4C56C

X-ray structure of the complex between staphylococcal enterotoxin b, t cell receptor and major histocompatibility complex class ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
227
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Structure of the Superantigen Staphylococcal Enterotoxin B in Complex with Tcr and Peptide-Mhc Demonstrates Absence of Tcr-Peptide Contacts.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 50
structure length 227
sequence length 235
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c56C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4c56C01
1QILA 4BWGB 4UDUC 1KLUD 5ELEA 2NTSA 1FGBD 1LTTD 5D3IB 1I4RA 1HA5A 1T5XD 4RCOA 1PTOF 2XNAC 3V05A 5ELBA 3OWEB 1D6EC 1STEA 4C56C 1EFID 1YN5A 2AQ1B 4ZYSA 1GOZA 1BXTA 3BYYB 1CHQD 1CT1D 2G9HD 1XTCD 1EEID 3GP7A 1ESFA 1HXYD 1KLGD 4DXFA 1S5FD 1SJED 2IPKD 1FD7D 2CHBD 5TSSA 2TSSA 2XRSD 1PRTF 1I4QA 5I4DA 2AQ3B 2AQ2B 2XN9C 2XRQD 4RGOS 1SE4A 4DXGA 3R8BA 3O13A 1EU3A 4L6TB 3EFXD 4K6LA 3R2TA 1SE2A 2Z8LA 5ELFA 1SXTA 1EU4A 1I4GA 1FNVA 3SEBA 1PTOD 1PRTB 1D5ZC 1UNSA 2WV6D 1BCPF 1ENFA 1RCVD 4RH6A 1L0XB 4O1NA 1HQRD 1YN4A 1I4XA 1V1OA 2J4XA 1I4HA 1KTKA 2ICIA 1SJHD 1S5BD 3DWAA 4RHSA 5FK9C 1V1PB 2SEBD 4Z9CB 1ET9A 5FKAC 1S5ED 2R61A 1I4PA 1CK1A 3R2IA 1LTSD 1LO5D 1TY2A 1BCPB 1TS2A 1TY0A 2QEJC 3KLSX 1PRTD 4RFBA 1HTLD 3W2DA 1LT4D 1PTOH 1TS3A 3DWPA 4RGNA 1TS5A 1FNUA 3URYA 2O2LD 1MD2D 1B1ZA 1UUPA 1CHPD 1RF2D 3BYTB 1CQVA 1YN3A 1LTBD 3BVGA 4RGMA 1PTOC 1LT5D 1BCPD 4L63B 1DYQA 1LTGD 1PYWD 1ET6A 1V1PA 1LTRD 1LT6D 1RD9D 5ELDA 1JCKB 1PZKD 1F77A 1JWSD 2NTTA 2RDHA 4RGTA 3TSSA 1LLRD 1AN8A 1B44D 1S5DD 1FNWA 3MFGA 1PRTC 1LTAD 2QILA 1JWMD 1JWUD 1G8ZD 3CHBD 1PZID 3EA6A 1XXGA 1L0YB 1D5MC 1EWCA 2IJ0A 1LTID 1EEFD 3MC0B 4RHRA 1TS4A 1LT3D 1JQYD 1D5XC 1PZJD 3BVZA 4TSSA 2RDGA 1SEBD 1BCPC 4NZLB 1SE3A 3DWQA 5D3DA 1DJRD 1AW7A 1S5CD 5ELCA 3BZDB 1PTOB 1RDPD 1SBBB 1JR0D 1M4VA 3BVMA 4OHJA
chains in the Genus database with same CATH superfamily
1VMCA 2WDQB 2EYOA 2ZM6Q 3EN2A 1EY4A 1Q1BA 3E6ZX 1SE8A 3QOLA 4LF4L 1RM6C 1ZW7A 3ZXRA 2XIWA 1S72A 2PNHA 2M17A 4OO1H 5H8YE 4ZCKA 2Q8RE 5IOIA 4S0RA 4DK3C 1VZ8A 4JI4Q 5D7GA 1TXYA 3OIPA 4B3RL 1WRIA 1BDOA 1S40A 1WFYA 4JCVE 2CU1A 3JVZX 5DPSA 1DOXA 1A15A 1TKYA 3K7AH 2KDIA 1V6EA 3GTGB 5JJLA 1SNPA 1B9MA 4UY8C 2G9HD 4QIWB 2CU3A 2KOXA 1OXUA 1RWSA 4B0MA 1CSQA 4X3KA 3R93A 2MCNB 3U4EG 3GQBA 2NPTA 4DHJB 2A68C 1L5PA 3NVZA 1X65A 3MVVA 1C8CA 4MSMB 3DVNU 5G5HA 1PRTF 4EKUA 3ZDMC 3HK0A 1NENB 3RT3B 4A90A 1STAA 3NZUA 3PO2H 4PZ6A 3L3OC 3SHLA 2B39A 4OONA 3CCMA 2X8XX 2JWUA 4ZRJA 1IXRA 5ELFA 4KY6A 4HEDA 3W3AA 2IO0B 1FEHA 2LJ5A 1LXDA 5DCNA 3RNUA 2EXDA 4HK2A 2LSSA 1E8ZA 3MEHA 3RZOB 2IL8A 3S17H 2EKIA 4JI3L 3JC66 1H9RA 3A5ZB 4RHSA 2K9XA 3HOYH 2MBOA 3DBSA 3DVGY 2WXGA 1V49A 4KKIA 2JSOA 2QF7A 4A3EB 3HM6X 3FPUB 1WTHA 1VLBA 1BVSA 1QUQB 1U0LA 4GKKL 1PFSA 1O7LA 1P7EA 4N6EB 5C1ZA 1C76A 4AOFA 2I5MX 1VQ8A 5EJWA 1FD6A 3TREA 1JE4A 2A6HC 5E4XA 1KL9A 3AFPA 4ANVA 4OX9Q 4DK6C 3WANA 3STBD 3E0JA 1TKEA 1D2BA 2J42A 1YN3A 1L1OA 1H4RA 4CQNA 2SDFA 2V4DA 3EJIA 2GBRA 2MEKA 1NBWA 3ZTDA 3IAS1 4YCUA 1ET6A 1K0RA 2ZXOA 3M9BA 4LF6Q 3N20C 2VB2X 4W9IA 1TIFA 3BK2A 2KFJA 5C4JH 2F0VA 3J7ZC 2BGFA 2N7DA 4KN7C 5HGQA 1WJNA 4NAMA 4D2KA 3CMAA 3V96A 3D4WA 1UE7A 3DBLB 4RGTA 1VMPA 1GXDC 5FJ8H 4HCPB 3K0YA 2QILA 1G6PA 1D8LA 2UWQA 1F2ZA 5L37A 2QHOA 4EE2A 2OT2A 3AFQA 1WD1A 4UP8A 4POGA 2IO2B 5J18A 1VQNA 3NQTA 3NWSA 1OFFA 3AV8A 4B0EA 5E6PA 2N7JA 3SK5A 5C23A 2Z0SA 3TJPA 4FBJB 3ZXVA 3DWGC 3MC0B 2KTRA 2B63H 2HHHL 2JQRB 3VQIA 4FJVB 2LUMA 5IT9c 3CCSA 2JWZA 3PIOA 5EQ0A 4POFA 2N88A 1DONA 3OJ3A 4N9PA 2DUDA 2DY7A 1OGWA 1YQ3B 2ACZB 2LVQA 4PZ8A 2QA4A 3FMCA 4E71A 2KFKA 2QJLA 3HG9A 1IW7C 4P73A 2EJFC 1V5OA 4MTNA 2H4OA 2NS5A 3EFCA 1SIFA 2ZJDA 3Q6SA 1Q46A 4BBRB 5DPRA 4W9FA 3AULA 3GOEA 1WM2A 2QIEB 1EIFA 1XQQA 4GXBA 4PS7A 4TUUA 4IJLA 3L2PA 1E9MA 2R92H 3A7AB 2B2UC 2MJ8A 4YWLA 3KYDD 1RODA 2JY6A 2CHXA 3KUPA 3GTQB 2K0PA 5JJIA 3RNCC 3HOWG 1X32A 3UQAA 4HKQA 4A3FG 3OAWA 3U30A 3I4OA 1PH9A 2AQ2B 1MJEA 3E0EA 2NR2A 5CHVC 1Z6HA 1X55A 4HTHA 2UXDQ 1ZYRD 4L6TB 2ZW0A 3SFEB 4RAUC 2IWHA 2GB1A 4I7ZC 4KLKA 1F52A 4K5VA 1IHZA 1VQMA 1I3QB 2GA4B 4PS3A 1WTPA 4C7YA 1JT8A 2K5DA 4BY7B 4IPGA 3GTJB 1FXAA 1HQRD 1SNCA 4DV6L 3A55A 3GTKH 3KF6B 4GKJL 4GMVA 1KAAA 4EQNA 3N1XC 3U2SC 3ENEA 3DM1A 1PFBA 2EDGA 3NQIA 3FVQA 4CGYB 3R2IA 1FJGQ 2PPBC 1TWHB 2F0NA 5DAUA 2ZM6L 3SXHA 4CBVA 2MBQA 5DNFA 4R4QA 3T13A 2KCMA 3AEBB 1Y1VH 2L1BA 3CAMA 2ZVNA 4ANWA 2JPHA 1Y69U 4BBNC 5AFWA 3ZJYC 1WGGA 2JZPA 4KI0A 1P0RA 3AN1A 1J7BA 2INCC 1WCMB 1HZ6A 1QOGA 3AEFB 1EF5A 3H15A 2B2WC 4XGAB 2LD9A 3OW7A 2KTRB 1Y8NB 1SSNA 1K8OA 2BYVE 2VZAA 3D31A 4P71A 3R7RA 3ZLZA 4KV6A 4ZKBB 1JICA 3A9KB 2W3RA 3PO0A 2NVTH 3QG1A 3N52A 5C3XA 1YIJA 2WXNA 3N32A 4AQYQ 3HS0C 2R7ZH 4HCNB 1U5KA 4IDIA 3L9AX 5CV7A 2CJOA 1O7IA 2KFKB 4LF8L 1DOKA 4NXNL 2OWOA 2EVBA 3KBGA 4GOCA 4UP9A 1WJ6A 2KJXA 3I4LA 4CDFC 1UAPA 3ZTCA 1RIPA 2A1AA 3N6RA 1ZPSA 3EA6A 4X62Q 3APFA 3B2GA 4KY7A 4M01A 5E6NA 2F03A 1K51A 3AEGB 4GDLA 1D5XC 1GJXA 2WKCA 1PGAA 2XWJB 4IPCA 2BE5C 1T0YA 4K7SA 2KVMA 3FP9A 2NVYH 1N60A 5BYQA 1DJRD 4W9EA 1GKHA 1NUCA 4A20A 5C5LA 4C3IB 1CZGA 1QILA 1C7YA 2N49A 4NW2A 3SK4A 3U9OA 2FFKB 1KIXA 1EYAA 4BY1H 3LB8C 5EE0A 1IYFA 3X3NA 4EVOA 3D4DA 2MH7A 4BBNF 1KNEA 2NTSA 3VVWB 1YOVB 2C9WB 2A4ZA 1IPGA 4ITKA 2LUEA 3UQBA 1HA5A 2QW7A 5EAYA 1QOBA 4B9KA 3P2BA 2N9XA 4FP5D 1UEAB 3S1MH 2BVCA 1B3QA 1BBUA 5JH5C 1DCZA 4JGHB 4Q2JA 4A3MB 3VFKA 3T3OA 3TCAA 4LF6L 1C9FA 1YNXA 1VQEA 1DOMA 1WFQA 2HIVA 3J81E 2LGIA 4A3DG 5I6YA 2HQEA 1KDCA 1O80A 1S5FD 2IPKD 3MZ5A 5EKIA 3I57A 2KOLA 5IGFA 3SHQA 2O2VA 2XRSD 2L9HA 1SR3A 2R93H 3IT4B 3ZIMA 1Y1WG 4N9F4 4ZAIA 2DYMA 2XN9C 2L00B 2OEDA 3FKYA 1SE4A 1SFOH 1BMLC 1WGKA 4JX1C 3WOEA 2BF8B 2RDFA 4H2AA 5GXGB 2CR5A 4BXXG 3K9OB 3K58A 4JI6L 1GB4A 3DMUA 4MNOA 4C1NK 1JJCB 3TDQA 2Y3AA 3KJPA 1IL8A 2N0SB 2Z4IA 3RFZB 2SNSA 3ULPA 2I07B 4G50A 3M3JA 3BDOA 2GN5A 4MTKA 2FCSA 3GE3C 4MM3A 3AMUA 5D2MB 2B2VA 1S5BD 5EE9A 4R4CA 1ASZA 2Q2IA 1PHJA 1EY7A 3S1RH 3P42A 3R3MA 4AUQC 3C1EA 4DK1A 2A19A 4FDBA 5C3EB 2KLCA 1H9KA 4IOCA 2RD0A 4XYQA 5C0XH 3KYCD 2F0WA 3LX0A 3DWPA 1TS5A 3HOVH 2K1FA 3SD5A 1CHPD 5IGDA 3PHXB 3ZO5B 3C1FA 3HOUG 2WFWA 4JI2L 1FCCC 4IZ8A 3BVGA 1UGJA 4N59A 5IGGA 4CO7A 3CQZB 2IZVB 4P75A 4DV7Q 1SIJA 1YX6B 3BU2A 4GDLB 4NJCA 4XDCA 4HIOA 4HRSA 5HKHA 3NUCA 4R8IA 2ALYB 3TZDA 3KUCB 2HD3A 1V9PA 1TIID 2RVLA 4C7ZA 1IGCA 3A33B 4TQ0A 1GUGA 1B7YB 1SNOA 4S3SA 1E8XA 2NBWB 2ZEQA 4K0KQ 3VXWA 4A3KH 1RRBA 2CH4A 5LHY1 3PZ7A 1R4MI 3Q2AC 4FHJA 2E2IB 1L1OC 2Y5PA 3K7AB 4KY5A 3P4PB 1KXLA 2MQJA 2K04A 5J3BA 3EGRA 2Z4HA 1EY8A 2NZOA 1LFDA 1VD2A 2K05A 4LUVA 2K5PA 3ABVB 5H92C 1XXGA 1NYQA 1IKMA 1SLJA 1STYA 1WX9A 4LNIA 2WXPA 1AEXA 2X69A 2D11A 3TQYA 2W55A 2ZCBA 3E3XA 1LT3D 3PVLA 3NSWA 3CF5A 3TZUA 3FKIG 5D3DA 3N1ZC 5JJZA 2BTEA 3NPPA 1VF5C 2K25A 1AWDA 3AEAB 2HDLA 5JHAA 4H44C 4OHJA 4JBKA 2JXMB 2E2JB 1EY6A 4IOAA 4IUUA 1M94A 2VQEQ 4LLGM 5CX3A 4EOYA 4US9A 3PUYA 1A70A 3RZOH 2ZJPA 4I6NB 2EJGC 4AS1A 4IO9A 1F2RI 1GJZA 1BBWA 1FGBD 4F87A 1BKBA 4X64Q 2JYEA 3AEVA 1D4BA 4A3EH 2R3ZA 1H8CA 1LACA 1BQQT 1E3PA 3VYTA 2XNAC 3S17B 4FYDA 3ZJVA 2WWZA 2WXKA 3J7AF 1J5EQ 4WURA 1G51A 3Q3FA 1YJJA 1B70B 3JAMc 3E9IA 4DA2A 2UXBQ 2RA4A 2EKEC 2YYZA 1B8AA 1BUVT 4MM3B 5GAGC 5EDSA 4GS3A 4A3JH 1ESFA 3EVQA 3JAMi 1EY9A 3A54A 2C7HA 3DBRB 2MJEA 4AQYL 3RN9C 3A7LA 1F2RC 1STNA 4HJAA 2JK8A 1N62A 2KUMA 3O13A 2LHEA 1A3VA 2KEEA 3EFXD 3VUWA 3GZNB 2Z8LA 1NI3A 1PTOD 3RLFA 1J7CA 3TEYA 1CKOA 3MFYA 3H0GB 2BA0A 2PYKA 1ZKOA 1HCZA 2WXQA 3Q8BA 5E6OA 2L7RA 4B08A 4DR3L 1FM0D 2V9HA 2G3QB 4ICVA 2R61A 3SK8A 3FAHA 1EWYC 1XCQL 1RAXA 3IL8A 1JROA 3GTPB 1HTPA 1ZEQX 1PXUA 2JN4A 2PI2A 4NXMQ 2LASA 3UI3A 3CMMB 4F1SA 5CHWA 1AYFA 2CW0D 3T9LA 3CCRA 3FHWA 1TS3A 4MN3A 2QC8A 4GOPB 1V5TA 3DVNV 1LV9A 3TP7A 3T1HQ 1P7FA 1NYRA 4I6LB 2ICEC 3UE1A 1ZP0B 3PIPA 4IPHA 3LDZE 3BZCA 2FCNA 3U4ZA 2J0KA 3V3XA 1PH7A 4JI7Q 4HDOA 3AE7B 4EGVA 4KGRA 5BMHA 2RMMA 4WWMA 2D0PA 4KD3A 2ZNVB 2FHTA 4DV1L 4P1CC 3DOWA 2F52A 5K36G 2DNFA 4BBRH 3L7ZC 1Q8KA 1DXMA 2A5HA 2MBHA 2JE6I 1A8VA 3ICEA 1AN8A 1KLVA 2DY8A 2NBVB 1YITA 4A3LH 1WJ4A 2DYBA 3GTQH 3GV3A 5CBEE 2JZZA 2R92B 4DAYA 3Q6BA 4RMAA 3D6CA 2EY1A 4C3HG 3Q3MC 4L5QA 2D3GA 2KWCA 3IHPC 4JBJA 4WWPA 1YBYA 5KIXA 4B3RQ 4A93B 1Q12A 2MQHA 1WX8A 2B3GA 2OJRA 2K28A 3KVFB 4C00A 3J81L 1MIUA 4BOZB 4OO1I 3GD7A 5C4XB 2KQSA 1Y8OB 1SNDA 2QKIC 2BS2B 2L32A 2A6EC 2X6GA 5ELCA 2EYJA 1SBBB 4LNNA 5M3MB 1I3QH 1PDQA 2BS4B 2IBIB 5LNK1 1TWFB 4BWGB 4F8CB 3GTJH 2RSOA 2WGSA 3QJYA 3J9CA 4W9JA 4E6IA 3F2BA 3JW0X 4BY7G 3QWZB 1OQQA 4PV1C 4G11A 2CVRA 2MHVA 2AWOA 2HT1A 3VRBB 4HROA 3CRKC 5ELBA 2LMCA 2HUGA 4A55A 4NPSA 2WDTB 2E8GA 4YSXB 1JE5A 3QB3A 4YL8A 2I5HA 2L0CA 3K81C 4HJ5A 1YJ9A 3JSVA 5AZGA 3ZKJC 3TEHB 4JPSA 1JOQA 2N1WA 4X3UA 2PZWA 3CC4A 3I4MB 4F7XA 5M3FB 2UU9Q 1WCMH 1SJED 4P74A 2Q5WD 4ARIA 4NMZA 4HJ9A 2JA5H 4K0KL 2V4LA 3AU4A 4WFN3 3H7SA 4KGSA 3W1GA 2WX0A 5CV9A 3EUB2 2F0MA 3KLSA 4IUVA 4J1MA 5FLMH 2F4VQ 5L95C 1V81A 4CKCA 4IPDA 5EBCA 5J39A 3NBIA 1Q82C 1YJIA 2ZPYA 3PV1A 4DGZA 3QA8A 1XPUA 2HQLA 1QT9A 5DPWA 2J0TD 3A9JA 1EOTA 3QWNA 3P1HA 4KV2A 2LFIA 4X66Q 4DDID 1YNNC 4H0LC 2NVTB 2LS01 1J8IA 2BT6A 2KXJA 2LGYA 4OW0A 1OQRA 1TJEA 4W9HA 1HZAA 4A3BH 1A6XA 2IX1A 4WWNA 4OWWB 1V8CA 2A69D 2REXA 1WTXA 4X65Q 4BKTA 3MEFA 3KF8A 3I56A 2N1VA 2VQEL 1WGRA 2BB6A 2Z0EB 3PF5A 3S14B 3NVYA 3HEJA 2R7DA 4X64L 1MHHE 3W2DA 3MC8A 2WINB 4ZRQA 1K8RB 1N5WA 3BDCA 4C3IH 5C4ZA 1MD2D 1CMXB 3Q23A 1VDZA 2NVYB 4K14A 3KK7A 4NJ6A 2JQOA 2B2VC 1J5EL 1UE6A 1LTBD 2WHIA 4RA8A 1IBMQ 2CJNA 2HTHA 1E2WA 1LT5D 2UXBL 3ZRCA 4B6WA 3X0WA 5C44B 4ZYNA 1KNAA 5BMIA 4KDLB 4XXEA 2KVZA 4DAVA 1V1PA 5HY6A 2FCMA 5H1SE 2PEAA 3RMKC 3UF8A 2PCFB 2E3TA 2M2LA 2XK5B 2KANA 2JA8H 4EQ5A 1T5EA 3UIPB 4A3MH 4PMCA 4BKSD 4IFDH 1B44D 1V97A 1WJUA 1AFPA 1ESRA 4USAA 2RKSA 3A4RA 2D5DA 1GUWA 5KNDA 1CKNB 4KKUA 1GUTA 2A73B 3RD4A 3QARA 4JI5Q 3VTWA 3RCZA 4MT5A 1NE3A 3RD2A 2LMCB 3HZXA 1B3AA 3PF4A 4PMBA 3I4NB 1NSNS 1PYSB 2IJ0A 3H91A 4RHRA 1SROA 5IY0A 1WI0A 2J52A 1PZJD 1K3BC 4R8NA 2VXWA 3DWQA 5IP7H 4XE0A 3U58A 4P2CB 5JEAG 1EIYB 4XWTA 1E90A 3H8HA 2VY3A 3NWTA 2GMIC 2CWAA 3Q3OC 3TS0A 3U50C 2F3IA 1KH0A 1GPXA 3DHHC 4NXML 3AYHB 3E56A 4KN4C 2DENB 4LW1A 3O65B 4J3OD 3CPFA 4R4IA 3AU5A 3NJTA 3I5JC 1EQVA 2KC1A 4DU9A 3T1HL 5C3EH 5I2XA 3OW2A 2IO3B 3S15B 2ZNVC 4AP4C 4K1RB 3HRZC 5D94A 4DBGA 1D6EC 1EY0A 3APCA 1WGDA 1EFID 3I63C 1G6JA 4JI7L 4M8NA 2LGXA 4P16A 2CWPA 4DFAA 1VQOA 4BBSG 2JA6H 2D07B 5IWAL 2KVRA 2NN6H 5A35A 4BKGA 2Q2TA 2PMZB 4GKJQ 1EEID 1WXQA 3E9HA 1EIGA 1KLGD 4Y52H 1ZXIA 2R2QA 1EQRA 2JA7G 3GS2A 2A8VA 5G55A 3CQZH 1C79A 4LWCA 4QAYA 4OWTB 3PZ8A 4WRDA 3VR4A 3DQVA 4IW0A 1WVLA 1ISNA 2YLMA 1AE3A 3TBLD 2CFMA 5DLQE 2Q2HA 2K22A 1T6BX 3D32A 2RHSB 3KLRA 1WM3A 1G291 5EPJA 5C3WA 2KMMA 1VF7A 2L11A 1CA6A 1X56A 1X3GA 3OTOQ 2L0TA 1S3OA 4CDCC 1EO6A 4OO1G 4XYOA 1P8LA 5IYCH 4J6IA 4OXPA 1B9RA 2E2IH 4OZBA 4KHVA 1KTKA 2HJ8A 4A3KB 3RI7C 3A1QA 4DQOC 3W1YA 1V1PB 1I6HB 3PTFC 2VRRB 5FKAC 4JWSC 4XQQA 4GGQA 1XLOA 4WH4A 2KMAA 3TEZA 3Q24A 3LYYA 1GUOA 1TY0A 3ULLA 1GNUA 2F4IA 1PRTD 4ZRIA 4RFBA 4WJWA 2EYHA 4UAIA 3Q8AA 1SMYD 1TZ1A 2B3AA 2FXQA 4RGNA 4H7BA 4R9WA 3VR6A 1QOFA 4LF8Q 2E2JH 5CV6A 3ZNID 4NXNQ 3D6WA 4TQ1A 3MJWA 5M5WB 1XMQQ 3PO2G 2IY5B 2JYTA 3ML9A 2O6VD 3AH7A 4WJ4A 1P98A 2MSED 1CA5A 2VQFQ 2NVQH 2KWUB 1HFNA 2YEPB 5KYLA 1A3TA 2EMTA 4CHKA 2PPHA 4MGIE 4Q0FA 5IT9E 1HEZE 2UU9L 2KKCA 3AMZA 4GLSC 5LL6X 3RUIB 2QSDA 3MA2B 3U7ZA 4FF1A 3VDZA 4WQOB 2EYFA 3NENA 4EZLA 1F77A 3DUZA 1YEZA 2EYLA 3FDTA 3PUXA 2I1JA 2JF5A 1DGSA 1BO0A 1TU2B 1NR4A 1W6JA 3TSSA 1EFWA 1VQLA 2E5LQ 2F4VL 3EC8A 3IXSA 2GBMA 1MGSA 3HOZB 4MJSB 3SU8X 1TWGH 1JWMD 3CSFA 1HHVA 3ZJTA 2F0IA 2MO1A 2F3VA 3PCOB 1CTMA 2B29A 1PDXA 2Y5CA 3L0WB 1F2MA 3CHBD 4N8FA 4X66L 3G4SA 2VUMB 4A3JB 4HEA1 4CJ0B 3PGEA 1CFMA 3V6EB 1D5MC 4K8JA 3BVZA 4A3PA 1ICWA 1F9RA 3CSTA 3KF6A 2D5GA 4X65L 2DWQA 2A68D 3JYUA 1XMOL 1XCTL 4LUZA 3VA5A 3WALA 1QVFA 1SYGA 1R4QB 2PQEA 3MHBA 5HG2A 2VB3X 4UDUC 3T16A 3H0GH 2ASBA 2RSUA 2SAKA 2K8CA 4AJYB 2LXJA 4HCEA 4K81A 2PVGC 4A6QA 3VR5A 3BY4B 1WTQA 2CCZA 2KHWB 4OWXB 3PIO3 2AEHA 3A0JA 3PO3B 1VR9A 3HIZA 2ZJRA 3GTPH 5FJ8G 4JI6Q 4G57A 5CR3A 5A2QE 3AE5B 3ERSX 1A5RA 4YWKA 1P9DU 2GBKA 2F0EA 1IBML 3B2FA 1JQ4A 3TP5A 3DM3A 2AYOB 4CKBA 1VQHA 1GOZA 4RMFA 3PSEB 3T53B 2ZXPA 5C3JB 3L08A 4DUZQ 4NY0A 4HN7A 1DGJA 4FN2A 4LNKA 3A1QB 2ASQA 2WXOA 3A9KA 1IYUA 2B63G 1FD7D 3DBHB 4W9LA 3VRAB 3ZGZA 3S2DB 2KX0A 5BN5A 2GI9A 1AH9A 1DOYA 1JJ2A 3R8BA 2A6HD 3H9DA 4RKLA 3W1BA 1CSPA 2K7VA 4CKEA 1EU3A 4FJYA 4JI5L 4A9AA 4AQ7A 1R9TB 1OXVA 4HR7B 2Y0SB 3ETRA 3SEBA 1Q10A 4GB9A 2M19A 4I7AA 4C3JH 1D5ZC 5GQOA 5C0XI 3QCAA 3VUXA 2C7MB 1WXAA 4JC0A 4JPBW 4RH6A 4JI2Q 1BNZA 4DR7Q 1A63A 1E8YA 2LGSA 3HRDD 5EE1A 2K03A 1N5XA 2N7EA 3BIID 3NG0A 1CZWA 3W5UB 5C6AA 1UF0A 1LTSD 2R92G 2L4NA 4A93H 2H89B 4J15A 2W3SA 1XO3A 1BCPB 1KJTA 2DAJA 4MACA 5C4XH 5TR5A 1TBEA 4V0BA 2PO4A 4KZ0A 2FIFA 3DPDA 4LAAA 4YWGG 5JAVA 1QZEA 4XC2A 4YY3Q 2FNJB 5M3MH 4LJOB 1FNUA 1WYWB 4P7IA 1TWFH 2LXCA 5KNBA 3C2PA 1B1ZA 1KABA 2M0AA 2L0FA 3BG3A 2G4SA 2LY7A 3RULA 2K75A 3A8KE 2I2YA 5EPKA 4XT1B 2D0OA 1ZXHA 2N4FA 3NEMA 4L63B 3G6JB 3C0RB 1SYEA 3PRMB 2EY6A 3KOJA 4A3CH 3NTIA 4A3IH 3FEWX 3CF6E 2V3NA 4WJOA 3P75A 1GG3A 3P4RB 2D9UA 4IUMB 1C3TA 3J7AV 2V4IB 5JEAJ 1PH4A 3MHSD 1IW7D 1LLRD 1PGXA 1KD1C 5E6JA 4DV0L 4X57B 1SSOA 3PMFA 3X3MA 3H3VH 3I4MH 2PQAA 1FR3A 1MFWA 4N58A 5M3FH 1LM8B 2BWES 1Y1VG 2WACA 2HD5B 2K3UA 2NUCA 3J80E 4JK1C 1JMLA 3OTOL 4E3CA 1XLNA 1TTNA 1PZID 5M9OA 1WGYA 4XQNA 1E1OA 1VQPA 4KK7A 3RMHA 2I0QA 2N9KA 4RKBA 1LTID 3AE2B 4ODGA 4QUCA 3VYRA 5IGEA 2VS1A 2JA5B 2ZTDA 1PMRA 4IUQA 5IAAC 1LABA 3K8AA 5FLXE 2KDFB 2KEDA 2LRUA 4GN1A 1PTOB 1F0ZA 1GHJA 4ZUIA 2SOBA 2ONQA 2JEAI 2X38A 2J7ZA 2L12A 4AH6A 4PMWA 3L4PA 3W9CB 1LQBA 4J6HA 2K8BA 1TT5B 4N8X1 1KLUD 4LMQD 3TMEA 3RNFC 2EOTA 2K52A 2I38A 4BS9A 4FHKA 1UBQA 2F0FA 1TYGB 5HFYA 1U4AA 2R7ZG 4A3BB 1Y8PB 3AU7A 1XMQL 1BF4A 1PUTA 5JPNC 1P3QU 3P7JA 3S14H 3OJ4B 5DEHA 4IQZA 1ACCA 4BVUC 3B08A 3QIJA 2MBBB 3QC8B 5G3LF 2WYQA 1IKLA 2VQFL 2PZTA 5K5PA 4L5SA 4MHEA 2LGDA 1K52A 2R6GA 4QY7A 2KAJA 5AUKA 3K5NA 4G3XB 3DBLI 1QE6A 4L8JA 4DR3Q 1Z5SB 2OJWA 5C44H 2W82A 2E5LL 2IY1B 2LZ6A 1K8MA 3SDLC 2XRQD 1TGZB 2FMMA 3D3RA 3VA7A 1EYDA 4HJ8A 2PVOD 4R4OA 4BY1G 5IYDH 4K6LA 2INDC 3LJ3A 2NMQA 3WAMA 5LXIB 3PV0A 1QZGA 5HGTA 2WB1G 2NB0A 2M00A 1CJEA 4K7WA 2AWNA 5IT9L 1PH2A 2JA8B 2ID0A 4CJ2C 2J4XA 1XT9B 1VQCA 2ON8A 1MSGA 2GBNA 3A56A 2PI2E 4U68A 3GTOH 1RYJA 1LTLA 4DV1Q 2FE8A 4IM2A 4HMIA 1SB3C 2VZKD 3I4NH 1T0QC 3OIQA 2Q8IB 3QOJA 3TS2A 2F0JA 5M5XH 2DGYA 1H9MA 4HMJA 1D3ZA 2ZTEA 2BDOA 1H9SB 4DV3Q 2PIAA 3M3YB 2PQAB 2D2QA 1SNQA 1ASYA 1YHAA 3PUVA 4IURA 5M5YH 2R93G 2MHJA 3BK1A 2IYDB 1MKHA 3BINA 4QUFA 5AUIA 3AE1B 5C4HA 2WDRB 1WOCA 4RGMA 2GBJA 4HCSA 2BE5D 1VQKA 3AE6B 3ITPA 4ARCA 1LTGD 4DUZL 5FO7B 1PA6A 1L0VB 2MJ3A 2TMPA 2BQQA 1Y14B 2IHFA 3QO2A 3S15H 1ILQA 2F0DA 3M7NA 1YQ4B 3I91A 4A75A 3CWIA 4LDTD 2OQ0A 5GADC 4DUYQ 3NHEB 3ZRFA 3DHQA 3VR3A 3WWVA 1VQ4A 1EIHA 4A3GB 1XNQQ 3TIXA 1WYDA 2M0XA 5G2NA 1Q81C 1LTAD 1QLBB 1E7UA 4NAWB 3UGBB 2JA9A 5GMVA 2RSNA 3T51B 5A2QL 5C0XG 3KJOA 2E74C 1YHBA 2Z6KA 2JA6B 4GZYC 1V80A 3P4QB 1IZ6A 4XDXA 1XF5L 2M56B 1L0YB 3HOVG 4LCDE 1SYFA 4DF7A 4DPGA 4DR7L 4JWUC 1HTQA 2WB1E 4M02A 1TWCB 1CUKA 2BYEA 1BCPC 2DJFC 1IGDA 4ANUA 1F9SA 2Z6BA 1GD7A 4XZ4A 1M4VA 3DXJC 4A76A 3NZ3A 1D1IA 1Y56A 1OXXK 1J0GA 3RN2A 1R4NB 1XJVA 4R1JA 1ICFB 1MJCA 1WTOA 5KGUA 2L5TA 3SR1A 1I6HH 4YY3L 2D3BA 1I4RA 4GOPA 2JJQA 4B3SL 2V0GA 4A3KG 2UUCQ 4IG7B 5CHFA 2BBCA 4WJPA 4I65A 1EZ6A 5FO8B 3HVDA 4JG2A 1STEA 4EUTA 3N30A 4DV4Q 1XLPA 1C9OA 3KUDB 4A3OA 1FXTB 1WY8A 2KCNA 4PYZA 1ILPA 1UZXB 4LK1C 3U52E 1CHQD 3CRLC 3J81c 3T4AC 5M5WH 1L6UA 1YNTE 5IP9H 3HOXH 2F0GA 4NPNA 1JOKA 1UWMA 3RUZA 2XBBC 2FIDA 4DK5A 1MI0A 1EF1A 2DLBA 3NTHA 2DZMA 5LMUQ 1QG7A 2F0UA 1R4PB 3NS1A 3J81i 4JE3B 1U4PA 1YNJC 3MWYW 1FRDA 1QOAA 4Q5VA 1JORA 4PS8A 5I6WA 3WDNA 1E24A 2AQ3B 2ZCCA 3SFDB 1M1KC 3PHWB 4DAMA 1JMCA 2DNEA 1YD8U 1KM7A 2NVQB 4GIVA 3LXFA 1GO3E 1OEYJ 1PH6A 1YJNA 1FNVA 1JWAD 2K6AA 4PK1A 1G91A 2PMZE 1BCPF 4XX5A 3OPOA 3HOZH 4A3EG 3KYHC 1C48A 1RCVD 2MP1A 5CYUA 3SDZA 4B9WA 1J7AA 1I4XA 2K5QA 1D1KA 1YN4A 3GB1A 4RM9A 3QR8A 3HOVB 3DWAA 2C5LC 3V61A 1RJTA 1V2YA 1CKMA 1I5FA 1WRDB 2H88B 1U4LA 2KCTA 2VUMH 4IWQA 3KWLA 5AEKB 1S5ED 1TWGB 2KJRA 4KKJA 3KQ4A 2JEBI 1STBA 1JC7A 1LO5D 1GUAB 3KDFB 4DWFA 2DJGC 1N36Q 4A3JG 2JXTA 4HAEA 5DM73 2B8GA 5KNCA 4LF7L 2LXAA 1A3UA 2KACA 2KMCA 4XT3B 3RN5A 2Z1CA 4EX5A 3J80L 4H13C 4JI1L 4HJKA 2BYFA 1JOOA 5MPOA 1E2VA 3M62B 3A8JE 5IGBA 1XTDA 2VH1A 4K3BA 3BYTB 3VDYA 3C3LA 2L8JA 3OMCA 4QIWE 4IFDI 3ZDTA 5FLXL 4TRDA 4DV5Q 5CMDA 2MX2A 2G45B 3L16A 1JRPA 3PO3H 2KC2A 3N1YC 1CI3M 1WXMA 5I2YA 2D2CC 1PZKD 2LVPA 3H7PB 2WAQB 1IBLQ 2MUYA 2PW5A 5D14A 4HIKA 1S5DD 4GN4B 4TVAB 3Q8EA 1V1QA 1HR0L 5FR6A 3AQQA 2JT4B 5CORA 5F2DA 3S2DH 1RL2A 5E1FA 1R7SA 1PQSA 1HZBA 4G7HC 2LVOA 3M63B 4HJ7A 4NJ7A 4B9XA 1A2TA 2CKZB 1GB1A 4BOSC 2PE9A 2LXKA 2KN4A 1R9TH 3BWUD 3F2DA 5IWAQ 2Z9HA 2XEWA 1F9PA 4FJZA 2C60A 1X3QA 2WXJA 4JQWC 2PE6B 1X3FA 3S1NH 4BBRG 3APDA 5ELEA 2Y5BB 4C3JB 4DV3L 4YT0B 2G1EA 1VQ5A 3G6EA 1L0WA 1JJGA 2SNMA 2YU9H 4FXCA 3W1SA 2WXIA 4HJGE 2NCNA 3NUHB 5IKCM 1GC6A 3DLLA 3B6YA 4A3LG 1F2LA 4C56C 3B1LX 1PV4A 1HPCA 2LWPA 1BXTA 4GLAC 1K8GA 2K5NA 3WOFA 4MEMA 3D8GA 2EY2A 2WU5B 1CM9A 1R4NI 5JVG3 2FUHB 1I94Q 5J17A 3GP7A 1HNWQ 1HXYD 4G4KA 4DXFA 4DK0A 4MGZE 4RNAA 4DUYL 2KWVB 2TSSA 1E6EB 2MBEA 1EOVA 2XK5A 1I4QA 2R7FA 1XNQL 2WKDA 3QX1A 1MVKA 3IFTA 4RGOS 2QDBA 3NVWA 1UE5A 3ZVVA 3UI2A 2NVXH 1N9WA 2O5IC 3HOWB 2RPQA 1WTRA 1CKNA 3V6CB 4A3FB 1SE2A 1KAWA 1LYLA 4A3IB 4DHZB 3I72A 1ZDXA 1TR5A 3VR2A 2LKVA 2D62A 2AUKA 3HKZB 2L76A 5ELNA 1X1MA 1L2NA 1V1OA 2E76C 2I1KA 3RLNA 5IOCA 4W9CA 1VRAB 2KTFA 1NDDA 3ND8A 2KQ4X 4KJOA 3EROA 4IOIE 3G71A 1CK1A 1E0BA 1Q5WB 2WQYB 2OOBB 1IP9A 3HVZA 2CQOA 2AMCB 1TS2A 3GTMH 3MP9A 2Q2UA 4LFAQ 2L83A 4CDEC 4ME3A 4NB3A 1WCMG 1PTOH 1QZHA 1HUNA 3VR8B 2BH8A 3MJ5A 2UUCL 2JSVX 2FJ2A 2KWDA 1E10A 1O7ZA 5FLMG 3ZNHB 4M8AA 4DV4L 3ZNZB 1I50B 2EYPA 5C0XJ 4C80A 3M4QA 3NXWA 1EQTA 1BT0A 2N8NA 2A6ED 1PYWD 4FF3A 1RTOA 3ZJUA 3DBRI 4LK0M 4Y7NH 4ZHOA 1SYBA 2F3WA 3HM3A 1FMAD 1FL0A 4A3BG 4YIJA 5LMUL 1XMOQ 4K2LA 2KK8A 3E9SA 3L10B 2ES2A 3A74A 3BJUA 4WJ3M 1VQ6A 2JRHA 1J8CA 1FNWA 1Q90A 1O7YA 3GZNI 1EWIA 3AB9A 4APVA 1UEBA 4DN4M 3CCUA 2LHDA 4HPMB 2D3AA 1G8ZD 5BYSA 5HI1A 2C7NB 5IN7A 2RR9A 1YX5B 4EQOA 3IAYA 4DR5L 2JU6X 3AI5A 1NI2A 4C3IG 4HPLB 1OTCA 1EEFD 5CV4A 1HH2P 2EELA 2BCOA 3DEOA 4JYAQ 4C1NI 2QCZA 4JBMA 1F9JA 1N36L 2HDEA 1N8RC 1WMHB 2Z6KC 3GTLB 1NVID 2UUAL 3ZYYX 4US8A 1FCLA 1T0RC 5T8IA 1BBXC 1J9OA 2M9VA 1E2ZA 2YTVA 2JA8G 4A3MG 4RCOA 4C2MB 3OOCA 4IFDG 1YNND 5IA7A 3HFZB 3GTOB 3AEDB 2G4DB 4ME5A 1YN5A 2AQ1B 2OQKA 4DV5L 3VH4B 3M3YH 3K5OA 1D7QA 4LFCL 4DXAB 3IFWB 5M5XB 1WYGA 1UD7A 5CGKA 3F8TA 4GN3B 1IBLL 1MG4A 2NBUA 4GOPC 2PKOA 5M5YB 2M8SA 2RPVA 2B2YA 5IP7G 1TQOA 2HTME 2K6QA 3IAM1 5C5MA 4IWOA 4MJSA 2DZJA 3RNAC 2EZVA 4II3B 3ALBA 4KJNA 3HGBA 5KEEA 3HP3A 4KTAA 4N9TA 2L1AA 1SXTA 3GO5A 4K5XA 1G2SA 2RBMA 3MC9A 4A3GH 1WZ0A 2IDYA 1UNSA 2B76B 4BA1I 5C3EG 4JOIA 1CQFA 4FNFA 1ZUD2 2F0QA 5EKLA 1OQYA 2JXXA 2ICIA 2MPMA 2RHQB 1EQQA 2DZKA 2SEBD 4CHTB 3PZDA 3LWEA 1SAPA 4KVGB 4ACFA 2ZT9C 3Q0AA 3M4YA 1S4ZA 5IYBG 4JI0L 1TY2A 2NN6G 1N34Q 2KDBA 2N9LA 3RZWC 1TWCH 2EQSA 1LM0A 1VQ9A 3L0OA 3I8ZA 1K0SA 2J7QB 3AB5A 4PT5A 4W9DA 2JRIB 2K33A 4YWMA 4DV0Q 4ICUA 4W9GA 1K83B 4GNXA 1FGUA 5BN3A 1RF2D 5JVH3 1JWBD 1G6ZA 2K6DB 5GAEC 3FILB 3UDFA 3H1UA 3VTUA 3KH0A 3MXNB 2CS4A 3D0FA 1VQDA 4KKTA 2DYOA 1DYQA 5LMNL 2I46A 4YTPB 2IGGA 4REZA 1HNZL 1I94L 4FF2A 1NBFC 1OTRB 1HNWL 5IYCG 1UWXA 4KHPL 5J2RA 1JCKB 3ULJA 1Q7YC 3VUYA 1JWSD 1A0IA 1WTVA 4IJHA 4CDDC 1C4CA 4EEWA 4AYBB 5E7NA 4U673 3MFGA 2E6XA 5CTRC 3KUZA 4IWPA 1MHXA 2KHJA 1Q1OA 1EWHA 2R2OA 4P1BC 5D65A 2J53A 2JVCA 3ONSA 4AJWA 3NE5B 3RZDH 3UDGA 1UH6A 2AL3A 3W5OA 3GDEA 3BS1A 3HOXB 4JL9A 2WNMA 3STBC 3H3VC 1UWVA 4JI8L 1N61A 4DR2Q 1JQYD 2DHZA 1XWEA 3BDLA 1Q8IA 1FIQA 3HUIA 2KD0A 1SE3A 2G9DA 5CBAE 5JPMC 2Z59B 4YXDB 4JV5Q 3M85A 5I4DA 1P16A 4QGUA 1ZE3D 1UBIA 5C2TB 4LFAL 3FKIB 3WIMA 1RFKA 4MGKE 2KZRA 2XTIA 5D3IB 4NQLB 1QB5D 2VZKB 1HQMC 4IC7B 5JXVA 4ZDVA 3ZW3A 1FVIA 4O0AA 3V05A 4DNRB 4QQBX 4OVUA 5JZEB 2E2HB 5T1GA 1KDAA 4ZYSA 4G7ZC 1WTWA 3I55A 4HLEA 3AXCA 4QF4A 1JB7A 3H94A 3T8MA 3DWMA 3R66C 3ND9A 4A4IA 4FA6A 4DR6Q 5I9OA 1KQSA 3M7GA 2CHBD 1EUVB 1PH3A 3K6OA 3UDXA 5FO9B 3T3NA 3W1SC 4C4VA 1GUSA 3MTNB 1FRRA 2NYZD 4GDKB 4KIKB 2O5JC 4XYCA 3L13A 4DDGD 2BB5A 2MP2A 2KECA 2BA1A 4LDTB 1YIWA 2PMVA 2YV5A 3H0GG 4TKOB 3T56B 5LXHA 4GNXB 3I9V1 1C77A 3C46A 3NBHB 3TBIB 1I4GA 3H6MA 1ML0D 1WXVA 1F2YA 3QJZA 2WAQG 3U8ZA 1L0XB 2KA7A 1OXTA 4ZUJA 4L1BA 1I4HA 2CH4W 2KJ6A 2KX3A 4JYAL 1SF0A 2RDBC 4MELA 3BZKA 2IX3A 3WAOA 5IIFA 4GSWA 1YI2A 1XNRQ 3RPFC 1XLQA 1S3SG 2MO0A 3ECIA 5IE8A 2MJDA 3OMGA 2MGSA 2KLGA 3I7FA 1LGRA 3KLSX 1B2TA 4EZJA 2CHWA 1SNMA 3PRPB 1AP0A 3DDCB 1RHPA 5AZFA 3K80C 1WGHA 2WXHA 3PS6A 3V60A 1QNUA 3G7LA 1NJIC 2IX0A 2QDFA 1STGA 1N6ZA 3TN2A 1I6VC 4P6VF 4KX6B 4MZ9A 1ZYRC 5KYIA 1ROEA 3EFUA 1KDBA 1DOLA 3NS8A 3RNBC 2FMCA 2MNAA 3I3TB 4R4TA 1SN8A 2EE1A 5COYA 1WR6E 4TMAB 1BUIC 2KCCA 4O42A 2H1EA 1J6QA 3S1NB 2EJMA 3AECB 2BKFA 4C3JG 2OEOA 1AZQA 4KZCA 2NPTB 2ENBA 1N33L 1MI2A 4IM0A 3KLWA 4LNQA 2DBYA 2YU9B 2LEKA 3Q8FA 2JZ3B 4YTNB 2RDHA 4URKA 2VW9A 4YSZB 4XWWA 1HR0W 3Q3JA 4A93G 5BN4A 1PLFA 2EXZA 2RF4A 3DEPA 4KMUC 5C4XG 3U9SA 4HIMA 4B3SQ 3KW5B 1WD0A 4JBWA 3VYUA 5GAHC 1IYVA 2KO3A 2EY5A 4I6PA 3CPWA 5M3MG 1V8QA 4IFDJ 3IG3A 3HOWH 4TSSA 3TL5A 4L5TA 3IFDA 2WAQE 4GN5A 3I70A 1SEBD 1QWYA 4A3FH 2IGHA 2K1BA 4C3HB 3P1MA 1AW7A 3F1ZA 2F0SA 1RDPD 2NVXB 3S9WA 2WDVB 1ENAA 1N34L 1EY5A 3CKIB 4A3CG 4C4VB 1VCIA 4A3IG 1YJ1A 5FOBB 1RTNA 2BDNA 2FINB 2MW5A 1C4AA 1LTTD 2QGQA 3HKZG 2UXCQ 1H9SA 2KENA 2MP2B 4KSLC 2WXLA 3X23A 1MHWC 3E5SA 3SGIA 2HCCA 1VQFA 1VQGA 1H9JA 1PFMA 1V43A 1JRUA 5EGTA 1L1OB 5T1IA 1T3QA 3I4MG 5AZHA 1YZ6A 3H09A 3S2HB 5M3FG 1V9JA 2K8HA 2NVUI 5LL6S 1IBXA 4DR1Q 1S1QB 2KNBA 3GTMB 4J8QA 3BYYB 1TKGA 2M4NA 1UGMA 1XTCD 3AE9B 2CHZA 4ZHPA 2UUBQ 1N63A 3NOBA 2PTLA 3NP8A 2PLPA 3FC4A 5HURA 2D10A 1I50H 1IL2A 1PVOA 3P4SB 4PG3A 3J7A5 4DR4Q 4UPAA 1YMHE 2HIXA 4LF7Q 3Q14C 1HRJA 1K73C 1YHQA 1VZ6A 4NAWA 3IRBA 4JI4L 2A74C 1N32Q 2ZZPB 4JI1Q 4TV3A 4ILWA 2NZHA 1R4MB 3PLVA 1QCBD 1PH5A 4Y7NB 1EU4A 4UHVA 2V3SA 3ZQ4A 3TRZA 4TKNA 4M1UB 2YVCA 1IYJB 2BW2A 4DR2L 1ENFA 3HKSA 5G3LD 3I2ZA 4OVZA 3ZNGC 4NP5A 1VDVA 2B2YC 3LGJA 4JV5L 1F1HA 5FK9C 4RWSC 2B2TA 4LFBQ 3UE0A 3EHVA 2BS3B 4WORA 2JX5A 4IKGA 4ABNA 3S1QB 2GOWA 1DOIA 1T0SC 4FO2A 3HHMA 1WWTA 1KC8C 2N9EB 1FFUA 5BO4B 3R7QA 4DHZE 4RM8A 5J22A 1ZKHA 3CIRB 3URYA 2MFIA 2O2LD 3HKZE 4JW0A 5C44G 3F2CA 4GLXA 4JOIC 1HR0Q 4CJ1B 2Z0DB 3A4SC 2RQXA 1VZ7A 3C19A 4M0WA 2WP8J 3CCJA 3GTLH 1EYCA 4DHJD 5IYDG 4HKZE 3NHHA 4QB4A 5CV8A 2OF1A 3S16B 3P63A 3C8YA 4M00A 1GUNA 1I42A 4GLVB 4C2MH 3DBHI 3PGZA 1RKNA 2IW3A 2NZ1D 4H02A 4K2KA 5CV5A 1GM5A 4DR6L 2RGFA 4HSPA 3DCGA 4HDQA 4KGTA 4XDDA 3UIOB 4EZKA 4OEMB 1FYCA 3M4OB 3AE3B 2XGTA 1EM7A 4UP7A 2NTTA 5D6JB 3CXCA 4GNXC 2C5CA 5ISRA 2LJIA 1EZ8A 2VL6A 2YEPF 3CCVA 3I4NG 4WWOA 5JOBA 2Q8TA 3VHTC 4OX9L 3J80c 3OYYA 1QVGA 3SVMA 4GU2A 3UDIA 5JJKA 4X6AH 1L4ZB 4KHZA 1E22A 4BKSA 3K9PB 3U7DA 2WLBA 4OZAA 1FFVA 3WAPA 1RFAA 4A3DH 3J80i 1PH8A 1FO4A 1GAQB 1IBXB 5FLXc 3MTSA 3Q22A 1V86A 4HVBA 4ALPA 3RZFA 1Y1WH 3IBEA 1I35A 5EPLA 1XNRL 1TWAB 4X3TA 1JR0D 2E75C 3CC2A 5DPTA 4ZQ3A 3VAWA 2WS3B 2PW7A 4LF5Q 4DNTB 3W5VB 4E74A 4BXXH 3KDFA 1DZ1A 3D4RA 4XQJA 4LF9Q 3TP6A 4RF0A 1T9HA 1TKWB 3VTVA 1K3RA 1XX8A 2IO1B 4WAFA 1NMGA 2AL6A 3ML8A 1T5XD 2EPBA 2KT7A 1NEKB 3K5MA 2KDMA 1NCVA 2BPSA 2G5DA 3A5UA 1NNXA 3TEWA 4PYUA 3DVGX 1U4RA 1WJJA 4QL5A 1UE1A 3JAME 4HIDA 1K83H 1NMFA 3U4VA 3ONAB 4MDKE 2UYZB 3OWFA 4IUPA 5BMGA 1VQIA 2OXPA 4IUNA 1VQ7A 3IVFA 1NAPA 2IY0B 3H7PA 2XSCA 4K7UA 2VNUD 1A62A 4BBSB 2KBNA 3QHTA 4YHHQ 1GVPA 3OLMD 4HXDA 4MSQB 4HPPA 1PFNA 3HOUH 5AJ3Q 3VR9B 4DV2Q 2JA7B 3SE0A 4HWIB 4KKSA 1JW9D 3Q8DA 3R2TA 5KRUA 1GHKA 4RG1A 4M0WB 1CZPA 4W9KA 5IGCA 2WV6D 4OL7A 2K39A 4JIOU 2NWGA 4FVMA 4O1NA 1K8AC 4PNYA 4AYBG 3NTKA 4ZRZA 5BR8Q 1AZPA 1C0AA 5EE3A 1IBKQ 2FCQA 1I4PA 1SYDA 1EL0A 3T1YQ 3AM9A 3GTGH 2QEXA 1O78A 2QEJC 3RZDB 3N3KB 5IP9G 3HOXG 5BYRA 2UU7A 4QMGA 2QCPX 2OHFA 2UXCL 2UXDL 2GVBA 3EIVA 2JUOA 3Q8CA 1F9QA 1SGHA 1WIAA 4F7ZA 4F88A 1XYIA 1BR9A 3FKIH 2K4KA 2N9PC 1H95A 5J1ZA 3CD6A 4DR1L 4BAXA 1PTOC 1BCPD 3EBEA 4YCWA 4ZLTF 4DR5Q 5LMNW 1KHIA 3FRPB 3G48A 1YJWA 2X6LA 5DM63 3PO2B 2UUBL 3IT6B 4ZOHC 2A5UA 2XVSA 3A8IE 4FF4A 1FJGL 3HOZG 4B3TQ 2L3ZA 1RD9D 4OGQC 2E2HH 2O6VA 3QK0A 5IP4D 1X3PA 2O2VB 1II3A 1NR2A 3CU7A 1C1YB 4DR4L 2FAZA 2VUMG 4B95A 2INPE 4G0NB 1FPYA 2UUAQ 1N32L 2CW0C 4FADA 2WXRA 3AEEB 4MIUA 3TP8A 5CC4A 1L4DB 3PUWA 4B3MQ 3B9JA 1QVCA 2PZUA 2RCFA 3HOYB 5KHOA 1B9NA 2IGDA 1OEYA 2N78A 1WZ3A 3TEXA 4LNFA 4LUOA 1E8WA 2L55A 3WA0A 4K8IA 1Q3LA 1TS4A 4WJQA 2BWFA 2KHSA 2L15A 4CYEA 2RDGA 4NDXA 2IT1A 4NZLB 4RF1A 4LFCQ 1MPEA 3BZDB 2LI5A 4LFBL 1VQAA 4AYBE 4XIGS 2BH2A 4JLCA 4EQPA 2F0PA 1KRHA 1YNJD 1Q1EA 3KFUA 2JP1A 3PIP3 2ZW1A 3PO3G 1E0ZA 3FPPA 4DNIA 4K6DA 2PNRC 3KWVA 4K3CA 4ASWC 1GC7A 2AUJD 1HNXQ 1W3SA 1WE7A 4WAAA 2KHIA 5IO9A 1LUZA 4OIJA 4ZK9B 4X62L 1PTOF 1SMXA 3V2TA 5C4JB 3GE8C 3CCEA 1HE8A 4OELB 1B4OA 1K28A 2K5HA 4TQUS 2O4XA 3NVVA 4KSKC 1E5WA 3QAQA 4FXGC 4MH8A 1WH3A 2XWBB 2K32A 3R3OA 1XPOA 2V1CC 5E4WC 4PZ7A 2ATWA 2K5VA 4QJFA 4HSVA 5TSSA 2F0TA 4G7OC 2MA9B 3TMPB 1KRTA 3ER0A 3GV6A 3PSIA 1M8AA 1TVXA 4JI0Q 1L7YA 2Y0SG 1Q86C 1HUMA 1UELA 2ZJQA 2FUG1 4S17A 4DXGA 3PUZA 5E3FA 2B63B 2NN6I 3CC7A 1QKZA 3M4PA 4ZKCB 1IUEA 4M8MA 2MWSB 4MH0E 1PRTB 2JYOA 2L52A 5IODA 5K36H 3L54A 5KHQA 4WQMA 1JB3A 1K53A 2BKRB 3J7YW 1KFYB 2QDLA 4KD4A 4ZRKA 1SJHD 3LNNA 3K57A 5LMNQ 1KF6B 4O2DA 3RLOA 4Z9CB 1X54A 2K5WA 1HNZQ 1WI5A 2O6VB 2J0JA 4KHPQ 4LF5L 4JVZA 3V62A 4LF9L 3OSOA 4V190 1MG8A 2M1MA 4LF4Q 1WMHA 2MRPA 4C3HH 1EUJA 4DAPA 1B50A 2E2DC 4YCVA 1I7HA 5L83A 3NELA 1ONLA 2OTJA 1C78A 3I3CA 2WX1A 2EYMA 2WXMA 3VH3B 1ZDVA 2L05A 1QF6A 3ERQA 1MJDA 1CQVA 1K9MC 1K50A 1Z7TA 2B2TC 2HJ1A 2C35B 2AKWB 4PQXA 4JI8Q 2J0MA 2PW9A 4BFRA 3P20A 3DHGC 1C4QA 2B8FA 1XD3B 2F0KA 5NUCA 1WF9A 1E7ZA 1VJKA 1Y8RC 2QMTA 2A69C 3PRZA 1LT6D 4IM3A 4LTUA 5ELDA 1B53A 3S2HH 3F2UA 4BY7H 3EECA 3ZUNA 4A8XC 2W54A 2F0HA 2BYTA 1WR1A 4YHHL 3NY5A 1DD2A 3PREA 3B0AA 3EQLC 3KBXA 4AWJA 3NK9A 3NZSA 2Y0SE 5AJ3L 4DV2L 1JWUD 1TWHH 2ZXRA 2JA5G 3GTKB 2AWTA 3SK6A 3TUOA 5GROA 1PH1A 2EIFA 1QQRA 1XPRA 2DZIA 1E7VA 2WIIB 1KRSA 1WE6A 4KDIC 3SR6A 3JAML 5I9PA 2AHOB 4DV7L 1X9NA 1EWCA 1YQBA 3CCQA 3OG5A 2KDEB 4MGYE 1U9RA 1Y1VB 2DN8A 5BR8L 4L23A 4YTMB 5JHBA 3Q3NC 2HDMA 2N3SA 1IBKL 1SYCA 1MBYA 2ZTCA 4JI3Q 2INNE 2KN5A 3AE8B 3WCQA 2KJHB 2YTXA 3BVMA 1X3EA 2HE7A 3T1YL 4QCLA 2WU2B 4X3SA 2B2UA 3RR5A 1TT2A 4OZCA 2OTLA 2ZPNA 3CCLA 1M90C 1HA6A 2YTYA 4GKKQ 2K14A 3K7UC 2FBWB 2V1YA 1PYBA 1DM0B 2EMSA 1P1AA 1VCBA 2KYWA 3FILA 3MXGA 4OIKA 1OXSC 3HOYG 3OWEB 3S1QH 3K0XA 1E7PB 4RCNA 4FLHA 3MXNA 2I5LX 2PJHA 1SRUA 2R7ZB 1QJOA 1XEEA 4ZRPA 2DNCA 1CT1D 1ENCA 1YVCA 1WXSA 3CMEA 1W2BA 4B3TL 4OVVA 4BA2I 4AIMA 1Z9FA 1PFDA 3N9YC 3OHXC 2IHEA 2LFNA 2D3CA 2GLSA 3I90A 1HJPA 3QIAA 4P72A 3S16H 1KOTA 4ULLA 3MAQA 2AX5A 4LNOA 3RNGC 5FR3A 3LWUA 1C4PA 1JALA 2NBFA 2P5ZX 4FXKC 4DAYB 4B3ML 1Z47A 2F0OA 3L17A 3M4OH 1G2TA 2VH2A 4L2YA 3PLUA 1HZCA 3H6NA 3NRZA 4L5RC 1ZGUB 4K5WA 4XTCS 4BY1B 4NQKE 2W9NA 2WP9B 5LLIA 4FULA 1NY4A 2WXFA 2HHHQ 1HZ9A 2N55A 4EFOA 1QNKA 1VQJA 1X6OA 4ID6A 2HCIA 3PPAA 2B2WA 1ET9A 2GRIA 2WB1B 1EYGA 3RNEC 4NKLA 3MHZA 1N33Q 1L6VA 3Q69A 1A2UA 3S24A 2DX5B 3S1MB 3K59A 4ANXA 1VQBA 1Q0WB 1HTLD 5G5GA 1LT4D 1HNXL 1TWAH 4A3DB 5EBDA 2BOSA 1PGBA 1UUPA 1WX7A 2LRWA 1Y1WB 1QOHA 1VS0A 3VYSA 2K01A 4WJNA 5JEAH 3JSVB 1E1TA 3UINB 1Z2MA 2R93B 1HFGA 3K5LA 1J19A 2CKHB 1TZOA 3PQIA 4A3GG 1U4MA 1SDFA 1WSPA 1LTRD 1SFOB 4WIPA 2OCEA 5ELOA 3AE4B 2DAFA 4NNJB 4YSYB 3S2AA 2C9OA 1BOSA 3MXPA 2MLBA 1HTOA 1STHA 3RYTA 2JA6G 1RLFA 1QUQA 1L2FA 4DKAC 5EKKA 3CW2C 4IUTA 1ZOYB 2KQ7A 3DHIC 4GDKA 4KIKA 1PRTC 3PT2B 2F0LA 1HZ5A 4IN3A 2H5XA 4FXDA 1SMYC 1FXIA 2GVAA 3MXUA 2ZVOA 3A9JB 1AE2A 2F1MA 1MSHA 4IALA 4BBSH 3NBHA 3S1RB 4LJPB 4F8MA 5HHDG 1ZXTA 2K50A 2KQ3A 3J81j 4LJZC 1OO9B 3I73A 4R3DA 3IKJA 1W6KA 5IYBH 2JA7H 2CQAA 4DV6Q 3H3VI 1AARA 4II2B 2V3PA 3M95A 1SE9A 1S5CD 1NTGA 3QQ8B 2RCNA 3KF8B 4BZAA 3HOUB 3CP0A
chains in the Genus database with same CATH topology
1VMCA 2WDQB 2EYOA 1EY4A 1Q1BA 3E6ZX 3QOLA 1RM6C 2XIWA 4OO1H 5H8YE 2Q8RE 1VZ8A 5D7GA 3OIPA 1WRIA 1BDOA 1DOXA 1A15A 1TKYA 3GTGB 1SNPA 1B9MA 2G9HD 4QIWB 2CU3A 1OXUA 1RWSA 4B0MA 3R93A 4X3KA 3U4EG 3GQBA 2A68C 1L5PA 3NVZA 3MVVA 1C8CA 5G5HA 1PRTF 4A90A 1NENB 1STAA 3L3OC 3SHLA 2B39A 2JWUA 5ELFA 4KY6A 4HEDA 3W3AA 1FEHA 3MEHA 3RZOB 2IL8A 2EKIA 2K9XA 1H9RA 4RHSA 2WXGA 4KKIA 2JSOA 2QF7A 4A3EB 3FPUB 1VLBA 1P7EA 1O7LA 4N6EB 1C76A 5EJWA 1FD6A 1JE4A 2A6HC 5E4XA 1TKEA 3E0JA 1D2BA 2J42A 1YN3A 4CQNA 2SDFA 2V4DA 3EJIA 2MEKA 3IAS1 1ET6A 2ZXOA 2VB2X 3BK2A 2F0VA 4KN7C 4NAMA 4D2KA 3V96A 3D4WA 4RGTA 1VMPA 1GXDC 3K0YA 2QILA 1F2ZA 4EE2A 2OT2A 1WD1A 3AV8A 3NQTA 3NWSA 1OFFA 4B0EA 2N7JA 3SK5A 3DWGC 3MC0B 2JQRB 3VQIA 2LUMA 5EQ0A 2N88A 1DONA 4N9PA 2DY7A 1YQ3B 2ACZB 3FMCA 2QJLA 3HG9A 1IW7C 2EJFC 2H4OA 3Q6SA 4BBRB 2QIEB 1E9MA 3A7AB 2B2UC 2MJ8A 1RODA 2K0PA 3KUPA 3GTQB 1X32A 4HKQA 2AQ2B 1Z6HA 4HTHA 1ZYRD 4L6TB 2ZW0A 3SFEB 4RAUC 2IWHA 2GB1A 4I7ZC 4K5VA 1IHZA 1I3QB 2GA4B 1WTPA 4C7YA 2K5DA 4BY7B 3GTJB 1FXAA 1HQRD 1SNCA 3A55A 1KAAA 4EQNA 3U2SC 3DM1A 1PFBA 2EDGA 3NQIA 3FVQA 4CGYB 3R2IA 2PPBC 1TWHB 2F0NA 5DAUA 3SXHA 4CBVA 5DNFA 3T13A 3AEBB 2L1BA 1Y69U 5AFWA 2JZPA 4KI0A 3AN1A 1J7BA 1WCMB 1HZ6A 1QOGA 3AEFB 2B2WC 3OW7A 1Y8NB 1SSNA 1K8OA 3D31A 4KV6A 4ZKBB 1JICA 3PO0A 2W3RA 3QG1A 3N52A 5C3XA 2WXNA 3HS0C 4IDIA 3L9AX 5CV7A 2CJOA 1DOKA 2EVBA 3KBGA 2KJXA 3I4LA 1UAPA 3N6RA 1ZPSA 3B2GA 3EA6A 4KY7A 2F03A 1K51A 3AEGB 1D5XC 1GJXA 2WKCA 1PGAA 2XWJB 5BYQA 2BE5C 2KVMA 1N60A 1DJRD 1NUCA 5C5LA 4C3IB 1CZGA 1QILA 4NW2A 3SK4A 3U9OA 2FFKB 3LB8C 1EYAA 5EE0A 3X3NA 4EVOA 3D4DA 2MH7A 1KNEA 2NTSA 4ITKA 1HA5A 1QOBA 4FP5D 1UEAB 1DCZA 4Q2JA 4A3MB 3T3OA 1C9FA 1DOMA 3J81E 2LGIA 5I6YA 2HQEA 1KDCA 1O80A 1S5FD 2IPKD 3MZ5A 5EKIA 3I57A 2KOLA 5IGFA 2XRSD 2L9HA 3IT4B 4ZAIA 2DYMA 2XN9C 2OEDA 1SE4A 1BMLC 1WGKA 4JX1C 3WOEA 2RDFA 4H2AA 5GXGB 1GB4A 3K58A 3DMUA 4C1NK 3TDQA 2Y3AA 1IL8A 2N0SB 2Z4IA 3RFZB 2SNSA 2I07B 3BDOA 3AMUA 2B2VA 1S5BD 5EE9A 1EY7A 3P42A 3C1EA 4DK1A 5C3EB 1H9KA 4XYQA 5C0XH 2F0WA 3LX0A 3DWPA 1TS5A 1CHPD 5IGDA 3C1FA 1FCCC 4IZ8A 3BVGA 1UGJA 4N59A 5IGGA 3CQZB 4GDLB 1SIJA 4NJCA 4XDCA 4HRSA 3NUCA 4R8IA 3TZDA 2RVLA 1TIID 4C7ZA 1IGCA 4TQ0A 1GUGA 1SNOA 4S3SA 5LHY1 3PZ7A 2E2IB 2Y5PA 3K7AB 4KY5A 3P4PB 2K04A 3EGRA 2Z4HA 1EY8A 2K5PA 3ABVB 2K05A 5H92C 1XXGA 1NYQA 1IKMA 1STYA 4YSXB 2WXPA 1AEXA 2X69A 2W55A 1LT3D 3NSWA 3TZUA 5D3DA 2BTEA 5JJZA 3NPPA 1VF5C 1AWDA 3AEAB 2HDLA 4H44C 4OHJA 2E2JB 2JXMB 1EY6A 4IUUA 4LLGM 4US9A 3PUYA 1A70A 2EJGC 4AS1A 1F2RI 1FGBD 4F87A 2JYEA 1D4BA 2R3ZA 1LACA 1BQQT 3VYTA 3S17B 2XNAC 4FYDA 2WXKA 3J7AF 4WURA 1YJJA 4DA2A 2RA4A 2YYZA 1BUVT 4MM3B 1ESFA 3EVQA 1EY9A 3A54A 2MJEA 3A7LA 1F2RC 1STNA 1N62A 2KUMA 3O13A 2LHEA 1A3VA 2KEEA 3EFXD 2Z8LA 1NI3A 1PTOD 3RLFA 1J7CA 3TEYA 3MFYA 3H0GB 2BA0A 2PYKA 1ZKOA 1HCZA 2WXQA 3Q8BA 4B08A 1FM0D 2R61A 3SK8A 3FAHA 1EWYC 1XCQL 3IL8A 1JROA 3GTPB 1HTPA 1ZEQX 1PXUA 3UI3A 1AYFA 2CW0D 1TS3A 4MN3A 1LV9A 3TP7A 1P7FA 1NYRA 2ICEC 1ZP0B 3V3XA 3AE7B 4EGVA 4KGRA 5BMHA 2RMMA 4WWMA 4KD3A 2FHTA 5K36G 3L7ZC 1DXMA 2A5HA 2JE6I 1AN8A 2DY8A 3GV3A 5CBEE 2R92B 4DAYA 3D6CA 2EY1A 4C3HG 5KIXA 4A93B 1Q12A 2K28A 3J81L 4OO1I 3GD7A 5C4XB 2L32A 1Y8OB 1SNDA 2QKIC 2BS2B 2A6EC 2X6GA 5ELCA 2EYJA 1SBBB 5M3MB 1PDQA 2BS4B 5LNK1 1TWFB 4BWGB 2RSOA 3QJYA 3J9CA 4E6IA 1OQQA 4PV1C 2CVRA 2MHVA 2AWOA 3VRBB 4HROA 3CRKC 5ELBA 2LMCA 2HUGA 4A55A 3QB3A 2L0CA 4JPSA 1JOQA 4X3UA 2PZWA 3I4MB 4F7XA 5M3FB 2Q5WD 1SJED 4ARIA 4NMZA 4WFN3 4KGSA 5CV9A 3EUB2 2F0MA 3KLSA 4IUVA 4J1MA 4CKCA 5J39A 5EBCA 3NBIA 1YJIA 4DGZA 1QT9A 2J0TD 1EOTA 3QWNA 3P1HA 2LFIA 1YNNC 4H0LC 2NVTB 2LS01 1J8IA 2BT6A 4OW0A 1OQRA 1TJEA 1A6XA 2IX1A 1V8CA 2A69D 1WTXA 3KF8A 2BB6A 3S14B 3NVYA 3HEJA 1MHHE 3W2DA 2WINB 4ZRQA 1N5WA 3BDCA 5C4ZA 1MD2D 3Q23A 1VDZA 2NVYB 4K14A 3KK7A 2B2VC 1LTBD 4RA8A 2CJNA 1E2WA 1LT5D 5C44B 1KNAA 5BMIA 4XXEA 4DAVA 1V1PA 2PCFB 2E3TA 2M2LA 1T5EA 4PMCA 4IFDH 1B44D 1V97A 1AFPA 1ESRA 4USAA 2RKSA 2D5DA 1GUWA 5KNDA 4KKUA 3RD4A 1GUTA 2A73B 4MT5A 2LMCB 3HZXA 1B3AA 4PMBA 3I4NB 1NSNS 3H91A 2IJ0A 4RHRA 2J52A 1PZJD 4R8NA 2VXWA 3DWQA 4XE0A 4P2CB 5JEAG 4XWTA 3H8HA 3NWTA 1GPXA 1KH0A 3E56A 4KN4C 4J3OD 1EQVA 4DU9A 5I2XA 3S15B 3HRZC 1D6EC 1EY0A 1EFID 4P16A 4DFAA 2NN6H 5A35A 2PMZB 1ZXIA 1EEID 1WXQA 1EIGA 1KLGD 3GS2A 1C79A 3PZ8A 4WRDA 3VR4A 1WVLA 2K22A 1T6BX 3KLRA 1G291 5EPJA 5C3WA 2KMMA 1VF7A 2L11A 1CA6A 4OO1G 4XYOA 1B9RA 4OZBA 4KHVA 1KTKA 4A3KB 4DQOC 1V1PB 1I6HB 5FKAC 4JWSC 4XQQA 1XLOA 4WH4A 3TEZA 3Q24A 3LYYA 1GUOA 1TY0A 2F4IA 1PRTD 4RFBA 4WJWA 2EYHA 4UAIA 3Q8AA 1SMYD 4RGNA 3VR6A 4H7BA 4R9WA 1QOFA 5CV6A 3D6WA 4TQ1A 5M5WB 2JYTA 3AH7A 1CA5A 2YEPB 1HFNA 5KYLA 1A3TA 4Q0FA 5IT9E 1HEZE 3AMZA 4GLSC 5LL6X 2QSDA 3MA2B 3U7ZA 4FF1A 2EYFA 1F77A 3DUZA 3FDTA 2EYLA 3PUXA 1TU2B 1BO0A 3TSSA 1NR4A 1W6JA 3IXSA 1MGSA 3HOZB 1JWMD 1HHVA 3ZJTA 2F0IA 2F3VA 1CTMA 1PDXA 2Y5CA 4HEA1 1F2MA 3CHBD 2VUMB 4A3JB 4CJ0B 1CFMA 1D5MC 4K8JA 3BVZA 1ICWA 1F9RA 2D5GA 2DWQA 2A68D 1XCTL 3VA5A 1SYGA 1R4QB 2PQEA 3MHBA 5HG2A 2VB3X 4UDUC 3T16A 2SAKA 4HCEA 4A6QA 2PVGC 3VR5A 1WTQA 3PIO3 3PO3B 1VR9A 4G57A 5CR3A 5A2QE 3AE5B 1JQ4A 3B2FA 2F0EA 3TP5A 4CKBA 1GOZA 3T53B 2ZXPA 5C3JB 4HN7A 1DGJA 2WXOA 1IYUA 1FD7D 3VRAB 3ZGZA 3S2DB 5BN5A 2GI9A 1DOYA 3R8BA 2A6HD 4RKLA 4CKEA 2K7VA 4AQ7A 1EU3A 4A9AA 1R9TB 1OXVA 4HR7B 2Y0SB 3ETRA 3SEBA 1Q10A 2M19A 5C0XI 1D5ZC 4RH6A 1BNZA 5EE1A 3HRDD 2K03A 1N5XA 3BIID 1CZWA 3W5UB 5C6AA 1LTSD 2L4NA 2H89B 2W3SA 1XO3A 1BCPB 4MACA 4V0BA 2PO4A 4LAAA 4YWGG 5JAVA 1FNUA 5KNBA 3C2PA 1B1ZA 1KABA 2M0AA 3BG3A 2LY7A 3A8KE 2I2YA 5EPKA 4XT1B 1ZXHA 4L63B 3G6JB 1SYEA 2EY6A 3NTIA 3FEWX 2V3NA 3P75A 3P4RB 2D9UA 3J7AV 2V4IB 5JEAJ 1IW7D 1LLRD 1PGXA 5E6JA 1SSOA 3PMFA 3X3MA 1FR3A 4N58A 2WACA 2K3UA 2NUCA 3J80E 4JK1C 1JMLA 1XLNA 1PZID 5M9OA 4XQNA 3AE2B 2N9KA 4KK7A 3RMHA 4RKBA 1LTID 4ODGA 4QUCA 3VYRA 5IGEA 2JA5B 4IUQA 1PMRA 1LABA 5FLXE 2KEDA 1F0ZA 1PTOB 1GHJA 4ZUIA 2SOBA 2ONQA 2JEAI 2X38A 2J7ZA 2L12A 4PMWA 3L4PA 3W9CB 4J6HA 3TMEA 1KLUD 4LMQD 2EOTA 2I38A 4BS9A 2F0FA 1TYGB 5HFYA 4A3BB 1Y8PB 3AU7A 1BF4A 1PUTA 5JPNC 3P7JA 5DEHA 4IQZA 1ACCA 5G3LF 1IKLA 2PZTA 5K5PA 4MHEA 1K52A 2R6GA 2KAJA 5AUKA 3K5NA 1QE6A 4L8JA 2W82A 1K8MA 2XRQD 2FMMA 3D3RA 3VA7A 1EYDA 2PVOD 4K6LA 2NMQA 3PV0A 5HGTA 2NB0A 2M00A 1CJEA 2AWNA 5IT9L 2JA8B 4CJ2C 2ID0A 2J4XA 2ON8A 1MSGA 3A56A 4U68A 1RYJA 2FE8A 4HMIA 1SB3C 2VZKD 3OIQA 2Q8IB 3QOJA 2F0JA 1H9MA 4HMJA 2BDOA 1H9SB 2PIAA 3M3YB 1SNQA 3PUVA 4IURA 3BK1A 4QUFA 5AUIA 3AE1B 5C4HA 2WDRB 4RGMA 4HCSA 2BE5D 3AE6B 3ITPA 4ARCA 1LTGD 5FO7B 1L0VB 2MJ3A 2TMPA 3QO2A 1ILQA 2F0DA 3M7NA 1YQ4B 3I91A 3CWIA 3DHQA 3VR3A 1EIHA 4A3GB 1LTAD 1QLBB 4NAWB 2RSNA 3T51B 5A2QL 5C0XG 2E74C 2JA6B 4GZYC 3P4QB 4XDXA 1XF5L 2M56B 1L0YB 1SYFA 4DF7A 4JWUC 1TWCB 1BCPC 1IGDA 1F9SA 1M4VA 3DXJC 3NZ3A 1D1IA 1Y56A 1OXXK 1WTOA 5KGUA 2L5TA 3SR1A 1I4RA 2V0GA 2BBCA 4I65A 1EZ6A 5FO8B 3HVDA 1STEA 1XLPA 2KCNA 1ILPA 4LK1C 3U52E 1CHQD 3CRLC 3T4AC 1L6UA 1YNTE 2F0GA 1JOKA 1UWMA 3RUZA 1MI0A 2DLBA 3NTHA 1QG7A 2F0UA 1R4PB 3NS1A 4JE3B 1U4PA 1YNJC 3MWYW 1FRDA 1QOAA 4Q5VA 1JORA 5I6WA 3WDNA 2AQ3B 3SFDB 2DNEA 2NVQB 3LXFA 1FNVA 1JWAD 2K6AA 1G91A 1BCPF 3OPOA 1C48A 1RCVD 2MP1A 5CYUA 3SDZA 4B9WA 1J7AA 1I4XA 2K5QA 1D1KA 1YN4A 3GB1A 3HOVB 3DWAA 1RJTA 2H88B 1U4LA 3KWLA 1S5ED 1TWGB 4KKJA 3KQ4A 2JEBI 1STBA 1JC7A 1LO5D 2JXTA 4HAEA 5DM73 2B8GA 5KNCA 1A3UA 2KACA 4XT3B 2Z1CA 3J80L 4H13C 1JOOA 5MPOA 1E2VA 3A8JE 5IGBA 3BYTB 3C3LA 3OMCA 4IFDI 5FLXL 4TRDA 5CMDA 1JRPA 1CI3M 5I2YA 2D2CC 1PZKD 2WAQB 2MUYA 2PW5A 5D14A 1S5DD 3Q8EA 5CORA 5F2DA 5E1FA 1R7SA 4G7HC 4B9XA 1A2TA 1GB1A 2KN4A 3BWUD 1F9PA 1X3QA 2WXJA 5ELEA 4YT0B 4C3JB 2G1EA 2SNMA 4FXCA 3W1SA 2WXIA 4HJGE 3NUHB 1F2LA 4C56C 1HPCA 1BXTA 3WOFA 3D8GA 2EY2A 2WU5B 1CM9A 5JVG3 3GP7A 1HXYD 4G4KA 4DXFA 4DK0A 4RNAA 2TSSA 1E6EB 1I4QA 2WKDA 1MVKA 3IFTA 4RGOS 2QDBA 3NVWA 3UI2A 3HOWB 2O5IC 1WTRA 4A3FB 1SE2A 4A3IB 3I72A 1ZDXA 1TR5A 3VR2A 2LKVA 2D62A 2AUKA 3HKZB 1V1OA 2E76C 5IOCA 1VRAB 3ND8A 2KQ4X 4KJOA 3EROA 4IOIE 1CK1A 1E0BA 2WQYB 3HVZA 1TS2A 3MP9A 2L83A 1PTOH 1HUNA 3VR8B 3MJ5A 2JSVX 2KWDA 2FJ2A 1E10A 1O7ZA 4M8AA 1I50B 2EYPA 5C0XJ 4C80A 3NXWA 1EQTA 2A6ED 1PYWD 4FF3A 1RTOA 3ZJUA 4LK0M 1SYBA 2F3WA 1FMAD 4YIJA 4K2LA 3E9SA 1FNWA 1Q90A 1O7YA 3AB9A 4DN4M 2LHDA 5BYSA 1G8ZD 5HI1A 4EQOA 3IAYA 2JU6X 4C3IG 1EEFD 5CV4A 2EELA 2BCOA 3DEOA 4C1NI 2HDEA 3GTLB 4US8A 1NVID 1FCLA 3ZYYX 5T8IA 1BBXC 1J9OA 2M9VA 1E2ZA 4RCOA 4C2MB 3OOCA 4IFDG 1YNND 3GTOB 3AEDB 4ME5A 1YN5A 2AQ1B 3K5OA 5M5XB 1WYGA 5CGKA 2PKOA 5M5YB 2RPVA 2B2YA 1TQOA 2HTME 3IAM1 5C5MA 2EZVA 4KJNA 3HGBA 5KEEA 3HP3A 4KTAA 4N9TA 2L1AA 1SXTA 3GO5A 4K5XA 1G2SA 2RBMA 2IDYA 1UNSA 2B76B 4BA1I 1CQFA 4FNFA 1ZUD2 2F0QA 5EKLA 2ICIA 2MPMA 2SEBD 4CHTB 3LWEA 1SAPA 2ZT9C 3Q0AA 3M4YA 1S4ZA 2N9LA 1TY2A 2NN6G 3AB5A 3I8ZA 4PT5A 2K33A 1K83B 3FILB 5BN3A 1RF2D 5JVH3 1JWBD 1G6ZA 4KKTA 2DYOA 1DYQA 2I46A 4YTPB 2IGGA 4REZA 4FF2A 1UWXA 1JCKB 1JWSD 1WTVA 1C4CA 4AYBB 4U673 3MFGA 2E6XA 1MHXA 1EWHA 5D65A 2J53A 3NE5B 3HOXB 3BS1A 2WNMA 3H3VC 1N61A 1JQYD 3HUIA 1XWEA 3BDLA 1Q8IA 1FIQA 1SE3A 2G9DA 5CBAE 5JPMC 4YXDB 3M85A 5I4DA 1ZE3D 5C2TB 3FKIB 1RFKA 5D3IB 1QB5D 2VZKB 1HQMC 5JXVA 3V05A 4DNRB 2E2HB 5T1GA 1KDAA 4ZYSA 4G7ZC 1WTWA 4QF4A 3H94A 3DWMA 3ND9A 5I9OA 3M7GA 2CHBD 3K6OA 5FO9B 3T3NA 1GUSA 1FRRA 2NYZD 4GDKB 2O5JC 2BB5A 2KECA 2BA1A 2PMVA 4TKOB 3T56B 3I9V1 1C77A 3C46A 3TBIB 1I4GA 3H6MA 1ML0D 1F2YA 1L0XB 2KA7A 1OXTA 4ZUJA 4L1BA 1I4HA 1SF0A 2IX3A 5IIFA 3RPFC 1XLQA 2MJDA 3OMGA 2MGSA 3KLSX 1B2TA 1SNMA 1AP0A 1RHPA 2WXHA 1QNUA 3G7LA 2IX0A 1STGA 3TN2A 1I6VC 4P6VF 4KX6B 1ZYRC 5KYIA 1ROEA 1KDBA 1DOLA 2FMCA 5COYA 2EE1A 4TMAB 1BUIC 2KCCA 4O42A 2H1EA 3S1NB 2EJMA 3AECB 4C3JG 2OEOA 1AZQA 2ENBA 1MI2A 2DBYA 2LEKA 2YU9B 3Q8FA 4YTNB 2RDHA 4YSZB 4XWWA 5BN4A 1PLFA 2EXZA 3DEPA 4KMUC 3U9SA 1WD0A 4JBWA 3VYUA 1IYVA 2EY5A 1V8QA 4IFDJ 4TSSA 3IFDA 1SEBD 1QWYA 3I70A 2IGHA 3P1MA 2K1BA 4C3HB 1AW7A 2F0SA 1RDPD 2NVXB 3S9WA 2WDVB 1ENAA 1EY5A 3CKIB 1VCIA 5FOBB 1RTNA 2BDNA 2FINB 1C4AA 1LTTD 1H9SA 2WXLA 3E5SA 2HCCA 1H9JA 1PFMA 1V43A 5EGTA 5T1IA 1T3QA 3H09A 3S2HB 5LL6S 1IBXA 3GTMB 4J8QA 3BYYB 1TKGA 1XTCD 3AE9B 4ZHPA 1N63A 2PTLA 3NP8A 2PLPA 3FC4A 5HURA 3P4SB 1YMHE 1HRJA 1VZ6A 2A74C 4ILWA 1QCBD 4Y7NB 1EU4A 3ZQ4A 4M1UB 2BW2A 1ENFA 5G3LD 4OVZA 4NP5A 1VDVA 2B2YC 5FK9C 4RWSC 2B2TA 2BS3B 4WORA 2JX5A 4IKGA 4ABNA 3S1QB 1DOIA 4FO2A 1WWTA 1FFUA 5J22A 3CIRB 3URYA 1IUEA 2O2LD 4CJ1B 4M0WA 2RQXA 1VZ7A 2WP8J 1EYCA 4HKZE 3NHHA 4QB4A 5CV8A 2OF1A 3S16B 3P63A 3C8YA 1GUNA 4K2KA 1RKNA 2IW3A 2NZ1D 5CV5A 4KGTA 4HSPA 4XDDA 1FYCA 3M4OB 3AE3B 1EM7A 2NTTA 2C5CA 5ISRA 2LJIA 1EZ8A 2YEPF 5JOBA 2Q8TA 3SVMA 1L4ZB 4KHZA 2WLBA 4OZAA 1FFVA 1FO4A 1IBXB 1GAQB 3MTSA 3Q22A 5EPLA 1TWAB 4X3TA 1JR0D 2E75C 4ZQ3A 2WS3B 2PW7A 4DNTB 3W5VB 1DZ1A 3D4RA 4XQJA 3TP6A 4RF0A 1TKWB 1XX8A 4WAFA 1T5XD 2EPBA 1NEKB 3K5MA 2KDMA 1NCVA 3TEWA 1U4RA 3JAME 3ONAB 3OWFA 4IUPA 5BMGA 2OXPA 4IUNA 1NAPA 2XSCA 2VNUD 4BBSB 1PFNA 3VR9B 2JA7B 3SE0A 4KKSA 1JW9D 3R2TA 1GHKA 5KRUA 1CZPA 5IGCA 2WV6D 4OL7A 2NWGA 4FVMA 4O1NA 4PNYA 3NTKA 4ZRZA 1AZPA 5EE3A 1I4PA 1SYDA 1EL0A 3AM9A 1O78A 2QEJC 3RZDB 5BYRA 4QMGA 2QCPX 2OHFA 3Q8CA 1F9QA 4F88A 1XYIA 1BR9A 5J1ZA 1PTOC 1BCPD 4ZLTF 3FRPB 2X6LA 5DM63 3PO2B 3IT6B 4ZOHC 2XVSA 3A8IE 4FF4A 1RD9D 4OGQC 1X3PA 1II3A 1NR2A 3CU7A 2INPE 2CW0C 2WXRA 3AEEB 4MIUA 3TP8A 5CC4A 1L4DB 3PUWA 3B9JA 4ZHOA 2PZUA 3HOYB 1B9NA 2IGDA 3TEXA 2L55A 4K8IA 1Q3LA 1TS4A 2KHSA 2RDGA 4NDXA 2IT1A 4NZLB 4RF1A 1MPEA 3BZDB 4XIGS 4EQPA 2F0PA 1KRHA 1YNJD 1Q1EA 2JP1A 3PIP3 2ZW1A 1E0ZA 3FPPA 4K6DA 2PNRC 3KWVA 2AUJD 4OIJA 4ZK9B 1PTOF 3V2TA 5C4JB 1B4OA 4TQUS 2O4XA 3NVVA 4FXGC 4MH8A 2XWBB 2K32A 3R3OA 5E4WC 5TSSA 4HSVA 2F0TA 4G7OC 3GV6A 1M8AA 1TVXA 1HUMA 2FUG1 4DXGA 3PUZA 5E3FA 2B63B 2NN6I 1QKZA 4ZKCB 1PRTB 2JYOA 2L52A 5IODA 5K36H 4WQMA 1JB3A 1K53A 3J7YW 1KFYB 4KD4A 1SJHD 3LNNA 3K57A 1KF6B 4Z9CB 2K5WA 3OSOA 4V190 4DAPA 1B50A 2E2DC 1I7HA 1ONLA 1C78A 3I3CA 2EYMA 2WXMA 1ZDVA 1QF6A 3ERQA 1CQVA 1K50A 1Z7TA 2B2TC 4PQXA 2PW9A 3P20A 1C4QA 2B8FA 2F0KA 5NUCA 1VJKA 2QMTA 4LTUA 2A69C 3ZJVA 1LT6D 5ELDA 1B53A 4A8XC 3F2UA 2W54A 2F0HA 2BYTA 1DD2A 3EQLC 3KBXA 3NK9A 1JWUD 2ZXRA 3GTKB 3TUOA 3SK6A 1QQRA 3SR6A 2WIIB 3JAML 5I9PA 1EWCA 1U9RA 1Y1VB 2DN8A 4L23A 4YTMB 2HDMA 3WCQA 1SYCA 1MBYA 2INNE 3AE8B 3BVMA 4QCLA 2WU2B 4X3SA 2B2UA 1TT2A 4OZCA 1HA6A 2FBWB 1DM0B 3FILA 3MXGA 4OIKA 1OXSC 1E7PB 3OWEB 4RCNA 3MXNA 2R7ZB 1QJOA 1XEEA 4ZRPA 2DNCA 1CT1D 1ENCA 4BA2I 3N9YC 1PFDA 3OHXC 2LFNA 3I90A 3QIAA 4ULLA 3MAQA 2AX5A 5FR3A 3LWUA 1C4PA 1JALA 2NBFA 4FXKC 1Z47A 2F0OA 1G2TA 4L2YA 3NRZA 4K5WA 4XTCS 4BY1B 2WP9B 2WXFA 2N55A 1QNKA 4ID6A