2ONQA

Gbeta1 stabilization by in vitro evolution and computational design
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
b'MQFKLIINGKTLKGEITIEAVDAAEAEKFFKQYANDNGIDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2onqA00
4WH4A 1YMHE 2LGIA 1GB4A 2KN4A 1IGCA 1PGBA 2KWDA 2N7JA 2IGHA 1PGXA 2JXTA 4GLSC 4KGTA 2J52A 1IGDA 2LUMA 2I38A 2ON8A 4OZCA 4HJGE 1YNTE 1FCLA 2IGDA 1EM7A 1PGAA 2RPVA 1UWXA 5BMGA 4KGSA 1F2RC 2PLPA 1IBXB 2KACA 1MPEA 4D2KA 1F2RI 4IKGA 2JWUA 1K50A 4HKZE 2PW9A 2EELA 1HEZE 5HG2A 1MVKA 2OEDA 1P7FA 2KQ4X 1IBXA 1C9FA 4OZAA 1MHXA 1ZXHA 2ZW1A 3V3XA 1Q10A 4KGRA 5BMIA 1P7EA 2K0PA 2JZPA 1KH0A 3UI3A 2PTLA 2J53A 2QSDA 1QKZA 2LHDA 4OZBA 2RMMA 5BMHA 5HFYA 3FILB 1FCCC 3MP9A 2GI9A 2NMQA 3GB1A 1GB1A 2KDMA 1K52A 3FILA 2ONQA 4MACA 2JU6X 1K51A 1FD6A 2JSVX 1MI0A 5JXVA 1XF5L 1HZ5A 2ZW0A 1K53A 2QMTA 1HZ6A 1XCTL 2GB1A 5HHDG 2N9KA 1MHHE 1D4BA 2N9LA 2IGGA 2I2YA 1XCQL 5HI1A 4IOIE 2LHEA 1JMLA
chains in the Genus database with same CATH superfamily
1TY0A 2E6XA 3ML8A 4TMAB 2FCNA 1EO6A 1TT5B 1RFKA 3QX1A 2IBIB 2JRHA 2ZCCA 2KQSA 2KC1A 4NZLB 2BS2B 3A9JA 3RN9C 1I4GA 4GU2A 5C2TB 3M95A 3O13A 4HJGE 2I1KA 2IYDB 3HM3A 2M19A 4LTUA 4KIKB 2NPTA 3I63C 3H9DA 1EF5A 4UDUC 4F7ZA 2L7RA 2BYFA 5KHQA 1LFDA 4ACFA 5MPOA 1WRDB 3V3XA 3AEEB 2INDC 1V2YA 1T0YA 4KV2A 2KX0A 4M8NA 3PSEB 5E6PA 3JW0X 2O6VD 1V5OA 4FA6A 5BMHA 4O1NA 1R4MI 4DWFA 2NMQA 1QOFA 2JF5A 2ASQA 2ZNVB 2YEPB 3RFZB 2BWFA 1X1MA 1GB1A 1N63A 2D5GA 2WQYB 3RUIB 2RR9A 2O2VB 2N1WA 2M0AA 2NTSA 1UBIA 3MHZA 2LGDA 2FCQA 3ZLZA 4GDLB 2V4LA 4MSQB 3MFGA 3T3OA 1TJEA 3ZJVA 1OEYJ 2L52A 1MHHE 4C7ZA 3E56A 4X57B 1I4RA 4A6QA 4YTMB 3ZNZB 1WSPA 1VZ7A 3U7DA 2PEAA 3Q2AC 1I4PA 1SBBB 3T8MA 1R7SA 3ZUNA 3AV8A 1C76A 4GLSC 3PTFC 3SU8X 4AOFA 1WXAA 3ZXVA 1UD7A 4W9KA 2G4SA 2MBBB 2Q5WD 2KQ7A 3RZWC 2FIFA 1YIWA 1V49A 1PYWD 3IHPC 3LDZE 4IWQA 3PGEA 3PV1A 1PDXA 3SEBA 1MPEA 4IKGA 4HKZE 1Q5WB 1Z2MA 2DZMA 4M00A 3NS8A 2KQ4X 5D3DA 4FJVB 1FMAD 1Q10A 5L95C 4KGRA 2H88B 5CX3A 3W5UB 1C78A 2XN9C 3VH3B 2DBYA 1GOZA 4OZBA 1JRUA 5L83A 1YQBA 4DHJD 1TZOA 3TMPB 4MJSA 2MBOA 2GBKA 2CJNA 5HKHA 4XX5A 1K52A 2B3AA 2DX5B 2NBWB 3VTWA 1AN8A 2K25A 2HDEA 4C00A 2WXQA 4MT5A 5AZGA 4M0WA 4AUQC 4EZJA 3EC8A 4I6PA 1Q1OA 2Z0DB 1WE7A 3AU5A 4B9KA 3SHQA 1D4BA 3Q3NC 4LLGM 4MGKE 2WXHA 1JWUD 2MHJA 5I4DA 1YX6B 1LGRA 1M4VA 2DYBA 3BVGA 2LGIA 4XC2A 1OGWA 1VJKA 2L0TA 3ZYYX 1F0ZA 1RYJA 2N7JA 3AM9A 1EUVB 4IC7B 1BMLC 3I9V1 1QT9A 1NI2A 3Q3JA 2KXJA 1ZPSA 1F9JA 3P4RB 4NNJB 4B95A 1TS3A 3DHGC 2MJ3A 3ZGZA 1CZPA 1PGAA 4OVVA 4TSSA 3PHXB 2GBNA 1D6EC 3VTVA 1ZW7A 2R61A 3U8ZA 1WMHA 1R4NI 1JWAD 2HJ8A 3RYTA 1UELA 4MELA 4RGNA 4OZAA 4NPNA 1N5XA 1K8RB 2X38A 2R2QA 2K0PA 3DBHI 1FO4A 2JZPA 2ZPNA 3WCQA 2B76B 1XLOA 3WAPA 4BKTA 4YXDB 2RDHA 1KOTA 2A4ZA 2Y5BB 4ANUA 3VR9B 4HVBA 2WXOA 3AEFB 2QDFA 3TEZA 3RPFC 4DHZB 4BFRA 2ONQA 3BYYB 2WXFA 2LGYA 4A20A 3BIID 2XEWA 4LDTD 3MTNB 1ZE3D 3KVFB 4N59A 3L54A 3A4RA 4IM2A 4PK1A 1WY8A 3EGRA 4ZRJA 2Z59B 1WR6E 3RMKC 1RRBA 1PQSA 2N9KA 2KMCA 3W2DA 3WIMA 1CK1A 3AE5B 1V1PB 2E3TA 3N20C 2INPE 4IOIE 4C4VB 3AEGB 3ML9A 1M94A 2N9EB 1YMHE 5D6JB 1ESFA 5C23A 1DOIA 2JXTA 1YN5A 5DPRA 2N9XA 4MH0E 3EHVA 1V8CA 3A1QB 1QF6A 2CR5A 4B0EA 3QAQA 1UWMA 2DLBA 2O6VA 1YN4A 1KLVA 1KF6B 2PVGC 1IBXB 1QLBB 3ZNID 3APFA 1TS2A 2LVQA 2JWUA 3UF8A 4KKIA 3APCA 5IP4D 1P7FA 3Q69A 3R2IA 4DDID 1UGJA 2QILA 4G0NB 1H4RA 4I6LB 4IG7B 2CKHB 2YLMA 1E10A 3Q14C 1IP9A 2D07B 1E8ZA 1WGKA 3A9KB 3OJ3A 3ZJUA 1ZDXA 3TEXA 1ET6A 1KFYB 4JL9A 3KUDB 2RSUA 1T5XD 4RGTA 3P2BA 4HPPA 4EUTA 2FUG1 3Q3FA 3EA6A 2HJ1A 4XGAB 1SF0A 4JX1C 1Y56A 3H7PA 1UZXB 3KH0A 3Q8CA 2MWSB 3CWIA 4P16A 1SIJA 4W9LA 3LYYA 2LJ5A 2W82A 3U7ZA 2C7NB 3ZQ4A 1EU3A 2WX0A 2D3AA 4US8A 2V9HA 4XE0A 2K3UA 4JWSC 2J0MA 3ZRFA 3DWMA 3AECB 1DGJA 1WX7A 2Z8LA 4DXGA 2JWZA 2PMVA 3R8BA 4ZRPA 1KM7A 4AS1A 4LCDE 1J7CA 2M1MA 4IWOA 5TR5A 3W9CB 3K9PB 4KDLB 1GC6A 3ZJTA 3B2GA 2NBVB 2KN4A 1VCBA 4FJZA 3A9JB 3W1YA 2MCNB 1JWMD 3ZVVA 1VRAB 4CYEA 1ZXIA 1D5XC 2CHXA 3CSTA 2INNE 3VR8B 2NPTB 2ON8A 3BVMA 3T9LA 1AWDA 3TL5A 4GIVA 1EM7A 3I3TB 3SDLC 4ZHPA 1J19A 4A3PA 4URKA 2ZEQA 4AQ7A 1J7BA 1VD2A 4GDKA 3A33B 1WGRA 4GB9A 1HEZE 3DOWA 2VH2A 2MP2A 4PS7A 1WJ4A 2LXAA 2BYTA 2KAJA 4FJYA 3Q8EA 4F1SA 3DHIC 3CMMB 1FCCC 2LFIA 2KT7A 2GI9A 3MP9A 2M0XA 4N6EB 2REXA 3C8YA 2AQ1B 3PRMB 3L10B 1WGYA 2KYWA 1VLBA 4KVGB 1TKEA 1FEHA 3V61A 2PIAA 4LNFA 3DHHC 2IZVB 3NOBA 2KDBA 2V3NA 1SE9A 1FNVA 2QHOA 3QC8B 1RWSA 4EKUA 3ZXRA 5CHWA 3Q8BA 1WE6A 4BVUC 2WXKA 4HROA 1JW9D 1AYFA 2XK5A 2D3CA 4XWWA 3UIPB 5GXGB 5BYQA 3NVZA 1ZKHA 3LJ3A 2NTTA 2YVCA 3DBRB 1SE2A 3NJTA 1WR1A 1B1ZA 1J0GA 3ZTDA 2IPKD 4LNOA 1JWBD 1BUIC 2JY6A 3Q3MC 4WWOA 4ICUA 3BVZA 1WH3A 4KGSA 3VXWA 5J17A 1RAXA 3AEBB 2N4FA 5JHAA 1N5WA 4FLHA 4K3BA 1P0RA 3N30A 2MBEA 5E6NA 1C9FA 4EZKA 1MHXA 3QIJA 1ZUD2 1JRPA 4MJSB 2IO0B 2WXRA 2PE6B 3OJ4B 3U4EG 2K5PA 4JQWC 5AZFA 3MC0B 2G9HD 4JLCA 3NZ3A 1XXGA 2NBUA 2WDTB 2JZ3B 3KW5B 3P63A 1NEKB 4P6VF 2DZJA 3N32A 4EOYA 1ET9A 2HE7A 3BY4B 4M0WB 1P3QU 2LD9A 4MDKE 1K51A 1T6BX 3RT3B 3OWEB 2J42A 3DPDA 4MGYE 4C7YA 1Y8RC 3R7QA 3DBSA 5IAAC 4XYCA 1HZ6A 4MSMB 2W3RA 4ZYNA 4DQOC 4WWMA 1L2NA 1TYGB 2QEJC 5HI1A 2KDIA 2XNAC 4HEA1 1FNWA 2DWQA 3KYCD 3BYTB 1CJEA 4ARIA 1TKGA 4WJQA 4P7IA 2QC8A 2Y5CA 4ZYSA 1VR9A 2WDRB 1VZ6A 2TSSA 3KQ4A 1FRRA 1WMHB 2CU1A 2ICIA 1FCLA 2KLCA 2EMTA 1EWCA 4AJYB 3P42A 1NYRA 3GZNB 2RPVA 3DDCB 1C1YB 1WWTA 2PLPA 1KRHA 4JE3B 3AU4A 2KACA 4HRSA 3OLMD 1F2RI 2D3GA 3AE3B 4IWPA 2RPQA 2OEDA 1UH6A 3IBEA 3NG0A 2VZKB 3AXCA 3ZNGC 4BKSD 1MJDA 1L6VA 5CTRC 2BT6A 1P7EA 2K8CA 4FHKA 3FKYA 1L5PA 2RMMA 4ARCA 4CO7A 3HRDD 2WXNA 3C19A 4W9GA 1I4HA 2UWQA 2MQJA 3R2TA 4EZLA 2RDGA 3PRPB 3VUYA 2RD0A 4KX6B 1I42A 2L05A 1XQQA 4N58A 4ANVA 2KZRA 3ABVB 3UQAA 2SEBD 2AL3A 1XO3A 3R3MA 2DZIA 1SB3C 2KWVB 1GUAB 1T0QC 1V80A 4PT5A 1UBQA 4OHJA 2GB1A 1FFVA 3Q8AA 2MEKA 2KOXA 2OOBB 1WX8A 1V86A 5EE3A 4ZRKA 2Y5PA 2N7EA 1OQYA 2KWDA 5BYRA 4GGQA 4WJPA 1STEA 4ZOHC 2PPHA 2O6VB 3HK0A 3HM6X 4G50A 2KJ6A 2JYTA 4BOSC 3VVWB 1H8CA 2HTME 3QCAA 4XWTA 2LUEA 5AUIA 2KKCA 1EF1A 2DENB 1F77A 2L32A 4YSYB 5AUKA 1YNTE 2OJWA 3DBRI 4M02A 4TKNA 1WXQA 4ZHOA 3ZKJC 4MGIE 1LXDA 1UWXA 4H2AA 2KN5A 3AI5A 1TS5A 2AQ2B 2GRIA 2J4XA 2LXCA 3ZDTA 2DYOA 4HXDA 3PT2B 2MW5A 3AE7B 5D94A 1FXTB 4HK2A 4W9IA 1ZXHA 2ZW1A 3VAWA 2WXIA 4IDIA 3UI3A 2PTLA 2J53A 4PYZA 1I4XA 1JWSD 3H7PB 4NAWA 3N1ZC 5D3IB 2N7DA 3AN1A 5E6JA 2FAZA 2ZJDA 2LEKA 3EECA 3M63B 3ONSA 3BK2A 4M01A 5JHBA 3IAM1 2WLBA 2WYQA 1XT9B 2KFJA 1NBFC 3QHTA 3RNEC 4DHZE 3JVZX 2HD5B 3P4PB 1TY2A 2V0GA 4FXCA 2W3SA 2FCSA 5LXHA 2BWES 1QQRA 4NQKE 2V3PA 4GN1A 2VH1A 4RCOA 1XD3B 3BZDB 4NY0A 3APDA 4K7WA 1WM2A 3HVDA 5G5HA 1HTQA 4L1BA 1YQ3B 3GP7A 3IG3A 1GC7A 2BF8B 1T0RC 2H89B 3AE6B 3MC9A 2PKOA 1PGXA 4GMVA 2KFKA 1SJHD 2WU5B 3DCGA 1ZDVA 4BOZB 3NY5A 5FR3A 5G2NA 4DHJB 1BT0A 2I38A 2KMAA 3PO0A 2KVRA 4RM8A 1TIFA 2ZVOA 2BTEA 1C3TA 1OFFA 4GDKB 1PUTA 2Y3AA 1D5ZC 3JSVA 2JQRB 3IXSA 2IDYA 2MP2B 2FNJB 2LMCA 2KD0A 4L2YA 4L23A 2BKFA 1E5WA 3SD5A 3X0WA 2KVZA 5KHOA 2N1VA 5DCNA 3ECIA 3UGBB 2EKEC 3JYUA 2WU2B 2DAJA 4ASWC 2KWUB 2MSED 2IO3B 1IUEA 3VUXA 3K9OB 3KWVA 4ANWA 2J7QB 1E8WA 3RNFC 3RD2A 3HUIA 1S3SG 1CMXB 3FILA 1KLGD 4DDGD 2WXLA 4HDOA 1I7HA 1TKYA 3B0AA 4US9A 1RM6C 4YTPB 1WJNA 2JSVX 4E71A 3SR6A 3AE1B 3ETRA 4NJCA 2LVOA 4G11A 4LJOB 1K53A 1T3QA 3CSFA 3ZDMC 1GNUA 3M62B 2WXJA 1XCQL 1ZP0B 2XK5B 1DYQA 5C1ZA 3CF6E 2YEPF 3VRAB 1C77A 4MEMA 5H92C 4LNNA 2DZKA 3U2SC 2IGHA 3M3JA 3DVGX 1FIQA 4FADA 3PPAA 3L17A 2VRRB 2ACZB 4BKSA 1PFDA 1XEEA 1E6EB 2HTHA 3BWUD 4A90A 2LWPA 1WRIA 4B6WA 4KSLC 2MBHA 5H8YE 2C7MB 1WZ0A 3KLSX 5JZEB 1SJED 2JT4B 3AEDB 4LDTB 4A55A 3LB8C 4K7UA 2BS3B 2JVCA 1K50A 1YQ4B 5DPTA 4WWPA 5GMVA 3N1XC 2AWTA 4YSXB 3BINA 3AMZA 3ZRCA 4WURA 2BPSA 5JH5C 3AULA 1TBEA 1ISNA 1E7PB 1SE4A 1HTOA 3A4SC 2KTRA 2QCZA 1VZ8A 2J0KA 4LNKA 1S1QB 2GLSA 3WA0A 3W5VB 1XLQA 1QOBA 3UIOB 3P4SB 3NZUA 4YL8A 2M56B 5EE9A 1GPXA 1N61A 4TQ0A 2C5LC 2JUOA 2KNBA 4HPLB 4TUUA 4RM9A 4WAFA 2GBMA 2NS5A 5JXVA 1HZ5A 4HCNB 2MH7A 1HXYD 1AW7A 3VRBB 5TSSA 2G45B 2Z0EB 3EFUA 4W9FA 3EFCA 4C80A 3EUB2 3PZ8A 3A1QA 1E0ZA 3RNGC 1IGCA 3PZ7A 1F1HA 4ANXA 4WAAA 2D10A 4JGHB 4PS8A 3RNCC 2ZPYA 2KLGA 2J52A 4XZ4A 2K1FA 3B2FA 1C79A 5IO9A 1L0XB 3QJZA 5J2RA 3KWLA 3TEWA 3P1MA 4HCPB 3VUWA 4C56C 1FXAA 5BMGA 3RNAC 3WAMA 1YX5B 1V81A 1E9MA 1SE3A 2DNFA 1E8YA 1WXVA 4KDIC 2KO3A 3PLVA 5HG2A 4NJ6A 3TBLD 2KTFA 3N1YC 3PZDA 2WXGA 3L0WB 4XDDA 1E8XA 1KH0A 2MBQA 3C0RB 2K8HA 4LJPB 3L4PA 2M4NA 1EWYC 3SFEB 1WF9A 3NZSA 2VZKD 3KUZA 2CHZA 4G3XB 3QA8A 2PJHA 1L4ZB 2M8SA 3QQ8B 3VQIA 2K22A 1NVID 3MHSD 2DHZA 3DVNV 2JXXA 3H6NA 1FD6A 2WXMA 4HLEA 4W9CA 4PS3A 3NHEB 2IO2B 3GS2A 1C4PA 1JROA 4KSKC 1HQRD 1AARA 2FIDA 4DXFA 2GBRA 5DPWA 1V97A 3L08A 1UF0A 2N0SB 1WXSA 3NUHB 4WJOA 4JIOU 2WP9B 1MG4A 2GOWA 1R4NB 3X23A 4A3OA 4NJ7A 4ZDVA 2IO1B 4IM0A 3IVFA 3VHTC 2N9PC 4WIPA 3DBHB 1V5TA 4HWIB 4OW0A 2K9XA 2KWCA 2LASA 4OZCA 3FAHA 2JX5A 2IGDA 4DK5A 2C7HA 2CU3A 4EEWA 4HJKA 1QILA 1WYWB 5D7GA 3OG5A 5LXIB 3RZFA 1Z5SB 4J6IA 4II2B 4M8MA 1NI3A 4D2KA 4KZCA 2RDBC 2MLBA 1A5RA 3H1UA 2L76A 3PRZA 1HE8A 2LVPA 4WQMA 4MM3A 3TSSA 3DBLB 4AJWA 5IN7A 4NAWB 3ZTCA 2BW2A 1QKZA 1N60A 1YJ1A 1C4AA 5IA7A 5HFYA 3AB5A 3H8HA 1DOXA 1U4AA 4W9JA 2OJRA 4RGMA 1UGMA 3ZIMA 4N9F4 2ZNVC 3B08A 1WGHA 4FN2A 4RFBA 5CHVC 5D2MB 1E90A 3VFKA 4ITKA 2KDFB 1OTRB 3DVNU 1V9JA 3GE8C 2WHIA 2AL6A 1XF5L 1WJ6A 1JQ4A 2ZW0A 2BS4B 5T8IA 2WWZA 2K6DB 1NYQA 2K8BA 3Q3OC 2AEHA 1GJZA 1WYGA 2KFKB 4E74A 4AWJA 3WAOA 3W1SC 2NR2A 1GB4A 1Q0WB 4BBNF 1L4DB 1WXMA 4R3DA 4KGTA 4NQLB 2EMSA 2KJRA 2NVUI 2BKRB 2MJDA 5AZHA 3JSVB 4I6NB 1JCKB 4FBJB 4CQNA 2MJEA 4PYUA 3TUOA 2FBWB 1OEYA 4II3B 3QK0A 1EU4A 2G3QB 2FE8A 2INCC 3NVWA 1UUPA 2BYVE 3HIZA 2EELA 3I57A 4KIKA 3MC8A 2DAFA 4K1RB 2WX1A 2KMMA 2M17A 1P98A 3AE9B 2WDVB 1ROEA 2KX3A 2QIEB 2V1YA 3PLUA 1SEBD 3FILB 1TS4A 4A8XC 2C9WB 4W9HA 3GB1A 1SGHA 3QWZB 3UINB 3WANA 2GBJA 4F8CB 4OVZA 2WGSA 2G4DB 2W9NA 4MACA 2W55A 3T3NA 1UNSA 1WI0A 3NRZA 1L0YB 2DYMA 4S0RA 4WQOB 3S2AA 2MA9B 1MI0A 3UQBA 2KJHB 2BB5A 1WFYA 1WZ3A 5BYSA 2JRIB 4BKGA 1KLUD 2O2VA 2LZ6A 1WJUA 3N9YC 2IY1B 3KUCB 4YWGG 2LRUA 4K3CA 2IGGA 2SAKA 1T0SC 5AEKB 4GDLA 2A5UA 3ALBA 2V3SA 4JWUC 1KTKA 2D2QA 2LI5A 1FPYA 4EE2A 3W1SA 2IY0B 2FCMA 3GOEA 1FM0D 4YT0B 2LUMA 4W9EA 2AQ3B 1VDVA 4S17A 3U30A 2X8XX 4KKJA 4HPMB 1FNUA 3ENEA 2K6QA 3L16A 2I1JA 3R66C 1P1AA 2PW9A 3VH4B 1RFAA 5IOIA 1D5MC 3MJWA 3RCZA 3V62A 3TIXA 1SSNA 1IYFA 1WIAA 2KTRB 4GOCA 2LGXA 1L0VB 1JALA 3E9SA 1J8CA 3DBLI 2QSDA 3O65B 4IM3A 5DPSA 5FKAC 2L3ZA 3NVVA 3GZNI 1YOVB 4GXBA 3RI7C 4NAMA 4TV3A 2L8JA 3TEYA 1YN3A 1MFWA 2BQQA 4LNIA 2BYEA 4IW0A 4WWNA 2RGFA 3DWGC 2JU6X 2L1AA 4RMAA 3V60A 3N3KB 1N62A 1QZEA 1G6JA 5G55A 4P1BC 1XLPA 3PREA 3U52E 5LNK1 1YD8U 1N6ZA 2WNMA 2ZZPB 2BBCA 4B0MA 4EFOA 1NENB 3AE8B 1FXIA 4K81A 2KHWB 5E6OA 3BK1A 2I2YA 3GE3C 2CJOA 4DXAB 1D3ZA 1IPGA 2UU7A 3QARA 4WH4A 1KJTA 1SXTA 3H7SA 3Q8FA 1A70A 2AYOB 4RH6A 1PGBA 3VTUA 5C3JB 2LGSA 4RGOS 2AX5A 2V4IB 2J0JA 2BVCA 3DQVA 1L6UA 2PVOD 1L7YA 3I5JC 2LRWA 5EE1A 1E7VA 4IUMB 4MGZE 2BGFA 4JPSA 4W9DA 3V6CB 4FHJA 5BO4B 1GG3A 2UYZB 3L13A 2NCNA 2L0FA 1RLFA 5J18A 4USAA 4GSWA 4XDCA 3P4QB 3PS6A 1FFUA 2KANA 4CHKA 2GMIC 3TCAA 1DOYA 3Q6BA 4RF1A 4MH8A 4KZ0A 1NDDA 1R4MB 1V6EA 4OVUA 4YSZB 3ZNHB 2JZZA 3AE2B 4QAYA 3AE4B 4E3CA 1WM3A 2L00B 3WALA 4A9AA 4HKQA 4HDQA 3RULA 2MRPA 3AEAB 3PVLA 1LO5D 2JYEA 2K39A 3IT4B 1WGDA 3IT6B 1J7AA 1V1OA 4BBNC 4REZA 4YTNB 1YJJA 5G5GA 2KDEB 1ZOYB 5IKCM 4BZAA 4DBGA 1GAQB 5EE0A 2QMTA 1TTNA 2ZCBA 1XCTL 2WS3B 1XLNA 3HHMA 2FUHB 2JPHA 3R7RA 1OQQA 1MG8A 2CHWA 5EDSA 3V6EB 4BAXA 2LHEA 1JMLA 4ICVA 2MX2A 2R2OA 3IAS1 4K7SA 4P1CC 1V1PA 3V05A 4ZRQA 5FK9C 3URYA 4C4VA 1LQBA 3KYDD 1BXTA 3PHWB 3MJ5A 2KC2A 4AP4C 1IGDA 3B9JA 1I35A 1TZ1A 3LXFA 1TGZB 4TQ1A 2G1EA 2D11A 4RNAA 4ZRIA 2XBBC 2C60A 2WDQB 3FC4A 3RNBC 1F2RC 4Q2JA 4MM3B 3TJPA 3D32A 1QOAA 1ENFA 1I4QA 2IJ0A 1MVKA 3DVGY 2L83A 2W54A 1P9DU 1OQRA 1IBXA 2EKIA 1QOGA 1YJIA 3NVYA 1CQVA 5BMIA 3NS1A 3IFWB 5LLIA 1HA5A 3OAWA 4J3OD 2LHDA 1FRDA 1E7UA 2CS4A 3VDZA 3A9KA 3HVZA 2KDMA 3ZW3A 1SIFA 2OHFA 1ZGUB 1WGGA 1LM8B 2QJLA 2BB6A 2ZVNA 4LK0M 1F52A 3SFDB 1WX9A 2WXPA 3J9CA 3CIRB 4RF0A 5FR6A 3AH7A 2KK8A 4WJNA 2LJIA 3ZO5B 2PE9A 5CHFA 5HHDG 2D3BA 2N9LA 1ACCA 1B9RA 1C4CA 4FULA 3B1LX
chains in the Genus database with same CATH topology
1TY0A 1YQ3B 3ZJTA 3B2GA 2E6XA 3GP7A 4TMAB 1GB4A 2KN4A 2H89B 3AE6B 1L4DB 1RFKA 2PKOA 1PGXA 1JWMD 1SJHD 1VRAB 1ZXIA 2WU5B 4KGTA 4R3DA 1ZDVA 5FR3A 4NZLB 2MJDA 1D5XC 2BS2B 1I4GA 2INNE 1JCKB 3VR8B 4CQNA 2I38A 2MJEA 2ON8A 3TUOA 3PO0A 5C2TB 2FBWB 3BVMA 3O13A 1AWDA 4HJGE 2BTEA 1EM7A 1OFFA 4GDKB 1PUTA 2Y3AA 4ZHPA 1D5ZC 2M19A 1EU4A 2JQRB 3IXSA 2FE8A 2IDYA 4LTUA 2LMCA 3NVWA 1UUPA 4AQ7A 4L2YA 1J7BA 4L23A 2EELA 3I57A 4UDUC 1HEZE 5MPOA 3V3XA 2KMMA 3AEEB 2BYTA 3AE9B 2KAJA 2WDVB 1ROEA 2WU2B 2QIEB 3Q8EA 1SEBD 4O1NA 5BMHA 3FILB 1IUEA 1FCCC 1TS4A 2LFIA 3KWVA 3MP9A 2GI9A 2NMQA 4N6EB 4A8XC 1QOFA 3C8YA 2AQ1B 3GB1A 3HUIA 2YEPB 3RFZB 1GB1A 4OVZA 1N63A 2D5GA 3FILA 1KLGD 2WQYB 2WXLA 1I7HA 1TKYA 4MACA 1VLBA 2W55A 4US9A 3T3NA 1UNSA 1RM6C 4YTPB 1TKEA 2M0AA 1L0YB 2DYMA 3NRZA 1FEHA 2JSVX 1MI0A 2NTSA 2BB5A 3SR6A 2PIAA 3MHZA 3AE1B 3ETRA 4NJCA 5BYSA 1KLUD 2V3NA 1K53A 3N9YC 4GDLB 1T3QA 3MFGA 3T3OA 1TJEA 1FNVA 3ZJVA 1RWSA 2L52A 4YWGG 1MHHE 4C7ZA 3E56A 2IGGA 1I4RA 2WXJA 1XCQL 1ZP0B 4A6QA 2SAKA 1DYQA 4YTMB 2YEPF 3VRAB 3Q8BA 1WSPA 1VZ7A 1C77A 2WXKA 5H92C 4HROA 1I4PA 1SBBB 3U2SC 1JW9D 4JWUC 1R7SA 1KTKA 1AYFA 2IGHA 4XWWA 3AV8A 4EE2A 5GXGB 3W1SA 5BYQA 1C76A 1FIQA 4GLSC 3NVZA 2NTTA 1FM0D 2ACZB 1SE2A 4YT0B 2LUMA 1PFDA 2Q5WD 1B1ZA 1XEEA 1E6EB 2AQ3B 1VDVA 3BWUD 4A90A 2IPKD 1JWBD 1WRIA 4KKJA 1PYWD 1BUIC 5H8YE 1FNUA 3BVZA 3KLSX 1PDXA 4KGSA 1SJED 3SEBA 3AEDB 4A55A 1MPEA 3LB8C 3AEBB 2BS3B 4IKGA 1K50A 4HKZE 1N5WA 1YQ4B 2PW9A 1D5MC 1SSNA 4YSXB 2KQ4X 5D3DA 3AMZA 1C9FA 1MHXA 1L0VB 1FMAD 4WURA 1Q10A 1JALA 1JRPA 1ZUD2 3E9SA 4KGRA 2WXRA 2H88B 3U4EG 2K5PA 3W5UB 1E7PB 1C78A 1SE4A 2XN9C 2DBYA 2G9HD 1GOZA 2QSDA 3MC0B 3NZ3A 4OZBA 1VZ8A 1XXGA 5FKAC 1TZOA 3P63A 1NEKB 3NVVA 4P6VF 2CJNA 3W5VB 1XLQA 4NAMA 1ET9A 1QOBA 3P4SB 3TEYA 1K52A 1YN3A 2M56B 5EE9A 1GPXA 1N61A 4TQ0A 3DWGC 2JU6X 2L1AA 1K51A 1AN8A 1N62A 1T6BX 4WAFA 3OWEB 1XLPA 2J42A 3U52E 5JXVA 2HDEA 4C7YA 5LNK1 2WXQA 4MT5A 1HZ5A 2MH7A 4M0WA 1HXYD 2WNMA 2BBCA 1AW7A 4B0MA 3VRBB 5TSSA 1HZ6A 1NENB 3AE8B 1FXIA 2W3RA 3BK1A 4DQOC 1D4BA 4WWMA 4LLGM 2I2YA 1TYGB 2QEJC 2WXHA 1JWUD 5HI1A 2CJOA 5I4DA 4C80A 3EUB2 1M4VA 3PZ8A 4WH4A 1SXTA 1E0ZA 3Q8FA 3BVGA 1A70A 2LGIA 2XNAC 4RH6A 1IGCA 1VJKA 1PGBA 4HEA1 1FNWA 3PZ7A 3ZYYX 1F0ZA 2DWQA 1RYJA 2N7JA 3AM9A 4RGOS 3BYTB 5C3JB 1CJEA 2AX5A 4ARIA 1BMLC 1TKGA 2V4IB 3I9V1 1QT9A 2Y5CA 2J52A 1L6UA 1ZPSA 2PVOD 4ZYSA 1VR9A 2WDRB 3P4RB 1VZ6A 3B2FA 1C79A 1TS3A 2TSSA 1L0XB 3KWLA 3KQ4A 1FRRA 5EE1A 2ICIA 2MJ3A 1FCLA 3ZGZA 1EWCA 1CZPA 3TEWA 3P1MA 3P42A 1PGAA 4JPSA 1NYRA 2RPVA 4C56C 1FXAA 1WWTA 4TSSA 5BMGA 2PLPA 1D6EC 1KRHA 1E9MA 4JE3B 2KACA 1SE3A 2R61A 4HRSA 1F2RI 1JWAD 3AE3B 4USAA 5HG2A 2OEDA 4XDCA 3P4QB 1FFUA 2VZKB 4RGNA 4OZAA 2WXGA 1DOYA 1L6VA 1N5XA 4RF1A 4MH8A 4XDDA 2X38A 2BT6A 1P7EA 2K0PA 1FO4A 2JZPA 1KH0A 3WCQA 2B76B 1XLOA 4YSZB 2RDHA 4YXDB 1L5PA 2RMMA 3AE2B 3L4PA 4ARCA 1EWYC 3SFEB 3AE4B 3HRDD 2VZKD 3VR9B 2WXNA 2WXOA 3AEFB 1I4HA 1L4ZB 4A9AA 3TEZA 4HKQA 3R2TA 3RPFC 3VQIA 2RDGA 3AEAB 1LO5D 2JYEA 2K22A 3IT4B 4KX6B 2ONQA 3BYYB 2WXFA 1NVID 4N58A 3IT6B 3BIID 1J7AA 1FD6A 1V1OA 2WXMA 1ZE3D 3ABVB 4REZA 4YTNB 1YJJA 2SEBD 1XO3A 4N59A 5G5GA 1ZOYB 1SB3C 3GS2A 1GAQB 5EE0A 2QMTA 4PT5A 1C4PA 4OHJA 1JROA 1XCTL 3EGRA 1HQRD 2GB1A 1FFVA 4DXFA 2WS3B 1XLNA 2N9KA 1V97A 2N0SB 3W2DA 1CK1A 3AE5B 1OQQA 1V1PB 3Q8AA 2MEKA 2E3TA 3NUHB 2INPE 4IOIE 2LHEA 1JMLA 2WP9B 5EE3A 3AEGB 1YMHE 2Y5PA 3IAS1 2KWDA 5BYRA 3V05A 1V1PA 4ZRQA 1ESFA 5FK9C 3URYA 1STEA 1DOIA 4ZOHC 2JXTA 1YN5A 1BXTA 3MJ5A 1V8CA 2JYTA 1QF6A 4WIPA 1IGDA 3B9JA 4B0EA 2HTME 4OW0A 2K9XA 4XWTA 1UWMA 3LXFA 5AUIA 4OZCA 3FAHA 2DLBA 2JX5A 1F77A 2L32A 4TQ1A 4YSYB 5AUKA 1YNTE 2IGDA 2CU3A 2G1EA 4RNAA 1WXQA 4ZHOA 1QILA 1YN4A 1UWXA 4H2AA 1KF6B 5D7GA 2PVGC 2WDQB 1TS5A 3FC4A 1F2RC 1IBXB 1QLBB 4Q2JA 4MM3B 1TS2A 2AQ2B 1NI3A 4D2KA 2GRIA 2J4XA 2JWUA 4KKIA 2DYOA 1QOAA 3AE7B 1ENFA 1I4QA 2IJ0A 1MVKA 2L83A 2W54A 1P7FA 3Q69A 1OQRA 1IBXA 4WQMA 3R2IA 3TSSA 2EKIA 1UGJA 2QILA 1QOGA 1ZXHA 2ZW1A 1YJIA 3NVYA 4NAWB 1CQVA 2WXIA 4IDIA 5BMIA 3NS1A 2BW2A 1E10A 1HA5A 3UI3A 1WGKA 2PTLA 2J53A 3ZJUA 1ZDXA 1I4XA 1QKZA 4J3OD 2LHDA 1ET6A 3TEXA 1N60A 1KFYB 1C4AA 1FRDA 5HFYA 3AB5A 1T5XD 3H8HA 4RGTA 1DOXA 1JWSD 2FUG1 5D3IB 3EA6A 3AN1A 4RGMA 5E6JA 3HVZA 2KDMA 2LEKA 2OHFA 1SF0A 4JX1C 3BK2A 4RFBA 1Y56A 3Q8CA 4ITKA 2QJLA 3IAM1 2BB6A 2WLBA 3CWIA 4P16A 1SIJA 4LK0M 3LYYA 2W82A 3SFDB 3U7ZA 3ZQ4A 1EU3A 3P4PB 1TY2A 4US8A 4XE0A 2V0GA 4FXCA 1XF5L 2K3UA 2W3SA 2WXPA 3J9CA 3CIRB 4JWSC 1JQ4A 2ZW0A 2BS4B 4RF0A 5T8IA 1QQRA 3AH7A 2V3PA 3DWMA 3AECB 1DGJA 2LJIA 4RCOA 3BZDB 2Z8LA 4DXGA 2PMVA 5HHDG 3R8BA 1NYQA 4ZRPA 4AS1A 2N9LA 1J7CA 1ACCA 1B9RA 1C4CA 1WYGA 3HVDA 5G5HA 4L1BA 3W9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH4 A;  1YMH E;  2LGI A;  1GB4 A;  2KN4 A;  1IGC A;  1PGB A;  2KWD A;  2N7J A;  2IGH A;  1PGX A;  2JXT A;  4GLS C;  4KGT A;  2J52 A;  1IGD A;  2LUM A;  2I38 A;  2ON8 A;  4OZC A;  4HJG E;  1YNT E;  1FCL A;  2IGD A;  1EM7 A;  1PGA A;  2RPV A;  1UWX A;  5BMG A;  4KGS A;  1F2R C;  2PLP A;  1IBX B;  2KAC A;  1MPE A;  4D2K A;  1F2R I;  4IKG A;  2JWU A;  1K50 A;  4HKZ E;  2PW9 A;  2EEL A;  1HEZ E;  5HG2 A;  1MVK A;  2OED A;  1P7F A;  2KQ4 X;  1IBX A;  1C9F A;  4OZA A;  1MHX A;  1ZXH A;  2ZW1 A;  3V3X A;  1Q10 A;  4KGR A;  5BMI A;  1P7E A;  2K0P A;  2JZP A;  1KH0 A;  3UI3 A;  2PTL A;  2J53 A;  2QSD A;  1QKZ A;  2LHD A;  4OZB A;  2RMM A;  5BMH A;  5HFY A;  3FIL B;  1FCC C;  3MP9 A;  2GI9 A;  2NMQ A;  3GB1 A;  1GB1 A;  2KDM A;  1K52 A;  3FIL A;  2ONQ A;  4MAC A;  2JU6 X;  1K51 A;  1FD6 A;  2JSV X;  1MI0 A;  5JXV A;  1XF5 L;  1HZ5 A;  2ZW0 A;  1K53 A;  2QMT A;  1HZ6 A;  1XCT L;  2GB1 A;  5HHD G;  2N9K A;  1MHH E;  1D4B A;  2N9L A;  2IGG A;  2I2Y A;  1XCQ L;  5HI1 A;  4IOI E;  2LHE A;  1JML A; 
#chains in the Genus database with same CATH topology
 1TY0 A;  2E6X A;  3ML8 A;  4TMA B;  2FCN A;  1EO6 A;  1TT5 B;  1RFK A;  3QX1 A;  2IBI B;  2JRH A;  2ZCC A;  2KQS A;  2KC1 A;  4NZL B;  2BS2 B;  3A9J A;  3RN9 C;  1I4G A;  4GU2 A;  5C2T B;  3M95 A;  3O13 A;  4HJG E;  2I1K A;  2IYD B;  3HM3 A;  2M19 A;  4LTU A;  4KIK B;  2NPT A;  3I63 C;  3H9D A;  1EF5 A;  4UDU C;  4F7Z A;  2L7R A;  2BYF A;  5KHQ A;  1LFD A;  4ACF A;  5MPO A;  1WRD B;  3V3X A;  3AEE B;  2IND C;  1V2Y A;  1T0Y A;  4KV2 A;  2KX0 A;  4M8N A;  3PSE B;  5E6P A;  3JW0 X;  2O6V D;  1V5O A;  4FA6 A;  5BMH A;  4O1N A;  1R4M I;  4DWF A;  2NMQ A;  1QOF A;  2JF5 A;  2ASQ A;  2ZNV B;  2YEP B;  3RFZ B;  2BWF A;  1X1M A;  1GB1 A;  1N63 A;  2D5G A;  2WQY B;  3RUI B;  2RR9 A;  2O2V B;  2N1W A;  2M0A A;  2NTS A;  1UBI A;  3MHZ A;  2LGD A;  2FCQ A;  3ZLZ A;  4GDL B;  2V4L A;  4MSQ B;  3MFG A;  3T3O A;  1TJE A;  3ZJV A;  1OEY J;  2L52 A;  1MHH E;  4C7Z A;  3E56 A;  4X57 B;  1I4R A;  4A6Q A;  4YTM B;  3ZNZ B;  1WSP A;  1VZ7 A;  3U7D A;  2PEA A;  3Q2A C;  1I4P A;  1SBB B;  3T8M A;  1R7S A;  3ZUN A;  3AV8 A;  1C76 A;  4GLS C;  3PTF C;  3SU8 X;  4AOF A;  1WXA A;  3ZXV A;  1UD7 A;  4W9K A;  2G4S A;  2MBB B;  2Q5W D;  2KQ7 A;  3RZW C;  2FIF A;  1YIW A;  1V49 A;  1PYW D;  3IHP C;  3LDZ E;  4IWQ A;  3PGE A;  3PV1 A;  1PDX A;  3SEB A;  1MPE A;  4IKG A;  4HKZ E;  1Q5W B;  1Z2M A;  2DZM A;  4M00 A;  3NS8 A;  2KQ4 X;  5D3D A;  4FJV B;  1FMA D;  1Q10 A;  5L95 C;  4KGR A;  2H88 B;  5CX3 A;  3W5U B;  1C78 A;  2XN9 C;  3VH3 B;  2DBY A;  1GOZ A;  4OZB A;  1JRU A;  5L83 A;  1YQB A;  4DHJ D;  1TZO A;  3TMP B;  4MJS A;  2MBO A;  2GBK A;  2CJN A;  5HKH A;  4XX5 A;  1K52 A;  2B3A A;  2DX5 B;  2NBW B;  3VTW A;  1AN8 A;  2K25 A;  2HDE A;  4C00 A;  2WXQ A;  4MT5 A;  5AZG A;  4M0W A;  4AUQ C;  4EZJ A;  3EC8 A;  4I6P A;  1Q1O A;  2Z0D B;  1WE7 A;  3AU5 A;  4B9K A;  3SHQ A;  1D4B A;  3Q3N C;  4LLG M;  4MGK E;  2WXH A;  1JWU D;  2MHJ A;  5I4D A;  1YX6 B;  1LGR A;  1M4V A;  2DYB A;  3BVG A;  2LGI A;  4XC2 A;  1OGW A;  1VJK A;  2L0T A;  3ZYY X;  1F0Z A;  1RYJ A;  2N7J A;  3AM9 A;  1EUV B;  4IC7 B;  1BML C;  3I9V 1;  1QT9 A;  1NI2 A;  3Q3J A;  2KXJ A;  1ZPS A;  1F9J A;  3P4R B;  4NNJ B;  4B95 A;  1TS3 A;  3DHG C;  2MJ3 A;  3ZGZ A;  1CZP A;  1PGA A;  4OVV A;  4TSS A;  3PHX B;  2GBN A;  1D6E C;  3VTV A;  1ZW7 A;  2R61 A;  3U8Z A;  1WMH A;  1R4N I;  1JWA D;  2HJ8 A;  3RYT A;  1UEL A;  4MEL A;  4RGN A;  4OZA A;  4NPN A;  1N5X A;  1K8R B;  2X38 A;  2R2Q A;  2K0P A;  3DBH I;  1FO4 A;  2JZP A;  2ZPN A;  3WCQ A;  2B76 B;  1XLO A;  3WAP A;  4BKT A;  4YXD B;  2RDH A;  1KOT A;  2A4Z A;  2Y5B B;  4ANU A;  3VR9 B;  4HVB A;  2WXO A;  3AEF B;  2QDF A;  3TEZ A;  3RPF C;  4DHZ B;  4BFR A;  2ONQ A;  3BYY B;  2WXF A;  2LGY A;  4A20 A;  3BII D;  2XEW A;  4LDT D;  3MTN B;  1ZE3 D;  3KVF B;  4N59 A;  3L54 A;  3A4R A;  4IM2 A;  4PK1 A;  1WY8 A;  3EGR A;  4ZRJ A;  2Z59 B;  1WR6 E;  3RMK C;  1RRB A;  1PQS A;  2N9K A;  2KMC A;  3W2D A;  3WIM A;  1CK1 A;  3AE5 B;  1V1P B;  2E3T A;  3N20 C;  2INP E;  4IOI E;  4C4V B;  3AEG B;  3ML9 A;  1M94 A;  2N9E B;  1YMH E;  5D6J B;  1ESF A;  5C23 A;  1DOI A;  2JXT A;  1YN5 A;  5DPR A;  2N9X A;  4MH0 E;  3EHV A;  1V8C A;  3A1Q B;  1QF6 A;  2CR5 A;  4B0E A;  3QAQ A;  1UWM A;  2DLB A;  2O6V A;  1YN4 A;  1KLV A;  1KF6 B;  2PVG C;  1IBX B;  1QLB B;  3ZNI D;  3APF A;  1TS2 A;  2LVQ A;  2JWU A;  3UF8 A;  4KKI A;  3APC A;  5IP4 D;  1P7F A;  3Q69 A;  3R2I A;  4DDI D;  1UGJ A;  2QIL A;  4G0N B;  1H4R A;  4I6L B;  4IG7 B;  2CKH B;  2YLM A;  1E10 A;  3Q14 C;  1IP9 A;  2D07 B;  1E8Z A;  1WGK A;  3A9K B;  3OJ3 A;  3ZJU A;  1ZDX A;  3TEX A;  1ET6 A;  1KFY B;  4JL9 A;  3KUD B;  2RSU A;  1T5X D;  4RGT A;  3P2B A;  4HPP A;  4EUT A;  2FUG 1;  3Q3F A;  3EA6 A;  2HJ1 A;  4XGA B;  1SF0 A;  4JX1 C;  1Y56 A;  3H7P A;  1UZX B;  3KH0 A;  3Q8C A;  2MWS B;  3CWI A;  4P16 A;  1SIJ A;  4W9L A;  3LYY A;  2LJ5 A;  2W82 A;  3U7Z A;  2C7N B;  3ZQ4 A;  1EU3 A;  2WX0 A;  2D3A A;  4US8 A;  2V9H A;  4XE0 A;  2K3U A;  4JWS C;  2J0M A;  3ZRF A;  3DWM A;  3AEC B;  1DGJ A;  1WX7 A;  2Z8L A;  4DXG A;  2JWZ A;  2PMV A;  3R8B A;  4ZRP A;  1KM7 A;  4AS1 A;  4LCD E;  1J7C A;  2M1M A;  4IWO A;  5TR5 A;  3W9C B;  3K9P B;  4KDL B;  1GC6 A;  3ZJT A;  3B2G A;  2NBV B;  2KN4 A;  1VCB A;  4FJZ A;  3A9J B;  3W1Y A;  2MCN B;  1JWM D;  3ZVV A;  1VRA B;  4CYE A;  1ZXI A;  1D5X C;  2CHX A;  3CST A;  2INN E;  3VR8 B;  2NPT B;  2ON8 A;  3BVM A;  3T9L A;  1AWD A;  3TL5 A;  4GIV A;  1EM7 A;  3I3T B;  3SDL C;  4ZHP A;  1J19 A;  4A3P A;  4URK A;  2ZEQ A;  4AQ7 A;  1J7B A;  1VD2 A;  4GDK A;  3A33 B;  1WGR A;  4GB9 A;  1HEZ E;  3DOW A;  2VH2 A;  2MP2 A;  4PS7 A;  1WJ4 A;  2LXA A;  2BYT A;  2KAJ A;  4FJY A;  3Q8E A;  4F1S A;  3DHI C;  3CMM B;  1FCC C;  2LFI A;  2KT7 A;  2GI9 A;  3MP9 A;  2M0X A;  4N6E B;  2REX A;  3C8Y A;  2AQ1 B;  3PRM B;  3L10 B;  1WGY A;  2KYW A;  1VLB A;  4KVG B;  1TKE A;  1FEH A;  3V61 A;  2PIA A;  4LNF A;  3DHH C;  2IZV B;  3NOB A;  2KDB A;  2V3N A;  1SE9 A;  1FNV A;  2QHO A;  3QC8 B;  1RWS A;  4EKU A;  3ZXR A;  5CHW A;  3Q8B A;  1WE6 A;  4BVU C;  2WXK A;  4HRO A;  1JW9 D;  1AYF A;  2XK5 A;  2D3C A;  4XWW A;  3UIP B;  5GXG B;  5BYQ A;  3NVZ A;  1ZKH A;  3LJ3 A;  2NTT A;  2YVC A;  3DBR B;  1SE2 A;  3NJT A;  1WR1 A;  1B1Z A;  1J0G A;  3ZTD A;  2IPK D;  4LNO A;  1JWB D;  1BUI C;  2JY6 A;  3Q3M C;  4WWO A;  4ICU A;  3BVZ A;  1WH3 A;  4KGS A;  3VXW A;  5J17 A;  1RAX A;  3AEB B;  2N4F A;  5JHA A;  1N5W A;  4FLH A;  4K3B A;  1P0R A;  3N30 A;  2MBE A;  5E6N A;  1C9F A;  4EZK A;  1MHX A;  3QIJ A;  1ZUD 2;  1JRP A;  4MJS B;  2IO0 B;  2WXR A;  2PE6 B;  3OJ4 B;  3U4E G;  2K5P A;  4JQW C;  5AZF A;  3MC0 B;  2G9H D;  4JLC A;  3NZ3 A;  1XXG A;  2NBU A;  2WDT B;  2JZ3 B;  3KW5 B;  3P63 A;  1NEK B;  4P6V F;  2DZJ A;  3N32 A;  4EOY A;  1ET9 A;  2HE7 A;  3BY4 B;  4M0W B;  1P3Q U;  2LD9 A;  4MDK E;  1K51 A;  1T6B X;  3RT3 B;  3OWE B;  2J42 A;  3DPD A;  4MGY E;  4C7Y A;  1Y8R C;  3R7Q A;  3DBS A;  5IAA C;  4XYC A;  1HZ6 A;  4MSM B;  2W3R A;  4ZYN A;  4DQO C;  4WWM A;  1L2N A;  1TYG B;  2QEJ C;  5HI1 A;  2KDI A;  2XNA C;  4HEA 1;  1FNW A;  2DWQ A;  3KYC D;  3BYT B;  1CJE A;  4ARI A;  1TKG A;  4WJQ A;  4P7I A;  2QC8 A;  2Y5C A;  4ZYS A;  1VR9 A;  2WDR B;  1VZ6 A;  2TSS A;  3KQ4 A;  1FRR A;  1WMH B;  2CU1 A;  2ICI A;  1FCL A;  2KLC A;  2EMT A;  1EWC A;  4AJY B;  3P42 A;  1NYR A;  3GZN B;  2RPV A;  3DDC B;  1C1Y B;  1WWT A;  2PLP A;  1KRH A;  4JE3 B;  3AU4 A;  2KAC A;  4HRS A;  3OLM D;  1F2R I;  2D3G A;  3AE3 B;  4IWP A;  2RPQ A;  2OED A;  1UH6 A;  3IBE A;  3NG0 A;  2VZK B;  3AXC A;  3ZNG C;  4BKS D;  1MJD A;  1L6V A;  5CTR C;  2BT6 A;  1P7E A;  2K8C A;  4FHK A;  3FKY A;  1L5P A;  2RMM A;  4ARC A;  4CO7 A;  3HRD D;  2WXN A;  3C19 A;  4W9G A;  1I4H A;  2UWQ A;  2MQJ A;  3R2T A;  4EZL A;  2RDG A;  3PRP B;  3VUY A;  2RD0 A;  4KX6 B;  1I42 A;  2L05 A;  1XQQ A;  4N58 A;  4ANV A;  2KZR A;  3ABV B;  3UQA A;  2SEB D;  2AL3 A;  1XO3 A;  3R3M A;  2DZI A;  1SB3 C;  2KWV B;  1GUA B;  1T0Q C;  1V80 A;  4PT5 A;  1UBQ A;  4OHJ A;  2GB1 A;  1FFV A;  3Q8A A;  2MEK A;  2KOX A;  2OOB B;  1WX8 A;  1V86 A;  5EE3 A;  4ZRK A;  2Y5P A;  2N7E A;  1OQY A;  2KWD A;  5BYR A;  4GGQ A;  4WJP A;  1STE A;  4ZOH C;  2PPH A;  2O6V B;  3HK0 A;  3HM6 X;  4G50 A;  2KJ6 A;  2JYT A;  4BOS C;  3VVW B;  1H8C A;  2HTM E;  3QCA A;  4XWT A;  2LUE A;  5AUI A;  2KKC A;  1EF1 A;  2DEN B;  1F77 A;  2L32 A;  4YSY B;  5AUK A;  1YNT E;  2OJW A;  3DBR I;  4M02 A;  4TKN A;  1WXQ A;  4ZHO A;  3ZKJ C;  4MGI E;  1LXD A;  1UWX A;  4H2A A;  2KN5 A;  3AI5 A;  1TS5 A;  2AQ2 B;  2GRI A;  2J4X A;  2LXC A;  3ZDT A;  2DYO A;  4HXD A;  3PT2 B;  2MW5 A;  3AE7 B;  5D94 A;  1FXT B;  4HK2 A;  4W9I A;  1ZXH A;  2ZW1 A;  3VAW A;  2WXI A;  4IDI A;  3UI3 A;  2PTL A;  2J53 A;  4PYZ A;  1I4X A;  1JWS D;  3H7P B;  4NAW A;  3N1Z C;  5D3I B;  2N7D A;  3AN1 A;  5E6J A;  2FAZ A;  2ZJD A;  2LEK A;  3EEC A;  3M63 B;  3ONS A;  3BK2 A;  4M01 A;  5JHB A;  3IAM 1;  2WLB A;  2WYQ A;  1XT9 B;  2KFJ A;  1NBF C;  3QHT A;  3RNE C;  4DHZ E;  3JVZ X;  2HD5 B;  3P4P B;  1TY2 A;  2V0G A;  4FXC A;  2W3S A;  2FCS A;  5LXH A;  2BWE S;  1QQR A;  4NQK E;  2V3P A;  4GN1 A;  2VH1 A;  4RCO A;  1XD3 B;  3BZD B;  4NY0 A;  3APD A;  4K7W A;  1WM2 A;  3HVD A;  5G5H A;  1HTQ A;  4L1B A;  1YQ3 B;  3GP7 A;  3IG3 A;  1GC7 A;  2BF8 B;  1T0R C;  2H89 B;  3AE6 B;  3MC9 A;  2PKO A;  1PGX A;  4GMV A;  2KFK A;  1SJH D;  2WU5 B;  3DCG A;  1ZDV A;  4BOZ B;  3NY5 A;  5FR3 A;  5G2N A;  4DHJ B;  1BT0 A;  2I38 A;  2KMA A;  3PO0 A;  2KVR A;  4RM8 A;  1TIF A;  2ZVO A;  2BTE A;  1C3T A;  1OFF A;  4GDK B;  1PUT A;  2Y3A A;  1D5Z C;  3JSV A;  2JQR B;  3IXS A;  2IDY A;  2MP2 B;  2FNJ B;  2LMC A;  2KD0 A;  4L2Y A;  4L23 A;  2BKF A;  1E5W A;  3SD5 A;  3X0W A;  2KVZ A;  5KHO A;  2N1V A;  5DCN A;  3ECI A;  3UGB B;  2EKE C;  3JYU A;  2WU2 B;  2DAJ A;  4ASW C;  2KWU B;  2MSE D;  2IO3 B;  1IUE A;  3VUX A;  3K9O B;  3KWV A;  4ANW A;  2J7Q B;  1E8W A;  3RNF C;  3RD2 A;  3HUI A;  1S3S G;  1CMX B;  3FIL A;  1KLG D;  4DDG D;  2WXL A;  4HDO A;  1I7H A;  1TKY A;  3B0A A;  4US9 A;  1RM6 C;  4YTP B;  1WJN A;  2JSV X;  4E71 A;  3SR6 A;  3AE1 B;  3ETR A;  4NJC A;  2LVO A;  4G11 A;  4LJO B;  1K53 A;  1T3Q A;  3CSF A;  3ZDM C;  1GNU A;  3M62 B;  2WXJ A;  1XCQ L;  1ZP0 B;  2XK5 B;  1DYQ A;  5C1Z A;  3CF6 E;  2YEP F;  3VRA B;  1C77 A;  4MEM A;  5H92 C;  4LNN A;  2DZK A;  3U2S C;  2IGH A;  3M3J A;  3DVG X;  1FIQ A;  4FAD A;  3PPA A;  3L17 A;  2VRR B;  2ACZ B;  4BKS A;  1PFD A;  1XEE A;  1E6E B;  2HTH A;  3BWU D;  4A90 A;  2LWP A;  1WRI A;  4B6W A;  4KSL C;  2MBH A;  5H8Y E;  2C7M B;  1WZ0 A;  3KLS X;  5JZE B;  1SJE D;  2JT4 B;  3AED B;  4LDT B;  4A55 A;  3LB8 C;  4K7U A;  2BS3 B;  2JVC A;  1K50 A;  1YQ4 B;  5DPT A;  4WWP A;  5GMV A;  3N1X C;  2AWT A;  4YSX B;  3BIN A;  3AMZ A;  3ZRC A;  4WUR A;  2BPS A;  5JH5 C;  3AUL A;  1TBE A;  1ISN A;  1E7P B;  1SE4 A;  1HTO A;  3A4S C;  2KTR A;  2QCZ A;  1VZ8 A;  2J0K A;  4LNK A;  1S1Q B;  2GLS A;  3WA0 A;  3W5V B;  1XLQ A;  1QOB A;  3UIO B;  3P4S B;  3NZU A;  4YL8 A;  2M56 B;  5EE9 A;  1GPX A;  1N61 A;  4TQ0 A;  2C5L C;  2JUO A;  2KNB A;  4HPL B;  4TUU A;  4RM9 A;  4WAF A;  2GBM A;  2NS5 A;  5JXV A;  1HZ5 A;  4HCN B;  2MH7 A;  1HXY D;  1AW7 A;  3VRB B;  5TSS A;  2G45 B;  2Z0E B;  3EFU A;  4W9F A;  3EFC A;  4C80 A;  3EUB 2;  3PZ8 A;  3A1Q A;  1E0Z A;  3RNG C;  1IGC A;  3PZ7 A;  1F1H A;  4ANX A;  4WAA A;  2D10 A;  4JGH B;  4PS8 A;  3RNC C;  2ZPY A;  2KLG A;  2J52 A;  4XZ4 A;  2K1F A;  3B2F A;  1C79 A;  5IO9 A;  1L0X B;  3QJZ A;  5J2R A;  3KWL A;  3TEW A;  3P1M A;  4HCP B;  3VUW A;  4C56 C;  1FXA A;  5BMG A;  3RNA C;  3WAM A;  1YX5 B;  1V81 A;  1E9M A;  1SE3 A;  2DNF A;  1E8Y A;  1WXV A;  4KDI C;  2KO3 A;  3PLV A;  5HG2 A;  4NJ6 A;  3TBL D;  2KTF A;  3N1Y C;  3PZD A;  2WXG A;  3L0W B;  4XDD A;  1E8X A;  1KH0 A;  2MBQ A;  3C0R B;  2K8H A;  4LJP B;  3L4P A;  2M4N A;  1EWY C;  3SFE B;  1WF9 A;  3NZS A;  2VZK D;  3KUZ A;  2CHZ A;  4G3X B;  3QA8 A;  2PJH A;  1L4Z B;  2M8S A;  3QQ8 B;  3VQI A;  2K22 A;  1NVI D;  3MHS D;  2DHZ A;  3DVN V;  2JXX A;  3H6N A;  1FD6 A;  2WXM A;  4HLE A;  4W9C A;  4PS3 A;  3NHE B;  2IO2 B;  3GS2 A;  1C4P A;  1JRO A;  4KSK C;  1HQR D;  1AAR A;  2FID A;  4DXF A;  2GBR A;  5DPW A;  1V97 A;  3L08 A;  1UF0 A;  2N0S B;  1WXS A;  3NUH B;  4WJO A;  4JIO U;  2WP9 B;  1MG4 A;  2GOW A;  1R4N B;  3X23 A;  4A3O A;  4NJ7 A;  4ZDV A;  2IO1 B;  4IM0 A;  3IVF A;  3VHT C;  2N9P C;  4WIP A;  3DBH B;  1V5T A;  4HWI B;  4OW0 A;  2K9X A;  2KWC A;  2LAS A;  4OZC A;  3FAH A;  2JX5 A;  2IGD A;  4DK5 A;  2C7H A;  2CU3 A;  4EEW A;  4HJK A;  1QIL A;  1WYW B;  5D7G A;  3OG5 A;  5LXI B;  3RZF A;  1Z5S B;  4J6I A;  4II2 B;  4M8M A;  1NI3 A;  4D2K A;  4KZC A;  2RDB C;  2MLB A;  1A5R A;  3H1U A;  2L76 A;  3PRZ A;  1HE8 A;  2LVP A;  4WQM A;  4MM3 A;  3TSS A;  3DBL B;  4AJW A;  5IN7 A;  4NAW B;  3ZTC A;  2BW2 A;  1QKZ A;  1N60 A;  1YJ1 A;  1C4A A;  5IA7 A;  5HFY A;  3AB5 A;  3H8H A;  1DOX A;  1U4A A;  4W9J A;  2OJR A;  4RGM A;  1UGM A;  3ZIM A;  4N9F 4;  2ZNV C;  3B08 A;  1WGH A;  4FN2 A;  4RFB A;  5CHV C;  5D2M B;  1E90 A;  3VFK A;  4ITK A;  2KDF B;  1OTR B;  3DVN U;  1V9J A;  3GE8 C;  2WHI A;  2AL6 A;  1XF5 L;  1WJ6 A;  1JQ4 A;  2ZW0 A;  2BS4 B;  5T8I A;  2WWZ A;  2K6D B;  1NYQ A;  2K8B A;  3Q3O C;  2AEH A;  1GJZ A;  1WYG A;  2KFK B;  4E74 A;  4AWJ A;  3WAO A;  3W1S C;  2NR2 A;  1GB4 A;  1Q0W B;  4BBN F;  1L4D B;  1WXM A;  4R3D A;  4KGT A;  4NQL B;  2EMS A;  2KJR A;  2NVU I;  2BKR B;  2MJD A;  5AZH A;  3JSV B;  4I6N B;  1JCK B;  4FBJ B;  4CQN A;  2MJE A;  4PYU A;  3TUO A;  2FBW B;  1OEY A;  4II3 B;  3QK0 A;  1EU4 A;  2G3Q B;  2FE8 A;  2INC C;  3NVW A;  1UUP A;  2BYV E;  3HIZ A;  2EEL A;  3I57 A;  4KIK A;  3MC8 A;  2DAF A;  4K1R B;  2WX1 A;  2KMM A;  2M17 A;  1P98 A;  3AE9 B;  2WDV B;  1ROE A;  2KX3 A;  2QIE B;  2V1Y A;  3PLU A;  1SEB D;  3FIL B;  1TS4 A;  4A8X C;  2C9W B;  4W9H A;  3GB1 A;  1SGH A;  3QWZ B;  3UIN B;  3WAN A;  2GBJ A;  4F8C B;  4OVZ A;  2WGS A;  2G4D B;  2W9N A;  4MAC A;  2W55 A;  3T3N A;  1UNS A;  1WI0 A;  3NRZ A;  1L0Y B;  2DYM A;  4S0R A;  4WQO B;  3S2A A;  2MA9 B;  1MI0 A;  3UQB A;  2KJH B;  2BB5 A;  1WFY A;  1WZ3 A;  5BYS A;  2JRI B;  4BKG A;  1KLU D;  2O2V A;  2LZ6 A;  1WJU A;  3N9Y C;  2IY1 B;  3KUC B;  4YWG G;  2LRU A;  4K3C A;  2IGG A;  2SAK A;  1T0S C;  5AEK B;  4GDL A;  2A5U A;  3ALB A;  2V3S A;  4JWU C;  1KTK A;  2D2Q A;  2LI5 A;  1FPY A;  4EE2 A;  3W1S A;  2IY0 B;  2FCM A;  3GOE A;  1FM0 D;  4YT0 B;  2LUM A;  4W9E A;  2AQ3 B;  1VDV A;  4S17 A;  3U30 A;  2X8X X;  4KKJ A;  4HPM B;  1FNU A;  3ENE A;  2K6Q A;  3L16 A;  2I1J A;  3R66 C;  1P1A A;  2PW9 A;  3VH4 B;  1RFA A;  5IOI A;  1D5M C;  3MJW A;  3RCZ A;  3V62 A;  3TIX A;  1SSN A;  1IYF A;  1WIA A;  2KTR B;  4GOC A;  2LGX A;  1L0V B;  1JAL A;  3E9S A;  1J8C A;  3DBL I;  2QSD A;  3O65 B;  4IM3 A;  5DPS A;  5FKA C;  2L3Z A;  3NVV A;  3GZN I;  1YOV B;  4GXB A;  3RI7 C;  4NAM A;  4TV3 A;  2L8J A;  3TEY A;  1YN3 A;  1MFW A;  2BQQ A;  4LNI A;  2BYE A;  4IW0 A;  4WWN A;  2RGF A;  3DWG C;  2JU6 X;  2L1A A;  4RMA A;  3V60 A;  3N3K B;  1N62 A;  1QZE A;  1G6J A;  5G55 A;  4P1B C;  1XLP A;  3PRE A;  3U52 E;  5LNK 1;  1YD8 U;  1N6Z A;  2WNM A;  2ZZP B;  2BBC A;  4B0M A;  4EFO A;  1NEN B;  3AE8 B;  1FXI A;  4K81 A;  2KHW B;  5E6O A;  3BK1 A;  2I2Y A;  3GE3 C;  2CJO A;  4DXA B;  1D3Z A;  1IPG A;  2UU7 A;  3QAR A;  4WH4 A;  1KJT A;  1SXT A;  3H7S A;  3Q8F A;  1A70 A;  2AYO B;  4RH6 A;  1PGB A;  3VTU A;  5C3J B;  2LGS A;  4RGO S;  2AX5 A;  2V4I B;  2J0J A;  2BVC A;  3DQV A;  1L6U A;  2PVO D;  1L7Y A;  3I5J C;  2LRW A;  5EE1 A;  1E7V A;  4IUM B;  4MGZ E;  2BGF A;  4JPS A;  4W9D A;  3V6C B;  4FHJ A;  5BO4 B;  1GG3 A;  2UYZ B;  3L13 A;  2NCN A;  2L0F A;  1RLF A;  5J18 A;  4USA A;  4GSW A;  4XDC A;  3P4Q B;  3PS6 A;  1FFU A;  2KAN A;  4CHK A;  2GMI C;  3TCA A;  1DOY A;  3Q6B A;  4RF1 A;  4MH8 A;  4KZ0 A;  1NDD A;  1R4M B;  1V6E A;  4OVU A;  4YSZ B;  3ZNH B;  2JZZ A;  3AE2 B;  4QAY A;  3AE4 B;  4E3C A;  1WM3 A;  2L00 B;  3WAL A;  4A9A A;  4HKQ A;  4HDQ A;  3RUL A;  2MRP A;  3AEA B;  3PVL A;  1LO5 D;  2JYE A;  2K39 A;  3IT4 B;  1WGD A;  3IT6 B;  1J7A A;  1V1O A;  4BBN C;  4REZ A;  4YTN B;  1YJJ A;  5G5G A;  2KDE B;  1ZOY B;  5IKC M;  4BZA A;  4DBG A;  1GAQ B;  5EE0 A;  2QMT A;  1TTN A;  2ZCB A;  1XCT L;  2WS3 B;  1XLN A;  3HHM A;  2FUH B;  2JPH A;  3R7R A;  1OQQ A;  1MG8 A;  2CHW A;  5EDS A;  3V6E B;  4BAX A;  2LHE A;  1JML A;  4ICV A;  2MX2 A;  2R2O A;  3IAS 1;  4K7S A;  4P1C C;  1V1P A;  3V05 A;  4ZRQ A;  5FK9 C;  3URY A;  4C4V A;  1LQB A;  3KYD D;  1BXT A;  3PHW B;  3MJ5 A;  2KC2 A;  4AP4 C;  1IGD A;  3B9J A;  1I35 A;  1TZ1 A;  3LXF A;  1TGZ B;  4TQ1 A;  2G1E A;  2D11 A;  4RNA A;  4ZRI A;  2XBB C;  2C60 A;  2WDQ B;  3FC4 A;  3RNB C;  1F2R C;  4Q2J A;  4MM3 B;  3TJP A;  3D32 A;  1QOA A;  1ENF A;  1I4Q A;  2IJ0 A;  1MVK A;  3DVG Y;  2L83 A;  2W54 A;  1P9D U;  1OQR A;  1IBX A;  2EKI A;  1QOG A;  1YJI A;  3NVY A;  1CQV A;  5BMI A;  3NS1 A;  3IFW B;  5LLI A;  1HA5 A;  3OAW A;  4J3O D;  2LHD A;  1FRD A;  1E7U A;  2CS4 A;  3VDZ A;  3A9K A;  3HVZ A;  2KDM A;  3ZW3 A;  1SIF A;  2OHF A;  1ZGU B;  1WGG A;  1LM8 B;  2QJL A;  2BB6 A;  2ZVN A;  4LK0 M;  1F52 A;  3SFD B;  1WX9 A;  2WXP A;  3J9C A;  3CIR B;  4RF0 A;  5FR6 A;  3AH7 A;  2KK8 A;  4WJN A;  2LJI A;  3ZO5 B;  2PE9 A;  5CHF A;  5HHD G;  2D3B A;  2N9L A;  1ACC A;  1B9R A;  1C4C A;  4FUL A;  3B1L X; 
#chains in the Genus database with same CATH homology
 1TY0 A;  1YQ3 B;  3ZJT A;  3B2G A;  2E6X A;  3GP7 A;  4TMA B;  1GB4 A;  2KN4 A;  2H89 B;  3AE6 B;  1L4D B;  1RFK A;  2PKO A;  1PGX A;  1JWM D;  1SJH D;  1VRA B;  1ZXI A;  2WU5 B;  4KGT A;  4R3D A;  1ZDV A;  5FR3 A;  4NZL B;  2MJD A;  1D5X C;  2BS2 B;  1I4G A;  2INN E;  1JCK B;  3VR8 B;  4CQN A;  2I38 A;  2MJE A;  2ON8 A;  3TUO A;  3PO0 A;  5C2T B;  2FBW B;  3BVM A;  3O13 A;  1AWD A;  4HJG E;  2BTE A;  1EM7 A;  1OFF A;  4GDK B;  1PUT A;  2Y3A A;  4ZHP A;  1D5Z C;  2M19 A;  1EU4 A;  2JQR B;  3IXS A;  2FE8 A;  2IDY A;  4LTU A;  2LMC A;  3NVW A;  1UUP A;  4AQ7 A;  4L2Y A;  1J7B A;  4L23 A;  2EEL A;  3I57 A;  4UDU C;  1HEZ E;  5MPO A;  3V3X A;  2KMM A;  3AEE B;  2BYT A;  3AE9 B;  2KAJ A;  2WDV B;  1ROE A;  2WU2 B;  2QIE B;  3Q8E A;  1SEB D;  4O1N A;  5BMH A;  3FIL B;  1IUE A;  1FCC C;  1TS4 A;  2LFI A;  3KWV A;  3MP9 A;  2GI9 A;  2NMQ A;  4N6E B;  4A8X C;  1QOF A;  3C8Y A;  2AQ1 B;  3GB1 A;  3HUI A;  2YEP B;  3RFZ B;  1GB1 A;  4OVZ A;  1N63 A;  2D5G A;  3FIL A;  1KLG D;  2WQY B;  2WXL A;  1I7H A;  1TKY A;  4MAC A;  1VLB A;  2W55 A;  4US9 A;  3T3N A;  1UNS A;  1RM6 C;  4YTP B;  1TKE A;  2M0A A;  1L0Y B;  2DYM A;  3NRZ A;  1FEH A;  2JSV X;  1MI0 A;  2NTS A;  2BB5 A;  3SR6 A;  2PIA A;  3MHZ A;  3AE1 B;  3ETR A;  4NJC A;  5BYS A;  1KLU D;  2V3N A;  1K53 A;  3N9Y C;  4GDL B;  1T3Q A;  3MFG A;  3T3O A;  1TJE A;  1FNV A;  3ZJV A;  1RWS A;  2L52 A;  4YWG G;  1MHH E;  4C7Z A;  3E56 A;  2IGG A;  1I4R A;  2WXJ A;  1XCQ L;  1ZP0 B;  4A6Q A;  2SAK A;  1DYQ A;  4YTM B;  2YEP F;  3VRA B;  3Q8B A;  1WSP A;  1VZ7 A;  1C77 A;  2WXK A;  5H92 C;  4HRO A;  1I4P A;  1SBB B;  3U2S C;  1JW9 D;  4JWU C;  1R7S A;  1KTK A;  1AYF A;  2IGH A;  4XWW A;  3AV8 A;  4EE2 A;  5GXG B;  3W1S A;  5BYQ A;  1C76 A;  1FIQ A;  4GLS C;  3NVZ A;  2NTT A;  1FM0 D;  2ACZ B;  1SE2 A;  4YT0 B;  2LUM A;  1PFD A;  2Q5W D;  1B1Z A;  1XEE A;  1E6E B;  2AQ3 B;  1VDV A;  3BWU D;  4A90 A;  2IPK D;  1JWB D;  1WRI A;  4KKJ A;  1PYW D;  1BUI C;  5H8Y E;  1FNU A;  3BVZ A;  3KLS X;  1PDX A;  4KGS A;  1SJE D;  3SEB A;  3AED B;  4A55 A;  1MPE A;  3LB8 C;  3AEB B;  2BS3 B;  4IKG A;  1K50 A;  4HKZ E;  1N5W A;  1YQ4 B;  2PW9 A;  1D5M C;  1SSN A;  4YSX B;  2KQ4 X;  5D3D A;  3AMZ A;  1C9F A;  1MHX A;  1L0V B;  1FMA D;  4WUR A;  1Q10 A;  1JAL A;  1JRP A;  1ZUD 2;  3E9S A;  4KGR A;  2WXR A;  2H88 B;  3U4E G;  2K5P A;  3W5U B;  1E7P B;  1C78 A;  1SE4 A;  2XN9 C;  2DBY A;  2G9H D;  1GOZ A;  2QSD A;  3MC0 B;  3NZ3 A;  4OZB A;  1VZ8 A;  1XXG A;  5FKA C;  1TZO A;  3P63 A;  1NEK B;  3NVV A;  4P6V F;  2CJN A;  3W5V B;  1XLQ A;  4NAM A;  1ET9 A;  1QOB A;  3P4S B;  3TEY A;  1K52 A;  1YN3 A;  2M56 B;  5EE9 A;  1GPX A;  1N61 A;  4TQ0 A;  3DWG C;  2JU6 X;  2L1A A;  1K51 A;  1AN8 A;  1N62 A;  1T6B X;  4WAF A;  3OWE B;  1XLP A;  2J42 A;  3U52 E;  5JXV A;  2HDE A;  4C7Y A;  5LNK 1;  2WXQ A;  4MT5 A;  1HZ5 A;  2MH7 A;  4M0W A;  1HXY D;  2WNM A;  2BBC A;  1AW7 A;  4B0M A;  3VRB B;  5TSS A;  1HZ6 A;  1NEN B;  3AE8 B;  1FXI A;  2W3R A;  3BK1 A;  4DQO C;  1D4B A;  4WWM A;  4LLG M;  2I2Y A;  1TYG B;  2QEJ C;  2WXH A;  1JWU D;  5HI1 A;  2CJO A;  5I4D A;  4C80 A;  3EUB 2;  1M4V A;  3PZ8 A;  4WH4 A;  1SXT A;  1E0Z A;  3Q8F A;  3BVG A;  1A70 A;  2LGI A;  2XNA C;  4RH6 A;  1IGC A;  1VJK A;  1PGB A;  4HEA 1;  1FNW A;  3PZ7 A;  3ZYY X;  1F0Z A;  2DWQ A;  1RYJ A;  2N7J A;  3AM9 A;  4RGO S;  3BYT B;  5C3J B;  1CJE A;  2AX5 A;  4ARI A;  1BML C;  1TKG A;  2V4I B;  3I9V 1;  1QT9 A;  2Y5C A;  2J52 A;  1L6U A;  1ZPS A;  2PVO D;  4ZYS A;  1VR9 A;  2WDR B;  3P4R B;  1VZ6 A;  3B2F A;  1C79 A;  1TS3 A;  2TSS A;  1L0X B;  3KWL A;  3KQ4 A;  1FRR A;  5EE1 A;  2ICI A;  2MJ3 A;  1FCL A;  3ZGZ A;  1EWC A;  1CZP A;  3TEW A;  3P1M A;  3P42 A;  1PGA A;  4JPS A;  1NYR A;  2RPV A;  4C56 C;  1FXA A;  1WWT A;  4TSS A;  5BMG A;  2PLP A;  1D6E C;  1KRH A;  1E9M A;  4JE3 B;  2KAC A;  1SE3 A;  2R61 A;  4HRS A;  1F2R I;  1JWA D;  3AE3 B;  4USA A;  5HG2 A;  2OED A;  4XDC A;  3P4Q B;  1FFU A;  2VZK B;  4RGN A;  4OZA A;  2WXG A;  1DOY A;  1L6V A;  1N5X A;  4RF1 A;  4MH8 A;  4XDD A;  2X38 A;  2BT6 A;  1P7E A;  2K0P A;  1FO4 A;  2JZP A;  1KH0 A;  3WCQ A;  2B76 B;  1XLO A;  4YSZ B;  2RDH A;  4YXD B;  1L5P A;  2RMM A;  3AE2 B;  3L4P A;  4ARC A;  1EWY C;  3SFE B;  3AE4 B;  3HRD D;  2VZK D;  3VR9 B;  2WXN A;  2WXO A;  3AEF B;  1I4H A;  1L4Z B;  4A9A A;  3TEZ A;  4HKQ A;  3R2T A;  3RPF C;  3VQI A;  2RDG A;  3AEA B;  1LO5 D;  2JYE A;  2K22 A;  3IT4 B;  4KX6 B;  2ONQ A;  3BYY B;  2WXF A;  1NVI D;  4N58 A;  3IT6 B;  3BII D;  1J7A A;  1FD6 A;  1V1O A;  2WXM A;  1ZE3 D;  3ABV B;  4REZ A;  4YTN B;  1YJJ A;  2SEB D;  1XO3 A;  4N59 A;  5G5G A;  1ZOY B;  1SB3 C;  3GS2 A;  1GAQ B;  5EE0 A;  2QMT A;  4PT5 A;  1C4P A;  4OHJ A;  1JRO A;  1XCT L;  3EGR A;  1HQR D;  2GB1 A;  1FFV A;  4DXF A;  2WS3 B;  1XLN A;  2N9K A;  1V97 A;  2N0S B;  3W2D A;  1CK1 A;  3AE5 B;  1OQQ A;  1V1P B;  3Q8A A;  2MEK A;  2E3T A;  3NUH B;  2INP E;  4IOI E;  2LHE A;  1JML A;  2WP9 B;  5EE3 A;  3AEG B;  1YMH E;  2Y5P A;  3IAS 1;  2KWD A;  5BYR A;  3V05 A;  1V1P A;  4ZRQ A;  1ESF A;  5FK9 C;  3URY A;  1STE A;  1DOI A;  4ZOH C;  2JXT A;  1YN5 A;  1BXT A;  3MJ5 A;  1V8C A;  2JYT A;  1QF6 A;  4WIP A;  1IGD A;  3B9J A;  4B0E A;  2HTM E;  4OW0 A;  2K9X A;  4XWT A;  1UWM A;  3LXF A;  5AUI A;  4OZC A;  3FAH A;  2DLB A;  2JX5 A;  1F77 A;  2L32 A;  4TQ1 A;  4YSY B;  5AUK A;  1YNT E;  2IGD A;  2CU3 A;  2G1E A;  4RNA A;  1WXQ A;  4ZHO A;  1QIL A;  1YN4 A;  1UWX A;  4H2A A;  1KF6 B;  5D7G A;  2PVG C;  2WDQ B;  1TS5 A;  3FC4 A;  1F2R C;  1IBX B;  1QLB B;  4Q2J A;  4MM3 B;  1TS2 A;  2AQ2 B;  1NI3 A;  4D2K A;  2GRI A;  2J4X A;  2JWU A;  4KKI A;  2DYO A;  1QOA A;  3AE7 B;  1ENF A;  1I4Q A;  2IJ0 A;  1MVK A;  2L83 A;  2W54 A;  1P7F A;  3Q69 A;  1OQR A;  1IBX A;  4WQM A;  3R2I A;  3TSS A;  2EKI A;  1UGJ A;  2QIL A;  1QOG A;  1ZXH A;  2ZW1 A;  1YJI A;  3NVY A;  4NAW B;  1CQV A;  2WXI A;  4IDI A;  5BMI A;  3NS1 A;  2BW2 A;  1E10 A;  1HA5 A;  3UI3 A;  1WGK A;  2PTL A;  2J53 A;  3ZJU A;  1ZDX A;  1I4X A;  1QKZ A;  4J3O D;  2LHD A;  1ET6 A;  3TEX A;  1N60 A;  1KFY B;  1C4A A;  1FRD A;  5HFY A;  3AB5 A;  1T5X D;  3H8H A;  4RGT A;  1DOX A;  1JWS D;  2FUG 1;  5D3I B;  3EA6 A;  3AN1 A;  4RGM A;  5E6J A;  3HVZ A;  2KDM A;  2LEK A;  2OHF A;  1SF0 A;  4JX1 C;  3BK2 A;  4RFB A;  1Y56 A;  3Q8C A;  4ITK A;  2QJL A;  3IAM 1;  2BB6 A;  2WLB A;  3CWI A;  4P16 A;  1SIJ A;  4LK0 M;  3LYY A;  2W82 A;  3SFD B;  3U7Z A;  3ZQ4 A;  1EU3 A;  3P4P B;  1TY2 A;  4US8 A;  4XE0 A;  2V0G A;  4FXC A;  1XF5 L;  2K3U A;  2W3S A;  2WXP A;  3J9C A;  3CIR B;  4JWS C;  1JQ4 A;  2ZW0 A;  2BS4 B;  4RF0 A;  5T8I A;  1QQR A;  3AH7 A;  2V3P A;  3DWM A;  3AEC B;  1DGJ A;  2LJI A;  4RCO A;  3BZD B;  2Z8L A;  4DXG A;  2PMV A;  5HHD G;  3R8B A;  1NYQ A;  4ZRP A;  4AS1 A;  2N9L A;  1J7C A;  1ACC A;  1B9R A;  1C4C A;  1WYG A;  3HVD A;  5G5H A;  4L1B A;  3W9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...