2IPKD

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 66
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ipkD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ipkD01
1BXTA 1M4VA 1JWSD 1BCPB 1JCKB 1PTOH 1V1PA 2IPKD 3R2TA 1SEBD 2Z8LA 2QEJC 2CHBD 1RDPD 1EFID 1RD9D 1V1OA 1LT3D 1S5CD 1HTLD 1TY0A 1B1ZA 1I4XA 1MD2D 3R8BA 2G9HD 2QILA 2XN9C 1GOZA 1LTSD 2XRQD 1EU4A 1BCPC 1YN5A 3KLSX 1TS5A 1I4HA 4RCOA 1EEFD 1RF2D 2NTSA 1STEA 4C56C 3TSSA 1ET9A 1S5DD 3CHBD 3OWEB 5D3IB 1KTKA 1BCPF 1TS3A 1FNWA 5ELDA 4L63B 2NTTA 1L0XB 1LTBD 1HQRD 1LT4D 2ICIA 3GP7A 3DWQA 1PTOF 3BYTB 4DXGA 1ENFA 1AW7A 1D5MC 2XRSD 5TSSA 3BVGA 3V05A 1SBBB 2IJ0A 1TS4A 4K6LA 1ESFA 4OHJA 3MC0B 1I4PA 4RFBA 4RGNA 4UDUC 1LO5D 1SJED 3EFXD 5FK9C 2XNAC 3W2DA 4O1NA 1TS2A 1PZJD 1G8ZD 1PZID 3BVMA 1QILA 1YN3A 1UUPA 4TSSA 1F77A 1CHQD 2WV6D 1D5ZC 3BVZA 1FNVA 1PRTB 2J4XA 4NZLB 4Z9CB 1EU3A 1EEID 1ET6A 2R61A 4BWGB 1PRTD 1PZKD 2TSSA 4L6TB 4RGOS 1RCVD 1LTGD 1HA5A 1SE4A 1V1PB 3DWPA 1CHPD 1S5FD 1B44D 1FNUA 1UNSA 3SEBA 1JWMD 1PTOD 1XTCD 2RDHA 5ELFA 2AQ1B 1KLUD 1LLRD 1AN8A 3R2IA 3O13A 4RH6A 1SE2A 2SEBD 1PRTF 1LT6D 1PTOB 2O2LD 3MFGA 1S5BD 1DYQA 1JWUD 1S5ED 1XXGA 4RGMA 1I4RA 1JR0D 1CQVA 1LTID 5I4DA 1PRTC 4DXFA 1JQYD 1TY2A 1YN4A 4RHSA 1EWCA 2AQ2B 1LTRD 5D3DA 1PTOC 2AQ3B 3URYA 3EA6A 1I4QA 1PYWD 1DJRD 3BYYB 5ELEA 1CT1D 1D6EC 1SXTA 1FD7D 1LTTD 1L0YB 5ELBA 1LT5D 1D5XC 1I4GA 4RHRA 3DWAA 1FGBD 3BZDB 1CK1A 1BCPD 1HXYD 1KLGD 5ELCA 1T5XD 4ZYSA 2RDGA 1SJHD 4RGTA 1SE3A 5FKAC 1LTAD
chains in the Genus database with same CATH superfamily
2LGSA 1BCPB 4IUVA 3D4WA 4KIKA 5KNDA 5E7NA 5IY0A 2HD3A 4N9F4 2FIFA 3AE7B 4HJ5A 2F0GA 4TQ0A 1CI3M 2CVRA 2RPVA 1YHBA 2XBBC 4P1BC 4Y7NB 2ACZB 3DLLA 2JSVX 4IM2A 3B2GA 1B9NA 2BA0A 4JGHB 2E2HH 4G7OC 3VXWA 1K83B 2ALYB 5JEAG 1IYVA 1TS5A 1I4HA 4IDIA 3KYHC 4PT5A 4BBNF 2MBHA 4ZUJA 2HIVA 5H8YE 2ZCCA 5IP4D 3PO3B 1BCPF 4IM3A 1QNUA 3TRZA 2AL3A 1FVIA 3PCOB 1PH1A 3J9CA 3J80L 4KV6A 4YL8A 5M5YH 2MGSA 2RKSA 2KEEA 2KJXA 1WJNA 2M4NA 4LNNA 4K8IA 3U7DA 4XTCS 2EY6A 4B3RL 1XD3B 2JY6A 2MCNB 4GOPC 1X3EA 3RN2A 3RMKC 5J22A 1QKZA 2I38A 3ML9A 3RLNA 2ZPYA 4AH6A 2BE5C 4B0EA 3AM9A 1CQFA 2MP2A 3H7PA 4W9GA 2EKEC 1R4MI 2D5DA 4JQWC 1WOCA 4C3IB 1ESFA 2EY5A 4RFBA 1HUNA 2ICEC 1LO5D 1SJED 1QQRA 4CKEA 5EE3A 2C5CA 3VH4B 5FLMG 3U58A 3IFDA 4IWPA 2WXKA 3PIO3 5KNCA 1EY6A 1GXDC 1UF0A 3OMGA 5DEHA 1VZ6A 4HIKA 5E6JA 3KBGA 3T9LA 5KYLA 2CFMA 3TBLD 2I5MX 3J81j 1V9JA 5EKIA 3X23A 5CGKA 3CD6A 2FE8A 3Q3MC 2M17A 3W1BA 3L17A 1H8CA 4LNQA 1SDFA 1FD6A 4L6TB 4DUZQ 1RCVD 3AE2B 1H9SB 4JI4L 2L05A 4YTMB 2AWTA 2RD0A 1JWMD 1J7CA 2ASQA 2KDEB 4DU9A 3EGRA 3ZYYX 3HVDA 4N59A 4BS9A 3NSWA 1UWVA 3NWSA 2VZAA 1KDBA 3ICEA 3L2PA 3A4SC 4GNXC 2K25A 1EWHA 2I07B 2ES2A 1WX8A 2LJ5A 3N30A 4HIDA 3E9IA 4BBSG 2K22A 3DWMA 3HKZB 2N9KA 1VZ7A 4QIWE 1JROA 1PRTC 1TXYA 4DR5L 2BTEA 4GKKL 4JPSA 3DOWA 1F9PA 2RCFA 3T1YL 1EIGA 3KWVA 1UBIA 2OCEA 5IGGA 1C4PA 4FF3A 5H92C 1C76A 2KMAA 1RTNA 4B6WA 2F0FA 1EOVA 3E5SA 3K7AH 3EHVA 1HZ5A 2D0OA 3TMEA 4B3RQ 2LXAA 2DENB 3A8IE 3W5VB 1QOBA 3EUB2 4C2MH 3U8ZA 1L5PA 1UBQA 4DV2L 3P7JA 4REZA 1TWFH 1B9MA 3AB9A 1II3A 3F8TA 3G6EA 4HCEA 4IUNA 5ISRA 4LCDE 1Q1BA 3K0XA 4FF4A 2IO1B 5EKLA 3MP9A 2KHSA 1GC6A 1X3GA 2X38A 3N32A 3ZO5B 3QC8B 2H5XA 3KDFA 1I6VC 4MJSB 2F0LA 3TZUA 4MACA 4JBWA 3AI5A 2K28A 1MD2D 4OVZA 2KHJA 3UE0A 3T1HQ 1M90C 4C3JG 2X69A 2XN9C 3D4RA 2LFNA 2F03A 1H95A 1FMAD 1WY8A 1Y1WG 2BS2B 2UU7A 5IAAC 1UE7A 1BCPC 2G3QB 2IY5B 1Z47A 1EEFD 2INPE 1TWGH 4PG3A 2D5GA 2D62A 2LMCA 2LUMA 2NVUI 3A9JB 3T51B 2X6GA 2K5QA 2F0EA 1TS3A 2HCIA 5HGQA 2K8HA 1EY5A 4KGSA 3I4NH 4JBJA 2K6AA 1NI2A 4JW0A 2B39A 3RLFA 3T3NA 2KVZA 3TQYA 1ENFA 1SFOH 2XRSD 3HRZC 1YNND 3JAME 4RA8A 2V3PA 1V43A 4DR3Q 3RUIB 4ZHOA 4B9KA 3QX1A 4EEWA 2E6XA 3S24A 3KF6A 1E1OA 4C3HH 2ZTEA 4A3EH 5IIFA 4L23A 1D8LA 4L2YA 2XNAC 1T0SC 3OTOQ 1VR9A 2O2VA 2WIIB 3I55A 4G0NB 1L6UA 1I94L 3HZXA 4LK0M 4DDID 3SXHA 4DK3C 1TZOA 2R6GA 2B2UA 1GM5A 4DV4Q 1E10A 1XMOL 4A3IH 4LFAQ 4DPGA 1MI0A 2JSOA 1PMRA 3HOUH 2EYPA 4KKSA 2KACA 5BYRA 4ZKBB 4ZK9B 3UIOB 3I91A 3H3VI 1PZKD 3RNUA 1I35A 5FO8B 2DWQA 4LUOA 1S3OA 1YHQA 1CHPD 4EKUA 3KOJA 3NZSA 2MHVA 1SE8A 5C4XB 1G51A 3Q0AA 4KVGB 4RM9A 1KLUD 2F3WA 4RNAA 4F8CB 1XTDA 1GNUA 2K6DB 3AECB 1A8VA 1WJJA 5IT9L 4HN7A 2DY8A 5GXGB 3SE0A 1PRTF 2ATWA 2KEDA 5I9PA 2KTRB 4DR1L 4DK5A 3OHXC 2ZJPA 1WJ4A 3NTIA 4FF1A 2KFKB 5EDSA 4DNIA 1E7ZA 1N32L 1E2ZA 3TN2A 1WCMG 1JQYD 4KX6B 4K81A 2K01A 2DZKA 3A4RA 4APVA 2VQFQ 3VDZA 1PTOC 1C0AA 1BKBA 4G4KA 5CV6A 2F52A 2B76B 3J81L 3PUXA 4P74A 3PTFC 2R2QA 4A3BB 2ONQA 1UWMA 3MVVA 1YIWA 4QUCA 1RWSA 3BDOA 2IX3A 5C0XH 1D5XC 2PNRC 2Z9HA 3OW7A 3DWAA 2MPMA 5DM63 4XZ4A 3A74A 1VQIA 4JV5Q 1T5XD 2NN6I 4LFCQ 2V4LA 2QW7A 2A5UA 4WQMA 4OONA 1BUIC 1U0LA 3HOWG 2HJ8A 1M4VA 1JWSD 3R2TA 2BS3B 4ODGA 2WXQA 3PRZA 2N1VA 1YI2A 1BF4A 4KHPQ 1NVID 2HJ1A 4DUZL 2K32A 1T9HA 2Y0SG 2KQSA 1G2TA 2YVCA 4IFDH 5LLIA 3RNBC 4N58A 2Z4HA 3PUVA 2QILA 2BYVE 1LTSD 4X66L 2LZ6A 4HWIB 5LMNQ 3U7ZA 1U4MA 3ZJTA 3CU7A 1PGBA 1IBKQ 1FO4A 1ET9A 4LWCA 1IKLA 4KHPL 2CQAA 2PJHA 3E9SA 1KDCA 4DK0A 3BK1A 2K6QA 2CH4A 3E0JA 2Y0SE 2L15A 3MEHA 1V5OA 2MP1A 1CZWA 1ROEA 5C4XG 2PVOD 4LNOA 3GP7A 3P42A 2D11A 3RZWC 4ICVA 3AQQA 3GTPH 3RFZB 3SR6A 1PH4A 1G6ZA 3HOVB 4BOZB 3V05A 1MHWC 4XC2A 2WP8J 1JE5A 4YCVA 4LJOB 2R7ZH 4DR4Q 4W9CA 1QUQB 1CKOA 4G7HC 2KDIA 2MRPA 3RT3B 5JJZA 2MLBA 5FR3A 1D3ZA 1K9MC 1BDOA 5M3FH 2MWSB 2WINB 2NZHA 1CA5A 3AU7A 1SB3C 4YSZB 1PZID 1RYJA 1EIHA 1QILA 1DOYA 2EYMA 3S15H 3S1NH 4WFN3 1ZXTA 1YNJC 3BVZA 4ZHPA 3UE1A 3M3YB 2A68C 3H0GH 1Z6HA 1IBLQ 5BMGA 4YHHQ 2JUOA 3PUZA 1WFYA 2L1BA 5AEKB 2QJLA 1EUVB 2NBFA 1C1YB 2ZEQA 1YHAA 3GOEA 4URKA 5JEAH 4OZAA 5L95C 4BBRB 2Y5BB 1BBXC 3M4PA 1IW7C 2ZW0A 4H02A 3M3JA 1C8CA 3BU2A 1I50B 2XIWA 1XTCD 3PGZA 4JI8Q 4KLKA 1XEEA 1YBYA 2QF7A 1FFUA 2K04A 1VMCA 5BN5A 3N6RA 4RH6A 2OF1A 4A3JG 2JEAI 1E7PB 2C35B 1TWHH 3BJUA 3NTKA 4JI6L 2D3BA 3I4NB 2F0PA 1PH7A 1EM7A 3QWNA 2ZPNA 1EF1A 3PLUA 4WH4A 2J42A 4QIWB 1WGRA 2CQOA 2PIAA 3HOZB 3DBHB 3DEOA 1SSOA 4A3DH 2NCNA 2RHSB 1IL2A 1YN4A 5CHWA 2K7VA 5C5LA 3DHIC 2B2WC 3M3YH 3O65B 4S17A 2HCCA 3QR8A 3CCQA 4PK1A 2PEAA 1YVCA 4C3HG 5AUKA 1GUOA 4A3FB 4NXNQ 1WMHB 2UXDQ 4XGAB 4C3HB 1Y69U 1WTQA 1P16A 1DJRD 3P2BA 2WDTB 4IW0A 4DR7Q 2M9VA 2OHFA 4TMAB 1EYAA 1SNCA 3M9BA 4M8MA 2OTLA 1HFNA 3E56A 1L0YB 1U4PA 2LXKA 5T8IA 4A6QA 1FXAA 1DZ1A 2PW7A 2MO1A 1R4NB 1N5XA 1FPYA 1V8CA 3H3VC 2BYFA 1VQ4A 2GOWA 1E0BA 5EBCA 1OXSC 1J19A 2UXCQ 1K53A 3P4RB 1SYCA 3L0OA 2N1WA 3Q8BA 2R7ZG 1LTAD 4US8A 2QSDA 1BXTA 3SDZA 3IVFA 1V81A 1D2BA 2IPKD 2KDMA 4JI3Q 3K7UC 2L52A 3VRAB 1HE8A 4KY6A 3Q23A 1PH2A 1I7HA 1PFDA 1TKEA 1TR5A 3BZKA 4RAUC 1HNZQ 3VTVA 4GXBA 2JRIB 3B2FA 2FIDA 3CCUA 5JZEB 2Z0SA 3AU5A 4FJZA 3ZRCA 2JP1A 2XRQD 1Q86C 3HKZG 2D07B 1A15A 2BB5A 1QCBD 2KCCA 5KYIA 4KKUA 1XPRA 1V5TA 2KFJA 3OWEB 4E3CA 2R92B 3AE8B 1E6EB 4OELB 2K5VA 1FNWA 2AHOB 2EJMA 5ELDA 4L63B 1MG4A 1JMCA 2VRRB 4A75A 1R7SA 1IBML 4YWMA 1KM7A 5DPTA 2O5IC 3VR3A 2EQSA 1WI0A 4BKGA 1AW7A 1H9KA 1I5FA 1Y8OB 4HCSA 2QCPX 4DV2Q 3A5UA 3KJPA 2HHHL 5G5GA 4P16A 2PZTA 2UUCL 4AQ7A 3NBHB 4N9PA 3HIZA 4PS7A 3M7GA 5TR5A 1VS0A 2SNSA 2HDEA 4K6LA 5EPKA 4B08A 3KYDD 4J3OD 3PF4A 2B2TC 2JE6I 2J7QB 2CU1A 2LGYA 4H0LC 1J0GA 3W2DA 2KC1A 2IZVB 3ECIA 2UXCL 2UU9Q 1C78A 1IBXB 3QJYA 2WXRA 1FCLA 1G8ZD 1SF0A 4NPNA 1HH2P 2UUBL 2YV5A 3K59A 1P8LA 1KXLA 3ULPA 2HQLA 1F77A 4DAMA 2F0SA 2E2IB 2REXA 1D5ZC 2NWGA 4HMIA 1FNVA 4BKSD 3KJOA 1PRTB 2R93H 1A63A 4KV2A 4C3JB 2R92H 3A9KB 3IFTA 1TT2A 1OFFA 2KUMA 1KHIA 3MA2B 3GTLH 1B3QA 1FM0D 4B3MQ 1MVKA 4M01A 1I3QB 1VQ5A 1TQOA 1HRJA 2B63G 3ZNGC 1LTGD 4A3FG 2MX2A 3IAM1 4NQLB 1NMGA 2F0KA 4LDTB 4CJ2C 1NCVA 2E2JH 4XYQA 5JVH3 2FCQA 3C2PA 1EQVA 1O78A 4K0KQ 2F0HA 4ASWC 1YX5B 2WB1B 1MJDA 2Z1CA 5C4HA 2BOSA 1NY4A 4EZLA 2EZVA 2N9LA 3JC66 2MBEA 1N33L 3OJ3A 3Q3OC 4DQOC 3CW2C 2LVPA 1CQVA 4KJOA 1HA6A 2E5LL 4BY7H 4UP8A 1PYBA 3KUPA 1XO3A 2EE1A 3FVQA 4JI2Q 4ULLA 5A35A 5M5WH 1AE2A 1TIID 1WM2A 3RNEC 1GUSA 2AX5A 3DEPA 3ZDTA 2MH7A 1L4ZB 3NZUA 3P1HA 3Q8CA 1I3QH 4FA6A 5M3FB 3U52E 4WJWA 3APDA 1K51A 1ZKOA 1HEZE 3EC8A 4X6AH 1BQQT 4GOCA 1EWIA 2B2YC 4DHZE 1O7IA 4WWOA 4OXPA 4EX5A 2JA8G 1SN8A 5C4JH 1QE6A 3LDZE 3ZNZB 1Y1VB 5C3JB 1F9JA 3DUZA 3H0GB 1VQ8A 4HJKA 5CV5A 1TVXA 1NDDA 1VF7A 1V6EA 1VQGA 4A3CG 1B8AA 1JJGA 4JI4Q 1OXVA 1Q1OA 4XQQA 5C3EB 1PFSA 2IYDB 2CHBD 2G4DB 1RDPD 2WB1G 3S16H 1PHJA 3T53B 2JXTA 1LT3D 1F2LA 5BN3A 1ISNA 3QWZB 4GN1A 5D2MB 5G2NA 4DK1A 2G9HD 5I2XA 5FO7B 1UZXB 5J39A 2KVRA 3H6NA 1N60A 3L54A 5DPSA 3ZNHB 1EY7A 1DOKA 3QJZA 4DN4M 1OXTA 4JI5L 4B9WA 4BKTA 3WIMA 3APCA 1PYSB 3OOCA 4R1JA 2E2HB 3LB8C 4FLHA 2BDOA 1N5WA 3MFYA 3DHQA 2RQXA 4NXMQ 1WIAA 1YQBA 2JXXA 2B29A 1WE6A 4C1NK 3DHHC 2HTME 3ZGZA 4DXGA 4F8MA 3MTNB 2V3NA 3RULA 5C4JB 3SFDB 4XWWA 2EELA 4P6VF 1PGXA 2UXBL 1OQRA 2JZZA 1VQAA 2JU6X 4K8JA 1K8RB 2WFWA 2PE9A 2GB1A 5IP9H 3KLRA 1TWAH 4AQYQ 1HTPA 1L1OB 1AE3A 1SYDA 2QDLA 3U50C 2WAQE 3MC0B 4IO9A 3S17H 1WYGA 2WS3B 3FMCA 2ZVNA 5LL6S 3L4PA 3EFXD 3QG1A 4KIKB 4ZAIA 3P4PB 2JA7G 2BDNA 2DNFA 1MSHA 2E76C 2WB1E 3VYSA 4YIJA 5JJIA 1D4BA 3NBIA 3NBHA 1NENB 3K81C 2LHDA 1UE5A 3VTWA 2G9DA 4K5WA 2JXMB 2AKWB 2KKCA 1LABA 4IZ8A 3AEAB 4CO7A 2ZJRA 4KY7A 4CDEC 2A73B 2MFIA 1QOFA 2L5TA 2J52A 1FJGL 3Q3FA 1AEXA 1WTHA 2KLGA 4C1NI 1NJIC 2AYOB 4A20A 1HJPA 3G48A 1S4ZA 5JJKA 3JYUA 2BKFA 1VQBA 2M0AA 4HPPA 1RFAA 1UNSA 1SYBA 1ZGUB 1PTOD 2M8SA 2Q5WD 3OPOA 5F2DA 3PRMB 5LXHA 1H9JA 4A93G 5E4XA 1OXUA 3GE3C 4LF9Q 3VR8B 3X0WA 2F0WA 2GA4B 2SEBD 4HSPA 3PIOA 3G7LA 1WWTA 3A56A 5CV8A 4X3TA 1PA6A 1S5BD 4WWMA 4AP4C 1VQCA 3UF8A 3D0FA 1VQMA 1CA6A 1JR0D 5K36H 2CHZA 4MH0E 3OSOA 3PIPA 2V9HA 2ASBA 3T8MA 3GO5A 3L3OC 4DXFA 4UPAA 2LRUA 2D9UA 1W3SA 4HJ9A 4C7ZA 2MEKA 2C7HA 4L5SA 3GZNI 4GGQA 2A74C 4A3IG 3Q6SA 4HDQA 3RUZA 1TWHB 5C1ZA 3HOUG 1MG8A 3KYCD 2KVMA 3Q69A 5ELEA 3C46A 3FEWX 1PFNA 4M1UB 5GROA 4EGVA 3GD7A 4Q0FA 5FJ8G 4GOPA 4JIOU 1LTLA 3EBEA 4RHRA 3ZQ4A 4EOYA 1E2WA 3OWFA 3A9JA 3MXUA 2LS01 1HXYD 1R4QB 3K5OA 2ZM6Q 4DV3Q 3PO2H 3DBRB 1P1AA 2RDGA 2K52A 4LF8L 3RMHA 4R4CA 4KDLB 2IX1A 1KRSA 1FFVA 4RCOA 2WXPA 3OYYA 3VQIA 4CJ0B 1QJOA 1MHXA 5FOBB 3NJTA 2NUCA 3EJIA 2A69C 1JT8A 2NMQA 3ZJYC 5CMDA 2EXZA 5LMUQ 3HM3A 2RBMA 3VR2A 3ML8A 3TP5A 4JV5L 1WGGA 2KK8A 5CBAE 3OAWA 4W9LA 1RTOA 4CKBA 4X65L 1A0IA 1GOZA 4A3JH 3BINA 3OIQA 1STYA 4MGYE 1T3QA 1EU4A 3CRLC 2G45B 1I42A 4IFDI 2JA7B 4MIUA 4ZRPA 2GBJA 1B53A 2M0XA 2VUMB 1JWAD 3K57A 1VQKA 2C7NB 1EYDA 2DAJA 3NS1A 5E4WC 1RIPA 3PREA 2A69D 4XXEA 3JVZX 3HOYB 3Q24A 1PQSA 1OGWA 2EJGC 5JPMC 1CMXB 1DOXA 3DBHI 1WTPA 3ZJUA 1WRIA 4GDLA 1C77A 5KHOA 3AE3B 5J17A 3TS2A 4GNXB 1L0WA 4J8QA 2HHHQ 3S1RB 1SLJA 1DOIA 2PLPA 4DA2A 1BT0A 4M0WA 4UDUC 4YHHL 1E8YA 5HHDG 5DAUA 2JA5B 2CS4A 2F0MA 1EYGA 2B3GA 4NAMA 4O1NA 1L7YA 3RD2A 1GVPA 1ZDXA 1PZJD 3PGEA 1OO9B 1TKYA 1CSQA 3TCAA 2JN4A 1K8GA 3HOUB 1VRAB 2K39A 1WR1A 1Y1VH 3V61A 1CHQD 4ITKA 3I2ZA 3L7ZC 2B8FA 2B8GA 3F1ZA 5A2QL 1XMQL 1KF6B 3PPAA 1SROA 3J7YW 4G50A 4JE3B 2WDQB 3W1GA 2HT1A 1WCMH 1EEID 2KT7A 3SU8X 4XQNA 2D2CC 4A4IA 4BWGB 4ZLTF 1PRTD 5BR8Q 4DV6L 2K9XA 4A3GG 5C4XH 5EGTA 3T1YQ 1C7YA 1OEYA 2GBRA 5BMHA 3QB3A 5EPJA 3S2DB 2GBNA 2WP9B 3VRBB 3C0RB 4DR6L 2MJ3A 3GV6A 4GLVB 3GTQB 2RDHA 4W9IA 3B08A 2RDBC 2CR5A 1J9OA 5C44B 4MT5A 2JX5A 2E2DC 2B63B 4DAYB 1Q12A 3AYHB 4LF8Q 3R3OA 2NS5A 2I5HA 4A3LH 1GB4A 3KF6B 4N8FA 2V0GA 2KLCA 2HE7A 3DVGX 4ZCKA 4XDCA 1DYQA 1S5ED 1T5EA 2A19A 5HURA 4M02A 1CUKA 4LJZC 3IFWB 2B3AA 4K3CA 1R9TH 4B3TL 2KC2A 5GADC 2Y3AA 2LI5A 1JORA 4ZRJA 2PE6B 3K58A 2V1YA 2JK8A 1HNXQ 3PT2B 4A3BH 1YJJA 5EJWA 1WF9A 4KGTA 5JHBA 1WX9A 4GB9A 4WWNA 4QUFA 3PIP3 3SHLA 1LQBA 1K0SA 4LF7Q 2ZXPA 4TRDA 3J80c 2F0IA 4A8XC 3KLWA 3E0EA 1LT5D 1AARA 2DZMA 2RSUA 1ESRA 2F3VA 4A3EG 1A70A 2YTVA 3SK6A 3T4AC 1O80A 3FRPB 3QOLA 4X3UA 4FO2A 2INDC 4RG1A 3TBIB 1VQ6A 4JYAL 1KABA 3RYTA 1KAAA 2FMMA 4GKKQ 4MM3B 4B95A 3CF6E 4GDLB 3MHSD 2KQ4X 4MELA 1X56A 4A3DG 2DAFA 4MNOA 1ZPSA 3N52A 2E74C 5C23A 1LM0A 2W54A 2JWZA 5C2TB 3SHQA 1JB3A 5C3WA 2N3SA 4YT0B 1B1ZA 1EUJA 2FJ2A 3V2TA 3FDTA 3M4YA 4KD3A 4PZ8A 5J3BA 3KW5B 5M5YB 1WZ3A 1GD7A 3CCMA 1WTVA 3PHXB 3VVWB 3IAYA 4XWTA 5AZGA 3H15A 4C56C 2PPHA 1PXUA 1GJZA 3WOEA 4GDKB 2YU9B 5D7GA 3IBEA 2DNEA 4NJ7A 4AYBE 3L10B 4AS1A 2BH2A 2FCMA 2A6HC 2CHXA 4IJLA 4R9WA 3GTOH 3PRPB 3ZW3A 1IKMA 2ZW1A 3NVZA 3WA0A 4A55A 4BA1I 1MBYA 2L3ZA 1WTOA 4YXDB 4K2LA 1X55A 3H6MA 1EL0A 2MW5A 1IGCA 2VS1A 3GQBA 3BVGA 4P73A 1VQ9A 1RFKA 4K3BA 1TS4A 2MJDA 2JA8B 2ZTDA 2GBKA 3I3CA 3P20A 1E3PA 4KZCA 2N7JA 2N0SB 2KXJA 3F2CA 3W3AA 2B2TA 2A6HD 1LACA 3R66C 4R3DA 4RWSC 5M9OA 2OEDA 1L0VB 1R4NI 3HOXH 1S3SG 3BY4B 3R3MA 4WJQA 1UUPA 4F88A 4LDTD 2NN6G 4DNTB 2B2VC 2AL6A 5EE0A 4DV0L 2RF4A 3MTSA 3HFZB 3VR6A 5FO9B 3S15B 1JC7A 4JVZA 2N9XA 4N8X1 5HY6A 4V190 4YTPB 4X3SA 1MJCA 2LXJA 5CBEE 1F2RC 1ET6A 4JK1C 1VQFA 1PUTA 4C00A 2TSSA 4CGYB 4HIMA 1N33Q 1QNKA 2L9HA 3RZOH 5IP9G 1Y1WB 4YTNB 3ZUNA 1PDXA 3I4MH 2MO0A 1SAPA 2TMPA 1N36Q 3NWTA 3L9AX 4DAPA 5M5XH 2D3GA 4OW0A 1LLRD 2RHQB 4S3SA 2R3ZA 3B0AA 3O13A 2PI2A 3X3NA 1I50H 1E22A 1ZXHA 2IY1B 2W82A 4MJSA 1G91A 2L55A 3K80C 3NENA 3PZ7A 1LT6D 1PTOB 4HSVA 4II3B 1RRBA 3ZTCA 2D3CA 4K0KL 3VFKA 4RGMA 1I4RA 4Y52H 5JOBA 4HXDA 2UYZB 4IOIE 1E1TA 3HOXB 4LAAA 2K1FA 1N8RC 1VD2A 5IP7G 2NVQB 2BYEA 2KHWB 2PO4A 2F0DA 4A3MH 5IYDG 5LMUL 2YLMA 3PV1A 2F0NA 4RCNA 3GB1A 2AWOA 3PQIA 3Q8DA 1KQSA 1TBEA 4DR2L 4V0BA 3M7NA 2LRWA 3B9JA 1YMHE 3ZRFA 3CCVA 1WGYA 2CWPA 2KQ3A 3HKSA 2EIFA 1KLGD 1VF5C 1RHPA 1HCZA 4PZ7A 3PO0A 5DPRA 5M5XB 5I6WA 1ZP0B 2X8XX 1MJEA 4CQNA 1SJHD 3UDGA 4AJYB 2LEKA 1LM8B 5J18A 2HIXA 1B2TA 2PNHA 4R8NA 2VUMG 1GUAB 1VQOA 1WCMB 4BFRA 1PTOH 3GV3A 2I46A 5IT9E 1IGDA 2H4OA 1N6ZA 1VJKA 2W3RA 4R4IA 4FHJA 1N63A 4ICUA 4YWKA 4BXXG 1DCZA 3K8AA 1XF5L 1P7FA 1Z9FA 1KLVA 3SR1A 2SNMA 3VYTA 1AFPA 3R8BA 2JA6B 1EO6A 5KHQA 1KRHA 3IHPC 1V49A 4P72A 1N34Q 3CCLA 1GAQB 2L8JA 3JSVA 1DXMA 5LL6X 2GLSA 1ZDVA 3SDLC 3CMEA 1TKWB 3ND8A 4KGRA 3MEFA 4LNFA 4AYBG 4UAIA 4C80A 2WQYB 1YZ6A 1K28A 2WDVB 1GB1A 2OQ0A 4TVAB 5D6JB 3WOFA 1VQ7A 3UGBB 4B9XA 2L0CA 2VY3A 3HK0A 3IAS1 1C79A 1XYIA 4NXML 4JI7L 4A3MG 2DX5B 4ANWA 1UELA 3V96A 4FXDA 3LWEA 5D94A 1SBBB 1R4PB 4GLAC 1PH5A 2CWAA 3NS8A 1JRUA 1KL9A 3KBXA 3K7AB 1KOTA 2LSSA 4PMWA 4JX1C 2QHOA 1WGDA 4OZCA 2GMIC 4ZOHC 2EJFC 4AJWA 2Q2TA 3J81c 2BS4B 1KC8C 3DBRI 4WJNA 1FL0A 4OO1H 3OLMD 2Y0SB 2PTLA 1TWFB 3ER0A 2D10A 2RR9A 3K9OB 1NAPA 2H89B 1WE7A 2EYHA 3I4LA 2N55A 2E2IH 3LGJA 5EAYA 1L2FA 1TWCH 1I6HB 4F7ZA 2R93B 4NJ6A 2PCFB 1ASZA 1NTGA 1MI2A 4GN3B 1WTRA 5L83A 2K5WA 2PI2E 4RGOS 2PMZE 5IT9c 4KD4A 1WJUA 4FXKC 3M63B 3VAWA 2DGYA 4ID6A 2N7EA 1MPEA 1RM6C 3G4SA 3KUCB 3NE5B 5M3MG 4FBJB 3HOXG 3OW2A 2YU9H 1CFMA 2A68D 1U4AA 3CWIA 1E0ZA 3DMUA 4OIKA 3FPPA 3JSVB 1JWUD 2WXHA 3OIPA 3S2DH 3A7LA 4FXGC 4NKLA 3GTJB 4GLSC 2MQJA 1CSPA 2M00A 1SFOB 1Y8RC 2N9EB 4RHSA 1B50A 2EDGA 1T0RC 5HG2A 4M0WB 4HRSA 1LTRD 4DHJD 2KWDA 4KKIA 3HEJA 1P9DU 4XYCA 5HGTA 5AZHA 2N9PC 2JRHA 1I4QA 4IWQA 3I8ZA 4DR2Q 1QOAA 4LF4Q 5M5WB 2BYTA 1EWYC 2KN4A 4WWPA 4M8AA 2GBMA 4RF0A 4DR4L 2RGFA 3I90A 2F3IA 4DFAA 3NELA 4BKSA 1KD1C 1X3PA 4I7ZC 5EKKA 4MEMA 2QKIC 2K14A 5LMNW 4PZ6A 3QAQA 3CQZH 3DDCB 1UEAB 5KGUA 4QGUA 2KOXA 3MAQA 2K3UA 1STAA 2F1MA 3L13A 5C44G 2Z8LA 4JI6Q 5CV7A 3CC4A 2RVLA 1E8XA 2MJ8A 4K14A 5FR6A 1RD9D 1V86A 5FLMH 2N78A 4WIPA 2ZJQA 3NEMA 2WXOA 3N9YC 3Q3NC 4DAYA 2UUCQ 1YQ4B 3RD4A 3RZDB 2ENBA 4HAEA 2Y5PA 3RNCC 4A3PA 1N36L 1G6PA 2FMCA 2KECA 3RI7C 1ZUD2 1UE6A 2J0KA 4YWLA 1F2RI 4AUQC 4FADA 4OX9Q 5D3IB 1X6OA 4RF1A 1WYDA 1WD1A 2HDMA 4ZYNA 2NTTA 1L4DB 2LGXA 4TUUA 4Q5VA 2BWES 3IRBA 2VH1A 2KX3A 2EYLA 1Q90A 3I4OA 1B7YB 2KNBA 3AEEB 3J81i 5IP7H 1BBUA 2LKVA 3PUYA 1WTXA 2BB6A 4JI0L 2A6EC 4C7YA 3IKJA 4RMAA 2JJQA 2WKCA 3ULLA 3A1QA 3SFEB 3WALA 2W3SA 2OXPA 4KHVA 3QCAA 1ILQA 2KDFB 3RPFC 1TJEA 1IXRA 1TS2A 3LNNA 4MM3A 3V6EB 4MHEA 3KDFB 3KLSA 4DV6Q 2BF8B 3UDIA 3MXNB 4TSSA 4BBRH 1WMHA 2L0TA 4TQ1A 3GTMB 4GZYC 2BPSA 2LUEA 2JA8H 2MSED 2W55A 3Q8FA 4WJPA 4ME5A 1Y8NB 2J4XA 4IPCA 4JI8L 3D6WA 4GS3A 2HDLA 5KEEA 1OQQA 3RLOA 2EPBA 4WORA 3RNAC 5CR3A 5C0XG 3WAMA 1F9SA 3STBD 3PO3G 4GN5A 3TEHB 4OX9L 1HZ9A 1PFBA 4GN4B 1DOMA 2OWOA 2J0JA 4WAAA 1AN8A 2KZRA 1C4QA 2A1AA 1DGSA 5ELOA 1WH3A 3QIJA 3VR4A 4FDBA 3OG5A 3J81E 4IPGA 2OTJA 4G3XB 3RZOB 2MBQA 1KH0A 3NVYA 4AIMA 3CRKC 5ELNA 4MTNA 2W9NA 2GVBA 2FCSA 2JZ3B 3WDNA 4X62L 3NQTA 3WAOA 1MHHE 5COYA 2KO3A 1CKNB 2C9OA 1PFMA 1Z7TA 4PMCA 4A3KH 2A5HA 2ON8A 1OTCA 2WX1A 2WYQA 3FC4A 4HJGE 2JYOA 3FKIB 2ZVOA 1HNXL 2R7ZB 5BMIA 1YOVB 1QWYA 2WHIA 4XDXA 2WDRB 3NTHA 1I4GA 3R93A 2CCZA 2R93G 2KJHB 3A1QB 4G7ZC 5ELCA 4RM8A 4HJ8A 1LXDA 1C9OA 2PQAA 4FHKA 1T0QC 2F0QA 3MWYW 2I0QA 2XK5A 5FKAC 4ZRIA 1A6XA 1HTQA 3ZIMA 5C3XA 2QDFA 3HUIA 4HIOA 4M8NA 4HJAA 4A93B 3HOWB 3GTKH 3EFUA 3PMFA 4GNXA 4IALA 2QEJC 1O7ZA 4YCWA 4HK2A 4JC0A 5JAVA 1TKGA 1HTLD 1TZ1A 1K0RA 3MC8A 1HZBA 2KTFA 2Z6KC 3S1QH 1SNPA 3FPUB 1Y14B 3I9V1 4IKGA 4DV5Q 4Q2JA 1M94A 4HCNB 3PV0A 1OXXK 1FGUA 5E3FA 3EVQA 4LFAL 2ZJDA 4NJCA 1STHA 3E3XA 2IO2B 4BVUC 3PF5A 4YCUA 2H1EA 3V60A 3UINB 3DWGC 1X9NA 4OEMB 2CJOA 3ZVVA 1CZPA 4MH8A 4A3BG 3RN9C 3GDEA 4DV5L 5CV9A 2EYOA 3HOZH 3S1RH 1C48A 5IGCA 5IKCM 1SMYD 2EMTA 2K5NA 4JBKA 1FCCC 3ZJVA 5E6NA 3SVMA 1VDZA 4F7XA 1EY8A 4JPBW 4ARCA 4FF2A 4A3FH 1EF5A 1Z2MA 3MC9A 4MGIE 3OTOL 1I4PA 5FLXE 2VQEL 1SIJA 4JI5Q 2J53A 2PKOA 4DUYL 2ZNVC 3AFPA 1STBA 1YJWA 2OJRA 3PHWB 3FP9A 3LYYA 3HM6X 3L08A 4FN2A 4DXAB 4QMGA 4CHKA 2FNJB 3ZNID 4PYZA 2XGTA 1D1KA 2MBOA 1ML0D 2C9WB 3CQZB 4LFBL 2CKHB 4GU2A 1A5RA 1WI5A 1GG3A 1HPCA 4R8IA 1UWXA 3KWLA 2X6LA 1B70B 5JEAJ 1PH9A 1FXTB 4Z9CB 1EU3A 3NUHB 3S2HB 2KJ6A 1WR6E 1XT9B 3GTQH 1ACCA 2LFIA 4A3CH 2MP2B 1SE4A 4Y7NH 4JI1Q 2ZCBA 3SEBA 3H3VH 3VUXA 2N4FA 4KKTA 4RKBA 2AQ1B 1QG7A 5G3LD 1FRRA 1ZKHA 5DPWA 4L8JA 1Q46A 1TWCB 4ARIA 2Z6KA 4DR1Q 1VLBA 2XTIA 5AZFA 3K5MA 4BOSC 1Q8KA 5C44H 1U9RA 2VL6A 1EOTA 2F0TA 5IGDA 1QZGA 1K73C 4LF9L 4XQJA 2WXIA 3KH0A 2L4NA 4YWGG 2BA1A 2E8GA 4L5TA 5IWAQ 2GI9A 3C8YA 4BZAA 1QF6A 4QAYA 1RKNA 3J7A5 2NPTB 2KWUB 2UXDL 4MN3A 3ERQA 5HI1A 4KI0A 3CC2A 3R7QA 3E6ZX 5D3DA 1V97A 4QJFA 4ZDVA 4NNJB 3D3RA 3P1MA 2PW5A 4H2AA 5CHFA 1Q0WB 1F9QA 5IGEA 2JPHA 3TMPB 2E75C 4K5XA 4IOCA 1FD7D 5C3EH 3D31A 2MA9B 4US9A 1EY9A 1AZPA 1XCQL 2NZOA 2Q8IB 3K9PB 3CF5A 4AOFA 3DVGY 1AWDA 4HKZE 4HKQA 5KNBA 2ZTCA 4NDXA 2AEHA 3S14H 4CDFC 2MUYA 4GKJL 5CTRC 4POGA 5KRUA 1N34L 4QF4A 3I7FA 5JVG3 1NBWA 4JG2A 1TU2B 4O2DA 4ALPA 4H44C 3A8KE 4JL9A 5EQ0A 1EFID 4U68A 4TV3A 3ALBA 2NVXB 5NUCA 1CJEA 3V62A 1MKHA 5GAHC 1IZ6A 1QZEA 2VNUD 1HFGA 3Q8AA 1ONLA 3AU4A 3S1NB 1YN5A 3CMAA 2A6ED 5FJ8H 1WXVA 5JPNC 3UDFA 3TSSA 4LF5L 1JE4A 1P3QU 2FXQA 4KJNA 1KTKA 3I73A 4KY5A 4JI2L 4BBSH 2UWQA 2WLBA 2YTXA 1NYQA 3PS6A 5IN7A 3F2UA 2QEXA 4DV1Q 1WYWB 3R7RA 5J2RA 1A62A 4BY1B 1K52A 1ZOYB 1F2YA 1GJXA 4A90A 1VCIA 3KFUA 4LFCL 3G6JB 1N62A 1XPOA 2FAZA 1DGJA 1X3QA 1BMLC 2KN5A 4EVOA 1XWEA 3DBLB 3IXSA 4II2B 2RA4A 1M1KC 1DD2A 3CMMB 4PMBA 4ACFA 4DR5Q 4RGNA 4JOIC 5AJ3Q 2PMVA 1E8WA 1VQJA 2LGIA 3K6OA 4AQYL 1SIFA 1P7EA 2QIEB 4MGKE 3GE8C 4UP7A 2OJWA 1YN3A 1YJNA 5D14A 1QB5D 1YQ3B 4EQNA 2EMSA 2JF5A 2ZM6L 4DV3L 5IYCH 3JW0X 1AH9A 3NPPA 4J6IA 1VQPA 5JXVA 1C9FA 5LMNL 4HDOA 3W9CB 4C3IH 1ENCA 3OMCA 4BXXH 2Y5CA 1QZHA 1EZ6A 4XX5A 2V4DA 3TEXA 4B3TQ 4W9EA 1OTRB 3S9WA 1YNXA 4X3KA 2F0OA 1V80A 4HMJA 2R61A 3S16B 4HCPB 2NBVB 3PSIA 1WXMA 3AEGB 2IO3B 3UQBA 3DWPA 4K7UA 1AP0A 3W1YA 3GTMH 1PVOA 1PH6A 3VUYA 4GLXA 4USAA 4DHJB 3TEYA 2P5ZX 2K8BA 4WQOB 3J80E 4X66Q 2Q2UA 2WGSA 3S1MH 4KMUC 2K1BA 4EZKA 3IT6B 2WX0A 3ZKJC 3P75A 2NVYH 4P71A 2KAJA 3CSFA 3OJ4B 2L11A 2LASA 5GAGC 4OO1I 3H7PB 1XXGA 4OVUA 4MSQB 1LTID 1IHZA 2UUAQ 4LF6Q 1X32A 2KHIA 3QIAA 4XT3B 4YY3Q 3CCSA 2ZT9C 4DV7L 4OVVA 1W6JA 3ABVB 4LTUA 2WXMA 4IQZA 1UH6A 3I63C 3A9KA 4A3EB 2DZIA 1JMLA 3S17B 4DUYQ 3HS0C 5C6AA 2QGQA 1JQ4A 1XCTL 2F4VL 5IYCG 3M85A 1WGKA 2K5PA 4DV1L 2O6VA 3A5ZB 1J8IA 2FUG1 3NVWA 1U4RA 4A3KB 2UUBQ 2C5LC 4R4QA 1F0ZA 2B2WA 4L5RC 2K0PA 3FKIH 3MHBA 4A3JB 4MGZE 3NG0A 4NAWA 1JJ2A 1A2TA 3NXWA 3SK5A 2NVYB 4MSMB 3J80i 2LWPA 3FKYA 3Q6BA 4QCLA 3C1EA 3VA5A 2HTHA 2M56B 1BO0A 3A33B 4QL5A 3UIPB 2Q8TA 4B3SQ 3HOYH 3RZFA 2BE5D 2D2QA 1VDVA 2J0MA 2WXLA 3QQ8B 4N6EB 5MPOA 4NXNL 3UDXA 2OEOA 4DGZA 2INCC 2QA4A 1SYGA 1E2VA 4XIGS 2OT2A 2KJRA 4FULA 3TP8A 4DK6C 4YY3L 4DV7Q 1OEYJ 1TIFA 3HVZA 1J5EL 1LTBD 4QY7A 2L7RA 3DVNU 2L12A 1EQTA 5K5PA 1ZYRD 4LMQD 3SGIA 4JWUC 2B2VA 5G3LF 1D5MC 2Z0DB 2LD9A 1BNZA 1NR4A 2PQEA 1GHJA 1XLOA 2BWFA 5DNFA 3L16A 4KHZA 3FKIG 3VYUA 4C4VA 4BY7G 2L83A 2Q8RE 1FYCA 3AE4B 4KZ0A 4ANXA 1I94Q 4X64L 2PW9A 4IPDA 4XE0A 1G6JA 3SK8A 1PGAA 3STBC 2JA5G 5BO4B 2K50A 1NSNS 1Q8IA 5IODA 1H9RA 3J7AF 2C60A 2XK5B 1SRUA 4KSKC 4KTAA 3TP6A 2PQAB 2ZZPB 1ZYRC 2MNAA 3Q2AC 2WV6D 3AEDB 2KENA 2VZKB 3PZ8A 3Q14C 5K36G 1RODA 4DNRB 2SDFA 4K6DA 3GTGH 2N7DA 2M2LA 1V2YA 1WX7A 1E7UA 4NAWB 4ME3A 5E6OA 1DONA 2I5LX 1HNZL 3K0YA 2IL8A 1S5FD 5AUIA 1FNUA 3UI2A 1E24A 1XPUA 2O6VB 1MGSA 5ELFA 2O5JC 4GOPB 4K7SA 2IHFA 2PZUA 1VZ8A 1PDQA 5KIXA 4LNKA 2VUMH 4P2CB 3H8HA 3S2HH 4UY8C 2JQRB 1WRDB 5G55A 4DDGD 3BDLA 3HG9A 3I4NG 3CC7A 3VUWA 1J6QA 4LUZA 2DY7A 2UU9L 4L1BA 2G4SA 3T16A 2DUDA 1V8QA 1KFYB 2K05A 1HQMC 4JOIA 2G1EA 4CBVA 1KAWA 1Q5WB 2KWVB 3Q3JA 4EUTA 3GTJH 4DV0Q 3MJ5A 3W1SC 5IOIA 2IY0B 5EE1A 4B0MA 1RL2A 2AQ3B 3QO2A 4FVMA 4C3IG 4DF7A 1F9RA 1YNTE 3EA6A 4WURA 2F4VQ 2FFKB 3D4DA 1IBLL 1W6KA 3AE1B 1WTWA 4GSWA 2FCNA 4M00A 2EXDA 1EIYB 3TDQA 2K33A 3GZNB 4JI1L 1ICWA 3CPWA 4IUQA 3M4OB 1GC7A 1IPGA 1CK1A 3VH3B 4DHZB 2E2JB 1E90A 5BR8L 5CX3A 3BS1A 2UXBQ 4A3GB 1IYFA 3KF8A 4HEA1 1QOGA 4L5QA 3AN1A 4KK7A 4IN3A 3G71A 4IM0A 1B9RA 1B3AA 4AWJA 2HD5B 2KA7A 2WXNA 1ZEQX 2CH4W 4JYAQ 2JYTA 1SEBD 4X64Q 3TJPA 1N61A 4X65Q 1S40A 1ZE3D 1XX8A 3I4MG 1XNQL 1XNRL 1J8CA 1S5CD 1TY0A 3ONSA 5G5HA 1GUTA 3ZDMC 3AE9B 1K83H 4CDCC 2KTRA 4LK1C 3Q22A 2XWBB 4FNFA 2XWJB 3CCRA 1IBKL 2CJNA 1YNNC 2WAQG 3DM1A 3DVNV 2LY7A 3KLSX 4TKOB 3I5JC 4I6LB 2WACA 4ANVA 2KX0A 4HVBA 1UEBA 4IURA 1XNQQ 1XNRQ 4LF5Q 2JT4B 4CJ1B 5IA7A 3N1ZC 2WXGA 3GS2A 4IG7B 1JB7A 2I1JA 4ZRQA 5DCNA 2KOLA 3PO3H 4R4TA 1H9SA 2B2UC 4J6HA 3IG3A 4A3DB 3ZXVA 3AMZA 1EYCA 4PYUA 2AMCB 4CKCA 2BCOA 5IGFA 3J7AV 4KDIC 4U673 5CV4A 4E74A 3I57A 4W9JA 1T0YA 3AEBB 2WNMA 1R4MB 5CORA 2K75A 3CCEA 3LWUA 3FAHA 3TS0A 1QVFA 2WAQB 3PVLA 4WJ3M 2GRIA 3UQAA 5IE8A 3QK0A 4CYEA 1K3RA 1WXAA 4OGQC 1NMFA 5C0XI 1O7LA 3AMUA 2VZKD 2KBNA 1SNQA 3BVMA 4ZKCB 5C3EG 5CC4A 5E6PA 1K8AC 3TEZA 5DM73 4S0RA 4FJYA 2PYKA 2BVCA 1SNMA 2IT1A 4GMVA 1Y1WH 1QT9A 4IUUA 5C0XJ 1GO3E 1GHKA 4G11A 5T1IA 4BBNC 1U5KA 2CHWA 3VDYA 1LGRA 3QARA 2E3TA 3E9HA 3NUCA 2XEWA 1N32Q 4LFBQ 4WJ4A 4HTHA 4OL7A 2K03A 3ERSX 2J7ZA 2DNCA 1PH8A 1YJIA 2R7DA 1WSPA 1V1PB 1A3VA 1FJGQ 1LV9A 2SOBA 1WZ0A 3PO2G 2I2YA 2DYMA 1WJ6A 3PO2B 2ID0A 1IBMQ 1SGHA 1A3TA 1NR2A 4IFDJ 5HKHA 1GUGA 4KN7C 2DYOA 1BOSA 3AE6B 4I7AA 3H09A 4KSLC 1PLFA 3HOVG 4JBMA 2IX0A 3MZ5A 3MFGA 2FUHB 2V3SA 3WAPA 1G291 2HQEA 3JAMc 1G2SA 4BY1G 2M19A 3GTOB 3N20C 1O7YA 3HGBA 1PH3A 2VB3X 1QLBB 4W9DA 1VCBA 4IUPA 4YSYB 1S1QB 1KNAA 1SNDA 3S1MB 3HRDD 2D0PA 3C3LA 3QHTA 2JA7H 3CIRB 3H9DA 2DJGC 4DAVA 2SAKA 4OWWB 1JALA 1MIUA 1FXIA 1XLNA 1JOKA 3BYYB 3DM3A 1V9PA 4LF4L 4CDDC 4HROA 1GPXA 1FR3A 3BZDB 1GUNA 4KN4C 3ENEA 2WU5B 1CZGA 3MXPA 4G57A 3L0WB 2F0JA 2F0UA 1VQLA 2JA6H 4H7BA 1YIJA 5BYQA 4DR7L 2Z4IA 4A3LG 4UHVA 3M4QA 1CTMA 1JCKB 1VQNA 3D32A 3S2AA 1NEKB 5IO9A 3GTLB 1NBFC 4EFOA 1PV4A 5IYBG 1M8AA 2CKZB 4ZRZA 2JA5H 4F1SA 2IHEA 3C19A 2M1MA 4A93H 2EYFA 4HPMB 2UUAL 4LF6L 2BQQA 2LJIA 1X65A 4QQBX 1CKNA 2BGFA 2V1CC 1TT5B 2NTSA 1STEA 1ILPA 1FIQA 3P4QB 3CHBD 3AB5A 1HZCA 3NVVA 3ND9A 2C7MB 4NQKE 1YEZA 2WU2B 3V3XA 5M3MH 2NN6H 1JW9D 3AEVA 1L0XB 3W5UB 2ZXOA 2N49A 3EECA 1YITA 1LT4D 1LUZA 2ICIA 4EQOA 1SE9A 1PTOF 1ZXIA 2A4ZA 2KD0A 4POFA 1EIFA 1TTNA 4P1CC 2DHZA 3TIXA 2NVQH 4IOAA 3NZ3A 1EQRA 2QCZA 1JRPA 4K2KA 1VQEA 4GIVA 4N9TA 2IJ0A 2VQFL 2LVOA 3RNGC 4TQUS 1HUMA 4E71A 4JI7Q 1EZ8A 3AH7A 4A76A 5IYDH 2ZXRA 5AFWA 2I1KA 3U4ZA 2V4IB 3AE5B 3U9SA 5A2QE 1JWBD 1UE1A 1OQYA 5GMVA 5J1ZA 1XQQA 1NUCA 2IWHA 4OWTB 5FLXc 2NBWB 3LX0A 1S72A 3TREA 1V1QA 3IL8A 3CCJA 3EFCA 3NHEB 4PS3A 3NHHA 1A3UA 3F2DA 4FJVB 4FXCA 3N1XC 3PSEB 1Q81C 2JA6G 1NYRA 4HPLB 4IJHA 2OOBB 1XMQQ 2N8NA 1KNEA 1XMOQ 3BK2A 4A3KG 3J7ZC 1BBWA 1SMXA 1J5EQ 3Q8EA 2KYWA 1RJTA 2INNE 2K5DA 3TP7A 4H13C 1L6VA 4F87A 2VH2A 3CXCA 2F4IA 1VMPA 1JOQA 5M3FG 2CW0C 1F2ZA 3BIID 3U30A 1YNJD 4JI0Q 5IWAL 4B3SL 2IDYA 4CHTB 1GKHA 4D2KA 2MQHA 2O2LD 3TZDA 4OO1G 3CPFA 5CHVC 1QVGA 3DXJC 3JAMi 2AUKA 1K8MA 3NK9A 3I3TB 1E8ZA 3VHTC 1IUEA 1WVLA 1XJVA 1HNWL 2VB2X 2NBUA 5L37A 1E5WA 3MHZA 1TWAB 2VXWA 1IYJB 2JEBI 2RDFA 3NP8A 2KANA 4XDDA 5BN4A 2Z0EB 3B1LX 2WKDA 3HOYG 1CT1D 3V6CB 2BKRB 1D6EC 1SXTA 4BBRG 4OWXB 3U4EG 1QOHA 1LTTD 4PV1C 4DKAC 3ZLZA 1D7QA 3KUDB 1BCPD 2DYBA 1UGMA 4UP9A 1H4RA 3IT4B 3DBSA 1C4AA 3W1SA 3FILB 2L0FA 5JJLA 1SE3A 2YYZA 3EQLC 1EQQA 1Q7YC 1SR3A 2EOTA 4K1RB 2NB0A 2NVXH 1P0RA 4FYDA 5CYUA 1HTOA 1YX6B 2FBWB 2DBYA 2R92G 1JJCB 2IBIB 3U2SC 1I6HH 3S14B 1R9TB 4OZBA 2BW2A 1V1OA 4E6IA 1W2BA 3DQVA 1I4XA 2AUJD 2PMZB 2KQ7A 4WAFA 3CSTA 1SMYC 4A3GH 2FINB 2DJFC 2LMCB 2NR2A 2K8CA 3NOBA 1J7BA 4NPSA 5HFYA 2HUGA 4HJ7A 1Q3LA 3KUZA 1RF2D 4J1MA 1SYEA 2F0VA 2JZPA 4I6PA 1A2UA 4PQXA 3HHMA 4BY1H 4YSXB 1SYFA 3FHWA 1F2MA 4XT1B 2EKIA 2QMTA 2Z6BA 4NW2A 3RCZA 1HQRD 4MZ9A 1BVSA 2E5LQ 3HOVH 2Z59B 3CAMA 3DWQA 4BBSB 1HR0W 1TYGB 1LFDA 4X62Q 2ZNVB 3QA8A 1SSNA 2J0TD 3PZDA 3WCQA 5LHY1 3I4MB 2RMMA 2LGDA 5C5MA 3GTPB 1STGA 4ZQ3A 3APFA 5BYSA 2WXFA 4A9AA 5JHAA 4DWFA 2CU3A 4NP5A 1T6BX 5FK9C 4RMFA 3KQ4A 5IYBH 2OQKA 1KDAA 2GVAA 1K8OA 3AXCA 4DV4L 4RKLA 1X54A 3VR5A 1Q1EA 2IW3A 3BDCA 3TUOA 3UI3A 4PS8A 2O6VD 1HNWQ 1K50A 4WRDA 1E7VA 1DOLA 3U9OA 1WGHA 2IGHA 1BR9A 4NB3A 4NZLB 4AYBB 2LVQA 2QDBA 1Q10A 1KIXA 1HR0L 2NZ1D 1UAPA 1NE3A 1WXQA 4EQPA 2YEPB 4O42A 3SK4A 2BH8A 1ASYA 2KWCA 4IUTA 2MBBB 3DHGC 5T1GA 1U4LA 2RSNA 1F1HA 1WM3A 1QVCA 3RZDH 4LNIA 2NYZD 3NQIA 2DLBA 1C4CA 1L1OC 2YEPF 3KVFB 1JICA 5C4ZA 4K7WA 2G5DA 2FHTA 2Q2IA 3R2IA 2JA9A 3U4VA 3A0JA 2KFKA 4ABNA 1SE2A 2L00B 3AULA 3D6CA 1Z5SB 4OIJA 1Y56A 4W9HA 5LNK1 2L76A 5FLXL 1J7AA 4HLEA 2KMMA 5IGBA 3AV8A 2EVBA 4ANUA 3CKIB 5EPLA 2K4KA 5I4DA 2MJEA 3H7SA 4I6NB 1IP9A 4W9FA 1Q82C 3H91A 4R4OA 3I56A 3T1HL 4P75A 1VQDA 4GKJQ 2RCNA 1CKMA 4LUVA 1KJTA 1WXSA 1X3FA 3NY5A 3HP3A 2D3AA 1E9MA 3CP0A 3RNFC 1AYFA 3AFQA 1PYWD 3W5OA 4DBGA 1HZ6A 1P98A 1IL8A 2VQEQ 3BG3A 3VR9B 3GTKB 4TKNA 1SNOA 5ELBA 2N88A 2RSOA 3DCGA 1DM0B 1EY0A 3SD5A 2WWZA 1H9MA 2O2VB 4ZYSA 4PNYA 4NY0A 4IUMB 4JLCA 3ETRA 4W9KA 1STNA 4LLGM 1HHVA 1B4OA 4BAXA 5LXIB 4KKJA 2AWNA 1V1PA 4J15A 1F52A 2KDBA 4QB4A 3WANA 4ZUIA 1C3TA 3H0GG 3T3OA 5GAEC 2K5HA 2KCNA 1Y8PB 1ICFB 3LXFA 2JWUA 3M95A 4LW1A 1NNXA 5I9OA 4A3MB 1CM9A 3MXGA 2B63H 2JQOA 5AJ3L 2VW9A 1YJ9A 3P63A 4MDKE 1S5DD 1XLPA 5DLQE 3M62B 4ILWA 1MFWA 4BA2I 4EE2A 4HR7B 4WJOA 3QOJA 3DPDA 2H88B 4A3OA 1HZAA 5H1SE 3BYTB 3T56B 4LF7L 1ENAA 5TSSA 2L1AA 4O0AA 2WXJA 1QUQA 1IYUA 5EE9A 1NI3A 5GQOA 1KRTA 1UGJA 5M3MB 2GN5A 4A3IB 4OHJA 1EY4A 1UD7A 1JOOA 2IO0B 5IOCA 2NVTB 1X1MA 3JAML 1IW7D 2A8VA 2YTYA 5EBDA 1MSGA 4GDKA 4C2MB 4MTKA 1RAXA 1BUVT 4C3JH 2CW0D 1VQHA 3GTGB 5I2YA 3X3MA 4EQ5A 2PPBC 2IGGA 1HR0Q 2EYJA 3D8GA 3HOZG 3ULJA 3T13A 2DZJA 3HOWH 1RLFA 3N3KB 4EZJA 4DR6Q 3B6YA 2KCTA 3WWVA 3BZCA 3EN2A 2DN8A 2QC8A 3DBLI 2LXCA 1HA5A 4ZRKA 4P7IA 3ZXRA 3S1QB 1B44D 1K3BC 1N9WA 2IGDA 1D1IA 3EIVA 4JI3L 2EY2A 2BBCA 4IC7B 1IBXA 4IFDG 3P4SB 3LJ3A 4C4VB 4XYOA 1TWGB 3NRZA 2PZWA 3A55A 4HEDA 3KF8B 2MHJA 3A8JE 3AEFB 1ZW7A 1WFQA 2B2YA 4I65A 2O4XA 3ITPA 3ONAB 5I6YA 3VA7A 2NVTH 4BY7B 1FRDA 3ZTDA 1L2NA 2JVCA 3I72A 3TL5A 4FP5D 3PUWA 3F2BA 3RR5A 3RN5A 2L32A 1TY2A 3MJWA 1EWCA 1WD0A 3MXNA 2XSCA 2AQ2B 2KCMA 4K5VA 2BT6A 2PVGC 2RPQA 1YD8U 1YJ1A 3VYRA 3FILA 3URYA 4DR3L 2NPTA 4JWSC 2R7FA 3A7AB 5JH5C 2JYEA 4LJPB 1AZQA 1XLQA 3N1YC 3VTUA 5E1FA 1Y1VG 3K5NA 4X57B 3KK7A 3H1UA 3PLVA 3H94A 1LYLA 4NMZA 1FGBD 3BWUD 3C1FA 2EY1A 3K5LA 4JCVE 4B3ML 1TGZB 2R2OA 3TEWA 2XVSA 2Q2HA 2KMCA 4IPHA 2LHEA 5D65A 1GUWA 4RGTA 3HKZE 3A54A 1EFWA 3M4OH 1FEHA 3I70A 4IWOA 1L1OA 3EROA
chains in the Genus database with same CATH topology
1BCPB 4IUVA 3D4WA 5KNDA 3AE7B 2F0GA 4TQ0A 1CI3M 2CVRA 2RPVA 4Y7NB 2ACZB 2JSVX 3B2GA 1B9NA 2BA0A 4G7OC 1K83B 5JEAG 1IYVA 1TS5A 1I4HA 4IDIA 4PT5A 4ZUJA 5H8YE 3PO3B 1BCPF 1QNUA 3J9CA 3J80L 4KV6A 2MGSA 2RKSA 2KEEA 2KJXA 4K8IA 4XTCS 2EY6A 5J22A 1QKZA 2I38A 2BE5C 4B0EA 3AM9A 1CQFA 2D5DA 4C3IB 1ESFA 2EY5A 4RFBA 1HUNA 2ICEC 1LO5D 1SJED 1QQRA 4CKEA 5EE3A 2C5CA 3IFDA 2WXKA 3PIO3 5KNCA 1EY6A 1GXDC 3OMGA 5DEHA 1VZ6A 5E6JA 3KBGA 5KYLA 5EKIA 5CGKA 2FE8A 1SDFA 1FD6A 4L6TB 1RCVD 3AE2B 1H9SB 4YTMB 1JWMD 1J7CA 4DU9A 3EGRA 3ZYYX 3HVDA 4N59A 4BS9A 3NSWA 3NWSA 1KDBA 1EWHA 2I07B 2K22A 3DWMA 3HKZB 2N9KA 1VZ7A 1JROA 1PRTC 2BTEA 4JPSA 1F9PA 1EIGA 3KWVA 5IGGA 1C4PA 4FF3A 5H92C 1C76A 1RTNA 2F0FA 3E5SA 1HZ5A 3TMEA 3A8IE 3W5VB 1QOBA 3EUB2 1L5PA 4REZA 3P7JA 1B9MA 3AB9A 1II3A 4HCEA 4IUNA 5ISRA 1Q1BA 4FF4A 5EKLA 3MP9A 2KHSA 2X38A 1I6VC 2F0LA 3TZUA 4MACA 4JBWA 2K28A 1MD2D 4OVZA 2F03A 1FMAD 4C3JG 2X69A 2XN9C 3D4RA 2LFNA 2BS2B 1BCPC 1Z47A 1EEFD 2INPE 2D5GA 2D62A 2LMCA 2LUMA 3T51B 2X6GA 2K5QA 2F0EA 1TS3A 2HCIA 1EY5A 4KGSA 2K6AA 2B39A 3RLFA 3T3NA 1ENFA 2XRSD 3HRZC 1YNND 3JAME 4RA8A 2V3PA 1V43A 4ZHOA 2E6XA 5IIFA 4L23A 4L2YA 2XNAC 1VR9A 2WIIB 1L6UA 4LK0M 3HZXA 3SXHA 1TZOA 2R6GA 2B2UA 1E10A 1MI0A 2JSOA 1PMRA 2EYPA 4KKSA 2KACA 5BYRA 4ZKBB 4ZK9B 3I91A 1PZKD 5FO8B 2DWQA 1CHPD 2MHVA 5C4XB 3Q0AA 1KLUD 2F3WA 4RNAA 3AECB 5GXGB 5IT9L 2DY8A 4HN7A 3SE0A 1PRTF 2KEDA 5I9PA 3OHXC 3NTIA 4FF1A 1E2ZA 3TN2A 1JQYD 4KX6B 2K01A 1PTOC 4G4KA 5CV6A 2B76B 3J81L 3PUXA 4A3BB 2ONQA 1UWMA 3MVVA 4QUCA 1RWSA 3BDOA 2IX3A 5C0XH 1D5XC 2PNRC 5DM63 3OW7A 3DWAA 2MPMA 1T5XD 2NN6I 4WQMA 1BUIC 1M4VA 1JWSD 3R2TA 2BS3B 4ODGA 2WXQA 1BF4A 1NVID 3MHZA 2K32A 1G2TA 4IFDH 4N58A 2Z4HA 3PUVA 2QILA 1LTSD 3U7ZA 1U4MA 3ZJTA 3CU7A 1PGBA 1FO4A 1ET9A 3E9SA 1IKLA 2CQAA 1KDCA 4DK0A 3BK1A 3E0JA 3MEHA 2MP1A 1CZWA 1ROEA 2PVOD 3GP7A 3P42A 3RFZB 3SR6A 1G6ZA 3HOVB 3V05A 2WP8J 4G7HC 5JJZA 5FR3A 1BDOA 2WINB 1CA5A 1SB3C 3AU7A 4YSZB 1PZID 1RYJA 1EIHA 1QILA 1DOYA 2EYMA 4WFN3 1ZXTA 1YNJC 3BVZA 4ZHPA 3M3YB 2A68C 5BMGA 1Z6HA 3PUZA 2L1BA 2QJLA 2NBFA 5JEAH 4OZAA 4BBRB 1BBXC 1IW7C 2ZW0A 1C8CA 1I50B 2XIWA 1XTCD 1XEEA 2QF7A 1FFUA 2K04A 5BN5A 1VMCA 3N6RA 4RH6A 2OF1A 2JEAI 1E7PB 3NTKA 3I4NB 2F0PA 1EM7A 3QWNA 4WH4A 2J42A 4QIWB 2PIAA 3HOZB 3DEOA 1SSOA 1YN4A 2K7VA 5C5LA 2B2WC 2HCCA 4C3HG 5AUKA 1GUOA 4A3FB 4C3HB 1Y69U 1WTQA 1DJRD 2M9VA 2OHFA 4TMAB 1EYAA 1SNCA 3E56A 1HFNA 1L0YB 1U4PA 5T8IA 4A6QA 1FXAA 1DZ1A 2PW7A 1N5XA 1V8CA 3H3VC 1E0BA 5EBCA 1OXSC 1K53A 3P4RB 1SYCA 3Q8BA 1LTAD 4US8A 2QSDA 1BXTA 3SDZA 1D2BA 2IPKD 2KDMA 3VRAB 2L52A 1PFDA 4KY6A 3Q23A 1I7HA 1TKEA 1TR5A 4RAUC 3B2FA 2JP1A 2XRQD 1A15A 2BB5A 1QCBD 2KCCA 5KYIA 4KKUA 3OWEB 2R92B 3AE8B 1E6EB 1FNWA 2EJMA 5ELDA 4L63B 1R7SA 2O5IC 3VR3A 1AW7A 1H9KA 1Y8OB 4HCSA 2QCPX 5G5GA 4P16A 2PZTA 4N9PA 3M7GA 2SNSA 2HDEA 4J3OD 4K6LA 5EPKA 4B08A 2B2TC 2JE6I 4H0LC 3W2DA 1IBXB 1C78A 3QJYA 2WXRA 1FCLA 1G8ZD 1SF0A 3K59A 3ABVB 2E2IB 1F77A 2F0SA 1D5ZC 2NWGA 4HMIA 1FNVA 1PRTB 4C3JB 3IFTA 1TT2A 1OFFA 2KUMA 3MA2B 1FM0D 1MVKA 1I3QB 1HRJA 1TQOA 1LTGD 3IAM1 2F0KA 4CJ2C 1NCVA 4XYQA 5JVH3 3C2PA 1EQVA 1O78A 2F0HA 2WB1B 5C4HA 2Z1CA 2BOSA 2EZVA 2N9LA 4DQOC 1CQVA 4KJOA 1HA6A 3KUPA 1XO3A 2EE1A 3FVQA 4ULLA 5A35A 1TIID 1GUSA 2AX5A 3DEPA 2MH7A 1L4ZB 3Q8CA 3P1HA 5M3FB 3U52E 4WJWA 1K51A 1ZKOA 1HEZE 1BQQT 2B2YC 1QE6A 1Y1VB 5C3JB 3DUZA 3H0GB 5CV5A 1TVXA 1VF7A 1OXVA 4XQQA 5C3EB 2JXTA 2CHBD 1RDPD 3T53B 1LT3D 1F2LA 5BN3A 4DK1A 2G9HD 5I2XA 5FO7B 5J39A 1N60A 1EY7A 1DOKA 4DN4M 1OXTA 4B9WA 3OOCA 2E2HB 3LB8C 2BDOA 1N5WA 3MFYA 3DHQA 2RQXA 4C1NK 3ZGZA 2HTME 4DXGA 4F8MA 4XWWA 2V3NA 3SFDB 5C4JB 2EELA 4P6VF 1PGXA 1OQRA 2JU6X 4K8JA 2GB1A 3KLRA 4AQ7A 1HTPA 1SYDA 2WS3B 3MC0B 1WYGA 3FMCA 5LL6S 3L4PA 3EFXD 3QG1A 4ZAIA 3P4PB 2BDNA 1MSHA 2E76C 3VYSA 4YIJA 1D4BA 3NBIA 3NBHA 1NENB 2LHDA 2G9DA 4K5WA 2JXMB 1LABA 4IZ8A 3AEAB 4KY7A 1QOFA 2A73B 2L5TA 2J52A 1AEXA 4C1NI 1S4ZA 2M0AA 1UNSA 1SYBA 1PTOD 2Q5WD 3OPOA 5F2DA 1H9JA 5E4XA 1OXUA 3VR8B 2F0WA 2GA4B 2SEBD 4HSPA 3G7LA 1WWTA 3A56A 5CV8A 4X3TA 1S5BD 4WWMA 1CA6A 1JR0D 5K36H 3OSOA 3GO5A 3L3OC 4DXFA 2D9UA 4C7ZA 2MEKA 2A74C 3Q6SA 3RUZA 1TWHB 2KVMA 3Q69A 5ELEA 3C46A 3FEWX 1PFNA 4M1UB 4EGVA 3GD7A 4Q0FA 4RHRA 3ZQ4A 1E2WA 3OWFA 3MXUA 2LS01 1HXYD 1R4QB 3K5OA 2RDGA 3RMHA 2IX1A 1FFVA 4RCOA 2WXPA 3VQIA 4CJ0B 1QJOA 1MHXA 5FOBB 2NUCA 3EJIA 2A69C 2NMQA 5CMDA 2EXZA 2RBMA 3VR2A 3TP5A 5CBAE 1RTOA 4CKBA 1GOZA 3OIQA 1STYA 1T3QA 1EU4A 3CRLC 4IFDI 2JA7B 4MIUA 4ZRPA 1B53A 2VUMB 1JWAD 3K57A 3NS1A 1EYDA 5E4WC 2A69D 4XXEA 3HOYB 3Q24A 2EJGC 5JPMC 1DOXA 1WTPA 3ZJUA 1WRIA 1C77A 3AE3B 4J8QA 2PLPA 3S1RB 1DOIA 4DA2A 4M0WA 4UDUC 5HHDG 5DAUA 2JA5B 2F0MA 4NAMA 4O1NA 1ZDXA 1PZJD 1OO9B 1TKYA 3HOUB 1VRAB 1CHQD 4ITKA 3L7ZC 5A2QL 2B8FA 2B8GA 1KF6B 4JE3B 3J7YW 2WDQB 1EEID 4XQNA 2D2CC 4BWGB 4ZLTF 2K9XA 1PRTD 2VZKD 5BMHA 5EGTA 3QB3A 5EPJA 3S2DB 2WP9B 3VRBB 2MJ3A 3GV6A 3GTQB 2RDHA 4MT5A 1J9OA 5C44B 2JX5A 2E2DC 2B63B 1Q12A 1GB4A 3R3OA 2V0GA 4XDCA 1DYQA 1S5ED 1T5EA 5HURA 4LJZC 2Y3AA 1JORA 3K58A 1YJJA 5EJWA 4KGTA 4QUFA 3PIP3 3SHLA 2ZXPA 4TRDA 2F0IA 4A8XC 1LT5D 1ESRA 2F3VA 1A70A 3SK6A 3T4AC 1O80A 3FRPB 3QOLA 4X3UA 4FO2A 3TBIB 1KABA 1KAAA 2FMMA 4MM3B 4GDLB 2KQ4X 1ZPSA 3N52A 2E74C 2W54A 5C2TB 1JB3A 5C3WA 4YT0B 1B1ZA 3V2TA 2FJ2A 3FDTA 3M4YA 4KD3A 5M5YB 1WTVA 3IAYA 4XWTA 4C56C 1PXUA 3WOEA 4GDKB 2YU9B 5D7GA 2DNEA 4AS1A 2A6HC 4R9WA 1IKMA 2ZW1A 3NVZA 4A55A 4BA1I 1MBYA 1WTOA 4YXDB 4K2LA 1EL0A 3H6MA 1IGCA 3GQBA 3BVGA 1RFKA 1TS4A 2MJDA 2JA8B 3I3CA 3P20A 2N7JA 2N0SB 3W3AA 2B2TA 2A6HD 1LACA 4R3DA 4RWSC 5M9OA 2OEDA 1L0VB 1UUPA 4F88A 2NN6G 4DNTB 2B2VC 5EE0A 3MTSA 3VR6A 5FO9B 3S15B 1JC7A 4V190 4YTPB 4X3SA 1F2RC 1PUTA 5CBEE 1ET6A 4JK1C 2TSSA 4CGYB 1QNKA 2L9HA 1Y1WB 4YTNB 1PDXA 1SAPA 2TMPA 3NWTA 3L9AX 4DAPA 4OW0A 1LLRD 4S3SA 2R3ZA 3O13A 3X3NA 1ZXHA 2W82A 1G91A 2L55A 3PZ7A 1LT6D 1PTOB 4HSVA 4RGMA 1I4RA 4IOIE 5JOBA 3HOXB 4LAAA 2NVQB 2PO4A 2F0DA 2F0NA 4RCNA 3GB1A 2AWOA 4V0BA 3M7NA 3B9JA 1YMHE 2KQ3A 1KLGD 1VF5C 1RHPA 1HCZA 3PO0A 5M5XB 5I6WA 1ZP0B 4CQNA 1SJHD 2LEKA 1B2TA 4R8NA 1WCMB 1PTOH 3GV3A 2I46A 5IT9E 1IGDA 2H4OA 1VJKA 2W3RA 1N63A 1DCZA 1XF5L 1P7FA 3SR1A 2SNMA 3VYTA 1AFPA 3R8BA 2JA6B 1KRHA 1GAQB 1DXMA 5LL6X 1ZDVA 1TKWB 3ND8A 4KGRA 1GB1A 4UAIA 4C80A 2WQYB 2WDVB 3WOFA 4B9XA 2L0CA 3IAS1 1C79A 1XYIA 3V96A 4FXDA 3LWEA 1SBBB 1R4PB 3KBXA 3K7AB 4PMWA 4JX1C 4OZCA 4ZOHC 2EJFC 2BS4B 4OO1H 2Y0SB 2PTLA 1TWFB 1NAPA 2H89B 2EYHA 3I4LA 2N55A 1I6HB 2R93B 2PCFB 1MI2A 1WTRA 2K5WA 4RGOS 4KD4A 4FXKC 4ID6A 1MPEA 1RM6C 3NE5B 3CWIA 1CFMA 2A68D 1E0ZA 3DMUA 4OIKA 3FPPA 1JWUD 2WXHA 3OIPA 3A7LA 4FXGC 4NKLA 3GTJB 4GLSC 2M00A 1SFOB 4RHSA 1B50A 2EDGA 5HG2A 4HRSA 1LTRD 2KWDA 4KKIA 3HEJA 5HGTA 1I4QA 3I8ZA 1QOAA 5M5WB 2BYTA 1EWYC 2KN4A 4M8AA 4RF0A 3I90A 4DFAA 1X3PA 4I7ZC 5EKKA 2QKIC 5KGUA 1UEAB 3MAQA 2K3UA 1STAA 2F1MA 2Z8LA 5CV7A 2RVLA 2MJ8A 4K14A 1RD9D 4WIPA 2WXOA 3N9YC 4DAYA 1YQ4B 3RD4A 3RZDB 2ENBA 4HAEA 2Y5PA 2FMCA 2KECA 1ZUD2 1F2RI 5D3IB 4RF1A 1WD1A 2HDMA 2NTTA 1L4DB 4Q5VA 2EYLA 1Q90A 3AEEB 2LKVA 3PUYA 1WTXA 2BB6A 2A6EC 4C7YA 3IKJA 3SFEB 2WKCA 2W3SA 2OXPA 4KHVA 1ILQA 3RPFC 1TJEA 1TS2A 3LNNA 4MHEA 3KLSA 4TSSA 4TQ1A 3GTMB 4GZYC 2W55A 3Q8FA 4ME5A 1Y8NB 2J4XA 3D6WA 2HDLA 5KEEA 1OQQA 2EPBA 4WORA 5CR3A 5C0XG 1F9SA 1PFBA 1DOMA 1AN8A 1C4QA 3VR4A 3J81E 3RZOB 1KH0A 3NVYA 3CRKC 3WDNA 3NQTA 1MHHE 5COYA 2C9OA 1PFMA 1Z7TA 4PMCA 2ON8A 2A5HA 3FC4A 4HJGE 2JYOA 3FKIB 2R7ZB 5BMIA 1QWYA 4XDXA 2WDRB 3NTHA 1I4GA 3R93A 4G7ZC 5ELCA 2F0QA 3MWYW 5FKAC 1A6XA 5C3XA 3HUIA 4A93B 3HOWB 3PMFA 4IALA 2QEJC 1O7ZA 5JAVA 1TKGA 1HTLD 1SNPA 3FPUB 4IKGA 3I9V1 4Q2JA 3PV0A 1OXXK 5E3FA 3EVQA 4NJCA 1STHA 2H1EA 3DWGC 2CJOA 1CZPA 4MH8A 5CV9A 2EYOA 1C48A 5IGCA 1SMYD 1FCCC 3ZJVA 3SVMA 1VDZA 4F7XA 1EY8A 4ARCA 4FF2A 1I4PA 5FLXE 1SIJA 2J53A 2PKOA 1STBA 3LYYA 4QMGA 1D1KA 1ML0D 3CQZB 1HPCA 4R8IA 1UWXA 3KWLA 2X6LA 5JEAJ 4Z9CB 1EU3A 3NUHB 3S2HB 1ACCA 2LFIA 1SE4A 3SEBA 4KKTA 4RKBA 2AQ1B 1QG7A 5G3LD 1FRRA 4L8JA 1TWCB 4ARIA 1VLBA 3K5MA 1U9RA 2WXIA 1EOTA 2F0TA 5IGDA 4XQJA 2L4NA 4YWGG 2BA1A 2GI9A 3C8YA 1QF6A 1RKNA 4MN3A 3ERQA 5HI1A 4KI0A 3E6ZX 5D3DA 1V97A 3D3RA 3P1MA 2PW5A 4H2AA 1F9QA 5IGEA 2E75C 4K5XA 1FD7D 3D31A 4US9A 1EY9A 1AZPA 1XCQL 2Q8IB 1AWDA 4HKZE 4HKQA 5KNBA 4NDXA 2MUYA 5KRUA 4QF4A 5JVG3 1TU2B 4H44C 3A8KE 5EQ0A 1EFID 4U68A 2NVXB 5NUCA 1CJEA 2VNUD 1HFGA 3Q8AA 1ONLA 3S1NB 1YN5A 2A6ED 5JPNC 3TSSA 1JE4A 4KJNA 1KTKA 3I73A 4KY5A 2WLBA 1NYQA 3F2UA 4BY1B 1K52A 1ZOYB 1F2YA 1GJXA 4A90A 1VCIA 3G6JB 1N62A 1DGJA 1X3QA 1BMLC 4EVOA 1XWEA 3IXSA 2RA4A 1DD2A 4PMBA 2PMVA 4RGNA 2LGIA 3K6OA 2QIEB 1P7EA 1YN3A 5D14A 1QB5D 1YQ3B 4EQNA 3NPPA 5JXVA 1C9FA 3W9CB 1ENCA 3OMCA 2Y5CA 1EZ6A 2V4DA 3TEXA 3S9WA 4X3KA 2F0OA 4HMJA 2R61A 3S16B 3AEGB 3DWPA 1AP0A 4USAA 3TEYA 3J80E 2K1BA 4KMUC 3IT6B 3P75A 2KAJA 2L11A 4OO1I 1XXGA 1LTID 1IHZA 1X32A 3QIAA 4XT3B 2ZT9C 1W6JA 4LTUA 2WXMA 4IQZA 4A3EB 1JMLA 3S17B 3HS0C 5C6AA 1JQ4A 1XCTL 3M85A 1WGKA 2K5PA 3NVWA 1J8IA 2FUG1 1U4RA 4A3KB 1F0ZA 2B2WA 2K0PA 3MHBA 4A3JB 1A2TA 3NXWA 3SK5A 2NVYB 4QCLA 3C1EA 3VA5A 2M56B 1BO0A 2Q8TA 2BE5D 1VDVA 2WXLA 4N6EB 5MPOA 2OEOA 4DGZA 1SYGA 1E2VA 4XIGS 2OT2A 3TP8A 3HVZA 1LTBD 2L12A 1EQTA 5K5PA 1ZYRD 4LMQD 4JWUC 2B2VA 5G3LF 1D5MC 1BNZA 1NR4A 2PQEA 1GHJA 1XLOA 5DNFA 4KHZA 3VYUA 2L83A 2Q8RE 1FYCA 3AE4B 2PW9A 4XE0A 3SK8A 1PGAA 3J7AF 1NSNS 1Q8IA 5IODA 1H9RA 4KTAA 3TP6A 1ZYRC 2WV6D 3AEDB 2VZKB 3PZ8A 5K36G 1RODA 4DNRB 2SDFA 4K6DA 2M2LA 4NAWB 1DONA 3K0YA 2IL8A 1S5FD 5AUIA 1FNUA 3UI2A 1MGSA 5ELFA 2O5JC 2PZUA 1VZ8A 1PDQA 5KIXA 4P2CB 3H8HA 2JQRB 3BDLA 3HG9A 2DY7A 4L1BA 3T16A 1V8QA 1KFYB 2K05A 1HQMC 2G1EA 4CBVA 3MJ5A 5EE1A 4B0MA 4C3IG 2AQ3B 3QO2A 4FVMA 4DF7A 1YNTE 1F9RA 3EA6A 4WURA 2FFKB 3D4DA 1W6KA 3AE1B 1WTWA 3TDQA 2K33A 1ICWA 4IUQA 3M4OB 1CK1A 2E2JB 3BS1A 4A3GB 3KF8A 4HEA1 1QOGA 3AN1A 4KK7A 4IN3A 1B9RA 1B3AA 2KA7A 2WXNA 1ZEQX 2JYTA 1SEBD 1N61A 1ZE3D 1XX8A 1S5CD 1TY0A 5G5HA 1GUTA 3AE9B 4LK1C 3Q22A 2XWBB 4FNFA 2XWJB 2CJNA 1YNNC 3DM1A 2LY7A 3KLSX 4TKOB 2WACA 4IURA 4CJ1B 2WXGA 3GS2A 4ZRQA 2KOLA 1H9SA 2B2UC 4J6HA 4A3DB 3AMZA 1EYCA 4CKCA 2BCOA 5IGFA 3J7AV 4U673 5CV4A 3I57A 3AEBB 2WNMA 5CORA 3LWUA 3FAHA 2WAQB 2GRIA 4OGQC 5C0XI 1O7LA 3AMUA 3BVMA 1SNQA 4ZKCB 5CC4A 3TEZA 5DM73 2PYKA 1SNMA 2IT1A 1QT9A 4IUUA 5C0XJ 1GHKA 5T1IA 2E3TA 3NUCA 4HTHA 4OL7A 2K03A 2J7ZA 2DNCA 1YJIA 1WSPA 1V1PB 1A3VA 1LV9A 2SOBA 2I2YA 2DYMA 3PO2B 2ID0A 1A3TA 1NR2A 4IFDJ 1GUGA 4KN7C 2DYOA 1BOSA 3AE6B 3H09A 1PLFA 2IX0A 3MZ5A 3MFGA 1G291 2HQEA 2M19A 1G2SA 3GTOB 1O7YA 3HGBA 1QLBB 2VB3X 4IUPA 4YSYB 1KNAA 1SNDA 3S1MB 3HRDD 3C3LA 3CIRB 4DAVA 2SAKA 1JALA 1FXIA 1XLNA 1JOKA 3BYYB 4HROA 1GPXA 1FR3A 3BZDB 1GUNA 4KN4C 2WU5B 1CZGA 3MXPA 4G57A 2F0JA 2F0UA 4H7BA 5BYQA 2Z4IA 1CTMA 1JCKB 1NEKB 3GTLB 1M8AA 4ZRZA 2EYFA 2LJIA 2NTSA 1STEA 1ILPA 1FIQA 3P4QB 3CHBD 3AB5A 3NVVA 3ND9A 2WU2B 3V3XA 2NN6H 1JW9D 1L0XB 3W5UB 2ZXOA 1LT4D 2ICIA 4EQOA 1PTOF 1ZXIA 3NZ3A 1JRPA 4K2KA 4N9TA 2IJ0A 4TQUS 1HUMA 1EZ8A 3AH7A 2ZXRA 5AFWA 2V4IB 3AE5B 3U9SA 5A2QE 1JWBD 5J1ZA 1NUCA 2IWHA 3LX0A 3IL8A 3NHHA 1A3UA 4FXCA 1NYRA 1KNEA 3BK2A 3Q8EA 1RJTA 2INNE 2K5DA 3TP7A 4H13C 1L6VA 4F87A 2F4IA 1VMPA 1JOQA 2CW0C 1F2ZA 3BIID 1YNJD 2IDYA 4CHTB 4D2KA 2O2LD 3TZDA 4OO1G 3DXJC 2AUKA 1K8MA 3NK9A 1IUEA 1WVLA 2VB2X 1TWAB 2VXWA 2RDFA 2JEBI 3NP8A 4XDDA 5BN4A 2WKDA 1CT1D 1D6EC 1SXTA 3U4EG 1QOHA 1LTTD 4PV1C 1BCPD 3IT4B 1C4AA 3W1SA 3FILB 1SE3A 2YYZA 3EQLC 2EOTA 2NB0A 4FYDA 5CYUA 2FBWB 2DBYA 3U2SC 3S14B 1R9TB 4OZBA 2BW2A 1V1OA 4E6IA 1I4XA 2AUJD 2PMZB 4WAFA 1SMYC 2FINB 2LMCB 1J7BA 5HFYA 2HUGA 1Q3LA 1RF2D 4J1MA 1SYEA 2F0VA 2JZPA 1A2UA 4PQXA 4YSXB 1SYFA 1F2MA 4XT1B 2EKIA 2QMTA 4NW2A 1HQRD 3DWQA 4BBSB 1TYGB 1SSNA 2J0TD 3WCQA 5LHY1 3I4MB 2RMMA 5C5MA 3GTPB 1STGA 4ZQ3A 5BYSA 2WXFA 4A9AA 2CU3A 4NP5A 1T6BX 5FK9C 3KQ4A 1KDAA 1K8OA 4RKLA 3VR5A 1Q1EA 2IW3A 3BDCA 3TUOA 3UI3A 1K50A 2IGHA 4WRDA 1DOLA 3U9OA 1BR9A 4NZLB 4AYBB 2QDBA 1Q10A 2NZ1D 1UAPA 1WXQA 4EQPA 2YEPB 4O42A 3SK4A 4IUTA 5T1GA 1U4LA 2RSNA 2NYZD 3NQIA 2DLBA 1C4CA 2YEPF 1JICA 5C4ZA 2FHTA 3R2IA 4ABNA 1SE2A 3D6CA 4OIJA 1Y56A 5LNK1 5FLXL 1J7AA 2KMMA 5IGBA 3AV8A 2EVBA 3CKIB 5EPLA 5I4DA 2MJEA 3H91A 3HP3A 1E9MA 1AYFA 1PYWD 1HZ6A 1IL8A 3BG3A 3VR9B 3GTKB 1SNOA 5ELBA 2N88A 2RSOA 1DM0B 1EY0A 1H9MA 4ZYSA 4PNYA 3ETRA 1STNA 4LLGM 1HHVA 1B4OA 4KKJA 2AWNA 1V1PA 4QB4A 4ZUIA 3T3OA 2KCNA 1Y8PB 3LXFA 2JWUA 5I9OA 4A3MB 1CM9A 3MXGA 3P63A 1S5DD 1XLPA 4ILWA 4BA2I 4EE2A 4HR7B 3QOJA 2H88B 3BYTB 3T56B 1ENAA 5TSSA 2L1AA 2WXJA 1IYUA 5EE9A 1NI3A 1UGJA 5M3MB 4A3IB 4OHJA 1EY4A 1JOOA 5IOCA 2NVTB 3JAML 1IW7D 5EBDA 1MSGA 4C2MB 1BUVT 2CW0D 3GTGB 5I2YA 3X3MA 2PPBC 2IGGA 2EYJA 3D8GA 3T13A