2KFKA

Solution structure of bem1p pb1 domain complexed with cdc24p pb1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
PHMKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bud emergence protein 1
publication title NMR structure of the heterodimer of Bem1 and Cdc24 PB1 domains from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kfkA00
3PV1A 1V5TA 1NDDA 4JIOU 2KTRA 2NBVB 3IHPC 4E3CA 1EF1A 1V2YA 2N4FA 2N7EA 5AZGA 3SHQA 3PPAA 5JH5C 4II2B 2BPSA 5LXHA 2VRRB 1V6EA 2WX0A 3OLMD 3L17A 1WX9A 3A1QB 1WZ0A 3EECA 4GSWA 1E8YA 2EMTA 1XD3B 4WJQA 2DZKA 4N9F4 4G50A 2ZNVB 2KTFA 5CHWA 1C1YB 5AZFA 3RZWC 2JZ3B 5DPSA 1WGYA 4BOSC 3O65B 4BBNF 2LD9A 4NY0A 2KMCA 5TR5A 3V6CB 2L8JA 1T0YA 2FAZA 2LXCA 3P2BA 3A33B 4BKSA 3UIPB 1P0RA 3VFKA 3JYUA 3DCGA 3B08A 4AOFA 2HTHA 1WXVA 4MM3A 3QCAA 3V60A 2DAJA 4W9LA 3WIMA 1WR6E 2KK8A 1V5OA 2MRPA 4HDQA 4HPLB 1UELA 3H9DA 3PSEB 4NAWB 4WJNA 3AXCA 1WX7A 4B9KA 4FADA 2YVCA 3KUZA 3QAQA 1V49A 3M3JA 1HE8A 1J19A 4MSQB 4ZRJA 3KUDB 4AWJA 1I42A 2R2QA 3UQBA 2JXXA 2KVRA 4M8NA 4WWOA 1OQYA 2KHWB 1EUVB 2KC2A 4BOZB 4HJKA 4EEWA 4W9GA 2KNBA 5L95C 2KFJA 3L13A 1TZ1A 4IG7B 4K81A 3ZDTA 4ZYNA 3UGBB 5JHBA 3PVLA 3VXWA 2KC1A 5D7GA 3SU8X 2KQ7A 1Z2MA 3RT3B 1F9JA 5E6PA 3ZRCA 1UH6A 2KX0A 4ZRKA 1KM7A 3QWZB 3QHTA 1WZ3A 2N7DA 1H8CA 3H7SA 2RPQA 4HXDA 5DCNA 3KYCD 1GUAB 2K8HA 2KX3A 4GDKA 4MJSA 4EZKA 1X1MA 2DAFA 4MELA 3AU4A 2KQSA 2BYEA 2KMAA 5J2RA 3X0WA 3VTVA 3ML8A 2MBOA 4F8CB 1LXDA 2MW5A 1R4MI 4DK5A 3LJ3A 1RLFA 4KZCA 3A1QA 2AL3A 1E5WA 2J7QB 1YQBA 3AI5A 4ICUA 3A9JB 3W1SC 3QQ8B 1GNUA 4HDOA 2AYOB 1AARA 2KLCA 2DENB 3EC8A 4EFOA 3JVZX 4MSMB 4E71A 5IAAC 3EFUA 4LCDE 2GBKA 2G3QB 4JLCA 2KDFB 4DDGD 1WM2A 1E8ZA 3RD2A 2C7NB 3CSTA 4II3B 1GG3A 2A5UA 2MLBA 2LI5A 4AUQC 1ZW7A 3ML9A 2G45B 3L16A 4FHJA 2FCQA 3A4SC 4NAWA 4WQOB 2KANA 4RM9A 2W9NA 2CHZA 2D11A 4IWQA 3WAOA 5DPWA 4IUMB 1XT9B 2LZ6A 2NPTB 1YX5B 3D32A 2B3AA 4WJOA 4FJVB 3BINA 4IWPA 1RAXA 1P9DU 1Z5SB 2KZRA 4ICVA 2LGYA 2Z59B 2LVPA 3H6NA 4IW0A 3TMPB 4G3XB 4ZDVA 2LWPA 3SDLC 1YIWA 5HKHA 3QA8A 1KLVA 2ZZPB 4GN1A 4W9JA 5AZHA 3M95A 3UINB 1WFYA 3I3TB 4IM0A 2Z0DB 4BFRA 2DYMA 1WXSA 3OJ3A 5DPRA 2L3ZA 2KJRA 1OEYJ 3N32A 2ZCCA 4FJYA 2PE6B 3X23A 2ZEQA 2DYBA 3MTNB 4M0WB 2MBHA 2BYVE 1R4NI 4BVUC 2IZVB 2WX1A 4MGYE 3TIXA 4LJOB 3TL5A 3WA0A 4I6PA 5LXIB 3KW5B 4KVGB 3OJ4B 4I6LB 2KLGA 1FXTB 4TUUA 3L10B 2MBEA 2M8SA 4FLHA 3A9JA 5C1ZA 4URKA 1WR1A 1TGZB 1BT0A 1WM3A 2UWQA 2WDTB 2REXA 1K8RB 3PGEA 1Q0WB 4GMVA 1GJZA 5D6JB 3GOEA 4JQWC 1YX6B 3APFA 3QJZA 2LGXA 2D2QA 4WJPA 3NHEB 3IG3A 1UBQA 3L0WB 4W9IA 3ENEA 3JW0X 4CHKA 3VDZA 3DVNU 3WALA 3W1YA 1OGWA 2BKFA 4G0NB 3APCA 2MCNB 2GMIC 3GZNI 1NI2A 2JRHA 2LXAA 4W9CA 2IYDB 1WH3A 3V61A 2MX2A 2NPTA 2EMSA 4MGIE 2BF8B 2OOBB 3UF8A 3N30A 4FULA 2IY1B 3HM6X 3V6EB 2JY6A 2WWZA 2J0KA 3ZLZA 2K8BA 2D07B 1V9JA 3VVWB 1Q5WB 3PRPB 3TBLD 2LVOA 2LRWA 4W9FA 3VUWA 4GGQA 1WJ4A 2MA9B 4JL9A 1TBEA 2CR5A 4K1RB 2K6QA 3ZIMA 4IC7B 1RRBA 5E6NA 2BWFA 3NOBA 2D10A 4YL8A 3DVNV 3LDZE 4KDIC 4TV3A 3ZNZB 4FBJB 3ECIA 1WJUA 3ZNHB 4E74A 3M63B 3DVGX 5C23A 2JWZA 2L7RA 5EDSA 3DOWA 2V1YA 3WAMA 2HD5B 1I35A 2AWTA 2GBJA 4XX5A 1S1QB 5GMVA 1Y8RC 3VHTC 3B0AA 4EZLA 1UD7A 1WJNA 1E7UA 2NVUI 2KFKA 3VUXA 2FCMA 3EHVA 1S3SG 5D94A 4I6NB 4EUTA 4F7ZA 1NBFC 3ZDMC 1ZKHA 2BYFA 1E7VA 4A3PA 5J17A 4W9EA 5G2NA 2D3GA 4FA6A 2K8CA 3UQAA 4KV2A 2C60A 3DBSA 4BKGA 2FCNA 2NS5A 2FIFA 2YLMA 1UGMA 2BGFA 3H1UA 2KDEB 3HM3A 2EKEC 4GU2A 3ZVVA 2O2VA 2IO2B 4WAAA 2CHXA 2MP2B 2DYOA 2N9PC 2KWVB 1EF5A 1E8XA 2K25A 2N9XA 4HPMB 4B6WA 2PEAA 2XK5A 2RGFA 2L0TA 2KD0A 5AEKB 2KXJA 2GOWA 3BY4B 3DBRI 4FHKA 1WY8A 4A20A 3PTFC 1ISNA 2FUHB 4X57B 2L76A 2JVCA 3TJPA 1SGHA 3IVFA 2RR9A 3KUCB 1SIFA 1XQQA 2ZNVC 4K7SA 4ZRIA 3V62A 2JT4B 3Q3FA 1WMHA 4W9KA 2C7HA 2JF5A 3ZW3A 1KOTA 4JGHB 2DZMA 4PS7A 3RUIB 1WXMA 2DX5B 4PYZA 2DZJA 4TQ0A 3N3KB 3VUYA 4ANWA 4WWPA 2L05A 2CKHB 3A4RA 2KDIA 4IWOA 2C9WB 2Z0EB 4HWIB 5G55A 4K7WA 1WGRA 1WI0A 3L08A 1WX8A 2IBIB 4NQLB 3T8MA 1WYWB 4GOCA 2CHWA 2ZPNA 4FJZA 4W9HA 2XBBC 4RM8A 3U7DA 4ANUA 1H4RA 2N1VA 2JZZA 3QK0A 2KJ6A 1A5RA 1VD2A 1WGHA 3K9OB 4PS3A 4KSLC 4KIKA 2XEWA 2KFKB 4BKTA 2DZIA 4LJPB 2FIDA 4KZ0A 1WGDA 1GC6A 2JUOA 2V3SA 1WE6A 2A4ZA 4IM3A 3PLUA 5CTRC 2IY0B 3CF6E 2PE9A 2I1KA 4KSKC 1V81A 3ZKJC 4DHZE 3AU5A 3PRZA 3PLVA 4DDID 3TCAA 2IO1B 2NCNA 2MP2A 4AJWA 3CMMB 4DWFA 4EOYA 1KJTA 3JSVA 4HCPB 3VQIA 2O2VB 2I1JA 2ZJDA 1VCBA 5D2MB 3R7RA 1RFAA 3ZNGC 4KDLB 4DBGA 4DHZB 3R66C 1EO6A 2N9EB 5J18A 3C0RB 3CSFA 3MJWA 2G4DB 2XK5B 3VH4B 4TQ1A 3DBHI 4BBNC 2BKRB 2Y5BB 2CS4A 1G6JA 1E90A 4MH0E 3HIZA 1C3TA 3R7QA 4GXBA 3T9LA 3ZTDA 4B95A 2C7MB 2PJHA 4HCNB 3SD5A 5KHQA 3ZUNA 3HHMA 1CMXB 4P7IA 4GIVA 1JRUA 1WMHB 4CYEA 4TKNA 4MGKE 3VTWA 3AULA 3PZDA 2GBMA 2MBBB 3QX1A 2KOXA 4AP4C 1LM8B 3A9KA 3UIOB 2GBNA 3ONSA 3ZO5B 1WGGA 3RULA 4GB9A 3KVFB 3PHXB 2M1MA 4ASWC 3HK0A 1PQSA 2LUEA 3RCZA 3U8ZA 2KWUB 3RZFA 3ZTCA 4DHJD 4F1SA 4XZ4A 2K39A 4NJ7A 2NBUA 3S2AA 4PS8A 5DPTA 4MGZE 1M94A 3M62B 1UZXB 3NZUA 2G4SA 1LQBA 2M17A 1YD8U 3WANA 2MBQA 3IBEA 3DVGY 1WXAA 2CU1A 2QHOA 2ASQA 4KIKB 3R3MA 5L83A 2PPHA 3PRMB 4WWNA 4CO7A 2KKCA 1J0GA 3H7PA 3W1SA 2MSED 1J8CA 2L00B 2NBWB 2JRIB 3IFWB 5CX3A 2LASA 2WYQA 4LDTD 2FCSA 2LVQA 2O6VA 1L7YA 1IPGA 2L0FA 3PHWB 2AEHA 2JPHA 1P1AA 1IYFA 4HLEA 3ZRFA 4BKSD 5JHAA 2NR2A 4FN2A 4XC2A 3Q3JA 3U30A 5CHFA 3NZSA 3JSVB 2BWES 2FNJB 2LGDA 3L54A 2R2OA 4GDLB 4J6IA 4MDKE 4DHJB 2M0XA 4RMAA 4AJYB 5JZEB 2MWSB 4NJ6A 4EZJA 2KTRB 1UBIA 4ANXA 4PYUA 1GC7A 2RSUA 5BO4B 4G11A 3DQVA 3WAPA 1WRDB 3APDA 3PREA 1E8WA 2IO0B 1YJ1A 2AL6A 3OAWA 2J0JA 1QZEA 1V80A 2KJHB 2OJRA 2KDBA 2DHZA 1Q1OA 4HVBA 3QARA 2ZVNA 2LJ5A 5KHOA 2C5LC 1LFDA 2ZCBA 4LDTB 2J0MA 2LRUA 1MG8A 2RD0A 3RYTA 1V86A 2GBRA 4OVVA 1D3ZA 3VTUA 1WF9A 2K6DB 2KWCA 4NNJB 3KYDD 3PS6A 5E6OA 2IO3B 2ZVOA 3A9KB 1WE7A 2M4NA 2O6VD 1U4AA 1WJ6A 3QIJA 4HK2A 4ANVA 4EKUA 2N1WA 2HJ8A 2UYZB 1OEYA 3DDCB 1ZGUB 3DBLI 4NQKE 5IA7A 2V4LA 5FR6A 4W9DA 1IP9A 4IM2A 1OTRB 1TTNA 3QC8B 1P98A 4OVUA 1L2NA 5LLIA 2K1FA 2ZPYA 3NY5A 3B1LX 1P3QU 3K9PB 3KH0A 3NS8A 1SE9A 3DPDA 4MEMA 3MHSD 3PT2B 4M8MA 3ALBA 4A3OA 3H7PB 2KN5A 5CHVC 3ZNID 2KO3A 2HE7A 1WIAA 2MQJA 2O6VB 4NPNA 3VAWA 3VH3B 4GDKB 4MJSB 4K7UA 4DXAB 4GDLA
chains in the Genus database with same CATH superfamily
4K3CA 3IHPC 1V2YA 2N4FA 2N7EA 2PW9A 2JWUA 5EE3A 3PPAA 4II2B 5LXHA 2WX0A 1WX9A 3IAM1 4KGRA 4G50A 2KTFA 5AZFA 2KMMA 2L8JA 1T0YA 2FAZA 2LXCA 3P2BA 1Y56A 3AE4B 4N59A 1SF0A 1YMHE 4TSSA 3T3OA 1XLPA 2INNE 3I5JC 2KK8A 4HPLB 3KWLA 4NAWB 4WJNA 1WX7A 3KUZA 3QAQA 4AWJA 1J19A 3NVZA 5I4DA 1ENFA 4BOZB 4YXDB 2KNBA 4GLSC 4IG7B 3ZDTA 3VXWA 2KC1A 2I38A 2MH7A 3SU8X 1Z2MA 5GXGB 1UH6A 3QWZB 1H8CA 2RPQA 1TY2A 4Q2JA 5BYRA 4MJSA 1L4ZB 4LK0M 2KMAA 3VTVA 3ML8A 2MBOA 2IGHA 1GB1A 1LGRA 1R4MI 4DK5A 3LJ3A 4KZCA 1E5WA 2J7QB 1YQBA 4ICUA 2N0SB 3Q69A 1AARA 2DENB 2KQ4X 3HVZA 5IAAC 3EFUA 2WQYB 4LCDE 1WM2A 1E8ZA 5H8YE 3BVGA 4YTMB 2MHJA 2MLBA 4FHJA 3ML9A 1F2RI 4NAWA 2FCQA 1HEZE 2Q5WD 3VRAB 3R8BA 1R4NB 2LZ6A 1KH0A 2W54A 2B3AA 2DBYA 1FEHA 1HZ5A 2Z59B 2LVPA 4G3XB 2LWPA 3SDLC 4KKJA 1YIWA 1UNSA 1QKZA 2WXIA 5FR3A 5DPRA 3OJ3A 2L3ZA 1SB3C 4L1BA 3CIRB 3MTNB 2BYVE 4BVUC 2IZVB 4RGMA 3TL5A 2RPVA 3AV8A 2KLGA 4I6LB 3ZQ4A 2Y3AA 2X38A 3AM9A 1WR1A 1WM3A 1ZDXA 1RYJA 2UWQA 2WDVB 1Q0WB 4GMVA 4JQWC 2GB1A 3IG3A 1UBQA 3AEFB 3I9V1 4W9IA 4CHKA 1F2RC 3DVNU 3WALA 2D3AA 1ROEA 2PVOD 3ZJTA 4ZRQA 2MCNB 3GZNI 1NI2A 1JWUD 2WXJA 2JRHA 2LXAA 1NYRA 2WS3B 2V0GA 4MGIE 2K0PA 2OOBB 3UF8A 1WRIA 1EWYC 1B1ZA 2JY6A 2WWZA 2J0KA 1L6VA 2MA9B 2CR5A 4PK1A 4RGNA 1KRHA 2BWFA 3NOBA 2D10A 3AEBB 3DVNV 5BMGA 1L5PA 2WDQB 3ZNHB 3M63B 2L7RA 3PZ8A 3SEBA 2V1YA 2HD5B 1I35A 2AWTA 2GBJA 4NAMA 1Y8RC 4EZLA 1UD7A 1YN4A 2NVUI 4B0EA 5D94A 4MACA 2JQRB 5G2NA 2D3GA 1PYWD 2K8CA 4KV2A 3DBSA 1V97A 1UGMA 4WAAA 2N9PC 2E3TA 2KWVB 5BYQA 2FE8A 2XK5A 2RGFA 3BY4B 1WY8A 3DBLB 2BQQA 3P42A 2WP9B 3Q6BA 4K7SA 2ZNVC 3V62A 1WMHA 1ZE3D 2JF5A 1KOTA 4JGHB 4PS7A 3RUIB 4TQ0A 1T0QC 3VUYA 4IWOA 2IPKD 2MJ3A 3E56A 4K7WA 1WI0A 1XCTL 2D3BA 1RFKA 2CHWA 2ZPNA 2X8XX 1RM6C 3W5UB 4C7YA 4ANUA 1H4RA 2JZZA 1A5RA 4PS3A 4KIKA 4JE3B 1WGDA 2RDGA 1PUTA 3PLUA 5CTRC 2PE9A 4DHZE 1CZPA 3TSSA 3PRZA 3PLVA 2IO1B 4B0MA 2WXOA 1VCBA 2PKOA 1C77A 3R7RA 1K51A 3R66C 5J18A 2WNMA 3FC4A 2DNFA 4B95A 4MH8A 4DXGA 5HFYA 2WXGA 3VTWA 3AE2B 3PZDA 3QX1A 1FO4A 3L4PA 4AP4C 3AE6B 1XXGA 2L52A 2QMTA 3ZO5B 2LMCA 3KVFB 5TSSA 3HK0A 2KWDA 2KWUB 3RZFA 4F1SA 2NBUA 1VRAB 3EFCA 4YTNB 1R4MB 1UWXA 1M94A 1J0GA 2W3SA 2L00B 2NBWB 4JPSA 2QJLA 5CX3A 2WYQA 4LDTD 2LVQA 2O6VA 1PGXA 4BKSD 4FN2A 2BB5A 3U30A 5CHFA 2R2OA 2E6XA 2M0XA 4NJ6A 5G5HA 2WXQA 2KTRB 1RWSA 2RSUA 2BYTA 3WAPA 3PREA 1E8WA 2DLBA 1I4PA 2OJRA 4HKQA 2JU6X 2L83A 3QARA 1UWMA 3P4RB 2J53A 3RYTA 5IN7A 1D3ZA 3KYDD 3PS6A 5E6OA 1CK1A 1SSNA 2O6VD 1U4AA 4HK2A 4ANVA 1GB4A 2N1WA 1VDVA 5FR6A 3MHZA 3QC8B 2ZW0A 1STEA 1QLBB 3P4SB 3NY5A 3NS8A 4M8MA 2GLSA 3ALBA 1YQ4B 5CHVC 4A90A 4XYCA 3ZNID 2KO3A 3IT4B 1CQVA 2BBCA 4NPNA 1C4CA 2PTLA 4JIOU 5AUIA 2KTRA 3SHQA 3T3NA 1JROA 3C19A 5JH5C 1F0ZA 3SFEB 2YEPF 4KKIA 4NZLB 1TS5A 3C8YA 3NJTA 2EMTA 3KQ4A 1XD3B 4WJQA 4N9F4 1JWAD 2VZKD 2ZNVB 5CHWA 2J4XA 2JZ3B 1WGYA 2V4IB 5DPSA 3O65B 2LD9A 1EM7A 3V6CB 1C4PA 4OHJA 1GPXA 1JWBD 3UIPB 1P0RA 3JYUA 3B08A 3N1ZC 2HTHA 4MM3A 1LO5D 3EUB2 2DAJA 4HDQA 3H9DA 3PSEB 2WXKA 2YVCA 1V49A 4MSQB 4M01A 4WWOA 1OQYA 1WXQA 2ON8A 4W9GA 4AQ7A 5L95C 3Q14C 2KFJA 3L13A 3VRBB 3UGBB 3PVLA 1FMAD 1VZ7A 2MJDA 3BVMA 2KQ7A 2MJEA 3RT3B 1F9JA 4ZRKA 1JCKB 3VR8B 3H7SA 2KACA 1TS4A 3AMZA 4ZHPA 4YT0B 2K8HA 1TKYA 2YEPB 3P63A 1X1MA 4MELA 3AU4A 2KQSA 3X0WA 1C76A 1T5XD 1TYGB 2V3NA 2MW5A 2WLBA 2AL3A 4P16A 3Q3NC 3OWEB 4HDOA 2AYOB 2KLCA 4EFOA 1ESFA 1GOZA 2C7NB 3CSTA 1SE3A 2LI5A 3LB8C 1ZW7A 4WQOB 2G45B 4AUQC 2KANA 2W9NA 2D11A 4IWQA 4IUMB 4XDCA 1KFYB 1Z5SB 2LGYA 4IW0A 4ZDVA 1V8CA 3BZDB 4W9JA 2V9HA 4A8XC 3UINB 2LHDA 3Q3MC 1XCQL 1D6EC 1WFYA 1VR9A 4IM0A 2Z0DB 1MPEA 2KJRA 1OEYJ 2WXFA 3X23A 2ZCCA 2ZEQA 2DYBA 2MBHA 5EE0A 4MGYE 4A9AA 5BYSA 3WA0A 2M56B 4KVGB 1I7HA 3FAHA 2SAKA 1FXTB 4TUUA 2MBEA 1SEBD 3B2GA 3U52E 4AS1A 2KDMA 2BS3B 4OW0A 2H88B 4FLHA 5C1ZA 3P1MA 4P6VF 2WDTB 1K8RB 1GJZA 1DOXA 5D6JB 1IUEA 1YX6B 3QJZA 2D2QA 3NHEB 4C4VB 3RNEC 3RFZB 3Q8FA 2INDC 4LNFA 1FPYA 3W1YA 1AWDA 1OGWA 3AB5A 1K52A 2ZW1A 4W9CA 3AE5B 3V61A 2BF8B 4ZYSA 3HM6X 3V6EB 2K8BA 4YSZB 1V9JA 3VVWB 3TBLD 1FNUA 2LVOA 4K1RB 2K6QA 3ZIMA 4YL8A 4KDIC 4TV3A 3UI3A 3ZNZB 3RI7C 1YJIA 1WJUA 4HROA 1FIQA 2LJIA 5C23A 3WAMA 2M0AA 4XX5A 1S1QB 5GMVA 3DBRB 1F52A 2ACZB 1QILA 1WJNA 1DYQA 1E7UA 3AH7A 3NZ3A 3VUXA 1NBFC 3PZ7A 3ZDMC 1ZKHA 2BYFA 4LLGM 4A3PA 3E9SA 1D5ZC 1UUPA 2C60A 2FCNA 4WAFA 3ZGZA 5D3DA 3H1UA 2KDEB 3AN1A 2D3CA 2IO2B 4C4VA 2CHXA 2DYOA 2N9XA 4WURA 3TEXA 1ACCA 3TEWA 4HPMB 3N1XC 2PEAA 5AEKB 2L0TA 4WQMA 4FHKA 2L32A 1E7PB 2L76A 3GE3C 3IVFA 4ZRIA 2JT4B 1BUIC 3ZW3A 5AUKA 3AEAB 1WXMA 3BYYB 4YSYB 3RNAC 5BMIA 2DZJA 4ANWA 1DOYA 3W2DA 4N58A 3A4RA 2KDIA 5G55A 4HWIB 2C9WB 3RNGC 1MJDA 1WGRA 4NQLB 1WX8A 2IBIB 3T8MA 1WYWB 4GOCA 2HDEA 2XBBC 2IGGA 2N1VA 2KJ6A 1E9MA 2JZPA 3DBHB 1VD2A 1WGHA 4KSLC 3ZXRA 3OG5A 4BKTA 3I57A 4LJPB 3I63C 1ZUD2 2KVZA 4KZ0A 1GC6A 4IM3A 4KGSA 4KSKC 1V81A 4AJWA 4DWFA 4EOYA 4S0RA 2IGDA 2AQ1B 1EU3A 3U4EG 3ZNGC 3C0RB 2XK5B 2KN4A 2WXPA 5BMHA 2CU3A 2ONQA 1N61A 3T9LA 4HCNB 3ZUNA 1CMXB 4YTPB 4GIVA 1WMHB 4MGKE 3ZJVA 3A9KA 5IP4D 2AX5A 4ASWC 1PQSA 4DHJD 1AYFA 4PS8A 5DPTA 3M62B 1UZXB 1F1HA 2G4SA 1LQBA 1YD8U 1J7AA 2MBQA 1WXAA 2CU1A 3IAS1 2QHOA 4KIKB 1JMLA 1C79A 5L83A 2PPHA 4CO7A 2MSED 1SE2A 1IYFA 1P1AA 3AEGB 1TS3A 1I4XA 1XEEA 4IDIA 3Q3JA 3NZSA 2G9HD 2LGDA 3L54A 4J6IA 4RMAA 2MWSB 3DHGC 1UBIA 3LXFA 1AW7A 4ANXA 1GC7A 1I4GA 4G11A 3APDA 2BTEA 1XLOA 2IO0B 5IO9A 1YJ1A 5C2TB 1V80A 2ZVNA 5KHOA 3CWIA 2C5LC 1LFDA 2ZCBA 4LDTB 2IDYA 4WIPA 2LRUA 3KLSX 4D2KA 1CJEA 3FILB 4OVVA 3MFGA 1I4HA 3DWGC 1XF5L 4KGTA 2KWCA 4NNJB 1ZP0B 2ZVOA 1WE7A 2K9XA 1HA5A 1NVID 4L2YA 3DDCB 5FKAC 1K50A 2V4LA 1J7BA 1FFUA 1L0VB 5MPOA 2K1FA 2ZPYA 3K9PB 3KH0A 4BAXA 1YJJA 4MEMA 3DWMA 3MHSD 2HE7A 1WIAA 2O6VB 3VAWA 3VH3B 4GDKB 2N9KA 2AQ2B 4DXAB 2QILA 2OJWA 4LTUA 3RNCC 3ABVB 1V5TA 1DGJA 1NDDA 4E3CA 3B9JA 1QOGA 3NVVA 1C4AA 2OEDA 3OLMD 3L17A 3A1QB 3EECA 1FFVA 4GSWA 1ZXHA 1JALA 2DZKA 1TY0A 4BOSC 1VZ8A 3VR9B 4BKSA 3FILA 3VFKA 3DCGA 4AOFA 3V60A 1WXVA 1WR6E 1V5OA 2MRPA 2KYWA 1UELA 4R3DA 3AXCA 4B9KA 4ZRJA 3RMKC 1I42A 4C00A 4M8NA 2KVRA 2KHWB 1EUVB 4JWUC 2VZKB 4EEWA 1QOAA 4P1CC 4OZBA 4ITKA 3QHTA 4M02A 2BT6A 1IBXB 1V1OA 2W55A 1T6BX 2KX3A 4M0WA 5G5GA 4GDKA 4EZKA 4REZA 2BYEA 1SBBB 4RF1A 5HI1A 4F8CB 1LXDA 3A1QA 1P7FA 2BW2A 3AI5A 1JWSD 3A9JB 3W1SC 1GNUA 5IKCM 3EC8A 3JVZX 3N20C 4RFBA 3GP7A 4JLCA 3RD2A 4II3B 1GG3A 4MM3B 2A5UA 3L16A 2CHZA 3SR6A 5DPWA 3WAOA 1V1PA 4CQNA 4HJGE 1NEKB 1YX5B 5JXVA 3D32A 3BK2A 4IWPA 4RCOA 1P9DU 2KZRA 1YN3A 2VH2A 3N1YC 3QA8A 2ZZPB 4GN1A 1HTOA 5AZHA 5D3IB 3M95A 5HG2A 2RDBC 3I3TB 1L6UA 1IBXA 2DYMA 1WXSA 3N32A 1E6EB 1YN5A 1R4NI 1K53A 3TIXA 1JW9D 3GZNB 3KW5B 2RDHA 3OJ4B 1TKEA 3L10B 2XN9C 4NJCA 2M8SA 4YWGG 3A9JA 1BT0A 3PGEA 3W9CB 3BIID 4HPPA 1SXTA 4WJPA 2RMMA 3L0WB 2PLPA 3JW0X 4ACFA 3DHHC 2BKFA 4G0NB 1VJKA 1XO3A 1TZOA 4ARIA 2IYDB 2K22A 1WH3A 1E0ZA 2MX2A 2EELA 3N30A 1FNWA 3ZLZA 1Q5WB 3PRPB 3ZJUA 1I4QA 1KLGD 3VUWA 4GGQA 4JL9A 1RRBA 5E6NA 2INPE 4K3BA 2V3PA 3ECIA 3Q8EA 3MC9A 3DVGX 5EDSA 2JWZA 2PIAA 2NMQA 4JWSC 1Q10A 3VHTC 1YNTE 1E10A 2KFKA 1JQ4A 2QEJC 1S3SG 4EUTA 4I6NB 4US9A 1E7VA 2BS4B 4W9EA 4FA6A 3WCQA 1VLBA 1MHHE 4XDDA 3U2SC 2YLMA 2BGFA 4GU2A 3HM3A 2O2VA 2K25A 3AE7B 4B6WA 4OZCA 2KD0A 4OZAA 4A20A 1T3QA 1TKGA 4X57B 2JVCA 1TJEA 3TJPA 3KUCB 1SIFA 1XQQA 3Q3FA 3H8HA 4W9KA 1B9RA 2EKIA 1P7EA 5T8IA 2DZMA 5HHDG 3N3KB 3P4PB 1ET9A 2Z0EB 4FXCA 3MP9A 3L08A 4FJZA 3U7DA 2LGSA 3K9OB 4PT5A 4IKGA 2W3RA 2V3SA 2A4ZA 2DWQA 2IY0B 1N62A 2I1KA 3ZKJC 3AU5A 2JX5A 3NVWA 3TCAA 1ET6A 3CMMB 1KJTA 3JSVA 3VQIA 5D2MB 3NUHB 1RFAA 4DBGA 4DHZB 3HUIA 1GAQB 2G4DB 4BBNC 2BKRB 2Y5BB 4MH0E 3HIZA 2N7JA 3R7QA 4GXBA 3ZTDA 1FCLA 2C7MB 3SD5A 3HHMA 1D4BA 4QAYA 4CYEA 1WGKA 4TKNA 3AULA 2MBBB 2IJ0A 4OVZA 3KWVA 1TS2A 1N60A 2WU2B 3GE8C 3MC8A 2GBNA 4XWTA 1KTKA 3RULA 4GB9A 2M1MA 3BWUD 3U8ZA 1ZXIA 2CJNA 4NJ7A 3S2AA 4MGZE 3RNFC 2M17A 3IBEA 3Q8CA 4WWNA 3H7PA 1FRDA 3W1SA 4LNKA 1J8CA 3HVDA 3IFWB 2JRIB 2XNAC 2FCSA 1TT5B 3ZRFA 1EU4A 1D5XC 2NR2A 2HTME 3GS2A 2FNJB 4MDKE 4DHJB 4N6EB 2WXNA 4RGTA 4EZJA 4PYUA 1WYGA 3NG0A 3OAWA 1QZEA 2KJHB 4C56C 2KDBA 1Q1OA 4HVBA 1N63A 2Y5CA 2LHEA 2LJ5A 1FM0D 3AE9B 4HKZE 4RH6A 1SJHD 3BVZA 1FCCC 3RNBC 4A6QA 3VTUA 1C78A 4MT5A 3BYTB 4BZAA 1XLQA 1FD6A 2G1EA 2IO3B 3A9KB 3QIJA 4EKUA 2HJ8A 1J7CA 1YOVB 4C7ZA 1KF6B 4W9DA 4IM2A 4HRSA 1TTNA 2LGIA 2KT7A 4WWMA 4OVUA 4UDUC 1P3QU 1WWTA 4J3OD 1QF6A 3DPDA 3PT2B 4S17A 3FKYA 4DXFA 2MQJA 1NENB 1SIJA 3NRZA 4K7UA 3PV1A 3NS1A 2NBVB 1EF1A 5AZGA 2W82A 2BPSA 2VRRB 1V6EA 1WZ0A 1E8YA 3RZWC 3AE8B 1C1YB 4BBNF 4NY0A 2KMCA 5TR5A 1XLNA 3A33B 4IOIE 3AEDB 3QCAA 4W9LA 3WIMA 3IT6B 2PMVA 4RF0A 1HQRD 4FADA 3M3JA 1HE8A 3KUDB 2R2QA 3UQBA 2JXXA 2KC2A 4HJKA 4A55A 1TZ1A 4K81A 4LNOA 5JHBA 4ZYNA 5D7GA 4WH4A 1FXAA 5E6PA 3ZRCA 2KX0A 1KM7A 1N5WA 1WZ3A 2KAJA 2N7DA 4HXDA 3V3XA 5DCNA 1PFDA 1GUAB 2FUG1 3EA6A 3KYCD 3U7ZA 2DAFA 1F77A 4KX6B 5J2RA 2WGSA 3MC0B 1RLFA 2SEBD 2QCZA 1TIFA 3V05A 1PDXA 5E6JA 1BMLC 1L4DB 2J52A 3QQ8B 1QOFA 1KLUD 1WSPA 2VH1A 2LUMA 4MSMB 4E71A 3AE1B 1PGBA 2GBKA 2G3QB 2KDFB 1NYQA 4DDGD 3MJ5A 2WU5B 3A4SC 2N9LA 2I2YA 4RM9A 2OHFA 2WHIA 1XT9B 2NPTB 3Q3OC 3B2FA 4FJVB 4WJOA 3BINA 1DOIA 1RAXA 3LYYA 4ICVA 3H6NA 2D5GA 3TMPB 4ZOHC 3AEEB 5HKHA 1KLVA 2Y5PA 1PGAA 2TSSA 3J9CA 4BFRA 2J42A 2B76B 4FJYA 2PE6B 4M0WB 1MHXA 2WX1A 4LJOB 5LXIB 4I6PA 1YQ3B 2Z8LA 3RPFC 3RN9C 5FK9C 2WXMA 1HZ6A 2JSVX 4US8A 4URKA 1SJED 1TGZB 1JRPA 2REXA 3GOEA 1R7SA 3APFA 2LGXA 3ENEA 2INCC 3VDZA 1QOBA 2QIEB 2GRIA 3APCA 2GMIC 1N5XA 1D5MC 3AE3B 3P4QB 2NPTA 1V1PB 2EMSA 5EE9A 4FULA 2IY1B 2D07B 2BS2B 2LRWA 4W9FA 1MG4A 1WJ4A 3Q2AC 1TBEA 1ZDVA 4IC7B 3LDZE 4RNAA 1FRRA 1M4VA 4FBJB 3AECB 4E74A 3SFDB 2BB6A 3DOWA 3Q8BA 4P1BC 4LNIA 4XE0A 3B0AA 2JXTA 5EE1A 3URYA 4O1NA 2FCMA 3EHVA 4F7ZA 2WDRB 1IGDA 2AQ3B 5J17A 3UQAA 3R2TA 4BKGA 3EGRA 2M19A 2NS5A 4ZHOA 2FIFA 3ZVVA 2EKEC 1MFWA 2MP2B 1EF5A 1E8XA 2JYTA 1JWMD 1VZ6A 2KXJA 1AN8A 2QC8A 2GOWA 3DBRI 4ARCA 3PTFC 1IGCA 1ISNA 2FUHB 2H89B 1OQRA 3GB1A 1SGHA 2UU7A 2RR9A 2CJOA 2JYEA 2C7HA 2DX5B 4PYZA 1FXIA 4WWPA 4XWWA 2L05A 2CKHB 1MI0A 2HJ1A 4W9HA 4RM8A 3QK0A 3ZYYX 1T0SC 2XEWA 1I4RA 2KFKB 2DZIA 4ZRPA 2FIDA 1MVKA 5LNK1 3NVYA 2JUOA 1WE6A 3W5VB 3CF6E 2FBWB 4DDID 4EE2A 2BVCA 2NCNA 2K5PA 2MP2A 4HCPB 2PVGC 3HRDD 2O2VB 2I1JA 3TUOA 2ZJDA 5IOIA 4HEA1 1QQRA 4KDLB 1EO6A 2N9EB 3CSFA 3MJWA 3VH4B 4TQ1A 3DBHI 2CS4A 1QT9A 1G6JA 1E90A 1UGJA 1C3TA 1ZPSA 2PJHA 5KHQA 4P7IA 3TEZA 1JRUA 2WXRA 2GBMA 2KOXA 5C3JB 3ETRA 4TMAB 1LM8B 1HTQA 3UIOB 3O13A 3ONSA 1WGGA 3PHXB 1NI3A 2LUEA 3RCZA 3ZTCA 4XZ4A 2K39A 3NZUA 3WANA 3DVGY 2LEKA 3IXSA 2ASQA 1HXYD 3R3MA 3PRMB 3R2IA 2KKCA 2MEKA 2QDFA 4YSXB 1BXTA 1UF0A 1OFFA 4H2AA 2LASA 2NTTA 1L0YB 1L7YA 1IPGA 2L0FA 3PHWB 2AEHA 2JPHA 4LNNA 4M00A 4HLEA 1OQQA 5JHAA 1L0XB 1ZOYB 4XC2A 3JSVB 2BWES 4GDLB 5JZEB 4AJYB 1SE4A 4DQOC 2K3UA 5BO4B 2ICIA 2R61A 3DQVA 3Q8AA 1WRDB 2AL6A 2J0JA 2GI9A 2LFIA 2DHZA 2WXLA 2QSDA 2J0MA 1MG8A 2RD0A 1V86A 2NTSA 3DHIC 2GBRA 3N9YC 1T0RC 1WF9A 2K6DB 1EWCA 1C9FA 2M4NA 1WJ6A 5H92C 2UYZB 1OEYA 3ZXVA 1ZGUB 3DBLI 4NQKE 5IA7A 1IP9A 3TEYA 1OTRB 4USAA 1P98A 4JX1C 1L2NA 5LLIA 3B1LX 3PO0A 1SE9A 1A70A 1FNVA 4A3OA 3H7PB 2KN5A 2WXHA 2L1AA 3BK1A 4RGOS 4MJSB 4C80A 4L23A 1N6ZA 4GDLA 4XGAB
chains in the Genus database with same CATH topology
3PV1A 1V5TA 1NDDA 4JIOU 2KTRA 2NBVB 3IHPC 4E3CA 1EF1A 1V2YA 2N4FA 2N7EA 5AZGA 3SHQA 3PPAA 5JH5C 4II2B 2BPSA 5LXHA 2VRRB 1V6EA 2WX0A 3OLMD 3L17A 1WX9A 3A1QB 1WZ0A 3EECA 4GSWA 1E8YA 2EMTA 1XD3B 4WJQA 2DZKA 4N9F4 4G50A 2ZNVB 2KTFA 5CHWA 1C1YB 5AZFA 3RZWC 2JZ3B 5DPSA 1WGYA 4BOSC 3O65B 4BBNF 2LD9A 4NY0A 2KMCA 5TR5A 3V6CB 2L8JA 1T0YA 2FAZA 2LXCA 3P2BA 3A33B 4BKSA 3UIPB 1P0RA 3VFKA 3JYUA 3DCGA 3B08A 4AOFA 2HTHA 1WXVA 4MM3A 3QCAA 3V60A 2DAJA 4W9LA 3WIMA 1WR6E 2KK8A 1V5OA 2MRPA 4HDQA 4HPLB 1UELA 3H9DA 3PSEB 4NAWB 4WJNA 3AXCA 1WX7A 4B9KA 4FADA 2YVCA 3KUZA 3QAQA 1V49A 3M3JA 1HE8A 1J19A 4MSQB 4ZRJA 3KUDB 4AWJA 1I42A 2R2QA 3UQBA 2JXXA 2KVRA 4M8NA 4WWOA 1OQYA 2KHWB 1EUVB 2KC2A 4BOZB 4HJKA 4EEWA 4W9GA 2KNBA 5L95C 2KFJA 3L13A 1TZ1A 4IG7B 4K81A 3ZDTA 4ZYNA 3UGBB 5JHBA 3PVLA 3VXWA 2KC1A 5D7GA 3SU8X 2KQ7A 1Z2MA 3RT3B 1F9JA 5E6PA 3ZRCA 1UH6A 2KX0A 4ZRKA 1KM7A 3QWZB 3QHTA 1WZ3A 2N7DA 1H8CA 3H7SA 2RPQA 4HXDA 5DCNA 3KYCD 1GUAB 2K8HA 2KX3A 4GDKA 4MJSA 4EZKA 1X1MA 2DAFA 4MELA 3AU4A 2KQSA 2BYEA 2KMAA 5J2RA 3X0WA 3VTVA 3ML8A 2MBOA 4F8CB 1LXDA 2MW5A 1R4MI 4DK5A 3LJ3A 1RLFA 4KZCA 3A1QA 2AL3A 1E5WA 2J7QB 1YQBA 3AI5A 4ICUA 3A9JB 3W1SC 3QQ8B 1GNUA 4HDOA 2AYOB 1AARA 2KLCA 2DENB 3EC8A 4EFOA 3JVZX 4MSMB 4E71A 5IAAC 3EFUA 4LCDE 2GBKA 2G3QB 4JLCA 2KDFB 4DDGD 1WM2A 1E8ZA 3RD2A 2C7NB 3CSTA 4II3B 1GG3A 2A5UA 2MLBA 2LI5A 4AUQC 1ZW7A 3ML9A 2G45B 3L16A 4FHJA 2FCQA 3A4SC 4NAWA 4WQOB 2KANA 4RM9A 2W9NA 2CHZA 2D11A 4IWQA 3WAOA 5DPWA 4IUMB 1XT9B 2LZ6A 2NPTB 1YX5B 3D32A 2B3AA 4WJOA 4FJVB 3BINA 4IWPA 1RAXA 1P9DU 1Z5SB 2KZRA 4ICVA 2LGYA 2Z59B 2LVPA 3H6NA 4IW0A 3TMPB 4G3XB 4ZDVA 2LWPA 3SDLC 1YIWA 5HKHA 3QA8A 1KLVA 2ZZPB 4GN1A 4W9JA 5AZHA 3M95A 3UINB 1WFYA 3I3TB 4IM0A 2Z0DB 4BFRA 2DYMA 1WXSA 3OJ3A 5DPRA 2L3ZA 2KJRA 1OEYJ 3N32A 2ZCCA 4FJYA 2PE6B 3X23A 2ZEQA 2DYBA 3MTNB 4M0WB 2MBHA 2BYVE 1R4NI 4BVUC 2IZVB 2WX1A 4MGYE 3TIXA 4LJOB 3TL5A 3WA0A 4I6PA 5LXIB 3KW5B 4KVGB 3OJ4B 4I6LB 2KLGA 1FXTB 4TUUA 3L10B 2MBEA 2M8SA 4FLHA 3A9JA 5C1ZA 4URKA 1WR1A 1TGZB 1BT0A 1WM3A 2UWQA 2WDTB 2REXA 1K8RB 3PGEA 1Q0WB 4GMVA 1GJZA 5D6JB 3GOEA 4JQWC 1YX6B 3APFA 3QJZA 2LGXA 2D2QA 4WJPA 3NHEB 3IG3A 1UBQA 3L0WB 4W9IA 3ENEA 3JW0X 4CHKA 3VDZA 3DVNU 3WALA 3W1YA 1OGWA 2BKFA 4G0NB 3APCA 2MCNB 2GMIC 3GZNI 1NI2A 2JRHA 2LXAA 4W9CA 2IYDB 1WH3A 3V61A 2MX2A 2NPTA 2EMSA 4MGIE 2BF8B 2OOBB 3UF8A 3N30A 4FULA 2IY1B 3HM6X 3V6EB 2JY6A 2WWZA 2J0KA 3ZLZA 2K8BA 2D07B 1V9JA 3VVWB 1Q5WB 3PRPB 3TBLD 2LVOA 2LRWA 4W9FA 3VUWA 4GGQA 1WJ4A 2MA9B 4JL9A 1TBEA 2CR5A 4K1RB 2K6QA 3ZIMA 4IC7B 1RRBA 5E6NA 2BWFA 3NOBA 2D10A 4YL8A 3DVNV 3LDZE 4KDIC 4TV3A 3ZNZB 4FBJB 3ECIA 1WJUA 3ZNHB 4E74A 3M63B 3DVGX 5C23A 2JWZA 2L7RA 5EDSA 3DOWA 2V1YA 3WAMA 2HD5B 1I35A 2AWTA 2GBJA 4XX5A 1S1QB 5GMVA 1Y8RC 3VHTC 3B0AA 4EZLA 1UD7A 1WJNA 1E7UA 2NVUI 2KFKA 3VUXA 2FCMA 3EHVA 1S3SG 5D94A 4I6NB 4EUTA 4F7ZA 1NBFC 3ZDMC 1ZKHA 2BYFA 1E7VA 4A3PA 5J17A 4W9EA 5G2NA 2D3GA 4FA6A 2K8CA 3UQAA 4KV2A 2C60A 3DBSA 4BKGA 2FCNA 2NS5A 2FIFA 2YLMA 1UGMA 2BGFA 3H1UA 2KDEB 3HM3A 2EKEC 4GU2A 3ZVVA 2O2VA 2IO2B 4WAAA 2CHXA 2MP2B 2DYOA 2N9PC 2KWVB 1EF5A 1E8XA 2K25A 2N9XA 4HPMB 4B6WA 2PEAA 2XK5A 2RGFA 2L0TA 2KD0A 5AEKB 2KXJA 2GOWA 3BY4B 3DBRI 4FHKA 1WY8A 4A20A 3PTFC 1ISNA 2FUHB 4X57B 2L76A 2JVCA 3TJPA 1SGHA 3IVFA 2RR9A 3KUCB 1SIFA 1XQQA 2ZNVC 4K7SA 4ZRIA 3V62A 2JT4B 3Q3FA 1WMHA 4W9KA 2C7HA 2JF5A 3ZW3A 1KOTA 4JGHB 2DZMA 4PS7A 3RUIB 1WXMA 2DX5B 4PYZA 2DZJA 4TQ0A 3N3KB 3VUYA 4ANWA 4WWPA 2L05A 2CKHB 3A4RA 2KDIA 4IWOA 2C9WB 2Z0EB 4HWIB 5G55A 4K7WA 1WGRA 1WI0A 3L08A 1WX8A 2IBIB 4NQLB 3T8MA 1WYWB 4GOCA 2CHWA 2ZPNA 4FJZA 4W9HA 2XBBC 4RM8A 3U7DA 4ANUA 1H4RA 2N1VA 2JZZA 3QK0A 2KJ6A 1A5RA 1VD2A 1WGHA 3K9OB 4PS3A 4KSLC 4KIKA 2XEWA 2KFKB 4BKTA 2DZIA 4LJPB 2FIDA 4KZ0A 1WGDA 1GC6A 2JUOA 2V3SA 1WE6A 2A4ZA 4IM3A 3PLUA 5CTRC 2IY0B 3CF6E 2PE9A 2I1KA 4KSKC 1V81A 3ZKJC 4DHZE 3AU5A 3PRZA 3PLVA 4DDID 3TCAA 2IO1B 2NCNA 2MP2A 4AJWA 3CMMB 4DWFA 4EOYA 1KJTA 3JSVA 4HCPB 3VQIA 2O2VB 2I1JA 2ZJDA 1VCBA 5D2MB 3R7RA 1RFAA 3ZNGC 4KDLB 4DBGA 4DHZB 3R66C 1EO6A 2N9EB 5J18A 3C0RB 3CSFA 3MJWA 2G4DB 2XK5B 3VH4B 4TQ1A 3DBHI 4BBNC 2BKRB 2Y5BB 2CS4A 1G6JA 1E90A 4MH0E 3HIZA 1C3TA 3R7QA 4GXBA 3T9LA 3ZTDA 4B95A 2C7MB 2PJHA 4HCNB 3SD5A 5KHQA 3ZUNA 3HHMA 1CMXB 4P7IA 4GIVA 1JRUA 1WMHB 4CYEA 4TKNA 4MGKE 3VTWA 3AULA 3PZDA 2GBMA 2MBBB 3QX1A 2KOXA 4AP4C 1LM8B 3A9KA 3UIOB 2GBNA 3ONSA 3ZO5B 1WGGA 3RULA 4GB9A 3KVFB 3PHXB 2M1MA 4ASWC 3HK0A 1PQSA 2LUEA 3RCZA 3U8ZA 2KWUB 3RZFA 3ZTCA 4DHJD 4F1SA 4XZ4A 2K39A 4NJ7A 2NBUA 3S2AA 4PS8A 5DPTA 4MGZE 1M94A 3M62B 1UZXB 3NZUA 2G4SA 1LQBA 2M17A 1YD8U 3WANA 2MBQA 3IBEA 3DVGY 1WXAA 2CU1A 2QHOA 2ASQA 4KIKB 3R3MA 5L83A 2PPHA 3PRMB 4WWNA 4CO7A 2KKCA 1J0GA 3H7PA 3W1SA 2MSED 1J8CA 2L00B 2NBWB 2JRIB 3IFWB 5CX3A 2LASA 2WYQA 4LDTD 2FCSA 2LVQA 2O6VA 1L7YA 1IPGA 2L0FA 3PHWB 2AEHA 2JPHA 1P1AA 1IYFA 4HLEA 3ZRFA 4BKSD 5JHAA 2NR2A 4FN2A 4XC2A 3Q3JA 3U30A 5CHFA 3NZSA 3JSVB 2BWES 2FNJB 2LGDA 3L54A 2R2OA 4GDLB 4J6IA 4MDKE 4DHJB 2M0XA 4RMAA 4AJYB 5JZEB 2MWSB 4NJ6A 4EZJA 2KTRB 1UBIA 4ANXA 4PYUA 1GC7A 2RSUA 5BO4B 4G11A 3DQVA 3WAPA 1WRDB 3APDA 3PREA 1E8WA 2IO0B 1YJ1A 2AL6A 3OAWA 2J0JA 1QZEA 1V80A 2KJHB 2OJRA 2KDBA 2DHZA 1Q1OA 4HVBA 3QARA 2ZVNA 2LJ5A 5KHOA 2C5LC 1LFDA 2ZCBA 4LDTB 2J0MA 2LRUA 1MG8A 2RD0A 3RYTA 1V86A 2GBRA 4OVVA 1D3ZA 3VTUA 1WF9A 2K6DB 2KWCA 4NNJB 3KYDD 3PS6A 5E6OA 2IO3B 2ZVOA 3A9KB 1WE7A 2M4NA 2O6VD 1U4AA 1WJ6A 3QIJA 4HK2A 4ANVA 4EKUA 2N1WA 2HJ8A 2UYZB 1OEYA 3DDCB 1ZGUB 3DBLI 4NQKE 5IA7A 2V4LA 5FR6A 4W9DA 1IP9A 4IM2A 1OTRB 1TTNA 3QC8B 1P98A 4OVUA 1L2NA 5LLIA 2K1FA 2ZPYA 3NY5A 3B1LX 1P3QU 3K9PB 3KH0A 3NS8A 1SE9A 3DPDA 4MEMA 3MHSD 3PT2B 4M8MA 3ALBA 4A3OA 3H7PB 2KN5A 5CHVC 3ZNID 2KO3A 2HE7A 1WIAA 2MQJA 2O6VB 4NPNA 3VAWA 3VH3B 4GDKB 4MJSB 4K7UA 4DXAB 4GDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV1 A;  1V5T A;  1NDD A;  4JIO U;  2KTR A;  2NBV B;  3IHP C;  4E3C A;  1EF1 A;  1V2Y A;  2N4F A;  2N7E A;  5AZG A;  3SHQ A;  3PPA A;  5JH5 C;  4II2 B;  2BPS A;  5LXH A;  2VRR B;  1V6E A;  2WX0 A;  3OLM D;  3L17 A;  1WX9 A;  3A1Q B;  1WZ0 A;  3EEC A;  4GSW A;  1E8Y A;  2EMT A;  1XD3 B;  4WJQ A;  2DZK A;  4N9F 4;  4G50 A;  2ZNV B;  2KTF A;  5CHW A;  1C1Y B;  5AZF A;  3RZW C;  2JZ3 B;  5DPS A;  1WGY A;  4BOS C;  3O65 B;  4BBN F;  2LD9 A;  4NY0 A;  2KMC A;  5TR5 A;  3V6C B;  2L8J A;  1T0Y A;  2FAZ A;  2LXC A;  3P2B A;  3A33 B;  4BKS A;  3UIP B;  1P0R A;  3VFK A;  3JYU A;  3DCG A;  3B08 A;  4AOF A;  2HTH A;  1WXV A;  4MM3 A;  3QCA A;  3V60 A;  2DAJ A;  4W9L A;  3WIM A;  1WR6 E;  2KK8 A;  1V5O A;  2MRP A;  4HDQ A;  4HPL B;  1UEL A;  3H9D A;  3PSE B;  4NAW B;  4WJN A;  3AXC A;  1WX7 A;  4B9K A;  4FAD A;  2YVC A;  3KUZ A;  3QAQ A;  1V49 A;  3M3J A;  1HE8 A;  1J19 A;  4MSQ B;  4ZRJ A;  3KUD B;  4AWJ A;  1I42 A;  2R2Q A;  3UQB A;  2JXX A;  2KVR A;  4M8N A;  4WWO A;  1OQY A;  2KHW B;  1EUV B;  2KC2 A;  4BOZ B;  4HJK A;  4EEW A;  4W9G A;  2KNB A;  5L95 C;  2KFJ A;  3L13 A;  1TZ1 A;  4IG7 B;  4K81 A;  3ZDT A;  4ZYN A;  3UGB B;  5JHB A;  3PVL A;  3VXW A;  2KC1 A;  5D7G A;  3SU8 X;  2KQ7 A;  1Z2M A;  3RT3 B;  1F9J A;  5E6P A;  3ZRC A;  1UH6 A;  2KX0 A;  4ZRK A;  1KM7 A;  3QWZ B;  3QHT A;  1WZ3 A;  2N7D A;  1H8C A;  3H7S A;  2RPQ A;  4HXD A;  5DCN A;  3KYC D;  1GUA B;  2K8H A;  2KX3 A;  4GDK A;  4MJS A;  4EZK A;  1X1M A;  2DAF A;  4MEL A;  3AU4 A;  2KQS A;  2BYE A;  2KMA A;  5J2R A;  3X0W A;  3VTV A;  3ML8 A;  2MBO A;  4F8C B;  1LXD A;  2MW5 A;  1R4M I;  4DK5 A;  3LJ3 A;  1RLF A;  4KZC A;  3A1Q A;  2AL3 A;  1E5W A;  2J7Q B;  1YQB A;  3AI5 A;  4ICU A;  3A9J B;  3W1S C;  3QQ8 B;  1GNU A;  4HDO A;  2AYO B;  1AAR A;  2KLC A;  2DEN B;  3EC8 A;  4EFO A;  3JVZ X;  4MSM B;  4E71 A;  5IAA C;  3EFU A;  4LCD E;  2GBK A;  2G3Q B;  4JLC A;  2KDF B;  4DDG D;  1WM2 A;  1E8Z A;  3RD2 A;  2C7N B;  3CST A;  4II3 B;  1GG3 A;  2A5U A;  2MLB A;  2LI5 A;  4AUQ C;  1ZW7 A;  3ML9 A;  2G45 B;  3L16 A;  4FHJ A;  2FCQ A;  3A4S C;  4NAW A;  4WQO B;  2KAN A;  4RM9 A;  2W9N A;  2CHZ A;  2D11 A;  4IWQ A;  3WAO A;  5DPW A;  4IUM B;  1XT9 B;  2LZ6 A;  2NPT B;  1YX5 B;  3D32 A;  2B3A A;  4WJO A;  4FJV B;  3BIN A;  4IWP A;  1RAX A;  1P9D U;  1Z5S B;  2KZR A;  4ICV A;  2LGY A;  2Z59 B;  2LVP A;  3H6N A;  4IW0 A;  3TMP B;  4G3X B;  4ZDV A;  2LWP A;  3SDL C;  1YIW A;  5HKH A;  3QA8 A;  1KLV A;  2ZZP B;  4GN1 A;  4W9J A;  5AZH A;  3M95 A;  3UIN B;  1WFY A;  3I3T B;  4IM0 A;  2Z0D B;  4BFR A;  2DYM A;  1WXS A;  3OJ3 A;  5DPR A;  2L3Z A;  2KJR A;  1OEY J;  3N32 A;  2ZCC A;  4FJY A;  2PE6 B;  3X23 A;  2ZEQ A;  2DYB A;  3MTN B;  4M0W B;  2MBH A;  2BYV E;  1R4N I;  4BVU C;  2IZV B;  2WX1 A;  4MGY E;  3TIX A;  4LJO B;  3TL5 A;  3WA0 A;  4I6P A;  5LXI B;  3KW5 B;  4KVG B;  3OJ4 B;  4I6L B;  2KLG A;  1FXT B;  4TUU A;  3L10 B;  2MBE A;  2M8S A;  4FLH A;  3A9J A;  5C1Z A;  4URK A;  1WR1 A;  1TGZ B;  1BT0 A;  1WM3 A;  2UWQ A;  2WDT B;  2REX A;  1K8R B;  3PGE A;  1Q0W B;  4GMV A;  1GJZ A;  5D6J B;  3GOE A;  4JQW C;  1YX6 B;  3APF A;  3QJZ A;  2LGX A;  2D2Q A;  4WJP A;  3NHE B;  3IG3 A;  1UBQ A;  3L0W B;  4W9I A;  3ENE A;  3JW0 X;  4CHK A;  3VDZ A;  3DVN U;  3WAL A;  3W1Y A;  1OGW A;  2BKF A;  4G0N B;  3APC A;  2MCN B;  2GMI C;  3GZN I;  1NI2 A;  2JRH A;  2LXA A;  4W9C A;  2IYD B;  1WH3 A;  3V61 A;  2MX2 A;  2NPT A;  2EMS A;  4MGI E;  2BF8 B;  2OOB B;  3UF8 A;  3N30 A;  4FUL A;  2IY1 B;  3HM6 X;  3V6E B;  2JY6 A;  2WWZ A;  2J0K A;  3ZLZ A;  2K8B A;  2D07 B;  1V9J A;  3VVW B;  1Q5W B;  3PRP B;  3TBL D;  2LVO A;  2LRW A;  4W9F A;  3VUW A;  4GGQ A;  1WJ4 A;  2MA9 B;  4JL9 A;  1TBE A;  2CR5 A;  4K1R B;  2K6Q A;  3ZIM A;  4IC7 B;  1RRB A;  5E6N A;  2BWF A;  3NOB A;  2D10 A;  4YL8 A;  3DVN V;  3LDZ E;  4KDI C;  4TV3 A;  3ZNZ B;  4FBJ B;  3ECI A;  1WJU A;  3ZNH B;  4E74 A;  3M63 B;  3DVG X;  5C23 A;  2JWZ A;  2L7R A;  5EDS A;  3DOW A;  2V1Y A;  3WAM A;  2HD5 B;  1I35 A;  2AWT A;  2GBJ A;  4XX5 A;  1S1Q B;  5GMV A;  1Y8R C;  3VHT C;  3B0A A;  4EZL A;  1UD7 A;  1WJN A;  1E7U A;  2NVU I;  2KFK A;  3VUX A;  2FCM A;  3EHV A;  1S3S G;  5D94 A;  4I6N B;  4EUT A;  4F7Z A;  1NBF C;  3ZDM C;  1ZKH A;  2BYF A;  1E7V A;  4A3P A;  5J17 A;  4W9E A;  5G2N A;  2D3G A;  4FA6 A;  2K8C A;  3UQA A;  4KV2 A;  2C60 A;  3DBS A;  4BKG A;  2FCN A;  2NS5 A;  2FIF A;  2YLM A;  1UGM A;  2BGF A;  3H1U A;  2KDE B;  3HM3 A;  2EKE C;  4GU2 A;  3ZVV A;  2O2V A;  2IO2 B;  4WAA A;  2CHX A;  2MP2 B;  2DYO A;  2N9P C;  2KWV B;  1EF5 A;  1E8X A;  2K25 A;  2N9X A;  4HPM B;  4B6W A;  2PEA A;  2XK5 A;  2RGF A;  2L0T A;  2KD0 A;  5AEK B;  2KXJ A;  2GOW A;  3BY4 B;  3DBR I;  4FHK A;  1WY8 A;  4A20 A;  3PTF C;  1ISN A;  2FUH B;  4X57 B;  2L76 A;  2JVC A;  3TJP A;  1SGH A;  3IVF A;  2RR9 A;  3KUC B;  1SIF A;  1XQQ A;  2ZNV C;  4K7S A;  4ZRI A;  3V62 A;  2JT4 B;  3Q3F A;  1WMH A;  4W9K A;  2C7H A;  2JF5 A;  3ZW3 A;  1KOT A;  4JGH B;  2DZM A;  4PS7 A;  3RUI B;  1WXM A;  2DX5 B;  4PYZ A;  2DZJ A;  4TQ0 A;  3N3K B;  3VUY A;  4ANW A;  4WWP A;  2L05 A;  2CKH B;  3A4R A;  2KDI A;  4IWO A;  2C9W B;  2Z0E B;  4HWI B;  5G55 A;  4K7W A;  1WGR A;  1WI0 A;  3L08 A;  1WX8 A;  2IBI B;  4NQL B;  3T8M A;  1WYW B;  4GOC A;  2CHW A;  2ZPN A;  4FJZ A;  4W9H A;  2XBB C;  4RM8 A;  3U7D A;  4ANU A;  1H4R A;  2N1V A;  2JZZ A;  3QK0 A;  2KJ6 A;  1A5R A;  1VD2 A;  1WGH A;  3K9O B;  4PS3 A;  4KSL C;  4KIK A;  2XEW A;  2KFK B;  4BKT A;  2DZI A;  4LJP B;  2FID A;  4KZ0 A;  1WGD A;  1GC6 A;  2JUO A;  2V3S A;  1WE6 A;  2A4Z A;  4IM3 A;  3PLU A;  5CTR C;  2IY0 B;  3CF6 E;  2PE9 A;  2I1K A;  4KSK C;  1V81 A;  3ZKJ C;  4DHZ E;  3AU5 A;  3PRZ A;  3PLV A;  4DDI D;  3TCA A;  2IO1 B;  2NCN A;  2MP2 A;  4AJW A;  3CMM B;  4DWF A;  4EOY A;  1KJT A;  3JSV A;  4HCP B;  3VQI A;  2O2V B;  2I1J A;  2ZJD A;  1VCB A;  5D2M B;  3R7R A;  1RFA A;  3ZNG C;  4KDL B;  4DBG A;  4DHZ B;  3R66 C;  1EO6 A;  2N9E B;  5J18 A;  3C0R B;  3CSF A;  3MJW A;  2G4D B;  2XK5 B;  3VH4 B;  4TQ1 A;  3DBH I;  4BBN C;  2BKR B;  2Y5B B;  2CS4 A;  1G6J A;  1E90 A;  4MH0 E;  3HIZ A;  1C3T A;  3R7Q A;  4GXB A;  3T9L A;  3ZTD A;  4B95 A;  2C7M B;  2PJH A;  4HCN B;  3SD5 A;  5KHQ A;  3ZUN A;  3HHM A;  1CMX B;  4P7I A;  4GIV A;  1JRU A;  1WMH B;  4CYE A;  4TKN A;  4MGK E;  3VTW A;  3AUL A;  3PZD A;  2GBM A;  2MBB B;  3QX1 A;  2KOX A;  4AP4 C;  1LM8 B;  3A9K A;  3UIO B;  2GBN A;  3ONS A;  3ZO5 B;  1WGG A;  3RUL A;  4GB9 A;  3KVF B;  3PHX B;  2M1M A;  4ASW C;  3HK0 A;  1PQS A;  2LUE A;  3RCZ A;  3U8Z A;  2KWU B;  3RZF A;  3ZTC A;  4DHJ D;  4F1S A;  4XZ4 A;  2K39 A;  4NJ7 A;  2NBU A;  3S2A A;  4PS8 A;  5DPT A;  4MGZ E;  1M94 A;  3M62 B;  1UZX B;  3NZU A;  2G4S A;  1LQB A;  2M17 A;  1YD8 U;  3WAN A;  2MBQ A;  3IBE A;  3DVG Y;  1WXA A;  2CU1 A;  2QHO A;  2ASQ A;  4KIK B;  3R3M A;  5L83 A;  2PPH A;  3PRM B;  4WWN A;  4CO7 A;  2KKC A;  1J0G A;  3H7P A;  3W1S A;  2MSE D;  1J8C A;  2L00 B;  2NBW B;  2JRI B;  3IFW B;  5CX3 A;  2LAS A;  2WYQ A;  4LDT D;  2FCS A;  2LVQ A;  2O6V A;  1L7Y A;  1IPG A;  2L0F A;  3PHW B;  2AEH A;  2JPH A;  1P1A A;  1IYF A;  4HLE A;  3ZRF A;  4BKS D;  5JHA A;  2NR2 A;  4FN2 A;  4XC2 A;  3Q3J A;  3U30 A;  5CHF A;  3NZS A;  3JSV B;  2BWE S;  2FNJ B;  2LGD A;  3L54 A;  2R2O A;  4GDL B;  4J6I A;  4MDK E;  4DHJ B;  2M0X A;  4RMA A;  4AJY B;  5JZE B;  2MWS B;  4NJ6 A;  4EZJ A;  2KTR B;  1UBI A;  4ANX A;  4PYU A;  1GC7 A;  2RSU A;  5BO4 B;  4G11 A;  3DQV A;  3WAP A;  1WRD B;  3APD A;  3PRE A;  1E8W A;  2IO0 B;  1YJ1 A;  2AL6 A;  3OAW A;  2J0J A;  1QZE A;  1V80 A;  2KJH B;  2OJR A;  2KDB A;  2DHZ A;  1Q1O A;  4HVB A;  3QAR A;  2ZVN A;  2LJ5 A;  5KHO A;  2C5L C;  1LFD A;  2ZCB A;  4LDT B;  2J0M A;  2LRU A;  1MG8 A;  2RD0 A;  3RYT A;  1V86 A;  2GBR A;  4OVV A;  1D3Z A;  3VTU A;  1WF9 A;  2K6D B;  2KWC A;  4NNJ B;  3KYD D;  3PS6 A;  5E6O A;  2IO3 B;  2ZVO A;  3A9K B;  1WE7 A;  2M4N A;  2O6V D;  1U4A A;  1WJ6 A;  3QIJ A;  4HK2 A;  4ANV A;  4EKU A;  2N1W A;  2HJ8 A;  2UYZ B;  1OEY A;  3DDC B;  1ZGU B;  3DBL I;  4NQK E;  5IA7 A;  2V4L A;  5FR6 A;  4W9D A;  1IP9 A;  4IM2 A;  1OTR B;  1TTN A;  3QC8 B;  1P98 A;  4OVU A;  1L2N A;  5LLI A;  2K1F A;  2ZPY A;  3NY5 A;  3B1L X;  1P3Q U;  3K9P B;  3KH0 A;  3NS8 A;  1SE9 A;  3DPD A;  4MEM A;  3MHS D;  3PT2 B;  4M8M A;  3ALB A;  4A3O A;  3H7P B;  2KN5 A;  5CHV C;  3ZNI D;  2KO3 A;  2HE7 A;  1WIA A;  2MQJ A;  2O6V B;  4NPN A;  3VAW A;  3VH3 B;  4GDK B;  4MJS B;  4K7U A;  4DXA B;  4GDL A; 
#chains in the Genus database with same CATH topology
 4K3C A;  3IHP C;  1V2Y A;  2N4F A;  2N7E A;  2PW9 A;  2JWU A;  5EE3 A;  3PPA A;  4II2 B;  5LXH A;  2WX0 A;  1WX9 A;  3IAM 1;  4KGR A;  4G50 A;  2KTF A;  5AZF A;  2KMM A;  2L8J A;  1T0Y A;  2FAZ A;  2LXC A;  3P2B A;  1Y56 A;  3AE4 B;  4N59 A;  1SF0 A;  1YMH E;  4TSS A;  3T3O A;  1XLP A;  2INN E;  3I5J C;  2KK8 A;  4HPL B;  3KWL A;  4NAW B;  4WJN A;  1WX7 A;  3KUZ A;  3QAQ A;  4AWJ A;  1J19 A;  3NVZ A;  5I4D A;  1ENF A;  4BOZ B;  4YXD B;  2KNB A;  4GLS C;  4IG7 B;  3ZDT A;  3VXW A;  2KC1 A;  2I38 A;  2MH7 A;  3SU8 X;  1Z2M A;  5GXG B;  1UH6 A;  3QWZ B;  1H8C A;  2RPQ A;  1TY2 A;  4Q2J A;  5BYR A;  4MJS A;  1L4Z B;  4LK0 M;  2KMA A;  3VTV A;  3ML8 A;  2MBO A;  2IGH A;  1GB1 A;  1LGR A;  1R4M I;  4DK5 A;  3LJ3 A;  4KZC A;  1E5W A;  2J7Q B;  1YQB A;  4ICU A;  2N0S B;  3Q69 A;  1AAR A;  2DEN B;  2KQ4 X;  3HVZ A;  5IAA C;  3EFU A;  2WQY B;  4LCD E;  1WM2 A;  1E8Z A;  5H8Y E;  3BVG A;  4YTM B;  2MHJ A;  2MLB A;  4FHJ A;  3ML9 A;  1F2R I;  4NAW A;  2FCQ A;  1HEZ E;  2Q5W D;  3VRA B;  3R8B A;  1R4N B;  2LZ6 A;  1KH0 A;  2W54 A;  2B3A A;  2DBY A;  1FEH A;  1HZ5 A;  2Z59 B;  2LVP A;  4G3X B;  2LWP A;  3SDL C;  4KKJ A;  1YIW A;  1UNS A;  1QKZ A;  2WXI A;  5FR3 A;  5DPR A;  3OJ3 A;  2L3Z A;  1SB3 C;  4L1B A;  3CIR B;  3MTN B;  2BYV E;  4BVU C;  2IZV B;  4RGM A;  3TL5 A;  2RPV A;  3AV8 A;  2KLG A;  4I6L B;  3ZQ4 A;  2Y3A A;  2X38 A;  3AM9 A;  1WR1 A;  1WM3 A;  1ZDX A;  1RYJ A;  2UWQ A;  2WDV B;  1Q0W B;  4GMV A;  4JQW C;  2GB1 A;  3IG3 A;  1UBQ A;  3AEF B;  3I9V 1;  4W9I A;  4CHK A;  1F2R C;  3DVN U;  3WAL A;  2D3A A;  1ROE A;  2PVO D;  3ZJT A;  4ZRQ A;  2MCN B;  3GZN I;  1NI2 A;  1JWU D;  2WXJ A;  2JRH A;  2LXA A;  1NYR A;  2WS3 B;  2V0G A;  4MGI E;  2K0P A;  2OOB B;  3UF8 A;  1WRI A;  1EWY C;  1B1Z A;  2JY6 A;  2WWZ A;  2J0K A;  1L6V A;  2MA9 B;  2CR5 A;  4PK1 A;  4RGN A;  1KRH A;  2BWF A;  3NOB A;  2D10 A;  3AEB B;  3DVN V;  5BMG A;  1L5P A;  2WDQ B;  3ZNH B;  3M63 B;  2L7R A;  3PZ8 A;  3SEB A;  2V1Y A;  2HD5 B;  1I35 A;  2AWT A;  2GBJ A;  4NAM A;  1Y8R C;  4EZL A;  1UD7 A;  1YN4 A;  2NVU I;  4B0E A;  5D94 A;  4MAC A;  2JQR B;  5G2N A;  2D3G A;  1PYW D;  2K8C A;  4KV2 A;  3DBS A;  1V97 A;  1UGM A;  4WAA A;  2N9P C;  2E3T A;  2KWV B;  5BYQ A;  2FE8 A;  2XK5 A;  2RGF A;  3BY4 B;  1WY8 A;  3DBL B;  2BQQ A;  3P42 A;  2WP9 B;  3Q6B A;  4K7S A;  2ZNV C;  3V62 A;  1WMH A;  1ZE3 D;  2JF5 A;  1KOT A;  4JGH B;  4PS7 A;  3RUI B;  4TQ0 A;  1T0Q C;  3VUY A;  4IWO A;  2IPK D;  2MJ3 A;  3E56 A;  4K7W A;  1WI0 A;  1XCT L;  2D3B A;  1RFK A;  2CHW A;  2ZPN A;  2X8X X;  1RM6 C;  3W5U B;  4C7Y A;  4ANU A;  1H4R A;  2JZZ A;  1A5R A;  4PS3 A;  4KIK A;  4JE3 B;  1WGD A;  2RDG A;  1PUT A;  3PLU A;  5CTR C;  2PE9 A;  4DHZ E;  1CZP A;  3TSS A;  3PRZ A;  3PLV A;  2IO1 B;  4B0M A;  2WXO A;  1VCB A;  2PKO A;  1C77 A;  3R7R A;  1K51 A;  3R66 C;  5J18 A;  2WNM A;  3FC4 A;  2DNF A;  4B95 A;  4MH8 A;  4DXG A;  5HFY A;  2WXG A;  3VTW A;  3AE2 B;  3PZD A;  3QX1 A;  1FO4 A;  3L4P A;  4AP4 C;  3AE6 B;  1XXG A;  2L52 A;  2QMT A;  3ZO5 B;  2LMC A;  3KVF B;  5TSS A;  3HK0 A;  2KWD A;  2KWU B;  3RZF A;  4F1S A;  2NBU A;  1VRA B;  3EFC A;  4YTN B;  1R4M B;  1UWX A;  1M94 A;  1J0G A;  2W3S A;  2L00 B;  2NBW B;  4JPS A;  2QJL A;  5CX3 A;  2WYQ A;  4LDT D;  2LVQ A;  2O6V A;  1PGX A;  4BKS D;  4FN2 A;  2BB5 A;  3U30 A;  5CHF A;  2R2O A;  2E6X A;  2M0X A;  4NJ6 A;  5G5H A;  2WXQ A;  2KTR B;  1RWS A;  2RSU A;  2BYT A;  3WAP A;  3PRE A;  1E8W A;  2DLB A;  1I4P A;  2OJR A;  4HKQ A;  2JU6 X;  2L83 A;  3QAR A;  1UWM A;  3P4R B;  2J53 A;  3RYT A;  5IN7 A;  1D3Z A;  3KYD D;  3PS6 A;  5E6O A;  1CK1 A;  1SSN A;  2O6V D;  1U4A A;  4HK2 A;  4ANV A;  1GB4 A;  2N1W A;  1VDV A;  5FR6 A;  3MHZ A;  3QC8 B;  2ZW0 A;  1STE A;  1QLB B;  3P4S B;  3NY5 A;  3NS8 A;  4M8M A;  2GLS A;  3ALB A;  1YQ4 B;  5CHV C;  4A90 A;  4XYC A;  3ZNI D;  2KO3 A;  3IT4 B;  1CQV A;  2BBC A;  4NPN A;  1C4C A;  2PTL A;  4JIO U;  5AUI A;  2KTR A;  3SHQ A;  3T3N A;  1JRO A;  3C19 A;  5JH5 C;  1F0Z A;  3SFE B;  2YEP F;  4KKI A;  4NZL B;  1TS5 A;  3C8Y A;  3NJT A;  2EMT A;  3KQ4 A;  1XD3 B;  4WJQ A;  4N9F 4;  1JWA D;  2VZK D;  2ZNV B;  5CHW A;  2J4X A;  2JZ3 B;  1WGY A;  2V4I B;  5DPS A;  3O65 B;  2LD9 A;  1EM7 A;  3V6C B;  1C4P A;  4OHJ A;  1GPX A;  1JWB D;  3UIP B;  1P0R A;  3JYU A;  3B08 A;  3N1Z C;  2HTH A;  4MM3 A;  1LO5 D;  3EUB 2;  2DAJ A;  4HDQ A;  3H9D A;  3PSE B;  2WXK A;  2YVC A;  1V49 A;  4MSQ B;  4M01 A;  4WWO A;  1OQY A;  1WXQ A;  2ON8 A;  4W9G A;  4AQ7 A;  5L95 C;  3Q14 C;  2KFJ A;  3L13 A;  3VRB B;  3UGB B;  3PVL A;  1FMA D;  1VZ7 A;  2MJD A;  3BVM A;  2KQ7 A;  2MJE A;  3RT3 B;  1F9J A;  4ZRK A;  1JCK B;  3VR8 B;  3H7S A;  2KAC A;  1TS4 A;  3AMZ A;  4ZHP A;  4YT0 B;  2K8H A;  1TKY A;  2YEP B;  3P63 A;  1X1M A;  4MEL A;  3AU4 A;  2KQS A;  3X0W A;  1C76 A;  1T5X D;  1TYG B;  2V3N A;  2MW5 A;  2WLB A;  2AL3 A;  4P16 A;  3Q3N C;  3OWE B;  4HDO A;  2AYO B;  2KLC A;  4EFO A;  1ESF A;  1GOZ A;  2C7N B;  3CST A;  1SE3 A;  2LI5 A;  3LB8 C;  1ZW7 A;  4WQO B;  2G45 B;  4AUQ C;  2KAN A;  2W9N A;  2D11 A;  4IWQ A;  4IUM B;  4XDC A;  1KFY B;  1Z5S B;  2LGY A;  4IW0 A;  4ZDV A;  1V8C A;  3BZD B;  4W9J A;  2V9H A;  4A8X C;  3UIN B;  2LHD A;  3Q3M C;  1XCQ L;  1D6E C;  1WFY A;  1VR9 A;  4IM0 A;  2Z0D B;  1MPE A;  2KJR A;  1OEY J;  2WXF A;  3X23 A;  2ZCC A;  2ZEQ A;  2DYB A;  2MBH A;  5EE0 A;  4MGY E;  4A9A A;  5BYS A;  3WA0 A;  2M56 B;  4KVG B;  1I7H A;  3FAH A;  2SAK A;  1FXT B;  4TUU A;  2MBE A;  1SEB D;  3B2G A;  3U52 E;  4AS1 A;  2KDM A;  2BS3 B;  4OW0 A;  2H88 B;  4FLH A;  5C1Z A;  3P1M A;  4P6V F;  2WDT B;  1K8R B;  1GJZ A;  1DOX A;  5D6J B;  1IUE A;  1YX6 B;  3QJZ A;  2D2Q A;  3NHE B;  4C4V B;  3RNE C;  3RFZ B;  3Q8F A;  2IND C;  4LNF A;  1FPY A;  3W1Y A;  1AWD A;  1OGW A;  3AB5 A;  1K52 A;  2ZW1 A;  4W9C A;  3AE5 B;  3V61 A;  2BF8 B;  4ZYS A;  3HM6 X;  3V6E B;  2K8B A;  4YSZ B;  1V9J A;  3VVW B;  3TBL D;  1FNU A;  2LVO A;  4K1R B;  2K6Q A;  3ZIM A;  4YL8 A;  4KDI C;  4TV3 A;  3UI3 A;  3ZNZ B;  3RI7 C;  1YJI A;  1WJU A;  4HRO A;  1FIQ A;  2LJI A;  5C23 A;  3WAM A;  2M0A A;  4XX5 A;  1S1Q B;  5GMV A;  3DBR B;  1F52 A;  2ACZ B;  1QIL A;  1WJN A;  1DYQ A;  1E7U A;  3AH7 A;  3NZ3 A;  3VUX A;  1NBF C;  3PZ7 A;  3ZDM C;  1ZKH A;  2BYF A;  4LLG M;  4A3P A;  3E9S A;  1D5Z C;  1UUP A;  2C60 A;  2FCN A;  4WAF A;  3ZGZ A;  5D3D A;  3H1U A;  2KDE B;  3AN1 A;  2D3C A;  2IO2 B;  4C4V A;  2CHX A;  2DYO A;  2N9X A;  4WUR A;  3TEX A;  1ACC A;  3TEW A;  4HPM B;  3N1X C;  2PEA A;  5AEK B;  2L0T A;  4WQM A;  4FHK A;  2L32 A;  1E7P B;  2L76 A;  3GE3 C;  3IVF A;  4ZRI A;  2JT4 B;  1BUI C;  3ZW3 A;  5AUK A;  3AEA B;  1WXM A;  3BYY B;  4YSY B;  3RNA C;  5BMI A;  2DZJ A;  4ANW A;  1DOY A;  3W2D A;  4N58 A;  3A4R A;  2KDI A;  5G55 A;  4HWI B;  2C9W B;  3RNG C;  1MJD A;  1WGR A;  4NQL B;  1WX8 A;  2IBI B;  3T8M A;  1WYW B;  4GOC A;  2HDE A;  2XBB C;  2IGG A;  2N1V A;  2KJ6 A;  1E9M A;  2JZP A;  3DBH B;  1VD2 A;  1WGH A;  4KSL C;  3ZXR A;  3OG5 A;  4BKT A;  3I57 A;  4LJP B;  3I63 C;  1ZUD 2;  2KVZ A;  4KZ0 A;  1GC6 A;  4IM3 A;  4KGS A;  4KSK C;  1V81 A;  4AJW A;  4DWF A;  4EOY A;  4S0R A;  2IGD A;  2AQ1 B;  1EU3 A;  3U4E G;  3ZNG C;  3C0R B;  2XK5 B;  2KN4 A;  2WXP A;  5BMH A;  2CU3 A;  2ONQ A;  1N61 A;  3T9L A;  4HCN B;  3ZUN A;  1CMX B;  4YTP B;  4GIV A;  1WMH B;  4MGK E;  3ZJV A;  3A9K A;  5IP4 D;  2AX5 A;  4ASW C;  1PQS A;  4DHJ D;  1AYF A;  4PS8 A;  5DPT A;  3M62 B;  1UZX B;  1F1H A;  2G4S A;  1LQB A;  1YD8 U;  1J7A A;  2MBQ A;  1WXA A;  2CU1 A;  3IAS 1;  2QHO A;  4KIK B;  1JML A;  1C79 A;  5L83 A;  2PPH A;  4CO7 A;  2MSE D;  1SE2 A;  1IYF A;  1P1A A;  3AEG B;  1TS3 A;  1I4X A;  1XEE A;  4IDI A;  3Q3J A;  3NZS A;  2G9H D;  2LGD A;  3L54 A;  4J6I A;  4RMA A;  2MWS B;  3DHG C;  1UBI A;  3LXF A;  1AW7 A;  4ANX A;  1GC7 A;  1I4G A;  4G11 A;  3APD A;  2BTE A;  1XLO A;  2IO0 B;  5IO9 A;  1YJ1 A;  5C2T B;  1V80 A;  2ZVN A;  5KHO A;  3CWI A;  2C5L C;  1LFD A;  2ZCB A;  4LDT B;  2IDY A;  4WIP A;  2LRU A;  3KLS X;  4D2K A;  1CJE A;  3FIL B;  4OVV A;  3MFG A;  1I4H A;  3DWG C;  1XF5 L;  4KGT A;  2KWC A;  4NNJ B;  1ZP0 B;  2ZVO A;  1WE7 A;  2K9X A;  1HA5 A;  1NVI D;  4L2Y A;  3DDC B;  5FKA C;  1K50 A;  2V4L A;  1J7B A;  1FFU A;  1L0V B;  5MPO A;  2K1F A;  2ZPY A;  3K9P B;  3KH0 A;  4BAX A;  1YJJ A;  4MEM A;  3DWM A;  3MHS D;  2HE7 A;  1WIA A;  2O6V B;  3VAW A;  3VH3 B;  4GDK B;  2N9K A;  2AQ2 B;  4DXA B;  2QIL A;  2OJW A;  4LTU A;  3RNC C;  3ABV B;  1V5T A;  1DGJ A;  1NDD A;  4E3C A;  3B9J A;  1QOG A;  3NVV A;  1C4A A;  2OED A;  3OLM D;  3L17 A;  3A1Q B;  3EEC A;  1FFV A;  4GSW A;  1ZXH A;  1JAL A;  2DZK A;  1TY0 A;  4BOS C;  1VZ8 A;  3VR9 B;  4BKS A;  3FIL A;  3VFK A;  3DCG A;  4AOF A;  3V60 A;  1WXV A;  1WR6 E;  1V5O A;  2MRP A;  2KYW A;  1UEL A;  4R3D A;  3AXC A;  4B9K A;  4ZRJ A;  3RMK C;  1I42 A;  4C00 A;  4M8N A;  2KVR A;  2KHW B;  1EUV B;  4JWU C;  2VZK B;  4EEW A;  1QOA A;  4P1C C;  4OZB A;  4ITK A;  3QHT A;  4M02 A;  2BT6 A;  1IBX B;  1V1O A;  2W55 A;  1T6B X;  2KX3 A;  4M0W A;  5G5G A;  4GDK A;  4EZK A;  4REZ A;  2BYE A;  1SBB B;  4RF1 A;  5HI1 A;  4F8C B;  1LXD A;  3A1Q A;  1P7F A;  2BW2 A;  3AI5 A;  1JWS D;  3A9J B;  3W1S C;  1GNU A;  5IKC M;  3EC8 A;  3JVZ X;  3N20 C;  4RFB A;  3GP7 A;  4JLC A;  3RD2 A;  4II3 B;  1GG3 A;  4MM3 B;  2A5U A;  3L16 A;  2CHZ A;  3SR6 A;  5DPW A;  3WAO A;  1V1P A;  4CQN A;  4HJG E;  1NEK B;  1YX5 B;  5JXV A;  3D32 A;  3BK2 A;  4IWP A;  4RCO A;  1P9D U;  2KZR A;  1YN3 A;  2VH2 A;  3N1Y C;  3QA8 A;  2ZZP B;  4GN1 A;  1HTO A;  5AZH A;  5D3I B;  3M95 A;  5HG2 A;  2RDB C;  3I3T B;  1L6U A;  1IBX A;  2DYM A;  1WXS A;  3N32 A;  1E6E B;  1YN5 A;  1R4N I;  1K53 A;  3TIX A;  1JW9 D;  3GZN B;  3KW5 B;  2RDH A;  3OJ4 B;  1TKE A;  3L10 B;  2XN9 C;  4NJC A;  2M8S A;  4YWG G;  3A9J A;  1BT0 A;  3PGE A;  3W9C B;  3BII D;  4HPP A;  1SXT A;  4WJP A;  2RMM A;  3L0W B;  2PLP A;  3JW0 X;  4ACF A;  3DHH C;  2BKF A;  4G0N B;  1VJK A;  1XO3 A;  1TZO A;  4ARI A;  2IYD B;  2K22 A;  1WH3 A;  1E0Z A;  2MX2 A;  2EEL A;  3N30 A;  1FNW A;  3ZLZ A;  1Q5W B;  3PRP B;  3ZJU A;  1I4Q A;  1KLG D;  3VUW A;  4GGQ A;  4JL9 A;  1RRB A;  5E6N A;  2INP E;  4K3B A;  2V3P A;  3ECI A;  3Q8E A;  3MC9 A;  3DVG X;  5EDS A;  2JWZ A;  2PIA A;  2NMQ A;  4JWS C;  1Q10 A;  3VHT C;  1YNT E;  1E10 A;  2KFK A;  1JQ4 A;  2QEJ C;  1S3S G;  4EUT A;  4I6N B;  4US9 A;  1E7V A;  2BS4 B;  4W9E A;  4FA6 A;  3WCQ A;  1VLB A;  1MHH E;  4XDD A;  3U2S C;  2YLM A;  2BGF A;  4GU2 A;  3HM3 A;  2O2V A;  2K25 A;  3AE7 B;  4B6W A;  4OZC A;  2KD0 A;  4OZA A;  4A20 A;  1T3Q A;  1TKG A;  4X57 B;  2JVC A;  1TJE A;  3TJP A;  3KUC B;  1SIF A;  1XQQ A;  3Q3F A;  3H8H A;  4W9K A;  1B9R A;  2EKI A;  1P7E A;  5T8I A;  2DZM A;  5HHD G;  3N3K B;  3P4P B;  1ET9 A;  2Z0E B;  4FXC A;  3MP9 A;  3L08 A;  4FJZ A;  3U7D A;  2LGS A;  3K9O B;  4PT5 A;  4IKG A;  2W3R A;  2V3S A;  2A4Z A;  2DWQ A;  2IY0 B;  1N62 A;  2I1K A;  3ZKJ C;  3AU5 A;  2JX5 A;  3NVW A;  3TCA A;  1ET6 A;  3CMM B;  1KJT A;  3JSV A;  3VQI A;  5D2M B;  3NUH B;  1RFA A;  4DBG A;  4DHZ B;  3HUI A;  1GAQ B;  2G4D B;  4BBN C;  2BKR B;  2Y5B B;  4MH0 E;  3HIZ A;  2N7J A;  3R7Q A;  4GXB A;  3ZTD A;  1FCL A;  2C7M B;  3SD5 A;  3HHM A;  1D4B A;  4QAY A;  4CYE A;  1WGK A;  4TKN A;  3AUL A;  2MBB B;  2IJ0 A;  4OVZ A;  3KWV A;  1TS2 A;  1N60 A;  2WU2 B;  3GE8 C;  3MC8 A;  2GBN A;  4XWT A;  1KTK A;  3RUL A;  4GB9 A;  2M1M A;  3BWU D;  3U8Z A;  1ZXI A;  2CJN A;  4NJ7 A;  3S2A A;  4MGZ E;  3RNF C;  2M17 A;  3IBE A;  3Q8C A;  4WWN A;  3H7P A;  1FRD A;  3W1S A;  4LNK A;  1J8C A;  3HVD A;  3IFW B;  2JRI B;  2XNA C;  2FCS A;  1TT5 B;  3ZRF A;  1EU4 A;  1D5X C;  2NR2 A;  2HTM E;  3GS2 A;  2FNJ B;  4MDK E;  4DHJ B;  4N6E B;  2WXN A;  4RGT A;  4EZJ A;  4PYU A;  1WYG A;  3NG0 A;  3OAW A;  1QZE A;  2KJH B;  4C56 C;  2KDB A;  1Q1O A;  4HVB A;  1N63 A;  2Y5C A;  2LHE A;  2LJ5 A;  1FM0 D;  3AE9 B;  4HKZ E;  4RH6 A;  1SJH D;  3BVZ A;  1FCC C;  3RNB C;  4A6Q A;  3VTU A;  1C78 A;  4MT5 A;  3BYT B;  4BZA A;  1XLQ A;  1FD6 A;  2G1E A;  2IO3 B;  3A9K B;  3QIJ A;  4EKU A;  2HJ8 A;  1J7C A;  1YOV B;  4C7Z A;  1KF6 B;  4W9D A;  4IM2 A;  4HRS A;  1TTN A;  2LGI A;  2KT7 A;  4WWM A;  4OVU A;  4UDU C;  1P3Q U;  1WWT A;  4J3O D;  1QF6 A;  3DPD A;  3PT2 B;  4S17 A;  3FKY A;  4DXF A;  2MQJ A;  1NEN B;  1SIJ A;  3NRZ A;  4K7U A;  3PV1 A;  3NS1 A;  2NBV B;  1EF1 A;  5AZG A;  2W82 A;  2BPS A;  2VRR B;  1V6E A;  1WZ0 A;  1E8Y A;  3RZW C;  3AE8 B;  1C1Y B;  4BBN F;  4NY0 A;  2KMC A;  5TR5 A;  1XLN A;  3A33 B;  4IOI E;  3AED B;  3QCA A;  4W9L A;  3WIM A;  3IT6 B;  2PMV A;  4RF0 A;  1HQR D;  4FAD A;  3M3J A;  1HE8 A;  3KUD B;  2R2Q A;  3UQB A;  2JXX A;  2KC2 A;  4HJK A;  4A55 A;  1TZ1 A;  4K81 A;  4LNO A;  5JHB A;  4ZYN A;  5D7G A;  4WH4 A;  1FXA A;  5E6P A;  3ZRC A;  2KX0 A;  1KM7 A;  1N5W A;  1WZ3 A;  2KAJ A;  2N7D A;  4HXD A;  3V3X A;  5DCN A;  1PFD A;  1GUA B;  2FUG 1;  3EA6 A;  3KYC D;  3U7Z A;  2DAF A;  1F77 A;  4KX6 B;  5J2R A;  2WGS A;  3MC0 B;  1RLF A;  2SEB D;  2QCZ A;  1TIF A;  3V05 A;  1PDX A;  5E6J A;  1BML C;  1L4D B;  2J52 A;  3QQ8 B;  1QOF A;  1KLU D;  1WSP A;  2VH1 A;  2LUM A;  4MSM B;  4E71 A;  3AE1 B;  1PGB A;  2GBK A;  2G3Q B;  2KDF B;  1NYQ A;  4DDG D;  3MJ5 A;  2WU5 B;  3A4S C;  2N9L A;  2I2Y A;  4RM9 A;  2OHF A;  2WHI A;  1XT9 B;  2NPT B;  3Q3O C;  3B2F A;  4FJV B;  4WJO A;  3BIN A;  1DOI A;  1RAX A;  3LYY A;  4ICV A;  3H6N A;  2D5G A;  3TMP B;  4ZOH C;  3AEE B;  5HKH A;  1KLV A;  2Y5P A;  1PGA A;  2TSS A;  3J9C A;  4BFR A;  2J42 A;  2B76 B;  4FJY A;  2PE6 B;  4M0W B;  1MHX A;  2WX1 A;  4LJO B;  5LXI B;  4I6P A;  1YQ3 B;  2Z8L A;  3RPF C;  3RN9 C;  5FK9 C;  2WXM A;  1HZ6 A;  2JSV X;  4US8 A;  4URK A;  1SJE D;  1TGZ B;  1JRP A;  2REX A;  3GOE A;  1R7S A;  3APF A;  2LGX A;  3ENE A;  2INC C;  3VDZ A;  1QOB A;  2QIE B;  2GRI A;  3APC A;  2GMI C;  1N5X A;  1D5M C;  3AE3 B;  3P4Q B;  2NPT A;  1V1P B;  2EMS A;  5EE9 A;  4FUL A;  2IY1 B;  2D07 B;  2BS2 B;  2LRW A;  4W9F A;  1MG4 A;  1WJ4 A;  3Q2A C;  1TBE A;  1ZDV A;  4IC7 B;  3LDZ E;  4RNA A;  1FRR A;  1M4V A;  4FBJ B;  3AEC B;  4E74 A;  3SFD B;  2BB6 A;  3DOW A;  3Q8B A;  4P1B C;  4LNI A;  4XE0 A;  3B0A A;  2JXT A;  5EE1 A;  3URY A;  4O1N A;  2FCM A;  3EHV A;  4F7Z A;  2WDR B;  1IGD A;  2AQ3 B;  5J17 A;  3UQA A;  3R2T A;  4BKG A;  3EGR A;  2M19 A;  2NS5 A;  4ZHO A;  2FIF A;  3ZVV A;  2EKE C;  1MFW A;  2MP2 B;  1EF5 A;  1E8X A;  2JYT A;  1JWM D;  1VZ6 A;  2KXJ A;  1AN8 A;  2QC8 A;  2GOW A;  3DBR I;  4ARC A;  3PTF C;  1IGC A;  1ISN A;  2FUH B;  2H89 B;  1OQR A;  3GB1 A;  1SGH A;  2UU7 A;  2RR9 A;  2CJO A;  2JYE A;  2C7H A;  2DX5 B;  4PYZ A;  1FXI A;  4WWP A;  4XWW A;  2L05 A;  2CKH B;  1MI0 A;  2HJ1 A;  4W9H A;  4RM8 A;  3QK0 A;  3ZYY X;  1T0S C;  2XEW A;  1I4R A;  2KFK B;  2DZI A;  4ZRP A;  2FID A;  1MVK A;  5LNK 1;  3NVY A;  2JUO A;  1WE6 A;  3W5V B;  3CF6 E;  2FBW B;  4DDI D;  4EE2 A;  2BVC A;  2NCN A;  2K5P A;  2MP2 A;  4HCP B;  2PVG C;  3HRD D;  2O2V B;  2I1J A;  3TUO A;  2ZJD A;  5IOI A;  4HEA 1;  1QQR A;  4KDL B;  1EO6 A;  2N9E B;  3CSF A;  3MJW A;  3VH4 B;  4TQ1 A;  3DBH I;  2CS4 A;  1QT9 A;  1G6J A;  1E90 A;  1UGJ A;  1C3T A;  1ZPS A;  2PJH A;  5KHQ A;  4P7I A;  3TEZ A;  1JRU A;  2WXR A;  2GBM A;  2KOX A;  5C3J B;  3ETR A;  4TMA B;  1LM8 B;  1HTQ A;  3UIO B;  3O13 A;  3ONS A;  1WGG A;  3PHX B;  1NI3 A;  2LUE A;  3RCZ A;  3ZTC A;  4XZ4 A;  2K39 A;  3NZU A;  3WAN A;  3DVG Y;  2LEK A;  3IXS A;  2ASQ A;  1HXY D;  3R3M A;  3PRM B;  3R2I A;  2KKC A;  2MEK A;  2QDF A;  4YSX B;  1BXT A;  1UF0 A;  1OFF A;  4H2A A;  2LAS A;  2NTT A;  1L0Y B;  1L7Y A;  1IPG A;  2L0F A;  3PHW B;  2AEH A;  2JPH A;  4LNN A;  4M00 A;  4HLE A;  1OQQ A;  5JHA A;  1L0X B;  1ZOY B;  4XC2 A;  3JSV B;  2BWE S;  4GDL B;  5JZE B;  4AJY B;  1SE4 A;  4DQO C;  2K3U A;  5BO4 B;  2ICI A;  2R61 A;  3DQV A;  3Q8A A;  1WRD B;  2AL6 A;  2J0J A;  2GI9 A;  2LFI A;  2DHZ A;  2WXL A;  2QSD A;  2J0M A;  1MG8 A;  2RD0 A;  1V86 A;  2NTS A;  3DHI C;  2GBR A;  3N9Y C;  1T0R C;  1WF9 A;  2K6D B;  1EWC A;  1C9F A;  2M4N A;  1WJ6 A;  5H92 C;  2UYZ B;  1OEY A;  3ZXV A;  1ZGU B;  3DBL I;  4NQK E;  5IA7 A;  1IP9 A;  3TEY A;  1OTR B;  4USA A;  1P98 A;  4JX1 C;  1L2N A;  5LLI A;  3B1L X;  3PO0 A;  1SE9 A;  1A70 A;  1FNV A;  4A3O A;  3H7P B;  2KN5 A;  2WXH A;  2L1A A;  3BK1 A;  4RGO S;  4MJS B;  4C80 A;  4L23 A;  1N6Z A;  4GDL A;  4XGA B; 
#chains in the Genus database with same CATH homology
 3PV1 A;  1V5T A;  1NDD A;  4JIO U;  2KTR A;  2NBV B;  3IHP C;  4E3C A;  1EF1 A;  1V2Y A;  2N4F A;  2N7E A;  5AZG A;  3SHQ A;  3PPA A;  5JH5 C;  4II2 B;  2BPS A;  5LXH A;  2VRR B;  1V6E A;  2WX0 A;  3OLM D;  3L17 A;  1WX9 A;  3A1Q B;  1WZ0 A;  3EEC A;  4GSW A;  1E8Y A;  2EMT A;  1XD3 B;  4WJQ A;  2DZK A;  4N9F 4;  4G50 A;  2ZNV B;  2KTF A;  5CHW A;  1C1Y B;  5AZF A;  3RZW C;  2JZ3 B;  5DPS A;  1WGY A;  4BOS C;  3O65 B;  4BBN F;  2LD9 A;  4NY0 A;  2KMC A;  5TR5 A;  3V6C B;  2L8J A;  1T0Y A;  2FAZ A;  2LXC A;  3P2B A;  3A33 B;  4BKS A;  3UIP B;  1P0R A;  3VFK A;  3JYU A;  3DCG A;  3B08 A;  4AOF A;  2HTH A;  1WXV A;  4MM3 A;  3QCA A;  3V60 A;  2DAJ A;  4W9L A;  3WIM A;  1WR6 E;  2KK8 A;  1V5O A;  2MRP A;  4HDQ A;  4HPL B;  1UEL A;  3H9D A;  3PSE B;  4NAW B;  4WJN A;  3AXC A;  1WX7 A;  4B9K A;  4FAD A;  2YVC A;  3KUZ A;  3QAQ A;  1V49 A;  3M3J A;  1HE8 A;  1J19 A;  4MSQ B;  4ZRJ A;  3KUD B;  4AWJ A;  1I42 A;  2R2Q A;  3UQB A;  2JXX A;  2KVR A;  4M8N A;  4WWO A;  1OQY A;  2KHW B;  1EUV B;  2KC2 A;  4BOZ B;  4HJK A;  4EEW A;  4W9G A;  2KNB A;  5L95 C;  2KFJ A;  3L13 A;  1TZ1 A;  4IG7 B;  4K81 A;  3ZDT A;  4ZYN A;  3UGB B;  5JHB A;  3PVL A;  3VXW A;  2KC1 A;  5D7G A;  3SU8 X;  2KQ7 A;  1Z2M A;  3RT3 B;  1F9J A;  5E6P A;  3ZRC A;  1UH6 A;  2KX0 A;  4ZRK A;  1KM7 A;  3QWZ B;  3QHT A;  1WZ3 A;  2N7D A;  1H8C A;  3H7S A;  2RPQ A;  4HXD A;  5DCN A;  3KYC D;  1GUA B;  2K8H A;  2KX3 A;  4GDK A;  4MJS A;  4EZK A;  1X1M A;  2DAF A;  4MEL A;  3AU4 A;  2KQS A;  2BYE A;  2KMA A;  5J2R A;  3X0W A;  3VTV A;  3ML8 A;  2MBO A;  4F8C B;  1LXD A;  2MW5 A;  1R4M I;  4DK5 A;  3LJ3 A;  1RLF A;  4KZC A;  3A1Q A;  2AL3 A;  1E5W A;  2J7Q B;  1YQB A;  3AI5 A;  4ICU A;  3A9J B;  3W1S C;  3QQ8 B;  1GNU A;  4HDO A;  2AYO B;  1AAR A;  2KLC A;  2DEN B;  3EC8 A;  4EFO A;  3JVZ X;  4MSM B;  4E71 A;  5IAA C;  3EFU A;  4LCD E;  2GBK A;  2G3Q B;  4JLC A;  2KDF B;  4DDG D;  1WM2 A;  1E8Z A;  3RD2 A;  2C7N B;  3CST A;  4II3 B;  1GG3 A;  2A5U A;  2MLB A;  2LI5 A;  4AUQ C;  1ZW7 A;  3ML9 A;  2G45 B;  3L16 A;  4FHJ A;  2FCQ A;  3A4S C;  4NAW A;  4WQO B;  2KAN A;  4RM9 A;  2W9N A;  2CHZ A;  2D11 A;  4IWQ A;  3WAO A;  5DPW A;  4IUM B;  1XT9 B;  2LZ6 A;  2NPT B;  1YX5 B;  3D32 A;  2B3A A;  4WJO A;  4FJV B;  3BIN A;  4IWP A;  1RAX A;  1P9D U;  1Z5S B;  2KZR A;  4ICV A;  2LGY A;  2Z59 B;  2LVP A;  3H6N A;  4IW0 A;  3TMP B;  4G3X B;  4ZDV A;  2LWP A;  3SDL C;  1YIW A;  5HKH A;  3QA8 A;  1KLV A;  2ZZP B;  4GN1 A;  4W9J A;  5AZH A;  3M95 A;  3UIN B;  1WFY A;  3I3T B;  4IM0 A;  2Z0D B;  4BFR A;  2DYM A;  1WXS A;  3OJ3 A;  5DPR A;  2L3Z A;  2KJR A;  1OEY J;  3N32 A;  2ZCC A;  4FJY A;  2PE6 B;  3X23 A;  2ZEQ A;  2DYB A;  3MTN B;  4M0W B;  2MBH A;  2BYV E;  1R4N I;  4BVU C;  2IZV B;  2WX1 A;  4MGY E;  3TIX A;  4LJO B;  3TL5 A;  3WA0 A;  4I6P A;  5LXI B;  3KW5 B;  4KVG B;  3OJ4 B;  4I6L B;  2KLG A;  1FXT B;  4TUU A;  3L10 B;  2MBE A;  2M8S A;  4FLH A;  3A9J A;  5C1Z A;  4URK A;  1WR1 A;  1TGZ B;  1BT0 A;  1WM3 A;  2UWQ A;  2WDT B;  2REX A;  1K8R B;  3PGE A;  1Q0W B;  4GMV A;  1GJZ A;  5D6J B;  3GOE A;  4JQW C;  1YX6 B;  3APF A;  3QJZ A;  2LGX A;  2D2Q A;  4WJP A;  3NHE B;  3IG3 A;  1UBQ A;  3L0W B;  4W9I A;  3ENE A;  3JW0 X;  4CHK A;  3VDZ A;  3DVN U;  3WAL A;  3W1Y A;  1OGW A;  2BKF A;  4G0N B;  3APC A;  2MCN B;  2GMI C;  3GZN I;  1NI2 A;  2JRH A;  2LXA A;  4W9C A;  2IYD B;  1WH3 A;  3V61 A;  2MX2 A;  2NPT A;  2EMS A;  4MGI E;  2BF8 B;  2OOB B;  3UF8 A;  3N30 A;  4FUL A;  2IY1 B;  3HM6 X;  3V6E B;  2JY6 A;  2WWZ A;  2J0K A;  3ZLZ A;  2K8B A;  2D07 B;  1V9J A;  3VVW B;  1Q5W B;  3PRP B;  3TBL D;  2LVO A;  2LRW A;  4W9F A;  3VUW A;  4GGQ A;  1WJ4 A;  2MA9 B;  4JL9 A;  1TBE A;  2CR5 A;  4K1R B;  2K6Q A;  3ZIM A;  4IC7 B;  1RRB A;  5E6N A;  2BWF A;  3NOB A;  2D10 A;  4YL8 A;  3DVN V;  3LDZ E;  4KDI C;  4TV3 A;  3ZNZ B;  4FBJ B;  3ECI A;  1WJU A;  3ZNH B;  4E74 A;  3M63 B;  3DVG X;  5C23 A;  2JWZ A;  2L7R A;  5EDS A;  3DOW A;  2V1Y A;  3WAM A;  2HD5 B;  1I35 A;  2AWT A;  2GBJ A;  4XX5 A;  1S1Q B;  5GMV A;  1Y8R C;  3VHT C;  3B0A A;  4EZL A;  1UD7 A;  1WJN A;  1E7U A;  2NVU I;  2KFK A;  3VUX A;  2FCM A;  3EHV A;  1S3S G;  5D94 A;  4I6N B;  4EUT A;  4F7Z A;  1NBF C;  3ZDM C;  1ZKH A;  2BYF A;  1E7V A;  4A3P A;  5J17 A;  4W9E A;  5G2N A;  2D3G A;  4FA6 A;  2K8C A;  3UQA A;  4KV2 A;  2C60 A;  3DBS A;  4BKG A;  2FCN A;  2NS5 A;  2FIF A;  2YLM A;  1UGM A;  2BGF A;  3H1U A;  2KDE B;  3HM3 A;  2EKE C;  4GU2 A;  3ZVV A;  2O2V A;  2IO2 B;  4WAA A;  2CHX A;  2MP2 B;  2DYO A;  2N9P C;  2KWV B;  1EF5 A;  1E8X A;  2K25 A;  2N9X A;  4HPM B;  4B6W A;  2PEA A;  2XK5 A;  2RGF A;  2L0T A;  2KD0 A;  5AEK B;  2KXJ A;  2GOW A;  3BY4 B;  3DBR I;  4FHK A;  1WY8 A;  4A20 A;  3PTF C;  1ISN A;  2FUH B;  4X57 B;  2L76 A;  2JVC A;  3TJP A;  1SGH A;  3IVF A;  2RR9 A;  3KUC B;  1SIF A;  1XQQ A;  2ZNV C;  4K7S A;  4ZRI A;  3V62 A;  2JT4 B;  3Q3F A;  1WMH A;  4W9K A;  2C7H A;  2JF5 A;  3ZW3 A;  1KOT A;  4JGH B;  2DZM A;  4PS7 A;  3RUI B;  1WXM A;  2DX5 B;  4PYZ A;  2DZJ A;  4TQ0 A;  3N3K B;  3VUY A;  4ANW A;  4WWP A;  2L05 A;  2CKH B;  3A4R A;  2KDI A;  4IWO A;  2C9W B;  2Z0E B;  4HWI B;  5G55 A;  4K7W A;  1WGR A;  1WI0 A;  3L08 A;  1WX8 A;  2IBI B;  4NQL B;  3T8M A;  1WYW B;  4GOC A;  2CHW A;  2ZPN A;  4FJZ A;  4W9H A;  2XBB C;  4RM8 A;  3U7D A;  4ANU A;  1H4R A;  2N1V A;  2JZZ A;  3QK0 A;  2KJ6 A;  1A5R A;  1VD2 A;  1WGH A;  3K9O B;  4PS3 A;  4KSL C;  4KIK A;  2XEW A;  2KFK B;  4BKT A;  2DZI A;  4LJP B;  2FID A;  4KZ0 A;  1WGD A;  1GC6 A;  2JUO A;  2V3S A;  1WE6 A;  2A4Z A;  4IM3 A;  3PLU A;  5CTR C;  2IY0 B;  3CF6 E;  2PE9 A;  2I1K A;  4KSK C;  1V81 A;  3ZKJ C;  4DHZ E;  3AU5 A;  3PRZ A;  3PLV A;  4DDI D;  3TCA A;  2IO1 B;  2NCN A;  2MP2 A;  4AJW A;  3CMM B;  4DWF A;  4EOY A;  1KJT A;  3JSV A;  4HCP B;  3VQI A;  2O2V B;  2I1J A;  2ZJD A;  1VCB A;  5D2M B;  3R7R A;  1RFA A;  3ZNG C;  4KDL B;  4DBG A;  4DHZ B;  3R66 C;  1EO6 A;  2N9E B;  5J18 A;  3C0R B;  3CSF A;  3MJW A;  2G4D B;  2XK5 B;  3VH4 B;  4TQ1 A;  3DBH I;  4BBN C;  2BKR B;  2Y5B B;  2CS4 A;  1G6J A;  1E90 A;  4MH0 E;  3HIZ A;  1C3T A;  3R7Q A;  4GXB A;  3T9L A;  3ZTD A;  4B95 A;  2C7M B;  2PJH A;  4HCN B;  3SD5 A;  5KHQ A;  3ZUN A;  3HHM A;  1CMX B;  4P7I A;  4GIV A;  1JRU A;  1WMH B;  4CYE A;  4TKN A;  4MGK E;  3VTW A;  3AUL A;  3PZD A;  2GBM A;  2MBB B;  3QX1 A;  2KOX A;  4AP4 C;  1LM8 B;  3A9K A;  3UIO B;  2GBN A;  3ONS A;  3ZO5 B;  1WGG A;  3RUL A;  4GB9 A;  3KVF B;  3PHX B;  2M1M A;  4ASW C;  3HK0 A;  1PQS A;  2LUE A;  3RCZ A;  3U8Z A;  2KWU B;  3RZF A;  3ZTC A;  4DHJ D;  4F1S A;  4XZ4 A;  2K39 A;  4NJ7 A;  2NBU A;  3S2A A;  4PS8 A;  5DPT A;  4MGZ E;  1M94 A;  3M62 B;  1UZX B;  3NZU A;  2G4S A;  1LQB A;  2M17 A;  1YD8 U;  3WAN A;  2MBQ A;  3IBE A;  3DVG Y;  1WXA A;  2CU1 A;  2QHO A;  2ASQ A;  4KIK B;  3R3M A;  5L83 A;  2PPH A;  3PRM B;  4WWN A;  4CO7 A;  2KKC A;  1J0G A;  3H7P A;  3W1S A;  2MSE D;  1J8C A;  2L00 B;  2NBW B;  2JRI B;  3IFW B;  5CX3 A;  2LAS A;  2WYQ A;  4LDT D;  2FCS A;  2LVQ A;  2O6V A;  1L7Y A;  1IPG A;  2L0F A;  3PHW B;  2AEH A;  2JPH A;  1P1A A;  1IYF A;  4HLE A;  3ZRF A;  4BKS D;  5JHA A;  2NR2 A;  4FN2 A;  4XC2 A;  3Q3J A;  3U30 A;  5CHF A;  3NZS A;  3JSV B;  2BWE S;  2FNJ B;  2LGD A;  3L54 A;  2R2O A;  4GDL B;  4J6I A;  4MDK E;  4DHJ B;  2M0X A;  4RMA A;  4AJY B;  5JZE B;  2MWS B;  4NJ6 A;  4EZJ A;  2KTR B;  1UBI A;  4ANX A;  4PYU A;  1GC7 A;  2RSU A;  5BO4 B;  4G11 A;  3DQV A;  3WAP A;  1WRD B;  3APD A;  3PRE A;  1E8W A;  2IO0 B;  1YJ1 A;  2AL6 A;  3OAW A;  2J0J A;  1QZE A;  1V80 A;  2KJH B;  2OJR A;  2KDB A;  2DHZ A;  1Q1O A;  4HVB A;  3QAR A;  2ZVN A;  2LJ5 A;  5KHO A;  2C5L C;  1LFD A;  2ZCB A;  4LDT B;  2J0M A;  2LRU A;  1MG8 A;  2RD0 A;  3RYT A;  1V86 A;  2GBR A;  4OVV A;  1D3Z A;  3VTU A;  1WF9 A;  2K6D B;  2KWC A;  4NNJ B;  3KYD D;  3PS6 A;  5E6O A;  2IO3 B;  2ZVO A;  3A9K B;  1WE7 A;  2M4N A;  2O6V D;  1U4A A;  1WJ6 A;  3QIJ A;  4HK2 A;  4ANV A;  4EKU A;  2N1W A;  2HJ8 A;  2UYZ B;  1OEY A;  3DDC B;  1ZGU B;  3DBL I;  4NQK E;  5IA7 A;  2V4L A;  5FR6 A;  4W9D A;  1IP9 A;  4IM2 A;  1OTR B;  1TTN A;  3QC8 B;  1P98 A;  4OVU A;  1L2N A;  5LLI A;  2K1F A;  2ZPY A;  3NY5 A;  3B1L X;  1P3Q U;  3K9P B;  3KH0 A;  3NS8 A;  1SE9 A;  3DPD A;  4MEM A;  3MHS D;  3PT2 B;  4M8M A;  3ALB A;  4A3O A;  3H7P B;  2KN5 A;  5CHV C;  3ZNI D;  2KO3 A;  2HE7 A;  1WIA A;  2MQJ A;  2O6V B;  4NPN A;  3VAW A;  3VH3 B;  4GDK B;  4MJS B;  4K7U A;  4DXA B;  4GDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...