2ONQA

Gbeta1 stabilization by in vitro evolution and computational design
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MQFKLIINGKTLKGEITIEAVDAAEAEKFFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2onqA00
3MP9A 1IBXB 1HEZE 1IGCA 4HJGE 1MI0A 1K53A 3FILA 1PGBA 2I38A 1F2RC 4HKZE 2JZPA 2RPVA 2ZW1A 2OEDA 3FILB 1FCLA 2IGDA 1IGDA 2N7JA 2KWDA 2LGIA 1FD6A 2J52A 4KGTA 2PLPA 5HFYA 2I2YA 1ZXHA 5HG2A 5HI1A 1XF5L 1MHXA 1HZ5A 2JXTA 1K51A 5BMHA 1Q10A 1MPEA 4MACA 2JU6X 4OZAA 1K50A 1HZ6A 1XCTL 2JWUA 4KGRA 4WH4A 2ZW0A 4GLSC 2N9KA 2GB1A 1EM7A 2GI9A 2EELA 1JMLA 2JSVX 1C9FA 4IOIE 3UI3A 1GB4A 5BMGA 2RMMA 4OZBA 2K0PA 1P7EA 2N9LA 2J53A 2LHEA 1MHHE 1MVKA 2IGGA 4IKGA 5JXVA 2KACA 1D4BA 2NMQA 2IGHA 4D2KA 1QKZA 1KH0A 2KDMA 2LHDA 2ON8A 3GB1A 1GB1A 1UWXA 5HHDG 1PGXA 3V3XA 2QSDA 2PTLA 2KQ4X 2QMTA 4KGSA 4OZCA 1YNTE 5BMIA 1IBXA 1F2RI 1PGAA 1XCQL 2ONQA 2LUMA 2PW9A 2KN4A 1YMHE 1P7FA 1K52A 1FCCC
chains in the Genus database with same CATH superfamily
1R4NB 1ZE3D 3C8YA 1I4QA 4PS7A 1WI0A 4DWFA 2BBCA 1I4RA 1IUEA 4KSKC 1VRAB 3B2FA 5DPRA 3PV1A 3NJTA 4K3CA 2RPVA 1V81A 2LZ6A 2ZPNA 2INDC 2J0MA 5EE0A 2FUHB 2VH2A 2V0GA 2N7EA 1SBBB 2W3RA 3ZJVA 3NS8A 1ACCA 3M62B 4WWNA 3ML9A 3CF6E 1F77A 2AX5A 2J52A 2H88B 4IDIA 4HWIB 3PO0A 4US9A 4EKUA 1ZP0B 4S0RA 1HZ5A 3PRMB 1YIWA 3BY4B 4GN1A 2L0FA 4KSLC 1WMHA 1MPEA 3VDZA 5EE9A 3CSFA 2IO1B 1WY8A 1FO4A 3W1SC 4LK0M 3D32A 3PLUA 4WH4A 2LGSA 4NNJB 3R7RA 4FJYA 2N9KA 1EM7A 2INPE 1OFFA 1JMLA 1PUTA 5AZFA 2ZVOA 2N4FA 1NDDA 1YJIA 1C3TA 1UH6A 1MHHE 2IGGA 4IKGA 4GDLA 2JX5A 2B76B 2CJOA 3P4RB 2L52A 1GC7A 2XK5B 3LJ3A 1J19A 2CU3A 1I4GA 2IGHA 3AXCA 2O6VD 2JVCA 2BPSA 1SEBD 2QSDA 1JWUD 2KQ4X 5E6OA 2ACZB 2MHJA 2W3SA 1GAQB 2WXKA 3TEWA 1ZDXA 2REXA 3KWLA 3P63A 3H7SA 4AJWA 3IXSA 4MELA 3DCGA 4C4VB 1K53A 4XWWA 1WM3A 4LJOB 2WDTB 4XYCA 2K3UA 3AI5A 3Q3OC 3ZJTA 3MJ5A 4IWOA 4ZYSA 1WXAA 3NUHB 3NS1A 2KN5A 3AE9B 2AQ2B 3NG0A 4MGIE 2QCZA 1QOBA 5GMVA 2IY1B 3QCAA 3VRBB 2I2YA 4KV2A 2MBHA 3V6EB 5DPTA 1TY0A 4PYUA 5H8YE 1YJ1A 1JQ4A 2QEJC 1C4CA 2C60A 1XLOA 2D3AA 3PRPB 2N9PC 5AUIA 1V97A 2KQ7A 3WCQA 2L1AA 3P1MA 4NJ6A 3TJPA 3NVYA 4N58A 5IKCM 3MC9A 2GI9A 3APDA 4BBNC 2D2QA 2KDBA 2LASA 4OZBA 2JYTA 5LXIB 4HPMB 1L2NA 4LDTD 1QZEA 3AV8A 3WAPA 5I4DA 2BWES 3RULA 1D4BA 3PRZA 4A55A 1U4AA 3H6NA 3KYCD 4MH8A 1WRDB 1D3ZA 1FIQA 3HIZA 3AE6B 5FK9C 2YEPB 2PVOD 4DDGD 2RGFA 2D07B 3R7QA 3RNGC 3ZGZA 3NVWA 1OGWA 2LRWA 3ZO5B 3IAM1 1Z2MA 4HVBA 2D3CA 3QJZA 1IGCA 3TUOA 1V86A 3P4QB 4B6WA 2ASQA 3FILA 1TGZB 4RFBA 2JUOA 4MGYE 1D5ZC 3DBSA 5IAAC 5C1ZA 3DBHB 1XO3A 3PZ7A 4I6PA 2D3GA 2OEDA 1TJEA 3W1YA 2ZVNA 2MP2B 4MT5A 1E8YA 5BYRA 4EEWA 2N7JA 1DGJA 2VH1A 3WAOA 2LI5A 1Y56A 2EMTA 3AECB 3AE3B 2OOBB 3ZLZA 4CO7A 5HFYA 3A9JB 1NI2A 1LO5D 4HCPB 1V1PB 4JPSA 3V60A 2WXOA 4RNAA 4BZAA 1WJUA 3AE4B 1LGRA 4MGKE 4A8XC 5E6JA 4MJSA 4B95A 2KO3A 4LLGM 2LGDA 4ZRKA 2KOXA 3OJ3A 2Q5WD 4E3CA 1V2YA 4LCDE 1MJDA 2KJHB 3JW0X 4XE0A 3I9V1 3M63B 4BBNF 1SB3C 2EELA 2ZNVC 2JSVX 2WU5B 2H89B 5BYSA 1TS4A 3HVDA 3H9DA 1RRBA 2BYVE 3KUDB 5J2RA 3ZTCA 2JZZA 1QOGA 4BKTA 4K7WA 2N9XA 3QK0A 2JT4B 2CS4A 2NPTB 3BK2A 3V3XA 4HDOA 3SDLC 2QMTA 3ENEA 1LXDA 3VUYA 4BFRA 3GZNB 1JRUA 3AE2B 2BQQA 4OVZA 2K25A 1OQRA 3RCZA 4A3PA 3MHSD 2IO2B 3HUIA 2MEKA 1QT9A 3NVZA 1JWSD 4N6EB 1L5PA 1WF9A 3H8HA 2WQYB 3PZDA 4HKZE 2MA9B 4YSZB 3H7PB 4WAAA 1J7AA 4HKQA 2M1MA 1TYGB 2O2VB 2CJNA 2KC1A 1NI3A 1V9JA 2K9XA 2M0XA 1UZXB 2KX3A 3B0AA 2KFKB 2M19A 2LRUA 3V6CB 3DQVA 3W5UB 2W54A 3OJ4B 4LNFA 4REZA 1DOYA 4ZRQA 1XCTL 2MBBB 2G1EA 4HDQA 1C79A 3CMMB 3MC0B 3N32A 2VRRB 1PDXA 2K22A 1M94A 2V3NA 4F7ZA 4ZHOA 4A90A 2KNBA 3QC8B 3UI3A 4LTUA 1Q1OA 2N9LA 3L17A 3DOWA 3PVLA 1ZGUB 1RM6C 1P98A 3NRZA 4BVUC 3GB1A 4Q2JA 3SR6A 2N1WA 2GBRA 2ZCCA 4KDLB 1WGKA 3AEBB 3AN1A 1V6EA 1JCKB 3Q8BA 3Q2AC 4P16A 2V1YA 2Y3AA 3AEAB 4YSXB 1B9RA 1ZOYB 5CHWA 4ZRPA 3MTNB 2Z0DB 1D5XC 1V49A 4II3B 5AZGA 1FMAD 1HEZE 3N9YC 3EC8A 5TSSA 3VUXA 4ITKA 3ZNID 1GC6A 2Y5PA 2HJ8A 2WHIA 1CK1A 5IP4D 4PT5A 2NVUI 1F9JA 2AQ3B 2Z0EB 1FNWA 4IC7B 3PZ8A 4KIKB 2MLBA 2KWDA 5AZHA 1WGDA 2RPQA 4JQWC 1RAXA 3A4SC 4DXFA 3KQ4A 3R2IA 2WP9B 3U52E 3ZIMA 1JW9D 5D7GA 4IM3A 4USAA 1N62A 1YQ3B 4JGHB 3QIJA 4W9EA 1Q5WB 4AJYB 3NHEB 2WXHA 4YT0B 3KVFB 4YXDB 2MX2A 2NBUA 4E71A 4ZHPA 1WH3A 2KTRA 4RM9A 3ZTDA 4W9KA 4WAFA 2BS3B 1VLBA 2WU2B 4BKSD 3QQ8B 3DVGX 1A70A 1ET9A 4NJ7A 3OAWA 4F1SA 2AWTA 2L00B 1SSNA 1TKYA 2R61A 3RT3B 2AEHA 4W9CA 1UWXA 5EE1A 2RD0A 3R3MA 3DBRB 1EUVB 2FCNA 1E0ZA 4KGSA 1IPGA 1QQRA 2WXQA 3APFA 2C7NB 1TBEA 2BGFA 2D10A 4HCNB 2J7QB 3TBLD 4C7ZA 2E6XA 2N7DA 1UF0A 2DAJA 4PK1A 1MI0A 5IN7A 3B08A 1YQ4B 1R7SA 2LEKA 2BT6A 4G0NB 1SF0A 3X23A 4GSWA 2A4ZA 3DHHC 1WGHA 2Z8LA 4AWJA 3C19A 3DVNU 2IDYA 3EGRA 5EE3A 1WX7A 4BOZB 2C7MB 4MM3B 4IM2A 2IGDA 2C9WB 4RGMA 5MPOA 4JWUC 1YN4A 4IUMB 1C76A 4YTPB 1FEHA 4PYZA 1MHXA 3FKYA 4A9AA 2O6VB 5BMHA 5C2TB 2NR2A 3A4RA 3APCA 4C00A 5LXHA 1E9MA 2XN9C 2HTME 4BKGA 3B1LX 4MEMA 3SHQA 2GB1A 2PIAA 4DQOC 3AEDB 2XK5A 2G45B 3EFCA 1SIFA 3PGEA 2D3BA 2YLMA 3QWZB 5T8IA 2MW5A 2J0KA 4NY0A 3RN9C 3I57A 3P4SB 2WDVB 4D2KA 3ZUNA 4URKA 2RDBC 2WWZA 3CWIA 5E6NA 1SE4A 2LMCA 2Z59B 1AYFA 2WDQB 3DBLB 4OZCA 5BMIA 4M0WB 4C4VA 3TL5A 3L54A 3U7DA 3LB8C 3RFZB 4ICUA 3ABVB 3X0WA 4W9FA 1ENFA 3FAHA 2KT7A 2JXXA 1P7FA 1C4PA 1FCCC 2AQ1B 2GBNA 4W9IA 1D5MC 3WA0A 3QARA 2L0TA 3HRDD 4JWSC 2JZ3B 3RPFC 2JF5A 2JZPA 4KKJA 4EE2A 2HTHA 2L32A 2W9NA 4GDKB 2PJHA 2HDEA 3PS6A 3GE8C 4LNKA 3TEXA 4GOCA 2DX5B 4NAWB 5CHFA 1WR1A 3BYTB 1L0YB 2WDRB 2ZZPB 2GLSA 1BMLC 2WXIA 1FD6A 2C7HA 4IM0A 2BS4B 4MSQB 1V5OA 4LDTB 3LDZE 3VTWA 2KD0A 2GOWA 3VH3B 2M17A 2CR5A 3QAQA 1XQQA 3AH7A 4DXAB 3LXFA 3ZRFA 2FE8A 1K8RB 4GLSC 3SEBA 1FRRA 4IG7B 2SAKA 3PT2B 4FADA 2BWFA 3AM9A 3HHMA 3SD5A 2KWCA 4HEA1 1XLQA 2FCSA 3HVZA 1AWDA 2LJ5A 1FPYA 4DHZE 1KLUD 2PVGC 1TIFA 2KFJA 3UF8A 1RYJA 2KX0A 3RUIB 4L2YA 1PFDA 1E5WA 3ALBA 4TKNA 1XCQL 4P1BC 2ONQA 2NCNA 3I3TB 1E90A 4W9JA 1LM8B 1WJ6A 1YMHE 1WSPA 1S1QB 5LNK1 1YOVB 1FNVA 4ANVA 2MP2A 3KW5B 1QLBB 2WXLA 2TSSA 2BVCA 2DYMA 3EA6A 3T9LA 1C4AA 2XEWA 2MBQA 4M8MA 3A9JA 1YJJA 2WGSA 3NY5A 1V1PA 2IYDB 2OJRA 1J7CA 2UYZB 4XGAB 4WJNA 3KH0A 2LGIA 1Y8RC 4G3XB 1V5TA 1OTRB 2RSUA 2X8XX 1STEA 1NEKB 1T0YA 5D2MB 1ZXHA 2DENB 4CQNA 1YN5A 2X38A 4II2B 5BO4B 2BYTA 4FBJB 2EMSA 4GB9A 4RCOA 3VH4B 1UD7A 1HZ6A 1L6UA 2KHWB 2L76A 4X57B 4GIVA 1HTOA 1V8CA 1C1YB 2PE9A 3W2DA 2WXMA 3RD2A 2KXJA 4JL9A 1I42A 3OWEB 1L6VA 4P6VF 1FXAA 4C80A 1HTQA 2B3AA 4XZ4A 3A33B 2G3QB 2K0PA 2NPTA 2KMAA 2J53A 2DBYA 1QILA 2KJRA 3IVFA 3Q8FA 3MFGA 1WJ4A 4EUTA 1HXYD 2DZMA 1N6ZA 1PGXA 2WXFA 2KVRA 3AEEB 4A6QA 4JE3B 3A1QB 4EZKA 1L0XB 4PS3A 1JWAD 2QDFA 2IPKD 2KN4A 2DLBA 1K52A 4RGNA 5E6PA 2CHZA 3H7PA 4FA6A 4UDUC 2O2VA 5BYQA 1ZXIA 1WJNA 4ZDVA 1SIJA 2WNMA 3QA8A 2BB6A 2ZW1A 5LLIA 1MG8A 2LD9A 4OW0A 4P7IA 5J18A 2WS3B 2KFKA 1WXQA 3U4EG 4MSMB 3TEYA 3KUCB 5KHOA 4A20A 1KRHA 4FJVB 2M8SA 4W9DA 3OLMD 4FLHA 3R8BA 1E7VA 4DBGA 1I4PA 3BVZA 2KC2A 2MJEA 3EUB2 4OZAA 3NOBA 2MQJA 3L16A 1TS2A 1T0SC 3WAMA 4M01A 1JWBD 3WANA 3Q3JA 3N20C 3H1UA 2W55A 4LNNA 4NAMA 1P9DU 2GRIA 4FN2A 3L10B 2NTSA 4PS8A 2ZNVB 2FIDA 4CHKA 1YX5B 1EWCA 3ETRA 2MCNB 4FJZA 5FKAC 4B0EA 2MWSB 4K7UA 2GBJA 1ZDVA 2K39A 3PSEB 3UQAA 1DYQA 2KMMA 2LGXA 1OEYA 2DZKA 2K6DB 2FUG1 3B9JA 2BYFA 2VZKD 3ZVVA 1T3QA 4US8A 1ZW7A 3VHTC 1PGAA 1KM7A 3IT4B 1B1ZA 2JWZA 4NJCA 2CHWA 5G55A 2INCC 4MDKE 2NS5A 4ASWC 2D11A 1PGBA 3BVMA 1CJEA 4KIKA 3JSVB 1F2RC 3AU5A 2KDFB 3QX1A 2A5UA 2V3PA 1EF1A 2ZJDA 2PEAA 2L05A 3O65B 3SU8X 4N9F4 3U30A 1UUPA 2WX0A 5FR3A 1TKGA 2N9EB 2MJ3A 1WGGA 2I1JA 2K5PA 2ZCBA 1F52A 5HG2A 4ICVA 3ZRCA 3V61A 3N1XC 3PHXB 1OQQA 3ZNHB 3Q3NC 1WGYA 2KKCA 4MACA 3P42A 1JRPA 1K50A 2K8HA 1XXGA 1E8XA 4NQLB 1VDVA 2ZW0A 4M00A 2OJWA 1GOZA 1YQBA 2L83A 4WJPA 3DBHI 3PHWB 1NYRA 3ZNZB 3DHIC 3NZSA 3ZYYX 4XDCA 2LXAA 4ANUA 1LQBA 5JXVA 2KACA 3A9KB 1FNUA 2ICIA 5H92C 2KMCA 3SFDB 1TTNA 1GJZA 3TSSA 3AULA 1SJHD 1YN3A 1E8ZA 1UBIA 4DXGA 1QF6A 5L95C 3RNFC 4BOSC 2IBIB 4AUQC 3IFWB 1FM0D 2LWPA 2M4NA 2MJDA 1WGRA 2L8JA 5IOIA 4B0MA 3IBEA 3AU4A 3DDCB 3GE3C 5JZEB 3ZXVA 2PW9A 3MP9A 5D6JB 1I7HA 2NTTA 3Q8EA 3TEZA 1CZPA 2IZVB 3RNBC 5D3DA 2I38A 3Q69A 4MM3A 2DYBA 3L4PA 2BKRB 2AL6A 1ESFA 1AW7A 2K6QA 2WYQA 3BYYB 4B9KA 5IA7A 3EHVA 2YVCA 1VCBA 4DDID 1ZKHA 2LUEA 2R2OA 1IGDA 1BUIC 2IO3B 1SGHA 2O6VA 2KYWA 3AEFB 1T6BX 4KGTA 3VUWA 2FAZA 4W9HA 2KANA 4AOFA 2WXNA 4XWTA 1NVID 3KUZA 2FCMA 2SEBD 3I5JC 5CHVC 2KDIA 4GU2A 4MGZE 4W9LA 4DHJD 4ZRJA 1YX6B 3T8MA 2QIEB 3MHZA 3BZDB 4G11A 2KAJA 1GNUA 3VR9B 2BKFA 2RMMA 5JH5C 1NYQA 3NVVA 4KKIA 1JALA 2NMQA 4M0WA 4WJOA 4ANWA 2EKEC 4FHKA 1HE8A 1A5RA 2WX1A 2MBOA 5GXGB 2WXGA 2K8BA 5TR5A 3U7ZA 3ZDTA 1X1MA 1VZ6A 3AE8B 4TQ0A 1FFUA 1IBXB 4HJGE 2BW2A 1SE3A 1WX8A 4GDKA 4KVGB 3MC8A 1WRIA 1PQSA 2KQSA 2MSED 2KK8A 2FNJB 3AMZA 4NAWA 3CSTA 2LXCA 4JX1C 2PKOA 1H8CA 1EWYC 1N61A 2DWQA 1L7YA 1TKEA 1PYWD 2DHZA 4HRSA 4JLCA 1S3SG 1L4ZB 2LVQA 4A3OA 1AN8A 1GUAB 4EFOA 2AYOB 4WWPA 3W1SA 4AQ7A 3ZNGC 4RGOS 4K7SA 4IWQA 2KTFA 2C5LC 3B2GA 1L4DB 3BIID 2N0SB 4NZLB 4YWGG 3W5VB 1HA5A 3O13A 1JROA 3KLSX 4WJQA 3ZQ4A 1N60A 2MBEA 3BK1A 1WMHB 1WM2A 1E10A 2GMIC 2KJ6A 1WR6E 4WWMA 1GB4A 5G5HA 3K9PB 4YTMB 1WYGA 3GOEA 1WYWB 4YSYB 4ARIA 2BB5A 3CIRB 4IWPA 5DCNA 1L0VB 2NBWB 2JY6A 3VVWB 1XLNA 2KDMA 3PREA 3N1YC 1NBFC 1GB1A 2QJLA 3KWVA 3UIPB 4H2AA 4M8NA 5IO9A 4GDLB 1FRDA 3U2SC 4YL8A 3J9CA 1YNTE 1F2RI 1JWMD 4JIOU 3RNAC 2JRHA 4LJPB 4NPNA 1BT0A 5L83A 3Q14C 3IG3A 1WXMA 3VR8B 3RI7C 2GBMA 2XBBC 1R4MI 4WQOB 1TT5B 3T3NA 1EF5A 3N30A 4LNOA 3ZW3A 3QHTA 4HROA 1DOIA 5DPSA 1FXTB 4EOYA 2WXPA 3RZWC 3Q6BA 3AB5A 3UIOB 3ZKJC 4TV3A 5CTRC 2IJ0A 3R66C 1OEYJ 2JYEA 2J42A 2QILA 3PPAA 5AUKA 5C3JB 1WXSA 3UINB 2IY0B 2PE6B 3LYYA 1J0GA 3DBRI 1N5XA 3IT6B 4WQMA 4WWOA 3VFKA 1CMXB 2V3SA 1G6JA 2JXTA 2BYEA 2D5GA 2CKHB 3VXWA 2V4LA 2RR9A 2JWUA 4DK5A 1KOTA 4KX6B 3Q8AA 3JYUA 3KYDD 1RLFA 1P0RA 1SE2A 2K8CA 1KFYB 3IHPC 3I63C 1E7PB 2R2QA 3ML8A 1ROEA 3WALA 4J3OD 3HM6X 1NENB 1WFYA 5G5GA 3Q3FA 1QKZA 2K1FA 4AP4C 4L23A 3A1QA 1R4NI 4EZLA 1TY2A 5HHDG 3TCAA 1WWTA 3R2TA 2YEPF 2KDEB 1J8CA 5D3IB 3ONSA 2OHFA 1I4XA 2W82A 4FHJA 3P4PB 4G50A 2XNAC 3EECA 1WXVA 2LUMA 3Q3MC 5AEKB 1WZ3A 1UBQA 1E6EB 4TUUA 2FIFA 3L13A 2G4DB 1KLGD 2LJIA 1XEEA 4RMAA 3E9SA 1VZ7A 1SJED 1ZPSA 1VJKA 4O1NA 2L3ZA 4ANXA 4GGQA 2HD5B 3FILB 3AE5B 1FCLA 3PLVA 4OHJA 1QOAA 1UGMA 5CX3A 1RWSA 4L1BA 2PMVA 1C77A 1T0QC 3ECIA 1IYFA 2LVOA 1LFDA 3DBLI 1I4HA 3RYTA 3RNCC 5JHAA 1QOFA 3E56A 1Q10A 1XD3B 2WLBA 2J4XA 3DPDA 4M02A 2KLGA 2VZKB 1C78A 2KWVB 1RFAA 1ISNA 4J6IA 3BVGA 1T0RC 3AE1B 1WE7A 3UGBB 3WIMA 4ACFA 3P2BA 2DZIA 2CHXA 1FFVA 4MJSB 2LGYA 3URYA 3V62A 2RDHA 2KVZA 3VTUA 4K3BA 5DPWA 1V1OA 2Y5BB 2WXJA 4R3DA 1WIAA 1Z5SB 3GS2A 3SFEB 2E3TA 2PPHA 3VQIA 4TSSA 1BXTA 2KWUB 3DWMA 3T3OA 3NZUA 3N1ZC 4WIPA 3DVGY 2NBVB 4YTNB 1UNSA 4K1RB 3TMPB 4EZJA 4AS1A 1DOXA 4KDIC 4CYEA 1RFKA 1GG3A 3JSVA 2KZRA 3HK0A 2N1VA 3TIXA 1EO6A 3IAS1 2HE7A 3VRAB 1TZ1A 2IO0B 1EU4A 4XX5A 3Q8CA 5D94A 4DHZB 2HJ1A 4HK2A 2JQRB 3UQBA 2EKIA 2JRIB 1N63A 3C0RB 4BKSA 1P1AA 2INNE 4C56C 2FCQA 4HPLB 3ZDMC 1VR9A 4F8CB 1WE6A 2L7RA 2UWQA 1F0ZA 1VZ8A 4LNIA 4XDDA 4MH0E 4I6LB 2PLPA 4WURA 1EU3A 3RZFA 3DWGC 5G2NA 2JPHA 5HI1A 1XT9B 3M95A 2MH7A 1N5WA 2JU6X 3N3KB 1E8WA 5EDSA 1UWMA 2AL3A 3U8ZA 2KLCA 3L0WB 3OG5A 4QAYA 2J0JA 4ZOHC 2M0AA 4BAXA 4FULA 3A9KA 3AE7B 1HQRD 4XC2A 5BMGA 4HLEA 2LHEA 3M3JA 2RDGA 1MVKA 2BTEA 4RF0A 1KLVA 4GXBA 1KH0A 2LHDA 5HKHA 2QHOA 1IP9A 2PTLA 3BWUD 1H4RA 4OVVA 1D6EC 4TMAB 2Y5CA 1OQYA 1FXIA 2DYOA 4W9GA 2V9HA 5J17A 4P1CC 2MRPA 3NZ3A 2I1KA 4HXDA 3DHGC 5C23A 1ET6A 1ZUD2 1TS5A 4TQ1A 3PTFC 4ARCA 1XLPA 1UELA 4RF1A 1WX9A 1GPXA 4DHJB 1CQVA 3GP7A 1E7UA 3ZXRA 1R4MB 2LVPA 2WXRA 4N59A 3JVZX 4RH6A 2UU7A 1YD8U 1VD2A 3MJWA 4NQKE 1T5XD 1MFWA 1XF5L 4K81A 3K9OB 3HM3A 4GMVA 1K51A 3BINA 1AARA 1V80A 1MG4A 2M56B 2LFIA 4ZYNA 1J7BA 2QC8A 1KJTA 4KGRA 2DNFA 2V4IB 3DVNV 4S17A 4FXCA 3VTVA 3ZJUA 4HJKA 2GBKA 1F1HA 2ZEQA 1C9FA 4IOIE 5FR6A 1KTKA 2G9HD 4IW0A 3GZNI 5JHBA 1P7EA 3VAWA 2BF8B 1M4VA 1P3QU 1TS3A 2KTRB 3S2AA 4HPPA 3L08A 4KZ0A 4RM8A 4RGTA 1I35A 2DZJA 4OVUA 1SXTA 1TZOA 2ON8A 4ZRIA 2DAFA 2FBWB 3V05A 2BS2B 3W9CB 1WZ0A 3AEGB 4KZCA 4E74A 4C7YA 3EFUA 3RNEC 1IBXA 2ZPYA 2G4SA 4I6NB 2CU1A 3FC4A 5KHQA 1SE9A 1UGJA 3RMKC 1KF6B 1Q0WB
chains in the Genus database with same CATH topology
4RGNA 1FMAD 1HEZE 3T3NA 3N9YC 5TSSA 1ZE3D 3C8YA 4ITKA 1I4QA 4UDUC 2BBCA 1I4RA 1IUEA 4HROA 5BYQA 1ZXIA 1DOIA 2Y5PA 1SIJA 2WNMA 1VRAB 3B2FA 1CK1A 2WXPA 2RPVA 2BB6A 2ZW1A 4PT5A 3AB5A 2AQ3B 1FNWA 5EE0A 4OW0A 2IJ0A 3PZ8A 2V0GA 2WS3B 1SBBB 2W3RA 1WXQA 2JYEA 3ZJVA 2J42A 3U4EG 1ACCA 2KWDA 2QILA 5AUKA 5C3JB 3TEYA 1F77A 2AX5A 2J52A 4DXFA 3KQ4A 3R2IA 3LYYA 2WP9B 3U52E 1KRHA 2H88B 4IDIA 3PO0A 4US9A 1JW9D 1N5XA 3IT6B 4WQMA 1ZP0B 5D7GA 3R8BA 1HZ5A 4USAA 1I4PA 2JXTA 3BVZA 1N62A 1YQ3B 2MJEA 3EUB2 4OZAA 1MPEA 2D5GA 5EE9A 2WXHA 1TS2A 1FO4A 4YT0B 2JWUA 4LK0M 4KX6B 4WH4A 1JWBD 3Q8AA 4YXDB 2N9KA 2W55A 4NAMA 4ZHPA 2GRIA 1EM7A 2INPE 1OFFA 2NTSA 1JMLA 1SE2A 1PUTA 4WAFA 2BS3B 1KFYB 1VLBA 1E7PB 2WU2B 1ROEA 1A70A 4J3OD 1EWCA 1YJIA 1ET9A 1MHHE 3ETRA 1NENB 2IGGA 4IKGA 2JX5A 2B76B 2CJOA 3P4RB 5G5GA 2L52A 5FKAC 4B0EA 1SSNA 2CU3A 1TKYA 1I4GA 2IGHA 2R61A 1QKZA 4L23A 1SEBD 1ZDVA 1TY2A 1UWXA 5EE1A 5HHDG 1DYQA 2KMMA 2QSDA 1JWUD 2FUG1 2KQ4X 3B9JA 1WWTA 3R2TA 2VZKD 2YEPF 1T3QA 2ACZB 5D3IB 4US8A 1E0ZA 4KGSA 1QQRA 2OHFA 1I4XA 2W3SA 2W82A 3P4PB 1PGAA 2WXQA 2XNAC 1GAQB 2WXKA 3TEWA 1ZDXA 3KWLA 3P63A 3IT4B 4C7ZA 1B1ZA 2E6XA 2LUMA 4NJCA 3IXSA 1E6EB 1MI0A 1KLGD 2LJIA 1K53A 1R7SA 1YQ4B 1XEEA 2LEKA 3E9SA 4XWWA 1PGBA 3BVMA 2BT6A 1VZ7A 1CJEA 1SF0A 1SJED 1ZPSA 2K3UA 1F2RC 1VJKA 4O1NA 3ZJTA 3MJ5A 4ZYSA 3NUHB 2V3PA 3NS1A 2Z8LA 2IDYA 3AE9B 2AQ2B 3EGRA 5EE3A 3FILB 3AE5B 1QOBA 1FCLA 4OHJA 4MM3B 1QOAA 2IGDA 1RWSA 1UUPA 4RGMA 5MPOA 5FR3A 1TKGA 2MJ3A 4JWUC 2K5PA 1YN4A 4L1BA 3VRBB 2I2YA 2PMVA 1TY0A 1C77A 5H8YE 1C76A 5HG2A 4YTPB 1FEHA 1JQ4A 2QEJC 1OQQA 1I4HA 1MHXA 1C4CA 1XLOA 4A9AA 5BMHA 1QOFA 5AUIA 3E56A 1Q10A 5C2TB 4MACA 2WLBA 2J4XA 1V97A 3P42A 1JRPA 1K50A 3WCQA 2L1AA 3P1MA 1E9MA 3NVYA 2XN9C 2HTME 1XXGA 2VZKB 1C78A 1VDVA 2ZW0A 4N58A 3BVGA 2GB1A 3AE1B 2PIAA 2GI9A 4DQOC 3AEDB 1FFVA 1GOZA 2L83A 1NYRA 3URYA 4OZBA 2JYTA 2RDHA 5T8IA 3ZYYX 4XDCA 1V1OA 5JXVA 2KACA 2WXJA 4R3DA 3AV8A 5I4DA 1D4BA 1FNUA 2ICIA 3I57A 3P4SB 2WDVB 3GS2A 5H92C 4A55A 3SFEB 4D2KA 2E3TA 3VQIA 3SFDB 4TSSA 1BXTA 3DWMA 4MH8A 3TSSA 3T3OA 3CWIA 1SJHD 1SE4A 1FIQA 1YN3A 2LMCA 4WIPA 4DXGA 1QF6A 4YTNB 3AE6B 1UNSA 1AYFA 5FK9C 2WDQB 2YEPB 2PVOD 4OZCA 4AS1A 5BMIA 1DOXA 1FM0D 3LB8C 3RFZB 2MJDA 3ABVB 1RFKA 4B0MA 3ZGZA 1ENFA 3NVWA 3FAHA 2PW9A 1P7FA 3IAM1 1C4PA 1FCCC 2AQ1B 3IAS1 3MP9A 3VRAB 1IGCA 1I7HA 3P4QB 3TUOA 2NTTA 3Q8EA 1D5MC 3TEZA 1EU4A 1CZPA 3FILA 5D3DA 3HRDD 2I38A 3Q8CA 3Q69A 4JWSC 4RFBA 1D5ZC 3L4PA 1XO3A 2JQRB 3PZ7A 3RPFC 2JZPA 4KKJA 1ESFA 4EE2A 2EKIA 1AW7A 2L32A 1N63A 2OEDA 1TJEA 3BYYB 4GDKB 2INNE 2HDEA 4C56C 1VR9A 4MT5A 3TEXA 5BYRA 1IGDA 1BUIC 1F0ZA 2N7JA 1DGJA 4NAWB 1VZ8A 3BYTB 1L0YB 2WDRB 4XDDA 1Y56A 1BMLC 2WXIA 3AECB 1FD6A 3AE3B 1T6BX 3AEFB 4KGTA 2PLPA 4WURA 5HFYA 1EU3A 1LO5D 2BS4B 3DWGC 1V1PB 5HI1A 4JPSA 2WXOA 2MH7A 4RNAA 1N5WA 2WXNA 3AE4B 4XWTA 4A8XC 1NVID 5E6JA 2JU6X 3AH7A 1UWMA 4LLGM 2SEBD 3LXFA 2Q5WD 2FE8A 4GLSC 2QIEB 3MHZA 4XE0A 4ZOHC 3BZDB 3I9V1 2M0AA 2KAJA 3SEBA 1SB3C 2EELA 1FRRA 2JSVX 3AE7B 3VR9B 1HQRD 2SAKA 2WU5B 5BMGA 3AM9A 2RMMA 2H89B 5BYSA 1TS4A 3HVDA 1NYQA 2LHEA 2RDGA 1MVKA 3NVVA 4KKIA 2BTEA 4RF0A 4HEA1 1XLQA 1JALA 3HVZA 1AWDA 2NMQA 1QOGA 4M0WA 1KH0A 2LHDA 1KLUD 2PVGC 3BK2A 3V3XA 2PTLA 3BWUD 1RYJA 2QMTA 1D6EC 4TMAB 4L2YA 5GXGB 2Y5CA 1PFDA 3AE2B 4OVZA 2WXGA 1XCQL 2ONQA 1FXIA 1OQRA 2DYOA 3U7ZA 1VZ6A 3AE8B 1YMHE 3NZ3A 1WSPA 3HUIA 2MEKA 4TQ0A 1QT9A 1FFUA 1IBXB 3NVZA 4HJGE 5LNK1 2BW2A 1JWSD 1SE3A 1FNVA 1ET6A 1ZUD2 1TS5A 4N6EB 1QLBB 1L5PA 2WXLA 3H8HA 2WQYB 2TSSA 4TQ1A 1WRIA 3AMZA 2DYMA 3EA6A 4ARCA 1XLPA 4HKZE 1C4AA 4RF1A 4YSZB 1GPXA 1J7AA 4HKQA 1CQVA 1YJJA 3GP7A 1TYGB 1V1PA 4JX1C 2PKOA 1J7CA 2CJNA 1EWYC 2WXRA 4N59A 1N61A 2DWQA 1NI3A 1TKEA 1PYWD 2LGIA 4RH6A 2K9XA 4HRSA 1L4ZB 1NEKB 1STEA 1ZXHA 1AN8A 4CQNA 1YN5A 1T5XD 2X38A 3W1SA 4AQ7A 2M19A 1XF5L 4RGOS 2BYTA 1K51A 3W5UB 2W54A 4RCOA 2M56B 3B2GA 4REZA 1L4DB 1DOYA 3BIID 1HZ6A 1L6UA 1XCTL 4ZRQA 2LFIA 2N0SB 4NZLB 4YWGG 1J7BA 3W5VB 4KGRA 1HA5A 3O13A 2G1EA 1JROA 1C79A 3KLSX 3ZQ4A 2V4IB 3MC0B 1V8CA 4FXCA 3ZJUA 3W2DA 2WXMA 1PDXA 2K22A 1N60A 2V3NA 3BK1A 4ZHOA 4A90A 3OWEB 1L6VA 4P6VF 1FXAA 4C80A 1E10A 1C9FA 4IOIE 3UI3A 4WWMA 4LTUA 1GB4A 1KTKA 5G5HA 2G9HD 4YTMB 1WYGA 2K0PA 1P7EA 2N9LA 1M4VA 4YSYB 2J53A 2DBYA 2BB5A 3CIRB 4ARIA 1TS3A 1QILA 1RM6C 1L0VB 4RGTA 3NRZA 3Q8FA 1XLNA 3MFGA 1HXYD 1SXTA 2KDMA 1TZOA 2ON8A 3GB1A 4Q2JA 3SR6A 1GB1A 2QJLA 3KWVA 2FBWB 3V05A 1PGXA 2BS2B 3W9CB 4H2AA 3AEGB 2WXFA 3AEEB 4GDLB 4C7YA 1FRDA 1WGKA 3U2SC 4A6QA 3J9CA 3AEBB 1YNTE 3AN1A 1IBXA 4JE3B 1F2RI 1JWMD 1JCKB 3FC4A 1L0XB 3Q8BA 4YSXB 1UGJA 2Y3AA 3AEAB 4P16A 1B9RA 1ZOYB 3VR8B 1KF6B 1JWAD 4ZRPA 2IPKD 2KN4A 1D5XC 2DLBA 1K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP9 A;  1IBX B;  1HEZ E;  1IGC A;  4HJG E;  1MI0 A;  1K53 A;  3FIL A;  1PGB A;  2I38 A;  1F2R C;  4HKZ E;  2JZP A;  2RPV A;  2ZW1 A;  2OED A;  3FIL B;  1FCL A;  2IGD A;  1IGD A;  2N7J A;  2KWD A;  2LGI A;  1FD6 A;  2J52 A;  4KGT A;  2PLP A;  5HFY A;  2I2Y A;  1ZXH A;  5HG2 A;  5HI1 A;  1XF5 L;  1MHX A;  1HZ5 A;  2JXT A;  1K51 A;  5BMH A;  1Q10 A;  1MPE A;  4MAC A;  2JU6 X;  4OZA A;  1K50 A;  1HZ6 A;  1XCT L;  2JWU A;  4KGR A;  4WH4 A;  2ZW0 A;  4GLS C;  2N9K A;  2GB1 A;  1EM7 A;  2GI9 A;  2EEL A;  1JML A;  2JSV X;  1C9F A;  4IOI E;  3UI3 A;  1GB4 A;  5BMG A;  2RMM A;  4OZB A;  2K0P A;  1P7E A;  2N9L A;  2J53 A;  2LHE A;  1MHH E;  1MVK A;  2IGG A;  4IKG A;  5JXV A;  2KAC A;  1D4B A;  2NMQ A;  2IGH A;  4D2K A;  1QKZ A;  1KH0 A;  2KDM A;  2LHD A;  2ON8 A;  3GB1 A;  1GB1 A;  1UWX A;  5HHD G;  1PGX A;  3V3X A;  2QSD A;  2PTL A;  2KQ4 X;  2QMT A;  4KGS A;  4OZC A;  1YNT E;  5BMI A;  1IBX A;  1F2R I;  1PGA A;  1XCQ L;  2ONQ A;  2LUM A;  2PW9 A;  2KN4 A;  1YMH E;  1P7F A;  1K52 A;  1FCC C; 
#chains in the Genus database with same CATH topology
 1R4N B;  1ZE3 D;  3C8Y A;  1I4Q A;  4PS7 A;  1WI0 A;  4DWF A;  2BBC A;  1I4R A;  1IUE A;  4KSK C;  1VRA B;  3B2F A;  5DPR A;  3PV1 A;  3NJT A;  4K3C A;  2RPV A;  1V81 A;  2LZ6 A;  2ZPN A;  2IND C;  2J0M A;  5EE0 A;  2FUH B;  2VH2 A;  2V0G A;  2N7E A;  1SBB B;  2W3R A;  3ZJV A;  3NS8 A;  1ACC A;  3M62 B;  4WWN A;  3ML9 A;  3CF6 E;  1F77 A;  2AX5 A;  2J52 A;  2H88 B;  4IDI A;  4HWI B;  3PO0 A;  4US9 A;  4EKU A;  1ZP0 B;  4S0R A;  1HZ5 A;  3PRM B;  1YIW A;  3BY4 B;  4GN1 A;  2L0F A;  4KSL C;  1WMH A;  1MPE A;  3VDZ A;  5EE9 A;  3CSF A;  2IO1 B;  1WY8 A;  1FO4 A;  3W1S C;  4LK0 M;  3D32 A;  3PLU A;  4WH4 A;  2LGS A;  4NNJ B;  3R7R A;  4FJY A;  2N9K A;  1EM7 A;  2INP E;  1OFF A;  1JML A;  1PUT A;  5AZF A;  2ZVO A;  2N4F A;  1NDD A;  1YJI A;  1C3T A;  1UH6 A;  1MHH E;  2IGG A;  4IKG A;  4GDL A;  2JX5 A;  2B76 B;  2CJO A;  3P4R B;  2L52 A;  1GC7 A;  2XK5 B;  3LJ3 A;  1J19 A;  2CU3 A;  1I4G A;  2IGH A;  3AXC A;  2O6V D;  2JVC A;  2BPS A;  1SEB D;  2QSD A;  1JWU D;  2KQ4 X;  5E6O A;  2ACZ B;  2MHJ A;  2W3S A;  1GAQ B;  2WXK A;  3TEW A;  1ZDX A;  2REX A;  3KWL A;  3P63 A;  3H7S A;  4AJW A;  3IXS A;  4MEL A;  3DCG A;  4C4V B;  1K53 A;  4XWW A;  1WM3 A;  4LJO B;  2WDT B;  4XYC A;  2K3U A;  3AI5 A;  3Q3O C;  3ZJT A;  3MJ5 A;  4IWO A;  4ZYS A;  1WXA A;  3NUH B;  3NS1 A;  2KN5 A;  3AE9 B;  2AQ2 B;  3NG0 A;  4MGI E;  2QCZ A;  1QOB A;  5GMV A;  2IY1 B;  3QCA A;  3VRB B;  2I2Y A;  4KV2 A;  2MBH A;  3V6E B;  5DPT A;  1TY0 A;  4PYU A;  5H8Y E;  1YJ1 A;  1JQ4 A;  2QEJ C;  1C4C A;  2C60 A;  1XLO A;  2D3A A;  3PRP B;  2N9P C;  5AUI A;  1V97 A;  2KQ7 A;  3WCQ A;  2L1A A;  3P1M A;  4NJ6 A;  3TJP A;  3NVY A;  4N58 A;  5IKC M;  3MC9 A;  2GI9 A;  3APD A;  4BBN C;  2D2Q A;  2KDB A;  2LAS A;  4OZB A;  2JYT A;  5LXI B;  4HPM B;  1L2N A;  4LDT D;  1QZE A;  3AV8 A;  3WAP A;  5I4D A;  2BWE S;  3RUL A;  1D4B A;  3PRZ A;  4A55 A;  1U4A A;  3H6N A;  3KYC D;  4MH8 A;  1WRD B;  1D3Z A;  1FIQ A;  3HIZ A;  3AE6 B;  5FK9 C;  2YEP B;  2PVO D;  4DDG D;  2RGF A;  2D07 B;  3R7Q A;  3RNG C;  3ZGZ A;  3NVW A;  1OGW A;  2LRW A;  3ZO5 B;  3IAM 1;  1Z2M A;  4HVB A;  2D3C A;  3QJZ A;  1IGC A;  3TUO A;  1V86 A;  3P4Q B;  4B6W A;  2ASQ A;  3FIL A;  1TGZ B;  4RFB A;  2JUO A;  4MGY E;  1D5Z C;  3DBS A;  5IAA C;  5C1Z A;  3DBH B;  1XO3 A;  3PZ7 A;  4I6P A;  2D3G A;  2OED A;  1TJE A;  3W1Y A;  2ZVN A;  2MP2 B;  4MT5 A;  1E8Y A;  5BYR A;  4EEW A;  2N7J A;  1DGJ A;  2VH1 A;  3WAO A;  2LI5 A;  1Y56 A;  2EMT A;  3AEC B;  3AE3 B;  2OOB B;  3ZLZ A;  4CO7 A;  5HFY A;  3A9J B;  1NI2 A;  1LO5 D;  4HCP B;  1V1P B;  4JPS A;  3V60 A;  2WXO A;  4RNA A;  4BZA A;  1WJU A;  3AE4 B;  1LGR A;  4MGK E;  4A8X C;  5E6J A;  4MJS A;  4B95 A;  2KO3 A;  4LLG M;  2LGD A;  4ZRK A;  2KOX A;  3OJ3 A;  2Q5W D;  4E3C A;  1V2Y A;  4LCD E;  1MJD A;  2KJH B;  3JW0 X;  4XE0 A;  3I9V 1;  3M63 B;  4BBN F;  1SB3 C;  2EEL A;  2ZNV C;  2JSV X;  2WU5 B;  2H89 B;  5BYS A;  1TS4 A;  3HVD A;  3H9D A;  1RRB A;  2BYV E;  3KUD B;  5J2R A;  3ZTC A;  2JZZ A;  1QOG A;  4BKT A;  4K7W A;  2N9X A;  3QK0 A;  2JT4 B;  2CS4 A;  2NPT B;  3BK2 A;  3V3X A;  4HDO A;  3SDL C;  2QMT A;  3ENE A;  1LXD A;  3VUY A;  4BFR A;  3GZN B;  1JRU A;  3AE2 B;  2BQQ A;  4OVZ A;  2K25 A;  1OQR A;  3RCZ A;  4A3P A;  3MHS D;  2IO2 B;  3HUI A;  2MEK A;  1QT9 A;  3NVZ A;  1JWS D;  4N6E B;  1L5P A;  1WF9 A;  3H8H A;  2WQY B;  3PZD A;  4HKZ E;  2MA9 B;  4YSZ B;  3H7P B;  4WAA A;  1J7A A;  4HKQ A;  2M1M A;  1TYG B;  2O2V B;  2CJN A;  2KC1 A;  1NI3 A;  1V9J A;  2K9X A;  2M0X A;  1UZX B;  2KX3 A;  3B0A A;  2KFK B;  2M19 A;  2LRU A;  3V6C B;  3DQV A;  3W5U B;  2W54 A;  3OJ4 B;  4LNF A;  4REZ A;  1DOY A;  4ZRQ A;  1XCT L;  2MBB B;  2G1E A;  4HDQ A;  1C79 A;  3CMM B;  3MC0 B;  3N32 A;  2VRR B;  1PDX A;  2K22 A;  1M94 A;  2V3N A;  4F7Z A;  4ZHO A;  4A90 A;  2KNB A;  3QC8 B;  3UI3 A;  4LTU A;  1Q1O A;  2N9L A;  3L17 A;  3DOW A;  3PVL A;  1ZGU B;  1RM6 C;  1P98 A;  3NRZ A;  4BVU C;  3GB1 A;  4Q2J A;  3SR6 A;  2N1W A;  2GBR A;  2ZCC A;  4KDL B;  1WGK A;  3AEB B;  3AN1 A;  1V6E A;  1JCK B;  3Q8B A;  3Q2A C;  4P16 A;  2V1Y A;  2Y3A A;  3AEA B;  4YSX B;  1B9R A;  1ZOY B;  5CHW A;  4ZRP A;  3MTN B;  2Z0D B;  1D5X C;  1V49 A;  4II3 B;  5AZG A;  1FMA D;  1HEZ E;  3N9Y C;  3EC8 A;  5TSS A;  3VUX A;  4ITK A;  3ZNI D;  1GC6 A;  2Y5P A;  2HJ8 A;  2WHI A;  1CK1 A;  5IP4 D;  4PT5 A;  2NVU I;  1F9J A;  2AQ3 B;  2Z0E B;  1FNW A;  4IC7 B;  3PZ8 A;  4KIK B;  2MLB A;  2KWD A;  5AZH A;  1WGD A;  2RPQ A;  4JQW C;  1RAX A;  3A4S C;  4DXF A;  3KQ4 A;  3R2I A;  2WP9 B;  3U52 E;  3ZIM A;  1JW9 D;  5D7G A;  4IM3 A;  4USA A;  1N62 A;  1YQ3 B;  4JGH B;  3QIJ A;  4W9E A;  1Q5W B;  4AJY B;  3NHE B;  2WXH A;  4YT0 B;  3KVF B;  4YXD B;  2MX2 A;  2NBU A;  4E71 A;  4ZHP A;  1WH3 A;  2KTR A;  4RM9 A;  3ZTD A;  4W9K A;  4WAF A;  2BS3 B;  1VLB A;  2WU2 B;  4BKS D;  3QQ8 B;  3DVG X;  1A70 A;  1ET9 A;  4NJ7 A;  3OAW A;  4F1S A;  2AWT A;  2L00 B;  1SSN A;  1TKY A;  2R61 A;  3RT3 B;  2AEH A;  4W9C A;  1UWX A;  5EE1 A;  2RD0 A;  3R3M A;  3DBR B;  1EUV B;  2FCN A;  1E0Z A;  4KGS A;  1IPG A;  1QQR A;  2WXQ A;  3APF A;  2C7N B;  1TBE A;  2BGF A;  2D10 A;  4HCN B;  2J7Q B;  3TBL D;  4C7Z A;  2E6X A;  2N7D A;  1UF0 A;  2DAJ A;  4PK1 A;  1MI0 A;  5IN7 A;  3B08 A;  1YQ4 B;  1R7S A;  2LEK A;  2BT6 A;  4G0N B;  1SF0 A;  3X23 A;  4GSW A;  2A4Z A;  3DHH C;  1WGH A;  2Z8L A;  4AWJ A;  3C19 A;  3DVN U;  2IDY A;  3EGR A;  5EE3 A;  1WX7 A;  4BOZ B;  2C7M B;  4MM3 B;  4IM2 A;  2IGD A;  2C9W B;  4RGM A;  5MPO A;  4JWU C;  1YN4 A;  4IUM B;  1C76 A;  4YTP B;  1FEH A;  4PYZ A;  1MHX A;  3FKY A;  4A9A A;  2O6V B;  5BMH A;  5C2T B;  2NR2 A;  3A4R A;  3APC A;  4C00 A;  5LXH A;  1E9M A;  2XN9 C;  2HTM E;  4BKG A;  3B1L X;  4MEM A;  3SHQ A;  2GB1 A;  2PIA A;  4DQO C;  3AED B;  2XK5 A;  2G45 B;  3EFC A;  1SIF A;  3PGE A;  2D3B A;  2YLM A;  3QWZ B;  5T8I A;  2MW5 A;  2J0K A;  4NY0 A;  3RN9 C;  3I57 A;  3P4S B;  2WDV B;  4D2K A;  3ZUN A;  4URK A;  2RDB C;  2WWZ A;  3CWI A;  5E6N A;  1SE4 A;  2LMC A;  2Z59 B;  1AYF A;  2WDQ B;  3DBL B;  4OZC A;  5BMI A;  4M0W B;  4C4V A;  3TL5 A;  3L54 A;  3U7D A;  3LB8 C;  3RFZ B;  4ICU A;  3ABV B;  3X0W A;  4W9F A;  1ENF A;  3FAH A;  2KT7 A;  2JXX A;  1P7F A;  1C4P A;  1FCC C;  2AQ1 B;  2GBN A;  4W9I A;  1D5M C;  3WA0 A;  3QAR A;  2L0T A;  3HRD D;  4JWS C;  2JZ3 B;  3RPF C;  2JF5 A;  2JZP A;  4KKJ A;  4EE2 A;  2HTH A;  2L32 A;  2W9N A;  4GDK B;  2PJH A;  2HDE A;  3PS6 A;  3GE8 C;  4LNK A;  3TEX A;  4GOC A;  2DX5 B;  4NAW B;  5CHF A;  1WR1 A;  3BYT B;  1L0Y B;  2WDR B;  2ZZP B;  2GLS A;  1BML C;  2WXI A;  1FD6 A;  2C7H A;  4IM0 A;  2BS4 B;  4MSQ B;  1V5O A;  4LDT B;  3LDZ E;  3VTW A;  2KD0 A;  2GOW A;  3VH3 B;  2M17 A;  2CR5 A;  3QAQ A;  1XQQ A;  3AH7 A;  4DXA B;  3LXF A;  3ZRF A;  2FE8 A;  1K8R B;  4GLS C;  3SEB A;  1FRR A;  4IG7 B;  2SAK A;  3PT2 B;  4FAD A;  2BWF A;  3AM9 A;  3HHM A;  3SD5 A;  2KWC A;  4HEA 1;  1XLQ A;  2FCS A;  3HVZ A;  1AWD A;  2LJ5 A;  1FPY A;  4DHZ E;  1KLU D;  2PVG C;  1TIF A;  2KFJ A;  3UF8 A;  1RYJ A;  2KX0 A;  3RUI B;  4L2Y A;  1PFD A;  1E5W A;  3ALB A;  4TKN A;  1XCQ L;  4P1B C;  2ONQ A;  2NCN A;  3I3T B;  1E90 A;  4W9J A;  1LM8 B;  1WJ6 A;  1YMH E;  1WSP A;  1S1Q B;  5LNK 1;  1YOV B;  1FNV A;  4ANV A;  2MP2 A;  3KW5 B;  1QLB B;  2WXL A;  2TSS A;  2BVC A;  2DYM A;  3EA6 A;  3T9L A;  1C4A A;  2XEW A;  2MBQ A;  4M8M A;  3A9J A;  1YJJ A;  2WGS A;  3NY5 A;  1V1P A;  2IYD B;  2OJR A;  1J7C A;  2UYZ B;  4XGA B;  4WJN A;  3KH0 A;  2LGI A;  1Y8R C;  4G3X B;  1V5T A;  1OTR B;  2RSU A;  2X8X X;  1STE A;  1NEK B;  1T0Y A;  5D2M B;  1ZXH A;  2DEN B;  4CQN A;  1YN5 A;  2X38 A;  4II2 B;  5BO4 B;  2BYT A;  4FBJ B;  2EMS A;  4GB9 A;  4RCO A;  3VH4 B;  1UD7 A;  1HZ6 A;  1L6U A;  2KHW B;  2L76 A;  4X57 B;  4GIV A;  1HTO A;  1V8C A;  1C1Y B;  2PE9 A;  3W2D A;  2WXM A;  3RD2 A;  2KXJ A;  4JL9 A;  1I42 A;  3OWE B;  1L6V A;  4P6V F;  1FXA A;  4C80 A;  1HTQ A;  2B3A A;  4XZ4 A;  3A33 B;  2G3Q B;  2K0P A;  2NPT A;  2KMA A;  2J53 A;  2DBY A;  1QIL A;  2KJR A;  3IVF A;  3Q8F A;  3MFG A;  1WJ4 A;  4EUT A;  1HXY D;  2DZM A;  1N6Z A;  1PGX A;  2WXF A;  2KVR A;  3AEE B;  4A6Q A;  4JE3 B;  3A1Q B;  4EZK A;  1L0X B;  4PS3 A;  1JWA D;  2QDF A;  2IPK D;  2KN4 A;  2DLB A;  1K52 A;  4RGN A;  5E6P A;  2CHZ A;  3H7P A;  4FA6 A;  4UDU C;  2O2V A;  5BYQ A;  1ZXI A;  1WJN A;  4ZDV A;  1SIJ A;  2WNM A;  3QA8 A;  2BB6 A;  2ZW1 A;  5LLI A;  1MG8 A;  2LD9 A;  4OW0 A;  4P7I A;  5J18 A;  2WS3 B;  2KFK A;  1WXQ A;  3U4E G;  4MSM B;  3TEY A;  3KUC B;  5KHO A;  4A20 A;  1KRH A;  4FJV B;  2M8S A;  4W9D A;  3OLM D;  4FLH A;  3R8B A;  1E7V A;  4DBG A;  1I4P A;  3BVZ A;  2KC2 A;  2MJE A;  3EUB 2;  4OZA A;  3NOB A;  2MQJ A;  3L16 A;  1TS2 A;  1T0S C;  3WAM A;  4M01 A;  1JWB D;  3WAN A;  3Q3J A;  3N20 C;  3H1U A;  2W55 A;  4LNN A;  4NAM A;  1P9D U;  2GRI A;  4FN2 A;  3L10 B;  2NTS A;  4PS8 A;  2ZNV B;  2FID A;  4CHK A;  1YX5 B;  1EWC A;  3ETR A;  2MCN B;  4FJZ A;  5FKA C;  4B0E A;  2MWS B;  4K7U A;  2GBJ A;  1ZDV A;  2K39 A;  3PSE B;  3UQA A;  1DYQ A;  2KMM A;  2LGX A;  1OEY A;  2DZK A;  2K6D B;  2FUG 1;  3B9J A;  2BYF A;  2VZK D;  3ZVV A;  1T3Q A;  4US8 A;  1ZW7 A;  3VHT C;  1PGA A;  1KM7 A;  3IT4 B;  1B1Z A;  2JWZ A;  4NJC A;  2CHW A;  5G55 A;  2INC C;  4MDK E;  2NS5 A;  4ASW C;  2D11 A;  1PGB A;  3BVM A;  1CJE A;  4KIK A;  3JSV B;  1F2R C;  3AU5 A;  2KDF B;  3QX1 A;  2A5U A;  2V3P A;  1EF1 A;  2ZJD A;  2PEA A;  2L05 A;  3O65 B;  3SU8 X;  4N9F 4;  3U30 A;  1UUP A;  2WX0 A;  5FR3 A;  1TKG A;  2N9E B;  2MJ3 A;  1WGG A;  2I1J A;  2K5P A;  2ZCB A;  1F52 A;  5HG2 A;  4ICV A;  3ZRC A;  3V61 A;  3N1X C;  3PHX B;  1OQQ A;  3ZNH B;  3Q3N C;  1WGY A;  2KKC A;  4MAC A;  3P42 A;  1JRP A;  1K50 A;  2K8H A;  1XXG A;  1E8X A;  4NQL B;  1VDV A;  2ZW0 A;  4M00 A;  2OJW A;  1GOZ A;  1YQB A;  2L83 A;  4WJP A;  3DBH I;  3PHW B;  1NYR A;  3ZNZ B;  3DHI C;  3NZS A;  3ZYY X;  4XDC A;  2LXA A;  4ANU A;  1LQB A;  5JXV A;  2KAC A;  3A9K B;  1FNU A;  2ICI A;  5H92 C;  2KMC A;  3SFD B;  1TTN A;  1GJZ A;  3TSS A;  3AUL A;  1SJH D;  1YN3 A;  1E8Z A;  1UBI A;  4DXG A;  1QF6 A;  5L95 C;  3RNF C;  4BOS C;  2IBI B;  4AUQ C;  3IFW B;  1FM0 D;  2LWP A;  2M4N A;  2MJD A;  1WGR A;  2L8J A;  5IOI A;  4B0M A;  3IBE A;  3AU4 A;  3DDC B;  3GE3 C;  5JZE B;  3ZXV A;  2PW9 A;  3MP9 A;  5D6J B;  1I7H A;  2NTT A;  3Q8E A;  3TEZ A;  1CZP A;  2IZV B;  3RNB C;  5D3D A;  2I38 A;  3Q69 A;  4MM3 A;  2DYB A;  3L4P A;  2BKR B;  2AL6 A;  1ESF A;  1AW7 A;  2K6Q A;  2WYQ A;  3BYY B;  4B9K A;  5IA7 A;  3EHV A;  2YVC A;  1VCB A;  4DDI D;  1ZKH A;  2LUE A;  2R2O A;  1IGD A;  1BUI C;  2IO3 B;  1SGH A;  2O6V A;  2KYW A;  3AEF B;  1T6B X;  4KGT A;  3VUW A;  2FAZ A;  4W9H A;  2KAN A;  4AOF A;  2WXN A;  4XWT A;  1NVI D;  3KUZ A;  2FCM A;  2SEB D;  3I5J C;  5CHV C;  2KDI A;  4GU2 A;  4MGZ E;  4W9L A;  4DHJ D;  4ZRJ A;  1YX6 B;  3T8M A;  2QIE B;  3MHZ A;  3BZD B;  4G11 A;  2KAJ A;  1GNU A;  3VR9 B;  2BKF A;  2RMM A;  5JH5 C;  1NYQ A;  3NVV A;  4KKI A;  1JAL A;  2NMQ A;  4M0W A;  4WJO A;  4ANW A;  2EKE C;  4FHK A;  1HE8 A;  1A5R A;  2WX1 A;  2MBO A;  5GXG B;  2WXG A;  2K8B A;  5TR5 A;  3U7Z A;  3ZDT A;  1X1M A;  1VZ6 A;  3AE8 B;  4TQ0 A;  1FFU A;  1IBX B;  4HJG E;  2BW2 A;  1SE3 A;  1WX8 A;  4GDK A;  4KVG B;  3MC8 A;  1WRI A;  1PQS A;  2KQS A;  2MSE D;  2KK8 A;  2FNJ B;  3AMZ A;  4NAW A;  3CST A;  2LXC A;  4JX1 C;  2PKO A;  1H8C A;  1EWY C;  1N61 A;  2DWQ A;  1L7Y A;  1TKE A;  1PYW D;  2DHZ A;  4HRS A;  4JLC A;  1S3S G;  1L4Z B;  2LVQ A;  4A3O A;  1AN8 A;  1GUA B;  4EFO A;  2AYO B;  4WWP A;  3W1S A;  4AQ7 A;  3ZNG C;  4RGO S;  4K7S A;  4IWQ A;  2KTF A;  2C5L C;  3B2G A;  1L4D B;  3BII D;  2N0S B;  4NZL B;  4YWG G;  3W5V B;  1HA5 A;  3O13 A;  1JRO A;  3KLS X;  4WJQ A;  3ZQ4 A;  1N60 A;  2MBE A;  3BK1 A;  1WMH B;  1WM2 A;  1E10 A;  2GMI C;  2KJ6 A;  1WR6 E;  4WWM A;  1GB4 A;  5G5H A;  3K9P B;  4YTM B;  1WYG A;  3GOE A;  1WYW B;  4YSY B;  4ARI A;  2BB5 A;  3CIR B;  4IWP A;  5DCN A;  1L0V B;  2NBW B;  2JY6 A;  3VVW B;  1XLN A;  2KDM A;  3PRE A;  3N1Y C;  1NBF C;  1GB1 A;  2QJL A;  3KWV A;  3UIP B;  4H2A A;  4M8N A;  5IO9 A;  4GDL B;  1FRD A;  3U2S C;  4YL8 A;  3J9C A;  1YNT E;  1F2R I;  1JWM D;  4JIO U;  3RNA C;  2JRH A;  4LJP B;  4NPN A;  1BT0 A;  5L83 A;  3Q14 C;  3IG3 A;  1WXM A;  3VR8 B;  3RI7 C;  2GBM A;  2XBB C;  1R4M I;  4WQO B;  1TT5 B;  3T3N A;  1EF5 A;  3N30 A;  4LNO A;  3ZW3 A;  3QHT A;  4HRO A;  1DOI A;  5DPS A;  1FXT B;  4EOY A;  2WXP A;  3RZW C;  3Q6B A;  3AB5 A;  3UIO B;  3ZKJ C;  4TV3 A;  5CTR C;  2IJ0 A;  3R66 C;  1OEY J;  2JYE A;  2J42 A;  2QIL A;  3PPA A;  5AUK A;  5C3J B;  1WXS A;  3UIN B;  2IY0 B;  2PE6 B;  3LYY A;  1J0G A;  3DBR I;  1N5X A;  3IT6 B;  4WQM A;  4WWO A;  3VFK A;  1CMX B;  2V3S A;  1G6J A;  2JXT A;  2BYE A;  2D5G A;  2CKH B;  3VXW A;  2V4L A;  2RR9 A;  2JWU A;  4DK5 A;  1KOT A;  4KX6 B;  3Q8A A;  3JYU A;  3KYD D;  1RLF A;  1P0R A;  1SE2 A;  2K8C A;  1KFY B;  3IHP C;  3I63 C;  1E7P B;  2R2Q A;  3ML8 A;  1ROE A;  3WAL A;  4J3O D;  3HM6 X;  1NEN B;  1WFY A;  5G5G A;  3Q3F A;  1QKZ A;  2K1F A;  4AP4 C;  4L23 A;  3A1Q A;  1R4N I;  4EZL A;  1TY2 A;  5HHD G;  3TCA A;  1WWT A;  3R2T A;  2YEP F;  2KDE B;  1J8C A;  5D3I B;  3ONS A;  2OHF A;  1I4X A;  2W82 A;  4FHJ A;  3P4P B;  4G50 A;  2XNA C;  3EEC A;  1WXV A;  2LUM A;  3Q3M C;  5AEK B;  1WZ3 A;  1UBQ A;  1E6E B;  4TUU A;  2FIF A;  3L13 A;  2G4D B;  1KLG D;  2LJI A;  1XEE A;  4RMA A;  3E9S A;  1VZ7 A;  1SJE D;  1ZPS A;  1VJK A;  4O1N A;  2L3Z A;  4ANX A;  4GGQ A;  2HD5 B;  3FIL B;  3AE5 B;  1FCL A;  3PLV A;  4OHJ A;  1QOA A;  1UGM A;  5CX3 A;  1RWS A;  4L1B A;  2PMV A;  1C77 A;  1T0Q C;  3ECI A;  1IYF A;  2LVO A;  1LFD A;  3DBL I;  1I4H A;  3RYT A;  3RNC C;  5JHA A;  1QOF A;  3E56 A;  1Q10 A;  1XD3 B;  2WLB A;  2J4X A;  3DPD A;  4M02 A;  2KLG A;  2VZK B;  1C78 A;  2KWV B;  1RFA A;  1ISN A;  4J6I A;  3BVG A;  1T0R C;  3AE1 B;  1WE7 A;  3UGB B;  3WIM A;  4ACF A;  3P2B A;  2DZI A;  2CHX A;  1FFV A;  4MJS B;  2LGY A;  3URY A;  3V62 A;  2RDH A;  2KVZ A;  3VTU A;  4K3B A;  5DPW A;  1V1O A;  2Y5B B;  2WXJ A;  4R3D A;  1WIA A;  1Z5S B;  3GS2 A;  3SFE B;  2E3T A;  2PPH A;  3VQI A;  4TSS A;  1BXT A;  2KWU B;  3DWM A;  3T3O A;  3NZU A;  3N1Z C;  4WIP A;  3DVG Y;  2NBV B;  4YTN B;  1UNS A;  4K1R B;  3TMP B;  4EZJ A;  4AS1 A;  1DOX A;  4KDI C;  4CYE A;  1RFK A;  1GG3 A;  3JSV A;  2KZR A;  3HK0 A;  2N1V A;  3TIX A;  1EO6 A;  3IAS 1;  2HE7 A;  3VRA B;  1TZ1 A;  2IO0 B;  1EU4 A;  4XX5 A;  3Q8C A;  5D94 A;  4DHZ B;  2HJ1 A;  4HK2 A;  2JQR B;  3UQB A;  2EKI A;  2JRI B;  1N63 A;  3C0R B;  4BKS A;  1P1A A;  2INN E;  4C56 C;  2FCQ A;  4HPL B;  3ZDM C;  1VR9 A;  4F8C B;  1WE6 A;  2L7R A;  2UWQ A;  1F0Z A;  1VZ8 A;  4LNI A;  4XDD A;  4MH0 E;  4I6L B;  2PLP A;  4WUR A;  1EU3 A;  3RZF A;  3DWG C;  5G2N A;  2JPH A;  5HI1 A;  1XT9 B;  3M95 A;  2MH7 A;  1N5W A;  2JU6 X;  3N3K B;  1E8W A;  5EDS A;  1UWM A;  2AL3 A;  3U8Z A;  2KLC A;  3L0W B;  3OG5 A;  4QAY A;  2J0J A;  4ZOH C;  2M0A A;  4BAX A;  4FUL A;  3A9K A;  3AE7 B;  1HQR D;  4XC2 A;  5BMG A;  4HLE A;  2LHE A;  3M3J A;  2RDG A;  1MVK A;  2BTE A;  4RF0 A;  1KLV A;  4GXB A;  1KH0 A;  2LHD A;  5HKH A;  2QHO A;  1IP9 A;  2PTL A;  3BWU D;  1H4R A;  4OVV A;  1D6E C;  4TMA B;  2Y5C A;  1OQY A;  1FXI A;  2DYO A;  4W9G A;  2V9H A;  5J17 A;  4P1C C;  2MRP A;  3NZ3 A;  2I1K A;  4HXD A;  3DHG C;  5C23 A;  1ET6 A;  1ZUD 2;  1TS5 A;  4TQ1 A;  3PTF C;  4ARC A;  1XLP A;  1UEL A;  4RF1 A;  1WX9 A;  1GPX A;  4DHJ B;  1CQV A;  3GP7 A;  1E7U A;  3ZXR A;  1R4M B;  2LVP A;  2WXR A;  4N59 A;  3JVZ X;  4RH6 A;  2UU7 A;  1YD8 U;  1VD2 A;  3MJW A;  4NQK E;  1T5X D;  1MFW A;  1XF5 L;  4K81 A;  3K9O B;  3HM3 A;  4GMV A;  1K51 A;  3BIN A;  1AAR A;  1V80 A;  1MG4 A;  2M56 B;  2LFI A;  4ZYN A;  1J7B A;  2QC8 A;  1KJT A;  4KGR A;  2DNF A;  2V4I B;  3DVN V;  4S17 A;  4FXC A;  3VTV A;  3ZJU A;  4HJK A;  2GBK A;  1F1H A;  2ZEQ A;  1C9F A;  4IOI E;  5FR6 A;  1KTK A;  2G9H D;  4IW0 A;  3GZN I;  5JHB A;  1P7E A;  3VAW A;  2BF8 B;  1M4V A;  1P3Q U;  1TS3 A;  2KTR B;  3S2A A;  4HPP A;  3L08 A;  4KZ0 A;  4RM8 A;  4RGT A;  1I35 A;  2DZJ A;  4OVU A;  1SXT A;  1TZO A;  2ON8 A;  4ZRI A;  2DAF A;  2FBW B;  3V05 A;  2BS2 B;  3W9C B;  1WZ0 A;  3AEG B;  4KZC A;  4E74 A;  4C7Y A;  3EFU A;  3RNE C;  1IBX A;  2ZPY A;  2G4S A;  4I6N B;  2CU1 A;  3FC4 A;  5KHQ A;  1SE9 A;  1UGJ A;  3RMK C;  1KF6 B;  1Q0W B; 
#chains in the Genus database with same CATH homology
 4RGN A;  1FMA D;  1HEZ E;  3T3N A;  3N9Y C;  5TSS A;  1ZE3 D;  3C8Y A;  4ITK A;  1I4Q A;  4UDU C;  2BBC A;  1I4R A;  1IUE A;  4HRO A;  5BYQ A;  1ZXI A;  1DOI A;  2Y5P A;  1SIJ A;  2WNM A;  1VRA B;  3B2F A;  1CK1 A;  2WXP A;  2RPV A;  2BB6 A;  2ZW1 A;  4PT5 A;  3AB5 A;  2AQ3 B;  1FNW A;  5EE0 A;  4OW0 A;  2IJ0 A;  3PZ8 A;  2V0G A;  2WS3 B;  1SBB B;  2W3R A;  1WXQ A;  2JYE A;  3ZJV A;  2J42 A;  3U4E G;  1ACC A;  2KWD A;  2QIL A;  5AUK A;  5C3J B;  3TEY A;  1F77 A;  2AX5 A;  2J52 A;  4DXF A;  3KQ4 A;  3R2I A;  3LYY A;  2WP9 B;  3U52 E;  1KRH A;  2H88 B;  4IDI A;  3PO0 A;  4US9 A;  1JW9 D;  1N5X A;  3IT6 B;  4WQM A;  1ZP0 B;  5D7G A;  3R8B A;  1HZ5 A;  4USA A;  1I4P A;  2JXT A;  3BVZ A;  1N62 A;  1YQ3 B;  2MJE A;  3EUB 2;  4OZA A;  1MPE A;  2D5G A;  5EE9 A;  2WXH A;  1TS2 A;  1FO4 A;  4YT0 B;  2JWU A;  4LK0 M;  4KX6 B;  4WH4 A;  1JWB D;  3Q8A A;  4YXD B;  2N9K A;  2W55 A;  4NAM A;  4ZHP A;  2GRI A;  1EM7 A;  2INP E;  1OFF A;  2NTS A;  1JML A;  1SE2 A;  1PUT A;  4WAF A;  2BS3 B;  1KFY B;  1VLB A;  1E7P B;  2WU2 B;  1ROE A;  1A70 A;  4J3O D;  1EWC A;  1YJI A;  1ET9 A;  1MHH E;  3ETR A;  1NEN B;  2IGG A;  4IKG A;  2JX5 A;  2B76 B;  2CJO A;  3P4R B;  5G5G A;  2L52 A;  5FKA C;  4B0E A;  1SSN A;  2CU3 A;  1TKY A;  1I4G A;  2IGH A;  2R61 A;  1QKZ A;  4L23 A;  1SEB D;  1ZDV A;  1TY2 A;  1UWX A;  5EE1 A;  5HHD G;  1DYQ A;  2KMM A;  2QSD A;  1JWU D;  2FUG 1;  2KQ4 X;  3B9J A;  1WWT A;  3R2T A;  2VZK D;  2YEP F;  1T3Q A;  2ACZ B;  5D3I B;  4US8 A;  1E0Z A;  4KGS A;  1QQR A;  2OHF A;  1I4X A;  2W3S A;  2W82 A;  3P4P B;  1PGA A;  2WXQ A;  2XNA C;  1GAQ B;  2WXK A;  3TEW A;  1ZDX A;  3KWL A;  3P63 A;  3IT4 B;  4C7Z A;  1B1Z A;  2E6X A;  2LUM A;  4NJC A;  3IXS A;  1E6E B;  1MI0 A;  1KLG D;  2LJI A;  1K53 A;  1R7S A;  1YQ4 B;  1XEE A;  2LEK A;  3E9S A;  4XWW A;  1PGB A;  3BVM A;  2BT6 A;  1VZ7 A;  1CJE A;  1SF0 A;  1SJE D;  1ZPS A;  2K3U A;  1F2R C;  1VJK A;  4O1N A;  3ZJT A;  3MJ5 A;  4ZYS A;  3NUH B;  2V3P A;  3NS1 A;  2Z8L A;  2IDY A;  3AE9 B;  2AQ2 B;  3EGR A;  5EE3 A;  3FIL B;  3AE5 B;  1QOB A;  1FCL A;  4OHJ A;  4MM3 B;  1QOA A;  2IGD A;  1RWS A;  1UUP A;  4RGM A;  5MPO A;  5FR3 A;  1TKG A;  2MJ3 A;  4JWU C;  2K5P A;  1YN4 A;  4L1B A;  3VRB B;  2I2Y A;  2PMV A;  1TY0 A;  1C77 A;  5H8Y E;  1C76 A;  5HG2 A;  4YTP B;  1FEH A;  1JQ4 A;  2QEJ C;  1OQQ A;  1I4H A;  1MHX A;  1C4C A;  1XLO A;  4A9A A;  5BMH A;  1QOF A;  5AUI A;  3E56 A;  1Q10 A;  5C2T B;  4MAC A;  2WLB A;  2J4X A;  1V97 A;  3P42 A;  1JRP A;  1K50 A;  3WCQ A;  2L1A A;  3P1M A;  1E9M A;  3NVY A;  2XN9 C;  2HTM E;  1XXG A;  2VZK B;  1C78 A;  1VDV A;  2ZW0 A;  4N58 A;  3BVG A;  2GB1 A;  3AE1 B;  2PIA A;  2GI9 A;  4DQO C;  3AED B;  1FFV A;  1GOZ A;  2L83 A;  1NYR A;  3URY A;  4OZB A;  2JYT A;  2RDH A;  5T8I A;  3ZYY X;  4XDC A;  1V1O A;  5JXV A;  2KAC A;  2WXJ A;  4R3D A;  3AV8 A;  5I4D A;  1D4B A;  1FNU A;  2ICI A;  3I57 A;  3P4S B;  2WDV B;  3GS2 A;  5H92 C;  4A55 A;  3SFE B;  4D2K A;  2E3T A;  3VQI A;  3SFD B;  4TSS A;  1BXT A;  3DWM A;  4MH8 A;  3TSS A;  3T3O A;  3CWI A;  1SJH D;  1SE4 A;  1FIQ A;  1YN3 A;  2LMC A;  4WIP A;  4DXG A;  1QF6 A;  4YTN B;  3AE6 B;  1UNS A;  1AYF A;  5FK9 C;  2WDQ B;  2YEP B;  2PVO D;  4OZC A;  4AS1 A;  5BMI A;  1DOX A;  1FM0 D;  3LB8 C;  3RFZ B;  2MJD A;  3ABV B;  1RFK A;  4B0M A;  3ZGZ A;  1ENF A;  3NVW A;  3FAH A;  2PW9 A;  1P7F A;  3IAM 1;  1C4P A;  1FCC C;  2AQ1 B;  3IAS 1;  3MP9 A;  3VRA B;  1IGC A;  1I7H A;  3P4Q B;  3TUO A;  2NTT A;  3Q8E A;  1D5M C;  3TEZ A;  1EU4 A;  1CZP A;  3FIL A;  5D3D A;  3HRD D;  2I38 A;  3Q8C A;  3Q69 A;  4JWS C;  4RFB A;  1D5Z C;  3L4P A;  1XO3 A;  2JQR B;  3PZ7 A;  3RPF C;  2JZP A;  4KKJ A;  1ESF A;  4EE2 A;  2EKI A;  1AW7 A;  2L32 A;  1N63 A;  2OED A;  1TJE A;  3BYY B;  4GDK B;  2INN E;  2HDE A;  4C56 C;  1VR9 A;  4MT5 A;  3TEX A;  5BYR A;  1IGD A;  1BUI C;  1F0Z A;  2N7J A;  1DGJ A;  4NAW B;  1VZ8 A;  3BYT B;  1L0Y B;  2WDR B;  4XDD A;  1Y56 A;  1BML C;  2WXI A;  3AEC B;  1FD6 A;  3AE3 B;  1T6B X;  3AEF B;  4KGT A;  2PLP A;  4WUR A;  5HFY A;  1EU3 A;  1LO5 D;  2BS4 B;  3DWG C;  1V1P B;  5HI1 A;  4JPS A;  2WXO A;  2MH7 A;  4RNA A;  1N5W A;  2WXN A;  3AE4 B;  4XWT A;  4A8X C;  1NVI D;  5E6J A;  2JU6 X;  3AH7 A;  1UWM A;  4LLG M;  2SEB D;  3LXF A;  2Q5W D;  2FE8 A;  4GLS C;  2QIE B;  3MHZ A;  4XE0 A;  4ZOH C;  3BZD B;  3I9V 1;  2M0A A;  2KAJ A;  3SEB A;  1SB3 C;  2EEL A;  1FRR A;  2JSV X;  3AE7 B;  3VR9 B;  1HQR D;  2SAK A;  2WU5 B;  5BMG A;  3AM9 A;  2RMM A;  2H89 B;  5BYS A;  1TS4 A;  3HVD A;  1NYQ A;  2LHE A;  2RDG A;  1MVK A;  3NVV A;  4KKI A;  2BTE A;  4RF0 A;  4HEA 1;  1XLQ A;  1JAL A;  3HVZ A;  1AWD A;  2NMQ A;  1QOG A;  4M0W A;  1KH0 A;  2LHD A;  1KLU D;  2PVG C;  3BK2 A;  3V3X A;  2PTL A;  3BWU D;  1RYJ A;  2QMT A;  1D6E C;  4TMA B;  4L2Y A;  5GXG B;  2Y5C A;  1PFD A;  3AE2 B;  4OVZ A;  2WXG A;  1XCQ L;  2ONQ A;  1FXI A;  1OQR A;  2DYO A;  3U7Z A;  1VZ6 A;  3AE8 B;  1YMH E;  3NZ3 A;  1WSP A;  3HUI A;  2MEK A;  4TQ0 A;  1QT9 A;  1FFU A;  1IBX B;  3NVZ A;  4HJG E;  5LNK 1;  2BW2 A;  1JWS D;  1SE3 A;  1FNV A;  1ET6 A;  1ZUD 2;  1TS5 A;  4N6E B;  1QLB B;  1L5P A;  2WXL A;  3H8H A;  2WQY B;  2TSS A;  4TQ1 A;  1WRI A;  3AMZ A;  2DYM A;  3EA6 A;  4ARC A;  1XLP A;  4HKZ E;  1C4A A;  4RF1 A;  4YSZ B;  1GPX A;  1J7A A;  4HKQ A;  1CQV A;  1YJJ A;  3GP7 A;  1TYG B;  1V1P A;  4JX1 C;  2PKO A;  1J7C A;  2CJN A;  1EWY C;  2WXR A;  4N59 A;  1N61 A;  2DWQ A;  1NI3 A;  1TKE A;  1PYW D;  2LGI A;  4RH6 A;  2K9X A;  4HRS A;  1L4Z B;  1NEK B;  1STE A;  1ZXH A;  1AN8 A;  4CQN A;  1YN5 A;  1T5X D;  2X38 A;  3W1S A;  4AQ7 A;  2M19 A;  1XF5 L;  4RGO S;  2BYT A;  1K51 A;  3W5U B;  2W54 A;  4RCO A;  2M56 B;  3B2G A;  4REZ A;  1L4D B;  1DOY A;  3BII D;  1HZ6 A;  1L6U A;  1XCT L;  4ZRQ A;  2LFI A;  2N0S B;  4NZL B;  4YWG G;  1J7B A;  3W5V B;  4KGR A;  1HA5 A;  3O13 A;  2G1E A;  1JRO A;  1C79 A;  3KLS X;  3ZQ4 A;  2V4I B;  3MC0 B;  1V8C A;  4FXC A;  3ZJU A;  3W2D A;  2WXM A;  1PDX A;  2K22 A;  1N60 A;  2V3N A;  3BK1 A;  4ZHO A;  4A90 A;  3OWE B;  1L6V A;  4P6V F;  1FXA A;  4C80 A;  1E10 A;  1C9F A;  4IOI E;  3UI3 A;  4WWM A;  4LTU A;  1GB4 A;  1KTK A;  5G5H A;  2G9H D;  4YTM B;  1WYG A;  2K0P A;  1P7E A;  2N9L A;  1M4V A;  4YSY B;  2J53 A;  2DBY A;  2BB5 A;  3CIR B;  4ARI A;  1TS3 A;  1QIL A;  1RM6 C;  1L0V B;  4RGT A;  3NRZ A;  3Q8F A;  1XLN A;  3MFG A;  1HXY D;  1SXT A;  2KDM A;  1TZO A;  2ON8 A;  3GB1 A;  4Q2J A;  3SR6 A;  1GB1 A;  2QJL A;  3KWV A;  2FBW B;  3V05 A;  1PGX A;  2BS2 B;  3W9C B;  4H2A A;  3AEG B;  2WXF A;  3AEE B;  4GDL B;  4C7Y A;  1FRD A;  1WGK A;  3U2S C;  4A6Q A;  3J9C A;  3AEB B;  1YNT E;  3AN1 A;  1IBX A;  4JE3 B;  1F2R I;  1JWM D;  1JCK B;  3FC4 A;  1L0X B;  3Q8B A;  4YSX B;  1UGJ A;  2Y3A A;  3AEA B;  4P16 A;  1B9R A;  1ZOY B;  3VR8 B;  1KF6 B;  1JWA D;  4ZRP A;  2IPK D;  2KN4 A;  1D5X C;  2DLB A;  1K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...