5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
1RF2D 1PTOF 5D3IB 1M4VA 3BVMA 2SEBD 4TSSA 1KTKA 1KLUD 1S5CD 1TS2A 4RGOS 4RGMA 5TSSA 3EA6A 1FNUA 1CT1D 2AQ1B 3R8BA 4Z9CB 1JR0D 2XRSD 3KLSX 1I4RA 1JQYD 1ESFA 1SE3A 1TS4A 2TSSA 1RDPD 1PRTF 2WV6D 5ELBA 1LTBD 3R2IA 4DXFA 3OWEB 2ICIA 1EU4A 4RGNA 1DYQA 2AQ2B 1LT6D 4NZLB 1BCPF 2AQ3B 5ELEA 1AW7A 1FD7D 4K6LA 4L63B 1TS5A 3BVGA 1GOZA 1HQRD 1MD2D 1RCVD 3BZDB 1D5MC 1D5ZC 5FKAC 1PYWD 5ELFA 4BWGB 1I4QA 1LTTD 1SJED 1FNWA 2XNAC 4RFBA 1LTRD 5ELDA 4O1NA 1V1OA 1S5ED 1RD9D 1LLRD 1BCPD 2O2LD 1EFID 1LTGD 4L6TB 1DJRD 1XXGA 4C56C 1JWSD 1I4HA 1S5BD 4UDUC 3V05A 1HA5A 1HXYD 1SJHD 1JWMD 1LT5D 1SXTA 1TS3A 2CHBD 2J4XA 1I4XA 2RDHA 1PTOB 1EEFD 1PRTC 1B1ZA 1BCPC 1B44D 1QILA 1V1PA 1FNVA 1UUPA 1PZJD 1EEID 2R61A 4DXGA 1CHQD 1HTLD 2XRQD 1CQVA 1S5FD 2XN9C 1YN5A 1D6EC 1S5DD 1BCPB 1XTCD 3BVZA 1L0YB 1SBBB 1V1PB 1PTOH 4RH6A 1YN4A 2IJ0A 3W2DA 2Z8LA 3EFXD 1G8ZD 1LT3D 4RHSA 1SE4A 2QILA 1SEBD 1EWCA 3DWAA 1I4PA 1CK1A 5FK9C 1PRTB 1JWUD 1TY0A 2G9HD 2IPKD 1PZKD 5I4DA 3MFGA 4RHRA 1L0XB 3SEBA 1TY2A 1UNSA 4OHJA 1PZID 3BYTB 1KLGD 1D5XC 1LT4D 1AN8A 3BYYB 1PTOD 1LO5D 3R2TA 4ZYSA 5D3DA 1BXTA 5ELCA 4RGTA 1EU3A 3DWQA 3TSSA 1JCKB 1I4GA 2QEJC 1LTID 1SE2A 2RDGA 1LTAD 3O13A 1PTOC 1STEA 4RCOA 1LTSD 3CHBD 3MC0B 2NTTA 1YN3A 1ENFA 1F77A 3URYA 3GP7A 1FGBD 1CHPD 1ET6A 2NTSA 1PRTD 3DWPA 1ET9A 1T5XD
chains in the Genus database with same CATH superfamily
4PMBA 1PFNA 2VQFQ 2RDFA 5IYBH 1VF5C 1MVKA 5A2QL 2OXPA 1KTKA 2PPHA 1GUGA 4RGMA 3ALBA 3TP8A 2CQOA 3T16A 2O5IC 2R7DA 2OQ0A 3NEMA 1KRTA 5DPTA 1WGYA 1YJJA 3AM9A 3KLSX 3L10B 2TMPA 1Q0WB 1CM9A 2KQ7A 1JJGA 4OO1G 1E7VA 2EPBA 3A7LA 1PRTF 2A6EC 2WB1G 4ME5A 3GTJH 1KM7A 2M17A 2WS3B 4DK3C 1N36L 2CR5A 5BMGA 5C44B 1I35A 1V9JA 2MHVA 1F52A 5J17A 3FMCA 3CU7A 2CCZA 2BGFA 2DAJA 1CKOA 5C4ZA 3IL8A 1TKEA 1RCVD 1Q1EA 1QJOA 5DLQE 1M1KC 2KOXA 1SRUA 3QWZB 4MN3A 1JW9D 2JVCA 4TVAB 1IYVA 3GO5A 4NMZA 2DWQA 1N63A 1CKMA 1LTTD 4IPGA 1FNWA 1WGKA 2KTRA 2EQSA 1EQVA 3HOYH 2PE9A 3FC4A 3W1GA 4G57A 1C4AA 4XQJA 2LXCA 3A7AB 2CU3A 4ALPA 1V1OA 4FP5D 3HOZB 1IBXA 1DXMA 4HDOA 3WAMA 3TP7A 2A68C 3CCEA 3IKJA 3WOEA 2PJHA 3K5OA 4QIWE 1SSOA 2HCIA 5CBAE 2ZVNA 2G1EA 1YQBA 4PYZA 3A56A 1EYDA 3E3XA 1K9MC 3RNCC 2K50A 1VZ6A 2E3TA 2K5HA 3Q8BA 1H9KA 2GN5A 2IGGA 3NBHA 2JSVX 2LXAA 3ZRFA 1CHQD 1CQVA 2JU6X 3WANA 2YVCA 3CMMB 3CCVA 2CVRA 3I72A 4ZUJA 1LFDA 2JYOA 4G11A 1NMFA 3I7FA 1Y56A 5EBDA 1EY5A 2G45B 4L5RC 3QO2A 2V1CC 1NTGA 1TIFA 3Q14C 1SEBD 2L7RA 2K9XA 1FXTB 1F2ZA 4K5VA 4HJ5A 1JRPA 2EYPA 1EIFA 4QMGA 1NE3A 2FCMA 3S24A 3EECA 1BKBA 1F0ZA 1P9DU 1IBXB 4UPAA 5HURA 2K5NA 1TYGB 2CH4A 2YTVA 3I73A 4EQ5A 4LF8L 2Y3AA 1CUKA 4XYOA 4O0AA 3VXWA 1FCLA 1IGDA 4K8JA 1VCBA 1XLNA 3KH0A 1IGCA 3P2BA 1MI2A 1D5XC 1S3OA 2K8BA 2Y0SB 4ZYSA 5M3MH 4A3IB 2HD5B 3UE1A 1STHA 4EQNA 3CCJA 4R8NA 1L0WA 3S15B 1N34L 4LFAL 1SB3C 1Q8KA 2KQ4X 5I2YA 5D94A 4F1SA 2RQXA 1VQJA 4P74A 2J53A 2VQEQ 3X3MA 2MBHA 2OOBB 1QF6A 5C3EH 2C60A 1ZE3D 2B2YC 2PQAA 2ZTCA 2ICEC 2A68D 3D8GA 2KHJA 5E3FA 2AHOB 3H0GB 4OX9L 5HKHA 4A93B 2F0EA 2EIFA 2KMAA 1IBLQ 2FE8A 4JG2A 2BPSA 4A3DB 1IW7C 4P71A 1NSNS 4PZ8A 4URKA 2WQYB 2ZXPA 2HQEA 1A8VA 2BDOA 4KLKA 1WSPA 4DR3L 1A2TA 2FUHB 2KYWA 3MXPA 5C4HA 1CT1D 4JI1Q 4F8CB 4PS3A 1HH2P 3QWNA 5FLXc 5KRUA 5FLMH 3M3YB 2E2HB 2KHIA 4CYEA 1MJEA 3KJPA 2JA8G 4YCUA 3K5MA 2BB6A 5M5WH 3RZOH 3AMUA 5LL6X 1FIQA 3KLSA 1VQBA 4IUTA 3RD4A 5GAHC 1XCQL 3OG5A 1IUEA 4WWOA 3PUZA 1Q1BA 1PV4A 1C1YB 2AWTA 1G6JA 1ICWA 2DN8A 4YHHL 1U5KA 1KH0A 2EMTA 2N9PC 3APFA 4HXDA 4A6QA 2NMQA 1C78A 3HS0C 4H02A 3PIPA 1R4NB 2QF7A 4ZOHC 2I2YA 4LUOA 1MJDA 1VJKA 5ELFA 2QHOA 1PYBA 1SF0A 5C44H 4ANWA 2UU9Q 3VTVA 3A5UA 4K5WA 1KF6B 1E22A 3H0GG 2HIXA 4XDXA 5C0XH 1IBKQ 4FF2A 4W9HA 1VQDA 3DM3A 1VQLA 1QLBB 1FYCA 1B9MA 3AEVA 4GN4B 4B08A 2IX3A 3PF4A 4Y7NH 1F2RI 1GHJA 2X6LA 1A0IA 4OIKA 3S2DH 1FXIA 4DK5A 3ZTCA 3P42A 4LJOB 3V05A 2M56B 4PT5A 1EYAA 1G6PA 3SDLC 3TIXA 2EXDA 4P6VF 3VVWB 3PVLA 2RDHA 1I4XA 1SNMA 2LVOA 2EDGA 2XEWA 2Y0SG 1JC7A 1QILA 1RTOA 3FAHA 4ANXA 4AYBE 1VDVA 3L17A 3Q3OC 3HOZH 3GOEA 1PZJD 1O78A 2EY5A 2KQSA 4UP8A 3ENEA 4NXNQ 4DR4Q 3PO2B 4M01A 3UDGA 1D7QA 1W3SA 4J3OD 1BBXC 3CRLC 1OEYJ 2NWGA 3PIOA 1STNA 4DV0L 4LTUA 2MEKA 1R9TH 2UXBL 3QAQA 1XLOA 4GOCA 4BXXG 3W1YA 1IBKL 1CKNB 3OYYA 3E0JA 1G6ZA 4GNXA 2FBWB 4KIKA 1PQSA 4NPSA 3U4ZA 4X57B 1E2VA 3DXJC 3AE5B 1TY0A 5GXGB 2A69C 1ILQA 2PE6B 1YITA 2BA0A 2JA6G 3FILA 2N88A 3MFGA 4RHRA 1Z9FA 1QVFA 2KN4A 4DHZB 2PVGC 3A9KA 4US9A 3U58A 1SNOA 1JROA 1Y8OB 3LNNA 4YWGG 5CHWA 2K5VA 3WIMA 2K5QA 1ZKOA 1STYA 5ELCA 4NXNL 2V3SA 2IWHA 1U4PA 3ONAB 3U8ZA 1O7ZA 3U52E 3HRZC 4C4VA 3H7PA 5J22A 3SD5A 2KXJA 2PMVA 4G7OC 1PXUA 3PO3B 5AJ3Q 5EJWA 4DV0Q 2K6DB 4ME3A 3FKIB 3RLOA 2FIDA 3KF6B 2XBBC 5IAAC 2NTTA 5D7GA 2E2IH 1MG8A 2RHSB 3A74A 1GUOA 4KD3A 2CJNA 3A8JE 4MT5A 1E0BA 2DNEA 2NVYB 5FO8B 4MGZE 2WYQA 4A3DG 1MHHE 1UGJA 2NZ1D 3BVMA 3ULJA 4DUZL 2B63G 1YNTE 2NPTA 3FDTA 2F0IA 4CHTB 1PH7A 4XWTA 1V2YA 3DLLA 1HUNA 2N7EA 4QAYA 2Y0SE 5FLXL 3I9V1 2R6GA 1QQRA 4H2AA 1HA6A 4AH6A 4K7UA 3AFPA 1NVID 3ZGZA 1WGRA 1SE8A 1SYEA 2K6QA 3M63B 1N6ZA 2N8NA 2XRSD 1RRBA 1Z7TA 3K7AH 2WXPA 2WXLA 4WURA 1L2FA 3T9LA 3D0FA 5BN3A 3I4MG 4LF5Q 4BY7G 3AEGB 1MKHA 5AJ3L 1YJNA 4JIOU 1CSPA 3OTOQ 2ID0A 4F8MA 2ATWA 2ZJQA 3ML9A 3I56A 4DV6Q 3CF5A 2FMCA 1CI3M 4YCVA 2F0UA 2K7VA 3TS2A 4ZHPA 2DYMA 2KX3A 2QDLA 3C0RB 5A2QE 2K28A 1J9OA 3NTKA 1ZDVA 2OJRA 4DUZQ 3B2FA 4RWSC 2ZTDA 5CYUA 3Q3NC 3U2SC 3KLRA 2DYBA 3A1QB 2WP8J 1H9JA 2NVTB 4PMWA 1Q5WB 2FFKB 1WYWB 1XTDA 1RJTA 2A5HA 5JOBA 5BYRA 1EQQA 3ZIMA 3A9KB 3A4RA 1J7CA 1EFID 1LTGD 4RA8A 2K22A 4K3CA 2GOWA 1J8CA 3FEWX 4C1NK 2JA6B 3Q8DA 1FEHA 3UQBA 4E6IA 1V8QA 1TWHH 3TP6A 2JZ3B 1QOFA 3AEFB 3I4NG 4DK6C 4A3BH 3STBC 3DMUA 4KIKB 5HG2A 1STAA 2BS4B 2BWES 2AMCB 1K0RA 1OQQA 2K5DA 2K0PA 4MDKE 5IN7A 2JWZA 2RHQB 4X3KA 3HUIA 3Q3FA 5FO7B 3NK9A 3E56A 2R93B 1WFYA 3JSVB 1E8XA 2Z4IA 4KN4C 1VLBA 4UP7A 2HQLA 2F0WA 2D62A 3CQZH 4M8AA 3Q24A 3H6MA 1BCPB 4BY1B 2HDEA 3F2UA 2LMCA 3QIJA 3CC4A 4P1BC 1DOXA 3NVYA 1L4DB 1WJ4A 2M8SA 5DPRA 4K81A 1HNWQ 3H6NA 2ZW1A 2MP1A 4OVZA 1I4PA 5FK9C 1PRTB 2UUAL 3L0WB 1UWXA 4Q0FA 1R9TB 5IGCA 1L1OC 1WFQA 3HEJA 1R4MI 2E2JB 3AULA 4JQWC 4IUQA 1TY2A 3W1SA 4BKGA 5C3EB 2LXKA 1KLGD 2A74C 2LJ5A 3B08A 3OMGA 5I6YA 2KMCA 1NENB 4USAA 2F4VL 4CKBA 3H0GH 5D3DA 3NZUA 1BXTA 1KJTA 4IURA 3X0WA 3T3NA 1HNXL 2ZNVC 4A3FH 1LTID 3Q3JA 1YHQA 1Z5SB 2HDLA 4DF7A 1PH1A 3T3OA 1LTSD 2EKEC 4ZCKA 5IP7H 2JWUA 3L3OC 2B39A 1GJXA 2HIVA 4DUYL 2IO0B 4AWJA 1HUMA 1E2ZA 5LL6S 2PI2A 4DNIA 3HFZB 3HIZA 4GLXA 4REZA 4LJZC 2WP9B 3PSEB 4KHVA 4OWTB 1X3EA 5BR8L 3T1YQ 1VQ6A 2VUMB 2JA7H 3R3MA 3UIPB 3U7ZA 2BA1A 4BKTA 1ASZA 3S1NH 1WH3A 3ULLA 1EFWA 1C76A 1II3A 4C3IH 1PH6A 3ZXVA 4ASWC 4JLCA 2EVBA 3BZKA 2R92H 2ONQA 1X3QA 3N30A 3H3VH 3HG9A 2F4VQ 5D14A 4JOIA 3OIPA 3NOBA 3JSVA 3PHXB 4EZLA 1B3AA 3BG3A 5ELNA 5J39A 3SR6A 1ESFA 4FULA 1TS4A 3SXHA 2MJ3A 2K14A 2B2UA 2EY2A 1SNQA 2YU9H 3PZ8A 1I3QH 1EU4A 5KNDA 3AU7A 4A3BG 4DXAB 3J80i 4ARIA 4A3GH 1CA5A 4JK1C 2PZTA 2E2DC 5FJ8H 4OZAA 4JWUC 3FVQA 5A35A 3BVGA 5FOBB 2ZVOA 3MC9A 3CSFA 2GVBA 1P8LA 2WIIB 3H94A 4RG1A 1VQ9A 2D3CA 1F9QA 5BR8Q 4AYBG 4BBRH 3T1YL 2NN6I 1Y1WH 3HOVG 1PGBA 4PK1A 3CD6A 1XLPA 2MFIA 2KECA 1ZKHA 1T9HA 1QVGA 3T51B 5EPLA 2EYFA 5BMIA 4HPLB 1A3VA 1XF5L 2CH4W 5F2DA 4DV7L 2VRRB 3CSTA 2O2LD 2MPMA 5CX3A 4FVMA 4NPNA 1ICFB 5AFWA 3UE0A 3N1ZC 4GDKB 2F0FA 3ZW3A 2FAZA 1HRJA 1D2BA 1C9FA 1SJHD 2QCPX 1D1IA 2RMMA 4TQ1A 1NR2A 1BUIC 1I94Q 3ZUNA 5M5XH 2DENB 1KDBA 1Q7YC 3RLFA 2JT4B 5J2RA 1B44D 3IT6B 1NNXA 5C2TB 3EFCA 2AL3A 4MIUA 2M4NA 3I5JC 4NQLB 3RULA 2OT2A 1OXVA 4HN7A 2V9HA 1PA6A 1EO6A 1FM0D 1PFBA 3J81E 4FBJB 2WXFA 3KDFA 4MH8A 1SNCA 3T56B 2E5LQ 4A3EG 3VUYA 1C3TA 3K0XA 1PTOH 5M9OA 2LGIA 3CKIB 2Z8LA 1YNNC 3QC8B 3S2AA 1VQ5A 2QILA 4LK1C 1EWCA 2FINB 4DV7Q 2Z0EB 4R8IA 3ONSA 4MHEA 1KDCA 4AYBB 2NVQB 1DZ1A 3PO0A 1E10A 3RZWC 1VQOA 1AWDA 2Z6BA 2NYZD 1HTPA 1X9NA 4LF4L 1V6EA 1V5TA 2N9EB 2DBYA 2LJIA 5AEKB 3K58A 1WTXA 1MG4A 1UELA 3B0AA 3NVWA 2WAQG 2SNMA 4GDLA 3FPUB 1HJPA 2GI9A 2WKCA 1PZID 3A0JA 3OOCA 4KGSA 3QJYA 1IPGA 1SYCA 3BYYB 3NHHA 1LO5D 4CDCC 3HOVH 4KKJA 1WM3A 2W55A 1IP9A 3HOXG 3PGZA 2BWFA 2OTJA 4V0BA 1JCKB 2GBJA 4N58A 4W9GA 3NTHA 2NUCA 3RN5A 2V4IB 1LTAD 3ICEA 2E5LL 4WH4A 3R7QA 3Q8EA 1TT5B 2NBWB 2C5LC 4MJSA 1YN3A 1WX9A 3HOWB 3VUXA 3R3OA 4KSLC 1FGBD 1MIUA 3E9IA 1VZ8A 3DWPA 2MBEA 3IAS1 3PV1A 1E0ZA 4A75A 4FF4A 3VAWA 2CKZB 3GTOH 1M4VA 3K7AB 1T6BX 2K8CA 2L5TA 3G6EA 2C9OA 4II3B 2Q2TA 2E75C 1RFKA 2UU7A 3Q8CA 4A3KH 1LQBA 1OXXK 1JOOA 2PI2E 1O7IA 1XPRA 2IX0A 1JMLA 2DHZA 3N9YC 3O65B 1YJWA 4S0RA 3E0EA 4KJOA 3EFUA 4W9CA 2F0PA 1MGSA 3R8BA 1J7BA 1WE6A 3GTQH 1E5WA 1E6EB 1NEKB 3DPDA 3RFZB 3KUZA 1WX8A 1NCVA 5BYSA 1N32L 3AH7A 3S1NB 3R2IA 5IOIA 4X66Q 3IRBA 3EIVA 4KI0A 3L16A 3ZXRA 2ICIA 4XWWA 4K7SA 2Z0SA 5DM73 2MJDA 3LB8C 4NZLB 1BCPF 1WE7A 3HOXB 5L83A 1AW7A 2WNMA 2B2WC 3M9BA 4BBNC 4BKSA 1EOVA 1DOYA 2JQOA 2CFMA 4B9KA 2HJ8A 1D5ZC 4DKAC 2WINB 1JORA 4LFBQ 1SMYC 2JJQA 2MX2A 4JL9A 4LMQD 1ZEQX 3PTFC 1L1OB 4WJNA 3D4RA 3PUXA 1YJ1A 5IO9A 2WXHA 4PYUA 3ECIA 3JAMc 2LFNA 4B3MQ 1Y69U 3CIRB 4EUTA 2UUCL 4V190 2LRWA 1RIPA 2FMMA 3V96A 1HR0Q 3L2PA 3Q6BA 1S5BD 2EJGC 3BK1A 4H7BA 3PIP3 3A33B 4P2CB 1TWCH 2UUBL 3M4OH 1K8GA 2CHBD 2RSNA 4LNFA 4ZDVA 5G2NA 3EQLC 1UBQA 1PRTC 4OZBA 5EDSA 1TIID 3L54A 3GTGB 2XIWA 3VFKA 3DBHI 4LK0M 1FJGQ 3VR6A 1VQEA 2IY0B 2D5DA 2YTXA 3I2ZA 5C3XA 1HNZQ 2VH2A 3P63A 2ZT9C 5FLXE 4WJ3M 2W9NA 3UI3A 4DV3Q 2L9HA 2WXJA 3B2GA 4R4CA 3GTMH 2HTHA 3W2DA 3M4QA 3G4SA 3MJWA 1GB1A 4EQOA 1SMXA 2JF5A 4B3ML 3TZDA 1I6VC 2UUCQ 4XX5A 4K8IA 4R3DA 3I3TB 4G4KA 1QB5D 4CJ0B 5LMNL 1QVCA 5JEAG 1RFAA 2R92G 1YNND 5J3BA 1EY9A 4AQYQ 4A3IG 4B3TQ 4I65A 1FRDA 1NR4A 5CV6A 4HLEA 2L0TA 5JEAH 3K5NA 4IM2A 3MP9A 3N6RA 2JA8B 3APCA 4RF1A 3E6ZX 2K4KA 1QZHA 1Q86C 2GVAA 3CP0A 1X54A 4OELB 3T8MA 3I8ZA 4PG3A 4DU9A 1WRIA 4MELA 2QEJC 3N52A 3NS1A 1MSHA 3FILB 4DV3L 5DPWA 2EXZA 3DBRI 2Z4HA 2WXRA 4HCNB 4OZCA 1M8AA 3HM3A 3CHBD 3ZVVA 4LF6L 4GLSC 2IT1A 2D10A 4BAXA 1KDAA 4CDDC 3RUZA 2R7ZH 2D3BA 4A3CH 3PRPB 3RN9C 3AB9A 4KKSA 3F2CA 3L08A 1IYJB 1KRSA 1N61A 4MM3B 1PGAA 5E6NA 2X69A 1H9SB 2N55A 1SMYD 1KLUD 3NUCA 1TKGA 3PO3G 5M5WB 4B3TL 4A3MH 3RT3B 3IAM1 4MGYE 1PMRA 1KAWA 1VQMA 1ASYA 3H7SA 2JP1A 4WWPA 3EA6A 1A5RA 3PUVA 5M5YB 1FNUA 4YXDB 2BE5C 4HCSA 1P98A 3SK4A 3SK8A 4A3DH 4EKUA 2A4ZA 4JI3L 3KJOA 3NZSA 3ZLZA 1AFPA 4ODGA 4IOAA 2V4LA 4IWQA 3TEYA 2F0MA 1BUVT 1VQHA 3IVFA 5AZFA 4LF6Q 2MJEA 1SYBA 2F0SA 4K0KQ 1L4ZB 2BF8B 3PLVA 4OEMB 1FD7D 1JRUA 5K36H 2LD9A 3KF6A 2MBBB 3KYCD 3C2PA 4IJHA 2F0JA 1L1OA 2D3AA 5G3LD 5IYCH 3QCAA 2OWOA 3V6EB 1X6OA 1EUVB 3D6WA 1Y8NB 3T13A 2G9DA 3VYRA 4DR6Q 1ZXIA 3AU4A 3VH4B 1XT9B 4ANUA 1QNKA 1ZP0B 4F7XA 2XNAC 3PUWA 2F0OA 5ELDA 3RMHA 4PV1C 3EJIA 1NAPA 1LLRD 5EE9A 1XNRL 1BCPD 2H1EA 3AE8B 3AYHB 4HVBA 4XT3B 2QA4A 1I4HA 1N8RC 1PDXA 2DGYA 4JI3Q 1WX7A 1JB3A 1G2SA 4KV2A 1B8AA 4DBGA 2V0GA 3N1YC 3W1BA 1K28A 3D31A 2LGYA 3QOJA 4DV1Q 2O6VD 2Z0DB 2K1BA 3S2HH 3UQAA 4GKJL 1TWFH 3N3KB 4W9JA 1WJJA 3P20A 5J1ZA 1E90A 2J0KA 2JA6H 4UY8C 1TWHB 2NVQH 2KWCA 1V81A 4JI6L 5E1FA 4L2YA 2JPHA 5LXHA 1L0YB 3OSOA 2BE5D 4JWSC 3NBIA 4DGZA 1QNUA 1K8RB 1SE4A 3CPFA 2J0MA 3CCMA 3WOFA 3CCSA 2QC8A 1XNRQ 2N4FA 4MJSB 3PSIA 3A5ZB 1VDZA 2KJHB 2B2WA 3OW7A 2KVMA 1SDFA 4ZLTF 1KRHA 1D3ZA 1L0XB 3D3RA 2O2VB 2WXIA 3HKZG 2B8GA 5C44G 1LT4D 1PTOD 4TV3A 2WXQA 1EU3A 4EQPA 1HZ6A 1S3SG 2VUMG 2MBQA 1IBML 5IY0A 4O42A 1BDOA 4OXPA 1F9PA 4HIOA 3E9SA 5JPNC 3O13A 1WJ6A 4A3KB 1AE3A 3K7UC 2UXCQ 2CHZA 2HE7A 2K25A 3DVGY 4J8QA 2R2OA 1WOCA 2KC1A 3SDZA 1N33Q 1YJIA 4E74A 1CHPD 1Y1VG 2F0DA 5EKKA 5IOCA 1GO3E 1PH5A 1KC8C 3M3YH 1YN4A 1E2WA 1T5XD 2R3ZA 3JAMi 3VRBB 2Q8RE 1P3QU 2B2VC 1DOLA 3A54A 3H09A 1RHPA 4L5QA 4M1UB 1F2LA 1WD1A 2JRHA 3P4PB 3AEAB 1E1OA 5DNFA 2Q5WD 4J6HA 3CF6E 4QQBX 3NVVA 4E3CA 3TEHB 1AE2A 4CJ1B 3GTPB 3TZUA 2WXMA 1GM5A 1JQYD 5LMUL 5HI1A 4PZ6A 1RL2A 3SK5A 1HHVA 3DM1A 1ZW7A 1WY8A 1R4PB 3RN2A 4GDKA 2R92B 2VH1A 1STGA 5EQ0A 3SGIA 1LYLA 3AEEB 2WU5B 1IKLA 1O7LA 4BY1G 1I6HH 4WAFA 1N33L 2WFWA 2F3IA 2NVTH 2A6ED 1YEZA 2JA5B 2ZZPB 4JBJA 3NHEB 4TQ0A 2UYZB 1WGGA 3KUDB 1BO0A 4Y7NB 3GTJB 4HJ9A 1WIAA 5C23A 1M90C 1PYWD 2L8JA 3D6CA 3F1ZA 2Q2UA 2DYOA 3NUHB 2IY5B 5IYDG 4O1NA 4LDTB 4UAIA 3ZJVA 3STBD 2MRPA 4X62L 1V8CA 2INPE 4W9FA 5C3EG 3T4AC 4WAAA 3LX0A 3RNGC 4JC0A 2EJMA 1EY4A 3SK6A 2RDBC 1JALA 2NB0A 3ZRCA 4UDUC 2C35B 1HA5A 3V3XA 3MHBA 1AH9A 4A3GG 1XCTL 2FCSA 1X3FA 3HOYB 2KQ3A 2QEXA 1JB7A 4GN5A 4JI5L 3KQ4A 1F9SA 1B1ZA 4CO7A 2KMMA 3N20C 4LNQA 2OJWA 3K6OA 2XRQD 1TBEA 3BK2A 1D6EC 2K8HA 4WIPA 1ZUD2 1YZ6A 2KTFA 4CBVA 3AV8A 5HHDG 1E3PA 2Q2IA 2V4DA 4KY6A 1K83H 4C3JB 2L11A 2O5JC 1YX6B 4QJFA 2KCNA 3EFXD 3N1XC 2JA8H 2AUKA 2IL8A 4NP5A 1E8ZA 1UD7A 4ZRQA 3IHPC 1YIWA 3WCQA 3PREA 3ND8A 4DR1Q 1VQ4A 5BYQA 1X3PA 2M2LA 3DEOA 4ZAIA 3Q3MC 3IXSA 3L13A 3KOJA 3SEBA 3K57A 4A3EB 3U9OA 1XPOA 3HRDD 2FJ2A 3PO3H 4KZCA 2LVPA 1WYDA 1FXAA 3EUB2 4BBSH 4NKLA 4CKCA 1GJZA 3RD2A 3VHTC 5HGTA 4YTMB 3I4NH 2WDTB 3ZNGC 3MFYA 4RF0A 3H8HA 4YY3L 1G291 3TUOA 5IP4D 4KN7C 2N78A 2EYLA 2JYEA 1PTOC 5I9PA 1DONA 2YEPF 1JWAD 1QT9A 4MSQB 4EOYA 4ZRKA 3HOVB 2M19A 3URYA 2ZPNA 2C7NB 1B70B 1PRTD 1DGSA 4NNJB 1PTOF 4W9KA 2DX5B 4DR1L 1VQNA 1FFVA 1XWEA 4P7IA 2RCFA 2OHFA 3CXCA 2KFJA 4X64L 2CWPA 4FN2A 1NUCA 1W6KA 4YWKA 2FIFA 2W3RA 2KVRA 3TEWA 1B9RA 2F0GA 1YOVB 3IFWB 2KEEA 3S1MB 2K01A 5IYBG 1KQSA 2PPBC 2E6XA 3PT2B 5EE3A 4IWOA 1Q90A 1VS0A 4WJWA 4YY3Q 5M3FB 1U4MA 5LLIA 4B0MA 4BBRB 1P16A 4C3IB 4LF7Q 3HOUH 3OWEB 1TTNA 4B3SQ 2NN6H 3M7NA 4N9TA 3B1LX 3VYTA 2V3PA 3M95A 3KK7A 1J6QA 1Q12A 4FXCA 3I4LA 1GKHA 2CW0C 5EAYA 4AUQC 4EZJA 4K6LA 4LF8Q 2E2HH 3M4PA 4LLGM 4F87A 5BO4B 4LUZA 1FR3A 4H44C 3I57A 1EM7A 4MZ9A 2JXTA 4LUVA 1I4QA 1UEBA 3M85A 3H15A 2JUOA 1CQFA 5CMDA 2MNAA 4J6IA 1K8OA 3J7YW 1HEZE 4XE0A 1XYIA 1F9RA 2KCTA 3F8TA 3P1HA 5IT9E 2PIAA 1PGXA 4ZK9B 4KY7A 2A8VA 1WF9A 1LACA 2CS4A 2KACA 3TEZA 2IHFA 4DNRB 2D0PA 2GBNA 3SHQA 2YLMA 4RKLA 3F2DA 3H91A 2D2QA 1HZAA 1SXTA 2WX1A 4U673 2KBNA 2D9UA 2FCNA 1PTOB 5C4XG 3BIID 1AZQA 1BCPC 1EEID 1XMQQ 5C5MA 4C3HG 3J80c 3N32A 3PRZA 1LXDA 3K81C 4DR3Q 3ZJYC 3RUIB 3CW2C 4DNTB 3I70A 3NXWA 5KEEA 1QZGA 2VL6A 2JZZA 3NBHB 2YEPB 2A73B 1WXMA 2RPVA 4ITKA 1GUTA 4EE2A 4US8A 5CR3A 4MSMB 4RCNA 5GAGC 2EOTA 4KGTA 2ZM6Q 1SGHA 3AEDB 1CZGA 2JE6I 2CWAA 2K52A 2G5DA 1GVPA 4F88A 4GS3A 4YHHQ 3I55A 1JWUD 3CAMA 2CKHB 2KWUB 1E8WA 4CDEC 4KVGB 4GB9A 5JJLA 1NMGA 3X23A 2WX0A 2QIEB 2PQAB 3HVZA 2W54A 1WD0A 1K0SA 1N9WA 3C1FA 4JI4Q 2XK5B 3A9JB 4EZKA 2UU9L 4DAPA 4PNYA 1XMQL 3HP3A 3A1QA 4OVUA 5H8YE 1B2TA 3KUPA 5M3FG 2MCNB 1IXRA 4GU2A 1ONLA 4L23A 2KJRA 3P7JA 1GUSA 3RZDB 2B2UC 1TKWB 4GNXC 4IUNA 2LGDA 4HWIB 1PH9A 2BVCA 3J7AF 5H92C 1MHXA 4DA2A 4HMIA 4WORA 2HHHQ 3S1RB 4JCVE 4GNXB 4FJVB 4LJPB 3UINB 1X3GA 2IW3A 3SR1A 2I38A 3SFDB 2I5MX 2DNFA 5C4XH 4DPGA 2YV5A 3AE7B 2IYDB 4DR4L 3NVZA 2RKSA 3FKIH 1T5EA 4IFDG 3D4WA 2X38A 3PZDA 2ZNVB 1NI2A 4DAMA 3HOWH 4XDDA 3ZJUA 3C3LA 3TREA 4ANVA 2KCMA 4BA1I 2UXBQ 4HKZE 4Z9CB 4Q2JA 2MGSA 1H9RA 4ABNA 1B53A 1HR0W 1JT8A 1J5EQ 2CW0D 4TUUA 1P1AA 3RLNA 1H9SA 5JVG3 4LF9Q 2LUEA 1B9NA 2WXGA 2JYTA 4C00A 2L55A 4NW2A 5ISRA 5FR6A 2PKOA 1PYSB 3BY4B 2I5LX 4NJ7A 5ELEA 3NE5B 4JBKA 4RMAA 4W9DA 1EY6A 1TS5A 4P73A 1MD2D 2GLSA 4LWCA 1T0YA 5JZEB 1D5MC 1NY4A 5CORA 4GXBA 1U4RA 4C4VB 2LWPA 4POGA 4ZRZA 3A55A 1QOGA 1K52A 2I5HA 2PMZE 1K3RA 4HCEA 4BKSD 2FUG1 1VQ7A 1CJEA 5FLMG 3GTGH 3S16H 1C48A 3VR9B 1QOBA 3IFDA 4A4IA 3DVGX 4WFN3 3VDZA 1J5EL 5I9OA 4IALA 3SU8X 4FXKC 1KXLA 2DZKA 4AJWA 4IUPA 4LF9L 1F2MA 1TS3A 4IM0A 3LXFA 2J4XA 2Q2HA 1JOKA 5KNBA 1SIJA 3CCRA 2C9WB 5IIFA 3CC7A 1XMOQ 1BOSA 1GC7A 2G4SA 4MH0E 3TL5A 3I4MB 4ZQ3A 4GOPB 5E4WC 2C7MB 2K75A 1RODA 5J18A 2PQEA 2BYEA 4QB4A 2MHJA 1E1TA 2F0KA 2XN9C 1YN5A 2MWSB 3V60A 2KK8A 3PPAA 4MGKE 4OVVA 1UH6A 4A8XC 2GBMA 2I0QA 2J7ZA 3B9JA 1TWAH 3Q69A 4GKKQ 2F0TA 3MA2B 1SFOH 3S2HB 1LT3D 4RHSA 1UZXB 4EGVA 3OTOL 3U4VA 3M4YA 4YL8A 1BF4A 5IP7G 1CZPA 1RAXA 1EY0A 4NJ6A 1SNDA 2SDFA 2FXQA 5GAEC 2I07B 2ZXOA 1V9PA 2OCEA 4DFAA 3DHHC 3QARA 2N9KA 1B7YB 2WAQB 4CKEA 4KV6A 3NTIA 2M00A 3R2TA 2F0NA 2E2IB 4JGHB 5EE0A 4A3LH 5JXVA 2AKWB 2DAFA 5CC4A 3ZKJC 5BMHA 2R7ZB 2NVYH 1YIJA 1G91A 3KF8B 2Y5CA 4DHJB 1PLFA 3OHXC 3J81i 2E2JH 3GV6A 4IO9A 2RF4A 4W9IA 3VTWA 4RNAA 2UXDQ 1A3TA 3WAPA 5MPOA 4GKKL 1QOAA 4B6WA 1GB4A 4NQKE 1DOKA 1ENFA 1KIXA 4C3IG 2VNUD 3K59A 2KHSA 3GP7A 3NS8A 3DBSA 3VH3B 1RTNA 1R4NI 1WMHA 3EC8A 3U30A 1Z47A 5C4JH 3W1SC 4JBMA 1RF2D 2OQKA 4X3TA 4IC7B 4GZYC 2BS3B 3TMPB 3L7ZC 2H89B 3VR8B 1ZXTA 4PZ7A 1WR6E 4A76A 2PZWA 1TS2A 4KDLB 2LEKA 4KY5A 1STBA 1SYDA 4AP4C 4R4QA 1HE8A 2J0JA 2JEAI 3DQVA 1JWBD 1T3QA 3HK0A 1DCZA 4B3RL 3ITPA 4AQ7A 5D2MB 4MM3A 2JSOA 2CU1A 4MTNA 1HNWL 3BZCA 4JYAQ 1TT2A 2ASBA 3QIAA 2QDFA 4BS9A 3ERSX 5GQOA 4A3MB 2UUAQ 3BINA 4I6LB 2GB1A 3U50C 1H9MA 2DJFC 2AQ3B 2PW5A 4DV5Q 1QOHA 4HAEA 1SN8A 2PZUA 3VA7A 3S1QB 3GTPH 3RMKC 1HTOA 1HQRD 5KHQA 4DDID 4NB3A 1VD2A 3RI7C 4K3BA 3WALA 1OXUA 2WACA 1W6JA 1I50B 3ZTDA 4S3SA 1UE1A 4HPMB 3HOYG 2L76A 2XK5A 4IG7B 4WJQA 3M3JA 3QX1A 1GD7A 2K6AA 4IDIA 1EYCA 2L05A 1M94A 1UEAB 5GROA 4B3RQ 1F2RC 4A3PA 1H8CA 2HD3A 2LSSA 3S14H 1WXSA 1ZXHA 3APDA 1GUNA 2XWJB 3AN1A 4NAWB 2F0LA 1Y8RC 3FHWA 1UWVA 4OWWB 1K3BC 4JYAL 1E9MA 3CQZB 4HJ7A 4XT1B 3U7DA 3B6YA 4BY1H 2MP2A 4N9F4 2EY6A 3GTMB 1ILPA 1FFUA 1V49A 2IHEA 4FXGC 1HFGA 4KKUA 2G3QB 4IPCA 3RZFA 1CTMA 2DNCA 3VYSA 4DN4M 3S16B 4DV5L 1NYRA 2R61A 5TR5A 4P1CC 3HOWG 1MBYA 4OGQC 4L5TA 1YHBA 1YNJD 3GZNI 1ZYRC 2BQQA 4ZRIA 5JVH3 5E6PA 5CHFA 2Y5PA 2INDC 2AUJD 3X3NA 1RYJA 5AZHA 1EL0A 1K8AC 4BY7B 4FHJA 3I4MH 4M8MA 3J81c 4QIWB 4P72A 1N36Q 1X56A 2JA9A 5LNK1 1ZOYB 5D65A 2KVZA 4CHKA 4NY0A 1EWHA 3IT4B 2RPQA 4HJGE 2WXOA 1ISNA 1XX8A 2WKDA 5G5GA 2X6GA 1PH2A 4K1RB 2BBCA 4P75A 1DGJA 1C9OA 2B3GA 2EMSA 2CJOA 1T0QC 4G7ZC 3U9SA 1Y1WG 2L32A 3MXNB 3RNUA 1GG3A 3ZNZB 3SHLA 4C7YA 5I6WA 3HGBA 3H3VI 3BDOA 2O2VA 1VQKA 4GN3B 4CJ2C 4A3EH 2JA7B 1PH3A 2DUDA 4HJKA 3IG3A 3MC0B 4BFRA 1J0GA 4ZUIA 4OWXB 1VMCA 3J81j 4OW0A 1WWTA 1TR5A 1I94L 2LGSA 4A55A 3CPWA 5JJKA 4TQUS 2KENA 1ET9A 3DVNV 3S15H 2WDQB 4E71A 1XLQA 4KHZA 2EYHA 2N3SA 2JRIB 1KFYB 2HUGA 1JMCA 4TSSA 1DOIA 3TCAA 1X32A 2B2VA 5CGKA 3JW0X 4GMVA 4WQMA 2L12A 4HROA 1XQQA 4IQZA 3UI2A 4MGIE 2L1AA 2NS5A 2F03A 4D2KA 2WB1B 4A3GB 1I6HB 1EWYC 3G6JB 4UP9A 2KWVB 1EIYB 2N1WA 3FKIG 4ILWA 5BN5A 1I7HA 4DWFA 2ZJRA 2M1MA 3TRZA 4DXFA 2AX5A 1KL9A 3TS0A 4NAWA 2FNJB 3MXGA 4JVZA 3E9HA 4LF4Q 1S4ZA 1AP0A 2M0AA 2L15A 3BWUD 4HRSA 4FXDA 5BN4A 1PVOA 2YYZA 2F3WA 4FO2A 2O6VB 3WA0A 2HJ1A 1XJVA 3SVMA 5JEAJ 3J7ZC 1WI5A 2C5CA 3BZDB 3KBXA 3JAME 4IM3A 2JA7G 2KJXA 4A3LG 1AARA 3VA5A 4KZ0A 4X3UA 4BBSG 2KJ6A 4DHZE 4LAAA 2IO2B 2KANA 1GUAB 1OEYA 3HOXH 2IO1B 1R4QB 2KOLA 4RFBA 1ZGUB 2IY1B 5G55A 1AEXA 4CDFC 2BCOA 4LFAQ 1N34Q 3NP8A 1UBIA 2VQEL 4R4IA 4G50A 1XXGA 3HZXA 3R93A 1CA6A 2EJFC 2ZW0A 2DY8A 4XC2A 4OX9Q 1TGZB 4KMUC 1V43A 3J80L 2DZJA 1WTHA 3A8KE 5IGFA 1IBLL 4W9LA 4G7HC 5LMNW 4Y52H 4NJCA 1HTLD 4C3JG 1X1MA 3PS6A 3Q23A 4LDTD 4XYCA 3KFUA 2RGFA 4NXML 1TWCB 3S17H 3BVZA 2GRIA 2N9LA 2NPTB 4JI1L 1WTWA 1LUZA 2HCCA 1XPUA 3WAOA 2JN4A 1PH8A 5C0XG 3ABVB 3NQTA 4A3MG 1N32Q 4IPDA 3W3AA 2BDNA 5KYLA 5I2XA 3QJZA 4JI0Q 4YTPB 1ZPSA 2NZOA 2PNHA 5IT9c 2L0CA 1R4MB 2GBRA 3Q8FA 3GTLB 2MP2B 3I4NB 2EELA 2SOBA 3J7AV 3WWVA 1PZKD 4ICUA 1KNEA 5FJ8G 2VW9A 4A20A 1BR9A 4YSZB 2IDYA 1Z6HA 4RKBA 4DDGD 1T0RC 4NDXA 3V62A 3IBEA 4LFBL 2K32A 1FD6A 1BVSA 2K03A 4JI7Q 4GSWA 5KYIA 2RCNA 2PTLA 4R9WA 3IFTA 4B9XA 2VXWA 2PYKA 5IGBA 4A93H 4IW0A 4ID6A 4PS7A 2OF1A 3AE9B 3GTOB 3KBGA 3P4RB 4R1JA 4NXMQ 1R7SA 3OAWA 5E6JA 1EZ6A 1P0RA 1D8LA 1SLJA 4AS1A 1YQ3B 4N59A 4HJ8A 3MHSD 4IJLA 3FP9A 4GLVB 1PHJA 3Q6SA 4JI0L 2UUBQ 1L6VA 3RR5A 3F2BA 4LFCL 3J7A5 5E4XA 5CV5A 4C2MB 1UAPA 5GMVA 5D3IB 3D32A 3DBLB 3RZDH 3GE3C 3LWEA 1PFMA 3K8AA 3BDLA 4LW1A 1HNZL 3AU5A 2GMIC 5AUIA 4HEDA 1S5CD 1EUJA 4GN1A 2KT7A 2YTYA 3RCZA 5H1SE 3P4SB 2AQ1B 4JI7L 2WWZA 3HVDA 1JR0D 4A3FG 5C4XB 1MJCA 4QUFA 3ND9A 2J42A 1EQTA 4QF4A 1V97A 5DEHA 1LTBD 2H5XA 2DJGC 3PUYA 2OTLA 1IKMA 3QHTA 5HFYA 4YCWA 4MTKA 1KLVA 3UDFA 1FRRA 1HZ9A 1WMHB 2AQ2B 5C3WA 4HJAA 4FDBA 4AQYL 3OLMD 5LHY1 4DR2L 5EPKA 2F52A 1A62A 4AOFA 2C7HA 2OEOA 4LFCQ 5C0XJ 5M3FH 3TJPA 2WB1E 3PQIA 1VQGA 2B63H 1GPXA 2BS2B 4JPBW 2LUMA 1WXQA 2LASA 3DBHB 3V6CB 2LS01 1HZ5A 2KTRB 1NYQA 1JJ2A 1S40A 3ZQ4A 2PW9A 2LY7A 2I1KA 1LTRD 1YBYA 3DCGA 3ZO5B 4TKNA 1CSQA 2BB5A 3EGRA 3K80C 2Z59B 3IAYA 1OXSC 3ZNID 1FPYA 1V5OA 2Z6KC 2UWQA 1N60A 3CCUA 2B29A 4DR7L 2KDMA 2VS1A 3HHMA 4IFDH 2AYOB 2DLBA 1C79A 1B50A 1VQCA 1Q8IA 4L1BA 3NSWA 1YJ9A 2ALYB 1Z2MA 1UUPA 4DR2Q 4DXGA 2MJ8A 5JAVA 2XTIA 5CV7A 5EBCA 2CHXA 1WR1A 4I6PA 3EHVA 5E7NA 4KTAA 4GOPC 4JI2L 1BBWA 4MACA 1S5DD 3TQYA 5C0XI 2K04A 1OQYA 3TN2A 1SBBB 2IJ0A 5IT9L 1FCCC 1OTCA 1NJIC 4F7ZA 2XGTA 2KZRA 4FLHA 1TWFB 3GZNB 4LF5L 3ULPA 1KD1C 4KDIC 1KHIA 2H4OA 4QUCA 2EZVA 4DR7Q 2IBIB 3H9DA 2G9HD 4XYQA 3E5SA 1TWAB 5I4DA 5IGGA 4DV6L 2I46A 2NBVB 2J52A 2BYVE 1RWSA 4OHJA 2MH7A 5CTRC 3FPPA 1DM0B 3CCQA 2D07B 2MSED 4M02A 4ZRPA 4HIKA 4TKOB 5CV9A 3S1RH 3GTLH 4DV4L 4RGTA 2DZIA 4BXXH 3TSSA 3M62B 5EKLA 4JI2Q 4GDLB 2RDGA 1STEA 3L0OA 4FNFA 1IW7D 5ELOA 4G0NB 1JICA 4G3XB 2EYJA 3PO2G 3I91A 2GBKA 5M5YH 1IYUA 1PFDA 2KD0A 1TXYA 4XDCA 2NZHA 2MO1A 1UE6A 4EX5A 4R4TA 4DV1L 4U68A 3QK0A 1QUQA 1S1QB 3ZDTA 2K39A 1CFMA 2A1AA 2KEDA 1L7YA 5IGEA 1O80A 2MA9B 1OGWA 2EYMA 1YX5B 1GAQB 1VQIA 3LDZE 2B76B 3P1MA 3OW2A 2LMCB 4WJ4A 5T8IA 2F0QA 1MPEA 4BBNF 3U4EG 2M9VA 2IX1A 1EWIA 2EE1A 1EY7A 1NBWA 1PDQA 3P4QB 4DV4Q 2VUMH 3DHIC 3Q0AA 3VTUA 3CMEA 2TSSA 1P7EA 4FJYA 5KHOA 3BDCA 5E6OA 2VB3X 3DUZA 1F2YA 4BBRG 1K50A 3OJ3A 1WM2A 1LT6D 1J8IA 3KLWA 1SR3A 5KGUA 5FO9B 4YSYB 3R66C 3H7PB 3MHZA 4HSPA 2LVQA 3UF8A 1PUTA 1YI2A 1E7UA 1U4LA 3P75A 1AYFA 2A5UA 2KAJA 2KKCA 1U0LA 3HOUG 1WTOA 2K05A 4YWLA 4L8JA 1Q81C 1XD3B 3MJ5A 4BZAA 3JAML 1Y14B 1SJED 1Y1VB 1WJNA 1IBMQ 3RPFC 4C7ZA 1HNXQ 3EROA 3S1QH 4KKTA 3A9JA 3ER0A 1VQAA 2O6VA 2UXCL 2KDFB 1O7YA 2QKIC 5DAUA 1EQRA 4ZRJA 3ZDMC 3C1EA 1NBFC 4DUYQ 3HM6X 3WDNA 1JWMD 4IZ8A 1CKNA 2FCQA 3HOZG 3G48A 2I1JA 2KLGA 5T1GA 1EF1A 2KDBA 4XIGS 1AZPA 3PZ7A 3K0YA 2NCNA 1NDDA 2EKIA 2SAKA 3S14B 1UF0A 3TP5A 4EEWA 2V1YA 4PQXA 1WCMH 1F9JA 3ETRA 4JW0A 2DZMA 2JX5A 1A15A 4DAYA 1UGMA 1VCIA 1A6XA 1YHAA 2E74C 1GC6A 1N5XA 2D5GA 2MBOA 4LNNA 1C7YA 3SFEB 1W2BA 4C3HH 1G8ZD 3PF5A 5NUCA 2NR2A 3FKYA 3AMZA 3D4DA 5EPJA 3RNAC 4DHJD 5KIXA 2L00B 4HR7B 1X55A 2SNSA 1HFNA 2P5ZX 1ACCA 1H95A 2KUMA 1SROA 4MNOA 4FF1A 1K83B 1S72A 4C3JH 2BH2A 3K9OB 2RD0A 2VZKB 2Z1CA 5C1ZA 2NVXB 2JEBI 1ENCA 3R7RA 3UGBB 4HK2A 3KF8A 2BT6A 2RA4A 1TQOA 3QB3A 3CWIA 4A3CG 2MQHA 1E8YA 4FF3A 1EY8A 3EVQA 3DWQA 4XZ4A 4FADA 5C4JB 2HDMA 1I4GA 2B2TA 4X62Q 2PLPA 1SE2A 3QG1A 2N0SB 4XXEA 4J15A 1YVCA 2LHEA 3I63C 3J9CA 2REXA 3I90A 3OMCA 3CMAA 1YD8U 2LRUA 4JX1C 3AQQA 1A3UA 2AEHA 1D1KA 3DBRB 2BW2A 4JI5Q 3V2TA 1RLFA 1E24A 2D11A 1QG7A 1J7AA 2N7JA 1WGHA 3VR4A 5JPMC 3BJUA 5G5HA 1L5PA 5AZGA 3V61A 4A3OA 3ZYYX 4LNOA 3UDIA 1RKNA 2XWBB 4DK0A 1HZCA 1LABA 2HT1A 3QA8A 2WU2B 3S9WA 4LNKA 1EOTA 3PV0A 5KNCA 2KN5A 4WRDA 2O4XA 2QMTA 3AECB 2JA5H 1I4RA 3AE6B 2K33A 4A3JB 3ZJTA 4QGUA 1P7FA 1LGRA 5JJZA 5M3MG 1I50H 1G2TA 3EN2A 4HDQA 2XVSA 2MLBA 3DVNU 4WQOB 3QR8A 1Q1OA 2LKVA 3S1MH 4L63B 3RYTA 1V86A 2LXJA 3NJTA 1JOQA 2LFIA 3MC8A 1GUWA 4HSVA 1FMAD 2LI5A 1FGUA 4P16A 1B4OA 2E76C 5HY6A 5FKAC 4H0LC 3RZOB 1J19A 4JPSA 3AFQA 3KWLA 2WLBA 2DY7A 2OEDA 1KAAA 4IOCA 1FL0A 4DR5L 4A93G 3MXNA 2MW5A 2H88B 2RR9A 1MSGA 3RNFC 1EYGA 5DPSA 4A90A 1VRAB 1U9RA 4DQOC 1MHWC 1A63A 2BKRB 2JK8A 2WGSA 3JVZX 4EVOA 4RMFA 4C56C 1HZBA 3PRMB 5GADC 2N1VA 2ZJDA 1KABA 3LJ3A 2AL6A 3VRAB 1IYFA 1KNAA 4FA6A 4KJNA 2IGDA 4B95A 2IGHA 4C1NI 3GTKH 1LT5D 5JH5C 3DEPA 4YT0B 3BU2A 4N8X1 2KHWB 4IPHA 4BY7H 2PW7A 1HTQA 1QKZA 4YIJA 1GHKA 3KDFB 4X64Q 4A3JG 2PCFB 3A8IE 1SNPA 4L5SA 2G4DB 3BS1A 3DWMA 4IFDJ 3AE1B 3RNEC 1TU2B 4POFA 3KWVA 4A3BB 5C6AA 1QUQB 3J80E 4DR5Q 2KC2A 1LV9A 2A69D 3T1HQ 1BMLC 3AE2B 1XNQQ 4LF7L 1SIFA 2GA4B 4IWPA 1PFSA 4B3SL 1WCMB 3DWAA 4X3SA 3LYYA 1WRDB 4X66L 4Q5VA 1OFFA 5HGQA 4I6NB 1VQPA 3S17B 1N62A 2LGXA 4LCDE 3I4OA 3GV3A 4AIMA 2L0FA 4GLAC 4KGRA 3HKZE 2MUYA 4KK7A 3VR2A 2LHDA 1HQMC 3NY5A 1VQ8A 4HKQA 3GD7A 3AI5A 4HPPA 3KUCB 1SAPA 1TWGH 4O2DA 1U4AA 3PHWB 3H3VC 1C8CA 3NWSA 2RBMA 5IWAQ 1OQRA 5FR3A 4K7WA 4DV2L 1OO9B 4KD4A 4OIJA 3GE8C 4CQNA 1Y8PB 2IZVB 3T53B 1HR0L 2X8XX 3PLUA 1IL2A 3T1HL 1YQ4B 2INNE 2Z6KA 3HKSA 2JXXA 3MEHA 1XNQL 5IODA 1A2UA 2BKFA 2NTSA 1K8MA 4I7AA 3GTQB 3W9CB 1QE6A 3AB5A 2A6HC 3Q2AC 2MQJA 3Q22A 1YMHE 5IYCG 1TKYA 1LTLA 1UE7A 5L37A 4HIMA 4OO1H 1WZ3A 1ML0D 2PEAA 1GXDC 2ZPYA 3KW5B 2F3VA 5TSSA 3G71A 4R4OA 1FJGL 5K36G 2CHWA 2ZCBA 5IKCM 3HOUB 2QGQA 5CHVC 1C4CA 2K5PA 4II2B 2JY6A 3VYUA 4GOPA 1LM8B 1BQQT 4XGAB 2WXKA 1C4QA 2WHIA 1H4RA 3NZ3A 4HCPB 1HCZA 3PIO3 2N7DA 4NAMA 2ZM6L 4A3KG 2R7ZG 1V1QA 3OWFA 2WV6D 1I42A 4LNIA 2JXMB 4XQQA 4ICVA 2EYOA 5IWAL 1CZWA 1XO3A 4DV2Q 4RGNA 1ROEA 3TEXA 1SYGA 1Y1VH 3QQ8B 1PH4A 3DDCB 1K73C 1QZEA 2ENBA 5LMNQ 4X6AH 1C4PA 2NBUA 4XTCS 4UHVA 1WVLA 1WI0A 2WDVB 4B0EA 4A3JH 4FHKA 2F4IA 1WTVA 5JHBA 4JI4L 3NPPA 1UWMA 2JZPA 4BWGB 4I7ZC 1I3QB 3HKZB 5EE1A 1C0AA 4K2KA 1WZ0A 1Q46A 2ASQA 4OONA 3M4OB 2KDIA 1T0SC 3TMEA 3DBLI 1DOMA 5IGDA 3MVVA 1JE5A 1IZ6A 2ZXRA 5COYA 1TJEA 2INCC 4JE3B 4QY7A 2HHHL 4MEMA 1SSNA 1WGDA 1HXYD 1UE5A 1VQFA 5G3LF 2N9XA 1SYFA 2B8FA 2JA5G 2XSCA 2BOSA 4X65L 1EEFD 1MFWA 1V1PA 4IUVA 2ZJPA 4KSKC 4HIDA 4DAYB 3AE3B 2VY3A 4ZKCB 4BOZB 4DK1A 4BA2I 3PMFA 2EY1A 4N6EB 5DCNA 1YNXA 2KX0A 4B9WA 3GTKB 2BTEA 1CMXB 4KHPL 1NI3A 5LXIB 4YSXB 5M5XB 2KA7A 4RH6A 3MTNB 2R93G 1DD2A 3JYUA 4WWMA 4S17A 2NBFA 4OL7A 4RM9A 2NVXH 1X65A 1QWYA 2AWNA 2BH8A 2R93H 3AE4B 2QCZA 2FHTA 2LZ6A 1BNZA 3GB1A 1FVIA 4HEA1 3LWUA 2RVLA 1E7PB 3Q8AA 2KCCA 4DAVA 3J81L 2KNBA 1WTQA 2PVOD 2KFKB 2IPKD 3M7GA 4K0KL 5IP9G 4A3FB 3L9AX 4M0WB 2Q8IB 4HMJA 1VR9A 1VF7A 1GNUA 1SFOB 3DHGC 4WWNA 4ACFA 3NRZA 2QDBA 1I5FA 2ZTEA 4X65Q 1VZ7A 1C77A 2AWOA 4ULLA 2R2QA 1AN8A 4JV5Q 4QL5A 3GS2A 3KYHC 4DR6L 1LM0A 3VR5A 2MO0A 1N5WA 3TDQA 2BYFA 1IL8A 2KO3A 4A9AA 1JE4A 3UIOB 4KHPQ 2VZAA 1JJCB 1WYGA 2A6HD 2V3NA 2JQRB 2QJLA 1A70A 4OO1I 3NELA 2A19A 4FJZA 1F77A 1OXTA 2F0HA 3VR3A 5M3MB 3MAQA 4A3IH 1EZ8A 4FYDA 1L0VB 1SE9A 2L83A 4GGQA 3NENA 2QW7A 5EKIA 4RAUC 4RCOA 3DHQA 2D3GA 3MEFA 2L52A 1F1HA 1TZ1A 2PMZB 1XMOL 3A4SC 5DM63 2SEBD 1K53A 2B3AA 2KWDA 4K5XA 3K5LA 2ZCCA 4IFDI 3KVFB 4BVUC 4RGOS 4GKJQ 4JI8Q 4APVA 4PMCA 5IA7A 4JOIC 3NQIA 1L2NA 4JV5L 5D6JB 3AEBB 1EF5A 4JI6Q 2QSDA 3UDXA 1WJUA 4IKGA 1XEEA 1ZDXA 1SE3A 4BOSC 1RDPD 1E7ZA 3CRKC 5ELBA 2B63B 4IUMB 4YTNB 2VB2X 4N8FA 5CBEE 2PNRC 3VUWA 1D4BA 4TMAB 1DYQA 1K51A 4WJOA 1B3QA 2NVUI 2ON8A 2K5WA 5IP9H 4IOIE 5IYDH 3OJ4B 2F0VA 4N9PA 1GOZA 2IO3B 2K3UA 3OIQA 4KX6B 3TBLD 4EFOA 1L6UA 2HTME 1KOTA 2YU9B 3EBEA 1IHZA 2L1BA 3VQIA 3MWYW 2RSUA 3C19A 5IE8A 5EGTA 3RNBC 4HTHA 4M00A 5C3JB 1G51A 1TVXA 4JI8L 2VZKD 3DOWA 1S5ED 2UXDL 1ENAA 1RD9D 2KFKA 2B2TC 2KLCA 3AXCA 4L6TB 1DJRD 2M0XA 1Y1WB 2WAQE 4C80A 1JWSD 3CCLA 3ZNHB 1WCMG 2B2YA 3JC66 5JHAA 3LGJA 3DWGC 1Q10A 3TBIB 2BYTA 1EIHA 2Q8TA 5L95C 3CC2A 3W5OA 1FNVA 4PS8A 4TRDA 3S2DB 3GDEA 4K14A 4M8NA 3QOLA 1S5FD 1BT0A 4K2LA 3MXUA 4AJYB 3W5VB 1QCBD 2J0TD 2F1MA 3PGEA 1XTCD 2R7FA 3C8YA 4WJPA 4RM8A 1V80A 2WXNA 2ES2A 5CV4A 4W9EA 1V1PB 2Z9HA 2N49A 1OTRB 4GIVA 5C5LA 3L4PA 5JJIA 1ZYRD 5T1IA 5LMUQ 1YNJC 1RM6C 3PO2H 1HPCA 2W82A 3NWTA 4IUUA 4J1MA 1CK1A 1JQ4A 1ESRA 4ZKBB 2VQFL 4ARCA 4YWMA 3I3CA 1EIGA 3ERQA 2RSOA 3NG0A 1TWGB 2PO4A 1WTPA 3GQBA 4XQNA 2L3ZA 4C3HB 1UNSA 2E8GA 2WDRB 3BYTB 1FO4A 5K5PA 1WXAA 4ZYNA 1WTRA 1Q3LA 4CGYB 4K6DA 2J7QB 3H1UA 4JBWA 3VDYA 2ACZB 2CQAA 4C2MH 1Q82C 5AUKA 1WXVA 2K1FA 3G7LA 3C46A 1BBUA 3OPOA 3MTSA 4IN3A 3MZ5A 2D0OA 4H13C 3ML8A 3FRPB 2ZEQA 2D2CC 5CV8A 3W5UB 4ZHOA 2L4NA 2NN6G 4BBSB 1VMPA 4QCLA 2KDEB 3KYDD 4M0WA 3SE0A 1TZOA 1MI0A 1ET6A 2Y5BB 3PCOB 3K9PB 4KKIA 2W3SA
chains in the Genus database with same CATH topology
4PMBA 1PFNA 2RDFA 1MVKA 1VF5C 5A2QL 2OXPA 1KTKA 1GUGA 4RGMA 3TP8A 3T16A 2O5IC 1YJJA 3AM9A 3KLSX 2TMPA 1CM9A 4OO1G 2EPBA 3A7LA 1PRTF 2A6EC 2WS3B 4ME5A 5BMGA 5C44B 2MHVA 3FMCA 3CU7A 5C4ZA 3IL8A 1TKEA 1RCVD 1Q1EA 1QJOA 4MN3A 1JW9D 1IYVA 3GO5A 4NMZA 2DWQA 1N63A 1LTTD 1FNWA 1WGKA 1EQVA 3FC4A 4G57A 1C4AA 4XQJA 3A7AB 2CU3A 1V1OA 4FP5D 3HOZB 1IBXA 1DXMA 3TP7A 2A68C 3IKJA 3WOEA 3K5OA 1SSOA 2HCIA 5CBAE 2G1EA 3A56A 1EYDA 1VZ6A 2E3TA 3Q8BA 1H9KA 2IGGA 3NBHA 2JSVX 1CHQD 1CQVA 2JU6X 2CVRA 3I72A 4ZUJA 2JYOA 1Y56A 5EBDA 1EY5A 3QO2A 1SEBD 2K9XA 1F2ZA 4K5VA 1JRPA 2EYPA 4QMGA 1F0ZA 1IBXB 5HURA 1TYGB 2Y3AA 3I73A 4XYOA 1FCLA 1IGDA 4K8JA 1XLNA 1IGCA 1MI2A 1D5XC 2Y0SB 4ZYSA 4A3IB 1STHA 4EQNA 4R8NA 3S15B 1SB3C 2KQ4X 5I2YA 2RQXA 2J53A 3X3MA 1QF6A 1ZE3D 2B2YC 2ICEC 2A68D 3D8GA 5E3FA 3H0GB 4A93B 2F0EA 2FE8A 4A3DB 1IW7C 1NSNS 2WQYB 2ZXPA 2HQEA 2BDOA 1WSPA 1A2TA 3MXPA 5C4HA 1CT1D 3QWNA 3M3YB 5KRUA 2E2HB 3K5MA 2BB6A 3AMUA 5LL6X 1FIQA 3KLSA 3RD4A 4IUTA 1XCQL 1IUEA 3PUZA 1Q1BA 1ICWA 2DN8A 1KH0A 4A6QA 2NMQA 1C78A 3HS0C 2QF7A 4ZOHC 2I2YA 1VJKA 5ELFA 1SF0A 4K5WA 1KF6B 4XDXA 5C0XH 4FF2A 1QLBB 1FYCA 1B9MA 4B08A 2IX3A 1F2RI 1GHJA 2X6LA 4OIKA 1FXIA 3P42A 3V05A 2M56B 4PT5A 1EYAA 4P6VF 2RDHA 1I4XA 1SNMA 2EDGA 1JC7A 1QILA 1RTOA 3FAHA 1VDVA 1PZJD 1O78A 2EY5A 3PO2B 4J3OD 1BBXC 3CRLC 2NWGA 1STNA 4LTUA 2MEKA 1XLOA 3E0JA 1G6ZA 2FBWB 1E2VA 3DXJC 3AE5B 1TY0A 5GXGB 2A69C 1ILQA 2BA0A 3FILA 2N88A 3MFGA 4RHRA 2KN4A 2PVGC 4US9A 1SNOA 1JROA 1Y8OB 3LNNA 4YWGG 2K5QA 1ZKOA 1STYA 5ELCA 2IWHA 1U4PA 3ONAB 1O7ZA 3U52E 3HRZC 5J22A 2PMVA 4G7OC 1PXUA 3PO3B 5EJWA 3FKIB 2NTTA 5D7GA 2CJNA 1GUOA 4KD3A 3A8JE 4MT5A 1E0BA 2DNEA 2NVYB 5FO8B 1MHHE 1UGJA 2NZ1D 3BVMA 1YNTE 3FDTA 2F0IA 4CHTB 4XWTA 1HUNA 5FLXL 3I9V1 2R6GA 1QQRA 4H2AA 1HA6A 3ZGZA 1NVID 1SYEA 2XRSD 1Z7TA 2WXPA 2WXLA 4WURA 5BN3A 3AEGB 2ID0A 4F8MA 2FMCA 1CI3M 2F0UA 2K7VA 4ZHPA 2DYMA 5A2QE 2K28A 1J9OA 3NTKA 1ZDVA 3B2FA 4RWSC 5CYUA 3U2SC 3KLRA 2WP8J 1H9JA 2NVTB 4PMWA 2FFKB 1RJTA 2A5HA 5JOBA 5BYRA 1J7CA 1EFID 1LTGD 4RA8A 2K22A 3FEWX 4C1NK 2JA6B 1FEHA 4E6IA 1V8QA 3TP6A 1QOFA 3AEFB 3DMUA 5HG2A 1STAA 2BS4B 1OQQA 2K0PA 2K5DA 4X3KA 3HUIA 5FO7B 3NK9A 3E56A 2R93B 1VLBA 2Z4IA 4KN4C 2F0WA 2D62A 4M8AA 3Q24A 2HDEA 3H6MA 1BCPB 4BY1B 3F2UA 2LMCA 1DOXA 3NVYA 1L4DB 2ZW1A 2MP1A 4OVZA 1I4PA 5FK9C 1PRTB 1UWXA 4Q0FA 1R9TB 5IGCA 3HEJA 3W1SA 2E2JB 4IUQA 1TY2A 5C3EB 1KLGD 2A74C 3OMGA 5I6YA 1NENB 4USAA 4CKBA 3T3NA 5D3DA 1BXTA 4IURA 1LTID 2HDLA 4DF7A 3T3OA 1LTSD 2JWUA 3L3OC 2B39A 1GJXA 1HUMA 1E2ZA 5LL6S 4REZA 4LJZC 2WP9B 4KHVA 2VUMB 3U7ZA 2BA1A 1C76A 1II3A 2EVBA 2ONQA 1X3QA 3HG9A 5D14A 3OIPA 1B3AA 3BG3A 5J39A 3SR6A 1ESFA 3SXHA 1TS4A 2MJ3A 2B2UA 2EY2A 1SNQA 3PZ8A 1EU4A 5KNDA 3AU7A 4ARIA 1CA5A 4JK1C 2PZTA 2E2DC 4OZAA 4JWUC 3FVQA 5A35A 3BVGA 5FOBB 2WIIB 3H94A 4EE2A 1F9QA 1PGBA 2NN6I 1XLPA 2KECA 3T51B 5EPLA 2EYFA 5BMIA 1A3VA 1XF5L 5F2DA 2O2LD 2MPMA 4FVMA 5AFWA 4GDKB 2F0FA 1HRJA 1D2BA 1C9FA 1SJHD 2QCPX 1D1IA 2RMMA 4TQ1A 1NR2A 1BUIC 1KDBA 3RLFA 1B44D 3IT6B 5C2TB 4MIUA 2OT2A 1OXVA 4HN7A 1FM0D 1PFBA 3J81E 2WXFA 4MH8A 1SNCA 3T56B 1PTOH 5M9OA 2LGIA 3CKIB 2Z8LA 1YNNC 2QILA 1EWCA 2FINB 4LK1C 3PO0A 4R8IA 4MHEA 1KDCA 4AYBB 2NVQB 1DZ1A 1E10A 1AWDA 2NYZD 1HTPA 2DBYA 2LJIA 3K58A 1WTXA 3NVWA 2SNMA 3FPUB 2GI9A 4KGSA 2WKCA 1PZID 3OOCA 3QJYA 1SYCA 3BYYB 3NHHA 1LO5D 4KKJA 2W55A 4V0BA 1JCKB 4N58A 3NTHA 2NUCA 2V4IB 1LTAD 4WH4A 3Q8EA 1YN3A 3HOWB 3R3OA 1FGBD 1VZ8A 3DWPA 3IAS1 1E0ZA 4FF4A 1M4VA 3K7AB 1T6BX 2L5TA 2C9OA 2E75C 1RFKA 3Q8CA 1OXXK 1JOOA 3N9YC 2IX0A 1JMLA 4KJOA 2F0PA 1MGSA 3R8BA 1J7BA 1E6EB 1NEKB 3RFZB 5BYSA 1NCVA 3AH7A 3S1NB 3R2IA 4KI0A 2ICIA 4XWWA 5DM73 2MJDA 3LB8C 4NZLB 1BCPF 3HOXB 1AW7A 2WNMA 2B2WC 1DOYA 1D5ZC 2WINB 1JORA 1SMYC 4LMQD 1ZEQX 3D4RA 3PUXA 2WXHA 2LFNA 3CIRB 1Y69U 4V190 2FMMA 3V96A 1S5BD 2EJGC 3BK1A 4H7BA 3PIP3 4P2CB 2CHBD 2RSNA 3EQLC 1PRTC 4OZBA 1TIID 3GTGB 2XIWA 4LK0M 3VR6A 2D5DA 5C3XA 3P63A 2ZT9C 5FLXE 3UI3A 2L9HA 2WXJA 3B2GA 3W2DA 1GB1A 4EQOA 3TZDA 1I6VC 4K8IA 4R3DA 4G4KA 1QB5D 4CJ0B 5JEAG 1YNND 1EY9A 4I65A 1FRDA 1NR4A 5CV6A 5JEAH 3K5NA 3MP9A 3N6RA 2JA8B 4RF1A 3E6ZX 3I8ZA 4DU9A 1WRIA 2QEJC 3N52A 3NS1A 1MSHA 3FILB 2EXZA 2Z4HA 2WXRA 4OZCA 1M8AA 3CHBD 4GLSC 2IT1A 1KDAA 3RUZA 3AB9A 4KKSA 1N61A 4MM3B 1PGAA 2X69A 1H9SB 2N55A 1SMYD 1KLUD 3NUCA 1TKGA 5M5WB 3IAM1 1PMRA 2JP1A 3EA6A 3PUVA 5M5YB 1FNUA 4YXDB 2BE5C 4HCSA 3SK4A 3SK8A 1AFPA 4ODGA 3TEYA 2F0MA 1BUVT 2MJEA 1SYBA 2F0SA 1L4ZB 1FD7D 5K36H 3C2PA 2F0JA 5G3LD 3D6WA 1Y8NB 3T13A 2G9DA 3VYRA 1ZXIA 1QNKA 1ZP0B 4F7XA 2XNAC 3PUWA 2F0OA 5ELDA 3RMHA 4PV1C 3EJIA 1NAPA 1LLRD 5EE9A 1BCPD 2H1EA 3AE8B 4XT3B 1I4HA 1PDXA 1JB3A 1G2SA 2V0GA 3D31A 3QOJA 2K1BA 5J1ZA 3P20A 1TWHB 5E1FA 4L2YA 1L0YB 3OSOA 2BE5D 4JWSC 3NBIA 4DGZA 1QNUA 1SE4A 3WOFA 1VDZA 2B2WA 3OW7A 2KVMA 1SDFA 4ZLTF 1KRHA 1L0XB 3D3RA 2WXIA 2B8GA 1LT4D 1PTOD 2WXQA 1EU3A 4EQPA 1HZ6A 4O42A 1BDOA 1F9PA 3E9SA 5JPNC 3O13A 4A3KB 4J8QA 3SDZA 1YJIA 5IOCA 1CHPD 5EKKA 2F0DA 1YN4A 1E2WA 1T5XD 2R3ZA 3VRBB 2Q8RE 2B2VC 1DOLA 3A54A 3H09A 1RHPA 4M1UB 1F2LA 1WD1A 3P4PB 3AEAB 5DNFA 2Q5WD 4J6HA 3NVVA 4CJ1B 3GTPB 3TZUA 2WXMA 1JQYD 5HI1A 3SK5A 1HHVA 3DM1A 1R4PB 2R92B 1STGA 5EQ0A 3AEEB 2WU5B 1IKLA 1O7LA 4WAFA 2A6ED 2JA5B 4TQ0A 1BO0A 4Y7NB 3GTJB 1PYWD 3D6CA 2DYOA 3NUHB 4O1NA 3ZJVA 4UAIA 1V8CA 2INPE 3T4AC 3LX0A 3SK6A 2EJMA 1EY4A 1JALA 2NB0A 4UDUC 1HA5A 3V3XA 3MHBA 1XCTL 3HOYB 2KQ3A 3KQ4A 1F9SA 1B1ZA 2KMMA 3K6OA 2XRQD 3BK2A 1D6EC 4WIPA 1ZUD2 4CBVA 3AV8A 5HHDG 2V4DA 4KY6A 4C3JB 2L11A 2O5JC 2KCNA 3EFXD 2AUKA 2IL8A 4NP5A 4ZRQA 3WCQA 3ND8A 5BYQA 1X3PA 2M2LA 3DEOA 4ZAIA 3IXSA 3SEBA 3K57A 4A3EB 3U9OA 3HRDD 2FJ2A 1FXAA 3EUB2 4NKLA 4CKCA 5HGTA 4YTMB 3MFYA 4RF0A 3H8HA 1G291 3TUOA 4KN7C 2EYLA 2JYEA 1PTOC 5I9PA 1DONA 2YEPF 1JWAD 1QT9A 3HOVB 2M19A 3URYA 1PRTD 1PTOF 1FFVA 1XWEA 2OHFA 1NUCA 1W6KA 3TEWA 2W3RA 1B9RA 2F0GA 2KEEA 3S1MB 2K01A 2PPBC 2E6XA 5EE3A 1Q90A 4WJWA 5M3FB 1U4MA 4B0MA 4BBRB 4C3IB 3OWEB 2NN6H 3M7NA 4N9TA 3VYTA 2V3PA 3KK7A 1Q12A 4FXCA 3I4LA 2CW0C 4K6LA 4LLGM 4F87A 1FR3A 4H44C 3I57A 1EM7A 2JXTA 1I4QA 3M85A 1CQFA 5CMDA 1K8OA 3J7YW 1HEZE 4XE0A 1XYIA 1F9RA 3P1HA 5IT9E 2PIAA 1PGXA 4ZK9B 4KY7A 1LACA 2KACA 3TEZA 4DNRB 4RKLA 3H91A 1SXTA 4U673 2D9UA 1PTOB 3BIID 1AZQA 1BCPC 1EEID 5C5MA 4C3HG 4DNTB 3I70A 3NXWA 5KEEA 2YEPB 2A73B 2RPVA 4ITKA 1GUTA 4US8A 5CR3A 4RCNA 4KGTA 2EOTA 3AEDB 1CZGA 2JE6I 4F88A 1JWUD 2QIEB 3HVZA 2W54A 1WD0A 3C1FA 4DAPA 4PNYA 3HP3A 5H8YE 1B2TA 3KUPA 1ONLA 4L23A 3P7JA 1GUSA 3RZDB 2B2UC 1TKWB 4IUNA 3J7AF 5H92C 1MHXA 4DA2A 4HMIA 4WORA 3S1RB 2IW3A 3SR1A 2I38A 3SFDB 3AE7B 3NVZA 2RKSA 4IFDG 1T5EA 2X38A 3D4WA 4XDDA 3ZJUA 3C3LA 4BA1I 4HKZE 4Z9CB 4Q2JA 2MGSA 1H9RA 4ABNA 1B53A 2CW0D 1H9SA 5JVG3 2WXGA 1B9NA 2JYTA 2L55A 4NW2A 5ISRA 2PKOA 5ELEA 3NE5B 1EY6A 1TS5A 1MD2D 1D5MC 5CORA 1U4RA 4ZRZA 3A55A 1QOGA 1K52A 4HCEA 2FUG1 1CJEA 1C48A 3VR9B 1QOBA 3IFDA 4WFN3 5I9OA 4IALA 4FXKC 4IUPA 1F2MA 1TS3A 3LXFA 2J4XA 1JOKA 5KNBA 1SIJA 5IIFA 1BOSA 3I4MB 4ZQ3A 5E4WC 1RODA 2PQEA 4QB4A 2F0KA 2XN9C 1YN5A 4A8XC 2J7ZA 3B9JA 3Q69A 2F0TA 3MA2B 3S2HB 1LT3D 4RHSA 4EGVA 3M4YA 1BF4A 1CZPA 1EY0A 1SNDA 2SDFA 2I07B 2ZXOA 4DFAA 2N9KA 2WAQB 4CKEA 4KV6A 3NTIA 2M00A 3R2TA 2F0NA 2E2IB 5EE0A 5JXVA 5CC4A 5BMHA 2R7ZB 1G91A 2Y5CA 1PLFA 3OHXC 3GV6A 4RNAA 1A3TA 5MPOA 1QOAA 1GB4A 1DOKA 1ENFA 4C3IG 2VNUD 3K59A 2KHSA 3GP7A 1RTNA 1Z47A 1RF2D 4X3TA 4GZYC 2BS3B 3L7ZC 2H89B 3VR8B 1ZXTA 2PZWA 1TS2A 2LEKA 4KY5A 1STBA 1SYDA 2JEAI 1JWBD 1T3QA 1DCZA 4AQ7A 3ITPA 2JSOA 1TT2A 3QIAA 4BS9A 4A3MB 2GB1A 1H9MA 2PW5A 2AQ3B 1QOHA 4HAEA 2PZUA 3S1QB 3VA7A 1HQRD 1OXUA 2WACA 1W6JA 1I50B 4S3SA 2K6AA 4IDIA 1EYCA 1UEAB 1F2RC 1ZXHA 3AN1A 1GUNA 2XWJB 2F0LA 1E9MA 3CQZB 4XT1B 2EY6A 3GTMB 1ILPA 1FFUA 4KKUA 4FXGC 1HFGA 1CTMA 2DNCA 3VYSA 4DN4M 3S16B 1NYRA 2R61A 1MBYA 4OGQC 1YNJD 1ZYRC 5JVH3 2Y5PA 2AUJD 3X3NA 1RYJA 1EL0A 4BY7B 4QIWB 5LNK1 1ZOYB 5D65A 1EWHA 3IT4B 4HJGE 2WXOA 1XX8A 2WKDA 5G5GA 2X6GA 2BBCA 1DGJA 2CJOA 4G7ZC 3U9SA 2L32A 3SHLA 4C7YA 5I6WA 3HGBA 3BDOA 4CJ2C 2JA7B 3MC0B 4ZUIA 1VMCA 4OW0A 1WWTA 1TR5A 4A55A 4TQUS 1ET9A 2WDQB 1XLQA 4KHZA 2EYHA 1KFYB 2HUGA 4TSSA 1DOIA 1X32A 2B2VA 5CGKA 4WQMA 2L12A 4HROA 4IQZA 3UI2A 2L1AA 2F03A 4D2KA 2WB1B 4A3GB 1I6HB 1EWYC 3G6JB 4ILWA 5BN5A 1I7HA 4DXFA 2AX5A 3MXGA 1S4ZA 1AP0A 2M0AA 3BWUD 4HRSA 4FXDA 5BN4A 2YYZA 2F3WA 4FO2A 3SVMA 5JEAJ 2C5CA 3BZDB 3KBXA 3JAME 2KJXA 3VA5A 4X3UA 4LAAA 1R4QB 2KOLA 4RFBA 1AEXA 2BCOA 3NP8A 1XXGA 3HZXA 3R93A 1CA6A 2EJFC 2ZW0A 2DY8A 4KMUC 1V43A 3J80L 5IGFA 3A8KE 4G7HC 4NJCA 1HTLD 4C3JG 3Q23A 1TWCB 2GRIA 3BVZA 2N9LA 1WTWA 2HCCA 5C0XG 3ABVB 3NQTA 3W3AA 2BDNA 5KYLA 5I2XA 4YTPB 1ZPSA 2L0CA 3Q8FA 3GTLB 3I4NB 2EELA 2SOBA 3J7AV 1PZKD 1KNEA 4YSZB 1BR9A 2IDYA 1Z6HA 4RKBA 4NDXA 2K32A 1FD6A 2K03A 5KYIA 2PTLA 4R9WA 4B9XA 3IFTA 2VXWA 2PYKA 5IGBA 4ID6A 2OF1A 3AE9B 3GTOB 3KBGA 3P4RB 5E6JA 1R7SA 1EZ6A 4AS1A 1YQ3B 4N59A 3Q6SA 1L6VA 5E4XA 5CV5A 4C2MB 1UAPA 5D3IB 3LWEA 1PFMA 3BDLA 5AUIA 4HEDA 1S5CD 3P4SB 2AQ1B 3HVDA 1JR0D 5C4XB 4QUFA 3ND9A 2J42A 4QF4A 1EQTA 1V97A 5DEHA 1LTBD 3PUYA 1IKMA 5HFYA 1FRRA 2AQ2B 5C3WA 5LHY1 5EPKA 2OEOA 5C0XJ 1GPXA 2BS2B 2LUMA 1WXQA 2LS01 1HZ5A 1NYQA 3ZQ4A 2PW9A 2LY7A 1LTRD 2BB5A 3EGRA 3IAYA 1OXSC 1N60A 2KDMA 4IFDH 2DLBA 1C79A 1B50A 4L1BA 1Q8IA 3NSWA 1UUPA 4DXGA 2MJ8A 5JAVA 5CV7A 5EBCA 4KTAA 4MACA 1S5DD 5C0XI 2K04A 3TN2A 1SBBB 2IJ0A 5IT9L 1FCCC 1TWFB 2H4OA 4QUCA 2EZVA 2G9HD 4XYQA 3E5SA 1TWAB 5I4DA 5IGGA 2I46A 2J52A 1RWSA 4OHJA 2MH7A 3FPPA 1DM0B 4ZRPA 4TKOB 5CV9A 4RGTA 3TSSA 5EKLA 4GDLB 2RDGA 1STEA 4FNFA 1IW7D 1JICA 2EYJA 3I91A 1IYUA 1PFDA 4XDCA 4U68A 1CFMA 2KEDA 5IGEA 1O80A 2EYMA 1GAQB 2B76B 3P1MA 2LMCB 5T8IA 2F0QA 1MPEA 3U4EG 2M9VA 2IX1A 2EE1A 3P4QB 1EY7A 1PDQA 3Q0AA 2TSSA 1P7EA 3BDCA 2VB3X 3DUZA 1F2YA 1K50A 1LT6D 1J8IA 5KGUA 5FO9B 4YSYB 3MHZA 4HSPA 1PUTA 1U4LA 3P75A 1AYFA 2KAJA 1WTOA 2K05A 4L8JA 3MJ5A 3JAML 1SJED 1Y1VB 3RPFC 4C7ZA 3EROA 4KKTA 1O7YA 2QKIC 5DAUA 3C1EA 3WDNA 1JWMD 4IZ8A 5T1GA 4XIGS 1AZPA 3PZ7A 3K0YA 2EKIA 2SAKA 3S14B 3TP5A 4PQXA 3ETRA 2JX5A 1A15A 4DAYA 1VCIA 1A6XA 1N5XA 2E74C 2D5GA 3SFEB 1G8ZD 5NUCA 3AMZA 3D4DA 5EPJA 5KIXA 4HR7B 2SNSA 1HFNA 1ACCA 2KUMA 4FF1A 1K83B 2VZKB 2Z1CA 2NVXB 2JEBI 1ENCA 3KF8A 2BT6A 2RA4A 1TQOA 3QB3A 3CWIA 4FF3A 1EY8A 3EVQA 3DWQA 5C4JB 2HDMA 1I4GA 2B2TA 2PLPA 1SE2A 3QG1A 2N0SB 4XXEA 2LHEA 3J9CA 3I90A 3OMCA 4JX1C 1A3UA 1D1KA 2BW2A 3V2TA 1QG7A 1J7AA 2N7JA 3VR4A 5JPMC 5G5HA 1L5PA 3ZYYX 1RKNA 2XWBB 4DK0A 1LABA 2WU2B 3S9WA 1EOTA 3PV0A 5KNCA 2QMTA 4WRDA 2O4XA 3AECB 1I4RA 3AE6B 2K33A 4A3JB 3ZJTA 1P7FA 5JJZA 1G2TA 2XVSA 2LKVA 4L63B 1JOQA 2LFIA 1GUWA 4HSVA 1FMAD 4P16A 1B4OA 2E76C 5FKAC 4H0LC 3RZOB 4JPSA 3KWLA 2WLBA 2DY7A 2OEDA 1KAAA 3MXNA 2H88B 1MSGA 4A90A 1VRAB 1U9RA 4DQOC 4EVOA 4C56C 3VRAB 1KABA 1KNAA 4KJNA 2IGDA 2IGHA 4C1NI 1LT5D 3DEPA 4YT0B 2PW7A 1QKZA 4YIJA 1GHKA 2PCFB 3A8IE 1SNPA 3BS1A 3DWMA 4IFDJ 3AE1B 1TU2B 3KWVA 4A3BB 5C6AA 3J80E 1LV9A 2A69D 1BMLC 3AE2B 2GA4B 1WCMB 3DWAA 4X3SA 3LYYA 4Q5VA 1OFFA 3S17B 1N62A 3GV3A 4KGRA 2MUYA 4KK7A 3VR2A 2LHDA 1HQMC 4HKQA 3GD7A 1SAPA 3H3VC 1C8CA 3NWSA 2RBMA 5FR3A 1OQRA 1OO9B 4KD4A 4OIJA 4CQNA 1Y8PB 3T53B 1YQ4B 2INNE 3MEHA 5IODA 1A2UA 2NTSA 1K8MA 3GTQB 3W9CB 1QE6A 3AB5A 2A6HC 3Q22A 1YMHE 1TKYA 4OO1H 1ML0D 1GXDC 2F3VA 5TSSA 5K36G 3HOUB 1C4CA 2K5PA 3VYUA 1BQQT 2WXKA 1C4QA 3NZ3A 1HCZA 3PIO3 4NAMA 3OWFA 2WV6D 2JXMB 4XQQA 2EYOA 1CZWA 1XO3A 4RGNA 1ROEA 3TEXA 1SYGA 2ENBA 1C4PA 4XTCS 2WDVB 1WVLA 4B0EA 2F4IA 1WTVA 3NPPA 1UWMA 2JZPA 4BWGB 4I7ZC 1I3QB 3HKZB 5EE1A 4K2KA 3M4OB 3TMEA 1DOMA 5IGDA 3MVVA 2ZXRA 5COYA 1TJEA 4JE3B 1SSNA 1HXYD 5G3LF 1SYFA 2B8FA 2BOSA 2XSCA 1EEFD 1V1PA 4IUVA 3AE3B 4ZKCB 4DK1A 4BA2I 3PMFA 2EY1A 4N6EB 4B9WA 3GTKB 2BTEA 1NI3A 4YSXB 5M5XB 2KA7A 4RH6A 1DD2A 4WWMA 2NBFA 4OL7A 1QWYA 2AWNA 3AE4B 3GB1A 2FHTA 1BNZA 4HEA1 3LWUA 2RVLA 1E7PB 3Q8AA 2KCCA 4DAVA 3J81L 1WTQA 2PVOD 2IPKD 3M7GA 4A3FB 3L9AX 2Q8IB 4HMJA 1VR9A 1VF7A 1SFOB 3NRZA 2QDBA 1VZ7A 1C77A 2AWOA 4ULLA 1AN8A 3GS2A 3VR5A 1N5WA 4A9AA 3TDQA 1IL8A 1JE4A 1WYGA 2A6HD 2V3NA 2JQRB 2QJLA 1A70A 4OO1I 1F77A 1OXTA 2F0HA 3VR3A 5M3MB 3MAQA 4FYDA 1EZ8A 1L0VB 2L83A 5EKIA 4RAUC 4RCOA 3DHQA 2L52A 2PMZB 5DM63 2SEBD 1K53A 2KWDA 4K5XA 3K5LA 4IFDI 4RGOS 4PMCA 3NQIA 3AEBB 2QSDA 4IKGA 1XEEA 1ZDXA 1SE3A 1RDPD 2B63B 3CRKC 5ELBA 4YTNB 2VB2X 5CBEE 2PNRC 1D4BA 4TMAB 1DYQA 1K51A 2ON8A 2K5WA 4IOIE 2F0VA 4N9PA 1GOZA 4KX6B 2K3UA 3OIQA 1L6UA 2HTME 2YU9B 1IHZA 2L1BA 3VQIA 3MWYW 5EGTA 4HTHA 5C3JB 1TVXA 2VZKD 1S5ED 1RD9D 1ENAA 2B2TC 4L6TB 1DJRD 1Y1WB 4C80A 1JWSD 2B2YA 3DWGC 1Q10A 3TBIB 2BYTA 1EIHA 2Q8TA 1FNVA 4TRDA 3S2DB 4K14A 3QOLA 1S5FD 4K2LA 3MXUA 3W5VB 1QCBD 2J0TD 2F1MA 1XTCD 3C8YA 2WXNA 5CV4A 1V1PB