3W1SC

Crystal structure of saccharomyces cerevisiae atg12-atg5 conjugate bound to the n-terminal domain of atg16
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
76
Chain Sequence
IQKIQIKFQPIGSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autophagy protein 5
publication title Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Ligase
total genus 20
structure length 76
sequence length 86
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1sC00
2BYVE 2BKFA 3QIJA 3SD5A 3PVLA 3SHQA 2K6DB 2GBKA 3A33B 2KHWB 4BKGA 3PHXB 1Y8RC 3KW5B 3R7RA 1WXAA 2AL6A 2NR2A 5G55A 3AXCA 2MBEA 2FUHB 4HCPB 5IAAC 1SE9A 3A9KA 4ANUA 3OAWA 5AZHA 1WMHB 4FJZA 4WJOA 5LLIA 3WAMA 1RAXA 3RULA 3QAQA 2GOWA 3QC8B 4WWPA 3ZNZB 5JHBA 2KC2A 3DQVA 2JWZA 1H4RA 2ZEQA 1U4AA 2DZMA 4PS8A 1H8CA 2I1JA 3NZSA 4RMAA 4K7UA 4NY0A 3RZWC 3V62A 1V49A 3B08A 1ISNA 1LM8B 1J8CA 4KSKC 4WJNA 4MJSA 1GJZA 2BPSA 1NDDA 2CHWA 2ZNVB 4WJPA 5D6JB 3OLMD 3UQBA 3ZUNA 3L08A 2ZVNA 3WAOA 3MHSD 3UIPB 5JZEB 3NY5A 4G11A 3APCA 4G50A 4HDQA 4ZRIA 4EZKA 1WYWB 2KTRB 3V6EB 1WMHA 1Z5SB 4MGIE 4IW0A 2KVRA 1Q1OA 2I1KA 2MBQA 3M63B 4W9IA 2KKCA 5L83A 2KMAA 2K8HA 4WQOB 2IO1B 4JIOU 4F7ZA 4ASWC 3KUZA 3ALBA 1WGGA 3KYCD 2ZPYA 3IHPC 2DAJA 3VFKA 4DHZE 2K8BA 2C7NB 1GC6A 2KWCA 4FJVB 2MBBB 1UGMA 4PS7A 2KX3A 1T0YA 4JGHB 3ZW3A 5LXIB 1V6EA 3H9DA 2ZVOA 2KFKA 3H7PA 2JF5A 3RCZA 2D10A 2NBWB 3LJ3A 1E90A 2FIDA 2UWQA 2KLCA 1KJTA 2JRIB 4W9JA 2O2VB 4AJWA 2PE9A 4NNJB 4LCDE 1NI2A 3C0RB 4MELA 3TIXA 1YX5B 2AL3A 2JRHA 2A5UA 5KHOA 3SU8X 2BF8B 2K8CA 2K25A 3RYTA 1WR1A 5E6OA 5AZGA 1WGYA 1JRUA 2L7RA 4WJQA 3V6CB 4BOSC 4JLCA 5DPTA 1MG8A 2KOXA 2C5LC 1YD8U 2RPQA 3V60A 4IC7B 3KYDD 1K8RB 5C1ZA 3HHMA 3I3TB 1RFAA 3DBLI 4EFOA 2IO2B 4EUTA 2MX2A 3APFA 3PS6A 4KZ0A 4P7IA 2KN5A 2O2VA 2ZZPB 1LQBA 1GUAB 2GBJA 2L8JA 2BYFA 2N7DA 3U8ZA 2QHOA 2CR5A 4W9LA 4EOYA 1IPGA 2FIFA 5D94A 3PGEA 1WM3A 1J19A 1WZ3A 4GN1A 5IA7A 3R3MA 2LI5A 1UBIA 2CKHB 1WXMA 2L0TA 4WWOA 2LVPA 3ML9A 4ZRKA 3SDLC 1V9JA 3T9LA 2NS5A 3JSVB 4IG7B 3AI5A 2D11A 5CTRC 5GMVA 3EFUA 2KANA 5C23A 2LVQA 2LJ5A 2V4LA 1Z2MA 4M8MA 1YJ1A 1CMXB 1V2YA 1UBQA 3RT3B 3JVZX 2BGFA 3L17A 3H1UA 4OVVA 2KD0A 2LGDA 3TMPB 3VTVA 3M3JA 3UIOB 3OJ3A 3DPDA 2LGYA 3QA8A 4E71A 3U30A 1QZEA 2MBOA 4F1SA 2NBVB 4AOFA 2G4SA 4LJPB 2LUEA 4ZYNA 4FA6A 3VHTC 5HKHA 2N9PC 4A20A 3DVNV 4GSWA 2GBRA 3JSVA 3PLVA 4KDLB 2EKEC 2MLBA 3ZNHB 1L2NA 4FHJA 1WJ4A 4FLHA 1VD2A 1ZKHA 3ZKJC 2LXAA 3PHWB 4KSLC 3A1QB 2YVCA 1R4NI 3KH0A 4AUQC 2KWVB 3CF6E 3VAWA 2M0XA 3APDA 2Z59B 3TJPA 1OTRB 2PEAA 3R66C 4W9DA 4W9GA 2N1VA 1OGWA 2LRWA 1FXTB 1RRBA 2ZNVC 3M95A 1WR6E 2K6QA 1V80A 4AP4C 2KJ6A 3S2AA 1KOTA 3H7SA 2D2QA 2RSUA 4ZRJA 5DCNA 1Q0WB 4ICUA 4BKSA 3VVWB 2MQJA 4W9EA 4F8CB 4W9CA 1HE8A 2EMSA 1YX6B 2C7HA 3DVGX 4NJ6A 3VH4B 1WY8A 1SIFA 2LZ6A 3QX1A 2DZJA 2KJHB 2HD5B 2MW5A 3MTNB 2JZ3B 3ZDTA 2L00B 4FBJB 1WE7A 1WX7A 1X1MA 5J17A 4DHZB 4IWOA 3DVGY 4BFRA 4OVUA 4GXBA 4BBNF 4ANWA 2C9WB 3OJ4B 4TQ0A 5E6PA 2IY1B 4N9F4 2ZJDA 2JY6A 2KDIA 2XK5B 3A9JB 2N1WA 4MGKE 4E3CA 3VXWA 3JYUA 2R2QA 3Q3JA 2KJRA 4HLEA 3PRZA 5CHFA 4HDOA 2MSED 1G6JA 2BYEA 2K39A 1KLVA 3MJWA 3X23A 2KO3A 1NBFC 4EKUA 2FNJB 2KTRA 1GC7A 2KK8A 4URKA 3ZVVA 1P98A 3NZUA 2KMCA 1E8ZA 1P1AA 2JXXA 3BY4B 4AJYB 2BWES 3VQIA 3L13A 4G3XB 2JZZA 2ZCCA 4FADA 3QHTA 1YQBA 3M62B 4PS3A 3WAPA 5CHVC 3ONSA 2AWTA 4MGYE 3RZFA 3R7QA 2KZRA 2C7MB 2PPHA 5D7GA 1I35A 2YLMA 2LGXA 4YL8A 2KDFB 3N3KB 3WA0A 3DVNU 4XX5A 2V3SA 2XK5A 3A9JA 2KC1A 2LASA 4TKNA 1D3ZA 3KVFB 4ICVA 4MSMB 4DBGA 1WGRA 3ECIA 2B3AA 2LWPA 1V86A 3DDCB 2RGFA 1GG3A 3PSEB 2MBHA 1V5OA 1UH6A 1V5TA 2O6VD 3B1LX 1WX9A 3WIMA 2AEHA 2N4FA 1E8XA 2EMTA 4GDLB 2N7EA 1UELA 1WIAA 3CSFA 3EECA 4RM8A 4II3B 4B6WA 1WFYA 4FHKA 5CHWA 4II2B 1WXVA 3JW0X 3L54A 3QK0A 2MP2B 4GGQA 2L3ZA 2J0KA 2N9EB 4WWNA 4BOZB 1F9JA 2IO0B 2FCNA 2MRPA 2DYOA 1LFDA 1P0RA 2RR9A 1ZW7A 2VRRB 4K81A 4NAWB 3V61A 3VUYA 1OEYA 3EC8A 1GNUA 2ZCBA 5E6NA 1BT0A 1WI0A 2C60A 2J7QB 1E8WA 1Q5WB 3A4SC 3TBLD 3PV1A 1WJUA 2DENB 1WH3A 3NHEB 4XZ4A 4HJKA 2G45B 1SGHA 1TTNA 3PRMB 4NJ7A 3VH3B 4DHJD 2NCNA 2W9NA 3ZDMC 4DDGD 5DPWA 4M8NA 3DBRI 3DBSA 2WDTB 4CO7A 3PTFC 4FN2A 4BVUC 3O65B 3QJZA 1OQYA 3ZNGC 2D3GA 4I6LB 1R4MI 3Q3FA 4B9KA 4TV3A 4NQKE 3PPAA 4EEWA 4XC2A 2IO3B 2PE6B 4JQWC 4KDIC 2G4DB 1E7VA 2M4NA 4HPLB 3AU4A 3U7DA 4DHJB 4FULA 3IFWB 3LDZE 3UF8A 2J0JA 2JT4B 2DZKA 3VTWA 3W1SC 3W1YA 1LXDA 3BINA 3HIZA 4MDKE 2FCQA 2MCNB 4DK5A 3ZTDA 2JPHA 2CS4A 2HE7A 2M17A 2GMIC 1KM7A 4MJSB 3IBEA 2NPTB 2GBNA 2KLGA 3KUDB 2BWFA 4FJYA 3QQ8B 2NVUI 1M94A 1WJ6A 2MWSB 2IY0B 3B0AA 3CSTA 3PREA 4A3PA 5JHAA 2LD9A 2Z0EB 1V81A 4LDTD 4LJOB 3HK0A 3ENEA 2MA9B 3W1SA 4WAAA 1P3QU 2R2OA 3TL5A 3UQAA 4IUMB 4K7SA 2UYZB 5KHQA 2JUOA 4MEMA 3RD2A 2IYDB 1WM2A 1E5WA 2BKRB 5G2NA 5LXHA 2WX0A 1WF9A 3EHVA 1UD7A 4MM3A 1EO6A 1TBEA 1RLFA 3PRPB 4LDTB 4W9HA 2K1FA 3ZIMA 5CX3A 2KDEB 3UINB 2REXA 1WZ0A 2NPTA 3K9OB 3PT2B 3VTUA 1WXSA 3DCGA 3DOWA 1J0GA 3A1QA 3AULA 3A4RA 2KFKB 3H7PB 4HK2A 4B95A 4BBNC 4HXDA 4TUUA 1AARA 2N9XA 1TGZB 2JVCA 3ZO5B 4DWFA 2RD0A 4HVBA 5L95C 4KIKB 2CHXA 2GBMA 2ZPNA 1S1QB 4GMVA 4IWQA 4ZDVA 4X57B 2FCMA 4KZCA 1WJNA 4CYEA 4IM3A 3ZTCA 2KWUB 3T8MA 1XD3B 3VDZA 2PJHA 2DAFA 2KXJA 4K7WA 2WWZA 1VCBA 2G3QB 2V1YA 3HM3A 3WALA 2KX0A 2OOBB 3GZNI 4IWPA 2LVOA 1IP9A 3GOEA 4PYZA 2LXCA 4EZJA 1I42A 1YIWA 4GOCA 3TCAA 3ZRCA 4AWJA 2HTHA 4GB9A 2Y5BB 3L16A 3PZDA 2NBUA 3K9PB 3QCAA 3WANA 1WX8A 4CHKA 4KIKA 1L7YA 4GU2A 1XQQA 4TQ1A 3ZRFA 2IBIB 4DDID 4MH0E 3QWZB 2CHZA 4KVGB 2Z0DB 1OEYJ 2M8SA 3HM6X 4BKTA 5J18A 2DX5B 1E7UA 2HJ8A 5AEKB 1A5RA 1EF1A 3P2BA 3PLUA 2XBBC 5BO4B 3IVFA 2KNBA 3QARA 2AYOB 4I6PA 4NQLB 1WRDB 1WGHA 4E74A 2WYQA 4GDKB 4IM0A 3L10B 1E8YA 1C1YB 1PQSA 3DBHI 2DYMA 2KTFA 2M1MA 4GIVA 5AZFA 3NOBA 2O6VB 4IM2A 5J2RA 2KFJA 2L0FA 2CU1A 2KDBA 3H6NA 4K1RB 2IZVB 2FAZA 4HPMB 2WX1A 4PYUA 4NPNA 1EUVB 2D07B 3VUXA 5D2MB 3D32A 2A4ZA 4JL9A 1TZ1A 1S3SG 3L0WB 1UZXB 3N32A 4ANVA 1IYFA 4DXAB 4A3OA 1WE6A 3ZLZA 4M0WB 4GDLA 2J0MA 3ML8A 4HCNB 3NS8A 3RUIB 2KQ7A 2ASQA 4MGZE 4HWIB 2MP2A 4W9FA 2DYBA 5EDSA 4EZLA 3A9KB 4KV2A 4GDKA 5FR6A 1WGDA 2XEWA 2DZIA 3UGBB 4NAWA 5TR5A 1EF5A 4RM9A 2L76A 2LRUA 2O6VA 4ANXA 3N30A 4G0NB 3CMMB 2FCSA 3X0WA 5JH5C 3ZNID 4J6IA 5DPRA 1C3TA 3AU5A 2OJRA 4I6NB 4MSQB 1XT9B 1P9DU 1ZGUB 2L05A 3IG3A 3KUCB 5DPSA 4W9KA 4BKSD 2KQSA 2DHZA 3VUWA
chains in the Genus database with same CATH superfamily
2BKFA 2K6DB 1ZP0B 3AH7A 3KW5B 2J4XA 2LMCA 2NR2A 3Q8CA 3RNBC 3RN9C 1FCCC 3KWLA 2ZW0A 1VLBA 1WMHB 4WJOA 1RAXA 3QAQA 4WWPA 4B0EA 1H4RA 3DHIC 4LLGM 3CIRB 4KSKC 4WJNA 2YEPF 1GJZA 2BPSA 1HQRD 3AE6B 5D6JB 5EE1A 3UQBA 3T3OA 3ZUNA 5JZEB 4DXFA 5E6JA 4G50A 3Q3OC 4HDQA 4ZRIA 2KTRB 1Z5SB 4MGIE 1Q1OA 4US8A 2QIEB 5L83A 3KUZA 4S17A 3KYCD 2KT7A 4JWSC 4OZBA 3NVYA 2C7NB 1GC6A 4FJVB 1QKZA 1R4MB 2KX3A 3ZW3A 1N60A 2ZVOA 4L2YA 3H7PA 2EELA 5T8IA 1FCLA 2QEJC 2K3UA 2NBWB 1AN8A 1VR9A 2WXHA 1D5MC 2O2VB 1FD6A 4LCDE 3GE3C 3BZDB 2A5UA 4H2AA 2BF8B 2QMTA 3LB8C 4EE2A 4C7ZA 3Q8BA 5AZGA 1WGYA 2L7RA 5DPTA 3N1XC 1K8RB 3I3TB 3DBLI 3NJTA 4LNNA 4EFOA 1HZ6A 4EUTA 4ZHPA 2K9XA 3P63A 3PS6A 4KZ0A 2KN5A 1DOIA 1XCTL 2JXTA 2L8JA 2BYFA 1L0YB 4W9LA 2FIFA 5D94A 5IA7A 3ETRA 2L0TA 4IOIE 4O1NA 4P1CC 4ZRKA 1V9JA 3T9LA 1N5WA 2D11A 2AX5A 1IBXA 2LVQA 4M8MA 2IJ0A 1V2YA 1UBQA 3RT3B 3JVZX 4ZHOA 2WXGA 2LGDA 3OJ3A 3GZNB 4AOFA 4LJPB 4ZYNA 5IO9A 5HKHA 3DVNV 4GSWA 2GBRA 2KYWA 1UWXA 1L2NA 1I7HA 1T5XD 3IT4B 3SEBA 1ZKHA 3PHWB 1YQ3B 3A1QB 1QOFA 2M0XA 3MC0B 3APDA 2Z59B 3DHGC 4HJGE 4XYCA 3TJPA 1KTKA 1KH0A 4W9DA 1OGWA 2LRWA 1FXTB 1RRBA 2ZNVC 3AM9A 1WR6E 3GP7A 4F8CB 2EMSA 3HRDD 3VH4B 1SIFA 3QX1A 1WX7A 2MJEA 4DHZB 3RMKC 4BFRA 2C9WB 3OJ4B 4TQ0A 2JY6A 4MGKE 5CHFA 1G6JA 1KLVA 3MJWA 1GB4A 1NBFC 2G1EA 4A6QA 2KTRA 2M56B 3NZ3A 1P98A 3TSSA 3NZUA 1P1AA 4ZRQA 4AJYB 2BWES 1I4GA 2Z8LA 1SJED 3OG5A 2KAJA 2H89B 2AWTA 2WXQA 1UF0A 3BYTB 1I35A 1FXAA 2LGXA 1ZDVA 4XX5A 3Q3MC 4KGSA 3KVFB 4ICVA 4M02A 2B3AA 3DDCB 2INPE 1AWDA 4BZAA 2O6VD 1QOAA 3WIMA 2AEHA 1E8XA 4C00A 4RM8A 4II3B 1XEEA 2MP2B 2ONQA 1JMLA 4WWNA 4BOZB 2IO0B 2FCNA 2WXLA 4K81A 1P0RA 3DWMA 2KVZA 1GNUA 5E6NA 4MACA 1YN4A 1WI0A 1FO4A 2K0PA 3A4SC 2DENB 4LTUA 1JWUD 4RF1A 3NHEB 2NCNA 3ZDMC 4ARCA 5DPWA 4DQOC 3AE9B 4FN2A 4D2KA 1OQYA 4LNOA 3PPAA 1SE2A 4KDIC 2XNAC 2M4NA 4HPLB 4DHJB 3IFWB 2JT4B 4KGRA 1VZ7A 2IGDA 1LXDA 4OZCA 3AE7B 2D5GA 1KLGD 1ET6A 4MM3B 1MFWA 1MVKA 1KM7A 3W5UB 2NPTB 4HRSA 3B0AA 2WQYB 3HK0A 2MA9B 4WAAA 1P3QU 1TS5A 2PTLA 3TL5A 2PKOA 4TMAB 4IUMB 2UYZB 3DBLB 1E7PB 2IYDB 3MHZA 1NI3A 1WF9A 1UD7A 1EO6A 1RLFA 4W9HA 5CX3A 1TY2A 1WZ0A 3BVMA 1XLPA 4TSSA 3A1QA 2KFKB 4RCOA 2N9XA 4LNIA 4UDUC 4GMVA 4LNFA 2W3RA 4IWQA 2IDYA 2FCMA 4OW0A 3T8MA 1XD3B 4RH6A 1QF6A 3VDZA 4NJCA 2KXJA 1K53A 1FNVA 2B76B 3ZGZA 3N9YC 3GOEA 1L4ZB 4AWJA 3TCAA 1N63A 1VZ6A 1L7YA 2V9HA 4GU2A 3Q3NC 4WAFA 3ZRFA 3AECB 4KVGB 2Z0DB 2DX5B 3BWUD 1E7UA 1A5RA 4I6PA 4NQLB 2RMMA 1AYFA 1JWAD 4N6EB 2W54A 1PQSA 2DYMA 4GIVA 3RNCC 2KFJA 2L0FA 2CU1A 2KN4A 4HPMB 4NPNA 4IDIA 2J53A 3VUXA 3IXSA 3L0WB 2WXNA 3AE2B 2QILA 4A3OA 3ZLZA 4HCNB 4HWIB 5AUKA 2FUG1 2MP2A 4W9FA 2DYBA 5EDSA 1WGDA 2XEWA 2DZIA 1GB1A 2LRUA 4G0NB 3X0WA 3ZNID 1TS2A 2MJ3A 3AU5A 4I6NB 1XT9B 2HJ1A 3KUCB 1PYWD 3RNFC 2KQSA 1SB3C 1L4DB 3ZYYX 3PVLA 5H8YE 3MJ5A 3Q6BA 1C77A 3CWIA 2W55A 3AXCA 1SE9A 2GLSA 3A9KA 3GB1A 5AZHA 4ANUA 1JROA 2SEBD 4YSXB 5JHBA 1EU4A 1TS4A 2KC2A 1R7SA 2ZEQA 4PS8A 2DZMA 1H8CA 2WXFA 1HTOA 4K7UA 4NY0A 3RZWC 2VH1A 1L5PA 5TSSA 1LM8B 1J8CA 1PDXA 2CHWA 2ZNVB 2MHJA 1FPYA 3L08A 2ZVNA 2M19A 3VRBB 4G11A 3APCA 3V6EB 2I1KA 1ZPSA 2KKCA 3C19A 2K8HA 4WQOB 1LO5D 4P1BC 2W3SA 1V1OA 2ZPYA 3OWEB 1T6BX 1NENB 2K8BA 3EA6A 1B9RA 2KWCA 1I4QA 3L4PA 1V1PA 2MBBB 1T0YA 3I63C 1V6EA 3H9DA 2JWUA 2KFKA 2JF5A 1WSPA 3RCZA 1FRDA 2UWQA 3EFCA 2KLCA 3PO0A 3LYYA 4AJWA 1NI2A 3C0RB 1MPEA 2AL3A 5KHOA 2JRHA 1KFYB 3ZJUA 3AMZA 2K25A 3RYTA 1WR1A 2I38A 4ITKA 2KOXA 3V60A 4IC7B 3KYDD 4B0MA 4RGNA 3HHMA 2IO2B 1GUAB 1FNUA 1TIFA 3NRZA 4XWTA 2N9KA 4GN1A 1WZ3A 3R3MA 2CKHB 1WXMA 2NTSA 2LVPA 1YN5A 1YNTE 1NYRA 3ZXVA 3AI5A 2WXRA 4YSYB 2KANA 1Z2MA 1YJ1A 1FM0D 4P6VF 3H1UA 2WXKA 2KD0A 3VTVA 3M3JA 4JWUC 1PGXA 4YTMB 1AW7A 3UIOB 2OHFA 1STEA 1D5XC 4OZAA 4ARIA 2NBVB 1N5XA 1FNWA 4A20A 3JSVA 1JQ4A 1FMAD 2K5PA 3PLVA 3Q2AC 4KDLB 4REZA 4MH8A 2MLBA 4C80A 3R8BA 2YEPB 2LXAA 4KSLC 3KH0A 1R4NI 4ZYSA 3CF6E 3NVVA 3O13A 5IOIA 1TKYA 4W9GA 2WXOA 2K6QA 2WXIA 2KJ6A 3S2AA 1KOTA 3H7SA 2D2QA 1Q0WB 4ICUA 4HPPA 4W9EA 2WXMA 3TEZA 3AE8B 3DVGX 4RF0A 2KJHB 1VRAB 5MPOA 2HD5B 2MW5A 3AN1A 2L00B 4FBJB 1WYGA 1A70A 4GXBA 4ANWA 1J7AA 5E6PA 1RFKA 3JYUA 3Q3JA 2KJRA 3IT6B 1T0QC 4HDOA 2VH2A 3RI7C 2L83A 3ZVVA 1BMLC 4WQMA 4L1BA 2BBCA 2NTTA 2JXXA 4KGTA 2RDBC 4NAMA 4G3XB 2V3NA 1GOZA 2L32A 3M62B 3RZFA 5BYRA 3E56A 3R7QA 2PPHA 1FRRA 4YL8A 3N3KB 2V3SA 2XK5A 2KC1A 2X38A 4TKNA 1D3ZA 4MSMB 4DBGA 2Y5CA 3ECIA 2LWPA 3NVWA 4YTNB 2RGFA 2OEDA 2LHDA 3B1LX 2N4FA 3NS1A 3CSFA 3BK1A 4FHKA 5CHWA 4II2B 1WXVA 2KDMA 2J0KA 4JE3B 1VDVA 2MRPA 2BYTA 1LFDA 3V61A 1ZW7A 2VRRB 2JYEA 1OEYA 3IAM1 2ZCBA 2C60A 1Q5WB 2WXPA 3TBLD 2PVOD 4XZ4A 2G45B 1SGHA 1YOVB 1E9MA 3DBRI 3DBSA 3RNEC 2DLBA 2WDTB 4CO7A 5IN7A 2Y5PA 4NQKE 4EEWA 3Q69A 4XC2A 1C78A 4JQWC 1E7VA 3U7DA 4FULA 4A9AA 3LDZE 4C7YA 1BXTA 1WGKA 1YN3A 2NMQA 2FCQA 3R2TA 3RNAC 2M17A 4MJSB 1NEKB 1F1HA 2KLGA 4KX6B 5JHAA 4LJOB 3TEWA 2R2OA 5HFYA 2WGSA 1QOGA 4A8XC 5G2NA 2WX0A 4YXDB 3VTUA 3DOWA 1J0GA 1JWBD 3AULA 2OJWA 4HK2A 1SE4A 3VRAB 4B95A 4HXDA 4DWFA 2RD0A 1F77A 4X57B 1N62A 4KZCA 1SXTA 1WJNA 5JXVA 3DHHC 4K7WA 4R3DA 1VCBA 3C8YA 2BVCA 2OOBB 1ZDXA 2LVOA 1I42A 1ET9A 2WU2B 3ZRCA 2FBWB 2Y5BB 3K9PB 1CQVA 5C3JB 3SR6A 4MH0E 3QWZB 2CHZA 1JCKB 1OEYJ 2M8SA 5J18A 3VR8B 5AEKB 1R4NB 3P2BA 5BO4B 3ZXRA 2WDVB 4Q2JA 3DWGC 1WRDB 2INCC 3ZQ4A 3TEYA 2WLBA 4IM0A 3L10B 5C2TB 1C1YB 2W82A 2LJIA 5AZFA 1ZUD2 2D3CA 2D07B 3D32A 1C4AA 1S3SG 3N32A 3R2IA 4DXAB 1UNSA 2J0MA 1SSNA 3U7ZA 3A9KB 4KV2A 4GDKA 5FR6A 3UGBB 4RM9A 2O6VA 2R61A 5D3IB 4ANXA 1QLBB 3CMMB 4J6IA 5DPRA 4MSQB 1T0RC 3IG3A 4BKSD 3AE4B 3BVGA 4ACFA 2BYVE 3SD5A 3SHQA 2GBKA 1GPXA 4M0WA 3PHXB 4C4VA 1Y8RC 2AL6A 5BYQA 1JW9D 2MBEA 1PGAA 2FUHB 4HCPB 5IAAC 3OAWA 4FJZA 3AV8A 3RULA 2KACA 3ZNZB 3DQVA 1C79A 2JWZA 1U4AA 3Q8EA 3V62A 1ISNA 2GRIA 4MJSA 1V1PB 1NDDA 1CK1A 4XE0A 4ZOHC 4HROA 1DYQA 3WAOA 3MHSD 3W2DA 4YSZB 4WURA 3NUHB 4KKIA 1WYWB 4N58A 1FFUA 1XF5L 3GE8C 1YMHE 2MBQA 2KMAA 1XCQL 4ASWC 2RPVA 3ALBA 1WGGA 3DBRB 4PT5A 4DHZE 4HKZE 1XLNA 2ON8A 1UGMA 1QT9A 3MP9A 4JGHB 5LXIB 2WS3B 3RNGC 1L6UA 3LJ3A 1UWMA 1E90A 2MJDA 2FIDA 1N61A 1KJTA 2JRIB 4W9JA 2KQ4X 2PW9A 1TT5B 4HEA1 2DWQA 5I4DA 4JPSA 1JRUA 3V6CB 1MG8A 1FFVA 1YD8U 3NG0A 1WXQA 1L0XB 5EE0A 2MX2A 1EM7A 2ACZB 3APFA 1VZ8A 4P7IA 1XLOA 2ZZPB 1CJEA 2QCZA 2GBJA 1K50A 2BQQA 2QHOA 2CR5A 4EOYA 1IPGA 3PGEA 1J19A 4WWOA 3Q8AA 3SDLC 1V8CA 1UUPA 1JALA 3JSVB 5CTRC 5GMVA 1B1ZA 1HTQA 1YJIA 3L17A 2BGFA 2E6XA 1ACCA 3ZJTA 4M00A 1DOYA 3PZ7A 2KWDA 3DPDA 2BS3B 2LGYA 2INDC 4M01A 2AQ1B 3U30A 2MBOA 4XDDA 1ROEA 3N1YC 4FA6A 1RWSA 2FE8A 3ZNHB 4FHJA 4FLHA 3ZKJC 1IUEA 2X8XX 3AE1B 2IGGA 1OTRB 2CU3A 1GAQB 3EGRA 4JX1C 1DOXA 2WU5B 4AP4C 2QDFA 1J7CA 3W5VB 4NZLB 1T0SC 2CJOA 3AEEB 5DCNA 5LNK1 2JU6X 2MQJA 1FIQA 1NVID 2H88B 3KQ4A 4NJ6A 3MC9A 2LZ6A 2DZJA 2LFIA 3MTNB 2JZ3B 3ZDTA 2N7JA 5J17A 4IWOA 3DVGY 4OVUA 4LK0M 2IY1B 4N9F4 2ZJDA 4E3CA 2XK5B 3VXWA 3HUIA 4HLEA 3N1ZC 3X23A 2KO3A 4EKUA 1HEZE 1YQ4B 3EUB2 4L23A 1OQQA 2LHEA 2KMCA 1E8ZA 3BY4B 3MFGA 3VQIA 2LGIA 5BMIA 3WAPA 4PS3A 5CHVC 3ONSA 3P4QB 2KZRA 2C7MB 2YLMA 2D3BA 2KDFB 3WA0A 3A9JA 2LASA 1WGRA 3Q8FA 1V86A 1GG3A 3PSEB 2MBHA 3AEBB 1UH6A 1V5TA 2JX5A 3V3XA 2EMTA 4GDLB 4B6WA 1WIAA 1WFYA 1L0VB 3L54A 3QK0A 4GGQA 2N9EB 4OVZA 1F9JA 1UGJA 4NAWB 3U52E 1BT0A 1E8WA 2WXJA 4P16A 3PV1A 1WH3A 1P7EA 1D5ZC 3FKYA 4HJKA 3TEXA 1F52A 4NJ7A 4DDGD 5HI1A 3SFEB 4BAXA 2D3GA 4I6LB 3Q3FA 4B9KA 4TV3A 5G5GA 3P4PB 1TKGA 3FILB 3MC8A 4USAA 2HDEA 3VTWA 2J0JA 2GI9A 3W1SC 3W1YA 3BINA 3HIZA 4MDKE 1TKEA 4DK5A 2KMMA 2MCNB 3ZTDA 1IGCA 1D6EC 1I4RA 2GBNA 3QQ8B 2NVUI 1M94A 2MWSB 5IP4D 2LD9A 2Z0EB 4LDTD 3P4SB 3UQAA 4K7SA 5KHQA 3RD2A 1WM2A 4RNAA 3BIID 1MHXA 1QQRA 3EHVA 1E6EB 2VZKD 3ZIMA 2K1FA 2KDEB 4CQNA 2REXA 3K9OB 1JRPA 3A4RA 1TS3A 4BBNC 1VJKA 2MEKA 1TGZB 2JVCA 2G9HD 4HVBA 2GBMA 1TYGB 3Q14C 1S1QB 4ZDVA 3SFDB 4IM3A 2KWUB 2IGHA 1P7FA 3W9CB 4WIPA 4AS1A 3UI3A 1F0ZA 2WWZA 2G3QB 2V1YA 2KX0A 2K22A 3IAS1 1IP9A 1I4HA 4EZJA 2HTHA 4GB9A 3PZDA 3L16A 2NBUA 3PZ8A 3QCAA 1WX8A 1XLQA 4KIKA 2M0AA 4CHKA 1XQQA 4DDID 2J42A 4BKTA 3P42A 1EF1A 3PLUA 1PFDA 2WP9B 2KNBA 3QARA 1OFFA 4E74A 2WYQA 4GDKB 2N0SB 1ZXIA 1E8YA 3ABVB 3DBHI 2M1MA 3NOBA 2O6VB 2L52A 5H92C 5J2RA 5IKCM 3BYYB 4K1RB 2WX1A 4MT5A 5EE9A 1WWTA 2A4ZA 1TZ1A 1UZXB 3KLSX 1IYFA 1WE6A 3I57A 4M0WB 1F2RC 4GDLA 3ML8A 3RUIB 4C4VB 2KQ7A 2LGSA 1V97A 4NAWA 4XWWA 5EE3A 4RGOS 2D3AA 2L76A 1FXIA 3N30A 2ZW1A 2DNFA 1ZGUB 5DPSA 4C56C 3VUWA 3QIJA 3A33B 2KHWB 4BKGA 4KKJA 3R7RA 1WXAA 5G55A 2WDQB 3VR9B 3AEDB 1TJEA 4RFBA 1I4XA 5LLIA 3WAMA 3FC4A 2GOWA 3QC8B 3FILA 2I1JA 3NZSA 4RMAA 4HKQA 1V49A 3B08A 1K52A 4XDCA 1KLUD 1ZE3D 4LNKA 3B2GA 4WJPA 3OLMD 3BVZA 4DXGA 3UIPB 4YWGG 3NY5A 4J3OD 3HVZA 4EZKA 1WMHA 2CJNA 4IW0A 2KVRA 3M63B 4W9IA 1EWCA 2IO1B 2PLPA 4JIOU 4F7ZA 1F2RI 2UU7A 3I9V1 3IHPC 2DAJA 3WCQA 3VFKA 3NVZA 5HHDG 4PS7A 1C76A 2XN9C 4K3CA 2D10A 3H8HA 4YT0B 2PE9A 4NNJB 3TIXA 4MELA 4A55A 1MHHE 1YX5B 1SBBB 3SU8X 2RDGA 2K8CA 5E6OA 4WJQA 1TY0A 1Y56A 4BOSC 4JLCA 3AEAB 2Y3AA 2C5LC 2RPQA 2BTEA 2AQ3B 5C1ZA 1K51A 1RFAA 1T3QA 4WH4A 1ESFA 2O2VA 1LQBA 2N7DA 3U8ZA 5FR3A 1WM3A 2LI5A 3B9JA 1UBIA 1RM6C 1XXGA 4WWMA 2V3PA 3ML9A 1KF6B 2NS5A 4IG7B 3EFUA 5C23A 2V4LA 1SF0A 2LJ5A 1CMXB 1WRIA 4FXCA 4AQ7A 2PMVA 4OVVA 1C9FA 3TMPB 3P4RB 4YTPB 3QA8A 4E71A 1QZEA 2QJLA 4F1SA 2L1AA 2G4SA 2LUEA 3VHTC 2N9PC 2EKEC 1WJ4A 1VD2A 1LGRA 2RDHA 1EWYC 1HA5A 2YVCA 4AUQC 2KWVB 2QC8A 3VAWA 1D4BA 3U4EG 1PUTA 4PK1A 1TZOA 3GS2A 3DBHB 2PEAA 3R66C 2N1VA 3M95A 2V0GA 1V80A 2JSVX 4S0RA 1MJDA 2RSUA 4ZRJA 2N9LA 4BKSA 3RFZB 3VVWB 4W9CA 1HE8A 1MG4A 1YX6B 2C7HA 2J52A 1WY8A 5AUIA 1NYQA 1Q10A 1WE7A 1X1MA 1QILA 2BB5A 4BBNF 2GB1A 4N59A 1PGBA 1ZOYB 2KDIA 1N6ZA 2N1WA 3A9JB 2R2QA 3PRZA 2MSED 2BYEA 2K39A 4QAYA 2FNJB 1GC7A 3T3NA 2KK8A 4URKA 1DGJA 5D3DA 2WHIA 3L13A 2JZZA 2ZCCA 4FADA 3QHTA 1YQBA 4MGYE 5D7GA 1ZXHA 3DVNU 1RYJA 2SAKA 4IKGA 2BT6A 1V5OA 2ICIA 2V4IB 2AQ2B 1WX9A 2N7EA 1UELA 1E0ZA 3EECA 2BW2A 3JW0X 1SEBD 2L3ZA 3FAHA 2DYOA 1E10A 2RR9A 5HG2A 3VUYA 1BUIC 3EC8A 2Q5WD 2EKIA 2J7QB 1WJUA 1MI0A 1HZ5A 1TTNA 3PRMB 3VH3B 4DHJD 2W9NA 3HVDA 4M8NA 4RGMA 3PTFC 4BVUC 3O65B 3QJZA 3ZNGC 4A90A 1R4MI 4GLSC 1SE3A 2IO3B 2PE6B 2G4DB 3AU4A 2QSDA 3AEFB 3UF8A 2DZKA 3URYA 2PVGC 2IPKD 2JPHA 2CS4A 2HE7A 2I2YA 2GMIC 2WNMA 3AE5B 5BMHA 3IBEA 3KUDB 4FJYA 2BWFA 2JZPA 1WJ6A 2IY0B 3CSTA 3PREA 4A3PA 1V81A 3ENEA 2BS4B 3AE3B 1CZPA 3W1SA 2JUOA 4MEMA 1E5WA 2BKRB 2TSSA 4XGAB 5LXHA 1XO3A 4MM3A 1TBEA 3U2SC 1OQRA 3PRPB 4LDTB 3ZJVA 2E3TA 3UINB 1M4VA 2NPTA 3PT2B 2WDRB 3P1MA 1WXSA 2MH7A 3DCGA 1L6VA 2BS2B 3H7PB 2HTME 3RPFC 4TUUA 1AARA 3ZO5B 5L95C 4KIKB 2VZKB 2CHXA 3LXFA 2ZPNA 1C4CA 4CYEA 3ZTCA 3J9CA 4OHJA 2INNE 1ENFA 2PJHA 1SJHD 2DAFA 1J7BA 5FKAC 3HM3A 3WALA 2JQRB 3AEGB 3E9SA 3GZNI 4IWPA 4PYZA 2LXCA 1YIWA 4GOCA 3BK2A 1JWMD 5G5HA 2DBYA 3WANA 1I4PA 1SIJA 2JYTA 4K3BA 4TQ1A 1C4PA 2IBIB 1YJJA 3I5JC 3HM6X 4US9A 2LEKA 3V05A 2HJ8A 4RGTA 4ZRPA 5FK9C 2LUMA 1HXYD 2XBBC 3IVFA 5BYSA 2AYOB 1JWSD 1WGHA 5BMGA 2KTFA 1KRHA 4IM2A 1IBXB 3H6NA 2KDBA 2IZVB 2FAZA 4PYUA 2PIAA 1EUVB 3KWVA 5D2MB 4JL9A 1IGDA 1FEHA 4ANVA 3B2FA 5GXGB 1QOBA 3NS8A 4MGZE 2ASQA 2BB6A 4EZLA 3N20C 3TUOA 5TR5A 1EF5A 5JH5C 2FCSA 1C3TA 2OJRA 1P9DU 2L05A 3AB5A 4W9KA 1EU3A 2DHZA
chains in the Genus database with same CATH topology
2BYVE 2BKFA 3QIJA 3SD5A 3PVLA 3SHQA 2K6DB 2GBKA 3A33B 2KHWB 4BKGA 3PHXB 1Y8RC 3KW5B 3R7RA 1WXAA 2AL6A 2NR2A 5G55A 3AXCA 2MBEA 2FUHB 4HCPB 5IAAC 1SE9A 3A9KA 4ANUA 3OAWA 5AZHA 1WMHB 4FJZA 4WJOA 5LLIA 3WAMA 1RAXA 3RULA 3QAQA 2GOWA 3QC8B 4WWPA 3ZNZB 5JHBA 2KC2A 3DQVA 2JWZA 1H4RA 2ZEQA 1U4AA 2DZMA 4PS8A 1H8CA 2I1JA 3NZSA 4RMAA 4K7UA 4NY0A 3RZWC 3V62A 1V49A 3B08A 1ISNA 1LM8B 1J8CA 4KSKC 4WJNA 4MJSA 1GJZA 2BPSA 1NDDA 2CHWA 2ZNVB 4WJPA 5D6JB 3OLMD 3UQBA 3ZUNA 3L08A 2ZVNA 3WAOA 3MHSD 3UIPB 5JZEB 3NY5A 4G11A 3APCA 4G50A 4HDQA 4ZRIA 4EZKA 1WYWB 2KTRB 3V6EB 1WMHA 1Z5SB 4MGIE 4IW0A 2KVRA 1Q1OA 2I1KA 2MBQA 3M63B 4W9IA 2KKCA 5L83A 2KMAA 2K8HA 4WQOB 2IO1B 4JIOU 4F7ZA 4ASWC 3KUZA 3ALBA 1WGGA 3KYCD 2ZPYA 3IHPC 2DAJA 3VFKA 4DHZE 2K8BA 2C7NB 1GC6A 2KWCA 4FJVB 2MBBB 1UGMA 4PS7A 2KX3A 1T0YA 4JGHB 3ZW3A 5LXIB 1V6EA 3H9DA 2ZVOA 2KFKA 3H7PA 2JF5A 3RCZA 2D10A 2NBWB 3LJ3A 1E90A 2FIDA 2UWQA 2KLCA 1KJTA 2JRIB 4W9JA 2O2VB 4AJWA 2PE9A 4NNJB 4LCDE 1NI2A 3C0RB 4MELA 3TIXA 1YX5B 2AL3A 2JRHA 2A5UA 5KHOA 3SU8X 2BF8B 2K8CA 2K25A 3RYTA 1WR1A 5E6OA 5AZGA 1WGYA 1JRUA 2L7RA 4WJQA 3V6CB 4BOSC 4JLCA 5DPTA 1MG8A 2KOXA 2C5LC 1YD8U 2RPQA 3V60A 4IC7B 3KYDD 1K8RB 5C1ZA 3HHMA 3I3TB 1RFAA 3DBLI 4EFOA 2IO2B 4EUTA 2MX2A 3APFA 3PS6A 4KZ0A 4P7IA 2KN5A 2O2VA 2ZZPB 1LQBA 1GUAB 2GBJA 2L8JA 2BYFA 2N7DA 3U8ZA 2QHOA 2CR5A 4W9LA 4EOYA 1IPGA 2FIFA 5D94A 3PGEA 1WM3A 1J19A 1WZ3A 4GN1A 5IA7A 3R3MA 2LI5A 1UBIA 2CKHB 1WXMA 2L0TA 4WWOA 2LVPA 3ML9A 4ZRKA 3SDLC 1V9JA 3T9LA 2NS5A 3JSVB 4IG7B 3AI5A 2D11A 5CTRC 5GMVA 3EFUA 2KANA 5C23A 2LVQA 2LJ5A 2V4LA 1Z2MA 4M8MA 1YJ1A 1CMXB 1V2YA 1UBQA 3RT3B 3JVZX 2BGFA 3L17A 3H1UA 4OVVA 2KD0A 2LGDA 3TMPB 3VTVA 3M3JA 3UIOB 3OJ3A 3DPDA 2LGYA 3QA8A 4E71A 3U30A 1QZEA 2MBOA 4F1SA 2NBVB 4AOFA 2G4SA 4LJPB 2LUEA 4ZYNA 4FA6A 3VHTC 5HKHA 2N9PC 4A20A 3DVNV 4GSWA 2GBRA 3JSVA 3PLVA 4KDLB 2EKEC 2MLBA 3ZNHB 1L2NA 4FHJA 1WJ4A 4FLHA 1VD2A 1ZKHA 3ZKJC 2LXAA 3PHWB 4KSLC 3A1QB 2YVCA 1R4NI 3KH0A 4AUQC 2KWVB 3CF6E 3VAWA 2M0XA 3APDA 2Z59B 3TJPA 1OTRB 2PEAA 3R66C 4W9DA 4W9GA 2N1VA 1OGWA 2LRWA 1FXTB 1RRBA 2ZNVC 3M95A 1WR6E 2K6QA 1V80A 4AP4C 2KJ6A 3S2AA 1KOTA 3H7SA 2D2QA 2RSUA 4ZRJA 5DCNA 1Q0WB 4ICUA 4BKSA 3VVWB 2MQJA 4W9EA 4F8CB 4W9CA 1HE8A 2EMSA 1YX6B 2C7HA 3DVGX 4NJ6A 3VH4B 1WY8A 1SIFA 2LZ6A 3QX1A 2DZJA 2KJHB 2HD5B 2MW5A 3MTNB 2JZ3B 3ZDTA 2L00B 4FBJB 1WE7A 1WX7A 1X1MA 5J17A 4DHZB 4IWOA 3DVGY 4BFRA 4OVUA 4GXBA 4BBNF 4ANWA 2C9WB 3OJ4B 4TQ0A 5E6PA 2IY1B 4N9F4 2ZJDA 2JY6A 2KDIA 2XK5B 3A9JB 2N1WA 4MGKE 4E3CA 3VXWA 3JYUA 2R2QA 3Q3JA 2KJRA 4HLEA 3PRZA 5CHFA 4HDOA 2MSED 1G6JA 2BYEA 2K39A 1KLVA 3MJWA 3X23A 2KO3A 1NBFC 4EKUA 2FNJB 2KTRA 1GC7A 2KK8A 4URKA 3ZVVA 1P98A 3NZUA 2KMCA 1E8ZA 1P1AA 2JXXA 3BY4B 4AJYB 2BWES 3VQIA 3L13A 4G3XB 2JZZA 2ZCCA 4FADA 3QHTA 1YQBA 3M62B 4PS3A 3WAPA 5CHVC 3ONSA 2AWTA 4MGYE 3RZFA 3R7QA 2KZRA 2C7MB 2PPHA 5D7GA 1I35A 2YLMA 2LGXA 4YL8A 2KDFB 3N3KB 3WA0A 3DVNU 4XX5A 2V3SA 2XK5A 3A9JA 2KC1A 2LASA 4TKNA 1D3ZA 3KVFB 4ICVA 4MSMB 4DBGA 1WGRA 3ECIA 2B3AA 2LWPA 1V86A 3DDCB 2RGFA 1GG3A 3PSEB 2MBHA 1V5OA 1UH6A 1V5TA 2O6VD 3B1LX 1WX9A 3WIMA 2AEHA 2N4FA 1E8XA 2EMTA 4GDLB 2N7EA 1UELA 1WIAA 3CSFA 3EECA 4RM8A 4II3B 4B6WA 1WFYA 4FHKA 5CHWA 4II2B 1WXVA 3JW0X 3L54A 3QK0A 2MP2B 4GGQA 2L3ZA 2J0KA 2N9EB 4WWNA 4BOZB 1F9JA 2IO0B 2FCNA 2MRPA 2DYOA 1LFDA 1P0RA 2RR9A 1ZW7A 2VRRB 4K81A 4NAWB 3V61A 3VUYA 1OEYA 3EC8A 1GNUA 2ZCBA 5E6NA 1BT0A 1WI0A 2C60A 2J7QB 1E8WA 1Q5WB 3A4SC 3TBLD 3PV1A 1WJUA 2DENB 1WH3A 3NHEB 4XZ4A 4HJKA 2G45B 1SGHA 1TTNA 3PRMB 4NJ7A 3VH3B 4DHJD 2NCNA 2W9NA 3ZDMC 4DDGD 5DPWA 4M8NA 3DBRI 3DBSA 2WDTB 4CO7A 3PTFC 4FN2A 4BVUC 3O65B 3QJZA 1OQYA 3ZNGC 2D3GA 4I6LB 1R4MI 3Q3FA 4B9KA 4TV3A 4NQKE 3PPAA 4EEWA 4XC2A 2IO3B 2PE6B 4JQWC 4KDIC 2G4DB 1E7VA 2M4NA 4HPLB 3AU4A 3U7DA 4DHJB 4FULA 3IFWB 3LDZE 3UF8A 2J0JA 2JT4B 2DZKA 3VTWA 3W1SC 3W1YA 1LXDA 3BINA 3HIZA 4MDKE 2FCQA 2MCNB 4DK5A 3ZTDA 2JPHA 2CS4A 2HE7A 2M17A 2GMIC 1KM7A 4MJSB 3IBEA 2NPTB 2GBNA 2KLGA 3KUDB 2BWFA 4FJYA 3QQ8B 2NVUI 1M94A 1WJ6A 2MWSB 2IY0B 3B0AA 3CSTA 3PREA 4A3PA 5JHAA 2LD9A 2Z0EB 1V81A 4LDTD 4LJOB 3HK0A 3ENEA 2MA9B 3W1SA 4WAAA 1P3QU 2R2OA 3TL5A 3UQAA 4IUMB 4K7SA 2UYZB 5KHQA 2JUOA 4MEMA 3RD2A 2IYDB 1WM2A 1E5WA 2BKRB 5G2NA 5LXHA 2WX0A 1WF9A 3EHVA 1UD7A 4MM3A 1EO6A 1TBEA 1RLFA 3PRPB 4LDTB 4W9HA 2K1FA 3ZIMA 5CX3A 2KDEB 3UINB 2REXA 1WZ0A 2NPTA 3K9OB 3PT2B 3VTUA 1WXSA 3DCGA 3DOWA 1J0GA 3A1QA 3AULA 3A4RA 2KFKB 3H7PB 4HK2A 4B95A 4BBNC 4HXDA 4TUUA 1AARA 2N9XA 1TGZB 2JVCA 3ZO5B 4DWFA 2RD0A 4HVBA 5L95C 4KIKB 2CHXA 2GBMA 2ZPNA 1S1QB 4GMVA 4IWQA 4ZDVA 4X57B 2FCMA 4KZCA 1WJNA 4CYEA 4IM3A 3ZTCA 2KWUB 3T8MA 1XD3B 3VDZA 2PJHA 2DAFA 2KXJA 4K7WA 2WWZA 1VCBA 2G3QB 2V1YA 3HM3A 3WALA 2KX0A 2OOBB 3GZNI 4IWPA 2LVOA 1IP9A 3GOEA 4PYZA 2LXCA 4EZJA 1I42A 1YIWA 4GOCA 3TCAA 3ZRCA 4AWJA 2HTHA 4GB9A 2Y5BB 3L16A 3PZDA 2NBUA 3K9PB 3QCAA 3WANA 1WX8A 4CHKA 4KIKA 1L7YA 4GU2A 1XQQA 4TQ1A 3ZRFA 2IBIB 4DDID 4MH0E 3QWZB 2CHZA 4KVGB 2Z0DB 1OEYJ 2M8SA 3HM6X 4BKTA 5J18A 2DX5B 1E7UA 2HJ8A 5AEKB 1A5RA 1EF1A 3P2BA 3PLUA 2XBBC 5BO4B 3IVFA 2KNBA 3QARA 2AYOB 4I6PA 4NQLB 1WRDB 1WGHA 4E74A 2WYQA 4GDKB 4IM0A 3L10B 1E8YA 1C1YB 1PQSA 3DBHI 2DYMA 2KTFA 2M1MA 4GIVA 5AZFA 3NOBA 2O6VB 4IM2A 5J2RA 2KFJA 2L0FA 2CU1A 2KDBA 3H6NA 4K1RB 2IZVB 2FAZA 4HPMB 2WX1A 4PYUA 4NPNA 1EUVB 2D07B 3VUXA 5D2MB 3D32A 2A4ZA 4JL9A 1TZ1A 1S3SG 3L0WB 1UZXB 3N32A 4ANVA 1IYFA 4DXAB 4A3OA 1WE6A 3ZLZA 4M0WB 4GDLA 2J0MA 3ML8A 4HCNB 3NS8A 3RUIB 2KQ7A 2ASQA 4MGZE 4HWIB 2MP2A 4W9FA 2DYBA 5EDSA 4EZLA 3A9KB 4KV2A 4GDKA 5FR6A 1WGDA 2XEWA 2DZIA 3UGBB 4NAWA 5TR5A 1EF5A 4RM9A 2L76A 2LRUA 2O6VA 4ANXA 3N30A 4G0NB 3CMMB 2FCSA 3X0WA 5JH5C 3ZNID 4J6IA 5DPRA 1C3TA 3AU5A 2OJRA 4I6NB 4MSQB 1XT9B 1P9DU 1ZGUB 2L05A 3IG3A 3KUCB 5DPSA 4W9KA 4BKSD 2KQSA 2DHZA 3VUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYV E;  2BKF A;  3QIJ A;  3SD5 A;  3PVL A;  3SHQ A;  2K6D B;  2GBK A;  3A33 B;  2KHW B;  4BKG A;  3PHX B;  1Y8R C;  3KW5 B;  3R7R A;  1WXA A;  2AL6 A;  2NR2 A;  5G55 A;  3AXC A;  2MBE A;  2FUH B;  4HCP B;  5IAA C;  1SE9 A;  3A9K A;  4ANU A;  3OAW A;  5AZH A;  1WMH B;  4FJZ A;  4WJO A;  5LLI A;  3WAM A;  1RAX A;  3RUL A;  3QAQ A;  2GOW A;  3QC8 B;  4WWP A;  3ZNZ B;  5JHB A;  2KC2 A;  3DQV A;  2JWZ A;  1H4R A;  2ZEQ A;  1U4A A;  2DZM A;  4PS8 A;  1H8C A;  2I1J A;  3NZS A;  4RMA A;  4K7U A;  4NY0 A;  3RZW C;  3V62 A;  1V49 A;  3B08 A;  1ISN A;  1LM8 B;  1J8C A;  4KSK C;  4WJN A;  4MJS A;  1GJZ A;  2BPS A;  1NDD A;  2CHW A;  2ZNV B;  4WJP A;  5D6J B;  3OLM D;  3UQB A;  3ZUN A;  3L08 A;  2ZVN A;  3WAO A;  3MHS D;  3UIP B;  5JZE B;  3NY5 A;  4G11 A;  3APC A;  4G50 A;  4HDQ A;  4ZRI A;  4EZK A;  1WYW B;  2KTR B;  3V6E B;  1WMH A;  1Z5S B;  4MGI E;  4IW0 A;  2KVR A;  1Q1O A;  2I1K A;  2MBQ A;  3M63 B;  4W9I A;  2KKC A;  5L83 A;  2KMA A;  2K8H A;  4WQO B;  2IO1 B;  4JIO U;  4F7Z A;  4ASW C;  3KUZ A;  3ALB A;  1WGG A;  3KYC D;  2ZPY A;  3IHP C;  2DAJ A;  3VFK A;  4DHZ E;  2K8B A;  2C7N B;  1GC6 A;  2KWC A;  4FJV B;  2MBB B;  1UGM A;  4PS7 A;  2KX3 A;  1T0Y A;  4JGH B;  3ZW3 A;  5LXI B;  1V6E A;  3H9D A;  2ZVO A;  2KFK A;  3H7P A;  2JF5 A;  3RCZ A;  2D10 A;  2NBW B;  3LJ3 A;  1E90 A;  2FID A;  2UWQ A;  2KLC A;  1KJT A;  2JRI B;  4W9J A;  2O2V B;  4AJW A;  2PE9 A;  4NNJ B;  4LCD E;  1NI2 A;  3C0R B;  4MEL A;  3TIX A;  1YX5 B;  2AL3 A;  2JRH A;  2A5U A;  5KHO A;  3SU8 X;  2BF8 B;  2K8C A;  2K25 A;  3RYT A;  1WR1 A;  5E6O A;  5AZG A;  1WGY A;  1JRU A;  2L7R A;  4WJQ A;  3V6C B;  4BOS C;  4JLC A;  5DPT A;  1MG8 A;  2KOX A;  2C5L C;  1YD8 U;  2RPQ A;  3V60 A;  4IC7 B;  3KYD D;  1K8R B;  5C1Z A;  3HHM A;  3I3T B;  1RFA A;  3DBL I;  4EFO A;  2IO2 B;  4EUT A;  2MX2 A;  3APF A;  3PS6 A;  4KZ0 A;  4P7I A;  2KN5 A;  2O2V A;  2ZZP B;  1LQB A;  1GUA B;  2GBJ A;  2L8J A;  2BYF A;  2N7D A;  3U8Z A;  2QHO A;  2CR5 A;  4W9L A;  4EOY A;  1IPG A;  2FIF A;  5D94 A;  3PGE A;  1WM3 A;  1J19 A;  1WZ3 A;  4GN1 A;  5IA7 A;  3R3M A;  2LI5 A;  1UBI A;  2CKH B;  1WXM A;  2L0T A;  4WWO A;  2LVP A;  3ML9 A;  4ZRK A;  3SDL C;  1V9J A;  3T9L A;  2NS5 A;  3JSV B;  4IG7 B;  3AI5 A;  2D11 A;  5CTR C;  5GMV A;  3EFU A;  2KAN A;  5C23 A;  2LVQ A;  2LJ5 A;  2V4L A;  1Z2M A;  4M8M A;  1YJ1 A;  1CMX B;  1V2Y A;  1UBQ A;  3RT3 B;  3JVZ X;  2BGF A;  3L17 A;  3H1U A;  4OVV A;  2KD0 A;  2LGD A;  3TMP B;  3VTV A;  3M3J A;  3UIO B;  3OJ3 A;  3DPD A;  2LGY A;  3QA8 A;  4E71 A;  3U30 A;  1QZE A;  2MBO A;  4F1S A;  2NBV B;  4AOF A;  2G4S A;  4LJP B;  2LUE A;  4ZYN A;  4FA6 A;  3VHT C;  5HKH A;  2N9P C;  4A20 A;  3DVN V;  4GSW A;  2GBR A;  3JSV A;  3PLV A;  4KDL B;  2EKE C;  2MLB A;  3ZNH B;  1L2N A;  4FHJ A;  1WJ4 A;  4FLH A;  1VD2 A;  1ZKH A;  3ZKJ C;  2LXA A;  3PHW B;  4KSL C;  3A1Q B;  2YVC A;  1R4N I;  3KH0 A;  4AUQ C;  2KWV B;  3CF6 E;  3VAW A;  2M0X A;  3APD A;  2Z59 B;  3TJP A;  1OTR B;  2PEA A;  3R66 C;  4W9D A;  4W9G A;  2N1V A;  1OGW A;  2LRW A;  1FXT B;  1RRB A;  2ZNV C;  3M95 A;  1WR6 E;  2K6Q A;  1V80 A;  4AP4 C;  2KJ6 A;  3S2A A;  1KOT A;  3H7S A;  2D2Q A;  2RSU A;  4ZRJ A;  5DCN A;  1Q0W B;  4ICU A;  4BKS A;  3VVW B;  2MQJ A;  4W9E A;  4F8C B;  4W9C A;  1HE8 A;  2EMS A;  1YX6 B;  2C7H A;  3DVG X;  4NJ6 A;  3VH4 B;  1WY8 A;  1SIF A;  2LZ6 A;  3QX1 A;  2DZJ A;  2KJH B;  2HD5 B;  2MW5 A;  3MTN B;  2JZ3 B;  3ZDT A;  2L00 B;  4FBJ B;  1WE7 A;  1WX7 A;  1X1M A;  5J17 A;  4DHZ B;  4IWO A;  3DVG Y;  4BFR A;  4OVU A;  4GXB A;  4BBN F;  4ANW A;  2C9W B;  3OJ4 B;  4TQ0 A;  5E6P A;  2IY1 B;  4N9F 4;  2ZJD A;  2JY6 A;  2KDI A;  2XK5 B;  3A9J B;  2N1W A;  4MGK E;  4E3C A;  3VXW A;  3JYU A;  2R2Q A;  3Q3J A;  2KJR A;  4HLE A;  3PRZ A;  5CHF A;  4HDO A;  2MSE D;  1G6J A;  2BYE A;  2K39 A;  1KLV A;  3MJW A;  3X23 A;  2KO3 A;  1NBF C;  4EKU A;  2FNJ B;  2KTR A;  1GC7 A;  2KK8 A;  4URK A;  3ZVV A;  1P98 A;  3NZU A;  2KMC A;  1E8Z A;  1P1A A;  2JXX A;  3BY4 B;  4AJY B;  2BWE S;  3VQI A;  3L13 A;  4G3X B;  2JZZ A;  2ZCC A;  4FAD A;  3QHT A;  1YQB A;  3M62 B;  4PS3 A;  3WAP A;  5CHV C;  3ONS A;  2AWT A;  4MGY E;  3RZF A;  3R7Q A;  2KZR A;  2C7M B;  2PPH A;  5D7G A;  1I35 A;  2YLM A;  2LGX A;  4YL8 A;  2KDF B;  3N3K B;  3WA0 A;  3DVN U;  4XX5 A;  2V3S A;  2XK5 A;  3A9J A;  2KC1 A;  2LAS A;  4TKN A;  1D3Z A;  3KVF B;  4ICV A;  4MSM B;  4DBG A;  1WGR A;  3ECI A;  2B3A A;  2LWP A;  1V86 A;  3DDC B;  2RGF A;  1GG3 A;  3PSE B;  2MBH A;  1V5O A;  1UH6 A;  1V5T A;  2O6V D;  3B1L X;  1WX9 A;  3WIM A;  2AEH A;  2N4F A;  1E8X A;  2EMT A;  4GDL B;  2N7E A;  1UEL A;  1WIA A;  3CSF A;  3EEC A;  4RM8 A;  4II3 B;  4B6W A;  1WFY A;  4FHK A;  5CHW A;  4II2 B;  1WXV A;  3JW0 X;  3L54 A;  3QK0 A;  2MP2 B;  4GGQ A;  2L3Z A;  2J0K A;  2N9E B;  4WWN A;  4BOZ B;  1F9J A;  2IO0 B;  2FCN A;  2MRP A;  2DYO A;  1LFD A;  1P0R A;  2RR9 A;  1ZW7 A;  2VRR B;  4K81 A;  4NAW B;  3V61 A;  3VUY A;  1OEY A;  3EC8 A;  1GNU A;  2ZCB A;  5E6N A;  1BT0 A;  1WI0 A;  2C60 A;  2J7Q B;  1E8W A;  1Q5W B;  3A4S C;  3TBL D;  3PV1 A;  1WJU A;  2DEN B;  1WH3 A;  3NHE B;  4XZ4 A;  4HJK A;  2G45 B;  1SGH A;  1TTN A;  3PRM B;  4NJ7 A;  3VH3 B;  4DHJ D;  2NCN A;  2W9N A;  3ZDM C;  4DDG D;  5DPW A;  4M8N A;  3DBR I;  3DBS A;  2WDT B;  4CO7 A;  3PTF C;  4FN2 A;  4BVU C;  3O65 B;  3QJZ A;  1OQY A;  3ZNG C;  2D3G A;  4I6L B;  1R4M I;  3Q3F A;  4B9K A;  4TV3 A;  4NQK E;  3PPA A;  4EEW A;  4XC2 A;  2IO3 B;  2PE6 B;  4JQW C;  4KDI C;  2G4D B;  1E7V A;  2M4N A;  4HPL B;  3AU4 A;  3U7D A;  4DHJ B;  4FUL A;  3IFW B;  3LDZ E;  3UF8 A;  2J0J A;  2JT4 B;  2DZK A;  3VTW A;  3W1S C;  3W1Y A;  1LXD A;  3BIN A;  3HIZ A;  4MDK E;  2FCQ A;  2MCN B;  4DK5 A;  3ZTD A;  2JPH A;  2CS4 A;  2HE7 A;  2M17 A;  2GMI C;  1KM7 A;  4MJS B;  3IBE A;  2NPT B;  2GBN A;  2KLG A;  3KUD B;  2BWF A;  4FJY A;  3QQ8 B;  2NVU I;  1M94 A;  1WJ6 A;  2MWS B;  2IY0 B;  3B0A A;  3CST A;  3PRE A;  4A3P A;  5JHA A;  2LD9 A;  2Z0E B;  1V81 A;  4LDT D;  4LJO B;  3HK0 A;  3ENE A;  2MA9 B;  3W1S A;  4WAA A;  1P3Q U;  2R2O A;  3TL5 A;  3UQA A;  4IUM B;  4K7S A;  2UYZ B;  5KHQ A;  2JUO A;  4MEM A;  3RD2 A;  2IYD B;  1WM2 A;  1E5W A;  2BKR B;  5G2N A;  5LXH A;  2WX0 A;  1WF9 A;  3EHV A;  1UD7 A;  4MM3 A;  1EO6 A;  1TBE A;  1RLF A;  3PRP B;  4LDT B;  4W9H A;  2K1F A;  3ZIM A;  5CX3 A;  2KDE B;  3UIN B;  2REX A;  1WZ0 A;  2NPT A;  3K9O B;  3PT2 B;  3VTU A;  1WXS A;  3DCG A;  3DOW A;  1J0G A;  3A1Q A;  3AUL A;  3A4R A;  2KFK B;  3H7P B;  4HK2 A;  4B95 A;  4BBN C;  4HXD A;  4TUU A;  1AAR A;  2N9X A;  1TGZ B;  2JVC A;  3ZO5 B;  4DWF A;  2RD0 A;  4HVB A;  5L95 C;  4KIK B;  2CHX A;  2GBM A;  2ZPN A;  1S1Q B;  4GMV A;  4IWQ A;  4ZDV A;  4X57 B;  2FCM A;  4KZC A;  1WJN A;  4CYE A;  4IM3 A;  3ZTC A;  2KWU B;  3T8M A;  1XD3 B;  3VDZ A;  2PJH A;  2DAF A;  2KXJ A;  4K7W A;  2WWZ A;  1VCB A;  2G3Q B;  2V1Y A;  3HM3 A;  3WAL A;  2KX0 A;  2OOB B;  3GZN I;  4IWP A;  2LVO A;  1IP9 A;  3GOE A;  4PYZ A;  2LXC A;  4EZJ A;  1I42 A;  1YIW A;  4GOC A;  3TCA A;  3ZRC A;  4AWJ A;  2HTH A;  4GB9 A;  2Y5B B;  3L16 A;  3PZD A;  2NBU A;  3K9P B;  3QCA A;  3WAN A;  1WX8 A;  4CHK A;  4KIK A;  1L7Y A;  4GU2 A;  1XQQ A;  4TQ1 A;  3ZRF A;  2IBI B;  4DDI D;  4MH0 E;  3QWZ B;  2CHZ A;  4KVG B;  2Z0D B;  1OEY J;  2M8S A;  3HM6 X;  4BKT A;  5J18 A;  2DX5 B;  1E7U A;  2HJ8 A;  5AEK B;  1A5R A;  1EF1 A;  3P2B A;  3PLU A;  2XBB C;  5BO4 B;  3IVF A;  2KNB A;  3QAR A;  2AYO B;  4I6P A;  4NQL B;  1WRD B;  1WGH A;  4E74 A;  2WYQ A;  4GDK B;  4IM0 A;  3L10 B;  1E8Y A;  1C1Y B;  1PQS A;  3DBH I;  2DYM A;  2KTF A;  2M1M A;  4GIV A;  5AZF A;  3NOB A;  2O6V B;  4IM2 A;  5J2R A;  2KFJ A;  2L0F A;  2CU1 A;  2KDB A;  3H6N A;  4K1R B;  2IZV B;  2FAZ A;  4HPM B;  2WX1 A;  4PYU A;  4NPN A;  1EUV B;  2D07 B;  3VUX A;  5D2M B;  3D32 A;  2A4Z A;  4JL9 A;  1TZ1 A;  1S3S G;  3L0W B;  1UZX B;  3N32 A;  4ANV A;  1IYF A;  4DXA B;  4A3O A;  1WE6 A;  3ZLZ A;  4M0W B;  4GDL A;  2J0M A;  3ML8 A;  4HCN B;  3NS8 A;  3RUI B;  2KQ7 A;  2ASQ A;  4MGZ E;  4HWI B;  2MP2 A;  4W9F A;  2DYB A;  5EDS A;  4EZL A;  3A9K B;  4KV2 A;  4GDK A;  5FR6 A;  1WGD A;  2XEW A;  2DZI A;  3UGB B;  4NAW A;  5TR5 A;  1EF5 A;  4RM9 A;  2L76 A;  2LRU A;  2O6V A;  4ANX A;  3N30 A;  4G0N B;  3CMM B;  2FCS A;  3X0W A;  5JH5 C;  3ZNI D;  4J6I A;  5DPR A;  1C3T A;  3AU5 A;  2OJR A;  4I6N B;  4MSQ B;  1XT9 B;  1P9D U;  1ZGU B;  2L05 A;  3IG3 A;  3KUC B;  5DPS A;  4W9K A;  4BKS D;  2KQS A;  2DHZ A;  3VUW A; 
#chains in the Genus database with same CATH topology
 2BKF A;  2K6D B;  1ZP0 B;  3AH7 A;  3KW5 B;  2J4X A;  2LMC A;  2NR2 A;  3Q8C A;  3RNB C;  3RN9 C;  1FCC C;  3KWL A;  2ZW0 A;  1VLB A;  1WMH B;  4WJO A;  1RAX A;  3QAQ A;  4WWP A;  4B0E A;  1H4R A;  3DHI C;  4LLG M;  3CIR B;  4KSK C;  4WJN A;  2YEP F;  1GJZ A;  2BPS A;  1HQR D;  3AE6 B;  5D6J B;  5EE1 A;  3UQB A;  3T3O A;  3ZUN A;  5JZE B;  4DXF A;  5E6J A;  4G50 A;  3Q3O C;  4HDQ A;  4ZRI A;  2KTR B;  1Z5S B;  4MGI E;  1Q1O A;  4US8 A;  2QIE B;  5L83 A;  3KUZ A;  4S17 A;  3KYC D;  2KT7 A;  4JWS C;  4OZB A;  3NVY A;  2C7N B;  1GC6 A;  4FJV B;  1QKZ A;  1R4M B;  2KX3 A;  3ZW3 A;  1N60 A;  2ZVO A;  4L2Y A;  3H7P A;  2EEL A;  5T8I A;  1FCL A;  2QEJ C;  2K3U A;  2NBW B;  1AN8 A;  1VR9 A;  2WXH A;  1D5M C;  2O2V B;  1FD6 A;  4LCD E;  3GE3 C;  3BZD B;  2A5U A;  4H2A A;  2BF8 B;  2QMT A;  3LB8 C;  4EE2 A;  4C7Z A;  3Q8B A;  5AZG A;  1WGY A;  2L7R A;  5DPT A;  3N1X C;  1K8R B;  3I3T B;  3DBL I;  3NJT A;  4LNN A;  4EFO A;  1HZ6 A;  4EUT A;  4ZHP A;  2K9X A;  3P63 A;  3PS6 A;  4KZ0 A;  2KN5 A;  1DOI A;  1XCT L;  2JXT A;  2L8J A;  2BYF A;  1L0Y B;  4W9L A;  2FIF A;  5D94 A;  5IA7 A;  3ETR A;  2L0T A;  4IOI E;  4O1N A;  4P1C C;  4ZRK A;  1V9J A;  3T9L A;  1N5W A;  2D11 A;  2AX5 A;  1IBX A;  2LVQ A;  4M8M A;  2IJ0 A;  1V2Y A;  1UBQ A;  3RT3 B;  3JVZ X;  4ZHO A;  2WXG A;  2LGD A;  3OJ3 A;  3GZN B;  4AOF A;  4LJP B;  4ZYN A;  5IO9 A;  5HKH A;  3DVN V;  4GSW A;  2GBR A;  2KYW A;  1UWX A;  1L2N A;  1I7H A;  1T5X D;  3IT4 B;  3SEB A;  1ZKH A;  3PHW B;  1YQ3 B;  3A1Q B;  1QOF A;  2M0X A;  3MC0 B;  3APD A;  2Z59 B;  3DHG C;  4HJG E;  4XYC A;  3TJP A;  1KTK A;  1KH0 A;  4W9D A;  1OGW A;  2LRW A;  1FXT B;  1RRB A;  2ZNV C;  3AM9 A;  1WR6 E;  3GP7 A;  4F8C B;  2EMS A;  3HRD D;  3VH4 B;  1SIF A;  3QX1 A;  1WX7 A;  2MJE A;  4DHZ B;  3RMK C;  4BFR A;  2C9W B;  3OJ4 B;  4TQ0 A;  2JY6 A;  4MGK E;  5CHF A;  1G6J A;  1KLV A;  3MJW A;  1GB4 A;  1NBF C;  2G1E A;  4A6Q A;  2KTR A;  2M56 B;  3NZ3 A;  1P98 A;  3TSS A;  3NZU A;  1P1A A;  4ZRQ A;  4AJY B;  2BWE S;  1I4G A;  2Z8L A;  1SJE D;  3OG5 A;  2KAJ A;  2H89 B;  2AWT A;  2WXQ A;  1UF0 A;  3BYT B;  1I35 A;  1FXA A;  2LGX A;  1ZDV A;  4XX5 A;  3Q3M C;  4KGS A;  3KVF B;  4ICV A;  4M02 A;  2B3A A;  3DDC B;  2INP E;  1AWD A;  4BZA A;  2O6V D;  1QOA A;  3WIM A;  2AEH A;  1E8X A;  4C00 A;  4RM8 A;  4II3 B;  1XEE A;  2MP2 B;  2ONQ A;  1JML A;  4WWN A;  4BOZ B;  2IO0 B;  2FCN A;  2WXL A;  4K81 A;  1P0R A;  3DWM A;  2KVZ A;  1GNU A;  5E6N A;  4MAC A;  1YN4 A;  1WI0 A;  1FO4 A;  2K0P A;  3A4S C;  2DEN B;  4LTU A;  1JWU D;  4RF1 A;  3NHE B;  2NCN A;  3ZDM C;  4ARC A;  5DPW A;  4DQO C;  3AE9 B;  4FN2 A;  4D2K A;  1OQY A;  4LNO A;  3PPA A;  1SE2 A;  4KDI C;  2XNA C;  2M4N A;  4HPL B;  4DHJ B;  3IFW B;  2JT4 B;  4KGR A;  1VZ7 A;  2IGD A;  1LXD A;  4OZC A;  3AE7 B;  2D5G A;  1KLG D;  1ET6 A;  4MM3 B;  1MFW A;  1MVK A;  1KM7 A;  3W5U B;  2NPT B;  4HRS A;  3B0A A;  2WQY B;  3HK0 A;  2MA9 B;  4WAA A;  1P3Q U;  1TS5 A;  2PTL A;  3TL5 A;  2PKO A;  4TMA B;  4IUM B;  2UYZ B;  3DBL B;  1E7P B;  2IYD B;  3MHZ A;  1NI3 A;  1WF9 A;  1UD7 A;  1EO6 A;  1RLF A;  4W9H A;  5CX3 A;  1TY2 A;  1WZ0 A;  3BVM A;  1XLP A;  4TSS A;  3A1Q A;  2KFK B;  4RCO A;  2N9X A;  4LNI A;  4UDU C;  4GMV A;  4LNF A;  2W3R A;  4IWQ A;  2IDY A;  2FCM A;  4OW0 A;  3T8M A;  1XD3 B;  4RH6 A;  1QF6 A;  3VDZ A;  4NJC A;  2KXJ A;  1K53 A;  1FNV A;  2B76 B;  3ZGZ A;  3N9Y C;  3GOE A;  1L4Z B;  4AWJ A;  3TCA A;  1N63 A;  1VZ6 A;  1L7Y A;  2V9H A;  4GU2 A;  3Q3N C;  4WAF A;  3ZRF A;  3AEC B;  4KVG B;  2Z0D B;  2DX5 B;  3BWU D;  1E7U A;  1A5R A;  4I6P A;  4NQL B;  2RMM A;  1AYF A;  1JWA D;  4N6E B;  2W54 A;  1PQS A;  2DYM A;  4GIV A;  3RNC C;  2KFJ A;  2L0F A;  2CU1 A;  2KN4 A;  4HPM B;  4NPN A;  4IDI A;  2J53 A;  3VUX A;  3IXS A;  3L0W B;  2WXN A;  3AE2 B;  2QIL A;  4A3O A;  3ZLZ A;  4HCN B;  4HWI B;  5AUK A;  2FUG 1;  2MP2 A;  4W9F A;  2DYB A;  5EDS A;  1WGD A;  2XEW A;  2DZI A;  1GB1 A;  2LRU A;  4G0N B;  3X0W A;  3ZNI D;  1TS2 A;  2MJ3 A;  3AU5 A;  4I6N B;  1XT9 B;  2HJ1 A;  3KUC B;  1PYW D;  3RNF C;  2KQS A;  1SB3 C;  1L4D B;  3ZYY X;  3PVL A;  5H8Y E;  3MJ5 A;  3Q6B A;  1C77 A;  3CWI A;  2W55 A;  3AXC A;  1SE9 A;  2GLS A;  3A9K A;  3GB1 A;  5AZH A;  4ANU A;  1JRO A;  2SEB D;  4YSX B;  5JHB A;  1EU4 A;  1TS4 A;  2KC2 A;  1R7S A;  2ZEQ A;  4PS8 A;  2DZM A;  1H8C A;  2WXF A;  1HTO A;  4K7U A;  4NY0 A;  3RZW C;  2VH1 A;  1L5P A;  5TSS A;  1LM8 B;  1J8C A;  1PDX A;  2CHW A;  2ZNV B;  2MHJ A;  1FPY A;  3L08 A;  2ZVN A;  2M19 A;  3VRB B;  4G11 A;  3APC A;  3V6E B;  2I1K A;  1ZPS A;  2KKC A;  3C19 A;  2K8H A;  4WQO B;  1LO5 D;  4P1B C;  2W3S A;  1V1O A;  2ZPY A;  3OWE B;  1T6B X;  1NEN B;  2K8B A;  3EA6 A;  1B9R A;  2KWC A;  1I4Q A;  3L4P A;  1V1P A;  2MBB B;  1T0Y A;  3I63 C;  1V6E A;  3H9D A;  2JWU A;  2KFK A;  2JF5 A;  1WSP A;  3RCZ A;  1FRD A;  2UWQ A;  3EFC A;  2KLC A;  3PO0 A;  3LYY A;  4AJW A;  1NI2 A;  3C0R B;  1MPE A;  2AL3 A;  5KHO A;  2JRH A;  1KFY B;  3ZJU A;  3AMZ A;  2K25 A;  3RYT A;  1WR1 A;  2I38 A;  4ITK A;  2KOX A;  3V60 A;  4IC7 B;  3KYD D;  4B0M A;  4RGN A;  3HHM A;  2IO2 B;  1GUA B;  1FNU A;  1TIF A;  3NRZ A;  4XWT A;  2N9K A;  4GN1 A;  1WZ3 A;  3R3M A;  2CKH B;  1WXM A;  2NTS A;  2LVP A;  1YN5 A;  1YNT E;  1NYR A;  3ZXV A;  3AI5 A;  2WXR A;  4YSY B;  2KAN A;  1Z2M A;  1YJ1 A;  1FM0 D;  4P6V F;  3H1U A;  2WXK A;  2KD0 A;  3VTV A;  3M3J A;  4JWU C;  1PGX A;  4YTM B;  1AW7 A;  3UIO B;  2OHF A;  1STE A;  1D5X C;  4OZA A;  4ARI A;  2NBV B;  1N5X A;  1FNW A;  4A20 A;  3JSV A;  1JQ4 A;  1FMA D;  2K5P A;  3PLV A;  3Q2A C;  4KDL B;  4REZ A;  4MH8 A;  2MLB A;  4C80 A;  3R8B A;  2YEP B;  2LXA A;  4KSL C;  3KH0 A;  1R4N I;  4ZYS A;  3CF6 E;  3NVV A;  3O13 A;  5IOI A;  1TKY A;  4W9G A;  2WXO A;  2K6Q A;  2WXI A;  2KJ6 A;  3S2A A;  1KOT A;  3H7S A;  2D2Q A;  1Q0W B;  4ICU A;  4HPP A;  4W9E A;  2WXM A;  3TEZ A;  3AE8 B;  3DVG X;  4RF0 A;  2KJH B;  1VRA B;  5MPO A;  2HD5 B;  2MW5 A;  3AN1 A;  2L00 B;  4FBJ B;  1WYG A;  1A70 A;  4GXB A;  4ANW A;  1J7A A;  5E6P A;  1RFK A;  3JYU A;  3Q3J A;  2KJR A;  3IT6 B;  1T0Q C;  4HDO A;  2VH2 A;  3RI7 C;  2L83 A;  3ZVV A;  1BML C;  4WQM A;  4L1B A;  2BBC A;  2NTT A;  2JXX A;  4KGT A;  2RDB C;  4NAM A;  4G3X B;  2V3N A;  1GOZ A;  2L32 A;  3M62 B;  3RZF A;  5BYR A;  3E56 A;  3R7Q A;  2PPH A;  1FRR A;  4YL8 A;  3N3K B;  2V3S A;  2XK5 A;  2KC1 A;  2X38 A;  4TKN A;  1D3Z A;  4MSM B;  4DBG A;  2Y5C A;  3ECI A;  2LWP A;  3NVW A;  4YTN B;  2RGF A;  2OED A;  2LHD A;  3B1L X;  2N4F A;  3NS1 A;  3CSF A;  3BK1 A;  4FHK A;  5CHW A;  4II2 B;  1WXV A;  2KDM A;  2J0K A;  4JE3 B;  1VDV A;  2MRP A;  2BYT A;  1LFD A;  3V61 A;  1ZW7 A;  2VRR B;  2JYE A;  1OEY A;  3IAM 1;  2ZCB A;  2C60 A;  1Q5W B;  2WXP A;  3TBL D;  2PVO D;  4XZ4 A;  2G45 B;  1SGH A;  1YOV B;  1E9M A;  3DBR I;  3DBS A;  3RNE C;  2DLB A;  2WDT B;  4CO7 A;  5IN7 A;  2Y5P A;  4NQK E;  4EEW A;  3Q69 A;  4XC2 A;  1C78 A;  4JQW C;  1E7V A;  3U7D A;  4FUL A;  4A9A A;  3LDZ E;  4C7Y A;  1BXT A;  1WGK A;  1YN3 A;  2NMQ A;  2FCQ A;  3R2T A;  3RNA C;  2M17 A;  4MJS B;  1NEK B;  1F1H A;  2KLG A;  4KX6 B;  5JHA A;  4LJO B;  3TEW A;  2R2O A;  5HFY A;  2WGS A;  1QOG A;  4A8X C;  5G2N A;  2WX0 A;  4YXD B;  3VTU A;  3DOW A;  1J0G A;  1JWB D;  3AUL A;  2OJW A;  4HK2 A;  1SE4 A;  3VRA B;  4B95 A;  4HXD A;  4DWF A;  2RD0 A;  1F77 A;  4X57 B;  1N62 A;  4KZC A;  1SXT A;  1WJN A;  5JXV A;  3DHH C;  4K7W A;  4R3D A;  1VCB A;  3C8Y A;  2BVC A;  2OOB B;  1ZDX A;  2LVO A;  1I42 A;  1ET9 A;  2WU2 B;  3ZRC A;  2FBW B;  2Y5B B;  3K9P B;  1CQV A;  5C3J B;  3SR6 A;  4MH0 E;  3QWZ B;  2CHZ A;  1JCK B;  1OEY J;  2M8S A;  5J18 A;  3VR8 B;  5AEK B;  1R4N B;  3P2B A;  5BO4 B;  3ZXR A;  2WDV B;  4Q2J A;  3DWG C;  1WRD B;  2INC C;  3ZQ4 A;  3TEY A;  2WLB A;  4IM0 A;  3L10 B;  5C2T B;  1C1Y B;  2W82 A;  2LJI A;  5AZF A;  1ZUD 2;  2D3C A;  2D07 B;  3D32 A;  1C4A A;  1S3S G;  3N32 A;  3R2I A;  4DXA B;  1UNS A;  2J0M A;  1SSN A;  3U7Z A;  3A9K B;  4KV2 A;  4GDK A;  5FR6 A;  3UGB B;  4RM9 A;  2O6V A;  2R61 A;  5D3I B;  4ANX A;  1QLB B;  3CMM B;  4J6I A;  5DPR A;  4MSQ B;  1T0R C;  3IG3 A;  4BKS D;  3AE4 B;  3BVG A;  4ACF A;  2BYV E;  3SD5 A;  3SHQ A;  2GBK A;  1GPX A;  4M0W A;  3PHX B;  4C4V A;  1Y8R C;  2AL6 A;  5BYQ A;  1JW9 D;  2MBE A;  1PGA A;  2FUH B;  4HCP B;  5IAA C;  3OAW A;  4FJZ A;  3AV8 A;  3RUL A;  2KAC A;  3ZNZ B;  3DQV A;  1C79 A;  2JWZ A;  1U4A A;  3Q8E A;  3V62 A;  1ISN A;  2GRI A;  4MJS A;  1V1P B;  1NDD A;  1CK1 A;  4XE0 A;  4ZOH C;  4HRO A;  1DYQ A;  3WAO A;  3MHS D;  3W2D A;  4YSZ B;  4WUR A;  3NUH B;  4KKI A;  1WYW B;  4N58 A;  1FFU A;  1XF5 L;  3GE8 C;  1YMH E;  2MBQ A;  2KMA A;  1XCQ L;  4ASW C;  2RPV A;  3ALB A;  1WGG A;  3DBR B;  4PT5 A;  4DHZ E;  4HKZ E;  1XLN A;  2ON8 A;  1UGM A;  1QT9 A;  3MP9 A;  4JGH B;  5LXI B;  2WS3 B;  3RNG C;  1L6U A;  3LJ3 A;  1UWM A;  1E90 A;  2MJD A;  2FID A;  1N61 A;  1KJT A;  2JRI B;  4W9J A;  2KQ4 X;  2PW9 A;  1TT5 B;  4HEA 1;  2DWQ A;  5I4D A;  4JPS A;  1JRU A;  3V6C B;  1MG8 A;  1FFV A;  1YD8 U;  3NG0 A;  1WXQ A;  1L0X B;  5EE0 A;  2MX2 A;  1EM7 A;  2ACZ B;  3APF A;  1VZ8 A;  4P7I A;  1XLO A;  2ZZP B;  1CJE A;  2QCZ A;  2GBJ A;  1K50 A;  2BQQ A;  2QHO A;  2CR5 A;  4EOY A;  1IPG A;  3PGE A;  1J19 A;  4WWO A;  3Q8A A;  3SDL C;  1V8C A;  1UUP A;  1JAL A;  3JSV B;  5CTR C;  5GMV A;  1B1Z A;  1HTQ A;  1YJI A;  3L17 A;  2BGF A;  2E6X A;  1ACC A;  3ZJT A;  4M00 A;  1DOY A;  3PZ7 A;  2KWD A;  3DPD A;  2BS3 B;  2LGY A;  2IND C;  4M01 A;  2AQ1 B;  3U30 A;  2MBO A;  4XDD A;  1ROE A;  3N1Y C;  4FA6 A;  1RWS A;  2FE8 A;  3ZNH B;  4FHJ A;  4FLH A;  3ZKJ C;  1IUE A;  2X8X X;  3AE1 B;  2IGG A;  1OTR B;  2CU3 A;  1GAQ B;  3EGR A;  4JX1 C;  1DOX A;  2WU5 B;  4AP4 C;  2QDF A;  1J7C A;  3W5V B;  4NZL B;  1T0S C;  2CJO A;  3AEE B;  5DCN A;  5LNK 1;  2JU6 X;  2MQJ A;  1FIQ A;  1NVI D;  2H88 B;  3KQ4 A;  4NJ6 A;  3MC9 A;  2LZ6 A;  2DZJ A;  2LFI A;  3MTN B;  2JZ3 B;  3ZDT A;  2N7J A;  5J17 A;  4IWO A;  3DVG Y;  4OVU A;  4LK0 M;  2IY1 B;  4N9F 4;  2ZJD A;  4E3C A;  2XK5 B;  3VXW A;  3HUI A;  4HLE A;  3N1Z C;  3X23 A;  2KO3 A;  4EKU A;  1HEZ E;  1YQ4 B;  3EUB 2;  4L23 A;  1OQQ A;  2LHE A;  2KMC A;  1E8Z A;  3BY4 B;  3MFG A;  3VQI A;  2LGI A;  5BMI A;  3WAP A;  4PS3 A;  5CHV C;  3ONS A;  3P4Q B;  2KZR A;  2C7M B;  2YLM A;  2D3B A;  2KDF B;  3WA0 A;  3A9J A;  2LAS A;  1WGR A;  3Q8F A;  1V86 A;  1GG3 A;  3PSE B;  2MBH A;  3AEB B;  1UH6 A;  1V5T A;  2JX5 A;  3V3X A;  2EMT A;  4GDL B;  4B6W A;  1WIA A;  1WFY A;  1L0V B;  3L54 A;  3QK0 A;  4GGQ A;  2N9E B;  4OVZ A;  1F9J A;  1UGJ A;  4NAW B;  3U52 E;  1BT0 A;  1E8W A;  2WXJ A;  4P16 A;  3PV1 A;  1WH3 A;  1P7E A;  1D5Z C;  3FKY A;  4HJK A;  3TEX A;  1F52 A;  4NJ7 A;  4DDG D;  5HI1 A;  3SFE B;  4BAX A;  2D3G A;  4I6L B;  3Q3F A;  4B9K A;  4TV3 A;  5G5G A;  3P4P B;  1TKG A;  3FIL B;  3MC8 A;  4USA A;  2HDE A;  3VTW A;  2J0J A;  2GI9 A;  3W1S C;  3W1Y A;  3BIN A;  3HIZ A;  4MDK E;  1TKE A;  4DK5 A;  2KMM A;  2MCN B;  3ZTD A;  1IGC A;  1D6E C;  1I4R A;  2GBN A;  3QQ8 B;  2NVU I;  1M94 A;  2MWS B;  5IP4 D;  2LD9 A;  2Z0E B;  4LDT D;  3P4S B;  3UQA A;  4K7S A;  5KHQ A;  3RD2 A;  1WM2 A;  4RNA A;  3BII D;  1MHX A;  1QQR A;  3EHV A;  1E6E B;  2VZK D;  3ZIM A;  2K1F A;  2KDE B;  4CQN A;  2REX A;  3K9O B;  1JRP A;  3A4R A;  1TS3 A;  4BBN C;  1VJK A;  2MEK A;  1TGZ B;  2JVC A;  2G9H D;  4HVB A;  2GBM A;  1TYG B;  3Q14 C;  1S1Q B;  4ZDV A;  3SFD B;  4IM3 A;  2KWU B;  2IGH A;  1P7F A;  3W9C B;  4WIP A;  4AS1 A;  3UI3 A;  1F0Z A;  2WWZ A;  2G3Q B;  2V1Y A;  2KX0 A;  2K22 A;  3IAS 1;  1IP9 A;  1I4H A;  4EZJ A;  2HTH A;  4GB9 A;  3PZD A;  3L16 A;  2NBU A;  3PZ8 A;  3QCA A;  1WX8 A;  1XLQ A;  4KIK A;  2M0A A;  4CHK A;  1XQQ A;  4DDI D;  2J42 A;  4BKT A;  3P42 A;  1EF1 A;  3PLU A;  1PFD A;  2WP9 B;  2KNB A;  3QAR A;  1OFF A;  4E74 A;  2WYQ A;  4GDK B;  2N0S B;  1ZXI A;  1E8Y A;  3ABV B;  3DBH I;  2M1M A;  3NOB A;  2O6V B;  2L52 A;  5H92 C;  5J2R A;  5IKC M;  3BYY B;  4K1R B;  2WX1 A;  4MT5 A;  5EE9 A;  1WWT A;  2A4Z A;  1TZ1 A;  1UZX B;  3KLS X;  1IYF A;  1WE6 A;  3I57 A;  4M0W B;  1F2R C;  4GDL A;  3ML8 A;  3RUI B;  4C4V B;  2KQ7 A;  2LGS A;  1V97 A;  4NAW A;  4XWW A;  5EE3 A;  4RGO S;  2D3A A;  2L76 A;  1FXI A;  3N30 A;  2ZW1 A;  2DNF A;  1ZGU B;  5DPS A;  4C56 C;  3VUW A;  3QIJ A;  3A33 B;  2KHW B;  4BKG A;  4KKJ A;  3R7R A;  1WXA A;  5G55 A;  2WDQ B;  3VR9 B;  3AED B;  1TJE A;  4RFB A;  1I4X A;  5LLI A;  3WAM A;  3FC4 A;  2GOW A;  3QC8 B;  3FIL A;  2I1J A;  3NZS A;  4RMA A;  4HKQ A;  1V49 A;  3B08 A;  1K52 A;  4XDC A;  1KLU D;  1ZE3 D;  4LNK A;  3B2G A;  4WJP A;  3OLM D;  3BVZ A;  4DXG A;  3UIP B;  4YWG G;  3NY5 A;  4J3O D;  3HVZ A;  4EZK A;  1WMH A;  2CJN A;  4IW0 A;  2KVR A;  3M63 B;  4W9I A;  1EWC A;  2IO1 B;  2PLP A;  4JIO U;  4F7Z A;  1F2R I;  2UU7 A;  3I9V 1;  3IHP C;  2DAJ A;  3WCQ A;  3VFK A;  3NVZ A;  5HHD G;  4PS7 A;  1C76 A;  2XN9 C;  4K3C A;  2D10 A;  3H8H A;  4YT0 B;  2PE9 A;  4NNJ B;  3TIX A;  4MEL A;  4A55 A;  1MHH E;  1YX5 B;  1SBB B;  3SU8 X;  2RDG A;  2K8C A;  5E6O A;  4WJQ A;  1TY0 A;  1Y56 A;  4BOS C;  4JLC A;  3AEA B;  2Y3A A;  2C5L C;  2RPQ A;  2BTE A;  2AQ3 B;  5C1Z A;  1K51 A;  1RFA A;  1T3Q A;  4WH4 A;  1ESF A;  2O2V A;  1LQB A;  2N7D A;  3U8Z A;  5FR3 A;  1WM3 A;  2LI5 A;  3B9J A;  1UBI A;  1RM6 C;  1XXG A;  4WWM A;  2V3P A;  3ML9 A;  1KF6 B;  2NS5 A;  4IG7 B;  3EFU A;  5C23 A;  2V4L A;  1SF0 A;  2LJ5 A;  1CMX B;  1WRI A;  4FXC A;  4AQ7 A;  2PMV A;  4OVV A;  1C9F A;  3TMP B;  3P4R B;  4YTP B;  3QA8 A;  4E71 A;  1QZE A;  2QJL A;  4F1S A;  2L1A A;  2G4S A;  2LUE A;  3VHT C;  2N9P C;  2EKE C;  1WJ4 A;  1VD2 A;  1LGR A;  2RDH A;  1EWY C;  1HA5 A;  2YVC A;  4AUQ C;  2KWV B;  2QC8 A;  3VAW A;  1D4B A;  3U4E G;  1PUT A;  4PK1 A;  1TZO A;  3GS2 A;  3DBH B;  2PEA A;  3R66 C;  2N1V A;  3M95 A;  2V0G A;  1V80 A;  2JSV X;  4S0R A;  1MJD A;  2RSU A;  4ZRJ A;  2N9L A;  4BKS A;  3RFZ B;  3VVW B;  4W9C A;  1HE8 A;  1MG4 A;  1YX6 B;  2C7H A;  2J52 A;  1WY8 A;  5AUI A;  1NYQ A;  1Q10 A;  1WE7 A;  1X1M A;  1QIL A;  2BB5 A;  4BBN F;  2GB1 A;  4N59 A;  1PGB A;  1ZOY B;  2KDI A;  1N6Z A;  2N1W A;  3A9J B;  2R2Q A;  3PRZ A;  2MSE D;  2BYE A;  2K39 A;  4QAY A;  2FNJ B;  1GC7 A;  3T3N A;  2KK8 A;  4URK A;  1DGJ A;  5D3D A;  2WHI A;  3L13 A;  2JZZ A;  2ZCC A;  4FAD A;  3QHT A;  1YQB A;  4MGY E;  5D7G A;  1ZXH A;  3DVN U;  1RYJ A;  2SAK A;  4IKG A;  2BT6 A;  1V5O A;  2ICI A;  2V4I B;  2AQ2 B;  1WX9 A;  2N7E A;  1UEL A;  1E0Z A;  3EEC A;  2BW2 A;  3JW0 X;  1SEB D;  2L3Z A;  3FAH A;  2DYO A;  1E10 A;  2RR9 A;  5HG2 A;  3VUY A;  1BUI C;  3EC8 A;  2Q5W D;  2EKI A;  2J7Q B;  1WJU A;  1MI0 A;  1HZ5 A;  1TTN A;  3PRM B;  3VH3 B;  4DHJ D;  2W9N A;  3HVD A;  4M8N A;  4RGM A;  3PTF C;  4BVU C;  3O65 B;  3QJZ A;  3ZNG C;  4A90 A;  1R4M I;  4GLS C;  1SE3 A;  2IO3 B;  2PE6 B;  2G4D B;  3AU4 A;  2QSD A;  3AEF B;  3UF8 A;  2DZK A;  3URY A;  2PVG C;  2IPK D;  2JPH A;  2CS4 A;  2HE7 A;  2I2Y A;  2GMI C;  2WNM A;  3AE5 B;  5BMH A;  3IBE A;  3KUD B;  4FJY A;  2BWF A;  2JZP A;  1WJ6 A;  2IY0 B;  3CST A;  3PRE A;  4A3P A;  1V81 A;  3ENE A;  2BS4 B;  3AE3 B;  1CZP A;  3W1S A;  2JUO A;  4MEM A;  1E5W A;  2BKR B;  2TSS A;  4XGA B;  5LXH A;  1XO3 A;  4MM3 A;  1TBE A;  3U2S C;  1OQR A;  3PRP B;  4LDT B;  3ZJV A;  2E3T A;  3UIN B;  1M4V A;  2NPT A;  3PT2 B;  2WDR B;  3P1M A;  1WXS A;  2MH7 A;  3DCG A;  1L6V A;  2BS2 B;  3H7P B;  2HTM E;  3RPF C;  4TUU A;  1AAR A;  3ZO5 B;  5L95 C;  4KIK B;  2VZK B;  2CHX A;  3LXF A;  2ZPN A;  1C4C A;  4CYE A;  3ZTC A;  3J9C A;  4OHJ A;  2INN E;  1ENF A;  2PJH A;  1SJH D;  2DAF A;  1J7B A;  5FKA C;  3HM3 A;  3WAL A;  2JQR B;  3AEG B;  3E9S A;  3GZN I;  4IWP A;  4PYZ A;  2LXC A;  1YIW A;  4GOC A;  3BK2 A;  1JWM D;  5G5H A;  2DBY A;  3WAN A;  1I4P A;  1SIJ A;  2JYT A;  4K3B A;  4TQ1 A;  1C4P A;  2IBI B;  1YJJ A;  3I5J C;  3HM6 X;  4US9 A;  2LEK A;  3V05 A;  2HJ8 A;  4RGT A;  4ZRP A;  5FK9 C;  2LUM A;  1HXY D;  2XBB C;  3IVF A;  5BYS A;  2AYO B;  1JWS D;  1WGH A;  5BMG A;  2KTF A;  1KRH A;  4IM2 A;  1IBX B;  3H6N A;  2KDB A;  2IZV B;  2FAZ A;  4PYU A;  2PIA A;  1EUV B;  3KWV A;  5D2M B;  4JL9 A;  1IGD A;  1FEH A;  4ANV A;  3B2F A;  5GXG B;  1QOB A;  3NS8 A;  4MGZ E;  2ASQ A;  2BB6 A;  4EZL A;  3N20 C;  3TUO A;  5TR5 A;  1EF5 A;  5JH5 C;  2FCS A;  1C3T A;  2OJR A;  1P9D U;  2L05 A;  3AB5 A;  4W9K A;  1EU3 A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 2BYV E;  2BKF A;  3QIJ A;  3SD5 A;  3PVL A;  3SHQ A;  2K6D B;  2GBK A;  3A33 B;  2KHW B;  4BKG A;  3PHX B;  1Y8R C;  3KW5 B;  3R7R A;  1WXA A;  2AL6 A;  2NR2 A;  5G55 A;  3AXC A;  2MBE A;  2FUH B;  4HCP B;  5IAA C;  1SE9 A;  3A9K A;  4ANU A;  3OAW A;  5AZH A;  1WMH B;  4FJZ A;  4WJO A;  5LLI A;  3WAM A;  1RAX A;  3RUL A;  3QAQ A;  2GOW A;  3QC8 B;  4WWP A;  3ZNZ B;  5JHB A;  2KC2 A;  3DQV A;  2JWZ A;  1H4R A;  2ZEQ A;  1U4A A;  2DZM A;  4PS8 A;  1H8C A;  2I1J A;  3NZS A;  4RMA A;  4K7U A;  4NY0 A;  3RZW C;  3V62 A;  1V49 A;  3B08 A;  1ISN A;  1LM8 B;  1J8C A;  4KSK C;  4WJN A;  4MJS A;  1GJZ A;  2BPS A;  1NDD A;  2CHW A;  2ZNV B;  4WJP A;  5D6J B;  3OLM D;  3UQB A;  3ZUN A;  3L08 A;  2ZVN A;  3WAO A;  3MHS D;  3UIP B;  5JZE B;  3NY5 A;  4G11 A;  3APC A;  4G50 A;  4HDQ A;  4ZRI A;  4EZK A;  1WYW B;  2KTR B;  3V6E B;  1WMH A;  1Z5S B;  4MGI E;  4IW0 A;  2KVR A;  1Q1O A;  2I1K A;  2MBQ A;  3M63 B;  4W9I A;  2KKC A;  5L83 A;  2KMA A;  2K8H A;  4WQO B;  2IO1 B;  4JIO U;  4F7Z A;  4ASW C;  3KUZ A;  3ALB A;  1WGG A;  3KYC D;  2ZPY A;  3IHP C;  2DAJ A;  3VFK A;  4DHZ E;  2K8B A;  2C7N B;  1GC6 A;  2KWC A;  4FJV B;  2MBB B;  1UGM A;  4PS7 A;  2KX3 A;  1T0Y A;  4JGH B;  3ZW3 A;  5LXI B;  1V6E A;  3H9D A;  2ZVO A;  2KFK A;  3H7P A;  2JF5 A;  3RCZ A;  2D10 A;  2NBW B;  3LJ3 A;  1E90 A;  2FID A;  2UWQ A;  2KLC A;  1KJT A;  2JRI B;  4W9J A;  2O2V B;  4AJW A;  2PE9 A;  4NNJ B;  4LCD E;  1NI2 A;  3C0R B;  4MEL A;  3TIX A;  1YX5 B;  2AL3 A;  2JRH A;  2A5U A;  5KHO A;  3SU8 X;  2BF8 B;  2K8C A;  2K25 A;  3RYT A;  1WR1 A;  5E6O A;  5AZG A;  1WGY A;  1JRU A;  2L7R A;  4WJQ A;  3V6C B;  4BOS C;  4JLC A;  5DPT A;  1MG8 A;  2KOX A;  2C5L C;  1YD8 U;  2RPQ A;  3V60 A;  4IC7 B;  3KYD D;  1K8R B;  5C1Z A;  3HHM A;  3I3T B;  1RFA A;  3DBL I;  4EFO A;  2IO2 B;  4EUT A;  2MX2 A;  3APF A;  3PS6 A;  4KZ0 A;  4P7I A;  2KN5 A;  2O2V A;  2ZZP B;  1LQB A;  1GUA B;  2GBJ A;  2L8J A;  2BYF A;  2N7D A;  3U8Z A;  2QHO A;  2CR5 A;  4W9L A;  4EOY A;  1IPG A;  2FIF A;  5D94 A;  3PGE A;  1WM3 A;  1J19 A;  1WZ3 A;  4GN1 A;  5IA7 A;  3R3M A;  2LI5 A;  1UBI A;  2CKH B;  1WXM A;  2L0T A;  4WWO A;  2LVP A;  3ML9 A;  4ZRK A;  3SDL C;  1V9J A;  3T9L A;  2NS5 A;  3JSV B;  4IG7 B;  3AI5 A;  2D11 A;  5CTR C;  5GMV A;  3EFU A;  2KAN A;  5C23 A;  2LVQ A;  2LJ5 A;  2V4L A;  1Z2M A;  4M8M A;  1YJ1 A;  1CMX B;  1V2Y A;  1UBQ A;  3RT3 B;  3JVZ X;  2BGF A;  3L17 A;  3H1U A;  4OVV A;  2KD0 A;  2LGD A;  3TMP B;  3VTV A;  3M3J A;  3UIO B;  3OJ3 A;  3DPD A;  2LGY A;  3QA8 A;  4E71 A;  3U30 A;  1QZE A;  2MBO A;  4F1S A;  2NBV B;  4AOF A;  2G4S A;  4LJP B;  2LUE A;  4ZYN A;  4FA6 A;  3VHT C;  5HKH A;  2N9P C;  4A20 A;  3DVN V;  4GSW A;  2GBR A;  3JSV A;  3PLV A;  4KDL B;  2EKE C;  2MLB A;  3ZNH B;  1L2N A;  4FHJ A;  1WJ4 A;  4FLH A;  1VD2 A;  1ZKH A;  3ZKJ C;  2LXA A;  3PHW B;  4KSL C;  3A1Q B;  2YVC A;  1R4N I;  3KH0 A;  4AUQ C;  2KWV B;  3CF6 E;  3VAW A;  2M0X A;  3APD A;  2Z59 B;  3TJP A;  1OTR B;  2PEA A;  3R66 C;  4W9D A;  4W9G A;  2N1V A;  1OGW A;  2LRW A;  1FXT B;  1RRB A;  2ZNV C;  3M95 A;  1WR6 E;  2K6Q A;  1V80 A;  4AP4 C;  2KJ6 A;  3S2A A;  1KOT A;  3H7S A;  2D2Q A;  2RSU A;  4ZRJ A;  5DCN A;  1Q0W B;  4ICU A;  4BKS A;  3VVW B;  2MQJ A;  4W9E A;  4F8C B;  4W9C A;  1HE8 A;  2EMS A;  1YX6 B;  2C7H A;  3DVG X;  4NJ6 A;  3VH4 B;  1WY8 A;  1SIF A;  2LZ6 A;  3QX1 A;  2DZJ A;  2KJH B;  2HD5 B;  2MW5 A;  3MTN B;  2JZ3 B;  3ZDT A;  2L00 B;  4FBJ B;  1WE7 A;  1WX7 A;  1X1M A;  5J17 A;  4DHZ B;  4IWO A;  3DVG Y;  4BFR A;  4OVU A;  4GXB A;  4BBN F;  4ANW A;  2C9W B;  3OJ4 B;  4TQ0 A;  5E6P A;  2IY1 B;  4N9F 4;  2ZJD A;  2JY6 A;  2KDI A;  2XK5 B;  3A9J B;  2N1W A;  4MGK E;  4E3C A;  3VXW A;  3JYU A;  2R2Q A;  3Q3J A;  2KJR A;  4HLE A;  3PRZ A;  5CHF A;  4HDO A;  2MSE D;  1G6J A;  2BYE A;  2K39 A;  1KLV A;  3MJW A;  3X23 A;  2KO3 A;  1NBF C;  4EKU A;  2FNJ B;  2KTR A;  1GC7 A;  2KK8 A;  4URK A;  3ZVV A;  1P98 A;  3NZU A;  2KMC A;  1E8Z A;  1P1A A;  2JXX A;  3BY4 B;  4AJY B;  2BWE S;  3VQI A;  3L13 A;  4G3X B;  2JZZ A;  2ZCC A;  4FAD A;  3QHT A;  1YQB A;  3M62 B;  4PS3 A;  3WAP A;  5CHV C;  3ONS A;  2AWT A;  4MGY E;  3RZF A;  3R7Q A;  2KZR A;  2C7M B;  2PPH A;  5D7G A;  1I35 A;  2YLM A;  2LGX A;  4YL8 A;  2KDF B;  3N3K B;  3WA0 A;  3DVN U;  4XX5 A;  2V3S A;  2XK5 A;  3A9J A;  2KC1 A;  2LAS A;  4TKN A;  1D3Z A;  3KVF B;  4ICV A;  4MSM B;  4DBG A;  1WGR A;  3ECI A;  2B3A A;  2LWP A;  1V86 A;  3DDC B;  2RGF A;  1GG3 A;  3PSE B;  2MBH A;  1V5O A;  1UH6 A;  1V5T A;  2O6V D;  3B1L X;  1WX9 A;  3WIM A;  2AEH A;  2N4F A;  1E8X A;  2EMT A;  4GDL B;  2N7E A;  1UEL A;  1WIA A;  3CSF A;  3EEC A;  4RM8 A;  4II3 B;  4B6W A;  1WFY A;  4FHK A;  5CHW A;  4II2 B;  1WXV A;  3JW0 X;  3L54 A;  3QK0 A;  2MP2 B;  4GGQ A;  2L3Z A;  2J0K A;  2N9E B;  4WWN A;  4BOZ B;  1F9J A;  2IO0 B;  2FCN A;  2MRP A;  2DYO A;  1LFD A;  1P0R A;  2RR9 A;  1ZW7 A;  2VRR B;  4K81 A;  4NAW B;  3V61 A;  3VUY A;  1OEY A;  3EC8 A;  1GNU A;  2ZCB A;  5E6N A;  1BT0 A;  1WI0 A;  2C60 A;  2J7Q B;  1E8W A;  1Q5W B;  3A4S C;  3TBL D;  3PV1 A;  1WJU A;  2DEN B;  1WH3 A;  3NHE B;  4XZ4 A;  4HJK A;  2G45 B;  1SGH A;  1TTN A;  3PRM B;  4NJ7 A;  3VH3 B;  4DHJ D;  2NCN A;  2W9N A;  3ZDM C;  4DDG D;  5DPW A;  4M8N A;  3DBR I;  3DBS A;  2WDT B;  4CO7 A;  3PTF C;  4FN2 A;  4BVU C;  3O65 B;  3QJZ A;  1OQY A;  3ZNG C;  2D3G A;  4I6L B;  1R4M I;  3Q3F A;  4B9K A;  4TV3 A;  4NQK E;  3PPA A;  4EEW A;  4XC2 A;  2IO3 B;  2PE6 B;  4JQW C;  4KDI C;  2G4D B;  1E7V A;  2M4N A;  4HPL B;  3AU4 A;  3U7D A;  4DHJ B;  4FUL A;  3IFW B;  3LDZ E;  3UF8 A;  2J0J A;  2JT4 B;  2DZK A;  3VTW A;  3W1S C;  3W1Y A;  1LXD A;  3BIN A;  3HIZ A;  4MDK E;  2FCQ A;  2MCN B;  4DK5 A;  3ZTD A;  2JPH A;  2CS4 A;  2HE7 A;  2M17 A;  2GMI C;  1KM7 A;  4MJS B;  3IBE A;  2NPT B;  2GBN A;  2KLG A;  3KUD B;  2BWF A;  4FJY A;  3QQ8 B;  2NVU I;  1M94 A;  1WJ6 A;  2MWS B;  2IY0 B;  3B0A A;  3CST A;  3PRE A;  4A3P A;  5JHA A;  2LD9 A;  2Z0E B;  1V81 A;  4LDT D;  4LJO B;  3HK0 A;  3ENE A;  2MA9 B;  3W1S A;  4WAA A;  1P3Q U;  2R2O A;  3TL5 A;  3UQA A;  4IUM B;  4K7S A;  2UYZ B;  5KHQ A;  2JUO A;  4MEM A;  3RD2 A;  2IYD B;  1WM2 A;  1E5W A;  2BKR B;  5G2N A;  5LXH A;  2WX0 A;  1WF9 A;  3EHV A;  1UD7 A;  4MM3 A;  1EO6 A;  1TBE A;  1RLF A;  3PRP B;  4LDT B;  4W9H A;  2K1F A;  3ZIM A;  5CX3 A;  2KDE B;  3UIN B;  2REX A;  1WZ0 A;  2NPT A;  3K9O B;  3PT2 B;  3VTU A;  1WXS A;  3DCG A;  3DOW A;  1J0G A;  3A1Q A;  3AUL A;  3A4R A;  2KFK B;  3H7P B;  4HK2 A;  4B95 A;  4BBN C;  4HXD A;  4TUU A;  1AAR A;  2N9X A;  1TGZ B;  2JVC A;  3ZO5 B;  4DWF A;  2RD0 A;  4HVB A;  5L95 C;  4KIK B;  2CHX A;  2GBM A;  2ZPN A;  1S1Q B;  4GMV A;  4IWQ A;  4ZDV A;  4X57 B;  2FCM A;  4KZC A;  1WJN A;  4CYE A;  4IM3 A;  3ZTC A;  2KWU B;  3T8M A;  1XD3 B;  3VDZ A;  2PJH A;  2DAF A;  2KXJ A;  4K7W A;  2WWZ A;  1VCB A;  2G3Q B;  2V1Y A;  3HM3 A;  3WAL A;  2KX0 A;  2OOB B;  3GZN I;  4IWP A;  2LVO A;  1IP9 A;  3GOE A;  4PYZ A;  2LXC A;  4EZJ A;  1I42 A;  1YIW A;  4GOC A;  3TCA A;  3ZRC A;  4AWJ A;  2HTH A;  4GB9 A;  2Y5B B;  3L16 A;  3PZD A;  2NBU A;  3K9P B;  3QCA A;  3WAN A;  1WX8 A;  4CHK A;  4KIK A;  1L7Y A;  4GU2 A;  1XQQ A;  4TQ1 A;  3ZRF A;  2IBI B;  4DDI D;  4MH0 E;  3QWZ B;  2CHZ A;  4KVG B;  2Z0D B;  1OEY J;  2M8S A;  3HM6 X;  4BKT A;  5J18 A;  2DX5 B;  1E7U A;  2HJ8 A;  5AEK B;  1A5R A;  1EF1 A;  3P2B A;  3PLU A;  2XBB C;  5BO4 B;  3IVF A;  2KNB A;  3QAR A;  2AYO B;  4I6P A;  4NQL B;  1WRD B;  1WGH A;  4E74 A;  2WYQ A;  4GDK B;  4IM0 A;  3L10 B;  1E8Y A;  1C1Y B;  1PQS A;  3DBH I;  2DYM A;  2KTF A;  2M1M A;  4GIV A;  5AZF A;  3NOB A;  2O6V B;  4IM2 A;  5J2R A;  2KFJ A;  2L0F A;  2CU1 A;  2KDB A;  3H6N A;  4K1R B;  2IZV B;  2FAZ A;  4HPM B;  2WX1 A;  4PYU A;  4NPN A;  1EUV B;  2D07 B;  3VUX A;  5D2M B;  3D32 A;  2A4Z A;  4JL9 A;  1TZ1 A;  1S3S G;  3L0W B;  1UZX B;  3N32 A;  4ANV A;  1IYF A;  4DXA B;  4A3O A;  1WE6 A;  3ZLZ A;  4M0W B;  4GDL A;  2J0M A;  3ML8 A;  4HCN B;  3NS8 A;  3RUI B;  2KQ7 A;  2ASQ A;  4MGZ E;  4HWI B;  2MP2 A;  4W9F A;  2DYB A;  5EDS A;  4EZL A;  3A9K B;  4KV2 A;  4GDK A;  5FR6 A;  1WGD A;  2XEW A;  2DZI A;  3UGB B;  4NAW A;  5TR5 A;  1EF5 A;  4RM9 A;  2L76 A;  2LRU A;  2O6V A;  4ANX A;  3N30 A;  4G0N B;  3CMM B;  2FCS A;  3X0W A;  5JH5 C;  3ZNI D;  4J6I A;  5DPR A;  1C3T A;  3AU5 A;  2OJR A;  4I6N B;  4MSQ B;  1XT9 B;  1P9D U;  1ZGU B;  2L05 A;  3IG3 A;  3KUC B;  5DPS A;  4W9K A;  4BKS D;  2KQS A;  2DHZ A;  3VUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...