3W1SC

Crystal structure of saccharomyces cerevisiae atg12-atg5 conjugate bound to the n-terminal domain of atg16
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
76
Chain Sequence
IQKIQIKFQPIGSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Autophagy protein 5
publication title Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 20
structure length 76
sequence length 86
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1sC00
1F9JA 2ZEQA 4BBNF 2KTRA 2XBBC 5KHQA 2IY0B 1E90A 3PGEA 4TUUA 2L05A 3A1QA 4FLHA 3QQ8B 3VQIA 3ZNHB 2LXCA 3IHPC 3OAWA 1J19A 2M1MA 3B1LX 3IBEA 4BVUC 2REXA 5G2NA 3K9OB 3HHMA 5LXIB 3ZNGC 1D3ZA 3GZNI 2EMSA 4FBJB 1UD7A 4LJOB 4NY0A 3OLMD 5CX3A 2LZ6A 5C1ZA 2JF5A 3UINB 2KNBA 2LD9A 4B9KA 2KFKB 5AEKB 4KSLC 1H8CA 2YVCA 4W9CA 3HM6X 3PPAA 2MCNB 3ZW3A 4ZDVA 2KHWB 3DVNU 2RR9A 1P1AA 3Q3FA 4LCDE 2JZZA 2KOXA 4PYZA 4FA6A 4ANWA 1ISNA 2MW5A 4KV2A 4AJWA 2IZVB 5DPRA 4DHJB 2BF8B 4LDTD 4EZLA 1WX7A 3CSFA 2KN5A 4NJ6A 2ZPNA 4XX5A 3QC8B 2NR2A 2DZMA 3DBHI 2CS4A 4II3B 1WMHA 3W1SC 1YX5B 1NBFC 2HE7A 4HCNB 3U7DA 4WWNA 2PPHA 3TL5A 4NNJB 4RMAA 3ZDMC 2KO3A 1WYWB 2KMCA 3M95A 5J18A 4BKSA 1GC7A 2KTRB 2GMIC 2MBHA 3A1QB 1M94A 2Z0EB 2GBJA 5D6JB 3VHTC 2FAZA 2I1KA 4DHJD 1JRUA 2JY6A 4HCPB 2OOBB 1SGHA 4JL9A 1WR1A 3KVFB 4WWOA 2KFJA 1NI2A 2L0FA 2KC2A 4BBNC 4J6IA 3ZKJC 3DVNV 3ZO5B 2ZVNA 2BWFA 4K7WA 2MX2A 2K6DB 1RLFA 2D2QA 2L0TA 2WX0A 4TKNA 3DBSA 4IWPA 4BKTA 1V6EA 4DBGA 3CF6E 3PLUA 2JZ3B 5AZFA 2XK5A 3ZRFA 2EMTA 3RYTA 4RM8A 2DYBA 1P98A 1L2NA 3B08A 2NBWB 2LRWA 2ZPYA 1V9JA 4K1RB 2MLBA 4WQOB 1E8ZA 2HJ8A 1WMHB 4FJVB 4HDQA 2KC1A 4IWQA 4W9EA 1X1MA 5IAAC 2Y5BB 4W9GA 2MBOA 3APFA 4G50A 1E8WA 4FJYA 3QK0A 3H1UA 3LJ3A 3UIPB 2DYOA 2IO1B 5DPSA 1L7YA 4ZRJA 2VRRB 4M8MA 2J7QB 2PJHA 4IC7B 1LFDA 2J0JA 2LVQA 4NQLB 2L8JA 4FN2A 2ZCBA 4MGIE 4CYEA 3V60A 1YD8U 4OVVA 3P2BA 2C7MB 3SU8X 5DPWA 3CSTA 2AEHA 2WWZA 3QAQA 2RPQA 2ZCCA 5G55A 4FADA 3PVLA 1WZ0A 4GOCA 4DXAB 4W9HA 1ZGUB 2ZNVC 3WAMA 3R3MA 2OJRA 4M0WB 2NS5A 4GDKA 1BT0A 4IM3A 3VVWB 3NOBA 2AYOB 3GOEA 2XK5B 1WGHA 2V4LA 2ASQA 4GU2A 3UQAA 3PS6A 2K39A 4F8CB 2RSUA 3ZDTA 3VH3B 4K7UA 3PREA 2KANA 3C0RB 4W9IA 2D11A 4CHKA 2KDBA 3NZSA 3R7RA 1WGDA 3SD5A 3WAPA 3PRZA 1V5TA 2C7HA 1WE7A 4IM2A 3OJ4B 2KQSA 3JYUA 1GNUA 1P0RA 2N9PC 3CMMB 2DZJA 4AWJA 5JH5C 3PRPB 3M3JA 1CMXB 2LWPA 2LGYA 2KDIA 5LXHA 4KDLB 3AI5A 3PTFC 2IY1B 1WXVA 1WGYA 2KJ6A 1TZ1A 1AARA 3NS8A 4LDTB 3EHVA 3M63B 1GJZA 2N9EB 4GDKB 4JQWC 3ZUNA 4B6WA 2FCMA 1ZW7A 3PHXB 1HE8A 4DDGD 1K8RB 4W9JA 3VTVA 1WF9A 4TQ1A 4GMVA 3O65B 5DCNA 2RGFA 1WIAA 2FIFA 2N7EA 4AJYB 1V2YA 1WJ6A 2MQJA 2FCSA 3N30A 4HJKA 5D94A 1I35A 1UZXB 1GG3A 1NDDA 4RM9A 2KX3A 4BFRA 2BGFA 3H6NA 3ALBA 1UBQA 4DHZE 3V6CB 3WA0A 4NAWA 4AUQC 5L83A 1P3QU 2V3SA 4K81A 5JZEB 4FHJA 1OEYJ 3L08A 2LVPA 3ZIMA 5J17A 1UH6A 4MEMA 5TR5A 3MJWA 4HDOA 1S3SG 2CU1A 3A4RA 2K8BA 4W9DA 3KUCB 3WIMA 3ZLZA 3BY4B 3PZDA 5CHWA 2N1WA 3DPDA 2K1FA 3WAOA 4ANUA 1VD2A 2L00B 2M8SA 4CO7A 3L54A 4KDIC 3T9LA 3VH4B 1LXDA 2DAJA 2LI5A 2C7NB 4HPLB 1WM2A 2LGXA 2LJ5A 3DVGY 4PS8A 1Z5SB 1E7UA 1V86A 2J0MA 4PS7A 1GUAB 1H4RA 2DAFA 4MELA 3KYCD 1OGWA 3N32A 5D7GA 4ZYNA 3UGBB 1KOTA 1VCBA 1EF5A 3PV1A 3EFUA 3VUWA 2IO0B 1R4NI 2D10A 2O6VD 3B0AA 4G11A 2PE6B 4MM3A 4PS3A 2BKRB 4NAWB 4B95A 4AP4C 2CKHB 4GB9A 2M17A 4HPMB 3X23A 4TQ0A 2A4ZA 2M0XA 5L95C 3PSEB 4W9LA 1UELA 2K25A 3KUZA 2DENB 2BYVE 3SDLC 2NCNA 3DQVA 4MGKE 1WJUA 3A9KA 1WRDB 4JGHB 2PEAA 2FUHB 2Z0DB 3EECA 4II2B 3A9JA 4NQKE 3DBRI 4ANXA 1RRBA 4E71A 1WH3A 4DWFA 5JHBA 2C9WB 2MWSB 1TBEA 1IPGA 2KD0A 2CHWA 5DPTA 1OTRB 3V62A 1WXMA 1TTNA 2KX0A 4IWOA 2G45B 3ENEA 3M62B 5E6NA 1WI0A 3QA8A 2IBIB 4DK5A 3U30A 3V6EB 4F1SA 4HWIB 4IUMB 3AU5A 5CHVC 2JWZA 2O2VA 2CR5A 4HK2A 4EZKA 1XQQA 3UQBA 1I42A 3QCAA 4KSKC 3PRMB 2GBRA 3U8ZA 3R7QA 4I6PA 1WJNA 4MGZE 4EZJA 2DZIA 3WALA 4N9F4 2LVOA 3ONSA 1WE6A 3VTWA 2ZVOA 2G4DB 3BINA 5BO4B 4OVUA 1S1QB 1WZ3A 4IG7B 3A33B 2AL6A 2L7RA 2UWQA 2GOWA 3RZFA 2W9NA 3DBLI 2I1JA 2FNJB 2FIDA 5J2RA 1Y8RC 3A9KB 3SHQA 3V61A 3W1SA 5CTRC 3A9JB 4F7ZA 2KLCA 1EUVB 2RD0A 3LDZE 1WX8A 1R4MI 2KVRA 2QHOA 4GIVA 4GXBA 3RCZA 2J0KA 4AOFA 2N4FA 2JUOA 1WFYA 1C1YB 1PQSA 1SE9A 2KJHB 2LGDA 1WY8A 2ZJDA 3DCGA 2HTHA 2O2VB 2O6VA 3JSVA 3KH0A 4IW0A 4WJOA 2KDEB 5GMVA 4ASWC 4A20A 5JHAA 2R2OA 3VAWA 1KM7A 4A3PA 4E3CA 1IYFA 3H7SA 2MP2A 3L0WB 1IP9A 4WWPA 5HKHA 3KW5B 4GGQA 3PLVA 2N7DA 2NPTA 4WJQA 3IFWB 2WDTB 4GDLA 4K7SA 1LM8B 2AWTA 3Q3JA 4FJZA 1XT9B 2FCNA 4WJPA 1EO6A 2G4SA 2L3ZA 2KJRA 2KQ7A 2DX5B 5FR6A 1E8XA 3D32A 2LUEA 2KWVB 3L17A 2JRIB 3ZVVA 1J0GA 4W9FA 3TJPA 2KMAA 4KVGB 3QX1A 3DOWA 2XEWA 2KKCA 3ML8A 2GBNA 3HM3A 5E6PA 1C3TA 1KJTA 1YIWA 3AULA 4FHKA 1QZEA 2KWCA 3IG3A 4M8NA 3PHWB 1V5OA 3RUIB 2DYMA 5KHOA 4ICVA 4URKA 3DVGX 3KUDB 5CHFA 5E6OA 1WJ4A 4YL8A 3TCAA 3PT2B 1P9DU 3VXWA 4BOZB 2JXXA 2BYFA 2UYZB 3JSVB 2O6VB 1WM3A 2LASA 4DHZB 1LQBA 1Z2MA 3HIZA 1WR6E 4KIKA 2MP2B 4MDKE 2NVUI 4I6NB 5IA7A 2JT4B 3R66C 4IM0A 2BKFA 2NPTB 1U4AA 3RT3B 2K6QA 3RZWC 4GDLB 4NPNA 2D07B 1YX6B 2BPSA 3ZNZB 3EC8A 1E7VA 1XD3B 2JPHA 1WXAA 2K8CA 1J8CA 2CHZA 3OJ3A 5C23A 1V49A 3MHSD 4EUTA 2KK8A 2N9XA 3TMPB 4MJSA 3T8MA 2KZRA 3TIXA 2IYDB 2MRPA 4P7IA 4ZRKA 2MA9B 4X57B 4HVBA 1G6JA 3L16A 3NHEB 4W9KA 3VDZA 3TBLD 4G3XB 3A4SC 3I3TB 3H7PA 1WGRA 2V1YA 3ZTDA 3L13A 4DDID 2N1VA 2PE9A 3X0WA 3ML9A 2A5UA 3S2AA 4HLEA 2WYQA 1V80A 2DHZA 3MTNB 4KZ0A 1RFAA 4MGYE 2C60A 2Z59B 2K8HA 4NJ7A 3UF8A 2D3GA 1A5RA 5AZHA 1RAXA 2CHXA 2NBUA 5AZGA 2L76A 3KYDD 4WJNA 4ICUA 4ANVA 2JVCA 4HXDA 3N3KB 1Q0WB 4EEWA 3RD2A 3L10B 3DDCB 4FULA 4KIKB 3QARA 1EF1A 1FXTB 2KTFA 2KWUB 3QWZB 1E8YA 3WANA 3W1YA 1E5WA 2ZZPB 2ZNVB 4GSWA 2WX1A 2MBBB 5EDSA 3H9DA 1OEYA 2MBEA 1ZKHA 3UIOB 4XC2A 2B3AA 2GBMA 2NBVB 5LLIA 1UGMA 4EKUA 2BWES 4MJSB 1WXSA 2R2QA 2IO2B 3APDA 4E74A 2EKEC 3VFKA 1MG8A 2MBQA 2AL3A 3AXCA 2GBKA 4TV3A 2MSED 2IO3B 3IVFA 4BKSD 4EOYA 1WX9A 2JRHA 3H7PB 3VUXA 3ECIA 1KLVA 3NY5A 4ZRIA 3ZRCA 3ZTCA 3JW0X 4MSQB 4WAAA 1T0YA 4LJPB 2BYEA 2LXAA 3K9PB 4MSMB 2KFKA 4G0NB 4XZ4A 1WGGA 3APCA 2YLMA 4I6LB 2M4NA 5D2MB 1TGZB 1V81A 3JVZX 4PYUA 2HD5B 3NZUA 1Q1OA 3RULA 4KZCA 4EFOA 3VTUA 2KDFB 3QIJA 2FCQA 4JIOU 4BOSC 4GN1A 3QHTA 4MH0E 1GC6A 2DZKA 2KLGA 3QJZA 4A3OA 3VUYA 1OQYA 4JLCA 3ZNID 4BKGA 3HK0A 2LRUA 1YJ1A 1SIFA 3AU4A 2G3QB 1Q5WB 1YQBA 2KXJA 2C5LC 1UBIA
chains in the Genus database with same CATH superfamily
5KHQA 3E56A 4TUUA 1E90A 1SE4A 2LXCA 2REXA 5G2NA 3K9OB 2RDHA 3HHMA 2WXRA 1SJHD 4FBJB 2AQ1B 3UINB 4R3DA 1F0ZA 4ITKA 4ZDVA 1L5PA 3NVZA 1N5WA 4DXFA 3AE3B 4KV2A 4P16A 2JWUA 4XX5A 3MC9A 2DZMA 4II3B 3W1SC 1NBFC 2HE7A 4HCNB 4RGNA 3AE7B 2KMCA 4P1CC 1QQRA 2Z0EB 1N6ZA 4L1BA 2KMMA 3U2SC 3B2FA 4HCPB 2JY6A 3Q8EA 2OOBB 4JL9A 4P1BC 4WWOA 4DHJD 4Q2JA 1NI2A 4BBNC 4KX6B 3I57A 3DVNV 2ZVNA 1C4CA 2BWFA 4C00A 4K7WA 2WS3B 2K6DB 4TKNA 3DBSA 5H92C 2VZKD 1V6EA 1RM6C 2EMTA 1EWCA 4MACA 4MT5A 2K9XA 2LRWA 2MLBA 3AE5B 3IAS1 3QK0A 1GOZA 3H1UA 5BMIA 4ZRJA 2VRRB 3NVYA 2QIEB 4M8MA 3NJTA 2L8JA 1T0SC 1HEZE 3AEDB 3AB5A 3P2BA 2AEHA 2WWZA 2ZCCA 4GOCA 1PFDA 2OJRA 1K53A 2NS5A 4RH6A 1XLNA 2UU7A 4RNAA 1SE2A 3VRBB 2KYWA 2E6XA 1SBBB 2B76B 2KDBA 3R7RA 1WGDA 3SD5A 3AEGB 3PRZA 2SAKA 3GE8C 3GE3C 1T3QA 4XE0A 1D5XC 1F52A 1RFKA 2LGYA 1FRRA 1C9FA 2MJ3A 1KH0A 4LNIA 2BT6A 2QC8A 1WGYA 2KJ6A 2N9EB 4B6WA 2FCMA 1HE8A 1WIAA 5D3DA 2MQJA 3N30A 1UZXB 4ZHPA 2KX3A 1AYFA 1UBQA 4YTPB 3V6CB 1NVID 2DWQA 2PMVA 3HRDD 5J17A 5TR5A 1E0ZA 4LNOA 3NVVA 4W9DA 1N63A 3BY4B 2Y5PA 1EU3A 1FFVA 1N5XA 3RNAC 3WAOA 1VD2A 5C2TB 4CO7A 4M00A 1SJED 2LI5A 3AEAB 4HPLB 1MI0A 1WM2A 2LGXA 2MJEA 3MJ5A 1TKEA 4PS8A 2X8XX 1FXAA 2JYEA 2YEPB 4ZYNA 1FM0D 3N32A 2IGGA 4A9AA 1UWMA 2IO0B 1HZ6A 2D3CA 2O6VD 2ACZB 4OZBA 1UGJA 4G11A 2PE6B 2BKRB 3W9CB 2N7JA 2J4XA 4RFBA 2M17A 3OG5A 2DENB 3AMZA 2NCNA 2QSDA 3NZ3A 4MGKE 1WRDB 3EECA 4L23A 1WH3A 4DWFA 2IPKD 1UWXA 4HROA 4KKIA 2L83A 3SR6A 5DPTA 1OTRB 3AV8A 4ZOHC 2INNE 1JMLA 1QOAA 2IBIB 3U30A 3V6EB 4DK5A 4IUMB 2O2VA 4EZKA 3UQBA 1I42A 4K3CA 1C77A 3PRMB 2LEKA 4I6PA 4EZJA 3AE4B 4N9F4 1FCLA 1HQRD 4IG7B 3A33B 4N6EB 2GOWA 2H89B 2I1JA 2FIDA 1Y8RC 2RMMA 3SHQA 3W1SA 4C56C 2BS3B 5EE9A 3LDZE 2ZW1A 4GXBA 4AOFA 3KWLA 1Q10A 2JUOA 3ZJTA 1PQSA 2PIAA 4WJOA 5AUKA 2HTHA 2O2VB 2O6VA 4ASWC 2KDEB 4ARIA 1TY2A 1OQQA 3L0WB 1T5XD 4WWPA 3DHGC 4GGQA 3ZJUA 2N7DA 2WDTB 4K7SA 4GDLA 1XT9B 1A70A 2KT7A 4WURA 1EO6A 4USAA 2G4SA 2OEDA 2L3ZA 2DX5B 2LUEA 2KWVB 1J0GA 3Q8FA 2CJOA 2PVOD 3TJPA 1D5ZC 1XCQL 3DOWA 1C3TA 1KJTA 3EA6A 4FHKA 3AULA 3PO0A 2WXMA 1V5OA 2DYMA 4URKA 4ICVA 3DVGX 2FUG1 4KKJA 5CHFA 1WJ4A 1P9DU 1PDXA 5GXGB 2O6VB 2LASA 4S0RA 3RPFC 1T0RC 1WR6E 4RCOA 1HXYD 3RT3B 4GDLB 1YX6B 1K50A 3EC8A 2JPHA 4A6QA 2K8CA 1J8CA 2EELA 2RDBC 2WU5B 2XN9C 3MHSD 3BVMA 4MJSA 3TIXA 2MRPA 4ZRKA 1ZXHA 4X57B 4HVBA 3NHEB 4W9KA 3A4SC 1N61A 1WGRA 5FKAC 3TEZA 4DDID 3N1YC 4HLEA 2RDGA 2WYQA 3MTNB 4MGYE 2C60A 1A5RA 3UF8A 3BWUD 2DLBA 2W82A 3N1XC 1RAXA 2NBUA 1ZE3D 2L76A 2JVCA 3EUB2 2JYTA 1Q0WB 4S17A 4FULA 3RNCC 3QARA 3U4EG 1E8YA 3WANA 3W1YA 2V0GA 2BTEA 1IBXA 3T3NA 2B3AA 3PZ8A 3VRAB 1IUEA 4MJSB 3VFKA 2AL3A 3VUXA 1I4QA 3ECIA 2TSSA 2QJLA 2INCC 4XZ4A 4H2AA 2MJDA 4KGRA 4LTUA 2WXIA 3VTUA 3QIJA 3AE1B 1F2RC 4MH0E 2KLGA 3QJZA 1IBXB 1Q5WB 1YQBA 2KXJA 2C5LC 4BBNF 2IY0B 3A1QA 4FLHA 3QQ8B 1R4MB 4BVUC 5E6JA 2H88B 2NTTA 5LXIB 1TS5A 1MHHE 5BMGA 2EMSA 1UD7A 1UUPA 1T0QC 2LZ6A 4JX1C 2LD9A 1H8CA 4KSLC 3PPAA 3ZW3A 4LCDE 1P1AA 3VR8B 2JZZA 4ANWA 2MW5A 4EZLA 1WX7A 1E6EB 4NJ6A 1ZUD2 4RGTA 1TKGA 2JZPA 4WWNA 4NNJB 2KO3A 3A1QB 1M94A 5D6JB 4B0EA 2I1KA 5EE3A 1QF6A 2KFJA 1YN5A 2J53A 1PGAA 4WIPA 4IWPA 4DBGA 1YNTE 4M0WA 3VR9B 3ZRFA 2OJWA 4C7YA 3HUIA 1ESFA 3V3XA 2ZPYA 1OFFA 1CK1A 4IWQA 3APFA 3I63C 1E8WA 3IT6B 3LJ3A 3W5UB 1FNWA 4FXCA 2HTME 2I2YA 2J52A 3Q3NC 2PJHA 1LFDA 2LVQA 4NQLB 3GS2A 2ZCBA 3BK2A 4TMAB 4IKGA 1C4AA 4OVZA 3P4SB 2WXLA 3SFDB 5FR3A 2RPQA 1DOYA 4FADA 1WZ0A 4DXAB 2ZNVC 1AW7A 4M0WB 4GDKA 1BT0A 2AYOB 1WGHA 2V4LA 5IKCM 4DQOC 3VH3B 2ICIA 2E3TA 1ZP0B 1FPYA 3C0RB 3WAPA 3OJ4B 2KQSA 3JYUA 2HJ1A 4ARCA 4M02A 1P0RA 2N9PC 3CMMB 2DZJA 4AWJA 3R2TA 1CMXB 2LWPA 5C3JB 4LNNA 2L32A 4L2YA 3NS8A 3BK1A 4GDKB 2KN4A 3ZUNA 3PHXB 4M01A 2BBCA 3VTVA 1YQ4B 4IDIA 4GMVA 4LNFA 1V2YA 1WYGA 5D94A 4HJKA 3B9JA 3FILA 1NDDA 4BFRA 2BB5A 4ZYSA 4AUQC 5L83A 2IGHA 4K81A 2M19A 2ZW0A 4FHJA 2GRIA 1FXIA 1QOBA 4TSSA 4HDOA 4OW0A 3A4RA 2K8BA 3MHZA 3WIMA 2N0SB 3KUCB 5CHWA 2N1WA 2ONQA 4ANUA 1FO4A 1E7PB 2M8SA 2BYTA 3L54A 1FRDA 1LXDA 3DBHB 2C7NB 1PGXA 4UDUC 1KTKA 4PS7A 1I4HA 1H4RA 2GLSA 2Y3AA 1E10A 1KOTA 1VCBA 3FILB 1JWSD 1EM7A 4MM3A 4B95A 4YTNB 4AP4C 2CKHB 4GB9A 3U7ZA 4TQ0A 1P7EA 2KVZA 5L95C 1KF6B 3PSEB 2PKOA 3DQVA 4JGHB 3P1MA 2Z0DB 4NQKE 3RNEC 4ANXA 5HI1A 2C9WB 2MWSB 1IPGA 3NUHB 2KX0A 1TS3A 3ENEA 2L52A 4HWIB 5CHVC 3CIRB 4XWWA 2GBRA 3U8ZA 1WJNA 3WALA 4MM3B 2K22A 1S1QB 2UWQA 1F1HA 1B1ZA 2LFIA 3U52E 4JWUC 2LHDA 3V61A 3R8BA 4NJCA 4F7ZA 2X38A 2KLCA 2W3SA 2QHOA 2J0KA 1WFYA 2KJHB 2LGDA 2V3NA 3N9YC 3KH0A 1TY0A 1GB4A 3VAWA 1IYFA 4E3CA 3P42A 1STEA 1IP9A 4XDCA 5HKHA 3KW5B 1VR9A 3PLVA 2NPTA 3MC0B 2LHEA 2M0AA 3D32A 3ZVVA 3BVZA 2JRIB 3GZNB 3QX1A 2GI9A 3C8YA 1FNUA 1QZEA 4M8NA 3BVGA 3PHWB 3RUIB 2WXQA 4BOZB 2JXXA 2UYZB 2OHFA 2BVCA 3Q14C 4JE3B 1LQBA 3AEFB 3HIZA 2KQ4X 4KIKA 4MDKE 4A55A 4I6NB 2JT4B 2LJIA 2NPTB 3DWMA 3ZNZB 1XD3B 1VJKA 4A90A 4EUTA 2KK8A 2N9XA 1LGRA 3IXSA 2IYDB 2MA9B 1XLOA 3L16A 4ACFA 1QT9A 3TBLD 4G3XB 3ZTDA 1DOIA 2Y5CA 2PE9A 4XWTA 1OQRA 1V80A 1QLBB 1RFAA 2Z59B 2K8HA 5AZHA 4MH8A 3ZXVA 1R4NB 1GPXA 2W54A 3L10B 3DDCB 2WXFA 1YN4A 4KIKB 2KTFA 3WCQA 1PUTA 2ZNVB 5EDSA 3H9DA 4XC2A 3RNBC 1QKZA 5BMHA 2BWES 1XEEA 2R2QA 3DBRB 5AUIA 2K3UA 2MBQA 3AXCA 2MSED 2IO3B 3IVFA 4WAFA 4BKSD 1N62A 1WX9A 1F2RI 3NY5A 4ZRIA 1JWUD 3ZTCA 4MSQB 3K9PB 4G0NB 3RNFC 1WGGA 2YLMA 4I6LB 1MPEA 1TGZB 1V81A 3OWEB 2W55A 4KZCA 4EFOA 4NAMA 3QHTA 4JLCA 4BKGA 3HK0A 1PGBA 2LRUA 3DBLB 1SE3A 1P7FA 1I4PA 2WXPA 1F9JA 2EKIA 3PGEA 2L05A 3IHPC 3OAWA 4RF1A 1J19A 4D2KA 2M1MA 1FIQA 3IBEA 1JWBD 1FD6A 3RI7C 3BYTB 3GZNI 4LK0M 4NY0A 2JF5A 2KNBA 2YVCA 4W9CA 1JALA 3HM6X 4PYZA 4WH4A 4FA6A 1ISNA 4AJWA 2IZVB 5DPRA 3SEBA 2BF8B 3CSFA 3IAM1 2DBYA 2KN5A 2ZPNA 3QC8B 2PTLA 2NR2A 4KGTA 2CS4A 4XGAB 1WMHA 4LLGM 3RNGC 3U7DA 5LNK1 3TL5A 3ZDMC 1WWTA 1WYWB 1XF5L 3M95A 2Z8LA 4BKSA 1GC7A 2MBHA 3VHTC 2FAZA 4NZLB 2HDEA 3Q8BA 4OHJA 1K51A 2PVGC 4J6IA 1IGCA 3ZO5B 1XXGA 2J42A 4CQNA 2MX2A 2D2QA 4BKTA 3Q6BA 1XCTL 2JZ3B 3O13A 2XK5A 4RM8A 2DYBA 2RPVA 3B08A 1V8CA 1VRAB 4K1RB 1YQ3B 4WQOB 2HJ8A 4YSXB 1WMHB 1M4VA 4FJVB 4HDQA 2PLPA 2MBOA 4FJYA 3UIPB 2DYOA 2IO1B 3AEBB 2JXTA 2J7QB 4RGOS 1I7HA 4FN2A 4MGIE 1FMAD 4REZA 4OVVA 2C7MB 3CSTA 3QAQA 3C19A 1SEBD 2WQYB 4W9HA 1ZGUB 3WAMA 3LYYA 4IM3A 3GOEA 2XK5B 3UQAA 1ENFA 3PS6A 4F8CB 3AECB 4ZRQA 4W9IA 2D11A 1J7BA 3NZSA 1V5TA 4HJGE 5JH5C 4K3BA 1ZPSA 3PRPB 3M3JA 4AQ7A 1C76A 4KDLB 3AI5A 3PTFC 2IY1B 1WXVA 1TZ1A 1AARA 4ZRPA 4JQWC 4US9A 3AM9A 1K8RB 4JWSC 4W9JA 1AN8A 4TQ1A 3O65B 2RGFA 1TS4A 4AJYB 1WJ6A 1I35A 1GG3A 1ROEA 4P6VF 4RM9A 1TT5B 1B9RA 2BGFA 2D5GA 4DHZE 1V1PA 4NAWA 2IJ0A 3MC8A 4N59A 2V3SA 3P4RB 5JZEB 1OEYJ 3L08A 2LVPA 2NTSA 3ZIMA 2Q5WD 1UH6A 1S3SG 3PZDA 1NYRA 4C4VA 3RN9C 2K1FA 2L00B 3R2IA 4KDIC 5BYSA 2DAJA 1Z5SB 1E7UA 2J0MA 1SSNA 2DAFA 1OGWA 3VUWA 3PV1A 3EFUA 1CQVA 2AQ2B 3TSSA 2GB1A 1L0YB 4PS3A 1V1PB 4NAWB 3HVZA 3X23A 1FFUA 2V9HA 3RFZB 4W9LA 1ET9A 5I4DA 1T6BX 3Q69A 2BYVE 3SDLC 1WJUA 3A9KA 3V05A 1XO3A 4II2B 3A9JA 4E71A 1L0XB 1RRBA 4XDDA 4C4VB 1TBEA 2CHWA 2WNMA 3V62A 1TTNA 1ACCA 5E6NA 2V3PA 4RF0A 2JWZA 1YOVB 2CR5A 3E9SA 4HK2A 3QCAA 4KSKC 4BAXA 1TKYA 1TZOA 4MGZE 3Q3OC 2DZIA 2LVOA 3VTWA 2KACA 5BO4B 4YSZB 3RZFA 4B0MA 2BQQA 2W9NA 2DNFA 2AX5A 2WXGA 5J2RA 1L4DB 2G9HD 3A9KB 1VDVA 3A9JB 5CTRC 2WDVB 2RD0A 1R4MI 2KVRA 4GIVA 2W3RA 1SIJA 4YTMB 1SE9A 4EE2A 3JSVA 1WY8A 2ZJDA 3DCGA 1JQ4A 4IW0A 3PZ7A 4A20A 1WSPA 2QMTA 4RGMA 2MP2A 1V1OA 4WJQA 1L0VB 2BW2A 3IFWB 3P63A 3Q3JA 3NRZA 5FK9C 2FCNA 1ZDXA 1ZXIA 1WXQA 2KJRA 2PW9A 5FR6A 1E8XA 4W9FA 2KMAA 3ML8A 2KKCA 1DYQA 5E6PA 3P4QB 2KWCA 5MPOA 5KHOA 3KUDB 3UI3A 3TCAA 3PT2B 3VXWA 1TJEA 2QEJC 3JSVB 5HFYA 1JROA 1SF0A 3B2GA 1EU4A 3RMKC 1DOXA 1Z2MA 2JSVX 2MP2B 2NVUI 1EWYC 3R66C 3MP9A 4IM0A 2BKFA 1U4AA 3RZWC 4NPNA 2D07B 1E7VA 3ZYYX 1WXAA 3MFGA 3IT4B 1VZ7A 2AQ3B 2CHZA 5IN7A 2INPE 3TMPB 2KZRA 1G6JA 3VDZA 1QOGA 3I3TB 3H7PA 3W5VB 3ML9A 2A5UA 3S2AA 2KDMA 4KZ0A 3KQ4A 4NJ7A 2CHXA 2ON8A 2QDFA 4WJNA 4ICUA 4YWGG 1ZOYB 4HXDA 1HZ5A 1JWMD 4EEWA 5G5GA 1NYQA 1FXTB 3QWZB 2ZZPB 1ZKHA 1BXTA 3UIOB 2NBVB 1I4RA 2MHJA 4EKUA 3APDA 2IO2B 4E74A 5H8YE 2EKEC 1MG8A 1XLQA 3DWGC 4EOYA 3H7PB 2CU3A 1C79A 4AS1A 4WAAA 4LJPB 2LXAA 2KFKA 3URYA 3TEXA 4HKZE 3APCA 2WXKA 5D2MB 1NEKB 3NZUA 1KRHA 3RULA 3TEYA 3LB8C 2KDFB 4QAYA 2FCQA 4JIOU 3I5JC 4GN1A 4A3OA 1OQYA 1YJ1A 1SIFA 3AU4A 2G3QB 2LMCA 1UBIA 2ZEQA 2KTRA 2WP9B 2XBBC 3VQIA 3ZNHB 3B1LX 1L6VA 5JXVA 3ZNGC 1D3ZA 4LJOB 3OLMD 5CX3A 5C1ZA 2D3AA 4B9KA 2KFKB 5AEKB 2MCNB 3ABVB 2KHWB 3DVNU 2RR9A 3Q3FA 4HPPA 2KOXA 1PYWD 4DHJB 4LDTD 2N9LA 2WXHA 1NI3A 3DBHI 1RWSA 1YX5B 2PPHA 4RMAA 1I4XA 5J18A 2KTRB 2GMIC 2VZKB 4C80A 2GBJA 1RYJA 1JRUA 1SGHA 2BS2B 1WR1A 3KVFB 2L0FA 2KC2A 1BMLC 3ZKJC 3ZXRA 3N20C 3TUOA 1D5MC 1RLFA 2L0TA 2WX0A 3H8HA 3CF6E 3PLUA 1VZ6A 4XYCA 2LGSA 5AZFA 3RYTA 4DXGA 1P98A 1L2NA 2NBWB 1V9JA 1E8ZA 4OZAA 1YJIA 2KWDA 5IAAC 2KC1A 4W9EA 1X1MA 1KLUD 2Y5BB 4W9GA 4G50A 1FEHA 4YT0B 2L1AA 5DPSA 1L7YA 1F77A 1HTOA 1JRPA 2FE8A 2INDC 4IC7B 2J0JA 1WRIA 1VZ8A 4CYEA 3V60A 1YD8U 2VH1A 3SU8X 5DPWA 1KFYB 3AEEB 5G55A 3P4PB 3PVLA 1BUIC 1MJDA 3R3MA 1SB3C 3VVWB 3NOBA 2QCZA 1ZDVA 2ASQA 4GU2A 2K39A 2RSUA 3ZDTA 4K7UA 3Q8AA 1SXTA 1HA5A 3BZDB 3PREA 2KANA 1MHXA 4GLSC 4CHKA 2MH7A 2WU2B 2C7HA 1C4PA 1WE7A 3BIID 4IM2A 5HHDG 1GNUA 1YMHE 3HVDA 3NG0A 3GP7A 2KDIA 5LXHA 3NVWA 2KAJA 3AE2B 1CJEA 4YSYB 1R7SA 2K0PA 3ZJVA 4LDTB 3EHVA 3M63B 1GJZA 1JW9D 1ZW7A 4DDGD 5IP4D 1WF9A 1JWAD 2JX5A 3Q8CA 5DCNA 2FIFA 2N7EA 4YXDB 2FCSA 4JPSA 1UF0A 3H6NA 4IOIE 2I38A 3ALBA 2YEPF 3DHHC 3WA0A 1AWDA 2D3BA 4PK1A 1P3QU 1N60A 2IGDA 3SFEB 4MEMA 3MJWA 3ETRA 1MVKA 2CU1A 4WQMA 3ZLZA 3AE6B 3DPDA 4US8A 1QILA 2BB6A 1C78A 3T9LA 3VH4B 2LJ5A 1D4BA 3DVGY 1V86A 3ZQ4A 1GUAB 4MELA 1TS2A 3KYCD 5D7GA 3UGBB 1L6UA 1EF5A 1NENB 3AN1A 1R4NI 2D10A 3B0AA 2SEBD 4HPMB 4J3OD 2A4ZA 1LO5D 2M0XA 1GAQB 1UELA 2K25A 3KUZA 4O1NA 2PEAA 2FUHB 1QOFA 3DBRI 4KGSA 5T8IA 5JHBA 1TIFA 2KD0A 2WXOA 1WXMA 4OZCA 4IWOA 1JCKB 2G45B 1YJJA 3M62B 1WI0A 2MEKA 3QA8A 4F1SA 3L4PA 3GB1A 3AU5A 5IO9A 2WXNA 4A8XC 1XQQA 3R7QA 5D3IB 1IGDA 4HKQA 1ET6A 3ONSA 1WE6A 3I9V1 2ZVOA 2G4DB 3BINA 4OVUA 4WWMA 1WZ3A 2AL6A 2L7RA 3J9CA 1J7CA 1KLGD 3DBLI 2FBWB 5EE1A 2FNJB 3BYYB 5TSSA 2N9KA 1EUVB 3DHIC 1WX8A 3RCZA 1Y56A 2WGSA 5EE0A 3Q2AC 2N4FA 2QILA 4LNKA 1C1YB 3ZGZA 3N1ZC 1FCCC 1I4GA 3EGRA 5GMVA 1CZPA 5JHAA 2R2OA 3AH7A 1KM7A 4A3PA 3H7SA 3FKYA 3FAHA 1LM8B 2AWTA 4FJZA 2LUMA 4WJPA 2KQ7A 5BYRA 3L17A 2CJNA 1MG4A 4KVGB 2WHIA 2XEWA 2GBNA 3HM3A 1V97A 1YIWA 3IG3A 2WDRB 3FC4A 1XLPA 5E6OA 4YL8A 2WLBA 1J7AA 2BYFA 2M56B 1WM3A 1DGJA 4DHZB 3TEWA 1L4ZB 5IA7A 4ZHOA 1HTQA 2K6QA 2BPSA 5G5HA 3OJ3A 1UNSA 5C23A 1V49A 1MFWA 3T8MA 2K5PA 1YN3A 4P7IA 2VH2A 5IOIA 2V1YA 5BYQA 3L13A 2N1VA 3X0WA 2R61A 3AE9B 2DHZA 4C7ZA 2XNAC 2D3GA 5AZGA 3EFCA 2LGIA 3KYDD 4ANVA 2WDQB 4N58A 3N3KB 3RD2A 1FNVA 1EF1A 2KWUB 3KLSX 1E5WA 2V4IB 4GSWA 2G1EA 2MBBB 2WX1A 1OEYA 5HG2A 2MBEA 2NMQA 2GBMA 5LLIA 3KWVA 1UGMA 3NS1A 1WXSA 1VLBA 3W2DA 2GBKA 4TV3A 1WGKA 2JRHA 1KLVA 3ZRCA 2WXJA 4PT5A 3JW0X 1T0YA 2BYEA 3CWIA 3AE8B 4MSMB 1TYGB 2JQRB 4BZAA 2M4NA 3JVZX 4PYUA 4HEA1 2HD5B 3T3OA 1K52A 1GB1A 1Q1OA 2JU6X 2BS4B 4BOSC 1E9MA 1GC6A 2DZKA 2IDYA 3VUYA 3ZNID 3LXFA 1D6EC 4HRSA 3Q3MC
chains in the Genus database with same CATH topology
1F9JA 2ZEQA 4BBNF 2KTRA 2XBBC 5KHQA 2IY0B 1E90A 3PGEA 4TUUA 2L05A 3A1QA 4FLHA 3QQ8B 3VQIA 3ZNHB 2LXCA 3IHPC 3OAWA 1J19A 2M1MA 3B1LX 3IBEA 4BVUC 2REXA 5G2NA 3K9OB 3HHMA 5LXIB 3ZNGC 1D3ZA 3GZNI 2EMSA 4FBJB 1UD7A 4LJOB 4NY0A 3OLMD 5CX3A 2LZ6A 5C1ZA 2JF5A 3UINB 2KNBA 2LD9A 4B9KA 2KFKB 5AEKB 4KSLC 1H8CA 2YVCA 4W9CA 3HM6X 3PPAA 2MCNB 3ZW3A 4ZDVA 2KHWB 3DVNU 2RR9A 1P1AA 3Q3FA 4LCDE 2JZZA 2KOXA 4PYZA 4FA6A 4ANWA 1ISNA 2MW5A 4KV2A 4AJWA 2IZVB 5DPRA 4DHJB 2BF8B 4LDTD 4EZLA 1WX7A 3CSFA 2KN5A 4NJ6A 2ZPNA 4XX5A 3QC8B 2NR2A 2DZMA 3DBHI 2CS4A 4II3B 1WMHA 3W1SC 1YX5B 1NBFC 2HE7A 4HCNB 3U7DA 4WWNA 2PPHA 3TL5A 4NNJB 4RMAA 3ZDMC 2KO3A 1WYWB 2KMCA 3M95A 5J18A 4BKSA 1GC7A 2KTRB 2GMIC 2MBHA 3A1QB 1M94A 2Z0EB 2GBJA 5D6JB 3VHTC 2FAZA 2I1KA 4DHJD 1JRUA 2JY6A 4HCPB 2OOBB 1SGHA 4JL9A 1WR1A 3KVFB 4WWOA 2KFJA 1NI2A 2L0FA 2KC2A 4BBNC 4J6IA 3ZKJC 3DVNV 3ZO5B 2ZVNA 2BWFA 4K7WA 2MX2A 2K6DB 1RLFA 2D2QA 2L0TA 2WX0A 4TKNA 3DBSA 4IWPA 4BKTA 1V6EA 4DBGA 3CF6E 3PLUA 2JZ3B 5AZFA 2XK5A 3ZRFA 2EMTA 3RYTA 4RM8A 2DYBA 1P98A 1L2NA 3B08A 2NBWB 2LRWA 2ZPYA 1V9JA 4K1RB 2MLBA 4WQOB 1E8ZA 2HJ8A 1WMHB 4FJVB 4HDQA 2KC1A 4IWQA 4W9EA 1X1MA 5IAAC 2Y5BB 4W9GA 2MBOA 3APFA 4G50A 1E8WA 4FJYA 3QK0A 3H1UA 3LJ3A 3UIPB 2DYOA 2IO1B 5DPSA 1L7YA 4ZRJA 2VRRB 4M8MA 2J7QB 2PJHA 4IC7B 1LFDA 2J0JA 2LVQA 4NQLB 2L8JA 4FN2A 2ZCBA 4MGIE 4CYEA 3V60A 1YD8U 4OVVA 3P2BA 2C7MB 3SU8X 5DPWA 3CSTA 2AEHA 2WWZA 3QAQA 2RPQA 2ZCCA 5G55A 4FADA 3PVLA 1WZ0A 4GOCA 4DXAB 4W9HA 1ZGUB 2ZNVC 3WAMA 3R3MA 2OJRA 4M0WB 2NS5A 4GDKA 1BT0A 4IM3A 3VVWB 3NOBA 2AYOB 3GOEA 2XK5B 1WGHA 2V4LA 2ASQA 4GU2A 3UQAA 3PS6A 2K39A 4F8CB 2RSUA 3ZDTA 3VH3B 4K7UA 3PREA 2KANA 3C0RB 4W9IA 2D11A 4CHKA 2KDBA 3NZSA 3R7RA 1WGDA 3SD5A 3WAPA 3PRZA 1V5TA 2C7HA 1WE7A 4IM2A 3OJ4B 2KQSA 3JYUA 1GNUA 1P0RA 2N9PC 3CMMB 2DZJA 4AWJA 5JH5C 3PRPB 3M3JA 1CMXB 2LWPA 2LGYA 2KDIA 5LXHA 4KDLB 3AI5A 3PTFC 2IY1B 1WXVA 1WGYA 2KJ6A 1TZ1A 1AARA 3NS8A 4LDTB 3EHVA 3M63B 1GJZA 2N9EB 4GDKB 4JQWC 3ZUNA 4B6WA 2FCMA 1ZW7A 3PHXB 1HE8A 4DDGD 1K8RB 4W9JA 3VTVA 1WF9A 4TQ1A 4GMVA 3O65B 5DCNA 2RGFA 1WIAA 2FIFA 2N7EA 4AJYB 1V2YA 1WJ6A 2MQJA 2FCSA 3N30A 4HJKA 5D94A 1I35A 1UZXB 1GG3A 1NDDA 4RM9A 2KX3A 4BFRA 2BGFA 3H6NA 3ALBA 1UBQA 4DHZE 3V6CB 3WA0A 4NAWA 4AUQC 5L83A 1P3QU 2V3SA 4K81A 5JZEB 4FHJA 1OEYJ 3L08A 2LVPA 3ZIMA 5J17A 1UH6A 4MEMA 5TR5A 3MJWA 4HDOA 1S3SG 2CU1A 3A4RA 2K8BA 4W9DA 3KUCB 3WIMA 3ZLZA 3BY4B 3PZDA 5CHWA 2N1WA 3DPDA 2K1FA 3WAOA 4ANUA 1VD2A 2L00B 2M8SA 4CO7A 3L54A 4KDIC 3T9LA 3VH4B 1LXDA 2DAJA 2LI5A 2C7NB 4HPLB 1WM2A 2LGXA 2LJ5A 3DVGY 4PS8A 1Z5SB 1E7UA 1V86A 2J0MA 4PS7A 1GUAB 1H4RA 2DAFA 4MELA 3KYCD 1OGWA 3N32A 5D7GA 4ZYNA 3UGBB 1KOTA 1VCBA 1EF5A 3PV1A 3EFUA 3VUWA 2IO0B 1R4NI 2D10A 2O6VD 3B0AA 4G11A 2PE6B 4MM3A 4PS3A 2BKRB 4NAWB 4B95A 4AP4C 2CKHB 4GB9A 2M17A 4HPMB 3X23A 4TQ0A 2A4ZA 2M0XA 5L95C 3PSEB 4W9LA 1UELA 2K25A 3KUZA 2DENB 2BYVE 3SDLC 2NCNA 3DQVA 4MGKE 1WJUA 3A9KA 1WRDB 4JGHB 2PEAA 2FUHB 2Z0DB 3EECA 4II2B 3A9JA 4NQKE 3DBRI 4ANXA 1RRBA 4E71A 1WH3A 4DWFA 5JHBA 2C9WB 2MWSB 1TBEA 1IPGA 2KD0A 2CHWA 5DPTA 1OTRB 3V62A 1WXMA 1TTNA 2KX0A 4IWOA 2G45B 3ENEA 3M62B 5E6NA 1WI0A 3QA8A 2IBIB 4DK5A 3U30A 3V6EB 4F1SA 4HWIB 4IUMB 3AU5A 5CHVC 2JWZA 2O2VA 2CR5A 4HK2A 4EZKA 1XQQA 3UQBA 1I42A 3QCAA 4KSKC 3PRMB 2GBRA 3U8ZA 3R7QA 4I6PA 1WJNA 4MGZE 4EZJA 2DZIA 3WALA 4N9F4 2LVOA 3ONSA 1WE6A 3VTWA 2ZVOA 2G4DB 3BINA 5BO4B 4OVUA 1S1QB 1WZ3A 4IG7B 3A33B 2AL6A 2L7RA 2UWQA 2GOWA 3RZFA 2W9NA 3DBLI 2I1JA 2FNJB 2FIDA 5J2RA 1Y8RC 3A9KB 3SHQA 3V61A 3W1SA 5CTRC 3A9JB 4F7ZA 2KLCA 1EUVB 2RD0A 3LDZE 1WX8A 1R4MI 2KVRA 2QHOA 4GIVA 4GXBA 3RCZA 2J0KA 4AOFA 2N4FA 2JUOA 1WFYA 1C1YB 1PQSA 1SE9A 2KJHB 2LGDA 1WY8A 2ZJDA 3DCGA 2HTHA 2O2VB 2O6VA 3JSVA 3KH0A 4IW0A 4WJOA 2KDEB 5GMVA 4ASWC 4A20A 5JHAA 2R2OA 3VAWA 1KM7A 4A3PA 4E3CA 1IYFA 3H7SA 2MP2A 3L0WB 1IP9A 4WWPA 5HKHA 3KW5B 4GGQA 3PLVA 2N7DA 2NPTA 4WJQA 3IFWB 2WDTB 4GDLA 4K7SA 1LM8B 2AWTA 3Q3JA 4FJZA 1XT9B 2FCNA 4WJPA 1EO6A 2G4SA 2L3ZA 2KJRA 2KQ7A 2DX5B 5FR6A 1E8XA 3D32A 2LUEA 2KWVB 3L17A 2JRIB 3ZVVA 1J0GA 4W9FA 3TJPA 2KMAA 4KVGB 3QX1A 3DOWA 2XEWA 2KKCA 3ML8A 2GBNA 3HM3A 5E6PA 1C3TA 1KJTA 1YIWA 3AULA 4FHKA 1QZEA 2KWCA 3IG3A 4M8NA 3PHWB 1V5OA 3RUIB 2DYMA 5KHOA 4ICVA 4URKA 3DVGX 3KUDB 5CHFA 5E6OA 1WJ4A 4YL8A 3TCAA 3PT2B 1P9DU 3VXWA 4BOZB 2JXXA 2BYFA 2UYZB 3JSVB 2O6VB 1WM3A 2LASA 4DHZB 1LQBA 1Z2MA 3HIZA 1WR6E 4KIKA 2MP2B 4MDKE 2NVUI 4I6NB 5IA7A 2JT4B 3R66C 4IM0A 2BKFA 2NPTB 1U4AA 3RT3B 2K6QA 3RZWC 4GDLB 4NPNA 2D07B 1YX6B 2BPSA 3ZNZB 3EC8A 1E7VA 1XD3B 2JPHA 1WXAA 2K8CA 1J8CA 2CHZA 3OJ3A 5C23A 1V49A 3MHSD 4EUTA 2KK8A 2N9XA 3TMPB 4MJSA 3T8MA 2KZRA 3TIXA 2IYDB 2MRPA 4P7IA 4ZRKA 2MA9B 4X57B 4HVBA 1G6JA 3L16A 3NHEB 4W9KA 3VDZA 3TBLD 4G3XB 3A4SC 3I3TB 3H7PA 1WGRA 2V1YA 3ZTDA 3L13A 4DDID 2N1VA 2PE9A 3X0WA 3ML9A 2A5UA 3S2AA 4HLEA 2WYQA 1V80A 2DHZA 3MTNB 4KZ0A 1RFAA 4MGYE 2C60A 2Z59B 2K8HA 4NJ7A 3UF8A 2D3GA 1A5RA 5AZHA 1RAXA 2CHXA 2NBUA 5AZGA 2L76A 3KYDD 4WJNA 4ICUA 4ANVA 2JVCA 4HXDA 3N3KB 1Q0WB 4EEWA 3RD2A 3L10B 3DDCB 4FULA 4KIKB 3QARA 1EF1A 1FXTB 2KTFA 2KWUB 3QWZB 1E8YA 3WANA 3W1YA 1E5WA 2ZZPB 2ZNVB 4GSWA 2WX1A 2MBBB 5EDSA 3H9DA 1OEYA 2MBEA 1ZKHA 3UIOB 4XC2A 2B3AA 2GBMA 2NBVB 5LLIA 1UGMA 4EKUA 2BWES 4MJSB 1WXSA 2R2QA 2IO2B 3APDA 4E74A 2EKEC 3VFKA 1MG8A 2MBQA 2AL3A 3AXCA 2GBKA 4TV3A 2MSED 2IO3B 3IVFA 4BKSD 4EOYA 1WX9A 2JRHA 3H7PB 3VUXA 3ECIA 1KLVA 3NY5A 4ZRIA 3ZRCA 3ZTCA 3JW0X 4MSQB 4WAAA 1T0YA 4LJPB 2BYEA 2LXAA 3K9PB 4MSMB 2KFKA 4G0NB 4XZ4A 1WGGA 3APCA 2YLMA 4I6LB 2M4NA 5D2MB 1TGZB 1V81A 3JVZX 4PYUA 2HD5B 3NZUA 1Q1OA 3RULA 4KZCA 4EFOA 3VTUA 2KDFB 3QIJA 2FCQA 4JIOU 4BOSC 4GN1A 3QHTA 4MH0E 1GC6A 2DZKA 2KLGA 3QJZA 4A3OA 3VUYA 1OQYA 4JLCA 3ZNID 4BKGA 3HK0A 2LRUA 1YJ1A 1SIFA 3AU4A 2G3QB 1Q5WB 1YQBA 2KXJA 2C5LC 1UBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9J A;  2ZEQ A;  4BBN F;  2KTR A;  2XBB C;  5KHQ A;  2IY0 B;  1E90 A;  3PGE A;  4TUU A;  2L05 A;  3A1Q A;  4FLH A;  3QQ8 B;  3VQI A;  3ZNH B;  2LXC A;  3IHP C;  3OAW A;  1J19 A;  2M1M A;  3B1L X;  3IBE A;  4BVU C;  2REX A;  5G2N A;  3K9O B;  3HHM A;  5LXI B;  3ZNG C;  1D3Z A;  3GZN I;  2EMS A;  4FBJ B;  1UD7 A;  4LJO B;  4NY0 A;  3OLM D;  5CX3 A;  2LZ6 A;  5C1Z A;  2JF5 A;  3UIN B;  2KNB A;  2LD9 A;  4B9K A;  2KFK B;  5AEK B;  4KSL C;  1H8C A;  2YVC A;  4W9C A;  3HM6 X;  3PPA A;  2MCN B;  3ZW3 A;  4ZDV A;  2KHW B;  3DVN U;  2RR9 A;  1P1A A;  3Q3F A;  4LCD E;  2JZZ A;  2KOX A;  4PYZ A;  4FA6 A;  4ANW A;  1ISN A;  2MW5 A;  4KV2 A;  4AJW A;  2IZV B;  5DPR A;  4DHJ B;  2BF8 B;  4LDT D;  4EZL A;  1WX7 A;  3CSF A;  2KN5 A;  4NJ6 A;  2ZPN A;  4XX5 A;  3QC8 B;  2NR2 A;  2DZM A;  3DBH I;  2CS4 A;  4II3 B;  1WMH A;  3W1S C;  1YX5 B;  1NBF C;  2HE7 A;  4HCN B;  3U7D A;  4WWN A;  2PPH A;  3TL5 A;  4NNJ B;  4RMA A;  3ZDM C;  2KO3 A;  1WYW B;  2KMC A;  3M95 A;  5J18 A;  4BKS A;  1GC7 A;  2KTR B;  2GMI C;  2MBH A;  3A1Q B;  1M94 A;  2Z0E B;  2GBJ A;  5D6J B;  3VHT C;  2FAZ A;  2I1K A;  4DHJ D;  1JRU A;  2JY6 A;  4HCP B;  2OOB B;  1SGH A;  4JL9 A;  1WR1 A;  3KVF B;  4WWO A;  2KFJ A;  1NI2 A;  2L0F A;  2KC2 A;  4BBN C;  4J6I A;  3ZKJ C;  3DVN V;  3ZO5 B;  2ZVN A;  2BWF A;  4K7W A;  2MX2 A;  2K6D B;  1RLF A;  2D2Q A;  2L0T A;  2WX0 A;  4TKN A;  3DBS A;  4IWP A;  4BKT A;  1V6E A;  4DBG A;  3CF6 E;  3PLU A;  2JZ3 B;  5AZF A;  2XK5 A;  3ZRF A;  2EMT A;  3RYT A;  4RM8 A;  2DYB A;  1P98 A;  1L2N A;  3B08 A;  2NBW B;  2LRW A;  2ZPY A;  1V9J A;  4K1R B;  2MLB A;  4WQO B;  1E8Z A;  2HJ8 A;  1WMH B;  4FJV B;  4HDQ A;  2KC1 A;  4IWQ A;  4W9E A;  1X1M A;  5IAA C;  2Y5B B;  4W9G A;  2MBO A;  3APF A;  4G50 A;  1E8W A;  4FJY A;  3QK0 A;  3H1U A;  3LJ3 A;  3UIP B;  2DYO A;  2IO1 B;  5DPS A;  1L7Y A;  4ZRJ A;  2VRR B;  4M8M A;  2J7Q B;  2PJH A;  4IC7 B;  1LFD A;  2J0J A;  2LVQ A;  4NQL B;  2L8J A;  4FN2 A;  2ZCB A;  4MGI E;  4CYE A;  3V60 A;  1YD8 U;  4OVV A;  3P2B A;  2C7M B;  3SU8 X;  5DPW A;  3CST A;  2AEH A;  2WWZ A;  3QAQ A;  2RPQ A;  2ZCC A;  5G55 A;  4FAD A;  3PVL A;  1WZ0 A;  4GOC A;  4DXA B;  4W9H A;  1ZGU B;  2ZNV C;  3WAM A;  3R3M A;  2OJR A;  4M0W B;  2NS5 A;  4GDK A;  1BT0 A;  4IM3 A;  3VVW B;  3NOB A;  2AYO B;  3GOE A;  2XK5 B;  1WGH A;  2V4L A;  2ASQ A;  4GU2 A;  3UQA A;  3PS6 A;  2K39 A;  4F8C B;  2RSU A;  3ZDT A;  3VH3 B;  4K7U A;  3PRE A;  2KAN A;  3C0R B;  4W9I A;  2D11 A;  4CHK A;  2KDB A;  3NZS A;  3R7R A;  1WGD A;  3SD5 A;  3WAP A;  3PRZ A;  1V5T A;  2C7H A;  1WE7 A;  4IM2 A;  3OJ4 B;  2KQS A;  3JYU A;  1GNU A;  1P0R A;  2N9P C;  3CMM B;  2DZJ A;  4AWJ A;  5JH5 C;  3PRP B;  3M3J A;  1CMX B;  2LWP A;  2LGY A;  2KDI A;  5LXH A;  4KDL B;  3AI5 A;  3PTF C;  2IY1 B;  1WXV A;  1WGY A;  2KJ6 A;  1TZ1 A;  1AAR A;  3NS8 A;  4LDT B;  3EHV A;  3M63 B;  1GJZ A;  2N9E B;  4GDK B;  4JQW C;  3ZUN A;  4B6W A;  2FCM A;  1ZW7 A;  3PHX B;  1HE8 A;  4DDG D;  1K8R B;  4W9J A;  3VTV A;  1WF9 A;  4TQ1 A;  4GMV A;  3O65 B;  5DCN A;  2RGF A;  1WIA A;  2FIF A;  2N7E A;  4AJY B;  1V2Y A;  1WJ6 A;  2MQJ A;  2FCS A;  3N30 A;  4HJK A;  5D94 A;  1I35 A;  1UZX B;  1GG3 A;  1NDD A;  4RM9 A;  2KX3 A;  4BFR A;  2BGF A;  3H6N A;  3ALB A;  1UBQ A;  4DHZ E;  3V6C B;  3WA0 A;  4NAW A;  4AUQ C;  5L83 A;  1P3Q U;  2V3S A;  4K81 A;  5JZE B;  4FHJ A;  1OEY J;  3L08 A;  2LVP A;  3ZIM A;  5J17 A;  1UH6 A;  4MEM A;  5TR5 A;  3MJW A;  4HDO A;  1S3S G;  2CU1 A;  3A4R A;  2K8B A;  4W9D A;  3KUC B;  3WIM A;  3ZLZ A;  3BY4 B;  3PZD A;  5CHW A;  2N1W A;  3DPD A;  2K1F A;  3WAO A;  4ANU A;  1VD2 A;  2L00 B;  2M8S A;  4CO7 A;  3L54 A;  4KDI C;  3T9L A;  3VH4 B;  1LXD A;  2DAJ A;  2LI5 A;  2C7N B;  4HPL B;  1WM2 A;  2LGX A;  2LJ5 A;  3DVG Y;  4PS8 A;  1Z5S B;  1E7U A;  1V86 A;  2J0M A;  4PS7 A;  1GUA B;  1H4R A;  2DAF A;  4MEL A;  3KYC D;  1OGW A;  3N32 A;  5D7G A;  4ZYN A;  3UGB B;  1KOT A;  1VCB A;  1EF5 A;  3PV1 A;  3EFU A;  3VUW A;  2IO0 B;  1R4N I;  2D10 A;  2O6V D;  3B0A A;  4G11 A;  2PE6 B;  4MM3 A;  4PS3 A;  2BKR B;  4NAW B;  4B95 A;  4AP4 C;  2CKH B;  4GB9 A;  2M17 A;  4HPM B;  3X23 A;  4TQ0 A;  2A4Z A;  2M0X A;  5L95 C;  3PSE B;  4W9L A;  1UEL A;  2K25 A;  3KUZ A;  2DEN B;  2BYV E;  3SDL C;  2NCN A;  3DQV A;  4MGK E;  1WJU A;  3A9K A;  1WRD B;  4JGH B;  2PEA A;  2FUH B;  2Z0D B;  3EEC A;  4II2 B;  3A9J A;  4NQK E;  3DBR I;  4ANX A;  1RRB A;  4E71 A;  1WH3 A;  4DWF A;  5JHB A;  2C9W B;  2MWS B;  1TBE A;  1IPG A;  2KD0 A;  2CHW A;  5DPT A;  1OTR B;  3V62 A;  1WXM A;  1TTN A;  2KX0 A;  4IWO A;  2G45 B;  3ENE A;  3M62 B;  5E6N A;  1WI0 A;  3QA8 A;  2IBI B;  4DK5 A;  3U30 A;  3V6E B;  4F1S A;  4HWI B;  4IUM B;  3AU5 A;  5CHV C;  2JWZ A;  2O2V A;  2CR5 A;  4HK2 A;  4EZK A;  1XQQ A;  3UQB A;  1I42 A;  3QCA A;  4KSK C;  3PRM B;  2GBR A;  3U8Z A;  3R7Q A;  4I6P A;  1WJN A;  4MGZ E;  4EZJ A;  2DZI A;  3WAL A;  4N9F 4;  2LVO A;  3ONS A;  1WE6 A;  3VTW A;  2ZVO A;  2G4D B;  3BIN A;  5BO4 B;  4OVU A;  1S1Q B;  1WZ3 A;  4IG7 B;  3A33 B;  2AL6 A;  2L7R A;  2UWQ A;  2GOW A;  3RZF A;  2W9N A;  3DBL I;  2I1J A;  2FNJ B;  2FID A;  5J2R A;  1Y8R C;  3A9K B;  3SHQ A;  3V61 A;  3W1S A;  5CTR C;  3A9J B;  4F7Z A;  2KLC A;  1EUV B;  2RD0 A;  3LDZ E;  1WX8 A;  1R4M I;  2KVR A;  2QHO A;  4GIV A;  4GXB A;  3RCZ A;  2J0K A;  4AOF A;  2N4F A;  2JUO A;  1WFY A;  1C1Y B;  1PQS A;  1SE9 A;  2KJH B;  2LGD A;  1WY8 A;  2ZJD A;  3DCG A;  2HTH A;  2O2V B;  2O6V A;  3JSV A;  3KH0 A;  4IW0 A;  4WJO A;  2KDE B;  5GMV A;  4ASW C;  4A20 A;  5JHA A;  2R2O A;  3VAW A;  1KM7 A;  4A3P A;  4E3C A;  1IYF A;  3H7S A;  2MP2 A;  3L0W B;  1IP9 A;  4WWP A;  5HKH A;  3KW5 B;  4GGQ A;  3PLV A;  2N7D A;  2NPT A;  4WJQ A;  3IFW B;  2WDT B;  4GDL A;  4K7S A;  1LM8 B;  2AWT A;  3Q3J A;  4FJZ A;  1XT9 B;  2FCN A;  4WJP A;  1EO6 A;  2G4S A;  2L3Z A;  2KJR A;  2KQ7 A;  2DX5 B;  5FR6 A;  1E8X A;  3D32 A;  2LUE A;  2KWV B;  3L17 A;  2JRI B;  3ZVV A;  1J0G A;  4W9F A;  3TJP A;  2KMA A;  4KVG B;  3QX1 A;  3DOW A;  2XEW A;  2KKC A;  3ML8 A;  2GBN A;  3HM3 A;  5E6P A;  1C3T A;  1KJT A;  1YIW A;  3AUL A;  4FHK A;  1QZE A;  2KWC A;  3IG3 A;  4M8N A;  3PHW B;  1V5O A;  3RUI B;  2DYM A;  5KHO A;  4ICV A;  4URK A;  3DVG X;  3KUD B;  5CHF A;  5E6O A;  1WJ4 A;  4YL8 A;  3TCA A;  3PT2 B;  1P9D U;  3VXW A;  4BOZ B;  2JXX A;  2BYF A;  2UYZ B;  3JSV B;  2O6V B;  1WM3 A;  2LAS A;  4DHZ B;  1LQB A;  1Z2M A;  3HIZ A;  1WR6 E;  4KIK A;  2MP2 B;  4MDK E;  2NVU I;  4I6N B;  5IA7 A;  2JT4 B;  3R66 C;  4IM0 A;  2BKF A;  2NPT B;  1U4A A;  3RT3 B;  2K6Q A;  3RZW C;  4GDL B;  4NPN A;  2D07 B;  1YX6 B;  2BPS A;  3ZNZ B;  3EC8 A;  1E7V A;  1XD3 B;  2JPH A;  1WXA A;  2K8C A;  1J8C A;  2CHZ A;  3OJ3 A;  5C23 A;  1V49 A;  3MHS D;  4EUT A;  2KK8 A;  2N9X A;  3TMP B;  4MJS A;  3T8M A;  2KZR A;  3TIX A;  2IYD B;  2MRP A;  4P7I A;  4ZRK A;  2MA9 B;  4X57 B;  4HVB A;  1G6J A;  3L16 A;  3NHE B;  4W9K A;  3VDZ A;  3TBL D;  4G3X B;  3A4S C;  3I3T B;  3H7P A;  1WGR A;  2V1Y A;  3ZTD A;  3L13 A;  4DDI D;  2N1V A;  2PE9 A;  3X0W A;  3ML9 A;  2A5U A;  3S2A A;  4HLE A;  2WYQ A;  1V80 A;  2DHZ A;  3MTN B;  4KZ0 A;  1RFA A;  4MGY E;  2C60 A;  2Z59 B;  2K8H A;  4NJ7 A;  3UF8 A;  2D3G A;  1A5R A;  5AZH A;  1RAX A;  2CHX A;  2NBU A;  5AZG A;  2L76 A;  3KYD D;  4WJN A;  4ICU A;  4ANV A;  2JVC A;  4HXD A;  3N3K B;  1Q0W B;  4EEW A;  3RD2 A;  3L10 B;  3DDC B;  4FUL A;  4KIK B;  3QAR A;  1EF1 A;  1FXT B;  2KTF A;  2KWU B;  3QWZ B;  1E8Y A;  3WAN A;  3W1Y A;  1E5W A;  2ZZP B;  2ZNV B;  4GSW A;  2WX1 A;  2MBB B;  5EDS A;  3H9D A;  1OEY A;  2MBE A;  1ZKH A;  3UIO B;  4XC2 A;  2B3A A;  2GBM A;  2NBV B;  5LLI A;  1UGM A;  4EKU A;  2BWE S;  4MJS B;  1WXS A;  2R2Q A;  2IO2 B;  3APD A;  4E74 A;  2EKE C;  3VFK A;  1MG8 A;  2MBQ A;  2AL3 A;  3AXC A;  2GBK A;  4TV3 A;  2MSE D;  2IO3 B;  3IVF A;  4BKS D;  4EOY A;  1WX9 A;  2JRH A;  3H7P B;  3VUX A;  3ECI A;  1KLV A;  3NY5 A;  4ZRI A;  3ZRC A;  3ZTC A;  3JW0 X;  4MSQ B;  4WAA A;  1T0Y A;  4LJP B;  2BYE A;  2LXA A;  3K9P B;  4MSM B;  2KFK A;  4G0N B;  4XZ4 A;  1WGG A;  3APC A;  2YLM A;  4I6L B;  2M4N A;  5D2M B;  1TGZ B;  1V81 A;  3JVZ X;  4PYU A;  2HD5 B;  3NZU A;  1Q1O A;  3RUL A;  4KZC A;  4EFO A;  3VTU A;  2KDF B;  3QIJ A;  2FCQ A;  4JIO U;  4BOS C;  4GN1 A;  3QHT A;  4MH0 E;  1GC6 A;  2DZK A;  2KLG A;  3QJZ A;  4A3O A;  3VUY A;  1OQY A;  4JLC A;  3ZNI D;  4BKG A;  3HK0 A;  2LRU A;  1YJ1 A;  1SIF A;  3AU4 A;  2G3Q B;  1Q5W B;  1YQB A;  2KXJ A;  2C5L C;  1UBI A; 
#chains in the Genus database with same CATH topology
 5KHQ A;  3E56 A;  4TUU A;  1E90 A;  1SE4 A;  2LXC A;  2REX A;  5G2N A;  3K9O B;  2RDH A;  3HHM A;  2WXR A;  1SJH D;  4FBJ B;  2AQ1 B;  3UIN B;  4R3D A;  1F0Z A;  4ITK A;  4ZDV A;  1L5P A;  3NVZ A;  1N5W A;  4DXF A;  3AE3 B;  4KV2 A;  4P16 A;  2JWU A;  4XX5 A;  3MC9 A;  2DZM A;  4II3 B;  3W1S C;  1NBF C;  2HE7 A;  4HCN B;  4RGN A;  3AE7 B;  2KMC A;  4P1C C;  1QQR A;  2Z0E B;  1N6Z A;  4L1B A;  2KMM A;  3U2S C;  3B2F A;  4HCP B;  2JY6 A;  3Q8E A;  2OOB B;  4JL9 A;  4P1B C;  4WWO A;  4DHJ D;  4Q2J A;  1NI2 A;  4BBN C;  4KX6 B;  3I57 A;  3DVN V;  2ZVN A;  1C4C A;  2BWF A;  4C00 A;  4K7W A;  2WS3 B;  2K6D B;  4TKN A;  3DBS A;  5H92 C;  2VZK D;  1V6E A;  1RM6 C;  2EMT A;  1EWC A;  4MAC A;  4MT5 A;  2K9X A;  2LRW A;  2MLB A;  3AE5 B;  3IAS 1;  3QK0 A;  1GOZ A;  3H1U A;  5BMI A;  4ZRJ A;  2VRR B;  3NVY A;  2QIE B;  4M8M A;  3NJT A;  2L8J A;  1T0S C;  1HEZ E;  3AED B;  3AB5 A;  3P2B A;  2AEH A;  2WWZ A;  2ZCC A;  4GOC A;  1PFD A;  2OJR A;  1K53 A;  2NS5 A;  4RH6 A;  1XLN A;  2UU7 A;  4RNA A;  1SE2 A;  3VRB B;  2KYW A;  2E6X A;  1SBB B;  2B76 B;  2KDB A;  3R7R A;  1WGD A;  3SD5 A;  3AEG B;  3PRZ A;  2SAK A;  3GE8 C;  3GE3 C;  1T3Q A;  4XE0 A;  1D5X C;  1F52 A;  1RFK A;  2LGY A;  1FRR A;  1C9F A;  2MJ3 A;  1KH0 A;  4LNI A;  2BT6 A;  2QC8 A;  1WGY A;  2KJ6 A;  2N9E B;  4B6W A;  2FCM A;  1HE8 A;  1WIA A;  5D3D A;  2MQJ A;  3N30 A;  1UZX B;  4ZHP A;  2KX3 A;  1AYF A;  1UBQ A;  4YTP B;  3V6C B;  1NVI D;  2DWQ A;  2PMV A;  3HRD D;  5J17 A;  5TR5 A;  1E0Z A;  4LNO A;  3NVV A;  4W9D A;  1N63 A;  3BY4 B;  2Y5P A;  1EU3 A;  1FFV A;  1N5X A;  3RNA C;  3WAO A;  1VD2 A;  5C2T B;  4CO7 A;  4M00 A;  1SJE D;  2LI5 A;  3AEA B;  4HPL B;  1MI0 A;  1WM2 A;  2LGX A;  2MJE A;  3MJ5 A;  1TKE A;  4PS8 A;  2X8X X;  1FXA A;  2JYE A;  2YEP B;  4ZYN A;  1FM0 D;  3N32 A;  2IGG A;  4A9A A;  1UWM A;  2IO0 B;  1HZ6 A;  2D3C A;  2O6V D;  2ACZ B;  4OZB A;  1UGJ A;  4G11 A;  2PE6 B;  2BKR B;  3W9C B;  2N7J A;  2J4X A;  4RFB A;  2M17 A;  3OG5 A;  2DEN B;  3AMZ A;  2NCN A;  2QSD A;  3NZ3 A;  4MGK E;  1WRD B;  3EEC A;  4L23 A;  1WH3 A;  4DWF A;  2IPK D;  1UWX A;  4HRO A;  4KKI A;  2L83 A;  3SR6 A;  5DPT A;  1OTR B;  3AV8 A;  4ZOH C;  2INN E;  1JML A;  1QOA A;  2IBI B;  3U30 A;  3V6E B;  4DK5 A;  4IUM B;  2O2V A;  4EZK A;  3UQB A;  1I42 A;  4K3C A;  1C77 A;  3PRM B;  2LEK A;  4I6P A;  4EZJ A;  3AE4 B;  4N9F 4;  1FCL A;  1HQR D;  4IG7 B;  3A33 B;  4N6E B;  2GOW A;  2H89 B;  2I1J A;  2FID A;  1Y8R C;  2RMM A;  3SHQ A;  3W1S A;  4C56 C;  2BS3 B;  5EE9 A;  3LDZ E;  2ZW1 A;  4GXB A;  4AOF A;  3KWL A;  1Q10 A;  2JUO A;  3ZJT A;  1PQS A;  2PIA A;  4WJO A;  5AUK A;  2HTH A;  2O2V B;  2O6V A;  4ASW C;  2KDE B;  4ARI A;  1TY2 A;  1OQQ A;  3L0W B;  1T5X D;  4WWP A;  3DHG C;  4GGQ A;  3ZJU A;  2N7D A;  2WDT B;  4K7S A;  4GDL A;  1XT9 B;  1A70 A;  2KT7 A;  4WUR A;  1EO6 A;  4USA A;  2G4S A;  2OED A;  2L3Z A;  2DX5 B;  2LUE A;  2KWV B;  1J0G A;  3Q8F A;  2CJO A;  2PVO D;  3TJP A;  1D5Z C;  1XCQ L;  3DOW A;  1C3T A;  1KJT A;  3EA6 A;  4FHK A;  3AUL A;  3PO0 A;  2WXM A;  1V5O A;  2DYM A;  4URK A;  4ICV A;  3DVG X;  2FUG 1;  4KKJ A;  5CHF A;  1WJ4 A;  1P9D U;  1PDX A;  5GXG B;  2O6V B;  2LAS A;  4S0R A;  3RPF C;  1T0R C;  1WR6 E;  4RCO A;  1HXY D;  3RT3 B;  4GDL B;  1YX6 B;  1K50 A;  3EC8 A;  2JPH A;  4A6Q A;  2K8C A;  1J8C A;  2EEL A;  2RDB C;  2WU5 B;  2XN9 C;  3MHS D;  3BVM A;  4MJS A;  3TIX A;  2MRP A;  4ZRK A;  1ZXH A;  4X57 B;  4HVB A;  3NHE B;  4W9K A;  3A4S C;  1N61 A;  1WGR A;  5FKA C;  3TEZ A;  4DDI D;  3N1Y C;  4HLE A;  2RDG A;  2WYQ A;  3MTN B;  4MGY E;  2C60 A;  1A5R A;  3UF8 A;  3BWU D;  2DLB A;  2W82 A;  3N1X C;  1RAX A;  2NBU A;  1ZE3 D;  2L76 A;  2JVC A;  3EUB 2;  2JYT A;  1Q0W B;  4S17 A;  4FUL A;  3RNC C;  3QAR A;  3U4E G;  1E8Y A;  3WAN A;  3W1Y A;  2V0G A;  2BTE A;  1IBX A;  3T3N A;  2B3A A;  3PZ8 A;  3VRA B;  1IUE A;  4MJS B;  3VFK A;  2AL3 A;  3VUX A;  1I4Q A;  3ECI A;  2TSS A;  2QJL A;  2INC C;  4XZ4 A;  4H2A A;  2MJD A;  4KGR A;  4LTU A;  2WXI A;  3VTU A;  3QIJ A;  3AE1 B;  1F2R C;  4MH0 E;  2KLG A;  3QJZ A;  1IBX B;  1Q5W B;  1YQB A;  2KXJ A;  2C5L C;  4BBN F;  2IY0 B;  3A1Q A;  4FLH A;  3QQ8 B;  1R4M B;  4BVU C;  5E6J A;  2H88 B;  2NTT A;  5LXI B;  1TS5 A;  1MHH E;  5BMG A;  2EMS A;  1UD7 A;  1UUP A;  1T0Q C;  2LZ6 A;  4JX1 C;  2LD9 A;  1H8C A;  4KSL C;  3PPA A;  3ZW3 A;  4LCD E;  1P1A A;  3VR8 B;  2JZZ A;  4ANW A;  2MW5 A;  4EZL A;  1WX7 A;  1E6E B;  4NJ6 A;  1ZUD 2;  4RGT A;  1TKG A;  2JZP A;  4WWN A;  4NNJ B;  2KO3 A;  3A1Q B;  1M94 A;  5D6J B;  4B0E A;  2I1K A;  5EE3 A;  1QF6 A;  2KFJ A;  1YN5 A;  2J53 A;  1PGA A;  4WIP A;  4IWP A;  4DBG A;  1YNT E;  4M0W A;  3VR9 B;  3ZRF A;  2OJW A;  4C7Y A;  3HUI A;  1ESF A;  3V3X A;  2ZPY A;  1OFF A;  1CK1 A;  4IWQ A;  3APF A;  3I63 C;  1E8W A;  3IT6 B;  3LJ3 A;  3W5U B;  1FNW A;  4FXC A;  2HTM E;  2I2Y A;  2J52 A;  3Q3N C;  2PJH A;  1LFD A;  2LVQ A;  4NQL B;  3GS2 A;  2ZCB A;  3BK2 A;  4TMA B;  4IKG A;  1C4A A;  4OVZ A;  3P4S B;  2WXL A;  3SFD B;  5FR3 A;  2RPQ A;  1DOY A;  4FAD A;  1WZ0 A;  4DXA B;  2ZNV C;  1AW7 A;  4M0W B;  4GDK A;  1BT0 A;  2AYO B;  1WGH A;  2V4L A;  5IKC M;  4DQO C;  3VH3 B;  2ICI A;  2E3T A;  1ZP0 B;  1FPY A;  3C0R B;  3WAP A;  3OJ4 B;  2KQS A;  3JYU A;  2HJ1 A;  4ARC A;  4M02 A;  1P0R A;  2N9P C;  3CMM B;  2DZJ A;  4AWJ A;  3R2T A;  1CMX B;  2LWP A;  5C3J B;  4LNN A;  2L32 A;  4L2Y A;  3NS8 A;  3BK1 A;  4GDK B;  2KN4 A;  3ZUN A;  3PHX B;  4M01 A;  2BBC A;  3VTV A;  1YQ4 B;  4IDI A;  4GMV A;  4LNF A;  1V2Y A;  1WYG A;  5D94 A;  4HJK A;  3B9J A;  3FIL A;  1NDD A;  4BFR A;  2BB5 A;  4ZYS A;  4AUQ C;  5L83 A;  2IGH A;  4K81 A;  2M19 A;  2ZW0 A;  4FHJ A;  2GRI A;  1FXI A;  1QOB A;  4TSS A;  4HDO A;  4OW0 A;  3A4R A;  2K8B A;  3MHZ A;  3WIM A;  2N0S B;  3KUC B;  5CHW A;  2N1W A;  2ONQ A;  4ANU A;  1FO4 A;  1E7P B;  2M8S A;  2BYT A;  3L54 A;  1FRD A;  1LXD A;  3DBH B;  2C7N B;  1PGX A;  4UDU C;  1KTK A;  4PS7 A;  1I4H A;  1H4R A;  2GLS A;  2Y3A A;  1E10 A;  1KOT A;  1VCB A;  3FIL B;  1JWS D;  1EM7 A;  4MM3 A;  4B95 A;  4YTN B;  4AP4 C;  2CKH B;  4GB9 A;  3U7Z A;  4TQ0 A;  1P7E A;  2KVZ A;  5L95 C;  1KF6 B;  3PSE B;  2PKO A;  3DQV A;  4JGH B;  3P1M A;  2Z0D B;  4NQK E;  3RNE C;  4ANX A;  5HI1 A;  2C9W B;  2MWS B;  1IPG A;  3NUH B;  2KX0 A;  1TS3 A;  3ENE A;  2L52 A;  4HWI B;  5CHV C;  3CIR B;  4XWW A;  2GBR A;  3U8Z A;  1WJN A;  3WAL A;  4MM3 B;  2K22 A;  1S1Q B;  2UWQ A;  1F1H A;  1B1Z A;  2LFI A;  3U52 E;  4JWU C;  2LHD A;  3V61 A;  3R8B A;  4NJC A;  4F7Z A;  2X38 A;  2KLC A;  2W3S A;  2QHO A;  2J0K A;  1WFY A;  2KJH B;  2LGD A;  2V3N A;  3N9Y C;  3KH0 A;  1TY0 A;  1GB4 A;  3VAW A;  1IYF A;  4E3C A;  3P42 A;  1STE A;  1IP9 A;  4XDC A;  5HKH A;  3KW5 B;  1VR9 A;  3PLV A;  2NPT A;  3MC0 B;  2LHE A;  2M0A A;  3D32 A;  3ZVV A;  3BVZ A;  2JRI B;  3GZN B;  3QX1 A;  2GI9 A;  3C8Y A;  1FNU A;  1QZE A;  4M8N A;  3BVG A;  3PHW B;  3RUI B;  2WXQ A;  4BOZ B;  2JXX A;  2UYZ B;  2OHF A;  2BVC A;  3Q14 C;  4JE3 B;  1LQB A;  3AEF B;  3HIZ A;  2KQ4 X;  4KIK A;  4MDK E;  4A55 A;  4I6N B;  2JT4 B;  2LJI A;  2NPT B;  3DWM A;  3ZNZ B;  1XD3 B;  1VJK A;  4A90 A;  4EUT A;  2KK8 A;  2N9X A;  1LGR A;  3IXS A;  2IYD B;  2MA9 B;  1XLO A;  3L16 A;  4ACF A;  1QT9 A;  3TBL D;  4G3X B;  3ZTD A;  1DOI A;  2Y5C A;  2PE9 A;  4XWT A;  1OQR A;  1V80 A;  1QLB B;  1RFA A;  2Z59 B;  2K8H A;  5AZH A;  4MH8 A;  3ZXV A;  1R4N B;  1GPX A;  2W54 A;  3L10 B;  3DDC B;  2WXF A;  1YN4 A;  4KIK B;  2KTF A;  3WCQ A;  1PUT A;  2ZNV B;  5EDS A;  3H9D A;  4XC2 A;  3RNB C;  1QKZ A;  5BMH A;  2BWE S;  1XEE A;  2R2Q A;  3DBR B;  5AUI A;  2K3U A;  2MBQ A;  3AXC A;  2MSE D;  2IO3 B;  3IVF A;  4WAF A;  4BKS D;  1N62 A;  1WX9 A;  1F2R I;  3NY5 A;  4ZRI A;  1JWU D;  3ZTC A;  4MSQ B;  3K9P B;  4G0N B;  3RNF C;  1WGG A;  2YLM A;  4I6L B;  1MPE A;  1TGZ B;  1V81 A;  3OWE B;  2W55 A;  4KZC A;  4EFO A;  4NAM A;  3QHT A;  4JLC A;  4BKG A;  3HK0 A;  1PGB A;  2LRU A;  3DBL B;  1SE3 A;  1P7F A;  1I4P A;  2WXP A;  1F9J A;  2EKI A;  3PGE A;  2L05 A;  3IHP C;  3OAW A;  4RF1 A;  1J19 A;  4D2K A;  2M1M A;  1FIQ A;  3IBE A;  1JWB D;  1FD6 A;  3RI7 C;  3BYT B;  3GZN I;  4LK0 M;  4NY0 A;  2JF5 A;  2KNB A;  2YVC A;  4W9C A;  1JAL A;  3HM6 X;  4PYZ A;  4WH4 A;  4FA6 A;  1ISN A;  4AJW A;  2IZV B;  5DPR A;  3SEB A;  2BF8 B;  3CSF A;  3IAM 1;  2DBY A;  2KN5 A;  2ZPN A;  3QC8 B;  2PTL A;  2NR2 A;  4KGT A;  2CS4 A;  4XGA B;  1WMH A;  4LLG M;  3RNG C;  3U7D A;  5LNK 1;  3TL5 A;  3ZDM C;  1WWT A;  1WYW B;  1XF5 L;  3M95 A;  2Z8L A;  4BKS A;  1GC7 A;  2MBH A;  3VHT C;  2FAZ A;  4NZL B;  2HDE A;  3Q8B A;  4OHJ A;  1K51 A;  2PVG C;  4J6I A;  1IGC A;  3ZO5 B;  1XXG A;  2J42 A;  4CQN A;  2MX2 A;  2D2Q A;  4BKT A;  3Q6B A;  1XCT L;  2JZ3 B;  3O13 A;  2XK5 A;  4RM8 A;  2DYB A;  2RPV A;  3B08 A;  1V8C A;  1VRA B;  4K1R B;  1YQ3 B;  4WQO B;  2HJ8 A;  4YSX B;  1WMH B;  1M4V A;  4FJV B;  4HDQ A;  2PLP A;  2MBO A;  4FJY A;  3UIP B;  2DYO A;  2IO1 B;  3AEB B;  2JXT A;  2J7Q B;  4RGO S;  1I7H A;  4FN2 A;  4MGI E;  1FMA D;  4REZ A;  4OVV A;  2C7M B;  3CST A;  3QAQ A;  3C19 A;  1SEB D;  2WQY B;  4W9H A;  1ZGU B;  3WAM A;  3LYY A;  4IM3 A;  3GOE A;  2XK5 B;  3UQA A;  1ENF A;  3PS6 A;  4F8C B;  3AEC B;  4ZRQ A;  4W9I A;  2D11 A;  1J7B A;  3NZS A;  1V5T A;  4HJG E;  5JH5 C;  4K3B A;  1ZPS A;  3PRP B;  3M3J A;  4AQ7 A;  1C76 A;  4KDL B;  3AI5 A;  3PTF C;  2IY1 B;  1WXV A;  1TZ1 A;  1AAR A;  4ZRP A;  4JQW C;  4US9 A;  3AM9 A;  1K8R B;  4JWS C;  4W9J A;  1AN8 A;  4TQ1 A;  3O65 B;  2RGF A;  1TS4 A;  4AJY B;  1WJ6 A;  1I35 A;  1GG3 A;  1ROE A;  4P6V F;  4RM9 A;  1TT5 B;  1B9R A;  2BGF A;  2D5G A;  4DHZ E;  1V1P A;  4NAW A;  2IJ0 A;  3MC8 A;  4N59 A;  2V3S A;  3P4R B;  5JZE B;  1OEY J;  3L08 A;  2LVP A;  2NTS A;  3ZIM A;  2Q5W D;  1UH6 A;  1S3S G;  3PZD A;  1NYR A;  4C4V A;  3RN9 C;  2K1F A;  2L00 B;  3R2I A;  4KDI C;  5BYS A;  2DAJ A;  1Z5S B;  1E7U A;  2J0M A;  1SSN A;  2DAF A;  1OGW A;  3VUW A;  3PV1 A;  3EFU A;  1CQV A;  2AQ2 B;  3TSS A;  2GB1 A;  1L0Y B;  4PS3 A;  1V1P B;  4NAW B;  3HVZ A;  3X23 A;  1FFU A;  2V9H A;  3RFZ B;  4W9L A;  1ET9 A;  5I4D A;  1T6B X;  3Q69 A;  2BYV E;  3SDL C;  1WJU A;  3A9K A;  3V05 A;  1XO3 A;  4II2 B;  3A9J A;  4E71 A;  1L0X B;  1RRB A;  4XDD A;  4C4V B;  1TBE A;  2CHW A;  2WNM A;  3V62 A;  1TTN A;  1ACC A;  5E6N A;  2V3P A;  4RF0 A;  2JWZ A;  1YOV B;  2CR5 A;  3E9S A;  4HK2 A;  3QCA A;  4KSK C;  4BAX A;  1TKY A;  1TZO A;  4MGZ E;  3Q3O C;  2DZI A;  2LVO A;  3VTW A;  2KAC A;  5BO4 B;  4YSZ B;  3RZF A;  4B0M A;  2BQQ A;  2W9N A;  2DNF A;  2AX5 A;  2WXG A;  5J2R A;  1L4D B;  2G9H D;  3A9K B;  1VDV A;  3A9J B;  5CTR C;  2WDV B;  2RD0 A;  1R4M I;  2KVR A;  4GIV A;  2W3R A;  1SIJ A;  4YTM B;  1SE9 A;  4EE2 A;  3JSV A;  1WY8 A;  2ZJD A;  3DCG A;  1JQ4 A;  4IW0 A;  3PZ7 A;  4A20 A;  1WSP A;  2QMT A;  4RGM A;  2MP2 A;  1V1O A;  4WJQ A;  1L0V B;  2BW2 A;  3IFW B;  3P63 A;  3Q3J A;  3NRZ A;  5FK9 C;  2FCN A;  1ZDX A;  1ZXI A;  1WXQ A;  2KJR A;  2PW9 A;  5FR6 A;  1E8X A;  4W9F A;  2KMA A;  3ML8 A;  2KKC A;  1DYQ A;  5E6P A;  3P4Q B;  2KWC A;  5MPO A;  5KHO A;  3KUD B;  3UI3 A;  3TCA A;  3PT2 B;  3VXW A;  1TJE A;  2QEJ C;  3JSV B;  5HFY A;  1JRO A;  1SF0 A;  3B2G A;  1EU4 A;  3RMK C;  1DOX A;  1Z2M A;  2JSV X;  2MP2 B;  2NVU I;  1EWY C;  3R66 C;  3MP9 A;  4IM0 A;  2BKF A;  1U4A A;  3RZW C;  4NPN A;  2D07 B;  1E7V A;  3ZYY X;  1WXA A;  3MFG A;  3IT4 B;  1VZ7 A;  2AQ3 B;  2CHZ A;  5IN7 A;  2INP E;  3TMP B;  2KZR A;  1G6J A;  3VDZ A;  1QOG A;  3I3T B;  3H7P A;  3W5V B;  3ML9 A;  2A5U A;  3S2A A;  2KDM A;  4KZ0 A;  3KQ4 A;  4NJ7 A;  2CHX A;  2ON8 A;  2QDF A;  4WJN A;  4ICU A;  4YWG G;  1ZOY B;  4HXD A;  1HZ5 A;  1JWM D;  4EEW A;  5G5G A;  1NYQ A;  1FXT B;  3QWZ B;  2ZZP B;  1ZKH A;  1BXT A;  3UIO B;  2NBV B;  1I4R A;  2MHJ A;  4EKU A;  3APD A;  2IO2 B;  4E74 A;  5H8Y E;  2EKE C;  1MG8 A;  1XLQ A;  3DWG C;  4EOY A;  3H7P B;  2CU3 A;  1C79 A;  4AS1 A;  4WAA A;  4LJP B;  2LXA A;  2KFK A;  3URY A;  3TEX A;  4HKZ E;  3APC A;  2WXK A;  5D2M B;  1NEK B;  3NZU A;  1KRH A;  3RUL A;  3TEY A;  3LB8 C;  2KDF B;  4QAY A;  2FCQ A;  4JIO U;  3I5J C;  4GN1 A;  4A3O A;  1OQY A;  1YJ1 A;  1SIF A;  3AU4 A;  2G3Q B;  2LMC A;  1UBI A;  2ZEQ A;  2KTR A;  2WP9 B;  2XBB C;  3VQI A;  3ZNH B;  3B1L X;  1L6V A;  5JXV A;  3ZNG C;  1D3Z A;  4LJO B;  3OLM D;  5CX3 A;  5C1Z A;  2D3A A;  4B9K A;  2KFK B;  5AEK B;  2MCN B;  3ABV B;  2KHW B;  3DVN U;  2RR9 A;  3Q3F A;  4HPP A;  2KOX A;  1PYW D;  4DHJ B;  4LDT D;  2N9L A;  2WXH A;  1NI3 A;  3DBH I;  1RWS A;  1YX5 B;  2PPH A;  4RMA A;  1I4X A;  5J18 A;  2KTR B;  2GMI C;  2VZK B;  4C80 A;  2GBJ A;  1RYJ A;  1JRU A;  1SGH A;  2BS2 B;  1WR1 A;  3KVF B;  2L0F A;  2KC2 A;  1BML C;  3ZKJ C;  3ZXR A;  3N20 C;  3TUO A;  1D5M C;  1RLF A;  2L0T A;  2WX0 A;  3H8H A;  3CF6 E;  3PLU A;  1VZ6 A;  4XYC A;  2LGS A;  5AZF A;  3RYT A;  4DXG A;  1P98 A;  1L2N A;  2NBW B;  1V9J A;  1E8Z A;  4OZA A;  1YJI A;  2KWD A;  5IAA C;  2KC1 A;  4W9E A;  1X1M A;  1KLU D;  2Y5B B;  4W9G A;  4G50 A;  1FEH A;  4YT0 B;  2L1A A;  5DPS A;  1L7Y A;  1F77 A;  1HTO A;  1JRP A;  2FE8 A;  2IND C;  4IC7 B;  2J0J A;  1WRI A;  1VZ8 A;  4CYE A;  3V60 A;  1YD8 U;  2VH1 A;  3SU8 X;  5DPW A;  1KFY B;  3AEE B;  5G55 A;  3P4P B;  3PVL A;  1BUI C;  1MJD A;  3R3M A;  1SB3 C;  3VVW B;  3NOB A;  2QCZ A;  1ZDV A;  2ASQ A;  4GU2 A;  2K39 A;  2RSU A;  3ZDT A;  4K7U A;  3Q8A A;  1SXT A;  1HA5 A;  3BZD B;  3PRE A;  2KAN A;  1MHX A;  4GLS C;  4CHK A;  2MH7 A;  2WU2 B;  2C7H A;  1C4P A;  1WE7 A;  3BII D;  4IM2 A;  5HHD G;  1GNU A;  1YMH E;  3HVD A;  3NG0 A;  3GP7 A;  2KDI A;  5LXH A;  3NVW A;  2KAJ A;  3AE2 B;  1CJE A;  4YSY B;  1R7S A;  2K0P A;  3ZJV A;  4LDT B;  3EHV A;  3M63 B;  1GJZ A;  1JW9 D;  1ZW7 A;  4DDG D;  5IP4 D;  1WF9 A;  1JWA D;  2JX5 A;  3Q8C A;  5DCN A;  2FIF A;  2N7E A;  4YXD B;  2FCS A;  4JPS A;  1UF0 A;  3H6N A;  4IOI E;  2I38 A;  3ALB A;  2YEP F;  3DHH C;  3WA0 A;  1AWD A;  2D3B A;  4PK1 A;  1P3Q U;  1N60 A;  2IGD A;  3SFE B;  4MEM A;  3MJW A;  3ETR A;  1MVK A;  2CU1 A;  4WQM A;  3ZLZ A;  3AE6 B;  3DPD A;  4US8 A;  1QIL A;  2BB6 A;  1C78 A;  3T9L A;  3VH4 B;  2LJ5 A;  1D4B A;  3DVG Y;  1V86 A;  3ZQ4 A;  1GUA B;  4MEL A;  1TS2 A;  3KYC D;  5D7G A;  3UGB B;  1L6U A;  1EF5 A;  1NEN B;  3AN1 A;  1R4N I;  2D10 A;  3B0A A;  2SEB D;  4HPM B;  4J3O D;  2A4Z A;  1LO5 D;  2M0X A;  1GAQ B;  1UEL A;  2K25 A;  3KUZ A;  4O1N A;  2PEA A;  2FUH B;  1QOF A;  3DBR I;  4KGS A;  5T8I A;  5JHB A;  1TIF A;  2KD0 A;  2WXO A;  1WXM A;  4OZC A;  4IWO A;  1JCK B;  2G45 B;  1YJJ A;  3M62 B;  1WI0 A;  2MEK A;  3QA8 A;  4F1S A;  3L4P A;  3GB1 A;  3AU5 A;  5IO9 A;  2WXN A;  4A8X C;  1XQQ A;  3R7Q A;  5D3I B;  1IGD A;  4HKQ A;  1ET6 A;  3ONS A;  1WE6 A;  3I9V 1;  2ZVO A;  2G4D B;  3BIN A;  4OVU A;  4WWM A;  1WZ3 A;  2AL6 A;  2L7R A;  3J9C A;  1J7C A;  1KLG D;  3DBL I;  2FBW B;  5EE1 A;  2FNJ B;  3BYY B;  5TSS A;  2N9K A;  1EUV B;  3DHI C;  1WX8 A;  3RCZ A;  1Y56 A;  2WGS A;  5EE0 A;  3Q2A C;  2N4F A;  2QIL A;  4LNK A;  1C1Y B;  3ZGZ A;  3N1Z C;  1FCC C;  1I4G A;  3EGR A;  5GMV A;  1CZP A;  5JHA A;  2R2O A;  3AH7 A;  1KM7 A;  4A3P A;  3H7S A;  3FKY A;  3FAH A;  1LM8 B;  2AWT A;  4FJZ A;  2LUM A;  4WJP A;  2KQ7 A;  5BYR A;  3L17 A;  2CJN A;  1MG4 A;  4KVG B;  2WHI A;  2XEW A;  2GBN A;  3HM3 A;  1V97 A;  1YIW A;  3IG3 A;  2WDR B;  3FC4 A;  1XLP A;  5E6O A;  4YL8 A;  2WLB A;  1J7A A;  2BYF A;  2M56 B;  1WM3 A;  1DGJ A;  4DHZ B;  3TEW A;  1L4Z B;  5IA7 A;  4ZHO A;  1HTQ A;  2K6Q A;  2BPS A;  5G5H A;  3OJ3 A;  1UNS A;  5C23 A;  1V49 A;  1MFW A;  3T8M A;  2K5P A;  1YN3 A;  4P7I A;  2VH2 A;  5IOI A;  2V1Y A;  5BYQ A;  3L13 A;  2N1V A;  3X0W A;  2R61 A;  3AE9 B;  2DHZ A;  4C7Z A;  2XNA C;  2D3G A;  5AZG A;  3EFC A;  2LGI A;  3KYD D;  4ANV A;  2WDQ B;  4N58 A;  3N3K B;  3RD2 A;  1FNV A;  1EF1 A;  2KWU B;  3KLS X;  1E5W A;  2V4I B;  4GSW A;  2G1E A;  2MBB B;  2WX1 A;  1OEY A;  5HG2 A;  2MBE A;  2NMQ A;  2GBM A;  5LLI A;  3KWV A;  1UGM A;  3NS1 A;  1WXS A;  1VLB A;  3W2D A;  2GBK A;  4TV3 A;  1WGK A;  2JRH A;  1KLV A;  3ZRC A;  2WXJ A;  4PT5 A;  3JW0 X;  1T0Y A;  2BYE A;  3CWI A;  3AE8 B;  4MSM B;  1TYG B;  2JQR B;  4BZA A;  2M4N A;  3JVZ X;  4PYU A;  4HEA 1;  2HD5 B;  3T3O A;  1K52 A;  1GB1 A;  1Q1O A;  2JU6 X;  2BS4 B;  4BOS C;  1E9M A;  1GC6 A;  2DZK A;  2IDY A;  3VUY A;  3ZNI D;  3LXF A;  1D6E C;  4HRS A;  3Q3M C; 
#chains in the Genus database with same CATH homology
 1F9J A;  2ZEQ A;  4BBN F;  2KTR A;  2XBB C;  5KHQ A;  2IY0 B;  1E90 A;  3PGE A;  4TUU A;  2L05 A;  3A1Q A;  4FLH A;  3QQ8 B;  3VQI A;  3ZNH B;  2LXC A;  3IHP C;  3OAW A;  1J19 A;  2M1M A;  3B1L X;  3IBE A;  4BVU C;  2REX A;  5G2N A;  3K9O B;  3HHM A;  5LXI B;  3ZNG C;  1D3Z A;  3GZN I;  2EMS A;  4FBJ B;  1UD7 A;  4LJO B;  4NY0 A;  3OLM D;  5CX3 A;  2LZ6 A;  5C1Z A;  2JF5 A;  3UIN B;  2KNB A;  2LD9 A;  4B9K A;  2KFK B;  5AEK B;  4KSL C;  1H8C A;  2YVC A;  4W9C A;  3HM6 X;  3PPA A;  2MCN B;  3ZW3 A;  4ZDV A;  2KHW B;  3DVN U;  2RR9 A;  1P1A A;  3Q3F A;  4LCD E;  2JZZ A;  2KOX A;  4PYZ A;  4FA6 A;  4ANW A;  1ISN A;  2MW5 A;  4KV2 A;  4AJW A;  2IZV B;  5DPR A;  4DHJ B;  2BF8 B;  4LDT D;  4EZL A;  1WX7 A;  3CSF A;  2KN5 A;  4NJ6 A;  2ZPN A;  4XX5 A;  3QC8 B;  2NR2 A;  2DZM A;  3DBH I;  2CS4 A;  4II3 B;  1WMH A;  3W1S C;  1YX5 B;  1NBF C;  2HE7 A;  4HCN B;  3U7D A;  4WWN A;  2PPH A;  3TL5 A;  4NNJ B;  4RMA A;  3ZDM C;  2KO3 A;  1WYW B;  2KMC A;  3M95 A;  5J18 A;  4BKS A;  1GC7 A;  2KTR B;  2GMI C;  2MBH A;  3A1Q B;  1M94 A;  2Z0E B;  2GBJ A;  5D6J B;  3VHT C;  2FAZ A;  2I1K A;  4DHJ D;  1JRU A;  2JY6 A;  4HCP B;  2OOB B;  1SGH A;  4JL9 A;  1WR1 A;  3KVF B;  4WWO A;  2KFJ A;  1NI2 A;  2L0F A;  2KC2 A;  4BBN C;  4J6I A;  3ZKJ C;  3DVN V;  3ZO5 B;  2ZVN A;  2BWF A;  4K7W A;  2MX2 A;  2K6D B;  1RLF A;  2D2Q A;  2L0T A;  2WX0 A;  4TKN A;  3DBS A;  4IWP A;  4BKT A;  1V6E A;  4DBG A;  3CF6 E;  3PLU A;  2JZ3 B;  5AZF A;  2XK5 A;  3ZRF A;  2EMT A;  3RYT A;  4RM8 A;  2DYB A;  1P98 A;  1L2N A;  3B08 A;  2NBW B;  2LRW A;  2ZPY A;  1V9J A;  4K1R B;  2MLB A;  4WQO B;  1E8Z A;  2HJ8 A;  1WMH B;  4FJV B;  4HDQ A;  2KC1 A;  4IWQ A;  4W9E A;  1X1M A;  5IAA C;  2Y5B B;  4W9G A;  2MBO A;  3APF A;  4G50 A;  1E8W A;  4FJY A;  3QK0 A;  3H1U A;  3LJ3 A;  3UIP B;  2DYO A;  2IO1 B;  5DPS A;  1L7Y A;  4ZRJ A;  2VRR B;  4M8M A;  2J7Q B;  2PJH A;  4IC7 B;  1LFD A;  2J0J A;  2LVQ A;  4NQL B;  2L8J A;  4FN2 A;  2ZCB A;  4MGI E;  4CYE A;  3V60 A;  1YD8 U;  4OVV A;  3P2B A;  2C7M B;  3SU8 X;  5DPW A;  3CST A;  2AEH A;  2WWZ A;  3QAQ A;  2RPQ A;  2ZCC A;  5G55 A;  4FAD A;  3PVL A;  1WZ0 A;  4GOC A;  4DXA B;  4W9H A;  1ZGU B;  2ZNV C;  3WAM A;  3R3M A;  2OJR A;  4M0W B;  2NS5 A;  4GDK A;  1BT0 A;  4IM3 A;  3VVW B;  3NOB A;  2AYO B;  3GOE A;  2XK5 B;  1WGH A;  2V4L A;  2ASQ A;  4GU2 A;  3UQA A;  3PS6 A;  2K39 A;  4F8C B;  2RSU A;  3ZDT A;  3VH3 B;  4K7U A;  3PRE A;  2KAN A;  3C0R B;  4W9I A;  2D11 A;  4CHK A;  2KDB A;  3NZS A;  3R7R A;  1WGD A;  3SD5 A;  3WAP A;  3PRZ A;  1V5T A;  2C7H A;  1WE7 A;  4IM2 A;  3OJ4 B;  2KQS A;  3JYU A;  1GNU A;  1P0R A;  2N9P C;  3CMM B;  2DZJ A;  4AWJ A;  5JH5 C;  3PRP B;  3M3J A;  1CMX B;  2LWP A;  2LGY A;  2KDI A;  5LXH A;  4KDL B;  3AI5 A;  3PTF C;  2IY1 B;  1WXV A;  1WGY A;  2KJ6 A;  1TZ1 A;  1AAR A;  3NS8 A;  4LDT B;  3EHV A;  3M63 B;  1GJZ A;  2N9E B;  4GDK B;  4JQW C;  3ZUN A;  4B6W A;  2FCM A;  1ZW7 A;  3PHX B;  1HE8 A;  4DDG D;  1K8R B;  4W9J A;  3VTV A;  1WF9 A;  4TQ1 A;  4GMV A;  3O65 B;  5DCN A;  2RGF A;  1WIA A;  2FIF A;  2N7E A;  4AJY B;  1V2Y A;  1WJ6 A;  2MQJ A;  2FCS A;  3N30 A;  4HJK A;  5D94 A;  1I35 A;  1UZX B;  1GG3 A;  1NDD A;  4RM9 A;  2KX3 A;  4BFR A;  2BGF A;  3H6N A;  3ALB A;  1UBQ A;  4DHZ E;  3V6C B;  3WA0 A;  4NAW A;  4AUQ C;  5L83 A;  1P3Q U;  2V3S A;  4K81 A;  5JZE B;  4FHJ A;  1OEY J;  3L08 A;  2LVP A;  3ZIM A;  5J17 A;  1UH6 A;  4MEM A;  5TR5 A;  3MJW A;  4HDO A;  1S3S G;  2CU1 A;  3A4R A;  2K8B A;  4W9D A;  3KUC B;  3WIM A;  3ZLZ A;  3BY4 B;  3PZD A;  5CHW A;  2N1W A;  3DPD A;  2K1F A;  3WAO A;  4ANU A;  1VD2 A;  2L00 B;  2M8S A;  4CO7 A;  3L54 A;  4KDI C;  3T9L A;  3VH4 B;  1LXD A;  2DAJ A;  2LI5 A;  2C7N B;  4HPL B;  1WM2 A;  2LGX A;  2LJ5 A;  3DVG Y;  4PS8 A;  1Z5S B;  1E7U A;  1V86 A;  2J0M A;  4PS7 A;  1GUA B;  1H4R A;  2DAF A;  4MEL A;  3KYC D;  1OGW A;  3N32 A;  5D7G A;  4ZYN A;  3UGB B;  1KOT A;  1VCB A;  1EF5 A;  3PV1 A;  3EFU A;  3VUW A;  2IO0 B;  1R4N I;  2D10 A;  2O6V D;  3B0A A;  4G11 A;  2PE6 B;  4MM3 A;  4PS3 A;  2BKR B;  4NAW B;  4B95 A;  4AP4 C;  2CKH B;  4GB9 A;  2M17 A;  4HPM B;  3X23 A;  4TQ0 A;  2A4Z A;  2M0X A;  5L95 C;  3PSE B;  4W9L A;  1UEL A;  2K25 A;  3KUZ A;  2DEN B;  2BYV E;  3SDL C;  2NCN A;  3DQV A;  4MGK E;  1WJU A;  3A9K A;  1WRD B;  4JGH B;  2PEA A;  2FUH B;  2Z0D B;  3EEC A;  4II2 B;  3A9J A;  4NQK E;  3DBR I;  4ANX A;  1RRB A;  4E71 A;  1WH3 A;  4DWF A;  5JHB A;  2C9W B;  2MWS B;  1TBE A;  1IPG A;  2KD0 A;  2CHW A;  5DPT A;  1OTR B;  3V62 A;  1WXM A;  1TTN A;  2KX0 A;  4IWO A;  2G45 B;  3ENE A;  3M62 B;  5E6N A;  1WI0 A;  3QA8 A;  2IBI B;  4DK5 A;  3U30 A;  3V6E B;  4F1S A;  4HWI B;  4IUM B;  3AU5 A;  5CHV C;  2JWZ A;  2O2V A;  2CR5 A;  4HK2 A;  4EZK A;  1XQQ A;  3UQB A;  1I42 A;  3QCA A;  4KSK C;  3PRM B;  2GBR A;  3U8Z A;  3R7Q A;  4I6P A;  1WJN A;  4MGZ E;  4EZJ A;  2DZI A;  3WAL A;  4N9F 4;  2LVO A;  3ONS A;  1WE6 A;  3VTW A;  2ZVO A;  2G4D B;  3BIN A;  5BO4 B;  4OVU A;  1S1Q B;  1WZ3 A;  4IG7 B;  3A33 B;  2AL6 A;  2L7R A;  2UWQ A;  2GOW A;  3RZF A;  2W9N A;  3DBL I;  2I1J A;  2FNJ B;  2FID A;  5J2R A;  1Y8R C;  3A9K B;  3SHQ A;  3V61 A;  3W1S A;  5CTR C;  3A9J B;  4F7Z A;  2KLC A;  1EUV B;  2RD0 A;  3LDZ E;  1WX8 A;  1R4M I;  2KVR A;  2QHO A;  4GIV A;  4GXB A;  3RCZ A;  2J0K A;  4AOF A;  2N4F A;  2JUO A;  1WFY A;  1C1Y B;  1PQS A;  1SE9 A;  2KJH B;  2LGD A;  1WY8 A;  2ZJD A;  3DCG A;  2HTH A;  2O2V B;  2O6V A;  3JSV A;  3KH0 A;  4IW0 A;  4WJO A;  2KDE B;  5GMV A;  4ASW C;  4A20 A;  5JHA A;  2R2O A;  3VAW A;  1KM7 A;  4A3P A;  4E3C A;  1IYF A;  3H7S A;  2MP2 A;  3L0W B;  1IP9 A;  4WWP A;  5HKH A;  3KW5 B;  4GGQ A;  3PLV A;  2N7D A;  2NPT A;  4WJQ A;  3IFW B;  2WDT B;  4GDL A;  4K7S A;  1LM8 B;  2AWT A;  3Q3J A;  4FJZ A;  1XT9 B;  2FCN A;  4WJP A;  1EO6 A;  2G4S A;  2L3Z A;  2KJR A;  2KQ7 A;  2DX5 B;  5FR6 A;  1E8X A;  3D32 A;  2LUE A;  2KWV B;  3L17 A;  2JRI B;  3ZVV A;  1J0G A;  4W9F A;  3TJP A;  2KMA A;  4KVG B;  3QX1 A;  3DOW A;  2XEW A;  2KKC A;  3ML8 A;  2GBN A;  3HM3 A;  5E6P A;  1C3T A;  1KJT A;  1YIW A;  3AUL A;  4FHK A;  1QZE A;  2KWC A;  3IG3 A;  4M8N A;  3PHW B;  1V5O A;  3RUI B;  2DYM A;  5KHO A;  4ICV A;  4URK A;  3DVG X;  3KUD B;  5CHF A;  5E6O A;  1WJ4 A;  4YL8 A;  3TCA A;  3PT2 B;  1P9D U;  3VXW A;  4BOZ B;  2JXX A;  2BYF A;  2UYZ B;  3JSV B;  2O6V B;  1WM3 A;  2LAS A;  4DHZ B;  1LQB A;  1Z2M A;  3HIZ A;  1WR6 E;  4KIK A;  2MP2 B;  4MDK E;  2NVU I;  4I6N B;  5IA7 A;  2JT4 B;  3R66 C;  4IM0 A;  2BKF A;  2NPT B;  1U4A A;  3RT3 B;  2K6Q A;  3RZW C;  4GDL B;  4NPN A;  2D07 B;  1YX6 B;  2BPS A;  3ZNZ B;  3EC8 A;  1E7V A;  1XD3 B;  2JPH A;  1WXA A;  2K8C A;  1J8C A;  2CHZ A;  3OJ3 A;  5C23 A;  1V49 A;  3MHS D;  4EUT A;  2KK8 A;  2N9X A;  3TMP B;  4MJS A;  3T8M A;  2KZR A;  3TIX A;  2IYD B;  2MRP A;  4P7I A;  4ZRK A;  2MA9 B;  4X57 B;  4HVB A;  1G6J A;  3L16 A;  3NHE B;  4W9K A;  3VDZ A;  3TBL D;  4G3X B;  3A4S C;  3I3T B;  3H7P A;  1WGR A;  2V1Y A;  3ZTD A;  3L13 A;  4DDI D;  2N1V A;  2PE9 A;  3X0W A;  3ML9 A;  2A5U A;  3S2A A;  4HLE A;  2WYQ A;  1V80 A;  2DHZ A;  3MTN B;  4KZ0 A;  1RFA A;  4MGY E;  2C60 A;  2Z59 B;  2K8H A;  4NJ7 A;  3UF8 A;  2D3G A;  1A5R A;  5AZH A;  1RAX A;  2CHX A;  2NBU A;  5AZG A;  2L76 A;  3KYD D;  4WJN A;  4ICU A;  4ANV A;  2JVC A;  4HXD A;  3N3K B;  1Q0W B;  4EEW A;  3RD2 A;  3L10 B;  3DDC B;  4FUL A;  4KIK B;  3QAR A;  1EF1 A;  1FXT B;  2KTF A;  2KWU B;  3QWZ B;  1E8Y A;  3WAN A;  3W1Y A;  1E5W A;  2ZZP B;  2ZNV B;  4GSW A;  2WX1 A;  2MBB B;  5EDS A;  3H9D A;  1OEY A;  2MBE A;  1ZKH A;  3UIO B;  4XC2 A;  2B3A A;  2GBM A;  2NBV B;  5LLI A;  1UGM A;  4EKU A;  2BWE S;  4MJS B;  1WXS A;  2R2Q A;  2IO2 B;  3APD A;  4E74 A;  2EKE C;  3VFK A;  1MG8 A;  2MBQ A;  2AL3 A;  3AXC A;  2GBK A;  4TV3 A;  2MSE D;  2IO3 B;  3IVF A;  4BKS D;  4EOY A;  1WX9 A;  2JRH A;  3H7P B;  3VUX A;  3ECI A;  1KLV A;  3NY5 A;  4ZRI A;  3ZRC A;  3ZTC A;  3JW0 X;  4MSQ B;  4WAA A;  1T0Y A;  4LJP B;  2BYE A;  2LXA A;  3K9P B;  4MSM B;  2KFK A;  4G0N B;  4XZ4 A;  1WGG A;  3APC A;  2YLM A;  4I6L B;  2M4N A;  5D2M B;  1TGZ B;  1V81 A;  3JVZ X;  4PYU A;  2HD5 B;  3NZU A;  1Q1O A;  3RUL A;  4KZC A;  4EFO A;  3VTU A;  2KDF B;  3QIJ A;  2FCQ A;  4JIO U;  4BOS C;  4GN1 A;  3QHT A;  4MH0 E;  1GC6 A;  2DZK A;  2KLG A;  3QJZ A;  4A3O A;  3VUY A;  1OQY A;  4JLC A;  3ZNI D;  4BKG A;  3HK0 A;  2LRU A;  1YJ1 A;  1SIF A;  3AU4 A;  2G3Q B;  1Q5W B;  1YQB A;  2KXJ A;  2C5L C;  1UBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...