5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
1SJED 1BCPD 3BZDB 4NZLB 1SE2A 5I4DA 1LT5D 1RD9D 1EEFD 2AQ3B 4DXGA 1L0YB 3GP7A 1HQRD 1JQYD 2Z8LA 1UUPA 4L63B 1BCPF 1STEA 1S5FD 1M4VA 2XN9C 1DYQA 3EFXD 4DXFA 1KLGD 1SE4A 1TY2A 1CHPD 1DJRD 2RDGA 1YN5A 1S5CD 1V1PB 4Z9CB 5ELEA 4RGMA 1V1PA 2IJ0A 3BYTB 2RDHA 3OWEB 1CHQD 1AW7A 1EU4A 1PYWD 1PZKD 3KLSX 2XNAC 3BVZA 3MFGA 5ELBA 1HXYD 1SBBB 1F77A 3BVMA 3R2TA 1D5XC 1JWUD 1RF2D 1TS5A 3BYYB 2AQ1B 3O13A 1BCPC 5ELDA 2WV6D 1LT4D 4BWGB 1D5ZC 1LTSD 1EEID 2J4XA 1S5ED 1KTKA 1YN3A 3DWPA 1EFID 4RGTA 1V1OA 1HTLD 1RDPD 5FK9C 4TSSA 1S5BD 2R61A 4UDUC 1RCVD 1JWSD 1I4PA 1D6EC 2XRQD 1PRTB 3EA6A 1GOZA 1LO5D 1XTCD 4RFBA 3URYA 1AN8A 1G8ZD 2NTSA 5D3DA 2XRSD 4ZYSA 4K6LA 1TS3A 1FNWA 1LLRD 1EWCA 1LTAD 3V05A 3DWAA 2AQ2B 1LT3D 5ELCA 1FD7D 1LTRD 1TS4A 1LTGD 3MC0B 1LTBD 1I4XA 1SJHD 1I4RA 1I4HA 1PRTD 4RH6A 3R8BA 2ICIA 1PTOD 1PRTC 1MD2D 2QILA 4RHSA 3W2DA 2G9HD 4RGNA 1CQVA 1ESFA 2SEBD 1D5MC 1PRTF 1LT6D 1JCKB 5ELFA 1SEBD 1XXGA 1QILA 1PTOB 1T5XD 4OHJA 1HA5A 1I4GA 1TY0A 2O2LD 1LTTD 1YN4A 3SEBA 3BVGA 1PTOH 1B44D 2NTTA 4L6TB 1TS2A 3R2IA 3DWQA 1L0XB 1LTID 3TSSA 1JWMD 1BXTA 4RHRA 1KLUD 1PZJD 5D3IB 1BCPB 1ET9A 2TSSA 4RGOS 1FNUA 2IPKD 1CT1D 1SE3A 1EU3A 1PZID 1FNVA 1FGBD 1UNSA 2CHBD 4RCOA 1PTOC 5TSSA 1S5DD 1B1ZA 1ET6A 4C56C 5FKAC 1JR0D 1CK1A 1ENFA 1PTOF 2QEJC 3CHBD 4O1NA 1SXTA 1I4QA
chains in the Genus database with same CATH superfamily
5C4XH 5DPRA 5GADC 4QGUA 3L4PA 1LT5D 3NENA 1YHAA 1PA6A 4RA8A 3VQIA 3CC4A 1PH7A 3EFUA 4EQ5A 4HMIA 1F9RA 3PUWA 4YTNB 2KT7A 3E3XA 1IP9A 4AJYB 4LFAQ 2Z6KA 3A8JE 1DXMA 2LS01 4JI8Q 4LFAL 3AB5A 1IHZA 3ONAB 4JI8L 1MJCA 3KDFB 1QOFA 5DPSA 2ZJRA 1MJEA 2E2HH 4KI0A 3ONSA 1BOSA 1E22A 4W9FA 4DXAB 1KDAA 3PUXA 1G2SA 3ZDTA 3RNFC 3I55A 4IOAA 2G1EA 1EU4A 4DK3C 4HJ7A 3GTMH 5FLXE 3QHTA 4G3XB 4B9KA 1STGA 4IPCA 3A74A 4KK7A 5IYBH 1NEKB 4WJQA 2BS2B 1X56A 2D0PA 1HTQA 4BXXH 4W9LA 2K3UA 2JA8H 2K22A 2L1BA 1I50H 3MEFA 3PUVA 4PZ6A 2WB1B 4AOFA 4B08A 3RD4A 3TS2A 3DPDA 2G9DA 4DKAC 1Y1WH 2R7ZB 5IP9G 2PYKA 1J19A 1Q5WB 1C79A 1YEZA 2IX1A 2K01A 1GM5A 1NJIC 4U68A 1JRPA 3D32A 4YSYB 3BZKA 1Y8PB 1WXSA 3CRKC 4TKNA 4IUTA 3L3OC 4CDDC 1GOZA 4JG2A 2DYMA 3URYA 1N33Q 4DF7A 2EELA 1AN8A 4JI6L 3PREA 4G50A 2NTSA 4GN5A 5DPTA 3RD2A 4AUQC 1TKEA 3ZTDA 4PZ8A 1U4MA 2AEHA 4JGHB 2N1VA 1DM0B 3EFCA 3EJIA 3FHWA 2EKEC 3JYUA 4YSZB 2AQ2B 4DA2A 1IKLA 2UXCL 1UEAB 2W3RA 1IUEA 3WCQA 4KY5A 3K6OA 1QKZA 4C2MH 4G57A 3U50C 3U4EG 1SJHD 4A3DB 2KFJA 2H89B 5E7NA 1SRUA 3I57A 2CQOA 5DPWA 4J8QA 3PO2G 4IM3A 3HOUH 2RSNA 2LXAA 5C44B 3AFPA 3RYTA 3TEYA 2K05A 3APFA 2LVOA 1GUNA 4GDLA 1XPRA 3HOYH 3GB1A 1J8IA 5AJ3Q 4MDKE 1N5WA 3DVNU 3ZGZA 1XLQA 3EC8A 1STNA 3PGEA 1RM6C 3AE2B 1WGDA 2W9NA 1XCQL 2N7EA 4ANUA 3S1NB 1KL9A 4NJCA 5JOBA 4J1MA 2R7DA 1QUQB 1WJ4A 1F0ZA 3E5SA 3KVFB 3P42A 3DXJC 1ZDXA 1JB7A 2GBMA 3VHTC 3VR3A 2G4SA 1TR5A 1NTGA 3A5ZB 4KN7C 4TQUS 4DNIA 4X3TA 1RYJA 1I6VC 2RSOA 2GLSA 1UNSA 1VCIA 2R6GA 3S1RB 1SB3C 4EZLA 1PH1A 3VUYA 2K6QA 2Y0SG 3NVZA 2LKVA 4KDIC 4A20A 5I6WA 5GAEC 3ML9A 2BH8A 2MO0A 3OYYA 2XK5A 4FULA 1K83H 1NYQA 1BMLC 2WAQG 1SJED 1LUZA 3Q3FA 3RPFC 5BMGA 1TGZB 2L0FA 1WYDA 4ZRPA 3W3AA 3UQAA 2JRIB 2B2UA 2L0CA 1NNXA 3AMUA 1WY8A 1FCCC 3J7ZC 3IFDA 1VZ7A 5E4WC 4YT0B 2KAJA 4FBJB 3LB8C 1A2TA 4OZBA 5C4HA 4P74A 1KHIA 3PV1A 3UDFA 5FLXL 4Z9CB 5ELEA 1V8QA 3MXUA 4RGMA 1A15A 2V9HA 3ZXRA 3OWEB 1P0RA 3ENEA 3WAPA 4DAMA 3ZO5B 3BVZA 1SR3A 3W5VB 4FYDA 1QF6A 4CDCC 1WTQA 3GE8C 4B9XA 4MH0E 1D5XC 4HCNB 1ILPA 4BOSC 2AQ1B 3W1GA 1HZCA 5I6YA 1EEID 2DHZA 1NDDA 1UF0A 4RNAA 3LYYA 3TQYA 1BUIC 5KGUA 2R7ZH 2PE6B 4TSSA 4AQ7A 1B9MA 2EYPA 1JWSD 2J53A 3N32A 3WAOA 3NRZA 2V1YA 3AU7A 2PW9A 4LF9Q 4C1NK 1U9RA 4LF9L 1I6HB 2FBWB 2B2WA 2BA0A 3K5MA 3CPFA 4I7AA 3BY4B 3W1BA 2KKCA 3M63B 2GBJA 4DR4L 4ZRIA 1Y14B 1BVSA 4JW0A 2MRPA 1A62A 3HKSA 4IZ8A 2N55A 2OTJA 1MI0A 2L7RA 3AE5B 1KC8C 3D4WA 4OGQC 1QJOA 2KJXA 2J0JA 2Z4IA 1C4QA 2F0SA 2PLPA 4N6EB 2LGIA 1NVID 1FO4A 1U4PA 1NYRA 4A3EG 4A3DH 1MSHA 1U5KA 4P75A 4TUUA 1SNMA 1WXVA 5C3XA 4AH6A 2KDEB 2VQEQ 2KCTA 5KNBA 1HNXQ 5C44H 1HNXL 2I5MX 5J3BA 2CR5A 2UU7A 1I4GA 4A3BB 2BOSA 2IHFA 4IUUA 5H1SE 3CSTA 5GMVA 3MVVA 4L6TB 2KK8A 5C0XG 5KNDA 1O7LA 1LTID 2JA7B 4B3MQ 4E6IA 1FXAA 1PZJD 2KX3A 4GN4B 4C3HB 3S1NH 3ECIA 4JOIC 3A33B 3M95A 5KYLA 5L83A 2MBHA 1KQSA 3EGRA 1VS0A 2PTLA 4A3GG 1LM8B 2A4ZA 3PRMB 1ZP0B 2UXBQ 3MHBA 2G4DB 2UXBL 5J17A 1ONLA 1PGXA 2WHIA 2BBCA 5JJKA 2M19A 4L2YA 2DENB 3S1RH 2LVPA 2IW3A 3GD7A 2HIVA 3KUPA 4KY7A 1B7YB 4BY1B 2BYFA 2QEXA 2M9VA 3GV6A 4KHVA 3PSIA 4CJ1B 2HJ1A 1DOXA 1KIXA 1QVGA 2JXTA 4HIKA 3ZYYX 3GP7A 3MTSA 4KD3A 4PMWA 4JBMA 4XIGS 2BYEA 2V3SA 1VQLA 5AUIA 2BA1A 3T1HQ 1KRHA 1XNQQ 3T1HL 3V6CB 2KOLA 1DYQA 3GDEA 3SGIA 2LGYA 4DUYQ 2O6VB 3ETRA 4NKLA 1CZGA 3ZLZA 3MXPA 5EGTA 5DEHA 5JHAA 2VB3X 2AL3A 4TV3A 1RKNA 5F2DA 2RDHA 1Z47A 3QB3A 5C4XG 1AFPA 1C0AA 1AW7A 2KMAA 1PYWD 1XLPA 3ABVB 4JV5Q 4LK0M 5HHDG 1YZ6A 5L95C 2PZWA 1EYGA 4NP5A 2JA6G 2N88A 1JWUD 1VQJA 1CJEA 1TS5A 4B3RQ 5ELDA 2OXPA 1ZDVA 1J5EL 1EUVB 5IY0A 2JJQA 2ZNVB 2KECA 2GRIA 2DN8A 2VL6A 2KQ4X 2C5LC 3C19A 3MJWA 4HJGE 4CQNA 2KA7A 1SE8A 1RHPA 4B95A 3L2PA 3I4OA 5FK9C 1S5BD 1EQVA 1YX5B 1QZEA 1TWFB 1TYGB 5IGCA 1I35A 2WDVB 3EA6A 1ZXIA 1YHBA 1JROA 1G8ZD 2WDRB 3VA5A 4M1UB 3JVZX 4KD4A 3QOJA 1DONA 1O78A 4OZCA 5GROA 3RZOB 5CHWA 5HY6A 5EJWA 2KHIA 3RNGC 1BO0A 4JCVE 3ND9A 1I6HH 1E5WA 3NPPA 4EOYA 2R2QA 2NN6H 1WH3A 5LMUQ 5BO4B 5CV9A 3HVDA 5LMUL 3HKZE 1WXMA 3M85A 5HG2A 1KD1C 1HR0W 4BKTA 3DBHI 4FO2A 1JOQA 1LTGD 1PMRA 4WORA 4DR5Q 1SIJA 4DR5L 2OCEA 2K33A 3MHSD 5IYCG 1IGCA 3FVQA 4KKTA 3SHQA 4RCNA 4LFCL 4ZHPA 1WGYA 5EBCA 4MGZE 5BYRA 3IT4B 2F0VA 2DGYA 2EKIA 3A9JB 3Q3MC 2IX3A 3CWIA 4POFA 3K58A 2KNBA 4A75A 2L52A 1YN4A 3M9BA 3SK6A 2LXCA 1M90C 1Z9FA 2F1MA 4DUZQ 3NVVA 2O4XA 5T1GA 4A3BH 4FF3A 4DUZL 5KHQA 1L0XB 3FKYA 4X65L 5E1FA 1B8AA 4OO1H 2VB2X 4DV3Q 5FR3A 2ZTDA 1PH5A 1OTRB 1IL2A 4DV3L 1SYBA 5IYDG 4DR1Q 2JA7H 2MW5A 2P5ZX 4DR1L 3KFUA 1D7QA 4C3HH 3HOUG 4F7ZA 2KVMA 1K8GA 1EIHA 3CCVA 1FM0D 1L6VA 3JAME 3Q8BA 2R7FA 1QQRA 1Q1EA 4HN7A 3L16A 4C80A 4DGZA 2UUBL 3RUIB 1H9SB 3H9DA 5IOCA 2A5UA 4YWLA 1JJ2A 3T8MA 2WX1A 2PMZB 5I2YA 4HIMA 3U30A 4CKEA 3G48A 5CGKA 2ALYB 4IFDH 3IVFA 4B0EA 1X32A 3AH7A 4ID6A 2NR2A 4DR2Q 4KKUA 3KF6B 2QGQA 1W2BA 1EOVA 4DR2L 1WD0A 2LJIA 4BY1H 4IJHA 2DY7A 2KEDA 1E1OA 1Q46A 2VXWA 1YJ9A 4JPSA 4R4CA 3VVWB 4LUOA 4LF5Q 1WYWB 2Z8LA 3RZFA 1HEZE 2L55A 1AARA 3K7AB 2J0MA 1MHHE 1XMQQ 1CKNB 4A3FB 1XMQL 3ZRCA 3TMPB 2ENBA 4AYBB 2JA5B 1CHPD 2Q5WD 4DAVA 2Z59B 3GZNI 4L23A 3TZUA 4FDBA 2LMCB 3S1QH 2KDMA 4P1BC 4CDFC 2DWQA 5H8YE 4YXDB 2KQSA 2KCNA 3W1YA 5LL6S 1P1AA 2K25A 1S3OA 1XQQA 2Q8IB 1R4MI 3P7JA 3ULLA 4KKIA 4IM0A 4L5RC 1J8CA 4DPGA 3RMKC 1XYIA 2DJFC 4YWMA 1GG3A 1PYBA 4DFAA 1VLBA 2MH7A 2WX0A 3PT2B 1LT4D 3QIJA 2SAKA 2Q2IA 4WJ4A 2Y5CA 2J4XA 4WJPA 1E7VA 2NWGA 5NUCA 1FXTB 1E2VA 3T4AC 1QLBB 2OTLA 4WWNA 4NAMA 4GDKA 4HR7B 3DWPA 1VQPA 2PPHA 1V8CA 2LGSA 4Q0FA 1L4ZB 1WRIA 1CKMA 2F0TA 2KHSA 4JOIA 1M94A 2K8CA 2PE9A 5GXGB 1QB5D 3TP8A 3NUCA 2K9XA 2MJDA 2LXJA 5C3EB 3N52A 2VUMB 5CR3A 2Z0DB 3U52E 4ZOHC 1TWFH 1E8ZA 1WZ3A 3FMCA 3H1UA 4JWUC 4BY7B 1WVLA 5AUKA 2IY5B 2DNFA 3UDXA 4PZ7A 2Y0SE 1HE8A 3RZOH 2FIDA 3W9CB 2RVLA 1PUTA 3K5NA 1S1QB 1UWXA 3SR6A 1BBXC 4DV0Q 2OF1A 3PMFA 1STYA 4DV0L 2WAQE 2R7ZG 1SNDA 4K8IA 5J18A 1J6QA 1Q81C 2F0WA 2Y5PA 2MX2A 3E56A 1GO3E 4HWIB 1RWSA 3MTNB 1OQYA 2MJ3A 3A1QB 4HDQA 3BDCA 1EY6A 3EN2A 1GD7A 1UAPA 4UP9A 3TUOA 4LMQD 5AZFA 5I9PA 3S14B 1MVKA 3KH0A 1PTOB 3NBHA 5C2TB 1XTDA 2RBMA 4WIPA 4PG3A 3RR5A 2B39A 4GKJQ 4HJKA 4XYCA 1TQOA 1WI5A 4PMCA 4DV2Q 3I4MB 1TS2A 2IGGA 4DV4Q 4DV2L 4I7ZC 2A8VA 4AS1A 2K8BA 3TP5A 2EIFA 1K8AC 3H0GB 2LRWA 2HCIA 1TT5B 4JI1Q 2I46A 3JAML 3AE4B 1J0GA 2KFKB 2AHOB 2B2TC 1R7SA 5ELNA 1C1YB 2Q2TA 2KO3A 2ZJDA 1DD2A 4A55A 2HDMA 4MEMA 5JEAG 3K81C 1FGBD 1YD8U 3KBGA 5TSSA 1GUOA 3H7PB 2FUHB 3IT6B 4HSVA 1K3BC 3PZ7A 2R93B 2WS3B 4KSLC 2A73B 4BA1I 4OZAA 5TR5A 3D4DA 3QA8A 2RR9A 4REZA 4NJ6A 1WJUA 5CX3A 2Z1CA 1VQMA 3FRPB 4WWMA 2QDLA 3D6CA 4J6HA 2MBQA 3GOEA 3HOWB 2C7NB 2FAZA 4MGKE 4HCPB 1RRBA 1T3QA 3CCSA 3L54A 3K7AH 4G7ZC 2LWPA 3OAWA 1VQBA 5D6JB 3VR9B 4OWTB 5EKIA 4A3FH 4CHTB 5BR8Q 3EUB2 2JA5H 4IALA 5BR8L 2CHXA 4UP8A 1BBUA 2QCPX 1TIID 1A0IA 4GKKQ 2K32A 4ILWA 4GKKL 4ANWA 4LF6L 4RM9A 1ML0D 1N6ZA 3KYDD 1F2RC 3NE5B 2KHJA 1N32Q 2KMCA 1SBBB 3CXCA 1CZWA 1RF2D 2JYOA 1AE3A 3MXNA 1SGHA 2E5LL 3TEWA 2EY6A 5CHFA 3VRAB 2KWDA 3JC66 4IO9A 5IA7A 3OPOA 1UGJA 2RF4A 4A3IB 2I1KA 4ULLA 4DV1Q 5G5HA 4ARIA 4JYAQ 2CHZA 4FXKC 3D4RA 2KWVB 1V43A 4B9WA 1PRTB 2YTXA 4QIWE 2ZVOA 2J0KA 1FMAD 3V2TA 1Q1BA 3J80i 5JH5C 4PQXA 4KDLB 2M4NA 5C3EH 2RMMA 3NHEB 1KM7A 1B4OA 3BU2A 2VUMH 4II3B 2PI2A 1VF7A 3EBEA 3ULJA 1YJWA 1I50B 1NBFC 3FILB 1XLOA 3VR4A 3NP8A 4BY7H 1JOKA 2NBWB 5D7GA 1WTHA 3V96A 1SYCA 2V1CC 2BDNA 4MTKA 4AIMA 2A68C 2BVCA 4DHZB 1SFOB 4R4OA 1B70B 1EQTA 2WKCA 1IBLQ 1ROEA 2JX5A 3VYUA 1IBXA 1IBLL 3SDLC 4G7OC 2M8SA 4H2AA 1CQVA 2C9OA 5JVG3 1S72A 4W9GA 1QG7A 3T1YQ 3N1ZC 4KN4C 4WJWA 4JI3Q 2IY1B 3T1YL 5C4JB 4HEDA 1WTXA 3S15B 4JI3L 3GTLB 1IBML 1EM7A 3DBRI 2N49A 2WXQA 1U4LA 3S14H 3MHZA 3O65B 2BTEA 2A5HA 1MSGA 1PTOH 1EY9A 3DBLB 1O7IA 3IFTA 1PDXA 1SSNA 2VZKB 4M0WA 1IL8A 4GLVB 1BXTA 4ZRKA 3I4MH 1PFBA 5EKKA 1FRDA 5DM63 2IYDB 2EMTA 4W9HA 2X8XX 2DUDA 4JI7Q 1BCPB 3ER0A 1ZW7A 1QZHA 4RGOS 4JI7L 4N9TA 1VDZA 3H0GH 5ELOA 3QWZB 4GIVA 1KFYB 2RCNA 3J7AV 4R3DA 1PZID 2K50A 3HG9A 2FCMA 1PTOC 3I73A 2KVZA 4OVVA 2WNMA 4X3SA 4C56C 3NY5A 2CWPA 1EIYB 1BDOA 2WXHA 2WXPA 5EE9A 4YTPB 4JI0L 5K36H 5ISRA 2INDC 3FC4A 3HZXA 2YU9B 5EBDA 4FXDA 3T3OA 1SE2A 2V3PA 1TWGB 2R93H 3NZ3A 1X55A 3ZJUA 1YMHE 5EPJA 3AE3B 2EY5A 4IPDA 3Q22A 1G91A 3RN9C 4C3HG 4RMAA 2MUYA 1UBIA 3VR2A 4NAWA 3STBC 4PT5A 1OFFA 1ICFB 2LXKA 4KZCA 1TY2A 2FMCA 2A69C 1LGRA 5C3JB 1YVCA 1V1PB 1KH0A 1LABA 1STBA 4A90A 3U4VA 1M8AA 2Z6BA 1M1KC 1FCLA 4IFDG 4LF4Q 1WM3A 1CHQD 2CH4W 4LF4L 4QUCA 3A0JA 2MEKA 2MP2B 4JIOU 2KWCA 4XQJA 4NY0A 3C2PA 1FXIA 2YVCA 4BY1G 4HRSA 4NQLB 3HOZB 4C7YA 3BVMA 3ITPA 4LNIA 5IAAC 1J9OA 3BYYB 1EF1A 3NELA 3R3OA 3MJ5A 3Q3NC 1A3UA 1D5ZC 2JYTA 4WQMA 2JVCA 1HCZA 1K8OA 3I9V1 3L0WB 4QJFA 1YITA 4A6QA 4EQPA 3H3VH 4DNTB 4PMBA 3KLWA 1VQ5A 1QOAA 4KV2A 2WQYB 4A3IH 2LHEA 3DWMA 1HUMA 2R61A 3UDIA 1T0SC 3X0WA 2B2TA 3UDGA 1DOIA 3V61A 1D6EC 5IO9A 1EL0A 1KDCA 1IZ6A 3R93A 1E6EB 3G4SA 1LO5D 1CZPA 1KRTA 1O80A 4F88A 3PRPB 1QVCA 2REXA 3M4OB 2E6XA 2L0TA 1YI2A 5JPMC 1WCMB 1A8VA 5M3MG 1VF5C 4KGRA 3U7ZA 5JXVA 4K1RB 5JEAJ 4DHJB 1OXSC 2BS3B 3MZ5A 2LRUA 5IT9E 4V190 1OO9B 1A63A 1TS4A 4QQBX 1H9JA 3AEDB 1KAAA 3DUZA 2K6AA 2A6EC 5G5GA 1PRTC 1E7UA 4MHEA 4OXPA 3DVGX 1V6EA 1KOTA 1Y1VB 3CMAA 4NXMQ 1SFOH 2KUMA 3KBXA 1ESFA 2X69A 3CCJA 4NXML 5IGDA 2JU6X 1H9SA 3IBEA 4K7UA 5ELFA 2D3BA 1R4NB 4NXNQ 3K80C 1XXGA 1QILA 3KF8B 2CH4A 5IP7G 1CFMA 1B53A 3Q2AC 1N33L 1SNQA 3SFDB 3VYSA 5C4JH 3J80L 3S15H 1B44D 3GTLH 4MZ9A 2HD3A 4A4IA 3KF6A 4M02A 4NQKE 2N7DA 4RAUC 1L2NA 5CC4A 1L0WA 4BA2I 3X3MA 4IC7B 5LNK1 4A93G 3RNBC 4DDGD 2BH2A 4C3JB 4JI2Q 3QWNA 5J39A 2JZZA 1DOKA 3L7ZC 4F8MA 3T13A 4C3IG 2D2QA 1CKNA 3RUZA 1ISNA 3KWVA 4BBRG 1ZOYB 3CCUA 4A3KG 3QC8B 3VFKA 1A5RA 3RI7C 2LMCA 5EKLA 1FPYA 3AFQA 2QIEB 1X54A 1GKHA 1PTOF 1VQEA 2JUOA 4ZRJA 4WWPA 2EMSA 4MTNA 5T8IA 4US8A 5AJ3L 2N9LA 3SK8A 2LJ5A 2Q8TA 1F9SA 4DV5Q 5LL6X 3GE3C 2YU9H 4KVGB 4DV5L 1E3PA 2K5WA 1HQRD 1YJ1A 1TWGH 3GTGB 3WOFA 2CJOA 1UUPA 2K28A 2L32A 4E74A 3IAM1 2FIFA 1M4VA 1IKMA 2K6DB 2Z0EB 3NZSA 2RGFA 3EFXD 1ZGUB 3CKIB 4DU9A 1HTPA 1WGHA 3AECB 5BMHA 2O2VB 3NWTA 1HNWQ 4YY3Q 2AL6A 1WM2A 2IO0B 2W54A 1HNWL 1UE1A 4YY3L 4ANXA 4NPNA 1YIWA 2LGXA 2NBVB 3VTUA 1K8RB 2EPBA 2R92B 2B8FA 2RHQB 3IG3A 1AH9A 3ERQA 1ICWA 2XNAC 1HHVA 1WTVA 1QVFA 2LI5A 5KEEA 5M3FG 1JWBD 4BFRA 3FKIG 2BDOA 2PQAB 4K14A 3HOZH 3Q3OC 1PH9A 4DR6Q 3JSVA 2A68D 3N3KB 4DR6L 4K5XA 4BBSG 2FFKB 3NOBA 2JEBI 1VMPA 5CV5A 1L5PA 4LDTD 4E3CA 3IAS1 4IM2A 3HVZA 1KTKA 4DBGA 3ZTCA 2A74C 4AYBG 4RGTA 2RKSA 1V1OA 2K75A 4H13C 4F8CB 2RHSB 4KGSA 1IBKQ 2MPMA 4GMVA 3J81E 3ZKJC 3R3MA 1IBKL 4MSQB 4W9JA 2I5LX 1I4PA 5JVH3 3CIRB 3APCA 3HM3A 1MGSA 3CRLC 4RFBA 2KJHB 3HOXB 1YQ4B 2M1MA 4F87A 2OHFA 2DX5B 1WJ6A 4QCLA 4X64Q 3OOCA 1TT2A 4K5VA 5BN3A 4X64L 3PO3H 2IO1B 1NMFA 3B2FA 2E3TA 3M4OH 2QW7A 2E2JB 1P16A 2EVBA 1WCMH 2DZKA 2AX5A 5JJLA 1LT3D 1I3QB 2XTIA 3SK4A 3OTOQ 3D6WA 4Y7NB 2ICEC 3NQIA 4LLGM 3OTOL 1LV9A 4XE0A 1W3SA 1WTOA 3HRZC 2KFKA 2L05A 2NN6I 1PTOD 3DLLA 1TVXA 1FYCA 2WXLA 1H8CA 3E6ZX 2L1AA 3T53B 4K7SA 4R4IA 1PRTF 1Y1VH 5IGBA 1C8CA 1K52A 1KJTA 1JCKB 1EY5A 2OEOA 4C4VA 3PF4A 3RZWC 2YEPB 4ZAIA 3EVQA 1HA5A 2ZTEA 4X57B 3Q23A 1PHJA 3RN2A 4BY7G 1V2YA 3SXHA 2OJRA 4GGQA 1KLVA 3NTHA 4S3SA 5FLMH 3R7RA 3NEMA 3BS1A 3B6YA 1WMHB 3HOVB 2B8GA 2Z0SA 3STBD 3BG3A 3CMMB 4ZRQA 3H6MA 3OSOA 4IFDJ 2HTME 1XO3A 1FRRA 4BZAA 4RF0A 2A69D 3GTJB 1VDVA 4FP5D 1F2ZA 2IPKD 2F0LA 1L1OB 2GVBA 3FPUB 3RLOA 4C3JH 4MIUA 4OO1I 5E6PA 3UIPB 2KEEA 3IKJA 1TTNA 1S4ZA 3VAWA 2NVXB 1NMGA 3VDZA 1AEXA 1HZ9A 3QK0A 4K6DA 1A6XA 2VQEL 2VH2A 2NBUA 2QEJC 5T1IA 4BS9A 4O1NA 3P4RB 4Q2JA 5EAYA 4A3MB 1GB4A 3VR5A 4ZCKA 4A3LH 2MQJA 4IDIA 3P4QB 4DXGA 4ME3A 4IUQA 3GQBA 1RODA 4DAYB 4IFDI 3C0RB 1E2WA 4FXCA 4B3ML 2KHWB 1BCPF 1Y8OB 3DM1A 3N6RA 2V4IB 1QOHA 1Q8KA 1E10A 2XN9C 3GTGH 1HR0Q 4P16A 2M0XA 1YQBA 5IWAQ 4AQYQ 2KZRA 1DOYA 1DJRD 5IWAL 4AQYL 2D3CA 2NVTB 4JI4Q 3TEXA 1ZYRC 2F0OA 1VRAB 3HGBA 3CCMA 2R92H 4FA6A 3UE0A 2KOXA 3RNUA 3ZJYC 1HXYD 3PVLA 3FILA 4K3CA 1GUTA 4FADA 1GC7A 2WXRA 4WH4A 1OXUA 4XT3B 1WXAA 1HFGA 3JW0X 4JX1C 5D2MB 1X3QA 2EXDA 2DZJA 2A6ED 3HOWG 3L0OA 1H9RA 1IGDA 1V1QA 3J81L 3I4NB 3TRZA 1XNQL 2FE8A 4GSWA 1YIJA 3H94A 2XVSA 1H9MA 4EGVA 2KX0A 1D3ZA 4DUYL 4KSKC 3S1QB 2NUCA 1VQIA 1SYEA 2GOWA 1I42A 1BNZA 4KIKB 2KTFA 1K8MA 1Q12A 3DCGA 3HKZB 2D07B 3LNNA 1CA5A 4TRDA 1UD7A 1XTCD 3AEVA 4DK5A 3QOLA 1UE6A 4FJZA 1YNJC 4J15A 4HK2A 4YTMB 3PZDA 4K81A 2PEAA 3HOXH 4JV5L 3RULA 3CAMA 3HS0C 3MA2B 2SOBA 3MAQA 1GXDC 2IHEA 4B3RL 3KLRA 4PYUA 2E2JH 3CCQA 4XQNA 5E4XA 2G45B 2M0AA 4QB4A 2LVQA 1EUJA 5LXIB 4FLHA 1B9RA 1IYJB 1I3QH 1K9MC 1D2BA 3HK0A 4IOCA 2ICIA 2PPBC 4Y7NH 2KTRB 1DOMA 4A9AA 1EZ6A 3P75A 3KYHC 1OQQA 1VD2A 1W6JA 1BQQT 1F9PA 4R8NA 5HGQA 2ZJQA 3AN1A 1HH2P 3A7AB 3UI3A 1E0BA 3VDYA 1IW7C 1BR9A 5IYBG 1WTWA 3KK7A 4FXGC 2BCOA 4OHJA 4BXXG 2JA8G 2QA4A 2KWUB 1HZ5A 4M01A 3A9KA 5IODA 3TSSA 1HFNA 4TQ0A 4YSXB 1KLUD 3JAMi 1K3RA 1Y1WG 2FCQA 5LLIA 3NVYA 4G4KA 1HZAA 3HOVH 2LUMA 2N7JA 4PYZA 1H95A 2CU1A 1WI0A 1V49A 2B76B 1QWYA 3N1YC 3GTJH 2F0NA 1DGSA 1Z5SB 4TKOB 5EDSA 2HHHQ 3CP0A 4BVUC 3T56B 1YOVB 4ASWC 2FCSA 1JC7A 3RZDB 2NVXH 1Q0WB 2NZOA 2WU5B 4CHKA 2WLBA 1I5FA 3BZDB 3I90A 4K2LA 3ZNZB 4J3OD 4C00A 2MGSA 4ABNA 2KQ3A 3MWYW 4A3MH 1IPGA 4DN4M 2K1BA 1T6BX 2D11A 2IDYA 2AUKA 4MJSB 4G0NB 3ZJVA 2MJEA 1EY0A 1CKOA 4NW2A 3NG0A 5AEKB 1N5XA 3PO2B 3H15A 1V81A 4JBJA 3KJPA 2RDGA 3KDFA 4FN2A 5I2XA 3HOYG 1F2RI 4IUPA 4IUNA 4ZLTF 2NVTH 1T0YA 1XT9B 1OEYJ 5IN7A 3L17A 3M62B 2EY1A 2QCZA 2K0PA 2HDEA 2D10A 2N3SA 2H1EA 5CTRC 4LFBQ 2N8NA 1UWMA 2L76A 3CF6E 2DNEA 3Q14C 3PCOB 3R2TA 3LX0A 4TVAB 3P63A 1KRSA 1JT8A 3I4LA 2KJRA 3F2BA 1V9PA 1V9JA 2LZ6A 2H5XA 4LF5L 1S5ED 3Q8AA 1Q1OA 1XMOQ 3Q6BA 5FJ8H 5HI1A 1EFID 1XMOL 3N1XC 2QMTA 3I4NH 2KVRA 1ACCA 2I0QA 4BAXA 2Y0SB 4KJNA 3H09A 3PLUA 4A3PA 2JEAI 1NI2A 2XRQD 1TZOA 4DHJD 4A3CH 5LMNQ 5LMNL 4L5QA 3M4PA 1NBWA 3J80c 2WAQB 4KX6B 3KF8A 4OX9Q 2JSVX 5BYQA 4PK1A 4JPBW 2FUG1 1XNRQ 4DDID 2LASA 1G6PA 1XNRL 4JWSC 4HROA 3ZJTA 1Q3LA 4WJ3M 4XT1B 1H4RA 4YCWA 4CGYB 4MELA 1SN8A 4BKSA 5JHBA 1FD7D 1RFAA 2GBRA 1N9WA 3TBIB 3MC0B 1TZ1A 4HMJA 1RLFA 1ZPSA 2WXGA 1EY8A 3M7GA 5IIFA 4RM8A 4DK6C 2WXNA 1E1TA 3D0FA 1MD2D 2K14A 2PO4A 4FJYA 3CC7A 4RGNA 2INNE 4GDLB 2BWFA 4QL5A 2GN5A 1CTMA 1NENB 1WTPA 2JZPA 4BKSD 2N0SB 4I6PA 4CYEA 3DBSA 4IOIE 2O2LD 5CV4A 3G6EA 2QC8A 4LUVA 3SFEB 2UUAQ 1E90A 4BOZB 3OWFA 1YHQA 2UUAL 1U4RA 3DWQA 2ZNVC 3MP9A 3MEHA 1T9HA 2MBEA 2VW9A 4ME5A 4ALPA 2BS4B 2MLBA 4GOCA 4JQWC 4MH8A 4WJNA 3K9PB 2WB1G 5J22A 2D3AA 1ET9A 1QUQA 2KENA 2TSSA 5IGFA 1XX8A 2I2YA 4LCDE 2F0IA 2UYZB 2OQ0A 2EYMA 1ZYRD 5IP9H 1MHXA 2HTHA 1VR9A 3H6NA 3ALBA 2Q2HA 4HCSA 3BJUA 2O2VA 1EQQA 4K5WA 2L3ZA 1E7PB 1SLJA 1QE6A 2F0UA 3ZQ4A 1LACA 2ES2A 2CW0C 5D94A 1JMCA 2DY8A 1PDQA 2ZXPA 4X3UA 4HIOA 2LSSA 3TS0A 2YEPF 2G3QB 2OWOA 3P4SB 5FLMG 2DLBA 5I4DA 3RZDH 5E6OA 4GKJL 4ODGA 1EEFD 1K28A 1L0YB 1JB3A 2SDFA 2JT4B 4L8JA 4DV4L 2PQAA 1WX9A 3BK2A 1PGBA 1FR3A 3AE6B 3TJPA 2XSCA 4HPPA 3PV0A 4JI1L 4GLSC 4A3DG 1PLFA 4OWXB 4A3EB 1WR6E 3U7DA 5CBAE 3DHQA 3K0YA 3UI2A 4W9DA 5FLXc 1N60A 4KJOA 3TCAA 1SYDA 2CVRA 1LTLA 1S5CD 3HEJA 3PO2H 1N34Q 1MIUA 5C44G 1AE2A 3A54A 1N34L 4HJ5A 4B3TQ 4GLXA 5HFYA 4A3LG 3I2ZA 2LFNA 4JC0A 4QUFA 4K7WA 2OT2A 3QIAA 5DM73 2YYZA 2EYJA 1RTNA 1F77A 1OQRA 1VQFA 5C6AA 2KN4A 2F4VQ 2XWJB 1MG8A 2K8HA 3VUXA 3IXSA 1HJPA 4B3SQ 1TKWB 2WV6D 4QIWB 1MI2A 1FIQA 3KYCD 4B3SL 2QKIC 2YTVA 3KJOA 4OONA 1TXYA 2K4KA 4A3GB 1GJZA 3OG5A 3DEPA 4APVA 3OW2A 2WDTB 1CUKA 2KLCA 3GTPB 4XDCA 1EYDA 4DV7Q 4TMAB 1HNZQ 1IW7D 1RCVD 1HNZL 1VQ8A 1NR2A 1LXDA 4W9CA 3H3VI 1PFSA 3AEBB 2F0EA 3G6JB 1FJGQ 2MBBB 2ON8A 2RDFA 1SMYC 1QNKA 4KTAA 4RMFA 1LTAD 1S40A 1JRUA 4X66Q 3S2DB 4X66L 2K5NA 4AP4C 4BKGA 1N32L 1V86A 1YNTE 4DQOC 4UPAA 2L4NA 1ESRA 3RLNA 4CDEC 1N63A 1WMHA 3T3NA 2PZTA 1JJGA 1TBEA 2BT6A 3PTFC 1BKBA 1EOTA 2MFIA 3M3YB 2ZJPA 2D5GA 3B9JA 1E8XA 3PQIA 4AJWA 2Z9HA 4DV1L 3W2DA 2LHDA 2G9HD 2FXQA 2KMMA 4JYAL 3PO0A 1WGKA 5CV6A 1K50A 3WOEA 2BKFA 3T51B 4LAAA 1B3QA 1XJVA 3AE7B 5A2QE 1KNEA 1T5XD 4EX5A 2WXJA 4WAAA 2JA6B 3TBLD 5A35A 3GO5A 5FOBB 1FEHA 1WOCA 1ZXHA 3AEGB 3CW2C 3TZDA 2WU2B 5CMDA 4IWOA 2JQOA 4RHRA 1EYAA 4S17A 3VXWA 1K0RA 1C9FA 1C4PA 2JQRB 1QCBD 4EFOA 1D8LA 1WYGA 1V5TA 2CS4A 1PH2A 1VQHA 2MWSB 1EU3A 3A5UA 1WGGA 3DBLI 1FNVA 4JBWA 4CKBA 4R9WA 2E8GA 2ZXOA 3KOJA 2J7ZA 3AE9B 2RA4A 2IGHA 3EIVA 3Q8CA 1D1KA 4K8JA 4F7XA 2ONQA 2L5TA 2BGFA 3F8TA 3U58A 4NJ7A 4NZLB 2NN6G 3AYHB 2IL8A 2Q8RE 3BWUD 1CSPA 2KCMA 5JPNC 3TP6A 3LJ3A 4KGTA 3WALA 4P71A 3FEWX 2KQ7A 3QCAA 3UE1A 2JP1A 4QF4A 4UHVA 4E71A 5DLQE 1JORA 4TQ1A 3WA0A 1NAPA 2MHJA 2BPSA 2EE1A 4N58A 1QZGA 2O6VA 2DYOA 2KDIA 4A3EH 3PHWB 2AWNA 1HA6A 2BYTA 3IHPC 2JPHA 4KIKA 3EROA 3UGBB 1UH6A 3BYTB 4LF8Q 4KHPQ 4LF8L 3TP7A 4KHPL 4JI5Q 2LFIA 4LJZC 5ELBA 3I91A 3ZRFA 2NZHA 4A3BG 4WRDA 1GJXA 3PIOA 4YL8A 3M3JA 4GU2A 1EWIA 5I9OA 4OO1G 4OEMB 2CHWA 3QAQA 2VQFQ 3AB9A 1WE7A 2O6VD 5C0XH 2M17A 2VQFL 4X6AH 2B3AA 4LF7Q 2JA7G 2WYQA 3A55A 4LF7L 4Q5VA 1N62A 3VTVA 4XX5A 4GNXB 3NJTA 1AP0A 4PNYA 1EYCA 1LM0A 3VR6A 3L9AX 4DK0A 4A3GH 2DZMA 1HTLD 3NK9A 1RFKA 1GHJA 3X23A 4WAFA 3GTPH 4A3JB 2M56B 2NPTB 2PVOD 4EKUA 2DZIA 3I8ZA 1WX7A 2KXJA 5EE1A 1UELA 3S2HB 1KXLA 1TS3A 4R8IA 2VH1A 1KAWA 1F1HA 3V05A 3OMCA 3DWAA 1PVOA 3A4RA 2IT1A 3E9SA 3U9SA 2DYBA 4KKJA 4XWWA 4K0KQ 2C5CA 3OMGA 4K0KL 4AWJA 1EIFA 4OWWB 3S2DH 4KZ0A 1NY4A 5FO8B 2RQXA 4L5TA 2WP9B 3R8BA 1UEBA 1I4HA 4LJPB 4XYOA 5BYSA 4ZHOA 2HUGA 1NCVA 2B2YC 3M3YH 2F3IA 4ZK9B 2CW0D 3K8AA 3CQZB 4MGIE 2JYEA 2CCZA 1VQ6A 1YJNA 4EUTA 2UWQA 2NZ1D 4ANVA 5J2RA 4ARCA 2JZ3B 2XBBC 1Z6HA 3D31A 4HPMB 3A9JA 3PO3B 2JWUA 3GS2A 1P7EA 1A3TA 3A7LA 1GUWA 2ZPNA 2JF5A 2K7VA 4JL9A 1E2ZA 2E74C 5IGEA 2N9EB 3OIQA 2JA6H 3PIO3 1JWMD 3H3VC 2ZCBA 2EY2A 2CU3A 1FVIA 2K1FA 3F2CA 4MJSA 1R4NI 1S3SG 1H9KA 1U4AA 3NS1A 2NCNA 2D9UA 2MHVA 1TWCB 4GXBA 4HPLB 1IYVA 4H44C 2K39A 1UE7A 3ZXVA 4ZDVA 5G3LF 1RJTA 2PCFB 4RCOA 4XXEA 4PS3A 1PQSA 3LWUA 2J42A 2EZVA 3ZDMC 1ET6A 2V0GA 1PXUA 1FGUA 3D8GA 2QSDA 4NXNL 4W9IA 4YHHQ 3R66C 2BW2A 3TREA 3ICEA 5C3WA 4YHHL 2GMIC 2PIAA 3ND8A 1JALA 1G6JA 2FHTA 1XF5L 3VR8B 3VH3B 2F0FA 1VJKA 2K5HA 2IBIB 3H8HA 1SMXA 4DAPA 3J7A5 3RNCC 3AEEB 5C1ZA 1V97A 3I5JC 3P1MA 3CD6A 4JI2L 1C77A 1C3TA 4DXFA 1KLGD 1SE4A 3VH4B 4HKQA 1BT0A 2BE5C 3Q3JA 3HRDD 5IYCH 1SDFA 2D62A 1X3EA 4QY7A 1XPUA 2FNJB 1PYSB 1SMYD 4JI6Q 1FFUA 2B2VC 2CFMA 4J6IA 1SSOA 2KDFB 4KV6A 4WURA 4W9EA 4HJ9A 2UXCQ 1AYFA 4MNOA 4DWFA 1MG4A 1ENCA 2SNMA 2F0GA 1F2YA 1BCPC 3QQ8B 1JE5A 2MJ8A 2F0MA 3K57A 1G2TA 2KYWA 3AEAB 1QOBA 2AWTA 1PFNA 4XZ4A 2MQHA 3J81i 2JXMB 5GQOA 1XLNA 4IKGA 2Z4HA 2GBNA 2EYHA 1OEYA 4GDKB 5IYDH 1K51A 5IE8A 2NVQB 2GA4B 4IN3A 4KHZA 1QOGA 4GLAC 1X65A 4GB9A 3BDLA 3I70A 3ML8A 2ZW1A 5JAVA 1L6UA 3OJ4B 1WJJA 2WDQB 4UDUC 5AZGA 3W5UB 4A3OA 3CC2A 2WB1E 5G55A 4ZUIA 2KCCA 4A3JH 4XQQA 3S17B 3KQ4A 4V0BA 4IWQA 1ZKHA 3H91A 5AZHA 2LD9A 2L15A 3KUCB 3QJZA 3S2HH 5G3LD 2IGDA 4GNXC 4I6NB 4XWTA 4YCUA 1VQNA 5EPKA 3L08A 4H02A 1TIFA 4M8MA 1DOLA 2E76C 1LTBD 1I4XA 2YLMA 1I4RA 1P9DU 5H92C 4N8FA 2K5QA 4A3FG 2F52A 3CSFA 3W1SC 2JA5G 1BBWA 3VA7A 1EY7A 1Q7YC 2FINB 5IKCM 2PVGC 1SE9A 4ZQ3A 3AM9A 1TWAB 3NBHB 1VQGA 3CQZH 1YBYA 5CV7A 3K0XA 3A1QA 1SEBD 3DEOA 2F0HA 4ZRZA 4YIJA 2EJFC 1WD1A 1TY0A 3IFWB 2CQAA 3AQQA 2FCNA 4PS8A 1Y8NB 2J0TD 2NVYB 1Y69U 4GZYC 5HKHA 1A2UA 5CHVC 2N78A 5IT9L 4EQNA 1CM9A 4UAIA 4P1CC 2LEKA 1VQAA 1F52A 5KHOA 2E2DC 1OGWA 3JAMc 2NB0A 4GN1A 5D3IB 3AULA 4N9F4 1SIFA 2WIIB 2JRHA 4N9PA 1X1MA 1OXTA 3M4QA 1ASZA 2K5PA 1G51A 5COYA 1TWCH 4RKBA 1WR1A 2IO2B 2I5HA 5EE3A 2B29A 1AZPA 4IUVA 1EZ8A 3D3RA 1B1ZA 1B9NA 2QHOA 4FJVB 1WE6A 1Q90A 2RPVA 5EQ0A 2WXIA 5FO9B 2NBFA 5C3EG 3NBIA 2DJGC 3TMEA 3W5OA 2VUMG 3H7PA 4HCEA 2ZCCA 3WDNA 1T0QC 3FP9A 5EPLA 1O7YA 1SNOA 1RD9D 1E8YA 4LWCA 1JJCB 3Q0AA 2L00B 3MXGA 1XCTL 1C76A 1EWYC 1E0ZA 1D1IA 2NVUI 2DAJA 1JQYD 4PV1C 4MM3B 2L83A 1E9MA 2I1JA 4OL7A 4IUMB 1KDBA 4H0LC 3OHXC 2RPQA 4X62Q 4X62L 2WXKA 2O5JC 4O0AA 2D3GA 2XEWA 1VMCA 3I72A 4R4TA 1YNNC 1LFDA 1RAXA 1UBQA 3I3CA 5DNFA 2IJ0A 3GTOB 2B2YA 4CJ0B 1TU2B 2OQKA 4KLKA 1XWEA 3S2AA 1A3VA 3KLSX 2WACA 4F1SA 3U2SC 2PZUA 1I7HA 4P2CB 3MXNB 4DR4Q 3TDQA 2B63B 2BKRB 1RTOA 1TWHB 2EQSA 3I4MG 1EQRA 2C7MB 1CI3M 1K73C 1OXXK 1B3AA 1NR4A 1F9JA 2F0KA 1JW9D 2WXFA 2X38A 4BWGB 4U673 1GUGA 1NSNS 2WFWA 3H0GG 2HT1A 3F1ZA 3IRBA 1YN3A 3AI5A 4W9KA 3PIPA 2BF8B 1QT9A 2KC1A 4WWOA 5JZEB 2KDBA 3NQTA 2INPE 3ZNID 3MFYA 1HR0L 3P4PB 3I56A 1YJJA 3RMHA 2NVQH 5JJZA 5JEAH 5FR6A 4A8XC 4RKLA 4FNFA 4JI4L 4G7HC 1AZQA 5K36G 2HIXA 1STAA 1OTCA 5D3DA 4HSPA 1G291 4IPHA 4HEA1 3RFZB 2LY7A 3RCZA 1PH8A 2R93G 1VZ6A 3A4SC 3S17H 2C60A 1C4CA 3N9YC 2MBOA 1X3GA 1W6KA 3DQVA 4FHJA 5FO7B 4IQZA 2EDGA 2ZM6Q 3NTIA 1X3FA 1HRJA 2ZM6L 1WFYA 2C7HA 4C1NI 4DR7Q 1WZ0A 4DNRB 4RH6A 1PRTD 4DR7L 1P7FA 1IBXB 4IURA 1R9TB 1KABA 3E0EA 3RN5A 1VQ4A 2QILA 1XD3B 3M4YA 5M5WB 5KIXA 1SF0A 4RHSA 3EECA 5J1ZA 2PW7A 1VQDA 3NWSA 4CJ2C 1PFDA 1ZXTA 3EHVA 1D5MC 3C3LA 3ZIMA 1LT6D 3FPPA 4KMUC 2LUEA 1K0SA 2KC2A 3QG1A 4M00A 1TWAH 4OIJA 3SDZA 1G6ZA 3DVGY 3ULPA 2UUCQ 3P1HA 2JWZA 4M0WB 3VYTA 2UUCL 2ACZB 4RG1A 3KWLA 4EZKA 3F2DA 2B2VA 4M8AA 1I94Q 1YQ3B 3R2IA 2BQQA 1I94L 2GI9A 3SU8X 3NVWA 1E8WA 2NVYH 2KLGA 2WXOA 3NXWA 2KANA 1SNPA 2F4IA 4JK1C 3Q24A 3APDA 1EF5A 2BE5D 3MC9A 2PI2E 4A3IG 1BF4A 3ZW3A 2HDLA 5K5PA 3PIP3 1OXVA 1N36Q 1Q10A 4ZYNA 3IL8A 4OW0A 1N36L 3PF5A 1PH4A 4US9A 1JMLA 2VZKD 2EOTA 2WGSA 2XWBB 3UQBA 1SXTA 5HURA 1I4QA 5M3MB 2O5IC 4NPSA 1BCPD 4L5SA 1C48A 1CA6A 3CF5A 1UWVA 4ACFA 1T5EA 1J5EQ 2ID0A 3VTWA 2V4DA 1VZ8A 4ZKBB 1R4QB 2QDFA 3P2BA 4NAWB 1STEA 4P7IA 4ITKA 4H7BA 4N8X1 4XDXA 2NMQA 1L7YA 2IX0A 2R3ZA 2RDBC 4GOPB 4GNXA 1J7BA 3K7UC 1J7CA 4IW0A 4DV6Q 4DV6L 2PQEA 2SNSA 3HFZB 1YN5A 1ZUD2 2ZEQA 4ICUA 3RNEC 3IAYA 3PRZA 1V1PA 4GS3A 2BB5A 2NPTA 3K9OB 1FD6A 4S0RA 3W1SA 2EJMA 2HHHL 1J7AA 1PZKD 2EXZA 1O7ZA 4P73A 3GTOH 2MP2A 4EE2A 2R2OA 1WXQA 1FL0A 4Y52H 3F2UA 1IYUA 2A6HC 3M7NA 2JY6A 4DR3Q 3GTQB 2B63H 3HHMA 4DR3L 4A93B 3AMZA 1TWHH 4YWKA 1L1OC 4GN3B 4NDXA 1XEEA 3B0AA 2F0DA 4OVUA 5G2NA 4C3IB 3CCRA 4ZKCB 3SK5A 2WKDA 2PNRC 2VNUD 4BBRB 2AUJD 4LFCQ 1MPEA 3NZUA 4A3KB 2LGDA 3HM6X 1P3QU 1PH3A 3V60A 3G71A 4FF1A 1DGJA 1GUSA 2HJ8A 1WJNA 3S24A 3J81j 1X9NA 4LNQA 1NE3A 4R1JA 3DBHB 2MCNB 2HD5B 3LDZE 1V5OA 3SHLA 2IWHA 3Q6SA 4ZUJA 4ZYSA 4IPGA 3S16B 4K6LA 4RWSC 4LNFA 1FNWA 2J7QB 5LHY1 4X65Q 3GTKB 1SROA 4LFBL 3C1EA 4UP7A 2QDBA 1HUNA 2I38A 2IO3B 5IGGA 1YX6B 4II2B 4PS7A 1F9QA 2KJ6A 2L12A 3A8KE 3E9HA 5M5YB 3PSEB 4YWGG 3RNAC 1LTRD 3L13A 1IXRA 2ASBA 1EWHA 3AE1B 4D2KA 2N4FA 2UUBQ 3G7LA 3OJ3A 4HIDA 3ZUNA 2K5VA 3S1MB 3K5OA 1R9TH 1GVPA 2D2CC 2IY0B 1GHKA 2SEBD 4A3JG 5M5WH 3GV3A 3FDTA 1R4PB 1C78A 3T9LA 2G5DA 5M3FB 3ZNGC 4X3KA 4JLCA 3T16A 2ZXRA 3BVGA 4I65A 4OX9L 1JICA 4DK1A 2NTTA 4IG7B 3HOZG 5IP4D 3FKIB 2N9XA 2ZT9C 3NSWA 2FMMA 5L37A 2MP1A 2K5DA 1B50A 5DCNA 1ENAA 1RL2A 3WIMA 2M00A 4BBSB 3U9OA 2PMVA 1LYLA 1YJIA 1CMXB 1KNAA 1FNUA 5DAUA 5C4ZA 3QARA 3C1FA 2QF7A 1CT1D 1SE3A 2HCCA 2GB1A 1YNND 2F0PA 4OELB 3TL5A 2RSUA 2ZPYA 2KD0A 1JE4A 5C5LA 2E75C 1S5DD 1Q8IA 1P8LA 2MO1A 2E2IB 2A19A 4FF4A 4CBVA 1WIAA 3PO3G 3AV8A 2BB6A 1B2TA 1WCMG 3CCEA 3KUZA 4HAEA 5M3MH 3GZNB 4MSMB 3LGJA 4USAA 3C8YA 4B0MA 2VRRB 1UZXB 3BIID 3X3NA 3DVNV 3VRBB 2L11A 4HTHA 4L63B 4EZJA 2PMZE 3BINA 1F2LA 1S5FD 2YTYA 3DM3A 4BBNC 1L4DB 2AYOB 3P20A 2Q2UA 2W3SA 3TN2A 1R4MB 3UINB 5IOIA 1MFWA 2W82A 4CKCA 5C0XJ 3B1LX 4XDDA 1TJEA 1Y1VG 2N9PC 1TKGA 4LDTB 5CORA 3KW5B 1NUCA 4JVZA 3SR1A 2NS5A 2XK5B 1MHWC 3C46A 1P98A 1STHA 1ASYA 1VQ7A 3MFGA 2L9HA 4EQOA 2C9WB 2K04A 5IP7H 3Q8FA 5JJIA 4AYBE 3E9IA 1N8RC 1WX8A 5BN4A 3NUHB 1GPXA 4P6VF 2K52A 2F3VA 3JSVB 3O13A 5MPOA 1JOOA 5BN5A 4GOPC 1GUAB 3PS6A 3PUZA 3DHIC 1LTSD 4HXDA 3LWEA 5KYIA 3GTQH 4IWPA 2EJGC 4C3JG 4A93H 2WWZA 2F0JA 2A1AA 2F03A 3TIXA 3E0JA 5C0XI 5C23A 3PUYA 4R4QA 5KRUA 4POGA 4OVZA 2WINB 5M5XB 1Y8RC 4C3IH 3PZ8A 2M2LA 2J52A 4MACA 1UGMA 3Q69A 3SD5A 4BBRH 1LQBA 2D0OA 4LW1A 1WF9A 3KUDB 4A3KH 3DWGC 4K3BA 3H7SA 1PV4A 1YNJD 4LNOA 1GAQB 4B3TL 1CSQA 1PGAA 2IZVB 2L8JA 4XYQA 2N1WA 5IT9c 1DCZA 5CBEE 2VZAA 1WSPA 1LLRD 1EWCA 2OOBB 3DOWA 2INCC 5AFWA 2Z6KC 4FVMA 3Q8DA 1WTRA 3S16H 2OJWA 3FAHA 2UXDQ 3ERSX 3RLFA 1VQCA 3GTKH 2UXDL 1WFQA 2F4VL 4O42A 2HE7A 1CQFA 3BK1A 1E24A 1SAPA 3U4ZA 2ATWA 3WAMA 5M5YH 1HQMC 4JE3B 4YCVA 5LMNW 4K2KA 2EYFA 5D14A 1VQOA 4NMZA 4MT5A 2ZTCA 1HZ6A 4DV7L 2N9KA 1U0LA 1WRDB 5GAHC 2HQEA 3S1MH 5E6JA 5CYUA 3AE8B 4C4VB 3OLMD 4HDOA 1EIGA 2WP8J 4IJLA 2R92G 2DBYA 3AU5A 3WANA 3B2GA 3DMUA 2ZZPB 2BYVE 2PW5A 1FJGL 1WWTA 1YNXA 3N30A 2MA9B 3J9CA 2FJ2A 5M3FH 2RD0A 4L1BA 3UF8A 1EY4A 2V3NA 1GB1A 3FKIH 5M9OA 1ZEQX 1V80A 4N59A 2W55A 4MM3A 3RT3B 1MBYA 4BBSH 3LXFA 2AMCB 4MGYE 5BMIA 3QR8A 3VYRA 2AKWB 4P72A 2H88B 3BZCA 4LNKA 1L1OA 1L0VB 1II3A 1E7ZA 2CWAA 2ASQA 1EFWA 5GAGC 3QJYA 4WQOB 4LF6Q 2ZW0A 3V6EB 3SVMA 1NI3A 3A8IE 4RF1A 4HVBA 5C4XB 4MN3A 1CK1A 1ENFA 2YV5A 3NHHA 5HGTA 3CHBD 2A6HD 3HOXG 4HJ8A 1GNUA 2MSED 4G11A 2E2IH 1N61A 2RCFA 3I63C 2E5LQ 2C35B 2H4OA 4EEWA 4HJAA 3DDCB 3EQLC 2JN4A 3HIZA 2GVAA 2AQ3B 2PJHA 2F3WA 4LK1C 1HTOA 3I7FA 3VUWA 3OIPA 3U8ZA 1BUVT 4XTCS 4NNJB 5E3FA 4DAYA 2F0QA 2QJLA 2E2HB 2CKHB 4OIKA 4LTUA 3DHGC 4BBNF 2VY3A 4QAYA 3V62A 2UU9Q 1HZBA 3CU7A 4FHKA 2VS1A 2UU9L 3GTMB 3HUIA 2JA9A 3N20C 2JSOA 2WXMA 4ICVA 3ZVVA 3QX1A 1SNCA 3CMEA 4LJOB 3CPWA 3AXCA 1VCBA 1FFVA 1SYFA 2JA8B 4I6LB 4URKA 5KNCA 1VQKA 1F2MA 2X6LA 1PH6A 3V3XA 3PGZA 2B3GA 1Y1WB 3HOVG 3J81c 3QO2A 2DAFA 2I07B 2XGTA 3PHXB 1JQ4A 1X6OA 2AWOA 1Q82C 1XPOA 3CCLA 1AWDA 3S9WA 3K59A 1RDPD 1JWAD 1Z7TA 4WFN3 3R7QA 3I3TB 1ILQA 1X3PA 5M5XH 1A70A 1ZKOA 2KN5A 4O2DA 4LUZA 1IBMQ 2NYZD 2ZVNA 3AU4A 3L10B 1QNUA 1L2FA 2X6GA 4KY6A 1HPCA 2XRSD 3Q8EA 2B2UC 2CJNA 1EO6A 4EVOA 2DNCA 2EYOA 3A56A 1C7YA 4JI5L 4LNNA 1WGRA 4A3MG 2CKZB 2B63G 1C4AA 2XIWA 3KLSA 4C2MB 4B6WA 1C9OA 3K5LA 4KKSA 3J80E 1GC6A 4CO7A 3SE0A 1Q86C 5ELCA 2PKOA 3OW7A 3AEFB 2JXXA 5EE0A 1PFMA 5E6NA 3DBRB 3HOUB 3PLVA 4C7ZA 5CV8A 2KACA 2KTRA 3HOYB 3ZNHB 4NB3A 4JI0Q 2V4LA 2Y3AA 1UE5A 5LXHA 3B08A 4HKZE 4DHZE 1LTTD 3PPAA 3J7AF 1KF6B 3SEBA 4JBKA 3J7YW 1ZE3D 4QMGA 3A9KB 2TMPA 3HP3A 3WWVA 3NS8A 1MJDA 2GBKA 3BDOA 1Y56A 2KBNA 5D65A 4XC2A 2Y5BB 4M8NA 2EYLA 2MNAA 5FJ8G 1D4BA 3DHHC 2OEDA 3HOWH 2D5DA 2JE6I 2BWES 1T0RC 4WJOA 4XGAB 3I4NG 5C5MA 4GOPA 1K53A 1SYGA 4A76A 3MC8A 4HLEA 3TEZA 2JK8A 1Z2MA 2CHBD 2PNHA 4FF2A 1DZ1A 1RIPA 1VQ9A 3UIOB 4A3CG 2B2WC 3TEHB 5A2QL 1K83B 1TKYA 3HKZG 5FKAC 1JR0D 2K03A 3NTKA 4UY8C 1IYFA 1MKHA 2HQLA
chains in the Genus database with same CATH topology
3L4PA 1LT5D 4RA8A 3VQIA 4HMIA 1F9RA 3PUWA 4YTNB 3A8JE 1DXMA 2LS01 3AB5A 1IHZA 3ONAB 1QOFA 4KI0A 1BOSA 1KDAA 3PUXA 1G2SA 2G1EA 1EU4A 5FLXE 1STGA 4KK7A 1NEKB 2BS2B 2K3UA 2K22A 2L1BA 3PUVA 2WB1B 4B08A 3RD4A 2G9DA 2R7ZB 2PYKA 1C79A 2IX1A 2K01A 4U68A 1JRPA 4YSYB 1Y8PB 3CRKC 4IUTA 3L3OC 1GOZA 2DYMA 3URYA 4DF7A 2EELA 1AN8A 2NTSA 1TKEA 1U4MA 1DM0B 4YSZB 3EJIA 2AQ2B 4DA2A 1IKLA 1UEAB 2W3RA 1IUEA 3WCQA 4KY5A 3K6OA 1QKZA 4G57A 3U4EG 1SJHD 4A3DB 2H89B 3I57A 4J8QA 2RSNA 5C44B 3TEYA 2K05A 1GUNA 3GB1A 1J8IA 1N5WA 3ZGZA 1XLQA 1STNA 1RM6C 1XCQL 3S1NB 4NJCA 5JOBA 4J1MA 1F0ZA 3E5SA 3P42A 3DXJC 1ZDXA 3VR3A 1TR5A 4KN7C 4TQUS 1RYJA 4X3TA 1I6VC 2RSOA 1UNSA 1VCIA 2R6GA 3S1RB 1SB3C 3NVZA 2LKVA 5I6WA 1NYQA 1BMLC 1SJED 3RPFC 5BMGA 4ZRPA 3W3AA 2B2UA 2L0CA 3AMUA 1FCCC 3IFDA 1VZ7A 5E4WC 4YT0B 2KAJA 3LB8C 1A2TA 4OZBA 5C4HA 5FLXL 4Z9CB 5ELEA 1V8QA 3MXUA 4RGMA 1A15A 3OWEB 3BVZA 3W5VB 4FYDA 1QF6A 1WTQA 4B9XA 1D5XC 1ILPA 2AQ1B 5I6YA 1EEID 4RNAA 3LYYA 1BUIC 5KGUA 4TSSA 4AQ7A 1B9MA 2EYPA 1JWSD 2J53A 3NRZA 3AU7A 2PW9A 4C1NK 1U9RA 1I6HB 2FBWB 2B2WA 2BA0A 3K5MA 4IZ8A 1MI0A 2N55A 3AE5B 3D4WA 4OGQC 1QJOA 2KJXA 2Z4IA 1C4QA 2F0SA 2PLPA 4N6EB 2LGIA 1NVID 1FO4A 1U4PA 1NYRA 1MSHA 1SNMA 5C3XA 5KNBA 1I4GA 4A3BB 2BOSA 4IUUA 3MVVA 4L6TB 5C0XG 5KNDA 1O7LA 1LTID 2JA7B 1FXAA 4E6IA 1PZJD 4C3HB 5KYLA 3EGRA 2PTLA 1ZP0B 3MHBA 1ONLA 1PGXA 2BBCA 2M19A 4L2YA 2IW3A 3GD7A 3KUPA 4KY7A 4BY1B 2M9VA 3GV6A 4KHVA 4CJ1B 1DOXA 2JXTA 3ZYYX 3GP7A 3MTSA 4KD3A 4PMWA 4XIGS 5AUIA 2BA1A 1KRHA 2KOLA 1DYQA 3ETRA 4NKLA 1CZGA 3MXPA 5EGTA 5DEHA 2VB3X 1RKNA 5F2DA 2RDHA 1Z47A 3QB3A 1AFPA 1AW7A 1PYWD 1XLPA 3ABVB 4LK0M 5HHDG 2PZWA 4NP5A 2N88A 1JWUD 1CJEA 1TS5A 5ELDA 2OXPA 1ZDVA 2KECA 2GRIA 2DN8A 2KQ4X 4HJGE 4CQNA 2KA7A 1RHPA 5FK9C 1S5BD 1EQVA 1TWFB 1TYGB 5IGCA 2WDVB 3EA6A 1ZXIA 1JROA 1G8ZD 2WDRB 3VA5A 4M1UB 4KD4A 3QOJA 1DONA 1O78A 4OZCA 3RZOB 5EJWA 1BO0A 3ND9A 3NPPA 2NN6H 5CV9A 3HVDA 5HG2A 3M85A 4FO2A 1JOQA 1LTGD 1PMRA 4WORA 1SIJA 2K33A 1IGCA 3FVQA 4KKTA 4RCNA 4ZHPA 5EBCA 5BYRA 3IT4B 2F0VA 2EKIA 2IX3A 3CWIA 3K58A 2L52A 1YN4A 3SK6A 2F1MA 3NVVA 2O4XA 5T1GA 4FF3A 1L0XB 5E1FA 4OO1H 2VB2X 5FR3A 1SYBA 2KVMA 1EIHA 1FM0D 1L6VA 3Q8BA 3JAME 4YXDB 4C80A 1QQRA 1Q1EA 4HN7A 4DGZA 1H9SB 5IOCA 2PMZB 5I2YA 4CKEA 5CGKA 4IFDH 4B0EA 1X32A 3AH7A 4ID6A 4KKUA 1WD0A 2LJIA 2DY7A 2KEDA 2VXWA 4JPSA 2Z8LA 1HEZE 2L55A 3K7AB 1MHHE 4A3FB 2ENBA 4AYBB 2JA5B 1CHPD 2Q5WD 4DAVA 4L23A 3TZUA 2LMCB 2KDMA 5H8YE 2DWQA 2KCNA 5LL6S 2Q8IB 3P7JA 4KKIA 1XYIA 4DFAA 1VLBA 2MH7A 1LT4D 2SAKA 2Y5CA 2J4XA 2NWGA 5NUCA 1E2VA 3T4AC 1QLBB 4NAMA 4HR7B 3DWPA 1V8CA 4Q0FA 1L4ZB 1WRIA 2F0TA 2KHSA 5GXGB 1QB5D 3TP8A 3NUCA 2K9XA 2MJDA 5C3EB 3N52A 2VUMB 5CR3A 3U52E 4ZOHC 3FMCA 4JWUC 4BY7B 1WVLA 5AUKA 3W9CB 2RVLA 1PUTA 3K5NA 1UWXA 3SR6A 1BBXC 2OF1A 3PMFA 1STYA 1SNDA 4K8IA 2F0WA 2Y5PA 3E56A 1RWSA 2MJ3A 3BDCA 1EY6A 1UAPA 3TUOA 4LMQD 5I9PA 3S14B 1MVKA 5C2TB 1PTOB 3NBHA 2RBMA 4WIPA 2B39A 1TQOA 4PMCA 3I4MB 1TS2A 2IGGA 4I7ZC 4AS1A 3TP5A 3H0GB 2HCIA 2I46A 3JAML 3AE4B 2B2TC 1R7SA 1DD2A 4A55A 2HDMA 5JEAG 1FGBD 3KBGA 5TSSA 1GUOA 3IT6B 4HSVA 3PZ7A 2R93B 2WS3B 2A73B 4BA1I 4OZAA 3D4DA 4REZA 2Z1CA 3FRPB 4WWMA 3D6CA 4J6HA 3HOWB 1T3QA 4G7ZC 3VR9B 5EKIA 4CHTB 3EUB2 4IALA 2QCPX 1TIID 2K32A 4ILWA 1ML0D 1F2RC 3NE5B 1SBBB 1CZWA 1RF2D 2JYOA 3MXNA 3TEWA 2EY6A 3VRAB 2KWDA 3OPOA 1UGJA 4A3IB 4ULLA 5G5HA 4ARIA 4FXKC 3D4RA 1V43A 4B9WA 1PRTB 1FMAD 3V2TA 1Q1BA 4PQXA 2RMMA 1B4OA 3FILB 1VF7A 1I50B 1XLOA 3VR4A 3NP8A 1JOKA 5D7GA 3V96A 1SYCA 2BDNA 2A68C 1SFOB 1EQTA 2WKCA 1ROEA 2JX5A 3VYUA 1IBXA 4G7OC 4H2AA 1CQVA 2C9OA 5JVG3 1QG7A 4KN4C 4WJWA 5C4JB 4HEDA 1WTXA 3S15B 3GTLB 1EM7A 2WXQA 3MHZA 1U4LA 2BTEA 2A5HA 1MSGA 1PTOH 1EY9A 1SSNA 3IFTA 1PDXA 4M0WA 2VZKB 1IL8A 1BXTA 1PFBA 5EKKA 1FRDA 5DM63 1BCPB 4RGOS 4N9TA 1VDZA 1KFYB 3J7AV 4R3DA 1PZID 3HG9A 1PTOC 3I73A 2WNMA 4X3SA 4C56C 2WXHA 1BDOA 2WXPA 5EE9A 4YTPB 5K36H 5ISRA 3FC4A 3HZXA 2YU9B 5EBDA 4FXDA 3T3OA 1SE2A 2V3PA 1TWGB 3NZ3A 3ZJUA 1YMHE 5EPJA 3AE3B 2EY5A 3Q22A 1G91A 4C3HG 2MUYA 3VR2A 4PT5A 1OFFA 1TY2A 2FMCA 2A69C 5C3JB 1KH0A 1V1PB 1LABA 1STBA 4A90A 1M8AA 1FCLA 4IFDG 1CHQD 2MEKA 4QUCA 4XQJA 3C2PA 1FXIA 4HRSA 3HOZB 4C7YA 3BVMA 3ITPA 1J9OA 3BYYB 3R3OA 3MJ5A 1A3UA 1D5ZC 2JYTA 4WQMA 1HCZA 1K8OA 3I9V1 4A6QA 4EQPA 4DNTB 4PMBA 1QOAA 2WQYB 2LHEA 3DWMA 1HUMA 2R61A 2B2TA 1DOIA 1D6EC 1EL0A 1KDCA 1E6EB 3R93A 1LO5D 1CZPA 4F88A 1O80A 3M4OB 2E6XA 5JPMC 1WCMB 1VF5C 4KGRA 3U7ZA 5JXVA 5JEAJ 1OXSC 2BS3B 3MZ5A 5IT9E 4V190 1OO9B 1TS4A 1H9JA 3AEDB 1KAAA 3DUZA 2K6AA 2A6EC 5G5GA 1PRTC 4MHEA 1Y1VB 2KUMA 3KBXA 1ESFA 2X69A 2JU6X 5IGDA 1H9SA 5ELFA 1XXGA 1QILA 1CFMA 1B53A 1SNQA 3SFDB 3VYSA 3J80L 1B44D 4RAUC 5CC4A 4BA2I 3X3MA 5LNK1 4C3JB 3QWNA 5J39A 1DOKA 3L7ZC 4F8MA 3T13A 4C3IG 3RUZA 3KWVA 1ZOYB 2LMCA 5EKLA 2QIEB 1PTOF 4US8A 5T8IA 2N9LA 3SK8A 2Q8TA 1F9SA 5LL6X 2K5WA 1HQRD 3GTGB 3WOFA 2CJOA 1UUPA 2K28A 2L32A 3IAM1 1M4VA 1IKMA 3EFXD 3CKIB 4DU9A 1HTPA 3AECB 5BMHA 3NWTA 2W54A 2EPBA 2R92B 2B8FA 3ERQA 1ICWA 2XNAC 1HHVA 1WTVA 5KEEA 1JWBD 2BDOA 4K14A 2A68D 4K5XA 2FFKB 2JEBI 1VMPA 5CV5A 1L5PA 3IAS1 3HVZA 1KTKA 2A74C 4RGTA 2RKSA 1V1OA 4H13C 4KGSA 2MPMA 3J81E 1I4PA 5JVH3 3CIRB 1MGSA 3CRLC 4RFBA 3HOXB 1YQ4B 4F87A 2OHFA 4QCLA 3OOCA 1TT2A 4K5VA 5BN3A 3B2FA 2E3TA 2E2JB 2EVBA 2AX5A 1LT3D 1I3QB 3SK4A 3D6WA 4Y7NB 2ICEC 3NQIA 4LLGM 1LV9A 4XE0A 1WTOA 3HRZC 2NN6I 1PTOD 1TVXA 1FYCA 2WXLA 3E6ZX 2L1AA 3T53B 1C8CA 1PRTF 1K52A 5IGBA 1JCKB 1EY5A 2OEOA 2YEPB 4ZAIA 3EVQA 1HA5A 3Q23A 3SXHA 3NTHA 4S3SA 3BS1A 3HOVB 2B8GA 3BG3A 4ZRQA 3H6MA 3OSOA 4IFDJ 2HTME 1XO3A 1FRRA 4RF0A 2A69D 3GTJB 1VDVA 1F2ZA 2IPKD 4FP5D 2F0LA 3FPUB 4OO1I 4MIUA 2KEEA 3IKJA 1S4ZA 2NVXB 1AEXA 4K6DA 1A6XA 2QEJC 5T1IA 4BS9A 4O1NA 3P4RB 4Q2JA 4A3MB 1GB4A 3VR5A 4IDIA 3P4QB 4DXGA 4IUQA 3GQBA 1RODA 4IFDI 1E2WA 4FXCA 2V4IB 1BCPF 1Y8OB 3DM1A 3N6RA 1QOHA 1E10A 2XN9C 4P16A 1DOYA 1DJRD 2NVTB 3TEXA 1ZYRC 2F0OA 1VRAB 3HGBA 1HXYD 3FILA 1GUTA 2WXRA 4WH4A 1OXUA 4XT3B 1HFGA 4JX1C 1X3QA 2A6ED 1H9RA 1IGDA 3J81L 3I4NB 2FE8A 3H94A 2XVSA 1H9MA 4EGVA 3S1QB 2NUCA 1SYEA 1BNZA 1K8MA 1Q12A 3HKZB 3LNNA 1CA5A 4TRDA 1XTCD 3QOLA 1YNJC 4YTMB 3MA2B 3HS0C 2SOBA 3MAQA 1GXDC 3KLRA 4XQNA 5E4XA 2M0AA 4QB4A 1B9RA 1D2BA 2ICIA 2PPBC 1DOMA 4A9AA 1EZ6A 3P75A 1OQQA 1W6JA 1BQQT 1F9PA 4R8NA 3UI3A 3AN1A 3A7AB 1E0BA 1IW7C 1BR9A 1WTWA 3KK7A 4FXGC 2BCOA 4OHJA 1HZ5A 4TQ0A 5IODA 3TSSA 1HFNA 4YSXB 1KLUD 3NVYA 4G4KA 2LUMA 2N7JA 2B76B 1QWYA 2F0NA 4TKOB 3T56B 1JC7A 3RZDB 2WU5B 2WLBA 3BZDB 3I90A 4K2LA 4J3OD 2MGSA 4ABNA 2KQ3A 3MWYW 1T6BX 4DN4M 2K1BA 2IDYA 2AUKA 3ZJVA 2MJEA 1EY0A 4NW2A 1N5XA 3PO2B 2RDGA 5I2XA 1F2RI 4IUPA 4IUNA 4ZLTF 2EY1A 2K0PA 2HDEA 2H1EA 1UWMA 2DNEA 3R2TA 3LX0A 3P63A 3I4LA 1S5ED 3Q8AA 5HI1A 1EFID 2QMTA 1ACCA 2Y0SB 4KJNA 3H09A 2JEAI 2XRQD 1TZOA 4KX6B 2WAQB 3KF8A 5BYQA 2JSVX 2FUG1 4JWSC 4HROA 3ZJTA 1Q3LA 4XT1B 4CGYB 1FD7D 3TBIB 3MC0B 4HMJA 2WXGA 1ZPSA 1EY8A 3M7GA 5IIFA 2WXNA 1MD2D 2PO4A 4RGNA 2INNE 4GDLB 1CTMA 1NENB 1WTPA 2JZPA 2N0SB 4IOIE 2O2LD 5CV4A 3SFEB 3OWFA 1U4RA 3DWQA 3MP9A 3MEHA 4MH8A 4ME5A 2BS4B 5J22A 1ET9A 2TSSA 5IGFA 1XX8A 2I2YA 2F0IA 2EYMA 1ZYRD 1MHXA 1VR9A 4HCSA 4K5WA 1E7PB 2F0UA 1QE6A 3ZQ4A 1LACA 2CW0C 2DY8A 1PDQA 2ZXPA 4X3UA 2YEPF 3P4SB 2DLBA 5I4DA 4ODGA 1EEFD 1L0YB 1JB3A 2SDFA 4L8JA 3BK2A 1PGBA 1FR3A 3AE6B 2XSCA 3PV0A 4GLSC 1PLFA 4A3EB 5CBAE 3DHQA 3K0YA 3UI2A 1N60A 4KJOA 1SYDA 2CVRA 1S5CD 3HEJA 3A54A 5HFYA 2LFNA 4QUFA 2OT2A 3QIAA 5DM73 2YYZA 2EYJA 1RTNA 1F77A 1OQRA 5C6AA 2KN4A 2XWJB 3IXSA 1TKWB 2WV6D 4QIWB 1MI2A 1FIQA 2QKIC 4A3GB 3DEPA 3GTPB 4XDCA 1EYDA 4TMAB 1IW7D 1RCVD 1NR2A 3AEBB 2F0EA 3G6JB 2ON8A 2RDFA 1SMYC 1QNKA 4KTAA 1LTAD 3S2DB 4DQOC 1YNTE 1N63A 2L4NA 1ESRA 3T3NA 2PZTA 2BT6A 1EOTA 3M3YB 2D5GA 3B9JA 3W2DA 2LHDA 2G9HD 2KMMA 3PO0A 1WGKA 5CV6A 1K50A 3WOEA 3T51B 4LAAA 3AE7B 5A2QE 1KNEA 1T5XD 2WXJA 2JA6B 5A35A 3GO5A 5FOBB 1FEHA 1ZXHA 3AEGB 3TZDA 2WU2B 5CMDA 4RHRA 1EYAA 1C9FA 1C4PA 2JQRB 1QCBD 1WYGA 1EU3A 1FNVA 4JBWA 4CKBA 4R9WA 2ZXOA 2J7ZA 3AE9B 2RA4A 2IGHA 3Q8CA 1D1KA 4K8JA 4F7XA 2ONQA 2L5TA 4NZLB 2NN6G 2IL8A 2Q8RE 3BWUD 5JPNC 3TP6A 4KGTA 3FEWX 2JP1A 4QF4A 1JORA 4TQ1A 1NAPA 2EE1A 4N58A 2DYOA 2AWNA 1HA6A 2BYTA 3EROA 3BYTB 3TP7A 2LFIA 4LJZC 5ELBA 3I91A 4WRDA 1GJXA 5I9OA 4OO1G 3AB9A 5C0XH 3A55A 4Q5VA 1N62A 1AP0A 4PNYA 1EYCA 3VR6A 3L9AX 4DK0A 1HTLD 3NK9A 1RFKA 1GHJA 4WAFA 4A3JB 2M56B 2PVOD 3I8ZA 5EE1A 3S2HB 1TS3A 4R8IA 3V05A 3OMCA 3DWAA 3E9SA 4XWWA 2IT1A 4KKJA 3U9SA 2C5CA 3OMGA 5FO8B 2RQXA 2WP9B 3R8BA 1I4HA 4XYOA 5BYSA 4ZHOA 2HUGA 1NCVA 2B2YC 4ZK9B 2CW0D 3CQZB 2JYEA 2NZ1D 4ARCA 1Z6HA 3D31A 3PO3B 2JWUA 3GS2A 1P7EA 1A3TA 3A7LA 1GUWA 2K7VA 1E2ZA 2E74C 5IGEA 3OIQA 3PIO3 1JWMD 3H3VC 2EY2A 2CU3A 1H9KA 3NS1A 2D9UA 2MHVA 1TWCB 1IYVA 4H44C 5G3LF 1RJTA 2PCFB 4RCOA 4XXEA 3LWUA 2J42A 2EZVA 2V0GA 1ET6A 1PXUA 3D8GA 2QSDA 2BW2A 5C3WA 2PIAA 3ND8A 1JALA 2FHTA 1XF5L 3VR8B 2F0FA 1VJKA 3H8HA 4DAPA 3AEEB 1V97A 3P1MA 1C77A 4DXFA 1KLGD 1SE4A 4HKQA 2BE5C 3HRDD 1SDFA 2D62A 1SMYD 1FFUA 2B2VC 1SSOA 4KV6A 4WURA 1AYFA 1ENCA 2SNMA 2F0GA 1F2YA 1BCPC 2MJ8A 2F0MA 3K57A 1G2TA 3AEAB 1QOBA 1PFNA 2JXMB 1XLNA 4IKGA 2Z4HA 4GDKB 2EYHA 1K51A 2NVQB 2GA4B 4IN3A 4KHZA 1QOGA 3BDLA 3I70A 2ZW1A 5JAVA 1L6UA 2WDQB 4UDUC 3W5UB 4ZUIA 2KCCA 4XQQA 3S17B 3KQ4A 4V0BA 3H91A 5G3LD 2IGDA 4XWTA 5EPKA 1DOLA 2E76C 1LTBD 1I4XA 1I4RA 5H92C 2K5QA 3VA7A 1EY7A 2FINB 2PVGC 4ZQ3A 3AM9A 1TWAB 5CV7A 1SEBD 3DEOA 2F0HA 4ZRZA 4YIJA 2EJFC 1WD1A 1TY0A 2CQAA 1Y8NB 2J0TD 2NVYB 1Y69U 4GZYC 1A2UA 5IT9L 4EQNA 1CM9A 4UAIA 2LEKA 2E2DC 2NB0A 5D3IB 2WIIB 4N9PA 1OXTA 2K5PA 5COYA 4RKBA 5EE3A 1AZPA 4IUVA 1EZ8A 3D3RA 1B1ZA 1B9NA 1Q90A 2RPVA 5EQ0A 2WXIA 5FO9B 2NBFA 3NBIA 3TMEA 4HCEA 3WDNA 5EPLA 1O7YA 1SNOA 1RD9D 3Q0AA 3MXGA 1XCTL 1C76A 1EWYC 1E0ZA 1D1IA 1JQYD 4PV1C 4MM3B 2L83A 1E9MA 4OL7A 1KDBA 4H0LC 3OHXC 2WXKA 2O5JC 1VMCA 3I72A 1YNNC 3I3CA 5DNFA 2IJ0A 3GTOB 2B2YA 4CJ0B 1TU2B 1XWEA 1A3VA 3KLSX 2WACA 3U2SC 2PZUA 1I7HA 4P2CB 3TDQA 2B63B 1RTOA 1TWHB 1CI3M 1OXXK 1B3AA 1NR4A 2WXFA 2F0KA 1JW9D 2X38A 4BWGB 4U673 1GUGA 1NSNS 1YN3A 1QT9A 3NQTA 2INPE 3MFYA 3P4PB 1YJJA 3RMHA 5JJZA 5JEAH 4A8XC 4RKLA 4FNFA 4G7HC 1AZQA 5K36G 1STAA 5D3DA 4HSPA 1G291 3RFZB 4HEA1 2LY7A 1VZ6A 1C4CA 3N9YC 1W6KA 5FO7B 4IQZA 2EDGA 3AE2B 3NTIA 1HRJA 4C1NI 4DNRB 4RH6A 1PRTD 1P7FA 1IBXB 4IURA 1R9TB 1KABA 2QILA 3M4YA 5M5WB 5KIXA 1SF0A 4RHSA 5J1ZA 2PW7A 4CJ2C 3NWSA 1PFDA 1ZXTA 1D5MC 3C3LA 1LT6D 3FPPA 4KMUC 3QG1A 3SDZA 4OIJA 1G6ZA 3P1HA 3VYTA 2ACZB 3KWLA 2B2VA 4M8AA 1YQ3B 3R2IA 2GI9A 3NVWA 2WXOA 3NXWA 1SNPA 2F4IA 4JK1C 3Q24A 2BE5D 1BF4A 2HDLA 5K5PA 3PIP3 1OXVA 1Q10A 3IL8A 4OW0A 4US9A 1JMLA 2VZKD 2EOTA 2XWBB 1SXTA 5HURA 1I4QA 5M3MB 2O5IC 1BCPD 1C48A 1CA6A 1T5EA 2ID0A 2V4DA 1VZ8A 4ZKBB 1R4QB 4NAWB 1STEA 4ITKA 4H7BA 4XDXA 2NMQA 2IX0A 2R3ZA 1J7BA 1J7CA 1ZUD2 2PQEA 2SNSA 1YN5A 3IAYA 1V1PA 2BB5A 1FD6A 3W1SA 2EJMA 1J7AA 1PZKD 2EXZA 1O7ZA 4EE2A 1WXQA 3F2UA 1IYUA 2A6HC 3M7NA 3GTQB 4A93B 3AMZA 4NDXA 1XEEA 2F0DA 4C3IB 4ZKCB 3SK5A 2WKDA 2PNRC 2VNUD 4BBRB 2AUJD 1MPEA 4A3KB 4FF1A 1DGJA 1GUSA 3SHLA 2IWHA 4ZYSA 3Q6SA 4ZUJA 3S16B 4K6LA 4RWSC 1FNWA 5LHY1 3GTKB 3C1EA 2QDBA 1HUNA 2I38A 5IGGA 1F9QA 2L12A 3A8KE 5M5YB 4YWGG 1LTRD 1EWHA 3AE1B 4D2KA 3G7LA 3S1MB 3K5OA 2D2CC 1GHKA 2SEBD 3GV3A 3FDTA 1R4PB 1C78A 5M3FB 4X3KA 3T16A 2ZXRA 3BVGA 4I65A 4DK1A 1JICA 2NTTA 3FKIB 2ZT9C 3NSWA 2FMMA 1B50A 2MP1A 2K5DA 1ENAA 2M00A 4BBSB 3U9OA 2PMVA 1YJIA 1KNAA 1FNUA 5DAUA 5C4ZA 3C1FA 2QF7A 1CT1D 1SE3A 2HCCA 2GB1A 1YNND 2F0PA 1JE4A 5C5LA 2E75C 1S5DD 1Q8IA 2E2IB 4FF4A 4CBVA 3AV8A 2BB6A 1B2TA 4HAEA 4USAA 3C8YA 4B0MA 3BIID 3X3NA 3VRBB 2L11A 4HTHA 4L63B 1F2LA 1S5FD 1L4DB 3P20A 2W3SA 3TN2A 2W82A 4CKCA 5C0XJ 4XDDA 1TJEA 1TKGA 5CORA 1NUCA 3SR1A 3C46A 1STHA 3MFGA 2L9HA 4EQOA 2K04A 3Q8FA 1GPXA 5BN4A 3NUHB 4P6VF 2F3VA 3O13A 5MPOA 1JOOA 5BN5A 3PUZA 1LTSD 3LWEA 5KYIA 2EJGC 4C3JG 2F0JA 2F03A 3E0JA 5C0XI 3PUYA 5KRUA 4OVZA 2WINB 5M5XB 3PZ8A 2M2LA 2J52A 4MACA 3Q69A 3DWGC 1YNJD 1GAQB 1PGAA 4XYQA 1WSPA 1DCZA 5CBEE 1LLRD 1EWCA 5AFWA 4FVMA 1WTRA 3FAHA 3RLFA 4O42A 1CQFA 3BK1A 1SAPA 1HQMC 4JE3B 4K2KA 2EYFA 5D14A 4NMZA 4MT5A 1HZ6A 2N9KA 5E6JA 2HQEA 5CYUA 3AE8B 1EIGA 2WP8J 2DBYA 3B2GA 3DMUA 2PW5A 1WWTA 3J9CA 2FJ2A 4L1BA 1EY4A 2V3NA 1GB1A 5M9OA 1ZEQX 4N59A 2W55A 1MBYA 3LXFA 5BMIA 3VYRA 2H88B 1L0VB 1II3A 3QJYA 2ZW0A 3SVMA 1NI3A 3A8IE 4RF1A 5C4XB 4MN3A 5HGTA 1CK1A 1ENFA 3NHHA 3CHBD 2A6HD 1N61A 2H4OA 3EQLC 2AQ3B 2F3WA 4LK1C 3OIPA 1BUVT 4XTCS 5E3FA 4DAYA 2F0QA 2QJLA 2E2HB 4OIKA 4LTUA 3CU7A 3GTMB 3HUIA 2JSOA 2WXMA 1SNCA 1FFVA 1SYFA 2JA8B 5KNCA 1F2MA 2X6LA 3V3XA 1Y1WB 3QO2A 2I07B 1JQ4A 2AWOA 1AWDA 3S9WA 3K59A 1RDPD 1JWAD 1Z7TA 4WFN3 1ILQA 1X3PA 1A70A 1ZKOA 2NYZD 1QNUA