2NS5A

The conserved n-terminal domain of par-3 adopts a novel pb1-like structure required for par-3 oligomerization and apical membrane localization
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
SEFKVTVCFGRTRVDVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning-defective 3 homolog
publication title The Par-3 NTD adopts a PB1-like structure required for Par-3 oligomerization and membrane localization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ns5A00
2A5UA 4IW0A 1XQQA 4AP4C 2KNBA 5JHBA 1RFAA 3KUDB 2CR5A 3NS8A 2FCMA 4HVBA 5DPWA 3AULA 2MBQA 3LJ3A 3PT2B 4G50A 3H7SA 3VH3B 3QHTA 4G0NB 4DBGA 4FJVB 3PLUA 4EUTA 2BF8B 4ZDVA 1UELA 4W9FA 2AEHA 4WJOA 4A20A 2IO3B 2ZJDA 4HXDA 3WALA 4WWPA 3ZIMA 3ML8A 2N7EA 2L7RA 1LFDA 4ANXA 2RSUA 3PS6A 3UIPB 3RYTA 3DBHI 2KO3A 3A1QA 1OTRB 3PGEA 4WJQA 3HM6X 2EKEC 1WX8A 3RULA 3HK0A 3VTUA 2DYOA 2C60A 3KH0A 3A9JB 4BBNC 1S1QB 4W9LA 3A9KA 4IWQA 3CMMB 2LVQA 4W9DA 1RAXA 1IP9A 1L2NA 1WJNA 2IY1B 2IY0B 2LVPA 3ZNID 3AI5A 1QZEA 2NR2A 1OGWA 2KK8A 3PRZA 1VD2A 2ZNVB 3ZTCA 4MM3A 4WQOB 3SDLC 1WR6E 4CYEA 2MSED 2JZ3B 2JRHA 1WH3A 5AZFA 3SHQA 3M3JA 4NAWA 4II2B 1YD8U 5E6OA 5D94A 1HE8A 2PE6B 2KWCA 1UBQA 4G3XB 2IO1B 1V80A 4EZLA 5G55A 5HKHA 5KHOA 4EKUA 1G6JA 2KX3A 1EO6A 1Y8RC 4M0WB 4GDKB 5JH5C 4DHJD 4NQKE 2MBHA 3IBEA 3B1LX 2K8HA 2MCNB 1C3TA 3AXCA 3TL5A 4DDID 3V6CB 1WGRA 2DYMA 1V49A 2N1WA 1GC6A 2G3QB 3VUXA 5DCNA 2B3AA 1P0RA 2ZVNA 3EHVA 3T8MA 3TBLD 1GC7A 3L10B 4PYUA 5JHAA 1E90A 4FBJB 2JVCA 2ZPYA 2JXXA 2ZEQA 3RUIB 2M17A 3L17A 2KQ7A 3QIJA 3CF6E 3A9KB 2I1KA 4W9CA 3QA8A 5JZEB 2C5LC 3DBLI 4KDIC 2DAFA 3C0RB 3V60A 4AJYB 4N9F4 2L8JA 1H4RA 5C1ZA 5IA7A 2CS4A 3EECA 4CHKA 4HPMB 1MG8A 3H6NA 2J0KA 4MGZE 4ASWC 1V9JA 2MBBB 4KZ0A 4HDQA 1WM3A 2LASA 4BKSD 3JSVA 3OJ4B 2R2OA 2KZRA 3VVWB 4BVUC 2HTHA 2IO2B 4GGQA 4NJ6A 2IBIB 3ENEA 3NOBA 3O65B 4MSQB 4ZRJA 2WX1A 5TR5A 3X23A 3SD5A 1VCBA 3PTFC 5L95C 3KVFB 1E7VA 3DVGX 2XK5A 4FJYA 1UZXB 1P9DU 2BYEA 2N9EB 3ZDMC 2BKRB 2MP2A 4KVGB 4BKGA 3KYDD 2AL6A 3BINA 1I35A 1P1AA 5C23A 4GU2A 4TQ1A 3N32A 4KIKB 4GB9A 4LJPB 2GMIC 2KHWB 2BWFA 2YLMA 2I1JA 1SE9A 4BOSC 3UGBB 2O6VD 3JYUA 1WF9A 2K8CA 4HK2A 2HE7A 2NPTA 1Z2MA 4FLHA 4K7SA 3VAWA 4DHZB 4DXAB 1WZ3A 3GOEA 4M8MA 1WJ4A 3W1SA 3ZO5B 4BKSA 2KKCA 4W9HA 3ZRFA 2KTRB 2ZPNA 3WA0A 1L7YA 4WJPA 4NQLB 2UYZB 3ONSA 4PS7A 5CHVC 3RZFA 1WJUA 1WX7A 2M0XA 5CHWA 2N4FA 3APCA 3Q3FA 3RD2A 2O2VA 1LQBA 4MEMA 5LLIA 3VDZA 2JUOA 3PZDA 2LJ5A 3ZW3A 1V5OA 1WRDB 3NY5A 4GDLA 4TKNA 2BPSA 5CHFA 2LRUA 3N3KB 4X57B 4XZ4A 4ANWA 3K9PB 1Z5SB 4IM3A 2R2QA 2K1FA 4EZKA 3PHXB 3PLVA 2FIFA 2NBUA 3APDA 3VTWA 2ASQA 3UQAA 2RR9A 2WWZA 2O6VA 3EFUA 1WE6A 2J0JA 1WI0A 3H7PA 1YX6B 4JLCA 4W9GA 1TGZB 1WMHA 2NVUI 2KJ6A 3VTVA 1NDDA 1NBFC 2N9PC 4AUQC 2KQSA 4FULA 2N9XA 2DZMA 2DAJA 3TJPA 5E6NA 4W9EA 4HCPB 5KHQA 2HD5B 1BT0A 1GNUA 5J18A 1J19A 1YJ1A 4K81A 1EF5A 3L54A 3ZLZA 3ZUNA 2LZ6A 4MJSB 1E5WA 1E8YA 2KTFA 4GMVA 4HLEA 2NPTB 2PEAA 3H1UA 1H8CA 2JF5A 2LGXA 4J6IA 2FCQA 4PS8A 4B6WA 4KSKC 1WGHA 3RT3B 3W1SC 2KDBA 1K8RB 4ANVA 2NS5A 3HIZA 4ZRKA 4MGIE 1IYFA 2K25A 3D32A 3UIOB 4AWJA 2DX5B 3JW0X 5DPSA 2BYVE 4NNJB 4ICUA 5D7GA 3ZKJC 2M8SA 3A4SC 2IZVB 3U30A 1XD3B 1WXMA 3R66C 4E3CA 4GN1A 2AL3A 2D2QA 4BKTA 2ZCBA 3QQ8B 3K9OB 5LXHA 4F1SA 2L0TA 1WXVA 4TV3A 2KFKA 4ICVA 3PREA 4EOYA 2EMTA 2L3ZA 2V3SA 3PVLA 1R4MI 4CO7A 1PQSA 3A1QB 1TZ1A 4KSLC 2KLGA 4KDLB 2JT4B 2FAZA 2LUEA 4II3B 4W9KA 1F9JA 2IYDB 2MWSB 4IWPA 2ZZPB 3W1YA 4FHJA 1GUAB 2D3GA 3DOWA 5CTRC 1R4NI 2CHXA 2KMAA 1KJTA 3QJZA 3JVZX 2MBOA 4M8NA 1A5RA 2KANA 3CSTA 2K39A 3IVFA 3DBSA 3ML9A 2C9WB 4JGHB 1T0YA 1JRUA 1V86A 3QARA 4B9KA 4LJOB 2GBKA 2G4DB 3ZNGC 1SGHA 2J7QB 2LXAA 2BYFA 1EF1A 4NAWB 4E74A 2UWQA 2GBNA 3DVNV 1WM2A 4XX5A 1E8WA 1V5TA 4DHZE 4AJWA 2CHZA 2KXJA 3HM3A 2XBBC 2DYBA 5EDSA 2DZKA 4F7ZA 3WAPA 3R7QA 2NCNA 1J0GA 3ZNHB 2KC1A 3WANA 4FADA 2XEWA 5IAAC 1UGMA 2DZJA 2CHWA 2JRIB 3DVNU 4IC7B 2Z59B 5CX3A 1GJZA 3M62B 4GOCA 4W9IA 3SU8X 3WAOA 2L0FA 2KJRA 4IG7B 5D6JB 2LWPA 3RZWC 3U8ZA 3AU4A 3RCZA 4HPLB 3V61A 3TMPB 3L13A 3DPDA 2KFJA 2FUHB 3LDZE 2NBWB 3MHSD 4IM0A 1WZ0A 1RLFA 4JQWC 4NPNA 1WXSA 3PSEB 1WXAA 1C1YB 3APFA 5AZHA 2MBEA 2C7NB 3A9JA 4HWIB 1WGDA 2K6DB 3NZUA 2D07B 4I6PA 2MA9B 3L0WB 1ISNA 1X1MA 2K6QA 2CU1A 2AWTA 2G45B 3A4RA 4MGYE 3U7DA 2GBJA 1E8ZA 2KOXA 1YQBA 2M1MA 1M94A 2N1VA 2MW5A 3DVGY 2FNJB 3VUWA 4DHJB 2KDEB 1Q5WB 3VHTC 2RPQA 2W9NA 1WJ6A 3JSVB 2BKFA 2MX2A 4ANUA 3ZNZB 5DPTA 2JWZA 2REXA 2PPHA 3ZRCA 1TBEA 3UINB 4IWOA 2D11A 2DHZA 3P2BA 4WAAA 4A3OA 2G4SA 3KW5B 2A4ZA 1U4AA 5BO4B 5AEKB 2XK5B 4W9JA 2PJHA 2KVRA 1NI2A 4GDKA 4MH0E 3QCAA 2MP2B 4A3PA 1WY8A 3NHEB 4BOZB 4OVUA 1J8CA 2KDIA 3KUZA 3ZDTA 3DBRI 3DCGA 4OVVA 3VFKA 1LM8B 2FIDA 3S2AA 3PRMB 4HJKA 3VQIA 2CKHB 2L05A 4AOFA 3M63B 3CSFA 1WIAA 3L08A 3V6EB 3QAQA 4FN2A 1YIWA 1WGYA 2LVOA 3T9LA 4BBNF 1WR1A 2KC2A 3OLMD 1E7UA 2KJHB 2YVCA 2RGFA 3UQBA 1WYWB 1OEYJ 2D10A 2JZZA 4P7IA 4E71A 3V62A 1ZW7A 2KMCA 4I6LB 2V4LA 2MQJA 1ZKHA 2AYOB 2LI5A 3B08A 4LDTD 2LGDA 3ZVVA 5G2NA 2L76A 2O2VB 2RD0A 4DK5A 2EMSA 3L16A 1D3ZA 3ZTDA 2OOBB 1UD7A 1I42A 1UH6A 2FCSA 3OJ3A 5J2RA 4GDLB 4NY0A 4TQ0A 3R7RA 3QX1A 2ZNVC 3EC8A 3NZSA 3PPAA 3Q3JA 4EEWA 4MGKE 3DQVA 2J0MA 1FXTB 2KDFB 4PYZA 3PRPB 2O6VB 2KWVB 1P3QU 4YL8A 3H7PB 2JY6A 2LXCA 1KOTA 1WMHB 4FA6A 4GIVA 4TUUA 1WX9A 3I3TB 1AARA 2BWES 1S3SG 2M4NA 3VXWA 4EZJA 5GMVA 3IHPC 2DZIA 4K7UA 4KIKA 1CMXB 3HHMA 4MSMB 1RRBA 1KM7A 4FJZA 3IG3A 2OJRA 5J17A 2GOWA 2N7DA 4F8CB 1KLVA 2Z0EB 1EUVB 3VH4B 3WIMA 1GG3A 2KLCA 3GZNI 4URKA 1LXDA 2KN5A 2ZVOA 2K8BA 1Q1OA 5FR6A 2KTRA 3R3MA 4KV2A 2KD0A 4IUMB 4HCNB 1V2YA 4IM2A 4I6NB 4PS3A 3A33B 3X0WA 2PE9A 1XT9B 4HDOA 3BY4B 1WGGA 2NBVB 1V6EA 2LGYA 4ZRIA 2VRRB 1UBIA 3DDCB 3UF8A 1Q0WB 2JPHA 3KUCB 1WE7A 1OEYA 4WJNA 5DPRA 4LCDE 3PV1A 2WYQA 4K7WA 5L83A 2DENB 4BFRA 4DWFA 4RMAA 2BGFA 2LD9A 4RM9A 4RM8A 5AZGA 2WDTB 3MTNB 4JL9A 2V1YA 2KFKB 1YX5B 2WX0A 2Z0DB 4WWOA 2GBMA 3VUYA 3QC8B 1WFYA 4FHKA 1V81A 3TIXA 2FCNA 1P98A 3TCAA 3WAMA 4XC2A 3ECIA 4G11A 3IFWB 2MRPA 1TTNA 2C7HA 4JIOU 4MELA 2C7MB 4KZCA 4B95A 5D2MB 3H9DA 3PHWB 2LRWA 2GBRA 3QWZB 1OQYA 2IO0B 5E6PA 2ZCCA 2KX0A 4LDTB 2KWUB 5LXIB 1IPGA 3ALBA 2HJ8A 3OAWA 4MDKE 4MJSA 4GXBA 4ZYNA 3KYCD 4NJ7A 2MLBA 2QHOA 3B0AA 1SIFA 3M95A 3MJWA 3QK0A 4WWNA 3N30A 2Y5BB 3AU5A 4EFOA 4K1RB 1ZGUB 4DDGD 2L00B 1E8XA 4GSWA
chains in the Genus database with same CATH superfamily
2A5UA 2INDC 2KNBA 1RWSA 1RFAA 3KUDB 2CR5A 1YMHE 2FCMA 2ACZB 5DPWA 1B9RA 3PT2B 4WURA 3H7SA 1L6VA 4EUTA 4FJVB 4XYCA 3AE9B 4W9FA 4WJOA 2IO3B 1T0SC 5C3JB 3ML8A 2RSUA 1A70A 2RDGA 3R2TA 3RYTA 3DBHI 2KO3A 4WJQA 5EE0A 3FILA 3HK0A 3A9KA 4RF1A 4S17A 1L2NA 1F0ZA 2IY0B 3MHZA 3P1MA 1OGWA 4P1CC 3Q3MC 5BYRA 3SDLC 1WR6E 1OQQA 1I4HA 1YD8U 3ZYYX 1V80A 1XO3A 2K22A 2J52A 3U4EG 2BS3B 4DHJD 3IBEA 4K3BA 3TL5A 1WGRA 2RPVA 2WDRB 2G3QB 3VUXA 2B3AA 3TBLD 4PYUA 5JHAA 2L1AA 2KT7A 2M17A 2KQ7A 1L0XB 4YTNB 4YWGG 5H8YE 4W9CA 3QA8A 1MPEA 4AJYB 4KDIC 2QMTA 1L4DB 2VH2A 2ZW0A 3AE8B 3Q3NC 4CHKA 1XLPA 1MG8A 4MGZE 4ASWC 1SJHD 2HDEA 1L0VB 3OJ4B 2R2OA 3O13A 1JWSD 4BVUC 4GGQA 2IBIB 4MSQB 2R61A 3DVGX 1P9DU 5FR3A 1QOBA 3ZDMC 2IGDA 2MP2A 3AV8A 1I35A 5C23A 2QJLA 4LJPB 5T8IA 2GMIC 2WP9B 2BWFA 3VAWA 1WZ3A 4M8MA 1K51A 4XE0A 4BKSA 2D3BA 3ZRFA 2ZPNA 2CJOA 4PS7A 3RZFA 2M0XA 1WGKA 3ZJTA 3APCA 3RD2A 2JUOA 2LJ5A 4XZ4A 4IM3A 2R2QA 2K1FA 4XDCA 2FIFA 3VTWA 2WWZA 2EELA 1WE6A 3H7PA 2KJ6A 1L6UA 1NDDA 1XCTL 2N9XA 2IGHA 3KWVA 2D5GA 3L54A 4JX1C 3ZXVA 4LK0M 1E8YA 3TEZA 4J3OD 5BYSA 4HLEA 1H8CA 2JF5A 4PS8A 4C56C 4YSXB 1WGHA 3RT3B 4ANVA 3HIZA 2GB1A 3D32A 1NVID 3ZKJC 3N9YC 4E3CA 4RGOS 1XLOA 2V3NA 1YQ3B 2DNFA 2ZCBA 1FXAA 4TV3A 4ICVA 2H88B 3PREA 4RGNA 3AEBB 1PQSA 4KSLC 1TZ1A 1F52A 4RCOA 2DWQA 3FILB 2LUEA 4II3B 1F9JA 2MWSB 2ZZPB 1TY0A 3TUOA 1GUAB 4JE3B 1KJTA 3QJZA 3T3NA 5IO9A 1T0YA 3MP9A 1JRUA 2V0GA 1TS2A 4B9KA 5MPOA 2GBKA 3BIID 3J9CA 1V5TA 1DOIA 1FD6A 2CHZA 1VLBA 2KXJA 3BYYB 2DZKA 3IT4B 3R7QA 4KGSA 2NCNA 3EUB2 4FADA 5HG2A 5CX3A 2JRIB 2RMMA 1GJZA 4IG7B 5D6JB 1CQVA 2KDMA 3RCZA 3TMPB 4IM0A 1WZ0A 2QDFA 2JSVX 2PIAA 5AZHA 3A9JA 3MC8A 2D07B 3Q14C 3V05A 2GBJA 2KOXA 3E9SA 1YQBA 1T3QA 2N1VA 1TS3A 2MW5A 1MI0A 3VHTC 1WXQA 2MX2A 1JALA 2JWZA 1MJDA 2REXA 1MFWA 4OW0A 2XN9C 3UINB 2D11A 4ZHOA 4W9JA 4MH0E 3TEWA 2MP2B 4WIPA 4YSYB 1YN5A 4BOZB 4OVUA 2WXFA 3DCGA 3NVYA 4OVVA 3VFKA 2FIDA 3PRMB 3VQIA 2L05A 2KWDA 1WSPA 3M63B 2ONQA 1YIWA 2KC2A 1V1PA 1E7UA 3W5VB 2RGFA 1OEYJ 4ZHPA 2D10A 1VRAB 1ZKHA 2AYOB 4LDTD 1VDVA 2JZPA 2CJNA 3Q3OC 1JWAD 3L16A 3T3OA 1FM0D 1I42A 5EE3A 2JWUA 3H8HA 2LGSA 3BZDB 4TQ0A 3R7RA 3AEEB 3N20C 3EC8A 4NZLB 1AWDA 2K9XA 3DQVA 2PVGC 1KTKA 2KDFB 4PYZA 3AMZA 4YL8A 3H7PB 4C80A 2LFIA 2BWES 1I4RA 1YNTE 4EZJA 1I4GA 4BZAA 4K7UA 3HHMA 2JYEA 1C77A 1R7SA 3NS1A 4HEA1 3IG3A 1UNSA 2INNE 2WXMA 3VH4B 5FKAC 5HI1A 1LXDA 3AB5A 2LUMA 3LYYA 2BVCA 3W5UB 2KTRA 4AS1A 2KD0A 4IM2A 4I6NB 1UWXA 1PDXA 3A33B 4REZA 2OHFA 1HTOA 1HZ5A 2LGYA 4ZRIA 3UF8A 1Q0WB 3PV1A 4K7WA 4AQ7A 2N9LA 3AE3B 4RMAA 2LD9A 4UDUC 1XLQA 4ZOHC 4WQMA 2WX0A 4ARCA 2Z0DB 1FCLA 1WFYA 1D5MC 3TIXA 2FCNA 3WAMA 4JIOU 3NVVA 4LNOA 4KZCA 4B95A 2LRWA 1OQYA 2ZCCA 5LXIB 3DHHC 3ALBA 2HJ8A 1R4MB 5E6JA 4GXBA 4ZYNA 3KYCD 1BMLC 3B0AA 1SIFA 3MJWA 4WWNA 4YT0B 2Y5BB 1M4VA 4K1RB 1HQRD 2L00B 1E8XA 4AP4C 5JHBA 3NS8A 4ZYSA 3BVZA 2W55A 3AULA 3VH3B 3QHTA 4DBGA 4KGTA 3AEFB 1ZE3D 2LMCA 5AUKA 1FIQA 4A90A 2ZJDA 4HKZE 3WALA 4M01A 4WWPA 2K0PA 2L7RA 3UIPB 2MJ3A 1OTRB 2EKEC 2DYOA 2C60A 3A9JB 2WQYB 1S1QB 3BK2A 4W9LA 4IWQA 2WU5B 3MC9A 2LVPA 2X38A 3AI5A 1HXYD 4O1NA 3PRZA 1VD2A 3ZTCA 3RMKC 2XNAC 3Q8BA 3MFGA 3AN1A 2MSED 1SSNA 1WH3A 2JRHA 5D94A 3SFDB 1UBQA 2IO1B 2WXGA 4EZLA 3C8YA 1ENFA 4EKUA 1G6JA 1EO6A 1Y8RC 2MJEA 2WXPA 3NZ3A 4LTUA 4NQKE 1FFVA 1RYJA 3B1LX 2WXHA 2DYMA 2E6XA 2BYTA 2ZVNA 1V1PB 4FBJB 4CQNA 2JXXA 3CIRB 3L17A 2SAKA 3CF6E 5JZEB 1PYWD 3HUIA 3V60A 3C0RB 1TKEA 1Y56A 1H4RA 3RNCC 2MBBB 4KZ0A 4WAFA 1WM3A 2LASA 3AEDB 4OZBA 3JSVA 3VVWB 3AECB 1XF5L 4HKQA 4NJ6A 3N1ZC 5TR5A 2AQ3B 2WX1A 5IOIA 3PTFC 5LNK1 3KVFB 3Q6BA 2BKRB 1IBXB 3KYDD 1T6BX 1STEA 3NUHB 4TQ1A 1FCCC 1YQ4B 2KHWB 1QQRA 1VZ6A 3P4RB 2I1JA 4B0EA 1WF9A 3MJ5A 4HJGE 2LGIA 4HK2A 4DHZB 1D3ZA 4FLHA 4DXAB 1WJ4A 4WWMA 5EE9A 1TKYA 1OQRA 2KTRB 4NQLB 3RI7C 1ROEA 1XEEA 5TSSA 5D3DA 2V3PA 3Q3FA 4MEMA 3PZDA 3U52E 1C4AA 1TS5A 3AE4B 3AEGB 2BPSA 2LRUA 4X57B 2BB6A 2ASQA 2O6VA 3EFUA 4JLCA 5BMHA 2KQSA 5E6NA 1RM6C 5KHQA 2HD5B 2BB5A 3ZLZA 1E5WA 3NVWA 1LO5D 4GMVA 2SEBD 3H1UA 2K5PA 1NEKB 4B6WA 2KDBA 5IN7A 1IYFA 1D5XC 2KVZA 4HROA 3RNAC 4NNJB 5D7GA 4LNIA 1HZ6A 3U30A 4ARIA 1XD3B 3R66C 1I4QA 2AQ1B 3AE1B 1C78A 4BKTA 3RNEC 1EU4A 4TSSA 5LXHA 4F1SA 1WXVA 2KFKA 2L3ZA 1L0YB 2MHJA 1R4MI 2QSDA 1E6EB 2FAZA 2ZW1A 4IWPA 2J53A 3DOWA 1Q10A 2LHEA 1ET9A 1QOGA 1A5RA 1J7BA 2MBOA 2KANA 1L4ZB 2WXQA 1V86A 3EGRA 3P4PB 4JPSA 1E8WA 3Q8FA 4DHZE 3HM3A 2XBBC 3WAPA 3IAS1 1J0GA 4PT5A 2GLSA 2KC1A 3CWIA 1PGXA 4S0RA 4PK1A 1UGMA 1C79A 2CHWA 1CK1A 1WWTA 3SU8X 2L0FA 2KJRA 4LLGM 1KF6B 3DPDA 2NBWB 4JQWC 3BWUD 1WXSA 1C1YB 3APFA 2C7NB 4HWIB 2X8XX 4XDDA 3GB1A 1YOVB 1ISNA 4JWSC 1X1MA 2K6QA 3A4RA 3AEAB 1WYGA 1M94A 4H2AA 3VUWA 2KDEB 1WJ6A 4WH4A 3NRZA 3JSVB 2OEDA 3ZRCA 1I7HA 3DBLB 3P2BA 1V97A 2KVRA 3Q8CA 4A3PA 1ZDXA 3FKYA 3KUZA 3ZGZA 3S2AA 4HJKA 4AOFA 1ZP0B 3FAHA 3BK1A 1WIAA 3V6EB 1IUEA 2LVOA 4BBNF 1VR9A 3UQBA 2JZZA 1GOZA 4P7IA 3V62A 4E71A 2V4LA 2LI5A 2L76A 2NTSA 4DXGA 3ZTDA 3Q69A 4EEWA 1FXTB 3ZXRA 2O6VB 1P3QU 1N5XA 4GIVA 4US8A 1WX9A 3TEYA 3VXWA 2KQ4X 2DZIA 4KIKA 4MSMB 2M0AA 4FJZA 2W82A 2V9HA 2OJRA 4A9AA 2N7DA 2G1EA 2KN5A 2K8BA 4KV2A 4IUMB 2EKIA 4HCNB 1V2YA 2DLBA 4PS3A 3X0WA 1C4PA 2BQQA 1SJED 1YN4A 2VRRB 1UBIA 4RH6A 3PZ7A 4IDIA 4WJNA 4JWUC 2DENB 4BFRA 4RM9A 4RM8A 5AZGA 2KFKB 3P4QB 1YX5B 4WWOA 1FEHA 4N59A 1TZOA 4FHKA 1P98A 2NTTA 4IKGA 3ECIA 2IGGA 1TTNA 4MELA 3VRAB 3QWZB 3WCQA 2KX0A 4LDTB 2KWUB 2IDYA 4MDKE 1JCKB 4GLSC 4NJ7A 2QHOA 3QK0A 3AU5A 1ZGUB 4DDGD 1R4NB 4GSWA 4IW0A 1I4PA 2QIEB 3SR6A 4K3CA 4HVBA 2MBQA 4G0NB 3R8BA 3PLUA 1UELA 3KWLA 4A20A 2N7EA 1D5ZC 4ANXA 2BBCA 3PS6A 3RNBC 3A1QA 3HM6X 4R3DA 2WXOA 4RF0A 4Q2JA 3KH0A 1F77A 1P7EA 1QLBB 2W54A 2WGSA 2PVOD 3CMMB 2LVQA 4W9DA 1J7CA 1WJNA 2IY1B 2TSSA 5IKCM 2KK8A 1YJJA 2ZNVB 1N61A 1KH0A 2L32A 2JZ3B 3SHQA 5AZFA 3M3JA 4NAWA 5E6OA 4KKIA 4G3XB 5KHOA 1QT9A 2KX3A 1FO4A 1SEBD 1IBXA 1I4XA 5GXGB 1GAQB 1XLNA 2WDVB 2W3SA 1V49A 1C9FA 1N60A 1V8CA 1P0RA 3I57A 3EHVA 3T8MA 1T5XD 3P4SB 1E90A 2JVCA 2ZPYA 2JXTA 2ZEQA 1SE4A 3QIJA 3DBRB 3AE5B 4ACFA 3NG0A 3DBLI 2DAFA 3ETRA 5C1ZA 5IA7A 2CS4A 4HPMB 2J0KA 1V9JA 1MVKA 2DBYA 4HDQA 4BKSD 2N7JA 1BUIC 3ZJUA 3ENEA 3O65B 4ZRJA 3X23A 5L95C 1EM7A 2XK5A 4FJYA 1UZXB 1ZXHA 2BYEA 2N9EB 2E3TA 1ZXIA 4KVGB 2AL6A 3BINA 1VJKA 4RFBA 1P1AA 4QAYA 4GU2A 3N32A 4KIKB 2YLMA 1SE9A 3UGBB 3JYUA 2M19A 3KLSX 3ZQ4A 4K7SA 4M02A 3UI3A 1QILA 3W1SA 1JRPA 1HEZE 4W9HA 3TSSA 4KGRA 2KN4A 3WA0A 1L7YA 4WJPA 3ONSA 5CHVC 1WX7A 1GB1A 2OJWA 3GZNB 1WRDB 4GDLA 3IXSA 4HRSA 2JU6X 4MACA 3K9PB 1UUPA 1Z5SB 2NBUA 3APDA 3UQAA 2LJIA 2J0JA 1WI0A 1YX6B 4W9GA 4RGMA 1TGZB 2NVUI 3VTVA 3IAM1 4B0MA 2N9PC 4AUQC 3RFZB 2LEKA 4FULA 5IP4D 2DAJA 3TJPA 3RN9C 4HCPB 1BT0A 1J19A 3AE6B 2WNMA 2Y5PA 2RDHA 2KTFA 2NPTB 3RNGC 3W9CB 2J42A 2LGXA 4J6IA 4KSKC 1FFUA 1ZPSA 2NS5A 5AUIA 4AWJA 5DPSA 1QOFA 3A4SC 1AW7A 2IZVB 1WXMA 2WXLA 4DXFA 1JW9D 2IPKD 3NJTA 4L1BA 2AL3A 2D2QA 3QQ8B 1FPYA 2L0TA 2V3SA 3PVLA 1ZDVA 3C19A 3A1QB 4A55A 2IYDB 1E9MA 1J7AA 3W1YA 2D3GA 5CTRC 1R4NI 2CHXA 3JVZX 4M8NA 3Q8EA 2IJ0A 2K39A 4BAXA 3ML9A 2C9WB 1NENB 3QARA 4RNAA 4LNNA 2G4DB 2H89B 2J7QB 1EF1A 4NAWB 2GBNA 1WM2A 4XX5A 1ESFA 4AJWA 2DYBA 4F7ZA 3BVMA 2L52A 5HFYA 2BS4B 1FMAD 4IC7B 2DZJA 3M62B 4W9IA 3U8ZA 1PGBA 1L5PA 4HPLB 3V61A 2V4IB 3P63A 2KFJA 3MHSD 2MCNB 1RLFA 4NPNA 3AE7B 1MHXA 2FE8A 2MBEA 1WGDA 2MEKA 2MH7A 3FC4A 3U7DA 1GPXA 1E8ZA 1HA5A 1HTQA 4C4VA 4DHJB 1UF0A 2RPQA 3Q8AA 2BKFA 4ANUA 4A8XC 1FNUA 4OHJA 1N63A 3VR9B 2PPHA 3U7ZA 2DHZA 4A3OA 2A4ZA 2XK5B 1GB4A 2PJHA 4M0WA 4GDKA 3QCAA 3N1YC 4L2YA 3ZDTA 3DBRI 1LM8B 2CKHB 4KKJA 3L08A 3QAQA 2VZKD 3OLMD 2KJHB 4MH8A 2KMCA 4I6LB 3B08A 1T0RC 4USAA 2EMSA 2OOBB 1UD7A 3OJ3A 1SE2A 4GDLB 2FBWB 4OVZA 3QX1A 2N9KA 2ZNVC 4N58A 3NZSA 3Q3JA 1WRIA 4MGKE 1VZ8A 4C00A 2KWVB 3GP7A 2JY6A 4US9A 2LXCA 4FA6A 1AARA 2Q5WD 4ITKA 1C4CA 5GMVA 3IHPC 1CMXB 1KM7A 1B1ZA 5J17A 2GOWA 5HHDG 3WIMA 2KLCA 3GZNI 4URKA 3HRDD 1DGJA 2Y5CA 1Q1OA 3R3MA 1TYGB 1ZUD2 2KAJA 1MG4A 4HDOA 1XT9B 3DWMA 3BY4B 3NVZA 1FXIA 1WGGA 2NBVB 1V6EA 2UU7A 1WE7A 3BVGA 5DPRA 2WXJA 1OFFA 2WYQA 5L83A 1FRDA 2WDTB 3HVDA 3MTNB 4JL9A 2GBMA 3QC8B 1V81A 2AX5A 4XC2A 1NYRA 4P6VF 2MRPA 2C7MB 3H9DA 3PHWB 1AYFA 2K3UA 5E6PA 3AM9A 1CJEA 3BYTB 3OAWA 3GS2A 1IGCA 4MJSA 1DOXA 1K53A 3M95A 3N30A 3EFCA 4EFOA 4YSZB 2QEJC 1XQQA 3I63C 2JYTA 3LJ3A 4G50A 1EWCA 3RNFC 2L83A 2JQRB 2BF8B 4ZDVA 3PZ8A 2AEHA 4YTPB 2PTLA 4HXDA 3ZIMA 1SIJA 2BT6A 1LFDA 3ZJVA 4IOIE 3PGEA 1WX8A 5G5GA 3RULA 3VTUA 1D4BA 1C76A 4BBNC 2B76B 3OG5A 1RAXA 1IP9A 4YXDB 4P1BC 3ZNID 1QZEA 2NR2A 3V3XA 1TJEA 2WXIA 4C4VB 4DQOC 1KFYB 5C2TB 4MM3A 4WQOB 3I5JC 4CYEA 3IT6B 5JXVA 3LB8C 4II2B 1V1OA 1HE8A 2PE6B 2KWCA 5D3IB 5HKHA 2YEPF 5G55A 4M0WB 4GDKB 5JH5C 2MBHA 2K8HA 3DWGC 1C3TA 1JROA 1AN8A 2NMQA 1NYQA 3AXCA 4OZAA 4DDID 3V6CB 1DYQA 2N1WA 1GC6A 5DCNA 2BS2B 2MJDA 1BXTA 2PW9A 1GC7A 4RGTA 3L10B 3GE3C 3N1XC 1SBBB 3RUIB 2HTME 1IGDA 2KACA 3A9KB 2D3CA 4ZRPA 2I1KA 2Y3AA 2C5LC 1F2RI 4N9F4 2L8JA 3EECA 1MHHE 3H6NA 4XWTA 1JWMD 2KMMA 2KZRA 2HTHA 4D2KA 2IO2B 1TIFA 3NOBA 3SD5A 1VCBA 2D3AA 1E7VA 1ACCA 1SF0A 2W3RA 4NJCA 2QILA 4BKGA 2WXKA 2VH1A 3DHIC 2J4XA 2WXRA 1FNWA 4GB9A 5BYQA 1VZ7A 2I38A 2Z8LA 4BOSC 2O6VD 2K8CA 2HE7A 2NPTA 1Z2MA 3GOEA 3ZO5B 2KKCA 2LHDA 2UYZB 5G5HA 1WJUA 2INPE 5CHWA 2N4FA 2O2VA 2WHIA 1LQBA 1SB3C 5LLIA 3VDZA 2WU2B 4N6EB 1TKGA 3ZW3A 1V5OA 3NY5A 4TKNA 5CHFA 3N3KB 4ANWA 4EZKA 3PHXB 3PLVA 4M00A 2RR9A 1YN3A 1F2RC 1WMHA 1NBFC 1XCQL 1JWBD 2RDBC 1E7PB 2DZMA 2ICIA 4W9EA 3W2DA 1GNUA 5J18A 1YJ1A 1ET6A 1JMLA 1N5WA 1K52A 1EF5A 3LXFA 4K81A 1JWUD 3ZUNA 2LZ6A 4MJSB 3VR8B 2PEAA 2FCQA 1CZPA 3W1SC 1K8RB 4NAMA 2INCC 4ZRKA 4MGIE 2K25A 3UIOB 2DX5B 3JW0X 2BYVE 4ICUA 2M8SA 4GN1A 3SEBA 3K9OB 1UGJA 4FXCA 4EOYA 2EMTA 3URYA 2I2YA 4CO7A 3EA6A 2KLGA 4KDLB 2JT4B 4W9KA 1TY2A 2M56B 4FHJA 2PMVA 1YJIA 2KMAA 3CSTA 3IVFA 3DBSA 3DBHB 4JGHB 4MM3B 4XGAB 4LJOB 3PO0A 3ZNGC 1SGHA 2LXAA 2BYFA 4E74A 2UWQA 3DVNV 1QF6A 4ZRQA 2PKOA 5EDSA 1N62A 3B2GA 1DOYA 1E0ZA 2PLPA 3ZNHB 3WANA 4OZCA 2XEWA 5IAAC 2BTEA 3DVNU 2Z59B 4HPPA 4GOCA 3WAOA 3RZWC 2LWPA 3AU4A 1PGAA 3L13A 3LDZE 2FUHB 4C7ZA 1E10A 3PSEB 1T0QC 1WXAA 1FNVA 3GE8C 4P16A 2K6DB 3NZUA 2AQ2B 2FUG1 4I6PA 2MA9B 3L0WB 4EE2A 2CU1A 2AWTA 2G45B 4MGYE 3ABVB 2M1MA 3DVGY 2FNJB 1LGRA 1Q5WB 2GRIA 4YTMB 2W9NA 2WLBA 1KLUD 3ZNZB 5DPTA 1EWYC 1KRHA 1P7FA 1TBEA 4IWOA 1FRRA 4WAAA 5EE1A 1SXTA 2G4SA 3KW5B 1U4AA 5BO4B 5AEKB 1NI2A 1N6ZA 1PFDA 1WY8A 3NHEB 1SE3A 1J8CA 2KDIA 2QCZA 1K50A 4KX6B 2QC8A 3CSFA 5BMIA 4FN2A 3E56A 1WGYA 3T9LA 1WR1A 2YVCA 1WYWB 1ZOYB 4XWWA 1ZW7A 2KYWA 2MQJA 5FK9C 5I4DA 2LGDA 1UWMA 3AE2B 3ZVVA 1TS4A 5G2NA 2JX5A 2O2VB 2RD0A 2YEPB 1QKZA 4DK5A 1UH6A 2FCSA 2ON8A 5J2RA 4NY0A 5BMGA 3PPAA 3R2IA 1D6EC 2J0MA 1PUTA 3PRPB 2WS3B 1KOTA 1WMHB 4TUUA 3I3TB 3VRBB 1EU3A 1S3SG 2M4NA 2CU3A 3P42A 1RRBA 2HJ1A 4LNKA 2G9HD 4F8CB 1KLVA 2Z0EB 1EUVB 1GG3A 2ZVOA 5FR6A 3AH7A 4L23A 3B2FA 2PE9A 3B9JA 3MC0B 4TMAB 3DDCB 3SFEB 2JPHA 3KUCB 1OEYA 4LCDE 1XXGA 3I9V1 4MT5A 1RFKA 4DWFA 1TT5B 2BGFA 3KQ4A 2V1YA 3VUYA 1QOAA 2VZKB 3TCAA 1NI3A 3L4PA 4G11A 5H92C 3IFWB 1F1HA 3Q2AC 2WDQB 2C7HA 2WXNA 2BW2A 5D2MB 1KLGD 2GBRA 2IO0B 4LNFA 4C7YA 3HVZA 1IPGA 2GI9A 3RPFC 2MLBA 2N0SB 1JQ4A 3U2SC 3OWEB 3DHGC 4A6QA 3TEXA
chains in the Genus database with same CATH topology
2A5UA 4IW0A 1XQQA 4AP4C 2KNBA 5JHBA 1RFAA 3KUDB 2CR5A 3NS8A 2FCMA 4HVBA 5DPWA 3AULA 2MBQA 3LJ3A 3PT2B 4G50A 3H7SA 3VH3B 3QHTA 4G0NB 4DBGA 4FJVB 3PLUA 4EUTA 2BF8B 4ZDVA 1UELA 4W9FA 2AEHA 4WJOA 4A20A 2IO3B 2ZJDA 4HXDA 3WALA 4WWPA 3ZIMA 3ML8A 2N7EA 2L7RA 1LFDA 4ANXA 2RSUA 3PS6A 3UIPB 3RYTA 3DBHI 2KO3A 3A1QA 1OTRB 3PGEA 4WJQA 3HM6X 2EKEC 1WX8A 3RULA 3HK0A 3VTUA 2DYOA 2C60A 3KH0A 3A9JB 4BBNC 1S1QB 4W9LA 3A9KA 4IWQA 3CMMB 2LVQA 4W9DA 1RAXA 1IP9A 1L2NA 1WJNA 2IY1B 2IY0B 2LVPA 3ZNID 3AI5A 1QZEA 2NR2A 1OGWA 2KK8A 3PRZA 1VD2A 2ZNVB 3ZTCA 4MM3A 4WQOB 3SDLC 1WR6E 4CYEA 2MSED 2JZ3B 2JRHA 1WH3A 5AZFA 3SHQA 3M3JA 4NAWA 4II2B 1YD8U 5E6OA 5D94A 1HE8A 2PE6B 2KWCA 1UBQA 4G3XB 2IO1B 1V80A 4EZLA 5G55A 5HKHA 5KHOA 4EKUA 1G6JA 2KX3A 1EO6A 1Y8RC 4M0WB 4GDKB 5JH5C 4DHJD 4NQKE 2MBHA 3IBEA 3B1LX 2K8HA 2MCNB 1C3TA 3AXCA 3TL5A 4DDID 3V6CB 1WGRA 2DYMA 1V49A 2N1WA 1GC6A 2G3QB 3VUXA 5DCNA 2B3AA 1P0RA 2ZVNA 3EHVA 3T8MA 3TBLD 1GC7A 3L10B 4PYUA 5JHAA 1E90A 4FBJB 2JVCA 2ZPYA 2JXXA 2ZEQA 3RUIB 2M17A 3L17A 2KQ7A 3QIJA 3CF6E 3A9KB 2I1KA 4W9CA 3QA8A 5JZEB 2C5LC 3DBLI 4KDIC 2DAFA 3C0RB 3V60A 4AJYB 4N9F4 2L8JA 1H4RA 5C1ZA 5IA7A 2CS4A 3EECA 4CHKA 4HPMB 1MG8A 3H6NA 2J0KA 4MGZE 4ASWC 1V9JA 2MBBB 4KZ0A 4HDQA 1WM3A 2LASA 4BKSD 3JSVA 3OJ4B 2R2OA 2KZRA 3VVWB 4BVUC 2HTHA 2IO2B 4GGQA 4NJ6A 2IBIB 3ENEA 3NOBA 3O65B 4MSQB 4ZRJA 2WX1A 5TR5A 3X23A 3SD5A 1VCBA 3PTFC 5L95C 3KVFB 1E7VA 3DVGX 2XK5A 4FJYA 1UZXB 1P9DU 2BYEA 2N9EB 3ZDMC 2BKRB 2MP2A 4KVGB 4BKGA 3KYDD 2AL6A 3BINA 1I35A 1P1AA 5C23A 4GU2A 4TQ1A 3N32A 4KIKB 4GB9A 4LJPB 2GMIC 2KHWB 2BWFA 2YLMA 2I1JA 1SE9A 4BOSC 3UGBB 2O6VD 3JYUA 1WF9A 2K8CA 4HK2A 2HE7A 2NPTA 1Z2MA 4FLHA 4K7SA 3VAWA 4DHZB 4DXAB 1WZ3A 3GOEA 4M8MA 1WJ4A 3W1SA 3ZO5B 4BKSA 2KKCA 4W9HA 3ZRFA 2KTRB 2ZPNA 3WA0A 1L7YA 4WJPA 4NQLB 2UYZB 3ONSA 4PS7A 5CHVC 3RZFA 1WJUA 1WX7A 2M0XA 5CHWA 2N4FA 3APCA 3Q3FA 3RD2A 2O2VA 1LQBA 4MEMA 5LLIA 3VDZA 2JUOA 3PZDA 2LJ5A 3ZW3A 1V5OA 1WRDB 3NY5A 4GDLA 4TKNA 2BPSA 5CHFA 2LRUA 3N3KB 4X57B 4XZ4A 4ANWA 3K9PB 1Z5SB 4IM3A 2R2QA 2K1FA 4EZKA 3PHXB 3PLVA 2FIFA 2NBUA 3APDA 3VTWA 2ASQA 3UQAA 2RR9A 2WWZA 2O6VA 3EFUA 1WE6A 2J0JA 1WI0A 3H7PA 1YX6B 4JLCA 4W9GA 1TGZB 1WMHA 2NVUI 2KJ6A 3VTVA 1NDDA 1NBFC 2N9PC 4AUQC 2KQSA 4FULA 2N9XA 2DZMA 2DAJA 3TJPA 5E6NA 4W9EA 4HCPB 5KHQA 2HD5B 1BT0A 1GNUA 5J18A 1J19A 1YJ1A 4K81A 1EF5A 3L54A 3ZLZA 3ZUNA 2LZ6A 4MJSB 1E5WA 1E8YA 2KTFA 4GMVA 4HLEA 2NPTB 2PEAA 3H1UA 1H8CA 2JF5A 2LGXA 4J6IA 2FCQA 4PS8A 4B6WA 4KSKC 1WGHA 3RT3B 3W1SC 2KDBA 1K8RB 4ANVA 2NS5A 3HIZA 4ZRKA 4MGIE 1IYFA 2K25A 3D32A 3UIOB 4AWJA 2DX5B 3JW0X 5DPSA 2BYVE 4NNJB 4ICUA 5D7GA 3ZKJC 2M8SA 3A4SC 2IZVB 3U30A 1XD3B 1WXMA 3R66C 4E3CA 4GN1A 2AL3A 2D2QA 4BKTA 2ZCBA 3QQ8B 3K9OB 5LXHA 4F1SA 2L0TA 1WXVA 4TV3A 2KFKA 4ICVA 3PREA 4EOYA 2EMTA 2L3ZA 2V3SA 3PVLA 1R4MI 4CO7A 1PQSA 3A1QB 1TZ1A 4KSLC 2KLGA 4KDLB 2JT4B 2FAZA 2LUEA 4II3B 4W9KA 1F9JA 2IYDB 2MWSB 4IWPA 2ZZPB 3W1YA 4FHJA 1GUAB 2D3GA 3DOWA 5CTRC 1R4NI 2CHXA 2KMAA 1KJTA 3QJZA 3JVZX 2MBOA 4M8NA 1A5RA 2KANA 3CSTA 2K39A 3IVFA 3DBSA 3ML9A 2C9WB 4JGHB 1T0YA 1JRUA 1V86A 3QARA 4B9KA 4LJOB 2GBKA 2G4DB 3ZNGC 1SGHA 2J7QB 2LXAA 2BYFA 1EF1A 4NAWB 4E74A 2UWQA 2GBNA 3DVNV 1WM2A 4XX5A 1E8WA 1V5TA 4DHZE 4AJWA 2CHZA 2KXJA 3HM3A 2XBBC 2DYBA 5EDSA 2DZKA 4F7ZA 3WAPA 3R7QA 2NCNA 1J0GA 3ZNHB 2KC1A 3WANA 4FADA 2XEWA 5IAAC 1UGMA 2DZJA 2CHWA 2JRIB 3DVNU 4IC7B 2Z59B 5CX3A 1GJZA 3M62B 4GOCA 4W9IA 3SU8X 3WAOA 2L0FA 2KJRA 4IG7B 5D6JB 2LWPA 3RZWC 3U8ZA 3AU4A 3RCZA 4HPLB 3V61A 3TMPB 3L13A 3DPDA 2KFJA 2FUHB 3LDZE 2NBWB 3MHSD 4IM0A 1WZ0A 1RLFA 4JQWC 4NPNA 1WXSA 3PSEB 1WXAA 1C1YB 3APFA 5AZHA 2MBEA 2C7NB 3A9JA 4HWIB 1WGDA 2K6DB 3NZUA 2D07B 4I6PA 2MA9B 3L0WB 1ISNA 1X1MA 2K6QA 2CU1A 2AWTA 2G45B 3A4RA 4MGYE 3U7DA 2GBJA 1E8ZA 2KOXA 1YQBA 2M1MA 1M94A 2N1VA 2MW5A 3DVGY 2FNJB 3VUWA 4DHJB 2KDEB 1Q5WB 3VHTC 2RPQA 2W9NA 1WJ6A 3JSVB 2BKFA 2MX2A 4ANUA 3ZNZB 5DPTA 2JWZA 2REXA 2PPHA 3ZRCA 1TBEA 3UINB 4IWOA 2D11A 2DHZA 3P2BA 4WAAA 4A3OA 2G4SA 3KW5B 2A4ZA 1U4AA 5BO4B 5AEKB 2XK5B 4W9JA 2PJHA 2KVRA 1NI2A 4GDKA 4MH0E 3QCAA 2MP2B 4A3PA 1WY8A 3NHEB 4BOZB 4OVUA 1J8CA 2KDIA 3KUZA 3ZDTA 3DBRI 3DCGA 4OVVA 3VFKA 1LM8B 2FIDA 3S2AA 3PRMB 4HJKA 3VQIA 2CKHB 2L05A 4AOFA 3M63B 3CSFA 1WIAA 3L08A 3V6EB 3QAQA 4FN2A 1YIWA 1WGYA 2LVOA 3T9LA 4BBNF 1WR1A 2KC2A 3OLMD 1E7UA 2KJHB 2YVCA 2RGFA 3UQBA 1WYWB 1OEYJ 2D10A 2JZZA 4P7IA 4E71A 3V62A 1ZW7A 2KMCA 4I6LB 2V4LA 2MQJA 1ZKHA 2AYOB 2LI5A 3B08A 4LDTD 2LGDA 3ZVVA 5G2NA 2L76A 2O2VB 2RD0A 4DK5A 2EMSA 3L16A 1D3ZA 3ZTDA 2OOBB 1UD7A 1I42A 1UH6A 2FCSA 3OJ3A 5J2RA 4GDLB 4NY0A 4TQ0A 3R7RA 3QX1A 2ZNVC 3EC8A 3NZSA 3PPAA 3Q3JA 4EEWA 4MGKE 3DQVA 2J0MA 1FXTB 2KDFB 4PYZA 3PRPB 2O6VB 2KWVB 1P3QU 4YL8A 3H7PB 2JY6A 2LXCA 1KOTA 1WMHB 4FA6A 4GIVA 4TUUA 1WX9A 3I3TB 1AARA 2BWES 1S3SG 2M4NA 3VXWA 4EZJA 5GMVA 3IHPC 2DZIA 4K7UA 4KIKA 1CMXB 3HHMA 4MSMB 1RRBA 1KM7A 4FJZA 3IG3A 2OJRA 5J17A 2GOWA 2N7DA 4F8CB 1KLVA 2Z0EB 1EUVB 3VH4B 3WIMA 1GG3A 2KLCA 3GZNI 4URKA 1LXDA 2KN5A 2ZVOA 2K8BA 1Q1OA 5FR6A 2KTRA 3R3MA 4KV2A 2KD0A 4IUMB 4HCNB 1V2YA 4IM2A 4I6NB 4PS3A 3A33B 3X0WA 2PE9A 1XT9B 4HDOA 3BY4B 1WGGA 2NBVB 1V6EA 2LGYA 4ZRIA 2VRRB 1UBIA 3DDCB 3UF8A 1Q0WB 2JPHA 3KUCB 1WE7A 1OEYA 4WJNA 5DPRA 4LCDE 3PV1A 2WYQA 4K7WA 5L83A 2DENB 4BFRA 4DWFA 4RMAA 2BGFA 2LD9A 4RM9A 4RM8A 5AZGA 2WDTB 3MTNB 4JL9A 2V1YA 2KFKB 1YX5B 2WX0A 2Z0DB 4WWOA 2GBMA 3VUYA 3QC8B 1WFYA 4FHKA 1V81A 3TIXA 2FCNA 1P98A 3TCAA 3WAMA 4XC2A 3ECIA 4G11A 3IFWB 2MRPA 1TTNA 2C7HA 4JIOU 4MELA 2C7MB 4KZCA 4B95A 5D2MB 3H9DA 3PHWB 2LRWA 2GBRA 3QWZB 1OQYA 2IO0B 5E6PA 2ZCCA 2KX0A 4LDTB 2KWUB 5LXIB 1IPGA 3ALBA 2HJ8A 3OAWA 4MDKE 4MJSA 4GXBA 4ZYNA 3KYCD 4NJ7A 2MLBA 2QHOA 3B0AA 1SIFA 3M95A 3MJWA 3QK0A 4WWNA 3N30A 2Y5BB 3AU5A 4EFOA 4K1RB 1ZGUB 4DDGD 2L00B 1E8XA 4GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5U A;  4IW0 A;  1XQQ A;  4AP4 C;  2KNB A;  5JHB A;  1RFA A;  3KUD B;  2CR5 A;  3NS8 A;  2FCM A;  4HVB A;  5DPW A;  3AUL A;  2MBQ A;  3LJ3 A;  3PT2 B;  4G50 A;  3H7S A;  3VH3 B;  3QHT A;  4G0N B;  4DBG A;  4FJV B;  3PLU A;  4EUT A;  2BF8 B;  4ZDV A;  1UEL A;  4W9F A;  2AEH A;  4WJO A;  4A20 A;  2IO3 B;  2ZJD A;  4HXD A;  3WAL A;  4WWP A;  3ZIM A;  3ML8 A;  2N7E A;  2L7R A;  1LFD A;  4ANX A;  2RSU A;  3PS6 A;  3UIP B;  3RYT A;  3DBH I;  2KO3 A;  3A1Q A;  1OTR B;  3PGE A;  4WJQ A;  3HM6 X;  2EKE C;  1WX8 A;  3RUL A;  3HK0 A;  3VTU A;  2DYO A;  2C60 A;  3KH0 A;  3A9J B;  4BBN C;  1S1Q B;  4W9L A;  3A9K A;  4IWQ A;  3CMM B;  2LVQ A;  4W9D A;  1RAX A;  1IP9 A;  1L2N A;  1WJN A;  2IY1 B;  2IY0 B;  2LVP A;  3ZNI D;  3AI5 A;  1QZE A;  2NR2 A;  1OGW A;  2KK8 A;  3PRZ A;  1VD2 A;  2ZNV B;  3ZTC A;  4MM3 A;  4WQO B;  3SDL C;  1WR6 E;  4CYE A;  2MSE D;  2JZ3 B;  2JRH A;  1WH3 A;  5AZF A;  3SHQ A;  3M3J A;  4NAW A;  4II2 B;  1YD8 U;  5E6O A;  5D94 A;  1HE8 A;  2PE6 B;  2KWC A;  1UBQ A;  4G3X B;  2IO1 B;  1V80 A;  4EZL A;  5G55 A;  5HKH A;  5KHO A;  4EKU A;  1G6J A;  2KX3 A;  1EO6 A;  1Y8R C;  4M0W B;  4GDK B;  5JH5 C;  4DHJ D;  4NQK E;  2MBH A;  3IBE A;  3B1L X;  2K8H A;  2MCN B;  1C3T A;  3AXC A;  3TL5 A;  4DDI D;  3V6C B;  1WGR A;  2DYM A;  1V49 A;  2N1W A;  1GC6 A;  2G3Q B;  3VUX A;  5DCN A;  2B3A A;  1P0R A;  2ZVN A;  3EHV A;  3T8M A;  3TBL D;  1GC7 A;  3L10 B;  4PYU A;  5JHA A;  1E90 A;  4FBJ B;  2JVC A;  2ZPY A;  2JXX A;  2ZEQ A;  3RUI B;  2M17 A;  3L17 A;  2KQ7 A;  3QIJ A;  3CF6 E;  3A9K B;  2I1K A;  4W9C A;  3QA8 A;  5JZE B;  2C5L C;  3DBL I;  4KDI C;  2DAF A;  3C0R B;  3V60 A;  4AJY B;  4N9F 4;  2L8J A;  1H4R A;  5C1Z A;  5IA7 A;  2CS4 A;  3EEC A;  4CHK A;  4HPM B;  1MG8 A;  3H6N A;  2J0K A;  4MGZ E;  4ASW C;  1V9J A;  2MBB B;  4KZ0 A;  4HDQ A;  1WM3 A;  2LAS A;  4BKS D;  3JSV A;  3OJ4 B;  2R2O A;  2KZR A;  3VVW B;  4BVU C;  2HTH A;  2IO2 B;  4GGQ A;  4NJ6 A;  2IBI B;  3ENE A;  3NOB A;  3O65 B;  4MSQ B;  4ZRJ A;  2WX1 A;  5TR5 A;  3X23 A;  3SD5 A;  1VCB A;  3PTF C;  5L95 C;  3KVF B;  1E7V A;  3DVG X;  2XK5 A;  4FJY A;  1UZX B;  1P9D U;  2BYE A;  2N9E B;  3ZDM C;  2BKR B;  2MP2 A;  4KVG B;  4BKG A;  3KYD D;  2AL6 A;  3BIN A;  1I35 A;  1P1A A;  5C23 A;  4GU2 A;  4TQ1 A;  3N32 A;  4KIK B;  4GB9 A;  4LJP B;  2GMI C;  2KHW B;  2BWF A;  2YLM A;  2I1J A;  1SE9 A;  4BOS C;  3UGB B;  2O6V D;  3JYU A;  1WF9 A;  2K8C A;  4HK2 A;  2HE7 A;  2NPT A;  1Z2M A;  4FLH A;  4K7S A;  3VAW A;  4DHZ B;  4DXA B;  1WZ3 A;  3GOE A;  4M8M A;  1WJ4 A;  3W1S A;  3ZO5 B;  4BKS A;  2KKC A;  4W9H A;  3ZRF A;  2KTR B;  2ZPN A;  3WA0 A;  1L7Y A;  4WJP A;  4NQL B;  2UYZ B;  3ONS A;  4PS7 A;  5CHV C;  3RZF A;  1WJU A;  1WX7 A;  2M0X A;  5CHW A;  2N4F A;  3APC A;  3Q3F A;  3RD2 A;  2O2V A;  1LQB A;  4MEM A;  5LLI A;  3VDZ A;  2JUO A;  3PZD A;  2LJ5 A;  3ZW3 A;  1V5O A;  1WRD B;  3NY5 A;  4GDL A;  4TKN A;  2BPS A;  5CHF A;  2LRU A;  3N3K B;  4X57 B;  4XZ4 A;  4ANW A;  3K9P B;  1Z5S B;  4IM3 A;  2R2Q A;  2K1F A;  4EZK A;  3PHX B;  3PLV A;  2FIF A;  2NBU A;  3APD A;  3VTW A;  2ASQ A;  3UQA A;  2RR9 A;  2WWZ A;  2O6V A;  3EFU A;  1WE6 A;  2J0J A;  1WI0 A;  3H7P A;  1YX6 B;  4JLC A;  4W9G A;  1TGZ B;  1WMH A;  2NVU I;  2KJ6 A;  3VTV A;  1NDD A;  1NBF C;  2N9P C;  4AUQ C;  2KQS A;  4FUL A;  2N9X A;  2DZM A;  2DAJ A;  3TJP A;  5E6N A;  4W9E A;  4HCP B;  5KHQ A;  2HD5 B;  1BT0 A;  1GNU A;  5J18 A;  1J19 A;  1YJ1 A;  4K81 A;  1EF5 A;  3L54 A;  3ZLZ A;  3ZUN A;  2LZ6 A;  4MJS B;  1E5W A;  1E8Y A;  2KTF A;  4GMV A;  4HLE A;  2NPT B;  2PEA A;  3H1U A;  1H8C A;  2JF5 A;  2LGX A;  4J6I A;  2FCQ A;  4PS8 A;  4B6W A;  4KSK C;  1WGH A;  3RT3 B;  3W1S C;  2KDB A;  1K8R B;  4ANV A;  2NS5 A;  3HIZ A;  4ZRK A;  4MGI E;  1IYF A;  2K25 A;  3D32 A;  3UIO B;  4AWJ A;  2DX5 B;  3JW0 X;  5DPS A;  2BYV E;  4NNJ B;  4ICU A;  5D7G A;  3ZKJ C;  2M8S A;  3A4S C;  2IZV B;  3U30 A;  1XD3 B;  1WXM A;  3R66 C;  4E3C A;  4GN1 A;  2AL3 A;  2D2Q A;  4BKT A;  2ZCB A;  3QQ8 B;  3K9O B;  5LXH A;  4F1S A;  2L0T A;  1WXV A;  4TV3 A;  2KFK A;  4ICV A;  3PRE A;  4EOY A;  2EMT A;  2L3Z A;  2V3S A;  3PVL A;  1R4M I;  4CO7 A;  1PQS A;  3A1Q B;  1TZ1 A;  4KSL C;  2KLG A;  4KDL B;  2JT4 B;  2FAZ A;  2LUE A;  4II3 B;  4W9K A;  1F9J A;  2IYD B;  2MWS B;  4IWP A;  2ZZP B;  3W1Y A;  4FHJ A;  1GUA B;  2D3G A;  3DOW A;  5CTR C;  1R4N I;  2CHX A;  2KMA A;  1KJT A;  3QJZ A;  3JVZ X;  2MBO A;  4M8N A;  1A5R A;  2KAN A;  3CST A;  2K39 A;  3IVF A;  3DBS A;  3ML9 A;  2C9W B;  4JGH B;  1T0Y A;  1JRU A;  1V86 A;  3QAR A;  4B9K A;  4LJO B;  2GBK A;  2G4D B;  3ZNG C;  1SGH A;  2J7Q B;  2LXA A;  2BYF A;  1EF1 A;  4NAW B;  4E74 A;  2UWQ A;  2GBN A;  3DVN V;  1WM2 A;  4XX5 A;  1E8W A;  1V5T A;  4DHZ E;  4AJW A;  2CHZ A;  2KXJ A;  3HM3 A;  2XBB C;  2DYB A;  5EDS A;  2DZK A;  4F7Z A;  3WAP A;  3R7Q A;  2NCN A;  1J0G A;  3ZNH B;  2KC1 A;  3WAN A;  4FAD A;  2XEW A;  5IAA C;  1UGM A;  2DZJ A;  2CHW A;  2JRI B;  3DVN U;  4IC7 B;  2Z59 B;  5CX3 A;  1GJZ A;  3M62 B;  4GOC A;  4W9I A;  3SU8 X;  3WAO A;  2L0F A;  2KJR A;  4IG7 B;  5D6J B;  2LWP A;  3RZW C;  3U8Z A;  3AU4 A;  3RCZ A;  4HPL B;  3V61 A;  3TMP B;  3L13 A;  3DPD A;  2KFJ A;  2FUH B;  3LDZ E;  2NBW B;  3MHS D;  4IM0 A;  1WZ0 A;  1RLF A;  4JQW C;  4NPN A;  1WXS A;  3PSE B;  1WXA A;  1C1Y B;  3APF A;  5AZH A;  2MBE A;  2C7N B;  3A9J A;  4HWI B;  1WGD A;  2K6D B;  3NZU A;  2D07 B;  4I6P A;  2MA9 B;  3L0W B;  1ISN A;  1X1M A;  2K6Q A;  2CU1 A;  2AWT A;  2G45 B;  3A4R A;  4MGY E;  3U7D A;  2GBJ A;  1E8Z A;  2KOX A;  1YQB A;  2M1M A;  1M94 A;  2N1V A;  2MW5 A;  3DVG Y;  2FNJ B;  3VUW A;  4DHJ B;  2KDE B;  1Q5W B;  3VHT C;  2RPQ A;  2W9N A;  1WJ6 A;  3JSV B;  2BKF A;  2MX2 A;  4ANU A;  3ZNZ B;  5DPT A;  2JWZ A;  2REX A;  2PPH A;  3ZRC A;  1TBE A;  3UIN B;  4IWO A;  2D11 A;  2DHZ A;  3P2B A;  4WAA A;  4A3O A;  2G4S A;  3KW5 B;  2A4Z A;  1U4A A;  5BO4 B;  5AEK B;  2XK5 B;  4W9J A;  2PJH A;  2KVR A;  1NI2 A;  4GDK A;  4MH0 E;  3QCA A;  2MP2 B;  4A3P A;  1WY8 A;  3NHE B;  4BOZ B;  4OVU A;  1J8C A;  2KDI A;  3KUZ A;  3ZDT A;  3DBR I;  3DCG A;  4OVV A;  3VFK A;  1LM8 B;  2FID A;  3S2A A;  3PRM B;  4HJK A;  3VQI A;  2CKH B;  2L05 A;  4AOF A;  3M63 B;  3CSF A;  1WIA A;  3L08 A;  3V6E B;  3QAQ A;  4FN2 A;  1YIW A;  1WGY A;  2LVO A;  3T9L A;  4BBN F;  1WR1 A;  2KC2 A;  3OLM D;  1E7U A;  2KJH B;  2YVC A;  2RGF A;  3UQB A;  1WYW B;  1OEY J;  2D10 A;  2JZZ A;  4P7I A;  4E71 A;  3V62 A;  1ZW7 A;  2KMC A;  4I6L B;  2V4L A;  2MQJ A;  1ZKH A;  2AYO B;  2LI5 A;  3B08 A;  4LDT D;  2LGD A;  3ZVV A;  5G2N A;  2L76 A;  2O2V B;  2RD0 A;  4DK5 A;  2EMS A;  3L16 A;  1D3Z A;  3ZTD A;  2OOB B;  1UD7 A;  1I42 A;  1UH6 A;  2FCS A;  3OJ3 A;  5J2R A;  4GDL B;  4NY0 A;  4TQ0 A;  3R7R A;  3QX1 A;  2ZNV C;  3EC8 A;  3NZS A;  3PPA A;  3Q3J A;  4EEW A;  4MGK E;  3DQV A;  2J0M A;  1FXT B;  2KDF B;  4PYZ A;  3PRP B;  2O6V B;  2KWV B;  1P3Q U;  4YL8 A;  3H7P B;  2JY6 A;  2LXC A;  1KOT A;  1WMH B;  4FA6 A;  4GIV A;  4TUU A;  1WX9 A;  3I3T B;  1AAR A;  2BWE S;  1S3S G;  2M4N A;  3VXW A;  4EZJ A;  5GMV A;  3IHP C;  2DZI A;  4K7U A;  4KIK A;  1CMX B;  3HHM A;  4MSM B;  1RRB A;  1KM7 A;  4FJZ A;  3IG3 A;  2OJR A;  5J17 A;  2GOW A;  2N7D A;  4F8C B;  1KLV A;  2Z0E B;  1EUV B;  3VH4 B;  3WIM A;  1GG3 A;  2KLC A;  3GZN I;  4URK A;  1LXD A;  2KN5 A;  2ZVO A;  2K8B A;  1Q1O A;  5FR6 A;  2KTR A;  3R3M A;  4KV2 A;  2KD0 A;  4IUM B;  4HCN B;  1V2Y A;  4IM2 A;  4I6N B;  4PS3 A;  3A33 B;  3X0W A;  2PE9 A;  1XT9 B;  4HDO A;  3BY4 B;  1WGG A;  2NBV B;  1V6E A;  2LGY A;  4ZRI A;  2VRR B;  1UBI A;  3DDC B;  3UF8 A;  1Q0W B;  2JPH A;  3KUC B;  1WE7 A;  1OEY A;  4WJN A;  5DPR A;  4LCD E;  3PV1 A;  2WYQ A;  4K7W A;  5L83 A;  2DEN B;  4BFR A;  4DWF A;  4RMA A;  2BGF A;  2LD9 A;  4RM9 A;  4RM8 A;  5AZG A;  2WDT B;  3MTN B;  4JL9 A;  2V1Y A;  2KFK B;  1YX5 B;  2WX0 A;  2Z0D B;  4WWO A;  2GBM A;  3VUY A;  3QC8 B;  1WFY A;  4FHK A;  1V81 A;  3TIX A;  2FCN A;  1P98 A;  3TCA A;  3WAM A;  4XC2 A;  3ECI A;  4G11 A;  3IFW B;  2MRP A;  1TTN A;  2C7H A;  4JIO U;  4MEL A;  2C7M B;  4KZC A;  4B95 A;  5D2M B;  3H9D A;  3PHW B;  2LRW A;  2GBR A;  3QWZ B;  1OQY A;  2IO0 B;  5E6P A;  2ZCC A;  2KX0 A;  4LDT B;  2KWU B;  5LXI B;  1IPG A;  3ALB A;  2HJ8 A;  3OAW A;  4MDK E;  4MJS A;  4GXB A;  4ZYN A;  3KYC D;  4NJ7 A;  2MLB A;  2QHO A;  3B0A A;  1SIF A;  3M95 A;  3MJW A;  3QK0 A;  4WWN A;  3N30 A;  2Y5B B;  3AU5 A;  4EFO A;  4K1R B;  1ZGU B;  4DDG D;  2L00 B;  1E8X A;  4GSW A; 
#chains in the Genus database with same CATH topology
 2A5U A;  2IND C;  2KNB A;  1RWS A;  1RFA A;  3KUD B;  2CR5 A;  1YMH E;  2FCM A;  2ACZ B;  5DPW A;  1B9R A;  3PT2 B;  4WUR A;  3H7S A;  1L6V A;  4EUT A;  4FJV B;  4XYC A;  3AE9 B;  4W9F A;  4WJO A;  2IO3 B;  1T0S C;  5C3J B;  3ML8 A;  2RSU A;  1A70 A;  2RDG A;  3R2T A;  3RYT A;  3DBH I;  2KO3 A;  4WJQ A;  5EE0 A;  3FIL A;  3HK0 A;  3A9K A;  4RF1 A;  4S17 A;  1L2N A;  1F0Z A;  2IY0 B;  3MHZ A;  3P1M A;  1OGW A;  4P1C C;  3Q3M C;  5BYR A;  3SDL C;  1WR6 E;  1OQQ A;  1I4H A;  1YD8 U;  3ZYY X;  1V80 A;  1XO3 A;  2K22 A;  2J52 A;  3U4E G;  2BS3 B;  4DHJ D;  3IBE A;  4K3B A;  3TL5 A;  1WGR A;  2RPV A;  2WDR B;  2G3Q B;  3VUX A;  2B3A A;  3TBL D;  4PYU A;  5JHA A;  2L1A A;  2KT7 A;  2M17 A;  2KQ7 A;  1L0X B;  4YTN B;  4YWG G;  5H8Y E;  4W9C A;  3QA8 A;  1MPE A;  4AJY B;  4KDI C;  2QMT A;  1L4D B;  2VH2 A;  2ZW0 A;  3AE8 B;  3Q3N C;  4CHK A;  1XLP A;  1MG8 A;  4MGZ E;  4ASW C;  1SJH D;  2HDE A;  1L0V B;  3OJ4 B;  2R2O A;  3O13 A;  1JWS D;  4BVU C;  4GGQ A;  2IBI B;  4MSQ B;  2R61 A;  3DVG X;  1P9D U;  5FR3 A;  1QOB A;  3ZDM C;  2IGD A;  2MP2 A;  3AV8 A;  1I35 A;  5C23 A;  2QJL A;  4LJP B;  5T8I A;  2GMI C;  2WP9 B;  2BWF A;  3VAW A;  1WZ3 A;  4M8M A;  1K51 A;  4XE0 A;  4BKS A;  2D3B A;  3ZRF A;  2ZPN A;  2CJO A;  4PS7 A;  3RZF A;  2M0X A;  1WGK A;  3ZJT A;  3APC A;  3RD2 A;  2JUO A;  2LJ5 A;  4XZ4 A;  4IM3 A;  2R2Q A;  2K1F A;  4XDC A;  2FIF A;  3VTW A;  2WWZ A;  2EEL A;  1WE6 A;  3H7P A;  2KJ6 A;  1L6U A;  1NDD A;  1XCT L;  2N9X A;  2IGH A;  3KWV A;  2D5G A;  3L54 A;  4JX1 C;  3ZXV A;  4LK0 M;  1E8Y A;  3TEZ A;  4J3O D;  5BYS A;  4HLE A;  1H8C A;  2JF5 A;  4PS8 A;  4C56 C;  4YSX B;  1WGH A;  3RT3 B;  4ANV A;  3HIZ A;  2GB1 A;  3D32 A;  1NVI D;  3ZKJ C;  3N9Y C;  4E3C A;  4RGO S;  1XLO A;  2V3N A;  1YQ3 B;  2DNF A;  2ZCB A;  1FXA A;  4TV3 A;  4ICV A;  2H88 B;  3PRE A;  4RGN A;  3AEB B;  1PQS A;  4KSL C;  1TZ1 A;  1F52 A;  4RCO A;  2DWQ A;  3FIL B;  2LUE A;  4II3 B;  1F9J A;  2MWS B;  2ZZP B;  1TY0 A;  3TUO A;  1GUA B;  4JE3 B;  1KJT A;  3QJZ A;  3T3N A;  5IO9 A;  1T0Y A;  3MP9 A;  1JRU A;  2V0G A;  1TS2 A;  4B9K A;  5MPO A;  2GBK A;  3BII D;  3J9C A;  1V5T A;  1DOI A;  1FD6 A;  2CHZ A;  1VLB A;  2KXJ A;  3BYY B;  2DZK A;  3IT4 B;  3R7Q A;  4KGS A;  2NCN A;  3EUB 2;  4FAD A;  5HG2 A;  5CX3 A;  2JRI B;  2RMM A;  1GJZ A;  4IG7 B;  5D6J B;  1CQV A;  2KDM A;  3RCZ A;  3TMP B;  4IM0 A;  1WZ0 A;  2QDF A;  2JSV X;  2PIA A;  5AZH A;  3A9J A;  3MC8 A;  2D07 B;  3Q14 C;  3V05 A;  2GBJ A;  2KOX A;  3E9S A;  1YQB A;  1T3Q A;  2N1V A;  1TS3 A;  2MW5 A;  1MI0 A;  3VHT C;  1WXQ A;  2MX2 A;  1JAL A;  2JWZ A;  1MJD A;  2REX A;  1MFW A;  4OW0 A;  2XN9 C;  3UIN B;  2D11 A;  4ZHO A;  4W9J A;  4MH0 E;  3TEW A;  2MP2 B;  4WIP A;  4YSY B;  1YN5 A;  4BOZ B;  4OVU A;  2WXF A;  3DCG A;  3NVY A;  4OVV A;  3VFK A;  2FID A;  3PRM B;  3VQI A;  2L05 A;  2KWD A;  1WSP A;  3M63 B;  2ONQ A;  1YIW A;  2KC2 A;  1V1P A;  1E7U A;  3W5V B;  2RGF A;  1OEY J;  4ZHP A;  2D10 A;  1VRA B;  1ZKH A;  2AYO B;  4LDT D;  1VDV A;  2JZP A;  2CJN A;  3Q3O C;  1JWA D;  3L16 A;  3T3O A;  1FM0 D;  1I42 A;  5EE3 A;  2JWU A;  3H8H A;  2LGS A;  3BZD B;  4TQ0 A;  3R7R A;  3AEE B;  3N20 C;  3EC8 A;  4NZL B;  1AWD A;  2K9X A;  3DQV A;  2PVG C;  1KTK A;  2KDF B;  4PYZ A;  3AMZ A;  4YL8 A;  3H7P B;  4C80 A;  2LFI A;  2BWE S;  1I4R A;  1YNT E;  4EZJ A;  1I4G A;  4BZA A;  4K7U A;  3HHM A;  2JYE A;  1C77 A;  1R7S A;  3NS1 A;  4HEA 1;  3IG3 A;  1UNS A;  2INN E;  2WXM A;  3VH4 B;  5FKA C;  5HI1 A;  1LXD A;  3AB5 A;  2LUM A;  3LYY A;  2BVC A;  3W5U B;  2KTR A;  4AS1 A;  2KD0 A;  4IM2 A;  4I6N B;  1UWX A;  1PDX A;  3A33 B;  4REZ A;  2OHF A;  1HTO A;  1HZ5 A;  2LGY A;  4ZRI A;  3UF8 A;  1Q0W B;  3PV1 A;  4K7W A;  4AQ7 A;  2N9L A;  3AE3 B;  4RMA A;  2LD9 A;  4UDU C;  1XLQ A;  4ZOH C;  4WQM A;  2WX0 A;  4ARC A;  2Z0D B;  1FCL A;  1WFY A;  1D5M C;  3TIX A;  2FCN A;  3WAM A;  4JIO U;  3NVV A;  4LNO A;  4KZC A;  4B95 A;  2LRW A;  1OQY A;  2ZCC A;  5LXI B;  3DHH C;  3ALB A;  2HJ8 A;  1R4M B;  5E6J A;  4GXB A;  4ZYN A;  3KYC D;  1BML C;  3B0A A;  1SIF A;  3MJW A;  4WWN A;  4YT0 B;  2Y5B B;  1M4V A;  4K1R B;  1HQR D;  2L00 B;  1E8X A;  4AP4 C;  5JHB A;  3NS8 A;  4ZYS A;  3BVZ A;  2W55 A;  3AUL A;  3VH3 B;  3QHT A;  4DBG A;  4KGT A;  3AEF B;  1ZE3 D;  2LMC A;  5AUK A;  1FIQ A;  4A90 A;  2ZJD A;  4HKZ E;  3WAL A;  4M01 A;  4WWP A;  2K0P A;  2L7R A;  3UIP B;  2MJ3 A;  1OTR B;  2EKE C;  2DYO A;  2C60 A;  3A9J B;  2WQY B;  1S1Q B;  3BK2 A;  4W9L A;  4IWQ A;  2WU5 B;  3MC9 A;  2LVP A;  2X38 A;  3AI5 A;  1HXY D;  4O1N A;  3PRZ A;  1VD2 A;  3ZTC A;  3RMK C;  2XNA C;  3Q8B A;  3MFG A;  3AN1 A;  2MSE D;  1SSN A;  1WH3 A;  2JRH A;  5D94 A;  3SFD B;  1UBQ A;  2IO1 B;  2WXG A;  4EZL A;  3C8Y A;  1ENF A;  4EKU A;  1G6J A;  1EO6 A;  1Y8R C;  2MJE A;  2WXP A;  3NZ3 A;  4LTU A;  4NQK E;  1FFV A;  1RYJ A;  3B1L X;  2WXH A;  2DYM A;  2E6X A;  2BYT A;  2ZVN A;  1V1P B;  4FBJ B;  4CQN A;  2JXX A;  3CIR B;  3L17 A;  2SAK A;  3CF6 E;  5JZE B;  1PYW D;  3HUI A;  3V60 A;  3C0R B;  1TKE A;  1Y56 A;  1H4R A;  3RNC C;  2MBB B;  4KZ0 A;  4WAF A;  1WM3 A;  2LAS A;  3AED B;  4OZB A;  3JSV A;  3VVW B;  3AEC B;  1XF5 L;  4HKQ A;  4NJ6 A;  3N1Z C;  5TR5 A;  2AQ3 B;  2WX1 A;  5IOI A;  3PTF C;  5LNK 1;  3KVF B;  3Q6B A;  2BKR B;  1IBX B;  3KYD D;  1T6B X;  1STE A;  3NUH B;  4TQ1 A;  1FCC C;  1YQ4 B;  2KHW B;  1QQR A;  1VZ6 A;  3P4R B;  2I1J A;  4B0E A;  1WF9 A;  3MJ5 A;  4HJG E;  2LGI A;  4HK2 A;  4DHZ B;  1D3Z A;  4FLH A;  4DXA B;  1WJ4 A;  4WWM A;  5EE9 A;  1TKY A;  1OQR A;  2KTR B;  4NQL B;  3RI7 C;  1ROE A;  1XEE A;  5TSS A;  5D3D A;  2V3P A;  3Q3F A;  4MEM A;  3PZD A;  3U52 E;  1C4A A;  1TS5 A;  3AE4 B;  3AEG B;  2BPS A;  2LRU A;  4X57 B;  2BB6 A;  2ASQ A;  2O6V A;  3EFU A;  4JLC A;  5BMH A;  2KQS A;  5E6N A;  1RM6 C;  5KHQ A;  2HD5 B;  2BB5 A;  3ZLZ A;  1E5W A;  3NVW A;  1LO5 D;  4GMV A;  2SEB D;  3H1U A;  2K5P A;  1NEK B;  4B6W A;  2KDB A;  5IN7 A;  1IYF A;  1D5X C;  2KVZ A;  4HRO A;  3RNA C;  4NNJ B;  5D7G A;  4LNI A;  1HZ6 A;  3U30 A;  4ARI A;  1XD3 B;  3R66 C;  1I4Q A;  2AQ1 B;  3AE1 B;  1C78 A;  4BKT A;  3RNE C;  1EU4 A;  4TSS A;  5LXH A;  4F1S A;  1WXV A;  2KFK A;  2L3Z A;  1L0Y B;  2MHJ A;  1R4M I;  2QSD A;  1E6E B;  2FAZ A;  2ZW1 A;  4IWP A;  2J53 A;  3DOW A;  1Q10 A;  2LHE A;  1ET9 A;  1QOG A;  1A5R A;  1J7B A;  2MBO A;  2KAN A;  1L4Z B;  2WXQ A;  1V86 A;  3EGR A;  3P4P B;  4JPS A;  1E8W A;  3Q8F A;  4DHZ E;  3HM3 A;  2XBB C;  3WAP A;  3IAS 1;  1J0G A;  4PT5 A;  2GLS A;  2KC1 A;  3CWI A;  1PGX A;  4S0R A;  4PK1 A;  1UGM A;  1C79 A;  2CHW A;  1CK1 A;  1WWT A;  3SU8 X;  2L0F A;  2KJR A;  4LLG M;  1KF6 B;  3DPD A;  2NBW B;  4JQW C;  3BWU D;  1WXS A;  1C1Y B;  3APF A;  2C7N B;  4HWI B;  2X8X X;  4XDD A;  3GB1 A;  1YOV B;  1ISN A;  4JWS C;  1X1M A;  2K6Q A;  3A4R A;  3AEA B;  1WYG A;  1M94 A;  4H2A A;  3VUW A;  2KDE B;  1WJ6 A;  4WH4 A;  3NRZ A;  3JSV B;  2OED A;  3ZRC A;  1I7H A;  3DBL B;  3P2B A;  1V97 A;  2KVR A;  3Q8C A;  4A3P A;  1ZDX A;  3FKY A;  3KUZ A;  3ZGZ A;  3S2A A;  4HJK A;  4AOF A;  1ZP0 B;  3FAH A;  3BK1 A;  1WIA A;  3V6E B;  1IUE A;  2LVO A;  4BBN F;  1VR9 A;  3UQB A;  2JZZ A;  1GOZ A;  4P7I A;  3V62 A;  4E71 A;  2V4L A;  2LI5 A;  2L76 A;  2NTS A;  4DXG A;  3ZTD A;  3Q69 A;  4EEW A;  1FXT B;  3ZXR A;  2O6V B;  1P3Q U;  1N5X A;  4GIV A;  4US8 A;  1WX9 A;  3TEY A;  3VXW A;  2KQ4 X;  2DZI A;  4KIK A;  4MSM B;  2M0A A;  4FJZ A;  2W82 A;  2V9H A;  2OJR A;  4A9A A;  2N7D A;  2G1E A;  2KN5 A;  2K8B A;  4KV2 A;  4IUM B;  2EKI A;  4HCN B;  1V2Y A;  2DLB A;  4PS3 A;  3X0W A;  1C4P A;  2BQQ A;  1SJE D;  1YN4 A;  2VRR B;  1UBI A;  4RH6 A;  3PZ7 A;  4IDI A;  4WJN A;  4JWU C;  2DEN B;  4BFR A;  4RM9 A;  4RM8 A;  5AZG A;  2KFK B;  3P4Q B;  1YX5 B;  4WWO A;  1FEH A;  4N59 A;  1TZO A;  4FHK A;  1P98 A;  2NTT A;  4IKG A;  3ECI A;  2IGG A;  1TTN A;  4MEL A;  3VRA B;  3QWZ B;  3WCQ A;  2KX0 A;  4LDT B;  2KWU B;  2IDY A;  4MDK E;  1JCK B;  4GLS C;  4NJ7 A;  2QHO A;  3QK0 A;  3AU5 A;  1ZGU B;  4DDG D;  1R4N B;  4GSW A;  4IW0 A;  1I4P A;  2QIE B;  3SR6 A;  4K3C A;  4HVB A;  2MBQ A;  4G0N B;  3R8B A;  3PLU A;  1UEL A;  3KWL A;  4A20 A;  2N7E A;  1D5Z C;  4ANX A;  2BBC A;  3PS6 A;  3RNB C;  3A1Q A;  3HM6 X;  4R3D A;  2WXO A;  4RF0 A;  4Q2J A;  3KH0 A;  1F77 A;  1P7E A;  1QLB B;  2W54 A;  2WGS A;  2PVO D;  3CMM B;  2LVQ A;  4W9D A;  1J7C A;  1WJN A;  2IY1 B;  2TSS A;  5IKC M;  2KK8 A;  1YJJ A;  2ZNV B;  1N61 A;  1KH0 A;  2L32 A;  2JZ3 B;  3SHQ A;  5AZF A;  3M3J A;  4NAW A;  5E6O A;  4KKI A;  4G3X B;  5KHO A;  1QT9 A;  2KX3 A;  1FO4 A;  1SEB D;  1IBX A;  1I4X A;  5GXG B;  1GAQ B;  1XLN A;  2WDV B;  2W3S A;  1V49 A;  1C9F A;  1N60 A;  1V8C A;  1P0R A;  3I57 A;  3EHV A;  3T8M A;  1T5X D;  3P4S B;  1E90 A;  2JVC A;  2ZPY A;  2JXT A;  2ZEQ A;  1SE4 A;  3QIJ A;  3DBR B;  3AE5 B;  4ACF A;  3NG0 A;  3DBL I;  2DAF A;  3ETR A;  5C1Z A;  5IA7 A;  2CS4 A;  4HPM B;  2J0K A;  1V9J A;  1MVK A;  2DBY A;  4HDQ A;  4BKS D;  2N7J A;  1BUI C;  3ZJU A;  3ENE A;  3O65 B;  4ZRJ A;  3X23 A;  5L95 C;  1EM7 A;  2XK5 A;  4FJY A;  1UZX B;  1ZXH A;  2BYE A;  2N9E B;  2E3T A;  1ZXI A;  4KVG B;  2AL6 A;  3BIN A;  1VJK A;  4RFB A;  1P1A A;  4QAY A;  4GU2 A;  3N32 A;  4KIK B;  2YLM A;  1SE9 A;  3UGB B;  3JYU A;  2M19 A;  3KLS X;  3ZQ4 A;  4K7S A;  4M02 A;  3UI3 A;  1QIL A;  3W1S A;  1JRP A;  1HEZ E;  4W9H A;  3TSS A;  4KGR A;  2KN4 A;  3WA0 A;  1L7Y A;  4WJP A;  3ONS A;  5CHV C;  1WX7 A;  1GB1 A;  2OJW A;  3GZN B;  1WRD B;  4GDL A;  3IXS A;  4HRS A;  2JU6 X;  4MAC A;  3K9P B;  1UUP A;  1Z5S B;  2NBU A;  3APD A;  3UQA A;  2LJI A;  2J0J A;  1WI0 A;  1YX6 B;  4W9G A;  4RGM A;  1TGZ B;  2NVU I;  3VTV A;  3IAM 1;  4B0M A;  2N9P C;  4AUQ C;  3RFZ B;  2LEK A;  4FUL A;  5IP4 D;  2DAJ A;  3TJP A;  3RN9 C;  4HCP B;  1BT0 A;  1J19 A;  3AE6 B;  2WNM A;  2Y5P A;  2RDH A;  2KTF A;  2NPT B;  3RNG C;  3W9C B;  2J42 A;  2LGX A;  4J6I A;  4KSK C;  1FFU A;  1ZPS A;  2NS5 A;  5AUI A;  4AWJ A;  5DPS A;  1QOF A;  3A4S C;  1AW7 A;  2IZV B;  1WXM A;  2WXL A;  4DXF A;  1JW9 D;  2IPK D;  3NJT A;  4L1B A;  2AL3 A;  2D2Q A;  3QQ8 B;  1FPY A;  2L0T A;  2V3S A;  3PVL A;  1ZDV A;  3C19 A;  3A1Q B;  4A55 A;  2IYD B;  1E9M A;  1J7A A;  3W1Y A;  2D3G A;  5CTR C;  1R4N I;  2CHX A;  3JVZ X;  4M8N A;  3Q8E A;  2IJ0 A;  2K39 A;  4BAX A;  3ML9 A;  2C9W B;  1NEN B;  3QAR A;  4RNA A;  4LNN A;  2G4D B;  2H89 B;  2J7Q B;  1EF1 A;  4NAW B;  2GBN A;  1WM2 A;  4XX5 A;  1ESF A;  4AJW A;  2DYB A;  4F7Z A;  3BVM A;  2L52 A;  5HFY A;  2BS4 B;  1FMA D;  4IC7 B;  2DZJ A;  3M62 B;  4W9I A;  3U8Z A;  1PGB A;  1L5P A;  4HPL B;  3V61 A;  2V4I B;  3P63 A;  2KFJ A;  3MHS D;  2MCN B;  1RLF A;  4NPN A;  3AE7 B;  1MHX A;  2FE8 A;  2MBE A;  1WGD A;  2MEK A;  2MH7 A;  3FC4 A;  3U7D A;  1GPX A;  1E8Z A;  1HA5 A;  1HTQ A;  4C4V A;  4DHJ B;  1UF0 A;  2RPQ A;  3Q8A A;  2BKF A;  4ANU A;  4A8X C;  1FNU A;  4OHJ A;  1N63 A;  3VR9 B;  2PPH A;  3U7Z A;  2DHZ A;  4A3O A;  2A4Z A;  2XK5 B;  1GB4 A;  2PJH A;  4M0W A;  4GDK A;  3QCA A;  3N1Y C;  4L2Y A;  3ZDT A;  3DBR I;  1LM8 B;  2CKH B;  4KKJ A;  3L08 A;  3QAQ A;  2VZK D;  3OLM D;  2KJH B;  4MH8 A;  2KMC A;  4I6L B;  3B08 A;  1T0R C;  4USA A;  2EMS A;  2OOB B;  1UD7 A;  3OJ3 A;  1SE2 A;  4GDL B;  2FBW B;  4OVZ A;  3QX1 A;  2N9K A;  2ZNV C;  4N58 A;  3NZS A;  3Q3J A;  1WRI A;  4MGK E;  1VZ8 A;  4C00 A;  2KWV B;  3GP7 A;  2JY6 A;  4US9 A;  2LXC A;  4FA6 A;  1AAR A;  2Q5W D;  4ITK A;  1C4C A;  5GMV A;  3IHP C;  1CMX B;  1KM7 A;  1B1Z A;  5J17 A;  2GOW A;  5HHD G;  3WIM A;  2KLC A;  3GZN I;  4URK A;  3HRD D;  1DGJ A;  2Y5C A;  1Q1O A;  3R3M A;  1TYG B;  1ZUD 2;  2KAJ A;  1MG4 A;  4HDO A;  1XT9 B;  3DWM A;  3BY4 B;  3NVZ A;  1FXI A;  1WGG A;  2NBV B;  1V6E A;  2UU7 A;  1WE7 A;  3BVG A;  5DPR A;  2WXJ A;  1OFF A;  2WYQ A;  5L83 A;  1FRD A;  2WDT B;  3HVD A;  3MTN B;  4JL9 A;  2GBM A;  3QC8 B;  1V81 A;  2AX5 A;  4XC2 A;  1NYR A;  4P6V F;  2MRP A;  2C7M B;  3H9D A;  3PHW B;  1AYF A;  2K3U A;  5E6P A;  3AM9 A;  1CJE A;  3BYT B;  3OAW A;  3GS2 A;  1IGC A;  4MJS A;  1DOX A;  1K53 A;  3M95 A;  3N30 A;  3EFC A;  4EFO A;  4YSZ B;  2QEJ C;  1XQQ A;  3I63 C;  2JYT A;  3LJ3 A;  4G50 A;  1EWC A;  3RNF C;  2L83 A;  2JQR B;  2BF8 B;  4ZDV A;  3PZ8 A;  2AEH A;  4YTP B;  2PTL A;  4HXD A;  3ZIM A;  1SIJ A;  2BT6 A;  1LFD A;  3ZJV A;  4IOI E;  3PGE A;  1WX8 A;  5G5G A;  3RUL A;  3VTU A;  1D4B A;  1C76 A;  4BBN C;  2B76 B;  3OG5 A;  1RAX A;  1IP9 A;  4YXD B;  4P1B C;  3ZNI D;  1QZE A;  2NR2 A;  3V3X A;  1TJE A;  2WXI A;  4C4V B;  4DQO C;  1KFY B;  5C2T B;  4MM3 A;  4WQO B;  3I5J C;  4CYE A;  3IT6 B;  5JXV A;  3LB8 C;  4II2 B;  1V1O A;  1HE8 A;  2PE6 B;  2KWC A;  5D3I B;  5HKH A;  2YEP F;  5G55 A;  4M0W B;  4GDK B;  5JH5 C;  2MBH A;  2K8H A;  3DWG C;  1C3T A;  1JRO A;  1AN8 A;  2NMQ A;  1NYQ A;  3AXC A;  4OZA A;  4DDI D;  3V6C B;  1DYQ A;  2N1W A;  1GC6 A;  5DCN A;  2BS2 B;  2MJD A;  1BXT A;  2PW9 A;  1GC7 A;  4RGT A;  3L10 B;  3GE3 C;  3N1X C;  1SBB B;  3RUI B;  2HTM E;  1IGD A;  2KAC A;  3A9K B;  2D3C A;  4ZRP A;  2I1K A;  2Y3A A;  2C5L C;  1F2R I;  4N9F 4;  2L8J A;  3EEC A;  1MHH E;  3H6N A;  4XWT A;  1JWM D;  2KMM A;  2KZR A;  2HTH A;  4D2K A;  2IO2 B;  1TIF A;  3NOB A;  3SD5 A;  1VCB A;  2D3A A;  1E7V A;  1ACC A;  1SF0 A;  2W3R A;  4NJC A;  2QIL A;  4BKG A;  2WXK A;  2VH1 A;  3DHI C;  2J4X A;  2WXR A;  1FNW A;  4GB9 A;  5BYQ A;  1VZ7 A;  2I38 A;  2Z8L A;  4BOS C;  2O6V D;  2K8C A;  2HE7 A;  2NPT A;  1Z2M A;  3GOE A;  3ZO5 B;  2KKC A;  2LHD A;  2UYZ B;  5G5H A;  1WJU A;  2INP E;  5CHW A;  2N4F A;  2O2V A;  2WHI A;  1LQB A;  1SB3 C;  5LLI A;  3VDZ A;  2WU2 B;  4N6E B;  1TKG A;  3ZW3 A;  1V5O A;  3NY5 A;  4TKN A;  5CHF A;  3N3K B;  4ANW A;  4EZK A;  3PHX B;  3PLV A;  4M00 A;  2RR9 A;  1YN3 A;  1F2R C;  1WMH A;  1NBF C;  1XCQ L;  1JWB D;  2RDB C;  1E7P B;  2DZM A;  2ICI A;  4W9E A;  3W2D A;  1GNU A;  5J18 A;  1YJ1 A;  1ET6 A;  1JML A;  1N5W A;  1K52 A;  1EF5 A;  3LXF A;  4K81 A;  1JWU D;  3ZUN A;  2LZ6 A;  4MJS B;  3VR8 B;  2PEA A;  2FCQ A;  1CZP A;  3W1S C;  1K8R B;  4NAM A;  2INC C;  4ZRK A;  4MGI E;  2K25 A;  3UIO B;  2DX5 B;  3JW0 X;  2BYV E;  4ICU A;  2M8S A;  4GN1 A;  3SEB A;  3K9O B;  1UGJ A;  4FXC A;  4EOY A;  2EMT A;  3URY A;  2I2Y A;  4CO7 A;  3EA6 A;  2KLG A;  4KDL B;  2JT4 B;  4W9K A;  1TY2 A;  2M56 B;  4FHJ A;  2PMV A;  1YJI A;  2KMA A;  3CST A;  3IVF A;  3DBS A;  3DBH B;  4JGH B;  4MM3 B;  4XGA B;  4LJO B;  3PO0 A;  3ZNG C;  1SGH A;  2LXA A;  2BYF A;  4E74 A;  2UWQ A;  3DVN V;  1QF6 A;  4ZRQ A;  2PKO A;  5EDS A;  1N62 A;  3B2G A;  1DOY A;  1E0Z A;  2PLP A;  3ZNH B;  3WAN A;  4OZC A;  2XEW A;  5IAA C;  2BTE A;  3DVN U;  2Z59 B;  4HPP A;  4GOC A;  3WAO A;  3RZW C;  2LWP A;  3AU4 A;  1PGA A;  3L13 A;  3LDZ E;  2FUH B;  4C7Z A;  1E10 A;  3PSE B;  1T0Q C;  1WXA A;  1FNV A;  3GE8 C;  4P16 A;  2K6D B;  3NZU A;  2AQ2 B;  2FUG 1;  4I6P A;  2MA9 B;  3L0W B;  4EE2 A;  2CU1 A;  2AWT A;  2G45 B;  4MGY E;  3ABV B;  2M1M A;  3DVG Y;  2FNJ B;  1LGR A;  1Q5W B;  2GRI A;  4YTM B;  2W9N A;  2WLB A;  1KLU D;  3ZNZ B;  5DPT A;  1EWY C;  1KRH A;  1P7F A;  1TBE A;  4IWO A;  1FRR A;  4WAA A;  5EE1 A;  1SXT A;  2G4S A;  3KW5 B;  1U4A A;  5BO4 B;  5AEK B;  1NI2 A;  1N6Z A;  1PFD A;  1WY8 A;  3NHE B;  1SE3 A;  1J8C A;  2KDI A;  2QCZ A;  1K50 A;  4KX6 B;  2QC8 A;  3CSF A;  5BMI A;  4FN2 A;  3E56 A;  1WGY A;  3T9L A;  1WR1 A;  2YVC A;  1WYW B;  1ZOY B;  4XWW A;  1ZW7 A;  2KYW A;  2MQJ A;  5FK9 C;  5I4D A;  2LGD A;  1UWM A;  3AE2 B;  3ZVV A;  1TS4 A;  5G2N A;  2JX5 A;  2O2V B;  2RD0 A;  2YEP B;  1QKZ A;  4DK5 A;  1UH6 A;  2FCS A;  2ON8 A;  5J2R A;  4NY0 A;  5BMG A;  3PPA A;  3R2I A;  1D6E C;  2J0M A;  1PUT A;  3PRP B;  2WS3 B;  1KOT A;  1WMH B;  4TUU A;  3I3T B;  3VRB B;  1EU3 A;  1S3S G;  2M4N A;  2CU3 A;  3P42 A;  1RRB A;  2HJ1 A;  4LNK A;  2G9H D;  4F8C B;  1KLV A;  2Z0E B;  1EUV B;  1GG3 A;  2ZVO A;  5FR6 A;  3AH7 A;  4L23 A;  3B2F A;  2PE9 A;  3B9J A;  3MC0 B;  4TMA B;  3DDC B;  3SFE B;  2JPH A;  3KUC B;  1OEY A;  4LCD E;  1XXG A;  3I9V 1;  4MT5 A;  1RFK A;  4DWF A;  1TT5 B;  2BGF A;  3KQ4 A;  2V1Y A;  3VUY A;  1QOA A;  2VZK B;  3TCA A;  1NI3 A;  3L4P A;  4G11 A;  5H92 C;  3IFW B;  1F1H A;  3Q2A C;  2WDQ B;  2C7H A;  2WXN A;  2BW2 A;  5D2M B;  1KLG D;  2GBR A;  2IO0 B;  4LNF A;  4C7Y A;  3HVZ A;  1IPG A;  2GI9 A;  3RPF C;  2MLB A;  2N0S B;  1JQ4 A;  3U2S C;  3OWE B;  3DHG C;  4A6Q A;  3TEX A; 
#chains in the Genus database with same CATH homology
 2A5U A;  4IW0 A;  1XQQ A;  4AP4 C;  2KNB A;  5JHB A;  1RFA A;  3KUD B;  2CR5 A;  3NS8 A;  2FCM A;  4HVB A;  5DPW A;  3AUL A;  2MBQ A;  3LJ3 A;  3PT2 B;  4G50 A;  3H7S A;  3VH3 B;  3QHT A;  4G0N B;  4DBG A;  4FJV B;  3PLU A;  4EUT A;  2BF8 B;  4ZDV A;  1UEL A;  4W9F A;  2AEH A;  4WJO A;  4A20 A;  2IO3 B;  2ZJD A;  4HXD A;  3WAL A;  4WWP A;  3ZIM A;  3ML8 A;  2N7E A;  2L7R A;  1LFD A;  4ANX A;  2RSU A;  3PS6 A;  3UIP B;  3RYT A;  3DBH I;  2KO3 A;  3A1Q A;  1OTR B;  3PGE A;  4WJQ A;  3HM6 X;  2EKE C;  1WX8 A;  3RUL A;  3HK0 A;  3VTU A;  2DYO A;  2C60 A;  3KH0 A;  3A9J B;  4BBN C;  1S1Q B;  4W9L A;  3A9K A;  4IWQ A;  3CMM B;  2LVQ A;  4W9D A;  1RAX A;  1IP9 A;  1L2N A;  1WJN A;  2IY1 B;  2IY0 B;  2LVP A;  3ZNI D;  3AI5 A;  1QZE A;  2NR2 A;  1OGW A;  2KK8 A;  3PRZ A;  1VD2 A;  2ZNV B;  3ZTC A;  4MM3 A;  4WQO B;  3SDL C;  1WR6 E;  4CYE A;  2MSE D;  2JZ3 B;  2JRH A;  1WH3 A;  5AZF A;  3SHQ A;  3M3J A;  4NAW A;  4II2 B;  1YD8 U;  5E6O A;  5D94 A;  1HE8 A;  2PE6 B;  2KWC A;  1UBQ A;  4G3X B;  2IO1 B;  1V80 A;  4EZL A;  5G55 A;  5HKH A;  5KHO A;  4EKU A;  1G6J A;  2KX3 A;  1EO6 A;  1Y8R C;  4M0W B;  4GDK B;  5JH5 C;  4DHJ D;  4NQK E;  2MBH A;  3IBE A;  3B1L X;  2K8H A;  2MCN B;  1C3T A;  3AXC A;  3TL5 A;  4DDI D;  3V6C B;  1WGR A;  2DYM A;  1V49 A;  2N1W A;  1GC6 A;  2G3Q B;  3VUX A;  5DCN A;  2B3A A;  1P0R A;  2ZVN A;  3EHV A;  3T8M A;  3TBL D;  1GC7 A;  3L10 B;  4PYU A;  5JHA A;  1E90 A;  4FBJ B;  2JVC A;  2ZPY A;  2JXX A;  2ZEQ A;  3RUI B;  2M17 A;  3L17 A;  2KQ7 A;  3QIJ A;  3CF6 E;  3A9K B;  2I1K A;  4W9C A;  3QA8 A;  5JZE B;  2C5L C;  3DBL I;  4KDI C;  2DAF A;  3C0R B;  3V60 A;  4AJY B;  4N9F 4;  2L8J A;  1H4R A;  5C1Z A;  5IA7 A;  2CS4 A;  3EEC A;  4CHK A;  4HPM B;  1MG8 A;  3H6N A;  2J0K A;  4MGZ E;  4ASW C;  1V9J A;  2MBB B;  4KZ0 A;  4HDQ A;  1WM3 A;  2LAS A;  4BKS D;  3JSV A;  3OJ4 B;  2R2O A;  2KZR A;  3VVW B;  4BVU C;  2HTH A;  2IO2 B;  4GGQ A;  4NJ6 A;  2IBI B;  3ENE A;  3NOB A;  3O65 B;  4MSQ B;  4ZRJ A;  2WX1 A;  5TR5 A;  3X23 A;  3SD5 A;  1VCB A;  3PTF C;  5L95 C;  3KVF B;  1E7V A;  3DVG X;  2XK5 A;  4FJY A;  1UZX B;  1P9D U;  2BYE A;  2N9E B;  3ZDM C;  2BKR B;  2MP2 A;  4KVG B;  4BKG A;  3KYD D;  2AL6 A;  3BIN A;  1I35 A;  1P1A A;  5C23 A;  4GU2 A;  4TQ1 A;  3N32 A;  4KIK B;  4GB9 A;  4LJP B;  2GMI C;  2KHW B;  2BWF A;  2YLM A;  2I1J A;  1SE9 A;  4BOS C;  3UGB B;  2O6V D;  3JYU A;  1WF9 A;  2K8C A;  4HK2 A;  2HE7 A;  2NPT A;  1Z2M A;  4FLH A;  4K7S A;  3VAW A;  4DHZ B;  4DXA B;  1WZ3 A;  3GOE A;  4M8M A;  1WJ4 A;  3W1S A;  3ZO5 B;  4BKS A;  2KKC A;  4W9H A;  3ZRF A;  2KTR B;  2ZPN A;  3WA0 A;  1L7Y A;  4WJP A;  4NQL B;  2UYZ B;  3ONS A;  4PS7 A;  5CHV C;  3RZF A;  1WJU A;  1WX7 A;  2M0X A;  5CHW A;  2N4F A;  3APC A;  3Q3F A;  3RD2 A;  2O2V A;  1LQB A;  4MEM A;  5LLI A;  3VDZ A;  2JUO A;  3PZD A;  2LJ5 A;  3ZW3 A;  1V5O A;  1WRD B;  3NY5 A;  4GDL A;  4TKN A;  2BPS A;  5CHF A;  2LRU A;  3N3K B;  4X57 B;  4XZ4 A;  4ANW A;  3K9P B;  1Z5S B;  4IM3 A;  2R2Q A;  2K1F A;  4EZK A;  3PHX B;  3PLV A;  2FIF A;  2NBU A;  3APD A;  3VTW A;  2ASQ A;  3UQA A;  2RR9 A;  2WWZ A;  2O6V A;  3EFU A;  1WE6 A;  2J0J A;  1WI0 A;  3H7P A;  1YX6 B;  4JLC A;  4W9G A;  1TGZ B;  1WMH A;  2NVU I;  2KJ6 A;  3VTV A;  1NDD A;  1NBF C;  2N9P C;  4AUQ C;  2KQS A;  4FUL A;  2N9X A;  2DZM A;  2DAJ A;  3TJP A;  5E6N A;  4W9E A;  4HCP B;  5KHQ A;  2HD5 B;  1BT0 A;  1GNU A;  5J18 A;  1J19 A;  1YJ1 A;  4K81 A;  1EF5 A;  3L54 A;  3ZLZ A;  3ZUN A;  2LZ6 A;  4MJS B;  1E5W A;  1E8Y A;  2KTF A;  4GMV A;  4HLE A;  2NPT B;  2PEA A;  3H1U A;  1H8C A;  2JF5 A;  2LGX A;  4J6I A;  2FCQ A;  4PS8 A;  4B6W A;  4KSK C;  1WGH A;  3RT3 B;  3W1S C;  2KDB A;  1K8R B;  4ANV A;  2NS5 A;  3HIZ A;  4ZRK A;  4MGI E;  1IYF A;  2K25 A;  3D32 A;  3UIO B;  4AWJ A;  2DX5 B;  3JW0 X;  5DPS A;  2BYV E;  4NNJ B;  4ICU A;  5D7G A;  3ZKJ C;  2M8S A;  3A4S C;  2IZV B;  3U30 A;  1XD3 B;  1WXM A;  3R66 C;  4E3C A;  4GN1 A;  2AL3 A;  2D2Q A;  4BKT A;  2ZCB A;  3QQ8 B;  3K9O B;  5LXH A;  4F1S A;  2L0T A;  1WXV A;  4TV3 A;  2KFK A;  4ICV A;  3PRE A;  4EOY A;  2EMT A;  2L3Z A;  2V3S A;  3PVL A;  1R4M I;  4CO7 A;  1PQS A;  3A1Q B;  1TZ1 A;  4KSL C;  2KLG A;  4KDL B;  2JT4 B;  2FAZ A;  2LUE A;  4II3 B;  4W9K A;  1F9J A;  2IYD B;  2MWS B;  4IWP A;  2ZZP B;  3W1Y A;  4FHJ A;  1GUA B;  2D3G A;  3DOW A;  5CTR C;  1R4N I;  2CHX A;  2KMA A;  1KJT A;  3QJZ A;  3JVZ X;  2MBO A;  4M8N A;  1A5R A;  2KAN A;  3CST A;  2K39 A;  3IVF A;  3DBS A;  3ML9 A;  2C9W B;  4JGH B;  1T0Y A;  1JRU A;  1V86 A;  3QAR A;  4B9K A;  4LJO B;  2GBK A;  2G4D B;  3ZNG C;  1SGH A;  2J7Q B;  2LXA A;  2BYF A;  1EF1 A;  4NAW B;  4E74 A;  2UWQ A;  2GBN A;  3DVN V;  1WM2 A;  4XX5 A;  1E8W A;  1V5T A;  4DHZ E;  4AJW A;  2CHZ A;  2KXJ A;  3HM3 A;  2XBB C;  2DYB A;  5EDS A;  2DZK A;  4F7Z A;  3WAP A;  3R7Q A;  2NCN A;  1J0G A;  3ZNH B;  2KC1 A;  3WAN A;  4FAD A;  2XEW A;  5IAA C;  1UGM A;  2DZJ A;  2CHW A;  2JRI B;  3DVN U;  4IC7 B;  2Z59 B;  5CX3 A;  1GJZ A;  3M62 B;  4GOC A;  4W9I A;  3SU8 X;  3WAO A;  2L0F A;  2KJR A;  4IG7 B;  5D6J B;  2LWP A;  3RZW C;  3U8Z A;  3AU4 A;  3RCZ A;  4HPL B;  3V61 A;  3TMP B;  3L13 A;  3DPD A;  2KFJ A;  2FUH B;  3LDZ E;  2NBW B;  3MHS D;  4IM0 A;  1WZ0 A;  1RLF A;  4JQW C;  4NPN A;  1WXS A;  3PSE B;  1WXA A;  1C1Y B;  3APF A;  5AZH A;  2MBE A;  2C7N B;  3A9J A;  4HWI B;  1WGD A;  2K6D B;  3NZU A;  2D07 B;  4I6P A;  2MA9 B;  3L0W B;  1ISN A;  1X1M A;  2K6Q A;  2CU1 A;  2AWT A;  2G45 B;  3A4R A;  4MGY E;  3U7D A;  2GBJ A;  1E8Z A;  2KOX A;  1YQB A;  2M1M A;  1M94 A;  2N1V A;  2MW5 A;  3DVG Y;  2FNJ B;  3VUW A;  4DHJ B;  2KDE B;  1Q5W B;  3VHT C;  2RPQ A;  2W9N A;  1WJ6 A;  3JSV B;  2BKF A;  2MX2 A;  4ANU A;  3ZNZ B;  5DPT A;  2JWZ A;  2REX A;  2PPH A;  3ZRC A;  1TBE A;  3UIN B;  4IWO A;  2D11 A;  2DHZ A;  3P2B A;  4WAA A;  4A3O A;  2G4S A;  3KW5 B;  2A4Z A;  1U4A A;  5BO4 B;  5AEK B;  2XK5 B;  4W9J A;  2PJH A;  2KVR A;  1NI2 A;  4GDK A;  4MH0 E;  3QCA A;  2MP2 B;  4A3P A;  1WY8 A;  3NHE B;  4BOZ B;  4OVU A;  1J8C A;  2KDI A;  3KUZ A;  3ZDT A;  3DBR I;  3DCG A;  4OVV A;  3VFK A;  1LM8 B;  2FID A;  3S2A A;  3PRM B;  4HJK A;  3VQI A;  2CKH B;  2L05 A;  4AOF A;  3M63 B;  3CSF A;  1WIA A;  3L08 A;  3V6E B;  3QAQ A;  4FN2 A;  1YIW A;  1WGY A;  2LVO A;  3T9L A;  4BBN F;  1WR1 A;  2KC2 A;  3OLM D;  1E7U A;  2KJH B;  2YVC A;  2RGF A;  3UQB A;  1WYW B;  1OEY J;  2D10 A;  2JZZ A;  4P7I A;  4E71 A;  3V62 A;  1ZW7 A;  2KMC A;  4I6L B;  2V4L A;  2MQJ A;  1ZKH A;  2AYO B;  2LI5 A;  3B08 A;  4LDT D;  2LGD A;  3ZVV A;  5G2N A;  2L76 A;  2O2V B;  2RD0 A;  4DK5 A;  2EMS A;  3L16 A;  1D3Z A;  3ZTD A;  2OOB B;  1UD7 A;  1I42 A;  1UH6 A;  2FCS A;  3OJ3 A;  5J2R A;  4GDL B;  4NY0 A;  4TQ0 A;  3R7R A;  3QX1 A;  2ZNV C;  3EC8 A;  3NZS A;  3PPA A;  3Q3J A;  4EEW A;  4MGK E;  3DQV A;  2J0M A;  1FXT B;  2KDF B;  4PYZ A;  3PRP B;  2O6V B;  2KWV B;  1P3Q U;  4YL8 A;  3H7P B;  2JY6 A;  2LXC A;  1KOT A;  1WMH B;  4FA6 A;  4GIV A;  4TUU A;  1WX9 A;  3I3T B;  1AAR A;  2BWE S;  1S3S G;  2M4N A;  3VXW A;  4EZJ A;  5GMV A;  3IHP C;  2DZI A;  4K7U A;  4KIK A;  1CMX B;  3HHM A;  4MSM B;  1RRB A;  1KM7 A;  4FJZ A;  3IG3 A;  2OJR A;  5J17 A;  2GOW A;  2N7D A;  4F8C B;  1KLV A;  2Z0E B;  1EUV B;  3VH4 B;  3WIM A;  1GG3 A;  2KLC A;  3GZN I;  4URK A;  1LXD A;  2KN5 A;  2ZVO A;  2K8B A;  1Q1O A;  5FR6 A;  2KTR A;  3R3M A;  4KV2 A;  2KD0 A;  4IUM B;  4HCN B;  1V2Y A;  4IM2 A;  4I6N B;  4PS3 A;  3A33 B;  3X0W A;  2PE9 A;  1XT9 B;  4HDO A;  3BY4 B;  1WGG A;  2NBV B;  1V6E A;  2LGY A;  4ZRI A;  2VRR B;  1UBI A;  3DDC B;  3UF8 A;  1Q0W B;  2JPH A;  3KUC B;  1WE7 A;  1OEY A;  4WJN A;  5DPR A;  4LCD E;  3PV1 A;  2WYQ A;  4K7W A;  5L83 A;  2DEN B;  4BFR A;  4DWF A;  4RMA A;  2BGF A;  2LD9 A;  4RM9 A;  4RM8 A;  5AZG A;  2WDT B;  3MTN B;  4JL9 A;  2V1Y A;  2KFK B;  1YX5 B;  2WX0 A;  2Z0D B;  4WWO A;  2GBM A;  3VUY A;  3QC8 B;  1WFY A;  4FHK A;  1V81 A;  3TIX A;  2FCN A;  1P98 A;  3TCA A;  3WAM A;  4XC2 A;  3ECI A;  4G11 A;  3IFW B;  2MRP A;  1TTN A;  2C7H A;  4JIO U;  4MEL A;  2C7M B;  4KZC A;  4B95 A;  5D2M B;  3H9D A;  3PHW B;  2LRW A;  2GBR A;  3QWZ B;  1OQY A;  2IO0 B;  5E6P A;  2ZCC A;  2KX0 A;  4LDT B;  2KWU B;  5LXI B;  1IPG A;  3ALB A;  2HJ8 A;  3OAW A;  4MDK E;  4MJS A;  4GXB A;  4ZYN A;  3KYC D;  4NJ7 A;  2MLB A;  2QHO A;  3B0A A;  1SIF A;  3M95 A;  3MJW A;  3QK0 A;  4WWN A;  3N30 A;  2Y5B B;  3AU5 A;  4EFO A;  4K1R B;  1ZGU B;  4DDG D;  2L00 B;  1E8X A;  4GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...