2ONQA

Gbeta1 stabilization by in vitro evolution and computational design
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MQFKLIINGKTLKGEITIEAVDAAEAEKFFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein G
publication title Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2onqA00
2LUMA 1FD6A 1FCLA 1HZ5A 2QMTA 2GB1A 4OZBA 2OEDA 1PGAA 4HJGE 4OZAA 1JMLA 1GB1A 2LHDA 5BMGA 1IGCA 2N9KA 2EELA 2IGGA 2NMQA 2I2YA 1QKZA 2ON8A 4WH4A 1IBXA 2N9LA 5JXVA 1MPEA 3V3XA 5HG2A 3FILA 1XF5L 1YMHE 2RMMA 1EM7A 1FCCC 2J52A 2J53A 1K50A 2PW9A 4KGRA 1K51A 2ONQA 1P7FA 2N7JA 2PLPA 1HZ6A 2QSDA 1D4BA 1GB4A 2RPVA 2KWDA 2KQ4X 2KDMA 1IBXB 2LGIA 4KGSA 3MP9A 4MACA 3FILB 1P7EA 4OZCA 2ZW0A 1F2RI 1HEZE 1MHHE 5BMIA 1MI0A 4KGTA 2IGDA 1XCQL 2JSVX 1PGBA 3GB1A 1MHXA 4D2KA 5HFYA 4GLSC 1ZXHA 2JWUA 1MVKA 1IGDA 1XCTL 5HHDG 4HKZE 2I38A 2KACA 2IGHA 1C9FA 3UI3A 1Q10A 4IKGA 2LHEA 1UWXA 1YNTE 2K0PA 2JU6X 5HI1A 5BMHA 1F2RC 1K53A 1K52A 4IOIE 2JZPA 2PTLA 1PGXA 2GI9A 1KH0A 2JXTA 2KN4A 2ZW1A
chains in the Genus database with same CATH superfamily
5J18A 1D3ZA 4HROA 4KDIC 2WS3B 5AZGA 4YTMB 2QMTA 2KTFA 3DQVA 4A9AA 3VHTC 3L08A 3Q2AC 2V3SA 3E9SA 4F8CB 3WAPA 5IN7A 3JSVB 4NAMA 3Q6BA 2NMQA 5CHVC 3GS2A 2BS4B 5J2RA 1GOZA 5TR5A 1WX7A 2AYOB 4TQ0A 1KTKA 2LGDA 2ZCBA 4W9CA 1F0ZA 2O6VB 1WX8A 2KC1A 4MM3A 3QAQA 4F7ZA 4US8A 3KLSX 4A20A 1H4RA 2WXNA 2BYEA 3ETRA 4G11A 2PVGC 1CMXB 4ZRQA 5G5HA 1WX9A 1SF0A 3Q8EA 2PEAA 1RAXA 3A9JA 2JSVX 3WIMA 1YIWA 2IY1B 1D5XC 2M1MA 3I5JC 3ZRCA 4WQMA 3OLMD 2PKOA 1FMAD 3VXWA 4NY0A 2I38A 4I6LB 2N9PC 3ZDMC 3RNEC 2K1FA 4DHJB 1WJ6A 3ZW3A 2LGYA 2JYTA 3AE9B 1YN4A 4QAYA 3RT3B 1OFFA 2O6VD 2E6XA 4PS8A 3MHZA 1FFVA 4YL8A 1R4NB 2WDRB 3W5UB 3V6EB 3O13A 1FXIA 3RNAC 1T6BX 1F52A 2WHIA 1ZW7A 4J6IA 1UBQA 2L05A 3BVZA 4CO7A 3IT6B 4EUTA 2VRRB 2Y3AA 1WXAA 1CK1A 2GB1A 1RFKA 2CHXA 2B76B 1JROA 1ZPSA 2KXJA 1B1ZA 2ZNVB 1QKZA 2MJEA 4EEWA 2ON8A 4KZ0A 3H1UA 2CJNA 2RMMA 4JQWC 2OHFA 2J53A 4DHJD 2V0GA 2WDTB 4ACFA 3HRDD 3AMZA 1IP9A 3AE6B 2LGSA 3DVGY 5G5GA 5AEKB 1SE2A 3B2GA 3FILB 1P7EA 5D94A 2MP2B 2SAKA 2KJRA 3V60A 2ZPYA 3R7RA 1M4VA 2HD5B 4CQNA 1YOVB 2NVUI 1I4GA 2RR9A 4GLSC 3P4SB 1E6EB 1FFUA 3EA6A 2JY6A 5HHDG 2REXA 4UDUC 4TUUA 1N63A 2L76A 4EZJA 4HK2A 3H8HA 3IAS1 3ZIMA 4HLEA 1GAQB 3U2SC 2DAFA 3LB8C 3Q8FA 2WXOA 4HWIB 1P9DU 1M94A 2J7QB 1K52A 1G6JA 2AEHA 3BIID 4JGHB 3QA8A 1TZ1A 2IY0B 4C7YA 2FCQA 4E74A 1PUTA 3ABVB 1JWMD 3T3OA 5IO9A 2K25A 2PE6B 3TCAA 1FCLA 2C9WB 4GIVA 3B1LX 4OW0A 3C19A 2C60A 1EO6A 4DXAB 2HJ8A 4M0WA 3SR6A 1C78A 4C4VA 3DOWA 1QILA 2IJ0A 2I2YA 1L6VA 4B0MA 2DYOA 2N7DA 3PHWB 5DPWA 3QQ8B 1MPEA 1X1MA 4NJ6A 1T5XD 5E6OA 1N5WA 2L3ZA 2KDFB 3MC8A 3JYUA 1K51A 1DGJA 2K8HA 2N7JA 2NTSA 2ASQA 1D6EC 3RUIB 4IUMB 4WWOA 2G9HD 2BPSA 4RMAA 3X0WA 2FIDA 2KQSA 4DHZB 2K3UA 2LGXA 1UH6A 2JRIB 1T0SC 2LWPA 4RGOS 3ZJTA 3H7PA 1WGYA 1ZUD2 1AW7A 1E8WA 2FNJB 2V3PA 1DOYA 1J8CA 1JCKB 5AUKA 2RPQA 1XCQL 1WM3A 3DHGC 4A3PA 2DWQA 2O2VA 3PV1A 5IA7A 2BKRB 1L0YB 2LMCA 4D2KA 2G45B 5IP4D 4ARCA 5BYQA 2L83A 1MVKA 2KN5A 5BO4B 3JSVA 2UU7A 2QC8A 2FAZA 2IYDB 3UQBA 2K0PA 3ENEA 2C7NB 1OEYA 4RGTA 2BWES 3NJTA 2JZPA 2K22A 3N1ZC 3AE2B 2R61A 1KH0A 1MFWA 4BOZB 3VTWA 1QZEA 1QT9A 1GJZA 2EKIA 4TMAB 3QIJA 1R4NI 3KYCD 5KHQA 4M8MA 1DOIA 2GMIC 3RNGC 4DQOC 1I35A 3VTVA 5BMGA 4HJKA 5C3JB 5LXIB 5GMVA 2MWSB 3NS1A 4RH6A 2N9LA 1FNUA 1ZGUB 1I4RA 1NI2A 2G4SA 1IPGA 3HUIA 3AB5A 3HVZA 1E7VA 1WZ3A 1GG3A 5EE3A 2RPVA 3PRPB 2KC2A 1IBXB 2NPTB 1UUPA 3QCAA 4S0RA 5AZHA 4C80A 1AWDA 1N62A 4HPLB 2LZ6A 3L13A 1V6EA 3URYA 4AOFA 4NZLB 4XDDA 3P42A 2Y5PA 5IAAC 3QX1A 2ZCCA 4A6QA 4LNNA 2KDIA 1WJNA 4HKZE 4MELA 2KACA 3AXCA 4ANXA 1UD7A 2N7EA 1WYWB 4E71A 1WJ4A 3DCGA 3AE7B 4XWWA 3VAWA 4BVUC 2HJ1A 2GI9A 3L0WB 2INCC 4P1CC 2BVCA 2KJHB 3PGEA 1YJ1A 2YVCA 1XEEA 3ZDTA 2MA9B 1WE7A 2K6QA 1VRAB 3AE4B 2LXAA 3DHIC 3ZQ4A 4RCOA 2DENB 4TKNA 4FHKA 4PS3A 5TSSA 3NVYA 1EWYC 4KZCA 2W3RA 1GUAB 3TEXA 1ET6A 1YX5B 2XBBC 1V8CA 3E56A 5C2TB 3A9KB 5DCNA 3HK0A 2KLCA 2MBEA 2IZVB 3BYYB 1FIQA 1C3TA 3CSTA 4GDLB 4X57B 2N0SB 2RGFA 4WURA 1UZXB 3ECIA 2KFJA 3VR8B 4C7ZA 4RGNA 2OJWA 3TMPB 2AL6A 1L2NA 1F9JA 4FJYA 4JL9A 3B0AA 1ZXIA 2Z8LA 4MDKE 3WANA 1VD2A 1J0GA 4W9LA 4EZKA 2LUEA 2M0AA 1IGDA 4K7SA 4KDLB 2W54A 4KSKC 2A4ZA 3QJZA 3RN9C 1E5WA 4JIOU 5D6JB 5C23A 3N3KB 2G1EA 2M19A 4FN2A 1ZE3D 4GSWA 1YNTE 1XD3B 2WYQA 1BUIC 3GZNB 1F2RC 3U4EG 2IO1B 3AU5A 1SE9A 5H92C 2IDYA 3N1YC 5LLIA 1WSPA 1OGWA 1EUVB 4FJZA 5T8IA 3CMMB 2MX2A 2MHJA 1RYJA 3R7QA 2DX5B 2W82A 2JT4B 2IO2B 2KNBA 2KHWB 1WYGA 4LCDE 4ZHPA 1WZ0A 3L17A 4HJGE 3KYDD 2BYTA 3N30A 3SHQA 3SD5A 2MH7A 1WXVA 3A1QB 4ZRPA 3TIXA 2EMSA 2CS4A 3U8ZA 1EM7A 1WGGA 2RDHA 1SJED 4WAFA 1TS3A 3RZWC 5JHAA 1H8CA 4JLCA 3K9PB 4P16A 1J19A 3ZJVA 1E8XA 2DHZA 3AE1B 1JWSD 4M00A 4C00A 2KFKB 1Z2MA 2KMMA 2KAJA 1SB3C 4WWMA 3Q3JA 4CYEA 1FO4A 3RPFC 2R2QA 4CHKA 3TEZA 4KVGB 4ZDVA 4URKA 1V97A 3NVWA 3SDLC 5HFYA 1L4DB 2QCZA 4J3OD 2WXRA 3M95A 3P4PB 4B0EA 2HTME 4N58A 1WXQA 2H89B 3ZGZA 3OWEB 4ICVA 1QOGA 3WAOA 1TIFA 4RFBA 1WM2A 4EFOA 3T3NA 2B3AA 2C7HA 4LJPB 2N1WA 2RDBC 1R4MI 1V49A 4ZYSA 5BMHA 1YJIA 4ZYNA 4GU2A 1N61A 2CR5A 4I6PA 2NPTA 3NVZA 2PVOD 3JW0X 2LEKA 1ZOYB 3W1SA 2JWZA 3BY4B 3DBHB 1E10A 1U4AA 3NY5A 3KWVA 3MTNB 1HE8A 2BYVE 2DYBA 2WXHA 2Y5BB 1JMLA 1WH3A 2KVZA 3V62A 2L8JA 2NCNA 3ZTCA 3Q3OC 1S1QB 3HVDA 1Q0WB 4XGAB 1KRHA 5JH5C 1VZ6A 4YT0B 2AQ1B 4A3OA 1T0QC 1K50A 2YLMA 4NAWB 2BYFA 2DZKA 4BKSD 1TYGB 4LTUA 1P7FA 3GP7A 2QSDA 5LXHA 1D4BA 2L52A 3R3MA 1JWUD 4YSXB 2I1KA 1TJEA 5AUIA 2KYWA 4XYCA 3AEBB 1JRPA 1MI0A 1Z5SB 1WXMA 1I42A 2GOWA 2N4FA 1ENFA 3ZYYX 3AM9A 4W9HA 1WGRA 1TTNA 1PFDA 1FEHA 2MBOA 2TSSA 2J42A 4HDQA 5JHBA 1GC6A 3I3TB 3R2IA 1RRBA 2BTEA 4K1RB 4PYZA 4DBGA 4WWNA 3KH0A 3AULA 2KOXA 2RD0A 4A55A 3Q8BA 4LJOB 3VUYA 3P4QB 2C7MB 1UF0A 1T3QA 3MJWA 4GDKA 2H88B 1FNWA 2GRIA 3H9DA 3Q8CA 4B9KA 1WGHA 3C0RB 2OOBB 5CHFA 3VUWA 1IYFA 4G50A 3VUXA 1C77A 5AZFA 2BF8B 1PGXA 2NBWB 2K8BA 4ANVA 3CSFA 4JWUC 1LQBA 2ZZPB 2WDVB 3IFWB 4XZ4A 3GZNI 1L0VB 5EE9A 2G3QB 2LJIA 3NHEB 3QARA 1B9RA 2INDC 3W5VB 3P1MA 3PLUA 1YQ3B 4G3XB 3S2AA 3UIOB 4M02A 2LVPA 5JXVA 3KQ4A 3SEBA 2KDBA 4DXFA 4FJVB 5LNK1 4KKJA 2PW9A 1TT5B 2R2OA 3PTFC 2MRPA 3Q69A 5CTRC 3DBRB 4ZHOA 1WMHB 2GBRA 1LM8B 3Q3MC 4OVUA 2BBCA 1AARA 1SSNA 2J0JA 4PT5A 2JZ3B 3EC8A 3EFCA 3IVFA 1J7AA 2SEBD 1V1PB 1HA5A 3LXFA 3UF8A 4JPSA 2K5PA 1T0RC 3GB1A 3JVZX 2KTRB 1MHXA 1N5XA 5L83A 2DNFA 5G2NA 2KLGA 3V05A 4JE3B 3ONSA 3HIZA 1FPYA 2FUHB 4HPPA 3ZLZA 4HCNB 1GPXA 3VRAB 3UI3A 4IKGA 1C4AA 1TGZB 1E7PB 1EWCA 3B08A 2NBUA 2WX1A 1UELA 2J0KA 1QOAA 4XE0A 1QOBA 3RZFA 1V86A 5D7GA 1I4PA 2WDQB 4FADA 2X38A 3FC4A 4XC2A 1F1HA 2M4NA 2KZRA 3IAM1 1PGAA 2O6VA 2JVCA 1KOTA 1YX6B 2INPE 4GN1A 4PS7A 2EELA 3DBHI 3ZXRA 4AP4C 4YTPB 2HE7A 3BVGA 3KW5B 1I4QA 2BKFA 1V5OA 4ANWA 4AQ7A 1AYFA 1OQYA 2MJDA 2QILA 1XXGA 3IT4B 4NJ7A 4O1NA 4HVBA 4WAAA 2FCNA 1VCBA 1SE4A 3IHPC 4NQKE 1YD8U 4KX6B 2LGIA 3NZSA 4IWOA 4XX5A 1V9JA 1KF6B 3KUDB 1F2RI 1WI0A 4PYUA 1WXSA 4KGTA 1JQ4A 4MM3B 2QIEB 2GBJA 2QDFA 1TBEA 2LD9A 4WWPA 4ITKA 1EU4A 4ZRKA 5MPOA 3Q8AA 3PS6A 1LGRA 4GXBA 2JXXA 4LNIA 3W2DA 5H8YE 3FAHA 1E7UA 1NEKB 1E0ZA 1FRRA 2D3AA 3A9JB 3DDCB 3AE8B 3MFGA 4N59A 4HRSA 1SIFA 2WXKA 5HI1A 4GMVA 1K53A 2NR2A 2WP9B 3ZJUA 2KK8A 3B9JA 3ZNZB 3DBLB 3KWLA 3APCA 4WJOA 2N1VA 2VH2A 1YQ4B 3M62B 2DZJA 4LNFA 2KANA 1FD6A 5EE0A 1TS4A 1V80A 4GGQA 3ZRFA 5FK9C 4TV3A 4OZAA 3TJPA 2PE9A 2LHDA 2D3GA 4IWPA 4MJSB 3MJ5A 2JZZA 1I4HA 2N9KA 2MEKA 2IGGA 3K9OB 4FXCA 3ZUNA 4G0NB 3V3XA 1CJEA 3FILA 3DVNU 4BAXA 1C79A 2MP2A 1DOXA 1RFAA 4HXDA 3NG0A 2LASA 3AEDB 2CHWA 4II3B 5DPSA 3UINB 1OTRB 3VVWB 4B6WA 1XLQA 2BT6A 2M17A 3PZ8A 2ACZB 4HKQA 2WNMA 3APDA 3VR9B 2CJOA 4YTNB 1E90A 3PHXB 2WXIA 3DBRI 3A4RA 1CQVA 5BYRA 4RF1A 1L0XB 4ANUA 3U7ZA 3SU8X 3ZVVA 2WU2B 1VDVA 4IG7B 1VLBA 3QC8B 2M8SA 5L95C 4K7UA 4JWSC 4IM2A 3PREA 2KT7A 3AN1A 3AE5B 2MBBB 3DPDA 3AEFB 3SFEB 5FR6A 1FM0D 4RNAA 1HQRD 4M01A 1YQBA 1UNSA 3P63A 3QK0A 1D5MC 4L2YA 3J9CA 4REZA 1WWTA 4WJNA 2KX3A 4HPMB 4ZOHC 3VQIA 2K9XA 2MBQA 3ML8A 1BXTA 3NOBA 2KX0A 1V5TA 1WJUA 4K7WA 3VFKA 3DWGC 2Z0DB 2VZKD 4FLHA 4FBJB 3AEGB 1NI3A 2D2QA 3WCQA 3L16A 1XLOA 4F1SA 1FNVA 3V61A 2MBHA 3BWUD 2XNAC 1PYWD 3AU4A 4OHJA 4EOYA 3Q14C 4N9F4 3NZUA 3EHVA 3PVLA 1ZDVA 2LJ5A 4M0WB 5EDSA 1C76A 4C4VB 3EECA 1XO3A 3GE3C 2IBIB 2KDMA 1ROEA 2HTHA 2LVOA 2ZNVC 4P7IA 2ZW0A 1HXYD 2KKCA 2WLBA 5BMIA 2M56B 3TBLD 1HTOA 4DDGD 4MGYE 2JYEA 4A8XC 3W1YA 4ICUA 3VH3B 2WXPA 4DXGA 3N20C 3O65B 2KVRA 2A5UA 3H7PB 2L1AA 1XCTL 1JWBD 1NVID 1WIAA 4N6EB 1NYRA 2IGHA 1AN8A 2KWVB 1Q10A 3AI5A 2PMVA 1S3SG 2E3TA 2Y5CA 2O2VB 1UWXA 1TY2A 3U7DA 4L23A 2MJ3A 1LXDA 1CZPA 2WXMA 1L7YA 2JUOA 1BT0A 2ICIA 1JALA 2NBVB 1IUEA 3SFDB 4KV2A 3RMKC 4NNJB 2DBYA 3VTUA 5FR3A 3PZ7A 1JW9D 1HTQA 3DBLI 4AWJA 1P1AA 1J7BA 3A33B 1VZ7A 2KO3A 3UQAA 2AX5A 3Q3FA 2QEJC 3RCZA 3PPAA 1IBXA 2DLBA 1C1YB 4K3CA 4W9EA 2BS2B 3EGRA 2WWZA 2QHOA 3AEEB 1EF1A 4W9GA 4US9A 3RI7C 1FXAA 3RFZB 4KIKB 4OVZA 2KQ4X 5G55A 1FXTB 3VDZA 1GNUA 1N60A 4KGSA 3PRMB 5J17A 1FRDA 1EU3A 2W55A 2JF5A 2DAJA 1XLPA 3HM3A 1VJKA 3ZNGC 1QOFA 3DVGX 3UGBB 4L1BA 2JQRB 3RNCC 4YXDB 2JPHA 2ZEQA 4IW0A 2JWUA 3H6NA 4MJSA 2RSUA 3L54A 1JWAD 2KMAA 3NUHB 4DHZE 4GOCA 2MW5A 5E6NA 3AH7A 1WRDB 4P6VF 2MLBA 2DZIA 5CHWA 2AL3A 1Y56A 2L0FA 2KWCA 2PTLA 2C5LC 1UWMA 1SJHD 1TKEA 2NS5A 3T8MA 3KUZA 2L7RA 1YN3A 1SXTA 2JXTA 3RD2A 1OQRA 2ZW1A 3TSSA 3IBEA 4WQOB 1WR6E 2N9XA 1WR1A 1LFDA 1Q1OA 2J4XA 3A9KA 5BYSA 3VRBB 1TS2A 3APFA 1J7CA 1GB1A 2W3SA 1F77A 3H7SA 1ZKHA 4Q2JA 3CWIA 5CX3A 4GDLA 3P4RB 2LI5A 1UBIA 4MH0E 2MQJA 1SGHA 1TZOA 2L32A 1TY0A 1YMHE 3GOEA 4BFRA 4IC7B 3ALBA 3PSEB 2ONQA 3I63C 4MEMA 2XK5B 3BINA 1T0YA 2WXGA 1QLBB 3U52E 4LNKA 5C1ZA 4TQ1A 4ZRIA 4NPNA 4PK1A 3MP9A 1SBBB 2WXJA 3C8YA 1NBFC 4C56C 3HHMA 1WF9A 2IGDA 3TEYA 1E8ZA 4BBNC 2WXFA 2LFIA 4W9KA 3PO0A 4NJCA 2GBNA 4ARIA 3AEAB 2J0MA 2BWFA 3AECB 3TUOA 1V1OA 4GB9A 4HDOA 2V1YA 3W1SC 4LNOA 3T9LA 2LHEA 4RGMA 5E6JA 2M0XA 1SEBD 3I9V1 4HEA1 3QWZB 2JU6X 4OVVA 5D2MB 4IOIE 1SE3A 2K39A 3EFUA 4W9IA 3AV8A 1DYQA 4BOSC 1ET9A 3V6CB 2WGSA 3I57A 2V4LA 3DVNV 3RYTA 2BGFA 2KN4A 3A1QA 2CKHB 1C4CA 2JRHA 3BVMA 4IWQA 3W9CB 3VH4B 4IM0A 4IM3A 2L00B 4OZBA 3LDZE 1P0RA 4W9JA 4BZAA 2PJHA 2Q5WD 4MGIE 4WJPA 1UGMA 2K6DB 2D10A 1I7HA 1BMLC 4YSZB 3TL5A 2AQ2B 4WH4A 2MCNB 2KFKA 5EE1A 4H2AA 1VR9A 4E3CA 5HG2A 1FCCC 1OQQA 2J52A 1VZ8A 4KGRA 1WGKA 2LRWA 3OJ4B 3FKYA 1XQQA 2KWUB 1HZ6A 4WIPA 3IXSA 4XWTA 2W9NA 2ZPNA 1WRIA 1KLVA 2OJRA 3UIPB 3A4SC 2FE8A 2HDEA 2G4DB 1KJTA 4OZCA 3ZTDA 2D11A 1RLFA 2VH1A 3EUB2 4P1BC 1MJDA 2V4IB 2UWQA 2XN9C 1C4PA 3N32A 4ASWC 1YN5A 1EF5A 5GXGB 2KD0A 1NDDA 4BKSA 2BQQA 1PGBA 3N1XC 1GC7A 4AUQC 3NS8A 1K8RB 1WE6A 5HKHA 2CU1A 3BZDB 3CIRB 2BS3B 2X8XX 4S17A 4KSLC 1L6UA 1P3QU 1ISNA 4RM8A 2WX0A 1A70A 1ESFA 3PRZA 2Z59B 3PT2B 4MGZE 3ZXVA 2FCMA 3R2TA 1V2YA 3L10B 5D3DA 4FULA 3BYTB 2WU5B 5D3IB 4AS1A 3PLVA 3U30A 1LO5D 1TKGA 2GBKA 2FIFA 4AJWA 4KIKA 3MC9A 2KJ6A 3IG3A 2IO0B 2D5GA 4FA6A 3GE8C 2PPHA 3DHHC 5DPRA 2LUMA 1JRUA 2MSED 4EZLA 3DWMA 2GLSA 4NAWA 1KM7A 1HZ5A 1A5RA 2OEDA 4K3BA 3RNBC 2KQ7A 3N9YC 2N9EB 4FHJA 4TSSA 3BK1A 3ML9A 2EMTA 1XF5L 3CF6E 3LYYA 3NZ3A 2WQYB 4NQLB 4DWFA 4RF0A 3NVVA 3M3JA 2INNE 1STEA 2RDGA 2PLPA 3ZKJC 2FUG1 1N6ZA 2EKEC 1GB4A 1KLGD 2KWDA 4YSYB 2AQ3B 4K81A 5IKCM 1R4MB 4XDCA 4BKTA 1XLNA 4W9FA 1MG4A 4BBNF 2L0TA 4KKIA 1HEZE 5FKAC 4LDTB 5JZEB 2LRUA 2D07B 2V9HA 1I4XA 3WA0A 4II2B 1D5ZC 1WY8A 4USAA 3BK2A 4DK5A 4MH8A 1NENB 3D32A 1OEYJ 2CHZA 1ZP0B 2XEWA 4I6NB 4MT5A 4W9DA 2YEPB 3L4PA 2LVQA 5DPTA 3MHSD 2VZKB 3OAWA 2AWTA 4HCPB 2WXQA 3TEWA 4MGKE 4B95A 2BB6A 2I1JA 2XK5A 2DZMA 2DYMA 4AJYB 4EE2A 2K8CA 3OJ3A 1YJJA 1ACCA 3KVFB 1SIJA 3ZNID 1WFYA 2KMCA 4GDKB 3ZNHB 2ZVOA 4DDID 4LDTD 1E8YA 4BKGA 1RWSA 3HM6X 5E6PA 1NYQA 4LK0M 2D3CA 2ZVNA 4MSMB 2YEPF 1WMHA 1IGCA 1Q5WB 3M63B 2BB5A 3P2BA 2PIAA 1XT9B 1R7SA 1V81A 2IPKD 3NRZA 3RULA 1QF6A 1V1PA 2CU3A 3KUCB 2V3NA 1Y8RC 2FBWB 2ZJDA 1ZDXA 1TKYA 1P98A 2IO3B 2GBMA 2UYZB 2KTRA 4JX1C 1QQRA 4MACA 3WAMA 1KFYB 3R66C 1TS5A 4YWGG 1MHHE 1L4ZB 1UGJA 3QHTA 1L5PA 3Q3NC 4IDIA 1E9MA 3MC0B 2QJLA 1PDXA 2LXCA 1RM6C 2NTTA 4A90A 1ZXHA 4MSQB 3R8BA 4R3DA 2D3BA 2FCSA 3B2FA 3X23A 3LJ3A 1C9FA 4WJQA 2KDEB 4LLGM 2JX5A 5I4DA 2BW2A 4ZRJA 3RNFC 3WALA 5KHOA 3DBSA 3OG5A 1WGDA 2Z0EB 1MG8A 4RM9A 1KLUD 3ZO5B 5IOIA 3AE3B 4M8NA 1PQSA 3PZDA 2WXLA 4EKUA
chains in the Genus database with same CATH topology
3TSSA 4HROA 2WS3B 3IAM1 4YTMB 5BYSA 2J4XA 1VRAB 2QMTA 3AE4B 1TS2A 3VRBB 4A9AA 1PGAA 1J7CA 3E9SA 1GB1A 3ZQ4A 2W3SA 4RCOA 1F77A 4Q2JA 2INPE 4NAMA 3CWIA 3P4RB 2EELA 2NMQA 5TSSA 3NVYA 1EWYC 3GS2A 2W3RA 2BS4B 4YTPB 3BVGA 1TZOA 2L32A 3TEXA 1TY0A 1YMHE 1ET6A 1GOZA 1I4QA 1V8CA 3E56A 4TQ0A 5C2TB 1KTKA 4AQ7A 2ONQA 1F0ZA 1AYFA 3BYYB 1FIQA 2MJDA 2WXGA 2QILA 1XXGA 1QLBB 3IT4B 4US8A 3U52E 4O1NA 3KLSX 4GDLB 2N0SB 1SE4A 2WXNA 4WURA 4TQ1A 3ETRA 4KX6B 3VR8B 4C7ZA 4RGNA 2LGIA 2PVGC 3MP9A 4ZRQA 1SBBB 2WXJA 5G5HA 3C8YA 1KF6B 1SF0A 1F2RI 4C56C 3Q8EA 4KGTA 2IGDA 3TEYA 1ZXIA 2Z8LA 4MM3B 1JQ4A 2QIEB 2JSVX 1D5XC 2WXFA 2LFIA 4WQMA 4ITKA 1EU4A 3PO0A 4NJCA 5MPOA 4ARIA 3Q8AA 2PKOA 1FMAD 3AEAB 2M0AA 1IGDA 3AECB 3W2DA 3TUOA 5H8YE 3FAHA 1V1OA 2W54A 1NEKB 2I38A 1E0ZA 1FRRA 2JYTA 3AE9B 1YN4A 2G1EA 2LHEA 3AE8B 4RGMA 5E6JA 2M19A 1OFFA 1ZE3D 3MFGA 4N59A 1SEBD 3I9V1 4HRSA 1YNTE 2E6XA 4HEA1 1BUIC 3MHZA 2JU6X 1FFVA 2WXKA 5HI1A 1F2RC 3U4EG 1K53A 4IOIE 1SE3A 2WDRB 3W5UB 3AV8A 1DYQA 2WP9B 5H92C 2IDYA 3O13A 1ET9A 1WSPA 3ZJUA 5T8IA 1FXIA 3B9JA 3I57A 3KWLA 1T6BX 1RYJA 2KN4A 1C4CA 1YQ4B 2W82A 3BVMA 3BVZA 3IT6B 3W9CB 1FD6A 5EE0A 2Y3AA 1TS4A 1WYGA 5FK9C 4ZHPA 1CK1A 4OZBA 2GB1A 1RFKA 2B76B 4HJGE 4OZAA 1JROA 1ZPSA 2BYTA 2Q5WD 2LHDA 3MJ5A 1I4HA 1I7HA 2N9KA 1B1ZA 1BMLC 2IGGA 2MEKA 2MH7A 4YSZB 1QKZA 2MJEA 4FXCA 2AQ2B 2ON8A 4WH4A 4ZRPA 5EE1A 4H2AA 1VR9A 3V3XA 1CJEA 3FILA 5HG2A 2CJNA 2RMMA 1EM7A 1FCCC 1C79A 1OQQA 2J53A 2J52A 2OHFA 1VZ8A 1DOXA 2RDHA 1SJED 1WGKA 4KGRA 4WAFA 2V0GA 1TS3A 3AEDB 1HZ6A 4WIPA 3HRDD 3IXSA 4XWTA 3AMZA 4P16A 3ZJVA 3AE1B 1JWSD 1WRIA 1XLQA 2BT6A 3AE6B 3PZ8A 2ACZB 5G5GA 4HKQA 2WNMA 1SE2A 2FE8A 3VR9B 3B2GA 2KMMA 2HDEA 2CJOA 3FILB 4YTNB 1P7EA 2KAJA 4OZCA 1SB3C 4WWMA 2SAKA 2WXIA 3EUB2 1FO4A 2V4IB 3RPFC 2XN9C 1M4VA 1C4PA 1YN5A 5GXGB 3TEZA 4CQNA 1CQVA 5BYRA 1PGBA 4RF1A 1L0XB 1V97A 3U7ZA 3NVWA 5HFYA 2WU2B 1VDVA 1L4DB 1I4GA 4GLSC 1VLBA 3P4SB 4J3OD 1E6EB 4JWSC 3BZDB 2WXRA 3P4PB 1FFUA 3EA6A 4B0EA 2HTME 4N58A 5HHDG 3CIRB 2BS3B 1WXQA 2H89B 3ZGZA 1L6UA 3OWEB 4UDUC 3AN1A 3AE5B 1A70A 1ESFA 1N63A 1QOGA 3AEFB 4RFBA 3T3NA 3R2TA 3H8HA 3IAS1 3SFEB 1GAQB 3U2SC 3LB8C 1FM0D 4RNAA 1HQRD 3Q8FA 5D3DA 3BYTB 2WU5B 5D3IB 1UNSA 2WXOA 3P63A 1D5MC 4ZYSA 4AS1A 4L2YA 3J9CA 5BMHA 4REZA 1YJIA 1K52A 3BIID 1LO5D 1TKGA 1WWTA 1N61A 4ZOHC 3VQIA 2K9XA 2D5GA 4C7YA 2PVOD 1BXTA 3NVZA 1PUTA 3ABVB 2LEKA 3DWGC 1JWMD 2VZKD 1ZOYB 3W1SA 3AEGB 3T3OA 2LUMA 1NI3A 1E10A 1FCLA 3DWMA 4OW0A 3KWVA 1HZ5A 3WCQA 2OEDA 2WXHA 4M0WA 1XLOA 3SR6A 1C78A 1JMLA 3N9YC 1FNVA 1QILA 4TSSA 3BK1A 2IJ0A 3BWUD 2I2YA 2XNAC 1PYWD 1L6VA 4OHJA 4B0MA 3HVDA 2DYOA 1MPEA 1KRHA 1T5XD 1N5WA 1XF5L 3LYYA 1VZ6A 3NZ3A 2AQ1B 2WQYB 4YT0B 1K50A 4NAWB 1ZDVA 4RF0A 1K51A 1DGJA 3NVVA 1TYGB 4LTUA 1P7FA 2INNE 1STEA 1C76A 2N7JA 2NTSA 2PLPA 2RDGA 3GP7A 2FUG1 1D6EC 2QSDA 1D4BA 2G9HD 1GB4A 1KLGD 2L52A 2KWDA 4YSYB 1JWUD 1XO3A 2AQ3B 4YSXB 2KDMA 2K3UA 1ROEA 4XDCA 4RGOS 3ZJTA 1ZUD2 1XLNA 1AW7A 1TJEA 2ZW0A 5AUIA 1HXYD 4KKIA 1HEZE 2V3PA 2WLBA 5BMIA 5FKAC 3AEBB 1JRPA 1DOYA 1MI0A 2M56B 1JCKB 2JYEA 5AUKA 4A8XC 1XCQL 1ENFA 1I4XA 3ZYYX 3AM9A 1PFDA 2DWQA 2WXPA 1D5ZC 1FEHA 1L0YB 2LMCA 4D2KA 4USAA 4DXGA 3BK2A 2TSSA 4ARCA 5BYQA 2J42A 4MH8A 2L83A 1MVKA 3R2IA 2L1AA 1NENB 2BTEA 1ZP0B 4MT5A 1XCTL 1JWBD 2YEPB 3L4PA 1NVID 4N6EB 1NYRA 2VZKB 2IGHA 1AN8A 4A55A 1Q10A 2WXQA 3Q8BA 2PMVA 3P4QB 3TEWA 2E3TA 2Y5CA 1T3QA 2H88B 1FNWA 2GRIA 1UWXA 1TY2A 3Q8CA 2BB6A 2K0PA 4L23A 2MJ3A 1CZPA 2WXMA 4RGTA 2DYMA 1C77A 2JZPA 4EE2A 1PGXA 2K22A 2ICIA 3AE2B 1JALA 2R61A 1KH0A 1YJJA 1ACCA 1IUEA 3SFDB 1SIJA 1QT9A 4JWUC 2WDVB 2EKIA 4GDKB 4TMAB 2DBYA 1L0VB 5EE9A 5FR3A 2LJIA 3PZ7A 1JW9D 1RWSA 1DOIA 1J7BA 1B9RA 1NYQA 4DQOC 4LK0M 1VZ7A 3W5VB 3P1MA 1YQ3B 2YEPF 2AX5A 2QEJC 5BMGA 1IGCA 5C3JB 2BB5A 1IBXA 3NS1A 4RH6A 2N9LA 5JXVA 2DLBA 3KQ4A 3SEBA 1FNUA 4DXFA 5LNK1 2PIAA 4KKJA 2PW9A 1I4RA 1R7SA 2IPKD 2BS2B 3NRZA 3EGRA 1QF6A 1V1PA 2CU3A 3Q69A 2V3NA 2FBWB 3HUIA 3AB5A 3AEEB 1ZDXA 1TKYA 3HVZA 4ZHOA 5EE3A 4US9A 2RPVA 1FXAA 3RFZB 4OVZA 2KQ4X 2BBCA 1IBXB 4JX1C 1SSNA 1UUPA 1N60A 1QQRA 4KGSA 4C80A 4MACA 4PT5A 1AWDA 1N62A 1J7AA 1EU3A 1FRDA 1KFYB 1TS5A 2W55A 4YWGG 1MHHE 2SEBD 1L4ZB 1UGJA 3URYA 1V1PB 1HA5A 1XLPA 3LXFA 1L5PA 4NZLB 4XDDA 1VJKA 3P42A 4JPSA 2Y5PA 2K5PA 4IDIA 1QOFA 3GB1A 1E9MA 4L1BA 3MC0B 2QJLA 1MHXA 1PDXA 1N5XA 2JQRB 4A6QA 4YXDB 1RM6C 2NTTA 4A90A 3V05A 1ZXHA 2JWUA 4JE3B 3R8BA 4R3DA 3B2FA 4HKZE 2KACA 1GPXA 1JWAD 1C9FA 3VRAB 3UI3A 3NUHB 4IKGA 1C4AA 4LLGM 2JX5A 3AH7A 5I4DA 1E7PB 2BW2A 1EWCA 4P6VF 3AE7B 4XWWA 1Y56A 1QOAA 2PTLA 4XE0A 1UWMA 2GI9A 1SJHD 1TKEA 1KLUD 1QOBA 1YN3A 5D7GA 1SXTA 3AE3B 1I4PA 2JXTA 2WDQB 1OQRA 1XEEA 2X38A 2ZW1A 2WXLA 3FC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  1FD6 A;  1FCL A;  1HZ5 A;  2QMT A;  2GB1 A;  4OZB A;  2OED A;  1PGA A;  4HJG E;  4OZA A;  1JML A;  1GB1 A;  2LHD A;  5BMG A;  1IGC A;  2N9K A;  2EEL A;  2IGG A;  2NMQ A;  2I2Y A;  1QKZ A;  2ON8 A;  4WH4 A;  1IBX A;  2N9L A;  5JXV A;  1MPE A;  3V3X A;  5HG2 A;  3FIL A;  1XF5 L;  1YMH E;  2RMM A;  1EM7 A;  1FCC C;  2J52 A;  2J53 A;  1K50 A;  2PW9 A;  4KGR A;  1K51 A;  2ONQ A;  1P7F A;  2N7J A;  2PLP A;  1HZ6 A;  2QSD A;  1D4B A;  1GB4 A;  2RPV A;  2KWD A;  2KQ4 X;  2KDM A;  1IBX B;  2LGI A;  4KGS A;  3MP9 A;  4MAC A;  3FIL B;  1P7E A;  4OZC A;  2ZW0 A;  1F2R I;  1HEZ E;  1MHH E;  5BMI A;  1MI0 A;  4KGT A;  2IGD A;  1XCQ L;  2JSV X;  1PGB A;  3GB1 A;  1MHX A;  4D2K A;  5HFY A;  4GLS C;  1ZXH A;  2JWU A;  1MVK A;  1IGD A;  1XCT L;  5HHD G;  4HKZ E;  2I38 A;  2KAC A;  2IGH A;  1C9F A;  3UI3 A;  1Q10 A;  4IKG A;  2LHE A;  1UWX A;  1YNT E;  2K0P A;  2JU6 X;  5HI1 A;  5BMH A;  1F2R C;  1K53 A;  1K52 A;  4IOI E;  2JZP A;  2PTL A;  1PGX A;  2GI9 A;  1KH0 A;  2JXT A;  2KN4 A;  2ZW1 A; 
#chains in the Genus database with same CATH topology
 5J18 A;  1D3Z A;  4HRO A;  4KDI C;  2WS3 B;  5AZG A;  4YTM B;  2QMT A;  2KTF A;  3DQV A;  4A9A A;  3VHT C;  3L08 A;  3Q2A C;  2V3S A;  3E9S A;  4F8C B;  3WAP A;  5IN7 A;  3JSV B;  4NAM A;  3Q6B A;  2NMQ A;  5CHV C;  3GS2 A;  2BS4 B;  5J2R A;  1GOZ A;  5TR5 A;  1WX7 A;  2AYO B;  4TQ0 A;  1KTK A;  2LGD A;  2ZCB A;  4W9C A;  1F0Z A;  2O6V B;  1WX8 A;  2KC1 A;  4MM3 A;  3QAQ A;  4F7Z A;  4US8 A;  3KLS X;  4A20 A;  1H4R A;  2WXN A;  2BYE A;  3ETR A;  4G11 A;  2PVG C;  1CMX B;  4ZRQ A;  5G5H A;  1WX9 A;  1SF0 A;  3Q8E A;  2PEA A;  1RAX A;  3A9J A;  2JSV X;  3WIM A;  1YIW A;  2IY1 B;  1D5X C;  2M1M A;  3I5J C;  3ZRC A;  4WQM A;  3OLM D;  2PKO A;  1FMA D;  3VXW A;  4NY0 A;  2I38 A;  4I6L B;  2N9P C;  3ZDM C;  3RNE C;  2K1F A;  4DHJ B;  1WJ6 A;  3ZW3 A;  2LGY A;  2JYT A;  3AE9 B;  1YN4 A;  4QAY A;  3RT3 B;  1OFF A;  2O6V D;  2E6X A;  4PS8 A;  3MHZ A;  1FFV A;  4YL8 A;  1R4N B;  2WDR B;  3W5U B;  3V6E B;  3O13 A;  1FXI A;  3RNA C;  1T6B X;  1F52 A;  2WHI A;  1ZW7 A;  4J6I A;  1UBQ A;  2L05 A;  3BVZ A;  4CO7 A;  3IT6 B;  4EUT A;  2VRR B;  2Y3A A;  1WXA A;  1CK1 A;  2GB1 A;  1RFK A;  2CHX A;  2B76 B;  1JRO A;  1ZPS A;  2KXJ A;  1B1Z A;  2ZNV B;  1QKZ A;  2MJE A;  4EEW A;  2ON8 A;  4KZ0 A;  3H1U A;  2CJN A;  2RMM A;  4JQW C;  2OHF A;  2J53 A;  4DHJ D;  2V0G A;  2WDT B;  4ACF A;  3HRD D;  3AMZ A;  1IP9 A;  3AE6 B;  2LGS A;  3DVG Y;  5G5G A;  5AEK B;  1SE2 A;  3B2G A;  3FIL B;  1P7E A;  5D94 A;  2MP2 B;  2SAK A;  2KJR A;  3V60 A;  2ZPY A;  3R7R A;  1M4V A;  2HD5 B;  4CQN A;  1YOV B;  2NVU I;  1I4G A;  2RR9 A;  4GLS C;  3P4S B;  1E6E B;  1FFU A;  3EA6 A;  2JY6 A;  5HHD G;  2REX A;  4UDU C;  4TUU A;  1N63 A;  2L76 A;  4EZJ A;  4HK2 A;  3H8H A;  3IAS 1;  3ZIM A;  4HLE A;  1GAQ B;  3U2S C;  2DAF A;  3LB8 C;  3Q8F A;  2WXO A;  4HWI B;  1P9D U;  1M94 A;  2J7Q B;  1K52 A;  1G6J A;  2AEH A;  3BII D;  4JGH B;  3QA8 A;  1TZ1 A;  2IY0 B;  4C7Y A;  2FCQ A;  4E74 A;  1PUT A;  3ABV B;  1JWM D;  3T3O A;  5IO9 A;  2K25 A;  2PE6 B;  3TCA A;  1FCL A;  2C9W B;  4GIV A;  3B1L X;  4OW0 A;  3C19 A;  2C60 A;  1EO6 A;  4DXA B;  2HJ8 A;  4M0W A;  3SR6 A;  1C78 A;  4C4V A;  3DOW A;  1QIL A;  2IJ0 A;  2I2Y A;  1L6V A;  4B0M A;  2DYO A;  2N7D A;  3PHW B;  5DPW A;  3QQ8 B;  1MPE A;  1X1M A;  4NJ6 A;  1T5X D;  5E6O A;  1N5W A;  2L3Z A;  2KDF B;  3MC8 A;  3JYU A;  1K51 A;  1DGJ A;  2K8H A;  2N7J A;  2NTS A;  2ASQ A;  1D6E C;  3RUI B;  4IUM B;  4WWO A;  2G9H D;  2BPS A;  4RMA A;  3X0W A;  2FID A;  2KQS A;  4DHZ B;  2K3U A;  2LGX A;  1UH6 A;  2JRI B;  1T0S C;  2LWP A;  4RGO S;  3ZJT A;  3H7P A;  1WGY A;  1ZUD 2;  1AW7 A;  1E8W A;  2FNJ B;  2V3P A;  1DOY A;  1J8C A;  1JCK B;  5AUK A;  2RPQ A;  1XCQ L;  1WM3 A;  3DHG C;  4A3P A;  2DWQ A;  2O2V A;  3PV1 A;  5IA7 A;  2BKR B;  1L0Y B;  2LMC A;  4D2K A;  2G45 B;  5IP4 D;  4ARC A;  5BYQ A;  2L83 A;  1MVK A;  2KN5 A;  5BO4 B;  3JSV A;  2UU7 A;  2QC8 A;  2FAZ A;  2IYD B;  3UQB A;  2K0P A;  3ENE A;  2C7N B;  1OEY A;  4RGT A;  2BWE S;  3NJT A;  2JZP A;  2K22 A;  3N1Z C;  3AE2 B;  2R61 A;  1KH0 A;  1MFW A;  4BOZ B;  3VTW A;  1QZE A;  1QT9 A;  1GJZ A;  2EKI A;  4TMA B;  3QIJ A;  1R4N I;  3KYC D;  5KHQ A;  4M8M A;  1DOI A;  2GMI C;  3RNG C;  4DQO C;  1I35 A;  3VTV A;  5BMG A;  4HJK A;  5C3J B;  5LXI B;  5GMV A;  2MWS B;  3NS1 A;  4RH6 A;  2N9L A;  1FNU A;  1ZGU B;  1I4R A;  1NI2 A;  2G4S A;  1IPG A;  3HUI A;  3AB5 A;  3HVZ A;  1E7V A;  1WZ3 A;  1GG3 A;  5EE3 A;  2RPV A;  3PRP B;  2KC2 A;  1IBX B;  2NPT B;  1UUP A;  3QCA A;  4S0R A;  5AZH A;  4C80 A;  1AWD A;  1N62 A;  4HPL B;  2LZ6 A;  3L13 A;  1V6E A;  3URY A;  4AOF A;  4NZL B;  4XDD A;  3P42 A;  2Y5P A;  5IAA C;  3QX1 A;  2ZCC A;  4A6Q A;  4LNN A;  2KDI A;  1WJN A;  4HKZ E;  4MEL A;  2KAC A;  3AXC A;  4ANX A;  1UD7 A;  2N7E A;  1WYW B;  4E71 A;  1WJ4 A;  3DCG A;  3AE7 B;  4XWW A;  3VAW A;  4BVU C;  2HJ1 A;  2GI9 A;  3L0W B;  2INC C;  4P1C C;  2BVC A;  2KJH B;  3PGE A;  1YJ1 A;  2YVC A;  1XEE A;  3ZDT A;  2MA9 B;  1WE7 A;  2K6Q A;  1VRA B;  3AE4 B;  2LXA A;  3DHI C;  3ZQ4 A;  4RCO A;  2DEN B;  4TKN A;  4FHK A;  4PS3 A;  5TSS A;  3NVY A;  1EWY C;  4KZC A;  2W3R A;  1GUA B;  3TEX A;  1ET6 A;  1YX5 B;  2XBB C;  1V8C A;  3E56 A;  5C2T B;  3A9K B;  5DCN A;  3HK0 A;  2KLC A;  2MBE A;  2IZV B;  3BYY B;  1FIQ A;  1C3T A;  3CST A;  4GDL B;  4X57 B;  2N0S B;  2RGF A;  4WUR A;  1UZX B;  3ECI A;  2KFJ A;  3VR8 B;  4C7Z A;  4RGN A;  2OJW A;  3TMP B;  2AL6 A;  1L2N A;  1F9J A;  4FJY A;  4JL9 A;  3B0A A;  1ZXI A;  2Z8L A;  4MDK E;  3WAN A;  1VD2 A;  1J0G A;  4W9L A;  4EZK A;  2LUE A;  2M0A A;  1IGD A;  4K7S A;  4KDL B;  2W54 A;  4KSK C;  2A4Z A;  3QJZ A;  3RN9 C;  1E5W A;  4JIO U;  5D6J B;  5C23 A;  3N3K B;  2G1E A;  2M19 A;  4FN2 A;  1ZE3 D;  4GSW A;  1YNT E;  1XD3 B;  2WYQ A;  1BUI C;  3GZN B;  1F2R C;  3U4E G;  2IO1 B;  3AU5 A;  1SE9 A;  5H92 C;  2IDY A;  3N1Y C;  5LLI A;  1WSP A;  1OGW A;  1EUV B;  4FJZ A;  5T8I A;  3CMM B;  2MX2 A;  2MHJ A;  1RYJ A;  3R7Q A;  2DX5 B;  2W82 A;  2JT4 B;  2IO2 B;  2KNB A;  2KHW B;  1WYG A;  4LCD E;  4ZHP A;  1WZ0 A;  3L17 A;  4HJG E;  3KYD D;  2BYT A;  3N30 A;  3SHQ A;  3SD5 A;  2MH7 A;  1WXV A;  3A1Q B;  4ZRP A;  3TIX A;  2EMS A;  2CS4 A;  3U8Z A;  1EM7 A;  1WGG A;  2RDH A;  1SJE D;  4WAF A;  1TS3 A;  3RZW C;  5JHA A;  1H8C A;  4JLC A;  3K9P B;  4P16 A;  1J19 A;  3ZJV A;  1E8X A;  2DHZ A;  3AE1 B;  1JWS D;  4M00 A;  4C00 A;  2KFK B;  1Z2M A;  2KMM A;  2KAJ A;  1SB3 C;  4WWM A;  3Q3J A;  4CYE A;  1FO4 A;  3RPF C;  2R2Q A;  4CHK A;  3TEZ A;  4KVG B;  4ZDV A;  4URK A;  1V97 A;  3NVW A;  3SDL C;  5HFY A;  1L4D B;  2QCZ A;  4J3O D;  2WXR A;  3M95 A;  3P4P B;  4B0E A;  2HTM E;  4N58 A;  1WXQ A;  2H89 B;  3ZGZ A;  3OWE B;  4ICV A;  1QOG A;  3WAO A;  1TIF A;  4RFB A;  1WM2 A;  4EFO A;  3T3N A;  2B3A A;  2C7H A;  4LJP B;  2N1W A;  2RDB C;  1R4M I;  1V49 A;  4ZYS A;  5BMH A;  1YJI A;  4ZYN A;  4GU2 A;  1N61 A;  2CR5 A;  4I6P A;  2NPT A;  3NVZ A;  2PVO D;  3JW0 X;  2LEK A;  1ZOY B;  3W1S A;  2JWZ A;  3BY4 B;  3DBH B;  1E10 A;  1U4A A;  3NY5 A;  3KWV A;  3MTN B;  1HE8 A;  2BYV E;  2DYB A;  2WXH A;  2Y5B B;  1JML A;  1WH3 A;  2KVZ A;  3V62 A;  2L8J A;  2NCN A;  3ZTC A;  3Q3O C;  1S1Q B;  3HVD A;  1Q0W B;  4XGA B;  1KRH A;  5JH5 C;  1VZ6 A;  4YT0 B;  2AQ1 B;  4A3O A;  1T0Q C;  1K50 A;  2YLM A;  4NAW B;  2BYF A;  2DZK A;  4BKS D;  1TYG B;  4LTU A;  1P7F A;  3GP7 A;  2QSD A;  5LXH A;  1D4B A;  2L52 A;  3R3M A;  1JWU D;  4YSX B;  2I1K A;  1TJE A;  5AUI A;  2KYW A;  4XYC A;  3AEB B;  1JRP A;  1MI0 A;  1Z5S B;  1WXM A;  1I42 A;  2GOW A;  2N4F A;  1ENF A;  3ZYY X;  3AM9 A;  4W9H A;  1WGR A;  1TTN A;  1PFD A;  1FEH A;  2MBO A;  2TSS A;  2J42 A;  4HDQ A;  5JHB A;  1GC6 A;  3I3T B;  3R2I A;  1RRB A;  2BTE A;  4K1R B;  4PYZ A;  4DBG A;  4WWN A;  3KH0 A;  3AUL A;  2KOX A;  2RD0 A;  4A55 A;  3Q8B A;  4LJO B;  3VUY A;  3P4Q B;  2C7M B;  1UF0 A;  1T3Q A;  3MJW A;  4GDK A;  2H88 B;  1FNW A;  2GRI A;  3H9D A;  3Q8C A;  4B9K A;  1WGH A;  3C0R B;  2OOB B;  5CHF A;  3VUW A;  1IYF A;  4G50 A;  3VUX A;  1C77 A;  5AZF A;  2BF8 B;  1PGX A;  2NBW B;  2K8B A;  4ANV A;  3CSF A;  4JWU C;  1LQB A;  2ZZP B;  2WDV B;  3IFW B;  4XZ4 A;  3GZN I;  1L0V B;  5EE9 A;  2G3Q B;  2LJI A;  3NHE B;  3QAR A;  1B9R A;  2IND C;  3W5V B;  3P1M A;  3PLU A;  1YQ3 B;  4G3X B;  3S2A A;  3UIO B;  4M02 A;  2LVP A;  5JXV A;  3KQ4 A;  3SEB A;  2KDB A;  4DXF A;  4FJV B;  5LNK 1;  4KKJ A;  2PW9 A;  1TT5 B;  2R2O A;  3PTF C;  2MRP A;  3Q69 A;  5CTR C;  3DBR B;  4ZHO A;  1WMH B;  2GBR A;  1LM8 B;  3Q3M C;  4OVU A;  2BBC A;  1AAR A;  1SSN A;  2J0J A;  4PT5 A;  2JZ3 B;  3EC8 A;  3EFC A;  3IVF A;  1J7A A;  2SEB D;  1V1P B;  1HA5 A;  3LXF A;  3UF8 A;  4JPS A;  2K5P A;  1T0R C;  3GB1 A;  3JVZ X;  2KTR B;  1MHX A;  1N5X A;  5L83 A;  2DNF A;  5G2N A;  2KLG A;  3V05 A;  4JE3 B;  3ONS A;  3HIZ A;  1FPY A;  2FUH B;  4HPP A;  3ZLZ A;  4HCN B;  1GPX A;  3VRA B;  3UI3 A;  4IKG A;  1C4A A;  1TGZ B;  1E7P B;  1EWC A;  3B08 A;  2NBU A;  2WX1 A;  1UEL A;  2J0K A;  1QOA A;  4XE0 A;  1QOB A;  3RZF A;  1V86 A;  5D7G A;  1I4P A;  2WDQ B;  4FAD A;  2X38 A;  3FC4 A;  4XC2 A;  1F1H A;  2M4N A;  2KZR A;  3IAM 1;  1PGA A;  2O6V A;  2JVC A;  1KOT A;  1YX6 B;  2INP E;  4GN1 A;  4PS7 A;  2EEL A;  3DBH I;  3ZXR A;  4AP4 C;  4YTP B;  2HE7 A;  3BVG A;  3KW5 B;  1I4Q A;  2BKF A;  1V5O A;  4ANW A;  4AQ7 A;  1AYF A;  1OQY A;  2MJD A;  2QIL A;  1XXG A;  3IT4 B;  4NJ7 A;  4O1N A;  4HVB A;  4WAA A;  2FCN A;  1VCB A;  1SE4 A;  3IHP C;  4NQK E;  1YD8 U;  4KX6 B;  2LGI A;  3NZS A;  4IWO A;  4XX5 A;  1V9J A;  1KF6 B;  3KUD B;  1F2R I;  1WI0 A;  4PYU A;  1WXS A;  4KGT A;  1JQ4 A;  4MM3 B;  2QIE B;  2GBJ A;  2QDF A;  1TBE A;  2LD9 A;  4WWP A;  4ITK A;  1EU4 A;  4ZRK A;  5MPO A;  3Q8A A;  3PS6 A;  1LGR A;  4GXB A;  2JXX A;  4LNI A;  3W2D A;  5H8Y E;  3FAH A;  1E7U A;  1NEK B;  1E0Z A;  1FRR A;  2D3A A;  3A9J B;  3DDC B;  3AE8 B;  3MFG A;  4N59 A;  4HRS A;  1SIF A;  2WXK A;  5HI1 A;  4GMV A;  1K53 A;  2NR2 A;  2WP9 B;  3ZJU A;  2KK8 A;  3B9J A;  3ZNZ B;  3DBL B;  3KWL A;  3APC A;  4WJO A;  2N1V A;  2VH2 A;  1YQ4 B;  3M62 B;  2DZJ A;  4LNF A;  2KAN A;  1FD6 A;  5EE0 A;  1TS4 A;  1V80 A;  4GGQ A;  3ZRF A;  5FK9 C;  4TV3 A;  4OZA A;  3TJP A;  2PE9 A;  2LHD A;  2D3G A;  4IWP A;  4MJS B;  3MJ5 A;  2JZZ A;  1I4H A;  2N9K A;  2MEK A;  2IGG A;  3K9O B;  4FXC A;  3ZUN A;  4G0N B;  3V3X A;  1CJE A;  3FIL A;  3DVN U;  4BAX A;  1C79 A;  2MP2 A;  1DOX A;  1RFA A;  4HXD A;  3NG0 A;  2LAS A;  3AED B;  2CHW A;  4II3 B;  5DPS A;  3UIN B;  1OTR B;  3VVW B;  4B6W A;  1XLQ A;  2BT6 A;  2M17 A;  3PZ8 A;  2ACZ B;  4HKQ A;  2WNM A;  3APD A;  3VR9 B;  2CJO A;  4YTN B;  1E90 A;  3PHX B;  2WXI A;  3DBR I;  3A4R A;  1CQV A;  5BYR A;  4RF1 A;  1L0X B;  4ANU A;  3U7Z A;  3SU8 X;  3ZVV A;  2WU2 B;  1VDV A;  4IG7 B;  1VLB A;  3QC8 B;  2M8S A;  5L95 C;  4K7U A;  4JWS C;  4IM2 A;  3PRE A;  2KT7 A;  3AN1 A;  3AE5 B;  2MBB B;  3DPD A;  3AEF B;  3SFE B;  5FR6 A;  1FM0 D;  4RNA A;  1HQR D;  4M01 A;  1YQB A;  1UNS A;  3P63 A;  3QK0 A;  1D5M C;  4L2Y A;  3J9C A;  4REZ A;  1WWT A;  4WJN A;  2KX3 A;  4HPM B;  4ZOH C;  3VQI A;  2K9X A;  2MBQ A;  3ML8 A;  1BXT A;  3NOB A;  2KX0 A;  1V5T A;  1WJU A;  4K7W A;  3VFK A;  3DWG C;  2Z0D B;  2VZK D;  4FLH A;  4FBJ B;  3AEG B;  1NI3 A;  2D2Q A;  3WCQ A;  3L16 A;  1XLO A;  4F1S A;  1FNV A;  3V61 A;  2MBH A;  3BWU D;  2XNA C;  1PYW D;  3AU4 A;  4OHJ A;  4EOY A;  3Q14 C;  4N9F 4;  3NZU A;  3EHV A;  3PVL A;  1ZDV A;  2LJ5 A;  4M0W B;  5EDS A;  1C76 A;  4C4V B;  3EEC A;  1XO3 A;  3GE3 C;  2IBI B;  2KDM A;  1ROE A;  2HTH A;  2LVO A;  2ZNV C;  4P7I A;  2ZW0 A;  1HXY D;  2KKC A;  2WLB A;  5BMI A;  2M56 B;  3TBL D;  1HTO A;  4DDG D;  4MGY E;  2JYE A;  4A8X C;  3W1Y A;  4ICU A;  3VH3 B;  2WXP A;  4DXG A;  3N20 C;  3O65 B;  2KVR A;  2A5U A;  3H7P B;  2L1A A;  1XCT L;  1JWB D;  1NVI D;  1WIA A;  4N6E B;  1NYR A;  2IGH A;  1AN8 A;  2KWV B;  1Q10 A;  3AI5 A;  2PMV A;  1S3S G;  2E3T A;  2Y5C A;  2O2V B;  1UWX A;  1TY2 A;  3U7D A;  4L23 A;  2MJ3 A;  1LXD A;  1CZP A;  2WXM A;  1L7Y A;  2JUO A;  1BT0 A;  2ICI A;  1JAL A;  2NBV B;  1IUE A;  3SFD B;  4KV2 A;  3RMK C;  4NNJ B;  2DBY A;  3VTU A;  5FR3 A;  3PZ7 A;  1JW9 D;  1HTQ A;  3DBL I;  4AWJ A;  1P1A A;  1J7B A;  3A33 B;  1VZ7 A;  2KO3 A;  3UQA A;  2AX5 A;  3Q3F A;  2QEJ C;  3RCZ A;  3PPA A;  1IBX A;  2DLB A;  1C1Y B;  4K3C A;  4W9E A;  2BS2 B;  3EGR A;  2WWZ A;  2QHO A;  3AEE B;  1EF1 A;  4W9G A;  4US9 A;  3RI7 C;  1FXA A;  3RFZ B;  4KIK B;  4OVZ A;  2KQ4 X;  5G55 A;  1FXT B;  3VDZ A;  1GNU A;  1N60 A;  4KGS A;  3PRM B;  5J17 A;  1FRD A;  1EU3 A;  2W55 A;  2JF5 A;  2DAJ A;  1XLP A;  3HM3 A;  1VJK A;  3ZNG C;  1QOF A;  3DVG X;  3UGB B;  4L1B A;  2JQR B;  3RNC C;  4YXD B;  2JPH A;  2ZEQ A;  4IW0 A;  2JWU A;  3H6N A;  4MJS A;  2RSU A;  3L54 A;  1JWA D;  2KMA A;  3NUH B;  4DHZ E;  4GOC A;  2MW5 A;  5E6N A;  3AH7 A;  1WRD B;  4P6V F;  2MLB A;  2DZI A;  5CHW A;  2AL3 A;  1Y56 A;  2L0F A;  2KWC A;  2PTL A;  2C5L C;  1UWM A;  1SJH D;  1TKE A;  2NS5 A;  3T8M A;  3KUZ A;  2L7R A;  1YN3 A;  1SXT A;  2JXT A;  3RD2 A;  1OQR A;  2ZW1 A;  3TSS A;  3IBE A;  4WQO B;  1WR6 E;  2N9X A;  1WR1 A;  1LFD A;  1Q1O A;  2J4X A;  3A9K A;  5BYS A;  3VRB B;  1TS2 A;  3APF A;  1J7C A;  1GB1 A;  2W3S A;  1F77 A;  3H7S A;  1ZKH A;  4Q2J A;  3CWI A;  5CX3 A;  4GDL A;  3P4R B;  2LI5 A;  1UBI A;  4MH0 E;  2MQJ A;  1SGH A;  1TZO A;  2L32 A;  1TY0 A;  1YMH E;  3GOE A;  4BFR A;  4IC7 B;  3ALB A;  3PSE B;  2ONQ A;  3I63 C;  4MEM A;  2XK5 B;  3BIN A;  1T0Y A;  2WXG A;  1QLB B;  3U52 E;  4LNK A;  5C1Z A;  4TQ1 A;  4ZRI A;  4NPN A;  4PK1 A;  3MP9 A;  1SBB B;  2WXJ A;  3C8Y A;  1NBF C;  4C56 C;  3HHM A;  1WF9 A;  2IGD A;  3TEY A;  1E8Z A;  4BBN C;  2WXF A;  2LFI A;  4W9K A;  3PO0 A;  4NJC A;  2GBN A;  4ARI A;  3AEA B;  2J0M A;  2BWF A;  3AEC B;  3TUO A;  1V1O A;  4GB9 A;  4HDO A;  2V1Y A;  3W1S C;  4LNO A;  3T9L A;  2LHE A;  4RGM A;  5E6J A;  2M0X A;  1SEB D;  3I9V 1;  4HEA 1;  3QWZ B;  2JU6 X;  4OVV A;  5D2M B;  4IOI E;  1SE3 A;  2K39 A;  3EFU A;  4W9I A;  3AV8 A;  1DYQ A;  4BOS C;  1ET9 A;  3V6C B;  2WGS A;  3I57 A;  2V4L A;  3DVN V;  3RYT A;  2BGF A;  2KN4 A;  3A1Q A;  2CKH B;  1C4C A;  2JRH A;  3BVM A;  4IWQ A;  3W9C B;  3VH4 B;  4IM0 A;  4IM3 A;  2L00 B;  4OZB A;  3LDZ E;  1P0R A;  4W9J A;  4BZA A;  2PJH A;  2Q5W D;  4MGI E;  4WJP A;  1UGM A;  2K6D B;  2D10 A;  1I7H A;  1BML C;  4YSZ B;  3TL5 A;  2AQ2 B;  4WH4 A;  2MCN B;  2KFK A;  5EE1 A;  4H2A A;  1VR9 A;  4E3C A;  5HG2 A;  1FCC C;  1OQQ A;  2J52 A;  1VZ8 A;  4KGR A;  1WGK A;  2LRW A;  3OJ4 B;  3FKY A;  1XQQ A;  2KWU B;  1HZ6 A;  4WIP A;  3IXS A;  4XWT A;  2W9N A;  2ZPN A;  1WRI A;  1KLV A;  2OJR A;  3UIP B;  3A4S C;  2FE8 A;  2HDE A;  2G4D B;  1KJT A;  4OZC A;  3ZTD A;  2D11 A;  1RLF A;  2VH1 A;  3EUB 2;  4P1B C;  1MJD A;  2V4I B;  2UWQ A;  2XN9 C;  1C4P A;  3N32 A;  4ASW C;  1YN5 A;  1EF5 A;  5GXG B;  2KD0 A;  1NDD A;  4BKS A;  2BQQ A;  1PGB A;  3N1X C;  1GC7 A;  4AUQ C;  3NS8 A;  1K8R B;  1WE6 A;  5HKH A;  2CU1 A;  3BZD B;  3CIR B;  2BS3 B;  2X8X X;  4S17 A;  4KSL C;  1L6U A;  1P3Q U;  1ISN A;  4RM8 A;  2WX0 A;  1A70 A;  1ESF A;  3PRZ A;  2Z59 B;  3PT2 B;  4MGZ E;  3ZXV A;  2FCM A;  3R2T A;  1V2Y A;  3L10 B;  5D3D A;  4FUL A;  3BYT B;  2WU5 B;  5D3I B;  4AS1 A;  3PLV A;  3U30 A;  1LO5 D;  1TKG A;  2GBK A;  2FIF A;  4AJW A;  4KIK A;  3MC9 A;  2KJ6 A;  3IG3 A;  2IO0 B;  2D5G A;  4FA6 A;  3GE8 C;  2PPH A;  3DHH C;  5DPR A;  2LUM A;  1JRU A;  2MSE D;  4EZL A;  3DWM A;  2GLS A;  4NAW A;  1KM7 A;  1HZ5 A;  1A5R A;  2OED A;  4K3B A;  3RNB C;  2KQ7 A;  3N9Y C;  2N9E B;  4FHJ A;  4TSS A;  3BK1 A;  3ML9 A;  2EMT A;  1XF5 L;  3CF6 E;  3LYY A;  3NZ3 A;  2WQY B;  4NQL B;  4DWF A;  4RF0 A;  3NVV A;  3M3J A;  2INN E;  1STE A;  2RDG A;  2PLP A;  3ZKJ C;  2FUG 1;  1N6Z A;  2EKE C;  1GB4 A;  1KLG D;  2KWD A;  4YSY B;  2AQ3 B;  4K81 A;  5IKC M;  1R4M B;  4XDC A;  4BKT A;  1XLN A;  4W9F A;  1MG4 A;  4BBN F;  2L0T A;  4KKI A;  1HEZ E;  5FKA C;  4LDT B;  5JZE B;  2LRU A;  2D07 B;  2V9H A;  1I4X A;  3WA0 A;  4II2 B;  1D5Z C;  1WY8 A;  4USA A;  3BK2 A;  4DK5 A;  4MH8 A;  1NEN B;  3D32 A;  1OEY J;  2CHZ A;  1ZP0 B;  2XEW A;  4I6N B;  4MT5 A;  4W9D A;  2YEP B;  3L4P A;  2LVQ A;  5DPT A;  3MHS D;  2VZK B;  3OAW A;  2AWT A;  4HCP B;  2WXQ A;  3TEW A;  4MGK E;  4B95 A;  2BB6 A;  2I1J A;  2XK5 A;  2DZM A;  2DYM A;  4AJY B;  4EE2 A;  2K8C A;  3OJ3 A;  1YJJ A;  1ACC A;  3KVF B;  1SIJ A;  3ZNI D;  1WFY A;  2KMC A;  4GDK B;  3ZNH B;  2ZVO A;  4DDI D;  4LDT D;  1E8Y A;  4BKG A;  1RWS A;  3HM6 X;  5E6P A;  1NYQ A;  4LK0 M;  2D3C A;  2ZVN A;  4MSM B;  2YEP F;  1WMH A;  1IGC A;  1Q5W B;  3M63 B;  2BB5 A;  3P2B A;  2PIA A;  1XT9 B;  1R7S A;  1V81 A;  2IPK D;  3NRZ A;  3RUL A;  1QF6 A;  1V1P A;  2CU3 A;  3KUC B;  2V3N A;  1Y8R C;  2FBW B;  2ZJD A;  1ZDX A;  1TKY A;  1P98 A;  2IO3 B;  2GBM A;  2UYZ B;  2KTR A;  4JX1 C;  1QQR A;  4MAC A;  3WAM A;  1KFY B;  3R66 C;  1TS5 A;  4YWG G;  1MHH E;  1L4Z B;  1UGJ A;  3QHT A;  1L5P A;  3Q3N C;  4IDI A;  1E9M A;  3MC0 B;  2QJL A;  1PDX A;  2LXC A;  1RM6 C;  2NTT A;  4A90 A;  1ZXH A;  4MSQ B;  3R8B A;  4R3D A;  2D3B A;  2FCS A;  3B2F A;  3X23 A;  3LJ3 A;  1C9F A;  4WJQ A;  2KDE B;  4LLG M;  2JX5 A;  5I4D A;  2BW2 A;  4ZRJ A;  3RNF C;  3WAL A;  5KHO A;  3DBS A;  3OG5 A;  1WGD A;  2Z0E B;  1MG8 A;  4RM9 A;  1KLU D;  3ZO5 B;  5IOI A;  3AE3 B;  4M8N A;  1PQS A;  3PZD A;  2WXL A;  4EKU A; 
#chains in the Genus database with same CATH homology
 3TSS A;  4HRO A;  2WS3 B;  3IAM 1;  4YTM B;  5BYS A;  2J4X A;  1VRA B;  2QMT A;  3AE4 B;  1TS2 A;  3VRB B;  4A9A A;  1PGA A;  1J7C A;  3E9S A;  1GB1 A;  3ZQ4 A;  2W3S A;  4RCO A;  1F77 A;  4Q2J A;  2INP E;  4NAM A;  3CWI A;  3P4R B;  2EEL A;  2NMQ A;  5TSS A;  3NVY A;  1EWY C;  3GS2 A;  2W3R A;  2BS4 B;  4YTP B;  3BVG A;  1TZO A;  2L32 A;  3TEX A;  1TY0 A;  1YMH E;  1ET6 A;  1GOZ A;  1I4Q A;  1V8C A;  3E56 A;  4TQ0 A;  5C2T B;  1KTK A;  4AQ7 A;  2ONQ A;  1F0Z A;  1AYF A;  3BYY B;  1FIQ A;  2MJD A;  2WXG A;  2QIL A;  1XXG A;  1QLB B;  3IT4 B;  4US8 A;  3U52 E;  4O1N A;  3KLS X;  4GDL B;  2N0S B;  1SE4 A;  2WXN A;  4WUR A;  4TQ1 A;  3ETR A;  4KX6 B;  3VR8 B;  4C7Z A;  4RGN A;  2LGI A;  2PVG C;  3MP9 A;  4ZRQ A;  1SBB B;  2WXJ A;  5G5H A;  3C8Y A;  1KF6 B;  1SF0 A;  1F2R I;  4C56 C;  3Q8E A;  4KGT A;  2IGD A;  3TEY A;  1ZXI A;  2Z8L A;  4MM3 B;  1JQ4 A;  2QIE B;  2JSV X;  1D5X C;  2WXF A;  2LFI A;  4WQM A;  4ITK A;  1EU4 A;  3PO0 A;  4NJC A;  5MPO A;  4ARI A;  3Q8A A;  2PKO A;  1FMA D;  3AEA B;  2M0A A;  1IGD A;  3AEC B;  3W2D A;  3TUO A;  5H8Y E;  3FAH A;  1V1O A;  2W54 A;  1NEK B;  2I38 A;  1E0Z A;  1FRR A;  2JYT A;  3AE9 B;  1YN4 A;  2G1E A;  2LHE A;  3AE8 B;  4RGM A;  5E6J A;  2M19 A;  1OFF A;  1ZE3 D;  3MFG A;  4N59 A;  1SEB D;  3I9V 1;  4HRS A;  1YNT E;  2E6X A;  4HEA 1;  1BUI C;  3MHZ A;  2JU6 X;  1FFV A;  2WXK A;  5HI1 A;  1F2R C;  3U4E G;  1K53 A;  4IOI E;  1SE3 A;  2WDR B;  3W5U B;  3AV8 A;  1DYQ A;  2WP9 B;  5H92 C;  2IDY A;  3O13 A;  1ET9 A;  1WSP A;  3ZJU A;  5T8I A;  1FXI A;  3B9J A;  3I57 A;  3KWL A;  1T6B X;  1RYJ A;  2KN4 A;  1C4C A;  1YQ4 B;  2W82 A;  3BVM A;  3BVZ A;  3IT6 B;  3W9C B;  1FD6 A;  5EE0 A;  2Y3A A;  1TS4 A;  1WYG A;  5FK9 C;  4ZHP A;  1CK1 A;  4OZB A;  2GB1 A;  1RFK A;  2B76 B;  4HJG E;  4OZA A;  1JRO A;  1ZPS A;  2BYT A;  2Q5W D;  2LHD A;  3MJ5 A;  1I4H A;  1I7H A;  2N9K A;  1B1Z A;  1BML C;  2IGG A;  2MEK A;  2MH7 A;  4YSZ B;  1QKZ A;  2MJE A;  4FXC A;  2AQ2 B;  2ON8 A;  4WH4 A;  4ZRP A;  5EE1 A;  4H2A A;  1VR9 A;  3V3X A;  1CJE A;  3FIL A;  5HG2 A;  2CJN A;  2RMM A;  1EM7 A;  1FCC C;  1C79 A;  1OQQ A;  2J53 A;  2J52 A;  2OHF A;  1VZ8 A;  1DOX A;  2RDH A;  1SJE D;  1WGK A;  4KGR A;  4WAF A;  2V0G A;  1TS3 A;  3AED B;  1HZ6 A;  4WIP A;  3HRD D;  3IXS A;  4XWT A;  3AMZ A;  4P16 A;  3ZJV A;  3AE1 B;  1JWS D;  1WRI A;  1XLQ A;  2BT6 A;  3AE6 B;  3PZ8 A;  2ACZ B;  5G5G A;  4HKQ A;  2WNM A;  1SE2 A;  2FE8 A;  3VR9 B;  3B2G A;  2KMM A;  2HDE A;  2CJO A;  3FIL B;  4YTN B;  1P7E A;  2KAJ A;  4OZC A;  1SB3 C;  4WWM A;  2SAK A;  2WXI A;  3EUB 2;  1FO4 A;  2V4I B;  3RPF C;  2XN9 C;  1M4V A;  1C4P A;  1YN5 A;  5GXG B;  3TEZ A;  4CQN A;  1CQV A;  5BYR A;  1PGB A;  4RF1 A;  1L0X B;  1V97 A;  3U7Z A;  3NVW A;  5HFY A;  2WU2 B;  1VDV A;  1L4D B;  1I4G A;  4GLS C;  1VLB A;  3P4S B;  4J3O D;  1E6E B;  4JWS C;  3BZD B;  2WXR A;  3P4P B;  1FFU A;  3EA6 A;  4B0E A;  2HTM E;  4N58 A;  5HHD G;  3CIR B;  2BS3 B;  1WXQ A;  2H89 B;  3ZGZ A;  1L6U A;  3OWE B;  4UDU C;  3AN1 A;  3AE5 B;  1A70 A;  1ESF A;  1N63 A;  1QOG A;  3AEF B;  4RFB A;  3T3N A;  3R2T A;  3H8H A;  3IAS 1;  3SFE B;  1GAQ B;  3U2S C;  3LB8 C;  1FM0 D;  4RNA A;  1HQR D;  3Q8F A;  5D3D A;  3BYT B;  2WU5 B;  5D3I B;  1UNS A;  2WXO A;  3P63 A;  1D5M C;  4ZYS A;  4AS1 A;  4L2Y A;  3J9C A;  5BMH A;  4REZ A;  1YJI A;  1K52 A;  3BII D;  1LO5 D;  1TKG A;  1WWT A;  1N61 A;  4ZOH C;  3VQI A;  2K9X A;  2D5G A;  4C7Y A;  2PVO D;  1BXT A;  3NVZ A;  1PUT A;  3ABV B;  2LEK A;  3DWG C;  1JWM D;  2VZK D;  1ZOY B;  3W1S A;  3AEG B;  3T3O A;  2LUM A;  1NI3 A;  1E10 A;  1FCL A;  3DWM A;  4OW0 A;  3KWV A;  1HZ5 A;  3WCQ A;  2OED A;  2WXH A;  4M0W A;  1XLO A;  3SR6 A;  1C78 A;  1JML A;  3N9Y C;  1FNV A;  1QIL A;  4TSS A;  3BK1 A;  2IJ0 A;  3BWU D;  2I2Y A;  2XNA C;  1PYW D;  1L6V A;  4OHJ A;  4B0M A;  3HVD A;  2DYO A;  1MPE A;  1KRH A;  1T5X D;  1N5W A;  1XF5 L;  3LYY A;  1VZ6 A;  3NZ3 A;  2AQ1 B;  2WQY B;  4YT0 B;  1K50 A;  4NAW B;  1ZDV A;  4RF0 A;  1K51 A;  1DGJ A;  3NVV A;  1TYG B;  4LTU A;  1P7F A;  2INN E;  1STE A;  1C76 A;  2N7J A;  2NTS A;  2PLP A;  2RDG A;  3GP7 A;  2FUG 1;  1D6E C;  2QSD A;  1D4B A;  2G9H D;  1GB4 A;  1KLG D;  2L52 A;  2KWD A;  4YSY B;  1JWU D;  1XO3 A;  2AQ3 B;  4YSX B;  2KDM A;  2K3U A;  1ROE A;  4XDC A;  4RGO S;  3ZJT A;  1ZUD 2;  1XLN A;  1AW7 A;  1TJE A;  2ZW0 A;  5AUI A;  1HXY D;  4KKI A;  1HEZ E;  2V3P A;  2WLB A;  5BMI A;  5FKA C;  3AEB B;  1JRP A;  1DOY A;  1MI0 A;  2M56 B;  1JCK B;  2JYE A;  5AUK A;  4A8X C;  1XCQ L;  1ENF A;  1I4X A;  3ZYY X;  3AM9 A;  1PFD A;  2DWQ A;  2WXP A;  1D5Z C;  1FEH A;  1L0Y B;  2LMC A;  4D2K A;  4USA A;  4DXG A;  3BK2 A;  2TSS A;  4ARC A;  5BYQ A;  2J42 A;  4MH8 A;  2L83 A;  1MVK A;  3R2I A;  2L1A A;  1NEN B;  2BTE A;  1ZP0 B;  4MT5 A;  1XCT L;  1JWB D;  2YEP B;  3L4P A;  1NVI D;  4N6E B;  1NYR A;  2VZK B;  2IGH A;  1AN8 A;  4A55 A;  1Q10 A;  2WXQ A;  3Q8B A;  2PMV A;  3P4Q B;  3TEW A;  2E3T A;  2Y5C A;  1T3Q A;  2H88 B;  1FNW A;  2GRI A;  1UWX A;  1TY2 A;  3Q8C A;  2BB6 A;  2K0P A;  4L23 A;  2MJ3 A;  1CZP A;  2WXM A;  4RGT A;  2DYM A;  1C77 A;  2JZP A;  4EE2 A;  1PGX A;  2K22 A;  2ICI A;  3AE2 B;  1JAL A;  2R61 A;  1KH0 A;  1YJJ A;  1ACC A;  1IUE A;  3SFD B;  1SIJ A;  1QT9 A;  4JWU C;  2WDV B;  2EKI A;  4GDK B;  4TMA B;  2DBY A;  1L0V B;  5EE9 A;  5FR3 A;  2LJI A;  3PZ7 A;  1JW9 D;  1RWS A;  1DOI A;  1J7B A;  1B9R A;  1NYQ A;  4DQO C;  4LK0 M;  1VZ7 A;  3W5V B;  3P1M A;  1YQ3 B;  2YEP F;  2AX5 A;  2QEJ C;  5BMG A;  1IGC A;  5C3J B;  2BB5 A;  1IBX A;  3NS1 A;  4RH6 A;  2N9L A;  5JXV A;  2DLB A;  3KQ4 A;  3SEB A;  1FNU A;  4DXF A;  5LNK 1;  2PIA A;  4KKJ A;  2PW9 A;  1I4R A;  1R7S A;  2IPK D;  2BS2 B;  3NRZ A;  3EGR A;  1QF6 A;  1V1P A;  2CU3 A;  3Q69 A;  2V3N A;  2FBW B;  3HUI A;  3AB5 A;  3AEE B;  1ZDX A;  1TKY A;  3HVZ A;  4ZHO A;  5EE3 A;  4US9 A;  2RPV A;  1FXA A;  3RFZ B;  4OVZ A;  2KQ4 X;  2BBC A;  1IBX B;  4JX1 C;  1SSN A;  1UUP A;  1N60 A;  1QQR A;  4KGS A;  4C80 A;  4MAC A;  4PT5 A;  1AWD A;  1N62 A;  1J7A A;  1EU3 A;  1FRD A;  1KFY B;  1TS5 A;  2W55 A;  4YWG G;  1MHH E;  2SEB D;  1L4Z B;  1UGJ A;  3URY A;  1V1P B;  1HA5 A;  1XLP A;  3LXF A;  1L5P A;  4NZL B;  4XDD A;  1VJK A;  3P42 A;  4JPS A;  2Y5P A;  2K5P A;  4IDI A;  1QOF A;  3GB1 A;  1E9M A;  4L1B A;  3MC0 B;  2QJL A;  1MHX A;  1PDX A;  1N5X A;  2JQR B;  4A6Q A;  4YXD B;  1RM6 C;  2NTT A;  4A90 A;  3V05 A;  1ZXH A;  2JWU A;  4JE3 B;  3R8B A;  4R3D A;  3B2F A;  4HKZ E;  2KAC A;  1GPX A;  1JWA D;  1C9F A;  3VRA B;  3UI3 A;  3NUH B;  4IKG A;  1C4A A;  4LLG M;  2JX5 A;  3AH7 A;  5I4D A;  1E7P B;  2BW2 A;  1EWC A;  4P6V F;  3AE7 B;  4XWW A;  1Y56 A;  1QOA A;  2PTL A;  4XE0 A;  1UWM A;  2GI9 A;  1SJH D;  1TKE A;  1KLU D;  1QOB A;  1YN3 A;  5D7G A;  1SXT A;  3AE3 B;  1I4P A;  2JXT A;  2WDQ B;  1OQR A;  1XEE A;  2X38 A;  2ZW1 A;  2WXL A;  3FC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...