1UGJA

Solution structure of a murine hypothetical protein from riken cdna 2310057j16
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
141
structure length
141
Chain Sequence
GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2310057J16 protein
total genus 15
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08683 CAMSAP_CKK Microtubule-binding calmodulin-regulated spectrin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.360 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ugjA01
1UGJA
chains in the Genus database with same CATH superfamily
4AUQC 3AEBB 5BYRA 3Q3NC 1HEZE 4IUMB 3AEDB 4OVVA 2FUG1 3GZNB 1MFWA 4J3OD 2WLBA 2KLGA 1Z5SB 2V4IB 3EHVA 3H7SA 3SD5A 3L16A 1FFVA 2IPKD 5L83A 2K8HA 2DLBA 1WM3A 2FIDA 2WXKA 3N3KB 3QJZA 1YJIA 1Q0WB 1XLNA 5H92C 4MELA 2KXJA 1T0RC 2CHWA 1VZ8A 3GOEA 3NS8A 3NG0A 4NQLB 2REXA 1EO6A 3MHSD 4MT5A 1ENFA 3DWGC 3VTWA 3HM6X 3SHQA 2JZZA 3FILA 1E5WA 4AJWA 3VUXA 1LO5D 3TMPB 2Y5BB 1EU3A 2JWUA 3HVZA 2FUHB 3QX1A 1N6ZA 3ML9A 1VRAB 2O2VB 1QZEA 1WSPA 3DVNV 1HZ6A 3VRBB 3JYUA 4PYUA 4ITKA 5G55A 1UD7A 3TL5A 5HG2A 2GLSA 2W3RA 2N9PC 2LFIA 3K9PB 4HDQA 2WU5B 4H2AA 2AYOB 2YEPF 3V6CB 3RI7C 1F1HA 4LTUA 4US8A 2K5PA 2BTEA 1WMHB 3R7QA 4ASWC 4NQKE 2BB6A 3HIZA 4W9FA 3HRDD 4LNIA 1VZ7A 1TY0A 1WYGA 1S1QB 5DPRA 4N9F4 1F9JA 5TSSA 1HZ5A 4IWPA 1I7HA 3AE6B 1YJJA 1V97A 4L23A 3ZNHB 2M0AA 3C0RB 1YN3A 1FEHA 2FCQA 1HE8A 2KTFA 3KLSX 3WALA 1ZGUB 4F7ZA 3AN1A 3TJPA 1WRDB 5KHQA 1SF0A 2IBIB 4JX1C 2GRIA 1FMAD 4KDIC 1E7PB 1E8YA 1WX8A 3VTVA 2XNAC 4RMAA 2VZKB 4L1BA 1IYFA 2KJ6A 4WAFA 1WX7A 1J0GA 2WXMA 3QA8A 2NMQA 4KZ0A 2L3ZA 1TIFA 3A33B 2AQ3B 2WYQA 1TY2A 4XYCA 1E8ZA 4ANXA 5BMGA 2K6DB 1WXSA 2OEDA 3GP7A 4WURA 1E8XA 1V1PA 2L83A 4BKTA 3PS6A 3IXSA 4KIKA 1T0SC 3QC8B 2K8BA 2A4ZA 5JZEB 2WGSA 3T3OA 2BGFA 4C4VB 1SE3A 1C1YB 5FKAC 1JWMD 2DZJA 2JT4B 2IGDA 3DCGA 3ZGZA 1NENB 3OAWA 4HCNB 2NVUI 2JU6X 3BVGA 1YOVB 1YMHE 3UQBA 3Q8AA 2YEPB 4NPNA 2CKHB 2LHEA 3PTFC 4R3DA 1ZP0B 2JQRB 2XN9C 2C7HA 1YNTE 4EE2A 2V1YA 2PVOD 3EFUA 3SFDB 2V3SA 2C7MB 3N30A 4CYEA 4HPLB 1WY8A 2ZVOA 2LEKA 3WA0A 4TQ0A 1KOTA 2KDEB 3VFKA 1B9RA 3JW0X 2IY1B 4LNKA 2WWZA 3RD2A 3BVMA 2IO0B 1QF6A 1VDVA 1PQSA 4X57B 2PTLA 2A5UA 1V6EA 4HCPB 5C1ZA 2R61A 4XZ4A 5CX3A 4GOCA 1EWCA 4DWFA 2KQ7A 2J0MA 4K7UA 3WIMA 4FADA 3WCQA 2Y5CA 1L5PA 2MBBB 1IBXB 1JWSD 3CSTA 1PDXA 1Y56A 3KUCB 3MC0B 1FPYA 4HKZE 4GXBA 2QC8A 1XLPA 3DHGC 4HPMB 4DQOC 1XXGA 1V2YA 2WDRB 1WYWB 1V49A 2D3BA 4YSXB 2W54A 1F2RC 1TS2A 4KDLB 2KTRA 3OG5A 4XC2A 3HHMA 2XK5A 1WXMA 4MGZE 3P4PB 1MG4A 1I4RA 2KQSA 3NVWA 2JSVX 3PZDA 2KT7A 4ACFA 1OTRB 1E7VA 3N32A 5HHDG 2MJEA 1KLGD 2JRIB 3TIXA 3Q3JA 4RGMA 4I6LB 3SDLC 3W5UB 2I38A 1P7EA 1WMHA 3GE8C 1OGWA 1WGKA 2CU3A 3ABVB 3ZW3A 5IO9A 4WAAA 3BYTB 3KWLA 5HI1A 2BPSA 1OQQA 4M02A 4CO7A 4WH4A 4ANWA 3AE5B 5G5HA 3ALBA 2DX5B 2GBMA 2RGFA 3VUWA 2HE7A 1Y8RC 4TQ1A 3VH3B 2N9LA 2C9WB 4GU2A 2BYVE 1T0YA 3APFA 2DBYA 2RD0A 3L17A 2KAJA 2JUOA 4E71A 2ZVNA 1UGMA 2VZKD 3SR6A 1X1MA 1KRHA 3PLVA 2LVOA 4M0WB 1FD6A 1WE7A 2JYEA 1E6EB 2IZVB 2K1FA 2BYFA 1ESFA 4BVUC 4II3B 4OZBA 3VDZA 3ZRFA 5J2RA 2DZMA 4RH6A 4FULA 3S2AA 1UBQA 1UGJA 2JYTA 1FIQA 1VR9A 3MTNB 5LXHA 1YD8U 2M8SA 3B9JA 4W9IA 4GN1A 1WGDA 4K7WA 1N61A 2BS2B 3B1LX 1V8CA 3ONSA 2BF8B 3RZFA 5LLIA 2PKOA 1WI0A 1FXTB 2BKFA 3W5VB 2RDBC 4AJYB 3AECB 2FCNA 4L2YA 2LMCA 2WHIA 4HLEA 4LJOB 5C23A 2MP2B 3MHZA 4TUUA 2MCNB 3B2FA 3T9LA 4LDTD 2M19A 2ICIA 2J42A 1JMLA 2RDGA 2WU2B 2V0GA 1QKZA 2RDHA 1ROEA 3JVZX 5C2TB 1LM8B 4C4VA 1C9FA 2NTSA 3R8BA 2NTTA 3IAM1 2CU1A 5DPTA 2LGYA 4IM3A 3C19A 2CJOA 3DWMA 3RNBC 3H7PB 1MVKA 3EC8A 3RULA 1TS5A 2GOWA 3PRZA 1J7AA 2Y3AA 4LNOA 4AWJA 3QARA 4JIOU 5AEKB 3WAPA 4OVZA 5D94A 4BOZB 1WX9A 2KMAA 5T8IA 1R4MB 3U30A 3EA6A 3N1YC 2VRRB 2WXJA 1YN5A 1J19A 2EMSA 4K1RB 5EE3A 1NI2A 3NZSA 2LI5A 2EKIA 3IG3A 1R7SA 1V5OA 4F8CB 1TZOA 4US9A 4W9JA 1IUEA 4JGHB 1P1AA 4RM9A 1VD2A 1YIWA 3DVGX 2KANA 3RNFC 5HKHA 4PS8A 3ZLZA 4WIPA 4W9DA 3ZXVA 3ML8A 1Z2MA 3DQVA 1J7CA 2NBVB 3UIPB 1MPEA 2LXAA 2OHFA 3KH0A 1PGXA 4N6EB 3PLUA 2AEHA 2K25A 2KWVB 3A9JA 4GLSC 1FXAA 3NUHB 4C56C 2ZW0A 2RPQA 2ZPNA 3AE3B 5IOIA 3DBLB 2LGXA 4OZCA 3ZIMA 3AE2B 3KWVA 5D7GA 1WGGA 4W9LA 1ZUD2 1UZXB 4YTMB 2Q5WD 5EDSA 4C7ZA 4KKIA 4K81A 4HKQA 2N7DA 4WWOA 3SEBA 2C5LC 1TS3A 2Z0EB 1I4QA 4NAMA 2L32A 2N9EB 3M95A 4BAXA 3KQ4A 2KTRB 2GBKA 2KKCA 4HJGE 1WXQA 1C4AA 2MBEA 1WR6E 1F0ZA 2G4DB 1V80A 1WR1A 2HTME 3X23A 3MP9A 3LJ3A 4HROA 3AB5A 4FLHA 2ZCBA 1QT9A 3PHXB 3KUDB 1JQ4A 3ZO5B 3L13A 2UU7A 3AV8A 3BIID 3KW5B 4A90A 1AW7A 4NNJB 3Q8BA 1GNUA 2N9KA 2O6VA 2QCZA 2YLMA 1P7FA 1P3QU 2DYMA 1VJKA 1V1PB 3QAQA 3RZWC 1IP9A 1EF1A 5EE9A 3PZ8A 2WDVB 4ZDVA 3B0AA 3QHTA 5LXIB 3IBEA 5BO4B 2KMCA 4KX6B 4S17A 3L08A 1SXTA 3A9JB 5AZFA 4IG7B 3R2IA 4IWOA 3A1QA 3ZJVA 2QJLA 4FN2A 2KYWA 4KGTA 4RM8A 3LDZE 3ZXRA 2D10A 3PHWB 2D11A 2KZRA 2D07B 5BMIA 4WJQA 1WE6A 2ACZB 1LXDA 1N5WA 4OW0A 1C78A 2GBRA 1CMXB 4REZA 2L1AA 2DWQA 1RAXA 1NDDA 1T6BX 2KWUB 2KN5A 1BXTA 2JPHA 1ZPSA 3W9CB 2AX5A 2IO2B 2AWTA 1SSNA 2N7JA 1ISNA 3AU5A 4M0WA 2DZIA 3ZYYX 4BKGA 2QDFA 1Q1OA 2KJRA 1DGJA 2WXOA 1EUVB 1TS4A 3RMKC 2JZ3B 4HK2A 3H1UA 2J52A 1SEBD 1V86A 5H8YE 2K0PA 4LNFA 3AEAB 1F2RI 4GDKA 4C80A 1D6EC 4DHZB 1IGCA 5E6JA 4NY0A 1YX6B 1UWMA 5L95C 1WRIA 1Q5WB 2OJRA 3ZJUA 3P4QB 3QCAA 4YXDB 5DPSA 3VVWB 2CJNA 1KM7A 2M17A 3FILB 1TGZB 1MG8A 4BFRA 1N63A 2BS4B 2DAJA 1KLVA 1MJDA 1I42A 1LFDA 1JALA 3AE1B 1YQBA 1ZE3D 1FNVA 3PZ7A 3Q2AC 2IJ0A 1E9MA 3RCZA 5TR5A 3R7RA 3AXCA 2FBWB 1FM0D 2KNBA 2JVCA 4B0MA 2PE6B 1DOYA 2KD0A 2MHJA 1E90A 4RGTA 5D3DA 3V6EB 2MX2A 1D5MC 3A9KA 3H9DA 2BVCA 2HD5B 4YTPB 3TEZA 4DHJD 1WJ6A 3VRAB 4ANVA 3TEWA 3BZDB 4KKJA 4B0EA 3U8ZA 2WXLA 4MEMA 1UF0A 4W9CA 1FFUA 1AWDA 2IO3B 2R2OA 4MH8A 1D4BA 4EFOA 4NZLB 1DOIA 2FE8A 4C7YA 2SAKA 4HWIB 2ZNVC 4MGYE 3BK2A 2L76A 2M4NA 1LGRA 2NBWB 1T5XD 4ZHPA 4AQ7A 2MBHA 3N1ZC 3V60A 2N0SB 1WGHA 1JWUD 3RN9C 3Q8CA 5IAAC 2DZKA 1KF6B 1GG3A 4JWSC 1QOFA 1PFDA 1FRDA 2MSED 2IY0B 3PRPB 2UWQA 3GZNI 2K22A 3ZDMC 2DNFA 2AQ1B 3V3XA 2NBUA 1UUPA 3QK0A 3AE9B 3DBLI 4A20A 3NZUA 4GB9A 5IP4D 3E56A 4P7IA 1TYGB 1KFYB 2KDBA 3OWEB 4RFBA 2H89B 4ZRKA 4IW0A 3ZNID 3MJ5A 4FA6A 4BBNC 3RNAC 3WAOA 4J6IA 2I1JA 1RFAA 3M63B 1K50A 3NOBA 5DPWA 2YVCA 2J0JA 3N9YC 2KO3A 1TT5B 2GI9A 3MC9A 4P1CC 5AUKA 4D2KA 3CF6E 1NYRA 2HTHA 3L54A 5E6OA 3P4RB 3MJWA 2QHOA 2HJ1A 2IYDB 2LGDA 2CS4A 3GB1A 4F1SA 5GXGB 4JL9A 3T8MA 3AMZA 4EUTA 4AS1A 1HQRD 4K3BA 1NVID 4NJCA 1R4MI 1E10A 2WDQB 3V61A 2ASQA 3M62B 4PT5A 1ZKHA 3DHIC 4KZCA 3VAWA 2DAFA 2BYTA 2PVGC 4LJPB 1WJ4A 4DBGA 4KVGB 4NAWA 4FBJB 3U52E 5AUIA 2WXNA 2LASA 3HM3A 2O6VB 4HDOA 4DXFA 2XK5B 1N60A 2D2QA 4P1BC 2WNMA 2W9NA 2L0TA 5J17A 1L0XB 3R2TA 4AP4C 3DOWA 2IGGA 1L6UA 3UIOB 4TMAB 2INCC 2WXQA 2M56B 4MGKE 3AEEB 1GOZA 5FR6A 3R66C 2GBNA 1D5XC 4DXGA 1PGBA 3NVYA 2LVPA 3PT2B 3ZNGC 3NY5A 3RFZB 1ZDVA 4ZHOA 1FO4A 2KFKB 4RF0A 5G2NA 1ZOYB 2VH2A 4G0NB 2KC2A 1U4AA 2RSUA 1SE9A 4ARCA 3FKYA 2JXTA 2X38A 4I6NB 4XWWA 1JROA 2L8JA 1IGDA 2LD9A 3OLMD 3DBRB 1FCCC 1K53A 3PRMB 2KJHB 2PEAA 1V9JA 3TUOA 4KGSA 4PS7A 3K9OB 3P4SB 1OEYJ 2G4SA 5D3IB 1AYFA 1BUIC 3T3NA 3IFWB 4HPPA 4GDKB 1XCTL 2ZCCA 4ZOHC 4ZRQA 4BKSD 1TJEA 4ZRJA 3QIJA 1SIJA 2N9XA 2PLPA 2LJIA 4IDIA 5IN7A 4CHKA 2BB5A 3ZDTA 2G1EA 4FJVB 1OFFA 2KN4A 1RYJA 2INPE 4KSLC 3R3MA 1XD3B 4XDDA 3PVLA 3ZTCA 3JSVB 4E74A 1ZXIA 3H6NA 4EZLA 2X8XX 1JRUA 1WXAA 2LJ5A 5G5GA 1I35A 1WGRA 4DDGD 4C00A 2FIFA 1TKGA 1RRBA 1WH3A 2KC1A 2MBQA 3VHTC 4II2B 3W1SC 3N1XC 1QLBB 1CQVA 1LQBA 3DDCB 5E6NA 3URYA 4JPSA 4W9HA 1GAQB 2MA9B 4ZRIA 1FRRA 3P42A 4K3CA 3Q6BA 5HFYA 3W2DA 3NZ3A 1KTKA 3LB8C 3OJ3A 4IM2A 5BYSA 3UGBB 3APCA 1A70A 2D3AA 2KMMA 3IVFA 4MH0E 4LLGM 4JQWC 3V62A 4DHJB 3Q8EA 1WIAA 2BBCA 2BKRB 2LHDA 3TSSA 3AULA 1YN4A 4K7SA 2WQYB 1XEEA 2RR9A 4YSZB 1QOGA 3NRZA 1D5ZC 1JWBD 2BW2A 3BYYB 2KWCA 1M94A 1MI0A 1YQ3B 2IDYA 4OHJA 3WANA 3NS1A 3APDA 1E8WA 2MRPA 5AZGA 1HA5A 1SGHA 2JF5A 3AEGB 5GMVA 3ECIA 3AH7A 3M3JA 4XX5A 4HJKA 2R2QA 2ZW1A 2KOXA 2V9HA 3O65B 1QOAA 2MJDA 5IA7A 2KDMA 1L0VB 2I2YA 2V3PA 4HXDA 2GMIC 5JXVA 4XE0A 2QEJC 4RGNA 4EOYA 1G6JA 2Z0DB 2CR5A 3Q3MC 3UINB 1UH6A 2BWES 3KYCD 2JRHA 4WJPA 4RF1A 1XO3A 2V4LA 4MSMB 2WXPA 4MGIE 2FNJB 3EUB2 3MFGA 1WJUA 3LXFA 2BT6A 3U7ZA 2FAZA 4PK1A 4ZYSA 4YT0B 4XWTA 1WJNA 2J0KA 4HEA1 1D3ZA 3AEFB 3ZJTA 2PIAA 1YQ4B 4B9KA 4EZJA 4BZAA 3JSVA 5EE0A 2J7QB 2AQ2B 4IC7B 3DBSA 3DVNU 2KDFB 1FXIA 4GMVA 4W9KA 3RNGC 3AE8B 3BWUD 4G11A 1OQYA 1RFKA 1WFYA 2WXRA 1J7BA 1WWTA 3U4EG 4A6QA 3QQ8B 4FXCA 3UQAA 3L10B 3I5JC 3N20C 2M1MA 3AU4A 2N1VA 5FR3A 1UELA 1EWYC 2PMVA 4PYZA 1V81A 2DHZA 3EECA 2JWZA 4M8NA 3GE3C 3UI3A 2NCNA 4KIKB 5IKCM 3TBLD 1IPGA 3ZRCA 3WAMA 4B95A 2EELA 1VCBA 4MSQB 2LZ6A 2KVZA 1DYQA 3RYTA 3KVFB 1C4PA 1RWSA 2WX0A 2VH1A 4AOFA 3VH4B 1RLFA 1MHHE 4WJNA 2I1KA 2LRWA 2KQ4X 2G9HD 3ZTDA 2EKEC 1ET9A 1F77A 4RCOA 1XT9B 1RM6C 1K52A 1UNSA 2QMTA 2AL3A 2KWDA 3PPAA 4EEWA 4USAA 4BKSA 3DBHB 2PW9A 4N59A 1XF5L 1PYWD 2Z8LA 1Q10A 1WZ0A 3UF8A 3NHEB 2QILA 4MACA 1QQRA 2LUEA 2NR2A 4DHZE 1IBXA 1R4NB 2WX1A 2KLCA 1E7UA 2K9XA 3I3TB 2D3CA 3ZKJC 4DDID 2RPVA 3Q14C 1C79A 4ZYNA 4MJSB 4P16A 3ETRA 3Q69A 1UBIA 2OJWA 3L0WB 2QIEB 1NI3A 2MEKA 3PO0A 2FCSA 4TKNA 1GC6A 2LGSA 1SB3C 1JRPA 2NPTA 4E3CA 3KYDD 3RUIB 1P0RA 1I4XA 1ET6A 2ZEQA 4FJYA 2UYZB 2MLBA 2L00B 2TSSA 3J9CA 2WXFA 3E9SA 1DOXA 3B08A 1F52A 2N1WA 4KSKC 4GIVA 2INNE 4WWMA 2N4FA 4A3PA 2ZNVB 1TZ1A 3ENEA 2XEWA 1XLOA 2LVQA 4M00A 1BMLC 3LYYA 4NAWB 1HTQA 1WZ3A 1K51A 1CK1A 3TEXA 1NBFC 1PGAA 2WP9B 4JE3B 3FAHA 2WS3B 4OZAA 2D3GA 1C77A 4A9AA 1KLUD 3D32A 4GDLB 3PGEA 5JH5C 4NJ7A 2ZZPB 1ACCA 3CWIA 3AE4B 5CHFA 1CZPA 5CHWA 3OJ4B 4OVUA 5C3JB 1KJTA 5CTRC 2JXXA 1TKYA 2LGIA 2QSDA 1GPXA 3P1MA 4WWNA 4P6VF 2HJ8A 3Q8FA 3P2BA 1XCQL 4XDCA 2ZPYA 4LNNA 3CIRB 4MM3A 2L7RA 4RGOS 3VR9B 2WXGA 2PE9A 4NJ6A 4WQOB 3ZUNA 2WDTB 4A55A 2XBBC 3A9KB 4HRSA 3Q3FA 1T0QC 2HDEA 5AZHA 1SIFA 2FCMA 2LWPA 4URKA 3QWZB 4JWUC 1ZXHA 2ZJDA 4MDKE 4B6WA 1J8CA 2MQJA 3VTUA 1XLQA 2NPTB 4YWGG 3ZVVA 3IT4B 3MC8A 4Q2JA 4QAYA 2G3QB 1VZ6A 3U2SC 5D2MB 2WXHA 1C76A 4DK5A 2ON8A 2J53A 2KDIA 1L0YB 2K39A 3I9V1 1N62A 2LUMA 1L6VA 1WXVA 3SU8X 2CHZA 4DXAB 3V05A 1EF5A 1NYQA 5MPOA 2MBOA 1A5RA 1L7YA 5DCNA 5J18A 4M01A 3ZNZB 1C3TA 4WQMA 5I4DA 2C7NB 2BQQA 3PV1A 2KHWB 1P98A 1TTNA 3HUIA 1FNWA 3DPDA 3FC4A 4PS3A 5EE1A 2INDC 1JCKB 4IKGA 4ICVA 2N7EA 1AARA 2O2VA 4I6PA 2W3SA 2MJ3A 3IHPC 3NJTA 4MJSA 2MP2A 3AE7B 2GBJA 3SFEB 2RMMA 4GSWA 1HTOA 4LCDE 2L05A 2B76B 3RNCC 1EU4A 3U7DA 4BBNF 3VQIA 5FK9C 1SJHD 4GGQA 1V5TA 4RNAA 1HXYD 3RNEC 3GS2A 3NVZA 5KHOA 1L2NA 2D5GA 3EGRA 2BS3B 3AM9A 3HK0A 1OEYA 2AL6A 1WM2A 3P63A 1T3QA 1PUTA 4A3OA 4BOSC 3ZQ4A 2JX5A 3B2GA 1YJ1A 1P9DU 1GC7A 2K6QA 2NS5A 4N58A 1TBEA 1R4NI 3I57A 3KUZA 1GUAB 2L52A 2MW5A 2E6XA 3RPFC 4S0RA 5BMHA 2W55A 3RT3B 3DBHI 2K8CA 1E0ZA 1H8CA 4GDLA 1NEKB 2OOBB 4FJZA 5LNK1 3H8HA 3HVDA 4FHKA 1UWXA 3NVVA 2BYEA 5CHVC 3W1SA 3X0WA 2JY6A 3O13A 2K3UA 3A1QB 4A8XC 1GB4A 3DBRI 4G3XB 1SE4A 5BYQA 4O1NA 4YTNB 1MHXA 1FNUA 3IAS1 1I4PA 4ANUA 2PPHA 3TCAA 1SE2A 4CQNA 3A4RA 4TV3A 4W9EA 2DENB 4LK0M 3C8YA 4ICUA 4EKUA 4UDUC 4TSSA 2LXCA 4W9GA 4YSYB 2Y5PA 2BWFA 1YX5B 4YL8A 4IM0A 4ZRPA 2KX3A 1QOBA 2H88B 2G45B 1BT0A 4LDTB 3IT6B 4XGAB 3CMMB 4HVBA 2KVRA 1CJEA 1H4RA 3BK1A 1S3SG 3DVGY 2KK8A 2MH7A 3AI5A 4G50A 4KV2A 1JW9D 2WXIA 2KFJA 2W82A 2L0FA 2Z59B 5JHAA 1QILA 4WJOA 4JLCA 3W1YA 3PREA 4KGRA 2IO1B 2JZPA 2KACA 1K8RB 3BVZA 3BY4B 2ONQA 1JWAD 3DHHC 1B1ZA 1ZDXA 3A4SC 2IGHA 1WF9A 2E3TA 3VR8B 2J4XA 1AN8A 2CHXA 2LRUA 1L4ZB 3Q3OC 1SBBB 4IWQA 1EM7A 4ARIA 2DYBA 3H7PA 2B3AA 2V3NA 1I4HA 1M4VA 3I63C 4IOIE 4FHJA 1I4GA 2C60A 3VUYA 1GB1A 1XQQA 2KFKA 1L4DB 2O6VD 2EMTA 5E6PA 3TEYA 2M0XA 5D6JB 1N5XA 2MWSB 1C4CA 2KX0A 1TKEA 4EZKA 1FCLA 3VXWA 1GJZA 1SJED 2GB1A 4MM3B 3BINA 1STEA 1ZW7A 1V1OA 3EFCA 4WWPA 5JHBA 4M8MA 1KH0A 2PJHA 1WGYA 3CSFA 1VLBA 3L4PA 3PSEB 2DYOA 2SEBD 1OQRA
chains in the Genus database with same CATH topology
3AEBB 5BYRA 3B9JA 3E56A 1HEZE 4USAA 3AEDB 1TYGB 1KFYB 3OWEB 4RFBA 2H89B 2PW9A 1N61A 2BS2B 2FUG1 4N59A 1XF5L 1PYWD 3MJ5A 4J3OD 2WLBA 2Z8LA 1Q10A 2V4IB 1V8CA 2QILA 4MACA 1QQRA 1K50A 1IBXA 2PKOA 1FFVA 2IPKD 3N9YC 2K9XA 3W5VB 2GI9A 3AECB 2DLBA 4L2YA 2LMCA 2RPVA 5AUKA 4D2KA 1C79A 1NYRA 4P16A 3ETRA 3Q69A 3P4RB 2WXKA 2QIEB 1NI3A 1YJIA 2MEKA 3PO0A 1XLNA 3MHZA 5H92C 3GB1A 5GXGB 1SB3C 1JRPA 1VZ8A 3B2FA 2M19A 1I4XA 2ICIA 2J42A 1JMLA 2RDGA 1ET6A 3AMZA 2WU2B 2V0GA 4MT5A 4AS1A 1ENFA 1HQRD 1QKZA 2RDHA 1ROEA 3DWGC 1NVID 4NJCA 2TSSA 3J9CA 2WXFA 1E10A 2WDQB 3E9SA 1DOXA 5C2TB 4PT5A 3FILA 2INNE 4WWMA 1C9FA 2NTSA 1LO5D 2BYTA 2PVGC 3R8BA 2NTTA 1EU3A 2JWUA 3HVZA 3IAM1 1XLOA 3U52E 1VRAB 5AUIA 1BMLC 2CJOA 2WXNA 3LYYA 3DWMA 4NAWB 1K51A 1WSPA 1HZ6A 3VRBB 1CK1A 1MVKA 3TEXA 1PGAA 4ITKA 2WP9B 4JE3B 1TS5A 4DXFA 3FAHA 2WS3B 4OZAA 1J7AA 2Y3AA 1N60A 1C77A 5HG2A 4A9AA 2W3RA 1KLUD 4OVZA 2WNMA 4GDLB 2LFIA 1L0XB 3R2TA 2WU5B 2IGGA 1ACCA 1L6UA 3CWIA 3AE4B 4H2AA 5T8IA 1CZPA 2YEPF 3EA6A 2WXJA 1YN5A 4TMAB 5C3JB 2WXQA 5EE3A 4LTUA 4US8A 2K5PA 2BTEA 1TKYA 2LGIA 2EKIA 2QSDA 1GPXA 3P1MA 4P6VF 1R7SA 3Q8FA 2BB6A 2M56B 1TZOA 3HRDD 3AEEB 1GOZA 1VZ7A 1XCQL 4XDCA 4US9A 1TY0A 1WYGA 3CIRB 1IUEA 4DXGA 1D5XC 5TSSA 1HZ5A 1PGBA 3NVYA 4RGOS 3VR9B 1I7HA 3AE6B 1YJJA 2WXGA 3RFZB 1V97A 1ZDVA 4L23A 4A55A 4ZHOA 1FO4A 4RF0A 2M0AA 1YN3A 1FEHA 4HRSA 3KLSX 2HDEA 4WIPA 3AN1A 4JWUC 1ZOYB 1ZXHA 1SF0A 4JX1C 1J7CA 1MPEA 2GRIA 1FMAD 1E7PB 2OHFA 4ARCA 1XLQA 1PGXA 4N6EB 2JXTA 2X38A 2XNAC 4YWGG 2VZKB 3IT4B 4L1BA 4XWWA 1JROA 4GLSC 4Q2JA 1FXAA 3NUHB 1IGDA 4C56C 1VZ6A 4WAFA 1FCCC 1K53A 2ZW0A 2WXMA 3U2SC 2WXHA 1C76A 3AE3B 2NMQA 4OZCA 3TUOA 2AQ3B 3AE2B 2ON8A 2J53A 1TY2A 3KWVA 1ZUD2 4KGSA 5D7GA 3P4SB 1L0YB 3I9V1 4YTMB 1N62A 5D3IB 5BMGA 1AYFA 1BUIC 2Q5WD 2LUMA 3T3NA 4C7ZA 4KKIA 2OEDA 3GP7A 1L6VA 4GDKB 1XCTL 4WURA 4ZOHC 4ZRQA 4HKQA 3SEBA 1TJEA 3V05A 1SIJA 1V1PA 2L83A 1NYQA 5MPOA 1TS3A 3IXSA 1I4QA 4NAMA 2PLPA 2LJIA 4IDIA 2L32A 4WQMA 5I4DA 2BB5A 3KQ4A 2G1EA 3T3OA 1OFFA 2KN4A 1RYJA 4HJGE 2INPE 1C4AA 1WXQA 1SE3A 1F0ZA 3HUIA 1FNWA 4XDDA 3FC4A 5EE1A 5FKAC 2HTME 1JCKB 4IKGA 1JWMD 3MP9A 4HROA 2IGDA 3AB5A 1QT9A 2W3SA 1ZXIA 2MJ3A 1JQ4A 3ZGZA 1NENB 2JU6X 3BVGA 3AE7B 1YMHE 3AV8A 3Q8AA 2YEPB 5G5GA 3SFEB 2RMMA 2LHEA 3BIID 4R3DA 2B76B 1ZP0B 2JQRB 4A90A 1AW7A 2XN9C 1TKGA 1EU4A 3Q8BA 2N9KA 1YNTE 3VQIA 4EE2A 5FK9C 1SJHD 2PVOD 4RNAA 1QLBB 3SFDB 1HXYD 1CQVA 1P7FA 2DYMA 1VJKA 3GS2A 1V1PB 3NVZA 3URYA 2D5GA 3EGRA 4JPSA 1GAQB 2LEKA 2BS3B 3AM9A 4TQ0A 1FRRA 5EE9A 3P63A 3P42A 3PZ8A 2WDVB 1B9RA 1T3QA 1PUTA 3ZQ4A 2JX5A 3B2GA 4KX6B 5HFYA 1SXTA 3W2DA 4N58A 3I57A 3NZ3A 1KTKA 3LB8C 3R2IA 3ZJVA 5BYSA 2QJLA 4KGTA 2L52A 1A70A 2E6XA 3RPFC 3BVMA 5BMHA 2W55A 1QF6A 1VDVA 2PTLA 2KMMA 4LLGM 5BMIA 2R61A 3Q8EA 1E0ZA 2ACZB 1N5WA 4OW0A 1C78A 1EWCA 2BBCA 2LHDA 3TSSA 1NEKB 5LNK1 4REZA 2L1AA 2DWQA 3H8HA 1YN4A 3HVDA 3WCQA 2WQYB 1UWXA 1T6BX 1XEEA 2Y5CA 3NVVA 1L5PA 1BXTA 4YSZB 1ZPSA 3W9CB 1IBXB 1QOGA 2AX5A 1D5ZC 3NRZA 1JWSD 1JWBD 1PDXA 1SSNA 2N7JA 3W1SA 2BW2A 3BYYB 3O13A 1MI0A 1Y56A 2K3UA 3MC0B 4M0WA 4A8XC 1GB4A 1YQ3B 1SE4A 5BYQA 3ZYYX 2IDYA 4OHJA 4O1NA 4YTNB 1MHXA 3NS1A 4HKZE 1FNUA 3IAS1 1DGJA 1XLPA 2WXOA 1TS4A 1I4PA 1HA5A 4DQOC 1XXGA 3AEGB 2J52A 1SEBD 2WDRB 3AH7A 1SE2A 5H8YE 4CQNA 2K0PA 3AEAB 1F2RI 4C80A 1D6EC 2ZW1A 1IGCA 4YSXB 5E6JA 2W54A 1F2RC 1TS2A 1UWMA 1WRIA 4LK0M 3ZJUA 3C8YA 1QOAA 3P4QB 2MJDA 4YXDB 4UDUC 2KDMA 4TSSA 1L0VB 2I2YA 2CJNA 3P4PB 4YSYB 2Y5PA 2V3PA 3FILB 1N63A 1I4RA 2BS4B 5JXVA 4XE0A 2QEJC 4RGNA 4ZRPA 3NVWA 2JSVX 1JALA 3AE1B 1ZE3D 1QOBA 2H88B 1FNVA 3PZ7A 3IT6B 2IJ0A 1E9MA 5HHDG 1CJEA 2MJEA 2FBWB 1FM0D 4RF1A 1KLGD 1XO3A 4B0MA 1DOYA 3BK1A 4RGMA 2WXPA 3W5UB 4RGTA 2MH7A 2I38A 1P7EA 3EUB2 3MFGA 5D3DA 3U7ZA 1JW9D 2BT6A 2WXIA 3LXFA 1D5MC 4ZYSA 2W82A 1WGKA 4XWTA 4YT0B 1QILA 2CU3A 4YTPB 3ABVB 3TEZA 4HEA1 4KGRA 3AEFB 3ZJTA 3VRAB 2JZPA 2PIAA 2KACA 1YQ4B 3BYTB 3BVZA 3KWLA 2ONQA 1JWAD 1B1ZA 5HI1A 1ZDXA 5EE0A 3TEWA 3BZDB 4KKJA 2IGHA 4B0EA 2E3TA 3VR8B 2WXLA 1OQQA 2AQ2B 2J4XA 1AN8A 4WH4A 1L4ZB 1FFUA 1AWDA 1FXIA 1SBBB 3AE8B 4MH8A 1D4BA 3BWUD 3AE5B 1EM7A 5G5HA 4ARIA 1RFKA 2V3NA 1DOIA 1I4HA 2FE8A 2WXRA 1M4VA 2SAKA 4NZLB 4C7YA 4IOIE 1J7BA 1I4GA 1WWTA 3U4EG 4A6QA 3BK2A 4TQ1A 2N9LA 1GB1A 4FXCA 1L4DB 1T5XD 2DBYA 3TEYA 4ZHPA 4AQ7A 5FR3A 2KAJA 1N5XA 1EWYC 2PMVA 2N0SB 1C4CA 1TKEA 2VZKD 3SR6A 1KRHA 3UI3A 1FCLA 1JWUD 3Q8CA 1KF6B 1FD6A 2EELA 2JYEA 1E6EB 4JWSC 1QOFA 1SJED 1PFDA 2GB1A 1DYQA 4MM3B 1STEA 1C4PA 1ESFA 1V1OA 1FRDA 1RWSA 4OZBA 4RH6A 1MHHE 1KH0A 2K22A 1UGJA 2JYTA 1FIQA 2KQ4X 2G9HD 1VR9A 1VLBA 2AQ1B 3L4PA 1ET9A 1F77A 4RCOA 3V3XA 1UUPA 1RM6C 2DYOA 3AE9B 1K52A 1UNSA 2QMTA 2SEBD 1OQRA 2KWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGJ A; 
#chains in the Genus database with same CATH topology
 4AUQ C;  3AEB B;  5BYR A;  3Q3N C;  1HEZ E;  4IUM B;  3AED B;  4OVV A;  2FUG 1;  3GZN B;  1MFW A;  4J3O D;  2WLB A;  2KLG A;  1Z5S B;  2V4I B;  3EHV A;  3H7S A;  3SD5 A;  3L16 A;  1FFV A;  2IPK D;  5L83 A;  2K8H A;  2DLB A;  1WM3 A;  2FID A;  2WXK A;  3N3K B;  3QJZ A;  1YJI A;  1Q0W B;  1XLN A;  5H92 C;  4MEL A;  2KXJ A;  1T0R C;  2CHW A;  1VZ8 A;  3GOE A;  3NS8 A;  3NG0 A;  4NQL B;  2REX A;  1EO6 A;  3MHS D;  4MT5 A;  1ENF A;  3DWG C;  3VTW A;  3HM6 X;  3SHQ A;  2JZZ A;  3FIL A;  1E5W A;  4AJW A;  3VUX A;  1LO5 D;  3TMP B;  2Y5B B;  1EU3 A;  2JWU A;  3HVZ A;  2FUH B;  3QX1 A;  1N6Z A;  3ML9 A;  1VRA B;  2O2V B;  1QZE A;  1WSP A;  3DVN V;  1HZ6 A;  3VRB B;  3JYU A;  4PYU A;  4ITK A;  5G55 A;  1UD7 A;  3TL5 A;  5HG2 A;  2GLS A;  2W3R A;  2N9P C;  2LFI A;  3K9P B;  4HDQ A;  2WU5 B;  4H2A A;  2AYO B;  2YEP F;  3V6C B;  3RI7 C;  1F1H A;  4LTU A;  4US8 A;  2K5P A;  2BTE A;  1WMH B;  3R7Q A;  4ASW C;  4NQK E;  2BB6 A;  3HIZ A;  4W9F A;  3HRD D;  4LNI A;  1VZ7 A;  1TY0 A;  1WYG A;  1S1Q B;  5DPR A;  4N9F 4;  1F9J A;  5TSS A;  1HZ5 A;  4IWP A;  1I7H A;  3AE6 B;  1YJJ A;  1V97 A;  4L23 A;  3ZNH B;  2M0A A;  3C0R B;  1YN3 A;  1FEH A;  2FCQ A;  1HE8 A;  2KTF A;  3KLS X;  3WAL A;  1ZGU B;  4F7Z A;  3AN1 A;  3TJP A;  1WRD B;  5KHQ A;  1SF0 A;  2IBI B;  4JX1 C;  2GRI A;  1FMA D;  4KDI C;  1E7P B;  1E8Y A;  1WX8 A;  3VTV A;  2XNA C;  4RMA A;  2VZK B;  4L1B A;  1IYF A;  2KJ6 A;  4WAF A;  1WX7 A;  1J0G A;  2WXM A;  3QA8 A;  2NMQ A;  4KZ0 A;  2L3Z A;  1TIF A;  3A33 B;  2AQ3 B;  2WYQ A;  1TY2 A;  4XYC A;  1E8Z A;  4ANX A;  5BMG A;  2K6D B;  1WXS A;  2OED A;  3GP7 A;  4WUR A;  1E8X A;  1V1P A;  2L83 A;  4BKT A;  3PS6 A;  3IXS A;  4KIK A;  1T0S C;  3QC8 B;  2K8B A;  2A4Z A;  5JZE B;  2WGS A;  3T3O A;  2BGF A;  4C4V B;  1SE3 A;  1C1Y B;  5FKA C;  1JWM D;  2DZJ A;  2JT4 B;  2IGD A;  3DCG A;  3ZGZ A;  1NEN B;  3OAW A;  4HCN B;  2NVU I;  2JU6 X;  3BVG A;  1YOV B;  1YMH E;  3UQB A;  3Q8A A;  2YEP B;  4NPN A;  2CKH B;  2LHE A;  3PTF C;  4R3D A;  1ZP0 B;  2JQR B;  2XN9 C;  2C7H A;  1YNT E;  4EE2 A;  2V1Y A;  2PVO D;  3EFU A;  3SFD B;  2V3S A;  2C7M B;  3N30 A;  4CYE A;  4HPL B;  1WY8 A;  2ZVO A;  2LEK A;  3WA0 A;  4TQ0 A;  1KOT A;  2KDE B;  3VFK A;  1B9R A;  3JW0 X;  2IY1 B;  4LNK A;  2WWZ A;  3RD2 A;  3BVM A;  2IO0 B;  1QF6 A;  1VDV A;  1PQS A;  4X57 B;  2PTL A;  2A5U A;  1V6E A;  4HCP B;  5C1Z A;  2R61 A;  4XZ4 A;  5CX3 A;  4GOC A;  1EWC A;  4DWF A;  2KQ7 A;  2J0M A;  4K7U A;  3WIM A;  4FAD A;  3WCQ A;  2Y5C A;  1L5P A;  2MBB B;  1IBX B;  1JWS D;  3CST A;  1PDX A;  1Y56 A;  3KUC B;  3MC0 B;  1FPY A;  4HKZ E;  4GXB A;  2QC8 A;  1XLP A;  3DHG C;  4HPM B;  4DQO C;  1XXG A;  1V2Y A;  2WDR B;  1WYW B;  1V49 A;  2D3B A;  4YSX B;  2W54 A;  1F2R C;  1TS2 A;  4KDL B;  2KTR A;  3OG5 A;  4XC2 A;  3HHM A;  2XK5 A;  1WXM A;  4MGZ E;  3P4P B;  1MG4 A;  1I4R A;  2KQS A;  3NVW A;  2JSV X;  3PZD A;  2KT7 A;  4ACF A;  1OTR B;  1E7V A;  3N32 A;  5HHD G;  2MJE A;  1KLG D;  2JRI B;  3TIX A;  3Q3J A;  4RGM A;  4I6L B;  3SDL C;  3W5U B;  2I38 A;  1P7E A;  1WMH A;  3GE8 C;  1OGW A;  1WGK A;  2CU3 A;  3ABV B;  3ZW3 A;  5IO9 A;  4WAA A;  3BYT B;  3KWL A;  5HI1 A;  2BPS A;  1OQQ A;  4M02 A;  4CO7 A;  4WH4 A;  4ANW A;  3AE5 B;  5G5H A;  3ALB A;  2DX5 B;  2GBM A;  2RGF A;  3VUW A;  2HE7 A;  1Y8R C;  4TQ1 A;  3VH3 B;  2N9L A;  2C9W B;  4GU2 A;  2BYV E;  1T0Y A;  3APF A;  2DBY A;  2RD0 A;  3L17 A;  2KAJ A;  2JUO A;  4E71 A;  2ZVN A;  1UGM A;  2VZK D;  3SR6 A;  1X1M A;  1KRH A;  3PLV A;  2LVO A;  4M0W B;  1FD6 A;  1WE7 A;  2JYE A;  1E6E B;  2IZV B;  2K1F A;  2BYF A;  1ESF A;  4BVU C;  4II3 B;  4OZB A;  3VDZ A;  3ZRF A;  5J2R A;  2DZM A;  4RH6 A;  4FUL A;  3S2A A;  1UBQ A;  1UGJ A;  2JYT A;  1FIQ A;  1VR9 A;  3MTN B;  5LXH A;  1YD8 U;  2M8S A;  3B9J A;  4W9I A;  4GN1 A;  1WGD A;  4K7W A;  1N61 A;  2BS2 B;  3B1L X;  1V8C A;  3ONS A;  2BF8 B;  3RZF A;  5LLI A;  2PKO A;  1WI0 A;  1FXT B;  2BKF A;  3W5V B;  2RDB C;  4AJY B;  3AEC B;  2FCN A;  4L2Y A;  2LMC A;  2WHI A;  4HLE A;  4LJO B;  5C23 A;  2MP2 B;  3MHZ A;  4TUU A;  2MCN B;  3B2F A;  3T9L A;  4LDT D;  2M19 A;  2ICI A;  2J42 A;  1JML A;  2RDG A;  2WU2 B;  2V0G A;  1QKZ A;  2RDH A;  1ROE A;  3JVZ X;  5C2T B;  1LM8 B;  4C4V A;  1C9F A;  2NTS A;  3R8B A;  2NTT A;  3IAM 1;  2CU1 A;  5DPT A;  2LGY A;  4IM3 A;  3C19 A;  2CJO A;  3DWM A;  3RNB C;  3H7P B;  1MVK A;  3EC8 A;  3RUL A;  1TS5 A;  2GOW A;  3PRZ A;  1J7A A;  2Y3A A;  4LNO A;  4AWJ A;  3QAR A;  4JIO U;  5AEK B;  3WAP A;  4OVZ A;  5D94 A;  4BOZ B;  1WX9 A;  2KMA A;  5T8I A;  1R4M B;  3U30 A;  3EA6 A;  3N1Y C;  2VRR B;  2WXJ A;  1YN5 A;  1J19 A;  2EMS A;  4K1R B;  5EE3 A;  1NI2 A;  3NZS A;  2LI5 A;  2EKI A;  3IG3 A;  1R7S A;  1V5O A;  4F8C B;  1TZO A;  4US9 A;  4W9J A;  1IUE A;  4JGH B;  1P1A A;  4RM9 A;  1VD2 A;  1YIW A;  3DVG X;  2KAN A;  3RNF C;  5HKH A;  4PS8 A;  3ZLZ A;  4WIP A;  4W9D A;  3ZXV A;  3ML8 A;  1Z2M A;  3DQV A;  1J7C A;  2NBV B;  3UIP B;  1MPE A;  2LXA A;  2OHF A;  3KH0 A;  1PGX A;  4N6E B;  3PLU A;  2AEH A;  2K25 A;  2KWV B;  3A9J A;  4GLS C;  1FXA A;  3NUH B;  4C56 C;  2ZW0 A;  2RPQ A;  2ZPN A;  3AE3 B;  5IOI A;  3DBL B;  2LGX A;  4OZC A;  3ZIM A;  3AE2 B;  3KWV A;  5D7G A;  1WGG A;  4W9L A;  1ZUD 2;  1UZX B;  4YTM B;  2Q5W D;  5EDS A;  4C7Z A;  4KKI A;  4K81 A;  4HKQ A;  2N7D A;  4WWO A;  3SEB A;  2C5L C;  1TS3 A;  2Z0E B;  1I4Q A;  4NAM A;  2L32 A;  2N9E B;  3M95 A;  4BAX A;  3KQ4 A;  2KTR B;  2GBK A;  2KKC A;  4HJG E;  1WXQ A;  1C4A A;  2MBE A;  1WR6 E;  1F0Z A;  2G4D B;  1V80 A;  1WR1 A;  2HTM E;  3X23 A;  3MP9 A;  3LJ3 A;  4HRO A;  3AB5 A;  4FLH A;  2ZCB A;  1QT9 A;  3PHX B;  3KUD B;  1JQ4 A;  3ZO5 B;  3L13 A;  2UU7 A;  3AV8 A;  3BII D;  3KW5 B;  4A90 A;  1AW7 A;  4NNJ B;  3Q8B A;  1GNU A;  2N9K A;  2O6V A;  2QCZ A;  2YLM A;  1P7F A;  1P3Q U;  2DYM A;  1VJK A;  1V1P B;  3QAQ A;  3RZW C;  1IP9 A;  1EF1 A;  5EE9 A;  3PZ8 A;  2WDV B;  4ZDV A;  3B0A A;  3QHT A;  5LXI B;  3IBE A;  5BO4 B;  2KMC A;  4KX6 B;  4S17 A;  3L08 A;  1SXT A;  3A9J B;  5AZF A;  4IG7 B;  3R2I A;  4IWO A;  3A1Q A;  3ZJV A;  2QJL A;  4FN2 A;  2KYW A;  4KGT A;  4RM8 A;  3LDZ E;  3ZXR A;  2D10 A;  3PHW B;  2D11 A;  2KZR A;  2D07 B;  5BMI A;  4WJQ A;  1WE6 A;  2ACZ B;  1LXD A;  1N5W A;  4OW0 A;  1C78 A;  2GBR A;  1CMX B;  4REZ A;  2L1A A;  2DWQ A;  1RAX A;  1NDD A;  1T6B X;  2KWU B;  2KN5 A;  1BXT A;  2JPH A;  1ZPS A;  3W9C B;  2AX5 A;  2IO2 B;  2AWT A;  1SSN A;  2N7J A;  1ISN A;  3AU5 A;  4M0W A;  2DZI A;  3ZYY X;  4BKG A;  2QDF A;  1Q1O A;  2KJR A;  1DGJ A;  2WXO A;  1EUV B;  1TS4 A;  3RMK C;  2JZ3 B;  4HK2 A;  3H1U A;  2J52 A;  1SEB D;  1V86 A;  5H8Y E;  2K0P A;  4LNF A;  3AEA B;  1F2R I;  4GDK A;  4C80 A;  1D6E C;  4DHZ B;  1IGC A;  5E6J A;  4NY0 A;  1YX6 B;  1UWM A;  5L95 C;  1WRI A;  1Q5W B;  2OJR A;  3ZJU A;  3P4Q B;  3QCA A;  4YXD B;  5DPS A;  3VVW B;  2CJN A;  1KM7 A;  2M17 A;  3FIL B;  1TGZ B;  1MG8 A;  4BFR A;  1N63 A;  2BS4 B;  2DAJ A;  1KLV A;  1MJD A;  1I42 A;  1LFD A;  1JAL A;  3AE1 B;  1YQB A;  1ZE3 D;  1FNV A;  3PZ7 A;  3Q2A C;  2IJ0 A;  1E9M A;  3RCZ A;  5TR5 A;  3R7R A;  3AXC A;  2FBW B;  1FM0 D;  2KNB A;  2JVC A;  4B0M A;  2PE6 B;  1DOY A;  2KD0 A;  2MHJ A;  1E90 A;  4RGT A;  5D3D A;  3V6E B;  2MX2 A;  1D5M C;  3A9K A;  3H9D A;  2BVC A;  2HD5 B;  4YTP B;  3TEZ A;  4DHJ D;  1WJ6 A;  3VRA B;  4ANV A;  3TEW A;  3BZD B;  4KKJ A;  4B0E A;  3U8Z A;  2WXL A;  4MEM A;  1UF0 A;  4W9C A;  1FFU A;  1AWD A;  2IO3 B;  2R2O A;  4MH8 A;  1D4B A;  4EFO A;  4NZL B;  1DOI A;  2FE8 A;  4C7Y A;  2SAK A;  4HWI B;  2ZNV C;  4MGY E;  3BK2 A;  2L76 A;  2M4N A;  1LGR A;  2NBW B;  1T5X D;  4ZHP A;  4AQ7 A;  2MBH A;  3N1Z C;  3V60 A;  2N0S B;  1WGH A;  1JWU D;  3RN9 C;  3Q8C A;  5IAA C;  2DZK A;  1KF6 B;  1GG3 A;  4JWS C;  1QOF A;  1PFD A;  1FRD A;  2MSE D;  2IY0 B;  3PRP B;  2UWQ A;  3GZN I;  2K22 A;  3ZDM C;  2DNF A;  2AQ1 B;  3V3X A;  2NBU A;  1UUP A;  3QK0 A;  3AE9 B;  3DBL I;  4A20 A;  3NZU A;  4GB9 A;  5IP4 D;  3E56 A;  4P7I A;  1TYG B;  1KFY B;  2KDB A;  3OWE B;  4RFB A;  2H89 B;  4ZRK A;  4IW0 A;  3ZNI D;  3MJ5 A;  4FA6 A;  4BBN C;  3RNA C;  3WAO A;  4J6I A;  2I1J A;  1RFA A;  3M63 B;  1K50 A;  3NOB A;  5DPW A;  2YVC A;  2J0J A;  3N9Y C;  2KO3 A;  1TT5 B;  2GI9 A;  3MC9 A;  4P1C C;  5AUK A;  4D2K A;  3CF6 E;  1NYR A;  2HTH A;  3L54 A;  5E6O A;  3P4R B;  3MJW A;  2QHO A;  2HJ1 A;  2IYD B;  2LGD A;  2CS4 A;  3GB1 A;  4F1S A;  5GXG B;  4JL9 A;  3T8M A;  3AMZ A;  4EUT A;  4AS1 A;  1HQR D;  4K3B A;  1NVI D;  4NJC A;  1R4M I;  1E10 A;  2WDQ B;  3V61 A;  2ASQ A;  3M62 B;  4PT5 A;  1ZKH A;  3DHI C;  4KZC A;  3VAW A;  2DAF A;  2BYT A;  2PVG C;  4LJP B;  1WJ4 A;  4DBG A;  4KVG B;  4NAW A;  4FBJ B;  3U52 E;  5AUI A;  2WXN A;  2LAS A;  3HM3 A;  2O6V B;  4HDO A;  4DXF A;  2XK5 B;  1N60 A;  2D2Q A;  4P1B C;  2WNM A;  2W9N A;  2L0T A;  5J17 A;  1L0X B;  3R2T A;  4AP4 C;  3DOW A;  2IGG A;  1L6U A;  3UIO B;  4TMA B;  2INC C;  2WXQ A;  2M56 B;  4MGK E;  3AEE B;  1GOZ A;  5FR6 A;  3R66 C;  2GBN A;  1D5X C;  4DXG A;  1PGB A;  3NVY A;  2LVP A;  3PT2 B;  3ZNG C;  3NY5 A;  3RFZ B;  1ZDV A;  4ZHO A;  1FO4 A;  2KFK B;  4RF0 A;  5G2N A;  1ZOY B;  2VH2 A;  4G0N B;  2KC2 A;  1U4A A;  2RSU A;  1SE9 A;  4ARC A;  3FKY A;  2JXT A;  2X38 A;  4I6N B;  4XWW A;  1JRO A;  2L8J A;  1IGD A;  2LD9 A;  3OLM D;  3DBR B;  1FCC C;  1K53 A;  3PRM B;  2KJH B;  2PEA A;  1V9J A;  3TUO A;  4KGS A;  4PS7 A;  3K9O B;  3P4S B;  1OEY J;  2G4S A;  5D3I B;  1AYF A;  1BUI C;  3T3N A;  3IFW B;  4HPP A;  4GDK B;  1XCT L;  2ZCC A;  4ZOH C;  4ZRQ A;  4BKS D;  1TJE A;  4ZRJ A;  3QIJ A;  1SIJ A;  2N9X A;  2PLP A;  2LJI A;  4IDI A;  5IN7 A;  4CHK A;  2BB5 A;  3ZDT A;  2G1E A;  4FJV B;  1OFF A;  2KN4 A;  1RYJ A;  2INP E;  4KSL C;  3R3M A;  1XD3 B;  4XDD A;  3PVL A;  3ZTC A;  3JSV B;  4E74 A;  1ZXI A;  3H6N A;  4EZL A;  2X8X X;  1JRU A;  1WXA A;  2LJ5 A;  5G5G A;  1I35 A;  1WGR A;  4DDG D;  4C00 A;  2FIF A;  1TKG A;  1RRB A;  1WH3 A;  2KC1 A;  2MBQ A;  3VHT C;  4II2 B;  3W1S C;  3N1X C;  1QLB B;  1CQV A;  1LQB A;  3DDC B;  5E6N A;  3URY A;  4JPS A;  4W9H A;  1GAQ B;  2MA9 B;  4ZRI A;  1FRR A;  3P42 A;  4K3C A;  3Q6B A;  5HFY A;  3W2D A;  3NZ3 A;  1KTK A;  3LB8 C;  3OJ3 A;  4IM2 A;  5BYS A;  3UGB B;  3APC A;  1A70 A;  2D3A A;  2KMM A;  3IVF A;  4MH0 E;  4LLG M;  4JQW C;  3V62 A;  4DHJ B;  3Q8E A;  1WIA A;  2BBC A;  2BKR B;  2LHD A;  3TSS A;  3AUL A;  1YN4 A;  4K7S A;  2WQY B;  1XEE A;  2RR9 A;  4YSZ B;  1QOG A;  3NRZ A;  1D5Z C;  1JWB D;  2BW2 A;  3BYY B;  2KWC A;  1M94 A;  1MI0 A;  1YQ3 B;  2IDY A;  4OHJ A;  3WAN A;  3NS1 A;  3APD A;  1E8W A;  2MRP A;  5AZG A;  1HA5 A;  1SGH A;  2JF5 A;  3AEG B;  5GMV A;  3ECI A;  3AH7 A;  3M3J A;  4XX5 A;  4HJK A;  2R2Q A;  2ZW1 A;  2KOX A;  2V9H A;  3O65 B;  1QOA A;  2MJD A;  5IA7 A;  2KDM A;  1L0V B;  2I2Y A;  2V3P A;  4HXD A;  2GMI C;  5JXV A;  4XE0 A;  2QEJ C;  4RGN A;  4EOY A;  1G6J A;  2Z0D B;  2CR5 A;  3Q3M C;  3UIN B;  1UH6 A;  2BWE S;  3KYC D;  2JRH A;  4WJP A;  4RF1 A;  1XO3 A;  2V4L A;  4MSM B;  2WXP A;  4MGI E;  2FNJ B;  3EUB 2;  3MFG A;  1WJU A;  3LXF A;  2BT6 A;  3U7Z A;  2FAZ A;  4PK1 A;  4ZYS A;  4YT0 B;  4XWT A;  1WJN A;  2J0K A;  4HEA 1;  1D3Z A;  3AEF B;  3ZJT A;  2PIA A;  1YQ4 B;  4B9K A;  4EZJ A;  4BZA A;  3JSV A;  5EE0 A;  2J7Q B;  2AQ2 B;  4IC7 B;  3DBS A;  3DVN U;  2KDF B;  1FXI A;  4GMV A;  4W9K A;  3RNG C;  3AE8 B;  3BWU D;  4G11 A;  1OQY A;  1RFK A;  1WFY A;  2WXR A;  1J7B A;  1WWT A;  3U4E G;  4A6Q A;  3QQ8 B;  4FXC A;  3UQA A;  3L10 B;  3I5J C;  3N20 C;  2M1M A;  3AU4 A;  2N1V A;  5FR3 A;  1UEL A;  1EWY C;  2PMV A;  4PYZ A;  1V81 A;  2DHZ A;  3EEC A;  2JWZ A;  4M8N A;  3GE3 C;  3UI3 A;  2NCN A;  4KIK B;  5IKC M;  3TBL D;  1IPG A;  3ZRC A;  3WAM A;  4B95 A;  2EEL A;  1VCB A;  4MSQ B;  2LZ6 A;  2KVZ A;  1DYQ A;  3RYT A;  3KVF B;  1C4P A;  1RWS A;  2WX0 A;  2VH1 A;  4AOF A;  3VH4 B;  1RLF A;  1MHH E;  4WJN A;  2I1K A;  2LRW A;  2KQ4 X;  2G9H D;  3ZTD A;  2EKE C;  1ET9 A;  1F77 A;  4RCO A;  1XT9 B;  1RM6 C;  1K52 A;  1UNS A;  2QMT A;  2AL3 A;  2KWD A;  3PPA A;  4EEW A;  4USA A;  4BKS A;  3DBH B;  2PW9 A;  4N59 A;  1XF5 L;  1PYW D;  2Z8L A;  1Q10 A;  1WZ0 A;  3UF8 A;  3NHE B;  2QIL A;  4MAC A;  1QQR A;  2LUE A;  2NR2 A;  4DHZ E;  1IBX A;  1R4N B;  2WX1 A;  2KLC A;  1E7U A;  2K9X A;  3I3T B;  2D3C A;  3ZKJ C;  4DDI D;  2RPV A;  3Q14 C;  1C79 A;  4ZYN A;  4MJS B;  4P16 A;  3ETR A;  3Q69 A;  1UBI A;  2OJW A;  3L0W B;  2QIE B;  1NI3 A;  2MEK A;  3PO0 A;  2FCS A;  4TKN A;  1GC6 A;  2LGS A;  1SB3 C;  1JRP A;  2NPT A;  4E3C A;  3KYD D;  3RUI B;  1P0R A;  1I4X A;  1ET6 A;  2ZEQ A;  4FJY A;  2UYZ B;  2MLB A;  2L00 B;  2TSS A;  3J9C A;  2WXF A;  3E9S A;  1DOX A;  3B08 A;  1F52 A;  2N1W A;  4KSK C;  4GIV A;  2INN E;  4WWM A;  2N4F A;  4A3P A;  2ZNV B;  1TZ1 A;  3ENE A;  2XEW A;  1XLO A;  2LVQ A;  4M00 A;  1BML C;  3LYY A;  4NAW B;  1HTQ A;  1WZ3 A;  1K51 A;  1CK1 A;  3TEX A;  1NBF C;  1PGA A;  2WP9 B;  4JE3 B;  3FAH A;  2WS3 B;  4OZA A;  2D3G A;  1C77 A;  4A9A A;  1KLU D;  3D32 A;  4GDL B;  3PGE A;  5JH5 C;  4NJ7 A;  2ZZP B;  1ACC A;  3CWI A;  3AE4 B;  5CHF A;  1CZP A;  5CHW A;  3OJ4 B;  4OVU A;  5C3J B;  1KJT A;  5CTR C;  2JXX A;  1TKY A;  2LGI A;  2QSD A;  1GPX A;  3P1M A;  4WWN A;  4P6V F;  2HJ8 A;  3Q8F A;  3P2B A;  1XCQ L;  4XDC A;  2ZPY A;  4LNN A;  3CIR B;  4MM3 A;  2L7R A;  4RGO S;  3VR9 B;  2WXG A;  2PE9 A;  4NJ6 A;  4WQO B;  3ZUN A;  2WDT B;  4A55 A;  2XBB C;  3A9K B;  4HRS A;  3Q3F A;  1T0Q C;  2HDE A;  5AZH A;  1SIF A;  2FCM A;  2LWP A;  4URK A;  3QWZ B;  4JWU C;  1ZXH A;  2ZJD A;  4MDK E;  4B6W A;  1J8C A;  2MQJ A;  3VTU A;  1XLQ A;  2NPT B;  4YWG G;  3ZVV A;  3IT4 B;  3MC8 A;  4Q2J A;  4QAY A;  2G3Q B;  1VZ6 A;  3U2S C;  5D2M B;  2WXH A;  1C76 A;  4DK5 A;  2ON8 A;  2J53 A;  2KDI A;  1L0Y B;  2K39 A;  3I9V 1;  1N62 A;  2LUM A;  1L6V A;  1WXV A;  3SU8 X;  2CHZ A;  4DXA B;  3V05 A;  1EF5 A;  1NYQ A;  5MPO A;  2MBO A;  1A5R A;  1L7Y A;  5DCN A;  5J18 A;  4M01 A;  3ZNZ B;  1C3T A;  4WQM A;  5I4D A;  2C7N B;  2BQQ A;  3PV1 A;  2KHW B;  1P98 A;  1TTN A;  3HUI A;  1FNW A;  3DPD A;  3FC4 A;  4PS3 A;  5EE1 A;  2IND C;  1JCK B;  4IKG A;  4ICV A;  2N7E A;  1AAR A;  2O2V A;  4I6P A;  2W3S A;  2MJ3 A;  3IHP C;  3NJT A;  4MJS A;  2MP2 A;  3AE7 B;  2GBJ A;  3SFE B;  2RMM A;  4GSW A;  1HTO A;  4LCD E;  2L05 A;  2B76 B;  3RNC C;  1EU4 A;  3U7D A;  4BBN F;  3VQI A;  5FK9 C;  1SJH D;  4GGQ A;  1V5T A;  4RNA A;  1HXY D;  3RNE C;  3GS2 A;  3NVZ A;  5KHO A;  1L2N A;  2D5G A;  3EGR A;  2BS3 B;  3AM9 A;  3HK0 A;  1OEY A;  2AL6 A;  1WM2 A;  3P63 A;  1T3Q A;  1PUT A;  4A3O A;  4BOS C;  3ZQ4 A;  2JX5 A;  3B2G A;  1YJ1 A;  1P9D U;  1GC7 A;  2K6Q A;  2NS5 A;  4N58 A;  1TBE A;  1R4N I;  3I57 A;  3KUZ A;  1GUA B;  2L52 A;  2MW5 A;  2E6X A;  3RPF C;  4S0R A;  5BMH A;  2W55 A;  3RT3 B;  3DBH I;  2K8C A;  1E0Z A;  1H8C A;  4GDL A;  1NEK B;  2OOB B;  4FJZ A;  5LNK 1;  3H8H A;  3HVD A;  4FHK A;  1UWX A;  3NVV A;  2BYE A;  5CHV C;  3W1S A;  3X0W A;  2JY6 A;  3O13 A;  2K3U A;  3A1Q B;  4A8X C;  1GB4 A;  3DBR I;  4G3X B;  1SE4 A;  5BYQ A;  4O1N A;  4YTN B;  1MHX A;  1FNU A;  3IAS 1;  1I4P A;  4ANU A;  2PPH A;  3TCA A;  1SE2 A;  4CQN A;  3A4R A;  4TV3 A;  4W9E A;  2DEN B;  4LK0 M;  3C8Y A;  4ICU A;  4EKU A;  4UDU C;  4TSS A;  2LXC A;  4W9G A;  4YSY B;  2Y5P A;  2BWF A;  1YX5 B;  4YL8 A;  4IM0 A;  4ZRP A;  2KX3 A;  1QOB A;  2H88 B;  2G45 B;  1BT0 A;  4LDT B;  3IT6 B;  4XGA B;  3CMM B;  4HVB A;  2KVR A;  1CJE A;  1H4R A;  3BK1 A;  1S3S G;  3DVG Y;  2KK8 A;  2MH7 A;  3AI5 A;  4G50 A;  4KV2 A;  1JW9 D;  2WXI A;  2KFJ A;  2W82 A;  2L0F A;  2Z59 B;  5JHA A;  1QIL A;  4WJO A;  4JLC A;  3W1Y A;  3PRE A;  4KGR A;  2IO1 B;  2JZP A;  2KAC A;  1K8R B;  3BVZ A;  3BY4 B;  2ONQ A;  1JWA D;  3DHH C;  1B1Z A;  1ZDX A;  3A4S C;  2IGH A;  1WF9 A;  2E3T A;  3VR8 B;  2J4X A;  1AN8 A;  2CHX A;  2LRU A;  1L4Z B;  3Q3O C;  1SBB B;  4IWQ A;  1EM7 A;  4ARI A;  2DYB A;  3H7P A;  2B3A A;  2V3N A;  1I4H A;  1M4V A;  3I63 C;  4IOI E;  4FHJ A;  1I4G A;  2C60 A;  3VUY A;  1GB1 A;  1XQQ A;  2KFK A;  1L4D B;  2O6V D;  2EMT A;  5E6P A;  3TEY A;  2M0X A;  5D6J B;  1N5X A;  2MWS B;  1C4C A;  2KX0 A;  1TKE A;  4EZK A;  1FCL A;  3VXW A;  1GJZ A;  1SJE D;  2GB1 A;  4MM3 B;  3BIN A;  1STE A;  1ZW7 A;  1V1O A;  3EFC A;  4WWP A;  5JHB A;  4M8M A;  1KH0 A;  2PJH A;  1WGY A;  3CSF A;  1VLB A;  3L4P A;  3PSE B;  2DYO A;  2SEB D;  1OQR A; 
#chains in the Genus database with same CATH homology
 3AEB B;  5BYR A;  3B9J A;  3E56 A;  1HEZ E;  4USA A;  3AED B;  1TYG B;  1KFY B;  3OWE B;  4RFB A;  2H89 B;  2PW9 A;  1N61 A;  2BS2 B;  2FUG 1;  4N59 A;  1XF5 L;  1PYW D;  3MJ5 A;  4J3O D;  2WLB A;  2Z8L A;  1Q10 A;  2V4I B;  1V8C A;  2QIL A;  4MAC A;  1QQR A;  1K50 A;  1IBX A;  2PKO A;  1FFV A;  2IPK D;  3N9Y C;  2K9X A;  3W5V B;  2GI9 A;  3AEC B;  2DLB A;  4L2Y A;  2LMC A;  2RPV A;  5AUK A;  4D2K A;  1C79 A;  1NYR A;  4P16 A;  3ETR A;  3Q69 A;  3P4R B;  2WXK A;  2QIE B;  1NI3 A;  1YJI A;  2MEK A;  3PO0 A;  1XLN A;  3MHZ A;  5H92 C;  3GB1 A;  5GXG B;  1SB3 C;  1JRP A;  1VZ8 A;  3B2F A;  2M19 A;  1I4X A;  2ICI A;  2J42 A;  1JML A;  2RDG A;  1ET6 A;  3AMZ A;  2WU2 B;  2V0G A;  4MT5 A;  4AS1 A;  1ENF A;  1HQR D;  1QKZ A;  2RDH A;  1ROE A;  3DWG C;  1NVI D;  4NJC A;  2TSS A;  3J9C A;  2WXF A;  1E10 A;  2WDQ B;  3E9S A;  1DOX A;  5C2T B;  4PT5 A;  3FIL A;  2INN E;  4WWM A;  1C9F A;  2NTS A;  1LO5 D;  2BYT A;  2PVG C;  3R8B A;  2NTT A;  1EU3 A;  2JWU A;  3HVZ A;  3IAM 1;  1XLO A;  3U52 E;  1VRA B;  5AUI A;  1BML C;  2CJO A;  2WXN A;  3LYY A;  3DWM A;  4NAW B;  1K51 A;  1WSP A;  1HZ6 A;  3VRB B;  1CK1 A;  1MVK A;  3TEX A;  1PGA A;  4ITK A;  2WP9 B;  4JE3 B;  1TS5 A;  4DXF A;  3FAH A;  2WS3 B;  4OZA A;  1J7A A;  2Y3A A;  1N60 A;  1C77 A;  5HG2 A;  4A9A A;  2W3R A;  1KLU D;  4OVZ A;  2WNM A;  4GDL B;  2LFI A;  1L0X B;  3R2T A;  2WU5 B;  2IGG A;  1ACC A;  1L6U A;  3CWI A;  3AE4 B;  4H2A A;  5T8I A;  1CZP A;  2YEP F;  3EA6 A;  2WXJ A;  1YN5 A;  4TMA B;  5C3J B;  2WXQ A;  5EE3 A;  4LTU A;  4US8 A;  2K5P A;  2BTE A;  1TKY A;  2LGI A;  2EKI A;  2QSD A;  1GPX A;  3P1M A;  4P6V F;  1R7S A;  3Q8F A;  2BB6 A;  2M56 B;  1TZO A;  3HRD D;  3AEE B;  1GOZ A;  1VZ7 A;  1XCQ L;  4XDC A;  4US9 A;  1TY0 A;  1WYG A;  3CIR B;  1IUE A;  4DXG A;  1D5X C;  5TSS A;  1HZ5 A;  1PGB A;  3NVY A;  4RGO S;  3VR9 B;  1I7H A;  3AE6 B;  1YJJ A;  2WXG A;  3RFZ B;  1V97 A;  1ZDV A;  4L23 A;  4A55 A;  4ZHO A;  1FO4 A;  4RF0 A;  2M0A A;  1YN3 A;  1FEH A;  4HRS A;  3KLS X;  2HDE A;  4WIP A;  3AN1 A;  4JWU C;  1ZOY B;  1ZXH A;  1SF0 A;  4JX1 C;  1J7C A;  1MPE A;  2GRI A;  1FMA D;  1E7P B;  2OHF A;  4ARC A;  1XLQ A;  1PGX A;  4N6E B;  2JXT A;  2X38 A;  2XNA C;  4YWG G;  2VZK B;  3IT4 B;  4L1B A;  4XWW A;  1JRO A;  4GLS C;  4Q2J A;  1FXA A;  3NUH B;  1IGD A;  4C56 C;  1VZ6 A;  4WAF A;  1FCC C;  1K53 A;  2ZW0 A;  2WXM A;  3U2S C;  2WXH A;  1C76 A;  3AE3 B;  2NMQ A;  4OZC A;  3TUO A;  2AQ3 B;  3AE2 B;  2ON8 A;  2J53 A;  1TY2 A;  3KWV A;  1ZUD 2;  4KGS A;  5D7G A;  3P4S B;  1L0Y B;  3I9V 1;  4YTM B;  1N62 A;  5D3I B;  5BMG A;  1AYF A;  1BUI C;  2Q5W D;  2LUM A;  3T3N A;  4C7Z A;  4KKI A;  2OED A;  3GP7 A;  1L6V A;  4GDK B;  1XCT L;  4WUR A;  4ZOH C;  4ZRQ A;  4HKQ A;  3SEB A;  1TJE A;  3V05 A;  1SIJ A;  1V1P A;  2L83 A;  1NYQ A;  5MPO A;  1TS3 A;  3IXS A;  1I4Q A;  4NAM A;  2PLP A;  2LJI A;  4IDI A;  2L32 A;  4WQM A;  5I4D A;  2BB5 A;  3KQ4 A;  2G1E A;  3T3O A;  1OFF A;  2KN4 A;  1RYJ A;  4HJG E;  2INP E;  1C4A A;  1WXQ A;  1SE3 A;  1F0Z A;  3HUI A;  1FNW A;  4XDD A;  3FC4 A;  5EE1 A;  5FKA C;  2HTM E;  1JCK B;  4IKG A;  1JWM D;  3MP9 A;  4HRO A;  2IGD A;  3AB5 A;  1QT9 A;  2W3S A;  1ZXI A;  2MJ3 A;  1JQ4 A;  3ZGZ A;  1NEN B;  2JU6 X;  3BVG A;  3AE7 B;  1YMH E;  3AV8 A;  3Q8A A;  2YEP B;  5G5G A;  3SFE B;  2RMM A;  2LHE A;  3BII D;  4R3D A;  2B76 B;  1ZP0 B;  2JQR B;  4A90 A;  1AW7 A;  2XN9 C;  1TKG A;  1EU4 A;  3Q8B A;  2N9K A;  1YNT E;  3VQI A;  4EE2 A;  5FK9 C;  1SJH D;  2PVO D;  4RNA A;  1QLB B;  3SFD B;  1HXY D;  1CQV A;  1P7F A;  2DYM A;  1VJK A;  3GS2 A;  1V1P B;  3NVZ A;  3URY A;  2D5G A;  3EGR A;  4JPS A;  1GAQ B;  2LEK A;  2BS3 B;  3AM9 A;  4TQ0 A;  1FRR A;  5EE9 A;  3P63 A;  3P42 A;  3PZ8 A;  2WDV B;  1B9R A;  1T3Q A;  1PUT A;  3ZQ4 A;  2JX5 A;  3B2G A;  4KX6 B;  5HFY A;  1SXT A;  3W2D A;  4N58 A;  3I57 A;  3NZ3 A;  1KTK A;  3LB8 C;  3R2I A;  3ZJV A;  5BYS A;  2QJL A;  4KGT A;  2L52 A;  1A70 A;  2E6X A;  3RPF C;  3BVM A;  5BMH A;  2W55 A;  1QF6 A;  1VDV A;  2PTL A;  2KMM A;  4LLG M;  5BMI A;  2R61 A;  3Q8E A;  1E0Z A;  2ACZ B;  1N5W A;  4OW0 A;  1C78 A;  1EWC A;  2BBC A;  2LHD A;  3TSS A;  1NEK B;  5LNK 1;  4REZ A;  2L1A A;  2DWQ A;  3H8H A;  1YN4 A;  3HVD A;  3WCQ A;  2WQY B;  1UWX A;  1T6B X;  1XEE A;  2Y5C A;  3NVV A;  1L5P A;  1BXT A;  4YSZ B;  1ZPS A;  3W9C B;  1IBX B;  1QOG A;  2AX5 A;  1D5Z C;  3NRZ A;  1JWS D;  1JWB D;  1PDX A;  1SSN A;  2N7J A;  3W1S A;  2BW2 A;  3BYY B;  3O13 A;  1MI0 A;  1Y56 A;  2K3U A;  3MC0 B;  4M0W A;  4A8X C;  1GB4 A;  1YQ3 B;  1SE4 A;  5BYQ A;  3ZYY X;  2IDY A;  4OHJ A;  4O1N A;  4YTN B;  1MHX A;  3NS1 A;  4HKZ E;  1FNU A;  3IAS 1;  1DGJ A;  1XLP A;  2WXO A;  1TS4 A;  1I4P A;  1HA5 A;  4DQO C;  1XXG A;  3AEG B;  2J52 A;  1SEB D;  2WDR B;  3AH7 A;  1SE2 A;  5H8Y E;  4CQN A;  2K0P A;  3AEA B;  1F2R I;  4C80 A;  1D6E C;  2ZW1 A;  1IGC A;  4YSX B;  5E6J A;  2W54 A;  1F2R C;  1TS2 A;  1UWM A;  1WRI A;  4LK0 M;  3ZJU A;  3C8Y A;  1QOA A;  3P4Q B;  2MJD A;  4YXD B;  4UDU C;  2KDM A;  4TSS A;  1L0V B;  2I2Y A;  2CJN A;  3P4P B;  4YSY B;  2Y5P A;  2V3P A;  3FIL B;  1N63 A;  1I4R A;  2BS4 B;  5JXV A;  4XE0 A;  2QEJ C;  4RGN A;  4ZRP A;  3NVW A;  2JSV X;  1JAL A;  3AE1 B;  1ZE3 D;  1QOB A;  2H88 B;  1FNV A;  3PZ7 A;  3IT6 B;  2IJ0 A;  1E9M A;  5HHD G;  1CJE A;  2MJE A;  2FBW B;  1FM0 D;  4RF1 A;  1KLG D;  1XO3 A;  4B0M A;  1DOY A;  3BK1 A;  4RGM A;  2WXP A;  3W5U B;  4RGT A;  2MH7 A;  2I38 A;  1P7E A;  3EUB 2;  3MFG A;  5D3D A;  3U7Z A;  1JW9 D;  2BT6 A;  2WXI A;  3LXF A;  1D5M C;  4ZYS A;  2W82 A;  1WGK A;  4XWT A;  4YT0 B;  1QIL A;  2CU3 A;  4YTP B;  3ABV B;  3TEZ A;  4HEA 1;  4KGR A;  3AEF B;  3ZJT A;  3VRA B;  2JZP A;  2PIA A;  2KAC A;  1YQ4 B;  3BYT B;  3BVZ A;  3KWL A;  2ONQ A;  1JWA D;  1B1Z A;  5HI1 A;  1ZDX A;  5EE0 A;  3TEW A;  3BZD B;  4KKJ A;  2IGH A;  4B0E A;  2E3T A;  3VR8 B;  2WXL A;  1OQQ A;  2AQ2 B;  2J4X A;  1AN8 A;  4WH4 A;  1L4Z B;  1FFU A;  1AWD A;  1FXI A;  1SBB B;  3AE8 B;  4MH8 A;  1D4B A;  3BWU D;  3AE5 B;  1EM7 A;  5G5H A;  4ARI A;  1RFK A;  2V3N A;  1DOI A;  1I4H A;  2FE8 A;  2WXR A;  1M4V A;  2SAK A;  4NZL B;  4C7Y A;  4IOI E;  1J7B A;  1I4G A;  1WWT A;  3U4E G;  4A6Q A;  3BK2 A;  4TQ1 A;  2N9L A;  1GB1 A;  4FXC A;  1L4D B;  1T5X D;  2DBY A;  3TEY A;  4ZHP A;  4AQ7 A;  5FR3 A;  2KAJ A;  1N5X A;  1EWY C;  2PMV A;  2N0S B;  1C4C A;  1TKE A;  2VZK D;  3SR6 A;  1KRH A;  3UI3 A;  1FCL A;  1JWU D;  3Q8C A;  1KF6 B;  1FD6 A;  2EEL A;  2JYE A;  1E6E B;  4JWS C;  1QOF A;  1SJE D;  1PFD A;  2GB1 A;  1DYQ A;  4MM3 B;  1STE A;  1C4P A;  1ESF A;  1V1O A;  1FRD A;  1RWS A;  4OZB A;  4RH6 A;  1MHH E;  1KH0 A;  2K22 A;  1UGJ A;  2JYT A;  1FIQ A;  2KQ4 X;  2G9H D;  1VR9 A;  1VLB A;  2AQ1 B;  3L4P A;  1ET9 A;  1F77 A;  4RCO A;  3V3X A;  1UUP A;  1RM6 C;  2DYO A;  3AE9 B;  1K52 A;  1UNS A;  2QMT A;  2SEB D;  1OQR A;  2KWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...