5TSSA

Toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 56
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5tssA01
4K6LA 1BCPC 1D5MC 2SEBD 1STEA 3OWEB 1LTSD 1HQRD 1ESFA 1PZID 3BYYB 1LT5D 1PTOC 1XTCD 1SE4A 1TY2A 2XRQD 1B1ZA 1FNWA 1PRTD 1BXTA 5FK9C 1JQYD 4RGTA 2TSSA 1FNUA 3EA6A 4O1NA 1CQVA 1SJHD 1JR0D 1EEID 3URYA 1V1OA 1UNSA 1V1PB 5ELDA 1LTAD 1TY0A 1JWUD 1PTOH 2ICIA 3DWPA 3TSSA 1GOZA 1KTKA 2AQ3B 4RHSA 5ELBA 3BVGA 3O13A 4RHRA 1I4RA 2QEJC 5ELFA 5FKAC 4RGNA 1SXTA 1TS3A 1JWMD 1JCKB 1LTRD 4RCOA 1LTBD 1S5DD 2O2LD 3CHBD 1D5ZC 2RDHA 3MC0B 4OHJA 1RF2D 1KLUD 1LT4D 1TS2A 4RGOS 1SBBB 3BYTB 3V05A 4C56C 4RH6A 1FNVA 1V1PA 4DXFA 1SE3A 1DYQA 1RD9D 1SE2A 1JWSD 1SEBD 4L6TB 4L63B 2XRSD 1I4XA 4DXGA 1PRTC 1B44D 1BCPB 1LT3D 3BVMA 4BWGB 5TSSA 1PTOB 1LT6D 1KLGD 1CHPD 2R61A 2XNAC 2IPKD 1L0YB 1LTID 1D6EC 1RDPD 1LO5D 1LLRD 1HXYD 1PRTB 1ET9A 4TSSA 1AW7A 1CK1A 1YN3A 2CHBD 1PYWD 1QILA 3DWQA 1ET6A 1TS4A 2WV6D 3R2TA 1I4QA 1I4HA 4RGMA 3BZDB 3EFXD 1PZJD 2NTTA 1XXGA 1BCPD 5ELCA 1HA5A 1S5BD 1LTTD 1G8ZD 1EU3A 2XN9C 1L0XB 1PZKD 2Z8LA 1BCPF 3R2IA 3SEBA 1D5XC 1LTGD 1EWCA 1PTOD 1YN5A 1HTLD 2AQ2B 4NZLB 2J4XA 1EFID 5ELEA 1ENFA 4UDUC 1RCVD 4RFBA 1PTOF 1UUPA 1FD7D 1AN8A 5D3IB 1M4VA 2IJ0A 2AQ1B 4Z9CB 5D3DA 1FGBD 1PRTF 1S5FD 1SJED 3R8BA 1EEFD 3BVZA 1MD2D 1F77A 1T5XD 2RDGA 3MFGA 1TS5A 4ZYSA 1I4GA 2G9HD 3GP7A 1DJRD 2QILA 3DWAA 1YN4A 1CT1D 1CHQD 5I4DA 1I4PA 1S5ED 2NTSA 3W2DA 1S5CD 1EU4A 3KLSX
chains in the Genus database with same CATH superfamily
2PI2A 2A19A 2R3ZA 2IO0B 3QC8B 2QGQA 2VQFQ 4ICVA 3GTMH 1IHZA 3KLRA 5D2MB 2E2HH 5T1GA 3AE4B 3GTMB 5ELNA 4C3HG 4X66Q 1WXAA 4A8XC 1WY8A 1RWSA 3MC9A 5M9OA 2HQEA 3A5UA 2D07B 4WJ3M 3RFZB 3V62A 1LABA 2N9EB 1CA6A 4QB4A 4B3MQ 4MZ9A 3ML9A 3NVVA 3D4DA 2KWDA 1Q10A 3NZUA 2Q2IA 1Q0WB 4MEMA 1JQ4A 1NNXA 1OTCA 1Y8RC 3PO2B 4WIPA 4K1RB 4DK3C 3KWLA 5G5GA 4DKAC 1I35A 3G48A 5EKLA 1V6EA 4LNFA 1E22A 4KVGB 1Q8KA 1GUGA 3OMCA 1HTPA 1LTBD 1HZ5A 3I55A 5EPLA 4LNIA 4K14A 4KK7A 4JI5Q 3I7FA 2KDMA 5DAUA 3KF6B 1TT2A 1WMHA 4DR7Q 2L3ZA 2PTLA 4IKGA 4KGSA 1KLUD 1LT4D 4US8A 3EROA 4IPHA 2ICEC 3HOVG 1A8VA 3K7AH 4LF5Q 2W3SA 2WP9B 3DWMA 2BYFA 4LJOB 5LNK1 1TWAH 3K7AB 3WDNA 3F1ZA 2NS5A 4CHKA 1EIGA 1HZBA 2FCMA 5I9PA 3PO3H 4ZRQA 4HKZE 4A3JG 1F2RC 4KTAA 2WXKA 1B44D 4X62L 1MGSA 3VYSA 2WKCA 5JXVA 2B2YA 3GE3C 4W9KA 2I46A 2N1VA 1EO6A 1G2TA 4QJFA 5EKKA 4X64L 2KTFA 3RNGC 3SHQA 4JI2L 2C7NB 4WWMA 3DMUA 3HOXH 1OEYA 3B2FA 4O42A 5M3FH 4GNXC 2A68C 4QIWB 3HOXB 4JI6L 3EN2A 1CI3M 5M3FB 2WS3B 1WOCA 1RDPD 5FO8B 1SNQA 2NVUI 4IM0A 4LDTD 3P20A 4GKKQ 1JRPA 3TCAA 3MC8A 2D62A 3FILB 1PFMA 1PLFA 3D3RA 3A33B 4FBJB 2F0QA 1S1QB 2GB1A 3QJZA 2PQAA 4DUYL 1RRBA 1VF7A 1EM7A 1S3SG 1XQQA 1C78A 5E7NA 5IOIA 2JSOA 3V96A 2JYTA 4KI0A 5BN3A 4KDIC 4GOCA 2B3AA 4LF4L 2JT4B 2Z59B 1EWHA 1GXDC 1QKZA 1FL0A 2LMCA 3BIID 3QWZB 3P4RB 3Q23A 2A4ZA 4P74A 5E6OA 3H1UA 1N6ZA 3J80L 1V9PA 1AE2A 3OSOA 4DV5L 1QZHA 1GNUA 3W1GA 1CJEA 1UGJA 2LJIA 1BMLC 2X6LA 4X65L 1PHJA 1FIQA 3PPAA 3I70A 1SMYC 3I72A 4IFDG 5BYRA 1CUKA 1GO3E 3Q8EA 1TWCH 4BY1H 4CBVA 5ELOA 1J7AA 3CCQA 1IGCA 5D3DA 1EWYC 1RYJA 4B95A 4BY1B 1GB4A 4B0MA 2WDVB 1R4MB 1DOYA 2X6GA 3ULLA 2FHTA 4JVZA 2QEXA 4DBGA 2L11A 4A93B 2XK5B 4K3CA 2B2VC 4YSZB 2B63G 2CJNA 4WFN3 1Q1OA 2V3PA 4WJPA 2L0TA 4RAUC 1E6EB 1V1QA 1S5ED 2L5TA 2F0FA 4GN3B 4M02A 4DFAA 1X9NA 1KJTA 1Y1VH 2ID0A 1QCBD 2ZTDA 5KEEA 2LXJA 2MBHA 1Y1VB 2R93G 1IKLA 2XWJB 1HQRD 3FC4A 4WJOA 4JC0A 4BBSG 5FK9C 2IX0A 3S1RB 1BXTA 3PIOA 4DUZL 3EA6A 3UDGA 3VH3B 1WJNA 3A9KA 3VTUA 2WXQA 4XX5A 4A3PA 5LLIA 2BQQA 1V1PB 4OVZA 4DNTB 1VQPA 1JT8A 3CPFA 4HSPA 1HPCA 2HUGA 1N62A 1JWUD 2ICIA 2YTXA 4ME5A 4ODGA 4RM8A 3QX1A 2BWFA 2GI9A 1PMRA 1OQRA 3T9LA 3SDLC 1CM9A 4RHRA 1D7QA 4YTPB 1VQKA 3N52A 3NWSA 4GIVA 4PZ7A 5IP9H 1Q86C 5C4JH 3I4NB 1NR2A 2UXDL 5C4JB 2KD0A 5EE9A 1MIUA 3RPFC 2W54A 1T0YA 2AUKA 1J0GA 4KZ0A 4HIOA 4QMGA 1RODA 1YOVB 2KA7A 1MVKA 3M3JA 5CV7A 2ASQA 2K33A 2KFJA 2KANA 3DVGX 3M4OH 4JWSC 2E2DC 3N6RA 3AB5A 3DCGA 5CHWA 3M4OB 4BA1I 3ZGZA 2X38A 3VFKA 1QVGA 1GD7A 1HE8A 4OX9L 2MGSA 3BY4B 1KH0A 3M4QA 4MJSB 1B8AA 5CC4A 4NY0A 3NPPA 3AEAB 1HZ9A 4HCSA 3SK8A 3O65B 1TIID 1CTMA 4FJZA 1M8AA 3RULA 1N34L 2IY5B 1C77A 4R4OA 2F0OA 2EXDA 2J52A 1VQCA 3NJTA 2CHBD 5IWAL 1QILA 3DWQA 5GMVA 3LXFA 5IAAC 3R2TA 4IUQA 4FJYA 3BU2A 2KVMA 1PYSB 3AE1B 2EKEC 5BR8L 4A6QA 3OWFA 4F87A 1BO0A 1YZ6A 1FCCC 3L2PA 3VDZA 4OWTB 4LNQA 1KOTA 1LM8B 4K3BA 4WWPA 3H0GG 1K53A 1I50H 1S5BD 1O80A 3UDIA 2XN9C 1I50B 4L8JA 2BPSA 3HK0A 2ZXOA 2N7JA 4NZLB 4B3TQ 4IWOA 4M00A 1JE4A 5D7GA 4RFBA 1YJ9A 2HDLA 4LUVA 5CV4A 1GUAB 2MBQA 4XIGS 4FVMA 3S2HH 2OF1A 3KDFB 5JJZA 4LFAL 4IFDI 2YLMA 5BYSA 3S2HB 4RMAA 4GZYC 1SFOH 4MH0E 1QZEA 4W9DA 2CWAA 2B2TC 4JI3L 5IYBH 1SFOB 2KWUB 2KCTA 3PSIA 3OW2A 3R8BA 3GTJH 2INCC 1ZXHA 3H6NA 3DM3A 2BDNA 2KNBA 4PQXA 4W9LA 2NVQH 3KLWA 1IBKL 2VZKD 2NVQB 4II2B 3I73A 4C00A 2JSVX 2O2VA 3Q8DA 1EYCA 3HM6X 2E5LL 3AEDB 1SR3A 1VQDA 1E10A 4II3B 1EQRA 2O6VA 4EGVA 2LZ6A 5C2TB 4QGUA 5FLXc 4NJ7A 3S2AA 3OWEB 2GOWA 4DPGA 2KC1A 5LMUQ 2K5DA 3AI5A 4EQPA 1MHXA 1DCZA 3KJOA 3VVWB 1PYBA 4NXML 1SYCA 5AUKA 1JJ2A 4E3CA 1Q8IA 1ZPSA 4MELA 1OXXK 3OIQA 4M0WB 2ZJRA 4MGIE 1NYQA 1NENB 1TT5B 1SNCA 4IN3A 2FIFA 1PH4A 3J9CA 4A3CH 2X8XX 3HOUH 2DNFA 1OXUA 2VQEL 3RNCC 1UEBA 1KTKA 1CA5A 2F0JA 1XMOQ 4P1BC 1VQHA 1EIFA 2MHVA 3BS1A 2UXBQ 2OEDA 3IHPC 2L9HA 4N9TA 1TJEA 1WXMA 2V0GA 2L15A 1FPYA 1D5ZC 3PUWA 4TKNA 3MC0B 3GD7A 1U4PA 3CP0A 5FLMH 3WAOA 4OZCA 4XWWA 4A3DG 4FF3A 2I5MX 4UP9A 3PCOB 2MQHA 4O2DA 3AE3B 4BY7H 1L5PA 3HOYH 5FO9B 2LRWA 3B0AA 4ITKA 1YX5B 3GZNB 4BY7B 1TKWB 4FULA 5LXHA 1WGYA 5JPMC 5IE8A 5EBDA 3NVYA 2F0NA 4HJ8A 1B9NA 4WJ4A 5LMNL 4EFOA 2IX3A 5KGUA 3KW5B 2A6HD 1LT6D 1TWFH 4PK1A 4V0BA 2KUMA 3J81j 1R4NB 3MWYW 3C2PA 3Q6BA 1C9FA 4ANVA 2BYVE 4ZOHC 1PRTB 4OVUA 3ZQ4A 3EBEA 1GUNA 4QY7A 3V6CB 3ZNHB 3HUIA 4GDKA 3QR8A 3WIMA 1BT0A 4C2MH 2IBIB 4XDDA 3FDTA 2MA9B 1EOTA 3H91A 3CC4A 4S17A 4LFCL 2MSED 2CHWA 3FVQA 3D8GA 3QCAA 2F0EA 3S15H 1K3BC 3S15B 1SYGA 5M5XB 1CKMA 2HDMA 3F8TA 4RKBA 5FLXE 1UGMA 1KRSA 1L0XB 2WP8J 2REXA 3KYCD 1BCPF 3SEBA 4W9IA 1J5EL 1ISNA 2V4LA 2Y5CA 4NAMA 2QW7A 1UBIA 1V8CA 2F3WA 1F0ZA 5GROA 3S9WA 3PIO3 3PO2G 4KY6A 2F0SA 2FAZA 4L2YA 1N36Q 2BDOA 2B2YC 1GKHA 4KV2A 4L5QA 2HHHL 1SN8A 3ZIMA 1TVXA 1Y69U 2OJWA 2WFWA 2HCIA 1F77A 3MFGA 1A6XA 1TKGA 4PYUA 1J8IA 1IPGA 4HIDA 5CV8A 1PFDA 4P72A 2NBUA 1BBXC 4BAXA 2D5DA 4HEA1 2UUAQ 3TS2A 2DY8A 2INPE 3NS1A 5LXIB 2KFKA 1N5XA 1VQJA 2PKOA 2KCMA 3J80c 2J0TD 3Q8FA 3PSEB 1FRDA 1NAPA 1STEA 1UE7A 1EUVB 1QT9A 4PYZA 1ESFA 2IO2B 3RZFA 2F0LA 2KTRB 2ALYB 2WB1E 2Z6BA 4CDCC 3QJYA 1XTCD 4DAYB 1MBYA 1TY2A 1VQ8A 3Q2AC 1FVIA 3EIVA 3IL8A 1DOIA 2RHSB 3CCSA 3DPDA 4GXBA 3NZSA 4KKJA 1VZ8A 4O1NA 1CKOA 1LUZA 1X3EA 3QHTA 1II3A 1WI0A 2N9XA 1E7VA 2WDRB 2RGFA 4TQUS 5M3FG 3AU7A 4YY3L 2J0JA 2DZKA 4GLSC 3UE0A 1IUEA 4MGKE 4EZKA 1GOZA 1KRHA 2NVYH 2X69A 3IAYA 2F4VL 5C4XG 2QHOA 2NVYB 3VR5A 4OZAA 5K5PA 3QARA 3C46A 4DR4L 2G45B 3MJ5A 4D2KA 3T3NA 1XJVA 4KIKB 2HCCA 1PH6A 1SF0A 3UI3A 3DLLA 3E0EA 3HOWH 2LUMA 1XWEA 2WAQB 1V2YA 3AMZA 4F1SA 5IYDG 3HOWB 1YJNA 2MLBA 4MT5A 4YXDB 3S1MH 3EQLC 1B50A 2L1AA 3DBHB 1SE3A 1HR0W 1WX8A 4JLCA 1MI0A 2XRSD 2QF7A 3DM1A 4FO2A 4HJAA 5IT9E 3I5JC 2CH4A 5DPTA 3B6YA 3NUHB 3RMKC 2A1AA 4IURA 4JV5Q 4FF2A 1T0SC 2MUYA 4A3FH 2N9KA 5CV6A 3U30A 4AQYQ 4HPMB 2I38A 3PRMB 1V5OA 3KF6A 3LYYA 4UHVA 1WJUA 2FXQA 1KLVA 4A93G 1K83H 2M0AA 4R1JA 2VQFL 2Z0EB 2M00A 1K83B 1YBYA 3BJUA 5JEAG 1CK1A 2UUBQ 1UWVA 2JA6H 2Z9HA 3AM9A 1I94Q 4YIJA 1WTWA 4FDBA 3RZOH 1ZUD2 2RSOA 2WV6D 2Q2UA 3AH7A 3DBLB 1VMCA 4I7AA 1JOQA 4MGYE 3UIOB 3J81E 4BBRB 2GLSA 3TZUA 4NP5A 1XNQL 2LVQA 1JICA 2BVCA 4P1CC 1I6HB 2GVAA 3PTFC 3RI7C 4B3ML 2OTJA 3N1YC 1XD3B 2DZJA 2I5HA 4A3EH 1F2RI 1Q1BA 4HDOA 1XTDA 5I2XA 2RKSA 3NQIA 3TDQA 2RA4A 3BZCA 5E3FA 1ESRA 3T1YQ 4V190 1V81A 4MHEA 1B4OA 3FILA 4HVBA 2N0SB 2Q5WD 4UDUC 2JU6X 2BA0A 3ULJA 2WX0A 1WYGA 3ZDTA 2PZWA 4JI7Q 4JI5L 2A6HC 1HZ6A 1I5FA 3B2GA 3KLSA 1F9PA 4DR7L 1WYDA 1WRDB 2PZTA 2N78A 5DM63 4GDLA 1CZWA 4LF5L 2W9NA 2R7FA 2PI2E 2LHDA 2UU9L 1STAA 4EQOA 4AWJA 3I4NG 4H13C 1ZKOA 1VDVA 3E56A 3AE5B 5C0XG 2K1BA 4ZYSA 3JAME 2RMMA 2WU5B 2GA4B 2J0MA 2JE6I 3U7ZA 2ACZB 5A35A 1MSHA 1SNOA 1EY7A 1ICFB 4JGHB 1PGBA 5GAEC 3CC7A 3I4MH 1HNWL 4AQ7A 4I6NB 1SYFA 1F2YA 1JE5A 2NN6H 3Q3MC 2DHZA 3U7DA 4HN7A 3DBRB 5IGGA 2I07B 2LASA 2GBRA 2M19A 3VTWA 2JA8H 3ICEA 4K2LA 1DD2A 1H8CA 1SE4A 2F0GA 4N59A 2ZXRA 3EGRA 2ZTCA 2A5HA 4FNFA 3JW0X 1CQVA 3DEPA 1NMGA 3MXGA 5C4ZA 3CKIB 3UINB 5LL6S 2A8VA 2QMTA 1HTOA 4HK2A 1EIYB 4M01A 1K8OA 1YI2A 2FIDA 1TTNA 2HDEA 4K8IA 5J17A 1STNA 1ZEQX 5ELBA 3TEWA 3U4EG 4RGNA 5T8IA 2XBBC 3A5ZB 3AEFB 1C4CA 5C3EH 4FJVB 3GTOH 1E2VA 2ZNVB 1NBWA 4YHHL 3RLFA 5LMNW 3GTOB 1EYGA 2SOBA 3P1HA 2JQRB 4OHJA 4XE0A 1TWHB 3GTLH 4PS3A 2IYDB 3BG3A 2YTVA 1V1PA 2XVSA 4TVAB 1X32A 1VQ6A 5C3JB 2M17A 4KY5A 1LFDA 4GLAC 3KUDB 3PZ7A 5EPKA 2ZJQA 3ZXRA 1J8CA 1IBXA 5KHQA 2A69D 2L32A 4BOZB 5M5WB 1QQRA 1QUQB 1YNND 2CU1A 2JZ3B 1XPRA 2G4DB 2K22A 2MP2B 2V1YA 4JWUC 1SSOA 2IY0B 1VRAB 1SAPA 1PTOB 1NI2A 4LK1C 3NE5B 1FYCA 1KLGD 4KLKA 4G57A 4A3BB 1R4MI 1XCTL 4W9HA 4C4VB 2BCOA 3I57A 1T0QC 3MVVA 3GV3A 4MIUA 4IOIE 1HXYD 2LSSA 4RCNA 1EQQA 1P3QU 3GTKB 3IRBA 5HHDG 4J8QA 3TN2A 4IG7B 4ZYNA 2L4NA 1JWBD 1C4QA 3PUXA 3HIZA 1AP0A 2IX1A 3VUYA 4LUOA 4K8JA 1HUMA 2EY2A 3OTOQ 5CORA 2JWUA 1SDFA 4HIMA 2AX5A 4EX5A 4IUNA 4MJSA 2PVOD 2E3TA 2H1EA 3J81i 4ZQ3A 2GN5A 3FKYA 1W3SA 3GDEA 1MJEA 4DR1Q 3I3TB 1CSQA 2XWBB 2ZM6L 3R7RA 4G4KA 5AJ3L 1I7HA 1D5XC 1A5RA 2ZVNA 4ME3A 1X65A 1WR1A 4KDLB 3SXHA 1VZ6A 4XT1B 4B9WA 4A3LH 4G7OC 1FXAA 4DV1Q 1HRJA 2LUEA 4TRDA 1MJDA 5DNFA 2R92H 4A3KH 2W82A 4CO7A 4DHJB 1KNEA 2R92B 5CHVC 2N7EA 1WH3A 4YWKA 4LF7Q 4DNIA 1A0IA 1OQYA 4DR5Q 1S3OA 1KAWA 1UD7A 4IOCA 2GBMA 1UZXB 4XGAB 1BR9A 5C0XI 1K8RB 2FJ2A 2JA7H 1FGUA 3RLOA 5HGTA 3D31A 3K59A 3M9BA 2I1KA 3SGIA 3ER0A 3HZXA 2D3BA 3DXJC 1UE5A 2YYZA 3JAMi 1OFFA 2FNJB 2K3UA 4GGQA 2RDFA 2YU9H 1EU4A 1KDBA 1R9TH 4WQMA 4XT3B 1FFUA 1AZQA 3FMCA 1R9TB 4BY7G 1HH2P 3SFDB 3VUWA 1A3TA 4IZ8A 2YTYA 1ZXTA 2L12A 3PV1A 4JBWA 2HT1A 4YL8A 3DQVA 5T1IA 2M9VA 4RA8A 1YHAA 2TSSA 3I4LA 2D5GA 4N58A 4K6DA 3A8IE 1WJ6A 1H9MA 1WYWB 4GB9A 4H2AA 1STYA 3HFZB 3PMFA 5J18A 4M8MA 1K28A 4IOAA 3PHXB 1HFNA 1N60A 5EE1A 3G6EA 2JA5H 5IODA 3S16H 1X1MA 2NUCA 4HPLB 3DVNU 3L54A 4OWXB 3S16B 2QEJC 1SXTA 2V4IB 2JVCA 2MBBB 3KYDD 4B3TL 3D0FA 3HOZH 1C4AA 3WOEA 4RG1A 2WXFA 4YWGG 4M0WA 3AECB 2UXCQ 3JSVB 1SBBB 5FR6A 2E2HB 4RH6A 3TP6A 1GB1A 3H8HA 3TEHB 3ECIA 3U58A 2PNRC 1U4MA 2PW9A 4HXDA 1KD1C 4REZA 2FUHB 4IDIA 2QDLA 1PQSA 5ISRA 4N8X1 4JG2A 2LKVA 4JW0A 1GAQB 3GE8C 4EQNA 1E7UA 3A1QB 3CC2A 2UUCL 4I65A 3F2DA 4A3IH 1E8WA 3MTNB 5EQ0A 1P7FA 2IGDA 1EYDA 4A3IB 2KDFB 1D6EC 1NDDA 1LLRD 5EKIA 5LMUL 5IY0A 3QIAA 5KYLA 1FM0D 4YSXB 2KDEB 1B9MA 2F3VA 4PZ8A 2PO4A 4KKUA 4JPSA 1FJGQ 4HSVA 4DV6Q 1VQEA 2XTIA 5H1SE 1TWAB 2JX5A 1JC7A 2NVTH 2OQKA 4HIKA 2PNHA 2VUMH 2KT7A 2NVTB 2WXPA 3F2UA 2VUMB 3PO3B 4ICUA 4WJNA 2Z6KA 4CDDC 4R9WA 3H94A 1J7BA 5IT9L 4KD3A 3H7PB 3Q3FA 1YITA 2LXKA 3MXNA 1PZKD 1EQVA 2A69C 4S0RA 1YNNC 2UXBL 2M0XA 2PMZB 1IXRA 1L1OA 1BKBA 2KMMA 4LJPB 3ZTCA 2J0KA 3AU4A 2BA1A 2M56B 1WE6A 2Q8RE 2Q8IB 4DV2Q 5DM73 1WXSA 3QWNA 3GTPH 4C3IH 3S14H 2FBWB 3GTPB 1K0SA 5L95C 1DONA 3S14B 3K57A 2L0CA 2K03A 2Y0SG 3BVZA 1W2BA 3J81L 2G1EA 2KCNA 3S2DH 2VNUD 3WAPA 2DZMA 2WAQG 4X3TA 1F2ZA 3CCMA 4BA2I 1ZGUB 5G3LD 3HOWG 3APFA 1F9RA 1QZGA 5J2RA 4PMCA 2AKWB 4ULLA 4OIKA 3NP8A 3SR1A 2C35B 2DAFA 5AZGA 4A3GH 2ENBA 1DOMA 4Y7NH 1YNJD 1D3ZA 3RUIB 3GQBA 4ACFA 4XQNA 3LWEA 1D5MC 3GZNI 4R8NA 3FAHA 3J7A5 3PHWB 4FXCA 4TQ1A 2MJ8A 3P4QB 3BYYB 4F7XA 1Y1WH 5BMGA 3A4SC 1B1ZA 4KN7C 1BBUA 3J7AF 4B0EA 2QIEB 3AE7B 4NDXA 5E1FA 1A62A 2F0DA 2L1BA 1TWCB 2CH4W 2PCFB 5KNCA 1R4NI 1ZDVA 4C1NK 5KYIA 5DPRA 1ASZA 2K5HA 2H4OA 1KAAA 2RD0A 3R93A 4NQLB 4CDEC 2QDFA 3CF6E 3KBXA 2EYFA 2LXAA 2Z0DB 5C23A 3JAML 1DGSA 4A55A 2C9OA 4RF0A 3O13A 2KCCA 1KL9A 5FKAC 3AE9B 4BZAA 4GLVB 1YX6B 4BBRG 2KTRA 5EDSA 4DAYA 4ARCA 3VYUA 4MM3B 3DDCB 3NBHB 3KJPA 4P71A 4B6WA 3TEXA 1QVCA 1S5DD 4DDID 1UE6A 2RDHA 4I7ZC 2AUJD 2IHEA 1A63A 2J42A 3RN2A 3AE6B 3BK1A 3W1YA 4BXXH 2KN4A 4X57B 3CQZH 1KQSA 5GQOA 4C3JH 1R7SA 4E6IA 2PW7A 1F2MA 5F2DA 3A74A 2JRHA 3JVZX 4AYBB 1TWGH 5IGDA 1WF9A 2LEKA 3DUZA 1LT3D 2FE8A 2KX3A 2YEPF 1EY6A 1TWGB 4HMIA 3AV8A 2XEWA 3K5NA 1CQFA 5K36H 1S4ZA 3U2SC 3TMPB 4LF9Q 3I2ZA 4KIKA 3DHGC 3U8ZA 1TBEA 5JHAA 2UUAL 3X0WA 3C1EA 4LNKA 1YJJA 1ACCA 2DYOA 2VH1A 4F7ZA 3LWUA 2H88B 1K52A 1MHWC 4DAMA 4TSSA 1PYWD 1N61A 3OOCA 3UI2A 1Z7TA 3LB8C 5A2QL 2NR2A 4N9PA 3RR5A 3IT6B 2KEDA 5BYQA 1I4HA 2B2UA 2AL6A 2VH2A 1QG7A 1BDOA 2NN6G 3K5LA 4H02A 4UP7A 1ZDXA 2KO3A 1STBA 2KWCA 3APCA 2N55A 1A3UA 1JROA 3NHHA 1XCQL 5IP7G 3VR8B 3HKZG 2CQAA 1L4ZB 3ZNZB 4WURA 3ZJVA 1YMHE 1FCLA 4XQQA 1YN5A 4B9KA 1EWCA 5M5YH 1XEEA 3ZNID 5ELEA 1B2TA 1SNPA 1WTVA 4IPDA 5M5YB 1P1AA 4PS8A 5L83A 3NK9A 1TZ1A 4B3RQ 4B3SL 2JEAI 4OO1H 1NEKB 2B8FA 3OPOA 4DGZA 4DV3Q 1HR0L 1ZYRD 1FGBD 1HNZQ 2CCZA 1IGDA 1E9MA 1FXIA 3T1HQ 2XGTA 4E71A 3F2CA 4BS9A 1VD2A 4RWSC 4DV4L 3W1BA 2QILA 1PH3A 1GPXA 2JEBI 1P98A 1OQQA 2V3NA 5FJ8G 3DBHI 3FKIH 1QE6A 2K5NA 4AQYL 2MO1A 4FYDA 3FKIB 4IPCA 3CD6A 2JF5A 2K9XA 4LLGM 3TQYA 3NEMA 1EIHA 4UY8C 5DPSA 3I4OA 4QAYA 2WIIB 3IXSA 4F8CB 2WU2B 2PPBC 1WIAA 4QCLA 1B7YB 2VS1A 4RGTA 2F0MA 3N30A 4JQWC 4YT0B 4C7YA 5JPNC 2KC2A 4A3BG 1ASYA 1MKHA 1W6KA 2F0HA 3E0JA 4JI8Q 2R7ZH 4JYAQ 3GTJB 1OGWA 1QOGA 2LI5A 3R3MA 3QK0A 4NJCA 1WGKA 1EOVA 1GVPA 4FF1A 2OCEA 1C0AA 2QCZA 4ANWA 1QNKA 3ZYYX 1RJTA 3DBLI 5C3WA 4MACA 1LTRD 5AUIA 2R2QA 4JI4Q 1MPEA 1NI3A 3W5UB 3P1MA 1YQ3B 2LXCA 1ZXIA 2PJHA 1YNJC 1VZ7A 1VQGA 4PZ6A 4H7BA 4QUFA 2KOXA 4LTUA 2JYEA 3GB1A 3PV0A 2NBWB 1RD9D 4LF6Q 1DOKA 4L6TB 3VA7A 1WCMH 1HTQA 4L63B 3G7LA 1YD8U 4WWOA 3H15A 3Q3JA 5EGTA 1BCPB 3E5SA 4NB3A 2KXJA 2HTME 1XPOA 1IYVA 2FUG1 3HOUB 5HY6A 2MPMA 1EUJA 1XNRQ 4OIJA 1DM0B 3H3VI 3NVZA 2EYMA 2IHFA 2XIWA 4A3MH 4LNOA 1G291 4OXPA 2EJFC 3VR4A 1ZW7A 4W9GA 2FINB 4FXKC 1KXLA 4DXAB 4ANXA 1BOSA 4KN4C 3U4ZA 3KVFB 5IA7A 1QUQA 3EFXD 2MP2A 3HHMA 5JJKA 3H7SA 2NVXH 4O0AA 2PE9A 3HOYB 4X64Q 2ATWA 2BW2A 4JI2Q 3VDYA 1H9KA 3PO0A 2JXMB 3GTQH 2ZZPB 4C4VA 4DR3L 4X6AH 2F0IA 4KKTA 5FOBB 1TYGB 2N9PC 1Z9FA 2NBVB 4ARIA 3KF8B 4GKJQ 1U4AA 2SAKA 1TWFB 3T53B 4IC7B 4NW2A 2QJLA 1HFGA 3U9SA 2I0QA 3P63A 4XZ4A 3CMEA 3RYTA 4ZDVA 4DK6C 4DUYQ 2K8CA 1M4VA 4ZRIA 2F03A 4BOSC 2LJ5A 3VR6A 5DLQE 5CGKA 3QG1A 3AE8B 1EZ8A 1JWAD 3RNBC 1UELA 5MPOA 3CAMA 2G3QB 1NTGA 1QWYA 1C9OA 3BDCA 4C2MB 4HDQA 4RM9A 3DOWA 5DEHA 3UGBB 4Q2JA 2LY7A 1YN4A 3HGBA 1EFWA 2BE5D 1YQ4B 3PF5A 2BBCA 2MBOA 3Q24A 3A55A 3QOLA 5IT9c 3S1QH 4PT5A 3AEBB 4W9CA 3ZNGC 3NUCA 1T3QA 4HMJA 2OEOA 4NPNA 2JJQA 3TRZA 4CHTB 1WVLA 2V4DA 1E2WA 1GJZA 1I3QH 1UF0A 3IAS1 1WSPA 2VB3X 2Z6KC 2JZZA 1I3QB 4KHVA 2K4KA 3E6ZX 4K7WA 3CMMB 2WWZA 4CJ2C 2L0FA 3L7ZC 3URYA 2CW0D 3OTOL 2DAJA 1GUSA 2C5CA 4A3IG 5ELDA 3BK2A 1ZYRC 4C3HH 1E0ZA 1ENAA 1L1OC 1C3TA 2D11A 4XDXA 4U68A 3J81c 2MJEA 3UIPB 1CZGA 2K5QA 3K5OA 5GADC 4EVOA 1L4DB 1HEZE 2FFKB 3CRKC 1JWMD 5CYUA 3KUCB 3AQQA 1V8QA 2BKFA 5BO4B 3R7QA 1Q12A 2QDBA 3AFQA 3CCEA 3U4VA 5BMHA 3PO3G 2QC8A 1V86A 2CHZA 3EECA 2E2IH 2LGYA 1RF2D 3C8YA 3HM3A 2RF4A 3ND9A 3BYTB 1VQNA 3TL5A 2EOTA 2TMPA 3TMEA 1O7LA 3IG3A 4IQZA 2BH2A 3CCLA 5EE3A 3HOXG 1M94A 3QO2A 3HOVH 4RMFA 4HJKA 1WFYA 2AWNA 1F52A 1WM2A 4DU9A 1WGHA 3JAMc 3WA0A 1SYDA 1E8YA 4A3JH 4W9JA 2R61A 4MTNA 2XNAC 3C3LA 2UXDQ 5D6JB 1GC6A 2AWOA 3JSVA 1JB7A 2WGSA 4YCWA 1LO5D 1SLJA 2BKRB 2CR5A 2N1WA 2KMCA 5EE0A 1F9SA 1NE3A 4K0KQ 5H92C 2D0PA 3S1MB 3OYYA 4F88A 1T9HA 3P75A 2HJ1A 1E8XA 2QCPX 1WTRA 2MHJA 5G55A 3A9KB 3ERSX 2W3RA 3A1QA 4AH6A 1J19A 3NTKA 3NG0A 1VQBA 1IYJB 2Z1CA 3HEJA 4DHZB 4ABNA 1JMCA 3SR6A 1WD0A 1SB3C 3I91A 3B08A 3L08A 1HZCA 2GMIC 1LTGD 4A3FB 1PTOD 1FRRA 1HTLD 4BY1G 2DWQA 2MJDA 3MA2B 4HAEA 1U9RA 5EAYA 5IWAQ 4NPSA 1FD7D 1LXDA 4K5XA 3CCJA 4YTMB 1K50A 2EDGA 4ZRKA 4X66L 1VQMA 2UXCL 2GBJA 2PE6B 4QUCA 3TZDA 3OIPA 2R7DA 2JA6B 4W9EA 4A3OA 2C7MB 3RZOB 4JE3B 3LGJA 2OJRA 1ZKHA 1G51A 4UP8A 1Y1VG 1Y8PB 4IFDH 4XWTA 4HWIB 2IGGA 2K39A 2AWTA 1EF5A 2ZCCA 2D3CA 2NCNA 4KHPQ 4HJGE 3FPPA 1K0RA 1I4PA 4ZUJA 1EY0A 4A3EB 5LHY1 1W6JA 4OGQC 4IUTA 4HCPB 3UF8A 3MHSD 2B63H 2QA4A 2B2UC 5BN4A 2RPQA 4LFAQ 4KGTA 4EZJA 3HP3A 4AYBG 4JPBW 4A20A 1PZID 4G50A 4JBKA 3T13A 3TP5A 4JI3Q 1FNWA 4ZK9B 4WQOB 1PH8A 2D0OA 4QL5A 4DHJD 2R93H 1ILQA 2F0PA 4APVA 2Y5PA 2K75A 2KJRA 1IBKQ 1FJGL 1X3QA 4DV6L 1V80A 3AYHB 4XYQA 5IP9G 4US9A 4G11A 3C19A 2LGSA 4R3DA 3DWPA 1B3AA 5AFWA 2G4SA 2E5LQ 5KIXA 2AQ3B 4IUPA 2SDFA 3WCQA 1SROA 4R4TA 1I4RA 3KBGA 2K25A 1M90C 2HJ8A 4YCVA 3HRZC 3I4MB 3N1XC 4P7IA 5E6NA 4R8IA 1WX9A 2RSUA 4RCOA 2KWVB 1V43A 1MSGA 4LJZC 3X3NA 2BE5C 5I9OA 4FA6A 1BNZA 5IYCH 1IBLQ 4DR6Q 4RGOS 3SK6A 2F3IA 2JA8B 4GKKL 3W1SA 4DK5A 1DOLA 5KHOA 2OOBB 1KM7A 4DXFA 4I6PA 2XK5A 2Z0SA 1SE2A 1WXQA 3VQIA 3SU8X 3P4SB 1N9WA 1WTOA 1MG8A 1YJIA 1K51A 2VRRB 3LX0A 1YJWA 4S3SA 2VQEQ 2F0UA 3H09A 5COYA 4RKLA 1YIJA 4CJ1B 1WRIA 5TSSA 2CW0C 3A56A 3NBHA 1XPUA 4CKEA 1H9JA 2NZHA 3H3VC 2WINB 4KKSA 3ULPA 3OJ3A 2CWPA 1U4RA 1TR5A 4B9XA 2C7HA 5C3EB 2O6VB 3SVMA 2R2OA 4DA2A 2EY6A 5A2QE 1BQQT 3KOJA 2KHJA 1PV4A 3RT3B 1FXTB 3GTLB 2WX1A 2Y5BB 2H89B 5E6JA 3S17H 3BZDB 4X3UA 2Q2HA 3FKIG 2DNEA 1NYRA 2PEAA 3S17B 4KX6B 3L3OC 1EY8A 2KOLA 3DBSA 3L13A 2GVBA 1GUWA 4KMUC 1CFMA 1MG4A 2QKIC 5CBEE 5C44H 1AH9A 2N7DA 2Z8LA 1I42A 2VZAA 5C44B 3RMHA 3VR3A 2OHFA 1VCIA 5NUCA 5IYBG 1GG3A 3OMGA 3SK5A 1RCVD 2F0TA 2A5UA 2CU3A 1HA6A 3H0GH 4ANUA 1JOKA 4DDGD 3D4WA 4CKCA 4J6IA 3J7YW 4LF8Q 3R66C 2MQJA 2M8SA 4NQKE 1O7ZA 1XO3A 1NVID 2WXHA 1JJCB 1N33Q 1HUNA 3PF4A 1SNDA 4IJLA 3V3XA 3K81C 4J15A 4AOFA 3WOFA 1KFYB 1G6JA 1PDQA 1PH5A 1GJXA 1V5TA 4GSWA 1K8MA 1V9JA 2KJ6A 4JBJA 1CHQD 3D4RA 2QSDA 1WJJA 3CSTA 1J5EQ 1G2SA 2IWHA 3K58A 3W9CB 4GOPB 1SMXA 1PFSA 3AEEB 5HURA 1J6QA 3Q6SA 2K8BA 4KSKC 2CQOA 3NSWA 3B9JA 4Y52H 1HJPA 1YJ1A 3VTVA 2L52A 2B3GA 4XDCA 3J7ZC 1PTOC 1BUVT 1LM0A 2M4NA 2NZ1D 5KRUA 4NNJB 2INDC 4A3CG 1SE9A 1X56A 3K6OA 3HOUG 4A3KB 3T4AC 4DN4M 1V97A 1SJHD 4P73A 1OXSC 3RNFC 5IGFA 3HG9A 2ZPNA 4BVUC 4XYOA 4FHKA 4MH8A 1WZ0A 1NSNS 3PVLA 2DY7A 4OWWB 1KHIA 4YSYB 2MP1A 4ILWA 1IW7D 3TSSA 1QB5D 3KH0A 2JA7B 5AZFA 4FXGC 5J1ZA 3JC66 1VQOA 4IUVA 3L9AX 3U50C 1TS3A 2E75C 5FLMG 1VQ5A 5I6WA 1PVOA 4XTCS 1JCKB 1QLBB 2GBNA 2PIAA 1L0WA 4JK1C 3I56A 3C1FA 2KAJA 3KDFA 1I6VC 2YU9B 2WKDA 3PZ8A 4ZRPA 3HOYG 1F1HA 1JALA 4AS1A 3PREA 4YWMA 3KQ4A 2Y0SE 2K6AA 3M62B 3PS6A 4POGA 5C5LA 4TMAB 2WAQE 3NTIA 3CU7A 2A74C 4HJ7A 2K6QA 2KHSA 2Y3AA 1RFAA 2DX5B 3NZ3A 1V49A 1E1OA 2K01A 1C48A 3BDOA 4A75A 4DR2Q 2A6ED 1EQTA 2F4VQ 4A3DH 2D3GA 1WD1A 2MRPA 1IYUA 3L0OA 1X55A 4BKSA 3DEOA 4PNYA 2JP1A 2AEHA 2JA5B 1N32Q 1FR3A 2D3AA 2KX0A 3CRLC 2KENA 4G7ZC 2IDYA 4JBMA 4H0LC 5IGEA 5E6PA 2K5WA 3HOZB 4AJYB 2M1MA 3Q8BA 3ZRFA 4C80A 4HLEA 2ZEQA 3C0RB 3M4YA 1ET6A 2B2WA 1BUIC 4EKUA 1E8ZA 1UE1A 4DV7Q 1BBWA 2EXZA 4RGMA 1B3QA 3ETRA 1X6OA 4JI8L 1ENCA 5BN5A 4JYAL 2M2LA 1CZPA 2ZJDA 1PH9A 4JI0Q 3ONAB 3AN1A 1IZ6A 2W55A 4FLHA 1X3FA 1G8ZD 3UDXA 1DXMA 2ZTEA 3AEGB 3X3MA 4PMBA 1PUTA 3N1ZC 4OVVA 2PQEA 2KHWB 1G91A 3VR9B 1S72A 4JI4L 4NXNQ 1ROEA 3DHQA 4P16A 4PS7A 1JW9D 3MP9A 2KLCA 3ZVVA 3ENEA 4PV1C 3VR2A 4M1UB 2IJ0A 5IP4D 2RHQB 4HTHA 3GO5A 3PIPA 1XNQQ 3ZLZA 4LWCA 4K5WA 2EJMA 1JOOA 4LW1A 1YVCA 3PT2B 4LF6L 4K81A 4C1NI 3PO2H 1WXVA 1PGXA 1OEYJ 4GNXB 2KQ7A 1TGZB 5CMDA 3V6EB 3DWAA 4OELB 2F52A 1WTXA 3STBD 2L55A 3KF8A 1O78A 3SE0A 4KZCA 1TU2B 4IWQA 4IALA 2NTSA 2JPHA 2Z4HA 1UAPA 2LVOA 2R6GA 1XMOL 1WX7A 1XNRL 5JH5C 4WORA 4WAAA 1GC7A 4LAAA 2LRUA 1RTNA 3KYHC 1LTSD 1B9RA 5JOBA 2V3SA 1XMQQ 4FADA 2XRQD 2NWGA 5G5HA 1ZP0B 5JJLA 4RF1A 2UU9Q 3DHIC 3PUVA 3DVGY 2YEPB 3D6WA 4JOIA 3HKZE 4C3IB 4PMWA 2ZXPA 1OXVA 2DNCA 2E8GA 3ND8A 1S40A 1P0RA 4OL7A 1LGRA 4HCNB 5J22A 1C4PA 2EYLA 4KHZA 1HNWQ 3JYUA 3S2DB 5EJWA 1KF6B 1MHHE 1VLBA 2HIVA 3VYTA 3A54A 3BVGA 4LUZA 3LNNA 5ELFA 1L2FA 2K1FA 1N5WA 4GKJL 1EWIA 4Y7NB 4A3GB 1XT9B 2P5ZX 4QF4A 5KNDA 1E3PA 3V61A 4ZRJA 1K3RA 5C4XH 5I2YA 2ZJPA 3AU5A 4G7HC 5IIFA 5C4XB 4AUQC 4C56C 1Y1WB 3QQ8B 2N8NA 2EZVA 2PYKA 5JVH3 1Z6HA 4A3FG 2L7RA 4GS3A 4GDLB 4OW0A 4N9F4 5IYDH 4L5RC 1I4XA 1TKYA 2BF8B 3IFWB 3I8ZA 2VL6A 2RCFA 3NBIA 3Q22A 3BVMA 2NPTB 1U4LA 4IUUA 4BWGB 2K52A 1K73C 4IW0A 1E7PB 2LGDA 1DOXA 4JI1Q 2EQSA 5CBAE 2WXGA 2MX2A 3EHVA 4USAA 2JA6G 3VRBB 3VRAB 2Q8TA 5L37A 3ML8A 1UEAB 3P4PB 4YHHQ 4U673 1IW7C 4MNOA 4L5SA 4WJQA 4IM3A 4BKSD 1ET9A 2VW9A 3PGZA 2HIXA 2IL8A 2OT2A 1AW7A 2BT6A 2YVCA 1JB3A 1RTOA 1TS4A 5JAVA 4A3EG 1N36L 1R4QB 1QOAA 2XSCA 4A93H 3BZKA 3CCRA 3CQZB 4WWNA 5CTRC 3CCUA 2B8GA 4C3JB 5JEAH 4XYCA 3PUYA 4UAIA 2JWZA 4EQ5A 2NTTA 3VA5A 2DZIA 4LK0M 4A90A 4TUUA 2K32A 1BCPD 3A7AB 4HJ9A 3MAQA 1YHQA 2C60A 2FCSA 1FD6A 3R2IA 2OWOA 1JJGA 3RCZA 3TBIB 3W1SC 1SIJA 2AQ2B 3KWVA 1E24A 3ZKJC 2JA9A 2A6EC 5GAHC 4IFDJ 1NCVA 3S1RH 2WXIA 2ZW0A 3L10B 4L1BA 1WE7A 1WM3A 2N3SA 2C9WB 1FO4A 3ZW3A 4R4CA 4ZAIA 1UWXA 1IL8A 3S1NH 1VQFA 1VMPA 3I4MG 1TZOA 3S1NB 3HS0C 2PPHA 1N8RC 2RDGA 2LFNA 4IO9A 2KJHB 1ZOYB 2WXRA 3AEVA 3BWUD 1I4GA 4KV6A 2WLBA 3N9YC 4ZRZA 4DV0Q 4NAWB 1IBXB 1B53A 5IYCG 4X3SA 2O4XA 2ZM6Q 1IBMQ 2JA8G 1WGDA 2LVPA 5AJ3Q 2F0WA 3I4NH 3SFEB 2K28A 1WWTA 1H9SB 1G6ZA 5C0XH 3CIRB 3KLSX 2L83A 2WB1B 1EY9A 3HKSA 1UBQA 3Q3NC 3KUZA 2SEBD 5CR3A 2AHOB 4XQJA 1P8LA 4I6LB 1LACA 3N32A 1LT5D 2CKZB 2RVLA 3MZ5A 2J53A 1PRTD 1JQYD 5JHBA 3SK4A 2I2YA 1SRUA 4K0KL 5AEKB 1C8CA 2VY3A 1HNXQ 1EEID 1LYLA 1XLNA 3K5MA 1T6BX 3OLMD 1V1OA 4GLXA 5C3EG 1LV9A 1E0BA 1TY0A 2G5DA 2K04A 3A8KE 3M7GA 5HFYA 5AZHA 4HEDA 1J7CA 2EELA 1Y8OB 4RHSA 3SDZA 4CYEA 4JV5L 5IGBA 4HRSA 2ES2A 1O7YA 4A76A 5IKCM 2BGFA 3STBC 3P42A 4LDTB 1EYAA 3I3CA 2O5JC 1STHA 2O2LD 3GV6A 2RBMA 3HVDA 4NKLA 1Q7YC 1AYFA 1TS2A 1D8LA 2AYOB 4YCUA 1PH1A 3H9DA 3RD4A 1DGJA 3APDA 3A9JB 4LFBQ 2D2QA 1KDCA 1TXYA 1FNVA 5KNBA 2UUBL 2KQ3A 5C44G 1I94L 2DYMA 1Q81C 4KGRA 3OW7A 1BVSA 2F1MA 4DXGA 4OEMB 1WTPA 3DWGC 4M8NA 3ALBA 2KQSA 2MWSB 3VUXA 3TP8A 2KMAA 2R7ZB 2PVGC 2UYZB 2MBEA 4FHJA 1OXTA 3IBEA 4KHPL 3IVFA 3NXWA 1C1YB 2IT1A 4J6HA 1WI5A 1YQBA 3NS8A 2LGXA 1CHPD 3G4SA 1Q3LA 1EY5A 2FMMA 3T1YL 1VDZA 2K8HA 3FPUB 4P2CB 3SHLA 3W3AA 5C5MA 1WGRA 4CQNA 1Z47A 3W5VB 4JI7L 3PIP3 1C7YA 2E2JH 1IP9A 1HZAA 5FO7B 2NMQA 5LL6X 2E2JB 2A73B 1VF5C 2WACA 2Z4IA 4OZBA 4HKQA 4ZLTF 1OTRB 4BKGA 2ONQA 4GMVA 1NMFA 3Q69A 3CWIA 1WCMB 3RZDH 1XXGA 4A3LG 3RZDB 4IWPA 2ZCBA 4JCVE 1LTTD 5J3BA 2UUCQ 2R92G 1A70A 4A3KG 4G0NB 4HPPA 4POFA 5FR3A 1XLPA 2JQOA 2BH8A 4IUMB 2J4XA 4FXDA 1AEXA 4WRDA 1E5WA 3FRPB 1AE3A 1YNXA 1SSNA 2KVRA 1Q90A 1CKNB 1HQMC 3QB3A 2LGIA 1E90A 1UUPA 2FMCA 3OHXC 1AZPA 1RKNA 2PMZE 1IBLL 4DR6L 4A3MB 5D3IB 4GU2A 2JA7G 1E2ZA 4QIWE 2HE7A 3MJWA 3KFUA 2ON8A 5JZEB 2MNAA 3OAWA 1S5FD 2KDIA 4DQOC 1WFQA 3DBRI 1F2LA 2NN6I 4ZCKA 1GHKA 1M1KC 4X62Q 2ZPYA 3GP7A 3N3KB 1QJOA 1VJKA 3A4RA 2NVXB 2G9DA 2PW5A 5H8YE 2WQYB 1L6UA 1D4BA 3R3OA 1Q5WB 5G3LF 2K0PA 2HD5B 1H95A 1EZ6A 3GTQB 3Q8AA 2B2WC 4ZHPA 4JI6Q 1TIFA 3KK7A 1BCPC 2K7VA 1U5KA 3TS0A 5HG2A 1XYIA 1L6VA 1AARA 1QOHA 3AMUA 4RNAA 4ALPA 1WTHA 2KHIA 2OTLA 4FF4A 1AWDA 4DNRB 3K8AA 2GRIA 4YWLA 3NQTA 1VQ4A 3I63C 1X54A 4URKA 2KACA 3NTHA 2JA5G 1WMHB 2IW3A 1RM6C 5M3MH 3E3XA 3TP7A 1PFNA 4EUTA 2EY1A 5M3MB 4LF4Q 1CSPA 3GOEA 3PRPB 3HOZG 4GOPA 2EIFA 2HD3A 4E74A 1JORA 1OO9B 2WYQA 2ZT9C 4K7SA 1B70B 1JMLA 2FCNA 2LD9A 3UE1A 5E4XA 3VXWA 1KRTA 5IGCA 2B76B 4DV5Q 2BB5A 1SIFA 1MFWA 3AULA 4KSLC 3ZO5B 3MXNB 2D10A 3T3OA 4DK1A 4X65Q 2JZPA 3S1QB 4FN2A 5IO9A 5JVG3 3CHBD 2IO3B 4IM2A 1L1OB 1C79A 4WH4A 4LF8L 2E76C 3K9PB 3LJ3A 5C1ZA 5J39A 3EJIA 2BB6A 1N33L 1X3GA 1YHBA 1VQ9A 3F2BA 1JWSD 1SEBD 2PQAB 1QOFA 4A4IA 3MEHA 1ZE3D 2NB0A 4QQBX 2KEEA 4TV3A 1PRTC 1D1KA 3RUZA 2L00B 5M5XH 2WXOA 2V1CC 3RN5A 1CMXB 2IZVB 5G2NA 1ICWA 3X23A 4C3HB 1STGA 1NR4A 4MSMB 3Q14C 1KDAA 3PQIA 3A8JE 3TBLD 4AYBE 4J3OD 4DR1L 2LMCB 1SYBA 2F0KA 5CHFA 4ZHOA 1L0YB 4JIOU 4JOIC 2L76A 2K14A 2BTEA 3ZJTA 1IYFA 4GN5A 2N88A 1XLOA 2N9LA 4DV1L 2VUMG 2MJ3A 1FMAD 2K5PA 4DUZQ 3M7NA 2PZUA 2E2IB 1PDXA 2MH7A 2ZVOA 1I4QA 2Q2TA 3NWTA 5DPWA 4LF7L 2VZKB 1WZ3A 2NBFA 2SNSA 4NMZA 2RDBC 3EVQA 3V60A 4DR5L 4WJWA 1IKMA 1UH6A 2L8JA 4J1MA 4KJOA 1ML0D 2WXNA 1HA5A 3P2BA 1FFVA 1ONLA 3HOVB 3NENA 3E9SA 1VCBA 4YTNB 2KBNA 3K0YA 4C3IG 2J7ZA 4XC2A 4A3JB 1RIPA 3WALA 1EL0A 2EY5A 1YNTE 1C76A 4ZKBB 3ERQA 2O6VD 3CMAA 3MHBA 5JJIA 2FCQA 2LFIA 1JRUA 3BDLA 1GUTA 1PRTF 4Q5VA 2V9HA 2BYTA 1SJED 4DAPA 4KJNA 5DCNA 4A3GG 1XF5L 1T5XD 3TREA 1Q46A 3UQBA 4MSQB 3GS2A 3FHWA 2G9HD 3CW2C 3NVWA 4DF7A 1DJRD 2RQXA 2MCNB 4OX9Q 1CT1D 4DR2L 1LQBA 3MHZA 2UU7A 2LHEA 4A9AA 1Y1WG 4NJ6A 2HTHA 3E9HA 4PG3A 3W2DA 2INNE 3TUOA 2WNMA 2Y0SB 1N32L 4IJHA 3LDZE 4B3SQ 4JX1C 3I90A 1SYEA 4K6LA 4K2KA 5IOCA 1N34Q 4N6EB 3EFUA 1HR0Q 1TQOA 2WDTB 4C7ZA 1KIXA 4EZLA 2KDBA 3ABVB 3T16A 4EE2A 1MI2A 3RLNA 1KC8C 4BFRA 2KYWA 2CVRA 3ITPA 4GNXA 1Q82C 5BR8Q 1JR0D 4DV4Q 4DV7L 4LCDE 2KLGA 1UNSA 2PLPA 4L23A 3H7PA 3TEZA 4DK0A 3L16A 5GAGC 4ID6A 5BMIA 4JI0L 2DJFC 3AB9A 1GUOA 3MTSA 1PFBA 3UDFA 3IT4B 3E9IA 3QOJA 2VXWA 1SE8A 4BXXG 1D2BA 3KUPA 1P16A 4BKTA 2KECA 4C3JG 3PZDA 4XXEA 4ZKCB 3EC8A 5GXGB 4NXNL 2B63B 4DAVA 1AFPA 2WXLA 4UPAA 3OJ4B 4KD4A 1RAXA 2NYZD 4BBRH 2E74C 1K9MC 3NRZA 1P7EA 1YIWA 1I6HH 4LMQD 5K36G 1DYQA 5E4WC 2R93B 1T0RC 2KQ4X 3ZJYC 4BBSH 3WWVA 5CV9A 4BBSB 3M63B 2D9UA 1E1TA 3A0JA 3J80E 2EJGC 1Y56A 3ONSA 1A3VA 1D1IA 1HCZA 2EYHA 4ZUIA 2RPVA 2DJGC 3EUB2 3ZXVA 3GTGH 3PRZA 3RNUA 5D14A 1WGGA 3GTGB 1O7IA 5CX3A 2EMTA 2B2VA 3T8MA 3I9V1 3CF5A 5JEAJ 3B1LX 3NY5A 1XMQL 1F9JA 1GM5A 1YN3A 1QNUA 2J7QB 3NHEB 4GN4B 2CFMA 4NXMQ 3ZRCA 4DV2L 4K7UA 3MXUA 5EBCA 2E6XA 1SNMA 4MN3A 3H3VH 3Q0AA 3K0XA 3SD5A 1Y14B 3CSFA 4OONA 2WB1G 2BS2B 2NPTA 3L4PA 3MEFA 2MW5A 1PZJD 5CV5A 4DWFA 1L0VB 5ELCA 4OO1G 5D65A 4KKIA 1EU3A 4MM3A 1FEHA 4BBNC 1UWMA 2IY1B 1NUCA 1EFID 2K05A 2O2VB 1DZ1A 1PA6A 1H9RA 2BS4B 5IP7H 4ASWC 3ZJUA 2DGYA 2NZOA 2LWPA 3IAM1 1TKEA 3HKZB 5C4HA 1AN8A 1RL2A 2MO0A 4AJWA 4Z9CB 3Q8CA 1KABA 2LS01 4GN1A 2F0VA 3G71A 3T56B 3RNAC 5C0XJ 1VQIA 1MD2D 2JXTA 2PMVA 2KZRA 3M85A 5HKHA 2SNMA 1TS5A 2KJXA 3PGEA 2MFIA 4AIMA 3EFCA 4DR3Q 3RZWC 3CCVA 5EPJA 5LMNQ 1EY4A 5I4DA 2I5LX 3AE2B 1GHJA 2EYPA 4JI1L 3QAQA 2F4IA 1E7ZA 3N20C 5HGQA 1RLFA 2RR9A 4HROA 1P9DU 4KY7A 3WAMA 1TWHH 3Q3OC 3M95A 2K5VA 2R7ZG 5TR5A 3RNEC 5FJ8H 1WJ4A 3H0GB 2DN8A 4EEWA 5HI1A 2EVBA 1FNUA 2JXXA 4LNNA 4K5VA 3WANA 3D32A 1L2NA 4FP5D 4NAWA 2JK8A 5M5WH 4LFCQ 2ZNVC 4TQ0A 3CXCA 4MTKA 3ZTDA 1Z5SB 3M3YH 1U0LA 4CJ0B 1LTAD 5I6YA 2JYOA 3M3YB 4IPGA 3HRDD 1PTOH 1H9SA 4BBNF 2AL3A 2A68D 1H4RA 4A3BH 1G6PA 3MFYA 3AXCA 4N8FA 4LF9L 4P6VF 1VQLA 3G6JB 3D6CA 2DLBA 2DENB 4HJ5A 3GTKH 3VAWA 2MEKA 1WCMG 3NOBA 4X3KA 3IFTA 1VQ7A 1ILPA 2CJOA 2WXMA 2JN4A 3VHTC 1PH2A 3DVNV 3PLUA 3K7UC 1YEZA 3V05A 2K50A 4WAFA 2HHHQ 3U9OA 3L0WB 2HQLA 3RN9C 1BF4A 4GDKB 3NELA 2O5IC 2OQ0A 1A2UA 4CKBA 3A7LA 3PUZA 2KN5A 3QIJA 4TKOB 2UWQA 1R4PB 4AP4C 4DV0L 4A3MG 2JRIB 1X3PA 2B2TA 3S24A 2ZW1A 1IBML 2YV5A 5IN7A 1EF1A 1SMYD 4M8AA 3V2TA 2B29A 1RHPA 1VS0A 5C6AA 3U52E 1T5EA 1KNAA 5D94A 3J80i 2IPKD 1LTID 4JL9A 3M4PA 2DBYA 4CDFC 4MDKE 2EPBA 3A9JA 1XX8A 3ZDMC 3TIXA 4F8MA 4B3RL 2CS4A 1L7YA 1XLQA 1F9QA 3VH4B 4DV3L 2I1JA 4GOPC 1IL2A 2BS3B 2N49A 2JUOA 2BYEA 2IO1B 4G3XB 2K6DB 2WXJA 1QVFA 1HNZL 1MJCA 2AMCB 2DUDA 3TEYA 1LTLA 3AFPA 5C3XA 1HNXL 1RFKA 4HCEA 3T1HL 2EMSA 3TJPA 4YY3Q 2IGHA 1VQAA 4MGZE 4Q0FA 1QF6A 2H5XA 1A2TA 2WDQB 4OO1I 1N63A 3RD2A 2BOSA 3H6MA 4CGYB 1VR9A 2EE1A 4A3DB 2GBKA 3UQAA 2EKIA 3FP9A 5FLXL 1PXUA 3W5OA 2ASBA 4DR4Q 3PLVA 2OXPA 1K8GA 4DHZE 1PH7A 3DHHC 1ENFA 1J9OA 1K8AC 2EYJA 5M3MG 3OG5A 3K9OB 1PTOF 3VYRA 3BINA 1HHVA 2KFKB 4R4QA 3P7JA 2D2CC 4B08A 3CPWA 2CKHB 1A15A 2KVZA 2VB2X 3L17A 3IFDA 1NBFC 2L05A 2AQ1B 4LFBL 2B39A 2CHXA 1PGAA 3IKJA 2EYOA 3T51B 1EEFD 1QOBA 4HR7B 4P75A 2BWES 1WTQA 3ZUNA 3MXPA 1NY4A 4H44C 4W9FA 2C5LC 4R4IA 1SGHA 2WHIA 1Q1EA 2RCNA 1Y8NB 1NJIC 2KKCA 2N4FA 2DYBA 4EOYA 2KK8A 1CKNA 3FEWX 3HVZA 1S5CD 1Z2MA 3J7AV 4L5TA 3K80C 2JY6A 3QA8A 1WR6E 2RSNA
chains in the Genus database with same CATH topology
2R3ZA 1IHZA 3KLRA 4A8XC 5T1GA 3AE4B 3GTMB 4C3HG 1RWSA 5M9OA 2HQEA 3RFZB 1LABA 1CA6A 4QB4A 3NVVA 3D4DA 2KWDA 1Q10A 1JQ4A 4WIPA 3PO2B 3KWLA 5G5GA 5EKLA 1GUGA 3OMCA 1HTPA 1LTBD 1HZ5A 5EPLA 4K14A 4KK7A 2KDMA 5DAUA 1TT2A 2PTLA 4IKGA 4US8A 4KGSA 1KLUD 1LT4D 3EROA 2ICEC 5LNK1 2W3SA 2WP9B 3DWMA 3K7AB 3WDNA 1EIGA 5I9PA 4ZRQA 4HKZE 1F2RC 4KTAA 2WXKA 1B44D 1MGSA 3VYSA 2WKCA 5JXVA 2B2YA 2I46A 1G2TA 5EKKA 4WWMA 3DMUA 3B2FA 4O42A 2A68C 4QIWB 3HOXB 5M3FB 1CI3M 2WS3B 5FO8B 1RDPD 1SNQA 3P20A 1JRPA 2D62A 3FILB 1PFMA 1PLFA 3D3RA 2F0QA 2GB1A 1VF7A 1EM7A 1C78A 2JSOA 3V96A 2JYTA 4KI0A 5BN3A 1EWHA 1GXDC 1QKZA 2LMCA 3BIID 3P4RB 3Q23A 3J80L 3OSOA 1UGJA 1CJEA 2LJIA 1BMLC 2X6LA 1FIQA 3I70A 1SMYC 3I72A 4IFDG 5BYRA 3Q8EA 1IGCA 1J7AA 4CBVA 5D3DA 1EWYC 1RYJA 4BY1B 1GB4A 4B0MA 2WDVB 1DOYA 2X6GA 2FHTA 2L11A 4A93B 2B2VC 4YSZB 2CJNA 4WFN3 2V3PA 4RAUC 1E6EB 1S5ED 2L5TA 2F0FA 4DFAA 2ID0A 1QCBD 5KEEA 1Y1VB 1IKLA 2XWJB 1HQRD 3FC4A 5FK9C 2IX0A 3S1RB 1BXTA 3EA6A 2WXQA 4OVZA 1V1PB 4DNTB 4HSPA 1HPCA 2HUGA 1N62A 1JWUD 2ICIA 4ME5A 4ODGA 2GI9A 1PMRA 1OQRA 1CM9A 4RHRA 4YTPB 3N52A 3NWSA 3I4NB 1NR2A 5C4JB 5EE9A 3RPFC 2W54A 2AUKA 4QMGA 1RODA 2KA7A 1MVKA 5CV7A 2K33A 4JWSC 2E2DC 3N6RA 3AB5A 3M4OB 4BA1I 3ZGZA 2X38A 2MGSA 1KH0A 5CC4A 3NPPA 3AEAB 4HCSA 3SK8A 1TIID 1CTMA 1M8AA 1C77A 2F0OA 2J52A 2CHBD 1QILA 3DWQA 3LXFA 3R2TA 4IUQA 2KVMA 3AE1B 4A6QA 3OWFA 4F87A 1BO0A 1FCCC 1K53A 1S5BD 1O80A 2XN9C 1I50B 4L8JA 2ZXOA 2N7JA 4NZLB 1JE4A 5D7GA 4RFBA 2HDLA 5CV4A 4XIGS 4FVMA 2OF1A 5JJZA 4IFDI 5BYSA 3S2HB 4GZYC 2B2TC 1SFOB 3R8BA 1ZXHA 2BDNA 4PQXA 2VZKD 2NVQB 3I73A 2JSVX 1EYCA 3AEDB 1E10A 5C2TB 4EGVA 3OWEB 2K5DA 4EQPA 1MHXA 1DCZA 5AUKA 1SYCA 1Q8IA 1ZPSA 1OXXK 3OIQA 1NYQA 1NENB 1SNCA 4IN3A 3J9CA 1OXUA 1KTKA 1CA5A 2F0JA 2MHVA 2OEDA 3BS1A 2L9HA 4N9TA 1TJEA 2V0GA 1D5ZC 3PUWA 3MC0B 3GD7A 1U4PA 4OZCA 4XWWA 4FF3A 3AE3B 1L5PA 5FO9B 4ITKA 4BY7B 1TKWB 5JPMC 5EBDA 3NVYA 2F0NA 1B9NA 2IX3A 5KGUA 2A6HD 1LT6D 4V0BA 2KUMA 3MWYW 3C2PA 1C9FA 4ZOHC 1PRTB 3ZQ4A 1GUNA 3HUIA 4XDDA 3FDTA 1EOTA 3H91A 3FVQA 3D8GA 2F0EA 3S15B 1SYGA 5M5XB 2HDMA 4RKBA 5FLXE 2WP8J 1L0XB 1BCPF 3SEBA 2Y5CA 4NAMA 1V8CA 2F3WA 1F0ZA 3PIO3 3S9WA 4KY6A 2F0SA 4L2YA 2BDOA 2B2YC 1TVXA 1Y69U 2HCIA 1F77A 3MFGA 1A6XA 1TKGA 1J8IA 5CV8A 1PFDA 1BBXC 2D5DA 4HEA1 2DY8A 2INPE 3NS1A 1N5XA 2PKOA 2J0TD 3Q8FA 1FRDA 1NAPA 1STEA 1QT9A 1ESFA 2F0LA 3QJYA 1XTCD 1MBYA 1TY2A 3IL8A 1DOIA 4KKJA 1VZ8A 4O1NA 1II3A 2WDRB 4TQUS 3AU7A 4GLSC 1IUEA 1GOZA 1KRHA 2X69A 3IAYA 2NVYB 3VR5A 4OZAA 5K5PA 3C46A 3MJ5A 4D2KA 3T3NA 2HCCA 1SF0A 3UI3A 2LUMA 1XWEA 2WAQB 3AMZA 3HOWB 4MT5A 4YXDB 1B50A 3EQLC 2L1AA 1SE3A 1MI0A 2XRSD 2QF7A 3DM1A 4FO2A 5IT9E 3NUHB 4IURA 4FF2A 2MUYA 2N9KA 5CV6A 2I38A 3LYYA 2M0AA 2M00A 1K83B 5JEAG 1CK1A 3AM9A 1ZUD2 4YIJA 1WTWA 1B9RA 2RSOA 2WV6D 3AH7A 1VMCA 1JOQA 3J81E 4BBRB 3TZUA 4NP5A 1JICA 1I6HB 1F2RI 1Q1BA 5I2XA 2RKSA 3NQIA 3TDQA 2RA4A 5E3FA 1ESRA 4V190 4MHEA 1B4OA 3FILA 2N0SB 2Q5WD 4UDUC 2JU6X 2BA0A 1WYGA 2PZWA 1HZ6A 2A6HC 3B2GA 3KLSA 1F9PA 2PZTA 5DM63 1CZWA 2LHDA 1STAA 4EQOA 4H13C 1ZKOA 1VDVA 3E56A 3AE5B 5C0XG 2K1BA 4ZYSA 3JAME 2RMMA 2WU5B 2GA4B 3U7ZA 2JE6I 2ACZB 5A35A 1MSHA 1SNOA 1EY7A 1PGBA 4AQ7A 1SYFA 1F2YA 2NN6H 4HN7A 5IGGA 2I07B 2M19A 1DD2A 4K2LA 1SE4A 2F0GA 4N59A 2ZXRA 3EGRA 2A5HA 4FNFA 1CQVA 3DEPA 3MXGA 5C4ZA 3CKIB 5LL6S 2QMTA 1K8OA 2HDEA 4K8IA 1STNA 1ZEQX 5ELBA 3TEWA 3U4EG 4RGNA 5T8IA 3AEFB 1C4CA 1E2VA 3RLFA 3GTOB 2SOBA 3P1HA 2JQRB 4OHJA 4XE0A 1TWHB 3BG3A 1V1PA 2XVSA 1X32A 5C3JB 4KY5A 3PZ7A 5EPKA 1IBXA 2A69D 2L32A 5M5WB 1QQRA 1YNND 2K22A 4JWUC 1SSOA 1VRAB 1SAPA 1PTOB 4LK1C 3NE5B 1FYCA 1KLGD 4G57A 4A3BB 1XCTL 2BCOA 3I57A 3MVVA 3GV3A 4MIUA 4IOIE 1HXYD 4RCNA 5HHDG 3GTKB 4J8QA 3TN2A 2L4NA 1JWBD 1C4QA 3PUXA 1AP0A 2IX1A 4K8JA 1HUMA 2EY2A 5CORA 2JWUA 1SDFA 2AX5A 4IUNA 2PVOD 2E3TA 2H1EA 4ZQ3A 2XWBB 4G4KA 1I7HA 1D5XC 3SXHA 1VZ6A 4XT1B 4B9WA 4G7OC 1FXAA 1HRJA 4TRDA 5DNFA 2W82A 1KNEA 2R92B 1BR9A 5C0XI 2FJ2A 5HGTA 3K59A 3D31A 3HZXA 3DXJC 2YYZA 1OFFA 2K3UA 2RDFA 1EU4A 1KDBA 4WQMA 4XT3B 1FFUA 1AZQA 3FMCA 1R9TB 3SFDB 1A3TA 4IZ8A 1ZXTA 2L12A 4JBWA 5T1IA 2M9VA 4RA8A 2TSSA 3I4LA 2D5GA 4N58A 4K6DA 3A8IE 1H9MA 4H2AA 1STYA 3PMFA 1HFNA 1N60A 5EE1A 5IODA 2NUCA 3S16B 2QEJC 1SXTA 2V4IB 1C4AA 3WOEA 2WXFA 4YWGG 4M0WA 3AECB 1SBBB 2E2HB 4RH6A 3TP6A 1GB1A 3H8HA 2PNRC 1U4MA 2PW9A 4REZA 4IDIA 5ISRA 2LKVA 1GAQB 4EQNA 4I65A 5EQ0A 1P7FA 2IGDA 1EYDA 4A3IB 1D6EC 1LLRD 5EKIA 3QIAA 5KYLA 1FM0D 4YSXB 1B9MA 2F3VA 2PO4A 4KKUA 4JPSA 4HSVA 2JX5A 1TWAB 1JC7A 2NVTB 2WXPA 3F2UA 2VUMB 3PO3B 1J7BA 4R9WA 3H94A 5IT9L 4KD3A 3MXNA 1PZKD 1EQVA 2A69C 1YNNC 2PMZB 2KMMA 2BA1A 2M56B 2Q8RE 2Q8IB 5DM73 3QWNA 2FBWB 3GTPB 1DONA 3S14B 3K57A 2L0CA 2K03A 3BVZA 3J81L 2G1EA 2KCNA 2VNUD 4X3TA 4BA2I 1F2ZA 5G3LD 1F9RA 4PMCA 4ULLA 4OIKA 3NP8A 3SR1A 2ENBA 1DOMA 1YNJD 3GQBA 4XQNA 3LWEA 1D5MC 4FXCA 4R8NA 3FAHA 4TQ1A 2MJ8A 3P4QB 3BYYB 4F7XA 5BMGA 1B1ZA 4KN7C 4B0EA 3J7AF 2QIEB 3AE7B 4NDXA 5E1FA 2PCFB 5KNCA 2F0DA 1TWCB 2L1BA 1ZDVA 4C1NK 5KYIA 2H4OA 1KAAA 3R93A 3KBXA 2EYFA 3JAML 4A55A 2C9OA 4RF0A 3O13A 2KCCA 5FKAC 3AE9B 4DAYA 4ARCA 3VYUA 4MM3B 3TEXA 1S5DD 2RDHA 4I7ZC 2AUJD 3AE6B 2J42A 3BK1A 2KN4A 1R7SA 4E6IA 2PW7A 1F2MA 5F2DA 4AYBB 5IGDA 2LEKA 3DUZA 1LT3D 2FE8A 2YEPF 3AV8A 1EY6A 1TWGB 4HMIA 3K5NA 1CQFA 5K36H 1S4ZA 3U2SC 3C1EA 1YJJA 1ACCA 2DYOA 3LWUA 2H88B 1K52A 4TSSA 1PYWD 1N61A 3OOCA 3UI2A 1Z7TA 3LB8C 5A2QL 4N9PA 3IT6B 2KEDA 5BYQA 1I4HA 2B2UA 1QG7A 1BDOA 2NN6G 3K5LA 1ZDXA 1STBA 2N55A 1A3UA 1JROA 3NHHA 1XCQL 3VR8B 2CQAA 1L4ZB 4WURA 3ZJVA 1YMHE 1FCLA 4XQQA 1YN5A 1EWCA 1XEEA 5ELEA 1B2TA 1SNPA 1WTVA 5M5YB 3NK9A 2JEAI 4OO1H 1NEKB 2B8FA 3OPOA 4DGZA 1ZYRD 1FGBD 1IGDA 1E9MA 1FXIA 4BS9A 4RWSC 2QILA 2JEBI 1OQQA 2V3NA 1QE6A 4FYDA 3FKIB 2K9XA 4LLGM 1EIHA 2WIIB 3IXSA 2WU2B 2PPBC 4QCLA 4RGTA 2F0MA 4YT0B 4C7YA 5JPNC 1W6KA 2F0HA 3E0JA 1QOGA 3GTJB 4NJCA 1WGKA 4FF1A 1QNKA 3ZYYX 1RJTA 5C3WA 4MACA 1LTRD 5AUIA 1MPEA 1NI3A 3W5UB 3P1MA 1YQ3B 1ZXIA 1YNJC 1VZ7A 4H7BA 4QUFA 4LTUA 2JYEA 3GB1A 3PV0A 1RD9D 1DOKA 4L6TB 3VA7A 4L63B 3G7LA 5EGTA 1BCPB 3E5SA 2HTME 1IYVA 2FUG1 3HOUB 2MPMA 4OIJA 1DM0B 3NVZA 2EYMA 2XIWA 1G291 2EJFC 3VR4A 2FINB 4FXKC 1BOSA 4KN4C 3EFXD 3HOYB 2BW2A 3PO0A 1H9KA 2JXMB 2F0IA 4KKTA 5FOBB 1TYGB 4ARIA 2SAKA 1TWFB 3T53B 4NW2A 2QJLA 1HFGA 3U9SA 3P63A 1M4VA 2F03A 3VR6A 5CGKA 3QG1A 3AE8B 1EZ8A 1JWAD 5MPOA 1QWYA 3BDCA 4C2MB 5DEHA 4Q2JA 2LY7A 1YN4A 3HGBA 2BE5D 1YQ4B 2BBCA 3Q24A 3A55A 3QOLA 4PT5A 3AEBB 3NUCA 1T3QA 4HMJA 2OEOA 4CHTB 1WVLA 2V4DA 1E2WA 3IAS1 1WSPA 2VB3X 1I3QB 4KHVA 3E6ZX 4CJ2C 3L7ZC 3URYA 2CW0D 1GPXA 1GUSA 2C5CA 1E0ZA 5ELDA 3BK2A 1ZYRC 1ENAA 4XDXA 4U68A 2MJEA 1CZGA 2K5QA 3K5OA 4EVOA 1L4DB 1HEZE 2FFKB 3CRKC 1JWMD 5CYUA 1V8QA 1Q12A 2QDBA 5BMHA 3C8YA 1RF2D 3ND9A 3BYTB 2EOTA 2TMPA 3TMEA 1O7LA 4IQZA 5EE3A 3QO2A 2AWNA 4DU9A 1SYDA 2R61A 2XNAC 3C3LA 2AWOA 1LO5D 5EE0A 1F9SA 5H92C 3S1MB 4F88A 3P75A 2QCPX 1WTRA 2W3RA 3NTKA 2Z1CA 3HEJA 4ABNA 3SR6A 1WD0A 1SB3C 3I91A 1LTGD 4A3FB 1PTOD 1FRRA 1HTLD 2DWQA 2MJDA 3MA2B 4HAEA 1U9RA 1FD7D 4K5XA 4YTMB 1K50A 2EDGA 4QUCA 3TZDA 3OIPA 2JA6B 3RZOB 4JE3B 4IFDH 1Y8PB 4XWTA 2IGGA 4HJGE 3FPPA 1I4PA 4ZUJA 1EY0A 4A3EB 5LHY1 1W6JA 4OGQC 4IUTA 2B2UC 5BN4A 4KGTA 3HP3A 1PZID 3T13A 3TP5A 1FNWA 4ZK9B 1ILQA 2F0PA 2Y5PA 1X3QA 4XYQA 4US9A 4R3DA 3DWPA 1B3AA 5AFWA 5KIXA 2AQ3B 4IUPA 2SDFA 3WCQA 1I4RA 3KBGA 3HRZC 3I4MB 4R8IA 4RCOA 1V43A 1MSGA 4LJZC 3X3NA 2BE5C 5I9OA 1BNZA 4RGOS 3SK6A 2JA8B 3W1SA 1DOLA 4DXFA 1SE2A 1WXQA 3VQIA 3P4SB 1WTOA 1YJIA 1K51A 3LX0A 4S3SA 2F0UA 3H09A 5COYA 4RKLA 4CJ1B 1WRIA 5TSSA 2CW0C 3A56A 3NBHA 4CKEA 1H9JA 3H3VC 2WINB 4KKSA 1U4RA 1TR5A 4B9XA 5C3EB 3SVMA 4DA2A 2EY6A 5A2QE 1BQQT 5E6JA 3GTLB 2H89B 3BZDB 4X3UA 1NYRA 2DNEA 4KX6B 3S17B 3L3OC 1EY8A 2KOLA 1GUWA 4KMUC 1CFMA 2QKIC 5CBEE 2Z8LA 5C44B 3RMHA 3VR3A 2OHFA 1VCIA 5NUCA 3OMGA 3SK5A 1RCVD 2F0TA 2CU3A 1HA6A 1JOKA 3D4WA 4CKCA 3J7YW 1O7ZA 1XO3A 1NVID 2WXHA 1HUNA 1SNDA 3V3XA 3WOFA 1KFYB 1PDQA 1GJXA 1K8MA 1CHQD 3D4RA 2QSDA 1G2SA 2IWHA 3K58A 3W9CB 3AEEB 5HURA 3Q6SA 3NSWA 3B9JA 2L52A 4XDCA 1PTOC 1BUVT 2NZ1D 5KRUA 3K6OA 4A3KB 3T4AC 4DN4M 1V97A 1SJHD 1OXSC 5IGFA 3HG9A 4XYOA 4MH8A 1NSNS 2DY7A 4YSYB 2MP1A 4ILWA 1IW7D 3TSSA 1QB5D 2JA7B 4FXGC 5J1ZA 4IUVA 3L9AX 1TS3A 2E75C 2PIAA 5I6WA 1QLBB 4XTCS 1JCKB 4JK1C 3C1FA 2KAJA 1I6VC 2YU9B 2WKDA 3PZ8A 4ZRPA 1JALA 4AS1A 3KQ4A 2K6AA 5C5LA 4TMAB 3NTIA 3CU7A 2A74C 2KHSA 2Y3AA 3NZ3A 2K01A 1C48A 3BDOA 2A6ED 1EQTA 1WD1A 1IYUA 3DEOA 4PNYA 2JP1A 2JA5B 1FR3A 3CRLC 4G7ZC 2IDYA 4H0LC 5IGEA 2K5WA 3HOZB 4C80A 3Q8BA 3M4YA 1ET6A 2B2WA 1BUIC 2EXZA 4RGMA 3ETRA 1ENCA 5BN5A 2M2LA 1CZPA 3ONAB 3AN1A 2W55A 1G8ZD 1DXMA 3AEGB 3X3MA 4PMBA 1PUTA 2PQEA 1G91A 3VR9B 1ROEA 3DHQA 4P16A 1JW9D 3MP9A 4PV1C 3VR2A 4M1UB 2IJ0A 4HTHA 3GO5A 4K5WA 2EJMA 1JOOA 4C1NI 1PGXA 5CMDA 3DWAA 1WTXA 2L55A 3KF8A 1O78A 3SE0A 1TU2B 4IALA 2NTSA 2Z4HA 1UAPA 2R6GA 4WORA 4LAAA 1RTNA 1LTSD 5JOBA 2XRQD 2NWGA 5G5HA 1ZP0B 4RF1A 3PUVA 2YEPB 3D6WA 4C3IB 4PMWA 2ZXPA 1OXVA 2DNCA 3ND8A 4OL7A 5J22A 1C4PA 2EYLA 4KHZA 3S2DB 5EJWA 1KF6B 1MHHE 1VLBA 3VYTA 3A54A 3BVGA 5ELFA 3LNNA 1N5WA 4A3GB 4Y7NB 4QF4A 5KNDA 5I2YA 4G7HC 5IIFA 5C4XB 4C56C 1Y1WB 2EZVA 2PYKA 5JVH3 1Z6HA 4GDLB 4OW0A 1I4XA 1TKYA 3I8ZA 3NBIA 3Q22A 3BVMA 1U4LA 4IUUA 4BWGB 1DOXA 1E7PB 5CBAE 2WXGA 4USAA 3VRAB 3VRBB 2Q8TA 1UEAB 3P4PB 4U673 1IW7C 1ET9A 2IL8A 2OT2A 1AW7A 2BT6A 1JB3A 1RTOA 1TS4A 5JAVA 1R4QB 1QOAA 2XSCA 3CQZB 2B8GA 4C3JB 5JEAH 3PUYA 4UAIA 2NTTA 3VA5A 4LK0M 4A90A 2K32A 1BCPD 3A7AB 3MAQA 1FD6A 3R2IA 3TBIB 1SIJA 2AQ2B 3KWVA 2A6EC 4IFDJ 1NCVA 2WXIA 2ZW0A 4L1BA 1FO4A 4ZAIA 1UWXA 1IL8A 1VMPA 1TZOA 3S1NB 3HS0C 2RDGA 2LFNA 2WXRA 1ZOYB 3BWUD 1I4GA 4KV6A 2WLBA 3N9YC 4ZRZA 4NAWB 1IBXB 1B53A 4X3SA 2O4XA 2F0WA 3SFEB 2K28A 1WWTA 1H9SB 1G6ZA 5C0XH 3CIRB 3KLSX 2L83A 2WB1B 1EY9A 2SEBD 5CR3A 4XQJA 1LACA 1LT5D 2RVLA 3MZ5A 2J53A 1PRTD 1JQYD 3SK4A 2I2YA 1C8CA 1XLNA 1EEID 3K5MA 1T6BX 1V1OA 1LV9A 1E0BA 1TY0A 2K04A 3A8KE 3M7GA 5HFYA 4HEDA 1J7CA 2EELA 1Y8OB 4RHSA 3SDZA 5IGBA 4HRSA 1O7YA 3P42A 1EYAA 3I3CA 2O5JC 1STHA 2O2LD 3GV6A 2RBMA 3HVDA 4NKLA 1AYFA 1TS2A 3RD4A 1DGJA 1KDCA 5KNBA 1FNVA 2KQ3A 2DYMA 4KGRA 3OW7A 2F1MA 4DXGA 3DWGC 1WTPA 3TP8A 2R7ZB 2PVGC 1OXTA 3NXWA 2IT1A 4J6HA 1CHPD 1Q3LA 1EY5A 2FMMA 1VDZA 3FPUB 4P2CB 3SHLA 3W3AA 5C5MA 4CQNA 1Z47A 3W5VB 3PIP3 5FO7B 2NMQA 5LL6X 2E2JB 2A73B 1VF5C 2WACA 2Z4IA 4OZBA 4HKQA 4ZLTF 2ONQA 3Q69A 3CWIA 1WCMB 1XXGA 3RZDB 1LTTD 1A70A 5FR3A 1XLPA 2J4XA 4FXDA 1AEXA 4WRDA 1SSNA 3FRPB 2LGIA 1Q90A 1HQMC 3QB3A 1UUPA 2FMCA 3OHXC 1AZPA 1RKNA 4A3MB 5D3IB 1E2ZA 2ON8A 1S5FD 4DQOC 1F2LA 2NN6I 1GHKA 3GP7A 1QJOA 1VJKA 2NVXB 2G9DA 2PW5A 5H8YE 2WQYB 1L6UA 1D4BA 3R3OA 2K0PA 5G3LF 1EZ6A 3GTQB 3Q8AA 2B2WC 4ZHPA 3KK7A 1BCPC 2K7VA 5HG2A 1XYIA 1L6VA 1QOHA 3AMUA 4RNAA 4FF4A 1AWDA 4DNRB 2GRIA 3NQTA 2KACA 3NTHA 2IW3A 1RM6C 3TP7A 1PFNA 2EY1A 5M3MB 1JORA 1OO9B 2ZT9C 1JMLA 5E4XA 5IGCA 2B76B 2BB5A 3T3OA 4DK1A 2JZPA 3S1QB 5JVG3 3CHBD 1C79A 4WH4A 2E76C 5J39A 3EJIA 2BB6A 1QOFA 1JWSD 1SEBD 1ZE3D 3MEHA 2NB0A 2KEEA 1PRTC 1D1KA 3RUZA 2WXOA 1ICWA 4C3HB 1STGA 1NR4A 1KDAA 3A8JE 4J3OD 2LMCB 1SYBA 2F0KA 4ZHOA 1L0YB 2BTEA 3ZJTA 2N88A 1XLOA 2N9LA 2MJ3A 1FMAD 2K5PA 3M7NA 2PZUA 2E2IB 1PDXA 2MH7A 1I4QA 3NWTA 2VZKB 2NBFA 2SNSA 4NMZA 3EVQA 4WJWA 1IKMA 4J1MA 4KJOA 1ML0D 2WXNA 1HA5A 1FFVA 1ONLA 3HOVB 3E9SA 4YTNB 3K0YA 4C3IG 2J7ZA 4A3JB 1EL0A 2EY5A 1YNTE 1C76A 4ZKBB 3ERQA 3MHBA 2LFIA 3BDLA 1GUTA 1PRTF 4Q5VA 2BYTA 1SJED 4DAPA 4KJNA 1XF5L 1T5XD 3GS2A 2G9HD 3NVWA 4DF7A 1DJRD 2RQXA 1CT1D 3MHZA 2LHEA 4A9AA 3W2DA 2INNE 3TUOA 2WNMA 2Y0SB 4JX1C 3I90A 1SYEA 4K6LA 4K2KA 5IOCA 4N6EB 1TQOA 4C7ZA 3ABVB 3T16A 4EE2A 1MI2A 2CVRA 3ITPA 1JR0D 1UNSA 2PLPA 4L23A 3TEZA 4DK0A 4ID6A 5BMIA 3AB9A 1GUOA 3MTSA 1PFBA 3IT4B 3QOJA 2VXWA 1D2BA 3KUPA 2KECA 4C3JG 4XXEA 4ZKCB 5GXGB 2B63B 4DAVA 1AFPA 2WXLA 4KD4A 2NYZD 2E74C 3NRZA 1P7EA 5K36G 4LMQD 1DYQA 5E4WC 2R93B 2KQ4X 5CV9A 4BBSB 2D9UA 3J80E 2EJGC 1Y56A 1A3VA 1D1IA 1HCZA 2EYHA 4ZUIA 2RPVA 3EUB2 5D14A 3GTGB 2B2VA 3I9V1 5JEAJ 1YN3A 1QNUA 3MXUA 5EBCA 2E6XA 1SNMA 4MN3A 3Q0AA 2BS2B 3L4PA 1PZJD 5CV5A 1L0VB 5ELCA 4OO1G 5D65A 4KKIA 1EU3A 1FEHA 1UWMA 1NUCA 1EFID 2K05A 1DZ1A 1H9RA 2BS4B 3ZJUA 3IAM1 1TKEA 3HKZB 5C4HA 1AN8A 4Z9CB 3Q8CA 1KABA 2LS01 2F0VA 3T56B 5C0XJ 2PMVA 1MD2D 2JXTA 3M85A 2SNMA 1TS5A 2KJXA 5EPJA 1EY4A 5I4DA 3AE2B 1GHJA 2EYPA 2F4IA 4HROA 4KY7A 3H0GB 2DN8A 5HI1A 2EVBA 1FNUA 4K5VA 4FP5D 4TQ0A 4CJ0B 1LTAD 5I6YA 2JYOA 3M3YB 3HRDD 1PTOH 1H9SA 2A68D 3MFYA 4P6VF 3G6JB 3D6CA 2DLBA 2MEKA 4X3KA 3IFTA 1ILPA 2CJOA 2WXMA 3V05A 4WAFA 3U9OA 1BF4A 4GDKB 2O5IC 1A2UA 4CKBA 3A7LA 3PUZA 4TKOB 1R4PB 1X3PA 2B2TA 2ZW1A 1SMYD 4M8AA 3V2TA 1RHPA 5C6AA 3U52E