2NS5A

The conserved n-terminal domain of par-3 adopts a novel pb1-like structure required for par-3 oligomerization and apical membrane localization
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
SEFKVTVCFGRTRVDVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning-defective 3 homolog
publication title The Par-3 NTD adopts a PB1-like structure required for Par-3 oligomerization and membrane localization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ns5A00
2KFJA 5JH5C 2GBJA 2M0XA 4BOSC 2RPQA 3ZUNA 1NDDA 3X0WA 3PLUA 3ZNID 2BKRB 1I42A 2V1YA 1H8CA 2LASA 3M95A 1UELA 2JRHA 5CHWA 5E6NA 4ZRKA 3PHWB 2JZZA 2DAFA 5AZFA 5G55A 5LXIB 2QHOA 2CHWA 4BKSD 1P1AA 2DZMA 2KJ6A 3QC8B 4JL9A 4PS8A 4RM8A 4FHKA 4EZKA 2NBVB 2KVRA 4NJ6A 4P7IA 3K9OB 1WGGA 3NHEB 1ZGUB 2KOXA 1P3QU 3ZO5B 4F8CB 2BKFA 1Q5WB 2AL6A 4GGQA 4WJQA 2KC1A 1SE9A 4E3CA 3A9JB 4M8MA 4FBJB 3IFWB 3DBHI 3H7SA 3NOBA 4KV2A 3VH3B 3DDCB 1ZW7A 3TJPA 2KJRA 1LXDA 4FHJA 3PHXB 3VTWA 2KTRA 4DDID 4WQOB 2ZNVC 2K25A 3DVNV 2KWCA 4RM9A 1WXMA 2BYVE 4G50A 5KHQA 4HWIB 2KWUB 4E74A 3H9DA 3A4RA 2UWQA 3DVGY 3NZSA 2DZKA 1LM8B 5DPWA 5CHFA 4K1RB 3PT2B 2JXXA 3V6CB 4ASWC 2C5LC 3BY4B 1OQYA 4WAAA 1X1MA 1YX5B 2KMAA 4W9DA 2ZEQA 2HD5B 5HKHA 3SD5A 1WE6A 3WIMA 5G2NA 3VFKA 4HCNB 2MX2A 2JF5A 3DPDA 2R2QA 2ZPNA 2M8SA 4HDQA 1WH3A 4MGZE 4MGKE 2GOWA 3HM6X 2D3GA 2PJHA 1NBFC 2XBBC 3VTUA 3W1SC 2IY1B 1CMXB 2B3AA 4TQ0A 3ZKJC 4M8NA 1OTRB 2LXAA 2MWSB 2HJ8A 1IP9A 4IUMB 2LVPA 3DVNU 4GSWA 2AL3A 1F9JA 4K81A 4ANVA 4IG7B 2D2QA 3H1UA 2D07B 2ZVOA 1E7VA 3PPAA 3L08A 4MDKE 2MW5A 2PEAA 4EUTA 3R66C 2AEHA 4LJOB 4FLHA 1E8XA 2N1VA 2J0KA 3ZVVA 2BF8B 5AZGA 2VRRB 5CTRC 3OJ3A 2MBBB 3ZIMA 2Z0DB 1FXTB 3L54A 3RT3B 3LDZE 2JT4B 4B95A 2KWVB 4BKSA 4F1SA 3M62B 3JW0X 2FCMA 3WA0A 3H7PA 2MA9B 4A3PA 1BT0A 4DBGA 2KQSA 2M4NA 2ZVNA 5FR6A 1E8ZA 1XQQA 2FIFA 4B6WA 3DOWA 5D6JB 4TV3A 1A5RA 4MGYE 2IY0B 4W9IA 4IM0A 4AJWA 1WGRA 3ZTDA 3PLVA 4G11A 2Z59B 4MSMB 3ZNHB 1J0GA 2DYOA 4MH0E 4GDLA 2N7DA 4LJPB 3RULA 5AEKB 4LDTB 2LVQA 3A1QA 1WX8A 2FNJB 2MP2B 2XEWA 3AXCA 2C7MB 3TL5A 2IO3B 3RZWC 4IM3A 2NBUA 3EECA 3C0RB 2XK5A 1RRBA 2YVCA 4F7ZA 2KDBA 4PYUA 2J7QB 4HLEA 3ZLZA 1WY8A 2C7HA 4AWJA 1LQBA 2IO2B 2ZNVB 4JLCA 3N30A 4PS3A 3PV1A 3PRMB 5CX3A 4ZRIA 1E8YA 3ML8A 4HXDA 2KANA 2V4LA 2MBHA 2KQ7A 4DXAB 1V5TA 4BBNC 1WYWB 3LJ3A 3T9LA 4DK5A 4EEWA 3HIZA 2DYMA 3PSEB 4ZDVA 4MGIE 4HPMB 5GMVA 3QWZB 3QJZA 1RFAA 2KTFA 3N32A 4NAWA 2JPHA 4GOCA 1KOTA 4BKTA 4GU2A 2KDEB 4AJYB 5DPTA 2EMTA 4XZ4A 1WIAA 3ML9A 1WGDA 1PQSA 4DDGD 2O2VB 1E90A 1S3SG 2MBEA 4ZYNA 2MLBA 3Q3FA 3IG3A 4EKUA 1WJNA 2LRWA 1EUVB 2GBNA 3VTVA 3DBLI 3T8MA 1WF9A 2LGXA 4MSQB 4GB9A 2LUEA 3QA8A 2LRUA 4W9HA 3WALA 3HM3A 3ONSA 4MELA 2YLMA 1TGZB 5J2RA 4NJ7A 1MG8A 2G4DB 4EZJA 2DENB 1WX9A 3I3TB 5BO4B 4E71A 3L10B 3IVFA 2LD9A 3ALBA 3QQ8B 3APDA 4I6NB 4AOFA 3H7PB 3WAOA 2ASQA 4CHKA 3QAQA 5LLIA 1I35A 3ZRCA 4DWFA 2JVCA 2WDTB 3KUZA 1KM7A 2MP2A 3VUWA 2L76A 1WXSA 2BGFA 3B0AA 2K39A 1WE7A 1V9JA 2BYEA 2UYZB 4GDLB 4PS7A 4A20A 3A1QB 3UQAA 5E6PA 1UBQA 2A4ZA 4BFRA 2GMIC 4HCPB 1QZEA 2XK5B 3R7QA 2K6QA 2KDIA 5DPSA 2CKHB 1AARA 1TBEA 4NY0A 3QHTA 1EF5A 1P0RA 4KIKA 2MCNB 2WWZA 3ZTCA 2KN5A 4GN1A 3RD2A 1GC6A 2JZ3B 2K1FA 2A5UA 3PRPB 3Q3JA 3DCGA 3UIPB 4W9GA 4GMVA 2HTHA 2N9PC 2KLCA 2MSED 2RD0A 5JZEB 2KJHB 3NY5A 2IO1B 2L7RA 3D32A 2D10A 2NR2A 4FN2A 3A4SC 4FJYA 3X23A 2CU1A 5J17A 1UH6A 3A9KA 2FCQA 4BOZB 4G3XB 4NAWB 2JRIB 2O2VA 3L13A 4W9EA 2L0TA 3PGEA 5C23A 3R7RA 3TIXA 3DBRI 3V60A 4MEMA 5D2MB 1V5OA 3IHPC 3W1SA 4EFOA 5E6OA 1C3TA 4GXBA 4HDOA 1J8CA 1SIFA 1WZ3A 4KZCA 2DYBA 5L83A 3H6NA 4IW0A 4WJOA 2LXCA 4NQLB 2BYFA 2REXA 4TQ1A 2LVOA 3L0WB 2R2OA 3NS8A 1NI2A 4W9JA 3RCZA 1WFYA 2CS4A 3KUCB 3ZNZB 1JRUA 2MQJA 2GBRA 3AI5A 3V62A 4DHJD 3ZRFA 2C7NB 2LGDA 2Y5BB 1UD7A 3VQIA 2K8CA 2NBWB 3ZDMC 3SU8X 3PREA 2FUHB 3OLMD 3U8ZA 2BPSA 4NQKE 1GC7A 3WAMA 4WJNA 3APFA 2EMSA 1RLFA 2KKCA 3AULA 3PRZA 1V81A 2NPTB 4B9KA 1WX7A 3R3MA 2OOBB 4OVUA 2N4FA 3UF8A 2CHXA 2HE7A 3QX1A 3UINB 3DQVA 4G0NB 4II2B 1R4MI 2BWES 2MBOA 2OJRA 3SDLC 2PE9A 1GJZA 1WMHA 1RAXA 4A3OA 4DHZB 4DHJB 2W9NA 3HK0A 3BINA 4N9F4 3MJWA 2N7EA 3L17A 4IC7B 2FCNA 2MRPA 2JWZA 2RSUA 2JUOA 3L16A 3JVZX 3TBLD 2CR5A 1WR1A 4KIKB 1WI0A 2AWTA 2N9EB 2ZPYA 3RZFA 3GZNI 4NPNA 1WGHA 4URKA 2K6DB 4TKNA 2DAJA 4WWPA 1LFDA 3QCAA 1M94A 3VXWA 4W9CA 2NVUI 4ZRJA 3JYUA 2FCSA 1G6JA 4NNJB 2KO3A 3A9KB 3VVWB 2I1JA 1E8WA 3DBSA 3KUDB 2WX1A 1R4NI 3U7DA 2NS5A 2LWPA 5TR5A 3VAWA 4M0WB 2IBIB 1GUAB 3AU5A 4ANWA 1Y8RC 3WANA 2L0FA 2KX0A 1GG3A 4ANXA 2DHZA 3K9PB 4WWOA 1YQBA 1WGYA 5KHOA 3P2BA 3W1YA 3O65B 2KFKB 4IWOA 3MTNB 4WWNA 3AU4A 4HK2A 4I6PA 3VUXA 4GIVA 3JSVA 4IM2A 4KSKC 2DX5B 2NPTA 4BVUC 5LXHA 2G3QB 1VCBA 2L00B 2O6VD 5CHVC 2DZJA 3V6EB 4EOYA 1V2YA 5IA7A 3QIJA 3WAPA 1ISNA 4HPLB 1E5WA 3NZUA 2LZ6A 1KJTA 3MHSD 1TTNA 2J0JA 4BKGA 3PS6A 1KLVA 3DVGX 3GOEA 1L2NA 1UZXB 1YIWA 3KVFB 3B1LX 2FIDA 4TUUA 1WMHB 3PTFC 2I1KA 2WX0A 1YJ1A 2G45B 5DPRA 4PYZA 3CSTA 4BBNF 3CSFA 1T0YA 5AZHA 4HJKA 2PPHA 4W9LA 1XT9B 2O6VB 3CMMB 3KYCD 1EF1A 1UGMA 4J6IA 2KLGA 1WM2A 4II3B 2LI5A 4DHZE 2LJ5A 2ZCBA 4XX5A 1IYFA 4KDIC 2GBMA 2L05A 4IWPA 5D7GA 3VUYA 1WJ6A 2KHWB 1WM3A 1YX6B 4KVGB 3EHVA 2WYQA 3TMPB 2KZRA 4GDKB 4X57B 3UIOB 4HVBA 2L3ZA 3IBEA 4JGHB 3A33B 2KNBA 3M63B 4KSLC 3APCA 2C60A 2Z0EB 3M3JA 4W9FA 5C1ZA 2KK8A 4MJSB 2EKEC 2RR9A 2V3SA 5IAAC 1TZ1A 1ZKHA 2RGFA 2KFKA 4ICUA 3VDZA 4IWQA 3UGBB 3V61A 2K8HA 4JIOU 3VHTC 2DZIA 2PE6B 2D11A 1VD2A 3SHQA 4W9KA 3QARA 3RYTA 3RUIB 4XC2A 1P98A 1WXVA 2KMCA 4K7UA 3OAWA 5EDSA 3KYDD 2K8BA 1E7UA 2M17A 1OEYA 3JSVB 2G4SA 2JY6A 1J19A 1YD8U 2BWFA 1U4AA 2KD0A 3KW5B 4K7SA 4CO7A 2ZZPB 3A9JA 4K7WA 1HE8A 1Z5SB 2NCNA 2IO0B 4FJVB 4LDTD 3B08A 3TCAA 2C9WB 1OEYJ 1WXAA 4KZ0A 1P9DU 4MM3A 4LCDE 4WJPA 3UQBA 1C1YB 1IPGA 2IYDB 5J18A 4AUQC 3OJ4B 1D3ZA 4YL8A 2KC2A 1V80A 2MBQA 3ECIA 2KTRB 2KDFB 1UBIA 1Q0WB 1L7YA 3ZDTA 1XD3B 5JHBA 2O6VA 1OGWA 1WZ0A 5JHAA 1WR6E 2GBKA 2LGYA 4FA6A 3PVLA 2CHZA 4FJZA 2M1MA 1S1QB 4ANUA 5L95C 1EO6A 1K8RB 1Z2MA 2KXJA 2N9XA 4FADA 3CF6E 1GNUA 3ZW3A 5D94A 4EZLA 1WRDB 2FAZA 2KX3A 2J0MA 3QK0A 1WJ4A 4JQWC 3PZDA 4OVVA 1V49A 3EC8A 4I6LB 4GDKA 1V6EA 3VH4B 3ZNGC 2ZJDA 1V86A 2IZVB 3EFUA 3N3KB 1WJUA 3ENEA 2AYOB 2ZCCA 2N1WA 1Q1OA 3KH0A 4FULA 4ICVA 4RMAA 2L8JA 3U30A 4MJSA 1H4RA 4AP4C 4KDLB 5DCNA 4CYEA 1SGHA 3HHMA 3S2AA
chains in the Genus database with same CATH superfamily
5JH5C 2RPQA 3X0WA 3ZNID 3PLUA 1H8CA 2LASA 3FILB 2HDEA 4YTPB 2JRHA 4XWWA 3PHWB 2CHWA 1P1AA 2KJ6A 4JE3B 4PS8A 1UWMA 2Y5PA 4QAYA 5JXVA 2QCZA 3P4RB 2KVRA 4NJ6A 1ROEA 1WGGA 1P3QU 3B2GA 1PGXA 4GGQA 1TY2A 2FE8A 1C77A 4P6VF 2ZW1A 3IFWB 4KV2A 3VH3B 3CIRB 4FHJA 3NVWA 4ZRPA 3DWMA 2ZNVC 1JRPA 4RM9A 2KWCA 2BYVE 2WXPA 4ZYSA 4E74A 1N5XA 5HFYA 3NVVA 2DZKA 1EWYC 5CHFA 4ASWC 1OQYA 2HD5B 1E6EB 4HCNB 3DPDA 2M8SA 4HDQA 3P42A 3NJTA 4MGKE 2GOWA 2XBBC 3VTUA 4HEA1 2K0PA 3GE8C 1DGJA 3AE9B 3R2TA 2BW2A 1EU4A 1PFDA 4GSWA 4ITKA 2JYEA 2BS2B 3R66C 2AEHA 4LJOB 1KLGD 4RGMA 2X38A 5CTRC 1DYQA 1FMAD 1AN8A 3ZIMA 2Z0DB 1UUPA 1FXTB 3I63C 4Q2JA 1SB3C 3HRDD 1OFFA 4B95A 3ZYYX 4F1SA 4TMAB 2MA9B 1BT0A 2ZVNA 4IKGA 1A5RA 3ZTDA 1STEA 4MSMB 2KACA 1OQRA 2DYOA 3RULA 1SE3A 5AEKB 4LDTB 1N6ZA 1WX8A 2MP2B 2KVZA 2XEWA 3AXCA 3TL5A 2IO3B 3EECA 3C0RB 4A6QA 2XK5A 4RF1A 4F7ZA 1TY0A 3TEXA 4PYUA 2QJLA 3ZLZA 1C76A 1WY8A 2C7HA 4JLCA 2ZNVB 3Q14C 1C79A 1TZOA 2KWDA 3LJ3A 1M4VA 4KGTA 3PSEB 2N9LA 2AQ1B 4C4VA 4MGIE 4ZDVA 4PK1A 3QWZB 2KTFA 5FR3A 4WQMA 1KOTA 3GP7A 4A8XC 4R3DA 2MBEA 4EKUA 1JALA 2LRWA 3DBLI 3AM9A 4MSQB 4GB9A 3RI7C 4KKIA 3ONSA 4MELA 2YLMA 3Q2AC 4NJ7A 3NZ3A 1MG8A 4E71A 2N0SB 1PGAA 3APDA 2WXHA 2WDTB 2IJ0A 2ZW0A 3E9SA 1KM7A 3RNAC 1HZ5A 2L76A 2DNFA 3B0AA 2YEPF 1WE7A 4GDLB 1ZXIA 5E6PA 1UBQA 1SBBB 4BFRA 3AN1A 2WDVB 1DOXA 1AARA 1XO3A 2GLSA 4C7YA 2K1FA 1YJJA 1RYJA 4W9GA 2N9PC 2INDC 2KLCA 1JWUD 3NY5A 2IO1B 3D32A 2D10A 4FN2A 3UI3A 2CU1A 1UH6A 3RN9C 1YQ3B 5C23A 2JRIB 1D4BA 2L0TA 5D2MB 5E6OA 1C3TA 4GXBA 2ACZB 4HDOA 1SIFA 4KZCA 1D5MC 1I4XA 2BYFA 2N7JA 3NS8A 1NI2A 1WFYA 2CS4A 3ZNZB 3AI5A 4OZAA 4DHJD 3URYA 3AECB 2Z8LA 3SU8X 1FNVA 1F52A 3WAMA 4WJNA 1RLFA 1L6UA 1WX7A 1I7HA 3UF8A 4ZRQA 1T3QA 3QX1A 3UINB 3DQVA 4G0NB 1R4MI 2OJRA 2I38A 2PE9A 1WMHA 4DHJB 2WXFA 3LYYA 3MJWA 2MJDA 3TEZA 2JUOA 3L16A 3AEBB 2D3CA 2CR5A 1WR1A 2AWTA 3GZNI 4TKNA 4WWPA 4OVZA 3AH7A 2WXOA 1E7PB 3SFEB 2FCSA 3NUHB 2KO3A 1J7CA 1TKGA 2WX1A 1R4NI 2NS5A 2LWPA 2RDGA 2ON8A 3ZJVA 1K53A 2IBIB 2WP9B 3WANA 2L0FA 1MHHE 3K9PB 2D3AA 4WWOA 1WGYA 1YJIA 2KFKB 3TSSA 4IM2A 2NPTA 4BVUC 1L5PA 4YXDB 3B2FA 2E3TA 2MEKA 3V6EB 1Q10A 4EOYA 2BB5A 4DXFA 1XF5L 5C3JB 3NZUA 1KJTA 1TS2A 1PYWD 3PS6A 1KLVA 3DVGX 4IOIE 1KLUD 1TJEA 3B1LX 4TUUA 2VZKD 4L2YA 3Q6BA 2W55A 3KYCD 1EF1A 1UGMA 4J6IA 3HUIA 2KLGA 2NMQA 4RGOS 4DHZE 1V8CA 2Q5WD 3N1YC 4K3BA 2ZCBA 4XX5A 1IYFA 1UWXA 3BVZA 1WJ6A 1SE2A 2EKIA 2KHWB 1YX6B 3OWEB 1JWBD 4X57B 4HVBA 4JGHB 1V1PA 1PUTA 3AEGB 3APCA 2Z0EB 2KMMA 3MFGA 2OEDA 2EKEC 2WLBA 5IAAC 1TZ1A 3FILA 2RGFA 3VDZA 3UGBB 3V61A 5LNK1 1SEBD 2DZIA 1VZ6A 1FD6A 3BVMA 4K7UA 5TSSA 5EDSA 3KYDD 3I5JC 3NRZA 4CQNA 2M17A 3IT4B 2G4SA 3JSVB 4XGAB 1YD8U 2ZZPB 4FJVB 4C80A 3BYTB 2MJEA 2JWUA 1VRAB 1WXAA 1P9DU 4MM3A 3UQBA 4AUQC 3OJ4B 1AYFA 3VR9B 1RWSA 2Y3AA 2MH7A 2KTRB 2MHJA 1XD3B 5IO9A 2CHZA 4FJZA 1EO6A 2BT6A 2D5GA 4FADA 3ZW3A 4A90A 3SFDB 1WJ4A 1HTOA 4ZHOA 5BMIA 3ZNGC 2ZJDA 2H89B 4FULA 1H4RA 3E56A 1L0YB 1SGHA 3ZXVA 1SE4A 2JSVX 3ZUNA 1R4MB 2V1YA 3TUOA 3RNGC 2H88B 3M95A 1UELA 4ZRKA 2LHDA 2JZZA 5AZFA 4BKSD 2DZMA 3QC8B 4EZKA 5E6JA 2NBVB 2WXMA 1ZGUB 4ARCA 5H8YE 2BKFA 1Q5WB 1WXQA 4E3CA 4M8MA 1FCCC 3NOBA 1JWMD 1JWAD 3DDCB 3VTWA 3PHXB 3ZXRA 2W3RA 2ONQA 1VZ8A 1QOFA 2K25A 3DVNV 5KHQA 4N6EB 4HWIB 1R4NB 4JWSC 4XE0A 1FXIA 3NZSA 1TS3A 1SSNA 5EE3A 5DPWA 3AE2B 3BY4B 4WAAA 4W9DA 4GLSC 2WQYB 3SD5A 2R2QA 2ZPNA 2L83A 2Y5CA 2J4XA 4MGZE 1NBFC 2NTTA 4HPPA 3W1SC 2IY1B 3RNBC 1CMXB 2B3AA 3P4PB 3DHHC 4P1BC 3I9V1 2HJ8A 2RDHA 4YT0B 3DVNU 3P4SB 2G9HD 3H1UA 2D07B 2MW5A 1XCTL 1ZDXA 1E8XA 3ZVVA 2BF8B 1T0QC 3U52E 2K3UA 3IAS1 1SXTA 2JT4B 4KKJA 3M62B 3JW0X 2WGSA 3R8BA 3WA0A 2KQSA 4B6WA 4G11A 1XLPA 4GDLA 4LJPB 2LVQA 2FNJB 2C7MB 2YVCA 1R7SA 2J7QB 1N5WA 1YNTE 2D3BA 4LNNA 1AWDA 4ZRIA 1B9RA 3ML8A 4HXDA 1NVID 2KANA 3SEBA 4DXAB 2LGSA 1D5ZC 4EEWA 4DK5A 3HIZA 1FNUA 2DYMA 1IBXA 4HROA 4A9AA 5MPOA 3N32A 1CQVA 3BZDB 4GOCA 4GU2A 1ACCA 5G5GA 4NJCA 3ML9A 4YSYB 1PQSA 1IGCA 1E90A 3AE5B 1WF9A 2QDFA 2LUEA 3BWUD 4W9HA 2LHEA 3AEAB 3BVGA 5J2RA 2IGDA 1WX9A 3I3TB 1TS5A 2LD9A 1YN5A 3QQ8B 2V3NA 2BVCA 4I6NB 4AOFA 2CJNA 3H7PB 3WAOA 1VR9A 2FBWB 4CHKA 2PMVA 3QAQA 4JX1C 1L4ZB 4DWFA 2JVCA 3C8YA 2UYZB 2R61A 4A20A 3A1QB 3UQAA 1UF0A 1F2RI 4HCPB 2K6QA 2KDIA 5DPSA 2CKHB 2BQQA 3ZTCA 1GC6A 3PRPB 2I2YA 3DCGA 4WAFA 1GPXA 1MI0A 3A4SC 4FJYA 3X23A 1CK1A 5J17A 1C4AA 1N61A 4LK0M 2X8XX 4G3XB 4NAWB 2O2VA 3L13A 4W9EA 3R7RA 4MEMA 1V5OA 4O1NA 3P63A 1J8CA 3Q3MC 5HG2A 4IW0A 2LXCA 2R2OA 4RGTA 2BTEA 4W9JA 3RCZA 3KUCB 2IDYA 1JRUA 2MQJA 5BMHA 3V62A 2BBCA 2C7NB 1QLBB 2LGDA 4ZHPA 2K8CA 1FM0D 1ET9A 1FNWA 1NYRA 3PRZA 1V81A 4B9KA 4OW0A 4OVUA 2N4FA 4II2B 3TEWA 5AUKA 1F0ZA 4MT5A 1P7FA 2N7EA 4IC7B 5IN7A 2J52A 2FCNA 3TBLD 4KIKB 4B0MA 3LXFA 4NPNA 1C4CA 2RPVA 2DAJA 3I57A 3VXWA 1SJED 2NVUI 3P1MA 3JYUA 4NNJB 4XDDA 4BZAA 1F2RC 3A9KB 3ETRA 1HTQA 4LTUA 5EE9A 5TR5A 1T0SC 3AU5A 1ZOYB 1Y8RC 2KX0A 4N58A 2DHZA 4M00A 4C7ZA 3Q3OC 4WWNA 3AU4A 4XWTA 4I6PA 4GIVA 3JSVA 2DX5B 4K3CA 5LXHA 2L00B 2LUMA 2DZJA 1V2YA 2HJ1A 2WNMA 3WAPA 1GB4A 4L1BA 1DOYA 4B0EA 1TTNA 2J0JA 2GI9A 3GOEA 2K9XA 1I4GA 4N59A 3V05A 2W82A 2INPE 1XXGA 3CSTA 4BBNF 3CSFA 5AZHA 4W9LA 3CMMB 2PVGC 1I4PA 2LEKA 1WSPA 3EGRA 4ACFA 4RFBA 3NVYA 2L05A 4IWPA 2KZRA 4GDKB 2L3ZA 3IBEA 3FC4A 4M0WA 2KNBA 4KSLC 3N9YC 2KK8A 2RR9A 2V3SA 3NS1A 1RM6C 1ZKHA 1B1ZA 4ICUA 4IWQA 3U4EG 1CZPA 3Q3NC 1VD2A 3SHQA 4P1CC 3QARA 4XC2A 3AEFB 1UGJA 1KH0A 2VH1A 2BWFA 4H2AA 1U4AA 3KW5B 1HE8A 1Z5SB 2NCNA 2IO0B 2K5PA 1C78A 1QF6A 1WWTA 4KZ0A 3P4QB 4LCDE 4WJPA 1C1YB 1IPGA 4IDIA 5J18A 1C9FA 5I4DA 1JWSD 2MBQA 1FPYA 1UBIA 2AQ2B 4FXCA 1QOAA 2CU3A 2O6VA 1IUEA 1WZ0A 1WR6E 3PVLA 3RNCC 2M1MA 4ANUA 2N9XA 2J0MA 1V49A 5BMGA 1ZXHA 3VH4B 2RMMA 3RNFC 1XCQL 5HHDG 1MJDA 3EFUA 2N1WA 3KH0A 2L32A 2L8JA 4MJSA 4AP4C 5DCNA 4ZOHC 4WIPA 3J9CA 2KFJA 2GBJA 2M0XA 3RPFC 1WRIA 1FRRA 5D3DA 2BKRB 1I42A 5E6NA 5CHWA 3T3OA 4MACA 5G55A 2PLPA 4JL9A 4FHKA 2V4IB 2LFIA 4P7IA 3K9OB 1WYGA 5BYSA 4F8CB 3L4PA 1JW9D 1JROA 2KN4A 2AL6A 3AE4B 4WJQA 5FKAC 3A9JB 4FBJB 1SJHD 3H7SA 2JZPA 3TJPA 2KJRA 4DDID 4WQOB 1PGBA 2QMTA 1WXMA 4C56C 2UWQA 3DVGY 4M02A 1KRHA 3DBLB 4K1RB 3PT2B 2JXXA 3V6CB 2XNAC 4KX6B 1X1MA 1YX5B 2KMAA 2ZEQA 2WXQA 1WE6A 3WIMA 2WXGA 1RFKA 3VFKA 2MX2A 3ABVB 2G1EA 2QC8A 3MC0B 1WH3A 3EA6A 3HVZA 2VZKB 3HM6X 2D3GA 1MFWA 1UNSA 3RMKC 2E6XA 4US9A 3ZKJC 2MWSB 1Y56A 1IP9A 2LVPA 2YEPB 4USAA 4ANVA 4IG7B 2D2QA 2IGGA 1E7VA 3L08A 4MDKE 1YMHE 3NG0A 3L54A 2XN9C 3LDZE 2FCMA 2DWQA 1V97A 3H7PA 2M4NA 1FO4A 5FR6A 1XQQA 4RCOA 2FIFA 3DOWA 5D6JB 4TV3A 5EE0A 4MGYE 2IPKD 2IY0B 4W9IA 4IM0A 1WGRA 3PLVA 1J0GA 2Z59B 2ICIA 1GAQB 2EELA 3AE7B 3A1QA 3PZ7A 4IM3A 2KDBA 1T0RC 4HLEA 4AWJA 2IO2B 4PS3A 3N30A 3PV1A 1E8YA 2V4LA 1V5TA 1WYWB 2GB1A 2SEBD 4HPMB 2BS4B 1RFAA 4NAWA 2M56B 4AJYB 5DPTA 3EUB2 4XZ4A 1WIAA 4DDGD 1S3SG 3Q3FA 2WU2B 1FXAA 5BYQA 1WJNA 3VTVA 3T8MA 1AW7A 3GZNB 1KTKA 3QA8A 2LRUA 4RH6A 4US8A 2W3SA 3HM3A 2OJWA 1TGZB 2G4DB 4EZJA 2WXNA 3IVFA 1E9MA 2ASQA 5LLIA 1I35A 4YSXB 2MP2A 2BGFA 1V9JA 3R7QA 1MVKA 1TS4A 4NY0A 2B76B 1FRDA 4KIKA 2WWZA 2KN5A 2V3PA 4GN1A 3UIPB 3Q3JA 2GRIA 4GMVA 2HTHA 5EE1A 2RD0A 5JZEB 2KJHB 2NR2A 1N60A 2M19A 3A9KA 4WWMA 4BOZB 3LB8C 2JXTA 4M01A 3PGEA 3V60A 4UDUC 3TIXA 3DBRI 1NYQA 3IHPC 3OG5A 5D3IB 2CJOA 2KDMA 1MG4A 1ZE3D 4NQLB 4LNOA 4TQ1A 3L0WB 2GBRA 4AS1A 1HZ6A 2Y5BB 3AE1B 3ZGZA 1MHXA 2NBWB 2PKOA 1QKZA 3PREA 2FUHB 3FKYA 1GC7A 3APFA 2UU7A 3AULA 2NPTB 4YWGG 1HA5A 2OOBB 2WXRA 2CHXA 1LO5D 2HE7A 3GE3C 2BWES 2MBOA 1ZP0B 3N1XC 3SDLC 4A3OA 1F1HA 1RAXA 2W54A 2W9NA 2J53A 5H92C 3BINA 4N9F4 1ZUD2 1I4QA 3L17A 2MRPA 3BK1A 1L4DB 3JVZX 1WI0A 2ZPYA 5GXGB 4URKA 5HI1A 2K6DB 1ENFA 2WDQB 2DBYA 3QCAA 4J3OD 3KWVA 1QT9A 2I1JA 1E8WA 3IT6B 3KUDB 4WURA 4ANWA 4DQOC 1EM7A 1GG3A 1LGRA 1YQBA 3W1YA 2JYTA 3MTNB 3VUXA 1XLNA 2DLBA 4KSKC 3AEEB 1ZPSA 4OHJA 1VCBA 2FUG1 4HKQA 4HPLB 4RGNA 1E5WA 2LZ6A 3MHSD 2J42A 1FIQA 1L2NA 4TSSA 2HTME 1YIWA 3KVFB 4MM3B 3PTFC 1YJ1A 1T0YA 1XT9B 1PDXA 2KAJA 4WH4A 1WM2A 3W9CB 2LJIA 2QIEB 2GBMA 2TSSA 3VUYA 5IKCM 1GOZA 4KVGB 3EFCA 3TMPB 2IGHA 1K51A 3M3JA 4W9FA 2KFKA 4DXGA 3ZQ4A 3AMZA 4JIOU 2WU5B 2D11A 4W9KA 3RYTA 3BYYB 3RUIB 1WXVA 3OAWA 2K8BA 3U2SC 1J19A 2KD0A 4PT5A 4CO7A 3A9JA 1XLQA 4LDTD 3MP9A 1D6EC 3N1ZC 1D3ZA 4YL8A 3RFZB 3DBRB 3Q8EA 5JHAA 2LGYA 4MH8A 2BS3B 1S1QB 2SAKA 3VR8B 1Z2MA 1GNUA 1VJKA 3W5VB 3MC9A 4I6LB 1N62A 2IZVB 1VDVA 1WJUA 1Q1OA 4RMAA 4KGSA 2KYWA 4CYEA 1VZ7A 3HHMA 3S2AA 1EWCA 4BOSC 1NDDA 1EU3A 5LXIB 3IXSA 2DAFA 2QHOA 2V9HA 4RM8A 4RF0A 1YOVB 1VLBA 4KGRA 1A70A 3NHEB 2KOXA 3ZO5B 3IAM1 2KC1A 1SE9A 4YTNB 3DBHI 1ZW7A 1LXDA 2KTRA 1KFYB 1TIFA 4G50A 1TT5B 2KWUB 3H9DA 3A4RA 4OZCA 1GB1A 1LM8B 2C5LC 4P16A 2LGIA 3NVZA 5HKHA 2WXIA 5G2NA 1J7BA 2JF5A 2PTLA 1BUIC 1V1OA 2PJHA 4NZLB 4XYCA 3SR6A 4TQ0A 4M8NA 1OTRB 2LXAA 2INNE 3DWGC 4IUMB 3AE3B 3Q69A 1IBXB 2AL3A 2WXKA 1F9JA 4K81A 4LNFA 2ZVOA 3PPAA 2PEAA 4EUTA 1NI3A 5BYRA 4FLHA 2N1VA 2J0KA 5AZGA 2VRRB 3OJ3A 2MBBB 4LLGM 3Q8FA 3RT3B 3R2IA 1HEZE 2L52A 3T3NA 3Q8AA 1QOGA 2KWVB 4BKSA 4A3PA 4DBGA 2BB6A 1FFUA 1E8ZA 3TEYA 4AJWA 3ZNHB 3Q8CA 4MH0E 2N7DA 1NEKB 2RDBC 4LNKA 3AEDB 1F77A 3FAHA 3RZWC 2N9KA 2NBUA 1ESFA 1RRBA 1LQBA 1QQRA 1XEEA 3PRMB 5CX3A 2MBHA 2KQ7A 1L6VA 3CWIA 2WXJA 4BBNC 3T9LA 1IGDA 1T5XD 1K52A 5GMVA 3QJZA 3BK2A 2JPHA 4BKTA 2KDEB 1JMLA 2EMTA 4YSZB 1WGDA 1WGKA 2O2VB 4ZYNA 2MLBA 1YN3A 3IG3A 1EUVB 1ZDVA 2GBNA 2LGXA 1N63A 4YTMB 1E0ZA 3DHIC 4HKZE 3WALA 4NAMA 1TYGB 2DENB 5BO4B 3KQ4A 3L10B 3ALBA 2MJ3A 1L0VB 2PVOD 1XLOA 4S0RA 1JCKB 3ZRCA 2JU6X 3KUZA 2QILA 3VUWA 1WXSA 2M0AA 5FK9C 1E10A 2K39A 2BYEA 1YQ4B 4PS7A 2AX5A 2A4ZA 2GMIC 1QZEA 2XK5B 3PZ8A 1L0XB 1TBEA 3VRBB 3QHTA 1EF5A 1P0RA 4JPSA 2MCNB 3PO0A 3MHZA 3RD2A 2JZ3B 2A5UA 1D5XC 3KWLA 2MSED 3GB1A 1FCLA 2L7RA 3DBHB 4C4VB 2FCQA 3ZJUA 2BYTA 4XDCA 3W1SA 4EFOA 4HRSA 1WZ3A 4RNAA 2DYBA 5L83A 2WHIA 3DHGC 3H6NA 4WJOA 2REXA 2LVOA 1I4HA 2QSDA 4OZBA 2JX5A 1ET6A 3ZRFA 1UD7A 3VQIA 3N20C 3ZDMC 1SIJA 3OLMD 3U8ZA 2BPSA 4NQKE 2EMSA 2KKCA 2KQ4X 3R3MA 2AQ3B 2NTSA 3V3XA 5C2TB 1TKYA 1GJZA 4DHZB 2WS3B 3HK0A 4HJGE 2JWZA 2RSUA 3VRAB 2N9EB 4JWUC 3RZFA 4LNIA 4REZA 5G5HA 1WGHA 1FEHA 2LMCA 1LFDA 1M94A 4W9CA 1K50A 4ZRJA 3KLSX 2WDRB 1G6JA 1YN4A 3AV8A 3VVWB 3MJ5A 3HVDA 3DBSA 5T8IA 3H8HA 3U7DA 4AQ7A 3VAWA 4M0WB 1GUAB 4ANXA 2K22A 3C19A 5KHOA 3P2BA 3AE6B 3W2DA 3O65B 4IWOA 3GS2A 4HK2A 1SF0A 2INCC 2G3QB 2O6VD 5CHVC 2WXLA 5IA7A 2OHFA 3QIJA 2V0GA 1ISNA 1NENB 1QILA 4BKGA 1UZXB 2FIDA 1WMHB 1FFVA 2I1KA 2WX0A 5DPRA 2G45B 4PYZA 4D2KA 2PW9A 4HJKA 2PPHA 4L23A 2O6VB 2L1AA 4II3B 2LI5A 1T6BX 2LJ5A 4KDIC 1KF6B 3WCQA 3O13A 5D7GA 1WM3A 3EHVA 1HQRD 1CJEA 2WYQA 3AB5A 3UIOB 4ARIA 5IOIA 3A33B 1DOIA 3M63B 2C60A 1J7AA 5C1ZA 4MJSB 2VH2A 2K8HA 3MC8A 3VHTC 2PE6B 3Q8BA 1P7EA 3RNEC 1P98A 1C4PA 1JQ4A 2KMCA 1E7UA 1OEYA 2JY6A 3W5UB 4K7SA 4K7WA 3B08A 3TCAA 2C9WB 4BAXA 1OEYJ 2QEJC 2KT7A 3ZJTA 2IYDB 2KC2A 1V80A 5AUIA 3ECIA 1QOBA 2JQRB 1Q0WB 2KDFB 1L7YA 3ZDTA 5JHBA 1HXYD 1OGWA 1BMLC 2GBKA 4FA6A 4C00A 5L95C 1K8RB 2KXJA 4S17A 1BXTA 3AE8B 3CF6E 3B9JA 1OQQA 5D94A 4EZLA 1MPEA 1WRDB 2FAZA 2KX3A 3QK0A 4JQWC 3PZDA 4OVVA 3EC8A 4A55A 4GDKA 1V6EA 2PIAA 1V86A 5IP4D 3N3KB 3U7ZA 3ENEA 2AYOB 2ZCCA 3U30A 4ICVA 1TKEA 4KDLB 3BIID 1I4RA 1V1PB 4EE2A
chains in the Genus database with same CATH topology
2KFJA 5JH5C 2GBJA 2M0XA 4BOSC 2RPQA 3ZUNA 1NDDA 3X0WA 3PLUA 3ZNID 2BKRB 1I42A 2V1YA 1H8CA 2LASA 3M95A 1UELA 2JRHA 5CHWA 5E6NA 4ZRKA 3PHWB 2JZZA 2DAFA 5AZFA 5G55A 5LXIB 2QHOA 2CHWA 4BKSD 1P1AA 2DZMA 2KJ6A 3QC8B 4JL9A 4PS8A 4RM8A 4FHKA 4EZKA 2NBVB 2KVRA 4NJ6A 4P7IA 3K9OB 1WGGA 3NHEB 1ZGUB 2KOXA 1P3QU 3ZO5B 4F8CB 2BKFA 1Q5WB 2AL6A 4GGQA 4WJQA 2KC1A 1SE9A 4E3CA 3A9JB 4M8MA 4FBJB 3IFWB 3DBHI 3H7SA 3NOBA 4KV2A 3VH3B 3DDCB 1ZW7A 3TJPA 2KJRA 1LXDA 4FHJA 3PHXB 3VTWA 2KTRA 4DDID 4WQOB 2ZNVC 2K25A 3DVNV 2KWCA 4RM9A 1WXMA 2BYVE 4G50A 5KHQA 4HWIB 2KWUB 4E74A 3H9DA 3A4RA 2UWQA 3DVGY 3NZSA 2DZKA 1LM8B 5DPWA 5CHFA 4K1RB 3PT2B 2JXXA 3V6CB 4ASWC 2C5LC 3BY4B 1OQYA 4WAAA 1X1MA 1YX5B 2KMAA 4W9DA 2ZEQA 2HD5B 5HKHA 3SD5A 1WE6A 3WIMA 5G2NA 3VFKA 4HCNB 2MX2A 2JF5A 3DPDA 2R2QA 2ZPNA 2M8SA 4HDQA 1WH3A 4MGZE 4MGKE 2GOWA 3HM6X 2D3GA 2PJHA 1NBFC 2XBBC 3VTUA 3W1SC 2IY1B 1CMXB 2B3AA 4TQ0A 3ZKJC 4M8NA 1OTRB 2LXAA 2MWSB 2HJ8A 1IP9A 4IUMB 2LVPA 3DVNU 4GSWA 2AL3A 1F9JA 4K81A 4ANVA 4IG7B 2D2QA 3H1UA 2D07B 2ZVOA 1E7VA 3PPAA 3L08A 4MDKE 2MW5A 2PEAA 4EUTA 3R66C 2AEHA 4LJOB 4FLHA 1E8XA 2N1VA 2J0KA 3ZVVA 2BF8B 5AZGA 2VRRB 5CTRC 3OJ3A 2MBBB 3ZIMA 2Z0DB 1FXTB 3L54A 3RT3B 3LDZE 2JT4B 4B95A 2KWVB 4BKSA 4F1SA 3M62B 3JW0X 2FCMA 3WA0A 3H7PA 2MA9B 4A3PA 1BT0A 4DBGA 2KQSA 2M4NA 2ZVNA 5FR6A 1E8ZA 1XQQA 2FIFA 4B6WA 3DOWA 5D6JB 4TV3A 1A5RA 4MGYE 2IY0B 4W9IA 4IM0A 4AJWA 1WGRA 3ZTDA 3PLVA 4G11A 2Z59B 4MSMB 3ZNHB 1J0GA 2DYOA 4MH0E 4GDLA 2N7DA 4LJPB 3RULA 5AEKB 4LDTB 2LVQA 3A1QA 1WX8A 2FNJB 2MP2B 2XEWA 3AXCA 2C7MB 3TL5A 2IO3B 3RZWC 4IM3A 2NBUA 3EECA 3C0RB 2XK5A 1RRBA 2YVCA 4F7ZA 2KDBA 4PYUA 2J7QB 4HLEA 3ZLZA 1WY8A 2C7HA 4AWJA 1LQBA 2IO2B 2ZNVB 4JLCA 3N30A 4PS3A 3PV1A 3PRMB 5CX3A 4ZRIA 1E8YA 3ML8A 4HXDA 2KANA 2V4LA 2MBHA 2KQ7A 4DXAB 1V5TA 4BBNC 1WYWB 3LJ3A 3T9LA 4DK5A 4EEWA 3HIZA 2DYMA 3PSEB 4ZDVA 4MGIE 4HPMB 5GMVA 3QWZB 3QJZA 1RFAA 2KTFA 3N32A 4NAWA 2JPHA 4GOCA 1KOTA 4BKTA 4GU2A 2KDEB 4AJYB 5DPTA 2EMTA 4XZ4A 1WIAA 3ML9A 1WGDA 1PQSA 4DDGD 2O2VB 1E90A 1S3SG 2MBEA 4ZYNA 2MLBA 3Q3FA 3IG3A 4EKUA 1WJNA 2LRWA 1EUVB 2GBNA 3VTVA 3DBLI 3T8MA 1WF9A 2LGXA 4MSQB 4GB9A 2LUEA 3QA8A 2LRUA 4W9HA 3WALA 3HM3A 3ONSA 4MELA 2YLMA 1TGZB 5J2RA 4NJ7A 1MG8A 2G4DB 4EZJA 2DENB 1WX9A 3I3TB 5BO4B 4E71A 3L10B 3IVFA 2LD9A 3ALBA 3QQ8B 3APDA 4I6NB 4AOFA 3H7PB 3WAOA 2ASQA 4CHKA 3QAQA 5LLIA 1I35A 3ZRCA 4DWFA 2JVCA 2WDTB 3KUZA 1KM7A 2MP2A 3VUWA 2L76A 1WXSA 2BGFA 3B0AA 2K39A 1WE7A 1V9JA 2BYEA 2UYZB 4GDLB 4PS7A 4A20A 3A1QB 3UQAA 5E6PA 1UBQA 2A4ZA 4BFRA 2GMIC 4HCPB 1QZEA 2XK5B 3R7QA 2K6QA 2KDIA 5DPSA 2CKHB 1AARA 1TBEA 4NY0A 3QHTA 1EF5A 1P0RA 4KIKA 2MCNB 2WWZA 3ZTCA 2KN5A 4GN1A 3RD2A 1GC6A 2JZ3B 2K1FA 2A5UA 3PRPB 3Q3JA 3DCGA 3UIPB 4W9GA 4GMVA 2HTHA 2N9PC 2KLCA 2MSED 2RD0A 5JZEB 2KJHB 3NY5A 2IO1B 2L7RA 3D32A 2D10A 2NR2A 4FN2A 3A4SC 4FJYA 3X23A 2CU1A 5J17A 1UH6A 3A9KA 2FCQA 4BOZB 4G3XB 4NAWB 2JRIB 2O2VA 3L13A 4W9EA 2L0TA 3PGEA 5C23A 3R7RA 3TIXA 3DBRI 3V60A 4MEMA 5D2MB 1V5OA 3IHPC 3W1SA 4EFOA 5E6OA 1C3TA 4GXBA 4HDOA 1J8CA 1SIFA 1WZ3A 4KZCA 2DYBA 5L83A 3H6NA 4IW0A 4WJOA 2LXCA 4NQLB 2BYFA 2REXA 4TQ1A 2LVOA 3L0WB 2R2OA 3NS8A 1NI2A 4W9JA 3RCZA 1WFYA 2CS4A 3KUCB 3ZNZB 1JRUA 2MQJA 2GBRA 3AI5A 3V62A 4DHJD 3ZRFA 2C7NB 2LGDA 2Y5BB 1UD7A 3VQIA 2K8CA 2NBWB 3ZDMC 3SU8X 3PREA 2FUHB 3OLMD 3U8ZA 2BPSA 4NQKE 1GC7A 3WAMA 4WJNA 3APFA 2EMSA 1RLFA 2KKCA 3AULA 3PRZA 1V81A 2NPTB 4B9KA 1WX7A 3R3MA 2OOBB 4OVUA 2N4FA 3UF8A 2CHXA 2HE7A 3QX1A 3UINB 3DQVA 4G0NB 4II2B 1R4MI 2BWES 2MBOA 2OJRA 3SDLC 2PE9A 1GJZA 1WMHA 1RAXA 4A3OA 4DHZB 4DHJB 2W9NA 3HK0A 3BINA 4N9F4 3MJWA 2N7EA 3L17A 4IC7B 2FCNA 2MRPA 2JWZA 2RSUA 2JUOA 3L16A 3JVZX 3TBLD 2CR5A 1WR1A 4KIKB 1WI0A 2AWTA 2N9EB 2ZPYA 3RZFA 3GZNI 4NPNA 1WGHA 4URKA 2K6DB 4TKNA 2DAJA 4WWPA 1LFDA 3QCAA 1M94A 3VXWA 4W9CA 2NVUI 4ZRJA 3JYUA 2FCSA 1G6JA 4NNJB 2KO3A 3A9KB 3VVWB 2I1JA 1E8WA 3DBSA 3KUDB 2WX1A 1R4NI 3U7DA 2NS5A 2LWPA 5TR5A 3VAWA 4M0WB 2IBIB 1GUAB 3AU5A 4ANWA 1Y8RC 3WANA 2L0FA 2KX0A 1GG3A 4ANXA 2DHZA 3K9PB 4WWOA 1YQBA 1WGYA 5KHOA 3P2BA 3W1YA 3O65B 2KFKB 4IWOA 3MTNB 4WWNA 3AU4A 4HK2A 4I6PA 3VUXA 4GIVA 3JSVA 4IM2A 4KSKC 2DX5B 2NPTA 4BVUC 5LXHA 2G3QB 1VCBA 2L00B 2O6VD 5CHVC 2DZJA 3V6EB 4EOYA 1V2YA 5IA7A 3QIJA 3WAPA 1ISNA 4HPLB 1E5WA 3NZUA 2LZ6A 1KJTA 3MHSD 1TTNA 2J0JA 4BKGA 3PS6A 1KLVA 3DVGX 3GOEA 1L2NA 1UZXB 1YIWA 3KVFB 3B1LX 2FIDA 4TUUA 1WMHB 3PTFC 2I1KA 2WX0A 1YJ1A 2G45B 5DPRA 4PYZA 3CSTA 4BBNF 3CSFA 1T0YA 5AZHA 4HJKA 2PPHA 4W9LA 1XT9B 2O6VB 3CMMB 3KYCD 1EF1A 1UGMA 4J6IA 2KLGA 1WM2A 4II3B 2LI5A 4DHZE 2LJ5A 2ZCBA 4XX5A 1IYFA 4KDIC 2GBMA 2L05A 4IWPA 5D7GA 3VUYA 1WJ6A 2KHWB 1WM3A 1YX6B 4KVGB 3EHVA 2WYQA 3TMPB 2KZRA 4GDKB 4X57B 3UIOB 4HVBA 2L3ZA 3IBEA 4JGHB 3A33B 2KNBA 3M63B 4KSLC 3APCA 2C60A 2Z0EB 3M3JA 4W9FA 5C1ZA 2KK8A 4MJSB 2EKEC 2RR9A 2V3SA 5IAAC 1TZ1A 1ZKHA 2RGFA 2KFKA 4ICUA 3VDZA 4IWQA 3UGBB 3V61A 2K8HA 4JIOU 3VHTC 2DZIA 2PE6B 2D11A 1VD2A 3SHQA 4W9KA 3QARA 3RYTA 3RUIB 4XC2A 1P98A 1WXVA 2KMCA 4K7UA 3OAWA 5EDSA 3KYDD 2K8BA 1E7UA 2M17A 1OEYA 3JSVB 2G4SA 2JY6A 1J19A 1YD8U 2BWFA 1U4AA 2KD0A 3KW5B 4K7SA 4CO7A 2ZZPB 3A9JA 4K7WA 1HE8A 1Z5SB 2NCNA 2IO0B 4FJVB 4LDTD 3B08A 3TCAA 2C9WB 1OEYJ 1WXAA 4KZ0A 1P9DU 4MM3A 4LCDE 4WJPA 3UQBA 1C1YB 1IPGA 2IYDB 5J18A 4AUQC 3OJ4B 1D3ZA 4YL8A 2KC2A 1V80A 2MBQA 3ECIA 2KTRB 2KDFB 1UBIA 1Q0WB 1L7YA 3ZDTA 1XD3B 5JHBA 2O6VA 1OGWA 1WZ0A 5JHAA 1WR6E 2GBKA 2LGYA 4FA6A 3PVLA 2CHZA 4FJZA 2M1MA 1S1QB 4ANUA 5L95C 1EO6A 1K8RB 1Z2MA 2KXJA 2N9XA 4FADA 3CF6E 1GNUA 3ZW3A 5D94A 4EZLA 1WRDB 2FAZA 2KX3A 2J0MA 3QK0A 1WJ4A 4JQWC 3PZDA 4OVVA 1V49A 3EC8A 4I6LB 4GDKA 1V6EA 3VH4B 3ZNGC 2ZJDA 1V86A 2IZVB 3EFUA 3N3KB 1WJUA 3ENEA 2AYOB 2ZCCA 2N1WA 1Q1OA 3KH0A 4FULA 4ICVA 4RMAA 2L8JA 3U30A 4MJSA 1H4RA 4AP4C 4KDLB 5DCNA 4CYEA 1SGHA 3HHMA 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFJ A;  5JH5 C;  2GBJ A;  2M0X A;  4BOS C;  2RPQ A;  3ZUN A;  1NDD A;  3X0W A;  3PLU A;  3ZNI D;  2BKR B;  1I42 A;  2V1Y A;  1H8C A;  2LAS A;  3M95 A;  1UEL A;  2JRH A;  5CHW A;  5E6N A;  4ZRK A;  3PHW B;  2JZZ A;  2DAF A;  5AZF A;  5G55 A;  5LXI B;  2QHO A;  2CHW A;  4BKS D;  1P1A A;  2DZM A;  2KJ6 A;  3QC8 B;  4JL9 A;  4PS8 A;  4RM8 A;  4FHK A;  4EZK A;  2NBV B;  2KVR A;  4NJ6 A;  4P7I A;  3K9O B;  1WGG A;  3NHE B;  1ZGU B;  2KOX A;  1P3Q U;  3ZO5 B;  4F8C B;  2BKF A;  1Q5W B;  2AL6 A;  4GGQ A;  4WJQ A;  2KC1 A;  1SE9 A;  4E3C A;  3A9J B;  4M8M A;  4FBJ B;  3IFW B;  3DBH I;  3H7S A;  3NOB A;  4KV2 A;  3VH3 B;  3DDC B;  1ZW7 A;  3TJP A;  2KJR A;  1LXD A;  4FHJ A;  3PHX B;  3VTW A;  2KTR A;  4DDI D;  4WQO B;  2ZNV C;  2K25 A;  3DVN V;  2KWC A;  4RM9 A;  1WXM A;  2BYV E;  4G50 A;  5KHQ A;  4HWI B;  2KWU B;  4E74 A;  3H9D A;  3A4R A;  2UWQ A;  3DVG Y;  3NZS A;  2DZK A;  1LM8 B;  5DPW A;  5CHF A;  4K1R B;  3PT2 B;  2JXX A;  3V6C B;  4ASW C;  2C5L C;  3BY4 B;  1OQY A;  4WAA A;  1X1M A;  1YX5 B;  2KMA A;  4W9D A;  2ZEQ A;  2HD5 B;  5HKH A;  3SD5 A;  1WE6 A;  3WIM A;  5G2N A;  3VFK A;  4HCN B;  2MX2 A;  2JF5 A;  3DPD A;  2R2Q A;  2ZPN A;  2M8S A;  4HDQ A;  1WH3 A;  4MGZ E;  4MGK E;  2GOW A;  3HM6 X;  2D3G A;  2PJH A;  1NBF C;  2XBB C;  3VTU A;  3W1S C;  2IY1 B;  1CMX B;  2B3A A;  4TQ0 A;  3ZKJ C;  4M8N A;  1OTR B;  2LXA A;  2MWS B;  2HJ8 A;  1IP9 A;  4IUM B;  2LVP A;  3DVN U;  4GSW A;  2AL3 A;  1F9J A;  4K81 A;  4ANV A;  4IG7 B;  2D2Q A;  3H1U A;  2D07 B;  2ZVO A;  1E7V A;  3PPA A;  3L08 A;  4MDK E;  2MW5 A;  2PEA A;  4EUT A;  3R66 C;  2AEH A;  4LJO B;  4FLH A;  1E8X A;  2N1V A;  2J0K A;  3ZVV A;  2BF8 B;  5AZG A;  2VRR B;  5CTR C;  3OJ3 A;  2MBB B;  3ZIM A;  2Z0D B;  1FXT B;  3L54 A;  3RT3 B;  3LDZ E;  2JT4 B;  4B95 A;  2KWV B;  4BKS A;  4F1S A;  3M62 B;  3JW0 X;  2FCM A;  3WA0 A;  3H7P A;  2MA9 B;  4A3P A;  1BT0 A;  4DBG A;  2KQS A;  2M4N A;  2ZVN A;  5FR6 A;  1E8Z A;  1XQQ A;  2FIF A;  4B6W A;  3DOW A;  5D6J B;  4TV3 A;  1A5R A;  4MGY E;  2IY0 B;  4W9I A;  4IM0 A;  4AJW A;  1WGR A;  3ZTD A;  3PLV A;  4G11 A;  2Z59 B;  4MSM B;  3ZNH B;  1J0G A;  2DYO A;  4MH0 E;  4GDL A;  2N7D A;  4LJP B;  3RUL A;  5AEK B;  4LDT B;  2LVQ A;  3A1Q A;  1WX8 A;  2FNJ B;  2MP2 B;  2XEW A;  3AXC A;  2C7M B;  3TL5 A;  2IO3 B;  3RZW C;  4IM3 A;  2NBU A;  3EEC A;  3C0R B;  2XK5 A;  1RRB A;  2YVC A;  4F7Z A;  2KDB A;  4PYU A;  2J7Q B;  4HLE A;  3ZLZ A;  1WY8 A;  2C7H A;  4AWJ A;  1LQB A;  2IO2 B;  2ZNV B;  4JLC A;  3N30 A;  4PS3 A;  3PV1 A;  3PRM B;  5CX3 A;  4ZRI A;  1E8Y A;  3ML8 A;  4HXD A;  2KAN A;  2V4L A;  2MBH A;  2KQ7 A;  4DXA B;  1V5T A;  4BBN C;  1WYW B;  3LJ3 A;  3T9L A;  4DK5 A;  4EEW A;  3HIZ A;  2DYM A;  3PSE B;  4ZDV A;  4MGI E;  4HPM B;  5GMV A;  3QWZ B;  3QJZ A;  1RFA A;  2KTF A;  3N32 A;  4NAW A;  2JPH A;  4GOC A;  1KOT A;  4BKT A;  4GU2 A;  2KDE B;  4AJY B;  5DPT A;  2EMT A;  4XZ4 A;  1WIA A;  3ML9 A;  1WGD A;  1PQS A;  4DDG D;  2O2V B;  1E90 A;  1S3S G;  2MBE A;  4ZYN A;  2MLB A;  3Q3F A;  3IG3 A;  4EKU A;  1WJN A;  2LRW A;  1EUV B;  2GBN A;  3VTV A;  3DBL I;  3T8M A;  1WF9 A;  2LGX A;  4MSQ B;  4GB9 A;  2LUE A;  3QA8 A;  2LRU A;  4W9H A;  3WAL A;  3HM3 A;  3ONS A;  4MEL A;  2YLM A;  1TGZ B;  5J2R A;  4NJ7 A;  1MG8 A;  2G4D B;  4EZJ A;  2DEN B;  1WX9 A;  3I3T B;  5BO4 B;  4E71 A;  3L10 B;  3IVF A;  2LD9 A;  3ALB A;  3QQ8 B;  3APD A;  4I6N B;  4AOF A;  3H7P B;  3WAO A;  2ASQ A;  4CHK A;  3QAQ A;  5LLI A;  1I35 A;  3ZRC A;  4DWF A;  2JVC A;  2WDT B;  3KUZ A;  1KM7 A;  2MP2 A;  3VUW A;  2L76 A;  1WXS A;  2BGF A;  3B0A A;  2K39 A;  1WE7 A;  1V9J A;  2BYE A;  2UYZ B;  4GDL B;  4PS7 A;  4A20 A;  3A1Q B;  3UQA A;  5E6P A;  1UBQ A;  2A4Z A;  4BFR A;  2GMI C;  4HCP B;  1QZE A;  2XK5 B;  3R7Q A;  2K6Q A;  2KDI A;  5DPS A;  2CKH B;  1AAR A;  1TBE A;  4NY0 A;  3QHT A;  1EF5 A;  1P0R A;  4KIK A;  2MCN B;  2WWZ A;  3ZTC A;  2KN5 A;  4GN1 A;  3RD2 A;  1GC6 A;  2JZ3 B;  2K1F A;  2A5U A;  3PRP B;  3Q3J A;  3DCG A;  3UIP B;  4W9G A;  4GMV A;  2HTH A;  2N9P C;  2KLC A;  2MSE D;  2RD0 A;  5JZE B;  2KJH B;  3NY5 A;  2IO1 B;  2L7R A;  3D32 A;  2D10 A;  2NR2 A;  4FN2 A;  3A4S C;  4FJY A;  3X23 A;  2CU1 A;  5J17 A;  1UH6 A;  3A9K A;  2FCQ A;  4BOZ B;  4G3X B;  4NAW B;  2JRI B;  2O2V A;  3L13 A;  4W9E A;  2L0T A;  3PGE A;  5C23 A;  3R7R A;  3TIX A;  3DBR I;  3V60 A;  4MEM A;  5D2M B;  1V5O A;  3IHP C;  3W1S A;  4EFO A;  5E6O A;  1C3T A;  4GXB A;  4HDO A;  1J8C A;  1SIF A;  1WZ3 A;  4KZC A;  2DYB A;  5L83 A;  3H6N A;  4IW0 A;  4WJO A;  2LXC A;  4NQL B;  2BYF A;  2REX A;  4TQ1 A;  2LVO A;  3L0W B;  2R2O A;  3NS8 A;  1NI2 A;  4W9J A;  3RCZ A;  1WFY A;  2CS4 A;  3KUC B;  3ZNZ B;  1JRU A;  2MQJ A;  2GBR A;  3AI5 A;  3V62 A;  4DHJ D;  3ZRF A;  2C7N B;  2LGD A;  2Y5B B;  1UD7 A;  3VQI A;  2K8C A;  2NBW B;  3ZDM C;  3SU8 X;  3PRE A;  2FUH B;  3OLM D;  3U8Z A;  2BPS A;  4NQK E;  1GC7 A;  3WAM A;  4WJN A;  3APF A;  2EMS A;  1RLF A;  2KKC A;  3AUL A;  3PRZ A;  1V81 A;  2NPT B;  4B9K A;  1WX7 A;  3R3M A;  2OOB B;  4OVU A;  2N4F A;  3UF8 A;  2CHX A;  2HE7 A;  3QX1 A;  3UIN B;  3DQV A;  4G0N B;  4II2 B;  1R4M I;  2BWE S;  2MBO A;  2OJR A;  3SDL C;  2PE9 A;  1GJZ A;  1WMH A;  1RAX A;  4A3O A;  4DHZ B;  4DHJ B;  2W9N A;  3HK0 A;  3BIN A;  4N9F 4;  3MJW A;  2N7E A;  3L17 A;  4IC7 B;  2FCN A;  2MRP A;  2JWZ A;  2RSU A;  2JUO A;  3L16 A;  3JVZ X;  3TBL D;  2CR5 A;  1WR1 A;  4KIK B;  1WI0 A;  2AWT A;  2N9E B;  2ZPY A;  3RZF A;  3GZN I;  4NPN A;  1WGH A;  4URK A;  2K6D B;  4TKN A;  2DAJ A;  4WWP A;  1LFD A;  3QCA A;  1M94 A;  3VXW A;  4W9C A;  2NVU I;  4ZRJ A;  3JYU A;  2FCS A;  1G6J A;  4NNJ B;  2KO3 A;  3A9K B;  3VVW B;  2I1J A;  1E8W A;  3DBS A;  3KUD B;  2WX1 A;  1R4N I;  3U7D A;  2NS5 A;  2LWP A;  5TR5 A;  3VAW A;  4M0W B;  2IBI B;  1GUA B;  3AU5 A;  4ANW A;  1Y8R C;  3WAN A;  2L0F A;  2KX0 A;  1GG3 A;  4ANX A;  2DHZ A;  3K9P B;  4WWO A;  1YQB A;  1WGY A;  5KHO A;  3P2B A;  3W1Y A;  3O65 B;  2KFK B;  4IWO A;  3MTN B;  4WWN A;  3AU4 A;  4HK2 A;  4I6P A;  3VUX A;  4GIV A;  3JSV A;  4IM2 A;  4KSK C;  2DX5 B;  2NPT A;  4BVU C;  5LXH A;  2G3Q B;  1VCB A;  2L00 B;  2O6V D;  5CHV C;  2DZJ A;  3V6E B;  4EOY A;  1V2Y A;  5IA7 A;  3QIJ A;  3WAP A;  1ISN A;  4HPL B;  1E5W A;  3NZU A;  2LZ6 A;  1KJT A;  3MHS D;  1TTN A;  2J0J A;  4BKG A;  3PS6 A;  1KLV A;  3DVG X;  3GOE A;  1L2N A;  1UZX B;  1YIW A;  3KVF B;  3B1L X;  2FID A;  4TUU A;  1WMH B;  3PTF C;  2I1K A;  2WX0 A;  1YJ1 A;  2G45 B;  5DPR A;  4PYZ A;  3CST A;  4BBN F;  3CSF A;  1T0Y A;  5AZH A;  4HJK A;  2PPH A;  4W9L A;  1XT9 B;  2O6V B;  3CMM B;  3KYC D;  1EF1 A;  1UGM A;  4J6I A;  2KLG A;  1WM2 A;  4II3 B;  2LI5 A;  4DHZ E;  2LJ5 A;  2ZCB A;  4XX5 A;  1IYF A;  4KDI C;  2GBM A;  2L05 A;  4IWP A;  5D7G A;  3VUY A;  1WJ6 A;  2KHW B;  1WM3 A;  1YX6 B;  4KVG B;  3EHV A;  2WYQ A;  3TMP B;  2KZR A;  4GDK B;  4X57 B;  3UIO B;  4HVB A;  2L3Z A;  3IBE A;  4JGH B;  3A33 B;  2KNB A;  3M63 B;  4KSL C;  3APC A;  2C60 A;  2Z0E B;  3M3J A;  4W9F A;  5C1Z A;  2KK8 A;  4MJS B;  2EKE C;  2RR9 A;  2V3S A;  5IAA C;  1TZ1 A;  1ZKH A;  2RGF A;  2KFK A;  4ICU A;  3VDZ A;  4IWQ A;  3UGB B;  3V61 A;  2K8H A;  4JIO U;  3VHT C;  2DZI A;  2PE6 B;  2D11 A;  1VD2 A;  3SHQ A;  4W9K A;  3QAR A;  3RYT A;  3RUI B;  4XC2 A;  1P98 A;  1WXV A;  2KMC A;  4K7U A;  3OAW A;  5EDS A;  3KYD D;  2K8B A;  1E7U A;  2M17 A;  1OEY A;  3JSV B;  2G4S A;  2JY6 A;  1J19 A;  1YD8 U;  2BWF A;  1U4A A;  2KD0 A;  3KW5 B;  4K7S A;  4CO7 A;  2ZZP B;  3A9J A;  4K7W A;  1HE8 A;  1Z5S B;  2NCN A;  2IO0 B;  4FJV B;  4LDT D;  3B08 A;  3TCA A;  2C9W B;  1OEY J;  1WXA A;  4KZ0 A;  1P9D U;  4MM3 A;  4LCD E;  4WJP A;  3UQB A;  1C1Y B;  1IPG A;  2IYD B;  5J18 A;  4AUQ C;  3OJ4 B;  1D3Z A;  4YL8 A;  2KC2 A;  1V80 A;  2MBQ A;  3ECI A;  2KTR B;  2KDF B;  1UBI A;  1Q0W B;  1L7Y A;  3ZDT A;  1XD3 B;  5JHB A;  2O6V A;  1OGW A;  1WZ0 A;  5JHA A;  1WR6 E;  2GBK A;  2LGY A;  4FA6 A;  3PVL A;  2CHZ A;  4FJZ A;  2M1M A;  1S1Q B;  4ANU A;  5L95 C;  1EO6 A;  1K8R B;  1Z2M A;  2KXJ A;  2N9X A;  4FAD A;  3CF6 E;  1GNU A;  3ZW3 A;  5D94 A;  4EZL A;  1WRD B;  2FAZ A;  2KX3 A;  2J0M A;  3QK0 A;  1WJ4 A;  4JQW C;  3PZD A;  4OVV A;  1V49 A;  3EC8 A;  4I6L B;  4GDK A;  1V6E A;  3VH4 B;  3ZNG C;  2ZJD A;  1V86 A;  2IZV B;  3EFU A;  3N3K B;  1WJU A;  3ENE A;  2AYO B;  2ZCC A;  2N1W A;  1Q1O A;  3KH0 A;  4FUL A;  4ICV A;  4RMA A;  2L8J A;  3U30 A;  4MJS A;  1H4R A;  4AP4 C;  4KDL B;  5DCN A;  4CYE A;  1SGH A;  3HHM A;  3S2A A; 
#chains in the Genus database with same CATH topology
 5JH5 C;  2RPQ A;  3X0W A;  3ZNI D;  3PLU A;  1H8C A;  2LAS A;  3FIL B;  2HDE A;  4YTP B;  2JRH A;  4XWW A;  3PHW B;  2CHW A;  1P1A A;  2KJ6 A;  4JE3 B;  4PS8 A;  1UWM A;  2Y5P A;  4QAY A;  5JXV A;  2QCZ A;  3P4R B;  2KVR A;  4NJ6 A;  1ROE A;  1WGG A;  1P3Q U;  3B2G A;  1PGX A;  4GGQ A;  1TY2 A;  2FE8 A;  1C77 A;  4P6V F;  2ZW1 A;  3IFW B;  4KV2 A;  3VH3 B;  3CIR B;  4FHJ A;  3NVW A;  4ZRP A;  3DWM A;  2ZNV C;  1JRP A;  4RM9 A;  2KWC A;  2BYV E;  2WXP A;  4ZYS A;  4E74 A;  1N5X A;  5HFY A;  3NVV A;  2DZK A;  1EWY C;  5CHF A;  4ASW C;  1OQY A;  2HD5 B;  1E6E B;  4HCN B;  3DPD A;  2M8S A;  4HDQ A;  3P42 A;  3NJT A;  4MGK E;  2GOW A;  2XBB C;  3VTU A;  4HEA 1;  2K0P A;  3GE8 C;  1DGJ A;  3AE9 B;  3R2T A;  2BW2 A;  1EU4 A;  1PFD A;  4GSW A;  4ITK A;  2JYE A;  2BS2 B;  3R66 C;  2AEH A;  4LJO B;  1KLG D;  4RGM A;  2X38 A;  5CTR C;  1DYQ A;  1FMA D;  1AN8 A;  3ZIM A;  2Z0D B;  1UUP A;  1FXT B;  3I63 C;  4Q2J A;  1SB3 C;  3HRD D;  1OFF A;  4B95 A;  3ZYY X;  4F1S A;  4TMA B;  2MA9 B;  1BT0 A;  2ZVN A;  4IKG A;  1A5R A;  3ZTD A;  1STE A;  4MSM B;  2KAC A;  1OQR A;  2DYO A;  3RUL A;  1SE3 A;  5AEK B;  4LDT B;  1N6Z A;  1WX8 A;  2MP2 B;  2KVZ A;  2XEW A;  3AXC A;  3TL5 A;  2IO3 B;  3EEC A;  3C0R B;  4A6Q A;  2XK5 A;  4RF1 A;  4F7Z A;  1TY0 A;  3TEX A;  4PYU A;  2QJL A;  3ZLZ A;  1C76 A;  1WY8 A;  2C7H A;  4JLC A;  2ZNV B;  3Q14 C;  1C79 A;  1TZO A;  2KWD A;  3LJ3 A;  1M4V A;  4KGT A;  3PSE B;  2N9L A;  2AQ1 B;  4C4V A;  4MGI E;  4ZDV A;  4PK1 A;  3QWZ B;  2KTF A;  5FR3 A;  4WQM A;  1KOT A;  3GP7 A;  4A8X C;  4R3D A;  2MBE A;  4EKU A;  1JAL A;  2LRW A;  3DBL I;  3AM9 A;  4MSQ B;  4GB9 A;  3RI7 C;  4KKI A;  3ONS A;  4MEL A;  2YLM A;  3Q2A C;  4NJ7 A;  3NZ3 A;  1MG8 A;  4E71 A;  2N0S B;  1PGA A;  3APD A;  2WXH A;  2WDT B;  2IJ0 A;  2ZW0 A;  3E9S A;  1KM7 A;  3RNA C;  1HZ5 A;  2L76 A;  2DNF A;  3B0A A;  2YEP F;  1WE7 A;  4GDL B;  1ZXI A;  5E6P A;  1UBQ A;  1SBB B;  4BFR A;  3AN1 A;  2WDV B;  1DOX A;  1AAR A;  1XO3 A;  2GLS A;  4C7Y A;  2K1F A;  1YJJ A;  1RYJ A;  4W9G A;  2N9P C;  2IND C;  2KLC A;  1JWU D;  3NY5 A;  2IO1 B;  3D32 A;  2D10 A;  4FN2 A;  3UI3 A;  2CU1 A;  1UH6 A;  3RN9 C;  1YQ3 B;  5C23 A;  2JRI B;  1D4B A;  2L0T A;  5D2M B;  5E6O A;  1C3T A;  4GXB A;  2ACZ B;  4HDO A;  1SIF A;  4KZC A;  1D5M C;  1I4X A;  2BYF A;  2N7J A;  3NS8 A;  1NI2 A;  1WFY A;  2CS4 A;  3ZNZ B;  3AI5 A;  4OZA A;  4DHJ D;  3URY A;  3AEC B;  2Z8L A;  3SU8 X;  1FNV A;  1F52 A;  3WAM A;  4WJN A;  1RLF A;  1L6U A;  1WX7 A;  1I7H A;  3UF8 A;  4ZRQ A;  1T3Q A;  3QX1 A;  3UIN B;  3DQV A;  4G0N B;  1R4M I;  2OJR A;  2I38 A;  2PE9 A;  1WMH A;  4DHJ B;  2WXF A;  3LYY A;  3MJW A;  2MJD A;  3TEZ A;  2JUO A;  3L16 A;  3AEB B;  2D3C A;  2CR5 A;  1WR1 A;  2AWT A;  3GZN I;  4TKN A;  4WWP A;  4OVZ A;  3AH7 A;  2WXO A;  1E7P B;  3SFE B;  2FCS A;  3NUH B;  2KO3 A;  1J7C A;  1TKG A;  2WX1 A;  1R4N I;  2NS5 A;  2LWP A;  2RDG A;  2ON8 A;  3ZJV A;  1K53 A;  2IBI B;  2WP9 B;  3WAN A;  2L0F A;  1MHH E;  3K9P B;  2D3A A;  4WWO A;  1WGY A;  1YJI A;  2KFK B;  3TSS A;  4IM2 A;  2NPT A;  4BVU C;  1L5P A;  4YXD B;  3B2F A;  2E3T A;  2MEK A;  3V6E B;  1Q10 A;  4EOY A;  2BB5 A;  4DXF A;  1XF5 L;  5C3J B;  3NZU A;  1KJT A;  1TS2 A;  1PYW D;  3PS6 A;  1KLV A;  3DVG X;  4IOI E;  1KLU D;  1TJE A;  3B1L X;  4TUU A;  2VZK D;  4L2Y A;  3Q6B A;  2W55 A;  3KYC D;  1EF1 A;  1UGM A;  4J6I A;  3HUI A;  2KLG A;  2NMQ A;  4RGO S;  4DHZ E;  1V8C A;  2Q5W D;  3N1Y C;  4K3B A;  2ZCB A;  4XX5 A;  1IYF A;  1UWX A;  3BVZ A;  1WJ6 A;  1SE2 A;  2EKI A;  2KHW B;  1YX6 B;  3OWE B;  1JWB D;  4X57 B;  4HVB A;  4JGH B;  1V1P A;  1PUT A;  3AEG B;  3APC A;  2Z0E B;  2KMM A;  3MFG A;  2OED A;  2EKE C;  2WLB A;  5IAA C;  1TZ1 A;  3FIL A;  2RGF A;  3VDZ A;  3UGB B;  3V61 A;  5LNK 1;  1SEB D;  2DZI A;  1VZ6 A;  1FD6 A;  3BVM A;  4K7U A;  5TSS A;  5EDS A;  3KYD D;  3I5J C;  3NRZ A;  4CQN A;  2M17 A;  3IT4 B;  2G4S A;  3JSV B;  4XGA B;  1YD8 U;  2ZZP B;  4FJV B;  4C80 A;  3BYT B;  2MJE A;  2JWU A;  1VRA B;  1WXA A;  1P9D U;  4MM3 A;  3UQB A;  4AUQ C;  3OJ4 B;  1AYF A;  3VR9 B;  1RWS A;  2Y3A A;  2MH7 A;  2KTR B;  2MHJ A;  1XD3 B;  5IO9 A;  2CHZ A;  4FJZ A;  1EO6 A;  2BT6 A;  2D5G A;  4FAD A;  3ZW3 A;  4A90 A;  3SFD B;  1WJ4 A;  1HTO A;  4ZHO A;  5BMI A;  3ZNG C;  2ZJD A;  2H89 B;  4FUL A;  1H4R A;  3E56 A;  1L0Y B;  1SGH A;  3ZXV A;  1SE4 A;  2JSV X;  3ZUN A;  1R4M B;  2V1Y A;  3TUO A;  3RNG C;  2H88 B;  3M95 A;  1UEL A;  4ZRK A;  2LHD A;  2JZZ A;  5AZF A;  4BKS D;  2DZM A;  3QC8 B;  4EZK A;  5E6J A;  2NBV B;  2WXM A;  1ZGU B;  4ARC A;  5H8Y E;  2BKF A;  1Q5W B;  1WXQ A;  4E3C A;  4M8M A;  1FCC C;  3NOB A;  1JWM D;  1JWA D;  3DDC B;  3VTW A;  3PHX B;  3ZXR A;  2W3R A;  2ONQ A;  1VZ8 A;  1QOF A;  2K25 A;  3DVN V;  5KHQ A;  4N6E B;  4HWI B;  1R4N B;  4JWS C;  4XE0 A;  1FXI A;  3NZS A;  1TS3 A;  1SSN A;  5EE3 A;  5DPW A;  3AE2 B;  3BY4 B;  4WAA A;  4W9D A;  4GLS C;  2WQY B;  3SD5 A;  2R2Q A;  2ZPN A;  2L83 A;  2Y5C A;  2J4X A;  4MGZ E;  1NBF C;  2NTT A;  4HPP A;  3W1S C;  2IY1 B;  3RNB C;  1CMX B;  2B3A A;  3P4P B;  3DHH C;  4P1B C;  3I9V 1;  2HJ8 A;  2RDH A;  4YT0 B;  3DVN U;  3P4S B;  2G9H D;  3H1U A;  2D07 B;  2MW5 A;  1XCT L;  1ZDX A;  1E8X A;  3ZVV A;  2BF8 B;  1T0Q C;  3U52 E;  2K3U A;  3IAS 1;  1SXT A;  2JT4 B;  4KKJ A;  3M62 B;  3JW0 X;  2WGS A;  3R8B A;  3WA0 A;  2KQS A;  4B6W A;  4G11 A;  1XLP A;  4GDL A;  4LJP B;  2LVQ A;  2FNJ B;  2C7M B;  2YVC A;  1R7S A;  2J7Q B;  1N5W A;  1YNT E;  2D3B A;  4LNN A;  1AWD A;  4ZRI A;  1B9R A;  3ML8 A;  4HXD A;  1NVI D;  2KAN A;  3SEB A;  4DXA B;  2LGS A;  1D5Z C;  4EEW A;  4DK5 A;  3HIZ A;  1FNU A;  2DYM A;  1IBX A;  4HRO A;  4A9A A;  5MPO A;  3N32 A;  1CQV A;  3BZD B;  4GOC A;  4GU2 A;  1ACC A;  5G5G A;  4NJC A;  3ML9 A;  4YSY B;  1PQS A;  1IGC A;  1E90 A;  3AE5 B;  1WF9 A;  2QDF A;  2LUE A;  3BWU D;  4W9H A;  2LHE A;  3AEA B;  3BVG A;  5J2R A;  2IGD A;  1WX9 A;  3I3T B;  1TS5 A;  2LD9 A;  1YN5 A;  3QQ8 B;  2V3N A;  2BVC A;  4I6N B;  4AOF A;  2CJN A;  3H7P B;  3WAO A;  1VR9 A;  2FBW B;  4CHK A;  2PMV A;  3QAQ A;  4JX1 C;  1L4Z B;  4DWF A;  2JVC A;  3C8Y A;  2UYZ B;  2R61 A;  4A20 A;  3A1Q B;  3UQA A;  1UF0 A;  1F2R I;  4HCP B;  2K6Q A;  2KDI A;  5DPS A;  2CKH B;  2BQQ A;  3ZTC A;  1GC6 A;  3PRP B;  2I2Y A;  3DCG A;  4WAF A;  1GPX A;  1MI0 A;  3A4S C;  4FJY A;  3X23 A;  1CK1 A;  5J17 A;  1C4A A;  1N61 A;  4LK0 M;  2X8X X;  4G3X B;  4NAW B;  2O2V A;  3L13 A;  4W9E A;  3R7R A;  4MEM A;  1V5O A;  4O1N A;  3P63 A;  1J8C A;  3Q3M C;  5HG2 A;  4IW0 A;  2LXC A;  2R2O A;  4RGT A;  2BTE A;  4W9J A;  3RCZ A;  3KUC B;  2IDY A;  1JRU A;  2MQJ A;  5BMH A;  3V62 A;  2BBC A;  2C7N B;  1QLB B;  2LGD A;  4ZHP A;  2K8C A;  1FM0 D;  1ET9 A;  1FNW A;  1NYR A;  3PRZ A;  1V81 A;  4B9K A;  4OW0 A;  4OVU A;  2N4F A;  4II2 B;  3TEW A;  5AUK A;  1F0Z A;  4MT5 A;  1P7F A;  2N7E A;  4IC7 B;  5IN7 A;  2J52 A;  2FCN A;  3TBL D;  4KIK B;  4B0M A;  3LXF A;  4NPN A;  1C4C A;  2RPV A;  2DAJ A;  3I57 A;  3VXW A;  1SJE D;  2NVU I;  3P1M A;  3JYU A;  4NNJ B;  4XDD A;  4BZA A;  1F2R C;  3A9K B;  3ETR A;  1HTQ A;  4LTU A;  5EE9 A;  5TR5 A;  1T0S C;  3AU5 A;  1ZOY B;  1Y8R C;  2KX0 A;  4N58 A;  2DHZ A;  4M00 A;  4C7Z A;  3Q3O C;  4WWN A;  3AU4 A;  4XWT A;  4I6P A;  4GIV A;  3JSV A;  2DX5 B;  4K3C A;  5LXH A;  2L00 B;  2LUM A;  2DZJ A;  1V2Y A;  2HJ1 A;  2WNM A;  3WAP A;  1GB4 A;  4L1B A;  1DOY A;  4B0E A;  1TTN A;  2J0J A;  2GI9 A;  3GOE A;  2K9X A;  1I4G A;  4N59 A;  3V05 A;  2W82 A;  2INP E;  1XXG A;  3CST A;  4BBN F;  3CSF A;  5AZH A;  4W9L A;  3CMM B;  2PVG C;  1I4P A;  2LEK A;  1WSP A;  3EGR A;  4ACF A;  4RFB A;  3NVY A;  2L05 A;  4IWP A;  2KZR A;  4GDK B;  2L3Z A;  3IBE A;  3FC4 A;  4M0W A;  2KNB A;  4KSL C;  3N9Y C;  2KK8 A;  2RR9 A;  2V3S A;  3NS1 A;  1RM6 C;  1ZKH A;  1B1Z A;  4ICU A;  4IWQ A;  3U4E G;  1CZP A;  3Q3N C;  1VD2 A;  3SHQ A;  4P1C C;  3QAR A;  4XC2 A;  3AEF B;  1UGJ A;  1KH0 A;  2VH1 A;  2BWF A;  4H2A A;  1U4A A;  3KW5 B;  1HE8 A;  1Z5S B;  2NCN A;  2IO0 B;  2K5P A;  1C78 A;  1QF6 A;  1WWT A;  4KZ0 A;  3P4Q B;  4LCD E;  4WJP A;  1C1Y B;  1IPG A;  4IDI A;  5J18 A;  1C9F A;  5I4D A;  1JWS D;  2MBQ A;  1FPY A;  1UBI A;  2AQ2 B;  4FXC A;  1QOA A;  2CU3 A;  2O6V A;  1IUE A;  1WZ0 A;  1WR6 E;  3PVL A;  3RNC C;  2M1M A;  4ANU A;  2N9X A;  2J0M A;  1V49 A;  5BMG A;  1ZXH A;  3VH4 B;  2RMM A;  3RNF C;  1XCQ L;  5HHD G;  1MJD A;  3EFU A;  2N1W A;  3KH0 A;  2L32 A;  2L8J A;  4MJS A;  4AP4 C;  5DCN A;  4ZOH C;  4WIP A;  3J9C A;  2KFJ A;  2GBJ A;  2M0X A;  3RPF C;  1WRI A;  1FRR A;  5D3D A;  2BKR B;  1I42 A;  5E6N A;  5CHW A;  3T3O A;  4MAC A;  5G55 A;  2PLP A;  4JL9 A;  4FHK A;  2V4I B;  2LFI A;  4P7I A;  3K9O B;  1WYG A;  5BYS A;  4F8C B;  3L4P A;  1JW9 D;  1JRO A;  2KN4 A;  2AL6 A;  3AE4 B;  4WJQ A;  5FKA C;  3A9J B;  4FBJ B;  1SJH D;  3H7S A;  2JZP A;  3TJP A;  2KJR A;  4DDI D;  4WQO B;  1PGB A;  2QMT A;  1WXM A;  4C56 C;  2UWQ A;  3DVG Y;  4M02 A;  1KRH A;  3DBL B;  4K1R B;  3PT2 B;  2JXX A;  3V6C B;  2XNA C;  4KX6 B;  1X1M A;  1YX5 B;  2KMA A;  2ZEQ A;  2WXQ A;  1WE6 A;  3WIM A;  2WXG A;  1RFK A;  3VFK A;  2MX2 A;  3ABV B;  2G1E A;  2QC8 A;  3MC0 B;  1WH3 A;  3EA6 A;  3HVZ A;  2VZK B;  3HM6 X;  2D3G A;  1MFW A;  1UNS A;  3RMK C;  2E6X A;  4US9 A;  3ZKJ C;  2MWS B;  1Y56 A;  1IP9 A;  2LVP A;  2YEP B;  4USA A;  4ANV A;  4IG7 B;  2D2Q A;  2IGG A;  1E7V A;  3L08 A;  4MDK E;  1YMH E;  3NG0 A;  3L54 A;  2XN9 C;  3LDZ E;  2FCM A;  2DWQ A;  1V97 A;  3H7P A;  2M4N A;  1FO4 A;  5FR6 A;  1XQQ A;  4RCO A;  2FIF A;  3DOW A;  5D6J B;  4TV3 A;  5EE0 A;  4MGY E;  2IPK D;  2IY0 B;  4W9I A;  4IM0 A;  1WGR A;  3PLV A;  1J0G A;  2Z59 B;  2ICI A;  1GAQ B;  2EEL A;  3AE7 B;  3A1Q A;  3PZ7 A;  4IM3 A;  2KDB A;  1T0R C;  4HLE A;  4AWJ A;  2IO2 B;  4PS3 A;  3N30 A;  3PV1 A;  1E8Y A;  2V4L A;  1V5T A;  1WYW B;  2GB1 A;  2SEB D;  4HPM B;  2BS4 B;  1RFA A;  4NAW A;  2M56 B;  4AJY B;  5DPT A;  3EUB 2;  4XZ4 A;  1WIA A;  4DDG D;  1S3S G;  3Q3F A;  2WU2 B;  1FXA A;  5BYQ A;  1WJN A;  3VTV A;  3T8M A;  1AW7 A;  3GZN B;  1KTK A;  3QA8 A;  2LRU A;  4RH6 A;  4US8 A;  2W3S A;  3HM3 A;  2OJW A;  1TGZ B;  2G4D B;  4EZJ A;  2WXN A;  3IVF A;  1E9M A;  2ASQ A;  5LLI A;  1I35 A;  4YSX B;  2MP2 A;  2BGF A;  1V9J A;  3R7Q A;  1MVK A;  1TS4 A;  4NY0 A;  2B76 B;  1FRD A;  4KIK A;  2WWZ A;  2KN5 A;  2V3P A;  4GN1 A;  3UIP B;  3Q3J A;  2GRI A;  4GMV A;  2HTH A;  5EE1 A;  2RD0 A;  5JZE B;  2KJH B;  2NR2 A;  1N60 A;  2M19 A;  3A9K A;  4WWM A;  4BOZ B;  3LB8 C;  2JXT A;  4M01 A;  3PGE A;  3V60 A;  4UDU C;  3TIX A;  3DBR I;  1NYQ A;  3IHP C;  3OG5 A;  5D3I B;  2CJO A;  2KDM A;  1MG4 A;  1ZE3 D;  4NQL B;  4LNO A;  4TQ1 A;  3L0W B;  2GBR A;  4AS1 A;  1HZ6 A;  2Y5B B;  3AE1 B;  3ZGZ A;  1MHX A;  2NBW B;  2PKO A;  1QKZ A;  3PRE A;  2FUH B;  3FKY A;  1GC7 A;  3APF A;  2UU7 A;  3AUL A;  2NPT B;  4YWG G;  1HA5 A;  2OOB B;  2WXR A;  2CHX A;  1LO5 D;  2HE7 A;  3GE3 C;  2BWE S;  2MBO A;  1ZP0 B;  3N1X C;  3SDL C;  4A3O A;  1F1H A;  1RAX A;  2W54 A;  2W9N A;  2J53 A;  5H92 C;  3BIN A;  4N9F 4;  1ZUD 2;  1I4Q A;  3L17 A;  2MRP A;  3BK1 A;  1L4D B;  3JVZ X;  1WI0 A;  2ZPY A;  5GXG B;  4URK A;  5HI1 A;  2K6D B;  1ENF A;  2WDQ B;  2DBY A;  3QCA A;  4J3O D;  3KWV A;  1QT9 A;  2I1J A;  1E8W A;  3IT6 B;  3KUD B;  4WUR A;  4ANW A;  4DQO C;  1EM7 A;  1GG3 A;  1LGR A;  1YQB A;  3W1Y A;  2JYT A;  3MTN B;  3VUX A;  1XLN A;  2DLB A;  4KSK C;  3AEE B;  1ZPS A;  4OHJ A;  1VCB A;  2FUG 1;  4HKQ A;  4HPL B;  4RGN A;  1E5W A;  2LZ6 A;  3MHS D;  2J42 A;  1FIQ A;  1L2N A;  4TSS A;  2HTM E;  1YIW A;  3KVF B;  4MM3 B;  3PTF C;  1YJ1 A;  1T0Y A;  1XT9 B;  1PDX A;  2KAJ A;  4WH4 A;  1WM2 A;  3W9C B;  2LJI A;  2QIE B;  2GBM A;  2TSS A;  3VUY A;  5IKC M;  1GOZ A;  4KVG B;  3EFC A;  3TMP B;  2IGH A;  1K51 A;  3M3J A;  4W9F A;  2KFK A;  4DXG A;  3ZQ4 A;  3AMZ A;  4JIO U;  2WU5 B;  2D11 A;  4W9K A;  3RYT A;  3BYY B;  3RUI B;  1WXV A;  3OAW A;  2K8B A;  3U2S C;  1J19 A;  2KD0 A;  4PT5 A;  4CO7 A;  3A9J A;  1XLQ A;  4LDT D;  3MP9 A;  1D6E C;  3N1Z C;  1D3Z A;  4YL8 A;  3RFZ B;  3DBR B;  3Q8E A;  5JHA A;  2LGY A;  4MH8 A;  2BS3 B;  1S1Q B;  2SAK A;  3VR8 B;  1Z2M A;  1GNU A;  1VJK A;  3W5V B;  3MC9 A;  4I6L B;  1N62 A;  2IZV B;  1VDV A;  1WJU A;  1Q1O A;  4RMA A;  4KGS A;  2KYW A;  4CYE A;  1VZ7 A;  3HHM A;  3S2A A;  1EWC A;  4BOS C;  1NDD A;  1EU3 A;  5LXI B;  3IXS A;  2DAF A;  2QHO A;  2V9H A;  4RM8 A;  4RF0 A;  1YOV B;  1VLB A;  4KGR A;  1A70 A;  3NHE B;  2KOX A;  3ZO5 B;  3IAM 1;  2KC1 A;  1SE9 A;  4YTN B;  3DBH I;  1ZW7 A;  1LXD A;  2KTR A;  1KFY B;  1TIF A;  4G50 A;  1TT5 B;  2KWU B;  3H9D A;  3A4R A;  4OZC A;  1GB1 A;  1LM8 B;  2C5L C;  4P16 A;  2LGI A;  3NVZ A;  5HKH A;  2WXI A;  5G2N A;  1J7B A;  2JF5 A;  2PTL A;  1BUI C;  1V1O A;  2PJH A;  4NZL B;  4XYC A;  3SR6 A;  4TQ0 A;  4M8N A;  1OTR B;  2LXA A;  2INN E;  3DWG C;  4IUM B;  3AE3 B;  3Q69 A;  1IBX B;  2AL3 A;  2WXK A;  1F9J A;  4K81 A;  4LNF A;  2ZVO A;  3PPA A;  2PEA A;  4EUT A;  1NI3 A;  5BYR A;  4FLH A;  2N1V A;  2J0K A;  5AZG A;  2VRR B;  3OJ3 A;  2MBB B;  4LLG M;  3Q8F A;  3RT3 B;  3R2I A;  1HEZ E;  2L52 A;  3T3N A;  3Q8A A;  1QOG A;  2KWV B;  4BKS A;  4A3P A;  4DBG A;  2BB6 A;  1FFU A;  1E8Z A;  3TEY A;  4AJW A;  3ZNH B;  3Q8C A;  4MH0 E;  2N7D A;  1NEK B;  2RDB C;  4LNK A;  3AED B;  1F77 A;  3FAH A;  3RZW C;  2N9K A;  2NBU A;  1ESF A;  1RRB A;  1LQB A;  1QQR A;  1XEE A;  3PRM B;  5CX3 A;  2MBH A;  2KQ7 A;  1L6V A;  3CWI A;  2WXJ A;  4BBN C;  3T9L A;  1IGD A;  1T5X D;  1K52 A;  5GMV A;  3QJZ A;  3BK2 A;  2JPH A;  4BKT A;  2KDE B;  1JML A;  2EMT A;  4YSZ B;  1WGD A;  1WGK A;  2O2V B;  4ZYN A;  2MLB A;  1YN3 A;  3IG3 A;  1EUV B;  1ZDV A;  2GBN A;  2LGX A;  1N63 A;  4YTM B;  1E0Z A;  3DHI C;  4HKZ E;  3WAL A;  4NAM A;  1TYG B;  2DEN B;  5BO4 B;  3KQ4 A;  3L10 B;  3ALB A;  2MJ3 A;  1L0V B;  2PVO D;  1XLO A;  4S0R A;  1JCK B;  3ZRC A;  2JU6 X;  3KUZ A;  2QIL A;  3VUW A;  1WXS A;  2M0A A;  5FK9 C;  1E10 A;  2K39 A;  2BYE A;  1YQ4 B;  4PS7 A;  2AX5 A;  2A4Z A;  2GMI C;  1QZE A;  2XK5 B;  3PZ8 A;  1L0X B;  1TBE A;  3VRB B;  3QHT A;  1EF5 A;  1P0R A;  4JPS A;  2MCN B;  3PO0 A;  3MHZ A;  3RD2 A;  2JZ3 B;  2A5U A;  1D5X C;  3KWL A;  2MSE D;  3GB1 A;  1FCL A;  2L7R A;  3DBH B;  4C4V B;  2FCQ A;  3ZJU A;  2BYT A;  4XDC A;  3W1S A;  4EFO A;  4HRS A;  1WZ3 A;  4RNA A;  2DYB A;  5L83 A;  2WHI A;  3DHG C;  3H6N A;  4WJO A;  2REX A;  2LVO A;  1I4H A;  2QSD A;  4OZB A;  2JX5 A;  1ET6 A;  3ZRF A;  1UD7 A;  3VQI A;  3N20 C;  3ZDM C;  1SIJ A;  3OLM D;  3U8Z A;  2BPS A;  4NQK E;  2EMS A;  2KKC A;  2KQ4 X;  3R3M A;  2AQ3 B;  2NTS A;  3V3X A;  5C2T B;  1TKY A;  1GJZ A;  4DHZ B;  2WS3 B;  3HK0 A;  4HJG E;  2JWZ A;  2RSU A;  3VRA B;  2N9E B;  4JWU C;  3RZF A;  4LNI A;  4REZ A;  5G5H A;  1WGH A;  1FEH A;  2LMC A;  1LFD A;  1M94 A;  4W9C A;  1K50 A;  4ZRJ A;  3KLS X;  2WDR B;  1G6J A;  1YN4 A;  3AV8 A;  3VVW B;  3MJ5 A;  3HVD A;  3DBS A;  5T8I A;  3H8H A;  3U7D A;  4AQ7 A;  3VAW A;  4M0W B;  1GUA B;  4ANX A;  2K22 A;  3C19 A;  5KHO A;  3P2B A;  3AE6 B;  3W2D A;  3O65 B;  4IWO A;  3GS2 A;  4HK2 A;  1SF0 A;  2INC C;  2G3Q B;  2O6V D;  5CHV C;  2WXL A;  5IA7 A;  2OHF A;  3QIJ A;  2V0G A;  1ISN A;  1NEN B;  1QIL A;  4BKG A;  1UZX B;  2FID A;  1WMH B;  1FFV A;  2I1K A;  2WX0 A;  5DPR A;  2G45 B;  4PYZ A;  4D2K A;  2PW9 A;  4HJK A;  2PPH A;  4L23 A;  2O6V B;  2L1A A;  4II3 B;  2LI5 A;  1T6B X;  2LJ5 A;  4KDI C;  1KF6 B;  3WCQ A;  3O13 A;  5D7G A;  1WM3 A;  3EHV A;  1HQR D;  1CJE A;  2WYQ A;  3AB5 A;  3UIO B;  4ARI A;  5IOI A;  3A33 B;  1DOI A;  3M63 B;  2C60 A;  1J7A A;  5C1Z A;  4MJS B;  2VH2 A;  2K8H A;  3MC8 A;  3VHT C;  2PE6 B;  3Q8B A;  1P7E A;  3RNE C;  1P98 A;  1C4P A;  1JQ4 A;  2KMC A;  1E7U A;  1OEY A;  2JY6 A;  3W5U B;  4K7S A;  4K7W A;  3B08 A;  3TCA A;  2C9W B;  4BAX A;  1OEY J;  2QEJ C;  2KT7 A;  3ZJT A;  2IYD B;  2KC2 A;  1V80 A;  5AUI A;  3ECI A;  1QOB A;  2JQR B;  1Q0W B;  2KDF B;  1L7Y A;  3ZDT A;  5JHB A;  1HXY D;  1OGW A;  1BML C;  2GBK A;  4FA6 A;  4C00 A;  5L95 C;  1K8R B;  2KXJ A;  4S17 A;  1BXT A;  3AE8 B;  3CF6 E;  3B9J A;  1OQQ A;  5D94 A;  4EZL A;  1MPE A;  1WRD B;  2FAZ A;  2KX3 A;  3QK0 A;  4JQW C;  3PZD A;  4OVV A;  3EC8 A;  4A55 A;  4GDK A;  1V6E A;  2PIA A;  1V86 A;  5IP4 D;  3N3K B;  3U7Z A;  3ENE A;  2AYO B;  2ZCC A;  3U30 A;  4ICV A;  1TKE A;  4KDL B;  3BII D;  1I4R A;  1V1P B;  4EE2 A; 
#chains in the Genus database with same CATH homology
 2KFJ A;  5JH5 C;  2GBJ A;  2M0X A;  4BOS C;  2RPQ A;  3ZUN A;  1NDD A;  3X0W A;  3PLU A;  3ZNI D;  2BKR B;  1I42 A;  2V1Y A;  1H8C A;  2LAS A;  3M95 A;  1UEL A;  2JRH A;  5CHW A;  5E6N A;  4ZRK A;  3PHW B;  2JZZ A;  2DAF A;  5AZF A;  5G55 A;  5LXI B;  2QHO A;  2CHW A;  4BKS D;  1P1A A;  2DZM A;  2KJ6 A;  3QC8 B;  4JL9 A;  4PS8 A;  4RM8 A;  4FHK A;  4EZK A;  2NBV B;  2KVR A;  4NJ6 A;  4P7I A;  3K9O B;  1WGG A;  3NHE B;  1ZGU B;  2KOX A;  1P3Q U;  3ZO5 B;  4F8C B;  2BKF A;  1Q5W B;  2AL6 A;  4GGQ A;  4WJQ A;  2KC1 A;  1SE9 A;  4E3C A;  3A9J B;  4M8M A;  4FBJ B;  3IFW B;  3DBH I;  3H7S A;  3NOB A;  4KV2 A;  3VH3 B;  3DDC B;  1ZW7 A;  3TJP A;  2KJR A;  1LXD A;  4FHJ A;  3PHX B;  3VTW A;  2KTR A;  4DDI D;  4WQO B;  2ZNV C;  2K25 A;  3DVN V;  2KWC A;  4RM9 A;  1WXM A;  2BYV E;  4G50 A;  5KHQ A;  4HWI B;  2KWU B;  4E74 A;  3H9D A;  3A4R A;  2UWQ A;  3DVG Y;  3NZS A;  2DZK A;  1LM8 B;  5DPW A;  5CHF A;  4K1R B;  3PT2 B;  2JXX A;  3V6C B;  4ASW C;  2C5L C;  3BY4 B;  1OQY A;  4WAA A;  1X1M A;  1YX5 B;  2KMA A;  4W9D A;  2ZEQ A;  2HD5 B;  5HKH A;  3SD5 A;  1WE6 A;  3WIM A;  5G2N A;  3VFK A;  4HCN B;  2MX2 A;  2JF5 A;  3DPD A;  2R2Q A;  2ZPN A;  2M8S A;  4HDQ A;  1WH3 A;  4MGZ E;  4MGK E;  2GOW A;  3HM6 X;  2D3G A;  2PJH A;  1NBF C;  2XBB C;  3VTU A;  3W1S C;  2IY1 B;  1CMX B;  2B3A A;  4TQ0 A;  3ZKJ C;  4M8N A;  1OTR B;  2LXA A;  2MWS B;  2HJ8 A;  1IP9 A;  4IUM B;  2LVP A;  3DVN U;  4GSW A;  2AL3 A;  1F9J A;  4K81 A;  4ANV A;  4IG7 B;  2D2Q A;  3H1U A;  2D07 B;  2ZVO A;  1E7V A;  3PPA A;  3L08 A;  4MDK E;  2MW5 A;  2PEA A;  4EUT A;  3R66 C;  2AEH A;  4LJO B;  4FLH A;  1E8X A;  2N1V A;  2J0K A;  3ZVV A;  2BF8 B;  5AZG A;  2VRR B;  5CTR C;  3OJ3 A;  2MBB B;  3ZIM A;  2Z0D B;  1FXT B;  3L54 A;  3RT3 B;  3LDZ E;  2JT4 B;  4B95 A;  2KWV B;  4BKS A;  4F1S A;  3M62 B;  3JW0 X;  2FCM A;  3WA0 A;  3H7P A;  2MA9 B;  4A3P A;  1BT0 A;  4DBG A;  2KQS A;  2M4N A;  2ZVN A;  5FR6 A;  1E8Z A;  1XQQ A;  2FIF A;  4B6W A;  3DOW A;  5D6J B;  4TV3 A;  1A5R A;  4MGY E;  2IY0 B;  4W9I A;  4IM0 A;  4AJW A;  1WGR A;  3ZTD A;  3PLV A;  4G11 A;  2Z59 B;  4MSM B;  3ZNH B;  1J0G A;  2DYO A;  4MH0 E;  4GDL A;  2N7D A;  4LJP B;  3RUL A;  5AEK B;  4LDT B;  2LVQ A;  3A1Q A;  1WX8 A;  2FNJ B;  2MP2 B;  2XEW A;  3AXC A;  2C7M B;  3TL5 A;  2IO3 B;  3RZW C;  4IM3 A;  2NBU A;  3EEC A;  3C0R B;  2XK5 A;  1RRB A;  2YVC A;  4F7Z A;  2KDB A;  4PYU A;  2J7Q B;  4HLE A;  3ZLZ A;  1WY8 A;  2C7H A;  4AWJ A;  1LQB A;  2IO2 B;  2ZNV B;  4JLC A;  3N30 A;  4PS3 A;  3PV1 A;  3PRM B;  5CX3 A;  4ZRI A;  1E8Y A;  3ML8 A;  4HXD A;  2KAN A;  2V4L A;  2MBH A;  2KQ7 A;  4DXA B;  1V5T A;  4BBN C;  1WYW B;  3LJ3 A;  3T9L A;  4DK5 A;  4EEW A;  3HIZ A;  2DYM A;  3PSE B;  4ZDV A;  4MGI E;  4HPM B;  5GMV A;  3QWZ B;  3QJZ A;  1RFA A;  2KTF A;  3N32 A;  4NAW A;  2JPH A;  4GOC A;  1KOT A;  4BKT A;  4GU2 A;  2KDE B;  4AJY B;  5DPT A;  2EMT A;  4XZ4 A;  1WIA A;  3ML9 A;  1WGD A;  1PQS A;  4DDG D;  2O2V B;  1E90 A;  1S3S G;  2MBE A;  4ZYN A;  2MLB A;  3Q3F A;  3IG3 A;  4EKU A;  1WJN A;  2LRW A;  1EUV B;  2GBN A;  3VTV A;  3DBL I;  3T8M A;  1WF9 A;  2LGX A;  4MSQ B;  4GB9 A;  2LUE A;  3QA8 A;  2LRU A;  4W9H A;  3WAL A;  3HM3 A;  3ONS A;  4MEL A;  2YLM A;  1TGZ B;  5J2R A;  4NJ7 A;  1MG8 A;  2G4D B;  4EZJ A;  2DEN B;  1WX9 A;  3I3T B;  5BO4 B;  4E71 A;  3L10 B;  3IVF A;  2LD9 A;  3ALB A;  3QQ8 B;  3APD A;  4I6N B;  4AOF A;  3H7P B;  3WAO A;  2ASQ A;  4CHK A;  3QAQ A;  5LLI A;  1I35 A;  3ZRC A;  4DWF A;  2JVC A;  2WDT B;  3KUZ A;  1KM7 A;  2MP2 A;  3VUW A;  2L76 A;  1WXS A;  2BGF A;  3B0A A;  2K39 A;  1WE7 A;  1V9J A;  2BYE A;  2UYZ B;  4GDL B;  4PS7 A;  4A20 A;  3A1Q B;  3UQA A;  5E6P A;  1UBQ A;  2A4Z A;  4BFR A;  2GMI C;  4HCP B;  1QZE A;  2XK5 B;  3R7Q A;  2K6Q A;  2KDI A;  5DPS A;  2CKH B;  1AAR A;  1TBE A;  4NY0 A;  3QHT A;  1EF5 A;  1P0R A;  4KIK A;  2MCN B;  2WWZ A;  3ZTC A;  2KN5 A;  4GN1 A;  3RD2 A;  1GC6 A;  2JZ3 B;  2K1F A;  2A5U A;  3PRP B;  3Q3J A;  3DCG A;  3UIP B;  4W9G A;  4GMV A;  2HTH A;  2N9P C;  2KLC A;  2MSE D;  2RD0 A;  5JZE B;  2KJH B;  3NY5 A;  2IO1 B;  2L7R A;  3D32 A;  2D10 A;  2NR2 A;  4FN2 A;  3A4S C;  4FJY A;  3X23 A;  2CU1 A;  5J17 A;  1UH6 A;  3A9K A;  2FCQ A;  4BOZ B;  4G3X B;  4NAW B;  2JRI B;  2O2V A;  3L13 A;  4W9E A;  2L0T A;  3PGE A;  5C23 A;  3R7R A;  3TIX A;  3DBR I;  3V60 A;  4MEM A;  5D2M B;  1V5O A;  3IHP C;  3W1S A;  4EFO A;  5E6O A;  1C3T A;  4GXB A;  4HDO A;  1J8C A;  1SIF A;  1WZ3 A;  4KZC A;  2DYB A;  5L83 A;  3H6N A;  4IW0 A;  4WJO A;  2LXC A;  4NQL B;  2BYF A;  2REX A;  4TQ1 A;  2LVO A;  3L0W B;  2R2O A;  3NS8 A;  1NI2 A;  4W9J A;  3RCZ A;  1WFY A;  2CS4 A;  3KUC B;  3ZNZ B;  1JRU A;  2MQJ A;  2GBR A;  3AI5 A;  3V62 A;  4DHJ D;  3ZRF A;  2C7N B;  2LGD A;  2Y5B B;  1UD7 A;  3VQI A;  2K8C A;  2NBW B;  3ZDM C;  3SU8 X;  3PRE A;  2FUH B;  3OLM D;  3U8Z A;  2BPS A;  4NQK E;  1GC7 A;  3WAM A;  4WJN A;  3APF A;  2EMS A;  1RLF A;  2KKC A;  3AUL A;  3PRZ A;  1V81 A;  2NPT B;  4B9K A;  1WX7 A;  3R3M A;  2OOB B;  4OVU A;  2N4F A;  3UF8 A;  2CHX A;  2HE7 A;  3QX1 A;  3UIN B;  3DQV A;  4G0N B;  4II2 B;  1R4M I;  2BWE S;  2MBO A;  2OJR A;  3SDL C;  2PE9 A;  1GJZ A;  1WMH A;  1RAX A;  4A3O A;  4DHZ B;  4DHJ B;  2W9N A;  3HK0 A;  3BIN A;  4N9F 4;  3MJW A;  2N7E A;  3L17 A;  4IC7 B;  2FCN A;  2MRP A;  2JWZ A;  2RSU A;  2JUO A;  3L16 A;  3JVZ X;  3TBL D;  2CR5 A;  1WR1 A;  4KIK B;  1WI0 A;  2AWT A;  2N9E B;  2ZPY A;  3RZF A;  3GZN I;  4NPN A;  1WGH A;  4URK A;  2K6D B;  4TKN A;  2DAJ A;  4WWP A;  1LFD A;  3QCA A;  1M94 A;  3VXW A;  4W9C A;  2NVU I;  4ZRJ A;  3JYU A;  2FCS A;  1G6J A;  4NNJ B;  2KO3 A;  3A9K B;  3VVW B;  2I1J A;  1E8W A;  3DBS A;  3KUD B;  2WX1 A;  1R4N I;  3U7D A;  2NS5 A;  2LWP A;  5TR5 A;  3VAW A;  4M0W B;  2IBI B;  1GUA B;  3AU5 A;  4ANW A;  1Y8R C;  3WAN A;  2L0F A;  2KX0 A;  1GG3 A;  4ANX A;  2DHZ A;  3K9P B;  4WWO A;  1YQB A;  1WGY A;  5KHO A;  3P2B A;  3W1Y A;  3O65 B;  2KFK B;  4IWO A;  3MTN B;  4WWN A;  3AU4 A;  4HK2 A;  4I6P A;  3VUX A;  4GIV A;  3JSV A;  4IM2 A;  4KSK C;  2DX5 B;  2NPT A;  4BVU C;  5LXH A;  2G3Q B;  1VCB A;  2L00 B;  2O6V D;  5CHV C;  2DZJ A;  3V6E B;  4EOY A;  1V2Y A;  5IA7 A;  3QIJ A;  3WAP A;  1ISN A;  4HPL B;  1E5W A;  3NZU A;  2LZ6 A;  1KJT A;  3MHS D;  1TTN A;  2J0J A;  4BKG A;  3PS6 A;  1KLV A;  3DVG X;  3GOE A;  1L2N A;  1UZX B;  1YIW A;  3KVF B;  3B1L X;  2FID A;  4TUU A;  1WMH B;  3PTF C;  2I1K A;  2WX0 A;  1YJ1 A;  2G45 B;  5DPR A;  4PYZ A;  3CST A;  4BBN F;  3CSF A;  1T0Y A;  5AZH A;  4HJK A;  2PPH A;  4W9L A;  1XT9 B;  2O6V B;  3CMM B;  3KYC D;  1EF1 A;  1UGM A;  4J6I A;  2KLG A;  1WM2 A;  4II3 B;  2LI5 A;  4DHZ E;  2LJ5 A;  2ZCB A;  4XX5 A;  1IYF A;  4KDI C;  2GBM A;  2L05 A;  4IWP A;  5D7G A;  3VUY A;  1WJ6 A;  2KHW B;  1WM3 A;  1YX6 B;  4KVG B;  3EHV A;  2WYQ A;  3TMP B;  2KZR A;  4GDK B;  4X57 B;  3UIO B;  4HVB A;  2L3Z A;  3IBE A;  4JGH B;  3A33 B;  2KNB A;  3M63 B;  4KSL C;  3APC A;  2C60 A;  2Z0E B;  3M3J A;  4W9F A;  5C1Z A;  2KK8 A;  4MJS B;  2EKE C;  2RR9 A;  2V3S A;  5IAA C;  1TZ1 A;  1ZKH A;  2RGF A;  2KFK A;  4ICU A;  3VDZ A;  4IWQ A;  3UGB B;  3V61 A;  2K8H A;  4JIO U;  3VHT C;  2DZI A;  2PE6 B;  2D11 A;  1VD2 A;  3SHQ A;  4W9K A;  3QAR A;  3RYT A;  3RUI B;  4XC2 A;  1P98 A;  1WXV A;  2KMC A;  4K7U A;  3OAW A;  5EDS A;  3KYD D;  2K8B A;  1E7U A;  2M17 A;  1OEY A;  3JSV B;  2G4S A;  2JY6 A;  1J19 A;  1YD8 U;  2BWF A;  1U4A A;  2KD0 A;  3KW5 B;  4K7S A;  4CO7 A;  2ZZP B;  3A9J A;  4K7W A;  1HE8 A;  1Z5S B;  2NCN A;  2IO0 B;  4FJV B;  4LDT D;  3B08 A;  3TCA A;  2C9W B;  1OEY J;  1WXA A;  4KZ0 A;  1P9D U;  4MM3 A;  4LCD E;  4WJP A;  3UQB A;  1C1Y B;  1IPG A;  2IYD B;  5J18 A;  4AUQ C;  3OJ4 B;  1D3Z A;  4YL8 A;  2KC2 A;  1V80 A;  2MBQ A;  3ECI A;  2KTR B;  2KDF B;  1UBI A;  1Q0W B;  1L7Y A;  3ZDT A;  1XD3 B;  5JHB A;  2O6V A;  1OGW A;  1WZ0 A;  5JHA A;  1WR6 E;  2GBK A;  2LGY A;  4FA6 A;  3PVL A;  2CHZ A;  4FJZ A;  2M1M A;  1S1Q B;  4ANU A;  5L95 C;  1EO6 A;  1K8R B;  1Z2M A;  2KXJ A;  2N9X A;  4FAD A;  3CF6 E;  1GNU A;  3ZW3 A;  5D94 A;  4EZL A;  1WRD B;  2FAZ A;  2KX3 A;  2J0M A;  3QK0 A;  1WJ4 A;  4JQW C;  3PZD A;  4OVV A;  1V49 A;  3EC8 A;  4I6L B;  4GDK A;  1V6E A;  3VH4 B;  3ZNG C;  2ZJD A;  1V86 A;  2IZV B;  3EFU A;  3N3K B;  1WJU A;  3ENE A;  2AYO B;  2ZCC A;  2N1W A;  1Q1O A;  3KH0 A;  4FUL A;  4ICV A;  4RMA A;  2L8J A;  3U30 A;  4MJS A;  1H4R A;  4AP4 C;  4KDL B;  5DCN A;  4CYE A;  1SGH A;  3HHM A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...