1UGJA

Solution structure of a murine hypothetical protein from riken cdna 2310057j16
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
141
structure length
141
Chain Sequence
GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2310057J16 protein
total genus 15
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08683 CAMSAP_CKK Microtubule-binding calmodulin-regulated spectrin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.360 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ugjA01
1UGJA
chains in the Genus database with same CATH superfamily
2KN4A 1F77A 2I38A 1OQYA 2PPHA 2GOWA 1B9RA 2G45B 1RAXA 1SE9A 3HK0A 2VH1A 2K0PA 2KQ4X 2WHIA 2WS3B 1KF6B 3SEBA 3GS2A 3PS6A 1IYFA 2WXPA 3PHXB 1ZXIA 4URKA 1ZOYB 2G9HD 2ZCCA 1WGKA 3I63C 4DHJD 3KH0A 2UU7A 3VTVA 4EKUA 1WI0A 1N63A 1P3QU 4A20A 2DAJA 3ZUNA 3P4PB 2GBKA 2KTRA 4PS7A 3VDZA 2GRIA 3RT3B 3PSEB 4B9KA 2OHFA 2KZRA 5TSSA 2L3ZA 4XE0A 3RFZB 4AWJA 1YJJA 2LVPA 5MPOA 5D3IB 4RH6A 1I4GA 2LEKA 2PLPA 2GI9A 5JZEB 2PE6B 2KNBA 2MJEA 3M3JA 1NI3A 3ZKJC 5JHAA 3L16A 3WIMA 1L0VB 1WRDB 2W82A 3Q69A 1FNUA 2DENB 3CF6E 3N9YC 1HXYD 5AZHA 3IXSA 4KKJA 4LDTB 4GGQA 2WNMA 1XXGA 3C8YA 1I4XA 3H8HA 4W9HA 1UBIA 1ZDVA 1OTRB 5IKCM 4AJYB 2PVOD 4LDTD 5G5HA 2ZNVB 3N3KB 1KLVA 1FPYA 1JRUA 3B9JA 3ZNID 1MPEA 2Z8LA 2KAJA 2KFKA 4JIOU 2BW2A 1T6BX 3KWVA 4PK1A 1UNSA 2WXIA 2CHXA 3HVDA 1HTOA 2W3SA 3R2TA 1WZ0A 1P1AA 4FHJA 1SJHD 2CU3A 2WX0A 3AB5A 2N9EB 1NBFC 3B0AA 1KLUD 4FULA 1AN8A 1DYQA 3ALBA 3U8ZA 4R3DA 1JWAD 1JWBD 1K52A 3IHPC 3V62A 1N60A 3VHTC 3LYYA 4IWQA 4WAAA 4BAXA 4LK0M 1Q0WB 4PS3A 2L0FA 3NHEB 3AU4A 3ENEA 3VRAB 4JGHB 4ZYSA 2V9HA 3GP7A 2O6VB 2MH7A 3AEEB 4OVZA 4E74A 5I4DA 4FN2A 1OQQA 5G5GA 2L8JA 2JRHA 2ICIA 2IGGA 1PUTA 4X57B 3H6NA 1JRPA 3R8BA 2XNAC 2N9LA 4HROA 3QWZB 5DPRA 2L00B 3U30A 1NENB 4Q2JA 2CHWA 3AE4B 1NVID 2HD5B 3JW0X 3W9CB 4AQ7A 3W1YA 4G0NB 1ET6A 2G1EA 3MC0B 4OVVA 2FAZA 1UF0A 3RNBC 3FKYA 2CU1A 3A33B 3VTUA 3WAMA 1QZEA 1JMLA 4BBNC 2JQRB 3EUB2 4C00A 2KC1A 4DXAB 1G6JA 3QX1A 1K8RB 1MG8A 1WWTA 1E9MA 1IBXA 3Q3FA 1YX6B 3HM3A 3P2BA 5BYSA 1FMAD 4HJKA 5HKHA 1V8CA 2DZMA 2KJ6A 5H92C 2WDTB 3OAWA 1FXIA 4DXFA 2N1WA 2ONQA 1P7EA 3V6EB 3DBSA 4P1BC 1T5XD 3RN9C 4XGAB 2KDEB 2HTME 4WQOB 3UINB 4N59A 4MGKE 2KQSA 3T9LA 1WM2A 4ICUA 2KWUB 4KGSA 2WU5B 1GB4A 4K7SA 1JALA 1YN5A 4KVGB 2KVZA 3N1ZC 4IWPA 3O13A 1SSNA 2BYVE 2CR5A 4JL9A 2RDHA 3B2GA 4GB9A 3RNEC 1EWCA 2YVCA 4W9FA 1S3SG 4LLGM 5D3DA 4BBNF 1EU4A 3DBRB 3K9PB 1YNTE 1WYGA 4YTPB 1OQRA 3RMKC 4PT5A 4B95A 3WAOA 4MGYE 2RD0A 1WJ6A 2KACA 2LVOA 4IUMB 4KZ0A 2M17A 3B1LX 3W5UB 2HJ8A 1V1PB 2DAFA 4IW0A 1QQRA 3SFEB 2MP2A 2LJ5A 2C9WB 3Q3OC 3A9JB 4RFBA 4ZRJA 4WIPA 2LI5A 3DWMA 1K53A 2JZ3B 5DPTA 1E5WA 4ZDVA 2V0GA 3A9KB 3BYYB 2YLMA 3OJ4B 1V49A 1D4BA 3RPFC 3ONSA 3ZQ4A 2QEJC 2N9PC 4ZRIA 2LUMA 3NS8A 5IP4D 1C1YB 5CHVC 4LNIA 3MJWA 1TS5A 3PPAA 3EECA 3K9OB 4AJWA 2G3QB 2UWQA 1EF5A 4NZLB 1R4MI 3ZJUA 3APCA 3V60A 1WY8A 1OGWA 2AX5A 1V81A 4N58A 4IM3A 1BT0A 1C3TA 1PYWD 1J8CA 2AWTA 2IO1B 4FA6A 1HZ5A 1TJEA 4G11A 1YD8U 3C0RB 2CJNA 4NQKE 1ZP0B 1XCTL 4HJGE 3QQ8B 4KKIA 2OJRA 2PE9A 1YIWA 1Y8RC 1C77A 3NVZA 2JY6A 3EFUA 1IUEA 3QK0A 1C9FA 2INPE 2RDGA 4JPSA 4MSMB 1BXTA 2BBCA 2LVQA 2GBJA 4KIKB 1C4PA 5JHBA 4IG7B 4CYEA 2CHZA 2QDFA 4ZRPA 4F8CB 1SJED 1WZ3A 1ROEA 4TSSA 4FJYA 3U7DA 3ZGZA 3U52E 2BKFA 2VH2A 5L83A 3A1QB 2W55A 1XF5L 4WJNA 5E6PA 1PGAA 1SE4A 4NY0A 2N0SB 1FXAA 3RNFC 2KWCA 2CJOA 3VR8B 2HJ1A 3SDLC 4JWSC 4H2AA 3NZUA 3PO0A 2GMIC 2V1YA 2AEHA 1WX9A 4W9CA 3N1YC 4I6LB 2MBBB 4EOYA 2O2VA 4DHJB 1SIFA 1SIJA 1C4AA 3RD2A 4EUTA 1YN3A 2WDRB 4HWIB 3DBLI 2G4SA 1GOZA 2C60A 3L0WB 1WF9A 1MVKA 1V1PA 2BTEA 4G3XB 4P16A 1UZXB 1AWDA 2INNE 1IP9A 4A55A 3Q8BA 4JE3B 1GG3A 2MQJA 2GBNA 3H1UA 3W5VB 2PEAA 3H9DA 1WGRA 1XD3B 5BO4B 1D6EC 1JROA 1DOYA 2ZPYA 2DNFA 2KWVB 2DYBA 4ANVA 2KDMA 2FNJB 3DBRI 4K1RB 3NZSA 3U2SC 2H89B 2C7NB 4G50A 1EWYC 2BYEA 2NBUA 2NVUI 1UH6A 3QIJA 2M4NA 4RGOS 4B0EA 2ZCBA 2D3AA 3P1MA 3M63B 1UGJA 1GPXA 2KFJA 3RNGC 2Z59B 3QHTA 4TQ0A 1SB3C 4TUUA 2G4DB 2L32A 1T0QC 3L10B 2LXCA 4IWOA 4ZOHC 1Z5SB 4A3OA 2WXNA 4GIVA 2FIFA 3GB1A 4C4VA 4HPLB 2MSED 1FCCC 1D5MC 3TEWA 3HVZA 1E8YA 2KN5A 4ZHOA 4GSWA 3PVLA 4YSYB 4II3B 3ZNZB 5IN7A 4IM0A 3U7ZA 3JYUA 2KANA 2IDYA 2C7HA 1TZOA 3IVFA 2K25A 2D3BA 2KMCA 2KLCA 4RGNA 2RMMA 5E6OA 2PJHA 3ZRFA 3B2FA 4LJOB 2PKOA 1KJTA 3RNCC 4HXDA 1V9JA 4WURA 4HEA1 3U4EG 3ETRA 1YQBA 1XLOA 3DWGC 4W9EA 2BVCA 5HHDG 3AULA 3T8MA 2QC8A 1X1MA 1V2YA 4UDUC 2BPSA 1UBQA 4EZLA 2NCNA 1T0SC 3V05A 4LNOA 2JXTA 3DVNU 1QOBA 2WGSA 3A4RA 2WDQB 1L6VA 1R4NB 3ZRCA 1RYJA 2ACZB 1CK1A 1RFKA 3P42A 2JZPA 3AEAB 1QOFA 3DQVA 4ANXA 1XEEA 1VRAB 4QAYA 5H8YE 2LRUA 2IO2B 4YXDB 2M8SA 4IKGA 3FILB 4DHZB 2L05A 2VRRB 1YN4A 1I35A 3AEBB 4NAMA 3LB8C 1SXTA 3URYA 4A6QA 3AE1B 2ZW1A 4F1SA 3DOWA 5EDSA 1B1ZA 4BOSC 4LCDE 3TCAA 2K8HA 3WANA 1ZKHA 2QCZA 3UQAA 5BMHA 2L52A 2IY1B 1VR9A 2FUHB 4IDIA 2EMSA 3KQ4A 3L4PA 3NY5A 3T3OA 4WWNA 3Q8EA 4MGIE 1GC7A 4II2B 2W54A 1FD6A 3NOBA 2V4LA 3JVZX 3PGEA 4BKSD 4M0WA 3PLVA 3Q6BA 1NYRA 2JWUA 4GDLA 2D3CA 1ZXHA 2LGDA 3AU5A 2I2YA 1RM6C 2WXLA 1Z2MA 2K3UA 3T3NA 2M56B 1P98A 4REZA 4W9KA 2W9NA 2WXQA 3VVWB 3BVZA 4K3CA 4PS8A 3AXCA 2SAKA 1E7PB 2JXXA 1GC6A 2KXJA 3NG0A 3VXWA 1UD7A 4WWPA 2J0JA 1RFAA 3KYCD 3WALA 4KSKC 1LFDA 2JX5A 1J19A 1WMHA 1L5PA 2WX1A 1U4AA 2AQ1B 3AE2B 3ZVVA 3HUIA 1XO3A 2PIAA 1HQRD 2EKEC 2K22A 4WQMA 3VRBB 2NBWB 5T8IA 4BVUC 4RNAA 2LHDA 1T0YA 1P7FA 1WGYA 3DDCB 1SGHA 1VZ7A 3KVFB 3QA8A 4AOFA 5AZGA 1TIFA 3L54A 2BB5A 2K8BA 3X23A 5E6JA 4KDLB 3OWEB 3C19A 2FCSA 3RZWC 2L1AA 3IT6B 1WGHA 1KLGD 2KVRA 2V3SA 1M94A 3FC4A 4DK5A 4B6WA 4EEWA 4BZAA 1QKZA 1ENFA 2ZEQA 1J7BA 4M02A 2ON8A 1VCBA 3NZ3A 2VZKB 3VUWA 4KZCA 2AL6A 3PLUA 2J7QB 1FM0D 3J9CA 4YWGG 3E9SA 3ZNGC 1GB1A 3DPDA 1PQSA 3TJPA 3VUXA 3KUZA 2UYZB 3BVGA 3BINA 5AZFA 1TZ1A 3TUOA 2JF5A 1AARA 2Y3AA 2IGHA 3NRZA 2MHJA 3CIRB 4F7ZA 1TS4A 2PW9A 1MHXA 4IOIE 1MG4A 2QIEB 4XZ4A 3HM6X 1Q1OA 4S0RA 1TKGA 4LNFA 3AE6B 3N32A 4WJQA 1TS2A 2NS5A 1FCLA 2M1MA 4MH8A 2CKHB 3TBLD 1C79A 1S1QB 3EGRA 2ZNVC 4FJVB 2DX5B 1WGDA 1NDDA 3EHVA 4KGTA 4S17A 3GE3C 3A1QA 3QARA 1J7AA 3KLSX 5CHWA 3I5JC 1JW9D 5J2RA 2DBYA 1WXSA 2J0KA 4LJPB 3PHWB 4MELA 4GDLB 3H7PA 4RM8A 1UWXA 1TKEA 3R7RA 1KH0A 3KW5B 2K9XA 4MGZE 3M95A 4M0WB 4GXBA 1WXVA 2WLBA 3D32A 3CSFA 5EE1A 3PRPB 1BUIC 4MEMA 2KT7A 1DOXA 2IGDA 3PREA 4JLCA 2IJ0A 2LHEA 1CMXB 1FXTB 4GOCA 2REXA 5D7GA 2EKIA 2KJHB 3LDZE 4ZYNA 5IOIA 4ASWC 2QHOA 4HPPA 3AMZA 1YQ3B 1L0XB 4MM3B 2LGSA 2PMVA 4ZHPA 2ZPNA 2N4FA 3ZYYX 1SEBD 2KD0A 4KDIC 5GMVA 1RWSA 1AYFA 4MSQB 4XC2A 2K8CA 2LRWA 2L83A 2V3NA 2Z0EB 2LASA 3NVVA 1I4RA 4CQNA 4PYUA 1E6EB 4HK2A 1K51A 4NAWA 1TTNA 1F9JA 1EO6A 2RPQA 1L6UA 3AE7B 3B08A 1QILA 1E8WA 1ZPSA 2JT4B 3A9KA 4L1BA 1AW7A 2NTTA 3QJZA 4C80A 1NYQA 4LNKA 3AV8A 4WJOA 4US9A 4EZJA 1I4PA 4OZAA 2ZZPB 5AUKA 1JWMD 1ZUD2 5IO9A 1D5XC 4M8MA 1R4NI 2N7JA 3IG3A 1N6ZA 2BYTA 1TYGB 2RDBC 1P0RA 1YJ1A 2FBWB 2KX3A 5E6NA 2ZVOA 1GAQB 1WXQA 1TY0A 2LMCA 3IAS1 1UUPA 1IBXB 2DYOA 2C7MB 3QCAA 2Q5WD 4NAWB 3V61A 2FE8A 5FR3A 4HPMB 4EZKA 1RLFA 2BS2B 1TBEA 2I1JA 3ZTCA 1A70A 2LGXA 3Q14C 4KSLC 3FAHA 1TT5B 2IY0B 2XN9C 1F0ZA 3KUDB 3Q3MC 2WDVB 5G2NA 4XWWA 2Z0DB 4WAFA 3TMPB 4N6EB 1T0RC 1JQ4A 3PRZA 4BKGA 1YX5B 2GB1A 2LFIA 1FFVA 4JX1C 2IO3B 1Y56A 5GXGB 4XDDA 1JWSD 1UELA 4A8XC 3AH7A 4C56C 4MACA 1WJNA 5D94A 4I6NB 4HDOA 4YSXB 4YTMB 5J17A 3ZDTA 2LD9A 1A5RA 1VZ8A 4A9AA 4NJ7A 1LXDA 2NBVB 2E3TA 3KUCB 2ASQA 3N30A 5CHFA 4BKTA 1N5XA 2L7RA 2QSDA 1FIQA 2MW5A 4DDID 1OEYA 3A4SC 4WWOA 2WXJA 2PTLA 3W1SC 5EE9A 2RPVA 1MFWA 2MBQA 4HCPB 5LXIB 4HRSA 2MBOA 3DBLB 2IPKD 1XQQA 3L08A 1J7CA 4ACFA 2QILA 3JSVA 4MH0E 3GOEA 4RGTA 2DYMA 1BMLC 3ECIA 3PZDA 1RRBA 1HE8A 4US8A 3MFGA 1ISNA 4NJ6A 4OVUA 2NPTA 3ZW3A 3LXFA 3TL5A 3PRMB 2INDC 2MX2A 2KQ7A 1HTQA 3AE8B 3P4QB 2O2VB 4DDGD 2M0AA 1V86A 3VH4B 2WXRA 3M62B 1NI2A 1KM7A 3O65B 2YEPB 4LTUA 4ANWA 2GLSA 4WH4A 1TGZB 1LM8B 2JSVX 1SE3A 1ET9A 1D3ZA 2D5GA 4ZRKA 2N7EA 5CTRC 4N9F4 1JCKB 3DVNV 4NJCA 2MJDA 3P4RB 4KX6B 2FCMA 2JVCA 1L4DB 1GJZA 1F1HA 1L0YB 5DPSA 4C4VB 3R66C 1V6EA 4MT5A 3OLMD 1F2RI 1OEYJ 1ACCA 4A90A 2LUEA 1E7VA 3SHQA 4P1CC 3ZDMC 2CS4A 5BYQA 4K3BA 4OZBA 2A4ZA 4RMAA 3BWUD 4ITKA 1EF1A 1MI0A 1KFYB 5HI1A 4FJZA 1PDXA 3APDA 4WWMA 2LZ6A 2KOXA 2BS4B 5HG2A 4OW0A 3WAPA 5CX3A 5EE3A 4C7YA 3GE8C 4IM2A 4FHKA 3L17A 4J3OD 1V1OA 1YQ4B 3EC8A 4RGMA 4W9IA 2RGFA 4NNJB 4BOZB 1XT9B 3AEFB 5IAAC 4FXCA 2LJIA 2MJ3A 1I7HA 4NQLB 1N61A 4M01A 2WXHA 4K7UA 4KGRA 1QOAA 4RF1A 2KMAA 2OJWA 2D10A 4W9LA 2J42A 2JWZA 2WXMA 4HLEA 4E71A 2KDIA 4MM3A 2LWPA 2O6VA 3I3TB 3S2AA 1E7UA 2JYEA 3X0WA 2BYFA 2BT6A 3R7QA 4BKSA 2BKRB 2MCNB 5IA7A 3AECB 3VUYA 1ESFA 1EU3A 4GLSC 1VLBA 2KTFA 3VQIA 1WE7A 2K6QA 2DZKA 3QC8B 5KHQA 3DBHI 4MDKE 4HKQA 2D2QA 5C3JB 4DXGA 1KTKA 2FCQA 4EE2A 3EFCA 4GMVA 1WJ4A 1XLNA 2N9KA 5D2MB 2FUG1 2B3AA 2WXFA 3DVGX 1XCQL 2WXGA 1V5TA 1ZGUB 1QOGA 5C1ZA 2ZW0A 3ML9A 2DHZA 4I6PA 3EA6A 3PV1A 2D3GA 1WH3A 3NVYA 3RULA 4E3CA 4ARIA 1QF6A 2K5PA 2LGIA 1I4QA 2Y5CA 2N9XA 4TMAB 3HHMA 1FEHA 4JWUC 2AQ2B 3ZTDA 2KK8A 3QAQA 4RM9A 2KDBA 1H4RA 3W1SA 1DGJA 4KIKA 1V5OA 4RF0A 4DQOC 5FK9C 2NR2A 5EE0A 2R61A 1OFFA 3NS1A 3MJ5A 3TSSA 1C76A 1LO5D 4FLHA 4WJPA 2L0TA 1VJKA 1F52A 4BFRA 3Q8AA 4K7WA 1CJEA 3TEYA 3NVWA 4HDQA 3UI3A 2N7DA 3WCQA 3L13A 1L4ZB 4PYZA 4LNNA 4J6IA 4MJSA 3UIOB 4KV2A 1CQVA 2TSSA 3GZNB 2OEDA 3WA0A 4W9GA 3BYTB 2A5UA 2MBEA 2XBBC 2D11A 2KKCA 1VZ6A 4TKNA 3P4SB 2IYDB 2K6DB 2ZVNA 3Q3NC 2X8XX 3ZJTA 2Y5BB 1WYWB 1E8ZA 2EELA 1UGMA 5C2TB 5C23A 4OHJA 3I57A 2MLBA 3H7SA 1UWMA 4AUQC 1DOIA 3UQBA 5DCNA 2MRPA 2ZJDA 4CHKA 1LQBA 1WM3A 5JH5C 4XWTA 2KX0A 2KLGA 1R7SA 4K81A 2NPTB 2BF8B 2KDFB 5TR5A 1K50A 3JSVB 3MHZA 2IBIB 1EM7A 2MP2B 3MHSD 4A3PA 3SR6A 4ANUA 4ZRQA 1VDVA 2XK5B 3MTNB 4TQ1A 1R4MB 1TY2A 3BVMA 1FNVA 1WX8A 2KC2A 1WMHB 3SFDB 3DHIC 3N20C 1STEA 2J53A 3DCGA 4JQWC 3TEXA 1EUVB 2WXKA 1M4VA 2QJLA 1IPGA 4M00A 1MJDA 3AE3B 5DPWA 3PZ8A 1NEKB 3Q8FA 4P6VF 1WR1A 3MC9A 1TS3A 2NTSA 1V80A 3IT4B 3N1XC 3VTWA 3CMMB 5L95C 3ZXRA 2IO0B 2XK5A 1P9DU 3AE9B 1C4CA 1PFDA 2M19A 3HIZA 3RNAC 4GDKB 2BGFA 2K1FA 4XDCA 2KJRA 2HE7A 2W3RA 5BMGA 2BQQA 2JUOA 1KRHA 2JZZA 5BMIA 3MP9A 1HZ6A 4USAA 1L7YA 3CWIA 3VR9B 2RSUA 3H7PB 3KWLA 4YTNB 4HCNB 2YEPF 3MC8A 3CSTA 3VH3B 4C7ZA 1ZDXA 2N1VA 2E6XA 3UGBB 3LJ3A 1WXAA 3TEZA 4YSZB 1FO4A 1N62A 3FILA 1SF0A 1WR6E 4P7IA 3E56A 4W9JA 4MJSB 4OZCA 5HFYA 2MEKA 2O6VD 2JPHA 4DBGA 1E10A 2D07B 2JU6X 4NPNA 2XEWA 3IAM1 4M8NA 2BWES 1YJIA 3AM9A 3A9JA 3ZO5B 2AYOB 1IGCA 2JRIB 1MHHE 4AP4C 1V97A 3AEGB 1ZE3D 2GBMA 3IBEA 2J52A 3BY4B 1I4HA 2EMTA 2V4IB 2L76A 3Q2AC 1SBBB 4GN1A 5JXVA 3UIPB 2FIDA 5AEKB 3V6CB 1I42A 1FNWA 3ZIMA 1SE2A 1FRRA 1D5ZC 5FKAC 3AN1A 4O1NA 2KWDA 1E8XA 4YT0B 2INCC 4TV3A 1HEZE 2C5LC 2DLBA 2VZKD 3NUHB 2DZIA 1CZPA 4FADA 3R2IA 2PVGC 3ABVB 3BZDB 1WGGA 2IZVB 3I9V1 3BK2A 2AQ3B 1WX7A 3DHHC 1LGRA 4AS1A 5KHOA 1J0GA 1KOTA 3Q8CA 2QMTA 1WJUA 2BWFA 3PT2B 3ZLZA 4L23A 2DWQA 4B0MA 2KFKB 1TKYA 3PZ7A 4D2KA 2Y5PA 2KYWA 4IC7B 3IFWB 3OG5A 3VFKA 1XLQA 2WXOA 5J18A 2HTHA 2RR9A 2M0XA 5LXHA 3RI7C 2J0MA 2R2QA 3UF8A 4ARCA 1PGXA 3OJ3A 4HVBA 2B76B 2NMQA 3TIXA 2WYQA 1N5WA 3APFA 1WXMA 3ZXVA 1VD2A 4YL8A 4HKZE 2R2OA 3KYDD 2HDEA 3PTFC 3GZNI 1XLPA 2K39A 3SD5A 2MA9B 2BS3B 2KMMA 1H8CA 1QT9A 5LNK1 3DHGC 2I1KA 1IGDA 5D6JB 1Q10A 4XYCA 4L2YA 2LXAA 2J4XA 3W2DA 3VAWA 2MWSB 3AE5B 3AEDB 1HA5A 1YMHE 1E90A 3RZFA 2OOBB 2KHWB 2LGYA 1JWUD 4DWFA 2WQYB 3DVGY 2GBRA 4W9DA 2KTRB 3RYTA 1PGBA 1WRIA 3ZNHB 4CO7A 2WWZA 2BB6A 3RUIB 4RCOA 4GDKA 5AUIA 1WSPA 3Q3JA 3HRDD 4XX5A 2KO3A 5LLIA 2WU2B 1Q5WB 1WFYA 3AI5A 4EFOA 2AL3A 2V3PA 1L2NA 1FFUA 1GUAB 2SEBD 1WIAA 2FCNA 3V3XA 4GU2A 5FR6A 3RCZA 3R3MA 3BK1A 4ICVA 1QLBB 1C78A 5G55A 1E0ZA 2WP9B 4DHZE 3ML8A 5BYRA 1WE6A 3DBHB 1FRDA 3SU8X 3NJTA 1F2RC 3BIID 2X38A 3P63A 1T3QA 4FBJB 2H88B 1ZW7A 1GNUA 1YOVB 2JYTA 3ZJVA 2DZJA 2MBHA
chains in the Genus database with same CATH topology
1KH0A 2AQ2B 2K9XA 2KN4A 1SIJA 1C4AA 3W1SA 1DGJA 1F77A 2WLBA 4RF0A 2I38A 4DQOC 1YN3A 5FK9C 2WDRB 5EE1A 1BUIC 1B9RA 5EE0A 1DOXA 2R61A 1GOZA 2IGDA 2K0PA 1OFFA 2KQ4X 2WS3B 3NS1A 1KF6B 2IJ0A 3SEBA 3GS2A 3MJ5A 3TSSA 2WXPA 1C76A 1MVKA 2LHEA 1V1PA 1LO5D 1ZXIA 2BTEA 4P16A 1ZOYB 1VJKA 2G9HD 5D7GA 2EKIA 1AWDA 2INNE 3Q8AA 3AMZA 1WGKA 1CJEA 1YQ3B 3NVWA 1L0XB 4A55A 3TEYA 3Q8BA 3UI3A 4JE3B 4MM3B 3WCQA 2PMVA 1N63A 4ZHPA 1L4ZB 3W5VB 3ZYYX 1SEBD 3P4PB 1CQVA 1RWSA 2TSSA 1AYFA 2GRIA 1D6EC 2OEDA 2L83A 3BYTB 2OHFA 5TSSA 1JROA 4XE0A 3RFZB 2V3NA 1YJJA 1DOYA 1VZ6A 3NVVA 3P4SB 5MPOA 1I4RA 5D3IB 4CQNA 4RH6A 1I4GA 3ZJTA 1E6EB 2LEKA 1K51A 2KDMA 2EELA 2PLPA 2GI9A 2MJEA 1NI3A 1L6UA 5C2TB 3U2SC 3AE7B 1QILA 2H89B 1ZPSA 4OHJA 1L0VB 3I57A 4L1BA 1AW7A 2NTTA 1UWMA 2W82A 3Q69A 4C80A 1DOIA 1EWYC 1NYQA 1FNUA 3AV8A 4US9A 3N9YC 1I4PA 1HXYD 3IXSA 4OZAA 4KKJA 4XWTA 4RGOS 2WNMA 1R7SA 1JWMD 5AUKA 1ZUD2 1D5XC 1XXGA 3C8YA 2N7JA 1I4XA 3H8HA 1ZDVA 4B0EA 2BYTA 3P1MA 2PVOD 1UGJA 1TYGB 1GPXA 1K50A 5G5HA 3MHZA 3B9JA 4TQ0A 1MPEA 1EM7A 1SB3C 2Z8LA 2FBWB 2KAJA 2L32A 3SR6A 4ZRQA 1VDVA 2BW2A 1T6BX 4ZOHC 3KWVA 1GAQB 4TQ1A 1TY0A 1UNSA 1WXQA 2WXIA 2WXNA 1TY2A 2LMCA 3IAS1 1UUPA 1IBXB 3GB1A 3HVDA 3BVMA 1FNVA 2DYOA 1FCCC 2Q5WD 4NAWB 3SFDB 2W3SA 1D5MC 3R2TA 3TEWA 3HVZA 2FE8A 1STEA 5FR3A 2J53A 3TEXA 4ZHOA 1SJHD 2WXKA 2CU3A 3AB5A 4YSYB 1M4VA 2QJLA 2BS2B 3AE3B 1KLUD 3U7ZA 1AN8A 2IDYA 3PZ8A 1DYQA 1TZOA 1NEKB 1A70A 3Q8FA 4P6VF 4R3DA 4RGNA 1TS3A 1JWAD 2RMMA 2NTSA 3FAHA 1JWBD 3IT4B 1K52A 3B2FA 2XN9C 1F0ZA 2PKOA 2WDVB 4WURA 1N60A 4XWWA 4HEA1 3U4EG 3ETRA 3LYYA 4WAFA 4LK0M 1XLOA 3AE9B 3DWGC 1C4CA 1PFDA 5HHDG 2M19A 4N6EB 1JQ4A 3VRAB 4ZYSA 3GP7A 2GB1A 2LFIA 4UDUC 4GDKB 2MH7A 3AEEB 1FFVA 4OVZA 4JX1C 5I4DA 4XDCA 5GXGB 1Y56A 1OQQA 4XDDA 1JWSD 3V05A 4A8XC 2JXTA 2W3RA 5G5GA 3AH7A 1QOBA 2ICIA 5BMGA 4C56C 2IGGA 4MACA 1PUTA 1L6VA 2WDQB 1KRHA 1JRPA 3R8BA 1RYJA 2ACZB 1CK1A 1RFKA 2N9LA 2XNAC 4HROA 3P42A 4YSXB 4YTMB 2JZPA 3AEAB 1QOFA 5BMIA 1XEEA 1VRAB 1HZ6A 3MP9A 4USAA 1VZ8A 4A9AA 1NENB 4Q2JA 3AE4B 1NVID 3CWIA 5H8YE 3VR9B 3W9CB 4YXDB 2E3TA 4AQ7A 3KWLA 4YTNB 4IKGA 3FILB 1ET6A 2G1EA 3MC0B 2YEPF 1N5XA 1YN4A 4C7ZA 1ZDXA 2QSDA 1FIQA 2E6XA 1JMLA 2JQRB 3EUB2 3TEZA 3AEBB 4NAMA 4YSZB 1FO4A 1N62A 3FILA 3LB8C 1SF0A 1SXTA 3URYA 2WXJA 4A6QA 1WWTA 2PTLA 3E56A 1E9MA 1IBXA 3AE1B 2ZW1A 5EE9A 2RPVA 4OZCA 1B1ZA 2MEKA 5HFYA 5BYSA 1FMAD 1E10A 2JU6X 1V8CA 3IAM1 4HRSA 2IPKD 5H92C 1J7CA 1YJIA 1FXIA 2QILA 3AM9A 4DXFA 5BMHA 4RGTA 2L52A 2DYMA 1BMLC 2ONQA 1IGCA 1P7EA 1VR9A 1MHHE 4IDIA 4US8A 1V97A 3KQ4A 3MFGA 3L4PA 1T5XD 3AEGB 1ZE3D 3T3OA 3Q8EA 2HTME 2J52A 1I4HA 3LXFA 4N59A 2V4IB 2W54A 1FD6A 1SBBB 3AE8B 3P4QB 5JXVA 4M0WA 4KGSA 2M0AA 2WU5B 1FNWA 1GB4A 1JALA 1NYRA 2WXRA 1SE2A 2JWUA 1YN5A 1FRRA 1D5ZC 1ZXHA 5FKAC 3AN1A 4O1NA 2KWDA 4YT0B 2I2YA 1RM6C 1HEZE 2WXLA 2VZKD 2DLBA 3NUHB 1CZPA 3O13A 1SSNA 3R2IA 2PVGC 2YEPB 4LTUA 2K3UA 3ABVB 3T3NA 3BZDB 2M56B 4WH4A 3I9V1 4REZA 2RDHA 3B2GA 3BK2A 2WXQA 2AQ3B 1EWCA 2JSVX 3BVZA 2SAKA 1SE3A 1ET9A 1E7PB 4LLGM 4AS1A 5D3DA 1EU4A 2D5GA 3Q8CA 2QMTA 1YNTE 1WYGA 4YTPB 1JCKB 4L23A 2JX5A 4NJCA 1OQRA 2MJDA 2DWQA 3P4RB 4PT5A 4B0MA 4KX6B 1L5PA 1L4DB 1TKYA 3PZ7A 4D2KA 2Y5PA 1L0YB 2KACA 2AQ1B 3AE2B 1XLQA 3HUIA 2WXOA 1XO3A 2PIAA 3W5UB 4MT5A 1HQRD 1F2RI 2K22A 1V1PB 1ACCA 4A90A 1QQRA 4WQMA 4ARCA 3SFEB 1PGXA 3VRBB 5T8IA 4RFBA 2B76B 5BYQA 4RNAA 2NMQA 2LHDA 4WIPA 4OZBA 1N5WA 3DWMA 1K53A 1P7FA 3BWUD 4ITKA 1MI0A 2V0GA 4HKZE 3BYYB 1VZ7A 1KFYB 5HI1A 1PDXA 3RPFC 1D4BA 3ZQ4A 2BB5A 4WWMA 2BS4B 2HDEA 5HG2A 2QEJC 4OW0A 1XLPA 5E6JA 2LUMA 2BS3B 5EE3A 2KMMA 4C7YA 3OWEB 1QT9A 5LNK1 1TS5A 4J3OD 1V1OA 1IGDA 1YQ4B 4RGMA 2L1AA 1Q10A 3IT6B 1KLGD 4L2YA 4NZLB 2J4XA 3W2DA 3ZJUA 3FC4A 3AE5B 3AEDB 3AEFB 1HA5A 2AX5A 1QKZA 4N58A 1ENFA 2LJIA 1YMHE 1J7BA 1PYWD 2MJ3A 4FXCA 1I7HA 2ON8A 1N61A 2WXHA 3NZ3A 1JWUD 1HZ5A 1TJEA 2VZKB 4KGRA 1QOAA 2WQYB 4RF1A 1FM0D 2CJNA 1ZP0B 1XCTL 3J9CA 4YWGG 3E9SA 1PGBA 2J42A 1GB1A 4HJGE 1WRIA 2WXMA 4KKIA 2BB6A 4RCOA 1C77A 3BVGA 3NVZA 2JYEA 5AUIA 1IUEA 1C9FA 1WSPA 3TUOA 3HRDD 2BT6A 2INPE 2RDGA 4JPSA 1BXTA 2BBCA 2Y3AA 1C4PA 2IGHA 2WU2B 3AECB 1ESFA 3NRZA 1EU3A 3CIRB 4GLSC 1VLBA 1TS4A 3VQIA 4ZRPA 2PW9A 2V3PA 1MHXA 4IOIE 1SJED 1FFUA 2QIEB 2SEBD 1ROEA 3V3XA 4TSSA 4HKQA 3BK1A 5C3JB 4DXGA 1TKGA 3ZGZA 1KTKA 1QLBB 1C78A 3U52E 4EE2A 3AE6B 1E0ZA 2WP9B 2W55A 1XF5L 1XLNA 2N9KA 1TS2A 5BYRA 1FCLA 1PGAA 1FRDA 4MH8A 2FUG1 2WXFA 1XCQL 1SE4A 2WXGA 1C79A 1F2RC 3BIID 1QOGA 3EGRA 2N0SB 2X38A 1FXAA 3P63A 2ZW0A 1T3QA 4KGTA 2H88B 2CJOA 1J7AA 3KLSX 3EA6A 3VR8B 4JWSC 4H2AA 1JW9D 2DBYA 3NVYA 3PO0A 4ARIA 1QF6A 2K5PA 2JYTA 2LGIA 1I4QA 2Y5CA 3ZJVA 4GDLB 4TMAB 1FEHA 1UWXA 4JWUC 1TKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGJ A; 
#chains in the Genus database with same CATH topology
 2KN4 A;  1F77 A;  2I38 A;  1OQY A;  2PPH A;  2GOW A;  1B9R A;  2G45 B;  1RAX A;  1SE9 A;  3HK0 A;  2VH1 A;  2K0P A;  2KQ4 X;  2WHI A;  2WS3 B;  1KF6 B;  3SEB A;  3GS2 A;  3PS6 A;  1IYF A;  2WXP A;  3PHX B;  1ZXI A;  4URK A;  1ZOY B;  2G9H D;  2ZCC A;  1WGK A;  3I63 C;  4DHJ D;  3KH0 A;  2UU7 A;  3VTV A;  4EKU A;  1WI0 A;  1N63 A;  1P3Q U;  4A20 A;  2DAJ A;  3ZUN A;  3P4P B;  2GBK A;  2KTR A;  4PS7 A;  3VDZ A;  2GRI A;  3RT3 B;  3PSE B;  4B9K A;  2OHF A;  2KZR A;  5TSS A;  2L3Z A;  4XE0 A;  3RFZ B;  4AWJ A;  1YJJ A;  2LVP A;  5MPO A;  5D3I B;  4RH6 A;  1I4G A;  2LEK A;  2PLP A;  2GI9 A;  5JZE B;  2PE6 B;  2KNB A;  2MJE A;  3M3J A;  1NI3 A;  3ZKJ C;  5JHA A;  3L16 A;  3WIM A;  1L0V B;  1WRD B;  2W82 A;  3Q69 A;  1FNU A;  2DEN B;  3CF6 E;  3N9Y C;  1HXY D;  5AZH A;  3IXS A;  4KKJ A;  4LDT B;  4GGQ A;  2WNM A;  1XXG A;  3C8Y A;  1I4X A;  3H8H A;  4W9H A;  1UBI A;  1ZDV A;  1OTR B;  5IKC M;  4AJY B;  2PVO D;  4LDT D;  5G5H A;  2ZNV B;  3N3K B;  1KLV A;  1FPY A;  1JRU A;  3B9J A;  3ZNI D;  1MPE A;  2Z8L A;  2KAJ A;  2KFK A;  4JIO U;  2BW2 A;  1T6B X;  3KWV A;  4PK1 A;  1UNS A;  2WXI A;  2CHX A;  3HVD A;  1HTO A;  2W3S A;  3R2T A;  1WZ0 A;  1P1A A;  4FHJ A;  1SJH D;  2CU3 A;  2WX0 A;  3AB5 A;  2N9E B;  1NBF C;  3B0A A;  1KLU D;  4FUL A;  1AN8 A;  1DYQ A;  3ALB A;  3U8Z A;  4R3D A;  1JWA D;  1JWB D;  1K52 A;  3IHP C;  3V62 A;  1N60 A;  3VHT C;  3LYY A;  4IWQ A;  4WAA A;  4BAX A;  4LK0 M;  1Q0W B;  4PS3 A;  2L0F A;  3NHE B;  3AU4 A;  3ENE A;  3VRA B;  4JGH B;  4ZYS A;  2V9H A;  3GP7 A;  2O6V B;  2MH7 A;  3AEE B;  4OVZ A;  4E74 A;  5I4D A;  4FN2 A;  1OQQ A;  5G5G A;  2L8J A;  2JRH A;  2ICI A;  2IGG A;  1PUT A;  4X57 B;  3H6N A;  1JRP A;  3R8B A;  2XNA C;  2N9L A;  4HRO A;  3QWZ B;  5DPR A;  2L00 B;  3U30 A;  1NEN B;  4Q2J A;  2CHW A;  3AE4 B;  1NVI D;  2HD5 B;  3JW0 X;  3W9C B;  4AQ7 A;  3W1Y A;  4G0N B;  1ET6 A;  2G1E A;  3MC0 B;  4OVV A;  2FAZ A;  1UF0 A;  3RNB C;  3FKY A;  2CU1 A;  3A33 B;  3VTU A;  3WAM A;  1QZE A;  1JML A;  4BBN C;  2JQR B;  3EUB 2;  4C00 A;  2KC1 A;  4DXA B;  1G6J A;  3QX1 A;  1K8R B;  1MG8 A;  1WWT A;  1E9M A;  1IBX A;  3Q3F A;  1YX6 B;  3HM3 A;  3P2B A;  5BYS A;  1FMA D;  4HJK A;  5HKH A;  1V8C A;  2DZM A;  2KJ6 A;  5H92 C;  2WDT B;  3OAW A;  1FXI A;  4DXF A;  2N1W A;  2ONQ A;  1P7E A;  3V6E B;  3DBS A;  4P1B C;  1T5X D;  3RN9 C;  4XGA B;  2KDE B;  2HTM E;  4WQO B;  3UIN B;  4N59 A;  4MGK E;  2KQS A;  3T9L A;  1WM2 A;  4ICU A;  2KWU B;  4KGS A;  2WU5 B;  1GB4 A;  4K7S A;  1JAL A;  1YN5 A;  4KVG B;  2KVZ A;  3N1Z C;  4IWP A;  3O13 A;  1SSN A;  2BYV E;  2CR5 A;  4JL9 A;  2RDH A;  3B2G A;  4GB9 A;  3RNE C;  1EWC A;  2YVC A;  4W9F A;  1S3S G;  4LLG M;  5D3D A;  4BBN F;  1EU4 A;  3DBR B;  3K9P B;  1YNT E;  1WYG A;  4YTP B;  1OQR A;  3RMK C;  4PT5 A;  4B95 A;  3WAO A;  4MGY E;  2RD0 A;  1WJ6 A;  2KAC A;  2LVO A;  4IUM B;  4KZ0 A;  2M17 A;  3B1L X;  3W5U B;  2HJ8 A;  1V1P B;  2DAF A;  4IW0 A;  1QQR A;  3SFE B;  2MP2 A;  2LJ5 A;  2C9W B;  3Q3O C;  3A9J B;  4RFB A;  4ZRJ A;  4WIP A;  2LI5 A;  3DWM A;  1K53 A;  2JZ3 B;  5DPT A;  1E5W A;  4ZDV A;  2V0G A;  3A9K B;  3BYY B;  2YLM A;  3OJ4 B;  1V49 A;  1D4B A;  3RPF C;  3ONS A;  3ZQ4 A;  2QEJ C;  2N9P C;  4ZRI A;  2LUM A;  3NS8 A;  5IP4 D;  1C1Y B;  5CHV C;  4LNI A;  3MJW A;  1TS5 A;  3PPA A;  3EEC A;  3K9O B;  4AJW A;  2G3Q B;  2UWQ A;  1EF5 A;  4NZL B;  1R4M I;  3ZJU A;  3APC A;  3V60 A;  1WY8 A;  1OGW A;  2AX5 A;  1V81 A;  4N58 A;  4IM3 A;  1BT0 A;  1C3T A;  1PYW D;  1J8C A;  2AWT A;  2IO1 B;  4FA6 A;  1HZ5 A;  1TJE A;  4G11 A;  1YD8 U;  3C0R B;  2CJN A;  4NQK E;  1ZP0 B;  1XCT L;  4HJG E;  3QQ8 B;  4KKI A;  2OJR A;  2PE9 A;  1YIW A;  1Y8R C;  1C77 A;  3NVZ A;  2JY6 A;  3EFU A;  1IUE A;  3QK0 A;  1C9F A;  2INP E;  2RDG A;  4JPS A;  4MSM B;  1BXT A;  2BBC A;  2LVQ A;  2GBJ A;  4KIK B;  1C4P A;  5JHB A;  4IG7 B;  4CYE A;  2CHZ A;  2QDF A;  4ZRP A;  4F8C B;  1SJE D;  1WZ3 A;  1ROE A;  4TSS A;  4FJY A;  3U7D A;  3ZGZ A;  3U52 E;  2BKF A;  2VH2 A;  5L83 A;  3A1Q B;  2W55 A;  1XF5 L;  4WJN A;  5E6P A;  1PGA A;  1SE4 A;  4NY0 A;  2N0S B;  1FXA A;  3RNF C;  2KWC A;  2CJO A;  3VR8 B;  2HJ1 A;  3SDL C;  4JWS C;  4H2A A;  3NZU A;  3PO0 A;  2GMI C;  2V1Y A;  2AEH A;  1WX9 A;  4W9C A;  3N1Y C;  4I6L B;  2MBB B;  4EOY A;  2O2V A;  4DHJ B;  1SIF A;  1SIJ A;  1C4A A;  3RD2 A;  4EUT A;  1YN3 A;  2WDR B;  4HWI B;  3DBL I;  2G4S A;  1GOZ A;  2C60 A;  3L0W B;  1WF9 A;  1MVK A;  1V1P A;  2BTE A;  4G3X B;  4P16 A;  1UZX B;  1AWD A;  2INN E;  1IP9 A;  4A55 A;  3Q8B A;  4JE3 B;  1GG3 A;  2MQJ A;  2GBN A;  3H1U A;  3W5V B;  2PEA A;  3H9D A;  1WGR A;  1XD3 B;  5BO4 B;  1D6E C;  1JRO A;  1DOY A;  2ZPY A;  2DNF A;  2KWV B;  2DYB A;  4ANV A;  2KDM A;  2FNJ B;  3DBR I;  4K1R B;  3NZS A;  3U2S C;  2H89 B;  2C7N B;  4G50 A;  1EWY C;  2BYE A;  2NBU A;  2NVU I;  1UH6 A;  3QIJ A;  2M4N A;  4RGO S;  4B0E A;  2ZCB A;  2D3A A;  3P1M A;  3M63 B;  1UGJ A;  1GPX A;  2KFJ A;  3RNG C;  2Z59 B;  3QHT A;  4TQ0 A;  1SB3 C;  4TUU A;  2G4D B;  2L32 A;  1T0Q C;  3L10 B;  2LXC A;  4IWO A;  4ZOH C;  1Z5S B;  4A3O A;  2WXN A;  4GIV A;  2FIF A;  3GB1 A;  4C4V A;  4HPL B;  2MSE D;  1FCC C;  1D5M C;  3TEW A;  3HVZ A;  1E8Y A;  2KN5 A;  4ZHO A;  4GSW A;  3PVL A;  4YSY B;  4II3 B;  3ZNZ B;  5IN7 A;  4IM0 A;  3U7Z A;  3JYU A;  2KAN A;  2IDY A;  2C7H A;  1TZO A;  3IVF A;  2K25 A;  2D3B A;  2KMC A;  2KLC A;  4RGN A;  2RMM A;  5E6O A;  2PJH A;  3ZRF A;  3B2F A;  4LJO B;  2PKO A;  1KJT A;  3RNC C;  4HXD A;  1V9J A;  4WUR A;  4HEA 1;  3U4E G;  3ETR A;  1YQB A;  1XLO A;  3DWG C;  4W9E A;  2BVC A;  5HHD G;  3AUL A;  3T8M A;  2QC8 A;  1X1M A;  1V2Y A;  4UDU C;  2BPS A;  1UBQ A;  4EZL A;  2NCN A;  1T0S C;  3V05 A;  4LNO A;  2JXT A;  3DVN U;  1QOB A;  2WGS A;  3A4R A;  2WDQ B;  1L6V A;  1R4N B;  3ZRC A;  1RYJ A;  2ACZ B;  1CK1 A;  1RFK A;  3P42 A;  2JZP A;  3AEA B;  1QOF A;  3DQV A;  4ANX A;  1XEE A;  1VRA B;  4QAY A;  5H8Y E;  2LRU A;  2IO2 B;  4YXD B;  2M8S A;  4IKG A;  3FIL B;  4DHZ B;  2L05 A;  2VRR B;  1YN4 A;  1I35 A;  3AEB B;  4NAM A;  3LB8 C;  1SXT A;  3URY A;  4A6Q A;  3AE1 B;  2ZW1 A;  4F1S A;  3DOW A;  5EDS A;  1B1Z A;  4BOS C;  4LCD E;  3TCA A;  2K8H A;  3WAN A;  1ZKH A;  2QCZ A;  3UQA A;  5BMH A;  2L52 A;  2IY1 B;  1VR9 A;  2FUH B;  4IDI A;  2EMS A;  3KQ4 A;  3L4P A;  3NY5 A;  3T3O A;  4WWN A;  3Q8E A;  4MGI E;  1GC7 A;  4II2 B;  2W54 A;  1FD6 A;  3NOB A;  2V4L A;  3JVZ X;  3PGE A;  4BKS D;  4M0W A;  3PLV A;  3Q6B A;  1NYR A;  2JWU A;  4GDL A;  2D3C A;  1ZXH A;  2LGD A;  3AU5 A;  2I2Y A;  1RM6 C;  2WXL A;  1Z2M A;  2K3U A;  3T3N A;  2M56 B;  1P98 A;  4REZ A;  4W9K A;  2W9N A;  2WXQ A;  3VVW B;  3BVZ A;  4K3C A;  4PS8 A;  3AXC A;  2SAK A;  1E7P B;  2JXX A;  1GC6 A;  2KXJ A;  3NG0 A;  3VXW A;  1UD7 A;  4WWP A;  2J0J A;  1RFA A;  3KYC D;  3WAL A;  4KSK C;  1LFD A;  2JX5 A;  1J19 A;  1WMH A;  1L5P A;  2WX1 A;  1U4A A;  2AQ1 B;  3AE2 B;  3ZVV A;  3HUI A;  1XO3 A;  2PIA A;  1HQR D;  2EKE C;  2K22 A;  4WQM A;  3VRB B;  2NBW B;  5T8I A;  4BVU C;  4RNA A;  2LHD A;  1T0Y A;  1P7F A;  1WGY A;  3DDC B;  1SGH A;  1VZ7 A;  3KVF B;  3QA8 A;  4AOF A;  5AZG A;  1TIF A;  3L54 A;  2BB5 A;  2K8B A;  3X23 A;  5E6J A;  4KDL B;  3OWE B;  3C19 A;  2FCS A;  3RZW C;  2L1A A;  3IT6 B;  1WGH A;  1KLG D;  2KVR A;  2V3S A;  1M94 A;  3FC4 A;  4DK5 A;  4B6W A;  4EEW A;  4BZA A;  1QKZ A;  1ENF A;  2ZEQ A;  1J7B A;  4M02 A;  2ON8 A;  1VCB A;  3NZ3 A;  2VZK B;  3VUW A;  4KZC A;  2AL6 A;  3PLU A;  2J7Q B;  1FM0 D;  3J9C A;  4YWG G;  3E9S A;  3ZNG C;  1GB1 A;  3DPD A;  1PQS A;  3TJP A;  3VUX A;  3KUZ A;  2UYZ B;  3BVG A;  3BIN A;  5AZF A;  1TZ1 A;  3TUO A;  2JF5 A;  1AAR A;  2Y3A A;  2IGH A;  3NRZ A;  2MHJ A;  3CIR B;  4F7Z A;  1TS4 A;  2PW9 A;  1MHX A;  4IOI E;  1MG4 A;  2QIE B;  4XZ4 A;  3HM6 X;  1Q1O A;  4S0R A;  1TKG A;  4LNF A;  3AE6 B;  3N32 A;  4WJQ A;  1TS2 A;  2NS5 A;  1FCL A;  2M1M A;  4MH8 A;  2CKH B;  3TBL D;  1C79 A;  1S1Q B;  3EGR A;  2ZNV C;  4FJV B;  2DX5 B;  1WGD A;  1NDD A;  3EHV A;  4KGT A;  4S17 A;  3GE3 C;  3A1Q A;  3QAR A;  1J7A A;  3KLS X;  5CHW A;  3I5J C;  1JW9 D;  5J2R A;  2DBY A;  1WXS A;  2J0K A;  4LJP B;  3PHW B;  4MEL A;  4GDL B;  3H7P A;  4RM8 A;  1UWX A;  1TKE A;  3R7R A;  1KH0 A;  3KW5 B;  2K9X A;  4MGZ E;  3M95 A;  4M0W B;  4GXB A;  1WXV A;  2WLB A;  3D32 A;  3CSF A;  5EE1 A;  3PRP B;  1BUI C;  4MEM A;  2KT7 A;  1DOX A;  2IGD A;  3PRE A;  4JLC A;  2IJ0 A;  2LHE A;  1CMX B;  1FXT B;  4GOC A;  2REX A;  5D7G A;  2EKI A;  2KJH B;  3LDZ E;  4ZYN A;  5IOI A;  4ASW C;  2QHO A;  4HPP A;  3AMZ A;  1YQ3 B;  1L0X B;  4MM3 B;  2LGS A;  2PMV A;  4ZHP A;  2ZPN A;  2N4F A;  3ZYY X;  1SEB D;  2KD0 A;  4KDI C;  5GMV A;  1RWS A;  1AYF A;  4MSQ B;  4XC2 A;  2K8C A;  2LRW A;  2L83 A;  2V3N A;  2Z0E B;  2LAS A;  3NVV A;  1I4R A;  4CQN A;  4PYU A;  1E6E B;  4HK2 A;  1K51 A;  4NAW A;  1TTN A;  1F9J A;  1EO6 A;  2RPQ A;  1L6U A;  3AE7 B;  3B08 A;  1QIL A;  1E8W A;  1ZPS A;  2JT4 B;  3A9K A;  4L1B A;  1AW7 A;  2NTT A;  3QJZ A;  4C80 A;  1NYQ A;  4LNK A;  3AV8 A;  4WJO A;  4US9 A;  4EZJ A;  1I4P A;  4OZA A;  2ZZP B;  5AUK A;  1JWM D;  1ZUD 2;  5IO9 A;  1D5X C;  4M8M A;  1R4N I;  2N7J A;  3IG3 A;  1N6Z A;  2BYT A;  1TYG B;  2RDB C;  1P0R A;  1YJ1 A;  2FBW B;  2KX3 A;  5E6N A;  2ZVO A;  1GAQ B;  1WXQ A;  1TY0 A;  2LMC A;  3IAS 1;  1UUP A;  1IBX B;  2DYO A;  2C7M B;  3QCA A;  2Q5W D;  4NAW B;  3V61 A;  2FE8 A;  5FR3 A;  4HPM B;  4EZK A;  1RLF A;  2BS2 B;  1TBE A;  2I1J A;  3ZTC A;  1A70 A;  2LGX A;  3Q14 C;  4KSL C;  3FAH A;  1TT5 B;  2IY0 B;  2XN9 C;  1F0Z A;  3KUD B;  3Q3M C;  2WDV B;  5G2N A;  4XWW A;  2Z0D B;  4WAF A;  3TMP B;  4N6E B;  1T0R C;  1JQ4 A;  3PRZ A;  4BKG A;  1YX5 B;  2GB1 A;  2LFI A;  1FFV A;  4JX1 C;  2IO3 B;  1Y56 A;  5GXG B;  4XDD A;  1JWS D;  1UEL A;  4A8X C;  3AH7 A;  4C56 C;  4MAC A;  1WJN A;  5D94 A;  4I6N B;  4HDO A;  4YSX B;  4YTM B;  5J17 A;  3ZDT A;  2LD9 A;  1A5R A;  1VZ8 A;  4A9A A;  4NJ7 A;  1LXD A;  2NBV B;  2E3T A;  3KUC B;  2ASQ A;  3N30 A;  5CHF A;  4BKT A;  1N5X A;  2L7R A;  2QSD A;  1FIQ A;  2MW5 A;  4DDI D;  1OEY A;  3A4S C;  4WWO A;  2WXJ A;  2PTL A;  3W1S C;  5EE9 A;  2RPV A;  1MFW A;  2MBQ A;  4HCP B;  5LXI B;  4HRS A;  2MBO A;  3DBL B;  2IPK D;  1XQQ A;  3L08 A;  1J7C A;  4ACF A;  2QIL A;  3JSV A;  4MH0 E;  3GOE A;  4RGT A;  2DYM A;  1BML C;  3ECI A;  3PZD A;  1RRB A;  1HE8 A;  4US8 A;  3MFG A;  1ISN A;  4NJ6 A;  4OVU A;  2NPT A;  3ZW3 A;  3LXF A;  3TL5 A;  3PRM B;  2IND C;  2MX2 A;  2KQ7 A;  1HTQ A;  3AE8 B;  3P4Q B;  2O2V B;  4DDG D;  2M0A A;  1V86 A;  3VH4 B;  2WXR A;  3M62 B;  1NI2 A;  1KM7 A;  3O65 B;  2YEP B;  4LTU A;  4ANW A;  2GLS A;  4WH4 A;  1TGZ B;  1LM8 B;  2JSV X;  1SE3 A;  1ET9 A;  1D3Z A;  2D5G A;  4ZRK A;  2N7E A;  5CTR C;  4N9F 4;  1JCK B;  3DVN V;  4NJC A;  2MJD A;  3P4R B;  4KX6 B;  2FCM A;  2JVC A;  1L4D B;  1GJZ A;  1F1H A;  1L0Y B;  5DPS A;  4C4V B;  3R66 C;  1V6E A;  4MT5 A;  3OLM D;  1F2R I;  1OEY J;  1ACC A;  4A90 A;  2LUE A;  1E7V A;  3SHQ A;  4P1C C;  3ZDM C;  2CS4 A;  5BYQ A;  4K3B A;  4OZB A;  2A4Z A;  4RMA A;  3BWU D;  4ITK A;  1EF1 A;  1MI0 A;  1KFY B;  5HI1 A;  4FJZ A;  1PDX A;  3APD A;  4WWM A;  2LZ6 A;  2KOX A;  2BS4 B;  5HG2 A;  4OW0 A;  3WAP A;  5CX3 A;  5EE3 A;  4C7Y A;  3GE8 C;  4IM2 A;  4FHK A;  3L17 A;  4J3O D;  1V1O A;  1YQ4 B;  3EC8 A;  4RGM A;  4W9I A;  2RGF A;  4NNJ B;  4BOZ B;  1XT9 B;  3AEF B;  5IAA C;  4FXC A;  2LJI A;  2MJ3 A;  1I7H A;  4NQL B;  1N61 A;  4M01 A;  2WXH A;  4K7U A;  4KGR A;  1QOA A;  4RF1 A;  2KMA A;  2OJW A;  2D10 A;  4W9L A;  2J42 A;  2JWZ A;  2WXM A;  4HLE A;  4E71 A;  2KDI A;  4MM3 A;  2LWP A;  2O6V A;  3I3T B;  3S2A A;  1E7U A;  2JYE A;  3X0W A;  2BYF A;  2BT6 A;  3R7Q A;  4BKS A;  2BKR B;  2MCN B;  5IA7 A;  3AEC B;  3VUY A;  1ESF A;  1EU3 A;  4GLS C;  1VLB A;  2KTF A;  3VQI A;  1WE7 A;  2K6Q A;  2DZK A;  3QC8 B;  5KHQ A;  3DBH I;  4MDK E;  4HKQ A;  2D2Q A;  5C3J B;  4DXG A;  1KTK A;  2FCQ A;  4EE2 A;  3EFC A;  4GMV A;  1WJ4 A;  1XLN A;  2N9K A;  5D2M B;  2FUG 1;  2B3A A;  2WXF A;  3DVG X;  1XCQ L;  2WXG A;  1V5T A;  1ZGU B;  1QOG A;  5C1Z A;  2ZW0 A;  3ML9 A;  2DHZ A;  4I6P A;  3EA6 A;  3PV1 A;  2D3G A;  1WH3 A;  3NVY A;  3RUL A;  4E3C A;  4ARI A;  1QF6 A;  2K5P A;  2LGI A;  1I4Q A;  2Y5C A;  2N9X A;  4TMA B;  3HHM A;  1FEH A;  4JWU C;  2AQ2 B;  3ZTD A;  2KK8 A;  3QAQ A;  4RM9 A;  2KDB A;  1H4R A;  3W1S A;  1DGJ A;  4KIK A;  1V5O A;  4RF0 A;  4DQO C;  5FK9 C;  2NR2 A;  5EE0 A;  2R61 A;  1OFF A;  3NS1 A;  3MJ5 A;  3TSS A;  1C76 A;  1LO5 D;  4FLH A;  4WJP A;  2L0T A;  1VJK A;  1F52 A;  4BFR A;  3Q8A A;  4K7W A;  1CJE A;  3TEY A;  3NVW A;  4HDQ A;  3UI3 A;  2N7D A;  3WCQ A;  3L13 A;  1L4Z B;  4PYZ A;  4LNN A;  4J6I A;  4MJS A;  3UIO B;  4KV2 A;  1CQV A;  2TSS A;  3GZN B;  2OED A;  3WA0 A;  4W9G A;  3BYT B;  2A5U A;  2MBE A;  2XBB C;  2D11 A;  2KKC A;  1VZ6 A;  4TKN A;  3P4S B;  2IYD B;  2K6D B;  2ZVN A;  3Q3N C;  2X8X X;  3ZJT A;  2Y5B B;  1WYW B;  1E8Z A;  2EEL A;  1UGM A;  5C2T B;  5C23 A;  4OHJ A;  3I57 A;  2MLB A;  3H7S A;  1UWM A;  4AUQ C;  1DOI A;  3UQB A;  5DCN A;  2MRP A;  2ZJD A;  4CHK A;  1LQB A;  1WM3 A;  5JH5 C;  4XWT A;  2KX0 A;  2KLG A;  1R7S A;  4K81 A;  2NPT B;  2BF8 B;  2KDF B;  5TR5 A;  1K50 A;  3JSV B;  3MHZ A;  2IBI B;  1EM7 A;  2MP2 B;  3MHS D;  4A3P A;  3SR6 A;  4ANU A;  4ZRQ A;  1VDV A;  2XK5 B;  3MTN B;  4TQ1 A;  1R4M B;  1TY2 A;  3BVM A;  1FNV A;  1WX8 A;  2KC2 A;  1WMH B;  3SFD B;  3DHI C;  3N20 C;  1STE A;  2J53 A;  3DCG A;  4JQW C;  3TEX A;  1EUV B;  2WXK A;  1M4V A;  2QJL A;  1IPG A;  4M00 A;  1MJD A;  3AE3 B;  5DPW A;  3PZ8 A;  1NEK B;  3Q8F A;  4P6V F;  1WR1 A;  3MC9 A;  1TS3 A;  2NTS A;  1V80 A;  3IT4 B;  3N1X C;  3VTW A;  3CMM B;  5L95 C;  3ZXR A;  2IO0 B;  2XK5 A;  1P9D U;  3AE9 B;  1C4C A;  1PFD A;  2M19 A;  3HIZ A;  3RNA C;  4GDK B;  2BGF A;  2K1F A;  4XDC A;  2KJR A;  2HE7 A;  2W3R A;  5BMG A;  2BQQ A;  2JUO A;  1KRH A;  2JZZ A;  5BMI A;  3MP9 A;  1HZ6 A;  4USA A;  1L7Y A;  3CWI A;  3VR9 B;  2RSU A;  3H7P B;  3KWL A;  4YTN B;  4HCN B;  2YEP F;  3MC8 A;  3CST A;  3VH3 B;  4C7Z A;  1ZDX A;  2N1V A;  2E6X A;  3UGB B;  3LJ3 A;  1WXA A;  3TEZ A;  4YSZ B;  1FO4 A;  1N62 A;  3FIL A;  1SF0 A;  1WR6 E;  4P7I A;  3E56 A;  4W9J A;  4MJS B;  4OZC A;  5HFY A;  2MEK A;  2O6V D;  2JPH A;  4DBG A;  1E10 A;  2D07 B;  2JU6 X;  4NPN A;  2XEW A;  3IAM 1;  4M8N A;  2BWE S;  1YJI A;  3AM9 A;  3A9J A;  3ZO5 B;  2AYO B;  1IGC A;  2JRI B;  1MHH E;  4AP4 C;  1V97 A;  3AEG B;  1ZE3 D;  2GBM A;  3IBE A;  2J52 A;  3BY4 B;  1I4H A;  2EMT A;  2V4I B;  2L76 A;  3Q2A C;  1SBB B;  4GN1 A;  5JXV A;  3UIP B;  2FID A;  5AEK B;  3V6C B;  1I42 A;  1FNW A;  3ZIM A;  1SE2 A;  1FRR A;  1D5Z C;  5FKA C;  3AN1 A;  4O1N A;  2KWD A;  1E8X A;  4YT0 B;  2INC C;  4TV3 A;  1HEZ E;  2C5L C;  2DLB A;  2VZK D;  3NUH B;  2DZI A;  1CZP A;  4FAD A;  3R2I A;  2PVG C;  3ABV B;  3BZD B;  1WGG A;  2IZV B;  3I9V 1;  3BK2 A;  2AQ3 B;  1WX7 A;  3DHH C;  1LGR A;  4AS1 A;  5KHO A;  1J0G A;  1KOT A;  3Q8C A;  2QMT A;  1WJU A;  2BWF A;  3PT2 B;  3ZLZ A;  4L23 A;  2DWQ A;  4B0M A;  2KFK B;  1TKY A;  3PZ7 A;  4D2K A;  2Y5P A;  2KYW A;  4IC7 B;  3IFW B;  3OG5 A;  3VFK A;  1XLQ A;  2WXO A;  5J18 A;  2HTH A;  2RR9 A;  2M0X A;  5LXH A;  3RI7 C;  2J0M A;  2R2Q A;  3UF8 A;  4ARC A;  1PGX A;  3OJ3 A;  4HVB A;  2B76 B;  2NMQ A;  3TIX A;  2WYQ A;  1N5W A;  3APF A;  1WXM A;  3ZXV A;  1VD2 A;  4YL8 A;  4HKZ E;  2R2O A;  3KYD D;  2HDE A;  3PTF C;  3GZN I;  1XLP A;  2K39 A;  3SD5 A;  2MA9 B;  2BS3 B;  2KMM A;  1H8C A;  1QT9 A;  5LNK 1;  3DHG C;  2I1K A;  1IGD A;  5D6J B;  1Q10 A;  4XYC A;  4L2Y A;  2LXA A;  2J4X A;  3W2D A;  3VAW A;  2MWS B;  3AE5 B;  3AED B;  1HA5 A;  1YMH E;  1E90 A;  3RZF A;  2OOB B;  2KHW B;  2LGY A;  1JWU D;  4DWF A;  2WQY B;  3DVG Y;  2GBR A;  4W9D A;  2KTR B;  3RYT A;  1PGB A;  1WRI A;  3ZNH B;  4CO7 A;  2WWZ A;  2BB6 A;  3RUI B;  4RCO A;  4GDK A;  5AUI A;  1WSP A;  3Q3J A;  3HRD D;  4XX5 A;  2KO3 A;  5LLI A;  2WU2 B;  1Q5W B;  1WFY A;  3AI5 A;  4EFO A;  2AL3 A;  2V3P A;  1L2N A;  1FFU A;  1GUA B;  2SEB D;  1WIA A;  2FCN A;  3V3X A;  4GU2 A;  5FR6 A;  3RCZ A;  3R3M A;  3BK1 A;  4ICV A;  1QLB B;  1C78 A;  5G55 A;  1E0Z A;  2WP9 B;  4DHZ E;  3ML8 A;  5BYR A;  1WE6 A;  3DBH B;  1FRD A;  3SU8 X;  3NJT A;  1F2R C;  3BII D;  2X38 A;  3P63 A;  1T3Q A;  4FBJ B;  2H88 B;  1ZW7 A;  1GNU A;  1YOV B;  2JYT A;  3ZJV A;  2DZJ A;  2MBH A; 
#chains in the Genus database with same CATH homology
 1KH0 A;  2AQ2 B;  2K9X A;  2KN4 A;  1SIJ A;  1C4A A;  3W1S A;  1DGJ A;  1F77 A;  2WLB A;  4RF0 A;  2I38 A;  4DQO C;  1YN3 A;  5FK9 C;  2WDR B;  5EE1 A;  1BUI C;  1B9R A;  5EE0 A;  1DOX A;  2R61 A;  1GOZ A;  2IGD A;  2K0P A;  1OFF A;  2KQ4 X;  2WS3 B;  3NS1 A;  1KF6 B;  2IJ0 A;  3SEB A;  3GS2 A;  3MJ5 A;  3TSS A;  2WXP A;  1C76 A;  1MVK A;  2LHE A;  1V1P A;  1LO5 D;  1ZXI A;  2BTE A;  4P16 A;  1ZOY B;  1VJK A;  2G9H D;  5D7G A;  2EKI A;  1AWD A;  2INN E;  3Q8A A;  3AMZ A;  1WGK A;  1CJE A;  1YQ3 B;  3NVW A;  1L0X B;  4A55 A;  3TEY A;  3Q8B A;  3UI3 A;  4JE3 B;  4MM3 B;  3WCQ A;  2PMV A;  1N63 A;  4ZHP A;  1L4Z B;  3W5V B;  3ZYY X;  1SEB D;  3P4P B;  1CQV A;  1RWS A;  2TSS A;  1AYF A;  2GRI A;  1D6E C;  2OED A;  2L83 A;  3BYT B;  2OHF A;  5TSS A;  1JRO A;  4XE0 A;  3RFZ B;  2V3N A;  1YJJ A;  1DOY A;  1VZ6 A;  3NVV A;  3P4S B;  5MPO A;  1I4R A;  5D3I B;  4CQN A;  4RH6 A;  1I4G A;  3ZJT A;  1E6E B;  2LEK A;  1K51 A;  2KDM A;  2EEL A;  2PLP A;  2GI9 A;  2MJE A;  1NI3 A;  1L6U A;  5C2T B;  3U2S C;  3AE7 B;  1QIL A;  2H89 B;  1ZPS A;  4OHJ A;  1L0V B;  3I57 A;  4L1B A;  1AW7 A;  2NTT A;  1UWM A;  2W82 A;  3Q69 A;  4C80 A;  1DOI A;  1EWY C;  1NYQ A;  1FNU A;  3AV8 A;  4US9 A;  3N9Y C;  1I4P A;  1HXY D;  3IXS A;  4OZA A;  4KKJ A;  4XWT A;  4RGO S;  2WNM A;  1R7S A;  1JWM D;  5AUK A;  1ZUD 2;  1D5X C;  1XXG A;  3C8Y A;  2N7J A;  1I4X A;  3H8H A;  1ZDV A;  4B0E A;  2BYT A;  3P1M A;  2PVO D;  1UGJ A;  1TYG B;  1GPX A;  1K50 A;  5G5H A;  3MHZ A;  3B9J A;  4TQ0 A;  1MPE A;  1EM7 A;  1SB3 C;  2Z8L A;  2FBW B;  2KAJ A;  2L32 A;  3SR6 A;  4ZRQ A;  1VDV A;  2BW2 A;  1T6B X;  4ZOH C;  3KWV A;  1GAQ B;  4TQ1 A;  1TY0 A;  1UNS A;  1WXQ A;  2WXI A;  2WXN A;  1TY2 A;  2LMC A;  3IAS 1;  1UUP A;  1IBX B;  3GB1 A;  3HVD A;  3BVM A;  1FNV A;  2DYO A;  1FCC C;  2Q5W D;  4NAW B;  3SFD B;  2W3S A;  1D5M C;  3R2T A;  3TEW A;  3HVZ A;  2FE8 A;  1STE A;  5FR3 A;  2J53 A;  3TEX A;  4ZHO A;  1SJH D;  2WXK A;  2CU3 A;  3AB5 A;  4YSY B;  1M4V A;  2QJL A;  2BS2 B;  3AE3 B;  1KLU D;  3U7Z A;  1AN8 A;  2IDY A;  3PZ8 A;  1DYQ A;  1TZO A;  1NEK B;  1A70 A;  3Q8F A;  4P6V F;  4R3D A;  4RGN A;  1TS3 A;  1JWA D;  2RMM A;  2NTS A;  3FAH A;  1JWB D;  3IT4 B;  1K52 A;  3B2F A;  2XN9 C;  1F0Z A;  2PKO A;  2WDV B;  4WUR A;  1N60 A;  4XWW A;  4HEA 1;  3U4E G;  3ETR A;  3LYY A;  4WAF A;  4LK0 M;  1XLO A;  3AE9 B;  3DWG C;  1C4C A;  1PFD A;  5HHD G;  2M19 A;  4N6E B;  1JQ4 A;  3VRA B;  4ZYS A;  3GP7 A;  2GB1 A;  2LFI A;  4UDU C;  4GDK B;  2MH7 A;  3AEE B;  1FFV A;  4OVZ A;  4JX1 C;  5I4D A;  4XDC A;  5GXG B;  1Y56 A;  1OQQ A;  4XDD A;  1JWS D;  3V05 A;  4A8X C;  2JXT A;  2W3R A;  5G5G A;  3AH7 A;  1QOB A;  2ICI A;  5BMG A;  4C56 C;  2IGG A;  4MAC A;  1PUT A;  1L6V A;  2WDQ B;  1KRH A;  1JRP A;  3R8B A;  1RYJ A;  2ACZ B;  1CK1 A;  1RFK A;  2N9L A;  2XNA C;  4HRO A;  3P42 A;  4YSX B;  4YTM B;  2JZP A;  3AEA B;  1QOF A;  5BMI A;  1XEE A;  1VRA B;  1HZ6 A;  3MP9 A;  4USA A;  1VZ8 A;  4A9A A;  1NEN B;  4Q2J A;  3AE4 B;  1NVI D;  3CWI A;  5H8Y E;  3VR9 B;  3W9C B;  4YXD B;  2E3T A;  4AQ7 A;  3KWL A;  4YTN B;  4IKG A;  3FIL B;  1ET6 A;  2G1E A;  3MC0 B;  2YEP F;  1N5X A;  1YN4 A;  4C7Z A;  1ZDX A;  2QSD A;  1FIQ A;  2E6X A;  1JML A;  2JQR B;  3EUB 2;  3TEZ A;  3AEB B;  4NAM A;  4YSZ B;  1FO4 A;  1N62 A;  3FIL A;  3LB8 C;  1SF0 A;  1SXT A;  3URY A;  2WXJ A;  4A6Q A;  1WWT A;  2PTL A;  3E56 A;  1E9M A;  1IBX A;  3AE1 B;  2ZW1 A;  5EE9 A;  2RPV A;  4OZC A;  1B1Z A;  2MEK A;  5HFY A;  5BYS A;  1FMA D;  1E10 A;  2JU6 X;  1V8C A;  3IAM 1;  4HRS A;  2IPK D;  5H92 C;  1J7C A;  1YJI A;  1FXI A;  2QIL A;  3AM9 A;  4DXF A;  5BMH A;  4RGT A;  2L52 A;  2DYM A;  1BML C;  2ONQ A;  1IGC A;  1P7E A;  1VR9 A;  1MHH E;  4IDI A;  4US8 A;  1V97 A;  3KQ4 A;  3MFG A;  3L4P A;  1T5X D;  3AEG B;  1ZE3 D;  3T3O A;  3Q8E A;  2HTM E;  2J52 A;  1I4H A;  3LXF A;  4N59 A;  2V4I B;  2W54 A;  1FD6 A;  1SBB B;  3AE8 B;  3P4Q B;  5JXV A;  4M0W A;  4KGS A;  2M0A A;  2WU5 B;  1FNW A;  1GB4 A;  1JAL A;  1NYR A;  2WXR A;  1SE2 A;  2JWU A;  1YN5 A;  1FRR A;  1D5Z C;  1ZXH A;  5FKA C;  3AN1 A;  4O1N A;  2KWD A;  4YT0 B;  2I2Y A;  1RM6 C;  1HEZ E;  2WXL A;  2VZK D;  2DLB A;  3NUH B;  1CZP A;  3O13 A;  1SSN A;  3R2I A;  2PVG C;  2YEP B;  4LTU A;  2K3U A;  3ABV B;  3T3N A;  3BZD B;  2M56 B;  4WH4 A;  3I9V 1;  4REZ A;  2RDH A;  3B2G A;  3BK2 A;  2WXQ A;  2AQ3 B;  1EWC A;  2JSV X;  3BVZ A;  2SAK A;  1SE3 A;  1ET9 A;  1E7P B;  4LLG M;  4AS1 A;  5D3D A;  1EU4 A;  2D5G A;  3Q8C A;  2QMT A;  1YNT E;  1WYG A;  4YTP B;  1JCK B;  4L23 A;  2JX5 A;  4NJC A;  1OQR A;  2MJD A;  2DWQ A;  3P4R B;  4PT5 A;  4B0M A;  4KX6 B;  1L5P A;  1L4D B;  1TKY A;  3PZ7 A;  4D2K A;  2Y5P A;  1L0Y B;  2KAC A;  2AQ1 B;  3AE2 B;  1XLQ A;  3HUI A;  2WXO A;  1XO3 A;  2PIA A;  3W5U B;  4MT5 A;  1HQR D;  1F2R I;  2K22 A;  1V1P B;  1ACC A;  4A90 A;  1QQR A;  4WQM A;  4ARC A;  3SFE B;  1PGX A;  3VRB B;  5T8I A;  4RFB A;  2B76 B;  5BYQ A;  4RNA A;  2NMQ A;  2LHD A;  4WIP A;  4OZB A;  1N5W A;  3DWM A;  1K53 A;  1P7F A;  3BWU D;  4ITK A;  1MI0 A;  2V0G A;  4HKZ E;  3BYY B;  1VZ7 A;  1KFY B;  5HI1 A;  1PDX A;  3RPF C;  1D4B A;  3ZQ4 A;  2BB5 A;  4WWM A;  2BS4 B;  2HDE A;  5HG2 A;  2QEJ C;  4OW0 A;  1XLP A;  5E6J A;  2LUM A;  2BS3 B;  5EE3 A;  2KMM A;  4C7Y A;  3OWE B;  1QT9 A;  5LNK 1;  1TS5 A;  4J3O D;  1V1O A;  1IGD A;  1YQ4 B;  4RGM A;  2L1A A;  1Q10 A;  3IT6 B;  1KLG D;  4L2Y A;  4NZL B;  2J4X A;  3W2D A;  3ZJU A;  3FC4 A;  3AE5 B;  3AED B;  3AEF B;  1HA5 A;  2AX5 A;  1QKZ A;  4N58 A;  1ENF A;  2LJI A;  1YMH E;  1J7B A;  1PYW D;  2MJ3 A;  4FXC A;  1I7H A;  2ON8 A;  1N61 A;  2WXH A;  3NZ3 A;  1JWU D;  1HZ5 A;  1TJE A;  2VZK B;  4KGR A;  1QOA A;  2WQY B;  4RF1 A;  1FM0 D;  2CJN A;  1ZP0 B;  1XCT L;  3J9C A;  4YWG G;  3E9S A;  1PGB A;  2J42 A;  1GB1 A;  4HJG E;  1WRI A;  2WXM A;  4KKI A;  2BB6 A;  4RCO A;  1C77 A;  3BVG A;  3NVZ A;  2JYE A;  5AUI A;  1IUE A;  1C9F A;  1WSP A;  3TUO A;  3HRD D;  2BT6 A;  2INP E;  2RDG A;  4JPS A;  1BXT A;  2BBC A;  2Y3A A;  1C4P A;  2IGH A;  2WU2 B;  3AEC B;  1ESF A;  3NRZ A;  1EU3 A;  3CIR B;  4GLS C;  1VLB A;  1TS4 A;  3VQI A;  4ZRP A;  2PW9 A;  2V3P A;  1MHX A;  4IOI E;  1SJE D;  1FFU A;  2QIE B;  2SEB D;  1ROE A;  3V3X A;  4TSS A;  4HKQ A;  3BK1 A;  5C3J B;  4DXG A;  1TKG A;  3ZGZ A;  1KTK A;  1QLB B;  1C78 A;  3U52 E;  4EE2 A;  3AE6 B;  1E0Z A;  2WP9 B;  2W55 A;  1XF5 L;  1XLN A;  2N9K A;  1TS2 A;  5BYR A;  1FCL A;  1PGA A;  1FRD A;  4MH8 A;  2FUG 1;  2WXF A;  1XCQ L;  1SE4 A;  2WXG A;  1C79 A;  1F2R C;  3BII D;  1QOG A;  3EGR A;  2N0S B;  2X38 A;  1FXA A;  3P63 A;  2ZW0 A;  1T3Q A;  4KGT A;  2H88 B;  2CJO A;  1J7A A;  3KLS X;  3EA6 A;  3VR8 B;  4JWS C;  4H2A A;  1JW9 D;  2DBY A;  3NVY A;  3PO0 A;  4ARI A;  1QF6 A;  2K5P A;  2JYT A;  2LGI A;  1I4Q A;  2Y5C A;  3ZJV A;  4GDL B;  4TMA B;  1FEH A;  1UWX A;  4JWU C;  1TKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...