2IPKD

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 66
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ipkD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ipkD01
1DJRD 1BCPD 1LT5D 1LTBD 1EFID 3EFXD 1TS5A 4Z9CB 1SJHD 1HTLD 1S5CD 2RDHA 2WV6D 1I4HA 1L0YB 4DXFA 1LTGD 2R61A 2AQ2B 1B44D 3EA6A 2ICIA 3W2DA 1PRTB 2CHBD 3DWQA 3O13A 1F77A 1RDPD 4RH6A 1FNVA 1LTRD 2NTTA 5ELFA 1CHQD 1TS3A 1EU4A 5ELCA 1RD9D 1LT3D 1SBBB 1QILA 1FD7D 3BZDB 1KLUD 1PTOF 3BVZA 4DXGA 3R8BA 1LT6D 1S5FD 3KLSX 1I4QA 1D5ZC 1SE3A 1RF2D 1FNWA 1S5BD 4C56C 2XRSD 4TSSA 1BCPC 5FKAC 1ET9A 1JR0D 1I4RA 2XNAC 3MFGA 1T5XD 4L6TB 1DYQA 1S5ED 1KTKA 1V1OA 1EWCA 3R2IA 1CHPD 1LLRD 1SJED 2XN9C 1FNUA 1JWUD 1XTCD 4K6LA 1YN4A 2J4XA 1M4VA 1PTOB 1V1PA 1D5MC 1S5DD 4RCOA 1ESFA 2QEJC 4RGTA 1B1ZA 1ET6A 1LT4D 3BVMA 1TS4A 2AQ1B 1HQRD 5I4DA 1SXTA 1LO5D 1SE4A 2RDGA 4RGNA 1MD2D 1HA5A 1PYWD 2O2LD 2NTSA 2QILA 5ELEA 1PTOC 3BVGA 4BWGB 1CK1A 3V05A 4O1NA 4UDUC 1SE2A 2SEBD 1KLGD 1PZKD 1L0XB 4ZYSA 3DWPA 3MC0B 1CQVA 1LTAD 2Z8LA 3CHBD 4RHSA 2XRQD 1YN3A 2G9HD 1FGBD 3TSSA 1BCPF 5FK9C 1LTSD 1BXTA 5ELBA 1HXYD 1UUPA 1JCKB 3BYTB 1JWMD 1EEFD 4RGMA 1PTOH 1AN8A 1XXGA 1JWSD 1PZJD 1TY2A 1STEA 1PRTF 2IJ0A 1SEBD 2TSSA 1I4GA 5TSSA 1TY0A 1UNSA 1V1PB 1PZID 3DWAA 5ELDA 2IPKD 1AW7A 1LTTD 1EU3A 1I4XA 4L63B 1YN5A 3R2TA 1LTID 1PTOD 5D3DA 3URYA 4NZLB 1RCVD 1D5XC 1BCPB 3BYYB 5D3IB 1CT1D 4RGOS 1PRTC 1ENFA 4OHJA 4RFBA 1G8ZD 1D6EC 3SEBA 2AQ3B 1JQYD 1PRTD 3OWEB 1I4PA 1TS2A 4RHRA 1GOZA 3GP7A 1EEID
chains in the Genus database with same CATH superfamily
3OIPA 1LT5D 2HCCA 1Y1WH 5GADC 5IP4D 1CZGA 4NKLA 1QE6A 2RDHA 1QZHA 3RMKC 4C3HG 3ER0A 2NN6H 2R61A 2ICEC 1FXTB 4DV3Q 4BKSD 1J5EL 3GDEA 1YZ6A 4KK7A 4I6PA 3KUDB 4JVZA 4JI5L 2N0SB 1B9MA 1PGAA 2WNMA 4JGHB 4GLAC 3VTVA 1X6OA 1HZ5A 2JYOA 2XVSA 2EKEC 2DHZA 2ZVNA 4XDXA 2J0KA 4IKGA 2ONQA 1EFWA 4XDDA 5FO9B 3TZUA 3U58A 5DM73 1FNWA 1OEYA 3I57A 4HJAA 3GO5A 4JI1L 5CORA 1AE3A 4ME5A 4PMWA 5K36G 4IUMB 1G6ZA 2GN5A 1L2NA 5G3LF 4NP5A 2O4XA 2IZVB 5KIXA 3NWTA 3UE0A 3MFGA 1T5XD 3N1ZC 3M63B 1LV9A 2C7NB 4JWSC 3PF4A 4I7AA 2JK8A 4K5WA 3GTGB 5CHFA 2PTLA 1XTCD 2JZZA 4BBRG 3CRLC 4YXDB 5IGFA 4GOPB 4CKCA 3L3OC 2NVUI 3RT3B 4EUTA 2AWOA 1M94A 3FPPA 3TEHB 4LWCA 2MLBA 4G7OC 4J6IA 5IP9G 3E5SA 4RNAA 2VL6A 3PUVA 2MO0A 4J15A 2F0WA 1HNWQ 3GTOB 2KDMA 1QUQB 3OJ4B 1D1IA 4M01A 1LUZA 4A3FG 4LFAQ 2GVBA 4C4VA 2ASQA 3F2UA 3AEFB 2F0KA 2K50A 1Q3LA 4X65Q 2O2VA 3ZNGC 5E4WC 5C4XG 1EIYB 3I91A 2HTHA 4ZRQA 4QB4A 4O1NA 4DR4L 1FIQA 5C4ZA 3K9OB 1SE2A 2MX2A 5AUKA 2FE8A 5GQOA 1E2VA 1PZKD 3I70A 1ICWA 5M5YH 4PYUA 4BA1I 4JI1Q 1OGWA 4DR3Q 4ID6A 2H5XA 2LWPA 2BA1A 4L5SA 3VR4A 4TRDA 2NB0A 4LNOA 4OIKA 2MBBB 3WA0A 2Z0DB 5HGQA 2Z6KC 4N58A 3PZDA 1X1MA 4XC2A 3RZOH 4YWLA 2NBFA 4GNXB 2UXDQ 1C4AA 1UEBA 2WXQA 4I65A 2K8BA 1JT8A 1PZJD 3JSVA 3SDZA 5J2RA 1Z2MA 2RDBC 3K80C 3VYRA 1GXDC 3L0OA 5KNDA 3UIOB 1AW7A 5IGCA 3S1MH 1YN5A 2QSDA 1TWFH 3VTWA 5ISRA 1EWIA 1W6KA 4WJQA 1WF9A 2OOBB 2PQAA 4IZ8A 1WGGA 2INNE 5IP9H 2Z0SA 2FXQA 3UDIA 1NR4A 4OWWB 2KJ6A 4RFBA 4DU9A 2F0LA 4KMUC 1U4PA 1IBKQ 2G3QB 4QY7A 1WH3A 2QJLA 4JBWA 1ISNA 1G6JA 3D4WA 3IFDA 4A55A 2J42A 1FXAA 3B2FA 1VF5C 4BS9A 2V3NA 1UE7A 5C4XH 4DHJB 1IBML 4B3SL 1WFYA 3BJUA 2KC2A 5H8YE 1MHWC 2HD3A 3U8ZA 3UI3A 2CHBD 4P74A 3SK6A 4RH6A 1ZDVA 2W3RA 3ABVB 3P4SB 1WTXA 4BOSC 2L55A 2WINB 2HD5B 4NPSA 3HKZB 4MHEA 2QDLA 2K32A 3QK0A 1LT3D 1VQEA 1SBBB 4HJ5A 2KCCA 5C44H 2WXFA 1YHAA 5CBEE 3I55A 3I4LA 5E1FA 1FRDA 3DBRI 2R7DA 4WRDA 4K7UA 1WX7A 1L4ZB 4EZKA 1GB1A 2MJ8A 1C8CA 4GN3B 1CI3M 4HAEA 2K28A 1EUVB 2K5NA 2R7ZG 2E76C 5FO8B 1WZ0A 2KCTA 2M00A 4J8QA 3HGBA 5IY0A 4RM9A 1HFGA 5J22A 3GTOH 2WDQB 1JWUD 2FIFA 4KDLB 1UD7A 3P4QB 3NQTA 1KABA 1DM0B 1QZEA 5LMUL 1XMQL 2PLPA 2MW5A 1ESFA 2L32A 1GNUA 4RCNA 2KFJA 2LASA 5CR3A 4A4IA 3HIZA 3PTFC 4AJYB 1ET6A 1OXTA 1XF5L 1N9WA 3D4RA 3NSWA 2A8VA 4XYQA 4K1RB 4TV3A 3HKZG 2DYBA 3LNNA 1YNJC 4IWOA 2I0QA 4RGNA 2WGSA 4GZYC 1QQRA 2MWSB 4DBGA 4FJVB 3EN2A 4HSPA 4ANVA 3ZQ4A 3H0GH 1U4LA 1WTRA 3K7AH 1N61A 2XWBB 1P8LA 3MHSD 4GOCA 3N1XC 4ALPA 4NXNL 2F03A 1WYWB 1QNKA 2DZJA 1RAXA 1FCLA 1XPRA 2C35B 2IT1A 4S0RA 5FLMG 2BKFA 4J1MA 1P3QU 3GV6A 2RHQB 5AZHA 1CQVA 1LTAD 3T13A 4X3TA 1H9RA 4LMQD 2ZJPA 4IG7B 4W9FA 3ZO5B 1JMLA 5FK9C 2K5DA 4HKQA 4QL5A 1P0RA 1UWMA 1DOYA 3JAML 1OO9B 1X54A 2K14A 2DZKA 1JWMD 4RMAA 1TT2A 4NXNQ 5CC4A 2WXMA 1EZ6A 5JEAH 3OMCA 5I6WA 5H92C 1Q8KA 3I73A 3EBEA 1L1OC 4X62L 4I6NB 3H3VC 3GE8C 1DOMA 3OOCA 2JSVX 4XE0A 4GKJQ 3OG5A 5IGBA 3RUIB 4RA8A 3WWVA 4IUNA 4EQNA 4UHVA 4C3JH 1C78A 2WXJA 2RCNA 4UP8A 3AI5A 3MJWA 3TMPB 2L1BA 2ZPYA 3AE7B 1JRUA 4LTUA 3DBLB 4UP9A 1BCPB 4AH6A 2RSUA 2IO0B 3PVLA 2LXKA 4AP4C 3S1QB 1UE6A 2LHEA 3ZLZA 3UGBB 4GB9A 2MNAA 2YTXA 1QB5D 3FPUB 3PSEB 4BBNC 1EEID 3CPFA 3E0EA 4A75A 4ASWC 1AE2A 3H0GG 4ZKCB 4KV6A 4TQ1A 5BN4A 4UAIA 3MHBA 4TKOB 1IL8A 3J80c 2N9EB 4PT5A 5C3EG 1A15A 4G4KA 1CMXB 4ZDVA 1XD3B 2YU9B 1PYSB 2WFWA 1HZCA 4UP7A 3PUWA 2H4OA 2NYZD 1GUGA 1PGXA 5C44B 1Z7TA 2Y0SB 3S14B 1T0SC 1TKGA 1YQBA 1WRIA 2NBWB 3AV8A 3IAS1 4LNFA 3MEHA 4A3LG 3BS1A 3KK7A 2UUBL 3SVMA 1VDVA 1J7AA 3NTHA 3BVZA 3DEOA 2VQEQ 2X38A 3PIOA 2L9HA 1SDFA 3K5LA 2DYMA 2FBWB 5CV5A 1SMYC 5M3FH 2WXRA 5C4XB 1DONA 1VCIA 1B3AA 1R4PB 3FKIH 1PV4A 1V97A 3LB8C 1VQHA 2OJRA 3DHQA 5JEAG 5EPKA 3S1RH 1HHVA 1NEKB 1SYDA 2RA4A 4YCUA 4G0NB 4P71A 1S72A 3VDZA 3AU4A 4URKA 1HZAA 2EJMA 4OL7A 4DN4M 3TEZA 1KRSA 3KW5B 2PPBC 1KHIA 1WCMH 4JC0A 4OO1H 1C0AA 1HRJA 2WXKA 2ATWA 2A5HA 2R93G 1H4RA 3Q14C 3CSFA 4YHHL 5AEKB 1A5RA 1PTOB 1VQOA 2JRIB 1RIPA 2NR2A 4QJFA 1TWAH 1PDXA 3V61A 4A3MB 2V1YA 1B1ZA 2KECA 3E9IA 2IBIB 1PMRA 1TS4A 4A3CH 4AQYL 2BW2A 1VQ7A 4GN4B 1N5WA 2CHZA 2KDFB 2Y5BB 4JPSA 3T8MA 1C7YA 3K8AA 5FO7B 2B2TA 3GTLB 2K4KA 2M1MA 5AZGA 2KTRB 3E6ZX 4KHVA 3K81C 1O7YA 1TTNA 3PO2B 2NTSA 5ELEA 2M19A 1TWGH 1B70B 2L12A 1W2BA 1EYGA 3H0GB 1K83H 1G51A 3TUOA 2E2JB 4WURA 5GAHC 1NI3A 2UXCL 2KK8A 2M56B 1P1AA 2WXIA 2UXBL 1FPYA 3I56A 4A8XC 3EHVA 4RF0A 3DXJC 3CC2A 1V5TA 2HIXA 3Q3NC 4ICVA 1B53A 1PFBA 3AQQA 3AB9A 4Q5VA 5IYDH 1SR3A 5CV7A 2JWZA 2LI5A 4X3SA 5ELBA 4BFRA 1WI0A 4B9XA 4HIDA 4C00A 4JI0L 3A5ZB 2DZIA 1NY4A 3DOWA 5LNK1 2B39A 1N8RC 4Y7NB 4ILWA 1S3SG 2EIFA 2IYDB 2E2HH 3DM3A 1ZXIA 3KDFB 4A3GG 1XPOA 2KWCA 1II3A 4PMBA 2KJXA 2WHIA 2EZVA 2E6XA 4YY3Q 2ZEQA 2ENBA 2N4FA 2XK5B 1CKNB 1UAPA 3KJPA 3T1HL 3CC4A 3RNUA 1GHKA 1X56A 2KHWB 1K8MA 3A9KA 3KQ4A 3NENA 5CTRC 3URYA 1QWYA 2LEKA 2ZTDA 2M8SA 1OXUA 1E90A 3LXFA 1GUOA 1F2LA 4OWXB 3RZWC 2B76B 1P98A 1VR9A 1IBXB 2RHSB 1R9TB 3BZCA 4TVAB 4KKJA 4MJSA 2O6VA 3SEBA 3CCMA 1K9MC 3EROA 3NVVA 5IO9A 1ZE3D 3VAWA 3E56A 1Y69U 1QVFA 2KFKA 3DBHB 1JE4A 5LMNW 5EKIA 1XEEA 3D8GA 3CD6A 2L11A 3GTPB 3M4YA 3K5MA 1DOXA 1XJVA 3HOZB 3J9CA 2RGFA 4F87A 3Q8AA 4NAMA 3DWMA 5LHY1 3HOUG 2WWZA 2D5GA 2NTTA 3PIPA 3TL5A 3D3RA 4XWTA 4C4VB 4CKEA 3S24A 1FD7D 1XLPA 4H13C 3L10B 3KUPA 3I4MG 2F0UA 5M3MB 1A0IA 4DXGA 3N52A 3R8BA 3S2HH 2BBCA 2G45B 1UEAB 1E22A 1D1KA 1P16A 3L7ZC 2D2CC 4A3JG 2IX0A 1D5ZC 5JPMC 2YLMA 3AH7A 1L0VB 1V6EA 1Y1VH 1R7SA 3WOEA 5IT9c 3X3MA 3EECA 1PFDA 1FMAD 4IO9A 1EWHA 4XGAB 1GG3A 1D3ZA 3TEYA 4LF4L 4L5QA 1NTGA 1BQQT 4JV5L 2UUBQ 2BE5D 4ITKA 3M95A 1CSQA 2L83A 3OTOL 1XLQA 2JT4B 1Y8NB 5I9PA 1VQAA 1ROEA 5G5GA 1SB3C 2KCMA 2K7VA 4L2YA 1IBXA 2PQAB 3PRZA 1C77A 5LXIB 4JLCA 1WE7A 4DV1Q 2BS2B 4J6HA 3ZRFA 1IBMQ 1LO5D 3QHTA 1E7VA 2CJNA 4LF6L 5E6OA 1VQ8A 2MBHA 2G4DB 4HVBA 3W1SC 3P63A 3DBHI 1MD2D 1HH2P 3M7NA 3HKZE 2O2LD 3J80E 1PTOC 2JA7H 4DV7L 2REXA 5BMGA 4C3IB 2SOBA 1DGJA 3ZNID 4V0BA 1Q82C 4DV0Q 4K14A 1E2WA 1STYA 4KZCA 3ITPA 1JE5A 1NUCA 2XEWA 4KJNA 1O80A 4QCLA 2BVCA 4B3RL 4RHSA 4HROA 1YN3A 2JXXA 4EQ5A 1KC8C 1FGBD 5BN3A 5C0XJ 1HZ6A 2CR5A 4GLXA 3P42A 4YWGG 5BR8Q 1BXTA 4FHKA 1J19A 2N9KA 3MAQA 3A56A 4IOCA 4A3JB 2V4LA 3OAWA 1JWSD 1NSNS 3UF8A 1I94L 4LF9Q 2E2HB 4KY6A 1WJJA 4C80A 2FCMA 2RVLA 3PO3H 1UH6A 3GS2A 1FFUA 1YNTE 3OYYA 2ZJQA 1CSPA 4X66Q 1WX8A 4A3GH 3BINA 1XTDA 2OHFA 1RTOA 4QAYA 2RDFA 1YNXA 1ZKHA 5EDSA 5IWAQ 2EDGA 1WXSA 1Q1EA 3AEAB 1LTID 1A3VA 1FM0D 2VQFL 4CKBA 1WTPA 2KQ4X 1WTWA 2NVTH 4JI4L 1WR6E 5IP7G 2LHDA 3G6EA 1AZPA 1PRTC 2VB3X 1B3QA 2ZPNA 3RCZA 1RYJA 2B2YA 2DLBA 3VYSA 4MM3B 4TQ0A 2NN6G 1SMYD 4ZAIA 1XMOQ 2D2QA 2KO3A 2F3VA 4ANXA 2HHHQ 2R93B 5JXVA 5JPNC 1XNQQ 2KHJA 4DR1L 5KNCA 3NZSA 2F0HA 4OZCA 4YTMB 4EX5A 1TQOA 4IUVA 1SLJA 5JVH3 2JA7G 3H7PA 1NI2A 1VZ7A 2EMTA 3MA2B 1I4HA 3GTMB 2MFIA 1I35A 4JBJA 3HRZC 2XK5A 4EQPA 2SAKA 2E74C 2ASBA 1EIFA 4FYDA 2WXOA 1FNVA 2I46A 5ELFA 1YOVB 2INPE 1EY7A 1TS3A 2K1BA 3ZKJC 2VRRB 3FAHA 2Z6BA 3J80L 4LF9L 3W5UB 4G11A 1JJ2A 2M0AA 4DNIA 2N78A 4DK6C 2LY7A 2AUJD 1J8IA 1K8RB 3NVWA 1GC6A 5JEAJ 3Q3MC 3I90A 2NVQH 4DA2A 2IGDA 1WM3A 1PVOA 2KWUB 4NNJB 3PF5A 1VQIA 1X65A 1N34L 2CW0C 1X3GA 2MQHA 2CS4A 2WLBA 3PUZA 4HJGE 4DK1A 4ULLA 2K5QA 4MH8A 2OF1A 2A73B 4OWTB 1FGUA 4GS3A 3DVGY 4LF5L 2N1VA 1I3QH 5IOCA 1NMGA 2UXCQ 2GOWA 2OEOA 1GUNA 5HI1A 3BIID 1VQBA 5FLXc 4CO7A 1EY9A 1TWCB 3J81j 4RGTA 4YCWA 1RRBA 2R7FA 2BPSA 2EELA 3AEDB 5BO4B 5BYQA 4DR2L 1E1TA 2R2OA 2QDFA 3D6WA 2ZCCA 4IURA 3PHWB 4YL8A 4IUQA 3MTSA 2MP2A 1RTNA 3PZ8A 3KF8A 1OTRB 4KIKA 1VD2A 1HA5A 5LXHA 1HEZE 1L4DB 2OQKA 3AEVA 1NYRA 3KJOA 4MGIE 4MT5A 5CX3A 1EQRA 1PH6A 4FN2A 1KLVA 1ILPA 3HHMA 4MTKA 1MHXA 1YVCA 4NMZA 3T1YQ 3F8TA 4JI8Q 1ZUD2 4REZA 4ZYSA 2YTYA 2D3AA 1HZBA 3DWPA 2DX5B 1SMXA 2BE5C 2OXPA 3VTUA 1HFNA 4JIOU 1YX5B 2JY6A 3ETRA 3VH3B 2JXMB 1HPCA 4JPBW 2MRPA 3PO0A 3BDOA 3NUCA 5CV4A 2PVOD 5M3MH 5DPRA 5GMVA 3K7AB 3QOJA 3J81i 1OXXK 3ECIA 4KKTA 5DLQE 1S4ZA 5GROA 5KRUA 4KKSA 1WXVA 3TP5A 1PRTF 4A20A 2GBKA 3QWNA 2BB6A 4JBMA 3W1GA 3UDGA 4FA6A 3QB3A 3QJYA 3TS0A 3OIQA 1XNQL 2KVZA 2ZXRA 2RR9A 5IYCG 4P6VF 4FF1A 2IY5B 5D3DA 1N60A 4DNTB 4JYAL 1JROA 1MJDA 1D5XC 1Y14B 4LNIA 1G6PA 5JJKA 3U7ZA 5HFYA 2PVGC 2N88A 3FKYA 3UDFA 1ENAA 1G8ZD 2VS1A 1ZOYB 3ZIMA 1CFMA 5LL6X 1EY5A 1A3UA 1SYEA 2EVBA 2WXGA 1FCCC 1N5XA 2L3ZA 1PHJA 1X32A 5E4XA 3B9JA 1WOCA 1HNZQ 1Q8IA 2KD0A 4U68A 2MJ3A 3H6MA 2NUCA 2XSCA 4M8AA 4X66L 3MJ5A 1S5CD 3X3NA 1E8ZA 1Q46A 4HMJA 1FVIA 2C7HA 2PPHA 3T1HQ 4JI5Q 1C1YB 1PUTA 1UBQA 2EMSA 4PS8A 3ZDTA 2EY6A 3DLLA 4IOIE 2FMCA 4K2KA 3AECB 2K04A 2HHHL 2A19A 3W3AA 1JMCA 3DUZA 2R7ZH 2R92H 2PW7A 2KC1A 1KLUD 3UI2A 4FJZA 4WJWA 1EQQA 2WAQG 3BZKA 3KYCD 4K5XA 1ZEQX 3NQIA 3NBHB 4TQUS 1DOKA 1Z9FA 5EGTA 3NVYA 1MVKA 5CYUA 3CMEA 4HR7B 1GVPA 1FRRA 1MFWA 3DHHC 1J8CA 4LF7Q 4NAWB 3WIMA 3NPPA 1HR0L 5HURA 2GVAA 5IYDG 4A3DB 2EOTA 4GDKA 1KDCA 2Y3AA 1VQMA 4BY1H 2LVOA 4OX9Q 1O7IA 3CCRA 2O6VD 4NQKE 1BVSA 4APVA 2O6VB 1GKHA 1YN4A 1L5PA 3FKIB 5IKCM 5IYBH 2MH7A 2YTVA 5IA7A 5COYA 2K6QA 3SK4A 3N1YC 1F2MA 1CTMA 4ZUJA 4JI6L 3NE5B 2KVRA 3I72A 4DR7Q 3ALBA 4P73A 3QCAA 4C1NI 1PH5A 3NBIA 2ZNVB 2RPQA 3VUWA 3K0YA 2UYZB 3ICEA 3QX1A 4B3RQ 1XWEA 3AFQA 5D14A 5A2QE 4OZBA 2WB1E 2PNRC 2BCOA 1UGMA 1XNRQ 3R3MA 2HJ1A 1Z47A 1QOGA 3ZGZA 4B3ML 5EE0A 1V86A 5LMUQ 5G5HA 1T3QA 1STAA 3A74A 1KXLA 4X3UA 2QIEB 4CYEA 1IBLQ 1VLBA 3EGRA 2PW5A 2M0XA 2EYMA 3U4VA 1NR2A 1CKMA 1F9PA 1JICA 3OMGA 4HJ8A 2K1FA 2WYQA 3PPAA 1QCBD 3ZYYX 1E7ZA 2KVMA 3RD2A 3HEJA 4HRSA 3RN5A 5JJLA 4R1JA 1GUTA 2B2TC 5BR8L 1TBEA 1LM0A 3UIPB 2F0QA 3VR9B 2PI2E 3OLMD 1EF5A 1EYDA 4A3DH 4GOPA 1SNQA 4YWKA 3HOYB 4X57B 4DUYL 1G91A 3TRZA 3WDNA 1XMOL 1WI5A 3Q6BA 4F8CB 3UDXA 4DR5L 1P7EA 2R2QA 4P7IA 2BB5A 4L63B 2N9XA 3RI7C 1A63A 2KKCA 4B3TL 1M1KC 3PO2H 1GO3E 2IDYA 3F2CA 2KWDA 1B9NA 4A3FH 2CQOA 1XCQL 2J7QB 5M5WH 3AULA 3DVGX 3PUYA 5I9OA 3TCAA 2V4DA 3DVNV 3HZXA 1E9MA 4CJ0B 1B9RA 4C3JG 1D8LA 4F88A 4NPNA 1R9TH 3G6JB 2JU6X 1F2RI 3HOVH 2F0SA 1L0WA 2UU7A 3K9PB 2GBMA 1LTBD 1EFID 4DGZA 3C2PA 1WXMA 2VW9A 1HTLD 4A3LH 4EEWA 3K7UC 5LL6S 1B44D 2MO1A 1TGZB 2KHSA 2K8CA 4RG1A 3KVFB 4JI2Q 2IHFA 3GTQB 1SYCA 2R6GA 4BBSH 1EOVA 2PO4A 5KGUA 1B2TA 1YX6B 2JUOA 3EC8A 4KN7C 2LXCA 2E5LQ 3I63C 4OONA 4KV2A 4HMIA 4OIJA 3U52E 1EWYC 1E2ZA 4WJ4A 2P5ZX 4N9TA 2L05A 4DFAA 4K0KL 5T1IA 1STHA 2RQXA 2PMZB 3BG3A 1P7FA 1RF2D 2D11A 4FHJA 4IFDJ 4PZ6A 2OEDA 2Z4IA 1V8QA 3PO3B 3V96A 4WWNA 1T0QC 4IJHA 1C9FA 3KF6A 3TQYA 1E1OA 2C5CA 4FXKC 4LF7L 2L1AA 4CGYB 2VUMH 2DAFA 1YIWA 1QOBA 2WQYB 2MBOA 4EZLA 3OW2A 3KYHC 5EPJA 2A69D 3W5OA 4HXDA 1WGKA 2J0JA 1ASYA 4B3MQ 3APFA 3DPDA 3VUYA 2QEJC 4HSVA 1WMHB 4IN3A 4N59A 2K25A 1IKMA 4KKIA 4OO1G 1LT4D 4KKUA 4LF8Q 1GB4A 1PLFA 3VYUA 3J7A5 3L4PA 2JJQA 2WX0A 4KTAA 3B08A 3ENEA 2OT2A 3MC9A 1CZWA 4C3JB 4J3OD 4NB3A 3GTMH 5IP7H 1L6VA 1PYWD 2CHXA 1CM9A 1AH9A 3P4PB 4IFDH 4LDTD 4FBJB 3CXCA 4MM3A 4IC7B 3AMUA 1AWDA 3P7JA 4USAA 2EJFC 3KLWA 2F0EA 1BMLC 4C3HB 3M4PA 5A2QL 5C3EB 2A4ZA 4QIWE 3MC0B 4S17A 3IXSA 1YJ1A 2Z8LA 3GTJH 4JQWC 1EO6A 5TR5A 3TS2A 1EF1A 1BOSA 3RNEC 1BCPF 1D7QA 1ZXTA 1BDOA 1J6QA 1LTSD 5J1ZA 5L37A 1LTLA 4JI7L 2EYFA 5GXGB 3DDCB 4FLHA 1WYDA 4DR4Q 2WDRB 2ZCBA 1TKWB 5M5WB 1WFQA 2WDTB 4KX6B 4XYCA 1ESRA 3KWVA 5C1ZA 3S14H 1TYGB 1PQSA 2HQLA 4G50A 3TBIB 4CJ2C 1VQ9A 1YNND 1PH7A 1ZKOA 2EY2A 2KN5A 5ELDA 1NE3A 3UQAA 2RSOA 4H02A 3VYTA 4ME3A 1LTTD 1GJXA 2BYEA 2DNEA 4RWSC 4HCNB 2Q2UA 4H7BA 3SHLA 1OTCA 2NBUA 3W1SA 4B95A 3C8YA 5CV6A 2MP2B 4YTNB 1X3QA 2VXWA 3PO2G 3FRPB 1V80A 2L52A 1STGA 4KGSA 5D3IB 4JI3L 3IFTA 2K52A 3CCJA 2BH8A 2Z59B 4OHJA 3EVQA 2ZXPA 2DUDA 1O78A 4B08A 2IY1B 3VR8B 2KEDA 3S1QH 1B8AA 2FUHB 2NZ1D 2ZM6Q 3S16B 3QA8A 2KLGA 1SE8A 1Y8RC 1I4PA 4DAYB 2K8HA 4KZ0A 2EE1A 4MN3A 1SROA 3HOVG 1Y8OB 4GKKQ 1E5WA 3KF8B 1SJHD 2QA4A 4IFDG 4K7WA 4QGUA 3T51B 2IW3A 1DOIA 2OCEA 2F4VQ 3RLOA 3I4MH 2JX5A 4PS3A 4A3FB 2N55A 4QUFA 2SNMA 1QLBB 1F9RA 3DWQA 3I9V1 5DPTA 4BBSB 1YQ4B 4OEMB 2JEAI 1LTRD 1Y56A 2FUG1 4GDLB 3H94A 2I5HA 4JI3Q 5EE3A 1F2ZA 1LACA 1I6VC 1NBFC 3MWYW 4F8MA 4FJYA 2UU9L 5E6JA 3HOXB 4F1SA 4WAAA 3A1QB 4CHTB 1HNZL 4N8FA 1IUEA 1Q10A 1ZXHA 1FEHA 1IYJB 5AFWA 1J5EQ 2ZW1A 1ILQA 3H09A 3IKJA 1I4RA 2BDNA 1CZPA 3VFKA 1PH2A 1VQ6A 3NUHB 2Z0EB 1BF4A 5JVG3 4LF8L 2V4IB 2CH4A 1JOKA 2E5LL 1Q12A 1V1OA 4M1UB 1N34Q 1T0YA 4II3B 4P1CC 2A69C 1U4AA 1U0LA 1Y1VG 4KLKA 4A3GB 4BY7G 4YIJA 2KTRA 3PCOB 1NAPA 5C5LA 4JE3B 2QDBA 3VRAB 1SNCA 1IP9A 3NXWA 2ES2A 3NHHA 3HOYG 2NPTA 5ELOA 3G7LA 1HNWL 3AU7A 1EY0A 3JYUA 1F2YA 2QF7A 2JA5H 1XPUA 1TWHB 2AQ1B 2EY5A 1D4BA 4G3XB 1FR3A 3WOFA 4KD4A 2KHIA 3S1MB 4OVZA 2WXPA 4UPAA 3EFCA 2Q8IB 1FO4A 3ULJA 1VCBA 3S15B 2PW9A 3GTLH 4GSWA 2Z6KA 1VQKA 2IY0B 5J17A 3H1UA 2W82A 1VQFA 1NNXA 4X64Q 3TIXA 2UWQA 2DWQA 4BXXG 3MTNB 1V9JA 4A3EH 1ACCA 1KDAA 1X3FA 3ERQA 1ZPSA 4JI8L 2KNBA 2W54A 1A3TA 3IL8A 3SR6A 2D3GA 4LUZA 4HDOA 2JN4A 4ZQ3A 3TSSA 2KJHB 4NAWA 4DXAB 3MXUA 1NMFA 4JI7Q 3NOBA 1PYBA 4NJCA 4EQOA 2WB1B 5GAGC 1VQJA 3NBHA 4HEDA 1WD1A 1WGDA 1XLNA 4TMAB 1K73C 1C4PA 3KFUA 1WJ4A 2WX1A 2M9VA 2ON8A 5K36H 1F0ZA 2CJOA 4EVOA 1B7YB 2F52A 3QG1A 3S1RB 3TP8A 1HCZA 1V1PB 4WJ3M 2KQSA 2HCIA 2R7ZB 4MJSB 1TR5A 2KX3A 4ZLTF 3I3TB 1TWFB 2F0NA 5C5MA 1KNEA 3SDLC 5DAUA 3A7AB 2HTME 3CKIB 4WFN3 4PQXA 3IAYA 1SN8A 2B29A 5KYIA 5M9OA 4BA2I 1IYUA 2QHOA 3I5JC 2B63H 2WAQE 2F0VA 4BY1G 2GBRA 1HNXL 4E71A 2AHOB 5M5XB 3HOWB 2GRIA 4ACFA 1BR9A 1QVCA 4MH0E 4MZ9A 2BS3B 3RLNA 3J81L 2AWNA 3A4RA 3T53B 1TS2A 4BKTA 2RBMA 3CAMA 1V1QA 1UF0A 2NZHA 3GTPH 4OO1I 3VRBB 2JXTA 5C6AA 1IGDA 4JK1C 1WXQA 3A4SC 4RMFA 3B6YA 2CKZB 2D07B 2W3SA 4YSYB 3NELA 3EA6A 2ICIA 2PE9A 1AP0A 1JB7A 2MGSA 2K9XA 5EAYA 4PV1C 3CCVA 3PLVA 2NVYH 5ELCA 4DHZB 3APCA 4K2LA 2MCNB 3HVZA 5MPOA 3KF6B 3CCUA 2AL6A 2I5MX 2BQQA 2KMCA 3GZNI 3MFYA 2WKCA 4K0KQ 4DPGA 4TSSA 3AE2B 3LYYA 4KI0A 2A6EC 2AX5A 2WB1G 1YMHE 3AMZA 1JR0D 3TMEA 3DVNU 4WWOA 1QJOA 1E10A 3ZW3A 2KTFA 1VQCA 2C9WB 4CDCC 3KBXA 1KTKA 2IX3A 2F3WA 4W9GA 3P2BA 1R4MB 2QCPX 5CMDA 4HPPA 2VNUD 3IG3A 3J81E 1MJEA 3U30A 3MVVA 3F1ZA 2J4XA 4A3IH 1KAWA 3DBLI 1IW7C 1S5DD 2V0GA 1PFMA 4PMCA 3L16A 3RLFA 1DCZA 1GUAB 2Y5CA 4LLGM 1UWXA 1EYCA 1Q81C 4KHPQ 4P1BC 2FCNA 4BY1B 4K3CA 4BKGA 4HJ9A 1I7HA 1LXDA 1A8VA 3NZ3A 1SFOH 4HCSA 2HDEA 1OFFA 2W9NA 5J18A 3ZJVA 1KIXA 4Y52H 1CK1A 1LGRA 4XX5A 2RMMA 5IN7A 2LGSA 3VUXA 4HTHA 1F1HA 2FJ2A 2VB2X 2KJRA 3A5UA 3F2DA 1QVGA 1P9DU 1Q1OA 1WY8A 2ZTEA 4KSKC 2AMCB 2SNSA 3AYHB 4HJKA 2BTEA 3HOVB 4K81A 3M3YH 5C44G 1BUIC 3DBRB 3KBGA 3VA7A 1IL2A 4PYZA 2MUYA 2KMMA 2PMZE 2JP1A 4DK3C 3NP8A 4DK0A 4XQJA 2F0DA 1KJTA 4N6EB 2EYPA 1PH4A 1WZ3A 3HOUB 2I1KA 5K5PA 3J7ZC 1AN8A 1I6HB 1TY2A 4HKZE 3MEFA 3STBC 4ODGA 2F0IA 4DV5L 3Q8FA 4WQMA 2K0PA 1SRUA 5CHWA 1EY8A 4GMVA 3ONSA 1PZID 5M3MG 2KCNA 2WXNA 2MJEA 4E74A 2B8FA 2YYZA 1F52A 1I4XA 2K5VA 4JYAQ 2KT7A 4ZRPA 4LW1A 1PH8A 4W9EA 2ZJRA 2JA8B 3AB5A 2B63B 3RR5A 2PKOA 4C3IH 4ZHOA 4RGOS 2F0MA 3SE0A 2MHJA 5IGDA 3CCSA 2ZM6L 2K75A 1ZYRD 3I4NB 2D9UA 2CW0D 1EYAA 2NS5A 4P75A 1ZW7A 3AE4B 1ICFB 1YJNA 3L0WB 4ANWA 3GP7A 2JZ3B 2L5TA 4NJ7A 3J7YW 4B3SQ 3AEGB 3QIJA 4QIWB 4FADA 1EQVA 1MGSA 2XIWA 4N8X1 4DV3L 1JORA 4BZAA 3PGZA 2AQ2B 3JC66 1GC7A 2VH2A 1UGJA 1ZYRC 1WSPA 3MC8A 1RDPD 5C0XH 4ARIA 3GD7A 2RF4A 1N6ZA 3D31A 1CHQD 2K5PA 1IBKL 2L7RA 2DY8A 4LAAA 4A90A 2L4NA 2EQSA 4WQOB 4P16A 1JB3A 4OELB 1WM2A 2HUGA 5C3JB 1LT6D 5M3FG 3ONAB 4JG2A 3G71A 1WRDB 4DAMA 2B2WC 3ZJYC 2JYTA 4GOPC 3WAPA 3S17H 1Q0WB 2KA7A 2ALYB 3FP9A 1EIHA 4JL9A 1MG8A 2HJ8A 2J7ZA 2YEPF 5AJ3L 2XNAC 3I2ZA 3OJ3A 4FXCA 1MJCA 3M9BA 3TP6A 5I2YA 3IHPC 4CHKA 4M8MA 2N1WA 2VUMB 2X8XX 4WH4A 5D94A 2PI2A 3DMUA 3PV1A 1T0RC 4AOFA 1EOTA 4IPHA 1X9NA 4BBRH 2Y5PA 2LGXA 4ZRZA 1FD6A 3H7SA 5FR3A 3I4OA 4Y7NH 4IALA 3TEXA 5IAAC 1A6XA 3T1YL 1H95A 3I7FA 2EKIA 3PRPB 3PIO3 3R3OA 2MBEA 2F0FA 3B1LX 1R4NB 2KOXA 3H7PB 4DV2Q 4LUOA 4X65L 2CWPA 4AYBB 1KD1C 4YT0B 2D62A 4B0MA 5DCNA 3AE5B 1ZP0B 5D7GA 1QNUA 1CA6A 1PA6A 1WTVA 3H3VH 2LVQA 4K8JA 1H9JA 2DENB 3OHXC 4JW0A 4LNNA 5DPSA 3U4EG 4LUVA 4Q0FA 4RF1A 3V3XA 3A33B 2M4NA 4GDLA 3IT4B 4A3DG 3TBLD 2G9HD 3M62B 2EXDA 1C4CA 3EFUA 1WX9A 3VR6A 1HTQA 3GTGH 1I50H 2JQRB 2KAJA 3HM6X 2I38A 4AWJA 1FYCA 1UUPA 3AN1A 3FKIG 2WAQB 2UUCL 4W9LA 1E24A 3P20A 1SYGA 2O5IC 5IIFA 5HHDG 2LGIA 1E8WA 4M00A 1TVXA 1OQQA 4C7YA 2PNHA 4AIMA 3A1QA 2EYJA 2N7DA 3A55A 4L1BA 3JW0X 1WCMG 2QMTA 3R2TA 5IODA 3RZOB 5IGGA 1GUWA 1PTOD 4HPLB 2PE6B 1AEXA 2FHTA 4FNFA 3E0JA 2PEAA 4WJOA 2A1AA 3Q6SA 4HWIB 3LDZE 4KIKB 5EE1A 4EKUA 1BUVT 4W9CA 3KLSA 1AFPA 4WWMA 2GLSA 2JWUA 1U4MA 1SNDA 2LFIA 2RD0A 1BNZA 4M0WA 5M5YB 3LJ3A 3W1BA 4A3CG 5BMIA 4A3BG 5L83A 2LUEA 1JWBD 2I07B 1WJNA 1IXRA 3M85A 1IGCA 3HRDD 3QARA 4LJOB 1GOZA 1XX8A 4RKBA 2MJDA 4MGZE 2FINB 4PK1A 1XLOA 3NG0A 2BYVE 2W55A 4JI2L 4IUPA 2CCZA 3H3VI 1K83B 3CRKC 1WTHA 4HLEA 5HG2A 2KDBA 4JI4Q 5CBAE 3RD4A 5CHVC 1R4QB 2AKWB 3S2HB 4LF4Q 1IKLA 4DR6L 3RULA 1H8CA 4YHHQ 1KOTA 2D3CA 3CP0A 1MPEA 1A2TA 1S5BD 5IOIA 2LMCA 1GM5A 3KLRA 3SK5A 5IE8A 2LXJA 1JOQA 1ET9A 2LD9A 3DQVA 5T8IA 3W1YA 3NWSA 3LWEA 5J3BA 3MXNA 2NMQA 1PH9A 3IBEA 4IM2A 2V9HA 1J0GA 4QMGA 3L9AX 5FR6A 5DPWA 1KRTA 3S16H 1EWCA 4E3CA 2O2VB 1RFAA 5JZEB 1LLRD 3GB1A 3BDCA 4G57A 1PFSA 4ZUIA 3PZ7A 4HCEA 4YCVA 1JOOA 4RKLA 4DV4L 3PREA 1BKBA 4KD3A 4DR1Q 1VQPA 3SHQA 3DCGA 2DJGC 3HUIA 3J7AV 4A93H 5KEEA 1T9HA 4FF2A 1M90C 1LFDA 4XDCA 4K8IA 3WAMA 2CFMA 4XT1B 3CF5A 1R4NI 4MGKE 3VR3A 4KGRA 1QKZA 1H9SB 3L08A 1VQGA 2A5UA 1VDZA 2KQ7A 2LFNA 2Q8RE 1F9SA 4BVUC 2WP8J 2YVCA 3DHIC 1YNNC 4MTNA 3S17B 4R4CA 2JA6B 2BF8B 4UDUC 5EQ0A 3DBSA 4KY7A 1L1OB 4L5TA 4YY3L 4DK5A 1FJGQ 1AZQA 2OTJA 4POGA 1UBIA 1V9PA 3VR2A 1EL0A 1FL0A 3I8ZA 5CV9A 2DNCA 1XNRL 3NHEB 3BK1A 1VJKA 4XXEA 2JE6I 1U5KA 1HXYD 1RWSA 4BBRB 3LWUA 2DGYA 4HCPB 1JWAD 2F4IA 3C3LA 2KBNA 3S2DH 2CKHB 2NVTB 2MP1A 2JYEA 3KH0A 1E0ZA 1C48A 1I5FA 2K3UA 3S9WA 3NJTA 2I5LX 3M4OH 3L13A 2N9PC 3RZDB 1UNSA 1WVLA 1MSHA 4DV0L 3DWAA 2KX0A 1YBYA 1IZ6A 1H9KA 1HTPA 2IO1B 5AZFA 2MA9B 3V62A 3MP9A 2UXBQ 2R93H 3AM9A 4AQ7A 1FJGL 2ZTCA 4U673 2JZPA 3H8HA 3PS6A 1WTQA 1YHBA 1TKEA 3ML8A 4A3KB 3NS8A 3WCQA 3BYYB 3WAOA 1CT1D 4A93G 4WAFA 3O65B 2PMVA 2EPBA 3RYTA 2J0TD 2KUMA 2PZUA 3N6RA 4OXPA 4AS1A 2SDFA 4RM8A 1KNAA 4A3IG 4HIKA 4ZRIA 2VZAA 1VQ4A 2F4VL 2AEHA 1IPGA 2X6LA 3PHXB 1GHJA 2CWAA 2WDVB 2Z1CA 4DXFA 1L0YB 4IFDI 5BYRA 1K52A 1SIJA 3RN2A 3TREA 1TWCH 1GD7A 1UELA 1PRTB 3O13A 1I42A 2PIAA 4JV5Q 3TP7A 2XBBC 4XQNA 4R3DA 2Q8TA 3V6CB 2LSSA 1EU4A 2HE7A 4O42A 4R8IA 2JVCA 2ZJDA 1EQTA 2KXJA 2NVYB 5EBDA 5AUIA 1N32Q 1K53A 1PXUA 3CSTA 1PTOF 3GZNB 1S3OA 1HR0W 1XQQA 2LJIA 3R7QA 3IFWB 4L23A 5L95C 1S5FD 5JJIA 4LNKA 2EYHA 2JPHA 4ZOHC 4GGQA 4C7ZA 2K01A 4PZ7A 1YNJD 3PT2B 1XT9B 5E6PA 4HK2A 4A93B 1VF7A 1HUMA 3Q24A 1R4MI 5HY6A 3SGIA 3HOYH 2DAJA 1CHPD 3R93A 1ASZA 2PCFB 3ML9A 1SJED 1MHHE 2KOLA 4W9KA 1IYVA 4A3IB 2E2IH 4A3KH 3OTOQ 1WWTA 3L2PA 1SGHA 1V8CA 4A3MH 1KFYB 4B6WA 4XYOA 3RZFA 1G2TA 2YU9H 4DR2Q 4JI6Q 4NXMQ 2LMCB 2Q2HA 3GTQH 4ICUA 3M3JA 5I4DA 4KN4C 5G3LD 1C3TA 2J0MA 1Q90A 4LK0M 2A68C 2UXDL 3SR1A 4LDTB 1VQ5A 3AE8B 2N49A 3QIAA 2QILA 2F0PA 4K7SA 3OSOA 1VZ8A 2Y0SG 4IQZA 1OXSC 3ZUNA 1KF6B 2CVRA 4DR3L 1KLGD 3D4DA 3ERSX 4H2AA 1L0XB 3M3YB 2KANA 2WXHA 3KYDD 3BWUD 2JEBI 1K51A 2VY3A 3B0AA 3J7AF 2B2YC 1C79A 2QEXA 3CMAA 3T3NA 4EOYA 4CDFC 3C1FA 2IWHA 1OXVA 4BXXH 1JCKB 2XTIA 3STBD 2N7EA 4M0WB 4LFAL 3LGJA 1RKNA 3VH4B 3VHTC 1H9SA 3TDQA 3RZDH 1SEBD 5D6JB 5DM63 4JOIC 5TSSA 2I1JA 1KDBA 2DY7A 1WR1A 1C76A 1YITA 2O5JC 3Q23A 4WJPA 2NVXH 3TJPA 1CUKA 3JVZX 3A8KE 1SYBA 4H0LC 1F2RC 3M7GA 1STBA 5EPLA 3ZXVA 4A3MG 5C23A 1BBUA 5LMNL 1Y1VB 3H15A 3FILA 2UUAL 1MIUA 1E0BA 1WMHA 3Q8CA 2C9OA 3PIP3 3W5VB 1YJIA 2A6HD 1CA5A 1B50A 3NRZA 2DBYA 2BOSA 5A35A 2BH2A 3AEBB 4O2DA 2EXZA 4XTCS 4A76A 1BCPD 2X69A 4KSLC 1TS5A 3S2AA 5C3WA 2BWES 5JOBA 1E3PA 2VZKD 3K6OA 4GN5A 3W2DA 4DF7A 3EIVA 1F77A 3KUCB 4DHZE 3DWGC 1KAAA 1N33Q 1WGYA 1EUJA 4H44C 3GQBA 5KNBA 1RD9D 3T4AC 5FJ8G 1O7ZA 2R92B 1JJGA 3K58A 2MSED 3L54A 3P4RB 4XWWA 3FDTA 1QF6A 4OW0A 1MSGA 4LFBQ 2L0FA 4WIPA 3N9YC 4IWQA 3PUXA 1YI2A 3X0WA 1I4QA 4LF5Q 4POFA 1NDDA 4PZ8A 4A3JH 1UE1A 4DV6Q 1S1QB 4YWMA 3CPWA 2KFKB 4DR5Q 4OZAA 3CWIA 4N9PA 1K0SA 1K3RA 1UZXB 2R3ZA 5KHOA 4NJ6A 3A9JB 3KOJA 4CDEC 2INCC 1PH3A 2NPTB 1DYQA 5C4HA 3U50C 3NTIA 2F0OA 3FHWA 2WIIB 5E6NA 4WORA 3HOXH 4N9F4 4KGTA 2BGFA 2QGQA 3UINB 4LK1C 2DN8A 5BN5A 4BOZB 1V49A 1D5MC 2KENA 1NJIC 1DZ1A 2QKIC 2N8NA 1WGRA 2AWTA 1AARA 3QQ8B 1HUNA 3V6EB 4IOAA 2A68D 2BS4B 1XCTL 3A8IE 2E8GA 3I4NH 3FC4A 4NXML 2LRUA 3Q8BA 1GAQB 4EZJA 4K5VA 4W9JA 3HK0A 4W9IA 3D0FA 4TKNA 5C2TB 2M17A 2I2YA 3S1NB 3J80i 3U9OA 3TN2A 3BVGA 5IT9E 1ZGUB 2Q2IA 2GBJA 2IL8A 3RNAC 4II2B 1EZ8A 4GKJL 3U2SC 3RNCC 1GUSA 2HT1A 4DV6L 2C5LC 1XMQQ 3A9KB 5E3FA 2L00B 2D0PA 1YEZA 2XRQD 3FEWX 3MXNB 1HZ9A 4PG3A 2VZKB 2R92G 3CW2C 2B2VA 2OJWA 4O0AA 2C7MB 2DNFA 4M02A 3APDA 4MELA 1Q86C 4DAPA 1CKNA 3N3KB 3ZJUA 3X23A 3N32A 4EFOA 5D65A 4ZK9B 2MBQA 2K03A 2V3SA 2IJ0A 1STEA 3A9JA 1IHZA 3IT6B 1WJ6A 3N20C 2G4SA 3OPOA 5JHAA 3PO3G 5G2NA 4BY7B 5E7NA 3AXCA 2N7JA 2IPKD 3HOXG 1BBWA 3EQLC 1EU3A 1I50B 3I3CA 2CU3A 4C2MH 3V2TA 1CJEA 3ZRCA 2FFKB 3E9SA 2L0TA 1RCVD 5EBCA 3AE3B 3A7LA 1SF0A 2IO2B 1TJEA 5I2XA 3P1HA 3VQIA 1E8YA 4X62Q 3IVFA 2UUAQ 5EKLA 1NENB 4GLVB 3UQBA 2KLCA 1PRTD 3OWEB 1C9OA 2RCFA 2RKSA 4X3KA 1A2UA 1RLFA 2KACA 4IW0A 3K5OA 3K0XA 3T3OA 2A74C 4A3EG 1TU2B 5IWAL 2K33A 1BBXC 2CU1A 2DYOA 3F2BA 4Z9CB 4C3IG 1GJZA 1RJTA 2HIVA 4DUZL 2WV6D 4NQLB 2IX1A 4P2CB 3BY4B 4KY5A 1TZOA 3A8JE 4LF6Q 4EE2A 4R8NA 2CH4W 3MXGA 2B2UC 1BO0A 1PH1A 4GN1A 4AUQC 4R4QA 3MXPA 2KQ3A 4KHZA 2D3BA 4D2KA 3ULPA 4A6QA 1N63A 3KDFA 2LXAA 5C4JB 4IWPA 1I3QB 1SE3A 1Y8PB 2E75C 1EIGA 1I6HH 1VZ6A 1XO3A 1L1OA 2K6AA 4F7XA 2BKRB 4ZHPA 4FF3A 5T1GA 4QQBX 4ZRKA 2N3SA 3PMFA 2B2UA 3D32A 4LJZC 3RUZA 2QCZA 1X3EA 2JRHA 1Q1BA 3CCQA 3RPFC 1MKHA 2J53A 2G1EA 2V1CC 1S5ED 2JA9A 3LX0A 2V3PA 4MSQB 4NDXA 1V81A 3M4QA 3R2IA 1N33L 1O7LA 5IYCH 2UU9Q 1WTOA 2GBNA 3ZXRA 2LJ5A 4K6LA 3PRMB 4FO2A 1SIFA 1WXAA 3U9SA 5F2DA 1V1PA 2TMPA 4HDQA 4DV1L 4UY8C 1MBYA 4W9DA 2H89B 5H1SE 3E9HA 2CHWA 2MQJA 4W9HA 3Q8EA 4NZLB 2Q5WD 1DOLA 2RSNA 3HOWH 1JRPA 3RMHA 1SE4A 4IDIA 3I4NG 1UWVA 4K3BA 4A9AA 3OWFA 5HKHA 1OQRA 5FLMH 1K8AC 3C1EA 3ULLA 3I4MB 2XGTA 1L7YA 2H88B 1HNXQ 3AE1B 3H6NA 3T16A 4DV4Q 2Y0SE 4GU2A 4K6DA 2KMAA 1SE9A 2BYTA 2E2DC 3NEMA 2F1MA 4GNXA 2NVQB 5C0XI 4MEMA 2WKDA 1JJCB 3OW7A 1YJWA 1RL2A 4HN7A 4BBSG 1VS0A 1QOFA 4IM3A 1U4RA 3SD5A 3BDLA 4DKAC 1RODA 4DHJD 2D5DA 5JJZA 2L15A 3CQZH 3A0JA 3K57A 1V5OA 2WP9B 3S1NH 1L6UA 2DZMA 2KDEB 3NVZA 3HOUH 2F0JA 1DD2A 2AL3A 2F3IA 4OVUA 1SSNA 4RGMA 1EY4A 2YV5A 1K0RA 1G291 1A62A 2GA4B 2G5DA 4IPCA 1RHPA 1AYFA 4FULA 2ZXOA 4C1NK 4GKKL 1QOHA 2QC8A 2K5HA 4IPDA 3K5NA 2E2IB 1KRHA 2K5WA 2ACZB 2K6DB 3NS1A 1LABA 1Z5SB 2HQEA 2JA8H 3TZDA 5C4JH 2LVPA 1NVID 4XQQA 2KDIA 2VUMG 4ANUA 3Q3OC 4GLSC 4DAVA 4G7ZC 1D2BA 4F7ZA 5LMNQ 3T9LA 3H9DA 4WWPA 4YSXB 3Q8DA 1D6EC 5C3EH 1TT5B 1WJUA 2BWFA 4XZ4A 3BK2A 4RHRA 2LGYA 4R4IA 1VMCA 2B8GA 1DJRD 4DQOC 1C4QA 5C3XA 2VQEL 3Q69A 3ND8A 1K50A 3HOZH 2KWVB 1E7PB 2KZRA 1HQMC 3WALA 2KEEA 3NTKA 4TUUA 3GV3A 3KWLA 1K8GA 1LTGD 3FVQA 3T56B 1VRAB 3CIRB 4AYBG 2CQAA 4A3BH 1Q5WB 3GTKB 1HA6A 4BBNF 3ZNZB 3PLUA 2ZT9C 5DEHA 4DV2L 4R4TA 4QUCA 4HIMA 3M4OB 2NN6I 5CGKA 3VXWA 5BYSA 2G9DA 4YSZB 3BZDB 3UE1A 2ZZPB 2EYLA 1J7BA 2MEKA 1H9MA 2FAZA 2A6HC 2IGHA 3DM1A 3NK9A 1SSOA 3S15H 2WACA 3KLSX 3CC7A 2QW7A 1TIID 2FNJB 1WD0A 2A6ED 1PGBA 5HGTA 1JALA 2XRSD 1QT9A 2D10A 5FKAC 1DGSA 4IUTA 4L5RC 2Q2TA 4ABNA 3EJIA 3HM3A 2INDC 3VVWB 4FVMA 3FILB 1KH0A 3VA5A 4KJOA 4HPMB 1JQ4A 2ZNVC 4FDBA 2B2VC 4FXDA 1YQ3B 2JA8G 1HTOA 1NBWA 4IJLA 3L17A 3SFDB 1FNUA 3JSVB 4ZCKA 4QF4A 2WS3B 3PGEA 3QWZB 1STNA 2HDMA 2JA7B 4KVGB 1SAPA 4R9WA 1T6BX 4RCOA 2HDLA 1EY6A 5CV8A 1YHQA 2PZWA 1N36L 2JA5B 4LCDE 1EM7A 1X3PA 3BVMA 4MNOA 1VQDA 1WE6A 3G4SA 1T5EA 2AUKA 4PS7A 1SXTA 2M2LA 2VQFQ 4NW2A 5C0XG 2RDGA 3HOWG 1ML0D 1TWHH 4FF4A 1Z6HA 4DAYA 2C60A 1MI2A 3AE6B 3CQZB 4DV7Q 3HOZG 1NYQA 3QR8A 3Q22A 2PJHA 3C0RB 3DHGC 3AEEB 2LKVA 4ARCA 5JH5C 3GE3C 1SNOA 1MG4A 3V05A 4DV5Q 1KQSA 2Z4HA 1PDQA 1I94Q 4A3PA 4DNRB 3PV0A 4B9WA 2BA0A 1V2YA 1LYLA 2JF5A 4IPGA 3ZTCA 4A3EB 3CHBD 4B3TQ 1L2FA 3QC8B 4Q2JA 2E3TA 3RNFC 2K39A 3J81c 1OQYA 4KDIC 2XWJB 3N30A 5GAEC 3AE9B 4DDGD 1YD8U 2FIDA 3Q3JA 3RNBC 3BYTB 4P72A 4HJ7A 3JAME 1EEFD 1QUQA 4E6IA 1SNPA 4JCVE 5FJ8H 1LM8B 2IGGA 4US9A 1BT0A 5J39A 2L8JA 1QOAA 3TEWA 4I7ZC 1CQFA 1I4GA 3HG9A 3CMMB 5M5XH 2X6GA 1TY0A 3AFPA 2OTLA 3EUB2 2KYWA 4OGQC 4LFCL 1GPXA 3E3XA 1Q7YC 2WU2B 4X6AH 2BT6A 1K8OA 4MSMB 3FMCA 2H1EA 2EYOA 3IAM1 2JQOA 3NY5A 3CCEA 4KHPL 1TWAB 3R7RA 1XYIA 4MDKE 2Z9HA 3B2GA 3ZDMC 4HEA1 4R4OA 3AU5A 1ENCA 1F9JA 1TZ1A 1ENFA 1N32L 3RN9C 3GTKH 1FFVA 2LS01 3HS0C 5BMHA 3U7DA 2NCNA 2AQ3B 3JAMi 3VDYA 2BDOA 3HP3A 2JA5G 3ND9A 2NVXB 3NZUA 4JX1C 2DJFC 2JSOA 1B4OA 5G55A 3SU8X 4A3OA 2LUMA 4PNYA 2K22A 3Q2AC 4OVVA 2B2WA 2LRWA 1TKYA 4DUYQ 4MACA 2ID0A 3EFXD 1QZGA 1N36Q 5EKKA 1RFKA 3SK8A 4FXGC 3RFZB 2PZTA 1TXYA 1VQNA 3WANA 1M8AA 2PQEA 4B0EA 1CKOA 4NY0A 2WXLA 5JAVA 3RNGC 4ZYNA 3Q0AA 2F0GA 1W3SA 3HFZB 4L8JA 3KUZA 3C46A 4GXBA 4CDDC 5FLXL 4JBKA 3CF6E 5EJWA 3HVDA 2JA6G 1QILA 4DWFA 1ONLA 4HIOA 4DDID 1Y1WB 5LLIA 1U9RA 4RAUC 4DUZQ 2RPVA 4C56C 4BKSA 3W9CB 4IM0A 4JOIA 1J7CA 3Q3FA 4XT3B 3C19A 2E2JH 2LZ6A 1BCPC 3K59A 4A3KG 1YJJA 2F0TA 1VQLA 3U4ZA 4L6TB 2MHVA 1NCVA 4EGVA 1MI0A 3GTJB 3MHZA 5EE9A 1S40A 1IYFA 4S3SA 4C2MB 4JI0Q 4B9KA 1SYFA 1JW9D 4ZRJA 2XN9C 3V60A 4MIUA 1SFOB 1ZDXA 2B3GA 3QO2A 4X64L 1M4VA 2MPMA 5IGEA 1N62A 4DR7L 1HE8A 1W6JA 2OQ0A 3GOEA 4US8A 4A3BB 2B63G 2ZW0A 2FCSA 1WGHA 1SNMA 1HQRD 4M8NA 1JC7A 2K05A 4OX9L 4GIVA 4I6LB 1WCMB 4G7HC 1YIJA 3ZTDA 1E6EB 2GB1A 1J9OA 1E8XA 3CU7A 4WJNA 3SFEB 4AJWA 3PSIA 2GMIC 4CQNA 1Y1WG 4XIGS 3ZNHB 1WIAA 4BWGB 1IW7D 2NZOA 2NWGA 1KM7A 2FMMA 5IT9L 4GNXC 5DNFA 1TWGB 3D6CA 4C3HH 1IBLL 3S2DB 2YEPB 1TIFA 1FXIA 4LFCQ 3P1MA 4V190 2AYOB 4LJPB 2WU5B 2SEBD 3JAMc 4AQYQ 2JA6H 3VR5A 1A70A 3QAQA 3QJZA 5D2MB 5FLXE 3ZJTA 3ZVVA 3BU2A 2UUCQ 1VMPA 5ELNA 4CJ1B 2NBVB 1HJPA 5NUCA 4ZKBB 1PTOH 3QOLA 5KYLA 5M3FB 2OWOA 1KL9A 4LNQA 4BAXA 1XXGA 1E7UA 1WYGA 1RM6C 1DXMA 1V43A 2FCQA 2L0CA 2PYKA 2D0OA 2TSSA 2GI9A 2ZVOA 4LFBL 2IO3B 5I6YA 1YJ9A 1G2SA 1X55A 1OEYJ 5JHBA 3PQIA 3A54A 3H91A 3SXHA 2B3AA 2L76A 1K28A 3DEPA 2EY1A 4BY7H 4CBVA 5AJ3Q 4MGYE 2LGDA 3MZ5A 2N9LA 1F9QA 2KN4A 1HR0Q 3R66C 4YTPB 1UE5A 5KHQA 4GDKB 2J52A 1K3BC 4JWUC 2BYFA 1PFNA 4DR6Q 3P75A 2EJGC 4AYBE 1LQBA 3IRBA 5FOBB 2IHEA 3HKSA 4FP5D 3CCLA 1JQYD 1QG7A 2VH1A 5IYBG 4IUUA 3G48A
chains in the Genus database with same CATH topology
3OIPA 1LT5D 2HCCA 1CZGA 4NKLA 1QE6A 2RDHA 4C3HG 2NN6H 2R61A 2ICEC 4KK7A 2N0SB 1B9MA 1PGAA 2WNMA 1HZ5A 2JYOA 2XVSA 4XDXA 4IKGA 2ONQA 4XDDA 5FO9B 3TZUA 5DM73 1FNWA 3I57A 3GO5A 5CORA 4PMWA 4ME5A 5K36G 1G6ZA 5G3LF 4NP5A 2O4XA 5KIXA 3NWTA 3MFGA 1T5XD 4JWSC 1LV9A 4K5WA 3GTGB 2PTLA 1XTCD 3CRLC 4YXDB 5IGFA 4CKCA 3L3OC 2AWOA 3FPPA 4G7OC 3E5SA 4RNAA 3PUVA 2F0WA 3GTOB 2KDMA 1D1IA 3F2UA 3AEFB 2F0KA 1Q3LA 5E4WC 3I91A 4ZRQA 4QB4A 4O1NA 1FIQA 5C4ZA 1SE2A 5AUKA 2FE8A 1E2VA 1PZKD 3I70A 1ICWA 4BA1I 4ID6A 2BA1A 3VR4A 4TRDA 2NB0A 4OIKA 4N58A 2NBFA 1C4AA 2WXQA 4I65A 1PZJD 3SDZA 3VYRA 1GXDC 5KNDA 1AW7A 5IGCA 1YN5A 2QSDA 5ISRA 1W6KA 4IZ8A 2INNE 1NR4A 4DU9A 4RFBA 2F0LA 4KMUC 1U4PA 2QJLA 4JBWA 3D4WA 3IFDA 4A55A 2J42A 1FXAA 3B2FA 1VF5C 4BS9A 2V3NA 5H8YE 3UI3A 2CHBD 3SK6A 4RH6A 1ZDVA 2W3RA 3ABVB 3P4SB 1WTXA 2L55A 2WINB 3HKZB 4MHEA 2K32A 1LT3D 1SBBB 2KCCA 2WXFA 5CBEE 3I4LA 5E1FA 1FRDA 4WRDA 1L4ZB 1GB1A 2MJ8A 1C8CA 4HAEA 1CI3M 2K28A 2E76C 5FO8B 2M00A 4J8QA 3HGBA 1HFGA 5J22A 2WDQB 1JWUD 3P4QB 3NQTA 1KABA 1DM0B 2PLPA 1ESFA 2L32A 4RCNA 5CR3A 1ET6A 1OXTA 1XF5L 3D4RA 3NSWA 4XYQA 3LNNA 1YNJC 4RGNA 4GZYC 1QQRA 4HSPA 3ZQ4A 1U4LA 1WTRA 1N61A 2XWBB 2F03A 1QNKA 1FCLA 2IT1A 4J1MA 3GV6A 3T13A 1CQVA 1LTAD 4X3TA 1H9RA 4LMQD 1JMLA 5FK9C 2K5DA 4HKQA 1UWMA 1DOYA 3JAML 1OO9B 1JWMD 1TT2A 5CC4A 2WXMA 1EZ6A 5JEAH 3OMCA 5I6WA 5H92C 3I73A 3H3VC 1DOMA 3OOCA 2JSVX 4XE0A 5IGBA 4RA8A 4IUNA 4EQNA 1C78A 2WXJA 2L1BA 3AE7B 4LTUA 1BCPB 3S1QB 2LHEA 1QB5D 3FPUB 1EEID 4ZKCB 4KV6A 4TQ1A 5BN4A 4UAIA 3MHBA 4TKOB 1IL8A 4PT5A 1A15A 4G4KA 2YU9B 3PUWA 2H4OA 2NYZD 1GUGA 1PGXA 5C44B 1Z7TA 2Y0SB 3S14B 1TKGA 3AV8A 3IAS1 1WRIA 3U2SC 3MEHA 3BS1A 3KK7A 1VDVA 3SVMA 1J7AA 3BVZA 3DEOA 3NTHA 2X38A 2L9HA 1SDFA 3K5LA 2DYMA 2FBWB 5CV5A 1SMYC 2WXRA 5C4XB 1DONA 1VCIA 1B3AA 1R4PB 1V97A 3LB8C 3DHQA 5JEAG 5EPKA 1HHVA 1NEKB 1SYDA 2RA4A 2EJMA 4OL7A 4DN4M 3TEZA 2PPBC 4OO1H 1HRJA 2WXKA 2A5HA 1PTOB 1PDXA 4A3MB 1B1ZA 2KECA 1PMRA 1TS4A 2BW2A 1N5WA 4JPSA 5FO7B 2B2TA 3GTLB 3E6ZX 4KHVA 1O7YA 3PO2B 2NTSA 5ELEA 2M19A 2L12A 3H0GB 3TUOA 2E2JB 4WURA 1NI3A 2M56B 2WXIA 4A8XC 4RF0A 3DXJC 1B53A 1PFBA 3AB9A 4Q5VA 5CV7A 4X3SA 5ELBA 4B9XA 5LNK1 2B39A 4Y7NB 4ILWA 1ZXIA 1II3A 4PMBA 2KJXA 2EZVA 2E6XA 2ENBA 1UAPA 1GHKA 1K8MA 3KQ4A 3URYA 1QWYA 2LEKA 4NZLB 1OXUA 3LXFA 1GUOA 1F2LA 2B76B 1VR9A 1IBXB 1R9TB 4KKJA 3SEBA 3NVVA 3EROA 1ZE3D 3E56A 1Y69U 1JE4A 5EKIA 1XEEA 3D8GA 2L11A 3GTPB 3M4YA 3K5MA 1DOXA 3HOZB 3J9CA 4F87A 3Q8AA 4NAMA 3DWMA 5LHY1 2D5GA 2NTTA 3D3RA 4XWTA 4CKEA 1FD7D 1XLPA 4H13C 3KUPA 2F0UA 5M3MB 4DXGA 3N52A 3R8BA 2BBCA 1UEAB 3L7ZC 1D1KA 2D2CC 2IX0A 1D5ZC 5JPMC 3AH7A 1L0VB 1R7SA 3WOEA 3X3MA 1PFDA 1FMAD 1EWHA 3TEYA 4ITKA 1BQQT 2BE5D 2L83A 1XLQA 1Y8NB 5I9PA 1ROEA 5G5GA 1SB3C 2K7VA 4L2YA 1IBXA 1C77A 2BS2B 4J6HA 1LO5D 2CJNA 3P63A 1MD2D 3M7NA 2O2LD 3J80E 1PTOC 5BMGA 4C3IB 2SOBA 1DGJA 4V0BA 4K14A 1E2WA 1STYA 3ITPA 1NUCA 4KJNA 1O80A 4QCLA 4HROA 4RHSA 1YN3A 1FGBD 5BN3A 5C0XJ 1HZ6A 3P42A 4YWGG 1BXTA 2N9KA 3MAQA 3A56A 4A3JB 1JWSD 1NSNS 4C80A 2E2HB 4KY6A 2RVLA 3GS2A 1FFUA 1YNTE 2OHFA 1RTOA 2RDFA 2EDGA 1Q1EA 3AEAB 1LTID 1A3VA 1FM0D 4CKBA 1WTPA 2KQ4X 1WTWA 2LHDA 1AZPA 1PRTC 2VB3X 1RYJA 2B2YA 2DLBA 3VYSA 4MM3B 4TQ0A 2NN6G 1SMYD 4ZAIA 2F3VA 2R93B 5JXVA 5JPNC 4OZCA 4YTMB 5KNCA 2F0HA 1TQOA 4IUVA 5JVH3 1VZ7A 3MA2B 1I4HA 3GTMB 3HRZC 4EQPA 2SAKA 2E74C 2WXOA 4FYDA 1FNVA 2I46A 5ELFA 2INPE 1EY7A 1TS3A 2K1BA 3FAHA 3J80L 3W5UB 2M0AA 2LY7A 2AUJD 1J8IA 3NVWA 5JEAJ 3I90A 2IGDA 4DA2A 2CW0C 2WLBA 3PUZA 4HJGE 4DK1A 4ULLA 2K5QA 4MH8A 2OF1A 2A73B 5IOCA 2OEOA 1GUNA 5HI1A 3BIID 1EY9A 1TWCB 4RGTA 2EELA 3AEDB 5BYQA 3D6WA 4IURA 4IUQA 3MTSA 3PZ8A 1RTNA 3KF8A 1HA5A 1HEZE 1L4DB 1NYRA 4MT5A 1ILPA 1MHXA 4NMZA 1ZUD2 4REZA 4ZYSA 3DWPA 2BE5C 2OXPA 1HFNA 3ETRA 2JXMB 1HPCA 3PO0A 3BDOA 3NUCA 5CV4A 2PVOD 3K7AB 3QOJA 1OXXK 4KKTA 1S4ZA 5KRUA 4KKSA 3TP5A 1PRTF 3QWNA 2BB6A 3QB3A 3QJYA 3OIQA 2ZXRA 4P6VF 4FF1A 5D3DA 1N60A 4DNTB 1JROA 1D5XC 3U7ZA 5HFYA 2PVGC 2N88A 1ENAA 1G8ZD 1ZOYB 1CFMA 5LL6X 1EY5A 1A3UA 1SYEA 2EVBA 2WXGA 1FCCC 1N5XA 1X32A 5E4XA 3B9JA 1Q8IA 2MJ3A 4U68A 3H6MA 2NUCA 2XSCA 4M8AA 3MJ5A 1S5CD 3X3NA 4HMJA 1PUTA 2EY6A 4IOIE 2FMCA 4K2KA 3AECB 2K04A 3W3AA 3DUZA 2PW7A 1KLUD 3UI2A 4WJWA 4K5XA 1ZEQX 3NQIA 4TQUS 1DOKA 5EGTA 3NVYA 1MVKA 5CYUA 4HR7B 1FRRA 4NAWB 3NPPA 4A3DB 5HURA 2EOTA 1KDCA 2Y3AA 1YN4A 1L5PA 3FKIB 2MH7A 5COYA 3SK4A 1F2MA 1CTMA 4ZUJA 3NE5B 3I72A 4C1NI 3NBIA 3K0YA 1XWEA 5D14A 5A2QE 4OZBA 2PNRC 2BCOA 1Z47A 1QOGA 3ZGZA 5EE0A 5G5HA 1T3QA 1STAA 4X3UA 2QIEB 1VLBA 3EGRA 2PW5A 2EYMA 1NR2A 3OMGA 1F9PA 1JICA 1QCBD 3ZYYX 2KVMA 3HEJA 4HRSA 1GUTA 2B2TC 3VR9B 2F0QA 1EYDA 1SNQA 3HOYB 1G91A 3WDNA 1P7EA 2BB5A 4L63B 2IDYA 2KWDA 1B9NA 1XCQL 3PUYA 5I9OA 2V4DA 3HZXA 1E9MA 4CJ0B 1B9RA 4C3JG 4F88A 3G6JB 2JU6X 1F2RI 2F0SA 1LTBD 1EFID 4DGZA 3C2PA 1HTLD 5LL6S 1B44D 2KHSA 3GTQB 1F0ZA 1SYCA 2R6GA 2PO4A 5KGUA 1B2TA 4KN7C 4HMIA 4OIJA 3U52E 1EWYC 1E2ZA 4N9TA 4DFAA 5T1IA 1STHA 2RQXA 2PMZB 3BG3A 1P7FA 1RF2D 4IFDJ 2OEDA 2Z4IA 1V8QA 3PO3B 3V96A 1C9FA 2C5CA 4FXKC 2L1AA 4CGYB 1QOBA 2WQYB 5EPJA 2A69D 1WGKA 2QEJC 4HSVA 4N59A 4IN3A 1IKMA 4KKIA 4OO1G 1LT4D 4KKUA 1GB4A 1PLFA 3VYUA 3L4PA 4KTAA 2OT2A 1CZWA 4C3JB 4J3OD 1L6VA 1PYWD 3P4PB 1CM9A 4IFDH 3AMUA 1AWDA 3P7JA 4USAA 2EJFC 2F0EA 1BMLC 4C3HB 5A2QL 5C3EB 3MC0B 3IXSA 2Z8LA 1BOSA 1BCPF 1ZXTA 1BDOA 1LTSD 5J1ZA 2EYFA 5GXGB 4KX6B 2WDRB 1TKWB 5M5WB 1ESRA 3KWVA 1TYGB 3TBIB 4CJ2C 1YNND 1ZKOA 2EY2A 5ELDA 2RSOA 3VYTA 1LTTD 1GJXA 2DNEA 4RWSC 3W1SA 4H7BA 3SHLA 3C8YA 5CV6A 4YTNB 1X3QA 2VXWA 2L52A 3FRPB 4KGSA 1STGA 5D3IB 3IFTA 4OHJA 3EVQA 2ZXPA 4B08A 1O78A 3VR8B 2KEDA 2NZ1D 3S16B 1I4PA 2EE1A 4MN3A 1Y8OB 1SJHD 4IFDG 3T51B 2IW3A 1DOIA 2JX5A 4A3FB 2N55A 4QUFA 2SNMA 1QLBB 1F9RA 3DWQA 3I9V1 4BBSB 1YQ4B 2JEAI 1LTRD 1Y56A 2FUG1 4GDLB 3H94A 5EE3A 1F2ZA 1LACA 1I6VC 3MWYW 4F8MA 5E6JA 3HOXB 4CHTB 1Q10A 1IUEA 1ZXHA 1FEHA 5AFWA 2ZW1A 1ILQA 3H09A 3IKJA 1I4RA 2BDNA 1CZPA 3NUHB 1BF4A 5JVG3 2V4IB 1JOKA 1Q12A 1V1OA 4M1UB 2A69C 4A3GB 4YIJA 1NAPA 5C5LA 4JE3B 2QDBA 3VRAB 1SNCA 3NXWA 3NHHA 3G7LA 3AU7A 1EY0A 1F2YA 2QF7A 1D4BA 1TWHB 2AQ1B 2EY5A 1FR3A 3WOFA 4KD4A 3S1MB 4OVZA 2WXPA 2Q8IB 1FO4A 2PW9A 3S15B 2W82A 2DWQA 1ACCA 1KDAA 3ERQA 1ZPSA 2W54A 1A3TA 3IL8A 3SR6A 4ZQ3A 3TSSA 3MXUA 4NJCA 4EQOA 2WB1B 4HEDA 3NBHA 1WD1A 4TMAB 1XLNA 1C4PA 2M9VA 2ON8A 5K36H 2CJOA 4EVOA 3QG1A 3S1RB 3TP8A 1HCZA 1V1PB 2HCIA 2R7ZB 1TR5A 4ZLTF 1TWFB 5C5MA 2F0NA 1KNEA 5DAUA 3A7AB 2HTME 3CKIB 4WFN3 4PQXA 3IAYA 5KYIA 5M9OA 4BA2I 1IYUA 2F0VA 3HOWB 5M5XB 2GRIA 1BR9A 2BS3B 3J81L 2AWNA 3T53B 1TS2A 2RBMA 4OO1I 3VRBB 2JXTA 5C6AA 1IGDA 4JK1C 1WXQA 4YSYB 2W3SA 3EA6A 2ICIA 1AP0A 2MGSA 2K9XA 4PV1C 5ELCA 5MPOA 4K2LA 3HVZA 3MFYA 2WKCA 4TSSA 3AE2B 3LYYA 4KI0A 2A6EC 2AX5A 3AMZA 1YMHE 1JR0D 3TMEA 1QJOA 1E10A 3KBXA 1KTKA 2IX3A 2F3WA 2QCPX 5CMDA 2VNUD 3J81E 3MVVA 2J4XA 1IW7C 1S5DD 2V0GA 1PFMA 4PMCA 3RLFA 1DCZA 2Y5CA 4LLGM 1UWXA 1EYCA 4BY1B 1I7HA 3NZ3A 4HCSA 2HDEA 1OFFA 3ZJVA 1CK1A 2RMMA 4HTHA 2FJ2A 2VB2X 2SNSA 2BTEA 3HOVB 1BUIC 3KBGA 3VA7A 2MUYA 2KMMA 2JP1A 3NP8A 4DK0A 4XQJA 2F0DA 4N6EB 2EYPA 3HOUB 5K5PA 1AN8A 1I6HB 1TY2A 4HKZE 4ODGA 2F0IA 3Q8FA 4WQMA 2K0PA 1EY8A 1PZID 2WXNA 2KCNA 2MJEA 2B8FA 2YYZA 1I4XA 4ZRPA 2JA8B 3AB5A 2B63B 2PKOA 4ZHOA 4RGOS 2F0MA 3SE0A 5IGDA 3I4NB 1ZYRD 2D9UA 2CW0D 1EYAA 3AE4B 3GP7A 2L5TA 3J7YW 3AEGB 4QIWB 1EQVA 1MGSA 2XIWA 1JORA 2AQ2B 1UGJA 1ZYRC 1WSPA 4ARIA 1RDPD 5C0XH 3GD7A 3D31A 1CHQD 2K5PA 4A90A 2DY8A 4LAAA 2L4NA 4P16A 1JB3A 2HUGA 5C3JB 1LT6D 3ONAB 2B2WC 2JYTA 2KA7A 1EIHA 2J7ZA 2YEPF 2XNAC 4FXCA 3TP6A 5I2YA 2VUMB 4WH4A 3DMUA 1EOTA 2Y5PA 4ZRZA 1FD6A 5FR3A 4IALA 3TEXA 1A6XA 2EKIA 3PIO3 3R3OA 2F0FA 4AYBB 4YT0B 2D62A 4B0MA 3AE5B 1ZP0B 5D7GA 1QNUA 1CA6A 1WTVA 4K8JA 1H9JA 3OHXC 3U4EG 4Q0FA 4RF1A 3V3XA 3IT4B 2G9HD 1C4CA 3VR6A 2JQRB 2KAJA 2I38A 1FYCA 1UUPA 3AN1A 2WAQB 3P20A 1SYGA 2O5IC 5IIFA 5HHDG 2LGIA 1TVXA 1OQQA 4C7YA 2EYJA 4L1BA 3A55A 2QMTA 3R2TA 5IODA 3RZOB 5IGGA 1GUWA 1PTOD 1AEXA 2FHTA 4FNFA 3E0JA 3Q6SA 5EE1A 1BUVT 3KLSA 1AFPA 4WWMA 2LFIA 2JWUA 1U4MA 1SNDA 1BNZA 4M0WA 5M5YB 5BMIA 3HRDD 1JWBD 2I07B 4OW0A 3M85A 1IGCA 1GOZA 1XX8A 4RKBA 2MJDA 2FINB 1XLOA 2W55A 4IUPA 1K83B 3CRKC 5HG2A 5CBAE 3RD4A 1R4QB 3S2HB 1IKLA 1MPEA 1A2TA 1S5BD 2LMCA 3KLRA 3SK5A 1JOQA 1ET9A 5T8IA 3NWSA 3LWEA 3MXNA 2NMQA 4QMGA 3L9AX 1EWCA 1LLRD 3GB1A 3BDCA 4G57A 4ZUIA 3PZ7A 4HCEA 1JOOA 4RKLA 4KD3A 3HUIA 3J7AV 5KEEA 4FF2A 4XDCA 4K8IA 4XT1B 3VR3A 4KGRA 1QKZA 1H9SB 1VDZA 2LFNA 2Q8RE 1F9SA 2WP8J 1YNNC 3S17B 2JA6B 4UDUC 5EQ0A 4KY7A 1AZQA 1EL0A 3VR2A 3I8ZA 5CV9A 2DNCA 3BK1A 1VJKA 4XXEA 2JE6I 1HXYD 1RWSA 4BBRB 3LWUA 1JWAD 2F4IA 3C3LA 1E0ZA 2JYEA 2NVTB 2MP1A 1C48A 2K3UA 3S9WA 3RZDB 1UNSA 1WVLA 1MSHA 3DWAA 1H9KA 1HTPA 4AQ7A 3MP9A 3AM9A 3H8HA 4U673 2JZPA 1WTQA 1TKEA 4A3KB 3WCQA 3BYYB 1CT1D 4WAFA 2PMVA 2EPBA 2J0TD 2KUMA 2PZUA 3N6RA 4AS1A 2SDFA 1KNAA 2X6LA 1GHJA 2WDVB 2Z1CA 4DXFA 1L0YB 4IFDI 5BYRA 1K52A 1SIJA 1PRTB 3O13A 2PIAA 3TP7A 4R3DA 4XQNA 2Q8TA 1EU4A 4O42A 4R8IA 1EQTA 2NVYB 5EBDA 5AUIA 1K53A 1PXUA 1PTOF 2LJIA 4L23A 1S5FD 2EYHA 4ZOHC 4C7ZA 2K01A 1YNJD 4A93B 1VF7A 1HUMA 3Q24A 1CHPD 3R93A 2PCFB 1SJED 1MHHE 2KOLA 1IYVA 4A3IB 1WWTA 1V8CA 1KFYB 4XYOA 1G2TA 2LMCB 5I4DA 4KN4C 5G3LD 1Q90A 4LK0M 2A68C 3SR1A 3AE8B 3QIAA 2QILA 2F0PA 3OSOA 1VZ8A 4IQZA 1OXSC 1KF6B 2CVRA 1KLGD 3D4DA 4H2AA 1L0XB 3M3YB 2WXHA 3BWUD 2JEBI 1K51A 3J7AF 2B2YC 1C79A 3T3NA 3C1FA 2IWHA 1OXVA 1JCKB 1RKNA 1H9SA 3TDQA 1SEBD 5DM63 5TSSA 1KDBA 2DY7A 1C76A 2O5JC 3Q23A 3A8KE 1SYBA 4H0LC 1F2RC 3M7GA 1STBA 5EPLA 1Y1VB 3FILA 1E0BA 3Q8CA 2C9OA 3PIP3 3W5VB 1YJIA 2A6HD 1CA5A 1B50A 3NRZA 2DBYA 2BOSA 5A35A 3AEBB 4XTCS 2EXZA 1BCPD 2X69A 1TS5A 5C3WA 5JOBA 2VZKD 3K6OA 3W2DA 4DF7A 1F77A 3DWGC 1KAAA 4H44C 3GQBA 5KNBA 1RD9D 3T4AC 2R92B 1O7ZA 3K58A 3P4RB 4XWWA 3FDTA 1QF6A 1MSGA 4WIPA 3N9YC 3PUXA 1I4QA 4OZAA 3CWIA 4N9PA 2R3ZA 1DYQA 5C4HA 3NTIA 2F0OA 2WIIB 4WORA 4KGTA 4LK1C 2DN8A 5BN5A 1D5MC 1DZ1A 2QKIC 1HUNA 2A68D 2BS4B 1XCTL 3A8IE 3FC4A 3Q8BA 1GAQB 4K5VA 5C2TB 2I2YA 3S1NB 3U9OA 3TN2A 3BVGA 5IT9E 2IL8A 1EZ8A 1GUSA 5E3FA 2XRQD 3FEWX 2VZKB 2B2VA 4DAPA 3ZJUA 5D65A 4ZK9B 2K03A 2IJ0A 1STEA 1IHZA 3IT6B 3OPOA 4BY7B 2N7JA 2IPKD 3EQLC 1EU3A 1I50B 3I3CA 2CU3A 1CJEA 3V2TA 2FFKB 3E9SA 1RCVD 5EBCA 3AE3B 3A7LA 1SF0A 1TJEA 5I2XA 3P1HA 3VQIA 5EKLA 1NENB 1PRTD 3OWEB 4X3KA 2KACA 2RKSA 1A2UA 3K5OA 3T3OA 2A74C 2DYOA 1TU2B 2K33A 1BBXC 4Z9CB 4C3IG 1RJTA 2WV6D 2IX1A 4P2CB 4KY5A 1TZOA 3A8JE 4EE2A 4R8NA 3MXGA 2B2UC 1BO0A 3MXPA 2KQ3A 4KHZA 4D2KA 4A6QA 1N63A 5C4JB 1I3QB 1SE3A 1Y8PB 2E75C 1EIGA 1VZ6A 1XO3A 4ZHPA 2K6AA 4F7XA 4FF3A 5T1GA 3PMFA 2B2UA 4LJZC 3RUZA 1Q1BA 3RPFC 2J53A 2G1EA 1S5ED 3LX0A 2V3PA 4NDXA 3R2IA 1O7LA 1WTOA 4K6LA 4FO2A 3U9SA 5F2DA 1V1PA 2TMPA 1MBYA 2H89B 3Q8EA 2Q5WD 1DOLA 2RSNA 1JRPA 3RMHA 1SE4A 4IDIA 4A9AA 3OWFA 1OQRA 3C1EA 3I4MB 2H88B 3AE1B 3T16A 4K6DA 2BYTA 2E2DC 2NVQB 2F1MA 5C0XI 2WKDA 3OW7A 4HN7A 1QOFA 1U4RA 3BDLA 1RODA 2D5DA 5JJZA 3K57A 2WP9B 1L6UA 3NVZA 2F0JA 1DD2A 1SSNA 4RGMA 1EY4A 1G291 2GA4B 1RHPA 1AYFA 2ZXOA 4C1NK 1QOHA 3K5NA 2E2IB 1KRHA 2K5WA 2ACZB 3NS1A 1LABA 2HQEA 3TZDA 1NVID 4XQQA 4GLSC 4DAVA 4G7ZC 1D2BA 4YSXB 1D6EC 3BK2A 4RHRA 1VMCA 2B8GA 1DJRD 4DQOC 1C4QA 5C3XA 3Q69A 3ND8A 1K50A 1E7PB 1HQMC 2KEEA 3NTKA 3GV3A 3KWLA 1LTGD 3FVQA 3T56B 1VRAB 3CIRB 2CQAA 3GTKB 1HA6A 2ZT9C 5DEHA 4QUCA 3M4OB 2NN6I 5CGKA 5BYSA 2G9DA 4YSZB 3BZDB 2EYLA 1J7BA 2MEKA 1H9MA 2A6HC 2IGHA 3DM1A 1SSOA 3NK9A 2WACA 3KLSX 1TIID 1WD0A 2A6ED 1PGBA 5HGTA 1JALA 2XRSD 1QT9A 5FKAC 4IUTA 4ABNA 3EJIA 4FVMA 3FILB 1KH0A 3VA5A 4KJOA 1JQ4A 2B2VC 4FXDA 1YQ3B 3SFDB 1FNUA 4QF4A 2WS3B 1STNA 2HDMA 2JA7B 1SAPA 4R9WA 1T6BX 4RCOA 2HDLA 1EY6A 5CV8A 2PZWA 2JA5B 1EM7A 1X3PA 3BVMA 1T5EA 2AUKA 1SXTA 2M2LA 4NW2A 5C0XG 2RDGA 1ML0D 4FF4A 1Z6HA 4DAYA 3AE6B 1MI2A 3CQZB 1NYQA 3Q22A 3AEEB 2LKVA 4ARCA 1SNOA 3V05A 2Z4HA 1PDQA 4DNRB 3PV0A 4B9WA 2BA0A 4A3EB 3CHBD 4Q2JA 2E3TA 2XWJB 3AE9B 3BYTB 3JAME 1EEFD 4US9A 4E6IA 1SNPA 2IGGA 5J39A 1QOAA 3TEWA 4I7ZC 1CQFA 1I4GA 3HG9A 2X6GA 1TY0A 3EUB2 4OGQC 1GPXA 2WU2B 2BT6A 1K8OA 3FMCA 2H1EA 2EYOA 3IAM1 1TWAB 1XYIA 3B2GA 4HEA1 1ENCA 1ENFA 1FFVA 2LS01 3HS0C 5BMHA 2AQ3B 2BDOA 3HP3A 2NVXB 3ND9A 4JX1C 2JSOA 1B4OA 2LUMA 4PNYA 2K22A 2B2WA 1TKYA 4MACA 2ID0A 3EFXD 5EKKA 1RFKA 3SK8A 4FXGC 3RFZB 2PZTA 4B0EA 1M8AA 2PQEA 2WXLA 5JAVA 3Q0AA 2F0GA 4L8JA 3C46A 5FLXL 5EJWA 3HVDA 1QILA 1ONLA 1Y1WB 1U9RA 4RAUC 2RPVA 4C56C 3W9CB 1J7CA 4XT3B 1BCPC 3K59A 1YJJA 2F0TA 4L6TB 2MHVA 1NCVA 4EGVA 1MI0A 3GTJB 3MHZA 5EE9A 4S3SA 4C2MB 1SYFA 1JW9D 2XN9C 4MIUA 1SFOB 1ZDXA 3QO2A 1M4VA 2MPMA 5IGEA 1N62A 1W6JA 4US8A 4A3BB 2ZW0A 1SNMA 1HQRD 1JC7A 2K05A