1UGJA

Solution structure of a murine hypothetical protein from riken cdna 2310057j16
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
141
structure length
141
Chain Sequence
GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2310057J16 protein
publication title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
rcsb
source organism Mus musculus
total genus 15
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08683 CAMSAP_CKK Microtubule-binding calmodulin-regulated spectrin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.360 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ugjA01
1UGJA
chains in the Genus database with same CATH superfamily
2L76A 4LJOB 1MHHE 3RULA 5EE9A 3AE1B 2BS3B 1QQRA 1FNVA 5D94A 2E3TA 2YVCA 2J0KA 3PSEB 2BGFA 1FMAD 1C4CA 2JF5A 3VRAB 4J3OD 3M62B 2H89B 1WJUA 2FIDA 1C79A 3IT4B 4GB9A 4WAFA 4CO7A 2BYEA 3BVMA 2ICIA 1FRRA 2N1WA 4BFRA 2OOBB 4KSKC 3IXSA 4P1CC 2G4SA 3ZNHB 3AEFB 3C0RB 3HHMA 2CS4A 2M19A 4YTPB 4P1BC 4S17A 4ZRIA 1T3QA 1ZXHA 4EKUA 1NYQA 4H2AA 2IO3B 2AL3A 2AL6A 5H92C 4W9HA 1IPGA 1PGAA 3ZIMA 2KMCA 2V3NA 3QQ8B 3ZNZB 3KUCB 3PT2B 2SAKA 3KWVA 2DENB 3U7ZA 3KLSX 3UIOB 2Y5BB 4DXFA 3LB8C 4ARCA 4AUQC 3MP9A 2PLPA 4N9F4 2DHZA 1QOAA 4RGMA 4EZJA 2IO1B 5JZEB 3L13A 1C78A 4ZYNA 2V3SA 1VD2A 1SSNA 1I4QA 1KFYB 3RZFA 2LVQA 1OQYA 1UZXB 2X38A 4LNNA 4AS1A 1WGKA 5DPWA 4RGTA 2PPHA 3P4PB 2NMQA 3UF8A 3AXCA 2JX5A 2N7DA 1QF6A 5LXIB 2V3PA 2BPSA 1HTOA 1L7YA 1VZ6A 4ZRKA 1I4XA 3DVGX 2VH1A 3Q69A 2KN5A 2GMIC 2DZKA 3OJ3A 5FK9C 3JW0X 1XD3B 3R8BA 4P7IA 1NYRA 2YEPB 3AE3B 5JXVA 4NAWB 2KLGA 4EZKA 1WR1A 1ZGUB 2HDEA 2ZVOA 3DBSA 3H6NA 1KF6B 1Q5WB 5BYQA 1SGHA 4BOZB 3KYCD 2C7NB 1I7HA 1YN5A 1EO6A 5L95C 4I6PA 4AJWA 2J52A 3PPAA 2X8XX 2KLCA 1R4NI 3ZTCA 3B08A 2O6VB 1N5WA 2UYZB 2IBIB 1WJ4A 4LK0M 4L1BA 4XZ4A 2OJRA 4NJ6A 5E6NA 4CYEA 1DOYA 3UIPB 2DZIA 4W9DA 4RCOA 2LVPA 1J7BA 2V4LA 1WFYA 1PGXA 2QC8A 2DZMA 4KDLB 2LMCA 3WANA 1P7FA 5AUIA 1V5TA 4URKA 2W9NA 5BMGA 3DHGC 4BOSC 2WP9B 1GG3A 1WRIA 3PHWB 3A1QB 4NY0A 5E6PA 2KANA 3AE7B 3DBRI 4ITKA 4TUUA 3WALA 2WDQB 1EF1A 1UELA 1UBIA 1LM8B 1YQBA 4IOIE 1YMHE 1TKYA 3ZXVA 3VR8B 3APCA 1HZ6A 3N1YC 1NEKB 3RI7C 1FXTB 4WWPA 4WJQA 1V8CA 4HLEA 4EOYA 2NCNA 2JYEA 2KZRA 2CR5A 1SXTA 5GXGB 1V5OA 1P0RA 3EUB2 4KIKA 3TJPA 3S2AA 2QILA 3T8MA 1YD8U 2D3BA 4JWSC 3QAQA 1WGHA 2LUEA 3P1MA 2D07B 3AU5A 2QEJC 4WJPA 3ZO5B 3DWGC 4BKGA 1WXAA 3ETRA 4XE0A 2XN9C 1HE8A 1VLBA 2CJNA 2IY1B 4P16A 2ZVNA 1ZE3D 2RSUA 1JWSD 5H8YE 3RCZA 1SIFA 3MHZA 4A55A 4HDQA 1N5XA 4K3BA 1P9DU 1K51A 2WX0A 1RYJA 2INCC 4C4VB 2QHOA 1CK1A 3VTUA 3UI3A 1HEZE 2KTFA 3V3XA 2JSVX 2MWSB 4LNFA 4GOCA 3VAWA 4I6LB 2K9XA 3X23A 1GNUA 3N9YC 2J42A 3MJWA 4B95A 4MEMA 4HVBA 3FAHA 4RGNA 3Q3OC 3VDZA 2AWTA 2IZVB 5D7GA 2Y5PA 1VR9A 3EHVA 3AULA 4JIOU 4AOFA 1UD7A 1WIAA 2NBUA 3T3OA 3U30A 4C7YA 5G5HA 4M02A 1AWDA 4WIPA 3EGRA 4XGAB 2KDFB 3KVFB 1ZPSA 1OGWA 1UGJA 2NBWB 1XXGA 1S3SG 4DXAB 2RR9A 3A9KB 3AMZA 1XO3A 2PIAA 2EKIA 3B2FA 3QC8B 4MSQB 4EFOA 3TEWA 2WXMA 1MHXA 3SD5A 2B3AA 3H7PB 2KO3A 5BYRA 1WWTA 4AWJA 1FFVA 1TS4A 3HIZA 4USAA 3AEEB 2JU6X 4EEWA 4XX5A 3GS2A 1I4RA 4WJOA 2KDIA 2WXJA 1RLFA 1JWAD 1P1AA 4PS7A 3VTWA 1D6EC 3ZJTA 1BUIC 3ZVVA 1B1ZA 1OTRB 2O2VB 3P4SB 5DPRA 3JSVA 2IGHA 3R66C 1KLGD 3NOBA 3AN1A 3TEZA 2K39A 3IAM1 3H1UA 1ESFA 4E3CA 2HTME 3TIXA 2W55A 3W1SC 2J4XA 2WLBA 2Y3AA 4FULA 1L2NA 1QOGA 3R2TA 2MJEA 3URYA 4B0MA 2D10A 3W5VB 4C00A 5DPTA 3AU4A 1FD6A 3RD2A 1KRHA 2J0MA 2KTRA 1XQQA 2E6XA 4K3CA 2IJ0A 1EU4A 1H8CA 2GBKA 1TS2A 4W9JA 2MRPA 1CZPA 1LFDA 3VQIA 4LDTD 3K9OB 4ZDVA 4O1NA 3BIID 2K8HA 3W1SA 4XYCA 2KFKB 1VZ8A 2JXXA 1V6EA 1I42A 5HFYA 1WJNA 4RF1A 5FKAC 2I38A 4XC2A 2LXCA 3QWZB 3N1XC 4B6WA 2QDFA 4FHKA 4AQ7A 1TKEA 3ML8A 1TS5A 3DBLI 5J17A 1QOBA 4A3PA 4DHJB 1FCCC 1GB4A 1E8WA 2AQ2B 1GC7A 3DVNU 5EDSA 3DOWA 1I4PA 2PMVA 3GZNI 4WWMA 1WYGA 1QKZA 4MJSA 3TMPB 5J18A 1BXTA 3EA6A 4C80A 4M00A 4PS8A 3LYYA 2RMMA 2V4IB 3Q8EA 4REZA 3BZDB 2MBEA 3MHSD 2WDTB 4II2B 1Y8RC 4OVZA 1WX7A 1U4AA 4L23A 4RGOS 3UQAA 2I1KA 4XDDA 1E7VA 3ZNGC 2BT6A 1NDDA 1QZEA 2IGGA 1SE3A 4KDIC 4ACFA 1V2YA 3L54A 1JWMD 4Q2JA 2KQSA 1NI2A 2D5GA 3Q8CA 4ZHPA 2DNFA 2DLBA 4A8XC 4IM3A 3VXWA 5IP4D 2GI9A 2JZPA 1D4BA 2XBBC 3P63A 4OVVA 1YIWA 4JX1C 2KWUB 2WU2B 4ICUA 4N59A 1XLNA 3VRBB 4IWQA 3KWLA 1SE2A 1UH6A 2CJOA 2L00B 4TV3A 1M94A 2KWVB 2RDGA 3L17A 4F7ZA 4DK5A 4I6NB 4OZCA 4TQ0A 4G3XB 4RH6A 2MQJA 2IPKD 4IWPA 4TKNA 3MC8A 4JLCA 2LASA 3CMMB 3QARA 2WYQA 3O65B 1T0SC 4GU2A 1TGZB 3L10B 3ZUNA 4JE3B 1L5PA 3ZJVA 3HRDD 1D5MC 3R2IA 1VZ7A 2ZW0A 4MGIE 5D2MB 3VHTC 2KAJA 2OHFA 4HKZE 1T0YA 5G5GA 2BWFA 2NTSA 4G11A 4ARIA 4MT5A 1TY0A 2VZKD 2ZNVB 3SFEB 1AW7A 4DQOC 5CHVC 4LLGM 2V9HA 2KJ6A 4K1RB 1C4AA 1N63A 4US9A 3W1YA 2OJWA 1TBEA 4C7ZA 2NTTA 3Q2AC 4DWFA 1AYFA 1R4MB 4ZYSA 3N1ZC 1ZP0B 1FO4A 4HWIB 2REXA 1YJIA 1JQ4A 1NVID 3ZRFA 3Q8BA 1ET9A 2IO2B 3NHEB 3PZ7A 3A33B 2D3AA 1OEYA 3TEYA 2MEKA 1HQRD 4BZAA 4YT0B 4MACA 4ASWC 5CX3A 4FLHA 3VH3B 3CWIA 2ZZPB 3NVWA 1SE4A 4S0RA 2J0JA 2NBVB 2NPTB 5TR5A 4OW0A 4DDID 4PYUA 1A5RA 5CHFA 2JUOA 1MI0A 1KJTA 1TY2A 2UU7A 4RMAA 5AZHA 3ZTDA 1YN4A 1TJEA 5AZFA 3W2DA 4OZBA 1LQBA 2J7QB 2JY6A 2K8BA 1Q10A 2MH7A 2N1VA 3QX1A 1J7CA 3AECB 2DYMA 4E74A 2V0GA 1F1HA 5L83A 2PE6B 4LNKA 2L8JA 4KX6B 4M8MA 3ALBA 4NZLB 4ZRJA 1V86A 1HZ5A 1YX5B 4HJGE 1V49A 2WU5B 1WF9A 2XNAC 4HRSA 3EFUA 1L0YB 2WXRA 3ENEA 1ZUD2 3DBHI 1KLVA 2L0TA 1DOXA 3RYTA 5JHBA 4HJKA 1TZ1A 2RDHA 2MBOA 3NUHB 2PVOD 4MGKE 2KJRA 3ZLZA 4JGHB 2M17A 2MBBB 3M95A 1CMXB 1SJHD 3E56A 3I57A 2KHWB 1MJDA 2N9XA 4US8A 2BKFA 1IBXA 1HTQA 3PRMB 1FRDA 5EE3A 4D2KA 1WZ3A 2WXFA 3PRPB 5GMVA 1WM3A 2MP2B 3BVGA 1VCBA 1L6UA 3VUWA 3H7SA 2QSDA 2XK5A 2LVOA 3I63C 3UINB 2A4ZA 4N6EB 1WX8A 3VTVA 1FCLA 1JCKB 3KH0A 1V9JA 4M0WA 3APFA 3VUXA 4ANUA 5IO9A 2WDVB 2N0SB 1KLUD 2LGDA 1WMHB 2GLSA 1GPXA 1LGRA 2QMTA 1HA5A 2KTRB 2C5LC 2BF8B 5G55A 1SIJA 1F2RC 3Q6BA 4IM2A 3NRZA 3WIMA 1IGCA 1P7EA 3NZSA 2L52A 4LNOA 1AARA 3VH4B 1PDXA 2J53A 1XLQA 1AN8A 3Q8AA 3V61A 4L2YA 5MPOA 3SHQA 4LCDE 3NZ3A 2Z0DB 4MH8A 3C8YA 3KUDB 2LRUA 2DAJA 1EU3A 4MH0E 2ACZB 1WM2A 3AEDB 3JVZX 1E90A 3QIJA 4JQWC 4DXGA 2FNJB 1QOFA 3TEXA 3D32A 3TBLD 2M1MA 2JZZA 1T0QC 2LEKA 3MFGA 1C76A 2D11A 4KV2A 3KUZA 1EUVB 4F8CB 2FCMA 3RFZB 1GUAB 2L1AA 4FJVB 4B9KA 2H88B 2LHEA 1TIFA 3P4RB 3Q14C 3ZRCA 3LJ3A 2KC2A 4RM8A 2N4FA 4EUTA 3AEAB 1R4NB 2C9WB 2IYDB 5CTRC 2JWZA 4A9AA 5E6JA 4ZHOA 1WR6E 2IY0B 5BMIA 2W82A 2D3GA 2M0XA 4LNIA 1TZOA 4MELA 2I2YA 2PE9A 2FBWB 2MA9B 4BKSD 4GN1A 3HK0A 4K7WA 2K6DB 4G50A 2BYVE 2WXIA 4JPSA 3W9CB 4CQNA 1B9RA 4HCPB 2MHJA 3PS6A 3MTNB 1I4HA 4KGRA 3AB5A 2N9EB 3DBRB 1KOTA 3GOEA 3SFDB 3ZYYX 2VH2A 4ZRPA 1TKGA 3N30A 3DQVA 3PLVA 1WE7A 2LJ5A 3IVFA 1IP9A 4LJPB 4BKSA 3DHIC 4WWNA 1ISNA 3MC9A 2L3ZA 4JWUC 3U7DA 4B0EA 1C3TA 2HTHA 1VJKA 1E7PB 3AI5A 3WAPA 1JWBD 2WHIA 4HK2A 3AEGB 3HUIA 4MGZE 1JW9D 2G9HD 1WSPA 4BVUC 2K0PA 3Q3NC 1S1QB 1K52A 5KHQA 3HVZA 4IG7B 2BQQA 1YOVB 4E71A 4HCNB 2C7HA 4R3DA 3NS1A 3AE6B 1F0ZA 1WH3A 4YSXB 1PGBA 1D5XC 1E0ZA 3WAMA 1IGDA 2LZ6A 3A9JA 1G6JA 4BKTA 1ENFA 1EWYC 1WRDB 2Z0EB 1P3QU 3AM9A 3BINA 3QA8A 4RFBA 1LO5D 4NPNA 3RNAC 1F77A 3ZGZA 5HHDG 2ZPYA 3SEBA 2L83A 2WXQA 2AEHA 1WJ6A 1BT0A 1TT5B 2JYTA 2KKCA 4XDCA 1ACCA 1E5WA 1TYGB 3BWUD 3AE8B 1C4PA 2BB6A 2DAFA 2K3UA 1H4RA 5D3DA 1GJZA 1MG4A 3K9PB 3RNBC 1E8XA 2R2QA 2N7JA 2MJ3A 5C3JB 3SR6A 4FA6A 1R7SA 3BY4B 1XEEA 3QCAA 3PZ8A 1WXVA 1NI3A 2KQ7A 1NBFC 1K8RB 3NJTA 2ASQA 3WA0A 3BK2A 4FADA 3IAS1 1L4DB 5C23A 2KDEB 1WE6A 3QJZA 4FXCA 2ZJDA 3J9CA 5D3IB 1FNUA 4KGSA 2WNMA 2JXTA 5EE0A 2CHWA 3I9V1 3PHXB 3BYTB 4MM3A 1E9MA 1FIQA 2IDYA 2QJLA 3NVVA 4KKJA 5C2TB 3P2BA 3UGBB 4C4VA 3CIRB 3GP7A 2JWUA 1L0VB 3RUIB 2AQ3B 1PFDA 2AYOB 3ZW3A 3H8HA 1JALA 2GRIA 2L32A 4MSMB 2SEBD 1F2RI 2R2OA 4GMVA 2M8SA 2KACA 3Q3JA 2HD5B 1STEA 2N9LA 3ZDTA 4DHZE 4DBGA 3RNCC 5BMHA 1GB1A 1UNSA 2MX2A 4GDLA 5HI1A 2KK8A 1GOZA 3C19A 4J6IA 1KM7A 3A9KA 2L0FA 1SB3C 1Z2MA 4W9IA 2G45B 1T6BX 2BS2B 1E8YA 1YJ1A 3ZXRA 1YN3A 2LUMA 3BVZA 3O13A 4PK1A 2G1EA 4KZCA 3H7PA 2EMTA 4KZ0A 4ANWA 1V81A 1GC6A 3DBLB 4K7UA 4WJNA 1YNTE 2K1FA 4MGYE 3UQBA 2XK5B 1P98A 4FHJA 1WGRA 2LGIA 3GZNB 3KQ4A 2KMAA 1JRUA 2FUG1 4A6QA 1XF5L 4GSWA 1J8CA 1ZOYB 2O2VA 2Z8LA 2CHXA 4FJZA 2KT7A 4A20A 3VFKA 3DWMA 2KX3A 4AJYB 3E9SA 4IWOA 1HXYD 2M56B 3EC8A 1UWMA 3AV8A 4FBJB 5IOIA 4DHZB 1UGMA 4YXDB 2KVRA 3N20C 5EE1A 2WXLA 1WXSA 3PVLA 1BMLC 4WH4A 3B1LX 2KDBA 4HPPA 5T8IA 4TQ1A 1FXIA 4PS3A 1J7AA 2PEAA 1N6ZA 2GOWA 1I35A 1QLBB 4BAXA 5DCNA 2FCNA 4KIKB 3L16A 2KXJA 2BWES 3IT6B 4DHJD 3CSTA 3OG5A 3HM3A 3V62A 3RNEC 2KFKA 4W9CA 1D3ZA 4IM0A 4GIVA 3RZWC 4A90A 1FFUA 3V60A 3WAOA 3U8ZA 2GBRA 4UDUC 4W9LA 4OHJA 5HG2A 2LJIA 3ECIA 4X57B 2ZEQA 5CHWA 2W54A 4NQLB 2ZCBA 1OQRA 3EECA 3W5UB 3RN9C 1PQSA 1Q0WB 4EE2A 5BYSA 1FEHA 1V1OA 3A4RA 2KQ4X 1UUPA 1OQQA 2WQYB 4QAYA 2R61A 3VUYA 1L0XB 2G4DB 1RM6C 1CJEA 3GB1A 4XWWA 3R7RA 1JROA 4JL9A 3WCQA 1JMLA 4HEA1 3EFCA 4W9FA 4GDKA 4RF0A 2BB5A 2WX1A 4M8NA 3RPFC 4K81A 5TSSA 4ZOHC 4BBNC 2WXOA 4RNAA 5HKHA 2WWZA 4TSSA 2GB1A 2N7EA 3TCAA 1VRAB 2RD0A 1LXDA 3AE2B 1UF0A 3P4QB 3NZUA 2JVCA 3OAWA 5AUKA 3PLUA 1T5XD 2OEDA 3PRZA 2LRWA 4OZAA 1YJJA 2FE8A 2DZJA 2AX5A 4ICVA 2ZW1A 1WZ0A 4HPMB 2JZ3B 4ANVA 3RMKC 1WYWB 4YTNB 1ET6A 2KN4A 2BBCA 2D2QA 3NVZA 3JSVB 3SDLC 2KWCA 2ZNVC 2FCQA 3FILA 4W9EA 4KGTA 4RM9A 2HE7A 3ML9A 2BYFA 3X0WA 2MCNB 2XEWA 3DVGY 1E8ZA 3ZDMC 1E7UA 3R7QA 2K25A 1C9FA 2JRIB 2MSED 4WURA 3Q8FA 5IKCM 3A9JB 2LGXA 1RRBA 1V1PA 4MDKE 3ONSA 1FPYA 2GBMA 3B9JA 4ANXA 3QK0A 3DHHC 3GE3C 4II3B 2G3QB 1SEBD 5AZGA 2LWPA 4IDIA 4C56C 2LD9A 2YLMA 2LHDA 2KDMA 2NS5A 2MW5A 3PTFC 2KNBA 1D5ZC 2I1JA 5D6JB 4YL8A 1N61A 1Y56A 3APDA 2DBYA 4NQKE 1JWUD 2KJHB 1SBBB 2JPHA 3U4EG 5JH5C 5JHAA 4LDTB 3Q3MC 3DVNV 2UWQA 3KW5B 4KSLC 4W9KA 3DBHB 2PJHA 4W9GA 3L0WB 1YQ4B 2WDRB 5LNK1 4YSYB 2PTLA 4MJSB 3IHPC 4BBNF 3I5JC 2CU3A 3KYDD 1WXMA 1EM7A 2KX0A 2IGDA 2HJ8A 2KC1A 4MM3B 1OFFA 4NAMA 3H9DA 2ONQA 1SE9A 2NPTA 4KVGB 2K8CA 4M01A 3U52E 1F52A 2TSSA 2N9KA 3HVDA 5LXHA 1L4ZB 2W3SA 3RNFC 2MJDA 1UBQA 2WXPA 1JRPA 5KHOA 4LTUA 3FC4A 1DYQA 1CQVA 4IC7B 4IKGA 3PREA 4K7SA 3MC0B 4A3OA 1J19A 2C60A 2INDC 4G0NB 2JT4B 2EELA 1E10A 2ON8A 3L08A 2FAZA 1ZKHA 4FN2A 1DOIA 1PYWD 2Q5WD 5AEKB 1E6EB 2KMMA 2B76B 3LDZE 2INPE 5C1ZA 3BYYB 3P42A 4GLSC 2W3RA 4GDLB 1F9JA 3AEBB 5LLIA 2M4NA 2Y5CA 5IN7A 4YTMB 4WQOB 2BW2A 4HDOA 4P6VF 2RDBC 3IG3A 4YWGG 4OVUA 1Z5SB 2WXKA 3N32A 3RT3B 2CKHB 4PYZA 5I4DA 4IW0A 1DGJA 1A70A 2ZCCA 1RFAA 1YX6B 2GBNA 3PZDA 2WXNA 4FJYA 5FR3A 1IYFA 2O6VD 3CSFA 3OWEB 3ABVB 1N62A 2BTEA 4NAWA 1V80A 3V6CB 2RPQA 1RAXA 2PVGC 2LFIA 1MFWA 2KVZA 3DCGA 4NNJB 2MP2A 4PT5A 2O6VA 1M4VA 2WS3B 4GXBA 4EZLA 2A5UA 4WAAA 3L4PA 1EF5A 1ROEA 3Q3FA 3OJ4B 1SJED 3PV1A 3GE8C 2MBHA 2V1YA 1K53A 3M63B 2KD0A 3VVWB 4DDGD 1XCQL 2QCZA 2C7MB 2RGFA 2VZKB 1WMHA 3VR9B 3HM6X 1ZXIA 3A1QA 3T3NA 1TTNA 1C77A 1SF0A 1C1YB 1IUEA 3AE5B 1XCTL 3R3MA 2BKRB 4IUMB 3RNGC 1ZDVA 2HJ1A 3MJ5A 2CU1A 2K22A 2ZPNA 4HPLB 4TMAB 5FR6A 2KYWA 1KH0A 3T9LA 2DYOA 4XWTA 4HXDA 2N9PC 3I3TB 3B2GA 4HROA 4AP4C 5G2NA 3IFWB 1NENB 1T0RC 2MBQA 2KFJA 2YEPF 2WXHA 3QHTA 1RFKA 2DYBA 2M0AA 2QIEB 5DPSA 5J2RA 2LXAA 2FUHB 1XLOA 1WGDA 3ZNID 3BK1A 1WX9A 1WGGA 1VDVA 2MLBA 3V6EB 2BVCA 1QILA 4WWOA 1R4MI 2DWQA 1I4GA 1WGYA 1X1MA 4CHKA 2BS4B 3PGEA 4YSZB 2JRHA 4GDKB 4GGQA 1MG8A 2NVUI 2BYTA 2WGSA 3AH7A 3TSSA 2EKEC 1ZW7A 3A4SC 2AQ1B 1WXQA 2D3CA 3NY5A 3TL5A 2DX5B 3NG0A 3JYUA 2JQRB 2K5PA 2RPVA 4F1SA 3ZQ4A 5BO4B 1V97A 4ZRQA 1Q1OA 2LGSA 3AE9B 2L7RA 1MVKA 2FCSA 4N58A 1L6VA 2PW9A 3OLMD 3N3KB 2Z59B 1FNWA 3ZKJC 3U2SC 1ZDXA 3AE4B 2K6QA 1KTKA 5E6OA 4NJ7A 2IO0B 1XLPA 2VRRB 3ZJUA 1XT9B 1IBXB 3LXFA 1WI0A 3IBEA 5IAAC 2WXGA 1GAQB 1UWXA 1MPEA 4NJCA 3B0AA 1QT9A 3NVYA 3CF6E 2EMSA 3SU8X 2LI5A 1WY8A 1RWSA 3NS8A 3FILB 3DPDA 3PO0A 5IA7A 1EWCA 2PKOA 1FM0D 4HKQA 2FIFA 1J0GA 1FXAA 2INNE 3FKYA 4M0WB 2CHZA 4WQMA 1PUTA 3DDCB 1K50A 2LGYA 1TS3A 2KOXA 1N60A 2NR2A 1OEYJ 2L05A 1V1PB 3V05A 4KKIA 2KWDA 2GBJA 3M3JA 1YQ3B 3TUOA
chains in the Genus database with same CATH topology
1GB4A 4YTNB 1ET6A 2AQ2B 1MHHE 1TZOA 5EE9A 2KN4A 2BBCA 2I2YA 3AE1B 2BS3B 1I4PA 2FBWB 1QQRA 1FNVA 2PMVA 3NVZA 2E3TA 4WWMA 1WYGA 1FMAD 1QKZA 1C4CA 2WXIA 1BXTA 4JPSA 3EA6A 3W9CB 4CQNA 4C80A 3FILA 3VRAB 4J3OD 1B9RA 4KGTA 3LYYA 1I4HA 4KGRA 2H89B 2RMMA 2V4IB 3AB5A 3Q8EA 4REZA 3BZDB 1C79A 3IT4B 3SFDB 3ZYYX 4WAFA 4ZRPA 4OVZA 1C9FA 1TKGA 4L23A 4WURA 3Q8FA 3BVMA 4RGOS 2ICIA 1FRRA 4XDDA 2BT6A 1V1PA 2IGGA 3IXSA 1SE3A 3B9JA 4JWUC 4B0EA 1JWMD 5D3IB 4Q2JA 1VJKA 2D5GA 3AEFB 3Q8CA 4ZHPA 1SEBD 2M19A 1E7PB 2DLBA 4YTPB 1JWBD 4A8XC 1T3QA 1ZXHA 3AEGB 1NYQA 2GI9A 3HUIA 2JZPA 1JW9D 2G9HD 4H2AA 4IDIA 4C56C 5H92C 1D4BA 2LHDA 2KDMA 3P63A 1WSPA 2K0PA 4JX1C 1PGAA 2WU2B 1K52A 4N59A 1XLNA 3HVZA 1D5ZC 3VRBB 3KWLA 1SE2A 2CJOA 1N61A 1Y56A 2V3NA 2RDGA 2DBYA 1JWUD 4R3DA 3NS1A 2SAKA 3KWVA 3AE6B 1F0ZA 4YSXB 3U7ZA 1PGBA 1SBBB 3KLSX 3U4EG 4OZCA 1D5XC 4DXFA 3LB8C 4ARCA 3MP9A 1E0ZA 4TQ0A 2PLPA 1IGDA 4RH6A 1QOAA 4RGMA 2IPKD 1YQ4B 1C78A 2WDRB 1ENFA 1EWYC 3AM9A 4RFBA 5LNK1 1LO5D 2PTLA 4YSYB 1SSNA 2CU3A 1F77A 1I4QA 1KFYB 3ZGZA 5HHDG 2X38A 3SEBA 4AS1A 2L83A 2WXQA 1EM7A 1WGKA 2JYTA 2IGDA 4MM3B 1OFFA 4NAMA 4RGTA 2ONQA 4XDCA 1ACCA 1TYGB 3P4PB 2NMQA 4JE3B 1L5PA 3ZJVA 3HRDD 3BWUD 1D5MC 3R2IA 2JX5A 3U52E 3AE8B 1C4PA 1QF6A 1VZ7A 2ZW0A 2BB6A 2K3UA 2V3PA 2TSSA 5D3DA 2KAJA 1VZ6A 2OHFA 4HKZE 1I4XA 2N9KA 2NTSA 3HVDA 5G5GA 4ARIA 4MT5A 3Q69A 1L4ZB 2W3SA 1TY0A 2N7JA 2MJ3A 5C3JB 3SR6A 2MJDA 2WXPA 2VZKD 1R7SA 3SFEB 1JRPA 1AW7A 4DQOC 1XEEA 4LLGM 4LTUA 3PZ8A 3FC4A 1DYQA 1CQVA 1NI3A 4IKGA 1C4AA 1N63A 4US9A 5FK9C 3MC0B 3R8BA 4C7ZA 3BK2A 2NTTA 1NYRA 2YEPB 3AE3B 5JXVA 4NAWB 1AYFA 4ZYSA 2EELA 2HDEA 1E10A 1ZP0B 2ON8A 1FO4A 1KF6B 1L4DB 3IAS1 5BYQA 4FXCA 3J9CA 1DOIA 1PYWD 1FNUA 2Q5WD 1I7HA 1YJIA 1YN5A 1E6EB 2KMMA 2JXTA 2B76B 2WNMA 4KGSA 1JQ4A 1NVID 5EE0A 3I9V1 3BYTB 3Q8BA 2INPE 2J52A 1ET9A 3BYYB 3P42A 4GLSC 1E9MA 3PZ7A 1FIQA 1N5WA 2W3RA 4GDLB 3AEBB 2IDYA 2QJLA 3NVVA 4LK0M 3TEYA 2MEKA 2Y5CA 4KKJA 4YTMB 1HQRD 2BW2A 4L1BA 4P6VF 4YWGG 1DOYA 5C2TB 4RCOA 2WXKA 4MACA 4YT0B 1J7BA 3CIRB 3GP7A 5I4DA 1PGXA 3CWIA 1DGJA 1A70A 2JWUA 1L0VB 2LMCA 1P7FA 5AUIA 3NVWA 2AQ3B 2WXNA 5FR3A 1PFDA 5BMGA 1SE4A 3OWEB 2WP9B 3H8HA 1JALA 3ABVB 1N62A 2BTEA 2GRIA 1WRIA 2L32A 4OW0A 2SEBD 1F2RI 2KACA 3AE7B 1STEA 1MI0A 4ITKA 2WDQB 1TY2A 2N9LA 2PVGC 2LFIA 4IOIE 1YMHE 1TKYA 1YN4A 1TJEA 3W2DA 3VR8B 4OZBA 1HZ6A 5BMHA 1NEKB 1GB1A 4PT5A 1UNSA 1Q10A 1V8CA 1M4VA 5HI1A 2WS3B 2MH7A 1GOZA 3L4PA 2JYEA 1SXTA 5GXGB 1ROEA 3EUB2 1J7CA 1SJED 3AECB 2QILA 2DYMA 1SB3C 2V0GA 1T6BX 1K53A 2BS2B 4JWSC 3P1MA 1YN3A 2LUMA 3BVZA 3O13A 1XCQL 4KX6B 2G1EA 2QEJC 2VZKB 4NZLB 3VR9B 3DWGC 3ETRA 1HZ5A 4HJGE 1ZXIA 2XN9C 4XE0A 1VLBA 2CJNA 4P16A 1YNTE 2WU5B 1ZE3D 1JWSD 2XNAC 5H8YE 4HRSA 3T3NA 3MHZA 1C77A 1SF0A 2LGIA 1L0YB 4A55A 1IUEA 1N5XA 1XCTL 2WXRA 3AE5B 1K51A 1ZDVA 1RYJA 3MJ5A 1ZUD2 3KQ4A 2K22A 2FUG1 4A6QA 1DOXA 1XF5L 1CK1A 4TMAB 2RDHA 1ZOYB 3UI3A 1KH0A 3NUHB 2PVOD 2DYOA 1HEZE 2Z8LA 4XWTA 3V3XA 2JSVX 3DWMA 3B2GA 2K9XA 4HROA 3N9YC 2J42A 3E9SA 1HXYD 2M56B 1UWMA 3AV8A 1SJHD 3E56A 3FAHA 3I57A 4RGNA 5D7GA 1NENB 2Y5PA 1VR9A 4US8A 4YXDB 5EE1A 1IBXA 2WXLA 1FRDA 5EE3A 3T3OA 4C7YA 5G5HA 4D2KA 1AWDA 1BMLC 2WXFA 4WIPA 3EGRA 2YEPF 2WXHA 1RFKA 4WH4A 5T8IA 2M0AA 2QIEB 3BVGA 4TQ1A 1FXIA 1ZPSA 1J7AA 1L6UA 1UGJA 1XLOA 1XXGA 2QSDA 3BK1A 1QLBB 1VDVA 3AMZA 1XO3A 2PIAA 2EKIA 4N6EB 3B2FA 3IT6B 1FCLA 1JCKB 1QILA 4M0WA 3TEWA 2WXMA 1MHXA 2DWQA 2WDVB 2N0SB 1I4GA 1KLUD 2BS4B 4YSZB 1GPXA 5BYRA 2QMTA 4A90A 1HA5A 1WWTA 1FFUA 1FFVA 1TS4A 4GDKB 4USAA 3AEEB 1SIJA 3AH7A 2BYTA 2JU6X 3TSSA 1F2RC 3GS2A 1I4RA 4UDUC 4OHJA 2WXJA 3NRZA 5HG2A 1JWAD 2AQ1B 1WXQA 2LJIA 1IGCA 2W54A 1P7EA 2L52A 1OQRA 2JQRB 2K5PA 2RPVA 1D6EC 3ZJTA 1BUIC 3ZQ4A 3W5UB 1PDXA 1V97A 4ZRQA 1B1ZA 2J53A 4EE2A 1XLQA 3AE9B 1AN8A 3Q8AA 5BYSA 3P4SB 4L2YA 1MVKA 1FEHA 2IGHA 5MPOA 4N58A 1V1OA 1L6VA 2PW9A 2KQ4X 3NZ3A 1UUPA 1OQQA 4MH8A 1KLGD 2WQYB 3C8YA 1FNWA 2R61A 1L0XB 3U2SC 3AN1A 1EU3A 3TEZA 3IAM1 2ACZB 1ZDXA 3AE4B 1RM6C 1CJEA 1KTKA 3GB1A 1ESFA 2HTME 3AEDB 4XWWA 1XLPA 3ZJUA 2W55A 2J4XA 2WLBA 2Y3AA 1IBXB 1JROA 1QOGA 3LXFA 2MJEA 3R2TA 3WCQA 1JMLA 3URYA 4HEA1 4B0MA 3W5VB 1FD6A 2WXGA 1GAQB 1KRHA 4DXGA 1UWXA 1MPEA 1QOFA 2E6XA 2BB5A 4RF0A 2IJ0A 1EU4A 3TEXA 4NJCA 3RPFC 1QT9A 3NVYA 1TS2A 5TSSA 4ZOHC 1CZPA 2LEKA 1RWSA 3MFGA 2WXOA 4RNAA 3FILB 1C76A 3VQIA 3PO0A 1EWCA 4TSSA 2PKOA 1FM0D 2GB1A 4HKQA 1FXAA 2INNE 4O1NA 3RFZB 1VRAB 3BIID 3W1SA 2L1AA 4WQMA 3AE2B 1PUTA 1VZ8A 1K50A 3P4QB 5HFYA 4RF1A 5FKAC 1TS3A 2H88B 2I38A 2LHEA 5AUKA 1N60A 1T5XD 2OEDA 3P4RB 4OZAA 1YJJA 2FE8A 3AEAB 2AX5A 4AQ7A 1V1PB 3V05A 1TKEA 1TS5A 2ZW1A 4A9AA 4KKIA 1QOBA 2KWDA 5E6JA 4ZHOA 5BMIA 2W82A 1YQ3B 3TUOA 1FCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGJ A; 
#chains in the Genus database with same CATH topology
 2L76 A;  4LJO B;  1MHH E;  3RUL A;  5EE9 A;  3AE1 B;  2BS3 B;  1QQR A;  1FNV A;  5D94 A;  2E3T A;  2YVC A;  2J0K A;  3PSE B;  2BGF A;  1FMA D;  1C4C A;  2JF5 A;  3VRA B;  4J3O D;  3M62 B;  2H89 B;  1WJU A;  2FID A;  1C79 A;  3IT4 B;  4GB9 A;  4WAF A;  4CO7 A;  2BYE A;  3BVM A;  2ICI A;  1FRR A;  2N1W A;  4BFR A;  2OOB B;  4KSK C;  3IXS A;  4P1C C;  2G4S A;  3ZNH B;  3AEF B;  3C0R B;  3HHM A;  2CS4 A;  2M19 A;  4YTP B;  4P1B C;  4S17 A;  4ZRI A;  1T3Q A;  1ZXH A;  4EKU A;  1NYQ A;  4H2A A;  2IO3 B;  2AL3 A;  2AL6 A;  5H92 C;  4W9H A;  1IPG A;  1PGA A;  3ZIM A;  2KMC A;  2V3N A;  3QQ8 B;  3ZNZ B;  3KUC B;  3PT2 B;  2SAK A;  3KWV A;  2DEN B;  3U7Z A;  3KLS X;  3UIO B;  2Y5B B;  4DXF A;  3LB8 C;  4ARC A;  4AUQ C;  3MP9 A;  2PLP A;  4N9F 4;  2DHZ A;  1QOA A;  4RGM A;  4EZJ A;  2IO1 B;  5JZE B;  3L13 A;  1C78 A;  4ZYN A;  2V3S A;  1VD2 A;  1SSN A;  1I4Q A;  1KFY B;  3RZF A;  2LVQ A;  1OQY A;  1UZX B;  2X38 A;  4LNN A;  4AS1 A;  1WGK A;  5DPW A;  4RGT A;  2PPH A;  3P4P B;  2NMQ A;  3UF8 A;  3AXC A;  2JX5 A;  2N7D A;  1QF6 A;  5LXI B;  2V3P A;  2BPS A;  1HTO A;  1L7Y A;  1VZ6 A;  4ZRK A;  1I4X A;  3DVG X;  2VH1 A;  3Q69 A;  2KN5 A;  2GMI C;  2DZK A;  3OJ3 A;  5FK9 C;  3JW0 X;  1XD3 B;  3R8B A;  4P7I A;  1NYR A;  2YEP B;  3AE3 B;  5JXV A;  4NAW B;  2KLG A;  4EZK A;  1WR1 A;  1ZGU B;  2HDE A;  2ZVO A;  3DBS A;  3H6N A;  1KF6 B;  1Q5W B;  5BYQ A;  1SGH A;  4BOZ B;  3KYC D;  2C7N B;  1I7H A;  1YN5 A;  1EO6 A;  5L95 C;  4I6P A;  4AJW A;  2J52 A;  3PPA A;  2X8X X;  2KLC A;  1R4N I;  3ZTC A;  3B08 A;  2O6V B;  1N5W A;  2UYZ B;  2IBI B;  1WJ4 A;  4LK0 M;  4L1B A;  4XZ4 A;  2OJR A;  4NJ6 A;  5E6N A;  4CYE A;  1DOY A;  3UIP B;  2DZI A;  4W9D A;  4RCO A;  2LVP A;  1J7B A;  2V4L A;  1WFY A;  1PGX A;  2QC8 A;  2DZM A;  4KDL B;  2LMC A;  3WAN A;  1P7F A;  5AUI A;  1V5T A;  4URK A;  2W9N A;  5BMG A;  3DHG C;  4BOS C;  2WP9 B;  1GG3 A;  1WRI A;  3PHW B;  3A1Q B;  4NY0 A;  5E6P A;  2KAN A;  3AE7 B;  3DBR I;  4ITK A;  4TUU A;  3WAL A;  2WDQ B;  1EF1 A;  1UEL A;  1UBI A;  1LM8 B;  1YQB A;  4IOI E;  1YMH E;  1TKY A;  3ZXV A;  3VR8 B;  3APC A;  1HZ6 A;  3N1Y C;  1NEK B;  3RI7 C;  1FXT B;  4WWP A;  4WJQ A;  1V8C A;  4HLE A;  4EOY A;  2NCN A;  2JYE A;  2KZR A;  2CR5 A;  1SXT A;  5GXG B;  1V5O A;  1P0R A;  3EUB 2;  4KIK A;  3TJP A;  3S2A A;  2QIL A;  3T8M A;  1YD8 U;  2D3B A;  4JWS C;  3QAQ A;  1WGH A;  2LUE A;  3P1M A;  2D07 B;  3AU5 A;  2QEJ C;  4WJP A;  3ZO5 B;  3DWG C;  4BKG A;  1WXA A;  3ETR A;  4XE0 A;  2XN9 C;  1HE8 A;  1VLB A;  2CJN A;  2IY1 B;  4P16 A;  2ZVN A;  1ZE3 D;  2RSU A;  1JWS D;  5H8Y E;  3RCZ A;  1SIF A;  3MHZ A;  4A55 A;  4HDQ A;  1N5X A;  4K3B A;  1P9D U;  1K51 A;  2WX0 A;  1RYJ A;  2INC C;  4C4V B;  2QHO A;  1CK1 A;  3VTU A;  3UI3 A;  1HEZ E;  2KTF A;  3V3X A;  2JSV X;  2MWS B;  4LNF A;  4GOC A;  3VAW A;  4I6L B;  2K9X A;  3X23 A;  1GNU A;  3N9Y C;  2J42 A;  3MJW A;  4B95 A;  4MEM A;  4HVB A;  3FAH A;  4RGN A;  3Q3O C;  3VDZ A;  2AWT A;  2IZV B;  5D7G A;  2Y5P A;  1VR9 A;  3EHV A;  3AUL A;  4JIO U;  4AOF A;  1UD7 A;  1WIA A;  2NBU A;  3T3O A;  3U30 A;  4C7Y A;  5G5H A;  4M02 A;  1AWD A;  4WIP A;  3EGR A;  4XGA B;  2KDF B;  3KVF B;  1ZPS A;  1OGW A;  1UGJ A;  2NBW B;  1XXG A;  1S3S G;  4DXA B;  2RR9 A;  3A9K B;  3AMZ A;  1XO3 A;  2PIA A;  2EKI A;  3B2F A;  3QC8 B;  4MSQ B;  4EFO A;  3TEW A;  2WXM A;  1MHX A;  3SD5 A;  2B3A A;  3H7P B;  2KO3 A;  5BYR A;  1WWT A;  4AWJ A;  1FFV A;  1TS4 A;  3HIZ A;  4USA A;  3AEE B;  2JU6 X;  4EEW A;  4XX5 A;  3GS2 A;  1I4R A;  4WJO A;  2KDI A;  2WXJ A;  1RLF A;  1JWA D;  1P1A A;  4PS7 A;  3VTW A;  1D6E C;  3ZJT A;  1BUI C;  3ZVV A;  1B1Z A;  1OTR B;  2O2V B;  3P4S B;  5DPR A;  3JSV A;  2IGH A;  3R66 C;  1KLG D;  3NOB A;  3AN1 A;  3TEZ A;  2K39 A;  3IAM 1;  3H1U A;  1ESF A;  4E3C A;  2HTM E;  3TIX A;  2W55 A;  3W1S C;  2J4X A;  2WLB A;  2Y3A A;  4FUL A;  1L2N A;  1QOG A;  3R2T A;  2MJE A;  3URY A;  4B0M A;  2D10 A;  3W5V B;  4C00 A;  5DPT A;  3AU4 A;  1FD6 A;  3RD2 A;  1KRH A;  2J0M A;  2KTR A;  1XQQ A;  2E6X A;  4K3C A;  2IJ0 A;  1EU4 A;  1H8C A;  2GBK A;  1TS2 A;  4W9J A;  2MRP A;  1CZP A;  1LFD A;  3VQI A;  4LDT D;  3K9O B;  4ZDV A;  4O1N A;  3BII D;  2K8H A;  3W1S A;  4XYC A;  2KFK B;  1VZ8 A;  2JXX A;  1V6E A;  1I42 A;  5HFY A;  1WJN A;  4RF1 A;  5FKA C;  2I38 A;  4XC2 A;  2LXC A;  3QWZ B;  3N1X C;  4B6W A;  2QDF A;  4FHK A;  4AQ7 A;  1TKE A;  3ML8 A;  1TS5 A;  3DBL I;  5J17 A;  1QOB A;  4A3P A;  4DHJ B;  1FCC C;  1GB4 A;  1E8W A;  2AQ2 B;  1GC7 A;  3DVN U;  5EDS A;  3DOW A;  1I4P A;  2PMV A;  3GZN I;  4WWM A;  1WYG A;  1QKZ A;  4MJS A;  3TMP B;  5J18 A;  1BXT A;  3EA6 A;  4C80 A;  4M00 A;  4PS8 A;  3LYY A;  2RMM A;  2V4I B;  3Q8E A;  4REZ A;  3BZD B;  2MBE A;  3MHS D;  2WDT B;  4II2 B;  1Y8R C;  4OVZ A;  1WX7 A;  1U4A A;  4L23 A;  4RGO S;  3UQA A;  2I1K A;  4XDD A;  1E7V A;  3ZNG C;  2BT6 A;  1NDD A;  1QZE A;  2IGG A;  1SE3 A;  4KDI C;  4ACF A;  1V2Y A;  3L54 A;  1JWM D;  4Q2J A;  2KQS A;  1NI2 A;  2D5G A;  3Q8C A;  4ZHP A;  2DNF A;  2DLB A;  4A8X C;  4IM3 A;  3VXW A;  5IP4 D;  2GI9 A;  2JZP A;  1D4B A;  2XBB C;  3P63 A;  4OVV A;  1YIW A;  4JX1 C;  2KWU B;  2WU2 B;  4ICU A;  4N59 A;  1XLN A;  3VRB B;  4IWQ A;  3KWL A;  1SE2 A;  1UH6 A;  2CJO A;  2L00 B;  4TV3 A;  1M94 A;  2KWV B;  2RDG A;  3L17 A;  4F7Z A;  4DK5 A;  4I6N B;  4OZC A;  4TQ0 A;  4G3X B;  4RH6 A;  2MQJ A;  2IPK D;  4IWP A;  4TKN A;  3MC8 A;  4JLC A;  2LAS A;  3CMM B;  3QAR A;  2WYQ A;  3O65 B;  1T0S C;  4GU2 A;  1TGZ B;  3L10 B;  3ZUN A;  4JE3 B;  1L5P A;  3ZJV A;  3HRD D;  1D5M C;  3R2I A;  1VZ7 A;  2ZW0 A;  4MGI E;  5D2M B;  3VHT C;  2KAJ A;  2OHF A;  4HKZ E;  1T0Y A;  5G5G A;  2BWF A;  2NTS A;  4G11 A;  4ARI A;  4MT5 A;  1TY0 A;  2VZK D;  2ZNV B;  3SFE B;  1AW7 A;  4DQO C;  5CHV C;  4LLG M;  2V9H A;  2KJ6 A;  4K1R B;  1C4A A;  1N63 A;  4US9 A;  3W1Y A;  2OJW A;  1TBE A;  4C7Z A;  2NTT A;  3Q2A C;  4DWF A;  1AYF A;  1R4M B;  4ZYS A;  3N1Z C;  1ZP0 B;  1FO4 A;  4HWI B;  2REX A;  1YJI A;  1JQ4 A;  1NVI D;  3ZRF A;  3Q8B A;  1ET9 A;  2IO2 B;  3NHE B;  3PZ7 A;  3A33 B;  2D3A A;  1OEY A;  3TEY A;  2MEK A;  1HQR D;  4BZA A;  4YT0 B;  4MAC A;  4ASW C;  5CX3 A;  4FLH A;  3VH3 B;  3CWI A;  2ZZP B;  3NVW A;  1SE4 A;  4S0R A;  2J0J A;  2NBV B;  2NPT B;  5TR5 A;  4OW0 A;  4DDI D;  4PYU A;  1A5R A;  5CHF A;  2JUO A;  1MI0 A;  1KJT A;  1TY2 A;  2UU7 A;  4RMA A;  5AZH A;  3ZTD A;  1YN4 A;  1TJE A;  5AZF A;  3W2D A;  4OZB A;  1LQB A;  2J7Q B;  2JY6 A;  2K8B A;  1Q10 A;  2MH7 A;  2N1V A;  3QX1 A;  1J7C A;  3AEC B;  2DYM A;  4E74 A;  2V0G A;  1F1H A;  5L83 A;  2PE6 B;  4LNK A;  2L8J A;  4KX6 B;  4M8M A;  3ALB A;  4NZL B;  4ZRJ A;  1V86 A;  1HZ5 A;  1YX5 B;  4HJG E;  1V49 A;  2WU5 B;  1WF9 A;  2XNA C;  4HRS A;  3EFU A;  1L0Y B;  2WXR A;  3ENE A;  1ZUD 2;  3DBH I;  1KLV A;  2L0T A;  1DOX A;  3RYT A;  5JHB A;  4HJK A;  1TZ1 A;  2RDH A;  2MBO A;  3NUH B;  2PVO D;  4MGK E;  2KJR A;  3ZLZ A;  4JGH B;  2M17 A;  2MBB B;  3M95 A;  1CMX B;  1SJH D;  3E56 A;  3I57 A;  2KHW B;  1MJD A;  2N9X A;  4US8 A;  2BKF A;  1IBX A;  1HTQ A;  3PRM B;  1FRD A;  5EE3 A;  4D2K A;  1WZ3 A;  2WXF A;  3PRP B;  5GMV A;  1WM3 A;  2MP2 B;  3BVG A;  1VCB A;  1L6U A;  3VUW A;  3H7S A;  2QSD A;  2XK5 A;  2LVO A;  3I63 C;  3UIN B;  2A4Z A;  4N6E B;  1WX8 A;  3VTV A;  1FCL A;  1JCK B;  3KH0 A;  1V9J A;  4M0W A;  3APF A;  3VUX A;  4ANU A;  5IO9 A;  2WDV B;  2N0S B;  1KLU D;  2LGD A;  1WMH B;  2GLS A;  1GPX A;  1LGR A;  2QMT A;  1HA5 A;  2KTR B;  2C5L C;  2BF8 B;  5G55 A;  1SIJ A;  1F2R C;  3Q6B A;  4IM2 A;  3NRZ A;  3WIM A;  1IGC A;  1P7E A;  3NZS A;  2L52 A;  4LNO A;  1AAR A;  3VH4 B;  1PDX A;  2J53 A;  1XLQ A;  1AN8 A;  3Q8A A;  3V61 A;  4L2Y A;  5MPO A;  3SHQ A;  4LCD E;  3NZ3 A;  2Z0D B;  4MH8 A;  3C8Y A;  3KUD B;  2LRU A;  2DAJ A;  1EU3 A;  4MH0 E;  2ACZ B;  1WM2 A;  3AED B;  3JVZ X;  1E90 A;  3QIJ A;  4JQW C;  4DXG A;  2FNJ B;  1QOF A;  3TEX A;  3D32 A;  3TBL D;  2M1M A;  2JZZ A;  1T0Q C;  2LEK A;  3MFG A;  1C76 A;  2D11 A;  4KV2 A;  3KUZ A;  1EUV B;  4F8C B;  2FCM A;  3RFZ B;  1GUA B;  2L1A A;  4FJV B;  4B9K A;  2H88 B;  2LHE A;  1TIF A;  3P4R B;  3Q14 C;  3ZRC A;  3LJ3 A;  2KC2 A;  4RM8 A;  2N4F A;  4EUT A;  3AEA B;  1R4N B;  2C9W B;  2IYD B;  5CTR C;  2JWZ A;  4A9A A;  5E6J A;  4ZHO A;  1WR6 E;  2IY0 B;  5BMI A;  2W82 A;  2D3G A;  2M0X A;  4LNI A;  1TZO A;  4MEL A;  2I2Y A;  2PE9 A;  2FBW B;  2MA9 B;  4BKS D;  4GN1 A;  3HK0 A;  4K7W A;  2K6D B;  4G50 A;  2BYV E;  2WXI A;  4JPS A;  3W9C B;  4CQN A;  1B9R A;  4HCP B;  2MHJ A;  3PS6 A;  3MTN B;  1I4H A;  4KGR A;  3AB5 A;  2N9E B;  3DBR B;  1KOT A;  3GOE A;  3SFD B;  3ZYY X;  2VH2 A;  4ZRP A;  1TKG A;  3N30 A;  3DQV A;  3PLV A;  1WE7 A;  2LJ5 A;  3IVF A;  1IP9 A;  4LJP B;  4BKS A;  3DHI C;  4WWN A;  1ISN A;  3MC9 A;  2L3Z A;  4JWU C;  3U7D A;  4B0E A;  1C3T A;  2HTH A;  1VJK A;  1E7P B;  3AI5 A;  3WAP A;  1JWB D;  2WHI A;  4HK2 A;  3AEG B;  3HUI A;  4MGZ E;  1JW9 D;  2G9H D;  1WSP A;  4BVU C;  2K0P A;  3Q3N C;  1S1Q B;  1K52 A;  5KHQ A;  3HVZ A;  4IG7 B;  2BQQ A;  1YOV B;  4E71 A;  4HCN B;  2C7H A;  4R3D A;  3NS1 A;  3AE6 B;  1F0Z A;  1WH3 A;  4YSX B;  1PGB A;  1D5X C;  1E0Z A;  3WAM A;  1IGD A;  2LZ6 A;  3A9J A;  1G6J A;  4BKT A;  1ENF A;  1EWY C;  1WRD B;  2Z0E B;  1P3Q U;  3AM9 A;  3BIN A;  3QA8 A;  4RFB A;  1LO5 D;  4NPN A;  3RNA C;  1F77 A;  3ZGZ A;  5HHD G;  2ZPY A;  3SEB A;  2L83 A;  2WXQ A;  2AEH A;  1WJ6 A;  1BT0 A;  1TT5 B;  2JYT A;  2KKC A;  4XDC A;  1ACC A;  1E5W A;  1TYG B;  3BWU D;  3AE8 B;  1C4P A;  2BB6 A;  2DAF A;  2K3U A;  1H4R A;  5D3D A;  1GJZ A;  1MG4 A;  3K9P B;  3RNB C;  1E8X A;  2R2Q A;  2N7J A;  2MJ3 A;  5C3J B;  3SR6 A;  4FA6 A;  1R7S A;  3BY4 B;  1XEE A;  3QCA A;  3PZ8 A;  1WXV A;  1NI3 A;  2KQ7 A;  1NBF C;  1K8R B;  3NJT A;  2ASQ A;  3WA0 A;  3BK2 A;  4FAD A;  3IAS 1;  1L4D B;  5C23 A;  2KDE B;  1WE6 A;  3QJZ A;  4FXC A;  2ZJD A;  3J9C A;  5D3I B;  1FNU A;  4KGS A;  2WNM A;  2JXT A;  5EE0 A;  2CHW A;  3I9V 1;  3PHX B;  3BYT B;  4MM3 A;  1E9M A;  1FIQ A;  2IDY A;  2QJL A;  3NVV A;  4KKJ A;  5C2T B;  3P2B A;  3UGB B;  4C4V A;  3CIR B;  3GP7 A;  2JWU A;  1L0V B;  3RUI B;  2AQ3 B;  1PFD A;  2AYO B;  3ZW3 A;  3H8H A;  1JAL A;  2GRI A;  2L32 A;  4MSM B;  2SEB D;  1F2R I;  2R2O A;  4GMV A;  2M8S A;  2KAC A;  3Q3J A;  2HD5 B;  1STE A;  2N9L A;  3ZDT A;  4DHZ E;  4DBG A;  3RNC C;  5BMH A;  1GB1 A;  1UNS A;  2MX2 A;  4GDL A;  5HI1 A;  2KK8 A;  1GOZ A;  3C19 A;  4J6I A;  1KM7 A;  3A9K A;  2L0F A;  1SB3 C;  1Z2M A;  4W9I A;  2G45 B;  1T6B X;  2BS2 B;  1E8Y A;  1YJ1 A;  3ZXR A;  1YN3 A;  2LUM A;  3BVZ A;  3O13 A;  4PK1 A;  2G1E A;  4KZC A;  3H7P A;  2EMT A;  4KZ0 A;  4ANW A;  1V81 A;  1GC6 A;  3DBL B;  4K7U A;  4WJN A;  1YNT E;  2K1F A;  4MGY E;  3UQB A;  2XK5 B;  1P98 A;  4FHJ A;  1WGR A;  2LGI A;  3GZN B;  3KQ4 A;  2KMA A;  1JRU A;  2FUG 1;  4A6Q A;  1XF5 L;  4GSW A;  1J8C A;  1ZOY B;  2O2V A;  2Z8L A;  2CHX A;  4FJZ A;  2KT7 A;  4A20 A;  3VFK A;  3DWM A;  2KX3 A;  4AJY B;  3E9S A;  4IWO A;  1HXY D;  2M56 B;  3EC8 A;  1UWM A;  3AV8 A;  4FBJ B;  5IOI A;  4DHZ B;  1UGM A;  4YXD B;  2KVR A;  3N20 C;  5EE1 A;  2WXL A;  1WXS A;  3PVL A;  1BML C;  4WH4 A;  3B1L X;  2KDB A;  4HPP A;  5T8I A;  4TQ1 A;  1FXI A;  4PS3 A;  1J7A A;  2PEA A;  1N6Z A;  2GOW A;  1I35 A;  1QLB B;  4BAX A;  5DCN A;  2FCN A;  4KIK B;  3L16 A;  2KXJ A;  2BWE S;  3IT6 B;  4DHJ D;  3CST A;  3OG5 A;  3HM3 A;  3V62 A;  3RNE C;  2KFK A;  4W9C A;  1D3Z A;  4IM0 A;  4GIV A;  3RZW C;  4A90 A;  1FFU A;  3V60 A;  3WAO A;  3U8Z A;  2GBR A;  4UDU C;  4W9L A;  4OHJ A;  5HG2 A;  2LJI A;  3ECI A;  4X57 B;  2ZEQ A;  5CHW A;  2W54 A;  4NQL B;  2ZCB A;  1OQR A;  3EEC A;  3W5U B;  3RN9 C;  1PQS A;  1Q0W B;  4EE2 A;  5BYS A;  1FEH A;  1V1O A;  3A4R A;  2KQ4 X;  1UUP A;  1OQQ A;  2WQY B;  4QAY A;  2R61 A;  3VUY A;  1L0X B;  2G4D B;  1RM6 C;  1CJE A;  3GB1 A;  4XWW A;  3R7R A;  1JRO A;  4JL9 A;  3WCQ A;  1JML A;  4HEA 1;  3EFC A;  4W9F A;  4GDK A;  4RF0 A;  2BB5 A;  2WX1 A;  4M8N A;  3RPF C;  4K81 A;  5TSS A;  4ZOH C;  4BBN C;  2WXO A;  4RNA A;  5HKH A;  2WWZ A;  4TSS A;  2GB1 A;  2N7E A;  3TCA A;  1VRA B;  2RD0 A;  1LXD A;  3AE2 B;  1UF0 A;  3P4Q B;  3NZU A;  2JVC A;  3OAW A;  5AUK A;  3PLU A;  1T5X D;  2OED A;  3PRZ A;  2LRW A;  4OZA A;  1YJJ A;  2FE8 A;  2DZJ A;  2AX5 A;  4ICV A;  2ZW1 A;  1WZ0 A;  4HPM B;  2JZ3 B;  4ANV A;  3RMK C;  1WYW B;  4YTN B;  1ET6 A;  2KN4 A;  2BBC A;  2D2Q A;  3NVZ A;  3JSV B;  3SDL C;  2KWC A;  2ZNV C;  2FCQ A;  3FIL A;  4W9E A;  4KGT A;  4RM9 A;  2HE7 A;  3ML9 A;  2BYF A;  3X0W A;  2MCN B;  2XEW A;  3DVG Y;  1E8Z A;  3ZDM C;  1E7U A;  3R7Q A;  2K25 A;  1C9F A;  2JRI B;  2MSE D;  4WUR A;  3Q8F A;  5IKC M;  3A9J B;  2LGX A;  1RRB A;  1V1P A;  4MDK E;  3ONS A;  1FPY A;  2GBM A;  3B9J A;  4ANX A;  3QK0 A;  3DHH C;  3GE3 C;  4II3 B;  2G3Q B;  1SEB D;  5AZG A;  2LWP A;  4IDI A;  4C56 C;  2LD9 A;  2YLM A;  2LHD A;  2KDM A;  2NS5 A;  2MW5 A;  3PTF C;  2KNB A;  1D5Z C;  2I1J A;  5D6J B;  4YL8 A;  1N61 A;  1Y56 A;  3APD A;  2DBY A;  4NQK E;  1JWU D;  2KJH B;  1SBB B;  2JPH A;  3U4E G;  5JH5 C;  5JHA A;  4LDT B;  3Q3M C;  3DVN V;  2UWQ A;  3KW5 B;  4KSL C;  4W9K A;  3DBH B;  2PJH A;  4W9G A;  3L0W B;  1YQ4 B;  2WDR B;  5LNK 1;  4YSY B;  2PTL A;  4MJS B;  3IHP C;  4BBN F;  3I5J C;  2CU3 A;  3KYD D;  1WXM A;  1EM7 A;  2KX0 A;  2IGD A;  2HJ8 A;  2KC1 A;  4MM3 B;  1OFF A;  4NAM A;  3H9D A;  2ONQ A;  1SE9 A;  2NPT A;  4KVG B;  2K8C A;  4M01 A;  3U52 E;  1F52 A;  2TSS A;  2N9K A;  3HVD A;  5LXH A;  1L4Z B;  2W3S A;  3RNF C;  2MJD A;  1UBQ A;  2WXP A;  1JRP A;  5KHO A;  4LTU A;  3FC4 A;  1DYQ A;  1CQV A;  4IC7 B;  4IKG A;  3PRE A;  4K7S A;  3MC0 B;  4A3O A;  1J19 A;  2C60 A;  2IND C;  4G0N B;  2JT4 B;  2EEL A;  1E10 A;  2ON8 A;  3L08 A;  2FAZ A;  1ZKH A;  4FN2 A;  1DOI A;  1PYW D;  2Q5W D;  5AEK B;  1E6E B;  2KMM A;  2B76 B;  3LDZ E;  2INP E;  5C1Z A;  3BYY B;  3P42 A;  4GLS C;  2W3R A;  4GDL B;  1F9J A;  3AEB B;  5LLI A;  2M4N A;  2Y5C A;  5IN7 A;  4YTM B;  4WQO B;  2BW2 A;  4HDO A;  4P6V F;  2RDB C;  3IG3 A;  4YWG G;  4OVU A;  1Z5S B;  2WXK A;  3N32 A;  3RT3 B;  2CKH B;  4PYZ A;  5I4D A;  4IW0 A;  1DGJ A;  1A70 A;  2ZCC A;  1RFA A;  1YX6 B;  2GBN A;  3PZD A;  2WXN A;  4FJY A;  5FR3 A;  1IYF A;  2O6V D;  3CSF A;  3OWE B;  3ABV B;  1N62 A;  2BTE A;  4NAW A;  1V80 A;  3V6C B;  2RPQ A;  1RAX A;  2PVG C;  2LFI A;  1MFW A;  2KVZ A;  3DCG A;  4NNJ B;  2MP2 A;  4PT5 A;  2O6V A;  1M4V A;  2WS3 B;  4GXB A;  4EZL A;  2A5U A;  4WAA A;  3L4P A;  1EF5 A;  1ROE A;  3Q3F A;  3OJ4 B;  1SJE D;  3PV1 A;  3GE8 C;  2MBH A;  2V1Y A;  1K53 A;  3M63 B;  2KD0 A;  3VVW B;  4DDG D;  1XCQ L;  2QCZ A;  2C7M B;  2RGF A;  2VZK B;  1WMH A;  3VR9 B;  3HM6 X;  1ZXI A;  3A1Q A;  3T3N A;  1TTN A;  1C77 A;  1SF0 A;  1C1Y B;  1IUE A;  3AE5 B;  1XCT L;  3R3M A;  2BKR B;  4IUM B;  3RNG C;  1ZDV A;  2HJ1 A;  3MJ5 A;  2CU1 A;  2K22 A;  2ZPN A;  4HPL B;  4TMA B;  5FR6 A;  2KYW A;  1KH0 A;  3T9L A;  2DYO A;  4XWT A;  4HXD A;  2N9P C;  3I3T B;  3B2G A;  4HRO A;  4AP4 C;  5G2N A;  3IFW B;  1NEN B;  1T0R C;  2MBQ A;  2KFJ A;  2YEP F;  2WXH A;  3QHT A;  1RFK A;  2DYB A;  2M0A A;  2QIE B;  5DPS A;  5J2R A;  2LXA A;  2FUH B;  1XLO A;  1WGD A;  3ZNI D;  3BK1 A;  1WX9 A;  1WGG A;  1VDV A;  2MLB A;  3V6E B;  2BVC A;  1QIL A;  4WWO A;  1R4M I;  2DWQ A;  1I4G A;  1WGY A;  1X1M A;  4CHK A;  2BS4 B;  3PGE A;  4YSZ B;  2JRH A;  4GDK B;  4GGQ A;  1MG8 A;  2NVU I;  2BYT A;  2WGS A;  3AH7 A;  3TSS A;  2EKE C;  1ZW7 A;  3A4S C;  2AQ1 B;  1WXQ A;  2D3C A;  3NY5 A;  3TL5 A;  2DX5 B;  3NG0 A;  3JYU A;  2JQR B;  2K5P A;  2RPV A;  4F1S A;  3ZQ4 A;  5BO4 B;  1V97 A;  4ZRQ A;  1Q1O A;  2LGS A;  3AE9 B;  2L7R A;  1MVK A;  2FCS A;  4N58 A;  1L6V A;  2PW9 A;  3OLM D;  3N3K B;  2Z59 B;  1FNW A;  3ZKJ C;  3U2S C;  1ZDX A;  3AE4 B;  2K6Q A;  1KTK A;  5E6O A;  4NJ7 A;  2IO0 B;  1XLP A;  2VRR B;  3ZJU A;  1XT9 B;  1IBX B;  3LXF A;  1WI0 A;  3IBE A;  5IAA C;  2WXG A;  1GAQ B;  1UWX A;  1MPE A;  4NJC A;  3B0A A;  1QT9 A;  3NVY A;  3CF6 E;  2EMS A;  3SU8 X;  2LI5 A;  1WY8 A;  1RWS A;  3NS8 A;  3FIL B;  3DPD A;  3PO0 A;  5IA7 A;  1EWC A;  2PKO A;  1FM0 D;  4HKQ A;  2FIF A;  1J0G A;  1FXA A;  2INN E;  3FKY A;  4M0W B;  2CHZ A;  4WQM A;  1PUT A;  3DDC B;  1K50 A;  2LGY A;  1TS3 A;  2KOX A;  1N60 A;  2NR2 A;  1OEY J;  2L05 A;  1V1P B;  3V05 A;  4KKI A;  2KWD A;  2GBJ A;  3M3J A;  1YQ3 B;  3TUO A; 
#chains in the Genus database with same CATH homology
 1GB4 A;  4YTN B;  1ET6 A;  2AQ2 B;  1MHH E;  1TZO A;  5EE9 A;  2KN4 A;  2BBC A;  2I2Y A;  3AE1 B;  2BS3 B;  1I4P A;  2FBW B;  1QQR A;  1FNV A;  2PMV A;  3NVZ A;  2E3T A;  4WWM A;  1WYG A;  1FMA D;  1QKZ A;  1C4C A;  2WXI A;  1BXT A;  4JPS A;  3EA6 A;  3W9C B;  4CQN A;  4C80 A;  3FIL A;  3VRA B;  4J3O D;  1B9R A;  4KGT A;  3LYY A;  1I4H A;  4KGR A;  2H89 B;  2RMM A;  2V4I B;  3AB5 A;  3Q8E A;  4REZ A;  3BZD B;  1C79 A;  3IT4 B;  3SFD B;  3ZYY X;  4WAF A;  4ZRP A;  4OVZ A;  1C9F A;  1TKG A;  4L23 A;  4WUR A;  3Q8F A;  3BVM A;  4RGO S;  2ICI A;  1FRR A;  4XDD A;  2BT6 A;  1V1P A;  2IGG A;  3IXS A;  1SE3 A;  3B9J A;  4JWU C;  4B0E A;  1JWM D;  5D3I B;  4Q2J A;  1VJK A;  2D5G A;  3AEF B;  3Q8C A;  4ZHP A;  1SEB D;  2M19 A;  1E7P B;  2DLB A;  4YTP B;  1JWB D;  4A8X C;  1T3Q A;  1ZXH A;  3AEG B;  1NYQ A;  2GI9 A;  3HUI A;  2JZP A;  1JW9 D;  2G9H D;  4H2A A;  4IDI A;  4C56 C;  5H92 C;  1D4B A;  2LHD A;  2KDM A;  3P63 A;  1WSP A;  2K0P A;  4JX1 C;  1PGA A;  2WU2 B;  1K52 A;  4N59 A;  1XLN A;  3HVZ A;  1D5Z C;  3VRB B;  3KWL A;  1SE2 A;  2CJO A;  1N61 A;  1Y56 A;  2V3N A;  2RDG A;  2DBY A;  1JWU D;  4R3D A;  3NS1 A;  2SAK A;  3KWV A;  3AE6 B;  1F0Z A;  4YSX B;  3U7Z A;  1PGB A;  1SBB B;  3KLS X;  3U4E G;  4OZC A;  1D5X C;  4DXF A;  3LB8 C;  4ARC A;  3MP9 A;  1E0Z A;  4TQ0 A;  2PLP A;  1IGD A;  4RH6 A;  1QOA A;  4RGM A;  2IPK D;  1YQ4 B;  1C78 A;  2WDR B;  1ENF A;  1EWY C;  3AM9 A;  4RFB A;  5LNK 1;  1LO5 D;  2PTL A;  4YSY B;  1SSN A;  2CU3 A;  1F77 A;  1I4Q A;  1KFY B;  3ZGZ A;  5HHD G;  2X38 A;  3SEB A;  4AS1 A;  2L83 A;  2WXQ A;  1EM7 A;  1WGK A;  2JYT A;  2IGD A;  4MM3 B;  1OFF A;  4NAM A;  4RGT A;  2ONQ A;  4XDC A;  1ACC A;  1TYG B;  3P4P B;  2NMQ A;  4JE3 B;  1L5P A;  3ZJV A;  3HRD D;  3BWU D;  1D5M C;  3R2I A;  2JX5 A;  3U52 E;  3AE8 B;  1C4P A;  1QF6 A;  1VZ7 A;  2ZW0 A;  2BB6 A;  2K3U A;  2V3P A;  2TSS A;  5D3D A;  2KAJ A;  1VZ6 A;  2OHF A;  4HKZ E;  1I4X A;  2N9K A;  2NTS A;  3HVD A;  5G5G A;  4ARI A;  4MT5 A;  3Q69 A;  1L4Z B;  2W3S A;  1TY0 A;  2N7J A;  2MJ3 A;  5C3J B;  3SR6 A;  2MJD A;  2WXP A;  2VZK D;  1R7S A;  3SFE B;  1JRP A;  1AW7 A;  4DQO C;  1XEE A;  4LLG M;  4LTU A;  3PZ8 A;  3FC4 A;  1DYQ A;  1CQV A;  1NI3 A;  4IKG A;  1C4A A;  1N63 A;  4US9 A;  5FK9 C;  3MC0 B;  3R8B A;  4C7Z A;  3BK2 A;  2NTT A;  1NYR A;  2YEP B;  3AE3 B;  5JXV A;  4NAW B;  1AYF A;  4ZYS A;  2EEL A;  2HDE A;  1E10 A;  1ZP0 B;  2ON8 A;  1FO4 A;  1KF6 B;  1L4D B;  3IAS 1;  5BYQ A;  4FXC A;  3J9C A;  1DOI A;  1PYW D;  1FNU A;  2Q5W D;  1I7H A;  1YJI A;  1YN5 A;  1E6E B;  2KMM A;  2JXT A;  2B76 B;  2WNM A;  4KGS A;  1JQ4 A;  1NVI D;  5EE0 A;  3I9V 1;  3BYT B;  3Q8B A;  2INP E;  2J52 A;  1ET9 A;  3BYY B;  3P42 A;  4GLS C;  1E9M A;  3PZ7 A;  1FIQ A;  1N5W A;  2W3R A;  4GDL B;  3AEB B;  2IDY A;  2QJL A;  3NVV A;  4LK0 M;  3TEY A;  2MEK A;  2Y5C A;  4KKJ A;  4YTM B;  1HQR D;  2BW2 A;  4L1B A;  4P6V F;  4YWG G;  1DOY A;  5C2T B;  4RCO A;  2WXK A;  4MAC A;  4YT0 B;  1J7B A;  3CIR B;  3GP7 A;  5I4D A;  1PGX A;  3CWI A;  1DGJ A;  1A70 A;  2JWU A;  1L0V B;  2LMC A;  1P7F A;  5AUI A;  3NVW A;  2AQ3 B;  2WXN A;  5FR3 A;  1PFD A;  5BMG A;  1SE4 A;  3OWE B;  2WP9 B;  3H8H A;  1JAL A;  3ABV B;  1N62 A;  2BTE A;  2GRI A;  1WRI A;  2L32 A;  4OW0 A;  2SEB D;  1F2R I;  2KAC A;  3AE7 B;  1STE A;  1MI0 A;  4ITK A;  2WDQ B;  1TY2 A;  2N9L A;  2PVG C;  2LFI A;  4IOI E;  1YMH E;  1TKY A;  1YN4 A;  1TJE A;  3W2D A;  3VR8 B;  4OZB A;  1HZ6 A;  5BMH A;  1NEK B;  1GB1 A;  4PT5 A;  1UNS A;  1Q10 A;  1V8C A;  1M4V A;  5HI1 A;  2WS3 B;  2MH7 A;  1GOZ A;  3L4P A;  2JYE A;  1SXT A;  5GXG B;  1ROE A;  3EUB 2;  1J7C A;  1SJE D;  3AEC B;  2QIL A;  2DYM A;  1SB3 C;  2V0G A;  1T6B X;  1K53 A;  2BS2 B;  4JWS C;  3P1M A;  1YN3 A;  2LUM A;  3BVZ A;  3O13 A;  1XCQ L;  4KX6 B;  2G1E A;  2QEJ C;  2VZK B;  4NZL B;  3VR9 B;  3DWG C;  3ETR A;  1HZ5 A;  4HJG E;  1ZXI A;  2XN9 C;  4XE0 A;  1VLB A;  2CJN A;  4P16 A;  1YNT E;  2WU5 B;  1ZE3 D;  1JWS D;  2XNA C;  5H8Y E;  4HRS A;  3T3N A;  3MHZ A;  1C77 A;  1SF0 A;  2LGI A;  1L0Y B;  4A55 A;  1IUE A;  1N5X A;  1XCT L;  2WXR A;  3AE5 B;  1K51 A;  1ZDV A;  1RYJ A;  3MJ5 A;  1ZUD 2;  3KQ4 A;  2K22 A;  2FUG 1;  4A6Q A;  1DOX A;  1XF5 L;  1CK1 A;  4TMA B;  2RDH A;  1ZOY B;  3UI3 A;  1KH0 A;  3NUH B;  2PVO D;  2DYO A;  1HEZ E;  2Z8L A;  4XWT A;  3V3X A;  2JSV X;  3DWM A;  3B2G A;  2K9X A;  4HRO A;  3N9Y C;  2J42 A;  3E9S A;  1HXY D;  2M56 B;  1UWM A;  3AV8 A;  1SJH D;  3E56 A;  3FAH A;  3I57 A;  4RGN A;  5D7G A;  1NEN B;  2Y5P A;  1VR9 A;  4US8 A;  4YXD B;  5EE1 A;  1IBX A;  2WXL A;  1FRD A;  5EE3 A;  3T3O A;  4C7Y A;  5G5H A;  4D2K A;  1AWD A;  1BML C;  2WXF A;  4WIP A;  3EGR A;  2YEP F;  2WXH A;  1RFK A;  4WH4 A;  5T8I A;  2M0A A;  2QIE B;  3BVG A;  4TQ1 A;  1FXI A;  1ZPS A;  1J7A A;  1L6U A;  1UGJ A;  1XLO A;  1XXG A;  2QSD A;  3BK1 A;  1QLB B;  1VDV A;  3AMZ A;  1XO3 A;  2PIA A;  2EKI A;  4N6E B;  3B2F A;  3IT6 B;  1FCL A;  1JCK B;  1QIL A;  4M0W A;  3TEW A;  2WXM A;  1MHX A;  2DWQ A;  2WDV B;  2N0S B;  1I4G A;  1KLU D;  2BS4 B;  4YSZ B;  1GPX A;  5BYR A;  2QMT A;  4A90 A;  1HA5 A;  1WWT A;  1FFU A;  1FFV A;  1TS4 A;  4GDK B;  4USA A;  3AEE B;  1SIJ A;  3AH7 A;  2BYT A;  2JU6 X;  3TSS A;  1F2R C;  3GS2 A;  1I4R A;  4UDU C;  4OHJ A;  2WXJ A;  3NRZ A;  5HG2 A;  1JWA D;  2AQ1 B;  1WXQ A;  2LJI A;  1IGC A;  2W54 A;  1P7E A;  2L52 A;  1OQR A;  2JQR B;  2K5P A;  2RPV A;  1D6E C;  3ZJT A;  1BUI C;  3ZQ4 A;  3W5U B;  1PDX A;  1V97 A;  4ZRQ A;  1B1Z A;  2J53 A;  4EE2 A;  1XLQ A;  3AE9 B;  1AN8 A;  3Q8A A;  5BYS A;  3P4S B;  4L2Y A;  1MVK A;  1FEH A;  2IGH A;  5MPO A;  4N58 A;  1V1O A;  1L6V A;  2PW9 A;  2KQ4 X;  3NZ3 A;  1UUP A;  1OQQ A;  4MH8 A;  1KLG D;  2WQY B;  3C8Y A;  1FNW A;  2R61 A;  1L0X B;  3U2S C;  3AN1 A;  1EU3 A;  3TEZ A;  3IAM 1;  2ACZ B;  1ZDX A;  3AE4 B;  1RM6 C;  1CJE A;  1KTK A;  3GB1 A;  1ESF A;  2HTM E;  3AED B;  4XWW A;  1XLP A;  3ZJU A;  2W55 A;  2J4X A;  2WLB A;  2Y3A A;  1IBX B;  1JRO A;  1QOG A;  3LXF A;  2MJE A;  3R2T A;  3WCQ A;  1JML A;  3URY A;  4HEA 1;  4B0M A;  3W5V B;  1FD6 A;  2WXG A;  1GAQ B;  1KRH A;  4DXG A;  1UWX A;  1MPE A;  1QOF A;  2E6X A;  2BB5 A;  4RF0 A;  2IJ0 A;  1EU4 A;  3TEX A;  4NJC A;  3RPF C;  1QT9 A;  3NVY A;  1TS2 A;  5TSS A;  4ZOH C;  1CZP A;  2LEK A;  1RWS A;  3MFG A;  2WXO A;  4RNA A;  3FIL B;  1C76 A;  3VQI A;  3PO0 A;  1EWC A;  4TSS A;  2PKO A;  1FM0 D;  2GB1 A;  4HKQ A;  1FXA A;  2INN E;  4O1N A;  3RFZ B;  1VRA B;  3BII D;  3W1S A;  2L1A A;  4WQM A;  3AE2 B;  1PUT A;  1VZ8 A;  1K50 A;  3P4Q B;  5HFY A;  4RF1 A;  5FKA C;  1TS3 A;  2H88 B;  2I38 A;  2LHE A;  5AUK A;  1N60 A;  1T5X D;  2OED A;  3P4R B;  4OZA A;  1YJJ A;  2FE8 A;  3AEA B;  2AX5 A;  4AQ7 A;  1V1P B;  3V05 A;  1TKE A;  1TS5 A;  2ZW1 A;  4A9A A;  4KKI A;  1QOB A;  2KWD A;  5E6J A;  4ZHO A;  5BMI A;  2W82 A;  1YQ3 B;  3TUO A;  1FCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...