2KFKA

Solution structure of bem1p pb1 domain complexed with cdc24p pb1 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
b'PHMKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bud emergence protein 1
publication title NMR structure of the heterodimer of Bem1 and Cdc24 PB1 domains from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 10
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kfkA00
2HJ8A 2KO3A 4I6LB 2KTRB 2PPHA 2DHZA 4FULA 2ZVOA 4GU2A 4ZYNA 1TGZB 2ZCCA 3L54A 3A4SC 3H7PB 2MX2A 3PHXB 4PYUA 1X1MA 2NVUI 1Z5SB 4AJYB 3VTVA 1J0GA 4B95A 1YX5B 2MW5A 1WJ6A 2KMAA 4MM3A 1WYWB 3A9JB 3JSVA 2BPSA 4DHJD 4PS3A 2BYVE 2DAFA 4EFOA 1WGRA 1WZ3A 2KQSA 4WJNA 3VUXA 2MRPA 3RZWC 4DDGD 3EHVA 5AEKB 2IY1B 3ONSA 4X57B 2M17A 2W9NA 3HM3A 1J19A 4NJ7A 2BF8B 2KD0A 1WR6E 1L7YA 2A4ZA 2D07B 3CSTA 4J6IA 4LDTB 4NNJB 1TTNA 2I1JA 4RM9A 1GNUA 2GBMA 4NQKE 1YX6B 4BKSD 3KUDB 3QC8B 2BWFA 2ZVNA 2ZJDA 5J2RA 3N30A 2K1FA 1TZ1A 2MSED 4JL9A 2FCNA 4E71A 4GXBA 3PS6A 4EOYA 1H8CA 3QCAA 2KX0A 1OEYJ 3H7PA 3K9OB 2C5LC 4W9IA 2IY0B 3S2AA 2K8HA 4BVUC 5JZEB 4KIKB 4DHJB 3TL5A 1WMHB 1Z2MA 2J0MA 1OEYA 3A33B 1WE6A 3A9JA 3QARA 4BOSC 2DZKA 3LJ3A 2MA9B 1GJZA 2ZCBA 4CYEA 2L0FA 2C7NB 3PZDA 3ZIMA 3L17A 3VDZA 4BKGA 4MJSB 4M0WB 2FNJB 2M4NA 3DOWA 3M62B 2GBNA 3DVNU 3VH3B 2HE7A 2MLBA 5DPSA 4MH0E 1OTRB 3JVZX 2AYOB 1V5TA 3GZNI 4KV2A 2V4LA 4K1RB 2K6QA 3KUZA 3H7SA 5L83A 2R2QA 4B9KA 2WDTB 2RD0A 3QA8A 4KIKA 3WAMA 3RD2A 4FLHA 1WMHA 4NQLB 3QAQA 3IBEA 4MEMA 4LJPB 4FBJB 2BYEA 5JHBA 4IWQA 2NBUA 3V62A 5DPWA 4TQ0A 1GG3A 4AWJA 2N9PC 1OGWA 1SIFA 3M95A 2DZJA 5CHVC 2O2VB 3KW5B 5IAAC 3A9KA 2FCQA 1VCBA 2JZZA 2C7HA 4IM3A 5LXIB 2K39A 3CSFA 1D3ZA 4IC7B 3R66C 3UQAA 2EKEC 3ZW3A 2C7MB 3L0WB 3NS8A 3KYDD 4RM8A 2FAZA 4WJOA 2MCNB 2LUEA 1KJTA 1GC7A 1WXVA 2LWPA 3AU5A 4TV3A 3UGBB 3AULA 4P7IA 2VRRB 2KWCA 4GGQA 2CU1A 1ZGUB 1E5WA 2G3QB 3TBLD 4JQWC 2KZRA 5GMVA 4BFRA 3KYCD 2KJRA 4IW0A 1WJ4A 3PV1A 4GSWA 4I6NB 3PVLA 1WGDA 1EF1A 1YD8U 2K8BA 2KC1A 2NS5A 3KVFB 5AZFA 2J0JA 1ISNA 4KDLB 1S3SG 4PYZA 3CMMB 2L05A 3NY5A 4GMVA 4WWOA 5KHOA 2O2VA 3DBLI 3JYUA 1F9JA 4EZLA 3M3JA 3NHEB 4BKTA 1J8CA 4IWPA 4GOCA 3KUCB 2LRWA 2KVRA 2HTHA 3AXCA 4GIVA 4LJOB 3L16A 4XC2A 2DYOA 3WA0A 3ZTCA 4URKA 2LD9A 4MSQB 1OQYA 2OOBB 4EZJA 5E6NA 2RR9A 1KLVA 4NAWB 3ZNGC 3APFA 1WM2A 2WX0A 4N9F4 1E90A 1XD3B 1UBQA 2BWES 2G45B 2LZ6A 3R3MA 4NY0A 3Q3JA 2XK5B 2DX5B 2ZNVB 2DYBA 4DHZE 4ANUA 2KMCA 1LM8B 4GDLA 1WH3A 4KZCA 3ZO5B 4HCNB 4PS8A 5D2MB 5J17A 1V6EA 3MHSD 2WX1A 2AWTA 2D10A 3IFWB 4FHJA 4WQOB 2RPQA 1HE8A 4IWOA 2ZPYA 5CHWA 5G55A 1WGGA 2IO0B 4GB9A 2MBHA 1YQBA 2L0TA 2D2QA 2BGFA 2YLMA 3IHPC 2N4FA 2JF5A 4NPNA 3LDZE 3RZFA 2UYZB 4EZKA 3ML9A 2NBWB 4TUUA 4W9HA 2KTRA 1Q5WB 1V80A 1SE9A 3UF8A 4WWPA 4AUQC 3BY4B 4ICVA 5AZGA 3UIPB 3ALBA 4NAWA 2LJ5A 2NBVB 3OJ3A 1V9JA 2DAJA 2YVCA 4K7UA 4ANVA 2FIDA 3DCGA 2JT4B 1L2NA 2XK5A 1V2YA 4W9EA 2KWUB 3O65B 2GBKA 4ZRKA 3ZLZA 3V6CB 1I35A 1UELA 2EMSA 4K7WA 1WX8A 2KDIA 1R4MI 2KQ7A 4HJKA 4MGKE 2O6VD 2IBIB 2MP2B 2KFJA 4FA6A 1C3TA 3AU4A 2JVCA 2KJHB 1H4RA 4IM0A 3PLUA 1YJ1A 2LI5A 4HPLB 2OJRA 4HLEA 1LXDA 3BINA 2KWVB 3DVGY 5DPRA 2CS4A 2MWSB 5LLIA 3ZKJC 2CHXA 1V49A 2AL6A 3JW0X 4HVBA 1UGMA 1KOTA 3PRMB 5DPTA 4MSMB 5BO4B 4KVGB 2JXXA 4PS7A 3UQBA 2K25A 4HDOA 3OLMD 5CX3A 2FUHB 4M8NA 1XQQA 2O6VB 4W9CA 2FCMA 2Z0DB 5AZHA 1EUVB 2AEHA 2MBEA 2N1WA 4YL8A 3X23A 4BBNC 3HM6X 3SHQA 3U7DA 2RSUA 4DDID 4MJSA 2KJ6A 3W1SA 2KANA 2M8SA 1P1AA 4BKSA 3HHMA 4LCDE 1EO6A 4FHKA 4ZRIA 3NZUA 4MGZE 1WZ0A 4A3PA 3D32A 4DHZB 3A1QB 3H6NA 1MG8A 2N9XA 3WAPA 4IG7B 3DVNV 3VTUA 4HDQA 1IPGA 2KOXA 1WM3A 2JY6A 4DXAB 2XEWA 4HCPB 4HPMB 4A20A 1UZXB 2ZEQA 4OVVA 1WGYA 3QHTA 4I6PA 3CF6E 2O6VA 3OAWA 1V5OA 2G4DB 5D94A 4BOZB 4OVUA 4EEWA 2B3AA 5DCNA 3DBRI 4EKUA 2KK8A 3MJWA 2CR5A 4ZDVA 2MQJA 4FJYA 2KLCA 5E6PA 3VUYA 3GOEA 3QJZA 2BKRB 1UH6A 2JUOA 3DVGX 3B0AA 2FIFA 1ZW7A 2L76A 1BT0A 1R4NI 4MELA 5TR5A 1WGHA 1QZEA 4JGHB 3PGEA 3R7QA 2I1KA 3TIXA 1RFAA 3ZUNA 2LGXA 4WAAA 2NCNA 4MGYE 1GC6A 4E74A 4XZ4A 5EDSA 2JRIB 4EUTA 4G3XB 3UIOB 3ZDMC 1NDDA 4IM2A 5C1ZA 2MBBB 2PE9A 3L08A 4HXDA 3I3TB 3KH0A 1WXSA 2GMIC 2A5UA 4II3B 1G6JA 2FCSA 3VQIA 2C9WB 1UD7A 3DPDA 4DWFA 2EMTA 3PRPB 3PSEB 4W9KA 3RULA 4ANXA 2PJHA 3VFKA 2LXCA 3VTWA 4MGIE 4K7SA 2C60A 2WYQA 2KTFA 1RLFA 3PPAA 3WIMA 1K8RB 3HK0A 2CHWA 4MDKE 5JH5C 1Q1OA 3PT2B 3ZNID 2AL3A 1Y8RC 2LGDA 2UWQA 1TBEA 2L7RA 1JRUA 2JWZA 3RUIB 1V81A 3DBHI 2N7EA 1WX9A 3W1SC 2GOWA 3C0RB 3H1UA 3HIZA 1YIWA 3SU8X 5JHAA 2JPHA 4W9LA 2ASQA 3A4RA 1WI0A 3ENEA 3VXWA 2QHOA 2DYMA 1V86A 3OJ4B 4WWNA 3ECIA 3VVWB 3X0WA 2KLGA 4W9JA 4ASWC 2IO3B 2R2OA 2M0XA 1Q0WB 2KX3A 3VH4B 2CHZA 2LGYA 1FXTB 2ZPNA 4IUMB 2Y5BB 4W9DA 3VUWA 3K9PB 3QWZB 5KHQA 2DZIA 2MBQA 2PEAA 2RGFA 3UINB 3MTNB 2KDBA 3EC8A 4FJVB 2IO1B 2N7DA 3QK0A 1WY8A 4KDIC 1UBIA 3VAWA 5IA7A 2M1MA 2N9EB 4WJQA 2V3SA 2KNBA 3IVFA 2KDFB 1A5RA 2ZZPB 4AP4C 4AJWA 2Z0EB 3DQVA 1RRBA 1WJUA 1U4AA 3H9DA 1AARA 2V1YA 3ZVVA 1WIAA 3WAOA 3WANA 5D6JB 4ICUA 1P98A 1KM7A 4GDKB 1IYFA 2KFKB 4CO7A 2L8JA 4RMAA 3TMPB 2NPTB 4JLCA 3M63B 3ML8A 1PQSA 3Q3FA 2MBOA 3ZRCA 3APDA 4AOFA 4FADA 4DBGA 5CHFA 1WJNA 3V6EB 2K8CA 1C1YB 4DK5A 4KZ0A 2N1VA 3PTFC 3T9LA 2KN5A 3IG3A 5HKHA 3L13A 4ZRJA 1WRDB 1E8WA 3A9KB 3L10B 3RCZA 3QIJA 3V61A 3ZTDA 1XT9B 1EF5A 2MP2A 3P2BA 2J0KA 1P0RA 2J7QB 3TJPA 2IYDB 4KSKC 3AI5A 5FR6A 3V60A 3PHWB 1T0YA 4F8CB 1IP9A 2IO2B 4M8MA 2JZ3B 3QX1A 4B6WA 3B08A 5E6OA 3PLVA 1E7VA 1WR1A 4HK2A 4F1SA 2HD5B 4ANWA 4WJPA 4JIOU 2IZVB 4GDKA 4A3OA 1E8YA 1WF9A 2KFKA 2KXJA 2Z59B 3TCAA 1LFDA 3SDLC 1NI2A 1WE7A 1WFYA 4II2B 2NPTA 4GN1A 3U30A 4CHKA 3T8MA 1VD2A 2K6DB 4NJ6A 2DENB 3DDCB 2BKFA 4BBNF 2KKCA 2LVPA 2LVOA 2DZMA 2PE6B 4TKNA 5L95C 1WXAA 1CMXB 2KC2A 3B1LX 3N3KB 2NR2A 3R7RA 2BYFA 1LQBA 1P3QU 2KHWB 2ZNVC 2D3GA 1E8ZA 1ZKHA 4W9FA 2LASA 2WWZA 2L3ZA 3PRZA 3W1YA 4G50A 2CKHB 4KSLC 4G0NB 2G4SA 3APCA 5D7GA 3WALA 5LXHA 3RYTA 3A1QA 2D11A 4FJZA 3SD5A 4FN2A 2GBRA 4F7ZA 2REXA 1WXMA 4XX5A 3ZNZB 4W9GA 2LXAA 4G11A 3NOBA 3PREA 4K81A 2KDEB 2XBBC 1E7UA 3VHTC 5J18A 1NBFC 3JSVB 2GBJA 4TQ1A 3N32A 5G2NA 3ZDTA 1I42A 4GDLB 1GUAB 5CTRC 1E8XA 3ZRFA 2JRHA 1P9DU 5C23A 4E3CA 3NZSA 3EFUA 3EECA 3RT3B 1RAXA 2LVQA 4HWIB 3QQ8B 1S1QB 3DBSA 1SGHA 3ZNHB 1WX7A 4LDTD 3U8ZA 2LRUA 2L00B 1M94A
chains in the Genus database with same CATH superfamily
1MHXA 2HJ8A 4I6LB 2KTRB 2PPHA 2ZVOA 4ZYNA 3L54A 3MFGA 4D2KA 4B95A 1QF6A 1LO5D 2KMAA 2BPSA 1N60A 1T0SC 4DDGD 1QOGA 1AWDA 4X57B 3HM3A 2A4ZA 2GBMA 4P16A 4BKSD 2BT6A 3QC8B 1EU3A 2ZVNA 4YSYB 4JL9A 4E71A 4N59A 4W9IA 1FMAD 4US8A 4ARCA 3A33B 4CYEA 1ESFA 4LNKA 3PZDA 1T3QA 2AQ2B 2FNJB 2M4NA 3M62B 2J52A 3VH3B 4O1NA 4K3CA 1V5TA 2V4LA 2J42A 3KUZA 3H7SA 4B9KA 3NVWA 4P1CC 2D3CA 1JW9D 3W9CB 4KIKA 3BK2A 3WAMA 2D3AA 3RD2A 2M19A 2QEJC 3IBEA 4LJPB 2BYEA 2WQYB 3Q8EA 4HKQA 1HZ6A 2RDBC 4AWJA 3M95A 2DZJA 4M0WA 2V4IB 4YWGG 5LXIB 2K39A 4IC7B 3UQAA 2EKEC 2C7MB 2KDMA 3NS8A 4WJOA 3ZJTA 1KFYB 1KJTA 2ZW0A 3NZ3A 1GC7A 1WXVA 1HQRD 1PUTA 2Y5PA 2CU1A 3RNFC 1ZGUB 1V1PA 4MACA 4JQWC 3TSSA 3KYCD 4AQ7A 1WGDA 1EF1A 2K8BA 2J0JA 1R7SA 4KDLB 3CMMB 4TSSA 2VH2A 1DYQA 3JYUA 3T3OA 1J8CA 4GOCA 3KWLA 3IAM1 2LRWA 2HTHA 3U4EG 4GIVA 4XC2A 2DYOA 2GRIA 2N7JA 4JX1C 4EZJA 2Q5WD 1RM6C 1WM2A 2LGIA 2EELA 2G45B 3R3MA 4ARIA 1DOXA 2KMCA 4YT0B 4HCNB 5LNK1 4L1BA 2AWTA 4YXDB 4IWOA 5CHWA 5G55A 3Q2AC 2NMQA 1QOFA 2BGFA 3IHPC 2UYZB 1Q5WB 4C56C 4AUQC 4WWPA 1HEZE 4NAWA 2DAJA 4ANVA 2JYEA 2JT4B 2XK5A 4USAA 1MPEA 4ZRKA 1XXGA 1YJJA 2QCZA 2EMSA 1E0ZA 4MGKE 4HJKA 2KFJA 4FA6A 1XO3A 1YJ1A 5FR3A 5HG2A 1JWAD 2E3TA 1R4NB 3BINA 1GAQB 5EE0A 5DPRA 5HFYA 5LLIA 3PRMB 5DPTA 1DOIA 4PS7A 4LLGM 4HDOA 2FUHB 5AZHA 1EUVB 1EWYC 2INNE 2RSUA 4DDID 4XYCA 3W1SA 2M8SA 2NTSA 4LCDE 4MGZE 1WZ0A 4A3PA 2H88B 2LFIA 4KGTA 3DVNV 2L52A 3L4PA 4A20A 1UZXB 3VRAB 2O6VA 1V5OA 2G4DB 2WDRB 4OVUA 3RI7C 2EKIA 3VUYA 3GOEA 2WXRA 2KQ4X 3B0AA 4S0RA 1R4NI 1F1HA 1QZEA 2YEPB 3R7QA 4WAAA 2NCNA 5EDSA 2INCC 2X38A 3UIOB 1PGBA 4HXDA 4XWWA 2FCSA 2C9WB 2BS4B 4DWFA 1VZ7A 2EMTA 3PRPB 3Q8AA 3VFKA 4K7SA 1SF0A 2KTFA 5JH5C 3WIMA 1K8RB 1Q1OA 2UWQA 2LGDA 2L7RA 3B2FA 3OWEB 3Q14C 4YTMB 3C0RB 1K53A 1YIWA 2LUMA 4B0EA 4W9LA 3VXWA 1HA5A 3NRZA 1ZXIA 3OJ4B 3U52E 3CIRB 2MJ3A 2LGYA 1FXTB 1IGDA 2Y5BB 3K9PB 3QWZB 5KHQA 2MBQA 2PEAA 1WYGA 1WSPA 3EC8A 4FJVB 3QK0A 2N7DA 1N62A 1YN4A 1UBIA 3VAWA 5IA7A 1L4ZB 1GB4A 1C4PA 4US9A 3DWMA 5D6JB 1N61A 4GDKB 2AQ3B 5BYSA 4P6VF 3ML8A 1KTKA 3N20C 4DBGA 2PKOA 3V6EB 2JSVX 2R61A 3IG3A 1E8WA 3A9KB 3BK1A 3V61A 4TMAB 1EF5A 1L0XB 4H2AA 3C8YA 4F8CB 4NZLB 3QX1A 4B6WA 3PLVA 1ZP0B 4HK2A 2HD5B 1QOBA 4JIOU 1N63A 3RMKC 1E8YA 5JXVA 2Z59B 3LYYA 1NI2A 4II2B 4ITKA 1VD2A 4NJ6A 1KRHA 2DENB 2BKFA 1V8CA 2WU5B 4NJCA 1CMXB 3EFCA 2BYFA 3RNCC 1LQBA 2BVCA 2BS2B 2JX5A 2G4SA 1E6EB 4WWMA 1TJEA 1DOYA 4FJZA 2REXA 4W9GA 4G11A 4K81A 2KDEB 3ZXVA 3JSVB 2GBJA 1GUAB 1E8XA 2JRHA 1D5XC 4HWIB 2KMMA 2GB1A 1SE3A 1JROA 1M94A 2KO3A 1UWXA 2WXMA 5AUIA 1TGZB 3DHIC 3A4SC 1X1MA 1J0GA 1RFKA 1WJ6A 4PK1A 4RF0A 4DHJD 3A9JB 2VH1A 1V1OA 4LNFA 4WJNA 3RZWC 5AEKB 3ONSA 1L7YA 2D07B 4LDTB 4J6IA 2I1JA 1YX6B 3MC8A 2BWFA 3BYYB 5J2RA 1TS3A 2MSED 3Q8CA 4EOYA 3QCAA 3S2AA 4BVUC 2JXTA 1WMHB 2G1EA 3BYTB 1A70A 3QARA 2MA9B 3CWIA 4DQOC 1YOVB 2W3RA 3DBLB 2L0FA 1L5PA 4REZA 2MLBA 4ZYSA 1B1ZA 4MH0E 1OTRB 3JVZX 3TEYA 2NTTA 4IKGA 1CK1A 3E9SA 2R2QA 3RNAC 3I5JC 3AECB 4C00A 1MVKA 3QAQA 5IO9A 1ENFA 4R3DA 2NBUA 5DPWA 2JQRB 4TQ0A 1GG3A 3LB8C 1HXYD 3P4RB 2O2VB 4C4VB 3R66C 3L0WB 2FAZA 1PYWD 2LWPA 4TV3A 4OZAA 1TS4A 3UGBB 2QMTA 2VRRB 1JWUD 2KZRA 5GMVA 4IW0A 4GSWA 2MHJA 3PVLA 1YD8U 5BYQA 3KVFB 2NS5A 4PYZA 1WRIA 1TY2A 4WWOA 3NY5A 1R4MB 3DBLI 1F0ZA 3NHEB 4XGAB 2I2YA 1DGJA 1OQRA 2KVRA 1L0VB 2BYTA 5E6JA 3O13A 3U7ZA 2OOBB 2WHIA 5E6NA 1SJED 3ZYYX 5I4DA 1VZ6A 2QDFA 4N9F4 1CJEA 5MPOA 3ABVB 4DHZE 3GS2A 4GDLA 1XCTL 4PT5A 4PS8A 1V6EA 2DWQA 2WX1A 2D10A 3Q8BA 2RPQA 1HE8A 4EZKA 2V0GA 2NBWB 4TUUA 2Y3AA 2V9HA 1SE9A 2WXPA 2LJ5A 4ACFA 1V9JA 2YVCA 1C78A 2FIDA 1V2YA 1SXTA 2KWUB 1I4GA 4K7WA 2KDIA 1R4MI 3EGRA 2MP2B 1C3TA 3AU4A 4IM0A 1H4RA 2OJRA 5IP4D 3NS1A 1MI0A 4KGSA 5BYRA 2MWSB 1XF5L 2KT7A 2WGSA 3JW0X 2L83A 4MSMB 5BO4B 4KVGB 2JXXA 2K25A 3GB1A 3VR8B 1FNVA 2FCMA 3P4SB 2Z0DB 4C7ZA 5HI1A 2MBEA 3X23A 3AMZA 4BAXA 2ACZB 4L2YA 1D5ZC 4MJSA 2KANA 1P1AA 3DBHB 1EO6A 4ZRIA 1JWSD 1GPXA 3HUIA 2WXGA 1P7EA 3H6NA 1L6VA 3P1MA 3LXFA 4HPPA 2WXKA 1IPGA 3TEXA 4DXAB 4KX6B 4HCPB 4HPMB 4OVVA 1WGYA 1ZXHA 2WXOA 3TEWA 3OAWA 1PFDA 2JU6X 2PLPA 1TS2A 4EEWA 4RGMA 2DNFA 3Q3NC 3MJ5A 2KK8A 1T0RC 3MJWA 2CR5A 4FJYA 4A9AA 1D5MC 1SIJA 2KLCA 3QJZA 2BKRB 1EM7A 1UH6A 3DVGX 3AE5B 2QIEB 5TR5A 1TKGA 1FO4A 1XLOA 2I1KA 1E7PB 3TIXA 3ZUNA 2LGXA 2IGDA 1GC6A 4E74A 3ZDMC 2SAKA 4IM2A 3L08A 4BZAA 2A5UA 4II3B 3VQIA 1OQQA 1UD7A 3PSEB 4W9KA 1JALA 2WS3B 2C60A 2AL3A 1TBEA 1JRUA 1YN3A 2TSSA 3DBHI 5GXGB 1FXIA 1NYRA 2ASQA 1WI0A 3N9YC 1Y56A 3RNBC 2DYMA 2D3BA 2IPKD 3OG5A 3AE4B 2KX3A 3Q6BA 4W9DA 3VUWA 3MTNB 1MJDA 4YTNB 2L1AA 2N9EB 4WJQA 3IVFA 2DBYA 2ZZPB 3I9V1 1RRBA 1U4AA 3H9DA 2OHFA 4ICUA 1P98A 1KM7A 1IYFA 4RMAA 2BTEA 3AEBB 4JLCA 3ZRCA 3Q3FA 3RPFC 3APDA 4RFBA 5CHFA 4N58A 3SFDB 2AX5A 3T9LA 1TIFA 5HKHA 3L13A 3NUHB 1WRDB 4RGNA 3RCZA 3VRBB 3ZTDA 1XT9B 3P2BA 1JRPA 2J0KA 3KLSX 1P0RA 2IYDB 4KSKC 1IP9A 1T0YA 1FFUA 2JZ3B 4MH8A 4KKJA 4ANWA 3ZQ4A 2IZVB 4GDKA 4A3OA 1WF9A 1V1PB 1LFDA 2E6XA 2LVPA 3KWVA 1C76A 1WXAA 2KC2A 3B1LX 3N3KB 2NR2A 2QJLA 2VZKD 3R7RA 3AE1B 2D3GA 2LASA 2WWZA 1VJKA 2L3ZA 3E56A 1ZDVA 3W1YA 1IBXA 3A1QA 5D3IB 4JPSA 1RYJA 1QQRA 1F52A 1E7UA 1TZOA 5J18A 4MM3B 2RDHA 3N32A 1KH0A 5C23A 3EFUA 3EECA 1SGHA 4XDCA 4WQMA 3ZNHB 3TUOA 1T5XD 4GU2A 2ZCCA 3H7PB 2MX2A 5G5HA 5D3DA 1WGKA 1Z5SB 4AJYB 1YX5B 2MW5A 5IN7A 3JSVA 1YQ4B 2BYVE 1UWMA 1WGRA 1WZ3A 2QSDA 2X8XX 2KQSA 3EHVA 2IY1B 2W9NA 5BMGA 1J19A 4NJ7A 2BF8B 2KD0A 1WR6E 2ICIA 3CSTA 3V05A 4NQKE 1BUIC 1GOZA 1PGAA 1NI3A 2K1FA 1TZ1A 2FCNA 1H8CA 2KX0A 1OEYJ 3K9OB 4DHJB 2WXIA 1Z2MA 1OEYA 3AE2B 1LGRA 1WE6A 3A9JA 1GJZA 2BB6A 4L23A 3ZIMA 2BQQA 2HE7A 5DPSA 3FILA 2AYOB 4KV2A 4K1RB 1C79A 1K51A 2K6QA 1TKYA 3EA6A 5L83A 3AEGB 4JWSC 1HZ5A 3QA8A 2ON8A 3AB5A 2KVZA 3BVZA 5AUKA 1WMHA 4NQLB 2WXFA 1F2RI 4MEMA 2QILA 2IGHA 4IWQA 3V62A 2N9PC 1OGWA 1SIFA 4KGRA 5EE1A 4FXCA 1VCBA 2JZZA 2C7HA 4ZHPA 3I63C 2CJNA 2LUEA 2HTME 4ZRQA 4C80A 4RNAA 3AULA 4P7IA 2KWCA 3DHGC 1E5WA 3TBLD 1FIQA 4N6EB 1F2RC 3ZXRA 4BFRA 5EE9A 2KJRA 2FE8A 1ZE3D 5AZFA 1NEKB 1S3SG 2L05A 4GMVA 2O2VA 3M3JA 4C4VA 3AV8A 2KYWA 4BKTA 2N9KA 4HRSA 4YTPB 3KUCB 1EWCA 1L4DB 5TSSA 4URKA 2LD9A 2CU3A 2PVGC 4MSQB 3ZGZA 1OQYA 1KLVA 2RMMA 3Q3MC 3APFA 3ZNGC 2AQ1B 2WDQB 2BWES 2LZ6A 4NY0A 2WXQA 3Q3JA 2DX5B 1YN5A 3AN1A 5H92C 2ZNVB 3V3XA 4DXFA 4ANUA 2JZPA 1WH3A 4KZCA 1FD6A 3ZO5B 2HJ1A 2BB5A 5J17A 2IDYA 3MHSD 4WQOB 4FHJA 3NVVA 2ZPYA 1N6ZA 1I4XA 1WGGA 4GB9A 2MBHA 2Z8LA 3RZFA 2D2QA 2N4FA 2JF5A 3LDZE 3RFZB 4W9HA 1CQVA 2KTRA 1V80A 3IAS1 4ICVA 2QC8A 3NJTA 5AZGA 1SEBD 3UIPB 3ALBA 3OJ3A 4K7UA 2RPVA 1GB1A 3P63A 3BVMA 1IGCA 1L2NA 2H89B 3O65B 3ZLZA 1K52A 4ZOHC 3MHZA 2LGSA 1UELA 3DBRB 4WAFA 2KQ7A 2O6VD 2IBIB 2GLSA 2JVCA 2KAJA 2KJHB 3AE6B 3AEAB 1SSNA 5BMHA 4HLEA 1LXDA 1FPYA 2KWVB 3ZKJC 1V49A 4HJGE 4HVBA 1QLBB 1FNWA 3OLMD 5CX3A 2W82A 4JWUC 4M8NA 1XQQA 3J9CA 2N1WA 4RH6A 4YL8A 3BWUD 3HM6X 3SHQA 3U7DA 2FUG1 1FRDA 3H8HA 4FHKA 3RNEC 3R8BA 1FM0D 2YEPF 4DHZB 3WAPA 4HDQA 1E9MA 2ZEQA 4I6PA 1FCCC 2K0PA 2J4XA 5DCNA 3DBRI 4EKUA 1QOAA 5E6PA 2JUOA 1ZW7A 2Y5CA 1WGHA 4JGHB 1RFAA 2LHEA 4XZ4A 5T8IA 3AE9B 2JRIB 4G3XB 2MBBB 2PE9A 3R2TA 3I3TB 3KH0A 3N1YC 2GMIC 3PZ7A 1G6JA 2PJHA 1XLQA 1XLNA 4A6QA 5JHBA 3PPAA 3HK0A 4MDKE 3PT2B 3ZNID 1Y8RC 2KN4A 2JWZA 2GI9A 1WX9A 2GOWA 1VDVA 3HIZA 1E10A 2RDGA 1UNSA 4Q2JA 1I4RA 3ENEA 2QHOA 5FK9C 1V86A 3VVWB 1I4PA 1Q10A 2KLGA 1P7FA 4RCOA 2V3PA 4W9JA 2R2OA 2M0XA 1Q0WB 4ASWC 4UDUC 4RGOS 2CHZA 1L0YB 4IUMB 2WXJA 1KF6B 3HVZA 2DZIA 1BMLC 4A55A 4KDIC 1WY8A 1HTQA 4OW0A 2M1MA 2V3SA 2KNBA 2KDFB 4M00A 4AP4C 2Z0EB 3DQVA 4OZBA 1AARA 2V1YA 5H8YE 4AS1A 3WANA 1TY0A 1VRAB 4YSXB 2KFKB 4CO7A 3TMPB 2NPTB 1ZOYB 1TT5B 2MBOA 4FADA 1C1YB 4KZ0A 2N1VA 1AYFA 2KN5A 1YNTE 4QAYA 1TS5A 3QIJA 4A8XC 2G9HD 2WNMA 3TJPA 5C2TB 2ONQA 5FR6A 3V60A 1SE4A 1AW7A 2IO2B 3NVZA 4WIPA 1WR1A 1T0QC 4HROA 4C7YA 3TCAA 3SDLC 2PVOD 4CHKA 3T8MA 1J7AA 2IGGA 1FEHA 4XE0A 5IOIA 2LVOA 2PE6B 1I4QA 2MJEA 2XN9C 2HDEA 1NENB 2K9XA 1FFVA 1E8ZA 1ZKHA 4W9FA 1IUEA 2WXHA 4LTUA 3PRZA 4G50A 1SE2A 5D7GA 1JMLA 1PDXA 4XWTA 3WALA 4A90A 1QKZA 1L6UA 2BW2A 1VR9A 2INDC 3SD5A 4FN2A 2GBRA 1WXMA 3ZNZB 2WLBA 3PREA 2VZKB 2B76B 3W5VB 3B9JA 1NBFC 4TQ1A 3ZDTA 4GDLB 2UU7A 5EE3A 3ZRFA 3NZSA 3RT3B 1RAXA 3QQ8B 1J7BA 3SEBA 4DXGA 1CZPA 2D5GA 3GZNB 1WX7A 2N0SB 2LRUA 2L00B 5G2NA 4ZHOA 2DHZA 4FULA 3PHXB 4PYUA 2NVUI 3Q8FA 3RNGC 4RF1A 3VTVA 2PW9A 4MM3A 1WYWB 4P1BC 4PS3A 3U2SC 2DAFA 4S17A 3I57A 4EFOA 3VUXA 2MRPA 3MC0B 2M17A 1AN8A 1ET6A 3W2DA 2WXNA 4NNJB 1TTNA 1FCLA 4RM9A 1GNUA 1F77A 3KUDB 1SJHD 2ZJDA 1VZ8A 3AM9A 3N30A 1C4CA 1FNUA 1YJIA 4GXBA 3PS6A 3H7PA 2C5LC 1JQ4A 2IY0B 5JZEB 2K8HA 4KIKB 3TL5A 1ACCA 2J0MA 4M02A 4BOSC 2DZKA 2M56B 3LJ3A 2ZCBA 1ROEA 2C7NB 2OEDA 3L17A 3VDZA 4BKGA 4MJSB 4M0WB 2JYTA 1TKEA 3DOWA 2BBCA 1MG4A 2GBNA 3DVNU 2OJWA 2LJIA 3GZNI 5G5GA 4LK0M 2W3SA 4WH4A 3W5UB 2KACA 2WDTB 2RD0A 1QILA 4FLHA 2LHDA 1D6EC 4FBJB 4YSZB 2PIAA 2I38A 3PZ8A 5CHVC 3KW5B 5IAAC 3A9KA 2FCQA 4IM3A 1I7HA 2V3NA 3CSFA 1D3ZA 3ZW3A 3SR6A 2MCNB 3KYDD 4RM8A 3AE8B 3AU5A 1I4HA 4K3BA 1SBBB 4GGQA 4KKIA 2G3QB 2FBWB 1ZDXA 3P4PB 1WJ4A 3PV1A 4I6NB 1JCKB 2KC1A 1ISNA 1XEEA 4HKZE 5KHOA 1F9JA 4EZLA 1M4VA 3GE3C 4IWPA 4OHJA 1JWBD 3HRDD 3AXCA 4LJOB 3WA0A 3L16A 3ZTCA 2LMCA 1V97A 2RR9A 4NAWB 4RGTA 2WX0A 1NYQA 1E90A 1FXAA 1PGXA 1UBQA 1XD3B 3T3NA 2XK5B 3IT4B 5IKCM 2DYBA 3N1ZC 4CQNA 1LM8B 4J3OD 3Q3OC 5D2MB 2XNAC 1XLPA 1MHHE 1D4BA 3IFWB 2IO0B 1YQBA 2L0TA 2YLMA 4NPNA 3URYA 1JWMD 1ZUD2 3ML9A 3UF8A 3BY4B 2CJOA 2NBVB 1VLBA 2K5PA 3DCGA 4W9EA 1UF0A 2J53A 2GBKA 3V6CB 1I35A 1HTOA 1WX8A 2WDVB 3PLUA 2LI5A 4HPLB 3NG0A 1B9RA 1EU4A 1K50A 1BXTA 3DVGY 3IXSA 2CS4A 2CHXA 3SFEB 3AE7B 2AL6A 4HEA1 1UGMA 1KOTA 1FRRA 3PO0A 3UQBA 2MEKA 1OFFA 1STEA 2O6VB 2BS3B 4W9CA 2AEHA 4BBNC 2PTLA 4LNNA 2ZW1A 2KJ6A 4BKSA 3HHMA 3NZUA 5BMIA 1IBXB 1UUPA 3D32A 3AEEB 3A1QB 1MG8A 2N9XA 1KLUD 4IG7B 3GP7A 2MH7A 1J7CA 3VTUA 2KOXA 1WM3A 2JY6A 3AE3B 2XEWA 3QHTA 2MJDA 3BIID 3CF6E 5D94A 4BOZB 2B3AA 1WWTA 4ZDVA 1N5XA 2MQJA 4MT5A 3BZDB 2FIFA 2L76A 3R2IA 1BT0A 4MELA 3P4QB 2SEBD 3PGEA 4LNIA 4GLSC 4MGYE 3KQ4A 4EUTA 2KWDA 1NDDA 2L32A 5C1ZA 3P42A 3AEDB 4B0MA 1WXSA 3DWGC 1KLGD 4OVZA 3DPDA 4ANXA 3GE8C 3RULA 2LXCA 3VTWA 4MGIE 2WYQA 1RLFA 1UGJA 5C3JB 2CHWA 1N5WA 3RUIB 1C9FA 1V81A 2K22A 2N7EA 3W1SC 3H1UA 3SU8X 5JHAA 2JPHA 2WU2B 3A4RA 1C77A 2JWUA 1TYGB 4WWNA 4NAMA 3ECIA 3UI3A 3X0WA 1QT9A 2IO3B 1ZPSA 3VH4B 2ZPNA 3FAHA 1MFWA 1ET9A 3MP9A 2RGFA 3FC4A 3UINB 4EE2A 4IDIA 2KDBA 2IO1B 3FILB 3VR9B 3RN9C 1C4AA 2INPE 1A5RA 4AJWA 1YQ3B 1WJUA 3FKYA 3ZVVA 1WIAA 3WAOA 2LEKA 2PMVA 2L8JA 1RWSA 3AEFB 5HHDG 3M63B 1PQSA 4AOFA 3EUB2 5FKAC 2N9LA 1WJNA 2W55A 4IOIE 2K8CA 4DK5A 3PTFC 4JE3B 3N1XC 4ZRJA 3L10B 1YMHE 1SB3C 4LNOA 1T6BX 2MP2A 3ETRA 4M01A 2J7QB 3AI5A 3PHWB 3NVYA 2W54A 4M8MA 4ZRPA 3B08A 5E6OA 3WCQA 1E7VA 3ZJVA 3MC9A 4WJPA 3BVGA 3DHHC 2KFKA 3C19A 2KXJA 1WE7A 1WFYA 3U30A 2NPTA 4GN1A 2K3UA 2K6DB 3DDCB 4BBNF 2KKCA 3AH7A 2DZMA 4TKNA 5L95C 1XCQL 2WXLA 1P3QU 2KHWB 2ZNVC 3Q69A 3HVDA 3TEZA 2IJ0A 2CKHB 4KSLC 4G0NB 2M0AA 3APCA 5LXHA 3RYTA 4XDDA 3ZJUA 2D11A 4F7ZA 3B2GA 4XX5A 2DLBA 2LXAA 3IT6B 3NOBA 2XBBC 3VHTC 1I42A 5CTRC 1P9DU 4WURA 4E3CA 1NVID 2LVQA 1S1QB 3DBSA 4OZCA 2WP9B 4F1SA 4LDTD 3U8ZA 1WXQA
chains in the Genus database with same CATH topology
2HJ8A 2KO3A 4I6LB 2KTRB 2PPHA 2DHZA 4FULA 2ZVOA 4GU2A 4ZYNA 1TGZB 2ZCCA 3L54A 3A4SC 3H7PB 2MX2A 3PHXB 4PYUA 1X1MA 2NVUI 1Z5SB 4AJYB 3VTVA 1J0GA 4B95A 1YX5B 2MW5A 1WJ6A 2KMAA 4MM3A 1WYWB 3A9JB 3JSVA 2BPSA 4DHJD 4PS3A 2BYVE 2DAFA 4EFOA 1WGRA 1WZ3A 2KQSA 4WJNA 3VUXA 2MRPA 3RZWC 4DDGD 3EHVA 5AEKB 2IY1B 3ONSA 4X57B 2M17A 2W9NA 3HM3A 1J19A 4NJ7A 2BF8B 2KD0A 1WR6E 1L7YA 2A4ZA 2D07B 3CSTA 4J6IA 4LDTB 4NNJB 1TTNA 2I1JA 4RM9A 1GNUA 2GBMA 4NQKE 1YX6B 4BKSD 3KUDB 3QC8B 2BWFA 2ZVNA 2ZJDA 5J2RA 3N30A 2K1FA 1TZ1A 2MSED 4JL9A 2FCNA 4E71A 4GXBA 3PS6A 4EOYA 1H8CA 3QCAA 2KX0A 1OEYJ 3H7PA 3K9OB 2C5LC 4W9IA 2IY0B 3S2AA 2K8HA 4BVUC 5JZEB 4KIKB 4DHJB 3TL5A 1WMHB 1Z2MA 2J0MA 1OEYA 3A33B 1WE6A 3A9JA 3QARA 4BOSC 2DZKA 3LJ3A 2MA9B 1GJZA 2ZCBA 4CYEA 2L0FA 2C7NB 3PZDA 3ZIMA 3L17A 3VDZA 4BKGA 4MJSB 4M0WB 2FNJB 2M4NA 3DOWA 3M62B 2GBNA 3DVNU 3VH3B 2HE7A 2MLBA 5DPSA 4MH0E 1OTRB 3JVZX 2AYOB 1V5TA 3GZNI 4KV2A 2V4LA 4K1RB 2K6QA 3KUZA 3H7SA 5L83A 2R2QA 4B9KA 2WDTB 2RD0A 3QA8A 4KIKA 3WAMA 3RD2A 4FLHA 1WMHA 4NQLB 3QAQA 3IBEA 4MEMA 4LJPB 4FBJB 2BYEA 5JHBA 4IWQA 2NBUA 3V62A 5DPWA 4TQ0A 1GG3A 4AWJA 2N9PC 1OGWA 1SIFA 3M95A 2DZJA 5CHVC 2O2VB 3KW5B 5IAAC 3A9KA 2FCQA 1VCBA 2JZZA 2C7HA 4IM3A 5LXIB 2K39A 3CSFA 1D3ZA 4IC7B 3R66C 3UQAA 2EKEC 3ZW3A 2C7MB 3L0WB 3NS8A 3KYDD 4RM8A 2FAZA 4WJOA 2MCNB 2LUEA 1KJTA 1GC7A 1WXVA 2LWPA 3AU5A 4TV3A 3UGBB 3AULA 4P7IA 2VRRB 2KWCA 4GGQA 2CU1A 1ZGUB 1E5WA 2G3QB 3TBLD 4JQWC 2KZRA 5GMVA 4BFRA 3KYCD 2KJRA 4IW0A 1WJ4A 3PV1A 4GSWA 4I6NB 3PVLA 1WGDA 1EF1A 1YD8U 2K8BA 2KC1A 2NS5A 3KVFB 5AZFA 2J0JA 1ISNA 4KDLB 1S3SG 4PYZA 3CMMB 2L05A 3NY5A 4GMVA 4WWOA 5KHOA 2O2VA 3DBLI 3JYUA 1F9JA 4EZLA 3M3JA 3NHEB 4BKTA 1J8CA 4IWPA 4GOCA 3KUCB 2LRWA 2KVRA 2HTHA 3AXCA 4GIVA 4LJOB 3L16A 4XC2A 2DYOA 3WA0A 3ZTCA 4URKA 2LD9A 4MSQB 1OQYA 2OOBB 4EZJA 5E6NA 2RR9A 1KLVA 4NAWB 3ZNGC 3APFA 1WM2A 2WX0A 4N9F4 1E90A 1XD3B 1UBQA 2BWES 2G45B 2LZ6A 3R3MA 4NY0A 3Q3JA 2XK5B 2DX5B 2ZNVB 2DYBA 4DHZE 4ANUA 2KMCA 1LM8B 4GDLA 1WH3A 4KZCA 3ZO5B 4HCNB 4PS8A 5D2MB 5J17A 1V6EA 3MHSD 2WX1A 2AWTA 2D10A 3IFWB 4FHJA 4WQOB 2RPQA 1HE8A 4IWOA 2ZPYA 5CHWA 5G55A 1WGGA 2IO0B 4GB9A 2MBHA 1YQBA 2L0TA 2D2QA 2BGFA 2YLMA 3IHPC 2N4FA 2JF5A 4NPNA 3LDZE 3RZFA 2UYZB 4EZKA 3ML9A 2NBWB 4TUUA 4W9HA 2KTRA 1Q5WB 1V80A 1SE9A 3UF8A 4WWPA 4AUQC 3BY4B 4ICVA 5AZGA 3UIPB 3ALBA 4NAWA 2LJ5A 2NBVB 3OJ3A 1V9JA 2DAJA 2YVCA 4K7UA 4ANVA 2FIDA 3DCGA 2JT4B 1L2NA 2XK5A 1V2YA 4W9EA 2KWUB 3O65B 2GBKA 4ZRKA 3ZLZA 3V6CB 1I35A 1UELA 2EMSA 4K7WA 1WX8A 2KDIA 1R4MI 2KQ7A 4HJKA 4MGKE 2O6VD 2IBIB 2MP2B 2KFJA 4FA6A 1C3TA 3AU4A 2JVCA 2KJHB 1H4RA 4IM0A 3PLUA 1YJ1A 2LI5A 4HPLB 2OJRA 4HLEA 1LXDA 3BINA 2KWVB 3DVGY 5DPRA 2CS4A 2MWSB 5LLIA 3ZKJC 2CHXA 1V49A 2AL6A 3JW0X 4HVBA 1UGMA 1KOTA 3PRMB 5DPTA 4MSMB 5BO4B 4KVGB 2JXXA 4PS7A 3UQBA 2K25A 4HDOA 3OLMD 5CX3A 2FUHB 4M8NA 1XQQA 2O6VB 4W9CA 2FCMA 2Z0DB 5AZHA 1EUVB 2AEHA 2MBEA 2N1WA 4YL8A 3X23A 4BBNC 3HM6X 3SHQA 3U7DA 2RSUA 4DDID 4MJSA 2KJ6A 3W1SA 2KANA 2M8SA 1P1AA 4BKSA 3HHMA 4LCDE 1EO6A 4FHKA 4ZRIA 3NZUA 4MGZE 1WZ0A 4A3PA 3D32A 4DHZB 3A1QB 3H6NA 1MG8A 2N9XA 3WAPA 4IG7B 3DVNV 3VTUA 4HDQA 1IPGA 2KOXA 1WM3A 2JY6A 4DXAB 2XEWA 4HCPB 4HPMB 4A20A 1UZXB 2ZEQA 4OVVA 1WGYA 3QHTA 4I6PA 3CF6E 2O6VA 3OAWA 1V5OA 2G4DB 5D94A 4BOZB 4OVUA 4EEWA 2B3AA 5DCNA 3DBRI 4EKUA 2KK8A 3MJWA 2CR5A 4ZDVA 2MQJA 4FJYA 2KLCA 5E6PA 3VUYA 3GOEA 3QJZA 2BKRB 1UH6A 2JUOA 3DVGX 3B0AA 2FIFA 1ZW7A 2L76A 1BT0A 1R4NI 4MELA 5TR5A 1WGHA 1QZEA 4JGHB 3PGEA 3R7QA 2I1KA 3TIXA 1RFAA 3ZUNA 2LGXA 4WAAA 2NCNA 4MGYE 1GC6A 4E74A 4XZ4A 5EDSA 2JRIB 4EUTA 4G3XB 3UIOB 3ZDMC 1NDDA 4IM2A 5C1ZA 2MBBB 2PE9A 3L08A 4HXDA 3I3TB 3KH0A 1WXSA 2GMIC 2A5UA 4II3B 1G6JA 2FCSA 3VQIA 2C9WB 1UD7A 3DPDA 4DWFA 2EMTA 3PRPB 3PSEB 4W9KA 3RULA 4ANXA 2PJHA 3VFKA 2LXCA 3VTWA 4MGIE 4K7SA 2C60A 2WYQA 2KTFA 1RLFA 3PPAA 3WIMA 1K8RB 3HK0A 2CHWA 4MDKE 5JH5C 1Q1OA 3PT2B 3ZNID 2AL3A 1Y8RC 2LGDA 2UWQA 1TBEA 2L7RA 1JRUA 2JWZA 3RUIB 1V81A 3DBHI 2N7EA 1WX9A 3W1SC 2GOWA 3C0RB 3H1UA 3HIZA 1YIWA 3SU8X 5JHAA 2JPHA 4W9LA 2ASQA 3A4RA 1WI0A 3ENEA 3VXWA 2QHOA 2DYMA 1V86A 3OJ4B 4WWNA 3ECIA 3VVWB 3X0WA 2KLGA 4W9JA 4ASWC 2IO3B 2R2OA 2M0XA 1Q0WB 2KX3A 3VH4B 2CHZA 2LGYA 1FXTB 2ZPNA 4IUMB 2Y5BB 4W9DA 3VUWA 3K9PB 3QWZB 5KHQA 2DZIA 2MBQA 2PEAA 2RGFA 3UINB 3MTNB 2KDBA 3EC8A 4FJVB 2IO1B 2N7DA 3QK0A 1WY8A 4KDIC 1UBIA 3VAWA 5IA7A 2M1MA 2N9EB 4WJQA 2V3SA 2KNBA 3IVFA 2KDFB 1A5RA 2ZZPB 4AP4C 4AJWA 2Z0EB 3DQVA 1RRBA 1WJUA 1U4AA 3H9DA 1AARA 2V1YA 3ZVVA 1WIAA 3WAOA 3WANA 5D6JB 4ICUA 1P98A 1KM7A 4GDKB 1IYFA 2KFKB 4CO7A 2L8JA 4RMAA 3TMPB 2NPTB 4JLCA 3M63B 3ML8A 1PQSA 3Q3FA 2MBOA 3ZRCA 3APDA 4AOFA 4FADA 4DBGA 5CHFA 1WJNA 3V6EB 2K8CA 1C1YB 4DK5A 4KZ0A 2N1VA 3PTFC 3T9LA 2KN5A 3IG3A 5HKHA 3L13A 4ZRJA 1WRDB 1E8WA 3A9KB 3L10B 3RCZA 3QIJA 3V61A 3ZTDA 1XT9B 1EF5A 2MP2A 3P2BA 2J0KA 1P0RA 2J7QB 3TJPA 2IYDB 4KSKC 3AI5A 5FR6A 3V60A 3PHWB 1T0YA 4F8CB 1IP9A 2IO2B 4M8MA 2JZ3B 3QX1A 4B6WA 3B08A 5E6OA 3PLVA 1E7VA 1WR1A 4HK2A 4F1SA 2HD5B 4ANWA 4WJPA 4JIOU 2IZVB 4GDKA 4A3OA 1E8YA 1WF9A 2KFKA 2KXJA 2Z59B 3TCAA 1LFDA 3SDLC 1NI2A 1WE7A 1WFYA 4II2B 2NPTA 4GN1A 3U30A 4CHKA 3T8MA 1VD2A 2K6DB 4NJ6A 2DENB 3DDCB 2BKFA 4BBNF 2KKCA 2LVPA 2LVOA 2DZMA 2PE6B 4TKNA 5L95C 1WXAA 1CMXB 2KC2A 3B1LX 3N3KB 2NR2A 3R7RA 2BYFA 1LQBA 1P3QU 2KHWB 2ZNVC 2D3GA 1E8ZA 1ZKHA 4W9FA 2LASA 2WWZA 2L3ZA 3PRZA 3W1YA 4G50A 2CKHB 4KSLC 4G0NB 2G4SA 3APCA 5D7GA 3WALA 5LXHA 3RYTA 3A1QA 2D11A 4FJZA 3SD5A 4FN2A 2GBRA 4F7ZA 2REXA 1WXMA 4XX5A 3ZNZB 4W9GA 2LXAA 4G11A 3NOBA 3PREA 4K81A 2KDEB 2XBBC 1E7UA 3VHTC 5J18A 1NBFC 3JSVB 2GBJA 4TQ1A 3N32A 5G2NA 3ZDTA 1I42A 4GDLB 1GUAB 5CTRC 1E8XA 3ZRFA 2JRHA 1P9DU 5C23A 4E3CA 3NZSA 3EFUA 3EECA 3RT3B 1RAXA 2LVQA 4HWIB 3QQ8B 1S1QB 3DBSA 1SGHA 3ZNHB 1WX7A 4LDTD 3U8ZA 2LRUA 2L00B 1M94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ8 A;  2KO3 A;  4I6L B;  2KTR B;  2PPH A;  2DHZ A;  4FUL A;  2ZVO A;  4GU2 A;  4ZYN A;  1TGZ B;  2ZCC A;  3L54 A;  3A4S C;  3H7P B;  2MX2 A;  3PHX B;  4PYU A;  1X1M A;  2NVU I;  1Z5S B;  4AJY B;  3VTV A;  1J0G A;  4B95 A;  1YX5 B;  2MW5 A;  1WJ6 A;  2KMA A;  4MM3 A;  1WYW B;  3A9J B;  3JSV A;  2BPS A;  4DHJ D;  4PS3 A;  2BYV E;  2DAF A;  4EFO A;  1WGR A;  1WZ3 A;  2KQS A;  4WJN A;  3VUX A;  2MRP A;  3RZW C;  4DDG D;  3EHV A;  5AEK B;  2IY1 B;  3ONS A;  4X57 B;  2M17 A;  2W9N A;  3HM3 A;  1J19 A;  4NJ7 A;  2BF8 B;  2KD0 A;  1WR6 E;  1L7Y A;  2A4Z A;  2D07 B;  3CST A;  4J6I A;  4LDT B;  4NNJ B;  1TTN A;  2I1J A;  4RM9 A;  1GNU A;  2GBM A;  4NQK E;  1YX6 B;  4BKS D;  3KUD B;  3QC8 B;  2BWF A;  2ZVN A;  2ZJD A;  5J2R A;  3N30 A;  2K1F A;  1TZ1 A;  2MSE D;  4JL9 A;  2FCN A;  4E71 A;  4GXB A;  3PS6 A;  4EOY A;  1H8C A;  3QCA A;  2KX0 A;  1OEY J;  3H7P A;  3K9O B;  2C5L C;  4W9I A;  2IY0 B;  3S2A A;  2K8H A;  4BVU C;  5JZE B;  4KIK B;  4DHJ B;  3TL5 A;  1WMH B;  1Z2M A;  2J0M A;  1OEY A;  3A33 B;  1WE6 A;  3A9J A;  3QAR A;  4BOS C;  2DZK A;  3LJ3 A;  2MA9 B;  1GJZ A;  2ZCB A;  4CYE A;  2L0F A;  2C7N B;  3PZD A;  3ZIM A;  3L17 A;  3VDZ A;  4BKG A;  4MJS B;  4M0W B;  2FNJ B;  2M4N A;  3DOW A;  3M62 B;  2GBN A;  3DVN U;  3VH3 B;  2HE7 A;  2MLB A;  5DPS A;  4MH0 E;  1OTR B;  3JVZ X;  2AYO B;  1V5T A;  3GZN I;  4KV2 A;  2V4L A;  4K1R B;  2K6Q A;  3KUZ A;  3H7S A;  5L83 A;  2R2Q A;  4B9K A;  2WDT B;  2RD0 A;  3QA8 A;  4KIK A;  3WAM A;  3RD2 A;  4FLH A;  1WMH A;  4NQL B;  3QAQ A;  3IBE A;  4MEM A;  4LJP B;  4FBJ B;  2BYE A;  5JHB A;  4IWQ A;  2NBU A;  3V62 A;  5DPW A;  4TQ0 A;  1GG3 A;  4AWJ A;  2N9P C;  1OGW A;  1SIF A;  3M95 A;  2DZJ A;  5CHV C;  2O2V B;  3KW5 B;  5IAA C;  3A9K A;  2FCQ A;  1VCB A;  2JZZ A;  2C7H A;  4IM3 A;  5LXI B;  2K39 A;  3CSF A;  1D3Z A;  4IC7 B;  3R66 C;  3UQA A;  2EKE C;  3ZW3 A;  2C7M B;  3L0W B;  3NS8 A;  3KYD D;  4RM8 A;  2FAZ A;  4WJO A;  2MCN B;  2LUE A;  1KJT A;  1GC7 A;  1WXV A;  2LWP A;  3AU5 A;  4TV3 A;  3UGB B;  3AUL A;  4P7I A;  2VRR B;  2KWC A;  4GGQ A;  2CU1 A;  1ZGU B;  1E5W A;  2G3Q B;  3TBL D;  4JQW C;  2KZR A;  5GMV A;  4BFR A;  3KYC D;  2KJR A;  4IW0 A;  1WJ4 A;  3PV1 A;  4GSW A;  4I6N B;  3PVL A;  1WGD A;  1EF1 A;  1YD8 U;  2K8B A;  2KC1 A;  2NS5 A;  3KVF B;  5AZF A;  2J0J A;  1ISN A;  4KDL B;  1S3S G;  4PYZ A;  3CMM B;  2L05 A;  3NY5 A;  4GMV A;  4WWO A;  5KHO A;  2O2V A;  3DBL I;  3JYU A;  1F9J A;  4EZL A;  3M3J A;  3NHE B;  4BKT A;  1J8C A;  4IWP A;  4GOC A;  3KUC B;  2LRW A;  2KVR A;  2HTH A;  3AXC A;  4GIV A;  4LJO B;  3L16 A;  4XC2 A;  2DYO A;  3WA0 A;  3ZTC A;  4URK A;  2LD9 A;  4MSQ B;  1OQY A;  2OOB B;  4EZJ A;  5E6N A;  2RR9 A;  1KLV A;  4NAW B;  3ZNG C;  3APF A;  1WM2 A;  2WX0 A;  4N9F 4;  1E90 A;  1XD3 B;  1UBQ A;  2BWE S;  2G45 B;  2LZ6 A;  3R3M A;  4NY0 A;  3Q3J A;  2XK5 B;  2DX5 B;  2ZNV B;  2DYB A;  4DHZ E;  4ANU A;  2KMC A;  1LM8 B;  4GDL A;  1WH3 A;  4KZC A;  3ZO5 B;  4HCN B;  4PS8 A;  5D2M B;  5J17 A;  1V6E A;  3MHS D;  2WX1 A;  2AWT A;  2D10 A;  3IFW B;  4FHJ A;  4WQO B;  2RPQ A;  1HE8 A;  4IWO A;  2ZPY A;  5CHW A;  5G55 A;  1WGG A;  2IO0 B;  4GB9 A;  2MBH A;  1YQB A;  2L0T A;  2D2Q A;  2BGF A;  2YLM A;  3IHP C;  2N4F A;  2JF5 A;  4NPN A;  3LDZ E;  3RZF A;  2UYZ B;  4EZK A;  3ML9 A;  2NBW B;  4TUU A;  4W9H A;  2KTR A;  1Q5W B;  1V80 A;  1SE9 A;  3UF8 A;  4WWP A;  4AUQ C;  3BY4 B;  4ICV A;  5AZG A;  3UIP B;  3ALB A;  4NAW A;  2LJ5 A;  2NBV B;  3OJ3 A;  1V9J A;  2DAJ A;  2YVC A;  4K7U A;  4ANV A;  2FID A;  3DCG A;  2JT4 B;  1L2N A;  2XK5 A;  1V2Y A;  4W9E A;  2KWU B;  3O65 B;  2GBK A;  4ZRK A;  3ZLZ A;  3V6C B;  1I35 A;  1UEL A;  2EMS A;  4K7W A;  1WX8 A;  2KDI A;  1R4M I;  2KQ7 A;  4HJK A;  4MGK E;  2O6V D;  2IBI B;  2MP2 B;  2KFJ A;  4FA6 A;  1C3T A;  3AU4 A;  2JVC A;  2KJH B;  1H4R A;  4IM0 A;  3PLU A;  1YJ1 A;  2LI5 A;  4HPL B;  2OJR A;  4HLE A;  1LXD A;  3BIN A;  2KWV B;  3DVG Y;  5DPR A;  2CS4 A;  2MWS B;  5LLI A;  3ZKJ C;  2CHX A;  1V49 A;  2AL6 A;  3JW0 X;  4HVB A;  1UGM A;  1KOT A;  3PRM B;  5DPT A;  4MSM B;  5BO4 B;  4KVG B;  2JXX A;  4PS7 A;  3UQB A;  2K25 A;  4HDO A;  3OLM D;  5CX3 A;  2FUH B;  4M8N A;  1XQQ A;  2O6V B;  4W9C A;  2FCM A;  2Z0D B;  5AZH A;  1EUV B;  2AEH A;  2MBE A;  2N1W A;  4YL8 A;  3X23 A;  4BBN C;  3HM6 X;  3SHQ A;  3U7D A;  2RSU A;  4DDI D;  4MJS A;  2KJ6 A;  3W1S A;  2KAN A;  2M8S A;  1P1A A;  4BKS A;  3HHM A;  4LCD E;  1EO6 A;  4FHK A;  4ZRI A;  3NZU A;  4MGZ E;  1WZ0 A;  4A3P A;  3D32 A;  4DHZ B;  3A1Q B;  3H6N A;  1MG8 A;  2N9X A;  3WAP A;  4IG7 B;  3DVN V;  3VTU A;  4HDQ A;  1IPG A;  2KOX A;  1WM3 A;  2JY6 A;  4DXA B;  2XEW A;  4HCP B;  4HPM B;  4A20 A;  1UZX B;  2ZEQ A;  4OVV A;  1WGY A;  3QHT A;  4I6P A;  3CF6 E;  2O6V A;  3OAW A;  1V5O A;  2G4D B;  5D94 A;  4BOZ B;  4OVU A;  4EEW A;  2B3A A;  5DCN A;  3DBR I;  4EKU A;  2KK8 A;  3MJW A;  2CR5 A;  4ZDV A;  2MQJ A;  4FJY A;  2KLC A;  5E6P A;  3VUY A;  3GOE A;  3QJZ A;  2BKR B;  1UH6 A;  2JUO A;  3DVG X;  3B0A A;  2FIF A;  1ZW7 A;  2L76 A;  1BT0 A;  1R4N I;  4MEL A;  5TR5 A;  1WGH A;  1QZE A;  4JGH B;  3PGE A;  3R7Q A;  2I1K A;  3TIX A;  1RFA A;  3ZUN A;  2LGX A;  4WAA A;  2NCN A;  4MGY E;  1GC6 A;  4E74 A;  4XZ4 A;  5EDS A;  2JRI B;  4EUT A;  4G3X B;  3UIO B;  3ZDM C;  1NDD A;  4IM2 A;  5C1Z A;  2MBB B;  2PE9 A;  3L08 A;  4HXD A;  3I3T B;  3KH0 A;  1WXS A;  2GMI C;  2A5U A;  4II3 B;  1G6J A;  2FCS A;  3VQI A;  2C9W B;  1UD7 A;  3DPD A;  4DWF A;  2EMT A;  3PRP B;  3PSE B;  4W9K A;  3RUL A;  4ANX A;  2PJH A;  3VFK A;  2LXC A;  3VTW A;  4MGI E;  4K7S A;  2C60 A;  2WYQ A;  2KTF A;  1RLF A;  3PPA A;  3WIM A;  1K8R B;  3HK0 A;  2CHW A;  4MDK E;  5JH5 C;  1Q1O A;  3PT2 B;  3ZNI D;  2AL3 A;  1Y8R C;  2LGD A;  2UWQ A;  1TBE A;  2L7R A;  1JRU A;  2JWZ A;  3RUI B;  1V81 A;  3DBH I;  2N7E A;  1WX9 A;  3W1S C;  2GOW A;  3C0R B;  3H1U A;  3HIZ A;  1YIW A;  3SU8 X;  5JHA A;  2JPH A;  4W9L A;  2ASQ A;  3A4R A;  1WI0 A;  3ENE A;  3VXW A;  2QHO A;  2DYM A;  1V86 A;  3OJ4 B;  4WWN A;  3ECI A;  3VVW B;  3X0W A;  2KLG A;  4W9J A;  4ASW C;  2IO3 B;  2R2O A;  2M0X A;  1Q0W B;  2KX3 A;  3VH4 B;  2CHZ A;  2LGY A;  1FXT B;  2ZPN A;  4IUM B;  2Y5B B;  4W9D A;  3VUW A;  3K9P B;  3QWZ B;  5KHQ A;  2DZI A;  2MBQ A;  2PEA A;  2RGF A;  3UIN B;  3MTN B;  2KDB A;  3EC8 A;  4FJV B;  2IO1 B;  2N7D A;  3QK0 A;  1WY8 A;  4KDI C;  1UBI A;  3VAW A;  5IA7 A;  2M1M A;  2N9E B;  4WJQ A;  2V3S A;  2KNB A;  3IVF A;  2KDF B;  1A5R A;  2ZZP B;  4AP4 C;  4AJW A;  2Z0E B;  3DQV A;  1RRB A;  1WJU A;  1U4A A;  3H9D A;  1AAR A;  2V1Y A;  3ZVV A;  1WIA A;  3WAO A;  3WAN A;  5D6J B;  4ICU A;  1P98 A;  1KM7 A;  4GDK B;  1IYF A;  2KFK B;  4CO7 A;  2L8J A;  4RMA A;  3TMP B;  2NPT B;  4JLC A;  3M63 B;  3ML8 A;  1PQS A;  3Q3F A;  2MBO A;  3ZRC A;  3APD A;  4AOF A;  4FAD A;  4DBG A;  5CHF A;  1WJN A;  3V6E B;  2K8C A;  1C1Y B;  4DK5 A;  4KZ0 A;  2N1V A;  3PTF C;  3T9L A;  2KN5 A;  3IG3 A;  5HKH A;  3L13 A;  4ZRJ A;  1WRD B;  1E8W A;  3A9K B;  3L10 B;  3RCZ A;  3QIJ A;  3V61 A;  3ZTD A;  1XT9 B;  1EF5 A;  2MP2 A;  3P2B A;  2J0K A;  1P0R A;  2J7Q B;  3TJP A;  2IYD B;  4KSK C;  3AI5 A;  5FR6 A;  3V60 A;  3PHW B;  1T0Y A;  4F8C B;  1IP9 A;  2IO2 B;  4M8M A;  2JZ3 B;  3QX1 A;  4B6W A;  3B08 A;  5E6O A;  3PLV A;  1E7V A;  1WR1 A;  4HK2 A;  4F1S A;  2HD5 B;  4ANW A;  4WJP A;  4JIO U;  2IZV B;  4GDK A;  4A3O A;  1E8Y A;  1WF9 A;  2KFK A;  2KXJ A;  2Z59 B;  3TCA A;  1LFD A;  3SDL C;  1NI2 A;  1WE7 A;  1WFY A;  4II2 B;  2NPT A;  4GN1 A;  3U30 A;  4CHK A;  3T8M A;  1VD2 A;  2K6D B;  4NJ6 A;  2DEN B;  3DDC B;  2BKF A;  4BBN F;  2KKC A;  2LVP A;  2LVO A;  2DZM A;  2PE6 B;  4TKN A;  5L95 C;  1WXA A;  1CMX B;  2KC2 A;  3B1L X;  3N3K B;  2NR2 A;  3R7R A;  2BYF A;  1LQB A;  1P3Q U;  2KHW B;  2ZNV C;  2D3G A;  1E8Z A;  1ZKH A;  4W9F A;  2LAS A;  2WWZ A;  2L3Z A;  3PRZ A;  3W1Y A;  4G50 A;  2CKH B;  4KSL C;  4G0N B;  2G4S A;  3APC A;  5D7G A;  3WAL A;  5LXH A;  3RYT A;  3A1Q A;  2D11 A;  4FJZ A;  3SD5 A;  4FN2 A;  2GBR A;  4F7Z A;  2REX A;  1WXM A;  4XX5 A;  3ZNZ B;  4W9G A;  2LXA A;  4G11 A;  3NOB A;  3PRE A;  4K81 A;  2KDE B;  2XBB C;  1E7U A;  3VHT C;  5J18 A;  1NBF C;  3JSV B;  2GBJ A;  4TQ1 A;  3N32 A;  5G2N A;  3ZDT A;  1I42 A;  4GDL B;  1GUA B;  5CTR C;  1E8X A;  3ZRF A;  2JRH A;  1P9D U;  5C23 A;  4E3C A;  3NZS A;  3EFU A;  3EEC A;  3RT3 B;  1RAX A;  2LVQ A;  4HWI B;  3QQ8 B;  1S1Q B;  3DBS A;  1SGH A;  3ZNH B;  1WX7 A;  4LDT D;  3U8Z A;  2LRU A;  2L00 B;  1M94 A; 
#chains in the Genus database with same CATH topology
 1MHX A;  2HJ8 A;  4I6L B;  2KTR B;  2PPH A;  2ZVO A;  4ZYN A;  3L54 A;  3MFG A;  4D2K A;  4B95 A;  1QF6 A;  1LO5 D;  2KMA A;  2BPS A;  1N60 A;  1T0S C;  4DDG D;  1QOG A;  1AWD A;  4X57 B;  3HM3 A;  2A4Z A;  2GBM A;  4P16 A;  4BKS D;  2BT6 A;  3QC8 B;  1EU3 A;  2ZVN A;  4YSY B;  4JL9 A;  4E71 A;  4N59 A;  4W9I A;  1FMA D;  4US8 A;  4ARC A;  3A33 B;  4CYE A;  1ESF A;  4LNK A;  3PZD A;  1T3Q A;  2AQ2 B;  2FNJ B;  2M4N A;  3M62 B;  2J52 A;  3VH3 B;  4O1N A;  4K3C A;  1V5T A;  2V4L A;  2J42 A;  3KUZ A;  3H7S A;  4B9K A;  3NVW A;  4P1C C;  2D3C A;  1JW9 D;  3W9C B;  4KIK A;  3BK2 A;  3WAM A;  2D3A A;  3RD2 A;  2M19 A;  2QEJ C;  3IBE A;  4LJP B;  2BYE A;  2WQY B;  3Q8E A;  4HKQ A;  1HZ6 A;  2RDB C;  4AWJ A;  3M95 A;  2DZJ A;  4M0W A;  2V4I B;  4YWG G;  5LXI B;  2K39 A;  4IC7 B;  3UQA A;  2EKE C;  2C7M B;  2KDM A;  3NS8 A;  4WJO A;  3ZJT A;  1KFY B;  1KJT A;  2ZW0 A;  3NZ3 A;  1GC7 A;  1WXV A;  1HQR D;  1PUT A;  2Y5P A;  2CU1 A;  3RNF C;  1ZGU B;  1V1P A;  4MAC A;  4JQW C;  3TSS A;  3KYC D;  4AQ7 A;  1WGD A;  1EF1 A;  2K8B A;  2J0J A;  1R7S A;  4KDL B;  3CMM B;  4TSS A;  2VH2 A;  1DYQ A;  3JYU A;  3T3O A;  1J8C A;  4GOC A;  3KWL A;  3IAM 1;  2LRW A;  2HTH A;  3U4E G;  4GIV A;  4XC2 A;  2DYO A;  2GRI A;  2N7J A;  4JX1 C;  4EZJ A;  2Q5W D;  1RM6 C;  1WM2 A;  2LGI A;  2EEL A;  2G45 B;  3R3M A;  4ARI A;  1DOX A;  2KMC A;  4YT0 B;  4HCN B;  5LNK 1;  4L1B A;  2AWT A;  4YXD B;  4IWO A;  5CHW A;  5G55 A;  3Q2A C;  2NMQ A;  1QOF A;  2BGF A;  3IHP C;  2UYZ B;  1Q5W B;  4C56 C;  4AUQ C;  4WWP A;  1HEZ E;  4NAW A;  2DAJ A;  4ANV A;  2JYE A;  2JT4 B;  2XK5 A;  4USA A;  1MPE A;  4ZRK A;  1XXG A;  1YJJ A;  2QCZ A;  2EMS A;  1E0Z A;  4MGK E;  4HJK A;  2KFJ A;  4FA6 A;  1XO3 A;  1YJ1 A;  5FR3 A;  5HG2 A;  1JWA D;  2E3T A;  1R4N B;  3BIN A;  1GAQ B;  5EE0 A;  5DPR A;  5HFY A;  5LLI A;  3PRM B;  5DPT A;  1DOI A;  4PS7 A;  4LLG M;  4HDO A;  2FUH B;  5AZH A;  1EUV B;  1EWY C;  2INN E;  2RSU A;  4DDI D;  4XYC A;  3W1S A;  2M8S A;  2NTS A;  4LCD E;  4MGZ E;  1WZ0 A;  4A3P A;  2H88 B;  2LFI A;  4KGT A;  3DVN V;  2L52 A;  3L4P A;  4A20 A;  1UZX B;  3VRA B;  2O6V A;  1V5O A;  2G4D B;  2WDR B;  4OVU A;  3RI7 C;  2EKI A;  3VUY A;  3GOE A;  2WXR A;  2KQ4 X;  3B0A A;  4S0R A;  1R4N I;  1F1H A;  1QZE A;  2YEP B;  3R7Q A;  4WAA A;  2NCN A;  5EDS A;  2INC C;  2X38 A;  3UIO B;  1PGB A;  4HXD A;  4XWW A;  2FCS A;  2C9W B;  2BS4 B;  4DWF A;  1VZ7 A;  2EMT A;  3PRP B;  3Q8A A;  3VFK A;  4K7S A;  1SF0 A;  2KTF A;  5JH5 C;  3WIM A;  1K8R B;  1Q1O A;  2UWQ A;  2LGD A;  2L7R A;  3B2F A;  3OWE B;  3Q14 C;  4YTM B;  3C0R B;  1K53 A;  1YIW A;  2LUM A;  4B0E A;  4W9L A;  3VXW A;  1HA5 A;  3NRZ A;  1ZXI A;  3OJ4 B;  3U52 E;  3CIR B;  2MJ3 A;  2LGY A;  1FXT B;  1IGD A;  2Y5B B;  3K9P B;  3QWZ B;  5KHQ A;  2MBQ A;  2PEA A;  1WYG A;  1WSP A;  3EC8 A;  4FJV B;  3QK0 A;  2N7D A;  1N62 A;  1YN4 A;  1UBI A;  3VAW A;  5IA7 A;  1L4Z B;  1GB4 A;  1C4P A;  4US9 A;  3DWM A;  5D6J B;  1N61 A;  4GDK B;  2AQ3 B;  5BYS A;  4P6V F;  3ML8 A;  1KTK A;  3N20 C;  4DBG A;  2PKO A;  3V6E B;  2JSV X;  2R61 A;  3IG3 A;  1E8W A;  3A9K B;  3BK1 A;  3V61 A;  4TMA B;  1EF5 A;  1L0X B;  4H2A A;  3C8Y A;  4F8C B;  4NZL B;  3QX1 A;  4B6W A;  3PLV A;  1ZP0 B;  4HK2 A;  2HD5 B;  1QOB A;  4JIO U;  1N63 A;  3RMK C;  1E8Y A;  5JXV A;  2Z59 B;  3LYY A;  1NI2 A;  4II2 B;  4ITK A;  1VD2 A;  4NJ6 A;  1KRH A;  2DEN B;  2BKF A;  1V8C A;  2WU5 B;  4NJC A;  1CMX B;  3EFC A;  2BYF A;  3RNC C;  1LQB A;  2BVC A;  2BS2 B;  2JX5 A;  2G4S A;  1E6E B;  4WWM A;  1TJE A;  1DOY A;  4FJZ A;  2REX A;  4W9G A;  4G11 A;  4K81 A;  2KDE B;  3ZXV A;  3JSV B;  2GBJ A;  1GUA B;  1E8X A;  2JRH A;  1D5X C;  4HWI B;  2KMM A;  2GB1 A;  1SE3 A;  1JRO A;  1M94 A;  2KO3 A;  1UWX A;  2WXM A;  5AUI A;  1TGZ B;  3DHI C;  3A4S C;  1X1M A;  1J0G A;  1RFK A;  1WJ6 A;  4PK1 A;  4RF0 A;  4DHJ D;  3A9J B;  2VH1 A;  1V1O A;  4LNF A;  4WJN A;  3RZW C;  5AEK B;  3ONS A;  1L7Y A;  2D07 B;  4LDT B;  4J6I A;  2I1J A;  1YX6 B;  3MC8 A;  2BWF A;  3BYY B;  5J2R A;  1TS3 A;  2MSE D;  3Q8C A;  4EOY A;  3QCA A;  3S2A A;  4BVU C;  2JXT A;  1WMH B;  2G1E A;  3BYT B;  1A70 A;  3QAR A;  2MA9 B;  3CWI A;  4DQO C;  1YOV B;  2W3R A;  3DBL B;  2L0F A;  1L5P A;  4REZ A;  2MLB A;  4ZYS A;  1B1Z A;  4MH0 E;  1OTR B;  3JVZ X;  3TEY A;  2NTT A;  4IKG A;  1CK1 A;  3E9S A;  2R2Q A;  3RNA C;  3I5J C;  3AEC B;  4C00 A;  1MVK A;  3QAQ A;  5IO9 A;  1ENF A;  4R3D A;  2NBU A;  5DPW A;  2JQR B;  4TQ0 A;  1GG3 A;  3LB8 C;  1HXY D;  3P4R B;  2O2V B;  4C4V B;  3R66 C;  3L0W B;  2FAZ A;  1PYW D;  2LWP A;  4TV3 A;  4OZA A;  1TS4 A;  3UGB B;  2QMT A;  2VRR B;  1JWU D;  2KZR A;  5GMV A;  4IW0 A;  4GSW A;  2MHJ A;  3PVL A;  1YD8 U;  5BYQ A;  3KVF B;  2NS5 A;  4PYZ A;  1WRI A;  1TY2 A;  4WWO A;  3NY5 A;  1R4M B;  3DBL I;  1F0Z A;  3NHE B;  4XGA B;  2I2Y A;  1DGJ A;  1OQR A;  2KVR A;  1L0V B;  2BYT A;  5E6J A;  3O13 A;  3U7Z A;  2OOB B;  2WHI A;  5E6N A;  1SJE D;  3ZYY X;  5I4D A;  1VZ6 A;  2QDF A;  4N9F 4;  1CJE A;  5MPO A;  3ABV B;  4DHZ E;  3GS2 A;  4GDL A;  1XCT L;  4PT5 A;  4PS8 A;  1V6E A;  2DWQ A;  2WX1 A;  2D10 A;  3Q8B A;  2RPQ A;  1HE8 A;  4EZK A;  2V0G A;  2NBW B;  4TUU A;  2Y3A A;  2V9H A;  1SE9 A;  2WXP A;  2LJ5 A;  4ACF A;  1V9J A;  2YVC A;  1C78 A;  2FID A;  1V2Y A;  1SXT A;  2KWU B;  1I4G A;  4K7W A;  2KDI A;  1R4M I;  3EGR A;  2MP2 B;  1C3T A;  3AU4 A;  4IM0 A;  1H4R A;  2OJR A;  5IP4 D;  3NS1 A;  1MI0 A;  4KGS A;  5BYR A;  2MWS B;  1XF5 L;  2KT7 A;  2WGS A;  3JW0 X;  2L83 A;  4MSM B;  5BO4 B;  4KVG B;  2JXX A;  2K25 A;  3GB1 A;  3VR8 B;  1FNV A;  2FCM A;  3P4S B;  2Z0D B;  4C7Z A;  5HI1 A;  2MBE A;  3X23 A;  3AMZ A;  4BAX A;  2ACZ B;  4L2Y A;  1D5Z C;  4MJS A;  2KAN A;  1P1A A;  3DBH B;  1EO6 A;  4ZRI A;  1JWS D;  1GPX A;  3HUI A;  2WXG A;  1P7E A;  3H6N A;  1L6V A;  3P1M A;  3LXF A;  4HPP A;  2WXK A;  1IPG A;  3TEX A;  4DXA B;  4KX6 B;  4HCP B;  4HPM B;  4OVV A;  1WGY A;  1ZXH A;  2WXO A;  3TEW A;  3OAW A;  1PFD A;  2JU6 X;  2PLP A;  1TS2 A;  4EEW A;  4RGM A;  2DNF A;  3Q3N C;  3MJ5 A;  2KK8 A;  1T0R C;  3MJW A;  2CR5 A;  4FJY A;  4A9A A;  1D5M C;  1SIJ A;  2KLC A;  3QJZ A;  2BKR B;  1EM7 A;  1UH6 A;  3DVG X;  3AE5 B;  2QIE B;  5TR5 A;  1TKG A;  1FO4 A;  1XLO A;  2I1K A;  1E7P B;  3TIX A;  3ZUN A;  2LGX A;  2IGD A;  1GC6 A;  4E74 A;  3ZDM C;  2SAK A;  4IM2 A;  3L08 A;  4BZA A;  2A5U A;  4II3 B;  3VQI A;  1OQQ A;  1UD7 A;  3PSE B;  4W9K A;  1JAL A;  2WS3 B;  2C60 A;  2AL3 A;  1TBE A;  1JRU A;  1YN3 A;  2TSS A;  3DBH I;  5GXG B;  1FXI A;  1NYR A;  2ASQ A;  1WI0 A;  3N9Y C;  1Y56 A;  3RNB C;  2DYM A;  2D3B A;  2IPK D;  3OG5 A;  3AE4 B;  2KX3 A;  3Q6B A;  4W9D A;  3VUW A;  3MTN B;  1MJD A;  4YTN B;  2L1A A;  2N9E B;  4WJQ A;  3IVF A;  2DBY A;  2ZZP B;  3I9V 1;  1RRB A;  1U4A A;  3H9D A;  2OHF A;  4ICU A;  1P98 A;  1KM7 A;  1IYF A;  4RMA A;  2BTE A;  3AEB B;  4JLC A;  3ZRC A;  3Q3F A;  3RPF C;  3APD A;  4RFB A;  5CHF A;  4N58 A;  3SFD B;  2AX5 A;  3T9L A;  1TIF A;  5HKH A;  3L13 A;  3NUH B;  1WRD B;  4RGN A;  3RCZ A;  3VRB B;  3ZTD A;  1XT9 B;  3P2B A;  1JRP A;  2J0K A;  3KLS X;  1P0R A;  2IYD B;  4KSK C;  1IP9 A;  1T0Y A;  1FFU A;  2JZ3 B;  4MH8 A;  4KKJ A;  4ANW A;  3ZQ4 A;  2IZV B;  4GDK A;  4A3O A;  1WF9 A;  1V1P B;  1LFD A;  2E6X A;  2LVP A;  3KWV A;  1C76 A;  1WXA A;  2KC2 A;  3B1L X;  3N3K B;  2NR2 A;  2QJL A;  2VZK D;  3R7R A;  3AE1 B;  2D3G A;  2LAS A;  2WWZ A;  1VJK A;  2L3Z A;  3E56 A;  1ZDV A;  3W1Y A;  1IBX A;  3A1Q A;  5D3I B;  4JPS A;  1RYJ A;  1QQR A;  1F52 A;  1E7U A;  1TZO A;  5J18 A;  4MM3 B;  2RDH A;  3N32 A;  1KH0 A;  5C23 A;  3EFU A;  3EEC A;  1SGH A;  4XDC A;  4WQM A;  3ZNH B;  3TUO A;  1T5X D;  4GU2 A;  2ZCC A;  3H7P B;  2MX2 A;  5G5H A;  5D3D A;  1WGK A;  1Z5S B;  4AJY B;  1YX5 B;  2MW5 A;  5IN7 A;  3JSV A;  1YQ4 B;  2BYV E;  1UWM A;  1WGR A;  1WZ3 A;  2QSD A;  2X8X X;  2KQS A;  3EHV A;  2IY1 B;  2W9N A;  5BMG A;  1J19 A;  4NJ7 A;  2BF8 B;  2KD0 A;  1WR6 E;  2ICI A;  3CST A;  3V05 A;  4NQK E;  1BUI C;  1GOZ A;  1PGA A;  1NI3 A;  2K1F A;  1TZ1 A;  2FCN A;  1H8C A;  2KX0 A;  1OEY J;  3K9O B;  4DHJ B;  2WXI A;  1Z2M A;  1OEY A;  3AE2 B;  1LGR A;  1WE6 A;  3A9J A;  1GJZ A;  2BB6 A;  4L23 A;  3ZIM A;  2BQQ A;  2HE7 A;  5DPS A;  3FIL A;  2AYO B;  4KV2 A;  4K1R B;  1C79 A;  1K51 A;  2K6Q A;  1TKY A;  3EA6 A;  5L83 A;  3AEG B;  4JWS C;  1HZ5 A;  3QA8 A;  2ON8 A;  3AB5 A;  2KVZ A;  3BVZ A;  5AUK A;  1WMH A;  4NQL B;  2WXF A;  1F2R I;  4MEM A;  2QIL A;  2IGH A;  4IWQ A;  3V62 A;  2N9P C;  1OGW A;  1SIF A;  4KGR A;  5EE1 A;  4FXC A;  1VCB A;  2JZZ A;  2C7H A;  4ZHP A;  3I63 C;  2CJN A;  2LUE A;  2HTM E;  4ZRQ A;  4C80 A;  4RNA A;  3AUL A;  4P7I A;  2KWC A;  3DHG C;  1E5W A;  3TBL D;  1FIQ A;  4N6E B;  1F2R C;  3ZXR A;  4BFR A;  5EE9 A;  2KJR A;  2FE8 A;  1ZE3 D;  5AZF A;  1NEK B;  1S3S G;  2L05 A;  4GMV A;  2O2V A;  3M3J A;  4C4V A;  3AV8 A;  2KYW A;  4BKT A;  2N9K A;  4HRS A;  4YTP B;  3KUC B;  1EWC A;  1L4D B;  5TSS A;  4URK A;  2LD9 A;  2CU3 A;  2PVG C;  4MSQ B;  3ZGZ A;  1OQY A;  1KLV A;  2RMM A;  3Q3M C;  3APF A;  3ZNG C;  2AQ1 B;  2WDQ B;  2BWE S;  2LZ6 A;  4NY0 A;  2WXQ A;  3Q3J A;  2DX5 B;  1YN5 A;  3AN1 A;  5H92 C;  2ZNV B;  3V3X A;  4DXF A;  4ANU A;  2JZP A;  1WH3 A;  4KZC A;  1FD6 A;  3ZO5 B;  2HJ1 A;  2BB5 A;  5J17 A;  2IDY A;  3MHS D;  4WQO B;  4FHJ A;  3NVV A;  2ZPY A;  1N6Z A;  1I4X A;  1WGG A;  4GB9 A;  2MBH A;  2Z8L A;  3RZF A;  2D2Q A;  2N4F A;  2JF5 A;  3LDZ E;  3RFZ B;  4W9H A;  1CQV A;  2KTR A;  1V80 A;  3IAS 1;  4ICV A;  2QC8 A;  3NJT A;  5AZG A;  1SEB D;  3UIP B;  3ALB A;  3OJ3 A;  4K7U A;  2RPV A;  1GB1 A;  3P63 A;  3BVM A;  1IGC A;  1L2N A;  2H89 B;  3O65 B;  3ZLZ A;  1K52 A;  4ZOH C;  3MHZ A;  2LGS A;  1UEL A;  3DBR B;  4WAF A;  2KQ7 A;  2O6V D;  2IBI B;  2GLS A;  2JVC A;  2KAJ A;  2KJH B;  3AE6 B;  3AEA B;  1SSN A;  5BMH A;  4HLE A;  1LXD A;  1FPY A;  2KWV B;  3ZKJ C;  1V49 A;  4HJG E;  4HVB A;  1QLB B;  1FNW A;  3OLM D;  5CX3 A;  2W82 A;  4JWU C;  4M8N A;  1XQQ A;  3J9C A;  2N1W A;  4RH6 A;  4YL8 A;  3BWU D;  3HM6 X;  3SHQ A;  3U7D A;  2FUG 1;  1FRD A;  3H8H A;  4FHK A;  3RNE C;  3R8B A;  1FM0 D;  2YEP F;  4DHZ B;  3WAP A;  4HDQ A;  1E9M A;  2ZEQ A;  4I6P A;  1FCC C;  2K0P A;  2J4X A;  5DCN A;  3DBR I;  4EKU A;  1QOA A;  5E6P A;  2JUO A;  1ZW7 A;  2Y5C A;  1WGH A;  4JGH B;  1RFA A;  2LHE A;  4XZ4 A;  5T8I A;  3AE9 B;  2JRI B;  4G3X B;  2MBB B;  2PE9 A;  3R2T A;  3I3T B;  3KH0 A;  3N1Y C;  2GMI C;  3PZ7 A;  1G6J A;  2PJH A;  1XLQ A;  1XLN A;  4A6Q A;  5JHB A;  3PPA A;  3HK0 A;  4MDK E;  3PT2 B;  3ZNI D;  1Y8R C;  2KN4 A;  2JWZ A;  2GI9 A;  1WX9 A;  2GOW A;  1VDV A;  3HIZ A;  1E10 A;  2RDG A;  1UNS A;  4Q2J A;  1I4R A;  3ENE A;  2QHO A;  5FK9 C;  1V86 A;  3VVW B;  1I4P A;  1Q10 A;  2KLG A;  1P7F A;  4RCO A;  2V3P A;  4W9J A;  2R2O A;  2M0X A;  1Q0W B;  4ASW C;  4UDU C;  4RGO S;  2CHZ A;  1L0Y B;  4IUM B;  2WXJ A;  1KF6 B;  3HVZ A;  2DZI A;  1BML C;  4A55 A;  4KDI C;  1WY8 A;  1HTQ A;  4OW0 A;  2M1M A;  2V3S A;  2KNB A;  2KDF B;  4M00 A;  4AP4 C;  2Z0E B;  3DQV A;  4OZB A;  1AAR A;  2V1Y A;  5H8Y E;  4AS1 A;  3WAN A;  1TY0 A;  1VRA B;  4YSX B;  2KFK B;  4CO7 A;  3TMP B;  2NPT B;  1ZOY B;  1TT5 B;  2MBO A;  4FAD A;  1C1Y B;  4KZ0 A;  2N1V A;  1AYF A;  2KN5 A;  1YNT E;  4QAY A;  1TS5 A;  3QIJ A;  4A8X C;  2G9H D;  2WNM A;  3TJP A;  5C2T B;  2ONQ A;  5FR6 A;  3V60 A;  1SE4 A;  1AW7 A;  2IO2 B;  3NVZ A;  4WIP A;  1WR1 A;  1T0Q C;  4HRO A;  4C7Y A;  3TCA A;  3SDL C;  2PVO D;  4CHK A;  3T8M A;  1J7A A;  2IGG A;  1FEH A;  4XE0 A;  5IOI A;  2LVO A;  2PE6 B;  1I4Q A;  2MJE A;  2XN9 C;  2HDE A;  1NEN B;  2K9X A;  1FFV A;  1E8Z A;  1ZKH A;  4W9F A;  1IUE A;  2WXH A;  4LTU A;  3PRZ A;  4G50 A;  1SE2 A;  5D7G A;  1JML A;  1PDX A;  4XWT A;  3WAL A;  4A90 A;  1QKZ A;  1L6U A;  2BW2 A;  1VR9 A;  2IND C;  3SD5 A;  4FN2 A;  2GBR A;  1WXM A;  3ZNZ B;  2WLB A;  3PRE A;  2VZK B;  2B76 B;  3W5V B;  3B9J A;  1NBF C;  4TQ1 A;  3ZDT A;  4GDL B;  2UU7 A;  5EE3 A;  3ZRF A;  3NZS A;  3RT3 B;  1RAX A;  3QQ8 B;  1J7B A;  3SEB A;  4DXG A;  1CZP A;  2D5G A;  3GZN B;  1WX7 A;  2N0S B;  2LRU A;  2L00 B;  5G2N A;  4ZHO A;  2DHZ A;  4FUL A;  3PHX B;  4PYU A;  2NVU I;  3Q8F A;  3RNG C;  4RF1 A;  3VTV A;  2PW9 A;  4MM3 A;  1WYW B;  4P1B C;  4PS3 A;  3U2S C;  2DAF A;  4S17 A;  3I57 A;  4EFO A;  3VUX A;  2MRP A;  3MC0 B;  2M17 A;  1AN8 A;  1ET6 A;  3W2D A;  2WXN A;  4NNJ B;  1TTN A;  1FCL A;  4RM9 A;  1GNU A;  1F77 A;  3KUD B;  1SJH D;  2ZJD A;  1VZ8 A;  3AM9 A;  3N30 A;  1C4C A;  1FNU A;  1YJI A;  4GXB A;  3PS6 A;  3H7P A;  2C5L C;  1JQ4 A;  2IY0 B;  5JZE B;  2K8H A;  4KIK B;  3TL5 A;  1ACC A;  2J0M A;  4M02 A;  4BOS C;  2DZK A;  2M56 B;  3LJ3 A;  2ZCB A;  1ROE A;  2C7N B;  2OED A;  3L17 A;  3VDZ A;  4BKG A;  4MJS B;  4M0W B;  2JYT A;  1TKE A;  3DOW A;  2BBC A;  1MG4 A;  2GBN A;  3DVN U;  2OJW A;  2LJI A;  3GZN I;  5G5G A;  4LK0 M;  2W3S A;  4WH4 A;  3W5U B;  2KAC A;  2WDT B;  2RD0 A;  1QIL A;  4FLH A;  2LHD A;  1D6E C;  4FBJ B;  4YSZ B;  2PIA A;  2I38 A;  3PZ8 A;  5CHV C;  3KW5 B;  5IAA C;  3A9K A;  2FCQ A;  4IM3 A;  1I7H A;  2V3N A;  3CSF A;  1D3Z A;  3ZW3 A;  3SR6 A;  2MCN B;  3KYD D;  4RM8 A;  3AE8 B;  3AU5 A;  1I4H A;  4K3B A;  1SBB B;  4GGQ A;  4KKI A;  2G3Q B;  2FBW B;  1ZDX A;  3P4P B;  1WJ4 A;  3PV1 A;  4I6N B;  1JCK B;  2KC1 A;  1ISN A;  1XEE A;  4HKZ E;  5KHO A;  1F9J A;  4EZL A;  1M4V A;  3GE3 C;  4IWP A;  4OHJ A;  1JWB D;  3HRD D;  3AXC A;  4LJO B;  3WA0 A;  3L16 A;  3ZTC A;  2LMC A;  1V97 A;  2RR9 A;  4NAW B;  4RGT A;  2WX0 A;  1NYQ A;  1E90 A;  1FXA A;  1PGX A;  1UBQ A;  1XD3 B;  3T3N A;  2XK5 B;  3IT4 B;  5IKC M;  2DYB A;  3N1Z C;  4CQN A;  1LM8 B;  4J3O D;  3Q3O C;  5D2M B;  2XNA C;  1XLP A;  1MHH E;  1D4B A;  3IFW B;  2IO0 B;  1YQB A;  2L0T A;  2YLM A;  4NPN A;  3URY A;  1JWM D;  1ZUD 2;  3ML9 A;  3UF8 A;  3BY4 B;  2CJO A;  2NBV B;  1VLB A;  2K5P A;  3DCG A;  4W9E A;  1UF0 A;  2J53 A;  2GBK A;  3V6C B;  1I35 A;  1HTO A;  1WX8 A;  2WDV B;  3PLU A;  2LI5 A;  4HPL B;  3NG0 A;  1B9R A;  1EU4 A;  1K50 A;  1BXT A;  3DVG Y;  3IXS A;  2CS4 A;  2CHX A;  3SFE B;  3AE7 B;  2AL6 A;  4HEA 1;  1UGM A;  1KOT A;  1FRR A;  3PO0 A;  3UQB A;  2MEK A;  1OFF A;  1STE A;  2O6V B;  2BS3 B;  4W9C A;  2AEH A;  4BBN C;  2PTL A;  4LNN A;  2ZW1 A;  2KJ6 A;  4BKS A;  3HHM A;  3NZU A;  5BMI A;  1IBX B;  1UUP A;  3D32 A;  3AEE B;  3A1Q B;  1MG8 A;  2N9X A;  1KLU D;  4IG7 B;  3GP7 A;  2MH7 A;  1J7C A;  3VTU A;  2KOX A;  1WM3 A;  2JY6 A;  3AE3 B;  2XEW A;  3QHT A;  2MJD A;  3BII D;  3CF6 E;  5D94 A;  4BOZ B;  2B3A A;  1WWT A;  4ZDV A;  1N5X A;  2MQJ A;  4MT5 A;  3BZD B;  2FIF A;  2L76 A;  3R2I A;  1BT0 A;  4MEL A;  3P4Q B;  2SEB D;  3PGE A;  4LNI A;  4GLS C;  4MGY E;  3KQ4 A;  4EUT A;  2KWD A;  1NDD A;  2L32 A;  5C1Z A;  3P42 A;  3AED B;  4B0M A;  1WXS A;  3DWG C;  1KLG D;  4OVZ A;  3DPD A;  4ANX A;  3GE8 C;  3RUL A;  2LXC A;  3VTW A;  4MGI E;  2WYQ A;  1RLF A;  1UGJ A;  5C3J B;  2CHW A;  1N5W A;  3RUI B;  1C9F A;  1V81 A;  2K22 A;  2N7E A;  3W1S C;  3H1U A;  3SU8 X;  5JHA A;  2JPH A;  2WU2 B;  3A4R A;  1C77 A;  2JWU A;  1TYG B;  4WWN A;  4NAM A;  3ECI A;  3UI3 A;  3X0W A;  1QT9 A;  2IO3 B;  1ZPS A;  3VH4 B;  2ZPN A;  3FAH A;  1MFW A;  1ET9 A;  3MP9 A;  2RGF A;  3FC4 A;  3UIN B;  4EE2 A;  4IDI A;  2KDB A;  2IO1 B;  3FIL B;  3VR9 B;  3RN9 C;  1C4A A;  2INP E;  1A5R A;  4AJW A;  1YQ3 B;  1WJU A;  3FKY A;  3ZVV A;  1WIA A;  3WAO A;  2LEK A;  2PMV A;  2L8J A;  1RWS A;  3AEF B;  5HHD G;  3M63 B;  1PQS A;  4AOF A;  3EUB 2;  5FKA C;  2N9L A;  1WJN A;  2W55 A;  4IOI E;  2K8C A;  4DK5 A;  3PTF C;  4JE3 B;  3N1X C;  4ZRJ A;  3L10 B;  1YMH E;  1SB3 C;  4LNO A;  1T6B X;  2MP2 A;  3ETR A;  4M01 A;  2J7Q B;  3AI5 A;  3PHW B;  3NVY A;  2W54 A;  4M8M A;  4ZRP A;  3B08 A;  5E6O A;  3WCQ A;  1E7V A;  3ZJV A;  3MC9 A;  4WJP A;  3BVG A;  3DHH C;  2KFK A;  3C19 A;  2KXJ A;  1WE7 A;  1WFY A;  3U30 A;  2NPT A;  4GN1 A;  2K3U A;  2K6D B;  3DDC B;  4BBN F;  2KKC A;  3AH7 A;  2DZM A;  4TKN A;  5L95 C;  1XCQ L;  2WXL A;  1P3Q U;  2KHW B;  2ZNV C;  3Q69 A;  3HVD A;  3TEZ A;  2IJ0 A;  2CKH B;  4KSL C;  4G0N B;  2M0A A;  3APC A;  5LXH A;  3RYT A;  4XDD A;  3ZJU A;  2D11 A;  4F7Z A;  3B2G A;  4XX5 A;  2DLB A;  2LXA A;  3IT6 B;  3NOB A;  2XBB C;  3VHT C;  1I42 A;  5CTR C;  1P9D U;  4WUR A;  4E3C A;  1NVI D;  2LVQ A;  1S1Q B;  3DBS A;  4OZC A;  2WP9 B;  4F1S A;  4LDT D;  3U8Z A;  1WXQ A; 
#chains in the Genus database with same CATH homology
 2HJ8 A;  2KO3 A;  4I6L B;  2KTR B;  2PPH A;  2DHZ A;  4FUL A;  2ZVO A;  4GU2 A;  4ZYN A;  1TGZ B;  2ZCC A;  3L54 A;  3A4S C;  3H7P B;  2MX2 A;  3PHX B;  4PYU A;  1X1M A;  2NVU I;  1Z5S B;  4AJY B;  3VTV A;  1J0G A;  4B95 A;  1YX5 B;  2MW5 A;  1WJ6 A;  2KMA A;  4MM3 A;  1WYW B;  3A9J B;  3JSV A;  2BPS A;  4DHJ D;  4PS3 A;  2BYV E;  2DAF A;  4EFO A;  1WGR A;  1WZ3 A;  2KQS A;  4WJN A;  3VUX A;  2MRP A;  3RZW C;  4DDG D;  3EHV A;  5AEK B;  2IY1 B;  3ONS A;  4X57 B;  2M17 A;  2W9N A;  3HM3 A;  1J19 A;  4NJ7 A;  2BF8 B;  2KD0 A;  1WR6 E;  1L7Y A;  2A4Z A;  2D07 B;  3CST A;  4J6I A;  4LDT B;  4NNJ B;  1TTN A;  2I1J A;  4RM9 A;  1GNU A;  2GBM A;  4NQK E;  1YX6 B;  4BKS D;  3KUD B;  3QC8 B;  2BWF A;  2ZVN A;  2ZJD A;  5J2R A;  3N30 A;  2K1F A;  1TZ1 A;  2MSE D;  4JL9 A;  2FCN A;  4E71 A;  4GXB A;  3PS6 A;  4EOY A;  1H8C A;  3QCA A;  2KX0 A;  1OEY J;  3H7P A;  3K9O B;  2C5L C;  4W9I A;  2IY0 B;  3S2A A;  2K8H A;  4BVU C;  5JZE B;  4KIK B;  4DHJ B;  3TL5 A;  1WMH B;  1Z2M A;  2J0M A;  1OEY A;  3A33 B;  1WE6 A;  3A9J A;  3QAR A;  4BOS C;  2DZK A;  3LJ3 A;  2MA9 B;  1GJZ A;  2ZCB A;  4CYE A;  2L0F A;  2C7N B;  3PZD A;  3ZIM A;  3L17 A;  3VDZ A;  4BKG A;  4MJS B;  4M0W B;  2FNJ B;  2M4N A;  3DOW A;  3M62 B;  2GBN A;  3DVN U;  3VH3 B;  2HE7 A;  2MLB A;  5DPS A;  4MH0 E;  1OTR B;  3JVZ X;  2AYO B;  1V5T A;  3GZN I;  4KV2 A;  2V4L A;  4K1R B;  2K6Q A;  3KUZ A;  3H7S A;  5L83 A;  2R2Q A;  4B9K A;  2WDT B;  2RD0 A;  3QA8 A;  4KIK A;  3WAM A;  3RD2 A;  4FLH A;  1WMH A;  4NQL B;  3QAQ A;  3IBE A;  4MEM A;  4LJP B;  4FBJ B;  2BYE A;  5JHB A;  4IWQ A;  2NBU A;  3V62 A;  5DPW A;  4TQ0 A;  1GG3 A;  4AWJ A;  2N9P C;  1OGW A;  1SIF A;  3M95 A;  2DZJ A;  5CHV C;  2O2V B;  3KW5 B;  5IAA C;  3A9K A;  2FCQ A;  1VCB A;  2JZZ A;  2C7H A;  4IM3 A;  5LXI B;  2K39 A;  3CSF A;  1D3Z A;  4IC7 B;  3R66 C;  3UQA A;  2EKE C;  3ZW3 A;  2C7M B;  3L0W B;  3NS8 A;  3KYD D;  4RM8 A;  2FAZ A;  4WJO A;  2MCN B;  2LUE A;  1KJT A;  1GC7 A;  1WXV A;  2LWP A;  3AU5 A;  4TV3 A;  3UGB B;  3AUL A;  4P7I A;  2VRR B;  2KWC A;  4GGQ A;  2CU1 A;  1ZGU B;  1E5W A;  2G3Q B;  3TBL D;  4JQW C;  2KZR A;  5GMV A;  4BFR A;  3KYC D;  2KJR A;  4IW0 A;  1WJ4 A;  3PV1 A;  4GSW A;  4I6N B;  3PVL A;  1WGD A;  1EF1 A;  1YD8 U;  2K8B A;  2KC1 A;  2NS5 A;  3KVF B;  5AZF A;  2J0J A;  1ISN A;  4KDL B;  1S3S G;  4PYZ A;  3CMM B;  2L05 A;  3NY5 A;  4GMV A;  4WWO A;  5KHO A;  2O2V A;  3DBL I;  3JYU A;  1F9J A;  4EZL A;  3M3J A;  3NHE B;  4BKT A;  1J8C A;  4IWP A;  4GOC A;  3KUC B;  2LRW A;  2KVR A;  2HTH A;  3AXC A;  4GIV A;  4LJO B;  3L16 A;  4XC2 A;  2DYO A;  3WA0 A;  3ZTC A;  4URK A;  2LD9 A;  4MSQ B;  1OQY A;  2OOB B;  4EZJ A;  5E6N A;  2RR9 A;  1KLV A;  4NAW B;  3ZNG C;  3APF A;  1WM2 A;  2WX0 A;  4N9F 4;  1E90 A;  1XD3 B;  1UBQ A;  2BWE S;  2G45 B;  2LZ6 A;  3R3M A;  4NY0 A;  3Q3J A;  2XK5 B;  2DX5 B;  2ZNV B;  2DYB A;  4DHZ E;  4ANU A;  2KMC A;  1LM8 B;  4GDL A;  1WH3 A;  4KZC A;  3ZO5 B;  4HCN B;  4PS8 A;  5D2M B;  5J17 A;  1V6E A;  3MHS D;  2WX1 A;  2AWT A;  2D10 A;  3IFW B;  4FHJ A;  4WQO B;  2RPQ A;  1HE8 A;  4IWO A;  2ZPY A;  5CHW A;  5G55 A;  1WGG A;  2IO0 B;  4GB9 A;  2MBH A;  1YQB A;  2L0T A;  2D2Q A;  2BGF A;  2YLM A;  3IHP C;  2N4F A;  2JF5 A;  4NPN A;  3LDZ E;  3RZF A;  2UYZ B;  4EZK A;  3ML9 A;  2NBW B;  4TUU A;  4W9H A;  2KTR A;  1Q5W B;  1V80 A;  1SE9 A;  3UF8 A;  4WWP A;  4AUQ C;  3BY4 B;  4ICV A;  5AZG A;  3UIP B;  3ALB A;  4NAW A;  2LJ5 A;  2NBV B;  3OJ3 A;  1V9J A;  2DAJ A;  2YVC A;  4K7U A;  4ANV A;  2FID A;  3DCG A;  2JT4 B;  1L2N A;  2XK5 A;  1V2Y A;  4W9E A;  2KWU B;  3O65 B;  2GBK A;  4ZRK A;  3ZLZ A;  3V6C B;  1I35 A;  1UEL A;  2EMS A;  4K7W A;  1WX8 A;  2KDI A;  1R4M I;  2KQ7 A;  4HJK A;  4MGK E;  2O6V D;  2IBI B;  2MP2 B;  2KFJ A;  4FA6 A;  1C3T A;  3AU4 A;  2JVC A;  2KJH B;  1H4R A;  4IM0 A;  3PLU A;  1YJ1 A;  2LI5 A;  4HPL B;  2OJR A;  4HLE A;  1LXD A;  3BIN A;  2KWV B;  3DVG Y;  5DPR A;  2CS4 A;  2MWS B;  5LLI A;  3ZKJ C;  2CHX A;  1V49 A;  2AL6 A;  3JW0 X;  4HVB A;  1UGM A;  1KOT A;  3PRM B;  5DPT A;  4MSM B;  5BO4 B;  4KVG B;  2JXX A;  4PS7 A;  3UQB A;  2K25 A;  4HDO A;  3OLM D;  5CX3 A;  2FUH B;  4M8N A;  1XQQ A;  2O6V B;  4W9C A;  2FCM A;  2Z0D B;  5AZH A;  1EUV B;  2AEH A;  2MBE A;  2N1W A;  4YL8 A;  3X23 A;  4BBN C;  3HM6 X;  3SHQ A;  3U7D A;  2RSU A;  4DDI D;  4MJS A;  2KJ6 A;  3W1S A;  2KAN A;  2M8S A;  1P1A A;  4BKS A;  3HHM A;  4LCD E;  1EO6 A;  4FHK A;  4ZRI A;  3NZU A;  4MGZ E;  1WZ0 A;  4A3P A;  3D32 A;  4DHZ B;  3A1Q B;  3H6N A;  1MG8 A;  2N9X A;  3WAP A;  4IG7 B;  3DVN V;  3VTU A;  4HDQ A;  1IPG A;  2KOX A;  1WM3 A;  2JY6 A;  4DXA B;  2XEW A;  4HCP B;  4HPM B;  4A20 A;  1UZX B;  2ZEQ A;  4OVV A;  1WGY A;  3QHT A;  4I6P A;  3CF6 E;  2O6V A;  3OAW A;  1V5O A;  2G4D B;  5D94 A;  4BOZ B;  4OVU A;  4EEW A;  2B3A A;  5DCN A;  3DBR I;  4EKU A;  2KK8 A;  3MJW A;  2CR5 A;  4ZDV A;  2MQJ A;  4FJY A;  2KLC A;  5E6P A;  3VUY A;  3GOE A;  3QJZ A;  2BKR B;  1UH6 A;  2JUO A;  3DVG X;  3B0A A;  2FIF A;  1ZW7 A;  2L76 A;  1BT0 A;  1R4N I;  4MEL A;  5TR5 A;  1WGH A;  1QZE A;  4JGH B;  3PGE A;  3R7Q A;  2I1K A;  3TIX A;  1RFA A;  3ZUN A;  2LGX A;  4WAA A;  2NCN A;  4MGY E;  1GC6 A;  4E74 A;  4XZ4 A;  5EDS A;  2JRI B;  4EUT A;  4G3X B;  3UIO B;  3ZDM C;  1NDD A;  4IM2 A;  5C1Z A;  2MBB B;  2PE9 A;  3L08 A;  4HXD A;  3I3T B;  3KH0 A;  1WXS A;  2GMI C;  2A5U A;  4II3 B;  1G6J A;  2FCS A;  3VQI A;  2C9W B;  1UD7 A;  3DPD A;  4DWF A;  2EMT A;  3PRP B;  3PSE B;  4W9K A;  3RUL A;  4ANX A;  2PJH A;  3VFK A;  2LXC A;  3VTW A;  4MGI E;  4K7S A;  2C60 A;  2WYQ A;  2KTF A;  1RLF A;  3PPA A;  3WIM A;  1K8R B;  3HK0 A;  2CHW A;  4MDK E;  5JH5 C;  1Q1O A;  3PT2 B;  3ZNI D;  2AL3 A;  1Y8R C;  2LGD A;  2UWQ A;  1TBE A;  2L7R A;  1JRU A;  2JWZ A;  3RUI B;  1V81 A;  3DBH I;  2N7E A;  1WX9 A;  3W1S C;  2GOW A;  3C0R B;  3H1U A;  3HIZ A;  1YIW A;  3SU8 X;  5JHA A;  2JPH A;  4W9L A;  2ASQ A;  3A4R A;  1WI0 A;  3ENE A;  3VXW A;  2QHO A;  2DYM A;  1V86 A;  3OJ4 B;  4WWN A;  3ECI A;  3VVW B;  3X0W A;  2KLG A;  4W9J A;  4ASW C;  2IO3 B;  2R2O A;  2M0X A;  1Q0W B;  2KX3 A;  3VH4 B;  2CHZ A;  2LGY A;  1FXT B;  2ZPN A;  4IUM B;  2Y5B B;  4W9D A;  3VUW A;  3K9P B;  3QWZ B;  5KHQ A;  2DZI A;  2MBQ A;  2PEA A;  2RGF A;  3UIN B;  3MTN B;  2KDB A;  3EC8 A;  4FJV B;  2IO1 B;  2N7D A;  3QK0 A;  1WY8 A;  4KDI C;  1UBI A;  3VAW A;  5IA7 A;  2M1M A;  2N9E B;  4WJQ A;  2V3S A;  2KNB A;  3IVF A;  2KDF B;  1A5R A;  2ZZP B;  4AP4 C;  4AJW A;  2Z0E B;  3DQV A;  1RRB A;  1WJU A;  1U4A A;  3H9D A;  1AAR A;  2V1Y A;  3ZVV A;  1WIA A;  3WAO A;  3WAN A;  5D6J B;  4ICU A;  1P98 A;  1KM7 A;  4GDK B;  1IYF A;  2KFK B;  4CO7 A;  2L8J A;  4RMA A;  3TMP B;  2NPT B;  4JLC A;  3M63 B;  3ML8 A;  1PQS A;  3Q3F A;  2MBO A;  3ZRC A;  3APD A;  4AOF A;  4FAD A;  4DBG A;  5CHF A;  1WJN A;  3V6E B;  2K8C A;  1C1Y B;  4DK5 A;  4KZ0 A;  2N1V A;  3PTF C;  3T9L A;  2KN5 A;  3IG3 A;  5HKH A;  3L13 A;  4ZRJ A;  1WRD B;  1E8W A;  3A9K B;  3L10 B;  3RCZ A;  3QIJ A;  3V61 A;  3ZTD A;  1XT9 B;  1EF5 A;  2MP2 A;  3P2B A;  2J0K A;  1P0R A;  2J7Q B;  3TJP A;  2IYD B;  4KSK C;  3AI5 A;  5FR6 A;  3V60 A;  3PHW B;  1T0Y A;  4F8C B;  1IP9 A;  2IO2 B;  4M8M A;  2JZ3 B;  3QX1 A;  4B6W A;  3B08 A;  5E6O A;  3PLV A;  1E7V A;  1WR1 A;  4HK2 A;  4F1S A;  2HD5 B;  4ANW A;  4WJP A;  4JIO U;  2IZV B;  4GDK A;  4A3O A;  1E8Y A;  1WF9 A;  2KFK A;  2KXJ A;  2Z59 B;  3TCA A;  1LFD A;  3SDL C;  1NI2 A;  1WE7 A;  1WFY A;  4II2 B;  2NPT A;  4GN1 A;  3U30 A;  4CHK A;  3T8M A;  1VD2 A;  2K6D B;  4NJ6 A;  2DEN B;  3DDC B;  2BKF A;  4BBN F;  2KKC A;  2LVP A;  2LVO A;  2DZM A;  2PE6 B;  4TKN A;  5L95 C;  1WXA A;  1CMX B;  2KC2 A;  3B1L X;  3N3K B;  2NR2 A;  3R7R A;  2BYF A;  1LQB A;  1P3Q U;  2KHW B;  2ZNV C;  2D3G A;  1E8Z A;  1ZKH A;  4W9F A;  2LAS A;  2WWZ A;  2L3Z A;  3PRZ A;  3W1Y A;  4G50 A;  2CKH B;  4KSL C;  4G0N B;  2G4S A;  3APC A;  5D7G A;  3WAL A;  5LXH A;  3RYT A;  3A1Q A;  2D11 A;  4FJZ A;  3SD5 A;  4FN2 A;  2GBR A;  4F7Z A;  2REX A;  1WXM A;  4XX5 A;  3ZNZ B;  4W9G A;  2LXA A;  4G11 A;  3NOB A;  3PRE A;  4K81 A;  2KDE B;  2XBB C;  1E7U A;  3VHT C;  5J18 A;  1NBF C;  3JSV B;  2GBJ A;  4TQ1 A;  3N32 A;  5G2N A;  3ZDT A;  1I42 A;  4GDL B;  1GUA B;  5CTR C;  1E8X A;  3ZRF A;  2JRH A;  1P9D U;  5C23 A;  4E3C A;  3NZS A;  3EFU A;  3EEC A;  3RT3 B;  1RAX A;  2LVQ A;  4HWI B;  3QQ8 B;  1S1Q B;  3DBS A;  1SGH A;  3ZNH B;  1WX7 A;  4LDT D;  3U8Z A;  2LRU A;  2L00 B;  1M94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...