDQ A;  4HCN B;  4A3P A;  4M8N A;  1H4R A;  3V6E B;  3PLU A;  2IZV B;  4CO7 A;  3ZRF A;  2PEA A;  2AYO B;  1WXV A;  2DAJ A;  2GBM A;  3C0R B;  4ZYN A;  1TTN A;  4KZ0 A;  1WYW B;  3KUC B;  3L16 A;  5G55 A;  3NZU A;  2MBO A;  3L13 A;  2KTF A;  2CHZ A;  1WX7 A;  1AAR A;  2BGF A;  2HJ8 A;  4URK A;  1GUA B;  4MDK E;  2ZVN A;  5BO4 B;  1OTR B;  4HLE A;  1WM3 A;  2LAS A;  2KVR A;  4LDT B;  5HKH A;  4HVB A;  2PE9 A;  4KIK A;  4MSQ B;  2AEH A;  2GOW A;  3SDL C;  3QX1 A;  3V62 A;  1R4M I;  2FUH B;  1WGD A;  1V9J A;  2I1K A;  5C23 A;  2KN5 A;  4W9H A;  5DCN A;  1P98 A;  2DHZ A;  4LDT D;  2NS5 A;  4A20 A;  1IPG A;  2ZZP B;  1WX8 A;  4WWO A;  2RGF A;  3KVF B;  4HJK A;  1RAX A;  3DBR I;  1Z5S B;  2GBK A;  1WE7 A;  2XK5 A;  1U4A A;  4FN2 A;  1WGR A;  4AOF A;  2PE6 B;  2KXJ A;  2V4L A;  3ML8 A;  4AWJ A;  3DOW A;  2KNB A;  4EEW A;  3VTU A;  3AI5 A;  4ANV A;  3EC8 A;  3UGB B;  2LJ5 A;  2V3S A;  3R3M A;  4MGI E;  1TZ1 A;  3RYT A;  4EZJ A;  1XT9 B;  2KC1 A;  1UBQ A;  4DHJ B;  1GC6 A;  2LXA A;  5J18 A;  3X23 A;  3ONS A;  3DCG A;  1V2Y A;  1J19 A;  2FCS A;  1NBF C;  2JF5 A;  3WIM A;  4DK5 A;  4HPL B;  2OJR A;  3PSE B;  3AU4 A;  4BFR A;  2K25 A;  2KO3 A;  2YVC A;  4DHJ D;  3D32 A;  2CR5 A;  2DYM A;  5JHB A;  4IC7 B;  4KZC A;  3WAO A;  2FNJ B;  4MGZ E;  4MH0 E;  4LJO B;  1F9J A;  1XD3 B;  3MHS D;  2KQS A;  1WY8 A;  3A9K B;  2FAZ A;  2ZNV B;  4M0W B;  4B6W A;  2MW5 A;  4NAW B;  1OEY J;  1LQB A;  2WX1 A;  2FCQ A;  3IHP C;  1A5R A;  1FXT B;  2L0F A;  3QK0 A;  4IWO A;  4TV3 A;  4ANW A;  1V5O A;  1WMH B;  3P2B A;  3EFU A;  2NCN A;  2BF8 B;  3L0W B;  2N9X A;  3JW0 X;  4HWI B;  3KYD D;  3A33 B;  3VH3 B;  1KM7 A;  5LLI A;  2UWQ A;  2DZK A;  3TBL D;  1RRB A;  4WJN A;  2D11 A;  5AZF A;  4BBN C;  3NHE B;  4IWP A;  2ZVO A;  3WA0 A;  5TR5 A;  1L2N A;  3PZD A;  3DBH I;  5DPW A;  3DVG X;  2D10 A;  1WJN A;  3OLM D;  2DZJ A;  3W1S C;  5DPS A;  2KMC A;  1L7Y A;  1V80 A;  1ZKH A;  2KDE B;  4W9K A;  3R7Q A;  2BWF A;  3KH0 A;  2DZI A;  4HCP B;  4BVU C;  1LFD A;  3TCA A;  1T0Y A;  4KIK B;  3CSF A;  2KC2 A;  5J17 A;  1GJZ A;  1ZW7 A;  1WXS A;  4PS8 A;  4RM8 A;  4GB9 A;  4RM9 A;  5JZE B;  3K9O B;  2KZR A;  3PTF C;  2GBJ A;  2KAN A;  3HHM A;  1GC7 A;  4BKS A;  5L83 A;  3RD2 A;  2LGD A;  3EEC A;  4AUQ C;  4I6L B;  4IUM B;  4NY0 A;  5IAA C;  5KHO A;  3U8Z A;  2KTR A;  1Q1O A;  2FCN A;  3A9J A;  4FHJ A;  1CMX B;  1OGW A;  4F8C B;  4K81 A;  4MEM A;  2PJH A;  5FR6 A;  1E7V A;  2L00 B;  4BBN F;  3AXC A;  3ZNI D;  4W9E A;  4II2 B;  3H7P A;  3PRZ A;  3R7R A;  2MBQ A;  5DPT A;  1WGH A;  2L7R A;  4G50 A;  3APD A;  4P7I A;  2NBV B;  3Q3J A;  3VQI A;  4FUL A;  2KWV B;  2VRR B;  4K7U A;  3PHX B;  3PRE A;  1OEY A;  4KSL C;  2GBR A;  2KFK A;  2MSE D;  4DDI D;  2EMT A;  2NBW B;  4MSM B;  3ZTD A;  3B08 A;  5D94 A;  5CHF A;  3UIN B;  3ZNG C;  1YX5 B;  3B1L X;  5EDS A;  2Y5B B;  3VXW A;  2FID A;  1IYF A;  2N4F A;  2KDF B;  3QHT A;  4ANU A;  3HM3 A;  2KFJ A;  1RLF A;  5D7G A;  2M0X A;  3AU5 A;  2A5U A;  3APC A;  1SE9 A;  1P1A A; 
#chains in the Genus database with same CATH topology
 2EMS A;  4MJS A;  3L54 A;  3N1Z C;  1FXI A;  4IW0 A;  2E6X A;  4K7W A;  3PT2 B;  3L4P A;  3Q8C A;  4OVV A;  4RCO A;  4M02 A;  3ZVV A;  2KJH B;  2LEK A;  1XEE A;  5AZG A;  1F0Z A;  4E71 A;  3PO0 A;  1DOX A;  2GBN A;  2RDB C;  3JSV A;  2O6V A;  2EKE C;  3HUI A;  2K22 A;  3BII D;  1NYQ A;  2IDY A;  1YQ3 B;  1I4X A;  1R4N B;  3N1X C;  4YSY B;  4JE3 B;  2JUO A;  3N32 A;  2MWS B;  4XYC A;  5CX3 A;  3AH7 A;  3P42 A;  4OVU A;  4KDL B;  4II3 B;  2Z0E B;  2BS4 B;  1C1Y B;  1K8R B;  1TZO A;  3RNB C;  2IO1 B;  4K3B A;  1NYR A;  3UF8 A;  1JCK B;  4F7Z A;  2WLB A;  2K8B A;  2PVG C;  1KLG D;  4GU2 A;  4HJG E;  1V1O A;  4WAF A;  1TBE A;  1IP9 A;  1E90 A;  3IG3 A;  3M95 A;  4ARI A;  2M1M A;  3EA6 A;  1UEL A;  2KDB A;  2BKF A;  3NVV A;  4ZHP A;  2Y3A A;  2R61 A;  2JVC A;  1E7U A;  3AE8 B;  5JHA A;  1MHH E;  3VR9 B;  1SJE D;  2BYV E;  4HDO A;  2QDF A;  2JRI B;  4FBJ B;  1WRD B;  2H88 B;  2IO3 B;  3I57 A;  3I3T B;  4ZRP A;  3UIP B;  1VLB A;  2MJE A;  3ZJT A;  2KOX A;  2HD5 B;  3U2S C;  4BKT A;  2IJ0 A;  4MEL A;  4JWU C;  5J2R A;  2CS4 A;  2N1V A;  1WYG A;  2D3B A;  4NPN A;  4F1S A;  3A9K A;  1ZGU B;  3DBL I;  1N63 A;  4K1R B;  3TIX A;  2LZ6 A;  2WHI A;  2DYO A;  2N7D A;  1XCT L;  3ZTC A;  2G45 B;  3QCA A;  2JT4 B;  1QOF A;  4AJY B;  2MBE A;  4GOC A;  2J53 A;  4AJW A;  1V86 A;  3TMP B;  4WQM A;  5D6J B;  1LO5 D;  3DHH C;  1CZP A;  2AWT A;  2AQ2 B;  2IGG A;  4M8M A;  1WM2 A;  4EZK A;  4GGQ A;  4LK0 M;  1ISN A;  1V5T A;  2NVU I;  2V3P A;  1NVI D;  3NVZ A;  1RYJ A;  2IGD A;  1BT0 A;  4FJV B;  4BKS D;  3DBS A;  3DVN U;  2G3Q B;  3NG0 A;  3B2F A;  1PFD A;  3H1U A;  4OW0 A;  4L1B A;  3VTW A;  4LJP B;  3LDZ E;  2M17 A;  2KFK B;  5FKA C;  5AEK B;  1TY2 A;  3L08 A;  4DXG A;  4WJP A;  3PZ8 A;  3VVW B;  4RNA A;  4M00 A;  4JLC A;  4XX5 A;  1NI2 A;  3KQ4 A;  4N9F 4;  3RPF C;  4FJY A;  1L0Y B;  5DPR A;  3DQV A;  3ETR A;  3TEY A;  2MRP A;  3DVG Y;  2KYW A;  3FAH A;  4W9L A;  2HTH A;  4IM3 A;  4ZDV A;  1IGC A;  2ACZ B;  1XO3 A;  2MLB A;  3VTV A;  1FFU A;  2LWP A;  3QAR A;  3PV1 A;  5L95 C;  4NJ6 A;  4YL8 A;  3ZGZ A;  2BB5 A;  4RF0 A;  4ZHO A;  3ZLZ A;  3DPD A;  1GG3 A;  3PRM B;  4DXA B;  2C5L C;  3CWI A;  1HEZ E;  4DWF A;  2LGY A;  2L05 A;  4MGY E;  2CU1 A;  1I42 A;  3A4R A;  3NUH B;  2L76 A;  1V49 A;  3VUW A;  1KLV A;  4JL9 A;  4A55 A;  3MFG A;  2NPT B;  1EU4 A;  1N62 A;  2M8S A;  3CMM B;  1EM7 A;  4TUU A;  3ECI A;  4AQ7 A;  3AN1 A;  4E74 A;  1FO4 A;  1KTK A;  3SU8 X;  1I4P A;  1WX9 A;  2LI5 A;  3BVZ A;  4XDD A;  3RUL A;  2N9E B;  5I4D A;  3KYC D;  3ZJV A;  2MBH A;  2RPV A;  2KD0 A;  1V1P B;  3NOB A;  4S0R A;  1QQR A;  4ZRI A;  4P1B C;  3VUX A;  5G5H A;  4YSX B;  1JW9 D;  1DYQ A;  2JYT A;  1ET9 A;  4CO7 A;  4XWT A;  1TTN A;  5E6J A;  3L16 A;  3NZU A;  4A90 A;  1ZDV A;  1YJJ A;  4XGA B;  2JZP A;  1GUA B;  4MDK E;  3GE3 C;  1OTR B;  2LUM A;  2KVR A;  4MSQ B;  2GOW A;  4JPS A;  3QX1 A;  1GOZ A;  1WGD A;  1V9J A;  2KN5 A;  1P98 A;  4JWS C;  4WWO A;  4OZC A;  1RAX A;  1Z5S B;  1VZ8 A;  2GBK A;  1HZ6 A;  2PE6 B;  2V4L A;  2KNB A;  1AW7 A;  3UGB B;  2V3S A;  1VJK A;  4MGI E;  5HHD G;  5J18 A;  1T6B X;  3HVD A;  4YT0 B;  1V2Y A;  1NBF C;  1HXY D;  3SEB A;  3ZXR A;  1FNW A;  3DBR B;  2CR5 A;  5JHB A;  1K51 A;  4MGZ E;  1XD3 B;  1WY8 A;  2FAZ A;  1UF0 A;  1IGD A;  2L0F A;  2ON8 A;  4TV3 A;  3EFU A;  2GLS A;  3L0W B;  2QCZ A;  4HRS A;  1A70 A;  3AEC B;  5IP4 D;  1KM7 A;  2WXJ A;  1RRB A;  4WJN A;  1BXT A;  1I7H A;  3R2I A;  3MP9 A;  5LNK 1;  3MC9 A;  1CJE A;  2D10 A;  3IXS A;  1L7Y A;  2PIA A;  2DZI A;  2LGI A;  3CSF A;  4RM9 A;  3ZQ4 A;  1GC7 A;  4BKS A;  5H8Y E;  3EEC A;  5IAA C;  4NY0 A;  3RNA C;  5FR6 A;  1E7V A;  4B0E A;  1QF6 A;  2MBQ A;  4P7I A;  1OQQ A;  3Q3J A;  2VRR B;  3PRE A;  2KFK A;  2WDR B;  3E9S A;  3Q3M C;  4A6Q A;  4DDI D;  2EMT A;  3ZNG C;  1YX5 B;  2WXQ A;  3BVM A;  2N4F A;  1T5X D;  3BK1 A;  4ANU A;  2KFJ A;  2M0X A;  1JWS D;  1XLP A;  1SE9 A;  3ZIM A;  2LUE A;  1BML C;  5IKC M;  3PS6 A;  1P3Q U;  4HPM B;  2BKR B;  4HK2 A;  1L0V B;  2V9H A;  3PVL A;  3NY5 A;  3EHV A;  1E8X A;  3ZJU A;  2D07 B;  3H9D A;  3O13 A;  2O2V B;  3RNF C;  2G9H D;  4MM3 A;  3TEW A;  2YLM A;  3Q8F A;  1RWS A;  1MG8 A;  2NPT A;  4MAC A;  3UIO B;  4L2Y A;  2LGS A;  1UWM A;  3ZNH B;  3MHZ A;  4GDL A;  3AE1 B;  3RCZ A;  3V6C B;  2MQJ A;  3ZO5 B;  2C7N B;  4B9K A;  2NR2 A;  4RGO S;  1V1P A;  1MHX A;  2FE8 A;  2L3Z A;  3HIZ A;  2W3S A;  4EUT A;  2AQ1 B;  3PHW B;  3A4S C;  2QHO A;  5E6P A;  1YIW A;  5E6N A;  2XBB C;  1BUI C;  2WDT B;  2ZEQ A;  3ZKJ C;  4ICV A;  1D5M C;  5AZH A;  1SJH D;  1P9D U;  4WJQ A;  1UWX A;  2C60 A;  2IY1 B;  2W3R A;  1C4A A;  1L0X B;  2WXR A;  1L6V A;  1KOT A;  1WZ0 A;  4E3C A;  2JYE A;  3QIJ A;  3T9L A;  1SIJ A;  2AL6 A;  3N30 A;  2W82 A;  5BYS A;  3QAQ A;  2K1F A;  3APF A;  3AM9 A;  3S2A A;  5CHW A;  2KX3 A;  1WI0 A;  2KKC A;  2M56 B;  3ZUN A;  4MGK E;  3DBH B;  2L0T A;  3RT3 B;  4WWP A;  1JWA D;  4L23 A;  1T0S C;  4B0M A;  4CHK A;  3BK2 A;  3WCQ A;  1NI3 A;  5KHQ A;  1WGG A;  5AUI A;  2WGS A;  4UDU C;  3X0W A;  1MG4 A;  1FRD A;  1Q0W B;  3FKY A;  2WS3 B;  1JWU D;  2BYF A;  4NJC A;  3RUI B;  3GE8 C;  3V3X A;  2KHW B;  1KFY B;  2N7J A;  2QEJ C;  2KJ6 A;  1VZ6 A;  3O65 B;  1HQR D;  1R7S A;  1JWB D;  2L83 A;  3SR6 A;  2I2Y A;  4O1N A;  2FCM A;  3HK0 A;  1WH3 A;  3EUB 2;  3DBL B;  1ZDX A;  2KAJ A;  3AE7 B;  3BIN A;  1SSN A;  2MP2 A;  1UD7 A;  1C76 A;  1RM6 C;  1X1M A;  2CU3 A;  3V61 A;  1P0R A;  2K8C A;  3BYY B;  2PKO A;  2BTE A;  3QWZ B;  1WZ3 A;  3KWL A;  4G0N B;  1JAL A;  1V8C A;  1YD8 U;  3NZ3 A;  1FIQ A;  2I38 A;  2KTR B;  4FJZ A;  2KK8 A;  1TGZ B;  2C9W B;  4S17 A;  2L8J A;  4P1C C;  3V60 A;  3Q3N C;  3OWE B;  4WH4 A;  2HJ1 A;  4TMA B;  5BYQ A;  1MVK A;  3AE2 B;  1WIA A;  2KT7 A;  3AE3 B;  2NBU A;  4KGS A;  4BKG A;  3QC8 B;  3Q3F A;  4PYZ A;  3VAW A;  3OJ3 A;  1RFA A;  2XNA C;  2V1Y A;  3U30 A;  4IOI E;  2WXG A;  3B0A A;  4I6N B;  2IO0 B;  3ENE A;  1E10 A;  3VUY A;  1VR9 A;  3A1Q B;  1TKG A;  1VZ7 A;  3Q14 C;  3LJ3 A;  1JRU A;  1XQQ A;  1GNU A;  4X57 B;  2L52 A;  3I9V 1;  1FMA D;  1WR1 A;  2LGX A;  2KX0 A;  2WDQ B;  2WXM A;  2AL3 A;  2O2V A;  1QIL A;  3IT6 B;  1UZX B;  3MTN B;  2BYE A;  1Z2M A;  2M4N A;  3IVF A;  4C80 A;  3BWU D;  2QJL A;  1ZUD 2;  2PMV A;  3TEZ A;  3P4S B;  3GZN B;  2UU7 A;  2K6D B;  1I4R A;  1KH0 A;  3HRD D;  1L4D B;  1N5W A;  4RGT A;  1WE6 A;  3AV8 A;  4TQ0 A;  2PW9 A;  4EKU A;  3ZDT A;  3RZF A;  2SEB D;  2RD0 A;  4N6E B;  3VHT C;  4JGH B;  4IG7 B;  3TSS A;  4ASW C;  2C7M B;  1S3S G;  1XCQ L;  4ICU A;  1WGK A;  2D3A A;  1QOG A;  4A3P A;  4NAM A;  1H4R A;  3Q3O C;  3V6E B;  3PLU A;  2J42 A;  3ZRF A;  2MJD A;  4C7Z A;  3C0R B;  4KZ0 A;  1WYW B;  3KUC B;  3DHI C;  4C00 A;  1WX7 A;  1AAR A;  2KAC A;  3T3N A;  5BO4 B;  4P6V F;  3U52 E;  2LAS A;  1UGJ A;  5HKH A;  4HVB A;  2PE9 A;  4KIK A;  5IO9 A;  1FFV A;  2DNF A;  1XLQ A;  2DHZ A;  2EEL A;  2NS5 A;  2LJI A;  2MHJ A;  1WE7 A;  1K53 A;  3ML8 A;  2LJ5 A;  1TZ1 A;  2M19 A;  5BMI A;  1UBQ A;  4DHJ B;  3DCG A;  1J19 A;  4KGR A;  4DK5 A;  2BT6 A;  4HPL B;  4ZRQ A;  3PSE B;  3AU4 A;  4BFR A;  2K25 A;  2KO3 A;  4DHJ D;  2VH2 A;  4KZC A;  2V0G A;  4MH0 E;  1DOI A;  1F52 A;  1TJE A;  4M0W B;  4B6W A;  2MW5 A;  4NAW B;  1LQB A;  2WX1 A;  2FCQ A;  3IHP C;  1KF6 B;  1FXT B;  3U4E G;  1V5O A;  1SE2 A;  1V97 A;  2WXF A;  2NCN A;  5FR3 A;  3JW0 X;  3VH3 B;  3Q8E A;  5LLI A;  2UWQ A;  3TBL D;  1GB4 A;  3NHE B;  1L2N A;  5DPW A;  3N9Y C;  3W1S C;  2GI9 A;  3R8B A;  1N61 A;  4W9K A;  3R7Q A;  3KH0 A;  4HCP B;  1LFD A;  2FUG 1;  1T0Y A;  3TCA A;  4PS8 A;  5JZE B;  2RDH A;  4RH6 A;  3VR8 B;  1XF5 L;  3PTF C;  2KAN A;  2OJW A;  1HTO A;  3RD2 A;  4AUQ C;  1B9R A;  4I6L B;  5JXV A;  2INC C;  2KTR A;  2FCN A;  1CMX B;  4F8C B;  1PGA A;  2L00 B;  1N5X A;  3Q6B A;  3R7R A;  5DPT A;  1WGH A;  2L7R A;  1FD6 A;  3APD A;  1DGJ A;  2KWV B;  4K7U A;  1NEK B;  1OEY A;  4KSL C;  1XLO A;  4YTM B;  2YEP F;  5D94 A;  5CHF A;  2JU6 X;  5EDS A;  3SFE B;  3VXW A;  2FID A;  1EU3 A;  3HM3 A;  1JWM D;  4BZA A;  3APC A;  1P1A A;  2INP E;  3ZRC A;  1XLN A;  4HPP A;  1SB3 C;  4NZL B;  2KQ7 A;  3W5U B;  1C3T A;  1UGM A;  1PGX A;  5E6O A;  1Q5W B;  2K6Q A;  1S1Q B;  3RNE C;  2BS3 B;  4A9A A;  3AUL A;  2K8H A;  3DHG C;  4KKI A;  2H89 B;  3V05 A;  1FNU A;  2N0S B;  4IM0 A;  4XC2 A;  3H6N A;  5CHV C;  2BS2 B;  2FIF A;  1Y8R C;  1JML A;  4GDK B;  5AUK A;  2CKH B;  1YQB A;  4FHK A;  4LTU A;  3AEA B;  3AE6 B;  2QIL A;  3UQB A;  4BOS C;  2SAK A;  4LLG M;  2JZZ A;  1IUE A;  3MJW A;  1SIF A;  5JH5 C;  3NS1 A;  1J0G A;  2KWD A;  4GSW A;  2REX A;  1OQR A;  1SE3 A;  2LVQ A;  2D2Q A;  1ET6 A;  2K9X A;  5TSS A;  1HTQ A;  2DBY A;  1PDX A;  4EOY A;  1GAQ B;  3B9J A;  1SEB D;  2RSU A;  1ENF A;  3R66 C;  3VDZ A;  4HXD A;  3E56 A;  4LNO A;  2GMI C;  2XN9 C;  1HA5 A;  4K7S A;  2BPS A;  4FLH A;  2XK5 B;  1KJT A;  2MBB B;  4WQO B;  2GRI A;  3PPA A;  3NS8 A;  1C4C A;  1ESF A;  2LHE A;  3Q69 A;  2Z0D B;  3SHQ A;  3KUD B;  2WDV B;  3NJT A;  2K39 A;  1ZXH A;  3PZ7 A;  1E8Y A;  4WIP A;  4US8 A;  4OHJ A;  2O6V D;  1LM8 B;  2PTL A;  2L1A A;  1WR6 E;  4NQK E;  1EWY C;  2JY6 A;  3OG5 A;  1VRA B;  1E5W A;  1YJI A;  4M0W A;  1FNV A;  4NAW A;  4D2K A;  1F1H A;  5LXH A;  5D3I B;  3PRP B;  1T0R C;  4KGT A;  2QIE B;  3SFD B;  2D3C A;  5D2M B;  4BAX A;  1NEN B;  3CIR B;  4AS1 A;  4W9G A;  4Q2J A;  3IFW B;  1D4B A;  2BWE S;  2LVO A;  4TQ1 A;  3SD5 A;  2J0M A;  2RR9 A;  1GB1 A;  1D5X C;  3K9P B;  1EF1 A;  4IKG A;  3EFC A;  1FXA A;  3JVZ X;  3L10 B;  4OZA A;  1UBI A;  4GMV A;  2MJ3 A;  3Q2A C;  2V3N A;  2MX2 A;  3TUO A;  3A9J B;  4FA6 A;  2JX5 A;  2WWZ A;  1L6U A;  2PPH A;  3H7P B;  2OOB B;  1UUP A;  2QMT A;  5HFY A;  2CHX A;  2JPH A;  2JWZ A;  4KVG B;  2WXP A;  4JQW C;  4W9D A;  1D3Z A;  2DX5 B;  3N3K B;  1TIF A;  2R2O A;  1UH6 A;  2IGH A;  3R2T A;  1UNS A;  4XZ4 A;  3PGE A;  4YSZ B;  3BYT B;  4DQO C;  2LMC A;  1QZE A;  2ICI A;  2KN4 A;  1WXM A;  1EF5 A;  1P7E A;  2JRH A;  2IBI B;  1PQS A;  4GIV A;  4OVZ A;  4J6I A;  3U7D A;  2K0P A;  2Y5C A;  3W1S A;  3VRB B;  3AEF B;  3RZW C;  3Q8B A;  5H92 C;  3EGR A;  2HDE A;  4TKN A;  1E7P B;  3WAN A;  3JYU A;  5EE0 A;  2R2Q A;  3GS2 A;  2RPQ A;  4G11 A;  1WWT A;  4WJO A;  4NNJ B;  2WU2 B;  1KLU D;  4USA A;  4RMA A;  4RF1 A;  3VFK A;  4ZYS A;  4GDK A;  2IO2 B;  2JSV X;  1V81 A;  3QJZ A;  2XEW A;  2DAF A;  4YTP B;  3C8Y A;  5IA7 A;  1VD2 A;  3RFZ B;  5LXI B;  2WXO A;  2KLC A;  4RGM A;  2KWU B;  2JQR B;  4NJ7 A;  3T8M A;  1YX6 B;  2LXC A;  4IWQ A;  4JIO U;  4M8N A;  3LB8 C;  2PEA A;  3RI7 C;  3AEG B;  4HRO A;  2AYO B;  1WXV A;  4ZYN A;  3U7Z A;  4C7Y A;  2W54 A;  5G55 A;  1F77 A;  2MBO A;  3NRZ A;  1MI0 A;  2KTF A;  1TT5 B;  2HJ8 A;  4URK A;  1TS4 A;  1FRR A;  1TY0 A;  1QOB A;  2ZVN A;  1ZXI A;  1WM3 A;  4LDT B;  2AQ3 B;  1AYF A;  3V62 A;  1R4M I;  2I1K A;  5C23 A;  2M0A A;  4W9H A;  2LFI A;  2JXT A;  2WXH A;  4LDT D;  1J7C A;  1IPG A;  4GLS C;  2ZZP B;  4A20 A;  1F2R I;  1WX8 A;  3RN9 C;  1FM0 D;  2XK5 A;  4ARC A;  4FN2 A;  4AOF A;  2KXJ A;  4AWJ A;  3AEE B;  3URY A;  1ACC A;  4ANV A;  3AI5 A;  2KVZ A;  2K5P A;  1XT9 B;  2LHD A;  2KC1 A;  1GC6 A;  2LXA A;  3W5V B;  3X23 A;  3RNC C;  1OFF A;  2WP9 B;  3P4Q B;  2DLB A;  2FCS A;  2JF5 A;  2BVC A;  5IOI A;  1D6E C;  2GB1 A;  2OJR A;  2YVC A;  2J52 A;  3D32 A;  4LJO B;  2MEK A;  2KQS A;  2PVO D;  4KKJ A;  1YN4 A;  2X38 A;  1OEY J;  3MC8 A;  4PK1 A;  1A5R A;  3QK0 A;  4ANW A;  1WMH B;  3P2B A;  4R3D A;  2WU5 B;  4CQN A;  4HWI B;  3AED B;  4WUR A;  2CJO A;  1JQ4 A;  1ZOY B;  3BVG A;  5AZF A;  4BBN C;  2VH1 A;  2ZVO A;  3PZD A;  3DBH I;  3DVG X;  1WJN A;  1SBB B;  2IND C;  1V80 A;  1ZKH A;  2KDE B;  4BVU C;  2E3T A;  5J17 A;  2KC2 A;  1GJZ A;  1WXS A;  3KLS X;  4GB9 A;  4K3C A;  1YN5 A;  4FXC A;  5L83 A;  1FPY A;  1IBX B;  5KHO A;  5T8I A;  2N9K A;  4FHJ A;  3A9J A;  1JRP A;  4MEM A;  3UI3 A;  3AXC A;  3ZNI D;  4II2 B;  3H7P A;  3MJ5 A;  2ZW1 A;  4ACF A;  1XXG A;  4G50 A;  2NBV B;  3VQI A;  3PHX B;  3Q8A A;  1WSP A;  5EE1 A;  4H2A A;  1E6E B;  2KDM A;  2NBW B;  1KRH A;  2Y5B B;  5D3D A;  1IYF A;  1P7F A;  1EWC A;  3AE9 B;  2KDF B;  2WQY B;  2D5G A;  1RLF A;  5D7G A;  3AU5 A;  2A5U A;  1J7A A;  3HM6 X;  4REZ A;  2A4Z A;  2G4S A;  4YWG G;  5HI1 A;  4PS7 A;  5C3J B;  2K3U A;  1WF9 A;  2V4I B;  4WWN A;  1R4N I;  1E8Z A;  3IT4 B;  4XE0 A;  1I35 A;  2RMM A;  3AB5 A;  3T3O A;  2MA9 B;  2KMA A;  1T0Q C;  3C19 A;  4DDG D;  1MJD A;  1RFK A;  2ZCB A;  3DDC B;  4KX6 B;  2KLG A;  2HE7 A;  2Z8L A;  1TKE A;  4GXB A;  3NVW A;  1WXA A;  3ML9 A;  4W9J A;  2Z59 B;  5IN7 A;  3OJ4 B;  1YMH E;  1VCB A;  2W55 A;  3HVZ A;  4GN1 A;  4J3O D;  3TL5 A;  4CYE A;  2ZCC A;  4IM2 A;  4W9C A;  3ZW3 A;  4WWM A;  5MPO A;  3GOE A;  2X8X X;  2UYZ B;  4YTN B;  1MFW A;  1C79 A;  1SE4 A;  2N9P C;  1SF0 A;  3M62 B;  2KDI A;  1ZE3 D;  2RDG A;  3DWM A;  3N20 C;  3H8H A;  2KJR A;  4KV2 A;  4G3X B;  3P4P B;  2ZPN A;  1WJ6 A;  1AN8 A;  2J7Q B;  2JXX A;  3IBE A;  4RGN A;  3ZDM C;  3BY4 B;  1OQY A;  2N1W A;  3GZN I;  2D3G A;  2LRW A;  1YNT E;  3QQ8 B;  3B2G A;  2ZJD A;  4ITK A;  1H8C A;  1M4V A;  4DHZ E;  1E9M A;  2BYT A;  4WAA A;  4C4V B;  3NZS A;  5G2N A;  1QOA A;  2ZW0 A;  3ZXV A;  2N7E A;  1VDV A;  3DWG C;  4MM3 B;  1M94 A;  2WYQ A;  2TSS A;  3W1Y A;  1I4Q A;  4PYU A;  5GMV A;  3W2D A;  2WXN A;  4GDL B;  2FBW B;  3WAL A;  1MPE A;  4ZRJ A;  1E8W A;  1HZ5 A;  2OED A;  1PYW D;  3L17 A;  2N9L A;  2G4D B;  3AMZ A;  2DWQ A;  1WJU A;  2IY0 B;  3KW5 B;  1D5Z C;  1WMH A;  1N60 A;  4JX1 C;  3A1Q A;  3VRA B;  1ZPS A;  4TSS A;  3OAW A;  4DBG A;  2WXK A;  2IPK D;  3CF6 E;  4OZB A;  2MCN B;  3I63 C;  2EKI A;  1WXQ A;  4RFB A;  1HE8 A;  4ZRK A;  4BOZ B;  3H7S A;  1QLB B;  1FCL A;  4A8X C;  4ZOH C;  1TYG B;  2J4X A;  1TS5 A;  4ANX A;  2DZM A;  2B76 B;  2B3A A;  2LD9 A;  4W9I A;  4B95 A;  1IBX A;  2WXL A;  3ABV B;  4KSK C;  3M63 B;  3WAP A;  1AWD A;  4DXF A;  3KUZ A;  3FIL B;  3RMK C;  1TS3 A;  2LVP A;  1EUV B;  3M3J A;  5BMG A;  2VZK B;  3NVY A;  4US9 A;  1NDD A;  2AX5 A;  1LXD A;  1YOV B;  2I1J A;  2J0J A;  2W9N A;  3ALB A;  2VZK D;  3DVN V;  3WAM A;  1Y56 A;  1WRI A;  3I5J C;  3KWV A;  4KDI C;  3PLV A;  1WGY A;  5GXG B;  2J0K A;  4W9F A;  5BYR A;  2JZ3 B;  3LXF A;  4MJS B;  3TEX A;  4DHZ B;  1SGH A;  4A3O A;  2DEN B;  2C7H A;  3BZD B;  4MT5 A;  2KWC A;  4EZL A;  1E0Z A;  2ZPY A;  2ONQ A;  1TS2 A;  3IAM 1;  2NMQ A;  2LRU A;  5EE9 A;  5BMH A;  2MP2 B;  1CQV A;  2DYB A;  4N58 A;  3ZNZ B;  3QA8 A;  5CTR C;  2CHW A;  3RNG C;  3JSV B;  2O6V B;  3FC4 A;  2IYD B;  3AEB B;  3CST A;  4LCD E;  1PGB A;  1G6J A;  4I6P A;  2WX0 A;  1Q10 A;  4HKZ E;  2WNM A;  3GP7 A;  3AE4 B;  4M01 A;  1YJ1 A;  1N6Z A;  1J8C A;  5C1Z A;  4LNK A;  1F2R C;  1C78 A;  3TJP A;  4EE2 A;  2CJN A;  4FAD A;  1V6E A;  2QSD A;  4AP4 C;  4NQL B;  3VH4 B;  1EO6 A;  4EFO A;  2L32 A;  2ASQ A;  1WJ4 A;  1WFY A;  1STE A;  4LNF A;  2JWU A;  2ZNV C;  4N59 A;  4PS3 A;  3UQA A;  4HDQ A;  4HCN B;  2IZV B;  1T3Q A;  2DAJ A;  2GBM A;  2INN E;  4HKQ A;  3L13 A;  2CHZ A;  2BGF A;  2PLP A;  5G5G A;  4HLE A;  2BBC A;  1CK1 A;  2AEH A;  1I4H A;  4QAY A;  3SDL C;  2FUH B;  1DOY A;  5DCN A;  1QKZ A;  4PT5 A;  2RGF A;  3KVF B;  4HJK A;  1GPX A;  3DBR I;  4C4V A;  1C9F A;  1U4A A;  1WGR A;  2NTT A;  3DOW A;  2YEP B;  3GB1 A;  4EEW A;  1YQ4 B;  3VTU A;  3EC8 A;  3R3M A;  3RYT A;  4EZJ A;  2NTS A;  2KMM A;  3ONS A;  1R4M B;  5C2T B;  1QT9 A;  2BB6 A;  1K50 A;  3W9C B;  3WIM A;  1ROE A;  4HEA 1;  1SXT A;  5FK9 C;  4MH8 A;  1JRO A;  1C4P A;  2DYM A;  4IC7 B;  3WAO A;  1I4G A;  2FNJ B;  1K52 A;  1F9J A;  3IAS 1;  3MHS D;  1PUT A;  3A9K B;  2ZNV B;  4YXD B;  2G1E A;  4XDC A;  4P16 A;  4IWO A;  4C56 C;  2BF8 B;  2N9X A;  1J7B A;  3KYD D;  3A33 B;  2BW2 A;  3P63 A;  2DZK A;  2D11 A;  2Y5P A;  4IWP A;  3WA0 A;  3P4R B;  3N1Y C;  5TR5 A;  3OLM D;  2DZJ A;  5DPS A;  1L4Z B;  2KMC A;  3P1M A;  4XWW A;  2BWF A;  4KIK B;  1C77 A;  1ZW7 A;  3MC0 B;  4RM8 A;  3K9O B;  5EE3 A;  2KZR A;  1B1Z A;  2GBJ A;  3HHM A;  2LGD A;  4IUM B;  4IDI A;  3U8Z A;  1Q1O A;  1OGW A;  3FIL A;  4K81 A;  2PJH A;  1L5P A;  4BBN F;  2HTM E;  4W9E A;  1YN3 A;  3PRZ A;  2BQQ A;  1ZP0 B;  2QC8 A;  4FUL A;  1TKY A;  3LYY A;  1FEH A;  2GBR A;  2MH7 A;  2MSE D;  1LGR A;  4MSM B;  3ZTD A;  3B08 A;  3UIN B;  2WXI A;  3B1L X;  3AE5 B;  1FCC C;  3J9C A;  5HG2 A;  4LNI A;  2Q5W D;  4LNN A;  2KQ4 X;  2OHF A;  3ZYY X;  3QHT A; 
#chains in the Genus database with same CATH homology
 2A4Z A;  2EMS A;  2G4S A;  2LUE A;  4MJS A;  3ZIM A;  4PS7 A;  3L54 A;  4IW0 A;  1WF9 A;  3ZRC A;  4WWN A;  4K7W A;  3PT2 B;  2KQ7 A;  3PS6 A;  1P3Q U;  4OVV A;  1R4N I;  1E8Z A;  3ZVV A;  1I35 A;  4HPM B;  2BKR B;  1C3T A;  1UGM A;  2KJH B;  4HK2 A;  3PVL A;  3NY5 A;  3EHV A;  5AZG A;  1E8X A;  4E71 A;  5E6O A;  2D07 B;  1Q5W B;  3H9D A;  2MA9 B;  2KMA A;  2O2V B;  4DDG D;  2K6Q A;  1S1Q B;  2ZCB A;  2GBN A;  3DDC B;  3AUL A;  2K8H A;  3JSV A;  2O6V A;  2KLG A;  2EKE C;  4MM3 A;  2HE7 A;  2YLM A;  1MG8 A;  4GXB A;  2NPT A;  1WXA A;  4IM0 A;  3ML9 A;  4XC2 A;  3UIO B;  4W9J A;  2Z59 B;  3H6N A;  3OJ4 B;  3ZNH B;  2JUO A;  5CHV C;  1VCB A;  3N32 A;  2MWS B;  2FIF A;  4GDL A;  1Y8R C;  5CX3 A;  4GDK B;  3RCZ A;  2CKH B;  1YQB A;  4FHK A;  4GN1 A;  3V6C B;  4OVU A;  3TL5 A;  4KDL B;  2MQJ A;  4II3 B;  4CYE A;  3ZO5 B;  3UQB A;  2C7N B;  2ZCC A;  2Z0E B;  4IM2 A;  4W9C A;  4B9K A;  2NR2 A;  3ZW3 A;  1C1Y B;  4BOS C;  1K8R B;  2L3Z A;  3GOE A;  3HIZ A;  2UYZ B;  2JZZ A;  4EUT A;  2IO1 B;  3PHW B;  3MJW A;  1SIF A;  3A4S C;  2N9P C;  3UF8 A;  4F7Z A;  5JH5 C;  3M62 B;  2K8B A;  2QHO A;  5E6P A;  1YIW A;  5E6N A;  2XBB C;  4GU2 A;  2KDI A;  1J0G A;  2WDT B;  2ZEQ A;  3ZKJ C;  4ICV A;  4GSW A;  1TBE A;  2REX A;  1IP9 A;  2KJR A;  5AZH A;  1E90 A;  1P9D U;  3IG3 A;  2LVQ A;  4G3X B;  4KV2 A;  4WJQ A;  3M95 A;  2ZPN A;  1WJ6 A;  2D2Q A;  2J7Q B;  2JXX A;  2C60 A;  2IY1 B;  2M1M A;  1UEL A;  3IBE A;  3ZDM C;  2KDB A;  3BY4 B;  1OQY A;  2BKF A;  2N1W A;  3GZN I;  4EOY A;  1KOT A;  1WZ0 A;  4E3C A;  2JVC A;  1E7U A;  3QIJ A;  3T9L A;  5JHA A;  2AL6 A;  2D3G A;  2LRW A;  3N30 A;  3QQ8 B;  3QAQ A;  2BYV E;  2ZJD A;  2RSU A;  4HDO A;  3R66 C;  2K1F A;  3VDZ A;  3APF A;  1H8C A;  4HXD A;  4DHZ E;  2GMI C;  4WAA A;  3S2A A;  5CHW A;  2JRI B;  1WI0 A;  1WRD B;  2KKC A;  2KX3 A;  4K7S A;  3ZUN A;  4FBJ B;  2IO3 B;  2BPS A;  4FLH A;  4MGK E;  2XK5 B;  3NZS A;  1KJT A;  2MBB B;  5G2N A;  4WQO B;  3PPA A;  2L0T A;  3I3T B;  3RT3 B;  3NS8 A;  3UIP B;  4WWP A;  2N7E A;  3SHQ A;  2Z0D B;  4CHK A;  1M94 A;  3KUD B;  2WYQ A;  2KOX A;  2K39 A;  1E8Y A;  2HD5 B;  3W1Y A;  4BKT A;  5KHQ A;  4PYU A;  5GMV A;  1WGG A;  4MEL A;  2O6V D;  5J2R A;  1LM8 B;  4GDL B;  2CS4 A;  2N1V A;  3X0W A;  1WR6 E;  3WAL A;  1Q0W B;  4NQK E;  2JY6 A;  4NPN A;  1E5W A;  4F1S A;  4ZRJ A;  3A9K A;  1E8W A;  1ZGU B;  4NAW A;  3DBL I;  3L17 A;  2G4D B;  5LXH A;  1WJU A;  2IY0 B;  3KW5 B;  4K1R B;  3TIX A;  2BYF A;  2LZ6 A;  3RUI B;  1WMH A;  2KHW B;  3PRP B;  3A1Q A;  2DYO A;  4DBG A;  2N7D A;  3OAW A;  5D2M B;  3HM6 X;  3ZTC A;  2KJ6 A;  2G45 B;  3O65 B;  3QCA A;  2JT4 B;  4W9G A;  3CF6 E;  4AJY B;  2MBE A;  4GOC A;  2MCN B;  3IFW B;  2BWE S;  2FCM A;  2LVO A;  3HK0 A;  4TQ1 A;  3SD5 A;  4AJW A;  1WH3 A;  1V86 A;  1HE8 A;  2J0M A;  3BIN A;  4ZRK A;  3TMP B;  4BOZ B;  2RR9 A;  3H7S A;  2MP2 A;  1UD7 A;  5D6J B;  2AWT A;  1X1M A;  1EF1 A;  3K9P B;  3V61 A;  4M8M A;  1WM2 A;  4ANX A;  2DZM A;  4EZK A;  1P0R A;  2K8C A;  2B3A A;  4GGQ A;  3JVZ X;  2LD9 A;  3QWZ B;  1WZ3 A;  1ISN A;  3L10 B;  4W9I A;  4B95 A;  4G0N B;  1UBI A;  4KSK C;  3M63 B;  1YD8 U;  4GMV A;  3WAP A;  1V5T A;  2MX2 A;  4FJZ A;  2KTR B;  2NVU I;  3A9J B;  3KUZ A;  4FA6 A;  2KK8 A;  1TGZ B;  2WWZ A;  1BT0 A;  4FJV B;  4BKS D;  2PPH A;  2C9W B;  2L8J A;  3DBS A;  3DVN U;  3H7P B;  2G3Q B;  2OOB B;  2LVP A;  3V60 A;  1EUV B;  3M3J A;  2CHX A;  3H1U A;  2JPH A;  3VTW A;  1NDD A;  2JWZ A;  4LJP B;  1WIA A;  2M17 A;  3LDZ E;  2KFK B;  4KVG B;  4JQW C;  4W9D A;  5AEK B;  1LXD A;  1D3Z A;  2DX5 B;  2I1J A;  2J0J A;  2NBU A;  2W9N A;  3ALB A;  3L08 A;  3N3K B;  2R2O A;  4BKG A;  3QC8 B;  4WJP A;  3DVN V;  3VVW B;  3WAM A;  4XX5 A;  4JLC A;  3Q3F A;  1UH6 A;  4PYZ A;  1NI2 A;  4N9F 4;  3VAW A;  4XZ4 A;  3OJ3 A;  3PGE A;  1RFA A;  4FJY A;  2V1Y A;  5DPR A;  3DQV A;  3U30 A;  3B0A A;  4KDI C;  3PLV A;  1WGY A;  2MRP A;  3DVG Y;  4I6N B;  2J0K A;  4W9F A;  2IO0 B;  4W9L A;  2JZ3 B;  2HTH A;  3ENE A;  4IM3 A;  4ZDV A;  1QZE A;  4MJS B;  3VUY A;  1WXM A;  4DHZ B;  1EF5 A;  1SGH A;  3A1Q B;  2JRH A;  4A3O A;  2DEN B;  2IBI B;  2MLB A;  2C7H A;  3VTV A;  1PQS A;  4GIV A;  4J6I A;  2LWP A;  3U7D A;  3LJ3 A;  1JRU A;  3QAR A;  2KWC A;  4EZL A;  3PV1 A;  1XQQ A;  1GNU A;  2ZPY A;  4NJ6 A;  4X57 B;  3W1S A;  5L95 C;  3RZW C;  1WR1 A;  2LGX A;  4YL8 A;  2KX0 A;  2AL3 A;  2LRU A;  2O2V A;  3ZLZ A;  3DPD A;  4TKN A;  1GG3 A;  3PRM B;  4DXA B;  2C5L C;  1UZX B;  3MTN B;  4DWF A;  2LGY A;  2BYE A;  2MP2 B;  1Z2M A;  2DYB A;  2M4N A;  3ZNZ B;  2L05 A;  3QA8 A;  3IVF A;  4MGY E;  5CTR C;  2CHW A;  3JYU A;  3WAN A;  2CU1 A;  2R2Q A;  3JSV B;  1I42 A;  2O6V B;  3A4R A;  2RPQ A;  4G11 A;  2IYD B;  3VUW A;  2L76 A;  1V49 A;  4NNJ B;  4WJO A;  2K6D B;  1KLV A;  3CST A;  4JL9 A;  4LCD E;  4RMA A;  2NPT B;  1G6J A;  2M8S A;  3CMM B;  1WE6 A;  4TUU A;  3ECI A;  4I6P A;  2WX0 A;  4E74 A;  3VFK A;  4TQ0 A;  3SU8 X;  4GDK A;  4EKU A;  2IO2 B;  1WX9 A;  3ZDT A;  2LI5 A;  1YJ1 A;  1V81 A;  3RZF A;  3QJZ A;  3RUL A;  1J8C A;  2RD0 A;  2XEW A;  3VHT C;  5C1Z A;  2N9E B;  4JGH B;  2DAF A;  4IG7 B;  4ASW C;  3KYC D;  3TJP A;  2C7M B;  5IA7 A;  1VD2 A;  1S3S G;  5LXI B;  2MBH A;  2KLC A;  2KD0 A;  4FAD A;  3NOB A;  1V6E A;  4AP4 C;  4NQL B;  3VH4 B;  2KWU B;  1EO6 A;  4EFO A;  2ASQ A;  4ZRI A;  1WJ4 A;  1WFY A;  4ICU A;  4NJ7 A;  1YX6 B;  2LXC A;  2ZNV C;  4PS3 A;  3T8M A;  3UQA A;  4IWQ A;  4JIO U;  3VUX A;  4HDQ A;  4HCN B;  4A3P A;  4M8N A;  1H4R A;  3V6E B;  3PLU A;  2IZV B;  4CO7 A;  3ZRF A;  2PEA A;  2AYO B;  1WXV A;  2DAJ A;  2GBM A;  3C0R B;  4ZYN A;  1TTN A;  4KZ0 A;  1WYW B;  3KUC B;  3L16 A;  5G55 A;  3NZU A;  2MBO A;  3L13 A;  2KTF A;  2CHZ A;  1WX7 A;  1AAR A;  2BGF A;  2HJ8 A;  4URK A;  1GUA B;  4MDK E;  2ZVN A;  5BO4 B;  1OTR B;  4HLE A;  1WM3 A;  2LAS A;  2KVR A;  4LDT B;  5HKH A;  4HVB A;  2PE9 A;  4KIK A;  4MSQ B;  2AEH A;  2GOW A;  3SDL C;  3QX1 A;  3V62 A;  1R4M I;  2FUH B;  1WGD A;  1V9J A;  2I1K A;  5C23 A;  2KN5 A;  4W9H A;  5DCN A;  1P98 A;  2DHZ A;  4LDT D;  2NS5 A;  4A20 A;  1IPG A;  2ZZP B;  1WX8 A;  4WWO A;  2RGF A;  3KVF B;  4HJK A;  1RAX A;  3DBR I;  1Z5S B;  2GBK A;  1WE7 A;  2XK5 A;  1U4A A;  4FN2 A;  1WGR A;  4AOF A;  2PE6 B;  2KXJ A;  2V4L A;  3ML8 A;  4AWJ A;  3DOW A;  2KNB A;  4EEW A;  3VTU A;  3AI5 A;  4ANV A;  3EC8 A;  3UGB B;  2LJ5 A;  2V3S A;  3R3M A;  4MGI E;  1TZ1 A;  3RYT A;  4EZJ A;  1XT9 B;  2KC1 A;  1UBQ A;  4DHJ B;  1GC6 A;  2LXA A;  5J18 A;  3X23 A;  3ONS A;  3DCG A;  1V2Y A;  1J19 A;  2FCS A;  1NBF C;  2JF5 A;  3WIM A;  4DK5 A;  4HPL B;  2OJR A;  3PSE B;  3AU4 A;  4BFR A;  2K25 A;  2KO3 A;  2YVC A;  4DHJ D;  3D32 A;  2CR5 A;  2DYM A;  5JHB A;  4IC7 B;  4KZC A;  3WAO A;  2FNJ B;  4MGZ E;  4MH0 E;  4LJO B;  1F9J A;  1XD3 B;  3MHS D;  2KQS A;  1WY8 A;  3A9K B;  2FAZ A;  2ZNV B;  4M0W B;  4B6W A;  2MW5 A;  4NAW B;  1OEY J;  1LQB A;  2WX1 A;  2FCQ A;  3IHP C;  1A5R A;  1FXT B;  2L0F A;  3QK0 A;  4IWO A;  4TV3 A;  4ANW A;  1V5O A;  1WMH B;  3P2B A;  3EFU A;  2NCN A;  2BF8 B;  3L0W B;  2N9X A;  3JW0 X;  4HWI B;  3KYD D;  3A33 B;  3VH3 B;  1KM7 A;  5LLI A;  2UWQ A;  2DZK A;  3TBL D;  1RRB A;  4WJN A;  2D11 A;  5AZF A;  4BBN C;  3NHE B;  4IWP A;  2ZVO A;  3WA0 A;  5TR5 A;  1L2N A;  3PZD A;  3DBH I;  5DPW A;  3DVG X;  2D10 A;  1WJN A;  3OLM D;  2DZJ A;  3W1S C;  5DPS A;  2KMC A;  1L7Y A;  1V80 A;  1ZKH A;  2KDE B;  4W9K A;  3R7Q A;  2BWF A;  3KH0 A;  2DZI A;  4HCP B;  4BVU C;  1LFD A;  3TCA A;  1T0Y A;  4KIK B;  3CSF A;  2KC2 A;  5J17 A;  1GJZ A;  1ZW7 A;  1WXS A;  4PS8 A;  4RM8 A;  4GB9 A;  4RM9 A;  5JZE B;  3K9O B;  2KZR A;  3PTF C;  2GBJ A;  2KAN A;  3HHM A;  1GC7 A;  4BKS A;  5L83 A;  3RD2 A;  2LGD A;  3EEC A;  4AUQ C;  4I6L B;  4IUM B;  4NY0 A;  5IAA C;  5KHO A;  3U8Z A;  2KTR A;  1Q1O A;  2FCN A;  3A9J A;  4FHJ A;  1CMX B;  1OGW A;  4F8C B;  4K81 A;  4MEM A;  2PJH A;  5FR6 A;  1E7V A;  2L00 B;  4BBN F;  3AXC A;  3ZNI D;  4W9E A;  4II2 B;  3H7P A;  3PRZ A;  3R7R A;  2MBQ A;  5DPT A;  1WGH A;  2L7R A;  4G50 A;  3APD A;  4P7I A;  2NBV B;  3Q3J A;  3VQI A;  4FUL A;  2KWV B;  2VRR B;  4K7U A;  3PHX B;  3PRE A;  1OEY A;  4KSL C;  2GBR A;  2KFK A;  2MSE D;  4DDI D;  2EMT A;  2NBW B;  4MSM B;  3ZTD A;  3B08 A;  5D94 A;  5CHF A;  3UIN B;  3ZNG C;  1YX5 B;  3B1L X;  5EDS A;  2Y5B B;  3VXW A;  2FID A;  1IYF A;  2N4F A;  2KDF B;  3QHT A;  4ANU A;  3HM3 A;  2KFJ A;  1RLF A;  5D7G A;  2M0X A;  3AU5 A;  2A5U A;  3APC A;  1SE9 A;  1P1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...