5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
molecule tags Toxin
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
3R8BA 1PRTB 4BWGB 2IPKD 3DWAA 3URYA 4RGMA 1S5CD 1ENFA 1CQVA 1XXGA 1CHQD 1CHPD 1TS3A 1L0YB 1PRTF 2G9HD 1JWSD 3BYTB 4RHSA 1JCKB 3DWPA 1PRTC 2AQ1B 1JWUD 3V05A 1PTOD 5D3IB 1V1PA 1SE2A 5FKAC 1I4GA 1LTBD 1BCPD 1EEFD 1RDPD 1V1PB 3SEBA 1LTTD 1DYQA 2WV6D 1UUPA 2Z8LA 3W2DA 3DWQA 1I4XA 1BCPB 1BCPF 3GP7A 1LT6D 1YN3A 2QEJC 4DXFA 1SBBB 1I4HA 1TY0A 1PZJD 4ZYSA 1ET6A 1FGBD 2XNAC 1RD9D 1CT1D 1L0XB 1ESFA 3BVMA 1TS4A 3BZDB 1HTLD 1UNSA 1STEA 1EU4A 1GOZA 1PRTD 4RFBA 1B1ZA 1V1OA 1HA5A 4C56C 1PZID 1SXTA 1PYWD 1KTKA 1YN5A 1SE4A 2ICIA 1S5DD 4Z9CB 4RHRA 2R61A 1G8ZD 2RDHA 1EEID 2IJ0A 1AN8A 2CHBD 1LLRD 3BVZA 1S5FD 1BCPC 1PTOB 1SJHD 1SJED 1B44D 4RGOS 4RH6A 1KLUD 1HQRD 1LTGD 1M4VA 3BVGA 5ELCA 1MD2D 1SE3A 1LT4D 3EFXD 5ELDA 1TS2A 2J4XA 1FNUA 5D3DA 1EWCA 2TSSA 1D5XC 5ELEA 2XN9C 4RCOA 3TSSA 4L6TB 5TSSA 1FNVA 4O1NA 2NTSA 1LO5D 1S5BD 1RCVD 1I4PA 3EA6A 1D6EC 4NZLB 1D5ZC 1JR0D 1XTCD 2AQ2B 4OHJA 1LTRD 1TS5A 5ELFA 1EU3A 1JQYD 1TY2A 1JWMD 1PTOC 3MFGA 1DJRD 2XRQD 1I4QA 4UDUC 2SEBD 2RDGA 2QILA 1LTID 1PTOF 3MC0B 3OWEB 1LT3D 1I4RA 3BYYB 3R2IA 1YN4A 1LT5D 1SEBD 3CHBD 1RF2D 1FD7D 1HXYD 1KLGD 1AW7A 4L63B 5I4DA 2NTTA 1EFID 1T5XD 4RGNA 1D5MC 2O2LD 1F77A 4TSSA 1LTSD 1PTOH 5ELBA 1CK1A 1BXTA 1S5ED 1QILA 1FNWA 2AQ3B 4RGTA 5FK9C 3O13A 4DXGA 1ET9A 1LTAD 3R2TA 1PZKD 4K6LA 3KLSX 2XRSD
chains in the Genus database with same CATH superfamily
5JJLA 3BY4B 3DHGC 2HDEA 4K6DA 3U4ZA 1F1HA 2ZNVC 3PREA 1CHQD 3HKZB 4DV5Q 3HOVB 2UXCL 1T0QC 2DLBA 1YNJD 1PH8A 3U58A 3PUVA 4OIJA 4A3GH 4IC7B 2KCMA 5KNBA 3FC4A 1QF6A 4I7AA 1SE8A 2ZCBA 3Q2AC 2N1WA 2WXNA 4LF4Q 2ZPNA 1WJJA 4B3ML 2WGSA 1X3QA 2G45B 3OIQA 1GUWA 1Y1VG 3T4AC 2BYEA 4IG7B 2CVRA 3NUCA 3TMEA 1YVCA 3GTPB 3S17H 1HEZE 2C7MB 4C1NI 2BW2A 3OJ4B 1G291 4OIKA 2IL8A 1PH1A 5KNCA 1IYJB 3LDZE 1YX5B 5IOIA 1STYA 1RLFA 1M94A 1N8RC 4G0NB 4FJYA 3SDLC 1B3QA 3EJIA 3M3JA 2BWFA 3E0EA 1YNNC 1RRBA 1WGHA 2X8XX 2VUMB 4N6EB 3A54A 3JAME 3TUOA 3VRBB 1XWEA 3CQZB 4LUOA 1ESFA 2K9XA 4CKEA 4W9GA 2LS01 1IW7C 4KK7A 3BDOA 5A35A 1I6HH 2JPHA 5GROA 3NELA 3ZYYX 3JVZX 5CHVC 2EYMA 1S72A 1N36L 2M4NA 3J7ZC 3S15B 2INPE 1PFDA 1PYBA 1V8CA 5FLMG 1ZXIA 3C8YA 3GTMH 5IP9G 2PLPA 4MH0E 1G8ZD 3PGEA 1MHWC 5IP9H 4W9JA 4FADA 1XTDA 1PH3A 3LYYA 1YJWA 1S3OA 3PZ8A 1K8MA 1XT9B 4LDTB 3U2SC 5IGDA 2CQOA 2JUOA 2KWVB 3NUHB 1STHA 2AWOA 4KY7A 5HKHA 4RG1A 1KJTA 4P73A 3GD7A 1IL2A 1EOTA 2NVYB 3I73A 5E4WC 1PUTA 3PSEB 4W9KA 1K83H 3BZKA 4L6TB 2KVZA 4XDCA 3F2DA 5CV6A 1S5BD 2WB1E 4F8MA 3GTKH 2CU3A 1JE5A 1JE4A 1EWIA 1GD7A 4CHTB 4EX5A 2CH4W 4ZRKA 4A3LH 3F2BA 2VXWA 1E8YA 3GOEA 1E2ZA 5C4HA 3AECB 4OHJA 1I94L 1TWGB 3OYYA 2D11A 2D3GA 5C0XH 2F0TA 3S24A 4U673 4MSMB 1NENB 2DZKA 2PNRC 2QILA 5JOBA 1TWFB 3L16A 2X6GA 1CM9A 1MJEA 1I4RA 2CH4A 3BYYB 4PS7A 1J19A 3NWSA 1VQNA 3PO3H 1N60A 4XX5A 2ICEC 2EJGC 4GNXB 3S1NB 2E75C 4K5WA 3UF8A 5BYSA 1Y8RC 2JXXA 4ZHOA 4H0LC 4I7ZC 4UP9A 2WX0A 2I5HA 1HTOA 1T5XD 2CW0D 1WGDA 4WJ4A 1HHVA 2A6HC 1GB4A 4B3SL 1PTOH 2G4SA 1RM6C 4IM2A 5LNK1 2OHFA 4US9A 3BZCA 1FNWA 2MWSB 4LF5L 3I9V1 2XTIA 4LFAQ 3QAQA 1CQFA 1C7YA 1F9SA 2QDFA 4FJVB 3RT3B 2JYOA 2CW0C 3LWEA 4A93B 1JMLA 2NZOA 3QOJA 2MP2A 3QQ8B 2KFKB 2KJXA 5DAUA 1IBLQ 4ICUA 4JK1C 2DNCA 3GDEA 2K22A 5L83A 4MH8A 5M3FH 2A19A 5EAYA 3RN9C 4OZAA 3K5MA 2KVRA 2F1MA 4KTAA 1CKNA 1WGKA 5COYA 3JSVB 3DWPA 3GV3A 5EKLA 1AYFA 3V05A 1TU2B 4P1CC 1B3AA 4EVOA 2A74C 5IOCA 2QEXA 2WLBA 1TKYA 1AE3A 1VCBA 4GNXA 2ZTEA 2C9OA 3TBLD 4IPDA 4PS8A 2AL6A 2R93G 2L0FA 4NXNL 4MGZE 5G5HA 3PLVA 1E22A 2KJRA 2EYLA 1BCPB 4A3IH 3I8ZA 1H9MA 5M5XB 3M63B 2QIEB 4AOFA 4GS3A 3BWUD 3MEFA 4A3EB 4A3KG 3S2DB 3WAOA 2QJLA 1GB1A 2KAJA 3K5LA 2R93H 2D07B 3ZNHB 1YNXA 3ND8A 1NMFA 1PGAA 2K50A 3DHHC 2KX3A 4O2DA 1VQDA 4DK0A 1VZ6A 4CO7A 5J39A 5HURA 4DV0Q 1GOZA 3DQVA 2C5CA 4NXNQ 1V1OA 5M3MG 4JG2A 3EQLC 4U68A 2PI2A 2K33A 4LUVA 1PMRA 5JJIA 1KTKA 4P16A 1B8AA 4JI6L 3M4OH 3HOWH 2LKVA 4ZYNA 4DU9A 1E0BA 4Z9CB 4A76A 3BU2A 4IPGA 4DA2A 4JI0L 1FXTB 1LLRD 3AE6B 1S5FD 3OLMD 4K81A 4DHJB 2EQSA 5G3LD 2B2YA 3V96A 1N32L 3MFYA 1GAQB 4ANXA 1J0GA 4GOCA 1EY0A 4KSKC 4PMCA 3SU8X 3K59A 2MEKA 3HKZG 2NN6H 1E2VA 3HOVG 2FIDA 1MI2A 2J4XA 1UE7A 2R6GA 2HHHQ 1X3PA 3G6EA 1XNQQ 3NJTA 4YTMB 5BO4B 4HMJA 2B2VA 2I07B 4XIGS 4DV1Q 2E2IH 2DENB 2GBKA 3Q69A 4MM3B 4BBNC 2JZZA 1TWFH 3H0GH 3S14H 4RWSC 3NEMA 2I46A 4HLEA 4ZK9B 5IGCA 4KGTA 4OX9Q 4DR1Q 1ZUD2 2J0MA 1IPGA 1TY2A 1JWMD 3MFGA 1WD1A 2IBIB 1K3BC 2K01A 1LTID 3S14B 4F8CB 4LCDE 1LT3D 2Q5WD 1YQ4B 3MC9A 1WTRA 3RLNA 1K83B 3M9BA 1V5OA 3CC7A 1ENCA 1B50A 1CZPA 1AW7A 2EVBA 3D4WA 5IYDG 4B3RQ 2CJNA 1WI5A 3PUYA 2RDFA 3NOBA 3ZGZA 1X3EA 4YWLA 4WORA 4AQYL 2NBWB 3A5ZB 4IUNA 1YX6B 4HJ8A 4C00A 3J81L 3KUPA 1YHQA 4HMIA 2YEPB 4HPPA 1AWDA 3UDIA 1HZBA 1I50H 4NJ6A 4ME3A 3N30A 2PZTA 5IO9A 1V49A 3D6WA 2Z4IA 4LMQD 2OJWA 4L1BA 1JJ2A 5DPTA 5I9OA 4RGMA 1ZOYB 2WINB 3R3MA 1CQVA 4NXML 1FJGQ 4BOSC 2LY7A 3OPOA 3VDZA 2BS2B 2LXCA 3KWLA 1VQKA 1PFNA 1JCKB 2VY3A 1WGGA 3FHWA 2FCSA 3Q3JA 3NP8A 4WWPA 2A6EC 4IZ8A 2OCEA 3K9OB 1ROEA 5C0XG 3S2DH 1CJEA 3EIVA 1V81A 1BCPD 2E6XA 1WCMH 3NHEB 1FM0D 2LASA 4HIOA 2UUBL 4A3MG 2F0SA 1I6VC 1OQQA 2PW7A 1H4RA 1WMHA 3Q8EA 3PIPA 2KECA 4UY8C 2K8BA 3ZLZA 3CCUA 1WCMG 1VQ6A 4K5XA 1M90C 3HK0A 3ML9A 4FN2A 4ZOHC 1NR4A 4JC0A 1SF0A 3B6YA 3Q8AA 5AJ3L 4Y7NH 1TKWB 1T6BX 3TDQA 4II2B 4I65A 2EYPA 4XGAB 2EYFA 4QQBX 1VDZA 2HCIA 1LXDA 3A8IE 4KIKB 4PNYA 1S1QB 3CMEA 1EL0A 1L0XB 2QGQA 1ZDVA 1SSNA 4HK2A 1FL0A 3VUYA 2UUBQ 2RHSB 3WAMA 1VQ4A 3GTOB 2JN4A 4CJ2C 2D62A 2MJ8A 3CU7A 2JZPA 2HUGA 3NBHA 2F0QA 5AJ3Q 1OXSC 3QG1A 2B63G 2YTVA 1ZW7A 4DF7A 1PTOB 4A93G 2GRIA 3PS6A 2JA7B 2K7VA 4HJAA 3L54A 4Y52H 1C1YB 5IGGA 2VQEQ 3D4DA 1UZXB 1KNEA 4F1SA 1SNDA 2H89B 1DOLA 4RCOA 4W9DA 2UWQA 4L5SA 4MNOA 1SGHA 4GGQA 1HFNA 1WGRA 2LWPA 2WQYB 4A3IG 1JWAD 2INCC 1B53A 2JY6A 3KUZA 5CR3A 4QCLA 5M5YH 4JBJA 4N58A 5HGQA 4BKSD 4QUFA 2RCFA 4OO1G 1YEZA 5AUKA 3TRZA 3MJWA 4NP5A 1SNPA 3ZIMA 3UDFA 2ES2A 3QK0A 2KQSA 2N3SA 4GOPB 2BOSA 1E7UA 2A6HD 2KENA 1SEBD 1VRAB 4UPAA 4LFCL 4KKSA 1RF2D 2NYZD 3FKYA 4TUUA 3W1BA 4IWOA 2N9XA 2FMCA 2Q2TA 1C77A 4BBSH 2ZW1A 4MJSB 2SDFA 2A5UA 1VQAA 3NE5B 3ULLA 3CWIA 1AEXA 2N9KA 2QSDA 5J3BA 2O2LD 3VA5A 3ITPA 1LTSD 3I4MB 1II3A 5D2MB 2D2QA 2ZJPA 2N9PC 4DV2L 1O80A 2G9DA 2QDLA 4C3JG 2HD3A 3QO2A 3GTLH 1X1MA 2RHQB 4B3MQ 4DK3C 1C79A 3AEVA 4NJCA 3VR5A 2CWPA 2F4VL 1IHZA 3DWAA 2HTME 1XCQL 4IN3A 1Q46A 3L13A 1WM3A 3M85A 1GUAB 2DAFA 1CSQA 1MFWA 1C78A 3T9LA 4ZRPA 1IYFA 3SK5A 4JQWC 4DR7Q 4KKJA 1FEHA 1HFGA 4C3HH 4FF1A 1Q10A 4XZ4A 4DAYA 2Z0DB 4M8MA 3N1ZC 2IYDB 5T1GA 3HP3A 4CDCC 3SR1A 4OO1I 3U7ZA 4IOCA 2O2VB 4HEA1 1R9TH 1VQOA 2D10A 3QWZB 1EZ8A 1N6ZA 3RNUA 3L17A 3KLRA 2RKSA 2WKCA 1N36Q 2IX1A 1OXTA 3SHLA 4IFDJ 1FMAD 1HZ6A 2Y3AA 4WWOA 4L5QA 2QEJC 5FLXE 2KTRA 1Q5WB 3RI7C 2WXIA 2K14A 4LJPB 2VQFL 3SD5A 2BKFA 1S4ZA 2F0MA 3E3XA 4WH4A 1EWYC 2PQAB 3PQIA 3ZJTA 4EQOA 4Q2JA 5C6AA 3Q8FA 1KIXA 3K9PB 3J7YW 3J9CA 2XGTA 1PZID 1PYWD 1QVCA 5BN4A 1UWXA 4UP8A 4ZRZA 2VQFQ 2CQAA 4HEDA 2NVTB 4GSWA 1R4MB 3L9AX 1GKHA 2HIVA 1R4NI 2DZJA 3OJ3A 4ZKBB 2B76B 2K3UA 3I4MH 4IKGA 1W6JA 2B3GA 1XYIA 2UU9L 1D3ZA 2MQJA 3H7PA 1HQRD 1Z5SB 2WDRB 4LFBL 3QR8A 1SE3A 2IY5B 2NVUI 4KV6A 2HQEA 2PMZB 1V6EA 2E2HH 2F0FA 5F2DA 4EUTA 3TREA 1WTVA 1L7YA 2XK5A 4FVMA 1IKMA 1TWCB 2XWBB 1EFWA 2BYTA 1HJPA 2UU7A 4A3KH 1D5ZC 1QNUA 3AN1A 1WR6E 2K32A 3AE1B 2PMZE 1XTCD 2R7ZG 3CSTA 4A3DH 1EU3A 2M0AA 3QC8B 1J8CA 5KHQA 2N88A 2L00B 1JOKA 4DAVA 4KHPQ 2K5HA 3K6OA 1NDDA 1SE9A 1WXMA 4URKA 4LF5Q 1WCMB 1NBWA 1BT0A 4DXAB 4WQMA 2ZTCA 5E6OA 4RAUC 2UUAQ 3ZRCA 2AHOB 4W9LA 2CKHB 1HXYD 3FVQA 2WXJA 1UWVA 4IUUA 4S0RA 3CF6E 2GA4B 3CCVA 1MG8A 1EFID 1DCZA 3VYTA 1A2TA 2WXGA 2BYFA 1DGSA 1GUSA 4JCVE 1TGZB 3ULPA 2QCPX 1K51A 3IFWB 1X3GA 3J80L 2JU6X 4H2AA 1VD2A 3RMKC 5IP7G 1K3RA 3IFTA 4JI3Q 1QZEA 2AEHA 2J53A 3NS8A 1HRJA 1R4NB 1L6VA 2ZJQA 1E1OA 3KYCD 3L3OC 4CDFC 2M00A 2JA6H 3MZ5A 4KGSA 4IUPA 3RN5A 1EUVB 1HNXL 1S40A 4BBSG 2WDQB 1FD6A 5EJWA 3BIID 4RM8A 1MJCA 3MVVA 5A2QL 2CR5A 5FJ8H 3WCQA 2NVQB 4YY3L 1JRUA 3NRZA 3R7RA 3A1QB 5CYUA 3TEHB 5D3IB 1L4DB 2LFIA 1UELA 2GBNA 2SAKA 3VR4A 3H7SA 2MFIA 1PFMA 5C3EH 3TEXA 4KHZA 1VQBA 1IBKQ 2K39A 2W54A 3E6ZX 4RMAA 4HIDA 5JHAA 1YITA 3J7AV 1CUKA 1E0ZA 3W1SC 3GP7A 1JJCB 1ZYRD 5LMNQ 1ZP0B 2BVCA 3DVGY 1OTCA 3TEZA 3ZJUA 4ANWA 3A7AB 3EROA 1CA5A 1JROA 2V4LA 2F3WA 3HOUB 3P4SB 3MEHA 4MDKE 3KYHC 3A74A 2O5JC 4UP7A 3WWVA 5J18A 2XWJB 4IOIE 4ARIA 1FR3A 3BZDB 4LAAA 1ML0D 5AUIA 3HOUH 2JSOA 1K0RA 2KTRB 3JC66 3I4MG 3I63C 1WIAA 1L0WA 3S1MB 1E1TA 4C3JB 4PYUA 2VL6A 3OW2A 4JI5Q 2BT6A 2BPSA 1QZHA 2NN6I 2L9HA 2PZWA 3S2HH 3B9JA 5AZHA 3V62A 1PVOA 4GDLA 4J3OD 1TT5B 4AQ7A 4K5VA 1U4MA 4J8QA 1UD7A 3CAMA 5ELDA 2NZ1D 1K8OA 4AS1A 1W2BA 2KCTA 1LABA 3NBIA 1EWHA 5K5PA 1N33L 2BF8B 3U9SA 4RF0A 2DJFC 3L0OA 4XTCS 4A3GG 3T1HQ 3BK2A 3GZNI 4KKTA 4LNFA 4DWFA 2FHTA 4KLKA 1X65A 1D8LA 1K53A 1QUQB 3HHMA 4BVUC 1F9QA 2VB3X 2LGXA 1HR0Q 4M8NA 1MG4A 2BWES 2FBWB 2VZAA 1JR0D 3L2PA 1IBMQ 1Q81C 2E3TA 2NBFA 4BS9A 1GHJA 4C4VB 3AEBB 4A93H 4QUCA 1RJTA 2KFKA 3MJ5A 1ESRA 3EN2A 2K5VA 1Y1VH 1N5WA 1UBIA 3PSIA 3CPFA 2XEWA 2JSVX 3N1XC 3AEEB 3AM9A 1ICFB 1GJZA 2NZHA 2Q2HA 4FXKC 1AZPA 1DZ1A 3I4NB 3EUB2 4QIWE 2ZM6L 4P6VF 1C9OA 1K28A 4GLAC 1L4ZB 1TIID 1ASZA 5TR5A 2IGGA 3H3VI 2JE6I 3ERSX 3ZKJC 2RCNA 2HDMA 3H09A 2PE9A 2F03A 4YSXB 2EKEC 3Q23A 2K03A 4KSLC 1SYDA 2K6AA 2AL3A 3PGZA 3W5OA 4RGTA 2Z6KA 5M5XH 2MUYA 3NPPA 2PPHA 2Y0SB 3P4PB 4H02A 3H1UA 1PZKD 2AWNA 2Z0EB 3ZO5B 2KX0A 2CFMA 2FCMA 2H88B 1TWCH 4DHZB 1LACA 2HTHA 2V3NA 3B08A 1ENFA 4YTPB 4JI2Q 4EQ5A 5I2XA 3PO2B 3PRZA 5LLIA 1WTPA 4C3IB 1L0YB 2B2VC 1WI0A 2KZRA 3UGBB 3G6JB 1EQQA 1EY5A 1V1QA 1RIPA 1VQ7A 5C4XB 1G6JA 2PYKA 3P20A 1S3SG 3S2AA 4K7UA 4QMGA 4XXEA 3X3NA 5CGKA 2PKOA 4M0WB 3RZDB 5EKKA 3FRPB 2WP8J 2OJRA 3T8MA 3MXUA 5IT9L 1IZ6A 2F0OA 3CW2C 2M2LA 2WB1G 1HZAA 5I6WA 1ACCA 3WOFA 1YJJA 1QOBA 3IAYA 3S16B 4DXFA 4GMVA 5IYDH 1QOAA 5EPLA 3QA8A 4RM9A 4ARCA 1Y1WB 2DYOA 4AJYB 3FEWX 1NE3A 1PZJD 5FR3A 1EY6A 1ET6A 3Q6BA 4KIKA 2N55A 2E2JH 2WXLA 2FCQA 1MPEA 5IYBH 2OTLA 2PE6B 1XMQL 2KDBA 3H6NA 1K8GA 4HROA 3IBEA 2M17A 5EQ0A 4RFBA 3RPFC 2I0QA 5E7NA 3CPWA 1MHHE 1F2ZA 1NVID 2QKIC 4JWUC 1JW9D 4KMUC 1VJKA 2RVLA 4XYQA 2KDFB 2LRUA 3MP9A 1BNZA 3KWVA 3ZDMC 1V86A 2WDTB 4RHRA 2K5NA 3M4PA 4J1MA 1E7VA 2KTFA 3L0WB 5DPWA 3GTPH 4N9PA 1SJED 2KACA 3J80c 3VDYA 5I9PA 5MPOA 4IW0A 3H9DA 1M4VA 5C3EB 4OWWB 2EMSA 4HIKA 3AV8A 4PZ6A 1D4BA 1XQQA 3TZUA 3TBIB 3CCSA 3S1QB 1TKEA 3CQZH 3MXPA 1P7FA 3FPPA 3VYRA 1EIGA 2WXKA 1YHBA 1VQFA 3RZOB 5TSSA 4EFOA 3TEWA 4JBMA 2N1VA 1MJDA 2INDC 4M1UB 1NI2A 4BY7G 1OQRA 2IGDA 4MTNA 2JA8B 4GN5A 5G5GA 3ZNID 2K52A 2KJHB 2K28A 1BQQT 4KKUA 2LXAA 3A0JA 3L4PA 3S2HB 2AQ2B 4C80A 3RNGC 3KK7A 4YHHL 2D3CA 3KVFB 4UAIA 2KOXA 1TWHH 4LNNA 2KQ7A 4IWPA 3KW5B 1SNCA 1HTPA 3GTMB 1V97A 1PTOF 3H7PB 3UINB 3AQQA 2VRRB 4QF4A 2UXBL 4OONA 3GS2A 1YMHE 4TRDA 1QUQA 1L6UA 2B2WC 1SYCA 1UGJA 3DBRI 2NVYH 2ZTDA 5GAEC 1C0AA 4AYBG 3HOUG 1OQYA 1TBEA 3E56A 2MA9B 4LUZA 3APDA 1NTGA 1IGCA 4BAXA 2IX3A 1X9NA 3D6CA 1WTOA 2LZ6A 4QJFA 4K8JA 1KNAA 3ZJYC 1WTXA 2EIFA 5AFWA 4FF2A 2KHSA 3NWTA 4C2MH 2W3SA 4HRSA 3I90A 3STBD 3K7AH 4JGHB 2R92B 5J1ZA 1N32Q 1RHPA 1Z7TA 5IWAL 3KUDB 3DUZA 2FINB 4CJ1B 4K6LA 4LF8L 2N7JA 2LMCA 1EZ6A 3QB3A 1C4AA 4TV3A 2I1JA 3SGIA 3C3LA 2IO2B 2JA5H 1XXGA 2AMCB 3PMFA 4JL9A 4DV1L 3N20C 4HIMA 4W9IA 1PRTF 2V1YA 1WOCA 2GMIC 2LGIA 2K4KA 4BKGA 3KF6A 3AXCA 2NN6G 4C3HB 5ELOA 1U9RA 5FO7B 3ND9A 4OX9L 2JA5B 4OZBA 3SFDB 4APVA 4WWNA 4BY1H 2RR9A 3GQBA 4IURA 2QA4A 3I4LA 2ZVOA 3ZXRA 1LTBD 1RDPD 4ZQ3A 4DNIA 2Q8IB 5KYIA 3JAMc 3KBGA 1FIQA 2GBJA 3G4SA 2PIAA 2ZJDA 3HUIA 4XWWA 1LTTD 3IAS1 2ALYB 2RPVA 3UE0A 1FVIA 1H9RA 1VQLA 1G51A 2D5DA 2JA6G 3I55A 2L5TA 1TZOA 2CJOA 1WYGA 2NVTH 1VQ8A 1ZKHA 4N9F4 1I4HA 2UUCQ 3N1YC 4DUYL 1FRRA 4KGRA 5E6PA 4PMWA 4ZAIA 5JHBA 1BBXC 2NBVB 1D2BA 1JC7A 3GTQH 4L5RC 3Q3OC 2XNAC 1WZ0A 3I4NG 4R8IA 4HCEA 2KWDA 1Q86C 1EYGA 4GU2A 4MACA 4LFBQ 2KDMA 3UI3A 3SK6A 1N34L 2L0TA 4B3TL 1IYVA 3MA2B 1EQVA 4NQLB 1HUNA 2DAJA 3A9JB 3IRBA 2F0LA 1EIHA 3TP6A 2LI5A 1OO9B 1DOXA 5E6NA 3T3OA 3VR3A 2R61A 1A63A 1AARA 5C44G 1MHXA 4KDLB 2O5IC 2EJFC 3ML8A 3HS0C 2Y0SG 1O7IA 3DM3A 3KF6B 4A3JB 3VYSA 3KFUA 2AWTA 4RH6A 3D0FA 4ITKA 4WQOB 2J52A 3U30A 2O4XA 3NXWA 2IY1B 2YYZA 1WSPA 5ELCA 4ZUIA 3UIPB 1CTMA 2V3SA 1E8XA 4ZKCB 4A3BB 4ID6A 1Z2MA 4MELA 4ACFA 4HSVA 4C3IG 2WWZA 4HPLB 1Z6HA 5ELEA 2WXHA 3WDNA 3VXWA 3TEYA 2EZVA 1GO3E 4WIPA 2B2UA 1E6EB 3RUZA 1NEKB 5C4XG 2CWAA 3GTQB 4BXXG 2KEEA 3G7LA 1AP0A 1PH9A 1C4CA 2ZCCA 3MXNB 3PUWA 2NPTB 4E3CA 2DGYA 3DBHB 1HA6A 4JI8Q 1I4QA 5JEAH 1I50B 3MAQA 2CU1A 2E74C 4FXCA 3A9KA 3RNCC 1Y1WG 5JZEB 4DK6C 3TP7A 3K5NA 5ISRA 1V5TA 4LNOA 1FD7D 5JEAJ 3GTJB 3VQIA 5JVG3 4R4TA 4OW0A 3DWGC 4L63B 2F0PA 3S1RB 2IT1A 4USAA 5CHFA 1UF0A 4R4QA 5CHWA 1B9RA 1NMGA 4RGNA 2L15A 1Y1WH 1WXQA 2I1KA 1FFUA 3B1LX 3PVLA 4OELB 1TWHB 4YY3Q 1UEAB 2FNJB 4IFDG 4OZCA 1QOHA 2PCFB 3OG5A 4GDKA 2M9VA 1KRTA 1LTLA 3IT4B 4IM0A 4BBNF 5EPJA 4A3LG 1Q0WB 3KYDD 5DLQE 5DM63 5D6JB 4ZHPA 2OXPA 3T16A 3P4RB 4E74A 4ZCKA 3ETRA 3KBXA 2R2OA 3M4QA 5E3FA 4M0WA 1YNJC 5JPMC 3ZXVA 3S1QH 5C3EG 1R4QB 2MSED 3IHPC 4DV4L 2BE5D 3FP9A 1WRIA 2ASQA 1JWSD 4XQJA 1ZKOA 1HZ5A 1EF5A 2LGDA 2QCZA 3W9CB 4FP5D 3NZUA 1Q7YC 3LX0A 5LL6X 1FO4A 2V3PA 2RBMA 1C4QA 5FKAC 2LVPA 1KD1C 1XO3A 4KKIA 5IY0A 5BR8L 1SYFA 2F0WA 3OMGA 2B63H 1AFPA 2IO3B 2BB6A 1FXAA 5CV5A 1I4XA 1O78A 3CKIB 3HOWG 2OOBB 3DOWA 1M1KC 2ATWA 3NVVA 2DY7A 4KVGB 3PUZA 5D65A 5CX3A 2KT7A 2RA4A 1J7CA 4JI5L 2C35B 3KUCB 4LW1A 4XQNA 4DR5Q 1Y8NB 4A3FB 2W55A 3IVFA 1TXYA 4X62L 1RL2A 4CYEA 4DR4L 2DN8A 3OIPA 2KNBA 4WFN3 3PO3B 2LGYA 1KXLA 1PRTD 3OSOA 1L1OA 4W9CA 4C7ZA 4PK1A 1HA5A 5M9OA 3K57A 2LVQA 2REXA 4Y7NB 4A3DG 4M02A 1T3QA 2ICIA 4YWKA 1P98A 1Q12A 2LHEA 5KYLA 4K2LA 3C0RB 1HR0L 1F52A 3HM3A 3BVZA 2IY0B 3RLOA 2BH2A 5LHY1 4A3CG 5M5YB 4W9FA 3UDGA 4RF1A 1HTQA 3ENEA 3BVGA 4YTNB 4DR4Q 3RNBC 1IYUA 2K5DA 3M4YA 4EE2A 3T56B 2C9WB 1K50A 2PW5A 5FJ8G 1IKLA 4M8AA 2BE5C 1EWCA 5CV7A 3HZXA 5GQOA 1XMOL 4EZLA 3TSSA 1P1AA 1I7HA 3TP5A 1FNVA 1NSNS 2LXKA 3P75A 4K0KQ 5C44H 2Z6BA 4BBRH 4DV3L 1WX8A 1IBXB 3RNAC 4G7OC 2FFKB 4O42A 3QHTA 1D7QA 1OXVA 2JQOA 2X69A 5CORA 4EQPA 1LM0A 4PV1C 1VQ9A 3HOZH 3N9YC 3R66C 4P71A 2G3QB 1ASYA 4J15A 3NVYA 1CKMA 3SK8A 2L12A 3M4OB 3JAML 1OEYA 2WXRA 2AKWB 1XMOQ 5E6JA 3HOYG 3EBEA 3TMPB 1YN4A 3BS1A 1WD0A 3I7FA 3NHHA 2ON8A 5T8IA 1ICWA 4BXXH 4GLXA 4IOAA 3A1QA 2DYMA 1K73C 2ZEQA 4JI2L 3VVWB 3HEJA 3DEPA 2H1EA 2I5LX 4TSSA 1E8WA 2OQ0A 4L5TA 1Q90A 2X6LA 3RZWC 1IP9A 3NSWA 2IO1B 4NAMA 1NY4A 1GUTA 2W82A 3Q8CA 4AIMA 1A3UA 1N63A 2BCOA 2VS1A 4MZ9A 2IDYA 2YLMA 4DNTB 2UU9Q 4IDIA 3B2FA 3N6RA 3P4QB 4FJZA 1K8AC 3AB5A 3AU4A 2JX5A 3LB8C 2WXPA 1C48A 1STAA 2ID0A 2IPKD 4HCNB 4KY5A 2N7DA 1LUZA 2VUMG 5EPKA 5BMGA 3RLFA 2A8VA 2TMPA 5EE3A 2IX0A 5AEKB 4H13C 1E7PB 1TTNA 1IBXA 1CZGA 1FFVA 4EKUA 4DV7L 3I91A 3VH3B 1HUMA 1PTOD 4DHZE 3KH0A 4FDBA 1ISNA 1I4GA 1V1PB 4YWGG 4KHPL 3AEAB 3CCLA 4I6LB 5C4JB 3ER0A 1SIJA 2L3ZA 2UUAL 3UE1A 3DM1A 4P2CB 2DUDA 4DR3L 1R7SA 1JT8A 1LT6D 2G1EA 3FKIG 1VQGA 1DONA 4LF9L 1WR1A 1X55A 2GBMA 2KK8A 3A9KB 4ICVA 4JWSC 5AZGA 3UI2A 3AE2B 4ZYSA 3V6CB 3VR9B 5IE8A 3M62B 2DYBA 3VYUA 2K8CA 3AE3B 3HRDD 2JZ3B 3I3TB 1KAWA 5LXHA 4IJLA 4J6HA 3OOCA 4IALA 4B9WA 2A6ED 4W9EA 4BKSA 2ZW0A 4H7BA 3A8JE 1DOIA 3K5OA 3J81i 1I42A 3I57A 3HOXB 2MBQA 4C4VA 4OL7A 1I35A 1WYWB 4LF9Q 4IM3A 1S5DD 2INNE 1HNXQ 3ZUNA 3DBRB 2K25A 3M95A 2KO3A 1YOVB 1KHIA 4X66Q 1G2TA 5GADC 4AWJA 2QDBA 4AYBE 4NB3A 2WACA 1WJ6A 3C1FA 2DZIA 2KWUB 2PMVA 3SR6A 1MIUA 3IT6B 4OO1H 3HOXH 1MI0A 1MGSA 2PVOD 3GTKB 4LF6L 1TQOA 3R93A 3CCMA 3S1RH 2JK8A 1WH3A 1J7AA 1J6QA 1H9SA 1QOGA 4V190 2K5WA 1A6XA 2E76C 4J6IA 2K8HA 4KX6B 4HN7A 1GPXA 2JRHA 5NUCA 1IBKL 5HG2A 3U4EG 4NNJB 1RYJA 2RSUA 3HOVH 4KI0A 3NENA 3KLSA 4NY0A 2JEBI 4JI7Q 3TS2A 2GLSA 2WXFA 1H9KA 1BBWA 5ELFA 1FXIA 3APFA 1V9JA 4R4OA 2JYEA 1I3QB 2KXJA 4C3JH 3GO5A 3ZNGC 4EZKA 1D1KA 3SFEB 3TCAA 3H91A 1E24A 5JXVA 4P72A 4B0MA 4MT5A 5FO8B 5IN7A 4TKNA 4WAFA 2ZXOA 3H3VH 2EY2A 1KQSA 4BY7H 1HH2P 2H4OA 3F1ZA 4DR6Q 3NY5A 5H8YE 1EY7A 2BTEA 3R7QA 1JALA 3QIJA 3A8KE 3JW0X 3F8TA 4LK0M 3NTHA 2NPTA 3SXHA 1SSOA 1TWAH 5BN3A 2PVGC 4A3DB 4GLSC 1SR3A 1SAPA 4OWTB 1E9MA 1JB3A 1X6OA 1P8LA 2G5DA 2UYZB 3P63A 4A3KB 4B0EA 3KLSX 3CF5A 1AH9A 3RD4A 2L05A 4DUZL 1N33Q 3IG3A 2OF1A 1S5CD 4BY1B 1LYLA 5A2QE 2HHHL 3OHXC 1QCBD 1GVPA 4B08A 3A5UA 2L7RA 1F2YA 2RDBC 3DBSA 3PHXB 4XE0A 2MBEA 1GC7A 4A90A 1KF6B 2G9HD 3VAWA 2UUCL 3PPAA 3BYTB 5M3MB 2YTYA 4RHSA 1SRUA 1U4LA 5CV8A 2L1BA 1IBML 1U4PA 2NWGA 1WFYA 3LJ3A 1UEBA 3M3YH 3FKIH 2RD0A 1RFKA 1PGXA 4GIVA 2K75A 4OVUA 3CRLC 3ERQA 3H6MA 4MHEA 2WV6D 4XYOA 1EF1A 1N34Q 2V4DA 3BINA 4JOIC 3W2DA 1X54A 3GTLB 1WTWA 4HJKA 1H9JA 1XLNA 4M01A 2A68D 1ZYRC 1UBQA 2EKIA 2ZM6Q 4BA1I 3GV6A 3TZDA 4B3RL 4WURA 3NBHB 1L1OB 3WOEA 3DBLI 3BJUA 1YBYA 1J8IA 3RZOH 4AQYQ 2L76A 1RD9D 5JH5C 2RQXA 3C46A 1SN8A 1HZ9A 1NR2A 3DBHI 2GVBA 4MJSA 2R7DA 5IKCM 3WAPA 1EU4A 2E2HB 1F2RI 3AFPA 1KLVA 1V2YA 2WXOA 2PW9A 4RKLA 2Z4HA 2L0CA 4R8NA 4X6AH 3KDFA 2ZT9C 3A56A 1MVKA 1PH6A 4G11A 2A73B 1BVSA 4B3SQ 1TZ1A 1B70B 4MSQB 2JJQA 2PO4A 3K0XA 1FJGL 4GKJQ 1A5RA 3EVQA 5IP4D 3SE0A 4PZ7A 3CMAA 1LFDA 2PQEA 3D3RA 4IUTA 4L8JA 1B44D 1WJ4A 2FCNA 3AI5A 4JPBW 5EDSA 4DBGA 1K52A 2K5PA 4A3EG 1TS2A 2F3VA 1R4MI 5D3DA 1XLQA 2ZNVB 2WAQB 2LUMA 1D5XC 1R4PB 2VNUD 1B4OA 1M8AA 2E2JB 1WTQA 3RYTA 4QAYA 4F87A 5LXIB 1JOQA 1LO5D 1VQPA 3WIMA 2LUEA 3W5UB 5C4ZA 3E0JA 2KQ3A 2R92H 1A70A 1CI3M 5IIFA 3HOYH 5EBCA 4PS3A 4X64Q 3BDLA 1KC8C 2KQ4X 1VQCA 1DD2A 4OEMB 2LMCB 1T5EA 1Y8PB 5IP7H 1L5PA 2KLCA 4YXDB 4TQ1A 3K8AA 1JWBD 4A9AA 3ECIA 5EE1A 3HVZA 2KA7A 3FKIB 2NMQA 2NR2A 3CXCA 2IO0B 3IFDA 1R9TB 1C76A 3I4OA 1YD8U 4NPNA 3F2CA 4YSZB 2MP1A 1OEYJ 4K3BA 3QOLA 1JMCA 2WKDA 1Y8OB 3W3AA 1UWMA 1RAXA 1WMHB 5IYCH 3U4VA 2AUKA 1A2UA 3KDFB 3T51B 4QGUA 3PF5A 2A69D 4BFRA 4JV5Q 4X64L 2D5GA 4DV4Q 4LF7L 2VZKB 1SNQA 1P0RA 4DV0L 2L8JA 2IHEA 5C0XI 2GB1A 3HOXG 2YEPF 4POGA 1XPRA 3Q3NC 4DQOC 1XNRQ 2R7ZH 3DXJC 1PXUA 1VZ8A 5BR8Q 1F2MA 1I5FA 2SNSA 2FE8A 5KNDA 1SMYC 3BG3A 4G50A 1SROA 1WE7A 2MX2A 1MBYA 4NDXA 3PRMB 4GKKL 2DZMA 1V9PA 4LF7Q 3L08A 1YNTE 2ACZB 2XSCA 1IW7D 3LNNA 4RKBA 3DVNU 4I6PA 1GHKA 1XNRL 5K36G 1QT9A 5GXGB 4DPGA 1QWYA 1WWTA 3M7GA 3DCGA 5KHOA 1SDFA 2B63B 4GN1A 2Z8LA 1I3QH 2EYOA 1EIFA 1ZGUB 2F4IA 2WXQA 2JA7G 4KJOA 3HGBA 4LFCQ 2BB5A 4PG3A 2A68C 2ASBA 4DR1L 3RZDH 4JYAL 3G71A 2F52A 2R2QA 4YSYB 4OGQC 2PPBC 3VFKA 3VR8B 1QNKA 2KFJA 3GB1A 2RGFA 1YJIA 3CRKC 1PH2A 4GNXC 2LEKA 3GTOH 2OT2A 2ZXRA 1FGBD 4XT1B 3QX1A 3UQAA 3AE5B 1TT2A 1KL9A 4JBWA 1XJVA 2XBBC 5JPNC 5EE9A 4A3OA 4DDID 4EQNA 3ZRFA 3PO2H 1C3TA 2A69C 2D3BA 1EY8A 2HDLA 4GOPA 3AE7B 3GE8C 4XWTA 3AB9A 3RMHA 3ICEA 4HVBA 1L0VB 4PYZA 3A4SC 4P1BC 5FOBB 4DV6L 4LLGM 3NQTA 2F4VQ 2JA7H 1HE8A 2PJHA 1QJOA 3AEGB 3B0AA 1UAPA 3IAM1 3PZ7A 4NQKE 5IGBA 4IQZA 4DV3Q 4ASWC 1VF7A 3KQ4A 2BH8A 4A3MB 5K36H 3ONSA 4HWIB 4EZJA 3V60A 2Z59B 3GTGB 3J81E 4RGOS 3I56A 4QL5A 4KV2A 1VMCA 4IFDH 4JLCA 4BY1G 1BMLC 1HQMC 4TMAB 3EFXD 4HXDA 2EY6A 5L37A 1GUGA 5E4XA 3ULJA 2XIWA 4DV6Q 4TQUS 1E2WA 4ODGA 2B3AA 2IW3A 1Q8KA 1BR9A 1IL8A 1WE6A 5FLXL 3X0WA 2JA9A 3HM6X 2BA1A 4P75A 4DNRB 3AH7A 2AUJD 2D0PA 4DUYQ 2KBNA 3HOZB 2BGFA 5LMUQ 3S1MH 1Q8IA 3U8ZA 4UDUC 2O6VB 2SEBD 2RDGA 2IWHA 1U0LA 4H44C 3MC0B 2F0HA 2HE7A 1EUJA 2IGHA 1JB7A 1SMXA 1VQMA 4IUMB 1LT5D 1SFOH 1QB5D 4B3TQ 5DPSA 3MC8A 3VHTC 3CC2A 4KZCA 3AEFB 1A8VA 2B2TA 1L2FA 2NTTA 1E10A 3Q3FA 2M8SA 3J7A5 4A55A 2DX5B 1TWGH 4DV7Q 4G4KA 5IAAC 1VS0A 4A3IB 2Q2UA 1HNWL 4TQ0A 3WANA 4S3SA 3IKJA 3R2TA 3OTOQ 4A3CH 3DBLB 1GNUA 2KN5A 2FAZA 2O6VD 4LJZC 5E1FA 2KN4A 1EYCA 2WU2B 3URYA 2B2UC 2NB0A 1YQ3B 1G6PA 1TJEA 2C60A 3V6EB 3VUXA 1RTOA 2WDVB 4DR3Q 5C5MA 4FO2A 1YI2A 2KDIA 2VW9A 1ZE3D 1JJGA 1SNOA 3STBC 3N32A 1GG3A 4DR2Q 4II3B 2WAQG 2AQ1B 1Z9FA 4DKAC 3GTJH 2VQEL 5JVH3 3ZQ4A 1XX8A 3U9OA 1V1PA 3A55A 3NTKA 3KJPA 1BF4A 3I4NH 4JIOU 4PT5A 5D7GA 4IUVA 3P7JA 3OTOL 4DAPA 1GJXA 1EEFD 1LM8B 4HKZE 1WGYA 1G91A 3PCOB 2KWCA 1YQBA 5G2NA 1DYQA 2OQKA 1ZPSA 2XK5B 3FILA 4FBJB 4K3CA 2WAQE 3W1SA 4NJ7A 3ZDTA 1C9FA 4MGYE 1HCZA 5JJKA 1JRPA 3DHIC 1PDXA 1XPUA 1I6HB 1K9MC 1SYGA 2R7FA 5KGUA 1TY0A 2EY1A 4DR2L 5T1IA 2MQHA 1L1OC 1Y69U 2RMMA 4KJNA 2E2IB 3J80E 3K80C 1PFBA 1B9NA 1GXDC 3BVMA 3N52A 3S9WA 1STEA 1H95A 1PGBA 3AE8B 4LF6Q 4FHJA 3HKSA 4JI3L 3U50C 4OVVA 3KLWA 2R7ZB 2R3ZA 2H5XA 4ANVA 2EE1A 2FUG1 4XDDA 2E8GA 2RSOA 3S17B 2C7NB 5HFYA 4CQNA 2UXDL 2Y5CA 3MTSA 1Y56A 4F7ZA 4QY7A 2KC1A 4HTHA 3PTFC 3Q3MC 3I2ZA 4MGKE 3QJYA 3CCJA 3DVNV 3W1YA 5C3JB 3APCA 2LJIA 1F0ZA 1BBUA 4AJWA 1MKHA 1V43A 4Q5VA 2PNHA 1NYQA 5JJZA 2KHWB 1SNMA 2O2VA 3I5JC 4JI1Q 2L52A 3IXSA 2I5MX 3OW7A 3ONAB 1PHJA 3LGJA 5GAHC 2NTSA 4KN4C 1VF5C 1GUOA 2D0OA 2N9LA 1PH7A 1VQ5A 4HDQA 1RCVD 3T3NA 1E5WA 3V3XA 4WJ3M 2FMMA 4DR6L 5LMNL 3PV1A 4F7XA 2EDGA 3MXNA 4CJ0B 4JPSA 3OMCA 4LK1C 4DR5L 2JA8H 5ELNA 3MHZA 1PH5A 1ENAA 2CCZA 4X62Q 1EY9A 2K0PA 4XDXA 2KLGA 4LNKA 2W9NA 3RCZA 3D32A 4KHVA 2MHVA 1XF5L 2FUHB 3R2IA 3PO0A 4A75A 4CGYB 4CKCA 2GBRA 1HNZQ 1UH6A 2N9EB 2NS5A 1KLGD 5IGFA 2IHFA 5CBAE 3GZNB 2D2CC 1NAPA 4IPHA 1F77A 2JXMB 4C3IH 5BN5A 1OXXK 4MN3A 3GTGH 3X3MA 1YJ1A 1NUCA 4R3DA 5BMHA 1RTNA 4KY6A 1BXTA 2SNMA 5FO9B 4HKQA 2V0GA 2QF7A 1ET9A 3T53B 2YU9H 1YZ6A 2W3RA 1HNZL 2XRSD 1TR5A 3R8BA 1QQRA 2N78A 1NJIC 2F0GA 2F0IA 2MRPA 1VMPA 4K14A 2KD0A 2LSSA 3T1HL 1C8CA 4DN4M 5C0XJ 1QLBB 4A20A 2EYHA 1Q1OA 2V9HA 2J7ZA 2L83A 2I2YA 3O65B 4K0KL 3ZNZB 3HG9A 4ULLA 4A3FH 1JQ4A 2JWUA 4K8IA 1PRTC 5CV4A 3QIAA 2MBHA 2B8FA 1QOFA 1WTHA 5HHDG 2F0KA 2MJEA 2MJDA 1WX7A 1IUEA 5CV9A 4LWCA 4ZRJA 1EIYB 1AE2A 3DHQA 3EFCA 2KCCA 3SEBA 4QIWB 1N9WA 3TP8A 2KYWA 1UUPA 1DM0B 3VTWA 5CC4A 3HOZG 5L95C 4KDIC 1SYBA 3K81C 4HSPA 4YCUA 2JXTA 2RF4A 4DAYB 3D31A 2AX5A 3G48A 1I94Q 3P42A 5H92C 3WA0A 1E8ZA 5BYRA 3RUIB 1UE6A 1KDCA 3L7ZC 5M3MH 2HIXA 2GVAA 1BO0A 2L4NA 1G2SA 1T0RC 3H15A 4BBSB 2FJ2A 3I72A 2M1MA 4C1NK 4GOPC 3EECA 1CT1D 5M3FG 1HTLD 3PF4A 3U7DA 4NW2A 2JT4B 4G3XB 3VTUA 4X3KA 3TS0A 2KC2A 5HGTA 1SXTA 1KFYB 2L1AA 5C1ZA 1YN5A 5EE0A 4G57A 2HT1A 1YIJA 5C23A 3K7AB 1EEID 1NCVA 2VZKD 2CS4A 4RNAA 2DY8A 2KMAA 3PT2B 2B39A 4HJ7A 2K6QA 2GOWA 1MSHA 4LFAL 4X3UA 4BOZB 2LJ5A 2BA0A 1MD2D 2KANA 1B7YB 5CMDA 2A1AA 2MH7A 1XLOA 2PEAA 1Q1EA 2XN9C 5DEHA 5IT9E 3DVGX 3JYUA 1NI3A 4O1NA 4G7HC 4RMFA 1T9HA 1VCIA 3E9SA 4FLHA 2KMMA 1I4PA 3EA6A 3ZVVA 1D6EC 1QZGA 4KZ0A 1WRDB 2YV5A 4JOIA 4X65Q 4GN4B 4LNIA 4JV5L 3AU5A 1JQYD 2F0UA 1DXMA 2D3AA 4NMZA 1QG7A 2EPBA 5KEEA 1QVGA 2DNEA 3PO2G 2NBUA 1XMQQ 5G55A 1K0SA 1VZ7A 2F0JA 3PIO3 4OWXB 1A62A 3T1YQ 5HI1A 2GI9A 1LV9A 1KH0A 3VA7A 1WZ3A 1P7EA 4YT0B 1H9SB 4A3BH 2KEDA 4X65L 1EOVA 1OTRB 2NVXH 2MBOA 1IXRA 4HDOA 4A3GB 3CC4A 2B2WA 5I2YA 4HJ9A 4A3JH 3M7NA 2QHOA 3HKZE 1S5ED 2N49A 3UIOB 3FMCA 4CBVA 3CCQA 2AQ3B 2RPQA 1EQTA 3PIOA 1WFQA 2O6VA 1LTAD 3Q14C 3VH4B 3WALA 3BDCA 1N5XA 1BDOA 1HPCA 5FLMH 1XD3B 2WYQA 2YVCA 2MCNB 4ZUJA 2M19A 2K1FA 1YNND 2VB2X 3AFQA 2MO1A 4MIUA 2JYTA 3PZDA 1X32A 2Q8RE 3I3CA 1CHPD 4YIJA 3DMUA 2J0JA 4X3TA 3AYHB 5BMIA 4JYAQ 1TVXA 5DNFA 4YCWA 2N0SB 4N8X1 1PA6A 4IO9A 2B2YC 2F0EA 4N9TA 4JI7L 4YHHQ 4S17A 1SE2A 2A5HA 1PV4A 2JVCA 4DAMA 1E3PA 4BA2I 3OWFA 4R9WA 5HY6A 4YCVA 3CMMB 3LWUA 5FR6A 3TL5A 5C4JH 3C1EA 2C5LC 3KOJA 3DWQA 3NK9A 1DOKA 1BCPF 3E9HA 4KD3A 2Q8TA 2BYVE 4FXDA 1SBBB 1VQHA 2F0DA 2Z1CA 3FDTA 2KUMA 3AULA 3H94A 1SB3C 4K1RB 1FCLA 2PTLA 5IYCG 2MP2B 2VH1A 2NVQH 1D1IA 4K7SA 4LF4L 3BK1A 3K7UC 4X3SA 3AMUA 4BZAA 1CZWA 1EYDA 5C3WA 4LTUA 3J81c 4AP4C 1J9OA 2ZXPA 4BY7B 4MM3A 2F0NA 4L23A 2EJMA 3SK4A 3MHBA 3P1HA 5M5WB 2KMCA 2GN5A 3C19A 1B1ZA 1F9RA 3C2PA 3NVWA 5IWAQ 4C56C 4WJWA 3KF8A 1DOYA 4DGZA 1ONLA 4GZYC 2P5ZX 4LF8Q 1SE4A 4EEWA 4DUZQ 3D4RA 3QJZA 4DHJD 4B6WA 2RDHA 2IJ0A 4GDKB 1AN8A 2CHBD 2JRIB 3NZSA 1SLJA 1WJNA 4A8XC 3J81j 3F2UA 2WB1B 1XCTL 4NAWA 1W3SA 1SJHD 4AUQC 1YJ9A 1FRDA 5IYBG 1JICA 3R3OA 3A7LA 1STNA 4FHKA 4P74A 2NCNA 2Y5BB 1RWSA 4BKTA 2BS4B 2DBYA 3TIXA 3SDZA 2WP9B 2ZPYA 1J5EL 4NXMQ 3NTIA 1YHAA 4JW0A 3PIP3 4R4IA 2KCNA 2BDNA 2KKCA 1QE6A 1STBA 3CCEA 4A3MH 2ZVNA 2Z6KC 4ALPA 5C5LA 2WX1A 4DK5A 5BYQA 1STGA 3ABVB 1XLPA 2WIIB 1DJRD 2XRQD 1U4RA 4ZLTF 1ZXTA 1T0SC 2EOTA 4X57B 4YL8A 1Y14B 1HNWQ 1J7BA 4PQXA 1BUIC 4K2KA 1WM2A 1PLFA 5GMVA 1J5EQ 3MWYW 3CHBD 1PH4A 2OEOA 1FCCC 3E5SA 3A33B 1EYAA 5DCNA 2JA5G 2WFWA 3JAMi 3QARA 4M00A 2Y0SE 4R1JA 2F0VA 5I4DA 1QVFA 3J80i 5M3FB 1E90A 4I6NB 4D2KA 4ZDVA 5D94A 3ZW3A 4ANUA 2LVOA 5C2TB 1CSPA 3VR2A 4GKJL 2V4IB 2NUCA 1LGRA 2JA6B 2JF5A 2A4ZA 4GN3B 2C7HA 3HIZA 4NAWB 4XC2A 5FK9C 2JA8G 4JE3B 4DXGA 5EKIA 2WU5B 4EGVA 1XPOA 1F2LA 1L2NA 2YTXA 2B29A 4WJOA 4GDLB 4YWMA 3SHQA 4BWGB 4HAEA 2WXMA 1EY4A 2HCCA 4R4CA 3AMZA 4C2MB 2KHIA 2KHJA 2HD5B 2B2TC 1WVLA 2EXDA 4BBRB 3J7AF 1FYCA 2K1BA 5J17A 1PYSB 2EYJA 2LHDA 4O0AA 3DDCB 3NVZA 4XQQA 3RULA 3PUXA 3MHSD 4REZA 2DWQA 2KOLA 4HCSA 4AYBB 4HJ5A 1B9MA 2LXJA 1FPYA 5AZFA 2CKZB 3HVDA 2L11A 4NKLA 1WY8A 4B9KA 1KRSA 3RD2A 3DPDA 1KABA 1MSGA 1KRHA 2CHWA 4FF4A 1VQJA 3ZJVA 1Q1BA 5H1SE 4CDEC 1Q3LA 2XVSA 1IBLL 3CD6A 2MHJA 1N61A 4A3JG 3H0GG 3LXFA 4GB9A 1Z47A 3HFZB 5GAGC 4ILWA 4POFA 1OGWA 2BKRB 1RODA 2K6DB 2HJ1A 2R92G 4HCPB 3Q8BA 3X23A 2M56B 5M5WH 1NYRA 3NG0A 4A3BG 1WXAA 2UXDQ 2MO0A 1PQSA 1JORA 1WX9A 3VR6A 2Z9HA 2DNFA 3CIRB 2PI2E 3VTVA 1O7ZA 1T0YA 1Q82C 5CBEE 4E71A 3ZTDA 2V1CC 2MNAA 5KRUA 2UXBQ 2MLBA 5DPRA 1TS4A 5IA7A 1UNSA 3T13A 4A3EH 4CKBA 5CTRC 4C3HG 3MTNB 3DEOA 4ZRIA 4JI1L 1HZCA 2K04A 3Q6SA 4LDTD 1W6KA 1ZEQX 3UDXA 2OTJA 2L32A 3FAHA 4XYCA 1PFSA 2PZUA 1U4AA 4GLVB 3N3KB 3EGRA 4L2YA 4DDGD 1KAAA 5D14A 1ILPA 2CHZA 3PV0A 5LL6S 4DV2Q 3KJOA 1WXSA 4QB4A 1PDQA 4GKKQ 3TQYA 1EM7A 5C3XA 1F2RC 1KLUD 1X3FA 1OXUA 1RFAA 4OVZA 1LT4D 2WNMA 3KF8B 2CHXA 4JI4L 1G6ZA 4ZRQA 4JI6Q 4B9XA 3H3VC 3CSFA 3RNFC 1CA6A 4FNFA 2KDEB 1A0IA 1P9DU 4DR7L 4JI0Q 1Y1VB 1V80A 3B2GA 4OXPA 4KD4A 3CP0A 3ZTCA 1A15A 2ZZPB 1LTRD 3I70A 2N7EA 1K8RB 2JEAI 1ILQA 5JEAG 4TVAB 1UE1A 3VUWA 3IL8A 2BQQA 4GXBA 2QMTA 1VDVA 5C44B 2FXQA 1AZQA 3OWEB 4JI4Q 2M0XA 4HR7B 3CCRA 1EQRA 1XNQL 1ZDXA 5I6YA 2BDOA 3NZ3A 3AE9B 4MTKA 5KIXA 1P16A 2WS3B 4PMBA 2VUMH 4N59A 5C4XH 1IGDA 4G7ZC 3A9JA 3P2BA 1CFMA 4C7YA 2J7QB 2K5QA 3V2TA 4P7IA 1WF9A 1TIFA 3K58A 2Y5PA 4ME5A 4A4IA 2ENBA 1BKBA 1BOSA 2ZJRA 1VLBA 1CK1A 1EO6A 4A6QA 4CHKA 1QILA 1JOOA 1U5KA 2E5LL 4RCNA 4WJPA 3Q0AA 3GE3C 2N8NA 1DGJA 1OFFA 5G3LF 1FGUA 4B95A 3PHWB 4IPCA 1PRTB 2OWOA 3NS1A 1WYDA 2J0KA 1XEEA 3EC8A 4A3FG 4HJGE 2I38A 3UQBA 2MGSA 1GC6A 1NNXA 1TS3A 2AYOB 2IZVB 4K7WA 2EMTA 3PO3G 4W9HA 2L55A 3QCAA 2BBCA 2WHIA 3DWMA 1JWUD 3RZFA 1A3TA 2EXZA 4IJHA 2E5LQ 1F9JA 1UE5A 2QW7A 5JAVA 3S1NH 3S16H 4IFDI 4MEMA 5LMUL 4LNQA 3W5VB 2VH2A 4IUQA 4WWMA 1SYEA 1GM5A 3U52E 2YU9B 5J2RA 3JSVA 4FYDA 3D8GA 2J42A 3TN2A 2B8GA 1YJNA 4WJNA 5DM73 3S15H 1TWAB 3SVMA 1YN3A 1N62A 2KVMA 2KJ6A 3Q8DA 2Z0SA 1E7ZA 3K0YA 4JVZA 4JI8L 5J22A 2E2DC 2DHZA 1VQEA 3H8HA 4DK1A 3NQIA 3OAWA 3PRPB 5IGEA 2J0TD 2QC8A 4LJOB 3L10B 2OEDA 4JBKA 1QKZA 4HPMB 3EFUA 4WRDA 4DFAA 1SFOB 1CMXB 3Q24A 1P3QU 4EOYA 4US8A 4PZ8A 1TYGB 1O7YA 2JQRB 1NBFC 4WJQA 2ONQA 1RKNA 4N8FA 4TKOB 2JP1A 2LRWA 4FXGC 2EELA 4ABNA 3FILB 1HR0W 3HOYB 2JWZA 3AEDB 3EHVA 4JX1C 1KOTA 3W1GA 2FIFA 1BCPC 4F88A 2G4DB 3A4RA 4NPSA 1DOMA 3HOWB 2X38A 3E9IA 3PLUA 4XT3B 1SIFA 1LTGD 2DJGC 2MBBB 1V8QA 3M3YB 1H8CA 1BUVT 3VRAB 4KN7C 4BBRG 3HRZC 5EBDA 1FNUA 2Q2IA 2TSSA 2SOBA 4A3PA 3Q22A 4FF3A 1CKOA 1ZXHA 1CKNB 3ALBA 2MJ3A 2LGSA 3RN2A 2PQAA 2N4FA 4V0BA 3T1YL 1C4PA 2MPMA 3RR5A 5IODA 1F9PA 2MW5A 1SMYD 1VQIA 4NZLB 4CDDC 4UHVA 1WXVA 2R93B 1KM7A 1YIWA 2BS3B 2LD9A 4AH6A 3RNEC 3AU7A 1TS5A 1WJUA 1X56A 3DLLA 1PTOC 4E6IA 3H0GB 3RFZB 2EY5A 1GUNA 2NVXB 1KDBA 4Q0FA 1VR9A 4MGIE 4FULA 2HJ8A 1KDAA 2F3IA 1TKGA 1O7LA 3QWNA 4DV5L 2UXCQ 1UGMA 2RSNA 5FLXc 1D5MC 5LMNW 2HQLA 4IWQA 5ELBA 4X66L 3AE4B 3MXGA 3FPUB 2LFNA 3O13A 1LQBA 4WAAA 3P1MA 4RA8A 5EGTA 1B2TA 4FA6A 5IT9c 2K05A 3TJPA 3V61A 2D9UA 1A3VA
chains in the Genus database with same CATH topology
2HDEA 4K6DA 1CHQD 3HKZB 3HOVB 2DLBA 1YNJD 3PUVA 4OIJA 5KNBA 3FC4A 1QF6A 2WXNA 1X3QA 3OIQA 1GUWA 3T4AC 2CVRA 3NUCA 3TMEA 1HEZE 3GTPB 4C1NI 2BW2A 1G291 4OIKA 2IL8A 5KNCA 1STYA 3EJIA 1YNNC 2VUMB 4N6EB 3A54A 3JAME 3TUOA 3VRBB 1XWEA 3CQZB 1ESFA 2K9XA 4CKEA 2LS01 1IW7C 4KK7A 3BDOA 5A35A 3ZYYX 2EYMA 3S15B 2INPE 1PFDA 1V8CA 1ZXIA 3C8YA 2PLPA 1G8ZD 3LYYA 3PZ8A 1K8MA 3U2SC 5IGDA 3NUHB 1STHA 2AWOA 4KY7A 3GD7A 1EOTA 2NVYB 3I73A 5E4WC 1PUTA 4L6TB 4XDCA 5CV6A 1S5BD 4F8MA 2CU3A 1JE4A 4CHTB 2VXWA 1E2ZA 5C4HA 3AECB 4OHJA 1TWGB 5C0XH 2F0TA 4U673 1NENB 2PNRC 2QILA 5JOBA 1TWFB 2X6GA 1CM9A 1I4RA 3BYYB 3NWSA 1N60A 2ICEC 2EJGC 3S1NB 5BYSA 2E75C 4K5WA 4ZHOA 4H0LC 4I7ZC 1T5XD 2CW0D 1HHVA 2A6HC 1GB4A 1PTOH 5LNK1 1RM6C 2OHFA 4US9A 1FNWA 3I9V1 1CQFA 1F9SA 2JYOA 2CW0C 3LWEA 4A93B 1JMLA 3QOJA 2KJXA 5DAUA 4JK1C 2DNCA 2K22A 4MH8A 4OZAA 3K5MA 2F1MA 4KTAA 1WGKA 5COYA 3DWPA 3GV3A 5EKLA 1AYFA 3V05A 1TU2B 1B3AA 4EVOA 2A74C 5IOCA 2WLBA 1TKYA 2C9OA 5G5HA 2EYLA 1BCPB 3I8ZA 1H9MA 5M5XB 2QIEB 3BWUD 4A3EB 3S2DB 2QJLA 1GB1A 2KAJA 3K5LA 3ND8A 1PGAA 4DK0A 1VZ6A 5J39A 5HURA 1GOZA 2C5CA 1V1OA 4U68A 3EQLC 2K33A 4P16A 1PMRA 1KTKA 2LKVA 4DU9A 1E0BA 4Z9CB 4DA2A 1LLRD 3AE6B 1S5FD 5G3LD 2B2YA 3V96A 3MFYA 1GAQB 1EY0A 4PMCA 3K59A 2MEKA 2NN6H 1E2VA 1MI2A 2J4XA 2R6GA 1X3PA 4YTMB 4HMJA 2B2VA 2I07B 4XIGS 3Q69A 4MM3B 4RWSC 2I46A 4ZK9B 5IGCA 4KGTA 1ZUD2 1TY2A 1JWMD 3MFGA 1WD1A 2K01A 1LTID 3S14B 1LT3D 2Q5WD 1YQ4B 1WTRA 1K83B 1ENCA 1B50A 1CZPA 1AW7A 2EVBA 3D4WA 2CJNA 3PUYA 2RDFA 3ZGZA 4WORA 4IUNA 3J81L 3KUPA 4HMIA 2YEPB 1AWDA 2PZTA 3D6WA 2Z4IA 4LMQD 4L1BA 5I9OA 4RGMA 1ZOYB 2WINB 1CQVA 2LY7A 3OPOA 2BS2B 3KWLA 1PFNA 1JCKB 3NP8A 2A6EC 4IZ8A 1ROEA 5C0XG 1CJEA 1BCPD 2E6XA 1FM0D 2F0SA 1I6VC 1OQQA 2PW7A 3Q8EA 2KECA 4ZOHC 4K5XA 1NR4A 1SF0A 3Q8AA 1TKWB 1T6BX 3TDQA 4I65A 2EYPA 2EYFA 1VDZA 2HCIA 3A8IE 4PNYA 1EL0A 1L0XB 1ZDVA 1SSNA 3GTOB 4CJ2C 2D62A 2MJ8A 3CU7A 2JZPA 2HUGA 3NBHA 2F0QA 1OXSC 3QG1A 4DF7A 1PTOB 2GRIA 2JA7B 2K7VA 5IGGA 3D4DA 1KNEA 1SNDA 2H89B 1DOLA 4RCOA 1HFNA 2WQYB 1JWAD 1B53A 5CR3A 4QCLA 4N58A 4QUFA 4OO1G 5AUKA 4NP5A 1SNPA 2BOSA 2A6HD 1SEBD 1VRAB 4KKSA 1RF2D 2NYZD 2FMCA 1C77A 2ZW1A 2SDFA 3CWIA 3NE5B 1AEXA 2N9KA 2QSDA 2O2LD 3VA5A 3ITPA 1LTSD 3I4MB 1II3A 1O80A 2G9DA 4C3JG 3QO2A 1C79A 4NJCA 3VR5A 1IHZA 3DWAA 2HTME 1XCQL 4IN3A 3M85A 1C78A 4ZRPA 3SK5A 4KKJA 1FEHA 1HFGA 4FF1A 1Q10A 4DAYA 5T1GA 3HP3A 3SR1A 4OO1I 3U7ZA 4HEA1 1EZ8A 3KLRA 2RKSA 2WKCA 2IX1A 4IFDJ 1OXTA 3SHLA 1FMAD 1HZ6A 2Y3AA 5FLXE 2QEJC 2WXIA 1S4ZA 2F0MA 4WH4A 1EWYC 3ZJTA 4EQOA 4Q2JA 5C6AA 3Q8FA 3J7YW 3J9CA 1PZID 1PYWD 5BN4A 1UWXA 4ZRZA 2CQAA 4HEDA 2NVTB 3L9AX 4ZKBB 2B76B 2K3UA 4IKGA 1W6JA 1XYIA 1HQRD 2WDRB 1SE3A 4KV6A 2HQEA 2PMZB 2F0FA 5F2DA 1WTVA 4FVMA 1IKMA 1TWCB 2XWBB 2BYTA 1D5ZC 1QNUA 3AN1A 2K32A 3AE1B 1XTCD 1EU3A 2M0AA 2N88A 1JOKA 4DAVA 3K6OA 1WCMB 4WQMA 4RAUC 1HXYD 3FVQA 2WXJA 4IUUA 2GA4B 1EFID 1DCZA 3VYTA 1A2TA 2WXGA 1GUSA 2QCPX 1K51A 3J80L 2JU6X 4H2AA 3IFTA 2J53A 1HRJA 1L6VA 3L3OC 2M00A 3MZ5A 4KGSA 4IUPA 2WDQB 1FD6A 5EJWA 3BIID 5A2QL 3MVVA 3WCQA 2NVQB 3NRZA 5CYUA 1L4DB 5D3IB 2LFIA 2SAKA 3VR4A 1PFMA 3TEXA 4KHZA 2W54A 3E6ZX 3J7AV 1E0ZA 3GP7A 1ZYRD 1ZP0B 3TEZA 3ZJUA 3A7AB 3EROA 1CA5A 1JROA 2F3WA 3HOUB 3P4SB 3MEHA 2O5JC 2XWJB 4IOIE 4ARIA 1FR3A 3BZDB 4LAAA 1ML0D 5AUIA 2JSOA 3S1MB 4C3JB 2BT6A 2NN6I 2L9HA 2PZWA 3B9JA 4J3OD 4AQ7A 4K5VA 1U4MA 4J8QA 5ELDA 2NZ1D 1K8OA 4AS1A 3NBIA 1LABA 5K5PA 1EWHA 4RF0A 3U9SA 3BK2A 4XTCS 4KKTA 2FHTA 1K53A 1F9QA 2VB3X 2FBWB 1JR0D 2E3TA 2NBFA 4BS9A 1GHJA 3AEBB 4QUCA 1RJTA 3MJ5A 1ESRA 1N5WA 2JSVX 3AEEB 3AM9A 4FXKC 1AZPA 1DZ1A 3I4NB 3EUB2 4P6VF 1L4ZB 1TIID 2IGGA 2JE6I 2HDMA 3H09A 2F03A 4YSXB 3Q23A 2K03A 1SYDA 2K6AA 4RGTA 2MUYA 3NPPA 2Y0SB 3P4PB 1PZKD 1A3VA 2AWNA 2H88B 1LACA 2V3NA 1ENFA 4YTPB 5I2XA 3PO2B 1WTPA 4C3IB 1L0YB 2B2VC 3G6JB 1EY5A 5C4XB 2PYKA 3P20A 4QMGA 4XXEA 3X3NA 5CGKA 2PKOA 3RZDB 5EKKA 3FRPB 2WP8J 3MXUA 5IT9L 2F0OA 2M2LA 5I6WA 1ACCA 3WOFA 1YJJA 1QOBA 3IAYA 3S16B 4DXFA 1QOAA 5EPLA 4ARCA 1Y1WB 2DYOA 3FEWX 1PZJD 5FR3A 1EY6A 1ET6A 2N55A 2WXLA 1MPEA 4HROA 5EQ0A 4RFBA 3RPFC 1MHHE 1F2ZA 1NVID 2QKIC 4JWUC 1JW9D 4KMUC 1VJKA 2RVLA 4XYQA 3MP9A 1BNZA 3KWVA 4RHRA 4J1MA 4N9PA 1SJED 2KACA 5MPOA 5I9PA 1M4VA 5C3EB 3AV8A 1D4BA 3TZUA 3TBIB 3S1QB 1TKEA 3MXPA 1P7FA 3FPPA 3VYRA 1EIGA 2WXKA 3RZOB 5TSSA 3TEWA 4M1UB 1OQRA 2IGDA 2JA8B 5G5GA 2K28A 1BQQT 4KKUA 3L4PA 3S2HB 2AQ2B 4C80A 3KK7A 4UAIA 1SNCA 1HTPA 3GTMB 1V97A 1PTOF 4QF4A 3GS2A 1YMHE 4TRDA 1L6UA 2B2WC 1SYCA 1UGJA 3E56A 1IGCA 2IX3A 3D6CA 1WTOA 4K8JA 1KNAA 1WTXA 5AFWA 4FF2A 2KHSA 3NWTA 2W3SA 4HRSA 3I90A 2R92B 5J1ZA 1RHPA 1Z7TA 3DUZA 2FINB 4K6LA 2N7JA 2LMCA 1EZ6A 3QB3A 1C4AA 3C3LA 1XXGA 3PMFA 1PRTF 2LGIA 2NN6G 4C3HB 1U9RA 5FO7B 3ND9A 2JA5B 4OZBA 3SFDB 3GQBA 4IURA 3I4LA 1LTBD 1RDPD 4ZQ3A 1FIQA 2Q8IB 5KYIA 2PIAA 3KBGA 3HUIA 4XWWA 1LTTD 3IAS1 2RPVA 1H9RA 2D5DA 2CJOA 2L5TA 1TZOA 1WYGA 1I4HA 1FRRA 4KGRA 4PMWA 4ZAIA 1BBXC 1D2BA 1JC7A 2XNAC 4R8IA 4HCEA 2KWDA 4MACA 2KDMA 3UI3A 3SK6A 1IYVA 3MA2B 1EQVA 1HUNA 2F0LA 1EIHA 3TP6A 1OO9B 1DOXA 3T3OA 3VR3A 2R61A 1MHXA 2O5IC 2EJFC 3HS0C 4A3JB 3VYSA 4RH6A 4ITKA 2J52A 2O4XA 3NXWA 2YYZA 1WSPA 5ELCA 4ZUIA 1CTMA 4ZKCB 4A3BB 4ID6A 4HSVA 4C3IG 1Z6HA 5ELEA 2WXHA 3WDNA 3TEYA 2EZVA 4WIPA 2B2UA 1E6EB 3RUZA 1NEKB 3GTQB 2KEEA 3G7LA 1AP0A 1C4CA 3PUWA 1HA6A 1I4QA 5JEAH 1I50B 3MAQA 2E74C 4FXCA 3TP7A 3K5NA 5ISRA 1FD7D 5JEAJ 3GTJB 3VQIA 5JVG3 4OW0A 3DWGC 4L63B 2F0PA 3S1RB 2IT1A 4USAA 1B9RA 4RGNA 1WXQA 1FFUA 1TWHB 1UEAB 4OZCA 4IFDG 1QOHA 2PCFB 2M9VA 3IT4B 5EPJA 5DM63 4ZHPA 2OXPA 3T16A 3P4RB 3ETRA 3KBXA 5E3FA 4M0WA 1YNJC 5JPMC 1R4QB 1WRIA 2BE5D 3W9CB 1JWSD 4XQJA 1ZKOA 1HZ5A 4FP5D 3LX0A 5LL6X 1FO4A 2V3PA 2RBMA 1C4QA 5FKAC 1XO3A 4KKIA 1SYFA 2F0WA 3OMGA 1AFPA 2BB6A 1FXAA 5CV5A 1I4XA 1O78A 3CKIB 3NVVA 2DY7A 3PUZA 5D65A 2RA4A 1J7CA 4XQNA 1Y8NB 4A3FB 2W55A 2DN8A 3OIPA 4WFN3 3PO3B 1PRTD 3OSOA 4C7ZA 1HA5A 5M9OA 3K57A 4Y7NB 1T3QA 2ICIA 1Q12A 2LHEA 5KYLA 4K2LA 3BVZA 5LHY1 5M5YB 4RF1A 3BVGA 4YTNB 4EE2A 1IYUA 2K5DA 3M4YA 3T56B 1K50A 2PW5A 1IKLA 4M8AA 2BE5C 1EWCA 5CV7A 3HZXA 3TSSA 1I7HA 3TP5A 1FNVA 1NSNS 3P75A 1IBXB 4G7OC 2FFKB 4O42A 1OXVA 2X69A 5CORA 4EQPA 3N9YC 4PV1C 3NVYA 3SK8A 2L12A 3M4OB 3JAML 2WXRA 5E6JA 1YN4A 3BS1A 1WD0A 3NHHA 5T8IA 1ICWA 2DYMA 3HEJA 3DEPA 2H1EA 4TSSA 1Q90A 2X6LA 3NSWA 4NAMA 1GUTA 2W82A 3Q8CA 1A3UA 1N63A 2BCOA 2IDYA 4DNTB 4IDIA 3B2FA 3N6RA 3P4QB 3AB5A 2JX5A 3LB8C 2WXPA 1C48A 1STAA 2ID0A 2IPKD 4KY5A 5EPKA 5BMGA 3RLFA 2TMPA 5EE3A 2IX0A 4H13C 1E7PB 1IBXA 1CZGA 1FFVA 3I91A 1HUMA 1PTOD 4YWGG 1I4GA 1V1PB 3AEAB 5C4JB 1SIJA 3DM1A 4P2CB 1R7SA 1LT6D 2G1EA 1DONA 4JWSC 3UI2A 3AE2B 4ZYSA 3VR9B 3AE3B 3VYUA 3HRDD 4J6HA 3OOCA 4IALA 4B9WA 2A6ED 2ZW0A 4H7BA 3A8JE 1DOIA 3K5OA 3I57A 3HOXB 4OL7A 1S5DD 2INNE 1G2TA 2QDBA 2WACA 2PMVA 3C1FA 3SR6A 3IT6B 4OO1H 1MI0A 1MGSA 2PVOD 3GTKB 1TQOA 3R93A 1J7AA 1H9SA 1QOGA 4V190 2K5WA 1A6XA 2E76C 4KX6B 4HN7A 1GPXA 5NUCA 5HG2A 3U4EG 1RYJA 4KI0A 3KLSA 2JEBI 2WXFA 1H9KA 5ELFA 1FXIA 2JYEA 1I3QB 3GO5A 1D1KA 3SFEB 3H91A 5JXVA 4B0MA 4MT5A 5FO8B 4WAFA 2ZXOA 2EY2A 2H4OA 5H8YE 1EY7A 2BTEA 1JALA 3A8KE 4LK0M 3NTHA 3SXHA 1SSOA 2PVGC 5BN3A 4A3DB 4GLSC 1SAPA 1E9MA 1JB3A 3P63A 4A3KB 4B0EA 3KLSX 3RD4A 2OF1A 1S5CD 4BY1B 5A2QE 3OHXC 1QCBD 4B08A 1F2YA 4A90A 4XE0A 1KF6B 2G9HD 3BYTB 5M3MB 4RHSA 1U4LA 5CV8A 2L1BA 1U4PA 2NWGA 1RFKA 1PGXA 3CRLC 3ERQA 3H6MA 4MHEA 2WV6D 4XYOA 2V4DA 3W2DA 3GTLB 1WTWA 1H9JA 1XLNA 2A68D 1ZYRC 2EKIA 4BA1I 3GV6A 3TZDA 4WURA 3WOEA 1J8IA 1RD9D 2RQXA 3C46A 1NR2A 1EU4A 2E2HB 1F2RI 2WXOA 2PW9A 4RKLA 2Z4HA 2L0CA 4R8NA 2ZT9C 3A56A 1MVKA 2A73B 2PO4A 3EVQA 3SE0A 2PQEA 3D3RA 4IUTA 4L8JA 1B44D 1K52A 2K5PA 1TS2A 2F3VA 5D3DA 1XLQA 2WAQB 2LUMA 1D5XC 1R4PB 2VNUD 1B4OA 1M8AA 2E2JB 1WTQA 4F87A 1JOQA 1LO5D 3W5UB 5C4ZA 3E0JA 2KQ3A 1A70A 1CI3M 5IIFA 5EBCA 3BDLA 2KQ4X 1DD2A 1L5PA 2LMCB 1T5EA 1Y8PB 4YXDB 4TQ1A 1JWBD 4A9AA 5EE1A 3HVZA 2KA7A 3FKIB 2NMQA 3IFDA 1R9TB 1C76A 4YSZB 2MP1A 3QOLA 2WKDA 1Y8OB 3W3AA 1UWMA 2AUKA 1A2UA 3T51B 2A69D 2D5GA 2VZKB 1SNQA 5C0XI 2GB1A 2YEPF 4DQOC 3DXJC 1PXUA 1VZ8A 1F2MA 2SNSA 2FE8A 5KNDA 1SMYC 3BG3A 1MBYA 4NDXA 1YNTE 2ACZB 2XSCA 1IW7D 3LNNA 4RKBA 1GHKA 5K36G 1QT9A 5GXGB 1QWYA 1WWTA 3M7GA 1SDFA 2B63B 2Z8LA 2EYOA 2WXQA 2F4IA 4KJOA 3HGBA 2BB5A 2A68C 4YSYB 3VR8B 4OGQC 2PPBC 1QNKA 3GB1A 1YJIA 3CRKC 2LEKA 2OT2A 2ZXRA 1FGBD 4XT1B 3AE5B 1TT2A 4JBWA 5JPNC 5EE9A 4EQNA 2A69C 4XWTA 1EY8A 2HDLA 3AE7B 3AB9A 3RMHA 1L0VB 5FOBB 4LLGM 3NQTA 3AEGB 1QJOA 1UAPA 3IAM1 3PZ7A 5IGBA 4IQZA 1VF7A 3KQ4A 4A3MB 5K36H 3GTGB 3J81E 4RGOS 1VMCA 4IFDH 1BMLC 1HQMC 4TMAB 3EFXD 2EY6A 1GUGA 5E4XA 2XIWA 4TQUS 1E2WA 4ODGA 2IW3A 1BR9A 1IL8A 5FLXL 2BA1A 4DNRB 3AH7A 2AUJD 3HOZB 1Q8IA 4UDUC 2SEBD 2RDGA 2IWHA 4H44C 3MC0B 2F0HA 2IGHA 1LT5D 1QB5D 3AEFB 2B2TA 2NTTA 1E10A 4A55A 4G4KA 4A3IB 4TQ0A 4S3SA 3IKJA 3R2TA 4LJZC 5E1FA 2KN4A 1EYCA 2WU2B 3URYA 2B2UC 2NB0A 1YQ3B 1TJEA 1RTOA 2WDVB 5C5MA 4FO2A 1ZE3D 1SNOA 2AQ1B 5JVH3 3ZQ4A 1XX8A 1BF4A 1V1PA 3A55A 3NTKA 3U9OA 5D7GA 4PT5A 4IUVA 3P7JA 1GJXA 4DAPA 1EEFD 4HKZE 1G91A 1DYQA 1ZPSA 3FILA 3W1SA 1C9FA 1HCZA 1JRPA 1PDXA 1I6HB 1SYGA 5KGUA 1TY0A 2EY1A 5T1IA 1Y69U 2RMMA 4KJNA 2E2IB 3J80E 1PFBA 1B9NA 1GXDC 3BVMA 3N52A 3S9WA 1STEA 1PGBA 3AE8B 2R7ZB 2R3ZA 2EE1A 2FUG1 4XDDA 2RSOA 3S17B 5HFYA 4CQNA 2Y5CA 3MTSA 1Y56A 4HTHA 3QJYA 5C3JB 2LJIA 1F0ZA 1V43A 4Q5VA 1NYQA 5JJZA 1SNMA 2L52A 3IXSA 3OW7A 3ONAB 2NTSA 4KN4C 1VF5C 1GUOA 2N9LA 1RCVD 3T3NA 3V3XA 2FMMA 4F7XA 2EDGA 3MXNA 4CJ0B 4JPSA 3OMCA 4LK1C 3MHZA 1ENAA 1EY9A 2K0PA 4XDXA 4KHVA 2MHVA 1XF5L 3PO0A 3R2IA 4CGYB 4CKCA 1KLGD 5IGFA 5CBAE 2D2CC 1NAPA 1F77A 2JXMB 2ON8A 5BN5A 1OXXK 4MN3A 3X3MA 1NUCA 4R3DA 5BMHA 1RTNA 4KY6A 1BXTA 2SNMA 5FO9B 4HKQA 2V0GA 2QF7A 1ET9A 3T53B 2W3RA 2XRSD 1TR5A 3R8BA 1QQRA 2F0GA 2F0IA 1VMPA 4K14A 1C8CA 4DN4M 5C0XJ 1QLBB 2EYHA 2J7ZA 2L83A 2I2YA 3HG9A 4ULLA 1JQ4A 2JWUA 4K8IA 1PRTC 5CV4A 3QIAA 2B8FA 1QOFA 5HHDG 2F0KA 2MJEA 2MJDA 1IUEA 5CV9A 3DHQA 2KCCA 3SEBA 4QIWB 3TP8A 1UUPA 1DM0B 5CC4A 1SYBA 4HSPA 2JXTA 3D31A 2AX5A 3P42A 5H92C 5BYRA 1KDCA 3L7ZC 2L4NA 1BO0A 1G2SA 4BBSB 2FJ2A 3I72A 4C1NK 1CT1D 1HTLD 4NW2A 4X3KA 5HGTA 1SXTA 1KFYB 2L1AA 1YN5A 5EE0A 4G57A 3K7AB 1EEID 1NCVA 2VZKD 4RNAA 2DY8A 2B39A 1MSHA 4X3UA 2BA0A 1MD2D 2MH7A 5CMDA 1XLOA 1Q1EA 2XN9C 5DEHA 5IT9E 1NI3A 4O1NA 4G7HC 1VCIA 3E9SA 2KMMA 1I4PA 3EA6A 1D6EC 1JQYD 2F0UA 1DXMA 4NMZA 1QG7A 2EPBA 5KEEA 2DNEA 1VZ7A 2F0JA 3PIO3 5HI1A 2GI9A 1LV9A 1KH0A 3VA7A 1P7EA 4YT0B 1H9SB 2KEDA 4A3GB 2B2WA 5I2YA 3M7NA 1S5ED 3FMCA 4CBVA 2AQ3B 1EQTA 1LTAD 3BDCA 1N5XA 1BDOA 1HPCA 4ZUJA 2M19A 1YNND 2VB2X 4MIUA 2JYTA 1X32A 2Q8RE 3I3CA 1CHPD 4YIJA 3DMUA 4X3TA 5BMIA 1TVXA 5DNFA 2N0SB 2B2YC 2F0EA 4N9TA 1SE2A 2A5HA 4BA2I 3OWFA 4R9WA 3LWUA 3C1EA 3DWQA 3NK9A 1DOKA 1BCPF 4KD3A 2Q8TA 4FXDA 1SBBB 2F0DA 2Z1CA 3FDTA 2KUMA 3H94A 1SB3C 1FCLA 2PTLA 1D1IA 3BK1A 4X3SA 3AMUA 1CZWA 1EYDA 5C3WA 4LTUA 1J9OA 2ZXPA 4BY7B 4L23A 2F0NA 2EJMA 3SK4A 3MHBA 3P1HA 5M5WB 1B1ZA 1F9RA 3C2PA 3NVWA 4C56C 4WJWA 3KF8A 1DOYA 4DGZA 1ONLA 4GZYC 1SE4A 3D4RA 2RDHA 2IJ0A 4GDKB 1AN8A 2CHBD 4A8XC 3F2UA 2WB1B 1XCTL 1SJHD 1FRDA 1JICA 3R3OA 3A7LA 1STNA 1RWSA 2BS4B 2DBYA 3SDZA 2WP9B 3NTIA 3PIP3 2KCNA 2BDNA 1QE6A 1STBA 5C5LA 5BYQA 1STGA 3ABVB 1XLPA 2WIIB 1DJRD 2XRQD 1U4RA 4ZLTF 1ZXTA 2EOTA 1J7BA 4PQXA 1BUIC 4K2KA 1PLFA 3MWYW 3CHBD 2OEOA 1FCCC 3E5SA 1EYAA 5I4DA 2F0VA 5M3FB 4D2KA 5C2TB 3VR2A 2V4IB 2NUCA 4NAWB 2JA6B 5FK9C 4JE3B 4DXGA 5EKIA 2WU5B 4EGVA 1F2LA 4GDLB 4BWGB 4HAEA 2WXMA 1EY4A 2HCCA 3AMZA 4C2MB 2B2TC 1WVLA 4BBRB 3J7AF 1FYCA 2K1BA 2EYJA 2LHDA 3NVZA 4XQQA 3PUXA 4REZA 2DWQA 2KOLA 4HCSA 4AYBB 1B9MA 3HVDA 2L11A 4NKLA 1KABA 1MSGA 1KRHA 4FF4A 3ZJVA 1Q1BA 3LXFA 1Q3LA 2XVSA 1N61A 1Z47A 4ILWA 1RODA 3Q8BA 2M56B 1NYRA 1JORA 3VR6A 3CIRB 1O7ZA 5CBEE 5KRUA 1TS4A 1UNSA 3T13A 4CKBA 4C3HG 3DEOA 2K04A 3Q6SA 1W6KA 1ZEQX 2L32A 3FAHA 2PZUA 3EGRA 4L2YA 1KAAA 5D14A 1ILPA 3PV0A 5LL6S 4QB4A 1PDQA 1EM7A 5C3XA 1F2RC 1KLUD 1OXUA 4OVZA 1LT4D 2WNMA 1G6ZA 4ZRQA 4B9XA 3H3VC 1CA6A 4FNFA 1Y1VB 3B2GA 4KD4A 1A15A 1LTRD 3I70A 2JEAI 1ILQA 5JEAG 3IL8A 2QMTA 1VDVA 5C44B 1AZQA 3OWEB 4HR7B 1ZDXA 5I6YA 2BDOA 3NZ3A 3AE9B 5KIXA 2WS3B 4PMBA 4N59A 1IGDA 4G7ZC 1CFMA 4C7YA 2K5QA 3V2TA 3K58A 2Y5PA 4ME5A 2ENBA 1VLBA 1BOSA 4A6QA 1CK1A 1QILA 1JOOA 4RCNA 3Q0AA 1DGJA 1OFFA 5G3LF 1PRTB 3NS1A 1XEEA 4HJGE 2I38A 2MGSA 1TS3A 2L55A 2BBCA 3DWMA 1JWUD 1A3TA 2EXZA 5JAVA 3W5VB 4IFDI 4IUQA 4WWMA 1SYEA 3U52E 2YU9B 4FYDA 3D8GA 2J42A 3TN2A 2B8GA 5DM73 1TWAB 3SVMA 1YN3A 1N62A 2KVMA 3K0YA 5J22A 2E2DC 3H8HA 4DK1A 3NQIA 5IGEA 2J0TD 2OEDA 1QKZA 4WRDA 4DFAA 1SFOB 3Q24A 4US8A 1TYGB 1O7YA 2JQRB 2ONQA 1RKNA 4TKOB 2JP1A 4FXGC 2EELA 4ABNA 3FILB