1UGJA

Solution structure of a murine hypothetical protein from riken cdna 2310057j16
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
141
structure length
141
Chain Sequence
b'GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2310057J16 protein
publication title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 15
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08683 CAMSAP_CKK Microtubule-binding calmodulin-regulated spectrin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.360 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ugjA01
1UGJA
chains in the Genus database with same CATH superfamily
4TMAB 2R2OA 5MPOA 4RGOS 1PUTA 4IM2A 2KZRA 3GP7A 3ZXRA 3UINB 1JWUD 1WXAA 3PV1A 3RNGC 4BFRA 1ZDVA 2IPKD 1A70A 3A9JB 3Q3JA 4XYCA 2LVOA 2N7EA 2MWSB 2ZCBA 3N32A 3UIOB 3NVVA 2PLPA 1KLVA 4C7YA 3WIMA 4KIKA 1XLNA 4W9EA 2D2QA 2J0JA 3EGRA 2FCQA 1V49A 2ASQA 1VZ8A 3Q3NC 5E6NA 2CR5A 1AYFA 1T0SC 2WS3B 3AE6B 1ESFA 3EC8A 1ZKHA 2CKHB 2KKCA 2J0KA 5KHOA 2DYBA 2NVUI 2M4NA 2D11A 4ICVA 3KYDD 2CJNA 1TKEA 1E7PB 1FXAA 3P4QB 4WIPA 2CJOA 5CX3A 2FUHB 3VAWA 1D4BA 1ENFA 2PW9A 3TEWA 5L95C 4D2KA 2KWDA 3NZSA 1Y56A 1TS4A 2XK5B 3V05A 2YVCA 3BK1A 2KWCA 1GAQB 1FRDA 1L4ZB 1WXSA 1FFVA 1I4XA 2KOXA 1WMHA 2M17A 2KDIA 4C00A 3P42A 4WAFA 3TBLD 1TS2A 2R2QA 3ZVVA 2JRHA 2KJ6A 2JRIB 1NENB 1HA5A 1L0VB 4IDIA 2V4LA 3GE8C 3EA6A 2WXNA 3ABVB 4LJPB 3MHZA 2AQ1B 4EOYA 2MRPA 1KLGD 3LYYA 1DYQA 4OVVA 1EUVB 1FRRA 4YWGG 1K50A 1GJZA 3NJTA 2NPTB 4LNOA 2DX5B 3Q8BA 2QMTA 4M0WA 2W3RA 2GBKA 2Z59B 3PHXB 2ZW1A 1T0RC 2BT6A 3HUIA 2ZJDA 5DPWA 4GIVA 3N1YC 3HRDD 3DWGC 3T3OA 2JWUA 2M1MA 2DZMA 1L0YB 1P1AA 5E6PA 4A55A 3IG3A 3I63C 4FHJA 4NPNA 4FXCA 4EE2A 3WCQA 1QZEA 1P7EA 3CF6E 3AE8B 4NJCA 3TEYA 2KTRB 4C4VB 2HD5B 2WNMA 1E9MA 3B0AA 1UWXA 2IO3B 3PO0A 2RSUA 3ENEA 4WWOA 1ZUD2 3GOEA 1M94A 1SE3A 2PKOA 1ZXHA 3RD2A 4ZRJA 3A4RA 3WAOA 3KUDB 3M63B 2D07B 2KVZA 4EZKA 5DPRA 1SB3C 1ROEA 3AE4B 2N1WA 1UD7A 2MP2A 1QOAA 5I4DA 3QCAA 5HHDG 3QARA 4IC7B 3PHWB 4A90A 2JXTA 1NVID 2KFKA 3ECIA 5AZFA 2N9EB 3KUCB 5LXIB 4JE3B 3N1ZC 2REXA 1WX7A 3ZJVA 1EF1A 1ZPSA 1WF9A 4KKJA 2KANA 2XNAC 1DOYA 2MW5A 2Q5WD 5GMVA 3UGBB 3NS8A 4LNFA 1LM8B 1SE4A 2QHOA 3VTWA 1EWCA 4US8A 3R7QA 1ZE3D 5D3IB 1HTQA 3KH0A 2JZZA 4P1CC 3ETRA 4XE0A 5L83A 1JCKB 3FAHA 3ONSA 2KLCA 3B1LX 5IOIA 3EFUA 4IG7B 2AEHA 3OLMD 1QOGA 2R61A 4RH6A 5E6JA 1SXTA 2G9HD 3E56A 4TUUA 3MJ5A 3R8BA 1V5TA 1C9FA 4GDKA 2IGHA 3DBRB 1J7AA 4KIKB 3VXWA 2AQ3B 1WR6E 4NAMA 1HTOA 1KTKA 3ZGZA 3MC0B 2BB6A 2ZPNA 1QOFA 2NTTA 3MFGA 1UBIA 3QX1A 1C76A 3GE3C 4K3BA 3R7RA 2WQYB 4MJSA 3AI5A 3IHPC 4OZBA 1QKZA 3WAPA 3PT2B 4WAAA 3ML8A 4WJOA 3WA0A 4DWFA 1ZOYB 4NNJB 1WI0A 1Q1OA 4AJWA 1WMHB 4IWOA 1JQ4A 3CMMB 4AQ7A 2KN5A 2K8CA 4NY0A 4NQKE 2ZW0A 2KACA 5JHAA 4BKGA 4IM3A 2WXLA 1I4QA 4AOFA 2INDC 4FN2A 4RFBA 2CU3A 1L6VA 4KVGB 1C77A 3I5JC 2IO0B 3NVZA 4G11A 3FKYA 1V8CA 1MG4A 3PRPB 3W1SA 3K9OB 4HK2A 1FXTB 1WM3A 1J0GA 1RLFA 2WXPA 2KWVB 2LJ5A 4ZYNA 3AE2B 2RPQA 3L08A 2LVPA 4II3B 2INCC 2XBBC 3CSTA 2ZCCA 2BYFA 2D10A 4IOIE 3RPFC 3BK2A 4E74A 3TUOA 1L2NA 4ITKA 3RCZA 1WR1A 1VD2A 1J7CA 4J3OD 4B95A 2ZVNA 4MACA 5G55A 2FCMA 3PLUA 3AEAB 5D7GA 4HXDA 4WJPA 3PSEB 3AMZA 3DHIC 1WX8A 2HTHA 2KDMA 2DNFA 5LLIA 4LDTB 3L4PA 4MH0E 2K5PA 2WXKA 4JX1C 2WDRB 1E6EB 1GC7A 1UUPA 3DVNU 1TS3A 3AU5A 3QA8A 2KVRA 2KMAA 1YOVB 1MG8A 3P2BA 1STEA 1YJ1A 2WXOA 2BW2A 3VDZA 3Q8FA 1GNUA 1IBXB 1SIFA 3AE9B 2KC1A 1F1HA 1RWSA 3EFCA 3LJ3A 1V9JA 1TS5A 3JYUA 5AUIA 3P63A 2M0XA 3DBHB 2ZVOA 3RNFC 4F1SA 1Q5WB 2NBWB 3RULA 1TGZB 1YX6B 2MHJA 4LTUA 5FR6A 2HDEA 3A33B 4JL9A 3KWLA 3W1YA 4MM3A 5HG2A 5C23A 3B2FA 2KLGA 1S3SG 2O6VA 4NJ7A 1IUEA 1YQBA 4W9GA 1YX5B 3PGEA 5HI1A 1L4DB 2BYVE 3QQ8B 1N5XA 2YLMA 5E6OA 2IGDA 3ZNGC 2GBJA 3S2AA 1GPXA 1MFWA 1K51A 2Z8LA 1K53A 4JPSA 3E9SA 4CQNA 4RM8A 1TZOA 1K52A 2Y3AA 2DYOA 3R2IA 3WALA 1NYRA 3T3NA 2KK8A 3QHTA 3W9CB 1I4GA 2XEWA 3U8ZA 1IYFA 1TKGA 3DHHC 4YSZB 4A9AA 4B0MA 2AWTA 2MQJA 4QAYA 4DHJD 2Y5PA 2JZPA 3IVFA 4WJNA 3BYYB 4KGTA 2MCNB 3NVYA 1E8XA 5BMIA 1PGXA 4PS7A 1WGHA 4OW0A 2BB5A 4DDID 2LGDA 4DQOC 5BMHA 3CIRB 1X1MA 2QJLA 4MT5A 2PE9A 1D5ZC 4YL8A 1WIAA 1E7VA 3RNBC 1JWMD 4PS8A 2D3AA 1BUIC 4C7ZA 1XCTL 4DHZB 4MJSB 3N9YC 1XCQL 2K1FA 4HDQA 4CHKA 3H7SA 2QIEB 3BYTB 4HCNB 1V1PA 2L52A 2FCSA 1I7HA 1GUAB 1YQ3B 4GLSC 2L0TA 2DAFA 1CZPA 4EUTA 1JRUA 4FBJB 2O2VB 2KTFA 1EF5A 2MBOA 2LGSA 2KQ4X 3ZJTA 2L76A 3Q8EA 5H8YE 4KKIA 5HFYA 2WGSA 2ZNVB 4CYEA 3Q8CA 4HJGE 4JIOU 3R2TA 3B9JA 1IGCA 3Q8AA 1C4CA 2NBVB 2BF8B 2IYDB 1SSNA 1OFFA 3UF8A 3ZJUA 3VH4B 1OGWA 3Q69A 2RDBC 2WLBA 2K6QA 2J7QB 2CHWA 4EKUA 1AW7A 4F8CB 5TSSA 3TL5A 2LUEA 3VUYA 2CU1A 5IO9A 2C9WB 4PK1A 4PT5A 2DHZA 1N63A 5CHVC 4LNNA 3LXFA 1V5OA 1TT5B 1BXTA 3OJ4B 4KGSA 3UQAA 3IT4B 1E7UA 4ARIA 2L8JA 3AEDB 3NRZA 4XWTA 4BAXA 1J7BA 1FM0D 2BS4B 2DLBA 3BVZA 4YTPB 4DXGA 3DBHI 4L23A 4XX5A 1NEKB 1JWBD 1R7SA 4MGYE 4FA6A 4K3CA 2C5LC 4K1RB 3MHSD 3AN1A 4XDDA 2BBCA 1C4PA 3MJWA 2J53A 2K22A 2L1AA 2WXMA 3AULA 4RCOA 5GXGB 1F2RC 2RDGA 2TSSA 2WWZA 4KZCA 4P7IA 5LXHA 2RD0A 2FUG1 5C2TB 2RGFA 1WX9A 1WJNA 4JGHB 3JSVA 3VTUA 1RFAA 1HE8A 4MM3B 2D3CA 3OWEB 4L2YA 2H88B 1PYWD 1GG3A 3A1QA 3L0WB 1SF0A 2O6VB 3DBSA 3T9LA 4REZA 1TY2A 1TJEA 3VRAB 2N0SB 4W9DA 1JWSD 4W9LA 2FNJB 3ZRCA 2GB1A 5T8IA 3QWZB 4LK0M 1WWTA 3TEXA 2MJEA 1V86A 4TKNA 3TSSA 1WSPA 4BKSD 2QEJC 3BWUD 1OQRA 3B2GA 3VTVA 2BGFA 3AM9A 2IY0B 2K6DB 1XF5L 4G50A 4A20A 4USAA 5IN7A 2MJDA 4GDLA 3RI7C 3V62A 3SDLC 4S0RA 4P16A 2IO2B 1FMAD 3VQIA 2V0GA 3RZWC 2JT4B 2I2YA 4MGKE 4LNKA 3VHTC 3DWMA 4RGNA 4DK5A 3KQ4A 3O13A 3ZDTA 2NBUA 3AEGB 3TEZA 1L7YA 2LUMA 1E90A 3RMKC 3SU8X 3M3JA 4N9F4 3APDA 3A4SC 4RF0A 1I4RA 1FIQA 5D6JB 1V1OA 2DBYA 3P4RB 1LQBA 3OAWA 2QSDA 2V3SA 3NUHB 3H7PA 3V6EB 4EZLA 2NR2A 3TMPB 2V1YA 2LWPA 4HJKA 3Q6BA 4WWMA 2C60A 1Q0WB 1ACCA 5DPTA 1GB1A 1UH6A 4GGQA 3ZYYX 5JXVA 4K7UA 4M02A 2JY6A 2ZEQA 1KRHA 2LMCA 1V2YA 4G0NB 2JWZA 1Y8RC 2LXAA 2BWFA 3AE7B 4AWJA 4IWQA 1DOIA 1L6UA 4NAWA 2M8SA 1UGJA 3PZDA 5FK9C 3UQBA 5CHFA 1E8ZA 3DVGY 3IFWB 5JZEB 1JRPA 1VLBA 1I42A 1C78A 3R66C 2LJIA 2N9KA 2V4IB 1OQQA 1TYGB 1CK1A 4DHZE 5C1ZA 1EO6A 1VJKA 4ZRKA 2RR9A 3EECA 4IWPA 1ZDXA 2L7RA 3L17A 5AZGA 5G5HA 4P1BC 1V97A 2AL6A 1L0XB 2GLSA 4GOCA 3KWVA 1NDDA 4MEMA 2BWES 3D32A 3H1UA 4J6IA 3ZDMC 4DXFA 4TV3A 3FILA 4DXAB 3AB5A 1P9DU 4W9FA 3PS6A 1QF6A 4TQ1A 2J0MA 1E8YA 1QILA 1RYJA 2MLBA 2IGGA 1WE7A 1H8CA 1VZ6A 3AE3B 4PYZA 4ZDVA 1FEHA 4XZ4A 2LRWA 1VDVA 3DDCB 2N9XA 5H92C 4US9A 3UI3A 3IAS1 1S1QB 1D5MC 1V6EA 1G6JA 4ZYSA 3V6CB 1N6ZA 2JPHA 3VR8B 2HJ1A 3DQVA 2EKIA 3JSVB 2PTLA 5KHQA 4C56C 2GBMA 3QK0A 4M0WB 2OEDA 3A1QB 4HPMB 2FBWB 4JWUC 1WM2A 2N1VA 5G5GA 1SE9A 2K9XA 2KJRA 3A9JA 2WXFA 3I57A 3W2DA 2PVOD 4H2AA 2VZKB 3QAQA 2JF5A 1LXDA 2PE6B 2KHWB 3ZXVA 2LHEA 3C0RB 5CHWA 1WGRA 2WXGA 3KYCD 3RZFA 1WRIA 2KQSA 4FHKA 4L1BA 3NZUA 2LI5A 1YMHE 2AQ2B 4FJVB 3N20C 3IXSA 3EUB2 2MJ3A 2ZNVC 4BZAA 4GDLB 3B08A 3Q3MC 2RDHA 1YN4A 1SBBB 4W9KA 2KNBA 3ZRFA 3U7ZA 1NBFC 3W1SC 4K7WA 2KJHB 1P3QU 4HEA1 4TSSA 3RN9C 3VVWB 4LJOB 4AP4C 2KX0A 2NCNA 1QOBA 1QLBB 1FFUA 5BO4B 3I9V1 2CS4A 2MP2B 4WWPA 4E71A 3U30A 1UZXB 3SHQA 1R4MB 2ZPYA 3HM6X 2WYQA 2MSED 3AEBB 4RGMA 1UWMA 2WDQB 2I1KA 3N3KB 1WGYA 3BIID 4MDKE 4G3XB 3URYA 1F0ZA 2WX0A 1VR9A 2KFKB 2SEBD 1WXVA 5D2MB 2CHZA 3Q14C 4AS1A 2CHXA 2INNE 2NPTA 5DPSA 3ZUNA 2KD0A 1MJDA 3RNCC 1Z5SB 3C8YA 2QC8A 3AV8A 3RNEC 1WGGA 3NG0A 3HHMA 4WH4A 2G45B 4NAWB 1FO4A 2D3GA 3WAMA 4WQMA 3EHVA 3BVMA 1C4AA 2ZZPB 4BBNF 2PPHA 1WJ6A 1KH0A 4EFOA 3AH7A 2IZVB 2WHIA 4DBGA 3H6NA 3ZIMA 1Z2MA 4KSKC 1HZ5A 3V61A 2IBIB 4GDKB 2KT7A 1D6EC 3NS1A 2N9LA 3ZTCA 5D94A 4GSWA 2G1EA 1XO3A 4JWSC 2RPVA 4M00A 3AEFB 1GC6A 4JLCA 2KXJA 3MC8A 4NJ6A 4R3DA 2BS3B 4K7SA 2XN9C 4AJYB 5EE0A 1ZGUB 2MBHA 3ALBA 2J52A 2EMSA 1AN8A 1PDXA 3FC4A 4BBNC 4KX6B 3RYTA 3HIZA 1F52A 2FIFA 4EZJA 1JALA 2L83A 4GN1A 3H8HA 2KDEB 2JYEA 2W9NA 3ZNID 1FCLA 2L0FA 3SFEB 1KFYB 1I35A 2IDYA 1OEYA 2KWUB 4FADA 2LFIA 2V9HA 2LGXA 1WJUA 4S17A 2MH7A 2PIAA 4WWNA 1IP9A 3IT6B 3HVDA 1P7FA 2QDFA 3DBLI 4MELA 1IPGA 4I6NB 4W9CA 2K3UA 3SFDB 4KDIC 5FR3A 4BOSC 2L32A 2C7HA 1TZ1A 3X0WA 2ONQA 1V80A 4M01A 1YIWA 3TIXA 5IKCM 5BYRA 4HDOA 4RNAA 4URKA 3KLSX 4FULA 2JQRB 1XLPA 3JVZX 1MHHE 3AE5B 2DENB 3DOWA 4GB9A 1TIFA 1T3QA 4N58A 4LDTD 1XEEA 2ON8A 2KMMA 1A5RA 2OHFA 4Q2JA 1LFDA 1N60A 2PVGC 2QCZA 3QJZA 4O1NA 3APFA 2FAZA 2DZJA 2JX5A 3BZDB 1E10A 4AUQC 2K8HA 1ISNA 3NHEB 2LZ6A 1VCBA 4X57B 2WP9B 4A3PA 1R4MI 2ICIA 2JSVX 2KYWA 3N30A 1YJJA 1WY8A 2WDVB 4NZLB 4C80A 1AARA 2NTSA 3ZW3A 2JYTA 2W3SA 2LASA 2JU6X 5JHBA 2DZIA 4FJZA 4YXDB 2EKEC 3P4SB 1JWAD 3Q3OC 2H89B 4KV2A 1LGRA 3WANA 4UDUC 3U7DA 1XQQA 2V3NA 4B0EA 1DGJA 1HZ6A 3ZNZB 2B3AA 3RUIB 4ZRPA 4OVUA 1OEYJ 1NI3A 3K9PB 3Q3FA 5BMGA 2KMCA 4ACFA 2GBNA 3ML9A 1ZW7A 4HKQA 1M4VA 3T8MA 3BVGA 2OJWA 1B9RA 4BKTA 3AEEB 4GMVA 4PYUA 4ZHPA 2MEKA 4A6QA 1HXYD 2M56B 1WRDB 5J18A 1I4HA 3PRMB 1PFDA 1RFKA 3PRZA 3X23A 2GBRA 4HCPB 2IJ0A 1V81A 4GU2A 2NS5A 4HWIB 2WU5B 4LLGM 3SR6A 4A8XC 2N4FA 3PPAA 2EELA 5LNK1 3QC8B 4KDLB 4WQOB 1EWYC 3NOBA 3V3XA 4B6WA 3L13A 3L54A 3UIPB 4ASWC 3DPDA 4PS3A 4N6EB 2AL3A 2B76B 3RNAC 2WXRA 2HE7A 4YTNB 3VR9B 2J4XA 4GXBA 2HJ8A 2I38A 4ZRQA 1XT9B 4A3OA 1WYWB 2GRIA 2LGIA 2W82A 3H9DA 3PTFC 2KQ7A 3AU4A 2JZ3B 4II2B 5AUKA 1UBQA 4RF1A 1XD3B 2MBEA 2FE8A 2JUOA 5JH5C 2IY1B 2X38A 3LB8C 3NVWA 2V3PA 2WXHA 1IBXA 1JROA 4OVZA 2I1JA 1TY0A 2A4ZA 4LNIA 2E3TA 1L5PA 1FNUA 1ZP0B 1OTRB 5TR5A 1QT9A 1NI2A 1V1PB 2LD9A 1YNTE 3R3MA 1OQYA 1E5WA 3CWIA 2MX2A 1H4RA 1FXIA 2SAKA 5EE3A 4RM9A 3MP9A 3A9KA 4K81A 1ET6A 5J17A 2YEPB 4B9KA 2Y5CA 3GS2A 2Y5BB 5DCNA 4ZHOA 2W54A 4KGRA 2PEAA 2C7NB 2Z0DB 1MPEA 2UYZB 1WGKA 2G4DB 2L3ZA 4ZRIA 3PLVA 2WXJA 1T5XD 1NYQA 1N5WA 3I3TB 5BYQA 3HK0A 4W9IA 1N61A 2RMMA 3ZLZA 1JMLA 2QILA 3BINA 2L00B 1PQSA 1K8RB 5D3DA 1MVKA 3MC9A 3L16A 4FLHA 1JW9D 1CJEA 4OZCA 1VRAB 2E6XA 2VRRB 2KFJA 4BKSA 3KUZA 2INPE 3M95A 1RRBA 4LCDE 1SJED 4OZAA 1WJ4A 3PZ8A 1GB4A 1QQRA 4CO7A 4XC2A 1J19A 3HM3A 3L10B 4ZOHC 1KLUD 2M19A 2G4SA 3GZNB 4DHJB 5IP4D 1DOXA 1D5XC 3OJ3A 1WFYA 2NMQA 1FNVA 2OJRA 1KM7A 1YN5A 1LO5D 2LHDA 3JW0X 3PVLA 5EE9A 2DZKA 2D3BA 4P6VF 4BOZB 4XGAB 2HTME 1R4NB 2BS2B 2VH1A 2KX3A 1PGBA 1XXGA 1FPYA 2O6VD 3DVNV 5EDSA 2UU7A 2VH2A 2LEKA 1PGAA 2WDTB 4KZ0A 4YSYB 1IGDA 2O2VA 5BYSA 3TCAA 1P0RA 2FIDA 2KDFB 1WH3A 4HPPA 3U4EG 4W9HA 5G2NA 3SEBA 1KJTA 1U4AA 3DBLB 3ZKJC 3DCGA 4MH8A 1HQRD 3AECB 4TQ0A 3APCA 2J42A 1WGDA 1WYGA 2LXCA 4ARCA 1FCCC 3CSFA 3NY5A 3TJPA 2GI9A 1FD6A 2DAJA 5AZHA 1WE6A 3Q2AC 4I6LB 2PJHA 1TBEA 2KO3A 2MA9B 2BYEA 3ZTDA 3PREA 4KSLC 2MBQA 2BKFA 3PZ7A 2EMTA 4MSQB 2KDBA 1TKYA 2Z0EB 2KAJA 1F9JA 2K25A 1F77A 4M8NA 1MHXA 2L05A 1YJIA 4MSMB 1SE2A 3V60A 1RM6C 1SIJA 2PMVA 2BYTA 2LVQA 2XK5A 3W5UB 3M62B 4NQLB 5IA7A 5C3JB 2X8XX 3BY4B 2JVCA 1SJHD 3HVZA 2ACZB 2IO1B 4RMAA 1N62A 1C79A 2KN4A 3J9CA 4HRSA 3MTNB 4HKZE 2A5UA 2WU2B 1YQ4B 5AEKB 2AX5A 1B1ZA 2MBBB 4ANVA 3ZNHB 1EM7A 1BT0A 2BVCA 3LDZE 3VFKA 5HKHA 4DDGD 5FKAC 2N7JA 1TTNA 4XWWA 4ANXA 3VUWA 3H7PB 1KF6B 1E0ZA 3SD5A 2D5GA 4N59A 1AWDA 3RFZB 1EU3A 1C1YB 4M8MA 3ZO5B 4HVBA 3OG5A 5CTRC 3RT3B 1GOZA 3A9KB 3KW5B 4HPLB 1XLOA 1KOTA 1UNSA 4IW0A 3GB1A 5J2RA 2GOWA 3AE1B 3U2SC 3VUXA 4XDCA 2BKRB 2WX1A 1MI0A 3DBRI 2G3QB 1UELA 4MGIE 3N1XC 1CQVA 1F2RI 4IM0A 3AXCA 4EEWA 2AYOB 4WURA 1WXQA 4FJYA 2DYMA 2WXQA 1FNWA 2DWQA 4BVUC 2KTRA 1VZ7A 2BTEA 2BPSA 1HEZE 4C4VA 1BMLC 5IAAC 3GZNI 1RAXA 4JQWC 1WXMA 3U52E 4RGTA 3IAM1 2OOBB 3VRBB 2W55A 1ET9A 3O65B 1I4PA 3W5VB 4HROA 1XLQA 2WXIA 3DVGX 4OHJA 3C19A 1R4NI 2N9PC 3FILB 1J8CA 3KVFB 3ZQ4A 2KC2A 2BQQA 1WZ0A 4W9JA 2GMIC 1CMXB 1EU4A 3QIJA 3P4PB 4IUMB 1SEBD 2K39A 3DHGC 1SGHA 2N7DA 1UGMA 3P1MA 1T6BX 2LRUA 2K8BA 2M0AA 4ANUA 4YTMB 1YN3A 4ANWA 2C7MB 1T0QC 3IBEA 4I6PA 4F7ZA 1Q10A 1UF0A 4WJQA 2JXXA 1D3ZA 1P98A 2LGYA 4E3CA 2FCNA 2UWQA 5EE1A 4ICUA 1ZXIA 1YD8U 4HLEA 1E8WA 1WZ3A 4IKGA 1T0YA 4MGZE 4YT0B 4YSXB 2YEPF 3VH3B 3NZ3A 1C3TA 2VZKD 2K0PA
chains in the Genus database with same CATH topology
1EWYC 4TMAB 5MPOA 4RGOS 1PUTA 4DXFA 3V3XA 3FILA 3GP7A 3AB5A 4LTUA 2HDEA 4N6EB 3KWLA 1JWUD 2B76B 1QF6A 5HG2A 4TQ1A 2WXRA 3B2FA 4YTNB 1ZDVA 2IPKD 1A70A 3VR9B 2J4XA 1IUEA 1QILA 2I38A 4ZRQA 2GRIA 2W82A 2LGIA 1RYJA 5HI1A 3NVVA 2PLPA 2IGGA 1L4DB 4C7YA 1VZ6A 1XLNA 5AUKA 3AE3B 1N5XA 1FEHA 2IGDA 3EGRA 4RF1A 1VDVA 2FE8A 5H92C 4US9A 1GPXA 1K51A 1VZ8A 2X38A 3LB8C 3UI3A 3IAS1 3NVWA 1D5MC 1AYFA 2V3PA 2WS3B 2WXHA 2Z8LA 1ESFA 1K53A 3AE6B 4JPSA 3E9SA 4ZYSA 4CQNA 1IBXA 1JROA 4OVZA 3VR8B 1TY0A 1TZOA 1K52A 2E3TA 2DYOA 1L5PA 2Y3AA 1FNUA 3R2IA 1NYRA 2EKIA 3T3NA 1ZP0B 2PTLA 4C56C 2CJNA 1TKEA 1E7PB 1FXAA 3W9CB 1I4GA 3P4QB 4WIPA 2CJOA 1D4BA 1ENFA 1TKGA 1QT9A 2PW9A 2OEDA 3TEWA 4D2KA 1V1PB 4YSZB 2KWDA 4A9AA 4B0MA 2FBWB 1Y56A 4JWUC 1YNTE 1TS4A 5G5GA 2Y5PA 3V05A 2JZPA 3BK1A 2K9XA 1GAQB 3CWIA 1FRDA 1L4ZB 1I4XA 1FFVA 1FXIA 3BYYB 2SAKA 4KGTA 5EE3A 3MP9A 2WXFA 3I57A 3NVYA 3P42A 3W2DA 4WAFA 1ET6A 2PVOD 4H2AA 2VZKB 2YEPB 1TS2A 2Y5CA 3GS2A 5BMIA 1PGXA 2LHEA 4OW0A 2BB5A 1NENB 2WXGA 3CIRB 4DQOC 4ZHOA 5BMHA 1HA5A 1L0VB 4IDIA 1WRIA 2W54A 2QJLA 4MT5A 1D5ZC 4KGRA 1JWMD 3EA6A 4L1BA 1BUIC 1MPEA 4C7ZA 1XCTL 2WXNA 1YMHE 2AQ2B 3ABVB 3MHZA 1WGKA 2AQ1B 3IXSA 3N9YC 3EUB2 1XCQL 1KLGD 3LYYA 2MJ3A 2WXJA 1DYQA 1T5XD 1NYQA 1N5WA 4GDLB 1FRRA 5BYQA 4YWGG 1K50A 2RDHA 1N61A 1YN4A 1SBBB 3Q8BA 2RMMA 2QMTA 1JMLA 2QILA 2QIEB 2W3RA 3BYTB 4M0WA 3U7ZA 1V1PA 2L52A 5D3DA 1MVKA 2ZW1A 1I7HA 1JW9D 1YQ3B 4GLSC 2BT6A 4HEA1 4TSSA 1CJEA 3HUIA 4OZCA 1VRAB 2E6XA 1CZPA 3HRDD 3DWGC 3T3OA 2INPE 2JWUA 1L0YB 1QOBA 1QLBB 1SJED 4OZAA 3PZ8A 1FFUA 4A55A 1GB4A 1QQRA 3I9V1 2KQ4X 4FXCA 3ZJTA 4ZOHC 1KLUD 4EE2A 3Q8EA 5H8YE 2M19A 4KKIA 3WCQA 5HFYA 3AEBB 3Q8CA 1DOXA 4RGMA 1UWMA 1P7EA 1D5XC 2WDQB 4HJGE 2NMQA 3BIID 1FNVA 3R2TA 3AE8B 3B9JA 4NJCA 1YN5A 1LO5D 3URYA 2LHDA 1F0ZA 1IGCA 1VR9A 3TEYA 2SEBD 3Q8AA 5EE9A 1C4CA 2WNMA 1E9MA 1UWXA 1SSNA 4P6VF 1OFFA 3PO0A 3ZJUA 4AS1A 2INNE 2HTME 3Q69A 2BS2B 2WLBA 1PGBA 1XXGA 1ZUD2 1AW7A 5TSSA 3C8YA 1SE3A 2LEKA 1PGAA 2PKOA 3AV8A 4PT5A 1N63A 1ZXHA 3LXFA 4YSYB 4WH4A 4NAWB 1FO4A 1IGDA 1BXTA 5BYSA 4KGSA 4WQMA 3IT4B 3BVMA 4ARIA 1C4AA 1SB3C 1ROEA 3AE4B 3AEDB 3NRZA 4XWTA 3U4EG 1QOAA 1KH0A 5I4DA 1J7BA 1FM0D 2BS4B 2DLBA 3AH7A 3SEBA 3BVZA 4YTPB 5HHDG 4DXGA 4L23A 1NEKB 1JWBD 1HZ5A 1R7SA 4A90A 2JXTA 4GDKB 1NVID 1D6EC 3NS1A 4MH8A 1HQRD 2N9LA 3AECB 4TQ0A 3AN1A 2G1EA 4XDDA 1XO3A 4JE3B 2BBCA 2J42A 1WYGA 4JWSC 2RPVA 1C4PA 4ARCA 1FCCC 3ZJVA 3AEFB 1ZPSA 2GI9A 4KKJA 2J53A 1FD6A 2K22A 2XNAC 2L1AA 1DOYA 2WXMA 2Q5WD 4R3DA 4RCOA 5GXGB 2BS3B 1F2RC 2XN9C 1SE4A 2RDGA 2TSSA 5EE0A 1EWCA 4US8A 2J52A 3PZ7A 1AN8A 1PDXA 2FUG1 3FC4A 1ZE3D 5C2TB 5D3IB 4KX6B 1TKYA 1JALA 2L83A 2KAJA 1F77A 3H8HA 1MHXA 1YJIA 2JYEA 3ETRA 4XE0A 1FCLA 1JCKB 3FAHA 4MM3B 1SE2A 3OWEB 4L2YA 2H88B 3SFEB 1PYWD 1SF0A 1RM6C 1KFYB 1SIJA 2PMVA 1QOGA 2BYTA 2R61A 2IDYA 4RH6A 1SXTA 2G9HD 5E6JA 3W5UB 3E56A 3MJ5A 4REZA 2LFIA 1TY2A 1TJEA 3R8BA 5C3JB 3VRAB 1C9FA 2N0SB 1SJHD 3HVZA 1JWSD 2IGHA 1J7AA 2ACZB 2MH7A 2PIAA 2AQ3B 1N62A 1C79A 4NAMA 2KN4A 3J9CA 4HRSA 3IT6B 1KTKA 3HVDA 2GB1A 5T8IA 1P7FA 3ZGZA 3MC0B 2BB6A 4LK0M 4HKZE 1WWTA 2WU2B 1YQ4B 3TEXA 2AX5A 1B1ZA 2MJEA 1QOFA 3TSSA 2K3UA 3SFDB 1EM7A 2NTTA 1WSPA 5FR3A 3MFGA 2L32A 2QEJC 3BWUD 1C76A 1OQRA 5FKAC 3B2GA 2N7JA 2ONQA 2WQYB 4XWWA 3AM9A 1XF5L 4OZBA 4USAA 5BYRA 1KF6B 1QKZA 4RNAA 1E0ZA 2D5GA 4N59A 2MJDA 1AWDA 3KLSX 2JQRB 3RFZB 1XLPA 1EU3A 1MHHE 3AE5B 1ZOYB 4P16A 1FMAD 3VQIA 1GOZA 2V0GA 1T3QA 4N58A 1JQ4A 1XEEA 2ON8A 2KMMA 1XLOA 2I2YA 4AQ7A 1UNSA 3DWMA 4RGNA 2OHFA 3KQ4A 3GB1A 4Q2JA 3O13A 3AE1B 2ZW0A 3AEGB 3TEZA 1N60A 2PVGC 3U2SC 2KACA 2LUMA 2WXLA 4O1NA 1I4QA 4XDCA 4RF0A 4RFBA 2CU3A 1I4RA 1L6VA 1MI0A 1FIQA 2JX5A 3BZDB 1E10A 1CQVA 1F2RI 1V1OA 2DBYA 1C77A 3P4RB 4WURA 3NVZA 1WXQA 1V8CA 2DYMA 2WXQA 1FNWA 2WP9B 2QSDA 2DWQA 1VZ7A 2BTEA 2JSVX 2ICIA 1HEZE 3NUHB 1BMLC 3W1SA 1YJJA 2WDVB 4WWMA 2WXPA 4NZLB 4C80A 3AE2B 1ACCA 3U52E 4RGTA 1GB1A 3ZYYX 3IAM1 5JXVA 2NTSA 3VRBB 2JYTA 2W3SA 2W55A 1ET9A 3W5VB 1I4PA 2JU6X 1KRHA 4HROA 2LMCA 1XLQA 2WXIA 4IOIE 4YXDB 4OHJA 3P4SB 1JWAD 3RPFC 2H89B 3AE7B 4UDUC 3BK2A 3TUOA 2V3NA 3FILB 4B0EA 1DOIA 4ITKA 1L6UA 3ZQ4A 1DGJA 1HZ6A 1J7CA 1UGJA 4J3OD 5FK9C 4ZRPA 4MACA 1EU4A 3AEAB 3P4PB 1NI3A 1SEBD 5D7GA 5BMGA 3AMZA 1JRPA 1VLBA 3P1MA 1T6BX 2KDMA 1C78A 4HKQA 2M0AA 3L4PA 2LJIA 1M4VA 4YTMB 3BVGA 2N9KA 1YN3A 2K5PA 2WXKA 2V4IB 1OQQA 2WDRB 1TYGB 1E6EB 4JX1C 1UUPA 1CK1A 1TS3A 1B9RA 3AEEB 1Q10A 4ZHPA 1VJKA 2MEKA 4A6QA 1HXYD 1STEA 2M56B 2BW2A 2WXOA 1I4HA 5EE1A 1ZDXA 1PFDA 1ZXIA 3Q8FA 1RFKA 5G5HA 1V97A 1IBXB 3AE9B 2IJ0A 4IKGA 1L0XB 1RWSA 4YT0B 2WU5B 4LLGM 3SR6A 4YSXB 1TS5A 2YEPF 3KWVA 3NZ3A 4A8XC 2EELA 5AUIA 3P63A 5LNK1 2VZKD 2K0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGJ A; 
#chains in the Genus database with same CATH topology
 4TMA B;  2R2O A;  5MPO A;  4RGO S;  1PUT A;  4IM2 A;  2KZR A;  3GP7 A;  3ZXR A;  3UIN B;  1JWU D;  1WXA A;  3PV1 A;  3RNG C;  4BFR A;  1ZDV A;  2IPK D;  1A70 A;  3A9J B;  3Q3J A;  4XYC A;  2LVO A;  2N7E A;  2MWS B;  2ZCB A;  3N32 A;  3UIO B;  3NVV A;  2PLP A;  1KLV A;  4C7Y A;  3WIM A;  4KIK A;  1XLN A;  4W9E A;  2D2Q A;  2J0J A;  3EGR A;  2FCQ A;  1V49 A;  2ASQ A;  1VZ8 A;  3Q3N C;  5E6N A;  2CR5 A;  1AYF A;  1T0S C;  2WS3 B;  3AE6 B;  1ESF A;  3EC8 A;  1ZKH A;  2CKH B;  2KKC A;  2J0K A;  5KHO A;  2DYB A;  2NVU I;  2M4N A;  2D11 A;  4ICV A;  3KYD D;  2CJN A;  1TKE A;  1E7P B;  1FXA A;  3P4Q B;  4WIP A;  2CJO A;  5CX3 A;  2FUH B;  3VAW A;  1D4B A;  1ENF A;  2PW9 A;  3TEW A;  5L95 C;  4D2K A;  2KWD A;  3NZS A;  1Y56 A;  1TS4 A;  2XK5 B;  3V05 A;  2YVC A;  3BK1 A;  2KWC A;  1GAQ B;  1FRD A;  1L4Z B;  1WXS A;  1FFV A;  1I4X A;  2KOX A;  1WMH A;  2M17 A;  2KDI A;  4C00 A;  3P42 A;  4WAF A;  3TBL D;  1TS2 A;  2R2Q A;  3ZVV A;  2JRH A;  2KJ6 A;  2JRI B;  1NEN B;  1HA5 A;  1L0V B;  4IDI A;  2V4L A;  3GE8 C;  3EA6 A;  2WXN A;  3ABV B;  4LJP B;  3MHZ A;  2AQ1 B;  4EOY A;  2MRP A;  1KLG D;  3LYY A;  1DYQ A;  4OVV A;  1EUV B;  1FRR A;  4YWG G;  1K50 A;  1GJZ A;  3NJT A;  2NPT B;  4LNO A;  2DX5 B;  3Q8B A;  2QMT A;  4M0W A;  2W3R A;  2GBK A;  2Z59 B;  3PHX B;  2ZW1 A;  1T0R C;  2BT6 A;  3HUI A;  2ZJD A;  5DPW A;  4GIV A;  3N1Y C;  3HRD D;  3DWG C;  3T3O A;  2JWU A;  2M1M A;  2DZM A;  1L0Y B;  1P1A A;  5E6P A;  4A55 A;  3IG3 A;  3I63 C;  4FHJ A;  4NPN A;  4FXC A;  4EE2 A;  3WCQ A;  1QZE A;  1P7E A;  3CF6 E;  3AE8 B;  4NJC A;  3TEY A;  2KTR B;  4C4V B;  2HD5 B;  2WNM A;  1E9M A;  3B0A A;  1UWX A;  2IO3 B;  3PO0 A;  2RSU A;  3ENE A;  4WWO A;  1ZUD 2;  3GOE A;  1M94 A;  1SE3 A;  2PKO A;  1ZXH A;  3RD2 A;  4ZRJ A;  3A4R A;  3WAO A;  3KUD B;  3M63 B;  2D07 B;  2KVZ A;  4EZK A;  5DPR A;  1SB3 C;  1ROE A;  3AE4 B;  2N1W A;  1UD7 A;  2MP2 A;  1QOA A;  5I4D A;  3QCA A;  5HHD G;  3QAR A;  4IC7 B;  3PHW B;  4A90 A;  2JXT A;  1NVI D;  2KFK A;  3ECI A;  5AZF A;  2N9E B;  3KUC B;  5LXI B;  4JE3 B;  3N1Z C;  2REX A;  1WX7 A;  3ZJV A;  1EF1 A;  1ZPS A;  1WF9 A;  4KKJ A;  2KAN A;  2XNA C;  1DOY A;  2MW5 A;  2Q5W D;  5GMV A;  3UGB B;  3NS8 A;  4LNF A;  1LM8 B;  1SE4 A;  2QHO A;  3VTW A;  1EWC A;  4US8 A;  3R7Q A;  1ZE3 D;  5D3I B;  1HTQ A;  3KH0 A;  2JZZ A;  4P1C C;  3ETR A;  4XE0 A;  5L83 A;  1JCK B;  3FAH A;  3ONS A;  2KLC A;  3B1L X;  5IOI A;  3EFU A;  4IG7 B;  2AEH A;  3OLM D;  1QOG A;  2R61 A;  4RH6 A;  5E6J A;  1SXT A;  2G9H D;  3E56 A;  4TUU A;  3MJ5 A;  3R8B A;  1V5T A;  1C9F A;  4GDK A;  2IGH A;  3DBR B;  1J7A A;  4KIK B;  3VXW A;  2AQ3 B;  1WR6 E;  4NAM A;  1HTO A;  1KTK A;  3ZGZ A;  3MC0 B;  2BB6 A;  2ZPN A;  1QOF A;  2NTT A;  3MFG A;  1UBI A;  3QX1 A;  1C76 A;  3GE3 C;  4K3B A;  3R7R A;  2WQY B;  4MJS A;  3AI5 A;  3IHP C;  4OZB A;  1QKZ A;  3WAP A;  3PT2 B;  4WAA A;  3ML8 A;  4WJO A;  3WA0 A;  4DWF A;  1ZOY B;  4NNJ B;  1WI0 A;  1Q1O A;  4AJW A;  1WMH B;  4IWO A;  1JQ4 A;  3CMM B;  4AQ7 A;  2KN5 A;  2K8C A;  4NY0 A;  4NQK E;  2ZW0 A;  2KAC A;  5JHA A;  4BKG A;  4IM3 A;  2WXL A;  1I4Q A;  4AOF A;  2IND C;  4FN2 A;  4RFB A;  2CU3 A;  1L6V A;  4KVG B;  1C77 A;  3I5J C;  2IO0 B;  3NVZ A;  4G11 A;  3FKY A;  1V8C A;  1MG4 A;  3PRP B;  3W1S A;  3K9O B;  4HK2 A;  1FXT B;  1WM3 A;  1J0G A;  1RLF A;  2WXP A;  2KWV B;  2LJ5 A;  4ZYN A;  3AE2 B;  2RPQ A;  3L08 A;  2LVP A;  4II3 B;  2INC C;  2XBB C;  3CST A;  2ZCC A;  2BYF A;  2D10 A;  4IOI E;  3RPF C;  3BK2 A;  4E74 A;  3TUO A;  1L2N A;  4ITK A;  3RCZ A;  1WR1 A;  1VD2 A;  1J7C A;  4J3O D;  4B95 A;  2ZVN A;  4MAC A;  5G55 A;  2FCM A;  3PLU A;  3AEA B;  5D7G A;  4HXD A;  4WJP A;  3PSE B;  3AMZ A;  3DHI C;  1WX8 A;  2HTH A;  2KDM A;  2DNF A;  5LLI A;  4LDT B;  3L4P A;  4MH0 E;  2K5P A;  2WXK A;  4JX1 C;  2WDR B;  1E6E B;  1GC7 A;  1UUP A;  3DVN U;  1TS3 A;  3AU5 A;  3QA8 A;  2KVR A;  2KMA A;  1YOV B;  1MG8 A;  3P2B A;  1STE A;  1YJ1 A;  2WXO A;  2BW2 A;  3VDZ A;  3Q8F A;  1GNU A;  1IBX B;  1SIF A;  3AE9 B;  2KC1 A;  1F1H A;  1RWS A;  3EFC A;  3LJ3 A;  1V9J A;  1TS5 A;  3JYU A;  5AUI A;  3P63 A;  2M0X A;  3DBH B;  2ZVO A;  3RNF C;  4F1S A;  1Q5W B;  2NBW B;  3RUL A;  1TGZ B;  1YX6 B;  2MHJ A;  4LTU A;  5FR6 A;  2HDE A;  3A33 B;  4JL9 A;  3KWL A;  3W1Y A;  4MM3 A;  5HG2 A;  5C23 A;  3B2F A;  2KLG A;  1S3S G;  2O6V A;  4NJ7 A;  1IUE A;  1YQB A;  4W9G A;  1YX5 B;  3PGE A;  5HI1 A;  1L4D B;  2BYV E;  3QQ8 B;  1N5X A;  2YLM A;  5E6O A;  2IGD A;  3ZNG C;  2GBJ A;  3S2A A;  1GPX A;  1MFW A;  1K51 A;  2Z8L A;  1K53 A;  4JPS A;  3E9S A;  4CQN A;  4RM8 A;  1TZO A;  1K52 A;  2Y3A A;  2DYO A;  3R2I A;  3WAL A;  1NYR A;  3T3N A;  2KK8 A;  3QHT A;  3W9C B;  1I4G A;  2XEW A;  3U8Z A;  1IYF A;  1TKG A;  3DHH C;  4YSZ B;  4A9A A;  4B0M A;  2AWT A;  2MQJ A;  4QAY A;  4DHJ D;  2Y5P A;  2JZP A;  3IVF A;  4WJN A;  3BYY B;  4KGT A;  2MCN B;  3NVY A;  1E8X A;  5BMI A;  1PGX A;  4PS7 A;  1WGH A;  4OW0 A;  2BB5 A;  4DDI D;  2LGD A;  4DQO C;  5BMH A;  3CIR B;  1X1M A;  2QJL A;  4MT5 A;  2PE9 A;  1D5Z C;  4YL8 A;  1WIA A;  1E7V A;  3RNB C;  1JWM D;  4PS8 A;  2D3A A;  1BUI C;  4C7Z A;  1XCT L;  4DHZ B;  4MJS B;  3N9Y C;  1XCQ L;  2K1F A;  4HDQ A;  4CHK A;  3H7S A;  2QIE B;  3BYT B;  4HCN B;  1V1P A;  2L52 A;  2FCS A;  1I7H A;  1GUA B;  1YQ3 B;  4GLS C;  2L0T A;  2DAF A;  1CZP A;  4EUT A;  1JRU A;  4FBJ B;  2O2V B;  2KTF A;  1EF5 A;  2MBO A;  2LGS A;  2KQ4 X;  3ZJT A;  2L76 A;  3Q8E A;  5H8Y E;  4KKI A;  5HFY A;  2WGS A;  2ZNV B;  4CYE A;  3Q8C A;  4HJG E;  4JIO U;  3R2T A;  3B9J A;  1IGC A;  3Q8A A;  1C4C A;  2NBV B;  2BF8 B;  2IYD B;  1SSN A;  1OFF A;  3UF8 A;  3ZJU A;  3VH4 B;  1OGW A;  3Q69 A;  2RDB C;  2WLB A;  2K6Q A;  2J7Q B;  2CHW A;  4EKU A;  1AW7 A;  4F8C B;  5TSS A;  3TL5 A;  2LUE A;  3VUY A;  2CU1 A;  5IO9 A;  2C9W B;  4PK1 A;  4PT5 A;  2DHZ A;  1N63 A;  5CHV C;  4LNN A;  3LXF A;  1V5O A;  1TT5 B;  1BXT A;  3OJ4 B;  4KGS A;  3UQA A;  3IT4 B;  1E7U A;  4ARI A;  2L8J A;  3AED B;  3NRZ A;  4XWT A;  4BAX A;  1J7B A;  1FM0 D;  2BS4 B;  2DLB A;  3BVZ A;  4YTP B;  4DXG A;  3DBH I;  4L23 A;  4XX5 A;  1NEK B;  1JWB D;  1R7S A;  4MGY E;  4FA6 A;  4K3C A;  2C5L C;  4K1R B;  3MHS D;  3AN1 A;  4XDD A;  2BBC A;  1C4P A;  3MJW A;  2J53 A;  2K22 A;  2L1A A;  2WXM A;  3AUL A;  4RCO A;  5GXG B;  1F2R C;  2RDG A;  2TSS A;  2WWZ A;  4KZC A;  4P7I A;  5LXH A;  2RD0 A;  2FUG 1;  5C2T B;  2RGF A;  1WX9 A;  1WJN A;  4JGH B;  3JSV A;  3VTU A;  1RFA A;  1HE8 A;  4MM3 B;  2D3C A;  3OWE B;  4L2Y A;  2H88 B;  1PYW D;  1GG3 A;  3A1Q A;  3L0W B;  1SF0 A;  2O6V B;  3DBS A;  3T9L A;  4REZ A;  1TY2 A;  1TJE A;  3VRA B;  2N0S B;  4W9D A;  1JWS D;  4W9L A;  2FNJ B;  3ZRC A;  2GB1 A;  5T8I A;  3QWZ B;  4LK0 M;  1WWT A;  3TEX A;  2MJE A;  1V86 A;  4TKN A;  3TSS A;  1WSP A;  4BKS D;  2QEJ C;  3BWU D;  1OQR A;  3B2G A;  3VTV A;  2BGF A;  3AM9 A;  2IY0 B;  2K6D B;  1XF5 L;  4G50 A;  4A20 A;  4USA A;  5IN7 A;  2MJD A;  4GDL A;  3RI7 C;  3V62 A;  3SDL C;  4S0R A;  4P16 A;  2IO2 B;  1FMA D;  3VQI A;  2V0G A;  3RZW C;  2JT4 B;  2I2Y A;  4MGK E;  4LNK A;  3VHT C;  3DWM A;  4RGN A;  4DK5 A;  3KQ4 A;  3O13 A;  3ZDT A;  2NBU A;  3AEG B;  3TEZ A;  1L7Y A;  2LUM A;  1E90 A;  3RMK C;  3SU8 X;  3M3J A;  4N9F 4;  3APD A;  3A4S C;  4RF0 A;  1I4R A;  1FIQ A;  5D6J B;  1V1O A;  2DBY A;  3P4R B;  1LQB A;  3OAW A;  2QSD A;  2V3S A;  3NUH B;  3H7P A;  3V6E B;  4EZL A;  2NR2 A;  3TMP B;  2V1Y A;  2LWP A;  4HJK A;  3Q6B A;  4WWM A;  2C60 A;  1Q0W B;  1ACC A;  5DPT A;  1GB1 A;  1UH6 A;  4GGQ A;  3ZYY X;  5JXV A;  4K7U A;  4M02 A;  2JY6 A;  2ZEQ A;  1KRH A;  2LMC A;  1V2Y A;  4G0N B;  2JWZ A;  1Y8R C;  2LXA A;  2BWF A;  3AE7 B;  4AWJ A;  4IWQ A;  1DOI A;  1L6U A;  4NAW A;  2M8S A;  1UGJ A;  3PZD A;  5FK9 C;  3UQB A;  5CHF A;  1E8Z A;  3DVG Y;  3IFW B;  5JZE B;  1JRP A;  1VLB A;  1I42 A;  1C78 A;  3R66 C;  2LJI A;  2N9K A;  2V4I B;  1OQQ A;  1TYG B;  1CK1 A;  4DHZ E;  5C1Z A;  1EO6 A;  1VJK A;  4ZRK A;  2RR9 A;  3EEC A;  4IWP A;  1ZDX A;  2L7R A;  3L17 A;  5AZG A;  5G5H A;  4P1B C;  1V97 A;  2AL6 A;  1L0X B;  2GLS A;  4GOC A;  3KWV A;  1NDD A;  4MEM A;  2BWE S;  3D32 A;  3H1U A;  4J6I A;  3ZDM C;  4DXF A;  4TV3 A;  3FIL A;  4DXA B;  3AB5 A;  1P9D U;  4W9F A;  3PS6 A;  1QF6 A;  4TQ1 A;  2J0M A;  1E8Y A;  1QIL A;  1RYJ A;  2MLB A;  2IGG A;  1WE7 A;  1H8C A;  1VZ6 A;  3AE3 B;  4PYZ A;  4ZDV A;  1FEH A;  4XZ4 A;  2LRW A;  1VDV A;  3DDC B;  2N9X A;  5H92 C;  4US9 A;  3UI3 A;  3IAS 1;  1S1Q B;  1D5M C;  1V6E A;  1G6J A;  4ZYS A;  3V6C B;  1N6Z A;  2JPH A;  3VR8 B;  2HJ1 A;  3DQV A;  2EKI A;  3JSV B;  2PTL A;  5KHQ A;  4C56 C;  2GBM A;  3QK0 A;  4M0W B;  2OED A;  3A1Q B;  4HPM B;  2FBW B;  4JWU C;  1WM2 A;  2N1V A;  5G5G A;  1SE9 A;  2K9X A;  2KJR A;  3A9J A;  2WXF A;  3I57 A;  3W2D A;  2PVO D;  4H2A A;  2VZK B;  3QAQ A;  2JF5 A;  1LXD A;  2PE6 B;  2KHW B;  3ZXV A;  2LHE A;  3C0R B;  5CHW A;  1WGR A;  2WXG A;  3KYC D;  3RZF A;  1WRI A;  2KQS A;  4FHK A;  4L1B A;  3NZU A;  2LI5 A;  1YMH E;  2AQ2 B;  4FJV B;  3N20 C;  3IXS A;  3EUB 2;  2MJ3 A;  2ZNV C;  4BZA A;  4GDL B;  3B08 A;  3Q3M C;  2RDH A;  1YN4 A;  1SBB B;  4W9K A;  2KNB A;  3ZRF A;  3U7Z A;  1NBF C;  3W1S C;  4K7W A;  2KJH B;  1P3Q U;  4HEA 1;  4TSS A;  3RN9 C;  3VVW B;  4LJO B;  4AP4 C;  2KX0 A;  2NCN A;  1QOB A;  1QLB B;  1FFU A;  5BO4 B;  3I9V 1;  2CS4 A;  2MP2 B;  4WWP A;  4E71 A;  3U30 A;  1UZX B;  3SHQ A;  1R4M B;  2ZPY A;  3HM6 X;  2WYQ A;  2MSE D;  3AEB B;  4RGM A;  1UWM A;  2WDQ B;  2I1K A;  3N3K B;  1WGY A;  3BII D;  4MDK E;  4G3X B;  3URY A;  1F0Z A;  2WX0 A;  1VR9 A;  2KFK B;  2SEB D;  1WXV A;  5D2M B;  2CHZ A;  3Q14 C;  4AS1 A;  2CHX A;  2INN E;  2NPT A;  5DPS A;  3ZUN A;  2KD0 A;  1MJD A;  3RNC C;  1Z5S B;  3C8Y A;  2QC8 A;  3AV8 A;  3RNE C;  1WGG A;  3NG0 A;  3HHM A;  4WH4 A;  2G45 B;  4NAW B;  1FO4 A;  2D3G A;  3WAM A;  4WQM A;  3EHV A;  3BVM A;  1C4A A;  2ZZP B;  4BBN F;  2PPH A;  1WJ6 A;  1KH0 A;  4EFO A;  3AH7 A;  2IZV B;  2WHI A;  4DBG A;  3H6N A;  3ZIM A;  1Z2M A;  4KSK C;  1HZ5 A;  3V61 A;  2IBI B;  4GDK B;  2KT7 A;  1D6E C;  3NS1 A;  2N9L A;  3ZTC A;  5D94 A;  4GSW A;  2G1E A;  1XO3 A;  4JWS C;  2RPV A;  4M00 A;  3AEF B;  1GC6 A;  4JLC A;  2KXJ A;  3MC8 A;  4NJ6 A;  4R3D A;  2BS3 B;  4K7S A;  2XN9 C;  4AJY B;  5EE0 A;  1ZGU B;  2MBH A;  3ALB A;  2J52 A;  2EMS A;  1AN8 A;  1PDX A;  3FC4 A;  4BBN C;  4KX6 B;  3RYT A;  3HIZ A;  1F52 A;  2FIF A;  4EZJ A;  1JAL A;  2L83 A;  4GN1 A;  3H8H A;  2KDE B;  2JYE A;  2W9N A;  3ZNI D;  1FCL A;  2L0F A;  3SFE B;  1KFY B;  1I35 A;  2IDY A;  1OEY A;  2KWU B;  4FAD A;  2LFI A;  2V9H A;  2LGX A;  1WJU A;  4S17 A;  2MH7 A;  2PIA A;  4WWN A;  1IP9 A;  3IT6 B;  3HVD A;  1P7F A;  2QDF A;  3DBL I;  4MEL A;  1IPG A;  4I6N B;  4W9C A;  2K3U A;  3SFD B;  4KDI C;  5FR3 A;  4BOS C;  2L32 A;  2C7H A;  1TZ1 A;  3X0W A;  2ONQ A;  1V80 A;  4M01 A;  1YIW A;  3TIX A;  5IKC M;  5BYR A;  4HDO A;  4RNA A;  4URK A;  3KLS X;  4FUL A;  2JQR B;  1XLP A;  3JVZ X;  1MHH E;  3AE5 B;  2DEN B;  3DOW A;  4GB9 A;  1TIF A;  1T3Q A;  4N58 A;  4LDT D;  1XEE A;  2ON8 A;  2KMM A;  1A5R A;  2OHF A;  4Q2J A;  1LFD A;  1N60 A;  2PVG C;  2QCZ A;  3QJZ A;  4O1N A;  3APF A;  2FAZ A;  2DZJ A;  2JX5 A;  3BZD B;  1E10 A;  4AUQ C;  2K8H A;  1ISN A;  3NHE B;  2LZ6 A;  1VCB A;  4X57 B;  2WP9 B;  4A3P A;  1R4M I;  2ICI A;  2JSV X;  2KYW A;  3N30 A;  1YJJ A;  1WY8 A;  2WDV B;  4NZL B;  4C80 A;  1AAR A;  2NTS A;  3ZW3 A;  2JYT A;  2W3S A;  2LAS A;  2JU6 X;  5JHB A;  2DZI A;  4FJZ A;  4YXD B;  2EKE C;  3P4S B;  1JWA D;  3Q3O C;  2H89 B;  4KV2 A;  1LGR A;  3WAN A;  4UDU C;  3U7D A;  1XQQ A;  2V3N A;  4B0E A;  1DGJ A;  1HZ6 A;  3ZNZ B;  2B3A A;  3RUI B;  4ZRP A;  4OVU A;  1OEY J;  1NI3 A;  3K9P B;  3Q3F A;  5BMG A;  2KMC A;  4ACF A;  2GBN A;  3ML9 A;  1ZW7 A;  4HKQ A;  1M4V A;  3T8M A;  3BVG A;  2OJW A;  1B9R A;  4BKT A;  3AEE B;  4GMV A;  4PYU A;  4ZHP A;  2MEK A;  4A6Q A;  1HXY D;  2M56 B;  1WRD B;  5J18 A;  1I4H A;  3PRM B;  1PFD A;  1RFK A;  3PRZ A;  3X23 A;  2GBR A;  4HCP B;  2IJ0 A;  1V81 A;  4GU2 A;  2NS5 A;  4HWI B;  2WU5 B;  4LLG M;  3SR6 A;  4A8X C;  2N4F A;  3PPA A;  2EEL A;  5LNK 1;  3QC8 B;  4KDL B;  4WQO B;  1EWY C;  3NOB A;  3V3X A;  4B6W A;  3L13 A;  3L54 A;  3UIP B;  4ASW C;  3DPD A;  4PS3 A;  4N6E B;  2AL3 A;  2B76 B;  3RNA C;  2WXR A;  2HE7 A;  4YTN B;  3VR9 B;  2J4X A;  4GXB A;  2HJ8 A;  2I38 A;  4ZRQ A;  1XT9 B;  4A3O A;  1WYW B;  2GRI A;  2LGI A;  2W82 A;  3H9D A;  3PTF C;  2KQ7 A;  3AU4 A;  2JZ3 B;  4II2 B;  5AUK A;  1UBQ A;  4RF1 A;  1XD3 B;  2MBE A;  2FE8 A;  2JUO A;  5JH5 C;  2IY1 B;  2X38 A;  3LB8 C;  3NVW A;  2V3P A;  2WXH A;  1IBX A;  1JRO A;  4OVZ A;  2I1J A;  1TY0 A;  2A4Z A;  4LNI A;  2E3T A;  1L5P A;  1FNU A;  1ZP0 B;  1OTR B;  5TR5 A;  1QT9 A;  1NI2 A;  1V1P B;  2LD9 A;  1YNT E;  3R3M A;  1OQY A;  1E5W A;  3CWI A;  2MX2 A;  1H4R A;  1FXI A;  2SAK A;  5EE3 A;  4RM9 A;  3MP9 A;  3A9K A;  4K81 A;  1ET6 A;  5J17 A;  2YEP B;  4B9K A;  2Y5C A;  3GS2 A;  2Y5B B;  5DCN A;  4ZHO A;  2W54 A;  4KGR A;  2PEA A;  2C7N B;  2Z0D B;  1MPE A;  2UYZ B;  1WGK A;  2G4D B;  2L3Z A;  4ZRI A;  3PLV A;  2WXJ A;  1T5X D;  1NYQ A;  1N5W A;  3I3T B;  5BYQ A;  3HK0 A;  4W9I A;  1N61 A;  2RMM A;  3ZLZ A;  1JML A;  2QIL A;  3BIN A;  2L00 B;  1PQS A;  1K8R B;  5D3D A;  1MVK A;  3MC9 A;  3L16 A;  4FLH A;  1JW9 D;  1CJE A;  4OZC A;  1VRA B;  2E6X A;  2VRR B;  2KFJ A;  4BKS A;  3KUZ A;  2INP E;  3M95 A;  1RRB A;  4LCD E;  1SJE D;  4OZA A;  1WJ4 A;  3PZ8 A;  1GB4 A;  1QQR A;  4CO7 A;  4XC2 A;  1J19 A;  3HM3 A;  3L10 B;  4ZOH C;  1KLU D;  2M19 A;  2G4S A;  3GZN B;  4DHJ B;  5IP4 D;  1DOX A;  1D5X C;  3OJ3 A;  1WFY A;  2NMQ A;  1FNV A;  2OJR A;  1KM7 A;  1YN5 A;  1LO5 D;  2LHD A;  3JW0 X;  3PVL A;  5EE9 A;  2DZK A;  2D3B A;  4P6V F;  4BOZ B;  4XGA B;  2HTM E;  1R4N B;  2BS2 B;  2VH1 A;  2KX3 A;  1PGB A;  1XXG A;  1FPY A;  2O6V D;  3DVN V;  5EDS A;  2UU7 A;  2VH2 A;  2LEK A;  1PGA A;  2WDT B;  4KZ0 A;  4YSY B;  1IGD A;  2O2V A;  5BYS A;  3TCA A;  1P0R A;  2FID A;  2KDF B;  1WH3 A;  4HPP A;  3U4E G;  4W9H A;  5G2N A;  3SEB A;  1KJT A;  1U4A A;  3DBL B;  3ZKJ C;  3DCG A;  4MH8 A;  1HQR D;  3AEC B;  4TQ0 A;  3APC A;  2J42 A;  1WGD A;  1WYG A;  2LXC A;  4ARC A;  1FCC C;  3CSF A;  3NY5 A;  3TJP A;  2GI9 A;  1FD6 A;  2DAJ A;  5AZH A;  1WE6 A;  3Q2A C;  4I6L B;  2PJH A;  1TBE A;  2KO3 A;  2MA9 B;  2BYE A;  3ZTD A;  3PRE A;  4KSL C;  2MBQ A;  2BKF A;  3PZ7 A;  2EMT A;  4MSQ B;  2KDB A;  1TKY A;  2Z0E B;  2KAJ A;  1F9J A;  2K25 A;  1F77 A;  4M8N A;  1MHX A;  2L05 A;  1YJI A;  4MSM B;  1SE2 A;  3V60 A;  1RM6 C;  1SIJ A;  2PMV A;  2BYT A;  2LVQ A;  2XK5 A;  3W5U B;  3M62 B;  4NQL B;  5IA7 A;  5C3J B;  2X8X X;  3BY4 B;  2JVC A;  1SJH D;  3HVZ A;  2ACZ B;  2IO1 B;  4RMA A;  1N62 A;  1C79 A;  2KN4 A;  3J9C A;  4HRS A;  3MTN B;  4HKZ E;  2A5U A;  2WU2 B;  1YQ4 B;  5AEK B;  2AX5 A;  1B1Z A;  2MBB B;  4ANV A;  3ZNH B;  1EM7 A;  1BT0 A;  2BVC A;  3LDZ E;  3VFK A;  5HKH A;  4DDG D;  5FKA C;  2N7J A;  1TTN A;  4XWW A;  4ANX A;  3VUW A;  3H7P B;  1KF6 B;  1E0Z A;  3SD5 A;  2D5G A;  4N59 A;  1AWD A;  3RFZ B;  1EU3 A;  1C1Y B;  4M8M A;  3ZO5 B;  4HVB A;  3OG5 A;  5CTR C;  3RT3 B;  1GOZ A;  3A9K B;  3KW5 B;  4HPL B;  1XLO A;  1KOT A;  1UNS A;  4IW0 A;  3GB1 A;  5J2R A;  2GOW A;  3AE1 B;  3U2S C;  3VUX A;  4XDC A;  2BKR B;  2WX1 A;  1MI0 A;  3DBR I;  2G3Q B;  1UEL A;  4MGI E;  3N1X C;  1CQV A;  1F2R I;  4IM0 A;  3AXC A;  4EEW A;  2AYO B;  4WUR A;  1WXQ A;  4FJY A;  2DYM A;  2WXQ A;  1FNW A;  2DWQ A;  4BVU C;  2KTR A;  1VZ7 A;  2BTE A;  2BPS A;  1HEZ E;  4C4V A;  1BML C;  5IAA C;  3GZN I;  1RAX A;  4JQW C;  1WXM A;  3U52 E;  4RGT A;  3IAM 1;  2OOB B;  3VRB B;  2W55 A;  1ET9 A;  3O65 B;  1I4P A;  3W5V B;  4HRO A;  1XLQ A;  2WXI A;  3DVG X;  4OHJ A;  3C19 A;  1R4N I;  2N9P C;  3FIL B;  1J8C A;  3KVF B;  3ZQ4 A;  2KC2 A;  2BQQ A;  1WZ0 A;  4W9J A;  2GMI C;  1CMX B;  1EU4 A;  3QIJ A;  3P4P B;  4IUM B;  1SEB D;  2K39 A;  3DHG C;  1SGH A;  2N7D A;  1UGM A;  3P1M A;  1T6B X;  2LRU A;  2K8B A;  2M0A A;  4ANU A;  4YTM B;  1YN3 A;  4ANW A;  2C7M B;  1T0Q C;  3IBE A;  4I6P A;  4F7Z A;  1Q10 A;  1UF0 A;  4WJQ A;  2JXX A;  1D3Z A;  1P98 A;  2LGY A;  4E3C A;  2FCN A;  2UWQ A;  5EE1 A;  4ICU A;  1ZXI A;  1YD8 U;  4HLE A;  1E8W A;  1WZ3 A;  4IKG A;  1T0Y A;  4MGZ E;  4YT0 B;  4YSX B;  2YEP F;  3VH3 B;  3NZ3 A;  1C3T A;  2VZK D;  2K0P A; 
#chains in the Genus database with same CATH homology
 1EWY C;  4TMA B;  5MPO A;  4RGO S;  1PUT A;  4DXF A;  3V3X A;  3FIL A;  3GP7 A;  3AB5 A;  4LTU A;  2HDE A;  4N6E B;  3KWL A;  1JWU D;  2B76 B;  1QF6 A;  5HG2 A;  4TQ1 A;  2WXR A;  3B2F A;  4YTN B;  1ZDV A;  2IPK D;  1A70 A;  3VR9 B;  2J4X A;  1IUE A;  1QIL A;  2I38 A;  4ZRQ A;  2GRI A;  2W82 A;  2LGI A;  1RYJ A;  5HI1 A;  3NVV A;  2PLP A;  2IGG A;  1L4D B;  4C7Y A;  1VZ6 A;  1XLN A;  5AUK A;  3AE3 B;  1N5X A;  1FEH A;  2IGD A;  3EGR A;  4RF1 A;  1VDV A;  2FE8 A;  5H92 C;  4US9 A;  1GPX A;  1K51 A;  1VZ8 A;  2X38 A;  3LB8 C;  3UI3 A;  3IAS 1;  3NVW A;  1D5M C;  1AYF A;  2V3P A;  2WS3 B;  2WXH A;  2Z8L A;  1ESF A;  1K53 A;  3AE6 B;  4JPS A;  3E9S A;  4ZYS A;  4CQN A;  1IBX A;  1JRO A;  4OVZ A;  3VR8 B;  1TY0 A;  1TZO A;  1K52 A;  2E3T A;  2DYO A;  1L5P A;  2Y3A A;  1FNU A;  3R2I A;  1NYR A;  2EKI A;  3T3N A;  1ZP0 B;  2PTL A;  4C56 C;  2CJN A;  1TKE A;  1E7P B;  1FXA A;  3W9C B;  1I4G A;  3P4Q B;  4WIP A;  2CJO A;  1D4B A;  1ENF A;  1TKG A;  1QT9 A;  2PW9 A;  2OED A;  3TEW A;  4D2K A;  1V1P B;  4YSZ B;  2KWD A;  4A9A A;  4B0M A;  2FBW B;  1Y56 A;  4JWU C;  1YNT E;  1TS4 A;  5G5G A;  2Y5P A;  3V05 A;  2JZP A;  3BK1 A;  2K9X A;  1GAQ B;  3CWI A;  1FRD A;  1L4Z B;  1I4X A;  1FFV A;  1FXI A;  3BYY B;  2SAK A;  4KGT A;  5EE3 A;  3MP9 A;  2WXF A;  3I57 A;  3NVY A;  3P42 A;  3W2D A;  4WAF A;  1ET6 A;  2PVO D;  4H2A A;  2VZK B;  2YEP B;  1TS2 A;  2Y5C A;  3GS2 A;  5BMI A;  1PGX A;  2LHE A;  4OW0 A;  2BB5 A;  1NEN B;  2WXG A;  3CIR B;  4DQO C;  4ZHO A;  5BMH A;  1HA5 A;  1L0V B;  4IDI A;  1WRI A;  2W54 A;  2QJL A;  4MT5 A;  1D5Z C;  4KGR A;  1JWM D;  3EA6 A;  4L1B A;  1BUI C;  1MPE A;  4C7Z A;  1XCT L;  2WXN A;  1YMH E;  2AQ2 B;  3ABV B;  3MHZ A;  1WGK A;  2AQ1 B;  3IXS A;  3N9Y C;  3EUB 2;  1XCQ L;  1KLG D;  3LYY A;  2MJ3 A;  2WXJ A;  1DYQ A;  1T5X D;  1NYQ A;  1N5W A;  4GDL B;  1FRR A;  5BYQ A;  4YWG G;  1K50 A;  2RDH A;  1N61 A;  1YN4 A;  1SBB B;  3Q8B A;  2RMM A;  2QMT A;  1JML A;  2QIL A;  2QIE B;  2W3R A;  3BYT B;  4M0W A;  3U7Z A;  1V1P A;  2L52 A;  5D3D A;  1MVK A;  2ZW1 A;  1I7H A;  1JW9 D;  1YQ3 B;  4GLS C;  2BT6 A;  4HEA 1;  4TSS A;  1CJE A;  3HUI A;  4OZC A;  1VRA B;  2E6X A;  1CZP A;  3HRD D;  3DWG C;  3T3O A;  2INP E;  2JWU A;  1L0Y B;  1QOB A;  1QLB B;  1SJE D;  4OZA A;  3PZ8 A;  1FFU A;  4A55 A;  1GB4 A;  1QQR A;  3I9V 1;  2KQ4 X;  4FXC A;  3ZJT A;  4ZOH C;  1KLU D;  4EE2 A;  3Q8E A;  5H8Y E;  2M19 A;  4KKI A;  3WCQ A;  5HFY A;  3AEB B;  3Q8C A;  1DOX A;  4RGM A;  1UWM A;  1P7E A;  1D5X C;  2WDQ B;  4HJG E;  2NMQ A;  3BII D;  1FNV A;  3R2T A;  3AE8 B;  3B9J A;  4NJC A;  1YN5 A;  1LO5 D;  3URY A;  2LHD A;  1F0Z A;  1IGC A;  1VR9 A;  3TEY A;  2SEB D;  3Q8A A;  5EE9 A;  1C4C A;  2WNM A;  1E9M A;  1UWX A;  1SSN A;  4P6V F;  1OFF A;  3PO0 A;  3ZJU A;  4AS1 A;  2INN E;  2HTM E;  3Q69 A;  2BS2 B;  2WLB A;  1PGB A;  1XXG A;  1ZUD 2;  1AW7 A;  5TSS A;  3C8Y A;  1SE3 A;  2LEK A;  1PGA A;  2PKO A;  3AV8 A;  4PT5 A;  1N63 A;  1ZXH A;  3LXF A;  4YSY B;  4WH4 A;  4NAW B;  1FO4 A;  1IGD A;  1BXT A;  5BYS A;  4KGS A;  4WQM A;  3IT4 B;  3BVM A;  4ARI A;  1C4A A;  1SB3 C;  1ROE A;  3AE4 B;  3AED B;  3NRZ A;  4XWT A;  3U4E G;  1QOA A;  1KH0 A;  5I4D A;  1J7B A;  1FM0 D;  2BS4 B;  2DLB A;  3AH7 A;  3SEB A;  3BVZ A;  4YTP B;  5HHD G;  4DXG A;  4L23 A;  1NEK B;  1JWB D;  1HZ5 A;  1R7S A;  4A90 A;  2JXT A;  4GDK B;  1NVI D;  1D6E C;  3NS1 A;  4MH8 A;  1HQR D;  2N9L A;  3AEC B;  4TQ0 A;  3AN1 A;  2G1E A;  4XDD A;  1XO3 A;  4JE3 B;  2BBC A;  2J42 A;  1WYG A;  4JWS C;  2RPV A;  1C4P A;  4ARC A;  1FCC C;  3ZJV A;  3AEF B;  1ZPS A;  2GI9 A;  4KKJ A;  2J53 A;  1FD6 A;  2K22 A;  2XNA C;  2L1A A;  1DOY A;  2WXM A;  2Q5W D;  4R3D A;  4RCO A;  5GXG B;  2BS3 B;  1F2R C;  2XN9 C;  1SE4 A;  2RDG A;  2TSS A;  5EE0 A;  1EWC A;  4US8 A;  2J52 A;  3PZ7 A;  1AN8 A;  1PDX A;  2FUG 1;  3FC4 A;  1ZE3 D;  5C2T B;  5D3I B;  4KX6 B;  1TKY A;  1JAL A;  2L83 A;  2KAJ A;  1F77 A;  3H8H A;  1MHX A;  1YJI A;  2JYE A;  3ETR A;  4XE0 A;  1FCL A;  1JCK B;  3FAH A;  4MM3 B;  1SE2 A;  3OWE B;  4L2Y A;  2H88 B;  3SFE B;  1PYW D;  1SF0 A;  1RM6 C;  1KFY B;  1SIJ A;  2PMV A;  1QOG A;  2BYT A;  2R61 A;  2IDY A;  4RH6 A;  1SXT A;  2G9H D;  5E6J A;  3W5U B;  3E56 A;  3MJ5 A;  4REZ A;  2LFI A;  1TY2 A;  1TJE A;  3R8B A;  5C3J B;  3VRA B;  1C9F A;  2N0S B;  1SJH D;  3HVZ A;  1JWS D;  2IGH A;  1J7A A;  2ACZ B;  2MH7 A;  2PIA A;  2AQ3 B;  1N62 A;  1C79 A;  4NAM A;  2KN4 A;  3J9C A;  4HRS A;  3IT6 B;  1KTK A;  3HVD A;  2GB1 A;  5T8I A;  1P7F A;  3ZGZ A;  3MC0 B;  2BB6 A;  4LK0 M;  4HKZ E;  1WWT A;  2WU2 B;  1YQ4 B;  3TEX A;  2AX5 A;  1B1Z A;  2MJE A;  1QOF A;  3TSS A;  2K3U A;  3SFD B;  1EM7 A;  2NTT A;  1WSP A;  5FR3 A;  3MFG A;  2L32 A;  2QEJ C;  3BWU D;  1C76 A;  1OQR A;  5FKA C;  3B2G A;  2N7J A;  2ONQ A;  2WQY B;  4XWW A;  3AM9 A;  1XF5 L;  4OZB A;  4USA A;  5BYR A;  1KF6 B;  1QKZ A;  4RNA A;  1E0Z A;  2D5G A;  4N59 A;  2MJD A;  1AWD A;  3KLS X;  2JQR B;  3RFZ B;  1XLP A;  1EU3 A;  1MHH E;  3AE5 B;  1ZOY B;  4P16 A;  1FMA D;  3VQI A;  1GOZ A;  2V0G A;  1T3Q A;  4N58 A;  1JQ4 A;  1XEE A;  2ON8 A;  2KMM A;  1XLO A;  2I2Y A;  4AQ7 A;  1UNS A;  3DWM A;  4RGN A;  2OHF A;  3KQ4 A;  3GB1 A;  4Q2J A;  3O13 A;  3AE1 B;  2ZW0 A;  3AEG B;  3TEZ A;  1N60 A;  2PVG C;  3U2S C;  2KAC A;  2LUM A;  2WXL A;  4O1N A;  1I4Q A;  4XDC A;  4RF0 A;  4RFB A;  2CU3 A;  1I4R A;  1L6V A;  1MI0 A;  1FIQ A;  2JX5 A;  3BZD B;  1E10 A;  1CQV A;  1F2R I;  1V1O A;  2DBY A;  1C77 A;  3P4R B;  4WUR A;  3NVZ A;  1WXQ A;  1V8C A;  2DYM A;  2WXQ A;  1FNW A;  2WP9 B;  2QSD A;  2DWQ A;  1VZ7 A;  2BTE A;  2JSV X;  2ICI A;  1HEZ E;  3NUH B;  1BML C;  3W1S A;  1YJJ A;  2WDV B;  4WWM A;  2WXP A;  4NZL B;  4C80 A;  3AE2 B;  1ACC A;  3U52 E;  4RGT A;  1GB1 A;  3ZYY X;  3IAM 1;  5JXV A;  2NTS A;  3VRB B;  2JYT A;  2W3S A;  2W55 A;  1ET9 A;  3W5V B;  1I4P A;  2JU6 X;  1KRH A;  4HRO A;  2LMC A;  1XLQ A;  2WXI A;  4IOI E;  4YXD B;  4OHJ A;  3P4S B;  1JWA D;  3RPF C;  2H89 B;  3AE7 B;  4UDU C;  3BK2 A;  3TUO A;  2V3N A;  3FIL B;  4B0E A;  1DOI A;  4ITK A;  1L6U A;  3ZQ4 A;  1DGJ A;  1HZ6 A;  1J7C A;  1UGJ A;  4J3O D;  5FK9 C;  4ZRP A;  4MAC A;  1EU4 A;  3AEA B;  3P4P B;  1NI3 A;  1SEB D;  5D7G A;  5BMG A;  3AMZ A;  1JRP A;  1VLB A;  3P1M A;  1T6B X;  2KDM A;  1C78 A;  4HKQ A;  2M0A A;  3L4P A;  2LJI A;  1M4V A;  4YTM B;  3BVG A;  2N9K A;  1YN3 A;  2K5P A;  2WXK A;  2V4I B;  1OQQ A;  2WDR B;  1TYG B;  1E6E B;  4JX1 C;  1UUP A;  1CK1 A;  1TS3 A;  1B9R A;  3AEE B;  1Q10 A;  4ZHP A;  1VJK A;  2MEK A;  4A6Q A;  1HXY D;  1STE A;  2M56 B;  2BW2 A;  2WXO A;  1I4H A;  5EE1 A;  1ZDX A;  1PFD A;  1ZXI A;  3Q8F A;  1RFK A;  5G5H A;  1V97 A;  1IBX B;  3AE9 B;  2IJ0 A;  4IKG A;  1L0X B;  1RWS A;  4YT0 B;  2WU5 B;  4LLG M;  3SR6 A;  4YSX B;  1TS5 A;  2YEP F;  3KWV A;  3NZ3 A;  4A8X C;  2EEL A;  5AUI A;  3P63 A;  5LNK 1;  2VZK D;  2K0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...