2NS5A

The conserved n-terminal domain of par-3 adopts a novel pb1-like structure required for par-3 oligomerization and apical membrane localization
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
SEFKVTVCFGRTRVDVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Partitioning-defective 3 homolog
publication title The Par-3 NTD adopts a PB1-like structure required for Par-3 oligomerization and membrane localization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ns5A00
2JWZA 1CMXB 3QC8B 1RRBA 5HKHA 2NBWB 5C23A 1WI0A 3PTFC 1WM2A 4KV2A 3PZDA 4B6WA 1G6JA 4IUMB 5DPSA 1WYWB 2DZMA 1E5WA 4KZ0A 4ZDVA 2N7DA 3QCAA 1P98A 4PYZA 2KWVB 2EKEC 2KNBA 3APCA 4F8CB 1RLFA 2BGFA 4P7IA 2LVOA 3K9OB 3ML9A 2NPTA 2UWQA 1XT9B 1H8CA 1WGRA 3NZSA 3R3MA 2KLCA 4ANWA 1WZ0A 2LZ6A 2Y5BB 4IM2A 2KDIA 4LDTD 3ZW3A 4HCPB 5AZFA 3QX1A 3JYUA 4DWFA 4BKSA 2LVQA 3QJZA 4ICUA 4EZKA 1X1MA 4K81A 2DZKA 3H7SA 3WAOA 4HPMB 2GMIC 2JZZA 1V80A 5CHVC 1WGHA 2KXJA 2KC1A 3CSTA 2DYBA 5D6JB 2PEAA 4URKA 1J8CA 4I6LB 1WIAA 2D10A 2M0XA 3DBHI 2MBOA 2K8BA 2LUEA 4AWJA 3IHPC 1KM7A 4IWOA 4A3OA 1J0GA 3H6NA 2K8HA 5JZEB 2KTFA 4GOCA 2K8CA 2Z59B 4BOZB 1E8WA 2NR2A 1WRDB 3A4RA 4HDQA 2ZNVB 4JL9A 2G45B 2KX3A 4K7UA 4F1SA 3QIJA 2WYQA 4NQKE 5KHQA 2LVPA 2BWFA 2BYVE 4KSKC 4K1RB 4BKTA 2KMCA 2KDEB 1YIWA 1GG3A 3M62B 4CYEA 2GBKA 5LXIB 3W1SC 2D11A 4LJPB 4XX5A 1I42A 2J0MA 4HJKA 3V62A 2MBHA 4CHKA 3RCZA 1WXAA 4NAWB 2KKCA 2LXAA 1OEYA 4NPNA 1WY8A 1LM8B 3LJ3A 1OEYJ 3QWZB 1GUAB 4BVUC 4M8NA 2GBJA 2FCQA 1E8XA 4RMAA 1UELA 5G2NA 1WJNA 1WFYA 3CSFA 4FULA 4W9IA 3L10B 1K8RB 1OGWA 2J0KA 2J0JA 2MX2A 2D07B 3ZNZB 2NBVB 1WF9A 2L7RA 3T8MA 1YX5B 2V3SA 3Q3FA 2JXXA 1NI2A 2MCNB 3IG3A 2ASQA 2L00B 3VQIA 3PV1A 1WZ3A 2IO2B 1V5TA 2KFKB 5E6OA 4EUTA 2KJRA 1P9DU 3IVFA 4K7WA 1R4MI 4FHKA 4PYUA 2CR5A 3L08A 1FXTB 1IP9A 3TIXA 2V1YA 3HK0A 3UIPB 3VDZA 3ALBA 1UBIA 3AU5A 4I6PA 2MBEA 1F9JA 1RFAA 4EOYA 3UQAA 2HD5B 4GDKA 2DYMA 4HK2A 2NS5A 3ZTCA 3PHXB 3ZNGC 4AJWA 3ML8A 1P3QU 2KQ7A 2L05A 3NS8A 4EEWA 2PE6B 1HE8A 1V5OA 2D2QA 3PHWB 2MRPA 4GB9A 1GC6A 4OVVA 5JHBA 2UYZB 3ZO5B 5J17A 1UGMA 3A33B 4FLHA 1YQBA 1WJUA 2MLBA 4W9DA 3WAPA 1VCBA 2KTRB 4G11A 3ZRFA 4W9CA 1WR6E 4MJSB 1UD7A 2M4NA 3VXWA 2K1FA 3O65B 1E7VA 1ZGUB 2N4FA 4DHJD 3APFA 3HHMA 4JIOU 1WMHB 2IO3B 4GSWA 4I6NB 3TMPB 3EHVA 1GNUA 4WWPA 5TR5A 1E90A 4II3B 3VH4B 2IBIB 3VTUA 4FJYA 2EMSA 3A4SC 3L16A 2FIFA 3P2BA 2ZCBA 3L54A 4PS3A 4FA6A 3PSEB 2N7EA 5BO4B 3R7RA 2ZPYA 5DPWA 1Z5SB 2FAZA 3L13A 3V61A 3MJWA 4GXBA 2MP2B 5AZGA 3A9JA 1EF5A 3KYCD 4WWOA 3JSVA 3KUCB 3VTVA 3ZIMA 2C5LC 2PJHA 3B08A 3QARA 4B95A 2V4LA 3S2AA 3VUWA 5J18A 2C9WB 4HPLB 3H7PB 4A3PA 2KX0A 1A5RA 3NOBA 4EZLA 1S1QB 4XC2A 1TZ1A 3DBLI 3WANA 2N1WA 1EF1A 5CX3A 2IYDB 3X23A 2AYOB 4MGZE 3TL5A 2CKHB 4IM0A 2LGYA 3AULA 5L95C 1V6EA 1Q5WB 4F7ZA 2L76A 2LGDA 1Y8RC 4FHJA 1I35A 4MSQB 3EFUA 3V60A 3H9DA 3I3TB 4A20A 4ASWC 2N9EB 3A1QB 4TQ0A 1OTRB 2MW5A 2NBUA 4AUQC 3H1UA 4WJNA 2O2VA 3QAQA 2MBQA 4WJQA 3AXCA 3TBLD 2XK5A 4BBNC 4FBJB 3K9PB 3V6EB 2O6VB 2ZPNA 1IPGA 3DBSA 4WWNA 1XD3B 2BYFA 2WX0A 2N9XA 4K7SA 3ZNID 1AARA 4GN1A 4GDLA 4W9EA 3N3KB 3M95A 5D94A 1TTNA 1P1AA 2M17A 1L2NA 4NJ7A 1T0YA 2K39A 1WX7A 1WX9A 1WM3A 4KDIC 1JRUA 2FUHB 3KUZA 2KFKA 2MA9B 2KMAA 3GZNI 3RT3B 1XQQA 3APDA 2DAFA 3PVLA 1BT0A 4HXDA 4JGHB 1ZKHA 4W9FA 2C7MB 3BINA 1E8YA 4YL8A 2KOXA 4HDOA 4TQ1A 3ZDTA 2AL6A 2NVUI 2ZZPB 3JW0X 2JRHA 4AOFA 2JUOA 1V86A 2NPTB 3A9KB 5KHOA 3W1YA 2KZRA 4G0NB 2Z0DB 5D2MB 3OAWA 4E74A 1SGHA 2DZIA 2KC2A 4BOSC 1WE7A 1YX6B 5DCNA 4EFOA 1Q1OA 2KANA 1E7UA 2VRRB 3AU4A 3RZFA 5IA7A 2B3AA 3PT2B 1SIFA 1UH6A 4ZRIA 2MBBB 5CHWA 3TJPA 3VHTC 3ZKJC 4ANXA 4HWIB 2CHXA 3C0RB 2BWES 2ZVOA 1NBFC 2GOWA 4M0WB 2R2OA 3ZVVA 4BKGA 4DHZB 4IC7B 2K6DB 4WJOA 1V2YA 4MEMA 1WXSA 1VD2A 2ZEQA 3DQVA 1LXDA 1TGZB 5LXHA 2KVRA 4ANVA 1OQYA 2HJ8A 2J7QB 2FIDA 2LRWA 4IW0A 3PGEA 4B9KA 4BBNF 2KK8A 3DOWA 4TV3A 4AJYB 4MSMB 2GBNA 4KIKB 1UZXB 3L17A 4ZYNA 4W9KA 1ISNA 4KDLB 4NY0A 2XEWA 3VFKA 1V49A 2Z0EB 5AEKB 2WX1A 3PRPB 4GU2A 3SD5A 1ZW7A 2NCNA 5CHFA 4GIVA 5EDSA 3WIMA 1R4NI 1WJ4A 4MGIE 3V6CB 2N1VA 5C1ZA 2C7NB 3H7PA 1C1YB 4KSLC 3CF6E 3ZUNA 2JT4B 3MTNB 4TUUA 2KWCA 3DVGX 3VVWB 2BKFA 2N9PC 4LDTB 4W9JA 2FCNA 4IG7B 2IO1B 2GBMA 5G55A 4DBGA 4MGKE 1P0RA 1WGDA 5DPTA 2I1KA 2R2QA 1IYFA 1KLVA 3A1QA 1E8ZA 1KJTA 1UBQA 4M8MA 2M8SA 4E3CA 2KJHB 2BYEA 2WDTB 2ZCCA 2FCMA 2O6VA 4X57B 5IAAC 2KDFB 4CO7A 3GOEA 4NJ6A 3PREA 3RD2A 3VAWA 3ZDMC 2LJ5A 4RM9A 3WAMA 3AI5A 4GMVA 3L0WB 1YD8U 3RULA 1EO6A 3WA0A 3ONSA 4W9HA 4E71A 3T9LA 4HVBA 3DCGA 2LRUA 3PS6A 4MGYE 1WE6A 1V9JA 2KJ6A 3DVGY 3QHTA 4HCNB 4IM3A 3SDLC 4GDKB 5DPRA 2DX5B 5FR6A 3QQ8B 2KD0A 2W9NA 4RM8A 2M1MA 1PQSA 4NAWA 3EECA 1MG8A 3ENEA 2BKRB 3OJ3A 3EC8A 2YLMA 3ZLZA 2K6QA 1NDDA 2A4ZA 3JVZX 3A9KA 4BFRA 4MELA 5J2RA 3RUIB 2IO0B 2IY0B 2ZJDA 2JVCA 4PS7A 2CHWA 2G4SA 1WGYA 2YVCA 2AEHA 4LJOB 2DZJA 3SHQA 2G4DB 2C7HA 4W9LA 4G3XB 3W1SA 2KO3A 2K25A 4PS8A 2JY6A 2KFJA 2L3ZA 2ZNVC 1TBEA 2IY1B 2IZVB 4WQOB 5E6NA 3OJ4B 3MHSD 4GGQA 3UF8A 3PRMB 1WXMA 1D3ZA 3LDZE 2I1JA 4FADA 1C3TA 5JHAA 4FJVB 1EUVB 3VUYA 4XZ4A 3IFWB 3ECIA 4JQWC 2JPHA 4DXAB 4MH0E 2DHZA 1L7YA 2C60A 2EMTA 4ZRJA 3DBRI 2LI5A 3A9JB 4AP4C 2BPSA 3JSVB 4EZJA 2KLGA 1M94A 3IBEA 2REXA 1QZEA 2OOBB 4G50A 2MWSB 4ICVA 1WH3A 4IWPA 4KIKA 4OVUA 4II2B 4LCDE 5AZHA 1GJZA 3M3JA 1GC7A 1RAXA 2CHZA 3RYTA 3DVNV 1Z2MA 2RGFA 2A5UA 2RR9A 3VTWA 1V81A 3B1LX 1LQBA 3U30A 3DDCB 5L83A 2BF8B 3HM3A 2MSED 1LFDA 3BY4B 3KW5B 4W9GA 2LXCA 2DYOA 2GBRA 3PLUA 1H4RA 2KTRA 3NZUA 2O6VD 1KOTA 2KN5A 2L0TA 3PPAA 2DAJA 4MJSA 2ZVNA 2RPQA 1U4AA 3DPDA 3VUXA 2O2VB 5CTRC 4DDGD 1WMHA 2JRIB 4DHZE 3OLMD 4DK5A 4WJPA 2XK5B 4NNJB 3KH0A 3RZWC 2KHWB 1WJ6A 3NHEB 3ZRCA 2D3GA 2AWTA 4IWQA 2QHOA 2HTHA 3X0WA 2L8JA 2WWZA 2PE9A 4DHJB 4FN2A 3QK0A 3Q3JA 4GDLB 2RD0A 2LD9A 2HE7A 3CMMB 2RSUA 2L0FA 3DVNU 4JLCA 1WGGA 5LLIA 3TCAA 3PLVA 4EKUA 2LWPA 3M63B 2MP2A 2CU1A 3SU8X 4FJZA 3KUDB 3UQBA 4J6IA 2MQJA 3U8ZA 3NY5A 3U7DA 2JZ3B 3N30A 3N32A 3R66C 4MM3A 3HIZA 1SE9A 2XBBC 2KDBA 3HM6X 5D7GA 4BKSD 3B0AA 4NQLB 1WXVA 4KZCA 1S3SG 3WALA 2FNJB 3D32A 1J19A 4TKNA 1WX8A 2AL3A 1YJ1A 4DDID 3KVFB 2KWUB 2PPHA 3UINB 1WR1A 3UGBB 3ZNHB 2FCSA 1Q0WB 2OJRA 2LGXA 5GMVA 3VH3B 4ZRKA 3ZTDA 5E6PA 2G3QB 4N9F4 2KQSA 4MDKE 3UIOB 3QA8A 5JH5C 3R7QA 2DENB 4WAAA 2LASA 4HLEA 2CS4A 3KYDD 2JF5A 4ANUA 3PRZA 4KVGB
chains in the Genus database with same CATH superfamily
3QC8B 5HG2A 1MHXA 1RRBA 1I4QA 5C3JB 1WI0A 4KKJA 3PZDA 1N62A 4IUMB 3FAHA 1P98A 2FE8A 2K3UA 4PYZA 1EU4A 2KWVB 2EKEC 2KNBA 4P7IA 2NPTA 3UI3A 1XT9B 3R3MA 2KLCA 1L6UA 1KLUD 1JCKB 3JYUA 3AEDB 1F77A 1KH0A 4K81A 2V0GA 1NI3A 4XWTA 4HPMB 3CIRB 1WGHA 3CSTA 4URKA 5D6JB 3PZ7A 1SE3A 1PYWD 4A9AA 1KM7A 3E56A 5JZEB 2KTFA 3BK2A 1YJIA 3TEXA 2NMQA 2JXTA 2M56B 4HDQA 2ZNVB 2KX3A 4K7UA 4NQKE 5KHQA 2LVPA 3EUB2 1JWAD 1YQ3B 1JALA 4HJGE 1SB3C 1FFUA 5LXIB 4S0RA 1I42A 3Q8EA 1PDXA 3LJ3A 3QWZB 2GBJA 2KQ4X 3TEZA 4WAFA 1VZ8A 1K8RB 2I2YA 2L7RA 2BQQA 1SE2A 1XCQL 1NI2A 2ASQA 1TS5A 3PV1A 3J9CA 2DNFA 2IO2B 5E6OA 4EUTA 1P9DU 3IVFA 5LNK1 4FHKA 3NVWA 2CR5A 1GB1A 1F1HA 2V1YA 3UIPB 3AU5A 1TS2A 1F9JA 3DWMA 2AQ3B 3OG5A 1C79A 1JROA 3PHXB 3ML8A 1DGJA 1P3QU 1KFYB 2KQ7A 3NS8A 3VR8B 3TEWA 2D2QA 3PHWB 2MRPA 1SEBD 1A70A 2MJ3A 2QILA 1WJUA 1C78A 1YNTE 4G11A 1WR6E 1ZGUB 2N4FA 4DHJD 1IGCA 1WMHB 1ZDXA 4WWPA 1E90A 1XF5L 3A4SC 3L54A 2DWQA 1FM0D 3FILA 2ZPYA 1JWSD 2FAZA 2RDGA 3L13A 4GXBA 2MP2B 4A55A 3KYCD 2BB6A 3JSVA 2X8XX 3KUCB 1OQRA 2NTSA 4IOIE 1HXYD 2C9WB 2N9KA 3H7PB 1A5RA 4USAA 1VLBA 2WXLA 3WANA 1EF1A 4ZHOA 3TL5A 1Q5WB 2L76A 4FHJA 4YTMB 3H9DA 4TQ0A 2BVCA 3A1QB 3KWLA 4JX1C 2W55A 2LGIA 2O2VA 4WJNA 2MBQA 4WJQA 3K9PB 3V6EB 3DBSA 4WWNA 2INCC 3TUOA 5D94A 3M95A 1ZP0B 1P1AA 4NJ7A 1T0YA 2K39A 2KACA 4KDIC 2FUHB 2KFKA 1JWUD 3PVLA 1BT0A 4JGHB 1ZKHA 1DOXA 1E8YA 1CK1A 1RWSA 2INDC 1L0VB 4TQ1A 2ZZPB 3JW0X 1MJDA 4AOFA 2JUOA 2NPTB 4G0NB 4E74A 1SGHA 2DZIA 1YX6B 5DCNA 2KANA 3RZFA 2W3SA 1SE4A 4HWIB 3ZVVA 2R2OA 4BKGA 1C9FA 1V2YA 1WXSA 1VD2A 2ZEQA 1LXDA 2KVRA 2W3RA 4M01A 2FIDA 3EA6A 4MT5A 2PVOD 4B9KA 2ON8A 4TV3A 4KGTA 4MSMB 3AE4B 3Q3NC 1UZXB 1SJHD 3L17A 4ZYNA 3VRBB 1CQVA 1ISNA 1NYRA 3RNAC 1QOFA 4N59A 2PIAA 2Y5PA 3PRPB 4GU2A 4WIPA 3IAM1 3OWEB 2KT7A 4OVZA 1UNSA 1R4NI 4HRSA 4BZAA 2OEDA 1J7AA 2N1VA 5C1ZA 4XE0A 3N1YC 2QDFA 4LDTB 3SEBA 2ZW0A 1J7BA 4IG7B 2GBMA 5E6JA 1XO3A 5DPTA 4YSXB 2NTTA 2KJHB 2WDTB 2ZCCA 1N5XA 3B2FA 3PREA 1AYFA 3ZDMC 3WAMA 1JW9D 1CJEA 3ONSA 4W9HA 3DCGA 3PS6A 4MGYE 1SSNA 1V9JA 2Y3AA 2WXPA 1PQSA 2EKIA 3EECA 3W5VB 3ENEA 4L2YA 3EC8A 2YLMA 1YMHE 2QJLA 3SFDB 2JVCA 2CHWA 2G4DB 2C7HA 4W9LA 3W1SA 2K25A 1ENFA 4PS8A 2JY6A 2KFJA 1KRHA 5E6NA 3OJ4B 3AMZA 1FIQA 4FADA 2MEKA 5JHAA 1AN8A 3NRZA 3VUYA 4XZ4A 3VR9B 3NVYA 1L7YA 4OZCA 4ZRJA 3JSVB 1V1OA 1QZEA 4IWPA 2CJNA 2MWSB 3R2TA 4OVUA 1GJZA 4II2B 4PT5A 3M3JA 1RAXA 3DVNV 2A5UA 3VTWA 1V81A 2GB1A 3L4PA 3AECB 2MSED 3BWUD 3BY4B 4W9GA 2DYOA 2MHJA 2G9HD 1XLOA 1DOIA 1WSPA 2ZVNA 1U4AA 1UWMA 1FMAD 2O2VB 1I4XA 3OLMD 2QCZA 3KH0A 3BYTB 4IWQA 2HTHA 2PW9A 3QK0A 1QILA 2RSUA 3C19A 2XN9C 5HFYA 2CU1A 3SU8X 4FJZA 1QLBB 3UQBA 3U8ZA 5EE0A 3N30A 2BTEA 4MM3A 1UF0A 1SE9A 3HIZA 2RDBC 3HM6X 5D7GA 3B0AA 1RYJA 4TKNA 1L4ZB 2AL3A 1YJ1A 2KWUB 2PPHA 1WR1A 3ZNHB 3MHZA 4HPPA 4YSZB 4ZRKA 1T0SC 4MDKE 5JH5C 2LASA 2UU7A 1UWXA 3PRZA 1PGBA 5C23A 1WM2A 1G6JA 5DPSA 4YXDB 2DZMA 3P1MA 5FKAC 4KZ0A 1FNVA 1ZXHA 4R3DA 3RMKC 1SBBB 4ZDVA 3NVZA 4L23A 4K3CA 2BGFA 2WXJA 3ML9A 1VRAB 1WGRA 3NZSA 1WZ0A 3IAS1 1V1PA 2HTME 4LDTD 5AZFA 3W9CB 2WU2B 3DHIC 1EU3A 1X1MA 1ZXIA 3WAOA 2KAJA 3P4PB 2GMIC 2JZZA 1V80A 2KC1A 2B76B 3DBLB 2K8BA 4AWJA 4C4VB 2LFIA 3H6NA 1D4BA 4BOZB 2IDYA 4YT0B 4JL9A 2G45B 1V97A 2JX5A 1T5XD 4F1SA 3FC4A 2XNAC 1L6VA 1YIWA 1GG3A 3M62B 1TY2A 1FCLA 2KWDA 1HTQA 2D3AA 3W1SC 4XX5A 3V62A 2MBHA 2LXAA 1OEYA 4NPNA 1LM8B 1N60A 1OEYJ 5EE9A 4BVUC 2G1EA 5BYSA 3Q8BA 1WFYA 3CSFA 3Q8CA 4W9IA 2NBVB 2LUMA 4LNKA 3ZQ4A 4UDUC 2V3SA 1SF0A 2AQ1B 5BMIA 2JXXA 4RF1A 1MG4A 4PYUA 1FXTB 2D5GA 4NZLB 3HK0A 3T3OA 3VDZA 3ALBA 4P1BC 4I6PA 2I38A 3UQAA 1D5ZC 2HD5B 4GDKA 2NS5A 3DHHC 2L52A 2L05A 1M4VA 2PE6B 5JHBA 5J17A 1UGMA 4XDCA 3ZRFA 2QMTA 2K1FA 3C8YA 2IO3B 3TMPB 4YSYB 2K9XA 5EE3A 4FJYA 3AE3B 2EMSA 1FXAA 2FIFA 4P1CC 4PS3A 5BO4B 1WGKA 1GB4A 3R8BA 3MC0B 4JWSC 4YTNB 2R61A 1IUEA 1LO5D 3VTVA 2C5LC 3B08A 3QARA 4B95A 3S2AA 3VUWA 1ESFA 4MM3B 1SIJA 1I7HA 1VZ6A 4HPLB 5GXGB 2KX0A 4US9A 3NOBA 4M02A 4XC2A 1TZ1A 3SFEB 4MGZE 5HHDG 4IM0A 2LGYA 2LJIA 5L95C 4MSQB 4LTUA 3GE8C 3V60A 3I3TB 1MHHE 3HVZA 2N9EB 3AV8A 3KLSX 4AUQC 2JU6X 3H1UA 3BK1A 3ETRA 3QAQA 1CZPA 1KLGD 3N9YC 5H92C 3TBLD 4L1BA 1XD3B 2WX0A 3RNBC 4K7SA 4GDLA 3N3KB 3AN1A 1N5WA 2HJ1A 1WX7A 3RT3B 3KUZA 1XQQA 2DAFA 3B2GA 2LHDA 2KOXA 3NZ3A 4HDOA 2BT6A 3I63C 2Z0DB 4BOSC 2KC2A 1WE7A 1D5XC 1Q1OA 1NEKB 2VRRB 1UH6A 2WXQA 4ZRIA 5CHWA 5G5HA 1T0RC 2ZVOA 1C76A 1NBFC 3MC9A 4MEMA 1MPEA 4ANVA 3N1ZC 1FNUA 4RGTA 4XYCA 3AE9B 5T8IA 2GLSA 1E9MA 1V8CA 3URYA 2GBNA 3P4SB 4KIKB 1YQ4B 3U7ZA 4NY0A 3VFKA 2XEWA 4KGSA 3BVGA 2WX1A 2NCNA 5CHFA 2D3BA 2ICIA 5EDSA 1TYGB 4HKZE 1TS3A 3AE5B 1PUTA 2PKOA 4MGIE 3V6CB 4YWGG 4A90A 3GE3C 4KSLC 3Q14C 2JT4B 3MTNB 2OJWA 4RCOA 5I4DA 3DVGX 3VVWB 2BKFA 1FRRA 4ZHPA 1QOBA 4DBGA 4MGKE 1P0RA 2I1KA 1IYFA 1KLVA 1E8ZA 2KMMA 3KWVA 2WDRB 3LXFA 5AUIA 2V3NA 1C77A 2O6VA 2WLBA 1TT5B 5IAAC 4CO7A 4NJ6A 4RM9A 4GMVA 5H8YE 3ZJVA 3GP7A 3I57A 1JWMD 3RULA 1HEZE 2LRUA 1T6BX 4IM3A 1WE6A 2D3CA 2KJ6A 2LHEA 4GDKB 4RM8A 2W9NA 4WURA 2PMVA 4NAWA 1IBXB 1MG8A 4ARIA 5AUKA 3ZLZA 1GOZA 2K6QA 3A9KA 4BFRA 4MELA 4P6VF 3RUIB 1TY0A 1L0YB 5BMGA 4G3XB 2KO3A 2L3ZA 2WS3B 4WQOB 4M0WA 2DLBA 4GGQA 3UF8A 2X38A 1FRDA 1EUVB 3IFWB 1T0QC 4M00A 3U4EG 3P63A 3DBRI 2IPKD 4AP4C 3DBHB 2KLGA 1M94A 4G50A 4ICVA 3RYTA 3RNEC 5FR3A 3DBRB 2RGFA 2CU3A 1LQBA 1TKEA 3HM3A 1LFDA 2KDMA 2SEBD 3KW5B 4XWWA 3Q2AC 1NENB 1H4RA 2KTRA 3NZUA 1KOTA 2L0TA 4JPSA 2RPQA 4DDGD 5CTRC 4NNJB 3RZWC 3ZRCA 2D3GA 2AWTA 1ZUD2 3LYYA 2L1AA 4GDLB 2MH7A 4JWUC 2RD0A 2LD9A 2HE7A 3CMMB 4JLCA 1MVKA 1WGGA 3TCAA 3V05A 4KX6B 3PLVA 4EKUA 1BUIC 3BIID 1QQRA 2WXGA 1SXTA 4J6IA 3N32A 3NJTA 2XBBC 3BVMA 2WXFA 1LGRA 1WXVA 4OZBA 1QT9A 3WALA 1J19A 3KVFB 2H89B 1Q0WB 2LGXA 3VH3B 2JYTA 4N9F4 3UIOB 3QA8A 2DENB 4WAAA 4REZA 2BB5A 3KYDD 2JF5A 1JMLA 1CMXB 1YN5A 2QSDA 5HKHA 2NBWB 3PTFC 4KV2A 2K5PA 2V9HA 4MACA 4K3BA 1ACCA 1RLFA 2MJEA 2LVOA 1H8CA 1N63A 1ZE3D 5EE1A 2LZ6A 2Y5BB 4IM2A 2KDIA 3ZW3A 3KQ4A 4BKSA 2LVQA 3RNFC 3QJZA 4ICUA 4ZRQA 2DZKA 1I4PA 3ZXVA 2DYBA 2PEAA 1Y56A 5G5GA 1J8CA 3NS1A 2KVZA 2M0XA 2MBOA 2LUEA 3IHPC 3ZYYX 3FILB 4A3OA 5IO9A 2K8CA 2Z59B 4JE3B 4KGRA 3QIJA 2WYQA 2BWFA 4LNNA 2BYVE 4K1RB 4BKTA 1SJED 1HZ5A 3PZ8A 1VDVA 3ZXRA 4CYEA 4LJPB 3AEBB 4CHKA 3RCZA 1WXAA 4NAWB 2KKCA 4XDDA 1GUAB 4M8NA 2FCQA 1E8XA 1WJNA 3NUHB 4H2AA 1OGWA 4HEA1 3W2DA 2N7JA 2WXHA 3Q3FA 2MCNB 3VQIA 3IG3A 3MP9A 4DXGA 1WZ3A 1F2RI 2JQRB 2KFKB 4HROA 1QOAA 1IP9A 4ARCA 1QOGA 1HA5A 2MBEA 2IJ0A 1RFAA 2VH2A 3ZTCA 3ZNGC 4AJWA 4TSSA 3AEGB 4N58A 4EEWA 1HE8A 3A33B 4FLHA 1ROEA 4W9DA 1VCBA 2KTRB 4S17A 3VXWA 3O65B 3APFA 4JIOU 3HHMA 2V3PA 4GSWA 3IXSA 3EHVA 1GNUA 3VH4B 1BMLC 4II3B 3VTUA 3L16A 3P2BA 2ZCBA 1VZ7A 5IP4D 3PSEB 2N7EA 5DPWA 5D3DA 3A9JA 1EF5A 4ITKA 3VRAB 3Q8FA 2V4LA 3N20C 3AE2B 4RGOS 5J18A 1S1QB 3Q8AA 3DBLI 4LNFA 2N1WA 5CX3A 2IYDB 3X23A 3LB8C 3E9SA 4DXFA 2CKHB 2L83A 3AULA 2WXKA 4D2KA 4F7ZA 2LGDA 1I35A 1Y8RC 5JXVA 2K22A 3TSSA 4A20A 1OTRB 2MW5A 2NBUA 1MI0A 2XK5A 2ZPNA 3AM9A 1IPGA 4J3OD 4A8XC 1FEHA 2BYFA 3ZNID 1AARA 4GN1A 4AS1A 4W9EA 1I4GA 2M17A 2J53A 1TIFA 2E3TA 1L2NA 1ZOYB 1WX9A 1JRUA 2MA9B 2KMAA 3GZNI 4W9FA 2C7MB 3BINA 1K51A 1FPYA 2AL6A 2NVUI 3TEYA 3ZJUA 2JRHA 3GZNB 5KHOA 5IOIA 2KZRA 2WHIA 4GLSC 3OAWA 4EFOA 4OHJA 1E7UA 3AU4A 5IA7A 2B3AA 3PT2B 2MBBB 2LGSA 2BWES 4B0MA 2GOWA 3Q3MC 4DHZB 4IC7B 3I5JC 3RPFC 3V3XA 1TGZB 3SR6A 1OQYA 2J7QB 4IW0A 4LLGM 4XGAB 2KK8A 2YEPF 3W5UB 2IGHA 1UUPA 4W9KA 3NG0A 2Z0EB 2AQ2B 3SD5A 1ZW7A 3RNCC 4GIVA 1WJ4A 2C7NB 2M0AA 3H7PA 1ET9A 3ZUNA 1XLPA 2N9PC 4W9JA 2FCNA 5G55A 5IKCM 1JQ4A 2R2QA 2N9LA 3A1QA 1K50A 1I4RA 4FXCA 3MFGA 4C7ZA 2FCMA 4X57B 2EELA 2KDFB 3RD2A 3VAWA 3L0WB 4HKQA 4E71A 3T9LA 1JWBD 1RFKA 1YJJA 2PLPA 3SDLC 5DPRA 2DX5B 1C4CA 5FR6A 3QQ8B 2M1MA 1WRIA 3AE6B 2BKRB 3OJ3A 1NDDA 2A4ZA 3JVZX 3RFZB 1F0ZA 2G4SA 1GAQB 2ZNVC 2IY1B 2M19A 1N61A 4RNAA 3MHSD 4RGMA 3LDZE 2AX5A 2I1JA 1STEA 2VZKB 3ECIA 2BS3B 4DXAB 2DHZA 2C60A 2EMTA 3IT6B 4B0EA 4EE2A 2LI5A 3A9JB 1I4HA 3AE8B 5HI1A 1AW7A 2REXA 4RFBA 1GC7A 2WGSA 1V1PB 1RM6C 3U30A 3DDCB 5L83A 2BF8B 2Y5CA 5MPOA 2BW2A 3ZGZA 2GBRA 3PLUA 2JSVX 4ZRPA 3PPAA 4MJSA 4N6EB 2DBYA 3VUXA 3DPDA 4DK5A 4DHZE 4WJPA 2XK5B 3NHEB 2QHOA 2BS4B 2WWZA 2PE9A 2Z8LA 1L4DB 4FN2A 3Q3JA 3DVNU 2L0FA 1E6EB 4MH8A 2QIEB 3U52E 3BVZA 2WXNA 1R7SA 2MQJA 1D5MC 3NY5A 2JZ3B 3R66C 4C56C 2KDBA 4BKSD 1PGAA 4NQLB 2INNE 2RDHA 4KZCA 3AH7A 1S3SG 2FNJB 3BYYB 4C80A 4DDID 1WXQA 2PTLA 3UGBB 2QC8A 4O1NA 4RF0A 4ACFA 2OJRA 1XLNA 5GMVA 2GI9A 3ZTDA 2G3QB 3R7QA 2J4XA 4QAYA 3N1XC 4HLEA 2CS4A 2K0PA 2BBCA 4ANUA 2IGGA 2JWZA 1NVID 4TMAB 4BAXA 4B6WA 3T3NA 1WYWB 1E5WA 1J7CA 1YN3A 2N7DA 3QCAA 3APCA 4F8CB 3K9OB 1E0ZA 2UWQA 3B9JA 4ANWA 1E10A 4HCPB 3QX1A 4DWFA 4EZKA 4PK1A 3H7SA 5CHVC 2KXJA 2J52A 1XCTL 1HQRD 4I6LB 1WIAA 2D10A 3DBHI 3GB1A 3BZDB 1DOYA 1EWCA 4IWOA 1J0GA 2WDQB 2K8HA 4GOCA 1E8WA 3EFCA 1K53A 2NR2A 1WRDB 3NVVA 3A4RA 4CQNA 1JRPA 2ZW1A 4KSKC 2KMCA 2KDEB 3AEEB 2GBKA 4US8A 3ZJTA 2D11A 2J0MA 4HJKA 2OHFA 1WY8A 1C4PA 4RMAA 1UELA 3Q69A 5G2NA 1NYQA 1YN4A 1ZDVA 4FULA 3L10B 2J0KA 2J0JA 2MX2A 2D07B 3ZNZB 1WF9A 3T8MA 1EWYC 1YX5B 4IKGA 2VZKD 1BXTA 3P4RB 1DYQA 2L00B 4A6QA 1AWDA 1V5TA 2ONQA 1EM7A 2JYEA 2KJRA 4K7WA 1QF6A 1Q10A 1R4MI 3L08A 4OW0A 3WCQA 1HTOA 3TIXA 4Q2JA 1TJEA 1UBIA 4EOYA 1R4MB 2DYMA 4HK2A 1UGJA 1GPXA 2WXRA 2JZPA 1V5OA 4GB9A 1GC6A 4OVVA 2UYZB 3ZO5B 2WXOA 5FK9C 1YQBA 2MLBA 1K52A 3WAPA 4W9CA 4MJSB 1UD7A 2M4NA 1E7VA 1TKYA 1HZ6A 1R4NB 2FBWB 1L0XB 2BS2B 4YTPB 4I6NB 2WXMA 5TR5A 2IBIB 2WNMA 3AEFB 4IDIA 4FA6A 4C4VA 2IGDA 1D6EC 3R7RA 1Z5SB 3V61A 3MJWA 2CJOA 5AZGA 4WWOA 3ZIMA 2PJHA 5TSSA 2GRIA 3P4QB 5C2TB 1QKZA 4A3PA 4EZLA 4C00A 1FNWA 2WQYB 4NJCA 2AYOB 2WU5B 1V6EA 1OFFA 1VR9A 1C4AA 2H88B 3EFUA 1TKGA 1TS4A 2LMCA 4ASWC 1N6ZA 4BBNC 3AE1B 3AXCA 4FBJB 1ET6A 2O6VB 1FCCC 2N9XA 2MJDA 2BYTA 3MC8A 1TTNA 5BYQA 2TSSA 1OQQA 2KN4A 1WM3A 3APDA 4HXDA 1IGDA 3IT4B 3Q3OC 4YL8A 3ZDTA 3DHGC 3EGRA 2N0SB 1PFDA 1V86A 3A9KB 3W1YA 5D2MB 1SIFA 1KTKA 4LK0M 3TJPA 3VHTC 3ZKJC 4ANXA 2CHXA 3C0RB 4M0WB 2WDVB 2K6DB 4WJOA 1B1ZA 3I9V1 4WWMA 4RGNA 3DQVA 5LXHA 2HJ8A 1WWTA 4KKIA 2LRWA 1F2RC 2L32A 3PGEA 4BBNF 3DOWA 4AJYB 3CWIA 2INPE 4KDLB 1V49A 5AEKB 1L5PA 4WH4A 3WIMA 1XLQA 1C1YB 3CF6E 3Q6BA 4TUUA 2KWCA 2KYWA 2IO1B 1WGDA 1KJTA 1UBQA 2WP9B 4M8MA 2M8SA 2E6XA 4E3CA 2VH1A 2BYEA 3AB5A 3HRDD 3GOEA 2LJ5A 3AI5A 3PO0A 1YD8U 1EO6A 3WA0A 3GS2A 2WXIA 4P16A 4HVBA 1XXGA 4HCNB 3DVGY 2SAKA 3QHTA 1YOVB 2KD0A 1FFVA 5BMHA 3R2IA 1P7FA 3ABVB 5J2RA 2IO0B 2IY0B 2ZJDA 4PS7A 1FXIA 1WGYA 2YVCA 2AEHA 4LJOB 3U2SC 3RN9C 2DZJA 2RMMA 3SHQA 3RI7C 1TBEA 2IZVB 2HDEA 4LNOA 3PRMB 1WXMA 1D3ZA 1MFWA 3AEAB 1C3TA 4WQMA 2J42A 4FJVB 4JQWC 2JPHA 2LEKA 4MH0E 5D3IB 4C7YA 4ZYSA 2YEPB 2BPSA 4EZJA 3IBEA 2OOBB 2V4IB 5AZHA 1WH3A 4KIKA 3MJ5A 1WYGA 4LCDE 5IN7A 2CHZA 3HVDA 1Z2MA 2RR9A 2FUG1 4LNIA 1XEEA 2QEJC 3B1LX 3AE7B 4DQOC 2LXCA 2O6VD 2KN5A 2DAJA 3DWGC 1WMHA 2JRIB 2PVGC 2W54A 3RNGC 1FD6A 2KHWB 1WJ6A 2ACZB 4OZAA 3X0WA 2L8JA 4DHJB 1ZPSA 1P7EA 1TZOA 5LLIA 1VJKA 1E7PB 2LWPA 4AQ7A 3M63B 2MP2A 1F52A 3KUDB 1KF6B 4RH6A 3U7DA 1T3QA 3FKYA 3O13A 1PGXA 3D32A 3HUIA 1WX8A 5BYRA 1IBXA 2JWUA 3UINB 2FCSA 2Q5WD 1FO4A 1B9RA 4NAMA 5E6PA 2KQSA 2RPVA 3P42A 2W82A 3H8HA 4ZOHC 4KVGB
chains in the Genus database with same CATH topology
2JWZA 1CMXB 3QC8B 1RRBA 5HKHA 2NBWB 5C23A 1WI0A 3PTFC 1WM2A 4KV2A 3PZDA 4B6WA 1G6JA 4IUMB 5DPSA 1WYWB 2DZMA 1E5WA 4KZ0A 4ZDVA 2N7DA 3QCAA 1P98A 4PYZA 2KWVB 2EKEC 2KNBA 3APCA 4F8CB 1RLFA 2BGFA 4P7IA 2LVOA 3K9OB 3ML9A 2NPTA 2UWQA 1XT9B 1H8CA 1WGRA 3NZSA 3R3MA 2KLCA 4ANWA 1WZ0A 2LZ6A 2Y5BB 4IM2A 2KDIA 4LDTD 3ZW3A 4HCPB 5AZFA 3QX1A 3JYUA 4DWFA 4BKSA 2LVQA 3QJZA 4ICUA 4EZKA 1X1MA 4K81A 2DZKA 3H7SA 3WAOA 4HPMB 2GMIC 2JZZA 1V80A 5CHVC 1WGHA 2KXJA 2KC1A 3CSTA 2DYBA 5D6JB 2PEAA 4URKA 1J8CA 4I6LB 1WIAA 2D10A 2M0XA 3DBHI 2MBOA 2K8BA 2LUEA 4AWJA 3IHPC 1KM7A 4IWOA 4A3OA 1J0GA 3H6NA 2K8HA 5JZEB 2KTFA 4GOCA 2K8CA 2Z59B 4BOZB 1E8WA 2NR2A 1WRDB 3A4RA 4HDQA 2ZNVB 4JL9A 2G45B 2KX3A 4K7UA 4F1SA 3QIJA 2WYQA 4NQKE 5KHQA 2LVPA 2BWFA 2BYVE 4KSKC 4K1RB 4BKTA 2KMCA 2KDEB 1YIWA 1GG3A 3M62B 4CYEA 2GBKA 5LXIB 3W1SC 2D11A 4LJPB 4XX5A 1I42A 2J0MA 4HJKA 3V62A 2MBHA 4CHKA 3RCZA 1WXAA 4NAWB 2KKCA 2LXAA 1OEYA 4NPNA 1WY8A 1LM8B 3LJ3A 1OEYJ 3QWZB 1GUAB 4BVUC 4M8NA 2GBJA 2FCQA 1E8XA 4RMAA 1UELA 5G2NA 1WJNA 1WFYA 3CSFA 4FULA 4W9IA 3L10B 1K8RB 1OGWA 2J0KA 2J0JA 2MX2A 2D07B 3ZNZB 2NBVB 1WF9A 2L7RA 3T8MA 1YX5B 2V3SA 3Q3FA 2JXXA 1NI2A 2MCNB 3IG3A 2ASQA 2L00B 3VQIA 3PV1A 1WZ3A 2IO2B 1V5TA 2KFKB 5E6OA 4EUTA 2KJRA 1P9DU 3IVFA 4K7WA 1R4MI 4FHKA 4PYUA 2CR5A 3L08A 1FXTB 1IP9A 3TIXA 2V1YA 3HK0A 3UIPB 3VDZA 3ALBA 1UBIA 3AU5A 4I6PA 2MBEA 1F9JA 1RFAA 4EOYA 3UQAA 2HD5B 4GDKA 2DYMA 4HK2A 2NS5A 3ZTCA 3PHXB 3ZNGC 4AJWA 3ML8A 1P3QU 2KQ7A 2L05A 3NS8A 4EEWA 2PE6B 1HE8A 1V5OA 2D2QA 3PHWB 2MRPA 4GB9A 1GC6A 4OVVA 5JHBA 2UYZB 3ZO5B 5J17A 1UGMA 3A33B 4FLHA 1YQBA 1WJUA 2MLBA 4W9DA 3WAPA 1VCBA 2KTRB 4G11A 3ZRFA 4W9CA 1WR6E 4MJSB 1UD7A 2M4NA 3VXWA 2K1FA 3O65B 1E7VA 1ZGUB 2N4FA 4DHJD 3APFA 3HHMA 4JIOU 1WMHB 2IO3B 4GSWA 4I6NB 3TMPB 3EHVA 1GNUA 4WWPA 5TR5A 1E90A 4II3B 3VH4B 2IBIB 3VTUA 4FJYA 2EMSA 3A4SC 3L16A 2FIFA 3P2BA 2ZCBA 3L54A 4PS3A 4FA6A 3PSEB 2N7EA 5BO4B 3R7RA 2ZPYA 5DPWA 1Z5SB 2FAZA 3L13A 3V61A 3MJWA 4GXBA 2MP2B 5AZGA 3A9JA 1EF5A 3KYCD 4WWOA 3JSVA 3KUCB 3VTVA 3ZIMA 2C5LC 2PJHA 3B08A 3QARA 4B95A 2V4LA 3S2AA 3VUWA 5J18A 2C9WB 4HPLB 3H7PB 4A3PA 2KX0A 1A5RA 3NOBA 4EZLA 1S1QB 4XC2A 1TZ1A 3DBLI 3WANA 2N1WA 1EF1A 5CX3A 2IYDB 3X23A 2AYOB 4MGZE 3TL5A 2CKHB 4IM0A 2LGYA 3AULA 5L95C 1V6EA 1Q5WB 4F7ZA 2L76A 2LGDA 1Y8RC 4FHJA 1I35A 4MSQB 3EFUA 3V60A 3H9DA 3I3TB 4A20A 4ASWC 2N9EB 3A1QB 4TQ0A 1OTRB 2MW5A 2NBUA 4AUQC 3H1UA 4WJNA 2O2VA 3QAQA 2MBQA 4WJQA 3AXCA 3TBLD 2XK5A 4BBNC 4FBJB 3K9PB 3V6EB 2O6VB 2ZPNA 1IPGA 3DBSA 4WWNA 1XD3B 2BYFA 2WX0A 2N9XA 4K7SA 3ZNID 1AARA 4GN1A 4GDLA 4W9EA 3N3KB 3M95A 5D94A 1TTNA 1P1AA 2M17A 1L2NA 4NJ7A 1T0YA 2K39A 1WX7A 1WX9A 1WM3A 4KDIC 1JRUA 2FUHB 3KUZA 2KFKA 2MA9B 2KMAA 3GZNI 3RT3B 1XQQA 3APDA 2DAFA 3PVLA 1BT0A 4HXDA 4JGHB 1ZKHA 4W9FA 2C7MB 3BINA 1E8YA 4YL8A 2KOXA 4HDOA 4TQ1A 3ZDTA 2AL6A 2NVUI 2ZZPB 3JW0X 2JRHA 4AOFA 2JUOA 1V86A 2NPTB 3A9KB 5KHOA 3W1YA 2KZRA 4G0NB 2Z0DB 5D2MB 3OAWA 4E74A 1SGHA 2DZIA 2KC2A 4BOSC 1WE7A 1YX6B 5DCNA 4EFOA 1Q1OA 2KANA 1E7UA 2VRRB 3AU4A 3RZFA 5IA7A 2B3AA 3PT2B 1SIFA 1UH6A 4ZRIA 2MBBB 5CHWA 3TJPA 3VHTC 3ZKJC 4ANXA 4HWIB 2CHXA 3C0RB 2BWES 2ZVOA 1NBFC 2GOWA 4M0WB 2R2OA 3ZVVA 4BKGA 4DHZB 4IC7B 2K6DB 4WJOA 1V2YA 4MEMA 1WXSA 1VD2A 2ZEQA 3DQVA 1LXDA 1TGZB 5LXHA 2KVRA 4ANVA 1OQYA 2HJ8A 2J7QB 2FIDA 2LRWA 4IW0A 3PGEA 4B9KA 4BBNF 2KK8A 3DOWA 4TV3A 4AJYB 4MSMB 2GBNA 4KIKB 1UZXB 3L17A 4ZYNA 4W9KA 1ISNA 4KDLB 4NY0A 2XEWA 3VFKA 1V49A 2Z0EB 5AEKB 2WX1A 3PRPB 4GU2A 3SD5A 1ZW7A 2NCNA 5CHFA 4GIVA 5EDSA 3WIMA 1R4NI 1WJ4A 4MGIE 3V6CB 2N1VA 5C1ZA 2C7NB 3H7PA 1C1YB 4KSLC 3CF6E 3ZUNA 2JT4B 3MTNB 4TUUA 2KWCA 3DVGX 3VVWB 2BKFA 2N9PC 4LDTB 4W9JA 2FCNA 4IG7B 2IO1B 2GBMA 5G55A 4DBGA 4MGKE 1P0RA 1WGDA 5DPTA 2I1KA 2R2QA 1IYFA 1KLVA 3A1QA 1E8ZA 1KJTA 1UBQA 4M8MA 2M8SA 4E3CA 2KJHB 2BYEA 2WDTB 2ZCCA 2FCMA 2O6VA 4X57B 5IAAC 2KDFB 4CO7A 3GOEA 4NJ6A 3PREA 3RD2A 3VAWA 3ZDMC 2LJ5A 4RM9A 3WAMA 3AI5A 4GMVA 3L0WB 1YD8U 3RULA 1EO6A 3WA0A 3ONSA 4W9HA 4E71A 3T9LA 4HVBA 3DCGA 2LRUA 3PS6A 4MGYE 1WE6A 1V9JA 2KJ6A 3DVGY 3QHTA 4HCNB 4IM3A 3SDLC 4GDKB 5DPRA 2DX5B 5FR6A 3QQ8B 2KD0A 2W9NA 4RM8A 2M1MA 1PQSA 4NAWA 3EECA 1MG8A 3ENEA 2BKRB 3OJ3A 3EC8A 2YLMA 3ZLZA 2K6QA 1NDDA 2A4ZA 3JVZX 3A9KA 4BFRA 4MELA 5J2RA 3RUIB 2IO0B 2IY0B 2ZJDA 2JVCA 4PS7A 2CHWA 2G4SA 1WGYA 2YVCA 2AEHA 4LJOB 2DZJA 3SHQA 2G4DB 2C7HA 4W9LA 4G3XB 3W1SA 2KO3A 2K25A 4PS8A 2JY6A 2KFJA 2L3ZA 2ZNVC 1TBEA 2IY1B 2IZVB 4WQOB 5E6NA 3OJ4B 3MHSD 4GGQA 3UF8A 3PRMB 1WXMA 1D3ZA 3LDZE 2I1JA 4FADA 1C3TA 5JHAA 4FJVB 1EUVB 3VUYA 4XZ4A 3IFWB 3ECIA 4JQWC 2JPHA 4DXAB 4MH0E 2DHZA 1L7YA 2C60A 2EMTA 4ZRJA 3DBRI 2LI5A 3A9JB 4AP4C 2BPSA 3JSVB 4EZJA 2KLGA 1M94A 3IBEA 2REXA 1QZEA 2OOBB 4G50A 2MWSB 4ICVA 1WH3A 4IWPA 4KIKA 4OVUA 4II2B 4LCDE 5AZHA 1GJZA 3M3JA 1GC7A 1RAXA 2CHZA 3RYTA 3DVNV 1Z2MA 2RGFA 2A5UA 2RR9A 3VTWA 1V81A 3B1LX 1LQBA 3U30A 3DDCB 5L83A 2BF8B 3HM3A 2MSED 1LFDA 3BY4B 3KW5B 4W9GA 2LXCA 2DYOA 2GBRA 3PLUA 1H4RA 2KTRA 3NZUA 2O6VD 1KOTA 2KN5A 2L0TA 3PPAA 2DAJA 4MJSA 2ZVNA 2RPQA 1U4AA 3DPDA 3VUXA 2O2VB 5CTRC 4DDGD 1WMHA 2JRIB 4DHZE 3OLMD 4DK5A 4WJPA 2XK5B 4NNJB 3KH0A 3RZWC 2KHWB 1WJ6A 3NHEB 3ZRCA 2D3GA 2AWTA 4IWQA 2QHOA 2HTHA 3X0WA 2L8JA 2WWZA 2PE9A 4DHJB 4FN2A 3QK0A 3Q3JA 4GDLB 2RD0A 2LD9A 2HE7A 3CMMB 2RSUA 2L0FA 3DVNU 4JLCA 1WGGA 5LLIA 3TCAA 3PLVA 4EKUA 2LWPA 3M63B 2MP2A 2CU1A 3SU8X 4FJZA 3KUDB 3UQBA 4J6IA 2MQJA 3U8ZA 3NY5A 3U7DA 2JZ3B 3N30A 3N32A 3R66C 4MM3A 3HIZA 1SE9A 2XBBC 2KDBA 3HM6X 5D7GA 4BKSD 3B0AA 4NQLB 1WXVA 4KZCA 1S3SG 3WALA 2FNJB 3D32A 1J19A 4TKNA 1WX8A 2AL3A 1YJ1A 4DDID 3KVFB 2KWUB 2PPHA 3UINB 1WR1A 3UGBB 3ZNHB 2FCSA 1Q0WB 2OJRA 2LGXA 5GMVA 3VH3B 4ZRKA 3ZTDA 5E6PA 2G3QB 4N9F4 2KQSA 4MDKE 3UIOB 3QA8A 5JH5C 3R7QA 2DENB 4WAAA 2LASA 4HLEA 2CS4A 3KYDD 2JF5A 4ANUA 3PRZA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWZ A;  1CMX B;  3QC8 B;  1RRB A;  5HKH A;  2NBW B;  5C23 A;  1WI0 A;  3PTF C;  1WM2 A;  4KV2 A;  3PZD A;  4B6W A;  1G6J A;  4IUM B;  5DPS A;  1WYW B;  2DZM A;  1E5W A;  4KZ0 A;  4ZDV A;  2N7D A;  3QCA A;  1P98 A;  4PYZ A;  2KWV B;  2EKE C;  2KNB A;  3APC A;  4F8C B;  1RLF A;  2BGF A;  4P7I A;  2LVO A;  3K9O B;  3ML9 A;  2NPT A;  2UWQ A;  1XT9 B;  1H8C A;  1WGR A;  3NZS A;  3R3M A;  2KLC A;  4ANW A;  1WZ0 A;  2LZ6 A;  2Y5B B;  4IM2 A;  2KDI A;  4LDT D;  3ZW3 A;  4HCP B;  5AZF A;  3QX1 A;  3JYU A;  4DWF A;  4BKS A;  2LVQ A;  3QJZ A;  4ICU A;  4EZK A;  1X1M A;  4K81 A;  2DZK A;  3H7S A;  3WAO A;  4HPM B;  2GMI C;  2JZZ A;  1V80 A;  5CHV C;  1WGH A;  2KXJ A;  2KC1 A;  3CST A;  2DYB A;  5D6J B;  2PEA A;  4URK A;  1J8C A;  4I6L B;  1WIA A;  2D10 A;  2M0X A;  3DBH I;  2MBO A;  2K8B A;  2LUE A;  4AWJ A;  3IHP C;  1KM7 A;  4IWO A;  4A3O A;  1J0G A;  3H6N A;  2K8H A;  5JZE B;  2KTF A;  4GOC A;  2K8C A;  2Z59 B;  4BOZ B;  1E8W A;  2NR2 A;  1WRD B;  3A4R A;  4HDQ A;  2ZNV B;  4JL9 A;  2G45 B;  2KX3 A;  4K7U A;  4F1S A;  3QIJ A;  2WYQ A;  4NQK E;  5KHQ A;  2LVP A;  2BWF A;  2BYV E;  4KSK C;  4K1R B;  4BKT A;  2KMC A;  2KDE B;  1YIW A;  1GG3 A;  3M62 B;  4CYE A;  2GBK A;  5LXI B;  3W1S C;  2D11 A;  4LJP B;  4XX5 A;  1I42 A;  2J0M A;  4HJK A;  3V62 A;  2MBH A;  4CHK A;  3RCZ A;  1WXA A;  4NAW B;  2KKC A;  2LXA A;  1OEY A;  4NPN A;  1WY8 A;  1LM8 B;  3LJ3 A;  1OEY J;  3QWZ B;  1GUA B;  4BVU C;  4M8N A;  2GBJ A;  2FCQ A;  1E8X A;  4RMA A;  1UEL A;  5G2N A;  1WJN A;  1WFY A;  3CSF A;  4FUL A;  4W9I A;  3L10 B;  1K8R B;  1OGW A;  2J0K A;  2J0J A;  2MX2 A;  2D07 B;  3ZNZ B;  2NBV B;  1WF9 A;  2L7R A;  3T8M A;  1YX5 B;  2V3S A;  3Q3F A;  2JXX A;  1NI2 A;  2MCN B;  3IG3 A;  2ASQ A;  2L00 B;  3VQI A;  3PV1 A;  1WZ3 A;  2IO2 B;  1V5T A;  2KFK B;  5E6O A;  4EUT A;  2KJR A;  1P9D U;  3IVF A;  4K7W A;  1R4M I;  4FHK A;  4PYU A;  2CR5 A;  3L08 A;  1FXT B;  1IP9 A;  3TIX A;  2V1Y A;  3HK0 A;  3UIP B;  3VDZ A;  3ALB A;  1UBI A;  3AU5 A;  4I6P A;  2MBE A;  1F9J A;  1RFA A;  4EOY A;  3UQA A;  2HD5 B;  4GDK A;  2DYM A;  4HK2 A;  2NS5 A;  3ZTC A;  3PHX B;  3ZNG C;  4AJW A;  3ML8 A;  1P3Q U;  2KQ7 A;  2L05 A;  3NS8 A;  4EEW A;  2PE6 B;  1HE8 A;  1V5O A;  2D2Q A;  3PHW B;  2MRP A;  4GB9 A;  1GC6 A;  4OVV A;  5JHB A;  2UYZ B;  3ZO5 B;  5J17 A;  1UGM A;  3A33 B;  4FLH A;  1YQB A;  1WJU A;  2MLB A;  4W9D A;  3WAP A;  1VCB A;  2KTR B;  4G11 A;  3ZRF A;  4W9C A;  1WR6 E;  4MJS B;  1UD7 A;  2M4N A;  3VXW A;  2K1F A;  3O65 B;  1E7V A;  1ZGU B;  2N4F A;  4DHJ D;  3APF A;  3HHM A;  4JIO U;  1WMH B;  2IO3 B;  4GSW A;  4I6N B;  3TMP B;  3EHV A;  1GNU A;  4WWP A;  5TR5 A;  1E90 A;  4II3 B;  3VH4 B;  2IBI B;  3VTU A;  4FJY A;  2EMS A;  3A4S C;  3L16 A;  2FIF A;  3P2B A;  2ZCB A;  3L54 A;  4PS3 A;  4FA6 A;  3PSE B;  2N7E A;  5BO4 B;  3R7R A;  2ZPY A;  5DPW A;  1Z5S B;  2FAZ A;  3L13 A;  3V61 A;  3MJW A;  4GXB A;  2MP2 B;  5AZG A;  3A9J A;  1EF5 A;  3KYC D;  4WWO A;  3JSV A;  3KUC B;  3VTV A;  3ZIM A;  2C5L C;  2PJH A;  3B08 A;  3QAR A;  4B95 A;  2V4L A;  3S2A A;  3VUW A;  5J18 A;  2C9W B;  4HPL B;  3H7P B;  4A3P A;  2KX0 A;  1A5R A;  3NOB A;  4EZL A;  1S1Q B;  4XC2 A;  1TZ1 A;  3DBL I;  3WAN A;  2N1W A;  1EF1 A;  5CX3 A;  2IYD B;  3X23 A;  2AYO B;  4MGZ E;  3TL5 A;  2CKH B;  4IM0 A;  2LGY A;  3AUL A;  5L95 C;  1V6E A;  1Q5W B;  4F7Z A;  2L76 A;  2LGD A;  1Y8R C;  4FHJ A;  1I35 A;  4MSQ B;  3EFU A;  3V60 A;  3H9D A;  3I3T B;  4A20 A;  4ASW C;  2N9E B;  3A1Q B;  4TQ0 A;  1OTR B;  2MW5 A;  2NBU A;  4AUQ C;  3H1U A;  4WJN A;  2O2V A;  3QAQ A;  2MBQ A;  4WJQ A;  3AXC A;  3TBL D;  2XK5 A;  4BBN C;  4FBJ B;  3K9P B;  3V6E B;  2O6V B;  2ZPN A;  1IPG A;  3DBS A;  4WWN A;  1XD3 B;  2BYF A;  2WX0 A;  2N9X A;  4K7S A;  3ZNI D;  1AAR A;  4GN1 A;  4GDL A;  4W9E A;  3N3K B;  3M95 A;  5D94 A;  1TTN A;  1P1A A;  2M17 A;  1L2N A;  4NJ7 A;  1T0Y A;  2K39 A;  1WX7 A;  1WX9 A;  1WM3 A;  4KDI C;  1JRU A;  2FUH B;  3KUZ A;  2KFK A;  2MA9 B;  2KMA A;  3GZN I;  3RT3 B;  1XQQ A;  3APD A;  2DAF A;  3PVL A;  1BT0 A;  4HXD A;  4JGH B;  1ZKH A;  4W9F A;  2C7M B;  3BIN A;  1E8Y A;  4YL8 A;  2KOX A;  4HDO A;  4TQ1 A;  3ZDT A;  2AL6 A;  2NVU I;  2ZZP B;  3JW0 X;  2JRH A;  4AOF A;  2JUO A;  1V86 A;  2NPT B;  3A9K B;  5KHO A;  3W1Y A;  2KZR A;  4G0N B;  2Z0D B;  5D2M B;  3OAW A;  4E74 A;  1SGH A;  2DZI A;  2KC2 A;  4BOS C;  1WE7 A;  1YX6 B;  5DCN A;  4EFO A;  1Q1O A;  2KAN A;  1E7U A;  2VRR B;  3AU4 A;  3RZF A;  5IA7 A;  2B3A A;  3PT2 B;  1SIF A;  1UH6 A;  4ZRI A;  2MBB B;  5CHW A;  3TJP A;  3VHT C;  3ZKJ C;  4ANX A;  4HWI B;  2CHX A;  3C0R B;  2BWE S;  2ZVO A;  1NBF C;  2GOW A;  4M0W B;  2R2O A;  3ZVV A;  4BKG A;  4DHZ B;  4IC7 B;  2K6D B;  4WJO A;  1V2Y A;  4MEM A;  1WXS A;  1VD2 A;  2ZEQ A;  3DQV A;  1LXD A;  1TGZ B;  5LXH A;  2KVR A;  4ANV A;  1OQY A;  2HJ8 A;  2J7Q B;  2FID A;  2LRW A;  4IW0 A;  3PGE A;  4B9K A;  4BBN F;  2KK8 A;  3DOW A;  4TV3 A;  4AJY B;  4MSM B;  2GBN A;  4KIK B;  1UZX B;  3L17 A;  4ZYN A;  4W9K A;  1ISN A;  4KDL B;  4NY0 A;  2XEW A;  3VFK A;  1V49 A;  2Z0E B;  5AEK B;  2WX1 A;  3PRP B;  4GU2 A;  3SD5 A;  1ZW7 A;  2NCN A;  5CHF A;  4GIV A;  5EDS A;  3WIM A;  1R4N I;  1WJ4 A;  4MGI E;  3V6C B;  2N1V A;  5C1Z A;  2C7N B;  3H7P A;  1C1Y B;  4KSL C;  3CF6 E;  3ZUN A;  2JT4 B;  3MTN B;  4TUU A;  2KWC A;  3DVG X;  3VVW B;  2BKF A;  2N9P C;  4LDT B;  4W9J A;  2FCN A;  4IG7 B;  2IO1 B;  2GBM A;  5G55 A;  4DBG A;  4MGK E;  1P0R A;  1WGD A;  5DPT A;  2I1K A;  2R2Q A;  1IYF A;  1KLV A;  3A1Q A;  1E8Z A;  1KJT A;  1UBQ A;  4M8M A;  2M8S A;  4E3C A;  2KJH B;  2BYE A;  2WDT B;  2ZCC A;  2FCM A;  2O6V A;  4X57 B;  5IAA C;  2KDF B;  4CO7 A;  3GOE A;  4NJ6 A;  3PRE A;  3RD2 A;  3VAW A;  3ZDM C;  2LJ5 A;  4RM9 A;  3WAM A;  3AI5 A;  4GMV A;  3L0W B;  1YD8 U;  3RUL A;  1EO6 A;  3WA0 A;  3ONS A;  4W9H A;  4E71 A;  3T9L A;  4HVB A;  3DCG A;  2LRU A;  3PS6 A;  4MGY E;  1WE6 A;  1V9J A;  2KJ6 A;  3DVG Y;  3QHT A;  4HCN B;  4IM3 A;  3SDL C;  4GDK B;  5DPR A;  2DX5 B;  5FR6 A;  3QQ8 B;  2KD0 A;  2W9N A;  4RM8 A;  2M1M A;  1PQS A;  4NAW A;  3EEC A;  1MG8 A;  3ENE A;  2BKR B;  3OJ3 A;  3EC8 A;  2YLM A;  3ZLZ A;  2K6Q A;  1NDD A;  2A4Z A;  3JVZ X;  3A9K A;  4BFR A;  4MEL A;  5J2R A;  3RUI B;  2IO0 B;  2IY0 B;  2ZJD A;  2JVC A;  4PS7 A;  2CHW A;  2G4S A;  1WGY A;  2YVC A;  2AEH A;  4LJO B;  2DZJ A;  3SHQ A;  2G4D B;  2C7H A;  4W9L A;  4G3X B;  3W1S A;  2KO3 A;  2K25 A;  4PS8 A;  2JY6 A;  2KFJ A;  2L3Z A;  2ZNV C;  1TBE A;  2IY1 B;  2IZV B;  4WQO B;  5E6N A;  3OJ4 B;  3MHS D;  4GGQ A;  3UF8 A;  3PRM B;  1WXM A;  1D3Z A;  3LDZ E;  2I1J A;  4FAD A;  1C3T A;  5JHA A;  4FJV B;  1EUV B;  3VUY A;  4XZ4 A;  3IFW B;  3ECI A;  4JQW C;  2JPH A;  4DXA B;  4MH0 E;  2DHZ A;  1L7Y A;  2C60 A;  2EMT A;  4ZRJ A;  3DBR I;  2LI5 A;  3A9J B;  4AP4 C;  2BPS A;  3JSV B;  4EZJ A;  2KLG A;  1M94 A;  3IBE A;  2REX A;  1QZE A;  2OOB B;  4G50 A;  2MWS B;  4ICV A;  1WH3 A;  4IWP A;  4KIK A;  4OVU A;  4II2 B;  4LCD E;  5AZH A;  1GJZ A;  3M3J A;  1GC7 A;  1RAX A;  2CHZ A;  3RYT A;  3DVN V;  1Z2M A;  2RGF A;  2A5U A;  2RR9 A;  3VTW A;  1V81 A;  3B1L X;  1LQB A;  3U30 A;  3DDC B;  5L83 A;  2BF8 B;  3HM3 A;  2MSE D;  1LFD A;  3BY4 B;  3KW5 B;  4W9G A;  2LXC A;  2DYO A;  2GBR A;  3PLU A;  1H4R A;  2KTR A;  3NZU A;  2O6V D;  1KOT A;  2KN5 A;  2L0T A;  3PPA A;  2DAJ A;  4MJS A;  2ZVN A;  2RPQ A;  1U4A A;  3DPD A;  3VUX A;  2O2V B;  5CTR C;  4DDG D;  1WMH A;  2JRI B;  4DHZ E;  3OLM D;  4DK5 A;  4WJP A;  2XK5 B;  4NNJ B;  3KH0 A;  3RZW C;  2KHW B;  1WJ6 A;  3NHE B;  3ZRC A;  2D3G A;  2AWT A;  4IWQ A;  2QHO A;  2HTH A;  3X0W A;  2L8J A;  2WWZ A;  2PE9 A;  4DHJ B;  4FN2 A;  3QK0 A;  3Q3J A;  4GDL B;  2RD0 A;  2LD9 A;  2HE7 A;  3CMM B;  2RSU A;  2L0F A;  3DVN U;  4JLC A;  1WGG A;  5LLI A;  3TCA A;  3PLV A;  4EKU A;  2LWP A;  3M63 B;  2MP2 A;  2CU1 A;  3SU8 X;  4FJZ A;  3KUD B;  3UQB A;  4J6I A;  2MQJ A;  3U8Z A;  3NY5 A;  3U7D A;  2JZ3 B;  3N30 A;  3N32 A;  3R66 C;  4MM3 A;  3HIZ A;  1SE9 A;  2XBB C;  2KDB A;  3HM6 X;  5D7G A;  4BKS D;  3B0A A;  4NQL B;  1WXV A;  4KZC A;  1S3S G;  3WAL A;  2FNJ B;  3D32 A;  1J19 A;  4TKN A;  1WX8 A;  2AL3 A;  1YJ1 A;  4DDI D;  3KVF B;  2KWU B;  2PPH A;  3UIN B;  1WR1 A;  3UGB B;  3ZNH B;  2FCS A;  1Q0W B;  2OJR A;  2LGX A;  5GMV A;  3VH3 B;  4ZRK A;  3ZTD A;  5E6P A;  2G3Q B;  4N9F 4;  2KQS A;  4MDK E;  3UIO B;  3QA8 A;  5JH5 C;  3R7Q A;  2DEN B;  4WAA A;  2LAS A;  4HLE A;  2CS4 A;  3KYD D;  2JF5 A;  4ANU A;  3PRZ A;  4KVG B; 
#chains in the Genus database with same CATH topology
 3QC8 B;  5HG2 A;  1MHX A;  1RRB A;  1I4Q A;  5C3J B;  1WI0 A;  4KKJ A;  3PZD A;  1N62 A;  4IUM B;  3FAH A;  1P98 A;  2FE8 A;  2K3U A;  4PYZ A;  1EU4 A;  2KWV B;  2EKE C;  2KNB A;  4P7I A;  2NPT A;  3UI3 A;  1XT9 B;  3R3M A;  2KLC A;  1L6U A;  1KLU D;  1JCK B;  3JYU A;  3AED B;  1F77 A;  1KH0 A;  4K81 A;  2V0G A;  1NI3 A;  4XWT A;  4HPM B;  3CIR B;  1WGH A;  3CST A;  4URK A;  5D6J B;  3PZ7 A;  1SE3 A;  1PYW D;  4A9A A;  1KM7 A;  3E56 A;  5JZE B;  2KTF A;  3BK2 A;  1YJI A;  3TEX A;  2NMQ A;  2JXT A;  2M56 B;  4HDQ A;  2ZNV B;  2KX3 A;  4K7U A;  4NQK E;  5KHQ A;  2LVP A;  3EUB 2;  1JWA D;  1YQ3 B;  1JAL A;  4HJG E;  1SB3 C;  1FFU A;  5LXI B;  4S0R A;  1I42 A;  3Q8E A;  1PDX A;  3LJ3 A;  3QWZ B;  2GBJ A;  2KQ4 X;  3TEZ A;  4WAF A;  1VZ8 A;  1K8R B;  2I2Y A;  2L7R A;  2BQQ A;  1SE2 A;  1XCQ L;  1NI2 A;  2ASQ A;  1TS5 A;  3PV1 A;  3J9C A;  2DNF A;  2IO2 B;  5E6O A;  4EUT A;  1P9D U;  3IVF A;  5LNK 1;  4FHK A;  3NVW A;  2CR5 A;  1GB1 A;  1F1H A;  2V1Y A;  3UIP B;  3AU5 A;  1TS2 A;  1F9J A;  3DWM A;  2AQ3 B;  3OG5 A;  1C79 A;  1JRO A;  3PHX B;  3ML8 A;  1DGJ A;  1P3Q U;  1KFY B;  2KQ7 A;  3NS8 A;  3VR8 B;  3TEW A;  2D2Q A;  3PHW B;  2MRP A;  1SEB D;  1A70 A;  2MJ3 A;  2QIL A;  1WJU A;  1C78 A;  1YNT E;  4G11 A;  1WR6 E;  1ZGU B;  2N4F A;  4DHJ D;  1IGC A;  1WMH B;  1ZDX A;  4WWP A;  1E90 A;  1XF5 L;  3A4S C;  3L54 A;  2DWQ A;  1FM0 D;  3FIL A;  2ZPY A;  1JWS D;  2FAZ A;  2RDG A;  3L13 A;  4GXB A;  2MP2 B;  4A55 A;  3KYC D;  2BB6 A;  3JSV A;  2X8X X;  3KUC B;  1OQR A;  2NTS A;  4IOI E;  1HXY D;  2C9W B;  2N9K A;  3H7P B;  1A5R A;  4USA A;  1VLB A;  2WXL A;  3WAN A;  1EF1 A;  4ZHO A;  3TL5 A;  1Q5W B;  2L76 A;  4FHJ A;  4YTM B;  3H9D A;  4TQ0 A;  2BVC A;  3A1Q B;  3KWL A;  4JX1 C;  2W55 A;  2LGI A;  2O2V A;  4WJN A;  2MBQ A;  4WJQ A;  3K9P B;  3V6E B;  3DBS A;  4WWN A;  2INC C;  3TUO A;  5D94 A;  3M95 A;  1ZP0 B;  1P1A A;  4NJ7 A;  1T0Y A;  2K39 A;  2KAC A;  4KDI C;  2FUH B;  2KFK A;  1JWU D;  3PVL A;  1BT0 A;  4JGH B;  1ZKH A;  1DOX A;  1E8Y A;  1CK1 A;  1RWS A;  2IND C;  1L0V B;  4TQ1 A;  2ZZP B;  3JW0 X;  1MJD A;  4AOF A;  2JUO A;  2NPT B;  4G0N B;  4E74 A;  1SGH A;  2DZI A;  1YX6 B;  5DCN A;  2KAN A;  3RZF A;  2W3S A;  1SE4 A;  4HWI B;  3ZVV A;  2R2O A;  4BKG A;  1C9F A;  1V2Y A;  1WXS A;  1VD2 A;  2ZEQ A;  1LXD A;  2KVR A;  2W3R A;  4M01 A;  2FID A;  3EA6 A;  4MT5 A;  2PVO D;  4B9K A;  2ON8 A;  4TV3 A;  4KGT A;  4MSM B;  3AE4 B;  3Q3N C;  1UZX B;  1SJH D;  3L17 A;  4ZYN A;  3VRB B;  1CQV A;  1ISN A;  1NYR A;  3RNA C;  1QOF A;  4N59 A;  2PIA A;  2Y5P A;  3PRP B;  4GU2 A;  4WIP A;  3IAM 1;  3OWE B;  2KT7 A;  4OVZ A;  1UNS A;  1R4N I;  4HRS A;  4BZA A;  2OED A;  1J7A A;  2N1V A;  5C1Z A;  4XE0 A;  3N1Y C;  2QDF A;  4LDT B;  3SEB A;  2ZW0 A;  1J7B A;  4IG7 B;  2GBM A;  5E6J A;  1XO3 A;  5DPT A;  4YSX B;  2NTT A;  2KJH B;  2WDT B;  2ZCC A;  1N5X A;  3B2F A;  3PRE A;  1AYF A;  3ZDM C;  3WAM A;  1JW9 D;  1CJE A;  3ONS A;  4W9H A;  3DCG A;  3PS6 A;  4MGY E;  1SSN A;  1V9J A;  2Y3A A;  2WXP A;  1PQS A;  2EKI A;  3EEC A;  3W5V B;  3ENE A;  4L2Y A;  3EC8 A;  2YLM A;  1YMH E;  2QJL A;  3SFD B;  2JVC A;  2CHW A;  2G4D B;  2C7H A;  4W9L A;  3W1S A;  2K25 A;  1ENF A;  4PS8 A;  2JY6 A;  2KFJ A;  1KRH A;  5E6N A;  3OJ4 B;  3AMZ A;  1FIQ A;  4FAD A;  2MEK A;  5JHA A;  1AN8 A;  3NRZ A;  3VUY A;  4XZ4 A;  3VR9 B;  3NVY A;  1L7Y A;  4OZC A;  4ZRJ A;  3JSV B;  1V1O A;  1QZE A;  4IWP A;  2CJN A;  2MWS B;  3R2T A;  4OVU A;  1GJZ A;  4II2 B;  4PT5 A;  3M3J A;  1RAX A;  3DVN V;  2A5U A;  3VTW A;  1V81 A;  2GB1 A;  3L4P A;  3AEC B;  2MSE D;  3BWU D;  3BY4 B;  4W9G A;  2DYO A;  2MHJ A;  2G9H D;  1XLO A;  1DOI A;  1WSP A;  2ZVN A;  1U4A A;  1UWM A;  1FMA D;  2O2V B;  1I4X A;  3OLM D;  2QCZ A;  3KH0 A;  3BYT B;  4IWQ A;  2HTH A;  2PW9 A;  3QK0 A;  1QIL A;  2RSU A;  3C19 A;  2XN9 C;  5HFY A;  2CU1 A;  3SU8 X;  4FJZ A;  1QLB B;  3UQB A;  3U8Z A;  5EE0 A;  3N30 A;  2BTE A;  4MM3 A;  1UF0 A;  1SE9 A;  3HIZ A;  2RDB C;  3HM6 X;  5D7G A;  3B0A A;  1RYJ A;  4TKN A;  1L4Z B;  2AL3 A;  1YJ1 A;  2KWU B;  2PPH A;  1WR1 A;  3ZNH B;  3MHZ A;  4HPP A;  4YSZ B;  4ZRK A;  1T0S C;  4MDK E;  5JH5 C;  2LAS A;  2UU7 A;  1UWX A;  3PRZ A;  1PGB A;  5C23 A;  1WM2 A;  1G6J A;  5DPS A;  4YXD B;  2DZM A;  3P1M A;  5FKA C;  4KZ0 A;  1FNV A;  1ZXH A;  4R3D A;  3RMK C;  1SBB B;  4ZDV A;  3NVZ A;  4L23 A;  4K3C A;  2BGF A;  2WXJ A;  3ML9 A;  1VRA B;  1WGR A;  3NZS A;  1WZ0 A;  3IAS 1;  1V1P A;  2HTM E;  4LDT D;  5AZF A;  3W9C B;  2WU2 B;  3DHI C;  1EU3 A;  1X1M A;  1ZXI A;  3WAO A;  2KAJ A;  3P4P B;  2GMI C;  2JZZ A;  1V80 A;  2KC1 A;  2B76 B;  3DBL B;  2K8B A;  4AWJ A;  4C4V B;  2LFI A;  3H6N A;  1D4B A;  4BOZ B;  2IDY A;  4YT0 B;  4JL9 A;  2G45 B;  1V97 A;  2JX5 A;  1T5X D;  4F1S A;  3FC4 A;  2XNA C;  1L6V A;  1YIW A;  1GG3 A;  3M62 B;  1TY2 A;  1FCL A;  2KWD A;  1HTQ A;  2D3A A;  3W1S C;  4XX5 A;  3V62 A;  2MBH A;  2LXA A;  1OEY A;  4NPN A;  1LM8 B;  1N60 A;  1OEY J;  5EE9 A;  4BVU C;  2G1E A;  5BYS A;  3Q8B A;  1WFY A;  3CSF A;  3Q8C A;  4W9I A;  2NBV B;  2LUM A;  4LNK A;  3ZQ4 A;  4UDU C;  2V3S A;  1SF0 A;  2AQ1 B;  5BMI A;  2JXX A;  4RF1 A;  1MG4 A;  4PYU A;  1FXT B;  2D5G A;  4NZL B;  3HK0 A;  3T3O A;  3VDZ A;  3ALB A;  4P1B C;  4I6P A;  2I38 A;  3UQA A;  1D5Z C;  2HD5 B;  4GDK A;  2NS5 A;  3DHH C;  2L52 A;  2L05 A;  1M4V A;  2PE6 B;  5JHB A;  5J17 A;  1UGM A;  4XDC A;  3ZRF A;  2QMT A;  2K1F A;  3C8Y A;  2IO3 B;  3TMP B;  4YSY B;  2K9X A;  5EE3 A;  4FJY A;  3AE3 B;  2EMS A;  1FXA A;  2FIF A;  4P1C C;  4PS3 A;  5BO4 B;  1WGK A;  1GB4 A;  3R8B A;  3MC0 B;  4JWS C;  4YTN B;  2R61 A;  1IUE A;  1LO5 D;  3VTV A;  2C5L C;  3B08 A;  3QAR A;  4B95 A;  3S2A A;  3VUW A;  1ESF A;  4MM3 B;  1SIJ A;  1I7H A;  1VZ6 A;  4HPL B;  5GXG B;  2KX0 A;  4US9 A;  3NOB A;  4M02 A;  4XC2 A;  1TZ1 A;  3SFE B;  4MGZ E;  5HHD G;  4IM0 A;  2LGY A;  2LJI A;  5L95 C;  4MSQ B;  4LTU A;  3GE8 C;  3V60 A;  3I3T B;  1MHH E;  3HVZ A;  2N9E B;  3AV8 A;  3KLS X;  4AUQ C;  2JU6 X;  3H1U A;  3BK1 A;  3ETR A;  3QAQ A;  1CZP A;  1KLG D;  3N9Y C;  5H92 C;  3TBL D;  4L1B A;  1XD3 B;  2WX0 A;  3RNB C;  4K7S A;  4GDL A;  3N3K B;  3AN1 A;  1N5W A;  2HJ1 A;  1WX7 A;  3RT3 B;  3KUZ A;  1XQQ A;  2DAF A;  3B2G A;  2LHD A;  2KOX A;  3NZ3 A;  4HDO A;  2BT6 A;  3I63 C;  2Z0D B;  4BOS C;  2KC2 A;  1WE7 A;  1D5X C;  1Q1O A;  1NEK B;  2VRR B;  1UH6 A;  2WXQ A;  4ZRI A;  5CHW A;  5G5H A;  1T0R C;  2ZVO A;  1C76 A;  1NBF C;  3MC9 A;  4MEM A;  1MPE A;  4ANV A;  3N1Z C;  1FNU A;  4RGT A;  4XYC A;  3AE9 B;  5T8I A;  2GLS A;  1E9M A;  1V8C A;  3URY A;  2GBN A;  3P4S B;  4KIK B;  1YQ4 B;  3U7Z A;  4NY0 A;  3VFK A;  2XEW A;  4KGS A;  3BVG A;  2WX1 A;  2NCN A;  5CHF A;  2D3B A;  2ICI A;  5EDS A;  1TYG B;  4HKZ E;  1TS3 A;  3AE5 B;  1PUT A;  2PKO A;  4MGI E;  3V6C B;  4YWG G;  4A90 A;  3GE3 C;  4KSL C;  3Q14 C;  2JT4 B;  3MTN B;  2OJW A;  4RCO A;  5I4D A;  3DVG X;  3VVW B;  2BKF A;  1FRR A;  4ZHP A;  1QOB A;  4DBG A;  4MGK E;  1P0R A;  2I1K A;  1IYF A;  1KLV A;  1E8Z A;  2KMM A;  3KWV A;  2WDR B;  3LXF A;  5AUI A;  2V3N A;  1C77 A;  2O6V A;  2WLB A;  1TT5 B;  5IAA C;  4CO7 A;  4NJ6 A;  4RM9 A;  4GMV A;  5H8Y E;  3ZJV A;  3GP7 A;  3I57 A;  1JWM D;  3RUL A;  1HEZ E;  2LRU A;  1T6B X;  4IM3 A;  1WE6 A;  2D3C A;  2KJ6 A;  2LHE A;  4GDK B;  4RM8 A;  2W9N A;  4WUR A;  2PMV A;  4NAW A;  1IBX B;  1MG8 A;  4ARI A;  5AUK A;  3ZLZ A;  1GOZ A;  2K6Q A;  3A9K A;  4BFR A;  4MEL A;  4P6V F;  3RUI B;  1TY0 A;  1L0Y B;  5BMG A;  4G3X B;  2KO3 A;  2L3Z A;  2WS3 B;  4WQO B;  4M0W A;  2DLB A;  4GGQ A;  3UF8 A;  2X38 A;  1FRD A;  1EUV B;  3IFW B;  1T0Q C;  4M00 A;  3U4E G;  3P63 A;  3DBR I;  2IPK D;  4AP4 C;  3DBH B;  2KLG A;  1M94 A;  4G50 A;  4ICV A;  3RYT A;  3RNE C;  5FR3 A;  3DBR B;  2RGF A;  2CU3 A;  1LQB A;  1TKE A;  3HM3 A;  1LFD A;  2KDM A;  2SEB D;  3KW5 B;  4XWW A;  3Q2A C;  1NEN B;  1H4R A;  2KTR A;  3NZU A;  1KOT A;  2L0T A;  4JPS A;  2RPQ A;  4DDG D;  5CTR C;  4NNJ B;  3RZW C;  3ZRC A;  2D3G A;  2AWT A;  1ZUD 2;  3LYY A;  2L1A A;  4GDL B;  2MH7 A;  4JWU C;  2RD0 A;  2LD9 A;  2HE7 A;  3CMM B;  4JLC A;  1MVK A;  1WGG A;  3TCA A;  3V05 A;  4KX6 B;  3PLV A;  4EKU A;  1BUI C;  3BII D;  1QQR A;  2WXG A;  1SXT A;  4J6I A;  3N32 A;  3NJT A;  2XBB C;  3BVM A;  2WXF A;  1LGR A;  1WXV A;  4OZB A;  1QT9 A;  3WAL A;  1J19 A;  3KVF B;  2H89 B;  1Q0W B;  2LGX A;  3VH3 B;  2JYT A;  4N9F 4;  3UIO B;  3QA8 A;  2DEN B;  4WAA A;  4REZ A;  2BB5 A;  3KYD D;  2JF5 A;  1JML A;  1CMX B;  1YN5 A;  2QSD A;  5HKH A;  2NBW B;  3PTF C;  4KV2 A;  2K5P A;  2V9H A;  4MAC A;  4K3B A;  1ACC A;  1RLF A;  2MJE A;  2LVO A;  1H8C A;  1N63 A;  1ZE3 D;  5EE1 A;  2LZ6 A;  2Y5B B;  4IM2 A;  2KDI A;  3ZW3 A;  3KQ4 A;  4BKS A;  2LVQ A;  3RNF C;  3QJZ A;  4ICU A;  4ZRQ A;  2DZK A;  1I4P A;  3ZXV A;  2DYB A;  2PEA A;  1Y56 A;  5G5G A;  1J8C A;  3NS1 A;  2KVZ A;  2M0X A;  2MBO A;  2LUE A;  3IHP C;  3ZYY X;  3FIL B;  4A3O A;  5IO9 A;  2K8C A;  2Z59 B;  4JE3 B;  4KGR A;  3QIJ A;  2WYQ A;  2BWF A;  4LNN A;  2BYV E;  4K1R B;  4BKT A;  1SJE D;  1HZ5 A;  3PZ8 A;  1VDV A;  3ZXR A;  4CYE A;  4LJP B;  3AEB B;  4CHK A;  3RCZ A;  1WXA A;  4NAW B;  2KKC A;  4XDD A;  1GUA B;  4M8N A;  2FCQ A;  1E8X A;  1WJN A;  3NUH B;  4H2A A;  1OGW A;  4HEA 1;  3W2D A;  2N7J A;  2WXH A;  3Q3F A;  2MCN B;  3VQI A;  3IG3 A;  3MP9 A;  4DXG A;  1WZ3 A;  1F2R I;  2JQR B;  2KFK B;  4HRO A;  1QOA A;  1IP9 A;  4ARC A;  1QOG A;  1HA5 A;  2MBE A;  2IJ0 A;  1RFA A;  2VH2 A;  3ZTC A;  3ZNG C;  4AJW A;  4TSS A;  3AEG B;  4N58 A;  4EEW A;  1HE8 A;  3A33 B;  4FLH A;  1ROE A;  4W9D A;  1VCB A;  2KTR B;  4S17 A;  3VXW A;  3O65 B;  3APF A;  4JIO U;  3HHM A;  2V3P A;  4GSW A;  3IXS A;  3EHV A;  1GNU A;  3VH4 B;  1BML C;  4II3 B;  3VTU A;  3L16 A;  3P2B A;  2ZCB A;  1VZ7 A;  5IP4 D;  3PSE B;  2N7E A;  5DPW A;  5D3D A;  3A9J A;  1EF5 A;  4ITK A;  3VRA B;  3Q8F A;  2V4L A;  3N20 C;  3AE2 B;  4RGO S;  5J18 A;  1S1Q B;  3Q8A A;  3DBL I;  4LNF A;  2N1W A;  5CX3 A;  2IYD B;  3X23 A;  3LB8 C;  3E9S A;  4DXF A;  2CKH B;  2L83 A;  3AUL A;  2WXK A;  4D2K A;  4F7Z A;  2LGD A;  1I35 A;  1Y8R C;  5JXV A;  2K22 A;  3TSS A;  4A20 A;  1OTR B;  2MW5 A;  2NBU A;  1MI0 A;  2XK5 A;  2ZPN A;  3AM9 A;  1IPG A;  4J3O D;  4A8X C;  1FEH A;  2BYF A;  3ZNI D;  1AAR A;  4GN1 A;  4AS1 A;  4W9E A;  1I4G A;  2M17 A;  2J53 A;  1TIF A;  2E3T A;  1L2N A;  1ZOY B;  1WX9 A;  1JRU A;  2MA9 B;  2KMA A;  3GZN I;  4W9F A;  2C7M B;  3BIN A;  1K51 A;  1FPY A;  2AL6 A;  2NVU I;  3TEY A;  3ZJU A;  2JRH A;  3GZN B;  5KHO A;  5IOI A;  2KZR A;  2WHI A;  4GLS C;  3OAW A;  4EFO A;  4OHJ A;  1E7U A;  3AU4 A;  5IA7 A;  2B3A A;  3PT2 B;  2MBB B;  2LGS A;  2BWE S;  4B0M A;  2GOW A;  3Q3M C;  4DHZ B;  4IC7 B;  3I5J C;  3RPF C;  3V3X A;  1TGZ B;  3SR6 A;  1OQY A;  2J7Q B;  4IW0 A;  4LLG M;  4XGA B;  2KK8 A;  2YEP F;  3W5U B;  2IGH A;  1UUP A;  4W9K A;  3NG0 A;  2Z0E B;  2AQ2 B;  3SD5 A;  1ZW7 A;  3RNC C;  4GIV A;  1WJ4 A;  2C7N B;  2M0A A;  3H7P A;  1ET9 A;  3ZUN A;  1XLP A;  2N9P C;  4W9J A;  2FCN A;  5G55 A;  5IKC M;  1JQ4 A;  2R2Q A;  2N9L A;  3A1Q A;  1K50 A;  1I4R A;  4FXC A;  3MFG A;  4C7Z A;  2FCM A;  4X57 B;  2EEL A;  2KDF B;  3RD2 A;  3VAW A;  3L0W B;  4HKQ A;  4E71 A;  3T9L A;  1JWB D;  1RFK A;  1YJJ A;  2PLP A;  3SDL C;  5DPR A;  2DX5 B;  1C4C A;  5FR6 A;  3QQ8 B;  2M1M A;  1WRI A;  3AE6 B;  2BKR B;  3OJ3 A;  1NDD A;  2A4Z A;  3JVZ X;  3RFZ B;  1F0Z A;  2G4S A;  1GAQ B;  2ZNV C;  2IY1 B;  2M19 A;  1N61 A;  4RNA A;  3MHS D;  4RGM A;  3LDZ E;  2AX5 A;  2I1J A;  1STE A;  2VZK B;  3ECI A;  2BS3 B;  4DXA B;  2DHZ A;  2C60 A;  2EMT A;  3IT6 B;  4B0E A;  4EE2 A;  2LI5 A;  3A9J B;  1I4H A;  3AE8 B;  5HI1 A;  1AW7 A;  2REX A;  4RFB A;  1GC7 A;  2WGS A;  1V1P B;  1RM6 C;  3U30 A;  3DDC B;  5L83 A;  2BF8 B;  2Y5C A;  5MPO A;  2BW2 A;  3ZGZ A;  2GBR A;  3PLU A;  2JSV X;  4ZRP A;  3PPA A;  4MJS A;  4N6E B;  2DBY A;  3VUX A;  3DPD A;  4DK5 A;  4DHZ E;  4WJP A;  2XK5 B;  3NHE B;  2QHO A;  2BS4 B;  2WWZ A;  2PE9 A;  2Z8L A;  1L4D B;  4FN2 A;  3Q3J A;  3DVN U;  2L0F A;  1E6E B;  4MH8 A;  2QIE B;  3U52 E;  3BVZ A;  2WXN A;  1R7S A;  2MQJ A;  1D5M C;  3NY5 A;  2JZ3 B;  3R66 C;  4C56 C;  2KDB A;  4BKS D;  1PGA A;  4NQL B;  2INN E;  2RDH A;  4KZC A;  3AH7 A;  1S3S G;  2FNJ B;  3BYY B;  4C80 A;  4DDI D;  1WXQ A;  2PTL A;  3UGB B;  2QC8 A;  4O1N A;  4RF0 A;  4ACF A;  2OJR A;  1XLN A;  5GMV A;  2GI9 A;  3ZTD A;  2G3Q B;  3R7Q A;  2J4X A;  4QAY A;  3N1X C;  4HLE A;  2CS4 A;  2K0P A;  2BBC A;  4ANU A;  2IGG A;  2JWZ A;  1NVI D;  4TMA B;  4BAX A;  4B6W A;  3T3N A;  1WYW B;  1E5W A;  1J7C A;  1YN3 A;  2N7D A;  3QCA A;  3APC A;  4F8C B;  3K9O B;  1E0Z A;  2UWQ A;  3B9J A;  4ANW A;  1E10 A;  4HCP B;  3QX1 A;  4DWF A;  4EZK A;  4PK1 A;  3H7S A;  5CHV C;  2KXJ A;  2J52 A;  1XCT L;  1HQR D;  4I6L B;  1WIA A;  2D10 A;  3DBH I;  3GB1 A;  3BZD B;  1DOY A;  1EWC A;  4IWO A;  1J0G A;  2WDQ B;  2K8H A;  4GOC A;  1E8W A;  3EFC A;  1K53 A;  2NR2 A;  1WRD B;  3NVV A;  3A4R A;  4CQN A;  1JRP A;  2ZW1 A;  4KSK C;  2KMC A;  2KDE B;  3AEE B;  2GBK A;  4US8 A;  3ZJT A;  2D11 A;  2J0M A;  4HJK A;  2OHF A;  1WY8 A;  1C4P A;  4RMA A;  1UEL A;  3Q69 A;  5G2N A;  1NYQ A;  1YN4 A;  1ZDV A;  4FUL A;  3L10 B;  2J0K A;  2J0J A;  2MX2 A;  2D07 B;  3ZNZ B;  1WF9 A;  3T8M A;  1EWY C;  1YX5 B;  4IKG A;  2VZK D;  1BXT A;  3P4R B;  1DYQ A;  2L00 B;  4A6Q A;  1AWD A;  1V5T A;  2ONQ A;  1EM7 A;  2JYE A;  2KJR A;  4K7W A;  1QF6 A;  1Q10 A;  1R4M I;  3L08 A;  4OW0 A;  3WCQ A;  1HTO A;  3TIX A;  4Q2J A;  1TJE A;  1UBI A;  4EOY A;  1R4M B;  2DYM A;  4HK2 A;  1UGJ A;  1GPX A;  2WXR A;  2JZP A;  1V5O A;  4GB9 A;  1GC6 A;  4OVV A;  2UYZ B;  3ZO5 B;  2WXO A;  5FK9 C;  1YQB A;  2MLB A;  1K52 A;  3WAP A;  4W9C A;  4MJS B;  1UD7 A;  2M4N A;  1E7V A;  1TKY A;  1HZ6 A;  1R4N B;  2FBW B;  1L0X B;  2BS2 B;  4YTP B;  4I6N B;  2WXM A;  5TR5 A;  2IBI B;  2WNM A;  3AEF B;  4IDI A;  4FA6 A;  4C4V A;  2IGD A;  1D6E C;  3R7R A;  1Z5S B;  3V61 A;  3MJW A;  2CJO A;  5AZG A;  4WWO A;  3ZIM A;  2PJH A;  5TSS A;  2GRI A;  3P4Q B;  5C2T B;  1QKZ A;  4A3P A;  4EZL A;  4C00 A;  1FNW A;  2WQY B;  4NJC A;  2AYO B;  2WU5 B;  1V6E A;  1OFF A;  1VR9 A;  1C4A A;  2H88 B;  3EFU A;  1TKG A;  1TS4 A;  2LMC A;  4ASW C;  1N6Z A;  4BBN C;  3AE1 B;  3AXC A;  4FBJ B;  1ET6 A;  2O6V B;  1FCC C;  2N9X A;  2MJD A;  2BYT A;  3MC8 A;  1TTN A;  5BYQ A;  2TSS A;  1OQQ A;  2KN4 A;  1WM3 A;  3APD A;  4HXD A;  1IGD A;  3IT4 B;  3Q3O C;  4YL8 A;  3ZDT A;  3DHG C;  3EGR A;  2N0S B;  1PFD A;  1V86 A;  3A9K B;  3W1Y A;  5D2M B;  1SIF A;  1KTK A;  4LK0 M;  3TJP A;  3VHT C;  3ZKJ C;  4ANX A;  2CHX A;  3C0R B;  4M0W B;  2WDV B;  2K6D B;  4WJO A;  1B1Z A;  3I9V 1;  4WWM A;  4RGN A;  3DQV A;  5LXH A;  2HJ8 A;  1WWT A;  4KKI A;  2LRW A;  1F2R C;  2L32 A;  3PGE A;  4BBN F;  3DOW A;  4AJY B;  3CWI A;  2INP E;  4KDL B;  1V49 A;  5AEK B;  1L5P A;  4WH4 A;  3WIM A;  1XLQ A;  1C1Y B;  3CF6 E;  3Q6B A;  4TUU A;  2KWC A;  2KYW A;  2IO1 B;  1WGD A;  1KJT A;  1UBQ A;  2WP9 B;  4M8M A;  2M8S A;  2E6X A;  4E3C A;  2VH1 A;  2BYE A;  3AB5 A;  3HRD D;  3GOE A;  2LJ5 A;  3AI5 A;  3PO0 A;  1YD8 U;  1EO6 A;  3WA0 A;  3GS2 A;  2WXI A;  4P16 A;  4HVB A;  1XXG A;  4HCN B;  3DVG Y;  2SAK A;  3QHT A;  1YOV B;  2KD0 A;  1FFV A;  5BMH A;  3R2I A;  1P7F A;  3ABV B;  5J2R A;  2IO0 B;  2IY0 B;  2ZJD A;  4PS7 A;  1FXI A;  1WGY A;  2YVC A;  2AEH A;  4LJO B;  3U2S C;  3RN9 C;  2DZJ A;  2RMM A;  3SHQ A;  3RI7 C;  1TBE A;  2IZV B;  2HDE A;  4LNO A;  3PRM B;  1WXM A;  1D3Z A;  1MFW A;  3AEA B;  1C3T A;  4WQM A;  2J42 A;  4FJV B;  4JQW C;  2JPH A;  2LEK A;  4MH0 E;  5D3I B;  4C7Y A;  4ZYS A;  2YEP B;  2BPS A;  4EZJ A;  3IBE A;  2OOB B;  2V4I B;  5AZH A;  1WH3 A;  4KIK A;  3MJ5 A;  1WYG A;  4LCD E;  5IN7 A;  2CHZ A;  3HVD A;  1Z2M A;  2RR9 A;  2FUG 1;  4LNI A;  1XEE A;  2QEJ C;  3B1L X;  3AE7 B;  4DQO C;  2LXC A;  2O6V D;  2KN5 A;  2DAJ A;  3DWG C;  1WMH A;  2JRI B;  2PVG C;  2W54 A;  3RNG C;  1FD6 A;  2KHW B;  1WJ6 A;  2ACZ B;  4OZA A;  3X0W A;  2L8J A;  4DHJ B;  1ZPS A;  1P7E A;  1TZO A;  5LLI A;  1VJK A;  1E7P B;  2LWP A;  4AQ7 A;  3M63 B;  2MP2 A;  1F52 A;  3KUD B;  1KF6 B;  4RH6 A;  3U7D A;  1T3Q A;  3FKY A;  3O13 A;  1PGX A;  3D32 A;  3HUI A;  1WX8 A;  5BYR A;  1IBX A;  2JWU A;  3UIN B;  2FCS A;  2Q5W D;  1FO4 A;  1B9R A;  4NAM A;  5E6P A;  2KQS A;  2RPV A;  3P42 A;  2W82 A;  3H8H A;  4ZOH C;  4KVG B; 
#chains in the Genus database with same CATH homology
 2JWZ A;  1CMX B;  3QC8 B;  1RRB A;  5HKH A;  2NBW B;  5C23 A;  1WI0 A;  3PTF C;  1WM2 A;  4KV2 A;  3PZD A;  4B6W A;  1G6J A;  4IUM B;  5DPS A;  1WYW B;  2DZM A;  1E5W A;  4KZ0 A;  4ZDV A;  2N7D A;  3QCA A;  1P98 A;  4PYZ A;  2KWV B;  2EKE C;  2KNB A;  3APC A;  4F8C B;  1RLF A;  2BGF A;  4P7I A;  2LVO A;  3K9O B;  3ML9 A;  2NPT A;  2UWQ A;  1XT9 B;  1H8C A;  1WGR A;  3NZS A;  3R3M A;  2KLC A;  4ANW A;  1WZ0 A;  2LZ6 A;  2Y5B B;  4IM2 A;  2KDI A;  4LDT D;  3ZW3 A;  4HCP B;  5AZF A;  3QX1 A;  3JYU A;  4DWF A;  4BKS A;  2LVQ A;  3QJZ A;  4ICU A;  4EZK A;  1X1M A;  4K81 A;  2DZK A;  3H7S A;  3WAO A;  4HPM B;  2GMI C;  2JZZ A;  1V80 A;  5CHV C;  1WGH A;  2KXJ A;  2KC1 A;  3CST A;  2DYB A;  5D6J B;  2PEA A;  4URK A;  1J8C A;  4I6L B;  1WIA A;  2D10 A;  2M0X A;  3DBH I;  2MBO A;  2K8B A;  2LUE A;  4AWJ A;  3IHP C;  1KM7 A;  4IWO A;  4A3O A;  1J0G A;  3H6N A;  2K8H A;  5JZE B;  2KTF A;  4GOC A;  2K8C A;  2Z59 B;  4BOZ B;  1E8W A;  2NR2 A;  1WRD B;  3A4R A;  4HDQ A;  2ZNV B;  4JL9 A;  2G45 B;  2KX3 A;  4K7U A;  4F1S A;  3QIJ A;  2WYQ A;  4NQK E;  5KHQ A;  2LVP A;  2BWF A;  2BYV E;  4KSK C;  4K1R B;  4BKT A;  2KMC A;  2KDE B;  1YIW A;  1GG3 A;  3M62 B;  4CYE A;  2GBK A;  5LXI B;  3W1S C;  2D11 A;  4LJP B;  4XX5 A;  1I42 A;  2J0M A;  4HJK A;  3V62 A;  2MBH A;  4CHK A;  3RCZ A;  1WXA A;  4NAW B;  2KKC A;  2LXA A;  1OEY A;  4NPN A;  1WY8 A;  1LM8 B;  3LJ3 A;  1OEY J;  3QWZ B;  1GUA B;  4BVU C;  4M8N A;  2GBJ A;  2FCQ A;  1E8X A;  4RMA A;  1UEL A;  5G2N A;  1WJN A;  1WFY A;  3CSF A;  4FUL A;  4W9I A;  3L10 B;  1K8R B;  1OGW A;  2J0K A;  2J0J A;  2MX2 A;  2D07 B;  3ZNZ B;  2NBV B;  1WF9 A;  2L7R A;  3T8M A;  1YX5 B;  2V3S A;  3Q3F A;  2JXX A;  1NI2 A;  2MCN B;  3IG3 A;  2ASQ A;  2L00 B;  3VQI A;  3PV1 A;  1WZ3 A;  2IO2 B;  1V5T A;  2KFK B;  5E6O A;  4EUT A;  2KJR A;  1P9D U;  3IVF A;  4K7W A;  1R4M I;  4FHK A;  4PYU A;  2CR5 A;  3L08 A;  1FXT B;  1IP9 A;  3TIX A;  2V1Y A;  3HK0 A;  3UIP B;  3VDZ A;  3ALB A;  1UBI A;  3AU5 A;  4I6P A;  2MBE A;  1F9J A;  1RFA A;  4EOY A;  3UQA A;  2HD5 B;  4GDK A;  2DYM A;  4HK2 A;  2NS5 A;  3ZTC A;  3PHX B;  3ZNG C;  4AJW A;  3ML8 A;  1P3Q U;  2KQ7 A;  2L05 A;  3NS8 A;  4EEW A;  2PE6 B;  1HE8 A;  1V5O A;  2D2Q A;  3PHW B;  2MRP A;  4GB9 A;  1GC6 A;  4OVV A;  5JHB A;  2UYZ B;  3ZO5 B;  5J17 A;  1UGM A;  3A33 B;  4FLH A;  1YQB A;  1WJU A;  2MLB A;  4W9D A;  3WAP A;  1VCB A;  2KTR B;  4G11 A;  3ZRF A;  4W9C A;  1WR6 E;  4MJS B;  1UD7 A;  2M4N A;  3VXW A;  2K1F A;  3O65 B;  1E7V A;  1ZGU B;  2N4F A;  4DHJ D;  3APF A;  3HHM A;  4JIO U;  1WMH B;  2IO3 B;  4GSW A;  4I6N B;  3TMP B;  3EHV A;  1GNU A;  4WWP A;  5TR5 A;  1E90 A;  4II3 B;  3VH4 B;  2IBI B;  3VTU A;  4FJY A;  2EMS A;  3A4S C;  3L16 A;  2FIF A;  3P2B A;  2ZCB A;  3L54 A;  4PS3 A;  4FA6 A;  3PSE B;  2N7E A;  5BO4 B;  3R7R A;  2ZPY A;  5DPW A;  1Z5S B;  2FAZ A;  3L13 A;  3V61 A;  3MJW A;  4GXB A;  2MP2 B;  5AZG A;  3A9J A;  1EF5 A;  3KYC D;  4WWO A;  3JSV A;  3KUC B;  3VTV A;  3ZIM A;  2C5L C;  2PJH A;  3B08 A;  3QAR A;  4B95 A;  2V4L A;  3S2A A;  3VUW A;  5J18 A;  2C9W B;  4HPL B;  3H7P B;  4A3P A;  2KX0 A;  1A5R A;  3NOB A;  4EZL A;  1S1Q B;  4XC2 A;  1TZ1 A;  3DBL I;  3WAN A;  2N1W A;  1EF1 A;  5CX3 A;  2IYD B;  3X23 A;  2AYO B;  4MGZ E;  3TL5 A;  2CKH B;  4IM0 A;  2LGY A;  3AUL A;  5L95 C;  1V6E A;  1Q5W B;  4F7Z A;  2L76 A;  2LGD A;  1Y8R C;  4FHJ A;  1I35 A;  4MSQ B;  3EFU A;  3V60 A;  3H9D A;  3I3T B;  4A20 A;  4ASW C;  2N9E B;  3A1Q B;  4TQ0 A;  1OTR B;  2MW5 A;  2NBU A;  4AUQ C;  3H1U A;  4WJN A;  2O2V A;  3QAQ A;  2MBQ A;  4WJQ A;  3AXC A;  3TBL D;  2XK5 A;  4BBN C;  4FBJ B;  3K9P B;  3V6E B;  2O6V B;  2ZPN A;  1IPG A;  3DBS A;  4WWN A;  1XD3 B;  2BYF A;  2WX0 A;  2N9X A;  4K7S A;  3ZNI D;  1AAR A;  4GN1 A;  4GDL A;  4W9E A;  3N3K B;  3M95 A;  5D94 A;  1TTN A;  1P1A A;  2M17 A;  1L2N A;  4NJ7 A;  1T0Y A;  2K39 A;  1WX7 A;  1WX9 A;  1WM3 A;  4KDI C;  1JRU A;  2FUH B;  3KUZ A;  2KFK A;  2MA9 B;  2KMA A;  3GZN I;  3RT3 B;  1XQQ A;  3APD A;  2DAF A;  3PVL A;  1BT0 A;  4HXD A;  4JGH B;  1ZKH A;  4W9F A;  2C7M B;  3BIN A;  1E8Y A;  4YL8 A;  2KOX A;  4HDO A;  4TQ1 A;  3ZDT A;  2AL6 A;  2NVU I;  2ZZP B;  3JW0 X;  2JRH A;  4AOF A;  2JUO A;  1V86 A;  2NPT B;  3A9K B;  5KHO A;  3W1Y A;  2KZR A;  4G0N B;  2Z0D B;  5D2M B;  3OAW A;  4E74 A;  1SGH A;  2DZI A;  2KC2 A;  4BOS C;  1WE7 A;  1YX6 B;  5DCN A;  4EFO A;  1Q1O A;  2KAN A;  1E7U A;  2VRR B;  3AU4 A;  3RZF A;  5IA7 A;  2B3A A;  3PT2 B;  1SIF A;  1UH6 A;  4ZRI A;  2MBB B;  5CHW A;  3TJP A;  3VHT C;  3ZKJ C;  4ANX A;  4HWI B;  2CHX A;  3C0R B;  2BWE S;  2ZVO A;  1NBF C;  2GOW A;  4M0W B;  2R2O A;  3ZVV A;  4BKG A;  4DHZ B;  4IC7 B;  2K6D B;  4WJO A;  1V2Y A;  4MEM A;  1WXS A;  1VD2 A;  2ZEQ A;  3DQV A;  1LXD A;  1TGZ B;  5LXH A;  2KVR A;  4ANV A;  1OQY A;  2HJ8 A;  2J7Q B;  2FID A;  2LRW A;  4IW0 A;  3PGE A;  4B9K A;  4BBN F;  2KK8 A;  3DOW A;  4TV3 A;  4AJY B;  4MSM B;  2GBN A;  4KIK B;  1UZX B;  3L17 A;  4ZYN A;  4W9K A;  1ISN A;  4KDL B;  4NY0 A;  2XEW A;  3VFK A;  1V49 A;  2Z0E B;  5AEK B;  2WX1 A;  3PRP B;  4GU2 A;  3SD5 A;  1ZW7 A;  2NCN A;  5CHF A;  4GIV A;  5EDS A;  3WIM A;  1R4N I;  1WJ4 A;  4MGI E;  3V6C B;  2N1V A;  5C1Z A;  2C7N B;  3H7P A;  1C1Y B;  4KSL C;  3CF6 E;  3ZUN A;  2JT4 B;  3MTN B;  4TUU A;  2KWC A;  3DVG X;  3VVW B;  2BKF A;  2N9P C;  4LDT B;  4W9J A;  2FCN A;  4IG7 B;  2IO1 B;  2GBM A;  5G55 A;  4DBG A;  4MGK E;  1P0R A;  1WGD A;  5DPT A;  2I1K A;  2R2Q A;  1IYF A;  1KLV A;  3A1Q A;  1E8Z A;  1KJT A;  1UBQ A;  4M8M A;  2M8S A;  4E3C A;  2KJH B;  2BYE A;  2WDT B;  2ZCC A;  2FCM A;  2O6V A;  4X57 B;  5IAA C;  2KDF B;  4CO7 A;  3GOE A;  4NJ6 A;  3PRE A;  3RD2 A;  3VAW A;  3ZDM C;  2LJ5 A;  4RM9 A;  3WAM A;  3AI5 A;  4GMV A;  3L0W B;  1YD8 U;  3RUL A;  1EO6 A;  3WA0 A;  3ONS A;  4W9H A;  4E71 A;  3T9L A;  4HVB A;  3DCG A;  2LRU A;  3PS6 A;  4MGY E;  1WE6 A;  1V9J A;  2KJ6 A;  3DVG Y;  3QHT A;  4HCN B;  4IM3 A;  3SDL C;  4GDK B;  5DPR A;  2DX5 B;  5FR6 A;  3QQ8 B;  2KD0 A;  2W9N A;  4RM8 A;  2M1M A;  1PQS A;  4NAW A;  3EEC A;  1MG8 A;  3ENE A;  2BKR B;  3OJ3 A;  3EC8 A;  2YLM A;  3ZLZ A;  2K6Q A;  1NDD A;  2A4Z A;  3JVZ X;  3A9K A;  4BFR A;  4MEL A;  5J2R A;  3RUI B;  2IO0 B;  2IY0 B;  2ZJD A;  2JVC A;  4PS7 A;  2CHW A;  2G4S A;  1WGY A;  2YVC A;  2AEH A;  4LJO B;  2DZJ A;  3SHQ A;  2G4D B;  2C7H A;  4W9L A;  4G3X B;  3W1S A;  2KO3 A;  2K25 A;  4PS8 A;  2JY6 A;  2KFJ A;  2L3Z A;  2ZNV C;  1TBE A;  2IY1 B;  2IZV B;  4WQO B;  5E6N A;  3OJ4 B;  3MHS D;  4GGQ A;  3UF8 A;  3PRM B;  1WXM A;  1D3Z A;  3LDZ E;  2I1J A;  4FAD A;  1C3T A;  5JHA A;  4FJV B;  1EUV B;  3VUY A;  4XZ4 A;  3IFW B;  3ECI A;  4JQW C;  2JPH A;  4DXA B;  4MH0 E;  2DHZ A;  1L7Y A;  2C60 A;  2EMT A;  4ZRJ A;  3DBR I;  2LI5 A;  3A9J B;  4AP4 C;  2BPS A;  3JSV B;  4EZJ A;  2KLG A;  1M94 A;  3IBE A;  2REX A;  1QZE A;  2OOB B;  4G50 A;  2MWS B;  4ICV A;  1WH3 A;  4IWP A;  4KIK A;  4OVU A;  4II2 B;  4LCD E;  5AZH A;  1GJZ A;  3M3J A;  1GC7 A;  1RAX A;  2CHZ A;  3RYT A;  3DVN V;  1Z2M A;  2RGF A;  2A5U A;  2RR9 A;  3VTW A;  1V81 A;  3B1L X;  1LQB A;  3U30 A;  3DDC B;  5L83 A;  2BF8 B;  3HM3 A;  2MSE D;  1LFD A;  3BY4 B;  3KW5 B;  4W9G A;  2LXC A;  2DYO A;  2GBR A;  3PLU A;  1H4R A;  2KTR A;  3NZU A;  2O6V D;  1KOT A;  2KN5 A;  2L0T A;  3PPA A;  2DAJ A;  4MJS A;  2ZVN A;  2RPQ A;  1U4A A;  3DPD A;  3VUX A;  2O2V B;  5CTR C;  4DDG D;  1WMH A;  2JRI B;  4DHZ E;  3OLM D;  4DK5 A;  4WJP A;  2XK5 B;  4NNJ B;  3KH0 A;  3RZW C;  2KHW B;  1WJ6 A;  3NHE B;  3ZRC A;  2D3G A;  2AWT A;  4IWQ A;  2QHO A;  2HTH A;  3X0W A;  2L8J A;  2WWZ A;  2PE9 A;  4DHJ B;  4FN2 A;  3QK0 A;  3Q3J A;  4GDL B;  2RD0 A;  2LD9 A;  2HE7 A;  3CMM B;  2RSU A;  2L0F A;  3DVN U;  4JLC A;  1WGG A;  5LLI A;  3TCA A;  3PLV A;  4EKU A;  2LWP A;  3M63 B;  2MP2 A;  2CU1 A;  3SU8 X;  4FJZ A;  3KUD B;  3UQB A;  4J6I A;  2MQJ A;  3U8Z A;  3NY5 A;  3U7D A;  2JZ3 B;  3N30 A;  3N32 A;  3R66 C;  4MM3 A;  3HIZ A;  1SE9 A;  2XBB C;  2KDB A;  3HM6 X;  5D7G A;  4BKS D;  3B0A A;  4NQL B;  1WXV A;  4KZC A;  1S3S G;  3WAL A;  2FNJ B;  3D32 A;  1J19 A;  4TKN A;  1WX8 A;  2AL3 A;  1YJ1 A;  4DDI D;  3KVF B;  2KWU B;  2PPH A;  3UIN B;  1WR1 A;  3UGB B;  3ZNH B;  2FCS A;  1Q0W B;  2OJR A;  2LGX A;  5GMV A;  3VH3 B;  4ZRK A;  3ZTD A;  5E6P A;  2G3Q B;  4N9F 4;  2KQS A;  4MDK E;  3UIO B;  3QA8 A;  5JH5 C;  3R7Q A;  2DEN B;  4WAA A;  2LAS A;  4HLE A;  2CS4 A;  3KYD D;  2JF5 A;  4ANU A;  3PRZ A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...