5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
1LTSD 1S5BD 1PTOD 3R8BA 1ESFA 5FKAC 2CHBD 2Z8LA 4L6TB 1V1OA 1LTGD 1PZJD 5ELFA 1LTRD 1B1ZA 1JR0D 1MD2D 1CK1A 1PYWD 1PRTB 1RDPD 1SJHD 2AQ3B 1F77A 2IJ0A 1TS3A 4UDUC 1TY2A 1KLUD 1LT6D 3BVGA 1TS4A 1YN5A 1KLGD 3BVMA 3URYA 1TS5A 3V05A 1YN3A 1AN8A 1FNVA 1BCPB 2QEJC 1QILA 3BYTB 1XTCD 1SJED 1V1PA 1RCVD 1HTLD 1LTAD 1ENFA 4RGOS 1PRTF 5D3IB 1FD7D 1FGBD 1SBBB 4RHSA 5ELCA 1YN4A 1M4VA 2WV6D 1EEFD 1CHPD 1CT1D 3O13A 1TS2A 2ICIA 2SEBD 3R2TA 1ET9A 1PRTC 4RGMA 1PTOB 1PZKD 1I4XA 1BXTA 3EFXD 1I4PA 1D5MC 4DXGA 1BCPF 3GP7A 1XXGA 1I4HA 1RD9D 1LTBD 4L63B 1SE4A 2RDGA 1KTKA 1BCPC 1PZID 1L0XB 3DWPA 1JCKB 5ELBA 3W2DA 1LT4D 1HA5A 3MFGA 1I4GA 2TSSA 4RGNA 1EU4A 1PTOF 4RFBA 1ET6A 1B44D 1G8ZD 1CQVA 1SE2A 3DWQA 1PTOC 1JWMD 1RF2D 1EU3A 3KLSX 1S5CD 1JWUD 5I4DA 4C56C 4DXFA 1DYQA 1S5DD 3MC0B 2AQ2B 2RDHA 2QILA 1LO5D 1STEA 4ZYSA 2NTTA 1UNSA 4RH6A 1EFID 1JWSD 3SEBA 1LTID 4O1NA 3BZDB 5FK9C 4Z9CB 1SEBD 2XRQD 3OWEB 1D5XC 4TSSA 2O2LD 5ELEA 4OHJA 2R61A 1EEID 1SXTA 1T5XD 2XN9C 5D3DA 1TY0A 1FNWA 1L0YB 1PTOH 5ELDA 1HXYD 1LLRD 2NTSA 1SE3A 4RCOA 1LTTD 2G9HD 2IPKD 1PRTD 2XRSD 1UUPA 4K6LA 3CHBD 3DWAA 4BWGB 5TSSA 3TSSA 1EWCA 1I4QA 1LT5D 1S5ED 3BVZA 1LT3D 1CHQD 1D6EC 3R2IA 3EA6A 1HQRD 1GOZA 1JQYD 2AQ1B 1BCPD 4RGTA 1DJRD 2XNAC 4RHRA 1FNUA 3BYYB 4NZLB 1AW7A 1D5ZC 2J4XA 1I4RA 1S5FD 1V1PB
chains in the Genus database with same CATH superfamily
2I46A 1Y56A 4FDBA 4A3EB 1A15A 3ZJVA 1FGUA 1GO3E 2EJGC 4R4OA 2KC1A 4HPMB 2B2YC 4W9CA 4JCVE 2WNMA 1DZ1A 3DHQA 1IL2A 3L54A 2F0GA 3P63A 2OF1A 4XC2A 1P98A 3NVVA 5LL6S 3HG9A 3N1XC 1SNOA 5A2QE 3M95A 4CDCC 4WH4A 1QILA 3BYTB 2A5UA 2NVYH 1NUCA 3F8TA 4EE2A 4PZ6A 5IT9c 5F2DA 1IYJB 1ACCA 1I50B 3MAQA 2UUAQ 3P4QB 2INNE 3RT3B 3N1YC 2JEBI 3B9JA 4X62L 1CJEA 2BT6A 3CC4A 3PF4A 2BB5A 2Z0EB 4P6VF 3CRLC 3K58A 3IXSA 3JVZX 3NJTA 3CCQA 3Q3JA 2LJ5A 4XWWA 3MTSA 3SHQA 3VDYA 1WGGA 3EBEA 3ALBA 2UU9L 3N9YC 3NS1A 2ACZB 3QQ8B 2NYZD 3GV6A 2F4VL 4LNFA 2KACA 2WXLA 1YBYA 4WURA 5I6YA 3S2DH 4A3MG 1A8VA 2B39A 2AL3A 2WX1A 3Q3OC 1PYBA 4JBWA 3D6CA 4JPBW 5DEHA 4EQ5A 1VQJA 3K7AH 4RMFA 3PSIA 1B70B 3ETRA 5M3FB 3SDLC 1QCBD 5GMVA 4F87A 2PE6B 3KLRA 2Z59B 1TWCB 2D0PA 2Z6BA 3E0JA 1SDFA 4N8X1 4BA2I 3TMEA 2I1KA 1T0QC 1H4RA 4KD4A 1ZDXA 4IWQA 1DM0B 5C4JH 1YNND 4A3BB 3RMHA 1OFFA 2ZNVB 2K9XA 3MXNA 4LF8Q 2A1AA 1YOVB 2MA9B 3CAMA 3NTHA 2UUBL 3ECIA 2F0SA 2IO3B 1HFNA 1STBA 2A8VA 3FMCA 4RMAA 2YU9B 3J9CA 4NJ6A 3LNNA 3IT4B 3SD5A 4C2MH 4DU9A 1UH6A 3AFPA 5HY6A 2ZCBA 4LCDE 5IP9H 1ZGUB 4YT0B 1WFYA 1TZOA 4K5XA 1WZ0A 1YX5B 5C44H 3M3JA 2CW0D 1UEAB 3RN9C 1XNQL 4FXDA 5C3EB 2KJRA 1EQQA 1N60A 4OONA 1CZGA 1WM2A 4HPPA 3AI5A 1S5ED 3M3YH 1D6EC 1BBWA 4X6AH 1PDXA 2IDYA 2YEPF 4RGTA 3J7AV 1W6JA 1CA5A 1SNCA 3QOLA 1TU2B 5E6NA 3K5NA 1N34Q 1X3PA 4KY5A 2JYTA 3HIZA 3VUYA 3PO2H 4A3FH 2GBJA 2VH1A 4OX9Q 4BXXG 2K6AA 2LZ6A 1P1AA 3T56B 4GLXA 3FPUB 3D6WA 3UE1A 1E7PB 2G4DB 2MP2A 1A3UA 3W1GA 4KKSA 4G57A 4JBKA 4QY7A 2DX5B 3CMEA 2IGGA 3B6YA 4S3SA 3I90A 1PYWD 2AQ3B 2WX0A 3I73A 5BMIA 2BA1A 4EEWA 1H9SA 4NMZA 5JHAA 1HA6A 4YWMA 3TDQA 3BVMA 1VQEA 1MG4A 2JA7B 2L00B 4FLHA 3PIP3 1YN3A 4P75A 4RKLA 5M3FG 4J1MA 4L23A 1AH9A 4ZUIA 2C7MB 3TZDA 2L15A 1RCVD 4KN4C 4C4VA 3OOCA 4RHSA 3RUIB 1AE3A 1CM9A 2WV6D 1CZPA 1T0RC 1C77A 1U4AA 1MJCA 1WYWB 2FCMA 2KHWB 3LJ3A 4YIJA 4A3KH 3K57A 3S17B 3IL8A 1C4CA 1I5FA 1Q3LA 1KM7A 1PRTC 4JWUC 3GE3C 2EYOA 5C0XJ 1TKYA 2Q5WD 1I4XA 3A4SC 4JYAQ 4I65A 2F0QA 3WOFA 3A8IE 1CZWA 5IAAC 3RNCC 1J0GA 5J39A 2ON8A 2PTLA 1IBLL 2N1VA 2WACA 2NVQB 3MXNB 4MGZE 2AKWB 5CMDA 5JAVA 1OXVA 3KYDD 4F7ZA 5LMNW 3DWPA 4BBRB 4CKCA 4DR7Q 1SRUA 3I4MH 2F0TA 2BH8A 2TSSA 1XMOL 3Q8AA 2CWPA 3P1MA 1PTOF 2KK8A 2QKIC 1FCLA 2M00A 1KJTA 3KWVA 5G5HA 3GZNB 5M3MH 3A9JA 4E6IA 4J3OD 1SNDA 4KHPL 4A3GH 1E1TA 2FMMA 3UDXA 1JW9D 1HTOA 4NQLB 3N3KB 3U2SC 2L76A 4FADA 3A7LA 1C7YA 2Q8RE 1MBYA 3ZO5B 4EGVA 3HFZB 5K36G 2W3RA 1E1OA 3QR8A 4N9F4 1QOFA 2Z6KC 2B63B 2L11A 1Q46A 2NTTA 4DV1L 1EZ6A 4DUYL 4RH6A 3I63C 3RNGC 3H6MA 5KHQA 5DPWA 4YCUA 3BZDB 2GMIC 5E6OA 2A73B 3I57A 3G6EA 1XLOA 5IY0A 2V0GA 4PS7A 3K59A 2PLPA 2IX3A 1R9TB 5D3DA 2ZVOA 3RCZA 4OELB 1PTOH 5E1FA 3MXUA 1T5EA 2R93G 3TJPA 1MJDA 4EZLA 3VR4A 5L37A 1GUOA 2CHWA 1DD2A 1MG8A 3AV8A 3FKIH 5JEAG 1HNZL 1YJ1A 1WE6A 2JA7G 5K5PA 2Z9HA 1VQ4A 4NXMQ 3IVFA 2MQHA 1H9SB 3HOZG 3MC9A 1A2UA 1E7UA 1N33Q 3ND9A 1WGHA 2D07B 4BFRA 2JP1A 1N9WA 1N8RC 1N36L 5HGQA 2AUJD 3AU5A 1TQOA 3Q3MC 1I35A 4X65L 3J80i 1QKZA 3EROA 2WYQA 3CCLA 1J8CA 4NZLB 5DPTA 4A3IH 5C5MA 3PSEB 3E9IA 3HOYH 3PRZA 1X56A 1LTSD 4A6QA 4C4VB 3BG3A 1XPRA 1GHKA 4BY7H 4L6TB 3NQTA 3CCMA 4OIJA 2WINB 3RPFC 2LXAA 5IOIA 1SSNA 3E5SA 4A55A 2RHSB 2NZ1D 1IZ6A 2DZJA 2OJRA 1O7LA 2GVAA 4MTKA 4UDUC 2MO0A 4BBRG 2KECA 2FE8A 3ZJTA 1UELA 1HRJA 2IGHA 5HGTA 1KLGD 1K0SA 3URYA 3N20C 2WLBA 4FN2A 3RNFC 2VY3A 1QOBA 1A5RA 2MBQA 1ZYRC 5ISRA 3V05A 4LDTD 1HZAA 1SMYD 3D3RA 3RLOA 3TS0A 2HDMA 5IOCA 4I6PA 1S4ZA 2J0JA 1X3EA 4IFDH 2WXOA 3DDCB 3W9CB 2M0XA 5D3IB 2E8GA 4DAVA 2FFKB 4NXNL 2BW2A 4C3JB 4YSXB 4POFA 5J17A 2KEDA 3X0WA 2IX1A 2JYEA 4N6EB 2KLCA 4W9LA 3SR6A 2EVBA 2EQSA 1WR1A 2JVCA 3AE4B 2DZKA 3T9LA 1HZCA 4JI2Q 3CC2A 1IPGA 1NI2A 1QZHA 1PGBA 3DQVA 1EOTA 2AUKA 5AUIA 4I7ZC 1N32Q 1RD9D 3A8JE 4QUCA 5KYLA 4K14A 3Q3NC 4AJYB 2A74C 3SVMA 4LF6L 2J0TD 1WY8A 1OEYA 1WGDA 1JCKB 3H8HA 1ISNA 4JI5Q 3PRPB 4DV4L 1IBKQ 3F1ZA 3CCVA 3ZLZA 5FR3A 3V62A 1EOVA 1TKGA 3I91A 1OQQA 4JLCA 3AB9A 3DWQA 2JYOA 1YJWA 1F2RC 2KVMA 3M4OB 2LGDA 3PO3G 2O6VD 1WTXA 2OXPA 2DY7A 5EBDA 4K0KL 2R7ZB 1NBFC 1WJUA 1XLPA 3SE0A 5DPRA 1ZKOA 4MGIE 1WI5A 3GTQB 2HJ1A 2K6QA 3L10B 2K5PA 4ZHPA 1J5EQ 2NCNA 2MJEA 2KOLA 1STEA 3A0JA 4DV5Q 4K8JA 3L13A 4PYUA 2K0PA 1SEBD 1WXSA 2NVUI 4LNIA 2WAQG 1VQAA 2K4KA 5JEAJ 4UY8C 1YHQA 5FLMH 1HTQA 1O7IA 2EY2A 1V86A 2WU2B 1YQBA 3AFQA 1SXTA 2LUMA 1XT9B 1FNWA 4XWTA 2VL6A 3T13A 2N7DA 1TXYA 1UUPA 5IWAQ 1OTRB 1NSNS 4RKBA 5IODA 5TSSA 3TSSA 2FCSA 1TIID 4R3DA 4JI1Q 1OXUA 3OTOL 3WAOA 4ZQ3A 2SNMA 4A3JG 2CCZA 3OHXC 2YYZA 1M90C 2Y5BB 1TR5A 1ML0D 4HIDA 1UWMA 1MPEA 4FJVB 1G91A 4BOZB 2Y5PA 4X3UA 2JXMB 1Y8PB 4HRSA 1WTHA 1QZEA 1V81A 3TP8A 2NVXB 2JXTA 5KNBA 1FL0A 3OLMD 5E4XA 4K6DA 1WTQA 4X57B 4IKGA 3UINB 2QF7A 2CHBD 5AFWA 4A4IA 3GTMH 2JA8B 4BKTA 2RBMA 1WD0A 4WWNA 3HOUG 4MSMB 1LTRD 3J7AF 3J80E 1YIJA 2CKHB 5H1SE 1Y8NB 4B3RQ 1J7CA 2UXBQ 4F8CB 4KGSA 2B3GA 4KIKA 5C4XB 1FJGL 2DJFC 1HR0L 5IP7H 2JZPA 3W5UB 3Q8DA 1YN5A 4APVA 1K28A 3MZ5A 1OGWA 4KY7A 1UBQA 3V61A 3VUWA 3B08A 1TWHH 1TWFB 2JF5A 1BCPB 3LYYA 2BBCA 4KDIC 2UUCL 4LNKA 2BYEA 4DFAA 5EKIA 2WDTB 2G3QB 3NY5A 4EFOA 2LGSA 1STYA 1HHVA 1UZXB 2WXMA 1WCMH 3DPDA 2E6XA 1JJ2A 5LXHA 2EPBA 3GD7A 4IN3A 2UXCQ 2A4ZA 2D2QA 1TS2A 2WDRB 3X23A 3APFA 2KMMA 2SOBA 3S16B 1PZKD 3P4PB 1LGRA 1WRIA 3T1HL 1I4PA 1WGKA 2L0FA 5BYSA 1WGYA 4N9TA 2WXGA 1F2YA 2N55A 5FJ8H 2JQRB 2KX3A 3EJIA 3S15B 2ATWA 2R7FA 3Q24A 2DZMA 4LTUA 3QX1A 2ASBA 1A70A 3AYHB 1D8LA 4OEMB 4DAPA 3KJOA 5NUCA 2ZM6Q 4V190 3M4PA 3G7LA 5I6WA 2B2UC 1FXTB 1JOOA 2E74C 4HCSA 4KD3A 2LS01 4JI4Q 4Q0FA 2UUAL 1FXAA 2B29A 2KOXA 2KVZA 4DWFA 1BR9A 4AH6A 4IG7B 4GB9A 1TT2A 2EYMA 2KEEA 3G48A 3PV0A 4WWOA 3AE6B 2VXWA 2C7NB 1XYIA 3MC0B 2YTVA 1LYLA 3GO5A 3H3VH 1X32A 3OJ3A 1DOXA 1YNXA 4P1BC 3AEEB 4GNXC 1MHHE 1UNSA 1JRUA 4JOIA 2K5NA 3FHWA 3LWUA 1JQ4A 1F9PA 1VF7A 1IL8A 4Z9CB 3HM6X 5CV6A 5IA7A 3M63B 3MFYA 1O7YA 4JW0A 1EUVB 5J22A 3BK1A 2CR5A 4IC7B 2KDBA 5J1ZA 1U9RA 1N5WA 4GSWA 1BVSA 2KANA 1T5XD 3VR2A 4AUQC 3KYHC 3A7AB 2RCFA 4CJ2C 1RAXA 4RCOA 2QDBA 2E5LQ 2REXA 4MH0E 4W9GA 5LMNQ 2INPE 1BBXC 1I3QB 3I5JC 1PFSA 3B2FA 2BDOA 4BS9A 4M1UB 3OSOA 4LF8L 1MSGA 3TREA 1AWDA 4ACFA 4C3HH 3OMGA 1VQHA 2F4IA 3I4NH 1GOZA 2ZZPB 4KIKB 4NQKE 4BKSD 3Q2AC 1Q10A 4HROA 2HIVA 5C0XH 2HUGA 2WB1B 4HR7B 3TBIB 3RR5A 1VMPA 1Q5WB 4IJLA 1XCTL 3KW5B 1RTNA 1BUIC 2G1EA 5FKAC 3Q6BA 1S5FD 1TYGB 4FXGC 3EQLC 4HTHA 3E9SA 3KQ4A 5LNK1 3F2BA 3UDGA 4R8IA 4BBSH 4YHHL 2MNAA 2VUMG 3FP9A 1CA6A 2N88A 2IY5B 1O80A 4ZRKA 4LF5L 4IUPA 2JT4B 3HUIA 1U4RA 2K5DA 2K75A 1V9JA 5M5XB 3IBEA 1TY2A 3SXHA 4EUTA 5IGEA 2KQSA 3ZIMA 4REZA 1YNJD 1JALA 2Q8TA 5BO4B 2WB1E 4DV2Q 3TRZA 4EOYA 4FF4A 1WMHA 2H4OA 1RTOA 3T8MA 4KKIA 1LXDA 1FEHA 2X8XX 3V6CB 1SJED 3GTPB 1N34L 4A3EH 3BK2A 1WOCA 3QCAA 4RM9A 5T1GA 2A68D 4DR1Q 4OX9L 1STHA 4GU2A 4JI0Q 3C0RB 3GTGB 2WQYB 1ET9A 3F2UA 4HIKA 4L5QA 3PIPA 1LACA 4F1SA 4FF2A 2NVTB 2V4IB 2F0FA 3OW7A 2J7QB 3HKZB 1Q86C 4JV5L 4GDKA 3FDTA 4IPCA 3ICEA 4US9A 2EKEC 5IGFA 1EZ8A 3VYTA 4BY1B 4OO1H 5LMUQ 1RFAA 5A35A 1KTKA 2L0CA 1YJNA 1BO0A 3H7SA 3RD4A 1D1KA 5HURA 2LI5A 4MGYE 2KXJA 2EXZA 1SYFA 3L9AX 5LLIA 4GOPC 2HT1A 3AE2B 2LFIA 3PO0A 2WXJA 4IWOA 1XMQQ 3HOXB 2H88B 5EGTA 4P7IA 2K1FA 1L1OC 5M5WH 1AEXA 4M02A 1CQVA 2CWAA 1NMFA 1BDOA 1PTOC 2RF4A 4KLKA 4XDCA 4P2CB 1CKOA 1B9MA 4ZLTF 1K0RA 2WXKA 3HKZE 4JE3B 1VQ9A 1ASZA 2A6HD 1DONA 1YX6B 4MELA 2Y0SG 1EWYC 4JYAL 5HKHA 2L5TA 4DHJD 1II3A 1KC8C 1QNUA 2IY0B 4A3CH 1L2NA 3S1MB 4HN7A 1EO6A 3K9OB 4HJ7A 2WB1G 5J3BA 4DR5Q 3ZNZB 1LTID 1H8CA 2Z6KA 3V3XA 4DR7L 5GAHC 5FK9C 2Z4HA 1YQ3B 1G2SA 3B2GA 1WTVA 4FF3A 3R93A 2O2LD 2O4XA 3UQBA 5IT9E 2WP8J 2ZTDA 4OHJA 2IZVB 2NPTA 1C78A 1OQYA 1CMXB 5DCNA 1OEYJ 1TZ1A 1TWAB 3K6OA 1E0BA 4WJQA 4A3BH 2JWZA 1WYDA 1NEKB 4HKZE 5LXIB 1PMRA 2I5HA 4G7HC 2V1YA 1SNMA 1ICWA 3DWAA 3NSWA 4I7AA 3IFTA 4FXKC 3AE3B 1F2ZA 1CI3M 3GOEA 1SYBA 4MNOA 4CBVA 2GOWA 2L52A 3C19A 1SFOH 1F9RA 3AMUA 3HVDA 3VR8B 1Y69U 1GUWA 3FAHA 3LGJA 3IKJA 5I9PA 2KX0A 3QARA 4B9XA 1P16A 1XLQA 1SAPA 3WCQA 5H8YE 4E74A 4OGQC 3CD6A 2WXPA 3AB5A 3ER0A 4DNRB 3CWIA 5C3EH 4C1NK 5T8IA 1PVOA 4IM3A 4M8AA 1WX9A 3AEAB 3Q69A 3CQZH 1EY8A 3HOWG 3DBHI 4PMCA 4DUZQ 1TGZB 4MN3A 2PEAA 4A9AA 1JR0D 2PZUA 1RRBA 1RDPD 1PRTB 4DR3Q 1XNRQ 2JRIB 4GDKB 4MIUA 1TS3A 4IM2A 1C9FA 1Y1VB 3NP8A 2INDC 3DVNV 4X3TA 4NXML 4JI8L 3RMKC 4C3IH 4LUOA 2KDEB 4DA2A 2A6EC 3HOXG 1G6ZA 1N33L 1XEEA 2RD0A 3A33B 3RNEC 3DBLB 2E2IH 1AN8A 4LJZC 3MEHA 3VVWB 2QGQA 1IYUA 4XXEA 3PCOB 2BCOA 4U673 4KN7C 1SGHA 3LX0A 2J0MA 1K83H 4HJAA 1SF0A 2G45B 2RSUA 1STAA 2MPMA 3JAMi 2NN6G 3R2TA 2R92B 2SEBD 2KCCA 3UDFA 3PGEA 1SIJA 2R2QA 4WIPA 3BJUA 2MP1A 3EHVA 4JWSC 4IUTA 2B76B 3IG3A 3NUCA 1MSHA 3DM3A 2HCIA 1AYFA 1JWBD 3GS2A 1SYEA 4IURA 4A75A 3NHEB 2N9KA 1JT8A 1E7ZA 1SE4A 5JVG3 1JICA 1VQ7A 3DHIC 3FILA 5I2YA 2VNUD 4AIMA 2MBBB 2F0LA 2IO0B 3BDOA 2QCPX 1EU4A 3N1ZC 4X66Q 4JI6L 4A3DH 3L0WB 2ZT9C 4K7SA 5CTRC 1ET6A 3T1YQ 2GBMA 2KTRA 4GXBA 2NPTB 4MDKE 1WI0A 1WTOA 2B2TC 4NDXA 1EU3A 1XX8A 2QSDA 3PUZA 2BKFA 4HIMA 1VZ7A 5CR3A 3RNBC 3VRAB 2IGDA 1EY4A 2BYFA 3J7ZC 4JI2L 1IBMQ 1S5DD 4LJOB 1R4NB 2GBKA 4MJSB 5CHVC 1N32L 3W1SA 1QNKA 4DV3L 2AMCB 2BWFA 4PG3A 1C0AA 1N61A 3H15A 1EFID 1JWSD 4B3SQ 1GD7A 1NYQA 4FULA 3S2HH 3CSTA 2IX0A 1QOAA 1FMAD 1VDZA 4GN5A 1IBKL 3EFUA 3VTVA 3TL5A 4KTAA 3S1NB 2D3BA 1K3RA 4O2DA 2K14A 4ASWC 3U4VA 1S3OA 1BBUA 5ELDA 2DNEA 3E0EA 3I8ZA 3X3NA 1HUMA 2VH2A 2D3AA 2NTSA 3HZXA 3QJYA 4H2AA 2KQ3A 1PH6A 2A6HC 2OTLA 2EOTA 1F2LA 5JJZA 2AWOA 2XRSD 3KH0A 1Y1VG 4DDGD 1J6QA 3D8GA 2B63H 1EY7A 3TEXA 2XWBB 2O2VA 1E8XA 2WHIA 4YL8A 1LT5D 3VYRA 3GZNI 1CHQD 1S72A 3FC4A 1PDQA 5EQ0A 1J5EL 4HMIA 4B3TL 1DOLA 2Q2HA 1WXMA 2INCC 3RZDH 5E4WC 1WX8A 4DV5L 2PO4A 2JA6H 1KHIA 1Q82C 1WJ4A 1D1IA 3NUHB 4X64Q 1FNUA 1R9TH 2LD9A 3DBHB 3S1QB 2W55A 3U8ZA 4F88A 3EN2A 2R92G 1PA6A 4FO2A 1MGSA 4GOCA 5HHDG 4N9PA 2V4DA 3TEHB 3WWVA 1WTPA 4K81A 4II2B 3A54A 1ESFA 4KSKC 3CC7A 2J0KA 2E2JB 1ZUD2 3VFKA 5IT9L 3OYYA 3FRPB 4JK1C 2PVOD 1A62A 3FVQA 1L4ZB 3SDZA 4UP7A 3Q22A 4HMJA 3ZTDA 4JI1L 1KLUD 4XQNA 3SK4A 3QJZA 2QCZA 4A76A 4B3MQ 2XBBC 3FILB 1L4DB 4XT3B 2PNRC 4LFCL 5C2TB 1NY4A 1K9MC 5J2RA 1HZ6A 2SNSA 3H0GH 1FNVA 1W3SA 4NPSA 4ZKBB 2V3PA 2OQ0A 4IQZA 4GZYC 3SU8X 3STBD 4OWWB 1B53A 2QHOA 4HJ9A 3C8YA 2N1WA 4F7XA 1K3BC 2LGYA 1B8AA 5C23A 2KTRB 5CBAE 2DLBA 2ZPNA 3IFWB 3ZW3A 3OW2A 5FLXc 3DWMA 4LFBQ 1L2FA 1CKMA 1SIFA 2K3UA 4PV1C 4OZAA 3DOWA 4B3RL 4PQXA 2UXBL 1WM3A 2K05A 5CBEE 2R93B 3TEWA 4JBMA 1HQMC 1B50A 4USAA 2DY8A 3HOVH 3J81c 1X6OA 3HP3A 4MTNA 4WJWA 2L32A 4HDOA 2O5IC 5G55A 3W2DA 2I07B 1PH8A 2ZVNA 1EY9A 4A3LG 4C3JH 3HOZB 4HJKA 1QVCA 1TWGB 3KLSA 3TMPB 3Q8CA 2F3VA 5BR8Q 1PH2A 4GN1A 1RIPA 5D65A 4L2YA 4NAWA 1JWMD 2B2UA 4X3KA 4WWMA 4C00A 4HKQA 3Q8FA 2UXCL 3T3NA 2EIFA 3GTKH 3PHWB 2KWVB 1V5OA 1P0RA 5I4DA 2JY6A 3AE8B 3CXCA 1Y14B 1NAPA 2XTIA 2NS5A 1ASYA 1NI3A 1RKNA 3IT6B 4N8FA 4UP8A 1A3VA 2O2VB 1HZ9A 3I70A 4K2LA 1ZEQX 3M9BA 2YTXA 1RHPA 3ERSX 3I56A 4GDLB 1PFNA 2B2WC 2LVQA 2SAKA 1R4PB 4FXCA 1WZ3A 3CIRB 2PNHA 2PYKA 3GTJH 4LFAL 3DCGA 1FM0D 3BDCA 2KKCA 2ZM6L 3CCSA 3DBSA 1X55A 2V1CC 1WR6E 1XF5L 2NVYB 3W1BA 2PVGC 4JI4L 4V0BA 2Y5CA 4XGAB 2WKDA 3VR9B 3N52A 4US8A 4HJ5A 3N6RA 3GTQH 2DWQA 2IPKD 4IUNA 3D0FA 2D3GA 4WQMA 1G51A 4ZRZA 4DR6L 4A20A 1R4QB 5FLXL 1I4QA 4UHVA 3PTFC 2VQEQ 4G7OC 1K52A 1WTWA 2JRHA 1TJEA 5L83A 2AWNA 3DLLA 1JQYD 1UWXA 2EYLA 1JROA 1UGMA 3NWTA 3R3MA 4MEMA 4OW0A 4BOSC 1E90A 5E6JA 4ZKCB 4WRDA 3J81L 3RN5A 2OJWA 4YSYB 1GKHA 2Q8IB 4B6WA 2X6LA 4MT5A 2J4XA 3P1HA 3S2DB 2WP9B 2KDFB 3L0OA 4IPDA 1FCCC 4HWIB 3PS6A 3W3AA 4Q2JA 2KDIA 1S5BD 4IWPA 3K7AB 4HCPB 1Y1WG 3PZ8A 2IHFA 2CH4W 4AOFA 2E5LL 1E7VA 1VQOA 1V80A 1VLBA 5LMNL 1YNNC 2CJOA 1Z7TA 4E3CA 1G291 3QK0A 4DKAC 2LJIA 1FVIA 3KDFA 4Y52H 2MSED 1C48A 3Q0AA 1XCQL 3DBRI 1LV9A 4GIVA 3PO3B 5E6PA 2HHHQ 3VA5A 3DHHC 4QJFA 4R4QA 1EFWA 2BE5D 2NVXH 4BBNF 5GAGC 3JAMc 4DV6Q 2ES2A 1UF0A 1TS5A 2F0HA 3AQQA 3UDIA 4IW0A 3C1FA 3DVGX 3BY4B 4HJ8A 2MH7A 2V3NA 3PLUA 5G2NA 4R1JA 3VUXA 1LTAD 3MTNB 2JA8H 2CHXA 1ZXHA 2KFJA 3DWGC 1QLBB 3NZSA 2CW0C 2RMMA 2FXQA 4C2MB 1EL0A 1JRPA 2WAQB 4RWSC 2KTFA 1GC7A 1CHPD 2N9LA 3K5OA 1KD1C 4NAWB 1V43A 4LWCA 5C44B 3DXJC 5C4XH 4GN3B 2HTME 4LNOA 5EE0A 4Y7NH 2F0EA 4WQOB 2L0TA 4IO9A 1C79A 3SFDB 3U4EG 3WALA 1BUVT 1JOKA 2UU7A 3RLNA 1ZE3D 1V2YA 2OHFA 4B9KA 3NQIA 4R9WA 3CMAA 2UWQA 1HZBA 4DV2L 1H9RA 5KGUA 4ULLA 4RGNA 2EYJA 4GOPA 3QA8A 4A3JB 2LGXA 2K5VA 2WAQE 1E0ZA 2BDNA 1L1OA 1A0IA 2H1EA 3S16H 1WIAA 2Y3AA 1GAQB 5JJIA 2KAJA 4JI0L 1YVCA 3PO2B 2N9EB 3IAS1 4ANXA 1QWYA 3TN2A 1B2TA 2N9XA 1ICFB 5C5LA 1PFMA 4HEDA 1VQLA 4ZRQA 2VB3X 4MGKE 3AE7B 4WWPA 4DN4M 3ABVB 1YJJA 2B2VA 4JG2A 3ZJYC 3HOUB 2QILA 3CCUA 2JPHA 2LWPA 2JA5H 4GKJL 2M56B 2LXJA 1LUZA 5MPOA 4CDEC 4ZYSA 2KQ4X 4JVZA 3OIQA 2B3AA 3CCJA 4IALA 3KK7A 1KLVA 5IYCH 4LF9Q 4YY3Q 1WRDB 1XMQL 1Z9FA 1J8IA 4OVUA 3JAML 1GUSA 2LXKA 1X65A 1H95A 3VTWA 1BF4A 4NY0A 1M8AA 2LHDA 1MIUA 4KHZA 2ZW0A 3AEVA 4EQOA 1TT5B 2RA4A 1B7YB 1BQQT 5CORA 2NBVB 3NBHB 2CKZB 4A3KB 4MZ9A 5JH5C 2MBEA 2ZW1A 4KVGB 1TKWB 3I4LA 3KDFB 2OWOA 1QOGA 2PZWA 2SDFA 1Q12A 1NE3A 1SN8A 4IJHA 1NNXA 5JVH3 2F4VQ 2JA6G 5L95C 1ILQA 4DR5L 1DJRD 2ZJDA 1SYDA 2FIDA 2F3WA 3E6ZX 1E6EB 3HRDD 5KRUA 5JHBA 4TRDA 3IAM1 4I6LB 4CDDC 2F0KA 5IP9G 1P8LA 3I4MB 3DBRB 5C44G 1I6HH 2DBYA 2EJMA 4WAFA 2IBIB 2LRWA 1NBWA 5KHOA 4XTCS 2G9DA 4IOCA 5ELFA 2P5ZX 4A3GB 1YJIA 1JJCB 2BS2B 4KJOA 1WWTA 4MSQB 2KCTA 3I3TB 4JI3Q 4PYZA 3TP7A 3DVGY 2JZZA 2KDMA 1IP9A 4G3XB 3BVGA 4XZ4A 1ZPSA 5CC4A 3Q23A 5BYQA 2L3ZA 3H91A 2WXRA 4MACA 5GROA 1QF6A 3AEGB 2E2DC 3PO2G 4A3FG 4GOPB 4RGOS 4TQ1A 1MFWA 1DOYA 5LHY1 5CV9A 1LM0A 3X3MA 1L1OB 5DM63 1CT1D 2LFNA 2QC8A 4URKA 2MJ8A 1PTOB 2L55A 3S14B 2YLMA 1YZ6A 4R4TA 4DUZL 1MI0A 3AU7A 4A3PA 2DHZA 5GQOA 3C1EA 2PW9A 5EE1A 1XNRL 3Q6SA 1B3QA 4A93H 4FBJB 2B2YA 1LTBD 1V9PA 4NJCA 3UF8A 4DR4Q 2BE5C 2F0VA 2GB1A 4KX6B 4OZBA 1E8WA 1V5TA 2A69D 2EZVA 2BH2A 5IYDH 3P2BA 1JOQA 4ZK9B 1HPCA 4I6NB 2D9UA 5KNCA 2FCNA 2IO2B 2F0DA 1OQRA 2DZIA 2NVTH 4NKLA 4QL5A 4A3KG 3PZDA 3HOYB 4HVBA 2KZRA 3PT2B 5ELOA 3I3CA 4Q5VA 2W54A 2EY6A 3AMZA 1L6VA 2F0OA 1J19A 2VUMB 2BB6A 2RDHA 2MBOA 4G7ZC 1WJNA 1UE7A 1JORA 3P42A 5GADC 2MJ3A 4KKJA 2ICEC 5M5YH 1XD3B 1E2WA 1E5WA 2YV5A 4KSLC 1PH5A 1SMYC 3I4MG 4FVMA 1Q1BA 3N30A 2K33A 1DGJA 2RSNA 3MVVA 4X66L 5M3MG 3L2PA 3AM9A 2R7DA 3OPOA 3T1YL 4CHTB 1L0WA 2GBRA 2MJDA 3H09A 1EYAA 1TY0A 1L0YB 4A3GG 2RDBC 3KF6A 1V6EA 1VQ5A 2EKIA 1LTTD 2GLSA 5IYBH 2K28A 2GBNA 5CV4A 4QGUA 3H7PB 5T1IA 3U30A 1EM7A 1K53A 2I1JA 2M17A 3ZRFA 1YITA 2H5XA 2BWES 1HQRD 2NR2A 2FUG1 2V4LA 3WDNA 2KMAA 4P74A 3ZDTA 1BCPD 1JB7A 3U50C 4B3SL 1KIXA 3HRZC 1YHBA 4QF4A 5IGBA 5BYRA 4OIKA 1VD2A 1TWAH 2NN6I 1H9MA 3CRKC 4ID6A 2EELA 4HPLB 1F2MA 4FP5D 2IL8A 4QMGA 4NPNA 4R4IA 2LVPA 3KF8A 3DEOA 3ULPA 1RFKA 4LAAA 2JE6I 3K5MA 3D4WA 1QVFA 5IP4D 5KEEA 1PH4A 3FKIG 1WXAA 4EX5A 4HDQA 1VQMA 3TS2A 1Y8OB 3G71A 1V8CA 4KZCA 2K50A 5AZGA 4R4CA 2CQOA 5BN4A 1W2BA 1GJZA 4WFN3 1X3FA 3VA7A 1LT6D 2VQFQ 4LMQD 3L17A 2Y0SB 1TS4A 2IWHA 4HIOA 1FIQA 3EUB2 4K1RB 3VYSA 4ICUA 1NR4A 4IUVA 1WSPA 5D94A 2Z0SA 4PZ8A 4X64L 4A3MH 3NBIA 4A3IG 4QCLA 3HGBA 1NDDA 1V1PA 1PQSA 2N7EA 2QJLA 4JL9A 3HOYG 3C3LA 3U7DA 5I9OA 1C3TA 2NWGA 4IM0A 4S0RA 1OXSC 3I72A 2W9NA 4BY7G 3QC8B 2C7HA 1H9KA 4C1NI 4JC0A 1F9SA 1GJXA 3GTLH 5ELNA 1E9MA 2EDGA 2AYOB 1XXGA 3UE0A 2Y0SE 3T4AC 2KQ7A 3CMMB 1XO3A 4NJ7A 1ZOYB 2GVBA 4B3ML 1WX7A 5IIFA 2L9HA 3IHPC 3VH4B 1YIWA 1YI2A 3NG0A 2XWJB 4MHEA 4X65Q 2K39A 2DYOA 2N0SB 2WXHA 3TP5A 3CPWA 2D62A 2PKOA 1DOKA 1AZQA 4IFDG 1AE2A 2G4SA 1B44D 1UE1A 3K80C 2BVCA 1R7SA 4W9JA 1JE5A 2WU5B 3KF6B 2VZAA 4LFBL 3DBLI 4XQJA 5FOBB 1QT9A 2KD0A 4KKTA 1RJTA 4DXFA 1OTCA 3GTMB 3OAWA 2EYHA 3V2TA 3UQAA 2JA5G 2DENB 3LB8C 3V60A 2KNBA 3HOWB 2LXCA 2RHQB 2LGIA 4K2KA 1M1KC 1WXVA 2LHEA 2K8BA 3I9V1 3D31A 5C3XA 3L4PA 4PT5A 4JBJA 4K5VA 2MUYA 2FIFA 1SYGA 1BMLC 1DCZA 5G3LD 1I6VC 3CF5A 2XRQD 1H9JA 2JSOA 2KUMA 2RDFA 3MXGA 1K50A 1I50H 3RD2A 5IO9A 3NVWA 2FINB 1PH1A 1AARA 2Z4IA 1U4PA 3J81i 1F9QA 4CDFC 5BR8L 2J53A 4L5SA 5DNFA 4BXXH 1VQ8A 1WD1A 1HXYD 3KF8B 1G6JA 1P3QU 1DXMA 4K6LA 3QHTA 4UAIA 2ZEQA 4ICVA 4O0AA 4CYEA 5C4HA 4KGRA 3ZUNA 4EQNA 2JQOA 3RNUA 2K6DB 3UIOB 2CS4A 4TMAB 3JW0X 1UWVA 4JQWC 1MKHA 3P4SB 3EA6A 3QIAA 1LFDA 1T3QA 4L5RC 2L12A 3CPFA 1GUNA 3E3XA 4FJZA 4M8NA 3PMFA 3PUXA 4DV4Q 3S1NH 1C76A 2PIAA 3H94A 2BYTA 2WIIB 2VZKB 5M3FH 1K8OA 1E8YA 2LASA 5FLMG 1D5ZC 2K5QA 1D7QA 4CGYB 1LABA 1I4RA 1R4NI 1TWCH 1V1PB 3PV1A 4D2KA 3M62B 2N78A 2E2HB 4TQ0A 4AP4C 4ZHOA 5CHFA 1KNAA 3A56A 3EVQA 3Q14C 3W1YA 1U4LA 4QIWB 2ID0A 2MHJA 2MWSB 4MJSA 1SJHD 4ZOHC 1EYGA 1KNEA 1ZXIA 2VQEL 1WTRA 1K8MA 2YU9H 1HH2P 4N58A 5BMHA 1EIFA 1OXXK 4BKGA 4EZJA 1EY0A 3ZVVA 2DAFA 2M4NA 2DAJA 2JU6X 2F0NA 2X38A 3RZOB 4BBNC 2MFIA 1ENFA 1QE6A 2IY1B 2E2JH 4JGHB 1STGA 1ZXTA 1FD7D 3QB3A 5KIXA 3OMCA 4OVVA 4CKEA 3O13A 4QIWE 2RQXA 4DV0Q 2UYZB 4ODGA 2E75C 4DPGA 4RM8A 4DQOC 3L7ZC 2HDEA 1NCVA 4DXGA 1CKNA 4ZDVA 1A3TA 1RODA 3WOEA 4IFDJ 2ZJQA 4IZ8A 4HJGE 1STNA 2K5HA 3E56A 3R3OA 5IP7G 5K36H 3GE8C 2M19A 3NVYA 4BAXA 3W5OA 1V8QA 2HHHL 3CSFA 4F8MA 5IGDA 1L0XB 3I4NB 5EPJA 1HUNA 2HD3A 1NMGA 3T51B 1UD7A 3K9PB 4IUQA 1QG7A 2J7ZA 1GM5A 1A6XA 1QZGA 1PUTA 1WCMG 3HEJA 3MHSD 3NWSA 2CHZA 3JSVA 2BS4B 2L83A 3KLSX 2M8SA 1S5CD 1VQDA 2R93H 2KFKA 4LF4Q 1GUTA 4M00A 2KHIA 2XEWA 5JEAH 5FJ8G 4FA6A 1FJGQ 2NMQA 3NXWA 3L08A 1J9OA 4RCNA 1X9NA 2JA7H 1XQQA 2Z1CA 1HNXQ 3ZGZA 2C5LC 1XPUA 1YNJC 4TV3A 3BINA 4XE0A 3HOZH 1A2TA 1KDCA 3P75A 1EIHA 1WJ6A 2DYMA 1WGRA 1KDAA 2CVRA 1PH3A 3A5UA 2XVSA 1YNTE 2J52A 1F2RI 3S17H 2A68C 1QB5D 4MM3A 2FMCA 1VQKA 4OXPA 1LLRD 2OEOA 1SE3A 3IRBA 3SK6A 3VR3A 5FLXE 5IYBG 2XK5A 3H9DA 1PRTD 1GVPA 2PQAA 3T1HQ 2PJHA 1PXUA 2EY1A 2NVQH 1X3QA 3KJPA 3BU2A 5HFYA 3RNAC 2FHTA 3J81E 3QIJA 1KOTA 4BBRH 4KGTA 4AQYQ 1OO9B 3B0AA 3G6JB 1CTMA 2E3TA 1YQ4B 3NK9A 2KCNA 3CCEA 4ME3A 4JX1C 4LF9L 2XNAC 3Q3FA 1HCZA 3BYYB 4HCEA 4JI5L 4H7BA 4YY3L 2MHVA 1VQ6A 3AU4A 1AW7A 4GGQA 1K8RB 4A8XC 4L5TA 1V1QA 5JPNC 5KYIA 2CFMA 5M5WB 1TBEA 1FD6A 3KLWA 3ND8A 2QA4A 1IBXA 2FUHB 2OT2A 1Z2MA 3MEFA 4IUMB 1T0SC 2KJHB 3AULA 1OXTA 1MD2D 4FHJA 1AZPA 3GTOB 3R7RA 1CKNB 3S1RB 4C3HG 3I4NG 3P4RB 3VAWA 2K01A 2F0PA 2PW5A 1YJ9A 4GDLA 2J42A 5M9OA 4G50A 3OG5A 5C0XG 4KZ0A 3VXWA 1WH3A 2FBWB 3AE5B 2XSCA 2ZTEA 4TUUA 3NPPA 1BKBA 3NTKA 4P16A 1XTCD 2DGYA 4AQ7A 2N3SA 5ELCA 1Q1EA 2M1MA 3CP0A 3NENA 4BBSG 2PI2A 3JSVB 4DNIA 3MJ5A 4CJ1B 2KLGA 2LRUA 2KWCA 4XYCA 2KFKB 1CUKA 2BA0A 3PO3H 1VRAB 1D5MC 5IWAL 2VW9A 3L3OC 3LWEA 3GP7A 4RF1A 2AX5A 4JI3L 3R66C 2QW7A 4JOIC 5EJWA 1HNWQ 1AP0A 3TBLD 3NTIA 3SR1A 1TVXA 2L05A 2NB0A 1HA5A 2F0IA 1SFOB 4W9FA 1FFUA 2K5WA 4RFBA 4A3EG 3RYTA 3A55A 4DK0A 4GS3A 1VQNA 1SE2A 2MQJA 4YHHQ 1S3SG 1PFDA 2LVOA 4MM3B 4GLAC 1ZKHA 3WA0A 2I0QA 2XK5B 4LF5Q 1KQSA 3QO2A 2WGSA 4W9HA 1GC6A 3D32A 2PQAB 4XYQA 4CHKA 2PCFB 3CQZB 5C1ZA 1E8ZA 1Y1WB 3ZNGC 3PVLA 5GXGB 4IUUA 1GHJA 3U4ZA 4OO1G 4AYBB 4J8QA 3H3VC 2LMCA 4IOAA 3PIO3 4JI7Q 3ZNHB 3EIVA 4DR4L 2MX2A 2ZTCA 2G5DA 3FPPA 5KNDA 1X1MA 4K7WA 4A3JH 3QG1A 1EY5A 3JAME 2JEAI 1L5PA 3DHGC 3Q8EA 3C2PA 4C3IB 1ZYRD 3AN1A 4HLEA 4ZRIA 1JB3A 1Z5SB 3UI3A 2JX5A 4PS3A 4ALPA 1NJIC 1DOIA 2KMCA 2E2IB 4DNTB 1RWSA 5ELEA 2A19A 2K1BA 2KBNA 2KHSA 2NBWB 1D2BA 4QUFA 1CQFA 4L1BA 2K22A 3QWZB 2BS3B 2MLBA 1K83B 1IBXB 2F03A 3DMUA 3HOUH 1X3GA 1Z6HA 4TVAB 4GKKQ 4BWGB 4JV5Q 3H6NA 3MHBA 3VR5A 1I94Q 3ML8A 4AYBE 4A3CG 3VDZA 4LW1A 5E7NA 2E76C 3QOJA 1LT3D 1DGSA 2GN5A 4B9WA 4WJ3M 1E10A 3L16A 2FNJB 3DVNU 2AQ1B 1EQRA 4KY6A 2JK8A 4XDXA 3KUDB 3WAPA 2KO3A 2ONQA 1Q8KA 1B9RA 1VQIA 3V6EB 4GNXA 2X6GA 1WXQA 2L8JA 2OCEA 1IUEA 1N6ZA 1BT0A 2B8FA 3PGZA 3AE1B 2HQEA 4IPHA 3M4OH 1KL9A 4A3DB 2ENBA 1VMCA 4A3BG 5AEKB 2R7ZH 1WYGA 3BWUD 3PUYA 4B95A 4HSPA 4JPSA 3A5ZB 1VZ8A 5JXVA 2O6VA 2UXDQ 4FJYA 4P73A 1ONLA 5CX3A 2A5HA 3QWNA 2MGSA 1S1QB 1C4QA 2L4NA 1FPYA 1Q0WB 2MO1A 2AEHA 3AEDB 4FHKA 5D6JB 1YHAA 5AJ3Q 2I5LX 2HQLA 2Q2IA 1UE6A 2F0MA 5BN3A 1VS0A 2GI9A 3RZWC 4DHZB 3A4RA 4NB3A 1C4AA 2RR9A 3S2HB 4YCWA 1K73C 3VQIA 5JJLA 4EVOA 3M4QA 5C3EG 4J15A 5A2QL 1JJGA 4RNAA 1D4BA 1M4VA 5E3FA 3VYUA 5C3WA 2RPVA 2PI2E 4P1CC 2DJGC 3MP9A 5D2MB 3AECB 2JZ3B 4XIGS 3NBHA 1T0YA 2CQAA 4AYBG 1U4MA 1RM6C 2JXXA 3AEBB 2HDLA 1B3AA 5IGGA 1BCPF 3ZDMC 3RULA 4DR2Q 1XLNA 4L63B 1WF9A 4C3IG 5C4JB 2RDGA 2VQFL 2KJ6A 2F0WA 1IW7D 2LMCB 2ZJRA 3TP6A 4CJ0B 1ROEA 2OEDA 2K25A 1SR3A 3APDA 2EXDA 4DHZE 1WJJA 5C3JB 2IHEA 4GLVB 5GAEC 3F2DA 4K3BA 3SK8A 3RZDB 3KUCB 2JA6B 1Q1OA 2C9WB 2N4FA 1GUGA 4LDTB 3HKSA 2KWDA 2F0UA 3HS0C 4BA1I 2RCNA 1KF6B 1KRTA 3NZ3A 3PLVA 1UGJA 3S14H 1QVGA 3I2ZA 1U0LA 1UE5A 1C1YB 5EKLA 1J7BA 4TKNA 1XJVA 1KXLA 2MP2B 1KFYB 1PV4A 1UAPA 1TKEA 5G5GA 2PE9A 1DYQA 4LF7Q 1JMLA 3AXCA 3SHLA 4JI8Q 5IE8A 3KUZA 2QMTA 5DM73 1R4MI 4WORA 2EY5A 1TWFH 3I7FA 1L0VB 3BIID 1CSQA 3M3YB 1UBIA 4ZUJA 4DV7Q 5CGKA 3TQYA 2D5GA 3MHZA 4GNXB 3STBC 4A3DG 1D3ZA 4DK6C 4DGZA 4M0WA 2C60A 3A9KA 3H0GB 4DK3C 5BMGA 4KK7A 4FYDA 4XT1B 2AL6A 3U58A 4N59A 1PLFA 1F0ZA 4DR1L 3Q8BA 5AUKA 2I38A 4A3FB 2NZOA 2ZNVC 2VUMH 2X69A 1NYRA 3CF6E 3S9WA 3LXFA 5EDSA 3S15H 5EPKA 2BF8B 2KWUB 2O6VB 2EJFC 1EWCA 3B1LX 5CHWA 4C7ZA 3R2IA 4R8NA 1ZDVA 2PPHA 3RI7C 5LMUL 1PHJA 4ZCKA 3V96A 4MH8A 4A90A 4OZCA 3HOVB 3NELA 2EE1A 2DN8A 2EYFA 4RHRA 4JI6Q 1AFPA 1KH0A 2MRPA 4EZKA 3ZXRA 2ZXPA 1NVID 1SYCA 2VS1A 3MXPA 4KKUA 1P7FA 3ENEA 3A9JB 1KRSA 4WJPA 2D3CA 2LEKA 4K3CA 2YEPB 2Z8LA 4X62Q 3ITPA 4FF1A 3APCA 3BZKA 4RA8A 5EBCA 1EIYB 4AWJA 2ALYB 2V9HA 4H02A 2ZCCA 5JJKA 2B63G 3TUOA 1GUAB 4CKBA 3GTKB 5BN5A 2OOBB 2PZTA 3CKIB 4B0MA 1YD8U 4X3SA 2IJ0A 2R6GA 4DV3Q 1VDVA 2IO1B 2N8NA 4ARCA 1QJOA 5G3LF 2UU9Q 4BVUC 1C8CA 3DEPA 2PW7A 4IFDI 3G4SA 2NBUA 1FFVA 2K52A 3BS1A 3K81C 2M9VA 4GN4B 4H13C 1Q90A 4OWXB 4K8IA 5LL6X 4QAYA 1ZW7A 4XX5A 3MJWA 2YVCA 2LKVA 3GTJB 2D0OA 2M2LA 2KN4A 2CU1A 2Q2TA 3HHMA 1RYJA 2H89B 3W5VB 3HM3A 1VZ6A 1G2TA 4II3B 1I3QH 5M3MB 1GB4A 1Z47A 1W6KA 4RGMA 4HSVA 4XQQA 3EGRA 5EKKA 3H7PA 1N5XA 3NZUA 3W1SC 2IYDB 2K8HA 2GA4B 2ZJPA 1SE9A 2FCQA 3MA2B 5AZFA 4PZ7A 4NP5A 4B3TQ 4M01A 2UUBQ 5FO9B 1PYSB 2VRRB 3NHHA 2OTJA 2RSOA 3MC8A 4KV2A 4DK5A 4BKSA 2PQEA 1FXIA 1PH9A 5ELBA 3KBXA 3H0GG 1LT4D 1MI2A 3MFGA 1VJKA 4NAMA 1I4GA 1ENAA 4ZRJA 3GDEA 2JN4A 2JWUA 1HR0W 1BNZA 5EAYA 2CJNA 4YWGG 4AS1A 2MBHA 3J7A5 1G8ZD 4NNJB 4M0WB 2B8GA 2HD5B 5EPLA 3A9KB 3H1UA 2MW5A 3GQBA 3NE5B 2D10A 1R4MB 3UI2A 1T6BX 1IYFA 2R3ZA 3SGIA 1WE7A 3WANA 1E2ZA 4O42A 1XNQQ 3M4YA 4EQPA 4DV0L 1VQGA 2WFWA 4TKOB 5M5XH 2KHJA 5JZEB 4YCVA 3J7YW 2FAZA 3PRMB 3TCAA 1DOMA 3UGBB 4DAMA 4DR3L 3HOVG 4RAUC 4YSZB 2RGFA 1WFQA 1IW7C 3FKIB 3PQIA 1LQBA 3AEFB 3ONSA 1PFBA 4KI0A 4LFCQ 3S2AA 3KUPA 1WVLA 2NZHA 3K8AA 4IPGA 4WJNA 3VTUA 1C4PA 2R2OA 3EFCA 3KFUA 3GTPH 2HE7A 3EC8A 4HK2A 4C3JG 1SNQA 1FYCA 1EIGA 2JUOA 2L1AA 3ZKJC 1GB1A 5CV8A 1SROA 2WXQA 1KRHA 2HIXA 1EEID 3PUVA 3GTGH 3KOJA 4A3IB 1GPXA 2ZXOA 4J6HA 1LM8B 2HJ8A 2WDQB 4LF4L 2B2TA 3HOWH 3CHBD 3ERQA 4ILWA 4BY1H 1GNUA 1HEZE 2ZPYA 4BY7B 3EECA 1VF5C 3JYUA 2MCNB 4HEA1 3VRBB 4AJWA 3CU7A 3BVZA 4UP9A 4WJOA 4Y7NB 2ASQA 2L7RA 4DXAB 3ML9A 1HNXL 1VQBA 2HCCA 2KA7A 4POGA 1JC7A 3HOXH 1IGDA 1VCIA 3K0XA 2QEXA 3AE9B 3TEZA 4B08A 1JE4A 3D4DA 4NW2A 1Q81C 2NUCA 1QQRA 1EYDA 3JC66 2R7ZG 4PMBA 1E24A 2L1BA 3ZNID 1PTOD 2K32A 3R8BA 1V1OA 1ESRA 2NN6H 1PZJD 3A74A 3KYCD 1P7EA 3BZCA 1KAWA 2GRIA 4YXDB 3S1MH 2BQQA 2VB2X 4K7UA 1CSPA 1EQVA 3VHTC 2IW3A 1CK1A 2C5CA 2RVLA 1F77A 1IBLQ 4YTNB 1XTDA 1IBML 5D14A 1Y8RC 3M7GA 1L7YA 3CW2C 4AQYL 2KYWA 4G11A 1VQCA 3VR6A 2BKRB 1LTLA 2JA5B 1HTPA 4LFAQ 1XMOQ 3NRZA 3CCRA 4KMUC 4W9DA 3RZFA 3ZQ4A 4LUZA 1MHXA 2E2HH 1SB3C 1EYCA 2KT7A 5FR6A 4ANWA 1V97A 3RLFA 1PRTF 1YN4A 1FGBD 2Z0DB 4G0NB 3SFEB 1Q7YC 4KHPQ 1NENB 4BZAA 2CU3A 5HI1A 3P20A 1NR2A 2TMPA 4H44C 2AHOB 5D7GA 4DR6Q 4LLGM 4WAAA 4K5WA 3EFXD 1N63A 4ANVA 2BGFA 3ZRCA 1I4HA 1K8AC 1PGXA 4LK1C 2AWTA 4XDDA 2N49A 1GXDC 4LNQA 4DV1Q 1K51A 4DUYQ 4L8JA 3FKYA 3RZOH 1PZID 4OVZA 1IXRA 1IGCA 5CV5A 4IOIE 4WJ4A 1F1HA 2F3IA 1ILPA 5I2XA 4ZAIA 1CFMA 1V49A 2JA8G 1EWHA 2WKCA 3PREA 2PPBC 2D5DA 3DM1A 3U52E 2F1MA 4FNFA 3U9OA 5C4ZA 2K8CA 3IFDA 5J18A 1EWIA 2F0JA 5JOBA 3H3VI 1I6HB 2XGTA 1JWUD 5C4XG 1GG3A 3WAMA 2K7VA 4C56C 2F52A 1HNZQ 3J80c 1Y1VH 3U9SA 4XYOA 1KABA 1QUQA 1SMXA 1SSOA 3K0YA 1XPOA 4ZRPA 3RUZA 1E3PA 2AQ2B 4KHVA 5CYUA 4YTPB 1FR3A 1MJEA 4C80A 2K04A 5C6AA 3C46A 1HNWL 2DYBA 3E9HA 1JWAD 2A6ED 1BOSA 1N36Q 4O1NA 3PUWA 1YEZA 1E22A 4KJNA 2DNCA 1MVKA 4YWKA 3OWEB 3LDZE 1I42A 2KJXA 2BOSA 1TIFA 2WS3B 1G6PA 3NEMA 3UIPB 1S40A 1HZ5A 2R61A 2R92H 2M0AA 1IKMA 5COYA 5FO8B 2XN9C 3M85A 3PIOA 5DLQE 4LK0M 3ZXVA 4QQBX 1SE8A 3SK5A 2W82A 2G9HD 2O5JC 5EE3A 5AZHA 2N7JA 2RKSA 4YTMB 1RLFA 5C0XI 1EY6A 4DK1A 4JIOU 4OWTB 3ULJA 1VQPA 4DHJB 3KBGA 1EQTA 4JI7L 4CO7A 4A93B 5IYCG 3I4OA 3IAYA 3I55A 5EE9A 2XIWA 1EUJA 2A69C 2B2WA 1B9NA 2MEKA 3MWYW 3PHXB 4GMVA 5IKCM 2BYVE 4TQUS 3U7ZA 3T16A 4P72A 1J7AA 3HK0A 1MHWC 4DAYA 1TWHB 4NXNQ 1ENCA 1TTNA 2ZXRA 2KN5A 4HXDA 3RN2A 1LTGD 2PMZB 4PK1A 1WCMB 2PMVA 3D4RA 1SNPA 2WXIA 3KVFB 4GKKL 5H92C 4GLSC 1B1ZA 5DPSA 3ZJUA 1B4OA 1HFGA 3T3OA 1I94L 4DF7A 3M7NA 4P71A 4GKJQ 3A1QA 2NBFA 3GB1A 3OJ4B 1O7ZA 2EMTA 3J80L 4LF6Q 2K03A 2OQKA 3N32A 1KDBA 4M8MA 4DDID 3AH7A 2DUDA 1HJPA 5M5YB 2Q2UA 2QEJC 1KAAA 2KENA 2I2YA 4A3LH 2QDLA 1HTLD 1X54A 4H0LC 4PMWA 2QIEB 4ZYNA 3RFZB 1Q8IA 1SBBB 5IGCA 1EF5A 3FEWX 2PMZE 3K5LA 1EEFD 5FO7B 2ICIA 4HCNB 3GTOH 4PS8A 4OO1I 3S1RH 1E2VA 2EYPA 4K0KQ 2YTYA 2B2VC 3K7UC 1BXTA 4ABNA 2JA9A 2N9PC 1VR9A 3OIPA 3NVZA 2UXDL 5DAUA 1YMHE 3ULLA 3TIXA 1XWEA 1QUQB 4KV6A 2DNFA 1C9OA 2KVRA 1FRDA 3F2CA 1BCPC 1JMCA 4S17A 3S1QH 3BDLA 3PZ7A 5AJ3L 3S24A 1HE8A 3ZYYX 2FJ2A 1NTGA 2JJQA 2LSSA 1A63A 2C35B 3GV3A 2QDFA 3ONAB 4ITKA 1RF2D 1F52A 3R7QA 2LUEA 2HTHA 3O65B 2BPSA 1IHZA 4LUVA 5TR5A 5CV7A 1F9JA 4CQNA 4UPAA 2RPQA 2W3SA 1QOHA 1P9DU 1VCBA 3DUZA 4A93G 4EKUA 1U5KA 3NS8A 1FRRA 4YWLA 1SLJA 4DR2L 1N62A 2KC2A 4C7YA 1LO5D 3OTOQ 4LJPB 1IYVA 2CH4A 4G4KA 3PPAA 2BTEA 5IN7A 2KCMA 3TZUA 3SEBA 2VZKD 4W9EA 4W9KA 1FO4A 4W9IA 2D11A 4ANUA 4C3HB 5IYDG 1WMHB 4DV6L 3QAQA 3KWLA 4ME5A 1D5XC 4ARIA 4A3OA 3NOBA 1K8GA 4IDIA 5HG2A 3ZTCA 4HAEA 4TSSA 1PGAA 2WDVB 4OL7A 3WIMA 4A3MB 1IKLA 4PNYA 1M94A 4B0EA 3T53B 2EMSA 4DAYB 1PH7A 3HKZG 2V3SA 1Y1WH 3TEYA 2LY7A 4U68A 3VH3B 1RL2A 4BY1G 2C9OA 1ZP0B 3J81j 3OWFA 4E71A 2I5MX 4J6IA 4BBSB 4LF7L 4DBGA 4RF0A 5JPMC 2JSVX 2WXNA 3HVZA 4LNNA 3GTLB 1HR0Q 1I7HA 3A1QB 1T9HA 3P7JA 4KDLB 2IT1A 1UEBA 1VQFA 4RG1A 4DV7L 3A8KE 1TWGH 2UUCQ 1EF1A 2WXFA 3PF5A 4QB4A 2WWZA 2D2CC 1L6UA 1O78A
chains in the Genus database with same CATH topology
2I46A 1Y56A 4A3EB 1A15A 3ZJVA 2EJGC 2B2YC 2WNMA 1DZ1A 3DHQA 2F0GA 3P63A 2OF1A 3NVVA 5LL6S 3HG9A 1SNOA 5A2QE 4WH4A 1QILA 3BYTB 1NUCA 4EE2A 5F2DA 1ACCA 1I50B 3MAQA 3P4QB 2INNE 2JEBI 3B9JA 1CJEA 2BT6A 2BB5A 4P6VF 3CRLC 3K58A 3IXSA 4XWWA 3MTSA 3N9YC 3NS1A 2ACZB 2NYZD 3GV6A 2KACA 2WXLA 4WURA 5I6YA 2B39A 4JBWA 3D6CA 5DEHA 3ETRA 5M3FB 1QCBD 4F87A 3KLRA 1TWCB 3E0JA 4BA2I 1SDFA 3TMEA 1ZDXA 4KD4A 1DM0B 1YNND 4A3BB 3RMHA 1OFFA 2K9XA 3MXNA 3NTHA 2F0SA 1HFNA 1STBA 3FMCA 2YU9B 3J9CA 3LNNA 3IT4B 4DU9A 4YT0B 1TZOA 4K5XA 2CW0D 1UEAB 4FXDA 5C3EB 1N60A 1CZGA 1S5ED 1D6EC 1PDXA 2IDYA 2YEPF 4RGTA 3J7AV 1W6JA 1CA5A 1SNCA 3QOLA 1TU2B 3K5NA 1X3PA 4KY5A 2JYTA 2K6AA 3T56B 3FPUB 3D6WA 1E7PB 1A3UA 4KKSA 4G57A 2IGGA 4S3SA 3I90A 1PYWD 2AQ3B 3I73A 5BMIA 2BA1A 1H9SA 4NMZA 1HA6A 3TDQA 3BVMA 2JA7B 3PIP3 1YN3A 4RKLA 4J1MA 4L23A 4ZUIA 3TZDA 1RCVD 4KN4C 3OOCA 4RHSA 1CM9A 2WV6D 1CZPA 1C77A 1B9RA 4YIJA 3S17B 3K57A 3IL8A 1C4CA 1Q3LA 1PRTC 4JWUC 2EYOA 5C0XJ 1TKYA 2Q5WD 1I4XA 4I65A 2F0QA 3WOFA 3A8IE 1CZWA 5J39A 2ON8A 2PTLA 2WACA 2NVQB 5CMDA 5JAVA 1OXVA 3DWPA 4BBRB 4CKCA 2F0TA 2TSSA 1FCLA 3Q8AA 3P1MA 1PTOF 2QKIC 2M00A 3KWVA 5G5HA 4E6IA 4J3OD 1SNDA 2FMMA 1JW9D 3U2SC 3A7LA 2Q8RE 1MBYA 4EGVA 5K36G 2W3RA 1QOFA 2B63B 2L11A 2NTTA 1EZ6A 4RH6A 3H6MA 3BZDB 2A73B 3I57A 1XLOA 2V0GA 3K59A 2PLPA 2IX3A 1R9TB 5D3DA 1PTOH 5E1FA 3MXUA 1T5EA 3VR4A 1GUOA 1DD2A 3AV8A 5JEAG 5K5PA 1H9SB 1A2UA 3ND9A 2JP1A 2AUJD 1TQOA 1QKZA 3EROA 4NZLB 5C5MA 1LTSD 4A6QA 3BG3A 1GHKA 4L6TB 3NQTA 4OIJA 2WINB 3RPFC 1SSNA 3E5SA 4A55A 2NZ1D 1O7LA 4UDUC 2KECA 2FE8A 3ZJTA 1HRJA 2IGHA 5HGTA 1KLGD 3URYA 2WLBA 1QOBA 1ZYRC 5ISRA 3V05A 1SMYD 3D3RA 2HDMA 5IOCA 1S4ZA 2WXOA 4IFDH 3W9CB 5D3IB 4DAVA 2FFKB 2BW2A 4C3JB 4YSXB 2KEDA 2IX1A 2JYEA 4N6EB 3SR6A 2EVBA 3AE4B 1PGBA 5AUIA 1EOTA 2AUKA 4I7ZC 1RD9D 3A8JE 4QUCA 5KYLA 4K14A 2A74C 3SVMA 2J0TD 1JCKB 3H8HA 5FR3A 1TKGA 3I91A 1OQQA 3AB9A 3DWQA 2JYOA 1F2RC 2KVMA 3M4OB 1WTXA 2OXPA 2DY7A 5EBDA 2R7ZB 1XLPA 3SE0A 1ZKOA 3GTQB 4ZHPA 2K5PA 2MJEA 2KOLA 1STEA 4K8JA 2K0PA 1SEBD 5JEAJ 2EY2A 2WU2B 2LUMA 1SXTA 1FNWA 4XWTA 3T13A 1UUPA 1NSNS 4RKBA 5IODA 5TSSA 3TSSA 1TIID 4R3DA 1OXUA 4ZQ3A 2SNMA 3OHXC 2YYZA 1TR5A 1ML0D 1UWMA 1MPEA 1G91A 2Y5PA 4X3UA 2JXMB 1Y8PB 4HRSA 3TP8A 2NVXB 2JXTA 5KNBA 5E4XA 4K6DA 1WTQA 4IKGA 2QF7A 2CHBD 5AFWA 2JA8B 2RBMA 1WD0A 1LTRD 3J7AF 3J80E 1Y8NB 1J7CA 4KGSA 5C4XB 2JZPA 3W5UB 1YN5A 3MZ5A 4KY7A 1TWFB 3LYYA 1BCPB 2BBCA 4DFAA 5EKIA 1STYA 1HHVA 2WXMA 2E6XA 2EPBA 3GD7A 4IN3A 2WDRB 1TS2A 2KMMA 2SOBA 3S16B 1PZKD 3P4PB 1WRIA 1I4PA 1WGKA 5BYSA 4N9TA 2WXGA 1F2YA 2N55A 2JQRB 3EJIA 3S15B 3Q24A 4LTUA 1A70A 4DAPA 5NUCA 4V190 3G7LA 5I6WA 2B2UC 1JOOA 2E74C 4HCSA 4KD3A 2LS01 4Q0FA 1FXAA 1BR9A 1TT2A 2EYMA 2KEEA 3PV0A 3AE6B 2VXWA 1XYIA 3MC0B 3GO5A 1X32A 1DOXA 3AEEB 1MHHE 1UNSA 1JQ4A 3LWUA 1F9PA 1VF7A 1IL8A 4Z9CB 5CV6A 3MFYA 1O7YA 3BK1A 5J22A 5J1ZA 1U9RA 1N5WA 1T5XD 3VR2A 3A7AB 4CJ2C 4RCOA 2QDBA 2INPE 1BBXC 1I3QB 3B2FA 2BDOA 4BS9A 4M1UB 3OSOA 1AWDA 1MSGA 3OMGA 2F4IA 1GOZA 1Q10A 4HROA 5C0XH 2HUGA 2WB1B 4HR7B 3TBIB 1XCTL 1VMPA 1RTNA 1BUIC 2G1EA 5FKAC 1S5FD 1TYGB 4FXGC 3EQLC 4HTHA 3E9SA 3KQ4A 5LNK1 4R8IA 1CA6A 2N88A 1O80A 4IUPA 3HUIA 1U4RA 2K5DA 5M5XB 1TY2A 3SXHA 5IGEA 4REZA 1YNJD 1JALA 2Q8TA 4FF4A 2H4OA 1RTOA 4KKIA 1FEHA 1SJED 3GTPB 3BK2A 5T1GA 2A68D 1STHA 3GTGB 2WQYB 1ET9A 3F2UA 1LACA 4FF2A 2NVTB 2V4IB 2F0FA 3OW7A 3HKZB 4US9A 3FDTA 5IGFA 1EZ8A 3VYTA 4BY1B 4OO1H 5A35A 1KTKA 2L0CA 1BO0A 3RD4A 1D1KA 5HURA 2EXZA 1SYFA 3L9AX 3AE2B 2LFIA 3PO0A 2WXJA 3HOXB 2H88B 5EGTA 1AEXA 1CQVA 1BDOA 1PTOC 4XDCA 4P2CB 1B9MA 4ZLTF 2WXKA 4JE3B 2A6HD 1DONA 1EWYC 2L5TA 1II3A 1QNUA 3S1MB 4HN7A 1LTID 3V3XA 5FK9C 2Z4HA 1YQ3B 1G2SA 3B2GA 1WTVA 4FF3A 3R93A 2O2LD 2O4XA 5IT9E 2WP8J 4OHJA 1C78A 1TWAB 3K6OA 1E0BA 4HKZE 1NEKB 1PMRA 4G7HC 1SNMA 1ICWA 3DWAA 3NSWA 3IFTA 4FXKC 3AE3B 1F2ZA 1CI3M 1SYBA 4CBVA 2L52A 1F9RA 3AMUA 3HVDA 3VR8B 1Y69U 1GUWA 3FAHA 3IKJA 5I9PA 4B9XA 1XLQA 1SAPA 3WCQA 5H8YE 4OGQC 2WXPA 3AB5A 4DNRB 3CWIA 4C1NK 5T8IA 4M8AA 3AEAB 3Q69A 1EY8A 4PMCA 4MN3A 4A9AA 1JR0D 2PZUA 1RDPD 1PRTB 4GDKB 4MIUA 1TS3A 1C9FA 1Y1VB 3NP8A 4X3TA 4DA2A 2A6EC 1G6ZA 1XEEA 1AN8A 4LJZC 3MEHA 1IYUA 4XXEA 2BCOA 4U673 4KN7C 3LX0A 1SF0A 1STAA 2MPMA 2NN6G 3R2TA 2R92B 2SEBD 2KCCA 1SIJA 4WIPA 2MP1A 4JWSC 4IUTA 2B76B 3NUCA 1MSHA 2HCIA 1AYFA 1JWBD 3GS2A 1SYEA 4IURA 2N9KA 1SE4A 5JVG3 1JICA 3FILA 5I2YA 2VNUD 2F0LA 3BDOA 2QCPX 1EU4A 2ZT9C 1ET6A 1WTOA 2B2TC 4NDXA 1EU3A 1XX8A 2QSDA 3PUZA 1VZ7A 5CR3A 3VRAB 2IGDA 1EY4A 1S5DD 3W1SA 1QNKA 1NYQA 1N61A 1EFID 1JWSD 2IX0A 1QOAA 1FMAD 1VDZA 4KTAA 3S1NB 5ELDA 2DNEA 3X3NA 3I8ZA 1HUMA 2NTSA 3HZXA 3QJYA 4H2AA 2KQ3A 2A6HC 2EOTA 1F2LA 5JJZA 2AWOA 2XRSD 3D8GA 3TEXA 1EY7A 2XWBB 1LT5D 3VYRA 1CHQD 3FC4A 1PDQA 5EQ0A 4HMIA 1DOLA 5E4WC 2PO4A 1D1IA 3NUHB 1FNUA 3S1QB 2W55A 4F88A 4FO2A 1MGSA 5HHDG 4N9PA 2V4DA 1WTPA 3A54A 1ESFA 2E2JB 1ZUD2 5IT9L 3FRPB 4JK1C 2PVOD 3FVQA 1L4ZB 3SDZA 3Q22A 4HMJA 1KLUD 4XQNA 3SK4A 3FILB 1L4DB 4XT3B 2PNRC 5C2TB 1HZ6A 2SNSA 1FNVA 4ZKBB 2V3PA 4IQZA 4GZYC 1B53A 3C8YA 4F7XA 5CBAE 2DLBA 3DWMA 2K3UA 4OZAA 4PV1C 4PQXA 3TEWA 2K05A 5CBEE 2R93B 4USAA 1HQMC 1B50A 2DY8A 3HP3A 4WJWA 2L32A 2O5IC 3W2DA 2I07B 1EY9A 3HOZB 1TWGB 3KLSA 3Q8CA 2F3VA 4HKQA 5D65A 4L2YA 1JWMD 2B2UA 4X3KA 4WWMA 3Q8FA 3T3NA 5I4DA 3AE8B 1NAPA 1NI3A 1RKNA 3IT6B 1A3VA 3I70A 4K2LA 1ZEQX 1RHPA 4GDLB 1PFNA 2B2WC 2SAKA 1R4PB 4FXCA 3CIRB 2PYKA 1FM0D 3BDCA 1XF5L 2NVYB 2PVGC 2Y5CA 4V0BA 2WKDA 3VR9B 3N52A 4US8A 3N6RA 2DWQA 2IPKD 4IUNA 4WQMA 4ZRZA 1R4QB 5FLXL 1I4QA 4G7OC 1K52A 1WTWA 1TJEA 2AWNA 1JQYD 1UWXA 2EYLA 1JROA 3NWTA 4OW0A 5E6JA 4ZKCB 4WRDA 3J81L 4YSYB 2Q8IB 2X6LA 4MT5A 2J4XA 3P1HA 3S2DB 2WP9B 1FCCC 3W3AA 4Q2JA 1S5BD 3K7AB 3PZ8A 1VLBA 2CJOA 1YNNC 1Z7TA 1G291 2LJIA 1C48A 3Q0AA 1XCQL 1LV9A 3PO3B 3VA5A 2BE5D 1TS5A 2F0HA 3C1FA 2MH7A 2V3NA 1LTAD 1ZXHA 3DWGC 1QLBB 2CW0C 2RMMA 1JRPA 4C2MB 1EL0A 2WAQB 4RWSC 1CHPD 2N9LA 3K5OA 4NAWB 1V43A 5C44B 3DXJC 2HTME 5EE0A 2F0EA 3SFDB 1C79A 3U4EG 1BUVT 1JOKA 1ZE3D 2OHFA 3NQIA 4R9WA 1H9RA 5KGUA 4ULLA 4RGNA 2EYJA 4A3JB 1E0ZA 2BDNA 2H1EA 2Y3AA 3IAS1 1GAQB 2KAJA 3PO2B 1QWYA 3TN2A 1B2TA 5C5LA 1PFMA 4HEDA 4ZRQA 2VB3X 3AE7B 4DN4M 3ABVB 1YJJA 2B2VA 3HOUB 2QILA 1E10A 2M56B 5MPOA 4ZYSA 2KQ4X 3OIQA 4IALA 3KK7A 1J8IA 3JAML 1GUSA 1BF4A 1M8AA 2LHDA 2ZW0A 4KHZA 4EQOA 2RA4A 1BQQT 5CORA 4A3KB 2ZW1A 1TKWB 3I4LA 1QOGA 2PZWA 2SDFA 1Q12A 5JVH3 1ILQA 3HRDD 1DJRD 1SYDA 2F3WA 3E6ZX 1E6EB 5KRUA 4TRDA 3IAM1 2F0KA 3I4MB 2DBYA 2EJMA 4WAFA 4XTCS 2G9DA 5ELFA 4A3GB 1YJIA 2BS2B 4KJOA 1WWTA 3TP7A 2KDMA 3BVGA 1ZPSA 5CC4A 3Q23A 5BYQA 3H91A 2WXRA 4MACA 1QF6A 3AEGB 2E2DC 4RGOS 4TQ1A 1DOYA 5LHY1 5CV9A 3X3MA 5DM63 1CT1D 2LFNA 2MJ8A 1PTOB 2L55A 3S14B 1MI0A 3AU7A 5EE1A 3C1EA 2PW9A 3Q6SA 2B2YA 1LTBD 4NJCA 2BE5C 2F0VA 2GB1A 4KX6B 4OZBA 2A69D 2EZVA 1JOQA 4ZK9B 1HPCA 2D9UA 5KNCA 2F0DA 1OQRA 4NKLA 3HOYB 3I3CA 4Q5VA 2W54A 2EY6A 3AMZA 1L6VA 2F0OA 2VUMB 2BB6A 2RDHA 4G7ZC 1JORA 3P42A 2MJ3A 4KKJA 2ICEC 1E2WA 1SMYC 4FVMA 1Q1BA 2K33A 1DGJA 2RSNA 3MVVA 3AM9A 3OPOA 4CHTB 2MJDA 3H09A 1EYAA 1TY0A 1L0YB 2EKIA 1LTTD 2K28A 5CV4A 5T1IA 1EM7A 1K53A 1HQRD 2FUG1 3WDNA 1BCPD 3HRZC 4QF4A 5IGBA 5BYRA 4OIKA 2NN6I 1H9MA 3CRKC 4ID6A 2EELA 1F2MA 4FP5D 2IL8A 4QMGA 3KF8A 3DEOA 1RFKA 4LAAA 2JE6I 3K5MA 3D4WA 5KEEA 1V8CA 1Y8OB 5BN4A 4WFN3 3VA7A 1LT6D 4LMQD 2Y0SB 1TS4A 2IWHA 1FIQA 3EUB2 3VYSA 1NR4A 4IUVA 1WSPA 3NBIA 4QCLA 2QJLA 3HGBA 1V1PA 3C3LA 5I9OA 2NWGA 1OXSC 3I72A 1H9KA 4C1NI 1F9SA 1GJXA 1E9MA 2EDGA 1XXGA 3T4AC 1XO3A 1ZOYB 5IIFA 2L9HA 2XWJB 4MHEA 2N0SB 2WXHA 2DYOA 3TP5A 2D62A 2PKOA 1DOKA 1AZQA 4IFDG 1B44D 1R7SA 2WU5B 4XQJA 5FOBB 1QT9A 4KKTA 1RJTA 4DXFA 3GTMB 2EYHA 3V2TA 3LB8C 3HOWB 2LGIA 4K2KA 2LHEA 3I9V1 3D31A 5C3XA 3L4PA 4PT5A 4K5VA 2MUYA 1SYGA 1BMLC 1DCZA 5G3LD 1I6VC 2XRQD 1H9JA 2JSOA 2KUMA 2RDFA 3MXGA 1K50A 3NVWA 2FINB 2Z4IA 1U4PA 2J53A 1F9QA 5DNFA 1WD1A 1HXYD 1DXMA 4K6LA 4UAIA 5C4HA 4KGRA 4EQNA 4TMAB 3P4SB 3EA6A 3QIAA 1T3QA 2L12A 1GUNA 3PMFA 3PUXA 1C76A 2PIAA 3H94A 2BYTA 2WIIB 2VZKB 1K8OA 1D5ZC 2K5QA 4CGYB 1LABA 1I4RA 1V1PB 4D2KA 2E2HB 4TQ0A 4ZHOA 1KNAA 3A56A 3EVQA 1U4LA 4QIWB 2ID0A 1SJHD 4ZOHC 1KNEA 1ZXIA 1WTRA 1K8MA 4N58A 5BMHA 1OXXK 1EY0A 2JU6X 2F0NA 2X38A 3RZOB 1ENFA 1QE6A 1STGA 1ZXTA 1FD7D 3QB3A 5KIXA 3OMCA 4CKEA 3O13A 2RQXA 4ODGA 2E75C 4DQOC 3L7ZC 2HDEA 1NCVA 4DXGA 1A3TA 1RODA 3WOEA 4IFDJ 4IZ8A 4HJGE 1STNA 3E56A 3R3OA 5K36H 3NVYA 2M19A 1V8QA 4F8MA 5IGDA 1L0XB 3I4NB 5EPJA 1HUNA 3T51B 4IUQA 1QG7A 2J7ZA 1A6XA 1PUTA 3HEJA 3NWSA 2BS4B 2L83A 3KLSX 1S5CD 1GUTA 5JEAH 2NMQA 3NXWA 1J9OA 4RCNA 2Z1CA 3ZGZA 1YNJC 4XE0A 1A2TA 1KDCA 3P75A 1EIHA 2DYMA 1KDAA 2CVRA 1YNTE 2XVSA 2J52A 1F2RI 2A68C 1QB5D 2FMCA 1LLRD 2OEOA 1SE3A 3SK6A 3VR3A 5FLXE 1PRTD 1PXUA 2EY1A 1X3QA 5HFYA 2FHTA 3J81E 4KGTA 1OO9B 3G6JB 1CTMA 2E3TA 1YQ4B 3NK9A 2KCNA 4JX1C 2XNAC 1HCZA 3BYYB 4HCEA 4H7BA 2MHVA 4A8XC 1AW7A 5JPNC 5KYIA 5M5WB 1FD6A 3ND8A 1IBXA 2OT2A 1OXTA 1MD2D 1AZPA 3GTOB 3S1RB 4C3HG 3P4RB 2K01A 2F0PA 2PW5A 2J42A 5M9OA 5C0XG 2FBWB 3AE5B 2XSCA 3NPPA 3NTKA 4P16A 1XTCD 4AQ7A 5ELCA 1Q1EA 3MJ5A 4CJ1B 2BA0A 1VRAB 1D5MC 3L3OC 3LWEA 3GP7A 4RF1A 2AX5A 5EJWA 1AP0A 3NTIA 3SR1A 1TVXA 2NB0A 1HA5A 2F0IA 1SFOB 1FFUA 2K5WA 4RFBA 3A55A 4DK0A 1SE2A 1PFDA 4MM3B 3QO2A 4XYQA 2PCFB 3CQZB 1Y1WB 5GXGB 4IUUA 1GHJA 4OO1G 4AYBB 4J8QA 3H3VC 2LMCA 3PIO3 3FPPA 5KNDA 2JEAI 3QG1A 1EY5A 3JAME 1L5PA 3Q8EA 3C2PA 4C3IB 1ZYRD 3AN1A 1JB3A 3UI3A 2JX5A 1DOIA 2E2IB 4DNTB 1RWSA 5ELEA 2K1BA 2KHSA 1D2BA 4QUFA 1CQFA 4L1BA 2K22A 2BS3B 1K83B 1IBXB 2F03A 3DMUA 1Z6HA 4BWGB 3MHBA 3VR5A 2E76C 1LT3D 3QOJA 4B9WA 2AQ1B 4KY6A 4XDXA 2ONQA 2X6GA 1WXQA 1IUEA 2B8FA 3AE1B 2HQEA 4A3DB 2ENBA 1VMCA 1WYGA 3BWUD 3PUYA 4HSPA 4JPSA 1VZ8A 5JXVA 1ONLA 2A5HA 3QWNA 2MGSA 1C4QA 2L4NA 3AEDB 2GI9A 2F0MA 5BN3A 1C4AA 3S2HB 3VQIA 4EVOA 5A2QL 4RNAA 1D4BA 1M4VA 5E3FA 3VYUA 5C3WA 2RPVA 3MP9A 3AECB 4XIGS 3NBHA 2CQAA 1U4MA 1RM6C 3AEBB 2HDLA 1B3AA 5IGGA 1BCPF 1XLNA 4L63B 4C3IG 5C4JB 2RDGA 2F0WA 1IW7D 2LMCB 1ROEA 3TP6A 4CJ0B 2OEDA 5C3JB 3SK8A 3RZDB 2JA6B 1GUGA 2KWDA 2F0UA 3HS0C 4BA1I 1KF6B 3NZ3A 1UGJA 1J7BA 5EKLA 1KFYB 1UAPA 1TKEA 5G5GA 1DYQA 1JMLA 3SHLA 2QMTA 5DM73 4WORA 2EY5A 1L0VB 3BIID 3M3YB 4ZUJA 5CGKA 2D5GA 3MHZA 4DGZA 4M0WA 5BMGA 3H0GB 4KK7A 4FYDA 4XT1B 4N59A 1PLFA 1F0ZA 3Q8BA 5AUKA 2I38A 4A3FB 2X69A 1NYRA 3S9WA 3LXFA 5EPKA 2EJFC 1EWCA 4C7ZA 3R2IA 4R8NA 1ZDVA 3V96A 4MH8A 4A90A 4OZCA 3HOVB 2EE1A 2DN8A 2EYFA 4RHRA 1AFPA 1KH0A 2ZXPA 1NVID 1SYCA 3MXPA 4KKUA 1P7FA 2LEKA 2YEPB 2Z8LA 4FF1A 3ITPA 4RA8A 5EBCA 3TUOA 4CKBA 3GTKB 5BN5A 2PZTA 3CKIB 4B0MA 4X3SA 2IJ0A 2R6GA 1VDVA 4ARCA 1QJOA 5G3LF 1C8CA 3DEPA 2PW7A 4IFDI 1FFVA 3BS1A 2M9VA 4H13C 5LL6X 1Q90A 4K8IA 2LKVA 3GTJB 2M2LA 2KN4A 1RYJA 2H89B 3W5VB 1VZ6A 1G2TA 5M3MB 1GB4A 1Z47A 1W6KA 4RGMA 4HSVA 4XQQA 3EGRA 5EKKA 1N5XA 2GA4B 3MA2B 4NP5A 5FO9B 3NHHA 2RSOA 2PQEA 1FXIA 5ELBA 3KBXA 1LT4D 1MI2A 3MFGA 1VJKA 4NAMA 1I4GA 1ENAA 2JWUA 4AS1A 1BNZA 2CJNA 4YWGG 1G8ZD 2B8GA 5EPLA 3GQBA 3NE5B 3UI2A 1T6BX 2R3ZA 1E2ZA 4O42A 3M4YA 4EQPA 4TKOB 3J7YW 1DOMA 4YSZB 4RAUC 3FKIB 1IW7C 3AEFB 1PFBA 4KI0A 3KUPA 1WVLA 1C4PA 4C3JG 1SNQA 1FYCA 1EIGA 2L1AA 1GB1A 5CV8A 2WXQA 1KRHA 1EEID 3PUVA 4A3IB 1GPXA 2ZXOA 4J6HA 2WDQB 1HEZE 2B2TA 3CHBD 3ERQA 4ILWA 3VRBB 4BY7B 1VF5C 4HEA1 3CU7A 3BVZA 4Y7NB 2HCCA 2KA7A 1JC7A 1IGDA 1VCIA 3AE9B 3TEZA 4B08A 1JE4A 3D4DA 4NW2A 2NUCA 1QQRA 1EYDA 4PMBA 2L1BA 1PTOD 2K32A 3R8BA 1V1OA 1ESRA 2NN6H 1PZJD 1P7EA 2GRIA 4YXDB 2VB2X 1EQVA 2IW3A 1CK1A 2C5CA 2RVLA 1F77A 4YTNB 5D14A 3M7GA 3VR6A 2JA5B 1HTPA 3NRZA 4KMUC 3ZQ4A 1MHXA 1SB3C 1EYCA 1V97A 3RLFA 1PRTF 1YN4A 1FGBD 3SFEB 1NENB 2CU3A 5HI1A 3P20A 1NR2A 2TMPA 4H44C 5D7GA 4LLGM 4K5WA 3EFXD 1N63A 1I4HA 1PGXA 4LK1C 4XDDA 1GXDC 1K51A 4L8JA 4OVZA 1PZID 1IGCA 5CV5A 4IOIE 1ILPA 5I2XA 4ZAIA 1CFMA 1EWHA 2WKCA 2PPBC 2D5DA 3DM1A 3U52E 2F1MA 4FNFA 3U9OA 5C4ZA 3IFDA 2F0JA 5JOBA 1I6HB 1JWUD 2K7VA 4C56C 3U9SA 4XYOA 1KABA 1SSOA 3K0YA 4ZRPA 3RUZA 2AQ2B 4KHVA 5CYUA 4YTPB 1FR3A 4C80A 2K04A 5C6AA 3C46A 1JWAD 2A6ED 1BOSA 4O1NA 3PUWA 4KJNA 2DNCA 1MVKA 3OWEB 2KJXA 2BOSA 2WS3B 1HZ5A 2R61A 2M0AA 1IKMA 5COYA 5FO8B 2XN9C 3M85A 4LK0M 3SK5A 2W82A 2G9HD 2O5JC 5EE3A 2N7JA 2RKSA 4YTMB 5C0XI 1EY6A 4DK1A 3KBGA 1EQTA 4A93B 3IAYA 5EE9A 2XIWA 2A69C 2B2WA 1B9NA 2MEKA 3MWYW 4TQUS 3U7ZA 3T16A 1J7AA 4DAYA 1TWHB 1ENCA 2ZXRA 1LTGD 2PMZB 1WCMB 2PMVA 3D4RA 1SNPA 2WXIA 3ZJUA 5H92C 4GLSC 1B1ZA 1B4OA 1HFGA 3T3OA 4DF7A 3M7NA 3GB1A 2NBFA 1O7ZA 3J80L 2K03A 1KDBA 3AH7A 5M5YB 2QEJC 1KAAA 2I2YA 1HTLD 4H0LC 4PMWA 2QIEB 3RFZB 1Q8IA 1SBBB 5IGCA 3FEWX 3K5LA 1EEFD 5FO7B 2ICIA 4OO1I 1E2VA 2EYPA 2B2VC 1BXTA 4ABNA 1VR9A 3OIPA 3NVZA 5DAUA 1YMHE 1XWEA 4KV6A 1FRDA 1BCPC