2KFKA

Solution structure of bem1p pb1 domain complexed with cdc24p pb1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
b'PHMKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bud emergence protein 1
publication title NMR structure of the heterodimer of Bem1 and Cdc24 PB1 domains from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 10
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kfkA00
2K8HA 2I1JA 2J0MA 1NBFC 2KZRA 2KMCA 1VD2A 2CU1A 3QQ8B 1KOTA 3VUWA 2MLBA 2KFKB 5CHVC 3DBRI 4X57B 5J17A 2ZPYA 3N30A 3RT3B 4E74A 4FADA 1OTRB 2MBHA 4W9KA 2YVCA 2XBBC 4ANUA 1WJ4A 3PLVA 2KOXA 2KJHB 4AWJA 2Z0EB 1WRDB 5DCNA 3T9LA 3KH0A 2G4DB 5CX3A 3DBHI 5C1ZA 2OOBB 4MELA 4ASWC 3VHTC 4M8MA 1PQSA 1U4AA 1Z2MA 3H7PA 1WGGA 1WXAA 4IUMB 2LGDA 3SD5A 3A9KB 5G55A 2BYVE 2MRPA 2LRWA 2LZ6A 2K8BA 2MA9B 4J6IA 2JRIB 1J19A 3N3KB 4MJSB 2ZCCA 2KJRA 2CKHB 2BGFA 2NR2A 1KJTA 2KDIA 3N32A 5IA7A 2L76A 3PT2B 5AZGA 4HK2A 1E7UA 1L7YA 2ZPNA 2BKRB 3TIXA 2W9NA 1BT0A 3WAOA 2WDTB 1A5RA 5IAAC 4W9HA 3A1QB 1IPGA 2LVOA 4ZYNA 1WE7A 4G0NB 1J8CA 2LGXA 3IFWB 3NY5A 1WIAA 1SIFA 4MSQB 3RUIB 5DPTA 1IP9A 2JUOA 2LASA 1V49A 3UF8A 4NAWB 1E8WA 3TBLD 4IWQA 3RD2A 2IO3B 5D6JB 2M17A 2G3QB 4GDKA 1WX7A 3T8MA 2LXCA 1X1MA 4RM8A 3OAWA 2ZZPB 2O6VB 2O2VA 2Z0DB 4CYEA 2J7QB 2N9EB 1NI2A 2GBMA 2IBIB 2K6DB 2NCNA 4NNJB 4MH0E 3ZRFA 3QCAA 1EF1A 3PHWB 4ZRKA 2FAZA 4BBNC 3JSVB 4NQLB 1Q0WB 5CTRC 3CSTA 2CHZA 1K8RB 3VDZA 1XQQA 3K9OB 4YL8A 2JZ3B 3WANA 2RPQA 2O6VA 3OLMD 5L95C 2XK5B 3UGBB 2IY0B 2BYEA 3PGEA 2NS5A 4NJ6A 3W1SA 4A3OA 5HKHA 2LXAA 4EZLA 1LM8B 2C7NB 2C7MB 1D3ZA 2KX3A 2EMSA 4FJZA 4IWPA 4FA6A 2IZVB 2V1YA 3Q3JA 2C5LC 3KVFB 1TZ1A 4MGIE 2GBNA 4IG7B 4MEMA 3JVZX 2V4LA 2HJ8A 4K81A 1ISNA 1P3QU 2HD5B 2KANA 3UIPB 2NBWB 3AULA 3PLUA 3HIZA 1KLVA 4MGZE 4DHZB 5J2RA 5JH5C 4AUQC 2REXA 1I35A 2DAJA 3M95A 4HPMB 4ZRJA 3QA8A 2KMAA 4CO7A 3VTVA 2KN5A 4EUTA 2N7EA 3A4RA 4IM3A 4IM0A 5E6OA 3QC8B 2Y5BB 3JYUA 4FHKA 2DYMA 3ZNZB 4KDLB 3KUCB 2AL6A 1WR1A 1E8XA 2MBBB 2JY6A 3B08A 1WMHA 2G4SA 4DHJB 2IO1B 2PJHA 2EMTA 3Q3FA 4XX5A 3WALA 4KIKB 2BYFA 2CR5A 3NHEB 4W9LA 1P98A 2XEWA 4N9F4 1I42A 2CHXA 2ZVNA 1UBQA 4FLHA 1V5OA 1J0GA 3HHMA 1WGYA 2FCSA 2MBEA 4BKSA 2A4ZA 1WY8A 2K25A 4K7WA 4XC2A 3I3TB 4LJOB 3O65B 2AWTA 3V6CB 1ZW7A 1LFDA 2R2QA 3DVGY 1WXMA 2L8JA 2RGFA 2D11A 3DPDA 4GU2A 5G2NA 3P2BA 3APFA 2KFJA 4KVGB 3TL5A 1V6EA 1M94A 1F9JA 4HJKA 2K8CA 1H4RA 4K7SA 4IWOA 2CS4A 2GMIC 5KHQA 3EFUA 2DAFA 4EEWA 2KDEB 2G45B 1R4MI 2LGYA 3L08A 5LLIA 3HM3A 4WJOA 2PE9A 1WM3A 3LJ3A 4FJYA 2RSUA 3R7QA 3NS8A 4I6LB 3RYTA 3ZIMA 2L05A 4GSWA 2WX0A 3DVNV 4EKUA 5J18A 3DCGA 3UIOB 2KFKA 2C60A 3A9JB 4I6NB 1HE8A 2N7DA 2D3GA 4P7IA 1WX8A 4E3CA 3VH4B 4M8NA 4GGQA 2M8SA 3ZW3A 2JWZA 3EECA 2N1WA 1T0YA 3L17A 3AU4A 3DBSA 2JF5A 4HDOA 1WXSA 3M62B 4JIOU 4WWOA 3A9JA 4WWNA 2N4FA 2DHZA 4DDGD 1C1YB 2ASQA 4EZJA 1QZEA 2K1FA 4RMAA 3TCAA 4BOZB 1WJ6A 3DVNU 3ZTCA 4KSLC 3NZUA 3A9KA 5DPRA 3ZUNA 4GXBA 4DDID 2JZZA 3DVGX 2L00B 2Z59B 5CHWA 1Q5WB 1Q1OA 4MJSA 2MQJA 3KUZA 5E6NA 1E90A 1V5TA 1WM2A 1IYFA 2KDFB 4NY0A 4BKTA 4F8CB 3RZFA 4ZDVA 3PTFC 2IYDB 3PZDA 5DPWA 2MCNB 3CMMB 2NBVB 4JLCA 2ZEQA 2HTHA 3RCZA 3ZNID 1EUVB 4FN2A 2J0JA 3SU8X 3KYDD 3GOEA 3A1QA 5D2MB 3QK0A 1YX5B 3KUDB 3PS6A 3ZO5B 4GOCA 2KLGA 1E5WA 2FIDA 4OVUA 4NAWA 3W1YA 4E71A 1WZ3A 4FHJA 2UYZB 4WQOB 4ZRIA 1L2NA 4AJYB 1R4NI 3D32A 1AARA 1WGDA 1WJUA 2KTRB 1TTNA 1WJNA 1LXDA 2BKFA 1OQYA 3JSVA 2ZCBA 2I1KA 5L83A 2D2QA 2KWVB 4KDIC 2KJ6A 2N1VA 1UZXB 1P9DU 4EOYA 3V6EB 2XK5A 2M0XA 4LCDE 4GDLB 3QIJA 2MBQA 3TMPB 1WXVA 4BOSC 4BFRA 1CMXB 2KC2A 3V62A 3SHQA 3H6NA 4AP4C 5JHBA 2M4NA 3X23A 3VXWA 3AI5A 3MJWA 2LWPA 3VTWA 2DYBA 4TKNA 3KW5B 4W9JA 1ZKHA 2KD0A 3A33B 2BPSA 4G50A 4KSKC 2YLMA 3DOWA 3QJZA 4W9IA 1WGHA 2KKCA 1RLFA 2KVRA 2EKEC 1P0RA 1EF5A 2IO0B 2IY1B 3QWZB 4K7UA 3R7RA 3V60A 4DWFA 3U8ZA 3PREA 2FCMA 4HXDA 3WAMA 4M0WB 3DDCB 4W9EA 4WAAA 2ZVOA 4ANWA 1KM7A 2K6QA 5CHFA 1RFAA 3PSEB 3VH3B 4EFOA 4NJ7A 2JPHA 2MP2B 3DQVA 4HCPB 2ZNVC 2KQSA 2JVCA 3PHXB 1GNUA 2QHOA 4LJPB 4BVUC 2GOWA 4WJPA 4KIKA 3VVWB 3M63B 3VUYA 2KQ7A 2LVQA 4KV2A 4W9GA 4JL9A 3ML8A 2NPTB 1WYWB 2GBKA 2WYQA 4AOFA 4F1SA 2KK8A 4ICUA 3C0RB 2B3AA 3H1UA 2GBJA 2KWUB 4II2B 3ML9A 2LRUA 4HCNB 2D07B 3QAQA 2J0KA 2N9XA 5AZHA 2BWES 1E7VA 1RRBA 3VQIA 2LVPA 4IW0A 2KNBA 4HLEA 5E6PA 4MDKE 3ZLZA 4W9DA 2KXJA 2MWSB 2UWQA 3L54A 5AEKB 1WFYA 3SDLC 4B95A 3VUXA 1WF9A 3ZNGC 4F7ZA 1V80A 2AYOB 2VRRB 2PPHA 2KX0A 4RM9A 1WR6E 4PS7A 4B6WA 4LDTD 1YD8U 2PEAA 4FBJB 2MBOA 2HE7A 2KHWB 2RR9A 4ANXA 3MHSD 5AZFA 1P1AA 1EO6A 3PRMB 4CHKA 2MX2A 1S1QB 3CF6E 2GBRA 4GMVA 4B9KA 3UQBA 1YIWA 4HWIB 3W1SC 3EC8A 3HM6X 2M1MA 3L0WB 1VCBA 2C7HA 3ENEA 4JGHB 3H7PB 3JW0X 5BO4B 1ZGUB 4PYZA 4URKA 1S3SG 3NOBA 4W9FA 2V3SA 4GN1A 3M3JA 2JT4B 1SGHA 1UGMA 1OGWA 3B0AA 3U7DA 5DPSA 4W9CA 1V81A 1Z5SB 3QX1A 2LD9A 2ZNVB 1TBEA 2DZIA 4PYUA 3WIMA 1XD3B 3DBLI 2DZKA 4GIVA 2KTFA 5GMVA 3APCA 4G11A 2OJRA 2BF8B 4EZKA 2C9WB 2DZMA 5FR6A 4A3PA 4NPNA 1GG3A 4MGKE 4OVVA 2DENB 1XT9B 3X0WA 2A5UA 1MG8A 3PRPB 3ZKJC 3ZTDA 2WX1A 4HPLB 3NZSA 4ANVA 2L7RA 2JRHA 4WWPA 2DX5B 2KDBA 2PE6B 1V9JA 2FUHB 3V61A 4KZ0A 4I6PA 1WX9A 4DK5A 2L3ZA 1GJZA 4GDKB 4TV3A 3ZVVA 3RZWC 3QHTA 3L16A 1JRUA 1OEYA 2O2VB 2KLCA 3EHVA 4IC7B 2LJ5A 1RAXA 3IVFA 3PV1A 4FULA 1UH6A 4AJWA 1WE6A 2L0FA 1YX6B 3BINA 3OJ3A 4HVBA 2LUEA 2MW5A 5TR5A 3ZRCA 3VTUA 4GB9A 1E8YA 5KHOA 4K1RB 3VFKA 5D94A 1GUAB 2N9PC 1FXTB 2R2OA 5JZEB 1LQBA 3QARA 2KTRA 3ZDTA 2AEHA 2D10A 2NBUA 3H7SA 3ONSA 3ZDMC 1WH3A 3IBEA 3R3MA 2RD0A 3KYCD 3HK0A 3TJPA 4G3XB 5LXHA 3AU5A 1SE9A 2KO3A 2K39A 1UBIA 4TQ1A 1YQBA 1C3TA 3GZNI 2WWZA 4DBGA 4PS3A 2O6VD 5LXIB 4DXAB 2JXXA 1V86A 3ZNHB 4GDLA 5D7GA 2FCNA 3UQAA 1OEYJ 4WJQA 2IO2B 2FCQA 3L13A 1WGRA 3L10B 2CHWA 4MSMB 2AL3A 4JQWC 3BY4B 1UD7A 4BKGA 4FJVB 2DZJA 2FNJB 1WZ0A 3OJ4B 1WMHB 3RULA 3IG3A 1Y8RC 2FIFA 2NVUI 4TQ0A 3MTNB 3H9DA 4MGYE 2L0TA 4II3B 3A4SC 2MSED 2BWFA 1G6JA 4A20A 2LI5A 4IM2A 4BBNF 3ALBA 3WA0A 1NDDA 1YJ1A 4DHZE 2MP2A 3WAPA 3R66C 1GC7A 5JHAA 1V2YA 3B1LX 2ZJDA 4KZCA 1H8CA 3AXCA 2KWCA 3PPAA 3IHPC 3UINB 4LDTB 1WI0A 3LDZE 2NPTA 4WJNA 1GC6A 1UELA 3K9PB 1E8ZA 2DYOA 3ECIA 3PRZA 4BKSD 4DHJD 4NQKE 3VAWA 3U30A 5C23A 4PS8A 4XZ4A 3S2AA 3CSFA 3PVLA 4HDQA 1TGZB 4ICVA 4TUUA 4MM3A 2KC1A 3APDA 5EDSA
chains in the Genus database with same CATH superfamily
1NBFC 3FILA 3N1ZC 1IUEA 2MLBA 2KFKB 1F77A 3DBRI 4X57B 5J17A 1STEA 2YVCA 2R61A 3Q3NC 1WJ4A 4GLSC 4AWJA 2Z0EB 3GZNB 2WXOA 2OEDA 4OZCA 1XO3A 2B76B 1PQSA 1WXAA 4IUMB 1YNTE 4C7YA 2BYVE 3AM9A 3VRBB 3T3OA 2PMVA 2KJRA 3R2IA 2CKHB 2BGFA 2NR2A 2KWDA 2KDIA 1SB3C 3RNBC 3Q8AA 1QKZA 3TIXA 2D3CA 3WAOA 1PUTA 1J8CA 2LGXA 1WIAA 4MSQB 3RNFC 5DPTA 1V49A 3RD2A 4K3BA 3T8MA 3AB5A 1X1MA 3OAWA 2O6VB 3N1XC 2INNE 2N9EB 2GBMA 2D5GA 3IT4B 3QCAA 4ZRKA 2CHZA 2JZ3B 4LNNA 3UGBB 1J7CA 5HKHA 4B0MA 1LM8B 3AEDB 1D3ZA 3TUOA 3AE5B 3KVFB 3BYYB 4MEMA 2HD5B 2KANA 3PLUA 1KLVA 2QDFA 3Q6BA 2D3AA 4AUQC 3ZQ4A 1I35A 3DBHB 1N63A 4ZRJA 2KN5A 1KLUD 3A4RA 3QC8B 2Y5BB 1SSNA 3JYUA 2GB1A 1BMLC 3KUCB 4P1CC 2XNAC 2JY6A 1WMHA 2EMTA 3Q3FA 4W9LA 1P98A 4M02A 2ZVNA 1JALA 1J0GA 1WGYA 1NVID 1WY8A 4K7WA 4XC2A 2AWTA 3LXFA 3V6CB 1SBBB 3DVGY 1WXMA 4WIPA 3NZ3A 3TL5A 1M94A 4HJKA 2K8CA 4IWOA 4JX1C 2GMIC 2KYWA 4WAFA 1L0YB 3J9CA 4OZAA 1ZDVA 2LGYA 3L08A 3HM3A 4REZA 2E3TA 3R7QA 1EWCA 3RYTA 3ZIMA 3AE6B 2L05A 1OFFA 2WNMA 2KFKA 3A9JB 4YWGG 2D3GA 4A9AA 4E3CA 3MC8A 4M8NA 1T0YA 3DBSA 2JF5A 4WWOA 4JIOU 4WWNA 1ZE3D 3KQ4A 1C1YB 2ASQA 1F52A 3PZ7A 1QZEA 1WJ6A 4KGRA 4N58A 2WP9B 1EU4A 1JWBD 3KUZA 5E6NA 1E90A 5C3JB 1WM2A 2YEPB 4RGTA 1IYFA 2KDFB 2JX5A 4C4VB 3URYA 2ZEQA 2HTHA 2QSDA 2BW2A 3QK0A 1YX5B 3KUDB 3PS6A 2KAJA 2UYZB 4ZRIA 3D32A 1AARA 4A8XC 2J42A 2W3RA 3VR9B 2KTRB 1OQYA 4A6QA 3IAS1 1VZ6A 2WXLA 4EOYA 2ONQA 2M0XA 2K5PA 3LB8C 1I4QA 4BOSC 2KC2A 2RDBC 3N20C 5JHBA 3ZJTA 2M4NA 3VXWA 2BYTA 3NJTA 3VTWA 2DYBA 4TKNA 3KW5B 2KD0A 1TS5A 4OZBA 3DOWA 3W9CB 1N5XA 3U4EG 4K7UA 4IDIA 2Y5CA 3V60A 1HXYD 3BVGA 4W9EA 2K6QA 1RFAA 3RFZB 2AQ1B 1JWUD 5AUIA 4WJPA 5BYSA 3VUYA 2KQ7A 4KV2A 3ML8A 3C0RB 2BS4B 2GBJA 4II2B 2LRUA 4HCNB 2N9XA 2BWES 5TSSA 4YSYB 1JRPA 1E7VA 1RRBA 2LVPA 1JWMD 2KNBA 2ZW1A 3Q8BA 4W9DA 2MWSB 5AEKB 3Q8CA 1C4PA 1HZ5A 1WF9A 5FK9C 1V80A 2KX0A 3OG5A 3P63A 4KGTA 4LDTD 4FBJB 2MEKA 2KHWB 2QMTA 1PGBA 2J52A 4B9KA 4JGHB 3AE8B 3H7PB 3JW0X 1LO5D 3NOBA 4GN1A 5JXVA 2Q5WD 1UGMA 1OGWA 3U7DA 1V81A 3QX1A 1YN3A 2ZNVB 1TBEA 2DZIA 4USAA 2DZKA 4GIVA 2KTFA 1TIFA 3APCA 4G11A 2OJRA 2C9WB 2DZMA 5FR6A 4A55A 2DENB 4O1NA 2KACA 1ENFA 3V3XA 1YN4A 1TT5B 3DHHC 4ANVA 2JRHA 1C78A 1JW9D 2QC8A 3FAHA 4DK5A 1D5ZC 3RNAC 4GDKB 1BXTA 3RZWC 3C8YA 2H89B 2BS3B 4S0RA 1RAXA 3PV1A 1ZDXA 1NYQA 4KX6B 2LUEA 3DHIC 3I57A 2E6XA 5KHOA 5JZEB 1HEZE 2KTRA 3ONSA 3ZDMC 3R3MA 2QEJC 2RD0A 2KO3A 1C3TA 1UGJA 2Z8LA 4PS3A 1FIQA 3BZDB 1V86A 2IGGA 3ZNHB 4WJQA 1I4XA 1WGRA 1N60A 2CHWA 1OQRA 1E6EB 2LGIA 2W82A 4YXDB 1WZ0A 3OJ4B 2FIFA 3H9DA 4RCOA 2L0TA 3DBLB 2WXRA 3AECB 3ALBA 1NDDA 1GC7A 3IT6B 3PPAA 2D3BA 2BT6A 3LDZE 4WJNA 3K9PB 1UELA 2MHJA 2K22A 3PRZA 4BKSD 4NQKE 5I4DA 3U30A 2W3SA 4K3CA 2HDEA 3S2AA 1NEKB 4TUUA 3MP9A 5EDSA 5MPOA 1J7AA 3Q14C 2K8HA 2I1JA 2J0MA 3HVDA 2IJ0A 3TEZA 1P7EA 3E56A 3C19A 1KOTA 3VUWA 2WGSA 1QT9A 4LK0M 1FXIA 5CHVC 3N1YC 3N30A 3RT3B 4C7ZA 4P16A 4YT0B 1R7SA 2JU6X 3PLVA 2QCZA 2NTSA 5DCNA 2G4DB 5CX3A 1SIJA 2OOBB 1K53A 5GXGB 4ASWC 3H7PA 2FBWB 2LGDA 1YJIA 4NJCA 1L5PA 3SD5A 3A9KB 2LRWA 2YEPF 4C56C 5IA7A 4BZAA 1P7FA 5AZGA 3VR8B 1GB4A 2OHFA 2BKRB 3RPFC 2SEBD 1BT0A 3AMZA 1A5RA 1D5MC 2LVOA 2H88B 4HKZE 1SIFA 3UF8A 3TBLD 1E8WA 1CQVA 2Y3AA 4GDKA 4RM8A 1YMHE 2ZZPB 4D2KA 1ESFA 2Z0DB 2WDVB 1V1PB 4NNJB 2K6DB 1EF1A 1VZ7A 3RNCC 4NQLB 3CSTA 3Q3MC 1K8RB 3VDZA 3P42A 2VH1A 2RPQA 4RGMA 5L95C 2XK5B 3PGEA 4RFBA 3W1SA 1PGXA 2KX3A 2C5LC 1TZ1A 2GBNA 3AEEB 2I2YA 2M56B 1FM0D 3AULA 1UF0A 3HIZA 1DYQA 3NVWA 4XGAB 4N59A 4EUTA 4IM3A 3PO0A 3T3NA 1FPYA 4JE3B 2DYMA 2AL6A 2MBBB 2G4SA 4DHJB 2IO1B 2K0PA 3SFDB 4XX5A 3WALA 2CR5A 1RYJA 4KKIA 1KF6B 1I42A 1QOFA 2CHXA 4WURA 1FNVA 4BKSA 2K25A 2QIEB 4LJOB 4HKQA 3O65B 1ZW7A 1LFDA 2RGFA 5G2NA 3APFA 1V6EA 1Y56A 3EFUA 2KDEB 1R4MI 5LLIA 1FMAD 4WJOA 2PE9A 4R3DA 1WM3A 3NS8A 2WXFA 1ZXHA 5D3IB 4IOIE 3GE8C 1ACCA 1QLBB 5J18A 2C60A 4I6NB 1HE8A 1PDXA 3Q69A 4P7IA 1WX8A 3VH4B 4HDOA 3AE1B 2JSVX 3SR6A 2K1FA 1T0SC 4RMAA 3ZTCA 4BAXA 1L4DB 4KSLC 3A9KA 5DPRA 4GXBA 2JZZA 3DVGX 5CHWA 2CU3A 4C00A 1V5TA 4BKTA 4F8CB 3RZFA 4P1BC 1XCTL 1TKGA 1F1HA 4OVZA 5DPWA 2MCNB 4JLCA 1MPEA 1L6UA 1SEBD 3ZO5B 4GOCA 3RMKC 2W54A 4OVUA 3AE4B 4FHJA 1SE3A 2KT7A 1R4NI 1V1PA 5G5GA 4RGNA 1LGRA 2BKFA 2ZCBA 5L83A 2D2QA 4XYCA 2KJ6A 2HTME 3V6EB 2XK5A 4MT5A 1KLGD 2LJIA 4GDLB 3TMPB 1WXVA 3SHQA 4AP4C 3AI5A 1ZKHA 3B2GA 3B9JA 2BPSA 4JWUC 2I38A 2YLMA 2VZKB 3CWIA 2KKCA 2EKEC 4P6VF 2MJDA 4ZOHC 1XXGA 2IO0B 3U8ZA 3PREA 3AEGB 1QILA 3WAMA 3DDCB 4ANWA 2JYTA 5IP4D 1KM7A 3VH3B 2VZKD 3GS2A 4EFOA 2JPHA 2MP2B 3DQVA 3RI7C 4ZHPA 2ZNVC 4MH8A 2RPVA 2TSSA 2LVQA 4JL9A 2NPTB 1WYWB 4AOFA 4F1SA 2KK8A 2KWUB 4M00A 2DWQA 1N61A 1FFUA 1I7HA 4XE0A 3IAM1 4IW0A 4Q2JA 1FCLA 3ZLZA 3L54A 2BVCA 1WFYA 1QOAA 2PPHA 2INCC 3NUHB 1C76A 1WR6E 2FE8A 1NI3A 3AEBB 2RR9A 3TEWA 3MHSD 4NZLB 4YTPB 5AZFA 1P1AA 1EO6A 2ACZB 2MX2A 3TEYA 2GBRA 3BK1A 3P4PB 3ZGZA 3UQBA 1YIWA 4HWIB 3W1SC 2M1MA 3ENEA 2PTLA 4URKA 2RDHA 4TMAB 1JMLA 1T0RC 5DPSA 1AW7A 1Z5SB 3WIMA 3DWGC 2IGDA 4EZKA 5FR3A 4A3PA 1SF0A 4MGKE 1VJKA 3TEXA 1XLNA 2PVGC 1MG8A 3PRPB 3ZKJC 2WX1A 3NZSA 1SE4A 4WWPA 2LGSA 1V9JA 1WX9A 4XWTA 3QHTA 1YQ4B 3L16A 1FRRA 2O2VB 2VH2A 2KLCA 4FULA 3SFEB 4AJWA 1WE6A 1YX6B 3OJ3A 1HA5A 1HTOA 2MW5A 5TR5A 3ZRCA 1MG4A 4TSSA 1E8YA 4RH6A 4K1RB 1I4HA 1LQBA 3QARA 2EELA 2NBUA 3VRAB 3IBEA 2IPKD 2RMMA 3KYCD 1WYGA 5FKAC 2UU7A 3GZNI 1AWDA 2WWZA 3RNGC 3WCQA 5LXIB 2MH7A 4GDLA 5D7GA 1L6VA 5BMIA 1XLQA 3GP7A 3ABVB 3UQAA 4AS1A 1OEYJ 3R8BA 4LNKA 4MSMB 1TY2A 3AE9B 4JQWC 1TJEA 4BKGA 4IKGA 2WU2B 3W5UB 1T3QA 1CK1A 4TQ0A 3MTNB 2LUMA 4MGYE 4II3B 2MSED 1G6JA 1DOXA 2LI5A 5HFYA 1FNUA 2J53A 2MP2A 3WAPA 1V2YA 4KZCA 3AXCA 2KWCA 1C4CA 4LDTB 2LEKA 2NPTA 1E8ZA 2DYOA 3VAWA 1MHHE 4XZ4A 2WXQA 1TGZB 1GOZA 2GRIA 4QAYA 4DQOC 2ICIA 2KZRA 2KMCA 1K52A 4HEA1 2ZPYA 4E74A 2MBHA 4W9KA 1XF5L 2XBBC 2KOXA 1WRDB 3KH0A 3DBHI 2KMMA 2KDMA 1GB1A 4M8MA 2XN9C 1U4AA 1Z2MA 1NENB 3BYTB 4WWMA 3Q2AC 2LZ6A 3PZ8A 2K8BA 1XCQL 2ZW0A 4MJSB 1IGDA 3N9YC 2INDC 1KJTA 3I9V1 3N32A 2L76A 3PT2B 4HK2A 1L7YA 3AEAB 1I4RA 1YOVB 4ARCA 4W9HA 3A1QB 1WE7A 4G0NB 3NY5A 2LASA 4NAWB 2IO3B 5D6JB 3GE3C 2O2VA 4CYEA 3W2DA 3B2FA 2JZPA 4MH0E 5AUKA 1TKYA 5CTRC 3K9OB 1TS2A 4YL8A 1WSPA 3OLMD 2IY0B 1F2RI 2BYEA 2NS5A 4A3OA 4EZLA 1XEEA 3MFGA 2EMSA 3Q3JA 4MGIE 2V4LA 1P3QU 4MGZE 4DHZB 5JH5C 2REXA 3M95A 1VZ8A 4NAMA 1YJJA 1N6ZA 3VTVA 5G5HA 4KKJA 2KQ4X 4IM0A 3ZNZB 4KDLB 1QQRA 1WR1A 1E8XA 3B08A 2PJHA 1TYGB 1FCCC 2BYFA 4N9F4 1UBQA 4FLHA 3HHMA 2FCSA 5T8IA 2MBEA 2A4ZA 3DHGC 3ZYYX 2HJ1A 2R2QA 2WDRB 2D11A 3DPDA 2KFJA 1K51A 5IKCM 2DAFA 4EEWA 4JWSC 1VRAB 3LJ3A 3MJ5A 4FJYA 3KLSX 2RSUA 1IBXB 2WX0A 4EKUA 3DCGA 2K3UA 4JPSA 3UIOB 2L1AA 2M0AA 2MJEA 2N9KA 1Q10A 3I63C 4GGQA 3ZW3A 3EECA 1GPXA 2BB6A 3AU4A 3L17A 1WXQA 3M62B 5BYRA 2N4FA 3ZJUA 3TCAA 4BOZB 2EKIA 4UDUC 2L00B 3BVZA 1Q5WB 3EUB2 1Q1OA 4MJSA 3BWUD 4DXFA 5BYQA 4NY0A 5IO9A 4ZDVA 3PTFC 2KVZA 2SAKA 3RCZA 1YQ3B 4ZHOA 4FN2A 2J0JA 2BBCA 3A1QA 1KRHA 5HHDG 3RNEC 2KLGA 2ON8A 1E5WA 2FIDA 4NAWA 1WZ3A 4WQOB 4HRSA 5H8YE 1WGDA 1WJUA 1PFDA 3AE3B 5IOIA 1WJNA 1LXDA 3TSSA 3KWLA 2KWVB 2N1VA 3NVVA 2V3PA 4L23A 1P9DU 1OQQA 2LFIA 2MBQA 3LYYA 1CMXB 1N62A 3V62A 3H6NA 4ZYSA 2IDYA 3MJWA 5HI1A 4W9JA 3U7ZA 1F2RC 3A33B 3AE2B 3EGRA 4G50A 3QJZA 2MJ3A 1RLFA 2N7JA 1F0ZA 1L0VB 2RDGA 1EF5A 2IGHA 2IY1B 3QWZB 4DWFA 5BMGA 2FCMA 4M0WB 3U2SC 2ZVOA 1E10A 2KQSA 2JVCA 3PHXB 4XDCA 4LJPB 4BVUC 2GOWA 3VVWB 4W9GA 2GBKA 2WYQA 2LMCA 4ICUA 1ZXIA 2B3AA 3U52E 2KN4A 4N6EB 4KGSA 1KTKA 2D07B 4EE2A 2CJOA 2JYEA 4MM3B 3VQIA 5E6PA 4MDKE 3P4QB 3ZXRA 2KXJA 2UWQA 3SDLC 1WRIA 1XLOA 3ZNGC 4F7ZA 2VRRB 3I5JC 3V05A 1YD8U 1DOIA 4ANXA 4CHKA 1IBXA 5HG2A 1S1QB 3CF6E 4GMVA 4A90A 5EE1A 1VCBA 2C7HA 4ZRQA 3IXSA 4YTMB 3M3JA 1MI0A 1RWSA 1I4GA 1FFVA 2LD9A 4PYUA 2WU5B 3DBLI 1VR9A 2BB5A 1E7PB 3ETRA 4NPNA 1XT9B 3MHZA 1KFYB 1V97A 4HPLB 1UNSA 2L7RA 4US8A 2DX5B 2KDBA 4I6PA 2L3ZA 1N5WA 4TV3A 1JRUA 1OEYA 3EHVA 4IC7B 2LJ5A 2NTTA 1UH6A 1MFWA 3BINA 3HRDD 4HVBA 4GB9A 2V9HA 1MHXA 1GUAB 2PW9A 3ZDTA 2AEHA 2QILA 3H7SA 3HK0A 3TJPA 5LXHA 1UUPA 2K39A 1UBIA 1YQBA 1TS3A 4DBGA 2O6VD 4DXAB 2FCNA 2LHDA 1QF6A 3AE7B 1J7BA 2AX5A 1JCKB 1UD7A 4FJVB 4M01A 1IGCA 2PIAA 3IG3A 1Y8RC 2NVUI 1I4PA 2WHIA 5EE0A 4RGOS 4WQMA 3A4SC 2BWFA 4A20A 4IM2A 4BBNF 3AV8A 4M0WA 1HZ6A 1YJ1A 4DHZE 3AH7A 3B1LX 2G1EA 3EA6A 3UINB 4B0EA 2GI9A 4LNIA 3ECIA 4C80A 5IN7A 5C23A 4PS8A 3PVLA 4J3OD 4HDQA 4MM3A 1T5XD 3APDA 2Y5PA 1VD2A 2CU1A 3QQ8B 4LNFA 4FADA 1OTRB 3NS1A 4ANUA 2KJHB 4CQNA 3Q8FA 3T9LA 3GB1A 1C79A 5C1ZA 4MELA 3VHTC 2BS2B 1WGGA 2OJWA 5G55A 2MRPA 2MA9B 4J6IA 2JRIB 1J19A 3N3KB 2ZCCA 1GAQB 2M19A 1PGAA 3NRZA 1ET9A 2JWUA 1E7UA 3L4PA 2ZPNA 2W9NA 2WDTB 4DXGA 5IAAC 3NG0A 2DBYA 1IPGA 4ZYNA 3IFWB 3OWEB 2J4XA 3RUIB 1IP9A 2JUOA 2V4IB 4IWQA 1SE2A 2K9XA 2M17A 2G3QB 1WX7A 2LXCA 4HJGE 2J7QB 1NI2A 2IBIB 2NCNA 3ZRFA 4BBNC 1B1ZA 4LNOA 3PHWB 2FAZA 3JSVB 4FXCA 1Q0WB 1XQQA 3WANA 2O6VA 2PVOD 4NJ6A 2LXAA 2C7NB 2C7MB 4HROA 4FJZA 4IWPA 4FA6A 1DGJA 2IZVB 2V1YA 1FD6A 4IG7B 1NYRA 3JVZX 4K81A 2HJ8A 3UIPB 1ISNA 2NBWB 4HPPA 4ARIA 1L0XB 1JROA 5J2RA 4ZRPA 2DAJA 4ACFA 4HPMB 3QA8A 2KMAA 4CO7A 3ZJVA 1WGKA 2N7EA 5E6OA 2INPE 2WXPA 4FHKA 2L52A 2V3NA 1ZOYB 1DOYA 2WXJA 1C9FA 1CJEA 4KIKB 3NHEB 2XEWA 1VLBA 5BMHA 2WXMA 3R2TA 1V5OA 1EM7A 4AQ7A 2AQ3B 3I3TB 2L8JA 4GU2A 1AYFA 1ZP0B 3P2BA 4KVGB 1F9JA 2G9HD 2WDQB 1H4RA 2BQQA 4K7SA 2CS4A 5KHQA 3SEBA 2G45B 2N0SB 5LNK1 2WXNA 1FXAA 1YN5A 1L4ZB 1RFKA 2NMQA 1JWAD 4I6LB 4PK1A 2CJNA 2X38A 2WXHA 4GSWA 3DVNV 3FKYA 1FO4A 3P4RB 4YSZB 2N7DA 2WLBA 2M8SA 5EE3A 2JWZA 2N1WA 4US9A 1A70A 4L2YA 2DNFA 1WXSA 3A9JA 2DHZA 4DDGD 4EZJA 3DVNU 1FRDA 3NZUA 3ZUNA 4DDID 1JQ4A 2Z59B 3ZXVA 2MQJA 3NVYA 3RN9C 2IYDB 3PZDA 1E0ZA 3CMMB 2NBVB 3ZNID 1EUVB 5C2TB 5E6JA 3SU8X 1FNWA 2WXGA 3KYDD 3GOEA 2WXKA 3BIID 5D2MB 4XDDA 1UWMA 4C4VA 2JXTA 4LLGM 2PKOA 4H2AA 1SXTA 3W1YA 4E71A 1L2NA 4AJYB 1TTNA 3HUIA 3JSVA 2I1KA 1C4AA 1V8CA 5D3DA 1R4MB 4KDIC 1BUIC 1UZXB 4LCDE 3DBRB 3QIJA 4BFRA 1XLPA 1ROEA 3X23A 1T6BX 2LWPA 1QOGA 4KSKC 4W9IA 1AN8A 1KH0A 1ET6A 1WGHA 2KVRA 1V1OA 1D4BA 1P0RA 3R7RA 2BTEA 4HXDA 4ITKA 4WAAA 2PLPA 3AN1A 3NVZA 5CHFA 3PSEB 4NJ7A 4HCPB 4PT5A 4WH4A 1GNUA 2QHOA 4KIKA 3O13A 3M63B 2W55A 1JWSD 1K50A 3UI3A 2L83A 3H1UA 3ML9A 2N9LA 1SJHD 3QAQA 2J0KA 5AZHA 1PYWD 2DLBA 1QOBA 4HLEA 4RF0A 4XWWA 3FILB 4B95A 3VUXA 2AYOB 1EU3A 1R4NB 4RM9A 4B6WA 4PS7A 2PEAA 2MBOA 2HE7A 3W5VB 3PRMB 3H8HA 1RM6C 2L32A 1HQRD 3EC8A 3HM6X 3L0WB 5BO4B 1ZGUB 4PYZA 4OHJA 1S3SG 3MC9A 3P1MA 2V3SA 4W9FA 4YSXB 2JT4B 1SGHA 3B0AA 4W9CA 1HTQA 1XD3B 5GMVA 3HVZA 2BF8B 1GG3A 1CZPA 4OVVA 3X0WA 4L1BA 2A5UA 4MACA 3ZTDA 2FUG1 3KWVA 2PE6B 4S17A 2FUHB 3V61A 4KZ0A 1TKEA 3CIRB 1GJZA 3ZVVA 1TS4A 3IVFA 2WS3B 2L0FA 1TY0A 4LTUA 3Q8EA 3VTUA 4OW0A 3VFKA 5D94A 2N9PC 1FXTB 1MJDA 2R2OA 1TZOA 1MVKA 1SJED 2D10A 1WH3A 3Q3OC 4G3XB 3AU5A 1SE9A 3MC0B 4YTNB 4TQ1A 1ZPSA 3BVMA 2JXXA 3E9SA 1WWTA 2IO2B 2FCQA 4RNAA 3DWMA 3L13A 1FEHA 3L10B 3BK2A 1EWYC 2AL3A 1D6EC 3BY4B 2V0GA 2WQYB 1ZUD2 2DZJA 2FNJB 1WMHB 3RULA 5H92C 1D5XC 1VDVA 3P4SB 3WA0A 5EE9A 1C77A 3R66C 5JHAA 2ZJDA 3FC4A 1H8CA 2AQ2B 1M4VA 2X8XX 3IHPC 2GLSA 2JQRB 1T0QC 1WI0A 1E9MA 1B9RA 3EFCA 4RF1A 1GC6A 3AEFB 2LHEA 2QJLA 4DHJD 2WXIA 3CSFA 4ICVA 1UWXA 2KC1A
chains in the Genus database with same CATH topology
2K8HA 2I1JA 2J0MA 1NBFC 2KZRA 2KMCA 1VD2A 2CU1A 3QQ8B 1KOTA 3VUWA 2MLBA 2KFKB 5CHVC 3DBRI 4X57B 5J17A 2ZPYA 3N30A 3RT3B 4E74A 4FADA 1OTRB 2MBHA 4W9KA 2YVCA 2XBBC 4ANUA 1WJ4A 3PLVA 2KOXA 2KJHB 4AWJA 2Z0EB 1WRDB 5DCNA 3T9LA 3KH0A 2G4DB 5CX3A 3DBHI 5C1ZA 2OOBB 4MELA 4ASWC 3VHTC 4M8MA 1PQSA 1U4AA 1Z2MA 3H7PA 1WGGA 1WXAA 4IUMB 2LGDA 3SD5A 3A9KB 5G55A 2BYVE 2MRPA 2LRWA 2LZ6A 2K8BA 2MA9B 4J6IA 2JRIB 1J19A 3N3KB 4MJSB 2ZCCA 2KJRA 2CKHB 2BGFA 2NR2A 1KJTA 2KDIA 3N32A 5IA7A 2L76A 3PT2B 5AZGA 4HK2A 1E7UA 1L7YA 2ZPNA 2BKRB 3TIXA 2W9NA 1BT0A 3WAOA 2WDTB 1A5RA 5IAAC 4W9HA 3A1QB 1IPGA 2LVOA 4ZYNA 1WE7A 4G0NB 1J8CA 2LGXA 3IFWB 3NY5A 1WIAA 1SIFA 4MSQB 3RUIB 5DPTA 1IP9A 2JUOA 2LASA 1V49A 3UF8A 4NAWB 1E8WA 3TBLD 4IWQA 3RD2A 2IO3B 5D6JB 2M17A 2G3QB 4GDKA 1WX7A 3T8MA 2LXCA 1X1MA 4RM8A 3OAWA 2ZZPB 2O6VB 2O2VA 2Z0DB 4CYEA 2J7QB 2N9EB 1NI2A 2GBMA 2IBIB 2K6DB 2NCNA 4NNJB 4MH0E 3ZRFA 3QCAA 1EF1A 3PHWB 4ZRKA 2FAZA 4BBNC 3JSVB 4NQLB 1Q0WB 5CTRC 3CSTA 2CHZA 1K8RB 3VDZA 1XQQA 3K9OB 4YL8A 2JZ3B 3WANA 2RPQA 2O6VA 3OLMD 5L95C 2XK5B 3UGBB 2IY0B 2BYEA 3PGEA 2NS5A 4NJ6A 3W1SA 4A3OA 5HKHA 2LXAA 4EZLA 1LM8B 2C7NB 2C7MB 1D3ZA 2KX3A 2EMSA 4FJZA 4IWPA 4FA6A 2IZVB 2V1YA 3Q3JA 2C5LC 3KVFB 1TZ1A 4MGIE 2GBNA 4IG7B 4MEMA 3JVZX 2V4LA 2HJ8A 4K81A 1ISNA 1P3QU 2HD5B 2KANA 3UIPB 2NBWB 3AULA 3PLUA 3HIZA 1KLVA 4MGZE 4DHZB 5J2RA 5JH5C 4AUQC 2REXA 1I35A 2DAJA 3M95A 4HPMB 4ZRJA 3QA8A 2KMAA 4CO7A 3VTVA 2KN5A 4EUTA 2N7EA 3A4RA 4IM3A 4IM0A 5E6OA 3QC8B 2Y5BB 3JYUA 4FHKA 2DYMA 3ZNZB 4KDLB 3KUCB 2AL6A 1WR1A 1E8XA 2MBBB 2JY6A 3B08A 1WMHA 2G4SA 4DHJB 2IO1B 2PJHA 2EMTA 3Q3FA 4XX5A 3WALA 4KIKB 2BYFA 2CR5A 3NHEB 4W9LA 1P98A 2XEWA 4N9F4 1I42A 2CHXA 2ZVNA 1UBQA 4FLHA 1V5OA 1J0GA 3HHMA 1WGYA 2FCSA 2MBEA 4BKSA 2A4ZA 1WY8A 2K25A 4K7WA 4XC2A 3I3TB 4LJOB 3O65B 2AWTA 3V6CB 1ZW7A 1LFDA 2R2QA 3DVGY 1WXMA 2L8JA 2RGFA 2D11A 3DPDA 4GU2A 5G2NA 3P2BA 3APFA 2KFJA 4KVGB 3TL5A 1V6EA 1M94A 1F9JA 4HJKA 2K8CA 1H4RA 4K7SA 4IWOA 2CS4A 2GMIC 5KHQA 3EFUA 2DAFA 4EEWA 2KDEB 2G45B 1R4MI 2LGYA 3L08A 5LLIA 3HM3A 4WJOA 2PE9A 1WM3A 3LJ3A 4FJYA 2RSUA 3R7QA 3NS8A 4I6LB 3RYTA 3ZIMA 2L05A 4GSWA 2WX0A 3DVNV 4EKUA 5J18A 3DCGA 3UIOB 2KFKA 2C60A 3A9JB 4I6NB 1HE8A 2N7DA 2D3GA 4P7IA 1WX8A 4E3CA 3VH4B 4M8NA 4GGQA 2M8SA 3ZW3A 2JWZA 3EECA 2N1WA 1T0YA 3L17A 3AU4A 3DBSA 2JF5A 4HDOA 1WXSA 3M62B 4JIOU 4WWOA 3A9JA 4WWNA 2N4FA 2DHZA 4DDGD 1C1YB 2ASQA 4EZJA 1QZEA 2K1FA 4RMAA 3TCAA 4BOZB 1WJ6A 3DVNU 3ZTCA 4KSLC 3NZUA 3A9KA 5DPRA 3ZUNA 4GXBA 4DDID 2JZZA 3DVGX 2L00B 2Z59B 5CHWA 1Q5WB 1Q1OA 4MJSA 2MQJA 3KUZA 5E6NA 1E90A 1V5TA 1WM2A 1IYFA 2KDFB 4NY0A 4BKTA 4F8CB 3RZFA 4ZDVA 3PTFC 2IYDB 3PZDA 5DPWA 2MCNB 3CMMB 2NBVB 4JLCA 2ZEQA 2HTHA 3RCZA 3ZNID 1EUVB 4FN2A 2J0JA 3SU8X 3KYDD 3GOEA 3A1QA 5D2MB 3QK0A 1YX5B 3KUDB 3PS6A 3ZO5B 4GOCA 2KLGA 1E5WA 2FIDA 4OVUA 4NAWA 3W1YA 4E71A 1WZ3A 4FHJA 2UYZB 4WQOB 4ZRIA 1L2NA 4AJYB 1R4NI 3D32A 1AARA 1WGDA 1WJUA 2KTRB 1TTNA 1WJNA 1LXDA 2BKFA 1OQYA 3JSVA 2ZCBA 2I1KA 5L83A 2D2QA 2KWVB 4KDIC 2KJ6A 2N1VA 1UZXB 1P9DU 4EOYA 3V6EB 2XK5A 2M0XA 4LCDE 4GDLB 3QIJA 2MBQA 3TMPB 1WXVA 4BOSC 4BFRA 1CMXB 2KC2A 3V62A 3SHQA 3H6NA 4AP4C 5JHBA 2M4NA 3X23A 3VXWA 3AI5A 3MJWA 2LWPA 3VTWA 2DYBA 4TKNA 3KW5B 4W9JA 1ZKHA 2KD0A 3A33B 2BPSA 4G50A 4KSKC 2YLMA 3DOWA 3QJZA 4W9IA 1WGHA 2KKCA 1RLFA 2KVRA 2EKEC 1P0RA 1EF5A 2IO0B 2IY1B 3QWZB 4K7UA 3R7RA 3V60A 4DWFA 3U8ZA 3PREA 2FCMA 4HXDA 3WAMA 4M0WB 3DDCB 4W9EA 4WAAA 2ZVOA 4ANWA 1KM7A 2K6QA 5CHFA 1RFAA 3PSEB 3VH3B 4EFOA 4NJ7A 2JPHA 2MP2B 3DQVA 4HCPB 2ZNVC 2KQSA 2JVCA 3PHXB 1GNUA 2QHOA 4LJPB 4BVUC 2GOWA 4WJPA 4KIKA 3VVWB 3M63B 3VUYA 2KQ7A 2LVQA 4KV2A 4W9GA 4JL9A 3ML8A 2NPTB 1WYWB 2GBKA 2WYQA 4AOFA 4F1SA 2KK8A 4ICUA 3C0RB 2B3AA 3H1UA 2GBJA 2KWUB 4II2B 3ML9A 2LRUA 4HCNB 2D07B 3QAQA 2J0KA 2N9XA 5AZHA 2BWES 1E7VA 1RRBA 3VQIA 2LVPA 4IW0A 2KNBA 4HLEA 5E6PA 4MDKE 3ZLZA 4W9DA 2KXJA 2MWSB 2UWQA 3L54A 5AEKB 1WFYA 3SDLC 4B95A 3VUXA 1WF9A 3ZNGC 4F7ZA 1V80A 2AYOB 2VRRB 2PPHA 2KX0A 4RM9A 1WR6E 4PS7A 4B6WA 4LDTD 1YD8U 2PEAA 4FBJB 2MBOA 2HE7A 2KHWB 2RR9A 4ANXA 3MHSD 5AZFA 1P1AA 1EO6A 3PRMB 4CHKA 2MX2A 1S1QB 3CF6E 2GBRA 4GMVA 4B9KA 3UQBA 1YIWA 4HWIB 3W1SC 3EC8A 3HM6X 2M1MA 3L0WB 1VCBA 2C7HA 3ENEA 4JGHB 3H7PB 3JW0X 5BO4B 1ZGUB 4PYZA 4URKA 1S3SG 3NOBA 4W9FA 2V3SA 4GN1A 3M3JA 2JT4B 1SGHA 1UGMA 1OGWA 3B0AA 3U7DA 5DPSA 4W9CA 1V81A 1Z5SB 3QX1A 2LD9A 2ZNVB 1TBEA 2DZIA 4PYUA 3WIMA 1XD3B 3DBLI 2DZKA 4GIVA 2KTFA 5GMVA 3APCA 4G11A 2OJRA 2BF8B 4EZKA 2C9WB 2DZMA 5FR6A 4A3PA 4NPNA 1GG3A 4MGKE 4OVVA 2DENB 1XT9B 3X0WA 2A5UA 1MG8A 3PRPB 3ZKJC 3ZTDA 2WX1A 4HPLB 3NZSA 4ANVA 2L7RA 2JRHA 4WWPA 2DX5B 2KDBA 2PE6B 1V9JA 2FUHB 3V61A 4KZ0A 4I6PA 1WX9A 4DK5A 2L3ZA 1GJZA 4GDKB 4TV3A 3ZVVA 3RZWC 3QHTA 3L16A 1JRUA 1OEYA 2O2VB 2KLCA 3EHVA 4IC7B 2LJ5A 1RAXA 3IVFA 3PV1A 4FULA 1UH6A 4AJWA 1WE6A 2L0FA 1YX6B 3BINA 3OJ3A 4HVBA 2LUEA 2MW5A 5TR5A 3ZRCA 3VTUA 4GB9A 1E8YA 5KHOA 4K1RB 3VFKA 5D94A 1GUAB 2N9PC 1FXTB 2R2OA 5JZEB 1LQBA 3QARA 2KTRA 3ZDTA 2AEHA 2D10A 2NBUA 3H7SA 3ONSA 3ZDMC 1WH3A 3IBEA 3R3MA 2RD0A 3KYCD 3HK0A 3TJPA 4G3XB 5LXHA 3AU5A 1SE9A 2KO3A 2K39A 1UBIA 4TQ1A 1YQBA 1C3TA 3GZNI 2WWZA 4DBGA 4PS3A 2O6VD 5LXIB 4DXAB 2JXXA 1V86A 3ZNHB 4GDLA 5D7GA 2FCNA 3UQAA 1OEYJ 4WJQA 2IO2B 2FCQA 3L13A 1WGRA 3L10B 2CHWA 4MSMB 2AL3A 4JQWC 3BY4B 1UD7A 4BKGA 4FJVB 2DZJA 2FNJB 1WZ0A 3OJ4B 1WMHB 3RULA 3IG3A 1Y8RC 2FIFA 2NVUI 4TQ0A 3MTNB 3H9DA 4MGYE 2L0TA 4II3B 3A4SC 2MSED 2BWFA 1G6JA 4A20A 2LI5A 4IM2A 4BBNF 3ALBA 3WA0A 1NDDA 1YJ1A 4DHZE 2MP2A 3WAPA 3R66C 1GC7A 5JHAA 1V2YA 3B1LX 2ZJDA 4KZCA 1H8CA 3AXCA 2KWCA 3PPAA 3IHPC 3UINB 4LDTB 1WI0A 3LDZE 2NPTA 4WJNA 1GC6A 1UELA 3K9PB 1E8ZA 2DYOA 3ECIA 3PRZA 4BKSD 4DHJD 4NQKE 3VAWA 3U30A 5C23A 4PS8A 4XZ4A 3S2AA 3CSFA 3PVLA 4HDQA 1TGZB 4ICVA 4TUUA 4MM3A 2KC1A 3APDA 5EDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8H A;  2I1J A;  2J0M A;  1NBF C;  2KZR A;  2KMC A;  1VD2 A;  2CU1 A;  3QQ8 B;  1KOT A;  3VUW A;  2MLB A;  2KFK B;  5CHV C;  3DBR I;  4X57 B;  5J17 A;  2ZPY A;  3N30 A;  3RT3 B;  4E74 A;  4FAD A;  1OTR B;  2MBH A;  4W9K A;  2YVC A;  2XBB C;  4ANU A;  1WJ4 A;  3PLV A;  2KOX A;  2KJH B;  4AWJ A;  2Z0E B;  1WRD B;  5DCN A;  3T9L A;  3KH0 A;  2G4D B;  5CX3 A;  3DBH I;  5C1Z A;  2OOB B;  4MEL A;  4ASW C;  3VHT C;  4M8M A;  1PQS A;  1U4A A;  1Z2M A;  3H7P A;  1WGG A;  1WXA A;  4IUM B;  2LGD A;  3SD5 A;  3A9K B;  5G55 A;  2BYV E;  2MRP A;  2LRW A;  2LZ6 A;  2K8B A;  2MA9 B;  4J6I A;  2JRI B;  1J19 A;  3N3K B;  4MJS B;  2ZCC A;  2KJR A;  2CKH B;  2BGF A;  2NR2 A;  1KJT A;  2KDI A;  3N32 A;  5IA7 A;  2L76 A;  3PT2 B;  5AZG A;  4HK2 A;  1E7U A;  1L7Y A;  2ZPN A;  2BKR B;  3TIX A;  2W9N A;  1BT0 A;  3WAO A;  2WDT B;  1A5R A;  5IAA C;  4W9H A;  3A1Q B;  1IPG A;  2LVO A;  4ZYN A;  1WE7 A;  4G0N B;  1J8C A;  2LGX A;  3IFW B;  3NY5 A;  1WIA A;  1SIF A;  4MSQ B;  3RUI B;  5DPT A;  1IP9 A;  2JUO A;  2LAS A;  1V49 A;  3UF8 A;  4NAW B;  1E8W A;  3TBL D;  4IWQ A;  3RD2 A;  2IO3 B;  5D6J B;  2M17 A;  2G3Q B;  4GDK A;  1WX7 A;  3T8M A;  2LXC A;  1X1M A;  4RM8 A;  3OAW A;  2ZZP B;  2O6V B;  2O2V A;  2Z0D B;  4CYE A;  2J7Q B;  2N9E B;  1NI2 A;  2GBM A;  2IBI B;  2K6D B;  2NCN A;  4NNJ B;  4MH0 E;  3ZRF A;  3QCA A;  1EF1 A;  3PHW B;  4ZRK A;  2FAZ A;  4BBN C;  3JSV B;  4NQL B;  1Q0W B;  5CTR C;  3CST A;  2CHZ A;  1K8R B;  3VDZ A;  1XQQ A;  3K9O B;  4YL8 A;  2JZ3 B;  3WAN A;  2RPQ A;  2O6V A;  3OLM D;  5L95 C;  2XK5 B;  3UGB B;  2IY0 B;  2BYE A;  3PGE A;  2NS5 A;  4NJ6 A;  3W1S A;  4A3O A;  5HKH A;  2LXA A;  4EZL A;  1LM8 B;  2C7N B;  2C7M B;  1D3Z A;  2KX3 A;  2EMS A;  4FJZ A;  4IWP A;  4FA6 A;  2IZV B;  2V1Y A;  3Q3J A;  2C5L C;  3KVF B;  1TZ1 A;  4MGI E;  2GBN A;  4IG7 B;  4MEM A;  3JVZ X;  2V4L A;  2HJ8 A;  4K81 A;  1ISN A;  1P3Q U;  2HD5 B;  2KAN A;  3UIP B;  2NBW B;  3AUL A;  3PLU A;  3HIZ A;  1KLV A;  4MGZ E;  4DHZ B;  5J2R A;  5JH5 C;  4AUQ C;  2REX A;  1I35 A;  2DAJ A;  3M95 A;  4HPM B;  4ZRJ A;  3QA8 A;  2KMA A;  4CO7 A;  3VTV A;  2KN5 A;  4EUT A;  2N7E A;  3A4R A;  4IM3 A;  4IM0 A;  5E6O A;  3QC8 B;  2Y5B B;  3JYU A;  4FHK A;  2DYM A;  3ZNZ B;  4KDL B;  3KUC B;  2AL6 A;  1WR1 A;  1E8X A;  2MBB B;  2JY6 A;  3B08 A;  1WMH A;  2G4S A;  4DHJ B;  2IO1 B;  2PJH A;  2EMT A;  3Q3F A;  4XX5 A;  3WAL A;  4KIK B;  2BYF A;  2CR5 A;  3NHE B;  4W9L A;  1P98 A;  2XEW A;  4N9F 4;  1I42 A;  2CHX A;  2ZVN A;  1UBQ A;  4FLH A;  1V5O A;  1J0G A;  3HHM A;  1WGY A;  2FCS A;  2MBE A;  4BKS A;  2A4Z A;  1WY8 A;  2K25 A;  4K7W A;  4XC2 A;  3I3T B;  4LJO B;  3O65 B;  2AWT A;  3V6C B;  1ZW7 A;  1LFD A;  2R2Q A;  3DVG Y;  1WXM A;  2L8J A;  2RGF A;  2D11 A;  3DPD A;  4GU2 A;  5G2N A;  3P2B A;  3APF A;  2KFJ A;  4KVG B;  3TL5 A;  1V6E A;  1M94 A;  1F9J A;  4HJK A;  2K8C A;  1H4R A;  4K7S A;  4IWO A;  2CS4 A;  2GMI C;  5KHQ A;  3EFU A;  2DAF A;  4EEW A;  2KDE B;  2G45 B;  1R4M I;  2LGY A;  3L08 A;  5LLI A;  3HM3 A;  4WJO A;  2PE9 A;  1WM3 A;  3LJ3 A;  4FJY A;  2RSU A;  3R7Q A;  3NS8 A;  4I6L B;  3RYT A;  3ZIM A;  2L05 A;  4GSW A;  2WX0 A;  3DVN V;  4EKU A;  5J18 A;  3DCG A;  3UIO B;  2KFK A;  2C60 A;  3A9J B;  4I6N B;  1HE8 A;  2N7D A;  2D3G A;  4P7I A;  1WX8 A;  4E3C A;  3VH4 B;  4M8N A;  4GGQ A;  2M8S A;  3ZW3 A;  2JWZ A;  3EEC A;  2N1W A;  1T0Y A;  3L17 A;  3AU4 A;  3DBS A;  2JF5 A;  4HDO A;  1WXS A;  3M62 B;  4JIO U;  4WWO A;  3A9J A;  4WWN A;  2N4F A;  2DHZ A;  4DDG D;  1C1Y B;  2ASQ A;  4EZJ A;  1QZE A;  2K1F A;  4RMA A;  3TCA A;  4BOZ B;  1WJ6 A;  3DVN U;  3ZTC A;  4KSL C;  3NZU A;  3A9K A;  5DPR A;  3ZUN A;  4GXB A;  4DDI D;  2JZZ A;  3DVG X;  2L00 B;  2Z59 B;  5CHW A;  1Q5W B;  1Q1O A;  4MJS A;  2MQJ A;  3KUZ A;  5E6N A;  1E90 A;  1V5T A;  1WM2 A;  1IYF A;  2KDF B;  4NY0 A;  4BKT A;  4F8C B;  3RZF A;  4ZDV A;  3PTF C;  2IYD B;  3PZD A;  5DPW A;  2MCN B;  3CMM B;  2NBV B;  4JLC A;  2ZEQ A;  2HTH A;  3RCZ A;  3ZNI D;  1EUV B;  4FN2 A;  2J0J A;  3SU8 X;  3KYD D;  3GOE A;  3A1Q A;  5D2M B;  3QK0 A;  1YX5 B;  3KUD B;  3PS6 A;  3ZO5 B;  4GOC A;  2KLG A;  1E5W A;  2FID A;  4OVU A;  4NAW A;  3W1Y A;  4E71 A;  1WZ3 A;  4FHJ A;  2UYZ B;  4WQO B;  4ZRI A;  1L2N A;  4AJY B;  1R4N I;  3D32 A;  1AAR A;  1WGD A;  1WJU A;  2KTR B;  1TTN A;  1WJN A;  1LXD A;  2BKF A;  1OQY A;  3JSV A;  2ZCB A;  2I1K A;  5L83 A;  2D2Q A;  2KWV B;  4KDI C;  2KJ6 A;  2N1V A;  1UZX B;  1P9D U;  4EOY A;  3V6E B;  2XK5 A;  2M0X A;  4LCD E;  4GDL B;  3QIJ A;  2MBQ A;  3TMP B;  1WXV A;  4BOS C;  4BFR A;  1CMX B;  2KC2 A;  3V62 A;  3SHQ A;  3H6N A;  4AP4 C;  5JHB A;  2M4N A;  3X23 A;  3VXW A;  3AI5 A;  3MJW A;  2LWP A;  3VTW A;  2DYB A;  4TKN A;  3KW5 B;  4W9J A;  1ZKH A;  2KD0 A;  3A33 B;  2BPS A;  4G50 A;  4KSK C;  2YLM A;  3DOW A;  3QJZ A;  4W9I A;  1WGH A;  2KKC A;  1RLF A;  2KVR A;  2EKE C;  1P0R A;  1EF5 A;  2IO0 B;  2IY1 B;  3QWZ B;  4K7U A;  3R7R A;  3V60 A;  4DWF A;  3U8Z A;  3PRE A;  2FCM A;  4HXD A;  3WAM A;  4M0W B;  3DDC B;  4W9E A;  4WAA A;  2ZVO A;  4ANW A;  1KM7 A;  2K6Q A;  5CHF A;  1RFA A;  3PSE B;  3VH3 B;  4EFO A;  4NJ7 A;  2JPH A;  2MP2 B;  3DQV A;  4HCP B;  2ZNV C;  2KQS A;  2JVC A;  3PHX B;  1GNU A;  2QHO A;  4LJP B;  4BVU C;  2GOW A;  4WJP A;  4KIK A;  3VVW B;  3M63 B;  3VUY A;  2KQ7 A;  2LVQ A;  4KV2 A;  4W9G A;  4JL9 A;  3ML8 A;  2NPT B;  1WYW B;  2GBK A;  2WYQ A;  4AOF A;  4F1S A;  2KK8 A;  4ICU A;  3C0R B;  2B3A A;  3H1U A;  2GBJ A;  2KWU B;  4II2 B;  3ML9 A;  2LRU A;  4HCN B;  2D07 B;  3QAQ A;  2J0K A;  2N9X A;  5AZH A;  2BWE S;  1E7V A;  1RRB A;  3VQI A;  2LVP A;  4IW0 A;  2KNB A;  4HLE A;  5E6P A;  4MDK E;  3ZLZ A;  4W9D A;  2KXJ A;  2MWS B;  2UWQ A;  3L54 A;  5AEK B;  1WFY A;  3SDL C;  4B95 A;  3VUX A;  1WF9 A;  3ZNG C;  4F7Z A;  1V80 A;  2AYO B;  2VRR B;  2PPH A;  2KX0 A;  4RM9 A;  1WR6 E;  4PS7 A;  4B6W A;  4LDT D;  1YD8 U;  2PEA A;  4FBJ B;  2MBO A;  2HE7 A;  2KHW B;  2RR9 A;  4ANX A;  3MHS D;  5AZF A;  1P1A A;  1EO6 A;  3PRM B;  4CHK A;  2MX2 A;  1S1Q B;  3CF6 E;  2GBR A;  4GMV A;  4B9K A;  3UQB A;  1YIW A;  4HWI B;  3W1S C;  3EC8 A;  3HM6 X;  2M1M A;  3L0W B;  1VCB A;  2C7H A;  3ENE A;  4JGH B;  3H7P B;  3JW0 X;  5BO4 B;  1ZGU B;  4PYZ A;  4URK A;  1S3S G;  3NOB A;  4W9F A;  2V3S A;  4GN1 A;  3M3J A;  2JT4 B;  1SGH A;  1UGM A;  1OGW A;  3B0A A;  3U7D A;  5DPS A;  4W9C A;  1V81 A;  1Z5S B;  3QX1 A;  2LD9 A;  2ZNV B;  1TBE A;  2DZI A;  4PYU A;  3WIM A;  1XD3 B;  3DBL I;  2DZK A;  4GIV A;  2KTF A;  5GMV A;  3APC A;  4G11 A;  2OJR A;  2BF8 B;  4EZK A;  2C9W B;  2DZM A;  5FR6 A;  4A3P A;  4NPN A;  1GG3 A;  4MGK E;  4OVV A;  2DEN B;  1XT9 B;  3X0W A;  2A5U A;  1MG8 A;  3PRP B;  3ZKJ C;  3ZTD A;  2WX1 A;  4HPL B;  3NZS A;  4ANV A;  2L7R A;  2JRH A;  4WWP A;  2DX5 B;  2KDB A;  2PE6 B;  1V9J A;  2FUH B;  3V61 A;  4KZ0 A;  4I6P A;  1WX9 A;  4DK5 A;  2L3Z A;  1GJZ A;  4GDK B;  4TV3 A;  3ZVV A;  3RZW C;  3QHT A;  3L16 A;  1JRU A;  1OEY A;  2O2V B;  2KLC A;  3EHV A;  4IC7 B;  2LJ5 A;  1RAX A;  3IVF A;  3PV1 A;  4FUL A;  1UH6 A;  4AJW A;  1WE6 A;  2L0F A;  1YX6 B;  3BIN A;  3OJ3 A;  4HVB A;  2LUE A;  2MW5 A;  5TR5 A;  3ZRC A;  3VTU A;  4GB9 A;  1E8Y A;  5KHO A;  4K1R B;  3VFK A;  5D94 A;  1GUA B;  2N9P C;  1FXT B;  2R2O A;  5JZE B;  1LQB A;  3QAR A;  2KTR A;  3ZDT A;  2AEH A;  2D10 A;  2NBU A;  3H7S A;  3ONS A;  3ZDM C;  1WH3 A;  3IBE A;  3R3M A;  2RD0 A;  3KYC D;  3HK0 A;  3TJP A;  4G3X B;  5LXH A;  3AU5 A;  1SE9 A;  2KO3 A;  2K39 A;  1UBI A;  4TQ1 A;  1YQB A;  1C3T A;  3GZN I;  2WWZ A;  4DBG A;  4PS3 A;  2O6V D;  5LXI B;  4DXA B;  2JXX A;  1V86 A;  3ZNH B;  4GDL A;  5D7G A;  2FCN A;  3UQA A;  1OEY J;  4WJQ A;  2IO2 B;  2FCQ A;  3L13 A;  1WGR A;  3L10 B;  2CHW A;  4MSM B;  2AL3 A;  4JQW C;  3BY4 B;  1UD7 A;  4BKG A;  4FJV B;  2DZJ A;  2FNJ B;  1WZ0 A;  3OJ4 B;  1WMH B;  3RUL A;  3IG3 A;  1Y8R C;  2FIF A;  2NVU I;  4TQ0 A;  3MTN B;  3H9D A;  4MGY E;  2L0T A;  4II3 B;  3A4S C;  2MSE D;  2BWF A;  1G6J A;  4A20 A;  2LI5 A;  4IM2 A;  4BBN F;  3ALB A;  3WA0 A;  1NDD A;  1YJ1 A;  4DHZ E;  2MP2 A;  3WAP A;  3R66 C;  1GC7 A;  5JHA A;  1V2Y A;  3B1L X;  2ZJD A;  4KZC A;  1H8C A;  3AXC A;  2KWC A;  3PPA A;  3IHP C;  3UIN B;  4LDT B;  1WI0 A;  3LDZ E;  2NPT A;  4WJN A;  1GC6 A;  1UEL A;  3K9P B;  1E8Z A;  2DYO A;  3ECI A;  3PRZ A;  4BKS D;  4DHJ D;  4NQK E;  3VAW A;  3U30 A;  5C23 A;  4PS8 A;  4XZ4 A;  3S2A A;  3CSF A;  3PVL A;  4HDQ A;  1TGZ B;  4ICV A;  4TUU A;  4MM3 A;  2KC1 A;  3APD A;  5EDS A; 
#chains in the Genus database with same CATH topology
 1NBF C;  3FIL A;  3N1Z C;  1IUE A;  2MLB A;  2KFK B;  1F77 A;  3DBR I;  4X57 B;  5J17 A;  1STE A;  2YVC A;  2R61 A;  3Q3N C;  1WJ4 A;  4GLS C;  4AWJ A;  2Z0E B;  3GZN B;  2WXO A;  2OED A;  4OZC A;  1XO3 A;  2B76 B;  1PQS A;  1WXA A;  4IUM B;  1YNT E;  4C7Y A;  2BYV E;  3AM9 A;  3VRB B;  3T3O A;  2PMV A;  2KJR A;  3R2I A;  2CKH B;  2BGF A;  2NR2 A;  2KWD A;  2KDI A;  1SB3 C;  3RNB C;  3Q8A A;  1QKZ A;  3TIX A;  2D3C A;  3WAO A;  1PUT A;  1J8C A;  2LGX A;  1WIA A;  4MSQ B;  3RNF C;  5DPT A;  1V49 A;  3RD2 A;  4K3B A;  3T8M A;  3AB5 A;  1X1M A;  3OAW A;  2O6V B;  3N1X C;  2INN E;  2N9E B;  2GBM A;  2D5G A;  3IT4 B;  3QCA A;  4ZRK A;  2CHZ A;  2JZ3 B;  4LNN A;  3UGB B;  1J7C A;  5HKH A;  4B0M A;  1LM8 B;  3AED B;  1D3Z A;  3TUO A;  3AE5 B;  3KVF B;  3BYY B;  4MEM A;  2HD5 B;  2KAN A;  3PLU A;  1KLV A;  2QDF A;  3Q6B A;  2D3A A;  4AUQ C;  3ZQ4 A;  1I35 A;  3DBH B;  1N63 A;  4ZRJ A;  2KN5 A;  1KLU D;  3A4R A;  3QC8 B;  2Y5B B;  1SSN A;  3JYU A;  2GB1 A;  1BML C;  3KUC B;  4P1C C;  2XNA C;  2JY6 A;  1WMH A;  2EMT A;  3Q3F A;  4W9L A;  1P98 A;  4M02 A;  2ZVN A;  1JAL A;  1J0G A;  1WGY A;  1NVI D;  1WY8 A;  4K7W A;  4XC2 A;  2AWT A;  3LXF A;  3V6C B;  1SBB B;  3DVG Y;  1WXM A;  4WIP A;  3NZ3 A;  3TL5 A;  1M94 A;  4HJK A;  2K8C A;  4IWO A;  4JX1 C;  2GMI C;  2KYW A;  4WAF A;  1L0Y B;  3J9C A;  4OZA A;  1ZDV A;  2LGY A;  3L08 A;  3HM3 A;  4REZ A;  2E3T A;  3R7Q A;  1EWC A;  3RYT A;  3ZIM A;  3AE6 B;  2L05 A;  1OFF A;  2WNM A;  2KFK A;  3A9J B;  4YWG G;  2D3G A;  4A9A A;  4E3C A;  3MC8 A;  4M8N A;  1T0Y A;  3DBS A;  2JF5 A;  4WWO A;  4JIO U;  4WWN A;  1ZE3 D;  3KQ4 A;  1C1Y B;  2ASQ A;  1F52 A;  3PZ7 A;  1QZE A;  1WJ6 A;  4KGR A;  4N58 A;  2WP9 B;  1EU4 A;  1JWB D;  3KUZ A;  5E6N A;  1E90 A;  5C3J B;  1WM2 A;  2YEP B;  4RGT A;  1IYF A;  2KDF B;  2JX5 A;  4C4V B;  3URY A;  2ZEQ A;  2HTH A;  2QSD A;  2BW2 A;  3QK0 A;  1YX5 B;  3KUD B;  3PS6 A;  2KAJ A;  2UYZ B;  4ZRI A;  3D32 A;  1AAR A;  4A8X C;  2J42 A;  2W3R A;  3VR9 B;  2KTR B;  1OQY A;  4A6Q A;  3IAS 1;  1VZ6 A;  2WXL A;  4EOY A;  2ONQ A;  2M0X A;  2K5P A;  3LB8 C;  1I4Q A;  4BOS C;  2KC2 A;  2RDB C;  3N20 C;  5JHB A;  3ZJT A;  2M4N A;  3VXW A;  2BYT A;  3NJT A;  3VTW A;  2DYB A;  4TKN A;  3KW5 B;  2KD0 A;  1TS5 A;  4OZB A;  3DOW A;  3W9C B;  1N5X A;  3U4E G;  4K7U A;  4IDI A;  2Y5C A;  3V60 A;  1HXY D;  3BVG A;  4W9E A;  2K6Q A;  1RFA A;  3RFZ B;  2AQ1 B;  1JWU D;  5AUI A;  4WJP A;  5BYS A;  3VUY A;  2KQ7 A;  4KV2 A;  3ML8 A;  3C0R B;  2BS4 B;  2GBJ A;  4II2 B;  2LRU A;  4HCN B;  2N9X A;  2BWE S;  5TSS A;  4YSY B;  1JRP A;  1E7V A;  1RRB A;  2LVP A;  1JWM D;  2KNB A;  2ZW1 A;  3Q8B A;  4W9D A;  2MWS B;  5AEK B;  3Q8C A;  1C4P A;  1HZ5 A;  1WF9 A;  5FK9 C;  1V80 A;  2KX0 A;  3OG5 A;  3P63 A;  4KGT A;  4LDT D;  4FBJ B;  2MEK A;  2KHW B;  2QMT A;  1PGB A;  2J52 A;  4B9K A;  4JGH B;  3AE8 B;  3H7P B;  3JW0 X;  1LO5 D;  3NOB A;  4GN1 A;  5JXV A;  2Q5W D;  1UGM A;  1OGW A;  3U7D A;  1V81 A;  3QX1 A;  1YN3 A;  2ZNV B;  1TBE A;  2DZI A;  4USA A;  2DZK A;  4GIV A;  2KTF A;  1TIF A;  3APC A;  4G11 A;  2OJR A;  2C9W B;  2DZM A;  5FR6 A;  4A55 A;  2DEN B;  4O1N A;  2KAC A;  1ENF A;  3V3X A;  1YN4 A;  1TT5 B;  3DHH C;  4ANV A;  2JRH A;  1C78 A;  1JW9 D;  2QC8 A;  3FAH A;  4DK5 A;  1D5Z C;  3RNA C;  4GDK B;  1BXT A;  3RZW C;  3C8Y A;  2H89 B;  2BS3 B;  4S0R A;  1RAX A;  3PV1 A;  1ZDX A;  1NYQ A;  4KX6 B;  2LUE A;  3DHI C;  3I57 A;  2E6X A;  5KHO A;  5JZE B;  1HEZ E;  2KTR A;  3ONS A;  3ZDM C;  3R3M A;  2QEJ C;  2RD0 A;  2KO3 A;  1C3T A;  1UGJ A;  2Z8L A;  4PS3 A;  1FIQ A;  3BZD B;  1V86 A;  2IGG A;  3ZNH B;  4WJQ A;  1I4X A;  1WGR A;  1N60 A;  2CHW A;  1OQR A;  1E6E B;  2LGI A;  2W82 A;  4YXD B;  1WZ0 A;  3OJ4 B;  2FIF A;  3H9D A;  4RCO A;  2L0T A;  3DBL B;  2WXR A;  3AEC B;  3ALB A;  1NDD A;  1GC7 A;  3IT6 B;  3PPA A;  2D3B A;  2BT6 A;  3LDZ E;  4WJN A;  3K9P B;  1UEL A;  2MHJ A;  2K22 A;  3PRZ A;  4BKS D;  4NQK E;  5I4D A;  3U30 A;  2W3S A;  4K3C A;  2HDE A;  3S2A A;  1NEK B;  4TUU A;  3MP9 A;  5EDS A;  5MPO A;  1J7A A;  3Q14 C;  2K8H A;  2I1J A;  2J0M A;  3HVD A;  2IJ0 A;  3TEZ A;  1P7E A;  3E56 A;  3C19 A;  1KOT A;  3VUW A;  2WGS A;  1QT9 A;  4LK0 M;  1FXI A;  5CHV C;  3N1Y C;  3N30 A;  3RT3 B;  4C7Z A;  4P16 A;  4YT0 B;  1R7S A;  2JU6 X;  3PLV A;  2QCZ A;  2NTS A;  5DCN A;  2G4D B;  5CX3 A;  1SIJ A;  2OOB B;  1K53 A;  5GXG B;  4ASW C;  3H7P A;  2FBW B;  2LGD A;  1YJI A;  4NJC A;  1L5P A;  3SD5 A;  3A9K B;  2LRW A;  2YEP F;  4C56 C;  5IA7 A;  4BZA A;  1P7F A;  5AZG A;  3VR8 B;  1GB4 A;  2OHF A;  2BKR B;  3RPF C;  2SEB D;  1BT0 A;  3AMZ A;  1A5R A;  1D5M C;  2LVO A;  2H88 B;  4HKZ E;  1SIF A;  3UF8 A;  3TBL D;  1E8W A;  1CQV A;  2Y3A A;  4GDK A;  4RM8 A;  1YMH E;  2ZZP B;  4D2K A;  1ESF A;  2Z0D B;  2WDV B;  1V1P B;  4NNJ B;  2K6D B;  1EF1 A;  1VZ7 A;  3RNC C;  4NQL B;  3CST A;  3Q3M C;  1K8R B;  3VDZ A;  3P42 A;  2VH1 A;  2RPQ A;  4RGM A;  5L95 C;  2XK5 B;  3PGE A;  4RFB A;  3W1S A;  1PGX A;  2KX3 A;  2C5L C;  1TZ1 A;  2GBN A;  3AEE B;  2I2Y A;  2M56 B;  1FM0 D;  3AUL A;  1UF0 A;  3HIZ A;  1DYQ A;  3NVW A;  4XGA B;  4N59 A;  4EUT A;  4IM3 A;  3PO0 A;  3T3N A;  1FPY A;  4JE3 B;  2DYM A;  2AL6 A;  2MBB B;  2G4S A;  4DHJ B;  2IO1 B;  2K0P A;  3SFD B;  4XX5 A;  3WAL A;  2CR5 A;  1RYJ A;  4KKI A;  1KF6 B;  1I42 A;  1QOF A;  2CHX A;  4WUR A;  1FNV A;  4BKS A;  2K25 A;  2QIE B;  4LJO B;  4HKQ A;  3O65 B;  1ZW7 A;  1LFD A;  2RGF A;  5G2N A;  3APF A;  1V6E A;  1Y56 A;  3EFU A;  2KDE B;  1R4M I;  5LLI A;  1FMA D;  4WJO A;  2PE9 A;  4R3D A;  1WM3 A;  3NS8 A;  2WXF A;  1ZXH A;  5D3I B;  4IOI E;  3GE8 C;  1ACC A;  1QLB B;  5J18 A;  2C60 A;  4I6N B;  1HE8 A;  1PDX A;  3Q69 A;  4P7I A;  1WX8 A;  3VH4 B;  4HDO A;  3AE1 B;  2JSV X;  3SR6 A;  2K1F A;  1T0S C;  4RMA A;  3ZTC A;  4BAX A;  1L4D B;  4KSL C;  3A9K A;  5DPR A;  4GXB A;  2JZZ A;  3DVG X;  5CHW A;  2CU3 A;  4C00 A;  1V5T A;  4BKT A;  4F8C B;  3RZF A;  4P1B C;  1XCT L;  1TKG A;  1F1H A;  4OVZ A;  5DPW A;  2MCN B;  4JLC A;  1MPE A;  1L6U A;  1SEB D;  3ZO5 B;  4GOC A;  3RMK C;  2W54 A;  4OVU A;  3AE4 B;  4FHJ A;  1SE3 A;  2KT7 A;  1R4N I;  1V1P A;  5G5G A;  4RGN A;  1LGR A;  2BKF A;  2ZCB A;  5L83 A;  2D2Q A;  4XYC A;  2KJ6 A;  2HTM E;  3V6E B;  2XK5 A;  4MT5 A;  1KLG D;  2LJI A;  4GDL B;  3TMP B;  1WXV A;  3SHQ A;  4AP4 C;  3AI5 A;  1ZKH A;  3B2G A;  3B9J A;  2BPS A;  4JWU C;  2I38 A;  2YLM A;  2VZK B;  3CWI A;  2KKC A;  2EKE C;  4P6V F;  2MJD A;  4ZOH C;  1XXG A;  2IO0 B;  3U8Z A;  3PRE A;  3AEG B;  1QIL A;  3WAM A;  3DDC B;  4ANW A;  2JYT A;  5IP4 D;  1KM7 A;  3VH3 B;  2VZK D;  3GS2 A;  4EFO A;  2JPH A;  2MP2 B;  3DQV A;  3RI7 C;  4ZHP A;  2ZNV C;  4MH8 A;  2RPV A;  2TSS A;  2LVQ A;  4JL9 A;  2NPT B;  1WYW B;  4AOF A;  4F1S A;  2KK8 A;  2KWU B;  4M00 A;  2DWQ A;  1N61 A;  1FFU A;  1I7H A;  4XE0 A;  3IAM 1;  4IW0 A;  4Q2J A;  1FCL A;  3ZLZ A;  3L54 A;  2BVC A;  1WFY A;  1QOA A;  2PPH A;  2INC C;  3NUH B;  1C76 A;  1WR6 E;  2FE8 A;  1NI3 A;  3AEB B;  2RR9 A;  3TEW A;  3MHS D;  4NZL B;  4YTP B;  5AZF A;  1P1A A;  1EO6 A;  2ACZ B;  2MX2 A;  3TEY A;  2GBR A;  3BK1 A;  3P4P B;  3ZGZ A;  3UQB A;  1YIW A;  4HWI B;  3W1S C;  2M1M A;  3ENE A;  2PTL A;  4URK A;  2RDH A;  4TMA B;  1JML A;  1T0R C;  5DPS A;  1AW7 A;  1Z5S B;  3WIM A;  3DWG C;  2IGD A;  4EZK A;  5FR3 A;  4A3P A;  1SF0 A;  4MGK E;  1VJK A;  3TEX A;  1XLN A;  2PVG C;  1MG8 A;  3PRP B;  3ZKJ C;  2WX1 A;  3NZS A;  1SE4 A;  4WWP A;  2LGS A;  1V9J A;  1WX9 A;  4XWT A;  3QHT A;  1YQ4 B;  3L16 A;  1FRR A;  2O2V B;  2VH2 A;  2KLC A;  4FUL A;  3SFE B;  4AJW A;  1WE6 A;  1YX6 B;  3OJ3 A;  1HA5 A;  1HTO A;  2MW5 A;  5TR5 A;  3ZRC A;  1MG4 A;  4TSS A;  1E8Y A;  4RH6 A;  4K1R B;  1I4H A;  1LQB A;  3QAR A;  2EEL A;  2NBU A;  3VRA B;  3IBE A;  2IPK D;  2RMM A;  3KYC D;  1WYG A;  5FKA C;  2UU7 A;  3GZN I;  1AWD A;  2WWZ A;  3RNG C;  3WCQ A;  5LXI B;  2MH7 A;  4GDL A;  5D7G A;  1L6V A;  5BMI A;  1XLQ A;  3GP7 A;  3ABV B;  3UQA A;  4AS1 A;  1OEY J;  3R8B A;  4LNK A;  4MSM B;  1TY2 A;  3AE9 B;  4JQW C;  1TJE A;  4BKG A;  4IKG A;  2WU2 B;  3W5U B;  1T3Q A;  1CK1 A;  4TQ0 A;  3MTN B;  2LUM A;  4MGY E;  4II3 B;  2MSE D;  1G6J A;  1DOX A;  2LI5 A;  5HFY A;  1FNU A;  2J53 A;  2MP2 A;  3WAP A;  1V2Y A;  4KZC A;  3AXC A;  2KWC A;  1C4C A;  4LDT B;  2LEK A;  2NPT A;  1E8Z A;  2DYO A;  3VAW A;  1MHH E;  4XZ4 A;  2WXQ A;  1TGZ B;  1GOZ A;  2GRI A;  4QAY A;  4DQO C;  2ICI A;  2KZR A;  2KMC A;  1K52 A;  4HEA 1;  2ZPY A;  4E74 A;  2MBH A;  4W9K A;  1XF5 L;  2XBB C;  2KOX A;  1WRD B;  3KH0 A;  3DBH I;  2KMM A;  2KDM A;  1GB1 A;  4M8M A;  2XN9 C;  1U4A A;  1Z2M A;  1NEN B;  3BYT B;  4WWM A;  3Q2A C;  2LZ6 A;  3PZ8 A;  2K8B A;  1XCQ L;  2ZW0 A;  4MJS B;  1IGD A;  3N9Y C;  2IND C;  1KJT A;  3I9V 1;  3N32 A;  2L76 A;  3PT2 B;  4HK2 A;  1L7Y A;  3AEA B;  1I4R A;  1YOV B;  4ARC A;  4W9H A;  3A1Q B;  1WE7 A;  4G0N B;  3NY5 A;  2LAS A;  4NAW B;  2IO3 B;  5D6J B;  3GE3 C;  2O2V A;  4CYE A;  3W2D A;  3B2F A;  2JZP A;  4MH0 E;  5AUK A;  1TKY A;  5CTR C;  3K9O B;  1TS2 A;  4YL8 A;  1WSP A;  3OLM D;  2IY0 B;  1F2R I;  2BYE A;  2NS5 A;  4A3O A;  4EZL A;  1XEE A;  3MFG A;  2EMS A;  3Q3J A;  4MGI E;  2V4L A;  1P3Q U;  4MGZ E;  4DHZ B;  5JH5 C;  2REX A;  3M95 A;  1VZ8 A;  4NAM A;  1YJJ A;  1N6Z A;  3VTV A;  5G5H A;  4KKJ A;  2KQ4 X;  4IM0 A;  3ZNZ B;  4KDL B;  1QQR A;  1WR1 A;  1E8X A;  3B08 A;  2PJH A;  1TYG B;  1FCC C;  2BYF A;  4N9F 4;  1UBQ A;  4FLH A;  3HHM A;  2FCS A;  5T8I A;  2MBE A;  2A4Z A;  3DHG C;  3ZYY X;  2HJ1 A;  2R2Q A;  2WDR B;  2D11 A;  3DPD A;  2KFJ A;  1K51 A;  5IKC M;  2DAF A;  4EEW A;  4JWS C;  1VRA B;  3LJ3 A;  3MJ5 A;  4FJY A;  3KLS X;  2RSU A;  1IBX B;  2WX0 A;  4EKU A;  3DCG A;  2K3U A;  4JPS A;  3UIO B;  2L1A A;  2M0A A;  2MJE A;  2N9K A;  1Q10 A;  3I63 C;  4GGQ A;  3ZW3 A;  3EEC A;  1GPX A;  2BB6 A;  3AU4 A;  3L17 A;  1WXQ A;  3M62 B;  5BYR A;  2N4F A;  3ZJU A;  3TCA A;  4BOZ B;  2EKI A;  4UDU C;  2L00 B;  3BVZ A;  1Q5W B;  3EUB 2;  1Q1O A;  4MJS A;  3BWU D;  4DXF A;  5BYQ A;  4NY0 A;  5IO9 A;  4ZDV A;  3PTF C;  2KVZ A;  2SAK A;  3RCZ A;  1YQ3 B;  4ZHO A;  4FN2 A;  2J0J A;  2BBC A;  3A1Q A;  1KRH A;  5HHD G;  3RNE C;  2KLG A;  2ON8 A;  1E5W A;  2FID A;  4NAW A;  1WZ3 A;  4WQO B;  4HRS A;  5H8Y E;  1WGD A;  1WJU A;  1PFD A;  3AE3 B;  5IOI A;  1WJN A;  1LXD A;  3TSS A;  3KWL A;  2KWV B;  2N1V A;  3NVV A;  2V3P A;  4L23 A;  1P9D U;  1OQQ A;  2LFI A;  2MBQ A;  3LYY A;  1CMX B;  1N62 A;  3V62 A;  3H6N A;  4ZYS A;  2IDY A;  3MJW A;  5HI1 A;  4W9J A;  3U7Z A;  1F2R C;  3A33 B;  3AE2 B;  3EGR A;  4G50 A;  3QJZ A;  2MJ3 A;  1RLF A;  2N7J A;  1F0Z A;  1L0V B;  2RDG A;  1EF5 A;  2IGH A;  2IY1 B;  3QWZ B;  4DWF A;  5BMG A;  2FCM A;  4M0W B;  3U2S C;  2ZVO A;  1E10 A;  2KQS A;  2JVC A;  3PHX B;  4XDC A;  4LJP B;  4BVU C;  2GOW A;  3VVW B;  4W9G A;  2GBK A;  2WYQ A;  2LMC A;  4ICU A;  1ZXI A;  2B3A A;  3U52 E;  2KN4 A;  4N6E B;  4KGS A;  1KTK A;  2D07 B;  4EE2 A;  2CJO A;  2JYE A;  4MM3 B;  3VQI A;  5E6P A;  4MDK E;  3P4Q B;  3ZXR A;  2KXJ A;  2UWQ A;  3SDL C;  1WRI A;  1XLO A;  3ZNG C;  4F7Z A;  2VRR B;  3I5J C;  3V05 A;  1YD8 U;  1DOI A;  4ANX A;  4CHK A;  1IBX A;  5HG2 A;  1S1Q B;  3CF6 E;  4GMV A;  4A90 A;  5EE1 A;  1VCB A;  2C7H A;  4ZRQ A;  3IXS A;  4YTM B;  3M3J A;  1MI0 A;  1RWS A;  1I4G A;  1FFV A;  2LD9 A;  4PYU A;  2WU5 B;  3DBL I;  1VR9 A;  2BB5 A;  1E7P B;  3ETR A;  4NPN A;  1XT9 B;  3MHZ A;  1KFY B;  1V97 A;  4HPL B;  1UNS A;  2L7R A;  4US8 A;  2DX5 B;  2KDB A;  4I6P A;  2L3Z A;  1N5W A;  4TV3 A;  1JRU A;  1OEY A;  3EHV A;  4IC7 B;  2LJ5 A;  2NTT A;  1UH6 A;  1MFW A;  3BIN A;  3HRD D;  4HVB A;  4GB9 A;  2V9H A;  1MHX A;  1GUA B;  2PW9 A;  3ZDT A;  2AEH A;  2QIL A;  3H7S A;  3HK0 A;  3TJP A;  5LXH A;  1UUP A;  2K39 A;  1UBI A;  1YQB A;  1TS3 A;  4DBG A;  2O6V D;  4DXA B;  2FCN A;  2LHD A;  1QF6 A;  3AE7 B;  1J7B A;  2AX5 A;  1JCK B;  1UD7 A;  4FJV B;  4M01 A;  1IGC A;  2PIA A;  3IG3 A;  1Y8R C;  2NVU I;  1I4P A;  2WHI A;  5EE0 A;  4RGO S;  4WQM A;  3A4S C;  2BWF A;  4A20 A;  4IM2 A;  4BBN F;  3AV8 A;  4M0W A;  1HZ6 A;  1YJ1 A;  4DHZ E;  3AH7 A;  3B1L X;  2G1E A;  3EA6 A;  3UIN B;  4B0E A;  2GI9 A;  4LNI A;  3ECI A;  4C80 A;  5IN7 A;  5C23 A;  4PS8 A;  3PVL A;  4J3O D;  4HDQ A;  4MM3 A;  1T5X D;  3APD A;  2Y5P A;  1VD2 A;  2CU1 A;  3QQ8 B;  4LNF A;  4FAD A;  1OTR B;  3NS1 A;  4ANU A;  2KJH B;  4CQN A;  3Q8F A;  3T9L A;  3GB1 A;  1C79 A;  5C1Z A;  4MEL A;  3VHT C;  2BS2 B;  1WGG A;  2OJW A;  5G55 A;  2MRP A;  2MA9 B;  4J6I A;  2JRI B;  1J19 A;  3N3K B;  2ZCC A;  1GAQ B;  2M19 A;  1PGA A;  3NRZ A;  1ET9 A;  2JWU A;  1E7U A;  3L4P A;  2ZPN A;  2W9N A;  2WDT B;  4DXG A;  5IAA C;  3NG0 A;  2DBY A;  1IPG A;  4ZYN A;  3IFW B;  3OWE B;  2J4X A;  3RUI B;  1IP9 A;  2JUO A;  2V4I B;  4IWQ A;  1SE2 A;  2K9X A;  2M17 A;  2G3Q B;  1WX7 A;  2LXC A;  4HJG E;  2J7Q B;  1NI2 A;  2IBI B;  2NCN A;  3ZRF A;  4BBN C;  1B1Z A;  4LNO A;  3PHW B;  2FAZ A;  3JSV B;  4FXC A;  1Q0W B;  1XQQ A;  3WAN A;  2O6V A;  2PVO D;  4NJ6 A;  2LXA A;  2C7N B;  2C7M B;  4HRO A;  4FJZ A;  4IWP A;  4FA6 A;  1DGJ A;  2IZV B;  2V1Y A;  1FD6 A;  4IG7 B;  1NYR A;  3JVZ X;  4K81 A;  2HJ8 A;  3UIP B;  1ISN A;  2NBW B;  4HPP A;  4ARI A;  1L0X B;  1JRO A;  5J2R A;  4ZRP A;  2DAJ A;  4ACF A;  4HPM B;  3QA8 A;  2KMA A;  4CO7 A;  3ZJV A;  1WGK A;  2N7E A;  5E6O A;  2INP E;  2WXP A;  4FHK A;  2L52 A;  2V3N A;  1ZOY B;  1DOY A;  2WXJ A;  1C9F A;  1CJE A;  4KIK B;  3NHE B;  2XEW A;  1VLB A;  5BMH A;  2WXM A;  3R2T A;  1V5O A;  1EM7 A;  4AQ7 A;  2AQ3 B;  3I3T B;  2L8J A;  4GU2 A;  1AYF A;  1ZP0 B;  3P2B A;  4KVG B;  1F9J A;  2G9H D;  2WDQ B;  1H4R A;  2BQQ A;  4K7S A;  2CS4 A;  5KHQ A;  3SEB A;  2G45 B;  2N0S B;  5LNK 1;  2WXN A;  1FXA A;  1YN5 A;  1L4Z B;  1RFK A;  2NMQ A;  1JWA D;  4I6L B;  4PK1 A;  2CJN A;  2X38 A;  2WXH A;  4GSW A;  3DVN V;  3FKY A;  1FO4 A;  3P4R B;  4YSZ B;  2N7D A;  2WLB A;  2M8S A;  5EE3 A;  2JWZ A;  2N1W A;  4US9 A;  1A70 A;  4L2Y A;  2DNF A;  1WXS A;  3A9J A;  2DHZ A;  4DDG D;  4EZJ A;  3DVN U;  1FRD A;  3NZU A;  3ZUN A;  4DDI D;  1JQ4 A;  2Z59 B;  3ZXV A;  2MQJ A;  3NVY A;  3RN9 C;  2IYD B;  3PZD A;  1E0Z A;  3CMM B;  2NBV B;  3ZNI D;  1EUV B;  5C2T B;  5E6J A;  3SU8 X;  1FNW A;  2WXG A;  3KYD D;  3GOE A;  2WXK A;  3BII D;  5D2M B;  4XDD A;  1UWM A;  4C4V A;  2JXT A;  4LLG M;  2PKO A;  4H2A A;  1SXT A;  3W1Y A;  4E71 A;  1L2N A;  4AJY B;  1TTN A;  3HUI A;  3JSV A;  2I1K A;  1C4A A;  1V8C A;  5D3D A;  1R4M B;  4KDI C;  1BUI C;  1UZX B;  4LCD E;  3DBR B;  3QIJ A;  4BFR A;  1XLP A;  1ROE A;  3X23 A;  1T6B X;  2LWP A;  1QOG A;  4KSK C;  4W9I A;  1AN8 A;  1KH0 A;  1ET6 A;  1WGH A;  2KVR A;  1V1O A;  1D4B A;  1P0R A;  3R7R A;  2BTE A;  4HXD A;  4ITK A;  4WAA A;  2PLP A;  3AN1 A;  3NVZ A;  5CHF A;  3PSE B;  4NJ7 A;  4HCP B;  4PT5 A;  4WH4 A;  1GNU A;  2QHO A;  4KIK A;  3O13 A;  3M63 B;  2W55 A;  1JWS D;  1K50 A;  3UI3 A;  2L83 A;  3H1U A;  3ML9 A;  2N9L A;  1SJH D;  3QAQ A;  2J0K A;  5AZH A;  1PYW D;  2DLB A;  1QOB A;  4HLE A;  4RF0 A;  4XWW A;  3FIL B;  4B95 A;  3VUX A;  2AYO B;  1EU3 A;  1R4N B;  4RM9 A;  4B6W A;  4PS7 A;  2PEA A;  2MBO A;  2HE7 A;  3W5V B;  3PRM B;  3H8H A;  1RM6 C;  2L32 A;  1HQR D;  3EC8 A;  3HM6 X;  3L0W B;  5BO4 B;  1ZGU B;  4PYZ A;  4OHJ A;  1S3S G;  3MC9 A;  3P1M A;  2V3S A;  4W9F A;  4YSX B;  2JT4 B;  1SGH A;  3B0A A;  4W9C A;  1HTQ A;  1XD3 B;  5GMV A;  3HVZ A;  2BF8 B;  1GG3 A;  1CZP A;  4OVV A;  3X0W A;  4L1B A;  2A5U A;  4MAC A;  3ZTD A;  2FUG 1;  3KWV A;  2PE6 B;  4S17 A;  2FUH B;  3V61 A;  4KZ0 A;  1TKE A;  3CIR B;  1GJZ A;  3ZVV A;  1TS4 A;  3IVF A;  2WS3 B;  2L0F A;  1TY0 A;  4LTU A;  3Q8E A;  3VTU A;  4OW0 A;  3VFK A;  5D94 A;  2N9P C;  1FXT B;  1MJD A;  2R2O A;  1TZO A;  1MVK A;  1SJE D;  2D10 A;  1WH3 A;  3Q3O C;  4G3X B;  3AU5 A;  1SE9 A;  3MC0 B;  4YTN B;  4TQ1 A;  1ZPS A;  3BVM A;  2JXX A;  3E9S A;  1WWT A;  2IO2 B;  2FCQ A;  4RNA A;  3DWM A;  3L13 A;  1FEH A;  3L10 B;  3BK2 A;  1EWY C;  2AL3 A;  1D6E C;  3BY4 B;  2V0G A;  2WQY B;  1ZUD 2;  2DZJ A;  2FNJ B;  1WMH B;  3RUL A;  5H92 C;  1D5X C;  1VDV A;  3P4S B;  3WA0 A;  5EE9 A;  1C77 A;  3R66 C;  5JHA A;  2ZJD A;  3FC4 A;  1H8C A;  2AQ2 B;  1M4V A;  2X8X X;  3IHP C;  2GLS A;  2JQR B;  1T0Q C;  1WI0 A;  1E9M A;  1B9R A;  3EFC A;  4RF1 A;  1GC6 A;  3AEF B;  2LHE A;  2QJL A;  4DHJ D;  2WXI A;  3CSF A;  4ICV A;  1UWX A;  2KC1 A; 
#chains in the Genus database with same CATH homology
 2K8H A;  2I1J A;  2J0M A;  1NBF C;  2KZR A;  2KMC A;  1VD2 A;  2CU1 A;  3QQ8 B;  1KOT A;  3VUW A;  2MLB A;  2KFK B;  5CHV C;  3DBR I;  4X57 B;  5J17 A;  2ZPY A;  3N30 A;  3RT3 B;  4E74 A;  4FAD A;  1OTR B;  2MBH A;  4W9K A;  2YVC A;  2XBB C;  4ANU A;  1WJ4 A;  3PLV A;  2KOX A;  2KJH B;  4AWJ A;  2Z0E B;  1WRD B;  5DCN A;  3T9L A;  3KH0 A;  2G4D B;  5CX3 A;  3DBH I;  5C1Z A;  2OOB B;  4MEL A;  4ASW C;  3VHT C;  4M8M A;  1PQS A;  1U4A A;  1Z2M A;  3H7P A;  1WGG A;  1WXA A;  4IUM B;  2LGD A;  3SD5 A;  3A9K B;  5G55 A;  2BYV E;  2MRP A;  2LRW A;  2LZ6 A;  2K8B A;  2MA9 B;  4J6I A;  2JRI B;  1J19 A;  3N3K B;  4MJS B;  2ZCC A;  2KJR A;  2CKH B;  2BGF A;  2NR2 A;  1KJT A;  2KDI A;  3N32 A;  5IA7 A;  2L76 A;  3PT2 B;  5AZG A;  4HK2 A;  1E7U A;  1L7Y A;  2ZPN A;  2BKR B;  3TIX A;  2W9N A;  1BT0 A;  3WAO A;  2WDT B;  1A5R A;  5IAA C;  4W9H A;  3A1Q B;  1IPG A;  2LVO A;  4ZYN A;  1WE7 A;  4G0N B;  1J8C A;  2LGX A;  3IFW B;  3NY5 A;  1WIA A;  1SIF A;  4MSQ B;  3RUI B;  5DPT A;  1IP9 A;  2JUO A;  2LAS A;  1V49 A;  3UF8 A;  4NAW B;  1E8W A;  3TBL D;  4IWQ A;  3RD2 A;  2IO3 B;  5D6J B;  2M17 A;  2G3Q B;  4GDK A;  1WX7 A;  3T8M A;  2LXC A;  1X1M A;  4RM8 A;  3OAW A;  2ZZP B;  2O6V B;  2O2V A;  2Z0D B;  4CYE A;  2J7Q B;  2N9E B;  1NI2 A;  2GBM A;  2IBI B;  2K6D B;  2NCN A;  4NNJ B;  4MH0 E;  3ZRF A;  3QCA A;  1EF1 A;  3PHW B;  4ZRK A;  2FAZ A;  4BBN C;  3JSV B;  4NQL B;  1Q0W B;  5CTR C;  3CST A;  2CHZ A;  1K8R B;  3VDZ A;  1XQQ A;  3K9O B;  4YL8 A;  2JZ3 B;  3WAN A;  2RPQ A;  2O6V A;  3OLM D;  5L95 C;  2XK5 B;  3UGB B;  2IY0 B;  2BYE A;  3PGE A;  2NS5 A;  4NJ6 A;  3W1S A;  4A3O A;  5HKH A;  2LXA A;  4EZL A;  1LM8 B;  2C7N B;  2C7M B;  1D3Z A;  2KX3 A;  2EMS A;  4FJZ A;  4IWP A;  4FA6 A;  2IZV B;  2V1Y A;  3Q3J A;  2C5L C;  3KVF B;  1TZ1 A;  4MGI E;  2GBN A;  4IG7 B;  4MEM A;  3JVZ X;  2V4L A;  2HJ8 A;  4K81 A;  1ISN A;  1P3Q U;  2HD5 B;  2KAN A;  3UIP B;  2NBW B;  3AUL A;  3PLU A;  3HIZ A;  1KLV A;  4MGZ E;  4DHZ B;  5J2R A;  5JH5 C;  4AUQ C;  2REX A;  1I35 A;  2DAJ A;  3M95 A;  4HPM B;  4ZRJ A;  3QA8 A;  2KMA A;  4CO7 A;  3VTV A;  2KN5 A;  4EUT A;  2N7E A;  3A4R A;  4IM3 A;  4IM0 A;  5E6O A;  3QC8 B;  2Y5B B;  3JYU A;  4FHK A;  2DYM A;  3ZNZ B;  4KDL B;  3KUC B;  2AL6 A;  1WR1 A;  1E8X A;  2MBB B;  2JY6 A;  3B08 A;  1WMH A;  2G4S A;  4DHJ B;  2IO1 B;  2PJH A;  2EMT A;  3Q3F A;  4XX5 A;  3WAL A;  4KIK B;  2BYF A;  2CR5 A;  3NHE B;  4W9L A;  1P98 A;  2XEW A;  4N9F 4;  1I42 A;  2CHX A;  2ZVN A;  1UBQ A;  4FLH A;  1V5O A;  1J0G A;  3HHM A;  1WGY A;  2FCS A;  2MBE A;  4BKS A;  2A4Z A;  1WY8 A;  2K25 A;  4K7W A;  4XC2 A;  3I3T B;  4LJO B;  3O65 B;  2AWT A;  3V6C B;  1ZW7 A;  1LFD A;  2R2Q A;  3DVG Y;  1WXM A;  2L8J A;  2RGF A;  2D11 A;  3DPD A;  4GU2 A;  5G2N A;  3P2B A;  3APF A;  2KFJ A;  4KVG B;  3TL5 A;  1V6E A;  1M94 A;  1F9J A;  4HJK A;  2K8C A;  1H4R A;  4K7S A;  4IWO A;  2CS4 A;  2GMI C;  5KHQ A;  3EFU A;  2DAF A;  4EEW A;  2KDE B;  2G45 B;  1R4M I;  2LGY A;  3L08 A;  5LLI A;  3HM3 A;  4WJO A;  2PE9 A;  1WM3 A;  3LJ3 A;  4FJY A;  2RSU A;  3R7Q A;  3NS8 A;  4I6L B;  3RYT A;  3ZIM A;  2L05 A;  4GSW A;  2WX0 A;  3DVN V;  4EKU A;  5J18 A;  3DCG A;  3UIO B;  2KFK A;  2C60 A;  3A9J B;  4I6N B;  1HE8 A;  2N7D A;  2D3G A;  4P7I A;  1WX8 A;  4E3C A;  3VH4 B;  4M8N A;  4GGQ A;  2M8S A;  3ZW3 A;  2JWZ A;  3EEC A;  2N1W A;  1T0Y A;  3L17 A;  3AU4 A;  3DBS A;  2JF5 A;  4HDO A;  1WXS A;  3M62 B;  4JIO U;  4WWO A;  3A9J A;  4WWN A;  2N4F A;  2DHZ A;  4DDG D;  1C1Y B;  2ASQ A;  4EZJ A;  1QZE A;  2K1F A;  4RMA A;  3TCA A;  4BOZ B;  1WJ6 A;  3DVN U;  3ZTC A;  4KSL C;  3NZU A;  3A9K A;  5DPR A;  3ZUN A;  4GXB A;  4DDI D;  2JZZ A;  3DVG X;  2L00 B;  2Z59 B;  5CHW A;  1Q5W B;  1Q1O A;  4MJS A;  2MQJ A;  3KUZ A;  5E6N A;  1E90 A;  1V5T A;  1WM2 A;  1IYF A;  2KDF B;  4NY0 A;  4BKT A;  4F8C B;  3RZF A;  4ZDV A;  3PTF C;  2IYD B;  3PZD A;  5DPW A;  2MCN B;  3CMM B;  2NBV B;  4JLC A;  2ZEQ A;  2HTH A;  3RCZ A;  3ZNI D;  1EUV B;  4FN2 A;  2J0J A;  3SU8 X;  3KYD D;  3GOE A;  3A1Q A;  5D2M B;  3QK0 A;  1YX5 B;  3KUD B;  3PS6 A;  3ZO5 B;  4GOC A;  2KLG A;  1E5W A;  2FID A;  4OVU A;  4NAW A;  3W1Y A;  4E71 A;  1WZ3 A;  4FHJ A;  2UYZ B;  4WQO B;  4ZRI A;  1L2N A;  4AJY B;  1R4N I;  3D32 A;  1AAR A;  1WGD A;  1WJU A;  2KTR B;  1TTN A;  1WJN A;  1LXD A;  2BKF A;  1OQY A;  3JSV A;  2ZCB A;  2I1K A;  5L83 A;  2D2Q A;  2KWV B;  4KDI C;  2KJ6 A;  2N1V A;  1UZX B;  1P9D U;  4EOY A;  3V6E B;  2XK5 A;  2M0X A;  4LCD E;  4GDL B;  3QIJ A;  2MBQ A;  3TMP B;  1WXV A;  4BOS C;  4BFR A;  1CMX B;  2KC2 A;  3V62 A;  3SHQ A;  3H6N A;  4AP4 C;  5JHB A;  2M4N A;  3X23 A;  3VXW A;  3AI5 A;  3MJW A;  2LWP A;  3VTW A;  2DYB A;  4TKN A;  3KW5 B;  4W9J A;  1ZKH A;  2KD0 A;  3A33 B;  2BPS A;  4G50 A;  4KSK C;  2YLM A;  3DOW A;  3QJZ A;  4W9I A;  1WGH A;  2KKC A;  1RLF A;  2KVR A;  2EKE C;  1P0R A;  1EF5 A;  2IO0 B;  2IY1 B;  3QWZ B;  4K7U A;  3R7R A;  3V60 A;  4DWF A;  3U8Z A;  3PRE A;  2FCM A;  4HXD A;  3WAM A;  4M0W B;  3DDC B;  4W9E A;  4WAA A;  2ZVO A;  4ANW A;  1KM7 A;  2K6Q A;  5CHF A;  1RFA A;  3PSE B;  3VH3 B;  4EFO A;  4NJ7 A;  2JPH A;  2MP2 B;  3DQV A;  4HCP B;  2ZNV C;  2KQS A;  2JVC A;  3PHX B;  1GNU A;  2QHO A;  4LJP B;  4BVU C;  2GOW A;  4WJP A;  4KIK A;  3VVW B;  3M63 B;  3VUY A;  2KQ7 A;  2LVQ A;  4KV2 A;  4W9G A;  4JL9 A;  3ML8 A;  2NPT B;  1WYW B;  2GBK A;  2WYQ A;  4AOF A;  4F1S A;  2KK8 A;  4ICU A;  3C0R B;  2B3A A;  3H1U A;  2GBJ A;  2KWU B;  4II2 B;  3ML9 A;  2LRU A;  4HCN B;  2D07 B;  3QAQ A;  2J0K A;  2N9X A;  5AZH A;  2BWE S;  1E7V A;  1RRB A;  3VQI A;  2LVP A;  4IW0 A;  2KNB A;  4HLE A;  5E6P A;  4MDK E;  3ZLZ A;  4W9D A;  2KXJ A;  2MWS B;  2UWQ A;  3L54 A;  5AEK B;  1WFY A;  3SDL C;  4B95 A;  3VUX A;  1WF9 A;  3ZNG C;  4F7Z A;  1V80 A;  2AYO B;  2VRR B;  2PPH A;  2KX0 A;  4RM9 A;  1WR6 E;  4PS7 A;  4B6W A;  4LDT D;  1YD8 U;  2PEA A;  4FBJ B;  2MBO A;  2HE7 A;  2KHW B;  2RR9 A;  4ANX A;  3MHS D;  5AZF A;  1P1A A;  1EO6 A;  3PRM B;  4CHK A;  2MX2 A;  1S1Q B;  3CF6 E;  2GBR A;  4GMV A;  4B9K A;  3UQB A;  1YIW A;  4HWI B;  3W1S C;  3EC8 A;  3HM6 X;  2M1M A;  3L0W B;  1VCB A;  2C7H A;  3ENE A;  4JGH B;  3H7P B;  3JW0 X;  5BO4 B;  1ZGU B;  4PYZ A;  4URK A;  1S3S G;  3NOB A;  4W9F A;  2V3S A;  4GN1 A;  3M3J A;  2JT4 B;  1SGH A;  1UGM A;  1OGW A;  3B0A A;  3U7D A;  5DPS A;  4W9C A;  1V81 A;  1Z5S B;  3QX1 A;  2LD9 A;  2ZNV B;  1TBE A;  2DZI A;  4PYU A;  3WIM A;  1XD3 B;  3DBL I;  2DZK A;  4GIV A;  2KTF A;  5GMV A;  3APC A;  4G11 A;  2OJR A;  2BF8 B;  4EZK A;  2C9W B;  2DZM A;  5FR6 A;  4A3P A;  4NPN A;  1GG3 A;  4MGK E;  4OVV A;  2DEN B;  1XT9 B;  3X0W A;  2A5U A;  1MG8 A;  3PRP B;  3ZKJ C;  3ZTD A;  2WX1 A;  4HPL B;  3NZS A;  4ANV A;  2L7R A;  2JRH A;  4WWP A;  2DX5 B;  2KDB A;  2PE6 B;  1V9J A;  2FUH B;  3V61 A;  4KZ0 A;  4I6P A;  1WX9 A;  4DK5 A;  2L3Z A;  1GJZ A;  4GDK B;  4TV3 A;  3ZVV A;  3RZW C;  3QHT A;  3L16 A;  1JRU A;  1OEY A;  2O2V B;  2KLC A;  3EHV A;  4IC7 B;  2LJ5 A;  1RAX A;  3IVF A;  3PV1 A;  4FUL A;  1UH6 A;  4AJW A;  1WE6 A;  2L0F A;  1YX6 B;  3BIN A;  3OJ3 A;  4HVB A;  2LUE A;  2MW5 A;  5TR5 A;  3ZRC A;  3VTU A;  4GB9 A;  1E8Y A;  5KHO A;  4K1R B;  3VFK A;  5D94 A;  1GUA B;  2N9P C;  1FXT B;  2R2O A;  5JZE B;  1LQB A;  3QAR A;  2KTR A;  3ZDT A;  2AEH A;  2D10 A;  2NBU A;  3H7S A;  3ONS A;  3ZDM C;  1WH3 A;  3IBE A;  3R3M A;  2RD0 A;  3KYC D;  3HK0 A;  3TJP A;  4G3X B;  5LXH A;  3AU5 A;  1SE9 A;  2KO3 A;  2K39 A;  1UBI A;  4TQ1 A;  1YQB A;  1C3T A;  3GZN I;  2WWZ A;  4DBG A;  4PS3 A;  2O6V D;  5LXI B;  4DXA B;  2JXX A;  1V86 A;  3ZNH B;  4GDL A;  5D7G A;  2FCN A;  3UQA A;  1OEY J;  4WJQ A;  2IO2 B;  2FCQ A;  3L13 A;  1WGR A;  3L10 B;  2CHW A;  4MSM B;  2AL3 A;  4JQW C;  3BY4 B;  1UD7 A;  4BKG A;  4FJV B;  2DZJ A;  2FNJ B;  1WZ0 A;  3OJ4 B;  1WMH B;  3RUL A;  3IG3 A;  1Y8R C;  2FIF A;  2NVU I;  4TQ0 A;  3MTN B;  3H9D A;  4MGY E;  2L0T A;  4II3 B;  3A4S C;  2MSE D;  2BWF A;  1G6J A;  4A20 A;  2LI5 A;  4IM2 A;  4BBN F;  3ALB A;  3WA0 A;  1NDD A;  1YJ1 A;  4DHZ E;  2MP2 A;  3WAP A;  3R66 C;  1GC7 A;  5JHA A;  1V2Y A;  3B1L X;  2ZJD A;  4KZC A;  1H8C A;  3AXC A;  2KWC A;  3PPA A;  3IHP C;  3UIN B;  4LDT B;  1WI0 A;  3LDZ E;  2NPT A;  4WJN A;  1GC6 A;  1UEL A;  3K9P B;  1E8Z A;  2DYO A;  3ECI A;  3PRZ A;  4BKS D;  4DHJ D;  4NQK E;  3VAW A;  3U30 A;  5C23 A;  4PS8 A;  4XZ4 A;  3S2A A;  3CSF A;  3PVL A;  4HDQ A;  1TGZ B;  4ICV A;  4TUU A;  4MM3 A;  2KC1 A;  3APD A;  5EDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...