4C56C

X-ray structure of the complex between staphylococcal enterotoxin b, t cell receptor and major histocompatibility complex class ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
227
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Structure of the Superantigen Staphylococcal Enterotoxin B in Complex with Tcr and Peptide-Mhc Demonstrates Absence of Tcr-Peptide Contacts.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 227
sequence length 235
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c56C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4c56C01
1PTOH 3R2IA 1LTSD 1T5XD 1HA5A 1EU3A 1EEID 1SE4A 5I4DA 1LT6D 3BVGA 3SEBA 1L0YB 2XN9C 1XTCD 1PRTF 3OWEB 5FKAC 1V1PB 1AW7A 1FGBD 1ET6A 2TSSA 2NTTA 1EEFD 1L0XB 1TY2A 2XRSD 1LTAD 3MC0B 3W2DA 2Z8LA 3URYA 2J4XA 1B1ZA 1I4GA 1LO5D 1EU4A 1FNUA 4BWGB 4L6TB 1CT1D 1PTOF 4K6LA 1BCPD 1SEBD 1LTID 1ET9A 1B44D 3DWPA 1V1PA 5ELEA 1EFID 1EWCA 1JR0D 3GP7A 5TSSA 1LT4D 1TY0A 3BZDB 3TSSA 4L63B 3EFXD 1D6EC 1SE3A 1TS2A 4RHRA 1ENFA 1CK1A 1I4XA 1I4QA 1BCPC 1LLRD 1BXTA 1LTRD 1SJHD 2SEBD 1D5ZC 1JWSD 1PYWD 1I4PA 1PZID 2CHBD 2AQ2B 4O1NA 5D3DA 1F77A 1BCPB 1LT5D 4RGTA 1S5CD 1I4HA 2R61A 4DXGA 1AN8A 1DJRD 1DYQA 3DWAA 1KLUD 1LT3D 5ELDA 1XXGA 1M4VA 1PRTC 1PZJD 4RGNA 1RF2D 4RGMA 2ICIA 1PTOD 1TS4A 3KLSX 2AQ3B 1PZKD 1ESFA 1KTKA 2XNAC 1TS5A 1D5XC 3O13A 3BVZA 2NTSA 3CHBD 1LTTD 1STEA 3R8BA 1MD2D 2RDHA 1QILA 1V1OA 4OHJA 4TSSA 5FK9C 1S5ED 1BCPF 2QEJC 1GOZA 1G8ZD 1UUPA 4C56C 1FD7D 1SJED 2O2LD 2G9HD 2QILA 1PRTD 1KLGD 1HQRD 1PTOC 5D3IB 1CQVA 1D5MC 2IJ0A 4Z9CB 4DXFA 1UNSA 4RHSA 1JCKB 1YN4A 3MFGA 1RD9D 5ELCA 1I4RA 5ELFA 4UDUC 1LTBD 4ZYSA 1FNVA 5ELBA 2IPKD 1LTGD 1S5DD 2WV6D 4RGOS 3DWQA 1SXTA 1YN5A 1S5FD 1SBBB 3V05A 1PRTB 3BYYB 1HTLD 3BVMA 1CHQD 1JWMD 3R2TA 1HXYD 4RFBA 3BYTB 2XRQD 4RH6A 1TS3A 4RCOA 1JWUD 2RDGA 1RDPD 2AQ1B 1YN3A 1SE2A 4NZLB 3EA6A 1RCVD 1FNWA 1CHPD 1JQYD 1S5BD 1PTOB
chains in the Genus database with same CATH superfamily
3HOVB 1PTOH 4YTPB 2N7EA 5F2DA 1QZHA 5ISRA 3GE3C 3NZUA 2ZZPB 5C23A 3VUXA 1II3A 5C5MA 4B3ML 2GOWA 4ODGA 3SEBA 2E5LL 3V62A 2RHSB 3Q3FA 5D65A 3J81i 4YSYB 4N59A 1Z5SB 2R93H 2DAFA 1ET6A 4AQYQ 1EEFD 2PMVA 2Z9HA 3A8JE 1PFBA 1GG3A 3A55A 2FINB 1WXSA 2MBEA 5BMHA 4Q5VA 1LTLA 1LO5D 2V3PA 1PH3A 4DKAC 3QCAA 4RF0A 2RDFA 4K6LA 4CJ1B 1PDQA 1C1YB 2PO4A 3EJIA 3QB3A 4JW0A 3H3VI 4JI0L 4GS3A 3NQIA 1WTOA 2EJGC 4DNTB 5ELEA 3H3VC 2XEWA 2KBNA 3HKZG 1ICWA 2MJEA 4GDLA 3VTVA 3L08A 3PLVA 1JMLA 3H1UA 2DNEA 1XMQQ 3Q8AA 3I55A 3I91A 1ENFA 1BCPC 3DEOA 1BXTA 4ZUIA 4DV5Q 3A1QB 2N9PC 3X3MA 2K5WA 2ZM6L 2RPVA 4JL9A 2FJ2A 2QMTA 3CIRB 5D2MB 3VRAB 1H9RA 1Z2MA 4CJ0B 5IGEA 1EQTA 4QL5A 5FO9B 4BKSA 1GC7A 3MWYW 2JQOA 3S2DB 3PO2H 1H8CA 3MC9A 3E9HA 2NYZD 3OYYA 4IFDI 1WD0A 1YQ3B 2ES2A 2JZZA 4BA2I 5E6OA 3M9BA 1KHIA 1GB1A 1BVSA 4XYOA 2KC1A 2KDFB 1TWHB 2R6GA 2QJLA 3DVGY 5GAEC 1E90A 4DR2Q 1STEA 4QB4A 1YVCA 3RUZA 2I46A 3X0WA 3OHXC 3DUZA 1CUKA 3RFZB 4XDDA 1UUPA 3NP8A 2KCTA 1FD7D 2O2LD 1DGSA 5DM63 4QMGA 4JI2Q 2ID0A 2FCSA 3A5ZB 1IGCA 4ZRQA 3B08A 2NS5A 4DHJD 2IL8A 3Q24A 3Q23A 3F8TA 2KWVB 4NNJB 1P0RA 2B2YC 4C3JB 4IFDG 4LCDE 4A8XC 2HE7A 1Y8NB 2XWBB 1B3AA 4JI8L 4EQOA 4DV0L 5AZFA 1UELA 2MJ3A 5IO9A 1JALA 5L83A 2WU5B 3RN9C 4UDUC 1IW7C 4K5VA 2GN5A 2F0UA 3AECB 3EHVA 1FL0A 3ULJA 1FXAA 4LNQA 3HOYH 5FLMH 4GKKQ 4MELA 1HZCA 1KDCA 4DR7L 1F9QA 2L4NA 3MVVA 3PCOB 4HJ8A 2VH2A 1E8YA 4GMVA 2GB1A 3ECIA 3U9SA 3TP5A 3J81E 1TQOA 1ZYRD 3AU4A 2OEDA 4XT1B 4KDLB 4W9CA 4C3IB 3HUIA 1IL2A 2PLPA 4P73A 2GMIC 4XWTA 5DCNA 4JYAQ 3UE1A 1XJVA 2LRUA 3DVNU 4QIWE 4BY1G 3HGBA 2UXBL 1E8WA 3A54A 4UPAA 5ELDA 3A9KA 3VVWB 2M0XA 2D0PA 1SMXA 1Y1VG 3VUYA 1IXRA 4P74A 3PV0A 1JRPA 3OIQA 4KGTA 4JBMA 1B50A 1RTOA 3DM3A 1OGWA 1XTCD 1WTQA 5EKKA 5L95C 3P2BA 1BBUA 4IDIA 2F03A 4C3HG 3CWIA 3GTOB 2EY5A 3DVNV 1KRSA 3D6CA 1VZ7A 4DWFA 3T1YQ 3T16A 3A9JB 1VQFA 2UU7A 3WCQA 3NUCA 5GADC 2J4XA 1YX6B 2BS2B 2LGSA 2BBCA 4A3DH 5D94A 3ZLZA 1FJGQ 3ULPA 3CP0A 1QQRA 4I6LB 5FO7B 4X66Q 4E6IA 2IX3A 1X3QA 5JEAG 5BN4A 2UXCL 3W9CB 2B63B 1MJCA 4H0LC 1BBWA 1EY6A 2JYTA 1TY0A 2PYKA 1WX9A 3IAM1 3BDOA 5CV8A 4JI3L 1BO0A 4WJWA 3BG3A 4DV2L 3CAMA 3U2SC 3RZFA 1IP9A 3EBEA 1CJEA 1GUSA 4LF6Q 4HEDA 3NEMA 1CQFA 1KXLA 1WM2A 2B2WC 3AU7A 5J1ZA 3S16B 2K5VA 3NG0A 2RPQA 3NTIA 2MO1A 4IQZA 3I3TB 1OXVA 4HLEA 1IYUA 1VRAB 1P3QU 2L11A 2Z4HA 1XNRQ 2AEHA 3K58A 2JY6A 1VMPA 2D62A 2PQAB 3H0GB 5G3LD 4DNRB 1PHJA 1VF7A 3QC8B 2AHOB 4DR6Q 2RVLA 1UH6A 4DV1Q 1GNUA 3UI3A 1N32Q 5LMNQ 2VQEQ 1RHPA 2F1MA 3GD7A 1T0RC 4MJSB 1PFMA 1PTOD 2WXKA 4K8IA 2ZTEA 2NBFA 3U9OA 2LGXA 1I5FA 2JA8G 3ENEA 1PGXA 1EY8A 1WFQA 4YY3L 4FJYA 1S5ED 2MHVA 1IL8A 4AYBG 4C56C 2O4XA 1YJNA 5JJIA 1OFFA 3K80C 2C5CA 2QILA 4OO1I 5C1ZA 3GV6A 1SNCA 2K52A 2KK8A 5DNFA 3NBHA 1VS0A 3DWGC 1J5EL 4DXFA 5C4JH 2BB6A 2KWDA 1WTWA 1V6EA 4KGSA 4A93B 4IUTA 2GVBA 4GOPC 4A3IH 1I4RA 4A3JB 3EN2A 5ELBA 3CCRA 1XX8A 1KH0A 1HR0L 3E0JA 2JP1A 4QF4A 1QLBB 2KTRB 3V05A 1STHA 3RN5A 1K0RA 2K05A 4EVOA 4A3MB 4FF4A 4OO1G 2DN8A 4FO2A 1U4PA 4RH6A 3PREA 4DR4L 3HOWB 4Y52H 4LNIA 2MQJA 3IXSA 4KJNA 2N1VA 4EE2A 4POFA 4ZRJA 2JA7H 1SE2A 3Q2AC 1IKMA 4BFRA 3CPWA 2DZMA 3EA6A 4ASWC 4DV7L 4WWPA 1TBEA 4ARCA 3D6WA 2RQXA 1CHPD 1JQYD 1VQDA 2XK5A 1PTOB 1JC7A 3E6ZX 1HHVA 5IT9E 3OSOA 4DUZQ 3AYHB 2KZRA 3KF8A 4KHVA 2C5LC 1WSPA 3PS6A 1X55A 3NE5B 3E9SA 2JQRB 3DMUA 4FNFA 5GAGC 4JOIA 2YEPF 4ZCKA 5EE0A 4XQNA 4KIKB 2R92G 5I6WA 5IGFA 2DZKA 2R93B 4JE3B 3C8YA 1SFOH 3H9DA 3WALA 4I7ZC 3KOJA 3OG5A 3HP3A 3I72A 3DHQA 2LD9A 2CWAA 4JLCA 3CD6A 2O5JC 4LUOA 4YSXB 4AP4C 1XMOL 3W1SA 3K0YA 1PH8A 2D10A 3SK5A 3W5OA 3TBLD 2W82A 3TZDA 1GKHA 3VDYA 3CRKC 3KYDD 4OZCA 5C4XG 4LF4Q 3X23A 3DEPA 2INCC 4IWQA 2GA4B 1HFGA 1E24A 4C7ZA 5EDSA 1IUEA 4L63B 3TP6A 3PTFC 3EFXD 2WB1B 2J52A 4JWSC 2UUCL 2BF8B 2YU9H 4ICVA 1I4XA 3K0XA 1LLRD 5H8YE 1SYCA 1SNOA 5IA7A 1HUNA 3SD5A 3A74A 3UDFA 3SGIA 2N9EB 4O1NA 2KVMA 4AJWA 1VQAA 1K8AC 4IJLA 1IBML 3NVWA 5FOBB 3PHWB 4LJPB 3TEXA 1BF4A 1WGDA 3PO2B 4JI5L 2BA1A 1I7HA 5G2NA 1JICA 3RD2A 4ARIA 3DWAA 4DUYL 3TREA 4MTNA 1XLNA 1NENB 1WE7A 1C9FA 3IG3A 5DLQE 1UWXA 3CKIB 1WZ3A 3AE2B 3AE6B 4HXDA 4N9PA 1JORA 3VRBB 4L5SA 1AFPA 3I63C 2CH4A 2F0DA 1N5XA 2WAQE 4IOIE 2VQFQ 1RJTA 1GHKA 1ZGUB 2JE6I 2ON8A 1IBKL 1PYBA 1YD8U 1N9WA 1Y1WH 1R9TH 2CKZB 2BPSA 2LXAA 2MBOA 2F3WA 1OQQA 5FLXL 3PQIA 2KMCA 3I3CA 5JJKA 2VZAA 3OJ4B 4A3FG 3KUZA 2MCNB 3PRPB 3ZGZA 3T4AC 1HNWL 1ZUD2 5M5WH 2NBUA 3CC2A 3PRZA 3LXFA 4B9XA 1GXDC 3WOEA 2AYOB 3ER0A 1VQKA 3Q8FA 4IJHA 3I4NG 1QUQB 4L5TA 2EKEC 3PF4A 4A3EG 4A3LG 2CCZA 4GSWA 3HOYB 1RRBA 2W3SA 1OXUA 1A0IA 3C1EA 4TQ1A 1MSGA 5I9OA 1WJ4A 3EFCA 3Q6BA 2WKCA 4KKIA 2EXZA 2L0CA 2K6DB 3G6JB 4H13C 4J8QA 3A5UA 3AEVA 3S14H 4OZBA 1IBLL 2AQ1B 1S1QB 1YN3A 3UQAA 1X3EA 2Q2TA 3QX1A 3DBLI 2KHIA 3CCMA 1PH2A 4M02A 3DHGC 3ZO5B 4B95A 4OZAA 1E0ZA 3U52E 3ABVB 2CJOA 1LGRA 5T1GA 3TBIB 1WXAA 2BKFA 2IGHA 1QT9A 5BN3A 2O2VA 4OONA 1R4MI 4IM3A 5JVG3 1WYWB 1N5WA 4LFCL 5M3MG 3RNCC 4CKBA 2CU3A 1U4RA 3LWUA 2QKIC 4OEMB 3RN2A 1L0YB 4GNXB 4RG1A 1PRTF 2QDFA 1VQGA 1E3PA 2WLBA 3VAWA 2LS01 1ZP0B 4UP8A 3TS2A 1MG4A 2MX2A 3JAML 1KAWA 2DY7A 3HOUG 3APCA 2Y0SE 2V1CC 2AL3A 3N30A 4RMAA 1Q3LA 2IYDB 1YJ9A 4A3DB 2KLCA 1EU4A 2NPTA 3VYSA 1VQ9A 3C46A 3P4PB 4HDOA 2XBBC 2QA4A 2K7VA 3KQ4A 5A2QL 3NTHA 2LEKA 3PZDA 2C9WB 3HM3A 4BY7G 3NK9A 2KYWA 2HUGA 1O7LA 4RM9A 2JYOA 3N1XC 2O5IC 4AIMA 4J6HA 1VQBA 2EQSA 2F3VA 1LT4D 2A68D 1IHZA 1PUTA 1LYLA 4N9F4 5KHQA 4IPHA 3D31A 1SE3A 4LW1A 4ME5A 3OTOL 4DR1L 2GI9A 1V5OA 2OF1A 4OGQC 1X1MA 3MFYA 1PA6A 4AOFA 1Y8RC 2A4ZA 1RFKA 3ZVVA 3CW2C 2INDC 4JC0A 1K51A 2J7ZA 4CBVA 1N8RC 4FXGC 2WINB 2HIXA 3KUPA 3KUDB 3I9V1 1HPCA 1G6JA 4WURA 1V49A 1DYQA 4BBRH 1I6VC 4B3SQ 5LLIA 3M62B 1E1TA 1V81A 4X3UA 3NJTA 4MACA 2L15A 3Q22A 2EPBA 3T56B 1K9MC 4MHEA 4RM8A 1M1KC 3J80i 3HOZG 3T51B 3D3RA 1JJGA 2MSED 3CHBD 4G3XB 3RCZA 2AUKA 2D3CA 4IWPA 1AP0A 5KIXA 2MJ8A 1YEZA 2NCNA 4HMIA 4W9FA 4DR3L 5J2RA 1B9NA 2AKWB 2NB0A 3STBD 3MJ5A 3UINB 4ID6A 4IM2A 1X6OA 3VA7A 3NHHA 5C4JB 1ASZA 2LVOA 2LASA 4E3CA 2IHFA 4LUZA 1WY8A 1F9SA 1JCKB 5D14A 5BMGA 2LRWA 3B9JA 2N4FA 1VJKA 2ZPNA 1FRRA 4A3IB 3H7PB 1QZEA 1JB3A 2F0SA 4A3OA 1DCZA 1PH5A 4DNIA 3G7LA 3AE4B 1KNEA 4PYZA 1ZE3D 2F0VA 1I94Q 3S1QH 2GVAA 2EYLA 3KK7A 2C35B 2BH8A 3RMHA 2UXDQ 5JVH3 1H9SA 1WX7A 1NR2A 2PW5A 3M7GA 2KVRA 1EUVB 2V9HA 2UU9L 2JA7B 3SR1A 3U4ZA 2C7MB 2EZVA 2E76C 2O6VD 1FNWA 4NJ7A 2PPBC 2LKVA 1K8MA 3NENA 4DR5Q 1XT9B 4NMZA 2WDTB 3DVGX 5IYDH 3J9CA 2JA6G 2JEAI 2JWUA 5LMUQ 1U4AA 4WH4A 4YWMA 1T5XD 4FHJA 1HA5A 5K5PA 2K14A 3IFDA 1C76A 1IZ6A 2EE1A 3LDZE 2XN9C 4B0MA 4HEA1 2WDVB 4ITKA 1VF5C 4JI7L 2WAQG 2GBJA 1C9OA 1UE1A 1SFOB 1TJEA 3P1MA 4AUQC 1V8CA 3A8IE 4ZLTF 1XQQA 3Q14C 1EY5A 1N34L 1H9KA 4POGA 2IO0B 4ULLA 3NS8A 1SYEA 1UEAB 2XRSD 4GN5A 5J39A 3NOBA 3OJ3A 3W2DA 5DM73 2KACA 2NZ1D 4MGIE 3RNGC 3M4YA 3ZTDA 1PV4A 3PUXA 4YCVA 2FCMA 2PTLA 1CTMA 2K32A 1YZ6A 3AE3B 4M00A 3Q3OC 3PGZA 4HROA 2I38A 2B2YA 2I1KA 4I7AA 3OPOA 3LJ3A 1SMYC 1FM0D 3HFZB 4X3KA 2LMCA 1Y69U 1X3FA 3CCJA 1EWCA 1SNMA 4HDQA 4HIKA 2KJXA 3L4PA 3D32A 5C0XJ 3SK6A 2YU9B 3UIPB 1A3VA 4RHRA 4DV6Q 1NTGA 4NB3A 1ENCA 3VYUA 2SEBD 5DPRA 5FLXc 5EJWA 2K4KA 3J80E 1JWSD 1YJWA 2G45B 5KNCA 3KVFB 1J7CA 2AWNA 2FMCA 2F0JA 3GTQH 1W2BA 3VA5A 1MI2A 1GUGA 4DAVA 2R7ZH 2Y5BB 1L2FA 1L5PA 3U8ZA 4L23A 5IP9H 1B9RA 4XXEA 1WXVA 3LYYA 1PMRA 1TU2B 2Z0SA 1FPYA 3IFTA 3QOJA 2UUAQ 4MH8A 1YJIA 2PCFB 2XK5B 4R8NA 3GZNI 4MTKA 4P71A 2F3IA 3FKIG 2DUDA 2DAJA 1D1KA 1ESFA 4EUTA 4FA6A 5AZGA 3IVFA 4PS7A 3HEJA 1L1OC 4CDFC 1Y1WB 4IFDH 1C4CA 4K2LA 1R9TB 1MHXA 1E1OA 2YYZA 4AQYL 4ZKBB 1BNZA 1G8ZD 2H1EA 1WTPA 4LJZC 3NZSA 4XIGS 2MP1A 3MHBA 3HRZC 2KKCA 4HAEA 2JWZA 2B8GA 2NN6H 2KDBA 3KUCB 4IUPA 4MGKE 3FHWA 1R4NB 4LFAL 1TZ1A 5M5WB 2LHDA 2ZXOA 4DV4L 1WMHA 2WIIB 1EF5A 1E8XA 4MDKE 1F2LA 2IPKD 3AB9A 1DOLA 2VS1A 1FYCA 2WV6D 1XMQL 4WJPA 3ZJVA 1AEXA 4B9WA 3FAHA 2WHIA 1AE3A 1BMLC 4TVAB 3HOXG 4KKSA 3JAMc 4DV5L 1KQSA 4LF9Q 1CHQD 4KI0A 4IUNA 1VQNA 2Z6KA 1HXYD 4RFBA 1Q86C 2F4VQ 2B2WA 4BXXH 4YSZB 1O78A 3ZJYC 5AUKA 1AYFA 2RSOA 3S14B 1HZ6A 3TL5A 5AFWA 1Z6HA 2W3RA 1G51A 4Q2JA 3KLRA 1TTNA 4M1UB 1HE8A 4KGRA 2MH7A 4JK1C 5G55A 2F0HA 3PO3B 4B0EA 1EYDA 1V1QA 2R2OA 4YTNB 4ANVA 1GHJA 1Q5WB 2IO3B 3NHEB 3GTGH 1MHWC 4LUVA 4DK3C 1EU3A 2N8NA 1H9MA 2FXQA 1A2TA 3BVGA 4II3B 5LXIB 3DBRI 1CZPA 1KAAA 4DR2L 1ASYA 4JI6Q 1N33Q 2FIFA 2MJDA 1SIJA 2L3ZA 2PPHA 1MBYA 2JK8A 1HFNA 2E2JH 3PZ8A 2HD3A 2M00A 2Z0EB 3WWVA 4OELB 4JI2L 4A3CG 1B7YB 4HCNB 1B1ZA 1CI3M 5CV7A 1MG8A 2CHZA 2Y5CA 5LXHA 1Q46A 3K5OA 3D4DA 2G9DA 1RL2A 2NVQH 1GAQB 1A3UA 3DWPA 3G6EA 2TMPA 2AX5A 3AN1A 3TIXA 4GOPA 1D1IA 4WJ4A 2MLBA 2NVXH 2V4DA 3JW0X 4NY0A 4DDID 2RF4A 4OWTB 3CCVA 2HD5B 4KV6A 4W9GA 1EIGA 2H5XA 2J0JA 2KFKB 3AV8A 3PUYA 3EC8A 3ZRCA 1WTRA 4GKKL 4HJGE 1QOBA 2VRRB 1SJHD 1IBXB 4XDXA 2NZOA 1YNNC 2ZCBA 1M94A 2CHWA 4AYBE 2W55A 1XWEA 3KF6B 1AZPA 1E8ZA 3K9OB 1F2MA 2Z1CA 1JW9D 1N6ZA 1UBQA 3N1YC 2PZTA 4ZQ3A 4JV5Q 2KX0A 5D6JB 4KY5A 3FILB 4JYAL 2PMZB 1L6UA 5IKCM 1XPOA 2A6EC 4BBRB 4W9JA 3N9YC 4MIUA 3ZRFA 1YNND 1EYGA 1WR6E 2N7JA 1NSNS 4XYQA 3AB5A 4IUQA 1PXUA 4OX9Q 1SROA 2F0NA 1RAXA 1WJUA 2DGYA 2PW9A 4K14A 2NZHA 5IT9L 4C3JG 1PYSB 1D3ZA 3VR5A 1JOQA 3VR8B 1CM9A 1CSPA 3AEEB 5EPJA 2RDHA 2A6ED 4H02A 4K8JA 2RKSA 4CO7A 3RNBC 3MTSA 2K28A 1JWAD 1JROA 3N20C 4KHZA 1C77A 4BKGA 1KOTA 2EYHA 3LB8C 5CGKA 2WB1E 1OQYA 3V6CB 2YV5A 2E74C 3KW5B 1HUMA 3ZQ4A 4Y7NH 2WXPA 3J81j 3WAOA 4LMQD 1FJGL 1WRIA 4G57A 4X66L 3NRZA 2PEAA 5C5LA 2BTEA 5AZHA 2HHHQ 2M8SA 4M0WA 2CW0C 2M17A 3BIID 3HZXA 1BBXC 3NSWA 2BGFA 3A4RA 3UE0A 4C3IG 3SFEB 3S1QB 2L76A 4NAWB 5CV5A 4WAFA 5LL6X 1NY4A 3HS0C 4LF6L 1YHBA 3M3JA 4L1BA 2VXWA 3CXCA 4A75A 1VQ5A 2JYEA 1VQHA 2CW0D 1K8GA 1J8IA 2DX5B 1TS3A 1HTQA 5HFYA 4F8MA 2UUBQ 1XNRL 3BU2A 4FJVB 4PV1C 1MSHA 5MPOA 3I7FA 2K8HA 4LNKA 5JZEB 2XGTA 1QE6A 4XT3B 4DR6L 4N6EB 5JH5C 4DV1L 1N32L 1EWIA 4DA2A 4EQNA 2VQEL 2R7FA 2REXA 1N60A 2D0OA 1I6HH 3V6EB 1TKWB 1IYJB 3G4SA 1ZYRC 2AWOA 4L5RC 5BYSA 1CZWA 4QGUA 2PNRC 3OWEB 4OXPA 4R1JA 2IY0B 3OMCA 4IO9A 4K3CA 5HG2A 1AW7A 2Q2IA 3VHTC 3GE8C 1XLQA 1TY2A 3OWFA 2B63G 1G291 4LNOA 1LTAD 2BYEA 4XE0A 2DLBA 2MBQA 2VUMG 1D7QA 4QY7A 3MEHA 2INNE 4KZ0A 5CX3A 4L6TB 4LFBQ 4GDKA 4WAAA 3U30A 4YT0B 4HKQA 1UAPA 4HK2A 1B44D 1ET9A 4JQWC 4JI4Q 1WM3A 2Y3AA 1V1PA 2RHQB 1XPRA 1PH4A 2UYZB 5I6YA 2RSUA 1FXIA 5C44H 3JSVA 4ZHPA 3U4EG 2DWQA 2M19A 3TUOA 2XIWA 3L0WB 1OXTA 4DXAB 3CCEA 3Q3JA 2M0AA 3CMMB 4HIOA 4YCWA 3DWMA 1E7ZA 5GXGB 3NUHB 4QAYA 1T0YA 3PUZA 5E3FA 2ZXRA 4YCUA 4FF2A 3A4SC 3S1MH 1JB7A 3GTQB 3Q3NC 3QK0A 4WORA 4MH0E 2A69C 1BCPB 2PZWA 2RSNA 1T5EA 3PUWA 1I35A 1IPGA 2WXGA 2LFNA 4HPPA 2R7ZB 3I56A 2JPHA 1H9SB 1XCTL 1MJDA 3TEYA 1SE9A 3IAS1 1CKNB 4YL8A 1ZKHA 1KLUD 1J9OA 4DUZL 5C0XH 3RNUA 2E2DC 2DBYA 3KWVA 2A69D 5C4HA 2A8VA 3APDA 5CORA 3RNAC 2AQ3B 1PZKD 5FO8B 2XSCA 5JJZA 1S3SG 2KFJA 3WIMA 1FCLA 2D5DA 2BDNA 4A93G 4GGQA 4HTHA 2V4IB 2ZPYA 2Z6KC 3RR5A 4A3JG 2WXOA 1WJJA 2IGDA 3MP9A 1E7VA 1FRDA 1PTOC 1WX8A 1OTRB 1GUWA 4HJ7A 3S17H 1XD3B 5C2TB 2LWPA 4Z9CB 3V60A 1XO3A 2KXJA 4F1SA 5BYRA 4HIDA 1SDFA 4A3MG 4BOSC 4P75A 4LF4L 2PVGC 1UE7A 4XX5A 5IP7G 2QCPX 4XWWA 3MAQA 4GIVA 3HOWG 2BB5A 4FDBA 3B1LX 1DONA 3AFQA 2K6QA 3AI5A 1C4AA 4HJ5A 1HQMC 2PIAA 4N58A 1KL9A 3I2ZA 3QOLA 1L4ZB 5D7GA 3RLNA 2CS4A 3IAYA 3EQLC 4WRDA 1PLFA 2EY6A 3GOEA 1QVCA 4HPLB 3SK4A 3UDGA 1ENAA 4LF8Q 3KDFB 1WZ0A 4C4VA 3Q6SA 1RDPD 2QCZA 2YVCA 3A7AB 5E6PA 4XTCS 1C3TA 2R93G 5GMVA 5GAHC 3SDZA 3QJZA 4F7ZA 1LABA 4DV0Q 3GO5A 3PSIA 1QJOA 3U58A 4X62Q 3GTGB 5C3XA 1RM6C 4A9AA 4DU9A 1X32A 4PMBA 4KD4A 4JWUC 2WKDA 1C48A 2JA5H 4KZCA 5E7NA 2VQFL 5KNDA 1V8QA 1F9RA 5FKAC 3KFUA 1K52A 1SSNA 2WXNA 1FGUA 1QZGA 4BBSH 4MSQB 2E2JB 5HGTA 1WE6A 2ALYB 1L0XB 1AARA 5JXVA 1STYA 4LNNA 4PS3A 2X6LA 3MHSD 5EE1A 3TQYA 3PF5A 2DHZA 2WB1G 1KRTA 1YIWA 2D07B 4CHKA 4KK7A 2NVQB 4RAUC 1EL0A 4DHZE 4KN7C 3H6MA 4IURA 2FE8A 5LL6S 4HCPB 2NVXB 2IY1B 1XTDA 4W9DA 2R2QA 5IT9c 2OQKA 1ONLA 2H89B 1PH9A 2D11A 3ZNHB 5LNK1 1N61A 2LXCA 3PO2G 4UP9A 2BYVE 4FADA 2LJIA 4RWSC 4DPGA 3AULA 4W9IA 1WD1A 4AWJA 1STGA 1NUCA 1F77A 2JJQA 2Z6BA 4P7IA 2L05A 1F52A 4HKZE 2IX0A 1HNXQ 1NI2A 3P75A 5IP4D 4DDGD 3FPUB 4CHTB 3M4PA 3ML8A 3U50C 3T1HQ 1N36Q 4ANWA 3QAQA 3ERQA 4USAA 2PE6B 5J17A 3P1HA 4KJOA 4NXMQ 1SGHA 4ZUJA 5IIFA 1F2RI 2G3QB 3P4SB 1GPXA 5CV4A 1C4QA 4RGMA 4A3KH 5IYBH 4FF3A 2HTME 1F2RC 3DBHI 4BBNC 3N6RA 4BZAA 3GTPH 2HIVA 1Q1BA 2WYQA 4EQ5A 2WXIA 3FP9A 3J7ZC 5EBDA 2CVRA 1EWHA 1EIHA 4DV3Q 2D2QA 4TKNA 4LF5Q 5CHFA 1J7BA 1Q1EA 1P7FA 4R9WA 1HCZA 3L0OA 1N63A 3VR6A 2JU6X 1L6VA 2K22A 4K81A 1EQVA 4XQJA 2QHOA 4KX6B 1QB5D 4Y7NB 1QG7A 4IFDJ 4C80A 3DM1A 4KTAA 4MNOA 3HOYG 5FLMG 4R4TA 5T1IA 2EYFA 1WGYA 2ATWA 5EBCA 2X38A 3AM9A 3EGRA 3H6NA 1EO6A 5KNBA 1A62A 1UGMA 1YOVB 4XZ4A 2VNUD 2ZNVB 1IKLA 4MT5A 2NUCA 1WIAA 4JG2A 4L2YA 4ZYSA 1TVXA 1FCCC 4HJKA 1S5DD 2FFKB 3A7LA 5IODA 4CQNA 2KTFA 4MM3A 5FJ8H 4UY8C 1UE5A 3RI7C 1YNJC 4G4KA 1RTNA 2I5LX 3PSEB 5KRUA 1L0WA 3TN2A 3J7AV 4ACFA 4RCOA 2LXKA 4IUVA 2ZVOA 4W9KA 1WTXA 2NWGA 2EY1A 3CQZH 2IWHA 2RGFA 2WWZA 3ITPA 4X65Q 4FBJB 1S4ZA 2ASBA 1STNA 2JSOA 3EROA 3FEWX 1YNJD 4B3SL 4P2CB 3F2DA 1UWMA 1K83H 3K7UC 1I6HB 1YHQA 1JJ2A 2K1BA 1C8CA 1NJIC 4A3DG 1Q90A 2YTYA 4A3GH 2OJRA 2A73B 3MXNA 4XQQA 3PT2B 2EIFA 1KJTA 3G48A 3U7DA 1NYQA 1WTHA 3AE1B 4GDLB 1LV9A 2VH1A 1L1OA 3K6OA 1V2YA 2WFWA 1HR0W 3VUWA 1JWBD 1E0BA 4ZRPA 2K04A 2KHSA 4DAYA 5J22A 1PVOA 5C3EH 2ZVNA 4GN1A 1F0ZA 1FNUA 4A3BH 3LNNA 4NQLB 5NUCA 5A35A 2CQAA 3PO3H 2LUEA 4P6VF 2CKHB 1TXYA 2V0GA 2MBHA 3RD4A 2JEBI 1JR0D 5C44B 4GOCA 3NQTA 2NVTH 4LF7Q 2L1BA 1B2TA 5DPWA 3P4QB 4OVZA 1EY7A 2HCCA 1GUTA 3PZ7A 2MRPA 2A19A 2H4OA 2KUMA 1I94L 3ONSA 3BS1A 4QIWB 1A6XA 1UE6A 2UXDL 1ACCA 1IGDA 3S1MB 1LQBA 3VFKA 1EZ6A 2EKIA 3CF5A 1PZID 2CHBD 2N88A 2Z4IA 3TZUA 1OEYA 2QC8A 3I4MH 2A68C 2WACA 4LWCA 2IGGA 2KDEB 2IBIB 5IAAC 1X3GA 1NEKB 3KH0A 4O2DA 1TR5A 3OIPA 4NDXA 3QA8A 4DR5L 2F0FA 1VQ4A 2ICEC 2G1EA 2MP2A 3BZKA 5CV9A 5LMUL 2NVUI 1NBWA 1M4VA 3VXWA 5E1FA 4FVMA 1EQQA 1EOVA 4GZYC 3O65B 1RF2D 4K0KQ 1V5TA 3MHZA 1NAPA 4ZDVA 3VTUA 2BYTA 4IPCA 2NTSA 5JHBA 1YBYA 4MSMB 4OW0A 4A3IG 2CHXA 1NR4A 4R4CA 1WCMH 2KWCA 3HVZA 3SR6A 2HDMA 3PIOA 5IYCH 1XF5L 2L8JA 1MKHA 1C78A 2KN4A 2KT7A 3S17B 2AL6A 2KQ4X 4RF1A 4IZ8A 2JX5A 4KKTA 3NTKA 5JAVA 1X65A 4G7ZC 3RNEC 4FYDA 4H44C 1GD7A 4DUYQ 5FR6A 3QIJA 3AEGB 2PW7A 4A55A 4PNYA 1NMFA 2B2VC 5JOBA 1YN4A 2HQEA 2PKOA 4GDKB 3T3NA 1FFUA 2HTHA 1LTBD 3IRBA 2JA7G 3STBC 4PYUA 3CSTA 2ZTDA 3A9KB 2PMZE 1KDBA 5IY0A 4DV6L 2F0KA 1YJ1A 3ZJUA 1LXDA 4US8A 5IGDA 1SAPA 3JYUA 4K7WA 1EYCA 3JSVB 1Q12A 1HEZE 5CC4A 2ONQA 3L16A 5H1SE 3PIPA 2RDGA 1Q8IA 2EELA 4GKJQ 1EWYC 4M8MA 1CA6A 1SYDA 3APFA 3HOVG 2EJMA 3WAPA 1YX5B 4FP5D 1V97A 1D2BA 2L00B 2Q8IB 2CWPA 4XC2A 4FJZA 1C0AA 5K36H 5EPKA 2ZJDA 2UUAL 4FLHA 2KQ3A 3M7NA 5EAYA 4DK1A 1EEID 3K59A 4A3CH 1QKZA 1UBIA 1IYFA 2VB2X 2JA5B 2CR5A 5C3JB 1Y56A 2N3SA 2QDBA 4BBSB 5KYIA 1AWDA 5HKHA 3M4QA 5J18A 1C79A 4HPMB 5T8IA 1K50A 4DBGA 1CZGA 2KOXA 4F88A 1F9PA 5KEEA 5M9OA 4AQ7A 3ND8A 1SNPA 4UAIA 4LJOB 4CGYB 2HDEA 3RUIB 1VQPA 1YNXA 1J19A 4G11A 1P1AA 1B70B 1NNXA 4K5XA 4QUFA 2K25A 1D6EC 4ALPA 1K73C 3A9JA 2FHTA 4NXNQ 4UP7A 4KD3A 2IZVB 1O7IA 1FXTB 1FO4A 4LF9L 1S72A 4HCSA 4G0NB 2F4VL 4EZJA 3UIOB 3W5UB 5EKIA 1WH3A 2K8CA 2HT1A 3KJOA 1FR3A 3TMEA 1R7SA 4B3TQ 4FXKC 3H8HA 4WFN3 2LSSA 1QOFA 4YWLA 2KLGA 1IYVA 2WQYB 1Q1OA 3ZUNA 3E5SA 1V43A 2UWQA 1Y1WG 2ZCCA 1P9DU 3M3YH 2PE9A 1WVLA 3U4VA 4K5WA 2QDLA 3NBHB 4GLAC 2ZJRA 4P1CC 3MJWA 3WANA 4QJFA 3DHHC 4A3KB 3W1GA 2V3NA 1KC8C 2RBMA 3M4OH 3J7YW 3GTPB 2Q8TA 1SR3A 3CU7A 3SK8A 3W5VB 5KGUA 2K75A 4NQKE 1D5XC 4APVA 4JI6L 1N33L 1RIPA 1LTTD 2B3GA 1ZPSA 4XYCA 2KJRA 2KQ7A 4JI1Q 3H3VH 3AE8B 2R7DA 3AEDB 3NVZA 1TKEA 1JOOA 4K1RB 2PQAA 4ME3A 4GU2A 2JXTA 1SYBA 4K6DA 3VR2A 1UGJA 3ND9A 1VQLA 2INPE 1V80A 2J7QB 4M8AA 2PJHA 5IGBA 3IL8A 1EYAA 4US9A 5CBAE 2KOLA 3F1ZA 2NVYH 2F0MA 2F0WA 3FRPB 1HTPA 2E75C 1WR1A 3J81L 2EXDA 4GLVB 4EKUA 3VDZA 3HVDA 1SNQA 5ELFA 1YQBA 2MFIA 1S3OA 3P4RB 4L8JA 2B39A 1A3TA 2KEDA 4RCNA 1TWGH 4HN7A 2A74C 3DWQA 4LLGM 1SBBB 3OOCA 2YEPB 3KF8B 4RA8A 5IWAQ 1X54A 2B2UC 3AEBB 5IOIA 1KNAA 5C4ZA 2ZEQA 2ZXPA 2BT6A 4PZ8A 1SLJA 2PI2E 5CBEE 4P1BC 3CQZB 2VZKB 5G5HA 4JV5L 1RYJA 5FR3A 4K2KA 2IO2B 4URKA 4ABNA 4TQ0A 2K5PA 3UF8A 5M3FG 1WJNA 3ERSX 4WWNA 1HNZQ 2BQQA 4S17A 4XDCA 1K83B 3SFDB 2KTRA 4A3GB 3R3OA 1OTCA 1XNQQ 4HSVA 4OX9L 4PK1A 2VUMH 1VCBA 5AJ3Q 3ZNZB 3QQ8B 1X3PA 2LXJA 1VQ8A 3CC4A 2V4LA 2B29A 3Q0AA 4LK1C 2N78A 2E2IH 5G3LF 3DHIC 2NTTA 4BY1H 3DOWA 3K5NA 3MC0B 3V2TA 4OIKA 1Y1VH 3CMEA 5C3EB 4CYEA 4JBWA 4A3BB 4DAPA 2QEXA 5JPNC 1WGHA 1H95A 4JPSA 1PTOF 2K5DA 3OW7A 2V3SA 3IT6B 1CMXB 2HHHL 1A2UA 2NBVB 1VQJA 5EE9A 2R3ZA 4JCVE 3I4OA 4KIKA 2WDRB 4C3HH 2L9HA 1Q81C 1WWTA 1K3BC 3S24A 1QNUA 2NVTB 2JA9A 4IOCA 4DGZA 1UEBA 4WJNA 2CQOA 4WIPA 3RMKC 4BBRG 4GLXA 2Y5PA 3A56A 1L7YA 4H2AA 4J6IA 1I4PA 4MN3A 4TRDA 4HRSA 3BK1A 3L7ZC 3K57A 3I4MB 2PNHA 4IC7B 5BO4B 3QWNA 3HRDD 5JEAH 3IT4B 4A3PA 2ZW1A 1I4HA 3M63B 3NY5A 1VQCA 1K3RA 1BR9A 3RZOH 1TWFH 2A1AA 3SXHA 4NW2A 2JVCA 2Q5WD 4EZLA 3RZDH 2PZUA 3D4WA 2L32A 2LFIA 1K53A 3ICEA 4HJAA 3VYTA 1ZKOA 1WRDB 4A20A 2Y0SB 3R66C 1TS4A 3KLSX 3TRZA 3I57A 4RNAA 4ZKCB 3TS0A 1KTKA 1EIFA 1I50B 2XNAC 3BINA 4X64Q 3HHMA 1JT8A 4WJOA 1ZDVA 1WCMB 2DJFC 4TSSA 1RLFA 1GOZA 2FCNA 3GZNB 3ULLA 3AMUA 3K7AH 2FBWB 4II2B 5I2YA 2DYBA 1L1OB 3V61A 2AMCB 3IKJA 3I4LA 2M1MA 2M4NA 2LI5A 2Q8RE 2IJ0A 4LFBL 3H15A 3T3OA 3VR4A 1BQQT 2KCMA 1MPEA 2JA8H 5CTRC 2F0PA 4JI4L 2EMSA 4R4OA 3ZYYX 2HQLA 3P63A 4WQOB 2KDIA 4C1NK 2A5UA 1OXSC 2VW9A 3S15H 2YLMA 3W1YA 4MZ9A 1S40A 1WJ6A 2O2VB 4X3SA 2P5ZX 1EF1A 5IYDG 1PRTB 1HTLD 2KQSA 1JWMD 1P98A 3B2FA 4FHKA 2XRQD 4I6NB 3T1YL 2OTJA 1T6BX 1GUNA 3TEZA 2C60A 2D9UA 2IHEA 5M5XB 3ZXRA 4ILWA 2ASQA 5IGCA 3AE7B 4IOAA 2BA0A 2QSDA 4LFAQ 1VZ6A 1SIFA 1QUQA 4DV4Q 2ZT9C 1OQRA 1ZEQX 2NPTB 1ESRA 4YHHQ 3KBGA 1Q7YC 4OO1H 4W9EA 3K5MA 5G5GA 2MP2B 5BN5A 2K33A 2AWTA 5AEKB 4O0AA 4BBNF 4IALA 2N55A 1HJPA 1VCIA 4G7OC 1NVID 4DN4M 5C3WA 3L13A 3GTJH 1G6ZA 3D0FA 5EQ0A 2JZ3B 2KO3A 3B2GA 3NVVA 2EJFC 3A33B 3R7QA 4AS1A 5BR8Q 4DF7A 2Z8LA 3K9PB 3DBRB 1A15A 4IN3A 5HGQA 2G4DB 2PQEA 1K8OA 1STAA 3DPDA 4KHPQ 1BCPD 1SEBD 1KLVA 4GNXA 1E2ZA 2R92H 2ZTCA 2KNBA 4W9LA 3T9LA 3NXWA 5JHAA 2KCNA 1QOHA 1LACA 3DCGA 1HH2P 5LMNL 3H7SA 1VQIA 5JPMC 3GTKH 2R7ZG 1RWSA 5IP9G 2B3AA 4B3RQ 2NN6I 3P42A 1U0LA 4R4IA 4YIJA 5JJLA 2KC2A 1EFWA 2EDGA 5BMIA 4GB9A 2I2YA 2OCEA 4Q0FA 3MEFA 3PUVA 5C4XH 1DD2A 2DNFA 4LF8L 2K5QA 1R4PB 1O80A 1Y14B 2AQ2B 1CKMA 5D3DA 3HKZB 2JZPA 3WA0A 3ZNGC 4C00A 2DYMA 2G4SA 3TJPA 4DXGA 3QWZB 3J81c 1U5KA 4QCLA 3PRMB 4H7BA 1ROEA 3M3YB 4DQOC 2BE5C 1CFMA 4BS9A 4X62L 1P7EA 2DY8A 1YJJA 3M95A 3TEHB 2OJWA 4B3MQ 2GBNA 2ICIA 3M4OB 2WGSA 2NN6G 3W1BA 1JE4A 2E5LQ 4PZ7A 3SHQA 4HR7B 2KAJA 4NPSA 1TS5A 4EZKA 3H0GG 4B08A 3R8BA 3GTLH 1V9JA 3B0AA 4DFAA 4OHJA 1CKOA 4J3OD 2BE5D 1I3QH 2KMMA 2D5GA 5EGTA 1O7ZA 4YTMB 1UF0A 1IW7D 2EOTA 4C2MH 2MW5A 2J0TD 2Z59B 2NVYB 4EX5A 1KIXA 1YQ4B 2WP9B 2QIEB 1PFNA 2RMMA 4ZYNA 2G5DA 4BXXG 2NBWB 1PFSA 3LX0A 2OEOA 4AH6A 2F52A 1DGJA 1FFVA 1DM0B 1NYRA 1BDOA 4JI0Q 2CFMA 4YWKA 2ACZB 2EYJA 1RD9D 5ELCA 2N1WA 1T9HA 3IHPC 2KEEA 1H9JA 1E10A 3QJYA 1TWGB 3MA2B 1E9MA 2MWSB 1F2ZA 4RGOS 1WXMA 4BVUC 3Q8DA 3AFPA 4MGZE 4JVZA 2B2TC 1JOKA 1C7YA 2HCIA 1KF6B 2F0QA 5ELOA 3TP8A 4CDDC 4A3FH 1TZOA 2FUHB 4DHJB 2EMTA 3BYTB 3KWLA 2D3GA 5I2XA 2H88B 3GQBA 1NCVA 2ZM6Q 5M5YH 3KJPA 1L4DB 3CCQA 1HNXL 5BYQA 4AJYB 3H7PA 2W54A 1PGBA 3SE0A 3SVMA 3FMCA 3I4NH 2K39A 4S0RA 4L5QA 4OWWB 4A3EH 4A3LH 3P20A 3T1HL 1ZOYB 4OIJA 1N36L 2K8BA 3PV1A 2JSVX 1KABA 4NXML 5EKLA 1LTSD 1XEEA 1OEYJ 1PGAA 3RZWC 1GJZA 5I4DA 2VUMB 1Z7TA 4PQXA 1PFDA 2QW7A 1K8RB 4ANUA 2J0KA 1TIID 2LMCB 5HY6A 4X57B 3VH4B 4KKJA 1E7PB 2E2IB 1FGBD 4BY1B 4DV3L 2LGYA 2JT4B 2WXRA 1LM0A 1JQ4A 4U68A 4LF5L 3V3XA 1T0QC 1SN8A 4CDEC 1Y1VB 3AE9B 4JBJA 3URYA 4OVUA 2DJGC 5M3MH 3K8AA 5EE3A 2K1FA 2E2HH 3BY4B 2BWES 4N8X1 4NKLA 2RR9A 3Q3MC 4KLKA 2GBMA 1BOSA 2I5MX 1GO3E 2I1JA 4DK5A 2LY7A 2GRIA 1TT2A 2XTIA 1QVFA 4C3HB 4JI8Q 4ZOHC 2B2VA 2IT1A 1ZDXA 1B4OA 3GP7A 1TIFA 3RNFC 2CU1A 3UDIA 3J7AF 2IW3A 3I73A 1SYFA 1EY0A 3HOUH 1JRUA 3N32A 1V9PA 1E7UA 3ZNID 1Q82C 3Q8CA 5LMNW 1VDZA 1ZXHA 1CK1A 1BUVT 5COYA 1DOIA 1LTRD 3I8ZA 5J3BA 3N3KB 3R93A 1YHAA 4G7HC 3H09A 2N9LA 3IFWB 1ZXTA 4DR7Q 2SOBA 3A8KE 4BY7H 2WXQA 1UZXB 2WXHA 3Q8BA 1UWVA 1QVGA 2EYPA 3WOFA 4RGTA 2ZNVC 3Q69A 2EYOA 1BUIC 5AUIA 3I90A 1STBA 3L9AX 3QR8A 1TWFB 3RZOB 1KRHA 4X65L 4LAAA 3EFUA 2MUYA 2OT2A 4K7UA 1OXXK 3P7JA 3RZDB 4WWOA 2UXBQ 3I5JC 1FIQA 1PDXA 4KN4C 2BYFA 3MTNB 3SDLC 4TMAB 4ZRKA 4NPNA 2LGDA 4FXCA 3E0EA 1GUAB 1WMHB 3Q8EA 3DDCB 1G91A 2MHJA 2O6VA 1BKBA 3R7RA 2N9XA 1TWCH 1P8LA 1QILA 1KFYB 4FN2A 4GN4B 1LUZA 5E6NA 1CSQA 3VTWA 3K7AB 1A5RA 3BK2A 2MBBB 1Y8PB 3T8MA 3U7ZA 2C9OA 3BDCA 4JPBW 1D5MC 2KJ6A 3RYTA 4MGYE 4TQUS 3MXGA 2HJ1A 3AH7A 3ZIMA 2JA8B 4YXDB 1MHHE 3HOZH 1F9JA 1XCQL 1Q8KA 1B8AA 5IE8A 3S1NH 3M85A 3GS2A 2YTXA 1WYDA 2JF5A 2D3BA 4AYBB 3S15B 2UXCQ 1VQOA 4LF7L 1JE5A 2DZJA 3OLMD 1GC6A 1TKGA 4JI3Q 2VB3X 3DQVA 4EEWA 1EQRA 1SXTA 4DV2Q 1YN5A 1S5FD 1WI5A 1ICFB 3OMGA 3CCSA 2K0PA 3GTMH 4JGHB 2OHFA 2SAKA 2MQHA 4HJ9A 4X3TA 2CH4W 5LHY1 2BH2A 1VD2A 2J0MA 2L52A 1G2TA 3HKSA 3N1ZC 3AEFB 2F4IA 3ZTCA 4ANXA 1X9NA 4NZLB 1DOXA 2L5TA 4R8IA 5IGGA 2LHEA 2LZ6A 2GBKA 4GNXC 3ZW3A 2OWOA 2WS3B 1XYIA 3PO0A 5TR5A 2IY5B 4K0KL 4ZAIA 1A8VA 4IW0A 3F2BA 4GXBA 4V190 4OVVA 1MFWA 3S2AA 3N52A 4GOPB 2WXFA 4LTUA 3ZDMC 5CHWA 1GVPA 3H91A 1T3QA 3GTJB 4BKSD 2BOSA 1J8CA 4IUUA 3GDEA 3V96A 2KDMA 4YY3Q 5DPSA 2FCQA 2KANA 4KVGB 2F0EA 5C44G 2E6XA 1MVKA 4REZA 5C0XI 2JA6H 2FAZA 3NWSA 1JMCA 1LFDA 3KLWA 4I6PA 1QNKA 2KHJA 4KMUC 3BWUD 3L17A 1RFAA 3LWEA 1QCBD 4BWGB 1QOGA 1CT1D 2RA4A 4J1MA 1J5EQ 3J80L 2I0QA 2DNCA 1W3SA 1LTID 2JXMB 1PH1A 2R92B 1F1HA 3HK0A 2WXLA 5E6JA 2WDQB 3E9IA 3NZ3A 1D4BA 2LVQA 4EGVA 3NELA 2F0IA 3GTKB 2BDOA 1TYGB 1HR0Q 2ZJQA 3VQIA 4KY7A 4DAMA 3AMZA 4NJ6A 2L0FA 2VL6A 1I4QA 3PIO3 5CYUA 2B2UA 5C0XG 1ILPA 1HZ5A 2LVPA 2X69A 1D5ZC 5C4XB 1KDAA 1PYWD 2KCCA 4TUUA 4DR4Q 4K7SA 2IO1B 4M01A 3BDLA 1J0GA 1TGZB 3F2CA 4GKJL 3RT3B 3RULA 4ICUA 4CDCC 3WAMA 1OO9B 3PMFA 4DV7Q 4KKUA 2KA7A 5JEAJ 2EY2A 3G71A 1NBFC 4PMCA 2KFKA 5L37A 3E3XA 1IBXA 4FF1A 4XGAB 3KYHC 4ZRIA 4M0WB 3KF6A 1GM5A 1EY9A 2K03A 3CCUA 4N8FA 3GTLB 3T13A 1DXMA 1MD2D 3PIP3 3K81C 1H4RA 2BS3B 2KWUB 1VQ6A 1V1OA 3R3MA 2F0OA 2FNJB 1I3QB 3DBHB 3FILA 2BW2A 3C1FA 2WNMA 4IPGA 4JX1C 4DK6C 1KLGD 4C2MB 5KYLA 3AE5B 1XMOQ 4ZRZA 3MC8A 1CQVA 1FEHA 3AEAB 2LGIA 3FKIH 3AXCA 3C0RB 2KJHB 3D8GA 2SNMA 3S1RH 3KLSA 1R4QB 2K01A 4LDTD 1VQEA 2WXMA 5HURA 4ZHOA 3MFGA 3F2UA 4JBKA 1I42A 3EUB2 3TEWA 4IPDA 2AUJD 3CMAA 1FNVA 1DOKA 3A1QA 1EUJA 4NP5A 2E3TA 1Q0WB 2UUCQ 4NXNL 4A4IA 2BWFA 3BYYB 4A3FB 1Q10A 1I50H 5M3FH 4WJQA 3QG1A 3ZXVA 4FXDA 4WJ3M 3PGEA 5M5YB 4A6QA 1DZ1A 1EIYB 1MJEA 4B3TL 2JA5G 4WWMA 4PMWA 4V0BA 4K3BA 3KBXA 2RCFA 2LJ5A 3I4NB 4PT5A 2X6GA 2QGQA 4E71A 1IBMQ 4HCEA 4A3EB 4BBSG 1QOAA 3SU8X 3S2HH 3J7A5 1WOCA 2FIDA 4JI5Q 1UD7A 3HM6X 4R3DA 1S5BD 4X6AH 3HOXH 1VQ7A 1NE3A 1TWAH 4G50A 4KSKC 2YTVA 3R2IA 3HOVH 4NAWA 3UI2A 2GLSA 2L55A 3H94A 1E6EB 2I5HA 1SE4A 2OOBB 1LT6D 1O7YA 1HTOA 3PVLA 3FC4A 1JJCB 1V1PB 1W6JA 5GROA 1IBKQ 2L12A 1ILQA 1F2YA 2I07B 4JI1L 1BT0A 1WYGA 4S3SA 1WTVA 5GQOA 1EM7A 4YWGG 5CR3A 2GBRA 3NVYA 3MXPA 4W9HA 5M3MB 3EECA 1ISNA 1I4GA 4HMJA 2E2HB 2OQ0A 2F0TA 2A6HC 4HWIB 4LDTB 5M5XH 1VDVA 4B6WA 2WX0A 4GN3B 1DOMA 2KECA 5DAUA 1HNWQ 1AE2A 1WGRA 4WQMA 5DPTA 1VZ8A 3JVZX 3CSFA 3W3AA 1SRUA 5TSSA 3HOUB 3D4RA 3DBLB 1SSOA 3TSSA 4HIMA 1YIJA 2RD0A 1C4PA 2LUMA 2A6HD 4OWXB 4UHVA 5IWAL 3NS1A 1V86A 1R4MB 1B9MA 1VMCA 3VH3B 2DENB 3PPAA 2E8GA 2D2CC 3UDXA 2Q2UA 4BY7B 1HA6A 4A3KG 4N9TA 2WXJA 5IYBG 3CPFA 3ZKJC 1LT5D 3T53B 1WGGA 2FMMA 1IBLQ 3MZ5A 2R61A 4I65A 2QF7A 2N49A 1K0SA 2EVBA 1AN8A 1L0VB 2D3AA 4F87A 4U673 2WX1A 3OAWA 4NJCA 1DJRD 4E74A 3ML9A 2MA9B 2SDFA 1HNZL 3S2DH 1YNTE 2HJ8A 1XXGA 4ZK9B 5EPLA 4LFCQ 3C19A 3LGJA 4RGNA 1WF9A 1XNQL 3K5LA 3IBEA 4GLSC 1PQSA 2JN4A 4JOIC 3WDNA 2L1AA 1SF0A 5AJ3L 1G6PA 3AU5A 3QO2A 1QWYA 1KM7A 2KVZA 4O42A 1TWHH 3UGBB 2Q2HA 3BVZA 2L83A 2RDBC 2JRHA 1TWCB 2N9KA 2K6AA 2PVOD 4DHZB 4F7XA 2M2LA 4IKGA 1Z47A 5FK9C 1BCPF 2QEJC 3NBIA 4EQPA 1R4NI 1QF6A 2BVCA 1SJED 1HZ9A 3NWTA 3VYRA 1CKNA 1YI2A 1Z9FA 3B6YA 5D3IB 2K5NA 5FJ8G 3W1SC 3VR9B 3KYCD 2JXXA 4J15A 3RLOA 1E2VA 2WP8J 3HOZB 3JC66 1UNSA 3S1NB 4RHSA 1T0SC 4C3JH 1WXQA 4C4VB 1FD6A 2EYMA 2KHWB 2PI2A 2J42A 2VZKD 2MEKA 3ALBA 3JAMi 2MPMA 3HKZE 2WU2B 4IWOA 2ZJPA 1DOYA 4BOZB 1VR9A 1LTGD 3L10B 1EY4A 4EOYA 2XWJB 4R4QA 1U4MA 1Y8OB 5CV6A 1E2WA 3OTOQ 4DR1Q 3EVQA 3GTMB 1XLOA 4KV2A 4DK0A 5C6AA 1RKNA 4KDIC 4PS8A 2BKRB 4A3GG 3GB1A 3L2PA 4HVBA 3EIVA 1JWUD 2NMQA 3C3LA 4TKOB 4C7YA 3J80c 4C1NI 2Z0DB 2L0TA 5H92C 4C3IH 4OL7A 5ELNA 3AQQA 2XVSA 4HSPA 4MJSA 4CJ2C 2OXPA 1YITA 2KX3A 1SE8A 3FKYA 5C3EG 4FULA 4D2KA 2K5HA 1K28A 4A3BG 1U4LA 1GUOA 3TP7A 1HZBA 3QIAA 3GV3A 3KDFA 4PZ6A 3TDQA 5FLXE 1RODA 3PO3G 4X64L 2C7HA 1XLPA 4CKCA 1SMYD 2ZW0A 3GTOH 2TSSA 4KY6A 4RMFA 3ZJTA 2JA6B 3CRLC 2O6VB 5CHVC 2F0LA 3UQBA 5E4XA 3NPPA 4DR3Q 3HG9A 3CC7A 3FPPA 4IM0A 2KD0A 3TCAA 1L2NA 1YMHE 2MNAA 2WAQB 1ZW7A 1B53A 1SNDA 1W6KA 2N7DA 4JIOU 3I4MG 3ETRA 1WI0A 3RLFA 2IX1A 1EFID 3ONAB 1WGKA 3BJUA 2B63H 2L7RA 3DBSA 4IG7B 3BZDB 2ENBA 1FMAD 4QUCA 1TS2A 3BZCA 3ZDTA 4F8CB 4A90A 1NDDA 1X56A 4P72A 2M56B 2NR2A 3HIZA 2B2TA 4A76A 4RKLA 2HDLA 1HRJA 1CA5A 2FUG1 3S16H 2Y0SG 1EZ8A 2CJNA 2K50A 5E4WC 1KD1C 2UU9Q 1S5CD 4BKTA 1GB4A 1E22A 3S9WA 4RKBA 1U9RA 5HI1A 3A0JA 2X8XX 3H0GH 2DYOA 1E5WA 1WCMG 4B9KA 2MGSA 2M9VA 5IYCG 2BS4B 4LNFA 1LT3D 1FVIA 3FVQA 4YHHL 4EFOA 4MEMA 4P16A 5DEHA 1PRTC 2OTLA 1PZJD 2W9NA 2KMAA 1VLBA 3OW2A 1M8AA 2A5HA 1TT5B 4TV3A 4IUMB 3JAME 2BCOA 1PH6A 2JRIB 4BA1I 4JI7Q 3O13A 2VY3A 1VQMA 1A70A 3TMPB 1PH7A 1N34Q 2JUOA 1GJXA 1HZAA 1B3QA 5BR8L 5A2QE 1J7AA 4MM3B 2G9HD 1AH9A 1PRTD 1HQRD 2UUBL 4PG3A 3DLLA 2KN5A 3X3NA 3VR3A 1P16A 3FKIB 1D8LA 3I70A 4QQBX 4KHPL 3E56A 1NI3A 3S1RB 4LK0M 4M8NA 5IN7A 4A93H 2K3UA 1J6QA 2IDYA 1ML0D 1N62A 4A3JH 2B76B 1SB3C 2F0GA 3MXUA 2K9XA 1WFYA 2RCNA 4CKEA 2SNSA 1AZQA 1LM8B 1A63A 3QARA 4B3RL 5M3FB 1XPUA 2C7NB 1SYGA 3SHLA 3BVMA 1TKYA 3CF6E 3PHXB 2DZIA 3L3OC 3R2TA 5K36G 3L54A 1M90C 3MXNB 4A3MH 5IOCA 2V1YA 3C2PA 5HHDG 3DXJC 1MI0A 3RPFC 5IP7H 1ZXIA 1G2SA 3QHTA 1NMGA 3HOWH 4NAMA 5I9PA 1MGSA 3FDTA 2J53A 2B8FA 5CMDA 3CCLA 2N0SB 1EOTA 4BAXA 2MO0A 1MIUA 3S2HB 5KHOA 1RCVD 3PLUA 4KSLC 3HOXB 4DAYB 1TWAB 2KENA
chains in the Genus database with same CATH topology
3HOVB 1PTOH 4YTPB 5F2DA 5ISRA 1II3A 5C5MA 4ODGA 3SEBA 5D65A 4YSYB 4N59A 1ET6A 1EEFD 2PMVA 3A8JE 1PFBA 3A55A 2FINB 5BMHA 4Q5VA 2V3PA 1LO5D 4RF0A 2RDFA 4K6LA 4CJ1B 1PDQA 2PO4A 3EJIA 3QB3A 3NQIA 1WTOA 2EJGC 4DNTB 5ELEA 3H3VC 2MJEA 1ICWA 1JMLA 3Q8AA 2DNEA 3I91A 1ENFA 1BCPC 3DEOA 1BXTA 4ZUIA 3X3MA 2K5WA 2RPVA 2FJ2A 2QMTA 3CIRB 3VRAB 1H9RA 4CJ0B 5IGEA 1EQTA 5FO9B 3MWYW 3S2DB 2NYZD 4IFDI 1WD0A 1YQ3B 4BA2I 1GB1A 4XYOA 1TWHB 2R6GA 2QJLA 1STEA 4QB4A 3RUZA 2I46A 3OHXC 3DUZA 3RFZB 4XDDA 1UUPA 3NP8A 1FD7D 2O2LD 5DM63 4QMGA 2ID0A 1IGCA 4ZRQA 2IL8A 3Q24A 3Q23A 2B2YC 4C3JB 4IFDG 4A8XC 1Y8NB 2XWBB 1B3AA 4EQOA 2MJ3A 1JALA 2WU5B 4UDUC 1IW7C 4K5VA 2F0UA 3AECB 1FXAA 1KDCA 1F9QA 2L4NA 3MVVA 2GB1A 3U9SA 3TP5A 3J81E 1TQOA 1ZYRD 2OEDA 4XT1B 4C3IB 3HUIA 2PLPA 4XWTA 3HGBA 3A54A 5ELDA 3PV0A 1JRPA 3OIQA 4KGTA 1B50A 1RTOA 1XTCD 1WTQA 5EKKA 4IDIA 2F03A 4C3HG 3CWIA 3GTOB 2EY5A 3D6CA 1VZ7A 3T16A 3WCQA 3NUCA 2J4XA 2BS2B 2BBCA 1QQRA 5FO7B 4E6IA 2IX3A 1X3QA 5JEAG 5BN4A 3W9CB 2B63B 4H0LC 2JYTA 1EY6A 1TY0A 2PYKA 3IAM1 3BDOA 5CV8A 1BO0A 4WJWA 3BG3A 3U2SC 1CJEA 1GUSA 4HEDA 1CQFA 2B2WC 3AU7A 5J1ZA 3S16B 3NTIA 4IQZA 1OXVA 1IYUA 1VRAB 2L11A 2Z4HA 3K58A 1VMPA 5G3LD 2D62A 3H0GB 4DNRB 1VF7A 2RVLA 3UI3A 1RHPA 2F1MA 3GD7A 1PFMA 1PTOD 2WXKA 4K8IA 3U9OA 2NBFA 1PGXA 1EY8A 1S5ED 2MHVA 1IL8A 1OFFA 4C56C 2O4XA 2C5CA 2QILA 4OO1I 3GV6A 1SNCA 5DNFA 3NBHA 3DWGC 4DXFA 2BB6A 2KWDA 1WTWA 4KGSA 4A93B 4IUTA 1I4RA 4A3JB 5ELBA 1KH0A 1XX8A 3E0JA 2JP1A 4QF4A 1QLBB 3V05A 1STHA 2K05A 4EVOA 4A3MB 4FF4A 4OO1G 2DN8A 4FO2A 1U4PA 4RH6A 3HOWB 3IXSA 4KJNA 4EE2A 1SE2A 1IKMA 3EA6A 4ARCA 3D6WA 2RQXA 1CHPD 1JQYD 1PTOB 1JC7A 3E6ZX 1HHVA 5IT9E 3OSOA 3KF8A 4KHVA 1WSPA 3NE5B 3E9SA 2JQRB 3DMUA 4FNFA 2YEPF 5EE0A 4XQNA 4JE3B 5I6WA 5IGFA 2R93B 3C8YA 4I7ZC 3HP3A 3I72A 3DHQA 2O5JC 4YSXB 3W1SA 3K0YA 3SK5A 2W82A 3TZDA 3CRKC 4OZCA 3DEPA 2GA4B 1HFGA 4C7ZA 1IUEA 4L63B 3TP6A 3EFXD 2WB1B 2J52A 4JWSC 1I4XA 1LLRD 5H8YE 1SYCA 1SNOA 1HUNA 4O1NA 2KVMA 3NVWA 5FOBB 3TEXA 1BF4A 3PO2B 1I7HA 2BA1A 1JICA 4ARIA 3DWAA 1XLNA 1NENB 1C9FA 1UWXA 3CKIB 3AE6B 3AE2B 4N9PA 1JORA 3VRBB 1AFPA 2F0DA 1N5XA 4IOIE 1RJTA 1GHKA 2JE6I 2ON8A 2F3WA 1OQQA 5FLXL 3I3CA 3ZGZA 3T4AC 1ZUD2 3LXFA 4B9XA 1GXDC 3WOEA 3Q8FA 3HOYB 2W3SA 1OXUA 3C1EA 4TQ1A 1MSGA 5I9OA 2WKCA 4KKIA 2EXZA 2L0CA 3G6JB 4H13C 4J8QA 4OZBA 2AQ1B 1YN3A 1E0ZA 4OZAA 3U52E 3ABVB 2CJOA 5T1GA 3TBIB 2IGHA 1QT9A 5BN3A 5JVG3 1N5WA 4CKBA 2CU3A 1U4RA 3LWUA 2QKIC 1L0YB 1PRTF 2WLBA 2LS01 1ZP0B 3JAML 2DY7A 1Q3LA 4A3DB 1EU4A 3VYSA 3C46A 3P4PB 2K7VA 3KQ4A 5A2QL 3NTHA 2LEKA 3NK9A 2HUGA 1O7LA 2JYOA 2O5IC 4J6HA 2F3VA 1LT4D 2A68D 1IHZA 1PUTA 3D31A 1SE3A 4ME5A 2GI9A 2OF1A 4OGQC 3MFYA 1RFKA 1K51A 2J7ZA 4CBVA 4FXGC 2WINB 3KUPA 3I9V1 1HPCA 4WURA 1DYQA 1I6VC 4X3UA 4MACA 3Q22A 2EPBA 3T56B 4MHEA 3T51B 3D3RA 3CHBD 2AUKA 1AP0A 5KIXA 2MJ8A 4HMIA 1B9NA 2NB0A 3MJ5A 4ID6A 3VA7A 5C4JB 3NHHA 1F9SA 1JCKB 5D14A 5BMGA 3B9JA 1VJKA 1FRRA 4A3IB 1JB3A 2F0SA 1DCZA 3G7LA 3AE4B 1KNEA 1ZE3D 2F0VA 2EYLA 3KK7A 3RMHA 5JVH3 1H9SA 1NR2A 2PW5A 3M7GA 2JA7B 3SR1A 2EZVA 2E76C 1FNWA 2PPBC 2LKVA 1K8MA 4NMZA 3J9CA 2JEAI 2JWUA 4WH4A 1T5XD 1HA5A 5K5PA 3IFDA 1C76A 2EE1A 2XN9C 4B0MA 4HEA1 2WDVB 4ITKA 1VF5C 1TJEA 1SFOB 3P1MA 1V8CA 3A8IE 4ZLTF 1EY5A 1H9KA 4ULLA 1SYEA 1UEAB 2XRSD 5J39A 3W2DA 5DM73 2KACA 2NZ1D 3M4YA 3PUXA 3AE3B 2PTLA 1CTMA 2K32A 4HROA 2B2YA 3OPOA 1SMYC 1FM0D 4X3KA 2LMCA 1Y69U 1EWCA 1SNMA 2KJXA 3L4PA 5C0XJ 3SK6A 2YU9B 1A3VA 4RHRA 1ENCA 3VYUA 2SEBD 5EJWA 3J80E 1JWSD 5KNCA 1J7CA 2AWNA 2FMCA 2F0JA 3VA5A 1MI2A 1GUGA 4DAVA 1L5PA 4L23A 1B9RA 4XXEA 3LYYA 1PMRA 1TU2B 3IFTA 3QOJA 4MH8A 1YJIA 2PCFB 4R8NA 1D1KA 1ESFA 3HEJA 1Y1WB 4IFDH 1C4CA 1MHXA 2I38A 4K2LA 1R9TB 2YYZA 4ZKBB 1BNZA 1G8ZD 2H1EA 1WTPA 4LJZC 4XIGS 2MP1A 3MHBA 3HRZC 4HAEA 2B8GA 2NN6H 4IUPA 5M5WB 2LHDA 2ZXOA 2WIIB 1F2LA 2IPKD 3AB9A 1DOLA 1FYCA 2WV6D 3ZJVA 1AEXA 4B9WA 3FAHA 1BMLC 4KKSA 1CHQD 4KI0A 4IUNA 4YSZB 1HXYD 4RFBA 2B2WA 1O78A 5AUKA 1AYFA 2RSOA 3S14B 1HZ6A 5AFWA 1Z6HA 2W3RA 4Q2JA 3KLRA 4M1UB 4KGRA 2MH7A 4JK1C 2F0HA 3PO3B 4B0EA 1EYDA 4YTNB 1GHJA 1EU3A 1H9MA 3BVGA 1A2TA 1CZPA 1KAAA 2MJDA 1SIJA 1MBYA 1HFNA 3PZ8A 2M00A 1B1ZA 1CI3M 5CV7A 2Y5CA 3K5OA 3D4DA 2G9DA 1GAQB 2AX5A 1A3UA 3DWPA 2TMPA 3AN1A 1D1IA 2V4DA 4KV6A 1EIGA 3AV8A 3PUYA 1WTRA 4HJGE 1QOBA 1SJHD 1IBXB 4XDXA 1YNNC 2W55A 1XWEA 1AZPA 1F2MA 2Z1CA 1JW9D 2PZTA 4ZQ3A 4KY5A 3FILB 2PMZB 1L6UA 2A6EC 4BBRB 3N9YC 4MIUA 1YNND 2N7JA 1NSNS 4XYQA 3AB5A 4IUQA 1PXUA 2F0NA 2PW9A 4K14A 5IT9L 4C3JG 3VR5A 1JOQA 3VR8B 1CM9A 3AEEB 5EPJA 2RDHA 2A6ED 4K8JA 2RKSA 3MTSA 2K28A 1JWAD 1JROA 4KHZA 1C77A 2EYHA 3LB8C 5CGKA 2E74C 3ZQ4A 1HUMA 2WXPA 4LMQD 1WRIA 4G57A 3NRZA 5C5LA 2BTEA 4M0WA 2CW0C 3BIID 3HZXA 1BBXC 3NSWA 4C3IG 3SFEB 3S1QB 4NAWB 5CV5A 4WAFA 5LL6X 3HS0C 4L1BA 2VXWA 2JYEA 2CW0D 1J8IA 1TS3A 5HFYA 4F8MA 4PV1C 1MSHA 5MPOA 1QE6A 4XT3B 4N6EB 4DA2A 4EQNA 1N60A 1TKWB 1ZYRC 2AWOA 5BYSA 1CZWA 2PNRC 3OWEB 3OMCA 5HG2A 1AW7A 1XLQA 1TY2A 3OWFA 1G291 1LTAD 4XE0A 2DLBA 3MEHA 2INNE 4L6TB 4YT0B 4HKQA 1UAPA 1B44D 1ET9A 2Y3AA 1V1PA 5I6YA 1FXIA 4ZHPA 3U4EG 2DWQA 2M19A 3TUOA 2XIWA 1OXTA 2M0AA 3DWMA 5GXGB 3NUHB 3PUZA 5E3FA 2ZXRA 4FF2A 3GTQB 4WORA 2A69C 1BCPB 2PZWA 2RSNA 1T5EA 3PUWA 2WXGA 2LFNA 2R7ZB 1H9SB 1XCTL 3TEYA 3IAS1 1KLUD 1J9OA 5C0XH 2E2DC 2DBYA 3KWVA 2A69D 5C4HA 5CORA 2AQ3B 1PZKD 5FO8B 2XSCA 5JJZA 1FCLA 2D5DA 2BDNA 4HTHA 2V4IB 2WXOA 2IGDA 3MP9A 1FRDA 1PTOC 1GUWA 5C2TB 4Z9CB 1XO3A 5BYRA 1SDFA 2PVGC 4XWWA 2QCPX 3MAQA 2BB5A 1DONA 1C4AA 1HQMC 2PIAA 4N58A 3QOLA 1L4ZB 5D7GA 3IAYA 3EQLC 4WRDA 1PLFA 2EY6A 3SK4A 1ENAA 3Q6SA 1RDPD 3A7AB 4XTCS 3SDZA 1LABA 3GO5A 1QJOA 3GTGB 1RM6C 4A9AA 5C3XA 4DU9A 1X32A 4PMBA 4KD4A 4JWUC 2WKDA 1C48A 2WXNA 5KNDA 1V8QA 1F9RA 5FKAC 1K52A 2E2JB 5HGTA 1L0XB 5JXVA 1STYA 5EE1A 2X6LA 4KK7A 2NVQB 4RAUC 1EL0A 4KN7C 3H6MA 4IURA 2FE8A 5LL6S 2NVXB 1ONLA 2H89B 5LNK1 1N61A 2LJIA 4RWSC 1WD1A 1STGA 1NUCA 1F77A 4HKZE 2IX0A 3P75A 3FPUB 4CHTB 3ERQA 4USAA 3P1HA 4KJOA 4ZUJA 5IIFA 1F2RI 3P4SB 1GPXA 5CV4A 1C4QA 4RGMA 2HTME 4FF3A 1F2RC 3N6RA 1Q1BA 2WXIA 5EBDA 2CVRA 1EWHA 1EIHA 1J7BA 1Q1EA 1P7FA 4R9WA 1HCZA 1N63A 3VR6A 2JU6X 1L6VA 2K22A 1EQVA 4XQJA 4KX6B 1QB5D 4Y7NB 1QG7A 4IFDJ 4C80A 3DM1A 4KTAA 5T1IA 2EYFA 2X38A 5EBCA 3AM9A 3EGRA 5KNBA 2VNUD 4MT5A 1IKLA 2NUCA 4L2YA 4ZYSA 1TVXA 1FCCC 1S5DD 2FFKB 3A7LA 5IODA 4CQNA 1YNJC 4G4KA 1RTNA 5KRUA 3TN2A 3J7AV 4RCOA 4IUVA 1WTXA 2NWGA 2EY1A 2IWHA 3ITPA 1S4ZA 1STNA 2JSOA 3EROA 3FEWX 1YNJD 4P2CB 1UWMA 1I6HB 2K1BA 1C8CA 1Q90A 2A73B 3MXNA 4XQQA 1NYQA 3AE1B 4GDLB 1LV9A 3K6OA 1JWBD 1E0BA 4ZRPA 2K04A 2KHSA 4DAYA 5J22A 1F0ZA 1FNUA 3LNNA 5NUCA 5A35A 2CQAA 4P6VF 2V0GA 3RD4A 2JEBI 1JR0D 5C44B 3NQTA 1B2TA 2L1BA 3P4QB 4OVZA 1EY7A 2HCCA 1GUTA 3PZ7A 2H4OA 2KUMA 3BS1A 4QIWB 1A6XA 1ACCA 1IGDA 3S1MB 1EZ6A 2EKIA 1PZID 2CHBD 2N88A 2Z4IA 3TZUA 2A68C 2WACA 2IGGA 1NEKB 1TR5A 3OIPA 4NDXA 2F0FA 2ICEC 2G1EA 5CV9A 1M4VA 5E1FA 4FVMA 4GZYC 1RF2D 3MHZA 1NAPA 2BYTA 2NTSA 4OW0A 1NR4A 3HVZA 3SR6A 2HDMA 1XF5L 1C78A 2KN4A 3S17B 2KQ4X 4RF1A 4IZ8A 2JX5A 4KKTA 3NTKA 5JAVA 4G7ZC 4FYDA 4H44C 3AEGB 2PW7A 4A55A 4PNYA 2PKOA 2B2VC 5JOBA 1YN4A 2HQEA 4GDKB 3T3NA 1FFUA 1LTBD 1KDBA 2F0KA 3ZJUA 4US8A 5IGDA 1SAPA 1EYCA 1Q12A 1HEZE 5CC4A 2ONQA 2RDGA 1Q8IA 2EELA 1EWYC 1CA6A 1SYDA 2EJMA 4FP5D 1V97A 1D2BA 2Q8IB 5K36H 5EPKA 2KQ3A 3M7NA 4DK1A 3K59A 1EEID 1QKZA 2VB2X 2JA5B 1Y56A 2QDBA 4BBSB 5KYIA 1AWDA 1C79A 5T8IA 1K50A 1CZGA 4F88A 1F9PA 5KEEA 5M9OA 4AQ7A 3ND8A 1SNPA 4UAIA 4CGYB 2HDEA 4K5XA 4QUFA 1D6EC 2FHTA 4KD3A 1FO4A 4HCSA 3W5UB 5EKIA 1FR3A 3TMEA 1R7SA 3H8HA 4FXKC 4WFN3 1QOFA 1IYVA 2WQYB 3E5SA 1V43A 1WVLA 4K5WA 4A3KB 2V3NA 2RBMA 3J7YW 3GTPB 2Q8TA 3SK8A 3CU7A 3W5VB 5KGUA 1D5XC 1ZPSA 1LTTD 3AE8B 3NVZA 3AEDB 1TKEA 1JOOA 2JXTA 1SYBA 4K6DA 3VR2A 1UGJA 3ND9A 2INPE 4M8AA 5IGBA 3IL8A 1EYAA 4US9A 5CBAE 2KOLA 2F0MA 2F0WA 3FRPB 1HTPA 2E75C 3J81L 3HVDA 1SNQA 5ELFA 3P4RB 4L8JA 2B39A 1A3TA 2KEDA 4RCNA 4HN7A 2A74C 3DWQA 4LLGM 1SBBB 3OOCA 2YEPB 4RA8A 2B2UC 3AEBB 1KNAA 5C4ZA 2ZXPA 2BT6A 5CBEE 3CQZB 2VZKB 5G5HA 5FR3A 1RYJA 4K2KA 4ABNA 4TQ0A 2K5PA 4XDCA 3SFDB 1K83B 4A3GB 3R3OA 4HSVA 1X3PA 3Q0AA 4LK1C 5G3LF 2NTTA 3K5NA 3MC0B 3V2TA 4OIKA 5C3EB 4JBWA 4A3BB 4DAPA 4JPSA 5JPNC 1PTOF 2K5DA 3OW7A 3IT6B 1A2UA 5EE9A 2R3ZA 2WDRB 2L9HA 1WWTA 1QNUA 2NVTB 4DGZA 4WIPA 2Y5PA 3A56A 4H2AA 1I4PA 4MN3A 4TRDA 4HRSA 3BK1A 3L7ZC 3K57A 3I4MB 3QWNA 3HRDD 5JEAH 3IT4B 2ZW1A 1I4HA 1BR9A 3SXHA 4NW2A 2Q5WD 2PZUA 3D4WA 2L32A 2LFIA 1K53A 3VYTA 1ZKOA 2Y0SB 1TS4A 3KLSX 3I57A 4RNAA 4ZKCB 1KTKA 1I50B 2XNAC 1ZDVA 1WCMB 4TSSA 1GOZA 3AMUA 2FBWB 5I2YA 3IKJA 3I4LA 2Q8RE 2IJ0A 3T3OA 3VR4A 1BQQT 1MPEA 2F0PA 3ZYYX 3P63A 4C1NK 1OXSC 4X3SA 1PRTB 1HTLD 1JWMD 3B2FA 2XRQD 1T6BX 3TEZA 1GUNA 2D9UA 5M5XB 4ILWA 3AE7B 5IGCA 2QSDA 2BA0A 1VZ6A 2ZT9C 1OQRA 1ZEQX 1ESRA 3KBGA 4OO1H 3K5MA 5G5GA 5BN5A 2K33A 4IALA 2N55A 4G7OC 1VCIA 1NVID 4DN4M 5C3WA 1G6ZA 3B2GA 5EQ0A 3NVVA 2EJFC 4AS1A 4DF7A 2Z8LA 1A15A 4IN3A 2PQEA 1K8OA 1STAA 1BCPD 1SEBD 1E2ZA 3NXWA 2KCNA 1QOHA 1LACA 5JPMC 1RWSA 2NN6I 3P42A 4YIJA 2EDGA 5BMIA 2I2YA 4Q0FA 3PUVA 1DD2A 2K5QA 1R4PB 1O80A 2AQ2B 5D3DA 3HKZB 2JZPA 2DYMA 4DXGA 4QCLA 4H7BA 1ROEA 3M3YB 4DQOC 2BE5C 1CFMA 4BS9A 1YJJA 1P7EA 2DY8A 2ICIA 3M4OB 2NN6G 1JE4A 4HR7B 2KAJA 1TS5A 4B08A 3R8BA 4DFAA 4OHJA 4J3OD 2BE5D 2KMMA 2D5GA 5EGTA 1O7ZA 4YTMB 1IW7D 2EOTA 2J0TD 2NVYB 1YQ4B 2WP9B 2QIEB 1PFNA 2RMMA 3LX0A 1DGJA 2OEOA 1NYRA 1FFVA 1DM0B 1BDOA 2ACZB 2EYJA 1RD9D 5ELCA 2KEEA 1H9JA 1E10A 3QJYA 1TWGB 3MA2B 1E9MA 1F2ZA 4RGOS 2B2TC 1JOKA 1TZOA 2HCIA 1KF6B 2F0QA 3TP8A 3BYTB 3KWLA 5I2XA 2H88B 3GQBA 1NCVA 1L4DB 5BYQA 2W54A 1PGBA 3SE0A 3SVMA 3FMCA 1ZOYB 3P20A 4OIJA 2JSVX 1KABA 5EKLA 1LTSD 1XEEA 1PGAA 5I4DA 2VUMB 1Z7TA 4PQXA 1PFDA 1TIID 2LMCB 4KKJA 1E7PB 2E2IB 1FGBD 4BY1B 2WXRA 1JQ4A 4U68A 3V3XA 1Y1VB 3AE9B 3URYA 5EE3A 4NKLA 1BOSA 2LY7A 2GRIA 1TT2A 4C3HB 4ZOHC 2B2VA 2IT1A 1ZDXA 1B4OA 3GP7A 3J7AF 2IW3A 3I73A 1SYFA 1EY0A 3Q8CA 1VDZA 1ZXHA 1CK1A 1BUVT 5COYA 1DOIA 1LTRD 3I8ZA 3R93A 4G7HC 3H09A 2N9LA 1ZXTA 2SOBA 3A8KE 2WXQA 3Q8BA 2WXHA 2EYPA 3WOFA 4RGTA 3Q69A 5AUIA 2EYOA 1BUIC 3I90A 1STBA 3L9AX 3RZOB 1TWFB 1KRHA 4LAAA 2MUYA 2OT2A 1OXXK 3P7JA 3RZDB 1FIQA 1PDXA 4KN4C 4TMAB 4FXCA 3Q8EA 1G91A 1KFYB 1QILA 3K7AB 3BK2A 1Y8PB 3U7ZA 2C9OA 3BDCA 1D5MC 4YXDB 4TQUS 3MXGA 3AH7A 2JA8B 1MHHE 1XCQL 3GS2A 3M85A 4AYBB 3S15B 1TKGA 2VB3X 1SXTA 1YN5A 1S5FD 3OMGA 2K0PA 2OHFA 2SAKA 4X3TA 5LHY1 2L52A 1G2TA 3AEFB 2F4IA 4NZLB 1DOXA 2L5TA 4R8IA 5IGGA 2LHEA 2WS3B 1XYIA 3PO0A 4ZAIA 4V190 3N52A 2WXFA 4LTUA 3H91A 1T3QA 3GTJB 2BOSA 4IUUA 3V96A 2KDMA 2F0EA 2E6XA 1MVKA 4REZA 5C0XI 3NWSA 1QNKA 4KMUC 3BWUD 3LWEA 1QCBD 4BWGB 1QOGA 1CT1D 2RA4A 4J1MA 3J80L 2DNCA 2R92B 1LTID 2JXMB 5E6JA 2WXLA 1D4BA 2WDQB 3NZ3A 4EGVA 2F0IA 3GTKB 2BDOA 1TYGB 3VQIA 4KY7A 3AMZA 1I4QA 3PIO3 5CYUA 2B2UA 5C0XG 1ILPA 1HZ5A 2X69A 1D5ZC 5C4XB 1KDAA 1PYWD 2KCCA 3BDLA 1OO9B 3PMFA 4KKUA 2KA7A 5JEAJ 2EY2A 4PMCA 1IBXA 4FF1A 1EY9A 2K03A 3GTLB 3T13A 1DXMA 1MD2D 3PIP3 2BS3B 1V1OA 2F0OA 1I3QB 3FILA 2BW2A 3C1FA 2WNMA 4JX1C 5KYLA 1KLGD 4C2MB 3AE5B 4ZRZA 1CQVA 1FEHA 3AEAB 2LGIA 3D8GA 2SNMA 3KLSA 1R4QB 2K01A 2WXMA 5HURA 4ZHOA 3MFGA 3F2UA 3EUB2 3TEWA 2AUJD 1FNVA 1DOKA 4NP5A 2E3TA 3BYYB 4A3FB 1Q10A 3QG1A 4FXDA 5M5YB 4A6QA 1DZ1A 4WWMA 4PMWA 4V0BA 4PT5A 3KBXA 3I4NB 2X6GA 4HCEA 4A3EB 4R3DA 1S5BD 3R2IA 3UI2A 2L55A 3H94A 1E6EB 1SE4A 1LT6D 1O7YA 3FC4A 1V1PB 1W6JA 2L12A 1ILQA 1F2YA 2I07B 1WYGA 4S3SA 1WTVA 1EM7A 4YWGG 5CR3A 3NVYA 3MXPA 5M3MB 1I4GA 4HMJA 2E2HB 2F0TA 2A6HC 1VDVA 4WQMA 1DOMA 2KECA 5DAUA 1VZ8A 3W3AA 5TSSA 3HOUB 3D4RA 1SSOA 3TSSA 1C4PA 2LUMA 2A6HD 3NS1A 1B9MA 1VMCA 2D2CC 4BY7B 1HA6A 2WXJA 4N9TA 1LT5D 3T53B 2FMMA 3MZ5A 2R61A 4I65A 2QF7A 2EVBA 1AN8A 1L0VB 4F87A 4U673 4NJCA 1DJRD 2SDFA 1YNTE 1XXGA 4ZK9B 5EPLA 4RGNA 4GLSC 3K5LA 2L1AA 3WDNA 1SF0A 3QO2A 1QWYA 4O42A 2L83A 3BVZA 1TWCB 2N9KA 2K6AA 2PVOD 4F7XA 2M2LA 4IKGA 1Z47A 5FK9C 1BCPF 2QEJC 3NBIA 4EQPA 1QF6A 1SJED 3NWTA 3VYRA 3VR9B 5D3IB 1E2VA 2WP8J 3HOZB 1UNSA 3S1NB 4RHSA 1FD6A 1WXQA 2EYMA 2J42A 2VZKD 2MEKA 2MPMA 2WU2B 1DOYA 1VR9A 1LTGD 1EY4A 5C3JB 2XWJB 1SSNA 1U4MA 1Y8OB 5CV6A 1E2WA 1XLOA 3EVQA 3GTMB 4DK0A 5C6AA 1RKNA 3GB1A 1JWUD 2NMQA 3C3LA 4TKOB 4C7YA 4C1NI 5H92C 4OL7A 2XVSA 4HSPA 4CJ2C 2OXPA 4D2KA 1U4LA 1GUOA 3TP7A 3QIAA 3GV3A 5FLXE 3TDQA 1RODA 1XLPA 4CKCA 1SMYD 2ZW0A 3ZJTA 2TSSA 4KY6A 2JA6B 3CRLC 2F0LA 5E4XA 3NPPA 3HG9A 3FPPA 1YMHE 2WAQB 1B53A 1SNDA 1W6KA 3ETRA 3RLFA 2IX1A 1EFID 3ONAB 1WGKA 3BZDB 2ENBA 1FMAD 4QUCA 1TS2A 4A90A 2M56B 2B2TA 4RKLA 2HDLA 1HRJA 1CA5A 2FUG1 1EZ8A 2CJNA 5E4WC 1S5CD 1GB4A 3S9WA 4RKBA 1U9RA 5HI1A 2DYOA 2MGSA 2M9VA 2BS4B