2NS5A

The conserved n-terminal domain of par-3 adopts a novel pb1-like structure required for par-3 oligomerization and apical membrane localization
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
b'SEFKVTVCFGRTRVDVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning-defective 3 homolog
publication title The Par-3 NTD adopts a PB1-like structure required for Par-3 oligomerization and membrane localization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ns5A00
2XK5A 2RD0A 2RR9A 4KIKA 2K25A 1ZKHA 2NPTB 4BBNF 4KDIC 4FULA 4NNJB 1V6EA 3C0RB 2GOWA 5CTRC 3DVGY 4EUTA 2YLMA 1KOTA 3H1UA 3M3JA 3OAWA 1A5RA 3L0WB 3WAOA 2KFJA 3X0WA 2KHWB 2IO2B 4A3OA 1P0RA 2IO1B 4G3XB 2L05A 3A33B 3W1SA 2ZCBA 1V5OA 2XEWA 5C23A 1WZ3A 2KLGA 2L0TA 3VUXA 2MLBA 4MGKE 3CF6E 2ZPYA 4DHZE 1I35A 3PPAA 3L54A 3PHXB 2JZZA 3U30A 2JWZA 1J0GA 4M8NA 2L00B 2K8CA 3U7DA 1RFAA 3KYCD 2JRIB 4TQ1A 1WE7A 5J17A 1WGRA 1WM3A 2BKRB 2L0FA 2Z59B 4RM9A 3MTNB 2C7MB 1EF1A 1OQYA 1WXVA 2DZJA 2KMAA 2V4LA 3A9KA 3I3TB 4FJYA 4KV2A 2DAJA 3PLVA 2NPTA 3PRPB 4MDKE 1WR1A 4BKSA 1WGYA 4W9JA 2LVOA 3PVLA 4II2B 3A9JB 4IUMB 3APCA 3VTWA 4AJYB 2FUHB 3WA0A 2KX0A 1WJ6A 2R2QA 3M95A 1WIAA 4X57B 1CMXB 4LJOB 3R3MA 1E8ZA 4WAAA 4EFOA 5D2MB 1WYWB 5EDSA 2AL6A 3AU5A 4GDKB 4LJPB 2AEHA 4FLHA 1WX8A 4W9HA 3RULA 4HCNB 5LXIB 2FIFA 4W9IA 3V6EB 3L16A 4JL9A 2WYQA 2HE7A 3QARA 2KXJA 1V2YA 2ZVOA 4LDTB 2M4NA 3L08A 4GB9A 3UINB 4II3B 2ZNVB 4HCPB 3DOWA 3ENEA 4MH0E 2L76A 5DCNA 3DCGA 2IY0B 4FA6A 3UGBB 1E8YA 1YX5B 2LWPA 2DAFA 2KQSA 4TKNA 3HHMA 2D10A 1WGDA 3N3KB 1NBFC 2RPQA 3ZDMC 4G0NB 3RUIB 2HTHA 1F9JA 4IWPA 3X23A 3PHWB 3QC8B 1LXDA 3ZNID 3ZKJC 4IM0A 1WMHB 2KD0A 2WDTB 3PSEB 3Q3JA 4KSLC 2GBJA 4WJNA 1H8CA 1WXSA 4GDKA 2BWFA 4JGHB 2FIDA 2MA9B 2REXA 4NY0A 1J19A 1Z5SB 1LM8B 3A1QA 4LCDE 2K8HA 2N1VA 1P1AA 2I1KA 1YX6B 2LVQA 3ZUNA 4GDLA 4FN2A 1Q5WB 2MBBB 5AEKB 5C1ZA 3BY4B 3JSVB 2CHWA 3KYDD 3R7RA 2EMTA 2N4FA 3CSTA 3GOEA 2LRWA 3KUZA 4EKUA 2BF8B 3NHEB 4IM2A 1V5TA 2IO0B 4EZKA 2I1JA 2Z0DB 3H6NA 2DZKA 3RT3B 2FCMA 3RZFA 2C7HA 4G11A 4K81A 4A3PA 1R4MI 2KC2A 2QHOA 5D94A 3TBLD 2L8JA 3MJWA 3DBSA 3ML8A 5HKHA 2WWZA 2D2QA 2DHZA 4WWNA 4F1SA 3JW0X 1S3SG 4HJKA 5J2RA 3CSFA 4YL8A 2O6VB 2KTRB 4MSMB 2MX2A 4K1RB 3AU4A 3B0AA 4W9KA 3ZTDA 2N1WA 2J0KA 2LJ5A 2Y5BB 1UH6A 4DHJB 2HJ8A 5E6PA 4PS8A 3VFKA 4HVBA 1ZW7A 5DPSA 4HLEA 1WM2A 4EEWA 3QIJA 2NBWB 2KFKA 4NPNA 4W9LA 2HD5B 1RAXA 1UGMA 3PTFC 2JY6A 4PYZA 4KVGB 2O2VB 3JSVA 3LDZE 2O6VD 4A20A 3P2BA 2GBMA 4JQWC 2J7QB 3ZLZA 1SE9A 1UELA 2NBUA 3Q3FA 1NI2A 3H9DA 5D6JB 4AOFA 3DQVA 4G50A 4MEMA 4DHJD 3B1LX 4BVUC 3PS6A 4I6NB 2C60A 3HK0A 2LUEA 4DHZB 1P98A 3SDLC 3W1SC 2KN5A 2KWCA 2K39A 1V81A 3N32A 4MJSB 1XQQA 3UIOB 4K7WA 3ZDTA 3TMPB 1EF5A 1YD8U 1M94A 2LXCA 2OOBB 3UQAA 4CHKA 2DYMA 3PV1A 3VUWA 3IG3A 4XC2A 1WX7A 1SGHA 2MBQA 4DDGD 1OEYJ 4FADA 1WF9A 2BGFA 2CR5A 4DDID 2N7DA 4BKGA 2N7EA 3DPDA 4BKSD 3VVWB 2KO3A 4W9FA 3RCZA 5IA7A 2FNJB 3NZSA 4BKTA 4P7IA 3A4SC 3VAWA 4GMVA 4ICVA 4KSKC 2CHZA 3ML9A 1UBIA 1WR6E 2LGYA 4ZRKA 4W9GA 2G3QB 2D3GA 4FHJA 4I6PA 3VH4B 2LGXA 4AUQC 1KLVA 1VCBA 4JIOU 2ASQA 2NCNA 4TV3A 3ZVVA 5CHFA 3AXCA 4M8MA 1JRUA 3UIPB 1TZ1A 2BYVE 3WANA 2L3ZA 2IY1B 2OJRA 2M0XA 4DXAB 1WJNA 2KDIA 2ZVNA 5DPWA 2JUOA 1H4RA 1KM7A 2ZEQA 3K9PB 5E6OA 3VQIA 2DYOA 4TUUA 4DWFA 2UWQA 3BINA 4ANXA 2VRRB 1E7UA 2AYOB 1P9DU 1WJ4A 3CMMB 3KVFB 3VXWA 3H7PB 1TTNA 2K1FA 4WJPA 3A9JA 2KTFA 3QJZA 1D3ZA 4W9EA 3KH0A 1WGHA 3NS8A 3VTVA 1GNUA 1ISNA 1WXMA 2MBEA 1Y8RC 1AARA 1WH3A 1WI0A 2JT4B 3ALBA 3D32A 3KW5B 4EOYA 3DDCB 2ZPNA 4E71A 2C7NB 2KC1A 1MG8A 2JZ3B 4HDOA 4XZ4A 2LXAA 2FCNA 4W9DA 5CHVC 2KANA 5TR5A 5LXHA 4N9F4 1IPGA 4IW0A 2FCQA 4WJOA 4AP4C 4URKA 3QK0A 1G6JA 3VUYA 1T0YA 3RYTA 1V80A 2L7RA 3V62A 1Q0WB 1TBEA 5CHWA 3ZIMA 5JHAA 3N30A 3PRMB 1QZEA 1Q1OA 5FR6A 4E74A 2GBKA 3JYUA 4PYUA 5AZGA 3U8ZA 2BPSA 3ZW3A 2LI5A 4KZCA 5E6NA 2C9WB 3DBRI 3QAQA 5J18A 2DZIA 3EFUA 4ASWC 3T9LA 2XK5B 1E90A 4KIKB 3IBEA 2GBRA 4HPLB 3O65B 1C3TA 2A5UA 2KVRA 2KMCA 2M8SA 2NBVB 4FJVB 3ZNHB 3L10B 4NQLB 2GBNA 3EC8A 1GUAB 2J0MA 1P3QU 3ONSA 1KJTA 1WMHA 4CO7A 2DX5B 4EZLA 4HXDA 2KNBA 5BO4B 4B9KA 1SIFA 3IVFA 2CHXA 3QCAA 4HPMB 1J8CA 2B3AA 4WWOA 1OEYA 4M0WB 3UF8A 3W1YA 1FXTB 4B95A 2J0JA 4MGIE 2NS5A 3TCAA 4CYEA 4ZDVA 3WALA 1YIWA 2EKEC 2MSED 3DVNV 2M1MA 5KHOA 3DVGX 1UBQA 2JXXA 3HM3A 1LFDA 2LRUA 2DYBA 2KKCA 4OVVA 4FJZA 4ZRIA 1UD7A 2IYDB 2FAZA 4MGYE 3V60A 3AULA 3JVZX 4WWPA 4F7ZA 2PJHA 1OTRB 2AWTA 3HIZA 2KLCA 2RSUA 4TQ0A 3L17A 3A9KB 4J6IA 1NDDA 2XBBC 2KQ7A 3VH3B 2PE6B 3NOBA 2DENB 4ANUA 1WGGA 1WE6A 2G4DB 2O6VA 3DVNU 2KTRA 3V61A 2ZJDA 3A4RA 2LD9A 1BT0A 5D7GA 5IAAC 3TL5A 4JLCA 4PS3A 3H7SA 1WRDB 2K6QA 4GU2A 3HM6X 3VDZA 3WIMA 5L95C 1PQSA 4BOSC 1V49A 2KWVB 3NZUA 4MSQB 1OGWA 2V1YA 3R66C 2D07B 2N9XA 4GOCA 2PPHA 2GMIC 3DBHI 3PZDA 3QQ8B 2D11A 4MELA 2KK8A 3MHSD 1UZXB 2CS4A 2O2VA 1U4AA 4DBGA 1IYFA 4FHKA 2JVCA 4IWOA 4NAWB 1WFYA 2Z0EB 3IFWB 4IWQA 2BYEA 3KUDB 4RMAA 4IG7B 3PRZA 4GN1A 2FCSA 1E8XA 4IM3A 4E3CA 1VD2A 1WX9A 3QX1A 2KJHB 3T8MA 3S2AA 4GIVA 3NY5A 1WY8A 3PGEA 1GC6A 3SU8X 4B6WA 1WXAA 1GJZA 2MQJA 2BKFA 2KZRA 2MBHA 2RGFA 4MJSA 3WAMA 2BWES 2V3SA 3IHPC 4ZRJA 2JPHA 3EHVA 4K7UA 2UYZB 4XX5A 3VTUA 4ANVA 3GZNI 4KZ0A 2MCNB 3L13A 2W9NA 3QA8A 2A4ZA 3A1QB 5G55A 4AJWA 2IO3B 4BFRA 2C5LC 4I6LB 2MP2B 5JH5C 2LVPA 3RZWC 3SD5A 4GDLB 4W9CA 3ZRFA 1C1YB 1TGZB 4IC7B 2PEAA 3QHTA 3APFA 2KJRA 1S1QB 4NAWA 3ZNZB 2IZVB 2KOXA 1HE8A 3M62B 3ZO5B 1R4NI 4ZYNA 1LQBA 2WX1A 1GC7A 4NJ6A 2BYFA 1E5WA 2NVUI 4HDQA 3UQBA 5DPRA 5JHBA 3WAPA 5GMVA 1RRBA 1V9JA 2JF5A 4ANWA 1L7YA 4DK5A 4LDTD 1I42A 4ICUA 3R7QA 1EO6A 1E8WA 5KHQA 2KWUB 1YQBA 4WJQA 4NQKE 1K8RB 2DZMA 3PREA 4FBJB 4AWJA 1RLFA 2WX0A 5LLIA 3APDA 2ZNVC 4HK2A 3QWZB 2R2OA 2PE9A 2NR2A 3AI5A 3M63B 2LZ6A 2K8BA 2G4SA 2KFKB 2MP2A 3ECIA 3H7PA 3LJ3A 2KX3A 3TJPA 4BBNC 4BOZB 3EECA 5AZFA 3ZNGC 1V86A 4MGZE 3RD2A 1E7VA 1XT9B 2AL3A 2MRPA 3OJ3A 4HWIB 2M17A 4K7SA 1YJ1A 2N9PC 4GGQA 5AZHA 2JRHA 2CU1A 3ZRCA 5L83A 2G45B 2MBOA 2KDFB 2LASA 2ZCCA 2IBIB 2KDEB 3DBLI 3B08A 1Z2MA 3PT2B 2LGDA 3TIXA 2N9EB 3VHTC 3V6CB 3ZTCA 1IP9A 4GXBA 1ZGUB 3KUCB 2KDBA 4KDLB 2MWSB 5DPTA 2K6DB 4GSWA 3OLMD 1GG3A 5CX3A 2EMSA 2ZZPB 4F8CB 4EZJA 1WZ0A 4PS7A 4NJ7A 1WJUA 3OJ4B 1L2NA 2YVCA 3PLUA 4WQOB 4RM8A 4MM3A 1EUVB 1XD3B 4OVUA 5JZEB 3SHQA 1X1MA 3K9OB 2KJ6A 2MW5A 2CKHB 5G2NA
chains in the Genus database with same CATH superfamily
4KIKA 1D5XC 3NRZA 4KDIC 1CZPA 1V6EA 5EE9A 3NJTA 3H1UA 3OAWA 3R2TA 3Q8BA 3X0WA 2KHWB 3AN1A 2L05A 2L1AA 2ZCBA 2XEWA 5IKCM 4M0WA 1WZ3A 3VUXA 1FD6A 3SFDB 3CF6E 2ZPYA 5IP4D 1K52A 4M8NA 1WGKA 2G9HD 2JRIB 2W55A 5J17A 3N9YC 1XCTL 2C7MB 1N61A 1WXVA 3I3TB 3FKYA 2BT6A 3A9KA 5HG2A 4MDKE 4W9JA 4RF1A 2LVOA 4II2B 3APCA 3WA0A 2KX0A 1WJ6A 2FUG1 2R2QA 4J3OD 4EFOA 4LJPB 4W9HA 3RULA 3T3OA 4A8XC 2JQRB 4W9IA 1R7SA 3L16A 1N5XA 1YQ3B 2ZNVB 2WQYB 2WU2B 4TMAB 3UGBB 1C76A 1YX5B 3KLSX 4C80A 1SF0A 2KQSA 2D10A 3NUHB 3PHWB 1I4PA 5E6JA 1H8CA 4WJNA 1Y56A 1WXSA 2NMQA 4LNNA 4NY0A 3B2GA 3A1QA 3ZJUA 1IUEA 4LK0M 2N1VA 2CJNA 3HVDA 4GDLA 4FN2A 3TSSA 4Q2JA 1E7PB 3VR9B 2CHWA 2WU5B 2LRWA 4EKUA 4O1NA 1N63A 3ZXRA 1C4CA 2IJ0A 4YT0B 2FCMA 1UWXA 3LXFA 4RGOS 2C7HA 4A3PA 2KC2A 2L8JA 3GE8C 3MJWA 4P1CC 2WWZA 2D2QA 4WWNA 2BB6A 3KWVA 3AEAB 3VR8B 2PTLA 3OWEB 4MSMB 1MHHE 4LNFA 4WURA 4PS8A 4HVBA 4HLEA 4YTNB 2O2VB 3JSVA 2O6VD 5G5HA 3ZJTA 4JQWC 4ZYSA 1ACCA 5G5GA 3P1MA 4DHJD 2C60A 1P98A 3W1SC 2KN5A 5IOIA 1V81A 3ZDTA 4K3CA 3W2DA 1YD8U 5BYSA 1WXQA 2OOBB 3L4PA 3P4QB 2KWDA 2DYMA 4H2AA 2QIEB 1WX7A 2MBQA 2BQQA 4YSYB 1C77A 2CR5A 2N7DA 3DPDA 4PK1A 5IA7A 1FNWA 2FNJB 3NZSA 3VAWA 1N6ZA 4GMVA 1QLBB 4KSKC 1HA5A 1UWMA 1WR6E 2LGYA 1K51A 4N58A 4YXDB 1QOFA 4C4VB 3DBHB 4AUQC 1YNTE 2INNE 3AXCA 1JRUA 4NAMA 2L52A 1TZ1A 2BYVE 4DXAB 1MI0A 3EGRA 2UWQA 2OEDA 3BINA 1KH0A 1P9DU 4W9EA 3NS8A 3GZNB 2MBEA 1Y8RC 1WI0A 2JT4B 3ALBA 2V3NA 3D32A 3N1XC 1C4AA 2D3CA 1XXGA 5TR5A 5LXHA 4IW0A 1ZPSA 4AP4C 1DOIA 3QK0A 2N7JA 3VUYA 3P4RB 1V80A 3TUOA 1TS2A 4RGMA 1L0VB 3Q69A 3RNAC 1TS3A 4PYUA 3U8ZA 1P7EA 2BPSA 4KZCA 3RNBC 4S17A 5C3JB 2N9LA 1NENB 3T9LA 1E90A 1MG4A 3O65B 2A5UA 2KVRA 2M8SA 3ZNHB 1E6EB 4NQLB 5JXVA 3C19A 4EZLA 1D5MC 4B9KA 3QCAA 3AE4B 4HPMB 5C2TB 2B3AA 1OEYA 2OJWA 1ESFA 1FXTB 4MGIE 3TCAA 4CYEA 1T0SC 3HM3A 1D6EC 3DBLB 4DXGA 2PMVA 4MGYE 3MC8A 3AULA 4LNKA 1OTRB 2AWTA 2QSDA 2CJOA 3L17A 2XBBC 2KQ7A 3IAS1 3NOBA 2DENB 4C7YA 2ZJDA 1BT0A 5IAAC 2K6QA 1C79A 4GU2A 2WDRB 3HM6X 3VDZA 4P16A 3N1YC 3W9CB 4MSQB 2D07B 4GOCA 2PPHA 4MELA 2O2VA 2JVCA 1FCCC 3IT6B 2Z0EB 4IWQA 1SEBD 3Q3NC 4RMAA 1TYGB 4GN1A 1WX9A 2KJHB 3NY5A 1WY8A 1WXAA 1GJZA 2BKFA 2RGFA 2BWES 2V3SA 3J9CA 2DBYA 1RFKA 1FFUA 4ZRJA 4EE2A 1IGDA 1T0QC 2UYZB 4KZ0A 2MCNB 2W9NA 1TY2A 2G1EA 2IO3B 3SD5A 3ZRFA 3I5JC 2XN9C 5EE1A 5I4DA 2KJRA 3M62B 3ZO5B 1R4NI 4ZYNA 2WX1A 1YN4A 1RRBA 3FILB 2JF5A 1L7YA 1I42A 2QMTA 3R7QA 2PLPA 3DWGC 4WJQA 4OW0A 3EUB2 3PREA 1QF6A 5LLIA 4HK2A 3ETRA 2QCZA 2PE9A 2NR2A 1SE2A 4BOZB 3RN9C 2J52A 3TEZA 1XCQL 3ZNGC 3RD2A 3HRDD 4ACFA 2AL3A 3OJ3A 1YJ1A 1V8CA 3ZRCA 2MBOA 2KDFB 2V4IB 1Z2MA 2ZW1A 3TIXA 2LGDA 2M0AA 1ZGUB 2KDBA 2K6DB 2QEJC 5CX3A 4F8CB 2ZZPB 1L2NA 1PYWD 1GB1A 4RM8A 4KKIA 1OQQA 2W54A 3Q6BA 1X1MA 5G2NA 3KQ4A 3P63A 4FULA 5CTRC 1KOTA 1A5RA 3FAHA 3WAOA 3E9SA 2KFJA 4A3OA 1P0RA 4P6VF 3W1SA 1TKGA 3BYYB 1VJKA 3L54A 3PPAA 2JZZA 2JWZA 1RFAA 1I4QA 1WGRA 2L0FA 3AE9B 1TS4A 2ZW0A 1EF1A 2V4LA 2Q5WD 4KV2A 2DAJA 3PLVA 3PRPB 2JYEA 4C00A 2WXJA 3A9JB 4IUMB 2FUHB 2D5GA 1WIAA 3AU5A 1FNUA 1B1ZA 1WX8A 4HCNB 2GB1A 1I4RA 1L4ZB 1I4GA 4GB9A 4MH0E 3DOWA 3RNFC 3DCGA 1K53A 4TKNA 3HHMA 2I38A 3N3KB 2ICIA 2WXKA 2WNMA 1FO4A 2KT7A 1F9JA 4S0RA 3AEDB 3QC8B 1SXTA 3ZKJC 1WMHB 2KD0A 2X8XX 4GDKA 2BWFA 3AM9A 1Z5SB 3ZUNA 4RGTA 4XE0A 1Q5WB 5AEKB 3JSVB 2UU7A 3CSTA 3GOEA 2K22A 3P42A 2BF8B 3NHEB 1V5TA 4EZKA 2I1JA 2Z0DB 3H6NA 2DZKA 3RZFA 3TBLD 2K0PA 3ML8A 1E9MA 3DBSA 2IDYA 3FILA 2VH2A 4W9KA 2KDMA 4KGRA 3C8YA 2M19A 5E6PA 3VFKA 5DPSA 3Q8EA 3QIJA 4NPNA 5LNK1 2JY6A 1PFDA 3V3XA 3LDZE 1I7HA 1SJED 4C7ZA 3P2BA 2GBMA 3ZLZA 1SE9A 1UELA 3ZJVA 3Q3FA 3H9DA 3PZ8A 4G50A 3URYA 3B1LX 1JWUD 4BVUC 3PS6A 3IT4B 5HHDG 3SDLC 5FKAC 2DNFA 2K39A 3EFCA 1XQQA 4K7WA 4NJCA 3PZ7A 2LXCA 3NVVA 3PV1A 3IG3A 4XC2A 1QT9A 4FADA 1WF9A 2EELA 1ENFA 1HEZE 1XO3A 1YN3A 2WXOA 1UBIA 4ZRKA 1FM0D 2D3GA 5BMGA 1XLPA 2BS4B 5CHFA 3UIPB 3WANA 2IY1B 2OJRA 5DPWA 5E6OA 1F52A 4RNAA 1TKEA 2VRRB 1E7UA 1ZUD2 4XDDA 3VXWA 3AEGB 1TTNA 4MACA 4WJPA 3A9JA 1GNUA 1F2RI 3RNCC 1WXMA 4EOYA 4LNOA 1BXTA 4HDOA 5CHVC 3Q8CA 3NVWA 4RGNA 2FCQA 4WJOA 1TT5B 2L7RA 3V62A 1Q0WB 2WGSA 3ZIMA 5JHAA 2KVZA 3PRMB 1QZEA 1Q1OA 2KACA 2GBKA 1FXIA 3DBRI 5J18A 2DZIA 3EFUA 3Q14C 4ZRQA 1GB4A 2XK5B 3IBEA 4HPPA 2INPE 2NBVB 1SE3A 3L10B 1GUAB 1JQ4A 3ONSA 1IGCA 1KJTA 1WMHA 4CO7A 2VZKB 2KNBA 1SIFA 1YMHE 4AQ7A 2SEBD 1MFWA 3GS2A 5KHOA 3DVGX 1UBQA 4KKJA 4TSSA 2KKCA 4FJZA 1UD7A 1F2RC 2FAZA 3V60A 4WWPA 1HZ6A 3MFGA 2RSUA 1OFFA 4XGAB 5BYQA 1NDDA 3T3NA 2PE6B 1WE6A 3V61A 3LB8C 1L0YB 3AEFB 1E10A 1EU3A 2WXFA 1FEHA 1GAQB 1FNVA 4A90A 1UF0A 3NZUA 2KWVB 3R66C 2N9XA 3PZDA 2D11A 2MJEA 4JX1C 2CS4A 1U4AA 4KGSA 4IWOA 1CJEA 1WFYA 5HFYA 3IFWB 3PRZA 4IM3A 4E3CA 1IBXB 4HROA 3QX1A 3RPFC 1GC6A 4M01A 1E0ZA 2MBHA 3IHPC 2EKIA 2JPHA 4XX5A 3VTUA 1RWSA 3AE5B 1I4HA 3GE3C 2AQ3B 1B9RA 1ZXHA 2IGDA 3RZWC 2BYTA 2K9XA 4OZCA 4W9CA 1C1YB 1UGJA 2CU3A 3QHTA 1S1QB 4NAWA 4A55A 4N59A 1CQVA 1HE8A 1LQBA 4NJ6A 1PDXA 3R8BA 2NVUI 3WCQA 3UQBA 3WAPA 3IXSA 1V9JA 2JSVX 3BK1A 4ANWA 4DK5A 1I4XA 1MHXA 1SIJA 2KMMA 3U4EG 4AWJA 1RLFA 3APDA 2WLBA 2WXNA 4WAFA 2R2OA 2JZPA 2KFKB 3TJPA 3EECA 5AZFA 3AH7A 1V86A 1E7VA 1EWCA 1PGAA 2LASA 1CK1A 2ZCCA 4JWUC 2KDEB 3B08A 1N5WA 2N9EB 3KUCB 4KDLB 2MWSB 2WXRA 1QOAA 4EZJA 4PS7A 4NJ7A 4WQMA 2LGSA 2WDVB 2YVCA 4XYCA 1EUVB 4USAA 3NZ3A 2J53A 2X38A 2WXMA 2XK5A 3NVYA 2RD0A 2RR9A 2QILA 4BBNF 1ZKHA 4NNJB 4EUTA 3C0RB 3DVGY 3M3JA 3L0WB 2YEPB 2IGGA 3I9V1 3Q8AA 3TEWA 4LLGM 5D3IB 4RF0A 2L0TA 2MLBA 1M4VA 4DHZE 3ZQ4A 1I35A 2HTME 1FCLA 2R61A 2OHFA 1NEKB 3U30A 2INCC 2L00B 2K8CA 1XLQA 3HVZA 3U7DA 3ABVB 3RFZB 4TQ1A 1WE7A 4IKGA 2N0SB 2KN4A 2Z59B 4RM9A 1OQYA 2W3SA 3W5UB 1C9FA 3TEXA 2NPTA 1WR1A 4BKSA 1WGYA 5FR3A 1L6UA 3VTWA 4X57B 1CMXB 1E8ZA 4WAAA 3SFEB 1TIFA 4GDKB 4FLHA 3AEEB 2IPKD 1SJHD 2FIFA 4HKZE 3V6EB 1NYQA 2WYQA 2HE7A 2KXJA 1V1PA 4JPSA 2ZVOA 1QQRA 4LDTB 2M4NA 1F77A 3ENEA 2H89B 2L76A 1SSNA 1OQRA 2IY0B 4FA6A 1E8YA 2LWPA 1WYGA 2DAFA 1IBXA 1BMLC 1QOGA 1WGDA 3BK2A 1NBFC 5BMHA 3AV8A 3I57A 4G0NB 2JX5A 2HTHA 1YOVB 5MPOA 1EU4A 4JE3B 3X23A 1LXDA 3ZNID 4IM0A 3Q3JA 4KSLC 1ET9A 1C78A 2MA9B 2REXA 1J19A 4US8A 4WH4A 1FFVA 2MBBB 2RDBC 2WXHA 2EMTA 1XEEA 1ZXIA 4ITKA 4IDIA 4IM2A 3RT3B 1KF6B 3AE6B 4HJGE 2BVCA 1MJDA 4G11A 4K81A 5HKHA 1P7FA 4F1SA 3JW0X 1S3SG 4HJKA 2O6VB 3AU4A 3FC4A 2N1WA 2LJ5A 1UH6A 4DHJB 4CQNA 1TZOA 2HJ1A 1WM2A 2NBWB 3BVGA 2KFKA 1RAXA 1UGMA 3PTFC 4PYZA 4KVGB 4L2YA 1LO5D 3R2IA 2MJ3A 2J7QB 2KQ4X 2VZKD 3DQVA 4MEMA 2D3AA 2GRIA 4BZAA 1ET6A 3AE1B 1EWYC 2KYWA 1JCKB 5TSSA 2JXTA 3N32A 4HEA1 3TMPB 1AYFA 3AEBB 3RMKC 1VDVA 3UQAA 4CHKA 1ZDVA 3VUWA 1SGHA 1OEYJ 3EA6A 4M02A 2BGFA 3BWUD 3UI3A 4ZHOA 4BKGA 2N7EA 3TEYA 4BKSD 3VVWB 4W9FA 3RCZA 4C56C 3DHHC 4P7IA 1JMLA 4ICVA 5H8YE 2CHZA 3ML9A 3DHIC 2JU6X 5T8IA 2E6XA 2G3QB 1T0RC 2LGXA 1KLVA 1VCBA 1VRAB 4JIOU 2ASQA 1AW7A 4YSZB 2M0XA 1WJNA 2KDIA 2ZVNA 2GLSA 1ZP0B 4MH8A 1H4RA 1KM7A 3K9PB 3VQIA 2DYOA 4GLSC 3NVZA 4ANXA 2AYOB 2LHDA 1WJ4A 3CMMB 3KVFB 3ZXVA 3PO0A 2Y3AA 4OVZA 2KTFA 2K5PA 3KH0A 1WGHA 2W3RA 5H92C 3W5VB 3DDCB 4E71A 2C7NB 2YEPF 2JZ3B 4XZ4A 2LXAA 2FCNA 4W9DA 4N9F4 1IPGA 4YTMB 2D3BA 4URKA 3ZGZA 4WWMA 3MP9A 1T0YA 1ZDXA 1K50A 1HXYD 1TBEA 1PUTA 3N30A 2AQ1B 5IN7A 1R4NB 5AZGA 3ZW3A 4MM3B 2C9WB 2WP9B 3QAQA 5AUKA 4N6EB 1SB3C 1LGRA 1C3TA 5BMIA 2GBNA 3EC8A 2J0MA 1P3QU 2RDHA 1T3QA 3AB5A 1YJIA 5BO4B 1J8CA 2CHXA 3W1YA 2KAJA 2J0JA 2NS5A 4ZDVA 3DHGC 2K3UA 3WALA 2EKEC 3DVNV 3Q8FA 4XWWA 2M1MA 2M56B 2BBCA 5FK9C 1LFDA 2E3TA 2DYBA 4OVVA 1D4BA 2IYDB 4F7ZA 3JVZX 2PJHA 2KLCA 2GI9A 2BS3B 1JWMD 3Q3MC 4MT5A 4ANUA 2G4DB 4WIPA 2O6VA 3TL5A 4PS3A 3H7SA 2RPVA 1HQRD 2WS3B 3N1ZC 2WXIA 1XF5L 3WIMA 5L95C 1PQSA 1BUIC 3IAM1 1OGWA 4ARCA 2GMIC 2NTSA 3DBHI 1UZXB 4ARIA 1T5XD 4NAWB 4B0MA 2BYEA 3KUDB 4IG7B 2MEKA 5HI1A 2FCSA 1MVKA 3U7ZA 3T8MA 3AE2B 3SU8X 1A70A 2QJLA 1TJEA 3WAMA 1FPYA 4K7UA 1NI3A 1KFYB 3P4PB 4ANVA 3GZNI 4DXFA 1KLUD 1WSPA 3CWIA 3QA8A 2A4ZA 5G55A 4AJWA 2C5LC 1UUPA 1MPEA 4IC7B 1TGZB 2PEAA 2V0GA 1XLOA 3E56A 2KOXA 4YSXB 4RFBA 5IO9A 1ZOYB 1ZE3D 2BYFA 1E5WA 5DPRA 5JHBA 3BZDB 4FXCA 2V9HA 4LDTD 4ICUA 1T6BX 1EO6A 1E8WA 1GPXA 2LGIA 3AE7B 4NQKE 2HDEA 3MC0B 1K8RB 2DZMA 4FBJB 2WX0A 3B2FA 3KWLA 3QWZB 2LZ6A 2K8BA 2G4SA 2MP2A 3ECIA 3LJ3A 1XT9B 3AE8B 4K7SA 4HWIB 5AZHA 2M17A 4GGQA 2JRHA 5L83A 1NYRA 2ONQA 2L83A 3DBLI 4ZHPA 3PT2B 2LFIA 2LEKA 2ACZB 2DLBA 4PT5A 4GSWA 1WZ0A 1WJUA 3U2SC 3PLUA 4MM3A 1RYJA 4OVUA 2WDQB 5JZEB 3SHQA 3K9OB 1KRHA 2KJ6A 2MW5A 3DVNU 2CKHB 3RNGC 2K25A 2NPTB 2GOWA 2YLMA 2MH7A 2IO2B 2NTTA 2IO1B 4G3XB 2LUMA 3A33B 1V5OA 5C23A 3MJ5A 1J7BA 2KLGA 4NZLB 4MGKE 1VR9A 4HKQA 3PHXB 1V1PB 1J0GA 3KYCD 1Q10A 4LNIA 4JWSC 1WM3A 2BKRB 3MTNB 2KMAA 2DZJA 4FJYA 2V3PA 2BTEA 3PVLA 4AJYB 1JALA 4XWTA 3M95A 4RH6A 4LJOB 3R3MA 1TKYA 5D2MB 4US9A 1WYWB 5EDSA 2AL6A 2AEHA 4ZRPA 2B76B 5LXIB 2I2YA 4JL9A 3QARA 1V2YA 3BIID 3L08A 3UINB 4II3B 4HCPB 3RI7C 1D5ZC 2QC8A 5DCNA 2FBWB 4L1BA 3N20C 1KLGD 1XLNA 4UDUC 2RPQA 3ZDMC 4XDCA 3RUIB 1VZ8A 4IWPA 1F1HA 1QKZA 2J42A 5GXGB 3PSEB 2WDTB 2GBJA 4JGHB 2FIDA 1UNSA 1LM8B 1F0ZA 4LCDE 1JW9D 2K8HA 3HUIA 1P1AA 2I1KA 4K3BA 1YX6B 2LVQA 4KX6B 5C1ZA 3BY4B 3KYDD 3R7RA 2N4FA 5BYRA 3KUZA 1V1OA 4KGTA 3LYYA 2IO0B 5EE0A 1HTQA 2J4XA 2PKOA 1WRIA 1R4MI 2QHOA 5D94A 4D2KA 2DHZA 2DWQA 5J2RA 3CSFA 4YL8A 3DBRB 2KTRB 2MX2A 4K1RB 3B0AA 3ZTDA 2J0KA 2Y5BB 4YTPB 2HJ8A 1ZW7A 3H8HA 4EEWA 4A9AA 4W9LA 2HD5B 3VRAB 4A20A 3BYTB 2NBUA 1DGJA 1NI2A 5D6JB 4AOFA 3AE3B 4A6QA 1SE4A 4I6NB 3HK0A 2LUEA 2PVOD 4DHZB 2KWCA 1DOYA 4ZOHC 1J7CA 4MJSB 1L4DB 1PGBA 4REZA 1AWDA 3UIOB 3ZYYX 1EF5A 3B9JA 1M94A 4B0EA 1DOXA 4DDGD 2LMCA 3BVZA 1PGXA 2BB5A 4DDID 1VZ7A 2KO3A 4BKTA 3A4SC 3GB1A 1AN8A 3NG0A 4W9GA 4FHJA 4I6PA 3VH4B 1JRPA 1NVID 2NCNA 3ZVVA 4TV3A 4M8MA 2BW2A 2L3ZA 2JUOA 2BS2B 2ZEQA 4TUUA 4M00A 2LJIA 4DWFA 1FIQA 3BVMA 2PW9A 1SBBB 5AUIA 1HZ5A 1JWBD 1KTKA 2ON8A 3H7PB 2K1FA 4AS1A 3QJZA 1D3ZA 3VTVA 1ISNA 3KW5B 1AARA 1WH3A 1JROA 2WXGA 2ZPNA 4OHJA 2KC1A 1MG8A 3OG5A 2KANA 1JWSD 3VRBB 4C4VA 1G6JA 3RYTA 5CHWA 2WXQA 4IOIE 5EE3A 1YJJA 5FR6A 4E74A 3MC9A 3JYUA 2LI5A 5E6NA 2FE8A 4OZAA 2W82A 4ASWC 5D3DA 1JWAD 4KIKB 2GBRA 4HPLB 3AMZA 2LHEA 2KMCA 4FJVB 1TS5A 2JYTA 2SAKA 2DX5B 4BAXA 4HXDA 3NS1A 3U52E 3IVFA 4WWOA 2RDGA 4R3DA 4M0WB 3UF8A 4B95A 3SR6A 1FXAA 1FRRA 1ROEA 3AECB 1YIWA 2MSED 3MHZA 1RM6C 2JXXA 2LRUA 4ZRIA 1QOBA 1R4MB 3HIZA 2RMMA 4TQ0A 2WHIA 3A9KB 4J6IA 4QAYA 3VH3B 2TSSA 1WGGA 2KTRA 5D7GA 3A4RA 2LD9A 4JLCA 1WRDB 3P4SB 2MHJA 4BOSC 1V49A 1FMAD 1L0XB 2V1YA 1FRDA 3QQ8B 2KK8A 3MHSD 1IYFA 1WWTA 2QDFA 4FHKA 1VLBA 1YN5A 2PIAA 1EM7A 1E8XA 2Y5PA 3Q3OC 1VD2A 2H88B 2PVGC 2JWUA 3S2AA 4GIVA 2INDC 3RNEC 3PGEA 4B6WA 3I63C 2MQJA 2KZRA 4MJSA 3EHVA 1QILA 4HRSA 2WXLA 3L13A 3A1QB 4L23A 4BFRA 4I6LB 5JH5C 2MP2B 2LVPA 3O13A 4GDLB 2Z8LA 3Q2AC 1HTOA 2XNAC 3APFA 2Y5CA 3ZNZB 4YWGG 2IZVB 1VZ6A 1N62A 1GC7A 1C4PA 4RCOA 4LTUA 2AX5A 4HDQA 1STEA 5GMVA 1J7AA 2IGHA 3DWMA 5KHQA 2KWUB 1YQBA 1YQ4B 2VH1A 3GP7A 3V05A 2ZNVC 1L6VA 2MJDA 3AI5A 3M63B 3H7PA 2KX3A 4BBNC 4P1BC 1V97A 1L5PA 4MGZE 2MRPA 2L32A 2N9PC 2CU1A 2G45B 3CIRB 2WXPA 2IBIB 1DYQA 1GOZA 2AQ2B 3VHTC 3V6CB 3ZTCA 1IP9A 4GXBA 5DPTA 3OLMD 1GG3A 2EMSA 3OJ4B 4DQOC 2N9KA 4WQOB 1TY0A 1XD3B 4OZBA 3SEBA 1N60A 4DBGA
chains in the Genus database with same CATH topology
2XK5A 2RD0A 2RR9A 4KIKA 2K25A 1ZKHA 2NPTB 4BBNF 4KDIC 4FULA 4NNJB 1V6EA 3C0RB 2GOWA 5CTRC 3DVGY 4EUTA 2YLMA 1KOTA 3H1UA 3M3JA 3OAWA 1A5RA 3L0WB 3WAOA 2KFJA 3X0WA 2KHWB 2IO2B 4A3OA 1P0RA 2IO1B 4G3XB 2L05A 3A33B 3W1SA 2ZCBA 1V5OA 2XEWA 5C23A 1WZ3A 2KLGA 2L0TA 3VUXA 2MLBA 4MGKE 3CF6E 2ZPYA 4DHZE 1I35A 3PPAA 3L54A 3PHXB 2JZZA 3U30A 2JWZA 1J0GA 4M8NA 2L00B 2K8CA 3U7DA 1RFAA 3KYCD 2JRIB 4TQ1A 1WE7A 5J17A 1WGRA 1WM3A 2BKRB 2L0FA 2Z59B 4RM9A 3MTNB 2C7MB 1EF1A 1OQYA 1WXVA 2DZJA 2KMAA 2V4LA 3A9KA 3I3TB 4FJYA 4KV2A 2DAJA 3PLVA 2NPTA 3PRPB 4MDKE 1WR1A 4BKSA 1WGYA 4W9JA 2LVOA 3PVLA 4II2B 3A9JB 4IUMB 3APCA 3VTWA 4AJYB 2FUHB 3WA0A 2KX0A 1WJ6A 2R2QA 3M95A 1WIAA 4X57B 1CMXB 4LJOB 3R3MA 1E8ZA 4WAAA 4EFOA 5D2MB 1WYWB 5EDSA 2AL6A 3AU5A 4GDKB 4LJPB 2AEHA 4FLHA 1WX8A 4W9HA 3RULA 4HCNB 5LXIB 2FIFA 4W9IA 3V6EB 3L16A 4JL9A 2WYQA 2HE7A 3QARA 2KXJA 1V2YA 2ZVOA 4LDTB 2M4NA 3L08A 4GB9A 3UINB 4II3B 2ZNVB 4HCPB 3DOWA 3ENEA 4MH0E 2L76A 5DCNA 3DCGA 2IY0B 4FA6A 3UGBB 1E8YA 1YX5B 2LWPA 2DAFA 2KQSA 4TKNA 3HHMA 2D10A 1WGDA 3N3KB 1NBFC 2RPQA 3ZDMC 4G0NB 3RUIB 2HTHA 1F9JA 4IWPA 3X23A 3PHWB 3QC8B 1LXDA 3ZNID 3ZKJC 4IM0A 1WMHB 2KD0A 2WDTB 3PSEB 3Q3JA 4KSLC 2GBJA 4WJNA 1H8CA 1WXSA 4GDKA 2BWFA 4JGHB 2FIDA 2MA9B 2REXA 4NY0A 1J19A 1Z5SB 1LM8B 3A1QA 4LCDE 2K8HA 2N1VA 1P1AA 2I1KA 1YX6B 2LVQA 3ZUNA 4GDLA 4FN2A 1Q5WB 2MBBB 5AEKB 5C1ZA 3BY4B 3JSVB 2CHWA 3KYDD 3R7RA 2EMTA 2N4FA 3CSTA 3GOEA 2LRWA 3KUZA 4EKUA 2BF8B 3NHEB 4IM2A 1V5TA 2IO0B 4EZKA 2I1JA 2Z0DB 3H6NA 2DZKA 3RT3B 2FCMA 3RZFA 2C7HA 4G11A 4K81A 4A3PA 1R4MI 2KC2A 2QHOA 5D94A 3TBLD 2L8JA 3MJWA 3DBSA 3ML8A 5HKHA 2WWZA 2D2QA 2DHZA 4WWNA 4F1SA 3JW0X 1S3SG 4HJKA 5J2RA 3CSFA 4YL8A 2O6VB 2KTRB 4MSMB 2MX2A 4K1RB 3AU4A 3B0AA 4W9KA 3ZTDA 2N1WA 2J0KA 2LJ5A 2Y5BB 1UH6A 4DHJB 2HJ8A 5E6PA 4PS8A 3VFKA 4HVBA 1ZW7A 5DPSA 4HLEA 1WM2A 4EEWA 3QIJA 2NBWB 2KFKA 4NPNA 4W9LA 2HD5B 1RAXA 1UGMA 3PTFC 2JY6A 4PYZA 4KVGB 2O2VB 3JSVA 3LDZE 2O6VD 4A20A 3P2BA 2GBMA 4JQWC 2J7QB 3ZLZA 1SE9A 1UELA 2NBUA 3Q3FA 1NI2A 3H9DA 5D6JB 4AOFA 3DQVA 4G50A 4MEMA 4DHJD 3B1LX 4BVUC 3PS6A 4I6NB 2C60A 3HK0A 2LUEA 4DHZB 1P98A 3SDLC 3W1SC 2KN5A 2KWCA 2K39A 1V81A 3N32A 4MJSB 1XQQA 3UIOB 4K7WA 3ZDTA 3TMPB 1EF5A 1YD8U 1M94A 2LXCA 2OOBB 3UQAA 4CHKA 2DYMA 3PV1A 3VUWA 3IG3A 4XC2A 1WX7A 1SGHA 2MBQA 4DDGD 1OEYJ 4FADA 1WF9A 2BGFA 2CR5A 4DDID 2N7DA 4BKGA 2N7EA 3DPDA 4BKSD 3VVWB 2KO3A 4W9FA 3RCZA 5IA7A 2FNJB 3NZSA 4BKTA 4P7IA 3A4SC 3VAWA 4GMVA 4ICVA 4KSKC 2CHZA 3ML9A 1UBIA 1WR6E 2LGYA 4ZRKA 4W9GA 2G3QB 2D3GA 4FHJA 4I6PA 3VH4B 2LGXA 4AUQC 1KLVA 1VCBA 4JIOU 2ASQA 2NCNA 4TV3A 3ZVVA 5CHFA 3AXCA 4M8MA 1JRUA 3UIPB 1TZ1A 2BYVE 3WANA 2L3ZA 2IY1B 2OJRA 2M0XA 4DXAB 1WJNA 2KDIA 2ZVNA 5DPWA 2JUOA 1H4RA 1KM7A 2ZEQA 3K9PB 5E6OA 3VQIA 2DYOA 4TUUA 4DWFA 2UWQA 3BINA 4ANXA 2VRRB 1E7UA 2AYOB 1P9DU 1WJ4A 3CMMB 3KVFB 3VXWA 3H7PB 1TTNA 2K1FA 4WJPA 3A9JA 2KTFA 3QJZA 1D3ZA 4W9EA 3KH0A 1WGHA 3NS8A 3VTVA 1GNUA 1ISNA 1WXMA 2MBEA 1Y8RC 1AARA 1WH3A 1WI0A 2JT4B 3ALBA 3D32A 3KW5B 4EOYA 3DDCB 2ZPNA 4E71A 2C7NB 2KC1A 1MG8A 2JZ3B 4HDOA 4XZ4A 2LXAA 2FCNA 4W9DA 5CHVC 2KANA 5TR5A 5LXHA 4N9F4 1IPGA 4IW0A 2FCQA 4WJOA 4AP4C 4URKA 3QK0A 1G6JA 3VUYA 1T0YA 3RYTA 1V80A 2L7RA 3V62A 1Q0WB 1TBEA 5CHWA 3ZIMA 5JHAA 3N30A 3PRMB 1QZEA 1Q1OA 5FR6A 4E74A 2GBKA 3JYUA 4PYUA 5AZGA 3U8ZA 2BPSA 3ZW3A 2LI5A 4KZCA 5E6NA 2C9WB 3DBRI 3QAQA 5J18A 2DZIA 3EFUA 4ASWC 3T9LA 2XK5B 1E90A 4KIKB 3IBEA 2GBRA 4HPLB 3O65B 1C3TA 2A5UA 2KVRA 2KMCA 2M8SA 2NBVB 4FJVB 3ZNHB 3L10B 4NQLB 2GBNA 3EC8A 1GUAB 2J0MA 1P3QU 3ONSA 1KJTA 1WMHA 4CO7A 2DX5B 4EZLA 4HXDA 2KNBA 5BO4B 4B9KA 1SIFA 3IVFA 2CHXA 3QCAA 4HPMB 1J8CA 2B3AA 4WWOA 1OEYA 4M0WB 3UF8A 3W1YA 1FXTB 4B95A 2J0JA 4MGIE 2NS5A 3TCAA 4CYEA 4ZDVA 3WALA 1YIWA 2EKEC 2MSED 3DVNV 2M1MA 5KHOA 3DVGX 1UBQA 2JXXA 3HM3A 1LFDA 2LRUA 2DYBA 2KKCA 4OVVA 4FJZA 4ZRIA 1UD7A 2IYDB 2FAZA 4MGYE 3V60A 3AULA 3JVZX 4WWPA 4F7ZA 2PJHA 1OTRB 2AWTA 3HIZA 2KLCA 2RSUA 4TQ0A 3L17A 3A9KB 4J6IA 1NDDA 2XBBC 2KQ7A 3VH3B 2PE6B 3NOBA 2DENB 4ANUA 1WGGA 1WE6A 2G4DB 2O6VA 3DVNU 2KTRA 3V61A 2ZJDA 3A4RA 2LD9A 1BT0A 5D7GA 5IAAC 3TL5A 4JLCA 4PS3A 3H7SA 1WRDB 2K6QA 4GU2A 3HM6X 3VDZA 3WIMA 5L95C 1PQSA 4BOSC 1V49A 2KWVB 3NZUA 4MSQB 1OGWA 2V1YA 3R66C 2D07B 2N9XA 4GOCA 2PPHA 2GMIC 3DBHI 3PZDA 3QQ8B 2D11A 4MELA 2KK8A 3MHSD 1UZXB 2CS4A 2O2VA 1U4AA 4DBGA 1IYFA 4FHKA 2JVCA 4IWOA 4NAWB 1WFYA 2Z0EB 3IFWB 4IWQA 2BYEA 3KUDB 4RMAA 4IG7B 3PRZA 4GN1A 2FCSA 1E8XA 4IM3A 4E3CA 1VD2A 1WX9A 3QX1A 2KJHB 3T8MA 3S2AA 4GIVA 3NY5A 1WY8A 3PGEA 1GC6A 3SU8X 4B6WA 1WXAA 1GJZA 2MQJA 2BKFA 2KZRA 2MBHA 2RGFA 4MJSA 3WAMA 2BWES 2V3SA 3IHPC 4ZRJA 2JPHA 3EHVA 4K7UA 2UYZB 4XX5A 3VTUA 4ANVA 3GZNI 4KZ0A 2MCNB 3L13A 2W9NA 3QA8A 2A4ZA 3A1QB 5G55A 4AJWA 2IO3B 4BFRA 2C5LC 4I6LB 2MP2B 5JH5C 2LVPA 3RZWC 3SD5A 4GDLB 4W9CA 3ZRFA 1C1YB 1TGZB 4IC7B 2PEAA 3QHTA 3APFA 2KJRA 1S1QB 4NAWA 3ZNZB 2IZVB 2KOXA 1HE8A 3M62B 3ZO5B 1R4NI 4ZYNA 1LQBA 2WX1A 1GC7A 4NJ6A 2BYFA 1E5WA 2NVUI 4HDQA 3UQBA 5DPRA 5JHBA 3WAPA 5GMVA 1RRBA 1V9JA 2JF5A 4ANWA 1L7YA 4DK5A 4LDTD 1I42A 4ICUA 3R7QA 1EO6A 1E8WA 5KHQA 2KWUB 1YQBA 4WJQA 4NQKE 1K8RB 2DZMA 3PREA 4FBJB 4AWJA 1RLFA 2WX0A 5LLIA 3APDA 2ZNVC 4HK2A 3QWZB 2R2OA 2PE9A 2NR2A 3AI5A 3M63B 2LZ6A 2K8BA 2G4SA 2KFKB 2MP2A 3ECIA 3H7PA 3LJ3A 2KX3A 3TJPA 4BBNC 4BOZB 3EECA 5AZFA 3ZNGC 1V86A 4MGZE 3RD2A 1E7VA 1XT9B 2AL3A 2MRPA 3OJ3A 4HWIB 2M17A 4K7SA 1YJ1A 2N9PC 4GGQA 5AZHA 2JRHA 2CU1A 3ZRCA 5L83A 2G45B 2MBOA 2KDFB 2LASA 2ZCCA 2IBIB 2KDEB 3DBLI 3B08A 1Z2MA 3PT2B 2LGDA 3TIXA 2N9EB 3VHTC 3V6CB 3ZTCA 1IP9A 4GXBA 1ZGUB 3KUCB 2KDBA 4KDLB 2MWSB 5DPTA 2K6DB 4GSWA 3OLMD 1GG3A 5CX3A 2EMSA 2ZZPB 4F8CB 4EZJA 1WZ0A 4PS7A 4NJ7A 1WJUA 3OJ4B 1L2NA 2YVCA 3PLUA 4WQOB 4RM8A 4MM3A 1EUVB 1XD3B 4OVUA 5JZEB 3SHQA 1X1MA 3K9OB 2KJ6A 2MW5A 2CKHB 5G2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK5 A;  2RD0 A;  2RR9 A;  4KIK A;  2K25 A;  1ZKH A;  2NPT B;  4BBN F;  4KDI C;  4FUL A;  4NNJ B;  1V6E A;  3C0R B;  2GOW A;  5CTR C;  3DVG Y;  4EUT A;  2YLM A;  1KOT A;  3H1U A;  3M3J A;  3OAW A;  1A5R A;  3L0W B;  3WAO A;  2KFJ A;  3X0W A;  2KHW B;  2IO2 B;  4A3O A;  1P0R A;  2IO1 B;  4G3X B;  2L05 A;  3A33 B;  3W1S A;  2ZCB A;  1V5O A;  2XEW A;  5C23 A;  1WZ3 A;  2KLG A;  2L0T A;  3VUX A;  2MLB A;  4MGK E;  3CF6 E;  2ZPY A;  4DHZ E;  1I35 A;  3PPA A;  3L54 A;  3PHX B;  2JZZ A;  3U30 A;  2JWZ A;  1J0G A;  4M8N A;  2L00 B;  2K8C A;  3U7D A;  1RFA A;  3KYC D;  2JRI B;  4TQ1 A;  1WE7 A;  5J17 A;  1WGR A;  1WM3 A;  2BKR B;  2L0F A;  2Z59 B;  4RM9 A;  3MTN B;  2C7M B;  1EF1 A;  1OQY A;  1WXV A;  2DZJ A;  2KMA A;  2V4L A;  3A9K A;  3I3T B;  4FJY A;  4KV2 A;  2DAJ A;  3PLV A;  2NPT A;  3PRP B;  4MDK E;  1WR1 A;  4BKS A;  1WGY A;  4W9J A;  2LVO A;  3PVL A;  4II2 B;  3A9J B;  4IUM B;  3APC A;  3VTW A;  4AJY B;  2FUH B;  3WA0 A;  2KX0 A;  1WJ6 A;  2R2Q A;  3M95 A;  1WIA A;  4X57 B;  1CMX B;  4LJO B;  3R3M A;  1E8Z A;  4WAA A;  4EFO A;  5D2M B;  1WYW B;  5EDS A;  2AL6 A;  3AU5 A;  4GDK B;  4LJP B;  2AEH A;  4FLH A;  1WX8 A;  4W9H A;  3RUL A;  4HCN B;  5LXI B;  2FIF A;  4W9I A;  3V6E B;  3L16 A;  4JL9 A;  2WYQ A;  2HE7 A;  3QAR A;  2KXJ A;  1V2Y A;  2ZVO A;  4LDT B;  2M4N A;  3L08 A;  4GB9 A;  3UIN B;  4II3 B;  2ZNV B;  4HCP B;  3DOW A;  3ENE A;  4MH0 E;  2L76 A;  5DCN A;  3DCG A;  2IY0 B;  4FA6 A;  3UGB B;  1E8Y A;  1YX5 B;  2LWP A;  2DAF A;  2KQS A;  4TKN A;  3HHM A;  2D10 A;  1WGD A;  3N3K B;  1NBF C;  2RPQ A;  3ZDM C;  4G0N B;  3RUI B;  2HTH A;  1F9J A;  4IWP A;  3X23 A;  3PHW B;  3QC8 B;  1LXD A;  3ZNI D;  3ZKJ C;  4IM0 A;  1WMH B;  2KD0 A;  2WDT B;  3PSE B;  3Q3J A;  4KSL C;  2GBJ A;  4WJN A;  1H8C A;  1WXS A;  4GDK A;  2BWF A;  4JGH B;  2FID A;  2MA9 B;  2REX A;  4NY0 A;  1J19 A;  1Z5S B;  1LM8 B;  3A1Q A;  4LCD E;  2K8H A;  2N1V A;  1P1A A;  2I1K A;  1YX6 B;  2LVQ A;  3ZUN A;  4GDL A;  4FN2 A;  1Q5W B;  2MBB B;  5AEK B;  5C1Z A;  3BY4 B;  3JSV B;  2CHW A;  3KYD D;  3R7R A;  2EMT A;  2N4F A;  3CST A;  3GOE A;  2LRW A;  3KUZ A;  4EKU A;  2BF8 B;  3NHE B;  4IM2 A;  1V5T A;  2IO0 B;  4EZK A;  2I1J A;  2Z0D B;  3H6N A;  2DZK A;  3RT3 B;  2FCM A;  3RZF A;  2C7H A;  4G11 A;  4K81 A;  4A3P A;  1R4M I;  2KC2 A;  2QHO A;  5D94 A;  3TBL D;  2L8J A;  3MJW A;  3DBS A;  3ML8 A;  5HKH A;  2WWZ A;  2D2Q A;  2DHZ A;  4WWN A;  4F1S A;  3JW0 X;  1S3S G;  4HJK A;  5J2R A;  3CSF A;  4YL8 A;  2O6V B;  2KTR B;  4MSM B;  2MX2 A;  4K1R B;  3AU4 A;  3B0A A;  4W9K A;  3ZTD A;  2N1W A;  2J0K A;  2LJ5 A;  2Y5B B;  1UH6 A;  4DHJ B;  2HJ8 A;  5E6P A;  4PS8 A;  3VFK A;  4HVB A;  1ZW7 A;  5DPS A;  4HLE A;  1WM2 A;  4EEW A;  3QIJ A;  2NBW B;  2KFK A;  4NPN A;  4W9L A;  2HD5 B;  1RAX A;  1UGM A;  3PTF C;  2JY6 A;  4PYZ A;  4KVG B;  2O2V B;  3JSV A;  3LDZ E;  2O6V D;  4A20 A;  3P2B A;  2GBM A;  4JQW C;  2J7Q B;  3ZLZ A;  1SE9 A;  1UEL A;  2NBU A;  3Q3F A;  1NI2 A;  3H9D A;  5D6J B;  4AOF A;  3DQV A;  4G50 A;  4MEM A;  4DHJ D;  3B1L X;  4BVU C;  3PS6 A;  4I6N B;  2C60 A;  3HK0 A;  2LUE A;  4DHZ B;  1P98 A;  3SDL C;  3W1S C;  2KN5 A;  2KWC A;  2K39 A;  1V81 A;  3N32 A;  4MJS B;  1XQQ A;  3UIO B;  4K7W A;  3ZDT A;  3TMP B;  1EF5 A;  1YD8 U;  1M94 A;  2LXC A;  2OOB B;  3UQA A;  4CHK A;  2DYM A;  3PV1 A;  3VUW A;  3IG3 A;  4XC2 A;  1WX7 A;  1SGH A;  2MBQ A;  4DDG D;  1OEY J;  4FAD A;  1WF9 A;  2BGF A;  2CR5 A;  4DDI D;  2N7D A;  4BKG A;  2N7E A;  3DPD A;  4BKS D;  3VVW B;  2KO3 A;  4W9F A;  3RCZ A;  5IA7 A;  2FNJ B;  3NZS A;  4BKT A;  4P7I A;  3A4S C;  3VAW A;  4GMV A;  4ICV A;  4KSK C;  2CHZ A;  3ML9 A;  1UBI A;  1WR6 E;  2LGY A;  4ZRK A;  4W9G A;  2G3Q B;  2D3G A;  4FHJ A;  4I6P A;  3VH4 B;  2LGX A;  4AUQ C;  1KLV A;  1VCB A;  4JIO U;  2ASQ A;  2NCN A;  4TV3 A;  3ZVV A;  5CHF A;  3AXC A;  4M8M A;  1JRU A;  3UIP B;  1TZ1 A;  2BYV E;  3WAN A;  2L3Z A;  2IY1 B;  2OJR A;  2M0X A;  4DXA B;  1WJN A;  2KDI A;  2ZVN A;  5DPW A;  2JUO A;  1H4R A;  1KM7 A;  2ZEQ A;  3K9P B;  5E6O A;  3VQI A;  2DYO A;  4TUU A;  4DWF A;  2UWQ A;  3BIN A;  4ANX A;  2VRR B;  1E7U A;  2AYO B;  1P9D U;  1WJ4 A;  3CMM B;  3KVF B;  3VXW A;  3H7P B;  1TTN A;  2K1F A;  4WJP A;  3A9J A;  2KTF A;  3QJZ A;  1D3Z A;  4W9E A;  3KH0 A;  1WGH A;  3NS8 A;  3VTV A;  1GNU A;  1ISN A;  1WXM A;  2MBE A;  1Y8R C;  1AAR A;  1WH3 A;  1WI0 A;  2JT4 B;  3ALB A;  3D32 A;  3KW5 B;  4EOY A;  3DDC B;  2ZPN A;  4E71 A;  2C7N B;  2KC1 A;  1MG8 A;  2JZ3 B;  4HDO A;  4XZ4 A;  2LXA A;  2FCN A;  4W9D A;  5CHV C;  2KAN A;  5TR5 A;  5LXH A;  4N9F 4;  1IPG A;  4IW0 A;  2FCQ A;  4WJO A;  4AP4 C;  4URK A;  3QK0 A;  1G6J A;  3VUY A;  1T0Y A;  3RYT A;  1V80 A;  2L7R A;  3V62 A;  1Q0W B;  1TBE A;  5CHW A;  3ZIM A;  5JHA A;  3N30 A;  3PRM B;  1QZE A;  1Q1O A;  5FR6 A;  4E74 A;  2GBK A;  3JYU A;  4PYU A;  5AZG A;  3U8Z A;  2BPS A;  3ZW3 A;  2LI5 A;  4KZC A;  5E6N A;  2C9W B;  3DBR I;  3QAQ A;  5J18 A;  2DZI A;  3EFU A;  4ASW C;  3T9L A;  2XK5 B;  1E90 A;  4KIK B;  3IBE A;  2GBR A;  4HPL B;  3O65 B;  1C3T A;  2A5U A;  2KVR A;  2KMC A;  2M8S A;  2NBV B;  4FJV B;  3ZNH B;  3L10 B;  4NQL B;  2GBN A;  3EC8 A;  1GUA B;  2J0M A;  1P3Q U;  3ONS A;  1KJT A;  1WMH A;  4CO7 A;  2DX5 B;  4EZL A;  4HXD A;  2KNB A;  5BO4 B;  4B9K A;  1SIF A;  3IVF A;  2CHX A;  3QCA A;  4HPM B;  1J8C A;  2B3A A;  4WWO A;  1OEY A;  4M0W B;  3UF8 A;  3W1Y A;  1FXT B;  4B95 A;  2J0J A;  4MGI E;  2NS5 A;  3TCA A;  4CYE A;  4ZDV A;  3WAL A;  1YIW A;  2EKE C;  2MSE D;  3DVN V;  2M1M A;  5KHO A;  3DVG X;  1UBQ A;  2JXX A;  3HM3 A;  1LFD A;  2LRU A;  2DYB A;  2KKC A;  4OVV A;  4FJZ A;  4ZRI A;  1UD7 A;  2IYD B;  2FAZ A;  4MGY E;  3V60 A;  3AUL A;  3JVZ X;  4WWP A;  4F7Z A;  2PJH A;  1OTR B;  2AWT A;  3HIZ A;  2KLC A;  2RSU A;  4TQ0 A;  3L17 A;  3A9K B;  4J6I A;  1NDD A;  2XBB C;  2KQ7 A;  3VH3 B;  2PE6 B;  3NOB A;  2DEN B;  4ANU A;  1WGG A;  1WE6 A;  2G4D B;  2O6V A;  3DVN U;  2KTR A;  3V61 A;  2ZJD A;  3A4R A;  2LD9 A;  1BT0 A;  5D7G A;  5IAA C;  3TL5 A;  4JLC A;  4PS3 A;  3H7S A;  1WRD B;  2K6Q A;  4GU2 A;  3HM6 X;  3VDZ A;  3WIM A;  5L95 C;  1PQS A;  4BOS C;  1V49 A;  2KWV B;  3NZU A;  4MSQ B;  1OGW A;  2V1Y A;  3R66 C;  2D07 B;  2N9X A;  4GOC A;  2PPH A;  2GMI C;  3DBH I;  3PZD A;  3QQ8 B;  2D11 A;  4MEL A;  2KK8 A;  3MHS D;  1UZX B;  2CS4 A;  2O2V A;  1U4A A;  4DBG A;  1IYF A;  4FHK A;  2JVC A;  4IWO A;  4NAW B;  1WFY A;  2Z0E B;  3IFW B;  4IWQ A;  2BYE A;  3KUD B;  4RMA A;  4IG7 B;  3PRZ A;  4GN1 A;  2FCS A;  1E8X A;  4IM3 A;  4E3C A;  1VD2 A;  1WX9 A;  3QX1 A;  2KJH B;  3T8M A;  3S2A A;  4GIV A;  3NY5 A;  1WY8 A;  3PGE A;  1GC6 A;  3SU8 X;  4B6W A;  1WXA A;  1GJZ A;  2MQJ A;  2BKF A;  2KZR A;  2MBH A;  2RGF A;  4MJS A;  3WAM A;  2BWE S;  2V3S A;  3IHP C;  4ZRJ A;  2JPH A;  3EHV A;  4K7U A;  2UYZ B;  4XX5 A;  3VTU A;  4ANV A;  3GZN I;  4KZ0 A;  2MCN B;  3L13 A;  2W9N A;  3QA8 A;  2A4Z A;  3A1Q B;  5G55 A;  4AJW A;  2IO3 B;  4BFR A;  2C5L C;  4I6L B;  2MP2 B;  5JH5 C;  2LVP A;  3RZW C;  3SD5 A;  4GDL B;  4W9C A;  3ZRF A;  1C1Y B;  1TGZ B;  4IC7 B;  2PEA A;  3QHT A;  3APF A;  2KJR A;  1S1Q B;  4NAW A;  3ZNZ B;  2IZV B;  2KOX A;  1HE8 A;  3M62 B;  3ZO5 B;  1R4N I;  4ZYN A;  1LQB A;  2WX1 A;  1GC7 A;  4NJ6 A;  2BYF A;  1E5W A;  2NVU I;  4HDQ A;  3UQB A;  5DPR A;  5JHB A;  3WAP A;  5GMV A;  1RRB A;  1V9J A;  2JF5 A;  4ANW A;  1L7Y A;  4DK5 A;  4LDT D;  1I42 A;  4ICU A;  3R7Q A;  1EO6 A;  1E8W A;  5KHQ A;  2KWU B;  1YQB A;  4WJQ A;  4NQK E;  1K8R B;  2DZM A;  3PRE A;  4FBJ B;  4AWJ A;  1RLF A;  2WX0 A;  5LLI A;  3APD A;  2ZNV C;  4HK2 A;  3QWZ B;  2R2O A;  2PE9 A;  2NR2 A;  3AI5 A;  3M63 B;  2LZ6 A;  2K8B A;  2G4S A;  2KFK B;  2MP2 A;  3ECI A;  3H7P A;  3LJ3 A;  2KX3 A;  3TJP A;  4BBN C;  4BOZ B;  3EEC A;  5AZF A;  3ZNG C;  1V86 A;  4MGZ E;  3RD2 A;  1E7V A;  1XT9 B;  2AL3 A;  2MRP A;  3OJ3 A;  4HWI B;  2M17 A;  4K7S A;  1YJ1 A;  2N9P C;  4GGQ A;  5AZH A;  2JRH A;  2CU1 A;  3ZRC A;  5L83 A;  2G45 B;  2MBO A;  2KDF B;  2LAS A;  2ZCC A;  2IBI B;  2KDE B;  3DBL I;  3B08 A;  1Z2M A;  3PT2 B;  2LGD A;  3TIX A;  2N9E B;  3VHT C;  3V6C B;  3ZTC A;  1IP9 A;  4GXB A;  1ZGU B;  3KUC B;  2KDB A;  4KDL B;  2MWS B;  5DPT A;  2K6D B;  4GSW A;  3OLM D;  1GG3 A;  5CX3 A;  2EMS A;  2ZZP B;  4F8C B;  4EZJ A;  1WZ0 A;  4PS7 A;  4NJ7 A;  1WJU A;  3OJ4 B;  1L2N A;  2YVC A;  3PLU A;  4WQO B;  4RM8 A;  4MM3 A;  1EUV B;  1XD3 B;  4OVU A;  5JZE B;  3SHQ A;  1X1M A;  3K9O B;  2KJ6 A;  2MW5 A;  2CKH B;  5G2N A; 
#chains in the Genus database with same CATH topology
 4KIK A;  1D5X C;  3NRZ A;  4KDI C;  1CZP A;  1V6E A;  5EE9 A;  3NJT A;  3H1U A;  3OAW A;  3R2T A;  3Q8B A;  3X0W A;  2KHW B;  3AN1 A;  2L05 A;  2L1A A;  2ZCB A;  2XEW A;  5IKC M;  4M0W A;  1WZ3 A;  3VUX A;  1FD6 A;  3SFD B;  3CF6 E;  2ZPY A;  5IP4 D;  1K52 A;  4M8N A;  1WGK A;  2G9H D;  2JRI B;  2W55 A;  5J17 A;  3N9Y C;  1XCT L;  2C7M B;  1N61 A;  1WXV A;  3I3T B;  3FKY A;  2BT6 A;  3A9K A;  5HG2 A;  4MDK E;  4W9J A;  4RF1 A;  2LVO A;  4II2 B;  3APC A;  3WA0 A;  2KX0 A;  1WJ6 A;  2FUG 1;  2R2Q A;  4J3O D;  4EFO A;  4LJP B;  4W9H A;  3RUL A;  3T3O A;  4A8X C;  2JQR B;  4W9I A;  1R7S A;  3L16 A;  1N5X A;  1YQ3 B;  2ZNV B;  2WQY B;  2WU2 B;  4TMA B;  3UGB B;  1C76 A;  1YX5 B;  3KLS X;  4C80 A;  1SF0 A;  2KQS A;  2D10 A;  3NUH B;  3PHW B;  1I4P A;  5E6J A;  1H8C A;  4WJN A;  1Y56 A;  1WXS A;  2NMQ A;  4LNN A;  4NY0 A;  3B2G A;  3A1Q A;  3ZJU A;  1IUE A;  4LK0 M;  2N1V A;  2CJN A;  3HVD A;  4GDL A;  4FN2 A;  3TSS A;  4Q2J A;  1E7P B;  3VR9 B;  2CHW A;  2WU5 B;  2LRW A;  4EKU A;  4O1N A;  1N63 A;  3ZXR A;  1C4C A;  2IJ0 A;  4YT0 B;  2FCM A;  1UWX A;  3LXF A;  4RGO S;  2C7H A;  4A3P A;  2KC2 A;  2L8J A;  3GE8 C;  3MJW A;  4P1C C;  2WWZ A;  2D2Q A;  4WWN A;  2BB6 A;  3KWV A;  3AEA B;  3VR8 B;  2PTL A;  3OWE B;  4MSM B;  1MHH E;  4LNF A;  4WUR A;  4PS8 A;  4HVB A;  4HLE A;  4YTN B;  2O2V B;  3JSV A;  2O6V D;  5G5H A;  3ZJT A;  4JQW C;  4ZYS A;  1ACC A;  5G5G A;  3P1M A;  4DHJ D;  2C60 A;  1P98 A;  3W1S C;  2KN5 A;  5IOI A;  1V81 A;  3ZDT A;  4K3C A;  3W2D A;  1YD8 U;  5BYS A;  1WXQ A;  2OOB B;  3L4P A;  3P4Q B;  2KWD A;  2DYM A;  4H2A A;  2QIE B;  1WX7 A;  2MBQ A;  2BQQ A;  4YSY B;  1C77 A;  2CR5 A;  2N7D A;  3DPD A;  4PK1 A;  5IA7 A;  1FNW A;  2FNJ B;  3NZS A;  3VAW A;  1N6Z A;  4GMV A;  1QLB B;  4KSK C;  1HA5 A;  1UWM A;  1WR6 E;  2LGY A;  1K51 A;  4N58 A;  4YXD B;  1QOF A;  4C4V B;  3DBH B;  4AUQ C;  1YNT E;  2INN E;  3AXC A;  1JRU A;  4NAM A;  2L52 A;  1TZ1 A;  2BYV E;  4DXA B;  1MI0 A;  3EGR A;  2UWQ A;  2OED A;  3BIN A;  1KH0 A;  1P9D U;  4W9E A;  3NS8 A;  3GZN B;  2MBE A;  1Y8R C;  1WI0 A;  2JT4 B;  3ALB A;  2V3N A;  3D32 A;  3N1X C;  1C4A A;  2D3C A;  1XXG A;  5TR5 A;  5LXH A;  4IW0 A;  1ZPS A;  4AP4 C;  1DOI A;  3QK0 A;  2N7J A;  3VUY A;  3P4R B;  1V80 A;  3TUO A;  1TS2 A;  4RGM A;  1L0V B;  3Q69 A;  3RNA C;  1TS3 A;  4PYU A;  3U8Z A;  1P7E A;  2BPS A;  4KZC A;  3RNB C;  4S17 A;  5C3J B;  2N9L A;  1NEN B;  3T9L A;  1E90 A;  1MG4 A;  3O65 B;  2A5U A;  2KVR A;  2M8S A;  3ZNH B;  1E6E B;  4NQL B;  5JXV A;  3C19 A;  4EZL A;  1D5M C;  4B9K A;  3QCA A;  3AE4 B;  4HPM B;  5C2T B;  2B3A A;  1OEY A;  2OJW A;  1ESF A;  1FXT B;  4MGI E;  3TCA A;  4CYE A;  1T0S C;  3HM3 A;  1D6E C;  3DBL B;  4DXG A;  2PMV A;  4MGY E;  3MC8 A;  3AUL A;  4LNK A;  1OTR B;  2AWT A;  2QSD A;  2CJO A;  3L17 A;  2XBB C;  2KQ7 A;  3IAS 1;  3NOB A;  2DEN B;  4C7Y A;  2ZJD A;  1BT0 A;  5IAA C;  2K6Q A;  1C79 A;  4GU2 A;  2WDR B;  3HM6 X;  3VDZ A;  4P16 A;  3N1Y C;  3W9C B;  4MSQ B;  2D07 B;  4GOC A;  2PPH A;  4MEL A;  2O2V A;  2JVC A;  1FCC C;  3IT6 B;  2Z0E B;  4IWQ A;  1SEB D;  3Q3N C;  4RMA A;  1TYG B;  4GN1 A;  1WX9 A;  2KJH B;  3NY5 A;  1WY8 A;  1WXA A;  1GJZ A;  2BKF A;  2RGF A;  2BWE S;  2V3S A;  3J9C A;  2DBY A;  1RFK A;  1FFU A;  4ZRJ A;  4EE2 A;  1IGD A;  1T0Q C;  2UYZ B;  4KZ0 A;  2MCN B;  2W9N A;  1TY2 A;  2G1E A;  2IO3 B;  3SD5 A;  3ZRF A;  3I5J C;  2XN9 C;  5EE1 A;  5I4D A;  2KJR A;  3M62 B;  3ZO5 B;  1R4N I;  4ZYN A;  2WX1 A;  1YN4 A;  1RRB A;  3FIL B;  2JF5 A;  1L7Y A;  1I42 A;  2QMT A;  3R7Q A;  2PLP A;  3DWG C;  4WJQ A;  4OW0 A;  3EUB 2;  3PRE A;  1QF6 A;  5LLI A;  4HK2 A;  3ETR A;  2QCZ A;  2PE9 A;  2NR2 A;  1SE2 A;  4BOZ B;  3RN9 C;  2J52 A;  3TEZ A;  1XCQ L;  3ZNG C;  3RD2 A;  3HRD D;  4ACF A;  2AL3 A;  3OJ3 A;  1YJ1 A;  1V8C A;  3ZRC A;  2MBO A;  2KDF B;  2V4I B;  1Z2M A;  2ZW1 A;  3TIX A;  2LGD A;  2M0A A;  1ZGU B;  2KDB A;  2K6D B;  2QEJ C;  5CX3 A;  4F8C B;  2ZZP B;  1L2N A;  1PYW D;  1GB1 A;  4RM8 A;  4KKI A;  1OQQ A;  2W54 A;  3Q6B A;  1X1M A;  5G2N A;  3KQ4 A;  3P63 A;  4FUL A;  5CTR C;  1KOT A;  1A5R A;  3FAH A;  3WAO A;  3E9S A;  2KFJ A;  4A3O A;  1P0R A;  4P6V F;  3W1S A;  1TKG A;  3BYY B;  1VJK A;  3L54 A;  3PPA A;  2JZZ A;  2JWZ A;  1RFA A;  1I4Q A;  1WGR A;  2L0F A;  3AE9 B;  1TS4 A;  2ZW0 A;  1EF1 A;  2V4L A;  2Q5W D;  4KV2 A;  2DAJ A;  3PLV A;  3PRP B;  2JYE A;  4C00 A;  2WXJ A;  3A9J B;  4IUM B;  2FUH B;  2D5G A;  1WIA A;  3AU5 A;  1FNU A;  1B1Z A;  1WX8 A;  4HCN B;  2GB1 A;  1I4R A;  1L4Z B;  1I4G A;  4GB9 A;  4MH0 E;  3DOW A;  3RNF C;  3DCG A;  1K53 A;  4TKN A;  3HHM A;  2I38 A;  3N3K B;  2ICI A;  2WXK A;  2WNM A;  1FO4 A;  2KT7 A;  1F9J A;  4S0R A;  3AED B;  3QC8 B;  1SXT A;  3ZKJ C;  1WMH B;  2KD0 A;  2X8X X;  4GDK A;  2BWF A;  3AM9 A;  1Z5S B;  3ZUN A;  4RGT A;  4XE0 A;  1Q5W B;  5AEK B;  3JSV B;  2UU7 A;  3CST A;  3GOE A;  2K22 A;  3P42 A;  2BF8 B;  3NHE B;  1V5T A;  4EZK A;  2I1J A;  2Z0D B;  3H6N A;  2DZK A;  3RZF A;  3TBL D;  2K0P A;  3ML8 A;  1E9M A;  3DBS A;  2IDY A;  3FIL A;  2VH2 A;  4W9K A;  2KDM A;  4KGR A;  3C8Y A;  2M19 A;  5E6P A;  3VFK A;  5DPS A;  3Q8E A;  3QIJ A;  4NPN A;  5LNK 1;  2JY6 A;  1PFD A;  3V3X A;  3LDZ E;  1I7H A;  1SJE D;  4C7Z A;  3P2B A;  2GBM A;  3ZLZ A;  1SE9 A;  1UEL A;  3ZJV A;  3Q3F A;  3H9D A;  3PZ8 A;  4G50 A;  3URY A;  3B1L X;  1JWU D;  4BVU C;  3PS6 A;  3IT4 B;  5HHD G;  3SDL C;  5FKA C;  2DNF A;  2K39 A;  3EFC A;  1XQQ A;  4K7W A;  4NJC A;  3PZ7 A;  2LXC A;  3NVV A;  3PV1 A;  3IG3 A;  4XC2 A;  1QT9 A;  4FAD A;  1WF9 A;  2EEL A;  1ENF A;  1HEZ E;  1XO3 A;  1YN3 A;  2WXO A;  1UBI A;  4ZRK A;  1FM0 D;  2D3G A;  5BMG A;  1XLP A;  2BS4 B;  5CHF A;  3UIP B;  3WAN A;  2IY1 B;  2OJR A;  5DPW A;  5E6O A;  1F52 A;  4RNA A;  1TKE A;  2VRR B;  1E7U A;  1ZUD 2;  4XDD A;  3VXW A;  3AEG B;  1TTN A;  4MAC A;  4WJP A;  3A9J A;  1GNU A;  1F2R I;  3RNC C;  1WXM A;  4EOY A;  4LNO A;  1BXT A;  4HDO A;  5CHV C;  3Q8C A;  3NVW A;  4RGN A;  2FCQ A;  4WJO A;  1TT5 B;  2L7R A;  3V62 A;  1Q0W B;  2WGS A;  3ZIM A;  5JHA A;  2KVZ A;  3PRM B;  1QZE A;  1Q1O A;  2KAC A;  2GBK A;  1FXI A;  3DBR I;  5J18 A;  2DZI A;  3EFU A;  3Q14 C;  4ZRQ A;  1GB4 A;  2XK5 B;  3IBE A;  4HPP A;  2INP E;  2NBV B;  1SE3 A;  3L10 B;  1GUA B;  1JQ4 A;  3ONS A;  1IGC A;  1KJT A;  1WMH A;  4CO7 A;  2VZK B;  2KNB A;  1SIF A;  1YMH E;  4AQ7 A;  2SEB D;  1MFW A;  3GS2 A;  5KHO A;  3DVG X;  1UBQ A;  4KKJ A;  4TSS A;  2KKC A;  4FJZ A;  1UD7 A;  1F2R C;  2FAZ A;  3V60 A;  4WWP A;  1HZ6 A;  3MFG A;  2RSU A;  1OFF A;  4XGA B;  5BYQ A;  1NDD A;  3T3N A;  2PE6 B;  1WE6 A;  3V61 A;  3LB8 C;  1L0Y B;  3AEF B;  1E10 A;  1EU3 A;  2WXF A;  1FEH A;  1GAQ B;  1FNV A;  4A90 A;  1UF0 A;  3NZU A;  2KWV B;  3R66 C;  2N9X A;  3PZD A;  2D11 A;  2MJE A;  4JX1 C;  2CS4 A;  1U4A A;  4KGS A;  4IWO A;  1CJE A;  1WFY A;  5HFY A;  3IFW B;  3PRZ A;  4IM3 A;  4E3C A;  1IBX B;  4HRO A;  3QX1 A;  3RPF C;  1GC6 A;  4M01 A;  1E0Z A;  2MBH A;  3IHP C;  2EKI A;  2JPH A;  4XX5 A;  3VTU A;  1RWS A;  3AE5 B;  1I4H A;  3GE3 C;  2AQ3 B;  1B9R A;  1ZXH A;  2IGD A;  3RZW C;  2BYT A;  2K9X A;  4OZC A;  4W9C A;  1C1Y B;  1UGJ A;  2CU3 A;  3QHT A;  1S1Q B;  4NAW A;  4A55 A;  4N59 A;  1CQV A;  1HE8 A;  1LQB A;  4NJ6 A;  1PDX A;  3R8B A;  2NVU I;  3WCQ A;  3UQB A;  3WAP A;  3IXS A;  1V9J A;  2JSV X;  3BK1 A;  4ANW A;  4DK5 A;  1I4X A;  1MHX A;  1SIJ A;  2KMM A;  3U4E G;  4AWJ A;  1RLF A;  3APD A;  2WLB A;  2WXN A;  4WAF A;  2R2O A;  2JZP A;  2KFK B;  3TJP A;  3EEC A;  5AZF A;  3AH7 A;  1V86 A;  1E7V A;  1EWC A;  1PGA A;  2LAS A;  1CK1 A;  2ZCC A;  4JWU C;  2KDE B;  3B08 A;  1N5W A;  2N9E B;  3KUC B;  4KDL B;  2MWS B;  2WXR A;  1QOA A;  4EZJ A;  4PS7 A;  4NJ7 A;  4WQM A;  2LGS A;  2WDV B;  2YVC A;  4XYC A;  1EUV B;  4USA A;  3NZ3 A;  2J53 A;  2X38 A;  2WXM A;  2XK5 A;  3NVY A;  2RD0 A;  2RR9 A;  2QIL A;  4BBN F;  1ZKH A;  4NNJ B;  4EUT A;  3C0R B;  3DVG Y;  3M3J A;  3L0W B;  2YEP B;  2IGG A;  3I9V 1;  3Q8A A;  3TEW A;  4LLG M;  5D3I B;  4RF0 A;  2L0T A;  2MLB A;  1M4V A;  4DHZ E;  3ZQ4 A;  1I35 A;  2HTM E;  1FCL A;  2R61 A;  2OHF A;  1NEK B;  3U30 A;  2INC C;  2L00 B;  2K8C A;  1XLQ A;  3HVZ A;  3U7D A;  3ABV B;  3RFZ B;  4TQ1 A;  1WE7 A;  4IKG A;  2N0S B;  2KN4 A;  2Z59 B;  4RM9 A;  1OQY A;  2W3S A;  3W5U B;  1C9F A;  3TEX A;  2NPT A;  1WR1 A;  4BKS A;  1WGY A;  5FR3 A;  1L6U A;  3VTW A;  4X57 B;  1CMX B;  1E8Z A;  4WAA A;  3SFE B;  1TIF A;  4GDK B;  4FLH A;  3AEE B;  2IPK D;  1SJH D;  2FIF A;  4HKZ E;  3V6E B;  1NYQ A;  2WYQ A;  2HE7 A;  2KXJ A;  1V1P A;  4JPS A;  2ZVO A;  1QQR A;  4LDT B;  2M4N A;  1F77 A;  3ENE A;  2H89 B;  2L76 A;  1SSN A;  1OQR A;  2IY0 B;  4FA6 A;  1E8Y A;  2LWP A;  1WYG A;  2DAF A;  1IBX A;  1BML C;  1QOG A;  1WGD A;  3BK2 A;  1NBF C;  5BMH A;  3AV8 A;  3I57 A;  4G0N B;  2JX5 A;  2HTH A;  1YOV B;  5MPO A;  1EU4 A;  4JE3 B;  3X23 A;  1LXD A;  3ZNI D;  4IM0 A;  3Q3J A;  4KSL C;  1ET9 A;  1C78 A;  2MA9 B;  2REX A;  1J19 A;  4US8 A;  4WH4 A;  1FFV A;  2MBB B;  2RDB C;  2WXH A;  2EMT A;  1XEE A;  1ZXI A;  4ITK A;  4IDI A;  4IM2 A;  3RT3 B;  1KF6 B;  3AE6 B;  4HJG E;  2BVC A;  1MJD A;  4G11 A;  4K81 A;  5HKH A;  1P7F A;  4F1S A;  3JW0 X;  1S3S G;  4HJK A;  2O6V B;  3AU4 A;  3FC4 A;  2N1W A;  2LJ5 A;  1UH6 A;  4DHJ B;  4CQN A;  1TZO A;  2HJ1 A;  1WM2 A;  2NBW B;  3BVG A;  2KFK A;  1RAX A;  1UGM A;  3PTF C;  4PYZ A;  4KVG B;  4L2Y A;  1LO5 D;  3R2I A;  2MJ3 A;  2J7Q B;  2KQ4 X;  2VZK D;  3DQV A;  4MEM A;  2D3A A;  2GRI A;  4BZA A;  1ET6 A;  3AE1 B;  1EWY C;  2KYW A;  1JCK B;  5TSS A;  2JXT A;  3N32 A;  4HEA 1;  3TMP B;  1AYF A;  3AEB B;  3RMK C;  1VDV A;  3UQA A;  4CHK A;  1ZDV A;  3VUW A;  1SGH A;  1OEY J;  3EA6 A;  4M02 A;  2BGF A;  3BWU D;  3UI3 A;  4ZHO A;  4BKG A;  2N7E A;  3TEY A;  4BKS D;  3VVW B;  4W9F A;  3RCZ A;  4C56 C;  3DHH C;  4P7I A;  1JML A;  4ICV A;  5H8Y E;  2CHZ A;  3ML9 A;  3DHI C;  2JU6 X;  5T8I A;  2E6X A;  2G3Q B;  1T0R C;  2LGX A;  1KLV A;  1VCB A;  1VRA B;  4JIO U;  2ASQ A;  1AW7 A;  4YSZ B;  2M0X A;  1WJN A;  2KDI A;  2ZVN A;  2GLS A;  1ZP0 B;  4MH8 A;  1H4R A;  1KM7 A;  3K9P B;  3VQI A;  2DYO A;  4GLS C;  3NVZ A;  4ANX A;  2AYO B;  2LHD A;  1WJ4 A;  3CMM B;  3KVF B;  3ZXV A;  3PO0 A;  2Y3A A;  4OVZ A;  2KTF A;  2K5P A;  3KH0 A;  1WGH A;  2W3R A;  5H92 C;  3W5V B;  3DDC B;  4E71 A;  2C7N B;  2YEP F;  2JZ3 B;  4XZ4 A;  2LXA A;  2FCN A;  4W9D A;  4N9F 4;  1IPG A;  4YTM B;  2D3B A;  4URK A;  3ZGZ A;  4WWM A;  3MP9 A;  1T0Y A;  1ZDX A;  1K50 A;  1HXY D;  1TBE A;  1PUT A;  3N30 A;  2AQ1 B;  5IN7 A;  1R4N B;  5AZG A;  3ZW3 A;  4MM3 B;  2C9W B;  2WP9 B;  3QAQ A;  5AUK A;  4N6E B;  1SB3 C;  1LGR A;  1C3T A;  5BMI A;  2GBN A;  3EC8 A;  2J0M A;  1P3Q U;  2RDH A;  1T3Q A;  3AB5 A;  1YJI A;  5BO4 B;  1J8C A;  2CHX A;  3W1Y A;  2KAJ A;  2J0J A;  2NS5 A;  4ZDV A;  3DHG C;  2K3U A;  3WAL A;  2EKE C;  3DVN V;  3Q8F A;  4XWW A;  2M1M A;  2M56 B;  2BBC A;  5FK9 C;  1LFD A;  2E3T A;  2DYB A;  4OVV A;  1D4B A;  2IYD B;  4F7Z A;  3JVZ X;  2PJH A;  2KLC A;  2GI9 A;  2BS3 B;  1JWM D;  3Q3M C;  4MT5 A;  4ANU A;  2G4D B;  4WIP A;  2O6V A;  3TL5 A;  4PS3 A;  3H7S A;  2RPV A;  1HQR D;  2WS3 B;  3N1Z C;  2WXI A;  1XF5 L;  3WIM A;  5L95 C;  1PQS A;  1BUI C;  3IAM 1;  1OGW A;  4ARC A;  2GMI C;  2NTS A;  3DBH I;  1UZX B;  4ARI A;  1T5X D;  4NAW B;  4B0M A;  2BYE A;  3KUD B;  4IG7 B;  2MEK A;  5HI1 A;  2FCS A;  1MVK A;  3U7Z A;  3T8M A;  3AE2 B;  3SU8 X;  1A70 A;  2QJL A;  1TJE A;  3WAM A;  1FPY A;  4K7U A;  1NI3 A;  1KFY B;  3P4P B;  4ANV A;  3GZN I;  4DXF A;  1KLU D;  1WSP A;  3CWI A;  3QA8 A;  2A4Z A;  5G55 A;  4AJW A;  2C5L C;  1UUP A;  1MPE A;  4IC7 B;  1TGZ B;  2PEA A;  2V0G A;  1XLO A;  3E56 A;  2KOX A;  4YSX B;  4RFB A;  5IO9 A;  1ZOY B;  1ZE3 D;  2BYF A;  1E5W A;  5DPR A;  5JHB A;  3BZD B;  4FXC A;  2V9H A;  4LDT D;  4ICU A;  1T6B X;  1EO6 A;  1E8W A;  1GPX A;  2LGI A;  3AE7 B;  4NQK E;  2HDE A;  3MC0 B;  1K8R B;  2DZM A;  4FBJ B;  2WX0 A;  3B2F A;  3KWL A;  3QWZ B;  2LZ6 A;  2K8B A;  2G4S A;  2MP2 A;  3ECI A;  3LJ3 A;  1XT9 B;  3AE8 B;  4K7S A;  4HWI B;  5AZH A;  2M17 A;  4GGQ A;  2JRH A;  5L83 A;  1NYR A;  2ONQ A;  2L83 A;  3DBL I;  4ZHP A;  3PT2 B;  2LFI A;  2LEK A;  2ACZ B;  2DLB A;  4PT5 A;  4GSW A;  1WZ0 A;  1WJU A;  3U2S C;  3PLU A;  4MM3 A;  1RYJ A;  4OVU A;  2WDQ B;  5JZE B;  3SHQ A;  3K9O B;  1KRH A;  2KJ6 A;  2MW5 A;  3DVN U;  2CKH B;  3RNG C;  2K25 A;  2NPT B;  2GOW A;  2YLM A;  2MH7 A;  2IO2 B;  2NTT A;  2IO1 B;  4G3X B;  2LUM A;  3A33 B;  1V5O A;  5C23 A;  3MJ5 A;  1J7B A;  2KLG A;  4NZL B;  4MGK E;  1VR9 A;  4HKQ A;  3PHX B;  1V1P B;  1J0G A;  3KYC D;  1Q10 A;  4LNI A;  4JWS C;  1WM3 A;  2BKR B;  3MTN B;  2KMA A;  2DZJ A;  4FJY A;  2V3P A;  2BTE A;  3PVL A;  4AJY B;  1JAL A;  4XWT A;  3M95 A;  4RH6 A;  4LJO B;  3R3M A;  1TKY A;  5D2M B;  4US9 A;  1WYW B;  5EDS A;  2AL6 A;  2AEH A;  4ZRP A;  2B76 B;  5LXI B;  2I2Y A;  4JL9 A;  3QAR A;  1V2Y A;  3BII D;  3L08 A;  3UIN B;  4II3 B;  4HCP B;  3RI7 C;  1D5Z C;  2QC8 A;  5DCN A;  2FBW B;  4L1B A;  3N20 C;  1KLG D;  1XLN A;  4UDU C;  2RPQ A;  3ZDM C;  4XDC A;  3RUI B;  1VZ8 A;  4IWP A;  1F1H A;  1QKZ A;  2J42 A;  5GXG B;  3PSE B;  2WDT B;  2GBJ A;  4JGH B;  2FID A;  1UNS A;  1LM8 B;  1F0Z A;  4LCD E;  1JW9 D;  2K8H A;  3HUI A;  1P1A A;  2I1K A;  4K3B A;  1YX6 B;  2LVQ A;  4KX6 B;  5C1Z A;  3BY4 B;  3KYD D;  3R7R A;  2N4F A;  5BYR A;  3KUZ A;  1V1O A;  4KGT A;  3LYY A;  2IO0 B;  5EE0 A;  1HTQ A;  2J4X A;  2PKO A;  1WRI A;  1R4M I;  2QHO A;  5D94 A;  4D2K A;  2DHZ A;  2DWQ A;  5J2R A;  3CSF A;  4YL8 A;  3DBR B;  2KTR B;  2MX2 A;  4K1R B;  3B0A A;  3ZTD A;  2J0K A;  2Y5B B;  4YTP B;  2HJ8 A;  1ZW7 A;  3H8H A;  4EEW A;  4A9A A;  4W9L A;  2HD5 B;  3VRA B;  4A20 A;  3BYT B;  2NBU A;  1DGJ A;  1NI2 A;  5D6J B;  4AOF A;  3AE3 B;  4A6Q A;  1SE4 A;  4I6N B;  3HK0 A;  2LUE A;  2PVO D;  4DHZ B;  2KWC A;  1DOY A;  4ZOH C;  1J7C A;  4MJS B;  1L4D B;  1PGB A;  4REZ A;  1AWD A;  3UIO B;  3ZYY X;  1EF5 A;  3B9J A;  1M94 A;  4B0E A;  1DOX A;  4DDG D;  2LMC A;  3BVZ A;  1PGX A;  2BB5 A;  4DDI D;  1VZ7 A;  2KO3 A;  4BKT A;  3A4S C;  3GB1 A;  1AN8 A;  3NG0 A;  4W9G A;  4FHJ A;  4I6P A;  3VH4 B;  1JRP A;  1NVI D;  2NCN A;  3ZVV A;  4TV3 A;  4M8M A;  2BW2 A;  2L3Z A;  2JUO A;  2BS2 B;  2ZEQ A;  4TUU A;  4M00 A;  2LJI A;  4DWF A;  1FIQ A;  3BVM A;  2PW9 A;  1SBB B;  5AUI A;  1HZ5 A;  1JWB D;  1KTK A;  2ON8 A;  3H7P B;  2K1F A;  4AS1 A;  3QJZ A;  1D3Z A;  3VTV A;  1ISN A;  3KW5 B;  1AAR A;  1WH3 A;  1JRO A;  2WXG A;  2ZPN A;  4OHJ A;  2KC1 A;  1MG8 A;  3OG5 A;  2KAN A;  1JWS D;  3VRB B;  4C4V A;  1G6J A;  3RYT A;  5CHW A;  2WXQ A;  4IOI E;  5EE3 A;  1YJJ A;  5FR6 A;  4E74 A;  3MC9 A;  3JYU A;  2LI5 A;  5E6N A;  2FE8 A;  4OZA A;  2W82 A;  4ASW C;  5D3D A;  1JWA D;  4KIK B;  2GBR A;  4HPL B;  3AMZ A;  2LHE A;  2KMC A;  4FJV B;  1TS5 A;  2JYT A;  2SAK A;  2DX5 B;  4BAX A;  4HXD A;  3NS1 A;  3U52 E;  3IVF A;  4WWO A;  2RDG A;  4R3D A;  4M0W B;  3UF8 A;  4B95 A;  3SR6 A;  1FXA A;  1FRR A;  1ROE A;  3AEC B;  1YIW A;  2MSE D;  3MHZ A;  1RM6 C;  2JXX A;  2LRU A;  4ZRI A;  1QOB A;  1R4M B;  3HIZ A;  2RMM A;  4TQ0 A;  2WHI A;  3A9K B;  4J6I A;  4QAY A;  3VH3 B;  2TSS A;  1WGG A;  2KTR A;  5D7G A;  3A4R A;  2LD9 A;  4JLC A;  1WRD B;  3P4S B;  2MHJ A;  4BOS C;  1V49 A;  1FMA D;  1L0X B;  2V1Y A;  1FRD A;  3QQ8 B;  2KK8 A;  3MHS D;  1IYF A;  1WWT A;  2QDF A;  4FHK A;  1VLB A;  1YN5 A;  2PIA A;  1EM7 A;  1E8X A;  2Y5P A;  3Q3O C;  1VD2 A;  2H88 B;  2PVG C;  2JWU A;  3S2A A;  4GIV A;  2IND C;  3RNE C;  3PGE A;  4B6W A;  3I63 C;  2MQJ A;  2KZR A;  4MJS A;  3EHV A;  1QIL A;  4HRS A;  2WXL A;  3L13 A;  3A1Q B;  4L23 A;  4BFR A;  4I6L B;  5JH5 C;  2MP2 B;  2LVP A;  3O13 A;  4GDL B;  2Z8L A;  3Q2A C;  1HTO A;  2XNA C;  3APF A;  2Y5C A;  3ZNZ B;  4YWG G;  2IZV B;  1VZ6 A;  1N62 A;  1GC7 A;  1C4P A;  4RCO A;  4LTU A;  2AX5 A;  4HDQ A;  1STE A;  5GMV A;  1J7A A;  2IGH A;  3DWM A;  5KHQ A;  2KWU B;  1YQB A;  1YQ4 B;  2VH1 A;  3GP7 A;  3V05 A;  2ZNV C;  1L6V A;  2MJD A;  3AI5 A;  3M63 B;  3H7P A;  2KX3 A;  4BBN C;  4P1B C;  1V97 A;  1L5P A;  4MGZ E;  2MRP A;  2L32 A;  2N9P C;  2CU1 A;  2G45 B;  3CIR B;  2WXP A;  2IBI B;  1DYQ A;  1GOZ A;  2AQ2 B;  3VHT C;  3V6C B;  3ZTC A;  1IP9 A;  4GXB A;  5DPT A;  3OLM D;  1GG3 A;  2EMS A;  3OJ4 B;  4DQO C;  2N9K A;  4WQO B;  1TY0 A;  1XD3 B;  4OZB A;  3SEB A;  1N60 A;  4DBG A; 
#chains in the Genus database with same CATH homology
 2XK5 A;  2RD0 A;  2RR9 A;  4KIK A;  2K25 A;  1ZKH A;  2NPT B;  4BBN F;  4KDI C;  4FUL A;  4NNJ B;  1V6E A;  3C0R B;  2GOW A;  5CTR C;  3DVG Y;  4EUT A;  2YLM A;  1KOT A;  3H1U A;  3M3J A;  3OAW A;  1A5R A;  3L0W B;  3WAO A;  2KFJ A;  3X0W A;  2KHW B;  2IO2 B;  4A3O A;  1P0R A;  2IO1 B;  4G3X B;  2L05 A;  3A33 B;  3W1S A;  2ZCB A;  1V5O A;  2XEW A;  5C23 A;  1WZ3 A;  2KLG A;  2L0T A;  3VUX A;  2MLB A;  4MGK E;  3CF6 E;  2ZPY A;  4DHZ E;  1I35 A;  3PPA A;  3L54 A;  3PHX B;  2JZZ A;  3U30 A;  2JWZ A;  1J0G A;  4M8N A;  2L00 B;  2K8C A;  3U7D A;  1RFA A;  3KYC D;  2JRI B;  4TQ1 A;  1WE7 A;  5J17 A;  1WGR A;  1WM3 A;  2BKR B;  2L0F A;  2Z59 B;  4RM9 A;  3MTN B;  2C7M B;  1EF1 A;  1OQY A;  1WXV A;  2DZJ A;  2KMA A;  2V4L A;  3A9K A;  3I3T B;  4FJY A;  4KV2 A;  2DAJ A;  3PLV A;  2NPT A;  3PRP B;  4MDK E;  1WR1 A;  4BKS A;  1WGY A;  4W9J A;  2LVO A;  3PVL A;  4II2 B;  3A9J B;  4IUM B;  3APC A;  3VTW A;  4AJY B;  2FUH B;  3WA0 A;  2KX0 A;  1WJ6 A;  2R2Q A;  3M95 A;  1WIA A;  4X57 B;  1CMX B;  4LJO B;  3R3M A;  1E8Z A;  4WAA A;  4EFO A;  5D2M B;  1WYW B;  5EDS A;  2AL6 A;  3AU5 A;  4GDK B;  4LJP B;  2AEH A;  4FLH A;  1WX8 A;  4W9H A;  3RUL A;  4HCN B;  5LXI B;  2FIF A;  4W9I A;  3V6E B;  3L16 A;  4JL9 A;  2WYQ A;  2HE7 A;  3QAR A;  2KXJ A;  1V2Y A;  2ZVO A;  4LDT B;  2M4N A;  3L08 A;  4GB9 A;  3UIN B;  4II3 B;  2ZNV B;  4HCP B;  3DOW A;  3ENE A;  4MH0 E;  2L76 A;  5DCN A;  3DCG A;  2IY0 B;  4FA6 A;  3UGB B;  1E8Y A;  1YX5 B;  2LWP A;  2DAF A;  2KQS A;  4TKN A;  3HHM A;  2D10 A;  1WGD A;  3N3K B;  1NBF C;  2RPQ A;  3ZDM C;  4G0N B;  3RUI B;  2HTH A;  1F9J A;  4IWP A;  3X23 A;  3PHW B;  3QC8 B;  1LXD A;  3ZNI D;  3ZKJ C;  4IM0 A;  1WMH B;  2KD0 A;  2WDT B;  3PSE B;  3Q3J A;  4KSL C;  2GBJ A;  4WJN A;  1H8C A;  1WXS A;  4GDK A;  2BWF A;  4JGH B;  2FID A;  2MA9 B;  2REX A;  4NY0 A;  1J19 A;  1Z5S B;  1LM8 B;  3A1Q A;  4LCD E;  2K8H A;  2N1V A;  1P1A A;  2I1K A;  1YX6 B;  2LVQ A;  3ZUN A;  4GDL A;  4FN2 A;  1Q5W B;  2MBB B;  5AEK B;  5C1Z A;  3BY4 B;  3JSV B;  2CHW A;  3KYD D;  3R7R A;  2EMT A;  2N4F A;  3CST A;  3GOE A;  2LRW A;  3KUZ A;  4EKU A;  2BF8 B;  3NHE B;  4IM2 A;  1V5T A;  2IO0 B;  4EZK A;  2I1J A;  2Z0D B;  3H6N A;  2DZK A;  3RT3 B;  2FCM A;  3RZF A;  2C7H A;  4G11 A;  4K81 A;  4A3P A;  1R4M I;  2KC2 A;  2QHO A;  5D94 A;  3TBL D;  2L8J A;  3MJW A;  3DBS A;  3ML8 A;  5HKH A;  2WWZ A;  2D2Q A;  2DHZ A;  4WWN A;  4F1S A;  3JW0 X;  1S3S G;  4HJK A;  5J2R A;  3CSF A;  4YL8 A;  2O6V B;  2KTR B;  4MSM B;  2MX2 A;  4K1R B;  3AU4 A;  3B0A A;  4W9K A;  3ZTD A;  2N1W A;  2J0K A;  2LJ5 A;  2Y5B B;  1UH6 A;  4DHJ B;  2HJ8 A;  5E6P A;  4PS8 A;  3VFK A;  4HVB A;  1ZW7 A;  5DPS A;  4HLE A;  1WM2 A;  4EEW A;  3QIJ A;  2NBW B;  2KFK A;  4NPN A;  4W9L A;  2HD5 B;  1RAX A;  1UGM A;  3PTF C;  2JY6 A;  4PYZ A;  4KVG B;  2O2V B;  3JSV A;  3LDZ E;  2O6V D;  4A20 A;  3P2B A;  2GBM A;  4JQW C;  2J7Q B;  3ZLZ A;  1SE9 A;  1UEL A;  2NBU A;  3Q3F A;  1NI2 A;  3H9D A;  5D6J B;  4AOF A;  3DQV A;  4G50 A;  4MEM A;  4DHJ D;  3B1L X;  4BVU C;  3PS6 A;  4I6N B;  2C60 A;  3HK0 A;  2LUE A;  4DHZ B;  1P98 A;  3SDL C;  3W1S C;  2KN5 A;  2KWC A;  2K39 A;  1V81 A;  3N32 A;  4MJS B;  1XQQ A;  3UIO B;  4K7W A;  3ZDT A;  3TMP B;  1EF5 A;  1YD8 U;  1M94 A;  2LXC A;  2OOB B;  3UQA A;  4CHK A;  2DYM A;  3PV1 A;  3VUW A;  3IG3 A;  4XC2 A;  1WX7 A;  1SGH A;  2MBQ A;  4DDG D;  1OEY J;  4FAD A;  1WF9 A;  2BGF A;  2CR5 A;  4DDI D;  2N7D A;  4BKG A;  2N7E A;  3DPD A;  4BKS D;  3VVW B;  2KO3 A;  4W9F A;  3RCZ A;  5IA7 A;  2FNJ B;  3NZS A;  4BKT A;  4P7I A;  3A4S C;  3VAW A;  4GMV A;  4ICV A;  4KSK C;  2CHZ A;  3ML9 A;  1UBI A;  1WR6 E;  2LGY A;  4ZRK A;  4W9G A;  2G3Q B;  2D3G A;  4FHJ A;  4I6P A;  3VH4 B;  2LGX A;  4AUQ C;  1KLV A;  1VCB A;  4JIO U;  2ASQ A;  2NCN A;  4TV3 A;  3ZVV A;  5CHF A;  3AXC A;  4M8M A;  1JRU A;  3UIP B;  1TZ1 A;  2BYV E;  3WAN A;  2L3Z A;  2IY1 B;  2OJR A;  2M0X A;  4DXA B;  1WJN A;  2KDI A;  2ZVN A;  5DPW A;  2JUO A;  1H4R A;  1KM7 A;  2ZEQ A;  3K9P B;  5E6O A;  3VQI A;  2DYO A;  4TUU A;  4DWF A;  2UWQ A;  3BIN A;  4ANX A;  2VRR B;  1E7U A;  2AYO B;  1P9D U;  1WJ4 A;  3CMM B;  3KVF B;  3VXW A;  3H7P B;  1TTN A;  2K1F A;  4WJP A;  3A9J A;  2KTF A;  3QJZ A;  1D3Z A;  4W9E A;  3KH0 A;  1WGH A;  3NS8 A;  3VTV A;  1GNU A;  1ISN A;  1WXM A;  2MBE A;  1Y8R C;  1AAR A;  1WH3 A;  1WI0 A;  2JT4 B;  3ALB A;  3D32 A;  3KW5 B;  4EOY A;  3DDC B;  2ZPN A;  4E71 A;  2C7N B;  2KC1 A;  1MG8 A;  2JZ3 B;  4HDO A;  4XZ4 A;  2LXA A;  2FCN A;  4W9D A;  5CHV C;  2KAN A;  5TR5 A;  5LXH A;  4N9F 4;  1IPG A;  4IW0 A;  2FCQ A;  4WJO A;  4AP4 C;  4URK A;  3QK0 A;  1G6J A;  3VUY A;  1T0Y A;  3RYT A;  1V80 A;  2L7R A;  3V62 A;  1Q0W B;  1TBE A;  5CHW A;  3ZIM A;  5JHA A;  3N30 A;  3PRM B;  1QZE A;  1Q1O A;  5FR6 A;  4E74 A;  2GBK A;  3JYU A;  4PYU A;  5AZG A;  3U8Z A;  2BPS A;  3ZW3 A;  2LI5 A;  4KZC A;  5E6N A;  2C9W B;  3DBR I;  3QAQ A;  5J18 A;  2DZI A;  3EFU A;  4ASW C;  3T9L A;  2XK5 B;  1E90 A;  4KIK B;  3IBE A;  2GBR A;  4HPL B;  3O65 B;  1C3T A;  2A5U A;  2KVR A;  2KMC A;  2M8S A;  2NBV B;  4FJV B;  3ZNH B;  3L10 B;  4NQL B;  2GBN A;  3EC8 A;  1GUA B;  2J0M A;  1P3Q U;  3ONS A;  1KJT A;  1WMH A;  4CO7 A;  2DX5 B;  4EZL A;  4HXD A;  2KNB A;  5BO4 B;  4B9K A;  1SIF A;  3IVF A;  2CHX A;  3QCA A;  4HPM B;  1J8C A;  2B3A A;  4WWO A;  1OEY A;  4M0W B;  3UF8 A;  3W1Y A;  1FXT B;  4B95 A;  2J0J A;  4MGI E;  2NS5 A;  3TCA A;  4CYE A;  4ZDV A;  3WAL A;  1YIW A;  2EKE C;  2MSE D;  3DVN V;  2M1M A;  5KHO A;  3DVG X;  1UBQ A;  2JXX A;  3HM3 A;  1LFD A;  2LRU A;  2DYB A;  2KKC A;  4OVV A;  4FJZ A;  4ZRI A;  1UD7 A;  2IYD B;  2FAZ A;  4MGY E;  3V60 A;  3AUL A;  3JVZ X;  4WWP A;  4F7Z A;  2PJH A;  1OTR B;  2AWT A;  3HIZ A;  2KLC A;  2RSU A;  4TQ0 A;  3L17 A;  3A9K B;  4J6I A;  1NDD A;  2XBB C;  2KQ7 A;  3VH3 B;  2PE6 B;  3NOB A;  2DEN B;  4ANU A;  1WGG A;  1WE6 A;  2G4D B;  2O6V A;  3DVN U;  2KTR A;  3V61 A;  2ZJD A;  3A4R A;  2LD9 A;  1BT0 A;  5D7G A;  5IAA C;  3TL5 A;  4JLC A;  4PS3 A;  3H7S A;  1WRD B;  2K6Q A;  4GU2 A;  3HM6 X;  3VDZ A;  3WIM A;  5L95 C;  1PQS A;  4BOS C;  1V49 A;  2KWV B;  3NZU A;  4MSQ B;  1OGW A;  2V1Y A;  3R66 C;  2D07 B;  2N9X A;  4GOC A;  2PPH A;  2GMI C;  3DBH I;  3PZD A;  3QQ8 B;  2D11 A;  4MEL A;  2KK8 A;  3MHS D;  1UZX B;  2CS4 A;  2O2V A;  1U4A A;  4DBG A;  1IYF A;  4FHK A;  2JVC A;  4IWO A;  4NAW B;  1WFY A;  2Z0E B;  3IFW B;  4IWQ A;  2BYE A;  3KUD B;  4RMA A;  4IG7 B;  3PRZ A;  4GN1 A;  2FCS A;  1E8X A;  4IM3 A;  4E3C A;  1VD2 A;  1WX9 A;  3QX1 A;  2KJH B;  3T8M A;  3S2A A;  4GIV A;  3NY5 A;  1WY8 A;  3PGE A;  1GC6 A;  3SU8 X;  4B6W A;  1WXA A;  1GJZ A;  2MQJ A;  2BKF A;  2KZR A;  2MBH A;  2RGF A;  4MJS A;  3WAM A;  2BWE S;  2V3S A;  3IHP C;  4ZRJ A;  2JPH A;  3EHV A;  4K7U A;  2UYZ B;  4XX5 A;  3VTU A;  4ANV A;  3GZN I;  4KZ0 A;  2MCN B;  3L13 A;  2W9N A;  3QA8 A;  2A4Z A;  3A1Q B;  5G55 A;  4AJW A;  2IO3 B;  4BFR A;  2C5L C;  4I6L B;  2MP2 B;  5JH5 C;  2LVP A;  3RZW C;  3SD5 A;  4GDL B;  4W9C A;  3ZRF A;  1C1Y B;  1TGZ B;  4IC7 B;  2PEA A;  3QHT A;  3APF A;  2KJR A;  1S1Q B;  4NAW A;  3ZNZ B;  2IZV B;  2KOX A;  1HE8 A;  3M62 B;  3ZO5 B;  1R4N I;  4ZYN A;  1LQB A;  2WX1 A;  1GC7 A;  4NJ6 A;  2BYF A;  1E5W A;  2NVU I;  4HDQ A;  3UQB A;  5DPR A;  5JHB A;  3WAP A;  5GMV A;  1RRB A;  1V9J A;  2JF5 A;  4ANW A;  1L7Y A;  4DK5 A;  4LDT D;  1I42 A;  4ICU A;  3R7Q A;  1EO6 A;  1E8W A;  5KHQ A;  2KWU B;  1YQB A;  4WJQ A;  4NQK E;  1K8R B;  2DZM A;  3PRE A;  4FBJ B;  4AWJ A;  1RLF A;  2WX0 A;  5LLI A;  3APD A;  2ZNV C;  4HK2 A;  3QWZ B;  2R2O A;  2PE9 A;  2NR2 A;  3AI5 A;  3M63 B;  2LZ6 A;  2K8B A;  2G4S A;  2KFK B;  2MP2 A;  3ECI A;  3H7P A;  3LJ3 A;  2KX3 A;  3TJP A;  4BBN C;  4BOZ B;  3EEC A;  5AZF A;  3ZNG C;  1V86 A;  4MGZ E;  3RD2 A;  1E7V A;  1XT9 B;  2AL3 A;  2MRP A;  3OJ3 A;  4HWI B;  2M17 A;  4K7S A;  1YJ1 A;  2N9P C;  4GGQ A;  5AZH A;  2JRH A;  2CU1 A;  3ZRC A;  5L83 A;  2G45 B;  2MBO A;  2KDF B;  2LAS A;  2ZCC A;  2IBI B;  2KDE B;  3DBL I;  3B08 A;  1Z2M A;  3PT2 B;  2LGD A;  3TIX A;  2N9E B;  3VHT C;  3V6C B;  3ZTC A;  1IP9 A;  4GXB A;  1ZGU B;  3KUC B;  2KDB A;  4KDL B;  2MWS B;  5DPT A;  2K6D B;  4GSW A;  3OLM D;  1GG3 A;  5CX3 A;  2EMS A;  2ZZP B;  4F8C B;  4EZJ A;  1WZ0 A;  4PS7 A;  4NJ7 A;  1WJU A;  3OJ4 B;  1L2N A;  2YVC A;  3PLU A;  4WQO B;  4RM8 A;  4MM3 A;  1EUV B;  1XD3 B;  4OVU A;  5JZE B;  3SHQ A;  1X1M A;  3K9O B;  2KJ6 A;  2MW5 A;  2CKH B;  5G2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...