2KFKA

Solution structure of bem1p pb1 domain complexed with cdc24p pb1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
PHMKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bud emergence protein 1
publication title NMR structure of the heterodimer of Bem1 and Cdc24 PB1 domains from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 10
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kfkA00
2EKEC 4EEWA 2KDIA 3H7SA 1V80A 2LASA 3ZIMA 2N9PC 4BOZB 4GIVA 2DYMA 4KZ0A 1V2YA 2C9WB 3KUDB 4HJKA 4LDTB 3NY5A 3VVWB 4WWPA 2PPHA 3QARA 3L54A 4IW0A 2NBWB 5E6NA 2HE7A 4HVBA 4E3CA 2KC2A 2KQSA 4DBGA 3V61A 1WZ3A 2JZ3B 3QIJA 2IO2B 4FJYA 1VCBA 1WMHB 2L8JA 4DHJD 3VDZA 2DAFA 4HPMB 4MGIE 2ZVNA 3V60A 1WX9A 1WX7A 3DQVA 4NPNA 2V3SA 4ANXA 4EFOA 1UBIA 3O65B 2IO3B 2BYFA 1WGHA 3PTFC 4W9IA 4ANWA 1R4MI 2BWFA 4BBNC 4GDLB 4DWFA 2DYOA 2I1JA 4B6WA 4BKTA 5IA7A 3HHMA 1A5RA 4BVUC 3ZUNA 2RR9A 3CF6E 3KUZA 5BO4B 4FBJB 5GMVA 1SE9A 2NBUA 3R7RA 2JPHA 1SGHA 2IO1B 5JZEB 2LWPA 3TL5A 4NJ7A 3PRPB 1PQSA 3APCA 3PREA 3TIXA 1YX5B 4KZCA 2MBQA 2YLMA 3NHEB 4J6IA 4BKGA 4ZYNA 3R7QA 5D94A 4CO7A 3U30A 2V4LA 3C0RB 3R3MA 1WXMA 2C5LC 2MLBA 2K8CA 4FN2A 2LXAA 3P2BA 4I6PA 4B95A 2RGFA 3BINA 4MGZE 1WXAA 2IY0B 4GMVA 3WANA 4E74A 2K8HA 2DENB 2IYDB 3L17A 1Z5SB 3ONSA 4WWNA 4P7IA 2DZJA 2FIDA 1UGMA 3DBLI 4KV2A 3IFWB 1XD3B 2OOBB 5DPRA 1J19A 3PHWB 3OLMD 4WQOB 4GU2A 4IUMB 3A9JB 1OEYA 5C23A 4ASWC 5EDSA 2CHWA 3TMPB 2MRPA 2NPTA 2HD5B 4LDTD 3PGEA 2GOWA 1U4AA 2IZVB 4W9LA 2RSUA 3K9PB 1YD8U 3APFA 4OVVA 2Z0DB 2BPSA 5G55A 1G6JA 2M17A 2LVPA 3RT3B 3AU4A 3L16A 2J0KA 5DPTA 3SDLC 1GJZA 1XQQA 2O2VB 2LGDA 1RRBA 5E6OA 2KKCA 4EZJA 4TKNA 1LFDA 4GOCA 2M8SA 3ZKJC 3H7PB 2LUEA 3EECA 4JQWC 2KDEB 3JSVB 4W9KA 2M0XA 2KFJA 1WYWB 3A1QA 1WJ6A 2KVRA 3JW0X 1WX8A 3PV1A 2KZRA 4CHKA 4BFRA 2KQ7A 3HM3A 2KWUB 3DCGA 1C3TA 2KDBA 1JRUA 1VD2A 3QAQA 2KLCA 3W1YA 4JL9A 5JH5C 4MSMB 2WX0A 3H1UA 3WAMA 1E7UA 4A3OA 3VH4B 2N7DA 1WFYA 4KDIC 2KFKB 3M62B 4IM2A 1WF9A 1XT9B 2ZZPB 4FULA 2BF8B 3ML8A 1LM8B 3UQAA 2JRHA 2IO0B 4M8MA 4F1SA 4WJPA 5CX3A 2AEHA 2D2QA 1YJ1A 2JY6A 3K9OB 2MW5A 2R2QA 4GDKA 2Z0EB 3PRMB 2PEAA 3ZNHB 2JT4B 4GSWA 3QK0A 3JVZX 5CTRC 1V6EA 4HCPB 3B0AA 2DZKA 3DDCB 4II3B 1T0YA 1EO6A 1F9JA 3QJZA 2KX3A 3L0WB 4TQ1A 4G50A 1WJUA 3ZVVA 2WDTB 5L83A 1WGGA 3WIMA 2REXA 4XZ4A 4NJ6A 4E71A 1WE7A 3ZNZB 2DHZA 1YIWA 3R66C 4HWIB 4ZDVA 2WWZA 3RYTA 1TBEA 2YVCA 5HKHA 2BGFA 3IVFA 1I35A 2FCMA 5DPSA 5D6JB 4NAWB 4W9CA 3DVNV 3H9DA 4MGYE 1ZGUB 4MJSA 1P0RA 5E6PA 4GGQA 1IP9A 1L7YA 2D11A 3D32A 3M3JA 4GN1A 2KWVB 2LD9A 1YX6B 3KUCB 2CR5A 3RZFA 3TCAA 3PSEB 3WALA 5L95C 2BKFA 4NY0A 4WAAA 3VUXA 3ZDMC 4FADA 1UD7A 2VRRB 2KJ6A 3A9KA 3DVGX 3VTWA 2KLGA 4XX5A 4MSQB 1H8CA 2KNBA 3VXWA 3DBSA 2MA9B 1ISNA 2JWZA 3MJWA 1R4NI 2C60A 4OVUA 3A33B 1WY8A 3ZRFA 2BYVE 3UQBA 3CMMB 2K1FA 2DX5B 1OTRB 1UH6A 4FA6A 2O6VB 4LJOB 2LZ6A 4GB9A 4BKSD 3X0WA 4W9JA 4ZRKA 2AL6A 2ZNVC 5AZGA 2MP2B 3LDZE 4WJOA 2KO3A 3NOBA 1SIFA 4DHZB 4I6NB 3A4RA 3AU5A 4KDLB 4N9F4 2K25A 2JUOA 1GC6A 1RLFA 3VTVA 4HDQA 4MDKE 2LGXA 4HK2A 4NQKE 5LLIA 2V1YA 3WAOA 4TV3A 4HDOA 4ZRJA 3QQ8B 2WX1A 3ZLZA 1WMHA 4AJYB 4TUUA 4W9FA 2BKRB 2L76A 4AOFA 5J2RA 1OGWA 1V9JA 3ZRCA 2KJRA 1ZW7A 4DXAB 2N9XA 5JHBA 1J8CA 3UINB 2N9EB 4KSLC 3H6NA 3CSFA 2KMAA 2UWQA 2MWSB 4GDLA 3SU8X 5D2MB 3A1QB 2DAJA 5TR5A 3UGBB 3PT2B 2KX0A 4IWPA 3QHTA 4XC2A 1WIAA 1EUVB 3KVFB 3AXCA 2PE6B 2MBBB 2L0TA 2AYOB 3BY4B 2K39A 2J0JA 1WE6A 2G45B 1H4RA 2IY1B 2XEWA 3V6CB 1WI0A 2KTRA 2MX2A 3OAWA 4G11A 3RZWC 3VH3B 3OJ3A 2O6VD 3PLUA 1V5OA 4W9GA 2GBJA 3UIOB 4FJVB 4YL8A 3W1SC 4BBNF 3EHVA 3KYDD 1Q0WB 1OQYA 4GDKB 2JVCA 1E90A 3N3KB 1FXTB 2GBKA 2GBMA 2KOXA 2CKHB 3VHTC 5J18A 4EZLA 4KIKA 2KD0A 3ML9A 2FCQA 4MH0E 4RM9A 1AARA 2MSED 3MTNB 2BYEA 2LXCA 2NBVB 4M8NA 2XK5A 1P3QU 1WGYA 4FJZA 4AUQC 1V5TA 4PS3A 2W9NA 3QA8A 4DHJB 2CU1A 2CHZA 2O2VA 1V81A 2HJ8A 2M4NA 1P98A 2ZVOA 1I42A 4HCNB 4PS7A 2KC1A 3L08A 4HXDA 4JLCA 4CYEA 1NDDA 2G4DB 2MQJA 1TTNA 2NCNA 3GOEA 3DVGY 3HM6X 1WRDB 4WJQA 1D3ZA 1TZ1A 3JYUA 3U7DA 2ZEQA 2NR2A 2FIFA 4K1RB 2RPQA 1S3SG 3N30A 2L05A 4FHKA 4MJSB 4F8CB 2EMTA 1LXDA 2PE9A 3QWZB 1E5WA 1BT0A 4K7SA 2J7QB 2KHWB 1KM7A 1M94A 2QHOA 2LJ5A 4GXBA 1MG8A 4RMAA 3VTUA 4HLEA 1EF1A 4EUTA 2C7HA 2L00B 4TQ0A 3A9KB 1UBQA 3L10B 5LXIB 2KFKA 2ZPNA 3KH0A 2G3QB 2MBHA 3PS6A 5KHOA 1GC7A 2KK8A 2J0MA 1WH3A 2L7RA 3QX1A 3UF8A 1J0GA 3GZNI 4MEMA 4IWQA 5AZHA 3PZDA 1RAXA 1UZXB 2FAZA 2MBEA 3NS8A 4PYUA 5D7GA 1V49A 2KANA 1Q1OA 3IBEA 4BKSA 4W9DA 1EF5A 4II2B 4IM0A 2I1KA 4MELA 1E8WA 4K7WA 2KMCA 2FCNA 2N1WA 4IM3A 2RD0A 2MBOA 3Q3FA 1KLVA 1TGZB 2NVUI 2L3ZA 4WWOA 3AI5A 3QCAA 4JGHB 3DBRI 5G2NA 5DPWA 4BOSC 3PVLA 2NS5A 2D3GA 2ZCCA 3ZNGC 2DZIA 1WJNA 4DDGD 3M63B 1Z2MA 3PPAA 3PHXB 2AWTA 1WXVA 2KXJA 3L13A 4ICVA 4G0NB 3TBLD 3APDA 2K6DB 2LGYA 2NPTB 3DOWA 1LQBA 1L2NA 2BWES 5CHVC 3W1SA 3VUYA 1YQBA 2KJHB 4NAWA 1NBFC 4W9EA 1WM3A 2Y5BB 2DYBA 3KW5B 1IYFA 2ASQA 5DCNA 2D10A 4ANUA 2JZZA 3U8ZA 4IG7B 1KJTA 3VFKA 3DVNU 3WA0A 2GMIC 4K7UA 4W9HA 4PYZA 4PS8A 3ZO5B 3PRZA 4URKA 3DBHI 4AJWA 5JHAA 4DHZE 5LXHA 2KN5A 3RULA 2KTRB 2FNJB 3N32A 3ZDTA 2L0FA 1GG3A 3T9LA 2K6QA 3ZNID 2O6VA 1WJ4A 2D07B 2PJHA 3HIZA 2CHXA 1GUAB 4ZRIA 3RUIB 1Y8RC 3SHQA 2JXXA 1WR6E 3WAPA 4IWOA 3B08A 1X1MA 2MP2A 5AEKB 1Q5WB 3Q3JA 3ZW3A 4K81A 4F7ZA 5AZFA 4KIKB 3LJ3A 4LJPB 3ECIA 3RD2A 2EMSA 1IPGA 2JF5A 2XBBC 3QC8B 1S1QB 4B9KA 2XK5B 2CS4A 2G4SA 3ZTDA 3ENEA 2FUHB 2HTHA 2N1VA 3M95A 5CHWA 3TJPA 4DK5A 3A9JA 2LRWA 4EOYA 3DPDA 2UYZB 2MCNB 1E8ZA 4KSKC 2N7EA 1K8RB 3V62A 1CMXB 1NI2A 5FR6A 3VQIA 3VUWA 4ICUA 3ZTCA 5CHFA 4AWJA 3CSTA 2ZNVB 2KWCA 3NZUA 4M0WB 3B1LX 2C7NB 1P9DU 4NNJB 3IHPC 1RFAA 3UIPB 3H7PA 3ALBA 1UELA 2FCSA 1OEYJ 2N4FA 2Z59B 2ZCBA 3JSVA 3NZSA 4MM3A 3SD5A 5KHQA 4IC7B 2ZPYA 4AP4C 1E8YA 1WM2A 2B3AA 3I3TB 4DDID 2JRIB 3EFUA 3KYCD 3HK0A 2IBIB 2R2OA 3EC8A 1GNUA 3IG3A 1V86A 2ZJDA 4NQLB 2DZMA 2GBRA 4LCDE 4A20A 1WGRA 1E7VA 2C7MB 2K8BA 3PLVA 2LRUA 1C1YB 4FHJA 4MGKE 2M1MA 2LI5A 5IAAC 4EZKA 1HE8A 2A5UA 4WJNA 2WYQA 4FLHA 3A4SC 1WZ0A 4KVGB 1E8XA 4ANVA 1KOTA 1P1AA 3T8MA 2AL3A 4I6LB 3RCZA 3S2AA 4X57B 1QZEA 3V6EB 1WXSA 2A4ZA 4A3PA 2GBNA 2KDFB 4EKUA 5J17A 3VAWA 1ZKHA 3MHSD 5C1ZA 4HPLB 4RM8A 1WGDA 3X23A 4JIOU 1WR1A 2OJRA 3OJ4B 3AULA 2KTFA 2LVOA 4G3XB 2LVQA
chains in the Genus database with same CATH superfamily
2KDIA 3H7SA 1V80A 2PVGC 4BOZB 4KZ0A 2C9WB 3KUDB 2NBWB 5E6NA 4HVBA 2L1AA 3N9YC 1I4XA 2IO2B 1L4DB 2FUG1 2L8JA 2WXOA 1WX9A 3DQVA 3O65B 3PTFC 3N1XC 2VZKD 4BBNC 4DWFA 1AWDA 4GLSC 1SE9A 3R7RA 1SGHA 2M19A 4NJ7A 4ZRQA 3PRPB 1PQSA 3AB5A 3PREA 4D2KA 1YX5B 2JQRB 1CQVA 4ZYNA 4OW0A 1I4PA 4FN2A 2RGFA 4UDUC 3WANA 2K8HA 2X8XX 3L17A 4WWNA 1EM7A 2FIDA 1XD3B 1J19A 3OLMD 4GU2A 3A9JB 5C23A 2WXQA 3FKYA 4A55A 1AN8A 4FXCA 1RFKA 3PGEA 3APFA 2J42A 2Z0DB 1G6JA 1KH0A 2BB6A 3ZGZA 2LVPA 2GLSA 3GB1A 1TT5B 2J0KA 3ZJVA 2KKCA 1LFDA 4GOCA 3ZKJC 3H7PB 2PW9A 4HKZE 1E6EB 2KFJA 4RF0A 4WURA 2KZRA 2KQ7A 2KDBA 1JRUA 1VD2A 2KLCA 2QDFA 4JL9A 4MSMB 3KWLA 1AYFA 2AQ2B 1WFYA 2Z8LA 3M62B 4IM2A 1QF6A 1WF9A 3ML8A 4M8MA 5CX3A 1FCLA 2LEKA 1YJ1A 2JYTA 2K9XA 2JY6A 2R2QA 2X38A 3AE9B 3QK0A 1V6EA 1PYWD 2DZKA 3DDCB 1K53A 3AEBB 1F9JA 4TQ1A 1C4PA 3E56A 2JYEA 3WCQA 4M0WA 2DHZA 2WWZA 3RYTA 3IT6B 2BGFA 4N6EB 1K51A 3N1ZC 4KKIA 4NAWB 3DVNV 3H9DA 4MGYE 1RM6C 1ZGUB 4JPSA 3RNGC 3FAHA 2KWVB 1YX6B 2CR5A 3R2IA 2KAJA 3WALA 1NYQA 2BKFA 4NY0A 4WAAA 3ZDMC 1UD7A 2KJ6A 2QSDA 4XX5A 2KNBA 1HXYD 2GRIA 3Q14C 1SE3A 3UQBA 1V1PA 1UH6A 4FA6A 1N62A 1N6ZA 3LDZE 4WJOA 3AU5A 4KDLB 1GC6A 1RLFA 4HDQA 3BYTB 2LGXA 4NQKE 3WAOA 3QQ8B 2WX1A 2AX5A 2L76A 1N5WA 5GXGB 2QC8A 2BS2B 3V3XA 4DXAB 4LK0M 3PZ7A 1K50A 1L6UA 2QILA 5IN7A 3DWMA 5D2MB 3A1QB 5TR5A 1YNTE 3BVZA 1AW7A 3T3NA 3HUIA 4XC2A 1WIAA 3KVFB 2LFIA 2DBYA 4MM3B 3ZYYX 1TY2A 3NS1A 1MI0A 2WXHA 2MX2A 2VH1A 3VH3B 1A70A 2O6VD 2LHDA 3EHVA 4ZYSA 2ZW1A 2KOXA 3DBRB 3VHTC 2AQ3B 5J18A 1F0ZA 2WXMA 3MHZA 3MJ5A 1KRHA 1AARA 2BYEA 4FJZA 3N1YC 4AUQC 3N20C 1YMHE 4DHJB 2INPE 1I42A 3L08A 5TSSA 4O1NA 1NDDA 3TUOA 1F77A 2Y5PA 2ZEQA 3U4EG 2NR2A 2L05A 4MJSB 1E5WA 5HG2A 4RMAA 3VTUA 2KMMA 4EUTA 3SEBA 2L00B 3A9KB 3KH0A 4C56C 2NMQA 3GZNI 5JXVA 3HVDA 4IWQA 3PZDA 2MBEA 1TYGB 2W54A 4BKSA 5FK9C 2N1WA 2RD0A 2MBOA 1KLVA 1TIFA 2L52A 3HVZA 1SE2A 3PVLA 2BYTA 1C77A 3PPAA 1WXVA 4USAA 3DOWA 2NPTB 1QOGA 3ZJTA 3W1SA 4NAWA 3RN9C 4W9EA 1WM3A 3KW5B 2KYWA 2FBWB 1MFWA 2D10A 4IG7B 1KFYB 1QT9A 3TEXA 3DVNU 4ZRPA 4K7UA 2WXKA 1PDXA 3RULA 2CJOA 1ZXHA 3V05A 3RUIB 3EGRA 2SAKA 2J4XA 4RGNA 1TS5A 1NI3A 4K81A 4C7YA 1I4RA 1XF5L 2EMSA 3W9CB 4B9KA 2G4SA 3ZTDA 3ENEA 3M95A 2PKOA 1FRRA 1SF0A 2LRWA 2NTTA 4EOYA 2KACA 3DPDA 4KSKC 3TEZA 1NI2A 2QJLA 5CHFA 3KWVA 4S17A 1DGJA 2C7NB 5FR3A 4NNJB 3UIPB 1UELA 2FCSA 2Z59B 5KHQA 4MM3A 3JSVA 1C79A 4BAXA 1L5PA 2KVZA 1GNUA 4LCDE 1V1OA 2K8BA 1E7VA 1FMAD 2C7MB 2LRUA 3B2GA 2LI5A 5IAAC 4EZKA 1DOYA 2WYQA 4ANVA 1E8XA 2WXRA 4IKGA 3S2AA 3RPFC 4NZLB 2WQYB 3X23A 4ZHOA 5I4DA 4N58A 1RYJA 2LVQA 4BZAA 2QCZA 4EEWA 3ZIMA 4A9AA 3ZXVA 4LDTB 3NY5A 2K22A 2PPHA 3QARA 4R3DA 2KQSA 4DBGA 3VR9B 1WZ3A 4FJYA 3NVVA 2DAFA 4MGIE 1ZPSA 4HKQA 2HTME 2LJIA 4NPNA 3NG0A 2V3SA 1UBIA 1UWMA 1NVID 4ANWA 5HFYA 4B6WA 1A5RA 3HHMA 3ZUNA 3KUZA 5BO4B 5GMVA 2NBUA 2IO1B 1L0YB 2JWUA 3TL5A 2MBQA 3NHEB 3RI7C 1D5MC 4J6IA 3R2TA 4CO7A 1RWSA 3MC9A 3C0RB 3U30A 4I6PA 1FIQA 4A90A 3P2BA 4B95A 4HPPA 4MGZE 1WXAA 4GMVA 4P7IA 1WGKA 1ZDVA 5DPRA 3PHWB 4IUMB 3GE3C 3TMPB 2NPTA 2GOWA 1U4AA 2IZVB 3BVGA 1EWYC 2RSUA 1QOBA 5G55A 2M17A 3RT3B 1JCKB 3L16A 2WGSA 2LUMA 1XQQA 2O2VB 1L6VA 2LGDA 5E6OA 3LB8C 2LUEA 4JQWC 2ICIA 3AE5B 3AV8A 2WXGA 4B0MA 4CHKA 3PV1A 4BFRA 3OG5A 1C3TA 1SJHD 1WYGA 2SEBD 3H1UA 4K3CA 2BVCA 3C19A 3VH4B 3L4PA 2BB5A 3O13A 4L2YA 1UWXA 2BF8B 1LM8B 3UQAA 4WJPA 2AEHA 2IPKD 3K9OB 3Q3NC 3PRMB 3JVZX 5IOIA 3NVWA 1Y56A 3QJZA 1J7AA 1WJUA 2MEKA 3SFEB 2REXA 4NJ6A 3H8HA 2JXTA 4YTMB 1YIWA 2OHFA 1FNUA 5HKHA 2K5PA 1DOIA 1MG4A 5LNK1 5DPSA 4W9CA 2J52A 3IAM1 4XE0A 5E6PA 1L7YA 2D11A 4GN1A 1UGJA 3RZFA 2D3CA 1L4ZB 5L95C 3BYYB 2VRRB 3VTWA 3GS2A 2KLGA 3MJWA 1R4NI 2BYVE 2K1FA 1YN4A 2IGGA 2LZ6A 4GB9A 4BKSD 5BMGA 2Y5CA 1HTOA 3NOBA 1SIFA 4DHZB 2TSSA 2K25A 3Q3OC 5HHDG 3VTVA 1GAQB 4MDKE 4HK2A 5LLIA 3CWIA 3P4QB 1F1HA 1YOVB 4C7ZA 2HJ1A 4W9FA 2BKRB 4AOFA 1OGWA 2KJRA 5EE0A 2LGSA 3UINB 2QEJC 2KMAA 2UWQA 3SU8X 4LNIA 5IO9A 3UGBB 1FXIA 3PT2B 2WS3B 3GP7A 1KLGD 2WXIA 3ZJUA 2PE6B 2MBBB 2KT7A 3TEWA 3BY4B 3GZNB 5AUKA 1HZ6A 2YEPF 2IY1B 3NZ3A 2KTRA 1ZUD2 3RZWC 3PLUA 4W9GA 2WHIA 4MH8A 3KYDD 1T6BX 4LLGM 4GDKB 1FXTB 1VZ8A 2V9HA 1XLQA 4KIKA 2H89B 4MH0E 4RM9A 4M8NA 4JWUC 4PS3A 1UUPA 3QA8A 2CU1A 2CHZA 2O2VA 2M4NA 1P98A 2ZVOA 5D3DA 4PS7A 3HM6X 2MQJA 1TTNA 3GOEA 1WRDB 1MPEA 3R8BA 1TZ1A 4LNOA 4RF1A 2FIFA 4K1RB 2RPQA 4FHKA 2EMTA 2PE9A 3QWZB 1BT0A 3HRDD 2QHOA 4GXBA 3KLSX 3PO0A 1XLNA 1UBQA 3DBLB 5LXIB 2ZPNA 3Q8BA 2G3QB 2MBHA 3DHHC 1JWMD 1PGXA 2L7RA 2ON8A 1NYRA 5AZHA 3KQ4A 1UZXB 5D7GA 1KTKA 3IBEA 2I1KA 1E8WA 3J9CA 4ZOHC 2KMCA 1YN3A 2RPVA 4ITKA 4WWOA 3QCAA 5G2NA 5DPWA 4RCOA 2ZCCA 2DZIA 1WJNA 4ICVA 4G0NB 3TBLD 2K6DB 3MC8A 1V97A 3VRAB 2WNMA 3P4PB 4C4VB 2KJHB 4WIPA 4HJGE 1TS3A 4ANUA 1EU3A 2JZZA 3MC0B 2GB1A 1KJTA 3W2DA 3WA0A 5H92C 4YT0B 3PRZA 4AJWA 4DHZE 4CQNA 2MH7A 3N32A 3ZDTA 1FXAA 2K6QA 3ZNID 4ZRIA 3HIZA 1Y8RC 1TY0A 3B08A 1Q5WB 3AEAB 5AZFA 4F7ZA 3BK2A 3ECIA 1L0XB 1MVKA 2JF5A 3QC8B 2XK5B 3RMKC 2CS4A 2OEDA 2RDGA 1KLUD 5D3IB 3VR8B 3A9JA 1VLBA 2G1EA 4XGAB 2MCNB 1E8ZA 3AH7A 2W55A 1V8CA 3V62A 5FR6A 5BMIA 1J7BA 5EE1A 4B0EA 4AWJA 3CSTA 2J53A 2ZNVB 1E0ZA 5IKCM 3TEYA 2DWQA 1M4VA 1RFAA 4OZCA 1WXQA 3H7PA 3ALBA 1OEYJ 3SD5A 2V3PA 3NZSA 3AE8B 1T5XD 2ZPYA 1I4GA 1E8YA 1FD6A 4DDID 2KDMA 3KYCD 2IBIB 3EC8A 2L32A 3IG3A 2DZMA 1WGRA 3PLVA 4FHJA 4MGKE 4J3OD 1HE8A 4WJNA 4FLHA 1KOTA 3T8MA 4YTPB 2AL3A 3V6EB 2A4ZA 4JE3B 2KDFB 4EE2A 3VAWA 5J17A 3MHSD 1IBXB 4JIOU 2B76B 3AULA 2KTFA 2LMCA 2LVOA 4QAYA 4BKTA 2EKEC 3W5UB 4DXFA 2N9PC 4GIVA 2DYMA 5MPOA 1ZE3D 4HJKA 3VVWB 1XCQL 4IW0A 1N63A 2HE7A 4E3CA 2KC2A 2BS3B 3QIJA 1VCBA 2ONQA 1VRAB 2ZVNA 2I38A 4ANXA 4EFOA 2IO3B 2BYFA 1WGHA 3IT4B 1R4MI 2BWFA 3FILB 4P16A 4GDLB 2I1JA 4BVUC 3CF6E 2H88B 2JPHA 2W3SA 2LWPA 4NJCA 5JZEB 4LNKA 1CK1A 3RNEC 3PZ8A 3TIXA 3AEGB 4KZCA 1SSNA 4BKGA 3P4SB 3R7QA 2N9LA 5D94A 3R3MA 1WXMA 2C5LC 2LGIA 2K8CA 2MLBA 2LXAA 3BIID 4REZA 3BINA 2IYDB 1Z5SB 4OHJA 1P7EA 4RFBA 3DBLI 2OOBB 1YJIA 4RGTA 4WQOB 3U52E 1OEYA 1VZ6A 5EDSA 4WQMA 2CHWA 2HD5B 4LDTD 2V3NA 4C4VA 1C9FA 4MT5A 1YD8U 1JW9D 4A6QA 3Q2AC 3AU4A 4NAMA 3SFDB 2Q5WD 3SDLC 2LHEA 4YWGG 4TKNA 1E7PB 2AQ1B 1JWUD 4KGRA 2M0XA 3A1QA 1WJ6A 2BS4B 3HM3A 2KWUB 3DCGA 3W1YA 5C2TB 5JH5C 1C4CA 1R4NB 2WDVB 4KGSA 2XN9C 1E7UA 2WXJA 4WAFA 2N7DA 1ZP0B 1B1ZA 2ZZPB 5BMHA 2JRHA 4F1SA 2D2QA 1UF0A 4US9A 2Z0EB 4XDCA 2PEAA 2EKIA 3ZNHB 4GSWA 3B0AA 4II3B 3L0WB 1UNSA 2W3RA 5L83A 1WGGA 1YN5A 1IUEA 4XZ4A 1JWBD 4E71A 1WE7A 3ZNZB 3R66C 4HWIB 4P6VF 1ET6A 1Q10A 1ESFA 4ZHPA 3IVFA 1I35A 2FCMA 2CU3A 5D6JB 2D3AA 4MJSA 1P0RA 1FPYA 1QKZA 2LD9A 3C8YA 4US8A 3VUXA 2V0GA 3A9KA 3P42A 4MSQB 4XWWA 2PMVA 4OVUA 3A33B 1WY8A 4DXGA 1IBXA 1LGRA 4LJOB 1TS2A 3X0WA 2JU6X 1SEBD 2DNFA 2V4IB 5AZGA 2ZNVC 3TSSA 2MP2B 3DHGC 2INDC 4XWTA 2KO3A 3MFGA 2QIEB 2JUOA 1C76A 3EFCA 4RGMA 4KX6B 4M00A 4TV3A 1VR9A 3ZLZA 4AJYB 5J2RA 1V9JA 3ZRCA 1MHHE 1E9MA 2N9EB 4KSLC 3H6NA 3OWEB 3FILA 2MWSB 4GDLA 4IWPA 1JMLA 1PGAA 2L0TA 2AYOB 4C80A 1BXTA 1WE6A 2G45B 1GPXA 3Q8FA 2YEPB 2D5GA 3OAWA 4G11A 3OJ3A 1JROA 4FJVB 4YL8A 3CIRB 4BBNF 1GB1A 1Q0WB 2WU5B 1ACCA 5BYSA 1E90A 3N3KB 2GBMA 2CKHB 2MHJA 4EZLA 2FCQA 2NBVB 1BUIC 1V5TA 4Q2JA 2WXLA 4HCNB 4EZJA 1WRIA 2KC1A 4HXDA 4JLCA 3DVGY 4WJQA 1D3ZA 3U7DA 4F8CB 1S3SG 1R7SA 1LXDA 2PTLA 2K3UA 2J7QB 2PIAA 1KM7A 3U2SC 4OZAA 1MG8A 4AS1A 5BYRA 4HLEA 2C7HA 3I9V1 1I4HA 4TQ0A 1GC7A 1BMLC 1XO3A 2RDBC 1J0GA 1V1PB 4TMAB 3AEEB 4MEMA 5AUIA 1EF5A 3P4RB 4II2B 1YQ4B 4K7WA 1QILA 4IM3A 1TGZB 3AI5A 4JGHB 2N0SB 4BOSC 1EU4A 1VZ7A 1YJJA 3PHXB 2PVOD 1FNWA 2AWTA 3L13A 3APDA 1LQBA 5CHVC 4H2AA 4OVZA 2DYBA 1PGBA 2WXFA 1I4QA 1QOAA 3AE3B 2N7JA 3ZQ4A 1OQQA 3VFKA 2N9KA 2GI9A 2GMIC 2BBCA 4WWMA 5JHAA 5LXHA 2KN5A 1F52A 2MJDA 2L0FA 3I5JC 3Q8EA 3T9LA 1EWCA 1WJ4A 2D07B 2CHXA 1GUAB 3SR6A 2JXXA 1FCCC 1WR6E 3RNBC 4IOIE 1X1MA 2MP2A 3Q8CA 3LJ3A 3NJTA 1XXGA 4LJPB 1NEKB 3RD2A 1F2RI 1S1QB 2KN4A 2N1VA 5CHWA 1MJDA 1CZPA 4DK5A 2WXPA 3DHIC 2ZW0A 3B2FA 2N7EA 4HRSA 1CMXB 3VQIA 1F2RC 3VUWA 4ICUA 2KQ4X 3ZTCA 3AE6B 3E9SA 1R4MB 3IAS1 1P9DU 5G5GA 1VDVA 3ABVB 1FRDA 1DOXA 4IC7B 1IGDA 1NENB 4AP4C 2VZKB 5E6JA 4PT5A 3URYA 2JRIB 3EFUA 3HK0A 4YSXB 2R2OA 2D3BA 1V86A 2GBRA 4A20A 3Q3MC 2R61A 1C1YB 1TZOA 5C3JB 2A5UA 1WWTA 1XLPA 3EA6A 5T8IA 1P1AA 3RCZA 3AM9A 1QZEA 4YXDB 1WXSA 4A3PA 2GBNA 4EKUA 4IDIA 5C1ZA 2UU7A 2OJRA 2M0AA 1FFVA 2MJ3A 2XNAC 3ZXRA 2LASA 2IJ0A 1L0VB 1V2YA 2K0PA 4A8XC 1N60A 2INCC 4WWPA 1SBBB 3L54A 3IXSA 2EELA 4N59A 3V61A 2JZ3B 1WMHB 3I63C 5G5HA 4DHJD 2OJWA 3VDZA 2Y3AA 4HPMB 4L23A 3V60A 1WX7A 2IGHA 1SE4A 4W9IA 3NVYA 3Q6BA 1T0QC 2DYOA 5IA7A 5BYQA 2RR9A 4FBJB 1QQRA 4ARCA 1JRPA 1XEEA 3APCA 4PK1A 2YLMA 4LNFA 2V4LA 2IY0B 2WDQB 4E74A 3ONSA 2DENB 2DZJA 1HA5A 1UGMA 4KV2A 3IFWB 3RNCC 4RGOS 4P1CC 4ASWC 1MHXA 2MRPA 3FC4A 4JX1C 1D5XC 1ZXIA 3EUB2 4W9LA 3K9PB 4OVVA 2BPSA 3RNAC 1T0RC 2NTSA 5DPTA 1GJZA 2FE8A 1RRBA 2M8SA 3EECA 4L1BA 2KDEB 3JSVB 4W9KA 3BK1A 2WU2B 1WYWB 1N5XA 3JW0X 2KVRA 1WX8A 1HEZE 1SB3C 1I7HA 3QAQA 2WX0A 3WAMA 4A3OA 1PFDA 4KDIC 2KFKB 1XT9B 4FULA 2IO0B 1K52A 1D5ZC 3UI3A 3Q69A 2BT6A 2L83A 2MW5A 4GDKA 1D6EC 5HI1A 3W5VB 2JT4B 1XCTL 1ZDXA 5CTRC 4HCPB 1T0YA 3MP9A 3I57A 1EO6A 4K3BA 2KX3A 4G50A 3ZVVA 2WDTB 2KWDA 2G9HD 3WIMA 2M56B 1TKYA 3DBHB 1SXTA 2JX5A 4ZDVA 1TBEA 2YVCA 3VRBB 3Q8AA 4HEA1 5FKAC 3RNFC 4GGQA 1IP9A 1E10A 3D32A 1ROEA 3M3JA 2E6XA 3KUCB 3TCAA 1HTQA 3PSEB 1TS4A 4FADA 1JWAD 2PLPA 3DVGX 1H8CA 3VXWA 2CJNA 3DBSA 2MA9B 3BZDB 1ISNA 2JWZA 2C60A 3ZRFA 1IGCA 3CMMB 2DX5B 1OTRB 2WLBA 2IGDA 4M02A 2O6VB 3AN1A 1GOZA 4W9JA 1D4BA 4ZRKA 2AL6A 1JALA 2WDRB 3A4RA 4I6NB 4AQ7A 4N9F4 1C78A 1T3QA 4P1BC 1ENFA 2V1YA 2VH2A 4HDOA 4ZRJA 4ARIA 1OQRA 1WMHA 4TUUA 2INNE 1ZW7A 2N9XA 1SJED 5JHBA 1J8CA 3CSFA 2WP9B 4DQOC 4RNAA 2DAJA 4YTNB 2BTEA 2KX0A 3P1MA 3QHTA 1EUVB 4XYCA 3AXCA 1KF6B 1JQ4A 4M01A 2K39A 1HZ5A 1WSPA 2J0JA 1H4RA 3V6CB 2XEWA 1WI0A 1GB4A 3NVZA 4OZBA 2BW2A 4KGTA 2DLBA 1FO4A 1V5OA 2GBJA 3UIOB 1OFFA 3W1SC 1VJKA 3BWUD 1OQYA 2JVCA 3LXFA 2GBKA 3BVMA 1B9RA 2WXNA 3NRZA 2KD0A 3ML9A 2MSED 3MTNB 1CJEA 2LXCA 2XK5A 1P3QU 1WGYA 2W9NA 2RMMA 1V81A 2HJ8A 5EE3A 4CYEA 1LO5D 2G4DB 2NCNA 1FFUA 3JYUA 1FEHA 2IDYA 3U7ZA 3N30A 4K7SA 2KHWB 1M94A 2LJ5A 1EF1A 4ACFA 5EE9A 4YSYB 3L10B 2KFKA 3AEDB 5KHOA 3PS6A 3B9JA 2KK8A 2J0MA 1WH3A 3QX1A 3UF8A 1DYQA 5IP4D 1RAXA 2FAZA 2I2YA 3NS8A 4PYUA 1V49A 2KANA 1Q1OA 1QOFA 4W9DA 4IM0A 4MELA 2RDHA 1TKEA 4S0RA 2FCNA 3GE8C 1T0SC 1P7FA 2MJEA 3Q3FA 1JWSD 2NVUI 2L3ZA 2JZPA 1QLBB 3DBRI 3AE4B 2NS5A 2D3GA 3ZNGC 4DDGD 3M63B 1Z2MA 2QMTA 2KXJA 4LNNA 2LGYA 1L2NA 2BWES 3VUYA 1YQBA 4RH6A 1NBFC 1TJEA 4HROA 2Y5BB 1J7CA 3AMZA 2ACZB 2ASQA 3AE2B 5DCNA 4WH4A 1STEA 3U8ZA 4LTUA 3ZO5B 4W9HA 4PYZA 4PS8A 4URKA 3DBHI 2KTRB 2FNJB 3P63A 1GG3A 1YQ3B 2O6VA 2PJHA 3LYYA 3SHQA 1FNVA 5H8YE 4IWOA 3WAPA 5AEKB 3Q3JA 3ZW3A 1ZOYB 4KIKB 1TKGA 1IPGA 1XLOA 1N61A 2XBBC 3AEFB 4KKJA 2FUHB 2HTHA 3TJPA 2JSVX 3NUHB 1PUTA 2UYZB 3ETRA 1K8RB 4C00A 4TSSA 4YSZB 2KWCA 3NZUA 4M0WB 3B1LX 3IHPC 2W82A 2HDEA 1SIJA 2BQQA 2N4FA 2ZCBA 4JWSC 1WM2A 2B3AA 3I3TB 3T3OA 3DWGC 4NQLB 2ZJDA 1ET9A 4XDDA 3RFZB 2M1MA 3A4SC 2E3TA 1WZ0A 4KVGB 3AE7B 4I6LB 4X57B 1FM0D 1C4AA 1ZKHA 4MACA 4HPLB 4RM8A 1WGDA 3AECB 1WR1A 3AE1B 3OJ4B 1HQRD 4G3XB 1IYFA
chains in the Genus database with same CATH topology
2EKEC 4EEWA 2KDIA 3H7SA 1V80A 2LASA 3ZIMA 2N9PC 4BOZB 4GIVA 2DYMA 4KZ0A 1V2YA 2C9WB 3KUDB 4HJKA 4LDTB 3NY5A 3VVWB 4WWPA 2PPHA 3QARA 3L54A 4IW0A 2NBWB 5E6NA 2HE7A 4HVBA 4E3CA 2KC2A 2KQSA 4DBGA 3V61A 1WZ3A 2JZ3B 3QIJA 2IO2B 4FJYA 1VCBA 1WMHB 2L8JA 4DHJD 3VDZA 2DAFA 4HPMB 4MGIE 2ZVNA 3V60A 1WX9A 1WX7A 3DQVA 4NPNA 2V3SA 4ANXA 4EFOA 1UBIA 3O65B 2IO3B 2BYFA 1WGHA 3PTFC 4W9IA 4ANWA 1R4MI 2BWFA 4BBNC 4GDLB 4DWFA 2DYOA 2I1JA 4B6WA 4BKTA 5IA7A 3HHMA 1A5RA 4BVUC 3ZUNA 2RR9A 3CF6E 3KUZA 5BO4B 4FBJB 5GMVA 1SE9A 2NBUA 3R7RA 2JPHA 1SGHA 2IO1B 5JZEB 2LWPA 3TL5A 4NJ7A 3PRPB 1PQSA 3APCA 3PREA 3TIXA 1YX5B 4KZCA 2MBQA 2YLMA 3NHEB 4J6IA 4BKGA 4ZYNA 3R7QA 5D94A 4CO7A 3U30A 2V4LA 3C0RB 3R3MA 1WXMA 2C5LC 2MLBA 2K8CA 4FN2A 2LXAA 3P2BA 4I6PA 4B95A 2RGFA 3BINA 4MGZE 1WXAA 2IY0B 4GMVA 3WANA 4E74A 2K8HA 2DENB 2IYDB 3L17A 1Z5SB 3ONSA 4WWNA 4P7IA 2DZJA 2FIDA 1UGMA 3DBLI 4KV2A 3IFWB 1XD3B 2OOBB 5DPRA 1J19A 3PHWB 3OLMD 4WQOB 4GU2A 4IUMB 3A9JB 1OEYA 5C23A 4ASWC 5EDSA 2CHWA 3TMPB 2MRPA 2NPTA 2HD5B 4LDTD 3PGEA 2GOWA 1U4AA 2IZVB 4W9LA 2RSUA 3K9PB 1YD8U 3APFA 4OVVA 2Z0DB 2BPSA 5G55A 1G6JA 2M17A 2LVPA 3RT3B 3AU4A 3L16A 2J0KA 5DPTA 3SDLC 1GJZA 1XQQA 2O2VB 2LGDA 1RRBA 5E6OA 2KKCA 4EZJA 4TKNA 1LFDA 4GOCA 2M8SA 3ZKJC 3H7PB 2LUEA 3EECA 4JQWC 2KDEB 3JSVB 4W9KA 2M0XA 2KFJA 1WYWB 3A1QA 1WJ6A 2KVRA 3JW0X 1WX8A 3PV1A 2KZRA 4CHKA 4BFRA 2KQ7A 3HM3A 2KWUB 3DCGA 1C3TA 2KDBA 1JRUA 1VD2A 3QAQA 2KLCA 3W1YA 4JL9A 5JH5C 4MSMB 2WX0A 3H1UA 3WAMA 1E7UA 4A3OA 3VH4B 2N7DA 1WFYA 4KDIC 2KFKB 3M62B 4IM2A 1WF9A 1XT9B 2ZZPB 4FULA 2BF8B 3ML8A 1LM8B 3UQAA 2JRHA 2IO0B 4M8MA 4F1SA 4WJPA 5CX3A 2AEHA 2D2QA 1YJ1A 2JY6A 3K9OB 2MW5A 2R2QA 4GDKA 2Z0EB 3PRMB 2PEAA 3ZNHB 2JT4B 4GSWA 3QK0A 3JVZX 5CTRC 1V6EA 4HCPB 3B0AA 2DZKA 3DDCB 4II3B 1T0YA 1EO6A 1F9JA 3QJZA 2KX3A 3L0WB 4TQ1A 4G50A 1WJUA 3ZVVA 2WDTB 5L83A 1WGGA 3WIMA 2REXA 4XZ4A 4NJ6A 4E71A 1WE7A 3ZNZB 2DHZA 1YIWA 3R66C 4HWIB 4ZDVA 2WWZA 3RYTA 1TBEA 2YVCA 5HKHA 2BGFA 3IVFA 1I35A 2FCMA 5DPSA 5D6JB 4NAWB 4W9CA 3DVNV 3H9DA 4MGYE 1ZGUB 4MJSA 1P0RA 5E6PA 4GGQA 1IP9A 1L7YA 2D11A 3D32A 3M3JA 4GN1A 2KWVB 2LD9A 1YX6B 3KUCB 2CR5A 3RZFA 3TCAA 3PSEB 3WALA 5L95C 2BKFA 4NY0A 4WAAA 3VUXA 3ZDMC 4FADA 1UD7A 2VRRB 2KJ6A 3A9KA 3DVGX 3VTWA 2KLGA 4XX5A 4MSQB 1H8CA 2KNBA 3VXWA 3DBSA 2MA9B 1ISNA 2JWZA 3MJWA 1R4NI 2C60A 4OVUA 3A33B 1WY8A 3ZRFA 2BYVE 3UQBA 3CMMB 2K1FA 2DX5B 1OTRB 1UH6A 4FA6A 2O6VB 4LJOB 2LZ6A 4GB9A 4BKSD 3X0WA 4W9JA 4ZRKA 2AL6A 2ZNVC 5AZGA 2MP2B 3LDZE 4WJOA 2KO3A 3NOBA 1SIFA 4DHZB 4I6NB 3A4RA 3AU5A 4KDLB 4N9F4 2K25A 2JUOA 1GC6A 1RLFA 3VTVA 4HDQA 4MDKE 2LGXA 4HK2A 4NQKE 5LLIA 2V1YA 3WAOA 4TV3A 4HDOA 4ZRJA 3QQ8B 2WX1A 3ZLZA 1WMHA 4AJYB 4TUUA 4W9FA 2BKRB 2L76A 4AOFA 5J2RA 1OGWA 1V9JA 3ZRCA 2KJRA 1ZW7A 4DXAB 2N9XA 5JHBA 1J8CA 3UINB 2N9EB 4KSLC 3H6NA 3CSFA 2KMAA 2UWQA 2MWSB 4GDLA 3SU8X 5D2MB 3A1QB 2DAJA 5TR5A 3UGBB 3PT2B 2KX0A 4IWPA 3QHTA 4XC2A 1WIAA 1EUVB 3KVFB 3AXCA 2PE6B 2MBBB 2L0TA 2AYOB 3BY4B 2K39A 2J0JA 1WE6A 2G45B 1H4RA 2IY1B 2XEWA 3V6CB 1WI0A 2KTRA 2MX2A 3OAWA 4G11A 3RZWC 3VH3B 3OJ3A 2O6VD 3PLUA 1V5OA 4W9GA 2GBJA 3UIOB 4FJVB 4YL8A 3W1SC 4BBNF 3EHVA 3KYDD 1Q0WB 1OQYA 4GDKB 2JVCA 1E90A 3N3KB 1FXTB 2GBKA 2GBMA 2KOXA 2CKHB 3VHTC 5J18A 4EZLA 4KIKA 2KD0A 3ML9A 2FCQA 4MH0E 4RM9A 1AARA 2MSED 3MTNB 2BYEA 2LXCA 2NBVB 4M8NA 2XK5A 1P3QU 1WGYA 4FJZA 4AUQC 1V5TA 4PS3A 2W9NA 3QA8A 4DHJB 2CU1A 2CHZA 2O2VA 1V81A 2HJ8A 2M4NA 1P98A 2ZVOA 1I42A 4HCNB 4PS7A 2KC1A 3L08A 4HXDA 4JLCA 4CYEA 1NDDA 2G4DB 2MQJA 1TTNA 2NCNA 3GOEA 3DVGY 3HM6X 1WRDB 4WJQA 1D3ZA 1TZ1A 3JYUA 3U7DA 2ZEQA 2NR2A 2FIFA 4K1RB 2RPQA 1S3SG 3N30A 2L05A 4FHKA 4MJSB 4F8CB 2EMTA 1LXDA 2PE9A 3QWZB 1E5WA 1BT0A 4K7SA 2J7QB 2KHWB 1KM7A 1M94A 2QHOA 2LJ5A 4GXBA 1MG8A 4RMAA 3VTUA 4HLEA 1EF1A 4EUTA 2C7HA 2L00B 4TQ0A 3A9KB 1UBQA 3L10B 5LXIB 2KFKA 2ZPNA 3KH0A 2G3QB 2MBHA 3PS6A 5KHOA 1GC7A 2KK8A 2J0MA 1WH3A 2L7RA 3QX1A 3UF8A 1J0GA 3GZNI 4MEMA 4IWQA 5AZHA 3PZDA 1RAXA 1UZXB 2FAZA 2MBEA 3NS8A 4PYUA 5D7GA 1V49A 2KANA 1Q1OA 3IBEA 4BKSA 4W9DA 1EF5A 4II2B 4IM0A 2I1KA 4MELA 1E8WA 4K7WA 2KMCA 2FCNA 2N1WA 4IM3A 2RD0A 2MBOA 3Q3FA 1KLVA 1TGZB 2NVUI 2L3ZA 4WWOA 3AI5A 3QCAA 4JGHB 3DBRI 5G2NA 5DPWA 4BOSC 3PVLA 2NS5A 2D3GA 2ZCCA 3ZNGC 2DZIA 1WJNA 4DDGD 3M63B 1Z2MA 3PPAA 3PHXB 2AWTA 1WXVA 2KXJA 3L13A 4ICVA 4G0NB 3TBLD 3APDA 2K6DB 2LGYA 2NPTB 3DOWA 1LQBA 1L2NA 2BWES 5CHVC 3W1SA 3VUYA 1YQBA 2KJHB 4NAWA 1NBFC 4W9EA 1WM3A 2Y5BB 2DYBA 3KW5B 1IYFA 2ASQA 5DCNA 2D10A 4ANUA 2JZZA 3U8ZA 4IG7B 1KJTA 3VFKA 3DVNU 3WA0A 2GMIC 4K7UA 4W9HA 4PYZA 4PS8A 3ZO5B 3PRZA 4URKA 3DBHI 4AJWA 5JHAA 4DHZE 5LXHA 2KN5A 3RULA 2KTRB 2FNJB 3N32A 3ZDTA 2L0FA 1GG3A 3T9LA 2K6QA 3ZNID 2O6VA 1WJ4A 2D07B 2PJHA 3HIZA 2CHXA 1GUAB 4ZRIA 3RUIB 1Y8RC 3SHQA 2JXXA 1WR6E 3WAPA 4IWOA 3B08A 1X1MA 2MP2A 5AEKB 1Q5WB 3Q3JA 3ZW3A 4K81A 4F7ZA 5AZFA 4KIKB 3LJ3A 4LJPB 3ECIA 3RD2A 2EMSA 1IPGA 2JF5A 2XBBC 3QC8B 1S1QB 4B9KA 2XK5B 2CS4A 2G4SA 3ZTDA 3ENEA 2FUHB 2HTHA 2N1VA 3M95A 5CHWA 3TJPA 4DK5A 3A9JA 2LRWA 4EOYA 3DPDA 2UYZB 2MCNB 1E8ZA 4KSKC 2N7EA 1K8RB 3V62A 1CMXB 1NI2A 5FR6A 3VQIA 3VUWA 4ICUA 3ZTCA 5CHFA 4AWJA 3CSTA 2ZNVB 2KWCA 3NZUA 4M0WB 3B1LX 2C7NB 1P9DU 4NNJB 3IHPC 1RFAA 3UIPB 3H7PA 3ALBA 1UELA 2FCSA 1OEYJ 2N4FA 2Z59B 2ZCBA 3JSVA 3NZSA 4MM3A 3SD5A 5KHQA 4IC7B 2ZPYA 4AP4C 1E8YA 1WM2A 2B3AA 3I3TB 4DDID 2JRIB 3EFUA 3KYCD 3HK0A 2IBIB 2R2OA 3EC8A 1GNUA 3IG3A 1V86A 2ZJDA 4NQLB 2DZMA 2GBRA 4LCDE 4A20A 1WGRA 1E7VA 2C7MB 2K8BA 3PLVA 2LRUA 1C1YB 4FHJA 4MGKE 2M1MA 2LI5A 5IAAC 4EZKA 1HE8A 2A5UA 4WJNA 2WYQA 4FLHA 3A4SC 1WZ0A 4KVGB 1E8XA 4ANVA 1KOTA 1P1AA 3T8MA 2AL3A 4I6LB 3RCZA 3S2AA 4X57B 1QZEA 3V6EB 1WXSA 2A4ZA 4A3PA 2GBNA 2KDFB 4EKUA 5J17A 3VAWA 1ZKHA 3MHSD 5C1ZA 4HPLB 4RM8A 1WGDA 3X23A 4JIOU 1WR1A 2OJRA 3OJ4B 3AULA 2KTFA 2LVOA 4G3XB 2LVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKE C;  4EEW A;  2KDI A;  3H7S A;  1V80 A;  2LAS A;  3ZIM A;  2N9P C;  4BOZ B;  4GIV A;  2DYM A;  4KZ0 A;  1V2Y A;  2C9W B;  3KUD B;  4HJK A;  4LDT B;  3NY5 A;  3VVW B;  4WWP A;  2PPH A;  3QAR A;  3L54 A;  4IW0 A;  2NBW B;  5E6N A;  2HE7 A;  4HVB A;  4E3C A;  2KC2 A;  2KQS A;  4DBG A;  3V61 A;  1WZ3 A;  2JZ3 B;  3QIJ A;  2IO2 B;  4FJY A;  1VCB A;  1WMH B;  2L8J A;  4DHJ D;  3VDZ A;  2DAF A;  4HPM B;  4MGI E;  2ZVN A;  3V60 A;  1WX9 A;  1WX7 A;  3DQV A;  4NPN A;  2V3S A;  4ANX A;  4EFO A;  1UBI A;  3O65 B;  2IO3 B;  2BYF A;  1WGH A;  3PTF C;  4W9I A;  4ANW A;  1R4M I;  2BWF A;  4BBN C;  4GDL B;  4DWF A;  2DYO A;  2I1J A;  4B6W A;  4BKT A;  5IA7 A;  3HHM A;  1A5R A;  4BVU C;  3ZUN A;  2RR9 A;  3CF6 E;  3KUZ A;  5BO4 B;  4FBJ B;  5GMV A;  1SE9 A;  2NBU A;  3R7R A;  2JPH A;  1SGH A;  2IO1 B;  5JZE B;  2LWP A;  3TL5 A;  4NJ7 A;  3PRP B;  1PQS A;  3APC A;  3PRE A;  3TIX A;  1YX5 B;  4KZC A;  2MBQ A;  2YLM A;  3NHE B;  4J6I A;  4BKG A;  4ZYN A;  3R7Q A;  5D94 A;  4CO7 A;  3U30 A;  2V4L A;  3C0R B;  3R3M A;  1WXM A;  2C5L C;  2MLB A;  2K8C A;  4FN2 A;  2LXA A;  3P2B A;  4I6P A;  4B95 A;  2RGF A;  3BIN A;  4MGZ E;  1WXA A;  2IY0 B;  4GMV A;  3WAN A;  4E74 A;  2K8H A;  2DEN B;  2IYD B;  3L17 A;  1Z5S B;  3ONS A;  4WWN A;  4P7I A;  2DZJ A;  2FID A;  1UGM A;  3DBL I;  4KV2 A;  3IFW B;  1XD3 B;  2OOB B;  5DPR A;  1J19 A;  3PHW B;  3OLM D;  4WQO B;  4GU2 A;  4IUM B;  3A9J B;  1OEY A;  5C23 A;  4ASW C;  5EDS A;  2CHW A;  3TMP B;  2MRP A;  2NPT A;  2HD5 B;  4LDT D;  3PGE A;  2GOW A;  1U4A A;  2IZV B;  4W9L A;  2RSU A;  3K9P B;  1YD8 U;  3APF A;  4OVV A;  2Z0D B;  2BPS A;  5G55 A;  1G6J A;  2M17 A;  2LVP A;  3RT3 B;  3AU4 A;  3L16 A;  2J0K A;  5DPT A;  3SDL C;  1GJZ A;  1XQQ A;  2O2V B;  2LGD A;  1RRB A;  5E6O A;  2KKC A;  4EZJ A;  4TKN A;  1LFD A;  4GOC A;  2M8S A;  3ZKJ C;  3H7P B;  2LUE A;  3EEC A;  4JQW C;  2KDE B;  3JSV B;  4W9K A;  2M0X A;  2KFJ A;  1WYW B;  3A1Q A;  1WJ6 A;  2KVR A;  3JW0 X;  1WX8 A;  3PV1 A;  2KZR A;  4CHK A;  4BFR A;  2KQ7 A;  3HM3 A;  2KWU B;  3DCG A;  1C3T A;  2KDB A;  1JRU A;  1VD2 A;  3QAQ A;  2KLC A;  3W1Y A;  4JL9 A;  5JH5 C;  4MSM B;  2WX0 A;  3H1U A;  3WAM A;  1E7U A;  4A3O A;  3VH4 B;  2N7D A;  1WFY A;  4KDI C;  2KFK B;  3M62 B;  4IM2 A;  1WF9 A;  1XT9 B;  2ZZP B;  4FUL A;  2BF8 B;  3ML8 A;  1LM8 B;  3UQA A;  2JRH A;  2IO0 B;  4M8M A;  4F1S A;  4WJP A;  5CX3 A;  2AEH A;  2D2Q A;  1YJ1 A;  2JY6 A;  3K9O B;  2MW5 A;  2R2Q A;  4GDK A;  2Z0E B;  3PRM B;  2PEA A;  3ZNH B;  2JT4 B;  4GSW A;  3QK0 A;  3JVZ X;  5CTR C;  1V6E A;  4HCP B;  3B0A A;  2DZK A;  3DDC B;  4II3 B;  1T0Y A;  1EO6 A;  1F9J A;  3QJZ A;  2KX3 A;  3L0W B;  4TQ1 A;  4G50 A;  1WJU A;  3ZVV A;  2WDT B;  5L83 A;  1WGG A;  3WIM A;  2REX A;  4XZ4 A;  4NJ6 A;  4E71 A;  1WE7 A;  3ZNZ B;  2DHZ A;  1YIW A;  3R66 C;  4HWI B;  4ZDV A;  2WWZ A;  3RYT A;  1TBE A;  2YVC A;  5HKH A;  2BGF A;  3IVF A;  1I35 A;  2FCM A;  5DPS A;  5D6J B;  4NAW B;  4W9C A;  3DVN V;  3H9D A;  4MGY E;  1ZGU B;  4MJS A;  1P0R A;  5E6P A;  4GGQ A;  1IP9 A;  1L7Y A;  2D11 A;  3D32 A;  3M3J A;  4GN1 A;  2KWV B;  2LD9 A;  1YX6 B;  3KUC B;  2CR5 A;  3RZF A;  3TCA A;  3PSE B;  3WAL A;  5L95 C;  2BKF A;  4NY0 A;  4WAA A;  3VUX A;  3ZDM C;  4FAD A;  1UD7 A;  2VRR B;  2KJ6 A;  3A9K A;  3DVG X;  3VTW A;  2KLG A;  4XX5 A;  4MSQ B;  1H8C A;  2KNB A;  3VXW A;  3DBS A;  2MA9 B;  1ISN A;  2JWZ A;  3MJW A;  1R4N I;  2C60 A;  4OVU A;  3A33 B;  1WY8 A;  3ZRF A;  2BYV E;  3UQB A;  3CMM B;  2K1F A;  2DX5 B;  1OTR B;  1UH6 A;  4FA6 A;  2O6V B;  4LJO B;  2LZ6 A;  4GB9 A;  4BKS D;  3X0W A;  4W9J A;  4ZRK A;  2AL6 A;  2ZNV C;  5AZG A;  2MP2 B;  3LDZ E;  4WJO A;  2KO3 A;  3NOB A;  1SIF A;  4DHZ B;  4I6N B;  3A4R A;  3AU5 A;  4KDL B;  4N9F 4;  2K25 A;  2JUO A;  1GC6 A;  1RLF A;  3VTV A;  4HDQ A;  4MDK E;  2LGX A;  4HK2 A;  4NQK E;  5LLI A;  2V1Y A;  3WAO A;  4TV3 A;  4HDO A;  4ZRJ A;  3QQ8 B;  2WX1 A;  3ZLZ A;  1WMH A;  4AJY B;  4TUU A;  4W9F A;  2BKR B;  2L76 A;  4AOF A;  5J2R A;  1OGW A;  1V9J A;  3ZRC A;  2KJR A;  1ZW7 A;  4DXA B;  2N9X A;  5JHB A;  1J8C A;  3UIN B;  2N9E B;  4KSL C;  3H6N A;  3CSF A;  2KMA A;  2UWQ A;  2MWS B;  4GDL A;  3SU8 X;  5D2M B;  3A1Q B;  2DAJ A;  5TR5 A;  3UGB B;  3PT2 B;  2KX0 A;  4IWP A;  3QHT A;  4XC2 A;  1WIA A;  1EUV B;  3KVF B;  3AXC A;  2PE6 B;  2MBB B;  2L0T A;  2AYO B;  3BY4 B;  2K39 A;  2J0J A;  1WE6 A;  2G45 B;  1H4R A;  2IY1 B;  2XEW A;  3V6C B;  1WI0 A;  2KTR A;  2MX2 A;  3OAW A;  4G11 A;  3RZW C;  3VH3 B;  3OJ3 A;  2O6V D;  3PLU A;  1V5O A;  4W9G A;  2GBJ A;  3UIO B;  4FJV B;  4YL8 A;  3W1S C;  4BBN F;  3EHV A;  3KYD D;  1Q0W B;  1OQY A;  4GDK B;  2JVC A;  1E90 A;  3N3K B;  1FXT B;  2GBK A;  2GBM A;  2KOX A;  2CKH B;  3VHT C;  5J18 A;  4EZL A;  4KIK A;  2KD0 A;  3ML9 A;  2FCQ A;  4MH0 E;  4RM9 A;  1AAR A;  2MSE D;  3MTN B;  2BYE A;  2LXC A;  2NBV B;  4M8N A;  2XK5 A;  1P3Q U;  1WGY A;  4FJZ A;  4AUQ C;  1V5T A;  4PS3 A;  2W9N A;  3QA8 A;  4DHJ B;  2CU1 A;  2CHZ A;  2O2V A;  1V81 A;  2HJ8 A;  2M4N A;  1P98 A;  2ZVO A;  1I42 A;  4HCN B;  4PS7 A;  2KC1 A;  3L08 A;  4HXD A;  4JLC A;  4CYE A;  1NDD A;  2G4D B;  2MQJ A;  1TTN A;  2NCN A;  3GOE A;  3DVG Y;  3HM6 X;  1WRD B;  4WJQ A;  1D3Z A;  1TZ1 A;  3JYU A;  3U7D A;  2ZEQ A;  2NR2 A;  2FIF A;  4K1R B;  2RPQ A;  1S3S G;  3N30 A;  2L05 A;  4FHK A;  4MJS B;  4F8C B;  2EMT A;  1LXD A;  2PE9 A;  3QWZ B;  1E5W A;  1BT0 A;  4K7S A;  2J7Q B;  2KHW B;  1KM7 A;  1M94 A;  2QHO A;  2LJ5 A;  4GXB A;  1MG8 A;  4RMA A;  3VTU A;  4HLE A;  1EF1 A;  4EUT A;  2C7H A;  2L00 B;  4TQ0 A;  3A9K B;  1UBQ A;  3L10 B;  5LXI B;  2KFK A;  2ZPN A;  3KH0 A;  2G3Q B;  2MBH A;  3PS6 A;  5KHO A;  1GC7 A;  2KK8 A;  2J0M A;  1WH3 A;  2L7R A;  3QX1 A;  3UF8 A;  1J0G A;  3GZN I;  4MEM A;  4IWQ A;  5AZH A;  3PZD A;  1RAX A;  1UZX B;  2FAZ A;  2MBE A;  3NS8 A;  4PYU A;  5D7G A;  1V49 A;  2KAN A;  1Q1O A;  3IBE A;  4BKS A;  4W9D A;  1EF5 A;  4II2 B;  4IM0 A;  2I1K A;  4MEL A;  1E8W A;  4K7W A;  2KMC A;  2FCN A;  2N1W A;  4IM3 A;  2RD0 A;  2MBO A;  3Q3F A;  1KLV A;  1TGZ B;  2NVU I;  2L3Z A;  4WWO A;  3AI5 A;  3QCA A;  4JGH B;  3DBR I;  5G2N A;  5DPW A;  4BOS C;  3PVL A;  2NS5 A;  2D3G A;  2ZCC A;  3ZNG C;  2DZI A;  1WJN A;  4DDG D;  3M63 B;  1Z2M A;  3PPA A;  3PHX B;  2AWT A;  1WXV A;  2KXJ A;  3L13 A;  4ICV A;  4G0N B;  3TBL D;  3APD A;  2K6D B;  2LGY A;  2NPT B;  3DOW A;  1LQB A;  1L2N A;  2BWE S;  5CHV C;  3W1S A;  3VUY A;  1YQB A;  2KJH B;  4NAW A;  1NBF C;  4W9E A;  1WM3 A;  2Y5B B;  2DYB A;  3KW5 B;  1IYF A;  2ASQ A;  5DCN A;  2D10 A;  4ANU A;  2JZZ A;  3U8Z A;  4IG7 B;  1KJT A;  3VFK A;  3DVN U;  3WA0 A;  2GMI C;  4K7U A;  4W9H A;  4PYZ A;  4PS8 A;  3ZO5 B;  3PRZ A;  4URK A;  3DBH I;  4AJW A;  5JHA A;  4DHZ E;  5LXH A;  2KN5 A;  3RUL A;  2KTR B;  2FNJ B;  3N32 A;  3ZDT A;  2L0F A;  1GG3 A;  3T9L A;  2K6Q A;  3ZNI D;  2O6V A;  1WJ4 A;  2D07 B;  2PJH A;  3HIZ A;  2CHX A;  1GUA B;  4ZRI A;  3RUI B;  1Y8R C;  3SHQ A;  2JXX A;  1WR6 E;  3WAP A;  4IWO A;  3B08 A;  1X1M A;  2MP2 A;  5AEK B;  1Q5W B;  3Q3J A;  3ZW3 A;  4K81 A;  4F7Z A;  5AZF A;  4KIK B;  3LJ3 A;  4LJP B;  3ECI A;  3RD2 A;  2EMS A;  1IPG A;  2JF5 A;  2XBB C;  3QC8 B;  1S1Q B;  4B9K A;  2XK5 B;  2CS4 A;  2G4S A;  3ZTD A;  3ENE A;  2FUH B;  2HTH A;  2N1V A;  3M95 A;  5CHW A;  3TJP A;  4DK5 A;  3A9J A;  2LRW A;  4EOY A;  3DPD A;  2UYZ B;  2MCN B;  1E8Z A;  4KSK C;  2N7E A;  1K8R B;  3V62 A;  1CMX B;  1NI2 A;  5FR6 A;  3VQI A;  3VUW A;  4ICU A;  3ZTC A;  5CHF A;  4AWJ A;  3CST A;  2ZNV B;  2KWC A;  3NZU A;  4M0W B;  3B1L X;  2C7N B;  1P9D U;  4NNJ B;  3IHP C;  1RFA A;  3UIP B;  3H7P A;  3ALB A;  1UEL A;  2FCS A;  1OEY J;  2N4F A;  2Z59 B;  2ZCB A;  3JSV A;  3NZS A;  4MM3 A;  3SD5 A;  5KHQ A;  4IC7 B;  2ZPY A;  4AP4 C;  1E8Y A;  1WM2 A;  2B3A A;  3I3T B;  4DDI D;  2JRI B;  3EFU A;  3KYC D;  3HK0 A;  2IBI B;  2R2O A;  3EC8 A;  1GNU A;  3IG3 A;  1V86 A;  2ZJD A;  4NQL B;  2DZM A;  2GBR A;  4LCD E;  4A20 A;  1WGR A;  1E7V A;  2C7M B;  2K8B A;  3PLV A;  2LRU A;  1C1Y B;  4FHJ A;  4MGK E;  2M1M A;  2LI5 A;  5IAA C;  4EZK A;  1HE8 A;  2A5U A;  4WJN A;  2WYQ A;  4FLH A;  3A4S C;  1WZ0 A;  4KVG B;  1E8X A;  4ANV A;  1KOT A;  1P1A A;  3T8M A;  2AL3 A;  4I6L B;  3RCZ A;  3S2A A;  4X57 B;  1QZE A;  3V6E B;  1WXS A;  2A4Z A;  4A3P A;  2GBN A;  2KDF B;  4EKU A;  5J17 A;  3VAW A;  1ZKH A;  3MHS D;  5C1Z A;  4HPL B;  4RM8 A;  1WGD A;  3X23 A;  4JIO U;  1WR1 A;  2OJR A;  3OJ4 B;  3AUL A;  2KTF A;  2LVO A;  4G3X B;  2LVQ A; 
#chains in the Genus database with same CATH topology
 2KDI A;  3H7S A;  1V80 A;  2PVG C;  4BOZ B;  4KZ0 A;  2C9W B;  3KUD B;  2NBW B;  5E6N A;  4HVB A;  2L1A A;  3N9Y C;  1I4X A;  2IO2 B;  1L4D B;  2FUG 1;  2L8J A;  2WXO A;  1WX9 A;  3DQV A;  3O65 B;  3PTF C;  3N1X C;  2VZK D;  4BBN C;  4DWF A;  1AWD A;  4GLS C;  1SE9 A;  3R7R A;  1SGH A;  2M19 A;  4NJ7 A;  4ZRQ A;  3PRP B;  1PQS A;  3AB5 A;  3PRE A;  4D2K A;  1YX5 B;  2JQR B;  1CQV A;  4ZYN A;  4OW0 A;  1I4P A;  4FN2 A;  2RGF A;  4UDU C;  3WAN A;  2K8H A;  2X8X X;  3L17 A;  4WWN A;  1EM7 A;  2FID A;  1XD3 B;  1J19 A;  3OLM D;  4GU2 A;  3A9J B;  5C23 A;  2WXQ A;  3FKY A;  4A55 A;  1AN8 A;  4FXC A;  1RFK A;  3PGE A;  3APF A;  2J42 A;  2Z0D B;  1G6J A;  1KH0 A;  2BB6 A;  3ZGZ A;  2LVP A;  2GLS A;  3GB1 A;  1TT5 B;  2J0K A;  3ZJV A;  2KKC A;  1LFD A;  4GOC A;  3ZKJ C;  3H7P B;  2PW9 A;  4HKZ E;  1E6E B;  2KFJ A;  4RF0 A;  4WUR A;  2KZR A;  2KQ7 A;  2KDB A;  1JRU A;  1VD2 A;  2KLC A;  2QDF A;  4JL9 A;  4MSM B;  3KWL A;  1AYF A;  2AQ2 B;  1WFY A;  2Z8L A;  3M62 B;  4IM2 A;  1QF6 A;  1WF9 A;  3ML8 A;  4M8M A;  5CX3 A;  1FCL A;  2LEK A;  1YJ1 A;  2JYT A;  2K9X A;  2JY6 A;  2R2Q A;  2X38 A;  3AE9 B;  3QK0 A;  1V6E A;  1PYW D;  2DZK A;  3DDC B;  1K53 A;  3AEB B;  1F9J A;  4TQ1 A;  1C4P A;  3E56 A;  2JYE A;  3WCQ A;  4M0W A;  2DHZ A;  2WWZ A;  3RYT A;  3IT6 B;  2BGF A;  4N6E B;  1K51 A;  3N1Z C;  4KKI A;  4NAW B;  3DVN V;  3H9D A;  4MGY E;  1RM6 C;  1ZGU B;  4JPS A;  3RNG C;  3FAH A;  2KWV B;  1YX6 B;  2CR5 A;  3R2I A;  2KAJ A;  3WAL A;  1NYQ A;  2BKF A;  4NY0 A;  4WAA A;  3ZDM C;  1UD7 A;  2KJ6 A;  2QSD A;  4XX5 A;  2KNB A;  1HXY D;  2GRI A;  3Q14 C;  1SE3 A;  3UQB A;  1V1P A;  1UH6 A;  4FA6 A;  1N62 A;  1N6Z A;  3LDZ E;  4WJO A;  3AU5 A;  4KDL B;  1GC6 A;  1RLF A;  4HDQ A;  3BYT B;  2LGX A;  4NQK E;  3WAO A;  3QQ8 B;  2WX1 A;  2AX5 A;  2L76 A;  1N5W A;  5GXG B;  2QC8 A;  2BS2 B;  3V3X A;  4DXA B;  4LK0 M;  3PZ7 A;  1K50 A;  1L6U A;  2QIL A;  5IN7 A;  3DWM A;  5D2M B;  3A1Q B;  5TR5 A;  1YNT E;  3BVZ A;  1AW7 A;  3T3N A;  3HUI A;  4XC2 A;  1WIA A;  3KVF B;  2LFI A;  2DBY A;  4MM3 B;  3ZYY X;  1TY2 A;  3NS1 A;  1MI0 A;  2WXH A;  2MX2 A;  2VH1 A;  3VH3 B;  1A70 A;  2O6V D;  2LHD A;  3EHV A;  4ZYS A;  2ZW1 A;  2KOX A;  3DBR B;  3VHT C;  2AQ3 B;  5J18 A;  1F0Z A;  2WXM A;  3MHZ A;  3MJ5 A;  1KRH A;  1AAR A;  2BYE A;  4FJZ A;  3N1Y C;  4AUQ C;  3N20 C;  1YMH E;  4DHJ B;  2INP E;  1I42 A;  3L08 A;  5TSS A;  4O1N A;  1NDD A;  3TUO A;  1F77 A;  2Y5P A;  2ZEQ A;  3U4E G;  2NR2 A;  2L05 A;  4MJS B;  1E5W A;  5HG2 A;  4RMA A;  3VTU A;  2KMM A;  4EUT A;  3SEB A;  2L00 B;  3A9K B;  3KH0 A;  4C56 C;  2NMQ A;  3GZN I;  5JXV A;  3HVD A;  4IWQ A;  3PZD A;  2MBE A;  1TYG B;  2W54 A;  4BKS A;  5FK9 C;  2N1W A;  2RD0 A;  2MBO A;  1KLV A;  1TIF A;  2L52 A;  3HVZ A;  1SE2 A;  3PVL A;  2BYT A;  1C77 A;  3PPA A;  1WXV A;  4USA A;  3DOW A;  2NPT B;  1QOG A;  3ZJT A;  3W1S A;  4NAW A;  3RN9 C;  4W9E A;  1WM3 A;  3KW5 B;  2KYW A;  2FBW B;  1MFW A;  2D10 A;  4IG7 B;  1KFY B;  1QT9 A;  3TEX A;  3DVN U;  4ZRP A;  4K7U A;  2WXK A;  1PDX A;  3RUL A;  2CJO A;  1ZXH A;  3V05 A;  3RUI B;  3EGR A;  2SAK A;  2J4X A;  4RGN A;  1TS5 A;  1NI3 A;  4K81 A;  4C7Y A;  1I4R A;  1XF5 L;  2EMS A;  3W9C B;  4B9K A;  2G4S A;  3ZTD A;  3ENE A;  3M95 A;  2PKO A;  1FRR A;  1SF0 A;  2LRW A;  2NTT A;  4EOY A;  2KAC A;  3DPD A;  4KSK C;  3TEZ A;  1NI2 A;  2QJL A;  5CHF A;  3KWV A;  4S17 A;  1DGJ A;  2C7N B;  5FR3 A;  4NNJ B;  3UIP B;  1UEL A;  2FCS A;  2Z59 B;  5KHQ A;  4MM3 A;  3JSV A;  1C79 A;  4BAX A;  1L5P A;  2KVZ A;  1GNU A;  4LCD E;  1V1O A;  2K8B A;  1E7V A;  1FMA D;  2C7M B;  2LRU A;  3B2G A;  2LI5 A;  5IAA C;  4EZK A;  1DOY A;  2WYQ A;  4ANV A;  1E8X A;  2WXR A;  4IKG A;  3S2A A;  3RPF C;  4NZL B;  2WQY B;  3X23 A;  4ZHO A;  5I4D A;  4N58 A;  1RYJ A;  2LVQ A;  4BZA A;  2QCZ A;  4EEW A;  3ZIM A;  4A9A A;  3ZXV A;  4LDT B;  3NY5 A;  2K22 A;  2PPH A;  3QAR A;  4R3D A;  2KQS A;  4DBG A;  3VR9 B;  1WZ3 A;  4FJY A;  3NVV A;  2DAF A;  4MGI E;  1ZPS A;  4HKQ A;  2HTM E;  2LJI A;  4NPN A;  3NG0 A;  2V3S A;  1UBI A;  1UWM A;  1NVI D;  4ANW A;  5HFY A;  4B6W A;  1A5R A;  3HHM A;  3ZUN A;  3KUZ A;  5BO4 B;  5GMV A;  2NBU A;  2IO1 B;  1L0Y B;  2JWU A;  3TL5 A;  2MBQ A;  3NHE B;  3RI7 C;  1D5M C;  4J6I A;  3R2T A;  4CO7 A;  1RWS A;  3MC9 A;  3C0R B;  3U30 A;  4I6P A;  1FIQ A;  4A90 A;  3P2B A;  4B95 A;  4HPP A;  4MGZ E;  1WXA A;  4GMV A;  4P7I A;  1WGK A;  1ZDV A;  5DPR A;  3PHW B;  4IUM B;  3GE3 C;  3TMP B;  2NPT A;  2GOW A;  1U4A A;  2IZV B;  3BVG A;  1EWY C;  2RSU A;  1QOB A;  5G55 A;  2M17 A;  3RT3 B;  1JCK B;  3L16 A;  2WGS A;  2LUM A;  1XQQ A;  2O2V B;  1L6V A;  2LGD A;  5E6O A;  3LB8 C;  2LUE A;  4JQW C;  2ICI A;  3AE5 B;  3AV8 A;  2WXG A;  4B0M A;  4CHK A;  3PV1 A;  4BFR A;  3OG5 A;  1C3T A;  1SJH D;  1WYG A;  2SEB D;  3H1U A;  4K3C A;  2BVC A;  3C19 A;  3VH4 B;  3L4P A;  2BB5 A;  3O13 A;  4L2Y A;  1UWX A;  2BF8 B;  1LM8 B;  3UQA A;  4WJP A;  2AEH A;  2IPK D;  3K9O B;  3Q3N C;  3PRM B;  3JVZ X;  5IOI A;  3NVW A;  1Y56 A;  3QJZ A;  1J7A A;  1WJU A;  2MEK A;  3SFE B;  2REX A;  4NJ6 A;  3H8H A;  2JXT A;  4YTM B;  1YIW A;  2OHF A;  1FNU A;  5HKH A;  2K5P A;  1DOI A;  1MG4 A;  5LNK 1;  5DPS A;  4W9C A;  2J52 A;  3IAM 1;  4XE0 A;  5E6P A;  1L7Y A;  2D11 A;  4GN1 A;  1UGJ A;  3RZF A;  2D3C A;  1L4Z B;  5L95 C;  3BYY B;  2VRR B;  3VTW A;  3GS2 A;  2KLG A;  3MJW A;  1R4N I;  2BYV E;  2K1F A;  1YN4 A;  2IGG A;  2LZ6 A;  4GB9 A;  4BKS D;  5BMG A;  2Y5C A;  1HTO A;  3NOB A;  1SIF A;  4DHZ B;  2TSS A;  2K25 A;  3Q3O C;  5HHD G;  3VTV A;  1GAQ B;  4MDK E;  4HK2 A;  5LLI A;  3CWI A;  3P4Q B;  1F1H A;  1YOV B;  4C7Z A;  2HJ1 A;  4W9F A;  2BKR B;  4AOF A;  1OGW A;  2KJR A;  5EE0 A;  2LGS A;  3UIN B;  2QEJ C;  2KMA A;  2UWQ A;  3SU8 X;  4LNI A;  5IO9 A;  3UGB B;  1FXI A;  3PT2 B;  2WS3 B;  3GP7 A;  1KLG D;  2WXI A;  3ZJU A;  2PE6 B;  2MBB B;  2KT7 A;  3TEW A;  3BY4 B;  3GZN B;  5AUK A;  1HZ6 A;  2YEP F;  2IY1 B;  3NZ3 A;  2KTR A;  1ZUD 2;  3RZW C;  3PLU A;  4W9G A;  2WHI A;  4MH8 A;  3KYD D;  1T6B X;  4LLG M;  4GDK B;  1FXT B;  1VZ8 A;  2V9H A;  1XLQ A;  4KIK A;  2H89 B;  4MH0 E;  4RM9 A;  4M8N A;  4JWU C;  4PS3 A;  1UUP A;  3QA8 A;  2CU1 A;  2CHZ A;  2O2V A;  2M4N A;  1P98 A;  2ZVO A;  5D3D A;  4PS7 A;  3HM6 X;  2MQJ A;  1TTN A;  3GOE A;  1WRD B;  1MPE A;  3R8B A;  1TZ1 A;  4LNO A;  4RF1 A;  2FIF A;  4K1R B;  2RPQ A;  4FHK A;  2EMT A;  2PE9 A;  3QWZ B;  1BT0 A;  3HRD D;  2QHO A;  4GXB A;  3KLS X;  3PO0 A;  1XLN A;  1UBQ A;  3DBL B;  5LXI B;  2ZPN A;  3Q8B A;  2G3Q B;  2MBH A;  3DHH C;  1JWM D;  1PGX A;  2L7R A;  2ON8 A;  1NYR A;  5AZH A;  3KQ4 A;  1UZX B;  5D7G A;  1KTK A;  3IBE A;  2I1K A;  1E8W A;  3J9C A;  4ZOH C;  2KMC A;  1YN3 A;  2RPV A;  4ITK A;  4WWO A;  3QCA A;  5G2N A;  5DPW A;  4RCO A;  2ZCC A;  2DZI A;  1WJN A;  4ICV A;  4G0N B;  3TBL D;  2K6D B;  3MC8 A;  1V97 A;  3VRA B;  2WNM A;  3P4P B;  4C4V B;  2KJH B;  4WIP A;  4HJG E;  1TS3 A;  4ANU A;  1EU3 A;  2JZZ A;  3MC0 B;  2GB1 A;  1KJT A;  3W2D A;  3WA0 A;  5H92 C;  4YT0 B;  3PRZ A;  4AJW A;  4DHZ E;  4CQN A;  2MH7 A;  3N32 A;  3ZDT A;  1FXA A;  2K6Q A;  3ZNI D;  4ZRI A;  3HIZ A;  1Y8R C;  1TY0 A;  3B08 A;  1Q5W B;  3AEA B;  5AZF A;  4F7Z A;  3BK2 A;  3ECI A;  1L0X B;  1MVK A;  2JF5 A;  3QC8 B;  2XK5 B;  3RMK C;  2CS4 A;  2OED A;  2RDG A;  1KLU D;  5D3I B;  3VR8 B;  3A9J A;  1VLB A;  2G1E A;  4XGA B;  2MCN B;  1E8Z A;  3AH7 A;  2W55 A;  1V8C A;  3V62 A;  5FR6 A;  5BMI A;  1J7B A;  5EE1 A;  4B0E A;  4AWJ A;  3CST A;  2J53 A;  2ZNV B;  1E0Z A;  5IKC M;  3TEY A;  2DWQ A;  1M4V A;  1RFA A;  4OZC A;  1WXQ A;  3H7P A;  3ALB A;  1OEY J;  3SD5 A;  2V3P A;  3NZS A;  3AE8 B;  1T5X D;  2ZPY A;  1I4G A;  1E8Y A;  1FD6 A;  4DDI D;  2KDM A;  3KYC D;  2IBI B;  3EC8 A;  2L32 A;  3IG3 A;  2DZM A;  1WGR A;  3PLV A;  4FHJ A;  4MGK E;  4J3O D;  1HE8 A;  4WJN A;  4FLH A;  1KOT A;  3T8M A;  4YTP B;  2AL3 A;  3V6E B;  2A4Z A;  4JE3 B;  2KDF B;  4EE2 A;  3VAW A;  5J17 A;  3MHS D;  1IBX B;  4JIO U;  2B76 B;  3AUL A;  2KTF A;  2LMC A;  2LVO A;  4QAY A;  4BKT A;  2EKE C;  3W5U B;  4DXF A;  2N9P C;  4GIV A;  2DYM A;  5MPO A;  1ZE3 D;  4HJK A;  3VVW B;  1XCQ L;  4IW0 A;  1N63 A;  2HE7 A;  4E3C A;  2KC2 A;  2BS3 B;  3QIJ A;  1VCB A;  2ONQ A;  1VRA B;  2ZVN A;  2I38 A;  4ANX A;  4EFO A;  2IO3 B;  2BYF A;  1WGH A;  3IT4 B;  1R4M I;  2BWF A;  3FIL B;  4P16 A;  4GDL B;  2I1J A;  4BVU C;  3CF6 E;  2H88 B;  2JPH A;  2W3S A;  2LWP A;  4NJC A;  5JZE B;  4LNK A;  1CK1 A;  3RNE C;  3PZ8 A;  3TIX A;  3AEG B;  4KZC A;  1SSN A;  4BKG A;  3P4S B;  3R7Q A;  2N9L A;  5D94 A;  3R3M A;  1WXM A;  2C5L C;  2LGI A;  2K8C A;  2MLB A;  2LXA A;  3BII D;  4REZ A;  3BIN A;  2IYD B;  1Z5S B;  4OHJ A;  1P7E A;  4RFB A;  3DBL I;  2OOB B;  1YJI A;  4RGT A;  4WQO B;  3U52 E;  1OEY A;  1VZ6 A;  5EDS A;  4WQM A;  2CHW A;  2HD5 B;  4LDT D;  2V3N A;  4C4V A;  1C9F A;  4MT5 A;  1YD8 U;  1JW9 D;  4A6Q A;  3Q2A C;  3AU4 A;  4NAM A;  3SFD B;  2Q5W D;  3SDL C;  2LHE A;  4YWG G;  4TKN A;  1E7P B;  2AQ1 B;  1JWU D;  4KGR A;  2M0X A;  3A1Q A;  1WJ6 A;  2BS4 B;  3HM3 A;  2KWU B;  3DCG A;  3W1Y A;  5C2T B;  5JH5 C;  1C4C A;  1R4N B;  2WDV B;  4KGS A;  2XN9 C;  1E7U A;  2WXJ A;  4WAF A;  2N7D A;  1ZP0 B;  1B1Z A;  2ZZP B;  5BMH A;  2JRH A;  4F1S A;  2D2Q A;  1UF0 A;  4US9 A;  2Z0E B;  4XDC A;  2PEA A;  2EKI A;  3ZNH B;  4GSW A;  3B0A A;  4II3 B;  3L0W B;  1UNS A;  2W3R A;  5L83 A;  1WGG A;  1YN5 A;  1IUE A;  4XZ4 A;  1JWB D;  4E71 A;  1WE7 A;  3ZNZ B;  3R66 C;  4HWI B;  4P6V F;  1ET6 A;  1Q10 A;  1ESF A;  4ZHP A;  3IVF A;  1I35 A;  2FCM A;  2CU3 A;  5D6J B;  2D3A A;  4MJS A;  1P0R A;  1FPY A;  1QKZ A;  2LD9 A;  3C8Y A;  4US8 A;  3VUX A;  2V0G A;  3A9K A;  3P42 A;  4MSQ B;  4XWW A;  2PMV A;  4OVU A;  3A33 B;  1WY8 A;  4DXG A;  1IBX A;  1LGR A;  4LJO B;  1TS2 A;  3X0W A;  2JU6 X;  1SEB D;  2DNF A;  2V4I B;  5AZG A;  2ZNV C;  3TSS A;  2MP2 B;  3DHG C;  2IND C;  4XWT A;  2KO3 A;  3MFG A;  2QIE B;  2JUO A;  1C76 A;  3EFC A;  4RGM A;  4KX6 B;  4M00 A;  4TV3 A;  1VR9 A;  3ZLZ A;  4AJY B;  5J2R A;  1V9J A;  3ZRC A;  1MHH E;  1E9M A;  2N9E B;  4KSL C;  3H6N A;  3OWE B;  3FIL A;  2MWS B;  4GDL A;  4IWP A;  1JML A;  1PGA A;  2L0T A;  2AYO B;  4C80 A;  1BXT A;  1WE6 A;  2G45 B;  1GPX A;  3Q8F A;  2YEP B;  2D5G A;  3OAW A;  4G11 A;  3OJ3 A;  1JRO A;  4FJV B;  4YL8 A;  3CIR B;  4BBN F;  1GB1 A;  1Q0W B;  2WU5 B;  1ACC A;  5BYS A;  1E90 A;  3N3K B;  2GBM A;  2CKH B;  2MHJ A;  4EZL A;  2FCQ A;  2NBV B;  1BUI C;  1V5T A;  4Q2J A;  2WXL A;  4HCN B;  4EZJ A;  1WRI A;  2KC1 A;  4HXD A;  4JLC A;  3DVG Y;  4WJQ A;  1D3Z A;  3U7D A;  4F8C B;  1S3S G;  1R7S A;  1LXD A;  2PTL A;  2K3U A;  2J7Q B;  2PIA A;  1KM7 A;  3U2S C;  4OZA A;  1MG8 A;  4AS1 A;  5BYR A;  4HLE A;  2C7H A;  3I9V 1;  1I4H A;  4TQ0 A;  1GC7 A;  1BML C;  1XO3 A;  2RDB C;  1J0G A;  1V1P B;  4TMA B;  3AEE B;  4MEM A;  5AUI A;  1EF5 A;  3P4R B;  4II2 B;  1YQ4 B;  4K7W A;  1QIL A;  4IM3 A;  1TGZ B;  3AI5 A;  4JGH B;  2N0S B;  4BOS C;  1EU4 A;  1VZ7 A;  1YJJ A;  3PHX B;  2PVO D;  1FNW A;  2AWT A;  3L13 A;  3APD A;  1LQB A;  5CHV C;  4H2A A;  4OVZ A;  2DYB A;  1PGB A;  2WXF A;  1I4Q A;  1QOA A;  3AE3 B;  2N7J A;  3ZQ4 A;  1OQQ A;  3VFK A;  2N9K A;  2GI9 A;  2GMI C;  2BBC A;  4WWM A;  5JHA A;  5LXH A;  2KN5 A;  1F52 A;  2MJD A;  2L0F A;  3I5J C;  3Q8E A;  3T9L A;  1EWC A;  1WJ4 A;  2D07 B;  2CHX A;  1GUA B;  3SR6 A;  2JXX A;  1FCC C;  1WR6 E;  3RNB C;  4IOI E;  1X1M A;  2MP2 A;  3Q8C A;  3LJ3 A;  3NJT A;  1XXG A;  4LJP B;  1NEK B;  3RD2 A;  1F2R I;  1S1Q B;  2KN4 A;  2N1V A;  5CHW A;  1MJD A;  1CZP A;  4DK5 A;  2WXP A;  3DHI C;  2ZW0 A;  3B2F A;  2N7E A;  4HRS A;  1CMX B;  3VQI A;  1F2R C;  3VUW A;  4ICU A;  2KQ4 X;  3ZTC A;  3AE6 B;  3E9S A;  1R4M B;  3IAS 1;  1P9D U;  5G5G A;  1VDV A;  3ABV B;  1FRD A;  1DOX A;  4IC7 B;  1IGD A;  1NEN B;  4AP4 C;  2VZK B;  5E6J A;  4PT5 A;  3URY A;  2JRI B;  3EFU A;  3HK0 A;  4YSX B;  2R2O A;  2D3B A;  1V86 A;  2GBR A;  4A20 A;  3Q3M C;  2R61 A;  1C1Y B;  1TZO A;  5C3J B;  2A5U A;  1WWT A;  1XLP A;  3EA6 A;  5T8I A;  1P1A A;  3RCZ A;  3AM9 A;  1QZE A;  4YXD B;  1WXS A;  4A3P A;  2GBN A;  4EKU A;  4IDI A;  5C1Z A;  2UU7 A;  2OJR A;  2M0A A;  1FFV A;  2MJ3 A;  2XNA C;  3ZXR A;  2LAS A;  2IJ0 A;  1L0V B;  1V2Y A;  2K0P A;  4A8X C;  1N60 A;  2INC C;  4WWP A;  1SBB B;  3L54 A;  3IXS A;  2EEL A;  4N59 A;  3V61 A;  2JZ3 B;  1WMH B;  3I63 C;  5G5H A;  4DHJ D;  2OJW A;  3VDZ A;  2Y3A A;  4HPM B;  4L23 A;  3V60 A;  1WX7 A;  2IGH A;  1SE4 A;  4W9I A;  3NVY A;  3Q6B A;  1T0Q C;  2DYO A;  5IA7 A;  5BYQ A;  2RR9 A;  4FBJ B;  1QQR A;  4ARC A;  1JRP A;  1XEE A;  3APC A;  4PK1 A;  2YLM A;  4LNF A;  2V4L A;  2IY0 B;  2WDQ B;  4E74 A;  3ONS A;  2DEN B;  2DZJ A;  1HA5 A;  1UGM A;  4KV2 A;  3IFW B;  3RNC C;  4RGO S;  4P1C C;  4ASW C;  1MHX A;  2MRP A;  3FC4 A;  4JX1 C;  1D5X C;  1ZXI A;  3EUB 2;  4W9L A;  3K9P B;  4OVV A;  2BPS A;  3RNA C;  1T0R C;  2NTS A;  5DPT A;  1GJZ A;  2FE8 A;  1RRB A;  2M8S A;  3EEC A;  4L1B A;  2KDE B;  3JSV B;  4W9K A;  3BK1 A;  2WU2 B;  1WYW B;  1N5X A;  3JW0 X;  2KVR A;  1WX8 A;  1HEZ E;  1SB3 C;  1I7H A;  3QAQ A;  2WX0 A;  3WAM A;  4A3O A;  1PFD A;  4KDI C;  2KFK B;  1XT9 B;  4FUL A;  2IO0 B;  1K52 A;  1D5Z C;  3UI3 A;  3Q69 A;  2BT6 A;  2L83 A;  2MW5 A;  4GDK A;  1D6E C;  5HI1 A;  3W5V B;  2JT4 B;  1XCT L;  1ZDX A;  5CTR C;  4HCP B;  1T0Y A;  3MP9 A;  3I57 A;  1EO6 A;  4K3B A;  2KX3 A;  4G50 A;  3ZVV A;  2WDT B;  2KWD A;  2G9H D;  3WIM A;  2M56 B;  1TKY A;  3DBH B;  1SXT A;  2JX5 A;  4ZDV A;  1TBE A;  2YVC A;  3VRB B;  3Q8A A;  4HEA 1;  5FKA C;  3RNF C;  4GGQ A;  1IP9 A;  1E10 A;  3D32 A;  1ROE A;  3M3J A;  2E6X A;  3KUC B;  3TCA A;  1HTQ A;  3PSE B;  1TS4 A;  4FAD A;  1JWA D;  2PLP A;  3DVG X;  1H8C A;  3VXW A;  2CJN A;  3DBS A;  2MA9 B;  3BZD B;  1ISN A;  2JWZ A;  2C60 A;  3ZRF A;  1IGC A;  3CMM B;  2DX5 B;  1OTR B;  2WLB A;  2IGD A;  4M02 A;  2O6V B;  3AN1 A;  1GOZ A;  4W9J A;  1D4B A;  4ZRK A;  2AL6 A;  1JAL A;  2WDR B;  3A4R A;  4I6N B;  4AQ7 A;  4N9F 4;  1C78 A;  1T3Q A;  4P1B C;  1ENF A;  2V1Y A;  2VH2 A;  4HDO A;  4ZRJ A;  4ARI A;  1OQR A;  1WMH A;  4TUU A;  2INN E;  1ZW7 A;  2N9X A;  1SJE D;  5JHB A;  1J8C A;  3CSF A;  2WP9 B;  4DQO C;  4RNA A;  2DAJ A;  4YTN B;  2BTE A;  2KX0 A;  3P1M A;  3QHT A;  1EUV B;  4XYC A;  3AXC A;  1KF6 B;  1JQ4 A;  4M01 A;  2K39 A;  1HZ5 A;  1WSP A;  2J0J A;  1H4R A;  3V6C B;  2XEW A;  1WI0 A;  1GB4 A;  3NVZ A;  4OZB A;  2BW2 A;  4KGT A;  2DLB A;  1FO4 A;  1V5O A;  2GBJ A;  3UIO B;  1OFF A;  3W1S C;  1VJK A;  3BWU D;  1OQY A;  2JVC A;  3LXF A;  2GBK A;  3BVM A;  1B9R A;  2WXN A;  3NRZ A;  2KD0 A;  3ML9 A;  2MSE D;  3MTN B;  1CJE A;  2LXC A;  2XK5 A;  1P3Q U;  1WGY A;  2W9N A;  2RMM A;  1V81 A;  2HJ8 A;  5EE3 A;  4CYE A;  1LO5 D;  2G4D B;  2NCN A;  1FFU A;  3JYU A;  1FEH A;  2IDY A;  3U7Z A;  3N30 A;  4K7S A;  2KHW B;  1M94 A;  2LJ5 A;  1EF1 A;  4ACF A;  5EE9 A;  4YSY B;  3L10 B;  2KFK A;  3AED B;  5KHO A;  3PS6 A;  3B9J A;  2KK8 A;  2J0M A;  1WH3 A;  3QX1 A;  3UF8 A;  1DYQ A;  5IP4 D;  1RAX A;  2FAZ A;  2I2Y A;  3NS8 A;  4PYU A;  1V49 A;  2KAN A;  1Q1O A;  1QOF A;  4W9D A;  4IM0 A;  4MEL A;  2RDH A;  1TKE A;  4S0R A;  2FCN A;  3GE8 C;  1T0S C;  1P7F A;  2MJE A;  3Q3F A;  1JWS D;  2NVU I;  2L3Z A;  2JZP A;  1QLB B;  3DBR I;  3AE4 B;  2NS5 A;  2D3G A;  3ZNG C;  4DDG D;  3M63 B;  1Z2M A;  2QMT A;  2KXJ A;  4LNN A;  2LGY A;  1L2N A;  2BWE S;  3VUY A;  1YQB A;  4RH6 A;  1NBF C;  1TJE A;  4HRO A;  2Y5B B;  1J7C A;  3AMZ A;  2ACZ B;  2ASQ A;  3AE2 B;  5DCN A;  4WH4 A;  1STE A;  3U8Z A;  4LTU A;  3ZO5 B;  4W9H A;  4PYZ A;  4PS8 A;  4URK A;  3DBH I;  2KTR B;  2FNJ B;  3P63 A;  1GG3 A;  1YQ3 B;  2O6V A;  2PJH A;  3LYY A;  3SHQ A;  1FNV A;  5H8Y E;  4IWO A;  3WAP A;  5AEK B;  3Q3J A;  3ZW3 A;  1ZOY B;  4KIK B;  1TKG A;  1IPG A;  1XLO A;  1N61 A;  2XBB C;  3AEF B;  4KKJ A;  2FUH B;  2HTH A;  3TJP A;  2JSV X;  3NUH B;  1PUT A;  2UYZ B;  3ETR A;  1K8R B;  4C00 A;  4TSS A;  4YSZ B;  2KWC A;  3NZU A;  4M0W B;  3B1L X;  3IHP C;  2W82 A;  2HDE A;  1SIJ A;  2BQQ A;  2N4F A;  2ZCB A;  4JWS C;  1WM2 A;  2B3A A;  3I3T B;  3T3O A;  3DWG C;  4NQL B;  2ZJD A;  1ET9 A;  4XDD A;  3RFZ B;  2M1M A;  3A4S C;  2E3T A;  1WZ0 A;  4KVG B;  3AE7 B;  4I6L B;  4X57 B;  1FM0 D;  1C4A A;  1ZKH A;  4MAC A;  4HPL B;  4RM8 A;  1WGD A;  3AEC B;  1WR1 A;  3AE1 B;  3OJ4 B;  1HQR D;  4G3X B;  1IYF A; 
#chains in the Genus database with same CATH homology
 2EKE C;  4EEW A;  2KDI A;  3H7S A;  1V80 A;  2LAS A;  3ZIM A;  2N9P C;  4BOZ B;  4GIV A;  2DYM A;  4KZ0 A;  1V2Y A;  2C9W B;  3KUD B;  4HJK A;  4LDT B;  3NY5 A;  3VVW B;  4WWP A;  2PPH A;  3QAR A;  3L54 A;  4IW0 A;  2NBW B;  5E6N A;  2HE7 A;  4HVB A;  4E3C A;  2KC2 A;  2KQS A;  4DBG A;  3V61 A;  1WZ3 A;  2JZ3 B;  3QIJ A;  2IO2 B;  4FJY A;  1VCB A;  1WMH B;  2L8J A;  4DHJ D;  3VDZ A;  2DAF A;  4HPM B;  4MGI E;  2ZVN A;  3V60 A;  1WX9 A;  1WX7 A;  3DQV A;  4NPN A;  2V3S A;  4ANX A;  4EFO A;  1UBI A;  3O65 B;  2IO3 B;  2BYF A;  1WGH A;  3PTF C;  4W9I A;  4ANW A;  1R4M I;  2BWF A;  4BBN C;  4GDL B;  4DWF A;  2DYO A;  2I1J A;  4B6W A;  4BKT A;  5IA7 A;  3HHM A;  1A5R A;  4BVU C;  3ZUN A;  2RR9 A;  3CF6 E;  3KUZ A;  5BO4 B;  4FBJ B;  5GMV A;  1SE9 A;  2NBU A;  3R7R A;  2JPH A;  1SGH A;  2IO1 B;  5JZE B;  2LWP A;  3TL5 A;  4NJ7 A;  3PRP B;  1PQS A;  3APC A;  3PRE A;  3TIX A;  1YX5 B;  4KZC A;  2MBQ A;  2YLM A;  3NHE B;  4J6I A;  4BKG A;  4ZYN A;  3R7Q A;  5D94 A;  4CO7 A;  3U30 A;  2V4L A;  3C0R B;  3R3M A;  1WXM A;  2C5L C;  2MLB A;  2K8C A;  4FN2 A;  2LXA A;  3P2B A;  4I6P A;  4B95 A;  2RGF A;  3BIN A;  4MGZ E;  1WXA A;  2IY0 B;  4GMV A;  3WAN A;  4E74 A;  2K8H A;  2DEN B;  2IYD B;  3L17 A;  1Z5S B;  3ONS A;  4WWN A;  4P7I A;  2DZJ A;  2FID A;  1UGM A;  3DBL I;  4KV2 A;  3IFW B;  1XD3 B;  2OOB B;  5DPR A;  1J19 A;  3PHW B;  3OLM D;  4WQO B;  4GU2 A;  4IUM B;  3A9J B;  1OEY A;  5C23 A;  4ASW C;  5EDS A;  2CHW A;  3TMP B;  2MRP A;  2NPT A;  2HD5 B;  4LDT D;  3PGE A;  2GOW A;  1U4A A;  2IZV B;  4W9L A;  2RSU A;  3K9P B;  1YD8 U;  3APF A;  4OVV A;  2Z0D B;  2BPS A;  5G55 A;  1G6J A;  2M17 A;  2LVP A;  3RT3 B;  3AU4 A;  3L16 A;  2J0K A;  5DPT A;  3SDL C;  1GJZ A;  1XQQ A;  2O2V B;  2LGD A;  1RRB A;  5E6O A;  2KKC A;  4EZJ A;  4TKN A;  1LFD A;  4GOC A;  2M8S A;  3ZKJ C;  3H7P B;  2LUE A;  3EEC A;  4JQW C;  2KDE B;  3JSV B;  4W9K A;  2M0X A;  2KFJ A;  1WYW B;  3A1Q A;  1WJ6 A;  2KVR A;  3JW0 X;  1WX8 A;  3PV1 A;  2KZR A;  4CHK A;  4BFR A;  2KQ7 A;  3HM3 A;  2KWU B;  3DCG A;  1C3T A;  2KDB A;  1JRU A;  1VD2 A;  3QAQ A;  2KLC A;  3W1Y A;  4JL9 A;  5JH5 C;  4MSM B;  2WX0 A;  3H1U A;  3WAM A;  1E7U A;  4A3O A;  3VH4 B;  2N7D A;  1WFY A;  4KDI C;  2KFK B;  3M62 B;  4IM2 A;  1WF9 A;  1XT9 B;  2ZZP B;  4FUL A;  2BF8 B;  3ML8 A;  1LM8 B;  3UQA A;  2JRH A;  2IO0 B;  4M8M A;  4F1S A;  4WJP A;  5CX3 A;  2AEH A;  2D2Q A;  1YJ1 A;  2JY6 A;  3K9O B;  2MW5 A;  2R2Q A;  4GDK A;  2Z0E B;  3PRM B;  2PEA A;  3ZNH B;  2JT4 B;  4GSW A;  3QK0 A;  3JVZ X;  5CTR C;  1V6E A;  4HCP B;  3B0A A;  2DZK A;  3DDC B;  4II3 B;  1T0Y A;  1EO6 A;  1F9J A;  3QJZ A;  2KX3 A;  3L0W B;  4TQ1 A;  4G50 A;  1WJU A;  3ZVV A;  2WDT B;  5L83 A;  1WGG A;  3WIM A;  2REX A;  4XZ4 A;  4NJ6 A;  4E71 A;  1WE7 A;  3ZNZ B;  2DHZ A;  1YIW A;  3R66 C;  4HWI B;  4ZDV A;  2WWZ A;  3RYT A;  1TBE A;  2YVC A;  5HKH A;  2BGF A;  3IVF A;  1I35 A;  2FCM A;  5DPS A;  5D6J B;  4NAW B;  4W9C A;  3DVN V;  3H9D A;  4MGY E;  1ZGU B;  4MJS A;  1P0R A;  5E6P A;  4GGQ A;  1IP9 A;  1L7Y A;  2D11 A;  3D32 A;  3M3J A;  4GN1 A;  2KWV B;  2LD9 A;  1YX6 B;  3KUC B;  2CR5 A;  3RZF A;  3TCA A;  3PSE B;  3WAL A;  5L95 C;  2BKF A;  4NY0 A;  4WAA A;  3VUX A;  3ZDM C;  4FAD A;  1UD7 A;  2VRR B;  2KJ6 A;  3A9K A;  3DVG X;  3VTW A;  2KLG A;  4XX5 A;  4MSQ B;  1H8C A;  2KNB A;  3VXW A;  3DBS A;  2MA9 B;  1ISN A;  2JWZ A;  3MJW A;  1R4N I;  2C60 A;  4OVU A;  3A33 B;  1WY8 A;  3ZRF A;  2BYV E;  3UQB A;  3CMM B;  2K1F A;  2DX5 B;  1OTR B;  1UH6 A;  4FA6 A;  2O6V B;  4LJO B;  2LZ6 A;  4GB9 A;  4BKS D;  3X0W A;  4W9J A;  4ZRK A;  2AL6 A;  2ZNV C;  5AZG A;  2MP2 B;  3LDZ E;  4WJO A;  2KO3 A;  3NOB A;  1SIF A;  4DHZ B;  4I6N B;  3A4R A;  3AU5 A;  4KDL B;  4N9F 4;  2K25 A;  2JUO A;  1GC6 A;  1RLF A;  3VTV A;  4HDQ A;  4MDK E;  2LGX A;  4HK2 A;  4NQK E;  5LLI A;  2V1Y A;  3WAO A;  4TV3 A;  4HDO A;  4ZRJ A;  3QQ8 B;  2WX1 A;  3ZLZ A;  1WMH A;  4AJY B;  4TUU A;  4W9F A;  2BKR B;  2L76 A;  4AOF A;  5J2R A;  1OGW A;  1V9J A;  3ZRC A;  2KJR A;  1ZW7 A;  4DXA B;  2N9X A;  5JHB A;  1J8C A;  3UIN B;  2N9E B;  4KSL C;  3H6N A;  3CSF A;  2KMA A;  2UWQ A;  2MWS B;  4GDL A;  3SU8 X;  5D2M B;  3A1Q B;  2DAJ A;  5TR5 A;  3UGB B;  3PT2 B;  2KX0 A;  4IWP A;  3QHT A;  4XC2 A;  1WIA A;  1EUV B;  3KVF B;  3AXC A;  2PE6 B;  2MBB B;  2L0T A;  2AYO B;  3BY4 B;  2K39 A;  2J0J A;  1WE6 A;  2G45 B;  1H4R A;  2IY1 B;  2XEW A;  3V6C B;  1WI0 A;  2KTR A;  2MX2 A;  3OAW A;  4G11 A;  3RZW C;  3VH3 B;  3OJ3 A;  2O6V D;  3PLU A;  1V5O A;  4W9G A;  2GBJ A;  3UIO B;  4FJV B;  4YL8 A;  3W1S C;  4BBN F;  3EHV A;  3KYD D;  1Q0W B;  1OQY A;  4GDK B;  2JVC A;  1E90 A;  3N3K B;  1FXT B;  2GBK A;  2GBM A;  2KOX A;  2CKH B;  3VHT C;  5J18 A;  4EZL A;  4KIK A;  2KD0 A;  3ML9 A;  2FCQ A;  4MH0 E;  4RM9 A;  1AAR A;  2MSE D;  3MTN B;  2BYE A;  2LXC A;  2NBV B;  4M8N A;  2XK5 A;  1P3Q U;  1WGY A;  4FJZ A;  4AUQ C;  1V5T A;  4PS3 A;  2W9N A;  3QA8 A;  4DHJ B;  2CU1 A;  2CHZ A;  2O2V A;  1V81 A;  2HJ8 A;  2M4N A;  1P98 A;  2ZVO A;  1I42 A;  4HCN B;  4PS7 A;  2KC1 A;  3L08 A;  4HXD A;  4JLC A;  4CYE A;  1NDD A;  2G4D B;  2MQJ A;  1TTN A;  2NCN A;  3GOE A;  3DVG Y;  3HM6 X;  1WRD B;  4WJQ A;  1D3Z A;  1TZ1 A;  3JYU A;  3U7D A;  2ZEQ A;  2NR2 A;  2FIF A;  4K1R B;  2RPQ A;  1S3S G;  3N30 A;  2L05 A;  4FHK A;  4MJS B;  4F8C B;  2EMT A;  1LXD A;  2PE9 A;  3QWZ B;  1E5W A;  1BT0 A;  4K7S A;  2J7Q B;  2KHW B;  1KM7 A;  1M94 A;  2QHO A;  2LJ5 A;  4GXB A;  1MG8 A;  4RMA A;  3VTU A;  4HLE A;  1EF1 A;  4EUT A;  2C7H A;  2L00 B;  4TQ0 A;  3A9K B;  1UBQ A;  3L10 B;  5LXI B;  2KFK A;  2ZPN A;  3KH0 A;  2G3Q B;  2MBH A;  3PS6 A;  5KHO A;  1GC7 A;  2KK8 A;  2J0M A;  1WH3 A;  2L7R A;  3QX1 A;  3UF8 A;  1J0G A;  3GZN I;  4MEM A;  4IWQ A;  5AZH A;  3PZD A;  1RAX A;  1UZX B;  2FAZ A;  2MBE A;  3NS8 A;  4PYU A;  5D7G A;  1V49 A;  2KAN A;  1Q1O A;  3IBE A;  4BKS A;  4W9D A;  1EF5 A;  4II2 B;  4IM0 A;  2I1K A;  4MEL A;  1E8W A;  4K7W A;  2KMC A;  2FCN A;  2N1W A;  4IM3 A;  2RD0 A;  2MBO A;  3Q3F A;  1KLV A;  1TGZ B;  2NVU I;  2L3Z A;  4WWO A;  3AI5 A;  3QCA A;  4JGH B;  3DBR I;  5G2N A;  5DPW A;  4BOS C;  3PVL A;  2NS5 A;  2D3G A;  2ZCC A;  3ZNG C;  2DZI A;  1WJN A;  4DDG D;  3M63 B;  1Z2M A;  3PPA A;  3PHX B;  2AWT A;  1WXV A;  2KXJ A;  3L13 A;  4ICV A;  4G0N B;  3TBL D;  3APD A;  2K6D B;  2LGY A;  2NPT B;  3DOW A;  1LQB A;  1L2N A;  2BWE S;  5CHV C;  3W1S A;  3VUY A;  1YQB A;  2KJH B;  4NAW A;  1NBF C;  4W9E A;  1WM3 A;  2Y5B B;  2DYB A;  3KW5 B;  1IYF A;  2ASQ A;  5DCN A;  2D10 A;  4ANU A;  2JZZ A;  3U8Z A;  4IG7 B;  1KJT A;  3VFK A;  3DVN U;  3WA0 A;  2GMI C;  4K7U A;  4W9H A;  4PYZ A;  4PS8 A;  3ZO5 B;  3PRZ A;  4URK A;  3DBH I;  4AJW A;  5JHA A;  4DHZ E;  5LXH A;  2KN5 A;  3RUL A;  2KTR B;  2FNJ B;  3N32 A;  3ZDT A;  2L0F A;  1GG3 A;  3T9L A;  2K6Q A;  3ZNI D;  2O6V A;  1WJ4 A;  2D07 B;  2PJH A;  3HIZ A;  2CHX A;  1GUA B;  4ZRI A;  3RUI B;  1Y8R C;  3SHQ A;  2JXX A;  1WR6 E;  3WAP A;  4IWO A;  3B08 A;  1X1M A;  2MP2 A;  5AEK B;  1Q5W B;  3Q3J A;  3ZW3 A;  4K81 A;  4F7Z A;  5AZF A;  4KIK B;  3LJ3 A;  4LJP B;  3ECI A;  3RD2 A;  2EMS A;  1IPG A;  2JF5 A;  2XBB C;  3QC8 B;  1S1Q B;  4B9K A;  2XK5 B;  2CS4 A;  2G4S A;  3ZTD A;  3ENE A;  2FUH B;  2HTH A;  2N1V A;  3M95 A;  5CHW A;  3TJP A;  4DK5 A;  3A9J A;  2LRW A;  4EOY A;  3DPD A;  2UYZ B;  2MCN B;  1E8Z A;  4KSK C;  2N7E A;  1K8R B;  3V62 A;  1CMX B;  1NI2 A;  5FR6 A;  3VQI A;  3VUW A;  4ICU A;  3ZTC A;  5CHF A;  4AWJ A;  3CST A;  2ZNV B;  2KWC A;  3NZU A;  4M0W B;  3B1L X;  2C7N B;  1P9D U;  4NNJ B;  3IHP C;  1RFA A;  3UIP B;  3H7P A;  3ALB A;  1UEL A;  2FCS A;  1OEY J;  2N4F A;  2Z59 B;  2ZCB A;  3JSV A;  3NZS A;  4MM3 A;  3SD5 A;  5KHQ A;  4IC7 B;  2ZPY A;  4AP4 C;  1E8Y A;  1WM2 A;  2B3A A;  3I3T B;  4DDI D;  2JRI B;  3EFU A;  3KYC D;  3HK0 A;  2IBI B;  2R2O A;  3EC8 A;  1GNU A;  3IG3 A;  1V86 A;  2ZJD A;  4NQL B;  2DZM A;  2GBR A;  4LCD E;  4A20 A;  1WGR A;  1E7V A;  2C7M B;  2K8B A;  3PLV A;  2LRU A;  1C1Y B;  4FHJ A;  4MGK E;  2M1M A;  2LI5 A;  5IAA C;  4EZK A;  1HE8 A;  2A5U A;  4WJN A;  2WYQ A;  4FLH A;  3A4S C;  1WZ0 A;  4KVG B;  1E8X A;  4ANV A;  1KOT A;  1P1A A;  3T8M A;  2AL3 A;  4I6L B;  3RCZ A;  3S2A A;  4X57 B;  1QZE A;  3V6E B;  1WXS A;  2A4Z A;  4A3P A;  2GBN A;  2KDF B;  4EKU A;  5J17 A;  3VAW A;  1ZKH A;  3MHS D;  5C1Z A;  4HPL B;  4RM8 A;  1WGD A;  3X23 A;  4JIO U;  1WR1 A;  2OJR A;  3OJ4 B;  3AUL A;  2KTF A;  2LVO A;  4G3X B;  2LVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...