5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
4Z9CB 1LTRD 1PTOH 1SJED 1AN8A 1LTTD 2XNAC 4RGMA 4UDUC 1CQVA 1ESFA 1FNVA 5ELBA 1S5CD 1PYWD 5ELDA 4ZYSA 1EWCA 3R8BA 1LTBD 1JWSD 2XN9C 3R2TA 1XTCD 3MFGA 4OHJA 1MD2D 1FD7D 1UUPA 3BVMA 3BYYB 1PRTB 1XXGA 1BCPB 1I4HA 1LTSD 4L63B 1PTOC 1M4VA 3BYTB 1F77A 1L0YB 1EEFD 2AQ3B 1S5DD 1SXTA 1CHQD 1FNUA 4RHSA 5D3IB 1SE2A 1V1OA 4RCOA 3BZDB 1I4RA 1PRTD 1YN5A 1L0XB 1D5ZC 3DWAA 1YN3A 1D5MC 1FNWA 2IPKD 5ELEA 1JQYD 2Z8LA 1KTKA 2J4XA 4K6LA 1I4GA 1LTAD 1HTLD 1ENFA 1S5FD 1EEID 1I4XA 2SEBD 5I4DA 1PTOF 4RFBA 1LT4D 1I4PA 1TS4A 2O2LD 1TS2A 1PRTC 4C56C 1HXYD 3O13A 3URYA 1B1ZA 1LT5D 1PTOB 1I4QA 2QILA 5FK9C 2R61A 4O1NA 4RGTA 1BXTA 5ELCA 1DYQA 2CHBD 1PZJD 3BVGA 3W2DA 1S5BD 3MC0B 1TY2A 1PTOD 2XRQD 1RCVD 1RDPD 1TS5A 2RDHA 3DWQA 1KLGD 1LLRD 1SBBB 3EFXD 1EU4A 3BVZA 1D6EC 1TY0A 3DWPA 4BWGB 1LO5D 1CT1D 1DJRD 1FGBD 1LTGD 2WV6D 4RHRA 1D5XC 1EFID 4TSSA 2IJ0A 1TS3A 1BCPD 1HA5A 1ET6A 3EA6A 1BCPF 2QEJC 1G8ZD 1PRTF 1V1PA 1CK1A 2AQ1B 1STEA 4L6TB 3TSSA 3KLSX 1AW7A 5D3DA 5ELFA 4DXFA 1JCKB 1LT6D 1RF2D 3GP7A 3R2IA 1YN4A 1T5XD 2NTSA 4RGNA 5FKAC 1SE4A 1ET9A 1HQRD 2NTTA 2RDGA 1UNSA 1BCPC 4DXGA 4NZLB 1JWMD 1PZKD 2TSSA 1GOZA 2XRSD 3CHBD 1LT3D 1SJHD 1SEBD 1PZID 1JWUD 1RD9D 1S5ED 4RGOS 1QILA 3V05A 1JR0D 1V1PB 1EU3A 1LTID 5TSSA 3OWEB 1B44D 1SE3A 3SEBA 1KLUD 4RH6A 1CHPD 2ICIA 2G9HD 2AQ2B
chains in the Genus database with same CATH superfamily
1CUKA 4IJLA 4HJ5A 1AN8A 3CRKC 3HOXH 1F52A 4LJPB 3J81c 4JOIA 3W3AA 1HUNA 2L32A 3RLOA 3KLSA 3RULA 1VQ7A 3R8BA 4DR7L 1LTBD 4ILWA 5DM73 3M3YH 5FO8B 1Z9FA 4LFBQ 4CKBA 2B2VC 3LGJA 2DZJA 5IN7A 1TTNA 3RZDB 3AEAB 2OXPA 1CM9A 5C6AA 2N3SA 5BR8Q 2CU1A 2KX0A 2F0OA 5KHQA 3KF6B 3JW0X 3IAS1 1X9NA 1B9NA 2WXQA 1VQIA 1ESRA 1SNQA 2GMIC 2JYEA 3L08A 4P6VF 5HGTA 2EYJA 5IE8A 2DWQA 2HIVA 4B3SL 3GTKH 1QE6A 3TMPB 5LL6X 2JQOA 1SDFA 2K6DB 1RWSA 1E8XA 3RT3B 3KUZA 1SE2A 5IYBH 4RCOA 5M3MG 4DV0L 3SFEB 4GKKQ 2HJ8A 1OO9B 4HCPB 4HPLB 3PIPA 3KYDD 4EEWA 2K5PA 2Y5BB 1SYBA 5LMUQ 3C2PA 2J7ZA 1D5MC 4G7ZC 3PLVA 3ETRA 2KQ7A 2RD0A 5C4XB 5DLQE 1N63A 3EJIA 4K6LA 1SYDA 5HKHA 2A6ED 3WIMA 3K58A 2A5HA 1TWGB 1GJZA 2Y0SE 4J15A 1HZBA 3VHTC 2KQ4X 1HZ5A 1GM5A 1E5WA 1II3A 2BF8B 3DHGC 2A19A 3T1YQ 4DK5A 1UELA 5GMVA 1OXTA 2QILA 1WJUA 1F9PA 1G6JA 5AUIA 4XYOA 1YJWA 2A1AA 2GVAA 4OZAA 2OCEA 3S2HB 3RZDH 4NP5A 3DPDA 1T0YA 3GS2A 4OVUA 1UE1A 5C3WA 1LACA 1TS5A 3GD7A 2FE8A 1KLGD 1H9JA 3PO2G 4ZRQA 2LSSA 2E76C 4C3IB 1HZCA 1FGBD 2WV6D 2JP1A 1FXTB 1YX6B 2KTRA 4HLEA 1TS3A 1SB3C 3K6OA 4KN7C 4I7ZC 4JI1L 4X66L 1WRDB 1WCMG 2J0JA 2JXTA 4HN7A 1U4LA 1KQSA 1QZHA 5K36G 5D3DA 1F2YA 1HUMA 4FHJA 1IKLA 1HZ9A 2JN4A 3F2UA 4GU2A 2EYPA 2YV5A 3KF8A 3JAML 1EM7A 2VZKD 4A3OA 4IFDI 1ET9A 3RZOB 1SRUA 2VQEL 2IX3A 2BGFA 4S17A 4IM3A 5D7GA 3G6JB 4HJ7A 4BBNC 4NQLB 1UD7A 1V97A 1ACCA 3VTVA 1HE8A 3TEHB 2IYDB 4KIKA 1I42A 4DUYL 2L0TA 1GOZA 3S24A 4K0KQ 2B2TA 2E5LQ 2L4NA 5GAGC 1ILPA 1V49A 3AI5A 1IW7D 3AE3B 1TZ1A 1HCZA 5IGGA 2NS5A 1BKBA 1PFMA 5CYUA 4HROA 2ES2A 4CDCC 3U52E 5CV8A 4JWSC 2F0TA 3FKIH 3TS0A 1N8RC 1A62A 3PUZA 2F3VA 3ZNGC 3W9CB 2EY2A 4JV5Q 2I46A 3A0JA 3R66C 1EWCA 4FF3A 4LCDE 3KOJA 2K50A 3OMGA 4DR6L 3L13A 2WKCA 2V4LA 2CHXA 2UUCQ 4OONA 2AUKA 1FD7D 5AJ3Q 3W5OA 1XPRA 3G7LA 2NPTA 2MPMA 4OWTB 1HR0L 5J22A 1TWCB 4HJKA 2ZVOA 1U0LA 3JYUA 3MP9A 4QAYA 1N36L 1G2SA 2EPBA 2AQ3B 5IYCG 4JCVE 2VUMH 3MXUA 1R4NI 4YTNB 3S1QH 2DY8A 1O7IA 4JL9A 1WE6A 4W9HA 1L1OC 4NXNQ 3J7AF 2YYZA 1ENCA 1I4RA 5KRUA 3AEFB 2YTXA 1Y1WG 2VZKB 2ZT9C 4N59A 1KDBA 2CKZB 2UXDQ 1ZOYB 1X65A 3K5NA 1GPXA 1STGA 3GTPH 1CKNA 3E3XA 4BBSH 1JE4A 1P16A 5T1IA 1IUEA 2N88A 3VR2A 1P9DU 2MCNB 3K9PB 2UXCL 4DHJB 2N49A 2HTME 4AP4C 4OO1G 3H3VH 1PTOF 4FF1A 2R2QA 1NYQA 4C56C 5J2RA 2MBHA 3ZNID 2A68C 1H4RA 4N9F4 4XYCA 5FO7B 1PH2A 4IOCA 3S17H 3CU7A 3SE0A 3SR1A 3R7RA 1K52A 2ZNVC 2KK8A 1F1HA 2KQSA 2HD5B 1Y1WB 1WYWB 1PZJD 2JA8B 1O7YA 4KN4C 2LUMA 5KHOA 1RCVD 4JYAL 3VYTA 1WGDA 2UU9L 1TBEA 2J42A 5BMIA 1MJEA 3HM6X 5JJIA 3E9SA 4GLAC 1TWCH 2LGDA 1YNND 4EQNA 1LTGD 2I5MX 3VDZA 2L00B 3T9LA 5HHDG 4A3GH 4HRSA 3QK0A 4JC0A 1HH2P 4YCVA 1IBKL 2B2UA 2VUMB 4B0EA 2Z0EB 3SU8X 5IWAL 5IGCA 3AXCA 3I63C 3QX1A 3E9IA 1MJDA 2A74C 2PNRC 3K8AA 4AIMA 3A33B 3B9JA 2GA4B 2Q2TA 1NR4A 3KK7A 4MIUA 3OTOQ 3QJYA 1DGJA 1H95A 4DDID 1HJPA 2Z4HA 4BBSB 2M9VA 4APVA 1EY5A 2N9XA 4B3RL 1RLFA 1F9QA 3E9HA 1RM6C 1T9HA 4K8IA 1CI3M 1SYFA 2LMCB 3D0FA 3Q8AA 3HVDA 3S14B 3NQTA 4C3JB 2J52A 3APFA 2XRSD 1LM8B 3SD5A 2KECA 4GN3B 4KHPQ 4W9KA 3S16H 5JXVA 2PZWA 2VUMG 2V1CC 1HRJA 2F4VQ 1E8ZA 4QF4A 4M8MA 1NDDA 4LLGM 1MHHE 1STBA 3Q6SA 4PMBA 1WR1A 2G4SA 5TR5A 1PTOH 4UDUC 5M3MB 1Z47A 2D9UA 2FINB 2MJ8A 2R3ZA 4L5RC 1FNVA 3K81C 4B9KA 1AE2A 4FLHA 4A3BH 1PGAA 2WXPA 3IFWB 3ULJA 1XT9B 4EQPA 3P4SB 3NSWA 4R8IA 2EYFA 2R7ZG 5C4XG 5E6OA 4A3GB 1LM0A 2BW2A 1EQVA 1KL9A 5MPOA 1BDOA 2I5LX 1AFPA 1SR3A 1P3QU 1R4QB 2MQHA 4GIVA 2AYOB 2PE9A 1XMOQ 2ZPYA 3W1YA 3KVFB 1EQTA 1I4HA 3KLRA 3TN2A 3UDXA 5FLXE 5EGTA 4DR2Q 4CJ1B 1S72A 2IY5B 1EEFD 3C1FA 2B63H 3RUIB 5C3JB 3HOZB 3G48A 1V43A 2ZXOA 4NNJB 2Q2HA 1VQ8A 5DPTA 2IDYA 2D0PA 3VQIA 3NBHB 4QJFA 2JF5A 1VQ6A 2Z6KC 1VR9A 4WRDA 3RD2A 2XGTA 1AYFA 4DR6Q 2E6XA 4FADA 1F2RC 2Y0SB 4BY1B 2QDFA 3PVLA 3S16B 3Q22A 3RI7C 1HHVA 5K5PA 2RCFA 3O65B 3T56B 1N32Q 3QIJA 3I9V1 1WXAA 3P7JA 1TS2A 1VF5C 1VQKA 4PQXA 1RYJA 5H8YE 2LRUA 3HUIA 4MDKE 5J1ZA 1U4PA 3O13A 3PUXA 1XNQQ 4US9A 4LF8Q 1WCMB 1PTOB 1IBML 2KN5A 1E2ZA 3CMAA 1TR5A 2K6QA 5EBCA 5FR3A 4RGTA 2RPVA 1R7SA 3A4SC 4ARIA 1YBYA 2JK8A 3Q2AC 3TZUA 3RNEC 1XQQA 1KRTA 5I6YA 3VRBB 4DV0Q 4A6QA 3HFZB 2KO3A 4DAMA 2D3CA 4JLCA 3QA8A 3BDOA 5HG2A 2RDHA 2D62A 3Q8DA 3ZIMA 5CORA 5EAYA 2PEAA 1ZP0B 4DHZB 2QJLA 4N6EB 3PZDA 3A1QB 4AYBB 4WWMA 3Q3MC 3VR3A 2AWTA 1YQBA 2EY6A 2G4DB 3APDA 1YI2A 4TKNA 5E6NA 1IL2A 2CHZA 1TT5B 2IGDA 3X3NA 2IGGA 2J53A 3IKJA 3V96A 3N1ZC 2KDFB 4DR4Q 2MJ3A 2JXXA 4ZRIA 1OTCA 5EJWA 1SSOA 3QOJA 2E75C 3MC9A 3PT2B 5FO9B 2NTTA 2MRPA 4IUVA 1NENB 2K05A 4JYAQ 4HEDA 3Q8FA 2F0QA 3G4SA 1AP0A 3L7ZC 4C3IG 4H44C 4PMWA 1WTOA 2ZJRA 2WXFA 3T8MA 2L0CA 1N9WA 1O80A 2KEEA 3GOEA 4NJCA 4B3ML 1WCMH 2HDEA 4OVZA 4IOIE 2ZM6Q 4WWOA 1EUVB 4LF6Q 2D2QA 3A9KB 4EX5A 3NK9A 2X8XX 4MNOA 3J80i 1U4MA 2LHEA 5BYSA 4HKQA 5EE9A 1XO3A 4DV6Q 4ASWC 3FP9A 3VUYA 1KAWA 2DLBA 2OJWA 3CAMA 1OXVA 3NEMA 3W1GA 1ESFA 3F2BA 2NBUA 3ZW3A 2EMTA 5BN5A 1IW7C 2PO4A 1WMHA 2WXJA 3A9JA 3BIID 2LFNA 3HOWG 4KDLB 5M5XB 1XNRL 3FC4A 3U4VA 3DBSA 5EE3A 3D8GA 1HZAA 2MX2A 3EFUA 1QUQA 3Q69A 3AYHB 5E7NA 4DUYQ 4F88A 5KIXA 1CZWA 1HQMC 1KABA 5KNBA 4EZLA 3I4MG 1ENAA 3RD4A 4IOAA 4MN3A 1S5DD 4OEMB 3PF5A 5E6JA 2SNMA 4C2MB 3ZQ4A 4J1MA 4QB4A 2R92G 1O7LA 1E9MA 1L4ZB 4ICUA 1YJ9A 2E2HH 3VTWA 1P7FA 3GV6A 5D14A 1BBWA 4M02A 1E3PA 3X0WA 2PZUA 5KEEA 4ZYNA 4DXAB 2KCNA 2JA6H 1P98A 3MA2B 1PFDA 4BKTA 1IXRA 5IT9c 2JJQA 5EKIA 3CD6A 3RNAC 4BY7G 2QIEB 1PQSA 4F1SA 1WVLA 3NTHA 2VL6A 2FFKB 2EY1A 3SHLA 3AE1B 3DBRB 2H1EA 3U7ZA 4N58A 4NDXA 1WTVA 3EECA 3H7PA 2KA7A 4LTUA 3IAM1 1Y8OB 4DUZQ 1FPYA 2JQRB 4A3DB 2KAJA 2B2YA 4DNTB 3CCUA 3ITPA 1N36Q 3I55A 1HNXQ 1HNZQ 2MQJA 3DBRI 4MM3A 4B95A 2O4XA 2ZZPB 2DNFA 3AH7A 2BYEA 1HNXL 4W9LA 2ZW1A 4IO9A 4PS3A 1BBUA 1E22A 1L2NA 4JI3L 2IGHA 1S5BD 3RMHA 4KKIA 2FXQA 5D94A 5JHAA 3BVZA 2Z4IA 5G3LD 1U4RA 1JWAD 1TVXA 4FXCA 1CT1D 1FYCA 3VR9B 2GBNA 2FCSA 3R3OA 1STYA 4JV5L 2ZXPA 1HNZL 2LVPA 2EYHA 2F0PA 2JYOA 1J5EQ 1JRPA 2A6HC 3MXPA 5IODA 3HOVH 1FRDA 2LGIA 5CGKA 3KW5B 3QARA 2NVXH 4LDTD 2QGQA 2KMAA 1WX8A 3S2AA 4A3FH 2LXKA 1ILQA 3AN1A 4CHKA 2E2HB 4MSQB 2MP2B 4X3SA 4MELA 3PS6A 1KD1C 4GKJQ 4XT3B 1D4BA 3MEFA 4B9WA 2BKFA 2MBBB 1QCBD 4DK0A 3ZNHB 1HQRD 4AQYL 2RMMA 3UQBA 1KF6B 1L7YA 2DYOA 2X38A 2PIAA 3N20C 1JWMD 1ROEA 1QOFA 2N7EA 4MT5A 1Z2MA 1A8VA 1SJHD 1VMPA 3TP8A 1VQMA 1GUTA 4IPCA 4FNFA 1UAPA 4IPDA 1JWUD 2EXZA 2HQEA 3FRPB 1MFWA 1N62A 2D5GA 3DVNU 4YSYB 3L4PA 1ONLA 1XLPA 4CJ2C 4ZUJA 2NZOA 2HIXA 2D2CC 2DAFA 3EGRA 2A69C 1B44D 1SE3A 5IAAC 3UINB 2MA9B 2JWZA 4RKBA 3ND8A 1BR9A 3M9BA 4MZ9A 2OQ0A 4WJWA 4X3UA 4YWKA 5C3EH 3GTMB 2XNAC 2AHOB 2W54A 4NXML 3M3JA 1F0ZA 2MJEA 5ELBA 2WXLA 4LUZA 2D3BA 5ELDA 2NPTB 3ZXVA 2N7DA 4ZDVA 1T5EA 1ASYA 4XGAB 2XWJB 1EY0A 2XN9C 3AMUA 1EY4A 4YTPB 2Y0SG 3DHQA 4B3RQ 5EQ0A 4CDDC 1X3EA 3DBLB 4GN1A 4R4OA 2NVXB 3VA5A 3DM3A 1ZE3D 1SMXA 1TXYA 3HK0A 3J9CA 5CV9A 5IKCM 1YZ6A 2K25A 4J6HA 2X6GA 3PGZA 2KTFA 2GRIA 1QWYA 1NBFC 5IP9G 2BA1A 4BZAA 2A4ZA 3B0AA 2F0DA 2ZJDA 3HKZB 3KQ4A 2EJMA 2F0FA 3H0GB 4JIOU 1LQBA 3WOEA 3KUPA 1QJOA 5JEAG 1UGMA 3U2SC 2KXJA 4K2KA 2KLGA 2J4XA 3MXNB 4A3GG 2PTLA 1RODA 2MP1A 2JY6A 1WXMA 4NPNA 1CJEA 4TV3A 1QVCA 2ALYB 1HTLD 5G3LF 3JAMc 4IFDJ 4GZYC 4FBJB 4LNKA 3A8JE 1IBXB 4ITKA 3GTMH 3R93A 3IT4B 1B3AA 1LT5D 4IWQA 4P16A 3M4YA 4LFCQ 3EROA 2BYFA 3K0YA 2RPQA 2R61A 3NS8A 4UAIA 2BB6A 1C4QA 2V4DA 1VRAB 2V3NA 3L54A 3X23A 4LF4L 1QLBB 2Q8IB 3I56A 1PDXA 2O2VB 4QMGA 4HWIB 4LFAQ 1IYJB 3NP8A 5DPWA 4UHVA 1TY2A 4DN4M 4K3CA 3P75A 3DWQA 1RKNA 1LLRD 2WAQG 3AU5A 1CKNB 2N78A 4A93B 1KM7A 2D10A 5IGDA 2UXBL 2VB3X 4Q5VA 5IO9A 4C4VA 1RTNA 4GDLA 2G1EA 1CK1A 1FJGL 5GROA 2L5TA 2MO1A 3H0GH 1HFNA 1T0SC 3Q14C 2DZMA 2WACA 1W6KA 1EIGA 3A8KE 2VQFQ 3QWNA 4HTHA 1WGHA 1IKMA 2IO0B 1XMOL 1X3PA 2KX3A 2LJIA 1B50A 4JBMA 3C19A 2WXKA 3UDGA 4M1UB 1F2LA 4YHHL 5LMNL 2WNMA 3RZFA 4L2YA 1B4OA 2FBWB 1WR6E 3B6YA 1Z5SB 4JVZA 2MEKA 1YNTE 1TWGH 3NOBA 4AYBE 3ZJUA 2L76A 3TBIB 4WJPA 2N9EB 3IXSA 1WY8A 2INNE 2TSSA 2BS3B 1VQ9A 1VQ4A 1U5KA 1QOBA 4A20A 2MSED 5C4JB 4LUVA 1MSGA 1BNZA 3V05A 3H94A 2KJXA 3SFDB 1EOTA 2F0HA 3UDIA 4YWLA 4JI5L 1UWXA 1LXDA 4F7ZA 1TIID 1IYVA 4RH6A 1ZKHA 3U9SA 2A5UA 3CPWA 4DPGA 2LXAA 3WALA 3SK6A 2WQYB 2K14A 2RBMA 1N32L 4L23A 3H09A 1ZEQX 4X65L 3D32A 4CDEC 2WU2B 1PYWD 4MJSB 2KTRB 4JK1C 2YTYA 4ZYSA 4C3IH 1FFUA 3A9JB 1WMHB 4RM8A 1OXSC 2WIIB 1N33Q 1IP9A 1FCCC 3UI3A 2CVRA 2OF1A 2PNHA 1STAA 4TQ1A 3TEZA 4A3CG 4BY7B 2V0GA 2DBYA 4KZ0A 3OJ3A 5AUKA 3BDCA 1EWIA 4KY5A 1WI5A 1L1OA 2YTVA 2PJHA 3H1UA 1L5PA 4ZK9B 1PH3A 3H15A 4ZOHC 2FHTA 3WOFA 4ALPA 3AV8A 4JWUC 3HKZE 3CSFA 4K8JA 3H6NA 3RZOH 2NZ1D 2D11A 4PZ7A 3CMMB 4OXPA 5IYBG 1X3GA 1CQFA 2IPKD 3H8HA 3Q23A 3J80L 2BH8A 1TYGB 5HGQA 1GG3A 2GB1A 4PYZA 3MJ5A 4A3IG 5C4JH 1JQ4A 4GB9A 1BUIC 1SNDA 1WGKA 1TKYA 5EKKA 2V3PA 1I4PA 2M4NA 1E7ZA 3Q3OC 4XC2A 1VDZA 3N3KB 4G0NB 3FKIB 1V6EA 4URKA 4AJYB 4S0RA 3BK1A 4R4CA 2XTIA 1OQRA 2JZPA 3HOYH 2LUEA 1A3UA 4A9AA 5ELCA 4DV4Q 1PGXA 2CFMA 2CW0C 1BO0A 4M01A 2EELA 4LF5L 3M62B 2F0KA 2LKVA 2N9KA 1EZ6A 4WWPA 3TEWA 1Z6HA 2ICEC 1YMHE 3VYUA 1RJTA 2B2VA 3L2PA 4BY7H 1JRUA 4QUCA 1YQ3B 1SBBB 3S1MB 1EU4A 3DWPA 3LB8C 3ZTCA 1XF5L 2F0UA 4DKAC 2GLSA 2K8CA 3BWUD 3TMEA 1VQGA 1J7BA 2KYWA 2ZNVB 3CC7A 2E5LL 1GKHA 2ZJPA 4TSSA 3OMCA 3GE8C 1YHBA 4LFCL 1X56A 3J81E 1TZOA 4ANXA 1BCPF 5L83A 1K8MA 4KV2A 1VQJA 2BDNA 2MBOA 3NVYA 3ZDTA 4TQ0A 4DDGD 4IC7B 2M0XA 5EDSA 1X1MA 2FMMA 2O2VA 1K53A 3GTPB 1YOVB 4RGNA 4OELB 3N1YC 1V86A 4IN3A 2A6HD 4JG2A 3HRDD 2JUOA 2H4OA 4A3CH 1L0VB 4HSPA 3I5JC 2KHJA 1WH3A 3VUXA 4W9JA 4HKZE 4MHEA 4DV3L 4XE0A 1LTLA 1H9SB 3PZ7A 1MBYA 2R7FA 1RD9D 2K33A 1NTGA 2FNJB 3IAYA 2WWZA 4LF9L 4YCWA 2FCNA 3T1HQ 2F0WA 1Q3LA 3HOYB 3DBHI 4RM9A 1DM0B 4YWMA 2ICIA 1PFBA 1WJNA 3GDEA 2Y5PA 1XLOA 5M3FB 1LTTD 2GBKA 2RSOA 1CQVA 1E7VA 1XCQL 1L4DB 3TL5A 3L0OA 2A68D 3PQIA 1BMLC 4LF9Q 2IL8A 1HA6A 1T3QA 4E3CA 1XMQQ 2HDMA 2UWQA 2A69D 4AQYQ 1UBQA 1MD2D 1VZ7A 4G7HC 2GBRA 5CMDA 2L12A 1PRTB 1PH9A 1LTSD 2ENBA 3AECB 2PE6B 5DPSA 3NJTA 4POFA 4IKGA 1Y14B 2IX1A 2JA9A 4JI5Q 4BA1I 2PLPA 2Z6BA 4GXBA 3J81i 2FIDA 4FDBA 4RHSA 2DYBA 3RYTA 4ABNA 3FEWX 2BKRB 2EVBA 1EWYC 1C77A 2KMCA 4KKTA 3QWZB 4GS3A 1WTWA 1J5EL 5C4ZA 3DVGX 2JYTA 1WD1A 3DEPA 2PQEA 1T6BX 3A7LA 3N6RA 3S14H 4WH4A 4WFN3 3NE5B 1I5FA 4DK3C 3AEEB 3CWIA 2L05A 4II3B 5JJLA 3SR6A 1WOCA 1EEID 1UE7A 1I4XA 5CBAE 4RFBA 1YNXA 1NMGA 3OW2A 5C0XH 1EF5A 2KWVB 3NVWA 4NJ7A 1VQBA 2J0KA 1NAPA 3HRZC 3PUWA 3CCEA 3M85A 1B1ZA 5M3FH 3NBIA 4NB3A 2I0QA 4PMCA 4Y7NH 4YTMB 3A55A 3K5OA 3U4ZA 3Q3FA 2OT2A 3LWEA 4UPAA 1EY7A 1FVIA 2WS3B 2YLMA 5BN3A 3PMFA 2EYOA 3V62A 2CHBD 4W9EA 5IGBA 4X3TA 2EE1A 2RF4A 1SIJA 2DUDA 4E6IA 2PVOD 1PTOD 4R8NA 1WGGA 5COYA 2FUG1 1PH6A 4FYDA 1VQCA 2IHEA 1RFKA 2LASA 3RNFC 5DNFA 1VQHA 2M17A 4RHRA 3P42A 2VNUD 2KANA 1JOOA 4IUMB 2B63B 3CQZH 1GNUA 3HOZH 4BVUC 3D6WA 1WM3A 2WYQA 4K81A 1YD8U 1ZDVA 3QB3A 4DR5Q 3FPUB 1K0SA 4MEMA 1W6JA 3DMUA 3J7ZC 2DENB 2INCC 5FR6A 1LT6D 3TIXA 4LF5Q 4KD4A 1P1AA 3R2IA 4JI2L 2K5NA 1S3OA 1QVGA 4KVGB 4X64L 4AWJA 4BY1H 1XEEA 3K57A 4U68A 4ME3A 3LWUA 4JI1Q 4X66Q 3ERSX 2D3GA 4JGHB 1BBXC 4P2CB 4A3EG 4MSMB 1B9MA 2QDLA 3CRLC 4JI6Q 4OX9L 3NPPA 3J7A5 1AZQA 4A8XC 3PUYA 5H92C 5LNK1 4GDKB 2AL3A 1IHZA 2JE6I 4Y7NB 1EU3A 1NVID 2VH1A 5LLIA 1DOXA 3IL8A 4TVAB 1DOIA 1EY6A 3KDFB 4KK7A 1E8WA 4DNRB 4NMZA 4A3KB 3PRMB 4YL8A 5L95C 2F0SA 3NELA 2UYZB 1Q10A 3WA0A 4A55A 4HJ9A 3QC8B 3D4DA 2J7QB 2IHFA 1UEAB 1ZXIA 3BINA 3SK8A 5AFWA 2SOBA 3UDFA 2HTHA 5ELOA 1STNA 1XTCD 5CHWA 4B3TQ 1ZKOA 2Q2IA 1WRIA 3CQZB 1ML0D 2F52A 3PO2H 1CMXB 2F0NA 4PZ6A 4IM0A 3CCSA 3RN2A 3I8ZA 1Q81C 3HP3A 2LGYA 2O6VB 2XBBC 1KHIA 2EXDA 3A7AB 3L3OC 1LGRA 4UP8A 3AE6B 4POGA 1KXLA 1PV4A 1JJGA 2ASQA 3I70A 2G3QB 2IO3B 1FO4A 3M7GA 2R93H 4KSLC 2Z1CA 3TBLD 1X3FA 4KMUC 3NBHA 2WXGA 4DAPA 4DV5Q 1WTPA 1H9KA 3U8ZA 2M1MA 2K52A 4B08A 2MWSB 3OAWA 1MHXA 5ELEA 2DHZA 1KTKA 4C4VB 3Q6BA 4E71A 2ZTEA 5C1ZA 2PMVA 3D31A 1S1QB 1E7UA 2VS1A 4IJHA 2MFIA 1B3QA 4OO1H 4A3KH 1SROA 3IHPC 3QQ8B 5JOBA 4FXKC 2WXRA 1B9RA 1I4QA 4KKSA 5CTRC 3D6CA 5I9OA 5HFYA 4WWNA 2WDVB 1V1QA 3NG0A 4U673 4BA2I 3PGEA 1BXTA 1SFOH 4ZKBB 5BR8L 3FILA 2MH7A 2HT1A 4IZ8A 4BKSD 3DLLA 4W9GA 1VMCA 1SSNA 3S1RB 1QVFA 1C48A 1N5XA 1A2UA 2NVTB 4BWGB 3AE2B 4X65Q 1H9RA 4O42A 2DYMA 1ZYRC 2F0EA 1VS0A 2ID0A 4JW0A 4A3PA 2IJ0A 3UE1A 2ZTCA 5GAHC 2JA5B 4L5QA 1BCPD 3FMCA 2KFKB 2O6VD 2B3AA 2WXMA 3K0XA 1GVPA 4C2MH 5DPRA 2CW0D 2KQ3A 1TQOA 2R93B 5LMNW 2UUBL 4R1JA 1U4AA 1STEA 3KLSX 2HCIA 1NI2A 2DZIA 4I7AA 3GTLH 2C7MB 1E1OA 2KNBA 3GP7A 4GKKL 3BZCA 2D0OA 1KJTA 2JA6B 3BS1A 4DV1Q 4LDTB 2NVYB 1PYBA 2QW7A 4K2LA 3AEBB 2PKOA 4JI4Q 2DJFC 4NJ6A 3VTUA 4DR1L 3HOVG 4H13C 1SYEA 4DGZA 5IGEA 3PTFC 1VQDA 1GUWA 3GTGH 2KJRA 4IW0A 1WZ3A 1PA6A 2I5HA 4FA6A 1GB1A 4FVMA 5I9PA 4XQJA 5IYDG 3PO3G 3SDLC 4V0BA 1EO6A 2E74C 1DOMA 4RAUC 1G6ZA 3PRZA 4A3DH 5EPJA 1CFMA 3K5MA 3CF5A 3BK2A 2L11A 5JVH3 1SFOB 5FJ8H 1GC7A 1V5OA 3ZNZB 2AQ2B 3HKZG 4FO2A 1STHA 2XWBB 4Z9CB 3ZTDA 1CTMA 4LNIA 4DV4L 1IBLL 2PPBC 2NZHA 1RL2A 4JI2Q 2W3RA 1W3SA 5IY0A 4DV6L 3DEOA 2KCMA 3AU7A 5IP7H 2JA8G 1A0IA 3KLWA 1P8LA 3VR5A 4DV7Q 3RLFA 2EYLA 3ZVVA 3CCQA 3HOVB 3TDQA 2INPE 4F87A 4MJSA 2K32A 4AYBG 3DWGC 5CHVC 3OHXC 1SMYD 3I91A 4A3FB 1SE8A 1BCPB 5C0XJ 2L8JA 4R4TA 1LUZA 2K04A 4L63B 1Q1BA 1VQLA 3EFCA 3NTIA 3NZ3A 2EIFA 3TCAA 1L0YB 4NAWB 2BS2B 1SXTA 1QG7A 4KLKA 1D1IA 5D3IB 1Y69U 3VUWA 4ACFA 1EOVA 1QZGA 2NVYH 4MM3B 5JZEB 1JORA 3EVQA 1KRHA 2NBVB 4YSXB 2WX0A 5G5HA 3PV1A 1QOAA 4QCLA 2HJ1A 2G45B 1JQYD 1KDCA 4GNXB 3GTGB 1QB5D 1Q8KA 1QQRA 3SXHA 2B2WA 1WXVA 2NUCA 3EQLC 2PI2A 1TWFB 1V8QA 1ZGUB 3AE4B 5IOCA 3MTNB 4MGZE 2ON8A 1YITA 2EDGA 3LDZE 3MAQA 4EE2A 1D1KA 3I3TB 3GO5A 2HCCA 3K80C 3CF6E 2IW3A 2KVRA 4MACA 2LVQA 4FHKA 4KSKC 1FCLA 1HPCA 3M4PA 1EIFA 3RR5A 2IY0B 2NVQH 5LMNQ 4HAEA 4DV5L 1ASZA 1UE6A 1GC6A 3E56A 4RNAA 1WI0A 4BAXA 4P74A 1VQEA 1ZXHA 5C3EG 3HHMA 2KVMA 3ZJTA 2UXCQ 2P5ZX 2CKHB 3FILB 2E2DC 1KFYB 1SLJA 3FAHA 1YHQA 1L2FA 2PMZB 2N9LA 1FM0D 3WAPA 3CW2C 4TMAB 1ZXTA 5EBDA 1PFNA 4LNNA 3AE9B 3S9WA 4IURA 4CDFC 4A3EB 3E5SA 3QR8A 1KIXA 2N7JA 3PHWB 1HR0Q 4QUFA 3RLNA 4HJ8A 4R4IA 3I4MB 2V3SA 3I72A 1N60A 3TSSA 1ICFB 1R4MI 2WGSA 4WJQA 4RF0A 1C3TA 4H0LC 5GADC 3GTQB 2JRHA 3CCJA 3FHWA 1XJVA 3TS2A 3GZNB 4K7WA 5BMGA 3I90A 3NHEB 3NRZA 1GUAB 4IM2A 1UF0A 2PPHA 4DQOC 3ZUNA 3H3VC 2IX0A 2LVOA 4MGKE 4DR3Q 4ANUA 5G2NA 3TJPA 1TWFH 4DR7Q 3U50C 3S15H 1QUQB 1CA6A 2RA4A 2XVSA 1J6QA 2SNSA 2I38A 2KWDA 5D65A 1KH0A 3C0RB 2SAKA 1D2BA 2L83A 1YEZA 1A70A 3ZYYX 2UUBQ 2KDMA 4BXXG 4A3JG 1C4CA 5CBEE 1VZ6A 1E24A 1LTRD 2QEXA 2NBWB 2ZCBA 1XWEA 1QKZA 1KNEA 2G5DA 1WD0A 1E7PB 2AMCB 1NY4A 3DVNV 4JI7L 2HD3A 1QNUA 3APCA 5GQOA 1HTPA 2I07B 2BTEA 5IGFA 4A93H 1K28A 4JI4L 4LF6L 4A3EH 3EC8A 2IO2B 2BT6A 2KHIA 5GXGB 3NVZA 4OWXB 1RIPA 3J7AV 1K0RA 3VYRA 2CHWA 4HXDA 5G5GA 2JA7G 4IFDH 1V80A 1Y1VH 1TWHH 4N8X1 4BOSC 3A56A 4EOYA 1X55A 5IWAQ 3ZLZA 3GTQH 1MJCA 2F3IA 3N52A 5JPNC 1EYGA 4IUPA 2BOSA 3OYYA 1WJ6A 2K03A 1JALA 4MGYE 4PK1A 2WB1E 4BBNF 4HR7B 2Z59B 2XK5B 4QY7A 4K7SA 1TIFA 3U30A 3HS0C 4HMJA 2N1VA 5CX3A 4N9TA 1SNPA 3QOLA 4DAYB 3ENEA 2O6VA 5JPMC 3UF8A 4QIWB 2LD9A 4BBRG 5BYQA 2JA5G 2B3GA 4H7BA 1F9JA 2N9PC 1GUOA 4LNFA 1HXYD 3GQBA 4KJNA 2IZVB 2C5CA 3K5LA 5FK9C 4M00A 1QNKA 2RVLA 2WAQE 1M90C 2PZTA 1IGCA 2MBEA 2BPSA 1WTXA 2DX5B 2JZZA 5CHFA 4GOPC 2B39A 1NI3A 1OXUA 3C3LA 5JJZA 1UEBA 2XRQD 1RDPD 4B3TL 4G7OC 3NY5A 1BF4A 2HQLA 2L1BA 2VQEQ 3ML8A 3N32A 2KVZA 1Y8PB 4IPGA 1Y1VB 1XPOA 4DBGA 3T13A 3FPPA 3V60A 2BYVE 4C80A 2LJ5A 1TWHB 4JBWA 2KFKA 5J17A 1EYCA 4K0KL 3U4EG 4ICVA 2VQFL 2K7VA 3A5UA 3C46A 1OFFA 4B6WA 2ZXRA 1J7CA 2UUCL 1V1PA 3UQAA 2AQ1B 1JT8A 2RSUA 2Z0DB 3R3MA 3AULA 4ZKCB 1SF0A 3TQYA 3PREA 3VR4A 2LHDA 1K83B 3HEJA 4NW2A 4CKCA 1WJ4A 5AZFA 1WF9A 1K8RB 4HJGE 4REZA 2ZEQA 2REXA 3MZ5A 2RDGA 5LHY1 1AARA 3RPFC 2L7RA 5T1GA 1JICA 3KBGA 1BCPC 2K75A 2VXWA 4RMAA 4J8QA 4LF8L 3P4QB 5M5WH 2Z9HA 2UXDL 1D7QA 2I1JA 3IT6B 2R93G 2PVGC 2FUHB 1PH7A 2B8FA 3WAMA 1XNQL 3ECIA 3S1NH 4AUQC 5IP4D 2CH4W 3NWTA 4OZCA 3H3VI 1CHPD 3A54A 4UP9A 3V3XA 3KJPA 4GNXC 2ASBA 4A3LH 2EOTA 1JMCA 3ABVB 3VRAB 3JAME 1K73C 4DWFA 4G3XB 4GSWA 4DU9A 1NUCA 4AQ7A 1S5CD 5EPLA 1KLVA 1U9RA 3S1MH 4YIJA 1MI0A 3V6EB 1I6VC 3VA7A 3OIQA 4RCNA 3MFGA 1GO3E 4OHJA 4QIWE 3J80E 4DV1L 2K5QA 1MIUA 3AB5A 4B3MQ 3STBC 4X62L 3ZJVA 2PYKA 3DVGY 4WQMA 3PO3B 2RSNA 4GOCA 3TUOA 1UWVA 2FMCA 4F8MA 2L55A 2PQAB 2KEDA 4MH8A 2QHOA 3X3MA 2LRWA 3LXFA 1K83H 1RFAA 2L52A 1GUGA 3P1HA 3ER0A 4O2DA 3ND9A 1A3VA 2F0LA 2NN6I 4CJ0B 3DWMA 3VXWA 1NE3A 3OOCA 1FGUA 4GLXA 2KC1A 1PRTD 1YHAA 2K01A 1L0XB 3DWAA 3L9AX 4XQNA 3SVMA 3NUCA 5M5WB 2X6LA 4ZAIA 2XEWA 2JEAI 1I50B 1CKMA 3F1ZA 4K5WA 5KYLA 3CC2A 1JOKA 2Q5WD 4EFOA 4KKUA 3MC8A 5I4DA 4CKEA 5A2QL 1Q1OA 2KMMA 4LW1A 3JAMi 5EE1A 4GDKA 1A3TA 4DV7L 3S1NB 1G291 2KN4A 3KFUA 2JT4B 1Q7YC 4V190 3AU4A 1SNOA 5ELNA 3URYA 4ZUIA 3DBHB 4JBKA 2LI5A 3SK4A 3VR6A 3AFQA 3K7UC 4JI8L 1IBLQ 5IT9E 2DJGC 1WFQA 2RDFA 1E1TA 3OTOL 1YX5B 4JPBW 3W2DA 1TJEA 2RR9A 3N1XC 3UGBB 1G6PA 3M95A 4XWWA 4LFAL 1MHWC 4F7XA 1AZPA 2QA4A 1EFWA 2KLCA 1D6EC 2VZAA 3PO3H 2G9DA 2L15A 2E8GA 2WFWA 1EIHA 1WIAA 3RMKC 4L5SA 4BKGA 5E4XA 2CQAA 2K6AA 4OGQC 2DAJA 4RWSC 1PH4A 1HNWL 1IGDA 1NR2A 1PUTA 2W55A 3MEHA 3AEDB 1HA5A 3E6ZX 4MTKA 4NPSA 3KBXA 2E2IH 4FJYA 4N8FA 2NN6G 4HK2A 2L9HA 1E2WA 2DGYA 2K8BA 2C9OA 3CCMA 3AQQA 2JZ3B 2OHFA 1UWMA 2MBQA 1N34L 2RHSB 2JRIB 2BYTA 3J7YW 2UXBQ 4WORA 5FKAC 3BY4B 3ONSA 2KD0A 3ZO5B 5C5LA 1I50H 4WURA 3JSVA 4ARCA 1F9RA 4XTCS 4TRDA 4Q2JA 5JEAH 1C1YB 2PCFB 3VVWB 5FOBB 3CXCA 3W1SC 4PG3A 4KKJA 4ZRJA 2KCTA 5JVG3 4IUQA 2BQQA 1C79A 2K0PA 5C44H 5LXIB 1WGYA 4RGOS 2M56B 4HSVA 2OEOA 3FKIG 4KD3A 4LNQA 1YQ4B 2M19A 2CH4A 4IPHA 5TSSA 1JOQA 1B70B 3I4NG 4RMFA 4JI3Q 3AE5B 3MHZA 4KY6A 2QMTA 2QF7A 1SE9A 2K5HA 2JVCA 3RCZA 2LFIA 1GHJA 4DAVA 1O78A 2AWNA 1R9TB 5E6PA 1LFDA 2LWPA 3WANA 1ZDXA 4C00A 1L0WA 3U9OA 2KJ6A 3MXNA 2C5LC 3R2TA 2JXMB 3R7QA 4HIKA 2HHHL 2WDTB 3KUCB 4ID6A 1J8IA 1OEYA 3JSVB 4WQOB 2FCMA 1UUPA 4EZKA 3WCQA 1NSNS 2J0TD 4QGUA 2E2IB 4LF7Q 1OQYA 3BVMA 1MPEA 2WDRB 5A35A 4GKJL 1XXGA 3DBLI 1VQAA 2B8GA 4PS8A 4L8JA 1Q1EA 2GBMA 2KKCA 1PTOC 4DV2L 4S3SA 4GOPB 1LABA 5KNCA 2D3AA 3Q8BA 2KWCA 4KGSA 1N33L 1TKWB 3OPOA 5LMUL 3HOZG 1V1OA 2JEBI 4XIGS 1VLBA 3H0GG 1K3RA 3NHHA 1OQQA 4BBSG 3WDNA 4LF7L 1V81A 1YN5A 2WDQB 4KV6A 3B08A 1UBIA 1C78A 1P7EA 4LFBL 1YVCA 1EYAA 1SYGA 1E6EB 3UIPB 2GBJA 2OTLA 4DK6C 4BY1G 4ME5A 4R4QA 4FN2A 4P1BC 1NMFA 1ENFA 1S5FD 1JB3A 4QL5A 2Z6KA 4USAA 4ZHOA 4DAYA 1SYCA 1MGSA 3P20A 1ZUD2 1LT4D 4C3HH 2E2JB 4C7ZA 4NXMQ 4FULA 2H5XA 4KZCA 4WAAA 1WM2A 2CWAA 1YJIA 4FJVB 4B3SQ 3LNNA 3BZKA 4KX6B 4FF2A 4CBVA 1FR3A 2F0IA 1T0QC 4DR5L 1EIYB 2EJFC 4OIJA 2OQKA 5CV5A 4UY8C 2ATWA 2FAZA 4EUTA 4O1NA 4OIKA 3ML9A 5A2QE 3QCAA 4JQWC 1UZXB 3T51B 1NBWA 2CJOA 5AZGA 1N6ZA 4DR4L 4EQOA 3BVGA 3DHHC 2Q8RE 3JVZX 1XPUA 3PO2B 2W9NA 4NKLA 1QOGA 1DOYA 4EQ5A 4ZRZA 5I6WA 3IFTA 4XT1B 1PH5A 1DJRD 3M3YB 1IBKQ 4I6NB 1D5XC 1F2ZA 1XX8A 4H02A 4JI6L 4OX9Q 1JW9D 1Q0WB 4BBRB 4K1RB 1YJ1A 1ET6A 2BA0A 2J0MA 3DHIC 3EA6A 2BWES 5K36H 1R4MB 2QCZA 4IQZA 1XNRQ 4D2KA 2KWUB 3PO0A 1VQNA 4FXDA 3OW7A 3MWYW 1PYSB 5ELFA 4X64Q 5CR3A 3GTKB 4JI0L 3D3RA 1BOSA 3K7AH 4MGIE 3U7DA 3CMEA 2NTSA 5C23A 3HGBA 1JMLA 4JPSA 3M7NA 1K3BC 3DUZA 2OOBB 3TP5A 4WJNA 5AEKB 3RNBC 1PZKD 4GLVB 1VZ8A 4C3HB 2E2JH 2NB0A 2WU5B 3MFYA 1S4ZA 3NS1A 3TP6A 3VH4B 2MNAA 1S5ED 1QILA 2K5VA 5JEAJ 4K5XA 5IT9L 3PIP3 2HDLA 1JR0D 4DV3Q 4YXDB 3NWSA 2L0FA 1MG4A 2WX1A 1CZPA 1X54A 1W2BA 1RRBA 4WJ4A 1Q46A 2K9XA 1GHKA 3GV3A 3ERQA 4BKSA 1PFSA 3TP7A 1IL8A 2KDEB 2NVUI 3VH3B 1GUSA 4EVOA 4FP5D 3S1RH 3B2FA 1A63A 1EZ8A 2W3SA 4PZ8A 4YY3L 2K39A 2NVTH 1FIQA 1CA5A 2C60A 4IUNA 3TRZA 5F2DA 3H91A 4II2B 2JX5A 1VCBA 3I57A 4IUTA 2F1MA 3Q24A 1PH8A 1YJNA 1HTQA 3I4LA 3S2HH 4G4KA 4BBRH 3PIOA 2JA5H 3ULPA 2GI9A 3SHQA 3ZDMC 3NZUA 3V61A 1H9MA 5C5MA 1G91A 2NWGA 1WJJA 3BYYB 2B63G 4BOZB 2HUGA 2B2YC 3H9DA 2BS4B 3W5VB 2AUJD 3EBEA 3GTLB 4QQBX 3AE8B 2R7DA 2F3WA 4PNYA 2K1BA 2BVCA 1YNJC 3K7AB 4US8A 1HZ6A 1CHQD 1JC7A 1PHJA 2CR5A 2V4IB 1ZYRD 2M00A 4P1CC 3CPFA 1EQQA 2R92B 5IP7G 1BQQT 1GAQB 1C9FA 3F2CA 3UI2A 3STBD 4UP7A 1N61A 1D5ZC 1TGZB 2INDC 3A4RA 2HHHQ 1XLQA 1D8LA 3WAOA 1GJXA 2F0VA 5J3BA 2XIWA 2C35B 1LYLA 3CKIB 2NYZD 2CU3A 2RKSA 2F0JA 1UGJA 4C7YA 3P63A 1Y8NB 1DCZA 2DN8A 3M4QA 3PZ8A 4CYEA 1TS4A 5CV6A 3G6EA 4BS9A 2O5JC 1SNMA 4GNXA 4YWGG 1IYFA 3GTJH 1PRTC 1UH6A 3T16A 1V9PA 4HCNB 3HVZA 1VQ5A 4A3KG 1HR0W 4PT5A 4Y52H 3D4WA 1PXUA 1WX9A 5M3FG 1GUNA 4DA2A 2BE5D 2LXJA 2ZTDA 4E74A 2DY7A 1DOKA 3A8IE 2K4KA 1YIJA 3GZNI 1K8OA 3NUHB 1S3SG 1FRRA 2N1WA 4RA8A 1JE5A 1C9OA 3EN2A 1DZ1A 1C4AA 2EY5A 2MHVA 1GB4A 3N30A 3T3OA 2WKDA 2LXCA 1EYDA 3Q3NC 4P71A 3MVVA 1X3QA 3AEVA 3CSTA 4ZHPA 4W9CA 1KC8C 1FMAD 4I6LB 3Q3JA 2MLBA 1B2TA 2A8VA 2A73B 3A5ZB 2KDBA 5J39A 4HPMB 4TQUS 2QSDA 3PUVA 4A3LG 1JB7A 3T4AC 2R92H 4A3JB 4L6TB 3UIOB 1EL0A 1F2MA 4C1NI 1JCKB 2WXHA 3A1QA 3QAQA 4LJZC 4JI7Q 2YU9B 3RNCC 5GAEC 1EY8A 1SMYC 3CCRA 3DXJC 4AJWA 1J9OA 3S1QB 2CQOA 2B2TC 4LUOA 1NNXA 4DR1Q 2ZCCA 3RNUA 3ZGZA 1VCIA 4ULLA 1NYRA 2BDOA 2OTJA 1I7HA 4DXGA 2GN5A 2UU9Q 2EMSA 2MP2A 4KDIC 1KRSA 1Y8RC 2C7NB 2VH2A 1XD3B 1WYGA 3AFPA 2DNEA 3GTJB 5KNDA 1NJIC 3CP0A 4LJOB 2AEHA 5C2TB 2UUAL 5C0XG 1HFGA 3OWEB 2NVQB 3SEBA 3I4OA 2Q2UA 3AE7B 4LWCA 1JJ2A 2UUAQ 1JROA 2Q8TA 2KUMA 5FJ8G 4RGMA 4EKUA 4JE3B 2LEKA 5IOIA 3S17B 2Z0SA 1VJKA 3E0EA 4FJZA 4W9DA 2WP9B 1OEYJ 2EQSA 1V8CA 1MSHA 2LY7A 2RQXA 1Y1WH 1M1KC 1SIFA 2K1FA 2NMQA 2X69A 3C8YA 2K5WA 3CCVA 5FLMG 2JA8H 1WXQA 4KHVA 1WX7A 3PHXB 5JHBA 3HOUG 2JWUA 3I3CA 3H7PB 4PYUA 3FVQA 3I4MH 1R4PB 1HNWQ 3MHSD 3BJUA 4A3JH 1PLFA 4KHZA 4R9WA 4M8AA 3ULLA 3I4NB 2VW9A 1FJGQ 3P4RB 2YU9H 3SGIA 4WJ3M 4P7IA 3IFDA 3OSOA 1UE5A 4HMIA 4FXGC 2K8HA 3K9OB 4DHJD 4HDOA 3QIAA 4YY3Q 4ODGA 5FLXL 1N34Q 4K5VA 5T8IA 3KYHC 2JA6G 2MW5A 3ZXRA 1FNWA 3OWFA 3IRBA 3S15B 4LK0M 1XYIA 4NY0A 5D6JB 5AZHA 4A76A 3RZWC 1TKEA 3VFKA 2MUYA 3M4OB 4A3MG 3GE3C 4X3KA 4JBJA 4IFDG 3L10B 4OW0A 1Y1VG 1C7YA 2RHQB 3ZKJC 3PF4A 3HOUB 2WLBA 4C3JH 2KCCA 1K51A 3TZDA 1WXSA 4MTNA 4DUZL 2JPHA 3A9KA 2I2YA 3T1HL 2NR2A 1VQPA 2RDBC 3QHTA 3CCLA 4GMVA 2JSOA 4AH6A 2M2LA 4GGQA 5BO4B 1I94L 1RTOA 5EKLA 3JC66 2E3TA 3IVFA 1SAPA 5I2YA 2KDIA 1DYQA 1VQFA 2SDFA 3SK5A 1I94Q 3MXGA 1P0RA 2ZW0A 2KOXA 4L5TA 3KJOA 3KF6A 4NXNL 5M3MH 1WSPA 3MC0B 4J3OD 4RF1A 3PIO3 3B2GA 1OXXK 1B7YB 3W1BA 2ZJQA 5H1SE 3OLMD 1G2TA 1C76A 4A3BB 2OJRA 1AWDA 4A3MB 4B0MA 1VQOA 5DAUA 4A3FG 3I4NH 2D5DA 1L6UA 2KOLA 2CWPA 2WHIA 3N9YC 5D2MB 4WAFA 2KHSA 2QEJC 3H6MA 1I3QH 1G8ZD 1PRTF 1PVOA 2F0GA 3ALBA 2EZVA 1A6XA 4NQKE 4TUUA 5NUCA 1AEXA 5CC4A 1B8AA 3AM9A 4DXFA 3F8TA 1C4PA 4OWWB 4ZRKA 1F2RI 3OJ4B 2H89B 5E1FA 1DOLA 5KYIA 1IYUA 4KGRA 4K7UA 1T5XD 5BN4A 1D3ZA 3I73A 4IALA 3HOXG 1HEZE 4X57B 3M4OH 3ZRCA 3LX0A 3I7FA 1VD2A 1E90A 3V6CB 1UNSA 3T53B 2CCZA 2BH2A 4LMQD 3EUB2 4IUUA 3HOUH 4JX1C 4M0WB 4O0AA 2KJHB 3KUDB 3QJZA 1CKOA 1PDQA 3NVVA 4F8CB 3CHBD 3K59A 2QC8A 3FDTA 5M9OA 1JWBD 1PGBA 1XLNA 2WP8J 2R7ZH 2ZVNA 1NCVA 4OVVA 4HPPA 3KWLA 4P72A 1V1PB 5IIFA 3VDYA 3E0JA 4OO1I 2RGFA 3IG3A 2DNCA 4HCEA 3T1YL 2C9WB 1XTDA 3KDFA 4G50A 4XXEA 3H7SA 2B2UC 2K5DA 2EYMA 2PW9A 3PSEB 4J6IA 1FL0A 3ICEA 1SJED 1WGRA 4IWOA 1PH1A 2MHJA 1BT0A 1X6OA 4DF7A 4JI0Q 3VR8B 1E0ZA 1SNCA 4A3MH 3PPAA 4DFAA 1T0RC 1JWSD 4ZCKA 2XK5A 3DM1A 1Q82C 1E8YA 4XDDA 3VAWA 4CO7A 3OIPA 4A93G 4DHZE 4HJAA 4GOPA 4C3JG 1GXDC 1WYDA 4ZQ3A 1I3QB 4IG7B 1EY9A 1E10A 5KGUA 3SDZA 3DDCB 1M8AA 4XQQA 4JI8Q 2VRRB 5JH5C 2A6EC 2PQAA 4GN5A 3RN5A 1F77A 2JA7H 1WWTA 1XCTL 4H2AA 2AWOA 1WTQA 1TKGA 5LL6S 4AS1A 1QF6A 5I2XA 1CZGA 2IY1B 1V2YA 2H88B 2WXNA 1ZW7A 5DM63 3Q8EA 3VYSA 2B29A 2KENA 3AB9A 4NAMA 3CIRB 5E4WC 4X6AH 2KT7A 2FJ2A 4XDCA 3F2DA 3P4PB 2AKWB 4LNOA 1I4GA 1MI2A 2BCOA 1KAAA 1RHPA 4A3IB 2GVBA 2R7ZB 1NEKB 4GDLB 1YNJD 4PV1C 4LF4Q 2Y3AA 2YEPF 3QG1A 3HKSA 1VF7A 2O2LD 5DEHA 5M5YB 5EPKA 4KJOA 1WE7A 3HG9A 4WJOA 5L37A 1WFYA 2N8NA 4LAAA 5IYDH 1I35A 1K8GA 4A90A 1O7ZA 4HCSA 1Z7TA 3LJ3A 4A3DG 1AE3A 3D4RA 3PRPB 1H8CA 1C8CA 3L17A 1Q90A 4YCUA 5ISRA 4DR2L 3RUZA 4WIPA 3NQIA 5IYCH 5AJ3L 1BUVT 2F0MA 2IT1A 2XSCA 4KIKB 2B2WC 3TEXA 4BFRA 3T3NA 2R6GA 2LMCA 5BMHA 3TEYA 3OG5A 2QKIC 1E2VA 1R4NB 3EHVA 1XMQL 5IA7A 2K28A 3EFXD 2I1KA 2EKIA 1TY0A 2KZRA 1LO5D 3AMZA 3DOWA 4I6PA 4DNIA 4AOFA 5G55A 5M5XH 3L0WB 2JA7B 3Q0AA 3G71A 2V1YA 4PS7A 2BE5C 1YIWA 1MVKA 1DONA 3PV0A 4ZRPA 4G11A 2NBFA 4DK1A 2LZ6A 4GLSC 3NENA 3BU2A 1FXIA 1N5WA 1RF2D 2C7HA 1VDVA 3NZSA 2KHWB 5JAVA 5HY6A 4XYQA 1F9SA 1EF1A 2UU7A 1ICWA 1C0AA 4A3IH 2PW7A 1BVSA 1HTOA 5C3XA 2CJNA 3KH0A 1YJJA 2ZPNA 2N0SB 4XDXA 2FCQA 2OWOA 1K50A 5M5YH 1EQRA 3GB1A 1M94A 1FFVA 3HIZA 5E3FA 4X62Q 1SEBD 4TKOB 3HOWH 1FD6A 4HVBA 4B9XA 4MH0E 2M0AA 4CQNA 4I65A 3S2DH 1K8AC 1SGHA 4K6DA 2BWFA 1LTID 2CS4A 4W9FA 5C0XI 3W1SA 2BB5A 5HURA 1KLUD 3HM3A 1Q8IA 4DR3L 1QZEA 4L1BA 2G9HD 4HEA1 2FIFA 4OZBA 4BXXH 4M8NA 2HE7A 4G57A 2LGXA 2WB1G 4KY7A 3L16A 4P75A 2K3UA 4RG1A 3NTKA 2JSVX 1WZ0A 4XZ4A 5C44G 3PSIA 2IBIB 2WAQB 1TT2A 2WINB 4YSZB 2N55A 4ANVA 1CSQA 2IWHA 2L3ZA 1TWAB 3B1LX 1FXAA 1GD7A 5J18A 3MTSA 2W82A 3ONAB 4KGTA 1IPGA 2B76B 5IP9H 2NCNA 3DCGA 3P1MA 1M4VA 1WTHA 3BYTB 3I2ZA 1ISNA 1LV9A 2KFJA 3RN9C 2ZM6L 1FNUA 4A4IA 1I6HH 2K22A 3IBEA 2MJDA 2OEDA 3GTOH 1QT9A 3AEGB 3BZDB 4LK1C 2YVCA 2O5IC 1YN3A 1EWHA 4N9PA 2WXOA 3P2BA 1S40A 2WB1B 1JJCB 2ONQA 1J19A 1OTRB 2Z8LA 1A2TA 2F4VL 3HOWB 5C44B 4IDIA 1LTAD 4A3BG 1DD2A 1L6VA 3KF8B 2LGSA 3KWVA 2KBNA 1G51A 3S2DB 2SEBD 4HDQA 3NXWA 4KHPL 3BDLA 2WXIA 1A15A 4OL7A 1A5RA 2MO0A 4GN4B 3FKYA 1KOTA 2EJGC 4NAWA 1E0BA 5DCNA 1KDAA 2YEPB 1TU2B 2F4IA 3HOYG 4IWPA 1YNNC 4EGVA 3RFZB 3DQVA 1R9TH 4CGYB 4Q0FA 3PCOB 3V2TA 1RAXA 1WTRA 2L1AA 3WWVA 3U58A 2TMPA 2R2OA 3KYCD 1X32A 3J81j 3LYYA 4W9IA 3PLUA 1Q12A 1MG8A 2DZKA 4XX5A 5FLXc 1KNAA 2N4FA 4KTAA 5C3EB 1Q86C 3ZRFA 2QCPX 5CV7A 1Q5WB 4ANWA 3HOXB 2M8SA 1DXMA 2D07B 4R3DA 1PMRA 3TREA 2JU6X 1L1OB 3C1EA 4C3HG 1TWAH 1IBXA 2KC2A 5BYRA 1CSPA 4JOIC 2KACA 3M63B 4K3BA 1Y56A 1AH9A 2RCNA 1EFID 4XWTA 1J7AA 1IZ6A 4K14A 1V9JA 5C4HA 1V5TA 3RNGC 1EUJA 3MJWA 1I6HB 3GTOB 2IO1B 3MHBA 1QOHA 1OGWA 2V9HA 2F03A 2NN6H 5CV4A 3EIVA 2AL6A 1AW7A 2AX5A 2EKEC 4C1NK 1J0GA 1DGSA 4CHTB 3J80c 1YN4A 4HIDA 2ACZB 2BBCA 4HIMA 1SE4A 1H9SA 5FLMH 1B53A 5LXHA 3Q8CA 2MGSA 3HZXA 5JJKA 4NZLB 4RKLA 3J81L 3QO2A 2VY3A 1K9MC 4YHHQ 3CC4A 2QDBA 2VB2X 2Y5CA 4HIOA 1FEHA 4M0WA 5C4XH 1LT3D 4EZJA 5HI1A 3ZJYC 1SN8A 1PZID 4A75A 4FF4A 2PW5A 1ZPSA 4KI0A 3A74A 5EE0A 4P73A 1MKHA 2PI2E 3BG3A 4DV2Q 1IBMQ 4YT0B 2GOWA 3W5UB 4ZLTF 2LS01 3UE0A 1J8CA 2PMZE
chains in the Genus database with same CATH topology
1AN8A 3CRKC 3W3AA 1HUNA 2L32A 3KLSA 3R8BA 1LTBD 4ILWA 5DM73 5FO8B 4CKBA 2B2VC 3RZDB 3AEAB 2OXPA 1CM9A 5C6AA 3FILB 2F0OA 3IAS1 2WXQA 1B9NA 1ESRA 1SNQA 2JYEA 4P6VF 5HGTA 2EYJA 2DWQA 1QE6A 5LL6X 1SDFA 1RWSA 1SE2A 3SFEB 4RCOA 1OO9B 2K5PA 1SYBA 3C2PA 2J7ZA 1D5MC 4G7ZC 3ETRA 5C4XB 1N63A 3EJIA 4K6LA 1SYDA 2A6ED 3K58A 2A5HA 1TWGB 2KQ4X 1HZ5A 1II3A 1OXTA 2QILA 1F9PA 5AUIA 4XYOA 4OZAA 3S2HB 4NP5A 3GS2A 5C3WA 1TS5A 1LACA 3GD7A 2FE8A 1KLGD 1H9JA 4ZRQA 2E76C 4C3IB 1FGBD 2WV6D 2JP1A 1TS3A 1SB3C 3K6OA 4KN7C 4I7ZC 2JXTA 4HN7A 1U4LA 5K36G 5D3DA 1F2YA 1HUMA 1IKLA 3F2UA 2EYPA 3KF8A 3JAML 1EM7A 2VZKD 4IFDI 1ET9A 3RZOB 2IX3A 5D7GA 3G6JB 1V97A 1ACCA 1GOZA 2B2TA 2L4NA 1ILPA 1IW7D 3AE3B 1HCZA 5IGGA 1PFMA 5CYUA 4HROA 3U52E 5CV8A 4JWSC 2F0TA 3PUZA 2F3VA 3W9CB 2EY2A 2I46A 1EWCA 4FF3A 3OMGA 2WKCA 2AUKA 1FD7D 3G7LA 2MPMA 5J22A 1TWCB 3MP9A 1G2SA 2EPBA 2AQ3B 3MXUA 4YTNB 2DY8A 3J7AF 2YYZA 1ENCA 1I4RA 5KRUA 3AEFB 2VZKB 2ZT9C 4N59A 1KDBA 1ZOYB 3K5NA 1GPXA 1STGA 1JE4A 5T1IA 1IUEA 2N88A 3VR2A 2HTME 4OO1G 1PTOF 4FF1A 1NYQA 4C56C 2A68C 5FO7B 3CU7A 3SE0A 3SR1A 1K52A 1Y1WB 1PZJD 2JA8B 1O7YA 4KN4C 2LUMA 1RCVD 3VYTA 5BMIA 2J42A 3E9SA 1YNND 4EQNA 1LTGD 5HHDG 4HRSA 2B2UA 2VUMB 4B0EA 5IGCA 2A74C 2PNRC 3B9JA 2GA4B 1NR4A 3KK7A 4MIUA 3QJYA 1DGJA 4BBSB 2Z4HA 2M9VA 1EY5A 1F9QA 1RM6C 2LMCB 1CI3M 1SYFA 4K8IA 3Q8AA 3HVDA 3S14B 3NQTA 4C3JB 2J52A 2XRSD 2KECA 5JXVA 2PZWA 1HRJA 4QF4A 4LLGM 1MHHE 1STBA 3Q6SA 4PMBA 1PTOH 4UDUC 5M3MB 1Z47A 2D9UA 2FINB 2MJ8A 2R3ZA 1FNVA 1PGAA 2WXPA 4EQPA 3P4SB 3NSWA 4R8IA 2EYFA 4A3GB 2BW2A 1EQVA 5MPOA 1BDOA 1AFPA 1R4QB 1EQTA 1I4HA 3KLRA 3TN2A 5FLXE 5EGTA 4CJ1B 1EEFD 3C1FA 5C3JB 3HOZB 1V43A 2ZXOA 2IDYA 3VQIA 1VR9A 4WRDA 1AYFA 2E6XA 1F2RC 2Y0SB 4BY1B 3S16B 3Q22A 1HHVA 5K5PA 3T56B 3I9V1 3P7JA 1TS2A 1VF5C 4PQXA 1RYJA 5H8YE 3HUIA 5J1ZA 1U4PA 3O13A 3PUXA 4US9A 1WCMB 1PTOB 1E2ZA 1TR5A 5EBCA 5FR3A 4RGTA 2RPVA 1R7SA 4ARIA 3TZUA 5I6YA 3VRBB 4A6QA 3BDOA 5HG2A 2RDHA 2D62A 5CORA 1ZP0B 2QJLA 4N6EB 4AYBB 4WWMA 3VR3A 2EY6A 2IGDA 3X3NA 2IGGA 2J53A 3IKJA 3V96A 2MJ3A 5EJWA 1SSOA 3QOJA 2E75C 5FO9B 2NTTA 4IUVA 1NENB 2K05A 4HEDA 3Q8FA 2F0QA 1AP0A 3L7ZC 4C3IG 4H44C 4PMWA 1WTOA 2WXFA 2L0CA 1O80A 2KEEA 4NJCA 2HDEA 4OVZA 4IOIE 3NK9A 1U4MA 2LHEA 5BYSA 4HKQA 5EE9A 1XO3A 2DLBA 1OXVA 1ESFA 5BN5A 1IW7C 2PO4A 2WXJA 3BIID 2LFNA 5M5XB 3FC4A 5EE3A 3D8GA 3Q69A 4F88A 5KIXA 1CZWA 1HQMC 1KABA 5KNBA 1ENAA 3RD4A 5E6JA 4MN3A 1S5DD 2SNMA 4C2MB 3ZQ4A 4J1MA 4QB4A 1O7LA 1E9MA 1L4ZB 1P7FA 3GV6A 5D14A 2PZUA 5KEEA 2KCNA 3MA2B 1PFDA 5EKIA 2QIEB 1WVLA 3NTHA 3SHLA 2FFKB 2EY1A 3AE1B 3U7ZA 2H1EA 4N58A 4NDXA 1WTVA 2KA7A 4LTUA 3IAM1 1Y8OB 2JQRB 4A3DB 2KAJA 2B2YA 4DNTB 3ITPA 2O4XA 3AH7A 2ZW1A 2IGHA 1S5BD 3RMHA 4KKIA 3BVZA 2Z4IA 5G3LD 1U4RA 1JWAD 1TVXA 4FXCA 1CT1D 1FYCA 3VR9B 3R3OA 1STYA 2ZXPA 2EYHA 2F0PA 2JYOA 1JRPA 2A6HC 3MXPA 5IODA 1FRDA 2LGIA 5CGKA 1ILQA 3AN1A 2E2HB 4X3SA 4XT3B 1D4BA 4B9WA 1QCBD 4DK0A 1HQRD 2RMMA 1KF6B 2DYOA 2X38A 2PIAA 1JWMD 1ROEA 1QOFA 4MT5A 1SJHD 1VMPA 3TP8A 1GUTA 1UAPA 2EXZA 1JWUD 2HQEA 3FRPB 4FNFA 1N62A 2D5GA 4YSYB 3L4PA 1ONLA 1XLPA 4CJ2C 4ZUJA 3EGRA 2D2CC 2A69C 1B44D 1SE3A 4RKBA 3ND8A 3GTMB 4WJWA 1BR9A 4X3UA 2W54A 2XNAC 1F0ZA 2MJEA 5ELBA 2WXLA 5ELDA 1T5EA 2XWJB 1EY0A 2XN9C 3AMUA 1EY4A 4YTPB 3DHQA 5EQ0A 2NVXB 3VA5A 1ZE3D 3J9CA 5CV9A 4J6HA 2X6GA 2GRIA 1QWYA 2BA1A 2F0DA 3HKZB 3KQ4A 2EJMA 2F0FA 3H0GB 3WOEA 3KUPA 1QJOA 5JEAG 3U2SC 4K2KA 2J4XA 2PTLA 1RODA 2MP1A 1CJEA 5G3LF 4IFDJ 1HTLD 4GZYC 3A8JE 1IBXB 4ITKA 3R93A 3IT4B 1B3AA 1LT5D 4P16A 3M4YA 3EROA 3K0YA 2R61A 4UAIA 2BB6A 1C4QA 2V4DA 1VRAB 2V3NA 1QLBB 2Q8IB 1PDXA 4QMGA 3NP8A 1TY2A 4DN4M 3P75A 1RKNA 3DWQA 1LLRD 4A93B 5IGDA 2VB3X 4Q5VA 1RTNA 2G1EA 1CK1A 2L5TA 1HFNA 2WACA 1W6KA 1EIGA 3A8KE 3QWNA 4HTHA 1IKMA 1X3PA 2LJIA 1B50A 2WXKA 4M1UB 1F2LA 2WNMA 4L2YA 1B4OA 2FBWB 2MEKA 1YNTE 3ZJUA 3TBIB 3IXSA 2INNE 2TSSA 2BS3B 1QOBA 5C4JB 1MSGA 1BNZA 3V05A 3H94A 2KJXA 3SFDB 1EOTA 2F0HA 1UWXA 1TIID 1IYVA 4RH6A 3U9SA 3SK6A 2WQYB 2RBMA 4L23A 3H09A 1ZEQX 2WU2B 1PYWD 4JK1C 4ZYSA 1FFUA 1OXSC 2WIIB 1FCCC 3UI3A 2CVRA 2OF1A 1STAA 4TQ1A 3TEZA 4BY7B 2V0GA 2DBYA 5AUKA 3BDCA 4KY5A 1L5PA 4ZK9B 4ZOHC 2FHTA 3WOFA 3AV8A 4JWUC 4K8JA 2NZ1D 1CQFA 2IPKD 3H8HA 3Q23A 3J80L 1TYGB 2GB1A 3MJ5A 1JQ4A 1BUIC 1SNDA 1WGKA 1TKYA 5EKKA 2V3PA 1I4PA 1VDZA 3FKIB 3BK1A 1OQRA 2JZPA 1A3UA 4A9AA 5ELCA 1PGXA 2CW0C 1BO0A 2EELA 2F0KA 2LKVA 2N9KA 1EZ6A 3TEWA 1Z6HA 2ICEC 1YMHE 3VYUA 1RJTA 2B2VA 1YQ3B 3LB8C 4QUCA 1SBBB 3S1MB 1EU4A 3DWPA 1XF5L 2F0UA 3BWUD 3TMEA 1J7BA 4TSSA 3OMCA 3J81E 1TZOA 1BCPF 1K8MA 2BDNA 3NVYA 4TQ0A 2FMMA 1K53A 3GTPB 4RGNA 4IN3A 2A6HD 3HRDD 2H4OA 1L0VB 4HSPA 4HKZE 4MHEA 4XE0A 1H9SB 3PZ7A 1MBYA 1RD9D 2K33A 3IAYA 2F0WA 1Q3LA 3HOYB 1DM0B 2ICIA 1PFBA 2Y5PA 1XLOA 5M3FB 1LTTD 2RSOA 1CQVA 1XCQL 1L4DB 2A68D 1BMLC 1HA6A 2IL8A 1T3QA 2HDMA 2A69D 1MD2D 1VZ7A 4G7HC 5CMDA 2L12A 1PRTB 1LTSD 2ENBA 3AECB 4IKGA 2IX1A 4BA1I 2PLPA 4RHSA 4ABNA 3FEWX 2EVBA 1EWYC 1C77A 4KKTA 1WTWA 5C4ZA 2JYTA 1WD1A 3DEPA 2PQEA 1T6BX 3A7LA 3N6RA 4WH4A 4WFN3 3NE5B 3AEEB 3CWIA 3SR6A 1EEID 5CBAE 1I4XA 4RFBA 5C0XH 3NVWA 1NAPA 3HRZC 3PUWA 3M85A 1B1ZA 3NBIA 4PMCA 4YTMB 3A55A 3K5OA 2OT2A 3LWEA 1EY7A 2WS3B 5BN3A 3PMFA 2EYOA 2CHBD 5IGBA 4X3TA 2EE1A 1SIJA 4E6IA 2PVOD 1PTOD 4R8NA 2FUG1 5COYA 4FYDA 1RFKA 5DNFA 4RHRA 3P42A 2VNUD 1JOOA 2B63B 3D6WA 1ZDVA 3QB3A 3FPUB 1W6JA 3DMUA 1LT6D 4KD4A 3R2IA 1XEEA 3K57A 4U68A 3LWUA 1BBXC 4P2CB 1B9MA 3CRLC 3NPPA 1AZQA 4A8XC 3PUYA 5H92C 5LNK1 4GDKB 1IHZA 2JE6I 4Y7NB 1EU3A 1NVID 1DOXA 3IL8A 1DOIA 1EY6A 4KK7A 4DNRB 4NMZA 4A3KB 2F0SA 4A55A 1Q10A 3D4DA 1UEAB 1ZXIA 3SK8A 5AFWA 2SOBA 1STNA 1XTCD 1ZKOA 1WRIA 3CQZB 1ML0D 2F0NA 3I8ZA 3HP3A 3A7AB 3L3OC 3AE6B 1FO4A 3I70A 3M7GA 2Z1CA 4KMUC 3NBHA 2WXGA 4DAPA 1WTPA 1H9KA 4B08A 1MHXA 5ELEA 1KTKA 2PMVA 3D31A 4OO1H 5JOBA 4FXKC 2WXRA 1B9RA 1I4QA 4KKSA 5I9OA 3D6CA 5HFYA 2WDVB 4U673 4BA2I 1BXTA 4ZKBB 3FILA 2MH7A 4IZ8A 1VMCA 1SSNA 3S1RB 1C48A 1N5XA 1A2UA 2NVTB 4BWGB 3AE2B 1H9RA 4O42A 2DYMA 1ZYRC 2F0EA 2ID0A 2IJ0A 2JA5B 2WXMA 1BCPD 3FMCA 2CW0D 2KQ3A 1TQOA 2R93B 1STEA 3KLSX 2HCIA 3GP7A 2JA6B 3BS1A 2NVYB 3AEBB 4K2LA 2PKOA 4H13C 1SYEA 4DGZA 5IGEA 1GUWA 1GB1A 5I9PA 4XQJA 4FVMA 4V0BA 2E74C 1DOMA 4RAUC 1G6ZA 5EPJA 1CFMA 3K5MA 3BK2A 2L11A 5JVH3 1SFOB 2AQ2B 4FO2A 2XWBB 1STHA 4Z9CB 1CTMA 2W3RA 2PPBC 3DEOA 3AU7A 3VR5A 3RLFA 2EYLA 3HOVB 3TDQA 2INPE 4F87A 2K32A 3DWGC 3OHXC 1SMYD 3I91A 4A3FB 1BCPB 5C0XJ 4L63B 2K04A 3NZ3A 1Q1BA 3NTIA 1L0YB 4NAWB 2BS2B 1SXTA 1QG7A 1D1IA 5D3IB 1Y69U 4MM3B 1JORA 3EVQA 1KRHA 4YSXB 5G5HA 1QOAA 4QCLA 1JQYD 1KDCA 3GTGB 1QB5D 1QQRA 3SXHA 2B2WA 2NUCA 3EQLC 1TWFB 1V8QA 3AE4B 5IOCA 2ON8A 2EDGA 3MAQA 4EE2A 1D1KA 3GO5A 2HCCA 2IW3A 4MACA 1FCLA 1HPCA 4HAEA 3E56A 4RNAA 1ZXHA 2KVMA 3ZJTA 2E2DC 1KFYB 3FAHA 2N9LA 2PMZB 1FM0D 4TMAB 1ZXTA 5EBDA 1PFNA 3AE9B 3S9WA 4IURA 4A3EB 2N7JA 3E5SA 4QUFA 3I4MB 3I72A 1N60A 3TSSA 4RF0A 4H0LC 3GTQB 5BMGA 3I90A 3NRZA 4DQOC 3H3VC 2IX0A 1CA6A 2RA4A 2XVSA 2SNSA 2I38A 2KWDA 5D65A 1KH0A 2SAKA 1D2BA 2L83A 1A70A 3ZYYX 2KDMA 1C4CA 5CBEE 1VZ6A 1LTRD 1XWEA 1QKZA 1KNEA 1WD0A 1E7PB 1QNUA 1HTPA 2I07B 2BTEA 5IGFA 2BT6A 5GXGB 3NVZA 3J7AV 3VYRA 5G5GA 4IFDH 3A56A 3N52A 5JPNC 4IUPA 2BOSA 2K03A 1JALA 4HR7B 3HS0C 4HMJA 4N9TA 1SNPA 3QOLA 5JPMC 4QIWB 5BYQA 4H7BA 1GUOA 1HXYD 3GQBA 4KJNA 2C5CA 3K5LA 5FK9C 1QNKA 2RVLA 1IGCA 2PZTA 1WTXA 2B39A 1NI3A 1OXUA 3C3LA 5JJZA 2XRQD 1RDPD 4G7OC 1BF4A 2L1BA 1Y8PB 1Y1VB 3T13A 3FPPA 4C80A 1TWHB 4JBWA 1EYCA 3U4EG 2K7VA 3C46A 1OFFA 2ZXRA 1J7CA 1V1PA 2AQ1B 4ZKCB 1SF0A 3VR4A 2LHDA 1K83B 3HEJA 4NW2A 4CKCA 4HJGE 4REZA 3MZ5A 2RDGA 5LHY1 3RPFC 5T1GA 1JICA 3KBGA 1BCPC 2VXWA 4J8QA 3P4QB 3IT6B 2PVGC 2B8FA 3NWTA 4OZCA 3V3XA 1CHPD 3A54A 3ABVB 2EOTA 3VRAB 3JAME 4AQ7A 4DU9A 1NUCA 1S5CD 5EPLA 1U9RA 4YIJA 1MI0A 1I6VC 3VA7A 3OIQA 4RCNA 3MFGA 4OHJA 3J80E 3AB5A 2K5QA 3ZJVA 2PYKA 4WQMA 3PO3B 2RSNA 3TUOA 2FMCA 4F8MA 2L55A 2KEDA 4MH8A 3X3MA 3LXFA 2L52A 1GUGA 3P1HA 3ND9A 1A3VA 2F0LA 2NN6I 4CJ0B 3DWMA 3OOCA 1PRTD 2K01A 1L0XB 3DWAA 3L9AX 4XQNA 3SVMA 3NUCA 5M5WB 2X6LA 4ZAIA 2JEAI 1I50B 5KYLA 4K5WA 1JOKA 2Q5WD 4KKUA 5I4DA 4CKEA 5A2QL 2KMMA 5EE1A 1A3TA 3S1NB 1G291 2KN4A 4V190 1SNOA 3URYA 4ZUIA 3SK4A 3VR6A 5IT9E 2RDFA 3W2DA 1TJEA 4XWWA 4F7XA 1AZPA 1D6EC 2G9DA 1EIHA 5E4XA 2CQAA 2K6AA 4OGQC 4RWSC 1PUTA 1IGDA 2W55A 1NR2A 3AEDB 3MEHA 1HA5A 3E6ZX 3KBXA 2NN6G 2L9HA 1E2WA 2C9OA 2OHFA 1UWMA 2BYTA 3J7YW 4WORA 5FKAC 5C5LA 4WURA 4ARCA 1F9RA 4XTCS 4TRDA 4Q2JA 5JEAH 2PCFB 5FOBB 4KKJA 5JVG3 4IUQA 1C79A 2K0PA 2M56B 4RGOS 4HSVA 2OEOA 4KD3A 2M19A 1YQ4B 5TSSA 1JOQA 3AE5B 3MHZA 4KY6A 2QMTA 2QF7A 2LFIA 1GHJA 4DAVA 1O78A 2AWNA 1R9TB 1ZDXA 3U9OA 3MXNA 3R2TA 2JXMB 4ID6A 1J8IA 1UUPA 3WCQA 1NSNS 2J0TD 2E2IB 3BVMA 1MPEA 2WDRB 5A35A 1XXGA 2B8GA 4L8JA 1Q1EA 1PTOC 4S3SA 1LABA 5KNCA 3Q8BA 4KGSA 1TKWB 3OPOA 1V1OA 2JEBI 4XIGS 1VLBA 3NHHA 1OQQA 3WDNA 1YN5A 2WDQB 4KV6A 1C78A 1P7EA 1EYAA 1SYGA 1E6EB 4ME5A 1S5FD 1ENFA 4ZHOA 1JB3A 4USAA 4DAYA 1SYCA 1MGSA 3P20A 1ZUD2 1LT4D 2E2JB 4C7ZA 1YJIA 3LNNA 4KX6B 4FF2A 4CBVA 1FR3A 2F0IA 2EJFC 4OIJA 5CV5A 4O1NA 4OIKA 5A2QE 3T51B 2CJOA 4EQOA 3BVGA 2Q8RE 3PO2B 4NKLA 1QOGA 1DOYA 4ZRZA 5I6WA 3IFTA 4XT1B 1DJRD 3M3YB 1D5XC 1F2ZA 1XX8A 1JW9D 4BBRB 1ET6A 2BA0A 3EA6A 5K36H 4D2KA 4IQZA 3PO0A 4FXDA 3OW7A 3MWYW 5ELFA 5CR3A 3GTKB 3D3RA 1BOSA 2NTSA 3HGBA 1JMLA 4JPSA 3M7NA 3DUZA 3TP5A 1PZKD 1VZ8A 4C3HB 2NB0A 2WU5B 3MFYA 1S4ZA 3NS1A 3TP6A 1S5ED 5JEAJ 1QILA 4K5XA 5IT9L 3PIP3 2HDLA 1JR0D 4YXDB 3NWSA 1CZPA 2K9XA 1GHKA 3GV3A 3ERQA 3TP7A 1IL8A 1GUSA 4EVOA 4FP5D 3B2FA 1EZ8A 2W3SA 1FIQA 1CA5A 4IUNA 5F2DA 3H91A 2JX5A 3I57A 4IUTA 2F1MA 3Q24A 3I4LA 4G4KA 2GI9A 1H9MA 5C5MA 1G91A 2NWGA 3BYYB 2HUGA 2B2YC 2BS4B 3W5VB 2AUJD 3GTLB 4US8A 3AE8B 2F3WA 4PNYA 2K1BA 1YNJC 3K7AB 1HZ6A 1CHQD 1JC7A 2V4IB 1ZYRD 2M00A 1GAQB 2R92B 1C9FA 1BQQT 3UI2A 1N61A 1D5ZC 1XLQA 1GJXA 2F0VA 2XIWA 3CKIB 2NYZD 2CU3A 2RKSA 2F0JA 1UGJA 4C7YA 3P63A 1Y8NB 1DCZA 2DN8A 3PZ8A 1TS4A 5CV6A 4BS9A 2O5JC 1SNMA 4YWGG 1PRTC 3T16A 3HVZA 4PT5A 3D4WA 1PXUA 1GUNA 4DA2A 2BE5D 2DY7A 1DOKA 3A8IE 1K8OA 3NUHB 1FRRA 4RA8A 1DZ1A 1C4AA 2EY5A 2MHVA 1GB4A 3T3OA 2WKDA 1EYDA 3MVVA 1X3QA 4ZHPA 1FMAD 1B2TA 2A73B 5J39A 4TQUS 2QSDA 3PUVA 3T4AC 4A3JB 4L6TB 1EL0A 1F2MA 4C1NI 1JCKB 2WXHA 4LJZC 2YU9B 1EY8A 1SMYC 3DXJC 1J9OA 3S1QB 3ZGZA 2B2TC 1VCIA 4ULLA 1NYRA 2BDOA 1I7HA 4DXGA 1WYGA 2DNEA 3GTJB 5KNDA 5C2TB 5C0XG 1HFGA 3OWEB 2NVQB 3SEBA 3AE7B 1JROA 2Q8TA 2KUMA 4RGMA 4JE3B 2LEKA 3S17B 1VJKA 2WP9B 1V8CA 1MSHA 2LY7A 2RQXA 2NMQA 3C8YA 2X69A 2K5WA 1WXQA 4KHVA 2JWUA 3I3CA 3FVQA 1R4PB 1PLFA 4KHZA 4R9WA 4M8AA 3I4NB 3P4RB 3IFDA 3OSOA 4HMIA 4FXGC 3QIAA 5FLXL 4ODGA 4K5VA 5T8IA 1FNWA 3OWFA 3S15B 4LK0M 1XYIA 1TKEA 2MUYA 3M4OB 4OW0A 4X3KA 4IFDG 3HOUB 2WLBA 2KCCA 1K51A 3TZDA 2I2YA 2JSOA 2M2LA 1RTOA 5EKLA 2E3TA 1SAPA 5I2YA 1DYQA 2SDFA 3SK5A 3MXGA 2ZW0A 1WSPA 3MC0B 4J3OD 4RF1A 3PIO3 3B2GA 1OXXK 1G2TA 1C76A 4A3BB 1AWDA 4A3MB 4B0MA 5DAUA 2D5DA 1L6UA 2KOLA 3N9YC 4WAFA 2KHSA 2QEJC 3H6MA 1G8ZD 1PRTF 2F0GA 2EZVA 1A6XA 5NUCA 1AEXA 5CC4A 3AM9A 4DXFA 1C4PA 1F2RI 2H89B 5E1FA 5KYIA 1DOLA 1IYUA 4KGRA 1T5XD 5BN4A 3I73A 4IALA 1HEZE 3LX0A 1UNSA 3T53B 3EUB2 4LMQD 4JX1C 4IUUA 3NVVA 1PDQA 3CHBD 3K59A 3FDTA 5M9OA 1JWBD 1PGBA 1XLNA 2WP8J 1NCVA 3KWLA 4OO1I 1V1PB 5IIFA 3E0JA 2DNCA 4HCEA 4XXEA 2B2UC 2K5DA 2PW9A 1SJED 4DF7A 3VR8B 1E0ZA 1SNCA 4DFAA 1JWSD 4XDDA 3DM1A 3OIPA 4C3JG 1GXDC 4ZQ3A 1I3QB 1EY9A 1E10A 5KGUA 3SDZA 1M8AA 4XQQA 2A6EC 1WWTA 1F77A 1XCTL 4H2AA 2AWOA 1WTQA 1TKGA 5LL6S 4AS1A 1QF6A 5I2XA 1CZGA 2H88B 2WXNA 5DM63 3Q8EA 3VYSA 3AB9A 4NAMA 3CIRB 5E4WC 4XDCA 2FJ2A 3P4PB 1I4GA 1MI2A 2BCOA 1KAAA 1RHPA 4A3IB 2R7ZB 1NEKB 4GDLB 1YNJD 4PV1C 2Y3AA 2YEPF 3QG1A 5DEHA 1VF7A 2O2LD 5M5YB 5EPKA 4KJOA 3HG9A 4LAAA 4A90A 1O7ZA 4HCSA 1Z7TA 3D4RA 1C8CA 1Q90A 5ISRA 3RUZA 4WIPA 3NQIA 1BUVT 2F0MA 2IT1A 2XSCA 3TEXA 2B2WC 3T3NA 2R6GA 2LMCA 5BMHA 3TEYA 2QKIC 1E2VA 2K28A 3EFXD 2EKIA 1TY0A 3AMZA 1LO5D 2JA7B 3Q0AA 2BE5C 1MVKA 1DONA 3PV0A 4ZRPA 2NBFA 4DK1A 4GLSC 1FXIA 1N5WA 1VDVA 1RF2D 5JAVA 4XYQA 1F9SA 1ICWA 2PW7A 2CJNA 5C3XA 1YJJA 2N0SB 4XDXA 1K50A 3GB1A 1FFVA 5E3FA 1SEBD 4TKOB 1FD6A 4B9XA 2M0AA 4CQNA 4I65A 4K6DA 1LTID 5C0XI 3W1SA 2BB5A 5HURA 1KLUD 1Q8IA 4L1BA 2G9HD 4HEA1 4OZBA 4G57A 4KY7A 2K3UA 3NTKA 2JSVX 2WAQB 1TT2A 2WINB 4YSZB 2N55A 2IWHA 1TWAB 1FXAA 3MTSA 2W82A 3ONAB 4KGTA 2B76B 3P1MA 1M4VA 3BYTB 1LV9A 1FNUA 2K22A 2MJDA 2OEDA 1QT9A 3AEGB 3BZDB 4LK1C 2O5IC 1YN3A 1EWHA 4N9PA 2WXOA 2WB1B 2ONQA 2Z8LA 1A2TA 3HOWB 5C44B 4IDIA 1LTAD 1DD2A 1L6VA 3KWVA 3S2DB 2SEBD 3NXWA 3BDLA 2WXIA 1A15A 4OL7A 2EJGC 1E0BA 1KDAA 2YEPB 1TU2B 2F4IA 4EGVA 1YNNC 3RFZB 4CGYB 4Q0FA 3V2TA 2L1AA 1WTRA 2TMPA 1X32A 3LYYA 1Q12A