2ONQA

Gbeta1 stabilization by in vitro evolution and computational design
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
b'MQFKLIINGKTLKGEITIEAVDAAEAEKFFKQYANDNGIDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
molecule tags Protein binding
source organism Streptococcus sp.
publication title Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization.
pubmed doi rcsb
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2onqA00
1K51A 1ZXHA 2LGIA 2RMMA 2JWUA 2J52A 1IGCA 5HG2A 1KH0A 2J53A 3UI3A 3V3XA 2KACA 1HZ5A 2JXTA 5BMHA 3GB1A 2K0PA 5BMGA 2IGHA 1GB4A 4IKGA 1XCTL 2JU6X 3FILB 1K52A 1FD6A 2NMQA 4D2KA 1C9FA 1F2RC 1MHXA 1D4BA 1XCQL 2LHDA 1YNTE 1IGDA 2ZW0A 4WH4A 3MP9A 2OEDA 1XF5L 4KGRA 2JSVX 5BMIA 1MHHE 2PW9A 5JXVA 2GI9A 1IBXA 1JMLA 4KGSA 1GB1A 1P7FA 1MI0A 2GB1A 2KDMA 3FILA 2LHEA 4MACA 2I2YA 2I38A 4OZAA 2KQ4X 4HKZE 1Q10A 4OZBA 2ON8A 1MVKA 1YMHE 5HHDG 1PGAA 1HEZE 1PGXA 5HI1A 4KGTA 2N7JA 1P7EA 1F2RI 2ZW1A 4GLSC 4OZCA 2ONQA 1EM7A 2KN4A 5HFYA 2IGGA 1FCLA 1FCCC 2JZPA 1MPEA 1QKZA 2EELA 1IBXB 2QSDA 4HJGE 2PLPA 1HZ6A 1K50A 2PTLA 2IGDA 2KWDA 4IOIE 2QMTA 2N9KA 1UWXA 2LUMA 1PGBA 1K53A 2N9LA 2RPVA
chains in the Genus database with same CATH superfamily
1V6EA 1PUTA 4CYEA 4MSMB 2RMMA 2KTRA 3DBHB 2HTHA 4EFOA 3NVWA 1SE2A 2E3TA 2RGFA 3PLVA 5BMGA 1J7CA 4UDUC 3R7QA 2K1FA 1TJEA 2LXAA 2KFJA 4LTUA 1QT9A 3ZYYX 3W2DA 3UIPB 3AU5A 3RFZB 1ISNA 4EZLA 4MGIE 1YJ1A 5C2TB 5D3IB 2K25A 4MGZE 1FXIA 2INPE 3ZO5B 2I2YA 4GGQA 1FM0D 1J7BA 2L05A 5JH5C 4XE0A 4MSQB 3X23A 1FXAA 4NY0A 1ZPSA 2UYZB 2WXKA 4AJYB 4HXDA 2DYMA 3BY4B 1JWUD 2BYFA 4M0WB 4CQNA 1D5MC 2M0XA 1GUAB 1WXMA 4EOYA 2N9PC 2LFIA 1GOZA 2V3NA 3RZWC 2IJ0A 2Y5BB 1HZ6A 4DHZE 1F0ZA 1TS2A 2LJ5A 1KFYB 4P1BC 4W9DA 3I63C 3I5JC 4TMAB 1V86A 2AQ1B 1KH0A 1WMHB 2KHWB 4AP4C 2X8XX 2KVZA 1KLUD 1M94A 3PS6A 2BF8B 3HHMA 2SAKA 2XN9C 3TMPB 3PO0A 1Q5WB 4GB9A 5GXGB 2RSUA 1T0QC 2FCNA 4GDKA 3ZDMC 1MHXA 1P9DU 3AEFB 3HVDA 2G3QB 1LO5D 1HTQA 2WXLA 4B6WA 2AEHA 4FLHA 3NJTA 4DXAB 3ZTDA 5H8YE 2L76A 2L3ZA 4KGSA 4WJQA 4HKQA 1TY2A 4O1NA 4B0EA 2J0KA 2WP9B 4HK2A 2VZKB 3TL5A 1Q10A 1OQQA 3DVNU 3EHVA 1L4DB 4TQ1A 3VH4B 1F77A 3V6CB 3VVWB 2K8HA 2DAJA 3D32A 5EE1A 2NTTA 4HWIB 2WDVB 1CJEA 1EWCA 3Q3FA 2ZZPB 3MTNB 4IM3A 3GS2A 2IGGA 4ZOHC 4W9GA 5BYRA 4MM3B 4GN1A 1FRRA 3TUOA 2BKRB 2OOBB 3TBLD 2KFKA 2PTLA 2AX5A 2WXRA 5LXIB 1EWYC 1JALA 1WGKA 2GOWA 3DDCB 2JXXA 1JRUA 4R3DA 1SXTA 1I4PA 2W3RA 1P3QU 2DYOA 4ZYNA 3Q3MC 4XX5A 3W1SC 3S2AA 1XLNA 1Y56A 2VRRB 4DBGA 3OLMD 3IFWB 5LLIA 3WA0A 1D5ZC 5EDSA 3ETRA 1GB4A 1ACCA 3T3NA 2D07B 2Z59B 1I35A 1ZE3D 4IWPA 1KOTA 4ZRQA 2JY6A 2K8CA 4ITKA 4HCPB 1B1ZA 3QARA 3HM6X 3H1UA 4HPMB 1TS4A 3AULA 3AH7A 2JUOA 2N7EA 2ZCBA 3CF6E 1DOYA 3CSFA 4S17A 2IBIB 1VR9A 4ZRPA 2PEAA 1FIQA 3UF8A 1TKGA 4HKZE 5C3JB 2PVOD 2Z8LA 4OZBA 3M62B 3ZNZB 2W3SA 5JHAA 4KZ0A 4PS7A 2DZIA 1JROA 3SFDB 2KKCA 5IP4D 4BKSA 1C78A 2ZVNA 4M01A 1PQSA 1FCLA 4E3CA 1F9JA 4JX1C 3ZUNA 3M3JA 2KXJA 3DBRI 3RT3B 3AE6B 1RAXA 4RMAA 2FNJB 1R7SA 3VUYA 2AQ3B 1EU3A 3AEBB 2JX5A 2KLCA 2WWZA 3N32A 1MJDA 3KH0A 1K51A 1OQRA 2WS3B 1PDXA 2RPQA 2LGIA 2JWUA 4ZRJA 2QIEB 4US8A 2QCZA 2MA9B 4LLGM 3VFKA 1HXYD 2L83A 4IDIA 3VXWA 1VRAB 1AN8A 2G9HD 3DHHC 3PV1A 2G45B 1SIFA 3BZDB 1XCTL 4RCOA 1QF6A 3P4SB 1C9FA 1C3TA 1IGDA 4KIKB 1Q0WB 2CHZA 4M02A 4NJ7A 2UU7A 2MBEA 3L16A 5DPSA 1L4ZB 2JYEA 2BWFA 2CU1A 2K3UA 2D10A 5EE9A 4LDTD 1T0SC 2GBMA 3A4SC 3ZIMA 5I4DA 4OZAA 4MH8A 4LDTB 2PE9A 2N7DA 4K7SA 2BW2A 5HHDG 2KX0A 4ZYSA 4KSKC 3WAOA 1PGXA 4M0WA 3AE2B 1RM6C 1YJIA 2WU5B 3KUCB 2BYVE 4F7ZA 2KN4A 1I4XA 5HFYA 3U2SC 3PHWB 1C1YB 3PT2B 2MEKA 3DVGX 2C7NB 1IYFA 1C79A 1RRBA 3T8MA 2OHFA 3VTWA 1FNWA 4HEA1 1KRHA 3QIJA 1E8WA 2LUMA 2H88B 4MELA 4OVUA 2M8SA 5E6OA 5DPTA 3IAM1 5FKAC 2CR5A 3AE9B 1VZ7A 2RR9A 1F52A 2BS2B 4US9A 1A5RA 2K0PA 2LUEA 1QLBB 3TEZA 4MGKE 3SU8X 1U4AA 4L1BA 3NY5A 3RULA 3ABVB 2KJHB 3N1XC 1KJTA 3Q6BA 2Z0DB 3PZDA 3LB8C 3MJWA 2FCSA 4G11A 1XF5L 4A90A 3HM3A 1GC7A 2IYDB 2W82A 1SBBB 3K9PB 2KDFB 1WFYA 4ANUA 2XNAC 3FKYA 4G0NB 3BWUD 1EU4A 1GG3A 5E6PA 1L0XB 2AQ2B 4EUTA 5LXHA 2MBHA 2GB1A 2KDMA 3PREA 3A4RA 2I38A 2KANA 2HDEA 3ZXVA 2LD9A 2KO3A 2ZJDA 4KV2A 2JQRB 4HRSA 3V05A 3AI5A 3J9CA 2G4DB 2N4FA 2WXGA 2IO1B 4DHZB 5LNK1 1WM2A 1SIJA 3W1SA 3PSEB 2JZ3B 2V0GA 3RN9C 2INDC 2I1KA 1R4NI 1NVID 4LJOB 4N9F4 4USAA 2WGSA 2EKEC 1WE6A 1YQ3B 2ICIA 3SEBA 1VZ8A 3PRZA 4FJZA 2H89B 4PYZA 1ZOYB 3QHTA 3WCQA 2DAFA 2O2VA 1E8XA 3EECA 2PKOA 1K50A 5FK9C 2W9NA 3BVZA 2M0AA 4RGTA 2KOXA 2WXPA 2VH2A 3IT4B 2MBOA 1TZ1A 3B9JA 1IGCA 4YSYB 2IO2B 2D3AA 3L10B 1FRDA 5AZFA 1BMLC 2Y3AA 2OJWA 4E74A 2LI5A 5AZHA 2EMTA 3AEEB 1STEA 3HRDD 3NUHB 1JWBD 2KDIA 1FD6A 3AE7B 2BTEA 3RUIB 4GSWA 1YNTE 3TEXA 4GU2A 3WANA 3A9KA 2ZNVC 4ARIA 1H8CA 1WY8A 4N59A 3QA8A 4LNNA 1XD3B 5BMIA 2N9EB 4P1CC 3VHTC 1MHHE 2QDFA 2WXMA 4M8MA 1VCBA 3PZ7A 1WGRA 5MPOA 4DDID 3DBSA 3W1YA 3ZKJC 1WR1A 1UGMA 4K1RB 2Y5CA 2LHEA 4S0RA 4ARCA 2KQ4X 2LVOA 1Z2MA 2L1AA 2QHOA 1QQRA 1K8RB 3QK0A 1ZP0B 4RFBA 4GXBA 4HJKA 3B08A 2E6XA 4GMVA 4GDLB 1PYWD 4ZHOA 4M8NA 2LXCA 5C23A 1C77A 3AN1A 3P4QB 1Z5SB 4DQOC 4ASWC 2HJ8A 2KDBA 4BKSD 2NBUA 1YN5A 2JF5A 1B9RA 3DWGC 2Y5PA 2M17A 4ZRIA 3OJ3A 2WU2B 3TEWA 2BB6A 1TKEA 3I3TB 1XLQA 2QC8A 2J52A 5H92C 3U7ZA 2GLSA 1FNUA 3UINB 5AEKB 1DOIA 3T9LA 2WXJA 2KJRA 4HDQA 2REXA 1AARA 2ZVOA 4BKTA 2B3AA 4KVGB 1WRDB 1WRIA 4HPLB 3TIXA 4W9FA 3PVLA 1N63A 3CSTA 4I6PA 3BINA 3URYA 2O2VB 2QJLA 4W9KA 2LHDA 3W5VB 4NAMA 3AE1B 1OFFA 2OEDA 2DZKA 1F1HA 4IM0A 1CQVA 3RNFC 4JWSC 1NI3A 2LGSA 2FBWB 2X38A 1IBXA 4G50A 2YEPB 5JZEB 1H4RA 4RGOS 4MACA 3P42A 2FIFA 2KMAA 2RDHA 2MHJA 1ET6A 2KDEB 3RNAC 1WR6E 2A5UA 2CJNA 1YOVB 1PGAA 5IAAC 1JRPA 5GMVA 4MEMA 2BGFA 3RD2A 3L0WB 3SD5A 4BZAA 2KQSA 1R4MB 3ZTCA 3T3OA 1UGJA 3AEAB 3A33B 2ONQA 1UWMA 4FXCA 5D2MB 3NRZA 3N3KB 3Q8AA 4FN2A 4LNIA 3JW0X 5G5GA 1L0VB 2J4XA 4DK5A 1NYQA 4ZRKA 1DOXA 5FR3A 2PE6B 4W9IA 3GP7A 1OGWA 3MHZA 2KNBA 3BVGA 3LXFA 1E7UA 1E7VA 3VAWA 2DHZA 2ZNVB 2CJOA 3ZQ4A 1I7HA 4KKIA 2XK5B 3DVNV 4M00A 3HUIA 2LGXA 4XWWA 1OEYJ 4A8XC 3EFUA 4JWUC 4BAXA 2BKFA 5G55A 2FCQA 3NHEB 1J0GA 1V5OA 3GZNI 2KLGA 3Q3JA 1Q1OA 1F2RC 4NJCA 4BVUC 2NTSA 2ACZB 3AMZA 1WM3A 2MJ3A 2MJEA 2RDBC 1KF6B 1KLVA 3DCGA 4EKUA 4FADA 1I42A 2L7RA 4FBJB 1E90A 2JVCA 1PFDA 2ZCCA 4XC2A 2D3GA 1L6VA 1QOFA 2GI9A 1WJ4A 4DHJD 3C19A 4YTNB 1I4RA 1TYGB 3EGRA 2GRIA 2NVUI 2KVRA 2NBWB 2WXNA 1SGHA 4KKJA 4JLCA 3QJZA 2LGYA 4CHKA 2FUHB 4HDOA 3VQIA 2LJIA 3DPDA 4PS3A 1S1QB 2MCNB 4KGTA 3OJ4B 2NBVB 2KYWA 4WQMA 4TSSA 3ZVVA 3M95A 3O13A 4XZ4A 2MQJA 2EELA 3C0RB 3CWIA 4QAYA 2K5PA 1SE9A 3ENEA 3B2FA 1TS3A 4IOIE 4KX6B 3Q2AC 2D3BA 2IDYA 3A9KB 1K53A 3U7DA 2JWZA 5JHBA 5BO4B 3RZFA 4YTPB 4YWGG 1E7PB 4DWFA 4IW0A 3VR8B 4I6LB 2BT6A 1GAQB 1HQRD 2LGDA 3DBHI 3RPFC 3TEYA 3KVFB 3O65B 2LASA 4RH6A 2JXTA 5BMHA 5CX3A 1FMAD 3BK1A 1EF5A 2V3PA 3WAPA 4D2KA 3L17A 3R66C 3IVFA 5EE3A 1YX5B 2IPKD 3NVYA 1ZDXA 2DLBA 2WDQB 1MG4A 2M4NA 3ZJUA 1QOAA 4NJ6A 2KK8A 1N60A 4KIKA 3Q8BA 3A9JB 1V9JA 4WWPA 4FA6A 4WQOB 3IAS1 2LMCA 3FILA 3B2GA 3KW5B 4K7WA 3EUB2 4LJPB 2KZRA 4C4VA 4K81A 1EUVB 2MH7A 2MJDA 1ZKHA 4FJVB 4K7UA 2KWUB 4TV3A 3NS1A 4A20A 2QILA 3DWMA 1WF9A 3AE3B 4N58A 1L5PA 1UZXB 1GNUA 4Q2JA 4OZCA 5J2RA 2J42A 3NVVA 4OW0A 3U4EG 1FCCC 4XDCA 1M4VA 2JZPA 1FNVA 4YXDB 1ZUD2 4WIPA 1AYFA 1UUPA 2M56B 2XBBC 2B76B 4HJGE 4KSLC 3HVZA 1BXTA 4I6NB 4LNOA 1C76A 2KWDA 4B0MA 1PGBA 1DGJA 1LGRA 1ZXHA 1ROEA 5L95C 2G4SA 1E9MA 1N5XA 1NYRA 1T6BX 4NZLB 3V62A 4C80A 4ANVA 5FR6A 3UIOB 1MFWA 4RF0A 2D5GA 3L08A 4PYUA 4XYCA 1HZ5A 1E5WA 2L0FA 1V80A 3N20C 1BUIC 2MBQA 2K22A 3AE4B 2A4ZA 4YSZB 4GDLA 2KX3A 1L7YA 2JU6X 1LM8B 4KDLB 2KT7A 2C60A 4W9EA 4WJOA 3IT6B 3ZNID 3PLUA 1DYQA 2C7HA 3MC0B 2M19A 1KLGD 3WIMA 4KGRA 3SR6A 1UBQA 4C7ZA 2CKHB 3QAQA 2MSED 1WMHA 3QX1A 4G3XB 2WDRB 4ANXA 1P7FA 1MI0A 3TJPA 3JVZX 3N1YC 2XEWA 4W9LA 3OG5A 1UELA 1XEEA 2CS4A 2DZMA 3AM9A 1T5XD 4MDKE 1A70A 3L54A 3VTVA 4P7IA 4YSXB 1F2RI 2XK5A 1FFUA 1JW9D 2IY0B 2DWQA 1AW7A 4RNAA 3VTUA 4A3OA 3APDA 2JRHA 3P63A 1NBFC 3ZRCA 2RD0A 4YL8A 3ZNGC 5IA7A 2ZEQA 2KWVB 3LJ3A 4X57B 1E6EB 3VH3B 2QMTA 3HIZA 2JRIB 2VH1A 2WXHA 3W5UB 3Q8CA 2O6VA 1P1AA 3AEDB 2KAJA 4GIVA 3H7PA 2YEPF 3NZ3A 5CHWA 4YT0B 2DZJA 1TGZB 2L32A 3M63B 4L23A 3BVMA 1V2YA 3V3XA 4ZHPA 3CIRB 4JQWC 4HROA 5CTRC 4KDIC 1TKYA 2BBCA 1OTRB 4A55A 1SE3A 2UWQA 1CZPA 3AE8B 1TS5A 2NMQA 3DBRB 2MP2B 4YTMB 1V1OA 4WH4A 2N1VA 2WXQA 1I4GA 5C1ZA 1TT5B 4RM8A 3ECIA 3R3MA 4FULA 5KHQA 3LDZE 2JSVX 2W54A 1C4CA 2PW9A 5KHOA 3DBLB 2MW5A 5IOIA 3Q14C 2DENB 3ZW3A 3H7PB 1XT9B 3IG3A 1CMXB 4ICVA 3KYCD 3VR9B 2W55A 3FAHA 1P0RA 5J18A 4MJSA 2ASQA 2KTFA 4K3BA 1WYWB 2GBKA 4BOZB 1UD7A 3R2TA 3N1ZC 4RGMA 2QEJC 3QWZB 2BYTA 1VD2A 1HA5A 5AUIA 1JCKB 2TSSA 1RFKA 3BK2A 2WX1A 1WZ3A 4EE2A 1EO6A 2DNFA 1IBXB 2QSDA 1L0YB 3IHPC 2V9HA 4TKNA 3AEGB 2I1JA 5D7GA 1RFAA 4EZJA 1V97A 3MC8A 2LWPA 5EE0A 2DBYA 2K9XA 4GOCA 2FE8A 4NPNA 3ONSA 1FFVA 3AXCA 2AWTA 2NPTA 4LK0M 1SSNA 2KACA 5G5HA 2GBJA 1VJKA 3FC4A 4LNFA 2MBBB 1IP9A 3OWEB 2ZPYA 2LVPA 4WURA 4URKA 3E9SA 1WXQA 2KWCA 1LFDA 4IKGA 4W9JA 1K52A 2C9WB 1ESFA 5CHFA 4C7YA 1E10A 4MT5A 2J7QB 2RDGA 1T3QA 2BS4B 1V81A 1R4NB 3RYTA 2M1MA 2HD5B 1T0YA 3NZUA 5DCNA 2AYOB 3H8HA 1E8ZA 3NG0A 5AUKA 2MWSB 4FJYA 3AB5A 4P16A 4JIOU 1WGGA 4AS1A 3UGBB 4C00A 1WI0A 2KC2A 3GE3C 4A6QA 1D6EC 4RGNA 2V4LA 1GPXA 3RNBC 4OVZA 2IZVB 3AU4A 2KJ6A 4B95A 2YVCA 1P7EA 1WJ6A 2YLMA 2WYQA 1YX6B 1T0RC 1RYJA 2HJ1A 3L4PA 5HKHA 2WQYB 1EF1A 4IWOA 3EC8A 1ZW7A 3W9CB 3SFEB 1WJUA 2IO3B 1C4AA 1FXTB 4AUQC 1JWMD 4PT5A 1N6ZA 5J17A 4NQLB 1TY0A 1WIAA 4DHJB 2L52A 1UWXA 4TUUA 4WAAA 3EFCA 2WXIA 3TCAA 3A1QB 3NZSA 4J6IA 3B1LX 5HG2A 2WHIA 3NS8A 2L0TA 1YQBA 4RF1A 3JSVA 2D2QA 3BYYB 2KMMA 1WXVA 2PPHA 3MHSD 3U52E 2GBRA 3QQ8B 3DVGY 2LEKA 1WZ0A 4W9CA 1BT0A 2AL3A 2DX5B 3B0AA 2PIAA 5T8IA 3R7RA 3X0WA 3P1MA 1XCQL 4EZKA 3WAMA 2O6VB 3VRAB 2EKIA 3EA6A 4ANWA 1RWSA 5TSSA 1WGDA 1YJJA 1JWSD 3KQ4A 3KWLA 3Q8EA 1IUEA 3ML8A 2D11A 5JXVA 1WGHA 1V8CA 5TR5A 4DXGA 1Y8RC 1WXSA 1NENB 4II2B 1IPGA 1L2NA 2C7MB 1MVKA 2WX0A 2L8JA 3ZRFA 3ZLZA 5L83A 2N9XA 4A9AA 3Q3NC 3UQAA 4RM9A 1WH3A 1EM7A 3ZJVA 4IM2A 3RNGC 2BQQA 4IUMB 3R2IA 2KFKB 5DPWA 3PPAA 2CU3A 1SJED 2WXOA 1C4PA 3AE5B 1MPEA 4HVBA 3V61A 2LRWA 2LVQA 3JYUA 1LQBA 1WSPA 1NI2A 4E71A 2PJHA 2N9KA 1KTKA 2PVGC 4WAFA 1SJHD 1E8YA 3HK0A 2CHWA 2FUG1 4DXFA 1GC6A 4TQ0A 3ALBA 1ZDVA 1JQ4A 1WGYA 3RNCC 2NPTB 1QOGA 2KTRB 1FPYA 1ZXIA 2BYEA 2N1WA 1QILA 2Q5WD 2C5LC 4ZDVA 3RMKC 1XQQA 5G2NA 2MP2A 2BS3B 2KQ7A 1D3ZA 3ZGZA 3DHIC 3IXSA 4JGHB 1D4BA 1LXDA 1XXGA 3BIID 3GOEA 4K3CA 3KWVA 4NAWA 3V6EB 1XLPA 3LYYA 2BPSA 2BB5A 1E0ZA 3L13A 1V1PA 2O6VD 4N6EB 4ACFA 4OHJA 3KYDD 3NOBA 2INCC 2OJRA 3E56A 2J0MA 1WX8A 3N9YC 1XLOA 4ICUA 1GB1A 4J3OD 1X1MA 2FCMA 1UH6A 2JZZA 1FO4A 4AOFA 4HCNB 4L2YA 5CHVC 1V5TA 2V3SA 2ON8A 4C56C 4WJPA 3R8BA 4DDGD 2KC1A 5HI1A 3DBLI 4GDKB 2D3CA 4XWTA 3QCAA 2ZW1A 1SEBD 3NVZA 3KLSX 4GLSC 4MGYE 2GMIC 1WYGA 4AQ7A 5DPRA 2ZPNA 3GZNB 1ZGUB 1D5XC 1UF0A 3KUDB 4EEWA 2R61A 3P2BA 3VUWA 2RPVA 5BYSA 2CHXA 3H9DA 2HE7A 3APFA 1FEHA 1L6UA 1AWDA 3A1QA 3RCZA 3RI7C 2J53A 1HTOA 3UI3A 1YIWA 2BVCA 2L00B 4JE3B 2K39A 3A9JA 4A3PA 3OAWA 4II3B 3MJ5A 1J8CA 3GB1A 4F8CB 2JPHA 4AJWA 1J7AA 3U8ZA 2PMVA 1J19A 4BFRA 2FAZA 4IG7B 1ENFA 3FILB 3UQBA 1N5WA 1YN4A 2WDTB 3BYTB 4WWOA 3P4PB 3KUZA 3H7SA 3AECB 4BBNF 4C4VB 2JT4B 3V60A 3U30A 3VRBB 1G6JA 2DYBA 2MX2A 5D6JB 2K6QA 1SF0A 3PGEA 5E6NA 3PRPB 4BKGA 1R4MI 4NAWB 3I9V1 3ZNHB 3ML9A 1P98A 1UNSA 1UBIA 4PS8A 1N62A 5IO9A 2MLBA 3Q3OC 1MG8A 4HPPA 1YD8U 1WE7A 3PTFC 5BYQA 2KN5A 2LRUA 1YMHE 4AWJA 1HEZE 2VZKD 2R2QA 1TIFA 4FHKA 3JSVB 3PZ8A 3QC8B 5D94A 1WX7A 4CO7A 1I4QA 3IBEA 3ZXRA 1TBEA 4IWQA 1N61A 3DOWA 1QKZA 4IC7B 1VLBA 1CK1A 4F1SA 4JL9A 5AZGA 1WX9A 1XO3A 4KZCA 1V49A 2IGDA 3Q69A 1RLFA 2WXFA 4LCDE 3PRMB 1WXAA 2HTME 3RNEC 2KMCA 1KM7A 2IO0B 2JYTA 1WWTA 3DQVA 3K9OB 1I4HA 1S3SG 2J0JA 4PK1A 4MH0E 1YN3A 4NQKE 3I57A 3ZJTA 1VDVA 3AV8A 3C8YA 3APCA 2IGHA 1OQYA 3MFGA 4BOSC 2Z0EB 2EMSA 4FHJA 4WJNA 4NNJB 3H6NA 4H2AA 3Q8FA 4WWNA 3TSSA 1OEYA 2ZW0A 3MP9A 1SB3C 5E6JA 2G1EA 3VDZA 1GJZA 3PHXB 1NEKB 4XGAB 2BWES 2NS5A 4HLEA 1TTNA 4W9HA 3VUXA 1YQ4B 2AL6A 2R2OA 3P4RB 1JMLA 1QZEA 4MM3A 1HE8A 3WALA 1WJNA 4LNKA 1ET9A 2IY1B 1NDDA 1QOBA 4B9KA 3ZDTA 2GBNA 3N30A 2WNMA 3DHGC 3SHQA 4JPSA 2N7JA 1V1PB 2N0SB 4OVVA 2NR2A 4REZA 3MC9A 1JWAD 4MJSB 2INNE 2LZ6A 2WLBA 2V4IB 5D3DA 5IKCM 2FIDA 1SE4A 2KD0A 1TZOA 4BBNC 3CMMB 4P6VF 3SDLC 4WWMA 5IN7A 2K6DB 1VZ6A 2PLPA 2NCNA 3GE8C 2K8BA 2V1YA 2SEBD 4XDDA 2MRPA 2N9LA
chains in the Genus database with same CATH topology
1PUTA 4YTPB 4YWGG 1E7PB 2RMMA 2WXIA 3VR8B 3IAM1 2BT6A 5FKAC 5HG2A 1GAQB 1HQRD 3AE9B 1VZ7A 3RPFC 4RF1A 3TEYA 4RH6A 4US9A 2BS2B 3NVWA 2JXTA 5BMHA 3BYYB 2KMMA 1FMAD 1SE2A 2K0PA 3U52E 3BK1A 2E3TA 1QLBB 5BMGA 2LEKA 1J7CA 4UDUC 3TEZA 1TJEA 2V3PA 2PIAA 4L1BA 4D2KA 5T8IA 4LTUA 5EE3A 3ABVB 3P1MA 1XCQL 2IPKD 3VRAB 2EKIA 1QT9A 3NVYA 3EA6A 1ZDXA 3LB8C 3ZYYX 1RWSA 2DLBA 3W2DA 2WDQB 5TSSA 1YJJA 1JWSD 1XF5L 4A90A 3ZJUA 3KQ4A 3KWLA 1QOAA 3Q8EA 1N60A 3RFZB 3Q8BA 1IUEA 2W82A 1SBBB 5JXVA 2XNAC 3BWUD 1V8CA 1EU4A 5C2TB 5D3IB 1L0XB 4DXGA 2AQ2B 1FXIA 3IAS1 2INPE 2GB1A 2KDMA 2LMCA 3B2GA 3FILA 1NENB 2I38A 2I2YA 1FM0D 3EUB2 2HDEA 1J7BA 2JQRB 4HRSA 3V05A 1MVKA 2MJDA 2MH7A 3J9CA 4XE0A 2WXGA 3NS1A 2QILA 3DWMA 5LNK1 1SIJA 3W1SA 3AE3B 4N58A 1L5PA 4A9AA 1FXAA 2V0GA 4Q2JA 4OZCA 1NVID 4USAA 2J42A 1ZPSA 2WXKA 3NVVA 1EM7A 2DYMA 4OW0A 1JWUD 3U4EG 3ZJVA 4CQNA 1FCCC 1YQ3B 2ICIA 1D5MC 4XDCA 3SEBA 3R2IA 1M4VA 1VZ8A 2JZPA 2CU3A 1SJED 1FNVA 2WXOA 1C4PA 4YXDB 3AE5B 2H89B 1MPEA 1ZOYB 1GOZA 1ZUD2 1AYFA 2LFIA 4WIPA 3WCQA 1UUPA 2M56B 2V3NA 2IJ0A 2B76B 4HJGE 3HVZA 1HZ6A 2PKOA 1K50A 1WSPA 5FK9C 1BXTA 1C76A 2KWDA 1TS2A 4B0MA 1F0ZA 2N9KA 3BVZA 1PGBA 1KFYB 1DGJA 2M0AA 1KTKA 4RGTA 2WXPA 2PVGC 1ZXHA 3IT4B 1ROEA 3B9JA 1E9MA 1N5XA 4WAFA 1SJHD 1NYRA 1T6BX 4NZLB 4C80A 4TMAB 1IGCA 2FUG1 4DXFA 4YSYB 2AQ1B 1KH0A 4TQ0A 1ZDVA 4RF0A 2D5GA 1JQ4A 1QOGA 1KLUD 1HZ5A 1ZXIA 1FRDA 1QILA 2Q5WD 1BMLC 2Y3AA 2SAKA 2XN9C 1BUIC 2K22A 3AE4B 2BS3B 3PO0A 3AEEB 5GXGB 4YSZB 1STEA 2JU6X 3HRDD 3NUHB 1JWBD 1FD6A 3AE7B 3ZGZA 2BTEA 3IXSA 1MHXA 1D4BA 1YNTE 3IT6B 3AEFB 1XXGA 3BIID 3HVDA 3KWVA 3TEXA 1XLPA 1DYQA 3LYYA 1LO5D 2M19A 3MC0B 2BB5A 1KLGD 4ARIA 2WXLA 1E0ZA 1V1PA 4N6EB 4N59A 4KGRA 4OHJA 3SR6A 5BMIA 4C7ZA 1MHHE 3E56A 2WXMA 5H8YE 3N9YC 3PZ7A 1XLOA 2WDRB 5MPOA 4KGSA 1GB1A 1P7FA 1MI0A 4J3OD 1FO4A 4HKQA 1TY2A 4O1NA 4B0EA 2Y5CA 2LHEA 4ARCA 2KQ4X 4L2YA 2WP9B 2L1AA 2VZKB 1Q10A 2ON8A 1XEEA 4C56C 1OQQA 1L4DB 3R8BA 3AM9A 4TQ1A 1QQRA 1T5XD 1F77A 1ZP0B 5HI1A 1A70A 4RFBA 4GDKB 4XWTA 4YSXB 1F2RI 2E6XA 2ZW1A 1SEBD 3NVZA 5EE1A 3KLSX 4GDLB 4GLSC 1FFUA 1JW9D 2NTTA 1PYWD 1WYGA 1AW7A 2DWQA 2WDVB 1CJEA 1EWCA 4RNAA 4AQ7A 4ZHOA 3GS2A 1C77A 2IGGA 4ZOHC 3AN1A 5BYRA 3P4QB 4MM3B 1FRRA 3P63A 4DQOC 3TUOA 1YN5A 1B9RA 3DWGC 2Y5PA 1D5XC 2PTLA 2AX5A 1E6EB 2QMTA 2WXRA 1EWYC 2R61A 2RPVA 1JALA 2WU2B 1WGKA 5BYSA 2WXHA 3W5UB 3TEWA 3Q8CA 2BB6A 1TKEA 3AEDB 4R3DA 1FEHA 1SXTA 1XLQA 1I4PA 1L6UA 2KAJA 2W3RA 2J52A 1AWDA 5H92C 2YEPF 3NZ3A 3U7ZA 2J53A 4YT0B 2DYOA 3UI3A 1FNUA 2L32A 4JE3B 4L23A 1DOIA 3BVMA 3V3XA 2WXJA 4ZHPA 1XLNA 1Y56A 3CIRB 3MJ5A 3GB1A 4HROA 1TKYA 2BBCA 1J7AA 4A55A 1D5ZC 1SE3A 2PMVA 3ETRA 1WRIA 1GB4A 1ACCA 3T3NA 1ENFA 1N63A 3FILB 1N5WA 1YN4A 1ZE3D 1CZPA 3AE8B 3BYTB 1TS5A 2NMQA 4ZRQA 3URYA 2QJLA 3W5VB 3P4PB 2LHDA 4YTMB 1V1OA 4WH4A 3AECB 4ITKA 4NAMA 2WXQA 3AE1B 1I4GA 1OFFA 2OEDA 1B1ZA 3VRBB 1SF0A 1CQVA 2JSVX 4NAWB 4JWSC 3I9V1 2W54A 1C4CA 1NI3A 2FBWB 2PW9A 2X38A 1TS4A 3AH7A 1IBXA 2YEPB 1DOYA 1UNSA 1N62A 1VR9A 4ZRPA 4RGOS 1FIQA 4MACA 1TKGA 3P42A 2RDHA 4HKZE 5BYQA 5C3JB 2PVOD 2Z8LA 3VR9B 1ET6A 2W55A 4OZBA 2CJNA 1YMHE 3FAHA 1PGAA 1JRPA 2W3SA 1HEZE 2VZKD 3T3OA 1JROA 1UGJA 3AEAB 3PZ8A 3SFDB 3R2TA 2ONQA 1UWMA 4FXCA 1C78A 3NRZA 4RGMA 2QEJC 1FCLA 1I4QA 2BYTA 4JX1C 1N61A 3Q8AA 1HA5A 5AUIA 1JCKB 2TSSA 1RFKA 3BK2A 1QKZA 3AE6B 4EE2A 1IBXB 1R7SA 1VLBA 1CK1A 5G5GA 2QSDA 1L0VB 2AQ3B 1XO3A 1EU3A 1L0YB 2J4XA 2IGDA 3AEBB 3Q69A 2JX5A 2WXFA 3AEGB 5D7GA 1NYQA 1DOXA 2HTME 1V97A 1K51A 5FR3A 5EE0A 1OQRA 2DBYA 2JYTA 1PDXA 2K9XA 2WS3B 3GP7A 2FE8A 3MHZA 1WWTA 2LGIA 3BVGA 3LXFA 2JWUA 1FFVA 1I4HA 2QIEB 4US8A 4LK0M 1SSNA 4LLGM 3ZQ4A 2CJOA 1I7HA 1YN3A 2KACA 1HXYD 5G5HA 2L83A 4KKIA 3I57A 3ZJTA 1VDVA 1VJKA 3AV8A 3FC4A 4IDIA 1VRAB 1AN8A 3HUIA 2G9HD 3C8YA 4XWWA 4A8XC 3OWEB 4JWUC 2IGHA 4WURA 3BZDB 3E9SA 1WXQA 3MFGA 4IKGA 1XCTL 1K52A 4RCOA 1QF6A 4H2AA 3P4SB 3Q8FA 3TSSA 1ESFA 1C9FA 1F2RC 4NJCA 2NTSA 1IGDA 2ZW0A 4C7YA 2ACZB 3MP9A 3AMZA 1E10A 2MJEA 2MJ3A 1SB3C 5E6JA 4MT5A 2RDGA 2G1EA 1T3QA 2BS4B 1KF6B 1L4ZB 2JYEA 1NEKB 1PFDA 3H8HA 5AUKA 1L6VA 1QOFA 3AB5A 2GI9A 2K3UA 5EE9A 1YQ4B 4P16A 3P4RB 4YTNB 1I4RA 1JMLA 1TYGB 3EGRA 2GRIA 5I4DA 4OZAA 4AS1A 1ET9A 4MH8A 2WXNA 4A6QA 1QOBA 4KKJA 1D6EC 4RGNA 1GPXA 4OVZA 2BW2A 5HHDG 3VQIA 4ZYSA 2LJIA 2WNMA 1PGXA 4JPSA 4KGTA 2N7JA 4M0WA 1V1PB 1P7EA 3AE2B 2N0SB 4REZA 1RM6C 1YJIA 4TSSA 4WQMA 2WU5B 1JWAD 1RYJA 2INNE 3L4PA 2WLBA 2V4IB 5D3DA 2WQYB 2KN4A 1I4XA 5HFYA 3U2SC 1SE4A 2MEKA 1TZOA 3W9CB 3SFEB 3O13A 4P6VF 2EELA 1C79A 1C4AA 4WWMA 3CWIA 1JWMD 4PT5A 2K5PA 2OHFA 1FNWA 1VZ6A 2PLPA 3B2FA 1TY0A 2L52A 1TS3A 4IOIE 4HEA1 1KRHA 2SEBD 4KX6B 1UWXA 2IDYA 2LUMA 4XDDA 2H88B 1K53A 2N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K51 A;  1ZXH A;  2LGI A;  2RMM A;  2JWU A;  2J52 A;  1IGC A;  5HG2 A;  1KH0 A;  2J53 A;  3UI3 A;  3V3X A;  2KAC A;  1HZ5 A;  2JXT A;  5BMH A;  3GB1 A;  2K0P A;  5BMG A;  2IGH A;  1GB4 A;  4IKG A;  1XCT L;  2JU6 X;  3FIL B;  1K52 A;  1FD6 A;  2NMQ A;  4D2K A;  1C9F A;  1F2R C;  1MHX A;  1D4B A;  1XCQ L;  2LHD A;  1YNT E;  1IGD A;  2ZW0 A;  4WH4 A;  3MP9 A;  2OED A;  1XF5 L;  4KGR A;  2JSV X;  5BMI A;  1MHH E;  2PW9 A;  5JXV A;  2GI9 A;  1IBX A;  1JML A;  4KGS A;  1GB1 A;  1P7F A;  1MI0 A;  2GB1 A;  2KDM A;  3FIL A;  2LHE A;  4MAC A;  2I2Y A;  2I38 A;  4OZA A;  2KQ4 X;  4HKZ E;  1Q10 A;  4OZB A;  2ON8 A;  1MVK A;  1YMH E;  5HHD G;  1PGA A;  1HEZ E;  1PGX A;  5HI1 A;  4KGT A;  2N7J A;  1P7E A;  1F2R I;  2ZW1 A;  4GLS C;  4OZC A;  2ONQ A;  1EM7 A;  2KN4 A;  5HFY A;  2IGG A;  1FCL A;  1FCC C;  2JZP A;  1MPE A;  1QKZ A;  2EEL A;  1IBX B;  2QSD A;  4HJG E;  2PLP A;  1HZ6 A;  1K50 A;  2PTL A;  2IGD A;  2KWD A;  4IOI E;  2QMT A;  2N9K A;  1UWX A;  2LUM A;  1PGB A;  1K53 A;  2N9L A;  2RPV A; 
#chains in the Genus database with same CATH topology
 1V6E A;  1PUT A;  4CYE A;  4MSM B;  2RMM A;  2KTR A;  3DBH B;  2HTH A;  4EFO A;  3NVW A;  1SE2 A;  2E3T A;  2RGF A;  3PLV A;  5BMG A;  1J7C A;  4UDU C;  3R7Q A;  2K1F A;  1TJE A;  2LXA A;  2KFJ A;  4LTU A;  1QT9 A;  3ZYY X;  3W2D A;  3UIP B;  3AU5 A;  3RFZ B;  1ISN A;  4EZL A;  4MGI E;  1YJ1 A;  5C2T B;  5D3I B;  2K25 A;  4MGZ E;  1FXI A;  2INP E;  3ZO5 B;  2I2Y A;  4GGQ A;  1FM0 D;  1J7B A;  2L05 A;  5JH5 C;  4XE0 A;  4MSQ B;  3X23 A;  1FXA A;  4NY0 A;  1ZPS A;  2UYZ B;  2WXK A;  4AJY B;  4HXD A;  2DYM A;  3BY4 B;  1JWU D;  2BYF A;  4M0W B;  4CQN A;  1D5M C;  2M0X A;  1GUA B;  1WXM A;  4EOY A;  2N9P C;  2LFI A;  1GOZ A;  2V3N A;  3RZW C;  2IJ0 A;  2Y5B B;  1HZ6 A;  4DHZ E;  1F0Z A;  1TS2 A;  2LJ5 A;  1KFY B;  4P1B C;  4W9D A;  3I63 C;  3I5J C;  4TMA B;  1V86 A;  2AQ1 B;  1KH0 A;  1WMH B;  2KHW B;  4AP4 C;  2X8X X;  2KVZ A;  1KLU D;  1M94 A;  3PS6 A;  2BF8 B;  3HHM A;  2SAK A;  2XN9 C;  3TMP B;  3PO0 A;  1Q5W B;  4GB9 A;  5GXG B;  2RSU A;  1T0Q C;  2FCN A;  4GDK A;  3ZDM C;  1MHX A;  1P9D U;  3AEF B;  3HVD A;  2G3Q B;  1LO5 D;  1HTQ A;  2WXL A;  4B6W A;  2AEH A;  4FLH A;  3NJT A;  4DXA B;  3ZTD A;  5H8Y E;  2L76 A;  2L3Z A;  4KGS A;  4WJQ A;  4HKQ A;  1TY2 A;  4O1N A;  4B0E A;  2J0K A;  2WP9 B;  4HK2 A;  2VZK B;  3TL5 A;  1Q10 A;  1OQQ A;  3DVN U;  3EHV A;  1L4D B;  4TQ1 A;  3VH4 B;  1F77 A;  3V6C B;  3VVW B;  2K8H A;  2DAJ A;  3D32 A;  5EE1 A;  2NTT A;  4HWI B;  2WDV B;  1CJE A;  1EWC A;  3Q3F A;  2ZZP B;  3MTN B;  4IM3 A;  3GS2 A;  2IGG A;  4ZOH C;  4W9G A;  5BYR A;  4MM3 B;  4GN1 A;  1FRR A;  3TUO A;  2BKR B;  2OOB B;  3TBL D;  2KFK A;  2PTL A;  2AX5 A;  2WXR A;  5LXI B;  1EWY C;  1JAL A;  1WGK A;  2GOW A;  3DDC B;  2JXX A;  1JRU A;  4R3D A;  1SXT A;  1I4P A;  2W3R A;  1P3Q U;  2DYO A;  4ZYN A;  3Q3M C;  4XX5 A;  3W1S C;  3S2A A;  1XLN A;  1Y56 A;  2VRR B;  4DBG A;  3OLM D;  3IFW B;  5LLI A;  3WA0 A;  1D5Z C;  5EDS A;  3ETR A;  1GB4 A;  1ACC A;  3T3N A;  2D07 B;  2Z59 B;  1I35 A;  1ZE3 D;  4IWP A;  1KOT A;  4ZRQ A;  2JY6 A;  2K8C A;  4ITK A;  4HCP B;  1B1Z A;  3QAR A;  3HM6 X;  3H1U A;  4HPM B;  1TS4 A;  3AUL A;  3AH7 A;  2JUO A;  2N7E A;  2ZCB A;  3CF6 E;  1DOY A;  3CSF A;  4S17 A;  2IBI B;  1VR9 A;  4ZRP A;  2PEA A;  1FIQ A;  3UF8 A;  1TKG A;  4HKZ E;  5C3J B;  2PVO D;  2Z8L A;  4OZB A;  3M62 B;  3ZNZ B;  2W3S A;  5JHA A;  4KZ0 A;  4PS7 A;  2DZI A;  1JRO A;  3SFD B;  2KKC A;  5IP4 D;  4BKS A;  1C78 A;  2ZVN A;  4M01 A;  1PQS A;  1FCL A;  4E3C A;  1F9J A;  4JX1 C;  3ZUN A;  3M3J A;  2KXJ A;  3DBR I;  3RT3 B;  3AE6 B;  1RAX A;  4RMA A;  2FNJ B;  1R7S A;  3VUY A;  2AQ3 B;  1EU3 A;  3AEB B;  2JX5 A;  2KLC A;  2WWZ A;  3N32 A;  1MJD A;  3KH0 A;  1K51 A;  1OQR A;  2WS3 B;  1PDX A;  2RPQ A;  2LGI A;  2JWU A;  4ZRJ A;  2QIE B;  4US8 A;  2QCZ A;  2MA9 B;  4LLG M;  3VFK A;  1HXY D;  2L83 A;  4IDI A;  3VXW A;  1VRA B;  1AN8 A;  2G9H D;  3DHH C;  3PV1 A;  2G45 B;  1SIF A;  3BZD B;  1XCT L;  4RCO A;  1QF6 A;  3P4S B;  1C9F A;  1C3T A;  1IGD A;  4KIK B;  1Q0W B;  2CHZ A;  4M02 A;  4NJ7 A;  2UU7 A;  2MBE A;  3L16 A;  5DPS A;  1L4Z B;  2JYE A;  2BWF A;  2CU1 A;  2K3U A;  2D10 A;  5EE9 A;  4LDT D;  1T0S C;  2GBM A;  3A4S C;  3ZIM A;  5I4D A;  4OZA A;  4MH8 A;  4LDT B;  2PE9 A;  2N7D A;  4K7S A;  2BW2 A;  5HHD G;  2KX0 A;  4ZYS A;  4KSK C;  3WAO A;  1PGX A;  4M0W A;  3AE2 B;  1RM6 C;  1YJI A;  2WU5 B;  3KUC B;  2BYV E;  4F7Z A;  2KN4 A;  1I4X A;  5HFY A;  3U2S C;  3PHW B;  1C1Y B;  3PT2 B;  2MEK A;  3DVG X;  2C7N B;  1IYF A;  1C79 A;  1RRB A;  3T8M A;  2OHF A;  3VTW A;  1FNW A;  4HEA 1;  1KRH A;  3QIJ A;  1E8W A;  2LUM A;  2H88 B;  4MEL A;  4OVU A;  2M8S A;  5E6O A;  5DPT A;  3IAM 1;  5FKA C;  2CR5 A;  3AE9 B;  1VZ7 A;  2RR9 A;  1F52 A;  2BS2 B;  4US9 A;  1A5R A;  2K0P A;  2LUE A;  1QLB B;  3TEZ A;  4MGK E;  3SU8 X;  1U4A A;  4L1B A;  3NY5 A;  3RUL A;  3ABV B;  2KJH B;  3N1X C;  1KJT A;  3Q6B A;  2Z0D B;  3PZD A;  3LB8 C;  3MJW A;  2FCS A;  4G11 A;  1XF5 L;  4A90 A;  3HM3 A;  1GC7 A;  2IYD B;  2W82 A;  1SBB B;  3K9P B;  2KDF B;  1WFY A;  4ANU A;  2XNA C;  3FKY A;  4G0N B;  3BWU D;  1EU4 A;  1GG3 A;  5E6P A;  1L0X B;  2AQ2 B;  4EUT A;  5LXH A;  2MBH A;  2GB1 A;  2KDM A;  3PRE A;  3A4R A;  2I38 A;  2KAN A;  2HDE A;  3ZXV A;  2LD9 A;  2KO3 A;  2ZJD A;  4KV2 A;  2JQR B;  4HRS A;  3V05 A;  3AI5 A;  3J9C A;  2G4D B;  2N4F A;  2WXG A;  2IO1 B;  4DHZ B;  5LNK 1;  1WM2 A;  1SIJ A;  3W1S A;  3PSE B;  2JZ3 B;  2V0G A;  3RN9 C;  2IND C;  2I1K A;  1R4N I;  1NVI D;  4LJO B;  4N9F 4;  4USA A;  2WGS A;  2EKE C;  1WE6 A;  1YQ3 B;  2ICI A;  3SEB A;  1VZ8 A;  3PRZ A;  4FJZ A;  2H89 B;  4PYZ A;  1ZOY B;  3QHT A;  3WCQ A;  2DAF A;  2O2V A;  1E8X A;  3EEC A;  2PKO A;  1K50 A;  5FK9 C;  2W9N A;  3BVZ A;  2M0A A;  4RGT A;  2KOX A;  2WXP A;  2VH2 A;  3IT4 B;  2MBO A;  1TZ1 A;  3B9J A;  1IGC A;  4YSY B;  2IO2 B;  2D3A A;  3L10 B;  1FRD A;  5AZF A;  1BML C;  2Y3A A;  2OJW A;  4E74 A;  2LI5 A;  5AZH A;  2EMT A;  3AEE B;  1STE A;  3HRD D;  3NUH B;  1JWB D;  2KDI A;  1FD6 A;  3AE7 B;  2BTE A;  3RUI B;  4GSW A;  1YNT E;  3TEX A;  4GU2 A;  3WAN A;  3A9K A;  2ZNV C;  4ARI A;  1H8C A;  1WY8 A;  4N59 A;  3QA8 A;  4LNN A;  1XD3 B;  5BMI A;  2N9E B;  4P1C C;  3VHT C;  1MHH E;  2QDF A;  2WXM A;  4M8M A;  1VCB A;  3PZ7 A;  1WGR A;  5MPO A;  4DDI D;  3DBS A;  3W1Y A;  3ZKJ C;  1WR1 A;  1UGM A;  4K1R B;  2Y5C A;  2LHE A;  4S0R A;  4ARC A;  2KQ4 X;  2LVO A;  1Z2M A;  2L1A A;  2QHO A;  1QQR A;  1K8R B;  3QK0 A;  1ZP0 B;  4RFB A;  4GXB A;  4HJK A;  3B08 A;  2E6X A;  4GMV A;  4GDL B;  1PYW D;  4ZHO A;  4M8N A;  2LXC A;  5C23 A;  1C77 A;  3AN1 A;  3P4Q B;  1Z5S B;  4DQO C;  4ASW C;  2HJ8 A;  2KDB A;  4BKS D;  2NBU A;  1YN5 A;  2JF5 A;  1B9R A;  3DWG C;  2Y5P A;  2M17 A;  4ZRI A;  3OJ3 A;  2WU2 B;  3TEW A;  2BB6 A;  1TKE A;  3I3T B;  1XLQ A;  2QC8 A;  2J52 A;  5H92 C;  3U7Z A;  2GLS A;  1FNU A;  3UIN B;  5AEK B;  1DOI A;  3T9L A;  2WXJ A;  2KJR A;  4HDQ A;  2REX A;  1AAR A;  2ZVO A;  4BKT A;  2B3A A;  4KVG B;  1WRD B;  1WRI A;  4HPL B;  3TIX A;  4W9F A;  3PVL A;  1N63 A;  3CST A;  4I6P A;  3BIN A;  3URY A;  2O2V B;  2QJL A;  4W9K A;  2LHD A;  3W5V B;  4NAM A;  3AE1 B;  1OFF A;  2OED A;  2DZK A;  1F1H A;  4IM0 A;  1CQV A;  3RNF C;  4JWS C;  1NI3 A;  2LGS A;  2FBW B;  2X38 A;  1IBX A;  4G50 A;  2YEP B;  5JZE B;  1H4R A;  4RGO S;  4MAC A;  3P42 A;  2FIF A;  2KMA A;  2RDH A;  2MHJ A;  1ET6 A;  2KDE B;  3RNA C;  1WR6 E;  2A5U A;  2CJN A;  1YOV B;  1PGA A;  5IAA C;  1JRP A;  5GMV A;  4MEM A;  2BGF A;  3RD2 A;  3L0W B;  3SD5 A;  4BZA A;  2KQS A;  1R4M B;  3ZTC A;  3T3O A;  1UGJ A;  3AEA B;  3A33 B;  2ONQ A;  1UWM A;  4FXC A;  5D2M B;  3NRZ A;  3N3K B;  3Q8A A;  4FN2 A;  4LNI A;  3JW0 X;  5G5G A;  1L0V B;  2J4X A;  4DK5 A;  1NYQ A;  4ZRK A;  1DOX A;  5FR3 A;  2PE6 B;  4W9I A;  3GP7 A;  1OGW A;  3MHZ A;  2KNB A;  3BVG A;  3LXF A;  1E7U A;  1E7V A;  3VAW A;  2DHZ A;  2ZNV B;  2CJO A;  3ZQ4 A;  1I7H A;  4KKI A;  2XK5 B;  3DVN V;  4M00 A;  3HUI A;  2LGX A;  4XWW A;  1OEY J;  4A8X C;  3EFU A;  4JWU C;  4BAX A;  2BKF A;  5G55 A;  2FCQ A;  3NHE B;  1J0G A;  1V5O A;  3GZN I;  2KLG A;  3Q3J A;  1Q1O A;  1F2R C;  4NJC A;  4BVU C;  2NTS A;  2ACZ B;  3AMZ A;  1WM3 A;  2MJ3 A;  2MJE A;  2RDB C;  1KF6 B;  1KLV A;  3DCG A;  4EKU A;  4FAD A;  1I42 A;  2L7R A;  4FBJ B;  1E90 A;  2JVC A;  1PFD A;  2ZCC A;  4XC2 A;  2D3G A;  1L6V A;  1QOF A;  2GI9 A;  1WJ4 A;  4DHJ D;  3C19 A;  4YTN B;  1I4R A;  1TYG B;  3EGR A;  2GRI A;  2NVU I;  2KVR A;  2NBW B;  2WXN A;  1SGH A;  4KKJ A;  4JLC A;  3QJZ A;  2LGY A;  4CHK A;  2FUH B;  4HDO A;  3VQI A;  2LJI A;  3DPD A;  4PS3 A;  1S1Q B;  2MCN B;  4KGT A;  3OJ4 B;  2NBV B;  2KYW A;  4WQM A;  4TSS A;  3ZVV A;  3M95 A;  3O13 A;  4XZ4 A;  2MQJ A;  2EEL A;  3C0R B;  3CWI A;  4QAY A;  2K5P A;  1SE9 A;  3ENE A;  3B2F A;  1TS3 A;  4IOI E;  4KX6 B;  3Q2A C;  2D3B A;  2IDY A;  3A9K B;  1K53 A;  3U7D A;  2JWZ A;  5JHB A;  5BO4 B;  3RZF A;  4YTP B;  4YWG G;  1E7P B;  4DWF A;  4IW0 A;  3VR8 B;  4I6L B;  2BT6 A;  1GAQ B;  1HQR D;  2LGD A;  3DBH I;  3RPF C;  3TEY A;  3KVF B;  3O65 B;  2LAS A;  4RH6 A;  2JXT A;  5BMH A;  5CX3 A;  1FMA D;  3BK1 A;  1EF5 A;  2V3P A;  3WAP A;  4D2K A;  3L17 A;  3R66 C;  3IVF A;  5EE3 A;  1YX5 B;  2IPK D;  3NVY A;  1ZDX A;  2DLB A;  2WDQ B;  1MG4 A;  2M4N A;  3ZJU A;  1QOA A;  4NJ6 A;  2KK8 A;  1N60 A;  4KIK A;  3Q8B A;  3A9J B;  1V9J A;  4WWP A;  4FA6 A;  4WQO B;  3IAS 1;  2LMC A;  3FIL A;  3B2G A;  3KW5 B;  4K7W A;  3EUB 2;  4LJP B;  2KZR A;  4C4V A;  4K81 A;  1EUV B;  2MH7 A;  2MJD A;  1ZKH A;  4FJV B;  4K7U A;  2KWU B;  4TV3 A;  3NS1 A;  4A20 A;  2QIL A;  3DWM A;  1WF9 A;  3AE3 B;  4N58 A;  1L5P A;  1UZX B;  1GNU A;  4Q2J A;  4OZC A;  5J2R A;  2J42 A;  3NVV A;  4OW0 A;  3U4E G;  1FCC C;  4XDC A;  1M4V A;  2JZP A;  1FNV A;  4YXD B;  1ZUD 2;  4WIP A;  1AYF A;  1UUP A;  2M56 B;  2XBB C;  2B76 B;  4HJG E;  4KSL C;  3HVZ A;  1BXT A;  4I6N B;  4LNO A;  1C76 A;  2KWD A;  4B0M A;  1PGB A;  1DGJ A;  1LGR A;  1ZXH A;  1ROE A;  5L95 C;  2G4S A;  1E9M A;  1N5X A;  1NYR A;  1T6B X;  4NZL B;  3V62 A;  4C80 A;  4ANV A;  5FR6 A;  3UIO B;  1MFW A;  4RF0 A;  2D5G A;  3L08 A;  4PYU A;  4XYC A;  1HZ5 A;  1E5W A;  2L0F A;  1V80 A;  3N20 C;  1BUI C;  2MBQ A;  2K22 A;  3AE4 B;  2A4Z A;  4YSZ B;  4GDL A;  2KX3 A;  1L7Y A;  2JU6 X;  1LM8 B;  4KDL B;  2KT7 A;  2C60 A;  4W9E A;  4WJO A;  3IT6 B;  3ZNI D;  3PLU A;  1DYQ A;  2C7H A;  3MC0 B;  2M19 A;  1KLG D;  3WIM A;  4KGR A;  3SR6 A;  1UBQ A;  4C7Z A;  2CKH B;  3QAQ A;  2MSE D;  1WMH A;  3QX1 A;  4G3X B;  2WDR B;  4ANX A;  1P7F A;  1MI0 A;  3TJP A;  3JVZ X;  3N1Y C;  2XEW A;  4W9L A;  3OG5 A;  1UEL A;  1XEE A;  2CS4 A;  2DZM A;  3AM9 A;  1T5X D;  4MDK E;  1A70 A;  3L54 A;  3VTV A;  4P7I A;  4YSX B;  1F2R I;  2XK5 A;  1FFU A;  1JW9 D;  2IY0 B;  2DWQ A;  1AW7 A;  4RNA A;  3VTU A;  4A3O A;  3APD A;  2JRH A;  3P63 A;  1NBF C;  3ZRC A;  2RD0 A;  4YL8 A;  3ZNG C;  5IA7 A;  2ZEQ A;  2KWV B;  3LJ3 A;  4X57 B;  1E6E B;  3VH3 B;  2QMT A;  3HIZ A;  2JRI B;  2VH1 A;  2WXH A;  3W5U B;  3Q8C A;  2O6V A;  1P1A A;  3AED B;  2KAJ A;  4GIV A;  3H7P A;  2YEP F;  3NZ3 A;  5CHW A;  4YT0 B;  2DZJ A;  1TGZ B;  2L32 A;  3M63 B;  4L23 A;  3BVM A;  1V2Y A;  3V3X A;  4ZHP A;  3CIR B;  4JQW C;  4HRO A;  5CTR C;  4KDI C;  1TKY A;  2BBC A;  1OTR B;  4A55 A;  1SE3 A;  2UWQ A;  1CZP A;  3AE8 B;  1TS5 A;  2NMQ A;  3DBR B;  2MP2 B;  4YTM B;  1V1O A;  4WH4 A;  2N1V A;  2WXQ A;  1I4G A;  5C1Z A;  1TT5 B;  4RM8 A;  3ECI A;  3R3M A;  4FUL A;  5KHQ A;  3LDZ E;  2JSV X;  2W54 A;  1C4C A;  2PW9 A;  5KHO A;  3DBL B;  2MW5 A;  5IOI A;  3Q14 C;  2DEN B;  3ZW3 A;  3H7P B;  1XT9 B;  3IG3 A;  1CMX B;  4ICV A;  3KYC D;  3VR9 B;  2W55 A;  3FAH A;  1P0R A;  5J18 A;  4MJS A;  2ASQ A;  2KTF A;  4K3B A;  1WYW B;  2GBK A;  4BOZ B;  1UD7 A;  3R2T A;  3N1Z C;  4RGM A;  2QEJ C;  3QWZ B;  2BYT A;  1VD2 A;  1HA5 A;  5AUI A;  1JCK B;  2TSS A;  1RFK A;  3BK2 A;  2WX1 A;  1WZ3 A;  4EE2 A;  1EO6 A;  2DNF A;  1IBX B;  2QSD A;  1L0Y B;  3IHP C;  2V9H A;  4TKN A;  3AEG B;  2I1J A;  5D7G A;  1RFA A;  4EZJ A;  1V97 A;  3MC8 A;  2LWP A;  5EE0 A;  2DBY A;  2K9X A;  4GOC A;  2FE8 A;  4NPN A;  3ONS A;  1FFV A;  3AXC A;  2AWT A;  2NPT A;  4LK0 M;  1SSN A;  2KAC A;  5G5H A;  2GBJ A;  1VJK A;  3FC4 A;  4LNF A;  2MBB B;  1IP9 A;  3OWE B;  2ZPY A;  2LVP A;  4WUR A;  4URK A;  3E9S A;  1WXQ A;  2KWC A;  1LFD A;  4IKG A;  4W9J A;  1K52 A;  2C9W B;  1ESF A;  5CHF A;  4C7Y A;  1E10 A;  4MT5 A;  2J7Q B;  2RDG A;  1T3Q A;  2BS4 B;  1V81 A;  1R4N B;  3RYT A;  2M1M A;  2HD5 B;  1T0Y A;  3NZU A;  5DCN A;  2AYO B;  3H8H A;  1E8Z A;  3NG0 A;  5AUK A;  2MWS B;  4FJY A;  3AB5 A;  4P16 A;  4JIO U;  1WGG A;  4AS1 A;  3UGB B;  4C00 A;  1WI0 A;  2KC2 A;  3GE3 C;  4A6Q A;  1D6E C;  4RGN A;  2V4L A;  1GPX A;  3RNB C;  4OVZ A;  2IZV B;  3AU4 A;  2KJ6 A;  4B95 A;  2YVC A;  1P7E A;  1WJ6 A;  2YLM A;  2WYQ A;  1YX6 B;  1T0R C;  1RYJ A;  2HJ1 A;  3L4P A;  5HKH A;  2WQY B;  1EF1 A;  4IWO A;  3EC8 A;  1ZW7 A;  3W9C B;  3SFE B;  1WJU A;  2IO3 B;  1C4A A;  1FXT B;  4AUQ C;  1JWM D;  4PT5 A;  1N6Z A;  5J17 A;  4NQL B;  1TY0 A;  1WIA A;  4DHJ B;  2L52 A;  1UWX A;  4TUU A;  4WAA A;  3EFC A;  2WXI A;  3TCA A;  3A1Q B;  3NZS A;  4J6I A;  3B1L X;  5HG2 A;  2WHI A;  3NS8 A;  2L0T A;  1YQB A;  4RF1 A;  3JSV A;  2D2Q A;  3BYY B;  2KMM A;  1WXV A;  2PPH A;  3MHS D;  3U52 E;  2GBR A;  3QQ8 B;  3DVG Y;  2LEK A;  1WZ0 A;  4W9C A;  1BT0 A;  2AL3 A;  2DX5 B;  3B0A A;  2PIA A;  5T8I A;  3R7R A;  3X0W A;  3P1M A;  1XCQ L;  4EZK A;  3WAM A;  2O6V B;  3VRA B;  2EKI A;  3EA6 A;  4ANW A;  1RWS A;  5TSS A;  1WGD A;  1YJJ A;  1JWS D;  3KQ4 A;  3KWL A;  3Q8E A;  1IUE A;  3ML8 A;  2D11 A;  5JXV A;  1WGH A;  1V8C A;  5TR5 A;  4DXG A;  1Y8R C;  1WXS A;  1NEN B;  4II2 B;  1IPG A;  1L2N A;  2C7M B;  1MVK A;  2WX0 A;  2L8J A;  3ZRF A;  3ZLZ A;  5L83 A;  2N9X A;  4A9A A;  3Q3N C;  3UQA A;  4RM9 A;  1WH3 A;  1EM7 A;  3ZJV A;  4IM2 A;  3RNG C;  2BQQ A;  4IUM B;  3R2I A;  2KFK B;  5DPW A;  3PPA A;  2CU3 A;  1SJE D;  2WXO A;  1C4P A;  3AE5 B;  1MPE A;  4HVB A;  3V61 A;  2LRW A;  2LVQ A;  3JYU A;  1LQB A;  1WSP A;  1NI2 A;  4E71 A;  2PJH A;  2N9K A;  1KTK A;  2PVG C;  4WAF A;  1SJH D;  1E8Y A;  3HK0 A;  2CHW A;  2FUG 1;  4DXF A;  1GC6 A;  4TQ0 A;  3ALB A;  1ZDV A;  1JQ4 A;  1WGY A;  3RNC C;  2NPT B;  1QOG A;  2KTR B;  1FPY A;  1ZXI A;  2BYE A;  2N1W A;  1QIL A;  2Q5W D;  2C5L C;  4ZDV A;  3RMK C;  1XQQ A;  5G2N A;  2MP2 A;  2BS3 B;  2KQ7 A;  1D3Z A;  3ZGZ A;  3DHI C;  3IXS A;  4JGH B;  1D4B A;  1LXD A;  1XXG A;  3BII D;  3GOE A;  4K3C A;  3KWV A;  4NAW A;  3V6E B;  1XLP A;  3LYY A;  2BPS A;  2BB5 A;  1E0Z A;  3L13 A;  1V1P A;  2O6V D;  4N6E B;  4ACF A;  4OHJ A;  3KYD D;  3NOB A;  2INC C;  2OJR A;  3E56 A;  2J0M A;  1WX8 A;  3N9Y C;  1XLO A;  4ICU A;  1GB1 A;  4J3O D;  1X1M A;  2FCM A;  1UH6 A;  2JZZ A;  1FO4 A;  4AOF A;  4HCN B;  4L2Y A;  5CHV C;  1V5T A;  2V3S A;  2ON8 A;  4C56 C;  4WJP A;  3R8B A;  4DDG D;  2KC1 A;  5HI1 A;  3DBL I;  4GDK B;  2D3C A;  4XWT A;  3QCA A;  2ZW1 A;  1SEB D;  3NVZ A;  3KLS X;  4GLS C;  4MGY E;  2GMI C;  1WYG A;  4AQ7 A;  5DPR A;  2ZPN A;  3GZN B;  1ZGU B;  1D5X C;  1UF0 A;  3KUD B;  4EEW A;  2R61 A;  3P2B A;  3VUW A;  2RPV A;  5BYS A;  2CHX A;  3H9D A;  2HE7 A;  3APF A;  1FEH A;  1L6U A;  1AWD A;  3A1Q A;  3RCZ A;  3RI7 C;  2J53 A;  1HTO A;  3UI3 A;  1YIW A;  2BVC A;  2L00 B;  4JE3 B;  2K39 A;  3A9J A;  4A3P A;  3OAW A;  4II3 B;  3MJ5 A;  1J8C A;  3GB1 A;  4F8C B;  2JPH A;  4AJW A;  1J7A A;  3U8Z A;  2PMV A;  1J19 A;  4BFR A;  2FAZ A;  4IG7 B;  1ENF A;  3FIL B;  3UQB A;  1N5W A;  1YN4 A;  2WDT B;  3BYT B;  4WWO A;  3P4P B;  3KUZ A;  3H7S A;  3AEC B;  4BBN F;  4C4V B;  2JT4 B;  3V60 A;  3U30 A;  3VRB B;  1G6J A;  2DYB A;  2MX2 A;  5D6J B;  2K6Q A;  1SF0 A;  3PGE A;  5E6N A;  3PRP B;  4BKG A;  1R4M I;  4NAW B;  3I9V 1;  3ZNH B;  3ML9 A;  1P98 A;  1UNS A;  1UBI A;  4PS8 A;  1N62 A;  5IO9 A;  2MLB A;  3Q3O C;  1MG8 A;  4HPP A;  1YD8 U;  1WE7 A;  3PTF C;  5BYQ A;  2KN5 A;  2LRU A;  1YMH E;  4AWJ A;  1HEZ E;  2VZK D;  2R2Q A;  1TIF A;  4FHK A;  3JSV B;  3PZ8 A;  3QC8 B;  5D94 A;  1WX7 A;  4CO7 A;  1I4Q A;  3IBE A;  3ZXR A;  1TBE A;  4IWQ A;  1N61 A;  3DOW A;  1QKZ A;  4IC7 B;  1VLB A;  1CK1 A;  4F1S A;  4JL9 A;  5AZG A;  1WX9 A;  1XO3 A;  4KZC A;  1V49 A;  2IGD A;  3Q69 A;  1RLF A;  2WXF A;  4LCD E;  3PRM B;  1WXA A;  2HTM E;  3RNE C;  2KMC A;  1KM7 A;  2IO0 B;  2JYT A;  1WWT A;  3DQV A;  3K9O B;  1I4H A;  1S3S G;  2J0J A;  4PK1 A;  4MH0 E;  1YN3 A;  4NQK E;  3I57 A;  3ZJT A;  1VDV A;  3AV8 A;  3C8Y A;  3APC A;  2IGH A;  1OQY A;  3MFG A;  4BOS C;  2Z0E B;  2EMS A;  4FHJ A;  4WJN A;  4NNJ B;  3H6N A;  4H2A A;  3Q8F A;  4WWN A;  3TSS A;  1OEY A;  2ZW0 A;  3MP9 A;  1SB3 C;  5E6J A;  2G1E A;  3VDZ A;  1GJZ A;  3PHX B;  1NEK B;  4XGA B;  2BWE S;  2NS5 A;  4HLE A;  1TTN A;  4W9H A;  3VUX A;  1YQ4 B;  2AL6 A;  2R2O A;  3P4R B;  1JML A;  1QZE A;  4MM3 A;  1HE8 A;  3WAL A;  1WJN A;  4LNK A;  1ET9 A;  2IY1 B;  1NDD A;  1QOB A;  4B9K A;  3ZDT A;  2GBN A;  3N30 A;  2WNM A;  3DHG C;  3SHQ A;  4JPS A;  2N7J A;  1V1P B;  2N0S B;  4OVV A;  2NR2 A;  4REZ A;  3MC9 A;  1JWA D;  4MJS B;  2INN E;  2LZ6 A;  2WLB A;  2V4I B;  5D3D A;  5IKC M;  2FID A;  1SE4 A;  2KD0 A;  1TZO A;  4BBN C;  3CMM B;  4P6V F;  3SDL C;  4WWM A;  5IN7 A;  2K6D B;  1VZ6 A;  2PLP A;  2NCN A;  3GE8 C;  2K8B A;  2V1Y A;  2SEB D;  4XDD A;  2MRP A;  2N9L A; 
#chains in the Genus database with same CATH homology
 1PUT A;  4YTP B;  4YWG G;  1E7P B;  2RMM A;  2WXI A;  3VR8 B;  3IAM 1;  2BT6 A;  5FKA C;  5HG2 A;  1GAQ B;  1HQR D;  3AE9 B;  1VZ7 A;  3RPF C;  4RF1 A;  3TEY A;  4RH6 A;  4US9 A;  2BS2 B;  3NVW A;  2JXT A;  5BMH A;  3BYY B;  2KMM A;  1FMA D;  1SE2 A;  2K0P A;  3U52 E;  3BK1 A;  2E3T A;  1QLB B;  5BMG A;  2LEK A;  1J7C A;  4UDU C;  3TEZ A;  1TJE A;  2V3P A;  2PIA A;  4L1B A;  4D2K A;  5T8I A;  4LTU A;  5EE3 A;  3ABV B;  3P1M A;  1XCQ L;  2IPK D;  3VRA B;  2EKI A;  1QT9 A;  3NVY A;  3EA6 A;  1ZDX A;  3LB8 C;  3ZYY X;  1RWS A;  2DLB A;  3W2D A;  2WDQ B;  5TSS A;  1YJJ A;  1JWS D;  1XF5 L;  4A90 A;  3ZJU A;  3KQ4 A;  3KWL A;  1QOA A;  3Q8E A;  1N60 A;  3RFZ B;  3Q8B A;  1IUE A;  2W82 A;  1SBB B;  5JXV A;  2XNA C;  3BWU D;  1V8C A;  1EU4 A;  5C2T B;  5D3I B;  1L0X B;  4DXG A;  2AQ2 B;  1FXI A;  3IAS 1;  2INP E;  2GB1 A;  2KDM A;  2LMC A;  3B2G A;  3FIL A;  1NEN B;  2I38 A;  2I2Y A;  1FM0 D;  3EUB 2;  2HDE A;  1J7B A;  2JQR B;  4HRS A;  3V05 A;  1MVK A;  2MJD A;  2MH7 A;  3J9C A;  4XE0 A;  2WXG A;  3NS1 A;  2QIL A;  3DWM A;  5LNK 1;  1SIJ A;  3W1S A;  3AE3 B;  4N58 A;  1L5P A;  4A9A A;  1FXA A;  2V0G A;  4Q2J A;  4OZC A;  1NVI D;  4USA A;  2J42 A;  1ZPS A;  2WXK A;  3NVV A;  1EM7 A;  2DYM A;  4OW0 A;  1JWU D;  3U4E G;  3ZJV A;  4CQN A;  1FCC C;  1YQ3 B;  2ICI A;  1D5M C;  4XDC A;  3SEB A;  3R2I A;  1M4V A;  1VZ8 A;  2JZP A;  2CU3 A;  1SJE D;  1FNV A;  2WXO A;  1C4P A;  4YXD B;  3AE5 B;  2H89 B;  1MPE A;  1ZOY B;  1GOZ A;  1ZUD 2;  1AYF A;  2LFI A;  4WIP A;  3WCQ A;  1UUP A;  2M56 B;  2V3N A;  2IJ0 A;  2B76 B;  4HJG E;  3HVZ A;  1HZ6 A;  2PKO A;  1K50 A;  1WSP A;  5FK9 C;  1BXT A;  1C76 A;  2KWD A;  1TS2 A;  4B0M A;  1F0Z A;  2N9K A;  3BVZ A;  1PGB A;  1KFY B;  1DGJ A;  2M0A A;  1KTK A;  4RGT A;  2WXP A;  2PVG C;  1ZXH A;  3IT4 B;  1ROE A;  3B9J A;  1E9M A;  1N5X A;  4WAF A;  1SJH D;  1NYR A;  1T6B X;  4NZL B;  4C80 A;  4TMA B;  1IGC A;  2FUG 1;  4DXF A;  4YSY B;  2AQ1 B;  1KH0 A;  4TQ0 A;  1ZDV A;  4RF0 A;  2D5G A;  1JQ4 A;  1QOG A;  1KLU D;  1HZ5 A;  1ZXI A;  1FRD A;  1QIL A;  2Q5W D;  1BML C;  2Y3A A;  2SAK A;  2XN9 C;  1BUI C;  2K22 A;  3AE4 B;  2BS3 B;  3PO0 A;  3AEE B;  5GXG B;  4YSZ B;  1STE A;  2JU6 X;  3HRD D;  3NUH B;  1JWB D;  1FD6 A;  3AE7 B;  3ZGZ A;  2BTE A;  3IXS A;  1MHX A;  1D4B A;  1YNT E;  3IT6 B;  3AEF B;  1XXG A;  3BII D;  3HVD A;  3KWV A;  3TEX A;  1XLP A;  1DYQ A;  3LYY A;  1LO5 D;  2M19 A;  3MC0 B;  2BB5 A;  1KLG D;  4ARI A;  2WXL A;  1E0Z A;  1V1P A;  4N6E B;  4N59 A;  4KGR A;  4OHJ A;  3SR6 A;  5BMI A;  4C7Z A;  1MHH E;  3E56 A;  2WXM A;  5H8Y E;  3N9Y C;  3PZ7 A;  1XLO A;  2WDR B;  5MPO A;  4KGS A;  1GB1 A;  1P7F A;  1MI0 A;  4J3O D;  1FO4 A;  4HKQ A;  1TY2 A;  4O1N A;  4B0E A;  2Y5C A;  2LHE A;  4ARC A;  2KQ4 X;  4L2Y A;  2WP9 B;  2L1A A;  2VZK B;  1Q10 A;  2ON8 A;  1XEE A;  4C56 C;  1OQQ A;  1L4D B;  3R8B A;  3AM9 A;  4TQ1 A;  1QQR A;  1T5X D;  1F77 A;  1ZP0 B;  5HI1 A;  1A70 A;  4RFB A;  4GDK B;  4XWT A;  4YSX B;  1F2R I;  2E6X A;  2ZW1 A;  1SEB D;  3NVZ A;  5EE1 A;  3KLS X;  4GDL B;  4GLS C;  1FFU A;  1JW9 D;  2NTT A;  1PYW D;  1WYG A;  1AW7 A;  2DWQ A;  2WDV B;  1CJE A;  1EWC A;  4RNA A;  4AQ7 A;  4ZHO A;  3GS2 A;  1C77 A;  2IGG A;  4ZOH C;  3AN1 A;  5BYR A;  3P4Q B;  4MM3 B;  1FRR A;  3P63 A;  4DQO C;  3TUO A;  1YN5 A;  1B9R A;  3DWG C;  2Y5P A;  1D5X C;  2PTL A;  2AX5 A;  1E6E B;  2QMT A;  2WXR A;  1EWY C;  2R61 A;  2RPV A;  1JAL A;  2WU2 B;  1WGK A;  5BYS A;  2WXH A;  3W5U B;  3TEW A;  3Q8C A;  2BB6 A;  1TKE A;  3AED B;  4R3D A;  1FEH A;  1SXT A;  1XLQ A;  1I4P A;  1L6U A;  2KAJ A;  2W3R A;  2J52 A;  1AWD A;  5H92 C;  2YEP F;  3NZ3 A;  3U7Z A;  2J53 A;  4YT0 B;  2DYO A;  3UI3 A;  1FNU A;  2L32 A;  4JE3 B;  4L23 A;  1DOI A;  3BVM A;  3V3X A;  2WXJ A;  4ZHP A;  1XLN A;  1Y56 A;  3CIR B;  3MJ5 A;  3GB1 A;  4HRO A;  1TKY A;  2BBC A;  1J7A A;  4A55 A;  1D5Z C;  1SE3 A;  2PMV A;  3ETR A;  1WRI A;  1GB4 A;  1ACC A;  3T3N A;  1ENF A;  1N63 A;  3FIL B;  1N5W A;  1YN4 A;  1ZE3 D;  1CZP A;  3AE8 B;  3BYT B;  1TS5 A;  2NMQ A;  4ZRQ A;  3URY A;  2QJL A;  3W5V B;  3P4P B;  2LHD A;  4YTM B;  1V1O A;  4WH4 A;  3AEC B;  4ITK A;  4NAM A;  2WXQ A;  3AE1 B;  1I4G A;  1OFF A;  2OED A;  1B1Z A;  3VRB B;  1SF0 A;  1CQV A;  2JSV X;  4NAW B;  4JWS C;  3I9V 1;  2W54 A;  1C4C A;  1NI3 A;  2FBW B;  2PW9 A;  2X38 A;  1TS4 A;  3AH7 A;  1IBX A;  2YEP B;  1DOY A;  1UNS A;  1N62 A;  1VR9 A;  4ZRP A;  4RGO S;  1FIQ A;  4MAC A;  1TKG A;  3P42 A;  2RDH A;  4HKZ E;  5BYQ A;  5C3J B;  2PVO D;  2Z8L A;  3VR9 B;  1ET6 A;  2W55 A;  4OZB A;  2CJN A;  1YMH E;  3FAH A;  1PGA A;  1JRP A;  2W3S A;  1HEZ E;  2VZK D;  3T3O A;  1JRO A;  1UGJ A;  3AEA B;  3PZ8 A;  3SFD B;  3R2T A;  2ONQ A;  1UWM A;  4FXC A;  1C78 A;  3NRZ A;  4RGM A;  2QEJ C;  1FCL A;  1I4Q A;  2BYT A;  4JX1 C;  1N61 A;  3Q8A A;  1HA5 A;  5AUI A;  1JCK B;  2TSS A;  1RFK A;  3BK2 A;  1QKZ A;  3AE6 B;  4EE2 A;  1IBX B;  1R7S A;  1VLB A;  1CK1 A;  5G5G A;  2QSD A;  1L0V B;  2AQ3 B;  1XO3 A;  1EU3 A;  1L0Y B;  2J4X A;  2IGD A;  3AEB B;  3Q69 A;  2JX5 A;  2WXF A;  3AEG B;  5D7G A;  1NYQ A;  1DOX A;  2HTM E;  1V97 A;  1K51 A;  5FR3 A;  5EE0 A;  1OQR A;  2DBY A;  2JYT A;  1PDX A;  2K9X A;  2WS3 B;  3GP7 A;  2FE8 A;  3MHZ A;  1WWT A;  2LGI A;  3BVG A;  3LXF A;  2JWU A;  1FFV A;  1I4H A;  2QIE B;  4US8 A;  4LK0 M;  1SSN A;  4LLG M;  3ZQ4 A;  2CJO A;  1I7H A;  1YN3 A;  2KAC A;  1HXY D;  5G5H A;  2L83 A;  4KKI A;  3I57 A;  3ZJT A;  1VDV A;  1VJK A;  3AV8 A;  3FC4 A;  4IDI A;  1VRA B;  1AN8 A;  3HUI A;  2G9H D;  3C8Y A;  4XWW A;  4A8X C;  3OWE B;  4JWU C;  2IGH A;  4WUR A;  3BZD B;  3E9S A;  1WXQ A;  3MFG A;  4IKG A;  1XCT L;  1K52 A;  4RCO A;  1QF6 A;  4H2A A;  3P4S B;  3Q8F A;  3TSS A;  1ESF A;  1C9F A;  1F2R C;  4NJC A;  2NTS A;  1IGD A;  2ZW0 A;  4C7Y A;  2ACZ B;  3MP9 A;  3AMZ A;  1E10 A;  2MJE A;  2MJ3 A;  1SB3 C;  5E6J A;  4MT5 A;  2RDG A;  2G1E A;  1T3Q A;  2BS4 B;  1KF6 B;  1L4Z B;  2JYE A;  1NEK B;  1PFD A;  3H8H A;  5AUK A;  1L6V A;  1QOF A;  3AB5 A;  2GI9 A;  2K3U A;  5EE9 A;  1YQ4 B;  4P16 A;  3P4R B;  4YTN B;  1I4R A;  1JML A;  1TYG B;  3EGR A;  2GRI A;  5I4D A;  4OZA A;  4AS1 A;  1ET9 A;  4MH8 A;  2WXN A;  4A6Q A;  1QOB A;  4KKJ A;  1D6E C;  4RGN A;  1GPX A;  4OVZ A;  2BW2 A;  5HHD G;  3VQI A;  4ZYS A;  2LJI A;  2WNM A;  1PGX A;  4JPS A;  4KGT A;  2N7J A;  4M0W A;  1V1P B;  1P7E A;  3AE2 B;  2N0S B;  4REZ A;  1RM6 C;  1YJI A;  4TSS A;  4WQM A;  2WU5 B;  1JWA D;  1RYJ A;  2INN E;  3L4P A;  2WLB A;  2V4I B;  5D3D A;  2WQY B;  2KN4 A;  1I4X A;  5HFY A;  3U2S C;  1SE4 A;  2MEK A;  1TZO A;  3W9C B;  3SFE B;  3O13 A;  4P6V F;  2EEL A;  1C79 A;  1C4A A;  4WWM A;  3CWI A;  1JWM D;  4PT5 A;  2K5P A;  2OHF A;  1FNW A;  1VZ6 A;  2PLP A;  3B2F A;  1TY0 A;  2L52 A;  1TS3 A;  4IOI E;  4HEA 1;  1KRH A;  2SEB D;  4KX6 B;  1UWX A;  2IDY A;  2LUM A;  4XDD A;  2H88 B;  1K53 A;  2N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...