4C56C

X-ray structure of the complex between staphylococcal enterotoxin b, t cell receptor and major histocompatibility complex class ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
227
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Superantigen Staphylococcal Enterotoxin B in Complex with Tcr and Peptide-Mhc Demonstrates Absence of Tcr-Peptide Contacts.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords T CELL RECEPTOR ALPHA CHAIN
total genus 50
structure length 227
sequence length 235
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c56C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4c56C01
2NTTA 1ESFA 1S5BD 1I4GA 1BCPB 2IJ0A 3BVMA 4OHJA 1LLRD 1PTOC 3V05A 1KTKA 3MFGA 4C56C 1EFID 1FNWA 1BCPD 2XRSD 1LT5D 1YN4A 4RH6A 2XRQD 1PRTD 2O2LD 1S5DD 1PZKD 1SJHD 1EU4A 1AW7A 1V1OA 1JCKB 2IPKD 1TS5A 4O1NA 1HQRD 1PRTC 1L0YB 4L6TB 1SE4A 1CHQD 1YN5A 1ET9A 3BYTB 1TY2A 1RCVD 5ELEA 4ZYSA 1PTOH 1LTSD 1CK1A 1BCPF 1D6EC 1DJRD 3R2TA 1B1ZA 3BVZA 1LTRD 3EA6A 4RGTA 4RGOS 4RGMA 2SEBD 5D3IB 2TSSA 1HXYD 1LT3D 1I4RA 3EFXD 1FGBD 1LT6D 1BCPC 1LTGD 1PTOD 1I4PA 2R61A 1L0XB 3TSSA 1S5CD 4RHSA 1PYWD 2RDHA 1XTCD 1HTLD 1GOZA 1PTOF 3BYYB 5ELDA 1RDPD 3R2IA 1S5ED 2NTSA 5ELBA 1JWSD 4RHRA 1V1PA 4BWGB 1JWUD 1M4VA 2ICIA 2QILA 3O13A 1LTBD 3DWAA 2Z8LA 1LT4D 1G8ZD 1EEID 1D5ZC 1RD9D 4K6LA 4Z9CB 1SE2A 5ELCA 1D5MC 1RF2D 1QILA 1CHPD 4L63B 3SEBA 1BXTA 1I4HA 1MD2D 1SXTA 1TS4A 1HA5A 1LTAD 1UUPA 1PZID 1SEBD 1KLGD 1LO5D 2XNAC 3KLSX 1SE3A 3OWEB 4RGNA 4DXFA 1FD7D 2G9HD 3BZDB 2XN9C 1UNSA 1EU3A 3CHBD 1AN8A 1TS2A 2J4XA 1LTTD 4RFBA 1ENFA 2AQ3B 4TSSA 5I4DA 1F77A 1TS3A 4RCOA 3URYA 1B44D 1JQYD 5ELFA 3MC0B 1D5XC 2RDGA 5D3DA 3R8BA 1I4QA 1EEFD 1TY0A 1LTID 3DWQA 1S5FD 2AQ2B 5TSSA 1XXGA 1JR0D 1YN3A 2WV6D 1FNVA 4UDUC 1CT1D 1DYQA 1JWMD 1SBBB 4NZLB 1STEA 3W2DA 1FNUA 2CHBD 1CQVA 3DWPA 1PTOB 5FKAC 1EWCA 3GP7A 4DXGA 2AQ1B 1I4XA 1KLUD 5FK9C 2QEJC 1ET6A 1PRTF 1PRTB 1SJED 1T5XD 1V1PB 1PZJD 3BVGA
chains in the Genus database with same CATH superfamily
2LS01 3KWLA 1SE8A 4ZUIA 4A3EG 2FXQA 3ITPA 1KNAA 3ZLZA 1B3QA 2AHOB 5C2TB 1BOSA 4LNKA 2JY6A 4AYBG 1KLVA 2FCNA 2G1EA 1GD7A 4X65Q 1PH4A 1AW7A 4CDDC 3J80E 3IG3A 4F8CB 2GBJA 1U4MA 2PCFB 2F0VA 3OSOA 4JI8Q 1GHJA 4QJFA 2F0PA 4IM2A 3PF4A 3ND8A 1VQ6A 2E2JB 3R2TA 3GZNI 4LFBL 1B53A 3QB3A 5EPJA 1QQRA 4PYUA 2M1MA 3FKIG 5C4ZA 4WJ4A 1LTLA 1NAPA 5D14A 2JA7G 1KRTA 3HOVG 1R4QB 1BCPC 2K6AA 1VQNA 4HKQA 4LCDE 3CIRB 3CRKC 1Y8NB 3CMEA 3P75A 2Z4IA 1SLJA 2CHWA 1EFWA 5IP4D 3I56A 3UDIA 3HOXH 2HIVA 3AE4B 4FXKC 1RFAA 4H44C 3DUZA 4ZK9B 2BQQA 3L0OA 2R92H 2AYOB 3S24A 3A1QA 3N52A 2LUEA 4XQNA 3PZ8A 2J0KA 3I72A 1Y8PB 1XLQA 2F0DA 3GTMH 1WZ0A 4PT5A 3U2SC 2H88B 1N60A 1J0GA 3AEVA 4BA2I 4BXXH 3TEWA 2ZXRA 5CV4A 1D5ZC 1Q90A 2UXDQ 3T9LA 4H7BA 1TTNA 1Y1VH 2V3SA 4NJ6A 1C4QA 4I6PA 1WXAA 4GLXA 3TIXA 4EQNA 1IYVA 5EE3A 3KH0A 2L05A 1CQFA 3PIPA 1VMPA 1RM6C 2J0TD 2O2VA 2WFWA 2C9OA 1FFUA 2F1MA 3DM3A 3VH4B 3X23A 3DBSA 3BZCA 1EU3A 1VQAA 3CHBD 2A8VA 1P16A 4DV5L 4HWIB 5M5XH 4PZ7A 5JPNC 1TS3A 1MG8A 3MEFA 3P4PB 2E5LL 4XGAB 1QKZA 4JWSC 1F52A 4TKOB 1G6JA 3TQYA 2NVYH 1EQQA 3PO3G 2CCZA 1OFFA 2FUG1 4KVGB 3K9OB 3AFPA 1N61A 3EN2A 1DOIA 4LNFA 4F7XA 2X8XX 3N1XC 2F0QA 4UDUC 1F2RI 1WGRA 1HFGA 2WP9B 1ILQA 3B08A 3PHWB 3NTKA 5JEAJ 1P1AA 2RR9A 1FNUA 4ME5A 2JZZA 3TS2A 1XMQQ 1X56A 2F4VL 4ID6A 4K8IA 1DXMA 4DR3L 3GTMB 1K0SA 1FXTB 5JJIA 2IHFA 3Q8AA 1T0QC 4PMWA 3HP3A 5AJ3L 3UIPB 1E90A 3RNCC 2V1CC 5M5WB 2KWDA 3FKIH 4R9WA 3A56A 2DZKA 3C8YA 2A68C 4KN7C 2IJ0A 2O5JC 3DWMA 2A68D 1Q8IA 1JOQA 3J81L 2L32A 3H15A 3HRDD 3CMMB 3H9DA 3NOBA 1FGUA 3D4DA 1H9SA 1FNWA 4LF8Q 4GU2A 1SMYC 1SSOA 1JC7A 3RUIB 1LYLA 3APFA 1QUQA 1PRTD 2WXIA 4KSKC 5HHDG 3SK4A 1DGJA 1STBA 1JICA 4WORA 3EIVA 5IWAQ 4JBKA 1UZXB 2IY1B 4DR2L 2K6QA 4UY8C 2KAJA 3IRBA 5HI1A 5BN3A 1N32Q 1AYFA 4DN4M 4L5SA 3HVZA 4KSLC 1TWFB 3E3XA 3EA6A 2K3UA 4JW0A 1PMRA 2JEAI 2WHIA 2CR5A 4G0NB 4OZCA 3ZO5B 3JAME 2FINB 2Z0DB 3PT2B 4KIKA 3ZKJC 2KVMA 4FADA 1R9TH 2SNMA 5J39A 1LTGD 1H95A 3LNNA 1V8QA 1FRDA 4GMVA 2QGQA 4KJOA 2HE7A 2WAQE 2G9DA 3CCVA 1X3QA 4A3LH 2YTYA 2V3PA 4US8A 4LUVA 1HTLD 2WLBA 4Y7NH 4JYAQ 1E22A 2DYOA 2WKCA 4JI7Q 3I5JC 3KVFB 3FP9A 1VCIA 4R3DA 1YI2A 3SHQA 1AP0A 5EKLA 4ZHOA 4A93B 1HCZA 3B2GA 1BMLC 3VR3A 1J7AA 4ANVA 4LF9L 3GB1A 2IHEA 3EVQA 4CDEC 1TYGB 3AU7A 2KQSA 4ZRPA 2B8FA 5G3LF 4TMAB 5JEAH 2JZ3B 4P6VF 4K3BA 1DGSA 3ZNZB 2PIAA 5FJ8G 5LL6S 2RQXA 2N4FA 3A55A 4BXXG 4J6HA 1XLNA 2AKWB 5KRUA 1F9SA 1WYDA 3S2DH 2D11A 2QCZA 1H9MA 1F9JA 1QOAA 3AXCA 2A19A 5E6JA 2KJHB 1BKBA 2D3CA 5L95C 1I3QH 3OWEB 5EKKA 4DV5Q 3NVZA 1XX8A 3AB5A 3NWTA 4FHKA 1C78A 3H1UA 4Q2JA 4N9PA 1E24A 1TWHB 2MQJA 3M4YA 1PUTA 3ZTDA 2J4XA 1J5EQ 3ZQ4A 2AQ3B 3DCGA 4ANWA 4A3KB 4WJPA 2ZTDA 3TN2A 4CO7A 5BR8Q 4OO1G 2HJ8A 1Y14B 2F3VA 3PUYA 3CPWA 2UU7A 1BNZA 3VTWA 3GTKB 1WY8A 3BZKA 2GBNA 2E2IB 4XT1B 3FILA 5IKCM 3HEJA 1FNVA 1CT1D 2KACA 1IP9A 4EQOA 3HOYH 2KK8A 3AH7A 2HDLA 3ETRA 4DPGA 3CCEA 4IUTA 2OOBB 3PGEA 4C3IG 3VUXA 2ASBA 3RZDH 4HJ5A 1M94A 2ASQA 2LXCA 3AE9B 2QIEB 2MWSB 3WALA 2RDBC 1BUVT 4EQ5A 3QIJA 1A3UA 5BN5A 1QZEA 4JVZA 1YX6B 4DR4Q 3ML8A 2OCEA 2LRWA 5ELNA 5JHAA 4M8AA 2L52A 3UE1A 4AUQC 4ZDVA 3HS0C 1C7YA 3J7A5 3JW0X 1JJCB 1RIPA 1SNQA 3BVGA 4QGUA 2CQOA 1WR1A 4JCVE 4DAYB 4JI6Q 3SGIA 1N6ZA 5DEHA 2VRRB 5E6OA 1I6HB 2KLCA 1ZXTA 4AYBE 2VQEQ 2C5CA 2IX0A 1V81A 1X1MA 1E7ZA 3BS1A 2JRIB 4B0EA 5K36H 4O0AA 4DAYA 4C56C 4A3GB 2VH1A 1U9RA 1WTRA 5BMHA 3J81c 4A3IG 1WGDA 1C3TA 4HAEA 3NY5A 1TVXA 1Z47A 2R93H 5FR3A 4XWWA 3H3VH 2CFMA 2O2LD 3TMPB 4IZ8A 1R7SA 1RL2A 2PLPA 4II2B 4WWMA 4A20A 1SE4A 4TKNA 1YN5A 3CCUA 1HZ9A 1Z5SB 2N9EB 3K0XA 1GJXA 4X66L 1WGYA 2QEXA 1PFDA 3KLWA 1B1ZA 2B63H 1R4MB 1KRHA 3MHSD 2TSSA 1WX9A 1HXYD 1IXRA 2IDYA 4JLCA 1YNJD 3JAML 1EWYC 4LJZC 3GTKH 3FPPA 1K3BC 2ALYB 2LGDA 3ENEA 2F0GA 2R61A 1K8RB 4HN7A 3TSSA 2K6DB 4DHZB 3BG3A 1JE4A 4RMFA 1GKHA 2PZWA 2D3BA 2B2WC 2NVXB 2KVZA 5JPMC 4G7HC 2WDRB 1OTCA 3EGRA 4DV6Q 1MGSA 3I4LA 3IFTA 3STBD 3MXPA 3NQIA 1OXUA 4IFDI 2PTLA 2WAQG 5A2QE 1X6OA 3MXGA 4DV6L 1ML0D 2SOBA 3V61A 1VD2A 3AB9A 4WJWA 4QUCA 1L4ZB 3WAMA 1I3QB 1L6UA 3CCMA 5GAGC 2LXAA 2WGSA 1JE5A 3BU2A 2QILA 1X55A 1ZYRC 2QCPX 2A6ED 4LF6Q 2HDEA 4DUZQ 3O13A 4YL8A 3HOVB 3RZDB 2WXRA 3CAMA 4LK0M 3I4MB 3NJTA 2DAJA 1RHPA 1S40A 2KDIA 4MGIE 4G57A 1L1OB 1OEYA 1CHPD 5C4JB 1UEAB 4L63B 1PDQA 4JI1L 1I4HA 1SAPA 2NBFA 5IYDH 3SFEB 3NHEB 2BBCA 3E0EA 3SXHA 3TZDA 3FC4A 1KLGD 4F87A 3UDFA 2F0HA 2I46A 1GUAB 2LJ5A 3MXNB 5A2QL 3JVZX 2WXFA 2V9HA 4ITKA 1SSNA 4JIOU 1WCMB 4PMCA 1CKMA 4A3MG 5C0XH 2WB1B 4RFBA 2BWES 4IQZA 2PW9A 1WF9A 2RVLA 4RCOA 1EY8A 2WKDA 2NBWB 3T16A 4E3CA 1UF0A 4O42A 2R3ZA 5D3DA 2HDMA 2WXGA 3PVLA 3NTIA 3K80C 4RKBA 2F0EA 1Y1WB 1KF6B 3DVGX 1HTQA 3DEOA 2M19A 3S2DB 2R7FA 1R9TB 2KHWB 1FFVA 5GMVA 1G51A 1QLBB 2EYHA 3AE8B 4GN1A 3M4QA 2BW2A 3C46A 4RM8A 2K5QA 2WAQB 1VQBA 1N36L 4OX9Q 1HZBA 1Q3LA 1STEA 4GNXB 1QZHA 1AFPA 1E5WA 4RM9A 2N3SA 3CC2A 1A3TA 3VR6A 5I6YA 2K14A 1RYJA 5DM73 4XTCS 1GVPA 2VS1A 2R7ZB 3A5ZB 1WE6A 1YVCA 3E9IA 4A93H 2N7DA 2YVCA 3MWYW 5CTRC 4LWCA 1TT5B 1EF5A 3ZGZA 2WXMA 2LVOA 5FK9C 4KY5A 3Q14C 4A3OA 1BBUA 1C77A 1EYAA 5CV8A 4MZ9A 1HZCA 2G3QB 2LMCA 2UU9L 4KY7A 4B3RL 5IYBG 1LM8B 2PVGC 1TZ1A 1L7YA 1VMCA 4MT5A 1X3EA 3I70A 5IYBH 1E8ZA 1WSPA 2L3ZA 2CKHB 3NUHB 3H3VI 2PKOA 1PH9A 2K28A 1GUOA 3SDZA 1UEBA 3H7SA 1EY5A 3PTFC 1W3SA 4BBSG 1J5EL 1LT5D 2GVBA 4YWMA 3OAWA 2MBOA 1S5DD 5C23A 2VY3A 1KL9A 3MC8A 3BINA 2RSOA 4J15A 1LFDA 4HEDA 2X69A 2BYEA 2ONQA 4IUQA 2EY6A 1CSPA 3T51B 1EUVB 1GM5A 3AEBB 3TEXA 1F2MA 1H9RA 2JA5G 2EPBA 4LF9Q 3GTGB 2CHXA 2WXHA 1Y1WH 3CF6E 1HQMC 2D5DA 2JJQA 1FIQA 1KM7A 2BB5A 3BIID 2X6LA 4P74A 3E9HA 5M3FG 4UP7A 4GLSC 1E6EB 4OZBA 2OJRA 4ILWA 1PTOD 4PQXA 1H9SB 5HY6A 2ACZB 2NN6H 2UXBL 1XLOA 1K51A 2RDHA 1UGMA 4KJNA 5K36G 2QSDA 4K81A 3G6EA 4HIDA 3WOFA 1K8MA 1HNWL 2JA8G 4U68A 1MI2A 1A2UA 1EWIA 2KFKA 2FUHB 2I38A 4CHTB 1OGWA 2WDTB 4ALPA 4FDBA 5KNCA 2B2UA 3PUVA 2J0MA 5IYDG 2LEKA 3HOVH 3U30A 4DR4L 1EY4A 1GG3A 3APDA 1TWAH 1HTOA 1SIJA 1JORA 3EJIA 4K6LA 3APCA 1R4PB 4B6WA 3KK7A 3QR8A 4LUZA 2PEAA 3U7ZA 5LLIA 4M02A 3ZYYX 4A6QA 3OTOL 4GSWA 4R4OA 2NVXH 4IJLA 5LMUL 1IBLQ 3M4OH 1MVKA 2LHEA 3RCZA 1CKOA 4JI4L 1IBKQ 1KD1C 4CGYB 4YWLA 2KDBA 2N9LA 2EY1A 3W5UB 2RCNA 4QB4A 1VQ9A 2IX3A 2NVTH 4LUOA 1WTHA 1WRDB 3GOEA 1C48A 5IP7H 4HCSA 1HNXL 2XVSA 4HCNB 3H91A 4HJ8A 2F4VQ 1WX7A 1I35A 5TSSA 4OGQC 1YNJC 3OW2A 2K01A 3U7DA 1YN3A 2Y5BB 5I6WA 1Y1VB 1WXVA 4ANXA 1T0YA 2VH2A 3RNBC 1TGZB 4EFOA 1EYCA 1E8XA 2K1FA 4C3HG 1YJ9A 1N34Q 1FO4A 3H0GH 2F0JA 2CU3A 4DAMA 1GXDC 5BN4A 2KCTA 4JPBW 3I90A 3ZW3A 4EZJA 1IW7D 3K7AH 1UWVA 2FAZA 1XMOL 3HZXA 4TUUA 1WR6E 3KFUA 4W9FA 1IPGA 1PZJD 2MJDA 4F7ZA 3A8JE 3S14B 2IGHA 2EY2A 3CMAA 1FXAA 3A9JB 1STHA 2LGXA 3N1YC 2A6HD 1WVLA 2RGFA 4LNIA 1PQSA 1L0VB 4C1NI 1PTOC 2DYMA 2LASA 4BAXA 2P5ZX 2B2YC 2XGTA 1IL2A 2JSVX 2EYFA 1WTPA 3BK2A 5EBDA 3L13A 1FYCA 4O2DA 5CHFA 1JJGA 1TS5A 1WJ6A 3W5OA 1D1IA 3AE2B 2K33A 1SNCA 4BKSA 3L3OC 3NZ3A 2BT6A 3BYTB 3Q6BA 5AUKA 3L7ZC 5EPLA 3VR2A 1RFKA 3E0JA 3MEHA 4RWSC 2WXQA 2D9UA 1SE9A 1BCPF 3M4PA 3K9PB 5D3IB 3DBHI 3TJPA 1UD7A 2J42A 1V1QA 4K1RB 3GV3A 5GQOA 4BBRH 5FLXE 4DR2Q 2QMTA 3J7AF 1A2TA 4BBRG 3VUWA 1WJJA 2MP2A 2UXCL 1TWHH 1OTRB 3GTQH 2XIWA 2FMCA 2IBIB 2IGDA 4DV4L 3R3OA 1FCCC 3ERQA 4GOPC 1XTCD 2UXCQ 5G2NA 3BWUD 3MVVA 1VF5C 3BYYB 2L5TA 4M0WA 1BF4A 2H5XA 2MGSA 1SF0A 3OTOQ 1HZAA 2B39A 2NZHA 3EECA 3PUWA 2ZZPB 4KZCA 4DV1Q 1X65A 3MTNB 1SYCA 1RWSA 3NS1A 3R93A 1ZUD2 4AQ7A 3KWVA 3V6EB 5C0XI 5FJ8H 2GRIA 2B2TA 2A6HC 3W3AA 4H0LC 4HR7B 4HSPA 4K3CA 2BTEA 4Z9CB 3FKYA 1I5FA 4HPPA 1U0LA 1D5MC 1ISNA 1ZKHA 1KDAA 1G2TA 1G6ZA 2UYZB 4HK2A 1JOKA 5LMNQ 4DK1A 1D3ZA 3QIAA 4BY1B 4OEMB 4JI8L 3KLSX 3I2ZA 4DV0Q 4IFDG 1VZ7A 1B70B 1RKNA 2F0FA 2V4DA 4NXNQ 2MRPA 4J8QA 5C4HA 4U673 5EKIA 4IALA 1KHIA 2B63G 4QIWE 4BS9A 1OXXK 3D6WA 4KV6A 4DR3Q 1P9DU 1Q86C 3M7NA 1S72A 3U50C 2JRHA 4N58A 1JT8A 3PMFA 5AEKB 1EIFA 3VAWA 3A8IE 4RA8A 3A54A 2FCMA 4TV3A 1GHKA 3JC66 3ZJYC 5IT9L 5C6AA 1VQ5A 2I5LX 3GZNB 1QCBD 5AZHA 4LFCL 1FXIA 2XEWA 3J80i 1EQVA 3PUZA 1WXSA 5M9OA 3DVNU 1N33L 4NZLB 2PI2E 2LFNA 4IUPA 3QA8A 1NYRA 3L54A 2A69C 4IUMB 1YOVB 4JI2Q 5IGCA 1P8LA 3DDCB 4DXGA 2D0OA 2ZJRA 1RTNA 4HTHA 1VQMA 2BF8B 1EOVA 1B7YB 5DPRA 5IAAC 1E1TA 3HIZA 2QEJC 3FKIB 5M5WH 1T5XD 1V1PB 4GS3A 1WD0A 1WGKA 3FVQA 3FHWA 4G4KA 1ZXIA 3C0RB 4C3HH 1S5BD 2JWZA 2OXPA 3RT3B 1FR3A 1S3OA 4IWOA 2E74C 4OHJA 1LLRD 1GUSA 3V05A 5J1ZA 4NB3A 3UDGA 2OTJA 2YU9H 1A70A 4JBJA 2A5UA 3HM6X 4KDIC 5M3MB 4DV1L 1SJHD 2IT1A 2KC2A 3IXSA 4AYBB 5EGTA 1WFQA 2L1AA 3C2PA 1O7IA 1MHWC 1WZ3A 4CJ0B 2I0QA 3PCOB 4HJ7A 5NUCA 3VTVA 1N8RC 1WXQA 2NVYB 4NQLB 2YTVA 3KF6B 1W6JA 4NDXA 4RGTA 4RGMA 2HIXA 1E2ZA 3TRZA 2LGSA 3ALBA 1PH7A 1H4RA 1VQ4A 1Q10A 1E10A 5GADC 2G5DA 3KYCD 3SFDB 4MEMA 1WTVA 2RPQA 2W3RA 3OG5A 4IOIE 3T3OA 2JN4A 1SROA 5CR3A 2AMCB 1KC8C 1VQKA 1SNPA 1V43A 4XYOA 2F0TA 4N8X1 3KUDB 1VDVA 4DAVA 1T0RC 3EBEA 4GLAC 5AUIA 1Q12A 1GOZA 4B9XA 2VB2X 5ELDA 4PS8A 2VUMG 3R2IA 5IP9G 4BY1G 2B2UC 3TDQA 3RZOH 2KMMA 2NPTA 3I4NB 3TBLD 4HJAA 2XK5B 5E1FA 4R8NA 2XWJB 2MBHA 2CWPA 1ENCA 2KXJA 4DF7A 4JE3B 2DUDA 2Z8LA 1V5TA 2RDFA 1M1KC 2INPE 1KDBA 4NQKE 1WYWB 5C4XG 1N34L 4POGA 1NBWA 1WTOA 1IBXA 1C0AA 1BBWA 4FF4A 1XEEA 2K32A 1FD6A 3NSWA 3HOYG 1C4CA 5IO9A 2ES2A 2MLBA 4A3IH 1TKWB 1SXTA 2WXNA 4FVMA 2DENB 2REXA 2MPMA 2V0GA 5FO9B 1LM0A 2LXKA 2PE6B 5E6NA 4H13C 5FLMH 5KEEA 5IGFA 4J1MA 3K5MA 3IT4B 3HOZH 4HPLB 2KQ4X 4RF0A 3QG1A 2MHVA 1O7ZA 4A3EH 1SNMA 2L83A 4XZ4A 1K3RA 4CKCA 3VRAB 4ZHPA 3I57A 3T56B 4W9JA 1I4QA 1S3SG 2BB6A 2HT1A 4L2YA 3HFZB 4C7ZA 1S5FD 1IBXB 3CW2C 5LMUQ 3ERSX 3DBLB 3GTJB 3W9CB 1ZW7A 1IZ6A 5JJZA 3OMCA 3OPOA 4OVVA 2PQEA 1QNKA 1YNNC 1WWTA 4MM3B 2B2TC 4QQBX 4X6AH 3W1BA 3S9WA 4MSQB 4BBSB 5IOIA 4MGYE 5G55A 4JI4Q 4C3IH 4DAPA 1N32L 5CV6A 1TIID 4X3TA 1K8AC 1NI2A 1JALA 2RHQB 1JRPA 3JSVA 2WXOA 5D6JB 3ZJTA 2Z1CA 1LGRA 1T9HA 4C7YA 4LK1C 1WFYA 1FM0D 3HG9A 3TZUA 5GAHC 3KJOA 3A33B 1NYQA 3M3YH 2BWFA 4GOPA 1YITA 2ZCCA 4HIKA 2JU6X 2K22A 2FIDA 3IVFA 5FO7B 3K5LA 2BOSA 3UI3A 3H09A 2NR2A 2Z6KA 4TQ0A 5I9OA 3CC7A 1HZ5A 1LUZA 3S1QH 1EIYB 1RAXA 2A69D 2IO2B 1STYA 1UBQA 4OZAA 1PGBA 4O1NA 1RODA 1B9MA 3TEHB 2DZJA 4PS7A 4EEWA 4FO2A 3V62A 5AJ3Q 2EELA 1Y1WG 1SN8A 2NYZD 2BE5D 3OMGA 1CK1A 3I91A 3AMUA 3NXWA 4JOIC 3AQQA 4C1NK 5C5MA 3KBGA 1G91A 2DNCA 3F1ZA 3GQBA 4R1JA 1EO6A 1SIFA 1ZXHA 4RG1A 4YHHL 1F9PA 3H3VC 3Q69A 4C00A 2LHDA 2VUMH 3CQZH 1YJJA 2YEPB 4W9EA 1FGBD 2UUBL 4A3MB 2LVQA 2CHZA 4REZA 1YIWA 2KUMA 2L0CA 1I4PA 3I73A 1MBYA 1K52A 1WCMH 5M3MG 2CJOA 5G5GA 4OO1H 3CKIB 2DX5B 2KCMA 2KWVB 4ANUA 4C4VA 2JPHA 4KLKA 1EY9A 2AWTA 1L2FA 4DV2L 1QVCA 5KYIA 2F3IA 2Q8RE 4M00A 2UUBQ 2I2YA 4JK1C 2AX5A 3OOCA 4HDQA 4MH8A 4MM3A 1IGCA 1O78A 3D8GA 2NVUI 1YD8U 2HCCA 3OW7A 4POFA 2ZXOA 1PFNA 2D3AA 3RUZA 3M3YB 5D7GA 3IBEA 3T13A 2ICIA 1IBMQ 3I4MH 1NI3A 2KECA 4N59A 4PK1A 3EROA 3P1MA 2IY0B 3P4SB 2ZJDA 2JQRB 4C3JG 2MH7A 2OJWA 3F2CA 1R4NI 3G4SA 1SYDA 2D2QA 1QUQB 4OX9L 3NRZA 2MQHA 3OHXC 2CH4W 4ZRJA 1YHAA 1UUPA 1HA5A 2ID0A 3S16B 3Q8BA 2K4KA 1JROA 4JYAL 1H9KA 3SDLC 3AECB 4UP9A 2KYWA 3AEGB 4CDFC 2RBMA 3VYUA 1I50H 2JEBI 3K7UC 2H4OA 2C35B 5CBEE 3U52E 2DYBA 2WWZA 4CBVA 5CHVC 2BH8A 5ELFA 2EYPA 1CSQA 2N7JA 1VQHA 5IT9c 2B63B 3PRPB 5C3WA 1UE1A 1A0IA 1LTID 3CPFA 4P71A 4JI6L 1E9MA 5DPSA 1H8CA 4QUFA 2I07B 2WP8J 1N63A 1V8CA 3W1GA 1SGHA 3QJZA 1E7UA 3RLOA 1EY6A 4FXGC 3RZFA 5L83A 3HOZG 3IFDA 4DKAC 5I2XA 4A3JH 3Q3MC 2E75C 4A3IB 3DHIC 4MJSB 1IKMA 2EJGC 1HZ6A 2EQSA 1BUIC 4WAAA 2NVQH 1IGDA 4N6EB 1AWDA 4MDKE 2ZM6L 2LD9A 3OJ4B 3SVMA 1GUTA 2LFIA 3VVWB 4LF5Q 2KA7A 2BA0A 1K0RA 3LWUA 5C4XB 2CKZB 1XPUA 1EM7A 1I6HH 2JYOA 3PRZA 4GKKL 2KQ3A 5I2YA 2GB1A 5EJWA 2M17A 1DOXA 5DCNA 3PLVA 3P1HA 5EE0A 3N1ZC 2BYTA 3GTOB 2KJXA 3RZOB 5KNBA 3AE5B 4FJYA 4X3UA 1KFYB 4WURA 3J7AV 1A8VA 1MHXA 1NDDA 4NY0A 3IKJA 4IPCA 3IAYA 1QOFA 2VZKD 4LF6L 1SR3A 4QF4A 1SNDA 1UGJA 5E7NA 1ENAA 2R7ZG 3LXFA 4NPNA 1V1OA 4WWNA 1PH6A 3ND9A 3K6OA 3V96A 1XMQL 1PRTC 3P20A 2F0LA 4NAWB 4JQWC 4CYEA 5IA7A 3Q22A 4DV3L 3SE0A 4B0MA 3MFYA 4FXCA 3ONSA 3A0JA 4DR6Q 4MACA 5J22A 3UF8A 4S17A 3T1HQ 2MHJA 3PHXB 1STNA 2PW7A 2SEBD 1A63A 4GIVA 4A3KH 4J3OD 3MA2B 5IE8A 2ZT9C 5JVG3 2WXJA 4XT3B 1F0ZA 4K0KQ 1YNND 4DR1Q 4DK0A 4EOYA 1E3PA 2PMZB 1WCMG 5M3MH 2ZVNA 4N9TA 1PTOF 1ZDVA 3SU8X 3WAOA 4KGSA 5KNDA 4R4QA 4X3SA 4CJ2C 4QL5A 5DNFA 2DHZA 1JJ2A 2YLMA 4AP4C 1IBKL 3TP7A 3A4SC 3BDLA 4JI3Q 4EVOA 3RN9C 4GN5A 1N36Q 2JT4B 4KX6B 4MELA 4AH6A 4MNOA 3TREA 1G8ZD 1WJ4A 1JWBD 4Q0FA 2N0SB 1RD9D 2K50A 3PO2G 4JI5Q 3QCAA 1GO3E 1B3AA 1RF2D 4YY3Q 5T1IA 4GB9A 4IUNA 1B9RA 4ACFA 3H6NA 3J9CA 3U58A 2K0PA 4PV1C 4RNAA 3DLLA 4C80A 2MEKA 3J81E 1SEBD 2K7VA 5ISRA 5C44G 4KHPL 2B76B 2R92G 4BY7H 3I3CA 4FYDA 1X3PA 4WJNA 3ZJVA 2JQOA 4K14A 4ZRZA 4DR5L 4DUYQ 4JPSA 1NJIC 3BJUA 4L5QA 4DV7Q 1LTTD 1YNXA 2KN5A 4F88A 1E7VA 2KDEB 2Y0SE 3PSIA 2LGIA 3I63C 5EDSA 2VZKB 3NS8A 3Q3JA 4W9KA 4AJWA 4JI1Q 2RDGA 4KZ0A 2RPVA 2V4IB 3Q8CA 1XPOA 3E56A 1BO0A 4W9HA 4JI2L 3IFWB 4YXDB 1EWHA 1JR0D 4OIKA 4KKSA 2ZPYA 4B08A 2PNRC 1XNRQ 2DNEA 1SBBB 4JBMA 2JA6H 4XDCA 4BY1H 1IBML 3TBIB 1Q1EA 1KJTA 1FPYA 5HG2A 2KEEA 3Q8EA 3Q8FA 3OIQA 4BA1I 1LV9A 2Y5PA 2O6VB 3AU4A 2AWOA 2EKIA 3KLRA 4DGZA 1EQTA 5C3EH 3Q23A 1KXLA 4MTNA 1VZ8A 5ELOA 3PQIA 4K2LA 3PZ7A 2NTTA 4KHZA 1OXTA 3WA0A 4A3DG 4AQYL 3BVMA 1XYIA 1XLPA 3RLFA 2ZW0A 3VQIA 1KTKA 4HLEA 1AZQA 4IPHA 2JA5H 5AZGA 4A4IA 1WX8A 3X3NA 1IHZA 3UQBA 2DN8A 3A8KE 1HNZL 2WNMA 3PO3H 4K8JA 1EU4A 1GNUA 4XQQA 1HQRD 2G4SA 4AS1A 3CCJA 2GBKA 2C7HA 4GDLB 3FMCA 2Q5WD 1LABA 1PTOH 4I7AA 4BBRB 3M95A 3WIMA 4GDKB 4DR5Q 4FF2A 4H02A 3S17B 1E8WA 3WCQA 3ZXVA 3NE5B 3UGBB 3BVZA 1C79A 1Y56A 5JOBA 2EYMA 5M5YH 2EJFC 3J81i 2ATWA 2UXDL 3VHTC 3W1SC 5JXVA 3SK8A 4FF3A 2JA8H 3IHPC 4XC2A 2VQEL 2NB0A 2BKFA 4WWPA 2XK5A 3U4ZA 1IUEA 3B1LX 2HJ1A 5DAUA 4PNYA 2IW3A 1O80A 4YSXB 2BDNA 5DPTA 2LGYA 3KW5B 1HR0L 4FBJB 1CKNB 2MBEA 3NG0A 5MPOA 1R4NB 1IKLA 2FNJB 2GA4B 3MHBA 1IBLL 1JW9D 4GXBA 2K8HA 3V6CB 4JI3L 4B3SQ 3N20C 1GJZA 4HDOA 3PUXA 2FHTA 3C1FA 4WJ3M 3EUB2 3DWGC 2LXJA 3N9YC 1V1PA 2A4ZA 3TP6A 3DPDA 3G71A 4FULA 4CKEA 2M8SA 1LTBD 5HGQA 2O6VA 4EUTA 4C2MH 1ZYRD 3KUPA 3RLNA 5C4XH 1YHQA 3AYHB 2NBUA 2F0MA 3ZUNA 2UWQA 3J80L 2ZVOA 2PYKA 4KIKB 1SE2A 3E5SA 4EZKA 2UUAL 3PF5A 3H0GB 2R92B 1BBXC 1MI0A 1DZ1A 2N9XA 3LB8C 4GGQA 4CHKA 1HJPA 3PIOA 4DUZL 1VR9A 4HJ9A 2JYTA 1YJ1A 2MFIA 4OWWB 2G9HD 3BZDB 2GLSA 3GS2A 2K8CA 2MO0A 5IY0A 4PS3A 3BY4B 1FJGQ 2UXBQ 1V49A 2KBNA 3L9AX 2MJ8A 1F1HA 2KANA 3ZNGC 3EHVA 2NVTB 4IW0A 3M85A 2PZUA 3EFUA 2PVOD 4LFCQ 3QOLA 4IFDH 3L08A 2AQ2B 5BMIA 5LNK1 4GNXA 1Q8KA 2LRUA 4US9A 4JL9A 2HQLA 4IM3A 2M00A 3M4OB 1VQGA 1XPRA 3CCRA 1ACCA 5C1ZA 4GKJQ 2C7NB 2KZRA 4C2MB 2D5GA 3MC9A 4HPMB 1S1QB 2R6GA 2CHBD 5FLMG 3CCSA 1PTOB 1PV4A 1PH5A 4IKGA 3AI5A 4P7IA 2CJNA 4KGRA 1A62A 1LACA 2AQ1B 5CORA 4E6IA 1NMFA 2PO4A 5C44H 4WJOA 5H92C 1KAAA 3AE6B 4EE2A 2F0UA 1WJUA 2JXMB 5CGKA 1F2LA 3AULA 3ZIMA 4CQNA 2EIFA 3GO5A 3S2AA 4HCPB 3MZ5A 1CTMA 1N9WA 1RTOA 3LGJA 2JXTA 4NW2A 3A74A 2KMAA 1FCLA 3TS0A 3NHHA 4A76A 2DJFC 2BPSA 2KWUB 3NVVA 2J53A 2ZJPA 2M4NA 3B2FA 4K6DA 2WINB 2XRSD 2JA8B 3TEZA 4LF5L 4YY3L 4PZ8A 4B9WA 1YQ4B 4DDGD 5M5YB 2PQAA 3UDXA 2JYEA 1J8CA 1AZPA 3I8ZA 2DZMA 3P63A 2CVRA 2MP2B 4ICVA 1XWEA 1OQRA 2LUMA 5JHBA 3HOWB 4L6TB 1RLFA 2AL3A 2EKEC 3MP9A 1Q81C 1K8OA 2DY7A 2W54A 4X3KA 4ZYSA 2KHIA 2CS4A 2WIIB 3X3MA 5M3FB 1OEYJ 3ONAB 2K5WA 3QAQA 3K81C 4B3MQ 1Q7YC 2JA6B 3GTLH 2I5MX 1PYBA 3PO3B 3JAMc 2MBBB 3AEAB 2A6EC 1BR9A 1I94Q 1I4RA 3T1YQ 2CW0C 1LT6D 5C3EG 4P73A 3RN2A 2JA5B 3GE3C 1PH1A 2IYDB 3LYYA 1PLFA 2JWUA 1O7YA 2ZXPA 4MSMB 1PYWD 2DBYA 1TBEA 2BGFA 1SYBA 3T4AC 1KIXA 4AOFA 1AEXA 3FDTA 2QDBA 3HKZG 1HUMA 5C3EB 3VR4A 3S1MH 1NY4A 1PH2A 3Q3FA 2ZW1A 1ZE3D 3PV1A 1JWSD 4R4TA 4IPGA 2JA6G 3A9JA 1ASZA 4LAAA 1WOCA 4DR6L 4X65L 3GTPH 4CDCC 2VZAA 4RCNA 2KDMA 1VLBA 1MKHA 3DM1A 4ZOHC 4WQOB 1K8GA 3NVWA 2HUGA 2NPTB 1HE8A 2JX5A 1LT4D 3QJYA 4DV2Q 2V1YA 3SK6A 2C60A 4HJGE 4LNNA 1Q1BA 3D6CA 2ZNVC 2KTRA 4E71A 1EIGA 2BA1A 4HIMA 4MJSA 4LFAQ 2R7DA 4C3IB 1NENB 4YTNB 2LJIA 1W6KA 3SHLA 1XNQQ 1Q1OA 2KX3A 2EOTA 5IGEA 1LTAD 4G7ZC 4DU9A 4FF1A 4XYCA 1Z9FA 3S1RB 3CCQA 3NBHB 2MX2A 4A3DH 4GOCA 3UINB 1FJGL 2MW5A 4IWPA 4GN3B 2ZTCA 3KQ4A 3TP8A 1E2VA 4OWTB 5JZEB 1SFOH 4NXNL 4JWUC 4QCLA 2VB3X 4TSSA 2DZIA 3NVYA 4W9CA 4XDDA 1L1OA 4ASWC 1E0ZA 2NN6I 4JBWA 1KQSA 2XBBC 3L16A 4IO9A 1D5XC 4ZUJA 1YMHE 1TJEA 2JA7B 3KUCB 5KIXA 4P1CC 3DWQA 4MTKA 3SK5A 1QVGA 2WB1G 2LVPA 4M8NA 1UBIA 4IUUA 2IO0B 4G3XB 2Z59B 4I7ZC 1L2NA 5CYUA 1AH9A 2A73B 2W82A 1QZGA 1PFSA 5IODA 2JXXA 3L4PA 3CP0A 4UP8A 2JZPA 3G7LA 2NS5A 1WI5A 1I4XA 1CZGA 2QF7A 3ER0A 4UAIA 3C3LA 2IGGA 3ML9A 1KRSA 3KLSA 3IT6B 4N9F4 4IURA 4HVBA 1YQ3B 2F52A 5E3FA 4A93G 3L17A 1JB3A 4XE0A 4L23A 2BCOA 2F0NA 4YCWA 2EXZA 3H8HA 2O5IC 1K73C 2RHSB 3M7GA 2Z6BA 4TRDA 2E8GA 1CI3M 1QE6A 1QT9A 2O6VD 3AM9A 4LFBQ 3P4QB 1B9NA 4LTUA 3NP8A 3DMUA 5JH5C 3K59A 2OEOA 1DOLA 4YCVA 2BH2A 3H7PA 5AZFA 4ME3A 4XXEA 5GAEC 1H9JA 4P2CB 4MN3A 5BR8L 1EF1A 2KEDA 3GDEA 2J7ZA 3PIO3 1CHQD 2NVQB 1ET9A 1NVID 1RCVD 4PZ6A 3C1EA 2MJ3A 4WIPA 1CFMA 4PYZA 2W3SA 3QWZB 4YCUA 2B2WA 1NEKB 2N8NA 2NBVB 2QHOA 1CA5A 3SD5A 2QJLA 1A15A 2E2HH 4DR7Q 4W9IA 4ZCKA 1ZEQX 3RN5A 3N30A 1C9OA 2GN5A 5JEAG 4GKJL 4OL7A 3L2PA 4HROA 4IDIA 1BT0A 3F2DA 1JQ4A 4GZYC 1X3GA 2K03A 1L0XB 4BKGA 4K7WA 3DHQA 4X64L 1MSHA 3A1QB 3ZVVA 2PE9A 3T1HL 3CSTA 4ARCA 2R93B 3KOJA 3HHMA 4BOZB 5E4WC 1SFOB 1ZKOA 4A3GH 2KMCA 2KQ7A 1S5ED 1QF6A 3A9KA 4KD4A 3BDOA 2NTSA 3KYHC 4YTMB 4B3TL 1EY7A 2L4NA 4X66Q 2N9PC 1JWUD 1SRUA 2F0SA 3TP5A 3S15B 3E9SA 2QKIC 3JSVB 3TUOA 3N6RA 4B95A 1EEID 2QA4A 4HJKA 3PGZA 4L1BA 4IN3A 1K50A 3KJPA 2J52A 1OO9B 4NKLA 3PREA 4X57B 1F2RC 1MD2D 2QDLA 3CU7A 4UHVA 1TS4A 4K5XA 1ICFB 4FNFA 3D3RA 3LX0A 2IX1A 2BDOA 1EIHA 1FEHA 2JA7H 1WJNA 4WWOA 3HOYB 1SDFA 2INDC 3N3KB 2KOLA 4K2KA 5K5PA 1XTDA 2ZM6Q 3KF8B 5HFYA 2XN9C 3KF6A 3S1MB 1F2YA 2KHJA 1AN8A 2N78A 3DHHC 1STAA 1DONA 4FJZA 4YSYB 5I4DA 3T53B 3UI2A 1V9JA 1WTWA 2W55A 3OYYA 2X38A 4LF4Q 4A3DB 4DK6C 4GOPB 2G4DB 2PMZE 4ZAIA 3S1RH 3S16H 2RD0A 1YHBA 2YEPF 3I4NG 4NMZA 4JI5L 4A3KG 2D3GA 1ICWA 3VR9B 4JI0Q 5BYSA 5IP7G 5I9PA 4LDTB 3W1SA 2VUMB 5CBAE 2JUOA 3JYUA 4OONA 2J0JA 4M8MA 3DBRB 2WS3B 4A3FH 4GN4B 3HOUG 2EY5A 3TEYA 2FMMA 2VL6A 3KF8A 2OTLA 2E76C 3GTPB 1U4PA 2FFKB 5LMNW 2WACA 2JVCA 2HTME 4WFN3 2PW5A 4USAA 5CV7A 1EQRA 3AE7B 4FN2A 5LXHA 1M90C 2CW0D 4TQ1A 3OJ3A 2JE6I 1PH8A 4CJ1B 2WXLA 2KC1A 2ZEQA 2WX0A 1N5WA 1RRBA 1XF5L 1YBYA 3D32A 3VYSA 1KH0A 4HKZE 3VXWA 2L15A 1DM0B 2H89B 1EFID 1WM2A 4AQYQ 4APVA 3JAMi 3P2BA 4A3MH 3NENA 2KX0A 2OHFA 1YN4A 4ZKCB 2OF1A 1OQQA 1HPCA 2N88A 4A3FB 3G48A 4IOAA 3V2TA 3PO2B 1PFBA 1MPEA 1JCKB 2MCNB 3A9KB 1NCVA 5C44B 3Q24A 4LF7Q 1B4OA 1J9OA 4JV5Q 2PPBC 1N33Q 2FE8A 4V0BA 1KNEA 1LTSD 1OXVA 4ULLA 5TR5A 3J7YW 3QK0A 4CKBA 4ZQ3A 1L5PA 2N7EA 4FJVB 4FXDA 1C76A 4I6LB 4YSZB 2K5DA 1VZ6A 4E74A 1L0WA 3V60A 2ON8A 1LT3D 5CV9A 2UUCQ 3S1QB 2F4IA 3GTJH 2E6XA 3PZDA 1S5CD 2B3AA 1TKGA 3OLMD 4K5WA 4EGVA 5AFWA 2KENA 3RNFC 4A3EB 1TZOA 3HRZC 5IGDA 2SNSA 5LL6X 3HKSA 3NBHA 3RMHA 4H2AA 1RDPD 2C7MB 4DWFA 4DV0L 2M0AA 1NMGA 3NTHA 1R4MI 2EMSA 3MJ5A 3VA7A 5HURA 3I9V1 4B3SL 2KD0A 4TVAB 4BZAA 4FHJA 1D7QA 3ZNHB 2M2LA 1PH3A 3S15H 4HIOA 1LXDA 1VF7A 3Q6SA 1ROEA 1C4AA 3QC8B 3J7ZC 3NQTA 2VQFQ 4JI0L 1HRJA 5HKHA 5J17A 1VS0A 2OQKA 2B3GA 2GBMA 4L5RC 2RMMA 4I6NB 5ELCA 3VR8B 4DHJB 3LJ3A 4A3LG 1CMXB 4ICUA 3AE3B 5CMDA 1PZID 1AARA 1T3QA 1SE3A 4AIMA 2E3TA 3UQAA 2MJEA 3NUCA 3DBRI 3L10B 2Y3AA 5EBCA 4R4IA 2L11A 1CKNA 1VCBA 1JQYD 1A5RA 3MC0B 4LW1A 1HNWQ 2DWQA 2E2HB 4HCEA 2L0TA 1I42A 3DQVA 1XCTL 4KMUC 5D94A 1WRIA 1A3VA 4GNXC 3RULA 4KK7A 1MJCA 3KYDD 5C5LA 2NCNA 3VFKA 4ZRIA 1DYQA 1JWMD 2M9VA 1WGGA 4DHZE 1KDCA 1JOOA 1V80A 4LJOB 2X6GA 4F8MA 3ABVB 3M3JA 3R3MA 3S17H 2BYVE 1YIJA 3PV0A 3Q3NC 1SYEA 2FCQA 1SYFA 2B2VA 2Q2IA 1J8IA 1KAWA 2EJMA 3AV8A 3LDZE 4LLGM 5J3BA 2FBWB 4TQUS 3A7LA 5FO8B 4DNTB 4DV3Q 1UWMA 1IW7C 3QARA 3SR6A 3VTUA 1Q46A 2JK8A 1ET6A 4UPAA 1UE7A 3GV6A 3ECIA 4YT0B 3WANA 4BOSC 4AWJA 4ZRKA 4XQJA 3RNGC 2IWHA 3CWIA 3EQLC 3DHGC 1K83B 5E6PA 1VQCA 3ZDTA 4P1BC 3VDZA 5L37A 1IYUA 2K75A 1GAQB 4MH0E 4XYQA 1AE3A 5IYCH 1L6VA 4AJYB 3HOWG 2AL6A 2D07B 2KN4A 4IM0A 4WH4A 5J18A 2TMPA 5CC4A 4C3JB 1QG7A 4MGKE 4RAUC 2EZVA 2CH4A 1MFWA 1X3FA 1I94L 4JI7L 3KDFA 1PGAA 5COYA 1X9NA 4NNJB 4OW0A 4W9LA 3R7QA 4B3ML 1Q0WB 5LMNL 1OQYA 3DBHB 3NWSA 5A35A 3WOEA 4DUYL 4R8IA 5GROA 2L7RA 1D6EC 3HVDA 4WAFA 1YJIA 2E2JH 2EXDA 4HMIA 2K05A 5FLXc 3FRPB 3GTGH 2FCSA 3DVNV 2LMCB 4P16A 1HR0Q 1KABA 2Z6KC 2L1BA 1DOYA 4RHSA 2HD5B 4KV2A 2F0KA 2KJRA 4C3HB 4LF8L 5CV5A 4W9DA 4OVZA 2IO3B 3STBC 2K04A 3K5OA 1QWYA 4LF4L 1RJTA 2L55A 3A7AB 3E6ZX 4OVUA 2AUKA 2FJ2A 2GMIC 2R2OA 1VDZA 4DQOC 4BY7B 2B8GA 1TWGB 3CF5A 4IOCA 3H6MA 1P3QU 3D31A 3RNAC 1GUWA 4K5VA 1GB1A 5KHQA 1SNOA 2BVCA 3DWAA 2G45B 3L0WB 1SMXA 1K9MC 3RD4A 4BY7G 1YNTE 3O65B 1QOHA 2R7ZH 1Q82C 3S1NH 4KHVA 1BXTA 4NP5A 1FMAD 2NMQA 3T8MA 3AEFB 4OWXB 1EY0A 2EDGA 2Y0SB 1N62A 2GBRA 4IUVA 2XNAC 3PIP3 3RYTA 4RGNA 3U4VA 1HA6A 2F0IA 3H0GG 4L8JA 4QIWB 3D0FA 1UNSA 2AUJD 1UE5A 2B2VC 3RI7C 1YJWA 2L00B 1F77A 4OO1I 1K28A 1TKYA 4DK5A 1HR0W 1HTPA 3M63B 1C9FA 4YTPB 3R8BA 3CCLA 3GTQB 2VW9A 2EYLA 5M3FH 1HHVA 1GC7A 4DHJD 2B2YA 3MTSA 3MXUA 4NXML 1CA6A 1XXGA 2RA4A 2WV6D 3FEWX 4A3JG 2Q2UA 1P0RA 4LNOA 3HOWH 1VRAB 3ICEA 1XCQL 3PS6A 5EE1A 4PMBA 4GDLA 1JB7A 2GI9A 2K9XA 2L8JA 1PHJA 4C3JH 4B3RQ 3RNEC 2L0FA 1CQVA 4LF7L 2K5PA 4HXDA 1P98A 1EWCA 3C19A 2GVAA 5HGTA 1E0BA 1KLUD 2WX1A 1ESRA 1DD2A 2RKSA 4KKIA 4KTAA 4XWTA 5IGGA 2Q8TA 1K83H 5E4XA 3VR5A 1LQBA 1WYGA 2BYFA 2Z4HA 1VQEA 3R66C 1U4RA 4HRSA 4ZKBB 1XD3B 1S4ZA 1Y69U 2QC8A 3ZRCA 4QY7A 3LWEA 3U9SA 4GKKQ 4WRDA 2KTFA 1D8LA 1QNUA 2YTXA 1SB3C 2JSOA 1ZDXA 1MJDA 1EZ6A 1ONLA 5KHOA 4NJ7A 4LNQA 5LXIB 3U9OA 1E2WA 1MHHE 2WU2B 4NAMA 3F8TA 1TR5A 1WD1A 3FILB 2K25A 1BVSA 1E1OA 1BQQT 2VQFL 2MP1A 1HUNA 1L0YB 1L4DB 1XO3A 1NSNS 2F03A 5FR6A 1TY2A 1Z2MA 5ELEA 5IWAL 4C4VB 1EL0A 3M9BA 4MHEA 4A3JB 4JX1C 2RSNA 2D62A 1PYSB 1DJRD 4RHRA 5KYLA 4RGOS 3I3TB 1D1KA 1TU2B 3QHTA 1D4BA 3EFXD 1FL0A 3G6JB 1Z6HA 4EX5A 2ZJQA 2I1JA 3HOUH 3PO0A 2L9HA 1A6XA 3VYTA 3D4WA 4EKUA 2ZTEA 5IIFA 2K1BA 4ZRQA 3P7JA 2HQEA 1DOKA 4B9KA 4DBGA 1IYFA 3S14H 2QDFA 3F2UA 4LJPB 2XWBB 4KKUA 2IY5B 3HOXG 1PXUA 4OELB 4DNRB 3RFZB 3QOJA 2Y0SG 4HMJA 3Q0AA 3CD6A 3WAPA 3K7AB 5ELBA 5BO4B 1WMHB 4BKTA 2BE5C 4K0KL 4BWGB 2JA9A 4Q5VA 2J7QB 2MA9B 2EE1A 3DEPA 2LKVA 5C3JB 2AEHA 4M01A 1X54A 4A8XC 2OEDA 4LMQD 3A5UA 1F2ZA 4LDTD 4P75A 4XIGS 2XTIA 3U8ZA 2BS4B 3ULLA 1TWAB 2WU5B 3QQ8B 5H1SE 3VYRA 1J7CA 1YJNA 4IG7B 3SEBA 3AEEB 4B3TQ 4II3B 5JJLA 3GD7A 2BKRB 2KTRB 2E5LQ 1TKEA 2D0PA 1XQQA 3Q2AC 1AE2A 1XMOQ 5J2RA 1LO5D 5FOBB 4EZLA 2LSSA 1V6EA 4KDLB 3KDFB 4DXFA 5DPWA 1NR4A 2EVBA 1HNXQ 2RF4A 2MBQA 2HD3A 3IAM1 3ULPA 3ZNID 2NUCA 4L5TA 1U4LA 1ENFA 2VXWA 3I4MG 3P4RB 4IWQA 3VUYA 2PNHA 2K8BA 1B44D 1WH3A 1WIAA 4DV7L 1TWCB 2YV5A 4QAYA 2DLBA 3AMZA 2HTHA 3CXCA 3CC4A 4G11A 1EOTA 2M0XA 1TQOA 2UU9Q 1P7EA 1TIFA 4WQMA 4BVUC 4DR7L 2A1AA 3MXNA 1STGA 4FLHA 1F9QA 2DAFA 1PVOA 4KI0A 1MJEA 5CHWA 1B8AA 3K5NA 3T1YL 4FA6A 3PO2H 2A5HA 3HGBA 1UE6A 5DM63 1FRRA 3EC8A 4NAWA 5FKAC 4A3BH 1JRUA 3M62B 3H7PB 4OXPA 2WYQA 1UELA 3RZWC 4A3BG 1JMCA 3GP7A 2HHHL 2K5VA 4YIJA 2EMTA 2Q8IB 4BFRA 4K7SA 2B29A 1IYJB 1C8CA 4KHPQ 1SJED 1FVIA 3NK9A 1WGHA 1E7PB 2KKCA 1IL8A 1EZ8A 3RR5A 1Z7TA 4OIJA 1QOBA 2Q2TA 3DVGY 4NJCA 4KD3A 1OXSC 3DOWA 3BK1A 3VA5A 1I4GA 2NZOA 1BCPB 2VNUD 2N9KA 5IN7A 4DK3C 2GOWA 3HKZE 3NBIA 4DR1L 1PDXA 1YX5B 3A4RA 2WB1E 3AEDB 1NE3A 4MGZE 3CQZB 2SAKA 1NTGA 1O7LA 4XDXA 2KNBA 1G291 2LY7A 3ZTCA 4ZYNA 4R4CA 2F0OA 2WXKA 3S2HH 4A3GG 2I5HA 4M0WB 4Y52H 4JC0A 5LHY1 5G3LD 4HSVA 4URKA 4BBSH 2XSCA 4W9GA 2W9NA 4MIUA 2RCFA 3OIPA 3T3NA 1U4AA 3OWFA 3B9JA 3TMEA 2SDFA 1Q5WB 3TL5A 4A90A 3AU5A 1HH2P 2DY8A 3CRLC 2RSUA 2PMVA 1XNQL 1MSGA 1YEZA 2KFJA 2HCIA 3S2HB 4LFAL 4A3CH 1VQDA 1UH6A 3CSFA 1NNXA 4NXMQ 4P72A 1EYGA 3IL8A 3HOZB 3B6YA 1HFNA 5G5HA 2INCC 3VDYA 4JV5L 2KJ6A 3B0AA 1ILPA 3W1YA 1ZPSA 3ZJUA 2PZTA 3U4EG 1M4VA 1WTXA 1T5EA 4KN4C 1Y8OB 5IYCG 3RNUA 2O4XA 1XNRL 4I65A 5C4JH 5BYQA 1UWXA 3QX1A 4XX5A 3NELA 2L12A 1U5KA 1SYGA 1GPXA 4KY6A 3KUZA 4BBNF 2PQAB 1V2YA 3NZSA 4A3BB 5D2MB 2IO1B 3ZRFA 4RKLA 2C9WB 1GUGA 3PSEB 2K52A 4YWGG 2LZ6A 3I4NH 1V9PA 2N1WA 3W5VB 2Y5CA 2NZ1D 2N1VA 4JOIA 1WXMA 5C0XJ 3H94A 1II3A 4A9AA 4DA2A 1TS2A 1GC6A 2N55A 5DLQE 2PPHA 3V3XA 2NN6G 2D2CC 2YYZA 1TWCH 3I7FA 4HEA1 2JP1A 1JWAD 2JF5A 1EEFD 5M5XB 5IT9E 1PGXA 1WTQA 4KGTA 2KHSA 2ZNVB 3F2BA 3SR1A 3AE1B 1QJOA 5KGUA 2KDFB 2KO3A 2K5HA 2KOXA 4F1SA 1VQFA 1Y1VG 2LWPA 2OQ0A 3DXJC 3P42A 4YWKA 1KOTA 4A55A 3Q8DA 5JVH3 2PI2A 3NEMA 1G6PA 1ZGUB 4A3FG 2ZCBA 5C3XA 1C1YB 2MO1A 3D4RA 4GDKA 2Z9HA 3UIOB 2BS3B 4IFDJ 1ASYA 2MNAA 3GE8C 1TT2A 3BDCA 2OWOA 1V86A 2FIFA 1VQLA 1J19A 3GTOH 3ZXRA 5EAYA 3IAS1 2LI5A 1V5OA 2YU9B 1MIUA 1DOMA 2BS2B 1K53A 1EUJA 4A3PA 1CZWA 1ESFA 1P7FA 2H1EA 1DCZA 1I6VC 3QO2A 3HM3A 2UUCL 2EYJA 1CJEA 3MFGA 1BCPD 1V97A 3HOXB 4X64Q 3MJWA 4G7OC 3K0YA 4RH6A 1G2SA 2XRQD 3K58A 1PZKD 2NWGA 1BDOA 2IPKD 2OT2A 5T1GA 1XT9B 2IL8A 2C5LC 5EQ0A 4EQPA 2A74C 1CUKA 4KKJA 1YQBA 3HOUB 2Z0EB 2WXPA 3RMKC 1L1OC 3FAHA 4RF1A 2KVRA 4ABNA 4IJHA 4KKTA 3RPFC 3WWVA 3J81j 1C4PA 3DBLI 1YZ6A 2K5NA 1LTRD 1J6QA 1WI0A 2F3WA 4ARIA 2K39A 2QW7A 3PPAA 1TXYA 1QB5D 3TCAA 4IPDA 1VQIA 2CU1A 2E2IH 5FLXL 4J6IA 4GLVB 4QMGA 1D2BA 3K8AA 4NPSA 1I50B 4S3SA 1VQ7A 2UUAQ 2ZPNA 3X0WA 1Y8RC 2AWNA 4YHHQ 2KCNA 2EYOA 3I4OA 4WJQA 1EYDA 4ZLTF 1XJVA 1NR2A 5F2DA 3Q3OC 1GUNA 4BBNC 2CWAA 1I7HA 1WMHA 4DNIA 1ZP0B 2IZVB 1UAPA 3K57A 1N5XA 2CQAA 2KCCA 4JG2A 5D65A 2M56B 4S0RA 1PA6A 1ZOYB 3MAQA 2MSED 2KLGA 5H8YE 5JJKA 2KFKB 1GB4A 1VQOA 2WQYB 1QVFA 4BKSD 5C0XG 3HUIA 4A75A 1HEZE 3J80c 3VH3B 2HHHQ 1B2TA 4DXAB 1QOGA 3N32A 3FPUB 4PG3A 3PRMB 3ZDMC 1QILA 1SMYD 2D10A 4V190 3PLUA 3HKZB 2R2QA 1T6BX 1WE7A 4DDID 1E8YA 3WDNA 4DFAA 2N49A 3QWNA 3AN1A 4ODGA 1FD7D 1T0SC 2R93G 5T8IA 4N8FA 4K7UA 5IGBA 2ENBA 4DV4Q 3KBXA 2KWCA 1CZPA 1VQPA 1JMLA 1X32A 2DJGC 3UE0A 3URYA 1MG4A 1CM9A 3EFCA 4A3CG 1WM3A 2MUYA 5EPKA 5JAVA 3GTLB 4JGHB 3NPPA 2E2DC 1HNZQ 1TY0A 1NUCA 1NBFC 4FP5D 1W2BA 3RD2A 4RMAA 2DNFA 2O2VB 2WDVB 1VQ8A 1PFMA 5IOCA 3MHZA 3W2DA 5CX3A 1TWFH 1B50A 2DGYA 4X62L 2I1KA 2KT7A 3DWPA 1VJKA 2F0WA 3AFQA 2V4LA 3S1NB 2ICEC 4G50A 2V3NA 1VQJA 3I55A 5GXGB 1J7BA 1M8AA 3NZUA 4IC7B 1F9RA 2PJHA 3HK0A 2INNE 5BYRA 5EE9A 5BMGA 1PRTF 1PRTB 3ULJA 3VRBB 5IP9H 4D2KA 4M1UB 4Y7NB 2WDQB 3R7RA 2Q2HA 2Z0SA 2L76A 4X62Q 1TWGH
chains in the Genus database with same CATH topology
2LS01 3KWLA 4ZUIA 3ITPA 1KNAA 5C2TB 1BOSA 2G1EA 1AW7A 3J80E 1U4MA 2PCFB 2F0VA 3OSOA 1GHJA 2F0PA 3ND8A 2E2JB 3R2TA 1B53A 3QB3A 5EPJA 1QQRA 5C4ZA 1NAPA 5D14A 1R4QB 1BCPC 2K6AA 4HKQA 3CIRB 3CRKC 1Y8NB 3P75A 2Z4IA 3AE4B 4FXKC 4H44C 3DUZA 4ZK9B 3N52A 4XQNA 3PZ8A 3I72A 1Y8PB 1XLQA 2F0DA 4PT5A 3U2SC 2H88B 1N60A 4BA2I 3TEWA 2ZXRA 5CV4A 1D5ZC 1Q90A 4H7BA 1C4QA 4EQNA 1IYVA 5EE3A 1CQFA 1RM6C 1VMPA 2J0TD 2C9OA 1FFUA 2F1MA 1EU3A 3CHBD 5JPNC 3P4PB 1TS3A 1QKZA 4JWSC 4TKOB 1OFFA 2FUG1 1N61A 1DOIA 4F7XA 2F0QA 4UDUC 1F2RI 2WP9B 1HFGA 1ILQA 3NTKA 5JEAJ 1FNUA 4ME5A 4ID6A 4K8IA 1DXMA 3GTMB 3Q8AA 4PMWA 3HP3A 5M5WB 2KWDA 4R9WA 3A56A 3C8YA 2A68C 4KN7C 2IJ0A 2O5JC 3DWMA 2A68D 1Q8IA 1JOQA 3J81L 2L32A 3HRDD 3D4DA 1H9SA 1FNWA 1SMYC 1SSOA 1JC7A 1PRTD 2WXIA 5HHDG 3SK4A 1DGJA 1STBA 1JICA 4WORA 2KAJA 5HI1A 5BN3A 1AYFA 4DN4M 3HVZA 1TWFB 3EA6A 2K3UA 1PMRA 2JEAI 4OZCA 3JAME 2FINB 2KVMA 2SNMA 5J39A 1LTGD 3LNNA 1V8QA 1FRDA 4KJOA 2G9DA 1X3QA 2V3PA 4US8A 1HTLD 2WLBA 2DYOA 2WKCA 1VCIA 4R3DA 1AP0A 5EKLA 4ZHOA 4A93B 1HCZA 3B2GA 1BMLC 3VR3A 1J7AA 3GB1A 4ZRPA 3EVQA 1TYGB 3AU7A 2B8FA 5G3LF 4TMAB 5JEAH 4P6VF 2PIAA 5LL6S 2RQXA 3A55A 4J6HA 1XLNA 5KRUA 1F9SA 1H9MA 1QOAA 5E6JA 3OWEB 5EKKA 3NVZA 1XX8A 3AB5A 3NWTA 1C78A 4Q2JA 4N9PA 1TWHB 3M4YA 1PUTA 3ZQ4A 2J4XA 2AQ3B 4A3KB 3TN2A 4OO1G 2F3VA 3PUYA 1BNZA 3GTKB 2E2IB 4XT1B 3FILA 3HEJA 1FNVA 1CT1D 2KACA 4EQOA 3AH7A 2HDLA 4IUTA 4C3IG 3AE9B 2QIEB 1BUVT 1A3UA 5BN5A 4M8AA 2L52A 3HS0C 1SNQA 3BVGA 5DEHA 1I6HB 1ZXTA 2C5CA 2IX0A 4B0EA 3BS1A 5K36H 4DAYA 4C56C 4A3GB 1U9RA 1WTRA 5BMHA 4HAEA 1TVXA 1Z47A 5FR3A 4XWWA 2O2LD 4IZ8A 1R7SA 2PLPA 4WWMA 1SE4A 1YN5A 1GJXA 1PFDA 1B1ZA 1KRHA 2TSSA 1HXYD 2IDYA 1YNJD 3JAML 1EWYC 4LJZC 3FPPA 2F0GA 2R61A 4HN7A 3TSSA 3BG3A 1JE4A 2PZWA 2B2WC 2NVXB 2WDRB 5JPMC 4G7HC 3EGRA 1MGSA 3I4LA 3IFTA 3MXPA 3NQIA 1OXUA 4IFDI 2PTLA 5A2QE 3MXGA 1ML0D 2SOBA 3AB9A 4WJWA 4QUCA 1L4ZB 1I3QB 1L6UA 2QILA 1ZYRC 2HDEA 2QCPX 2A6ED 3O13A 3HOVB 3RZDB 2WXRA 4LK0M 3I4MB 1RHPA 4G57A 1CHPD 5C4JB 1UEAB 4L63B 1PDQA 1I4HA 1SAPA 2NBFA 3SFEB 2BBCA 3SXHA 3TZDA 3FC4A 1KLGD 4F87A 2F0HA 2I46A 5A2QL 2WXFA 4ITKA 1SSNA 1WCMB 4PMCA 5C0XH 2WB1B 4RFBA 4IQZA 2PW9A 2RVLA 4RCOA 1EY8A 2WKDA 3T16A 4O42A 2R3ZA 5D3DA 2HDMA 2WXGA 3NTIA 4RKBA 2F0EA 1Y1WB 1KF6B 3DEOA 2M19A 3S2DB 1R9TB 1FFVA 1QLBB 3AE8B 2EYHA 2BW2A 3C46A 2K5QA 2WAQB 1Q3LA 1STEA 1AFPA 1A3TA 3VR6A 5I6YA 1RYJA 5DM73 4XTCS 2R7ZB 3MWYW 3ZGZA 2WXMA 5FK9C 4KY5A 1C77A 1EYAA 5CV8A 2LMCA 4KY7A 2PVGC 4MT5A 2V0GA 1VMCA 3I70A 1WSPA 3NUHB 2PKOA 2K28A 1GUOA 3SDZA 1EY5A 1LT5D 1S5DD 2RSOA 4HEDA 2X69A 2ONQA 4IUQA 2EY6A 3T51B 3TEXA 3AEBB 1F2MA 1H9RA 2EPBA 3GTGB 2WXHA 1HQMC 2D5DA 1FIQA 2BB5A 3BIID 2X6LA 4GLSC 4OZBA 1E6EB 4ILWA 1PTOD 4PQXA 1H9SB 2ACZB 2NN6H 1XLOA 1K51A 2RDHA 4KJNA 5K36G 2QSDA 3WOFA 1K8MA 4U68A 1MI2A 1A2UA 2I38A 4CHTB 5KNCA 2B2UA 3PUVA 2LEKA 1EY4A 1SIJA 1JORA 3EJIA 4K6LA 1R4PB 3KK7A 3U7ZA 3ZYYX 4A6QA 1MVKA 2LHEA 4CGYB 2N9LA 2EY1A 3W5UB 4QB4A 2IX3A 1C48A 4HCSA 2XVSA 3H91A 5TSSA 4OGQC 1YNJC 2K01A 1YN3A 5I6WA 1Y1VB 1EYCA 4C3HG 1FO4A 2F0JA 2CU3A 1GXDC 5BN4A 3I90A 1IW7D 3HZXA 1PZJD 2MJDA 3A8JE 3S14B 2IGHA 2EY2A 1FXAA 1STHA 2A6HD 1WVLA 1L0VB 4C1NI 1PTOC 2DYMA 2B2YC 2JSVX 2EYFA 1WTPA 3BK2A 5EBDA 1FYCA 1TS5A 3AE2B 1D1IA 2K33A 1SNCA 3L3OC 3NZ3A 2BT6A 3BYTB 5AUKA 3L7ZC 5EPLA 3VR2A 1RFKA 3E0JA 3MEHA 4RWSC 2WXQA 2D9UA 1BCPF 5D3IB 2J42A 3GV3A 5FLXE 2QMTA 3J7AF 1A2TA 2XIWA 2FMCA 2IGDA 3R3OA 1FCCC 3ERQA 1XTCD 3BWUD 3MVVA 1VF5C 3BYYB 2L5TA 4M0WA 1BF4A 1SF0A 2MGSA 2B39A 3PUWA 1SYCA 1RWSA 3NS1A 3R93A 1ZUD2 4AQ7A 3KWVA 5C0XI 2GRIA 2B2TA 2A6HC 3W3AA 4H0LC 4HR7B 4HSPA 2BTEA 4Z9CB 1D5MC 1KDAA 1G2TA 1G6ZA 1JOKA 4DK1A 3QIAA 4BY1B 3KLSX 4IFDG 1VZ7A 2F0FA 1RKNA 2V4DA 4J8QA 5C4HA 4U673 5EKIA 4IALA 4BS9A 1OXXK 3D6WA 4KV6A 3M7NA 4N58A 3PMFA 3A8IE 4RA8A 3A54A 1GHKA 5IT9L 5C6AA 1QCBD 1FXIA 1EQVA 3PUZA 5M9OA 4NZLB 2LFNA 4IUPA 1NYRA 2A69C 5IGCA 4DXGA 1RTNA 4HTHA 2QEJC 3FKIB 1T5XD 1V1PB 1WD0A 1WGKA 3FVQA 4G4KA 1ZXIA 1S5BD 2OXPA 1FR3A 2E74C 4OHJA 1LLRD 1GUSA 3V05A 5J1ZA 3ETRA 1A70A 5M3MB 1SJHD 2IT1A 3IXSA 4AYBB 5EGTA 2L1AA 3C2PA 4CJ0B 5NUCA 1WXQA 2NVYB 1W6JA 4NDXA 4RGTA 4RGMA 1E2ZA 1Q10A 1E10A 3SFDB 1WTVA 4IOIE 2W3RA 3T3OA 5CR3A 1SNPA 1V43A 4XYOA 2F0TA 1VDVA 4DAVA 5AUIA 1Q12A 1GOZA 4B9XA 2VB2X 5ELDA 3R2IA 2B2UC 3TDQA 2KMMA 3I4NB 5E1FA 4R8NA 2XWJB 1ENCA 4DF7A 4JE3B 2Z8LA 2RDFA 2INPE 1KDBA 1IBXA 1WTOA 4FF4A 1XEEA 2K32A 1FD6A 3NSWA 1C4CA 1TKWB 1SXTA 2WXNA 4FVMA 2MPMA 5FO9B 4H13C 5KEEA 5IGFA 4J1MA 3K5MA 3IT4B 2KQ4X 4RF0A 3QG1A 2MHVA 1O7ZA 1SNMA 2L83A 4CKCA 4ZHPA 3VRAB 3I57A 3T56B 1I4QA 4L2YA 2BB6A 1IBXB 1S5FD 3GTJB 3W9CB 5JJZA 3OMCA 3OPOA 2PQEA 1QNKA 1YNNC 1WWTA 4MM3B 2B2TC 3S9WA 4BBSB 4DAPA 5CV6A 1TIID 4X3TA 1JALA 1JRPA 2WXOA 3ZJTA 2Z1CA 4C7YA 4LK1C 1FM0D 3HG9A 3TZUA 1NYQA 2JU6X 2K22A 5FO7B 3K5LA 2BOSA 3UI3A 3H09A 4TQ0A 5I9OA 1HZ5A 2A69D 1STYA 4OZAA 1PGBA 4O1NA 1RODA 1B9MA 4FO2A 2EELA 2NYZD 2BE5D 3OMGA 1CK1A 3I91A 3AMUA 3NXWA 4C1NK 1G91A 3HVDA 5C5MA 3KBGA 2DNCA 3GQBA 1ZXHA 4C7ZA 3Q69A 3H3VC 1F9PA 2LHDA 1YJJA 2YEPB 1FGBD 4A3MB 4REZA 1I4PA 2KUMA 2L0CA 3I73A 1MBYA 1K52A 5G5GA 2CJOA 4OO1H 3CKIB 1EY9A 5KYIA 2Q8RE 2I2YA 4JK1C 2AX5A 3OOCA 4MH8A 1IGCA 1O78A 3D8GA 2HCCA 3OW7A 2ZXOA 1PFNA 3RUZA 3M3YB 5D7GA 3T13A 2ICIA 1NI3A 4N59A 2KECA 3EROA 3P4SB 2JQRB 4C3JG 2MH7A 1SYDA 3NRZA 3OHXC 1UUPA 1HA5A 2ID0A 3S16B 3Q8BA 1JROA 1H9KA 3AECB 3AEGB 2RBMA 3VYUA 2JEBI 2H4OA 3U52E 5CBEE 4CBVA 5ELFA 2EYPA 2N7JA 2B63B 5C3WA 1E9MA 1LTID 4QUFA 2I07B 2WP8J 1N63A 1V8CA 1EY6A 4FXGC 3IFDA 5I2XA 2E75C 4A3IB 1IKMA 2EJGC 1HZ6A 1BUIC 1IGDA 4N6EB 1AWDA 3SVMA 1GUTA 2LFIA 2KA7A 2BA0A 3LWUA 5C4XB 1EM7A 2JYOA 2KQ3A 5I2YA 2GB1A 5EJWA 1DOXA 3P1HA 5EE0A 2BYTA 3GTOB 2KJXA 3RZOB 5KNBA 3AE5B 4X3UA 1KFYB 4WURA 3J7AV 1MHXA 3IKJA 3IAYA 1QOFA 2VZKD 4QF4A 1SNDA 1UGJA 1ENAA 3LXFA 1V1OA 3ND9A 3K6OA 3V96A 4NAWB 1PRTC 3P20A 2F0LA 3Q22A 3SE0A 4B0MA 3MFYA 4FXCA 4MACA 5J22A 1STNA 2PW7A 2SEBD 4J3OD 3MA2B 2ZT9C 5JVG3 2WXJA 4XT3B 1F0ZA 1YNND 4DK0A 2PMZB 4N9TA 1PTOF 1ZDVA 4KGSA 5KNDA 4X3SA 4CJ2C 5DNFA 3TP7A 3BDLA 4EVOA 4KX6B 1G8ZD 1JWBD 4Q0FA 2N0SB 1RD9D 1B3AA 1RF2D 5T1IA 4IUNA 1B9RA 3J9CA 4RNAA 2K0PA 4PV1C 4C80A 2MEKA 3J81E 1SEBD 2K7VA 5ISRA 2B76B 4FYDA 3I3CA 1X3PA 3ZJVA 4K14A 4ZRZA 4JPSA 1LTTD 4F88A 2LGIA 2VZKB 2RDGA 2RPVA 2V4IB 3Q8CA 3E56A 1BO0A 4YXDB 1EWHA 1JR0D 4OIKA 4KKSA 4B08A 2PNRC 2DNEA 1SBBB 4XDCA 3TBIB 1Q1EA 5HG2A 2KEEA 3Q8EA 3Q8FA 3OIQA 4BA1I 1LV9A 2Y5PA 2AWOA 2EKIA 3KLRA 4DGZA 1EQTA 3Q23A 1VZ8A 4K2LA 3PZ7A 2NTTA 4KHZA 1OXTA 3BVMA 1XYIA 1XLPA 3RLFA 2ZW0A 3VQIA 1KTKA 1AZQA 3X3NA 1IHZA 2DN8A 3A8KE 2WNMA 4K8JA 1EU4A 4XQQA 1HQRD 4AS1A 4GDLB 3FMCA 2Q5WD 1LABA 1PTOH 4BBRB 4GDKB 3WCQA 4FF2A 3S17B 3NE5B 3BVZA 1C79A 1Y56A 5JOBA 2EYMA 2EJFC 5JXVA 3SK8A 4FF3A 2NB0A 1IUEA 5DAUA 4PNYA 2IW3A 1O80A 4YSXB 2BDNA 5MPOA 1IKLA 2GA4B 3MHBA 1JW9D 3PUXA 2FHTA 3C1FA 3EUB2 3DWGC 3N9YC 1V1PA 3TP6A 4CKEA 1LTBD 1ZYRD 3KUPA 2F0MA 3J80L 2PYKA 1SE2A 3E5SA 1MI0A 3H0GB 2R92B 1BBXC 1DZ1A 3LB8C 1VR9A 2JYTA 2G9HD 3BZDB 3GS2A 3L9AX 2MJ8A 2NVTB 3M85A 2PZUA 2PVOD 3QOLA 4IFDH 2AQ2B 5BMIA 5LNK1 4US9A 2M00A 3M4OB 1ACCA 4C2MB 2D5GA 2R6GA 2CHBD 1PTOB 4IKGA 2CJNA 4KGRA 1LACA 2AQ1B 5CORA 4E6IA 2PO4A 5H92C 1KAAA 3AE6B 4EE2A 2F0UA 2JXMB 5CGKA 1F2LA 4CQNA 3GO5A 3MZ5A 1CTMA 1RTOA 2JXTA 4NW2A 1FCLA 3NHHA 3NVVA 2J53A 3B2FA 4K6DA 2WINB 2XRSD 2JA8B 3TEZA 4B9WA 1YQ4B 5M5YB 2JYEA 1AZPA 3I8ZA 3P63A 2CVRA 1XWEA 1OQRA 2LUMA 3HOWB 4L6TB 3MP9A 1K8OA 2DY7A 2W54A 4X3KA 4ZYSA 2WIIB 3X3MA 5M3FB 3ONAB 2K5WA 2JA6B 3AEAB 3PO3B 2A6EC 1BR9A 1I4RA 2CW0C 1LT6D 2JA5B 3LYYA 1PLFA 2JWUA 1O7YA 2ZXPA 1PYWD 2DBYA 1SYBA 3T4AC 1AEXA 3FDTA 2QDBA 1HUMA 5C3EB 3VR4A 2ZW1A 1ZE3D 1JWSD 4LAAA 4RCNA 2KDMA 1VLBA 3DM1A 4ZOHC 3NVWA 2HUGA 2JX5A 1LT4D 3QJYA 3SK6A 4HJGE 1Q1BA 3D6CA 1EIGA 2BA1A 4C3IB 1NENB 4YTNB 2LJIA 1W6KA 3SHLA 2EOTA 5IGEA 1LTAD 4G7ZC 4DU9A 4FF1A 3S1RB 3KQ4A 3TP8A 1E2VA 4JWUC 4QCLA 4TSSA 2VB3X 3NVYA 1E0ZA 4XDDA 2NN6I 4JBWA 1D5XC 4ZUJA 1YMHE 1TJEA 2JA7B 5KIXA 3DWQA 3SK5A 4IUUA 4I7ZC 5CYUA 2A73B 2W82A 5IODA 3L4PA 2JZPA 3G7LA 3C3LA 1I4XA 1CZGA 2QF7A 4UAIA 2IGGA 3KLSA 3IT6B 4IURA 1YQ3B 5E3FA 1JB3A 4XE0A 4L23A 2BCOA 2F0NA 2EXZA 3H8HA 2O5IC 3M7GA 4TRDA 1CI3M 1QE6A 1QT9A 3AM9A 3P4QB 1B9NA 4LTUA 3NP8A 3DMUA 3K59A 2OEOA 1DOLA 4XXEA 1H9JA 4P2CB 4MN3A 2KEDA 2J7ZA 3PIO3 1CHQD 2NVQB 1ET9A 1NVID 1RCVD 4WIPA 3C1EA 2MJ3A 1CFMA 2W3SA 2B2WA 1NEKB 1CA5A 2QJLA 1A15A 1ZEQX 5JEAG 4OL7A 4HROA 4IDIA 1JQ4A 4GZYC 2K03A 1L0XB 3DHQA 1MSHA 4ARCA 2R93B 5E4WC 1SFOB 1ZKOA 1QF6A 1S5ED 4KD4A 3BDOA 2NTSA 4YTMB 1EY7A 2L4NA 1JWUD 2F0SA 3TP5A 3S15B 3E9SA 2QKIC 3TUOA 3N6RA 1EEID 4L1BA 4IN3A 1K50A 2J52A 1OO9B 4NKLA 1F2RC 1MD2D 3CU7A 1EIHA 1TS4A 3D3RA 2IX1A 3LX0A 4FNFA 4K5XA 1FEHA 2BDOA 1L5PA 3HOYB 1SDFA 2KOLA 4K2KA 5K5PA 5HFYA 2XN9C 3S1MB 1F2YA 1AN8A 4YSYB 1STAA 1DONA 5I4DA 3T53B 3UI2A 1WTWA 2W55A 2X38A 4A3DB 4ZAIA 2YEPF 4NMZA 1ICWA 3VR9B 5BYSA 5I9PA 3W1SA 2VUMB 5CBAE 2WS3B 2EY5A 3TEYA 2FMMA 3KF8A 2E76C 3GTPB 1U4PA 2FFKB 2WACA 2HTME 4WFN3 2PW5A 4USAA 5CV7A 3AE7B 2CW0D 4TQ1A 2JE6I 4CJ1B 2WXLA 1N5WA 1XF5L 3VYSA 1KH0A 4HKZE 1DM0B 2H89B 1EFID 2OHFA 1YN4A 4ZKCB 2OF1A 1OQQA 1HPCA 2N88A 4A3FB 3V2TA 3PO2B 1PFBA 1MPEA 1JCKB 1NCVA 5C44B 3Q24A 1B4OA 1J9OA 2PPBC 2FE8A 4V0BA 1KNEA 1LTSD 1OXVA 4ULLA 3J7YW 4CKBA 4ZQ3A 4FXDA 1C76A 4YSZB 2K5DA 1VZ6A 2ON8A 1LT3D 5CV9A 2E6XA 3S1QB 2F4IA 1S5CD 1TKGA 4K5WA 4EGVA 5AFWA 4A3EB 1TZOA 3HRZC 5IGDA 2SNSA 5LL6X 3RMHA 3NBHA 4H2AA 1RDPD 2M0AA 3NTHA 3MJ5A 3VA7A 5HURA 3I9V1 2M2LA 1VF7A 3Q6SA 1ROEA 1C4AA 3NQTA 1HRJA 2RMMA 3VR8B 5ELCA 3AE3B 5CMDA 1PZID 1T3QA 1SE3A 2E3TA 2MJEA 3NUCA 2Y3AA 5EBCA 2L11A 1JQYD 3MC0B 2DWQA 2E2HB 4HCEA 1XCTL 4KMUC 1WRIA 1A3VA 4KK7A 5C5LA 1DYQA 1JWMD 2M9VA 1KDCA 1JOOA 2X6GA 4F8MA 3ABVB 3PV0A 1SYEA 1SYFA 2B2VA 1J8IA 4LLGM 2EJMA 3AV8A 2FBWB 4TQUS 3A7LA 5FO8B 4DNTB 1UWMA 1IW7C 3SR6A 1ET6A 3GV6A 4YT0B 4XQJA 2IWHA 3CWIA 3EQLC 1K83B 1IYUA 1GAQB 4XYQA 1L6VA 2KN4A 4WH4A 2TMPA 5CC4A 4C3JB 1QG7A 4RAUC 2EZVA 4OW0A 1PGAA 5COYA 3NWSA 5A35A 3WOEA 4R8IA 1D6EC 4WAFA 1YJIA 4HMIA 2K05A 3FRPB 2LMCB 4P16A 1KABA 2L1BA 1DOYA 4RHSA 2F0KA 4C3HB 5CV5A 4OVZA 2K04A 3K5OA 1QWYA 1RJTA 2L55A 3A7AB 3E6ZX 2AUKA 2FJ2A 4DQOC 1VDZA 4BY7B 2B8GA 1TWGB 3H6MA 3D31A 1GUWA 4K5VA 1GB1A 1SNOA 3DWAA 3RD4A 1YNTE 1QOHA 4KHVA 1BXTA 4NP5A 1FMAD 2NMQA 3AEFB 1EY0A 2EDGA 2Y0SB 1N62A 4IUVA 2XNAC 3PIP3 4RGNA 1HA6A 2F0IA 4L8JA 4QIWB 1UNSA 2AUJD 2B2VC 1F77A 4OO1I 1TKYA 1HTPA 1C9FA 4YTPB 3R8BA 3GTQB 2EYLA 1HHVA 2B2YA 3MTSA 3MXUA 1CA6A 1XXGA 2RA4A 2WV6D 3FEWX 1VRAB 1XCQL 5EE1A 4PMBA 2K9XA 2GI9A 1CQVA 2K5PA 1EWCA 5HGTA 1E0BA 1KLUD 1ESRA 1DD2A 2RKSA 4KKIA 4KTAA 4XWTA 5IGGA 2Q8TA 5E4XA 3VR5A 1WYGA 2Z4HA 1U4RA 4HRSA 4ZKBB 1S4ZA 1Y69U 3LWEA 3U9SA 4WRDA 1QNUA 1SB3C 2JSOA 1ZDXA 1EZ6A 1ONLA 3U9OA 1E2WA 1MHHE 2WU2B 4NAMA 1WD1A 1TR5A 3FILB 3P1MA 1BQQT 1L4DB 2MP1A 1HUNA 1L0YB 1XO3A 1NSNS 2F03A 1TY2A 5ELEA 1EL0A 4MHEA 4A3JB 4JX1C 2RSNA 4RHRA 2D62A 1DJRD 5KYLA 4RGOS 1D1KA 1TU2B 1D4BA 3EFXD 3G6JB 1Z6HA 3PO0A 2L9HA 1A6XA 3VYTA 3D4WA 5IIFA 2K1BA 4ZRQA 3P7JA 2HQEA 1DOKA 3F2UA 2XWBB 4KKUA 1PXUA 4DNRB 3RFZB 3QOJA 4HMJA 3Q0AA 3K7AB 5ELBA 2BE5C 4BWGB 4Q5VA 2EE1A 3DEPA 2LKVA 5C3JB 4A8XC 2OEDA 4LMQD 1F2ZA 4XIGS 2BS4B 1TWAB 2WU5B 3VYRA 1J7CA 3SEBA 3AEEB 3GD7A 1TKEA 1LO5D 5FOBB 4DXFA 1NR4A 2EVBA 3IAM1 2NUCA 1U4LA 1ENFA 2VXWA 3P4RB 1B44D 1TWCB 2DLBA 3AMZA 1EOTA 1TQOA 1P7EA 4WQMA 3MXNA 1STGA 1F9QA 4KI0A 3K5NA 2A5HA 3HGBA 1FRRA 5DM63 5FKAC 3GP7A 4YIJA 2Q8IB 1C8CA 1SJED 3NK9A 1E7PB 1IL8A 1EZ8A 1QOBA 1Z7TA 4OIJA 4NJCA 4KD3A 1OXSC 3BK1A 3VA5A 1I4GA 1BCPB 2VNUD 2N9KA 3NBIA 3AEDB 1PDXA 3CQZB 2SAKA 1O7LA 4XDXA 1G291 2LY7A 2F0OA 2WXKA 5LHY1 5G3LD 4HSVA 2XSCA 4MIUA 3OIPA 3T3NA 3OWFA 3B9JA 3TMEA 2SDFA 4A90A 2DY8A 3CRLC 2PMVA 1MSGA 2HCIA 3S2HB 3IL8A 3HOZB 1HFNA 5G5HA 1ILPA 1ZPSA 3ZJUA 2PZTA 3U4EG 1M4VA 1WTXA 1T5EA 4KN4C 1Y8OB 2O4XA 4I65A 5BYQA 1UWXA 2L12A 1SYGA 1GPXA 4KY6A 4A3BB 4RKLA 1GUGA 4YWGG 3W5VB 2Y5CA 2NZ1D 5C0XJ 3H94A 1II3A 4A9AA 4DA2A 1TS2A 2N55A 3V3XA 2NN6G 2D2CC 2YYZA 4HEA1 2JP1A 1JWAD 1EEFD 5M5XB 5IT9E 1PGXA 1WTQA 4KGTA 2KHSA 3SR1A 3AE1B 1QJOA 5KGUA 3DXJC 3P42A 4A55A 5JVH3 5C3XA 3D4RA 2BS3B 4IFDJ 1TT2A 3BDCA 3IAS1 2YU9B 1DOMA 2BS2B 1K53A 1CZWA 1ESFA 1P7FA 2H1EA 1DCZA 1I6VC 3QO2A 2EYJA 1CJEA 3MFGA 1BCPD 1V97A 3HOXB 4G7OC 3K0YA 3K58A 1G2SA 2XRQD 4RH6A 1PZKD 2NWGA 1BDOA 2IPKD 2OT2A 5T1GA 4KKJA 2IL8A 4EQPA 5EQ0A 2A74C 3HOUB 2WXPA 3FAHA 4RF1A 4ABNA 4KKTA 3RPFC 1C4PA 1LTRD 2F3WA 4ARIA 1QB5D 5FLXL 4QMGA 1D2BA 1I50B 4S3SA 2AWNA 2KCNA 2EYOA 1EYDA 4ZLTF 1NR2A 5F2DA 1GUNA 1I7HA 1ZP0B 1UAPA 3K57A 1N5XA