2IPKD

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ipkD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ipkD01
2J4XA 2Z8LA 3R8BA 1I4RA 1YN5A 4DXGA 4RGTA 1LT6D 3SEBA 1FNWA 1HTLD 1PRTC 4K6LA 1XXGA 4RFBA 1B44D 1MD2D 2TSSA 1QILA 1SXTA 1CQVA 1LTRD 1TY2A 1PYWD 5I4DA 1D5XC 1PTOB 1SJHD 1HXYD 1D6EC 5ELBA 5FKAC 1TS5A 4RHRA 1JCKB 1RD9D 1I4XA 4BWGB 1XTCD 1GOZA 2AQ2B 2XN9C 3MC0B 5ELCA 2NTTA 1LTTD 1S5ED 4O1NA 3MFGA 3BVGA 1LLRD 3BYTB 1LT4D 1STEA 1TS4A 1KLUD 1RF2D 2IJ0A 1ET6A 1G8ZD 3EFXD 3R2TA 4NZLB 1PTOH 1FNVA 1HQRD 5D3IB 1PTOC 1B1ZA 2XRQD 1BCPF 2AQ3B 1LO5D 1FGBD 4RCOA 1D5ZC 2CHBD 3W2DA 2QILA 1PZID 3BYYB 3BVMA 1I4PA 1BCPD 1DYQA 1HA5A 5ELEA 1EU4A 1JWMD 1L0XB 1JWUD 1FD7D 1LT3D 4RH6A 2RDGA 1V1PB 1L0YB 1AW7A 1PRTD 1ENFA 1LT5D 4L6TB 5FK9C 1TY0A 5D3DA 2XRSD 1AN8A 1EU3A 1EEFD 1KLGD 3V05A 1LTGD 4RGOS 1RDPD 1LTBD 4C56C 1BCPB 1EFID 1I4GA 5ELDA 4DXFA 1YN4A 3URYA 1PZKD 1S5DD 1TS2A 2XNAC 2WV6D 3KLSX 1RCVD 1TS3A 1S5CD 4RGMA 2QEJC 3DWPA 4L63B 1SJED 1PRTF 4OHJA 2ICIA 3CHBD 2IPKD 1UUPA 4RHSA 4ZYSA 1CT1D 2R61A 1SE4A 1I4HA 2NTSA 3BVZA 4Z9CB 1BCPC 1EWCA 1DJRD 2O2LD 1S5FD 1JQYD 3TSSA 1CHQD 4UDUC 1M4VA 1FNUA 2G9HD 1LTSD 1PZJD 1SEBD 3BZDB 1ET9A 1S5BD 1I4QA 1D5MC 1YN3A 1SE2A 1BXTA 1PTOF 4RGNA 1LTID 1CHPD 3O13A 1PRTB 1LTAD 1T5XD 5ELFA 3OWEB 1ESFA 2SEBD 1UNSA 1PTOD 1CK1A 2AQ1B 1V1PA 4TSSA 5TSSA 3GP7A 1KTKA 2RDHA 1EEID 3DWQA 1JR0D 1SE3A 3R2IA 1JWSD 1F77A 1V1OA 3EA6A 1SBBB 3DWAA
chains in the Genus database with same CATH superfamily
1XJVA 5DEHA 2WYQA 2BKFA 5IT9E 4JI4L 1PQSA 1EY7A 3VXWA 1FNWA 2EYMA 2B3GA 2Z9HA 3RPFC 3I3CA 4DR5L 2OTJA 4YY3Q 1JWAD 4XT3B 1WTWA 3EN2A 1QG7A 3EJIA 3VUXA 1LTRD 3EQLC 4IZ8A 2C35B 2KN4A 1LYLA 3BDOA 4S0RA 3U9OA 1I4XA 1R4NI 4ZQ3A 2Q8TA 4QF4A 1HNWL 1QNUA 2R92H 5JJKA 4IPCA 4W9LA 1D1KA 1UGJA 1STEA 4JK1C 1ZYRD 4YWLA 4JI2Q 5J22A 3R2TA 1PTOH 4A3KH 5DPRA 4DV7Q 2WDQB 1YBYA 2C60A 1KJTA 1VQJA 3DHHC 1Y8OB 2L8JA 4ZKBB 4MGIE 3QR8A 1WTXA 2NCNA 5DPWA 1MG4A 2B2WC 1YMHE 1AARA 2GB1A 4GGQA 1G6JA 3A4RA 4HKQA 2K5VA 3M7GA 4C80A 4G4KA 1QWYA 1UWVA 3S9WA 2O6VD 4M8NA 4S3SA 4IUUA 3ULLA 2WAQE 2VUMB 1WH3A 3PZDA 1FRRA 5DLQE 2KWCA 1JC7A 3ZUNA 4K8JA 4POFA 2DHZA 3B2GA 1FRDA 1HZBA 2FXQA 2R93B 1F1HA 1R4QB 4HJ7A 4HKZE 3AQQA 4UP8A 3RR5A 1C4AA 5DPSA 1LTGD 3UQAA 2VL6A 3A56A 4LF4L 2INCC 1PH4A 4FF4A 3CCQA 3OJ3A 1EYDA 2ZZPB 3H91A 2JZ3B 5IY0A 3KH0A 5ELDA 1O7IA 2ASBA 4RM8A 3WCQA 3URYA 5JH5C 1XPRA 3CKIB 1T5EA 3KLSX 2RA4A 4A3MH 3CRKC 2EYFA 1BBXC 2KANA 2HDMA 3K0YA 5ISRA 2C9OA 1C78A 1NENB 4X3KA 2WDRB 4YY3L 2WU5B 2YLMA 1T9HA 3TP8A 1E0ZA 1I4HA 1VQLA 4BZAA 4AH6A 5BN3A 3KF6B 2N7EA 3PVLA 1VQ5A 3NY5A 3PO3B 2LGYA 4OWTB 1CSPA 1ZOYB 2Z59B 4OO1H 4CDDC 4O0AA 4WURA 2DY7A 2KDIA 2EYOA 2PKOA 1UWMA 3VHTC 1YITA 4JI2L 3NZ3A 4MGKE 4FP5D 1A8VA 4L8JA 3G7LA 4DR2Q 4JV5Q 3DCGA 4DV2L 3BIID 3P63A 3HOUH 4F88A 3CF6E 2F0UA 4YTMB 2K28A 3PUWA 3T9LA 5E4WC 1CFMA 1S72A 4K5VA 3UIOB 2LS01 4FF3A 1HHVA 4O2DA 3KF8A 2L83A 2NBUA 2F0VA 4EQPA 3DEOA 3ICEA 2ZVNA 3NQIA 4KY5A 1Q8KA 1XNQQ 1CJEA 5C3WA 4X64Q 4KLKA 1UEBA 2XSCA 2BVCA 3I4MB 5J1ZA 1EYCA 1NY4A 2K32A 3WOEA 2A68C 1HCZA 4J1MA 1LV9A 1SFOH 2DGYA 4HJ9A 2WNMA 4HIMA 4IDIA 4XDDA 1J0GA 1FCLA 1N5XA 1MJEA 2R7FA 5KYIA 4AOFA 3ER0A 2KLCA 1U4PA 3L3OC 4J15A 3G48A 3I73A 1WJNA 3H1UA 1B44D 1EOVA 1I5FA 3GZNB 3HOZH 2NBVB 1DZ1A 3MJWA 3HHMA 3C1EA 1IUEA 1E9MA 1WY8A 2D62A 2NVYB 2G5DA 1MJDA 1I6HH 3VUWA 1D5XC 1SLJA 3U50C 2ZW0A 2MBHA 3ZKJC 4EEWA 2F1MA 1HQMC 3I72A 3AE2B 1RD9D 1VQPA 4DK3C 5J3BA 1BOSA 3H15A 4EQOA 1UELA 3KWLA 1VMCA 1HJPA 1V1QA 3JAMi 2N4FA 3CW2C 3H7SA 4HJGE 1B4OA 2CW0D 3H0GH 2L12A 1FGUA 4I6PA 5E4XA 4LCDE 4CYEA 1A70A 3NVZA 5AZGA 3RNGC 2NVTB 2KQSA 5CBAE 2KA7A 1QVGA 1MHWC 1P98A 3HS0C 1V86A 2VUMH 1WF9A 4HPMB 3M4QA 3X3MA 3N1ZC 4B08A 1F2LA 4AUQC 4YSZB 3H7PB 1EY0A 2OQ0A 1VQ4A 3NBHA 2EYLA 1B7YB 2R93H 2Y3AA 4DDGD 3RFZB 4B3SQ 4XIGS 1SNCA 2KTFA 4FXDA 5IGGA 3S1MB 3HEJA 3S14B 1WMHA 1D8LA 2N9EB 1UEAB 3PIP3 3ND8A 4DR2L 4JV5L 5IIFA 1TWAH 1EIYB 4ZHPA 5IGBA 2E2JH 4GLVB 4ZCKA 3C0RB 5F2DA 3GOEA 1VQGA 1SDFA 3V05A 3VR6A 3HOXG 2UXDQ 1B9MA 2KC1A 4LAAA 1X3EA 1XNQL 4LK0M 1L1OA 4X64L 2QF7A 1JB3A 3KYHC 4A20A 2MQJA 4DV3Q 4DNRB 1AE2A 4N9PA 1CKMA 3J80E 1C0AA 2L76A 2F0FA 2HCCA 4TVAB 4X57B 3CSTA 3KFUA 1Q46A 4A3PA 4LK1C 4A3IG 2PNRC 4WORA 2N8NA 4IUVA 2L3ZA 2O2VA 4W9EA 4HJ5A 4IOCA 3AB5A 1VQAA 5IYCG 4YCVA 2WB1G 2DLBA 3S1QH 5IAAC 3ZJUA 3Q8CA 3STBC 3KLRA 3KBGA 3ZTCA 4DAYB 4PS8A 3VYTA 3NELA 4DNTB 4DA2A 1N36Q 4P71A 1PZJD 4DK6C 1KM7A 4KI0A 4AJWA 4D2KA 3LYYA 4PYZA 1K8GA 2GOWA 2FMMA 4G7HC 4EZKA 1VCBA 2OJWA 3UE0A 1ICWA 3E0EA 2WXRA 1DOXA 3AI5A 4G0NB 5EKKA 4GU2A 4H0LC 2F0NA 4R1JA 5H1SE 2RSUA 3GS2A 3MC9A 2N3SA 2DNCA 2N49A 3BU2A 2HD3A 1STYA 1ESFA 1BNZA 1UNSA 2AQ1B 5LLIA 2KT7A 4R4QA 2M17A 4JWUC 3K57A 4B3SL 1NEKB 2LASA 1HEZE 4A3EG 2XTIA 4P75A 4OW0A 3PGZA 1HZ6A 3L54A 3L0OA 3CC2A 1ACCA 3VQIA 4AQ7A 2C7NB 3AFQA 5EPKA 2Z8LA 1IPGA 2VH2A 4DR4Q 3TP6A 1TKWB 4JBMA 1IBML 5E6PA 3CWIA 1YNND 2HJ1A 2EJGC 4LF6Q 2LFIA 2O5JC 5K5PA 2UXDL 2BBCA 4LF7Q 1TWGH 2HDLA 2NVXB 5I4DA 2F0PA 1SYDA 2JE6I 3R7RA 4HEA1 2LRUA 2A1AA 5E1FA 2KEEA 1EL0A 3A54A 1EZ8A 1JOQA 4DHZE 3MC0B 5COYA 1YHBA 3DVNV 4ALPA 4EX5A 3HRZC 3KJOA 1U4AA 3ZTDA 1J9OA 3BY4B 4J6HA 3N1XC 4MZ9A 2B2TA 4ZUJA 4PK1A 2H5XA 3NQTA 2B39A 1SRUA 2ZTEA 3AE3B 5IGFA 2AQ3B 2K5DA 4IW0A 2QILA 1VQHA 1VZ7A 3BVMA 3Q8DA 2KTRA 4JYAQ 3A7AB 4OVUA 2Y0SE 5DM73 3GTOB 2F3VA 2FHTA 1N36L 3KJPA 1YJNA 4N59A 3L13A 4RH6A 4YHHL 2EYHA 1EIFA 4G7OC 2H1EA 1RLFA 3OW2A 3MJ5A 1TVXA 4BY1G 1ILQA 4L6TB 4R9WA 3E0JA 2FNJB 1X6OA 4DAMA 4FADA 4W9FA 4HMIA 4JBJA 2IX3A 2JA9A 2QCPX 4RGOS 2JF5A 3DVNU 4DV4Q 2LHDA 4AYBG 5LHY1 2MHJA 1YNJC 1EFID 2KO3A 4DXFA 3X3NA 4QIWB 2F0KA 2MJ8A 4XTCS 3KLWA 4K3BA 1TS2A 1BBWA 2VZAA 4CDCC 2Q2UA 1S3SG 2DYOA 3IAM1 3BG3A 3L9AX 1RCVD 4K5XA 4RGMA 4A3JH 4N58A 4DR4L 2RVLA 3NOBA 1PH3A 3I56A 1NNXA 2D3GA 2D3AA 3CCSA 4LF6L 2H89B 3RCZA 3TZUA 1AFPA 5FLXc 3HM6X 1CT1D 1OXTA 4JI5L 1FXTB 2IO3B 3ZQ4A 2ZT9C 3M3JA 2GA4B 4LF7L 3FDTA 1K8OA 1OEYA 1K8MA 3HOXH 2PW7A 2XK5A 1S5FD 4NP5A 3K9OB 4JLCA 2J0KA 3A5ZB 4YXDB 1HZCA 3H8HA 1AYFA 4C4VB 2ATWA 4RG1A 2MP1A 4K2LA 1OQRA 2JJQA 1ISNA 3A1QB 1YJ1A 2JA8B 3SK6A 4LDTD 3U7ZA 5HKHA 1SNPA 3S15H 4KHVA 4KX6B 2RKSA 4A3IH 1F9QA 1CA5A 1FJGQ 1P0RA 1NCVA 1E0BA 5KHQA 3KW5B 1NR2A 1U0LA 3HOYB 3ERSX 4QB4A 2SEBD 1G6PA 1Q1OA 3GZNI 3KBXA 1J6QA 2EDGA 4JYAL 5GMVA 4TSSA 4DGZA 3QX1A 2ID0A 4WWNA 4PMWA 3I8ZA 5IP9G 2KK8A 2F0TA 2UUAL 5E6OA 3HGBA 2LFNA 3D6CA 4HEDA 2BWES 2BWFA 2G3QB 2AWNA 1JRPA 1XLOA 4KN7C 1VQEA 3CAMA 2MH7A 4N6EB 2WAQB 4XQNA 4K8IA 1X56A 4O42A 4BBSB 1KNEA 1V2YA 2KDMA 1SF0A 5C3JB 1JT8A 4FLHA 3T1YQ 1WX9A 2UUCQ 2MP2A 1B3QA 4DV4L 3OHXC 4X62Q 3FKIG 1HXYD 3KUCB 1F2YA 5DM63 1GPXA 3NPPA 1L1OC 3ERQA 4KZCA 2V4DA 1S5ED 4LNKA 1X3PA 5C44H 1LT4D 1TS4A 2EXZA 3D0FA 2KMCA 1OXXK 4Q2JA 3W1YA 1JICA 3FPUB 5CV7A 4GKJQ 1MI0A 3C19A 3ZNID 1WTOA 4ICUA 3GTMH 1ZEQX 3HOWH 5BYSA 5CV9A 1LO5D 2QW7A 3HG9A 4RCOA 5IGDA 3LX0A 3PIOA 3K59A 2A6ED 1ZDVA 1ASZA 2FAZA 3JYUA 2MGSA 4IUTA 3E6ZX 2ENBA 4IPHA 2Z0DB 4DR1Q 4NNJB 4RAUC 3U9SA 2N9XA 5CHWA 5DCNA 4JI6Q 3LNNA 1JJ2A 2PZWA 3MWYW 2NZ1D 3SFDB 3VTWA 3N52A 4ILWA 4WFN3 3GTQB 4NXNQ 2K7VA 5IN7A 1F2MA 3SE0A 1EZ6A 2VQFQ 4K6DA 5M3MG 4EZLA 2F0HA 3P20A 2B76B 2ES2A 1ZPSA 3T1HQ 3GTKB 1SROA 3AU7A 1VQOA 2D10A 1N32Q 3S1RB 2NPTA 2ZTCA 4DF7A 1GD7A 5BO4B 1WGRA 1BBUA 5C3XA 4MDKE 1KH0A 3GE8C 1S40A 2DENB 2WXMA 2JRHA 2K01A 2J7QB 2JA6B 2MJDA 4C3IG 1JE4A 1S5DD 2VQEQ 3OMCA 1I3QB 3ZRCA 3NTIA 1YHAA 3Q8FA 2KVMA 2ZNVC 5HI1A 1NJIC 2JA5H 4L63B 4DR7L 4JL9A 2VB3X 2D2QA 1PRTF 4OHJA 4TUUA 4PV1C 3HOVH 2KNBA 3DLLA 1SSNA 4HCEA 4PS7A 1TWCB 4BY1H 3T1YL 3R7QA 4IPGA 3M85A 2UUCL 1CA6A 2DZKA 2L11A 2Q2HA 2NMQA 4X62L 3HM3A 2F3IA 3CMAA 3VH4B 4REZA 2CKZB 5CV8A 1PYBA 3RMHA 3TDQA 2YU9B 1R7SA 3PGEA 4W9IA 4DHJD 1VQIA 4K0KQ 3RMKC 3M3YB 4WJ3M 2D11A 3VFKA 2RDFA 4YIJA 5AZFA 4HJ8A 2QA4A 4GKJL 1W3SA 2I07B 3C8YA 3F2UA 2LXAA 1XLPA 3ML9A 3M95A 2DJFC 1BXTA 2B2TC 2LJ5A 1WMHB 1BMLC 3I3TB 3VUYA 4NAMA 3Q3OC 2PLPA 3MP9A 5EPJA 3FEWX 3NS1A 1WFQA 1X9NA 1TT2A 1CK1A 2Z6KA 4DR1L 2WDVB 3O65B 1CKNB 3LWEA 4JI6L 1WX7A 1EEID 3SHLA 3TREA 1HA6A 1V1OA 1N34Q 3V96A 2EMTA 5GADC 2WXNA 1F9RA 2VQFL 1KC8C 3I9V1 1U5KA 3L08A 1L1OB 4IM3A 5IYDH 5LMNW 3U52E 1JOOA 2N7DA 1WGHA 3T4AC 1BO0A 2IHEA 1WM2A 1JW9D 2I5MX 2PE6B 3NHHA 3RI7C 2KC2A 1DOKA 2JQRB 4OVZA 4E3CA 2KKCA 2O2VB 2LJIA 3RD2A 4GN4B 2K9XA 2VQEL 1SGHA 2MBEA 4MTKA 3AE4B 4OIJA 5JZEB 5IP9H 4IUQA 1QOAA 4EZJA 2BDNA 1YJWA 2R92G 5C3EG 1QKZA 5J18A 3I70A 1VLBA 5LXIB 5C4HA 1EF1A 4LF8L 4Y7NB 4LF9Q 1A62A 3N9YC 4LLGM 1KFYB 5D3IB 3MTNB 2CCZA 3GTQH 3N32A 4XC2A 2WX1A 1B1ZA 1IYUA 1PXUA 4FO2A 3J7AV 3ONSA 3U7DA 2DYMA 4A3KG 2BA1A 4P74A 3D4RA 2GBKA 3RLFA 2GLSA 3ZXRA 3GTKH 2D3BA 2A69D 1N60A 1FXIA 2E76C 1GG3A 2DYBA 1TGZB 3E56A 1GM5A 4EOYA 3T51B 1L0XB 1QB5D 1YEZA 1R9TH 1JWUD 2BH8A 4KY6A 2CHXA 1XMQQ 3VDZA 2RDGA 5IKCM 1Z7TA 1ENFA 4PZ7A 1XNRQ 2XVSA 1E5WA 1LT5D 3PO0A 4F7ZA 5IA7A 4WJWA 2ZNVB 2MX2A 4QMGA 5M5WH 1WZ3A 2GMIC 2KN5A 2JXXA 2KJHB 1X1MA 2YEPB 1SMYD 1PLFA 3ITPA 1CZGA 3RLNA 4V190 2JA7B 4DAYA 1IP9A 1FFUA 1GO3E 1XPUA 1EOTA 3X0WA 1QOHA 3CCRA 1WXAA 4J6IA 1ZYRC 5EKLA 2ZJPA 4DR3Q 1N34L 1I7HA 3ZRFA 1TS3A 2JZPA 3VTVA 2E8GA 2VB2X 1E7VA 1NBFC 2QEJC 3P1HA 3FMCA 3M4YA 5M5YB 1Q5WB 2DBYA 1STBA 4XYQA 4U68A 2EZVA 1IZ6A 4NXMQ 4RM9A 2V4IB 5GAGC 4B9WA 4KGTA 2NB0A 1RHPA 4KV2A 5M3MH 3VRAB 2FJ2A 4JPSA 2DX5B 5D2MB 3QK0A 4ASWC 2KMMA 4B3MQ 4IFDJ 1K83H 2L15A 1T0YA 3KWVA 4NJ7A 3VVWB 4IN3A 1WCMB 1GUNA 3AH7A 2JYEA 4XE0A 4DHZB 4I7ZC 1Y1WB 4AJYB 4OO1G 4IALA 3NG0A 1T0RC 2EPBA 3AE6B 4IC7B 4C3IH 1SEBD 4ACFA 2RCNA 1VQDA 5IWAQ 2WXFA 3NHEB 2IT1A 4CBVA 2KTRB 1B53A 1ZXIA 1OQYA 1YVCA 2XIWA 4LF9L 3N1YC 1D5MC 3VR3A 1PTOF 4C00A 3HIZA 1YOVB 3ULJA 5LMUQ 4KJOA 4JIOU 4ZAIA 4C3HG 1GHKA 4BY7B 3DHIC 2WB1E 1P16A 1PTOD 3BZCA 4KHZA 2CKHB 2KUMA 4ZRQA 2YVCA 2O5IC 3TBLD 1SYBA 3R2IA 4L2YA 3K7AH 2MO1A 4K7WA 4U673 2KHIA 1RFAA 1OXSC 1HH2P 3P1MA 5EE1A 4DXGA 3F2CA 3PF5A 1XNRL 1IW7D 4BS9A 1LT6D 1UE5A 4M1UB 1JROA 1WI0A 4EVOA 4PMCA 1MGSA 5EBCA 5JVG3 1XXGA 2KOLA 3KUPA 3PRZA 2PZTA 3WDNA 2N7JA 3T3NA 4ZLTF 5I6YA 4X3UA 5KIXA 1Z6HA 3HZXA 2KFJA 2E5LQ 4FYDA 4A3FB 1KDBA 1TU2B 2OCEA 1J5EQ 2UUBQ 4DR3L 2D5DA 2L32A 2MBBB 3APFA 1LTTD 5DAUA 3GDEA 1TIID 1Y1VB 3BVGA 3FHWA 2XK5B 4G11A 1H8CA 4NXML 4LW1A 3CIRB 5E6NA 4JBWA 3K6OA 1OTCA 4FVMA 4DNIA 1AE3A 5M5XH 1EY4A 4RCNA 4ZK9B 3TMPB 3ZJTA 2K52A 4CJ0B 1BCPF 2IZVB 3TEXA 4KVGB 4B3ML 4LFBQ 2YTYA 3OIQA 2VUMG 1HUNA 2Y5CA 2JSOA 1BCPD 1QE6A 4IUNA 4NQLB 4YWKA 3VR8B 3AE7B 2R93G 5ELEA 3DBHB 5EE3A 4YWGG 3IKJA 4M0WA 3KOJA 5L83A 1JB7A 2KJXA 1QOBA 4JVZA 4NW2A 3BS1A 5G2NA 2DZMA 2KHSA 2LI5A 3J81L 5C3EH 2L00B 2LHEA 2WACA 4XZ4A 1M8AA 1X54A 3VYUA 3RZDB 4LNQA 1B8AA 5M5YH 1KRHA 1Q12A 2Z4HA 1JE5A 2LSSA 2EJFC 1M90C 4C4VA 1A5RA 2RMMA 4LF5Q 3SU8X 4MT5A 3T16A 2Z6KC 1DXMA 3AMZA 2CW0C 3A1QA 3QARA 3Q22A 2MP2B 4FNFA 2O6VB 3SK4A 4HIOA 2PMZE 3S2HH 5IE8A 4ANXA 4V0BA 2PW5A 3PO3G 3LWUA 3UDXA 2F4IA 2FCNA 3ZNHB 1IBLQ 2AWTA 3QIJA 2PZUA 2JY6A 4DFAA 1O7YA 1CQFA 1PGXA 2LZ6A 2BGFA 3NZUA 2ZXPA 1FFVA 2E5LL 3RN9C 3PUVA 1I42A 1MSHA 2EJMA 2AUKA 4AYBE 2UUBL 4YSYB 2WXKA 1FNUA 2BCOA 3FKYA 1FR3A 1MVKA 5JEAG 3J9CA 1XTDA 4X65L 4IURA 4UY8C 1QCBD 1I4QA 2MW5A 3TCAA 5CV6A 4W9CA 1Q90A 5C4JB 2FIDA 1ZW7A 3GB1A 3I4MG 4DR6Q 1L4DB 4WRDA 4CKEA 2V1CC 3DM3A 4C7YA 2K75A 4LFBL 2BKRB 1PH8A 2GBJA 3AE5B 4RF0A 3WWVA 5LNK1 3VDYA 5TSSA 2CQOA 4MGZE 3DBRI 5EJWA 1YI2A 2NPTB 3DWQA 1YX5B 4BVUC 2WXHA 2F0SA 4WQOB 3NS8A 3L16A 4RF1A 3DPDA 2KDFB 1EQTA 1P3QU 1YN5A 4X3TA 3RUZA 2QCZA 4LUVA 4C1NI 3I55A 3J80L 4HPPA 3SEBA 3AE1B 1HE8A 3OJ4B 4K6LA 1JMCA 2JX5A 4CKBA 4W9GA 3N6RA 1RJTA 1WR6E 2BYVE 1HTQA 1DM0B 4A3GH 3RULA 2ZJQA 1C4QA 2NN6I 1GJXA 1G2SA 2LWPA 3Q2AC 3PRPB 4KGRA 1U4LA 4C3HH 4DV7L 3FAHA 2EYPA 1VDZA 4LF5L 2WS3B 3AFPA 2XN9C 4LFAQ 1STAA 4G3XB 4GN3B 3LJ3A 4FXGC 3NWSA 1TWHB 5IT9c 1P7FA 2GBMA 3W1BA 2BF8B 3ULPA 4BXXG 3I4LA 3S17B 3HVZA 2G4SA 1ZKOA 1G51A 5C0XG 2J52A 4GMVA 3J81E 1TJEA 4FF2A 4XQQA 1WM3A 4YTPB 3GTGB 2ZXOA 5D65A 2J42A 4NY0A 3W2DA 3N3KB 1D5ZC 2CHBD 4I6NB 1A0IA 2HTHA 4KKSA 3C46A 3PO2B 3MTSA 4OXPA 3RNAC 3DWMA 3L4PA 2OEOA 1EYGA 5LXHA 1K28A 3T53B 2FINB 4XYCA 1HA5A 3EBEA 5AFWA 1NDDA 4MELA 1STNA 2K5QA 4DV6Q 2JWZA 2BS2B 2QC8A 1HR0Q 1AW7A 4YL8A 3VA7A 3U4VA 4DR6L 3B2FA 4GOPC 1NTGA 1IGCA 2KJRA 3P4QB 1EU3A 1F2ZA 1LACA 1HFNA 4KD3A 3ZYYX 3PSEB 5A35A 1N33Q 5EQ0A 1RM6C 4C56C 1HTOA 1A3TA 1PFBA 2B8FA 3J7AF 1Q10A 1F9PA 4USAA 3BJUA 2R7ZB 4KKUA 3PLVA 2EXDA 4FA6A 3B1LX 1B3AA 4R3DA 1MBYA 3T3OA 4A3JG 3GE3C 1OXUA 5KYLA 3UI3A 4H7BA 3PUZA 3B9JA 5IOIA 2WXQA 2IY0B 4MSMB 2R61A 2ZXRA 1B70B 2K6AA 2NYZD 3AYHB 2LUEA 1E8WA 1IYFA 1MHHE 1CKNA 2O2LD 3BINA 2CHWA 3TSSA 1J8CA 4P6VF 4MN3A 3SDLC 1M4VA 3ZXVA 1TKGA 4WH4A 4A3BB 1KRSA 4XDCA 2GI9A 1C8CA 3BZDB 5M3FB 5CV5A 3U8ZA 2INNE 4XDXA 1G6ZA 2GN5A 2QDFA 4EQNA 3CCEA 4MGYE 3PO3H 2K8BA 2UU9Q 3MHBA 3ENEA 1GUWA 3W1SA 2D0OA 2YTVA 4QUCA 2BH2A 2DUDA 2JQOA 2WWZA 5IGEA 2DZIA 5D6JB 3Q14C 4DUZQ 2MSED 4N9F4 4JPBW 2E2IB 1PUTA 5FJ8H 3M4OB 1DGJA 3GP7A 1VQMA 4BKTA 1D2BA 1NI3A 4GN1A 1NUCA 4BOSC 1JR0D 1SE3A 2RBMA 3G71A 3GTLB 1PVOA 4DV6L 3P4PB 1SAPA 1WTQA 1IYVA 1FEHA 1HZ5A 2WDTB 3Q0AA 1HR0L 2F0JA 5JEAH 5BYRA 1ONLA 4GIVA 3I90A 4IFDI 1K9MC 1IBKQ 4A4IA 2Z4IA 1O80A 1H9JA 2DNEA 3J81j 5I6WA 3FILA 1YIJA 2M19A 3I4MH 3CMMB 2EY1A 3PRMB 5CGKA 1N33L 1EY6A 3A9JB 3VH3B 2M0XA 3WA0A 5L95C 1WXMA 2EKIA 3Q69A 3SFEB 3NRZA 3GTGH 2PPBC 4OEMB 3AM9A 4XX5A 3J81c 3RUIB 2QDLA 3AEVA 4LNFA 1WJUA 5EBDA 3KDFA 1Z2MA 3MFGA 1LABA 2Y5BB 3BYTB 1TTNA 4G7ZC 2ALYB 2D9UA 2JYTA 1SNMA 3DBHI 4HXDA 1WE6A 4ZDVA 2NVYH 5C44G 4ZRJA 3EROA 3LB8C 2WXOA 1BKBA 4G57A 3NUHB 2RSOA 1WTPA 1SYFA 2XRQD 4ZRIA 1ASYA 1J7CA 4WJOA 3KQ4A 1XO3A 3HOWG 4A8XC 4KY7A 4GOPB 4GOCA 3MAQA 1YJ9A 2RR9A 3ABVB 1C48A 1C9OA 3T13A 4HJAA 3PS6A 1L6VA 1EUJA 2KQ3A 2W9NA 1KXLA 4C2MB 1KDAA 2X6LA 4HK2A 3QCAA 2RPVA 2NVTH 2LGDA 4P73A 3TEHB 3K7UC 4KTAA 4DV3L 2FCQA 1WXSA 2ACZB 4BXXH 5DNFA 2R7ZH 1KNAA 4ULLA 5D3DA 5C0XH 4BBRB 2LUMA 3Q8BA 4LUOA 2KDEB 2CU1A 3P4SB 4TMAB 3S1MH 3OIPA 4ZOHC 1RDPD 3S14H 3SHQA 2FUG1 2WB1B 3AEAB 4K7UA 1V5OA 5KEEA 2N0SB 2M00A 2BYTA 1PH9A 5A2QL 2WXIA 3Q8EA 4II3B 4P16A 1V9JA 2K50A 4A93B 1FYCA 2WV6D 2EIFA 3TJPA 3Q6BA 3CQZB 1S5CD 3NVWA 2AMCB 3Q3MC 2GVAA 1GHJA 3MXUA 3P7JA 2M56B 4NPSA 4DV0Q 1UUPA 4A3BH 3W5VB 2JA5G 3PUYA 1K0RA 2A6EC 1HTPA 4OX9Q 3HOVG 4GKKQ 2I5HA 2JU6X 4OVVA 4WWOA 4DU9A 1HNZQ 3JC66 4UPAA 2CH4A 2BQQA 1IBXA 1EWCA 3S1NB 5KNDA 4JE3B 3QHTA 3DDCB 3IXSA 3C3LA 2AX5A 1VD2A 2C5LC 1D4BA 3EECA 2O4XA 3J80c 3J7A5 2MLBA 4P1CC 4TQ1A 2AKWB 5KNBA 2G9HD 4JW0A 1L0VB 2BB6A 4A3EB 2KWDA 3P42A 4IWQA 4EGVA 4K3CA 2Q2IA 1YQ4B 4BAXA 3HRDD 3GTPB 2A6HD 3RZFA 2B2YA 4MNOA 2TMPA 3SDZA 3DXJC 3B6YA 2N9KA 4M0WB 4NPNA 5GAEC 2EYJA 1S4ZA 3FRPB 5KNCA 5ELFA 3ZNZB 1WI5A 3OWEB 3VYSA 4J3OD 1KRTA 2WAQG 1Q82C 5FLMG 1Q8IA 5C4XB 3DUZA 4OIKA 1EQVA 4GLXA 1GAQB 2KLGA 3C1FA 3KVFB 1WOCA 2G9DA 2WXPA 2DY8A 3RLOA 1Q86C 1I94Q 3NUCA 1L5PA 1GVPA 1PRTC 1WJJA 2K1FA 2K5NA 4RFBA 1QLBB 5IYDG 1P9DU 1TBEA 1PYWD 3MHSD 4B9XA 5J17A 3ALBA 3X23A 5FKAC 1C4PA 3EIVA 3PPAA 4B0EA 3KUZA 3D8GA 2AQ2B 4L1BA 3DQVA 2JPHA 2FE8A 2ON8A 1VRAB 1RODA 5CTRC 1B50A 3A0JA 2E2HB 1LLRD 2MWSB 1I6VC 4EE2A 3IT6B 2Q5WD 2NVXH 1NBWA 4DV0L 1PA6A 4C1NK 2CFMA 2GRIA 3B08A 3ZIMA 1L7YA 2OT2A 4ANWA 4B3RQ 5G3LF 3H09A 3I63C 4OX9L 4W9JA 1GUTA 1K0SA 1HNZL 2B63B 2UU7A 1WD1A 4E71A 2SAKA 2K25A 4XWTA 2GBRA 2LY7A 3BYYB 2PW9A 5G3LD 1WYGA 2N88A 4ZYNA 3VTUA 3S2AA 2CJNA 1PGAA 2F0OA 1EO6A 2DN8A 4AYBB 2O6VA 1ZKHA 2PE9A 3I91A 5A2QE 3CXCA 2R6GA 3M9BA 3S2DB 2BB5A 4WAFA 2F0QA 1WR1A 2R3ZA 2NUCA 3TMEA 3A74A 1ZGUB 2XBBC 4A93H 1QT9A 1K53A 2RGFA 2JA6G 2W54A 1KL9A 3I5JC 4HTHA 3M62B 4JCVE 3GTOH 3CPFA 3MXNB 2G1EA 3KYCD 1WTRA 1UD7A 3RNBC 1AH9A 3W1SC 1H9SA 2J0MA 3A8JE 1E8ZA 1NR4A 1PMRA 2PVGC 2IX1A 4K1RB 5CMDA 1JRUA 4H2AA 2BDOA 2K22A 3FVQA 1JOKA 2LXKA 2BOSA 3E9SA 2D3CA 1EFWA 3G6JB 2UYZB 4FJZA 1EWIA 3N20C 1Q1BA 3CHBD 5K36G 1ILPA 2V4LA 3QA8A 3OLMD 1VZ6A 2KX3A 4ZYSA 2PMVA 3SGIA 3N30A 4BFRA 1W2BA 2NZOA 4MIUA 2MA9B 2QJLA 4IJHA 3J81i 1FJGL 1DONA 3SR6A 4E74A 3OW7A 1N5WA 2DAFA 1QVFA 3G4SA 3ZJVA 1LTSD 5I9PA 1U4MA 4N8X1 5AEKB 2J0TD 4R8NA 3E5SA 3E3XA 1ET9A 2Z0EB 1OGWA 2JVCA 1S5BD 5C4XH 1EQRA 4PZ8A 4B3RL 3NTHA 2ZJRA 2PYKA 1SMYC 1C3TA 4ZRPA 5CYUA 1MSGA 3VR2A 1K52A 1RYJA 1V6EA 3D4WA 2LGIA 2RPQA 3W9CB 1PRTB 4I7AA 1PFNA 1QQRA 4A76A 2HHHQ 1VZ8A 2MFIA 2F0EA 4JI1Q 1IKMA 5H8YE 1PDQA 3HFZB 1PFMA 2ZPNA 1E22A 2PO4A 2CJOA 1HPCA 3FKIB 3I57A 4DHJB 2JA8H 1XMOQ 2R2QA 3QOLA 2KYWA 1YJJA 1LM0A 2LGXA 2PTLA 4BBNF 1B2TA 3APDA 4HROA 3MVVA 5CORA 1WGGA 3CMEA 3HOYH 2BPSA 1E2ZA 2X69A 2QSDA 1SXTA 1MI2A 2Z6BA 2PVOD 1N9WA 1UE7A 1PDXA 5IGCA 1SIJA 1WWTA 5ELBA 1D6EC 2MUYA 3V6CB 3MFYA 2INDC 2REXA 2B63H 1CTMA 2NN6G 1KAAA 5FLMH 2OWOA 4BBSH 2N9LA 5MPOA 4PYUA 1KD1C 1VQNA 4UP9A 1RF2D 3ZGZA 2A5UA 1ENAA 1U4RA 2A19A 3AXCA 3Q23A 3VR5A 1GUSA 4NXNL 2RHQB 3DBLB 4DQOC 1PTOC 1BQQT 4JQWC 3I4NB 1F9JA 4ME5A 3OWFA 1T6BX 3J80i 3T1HL 3IVFA 1N32L 3WAPA 4BA1I 2K05A 1X55A 3UE1A 4A3DB 1N62A 4AWJA 3MZ5A 1C77A 3U4EG 4A75A 3K9PB 3DBRB 4FJYA 1IW7C 1E7ZA 2Z0SA 4DV1Q 1FIQA 1SMXA 2AUJD 2ZW1A 4Q0FA 3VA5A 5CBEE 4DBGA 5J2RA 1F2RI 3H3VI 1Z47A 2JEBI 1TY0A 1UAPA 2KWUB 3A9KB 3PQIA 2B2YC 5EKIA 2LGSA 4OWXB 3ZW3A 1K3BC 2A5HA 2HHHL 4IPDA 4JI1L 1YHQA 3DVGY 2LRWA 3TUOA 1I50B 4QCLA 3DHQA 2E74C 1GC6A 1II3A 4J8QA 2EMSA 2K03A 1PFDA 1XMOL 4L5RC 3FILB 2KQ7A 4FHJA 5KHOA 4ABNA 3S1RH 1X3GA 4K0KL 2JWUA 1QOFA 4E6IA 5DPTA 1RL2A 1YD8U 2M4NA 4FBJB 5BMHA 3BDCA 1WCMG 4HMJA 1Y1WG 3KDFB 2AHOB 2JA6H 1BCPC 3K58A 3I7FA 3S24A 1ZDXA 1I3QH 1RFKA 4F87A 1Q1EA 2HUGA 4FDBA 3BZKA 1R4MI 2HD5B 3QG1A 3K80C 2EY6A 5IOCA 1MKHA 4A3CG 3WAOA 3EGRA 4JI7Q 1A3VA 3AEGB 3HKZG 1YNXA 2KOXA 4IO9A 4IM2A 1JWBD 1TWCH 3HP3A 1WSPA 1TQOA 2GVBA 2YTXA 4HSVA 5CV4A 3AV8A 1MPEA 2WP9B 1TXYA 2HT1A 1RTOA 3MA2B 1GKHA 1RWSA 4JX1C 4ICVA 3R93A 2F03A 4OONA 5K36H 1S1QB 3IBEA 1VQ9A 4X6AH 2YU9H 3A9JA 4FULA 4JGHB 4JBKA 2KFKB 3M3YH 4MH8A 1A2UA 1WXVA 4HSPA 2RD0A 3ETRA 4MHEA 4POGA 2L1AA 2LVPA 5CR3A 3E9HA 1SB3C 1WXQA 2SOBA 2K04A 1O7ZA 1MFWA 1V49A 4PS3A 4RKLA 2W82A 1I4RA 1WIAA 4F8CB 4EUTA 1U9RA 1KDCA 5LMNQ 3TS2A 4HIDA 2Q8RE 2I5LX 3PF4A 2R92B 2BYFA 1QZEA 4L5SA 4M02A 4IG7B 1MD2D 4OELB 1QUQA 4GOPA 1CQVA 1L2NA 3AULA 1Y1VG 4HJKA 1WGYA 4W9DA 1PTOB 3M63B 3G6EA 4A3KB 4A3GG 4BKSD 1TS5A 3F2DA 2JRIB 1OFFA 3EC8A 2MQHA 3PV1A 1XTCD 1GOZA 5ELCA 4MH0E 5JHAA 1H9RA 2NTTA 1F9SA 1YNTE 1IBXB 3LDZE 3B0AA 3ONAB 3ZDMC 1KHIA 1V43A 2IJ0A 3DMUA 2MHVA 3TN2A 1ET6A 2KCMA 2Y0SB 3H9DA 1J7BA 2SNSA 4HCPB 5EDSA 1QF6A 2B3AA 2JXMB 2L1BA 3IRBA 1V80A 2K1BA 1XMQL 2BS4B 3RZOB 3RNFC 3VR9B 1NE3A 2MNAA 1AZQA 4HCNB 2WP8J 1K3RA 2M2LA 4FXCA 1HNWQ 1RAXA 2J53A 4N8FA 1I4PA 3TS0A 3CSFA 2F52A 2L0CA 3CU7A 1XX8A 2WLBA 4LFCQ 1EU4A 1STGA 3EFCA 4QAYA 1GC7A 1Q3LA 4Y7NH 2NN6H 3P2BA 3IL8A 1H95A 1H9MA 3V6EB 2ONQA 1L0YB 2BE5D 1WD0A 4HWIB 4BOZB 4GLAC 1M1KC 2VZKD 4R4OA 4A3MB 1UGMA 2LVQA 2F0GA 1FL0A 2JK8A 1E8YA 2HTME 4GN5A 4LTUA 2LD9A 2INPE 3AEDB 3A55A 3U2SC 1BCPB 4PNYA 4W9HA 1I4GA 2J7ZA 1V81A 5C2TB 3AMUA 1A2TA 1PZKD 2IDYA 1ZE3D 4M8AA 3IFWB 3S16B 1V97A 3QOJA 4GNXA 2PEAA 4QY7A 4GDKB 4IUPA 4ZKCB 4US8A 4HPLB 1WFYA 3D3RA 3SXHA 4C3JB 4PQXA 5IWAL 2C5CA 4LF4Q 2JA7H 1WVLA 1XLNA 3BVZA 3AECB 1HFGA 4CDFC 1N8RC 3HOUB 4MJSB 3L7ZC 2OF1A 1EIHA 2SDFA 1JQYD 2K14A 5LMUL 3V60A 3UINB 3QQ8B 5CHVC 2KECA 1EIGA 2KEDA 2AL6A 3MHZA 2Y5PA 1SNQA 2OQKA 3ZLZA 2M9VA 1VMPA 2QMTA 4XYOA 4TV3A 1IKLA 1E3PA 2RF4A 4K14A 4OWWB 2CR5A 4BKGA 4B9KA 1ZUD2 2I1KA 4X3SA 2MRPA 3EFUA 2FFKB 4F8MA 3J7YW 1VJKA 3QJYA 1SFOB 1EQQA 1WCMH 1A63A 3AU5A 4BKSA 2EKEC 1LTAD 3MC8A 3FC4A 4P72A 1Y1WH 3VAWA 1YIWA 4GDLB 3HOZB 2CH4W 3PMFA 4I6LB 3DHGC 5NUCA 2D2CC 2RDHA 5HGQA 4GXBA 4II2B 4LFCL 4DV2Q 3LXFA 4KDLB 5FJ8G 1I6HB 3GV6A 2CWPA 4JOIC 4R4TA 1OTRB 2W3SA 2J4XA 1H9SB 3R8BA 1J5EL 2OHFA 4DDID 1UH6A 2FIFA 3GO5A 2F0MA 3SVMA 1RKNA 4JC0A 4BY7H 1G2TA 2AL3A 3NWTA 3R66C 5IYBH 3U58A 2H88B 5CX3A 2TSSA 3CRLC 3D6WA 3H0GB 2K5WA 3NE5B 3DBLI 2KAJA 3IFDA 1TZ1A 4B6WA 2IO1B 3RZOH 3WOFA 1SYCA 4BWGB 3JSVA 2PQAA 1IXRA 1QJOA 5JEAJ 1QVCA 4TKOB 5AUIA 1PH6A 4DK0A 5HURA 3GQBA 1HR0W 1TKYA 4KD4A 3PO2G 1TWFB 4LMQD 1HZAA 1DOIA 4CO7A 5JPMC 1FNVA 1HQRD 1GNUA 2EQSA 4XQJA 3MXNA 1Y8PB 1TWAB 4OZBA 2L9HA 4A3FH 1JALA 1FGBD 2E2JB 1PHJA 4DK1A 5AJ3Q 4XGAB 4QGUA 5JPNC 4IFDH 1Y1VH 4MM3B 1CZWA 2WKDA 3ZDTA 4RNAA 5C4ZA 1DCZA 2A74C 4GLSC 3WALA 3RYTA 2BTEA 1JWMD 2WIIB 3U4ZA 1BVSA 1E2WA 3HVDA 2F0WA 1YX6B 4PG3A 2HJ8A 2PJHA 1ZXTA 3S16H 2D0PA 1BR9A 2PIAA 2XRSD 1EEFD 2R7ZG 4QJFA 4YCWA 3NSWA 4GS3A 1F52A 3OG5A 1V5TA 4A90A 4B0MA 3K5MA 4ZUIA 4C3JH 1IBLL 1T3QA 4QQBX 1LTBD 4ME3A 2JUOA 4P1BC 1ML0D 5E6JA 1LGRA 3V61A 2OJRA 5BN5A 2DZJA 3OMGA 3ZJYC 3S1QB 1G91A 5HFYA 3RNUA 1WYDA 1WTVA 1BDOA 2B2VA 1VF5C 2MPMA 2F0IA 3RN2A 3RZDH 3ML8A 5JJZA 1SNDA 3DWPA 4QL5A 5C0XJ 1K8AC 1CMXB 2ASQA 5CHFA 4A9AA 4RHSA 3I2ZA 1VQFA 1YNNC 1CKOA 1AEXA 5FLXL 5C23A 3CC7A 4Y52H 1SE4A 1SE8A 4A3BG 3QAQA 1SYEA 4KKTA 2ZCCA 3RNCC 3QWNA 1DJRD 5M3FG 4GB9A 1R4PB 2MBQA 3WIMA 1CHQD 1Z5SB 1Y56A 3NTKA 4DPGA 4GZYC 3SK5A 2HE7A 4OZCA 2XGTA 5BR8Q 2E2DC 4CGYB 1J8IA 5LL6S 1FM0D 1N6ZA 2L55A 2JXTA 1UWXA 4NMZA 3D32A 4IUMB 1E1TA 4M01A 3NBIA 1YJIA 1E1OA 2A8VA 4KKJA 4UP7A 5EGTA 1YN3A 2EELA 1VQ8A 1VS0A 2HQEA 1T5XD 4OL7A 5AJ3L 1UE1A 4CKCA 2OXPA 3RN5A 4G50A 1W6KA 2NBWB 3UF8A 2E3TA 4HDOA 4K2KA 1KTKA 1YQ3B 3JW0X 1TWGB 1HNXQ 2VNUD 3E9IA 2B29A 3PSIA 5C4JH 3K81C 4DKAC 4YTNB 1SBBB 3DWAA 5FO8B 3CC4A 3H3VC 1F2RC 4K5WA 2DWQA 3IAYA 4LFAL 4RGTA 1VF7A 1V9PA 3RT3B 2EE1A 2WXGA 3IHPC 4YSXB 2UXCQ 1XT9B 2Z1CA 2K5PA 3PHWB 4WJ4A 1QILA 5BMIA 4KK7A 1GJZA 1TWFH 1Y8RC 2WKCA 2NVQB 4I65A 2PI2E 1SJHD 2KVRA 1DOMA 3GV3A 1JCKB 4RHRA 3CF5A 2IGDA 1QZHA 2CVRA 2A6HC 1BUVT 2PQEA 5I2YA 3I4OA 2XWBB 1IBMQ 4ANVA 5FO7B 1L2FA 4RWSC 2K39A 2QHOA 4NAWB 4XXEA 2B8GA 4L23A 1G8ZD 4GNXC 1UBQA 1XCQL 1KQSA 3TP5A 4WIPA 4NKLA 1JQ4A 3A9KA 2PI2A 1Q7YC 2D07B 1L4ZB 3L10B 2RCFA 3TBIB 4H13C 3A4SC 3H6NA 3EVQA 3VYRA 3AEEB 2IX0A 5FO9B 3QC8B 4IWPA 2YV5A 3PIO3 5HGTA 1TWHH 3AB9A 4AP4C 1WX8A 5BYQA 3S17H 4K81A 5BR8L 4CHTB 2MO0A 3A7LA 4BBRG 3MEHA 3HKSA 2V9HA 1KIXA 2KDBA 3A33B 4FF1A 2KENA 4Q5VA 1EY5A 3PO2H 4OO1I 4A3JB 2WHIA 4A93G 2X8XX 2HCIA 2ZPYA 5FLXE 5T8IA 5JJIA 2YYZA 4OZAA 1FCCC 3PTFC 5HG2A 1B9RA 3K5OA 2JP1A 3ZVVA 2NS5A 1P8LA 1RTNA 4YHHQ 1BF4A 1HNXL 1EWHA 4IQZA 2BA0A 3Q24A 3SK8A 3HOXB 1QUQB 1KF6B 1TYGB 1V8CA 4KIKA 3TIXA 5C6AA 3UI2A 5D94A 2X38A 1DOLA 5AZHA 2A68D 2IPKD 2UXCL 1WRDB 2NWGA 3UGBB 5D7GA 2KFKA 2NTSA 2N1WA 1QNKA 4WJNA 1G291 2KMAA 4TQUS 2KCTA 3S15B 5IO9A 4A3IB 2UU9L 1UBIA 1UF0A 1WGKA 1SN8A 4TQ0A 3W5OA 5EAYA 1OO9B 4FJVB 2XWJB 4DUZL 4L5QA 2LMCA 2ZCBA 2ZJDA 1C79A 3PT2B 4X66Q 2E6XA 4KZ0A 1FO4A 1VQ6A 2IO2B 5IP7G 4JI5Q 2NR2A 3T8MA 5IP4D 1M94A 3QWZB 1EY8A 1CI3M 3Q3FA 1TZOA 2A4ZA 4LNNA 1HZ9A 5C4XG 2QKIC 4JG2A 5EPLA 3TEWA 1B9NA 3O13A 5JHBA 1ENCA 1SE9A 2DNFA 1IBKL 1EYAA 1V1PA 1YZ6A 2IY1B 5M3FH 1XLQA 5ELNA 4HDQA 2LKVA 5ELOA 1ROEA 1JWSD 1F77A 2NVQH 1Y14B 3BK1A 3NK9A 5E3FA 1C9FA 1KOTA 3HKZE 1Y8NB 2JA8G 4WJPA 1WGDA 2K3UA 5EE9A 1X65A 2K8CA 4UHVA 2G4DB 2LXJA 4R4CA 5L37A 4URKA 5C44B 5I2XA 4GNXB 2E2IH 2IGGA 2L0FA 3HOYG 3M4OH 1A15A 3CCUA 4KDIC 3GTLH 3OYYA 3WANA 2JZZA 4R4IA 3KYDD 3GTMB 2M0AA 3HOWB 2ZTDA 5C5LA 4C7ZA 1R4MB 3F1ZA 3NZSA 1XQQA 2FBWB 1VCIA 2R7DA 1XYIA 2F4VQ 1NMFA 1VQBA 2IW3A 3F8TA 5JOBA 1EY9A 3UDFA 1Y69U 2JYOA 4O1NA 4DAVA 1MG8A 2V3PA 2B63G 4BBSG 1LUZA 3Q3NC 3UDIA 2D5GA 2KD0A 2B2VC 3K8AA 2WGSA 2RQXA 1S3OA 5JAVA 3UDGA 2OEDA 4DK5A 1KABA 4XWWA 3CCMA 5D14A 2K0PA 5G55A 3JVZX 4RKBA 5KGUA 3KK7A 4LDTB 4KSKC 2RDBC 2BYEA 4R8IA 2IL8A 1EM7A 5C1ZA 1GUGA 1E8XA 4KHPQ 2IY5B 1KLVA 1EWYC 5FR3A 3STBD 4GDKA 1SYGA 1X3QA 4X66L 2JT4B 1GXDC 3P4RB 1HRJA 2KX0A 4BBNC 4RA8A 3RZWC 4AS1A 5GAHC 3MEFA 1C4CA 1CZPA 3M7NA 2CS4A 5FK9C 2MEKA 5HHDG 4LJOB 2A73B 3SD5A 1GUOA 4WQMA 1AN8A 2PMZB 4MJSA 2JA5B 1A6XA 4M00A 3HOVB 1O78A 3QIAA 4ARCA 4C2MH 1Q81C 1PH2A 2KXJA 1ICFB 4DN4M 4BY1B 2KCCA 3M4PA 4GKKL 2KBNA 1PH7A 4LUZA 3A8KE 1JJCB 2JEAI 3HK0A 2WQYB 1TIFA 2XNAC 2VRRB 4DUYQ 1SIFA 3DWGC 4BBRH 2N55A 4S17A 4MACA 2AWOA 3H6MA 1JORA 4LJPB 3APCA 2PQAB 2F3WA 3JSVB 5JJLA 5IYCH 4YCUA 3PIPA 1C1YB 1H4RA 1ZP0B 3MXPA 2I38A 3MXGA 3BDLA 4GDLA 4JWSC 5CC4A 3VR4A 3H3VH 3CQZH 4XT1B 3CCVA 1XF5L 1TT5B 4IOIE 4NJCA 1DOYA 2K6QA 5BMGA 3V2TA 2F4VL 2HQLA 1X32A 4DR7Q 3CPWA 2HIXA 2RSNA 2C7MB 1E90A 1VR9A 1K8RB 2XEWA 5GROA 2WINB 2IGHA 1TKEA 3AEBB 4ARIA 2IO0B 2L0TA 3QJZA 3S1NH 5E7NA 1SE2A 4HIKA 2IYDB 2L52A 1O7LA 4EKUA 4RGNA 4ITKA 1L6UA 1I94L 1EUVB 2EVBA 3AU4A 3CP0A 3FP9A 3CCJA 2FMCA 1P7EA 4IM0A 4OGQC 2VW9A 3JAML 2B2UA 5C0XI 4HN7A 4A3EH 1YQBA 4B95A 3R3MA 1W6JA 3TRZA 4KHPL 2A69C 2L4NA 1N61A 2KCNA 3GTPH 2WXLA 2G45B 5BN4A 4HRSA 1MJCA 4EFOA 3EA6A 4ZRKA 1T0QC 5FR6A 4RMFA 1K50A 1E7UA 1HTLD 5IP7H 1C7YA 2L7RA 3NVVA 1KAWA 4ZRZA 2EOTA 4A55A 4DXAB 4CJ2C 2N78A 1SR3A 4P7IA 1TY2A 4MM3A 3KF8B 4DV5Q 1XD3B 2ZEQA 4WWPA 3KLSA 2P5ZX 2L5TA 1WTHA 5J39A 3PV0A 1LM8B 3ZO5B 4DUYL 1YNJD 3I4NG 5H92C 1NYRA 3IG3A 1VQ7A 1KLUD 4NQKE 3KF6A 1QOGA 1PYSB 3EFXD 1E6EB 4PZ6A 4HR7B 2NBFA 1AWDA 2MCNB 5I9OA 3QO2A 4A3DG 1R9TB 3OSOA 1AZPA 3PLUA 2QIEB 2LVOA 4A6QA 4NJ6A 1VQKA 1R4NB 4IKGA 1PZID 4JI8Q 3IAS1 1FMAD 2V3SA 1T0SC 2M8SA 4KN4C 5IODA 1GB1A 2E2HH 1WE7A 5LL6X 2BS3B 2FCMA 5M5WB 1DYQA 2BW2A 3PZ7A 3KUDB 5G5HA 1L0WA 3PUXA 3C2PA 4FN2A 1WJ4A 4LF8Q 1QZGA 4A3CH 1FXAA 1STHA 2LEKA 2QDBA 2DAJA 3DEPA 1E7PB 1WRIA 2CU3A 1PRTD 4PMBA 1I35A 1PH1A 3D31A 4A3LG 3GTJB 2R2OA 3ECIA 2KHWB 2ZVOA 1KLGD 3RNEC 3Q8AA 2MJ3A 1E24A 3LGJA 3T56B 1LTLA 3S2DH 2ZM6Q 5M3MB 4H44C 2V0GA 4LNOA 2PCFB 4RMAA 3K5LA 3NBHB 4FHKA 1WZ0A 2EY2A 1C76A 1YN4A 2I0QA 2C9WB 3D4DA 1F0ZA 4UAIA 2UWQA 1MHXA 1K83B 2V3NA 1D7QA 2K5HA 2VY3A 4JOIA 1SJED 3EHVA 1WYWB 4C3IB 2OOBB 1DGSA 4APVA 2M1MA 3L0WB 2IWHA 1K73C 1XPOA 1BUIC 1EF5A 2ICEC 4NB3A 2B2WA 2JA7G 4TKNA 2QGQA 5M9OA 4DV5L 4ANUA 4KGSA 1D3ZA 2F0DA 4FXKC 2WU2B 1IGDA 4JI0Q 3JAME 2CQAA 2GBNA 1P1AA 1PFSA 1Z9FA 3OTOQ 4MTNA 3IT4B 2WXJA 1PV4A 2BE5C 4CJ1B 2FUHB 2PNHA 1NMGA 4ID6A 2H4OA 1AP0A 2C7HA 3H7PA 3VRBB 2LXCA 3K7AB 1X3FA 4KKIA 4LWCA 4IOAA 3DOWA 1SNOA 1K51A 1ZXHA 2JN4A 2I46A 1OQQA 1CHPD 2VXWA 4DAPA 3IFTA 2KVZA 3U30A 2WX0A 5GXGB 4JI8L 2K6DB 2NVUI 3CCLA 3DM1A 4B3TQ 1JJGA 4AIMA 2F0LA 2OTLA 4JI3Q 1E10A 2N1VA 3PCOB 2UXBQ 3TP7A 5TR5A 1WJ6A 2RHSB 3RD4A 4NAWA 2I2YA 4N9TA 4AQYQ 3W5UB 1IHZA 2DJGC 3TL5A 1IYJB 3AE8B 5FOBB 4KJNA 1H9KA 2Q2TA 3BWUD 4W9KA 5AUKA 4WJQA 3UQBA 2SNMA 1HUMA 4KIKB 4BY7G 1OXVA 2X6GA 3AE9B 3FKIH 5IYBG 2IBIB 1ESRA 2ZM6L 1LQBA 1NSNS 5M5XB 3EUB2 3K0XA 4HLEA 2Y0SG 3J7ZC 2QEXA 1GUAB 2L05A 1UE6A 2KHJA 3Q3JA 1NVID 2NZHA 2IHFA 4IJLA 5HY6A 4IWOA 4F7XA 5JXVA 1LXDA 3NJTA 5IT9L 3SR1A 1FVIA 4ZHOA 4GSWA 2KZRA 2K8HA 1NAPA 4US9A 2BT6A 2FCSA 4NZLB 1FPYA 4MSQB 4CHKA 1XCTL 3QB3A 5C5MA 4DV1L 2KWVB 2K4KA 2AYOB 2YEPF 1J7AA 4PT5A 5T1GA 2LMCB 1IL8A 4A3OA 2KQ4X 3HUIA 1N63A 1V8QA 3BK2A 5C3EB 5JVH3 3PREA 4A3FG 4JI0L 4M8MA 3GTJH 2N9PC 2Q8IB 3PHXB 4CDEC 4LNIA 3H94A 3L2PA 2KACA 2MJEA 1PH5A 2MBOA 3OTOL 4IFDG 1CM9A 4A3MG 2HIVA 2I1JA 1FD6A 4HAEA 3TEYA 1FD7D 1LT3D 2UUAQ 1V1PB 4EQ5A 4JI4Q 3I4NH 1BT0A 4CQNA 2CHZA 4WAAA 1OEYJ 3NVYA 5EE0A 3W1GA 4DR5Q 3S2HB 4LJZC 3ZNGC 4A3DH 2V1YA 2W55A 3OOCA 4B3TL 2VS1A 3A8IE 4JI3L 1D1IA 3CD6A 3TEZA 1CUKA 2UXBL 4C3JG 2K33A 5KRUA 2B2UC 3R3OA 3V62A 3W3AA 4MEMA 3ND9A 3OAWA 1IL2A 5G5GA 4AQYL 1GB4A 5GQOA 3HOUG 4DWFA 4H02A 3HKZB 1RIPA 4JI7L 4TRDA 5T1IA 3NP8A 2ICIA 3JAMc 2VZKB 4QUFA 4WWMA 3TZDA 1I50H 1VQCA 4HVBA 1VDVA 3L17A 1XWEA 4A3LH 1TR5A 1LFDA 2KJ6A 3NXWA 2EY5A 4Z9CB 1NYQA 2AEHA 1CSQA 4KSLC 4F1SA 1DD2A 3TQYA 1E2VA 3OPOA 1RRBA 3PZ8A 1Q0WB 4UDUC 1JMLA 4KMUC 1J19A 4YWMA 2JSVX 3Q6SA 3GD7A 4HCSA 4BA2I 1SSOA 2CWAA 4KV6A 4L5TA 2WFWA 1PGBA 3V3XA 1XEEA 3K5NA 3DVGX 3HOZG 3DBSA 4K7SA 2E75C 3FPPA 1LTID 3NEMA 5LMNL 2W3RA 4YT0B 2PPHA 4NDXA 3UIPB 4ODGA 3A5UA 1A3UA 3WAMA 1MIUA 3NENA 3P75A 1NI2A 4QIWE 3AN1A 4X65Q 4A3GB 2HDEA 2J0JA 4P2CB 1UZXB 3AEFB 2VH1A 3F2BA 4C3HB 3H0GG
chains in the Genus database with same CATH topology
5DEHA 5IT9E 1EY7A 1FNWA 2EYMA 3RPFC 3I3CA 1JWAD 4XT3B 1WTWA 1QG7A 3EJIA 1LTRD 3EQLC 4IZ8A 2KN4A 3BDOA 3U9OA 1I4XA 4ZQ3A 2Q8TA 4QF4A 1QNUA 1D1KA 1UGJA 1STEA 4JK1C 1ZYRD 5J22A 3R2TA 1PTOH 2WDQB 1Y8OB 4ZKBB 1WTXA 2B2WC 1YMHE 2GB1A 4HKQA 3M7GA 4C80A 4G4KA 1QWYA 3S9WA 4S3SA 4IUUA 2VUMB 1FRRA 1JC7A 4K8JA 3B2GA 1FRDA 2R93B 1R4QB 1C4AA 1LTGD 3A56A 4FF4A 1EYDA 3H91A 3WCQA 1DOYA 5ELDA 3URYA 3CKIB 1T5EA 3KLSX 2RA4A 3CRKC 2EYFA 1BBXC 2HDMA 3K0YA 5ISRA 2C9OA 1C78A 1NENB 4X3KA 2WDRB 2WU5B 3TP8A 1E0ZA 1I4HA 5BN3A 3PO3B 1ZOYB 4OO1H 4WURA 2DY7A 2EYOA 2PKOA 1UWMA 3NZ3A 4FP5D 4L8JA 3G7LA 3BIID 3P63A 4YTMB 4F88A 2F0UA 2K28A 3PUWA 5E4WC 1CFMA 4K5VA 2LS01 4FF3A 1HHVA 3KF8A 2L83A 2F0VA 4EQPA 3DEOA 3NQIA 4KY5A 1CJEA 5C3WA 2XSCA 3I4MB 5J1ZA 1EYCA 2K32A 3WOEA 2A68C 1HCZA 4J1MA 1LV9A 2WNMA 4HKZE 4IDIA 4XDDA 1FCLA 1N5XA 5KYIA 1U4PA 3L3OC 3I73A 1B44D 1DZ1A 3C1EA 1IUEA 1E9MA 2D62A 2NVYB 1D5XC 2ZW0A 2F1MA 1HQMC 3I72A 3AE2B 1RD9D 1BOSA 4EQOA 3KWLA 1VMCA 4HJGE 1B4OA 2CW0D 2L12A 5E4XA 1A70A 3NVZA 2NVTB 5CBAE 2KA7A 3HS0C 3X3MA 4B08A 1F2LA 4YSZB 1EY0A 3NBHA 2EYLA 2Y3AA 3RFZB 4XIGS 1SNCA 4FXDA 5IGGA 3S1MB 3HEJA 3S14B 1UEAB 3PIP3 3ND8A 5IIFA 5IGBA 5F2DA 1SDFA 3V05A 3VR6A 1B9MA 4LAAA 4LK0M 2QF7A 1JB3A 4DNRB 4N9PA 3J80E 2F0FA 2HCCA 4LK1C 2PNRC 4WORA 4IUVA 3AB5A 2DLBA 3ZJUA 3Q8CA 3KLRA 3KBGA 3VYTA 4DNTB 4DA2A 1PZJD 4KI0A 4D2KA 3LYYA 2FMMA 4G7HC 1ICWA 2WXRA 1DOXA 5EKKA 4H0LC 2F0NA 3GS2A 2DNCA 1STYA 1ESFA 1BNZA 1UNSA 2AQ1B 4JWUC 3K57A 1NEKB 1HEZE 4OW0A 1HZ6A 3VQIA 4AQ7A 1ACCA 5EPKA 2Z8LA 3TP6A 1TKWB 3CWIA 1YNND 2EJGC 2LFIA 2O5JC 5K5PA 2BBCA 2HDLA 2NVXB 5I4DA 2F0PA 1SYDA 2JE6I 4HEA1 5E1FA 2KEEA 1EL0A 3A54A 1EZ8A 1JOQA 3MC0B 5COYA 3HRZC 1J9OA 4J6HA 2B2TA 4ZUJA 3NQTA 2B39A 3AE3B 5IGFA 2AQ3B 2K5DA 2QILA 1VZ7A 3BVMA 3A7AB 5DM73 3GTOB 2F3VA 2FHTA 4N59A 4RH6A 2EYHA 4G7OC 2H1EA 3MJ5A 1TVXA 1ILQA 4L6TB 4R9WA 3E0JA 4HMIA 2IX3A 2QCPX 4RGOS 2LHDA 5LHY1 1YNJC 1EFID 4DXFA 3X3NA 4QIWB 2F0KA 2MJ8A 4XTCS 1TS2A 2DYOA 3IAM1 3BG3A 3L9AX 1RCVD 4K5XA 4RGMA 4N58A 2RVLA 2H89B 3TZUA 1AFPA 1CT1D 1OXTA 3ZQ4A 2ZT9C 2GA4B 3FDTA 1K8OA 1K8MA 2PW7A 1S5FD 4NP5A 4YXDB 3H8HA 1AYFA 2MP1A 4K2LA 1OQRA 2JA8B 3SK6A 3U7ZA 1SNPA 4KHVA 4KX6B 2RKSA 1F9QA 1CA5A 1NCVA 1E0BA 1NR2A 3HOYB 4QB4A 2SEBD 3KBXA 2EDGA 4TSSA 4DGZA 2ID0A 4PMWA 3I8ZA 2F0TA 3HGBA 2LFNA 3D6CA 4HEDA 2AWNA 1JRPA 1XLOA 4KN7C 4N6EB 2MH7A 2WAQB 4XQNA 4K8IA 4O42A 4BBSB 1KNEA 2KDMA 1SF0A 5C3JB 3OHXC 1HXYD 1F2YA 5DM63 1GPXA 3NPPA 3ERQA 2V4DA 1S5ED 1X3PA 1LT4D 1TS4A 2EXZA 4Q2JA 1OXXK 1JICA 3FPUB 5CV7A 1MI0A 1WTOA 1ZEQX 5BYSA 5CV9A 1LO5D 5IGDA 3HG9A 4RCOA 3LX0A 1ZDVA 3K59A 2A6ED 2MGSA 4IUTA 3E6ZX 2ENBA 4RAUC 3U9SA 3LNNA 2PZWA 3MWYW 2NZ1D 3SFDB 3N52A 4ILWA 4WFN3 3GTQB 2K7VA 1F2MA 3SE0A 1EZ6A 4K6DA 2F0HA 3P20A 2B76B 1ZPSA 3GTKB 3AU7A 3S1RB 4DF7A 5C3XA 1KH0A 2WXMA 2K01A 2JA6B 2MJDA 4C3IG 1JE4A 1S5DD 3OMCA 1I3QB 3NTIA 3Q8FA 2KVMA 5HI1A 4L63B 2VB3X 1PRTF 4OHJA 4PV1C 1SSNA 4HCEA 1TWCB 3M85A 1CA6A 2L11A 2NMQA 4REZA 5CV8A 1R7SA 3RMHA 3TDQA 2YU9B 3M3YB 2RDFA 4YIJA 3C8YA 2I07B 3F2UA 1XLPA 1BXTA 2B2TC 1BMLC 4NAMA 2PLPA 3MP9A 5EPJA 3FEWX 3NS1A 1TT2A 1CK1A 2WDVB 3LWEA 1EEID 3SHLA 1HA6A 1V1OA 3V96A 2WXNA 1F9RA 3I9V1 3U52E 1JOOA 3T4AC 1BO0A 1JW9D 3NHHA 1DOKA 2JQRB 4OVZA 2LJIA 2K9XA 3AE4B 4OIJA 4IUQA 1QOAA 2BDNA 1QKZA 3I70A 1VLBA 5C4HA 4Y7NB 3N9YC 4LLGM 1KFYB 5D3IB 1B1ZA 1IYUA 1PXUA 4FO2A 3J7AV 2DYMA 2BA1A 3D4RA 3RLFA 2A69D 1N60A 1FXIA 2E76C 3E56A 3T51B 1L0XB 1QB5D 1JWUD 4KY6A 2RDGA 1Z7TA 1ENFA 3PO0A 2XVSA 1LT5D 4WJWA 4QMGA 2YEPB 1SMYD 1PLFA 3ITPA 1CZGA 4V190 2JA7B 4DAYA 1FFUA 1EOTA 1QOHA 1ZYRC 5EKLA 1I7HA 1TS3A 2JZPA 2VB2X 2QEJC 3P1HA 3FMCA 3M4YA 5M5YB 2DBYA 1STBA 4XYQA 4U68A 2EZVA 2V4IB 4B9WA 4KGTA 2NB0A 1RHPA 3VRAB 2FJ2A 4JPSA 2KMMA 3KWVA 4IFDJ 4IN3A 1WCMB 1GUNA 3AH7A 2JYEA 4XE0A 4I7ZC 1Y1WB 4OO1G 4IALA 2EPBA 3AE6B 1SEBD 2WXFA 2IT1A 4CBVA 1B53A 1ZXIA 2XIWA 1D5MC 3VR3A 1PTOF 4KJOA 4ZAIA 4C3HG 1GHKA 4BY7B 4KHZA 4ZRQA 1PTOD 2KUMA 2O5IC 1SYBA 3R2IA 4L2YA 4U673 1OXSC 3P1MA 5EE1A 4DXGA 1IW7D 4BS9A 1LT6D 4M1UB 1JROA 4EVOA 4PMCA 1MGSA 5EBCA 5JVG3 1XXGA 2KOLA 3KUPA 2PZTA 3WDNA 2N7JA 3T3NA 4ZLTF 5I6YA 4X3UA 5KIXA 1Z6HA 3HZXA 4FYDA 4A3FB 1KDBA 1TU2B 2L32A 2D5DA 1LTTD 5DAUA 1TIID 1Y1VB 3BVGA 3CIRB 4JBWA 3K6OA 4FVMA 1EY4A 4RCNA 4ZK9B 3ZJTA 4CJ0B 1BCPF 3TEXA 3OIQA 1HUNA 2Y5CA 2JSOA 1BCPD 1QE6A 4IUNA 3VR8B 3AE7B 4YWGG 5ELEA 5EE3A 3IKJA 4M0WA 2KJXA 1QOBA 4NW2A 3BS1A 2KHSA 3J81L 2LHEA 2WACA 1M8AA 3VYUA 3RZDB 1KRHA 1Q12A 2Z4HA 2EJFC 2RMMA 4MT5A 3T16A 1DXMA 3AMZA 2CW0C 3Q22A 4FNFA 3SK4A 4V0BA 2PW5A 3LWUA 2F4IA 2PZUA 4DFAA 1O7YA 1CQFA 1PGXA 2ZXPA 1FFVA 3PUVA 1MSHA 2EJMA 2AUKA 4YSYB 2WXKA 1FNUA 2BCOA 3J9CA 1FR3A 1MVKA 5JEAG 4IURA 1QCBD 1I4QA 5CV6A 1Q90A 5C4JB 3GB1A 1L4DB 4WRDA 4CKEA 4C7YA 5LNK1 3AE5B 4RF0A 5TSSA 5EJWA 3DWQA 2WXHA 2F0SA 4RF1A 1EQTA 1YN5A 4X3TA 3RUZA 4C1NI 3J80L 3SEBA 3AE1B 4K6LA 2JX5A 4CKBA 3N6RA 1RJTA 1DM0B 1GJXA 1C4QA 2NN6I 1G2SA 4KGRA 1U4LA 3FAHA 2EYPA 1VDZA 2WS3B 2XN9C 1STAA 4FXGC 3NWSA 1TWHB 1P7FA 3I4LA 3S17B 3HVZA 1ZKOA 5C0XG 2J52A 3J81E 1TJEA 4FF2A 4XQQA 4YTPB 3GTGB 2ZXOA 5D65A 2J42A 3W2DA 1D5ZC 2CHBD 4KKSA 3C46A 3PO2B 3MTSA 3DWMA 3L4PA 2OEOA 3T53B 2FINB 1HA5A 5AFWA 1STNA 2K5QA 2BS2B 1AW7A 3VA7A 3B2FA 1IGCA 3P4QB 1EU3A 1F2ZA 1LACA 1HFNA 4KD3A 3ZYYX 5A35A 5EQ0A 1RM6C 4C56C 1A3TA 1PFBA 2B8FA 3J7AF 1Q10A 1F9PA 4USAA 2R7ZB 4KKUA 1B3AA 4R3DA 1MBYA 3T3OA 1OXUA 5KYLA 3UI3A 4H7BA 3PUZA 3B9JA 2WXQA 2R61A 2ZXRA 2K6AA 2NYZD 1MHHE 2O2LD 3TSSA 4P6VF 4MN3A 1M4VA 1TKGA 4WH4A 4A3BB 4XDCA 2GI9A 1C8CA 3BZDB 5M3FB 5CV5A 2INNE 4XDXA 1G6ZA 4EQNA 3MHBA 1GUWA 3W1SA 4QUCA 5IGEA 2E2IB 1PUTA 3M4OB 1DGJA 3GP7A 1D2BA 1NI3A 1NUCA 1JR0D 1SE3A 2RBMA 3GTLB 3P4PB 1SAPA 1WTQA 1IYVA 1FEHA 1HZ5A 3Q0AA 5BYRA 2F0JA 5JEAH 1ONLA 3I90A 4IFDI 2Z4IA 1O80A 1H9JA 2DNEA 5I6WA 3FILA 2M19A 2EY1A 5CGKA 1EY6A 3Q69A 2EKIA 3SFEB 3NRZA 2PPBC 3AM9A 5EBDA 3MFGA 1LABA 3BYTB 4G7ZC 2JYTA 2D9UA 1SNMA 3EROA 3LB8C 2WXOA 4G57A 3NUHB 2RSOA 1WTPA 1SYFA 2XRQD 1J7CA 3KQ4A 1XO3A 4A8XC 4KY7A 3MAQA 3ABVB 1C48A 3T13A 1L6VA 2KQ3A 4C2MB 1KDAA 2X6LA 2RPVA 4KTAA 2ACZB 5DNFA 1KNAA 4ULLA 5D3DA 5C0XH 4BBRB 2LUMA 3Q8BA 3P4SB 4TMAB 3OIPA 4ZOHC 1RDPD 2FUG1 2WB1B 3AEAB 5KEEA 2N0SB 2M00A 2BYTA 4P16A 5A2QL 2WXIA 3Q8EA 4A93B 1FYCA 2WV6D 3CQZB 1S5CD 3NVWA 1GHJA 3MXUA 3P7JA 2M56B 1UUPA 3W5VB 3PUYA 2A6EC 1HTPA 2JU6X 4DU9A 1IBXA 1EWCA 3S1NB 5KNDA 4JE3B 3IXSA 3C3LA 2AX5A 1D4BA 2O4XA 4TQ1A 5KNBA 2G9HD 1L0VB 2BB6A 2KWDA 4A3EB 3P42A 4EGVA 1YQ4B 3HRDD 3GTPB 2A6HD 2B2YA 2TMPA 3SDZA 3DXJC 2N9KA 2EYJA 1S4ZA 5KNCA 3FRPB 5ELFA 3OWEB 3VYSA 4J3OD 1Q8IA 5C4XB 3DUZA 4OIKA 1EQVA 1GAQB 3C1FA 2G9DA 2WXPA 2DY8A 3NUCA 1L5PA 1PRTC 4RFBA 1QLBB 1PYWD 4B9XA 5FKAC 1C4PA 4B0EA 3D8GA 2AQ2B 4L1BA 2FE8A 2ON8A 1VRAB 1RODA 1B50A 2E2HB 1LLRD 1I6VC 4EE2A 3IT6B 2Q5WD 2GRIA 4C1NK 2OT2A 5G3LF 3H09A 1GUTA 2B63B 1WD1A 2SAKA 4XWTA 2LY7A 3BYYB 2PW9A 5G3LD 1WYGA 2N88A 2CJNA 1PGAA 2F0OA 2DN8A 4AYBB 3I91A 5A2QE 4WAFA 2R6GA 3S2DB 2BB5A 2F0QA 2R3ZA 2NUCA 3TMEA 1QT9A 1K53A 2W54A 4HTHA 2G1EA 1WTRA 1H9SA 3A8JE 1NR4A 1PMRA 2PVGC 2IX1A 5CMDA 4H2AA 2BDOA 2K22A 3FVQA 1JOKA 2BOSA 3E9SA 3G6JB 1Q1BA 3CHBD 5K36G 1ILPA 1VZ6A 4ZYSA 2PMVA 4MIUA 2QJLA 1DONA 3SR6A 3OW7A 1N5WA 3ZJVA 1LTSD 5I9PA 1U4MA 2J0TD 4R8NA 3E5SA 1ET9A 1S5BD 3NTHA 2PYKA 1SMYC 4ZRPA 5CYUA 1MSGA 3VR2A 1K52A 1RYJA 2LGIA 3D4WA 3W9CB 1PRTB 1PFNA 1QQRA 1VZ8A 1IKMA 2F0EA 5H8YE 1PDQA 1PFMA 2PO4A 2CJOA 1HPCA 3FKIB 3I57A 3QOLA 1YJJA 2PTLA 1B2TA 4HROA 3MVVA 5CORA 1E2ZA 2X69A 2QSDA 1SXTA 1MI2A 2PVOD 1PDXA 5IGCA 1SIJA 1WWTA 5ELBA 1D6EC 2MUYA 3MFYA 1CTMA 2NN6G 1KAAA 2N9LA 5MPOA 1RF2D 3ZGZA 1ENAA 1U4RA 3Q23A 3VR5A 1GUSA 4DQOC 1PTOC 1BQQT 3I4NB 4ME5A 3OWFA 1T6BX 4BA1I 2K05A 4A3DB 1N62A 3MZ5A 1C77A 3U4EG 1IW7C 1FIQA 2AUJD 2ZW1A 4Q0FA 3VA5A 5CBEE 1F2RI 1Z47A 2JEBI 1TY0A 1UAPA 2B2YC 5EKIA 2A5HA 3TUOA 1I50B 4QCLA 3DHQA 2E74C 1II3A 4J8QA 2K03A 1PFDA 3FILB 4ABNA 2JWUA 1QOFA 4E6IA 5BMHA 3BDCA 4HMJA 1BCPC 3K58A 1ZDXA 1RFKA 4F87A 1Q1EA 2HUGA 3QG1A 5IOCA 2EY6A 3EGRA 1A3VA 3AEGB 1JWBD 3HP3A 1WSPA 1TQOA 4HSVA 5CV4A 3AV8A 1MPEA 2WP9B 1RTOA 3MA2B 1RWSA 4JX1C 3R93A 2F03A 5K36H 4MH8A 1A2UA 4HSPA 3ETRA 4MHEA 2L1AA 5CR3A 1SB3C 1WXQA 2SOBA 2K04A 1O7ZA 4RKLA 2W82A 1I4RA 1U9RA 1KDCA 4ZHPA 2Q8RE 2R92B 1MD2D 1CQVA 1PTOB 4A3KB 1TS5A 1OFFA 1XTCD 1GOZA 5ELCA 1H9RA 2NTTA 1F9SA 1YNTE 1IBXB 3ONAB 2IJ0A 1V43A 3DMUA 3PZ7A 2MHVA 3TN2A 1ET6A 2Y0SB 1QF6A 1J7BA 2SNSA 2JXMB 2L1BA 2BS4B 2K1BA 3RZOB 3VR9B 1AZQA 2WP8J 2M2LA 4FXCA 2J53A 1I4PA 2L0CA 3CU7A 2WLBA 1XX8A 1EU4A 1STGA 1Q3LA 2NN6H 3IL8A 1H9MA 2ONQA 1L0YB 2BE5D 1WD0A 2VZKD 4A3MB 2F0GA 2HTME 4LTUA 2INPE 3AEDB 3A55A 3U2SC 4PNYA 1BCPB 4YSXB 1I4GA 2J7ZA 5C2TB 3AMUA 1A2TA 1PZKD 2IDYA 1ZE3D 4M8AA 3S16B 1V97A 3QOJA 4GDKB 4IUPA 4ZKCB 4US8A 3D3RA 3SXHA 4C3JB 4PQXA 2C5CA 1WVLA 1XLNA 3BVZA 3AECB 1HFGA 3HOUB 3L7ZC 2OF1A 1EIHA 2SDFA 1JQYD 2KECA 1EIGA 2KEDA 3MHZA 2Y5PA 1SNQA 2M9VA 1VMPA 2QMTA 4XYOA 1IKLA 4K14A 1ZUD2 4X3SA 2FFKB 4F8MA 3J7YW 1VJKA 3QJYA 1SFOB 1LTAD 3FC4A 4GDLB 3HOZB 3PMFA 5NUCA 2D2CC 2RDHA 3LXFA 1I6HB 3GV6A 2W3SA 2J4XA 1H9SB 3R8BA 2OHFA 3GO5A 2F0MA 3SVMA 1RKNA 1G2TA 3NWTA 2H88B 2TSSA 3CRLC 3D6WA 3H0GB 2K5WA 3NE5B 2KAJA 3IFDA 3WOFA 1SYCA 4BWGB 5JEAJ 1QJOA 4TKOB 5AUIA 4DK0A 5HURA 3GQBA 1TKYA 4KD4A 1TWFB 4LMQD 1DOIA 5JPMC 1FNVA 1HQRD 4XQJA 3MXNA 1Y8PB 1TWAB 2L9HA 1JALA 1FGBD 2E2JB 4DK1A 5JPNC 4IFDH 4MM3B 1CZWA 2WKDA 4RNAA 5C4ZA 1DCZA 2A74C 4GLSC 2BTEA 1JWMD 2WIIB 1E2WA 3HVDA 2F0WA 1ZXTA 1BR9A 2PIAA 2XRSD 1EEFD 3NSWA 4B0MA 4A90A 3K5MA 4ZUIA 1T3QA 1LTBD 1ML0D 5E6JA 5BN5A 3OMGA 3S1QB 1G91A 5HFYA 1WTVA 1BDOA 2B2VA 1VF5C 2MPMA 2F0IA 5JJZA 1SNDA 3DWPA 5C0XJ 4A9AA 4RHSA 1YNNC 5FLXL 1AEXA 1SE4A 1SYEA 4KKTA 3QWNA 1DJRD 1R4PB 1CHQD 1Y56A 3NTKA 4GZYC 3SK5A 4OZCA 2E2DC 4CGYB 1J8IA 5LL6S 1FM0D 2L55A 2JXTA 1UWXA 4NMZA 3NBIA 1YJIA 4KKJA 5EGTA 1YN3A 2EELA 2HQEA 1T5XD 4OL7A 4CKCA 2OXPA 1W6KA 2E3TA 4K2KA 1KTKA 1YQ3B 1TWGB 2VNUD 4YTNB 1SBBB 3DWAA 5FO8B 1F2RC 3H3VC 4K5WA 2DWQA 3IAYA 4RGTA 1VF7A 2EE1A 2WXGA 2Z1CA 2K5PA 1QILA 5BMIA 4KK7A 2WKCA 2NVQB 4I65A 1SJHD 1DOMA 3GV3A 1JCKB 4RHRA 2IGDA 2CVRA 2A6HC 1BUVT 2PQEA 5I2YA 2XWBB 5FO7B 4RWSC 4NAWB 4XXEA 2B8GA 4L23A 1G8ZD 4WIPA 1XCQL 1JQ4A 3TP5A 4NKLA 1L4ZB 3TBIB 4H13C 3EVQA 3VYRA 3AEEB 2IX0A 5FO9B 3PIO3 5HGTA 3AB9A 5BYQA 4CHTB 3A7LA 3MEHA 4FF1A 4Q5VA 1EY5A 4OO1I 4A3JB 2HCIA 5T8IA 5FLXE 4OZAA 2YYZA 5HG2A 1FCCC 1B9RA 3K5OA 2JP1A 1BF4A 1RTNA 1EWHA 4IQZA 2BA0A 3Q24A 3SK8A 3HOXB 1TYGB 1KF6B 1V8CA 5C6AA 3UI2A 2X38A 1DOLA 2A68D 2IPKD 2NWGA 5D7GA 2NTSA 1QNKA 1G291 4TQUS 3S15B 4A3IB 1WGKA 4TQ0A 1OO9B 2XWJB 2LMCA 1C79A 2E6XA 1FO4A 1EY8A 1CI3M 1TZOA 2QKIC 3TEWA 5EPLA 1B9NA 3O13A 1ENCA 1EYAA 1V1PA 1XLQA 2LKVA 1ROEA 1JWSD 1F77A 3BK1A 3NK9A 5E3FA 1C9FA 1Y8NB 2K3UA 5EE9A 5C44B 5I2XA 2IGGA 1A15A 3GTMB 2M0AA 3HOWB 5C5LA 4C7ZA 2FBWB 1VCIA 1XYIA 2IW3A 5JOBA 1Y69U 2V3PA 1EY9A 4OZBA 2JYOA 4O1NA 4DAVA 2D5GA 2B2VC 2RQXA 5JAVA 2OEDA 1KABA 4XWWA 5D14A 2K0PA 4RKBA 5KGUA 3KK7A 4R8IA 2IL8A 1EM7A 1GUGA 1EWYC 5FR3A 1SYGA 1X3QA 1GXDC 3P4RB 1HRJA 4RA8A 4AS1A 1C4CA 1CZPA 2MEKA 3M7NA 5HHDG 5FK9C 2A73B 1GUOA 4WQMA 1AN8A 2PMZB 2JA5B 1A6XA 3HOVB 1O78A 3QIAA 4ARCA 4DN4M 4BY1B 2KCCA 3A8KE 2JEAI 2WQYB 2XNAC 3DWGC 2N55A 4MACA 2AWOA 3H6MA 1JORA 2F3WA 1ZP0B 3MXPA 2I38A 3MXGA 3BDLA 4JWSC 5CC4A 3VR4A 4XT1B 1XF5L 4IOIE 4NJCA 5BMGA 3V2TA 1X32A 2RSNA 1VR9A 2WINB 2IGHA 1TKEA 3AEBB 4ARIA 1SE2A 2L52A 1O7LA 4RGNA 4ITKA 1L6UA 2EVBA 1P7EA 2FMCA 4OGQC 3JAML 2B2UA 5C0XI 4HN7A 1W6JA 2A69C 2L4NA 1N61A 2KCNA 2WXLA 5BN4A 4HRSA 3EA6A 1K50A 1HTLD 3NVVA 4ZRZA 2EOTA 4A55A 4CJ2C 1TY2A 3KLSA 2L5TA 5J39A 3PV0A 1YNJD 5H92C 1NYRA 1KLUD 1QOGA 3EFXD 1E6EB 4HR7B 2NBFA 1AWDA 5I9OA 3QO2A 1R9TB 3OSOA 1AZPA 2QIEB 4A6QA 4IKGA 1PZID 3IAS1 1FMAD 1GB1A 4KN4C 5IODA 5LL6X 2BS3B 5M5WB 1DYQA 2BW2A 5G5HA 3PUXA 3C2PA 1FXAA 1STHA 2LEKA 2QDBA 3DEPA 1E7PB 1WRIA 2CU3A 1PRTD 4PMBA 3D31A 3GTJB 1KLGD 3Q8AA 2MJ3A 3T56B 5M3MB 4H44C 2V0GA 2PCFB 3K5LA 2EY2A 1C76A 1YN4A 3D4DA 1F0ZA 4UAIA 1MHXA 1K83B 2V3NA 1SJED 4C3IB 2IWHA 1BUIC 2ICEC 2B2WA 5M9OA 4KGSA 2F0DA 4FXKC 2WU2B 1IGDA 3JAME 2CQAA 3IT4B 2WXJA 2BE5C 4CJ1B 4ID6A 2H4OA 1AP0A 3VRBB 3K7AB 4KKIA 1SNOA 1K51A 1ZXHA 2I46A 1OQQA 1CHPD 2VXWA 4DAPA 3IFTA 5GXGB 3DM1A 2F0LA 1E10A 3TP7A 3RD4A 2I2YA 4N9TA 3W5UB 1IHZA 3AE8B 5FOBB 4KJNA 1H9KA 3BWUD 5AUKA 2SNMA 1HUMA 3AE9B 1OXVA 2X6GA 1ESRA 1NSNS 5M5XB 3EUB2 1NVID 4F7XA 5JXVA 5IT9L 3SR1A 4ZHOA 4US9A 1NAPA 2BT6A 4NZLB 1XCTL 3QB3A 5C5MA 2YEPF 4PT5A 1J7AA 5T1GA 2LMCB 1IL8A 2KQ4X 3HUIA 1N63A 1V8QA 3BK2A 5C3EB 5JVH3 2Q8IB 3H94A 2KACA 2MJEA 4IFDG 1CM9A 1FD6A 4HAEA 3TEYA 1FD7D 1LT3D <