3W1SC

Crystal structure of saccharomyces cerevisiae atg12-atg5 conjugate bound to the n-terminal domain of atg16
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
76
Chain Sequence
IQKIQIKFQPIGSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Ligase
molecule keywords Autophagy protein 5
total genus 20
structure length 76
sequence length 86
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1sC00
1OEYJ 4MSMB 2YVCA 3X23A 2G4SA 4GOCA 4WWNA 2NPTA 4IM0A 2FIFA 2DZKA 3L10B 2L00B 4CYEA 4HPLB 4ICVA 2DAFA 1TZ1A 1E5WA 2CS4A 2KDIA 1V9JA 2KXJA 2LGYA 1K8RB 3SDLC 2WYQA 4F7ZA 1IP9A 1YD8U 2DHZA 4FN2A 4DWFA 1SE9A 5CX3A 2KN5A 3VTUA 3W1SA 2KLGA 1UZXB 2K39A 2MBQA 4OVVA 3H7SA 3UQBA 2N7EA 4BKGA 2GOWA 4X57B 4AOFA 3CF6E 4DHJD 5IA7A 1GNUA 4KDIC 2MA9B 4XC2A 2O2VA 4KIKB 4WWPA 5CHWA 2AWTA 4MGYE 2I1KA 2KVRA 3QA8A 2GBKA 5TR5A 2KOXA 3V6EB 2FCNA 2GBMA 4ICUA 4HWIB 2LJ5A 4FULA 4URKA 1I35A 2L05A 5D7GA 4TV3A 4W9CA 3DQVA 3DVGY 1H8CA 2NS5A 4ZYNA 4GDKB 2KX0A 3ZDMC 1Z2MA 1S1QB 2LRUA 3QHTA 3JW0X 3ZNHB 2J7QB 2AL6A 1V2YA 1V86A 3A9JB 4HLEA 3PGEA 4HVBA 3TJPA 1ZKHA 4A20A 2NVUI 2BWES 4NAWB 3UQAA 1P0RA 1XQQA 1WGRA 3VTWA 2O2VB 4IG7B 2ZCCA 3PVLA 3KUCB 1WR6E 3VQIA 4W9KA 1OQYA 3RZWC 4WQOB 3ZRCA 2KKCA 3MHSD 3NY5A 2ZZPB 4MGIE 4W9IA 4ANXA 3RCZA 4DBGA 4LCDE 3JYUA 1V81A 3T8MA 2KMAA 3WANA 3HM6X 3A33B 2K8BA 2K8HA 1E8XA 2KDFB 4GDLB 3TBLD 3WALA 1WGDA 1WYWB 4AWJA 4W9GA 5LXHA 3KUZA 3O65B 3BINA 2AEHA 4J6IA 1WY8A 2K25A 2JPHA 4WAAA 4I6PA 1RFAA 5CHFA 1Q1OA 2PEAA 2I1JA 1PQSA 4HK2A 1WE7A 2KO3A 3DVNV 4RM9A 3DCGA 3APFA 2JZZA 2LD9A 3PV1A 5C23A 2N1VA 5C1ZA 2N4FA 2ZVNA 1OEYA 2ASQA 4GU2A 4EKUA 4LJPB 4PS7A 2A4ZA 2HTHA 1E7VA 2ZCBA 2LVOA 1WJUA 2NBVB 2KMCA 1YIWA 2WDTB 4NPNA 4HDQA 2NBWB 3QQ8B 4F1SA 2KTFA 4MGZE 3QARA 4W9JA 4I6NB 2MBBB 3C0RB 3UINB 1IPGA 3VTVA 3PT2B 4AJYB 1WE6A 1P9DU 3VUYA 4ZDVA 3QC8B 4KVGB 3A9KB 1WZ0A 1WF9A 1GJZA 2IO3B 4MSQB 1S3SG 3K9PB 1QZEA 3DDCB 2MP2A 1ISNA 2MW5A 3ALBA 1WFYA 2D10A 4E3CA 5G55A 1WGGA 1EF1A 4EZKA 2N9XA 4RM8A 2Z59B 3LJ3A 3VH4B 2LRWA 4HPMB 1R4NI 4PYZA 3L17A 4MH0E 3WAOA 3AU5A 2YLMA 3PRMB 4XZ4A 3D32A 2HD5B 3DOWA 3ZLZA 1Z5SB 2C9WB 3RUIB 4BVUC 4A3OA 5BO4B 1WXSA 2M17A 2KJ6A 2PE6B 2R2OA 3PLUA 5LXIB 5HKHA 4II2B 1E8YA 4IWQA 2NPTB 1WRDB 2CHZA 3V61A 3NZSA 3QIJA 1YX6B 3TIXA 3VUWA 3Q3FA 1WM3A 3ZTDA 1TBEA 4G50A 3CMMB 4FJYA 3L08A 1ZW7A 4DDGD 5JZEB 1V5TA 5JHAA 3B0AA 1V6EA 3APDA 4JLCA 3PTFC 2OJRA 1LQBA 3HM3A 3N3KB 4TKNA 2WX1A 2RGFA 2BF8B 2FNJB 2LGXA 2M1MA 3VVWB 1BT0A 3PPAA 4MELA 4BKSA 2DYMA 3L13A 3NOBA 2J0KA 2K8CA 2VRRB 4EOYA 1UBQA 2HE7A 3ZNZB 3GOEA 3PHWB 2DYOA 1GG3A 2KWVB 2MLBA 5E6OA 4WJOA 1WMHB 2UWQA 4AP4C 4ANUA 4JQWC 3VHTC 5AEKB 2MWSB 4TUUA 3DBSA 3IBEA 3PRPB 4EFOA 3PS6A 4WJPA 3ZKJC 4EZJA 3NZUA 2C60A 3MTNB 2V4LA 4DK5A 3M3JA 3VXWA 1WXAA 1VCBA 4G11A 2LXCA 2V3SA 3A1QB 4RMAA 1E8WA 3AU4A 3U30A 3A4SC 1RRBA 2G45B 3DBRI 2KWUB 1J8CA 2CHWA 4KDLB 1WXVA 2KTRA 4FJVB 4KV2A 1WI0A 2DENB 3L54A 3U8ZA 4K81A 1CMXB 1WR1A 3T9LA 3APCA 1RLFA 2A5UA 4IC7B 1V5OA 2MP2B 4BKTA 4HDOA 3DBHI 2ZPNA 3ML8A 5IAAC 3K9OB 3UIPB 3CSTA 3H7PB 2LGDA 3UGBB 3VFKA 2Z0EB 5D2MB 2L7RA 4OVUA 3WAMA 3WIMA 2LWPA 3L16A 2IYDB 1OGWA 3OAWA 1NI2A 2MRPA 4NNJB 4KIKA 2AL3A 4FLHA 4NJ6A 3ZO5B 1GC6A 2IY1B 2K1FA 5J2RA 1LM8B 3HIZA 1G6JA 3I3TB 1J0GA 4GSWA 1XT9B 4B95A 2C5LC 2FCQA 1M94A 1VD2A 1WGHA 5KHOA 5DPTA 1I42A 4E71A 4MM3A 1WX7A 4FJZA 3RZFA 3H9DA 1FXTB 5GMVA 3WAPA 3PHXB 1UD7A 4NQKE 3AXCA 2MSED 3ECIA 5AZHA 2L3ZA 3A9JA 4ZRIA 1WGYA 2KFJA 4EUTA 5G2NA 4TQ0A 5AZGA 1TTNA 3PLVA 3ZNGC 1U4AA 4IW0A 1YX5B 2V1YA 3ENEA 2KX3A 4IWOA 2RD0A 3ZTCA 2C7HA 1HE8A 2AYOB 1T0YA 2NBUA 3IHPC 4JGHB 1C3TA 2ZVOA 1WJNA 1LFDA 2DZJA 4IUMB 2G4DB 4F8CB 1EO6A 2EMTA 2JVCA 2HJ8A 3S2AA 2JY6A 2O6VA 4W9EA 3UIOB 4ZRJA 2XK5B 4BBNC 1EF5A 2BKRB 3EHVA 4FADA 3HHMA 4GB9A 4KSKC 1KOTA 3SD5A 2D2QA 2LVPA 3V6CB 4DDID 2OOBB 2WX0A 4A3PA 1R4MI 1LXDA 1NDDA 4M8MA 1TGZB 4GN1A 3ZNID 4BKSD 2KC1A 1JRUA 2FCSA 2B3AA 2JF5A 4KZ0A 4HJKA 3JVZX 3HK0A 3KYDD 3PREA 2BYEA 4B6WA 1E7UA 5EDSA 2EMSA 1NBFC 2G3QB 2CHXA 2L8JA 5D6JB 3TMPB 4ANVA 3QAQA 1UH6A 1WIAA 2GBNA 3H7PA 4WWOA 3ZW3A 4FBJB 2MX2A 2CR5A 2GBRA 4DHJB 2KHWB 1YJ1A 4BOZB 2J0JA 2NR2A 2LVQA 2JRIB 1F9JA 4B9KA 3ZUNA 1L7YA 2O6VD 2Z0DB 2KC2A 4IWPA 2DAJA 2LASA 2IY0B 1GUAB 2KFKB 3DBLI 3EFUA 4ZRKA 3ZIMA 5DPRA 3VDZA 3N30A 2JRHA 3LDZE 5J18A 4E74A 2N9EB 2IO0B 5CTRC 2KQ7A 2GMIC 3ZVVA 3OLMD 2L0FA 3ONSA 3R7QA 5E6PA 5L95C 2BYFA 4M8NA 1YQBA 3QWZB 4G3XB 3SU8X 5FR6A 2ZEQA 1A5RA 1SGHA 1P3QU 4HCNB 2RPQA 5D94A 3CSFA 4AUQC 1KLVA 2D11A 4GIVA 2K6DB 1WMHA 3JSVB 4HCPB 3W1YA 2N1WA 4LJOB 4W9HA 1Q0WB 2IBIB 4K7SA 4MDKE 2N9PC 4HXDA 3OJ3A 4GDLA 3EC8A 3X0WA 4K1RB 4K7UA 1KJTA 5DPSA 1OTRB 2JZ3B 1WX8A 2QHOA 2M0XA 2ZNVC 4AJWA 2PJHA 4PS8A 4MJSB 3EECA 3U7DA 3Q3JA 1P1AA 2KK8A 2UYZB 3R66C 3DPDA 1P98A 3TCAA 2KTRB 1XD3B 3JSVA 1EUVB 3NHEB 3A4RA 2EKEC 1AARA 2MQJA 1V49A 2D07B 2IO2B 2DZIA 2KJRA 3A1QA 2KWCA 3RD2A 4KSLC 1WXMA 2Y5BB 4MGKE 4I6LB 3V60A 3TL5A 3VH3B 3IVFA 4EEWA 4IM2A 4WJNA 2KJHB 2RR9A 3B08A 4NJ7A 3SHQA 1L2NA 3AI5A 2DX5B 3DVNU 1Y8RC 3BY4B 3QX1A 4M0WB 2LUEA 1SIFA 2N7DA 4FHJA 2W9NA 5E6NA 2D3GA 3V62A 4GDKA 2ZJDA 4N9F4 4MJSA 2BWFA 2L0TA 3B1LX 5LLIA 2BPSA 1WJ6A 4GMVA 2BKFA 2K6QA 3PSEB 4MEMA 4NQLB 3RYTA 4EZLA 3WA0A 5J17A 1MG8A 4CO7A 2LXAA 2KNBA 3OJ4B 3IFWB 4ANWA 2L76A 3MJWA 1C1YB 2JWZA 3H6NA 2RSUA 3DVGX 1RAXA 2BGFA 3R7RA 3ZDTA 2KZRA 3KH0A 4BBNF 4FHKA 3R3MA 2FUHB 3QK0A 2MCNB 3H1UA 4WJQA 1WZ3A 1GC7A 4FA6A 5JHBA 3VUXA 3ML9A 3VAWA 4W9FA 3W1SC 2XBBC 4K7WA 1UGMA 1UELA 4PS3A 2WWZA 2KDBA 2LI5A 4W9DA 2C7MB 2JXXA 4TQ1A 5KHQA 1Q5WB 3KUDB 4II3B 4PYUA 3RT3B 2MBOA 2O6VB 4JL9A 2PPHA 2XEWA 4DXAB 2CU1A 2IO1B 4P7IA 4W9LA 2DZMA 2ZNVB 2MBHA 1H4RA 1WJ4A 2GBJA 2LZ6A 1IYFA 4JIOU 4KZCA 4G0NB 4LDTD 5DCNA 2FCMA 4DHZB 2J0MA 3AULA 4YL8A 3A9KA 3QCAA 3P2BA 2DYBA 2FAZA 4BFRA 2M8SA 4IM3A 5JH5C 5DPWA 1V80A 2IZVB 2KDEB 1E8ZA 2REXA 2M4NA 2FIDA 2KD0A 2MBEA 2CKHB 3QJZA 1E90A 5CHVC 2KLCA 3NS8A 3PZDA 4GXBA 2ZPYA 4BOSC 1X1MA 1KM7A 1WX9A 3L0WB 5L83A 4CHKA 1ZGUB 2BYVE 3ZRFA 2NCNA 4DHZE 2R2QA 3N32A 3KVFB 2C7NB 2KQSA 3KW5B 3PRZA 4NAWA 2PE9A 2JT4B 4XX5A 1UBIA 1D3ZA 2JUOA 2KANA 3M63B 4NY0A 2XK5A 4GGQA 3UF8A 3M62B 3M95A 2KFKA 3IG3A 3GZNI 3KYCD 1WM2A 3RULA 5AZFA 4ASWC 1WH3A 4LDTB 1J19A
chains in the Genus database with same CATH superfamily
2JYTA 4NJCA 1V1PA 3X23A 4WWNA 1CJEA 4IM0A 2DZKA 1T0RC 3MFGA 2DAFA 2CS4A 2KDIA 3SDLC 4DXFA 2LGYA 1K8RB 2BT6A 2WYQA 2XNAC 3H8HA 2KN5A 2N7EA 2BS2B 2GOWA 3AEGB 3SFDB 4KDIC 3DWMA 4XC2A 4HKZE 4KGTA 1F0ZA 1L5PA 1PGBA 4Q2JA 3QA8A 2GBKA 5TR5A 2KOXA 4ICUA 3HVDA 3ETRA 4URKA 1I35A 2PLPA 4TV3A 1RM6C 4GDKB 2DLBA 3QHTA 3JW0X 4L23A 1V2YA 1V86A 3VR8B 3PGEA 3TJPA 1ZKHA 3UQAA 1YN5A 1WGRA 5GXGB 5G5HA 2WXRA 3RZWC 3ZRCA 2KKCA 3NY5A 2ZZPB 4W9IA 1SJHD 3JYUA 1V81A 3T8MA 3RNFC 2CJOA 3A33B 5HG2A 1YMHE 1WGDA 1SEBD 3BINA 5JXVA 2K25A 1KFYB 4I6PA 3Q2AC 5CHFA 2D3BA 1OQRA 1QT9A 2KO3A 2BW2A 3DCGA 5G5GA 2LD9A 5C23A 1F77A 5C1ZA 2N4FA 1OEYA 2A4ZA 2LVOA 2NTSA 1JROA 1PUTA 2KMCA 5FK9C 4YTNB 4I6NB 2OJWA 1P9DU 3VUYA 2L32A 1JW9D 3A9KB 1GJZA 4MSQB 1K50A 3VRBB 1ISNA 1WFYA 4RM8A 2Z59B 4PYZA 4YSXB 2CJNA 3SR6A 2YLMA 4LLGM 3D32A 2HD5B 3ZLZA 1Z5SB 2C9WB 2V3PA 4A3OA 2R2OA 4DXGA 3BVGA 1VR9A 5HKHA 1E8YA 2NPTB 3P4RB 3QIJA 2N9KA 1V1PB 4G50A 1YN3A 3CMMB 1PFDA 1NYQA 5JHAA 4LNOA 3RNCC 3GZNB 4JLCA 1LQBA 3AH7A 3HM3A 3N3KB 1NYRA 2RGFA 4XYCA 4H2AA 2FBWB 1BT0A 4MELA 3VVWB 3NOBA 2K8CA 2VRRB 4R3DA 1V97A 4EOYA 2HE7A 3FILB 3PHWB 2DYOA 4WJOA 3HUIA 5E6JA 2UWQA 1MJDA 1IGCA 3VHTC 2MEKA 5AEKB 1UUPA 3N20C 1A70A 3RNGC 4O1NA 2BTEA 2Q5WD 4MH8A 3IT4B 2V4LA 3M3JA 3BIID 3VXWA 1WXAA 4G11A 2LXCA 4RMAA 1QOBA 3A4SC 2KWUB 2PTLA 3B2GA 4KDLB 3AE5B 1E10A 4KV2A 3L54A 1WRIA 1RLFA 1V5OA 3R2IA 1IGDA 4HDOA 2ZPNA 3FKYA 3AN1A 2Z0EB 5D2MB 2L7RA 4OVUA 3WIMA 5BYRA 2LWPA 3I9V1 4BZAA 1WYGA 2PW9A 2K1FA 3UI3A 3HIZA 2FCQA 2WDVB 2Y5PA 5KHOA 1I42A 4MM3A 1WX7A 3RZFA 4B0EA 4NQKE 2MSED 2UU7A 4ZRIA 4HKQA 5AZGA 1U4AA 3ZTCA 1C78A 1HE8A 3AB5A 2EELA 1E6EB 5HI1A 1C76A 2E3TA 4KGRA 2JVCA 3DBRB 5D3IB 4W9EA 4ZRJA 3W9CB 2BB5A 4YT0B 5IO9A 2D2QA 4MM3B 3MJ5A 1VRAB 2LEKA 3AEAB 3AV8A 1NDDA 4BKSD 1JRUA 2N9LA 4FXCA 4JWSC 3HK0A 4TSSA 3W5UB 1NBFC 1MHXA 4ANVA 4OVZA 3BYTB 3QAQA 3H7PA 4WWOA 2MX2A 2IGDA 2GBRA 4DHJB 2KHWB 4BOZB 1K51A 1F9JA 2WXIA 2O6VD 1FEHA 3E9SA 2KMMA 4C7YA 2JRHA 3LDZE 3VRAB 4E74A 3AE7B 3ZVVA 1AN8A 1C4AA 3R7QA 4M8NA 4C00A 2CU3A 2V4IB 1YQBA 3QWZB 4C80A 1JWBD 5FR6A 1FCCC 1XEEA 5D94A 2D11A 4P1BC 1WMHA 3JSVB 1SJED 4HCPB 1EWYC 3W1YA 3ZGZA 4LJOB 1Q0WB 4K7SA 2KVZA 4GDLA 4K1RB 4K7UA 2JSVX 2ZNVC 5FKAC 3EECA 3NG0A 2RPVA 3AM9A 3NHEB 3Q8FA 2D07B 2DZIA 1VJKA 1WXMA 1BUIC 3VH3B 3IVFA 2WXLA 3O13A 3RI7C 2H89B 2KJHB 3B08A 4NJ7A 3RPFC 1Y8RC 1SIFA 4YTPB 3V62A 2ZJDA 2BWFA 2L0TA 2N7JA 5LLIA 2BPSA 1WJ6A 2K6QA 1UWXA 4ACFA 1TY0A 5J17A 3IT6B 4CO7A 2QEJC 2KNBA 1CZPA 2L76A 3KWVA 4LNIA 4A90A 3H1UA 2W3RA 2J53A 4W9FA 1GOZA 2WXMA 2KDBA 2C7MB 3B2FA 3KUDB 2WXKA 1AYFA 2MBOA 4JL9A 2IO1B 5C2TB 2WLBA 2LZ6A 4JE3B 4JIOU 4QAYA 3HVZA 4LDTD 4YL8A 1C9FA 3P2BA 1TS2A 2M8SA 4PT5A 1I4XA 5JH5C 1R4MB 2M4NA 2FIDA 1E90A 2KLCA 3L0WB 4OZBA 2NCNA 3AEBB 1ZXIA 3KW5B 5BMHA 4NY0A 1DOYA 2XK5A 4A6QA 1T0SC 1OQQA 4XWWA 4RNAA 4LDTB 4DQOC 4BAXA 2G4SA 2L00B 3P4PB 4CYEA 4HPLB 1TY2A 1E5WA 1TZ1A 2KXJA 2DHZA 4A8XC 3VTUA 2KLGA 1NEKB 4X57B 4AOFA 4LK0M 1QILA 4DHJD 2WU5B 3BVMA 3LB8C 2MA9B 4IOIE 2M19A 2AWTA 4MGYE 2I1KA 1TYGB 2H88B 2QSDA 3NVYA 2K3UA 1QF6A 1IBXA 1XXGA 1DYQA 1E7PB 1VZ7A 3N1ZC 3ZDMC 1S1QB 2LRUA 3EA6A 3Q6BA 1FD6A 3A9JB 3DBHB 1T5XD 4A20A 3TEXA 4N6EB 2O2VB 2RDBC 3VQIA 4W9KA 1HZ5A 1MPEA 4MGIE 3RCZA 4LNKA 3TBLD 4GDLB 2IGGA 4OW0A 3RNAC 2QCZA 1T3QA 2AEHA 4WH4A 4MACA 2PEAA 4HK2A 2JZZA 1F2RI 2N1VA 2WXFA 1SXTA 4EKUA 2IJ0A 1E7VA 2SEBD 1NENB 2WDTB 4NPNA 4HDQA 2NBWB 3QQ8B 2KTFA 2MH7A 3QARA 3UINB 3VTVA 2K9XA 4AJYB 5TSSA 1OFFA 2W3SA 4ZDVA 3Q14C 2IO3B 3K9PB 1QZEA 4C4VA 2MW5A 1L4DB 3PZ7A 4E3CA 1ZDXA 2J4XA 3VH4B 2WDQB 3AU5A 4RGNA 3PRMB 1YOVB 3DOWA 5BO4B 3PLUA 5LXIB 1D6EC 1XF5L 3V61A 3VUWA 3LYYA 1WM3A 1ZW7A 5IOIA 4K3BA 3ZJVA 4TKNA 2WX1A 4P16A 2FNJB 2LGXA 3E56A 3L13A 1I4PA 1UBQA 3GOEA 3ZXRA 2KWVB 2MLBA 4KX6B 5E6OA 1JMLA 2MWSB 1L0YB 3IBEA 3PRPB 1I4RA 4EFOA 2ACZB 3ZKJC 3NZUA 3MTNB 3W2DA 4DK5A 1ZOYB 3A1QB 3AU4A 3U30A 1J8CA 1WGKA 2KTRA 2GI9A 4FJVB 1WI0A 2DENB 3Q3OC 4IC7B 1FMAD 3VFKA 1STEA 1YJIA 1PYWD 3ZJTA 3SEBA 3TEYA 4KIKA 4UDUC 2JU6X 1FFUA 2IY1B 4US9A 3I3TB 1KLGD 3Q3NC 2HTME 5DPTA 4E71A 3H9DA 3PHXB 3AXCA 3ECIA 1ZXHA 5AZHA 2L3ZA 3A9JA 1YX5B 3ENEA 4IWOA 3W5VB 2WNMA 2AYOB 2NBUA 3IHPC 1WJNA 1LFDA 3DWGC 4KKIA 4F8CB 1UNSA 2HJ8A 3Q8CA 4FADA 3HHMA 3NRZA 2YEPF 4A3PA 3AEEB 1WWTA 4M8MA 1QLBB 1N5WA 2BYEA 1Y56A 2EMSA 2FE8A 1HEZE 1J7CA 3NUHB 1RWSA 4RF1A 4AQ7A 1DOIA 4YSZB 2W82A 2Z0DB 4IWPA 1WXQA 3DBLI 5DPRA 4LNNA 2N9EB 2KACA 3OLMD 3CIRB 1ENFA 1VLBA 4G3XB 3SU8X 2OHFA 1A5RA 4HCNB 2RPQA 3GP7A 3V05A 3MC0B 2BVCA 1DGJA 3T3NA 2QDFA 1L0XB 4CQNA 1B1ZA 4W9HA 2NTTA 3AEDB 3OJ3A 2LGSA 3EC8A 1KJTA 1XLPA 3Q8EA 3AE6B 1OTRB 1JQ4A 2M0XA 4MJSB 1P1AA 2UYZB 3R66C 3DPDA 2KTRB 1AW7A 1EUVB 2MQJA 4S0RA 3A1QA 2KWCA 2Y5BB 4MGKE 3TL5A 4M01A 1WSPA 1KTKA 4WAFA 3P63A 2RR9A 3SHQA 3BY4B 3QX1A 4M0WB 2LUEA 3I57A 1HA5A 2D3GA 1JWMD 3FC4A 3LXFA 4MJSA 1P7EA 2KYWA 4MEMA 3RYTA 2BKFA 3PSEB 3WA0A 2N0SB 1MG8A 2LXAA 3OJ4B 1C1YB 2JWZA 2BGFA 3R7RA 4FHKA 4JWUC 3R3MA 2FUHB 2MCNB 2WP9B 1WZ3A 3TEZA 3BZDB 2HJ1A 3W1SC 1UELA 2WWZA 2K5PA 3Q8AA 1P7FA 1Q5WB 2WXJA 1HXYD 1AWDA 1R7SA 3NVVA 2O6VB 3GE3C 1KF6B 2J52A 1TJEA 3GS2A 1H4RA 2GBJA 1TS4A 4KZCA 2ON8A 5BMIA 2FCMA 2J0MA 4K3CA 2DYBA 2FAZA 1V80A 3L4PA 4B0MA 1T6BX 2KDEB 3ZQ4A 2REXA 3U7ZA 3QJZA 2CKHB 1I4QA 1C4PA 4GXBA 4M00A 4NZLB 3U2SC 1X1MA 4BOSC 1ZGUB 3ZRFA 3KVFB 1XCTL 2KQSA 2PE9A 2JT4B 1PDXA 4XX5A 2JUOA 3M63B 3UF8A 4IKGA 3OWEB 2HDEA 3IG3A 3AE1B 3I63C 5AZFA 4EZJA 4ASWC 4MSMB 2YVCA 3MC8A 4GOCA 3MC9A 4RGTA 2GB1A 2FIFA 4AS1A 3L10B 1Q10A 4F7ZA 2JZPA 4FN2A 4DWFA 1FIQA 4OVVA 3DHGC 4BKGA 3FILA 3CF6E 1ZE3D 4ZHOA 4KIKB 4WWPA 2KVRA 2M56B 1SIJA 2FCNA 4LNFA 3RFZB 2LJ5A 1XLNA 4ZRPA 2L05A 4YTMB 5D7GA 3DQVA 3DVGY 1H8CA 1GPXA 4ZYNA 4XWTA 1Z2MA 3ZNHB 2FUG1 2J7QB 4HPPA 4HLEA 4JX1C 4NAWB 4WIPA 1FXAA 3VTWA 4IG7B 2ZCCA 3KUCB 1WR6E 4J3OD 1D5ZC 3MHSD 4ANXA 2AX5A 3BK2A 4DBGA 3WANA 2KMAA 4A9AA 1PGXA 4HJGE 2K8HA 2QMTA 1HTQA 3KUZA 3VR9B 5IP4D 4GLSC 2JPHA 1HTOA 1RFAA 4N58A 1ROEA 2I1JA 1PQSA 3N9YC 4RM9A 2WS3B 1YQ3B 3PV1A 3TEWA 2ZVNA 2ASQA 1N6ZA 3URYA 4NAMA 1WJUA 3TUOA 2NBVB 1YIWA 1T0QC 1L6UA 4F1SA 1SBBB 4W9JA 2LHEA 2NMQA 2MBBB 1EU3A 1IPGA 3PT2B 1YJJA 1WE6A 2VZKD 4D2KA 1WZ0A 1WF9A 5EE9A 1S3SG 3DDCB 2MP2A 4ARCA 3ALBA 2D10A 1GB4A 4EZKA 1SE2A 3LJ3A 4WURA 1MVKA 1KRHA 1QOGA 1R4NI 3NVWA 2X8XX 3WAOA 4BVUC 2K0PA 1WXSA 2KJ6A 2PE6B 2D3CA 4II2B 4IWQA 2WXPA 1WRDB 3TIXA 1YX6B 3Q3FA 1ET6A 3ZTDA 3BYYB 4FJYA 4USAA 3B0AA 1V6EA 3U52E 2LJIA 1CQVA 3PTFC 2OJRA 1D5XC 1N62A 4YSYB 3B9JA 2DNFA 4TMAB 5IN7A 2M1MA 1JWUD 2DYMA 4XGAB 1JCKB 2J0KA 2MHJA 3J9CA 1NVID 4ZOHC 4XE0A 4JQWC 1I4HA 4TUUA 4IDIA 3PS6A 4WJPA 4ARIA 1YN4A 2SAKA 2V3SA 4OHJA 1E8WA 1FCLA 4L1BA 2G45B 3DBRI 2CHWA 1WXVA 3U8ZA 1CMXB 3T9LA 3APCA 1ESFA 1YNTE 1D5MC 5MPOA 4BKTA 5IAAC 3DBHI 3ML8A 1HQRD 3CSTA 2LGDA 2INCC 3L16A 1BMLC 2MRPA 4NNJB 1FPYA 2AL3A 3ZO5B 5J2RA 1G6JA 2V0GA 1XT9B 2C5LC 1VD2A 2LGIA 2KN4A 4C7ZA 2Y3AA 1KH0A 1IBXB 1UD7A 1WGYA 2KFJA 4EUTA 5G2NA 3R2TA 3PLVA 5T8IA 2V1YA 2DWQA 1N5XA 2C7HA 2WXHA 1T0YA 3KWLA 1C3TA 2ZVOA 1JRPA 4IUMB 4RGOS 2G4DB 5HHDG 5C3JB 1EO6A 2EMTA 2JY6A 2O6VA 5D3DA 3RNBC 2XK5B 1EF5A 3EHVA 1J7AA 1GB1A 1KOTA 1F2RC 2LVPA 3SD5A 3V6CB 3GB1A 3AE9B 2WX0A 2BS3B 4GN1A 4YWGG 3ZNID 1FNWA 2B3AA 1ET9A 3R8BA 2JF5A 4HJKA 3JVZX 3KYDD 4B6WA 1E7UA 5EDSA 1VDVA 2CHXA 2G3QB 2IPKD 1J19A 1VZ6A 3TMPB 1UH6A 1WIAA 2GBNA 4FBJB 2KT7A 1XCQL 2NR2A 3IAS1 2LVQA 4B9KA 2XN9C 3MHZA 3ZUNA 1L7YA 2DAJA 2LASA 1GUAB 2KFKB 3EFUA 3DHHC 3VDZA 3DHIC 3N30A 5J18A 4RCOA 3KLSX 4A55A 1TS3A 1TKEA 2ZEQA 1XLQA 1FRDA 1SGHA 1P3QU 2V3NA 1SSNA 3CSFA 1PGAA 2IBIB 2N9PC 3N1XC 4M02A 5DPSA 2AQ1B 2JZ3B 2ONQA 1LO5D 2QHOA 1RYJA 4RFBA 2BBCA 4AJWA 2PJHA 1FXIA 3U7DA 3Q3JA 2KK8A 3TCAA 1P98A 3JSVA 1LGRA 3A4RA 2EKEC 1AARA 2IO2B 2KJRA 3RD2A 2WHIA 1K53A 1F52A 4I6LB 3V60A 3Q69A 2AQ2B 2BQQA 4EEWA 4WJNA 1EU4A 1L2NA 3ABVB 3AI5A 2N7DA 1QKZA 5E6NA 1N63A 3P1MA 2I2YA 4GDKA 2L83A 3B1LX 1E0ZA 4NQLB 4GMVA 4EZLA 1V1OA 1FFVA 1VZ8A 3CWIA 3IFWB 1ZDVA 2RSUA 2PVGC 2VH1A 3KH0A 4BBNF 3ZXVA 5H8YE 4WJQA 1GC7A 4FA6A 5JHBA 2V9HA 3VUXA 3ML9A 3VAWA 2XBBC 4K7WA 4PS3A 3NS1A 3RN9C 2JXXA 5KHQA 5I4DA 3C8YA 2YEPB 3NZ3A 4II3B 4PYUA 2PPHA 4MT5A 2XEWA 4DXAB 4P7IA 4W9LA 2DZMA 2E6XA 1WJ4A 2DBYA 4G0NB 4HROA 4DHZB 1UWMA 3A9KA 1B9RA 4EE2A 2TSSA 5DPWA 3Q3MC 2D5GA 2IZVB 1BXTA 1C77A 1XLOA 1C79A 2M0AA 3PZDA 1FNVA 1WX9A 4L2YA 5EE1A 1N60A 2KWDA 2C7NB 2LMCA 3PRZA 4NAWA 2KDMA 1UBIA 2KANA 4GGQA 3M62B 1TKYA 2KFKA 2INDC 1WM2A 3RULA 2JYEA 1WH3A 1OEYJ 1C4CA 5HFYA 2NPTA 3BWUD 2W55A 4ICVA 1V9JA 4JPSA 2RDHA 1IP9A 2WGSA 1YD8U 1SE9A 5CX3A 4ITKA 3W1SA 1UZXB 2K39A 2MBQA 3H7SA 3UQBA 2OEDA 1FRRA 5IA7A 1I4GA 1GNUA 2RMMA 5FR3A 2RDGA 2O2VA 5CHWA 1UGJA 4C56C 3V6EB 3T3OA 2GBMA 4HWIB 4FULA 4W9CA 3AMZA 2NS5A 4P6VF 2KX0A 4HRSA 3C19A 1F1HA 3RNEC 2AL6A 4HVBA 2NVUI 2BWES 2G9HD 1P0RA 1XQQA 3V3XA 3PVLA 3ZYYX 2LFIA 1OQYA 4WQOB 2L1AA 1FO4A 2X38A 4RGMA 2QJLA 2LHDA 4LCDE 3HM6X 2K8BA 1CK1A 1E8XA 2KDFB 3WALA 5LXHA 1WYWB 5AUKA 2MJEA 3HRDD 4W9GA 4AWJA 1TZOA 3O65B 4J6IA 1WY8A 4WAAA 4C4VB 2LUMA 2QILA 3EUB2 1Q1OA 3I5JC 1WE7A 3DVNV 1E9MA 2WQYB 2MJDA 2PIAA 3APFA 4GU2A 4M0WA 4LJPB 4PS7A 2HTHA 2ZCBA 1SB3C 2PVOD 1TT5B 2K22A 4MGZE 1EWCA 3C0RB 5BMGA 4PK1A 3QC8B 4KVGB 2INPE 2KQ4X 2ICIA 1RFKA 5G55A 1WGGA 1EF1A 2PKOA 3Q8BA 2N9XA 1TIFA 4ZHPA 2LRWA 4HPMB 2D3AA 3L17A 4MH0E 1JALA 4RH6A 4XZ4A 3RUIB 1L4ZB 2M17A 2BYTA 4ZRQA 2CHZA 3NZSA 2GLSA 4OZAA 1TBEA 3L08A 5JZEB 4DDGD 2Y5CA 3ZJUA 1V5TA 2WU2B 3AEFB 3APDA 5BYSA 2BF8B 4BKSA 3PPAA 2IGHA 3WCQA 3ZNZB 1GG3A 1L6VA 1WMHB 5EE0A 4AP4C 4ANUA 3IXSA 1UF0A 4YXDB 1J7BA 4KGSA 3DBSA 3AE2B 2KAJA 1ZUD2 2C60A 2G1EA 1VCBA 2Z8LA 2AQ3B 1RRBA 5EE3A 3SFEB 1QOAA 3BK1A 4K81A 1WR1A 2WXNA 3AE4B 1R4NB 1QQRA 2A5UA 2MP2B 2QC8A 4XDCA 3K9OB 3UIPB 3H7PB 3UGBB 3WAMA 1MG4A 2IYDB 1OGWA 3OAWA 1NI2A 3IAM1 3P4SB 3PO0A 4FLHA 4NJ6A 1GC6A 1LM8B 1EM7A 2IDYA 1J0GA 4GSWA 1MFWA 4B95A 1M94A 1WGHA 4US8A 5LNK1 4FJZA 5GMVA 1FXTB 3WAPA 1SE3A 4HEA1 5IKCM 2R61A 4TQ0A 1TTNA 2WDRB 3OG5A 3ZNGC 3BVZA 3FAHA 4IW0A 2KX3A 2RD0A 4JGHB 2DZJA 3N1YC 3S2AA 3UIOB 3PZ8A 4REZA 2GRIA 2B76B 4BBNC 2BKRB 4RF0A 1N61A 4GB9A 4KSKC 4ZYSA 4DDID 2OOBB 1R4MI 1LXDA 1TGZB 2KC1A 2FCSA 4KZ0A 2J42A 3PREA 1ZP0B 1L0VB 2ZW0A 2L8JA 5D6JB 2W54A 1JWAD 3EFCA 3AECB 3ZW3A 2JX5A 2CR5A 1YJ1A 2J0JA 2JRIB 1V8CA 2KC2A 4ZRKA 2IY0B 3ZIMA 2VH2A 1JWSD 2MJ3A 2INNE 5CTRC 2IO0B 2KQ7A 2GMIC 3NJTA 3AE8B 2WXOA 2L0FA 3ONSA 5E6PA 1IUEA 5L95C 2BYFA 1FNUA 2JXTA 1TKGA 4LTUA 4AUQC 2JQRB 1KLVA 4GIVA 2K6DB 3NVZA 1I7HA 2N1WA 1GAQB 3GE8C 2JWUA 4MDKE 4HXDA 3X0WA 3RMKC 1NI3A 1WX8A 1ZPSA 4PS8A 1XD3B 2BB6A 4WWMA 5H92C 1V49A 4KSLC 1YQ4B 5AUIA 3KQ4A 4IM2A 1FM0D 1XO3A 2DX5B 3DVNU 1DOXA 4FHJA 1SF0A 2W9NA 2ZW1A 4N9F4 1QOFA 4WQMA 4P1CC 4ANWA 3MJWA 3H6NA 3DVGX 1RAXA 3P42A 2KZRA 3ZDTA 2BS4B 3QK0A 1ACCA 3MP9A 1UGMA 2LI5A 4W9DA 3TSSA 4TQ1A 2WXGA 3RT3B 5BYQA 1TS5A 2CU1A 4XDDA 1M4VA 2ZNVB 2MBHA 1SE4A 3DBLB 1IYFA 3U4EG 5DCNA 2WXQA 3P4QB 3AULA 1HZ6A 3QCAA 1MI0A 4KKJA 2VZKB 4BFRA 4IM3A 1MHHE 4N59A 4OZCA 1E8ZA 3AE3B 2KD0A 2MBEA 5CHVC 2L52A 3NS8A 4S17A 2ZPYA 1KM7A 5L83A 2I38A 2BYVE 4CHKA 2PMVA 4DHZE 2R2QA 3N32A 1KLUD 1D4BA 1D3ZA 2EKIA 3M95A 3GZNI 3KYCD 1K52A 3EGRA 2QIEB
chains in the Genus database with same CATH topology
1OEYJ 4MSMB 2YVCA 3X23A 2G4SA 4GOCA 4WWNA 2NPTA 4IM0A 2FIFA 2DZKA 3L10B 2L00B 4CYEA 4HPLB 4ICVA 2DAFA 1TZ1A 1E5WA 2CS4A 2KDIA 1V9JA 2KXJA 2LGYA 1K8RB 3SDLC 2WYQA 4F7ZA 1IP9A 1YD8U 2DHZA 4FN2A 4DWFA 1SE9A 5CX3A 2KN5A 3VTUA 3W1SA 2KLGA 1UZXB 2K39A 2MBQA 4OVVA 3H7SA 3UQBA 2N7EA 4BKGA 2GOWA 4X57B 4AOFA 3CF6E 4DHJD 5IA7A 1GNUA 4KDIC 2MA9B 4XC2A 2O2VA 4KIKB 4WWPA 5CHWA 2AWTA 4MGYE 2I1KA 2KVRA 3QA8A 2GBKA 5TR5A 2KOXA 3V6EB 2FCNA 2GBMA 4ICUA 4HWIB 2LJ5A 4FULA 4URKA 1I35A 2L05A 5D7GA 4TV3A 4W9CA 3DQVA 3DVGY 1H8CA 2NS5A 4ZYNA 4GDKB 2KX0A 3ZDMC 1Z2MA 1S1QB 2LRUA 3QHTA 3JW0X 3ZNHB 2J7QB 2AL6A 1V2YA 1V86A 3A9JB 4HLEA 3PGEA 4HVBA 3TJPA 1ZKHA 4A20A 2NVUI 2BWES 4NAWB 3UQAA 1P0RA 1XQQA 1WGRA 3VTWA 2O2VB 4IG7B 2ZCCA 3PVLA 3KUCB 1WR6E 3VQIA 4W9KA 1OQYA 3RZWC 4WQOB 3ZRCA 2KKCA 3MHSD 3NY5A 2ZZPB 4MGIE 4W9IA 4ANXA 3RCZA 4DBGA 4LCDE 3JYUA 1V81A 3T8MA 2KMAA 3WANA 3HM6X 3A33B 2K8BA 2K8HA 1E8XA 2KDFB 4GDLB 3TBLD 3WALA 1WGDA 1WYWB 4AWJA 4W9GA 5LXHA 3KUZA 3O65B 3BINA 2AEHA 4J6IA 1WY8A 2K25A 2JPHA 4WAAA 4I6PA 1RFAA 5CHFA 1Q1OA 2PEAA 2I1JA 1PQSA 4HK2A 1WE7A 2KO3A 3DVNV 4RM9A 3DCGA 3APFA 2JZZA 2LD9A 3PV1A 5C23A 2N1VA 5C1ZA 2N4FA 2ZVNA 1OEYA 2ASQA 4GU2A 4EKUA 4LJPB 4PS7A 2A4ZA 2HTHA 1E7VA 2ZCBA 2LVOA 1WJUA 2NBVB 2KMCA 1YIWA 2WDTB 4NPNA 4HDQA 2NBWB 3QQ8B 4F1SA 2KTFA 4MGZE 3QARA 4W9JA 4I6NB 2MBBB 3C0RB 3UINB 1IPGA 3VTVA 3PT2B 4AJYB 1WE6A 1P9DU 3VUYA 4ZDVA 3QC8B 4KVGB 3A9KB 1WZ0A 1WF9A 1GJZA 2IO3B 4MSQB 1S3SG 3K9PB 1QZEA 3DDCB 2MP2A 1ISNA 2MW5A 3ALBA 1WFYA 2D10A 4E3CA 5G55A 1WGGA 1EF1A 4EZKA 2N9XA 4RM8A 2Z59B 3LJ3A 3VH4B 2LRWA 4HPMB 1R4NI 4PYZA 3L17A 4MH0E 3WAOA 3AU5A 2YLMA 3PRMB 4XZ4A 3D32A 2HD5B 3DOWA 3ZLZA 1Z5SB 2C9WB 3RUIB 4BVUC 4A3OA 5BO4B 1WXSA 2M17A 2KJ6A 2PE6B 2R2OA 3PLUA 5LXIB 5HKHA 4II2B 1E8YA 4IWQA 2NPTB 1WRDB 2CHZA 3V61A 3NZSA 3QIJA 1YX6B 3TIXA 3VUWA 3Q3FA 1WM3A 3ZTDA 1TBEA 4G50A 3CMMB 4FJYA 3L08A 1ZW7A 4DDGD 5JZEB 1V5TA 5JHAA 3B0AA 1V6EA 3APDA 4JLCA 3PTFC 2OJRA 1LQBA 3HM3A 3N3KB 4TKNA 2WX1A 2RGFA 2BF8B 2FNJB 2LGXA 2M1MA 3VVWB 1BT0A 3PPAA 4MELA 4BKSA 2DYMA 3L13A 3NOBA 2J0KA 2K8CA 2VRRB 4EOYA 1UBQA 2HE7A 3ZNZB 3GOEA 3PHWB 2DYOA 1GG3A 2KWVB 2MLBA 5E6OA 4WJOA 1WMHB 2UWQA 4AP4C 4ANUA 4JQWC 3VHTC 5AEKB 2MWSB 4TUUA 3DBSA 3IBEA 3PRPB 4EFOA 3PS6A 4WJPA 3ZKJC 4EZJA 3NZUA 2C60A 3MTNB 2V4LA 4DK5A 3M3JA 3VXWA 1WXAA 1VCBA 4G11A 2LXCA 2V3SA 3A1QB 4RMAA 1E8WA 3AU4A 3U30A 3A4SC 1RRBA 2G45B 3DBRI 2KWUB 1J8CA 2CHWA 4KDLB 1WXVA 2KTRA 4FJVB 4KV2A 1WI0A 2DENB 3L54A 3U8ZA 4K81A 1CMXB 1WR1A 3T9LA 3APCA 1RLFA 2A5UA 4IC7B 1V5OA 2MP2B 4BKTA 4HDOA 3DBHI 2ZPNA 3ML8A 5IAAC 3K9OB 3UIPB 3CSTA 3H7PB 2LGDA 3UGBB 3VFKA 2Z0EB 5D2MB 2L7RA 4OVUA 3WAMA 3WIMA 2LWPA 3L16A 2IYDB 1OGWA 3OAWA 1NI2A 2MRPA 4NNJB 4KIKA 2AL3A 4FLHA 4NJ6A 3ZO5B 1GC6A 2IY1B 2K1FA 5J2RA 1LM8B 3HIZA 1G6JA 3I3TB 1J0GA 4GSWA 1XT9B 4B95A 2C5LC 2FCQA 1M94A 1VD2A 1WGHA 5KHOA 5DPTA 1I42A 4E71A 4MM3A 1WX7A 4FJZA 3RZFA 3H9DA 1FXTB 5GMVA 3WAPA 3PHXB 1UD7A 4NQKE 3AXCA 2MSED 3ECIA 5AZHA 2L3ZA 3A9JA 4ZRIA 1WGYA 2KFJA 4EUTA 5G2NA 4TQ0A 5AZGA 1TTNA 3PLVA 3ZNGC 1U4AA 4IW0A 1YX5B 2V1YA 3ENEA 2KX3A 4IWOA 2RD0A 3ZTCA 2C7HA 1HE8A 2AYOB 1T0YA 2NBUA 3IHPC 4JGHB 1C3TA 2ZVOA 1WJNA 1LFDA 2DZJA 4IUMB 2G4DB 4F8CB 1EO6A 2EMTA 2JVCA 2HJ8A 3S2AA 2JY6A 2O6VA 4W9EA 3UIOB 4ZRJA 2XK5B 4BBNC 1EF5A 2BKRB 3EHVA 4FADA 3HHMA 4GB9A 4KSKC 1KOTA 3SD5A 2D2QA 2LVPA 3V6CB 4DDID 2OOBB 2WX0A 4A3PA 1R4MI 1LXDA 1NDDA 4M8MA 1TGZB 4GN1A 3ZNID 4BKSD 2KC1A 1JRUA 2FCSA 2B3AA 2JF5A 4KZ0A 4HJKA 3JVZX 3HK0A 3KYDD 3PREA 2BYEA 4B6WA 1E7UA 5EDSA 2EMSA 1NBFC 2G3QB 2CHXA 2L8JA 5D6JB 3TMPB 4ANVA 3QAQA 1UH6A 1WIAA 2GBNA 3H7PA 4WWOA 3ZW3A 4FBJB 2MX2A 2CR5A 2GBRA 4DHJB 2KHWB 1YJ1A 4BOZB 2J0JA 2NR2A 2LVQA 2JRIB 1F9JA 4B9KA 3ZUNA 1L7YA 2O6VD 2Z0DB 2KC2A 4IWPA 2DAJA 2LASA 2IY0B 1GUAB 2KFKB 3DBLI 3EFUA 4ZRKA 3ZIMA 5DPRA 3VDZA 3N30A 2JRHA 3LDZE 5J18A 4E74A 2N9EB 2IO0B 5CTRC 2KQ7A 2GMIC 3ZVVA 3OLMD 2L0FA 3ONSA 3R7QA 5E6PA 5L95C 2BYFA 4M8NA 1YQBA 3QWZB 4G3XB 3SU8X 5FR6A 2ZEQA 1A5RA 1SGHA 1P3QU 4HCNB 2RPQA 5D94A 3CSFA 4AUQC 1KLVA 2D11A 4GIVA 2K6DB 1WMHA 3JSVB 4HCPB 3W1YA 2N1WA 4LJOB 4W9HA 1Q0WB 2IBIB 4K7SA 4MDKE 2N9PC 4HXDA 3OJ3A 4GDLA 3EC8A 3X0WA 4K1RB 4K7UA 1KJTA 5DPSA 1OTRB 2JZ3B 1WX8A 2QHOA 2M0XA 2ZNVC 4AJWA 2PJHA 4PS8A 4MJSB 3EECA 3U7DA 3Q3JA 1P1AA 2KK8A 2UYZB 3R66C 3DPDA 1P98A 3TCAA 2KTRB 1XD3B 3JSVA 1EUVB 3NHEB 3A4RA 2EKEC 1AARA 2MQJA 1V49A 2D07B 2IO2B 2DZIA 2KJRA 3A1QA 2KWCA 3RD2A 4KSLC 1WXMA 2Y5BB 4MGKE 4I6LB 3V60A 3TL5A 3VH3B 3IVFA 4EEWA 4IM2A 4WJNA 2KJHB 2RR9A 3B08A 4NJ7A 3SHQA 1L2NA 3AI5A 2DX5B 3DVNU 1Y8RC 3BY4B 3QX1A 4M0WB 2LUEA 1SIFA 2N7DA 4FHJA 2W9NA 5E6NA 2D3GA 3V62A 4GDKA 2ZJDA 4N9F4 4MJSA 2BWFA 2L0TA 3B1LX 5LLIA 2BPSA 1WJ6A 4GMVA 2BKFA 2K6QA 3PSEB 4MEMA 4NQLB 3RYTA 4EZLA 3WA0A 5J17A 1MG8A 4CO7A 2LXAA 2KNBA 3OJ4B 3IFWB 4ANWA 2L76A 3MJWA 1C1YB 2JWZA 3H6NA 2RSUA 3DVGX 1RAXA 2BGFA 3R7RA 3ZDTA 2KZRA 3KH0A 4BBNF 4FHKA 3R3MA 2FUHB 3QK0A 2MCNB 3H1UA 4WJQA 1WZ3A 1GC7A 4FA6A 5JHBA 3VUXA 3ML9A 3VAWA 4W9FA 3W1SC 2XBBC 4K7WA 1UGMA 1UELA 4PS3A 2WWZA 2KDBA 2LI5A 4W9DA 2C7MB 2JXXA 4TQ1A 5KHQA 1Q5WB 3KUDB 4II3B 4PYUA 3RT3B 2MBOA 2O6VB 4JL9A 2PPHA 2XEWA 4DXAB 2CU1A 2IO1B 4P7IA 4W9LA 2DZMA 2ZNVB 2MBHA 1H4RA 1WJ4A 2GBJA 2LZ6A 1IYFA 4JIOU 4KZCA 4G0NB 4LDTD 5DCNA 2FCMA 4DHZB 2J0MA 3AULA 4YL8A 3A9KA 3QCAA 3P2BA 2DYBA 2FAZA 4BFRA 2M8SA 4IM3A 5JH5C 5DPWA 1V80A 2IZVB 2KDEB 1E8ZA 2REXA 2M4NA 2FIDA 2KD0A 2MBEA 2CKHB 3QJZA 1E90A 5CHVC 2KLCA 3NS8A 3PZDA 4GXBA 2ZPYA 4BOSC 1X1MA 1KM7A 1WX9A 3L0WB 5L83A 4CHKA 1ZGUB 2BYVE 3ZRFA 2NCNA 4DHZE 2R2QA 3N32A 3KVFB 2C7NB 2KQSA 3KW5B 3PRZA 4NAWA 2PE9A 2JT4B 4XX5A 1UBIA 1D3ZA 2JUOA 2KANA 3M63B 4NY0A 2XK5A 4GGQA 3UF8A 3M62B 3M95A 2KFKA 3IG3A 3GZNI 3KYCD 1WM2A 3RULA 5AZFA 4ASWC 1WH3A 4LDTB 1J19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OEY J;  4MSM B;  2YVC A;  3X23 A;  2G4S A;  4GOC A;  4WWN A;  2NPT A;  4IM0 A;  2FIF A;  2DZK A;  3L10 B;  2L00 B;  4CYE A;  4HPL B;  4ICV A;  2DAF A;  1TZ1 A;  1E5W A;  2CS4 A;  2KDI A;  1V9J A;  2KXJ A;  2LGY A;  1K8R B;  3SDL C;  2WYQ A;  4F7Z A;  1IP9 A;  1YD8 U;  2DHZ A;  4FN2 A;  4DWF A;  1SE9 A;  5CX3 A;  2KN5 A;  3VTU A;  3W1S A;  2KLG A;  1UZX B;  2K39 A;  2MBQ A;  4OVV A;  3H7S A;  3UQB A;  2N7E A;  4BKG A;  2GOW A;  4X57 B;  4AOF A;  3CF6 E;  4DHJ D;  5IA7 A;  1GNU A;  4KDI C;  2MA9 B;  4XC2 A;  2O2V A;  4KIK B;  4WWP A;  5CHW A;  2AWT A;  4MGY E;  2I1K A;  2KVR A;  3QA8 A;  2GBK A;  5TR5 A;  2KOX A;  3V6E B;  2FCN A;  2GBM A;  4ICU A;  4HWI B;  2LJ5 A;  4FUL A;  4URK A;  1I35 A;  2L05 A;  5D7G A;  4TV3 A;  4W9C A;  3DQV A;  3DVG Y;  1H8C A;  2NS5 A;  4ZYN A;  4GDK B;  2KX0 A;  3ZDM C;  1Z2M A;  1S1Q B;  2LRU A;  3QHT A;  3JW0 X;  3ZNH B;  2J7Q B;  2AL6 A;  1V2Y A;  1V86 A;  3A9J B;  4HLE A;  3PGE A;  4HVB A;  3TJP A;  1ZKH A;  4A20 A;  2NVU I;  2BWE S;  4NAW B;  3UQA A;  1P0R A;  1XQQ A;  1WGR A;  3VTW A;  2O2V B;  4IG7 B;  2ZCC A;  3PVL A;  3KUC B;  1WR6 E;  3VQI A;  4W9K A;  1OQY A;  3RZW C;  4WQO B;  3ZRC A;  2KKC A;  3MHS D;  3NY5 A;  2ZZP B;  4MGI E;  4W9I A;  4ANX A;  3RCZ A;  4DBG A;  4LCD E;  3JYU A;  1V81 A;  3T8M A;  2KMA A;  3WAN A;  3HM6 X;  3A33 B;  2K8B A;  2K8H A;  1E8X A;  2KDF B;  4GDL B;  3TBL D;  3WAL A;  1WGD A;  1WYW B;  4AWJ A;  4W9G A;  5LXH A;  3KUZ A;  3O65 B;  3BIN A;  2AEH A;  4J6I A;  1WY8 A;  2K25 A;  2JPH A;  4WAA A;  4I6P A;  1RFA A;  5CHF A;  1Q1O A;  2PEA A;  2I1J A;  1PQS A;  4HK2 A;  1WE7 A;  2KO3 A;  3DVN V;  4RM9 A;  3DCG A;  3APF A;  2JZZ A;  2LD9 A;  3PV1 A;  5C23 A;  2N1V A;  5C1Z A;  2N4F A;  2ZVN A;  1OEY A;  2ASQ A;  4GU2 A;  4EKU A;  4LJP B;  4PS7 A;  2A4Z A;  2HTH A;  1E7V A;  2ZCB A;  2LVO A;  1WJU A;  2NBV B;  2KMC A;  1YIW A;  2WDT B;  4NPN A;  4HDQ A;  2NBW B;  3QQ8 B;  4F1S A;  2KTF A;  4MGZ E;  3QAR A;  4W9J A;  4I6N B;  2MBB B;  3C0R B;  3UIN B;  1IPG A;  3VTV A;  3PT2 B;  4AJY B;  1WE6 A;  1P9D U;  3VUY A;  4ZDV A;  3QC8 B;  4KVG B;  3A9K B;  1WZ0 A;  1WF9 A;  1GJZ A;  2IO3 B;  4MSQ B;  1S3S G;  3K9P B;  1QZE A;  3DDC B;  2MP2 A;  1ISN A;  2MW5 A;  3ALB A;  1WFY A;  2D10 A;  4E3C A;  5G55 A;  1WGG A;  1EF1 A;  4EZK A;  2N9X A;  4RM8 A;  2Z59 B;  3LJ3 A;  3VH4 B;  2LRW A;  4HPM B;  1R4N I;  4PYZ A;  3L17 A;  4MH0 E;  3WAO A;  3AU5 A;  2YLM A;  3PRM B;  4XZ4 A;  3D32 A;  2HD5 B;  3DOW A;  3ZLZ A;  1Z5S B;  2C9W B;  3RUI B;  4BVU C;  4A3O A;  5BO4 B;  1WXS A;  2M17 A;  2KJ6 A;  2PE6 B;  2R2O A;  3PLU A;  5LXI B;  5HKH A;  4II2 B;  1E8Y A;  4IWQ A;  2NPT B;  1WRD B;  2CHZ A;  3V61 A;  3NZS A;  3QIJ A;  1YX6 B;  3TIX A;  3VUW A;  3Q3F A;  1WM3 A;  3ZTD A;  1TBE A;  4G50 A;  3CMM B;  4FJY A;  3L08 A;  1ZW7 A;  4DDG D;  5JZE B;  1V5T A;  5JHA A;  3B0A A;  1V6E A;  3APD A;  4JLC A;  3PTF C;  2OJR A;  1LQB A;  3HM3 A;  3N3K B;  4TKN A;  2WX1 A;  2RGF A;  2BF8 B;  2FNJ B;  2LGX A;  2M1M A;  3VVW B;  1BT0 A;  3PPA A;  4MEL A;  4BKS A;  2DYM A;  3L13 A;  3NOB A;  2J0K A;  2K8C A;  2VRR B;  4EOY A;  1UBQ A;  2HE7 A;  3ZNZ B;  3GOE A;  3PHW B;  2DYO A;  1GG3 A;  2KWV B;  2MLB A;  5E6O A;  4WJO A;  1WMH B;  2UWQ A;  4AP4 C;  4ANU A;  4JQW C;  3VHT C;  5AEK B;  2MWS B;  4TUU A;  3DBS A;  3IBE A;  3PRP B;  4EFO A;  3PS6 A;  4WJP A;  3ZKJ C;  4EZJ A;  3NZU A;  2C60 A;  3MTN B;  2V4L A;  4DK5 A;  3M3J A;  3VXW A;  1WXA A;  1VCB A;  4G11 A;  2LXC A;  2V3S A;  3A1Q B;  4RMA A;  1E8W A;  3AU4 A;  3U30 A;  3A4S C;  1RRB A;  2G45 B;  3DBR I;  2KWU B;  1J8C A;  2CHW A;  4KDL B;  1WXV A;  2KTR A;  4FJV B;  4KV2 A;  1WI0 A;  2DEN B;  3L54 A;  3U8Z A;  4K81 A;  1CMX B;  1WR1 A;  3T9L A;  3APC A;  1RLF A;  2A5U A;  4IC7 B;  1V5O A;  2MP2 B;  4BKT A;  4HDO A;  3DBH I;  2ZPN A;  3ML8 A;  5IAA C;  3K9O B;  3UIP B;  3CST A;  3H7P B;  2LGD A;  3UGB B;  3VFK A;  2Z0E B;  5D2M B;  2L7R A;  4OVU A;  3WAM A;  3WIM A;  2LWP A;  3L16 A;  2IYD B;  1OGW A;  3OAW A;  1NI2 A;  2MRP A;  4NNJ B;  4KIK A;  2AL3 A;  4FLH A;  4NJ6 A;  3ZO5 B;  1GC6 A;  2IY1 B;  2K1F A;  5J2R A;  1LM8 B;  3HIZ A;  1G6J A;  3I3T B;  1J0G A;  4GSW A;  1XT9 B;  4B95 A;  2C5L C;  2FCQ A;  1M94 A;  1VD2 A;  1WGH A;  5KHO A;  5DPT A;  1I42 A;  4E71 A;  4MM3 A;  1WX7 A;  4FJZ A;  3RZF A;  3H9D A;  1FXT B;  5GMV A;  3WAP A;  3PHX B;  1UD7 A;  4NQK E;  3AXC A;  2MSE D;  3ECI A;  5AZH A;  2L3Z A;  3A9J A;  4ZRI A;  1WGY A;  2KFJ A;  4EUT A;  5G2N A;  4TQ0 A;  5AZG A;  1TTN A;  3PLV A;  3ZNG C;  1U4A A;  4IW0 A;  1YX5 B;  2V1Y A;  3ENE A;  2KX3 A;  4IWO A;  2RD0 A;  3ZTC A;  2C7H A;  1HE8 A;  2AYO B;  1T0Y A;  2NBU A;  3IHP C;  4JGH B;  1C3T A;  2ZVO A;  1WJN A;  1LFD A;  2DZJ A;  4IUM B;  2G4D B;  4F8C B;  1EO6 A;  2EMT A;  2JVC A;  2HJ8 A;  3S2A A;  2JY6 A;  2O6V A;  4W9E A;  3UIO B;  4ZRJ A;  2XK5 B;  4BBN C;  1EF5 A;  2BKR B;  3EHV A;  4FAD A;  3HHM A;  4GB9 A;  4KSK C;  1KOT A;  3SD5 A;  2D2Q A;  2LVP A;  3V6C B;  4DDI D;  2OOB B;  2WX0 A;  4A3P A;  1R4M I;  1LXD A;  1NDD A;  4M8M A;  1TGZ B;  4GN1 A;  3ZNI D;  4BKS D;  2KC1 A;  1JRU A;  2FCS A;  2B3A A;  2JF5 A;  4KZ0 A;  4HJK A;  3JVZ X;  3HK0 A;  3KYD D;  3PRE A;  2BYE A;  4B6W A;  1E7U A;  5EDS A;  2EMS A;  1NBF C;  2G3Q B;  2CHX A;  2L8J A;  5D6J B;  3TMP B;  4ANV A;  3QAQ A;  1UH6 A;  1WIA A;  2GBN A;  3H7P A;  4WWO A;  3ZW3 A;  4FBJ B;  2MX2 A;  2CR5 A;  2GBR A;  4DHJ B;  2KHW B;  1YJ1 A;  4BOZ B;  2J0J A;  2NR2 A;  2LVQ A;  2JRI B;  1F9J A;  4B9K A;  3ZUN A;  1L7Y A;  2O6V D;  2Z0D B;  2KC2 A;  4IWP A;  2DAJ A;  2LAS A;  2IY0 B;  1GUA B;  2KFK B;  3DBL I;  3EFU A;  4ZRK A;  3ZIM A;  5DPR A;  3VDZ A;  3N30 A;  2JRH A;  3LDZ E;  5J18 A;  4E74 A;  2N9E B;  2IO0 B;  5CTR C;  2KQ7 A;  2GMI C;  3ZVV A;  3OLM D;  2L0F A;  3ONS A;  3R7Q A;  5E6P A;  5L95 C;  2BYF A;  4M8N A;  1YQB A;  3QWZ B;  4G3X B;  3SU8 X;  5FR6 A;  2ZEQ A;  1A5R A;  1SGH A;  1P3Q U;  4HCN B;  2RPQ A;  5D94 A;  3CSF A;  4AUQ C;  1KLV A;  2D11 A;  4GIV A;  2K6D B;  1WMH A;  3JSV B;  4HCP B;  3W1Y A;  2N1W A;  4LJO B;  4W9H A;  1Q0W B;  2IBI B;  4K7S A;  4MDK E;  2N9P C;  4HXD A;  3OJ3 A;  4GDL A;  3EC8 A;  3X0W A;  4K1R B;  4K7U A;  1KJT A;  5DPS A;  1OTR B;  2JZ3 B;  1WX8 A;  2QHO A;  2M0X A;  2ZNV C;  4AJW A;  2PJH A;  4PS8 A;  4MJS B;  3EEC A;  3U7D A;  3Q3J A;  1P1A A;  2KK8 A;  2UYZ B;  3R66 C;  3DPD A;  1P98 A;  3TCA A;  2KTR B;  1XD3 B;  3JSV A;  1EUV B;  3NHE B;  3A4R A;  2EKE C;  1AAR A;  2MQJ A;  1V49 A;  2D07 B;  2IO2 B;  2DZI A;  2KJR A;  3A1Q A;  2KWC A;  3RD2 A;  4KSL C;  1WXM A;  2Y5B B;  4MGK E;  4I6L B;  3V60 A;  3TL5 A;  3VH3 B;  3IVF A;  4EEW A;  4IM2 A;  4WJN A;  2KJH B;  2RR9 A;  3B08 A;  4NJ7 A;  3SHQ A;  1L2N A;  3AI5 A;  2DX5 B;  3DVN U;  1Y8R C;  3BY4 B;  3QX1 A;  4M0W B;  2LUE A;  1SIF A;  2N7D A;  4FHJ A;  2W9N A;  5E6N A;  2D3G A;  3V62 A;  4GDK A;  2ZJD A;  4N9F 4;  4MJS A;  2BWF A;  2L0T A;  3B1L X;  5LLI A;  2BPS A;  1WJ6 A;  4GMV A;  2BKF A;  2K6Q A;  3PSE B;  4MEM A;  4NQL B;  3RYT A;  4EZL A;  3WA0 A;  5J17 A;  1MG8 A;  4CO7 A;  2LXA A;  2KNB A;  3OJ4 B;  3IFW B;  4ANW A;  2L76 A;  3MJW A;  1C1Y B;  2JWZ A;  3H6N A;  2RSU A;  3DVG X;  1RAX A;  2BGF A;  3R7R A;  3ZDT A;  2KZR A;  3KH0 A;  4BBN F;  4FHK A;  3R3M A;  2FUH B;  3QK0 A;  2MCN B;  3H1U A;  4WJQ A;  1WZ3 A;  1GC7 A;  4FA6 A;  5JHB A;  3VUX A;  3ML9 A;  3VAW A;  4W9F A;  3W1S C;  2XBB C;  4K7W A;  1UGM A;  1UEL A;  4PS3 A;  2WWZ A;  2KDB A;  2LI5 A;  4W9D A;  2C7M B;  2JXX A;  4TQ1 A;  5KHQ A;  1Q5W B;  3KUD B;  4II3 B;  4PYU A;  3RT3 B;  2MBO A;  2O6V B;  4JL9 A;  2PPH A;  2XEW A;  4DXA B;  2CU1 A;  2IO1 B;  4P7I A;  4W9L A;  2DZM A;  2ZNV B;  2MBH A;  1H4R A;  1WJ4 A;  2GBJ A;  2LZ6 A;  1IYF A;  4JIO U;  4KZC A;  4G0N B;  4LDT D;  5DCN A;  2FCM A;  4DHZ B;  2J0M A;  3AUL A;  4YL8 A;  3A9K A;  3QCA A;  3P2B A;  2DYB A;  2FAZ A;  4BFR A;  2M8S A;  4IM3 A;  5JH5 C;  5DPW A;  1V80 A;  2IZV B;  2KDE B;  1E8Z A;  2REX A;  2M4N A;  2FID A;  2KD0 A;  2MBE A;  2CKH B;  3QJZ A;  1E90 A;  5CHV C;  2KLC A;  3NS8 A;  3PZD A;  4GXB A;  2ZPY A;  4BOS C;  1X1M A;  1KM7 A;  1WX9 A;  3L0W B;  5L83 A;  4CHK A;  1ZGU B;  2BYV E;  3ZRF A;  2NCN A;  4DHZ E;  2R2Q A;  3N32 A;  3KVF B;  2C7N B;  2KQS A;  3KW5 B;  3PRZ A;  4NAW A;  2PE9 A;  2JT4 B;  4XX5 A;  1UBI A;  1D3Z A;  2JUO A;  2KAN A;  3M63 B;  4NY0 A;  2XK5 A;  4GGQ A;  3UF8 A;  3M62 B;  3M95 A;  2KFK A;  3IG3 A;  3GZN I;  3KYC D;  1WM2 A;  3RUL A;  5AZF A;  4ASW C;  1WH3 A;  4LDT B;  1J19 A; 
#chains in the Genus database with same CATH topology
 2JYT A;  4NJC A;  1V1P A;  3X23 A;  4WWN A;  1CJE A;  4IM0 A;  2DZK A;  1T0R C;  3MFG A;  2DAF A;  2CS4 A;  2KDI A;  3SDL C;  4DXF A;  2LGY A;  1K8R B;  2BT6 A;  2WYQ A;  2XNA C;  3H8H A;  2KN5 A;  2N7E A;  2BS2 B;  2GOW A;  3AEG B;  3SFD B;  4KDI C;  3DWM A;  4XC2 A;  4HKZ E;  4KGT A;  1F0Z A;  1L5P A;  1PGB A;  4Q2J A;  3QA8 A;  2GBK A;  5TR5 A;  2KOX A;  4ICU A;  3HVD A;  3ETR A;  4URK A;  1I35 A;  2PLP A;  4TV3 A;  1RM6 C;  4GDK B;  2DLB A;  3QHT A;  3JW0 X;  4L23 A;  1V2Y A;  1V86 A;  3VR8 B;  3PGE A;  3TJP A;  1ZKH A;  3UQA A;  1YN5 A;  1WGR A;  5GXG B;  5G5H A;  2WXR A;  3RZW C;  3ZRC A;  2KKC A;  3NY5 A;  2ZZP B;  4W9I A;  1SJH D;  3JYU A;  1V81 A;  3T8M A;  3RNF C;  2CJO A;  3A33 B;  5HG2 A;  1YMH E;  1WGD A;  1SEB D;  3BIN A;  5JXV A;  2K25 A;  1KFY B;  4I6P A;  3Q2A C;  5CHF A;  2D3B A;  1OQR A;  1QT9 A;  2KO3 A;  2BW2 A;  3DCG A;  5G5G A;  2LD9 A;  5C23 A;  1F77 A;  5C1Z A;  2N4F A;  1OEY A;  2A4Z A;  2LVO A;  2NTS A;  1JRO A;  1PUT A;  2KMC A;  5FK9 C;  4YTN B;  4I6N B;  2OJW A;  1P9D U;  3VUY A;  2L32 A;  1JW9 D;  3A9K B;  1GJZ A;  4MSQ B;  1K50 A;  3VRB B;  1ISN A;  1WFY A;  4RM8 A;  2Z59 B;  4PYZ A;  4YSX B;  2CJN A;  3SR6 A;  2YLM A;  4LLG M;  3D32 A;  2HD5 B;  3ZLZ A;  1Z5S B;  2C9W B;  2V3P A;  4A3O A;  2R2O A;  4DXG A;  3BVG A;  1VR9 A;  5HKH A;  1E8Y A;  2NPT B;  3P4R B;  3QIJ A;  2N9K A;  1V1P B;  4G50 A;  1YN3 A;  3CMM B;  1PFD A;  1NYQ A;  5JHA A;  4LNO A;  3RNC C;  3GZN B;  4JLC A;  1LQB A;  3AH7 A;  3HM3 A;  3N3K B;  1NYR A;  2RGF A;  4XYC A;  4H2A A;  2FBW B;  1BT0 A;  4MEL A;  3VVW B;  3NOB A;  2K8C A;  2VRR B;  4R3D A;  1V97 A;  4EOY A;  2HE7 A;  3FIL B;  3PHW B;  2DYO A;  4WJO A;  3HUI A;  5E6J A;  2UWQ A;  1MJD A;  1IGC A;  3VHT C;  2MEK A;  5AEK B;  1UUP A;  3N20 C;  1A70 A;  3RNG C;  4O1N A;  2BTE A;  2Q5W D;  4MH8 A;  3IT4 B;  2V4L A;  3M3J A;  3BII D;  3VXW A;  1WXA A;  4G11 A;  2LXC A;  4RMA A;  1QOB A;  3A4S C;  2KWU B;  2PTL A;  3B2G A;  4KDL B;  3AE5 B;  1E10 A;  4KV2 A;  3L54 A;  1WRI A;  1RLF A;  1V5O A;  3R2I A;  1IGD A;  4HDO A;  2ZPN A;  3FKY A;  3AN1 A;  2Z0E B;  5D2M B;  2L7R A;  4OVU A;  3WIM A;  5BYR A;  2LWP A;  3I9V 1;  4BZA A;  1WYG A;  2PW9 A;  2K1F A;  3UI3 A;  3HIZ A;  2FCQ A;  2WDV B;  2Y5P A;  5KHO A;  1I42 A;  4MM3 A;  1WX7 A;  3RZF A;  4B0E A;  4NQK E;  2MSE D;  2UU7 A;  4ZRI A;  4HKQ A;  5AZG A;  1U4A A;  3ZTC A;  1C78 A;  1HE8 A;  3AB5 A;  2EEL A;  1E6E B;  5HI1 A;  1C76 A;  2E3T A;  4KGR A;  2JVC A;  3DBR B;  5D3I B;  4W9E A;  4ZRJ A;  3W9C B;  2BB5 A;  4YT0 B;  5IO9 A;  2D2Q A;  4MM3 B;  3MJ5 A;  1VRA B;  2LEK A;  3AEA B;  3AV8 A;  1NDD A;  4BKS D;  1JRU A;  2N9L A;  4FXC A;  4JWS C;  3HK0 A;  4TSS A;  3W5U B;  1NBF C;  1MHX A;  4ANV A;  4OVZ A;  3BYT B;  3QAQ A;  3H7P A;  4WWO A;  2MX2 A;  2IGD A;  2GBR A;  4DHJ B;  2KHW B;  4BOZ B;  1K51 A;  1F9J A;  2WXI A;  2O6V D;  1FEH A;  3E9S A;  2KMM A;  4C7Y A;  2JRH A;  3LDZ E;  3VRA B;  4E74 A;  3AE7 B;  3ZVV A;  1AN8 A;  1C4A A;  3R7Q A;  4M8N A;  4C00 A;  2CU3 A;  2V4I B;  1YQB A;  3QWZ B;  4C80 A;  1JWB D;  5FR6 A;  1FCC C;  1XEE A;  5D94 A;  2D11 A;  4P1B C;  1WMH A;  3JSV B;  1SJE D;  4HCP B;  1EWY C;  3W1Y A;  3ZGZ A;  4LJO B;  1Q0W B;  4K7S A;  2KVZ A;  4GDL A;  4K1R B;  4K7U A;  2JSV X;  2ZNV C;  5FKA C;  3EEC A;  3NG0 A;  2RPV A;  3AM9 A;  3NHE B;  3Q8F A;  2D07 B;  2DZI A;  1VJK A;  1WXM A;  1BUI C;  3VH3 B;  3IVF A;  2WXL A;  3O13 A;  3RI7 C;  2H89 B;  2KJH B;  3B08 A;  4NJ7 A;  3RPF C;  1Y8R C;  1SIF A;  4YTP B;  3V62 A;  2ZJD A;  2BWF A;  2L0T A;  2N7J A;  5LLI A;  2BPS A;  1WJ6 A;  2K6Q A;  1UWX A;  4ACF A;  1TY0 A;  5J17 A;  3IT6 B;  4CO7 A;  2QEJ C;  2KNB A;  1CZP A;  2L76 A;  3KWV A;  4LNI A;  4A90 A;  3H1U A;  2W3R A;  2J53 A;  4W9F A;  1GOZ A;  2WXM A;  2KDB A;  2C7M B;  3B2F A;  3KUD B;  2WXK A;  1AYF A;  2MBO A;  4JL9 A;  2IO1 B;  5C2T B;  2WLB A;  2LZ6 A;  4JE3 B;  4JIO U;  4QAY A;  3HVZ A;  4LDT D;  4YL8 A;  1C9F A;  3P2B A;  1TS2 A;  2M8S A;  4PT5 A;  1I4X A;  5JH5 C;  1R4M B;  2M4N A;  2FID A;  1E90 A;  2KLC A;  3L0W B;  4OZB A;  2NCN A;  3AEB B;  1ZXI A;  3KW5 B;  5BMH A;  4NY0 A;  1DOY A;  2XK5 A;  4A6Q A;  1T0S C;  1OQQ A;  4XWW A;  4RNA A;  4LDT B;  4DQO C;  4BAX A;  2G4S A;  2L00 B;  3P4P B;  4CYE A;  4HPL B;  1TY2 A;  1E5W A;  1TZ1 A;  2KXJ A;  2DHZ A;  4A8X C;  3VTU A;  2KLG A;  1NEK B;  4X57 B;  4AOF A;  4LK0 M;  1QIL A;  4DHJ D;  2WU5 B;  3BVM A;  3LB8 C;  2MA9 B;  4IOI E;  2M19 A;  2AWT A;  4MGY E;  2I1K A;  1TYG B;  2H88 B;  2QSD A;  3NVY A;  2K3U A;  1QF6 A;  1IBX A;  1XXG A;  1DYQ A;  1E7P B;  1VZ7 A;  3N1Z C;  3ZDM C;  1S1Q B;  2LRU A;  3EA6 A;  3Q6B A;  1FD6 A;  3A9J B;  3DBH B;  1T5X D;  4A20 A;  3TEX A;  4N6E B;  2O2V B;  2RDB C;  3VQI A;  4W9K A;  1HZ5 A;  1MPE A;  4MGI E;  3RCZ A;  4LNK A;  3TBL D;  4GDL B;  2IGG A;  4OW0 A;  3RNA C;  2QCZ A;  1T3Q A;  2AEH A;  4WH4 A;  4MAC A;  2PEA A;  4HK2 A;  2JZZ A;  1F2R I;  2N1V A;  2WXF A;  1SXT A;  4EKU A;  2IJ0 A;  1E7V A;  2SEB D;  1NEN B;  2WDT B;  4NPN A;  4HDQ A;  2NBW B;  3QQ8 B;  2KTF A;  2MH7 A;  3QAR A;  3UIN B;  3VTV A;  2K9X A;  4AJY B;  5TSS A;  1OFF A;  2W3S A;  4ZDV A;  3Q14 C;  2IO3 B;  3K9P B;  1QZE A;  4C4V A;  2MW5 A;  1L4D B;  3PZ7 A;  4E3C A;  1ZDX A;  2J4X A;  3VH4 B;  2WDQ B;  3AU5 A;  4RGN A;  3PRM B;  1YOV B;  3DOW A;  5BO4 B;  3PLU A;  5LXI B;  1D6E C;  1XF5 L;  3V61 A;  3VUW A;  3LYY A;  1WM3 A;  1ZW7 A;  5IOI A;  4K3B A;  3ZJV A;  4TKN A;  2WX1 A;  4P16 A;  2FNJ B;  2LGX A;  3E56 A;  3L13 A;  1I4P A;  1UBQ A;  3GOE A;  3ZXR A;  2KWV B;  2MLB A;  4KX6 B;  5E6O A;  1JML A;  2MWS B;  1L0Y B;  3IBE A;  3PRP B;  1I4R A;  4EFO A;  2ACZ B;  3ZKJ C;  3NZU A;  3MTN B;  3W2D A;  4DK5 A;  1ZOY B;  3A1Q B;  3AU4 A;  3U30 A;  1J8C A;  1WGK A;  2KTR A;  2GI9 A;  4FJV B;  1WI0 A;  2DEN B;  3Q3O C;  4IC7 B;  1FMA D;  3VFK A;  1STE A;  1YJI A;  1PYW D;  3ZJT A;  3SEB A;  3TEY A;  4KIK A;  4UDU C;  2JU6 X;  1FFU A;  2IY1 B;  4US9 A;  3I3T B;  1KLG D;  3Q3N C;  2HTM E;  5DPT A;  4E71 A;  3H9D A;  3PHX B;  3AXC A;  3ECI A;  1ZXH A;  5AZH A;  2L3Z A;  3A9J A;  1YX5 B;  3ENE A;  4IWO A;  3W5V B;  2WNM A;  2AYO B;  2NBU A;  3IHP C;  1WJN A;  1LFD A;  3DWG C;  4KKI A;  4F8C B;  1UNS A;  2HJ8 A;  3Q8C A;  4FAD A;  3HHM A;  3NRZ A;  2YEP F;  4A3P A;  3AEE B;  1WWT A;  4M8M A;  1QLB B;  1N5W A;  2BYE A;  1Y56 A;  2EMS A;  2FE8 A;  1HEZ E;  1J7C A;  3NUH B;  1RWS A;  4RF1 A;  4AQ7 A;  1DOI A;  4YSZ B;  2W82 A;  2Z0D B;  4IWP A;  1WXQ A;  3DBL I;  5DPR A;  4LNN A;  2N9E B;  2KAC A;  3OLM D;  3CIR B;  1ENF A;  1VLB A;  4G3X B;  3SU8 X;  2OHF A;  1A5R A;  4HCN B;  2RPQ A;  3GP7 A;  3V05 A;  3MC0 B;  2BVC A;  1DGJ A;  3T3N A;  2QDF A;  1L0X B;  4CQN A;  1B1Z A;  4W9H A;  2NTT A;  3AED B;  3OJ3 A;  2LGS A;  3EC8 A;  1KJT A;  1XLP A;  3Q8E A;  3AE6 B;  1OTR B;  1JQ4 A;  2M0X A;  4MJS B;  1P1A A;  2UYZ B;  3R66 C;  3DPD A;  2KTR B;  1AW7 A;  1EUV B;  2MQJ A;  4S0R A;  3A1Q A;  2KWC A;  2Y5B B;  4MGK E;  3TL5 A;  4M01 A;  1WSP A;  1KTK A;  4WAF A;  3P63 A;  2RR9 A;  3SHQ A;  3BY4 B;  3QX1 A;  4M0W B;  2LUE A;  3I57 A;  1HA5 A;  2D3G A;  1JWM D;  3FC4 A;  3LXF A;  4MJS A;  1P7E A;  2KYW A;  4MEM A;  3RYT A;  2BKF A;  3PSE B;  3WA0 A;  2N0S B;  1MG8 A;  2LXA A;  3OJ4 B;  1C1Y B;  2JWZ A;  2BGF A;  3R7R A;  4FHK A;  4JWU C;  3R3M A;  2FUH B;  2MCN B;  2WP9 B;  1WZ3 A;  3TEZ A;  3BZD B;  2HJ1 A;  3W1S C;  1UEL A;  2WWZ A;  2K5P A;  3Q8A A;  1P7F A;  1Q5W B;  2WXJ A;  1HXY D;  1AWD A;  1R7S A;  3NVV A;  2O6V B;  3GE3 C;  1KF6 B;  2J52 A;  1TJE A;  3GS2 A;  1H4R A;  2GBJ A;  1TS4 A;  4KZC A;  2ON8 A;  5BMI A;  2FCM A;  2J0M A;  4K3C A;  2DYB A;  2FAZ A;  1V80 A;  3L4P A;  4B0M A;  1T6B X;  2KDE B;  3ZQ4 A;  2REX A;  3U7Z A;  3QJZ A;  2CKH B;  1I4Q A;  1C4P A;  4GXB A;  4M00 A;  4NZL B;  3U2S C;  1X1M A;  4BOS C;  1ZGU B;  3ZRF A;  3KVF B;  1XCT L;  2KQS A;  2PE9 A;  2JT4 B;  1PDX A;  4XX5 A;  2JUO A;  3M63 B;  3UF8 A;  4IKG A;  3OWE B;  2HDE A;  3IG3 A;  3AE1 B;  3I63 C;  5AZF A;  4EZJ A;  4ASW C;  4MSM B;  2YVC A;  3MC8 A;  4GOC A;  3MC9 A;  4RGT A;  2GB1 A;  2FIF A;  4AS1 A;  3L10 B;  1Q10 A;  4F7Z A;  2JZP A;  4FN2 A;  4DWF A;  1FIQ A;  4OVV A;  3DHG C;  4BKG A;  3FIL A;  3CF6 E;  1ZE3 D;  4ZHO A;  4KIK B;  4WWP A;  2KVR A;  2M56 B;  1SIJ A;  2FCN A;  4LNF A;  3RFZ B;  2LJ5 A;  1XLN A;  4ZRP A;  2L05 A;  4YTM B;  5D7G A;  3DQV A;  3DVG Y;  1H8C A;  1GPX A;  4ZYN A;  4XWT A;  1Z2M A;  3ZNH B;  2FUG 1;  2J7Q B;  4HPP A;  4HLE A;  4JX1 C;  4NAW B;  4WIP A;  1FXA A;  3VTW A;  4IG7 B;  2ZCC A;  3KUC B;  1WR6 E;  4J3O D;  1D5Z C;  3MHS D;  4ANX A;  2AX5 A;  3BK2 A;  4DBG A;  3WAN A;  2KMA A;  4A9A A;  1PGX A;  4HJG E;  2K8H A;  2QMT A;  1HTQ A;  3KUZ A;  3VR9 B;  5IP4 D;  4GLS C;  2JPH A;  1HTO A;  1RFA A;  4N58 A;  1ROE A;  2I1J A;  1PQS A;  3N9Y C;  4RM9 A;  2WS3 B;  1YQ3 B;  3PV1 A;  3TEW A;  2ZVN A;  2ASQ A;  1N6Z A;  3URY A;  4NAM A;  1WJU A;  3TUO A;  2NBV B;  1YIW A;  1T0Q C;  1L6U A;  4F1S A;  1SBB B;  4W9J A;  2LHE A;  2NMQ A;  2MBB B;  1EU3 A;  1IPG A;  3PT2 B;  1YJJ A;  1WE6 A;  2VZK D;  4D2K A;  1WZ0 A;  1WF9 A;  5EE9 A;  1S3S G;  3DDC B;  2MP2 A;  4ARC A;  3ALB A;  2D10 A;  1GB4 A;  4EZK A;  1SE2 A;  3LJ3 A;  4WUR A;  1MVK A;  1KRH A;  1QOG A;  1R4N I;  3NVW A;  2X8X X;  3WAO A;  4BVU C;  2K0P A;  1WXS A;  2KJ6 A;  2PE6 B;  2D3C A;  4II2 B;  4IWQ A;  2WXP A;  1WRD B;  3TIX A;  1YX6 B;  3Q3F A;  1ET6 A;  3ZTD A;  3BYY B;  4FJY A;  4USA A;  3B0A A;  1V6E A;  3U52 E;  2LJI A;  1CQV A;  3PTF C;  2OJR A;  1D5X C;  1N62 A;  4YSY B;  3B9J A;  2DNF A;  4TMA B;  5IN7 A;  2M1M A;  1JWU D;  2DYM A;  4XGA B;  1JCK B;  2J0K A;  2MHJ A;  3J9C A;  1NVI D;  4ZOH C;  4XE0 A;  4JQW C;  1I4H A;  4TUU A;  4IDI A;  3PS6 A;  4WJP A;  4ARI A;  1YN4 A;  2SAK A;  2V3S A;  4OHJ A;  1E8W A;  1FCL A;  4L1B A;  2G45 B;  3DBR I;  2CHW A;  1WXV A;  3U8Z A;  1CMX B;  3T9L A;  3APC A;  1ESF A;  1YNT E;  1D5M C;  5MPO A;  4BKT A;  5IAA C;  3DBH I;  3ML8 A;  1HQR D;  3CST A;  2LGD A;  2INC C;  3L16 A;  1BML C;  2MRP A;  4NNJ B;  1FPY A;  2AL3 A;  3ZO5 B;  5J2R A;  1G6J A;  2V0G A;  1XT9 B;  2C5L C;  1VD2 A;  2LGI A;  2KN4 A;  4C7Z A;  2Y3A A;  1KH0 A;  1IBX B;  1UD7 A;  1WGY A;  2KFJ A;  4EUT A;  5G2N A;  3R2T A;  3PLV A;  5T8I A;  2V1Y A;  2DWQ A;  1N5X A;  2C7H A;  2WXH A;  1T0Y A;  3KWL A;  1C3T A;  2ZVO A;  1JRP A;  4IUM B;  4RGO S;  2G4D B;  5HHD G;  5C3J B;  1EO6 A;  2EMT A;  2JY6 A;  2O6V A;  5D3D A;  3RNB C;  2XK5 B;  1EF5 A;  3EHV A;  1J7A A;  1GB1 A;  1KOT A;  1F2R C;  2LVP A;  3SD5 A;  3V6C B;  3GB1 A;  3AE9 B;  2WX0 A;  2BS3 B;  4GN1 A;  4YWG G;  3ZNI D;  1FNW A;  2B3A A;  1ET9 A;  3R8B A;  2JF5 A;  4HJK A;  3JVZ X;  3KYD D;  4B6W A;  1E7U A;  5EDS A;  1VDV A;  2CHX A;  2G3Q B;  2IPK D;  1J19 A;  1VZ6 A;  3TMP B;  1UH6 A;  1WIA A;  2GBN A;  4FBJ B;  2KT7 A;  1XCQ L;  2NR2 A;  3IAS 1;  2LVQ A;  4B9K A;  2XN9 C;  3MHZ A;  3ZUN A;  1L7Y A;  2DAJ A;  2LAS A;  1GUA B;  2KFK B;  3EFU A;  3DHH C;  3VDZ A;  3DHI C;  3N30 A;  5J18 A;  4RCO A;  3KLS X;  4A55 A;  1TS3 A;  1TKE A;  2ZEQ A;  1XLQ A;  1FRD A;  1SGH A;  1P3Q U;  2V3N A;  1SSN A;  3CSF A;  1PGA A;  2IBI B;  2N9P C;  3N1X C;  4M02 A;  5DPS A;  2AQ1 B;  2JZ3 B;  2ONQ A;  1LO5 D;  2QHO A;  1RYJ A;  4RFB A;  2BBC A;  4AJW A;  2PJH A;  1FXI A;  3U7D A;  3Q3J A;  2KK8 A;  3TCA A;  1P98 A;  3JSV A;  1LGR A;  3A4R A;  2EKE C;  1AAR A;  2IO2 B;  2KJR A;  3RD2 A;  2WHI A;  1K53 A;  1F52 A;  4I6L B;  3V60 A;  3Q69 A;  2AQ2 B;  2BQQ A;  4EEW A;  4WJN A;  1EU4 A;  1L2N A;  3ABV B;  3AI5 A;  2N7D A;  1QKZ A;  5E6N A;  1N63 A;  3P1M A;  2I2Y A;  4GDK A;  2L83 A;  3B1L X;  1E0Z A;  4NQL B;  4GMV A;  4EZL A;  1V1O A;  1FFV A;  1VZ8 A;  3CWI A;  3IFW B;  1ZDV A;  2RSU A;  2PVG C;  2VH1 A;  3KH0 A;  4BBN F;  3ZXV A;  5H8Y E;  4WJQ A;  1GC7 A;  4FA6 A;  5JHB A;  2V9H A;  3VUX A;  3ML9 A;  3VAW A;  2XBB C;  4K7W A;  4PS3 A;  3NS1 A;  3RN9 C;  2JXX A;  5KHQ A;  5I4D A;  3C8Y A;  2YEP B;  3NZ3 A;  4II3 B;  4PYU A;  2PPH A;  4MT5 A;  2XEW A;  4DXA B;  4P7I A;  4W9L A;  2DZM A;  2E6X A;  1WJ4 A;  2DBY A;  4G0N B;  4HRO A;  4DHZ B;  1UWM A;  3A9K A;  1B9R A;  4EE2 A;  2TSS A;  5DPW A;  3Q3M C;  2D5G A;  2IZV B;  1BXT A;  1C77 A;  1XLO A;  1C79 A;  2M0A A;  3PZD A;  1FNV A;  1WX9 A;  4L2Y A;  5EE1 A;  1N60 A;  2KWD A;  2C7N B;  2LMC A;  3PRZ A;  4NAW A;  2KDM A;  1UBI A;  2KAN A;  4GGQ A;  3M62 B;  1TKY A;  2KFK A;  2IND C;  1WM2 A;  3RUL A;  2JYE A;  1WH3 A;  1OEY J;  1C4C A;  5HFY A;  2NPT A;  3BWU D;  2W55 A;  4ICV A;  1V9J A;  4JPS A;  2RDH A;  1IP9 A;  2WGS A;  1YD8 U;  1SE9 A;  5CX3 A;  4ITK A;  3W1S A;  1UZX B;  2K39 A;  2MBQ A;  3H7S A;  3UQB A;  2OED A;  1FRR A;  5IA7 A;  1I4G A;  1GNU A;  2RMM A;  5FR3 A;  2RDG A;  2O2V A;  5CHW A;  1UGJ A;  4C56 C;  3V6E B;  3T3O A;  2GBM A;  4HWI B;  4FUL A;  4W9C A;  3AMZ A;  2NS5 A;  4P6V F;  2KX0 A;  4HRS A;  3C19 A;  1F1H A;  3RNE C;  2AL6 A;  4HVB A;  2NVU I;  2BWE S;  2G9H D;  1P0R A;  1XQQ A;  3V3X A;  3PVL A;  3ZYY X;  2LFI A;  1OQY A;  4WQO B;  2L1A A;  1FO4 A;  2X38 A;  4RGM A;  2QJL A;  2LHD A;  4LCD E;  3HM6 X;  2K8B A;  1CK1 A;  1E8X A;  2KDF B;  3WAL A;  5LXH A;  1WYW B;  5AUK A;  2MJE A;  3HRD D;  4W9G A;  4AWJ A;  1TZO A;  3O65 B;  4J6I A;  1WY8 A;  4WAA A;  4C4V B;  2LUM A;  2QIL A;  3EUB 2;  1Q1O A;  3I5J C;  1WE7 A;  3DVN V;  1E9M A;  2WQY B;  2MJD A;  2PIA A;  3APF A;  4GU2 A;  4M0W A;  4LJP B;  4PS7 A;  2HTH A;  2ZCB A;  1SB3 C;  2PVO D;  1TT5 B;  2K22 A;  4MGZ E;  1EWC A;  3C0R B;  5BMG A;  4PK1 A;  3QC8 B;  4KVG B;  2INP E;  2KQ4 X;  2ICI A;  1RFK A;  5G55 A;  1WGG A;  1EF1 A;  2PKO A;  3Q8B A;  2N9X A;  1TIF A;  4ZHP A;  2LRW A;  4HPM B;  2D3A A;  3L17 A;  4MH0 E;  1JAL A;  4RH6 A;  4XZ4 A;  3RUI B;  1L4Z B;  2M17 A;  2BYT A;  4ZRQ A;  2CHZ A;  3NZS A;  2GLS A;  4OZA A;  1TBE A;  3L08 A;  5JZE B;  4DDG D;  2Y5C A;  3ZJU A;  1V5T A;  2WU2 B;  3AEF B;  3APD A;  5BYS A;  2BF8 B;  4BKS A;  3PPA A;  2IGH A;  3WCQ A;  3ZNZ B;  1GG3 A;  1L6V A;  1WMH B;  5EE0 A;  4AP4 C;  4ANU A;  3IXS A;  1UF0 A;  4YXD B;  1J7B A;  4KGS A;  3DBS A;  3AE2 B;  2KAJ A;  1ZUD 2;  2C60 A;  2G1E A;  1VCB A;  2Z8L A;  2AQ3 B;  1RRB A;  5EE3 A;  3SFE B;  1QOA A;  3BK1 A;  4K81 A;  1WR1 A;  2WXN A;  3AE4 B;  1R4N B;  1QQR A;  2A5U A;  2MP2 B;  2QC8 A;  4XDC A;  3K9O B;  3UIP B;  3H7P B;  3UGB B;  3WAM A;  1MG4 A;  2IYD B;  1OGW A;  3OAW A;  1NI2 A;  3IAM 1;  3P4S B;  3PO0 A;  4FLH A;  4NJ6 A;  1GC6 A;  1LM8 B;  1EM7 A;  2IDY A;  1J0G A;  4GSW A;  1MFW A;  4B95 A;  1M94 A;  1WGH A;  4US8 A;  5LNK 1;  4FJZ A;  5GMV A;  1FXT B;  3WAP A;  1SE3 A;  4HEA 1;  5IKC M;  2R61 A;  4TQ0 A;  1TTN A;  2WDR B;  3OG5 A;  3ZNG C;  3BVZ A;  3FAH A;  4IW0 A;  2KX3 A;  2RD0 A;  4JGH B;  2DZJ A;  3N1Y C;  3S2A A;  3UIO B;  3PZ8 A;  4REZ A;  2GRI A;  2B76 B;  4BBN C;  2BKR B;  4RF0 A;  1N61 A;  4GB9 A;  4KSK C;  4ZYS A;  4DDI D;  2OOB B;  1R4M I;  1LXD A;  1TGZ B;  2KC1 A;  2FCS A;  4KZ0 A;  2J42 A;  3PRE A;  1ZP0 B;  1L0V B;  2ZW0 A;  2L8J A;  5D6J B;  2W54 A;  1JWA D;  3EFC A;  3AEC B;  3ZW3 A;  2JX5 A;  2CR5 A;  1YJ1 A;  2J0J A;  2JRI B;  1V8C A;  2KC2 A;  4ZRK A;  2IY0 B;  3ZIM A;  2VH2 A;  1JWS D;  2MJ3 A;  2INN E;  5CTR C;  2IO0 B;  2KQ7 A;  2GMI C;  3NJT A;  3AE8 B;  2WXO A;  2L0F A;  3ONS A;  5E6P A;  1IUE A;  5L95 C;  2BYF A;  1FNU A;  2JXT A;  1TKG A;  4LTU A;  4AUQ C;  2JQR B;  1KLV A;  4GIV A;  2K6D B;  3NVZ A;  1I7H A;  2N1W A;  1GAQ B;  3GE8 C;  2JWU A;  4MDK E;  4HXD A;  3X0W A;  3RMK C;  1NI3 A;  1WX8 A;  1ZPS A;  4PS8 A;  1XD3 B;  2BB6 A;  4WWM A;  5H92 C;  1V49 A;  4KSL C;  1YQ4 B;  5AUI A;  3KQ4 A;  4IM2 A;  1FM0 D;  1XO3 A;  2DX5 B;  3DVN U;  1DOX A;  4FHJ A;  1SF0 A;  2W9N A;  2ZW1 A;  4N9F 4;  1QOF A;  4WQM A;  4P1C C;  4ANW A;  3MJW A;  3H6N A;  3DVG X;  1RAX A;  3P42 A;  2KZR A;  3ZDT A;  2BS4 B;  3QK0 A;  1ACC A;  3MP9 A;  1UGM A;  2LI5 A;  4W9D A;  3TSS A;  4TQ1 A;  2WXG A;  3RT3 B;  5BYQ A;  1TS5 A;  2CU1 A;  4XDD A;  1M4V A;  2ZNV B;  2MBH A;  1SE4 A;  3DBL B;  1IYF A;  3U4E G;  5DCN A;  2WXQ A;  3P4Q B;  3AUL A;  1HZ6 A;  3QCA A;  1MI0 A;  4KKJ A;  2VZK B;  4BFR A;  4IM3 A;  1MHH E;  4N59 A;  4OZC A;  1E8Z A;  3AE3 B;  2KD0 A;  2MBE A;  5CHV C;  2L52 A;  3NS8 A;  4S17 A;  2ZPY A;  1KM7 A;  5L83 A;  2I38 A;  2BYV E;  4CHK A;  2PMV A;  4DHZ E;  2R2Q A;  3N32 A;  1KLU D;  1D4B A;  1D3Z A;  2EKI A;  3M95 A;  3GZN I;  3KYC D;  1K52 A;  3EGR A;  2QIE B; 
#chains in the Genus database with same CATH homology
 1OEY J;  4MSM B;  2YVC A;  3X23 A;  2G4S A;  4GOC A;  4WWN A;  2NPT A;  4IM0 A;  2FIF A;  2DZK A;  3L10 B;  2L00 B;  4CYE A;  4HPL B;  4ICV A;  2DAF A;  1TZ1 A;  1E5W A;  2CS4 A;  2KDI A;  1V9J A;  2KXJ A;  2LGY A;  1K8R B;  3SDL C;  2WYQ A;  4F7Z A;  1IP9 A;  1YD8 U;  2DHZ A;  4FN2 A;  4DWF A;  1SE9 A;  5CX3 A;  2KN5 A;  3VTU A;  3W1S A;  2KLG A;  1UZX B;  2K39 A;  2MBQ A;  4OVV A;  3H7S A;  3UQB A;  2N7E A;  4BKG A;  2GOW A;  4X57 B;  4AOF A;  3CF6 E;  4DHJ D;  5IA7 A;  1GNU A;  4KDI C;  2MA9 B;  4XC2 A;  2O2V A;  4KIK B;  4WWP A;  5CHW A;  2AWT A;  4MGY E;  2I1K A;  2KVR A;  3QA8 A;  2GBK A;  5TR5 A;  2KOX A;  3V6E B;  2FCN A;  2GBM A;  4ICU A;  4HWI B;  2LJ5 A;  4FUL A;  4URK A;  1I35 A;  2L05 A;  5D7G A;  4TV3 A;  4W9C A;  3DQV A;  3DVG Y;  1H8C A;  2NS5 A;  4ZYN A;  4GDK B;  2KX0 A;  3ZDM C;  1Z2M A;  1S1Q B;  2LRU A;  3QHT A;  3JW0 X;  3ZNH B;  2J7Q B;  2AL6 A;  1V2Y A;  1V86 A;  3A9J B;  4HLE A;  3PGE A;  4HVB A;  3TJP A;  1ZKH A;  4A20 A;  2NVU I;  2BWE S;  4NAW B;  3UQA A;  1P0R A;  1XQQ A;  1WGR A;  3VTW A;  2O2V B;  4IG7 B;  2ZCC A;  3PVL A;  3KUC B;  1WR6 E;  3VQI A;  4W9K A;  1OQY A;  3RZW C;  4WQO B;  3ZRC A;  2KKC A;  3MHS D;  3NY5 A;  2ZZP B;  4MGI E;  4W9I A;  4ANX A;  3RCZ A;  4DBG A;  4LCD E;  3JYU A;  1V81 A;  3T8M A;  2KMA A;  3WAN A;  3HM6 X;  3A33 B;  2K8B A;  2K8H A;  1E8X A;  2KDF B;  4GDL B;  3TBL D;  3WAL A;  1WGD A;  1WYW B;  4AWJ A;  4W9G A;  5LXH A;  3KUZ A;  3O65 B;  3BIN A;  2AEH A;  4J6I A;  1WY8 A;  2K25 A;  2JPH A;  4WAA A;  4I6P A;  1RFA A;  5CHF A;  1Q1O A;  2PEA A;  2I1J A;  1PQS A;  4HK2 A;  1WE7 A;  2KO3 A;  3DVN V;  4RM9 A;  3DCG A;  3APF A;  2JZZ A;  2LD9 A;  3PV1 A;  5C23 A;  2N1V A;  5C1Z A;  2N4F A;  2ZVN A;  1OEY A;  2ASQ A;  4GU2 A;  4EKU A;  4LJP B;  4PS7 A;  2A4Z A;  2HTH A;  1E7V A;  2ZCB A;  2LVO A;  1WJU A;  2NBV B;  2KMC A;  1YIW A;  2WDT B;  4NPN A;  4HDQ A;  2NBW B;  3QQ8 B;  4F1S A;  2KTF A;  4MGZ E;  3QAR A;  4W9J A;  4I6N B;  2MBB B;  3C0R B;  3UIN B;  1IPG A;  3VTV A;  3PT2 B;  4AJY B;  1WE6 A;  1P9D U;  3VUY A;  4ZDV A;  3QC8 B;  4KVG B;  3A9K B;  1WZ0 A;  1WF9 A;  1GJZ A;  2IO3 B;  4MSQ B;  1S3S G;  3K9P B;  1QZE A;  3DDC B;  2MP2 A;  1ISN A;  2MW5 A;  3ALB A;  1WFY A;  2D10 A;  4E3C A;  5G55 A;  1WGG A;  1EF1 A;  4EZK A;  2N9X A;  4RM8 A;  2Z59 B;  3LJ3 A;  3VH4 B;  2LRW A;  4HPM B;  1R4N I;  4PYZ A;  3L17 A;  4MH0 E;  3WAO A;  3AU5 A;  2YLM A;  3PRM B;  4XZ4 A;  3D32 A;  2HD5 B;  3DOW A;  3ZLZ A;  1Z5S B;  2C9W B;  3RUI B;  4BVU C;  4A3O A;  5BO4 B;  1WXS A;  2M17 A;  2KJ6 A;  2PE6 B;  2R2O A;  3PLU A;  5LXI B;  5HKH A;  4II2 B;  1E8Y A;  4IWQ A;  2NPT B;  1WRD B;  2CHZ A;  3V61 A;  3NZS A;  3QIJ A;  1YX6 B;  3TIX A;  3VUW A;  3Q3F A;  1WM3 A;  3ZTD A;  1TBE A;  4G50 A;  3CMM B;  4FJY A;  3L08 A;  1ZW7 A;  4DDG D;  5JZE B;  1V5T A;  5JHA A;  3B0A A;  1V6E A;  3APD A;  4JLC A;  3PTF C;  2OJR A;  1LQB A;  3HM3 A;  3N3K B;  4TKN A;  2WX1 A;  2RGF A;  2BF8 B;  2FNJ B;  2LGX A;  2M1M A;  3VVW B;  1BT0 A;  3PPA A;  4MEL A;  4BKS A;  2DYM A;  3L13 A;  3NOB A;  2J0K A;  2K8C A;  2VRR B;  4EOY A;  1UBQ A;  2HE7 A;  3ZNZ B;  3GOE A;  3PHW B;  2DYO A;  1GG3 A;  2KWV B;  2MLB A;  5E6O A;  4WJO A;  1WMH B;  2UWQ A;  4AP4 C;  4ANU A;  4JQW C;  3VHT C;  5AEK B;  2MWS B;  4TUU A;  3DBS A;  3IBE A;  3PRP B;  4EFO A;  3PS6 A;  4WJP A;  3ZKJ C;  4EZJ A;  3NZU A;  2C60 A;  3MTN B;  2V4L A;  4DK5 A;  3M3J A;  3VXW A;  1WXA A;  1VCB A;  4G11 A;  2LXC A;  2V3S A;  3A1Q B;  4RMA A;  1E8W A;  3AU4 A;  3U30 A;  3A4S C;  1RRB A;  2G45 B;  3DBR I;  2KWU B;  1J8C A;  2CHW A;  4KDL B;  1WXV A;  2KTR A;  4FJV B;  4KV2 A;  1WI0 A;  2DEN B;  3L54 A;  3U8Z A;  4K81 A;  1CMX B;  1WR1 A;  3T9L A;  3APC A;  1RLF A;  2A5U A;  4IC7 B;  1V5O A;  2MP2 B;  4BKT A;  4HDO A;  3DBH I;  2ZPN A;  3ML8 A;  5IAA C;  3K9O B;  3UIP B;  3CST A;  3H7P B;  2LGD A;  3UGB B;  3VFK A;  2Z0E B;  5D2M B;  2L7R A;  4OVU A;  3WAM A;  3WIM A;  2LWP A;  3L16 A;  2IYD B;  1OGW A;  3OAW A;  1NI2 A;  2MRP A;  4NNJ B;  4KIK A;  2AL3 A;  4FLH A;  4NJ6 A;  3ZO5 B;  1GC6 A;  2IY1 B;  2K1F A;  5J2R A;  1LM8 B;  3HIZ A;  1G6J A;  3I3T B;  1J0G A;  4GSW A;  1XT9 B;  4B95 A;  2C5L C;  2FCQ A;  1M94 A;  1VD2 A;  1WGH A;  5KHO A;  5DPT A;  1I42 A;  4E71 A;  4MM3 A;  1WX7 A;  4FJZ A;  3RZF A;  3H9D A;  1FXT B;  5GMV A;  3WAP A;  3PHX B;  1UD7 A;  4NQK E;  3AXC A;  2MSE D;  3ECI A;  5AZH A;  2L3Z A;  3A9J A;  4ZRI A;  1WGY A;  2KFJ A;  4EUT A;  5G2N A;  4TQ0 A;  5AZG A;  1TTN A;  3PLV A;  3ZNG C;  1U4A A;  4IW0 A;  1YX5 B;  2V1Y A;  3ENE A;  2KX3 A;  4IWO A;  2RD0 A;  3ZTC A;  2C7H A;  1HE8 A;  2AYO B;  1T0Y A;  2NBU A;  3IHP C;  4JGH B;  1C3T A;  2ZVO A;  1WJN A;  1LFD A;  2DZJ A;  4IUM B;  2G4D B;  4F8C B;  1EO6 A;  2EMT A;  2JVC A;  2HJ8 A;  3S2A A;  2JY6 A;  2O6V A;  4W9E A;  3UIO B;  4ZRJ A;  2XK5 B;  4BBN C;  1EF5 A;  2BKR B;  3EHV A;  4FAD A;  3HHM A;  4GB9 A;  4KSK C;  1KOT A;  3SD5 A;  2D2Q A;  2LVP A;  3V6C B;  4DDI D;  2OOB B;  2WX0 A;  4A3P A;  1R4M I;  1LXD A;  1NDD A;  4M8M A;  1TGZ B;  4GN1 A;  3ZNI D;  4BKS D;  2KC1 A;  1JRU A;  2FCS A;  2B3A A;  2JF5 A;  4KZ0 A;  4HJK A;  3JVZ X;  3HK0 A;  3KYD D;  3PRE A;  2BYE A;  4B6W A;  1E7U A;  5EDS A;  2EMS A;  1NBF C;  2G3Q B;  2CHX A;  2L8J A;  5D6J B;  3TMP B;  4ANV A;  3QAQ A;  1UH6 A;  1WIA A;  2GBN A;  3H7P A;  4WWO A;  3ZW3 A;  4FBJ B;  2MX2 A;  2CR5 A;  2GBR A;  4DHJ B;  2KHW B;  1YJ1 A;  4BOZ B;  2J0J A;  2NR2 A;  2LVQ A;  2JRI B;  1F9J A;  4B9K A;  3ZUN A;  1L7Y A;  2O6V D;  2Z0D B;  2KC2 A;  4IWP A;  2DAJ A;  2LAS A;  2IY0 B;  1GUA B;  2KFK B;  3DBL I;  3EFU A;  4ZRK A;  3ZIM A;  5DPR A;  3VDZ A;  3N30 A;  2JRH A;  3LDZ E;  5J18 A;  4E74 A;  2N9E B;  2IO0 B;  5CTR C;  2KQ7 A;  2GMI C;  3ZVV A;  3OLM D;  2L0F A;  3ONS A;  3R7Q A;  5E6P A;  5L95 C;  2BYF A;  4M8N A;  1YQB A;  3QWZ B;  4G3X B;  3SU8 X;  5FR6 A;  2ZEQ A;  1A5R A;  1SGH A;  1P3Q U;  4HCN B;  2RPQ A;  5D94 A;  3CSF A;  4AUQ C;  1KLV A;  2D11 A;  4GIV A;  2K6D B;  1WMH A;  3JSV B;  4HCP B;  3W1Y A;  2N1W A;  4LJO B;  4W9H A;  1Q0W B;  2IBI B;  4K7S A;  4MDK E;  2N9P C;  4HXD A;  3OJ3 A;  4GDL A;  3EC8 A;  3X0W A;  4K1R B;  4K7U A;  1KJT A;  5DPS A;  1OTR B;  2JZ3 B;  1WX8 A;  2QHO A;  2M0X A;  2ZNV C;  4AJW A;  2PJH A;  4PS8 A;  4MJS B;  3EEC A;  3U7D A;  3Q3J A;  1P1A A;  2KK8 A;  2UYZ B;  3R66 C;  3DPD A;  1P98 A;  3TCA A;  2KTR B;  1XD3 B;  3JSV A;  1EUV B;  3NHE B;  3A4R A;  2EKE C;  1AAR A;  2MQJ A;  1V49 A;  2D07 B;  2IO2 B;  2DZI A;  2KJR A;  3A1Q A;  2KWC A;  3RD2 A;  4KSL C;  1WXM A;  2Y5B B;  4MGK E;  4I6L B;  3V60 A;  3TL5 A;  3VH3 B;  3IVF A;  4EEW A;  4IM2 A;  4WJN A;  2KJH B;  2RR9 A;  3B08 A;  4NJ7 A;  3SHQ A;  1L2N A;  3AI5 A;  2DX5 B;  3DVN U;  1Y8R C;  3BY4 B;  3QX1 A;  4M0W B;  2LUE A;  1SIF A;  2N7D A;  4FHJ A;  2W9N A;  5E6N A;  2D3G A;  3V62 A;  4GDK A;  2ZJD A;  4N9F 4;  4MJS A;  2BWF A;  2L0T A;  3B1L X;  5LLI A;  2BPS A;  1WJ6 A;  4GMV A;  2BKF A;  2K6Q A;  3PSE B;  4MEM A;  4NQL B;  3RYT A;  4EZL A;  3WA0 A;  5J17 A;  1MG8 A;  4CO7 A;  2LXA A;  2KNB A;  3OJ4 B;  3IFW B;  4ANW A;  2L76 A;  3MJW A;  1C1Y B;  2JWZ A;  3H6N A;  2RSU A;  3DVG X;  1RAX A;  2BGF A;  3R7R A;  3ZDT A;  2KZR A;  3KH0 A;  4BBN F;  4FHK A;  3R3M A;  2FUH B;  3QK0 A;  2MCN B;  3H1U A;  4WJQ A;  1WZ3 A;  1GC7 A;  4FA6 A;  5JHB A;  3VUX A;  3ML9 A;  3VAW A;  4W9F A;  3W1S C;  2XBB C;  4K7W A;  1UGM A;  1UEL A;  4PS3 A;  2WWZ A;  2KDB A;  2LI5 A;  4W9D A;  2C7M B;  2JXX A;  4TQ1 A;  5KHQ A;  1Q5W B;  3KUD B;  4II3 B;  4PYU A;  3RT3 B;  2MBO A;  2O6V B;  4JL9 A;  2PPH A;  2XEW A;  4DXA B;  2CU1 A;  2IO1 B;  4P7I A;  4W9L A;  2DZM A;  2ZNV B;  2MBH A;  1H4R A;  1WJ4 A;  2GBJ A;  2LZ6 A;  1IYF A;  4JIO U;  4KZC A;  4G0N B;  4LDT D;  5DCN A;  2FCM A;  4DHZ B;  2J0M A;  3AUL A;  4YL8 A;  3A9K A;  3QCA A;  3P2B A;  2DYB A;  2FAZ A;  4BFR A;  2M8S A;  4IM3 A;  5JH5 C;  5DPW A;  1V80 A;  2IZV B;  2KDE B;  1E8Z A;  2REX A;  2M4N A;  2FID A;  2KD0 A;  2MBE A;  2CKH B;  3QJZ A;  1E90 A;  5CHV C;  2KLC A;  3NS8 A;  3PZD A;  4GXB A;  2ZPY A;  4BOS C;  1X1M A;  1KM7 A;  1WX9 A;  3L0W B;  5L83 A;  4CHK A;  1ZGU B;  2BYV E;  3ZRF A;  2NCN A;  4DHZ E;  2R2Q A;  3N32 A;  3KVF B;  2C7N B;  2KQS A;  3KW5 B;  3PRZ A;  4NAW A;  2PE9 A;  2JT4 B;  4XX5 A;  1UBI A;  1D3Z A;  2JUO A;  2KAN A;  3M63 B;  4NY0 A;  2XK5 A;  4GGQ A;  3UF8 A;  3M62 B;  3M95 A;  2KFK A;  3IG3 A;  3GZN I;  3KYC D;  1WM2 A;  3RUL A;  5AZF A;  4ASW C;  1WH3 A;  4LDT B;  1J19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...