2KFKA

Solution structure of bem1p pb1 domain complexed with cdc24p pb1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
PHMKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the heterodimer of Bem1 and Cdc24 PB1 domains from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Bud emergence protein 1
total genus 10
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kfkA00
3AU4A 2QHOA 4W9DA 4I6NB 3RYTA 1VCBA 4CO7A 2K8CA 2REXA 1D3ZA 2KD0A 3WIMA 4CHKA 5D7GA 3VAWA 4BBNF 2JF5A 1XD3B 4PYUA 1WX9A 2CR5A 2A5UA 3N30A 4HXDA 1WFYA 2HTHA 5CHVC 2LUEA 4LDTB 3T9LA 1IPGA 2GMIC 3R3MA 2LWPA 5CHWA 5D2MB 4AP4C 4ASWC 2K25A 2AWTA 3HM6X 3ZUNA 4A20A 3PV1A 2BWES 4NY0A 2KXJA 4J6IA 3EC8A 3KUDB 5IA7A 1WXAA 1WXMA 3RZFA 5AZGA 3JSVA 4FJVB 2CHWA 4A3OA 2PPHA 1WX7A 2N9PC 2MCNB 4ANXA 4EKUA 2DZIA 3UF8A 1MG8A 2NVUI 2PEAA 4MSQB 3ZNID 3ML9A 4TQ0A 3VXWA 3L08A 3W1SA 2N4FA 2FCQA 3EECA 3KUCB 2KMAA 3RD2A 1UD7A 2XK5A 2DZMA 3PRPB 3KW5B 5AZFA 2MA9B 2KK8A 2UWQA 2GBKA 2L0FA 4FHJA 3V6CB 1RRBA 1E90A 2J0MA 2WYQA 4HWIB 3A4RA 4K7WA 4FJZA 3QARA 3VUYA 1WE7A 2ZJDA 3PLVA 4E71A 2K8BA 3A9KB 2D3GA 2WX0A 2M4NA 1P9DU 1E8YA 1RFAA 2MX2A 4K7SA 4DDID 4DDGD 1GJZA 3U7DA 2RPQA 4OVUA 2LXCA 2AYOB 2KN5A 3S2AA 1KJTA 1RLFA 1WXVA 3ZRFA 1U4AA 4B95A 2NBUA 2J0KA 2L00B 2G3QB 4MDKE 3VUWA 3ZDMC 3A4SC 1IP9A 4TQ1A 2BWFA 3DVGY 3QIJA 4ZYNA 2W9NA 5KHQA 4JIOU 3NY5A 1Z5SB 3VH4B 3SD5A 4WQOB 2UYZB 2O6VB 2A4ZA 3H7SA 3ZNHB 3NZUA 4DHZE 2KX0A 2JY6A 4HDOA 2J0JA 2DHZA 5LLIA 4TUUA 4MEMA 1WM2A 2ZPNA 2KDEB 1GNUA 2AL3A 3B08A 3BINA 2D2QA 5J18A 3UQAA 4F8CB 2KJHB 3DBHI 1XT9B 2C5LC 4G11A 4WJQA 1V81A 1WZ3A 4EEWA 1Q0WB 3A9KA 3PSEB 2IO1B 1S1QB 2KDIA 1P1AA 3W1YA 2ZCBA 1WR6E 4GDKB 5E6NA 3R7RA 3KH0A 3L13A 4IM3A 3WAMA 2FCSA 1E8XA 2WDTB 3IBEA 5C23A 1OQYA 1LM8B 3OJ4B 1WM3A 3ZVVA 4BVUC 4AJYB 1L7YA 2DYMA 4NJ6A 2JXXA 4LJOB 5AZHA 4LCDE 4N9F4 4BKSD 4CYEA 5JZEB 1TTNA 3ML8A 4G50A 3O65B 5EDSA 2BGFA 1SIFA 4W9HA 4W9FA 2LXAA 5BO4B 3PVLA 2EKEC 4HPLB 4WWPA 1WJNA 2JRHA 2MQJA 4GOCA 2M17A 3QA8A 3ZTDA 4WJOA 1NDDA 2ZPYA 2R2QA 2KQSA 4KDIC 2DYOA 2KOXA 2I1JA 1P0RA 3ENEA 3LJ3A 3VDZA 5L95C 2NCNA 3QK0A 4ZDVA 3H7PA 1V49A 2LGDA 1EF5A 3NS8A 1EUVB 3ZW3A 2GOWA 3W1SC 3P2BA 5AEKB 5GMVA 2K1FA 4JLCA 3PT2B 3DCGA 3N3KB 3TCAA 4X57B 2N9XA 3QCAA 4GSWA 2LVQA 3UGBB 3VTUA 2IBIB 3HK0A 2LJ5A 3H9DA 2Z0EB 3R7QA 1J19A 4FN2A 4A3PA 2K6QA 1R4MI 4DHJD 4TKNA 2DAJA 2RSUA 3DBLI 4RM8A 2LRWA 3QQ8B 2IYDB 2FCMA 4GB9A 4NJ7A 5G55A 3ZO5B 3WA0A 2DX5B 3CF6E 4I6PA 4E74A 2L05A 3KUZA 3ZNZB 3PHXB 2DENB 3B1LX 4LDTD 5J2RA 2PE6B 2D07B 1KLVA 1JRUA 4II2B 4B6WA 1TGZB 2N1VA 1VD2A 3NOBA 1LXDA 3APFA 4HK2A 2IY1B 1ISNA 2IO0B 2L8JA 2IY0B 3N32A 2FAZA 2KFKB 2I1KA 3LDZE 1OTRB 1UELA 4F1SA 3V6EB 2K8HA 3M95A 2K39A 2MBOA 2LASA 4K7UA 4WAAA 3X23A 3I3TB 4IWPA 2JVCA 4IWQA 1UGMA 4NQLB 3PS6A 3ZLZA 2MW5A 2C7MB 2C9WB 4FULA 4MJSB 2HJ8A 2LRUA 4OVVA 1E5WA 3RULA 3K9PB 1PQSA 3PGEA 4WWNA 2KJRA 1E8ZA 4GGQA 1WH3A 1S3SG 2ASQA 5IAAC 1YQBA 2MWSB 2C60A 4MGIE 2FIDA 4W9LA 2ZCCA 3ALBA 4W9EA 3DBRI 2PJHA 4EOYA 3IVFA 2D10A 4NPNA 1ZGUB 3MTNB 3TBLD 1YJ1A 4ICVA 4M8MA 3RZWC 2KTFA 2N7EA 3ZIMA 2JT4B 3UINB 1V2YA 2KLGA 2OJRA 4IM2A 1YX5B 2G45B 1WJ4A 3DPDA 4KZCA 4MGZE 3A9JB 2M8SA 3IHPC 3OAWA 3TJPA 2MBQA 4HLEA 3PRMB 3NHEB 2LGXA 3VTWA 1WE6A 4MGYE 3JVZX 1L2NA 3KYCD 1H8CA 3V62A 4KSLC 2JZZA 5JHBA 1WIAA 4KV2A 1C3TA 2D11A 3L10B 3A1QA 1R4NI 3EHVA 3A9JA 3A33B 1NI2A 2KNBA 3ONSA 3KYDD 2YVCA 4KZ0A 1J8CA 1F9JA 2L76A 2KC2A 2XK5B 3L16A 2CHXA 4FHKA 2AEHA 4HPMB 2JWZA 3PRZA 3PPAA 1WRDB 5LXHA 1M94A 2KWVB 2R2OA 3APCA 2KTRB 4ZRJA 4WJPA 3U30A 4W9KA 4BFRA 3DQVA 4NNJB 2LGYA 1CMXB 2NBVB 3UIPB 4FLHA 4XC2A 3ZKJC 1IYFA 1FXTB 2MLBA 4XX5A 2MBBB 4GN1A 4LJPB 3RT3B 3A1QB 4W9JA 3DOWA 3ZNGC 2G4DB 1WX8A 4GIVA 4GDLA 2KDBA 1UZXB 2RD0A 4EFOA 2C7HA 4GDKA 2ZNVC 1EF1A 2BKFA 3UQBA 2DAFA 2C7NB 3VFKA 4EZKA 1GUAB 3V60A 2FNJB 2KJ6A 5D94A 2BF8B 3PLUA 2BKRB 3OLMD 2M1MA 4IG7B 4KIKB 1UH6A 2N9EB 3WAOA 3PZDA 3RUIB 5FR6A 3ZDTA 1LQBA 2KC1A 3L17A 4MELA 2LI5A 1GG3A 2JRIB 2V1YA 3APDA 3D32A 3NZSA 5DCNA 2L7RA 2JZ3B 2CHZA 5DPTA 4ANWA 1WZ0A 2JUOA 3EFUA 1AARA 3HIZA 4EZLA 4RMAA 1SGHA 4EZJA 3MHSD 4PS7A 2MP2A 2L0TA 2KTRA 4AJWA 2ZVNA 2OOBB 1UBQA 5CHFA 2KQ7A 4FADA 1Q5WB 3GOEA 1QZEA 2O6VA 3IFWB 4PS8A 4DHJB 4FBJB 3JW0X 3QC8B 2GBJA 3DBSA 4TV3A 2Y5BB 1ZW7A 3VQIA 2WWZA 3TIXA 3B0AA 1V9JA 4KVGB 4G0NB 3AI5A 4W9GA 1UBIA 3RCZA 2JPHA 2B3AA 1V5OA 2YLMA 2EMSA 4ZRIA 2FIFA 4IWOA 3DDCB 5JH5C 2IO2B 4BKGA 4MM3A 2DZKA 1EO6A 3Q3JA 3GZNI 3HM3A 3AU5A 4ANUA 1WJ6A 2N7DA 3ECIA 3X0WA 1WMHB 3WANA 4JGHB 2GBMA 2WX1A 1YD8U 2GBNA 3CSTA 4ICUA 4NQKE 3U8ZA 3DVNU 1OEYJ 4W9IA 5LXIB 3UIOB 2MRPA 1WJUA 1GC7A 2KWUB 2MBEA 3WAPA 4BOZB 4DK5A 1V6EA 5C1ZA 3ZTCA 2BYFA 2FUHB 2NR2A 4ZRKA 2MP2B 1WXSA 4MGKE 4IM0A 4URKA 1Z2MA 2XEWA 4M8NA 1HE8A 2LD9A 4GMVA 2V4LA 2L3ZA 4NAWB 3K9OB 3SU8X 3Q3FA 5E6PA 3QAQA 4AOFA 2MSED 2NBWB 2O2VA 4W9CA 2GBRA 2PE9A 4JL9A 4AWJA 4F7ZA 1V86A 1YX6B 3DVNV 5D6JB 3JYUA 2K6DB 1P3QU 1RAXA 1LFDA 4HDQA 3V61A 4I6LB 2ZVOA 2NPTB 3MJWA 5E6OA 1E8WA 3CSFA 4FJYA 4HVBA 1WGGA 2NS5A 4B9KA 1KOTA 3QHTA 3TMPB 1T0YA 4M0WB 5DPSA 1A5RA 2DZJA 3H6NA 2G4SA 2RR9A 1G6JA 1KM7A 3VTVA 4DXAB 1XQQA 1I35A 3C0RB 4E3CA 2ZNVB 4DBGA 1WF9A 1WGYA 3WALA 4K1RB 3SHQA 2MBHA 2BYVE 3PTFC 4BKSA 4ANVA 3AXCA 3KVFB 4K81A 4EUTA 5DPWA 1P98A 2KFKA 1WGRA 4KIKA 2V3SA 2KWCA 1H4RA 4DHZB 1Q1OA 1Y8RC 4DWFA 1WY8A 1BT0A 2KHWB 4HJKA 4WWOA 5CTRC 1E7UA 2FCNA 2BPSA 4KSKC 2NPTA 1WR1A 3QWZB 2M0XA 4JQWC 4II3B 1TZ1A 4IW0A 4PYZA 5G2NA 3H7PB 3VHTC 3CMMB 2O6VD 1WI0A 4BKTA 2Z0DB 2BYEA 4BBNC 3M3JA 3QX1A 4GDLB 1WYWB 2HE7A 2KO3A 2KLCA 3L0WB 2KX3A 4MH0E 2ZEQA 3M63B 3T8MA 4YL8A 5KHOA 1V5TA 4PS3A 2KVRA 1C1YB 4IC7B 5L83A 1WMHA 3OJ3A 1K8RB 2ZZPB 4GU2A 2IO3B 2KFJA 2VRRB 3VH3B 3M62B 1E7VA 2KDFB 1GC6A 4KDLB 4FA6A 4HCPB 4BOSC 2AL6A 5JHAA 5CX3A 2EMTA 1I42A 1X1MA 2DYBA 3JSVB 2KANA 1OGWA 2KKCA 2IZVB 5TR5A 4HCNB 2Z59B 3HHMA 3VUXA 1WGHA 3AULA 1SE9A 4MSMB 3ZRCA 3R66C 3DVGX 3TL5A 4GXBA 3IG3A 2LVOA 4WJNA 2HD5B 3L54A 1WGDA 4G3XB 5J17A 4IUMB 1TBEA 2CU1A 2KMCA 4RM9A 1NBFC 4MJSA 2J7QB 1YIWA 2LVPA 3QJZA 3VVWB 2O2VB 3BY4B 3H1UA 2N1WA 5DPRA 3SDLC 4XZ4A 1OEYA 1J0GA 1ZKHA 1V80A 4AUQC 5HKHA 2KZRA 2RGFA 2CS4A 2CKHB 4NAWA 4P7IA 3PREA 3PHWB 2LZ6A 2XBBC
chains in the Genus database with same CATH superfamily
3BYYB 3AU4A 5LNK1 1VCBA 4JWSC 2K8CA 2KD0A 5FKAC 3PO0A 2JF5A 1XXGA 3BK2A 1WX9A 1DOIA 2WGSA 2GLSA 2LUEA 4LDTB 3R3MA 5CHWA 4OVZA 4A20A 4MH8A 1WXQA 2BWES 4NY0A 4J6IA 1C78A 3W2DA 1ESFA 2N9PC 2WXMA 2DZIA 1EWYC 2MJ3A 3L08A 3KUCB 2KMAA 1UD7A 2DZMA 1ZDXA 2N7JA 3KW5B 2MA9B 2KK8A 2UWQA 2L0FA 3PLVA 2D3GA 1XLQA 2MX2A 4ZRQA 3LXFA 3IAS1 3AE9B 4FXCA 2AYOB 2KN5A 1KJTA 1SSNA 2L00B 2KN4A 1F2RI 1TKEA 1UWXA 2IGGA 5KHQA 4JIOU 1Z5SB 4JX1C 1ZUD2 3SD5A 5HG2A 2VZKD 3ZNHB 2BT6A 4TUUA 4MEMA 3BINA 5BYQA 1HTQA 1MPEA 3DBHI 4EEWA 1DGJA 1CK1A 1Q0WB 2QMTA 1S1QB 3W1YA 1E8XA 3DWMA 1LM8B 2AQ2B 1EM7A 4BVUC 1L7YA 2DYMA 1XCQL 4LJOB 5AZHA 2WXGA 3ML8A 5EDSA 3AEFB 2MH7A 1SIFA 2PW9A 1TT5B 2JU6X 3PVLA 4HPLB 2JRHA 2MQJA 5EE0A 3EFCA 4WJOA 2IGHA 2WXOA 3GB1A 2BQQA 2CJNA 2DYOA 2W3SA 3TEYA 1CJEA 4ZDVA 1L4DB 3P63A 2K1FA 3DCGA 3MC9A 2LVQA 3VTUA 3H9DA 4A3PA 1T0RC 1R4MI 1FNUA 3ZO5B 2IYDB 3J9CA 3CF6E 1KF6B 2ZW0A 1FD6A 3PHXB 4LDTD 3B1LX 2PE6B 1JWUD 1JRUA 4II2B 4B6WA 1MHHE 1VD2A 3NOBA 4HK2A 1QQRA 1ISNA 1SE3A 2IY0B 3I9V1 2KFKB 2I1KA 4US9A 3M95A 2QDFA 2K39A 2MBOA 4BZAA 1V1OA 4WAAA 2DBYA 3I3TB 2JVCA 1UGMA 3PS6A 4P1BC 2MW5A 3ZLZA 5IKCM 1QILA 4FULA 3RULA 3K9PB 1PQSA 2G1EA 2HDEA 3PGEA 1NYQA 1E8ZA 1WH3A 2ASQA 1YQBA 2NMQA 1FIQA 3ALBA 3DBRI 3RNFC 2PJHA 3IVFA 2W3RA 4ICVA 4M8MA 1TZOA 2KTFA 2OJRA 4DXGA 1WJ4A 2M8SA 3TJPA 3AE8B 2LGXA 4P6VF 1WE6A 1L2NA 1WIAA 4KV2A 2D11A 3A1QA 4B0MA 3EHVA 1V8CA 4EE2A 3A33B 3KYDD 4L1BA 4A90A 3AM9A 1N60A 2GB1A 3PPAA 1HZ6A 3NZ3A 4HJGE 4ZRJA 4W9KA 4BFRA 1FPYA 1XEEA 2WS3B 3DHHC 2SAKA 3DBRB 1ET6A 3UIPB 4XC2A 3ZKJC 1IYFA 2MLBA 4XX5A 3HUIA 1YQ4B 2M56B 3ZNGC 3OG5A 2ZNVC 2INNE 4Q2JA 5C2TB 1XLNA 3VFKA 2FNJB 5D94A 2K22A 1UH6A 3GP7A 3PZDA 3RUIB 1P7FA 3L17A 1V1PA 3NZSA 2L7RA 2CHZA 4ANWA 3EFUA 2QIEB 3HIZA 4KGRA 3MHSD 1AW7A 2ZVNA 2OOBB 1AYFA 1FFVA 2KQ7A 4FADA 1TY2A 3GOEA 1FNVA 4DHJB 4FBJB 3W5UB 1QOAA 4TV3A 2DNFA 3VQIA 3TIXA 2WXRA 3Q3NC 4TMAB 1V9JA 1J7AA 3AI5A 4W9GA 5C3JB 3RCZA 1IBXA 1GOZA 3AEAB 3DDCB 1WWTA 2UU7A 2Y3AA 2DLBA 3Q3JA 3HM3A 3AU5A 4OW0A 5G5GA 1PDXA 1WJ6A 1C77A 3ECIA 3B2GA 1WMHB 4RH6A 2GBMA 4S17A 1EWCA 2GBNA 1VR9A 4LK0M 1SXTA 3DVNU 4C7YA 5LXIB 3UIOB 1GC7A 4BOZB 1XO3A 2PIAA 1TS5A 1HE8A 2LD9A 1FMAD 2V4LA 2VH1A 3K9OB 1IBXB 2KQ4X 1QOBA 4AOFA 2O2VA 4W9CA 4JL9A 1N6ZA 4F7ZA 5D6JB 2WLBA 1P3QU 1RAXA 5MPOA 1BUIC 3PZ8A 4IOIE 1KOTA 1KLUD 2DZJA 2G4SA 2RR9A 1XQQA 1I35A 5EE1A 2MBHA 4BKSA 1P98A 2KFKA 4KIKA 2KWCA 1Q1OA 1BT0A 4HJKA 3UI3A 2FCNA 2BPSA 2NPTA 1C9FA 4KKIA 2BYEA 1KRHA 3RN9C 3B2FA 1WYWB 2KO3A 3L0WB 2KX3A 1FRRA 3T8MA 4WQMA 4YL8A 3LB8C 1SIJA 2K3UA 1AWDA 4IC7B 2PVGC 3OJ3A 3VH3B 1GC6A 4BOSC 5HFYA 1N63A 1X1MA 2RDBC 2KANA 3C8YA 1GPXA 3VUXA 1WGHA 3ZRCA 4ZRPA 3SFEB 3N1ZC 4GXBA 1PGBA 2EKIA 4G3XB 5J17A 1YOVB 2J7QB 1NENB 3KQ4A 4DQOC 4XZ4A 1ZKHA 3E9SA 2KZRA 2HJ1A 4P16A 3RYTA 4US8A 1F2RC 4CO7A 2REXA 4CHKA 1FNWA 3VAWA 4PYUA 1OQRA 4HXDA 5CHVC 1UGJA 2GMIC 4AP4C 4ASWC 2K25A 1JRPA 1R7SA 3Q8AA 4J3OD 1VZ8A 3PV1A 4MM3B 4YSYB 2WXKA 3RZFA 3O13A 2CHWA 3I5JC 2PPHA 4EKUA 5FR3A 2J4XA 1MG8A 2NVUI 4TQ0A 4MSQB 1L0YB 3W1SA 2FCQA 3PRPB 3RFZB 1YN5A 2E3TA 4K7WA 3VUYA 3A4RA 3QARA 2ZJDA 3CWIA 4LLGM 3L4PA 2M4NA 1E8YA 2J53A 1GJZA 3S2AA 1WXVA 3ZRFA 1V97A 2NBUA 2BWFA 4L2YA 4ZYNA 3BIID 1M4VA 2BYTA 4WQOB 1IGCA 2RDGA 2DHZA 2QC8A 1VDVA 4JWUC 2KDEB 2AL3A 3B08A 5J18A 1XF5L 4XDCA 4C00A 1A70A 5HI1A 4XWTA 2LJIA 1STEA 5E6NA 4GDKB 3WAMA 3L13A 4RGOS 2FCSA 1J7BA 3Q69A 3AE6B 1Q10A 3Q8BA 4AJYB 2WXHA 1UNSA 5JZEB 3O65B 4W9HA 3KWVA 3LYYA 2R2QA 2KQSA 3VDZA 1T0QC 2NCNA 5JXVA 4YTMB 3ZW3A 1N62A 5GXGB 3ABVB 5AEKB 4JLCA 3PT2B 1ZPSA 1N5XA 3AECB 4M02A 4XDDA 1C4PA 3QCAA 4GSWA 1V1PB 2N0SB 3NVVA 3HK0A 3ETRA 3R7QA 4FN2A 3RNEC 1SBBB 2K6QA 4TKNA 4XWWA 2LRWA 4NJ7A 2FCMA 3WA0A 3ZXRA 2KACA 4I6PA 4E74A 2L05A 1FFUA 4HKQA 5J2RA 3RNBC 3CIRB 4RCOA 2N1VA 1SE4A 2IO0B 1MFWA 2K8HA 1R4MB 1HXYD 4LNFA 1B1ZA 3DHGC 4IWQA 3AE5B 2XN9C 2LRUA 1E5WA 1JW9D 2I2YA 1D4BA 4GGQA 5EE9A 1YNTE 2B76B 4N59A 2JQRB 2FIDA 4BAXA 2ZCCA 3TEWA 1B9RA 1SB3C 3RPFC 2JYTA 3MTNB 3UINB 3T3NA 1HQRD 4IM2A 3DPDA 4KZCA 4R3DA 2MBQA 1T6BX 4HLEA 5E6JA 3PRMB 4ARCA 3P1MA 3Q8CA 4MGYE 1ENFA 3FILA 4KSLC 3MC8A 2JZZA 5JHBA 3L10B 1R4NI 3A9JA 1L5PA 3ONSA 1F9JA 2L76A 2XK5B 1C79A 2CHXA 1VLBA 1I4GA 2KWVB 1ZDVA 3APCA 4WJPA 1N5WA 3TEXA 3DQVA 1E10A 1CMXB 2NBVB 4FLHA 2MBBB 4GN1A 4LJPB 3RT3B 3A1QB 3DOWA 3ZYYX 2G4DB 1WX8A 2KDBA 2RD0A 3AE2B 2C7HA 4GDKA 2H89B 2BKFA 4EZKA 1L0VB 2LEKA 2BKRB 4XGAB 2M1MA 2N9EB 3BVMA 3NRZA 1GB4A 1LQBA 3Q8FA 4MELA 2JZ3B 1F77A 4RMAA 1SGHA 4EZJA 4HKZE 1FRDA 1UBQA 4REZA 3GE3C 1Q5WB 4XYCA 5BMIA 2L1AA 1C76A 2LFIA 1QZEA 4M00A 3W9CB 3QC8B 1I4RA 1E9MA 1PGXA 3Q14C 4KVGB 4YSZB 4GLSC 1UBIA 4NJCA 2JPHA 5JH5C 1D5XC 4YWGG 2WXPA 4QAYA 2CU3A 3OWEB 1ET9A 2W55A 3X0WA 1NI3A 1TKYA 5IOIA 2X8XX 3CSTA 1QOGA 4W9IA 1K53A 4OHJA 1WJUA 2KWUB 3WAPA 3ZTCA 4MGKE 4M8NA 3EA6A 1MI0A 4NAWB 3SU8X 4RGTA 2WU5B 3QAQA 1MHXA 4AWJA 3DVNV 4K3BA 4H2AA 4LNOA 1LFDA 4I6LB 2ZVOA 4JE3B 2JSVX 4FJYA 1IUEA 2NS5A 4B9KA 3Q2AC 1T0YA 4NZLB 5DPSA 2BB6A 3RNGC 1WF9A 2HTME 3AE1B 2BYVE 1TYGB 3PTFC 4DHZB 2NTTA 1Y8RC 1WY8A 1KFYB 1E7UA 1SJED 3QWZB 2M0XA 1DOYA 1KH0A 4PYZA 4IW0A 5G2NA 3MJ5A 2EELA 1TS4A 3QX1A 1I4XA 2KLCA 4MH0E 4PS3A 2KVRA 1C1YB 4YTPB 2LMCA 1K8RB 4GU2A 2ZZPB 3AV8A 2BS2B 1E7VA 2KDFB 2RMMA 2EMTA 2JXTA 2WDVB 4KGTA 3FILB 4KKJA 3IT4B 5TR5A 2IZVB 4HROA 1SE9A 5BMGA 1ZXIA 4ZHPA 1VZ6A 2ICIA 3TL5A 1PGAA 2ONQA 3VRBB 1L0XB 4RFBA 2R61A 4LTUA 3FC4A 2BW2A 1TBEA 4MJSA 4LNNA 1F52A 2LVPA 3BY4B 3SDLC 1OEYA 1V80A 3AEEB 4AUQC 4A8XC 5HKHA 2RGFA 4NAMA 2CKHB 2TSSA 4P7IA 1JMLA 2WXIA 3DBHB 4C4VA 2QEJC 3Q8EA 5D7GA 2INDC 3AH7A 3P4PB 3N30A 1WFYA 2XNAC 1IPGA 5D2MB 4HEA1 3ZUNA 2G9HD 1ACCA 1E0ZA 1WXAA 5AZGA 3JSVA 4FJVB 2RDHA 4RNAA 1WX7A 2MCNB 5TSSA 3ML9A 5IP4D 3VXWA 2N4FA 3EECA 3NUHB 4ZHOA 4K3CA 4LNIA 3V6CB 1E90A 2J0MA 4HWIB 3SEBA 3A9KB 2WX0A 1P9DU 1RFAA 3ZQ4A 4DDID 1E7PB 4ARIA 1TIFA 1U4AA 2G3QB 4MDKE 3A4SC 1IP9A 4TQ1A 1KLGD 3DVGY 1L6UA 2W9NA 2Z8LA 2FE8A 3VH4B 1K52A 3TSSA 3H7SA 3NZUA 4DHZE 2KX0A 2J0JA 5I4DA 4JPSA 2OJWA 1WM2A 2ZPNA 3HRDD 2N9KA 3UQAA 2KJHB 2C5LC 4WJQA 3A9KA 1JALA 3SFDB 1WSPA 3KH0A 3EGRA 3IBEA 5C23A 3NJTA 3OJ4B 1WM3A 3ZXVA 4NJ6A 2JXXA 3AN1A 4LCDE 4N9F4 4BKSD 4CYEA 4G50A 2BGFA 3P4RB 1RYJA 4W9FA 1VRAB 1WGKA 5BO4B 2EKEC 1FM0D 1WJNA 2X38A 2M17A 2RPVA 4KDIC 2KOXA 2I1JA 1P0RA 1MG4A 3ENEA 2LHDA 1NEKB 2JZPA 5L95C 4CQNA 2PVOD 3QK0A 4A6QA 2BS3B 3NS8A 1EUVB 2GOWA 3W1SC 1HEZE 2N9XA 3UGBB 4USAA 2IBIB 2JWUA 3VRAB 2WU2B 2Z0EB 2J42A 5EE3A 1J19A 4DHJD 4RM8A 3QQ8B 3ZJVA 1FCLA 2DX5B 3KUZA 3ZNZB 1KLVA 3NVYA 3NS1A 1TGZB 1LXDA 3RNCC 2L32A 2L8JA 4O1NA 3LDZE 4F1SA 2WHIA 4K7UA 2M0AA 2N9LA 1RM6C 3X23A 4IWPA 2LGIA 4NQLB 4WURA 1ZOYB 1YJIA 2C9WB 4HPPA 4MJSB 1FO4A 2D3AA 2MJDA 1JWMD 5IAAC 3RNAC 4W9LA 3V05A 4W9EA 2WQYB 2D10A 4NPNA 1ZGUB 3TBLD 5IO9A 3RZWC 2N7EA 2JT4B 2KLGA 4DXFA 1YX5B 3BYTB 3HVDA 3FKYA 4HRSA 3NHEB 3MC0B 3KYCD 3R8BA 1H8CA 1SJHD 3TUOA 2YVCA 4KZ0A 2SEBD 4PT5A 1P7EA 4WWMA 4FHKA 2AEHA 2QSDA 1WRDB 5LXHA 1FEHA 2R2OA 2KTRB 1MVKA 3U30A 2D3BA 4YSXB 4S0RA 4GIVA 3N20C 4EFOA 2LUMA 1EF1A 2DAFA 2C7NB 3V60A 3ZJUA 2BF8B 1CQVA 3OLMD 1JQ4A 1IGDA 2LI5A 1GG3A 2JRIB 3APDA 3D32A 1BXTA 3C19A 1PFDA 2VH2A 1WZ0A 2JUOA 1AARA 3GS2A 4PS7A 2KTRA 4AJWA 2LHEA 3MFGA 2K5PA 3U2SC 2GBJA 2Y5BB 1ZW7A 2WWZA 3P4QB 2V3PA 1I7HA 2PMVA 1V5OA 4ZRIA 2FIFA 3AB5A 5FK9C 1LGRA 2IO2B 4BKGA 4MM3A 3PZ7A 4M0WA 3WANA 4AQ7A 1FCCC 1YD8U 3NVZA 3BK1A 3U8ZA 1OEYJ 2MRPA 2MBEA 1V6EA 2BYFA 2NR2A 4ZRKA 3H8HA 2MP2B 1JCKB 4GMVA 3HVZA 3Q3FA 2ON8A 2NBWB 2GBRA 2PE9A 3R2TA 3JYUA 2K6DB 4HDQA 3MJWA 5E6OA 1E8WA 4HVBA 2AQ3B 3TMPB 4M0WB 3H6NA 5BYRA 3VTVA 2IGDA 4DXAB 3C0RB 1YMHE 4DBGA 2WNMA 1WGYA 3WALA 4K1RB 3SHQA 3AXCA 3KVFB 4K81A 5DPWA 3P42A 2K9XA 4DWFA 3B9JA 3N1YC 2OEDA 1JWSD 2GI9A 4KSKC 1WR1A 1MJDA 3WCQA 3AEDB 4II3B 1TZ1A 3H7PB 3VHTC 3CMMB 4RF1A 4WH4A 2O6VD 1WI0A 4BKTA 4N58A 1Y56A 2WDQB 4GDLB 4ZOHC 5KHOA 1V5TA 1E6EB 2WXLA 1UUPA 4KDLB 3BVZA 3M62B 3TEZA 4HCPB 5JHAA 5CX3A 2DYBA 2D5GA 1TS2A 2KKCA 4HCNB 4YT0B 2Z59B 3U7ZA 2FBWB 3AULA 4MSMB 3R66C 3DVGX 4RGNA 2GRIA 2QILA 3IG3A 1WGDA 4PK1A 1FXIA 4OZCA 4ZYSA 1N61A 4UDUC 4RM9A 4AS1A 1NBFC 1YN3A 1YIWA 2O2VB 2N1WA 1YJJA 4MT5A 1K51A 4NAWA 1C4CA 3PREA 1P1AA 1WYGA 2QHOA 4W9DA 4I6NB 2BB5A 2PKOA 2IJ0A 1D3ZA 1HA5A 1F0ZA 3WIMA 1F1HA 4BBNF 1XD3B 2BBCA 2CR5A 2A5UA 2BS4B 2FUG1 2HTHA 3T9LA 2LWPA 2KT7A 3EUB2 2AWTA 3HM6X 1YQ3B 3BVGA 2KXJA 3EC8A 3KUDB 5IA7A 1WXMA 3U52E 4A3OA 4ANXA 3UF8A 3ZNID 2PEAA 5D3DA 3AMZA 3RD2A 3AE4B 2XK5A 2Y5PA 3BWUD 5AZFA 1WRIA 2V3NA 2GBKA 4FHJA 2CJOA 1RRBA 3URYA 2WYQA 4FJZA 1WE7A 4E71A 1QOFA 2K8BA 3U4EG 1D5MC 1DOXA 5AUIA 2J52A 1VJKA 2KDMA 4K7SA 4DDGD 3U7DA 2RPQA 4MACA 2LXCA 4OVUA 4B95A 1RLFA 2INCC 1NYRA 2J0KA 2OHFA 3VUWA 3ZDMC 3QIJA 1I4QA 3Q3MC 3NY5A 2UYZB 2O6VB 1HTOA 2A4ZA 3NVWA 4HDOA 2JY6A 5LLIA 2QJLA 4A55A 1GNUA 2D2QA 1QKZA 1SEBD 4F8CB 4G11A 1XT9B 2YEPB 4C56C 1V81A 1WZ3A 2JYEA 3PSEB 2IO1B 2KDIA 3DBLB 1I4PA 1RWSA 2ZCBA 1WR6E 5BMHA 2NTSA 4IM3A 2WXJA 3R7RA 4KGSA 2WDTB 1OQYA 1SE2A 3AE3B 3ZVVA 1I4HA 2WDRB 1GB1A 1TTNA 3FAHA 5HHDG 1XLPA 2LXAA 1KTKA 2IDYA 4WWPA 2ZW1A 3ZTDA 4GOCA 3QA8A 1AN8A 1NDDA 2ZPYA 2KAJA 2V4IB 2WXNA 3LJ3A 2M19A 3N1XC 3AEGB 3H7PA 1V49A 2LGDA 1EF5A 2L83A 1JWAD 1R4NB 3P2BA 4YXDB 5GMVA 3TCAA 3N3KB 1JWBD 1OFFA 4X57B 3W5VB 1OQQA 3Q6BA 2LJ5A 2V9HA 2DAJA 2RSUA 3DBLI 4GB9A 5G55A 2AX5A 2K0PA 2DENB 3MHZA 3N9YC 2D07B 3IAM1 3APFA 2IY1B 3DWGC 4M01A 3N32A 2FAZA 3AEBB 1OTRB 1UELA 3V6EB 2KMMA 2LASA 4N6EB 1DYQA 4OVVA 1JROA 1YN4A 2C7MB 2HJ8A 4KX6B 4WWNA 2KJRA 1S3SG 5H92C 3VR9B 2MWSB 1VZ7A 1ZP0B 2C60A 2MJEA 4ITKA 4MGIE 2YEPF 1PYWD 2BTEA 2KYWA 4EOYA 1CZPA 1YJ1A 1EU4A 3RI7C 3ZIMA 4D2KA 1V2YA 2G45B 4MGZE 3A9JB 3IHPC 3OAWA 3VTWA 3GE8C 3JVZX 1ROEA 2KVZA 3V62A 1C3TA 3BZDB 2VZKB 3SR6A 1NI2A 1EU3A 1T0SC 2KNBA 1J8CA 2KC2A 3L16A 3ZGZA 1GAQB 4A9AA 4ACFA 4HPMB 1HZ5A 2JWZA 3PRZA 1RFKA 1M94A 1QF6A 1SF0A 1C4AA 4NNJB 2LGYA 2WXFA 1XLOA 1FXTB 4W9JA 1L4ZB 2V0GA 4GDLA 2H88B 2WP9B 1UZXB 4C80A 1TJEA 3UQBA 1GUAB 5D3IB 4B0EA 2KJ6A 4IG7B 2LGSA 2PLPA 3PLUA 4KIKB 3RMKC 1ZXHA 3WAOA 1QLBB 5FR6A 2KC1A 2V1YA 5DCNA 3IT6B 5DPTA 4C4VB 1FXAA 4EZLA 1D5ZC 2IPKD 2MP2A 2L0TA 4WIPA 5CHFA 2AQ1B 1TKGA 2O6VA 3IFWB 4PS8A 2WXQA 1L6VA 3JW0X 3DBSA 2ACZB 4LNKA 4TSSA 1PUTA 3B0AA 4G0NB 3V3XA 3IXSA 4RF0A 2B3AA 2YLMA 2EMSA 4IWOA 1XCTL 3KLSX 2DZKA 1EO6A 1QT9A 3GZNI 4ANUA 5IN7A 3VR8B 3MP9A 2N7DA 4JGHB 1TS3A 1UF0A 2WX1A 5H8YE 2JX5A 3Q3OC 4ICUA 4NQKE 2I38A 4DK5A 2MHJA 5C1ZA 2FUHB 5BYSA 1WXSA 4IM0A 4URKA 1Z2MA 2XEWA 3NG0A 2L3ZA 3KWLA 3P4SB 4L23A 1TY0A 3I57A 5E6PA 4XE0A 2MSED 1V86A 1YX6B 3AE7B 4OZBA 3V61A 2W82A 2NPTB 2INPE 2BVCA 2E6XA 3CSFA 1WGGA 4P1CC 3QHTA 4RGMA 1A5RA 1G6JA 1J7CA 1KM7A 2QCZA 3GZNB 4E3CA 2ZNVB 4WAFA 4ANVA 4EUTA 1WGRA 2V3SA 1H4RA 2PTLA 2KHWB 4WWOA 5CTRC 4C7ZA 3DHIC 4IDIA 4JQWC 5AUKA 2Z0DB 4BBNC 3M3JA 3E56A 3I63C 2HE7A 4YTNB 2ZEQA 3M63B 2Y5CA 5L83A 1WMHA 1BMLC 3R2IA 1T5XD 3ZDTA 2VRRB 2IO3B 2KFJA 2Q5WD 1K50A 4FA6A 2KWDA 2AL6A 1I42A 4OZAA 3JSVB 1NVID 1OGWA 5G5HA 2DWQA 5T8IA 3HHMA 3T3OA 2D3CA 1LO5D 1T3QA 2LVOA 4WJNA 2HD5B 3L54A 3ZJTA 4IKGA 2W54A 1UWMA 4IUMB 2CU1A 2KMCA 1D6EC 2MEKA 2L52A 3QJZA 3VVWB 3H1UA 5DPRA 1J0GA 2CS4A 1ZE3D 3PHWB 2LZ6A 2XBBC
chains in the Genus database with same CATH topology
3AU4A 2QHOA 4W9DA 4I6NB 3RYTA 1VCBA 4CO7A 2K8CA 2REXA 1D3ZA 2KD0A 3WIMA 4CHKA 5D7GA 3VAWA 4BBNF 2JF5A 1XD3B 4PYUA 1WX9A 2CR5A 2A5UA 3N30A 4HXDA 1WFYA 2HTHA 5CHVC 2LUEA 4LDTB 3T9LA 1IPGA 2GMIC 3R3MA 2LWPA 5CHWA 5D2MB 4AP4C 4ASWC 2K25A 2AWTA 3HM6X 3ZUNA 4A20A 3PV1A 2BWES 4NY0A 2KXJA 4J6IA 3EC8A 3KUDB 5IA7A 1WXAA 1WXMA 3RZFA 5AZGA 3JSVA 4FJVB 2CHWA 4A3OA 2PPHA 1WX7A 2N9PC 2MCNB 4ANXA 4EKUA 2DZIA 3UF8A 1MG8A 2NVUI 2PEAA 4MSQB 3ZNID 3ML9A 4TQ0A 3VXWA 3L08A 3W1SA 2N4FA 2FCQA 3EECA 3KUCB 2KMAA 3RD2A 1UD7A 2XK5A 2DZMA 3PRPB 3KW5B 5AZFA 2MA9B 2KK8A 2UWQA 2GBKA 2L0FA 4FHJA 3V6CB 1RRBA 1E90A 2J0MA 2WYQA 4HWIB 3A4RA 4K7WA 4FJZA 3QARA 3VUYA 1WE7A 2ZJDA 3PLVA 4E71A 2K8BA 3A9KB 2D3GA 2WX0A 2M4NA 1P9DU 1E8YA 1RFAA 2MX2A 4K7SA 4DDID 4DDGD 1GJZA 3U7DA 2RPQA 4OVUA 2LXCA 2AYOB 2KN5A 3S2AA 1KJTA 1RLFA 1WXVA 3ZRFA 1U4AA 4B95A 2NBUA 2J0KA 2L00B 2G3QB 4MDKE 3VUWA 3ZDMC 3A4SC 1IP9A 4TQ1A 2BWFA 3DVGY 3QIJA 4ZYNA 2W9NA 5KHQA 4JIOU 3NY5A 1Z5SB 3VH4B 3SD5A 4WQOB 2UYZB 2O6VB 2A4ZA 3H7SA 3ZNHB 3NZUA 4DHZE 2KX0A 2JY6A 4HDOA 2J0JA 2DHZA 5LLIA 4TUUA 4MEMA 1WM2A 2ZPNA 2KDEB 1GNUA 2AL3A 3B08A 3BINA 2D2QA 5J18A 3UQAA 4F8CB 2KJHB 3DBHI 1XT9B 2C5LC 4G11A 4WJQA 1V81A 1WZ3A 4EEWA 1Q0WB 3A9KA 3PSEB 2IO1B 1S1QB 2KDIA 1P1AA 3W1YA 2ZCBA 1WR6E 4GDKB 5E6NA 3R7RA 3KH0A 3L13A 4IM3A 3WAMA 2FCSA 1E8XA 2WDTB 3IBEA 5C23A 1OQYA 1LM8B 3OJ4B 1WM3A 3ZVVA 4BVUC 4AJYB 1L7YA 2DYMA 4NJ6A 2JXXA 4LJOB 5AZHA 4LCDE 4N9F4 4BKSD 4CYEA 5JZEB 1TTNA 3ML8A 4G50A 3O65B 5EDSA 2BGFA 1SIFA 4W9HA 4W9FA 2LXAA 5BO4B 3PVLA 2EKEC 4HPLB 4WWPA 1WJNA 2JRHA 2MQJA 4GOCA 2M17A 3QA8A 3ZTDA 4WJOA 1NDDA 2ZPYA 2R2QA 2KQSA 4KDIC 2DYOA 2KOXA 2I1JA 1P0RA 3ENEA 3LJ3A 3VDZA 5L95C 2NCNA 3QK0A 4ZDVA 3H7PA 1V49A 2LGDA 1EF5A 3NS8A 1EUVB 3ZW3A 2GOWA 3W1SC 3P2BA 5AEKB 5GMVA 2K1FA 4JLCA 3PT2B 3DCGA 3N3KB 3TCAA 4X57B 2N9XA 3QCAA 4GSWA 2LVQA 3UGBB 3VTUA 2IBIB 3HK0A 2LJ5A 3H9DA 2Z0EB 3R7QA 1J19A 4FN2A 4A3PA 2K6QA 1R4MI 4DHJD 4TKNA 2DAJA 2RSUA 3DBLI 4RM8A 2LRWA 3QQ8B 2IYDB 2FCMA 4GB9A 4NJ7A 5G55A 3ZO5B 3WA0A 2DX5B 3CF6E 4I6PA 4E74A 2L05A 3KUZA 3ZNZB 3PHXB 2DENB 3B1LX 4LDTD 5J2RA 2PE6B 2D07B 1KLVA 1JRUA 4II2B 4B6WA 1TGZB 2N1VA 1VD2A 3NOBA 1LXDA 3APFA 4HK2A 2IY1B 1ISNA 2IO0B 2L8JA 2IY0B 3N32A 2FAZA 2KFKB 2I1KA 3LDZE 1OTRB 1UELA 4F1SA 3V6EB 2K8HA 3M95A 2K39A 2MBOA 2LASA 4K7UA 4WAAA 3X23A 3I3TB 4IWPA 2JVCA 4IWQA 1UGMA 4NQLB 3PS6A 3ZLZA 2MW5A 2C7MB 2C9WB 4FULA 4MJSB 2HJ8A 2LRUA 4OVVA 1E5WA 3RULA 3K9PB 1PQSA 3PGEA 4WWNA 2KJRA 1E8ZA 4GGQA 1WH3A 1S3SG 2ASQA 5IAAC 1YQBA 2MWSB 2C60A 4MGIE 2FIDA 4W9LA 2ZCCA 3ALBA 4W9EA 3DBRI 2PJHA 4EOYA 3IVFA 2D10A 4NPNA 1ZGUB 3MTNB 3TBLD 1YJ1A 4ICVA 4M8MA 3RZWC 2KTFA 2N7EA 3ZIMA 2JT4B 3UINB 1V2YA 2KLGA 2OJRA 4IM2A 1YX5B 2G45B 1WJ4A 3DPDA 4KZCA 4MGZE 3A9JB 2M8SA 3IHPC 3OAWA 3TJPA 2MBQA 4HLEA 3PRMB 3NHEB 2LGXA 3VTWA 1WE6A 4MGYE 3JVZX 1L2NA 3KYCD 1H8CA 3V62A 4KSLC 2JZZA 5JHBA 1WIAA 4KV2A 1C3TA 2D11A 3L10B 3A1QA 1R4NI 3EHVA 3A9JA 3A33B 1NI2A 2KNBA 3ONSA 3KYDD 2YVCA 4KZ0A 1J8CA 1F9JA 2L76A 2KC2A 2XK5B 3L16A 2CHXA 4FHKA 2AEHA 4HPMB 2JWZA 3PRZA 3PPAA 1WRDB 5LXHA 1M94A 2KWVB 2R2OA 3APCA 2KTRB 4ZRJA 4WJPA 3U30A 4W9KA 4BFRA 3DQVA 4NNJB 2LGYA 1CMXB 2NBVB 3UIPB 4FLHA 4XC2A 3ZKJC 1IYFA 1FXTB 2MLBA 4XX5A 2MBBB 4GN1A 4LJPB 3RT3B 3A1QB 4W9JA 3DOWA 3ZNGC 2G4DB 1WX8A 4GIVA 4GDLA 2KDBA 1UZXB 2RD0A 4EFOA 2C7HA 4GDKA 2ZNVC 1EF1A 2BKFA 3UQBA 2DAFA 2C7NB 3VFKA 4EZKA 1GUAB 3V60A 2FNJB 2KJ6A 5D94A 2BF8B 3PLUA 2BKRB 3OLMD 2M1MA 4IG7B 4KIKB 1UH6A 2N9EB 3WAOA 3PZDA 3RUIB 5FR6A 3ZDTA 1LQBA 2KC1A 3L17A 4MELA 2LI5A 1GG3A 2JRIB 2V1YA 3APDA 3D32A 3NZSA 5DCNA 2L7RA 2JZ3B 2CHZA 5DPTA 4ANWA 1WZ0A 2JUOA 3EFUA 1AARA 3HIZA 4EZLA 4RMAA 1SGHA 4EZJA 3MHSD 4PS7A 2MP2A 2L0TA 2KTRA 4AJWA 2ZVNA 2OOBB 1UBQA 5CHFA 2KQ7A 4FADA 1Q5WB 3GOEA 1QZEA 2O6VA 3IFWB 4PS8A 4DHJB 4FBJB 3JW0X 3QC8B 2GBJA 3DBSA 4TV3A 2Y5BB 1ZW7A 3VQIA 2WWZA 3TIXA 3B0AA 1V9JA 4KVGB 4G0NB 3AI5A 4W9GA 1UBIA 3RCZA 2JPHA 2B3AA 1V5OA 2YLMA 2EMSA 4ZRIA 2FIFA 4IWOA 3DDCB 5JH5C 2IO2B 4BKGA 4MM3A 2DZKA 1EO6A 3Q3JA 3GZNI 3HM3A 3AU5A 4ANUA 1WJ6A 2N7DA 3ECIA 3X0WA 1WMHB 3WANA 4JGHB 2GBMA 2WX1A 1YD8U 2GBNA 3CSTA 4ICUA 4NQKE 3U8ZA 3DVNU 1OEYJ 4W9IA 5LXIB 3UIOB 2MRPA 1WJUA 1GC7A 2KWUB 2MBEA 3WAPA 4BOZB 4DK5A 1V6EA 5C1ZA 3ZTCA 2BYFA 2FUHB 2NR2A 4ZRKA 2MP2B 1WXSA 4MGKE 4IM0A 4URKA 1Z2MA 2XEWA 4M8NA 1HE8A 2LD9A 4GMVA 2V4LA 2L3ZA 4NAWB 3K9OB 3SU8X 3Q3FA 5E6PA 3QAQA 4AOFA 2MSED 2NBWB 2O2VA 4W9CA 2GBRA 2PE9A 4JL9A 4AWJA 4F7ZA 1V86A 1YX6B 3DVNV 5D6JB 3JYUA 2K6DB 1P3QU 1RAXA 1LFDA 4HDQA 3V61A 4I6LB 2ZVOA 2NPTB 3MJWA 5E6OA 1E8WA 3CSFA 4FJYA 4HVBA 1WGGA 2NS5A 4B9KA 1KOTA 3QHTA 3TMPB 1T0YA 4M0WB 5DPSA 1A5RA 2DZJA 3H6NA 2G4SA 2RR9A 1G6JA 1KM7A 3VTVA 4DXAB 1XQQA 1I35A 3C0RB 4E3CA 2ZNVB 4DBGA 1WF9A 1WGYA 3WALA 4K1RB 3SHQA 2MBHA 2BYVE 3PTFC 4BKSA 4ANVA 3AXCA 3KVFB 4K81A 4EUTA 5DPWA 1P98A 2KFKA 1WGRA 4KIKA 2V3SA 2KWCA 1H4RA 4DHZB 1Q1OA 1Y8RC 4DWFA 1WY8A 1BT0A 2KHWB 4HJKA 4WWOA 5CTRC 1E7UA 2FCNA 2BPSA 4KSKC 2NPTA 1WR1A 3QWZB 2M0XA 4JQWC 4II3B 1TZ1A 4IW0A 4PYZA 5G2NA 3H7PB 3VHTC 3CMMB 2O6VD 1WI0A 4BKTA 2Z0DB 2BYEA 4BBNC 3M3JA 3QX1A 4GDLB 1WYWB 2HE7A 2KO3A 2KLCA 3L0WB 2KX3A 4MH0E 2ZEQA 3M63B 3T8MA 4YL8A 5KHOA 1V5TA 4PS3A 2KVRA 1C1YB 4IC7B 5L83A 1WMHA 3OJ3A 1K8RB 2ZZPB 4GU2A 2IO3B 2KFJA 2VRRB 3VH3B 3M62B 1E7VA 2KDFB 1GC6A 4KDLB 4FA6A 4HCPB 4BOSC 2AL6A 5JHAA 5CX3A 2EMTA 1I42A 1X1MA 2DYBA 3JSVB 2KANA 1OGWA 2KKCA 2IZVB 5TR5A 4HCNB 2Z59B 3HHMA 3VUXA 1WGHA 3AULA 1SE9A 4MSMB 3ZRCA 3R66C 3DVGX 3TL5A 4GXBA 3IG3A 2LVOA 4WJNA 2HD5B 3L54A 1WGDA 4G3XB 5J17A 4IUMB 1TBEA 2CU1A 2KMCA 4RM9A 1NBFC 4MJSA 2J7QB 1YIWA 2LVPA 3QJZA 3VVWB 2O2VB 3BY4B 3H1UA 2N1WA 5DPRA 3SDLC 4XZ4A 1OEYA 1J0GA 1ZKHA 1V80A 4AUQC 5HKHA 2KZRA 2RGFA 2CS4A 2CKHB 4NAWA 4P7IA 3PREA 3PHWB 2LZ6A 2XBBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU4 A;  2QHO A;  4W9D A;  4I6N B;  3RYT A;  1VCB A;  4CO7 A;  2K8C A;  2REX A;  1D3Z A;  2KD0 A;  3WIM A;  4CHK A;  5D7G A;  3VAW A;  4BBN F;  2JF5 A;  1XD3 B;  4PYU A;  1WX9 A;  2CR5 A;  2A5U A;  3N30 A;  4HXD A;  1WFY A;  2HTH A;  5CHV C;  2LUE A;  4LDT B;  3T9L A;  1IPG A;  2GMI C;  3R3M A;  2LWP A;  5CHW A;  5D2M B;  4AP4 C;  4ASW C;  2K25 A;  2AWT A;  3HM6 X;  3ZUN A;  4A20 A;  3PV1 A;  2BWE S;  4NY0 A;  2KXJ A;  4J6I A;  3EC8 A;  3KUD B;  5IA7 A;  1WXA A;  1WXM A;  3RZF A;  5AZG A;  3JSV A;  4FJV B;  2CHW A;  4A3O A;  2PPH A;  1WX7 A;  2N9P C;  2MCN B;  4ANX A;  4EKU A;  2DZI A;  3UF8 A;  1MG8 A;  2NVU I;  2PEA A;  4MSQ B;  3ZNI D;  3ML9 A;  4TQ0 A;  3VXW A;  3L08 A;  3W1S A;  2N4F A;  2FCQ A;  3EEC A;  3KUC B;  2KMA A;  3RD2 A;  1UD7 A;  2XK5 A;  2DZM A;  3PRP B;  3KW5 B;  5AZF A;  2MA9 B;  2KK8 A;  2UWQ A;  2GBK A;  2L0F A;  4FHJ A;  3V6C B;  1RRB A;  1E90 A;  2J0M A;  2WYQ A;  4HWI B;  3A4R A;  4K7W A;  4FJZ A;  3QAR A;  3VUY A;  1WE7 A;  2ZJD A;  3PLV A;  4E71 A;  2K8B A;  3A9K B;  2D3G A;  2WX0 A;  2M4N A;  1P9D U;  1E8Y A;  1RFA A;  2MX2 A;  4K7S A;  4DDI D;  4DDG D;  1GJZ A;  3U7D A;  2RPQ A;  4OVU A;  2LXC A;  2AYO B;  2KN5 A;  3S2A A;  1KJT A;  1RLF A;  1WXV A;  3ZRF A;  1U4A A;  4B95 A;  2NBU A;  2J0K A;  2L00 B;  2G3Q B;  4MDK E;  3VUW A;  3ZDM C;  3A4S C;  1IP9 A;  4TQ1 A;  2BWF A;  3DVG Y;  3QIJ A;  4ZYN A;  2W9N A;  5KHQ A;  4JIO U;  3NY5 A;  1Z5S B;  3VH4 B;  3SD5 A;  4WQO B;  2UYZ B;  2O6V B;  2A4Z A;  3H7S A;  3ZNH B;  3NZU A;  4DHZ E;  2KX0 A;  2JY6 A;  4HDO A;  2J0J A;  2DHZ A;  5LLI A;  4TUU A;  4MEM A;  1WM2 A;  2ZPN A;  2KDE B;  1GNU A;  2AL3 A;  3B08 A;  3BIN A;  2D2Q A;  5J18 A;  3UQA A;  4F8C B;  2KJH B;  3DBH I;  1XT9 B;  2C5L C;  4G11 A;  4WJQ A;  1V81 A;  1WZ3 A;  4EEW A;  1Q0W B;  3A9K A;  3PSE B;  2IO1 B;  1S1Q B;  2KDI A;  1P1A A;  3W1Y A;  2ZCB A;  1WR6 E;  4GDK B;  5E6N A;  3R7R A;  3KH0 A;  3L13 A;  4IM3 A;  3WAM A;  2FCS A;  1E8X A;  2WDT B;  3IBE A;  5C23 A;  1OQY A;  1LM8 B;  3OJ4 B;  1WM3 A;  3ZVV A;  4BVU C;  4AJY B;  1L7Y A;  2DYM A;  4NJ6 A;  2JXX A;  4LJO B;  5AZH A;  4LCD E;  4N9F 4;  4BKS D;  4CYE A;  5JZE B;  1TTN A;  3ML8 A;  4G50 A;  3O65 B;  5EDS A;  2BGF A;  1SIF A;  4W9H A;  4W9F A;  2LXA A;  5BO4 B;  3PVL A;  2EKE C;  4HPL B;  4WWP A;  1WJN A;  2JRH A;  2MQJ A;  4GOC A;  2M17 A;  3QA8 A;  3ZTD A;  4WJO A;  1NDD A;  2ZPY A;  2R2Q A;  2KQS A;  4KDI C;  2DYO A;  2KOX A;  2I1J A;  1P0R A;  3ENE A;  3LJ3 A;  3VDZ A;  5L95 C;  2NCN A;  3QK0 A;  4ZDV A;  3H7P A;  1V49 A;  2LGD A;  1EF5 A;  3NS8 A;  1EUV B;  3ZW3 A;  2GOW A;  3W1S C;  3P2B A;  5AEK B;  5GMV A;  2K1F A;  4JLC A;  3PT2 B;  3DCG A;  3N3K B;  3TCA A;  4X57 B;  2N9X A;  3QCA A;  4GSW A;  2LVQ A;  3UGB B;  3VTU A;  2IBI B;  3HK0 A;  2LJ5 A;  3H9D A;  2Z0E B;  3R7Q A;  1J19 A;  4FN2 A;  4A3P A;  2K6Q A;  1R4M I;  4DHJ D;  4TKN A;  2DAJ A;  2RSU A;  3DBL I;  4RM8 A;  2LRW A;  3QQ8 B;  2IYD B;  2FCM A;  4GB9 A;  4NJ7 A;  5G55 A;  3ZO5 B;  3WA0 A;  2DX5 B;  3CF6 E;  4I6P A;  4E74 A;  2L05 A;  3KUZ A;  3ZNZ B;  3PHX B;  2DEN B;  3B1L X;  4LDT D;  5J2R A;  2PE6 B;  2D07 B;  1KLV A;  1JRU A;  4II2 B;  4B6W A;  1TGZ B;  2N1V A;  1VD2 A;  3NOB A;  1LXD A;  3APF A;  4HK2 A;  2IY1 B;  1ISN A;  2IO0 B;  2L8J A;  2IY0 B;  3N32 A;  2FAZ A;  2KFK B;  2I1K A;  3LDZ E;  1OTR B;  1UEL A;  4F1S A;  3V6E B;  2K8H A;  3M95 A;  2K39 A;  2MBO A;  2LAS A;  4K7U A;  4WAA A;  3X23 A;  3I3T B;  4IWP A;  2JVC A;  4IWQ A;  1UGM A;  4NQL B;  3PS6 A;  3ZLZ A;  2MW5 A;  2C7M B;  2C9W B;  4FUL A;  4MJS B;  2HJ8 A;  2LRU A;  4OVV A;  1E5W A;  3RUL A;  3K9P B;  1PQS A;  3PGE A;  4WWN A;  2KJR A;  1E8Z A;  4GGQ A;  1WH3 A;  1S3S G;  2ASQ A;  5IAA C;  1YQB A;  2MWS B;  2C60 A;  4MGI E;  2FID A;  4W9L A;  2ZCC A;  3ALB A;  4W9E A;  3DBR I;  2PJH A;  4EOY A;  3IVF A;  2D10 A;  4NPN A;  1ZGU B;  3MTN B;  3TBL D;  1YJ1 A;  4ICV A;  4M8M A;  3RZW C;  2KTF A;  2N7E A;  3ZIM A;  2JT4 B;  3UIN B;  1V2Y A;  2KLG A;  2OJR A;  4IM2 A;  1YX5 B;  2G45 B;  1WJ4 A;  3DPD A;  4KZC A;  4MGZ E;  3A9J B;  2M8S A;  3IHP C;  3OAW A;  3TJP A;  2MBQ A;  4HLE A;  3PRM B;  3NHE B;  2LGX A;  3VTW A;  1WE6 A;  4MGY E;  3JVZ X;  1L2N A;  3KYC D;  1H8C A;  3V62 A;  4KSL C;  2JZZ A;  5JHB A;  1WIA A;  4KV2 A;  1C3T A;  2D11 A;  3L10 B;  3A1Q A;  1R4N I;  3EHV A;  3A9J A;  3A33 B;  1NI2 A;  2KNB A;  3ONS A;  3KYD D;  2YVC A;  4KZ0 A;  1J8C A;  1F9J A;  2L76 A;  2KC2 A;  2XK5 B;  3L16 A;  2CHX A;  4FHK A;  2AEH A;  4HPM B;  2JWZ A;  3PRZ A;  3PPA A;  1WRD B;  5LXH A;  1M94 A;  2KWV B;  2R2O A;  3APC A;  2KTR B;  4ZRJ A;  4WJP A;  3U30 A;  4W9K A;  4BFR A;  3DQV A;  4NNJ B;  2LGY A;  1CMX B;  2NBV B;  3UIP B;  4FLH A;  4XC2 A;  3ZKJ C;  1IYF A;  1FXT B;  2MLB A;  4XX5 A;  2MBB B;  4GN1 A;  4LJP B;  3RT3 B;  3A1Q B;  4W9J A;  3DOW A;  3ZNG C;  2G4D B;  1WX8 A;  4GIV A;  4GDL A;  2KDB A;  1UZX B;  2RD0 A;  4EFO A;  2C7H A;  4GDK A;  2ZNV C;  1EF1 A;  2BKF A;  3UQB A;  2DAF A;  2C7N B;  3VFK A;  4EZK A;  1GUA B;  3V60 A;  2FNJ B;  2KJ6 A;  5D94 A;  2BF8 B;  3PLU A;  2BKR B;  3OLM D;  2M1M A;  4IG7 B;  4KIK B;  1UH6 A;  2N9E B;  3WAO A;  3PZD A;  3RUI B;  5FR6 A;  3ZDT A;  1LQB A;  2KC1 A;  3L17 A;  4MEL A;  2LI5 A;  1GG3 A;  2JRI B;  2V1Y A;  3APD A;  3D32 A;  3NZS A;  5DCN A;  2L7R A;  2JZ3 B;  2CHZ A;  5DPT A;  4ANW A;  1WZ0 A;  2JUO A;  3EFU A;  1AAR A;  3HIZ A;  4EZL A;  4RMA A;  1SGH A;  4EZJ A;  3MHS D;  4PS7 A;  2MP2 A;  2L0T A;  2KTR A;  4AJW A;  2ZVN A;  2OOB B;  1UBQ A;  5CHF A;  2KQ7 A;  4FAD A;  1Q5W B;  3GOE A;  1QZE A;  2O6V A;  3IFW B;  4PS8 A;  4DHJ B;  4FBJ B;  3JW0 X;  3QC8 B;  2GBJ A;  3DBS A;  4TV3 A;  2Y5B B;  1ZW7 A;  3VQI A;  2WWZ A;  3TIX A;  3B0A A;  1V9J A;  4KVG B;  4G0N B;  3AI5 A;  4W9G A;  1UBI A;  3RCZ A;  2JPH A;  2B3A A;  1V5O A;  2YLM A;  2EMS A;  4ZRI A;  2FIF A;  4IWO A;  3DDC B;  5JH5 C;  2IO2 B;  4BKG A;  4MM3 A;  2DZK A;  1EO6 A;  3Q3J A;  3GZN I;  3HM3 A;  3AU5 A;  4ANU A;  1WJ6 A;  2N7D A;  3ECI A;  3X0W A;  1WMH B;  3WAN A;  4JGH B;  2GBM A;  2WX1 A;  1YD8 U;  2GBN A;  3CST A;  4ICU A;  4NQK E;  3U8Z A;  3DVN U;  1OEY J;  4W9I A;  5LXI B;  3UIO B;  2MRP A;  1WJU A;  1GC7 A;  2KWU B;  2MBE A;  3WAP A;  4BOZ B;  4DK5 A;  1V6E A;  5C1Z A;  3ZTC A;  2BYF A;  2FUH B;  2NR2 A;  4ZRK A;  2MP2 B;  1WXS A;  4MGK E;  4IM0 A;  4URK A;  1Z2M A;  2XEW A;  4M8N A;  1HE8 A;  2LD9 A;  4GMV A;  2V4L A;  2L3Z A;  4NAW B;  3K9O B;  3SU8 X;  3Q3F A;  5E6P A;  3QAQ A;  4AOF A;  2MSE D;  2NBW B;  2O2V A;  4W9C A;  2GBR A;  2PE9 A;  4JL9 A;  4AWJ A;  4F7Z A;  1V86 A;  1YX6 B;  3DVN V;  5D6J B;  3JYU A;  2K6D B;  1P3Q U;  1RAX A;  1LFD A;  4HDQ A;  3V61 A;  4I6L B;  2ZVO A;  2NPT B;  3MJW A;  5E6O A;  1E8W A;  3CSF A;  4FJY A;  4HVB A;  1WGG A;  2NS5 A;  4B9K A;  1KOT A;  3QHT A;  3TMP B;  1T0Y A;  4M0W B;  5DPS A;  1A5R A;  2DZJ A;  3H6N A;  2G4S A;  2RR9 A;  1G6J A;  1KM7 A;  3VTV A;  4DXA B;  1XQQ A;  1I35 A;  3C0R B;  4E3C A;  2ZNV B;  4DBG A;  1WF9 A;  1WGY A;  3WAL A;  4K1R B;  3SHQ A;  2MBH A;  2BYV E;  3PTF C;  4BKS A;  4ANV A;  3AXC A;  3KVF B;  4K81 A;  4EUT A;  5DPW A;  1P98 A;  2KFK A;  1WGR A;  4KIK A;  2V3S A;  2KWC A;  1H4R A;  4DHZ B;  1Q1O A;  1Y8R C;  4DWF A;  1WY8 A;  1BT0 A;  2KHW B;  4HJK A;  4WWO A;  5CTR C;  1E7U A;  2FCN A;  2BPS A;  4KSK C;  2NPT A;  1WR1 A;  3QWZ B;  2M0X A;  4JQW C;  4II3 B;  1TZ1 A;  4IW0 A;  4PYZ A;  5G2N A;  3H7P B;  3VHT C;  3CMM B;  2O6V D;  1WI0 A;  4BKT A;  2Z0D B;  2BYE A;  4BBN C;  3M3J A;  3QX1 A;  4GDL B;  1WYW B;  2HE7 A;  2KO3 A;  2KLC A;  3L0W B;  2KX3 A;  4MH0 E;  2ZEQ A;  3M63 B;  3T8M A;  4YL8 A;  5KHO A;  1V5T A;  4PS3 A;  2KVR A;  1C1Y B;  4IC7 B;  5L83 A;  1WMH A;  3OJ3 A;  1K8R B;  2ZZP B;  4GU2 A;  2IO3 B;  2KFJ A;  2VRR B;  3VH3 B;  3M62 B;  1E7V A;  2KDF B;  1GC6 A;  4KDL B;  4FA6 A;  4HCP B;  4BOS C;  2AL6 A;  5JHA A;  5CX3 A;  2EMT A;  1I42 A;  1X1M A;  2DYB A;  3JSV B;  2KAN A;  1OGW A;  2KKC A;  2IZV B;  5TR5 A;  4HCN B;  2Z59 B;  3HHM A;  3VUX A;  1WGH A;  3AUL A;  1SE9 A;  4MSM B;  3ZRC A;  3R66 C;  3DVG X;  3TL5 A;  4GXB A;  3IG3 A;  2LVO A;  4WJN A;  2HD5 B;  3L54 A;  1WGD A;  4G3X B;  5J17 A;  4IUM B;  1TBE A;  2CU1 A;  2KMC A;  4RM9 A;  1NBF C;  4MJS A;  2J7Q B;  1YIW A;  2LVP A;  3QJZ A;  3VVW B;  2O2V B;  3BY4 B;  3H1U A;  2N1W A;  5DPR A;  3SDL C;  4XZ4 A;  1OEY A;  1J0G A;  1ZKH A;  1V80 A;  4AUQ C;  5HKH A;  2KZR A;  2RGF A;  2CS4 A;  2CKH B;  4NAW A;  4P7I A;  3PRE A;  3PHW B;  2LZ6 A;  2XBB C; 
#chains in the Genus database with same CATH topology
 3BYY B;  3AU4 A;  5LNK 1;  1VCB A;  4JWS C;  2K8C A;  2KD0 A;  5FKA C;  3PO0 A;  2JF5 A;  1XXG A;  3BK2 A;  1WX9 A;  1DOI A;  2WGS A;  2GLS A;  2LUE A;  4LDT B;  3R3M A;  5CHW A;  4OVZ A;  4A20 A;  4MH8 A;  1WXQ A;  2BWE S;  4NY0 A;  4J6I A;  1C78 A;  3W2D A;  1ESF A;  2N9P C;  2WXM A;  2DZI A;  1EWY C;  2MJ3 A;  3L08 A;  3KUC B;  2KMA A;  1UD7 A;  2DZM A;  1ZDX A;  2N7J A;  3KW5 B;  2MA9 B;  2KK8 A;  2UWQ A;  2L0F A;  3PLV A;  2D3G A;  1XLQ A;  2MX2 A;  4ZRQ A;  3LXF A;  3IAS 1;  3AE9 B;  4FXC A;  2AYO B;  2KN5 A;  1KJT A;  1SSN A;  2L00 B;  2KN4 A;  1F2R I;  1TKE A;  1UWX A;  2IGG A;  5KHQ A;  4JIO U;  1Z5S B;  4JX1 C;  1ZUD 2;  3SD5 A;  5HG2 A;  2VZK D;  3ZNH B;  2BT6 A;  4TUU A;  4MEM A;  3BIN A;  5BYQ A;  1HTQ A;  1MPE A;  3DBH I;  4EEW A;  1DGJ A;  1CK1 A;  1Q0W B;  2QMT A;  1S1Q B;  3W1Y A;  1E8X A;  3DWM A;  1LM8 B;  2AQ2 B;  1EM7 A;  4BVU C;  1L7Y A;  2DYM A;  1XCQ L;  4LJO B;  5AZH A;  2WXG A;  3ML8 A;  5EDS A;  3AEF B;  2MH7 A;  1SIF A;  2PW9 A;  1TT5 B;  2JU6 X;  3PVL A;  4HPL B;  2JRH A;  2MQJ A;  5EE0 A;  3EFC A;  4WJO A;  2IGH A;  2WXO A;  3GB1 A;  2BQQ A;  2CJN A;  2DYO A;  2W3S A;  3TEY A;  1CJE A;  4ZDV A;  1L4D B;  3P63 A;  2K1F A;  3DCG A;  3MC9 A;  2LVQ A;  3VTU A;  3H9D A;  4A3P A;  1T0R C;  1R4M I;  1FNU A;  3ZO5 B;  2IYD B;  3J9C A;  3CF6 E;  1KF6 B;  2ZW0 A;  1FD6 A;  3PHX B;  4LDT D;  3B1L X;  2PE6 B;  1JWU D;  1JRU A;  4II2 B;  4B6W A;  1MHH E;  1VD2 A;  3NOB A;  4HK2 A;  1QQR A;  1ISN A;  1SE3 A;  2IY0 B;  3I9V 1;  2KFK B;  2I1K A;  4US9 A;  3M95 A;  2QDF A;  2K39 A;  2MBO A;  4BZA A;  1V1O A;  4WAA A;  2DBY A;  3I3T B;  2JVC A;  1UGM A;  3PS6 A;  4P1B C;  2MW5 A;  3ZLZ A;  5IKC M;  1QIL A;  4FUL A;  3RUL A;  3K9P B;  1PQS A;  2G1E A;  2HDE A;  3PGE A;  1NYQ A;  1E8Z A;  1WH3 A;  2ASQ A;  1YQB A;  2NMQ A;  1FIQ A;  3ALB A;  3DBR I;  3RNF C;  2PJH A;  3IVF A;  2W3R A;  4ICV A;  4M8M A;  1TZO A;  2KTF A;  2OJR A;  4DXG A;  1WJ4 A;  2M8S A;  3TJP A;  3AE8 B;  2LGX A;  4P6V F;  1WE6 A;  1L2N A;  1WIA A;  4KV2 A;  2D11 A;  3A1Q A;  4B0M A;  3EHV A;  1V8C A;  4EE2 A;  3A33 B;  3KYD D;  4L1B A;  4A90 A;  3AM9 A;  1N60 A;  2GB1 A;  3PPA A;  1HZ6 A;  3NZ3 A;  4HJG E;  4ZRJ A;  4W9K A;  4BFR A;  1FPY A;  1XEE A;  2WS3 B;  3DHH C;  2SAK A;  3DBR B;  1ET6 A;  3UIP B;  4XC2 A;  3ZKJ C;  1IYF A;  2MLB A;  4XX5 A;  3HUI A;  1YQ4 B;  2M56 B;  3ZNG C;  3OG5 A;  2ZNV C;  2INN E;  4Q2J A;  5C2T B;  1XLN A;  3VFK A;  2FNJ B;  5D94 A;  2K22 A;  1UH6 A;  3GP7 A;  3PZD A;  3RUI B;  1P7F A;  3L17 A;  1V1P A;  3NZS A;  2L7R A;  2CHZ A;  4ANW A;  3EFU A;  2QIE B;  3HIZ A;  4KGR A;  3MHS D;  1AW7 A;  2ZVN A;  2OOB B;  1AYF A;  1FFV A;  2KQ7 A;  4FAD A;  1TY2 A;  3GOE A;  1FNV A;  4DHJ B;  4FBJ B;  3W5U B;  1QOA A;  4TV3 A;  2DNF A;  3VQI A;  3TIX A;  2WXR A;  3Q3N C;  4TMA B;  1V9J A;  1J7A A;  3AI5 A;  4W9G A;  5C3J B;  3RCZ A;  1IBX A;  1GOZ A;  3AEA B;  3DDC B;  1WWT A;  2UU7 A;  2Y3A A;  2DLB A;  3Q3J A;  3HM3 A;  3AU5 A;  4OW0 A;  5G5G A;  1PDX A;  1WJ6 A;  1C77 A;  3ECI A;  3B2G A;  1WMH B;  4RH6 A;  2GBM A;  4S17 A;  1EWC A;  2GBN A;  1VR9 A;  4LK0 M;  1SXT A;  3DVN U;  4C7Y A;  5LXI B;  3UIO B;  1GC7 A;  4BOZ B;  1XO3 A;  2PIA A;  1TS5 A;  1HE8 A;  2LD9 A;  1FMA D;  2V4L A;  2VH1 A;  3K9O B;  1IBX B;  2KQ4 X;  1QOB A;  4AOF A;  2O2V A;  4W9C A;  4JL9 A;  1N6Z A;  4F7Z A;  5D6J B;  2WLB A;  1P3Q U;  1RAX A;  5MPO A;  1BUI C;  3PZ8 A;  4IOI E;  1KOT A;  1KLU D;  2DZJ A;  2G4S A;  2RR9 A;  1XQQ A;  1I35 A;  5EE1 A;  2MBH A;  4BKS A;  1P98 A;  2KFK A;  4KIK A;  2KWC A;  1Q1O A;  1BT0 A;  4HJK A;  3UI3 A;  2FCN A;  2BPS A;  2NPT A;  1C9F A;  4KKI A;  2BYE A;  1KRH A;  3RN9 C;  3B2F A;  1WYW B;  2KO3 A;  3L0W B;  2KX3 A;  1FRR A;  3T8M A;  4WQM A;  4YL8 A;  3LB8 C;  1SIJ A;  2K3U A;  1AWD A;  4IC7 B;  2PVG C;  3OJ3 A;  3VH3 B;  1GC6 A;  4BOS C;  5HFY A;  1N63 A;  1X1M A;  2RDB C;  2KAN A;  3C8Y A;  1GPX A;  3VUX A;  1WGH A;  3ZRC A;  4ZRP A;  3SFE B;  3N1Z C;  4GXB A;  1PGB A;  2EKI A;  4G3X B;  5J17 A;  1YOV B;  2J7Q B;  1NEN B;  3KQ4 A;  4DQO C;  4XZ4 A;  1ZKH A;  3E9S A;  2KZR A;  2HJ1 A;  4P16 A;  3RYT A;  4US8 A;  1F2R C;  4CO7 A;  2REX A;  4CHK A;  1FNW A;  3VAW A;  4PYU A;  1OQR A;  4HXD A;  5CHV C;  1UGJ A;  2GMI C;  4AP4 C;  4ASW C;  2K25 A;  1JRP A;  1R7S A;  3Q8A A;  4J3O D;  1VZ8 A;  3PV1 A;  4MM3 B;  4YSY B;  2WXK A;  3RZF A;  3O13 A;  2CHW A;  3I5J C;  2PPH A;  4EKU A;  5FR3 A;  2J4X A;  1MG8 A;  2NVU I;  4TQ0 A;  4MSQ B;  1L0Y B;  3W1S A;  2FCQ A;  3PRP B;  3RFZ B;  1YN5 A;  2E3T A;  4K7W A;  3VUY A;  3A4R A;  3QAR A;  2ZJD A;  3CWI A;  4LLG M;  3L4P A;  2M4N A;  1E8Y A;  2J53 A;  1GJZ A;  3S2A A;  1WXV A;  3ZRF A;  1V97 A;  2NBU A;  2BWF A;  4L2Y A;  4ZYN A;  3BII D;  1M4V A;  2BYT A;  4WQO B;  1IGC A;  2RDG A;  2DHZ A;  2QC8 A;  1VDV A;  4JWU C;  2KDE B;  2AL3 A;  3B08 A;  5J18 A;  1XF5 L;  4XDC A;  4C00 A;  1A70 A;  5HI1 A;  4XWT A;  2LJI A;  1STE A;  5E6N A;  4GDK B;  3WAM A;  3L13 A;  4RGO S;  2FCS A;  1J7B A;  3Q69 A;  3AE6 B;  1Q10 A;  3Q8B A;  4AJY B;  2WXH A;  1UNS A;  5JZE B;  3O65 B;  4W9H A;  3KWV A;  3LYY A;  2R2Q A;  2KQS A;  3VDZ A;  1T0Q C;  2NCN A;  5JXV A;  4YTM B;  3ZW3 A;  1N62 A;  5GXG B;  3ABV B;  5AEK B;  4JLC A;  3PT2 B;  1ZPS A;  1N5X A;  3AEC B;  4M02 A;  4XDD A;  1C4P A;  3QCA A;  4GSW A;  1V1P B;  2N0S B;  3NVV A;  3HK0 A;  3ETR A;  3R7Q A;  4FN2 A;  3RNE C;  1SBB B;  2K6Q A;  4TKN A;  4XWW A;  2LRW A;  4NJ7 A;  2FCM A;  3WA0 A;  3ZXR A;  2KAC A;  4I6P A;  4E74 A;  2L05 A;  1FFU A;  4HKQ A;  5J2R A;  3RNB C;  3CIR B;  4RCO A;  2N1V A;  1SE4 A;  2IO0 B;  1MFW A;  2K8H A;  1R4M B;  1HXY D;  4LNF A;  1B1Z A;  3DHG C;  4IWQ A;  3AE5 B;  2XN9 C;  2LRU A;  1E5W A;  1JW9 D;  2I2Y A;  1D4B A;  4GGQ A;  5EE9 A;  1YNT E;  2B76 B;  4N59 A;  2JQR B;  2FID A;  4BAX A;  2ZCC A;  3TEW A;  1B9R A;  1SB3 C;  3RPF C;  2JYT A;  3MTN B;  3UIN B;  3T3N A;  1HQR D;  4IM2 A;  3DPD A;  4KZC A;  4R3D A;  2MBQ A;  1T6B X;  4HLE A;  5E6J A;  3PRM B;  4ARC A;  3P1M A;  3Q8C A;  4MGY E;  1ENF A;  3FIL A;  4KSL C;  3MC8 A;  2JZZ A;  5JHB A;  3L10 B;  1R4N I;  3A9J A;  1L5P A;  3ONS A;  1F9J A;  2L76 A;  2XK5 B;  1C79 A;  2CHX A;  1VLB A;  1I4G A;  2KWV B;  1ZDV A;  3APC A;  4WJP A;  1N5W A;  3TEX A;  3DQV A;  1E10 A;  1CMX B;  2NBV B;  4FLH A;  2MBB B;  4GN1 A;  4LJP B;  3RT3 B;  3A1Q B;  3DOW A;  3ZYY X;  2G4D B;  1WX8 A;  2KDB A;  2RD0 A;  3AE2 B;  2C7H A;  4GDK A;  2H89 B;  2BKF A;  4EZK A;  1L0V B;  2LEK A;  2BKR B;  4XGA B;  2M1M A;  2N9E B;  3BVM A;  3NRZ A;  1GB4 A;  1LQB A;  3Q8F A;  4MEL A;  2JZ3 B;  1F77 A;  4RMA A;  1SGH A;  4EZJ A;  4HKZ E;  1FRD A;  1UBQ A;  4REZ A;  3GE3 C;  1Q5W B;  4XYC A;  5BMI A;  2L1A A;  1C76 A;  2LFI A;  1QZE A;  4M00 A;  3W9C B;  3QC8 B;  1I4R A;  1E9M A;  1PGX A;  3Q14 C;  4KVG B;  4YSZ B;  4GLS C;  1UBI A;  4NJC A;  2JPH A;  5JH5 C;  1D5X C;  4YWG G;  2WXP A;  4QAY A;  2CU3 A;  3OWE B;  1ET9 A;  2W55 A;  3X0W A;  1NI3 A;  1TKY A;  5IOI A;  2X8X X;  3CST A;  1QOG A;  4W9I A;  1K53 A;  4OHJ A;  1WJU A;  2KWU B;  3WAP A;  3ZTC A;  4MGK E;  4M8N A;  3EA6 A;  1MI0 A;  4NAW B;  3SU8 X;  4RGT A;  2WU5 B;  3QAQ A;  1MHX A;  4AWJ A;  3DVN V;  4K3B A;  4H2A A;  4LNO A;  1LFD A;  4I6L B;  2ZVO A;  4JE3 B;  2JSV X;  4FJY A;  1IUE A;  2NS5 A;  4B9K A;  3Q2A C;  1T0Y A;  4NZL B;  5DPS A;  2BB6 A;  3RNG C;  1WF9 A;  2HTM E;  3AE1 B;  2BYV E;  1TYG B;  3PTF C;  4DHZ B;  2NTT A;  1Y8R C;  1WY8 A;  1KFY B;  1E7U A;  1SJE D;  3QWZ B;  2M0X A;  1DOY A;  1KH0 A;  4PYZ A;  4IW0 A;  5G2N A;  3MJ5 A;  2EEL A;  1TS4 A;  3QX1 A;  1I4X A;  2KLC A;  4MH0 E;  4PS3 A;  2KVR A;  1C1Y B;  4YTP B;  2LMC A;  1K8R B;  4GU2 A;  2ZZP B;  3AV8 A;  2BS2 B;  1E7V A;  2KDF B;  2RMM A;  2EMT A;  2JXT A;  2WDV B;  4KGT A;  3FIL B;  4KKJ A;  3IT4 B;  5TR5 A;  2IZV B;  4HRO A;  1SE9 A;  5BMG A;  1ZXI A;  4ZHP A;  1VZ6 A;  2ICI A;  3TL5 A;  1PGA A;  2ONQ A;  3VRB B;  1L0X B;  4RFB A;  2R61 A;  4LTU A;  3FC4 A;  2BW2 A;  1TBE A;  4MJS A;  4LNN A;  1F52 A;  2LVP A;  3BY4 B;  3SDL C;  1OEY A;  1V80 A;  3AEE B;  4AUQ C;  4A8X C;  5HKH A;  2RGF A;  4NAM A;  2CKH B;  2TSS A;  4P7I A;  1JML A;  2WXI A;  3DBH B;  4C4V A;  2QEJ C;  3Q8E A;  5D7G A;  2IND C;  3AH7 A;  3P4P B;  3N30 A;  1WFY A;  2XNA C;  1IPG A;  5D2M B;  4HEA 1;  3ZUN A;  2G9H D;  1ACC A;  1E0Z A;  1WXA A;  5AZG A;  3JSV A;  4FJV B;  2RDH A;  4RNA A;  1WX7 A;  2MCN B;  5TSS A;  3ML9 A;  5IP4 D;  3VXW A;  2N4F A;  3EEC A;  3NUH B;  4ZHO A;  4K3C A;  4LNI A;  3V6C B;  1E90 A;  2J0M A;  4HWI B;  3SEB A;  3A9K B;  2WX0 A;  1P9D U;  1RFA A;  3ZQ4 A;  4DDI D;  1E7P B;  4ARI A;  1TIF A;  1U4A A;  2G3Q B;  4MDK E;  3A4S C;  1IP9 A;  4TQ1 A;  1KLG D;  3DVG Y;  1L6U A;  2W9N A;  2Z8L A;  2FE8 A;  3VH4 B;  1K52 A;  3TSS A;  3H7S A;  3NZU A;  4DHZ E;  2KX0 A;  2J0J A;  5I4D A;  4JPS A;  2OJW A;  1WM2 A;  2ZPN A;  3HRD D;  2N9K A;  3UQA A;  2KJH B;  2C5L C;  4WJQ A;  3A9K A;  1JAL A;  3SFD B;  1WSP A;  3KH0 A;  3EGR A;  3IBE A;  5C23 A;  3NJT A;  3OJ4 B;  1WM3 A;  3ZXV A;  4NJ6 A;  2JXX A;  3AN1 A;  4LCD E;  4N9F 4;  4BKS D;  4CYE A;  4G50 A;  2BGF A;  3P4R B;  1RYJ A;  4W9F A;  1VRA B;  1WGK A;  5BO4 B;  2EKE C;  1FM0 D;  1WJN A;  2X38 A;  2M17 A;  2RPV A;  4KDI C;  2KOX A;  2I1J A;  1P0R A;  1MG4 A;  3ENE A;  2LHD A;  1NEK B;  2JZP A;  5L95 C;  4CQN A;  2PVO D;  3QK0 A;  4A6Q A;  2BS3 B;  3NS8 A;  1EUV B;  2GOW A;  3W1S C;  1HEZ E;  2N9X A;  3UGB B;  4USA A;  2IBI B;  2JWU A;  3VRA B;  2WU2 B;  2Z0E B;  2J42 A;  5EE3 A;  1J19 A;  4DHJ D;  4RM8 A;  3QQ8 B;  3ZJV A;  1FCL A;  2DX5 B;  3KUZ A;  3ZNZ B;  1KLV A;  3NVY A;  3NS1 A;  1TGZ B;  1LXD A;  3RNC C;  2L32 A;  2L8J A;  4O1N A;  3LDZ E;  4F1S A;  2WHI A;  4K7U A;  2M0A A;  2N9L A;  1RM6 C;  3X23 A;  4IWP A;  2LGI A;  4NQL B;  4WUR A;  1ZOY B;  1YJI A;  2C9W B;  4HPP A;  4MJS B;  1FO4 A;  2D3A A;  2MJD A;  1JWM D;  5IAA C;  3RNA C;  4W9L A;  3V05 A;  4W9E A;  2WQY B;  2D10 A;  4NPN A;  1ZGU B;  3TBL D;  5IO9 A;  3RZW C;  2N7E A;  2JT4 B;  2KLG A;  4DXF A;  1YX5 B;  3BYT B;  3HVD A;  3FKY A;  4HRS A;  3NHE B;  3MC0 B;  3KYC D;  3R8B A;  1H8C A;  1SJH D;  3TUO A;  2YVC A;  4KZ0 A;  2SEB D;  4PT5 A;  1P7E A;  4WWM A;  4FHK A;  2AEH A;  2QSD A;  1WRD B;  5LXH A;  1FEH A;  2R2O A;  2KTR B;  1MVK A;  3U30 A;  2D3B A;  4YSX B;  4S0R A;  4GIV A;  3N20 C;  4EFO A;  2LUM A;  1EF1 A;  2DAF A;  2C7N B;  3V60 A;  3ZJU A;  2BF8 B;  1CQV A;  3OLM D;  1JQ4 A;  1IGD A;  2LI5 A;  1GG3 A;  2JRI B;  3APD A;  3D32 A;  1BXT A;  3C19 A;  1PFD A;  2VH2 A;  1WZ0 A;  2JUO A;  1AAR A;  3GS2 A;  4PS7 A;  2KTR A;  4AJW A;  2LHE A;  3MFG A;  2K5P A;  3U2S C;  2GBJ A;  2Y5B B;  1ZW7 A;  2WWZ A;  3P4Q B;  2V3P A;  1I7H A;  2PMV A;  1V5O A;  4ZRI A;  2FIF A;  3AB5 A;  5FK9 C;  1LGR A;  2IO2 B;  4BKG A;  4MM3 A;  3PZ7 A;  4M0W A;  3WAN A;  4AQ7 A;  1FCC C;  1YD8 U;  3NVZ A;  3BK1 A;  3U8Z A;  1OEY J;  2MRP A;  2MBE A;  1V6E A;  2BYF A;  2NR2 A;  4ZRK A;  3H8H A;  2MP2 B;  1JCK B;  4GMV A;  3HVZ A;  3Q3F A;  2ON8 A;  2NBW B;  2GBR A;  2PE9 A;  3R2T A;  3JYU A;  2K6D B;  4HDQ A;  3MJW A;  5E6O A;  1E8W A;  4HVB A;  2AQ3 B;  3TMP B;  4M0W B;  3H6N A;  5BYR A;  3VTV A;  2IGD A;  4DXA B;  3C0R B;  1YMH E;  4DBG A;  2WNM A;  1WGY A;  3WAL A;  4K1R B;  3SHQ A;  3AXC A;  3KVF B;  4K81 A;  5DPW A;  3P42 A;  2K9X A;  4DWF A;  3B9J A;  3N1Y C;  2OED A;  1JWS D;  2GI9 A;  4KSK C;  1WR1 A;  1MJD A;  3WCQ A;  3AED B;  4II3 B;  1TZ1 A;  3H7P B;  3VHT C;  3CMM B;  4RF1 A;  4WH4 A;  2O6V D;  1WI0 A;  4BKT A;  4N58 A;  1Y56 A;  2WDQ B;  4GDL B;  4ZOH C;  5KHO A;  1V5T A;  1E6E B;  2WXL A;  1UUP A;  4KDL B;  3BVZ A;  3M62 B;  3TEZ A;  4HCP B;  5JHA A;  5CX3 A;  2DYB A;  2D5G A;  1TS2 A;  2KKC A;  4HCN B;  4YT0 B;  2Z59 B;  3U7Z A;  2FBW B;  3AUL A;  4MSM B;  3R66 C;  3DVG X;  4RGN A;  2GRI A;  2QIL A;  3IG3 A;  1WGD A;  4PK1 A;  1FXI A;  4OZC A;  4ZYS A;  1N61 A;  4UDU C;  4RM9 A;  4AS1 A;  1NBF C;  1YN3 A;  1YIW A;  2O2V B;  2N1W A;  1YJJ A;  4MT5 A;  1K51 A;  4NAW A;  1C4C A;  3PRE A;  1P1A A;  1WYG A;  2QHO A;  4W9D A;  4I6N B;  2BB5 A;  2PKO A;  2IJ0 A;  1D3Z A;  1HA5 A;  1F0Z A;  3WIM A;  1F1H A;  4BBN F;  1XD3 B;  2BBC A;  2CR5 A;  2A5U A;  2BS4 B;  2FUG 1;  2HTH A;  3T9L A;  2LWP A;  2KT7 A;  3EUB 2;  2AWT A;  3HM6 X;  1YQ3 B;  3BVG A;  2KXJ A;  3EC8 A;  3KUD B;  5IA7 A;  1WXM A;  3U52 E;  4A3O A;  4ANX A;  3UF8 A;  3ZNI D;  2PEA A;  5D3D A;  3AMZ A;  3RD2 A;  3AE4 B;  2XK5 A;  2Y5P A;  3BWU D;  5AZF A;  1WRI A;  2V3N A;  2GBK A;  4FHJ A;  2CJO A;  1RRB A;  3URY A;  2WYQ A;  4FJZ A;  1WE7 A;  4E71 A;  1QOF A;  2K8B A;  3U4E G;  1D5M C;  1DOX A;  5AUI A;  2J52 A;  1VJK A;  2KDM A;  4K7S A;  4DDG D;  3U7D A;  2RPQ A;  4MAC A;  2LXC A;  4OVU A;  4B95 A;  1RLF A;  2INC C;  1NYR A;  2J0K A;  2OHF A;  3VUW A;  3ZDM C;  3QIJ A;  1I4Q A;  3Q3M C;  3NY5 A;  2UYZ B;  2O6V B;  1HTO A;  2A4Z A;  3NVW A;  4HDO A;  2JY6 A;  5LLI A;  2QJL A;  4A55 A;  1GNU A;  2D2Q A;  1QKZ A;  1SEB D;  4F8C B;  4G11 A;  1XT9 B;  2YEP B;  4C56 C;  1V81 A;  1WZ3 A;  2JYE A;  3PSE B;  2IO1 B;  2KDI A;  3DBL B;  1I4P A;  1RWS A;  2ZCB A;  1WR6 E;  5BMH A;  2NTS A;  4IM3 A;  2WXJ A;  3R7R A;  4KGS A;  2WDT B;  1OQY A;  1SE2 A;  3AE3 B;  3ZVV A;  1I4H A;  2WDR B;  1GB1 A;  1TTN A;  3FAH A;  5HHD G;  1XLP A;  2LXA A;  1KTK A;  2IDY A;  4WWP A;  2ZW1 A;  3ZTD A;  4GOC A;  3QA8 A;  1AN8 A;  1NDD A;  2ZPY A;  2KAJ A;  2V4I B;  2WXN A;  3LJ3 A;  2M19 A;  3N1X C;  3AEG B;  3H7P A;  1V49 A;  2LGD A;  1EF5 A;  2L83 A;  1JWA D;  1R4N B;  3P2B A;  4YXD B;  5GMV A;  3TCA A;  3N3K B;  1JWB D;  1OFF A;  4X57 B;  3W5V B;  1OQQ A;  3Q6B A;  2LJ5 A;  2V9H A;  2DAJ A;  2RSU A;  3DBL I;  4GB9 A;  5G55 A;  2AX5 A;  2K0P A;  2DEN B;  3MHZ A;  3N9Y C;  2D07 B;  3IAM 1;  3APF A;  2IY1 B;  3DWG C;  4M01 A;  3N32 A;  2FAZ A;  3AEB B;  1OTR B;  1UEL A;  3V6E B;  2KMM A;  2LAS A;  4N6E B;  1DYQ A;  4OVV A;  1JRO A;  1YN4 A;  2C7M B;  2HJ8 A;  4KX6 B;  4WWN A;  2KJR A;  1S3S G;  5H92 C;  3VR9 B;  2MWS B;  1VZ7 A;  1ZP0 B;  2C60 A;  2MJE A;  4ITK A;  4MGI E;  2YEP F;  1PYW D;  2BTE A;  2KYW A;  4EOY A;  1CZP A;  1YJ1 A;  1EU4 A;  3RI7 C;  3ZIM A;  4D2K A;  1V2Y A;  2G45 B;  4MGZ E;  3A9J B;  3IHP C;  3OAW A;  3VTW A;  3GE8 C;  3JVZ X;  1ROE A;  2KVZ A;  3V62 A;  1C3T A;  3BZD B;  2VZK B;  3SR6 A;  1NI2 A;  1EU3 A;  1T0S C;  2KNB A;  1J8C A;  2KC2 A;  3L16 A;  3ZGZ A;  1GAQ B;  4A9A A;  4ACF A;  4HPM B;  1HZ5 A;  2JWZ A;  3PRZ A;  1RFK A;  1M94 A;  1QF6 A;  1SF0 A;  1C4A A;  4NNJ B;  2LGY A;  2WXF A;  1XLO A;  1FXT B;  4W9J A;  1L4Z B;  2V0G A;  4GDL A;  2H88 B;  2WP9 B;  1UZX B;  4C80 A;  1TJE A;  3UQB A;  1GUA B;  5D3I B;  4B0E A;  2KJ6 A;  4IG7 B;  2LGS A;  2PLP A;  3PLU A;  4KIK B;  3RMK C;  1ZXH A;  3WAO A;  1QLB B;  5FR6 A;  2KC1 A;  2V1Y A;  5DCN A;  3IT6 B;  5DPT A;  4C4V B;  1FXA A;  4EZL A;  1D5Z C;  2IPK D;  2MP2 A;  2L0T A;  4WIP A;  5CHF A;  2AQ1 B;  1TKG A;  2O6V A;  3IFW B;  4PS8 A;  2WXQ A;  1L6V A;  3JW0 X;  3DBS A;  2ACZ B;  4LNK A;  4TSS A;  1PUT A;  3B0A A;  4G0N B;  3V3X A;  3IXS A;  4RF0 A;  2B3A A;  2YLM A;  2EMS A;  4IWO A;  1XCT L;  3KLS X;  2DZK A;  1EO6 A;  1QT9 A;  3GZN I;  4ANU A;  5IN7 A;  3VR8 B;  3MP9 A;  2N7D A;  4JGH B;  1TS3 A;  1UF0 A;  2WX1 A;  5H8Y E;  2JX5 A;  3Q3O C;  4ICU A;  4NQK E;  2I38 A;  4DK5 A;  2MHJ A;  5C1Z A;  2FUH B;  5BYS A;  1WXS A;  4IM0 A;  4URK A;  1Z2M A;  2XEW A;  3NG0 A;  2L3Z A;  3KWL A;  3P4S B;  4L23 A;  1TY0 A;  3I57 A;  5E6P A;  4XE0 A;  2MSE D;  1V86 A;  1YX6 B;  3AE7 B;  4OZB A;  3V61 A;  2W82 A;  2NPT B;  2INP E;  2BVC A;  2E6X A;  3CSF A;  1WGG A;  4P1C C;  3QHT A;  4RGM A;  1A5R A;  1G6J A;  1J7C A;  1KM7 A;  2QCZ A;  3GZN B;  4E3C A;  2ZNV B;  4WAF A;  4ANV A;  4EUT A;  1WGR A;  2V3S A;  1H4R A;  2PTL A;  2KHW B;  4WWO A;  5CTR C;  4C7Z A;  3DHI C;  4IDI A;  4JQW C;  5AUK A;  2Z0D B;  4BBN C;  3M3J A;  3E56 A;  3I63 C;  2HE7 A;  4YTN B;  2ZEQ A;  3M63 B;  2Y5C A;  5L83 A;  1WMH A;  1BML C;  3R2I A;  1T5X D;  3ZDT A;  2VRR B;  2IO3 B;  2KFJ A;  2Q5W D;  1K50 A;  4FA6 A;  2KWD A;  2AL6 A;  1I42 A;  4OZA A;  3JSV B;  1NVI D;  1OGW A;  5G5H A;  2DWQ A;  5T8I A;  3HHM A;  3T3O A;  2D3C A;  1LO5 D;  1T3Q A;  2LVO A;  4WJN A;  2HD5 B;  3L54 A;  3ZJT A;  4IKG A;  2W54 A;  1UWM A;  4IUM B;  2CU1 A;  2KMC A;  1D6E C;  2MEK A;  2L52 A;  3QJZ A;  3VVW B;  3H1U A;  5DPR A;  1J0G A;  2CS4 A;  1ZE3 D;  3PHW B;  2LZ6 A;  2XBB C; 
#chains in the Genus database with same CATH homology
 3AU4 A;  2QHO A;  4W9D A;  4I6N B;  3RYT A;  1VCB A;  4CO7 A;  2K8C A;  2REX A;  1D3Z A;  2KD0 A;  3WIM A;  4CHK A;  5D7G A;  3VAW A;  4BBN F;  2JF5 A;  1XD3 B;  4PYU A;  1WX9 A;  2CR5 A;  2A5U A;  3N30 A;  4HXD A;  1WFY A;  2HTH A;  5CHV C;  2LUE A;  4LDT B;  3T9L A;  1IPG A;  2GMI C;  3R3M A;  2LWP A;  5CHW A;  5D2M B;  4AP4 C;  4ASW C;  2K25 A;  2AWT A;  3HM6 X;  3ZUN A;  4A20 A;  3PV1 A;  2BWE S;  4NY0 A;  2KXJ A;  4J6I A;  3EC8 A;  3KUD B;  5IA7 A;  1WXA A;  1WXM A;  3RZF A;  5AZG A;  3JSV A;  4FJV B;  2CHW A;  4A3O A;  2PPH A;  1WX7 A;  2N9P C;  2MCN B;  4ANX A;  4EKU A;  2DZI A;  3UF8 A;  1MG8 A;  2NVU I;  2PEA A;  4MSQ B;  3ZNI D;  3ML9 A;  4TQ0 A;  3VXW A;  3L08 A;  3W1S A;  2N4F A;  2FCQ A;  3EEC A;  3KUC B;  2KMA A;  3RD2 A;  1UD7 A;  2XK5 A;  2DZM A;  3PRP B;  3KW5 B;  5AZF A;  2MA9 B;  2KK8 A;  2UWQ A;  2GBK A;  2L0F A;  4FHJ A;  3V6C B;  1RRB A;  1E90 A;  2J0M A;  2WYQ A;  4HWI B;  3A4R A;  4K7W A;  4FJZ A;  3QAR A;  3VUY A;  1WE7 A;  2ZJD A;  3PLV A;  4E71 A;  2K8B A;  3A9K B;  2D3G A;  2WX0 A;  2M4N A;  1P9D U;  1E8Y A;  1RFA A;  2MX2 A;  4K7S A;  4DDI D;  4DDG D;  1GJZ A;  3U7D A;  2RPQ A;  4OVU A;  2LXC A;  2AYO B;  2KN5 A;  3S2A A;  1KJT A;  1RLF A;  1WXV A;  3ZRF A;  1U4A A;  4B95 A;  2NBU A;  2J0K A;  2L00 B;  2G3Q B;  4MDK E;  3VUW A;  3ZDM C;  3A4S C;  1IP9 A;  4TQ1 A;  2BWF A;  3DVG Y;  3QIJ A;  4ZYN A;  2W9N A;  5KHQ A;  4JIO U;  3NY5 A;  1Z5S B;  3VH4 B;  3SD5 A;  4WQO B;  2UYZ B;  2O6V B;  2A4Z A;  3H7S A;  3ZNH B;  3NZU A;  4DHZ E;  2KX0 A;  2JY6 A;  4HDO A;  2J0J A;  2DHZ A;  5LLI A;  4TUU A;  4MEM A;  1WM2 A;  2ZPN A;  2KDE B;  1GNU A;  2AL3 A;  3B08 A;  3BIN A;  2D2Q A;  5J18 A;  3UQA A;  4F8C B;  2KJH B;  3DBH I;  1XT9 B;  2C5L C;  4G11 A;  4WJQ A;  1V81 A;  1WZ3 A;  4EEW A;  1Q0W B;  3A9K A;  3PSE B;  2IO1 B;  1S1Q B;  2KDI A;  1P1A A;  3W1Y A;  2ZCB A;  1WR6 E;  4GDK B;  5E6N A;  3R7R A;  3KH0 A;  3L13 A;  4IM3 A;  3WAM A;  2FCS A;  1E8X A;  2WDT B;  3IBE A;  5C23 A;  1OQY A;  1LM8 B;  3OJ4 B;  1WM3 A;  3ZVV A;  4BVU C;  4AJY B;  1L7Y A;  2DYM A;  4NJ6 A;  2JXX A;  4LJO B;  5AZH A;  4LCD E;  4N9F 4;  4BKS D;  4CYE A;  5JZE B;  1TTN A;  3ML8 A;  4G50 A;  3O65 B;  5EDS A;  2BGF A;  1SIF A;  4W9H A;  4W9F A;  2LXA A;  5BO4 B;  3PVL A;  2EKE C;  4HPL B;  4WWP A;  1WJN A;  2JRH A;  2MQJ A;  4GOC A;  2M17 A;  3QA8 A;  3ZTD A;  4WJO A;  1NDD A;  2ZPY A;  2R2Q A;  2KQS A;  4KDI C;  2DYO A;  2KOX A;  2I1J A;  1P0R A;  3ENE A;  3LJ3 A;  3VDZ A;  5L95 C;  2NCN A;  3QK0 A;  4ZDV A;  3H7P A;  1V49 A;  2LGD A;  1EF5 A;  3NS8 A;  1EUV B;  3ZW3 A;  2GOW A;  3W1S C;  3P2B A;  5AEK B;  5GMV A;  2K1F A;  4JLC A;  3PT2 B;  3DCG A;  3N3K B;  3TCA A;  4X57 B;  2N9X A;  3QCA A;  4GSW A;  2LVQ A;  3UGB B;  3VTU A;  2IBI B;  3HK0 A;  2LJ5 A;  3H9D A;  2Z0E B;  3R7Q A;  1J19 A;  4FN2 A;  4A3P A;  2K6Q A;  1R4M I;  4DHJ D;  4TKN A;  2DAJ A;  2RSU A;  3DBL I;  4RM8 A;  2LRW A;  3QQ8 B;  2IYD B;  2FCM A;  4GB9 A;  4NJ7 A;  5G55 A;  3ZO5 B;  3WA0 A;  2DX5 B;  3CF6 E;  4I6P A;  4E74 A;  2L05 A;  3KUZ A;  3ZNZ B;  3PHX B;  2DEN B;  3B1L X;  4LDT D;  5J2R A;  2PE6 B;  2D07 B;  1KLV A;  1JRU A;  4II2 B;  4B6W A;  1TGZ B;  2N1V A;  1VD2 A;  3NOB A;  1LXD A;  3APF A;  4HK2 A;  2IY1 B;  1ISN A;  2IO0 B;  2L8J A;  2IY0 B;  3N32 A;  2FAZ A;  2KFK B;  2I1K A;  3LDZ E;  1OTR B;  1UEL A;  4F1S A;  3V6E B;  2K8H A;  3M95 A;  2K39 A;  2MBO A;  2LAS A;  4K7U A;  4WAA A;  3X23 A;  3I3T B;  4IWP A;  2JVC A;  4IWQ A;  1UGM A;  4NQL B;  3PS6 A;  3ZLZ A;  2MW5 A;  2C7M B;  2C9W B;  4FUL A;  4MJS B;  2HJ8 A;  2LRU A;  4OVV A;  1E5W A;  3RUL A;  3K9P B;  1PQS A;  3PGE A;  4WWN A;  2KJR A;  1E8Z A;  4GGQ A;  1WH3 A;  1S3S G;  2ASQ A;  5IAA C;  1YQB A;  2MWS B;  2C60 A;  4MGI E;  2FID A;  4W9L A;  2ZCC A;  3ALB A;  4W9E A;  3DBR I;  2PJH A;  4EOY A;  3IVF A;  2D10 A;  4NPN A;  1ZGU B;  3MTN B;  3TBL D;  1YJ1 A;  4ICV A;  4M8M A;  3RZW C;  2KTF A;  2N7E A;  3ZIM A;  2JT4 B;  3UIN B;  1V2Y A;  2KLG A;  2OJR A;  4IM2 A;  1YX5 B;  2G45 B;  1WJ4 A;  3DPD A;  4KZC A;  4MGZ E;  3A9J B;  2M8S A;  3IHP C;  3OAW A;  3TJP A;  2MBQ A;  4HLE A;  3PRM B;  3NHE B;  2LGX A;  3VTW A;  1WE6 A;  4MGY E;  3JVZ X;  1L2N A;  3KYC D;  1H8C A;  3V62 A;  4KSL C;  2JZZ A;  5JHB A;  1WIA A;  4KV2 A;  1C3T A;  2D11 A;  3L10 B;  3A1Q A;  1R4N I;  3EHV A;  3A9J A;  3A33 B;  1NI2 A;  2KNB A;  3ONS A;  3KYD D;  2YVC A;  4KZ0 A;  1J8C A;  1F9J A;  2L76 A;  2KC2 A;  2XK5 B;  3L16 A;  2CHX A;  4FHK A;  2AEH A;  4HPM B;  2JWZ A;  3PRZ A;  3PPA A;  1WRD B;  5LXH A;  1M94 A;  2KWV B;  2R2O A;  3APC A;  2KTR B;  4ZRJ A;  4WJP A;  3U30 A;  4W9K A;  4BFR A;  3DQV A;  4NNJ B;  2LGY A;  1CMX B;  2NBV B;  3UIP B;  4FLH A;  4XC2 A;  3ZKJ C;  1IYF A;  1FXT B;  2MLB A;  4XX5 A;  2MBB B;  4GN1 A;  4LJP B;  3RT3 B;  3A1Q B;  4W9J A;  3DOW A;  3ZNG C;  2G4D B;  1WX8 A;  4GIV A;  4GDL A;  2KDB A;  1UZX B;  2RD0 A;  4EFO A;  2C7H A;  4GDK A;  2ZNV C;  1EF1 A;  2BKF A;  3UQB A;  2DAF A;  2C7N B;  3VFK A;  4EZK A;  1GUA B;  3V60 A;  2FNJ B;  2KJ6 A;  5D94 A;  2BF8 B;  3PLU A;  2BKR B;  3OLM D;  2M1M A;  4IG7 B;  4KIK B;  1UH6 A;  2N9E B;  3WAO A;  3PZD A;  3RUI B;  5FR6 A;  3ZDT A;  1LQB A;  2KC1 A;  3L17 A;  4MEL A;  2LI5 A;  1GG3 A;  2JRI B;  2V1Y A;  3APD A;  3D32 A;  3NZS A;  5DCN A;  2L7R A;  2JZ3 B;  2CHZ A;  5DPT A;  4ANW A;  1WZ0 A;  2JUO A;  3EFU A;  1AAR A;  3HIZ A;  4EZL A;  4RMA A;  1SGH A;  4EZJ A;  3MHS D;  4PS7 A;  2MP2 A;  2L0T A;  2KTR A;  4AJW A;  2ZVN A;  2OOB B;  1UBQ A;  5CHF A;  2KQ7 A;  4FAD A;  1Q5W B;  3GOE A;  1QZE A;  2O6V A;  3IFW B;  4PS8 A;  4DHJ B;  4FBJ B;  3JW0 X;  3QC8 B;  2GBJ A;  3DBS A;  4TV3 A;  2Y5B B;  1ZW7 A;  3VQI A;  2WWZ A;  3TIX A;  3B0A A;  1V9J A;  4KVG B;  4G0N B;  3AI5 A;  4W9G A;  1UBI A;  3RCZ A;  2JPH A;  2B3A A;  1V5O A;  2YLM A;  2EMS A;  4ZRI A;  2FIF A;  4IWO A;  3DDC B;  5JH5 C;  2IO2 B;  4BKG A;  4MM3 A;  2DZK A;  1EO6 A;  3Q3J A;  3GZN I;  3HM3 A;  3AU5 A;  4ANU A;  1WJ6 A;  2N7D A;  3ECI A;  3X0W A;  1WMH B;  3WAN A;  4JGH B;  2GBM A;  2WX1 A;  1YD8 U;  2GBN A;  3CST A;  4ICU A;  4NQK E;  3U8Z A;  3DVN U;  1OEY J;  4W9I A;  5LXI B;  3UIO B;  2MRP A;  1WJU A;  1GC7 A;  2KWU B;  2MBE A;  3WAP A;  4BOZ B;  4DK5 A;  1V6E A;  5C1Z A;  3ZTC A;  2BYF A;  2FUH B;  2NR2 A;  4ZRK A;  2MP2 B;  1WXS A;  4MGK E;  4IM0 A;  4URK A;  1Z2M A;  2XEW A;  4M8N A;  1HE8 A;  2LD9 A;  4GMV A;  2V4L A;  2L3Z A;  4NAW B;  3K9O B;  3SU8 X;  3Q3F A;  5E6P A;  3QAQ A;  4AOF A;  2MSE D;  2NBW B;  2O2V A;  4W9C A;  2GBR A;  2PE9 A;  4JL9 A;  4AWJ A;  4F7Z A;  1V86 A;  1YX6 B;  3DVN V;  5D6J B;  3JYU A;  2K6D B;  1P3Q U;  1RAX A;  1LFD A;  4HDQ A;  3V61 A;  4I6L B;  2ZVO A;  2NPT B;  3MJW A;  5E6O A;  1E8W A;  3CSF A;  4FJY A;  4HVB A;  1WGG A;  2NS5 A;  4B9K A;  1KOT A;  3QHT A;  3TMP B;  1T0Y A;  4M0W B;  5DPS A;  1A5R A;  2DZJ A;  3H6N A;  2G4S A;  2RR9 A;  1G6J A;  1KM7 A;  3VTV A;  4DXA B;  1XQQ A;  1I35 A;  3C0R B;  4E3C A;  2ZNV B;  4DBG A;  1WF9 A;  1WGY A;  3WAL A;  4K1R B;  3SHQ A;  2MBH A;  2BYV E;  3PTF C;  4BKS A;  4ANV A;  3AXC A;  3KVF B;  4K81 A;  4EUT A;  5DPW A;  1P98 A;  2KFK A;  1WGR A;  4KIK A;  2V3S A;  2KWC A;  1H4R A;  4DHZ B;  1Q1O A;  1Y8R C;  4DWF A;  1WY8 A;  1BT0 A;  2KHW B;  4HJK A;  4WWO A;  5CTR C;  1E7U A;  2FCN A;  2BPS A;  4KSK C;  2NPT A;  1WR1 A;  3QWZ B;  2M0X A;  4JQW C;  4II3 B;  1TZ1 A;  4IW0 A;  4PYZ A;  5G2N A;  3H7P B;  3VHT C;  3CMM B;  2O6V D;  1WI0 A;  4BKT A;  2Z0D B;  2BYE A;  4BBN C;  3M3J A;  3QX1 A;  4GDL B;  1WYW B;  2HE7 A;  2KO3 A;  2KLC A;  3L0W B;  2KX3 A;  4MH0 E;  2ZEQ A;  3M63 B;  3T8M A;  4YL8 A;  5KHO A;  1V5T A;  4PS3 A;  2KVR A;  1C1Y B;  4IC7 B;  5L83 A;  1WMH A;  3OJ3 A;  1K8R B;  2ZZP B;  4GU2 A;  2IO3 B;  2KFJ A;  2VRR B;  3VH3 B;  3M62 B;  1E7V A;  2KDF B;  1GC6 A;  4KDL B;  4FA6 A;  4HCP B;  4BOS C;  2AL6 A;  5JHA A;  5CX3 A;  2EMT A;  1I42 A;  1X1M A;  2DYB A;  3JSV B;  2KAN A;  1OGW A;  2KKC A;  2IZV B;  5TR5 A;  4HCN B;  2Z59 B;  3HHM A;  3VUX A;  1WGH A;  3AUL A;  1SE9 A;  4MSM B;  3ZRC A;  3R66 C;  3DVG X;  3TL5 A;  4GXB A;  3IG3 A;  2LVO A;  4WJN A;  2HD5 B;  3L54 A;  1WGD A;  4G3X B;  5J17 A;  4IUM B;  1TBE A;  2CU1 A;  2KMC A;  4RM9 A;  1NBF C;  4MJS A;  2J7Q B;  1YIW A;  2LVP A;  3QJZ A;  3VVW B;  2O2V B;  3BY4 B;  3H1U A;  2N1W A;  5DPR A;  3SDL C;  4XZ4 A;  1OEY A;  1J0G A;  1ZKH A;  1V80 A;  4AUQ C;  5HKH A;  2KZR A;  2RGF A;  2CS4 A;  2CKH B;  4NAW A;  4P7I A;  3PRE A;  3PHW B;  2LZ6 A;  2XBB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...