1UGJA

Solution structure of a murine hypothetical protein from riken cdna 2310057j16
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
141
structure length
141
Chain Sequence
GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2310057J16 protein
publication title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 15
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08683 CAMSAP_CKK Microtubule-binding calmodulin-regulated spectrin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.360 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ugjA01
1UGJA
chains in the Genus database with same CATH superfamily
1UUPA 1SBBB 1WI0A 2NTTA 4S0RA 1QKZA 1R4NI 3A4RA 1VZ7A 4GB9A 2I38A 2NMQA 3NS8A 1FCCC 3FILA 4WAAA 2LVPA 4GGQA 4RM9A 2PVGC 3LB8C 3MTNB 2C9WB 1WXAA 2RSUA 1JQ4A 3HVDA 2KT7A 2A5UA 2BPSA 1EF1A 2Q5WD 1WY8A 2JZZA 3AE2B 1MFWA 3NG0A 1YQBA 2WX1A 3DVGX 3FILB 4YSXB 4XE0A 4B6WA 5H8YE 1I4RA 3KUDB 2MA9B 3CMMB 1IP9A 3ETRA 1L2NA 2C7NB 1RYJA 5E6PA 1L7YA 1I4HA 4ANWA 1FD6A 3RMKC 1WRIA 3NVWA 2CR5A 4M0WB 3OWEB 1UF0A 4A9AA 2C7HA 4II3B 2BGFA 3RN9C 1NVID 1TY0A 2GBKA 3CSTA 4BKTA 4G0NB 4RCOA 2PVOD 3NZSA 1NYRA 1SJED 4GSWA 5JZEB 2L0TA 1F2RI 3ZLZA 1B1ZA 2PEAA 3ZQ4A 2C7MB 4D2KA 4PT5A 2FIFA 2LVOA 2W3SA 2D07B 4WQMA 2FCSA 2KDMA 1KFYB 1LGRA 3H8HA 4TQ0A 5C2TB 3U7ZA 3ENEA 2N7DA 3ZVVA 4ICUA 4PYZA 2VZKD 3MHZA 1XLPA 2R2QA 1JWSD 4TUUA 2PIAA 2KJ6A 1K50A 2L8JA 1WX9A 1HE8A 2DYBA 4XC2A 5H92C 3IXSA 3NUHB 2L05A 3R3MA 3IG3A 4M00A 2OOBB 4ZOHC 4F7ZA 4KIKA 1NENB 2KMCA 2YVCA 2IGGA 1FCLA 4YXDB 4LNIA 2HTME 4AP4C 1E5WA 1T6BX 1JWAD 4K7SA 2WXHA 3PV1A 2IO3B 3ZO5B 2M56B 3VTUA 4NJCA 3BINA 1UNSA 4WWOA 1HTOA 1E9MA 2Y5PA 3P4SB 5CHVC 3DBLB 5DPTA 3V6EB 2MQJA 4XDDA 4WJPA 4TMAB 4OHJA 4W9CA 3PRPB 4AOFA 1FMAD 3ZW3A 1ZPSA 3PVLA 3BIID 3W9CB 2JPHA 2N9XA 1F52A 3QJZA 4N59A 3ECIA 2CJOA 2AYOB 3GB1A 1JWUD 4HROA 3IAM1 3R7QA 1Y8RC 2K8CA 2BB5A 3I63C 4ZRIA 4WJOA 4IWQA 4K7WA 4HKQA 3A9KA 2JWZA 3T8MA 2ZPYA 3ZIMA 2FE8A 4L2YA 4JIOU 2MHJA 3GE3C 3ZNGC 1TTNA 3U4EG 1ET6A 1LO5D 2LXAA 1FNVA 4ARCA 3W5UB 1I4PA 1ZUD2 4KZ0A 4EUTA 2J0KA 5EE1A 3A9KB 4W9LA 1DOXA 3IVFA 3VXWA 5AZFA 3Q2AC 3NZ3A 4B9KA 4DQOC 3PLUA 4KKJA 1XLQA 3RT3B 1FRRA 2O6VA 1F0ZA 5JHBA 2BWES 1SEBD 2ICIA 1ZE3D 4E74A 4LLGM 3AECB 3PZDA 1GC7A 1EWYC 4IW0A 1UBIA 3T3OA 3C8YA 2Z0EB 4XX5A 1Z2MA 3A33B 3ZNID 4P1BC 2GI9A 1N60A 3VAWA 4C00A 4HWIB 2N1WA 1L4ZB 2O6VB 3Q3MC 3WAMA 4FJYA 3QX1A 1EF5A 1D5XC 2I2YA 1V2YA 1TS3A 1WJ6A 4JX1C 2V1YA 4KKIA 4EKUA 1N6ZA 3KYCD 1R7SA 3U8ZA 5D7GA 2CHXA 2ZEQA 3B08A 1ZDVA 4LDTB 4KSKC 1IBXA 1ZXIA 4L1BA 4NY0A 4HRSA 3L17A 4ZDVA 2Y5BB 3NOBA 3DBLI 3BVGA 4A90A 1LXDA 2ACZB 2KMAA 4MJSB 2BTEA 4URKA 4ARIA 3J9CA 4IWPA 1IBXB 4P1CC 5D3DA 3O65B 3AE7B 3OJ4B 1YN5A 4B95A 5J18A 2PTLA 1T0QC 2LEKA 2NTSA 1UGMA 4K81A 4IM2A 3CSFA 1HQRD 3SD5A 4HDOA 1TZOA 2DBYA 4M8NA 4LNKA 3ML8A 4GDLA 4NAMA 2KLCA 5L83A 1EUVB 1WSPA 2D3AA 2L1AA 1ZGUB 5CHFA 1HXYD 1LFDA 2D5GA 4C4VA 3X23A 4YSZB 2WX0A 1QZEA 3EHVA 1Z5SB 4HPPA 3JYUA 2W3RA 4IKGA 1ZDXA 1EO6A 4RF0A 1T3QA 1HA5A 2X38A 3QC8B 3HHMA 2MRPA 2QEJC 1VJKA 3BZDB 2V3NA 2HE7A 4RGNA 3GE8C 3QIJA 3VFKA 3TEYA 5DCNA 3VR8B 2D3GA 3VUWA 3N1YC 1MG8A 1OQQA 3TEXA 1K52A 4BAXA 4IDIA 3UQAA 1RRBA 2MP2B 3AEFB 3PZ8A 4X57B 1ZOYB 2TSSA 1UWXA 3ZNZB 4KDIC 1YD8U 2ZJDA 1JRUA 2YEPB 2G4SA 4E71A 1X1MA 4WH4A 5J2RA 1YX6B 5IOIA 1FFVA 3ZJUA 1N61A 2KYWA 2L00B 3VH3B 1DYQA 2JWUA 1ESFA 2L7RA 1I42A 4RH6A 4WAFA 2O2VA 1ZP0B 1L0VB 3VRAB 2LWPA 3L54A 4J6IA 2IYDB 1KM7A 1D6EC 3NVVA 1TY2A 2KJHB 4RGMA 3UIPB 2N9LA 3SU8X 1YNTE 1Q0WB 5L95C 2CJNA 2H88B 3Q3NC 2O2VB 3L10B 1WJUA 1V1PA 3N32A 1OEYJ 4A8XC 3AE3B 1L5PA 2DYOA 4HPLB 4RGTA 1FXAA 2K3UA 2IY0B 1S3SG 1E8WA 2MBEA 1PUTA 1PFDA 2J7QB 3TJPA 1KRHA 3O13A 3WALA 5AEKB 4BBNC 1V1PB 2KWVB 2WNMA 2JF5A 3AN1A 4A20A 4W9DA 1YQ3B 2YEPF 2BBCA 5GMVA 1PGAA 1V97A 2LXCA 1DOYA 3RNFC 1D5MC 4MGZE 1OGWA 1V6EA 2WXFA 1WGDA 2QSDA 1WWTA 1FNUA 4MH8A 2K1FA 3ZRCA 4LNOA 1TIFA 4RGOS 3QK0A 3RD2A 2K39A 5FR3A 1J0GA 3DHHC 1STEA 3OLMD 5KHOA 5HKHA 2PKOA 3V05A 4US8A 4MACA 1Q5WB 2UWQA 1NYQA 1E6EB 1JWMD 2LI5A 5G5HA 3U7DA 1AN8A 1IGDA 1JROA 3T9LA 2MLBA 3L16A 3Q3OC 2L3ZA 4RMAA 3W1SA 3R7RA 3PPAA 2IO2B 4ANUA 1D3ZA 1I4GA 1RWSA 2MBQA 4E3CA 2ONQA 2IGDA 3NVYA 1FEHA 2WP9B 3HM3A 4PS7A 4FJVB 1KOTA 3NVZA 3BYYB 3RI7C 4LCDE 1UGJA 2LJIA 2PW9A 2GBRA 3KQ4A 3U2SC 3UINB 2WHIA 1C4PA 4HXDA 1V5OA 2DZMA 3DBHB 2LGYA 2J4XA 3QWZB 3BY4B 3P1MA 3AM9A 1E7VA 4M02A 1GJZA 3P63A 2KWCA 1QQRA 3EUB2 2HTHA 2G3QB 1MI0A 2MJDA 3RNCC 3GZNB 2K9XA 2WXJA 5I4DA 2RPVA 2JYTA 1E10A 3PHXB 1P1AA 3N3KB 4KSLC 3IFWB 5C1ZA 4S17A 4FLHA 3W1YA 1TBEA 2HD5B 2NR2A 2HJ1A 1VLBA 3LXFA 3FC4A 1XCTL 3MFGA 4K1RB 4WWNA 3KUZA 3S2AA 1WGYA 1WX7A 2RDBC 3UI3A 1QF6A 3MP9A 2DWQA 2WXGA 2WWZA 2N9EB 1J7CA 1FM0D 2JY6A 3TUOA 4FJZA 2KHWB 3KVFB 4YTPB 2WXNA 2EMSA 3AXCA 4H2AA 1HTQA 1K8RB 3BK1A 3Q8AA 2DHZA 5TR5A 4DHZB 4LK0M 1C78A 3DVNU 4GN1A 5E6OA 4ITKA 3PRZA 1WH3A 2FIDA 5AZHA 1WX8A 2KX3A 5C3JB 4DBGA 2WXOA 1XEEA 4M0WA 2Z8LA 4KVGB 3SFEB 3RNEC 1OFFA 1IUEA 1WFYA 2GBJA 2KDIA 1WM3A 3DBHI 1GC6A 4W9FA 1N63A 4HDQA 1I7HA 4ZRQA 4NNJB 3AE5B 2WDQB 2K5PA 1TT5B 2K25A 3B2FA 3CWIA 4EFOA 1KLVA 2WU2B 2YLMA 1EM7A 4L23A 4C7ZA 4FHJA 3ALBA 1TKYA 2MX2A 4G3XB 1E7UA 4LJOB 4CO7A 1GAQB 1SSNA 3IBEA 3NY5A 2JU6X 3CIRB 2AL6A 5IO9A 3IAS1 4AWJA 2WXQA 3B0AA 1IPGA 1RAXA 2CKHB 1G6JA 4XDCA 4FXCA 2BF8B 2K0PA 4HLEA 2W9NA 3KWLA 3N30A 1S1QB 2DNFA 1KLUD 4UDUC 1OQYA 1RFAA 3V3XA 3VQIA 3Q6BA 1XXGA 2CHZA 2R2OA 2KC1A 3BK2A 3GS2A 2DZIA 4G11A 1JCKB 3VH4B 1QOGA 1N5XA 3AV8A 1GNUA 2WXRA 4I6PA 2IGHA 1JMLA 2HJ8A 4IM3A 1V86A 2J42A 3QAQA 1SXTA 4FN2A 4MGIE 1NDDA 2BKFA 4R3DA 3PSEB 1PYWD 1J7BA 2FCMA 3HIZA 3AB5A 4MT5A 3QHTA 2KO3A 3M3JA 3TIXA 3WA0A 2JXTA 2XEWA 1E0ZA 2N7EA 4F1SA 4BOZB 1V80A 2KFJA 1C76A 3TEZA 4IM0A 2NBVB 1Q1OA 2JRHA 1F2RC 1WE7A 3QQ8B 4DK5A 2AQ1B 1IGCA 4P16A 3HRDD 3P2BA 1OTRB 2RDGA 2N0SB 4YSYB 1XO3A 3I57A 3IT4B 1R4MB 2MCNB 2WLBA 1F77A 3OAWA 2C60A 3N1ZC 4P7IA 3TMPB 3ZDMC 1F1HA 2D11A 3SFDB 1L0YB 2JSVX 2WU5B 4ZYSA 3KWVA 2N9PC 3UQBA 2XBBC 2INCC 1VZ8A 3X0WA 1FIQA 2QHOA 3N20C 5CX3A 1FPYA 2WQYB 1WZ0A 1Y56A 4W9KA 3VTWA 3AE6B 1KLGD 3DOWA 1C79A 3MC8A 3PS6A 3PO0A 2LRUA 4A55A 3DBSA 1YMHE 2JVCA 4MJSA 3ZJTA 2J52A 4DXGA 5EE9A 3AULA 2AL3A 3ZTDA 2LASA 5CTRC 2ZPNA 3PTFC 4XZ4A 3WANA 4BFRA 3AU5A 2M0XA 2M1MA 4PS8A 1TZ1A 3VDZA 3H6NA 5IN7A 1GB1A 4CHKA 2FBWB 2Y3AA 4OZCA 1XF5L 1V1OA 1CMXB 3B1LX 4KZCA 1C77A 3FAHA 3VRBB 3VUYA 2JX5A 1WXSA 3PRMB 2NBUA 3VVWB 4A3PA 1JWBD 1BUIC 1WJNA 2LGDA 2BYEA 1XCQL 2OJRA 3SEBA 3CF6E 2B3AA 2KFKA 1R4MI 5DPRA 2MJEA 4FADA 2BYFA 3UIOB 2BW2A 1KJTA 4IUMB 2MH7A 2XN9C 2ZNVB 2UU7A 1OQRA 5DPWA 2SAKA 1UD7A 3Q8FA 2KC2A 3PLVA 2LUEA 2JXXA 2KFKB 3Q8EA 3RYTA 5IP4D 1SE3A 2B76B 2VH2A 2NCNA 3DHIC 2DENB 3FKYA 4DDGD 1T0RC 4BOSC 4ASWC 2AX5A 2MP2A 2KWDA 1YJJA 1JRPA 4G50A 2XNAC 2KACA 2R61A 2WYQA 2KDEB 3NZUA 3HK0A 1T0SC 2M4NA 1VD2A 3BVMA 1NI3A 2RD0A 4ACFA 3P42A 5D3IB 1SIJA 1SE9A 2M0AA 1PQSA 4EE2A 2X8XX 3ZRFA 3DDCB 2KTRB 5BMIA 3ZDTA 1SIFA 3V61A 4MM3A 2KVRA 3KUCB 3HVZA 1V49A 4EZKA 5HFYA 3EFCA 1WMHB 2WXLA 2MBHA 3H7PA 2INDC 4W9GA 2NVUI 4MM3B 4AJYB 2CHWA 2KANA 4HCPB 1CZPA 1KH0A 3RPFC 1L6UA 1D5ZC 1LQBA 4B0EA 2BS4B 1UELA 4NZLB 5FK9C 4YTMB 3UGBB 3AE9B 4WWMA 1XT9B 3H7PB 2M8SA 2INPE 2WXKA 4MSMB 4C80A 3QARA 4W9EA 2QCZA 3D32A 1P98A 3SDLC 3I5JC 1WF9A 3AE1B 1XD3B 3OJ3A 1ZKHA 4C7YA 4RM8A 3L08A 3APCA 3L4PA 3TSSA 2N1VA 5JHAA 1C4AA 1MHXA 4F8CB 5DPSA 2ZVNA 2LGXA 2KX0A 2WDVB 1E8XA 4GLSC 2IBIB 1YIWA 1SE2A 2L83A 4ZYNA 4IG7B 5BYQA 2GBMA 2G9HD 2DAJA 4DWFA 2WXIA 2K6DB 3NJTA 4N6EB 3T3NA 4J3OD 2PPHA 2KTFA 2OJWA 1WGGA 1WR6E 3QCAA 4FULA 3R2IA 3DCGA 1TS2A 2E3TA 3OG5A 3WIMA 3Q8CA 2IY1B 4HKZE 1QOBA 2PMVA 1QOFA 2AEHA 2QDFA 1GPXA 1J7AA 1WM2A 1R4NB 3W5VB 5HI1A 3RCZA 1VDVA 3EECA 4WURA 3KYDD 2KNBA 1GOZA 4I6NB 4REZA 2RDHA 3SR6A 1ZXHA 4K3BA 2BYTA 1D4BA 4JWUC 4C56C 2GMIC 4HJKA 2KN4A 2KDBA 1TGZB 2Z0DB 3KLSX 4HEA1 5IA7A 1TKEA 3A4SC 4KDLB 1PGXA 4OZAA 5LNK1 4MELA 1WXMA 2KQ7A 3TCAA 4IWOA 3URYA 2WDTB 5KHQA 5GXGB 3U30A 2LGIA 2G4DB 1WXQA 2PE9A 3HUIA 1UBQA 4TSSA 2W54A 3RULA 4EOYA 2ZW1A 2VH1A 1FXTB 5D94A 2V4LA 1ISNA 1V8CA 3ZYYX 1H4RA 2RGFA 2PLPA 1WXVA 1EU3A 5JH5C 2ZVOA 1YN4A 3APFA 2XK5A 1FO4A 1HZ6A 5G55A 5IKCM 4GXBA 3LDZE 1IYFA 3AEEB 1U4AA 2NPTB 4GU2A 2EKEC 1FNWA 5LXHA 1MVKA 2KDFB 3AMZA 2IO1B 4GMVA 4BZAA 2IO0B 1YN3A 4ZRKA 3R8BA 3UF8A 1UH6A 2K6QA 2XK5B 4KGRA 1MPEA 2M19A 2MEKA 4ZRPA 1I4QA 5MPOA 1QT9A 2LZ6A 5E6NA 4YWGG 3RUIB 1XQQA 4A3OA 2WDRB 3EC8A 3Q14C 2KLGA 1CQVA 1VZ6A 4JPSA 3AH7A 2IJ0A 2D10A 4WJNA 1P0RA 4Q2JA 3B2GA 2KZRA 2GBNA 4KGSA 1J19A 1A70A 2LHDA 1UWMA 5BYRA 2C5LC 2M17A 2BYVE 4HPMB 2NS5A 3E9SA 2UYZB 2W82A 1QILA 2ZZPB 2AQ2B 4WQOB 3C0RB 4LNFA 3NS1A 4KX6B 3C19A 2BS3B 2KK8A 2BT6A 3GZNI 4QAYA 4US9A 2IPKD 4USAA 2IZVB 3JW0X 5FR6A 4AS1A 1HZ5A 4GOCA 1CJEA 4BKSD 5BO4B 3PREA 4YT0B 2FAZA 1DOIA 4OVZA 1AW7A 1P9DU 5LLIA 1L4DB 2KKCA 2G1EA 3HM6X 3DQVA 3AEGB 2WXPA 1K51A 2KMMA 4DDID 1HEZE 2Y5CA 1RFKA 3IT6B 1NI2A 4NJ7A 2K8BA 3RNAC 3MJ5A 4LJPB 3VUXA 5AUIA 4HK2A 1CK1A 2PJHA 3WAPA 3ML9A 3TL5A 2K8HA 2V0GA 2DZJA 5C23A 2LRWA 2N4FA 1FFUA 3RZWC 4MEMA 2D2QA 3ZNHB 3W1SC 4HVBA 2INNE 1SE4A 5EE3A 4LTUA 2JZ3B 5AUKA 3I3TB 1J8CA 2KQSA 4NAWA 4DHJB 1JALA 3BYTB 2LUMA 3N9YC 2L76A 2QIEB 4GDKA 4P6VF 3ZXVA 3MC9A 2E6XA 2BS2B 1UZXB 4MSQB 2LGSA 3MC0B 1KTKA 1WYWB 3V6CB 4ZRJA 3RZFA 4NAWB 2FCQA 4KIKB 4ANXA 1C1YB 3DWMA 1YOVB 4GDKB 3A1QA 5D6JB 4JE3B 2QILA 1C3TA 4FBJB 1NEKB 1XLNA 4EZLA 3R2TA 2G45B 1BXTA 2J53A 1YJ1A 2MJ3A 1ET9A 1TKGA 1VR9A 4WWPA 4YL8A 1LM8B 2DZKA 4M8MA 2EELA 2A4ZA 5HG2A 1V9JA 2GB1A 1N5WA 3A1QB 3DBRB 2BKRB 1E8YA 3IHPC 3VR9B 5BMHA 3TEWA 3MJWA 3Q69A 2PE6B 1WGKA 4CYEA 1A5RA 2WGSA 4RFBA 2ZCCA 3AE4B 1I35A 2FUG1 3DVNV 2IDYA 3H7SA 1FRDA 4HCNB 1EU4A 4PYUA 4W9IA 3EA6A 2JYEA 3A9JA 2GRIA 4EEWA 1M94A 2RMMA 4JQWC 1SJHD 4W9HA 2FCNA 2SEBD 3BVZA 2LFIA 2JQRB 2AQ3B 4OW0A 1PGBA 2JUOA 3QA8A 3A9JB 1FXIA 4HJGE 4DXAB 4MDKE 4TKNA 1ROEA 3H1UA 2KOXA 1WGRA 2QJLA 3GP7A 4OVVA 4K3CA 2CS4A 3BWUD 4WJQA 4NJ6A 3W2DA 3K9PB 4A6QA 3DHGC 4ZHOA 5EE0A 4M01A 5J17A 1WRDB 4ANVA 1V5TA 1P7FA 3ZGZA 2ZW0A 3DPDA 3TBLD 1QLBB 2CU1A 1E7PB 1E8ZA 2LHEA 4TQ1A 4JLCA 3AU4A 3ZUNA 2H89B 4XYCA 1N62A 1WR1A 5JXVA 1BMLC 2LD9A 3DBRI 3B9JA 2OEDA 2FUHB 2KN5A 2KWUB 4AQ7A 1XLOA 3U52E 2REXA 2LJ5A 2D3CA 1F9JA 2L32A 2ON8A 2KVZA 2I1KA 3WCQA 5G5GA 1DGJA 4BBNF 2CU3A 2DYMA 2V9HA 3ABVB 1V81A 4GDLB 4WIPA 3ZKJC 3M95A 2KTRA 1B9RA 2QC8A 1OEYA 1M4VA 1EWCA 3APDA 5EDSA 2D3BA 3NRZA 4C4VB 4KGTA 1WMHA 4YTNB 2LVQA 4DXFA 3AEBB 4IOIE 4DHJD 1WIAA 5BMGA 2HDEA 2BB6A 2KJRA 2ASQA 3P4QB 3GOEA 3SHQA 4XWTA 3DVGY 3VTVA 1YJIA 3Q3JA 3KW5B 1WGHA 2W55A 4LNNA 5BYSA 3Q3FA 2EMTA 4OZBA 3JSVA 4JL9A 2I1JA 2J0JA 2JRIB 2K22A 1AYFA 5HHDG 3H9DA 3PGEA 2DLBA 1T5XD 1VRAB 3V60A 4KV2A 2NBWB 4PK1A 2MW5A 5AZGA 3L0WB 4BKSA 3JSVB 4IC7B 1GG3A 4W9JA 1PDXA 4NQLB 4BKGA 1QOAA 1H8CA 1C9FA 2N7JA 3KH0A 2Z59B 4ICVA 3M62B 3WAOA 4AJWA 4N9F4 1YX5B 3NHEB 3PHWB 1AARA 1ENFA 3ONSA 1KF6B 2MSED 2BQQA 3M63B 2L52A 2RPQA 1K53A 1ZW7A 1WYGA 2GOWA 2DAFA 1L6VA 2DX5B 2WXMA 4RNAA 3R66C 2GLSA 3AI5A 4DHZE 3ZTCA 2EKIA 1AWDA 1NBFC 2JT4B 4XGAB 2KAJA 1MG4A 1VCBA 5D2MB 4ZHPA 2O6VD 2OHFA 1T0YA 3ZJVA 1SF0A 4RF1A 3LYYA 3PT2B 4EZJA 1MJDA 2LMCA 2VZKB 4BVUC 1WE6A 1P3QU 2FNJB 2MBOA 4LDTD 2L0FA 1TS5A 4NPNA 1MHHE 1E90A 4AUQC 4CQNA 2N9KA 1L0XB 2WS3B 5E6JA 1SGHA 2ZNVC 4TV3A 4B0MA 4MGYE 3L13A 4JWSC 1RLFA 4XWWA 3AEAB 3V62A 3RNBC 3RNGC 4MH0E 1JW9D 1C4CA 1RM6C 1WJ4A 4PS3A 5G2NA 4JGHB 1Q10A 4II2B 3P4RB 2BVCA 5TSSA 3AE8B 4FA6A 4I6LB 2RR9A 3ZXRA 1ACCA 3MHSD 3JVZX 5FKAC 2JZPA 4FHKA 1WZ3A 3EFUA 3Q8BA 2AWTA 2NPTA 1P7EA 1I4XA 2ZCBA 2VRRB 1SB3C 2J0MA 1GB4A 4O1NA 3EGRA 2KXJA 2V3PA 2QMTA 2MWSB 4MGKE 2BWFA 5CHWA 3K9OB 3PZ7A 5LXIB 3LJ3A 4K7UA 2V4IB 2KD0A 4GIVA 3VHTC 5T8IA 3DWGC 3AEDB 2MBBB 4NQKE 4OVUA 3I9V1 5IAAC 3N1XC 3RFZB 3E56A 1TJEA 2V3SA 1TYGB 1GUAB 1BT0A 3P4PB 2KQ4X 1TS4A 1YQ4B 4N58A
chains in the Genus database with same CATH topology
1UUPA 1YQ3B 1SBBB 2YEPF 2NTTA 2BBCA 1QKZA 2MH7A 2XN9C 3MC0B 1VZ7A 1KTKA 1OQRA 1PGAA 2I38A 2SAKA 2NMQA 3Q8FA 1V97A 1DOYA 4NAWB 1FCCC 3FILA 1D5MC 2WXFA 2PVGC 3Q8EA 3LB8C 2QSDA 1WWTA 3DWMA 4GDKB 1FNUA 1JQ4A 1SE3A 3HVDA 4JE3B 2B76B 2QILA 4MH8A 1NEKB 1XLNA 4RGOS 2Q5WD 3R2TA 5FR3A 1BXTA 2J53A 3AE2B 1STEA 2MJ3A 1ET9A 1TKGA 1VR9A 2AX5A 2KWDA 2PKOA 3FILB 1YJJA 4YSXB 1JRPA 4XE0A 2XNAC 2EELA 2KACA 5H8YE 1I4RA 3V05A 4US8A 5HG2A 4MACA 2R61A 2GB1A 1N5WA 1NYQA 1E6EB 1JWMD 3ETRA 5G5HA 3VR9B 1RYJA 1I4HA 5BMHA 3TEWA 3Q69A 1FD6A 3BVMA 1NI3A 1WGKA 1AN8A 1IGDA 1JROA 3P42A 4RFBA 1WRIA 5D3IB 3AE4B 1SIJA 3NVWA 2FUG1 3OWEB 4A9AA 2IDYA 3W1SA 1FRDA 2M0AA 4EE2A 1EU4A 1NVID 1I4GA 1TY0A 1RWSA 3EA6A 2JYEA 2ONQA 2GRIA 2IGDA 3NVYA 4RCOA 1FEHA 5BMIA 2WP9B 2PVOD 2RMMA 1NYRA 1SJED 3NVZA 3BYYB 1UGJA 1SJHD 2LJIA 2PW9A 3HVZA 2SEBD 3KQ4A 3BVZA 3U2SC 5HFYA 1F2RI 2JQRB 2LFIA 1C4PA 1B1ZA 2AQ3B 4OW0A 1PGBA 3ZQ4A 2J4XA 3P1MA 3AM9A 1FXIA 4HJGE 2WXLA 4D2KA 4PT5A 1ROEA 2W3SA 4WQMA 2QJLA 2KDMA 1KFYB 3P63A 3GP7A 3H8HA 4MM3B 1QQRA 4TQ0A 3EUB2 5C2TB 3U7ZA 1CZPA 1KH0A 3RPFC 1L6UA 1MI0A 2MJDA 1D5ZC 3BWUD 4B0EA 2K9XA 2BS4B 2VZKD 2WXJA 4NZLB 3MHZA 5FK9C 3W2DA 4YTMB 2RPVA 5I4DA 1XLPA 4A6QA 3AE9B 1JWSD 2JYTA 4WWMA 2PIAA 1E10A 4ZHOA 1K50A 2INPE 2WXKA 4C80A 5EE0A 5H92C 3IXSA 3NUHB 1P7FA 3ZGZA 2ZW0A 1QLBB 3AE1B 1E7PB 1VLBA 2LHEA 3FC4A 1XCTL 3LXFA 4TQ1A 3MFGA 4ZOHC 1NENB 4C7YA 2H89B 3UI3A 1QF6A 3MP9A 2DWQA 3L4PA 3TSSA 2WXGA 2IGGA 1FCLA 1C4AA 4YXDB 1MHXA 1N62A 2HTME 1T6BX 1JWAD 5JXVA 1BMLC 2WDVB 2WXHA 4GLSC 2M56B 4NJCA 1J7CA 1FM0D 1UNSA 1SE2A 2L83A 3TUOA 3B9JA 2OEDA 4AQ7A 4YTPB 5BYQA 2WXNA 1XLOA 3U52E 1E9MA 2Y5PA 4H2AA 2G9HD 3BK1A 3P4SB 3Q8AA 4XDDA 4TMAB 4OHJA 2WXIA 2L32A 2ON8A 4LK0M 4N6EB 4N58A 1FMAD 1C78A 3T3NA 4ITKA 1ZPSA 3BIID 3W9CB 4J3OD 5C3JB 4N59A 2WXOA 1XEEA 2CJOA 4M0WA 3WCQA 5G5GA 1DGJA 3GB1A 2Z8LA 1JWUD 3SFEB 4HROA 3IAM1 1OFFA 2CU3A 2DYMA 2BB5A 3ABVB 4GDLB 1IUEA 4WIPA 4HKQA 3R2IA 1TS2A 2E3TA 1B9RA 3Q8CA 2FE8A 4L2YA 1M4VA 1EWCA 4HKZE 3U4EG 1N63A 1ET6A 1QOBA 1I7HA 2PMVA 1LO5D 3NRZA 1FNVA 4ZRQA 1QOFA 4ARCA 4KGTA 3AE5B 2WDQB 3W5UB 2K5PA 1I4PA 4YTNB 1ZUD2 3CWIA 1J7AA 3B2FA 1GPXA 2WU2B 3W5VB 1EM7A 4L23A 4C7ZA 5HI1A 1VDVA 5EE1A 1TKYA 4DXFA 3AEBB 4IOIE 4WURA 1DOXA 3NZ3A 5BMGA 1GAQB 1SSNA 1GOZA 2HDEA 2BB6A 4DQOC 2JU6X 3CIRB 4KKJA 1XLQA 4REZA 3P4QB 1FRRA 1F0ZA 3IAS1 2RDHA 3SR6A 1ZXHA 1SEBD 2WXQA 4XWTA 2ICIA 1ZE3D 4JWUC 2BYTA 1D4BA 1YJIA 4C56C 4LLGM 2KN4A 3AECB 1EWYC 4XDCA 3T3OA 2W55A 3KLSX 3C8YA 4FXCA 4HEA1 5BYSA 1TKEA 2K0PA 2GI9A 1N60A 1PGXA 4OZAA 4OZBA 5LNK1 3KWLA 1L4ZB 3URYA 5GXGB 4UDUC 1D5XC 1KLUD 2K22A 2I2YA 2LGIA 1AYFA 1TS3A 5HHDG 4JX1C 3V3XA 4KKIA 2DLBA 1T5XD 1WXQA 3HUIA 1VRAB 3VQIA 4TSSA 1R7SA 1XXGA 2W54A 5D7GA 2ZW1A 1ZDVA 3BK2A 3GS2A 1V8CA 1JCKB 3ZYYX 1IBXA 1ZXIA 1QOGA 1N5XA 4L1BA 4HRSA 3AV8A 2PLPA 2WXRA 1EU3A 2IGHA 1JMLA 3BVGA 2J42A 1PDXA 4A90A 1SXTA 1YN4A 1QOAA 2ACZB 2BTEA 4ARIA 1C9FA 2N7JA 3J9CA 1FO4A 1HZ6A 1IBXB 4R3DA 5D3DA 3AE7B 1PYWD 1J7BA 3AEEB 1YN5A 2PTLA 1FNWA 3AB5A 2LEKA 1MVKA 2NTSA 3AMZA 4MT5A 1ENFA 1HQRD 1YN3A 3R8BA 1KF6B 2L52A 1TZOA 1K53A 2JXTA 4KGRA 1MPEA 2DBYA 1E0ZA 1WYGA 2M19A 2MEKA 4ZRPA 4NAMA 1I4QA 5MPOA 1QT9A 2WXMA 1L6VA 4YWGG 1C76A 4RNAA 3TEZA 2WDRB 1WSPA 1CQVA 1VZ6A 2EKIA 1AWDA 2L1AA 1HXYD 2KAJA 4JPSA 1F2RC 2D5GA 4YSZB 4ZHPA 3AH7A 2AQ1B 1IGCA 4P16A 2OHFA 3HRDD 3ZJVA 2IJ0A 1SF0A 2W3RA 4RF1A 4IKGA 3LYYA 4Q2JA 3B2GA 1ZDXA 4KGSA 1T3QA 4RF0A 2RDGA 2N0SB 1HA5A 4YSYB 1A70A 1XO3A 2LHDA 2X38A 3I57A 2LMCA 2VZKB 3IT4B 1UWMA 5BYRA 2QEJC 1VJKA 2WLBA 3BZDB 1TS5A 1MHHE 2V3NA 3E9SA 4RGNA 4CQNA 2N9KA 1QILA 2W82A 1F77A 3TEYA 3VR8B 2AQ2B 1L0XB 2WS3B 5E6JA 3NS1A 4KX6B 2BS3B 1OQQA 2BT6A 3TEXA 4B0MA 4US9A 1K52A 2IPKD 4USAA 4JWSC 4IDIA 3SFDB 1L0YB 4AS1A 2JSVX 2WU5B 1HZ5A 3AEFB 3PZ8A 4ZYSA 3KWVA 1CJEA 4XWWA 1ZOYB 3AEAB 2TSSA 1UWXA 1VZ8A 1FIQA 1JW9D 1C4CA 1RM6C 2WQYB 4YT0B 1Q10A 1DOIA 4OVZA 1AW7A 1Y56A 2YEPB 4WH4A 3AE6B 1KLGD 1L4DB 3P4RB 1C79A 2G1EA 5TSSA 3AE8B 3PO0A 3AEGB 4A55A 1FFVA 3ZJUA 1N61A 2WXPA 1ACCA 1DYQA 1K51A 1YMHE 2KMMA 1HEZE 2Y5CA 1RFKA 2JWUA 3IT6B 5FKAC 1ESFA 3ZJTA 2J52A 4RH6A 4WAFA 4DXGA 2JZPA 3MJ5A 5EE9A 1ZP0B 3Q8BA 1L0VB 1P7EA 3VRAB 1I4XA 5AUIA 1CK1A 1D6EC 1SB3C 1GB4A 3NVVA 1GB1A 2V0GA 2FBWB 2Y3AA 4O1NA 3EGRA 1TY2A 1XF5L 2V3PA 4OZCA 4RGMA 1V1OA 2N9LA 1FFUA 2QMTA 1YNTE 2CJNA 2H88B 1C77A 3PZ7A 3FAHA 3VRBB 2INNE 2JX5A 1V1PA 4A8XC 1SE4A 5EE3A 2V4IB 3AE3B 4LTUA 1JWBD 1L5PA 5T8IA 3DWGC 2DYOA 1BUIC 3AEDB 5AUKA 1XCQL 3I9V1 4RGTA 1FXAA 2K3UA 3SEBA 3RFZB 1JALA 3BYTB 2LUMA 3E56A 3N9YC 1PUTA 1TJEA 2QIEB 1PFDA 2MJEA 1TYGB 4P6VF 1KRHA 3O13A 2E6XA 3P4PB 2KQ4X 2BS2B 2BW2A 1TS4A 1V1PB 1YQ4B 2WNMA 3AN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGJ A; 
#chains in the Genus database with same CATH topology
 1UUP A;  1SBB B;  1WI0 A;  2NTT A;  4S0R A;  1QKZ A;  1R4N I;  3A4R A;  1VZ7 A;  4GB9 A;  2I38 A;  2NMQ A;  3NS8 A;  1FCC C;  3FIL A;  4WAA A;  2LVP A;  4GGQ A;  4RM9 A;  2PVG C;  3LB8 C;  3MTN B;  2C9W B;  1WXA A;  2RSU A;  1JQ4 A;  3HVD A;  2KT7 A;  2A5U A;  2BPS A;  1EF1 A;  2Q5W D;  1WY8 A;  2JZZ A;  3AE2 B;  1MFW A;  3NG0 A;  1YQB A;  2WX1 A;  3DVG X;  3FIL B;  4YSX B;  4XE0 A;  4B6W A;  5H8Y E;  1I4R A;  3KUD B;  2MA9 B;  3CMM B;  1IP9 A;  3ETR A;  1L2N A;  2C7N B;  1RYJ A;  5E6P A;  1L7Y A;  1I4H A;  4ANW A;  1FD6 A;  3RMK C;  1WRI A;  3NVW A;  2CR5 A;  4M0W B;  3OWE B;  1UF0 A;  4A9A A;  2C7H A;  4II3 B;  2BGF A;  3RN9 C;  1NVI D;  1TY0 A;  2GBK A;  3CST A;  4BKT A;  4G0N B;  4RCO A;  2PVO D;  3NZS A;  1NYR A;  1SJE D;  4GSW A;  5JZE B;  2L0T A;  1F2R I;  3ZLZ A;  1B1Z A;  2PEA A;  3ZQ4 A;  2C7M B;  4D2K A;  4PT5 A;  2FIF A;  2LVO A;  2W3S A;  2D07 B;  4WQM A;  2FCS A;  2KDM A;  1KFY B;  1LGR A;  3H8H A;  4TQ0 A;  5C2T B;  3U7Z A;  3ENE A;  2N7D A;  3ZVV A;  4ICU A;  4PYZ A;  2VZK D;  3MHZ A;  1XLP A;  2R2Q A;  1JWS D;  4TUU A;  2PIA A;  2KJ6 A;  1K50 A;  2L8J A;  1WX9 A;  1HE8 A;  2DYB A;  4XC2 A;  5H92 C;  3IXS A;  3NUH B;  2L05 A;  3R3M A;  3IG3 A;  4M00 A;  2OOB B;  4ZOH C;  4F7Z A;  4KIK A;  1NEN B;  2KMC A;  2YVC A;  2IGG A;  1FCL A;  4YXD B;  4LNI A;  2HTM E;  4AP4 C;  1E5W A;  1T6B X;  1JWA D;  4K7S A;  2WXH A;  3PV1 A;  2IO3 B;  3ZO5 B;  2M56 B;  3VTU A;  4NJC A;  3BIN A;  1UNS A;  4WWO A;  1HTO A;  1E9M A;  2Y5P A;  3P4S B;  5CHV C;  3DBL B;  5DPT A;  3V6E B;  2MQJ A;  4XDD A;  4WJP A;  4TMA B;  4OHJ A;  4W9C A;  3PRP B;  4AOF A;  1FMA D;  3ZW3 A;  1ZPS A;  3PVL A;  3BII D;  3W9C B;  2JPH A;  2N9X A;  1F52 A;  3QJZ A;  4N59 A;  3ECI A;  2CJO A;  2AYO B;  3GB1 A;  1JWU D;  4HRO A;  3IAM 1;  3R7Q A;  1Y8R C;  2K8C A;  2BB5 A;  3I63 C;  4ZRI A;  4WJO A;  4IWQ A;  4K7W A;  4HKQ A;  3A9K A;  2JWZ A;  3T8M A;  2ZPY A;  3ZIM A;  2FE8 A;  4L2Y A;  4JIO U;  2MHJ A;  3GE3 C;  3ZNG C;  1TTN A;  3U4E G;  1ET6 A;  1LO5 D;  2LXA A;  1FNV A;  4ARC A;  3W5U B;  1I4P A;  1ZUD 2;  4KZ0 A;  4EUT A;  2J0K A;  5EE1 A;  3A9K B;  4W9L A;  1DOX A;  3IVF A;  3VXW A;  5AZF A;  3Q2A C;  3NZ3 A;  4B9K A;  4DQO C;  3PLU A;  4KKJ A;  1XLQ A;  3RT3 B;  1FRR A;  2O6V A;  1F0Z A;  5JHB A;  2BWE S;  1SEB D;  2ICI A;  1ZE3 D;  4E74 A;  4LLG M;  3AEC B;  3PZD A;  1GC7 A;  1EWY C;  4IW0 A;  1UBI A;  3T3O A;  3C8Y A;  2Z0E B;  4XX5 A;  1Z2M A;  3A33 B;  3ZNI D;  4P1B C;  2GI9 A;  1N60 A;  3VAW A;  4C00 A;  4HWI B;  2N1W A;  1L4Z B;  2O6V B;  3Q3M C;  3WAM A;  4FJY A;  3QX1 A;  1EF5 A;  1D5X C;  2I2Y A;  1V2Y A;  1TS3 A;  1WJ6 A;  4JX1 C;  2V1Y A;  4KKI A;  4EKU A;  1N6Z A;  3KYC D;  1R7S A;  3U8Z A;  5D7G A;  2CHX A;  2ZEQ A;  3B08 A;  1ZDV A;  4LDT B;  4KSK C;  1IBX A;  1ZXI A;  4L1B A;  4NY0 A;  4HRS A;  3L17 A;  4ZDV A;  2Y5B B;  3NOB A;  3DBL I;  3BVG A;  4A90 A;  1LXD A;  2ACZ B;  2KMA A;  4MJS B;  2BTE A;  4URK A;  4ARI A;  3J9C A;  4IWP A;  1IBX B;  4P1C C;  5D3D A;  3O65 B;  3AE7 B;  3OJ4 B;  1YN5 A;  4B95 A;  5J18 A;  2PTL A;  1T0Q C;  2LEK A;  2NTS A;  1UGM A;  4K81 A;  4IM2 A;  3CSF A;  1HQR D;  3SD5 A;  4HDO A;  1TZO A;  2DBY A;  4M8N A;  4LNK A;  3ML8 A;  4GDL A;  4NAM A;  2KLC A;  5L83 A;  1EUV B;  1WSP A;  2D3A A;  2L1A A;  1ZGU B;  5CHF A;  1HXY D;  1LFD A;  2D5G A;  4C4V A;  3X23 A;  4YSZ B;  2WX0 A;  1QZE A;  3EHV A;  1Z5S B;  4HPP A;  3JYU A;  2W3R A;  4IKG A;  1ZDX A;  1EO6 A;  4RF0 A;  1T3Q A;  1HA5 A;  2X38 A;  3QC8 B;  3HHM A;  2MRP A;  2QEJ C;  1VJK A;  3BZD B;  2V3N A;  2HE7 A;  4RGN A;  3GE8 C;  3QIJ A;  3VFK A;  3TEY A;  5DCN A;  3VR8 B;  2D3G A;  3VUW A;  3N1Y C;  1MG8 A;  1OQQ A;  3TEX A;  1K52 A;  4BAX A;  4IDI A;  3UQA A;  1RRB A;  2MP2 B;  3AEF B;  3PZ8 A;  4X57 B;  1ZOY B;  2TSS A;  1UWX A;  3ZNZ B;  4KDI C;  1YD8 U;  2ZJD A;  1JRU A;  2YEP B;  2G4S A;  4E71 A;  1X1M A;  4WH4 A;  5J2R A;  1YX6 B;  5IOI A;  1FFV A;  3ZJU A;  1N61 A;  2KYW A;  2L00 B;  3VH3 B;  1DYQ A;  2JWU A;  1ESF A;  2L7R A;  1I42 A;  4RH6 A;  4WAF A;  2O2V A;  1ZP0 B;  1L0V B;  3VRA B;  2LWP A;  3L54 A;  4J6I A;  2IYD B;  1KM7 A;  1D6E C;  3NVV A;  1TY2 A;  2KJH B;  4RGM A;  3UIP B;  2N9L A;  3SU8 X;  1YNT E;  1Q0W B;  5L95 C;  2CJN A;  2H88 B;  3Q3N C;  2O2V B;  3L10 B;  1WJU A;  1V1P A;  3N32 A;  1OEY J;  4A8X C;  3AE3 B;  1L5P A;  2DYO A;  4HPL B;  4RGT A;  1FXA A;  2K3U A;  2IY0 B;  1S3S G;  1E8W A;  2MBE A;  1PUT A;  1PFD A;  2J7Q B;  3TJP A;  1KRH A;  3O13 A;  3WAL A;  5AEK B;  4BBN C;  1V1P B;  2KWV B;  2WNM A;  2JF5 A;  3AN1 A;  4A20 A;  4W9D A;  1YQ3 B;  2YEP F;  2BBC A;  5GMV A;  1PGA A;  1V97 A;  2LXC A;  1DOY A;  3RNF C;  1D5M C;  4MGZ E;  1OGW A;  1V6E A;  2WXF A;  1WGD A;  2QSD A;  1WWT A;  1FNU A;  4MH8 A;  2K1F A;  3ZRC A;  4LNO A;  1TIF A;  4RGO S;  3QK0 A;  3RD2 A;  2K39 A;  5FR3 A;  1J0G A;  3DHH C;  1STE A;  3OLM D;  5KHO A;  5HKH A;  2PKO A;  3V05 A;  4US8 A;  4MAC A;  1Q5W B;  2UWQ A;  1NYQ A;  1E6E B;  1JWM D;  2LI5 A;  5G5H A;  3U7D A;  1AN8 A;  1IGD A;  1JRO A;  3T9L A;  2MLB A;  3L16 A;  3Q3O C;  2L3Z A;  4RMA A;  3W1S A;  3R7R A;  3PPA A;  2IO2 B;  4ANU A;  1D3Z A;  1I4G A;  1RWS A;  2MBQ A;  4E3C A;  2ONQ A;  2IGD A;  3NVY A;  1FEH A;  2WP9 B;  3HM3 A;  4PS7 A;  4FJV B;  1KOT A;  3NVZ A;  3BYY B;  3RI7 C;  4LCD E;  1UGJ A;  2LJI A;  2PW9 A;  2GBR A;  3KQ4 A;  3U2S C;  3UIN B;  2WHI A;  1C4P A;  4HXD A;  1V5O A;  2DZM A;  3DBH B;  2LGY A;  2J4X A;  3QWZ B;  3BY4 B;  3P1M A;  3AM9 A;  1E7V A;  4M02 A;  1GJZ A;  3P63 A;  2KWC A;  1QQR A;  3EUB 2;  2HTH A;  2G3Q B;  1MI0 A;  2MJD A;  3RNC C;  3GZN B;  2K9X A;  2WXJ A;  5I4D A;  2RPV A;  2JYT A;  1E10 A;  3PHX B;  1P1A A;  3N3K B;  4KSL C;  3IFW B;  5C1Z A;  4S17 A;  4FLH A;  3W1Y A;  1TBE A;  2HD5 B;  2NR2 A;  2HJ1 A;  1VLB A;  3LXF A;  3FC4 A;  1XCT L;  3MFG A;  4K1R B;  4WWN A;  3KUZ A;  3S2A A;  1WGY A;  1WX7 A;  2RDB C;  3UI3 A;  1QF6 A;  3MP9 A;  2DWQ A;  2WXG A;  2WWZ A;  2N9E B;  1J7C A;  1FM0 D;  2JY6 A;  3TUO A;  4FJZ A;  2KHW B;  3KVF B;  4YTP B;  2WXN A;  2EMS A;  3AXC A;  4H2A A;  1HTQ A;  1K8R B;  3BK1 A;  3Q8A A;  2DHZ A;  5TR5 A;  4DHZ B;  4LK0 M;  1C78 A;  3DVN U;  4GN1 A;  5E6O A;  4ITK A;  3PRZ A;  1WH3 A;  2FID A;  5AZH A;  1WX8 A;  2KX3 A;  5C3J B;  4DBG A;  2WXO A;  1XEE A;  4M0W A;  2Z8L A;  4KVG B;  3SFE B;  3RNE C;  1OFF A;  1IUE A;  1WFY A;  2GBJ A;  2KDI A;  1WM3 A;  3DBH I;  1GC6 A;  4W9F A;  1N63 A;  4HDQ A;  1I7H A;  4ZRQ A;  4NNJ B;  3AE5 B;  2WDQ B;  2K5P A;  1TT5 B;  2K25 A;  3B2F A;  3CWI A;  4EFO A;  1KLV A;  2WU2 B;  2YLM A;  1EM7 A;  4L23 A;  4C7Z A;  4FHJ A;  3ALB A;  1TKY A;  2MX2 A;  4G3X B;  1E7U A;  4LJO B;  4CO7 A;  1GAQ B;  1SSN A;  3IBE A;  3NY5 A;  2JU6 X;  3CIR B;  2AL6 A;  5IO9 A;  3IAS 1;  4AWJ A;  2WXQ A;  3B0A A;  1IPG A;  1RAX A;  2CKH B;  1G6J A;  4XDC A;  4FXC A;  2BF8 B;  2K0P A;  4HLE A;  2W9N A;  3KWL A;  3N30 A;  1S1Q B;  2DNF A;  1KLU D;  4UDU C;  1OQY A;  1RFA A;  3V3X A;  3VQI A;  3Q6B A;  1XXG A;  2CHZ A;  2R2O A;  2KC1 A;  3BK2 A;  3GS2 A;  2DZI A;  4G11 A;  1JCK B;  3VH4 B;  1QOG A;  1N5X A;  3AV8 A;  1GNU A;  2WXR A;  4I6P A;  2IGH A;  1JML A;  2HJ8 A;  4IM3 A;  1V86 A;  2J42 A;  3QAQ A;  1SXT A;  4FN2 A;  4MGI E;  1NDD A;  2BKF A;  4R3D A;  3PSE B;  1PYW D;  1J7B A;  2FCM A;  3HIZ A;  3AB5 A;  4MT5 A;  3QHT A;  2KO3 A;  3M3J A;  3TIX A;  3WA0 A;  2JXT A;  2XEW A;  1E0Z A;  2N7E A;  4F1S A;  4BOZ B;  1V80 A;  2KFJ A;  1C76 A;  3TEZ A;  4IM0 A;  2NBV B;  1Q1O A;  2JRH A;  1F2R C;  1WE7 A;  3QQ8 B;  4DK5 A;  2AQ1 B;  1IGC A;  4P16 A;  3HRD D;  3P2B A;  1OTR B;  2RDG A;  2N0S B;  4YSY B;  1XO3 A;  3I57 A;  3IT4 B;  1R4M B;  2MCN B;  2WLB A;  1F77 A;  3OAW A;  2C60 A;  3N1Z C;  4P7I A;  3TMP B;  3ZDM C;  1F1H A;  2D11 A;  3SFD B;  1L0Y B;  2JSV X;  2WU5 B;  4ZYS A;  3KWV A;  2N9P C;  3UQB A;  2XBB C;  2INC C;  1VZ8 A;  3X0W A;  1FIQ A;  2QHO A;  3N20 C;  5CX3 A;  1FPY A;  2WQY B;  1WZ0 A;  1Y56 A;  4W9K A;  3VTW A;  3AE6 B;  1KLG D;  3DOW A;  1C79 A;  3MC8 A;  3PS6 A;  3PO0 A;  2LRU A;  4A55 A;  3DBS A;  1YMH E;  2JVC A;  4MJS A;  3ZJT A;  2J52 A;  4DXG A;  5EE9 A;  3AUL A;  2AL3 A;  3ZTD A;  2LAS A;  5CTR C;  2ZPN A;  3PTF C;  4XZ4 A;  3WAN A;  4BFR A;  3AU5 A;  2M0X A;  2M1M A;  4PS8 A;  1TZ1 A;  3VDZ A;  3H6N A;  5IN7 A;  1GB1 A;  4CHK A;  2FBW B;  2Y3A A;  4OZC A;  1XF5 L;  1V1O A;  1CMX B;  3B1L X;  4KZC A;  1C77 A;  3FAH A;  3VRB B;  3VUY A;  2JX5 A;  1WXS A;  3PRM B;  2NBU A;  3VVW B;  4A3P A;  1JWB D;  1BUI C;  1WJN A;  2LGD A;  2BYE A;  1XCQ L;  2OJR A;  3SEB A;  3CF6 E;  2B3A A;  2KFK A;  1R4M I;  5DPR A;  2MJE A;  4FAD A;  2BYF A;  3UIO B;  2BW2 A;  1KJT A;  4IUM B;  2MH7 A;  2XN9 C;  2ZNV B;  2UU7 A;  1OQR A;  5DPW A;  2SAK A;  1UD7 A;  3Q8F A;  2KC2 A;  3PLV A;  2LUE A;  2JXX A;  2KFK B;  3Q8E A;  3RYT A;  5IP4 D;  1SE3 A;  2B76 B;  2VH2 A;  2NCN A;  3DHI C;  2DEN B;  3FKY A;  4DDG D;  1T0R C;  4BOS C;  4ASW C;  2AX5 A;  2MP2 A;  2KWD A;  1YJJ A;  1JRP A;  4G50 A;  2XNA C;  2KAC A;  2R61 A;  2WYQ A;  2KDE B;  3NZU A;  3HK0 A;  1T0S C;  2M4N A;  1VD2 A;  3BVM A;  1NI3 A;  2RD0 A;  4ACF A;  3P42 A;  5D3I B;  1SIJ A;  1SE9 A;  2M0A A;  1PQS A;  4EE2 A;  2X8X X;  3ZRF A;  3DDC B;  2KTR B;  5BMI A;  3ZDT A;  1SIF A;  3V61 A;  4MM3 A;  2KVR A;  3KUC B;  3HVZ A;  1V49 A;  4EZK A;  5HFY A;  3EFC A;  1WMH B;  2WXL A;  2MBH A;  3H7P A;  2IND C;  4W9G A;  2NVU I;  4MM3 B;  4AJY B;  2CHW A;  2KAN A;  4HCP B;  1CZP A;  1KH0 A;  3RPF C;  1L6U A;  1D5Z C;  1LQB A;  4B0E A;  2BS4 B;  1UEL A;  4NZL B;  5FK9 C;  4YTM B;  3UGB B;  3AE9 B;  4WWM A;  1XT9 B;  3H7P B;  2M8S A;  2INP E;  2WXK A;  4MSM B;  4C80 A;  3QAR A;  4W9E A;  2QCZ A;  3D32 A;  1P98 A;  3SDL C;  3I5J C;  1WF9 A;  3AE1 B;  1XD3 B;  3OJ3 A;  1ZKH A;  4C7Y A;  4RM8 A;  3L08 A;  3APC A;  3L4P A;  3TSS A;  2N1V A;  5JHA A;  1C4A A;  1MHX A;  4F8C B;  5DPS A;  2ZVN A;  2LGX A;  2KX0 A;  2WDV B;  1E8X A;  4GLS C;  2IBI B;  1YIW A;  1SE2 A;  2L83 A;  4ZYN A;  4IG7 B;  5BYQ A;  2GBM A;  2G9H D;  2DAJ A;  4DWF A;  2WXI A;  2K6D B;  3NJT A;  4N6E B;  3T3N A;  4J3O D;  2PPH A;  2KTF A;  2OJW A;  1WGG A;  1WR6 E;  3QCA A;  4FUL A;  3R2I A;  3DCG A;  1TS2 A;  2E3T A;  3OG5 A;  3WIM A;  3Q8C A;  2IY1 B;  4HKZ E;  1QOB A;  2PMV A;  1QOF A;  2AEH A;  2QDF A;  1GPX A;  1J7A A;  1WM2 A;  1R4N B;  3W5V B;  5HI1 A;  3RCZ A;  1VDV A;  3EEC A;  4WUR A;  3KYD D;  2KNB A;  1GOZ A;  4I6N B;  4REZ A;  2RDH A;  3SR6 A;  1ZXH A;  4K3B A;  2BYT A;  1D4B A;  4JWU C;  4C56 C;  2GMI C;  4HJK A;  2KN4 A;  2KDB A;  1TGZ B;  2Z0D B;  3KLS X;  4HEA 1;  5IA7 A;  1TKE A;  3A4S C;  4KDL B;  1PGX A;  4OZA A;  5LNK 1;  4MEL A;  1WXM A;  2KQ7 A;  3TCA A;  4IWO A;  3URY A;  2WDT B;  5KHQ A;  5GXG B;  3U30 A;  2LGI A;  2G4D B;  1WXQ A;  2PE9 A;  3HUI A;  1UBQ A;  4TSS A;  2W54 A;  3RUL A;  4EOY A;  2ZW1 A;  2VH1 A;  1FXT B;  5D94 A;  2V4L A;  1ISN A;  1V8C A;  3ZYY X;  1H4R A;  2RGF A;  2PLP A;  1WXV A;  1EU3 A;  5JH5 C;  2ZVO A;  1YN4 A;  3APF A;  2XK5 A;  1FO4 A;  1HZ6 A;  5G55 A;  5IKC M;  4GXB A;  3LDZ E;  1IYF A;  3AEE B;  1U4A A;  2NPT B;  4GU2 A;  2EKE C;  1FNW A;  5LXH A;  1MVK A;  2KDF B;  3AMZ A;  2IO1 B;  4GMV A;  4BZA A;  2IO0 B;  1YN3 A;  4ZRK A;  3R8B A;  3UF8 A;  1UH6 A;  2K6Q A;  2XK5 B;  4KGR A;  1MPE A;  2M19 A;  2MEK A;  4ZRP A;  1I4Q A;  5MPO A;  1QT9 A;  2LZ6 A;  5E6N A;  4YWG G;  3RUI B;  1XQQ A;  4A3O A;  2WDR B;  3EC8 A;  3Q14 C;  2KLG A;  1CQV A;  1VZ6 A;  4JPS A;  3AH7 A;  2IJ0 A;  2D10 A;  4WJN A;  1P0R A;  4Q2J A;  3B2G A;  2KZR A;  2GBN A;  4KGS A;  1J19 A;  1A70 A;  2LHD A;  1UWM A;  5BYR A;  2C5L C;  2M17 A;  2BYV E;  4HPM B;  2NS5 A;  3E9S A;  2UYZ B;  2W82 A;  1QIL A;  2ZZP B;  2AQ2 B;  4WQO B;  3C0R B;  4LNF A;  3NS1 A;  4KX6 B;  3C19 A;  2BS3 B;  2KK8 A;  2BT6 A;  3GZN I;  4QAY A;  4US9 A;  2IPK D;  4USA A;  2IZV B;  3JW0 X;  5FR6 A;  4AS1 A;  1HZ5 A;  4GOC A;  1CJE A;  4BKS D;  5BO4 B;  3PRE A;  4YT0 B;  2FAZ A;  1DOI A;  4OVZ A;  1AW7 A;  1P9D U;  5LLI A;  1L4D B;  2KKC A;  2G1E A;  3HM6 X;  3DQV A;  3AEG B;  2WXP A;  1K51 A;  2KMM A;  4DDI D;  1HEZ E;  2Y5C A;  1RFK A;  3IT6 B;  1NI2 A;  4NJ7 A;  2K8B A;  3RNA C;  3MJ5 A;  4LJP B;  3VUX A;  5AUI A;  4HK2 A;  1CK1 A;  2PJH A;  3WAP A;  3ML9 A;  3TL5 A;  2K8H A;  2V0G A;  2DZJ A;  5C23 A;  2LRW A;  2N4F A;  1FFU A;  3RZW C;  4MEM A;  2D2Q A;  3ZNH B;  3W1S C;  4HVB A;  2INN E;  1SE4 A;  5EE3 A;  4LTU A;  2JZ3 B;  5AUK A;  3I3T B;  1J8C A;  2KQS A;  4NAW A;  4DHJ B;  1JAL A;  3BYT B;  2LUM A;  3N9Y C;  2L76 A;  2QIE B;  4GDK A;  4P6V F;  3ZXV A;  3MC9 A;  2E6X A;  2BS2 B;  1UZX B;  4MSQ B;  2LGS A;  3MC0 B;  1KTK A;  1WYW B;  3V6C B;  4ZRJ A;  3RZF A;  4NAW B;  2FCQ A;  4KIK B;  4ANX A;  1C1Y B;  3DWM A;  1YOV B;  4GDK B;  3A1Q A;  5D6J B;  4JE3 B;  2QIL A;  1C3T A;  4FBJ B;  1NEK B;  1XLN A;  4EZL A;  3R2T A;  2G45 B;  1BXT A;  2J53 A;  1YJ1 A;  2MJ3 A;  1ET9 A;  1TKG A;  1VR9 A;  4WWP A;  4YL8 A;  1LM8 B;  2DZK A;  4M8M A;  2EEL A;  2A4Z A;  5HG2 A;  1V9J A;  2GB1 A;  1N5W A;  3A1Q B;  3DBR B;  2BKR B;  1E8Y A;  3IHP C;  3VR9 B;  5BMH A;  3TEW A;  3MJW A;  3Q69 A;  2PE6 B;  1WGK A;  4CYE A;  1A5R A;  2WGS A;  4RFB A;  2ZCC A;  3AE4 B;  1I35 A;  2FUG 1;  3DVN V;  2IDY A;  3H7S A;  1FRD A;  4HCN B;  1EU4 A;  4PYU A;  4W9I A;  3EA6 A;  2JYE A;  3A9J A;  2GRI A;  4EEW A;  1M94 A;  2RMM A;  4JQW C;  1SJH D;  4W9H A;  2FCN A;  2SEB D;  3BVZ A;  2LFI A;  2JQR B;  2AQ3 B;  4OW0 A;  1PGB A;  2JUO A;  3QA8 A;  3A9J B;  1FXI A;  4HJG E;  4DXA B;  4MDK E;  4TKN A;  1ROE A;  3H1U A;  2KOX A;  1WGR A;  2QJL A;  3GP7 A;  4OVV A;  4K3C A;  2CS4 A;  3BWU D;  4WJQ A;  4NJ6 A;  3W2D A;  3K9P B;  4A6Q A;  3DHG C;  4ZHO A;  5EE0 A;  4M01 A;  5J17 A;  1WRD B;  4ANV A;  1V5T A;  1P7F A;  3ZGZ A;  2ZW0 A;  3DPD A;  3TBL D;  1QLB B;  2CU1 A;  1E7P B;  1E8Z A;  2LHE A;  4TQ1 A;  4JLC A;  3AU4 A;  3ZUN A;  2H89 B;  4XYC A;  1N62 A;  1WR1 A;  5JXV A;  1BML C;  2LD9 A;  3DBR I;  3B9J A;  2OED A;  2FUH B;  2KN5 A;  2KWU B;  4AQ7 A;  1XLO A;  3U52 E;  2REX A;  2LJ5 A;  2D3C A;  1F9J A;  2L32 A;  2ON8 A;  2KVZ A;  2I1K A;  3WCQ A;  5G5G A;  1DGJ A;  4BBN F;  2CU3 A;  2DYM A;  2V9H A;  3ABV B;  1V81 A;  4GDL B;  4WIP A;  3ZKJ C;  3M95 A;  2KTR A;  1B9R A;  2QC8 A;  1OEY A;  1M4V A;  1EWC A;  3APD A;  5EDS A;  2D3B A;  3NRZ A;  4C4V B;  4KGT A;  1WMH A;  4YTN B;  2LVQ A;  4DXF A;  3AEB B;  4IOI E;  4DHJ D;  1WIA A;  5BMG A;  2HDE A;  2BB6 A;  2KJR A;  2ASQ A;  3P4Q B;  3GOE A;  3SHQ A;  4XWT A;  3DVG Y;  3VTV A;  1YJI A;  3Q3J A;  3KW5 B;  1WGH A;  2W55 A;  4LNN A;  5BYS A;  3Q3F A;  2EMT A;  4OZB A;  3JSV A;  4JL9 A;  2I1J A;  2J0J A;  2JRI B;  2K22 A;  1AYF A;  5HHD G;  3H9D A;  3PGE A;  2DLB A;  1T5X D;  1VRA B;  3V60 A;  4KV2 A;  2NBW B;  4PK1 A;  2MW5 A;  5AZG A;  3L0W B;  4BKS A;  3JSV B;  4IC7 B;  1GG3 A;  4W9J A;  1PDX A;  4NQL B;  4BKG A;  1QOA A;  1H8C A;  1C9F A;  2N7J A;  3KH0 A;  2Z59 B;  4ICV A;  3M62 B;  3WAO A;  4AJW A;  4N9F 4;  1YX5 B;  3NHE B;  3PHW B;  1AAR A;  1ENF A;  3ONS A;  1KF6 B;  2MSE D;  2BQQ A;  3M63 B;  2L52 A;  2RPQ A;  1K53 A;  1ZW7 A;  1WYG A;  2GOW A;  2DAF A;  1L6V A;  2DX5 B;  2WXM A;  4RNA A;  3R66 C;  2GLS A;  3AI5 A;  4DHZ E;  3ZTC A;  2EKI A;  1AWD A;  1NBF C;  2JT4 B;  4XGA B;  2KAJ A;  1MG4 A;  1VCB A;  5D2M B;  4ZHP A;  2O6V D;  2OHF A;  1T0Y A;  3ZJV A;  1SF0 A;  4RF1 A;  3LYY A;  3PT2 B;  4EZJ A;  1MJD A;  2LMC A;  2VZK B;  4BVU C;  1WE6 A;  1P3Q U;  2FNJ B;  2MBO A;  4LDT D;  2L0F A;  1TS5 A;  4NPN A;  1MHH E;  1E90 A;  4AUQ C;  4CQN A;  2N9K A;  1L0X B;  2WS3 B;  5E6J A;  1SGH A;  2ZNV C;  4TV3 A;  4B0M A;  4MGY E;  3L13 A;  4JWS C;  1RLF A;  4XWW A;  3AEA B;  3V62 A;  3RNB C;  3RNG C;  4MH0 E;  1JW9 D;  1C4C A;  1RM6 C;  1WJ4 A;  4PS3 A;  5G2N A;  4JGH B;  1Q10 A;  4II2 B;  3P4R B;  2BVC A;  5TSS A;  3AE8 B;  4FA6 A;  4I6L B;  2RR9 A;  3ZXR A;  1ACC A;  3MHS D;  3JVZ X;  5FKA C;  2JZP A;  4FHK A;  1WZ3 A;  3EFU A;  3Q8B A;  2AWT A;  2NPT A;  1P7E A;  1I4X A;  2ZCB A;  2VRR B;  1SB3 C;  2J0M A;  1GB4 A;  4O1N A;  3EGR A;  2KXJ A;  2V3P A;  2QMT A;  2MWS B;  4MGK E;  2BWF A;  5CHW A;  3K9O B;  3PZ7 A;  5LXI B;  3LJ3 A;  4K7U A;  2V4I B;  2KD0 A;  4GIV A;  3VHT C;  5T8I A;  3DWG C;  3AED B;  2MBB B;  4NQK E;  4OVU A;  3I9V 1;  5IAA C;  3N1X C;  3RFZ B;  3E56 A;  1TJE A;  2V3S A;  1TYG B;  1GUA B;  1BT0 A;  3P4P B;  2KQ4 X;  1TS4 A;  1YQ4 B;  4N58 A; 
#chains in the Genus database with same CATH homology
 1UUP A;  1YQ3 B;  1SBB B;  2YEP F;  2NTT A;  2BBC A;  1QKZ A;  2MH7 A;  2XN9 C;  3MC0 B;  1VZ7 A;  1KTK A;  1OQR A;  1PGA A;  2I38 A;  2SAK A;  2NMQ A;  3Q8F A;  1V97 A;  1DOY A;  4NAW B;  1FCC C;  3FIL A;  1D5M C;  2WXF A;  2PVG C;  3Q8E A;  3LB8 C;  2QSD A;  1WWT A;  3DWM A;  4GDK B;  1FNU A;  1JQ4 A;  1SE3 A;  3HVD A;  4JE3 B;  2B76 B;  2QIL A;  4MH8 A;  1NEK B;  1XLN A;  4RGO S;  2Q5W D;  3R2T A;  5FR3 A;  1BXT A;  2J53 A;  3AE2 B;  1STE A;  2MJ3 A;  1ET9 A;  1TKG A;  1VR9 A;  2AX5 A;  2KWD A;  2PKO A;  3FIL B;  1YJJ A;  4YSX B;  1JRP A;  4XE0 A;  2XNA C;  2EEL A;  2KAC A;  5H8Y E;  1I4R A;  3V05 A;  4US8 A;  5HG2 A;  4MAC A;  2R61 A;  2GB1 A;  1N5W A;  1NYQ A;  1E6E B;  1JWM D;  3ETR A;  5G5H A;  3VR9 B;  1RYJ A;  1I4H A;  5BMH A;  3TEW A;  3Q69 A;  1FD6 A;  3BVM A;  1NI3 A;  1WGK A;  1AN8 A;  1IGD A;  1JRO A;  3P42 A;  4RFB A;  1WRI A;  5D3I B;  3AE4 B;  1SIJ A;  3NVW A;  2FUG 1;  3OWE B;  4A9A A;  2IDY A;  3W1S A;  1FRD A;  2M0A A;  4EE2 A;  1EU4 A;  1NVI D;  1I4G A;  1TY0 A;  1RWS A;  3EA6 A;  2JYE A;  2ONQ A;  2GRI A;  2IGD A;  3NVY A;  4RCO A;  1FEH A;  5BMI A;  2WP9 B;  2PVO D;  2RMM A;  1NYR A;  1SJE D;  3NVZ A;  3BYY B;  1UGJ A;  1SJH D;  2LJI A;  2PW9 A;  3HVZ A;  2SEB D;  3KQ4 A;  3BVZ A;  3U2S C;  5HFY A;  1F2R I;  2JQR B;  2LFI A;  1C4P A;  1B1Z A;  2AQ3 B;  4OW0 A;  1PGB A;  3ZQ4 A;  2J4X A;  3P1M A;  3AM9 A;  1FXI A;  4HJG E;  2WXL A;  4D2K A;  4PT5 A;  1ROE A;  2W3S A;  4WQM A;  2QJL A;  2KDM A;  1KFY B;  3P63 A;  3GP7 A;  3H8H A;  4MM3 B;  1QQR A;  4TQ0 A;  3EUB 2;  5C2T B;  3U7Z A;  1CZP A;  1KH0 A;  3RPF C;  1L6U A;  1MI0 A;  2MJD A;  1D5Z C;  3BWU D;  4B0E A;  2K9X A;  2BS4 B;  2VZK D;  2WXJ A;  4NZL B;  3MHZ A;  5FK9 C;  3W2D A;  4YTM B;  2RPV A;  5I4D A;  1XLP A;  4A6Q A;  3AE9 B;  1JWS D;  2JYT A;  4WWM A;  2PIA A;  1E10 A;  4ZHO A;  1K50 A;  2INP E;  2WXK A;  4C80 A;  5EE0 A;  5H92 C;  3IXS A;  3NUH B;  1P7F A;  3ZGZ A;  2ZW0 A;  1QLB B;  3AE1 B;  1E7P B;  1VLB A;  2LHE A;  3FC4 A;  1XCT L;  3LXF A;  4TQ1 A;  3MFG A;  4ZOH C;  1NEN B;  4C7Y A;  2H89 B;  3UI3 A;  1QF6 A;  3MP9 A;  2DWQ A;  3L4P A;  3TSS A;  2WXG A;  2IGG A;  1FCL A;  1C4A A;  4YXD B;  1MHX A;  1N62 A;  2HTM E;  1T6B X;  1JWA D;  5JXV A;  1BML C;  2WDV B;  2WXH A;  4GLS C;  2M56 B;  4NJC A;  1J7C A;  1FM0 D;  1UNS A;  1SE2 A;  2L83 A;  3TUO A;  3B9J A;  2OED A;  4AQ7 A;  4YTP B;  5BYQ A;  2WXN A;  1XLO A;  3U52 E;  1E9M A;  2Y5P A;  4H2A A;  2G9H D;  3BK1 A;  3P4S B;  3Q8A A;  4XDD A;  4TMA B;  4OHJ A;  2WXI A;  2L32 A;  2ON8 A;  4LK0 M;  4N6E B;  4N58 A;  1FMA D;  1C78 A;  3T3N A;  4ITK A;  1ZPS A;  3BII D;  3W9C B;  4J3O D;  5C3J B;  4N59 A;  2WXO A;  1XEE A;  2CJO A;  4M0W A;  3WCQ A;  5G5G A;  1DGJ A;  3GB1 A;  2Z8L A;  1JWU D;  3SFE B;  4HRO A;  3IAM 1;  1OFF A;  2CU3 A;  2DYM A;  2BB5 A;  3ABV B;  4GDL B;  1IUE A;  4WIP A;  4HKQ A;  3R2I A;  1TS2 A;  2E3T A;  1B9R A;  3Q8C A;  2FE8 A;  4L2Y A;  1M4V A;  1EWC A;  4HKZ E;  3U4E G;  1N63 A;  1ET6 A;  1QOB A;  1I7H A;  2PMV A;  1LO5 D;  3NRZ A;  1FNV A;  4ZRQ A;  1QOF A;  4ARC A;  4KGT A;  3AE5 B;  2WDQ B;  3W5U B;  2K5P A;  1I4P A;  4YTN B;  1ZUD 2;  3CWI A;  1J7A A;  3B2F A;  1GPX A;  2WU2 B;  3W5V B;  1EM7 A;  4L23 A;  4C7Z A;  5HI1 A;  1VDV A;  5EE1 A;  1TKY A;  4DXF A;  3AEB B;  4IOI E;  4WUR A;  1DOX A;  3NZ3 A;  5BMG A;  1GAQ B;  1SSN A;  1GOZ A;  2HDE A;  2BB6 A;  4DQO C;  2JU6 X;  3CIR B;  4KKJ A;  1XLQ A;  4REZ A;  3P4Q B;  1FRR A;  1F0Z A;  3IAS 1;  2RDH A;  3SR6 A;  1ZXH A;  1SEB D;  2WXQ A;  4XWT A;  2ICI A;  1ZE3 D;  4JWU C;  2BYT A;  1D4B A;  1YJI A;  4C56 C;  4LLG M;  2KN4 A;  3AEC B;  1EWY C;  4XDC A;  3T3O A;  2W55 A;  3KLS X;  3C8Y A;  4FXC A;  4HEA 1;  5BYS A;  1TKE A;  2K0P A;  2GI9 A;  1N60 A;  1PGX A;  4OZA A;  4OZB A;  5LNK 1;  3KWL A;  1L4Z B;  3URY A;  5GXG B;  4UDU C;  1D5X C;  1KLU D;  2K22 A;  2I2Y A;  2LGI A;  1AYF A;  1TS3 A;  5HHD G;  4JX1 C;  3V3X A;  4KKI A;  2DLB A;  1T5X D;  1WXQ A;  3HUI A;  1VRA B;  3VQI A;  4TSS A;  1R7S A;  1XXG A;  2W54 A;  5D7G A;  2ZW1 A;  1ZDV A;  3BK2 A;  3GS2 A;  1V8C A;  1JCK B;  3ZYY X;  1IBX A;  1ZXI A;  1QOG A;  1N5X A;  4L1B A;  4HRS A;  3AV8 A;  2PLP A;  2WXR A;  1EU3 A;  2IGH A;  1JML A;  3BVG A;  2J42 A;  1PDX A;  4A90 A;  1SXT A;  1YN4 A;  1QOA A;  2ACZ B;  2BTE A;  4ARI A;  1C9F A;  2N7J A;  3J9C A;  1FO4 A;  1HZ6 A;  1IBX B;  4R3D A;  5D3D A;  3AE7 B;  1PYW D;  1J7B A;  3AEE B;  1YN5 A;  2PTL A;  1FNW A;  3AB5 A;  2LEK A;  1MVK A;  2NTS A;  3AMZ A;  4MT5 A;  1ENF A;  1HQR D;  1YN3 A;  3R8B A;  1KF6 B;  2L52 A;  1TZO A;  1K53 A;  2JXT A;  4KGR A;  1MPE A;  2DBY A;  1E0Z A;  1WYG A;  2M19 A;  2MEK A;  4ZRP A;  4NAM A;  1I4Q A;  5MPO A;  1QT9 A;  2WXM A;  1L6V A;  4YWG G;  1C76 A;  4RNA A;  3TEZ A;  2WDR B;  1WSP A;  1CQV A;  1VZ6 A;  2EKI A;  1AWD A;  2L1A A;  1HXY D;  2KAJ A;  4JPS A;  1F2R C;  2D5G A;  4YSZ B;  4ZHP A;  3AH7 A;  2AQ1 B;  1IGC A;  4P16 A;  2OHF A;  3HRD D;  3ZJV A;  2IJ0 A;  1SF0 A;  2W3R A;  4RF1 A;  4IKG A;  3LYY A;  4Q2J A;  3B2G A;  1ZDX A;  4KGS A;  1T3Q A;  4RF0 A;  2RDG A;  2N0S B;  1HA5 A;  4YSY B;  1A70 A;  1XO3 A;  2LHD A;  2X38 A;  3I57 A;  2LMC A;  2VZK B;  3IT4 B;  1UWM A;  5BYR A;  2QEJ C;  1VJK A;  2WLB A;  3BZD B;  1TS5 A;  1MHH E;  2V3N A;  3E9S A;  4RGN A;  4CQN A;  2N9K A;  1QIL A;  2W82 A;  1F77 A;  3TEY A;  3VR8 B;  2AQ2 B;  1L0X B;  2WS3 B;  5E6J A;  3NS1 A;  4KX6 B;  2BS3 B;  1OQQ A;  2BT6 A;  3TEX A;  4B0M A;  4US9 A;  1K52 A;  2IPK D;  4USA A;  4JWS C;  4IDI A;  3SFD B;  1L0Y B;  4AS1 A;  2JSV X;  2WU5 B;  1HZ5 A;  3AEF B;  3PZ8 A;  4ZYS A;  3KWV A;  1CJE A;  4XWW A;  1ZOY B;  3AEA B;  2TSS A;  1UWX A;  1VZ8 A;  1FIQ A;  1JW9 D;  1C4C A;  1RM6 C;  2WQY B;  4YT0 B;  1Q10 A;  1DOI A;  4OVZ A;  1AW7 A;  1Y56 A;  2YEP B;  4WH4 A;  3AE6 B;  1KLG D;  1L4D B;  3P4R B;  1C79 A;  2G1E A;  5TSS A;  3AE8 B;  3PO0 A;  3AEG B;  4A55 A;  1FFV A;  3ZJU A;  1N61 A;  2WXP A;  1ACC A;  1DYQ A;  1K51 A;  1YMH E;  2KMM A;  1HEZ E;  2Y5C A;  1RFK A;  2JWU A;  3IT6 B;  5FKA C;  1ESF A;  3ZJT A;  2J52 A;  4RH6 A;  4WAF A;  4DXG A;  2JZP A;  3MJ5 A;  5EE9 A;  1ZP0 B;  3Q8B A;  1L0V B;  1P7E A;  3VRA B;  1I4X A;  5AUI A;  1CK1 A;  1D6E C;  1SB3 C;  1GB4 A;  3NVV A;  1GB1 A;  2V0G A;  2FBW B;  2Y3A A;  4O1N A;  3EGR A;  1TY2 A;  1XF5 L;  2V3P A;  4OZC A;  4RGM A;  1V1O A;  2N9L A;  1FFU A;  2QMT A;  1YNT E;  2CJN A;  2H88 B;  1C77 A;  3PZ7 A;  3FAH A;  3VRB B;  2INN E;  2JX5 A;  1V1P A;  4A8X C;  1SE4 A;  5EE3 A;  2V4I B;  3AE3 B;  4LTU A;  1JWB D;  1L5P A;  5T8I A;  3DWG C;  2DYO A;  1BUI C;  3AED B;  5AUK A;  1XCQ L;  3I9V 1;  4RGT A;  1FXA A;  2K3U A;  3SEB A;  3RFZ B;  1JAL A;  3BYT B;  2LUM A;  3E56 A;  3N9Y C;  1PUT A;  1TJE A;  2QIE B;  1PFD A;  2MJE A;  1TYG B;  4P6V F;  1KRH A;  3O13 A;  2E6X A;  3P4P B;  2KQ4 X;  2BS2 B;  2BW2 A;  1TS4 A;  1V1P B;  1YQ4 B;  2WNM A;  3AN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...