4C56C

X-ray structure of the complex between staphylococcal enterotoxin b, t cell receptor and major histocompatibility complex class ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
227
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Structure of the Superantigen Staphylococcal Enterotoxin B in Complex with Tcr and Peptide-Mhc Demonstrates Absence of Tcr-Peptide Contacts.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 50
structure length 227
sequence length 235
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c56C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4c56C01
1AN8A 1PTOH 3V05A 5ELFA 3TSSA 1PRTB 4RHRA 1EU3A 2R61A 5I4DA 2XRSD 1LTSD 1V1PB 1PTOD 5ELBA 1EEFD 1YN5A 1BCPD 1HXYD 4OHJA 1FNUA 3R8BA 1JQYD 2QEJC 1CK1A 1TS5A 1PRTD 1D5ZC 1D5MC 4BWGB 1AW7A 1SE3A 1CHQD 1V1PA 2AQ1B 3CHBD 3OWEB 4L6TB 1V1OA 1PTOB 2AQ3B 1G8ZD 3SEBA 5ELDA 1FD7D 2NTSA 5ELEA 1RF2D 1D6EC 1S5DD 1HA5A 2O2LD 2TSSA 1CT1D 1LT5D 2XN9C 1B1ZA 1PZJD 3EFXD 1F77A 1LTBD 4Z9CB 2IPKD 1EEID 3BZDB 3W2DA 1LTID 2Z8LA 1TY0A 1DJRD 1I4XA 3R2TA 1BXTA 2QILA 1KLUD 3BVGA 4RGNA 2WV6D 2XRQD 4RH6A 1UNSA 1RD9D 1UUPA 1RCVD 3R2IA 1S5FD 1SE4A 1SXTA 1CHPD 1JWSD 2IJ0A 2XNAC 1YN4A 4TSSA 3DWAA 3MC0B 1ENFA 1ESFA 1KLGD 1LTGD 1YN3A 1TS3A 1M4VA 1PRTF 1LLRD 1I4HA 2AQ2B 1PTOC 2J4XA 1PZKD 1XXGA 4UDUC 1BCPC 1JWUD 1I4PA 1I4GA 2NTTA 3KLSX 1GOZA 1I4QA 5ELCA 1T5XD 1EFID 1I4RA 1L0YB 1MD2D 1XTCD 5FK9C 1PRTC 5TSSA 1LTAD 4L63B 1FNVA 2RDGA 3DWPA 4C56C 1LT6D 4RGMA 1PZID 1PYWD 4K6LA 1L0XB 1HQRD 1PTOF 1TS4A 2RDHA 1BCPF 1KTKA 2SEBD 4RFBA 4NZLB 1JWMD 1LTRD 4RGOS 1D5XC 1QILA 1SE2A 4RHSA 1EU4A 1SEBD 4ZYSA 2G9HD 2ICIA 1STEA 1B44D 1JR0D 3DWQA 1S5ED 1LT3D 1S5BD 4RCOA 1ET9A 4DXGA 1DYQA 1FGBD 1TS2A 1LTTD 1SJHD 1SJED 5FKAC 3EA6A 5D3IB 1JCKB 3MFGA 4DXFA 3O13A 1ET6A 1LT4D 1SBBB 3BYYB 3GP7A 4O1NA 1TY2A 1CQVA 1HTLD 1EWCA 2CHBD 3BVMA 1LO5D 3BYTB 1FNWA 4RGTA 5D3DA 1RDPD 1BCPB 3URYA 1S5CD 3BVZA
chains in the Genus database with same CATH superfamily
5FLMH 3DLLA 1HNZQ 4UY8C 2K75A 5IP7H 4QUCA 4KSLC 2KCNA 3I7FA 3A55A 3VR3A 3RNUA 3N30A 2JA6H 5I4DA 5BMHA 4X66L 4M01A 3SK8A 5IP9G 4GKJQ 4WURA 1I50H 4KIKA 2K52A 4OVZA 1YNJD 1NR4A 3N1YC 1GVPA 3ULLA 5IYDH 4RNAA 3ZVVA 4DAYA 4O2DA 4JI6L 1NEKB 1TT5B 5DPTA 2MHJA 3CMEA 1V8QA 2A69D 3AM9A 1QUQA 2KFKA 1SAPA 4KKSA 1WYDA 1EY8A 5EPKA 1TIFA 4JI2Q 3M7NA 2PNRC 1K50A 2W54A 2JA6B 2ZW0A 1TKGA 5GMVA 3AMZA 2K39A 4NW2A 1V9PA 1E8ZA 1C48A 1JE4A 4JI5L 1I50B 2F3IA 1NDDA 2QIEB 2RPVA 4RA8A 1P7EA 3RZWC 3NBIA 3KF6A 2MX2A 3ICEA 2PQAA 1TY0A 5CV5A 1KLUD 2M2LA 1OXVA 4BBRG 1UUPA 4GGQA 4JI0Q 3AV8A 1XJVA 2JWUA 4HJ7A 1C78A 5IP9H 3TDQA 1YHQA 2R2QA 3Q14C 3HFZB 2K05A 4A3GH 3ALBA 1UWMA 2B39A 1WTOA 4DHJB 3NENA 1Y8PB 3S9WA 1PGBA 4WH4A 3J7YW 2V4LA 2K5WA 3GTQH 2Z6KA 3NTKA 1WM2A 3KJPA 2D2CC 1GJXA 1YNTE 2LJIA 4LNKA 5C23A 1XXGA 1HTPA 3IRBA 1N61A 2KVRA 1F2ZA 4LUOA 3EGRA 3AECB 1BDOA 2D5DA 1GKHA 3W3AA 4HK2A 2AEHA 2F0DA 2D62A 4I7AA 4L63B 2HDEA 4JI3L 2KWUB 3MP9A 1WYWB 1R4MB 5A2QL 1P1AA 1XMOL 3D31A 1NCVA 2CH4A 1M1KC 2AKWB 3RZOB 1NR2A 4DAVA 4BBRH 4E74A 4PNYA 1RHPA 4FBJB 5FLXE 1TWHH 3GTQB 3N3KB 3R7RA 4KHZA 1CSQA 1LTRD 2OQKA 1DGJA 4XDCA 2KN5A 1DONA 2M4NA 3FMCA 3QJYA 2O5IC 3DVNU 1Q1OA 2X6GA 2F4VQ 3ZTCA 2GBKA 2BH8A 3NXWA 3RN2A 1WTVA 5BR8Q 2MPMA 2PPBC 1HH2P 2R7DA 1I3QH 2B2UA 1JCKB 3MFGA 3L54A 1EY6A 5JAVA 1FRDA 2D2QA 5JJKA 2ZPYA 2SNSA 2ONQA 3S14B 1UF0A 4YWLA 4BBRB 3U4ZA 2LJ5A 3MXPA 2OJWA 3PV0A 3VTWA 2JZPA 1AN8A 3V05A 4G7OC 3NS1A 3PHWB 1PRTB 5BN5A 2KECA 1PLFA 4N9TA 2R2OA 5E7NA 4WRDA 2XRSD 2UUBQ 4FADA 1F9SA 1VQCA 2A74C 1B3AA 2NN6G 3L7ZC 2DJGC 4B3RL 1I3QB 2VQFQ 1A63A 1YN5A 1VQBA 4K8IA 3MJ5A 2A5HA 4J3OD 4BBSG 4P74A 2ZXPA 4JW0A 5T1IA 2LHDA 2R3ZA 4HJAA 1D5ZC 1XTDA 3ULPA 5EE3A 3OTOQ 4EEWA 1LYLA 4H2AA 5I2XA 1O7IA 3KYDD 1V1PA 2C7NB 2AQ1B 5HGQA 3P63A 2UUCL 2RCNA 4CHKA 3WALA 2I2YA 4P73A 4WFN3 1I6HB 2BA0A 1RM6C 5GADC 3WIMA 1V8CA 4XDDA 4YTPB 5J17A 4LF9L 1I35A 3TS2A 4B95A 1TWCH 2L11A 4XT1B 2C7MB 1LT5D 3J81j 4PMBA 2PW7A 2YYZA 4LUZA 2ATWA 3MXNA 2M0XA 3DCGA 1C3TA 4Z9CB 3K5OA 3A56A 2JY6A 4JI4Q 4OX9L 2GB1A 5KYIA 3F1ZA 2V4DA 3PREA 3OYYA 3K8AA 4X64Q 5IN7A 1HNWL 3R2IA 5G3LD 2EYFA 4CDCC 2CHXA 2MHVA 4HCPB 1VF7A 2EZVA 3SR6A 3DDCB 4NAWA 3VR8B 3MEFA 3OJ3A 4DUZQ 3CPFA 1MSHA 1QKZA 4WWNA 3DWAA 4II3B 4BBSH 2KYWA 2OEDA 4MEMA 1YNNC 1K0SA 1KC8C 3K5LA 1KLGD 1LTGD 1AARA 2DZMA 1XEEA 1X6OA 3QIJA 1YQ3B 4NQKE 4URKA 1Q90A 3OJ4B 5CHWA 1IBLQ 4JI1L 1MJCA 3H09A 5C3EG 1STYA 2EIFA 1J7CA 4LNFA 1WI5A 4OWTB 1SLJA 1LXDA 2M00A 2WS3B 3M4OH 1SNOA 4XE0A 4IJHA 1MPEA 4WORA 1Q3LA 1N6ZA 1SYFA 1TQOA 2LMCB 5BN4A 2F0JA 4IUTA 2HIXA 1D1IA 4BBSB 4GLSC 1L0XB 2BCOA 5C5MA 1U4RA 1EUVB 2DGYA 3L16A 2WXPA 1RRBA 3EJIA 1IKLA 2IT1A 2EDGA 3BDCA 3HKZG 4POFA 2NBVB 1WXAA 4MGYE 5AZHA 1F0ZA 3M4OB 1S3SG 4A3MG 5AFWA 3RMHA 1IBXA 1IW7C 1SB3C 3SE0A 2AL6A 2MQHA 2MJDA 1X56A 2EPBA 4XYQA 4WQOB 2H4OA 3NS8A 1SJED 5FKAC 1IBML 2C5LC 4JLCA 3CRLC 3QR8A 4CDDC 1E7ZA 4UAIA 1SBBB 3HOXG 3PF5A 1NMFA 5C3EH 2MH7A 1P16A 4DWFA 4A3CG 2CHBD 3ONAB 1LO5D 5EPJA 4W9EA 3K6OA 2W3RA 4LF6L 4R8NA 2PW9A 4W9CA 4L5SA 4CGYB 5IGDA 2KOLA 3RZDB 1C79A 5DPSA 4ZRZA 3M4QA 1FVIA 5IWAL 1OQQA 4JIOU 4A3KG 3PRPB 4HEDA 1UBQA 3UIPB 5GXGB 1T0SC 1WE7A 2FUHB 2LGIA 2R92G 3OIQA 2XWJB 2RSUA 2LWPA 1L4DB 3MC8A 5KNCA 4BOZB 4V190 3BZKA 3I90A 1GC7A 2XBBC 2RHQB 5C3EB 1WOCA 4F87A 1QZEA 5KIXA 2ZNVB 3BK2A 3KDFA 2ASQA 2ZJDA 1W3SA 4A3MH 2Q2UA 3A74A 1BUIC 4YY3L 3D32A 1TWGH 2L7RA 4X65Q 3E9HA 3Q24A 1M90C 1XMQQ 2KMCA 4JQWC 5CMDA 4PYZA 3AEDB 3TCAA 5IKCM 3CQZH 4C80A 3NPPA 1UE5A 4XWTA 4RF0A 2R7FA 1ROEA 1SF0A 2OOBB 3EFXD 4BA1I 3UINB 1MIUA 1EZ8A 4A3CH 1OQYA 2L4NA 3CXCA 1X3PA 4PQXA 3RT3B 4FP5D 1BUVT 2Z8LA 3BIID 1WTRA 1FMAD 2ZTDA 1IZ6A 3HKZB 3BVGA 2NVUI 3ZRFA 1Q82C 4W9HA 3VR6A 3GO5A 2PCFB 4M8AA 4A3KH 1WVLA 4A3MB 3WAPA 2OWOA 1MHXA 3QX1A 1E0ZA 3V6CB 2PMZB 1I7HA 1DOIA 2HCCA 1KH0A 1OXUA 3P1HA 2R92H 4LFAQ 3QA8A 3CQZB 4IFDJ 4O42A 1IYFA 3HOXB 2JQRB 2KBNA 2KCCA 1EY5A 2HD3A 4DNTB 2CHWA 2QKIC 3L0OA 3NVZA 1CZPA 1I4HA 3GTPH 3T13A 2LASA 4DQOC 1DOMA 4ZHOA 4IWOA 1VQLA 2KJHB 4POGA 4AWJA 5ELCA 3TL5A 4A3KB 4ID6A 1W6JA 4RCNA 4UP8A 5C4HA 1J8IA 2MCNB 1EM7A 3J80c 1WH3A 2K6DB 2R92B 2CU3A 5CR3A 4X66Q 2QMTA 4I65A 1PZID 1FFVA 3BWUD 5G55A 3VUWA 2Z0SA 1GNUA 4CJ0B 3W5VB 2V1CC 3HG9A 2KX3A 2L9HA 4MH8A 4BBNF 4ABNA 1Q12A 3PHXB 3TRZA 1D5XC 1QILA 2N1WA 4RHSA 1FGUA 4HTHA 4XDXA 2KQSA 4KKTA 4HRSA 2J0TD 4K7WA 1UE1A 3VYSA 2MEKA 1ET9A 3DHGC 3JSVA 4K1RB 4K3BA 4N59A 4P7IA 4F7ZA 5C5LA 4FDBA 4LDTD 4TQ1A 2I5LX 3PQIA 4KZ0A 1A2UA 2KTFA 4JL9A 1UGMA 1UGJA 4X3TA 1SNCA 1AH9A 3V3XA 3TZDA 2IYDB 2B2TA 4DPGA 1S5CD 1PFDA 4YWGG 4YT0B 1SFOH 1VDZA 1K53A 3D4RA 1Y56A 1V86A 1XT9B 5I6YA 1Q8KA 1UWXA 2CR5A 1UEAB 1S3OA 3DM1A 2JN4A 2CKZB 3ITPA 1EEFD 2K5DA 4W9IA 1LV9A 4RMFA 3CKIB 2Z0DB 4AQYL 3CCEA 2BPSA 5IYBG 2WU5B 3EUB2 5BYQA 4AUQC 4E71A 1AW7A 1C76A 2VZAA 4WJPA 2XGTA 2VZKB 3VTVA 2EYMA 3FVQA 1NENB 1KABA 1MG8A 1SFOB 3NBHB 5H8YE 3DXJC 1TYGB 3RLOA 2DAFA 2NTSA 2N88A 2CS4A 3VRBB 4IFDI 3Q6BA 3WCQA 2F0TA 2GRIA 2LVOA 4LAAA 4KN4C 1XMOQ 2LZ6A 4M0WA 3CF5A 3Q8DA 3DUZA 2Q8RE 5J2RA 4CKCA 2XWBB 5TR5A 4JYAL 3U52E 5M5YB 4KGSA 4DV6L 3ZNZB 1UNSA 1B9NA 3M85A 4WJNA 3N6RA 3L08A 2BWES 3V61A 1XF5L 1QVGA 5I2YA 3QAQA 3HVDA 3I70A 1A15A 3TEHB 1PYSB 2CH4W 2WKCA 3QWNA 4TSSA 1N32L 1TTNA 3CU7A 1BR9A 1KHIA 1T5EA 1TR5A 1C7YA 2CW0C 3OIPA 4GNXC 2KK8A 1WRDB 3F2CA 3HM6X 1QOFA 2DN8A 2INCC 3KQ4A 1CKNB 2WDQB 3TP7A 2N0SB 4TKOB 2FE8A 1IHZA 4CDFC 3I72A 1TIID 3V60A 2NTTA 2J0MA 2N3SA 5IGBA 1EL0A 5HURA 3PLVA 3GDEA 2CQOA 2OTLA 2WFWA 2YU9B 1K8OA 1QOBA 4P16A 4FXKC 2JWZA 3AU7A 4IUUA 4R4IA 3VA5A 3P20A 5IT9L 2V9HA 4LFCL 1WXMA 1CKMA 4ODGA 1C4CA 3OHXC 4K6LA 4N58A 5EAYA 4B3RQ 3PUYA 1PH5A 4KJOA 4JG2A 4JI7L 3J81L 1ASZA 1U9RA 3A9KB 3KF8A 3RD2A 1WX8A 2ZW1A 1EFWA 4MJSB 2RQXA 4BFRA 2QA4A 1G91A 3ZDMC 3UQAA 3OMGA 3GV3A 1SNPA 1JALA 3HIZA 3K57A 5DLQE 3KUCB 3KLRA 4KI0A 2CCZA 2QC8A 2Z0EB 4YWKA 1H9SB 1UBIA 3FKYA 2XSCA 5E1FA 5IY0A 1O78A 3GP7A 3SR1A 5JJZA 3SHLA 1A0IA 4NJ6A 3SU8X 3D4WA 4S3SA 2PE9A 1WJJA 5C0XH 3UDFA 2C9OA 2PZTA 1NYQA 1UZXB 3ZNHB 4HCEA 4IPHA 4OO1H 3RCZA 3O65B 4NKLA 4RHRA 1FCLA 1FD6A 1A70A 1STBA 2NVXH 4OIJA 1K83B 3UE1A 3CCUA 2NVTH 1WGKA 4PZ6A 1JE5A 4YTNB 2LS01 2KJ6A 3B9JA 3SDLC 1C0AA 3L17A 1VQHA 3L0WB 4DNRB 1BCPD 2K8HA 1IKMA 1FCCC 5BMIA 4XYCA 1EY0A 3NTHA 1HRJA 1T0RC 3B2FA 2HDLA 1OGWA 1PXUA 2A1AA 1A2TA 2WQYB 4EKUA 4A3LG 1FFUA 3NG0A 2I1KA 1QOAA 3VDZA 5IGGA 1MSGA 1U0LA 4I7ZC 2RMMA 1F2LA 4JI1Q 4CQNA 4HKQA 1EYCA 1WD1A 2VNUD 1RIPA 2WHIA 5DCNA 3I4MH 3AE3B 3VH4B 3FDTA 3VYUA 2ICEC 3DVGX 1N63A 3RYTA 1V80A 3SEBA 1FD7D 2NVXB 2NVTB 1FXAA 2EMSA 1JRUA 4IPCA 2Z6KC 4LWCA 2JZ3B 2PJHA 4KX6B 5HI1A 3SK4A 3LDZE 1EQTA 3WOFA 2M1MA 2Y5CA 4HJ9A 1WTQA 4DHZE 1DOXA 4JVZA 3PSEB 1A3TA 4IUPA 5C3XA 2JA8B 3ABVB 1SSNA 4DR5Q 3QIAA 1GUWA 1BQQT 4LF8Q 1EYDA 4LCDE 2FJ2A 1ZEQX 1WMHA 3QG1A 3QJZA 1JB3A 2Y5PA 1EOTA 4FXDA 1CKOA 3L10B 4P1BC 3LXFA 4BVUC 3RNFC 1B9RA 2WX0A 3AFPA 3MC0B 4US9A 1QVFA 1SMYC 1D1KA 1VQ5A 1PQSA 1VJKA 2B3AA 1IBMQ 2GI9A 3NQIA 4L5TA 3STBD 2KJXA 4A3LH 4DR3L 1TS3A 2KTRA 4KN7C 5NUCA 2EKIA 1E1OA 1SGHA 3TJPA 1KDBA 1WCMG 4IALA 4RKLA 4NDXA 1RKNA 4DV0L 5JHBA 4NP5A 3JC66 4LF6Q 1T5XD 2KWVB 1STHA 5D94A 3PIP3 3FRPB 3PO0A 3A33B 4U673 4L5RC 3VUXA 4ASWC 4DV5L 1IP9A 4R4CA 1WSPA 2K8BA 1XLNA 4BKSA 2WB1G 4EQNA 1F9QA 2ALYB 3LYYA 4AOFA 1TS4A 3W1SC 4OGQC 2QF7A 4K5VA 2XEWA 4LDTB 1JICA 2WINB 4DU9A 2SEBD 1Y14B 5EE9A 4NZLB 1Q1BA 4KKIA 1DOLA 1K8MA 1BVSA 1VQ7A 2HQLA 2KFJA 3PUXA 2JX5A 1YI2A 4YY3Q 3GTLH 2IY0B 2L00B 4MGKE 2RGFA 3EN2A 3U8ZA 4DR1L 2BVCA 3CPWA 1SIFA 4X65L 3E5SA 3VYRA 1OO9B 2DY8A 2WWZA 2GBRA 3BYYB 4IZ8A 2BS2B 1N36L 1JOQA 2OQ0A 3J80i 2N7DA 1WCMH 3N1ZC 3PUVA 1RJTA 2E3TA 3J7ZC 2HJ8A 1AWDA 1EWCA 2JRIB 1ZW7A 1RFKA 5EJWA 5JPNC 3L3OC 3NRZA 4A3BG 2GBJA 2BB6A 1PTOH 3CCVA 1QCBD 2LFNA 3PUWA 4JV5Q 3A1QB 3CCQA 3Q3NC 1YIJA 1MBYA 4J15A 3F2UA 2NPTB 2R61A 4LJOB 3GTLB 4KY6A 2AWOA 1F2RC 4GNXA 1ENAA 1Z7TA 1OFFA 3ZIMA 2I5HA 5KNBA 1P3QU 2NZHA 3NBHA 1E22A 1IW7D 1HNXL 4LFAL 2WACA 1Z6HA 3S24A 5C44G 1PH1A 3T1HL 1E6EB 4BXXG 4KJNA 1CK1A 1A6XA 5EKIA 1WCMB 2D3AA 2X69A 2MLBA 2NBFA 5LMNW 2A19A 3PIPA 4BOSC 4PT5A 3TEZA 2K4KA 1KJTA 2K9XA 4KGRA 1CMXB 1PTOB 1WD0A 1EO6A 3TQYA 4C7YA 4GU2A 3MWYW 4J6IA 2AMCB 2D3CA 5ELDA 2LD9A 1YHBA 2EXZA 1YJNA 3QQ8B 1QNKA 1WJNA 2DBYA 1NVID 4K3CA 2UU7A 2WB1B 3QHTA 5DAUA 1CM9A 2BE5C 4QJFA 5BYRA 2P5ZX 3EROA 3D6WA 1M94A 5KHOA 3RN9C 4OEMB 4A3BH 1E7PB 4MTKA 3PO3G 3FKIG 3ML8A 2WV6D 1R7SA 4IURA 2IO2B 1P0RA 3ZW3A 1RCVD 3P4PB 3H3VH 3JAMc 2KUMA 2KENA 2Q5WD 4DDID 1Y69U 3S2DH 5JXVA 5EKLA 3E0JA 4H02A 4EE2A 2MP2B 2F0OA 4LK1C 4ANUA 4MM3B 2XNAC 3Q8BA 1EWHA 3CCSA 1NI2A 5H92C 2NBUA 2CQAA 5C44H 3DBLB 3IAM1 4C7ZA 3J80E 2YLMA 3H15A 4X57B 2PO4A 2IL8A 5JEAJ 1PRTF 4USAA 3A9JB 1PTOC 1B70B 4A3BB 1N60A 2AX5A 1RODA 1XD3B 4L1BA 4J1MA 4MACA 1XX8A 1EF1A 1JWUD 2VXWA 3CCMA 1N33L 3JVZX 3A9KA 1E9MA 3S2DB 5T8IA 1JMCA 3PZ8A 2RDGA 2FIFA 1JJGA 2MFIA 3RULA 3RNAC 3K9OB 4RG1A 2HT1A 2DHZA 5C44B 4KY5A 3FAHA 3RPFC 3PO3H 3MHZA 3FKIH 4JWUC 1G2SA 4DR6L 5AUIA 2NZ1D 2K0PA 4YCUA 3RZOH 1H9SA 3DBHI 3EFCA 4AQYQ 1EWIA 1ZKOA 2KACA 1WZ3A 1STEA 1AEXA 3DM3A 1VS0A 3DWQA 3JAML 3GTOH 3TEXA 3IAS1 2A6ED 1GM5A 5LL6X 4K7SA 3B08A 4W9GA 3GB1A 3NZUA 1PUTA 2M19A 2NR2A 5D2MB 1LT4D 4GN3B 4GOPB 5I6WA 1P7FA 3PO3B 5LNK1 3FKIB 5KNDA 4HSVA 1O80A 3H3VC 4JYAQ 3Q0AA 1BCPB 1JT8A 3S14H 4ME3A 4DV6Q 4I6LB 3BVZA 1CTMA 2JP1A 1TWAH 3WOEA 2E2JH 4K8JA 1C1YB 1R9TH 2KANA 2L1BA 5HFYA 2EYHA 2QW7A 4MM3A 3UE0A 4HDQA 3MXGA 3GTOB 5H1SE 1EIGA 2K28A 4B3SL 1N32Q 4FJZA 2B63B 5I9PA 1JORA 1JQYD 2DWQA 1Y1VG 1PH3A 1PFNA 2ZVOA 2QCZA 3BDLA 1XQQA 2EMTA 2KLGA 1FM0D 2RSNA 4IN3A 4KD4A 4OZBA 2MNAA 4N8FA 1TWAB 2UXCL 2E2JB 2SDFA 3FPUB 1R9TB 2ID0A 1WZ0A 5IO9A 1J9OA 4P75A 5CGKA 3W1SA 5JZEB 1LQBA 2E2DC 1H9MA 1IL2A 5JJIA 2HCIA 1I6HH 1K3RA 3I4NG 2KD0A 5ISRA 2XN9C 4LFCQ 2DUDA 4AQ7A 4K5XA 3T53B 1T3QA 2ZXOA 1HZCA 3CCRA 2B2VA 1SR3A 1FJGL 2F0UA 1PH7A 4JI7Q 3CC7A 4GB9A 4DR4Q 2WXFA 3QOJA 3CC2A 1X3QA 3BDOA 2Q2IA 3AEAB 4A4IA 2LGXA 1F9JA 3TEYA 3P2BA 3K5MA 4Q2JA 4ANXA 4XGAB 2LI5A 4JPBW 3ENEA 1FL0A 2K50A 1IBKL 2FAZA 1BF4A 1C8CA 2JK8A 1VD2A 4KDLB 2AHOB 1Y1VH 5D65A 4XZ4A 2MWSB 3P4SB 1JJCB 3WWVA 1S4ZA 4JBKA 5CV4A 3PIOA 3G48A 1TKEA 4TV3A 3U7DA 4MNOA 2BDNA 4FO2A 5FO8B 4JBWA 2ZXRA 3HRDD 2WGSA 5CV9A 5E6NA 4LF4Q 4I6PA 1PRTC 3KH0A 4JBJA 3I4NH 2ZVNA 1A62A 2F0GA 4YIJA 3GTKH 1E8XA 1V49A 2J42A 3AE1B 3NZ3A 1H9RA 3NELA 4IOCA 1Q5WB 2L05A 2F0KA 5CYUA 2WAQE 5DNFA 4NXNL 3U50C 3TS0A 1Y1VB 3VR5A 1OTRB 2NN6H 5G2NA 3UIOB 2CFMA 4QL5A 2B2TC 4QGUA 1PGAA 3LWEA 3T4AC 2DX5B 4UHVA 3VR9B 4XWWA 1SDFA 4WAAA 3C8YA 4BKGA 1YNXA 4ANWA 1GJZA 1VDVA 5C0XJ 4DV4L 1EU4A 3OMCA 2B29A 1VMPA 1SN8A 4XX5A 1X3FA 1N8RC 4NMZA 1S5BD 4DXGA 4EQPA 4W9JA 2LKVA 4WAFA 2FCMA 3I4NB 3RMKC 1KF6B 2XTIA 1GHKA 3GTKB 1SE9A 2L52A 3A1QA 1EY9A 3U7ZA 3EA6A 3JW0X 2OJRA 2KQ4X 3K80C 2W9NA 4LK0M 3ERSX 1TY2A 4HCSA 1CQVA 3CMMB 4C1NI 4LNNA 1VQGA 3QWZB 2O6VB 1JOOA 2L0CA 4NXML 1Y8NB 1PH9A 3PO2B 2WDVB 5D3DA 2A8VA 5K5PA 4IUMB 3RNCC 3TSSA 2HDMA 4DR5L 3K0YA 1IUEA 4LF8L 3GTMH 3BG3A 2I0QA 1VF5C 4PMCA 3RZDH 2J0JA 5LHY1 2A68D 1F9RA 1I5FA 1MHHE 4L23A 2H89B 1RFAA 3T56B 1X9NA 2EYPA 2JA5G 2DAJA 3MTNB 4OHJA 3R8BA 2KC2A 2RPQA 3L4PA 2NB0A 4DR3Q 2FCSA 2K7VA 5FJ8G 2I1JA 3I4OA 2Q8TA 4YSYB 1QNUA 3AE2B 4DAPA 4DV0Q 2VUMG 4DFAA 1MG4A 3W5UB 4XQQA 4WJWA 5F2DA 2WB1E 3GTMB 2UU9L 3D3RA 3NQTA 1ZOYB 3S1RH 4DV5Q 1ZPSA 2UXBL 4LFBL 4LTUA 1WE6A 1LTBD 4A3FG 1WIAA 1L2NA 3MFYA 1LTLA 4BA2I 2Q2HA 5C6AA 1K9MC 3R66C 3AB9A 3TEWA 1BXTA 1II3A 2QILA 1WGHA 3U58A 2INPE 4HXDA 3R7QA 3QARA 4U68A 2XRQD 3TMPB 4KSKC 5I9OA 5FO7B 4HJGE 2YTVA 3EIVA 3L2PA 4ZK9B 4IW0A 3TIXA 2KKCA 2JA5H 3ZJYC 2KWCA 5HKHA 4DR1Q 1YZ6A 1HA6A 3PCOB 4F8CB 1ENFA 4M1UB 4WIPA 1X65A 1NI3A 3S1RB 3SXHA 5FJ8H 2JA7G 1BMLC 4RKBA 1EIYB 2N9EB 3VTUA 1CI3M 4ZAIA 1KAAA 3HOXH 1N36Q 2N9KA 2NBWB 2QJLA 4NNJB 2J4XA 2ZTCA 3IVFA 3CP0A 2WXNA 4JC0A 2VUMH 5BMGA 2B8GA 4UDUC 1R4NI 2GN5A 3KLSX 5KHQA 1YNJC 5KGUA 4DHZB 1EWYC 3NWSA 4QIWB 4A20A 5FR6A 2D0OA 5TSSA 4BKTA 3TN2A 5EGTA 1DXMA 4JV5L 1ZUD2 1QLBB 2JA5B 3S17H 3JAMi 2A69C 4A3FH 4XIGS 3HZXA 4IC7B 2Z4HA 3S16H 2K8CA 4BAXA 4W9DA 3ZDTA 1U4AA 1EOVA 1HNXQ 3OSOA 5GAGC 3PUZA 3C2PA 3KWLA 2DNCA 4DR2L 3T1HQ 4C4VB 5BYSA 1PDQA 1AE2A 2ZNVC 4RGOS 1VQ6A 2PVGC 4FULA 1SE2A 2VUMB 2V3PA 3A4SC 4FHJA 3SHQA 4YTMB 5LL6S 3U4VA 4A76A 1FXIA 1P9DU 1Y1WG 3PLUA 2AL3A 2K1FA 1L1OB 1DM0B 3WDNA 3BY4B 3IFDA 2JA7H 2WLBA 3T8MA 2WXHA 4GDKB 3S17B 3T3NA 2EKEC 4A3FB 2MBBB 3APFA 4LNOA 2IGDA 2YTXA 3S16B 1QOGA 3C1EA 1WJ6A 2PI2E 5DM73 1HQMC 4G0NB 1KOTA 2F4IA 4HN7A 4A3DG 1WTHA 3W1GA 5IA7A 4KV2A 4B9WA 5ELFA 1J7AA 3S1NH 1DCZA 1K73C 2JZZA 3H8HA 4KVGB 3PGEA 2N78A 2EOTA 3ER0A 4UP7A 2VQEL 1L5PA 5FR3A 1GUNA 4A6QA 2KDFB 2L12A 2BWFA 2JA7B 1WR1A 2D9UA 2B2WC 1ZDVA 3RR5A 1Q46A 1VQNA 2IX1A 4H7BA 4IQZA 4LJPB 1D5MC 1IPGA 4B3ML 1GHJA 2MGSA 4IWQA 5M5XH 1N34L 5CHFA 1Y1WH 2MJEA 3OWEB 4OWXB 2PZUA 5LMNQ 2Z9HA 1Q86C 1L7YA 1T0YA 5L83A 3DVGY 1N33Q 3S1NB 3RNBC 2N9LA 2FHTA 1ZYRD 3DOWA 4TMAB 2R6GA 1HTOA 2VY3A 2PE6B 2TSSA 4HVBA 2I07B 4B6WA 1CA5A 3C0RB 1GD7A 3AEVA 2VRRB 2KDBA 3VAWA 4RMAA 4ZRQA 4A3DH 5A2QE 4IOIE 4MELA 3H0GG 3GZNI 4DR6Q 2HIVA 2HE7A 4DK5A 1YD8U 4KZCA 2JEBI 4A3IG 4PS8A 4C00A 3ULJA 4DV3L 5M5XB 1Y1WB 3P7JA 2GVAA 5M5YH 1PA6A 1XNRQ 2OHFA 1V97A 4A3OA 1KD1C 1KM7A 5IE8A 2IWHA 2INNE 1CHPD 4FYDA 1JWSD 2SNMA 2KOXA 3UDXA 1YX6B 2IW3A 5DPRA 1UEBA 4JOIC 4KDIC 1BBUA 5K36G 3H6NA 3AU4A 2KNBA 1G51A 1HFNA 5IT9c 3QO2A 1WXVA 1YJJA 2LXKA 2WXIA 2KHIA 1D8LA 1TKWB 5IGEA 4A3DB 4TUUA 1WWTA 3MEHA 2MRPA 2WYQA 3J9CA 4HROA 2E5LQ 3MHBA 4GN1A 1IYUA 2PZWA 4NJ7A 3HEJA 3SGIA 1NUCA 4QMGA 3J81c 1FRRA 1OQRA 2YTYA 4WWOA 3ONSA 3WANA 2KEEA 3RUZA 4CO7A 3F2BA 2WIIB 4ALPA 1B8AA 2O2VB 3P1MA 1X3EA 3S15B 2HJ1A 4C3JG 1Z2MA 1TT2A 2J7QB 2I46A 4B0EA 1UD7A 2YU9H 1WI0A 1ZKHA 4B3SQ 3H0GH 1KRSA 1MJEA 2RDFA 2Z59B 3EHVA 4KTAA 5DM63 4A3IH 1WFYA 2GLSA 3I4LA 1WTWA 2FNJB 4AYBE 4RM9A 2LMCA 3VRAB 5IYBH 1NTGA 2BA1A 2VB2X 3S1MB 4ZYSA 4PG3A 1H4RA 2B8FA 4IPGA 1WY8A 1YMHE 3AULA 1X32A 2CWPA 2O6VA 4RCOA 1YEZA 2UXCQ 3PRMB 1O7ZA 3MTSA 2EE1A 5K36H 4D2KA 1SYBA 3AXCA 1MFWA 1LTTD 1SJHD 4CDEC 2N9XA 5IP4D 3NOBA 5E6OA 2E75C 2K5QA 3MHSD 4ULLA 2MA9B 1WFQA 3LNNA 1IBXB 2RBMA 3H0GB 2FCQA 2OCEA 1G2TA 4A3IB 2FCNA 3N1XC 1FJGQ 2F0PA 2IX0A 2C7HA 2YV5A 2M8SA 4QF4A 2KO3A 2QGQA 4K2LA 3A5ZB 4C3JH 4DR4L 1HZ6A 4KKUA 1B50A 2MBQA 4DAYB 1F1HA 3QB3A 2JA8G 3TZUA 1GPXA 3IT4B 1QUQB 4GMVA 2ZTEA 3R3OA 1IBKQ 4GLAC 4DR7L 2DLBA 5FLXL 2Q2TA 3SFEB 5GROA 3QK0A 4LUVA 1K83H 4CBVA 4IOAA 3ZJVA 5EBDA 2JRHA 5LMUL 3M3JA 4FJVB 1P98A 1WXQA 2XIWA 4YXDB 2QDBA 3KOJA 2NCNA 3VVWB 3C46A 1EQQA 2FFKB 4G7HC 3CHBD 3KF6B 4OL7A 4B0MA 5E6PA 2PQAB 2FMCA 1J0GA 4C3JB 1ZXHA 2JUOA 4KY7A 3RFZB 4LF4L 4E3CA 4WJOA 4W9LA 3H6MA 1FPYA 2MJ3A 3C3LA 3A54A 2KC1A 1NBWA 1PZJD 3CMAA 1JC7A 4NXNQ 2MUYA 5DEHA 3KBGA 2AWTA 2VB3X 3I8ZA 3W2DA 2IX3A 1EF5A 3DBRI 2NYZD 4ITKA 4DHJD 4IDIA 3R2TA 3Q3OC 4RGNA 2WXRA 5HY6A 5AJ3Q 2JA8H 2WAQG 4MGZE 1QE6A 4DV4Q 4V0BA 3ZUNA 2K6QA 1SXTA 2F0FA 5IOCA 2QCPX 2A6HC 3SVMA 5CC4A 2REXA 4EUTA 2PLPA 2RR9A 2N7JA 3E3XA 4HKZE 5C1ZA 1N5XA 3I73A 3SDZA 1PH2A 5CHVC 2OT2A 2RA4A 4DK1A 1S40A 2YVCA 4LNIA 2LGDA 4B9XA 5A35A 1HZBA 2YEPB 4DK3C 2JYTA 1AP0A 3JYUA 4LF5L 4FN2A 4QY7A 3PV1A 3LB8C 4NXMQ 3CF6E 1D7QA 5IODA 4QIWE 1GOZA 1WTPA 1QQRA 2RKSA 3D6CA 1YOVB 2B2WA 2UYZB 3AQQA 5FK9C 3PS6A 4P1CC 4AJWA 2D3GA 1WYGA 3OW7A 5KYLA 1R4NB 1IYJB 2WX1A 3Q8CA 3W9CB 2VH2A 2HUGA 4DK0A 3H9DA 3VH3B 1K8AC 4IO9A 3X23A 4QQBX 1L1OA 2WDRB 4A93G 1PTOF 4K2KA 2RDHA 2NVYH 3S1QB 4GDKA 5LXHA 1NAPA 2F3WA 2K32A 2R93G 1ENCA 2X38A 2D10A 1U5KA 1GG3A 3EVQA 2R7ZG 2F0EA 3FILB 5BN3A 2O4XA 2RHSB 2KDIA 2A4ZA 3APCA 3ND8A 1Y8OB 3WAMA 1S5ED 4H13C 2V1YA 4GKKL 5M3FG 3UF8A 3IHPC 3HKSA 1J5EL 1GUTA 1HZAA 2UU9Q 1O7YA 2AUKA 2K01A 4IPDA 3O13A 5IGCA 2UXBQ 3VFKA 3G7LA 1VQ9A 4LFBQ 5EBCA 4FXCA 4TKNA 4BY7B 2F1MA 3J7AV 4KHPQ 1RWSA 2NVYB 3SFDB 1LM0A 2KJRA 2L0FA 1EYAA 2QEXA 3HOZG 3NUHB 4AS1A 2WAQB 1RAXA 3T9LA 2XVSA 3AEBB 3HGBA 2XK5B 1E8WA 4JOIA 1YNND 2L32A 3KVFB 1GUAB 3Q3JA 1XPUA 3I91A 4YCVA 1C9FA 3SD5A 2Y0SE 4IFDG 1V1PB 4JI8L 3VQIA 2C5CA 1QVCA 4MTNA 4XTCS 2ZJPA 5ELBA 2B2VC 3W1BA 3GE8C 3H7PB 4JCVE 3IBEA 3MC9A 4IM3A 2MQJA 5IAAC 1B53A 2R93H 1SIJA 2V3SA 3OAWA 2BH2A 3Q8EA 4F1SA 3MZ5A 1KDCA 1ICFB 2RVLA 5L95C 2R7ZH 2BT6A 2HTHA 3S2AA 1STAA 3I55A 2KT7A 3Q22A 1B9MA 1DD2A 3AE6B 4HWIB 1ZDXA 1E5WA 2E8GA 1WGGA 1ISNA 3BINA 5CX3A 4L8JA 5M3FH 4IM2A 2ZT9C 1UE6A 1Q1EA 1WGDA 3RNGC 1MKHA 3M62B 2AQ3B 1PVOA 1HHVA 4K81A 1TVXA 1QG7A 4LLGM 1HJPA 3UI2A 1S5DD 2WXQA 5J3BA 3AYHB 1PFSA 2CWAA 4NY0A 1CT1D 1ASYA 4A93B 4S17A 5HG2A 1F77A 4GLVB 2C9WB 1EEID 3HOZH 2R93B 3AMUA 2ZPNA 4NAWB 4CKEA 1C9OA 2IO3B 3HK0A 2GVBA 4P72A 2R7ZB 1E10A 4DR2Q 1PH8A 2A5UA 5FLMG 4NB3A 2TMPA 1RD9D 2X6LA 1FEHA 2QDFA 4GXBA 4IFDH 1GB1A 2ENBA 3NP8A 1SE4A 5M3FB 3CCLA 3HOUG 1G6ZA 4JBMA 3I2ZA 2FINB 2B2YC 1QJOA 1CQFA 3GZNB 3EQLC 3NK9A 2BQQA 3LJ3A 3ZNGC 4ZDVA 1NSNS 3KYHC 1LM8B 3A7AB 2I5MX 2WP9B 3NVWA 1BKBA 3KUPA 1CFMA 3BZCA 2G1EA 3ZJUA 1M8AA 3HOZB 1TWFB 4CYEA 1Q8IA 1L0VB 4E6IA 2LVPA 2MSED 1ML0D 1WTXA 1EZ6A 4KMUC 4P2CB 2IHEA 4OWWB 4US8A 2G5DA 2BKFA 4HEA1 2J7ZA 1I4RA 3DMUA 5MPOA 3ZQ4A 4OXPA 4QB4A 1OXSC 2LGSA 1FNVA 1QT9A 2BKRB 4C56C 1EUJA 2VQEQ 1XO3A 1VQAA 2F0HA 1YQ4B 1CKNA 4HIKA 4BY1G 4NPNA 2CJNA 1S1QB 1W2BA 3PZDA 2Z1CA 2DYOA 2EELA 1HCZA 4BXXH 1F52A 1Q81C 3B6YA 4DAMA 1V5TA 3Q8FA 3V2TA 4B3MQ 3HOUH 4N9F4 4YSXB 2PIAA 3AEFB 2B63G 1UE7A 1AE3A 1N34Q 2BYVE 4J8QA 1OXXK 2ICIA 4K0KL 1AZPA 4YHHL 3GTJH 5E6JA 3ZJTA 4KD3A 1VQPA 4A3GG 3U2SC 3T1YL 4PS3A 3VXWA 2K03A 3L9AX 3J81i 1VRAB 3K9PB 5LMNL 1GUOA 1BBXC 3VDYA 2WXKA 3A0JA 5CBEE 5D3IB 1EIFA 1MI2A 2BS4B 4GIVA 2V3NA 3OW2A 1HR0W 4MJSA 4BZAA 1U4MA 1JWAD 2RSOA 2JVCA 3U9SA 3BVMA 2PMVA 3DVNV 3HOUB 3E9SA 4Q5VA 3EECA 1TZ1A 1MGSA 2WXGA 4EVOA 4DV3Q 1DOYA 4HIDA 3GTJB 1EU3A 3KUDB 3SK5A 4MIUA 3KDFB 1PHJA 4W9FA 4BY1H 2K22A 5C4XG 5ELNA 1XNRL 4GDLB 3D0FA 3WA0A 5G5GA 4ZRPA 3I57A 5AZGA 1X55A 3I3CA 1H95A 3VUYA 2QSDA 1LABA 4WWMA 3Q3FA 1YVCA 2VS1A 1UWVA 1IYVA 2IDYA 2IHFA 3IG3A 3S2HH 1OEYA 4FJYA 4G7ZC 2B63H 4ZOHC 1KL9A 3IFWB 3M63B 1DOKA 3ZTDA 1IL8A 1PH4A 3PF4A 4QUFA 1KRHA 2E5LL 1X3GA 2ASBA 1UAPA 4M00A 2GMIC 1V9JA 3CIRB 2K6AA 1NBFC 1LACA 4G57A 3RD4A 2SAKA 1RF2D 4BY1B 3IT6B 3PIO3 3ML9A 3IL8A 1HE8A 5JVH3 5T1GA 3KW5B 3KJOA 5E4XA 2E2IH 1O7LA 2JEAI 2AYOB 1HR0L 3N32A 1PYBA 5IT9E 1I4XA 1YJ9A 3S2HB 2ZM6L 4DUYL 4RH6A 2IBIB 3A7LA 3OWFA 4A3GB 1IXRA 5C4XH 3DBRB 3J81E 1GUGA 1VQJA 3D4DA 4O0AA 4EZLA 2FUG1 2JXTA 3ZYYX 2KHWB 2PYKA 3NHHA 4HLEA 3MJWA 1EQVA 1C4QA 1I94Q 2CKHB 2L3ZA 4W9KA 4K6DA 2KZRA 1I6VC 4AYBG 3AFQA 4CJ2C 2EQSA 2N55A 2F3VA 3NE5B 1AZQA 2E6XA 4X3UA 3R3MA 1BBWA 3FPPA 4P6VF 5LXIB 4MN3A 4GOPC 4DA2A 1YITA 4CHTB 2E2IB 1AFPA 4M8MA 4EZJA 2LXJA 2Z6BA 1K3BC 2A73B 5D14A 4HJ8A 4A3EG 2PNHA 2DYBA 2E74C 3AEEB 1BCPC 2DYMA 1I4PA 3NY5A 2K1BA 5EDSA 4FF3A 5KRUA 2JT4B 1EFID 2SOBA 5C4XB 3PRZA 4ARCA 3PO2G 3FILA 1LT6D 2MO1A 4TQ0A 1QWYA 2MW5A 4DR7Q 2F0SA 4BKSD 1TWHB 4PS7A 2FMMA 4HMJA 2ON8A 1PFMA 3JSVB 4R8IA 5LMUQ 1ESRA 1X1MA 4ZKCB 5J1ZA 3E56A 4OONA 4OW0A 3K58A 4XC2A 4MHEA 1TGZB 4K5WA 1E7UA 2G9HD 4A75A 4A3JG 1T0QC 1JR0D 2EJMA 5GAHC 1CUKA 1HZ9A 1Z47A 1CSPA 2XK5A 2F0IA 4X3SA 2JU6X 1SE8A 1K51A 1OEYJ 1F2MA 4JX1C 1C4PA 4G3XB 2PVOD 1ET6A 1RTOA 3P75A 1E7VA 1L6VA 2ZEQA 1FXTB 3KYCD 4A3EH 3D8GA 4HPLB 2KXJA 3RLFA 2B2YA 1HEZE 4BS9A 3H7PA 2KCMA 3AB5A 2NVQH 1FNWA 1E0BA 4XQNA 1ZP0B 3HVZA 4ICUA 2AWNA 3STBC 4FHKA 1GXDC 2JJQA 1L4ZB 3PO2H 2V0GA 1VMCA 2CW0D 4HIMA 5AJ3L 2UXDL 2ACZB 1BNZA 4DV1Q 2VZKD 3FEWX 4AYBB 4EQOA 4Y7NH 4A90A 1HUMA 4A8XC 4B3TL 4WJ4A 2K5PA 2F0NA 3DHHC 1HXYD 2LRWA 3DPDA 4I6NB 2LUMA 3OG5A 1VQ4A 1V43A 4OZCA 2QEJC 1XNQQ 4A3EB 1E2VA 2KHSA 4M0WB 2NPTA 4GN5A 2L15A 5DPWA 4LF5Q 2NVQB 3UQBA 1CHQD 1DGSA 3KLSA 4A3JH 4ACFA 4R4QA 4X62L 1G6PA 2VH1A 3IKJA 4L6TB 3RLNA 4EX5A 2LHEA 1K8GA 4NAMA 1TWCB 2EY2A 1G8ZD 1E24A 3QC8B 4F7XA 4IG7B 2G4DB 1N62A 4OVVA 1E8YA 1D6EC 1HA5A 2O2LD 4Y7NB 2G45B 5HGTA 3TP5A 3H91A 1KXLA 3AE9B 2F0VA 4HJ5A 2HHHL 1ILQA 2EXDA 2Q8IB 1TXYA 3I56A 1JW9D 2J52A 1HTQA 5C2TB 2I38A 5CTRC 1YQBA 4LMQD 4A3JB 2PPHA 1HPCA 2M17A 3CSTA 1TJEA 1EY4A 4N9PA 3KBXA 3DBSA 4JWSC 1TZOA 1STGA 2EJFC 3HS0C 4DF7A 4HPMB 5EQ0A 4GKKQ 1K52A 4S0RA 1J5EQ 4QCLA 3HP3A 1OTCA 1TKYA 5ELOA 4HPPA 3H7SA 4JGHB 1RLFA 1E2ZA 3TREA 3T3OA 1SYCA 3Q3MC 2JXXA 2CVRA 1LLRD 1WRIA 2L83A 5JOBA 4DK6C 3PVLA 1PZKD 3VYTA 4ZQ3A 4FXGC 1YIWA 2MP2A 4IM0A 5HHDG 4ANVA 4KHPL 3A4RA 2IGHA 3X3MA 2DNFA 2D0PA 1L0YB 1D2BA 4AJYB 3CRKC 2L76A 1KLVA 4G4KA 2L55A 3KF8B 1BO0A 1VQEA 3UDIA 1G291 3P4QB 2DZJA 1NE3A 4JI8Q 3A9JA 3DHIC 1SRUA 2A6HD 1FR3A 4UPAA 4G50A 3NTIA 3C19A 1E2WA 1IGDA 3PTFC 2BOSA 3GS2A 2Y0SG 5AZFA 2KQ7A 1S72A 1V81A 3APDA 2N8NA 1Z5SB 3BK1A 2K5NA 1KQSA 4CKBA 4DV2L 2LRUA 2W82A 3T16A 3ZXVA 4YCWA 3EFUA 5C0XI 2IY5B 1DYQA 1SYDA 3BJUA 2D07B 1CA6A 4DKAC 4PYUA 4ZRIA 4OO1I 2RDBC 3L13A 2JE6I 5M3MG 4REZA 1JWBD 3H1UA 4RAUC 4GDLA 3HM3A 1JQ4A 3NVYA 1TBEA 2NUCA 3NZSA 3PT2B 1NJIC 2N49A 2VL6A 3URYA 1CZGA 1W6KA 2KWDA 2KMMA 1SMYD 2O5JC 4X3KA 1XWEA 1JJ2A 4C1NK 4II2B 2GA4B 2NS5A 2DJFC 4GOPA 1LTSD 1N5WA 2UUAL 5E3FA 2K14A 2JYEA 4G11A 4WWPA 2N9PC 5G3LF 4MH0E 3TMEA 2PI2A 2PQEA 2MBOA 5JEAG 1WX9A 4GN4B 3DBHB 2HQEA 1F2YA 1X54A 1CJEA 1HFGA 1YBYA 1Q0WB 3HHMA 3M95A 1K8RB 1HUNA 3T51B 3KUZA 4DV7Q 1D3ZA 2KCTA 1TWGB 4IUQA 1XCTL 2KA7A 2EYJA 4LF7L 4L2YA 2B76B 2NMQA 4KKJA 3AEGB 3TP6A 4AIMA 4AP4C 4H0LC 1IGCA 1KNEA 3V96A 4WJ3M 1YJ1A 2IO0B 1D4BA 1L0WA 5M3MH 2LSSA 3EC8A 1B7YB 2G4SA 1A3UA 2GOWA 1WMHB 4M8NA 2OTJA 3P4RB 1RYJA 3MA2B 2Y0SB 1WXSA 3BZDB 2MJ8A 3HOYG 2LXCA 2A6EC 3NUCA 1QZGA 3NWTA 3EBEA 3HOVG 2RF4A 1F2RI 5JHAA 1HNZL 1GUSA 1KIXA 1V5OA 3Q8AA 2KTRB 1XYIA 2Y3AA 1Y8RC 1A8VA 2JYOA 3KFUA 1MVKA 4WJQA 4K0KQ 5JH5C 4YHHQ 2CU1A 4CJ1B 2F52A 3U9OA 3T1YQ 1L1OC 2JXMB 3PSIA 5JEAH 4GKJL 5M3MB 2BYTA 4NJCA 4WQMA 1ESFA 4NQLB 2JA9A 3JAME 3GTPB 3QCAA 1YN3A 4RM8A 4K7UA 4R3DA 1SNMA 4JI6Q 1T6BX 1M4VA 3B1LX 2BS3B 4OELB 2AUJD 2L5TA 3M4PA 4FNFA 4ZRJA 2AQ2B 2BF8B 1ACCA 4UP9A 4XT3B 2DNEA 1V1QA 5EE0A 3MVVA 3AE7B 1KRTA 2BGFA 2H88B 2Z4IA 3DEOA 2KVMA 1MD2D 4JI2L 4B9KA 4YL8A 3GD7A 4JI5Q 4RF1A 2KLCA 2F03A 3VR4A 4ZRKA 3GOEA 4ILWA 3AE8B 3A5UA 3HOYH 1J19A 1H9JA 1JOKA 2DY7A 3OPOA 3S15H 1ZE3D 3HOVH 2PTLA 4GS3A 2KMAA 1ILPA 2WNMA 1CZWA 1ONLA 4DNIA 1H8CA 1HQRD 5IGFA 2X8XX 2KDEB 3CCJA 1XCQL 4L5QA 2B3GA 2RCFA 3TBIB 3H94A 4RFBA 3E0EA 5GQOA 1E3PA 3G6EA 4MDKE 4JI0L 1YHAA 1WX7A 1T9HA 2BE5D 4PZ8A 3ND9A 2MBEA 3AU5A 3GV6A 2ZCCA 2KEDA 3J80L 1WJUA 3CSFA 4HAEA 5EPLA 5JVG3 1KFYB 3S1MH 2LFIA 3KK7A 3DQVA 2KAJA 3PGZA 3G4SA 2ZJRA 2NWGA 1WR6E 4IJLA 3HOYB 3X3NA 3AE4B 4IKGA 2J53A 5FLXc 3K0XA 3HOVB 1XLOA 4O1NA 4GNXB 3I9V1 1XPRA 2WXOA 3RI7C 3TBLD 1GB4A 3MXUA 2JSVX 1HR0Q 3BYTB 1STNA 3K59A 5M5WH 4MSQB 4RGTA 3PMFA 1PFBA 2ZM6Q 4DUYQ 1VQKA 4KLKA 2HD5B 4JI3Q 3BU2A 4ZCKA 3HOWG 1JB7A 3A8KE 2YEPF 5IYCG 3ETRA 1B3QA 1PTOD 4LJZC 3R93A 1Z9FA 5JPMC 4HIOA 3V62A 2JQOA 2DZIA 1NNXA 2OEOA 2BB5A 1I94L 3RZFA 1FNUA 4PV1C 5CV7A 2M56B 2EYLA 3FHWA 4X6AH 2DENB 3DBLI 3NJTA 2KX0A 1QOHA 1XLQA 2EJGC 1PMRA 5CV8A 1SE3A 5M5WB 1DZ1A 1PH6A 2F4VL 1K0RA 2N1VA 2FIDA 1NMGA 4KIKB 4KV6A 1KAWA 4M02A 1ZXIA 3OOCA 4XYOA 5BR8L 5ELEA 3ZNID 4JK1C 1J8CA 3H3VI 4HMIA 4KHVA 1V6EA 3B0AA 2WXLA 3TP8A 3F2DA 1PDXA 1RTNA 2EYOA 1F9PA 3B2GA 2IPKD 2K5VA 2BYFA 1VZ6A 2GBNA 2KFKB 4ICVA 1LTID 3M4YA 2PW5A 2KHJA 2BTEA 5C0XG 4A9AA 1KDAA 4H44C 4N8X1 4XXEA 4C3HG 3BS1A 3HOWH 4Q0FA 4OO1G 4R4OA 4DBGA 2IGGA 1P8LA 1S5FD 5IYCH 4FF4A 2WXJA 2M9VA 2WP8J 1SNQA 1YJIA 2UUBL 4EGVA 2BBCA 2IJ0A 5JJLA 1E90A 3OLMD 1SYEA 2D5GA 5EKKA 2VQFL 1VLBA 1RL2A 5COYA 3U4EG 4DGZA 2LY7A 2LGYA 4OZAA 3OTOL 4QAYA 3RUIB 1G6JA 1LFDA 2A68C 4EQ5A 2K3UA 2PKOA 2UUCQ 4AH6A 1LGRA 4FF1A 2VW9A 1ICWA 4BBNC 2ZJQA 3NSWA 4LNQA 1R4MI 2L0TA 2OXPA 2F0LA 3I4MG 1MHWC 3VA7A 1EIHA 1JROA 3UDGA 5FOBB 1I4QA 1VQMA 3HOWB 2JF5A 4LF9Q 3UGBB 3VR2A 4BY7G 1GO3E 2M0AA 3ZLZA 2F0MA 4A3PA 2MBHA 2UXDQ 1ZGUB 2KDMA 1VR9A 2E2HH 3DWPA 2WXMA 1YX5B 4RGMA 4OX9Q 4DV1L 3GTGH 2MP1A 5KEEA 5CV6A 4B3TQ 4ZUJA 2L8JA 2F0WA 5L37A 4JI4L 4ZYNA 2FXQA 4LW1A 2KVZA 5E4WC 3CW2C 5AEKB 2K5HA 4C3HH 2ES2A 1HNWQ 1U4PA 4MSMB 1KTKA 3IAYA 2C35B 1NYRA 1JWMD 4X64L 3S1QH 1XNQL 1Q10A 2LEKA 3DWGC 2BYEA 3I63C 4MGIE 1MJDA 2V4IB 4X62Q 1B44D 4PZ7A 3LWUA 3X0WA 3ZO5B 1LT3D 4ZUIA 4HCNB 4GZYC 4ZKBB 4DUZL 1FGBD 1TS2A 2E2HB 3N20C 4EZKA 4C4VA 1WJ4A 4TQUS 3QOLA 4DXFA 1SSOA 2J0KA 4C3IG 2L1AA 2ZZPB 1BOSA 3GTGB 3PZ7A 4F8MA 5M9OA 3F8TA 2HHHQ 4PK1A 1IBLL 1FYCA 4C3HB 2JPHA 3N9YC 1MI0A 3ZGZA 5IIFA 3N52A 3LX0A 2H1EA 5J39A 4BY7H 3KLWA 1K28A 2QHOA 4HR7B 4OIKA 3UI3A 3J7A5 4PMWA 4TRDA 1XLPA 3CWIA 3ERQA 1QZHA 4R9WA 1V2YA 3M9BA 1C4AA 1SNDA 3ZRCA 3IFTA 1GAQB 1GC6A 3NHEB 3VHTC 1J6QA 4ZHPA 1SMXA 2BW2A 3HKZE 2EY6A 4XQJA 1B4OA 2EY1A 1AYFA 3PPAA 4ARIA 2ZCBA 5C4JH 3NEMA 1VCIA 2K04A 2K33A 4FVMA 1TS5A 1PRTD 4P71A 2D3BA 2PMZE 3I4MB 2NZOA 1VZ8A 4BWGB 2EY5A 1NY4A 5GAEC 1VQ8A 2KQ3A 4APVA 4KK7A 1V1OA 1UH6A 2LXAA 4ZLTF 5CORA 1WF9A 4NPSA 1PV4A 5C3WA 2HTME 2LUEA 4C2MH 3IXSA 2W3SA 1I42A 4C3IH 1H9KA 2FBWB 3MAQA 3DHQA 2CJOA 1LUZA 3I3TB 2JSOA 3LGJA 2E76C 1B1ZA 3E6ZX 1VQDA 3I5JC 5C4JB 4EFOA 4HSPA 3GQBA 2N4FA 4A93H 1SYGA 1Q7YC 1DJRD 1TU2B 1UELA 3DEPA 3U30A 1VQIA 2B2UC 4F88A 1PGXA 3WAOA 3ZXRA 2H5XA 5EE1A 3A8JE 4N6EB 4IUNA 5IWAQ 2BDOA 2K25A 4MT5A 4FA6A 1WM3A 1VZ7A 1KNAA 5D6JB 4YSZB 3W1YA 4DDGD 3MXNB 4DV2Q 4J6HA 1B2TA 3ZKJC 3M3YH 1EQRA 2MO0A 4C2MB 1YN4A 2D11A 4FLHA 4C3IB 3E9IA 3CC4A 2G9DA 1VQFA 3KWVA 5IOIA 1JRPA 4MZ9A 3W5OA 1BT0A 5LLIA 1YJWA 3AI5A 3AN1A 2RD0A 3RNEC 1U4LA 4TVAB 4HJKA 2KN4A 3GE3C 4DXAB 2IZVB 4OVUA 1QB5D 2NN6I 2DZKA 1TWFH 1L2FA 2IY1B 1I4GA 3K7UC 4IUVA 1VQOA 2GBMA 3G6JB 4R1JA 2WDTB 4YWMA 3FC4A 5J22A 1XMQL 1XTCD 3HRZC 4R4TA 1ZXTA 5CBAE 1FIQA 4GLXA 2C60A 4RWSC 1LTAD 5IP7G 4JE3B 5G5HA 1FO4A 2UWQA 3M3YB 4ME5A 3HUIA 1A3VA 3J7AF 2UUAQ 2JA6G 5D7GA 3C1FA 5BO4B 1QF6A 1PYWD 1EY7A 3V6EB 1WGRA 1JMLA 3M7GA 1ZYRC 3RN5A 5J18A 4DN4M 3K7AH 3Q69A 1R4QB 3P42A 4GSWA 2Y5BB 3K81C 5C4ZA 5FO9B 1BCPF 2O2VA 3ECIA 5IYDG 2W55A 4KGTA 1SEBD 3FP9A 4DV7L 4LF7Q 2CHZA 2INDC 3CAMA 3Q23A 2O6VD 4Y52H 1WGYA 3A8IE 1C77A 4JPSA 1E1TA 4B08A 1J7BA 4FF2A 2WKDA 2N7EA 3AH7A 4HDOA 5AUKA 3SK6A 4EOYA 1HZ5A 2PEAA 1A5RA 1R4PB 2F0QA 1L6UA 2OF1A 2G3QB 1XPOA 1VCBA 2LVQA 3Q2AC 2EVBA 1OXTA 4K14A 4IWPA 2WU2B 3G71A 3AE5B 3DWMA 5C3JB 3Q6SA 3NVVA 1HTLD 2QDLA 2IO1B 3K7AB 4GOCA 1SROA 3K5NA 3TUOA 1N9WA 1RDPD 4A55A 1EYGA 3CD6A
chains in the Genus database with same CATH topology
4QUCA 2KCNA 3VR3A 3A55A 5I4DA 5BMHA 3SK8A 4WURA 4OVZA 1YNJD 1NR4A 4RNAA 4DAYA 1NEKB 1V8QA 2A69D 3AM9A 1SAPA 4KKSA 1EY8A 5EPKA 3M7NA 2PNRC 1K50A 2W54A 2JA6B 2ZW0A 1TKGA 3AMZA 4NW2A 2QIEB 1C48A 1JE4A 1I50B 2RPVA 4RA8A 1P7EA 3NBIA 1TY0A 5CV5A 1KLUD 2M2LA 1OXVA 1UUPA 3AV8A 2JWUA 1C78A 3TDQA 2K05A 1UWMA 2B39A 1WTOA 1Y8PB 3S9WA 1PGBA 4WH4A 3J7YW 2K5WA 3NTKA 1YNTE 2D2CC 1GJXA 2LJIA 1XXGA 1HTPA 1N61A 1F2ZA 3EGRA 3AECB 1BDOA 2D5DA 3W3AA 2F0DA 2D62A 4L63B 2HDEA 3MP9A 5A2QL 3D31A 1NCVA 3RZOB 1NR2A 4DAVA 4PNYA 1RHPA 5FLXE 3GTQB 4KHZA 1LTRD 1DGJA 4XDCA 1DONA 3FMCA 3QJYA 2O5IC 2X6GA 3NXWA 1WTVA 2MPMA 2PPBC 2B2UA 1JCKB 3MFGA 1EY6A 5JAVA 1FRDA 2SNSA 2ONQA 3S14B 4BBRB 3MXPA 3PV0A 2JZPA 1AN8A 3V05A 4G7OC 3NS1A 1PRTB 5BN5A 2KECA 1PLFA 4N9TA 4WRDA 2XRSD 1F9SA 2A74C 1B3AA 2NN6G 3L7ZC 1I3QB 1YN5A 4K8IA 3MJ5A 2A5HA 4J3OD 2LHDA 2ZXPA 5T1IA 2R3ZA 1D5ZC 5EE3A 4H2AA 5I2XA 1V1PA 2AQ1B 3P63A 2I2YA 4WFN3 1I6HB 2BA0A 1RM6C 1V8CA 4XDDA 4YTPB 2L11A 4XT1B 1LT5D 4PMBA 2PW7A 2YYZA 3MXNA 4Z9CB 3K5OA 3A56A 2GB1A 5KYIA 2V4DA 3R2IA 5G3LD 2EYFA 2MHVA 1VF7A 2EZVA 3SR6A 3VR8B 1MSHA 1QKZA 3DWAA 2OEDA 1YNNC 3K5LA 1KLGD 1LTGD 1XEEA 1YQ3B 1Q90A 3H09A 1J7CA 1STYA 2M00A 2WS3B 1SNOA 4XE0A 1MPEA 4WORA 1Q3LA 1SYFA 1TQOA 2LMCB 5BN4A 2F0JA 4IUTA 1D1IA 4BBSB 4GLSC 1L0XB 2BCOA 5C5MA 1U4RA 2WXPA 3EJIA 1IKLA 2IT1A 2EDGA 3BDCA 1F0ZA 3M4OB 5AFWA 3RMHA 1IBXA 1IW7C 1SB3C 3SE0A 2MJDA 4D2KA 2EPBA 4XYQA 2H4OA 1SJED 5FKAC 3CRLC 4UAIA 1SBBB 2MH7A 2CHBD 3ONAB 1LO5D 5EPJA 3K6OA 2W3RA 4R8NA 2PW9A 4CGYB 5IGDA 2KOLA 3RZDB 1C79A 4ZRZA 1OQQA 4HEDA 5GXGB 2LGIA 3OIQA 2XWJB 1L4DB 5KNCA 4V190 3I90A 5C3EB 4F87A 5KIXA 3BK2A 1BUIC 3Q24A 5CMDA 3AEDB 4C80A 3NPPA 4XWTA 4RF0A 1ROEA 1SF0A 3EFXD 4BA1I 1EZ8A 2L4NA 1X3PA 4PQXA 4FP5D 1BUVT 2Z8LA 3BIID 1WTRA 1FMAD 3HKZB 3BVGA 3VR6A 3GO5A 2PCFB 4M8AA 1WVLA 4A3MB 1MHXA 1E0ZA 2PMZB 1I7HA 1DOIA 2HCCA 1KH0A 1OXUA 3P1HA 3CQZB 4IFDJ 4O42A 3HOXB 2JQRB 2KCCA 1EY5A 4DNTB 2QKIC 3NVZA 1CZPA 1I4HA 3T13A 4DQOC 4ZHOA 1DOMA 5ELCA 4A3KB 4ID6A 1W6JA 4RCNA 5C4HA 1J8IA 1EM7A 2R92B 2CU3A 5CR3A 2QMTA 4I65A 1PZID 1FFVA 3BWUD 4CJ0B 3W5VB 3HG9A 2L9HA 4MH8A 4ABNA 1Q12A 1D5XC 1QILA 4RHSA 4HTHA 4XDXA 4KKTA 4HRSA 2J0TD 3VYSA 2MEKA 1ET9A 4N59A 5C5LA 4TQ1A 1A2UA 1UGJA 4X3TA 1SNCA 3V3XA 3TZDA 2B2TA 1S5CD 1PFDA 4YWGG 4YT0B 1VDZA 1K53A 3D4RA 1Y56A 5I6YA 1UWXA 1UEAB 3DM1A 3ITPA 1EEFD 2K5DA 1LV9A 3CKIB 2WU5B 3EUB2 5BYQA 1AW7A 1C76A 2VZKB 2EYMA 3FVQA 1NENB 1KABA 1SFOB 5H8YE 3DXJC 1TYGB 2NTSA 2N88A 3VRBB 4IFDI 3WCQA 2F0TA 2GRIA 4M0WA 4LAAA 4KN4C 3DUZA 2Q8RE 4CKCA 2XWBB 3U52E 5M5YB 4KGSA 1UNSA 1B9NA 3M85A 3N6RA 1XF5L 5I2YA 3HVDA 3I70A 1A15A 2WKCA 4TSSA 3QWNA 3CU7A 1BR9A 1T5EA 1TR5A 2CW0C 3OIPA 1QOFA 2DN8A 3KQ4A 2WDQB 3TP7A 2N0SB 4TKOB 2FE8A 1IHZA 3I72A 1TIID 2NTTA 1EL0A 5IGBA 5HURA 2YU9B 1QOBA 1K8OA 4P16A 4FXKC 3AU7A 4IUUA 3VA5A 3P20A 5IT9L 4ODGA 1C4CA 3OHXC 4K6LA 4N58A 3PUYA 4KJOA 3J81L 1U9RA 3KF8A 2ZW1A 2RQXA 1G91A 3GV3A 3OMGA 1SNPA 1JALA 3K57A 3KLRA 4KI0A 1H9SB 2XSCA 5E1FA 1O78A 3GP7A 3SR1A 5JJZA 3SHLA 3D4WA 4S3SA 5C0XH 2C9OA 2PZTA 1NYQA 4HCEA 4OO1H 4NKLA 4RHRA 1FCLA 1FD6A 1A70A 1STBA 1WGKA 4OIJA 1K83B 4YTNB 2LS01 3B9JA 4DNRB 1BCPD 5BMIA 1IKMA 1FCCC 1EY0A 3NTHA 1HRJA 3B2FA 2HDLA 1PXUA 2WQYB 1A2TA 1FFUA 1QOAA 5IGGA 1MSGA 2RMMA 4I7ZC 1F2LA 4HKQA 4CQNA 1EYCA 1WD1A 2VNUD 3AE3B 3FDTA 3VYUA 2ICEC 1N63A 3SEBA 1FD7D 2NVXB 2NVTB 1FXAA 4KX6B 5HI1A 3SK4A 1EQTA 3WOFA 2Y5CA 1WTQA 1DOXA 1A3TA 4IUPA 5C3XA 2JA8B 3ABVB 1SSNA 3QIAA 1GUWA 1BQQT 1EYDA 2FJ2A 1ZEQX 3QG1A 1JB3A 2Y5PA 1EOTA 4FXDA 3LXFA 1B9RA 3MC0B 4US9A 1VJKA 1SMYC 1D1KA 2GI9A 3NQIA 2KJXA 1TS3A 4KN7C 5NUCA 2EKIA 1KDBA 4IALA 4RKLA 4NDXA 1RKNA 4NP5A 1T5XD 1STHA 3PIP3 3FRPB 3PO0A 4U673 1WSPA 1XLNA 4EQNA 1F9QA 3LYYA 1TS4A 4OGQC 2QF7A 4K5VA 1JICA 2WINB 4DU9A 2SEBD 5EE9A 4NZLB 1Q1BA 4KKIA 1DOLA 1K8MA 3PUXA 2JX5A 3E5SA 3VYRA 1OO9B 2DY8A 3BYYB 4IZ8A 2BS2B 1JOQA 3PUVA 1RJTA 2E3TA 1AWDA 1EWCA 1RFKA 5EJWA 5JPNC 3L3OC 3NRZA 2BB6A 1PTOH 1QCBD 2LFNA 3PUWA 1MBYA 3F2UA 2R61A 3GTLB 4KY6A 2AWOA 1F2RC 1ENAA 1Z7TA 1OFFA 5KNBA 3NBHA 1IW7D 2WACA 1Z6HA 1E6EB 4KJNA 1CK1A 1A6XA 5EKIA 1WCMB 2X69A 2NBFA 4PT5A 3TEZA 2K9XA 4KGRA 1PTOB 1WD0A 4C7YA 3MWYW 5ELDA 2EXZA 1QNKA 2DBYA 1NVID 2WB1B 5DAUA 1CM9A 2BE5C 5BYRA 3EROA 3D6WA 1E7PB 2WV6D 1R7SA 4IURA 1RCVD 3P4PB 2KUMA 2Q5WD 1Y69U 5JXVA 5EKLA 3E0JA 4EE2A 2F0OA 4LK1C 2XNAC 3Q8BA 1EWHA 5H92C 2CQAA 3IAM1 3J80E 2PO4A 2IL8A 5JEAJ 1PRTF 4USAA 1PTOC 4A3BB 1N60A 2AX5A 1RODA 4L1BA 4J1MA 4MACA 1XX8A 1JWUD 2VXWA 1E9MA 3S2DB 5T8IA 3PZ8A 2RDGA 5C44B 4KY5A 3FAHA 3RPFC 3MHZA 4JWUC 1G2SA 5AUIA 2NZ1D 2K0PA 1H9SA 1ZKOA 2KACA 1STEA 1AEXA 3DWQA 3JAML 3TEXA 3IAS1 2A6ED 5LL6X 3GB1A 1PUTA 2M19A 1LT4D 5I6WA 1P7FA 3PO3B 5LNK1 3FKIB 5KNDA 4HSVA 1O80A 3H3VC 3Q0AA 1BCPB 3BVZA 1CTMA 2JP1A 3WOEA 4K8JA 5HFYA 2L1BA 2EYHA 3MXGA 3GTOB 1EIGA 2K28A 2B63B 5I9PA 1JORA 1JQYD 2DWQA 1PFNA 3BDLA 1FM0D 2RSNA 4IN3A 4KD4A 4OZBA 1TWAB 2E2JB 2SDFA 3FPUB 1R9TB 2ID0A 1J9OA 3W1SA 5CGKA 2E2DC 1H9MA 2HCIA 5ISRA 2XN9C 4AQ7A 4K5XA 3T53B 1T3QA 2ZXOA 2B2VA 2F0UA 2WXFA 3QOJA 3AEAB 1X3QA 3BDOA 3TEYA 4Q2JA 3K5MA 1BF4A 1C8CA 5D65A 3P4SB 1S4ZA 5CV4A 1TKEA 2BDNA 4FO2A 5FO8B 4JBWA 2ZXRA 3HRDD 5CV9A 1PRTC 2F0GA 4YIJA 3AE1B 2J42A 3NZ3A 1H9RA 2F0KA 5CYUA 5DNFA 1Y1VB 3VR5A 2NN6H 2B2TC 1PGAA 3LWEA 3T4AC 3VR9B 4XWWA 1SDFA 3C8YA 1VDVA 5C0XJ 1EU4A 3OMCA 1VMPA 4WAFA 4EQPA 4NMZA 1S5BD 4DXGA 2LKVA 3I4NB 1KF6B 3U7ZA 1GHKA 3GTKB 2L52A 1EY9A 3EA6A 2KQ4X 4LK0M 1TY2A 4HCSA 1CQVA 4C1NI 1JOOA 2L0CA 1Y8NB 3PO2B 2WDVB 5D3DA 5K5PA 3TSSA 2HDMA 3K0YA 1IUEA 3BG3A 1VF5C 4PMCA 5LHY1 2A68D 1F9RA 1MHHE 4L23A 2H89B 3T56B 2EYPA 4OHJA 3R8BA 3L4PA 2NB0A 2K7VA 2Q8TA 4YSYB 1QNUA 3AE2B 4DAPA 4DFAA 3W5UB 4XQQA 4WJWA 5F2DA 3GTMB 3D3RA 3NQTA 1ZOYB 1ZPSA 4LTUA 1LTBD 3MFYA 4BA2I 5C6AA 3TEWA 3AB9A 1BXTA 1II3A 2QILA 2INPE 4U68A 2XRQD 5I9OA 5FO7B 4HJGE 4ZK9B 1HA6A 1ENFA 4M1UB 4WIPA 1NI3A 3S1RB 3SXHA 1BMLC 4RKBA 1CI3M 4ZAIA 1KAAA 2N9KA 2QJLA 2J4XA 2WXNA 5BMGA 2B8GA 4UDUC 3KLSX 1YNJC 5KGUA 1EWYC 3NWSA 4QIWB 5TSSA 3TN2A 5EGTA 1DXMA 1ZUD2 1QLBB 2JA5B 2A69C 4XIGS 3HZXA 2Z4HA 3OSOA 3PUZA 3C2PA 3KWLA 2DNCA 5BYSA 1PDQA 4RGOS 2PVGC 1SE2A 2VUMB 2V3PA 4YTMB 5LL6S 1FXIA 1DM0B 3WDNA 3IFDA 2WLBA 2WXHA 4GDKB 3S17B 3T3NA 4A3FB 2IGDA 3S16B 1QOGA 3C1EA 5DM73 1HQMC 2F4IA 4HN7A 4B9WA 5ELFA 1J7AA 1DCZA 3H8HA 2EOTA 1L5PA 5FR3A 1GUNA 4A6QA 2L12A 2JA7B 2D9UA 2B2WC 1ZDVA 2IX1A 4H7BA 4IQZA 1D5MC 1GHJA 2MGSA 2MJEA 3OWEB 2PZUA 3S1NB 2N9LA 2FHTA 1ZYRD 4TMAB 2R6GA 2TSSA 2I07B 1CA5A 4ZRQA 5A2QE 4IOIE 2JEBI 5M5XB 1Y1WB 3P7JA 2OHFA 1V97A 2IWHA 2INNE 1CHPD 4FYDA 1JWSD 2SNMA 2IW3A 5K36G 1HFNA 3QO2A 1YJJA 2WXIA 1TKWB 5IGEA 4A3DB 1WWTA 3MEHA 3J9CA 4HROA 3MHBA 1IYUA 2PZWA 3HEJA 1FRRA 1NUCA 4QMGA 1OQRA 2KEEA 3RUZA 2WIIB 3P1MA 3S15B 4C3JG 1TT2A 4B0EA 2I46A 2RDFA 4KTAA 5DM63 3I4LA 1WTWA 2LMCA 3VRAB 2BA1A 2VB2X 3S1MB 4ZYSA 2B8FA 1YMHE 1X32A 4RCOA 1O7ZA 3MTSA 2EE1A 5K36H 1SYBA 1LTTD 1SJHD 2E75C 2K5QA 4ULLA 3LNNA 1IBXB 2RBMA 3H0GB 1G2TA 4A3IB 2F0PA 2IX0A 4QF4A 4K2LA 1HZ6A 4KKUA 1B50A 3QB3A 3TZUA 1GPXA 3IT4B 3R3OA 2DLBA 3SFEB 5FLXL 4CBVA 3ZJVA 5EBDA 1WXQA 2XIWA 4YXDB 2QDBA 3C46A 2FFKB 4G7HC 3CHBD 4B0MA 4OL7A 2FMCA 4C3JB 1ZXHA 4KY7A 3RFZB 3H6MA 2MJ3A 3C3LA 3A54A 1PZJD 1JC7A 2MUYA 5DEHA 3KBGA 2VB3X 3I8ZA 3W2DA 2IX3A 4ITKA 2NYZD 4IDIA 3R2TA 4RGNA 2WXRA 1QE6A 4V0BA 1SXTA 2F0FA 5IOCA 2QCPX 2A6HC 3SVMA 5CC4A 2PLPA 2N7JA 4HKZE 1N5XA 3I73A 3SDZA 2OT2A 2RA4A 4DK1A 4B9XA 5A35A 2YEPB 2JYTA 1AP0A 3LB8C 5IODA 1GOZA 1WTPA 1QQRA 2RKSA 3D6CA 2B2WA 5FK9C 1WYGA 3OW7A 5KYLA 3W9CB 3Q8CA 2HUGA 4DK0A 2WDRB 1PTOF 4K2KA 2RDHA 3S1QB 1NAPA 2F3WA 2K32A 1ENCA 2X38A 3EVQA 2F0EA 3FILB 5BN3A 2O4XA 3ND8A 1Y8OB 1S5ED 4H13C 1GUTA 1O7YA 2AUKA 2K01A 3O13A 5IGCA 3G7LA 5EBCA 4FXCA 4BY7B 2F1MA 3J7AV 1RWSA 2NVYB 3SFDB 1EYAA 3NUHB 4AS1A 2WAQB 2XVSA 3AEBB 3HGBA 2L32A 1YNND 3I91A 1C9FA 4IFDG 1V1PB 3VQIA 2C5CA 4XTCS 5ELBA 2B2VC 1B53A 1SIJA 3Q8EA 3MZ5A 1KDCA 2RVLA 2BT6A 1STAA 3Q22A 1B9MA 1DD2A 3AE6B 1ZDXA 4L8JA 2ZT9C 1Q1EA 2AQ3B 1HHVA 1TVXA 1QG7A 4LLGM 3UI2A 1S5DD 2WXQA 1CT1D 4A93B 5HG2A 1F77A 1EEID 2R93B 3AMUA 4NAWB 4CKEA 1E10A 2R7ZB 2TMPA 1RD9D 2X6LA 1FEHA 4IFDH 1GB1A 2ENBA 3NP8A 1SE4A 5M3FB 1G6ZA 3DWGC 2FINB 2B2YC 1QJOA 1CQFA 4C7ZA 3EQLC 3NK9A 1NSNS 3A7AB 2WP9B 3NVWA 3KUPA 1CFMA 2G1EA 3ZJUA 1M8AA 3HOZB 1TWFB 1Q8IA 1L0VB 4E6IA 1ML0D 1WTXA 1EZ6A 4KMUC 4P2CB 4US8A 4HEA1 2J7ZA 1I4RA 3DMUA 5MPOA 3ZQ4A 4QB4A 1OXSC 1FNVA 1QT9A 4C56C 1XO3A 2F0HA 1YQ4B 2CJNA 2Z1CA 2DYOA 2EELA 1HCZA 4YSXB 3Q8FA 3V2TA 2PIAA 3AEFB 4J8QA 1OXXK 2ICIA 3ZJTA 1AZPA 5E6JA 4KD3A 3U2SC 2K03A 3L9AX 1VRAB 1GUOA 1BBXC 2WXKA 5CBEE 5D3IB 1MI2A 2BS4B 2V3NA 1U4MA 1JWAD 2RSOA 3U9SA 3BVMA 2PMVA 3HOUB 3E9SA 4Q5VA 1MGSA 2WXGA 4EVOA 1DOYA 3GTJB 1EU3A 3SK5A 4MIUA 2K22A 4GDLB 5G5GA 4ZRPA 3I57A 3I3CA 2QSDA 1LABA 4WWMA 1IYVA 2IDYA 4G7ZC 4ZOHC 1DOKA 1IL8A 4QUFA 1KRHA 1UAPA 3CIRB 2K6AA 1LACA 4G57A 3RD4A 2SAKA 1RF2D 4BY1B 3IT6B 3PIO3 3IL8A 5JVH3 5T1GA 5E4XA 2JEAI 1O7LA 5IT9E 1I4XA 3S2HB 4RH6A 3A7LA 3OWFA 4A3GB 3J81E 1GUGA 3D4DA 2FUG1 2JXTA 3ZYYX 2PYKA 3NHHA 1EQVA 1C4QA 4K6DA 1I6VC 4CJ2C 2N55A 1AZQA 2F3VA 3NE5B 2E6XA 4X3UA 3FPPA 4P6VF 4MN3A 4DA2A 4CHTB 2E2IB 1AFPA 2A73B 5D14A 3AEEB 2E74C 1BCPC 2DYMA 1I4PA 2K1BA 4FF3A 5KRUA 1EFID 2SOBA 5C4XB 4ARCA 3FILA 1LT6D 4TQ0A 1QWYA 2F0SA 1TWHB 2FMMA 4HMJA 2ON8A 1PFMA 4R8IA 1ESRA 4ZKCB 5J1ZA 3E56A 4OW0A 3K58A 4MHEA 4K5WA 2G9HD 1JR0D 2EJMA 1Z47A 2F0IA 4X3SA 2JU6X 1K51A 1F2MA 4JX1C 1C4PA 2PVOD 1ET6A 1RTOA 3P75A 1L6VA 3D8GA 3RLFA 2B2YA 1HEZE 4BS9A 3AB5A 1FNWA 1E0BA 4XQNA 1ZP0B 3HVZA 2AWNA 1GXDC 1L4ZB 2V0GA 1VMCA 2CW0D 2ACZB 1BNZA 2VZKD 3FEWX 4AYBB 4EQOA 4A90A 1HUMA 4A8XC 2K5PA 2F0NA 1HXYD 2LUMA 1V43A 4OZCA 2QEJC 4A3EB 1E2VA 2KHSA 2NVQB 1CHQD 3KLSA 3IKJA 4L6TB 2LHEA 4NAMA 1TWCB 2EY2A 1G8ZD 4F7XA 1N62A 1D6EC 1HA5A 2O2LD 4Y7NB 5HGTA 3TP5A 3H91A 3AE9B 2F0VA 1ILQA 1JW9D 2Q8IB 2J52A 5C2TB 2I38A 4LMQD 4A3JB 1HPCA 1TJEA 1EY4A 4N9PA 3KBXA 4JWSC 1TZOA 1STGA 2EJFC 3HS0C 4DF7A 5EQ0A 1K52A 4QCLA 3HP3A 1TKYA 1E2ZA 3T3OA 1SYCA 2CVRA 1LLRD 1WRIA 2L83A 5JOBA 4RF1A 1PZKD 3VYTA 4ZQ3A 4FXGC 5HHDG 2IGHA 3X3MA 1L0YB 1D2BA 3CRKC 4G4KA 2L55A 1BO0A 3P4QB 1G291 2A6HD 1FR3A 3NTIA 1E2WA 1IGDA 2BOSA 3GS2A 3BK1A 4CKBA 2W82A 3T16A 5C0XI 1DYQA 1SYDA 1CA6A 4OO1I 2JE6I 4REZA 1JWBD 4RAUC 1JQ4A 3NVYA 2NUCA 3URYA 1CZGA 1W6KA 2KWDA 2KMMA 1SMYD 2O5JC 4X3KA 1XWEA 4C1NK 2GA4B 1LTSD 1N5WA 2JYEA 5E3FA 5G3LF 3TMEA 2PQEA 5JEAG 2HQEA 1F2YA 1CJEA 1HFGA 1HUNA 3T51B 1TWGB 4IUQA 1XCTL 2KA7A 2EYJA 4L2YA 2B76B 2NMQA 4KKJA 3AEGB 3TP6A 4H0LC 1IGCA 1KNEA 3V96A 1D4BA 1A3UA 3P4RB 1RYJA 3MA2B 2Y0SB 3BZDB 2MJ8A 2A6EC 3NUCA 3NWTA 1F2RI 1GUSA 3Q8AA 1XYIA 2Y3AA 2JYOA 1MVKA 4CJ1B 3U9OA 2JXMB 5JEAH 5M3MB 2BYTA 4WQMA 1ESFA 3GTPB 3JAME 1YN3A 4R3DA 1SNMA 1T6BX 1M4VA 2BS3B 2AUJD 2L5TA 4FNFA 2AQ2B 1ACCA 4XT3B 2DNEA 5EE0A 3MVVA 3AE7B 2H88B 2Z4IA 3DEOA 2KVMA 1MD2D 3GD7A 2F03A 3VR4A 4ILWA 3AE8B 1H9JA 1JOKA 2DY7A 3OPOA 2PTLA 1ZE3D 2WNMA 1ILPA 1CZWA 1ONLA 1HQRD 5IGFA 1XCQL 3TBIB 3H94A 4RFBA 2BE5D 3ND9A 3GV6A 2KEDA 3J80L 4HAEA 5EPLA 5JVG3 1KFYB 2LFIA 3KK7A 2KAJA 2NWGA 4IKGA 3HOYB 3X3NA 3AE4B 2J53A 1XLOA 3HOVB 4O1NA 3I9V1 2WXOA 1GB4A 3MXUA 2JSVX 3BYTB 1STNA 3K59A 4RGTA 3PMFA 1PFBA 3A8KE 2YEPF 3ETRA 1PTOD 4LJZC 3R93A 5JPMC 2OEOA 2BB5A 1FNUA 4PV1C 5CV7A 2M56B 2EYLA 1QOHA 1XLQA 2EJGC 1PMRA 5CV8A 1SE3A 5M5WB 1DZ1A 4KV6A 1ZXIA 3OOCA 4XYOA 5ELEA 4JK1C 4HMIA 4KHVA 2WXLA 3TP8A 1PDXA 1RTNA 2EYOA 1F9PA 3B2GA 2IPKD 1VZ6A 1LTID 3M4YA 2PW5A 2BTEA 5C0XG 4A9AA 1KDAA 4H44C 4XXEA 4C3HG 3BS1A 4Q0FA 4OO1G 2IGGA 1S5FD 2WXJA 4FF4A 2M9VA 2WP8J 1SNQA 1YJIA 2BBCA 4EGVA 2IJ0A 1SYEA 2D5GA 5EKKA 1VLBA 5COYA 3U4EG 4DGZA 2LY7A 4OZAA 2A68C 2K3UA 2PKOA 4FF1A 1ICWA 3NSWA 2OXPA 2F0LA 1EIHA 3VA7A 1JROA 3HOWB 5FOBB 1I4QA 3VR2A 2M0AA 2F0MA 2KDMA 1VR9A 3DWPA 2WXMA 4RGMA 2MP1A 5KEEA 5CV6A 4ZUJA 2F0WA 5E4WC 1U4PA 1KTKA 3IAYA 1Q10A 1NYRA 1JWMD 2LEKA 2V4IB 1B44D 3LWUA 1LT3D 4ZUIA 4GZYC 4ZKBB 1FGBD 1TS2A 2E2HB 4TQUS 3QOLA 4DXFA 1SSOA 3PZ7A 4C3IG 2L1AA 4MM3B 1BOSA 3GTGB 4F8MA 5M9OA 1FYCA 4C3HB 3N9YC 1MI0A 3ZGZA 5IIFA 3N52A 3LX0A 2H1EA 5J39A 4HR7B 4OIKA 3UI3A 4PMWA 4TRDA 1XLPA 3CWIA 3ERQA 4R9WA 1C4AA 1SNDA 3IFTA 1GAQB 4ZHPA 2BW2A 2EY6A 4XQJA 1B4OA 2EY1A 1AYFA 4ARIA 1VCIA 2K04A 2K33A 4FVMA 1TS5A 1PRTD 3I4MB 1VZ8A 4BWGB 2EY5A 2KQ3A 4KK7A 1V1OA 4ZLTF 5CORA 5C3WA 2HTME 3IXSA 2W3SA 1H9KA 2FBWB 3MAQA 3DHQA 2CJOA 2JSOA 2E76C 1B1ZA 3E6ZX 5C4JB 4HSPA 3GQBA 1SYGA 1DJRD 1TU2B 3DEPA 2B2UC 4F88A 1PGXA 5EE1A 3A8JE 4N6EB 4IUNA 2BDOA 4MT5A 1VZ7A 1KNAA 4YSZB 4J6HA 1B2TA 4C2MB 1YN4A 4C3IB 2G9DA 3KWVA 1JRPA 3AN1A 1U4LA 2KN4A 1QB5D