2IPKD

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ipkD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ipkD01
1PRTF 1D5XC 3EFXD 3BVZA 4ZYSA 1PZJD 1SJHD 1HXYD 1PYWD 1PTOF 1T5XD 1PZID 1V1PA 5ELBA 5I4DA 3R8BA 2QEJC 1B44D 1I4RA 2IJ0A 1LTID 2O2LD 1TY0A 3R2TA 1LO5D 5FKAC 4L63B 2XNAC 5ELEA 1CHQD 1PRTD 2J4XA 2R61A 1KTKA 5ELFA 1V1OA 1BCPC 1PTOD 1RD9D 1LTAD 5D3DA 1EEID 1DJRD 1XXGA 1CT1D 4RFBA 1HA5A 1JWUD 1LTGD 3EA6A 3OWEB 1FNVA 1YN5A 1LTSD 3O13A 4RGOS 1M4VA 1ENFA 2QILA 1TS2A 1PRTB 1S5DD 1SEBD 1BXTA 1LTBD 1PRTC 1STEA 4C56C 1PTOB 1I4QA 2XN9C 5D3IB 1PTOC 1I4HA 4RCOA 2AQ2B 1JR0D 3BVGA 1BCPB 4DXGA 1FNWA 1SBBB 1SE4A 1TY2A 1RF2D 1ET6A 1SE2A 1MD2D 4TSSA 3V05A 1B1ZA 4Z9CB 1LTRD 1L0YB 1S5FD 1L0XB 4RH6A 3R2IA 1EU4A 2RDGA 1I4XA 1CQVA 5ELDA 2G9HD 1LTTD 1S5CD 1SE3A 3GP7A 2ICIA 1I4PA 1YN3A 3DWPA 2NTSA 1D5MC 3BYYB 1LT3D 1S5BD 1SXTA 1G8ZD 4DXFA 2IPKD 1HTLD 1CHPD 3TSSA 2SEBD 3W2DA 2CHBD 5TSSA 1HQRD 1JCKB 1DYQA 1JWSD 1PZKD 1F77A 1JQYD 1FNUA 1FD7D 1UUPA 1ET9A 1AW7A 1FGBD 4O1NA 4RGMA 1EWCA 2NTTA 3MFGA 1GOZA 3KLSX 1TS3A 1UNSA 3URYA 1EU3A 3BZDB 1JWMD 1KLGD 2RDHA 4OHJA 4L6TB 3DWQA 5ELCA 1D5ZC 1AN8A 2WV6D 5FK9C 1SJED 1CK1A 2AQ1B 1I4GA 1BCPF 4RHRA 4RGTA 3MC0B 4NZLB 1LT5D 2Z8LA 1RCVD 3BVMA 4RGNA 1PTOH 1QILA 1YN4A 1TS4A 1V1PB 1TS5A 4BWGB 4K6LA 4RHSA 2XRQD 3DWAA 3CHBD 1EEFD 1S5ED 1XTCD 2TSSA 3BYTB 2XRSD 2AQ3B 1LT6D 1ESFA 1LT4D 1RDPD 1LLRD 1D6EC 3SEBA 1BCPD 1EFID 1KLUD 4UDUC
chains in the Genus database with same CATH superfamily
2WXKA 4FXDA 2ZT9C 1ZDVA 1OXTA 3KLRA 1YI2A 2R7ZG 5FJ8H 3S2DB 1PTOF 5ELOA 1Y1WB 1B3AA 5IYBH 1L4DB 2MRPA 1V1PA 2W3RA 3M95A 4PZ6A 1AARA 4A3KB 4KHZA 2GOWA 3K80C 1EIFA 3QJZA 1D1KA 1LO5D 3TN2A 1XMQQ 2K5HA 3K58A 1PH8A 4HK2A 2IO0B 1SRUA 3K7UC 3TEHB 1V9JA 3KUCB 1ACCA 2BOSA 2OQ0A 2V3NA 2VL6A 4ACFA 1BDOA 1N36Q 3GTJB 5T8IA 1ZKOA 4YY3Q 1WGKA 1CT1D 4IUVA 4OGQC 3N9YC 4LFCL 1RYJA 2ZJRA 2K8HA 4ZYNA 3ZKJC 1LV9A 1C0AA 3D31A 1KRTA 1KC8C 2FHTA 4DHJB 1C8CA 5CHWA 2QILA 2KJRA 3V3XA 4JIOU 3WIMA 1I42A 2G4DB 3CCSA 4JCVE 1SYCA 1XT9B 4KGSA 1HZ6A 1J5EQ 5GQOA 4HR7B 2O6VB 4G50A 5T1IA 4GKKQ 1C48A 4HKQA 1KJTA 1R4NB 1WYWB 4E71A 1QG7A 1L6UA 4N8X1 4JI8Q 5DM73 2EZVA 5HGQA 1VQCA 4U673 3QK0A 4TSSA 2X38A 5KHOA 1N63A 2JSVX 3P4SB 4X65Q 2P5ZX 4M01A 3AU7A 2WWZA 2EJGC 5T1GA 3TMPB 1I6HB 4DR1Q 1O78A 3GTLH 3H6MA 5AJ3L 1L0VB 4ZAIA 5E6JA 2O6VA 2QW7A 1PLFA 4ZRPA 1OXSC 1V97A 1VR9A 3H6NA 2EXZA 4FF2A 5AZHA 4XQNA 1FD6A 3PREA 3RD2A 1RTOA 1X32A 1O7IA 4A3CG 2IPKD 5BN3A 1E6EB 2DZJA 5K36H 2LZ6A 2JQOA 4B3SQ 4DDGD 1GUSA 4XWTA 4UHVA 4XYCA 3IAYA 5AEKB 2RQXA 3PIO3 4A3FH 1YQ3B 1FNUA 3T56B 4GOPB 1V5OA 4LNNA 1A3VA 1YJ9A 5EE0A 4EE2A 1VMPA 1QOBA 1HR0W 1XWEA 2N7DA 1L0WA 3V60A 2HHHQ 4LJOB 4BY7G 1WJUA 3BZDB 2OEOA 3I3CA 3PIP3 2E2IH 1WVLA 2F0DA 2M0XA 2WV6D 1TT2A 1I7HA 2RBMA 2VB3X 2L5TA 2I07B 3E9IA 2IDYA 1UE6A 4EQNA 4JE3B 1JT8A 2DN8A 4X3KA 3WAOA 2N55A 4GOPA 2E5LL 4JWUC 4XGAB 2F3VA 1LM0A 3VYTA 2MQJA 2M19A 4DV4L 4AYBE 3S16H 2WKCA 1Y69U 3RT3B 4K3BA 4KI0A 1SN8A 4JV5Q 4TVAB 1X1MA 1TVXA 2I1KA 3CCQA 2EE1A 2Z6BA 4DUZL 3Q8AA 4WQOB 1H8CA 1KF6B 4JI0L 4US9A 3KWVA 4CJ0B 1B7YB 2B2VA 2A8VA 3BVZA 3CPFA 3ND9A 1FJGL 4ZUIA 2WB1E 1OXXK 1HXYD 2L0TA 4C7YA 2JN4A 1R4NI 2KDMA 5KEEA 1YJWA 2NS5A 3PRZA 5GAGC 1LTID 5CV6A 5DNFA 2OJRA 3ZDTA 3UDIA 1U4MA 4MZ9A 4UAIA 2UUBL 4LF6L 1PVOA 2FINB 5D14A 1YJIA 2QJLA 3SK5A 4ULLA 3OW7A 3X3MA 4IFDJ 3X23A 5D3DA 3IXSA 4A3IH 4QAYA 1YX5B 4R4IA 2KJHB 4KY5A 1PFMA 3K5MA 1QZGA 2IY0B 3TS2A 1HH2P 3KH0A 1OXUA 2A4ZA 5KNBA 4ICVA 1FEHA 2L76A 2Z4HA 3JSVB 4K2KA 2Z59B 3ZQ4A 1TS2A 5C1ZA 1U4LA 4E6IA 1S5DD 3H3VC 2I2YA 4ZKCB 3J80E 2MWSB 2F03A 3HFZB 3ZGZA 1STEA 2QIEB 1G91A 1WE7A 5DPTA 1EOTA 2KMCA 5FJ8G 1E3PA 3Q3OC 1TWFH 4X57B 5IYBG 1TQOA 5FO8B 5M3MH 3N1ZC 3UI2A 1N8RC 1Q12A 4ZCKA 1V8CA 4J1MA 4J6IA 4WJQA 1NY4A 1SNQA 4IM2A 3SU8X 3EROA 2PPBC 2MW5A 4LNQA 4I6LB 1MD2D 2WINB 4OIJA 2WYQA 3U58A 2LXAA 1L0YB 1KIXA 1XO3A 1PFNA 3PO3B 2OTJA 2KC2A 1D1IA 3T8MA 5J39A 5C44B 1XMQL 2EKEC 1X3PA 2WAQE 3NZUA 1EQQA 2EJMA 2PQAB 3GTPH 1UBQA 5JJIA 3I4MH 2EMTA 4P1BC 1ZXIA 3KK7A 2BYVE 2VQEL 3MC9A 4KV2A 3J81c 3UE1A 4OW0A 2R7DA 5C4XH 4DAVA 2WXGA 3H91A 1Z6HA 4IUUA 3HEJA 4CO7A 3ZXRA 3M4QA 1HTLD 1OQYA 4QCLA 2WXOA 4B3TQ 5HHDG 3ZRFA 1FL0A 4IUTA 1QOFA 5F2DA 3STBC 4G11A 3I4NB 2PQAA 1F77A 4ZRJA 5G2NA 1FD7D 4HJKA 1ET9A 1VQEA 4ILWA 2GMIC 3HOVH 5EPKA 2E2JH 3EECA 4HRSA 1UWXA 3D4DA 4K1RB 1E0ZA 1TS3A 2K6QA 2L3ZA 1LACA 2JP1A 1T0YA 2RDHA 3VR2A 1J5EL 1KM7A 1X9NA 5C4JH 5C6AA 5C3XA 4RF0A 3WWVA 2JA8H 2F3WA 2CU3A 2WP9B 3ABVB 1C9FA 1IBXB 4JI8L 1ZEQX 1ASZA 2ES2A 2BYEA 1Y56A 2B2YA 4YWKA 1MPEA 1TS4A 1NAPA 2E75C 4JBWA 1TYGB 3NENA 4DR1L 1UWVA 3BYTB 4ANUA 4OEMB 2DUDA 3GV6A 5JVG3 1GAQB 1SIFA 3IBEA 1IBXA 4KV6A 5K36G 1BCPD 2WS3B 1D5XC 3EHVA 3RYTA 3X3NA 1NMGA 4A3FG 4NJ7A 3D4RA 3M85A 1X3FA 3QG1A 2BS3B 3DMUA 3P75A 3VYRA 1WTOA 2BA1A 4LAAA 4CHKA 2CH4A 3RD4A 2ASQA 1VZ6A 1EY4A 1TIFA 3SFEB 4GKJQ 5FKAC 4AYBG 3HVZA 1B9NA 1LGRA 3QIJA 4ZRQA 4W9JA 1VCIA 2F0GA 1PH7A 1GUOA 5C23A 5J17A 3NVYA 1VQJA 1M94A 4WJNA 4C3HB 4K8JA 4HVBA 3GV3A 4YWMA 1U4AA 3CMAA 2WB1G 4FJYA 1HNZL 2Z9HA 1YN5A 2WDVB 4OWXB 3IAS1 3A8KE 4WJPA 1QNKA 2PE6B 4EQ5A 3KVFB 4ZDVA 1F0ZA 1KAWA 5COYA 4YT0B 1TWAH 1IW7D 3S14H 4A3DH 2B39A 2LASA 3H9DA 4GLSC 4PMWA 5JPNC 4B0EA 2R93H 2RPQA 2B63H 4NY0A 2ZJQA 4Q2JA 2JPHA 2K22A 4DHZE 5IY0A 3IT4B 2B29A 2JA7H 3T16A 5IAAC 4GN5A 4K2LA 1WXSA 2BPSA 3W3AA 4NKLA 3SD5A 5M5XH 3I7FA 2KN4A 4HN7A 3A7AB 1S5FD 5KYIA 3PT2B 1P7FA 4PNYA 3WOEA 2Q2TA 3ML8A 2PPHA 1WZ0A 2EY5A 4KTAA 4AH6A 1FIQA 2RCFA 1XCTL 2OEDA 4A3IG 3G48A 1LTTD 3TZUA 4NQLB 4A90A 5J22A 5CYUA 3I8ZA 4V190 4L5TA 1CA6A 2KWVB 2XGTA 3G7LA 3UE0A 3DDCB 3MTNB 2ZVOA 2QC8A 4RM9A 1XMOQ 1TWHH 4CKBA 5IP4D 1DOKA 4JPBW 4EZKA 1XF5L 2I5LX 3C8YA 1EIGA 3OWFA 3NELA 4DNRB 3GTOH 4B9KA 1Q81C 3VRAB 3W1SA 3K5NA 4C3IB 4NMZA 3JAML 2RHSB 1SFOB 3VR8B 4ZKBB 2C7MB 3NVZA 4W9DA 5M3MG 4DF7A 3QO2A 2L0FA 4EEWA 3APFA 2WAQG 4N6EB 1AZPA 4OO1I 3PGEA 4L8JA 3KYHC 3APDA 4AJWA 3GTMB 1WM3A 2DZIA 2JRHA 3D3RA 1W2BA 1K8MA 1STBA 5I2YA 4WAAA 1C76A 2Y5PA 2N4FA 1FVIA 2QCZA 1ENCA 3NVWA 4ASWC 4A4IA 3H3VH 4DR4Q 3AE5B 1SJED 3FAHA 2GRIA 1Q8IA 1TT5B 4NJCA 2PQEA 2RD0A 2PNHA 3RNBC 2K05A 2LXKA 2DY8A 2L12A 3I4MG 1EIHA 3PMFA 4XDCA 1II3A 1K3RA 2KACA 4JQWC 3CU7A 5C4XG 1WJNA 3CCVA 3A9KB 1WFQA 1JJ2A 3OTOL 4YXDB 4IZ8A 3ULJA 4OONA 4URKA 3V96A 4PV1C 1WWTA 3F1ZA 5LMNL 1Z47A 2W55A 4KJOA 1Q46A 3A7LA 1EYDA 2MJEA 2KECA 4GNXC 3BK1A 4MT5A 1PYWD 3SFDB 2A6HD 3TZDA 3HOYB 4KX6B 1VF5C 4HIKA 1ZUD2 3HOVG 5ELBA 2MX2A 3OG5A 3IT6B 3I4LA 2JZZA 3A9KA 1XLQA 1SGHA 5C2TB 4B0MA 3DVGY 4M8NA 2TMPA 2WXJA 2JA8G 3BZCA 3NTKA 2QF7A 1K8OA 2HTHA 5CMDA 4W9GA 2LVOA 3J80c 1F2MA 2F0MA 5BR8Q 2R7ZB 3AN1A 2OHFA 1MJDA 4PQXA 4M00A 5IO9A 3ZNHB 1U9RA 3IKJA 3NP8A 3U4EG 3ZYYX 5BN4A 2F3IA 4WURA 2KX0A 4LK0M 3I5JC 1GB4A 2K03A 1K3BC 1LTSD 2YTYA 1C79A 1Q1OA 4LNOA 4R3DA 2B2UC 1K53A 1N60A 4AS1A 3M4OB 2RR9A 4OL7A 3Q6BA 5IGBA 3MHBA 4A3BH 4QMGA 4WWNA 4JI5Q 3W5UB 4BBNC 4RMFA 4MELA 2ZJPA 4OXPA 3VR4A 2LVPA 1ZYRC 2E2HH 1TJEA 2O2VB 1EYGA 2JJQA 3E6ZX 3PGZA 2EY2A 4DU9A 1SR3A 2YV5A 3PUYA 1C4PA 3WCQA 3CD6A 3L17A 3R66C 1EY6A 2Q2HA 1Q1BA 1IZ6A 3KWLA 2B2TC 1KDBA 4MSMB 1HFGA 2Q2IA 1H95A 1VS0A 3UIOB 4K5WA 3D6CA 3AE9B 4M1UB 4X3TA 1RFAA 1CTMA 1ZXHA 2O2VA 3UIPB 1WD0A 3CRLC 1D5MC 1SMYD 3NK9A 2INDC 4KY6A 3HOUH 3NUHB 4P71A 4ALPA 3AM9A 2A1AA 3L08A 2KHWB 4BKTA 1CHPD 4A3DG 4MNOA 2PMZE 2SEBD 3EVQA 2F4VQ 4IUPA 1JCKB 2R93G 2B63G 1S3OA 2V0GA 1TU2B 3RMHA 4O1NA 3A5UA 1YNJD 3MXUA 4L5QA 2JA7G 1F2RI 2L9HA 3I2ZA 2I0QA 2EELA 4ZOHC 4OHJA 1EL0A 3LNNA 3RNUA 3RLOA 1JORA 2W9NA 2D3CA 3VTWA 4KKJA 2IW3A 5C5MA 1AN8A 2OTLA 5FK9C 1FXIA 1S3SG 1DONA 1E1OA 1WGHA 3SK6A 1K28A 4ARCA 2M2LA 1TIID 2NZOA 1BCPF 2F1MA 1H9JA 1T0SC 1K83B 3BVMA 5C0XH 4CDEC 1PV4A 4BY7B 2LJ5A 1UH6A 5J2RA 4GN4B 2HCIA 1WJJA 2LWPA 4OWWB 1LT6D 2BDOA 2SOBA 4CGYB 1Q3LA 1NDDA 5D6JB 1IGDA 2JF5A 4JI6Q 2LGDA 3A4RA 4YL8A 1DGSA 3L10B 3U52E 2RF4A 3HG9A 5H1SE 3MJWA 1PFSA 3PS6A 1G6JA 4ZRKA 1WFYA 2FNJB 4C80A 4RF1A 2CW0D 3IHPC 2JEAI 5A2QE 1JJGA 4WWMA 3NBHB 1JC7A 1ZGUB 4O0AA 4LFCQ 2A73B 5G3LD 3ZJUA 2UXBL 2O4XA 2BH2A 1N6ZA 2NPTB 4RKBA 1N62A 3A55A 3RZOH 2K25A 1Q90A 3OJ4B 1V1OA 2K4KA 2JA5H 1GO3E 4DK6C 2WXLA 4A3GH 3PSIA 2NVXB 2E76C 1NR2A 2BH8A 1N9WA 2H4OA 1QVCA 3NBHA 1TKYA 5HKHA 1VQGA 3G4SA 1JB3A 2N7JA 1OXVA 1EY0A 3V62A 1ENFA 2NPTA 3TBLD 3RZDH 4RNAA 1JICA 1STHA 4DV2L 3FEWX 4XE0A 4XDXA 2A5HA 2K28A 2EPBA 1PH2A 2BKFA 3P63A 2BE5D 2H88B 4F7XA 2KJXA 3I55A 5IOCA 1I4HA 2IT1A 1N32L 4KGRA 4XZ4A 4TMAB 4KK7A 1PH4A 4A6QA 3LYYA 4A3EH 2V4LA 1ESRA 3CF6E 5AJ3Q 1EY5A 2NUCA 2WP8J 3CCUA 2Y5CA 3DVNU 4X3SA 3K6OA 3BIID 3K0XA 1BBXC 2WXIA 1LTRD 1QLBB 2Z6KA 1C4QA 1L0XB 4RH6A 1FCCC 3OLMD 2HE7A 4POFA 1YIWA 5IOIA 3S17H 4HWIB 4GSWA 3B08A 1L1OC 2H1EA 1SE3A 4QUCA 2KDFB 1VLBA 4AP4C 1O7YA 2ICIA 2B2WA 4A3MH 1UZXB 4OIKA 3ZW3A 2Y3AA 3DWPA 2NTSA 3K59A 3BYYB 1K8AC 2WXFA 1B50A 3CCEA 3Q3MC 2KVZA 1XEEA 3I90A 1DOMA 4A3BG 4LMQD 5JEAJ 3MA2B 1YOVB 4A3OA 4BS9A 1T9HA 1QJOA 2K5DA 5DM63 4FHKA 1HHVA 2R6GA 4YSYB 2L1BA 1LM8B 1G6PA 3VH4B 3CSTA 2KWUB 2E5LQ 4MTKA 5JOBA 2BQQA 5IP9H 3HOWH 3W1BA 3I57A 2JWZA 4DV4Q 4HDOA 4KLKA 3ZO5B 3RN5A 1JMCA 3AU4A 1B8AA 4LW1A 1WY8A 2D07B 3ZNGC 1GJZA 1ML0D 3B9JA 3PRMB 2Q8TA 4CYEA 4JI0Q 2NWGA 4NZLB 1E22A 2DENB 1IBKL 2HQLA 1Q10A 4DV7L 2ZVNA 1VQ5A 4KN7C 4K6LA 4DR5L 4DNTB 4C3JB 3S1NH 3P42A 5DPSA 4C00A 4CDCC 4P72A 3Q2AC 3DM1A 3HOUG 2X6LA 1I50H 1RDPD 1LLRD 2K75A 2V9HA 3PRPB 4PMBA 3WALA 4A93H 4C1NK 4KHPQ 2UUBQ 1PFDA 3BU2A 4LF6Q 3R3OA 1VQ6A 3GTLB 3JW0X 4REZA 5AZFA 4FDBA 5JH5C 2XSCA 1ONLA 4YCWA 2Z0DB 1T5XD 2F4VL 2NR2A 3R8BA 2WNMA 3HIZA 2NMQA 1EQVA 3LWEA 2V1CC 1WTVA 1FFVA 5M9OA 4I7AA 4PZ8A 3ZJYC 1WGDA 4KGTA 4HAEA 2K0PA 2WU2B 3R2TA 4P7IA 2LRUA 1A5RA 3JC66 4FF4A 1Q0WB 1NYRA 3TS0A 2X8XX 1WOCA 4HJ7A 3S1RH 2ZTDA 3HZXA 1X56A 4A3FB 4IM0A 2KQ3A 3W5OA 1Z5SB 2LGXA 2M8SA 3CCJA 2HQEA 5C0XG 1A70A 3P20A 4GLVB 1F2LA 1E8WA 1U0LA 4AYBB 2WX0A 3EUB2 3ULPA 5CTRC 5I6WA 3U9OA 2KNBA 4JWSC 1JOQA 4RGOS 3GOEA 3C1EA 1JE5A 1SYGA 3H09A 3E5SA 4G4KA 3PF5A 4C56C 2R7FA 1YX6B 2PZWA 2A5UA 2NVUI 2VRRB 3KUDB 2K5PA 4HPPA 3VR6A 1MGSA 1GUGA 5IYCH 3S16B 2WB1B 4YWLA 1HZ9A 3Q23A 3CPWA 4JI6L 1TBEA 3SDZA 1SE4A 3SE0A 5LL6S 4IFDH 1WJ6A 4DA2A 1AFPA 3EN2A 2VQEQ 2I5MX 2JK8A 2DLBA 3NQTA 4Z9CB 3MZ5A 4GOPC 3F2BA 3QB3A 1VMCA 1A15A 5CBEE 1MJEA 1IBMQ 2JA5G 2R2OA 3AU5A 2SNMA 3S24A 3QJYA 1QVFA 5CV8A 4A3GG 2L11A 5LL6X 1QOHA 3FKIH 4F8MA 1VRAB 2L4NA 2XIWA 3L7ZC 2B2VC 3QCAA 4FULA 2MJ8A 1YJNA 3NOBA 3GZNB 3V6CB 3DOWA 1WD1A 1AEXA 1ROEA 3NE5B 4CJ1B 3PV0A 2L55A 2CHBD 1Y1VH 4Q5VA 4A3IB 3K9PB 5HGTA 5C3JB 3FDTA 3C19A 2L15A 2A69C 3QIAA 3L16A 1FGBD 2ZW1A 4WJ4A 4OZCA 1KOTA 2FE8A 3NZ3A 3OIPA 4A3EG 2B3AA 4XWWA 3FPUB 2QHOA 2WXQA 1GOZA 4LF9L 4PK1A 4F1SA 2RMMA 4TKNA 4NDXA 2EDGA 2K33A 3HK0A 4KN4C 2KD0A 2VXWA 1OO9B 1WH3A 5I2XA 1E7UA 1RWSA 1IYUA 3N1YC 4LDTD 1EY7A 1CK1A 1IYJB 4IJLA 1TWFB 3K5LA 4RHRA 2ZNVC 4MIUA 2Z4IA 4DV0L 3U2SC 5G5GA 5M3MB 5DPRA 1NMFA 1JE4A 1C4AA 2JVCA 2WAQB 4ID6A 3RN2A 4A3MG 3Q8FA 4RHSA 4P75A 1E8YA 1ICFB 5L83A 3NEMA 3TIXA 3CHBD 1JROA 2L1AA 2BA0A 3M4PA 4JC0A 3ZJVA 1EF1A 1ZOYB 4K3CA 1H4RA 4IOAA 3WANA 5EPJA 4A3JH 5G3LF 1KH0A 4II2B 5CC4A 2UXCQ 3DVGX 4JI2L 5D2MB 3T51B 2N8NA 3I4MB 1BQQT 1SJHD 1H9MA 4X3UA 1QT9A 4BOSC 2KOLA 3LX0A 4J15A 3VYSA 1E2ZA 2D5GA 5C4XB 1PDXA 3AE6B 3BG3A 4ANVA 2N9EB 5IP9G 4WQMA 5JZEB 3HOWG 5FLXE 3RFZB 2KAJA 4FJVB 4YCVA 1NR4A 1TY0A 1CI3M 1HNZQ 1SB3C 2MH7A 1JWAD 2UXDL 3TEWA 1ASYA 2ZW0A 2AWTA 3G71A 2R61A 3QAQA 4B08A 2I46A 2CU1A 2JXTA 1H9SB 3AI5A 4DR6Q 3HHMA 2K1BA 3QX1A 2ZM6Q 4LNFA 1D3ZA 2E2JB 2RCNA 4ZQ3A 2KTFA 3AEGB 1IP9A 3P7JA 5C3EH 3LJ3A 2KLCA 2IYDB 2JEBI 1NI2A 5I9PA 5C4JB 1R9TH 2D2QA 3MAQA 3GZNI 2EKIA 3N30A 3AV8A 2JA8B 3W5VB 2N0SB 4DK1A 4XTCS 3OAWA 2LD9A 1SROA 3CF5A 5G5HA 1E5WA 2BWES 4GGQA 2NBVB 4A93G 1BMLC 5JHAA 1LQBA 2VZAA 4KZ0A 1FRRA 5KYLA 2M56B 1H9SA 2F0LA 2GN5A 3VFKA 2XN9C 3RNAC 4K8IA 4RCOA 2I1JA 4KHPL 3J81L 3ZTDA 1IUEA 3SR6A 3CRKC 2FUG1 1SBBB 2CQAA 1LYLA 1X3EA 1L4ZB 3P1HA 1YZ6A 1QWYA 4OVUA 4JI4Q 2MJ3A 4JI1L 4GB9A 4R4TA 5BO4B 1H9KA 1GHKA 2Y0SE 3STBD 1WYDA 4AQYL 5BMHA 1KNAA 2FUHB 4LCDE 1SF0A 1SYEA 5LMUQ 3Q8EA 1AE2A 1F9QA 2N88A 1BUIC 2NB0A 3Q6SA 1MHHE 2ZJDA 3NZSA 4NJ6A 5HFYA 5EKKA 2JE6I 3MFYA 2BF8B 1I4PA 3AXCA 3CMMB 3VQIA 5JHBA 1N33L 4NW2A 1ZP0B 3M3YH 4GZYC 5EBDA 1G8ZD 1MBYA 4A76A 2EYLA 1PGXA 2XWJB 2GBNA 1SNOA 5CV4A 1DYQA 4RMAA 2C35B 5IYCG 1AW7A 4DNIA 5EJWA 1A2UA 2NTTA 4G7HC 1S1QB 3ERQA 3DBLB 3ZNZB 1VQOA 4IFDG 1CM9A 2VW9A 2WDRB 4DHZB 1UE5A 4QB4A 4C4VB 1TWAB 3MXGA 5IT9E 5TR5A 2UWQA 3S14B 4A3DB 1QB5D 3T1YL 2NVQH 3DWMA 3LXFA 4J8QA 3OTOQ 2R93B 2B63B 2MP1A 1CMXB 2LUEA 4QGUA 3E0EA 2INPE 4RGTA 4QIWE 4IC7B 5FO7B 1SNCA 5LMNQ 2Z8LA 1VQKA 2F0IA 1BUVT 2K5VA 5M5YH 2C7HA 3FKIG 2JA7B 1SNPA 1IBML 3VYUA 4CBVA 3A0JA 3DWAA 5M5XB 2R92H 1J7CA 2TSSA 3CKIB 1VQMA 4C4VA 1CA5A 1ESFA 2PEAA 1R4QB 1H9RA 1D6EC 2A68D 3SEBA 1ZE3D 1I3QH 1KLUD 1Y1VG 1K8RB 1WR1A 2VQFQ 4KSKC 4LDTB 4M02A 5M5WH 4BBRH 3N6RA 1SYBA 4LJPB 2IX0A 1K0RA 4JK1C 3GTKH 3KBXA 3NVVA 2HDMA 4HJ8A 1S72A 2JA6H 2BKRB 4I6PA 1NE3A 1TWHB 3L9AX 2C9WB 5BMGA 2B8GA 4DAYB 4PT5A 2NZ1D 3OIQA 2LHEA 1CUKA 3GTOB 2N9PC 5LLIA 1CKMA 1X55A 4FADA 2FMCA 4DAPA 4HJ5A 2L05A 2PVGC 3JYUA 3TP5A 4M8MA 2GLSA 2KVMA 4IW0A 4RA8A 4NXNL 2CR5A 3L3OC 2GBMA 2UUCQ 4HPLB 4N9PA 4HSPA 2V4DA 4KD3A 4DAYA 3D4WA 4IQZA 1WMHB 2DZKA 2M1MA 2K6DB 4N8FA 1GD7A 2BTEA 2AEHA 4A3JG 2RGFA 3TP8A 3KJOA 2WDTB 5HG2A 4C2MH 1PRTC 3S1MH 4KY7A 1GC7A 4P1CC 2WKDA 3GTQH 2UXCL 2UU7A 1VQHA 3DBLI 2FCQA 3FC4A 1VQIA 3A4SC 3U4VA 1HA6A 3RZWC 3OYYA 4DUYQ 1WMHA 1ET6A 1LUZA 3KW5B 2DAJA 3PQIA 4MGIE 1CZGA 4MEMA 2C7NB 2JT4B 3DEPA 1R4PB 4CJ2C 4JYAL 2LVQA 3R2IA 5EPLA 1WGGA 1EZ8A 1CQVA 1PMRA 2EJFC 3PTFC 1HPCA 1XPOA 1C3TA 2ON8A 2D0PA 4MGYE 3ZXVA 1S5CD 4F87A 4G3XB 5KIXA 5C3EG 1M8AA 3PHXB 4H2AA 1FYCA 3T13A 4LF5L 4DR6L 1QOAA 4NNJB 1W6KA 2ZM6L 4LF8L 4W9IA 2JSOA 1G6ZA 4DV5L 3S2HH 1MIUA 2JA9A 3H1UA 4ZRIA 4KDLB 3ZNID 3RCZA 1Q8KA 3AE7B 3GO5A 2NBFA 5IWAL 3K7AH 4Q0FA 4KKSA 1XLPA 2YYZA 2BBCA 3J9CA 2VH1A 2J0JA 5C5LA 1WCMB 1NI3A 1UUPA 5CV9A 2Y0SG 1E9MA 2QEXA 2KMAA 2DYMA 1TR5A 4R4CA 2PJHA 4LF4L 4XC2A 5FR3A 2D3AA 1EU3A 4ANXA 1YHBA 2N78A 2EMSA 3R7QA 4A3BB 4MGKE 4XYOA 3AEEB 2J52A 2EOTA 2W82A 2ZCCA 3H94A 4EKUA 3OMCA 4JI4L 2FCNA 4YIJA 1FM0D 1F2RC 4WAFA 2C5CA 3HP3A 2FFKB 1T0QC 1V5TA 2D10A 2LI5A 2E2HB 1YN4A 2KT7A 1J8CA 2PW5A 4WJ3M 1DOYA 1DOXA 4K0KL 3AYHB 2KHSA 5FLXc 3GDEA 5LMUL 3H3VI 2KMMA 5NUCA 2BDNA 2EYOA 3R3MA 4MACA 4WIPA 3J80L 5IGCA 3I4NH 4IOCA 1N5WA 3QA8A 1VCBA 2UXBQ 2YTXA 1EEID 4MHEA 4UDUC 4RKLA 3L0WB 2JYOA 4HCEA 3RNCC 4MTNA 3B0AA 3K9OB 2PMZB 4ZYSA 3MHZA 1E24A 2DGYA 4EQPA 3G6EA 5HURA 2O5JC 4HJ9A 5E6OA 2M0AA 3HOUB 4UY8C 3PO0A 4K7SA 4HROA 2YU9H 1CSPA 2AMCB 2Q2UA 1JRUA 5LXIB 4HCSA 3PF4A 3IL8A 2J4XA 1RJTA 4HJAA 2L52A 3ZTCA 3H7SA 1EO6A 4DV2Q 1DD2A 1Q1EA 2A6ED 4BFRA 4EVOA 4OVVA 1UEBA 3AEFB 3M3JA 3HKZE 1HRJA 3WAPA 3GD7A 4KDIC 3GQBA 1LTGD 1N32Q 3C0RB 2R92G 3U7DA 3I72A 4PS7A 1QCBD 1JJCB 3H0GH 3C46A 2RDBC 2ONQA 3DBSA 1B9RA 3AEBB 3A9JB 2E74C 3TL5A 2N1VA 1C1YB 3BY4B 3HM3A 1BXTA 1LTBD 3I70A 4BBRG 3AFQA 3QHTA 4GDLB 4DWFA 1KL9A 3J81j 3I73A 2LGIA 2OCEA 2AQ2B 2JA6G 5EKLA 2KWCA 2VQFL 3LB8C 1BCPB 1FNWA 1KLVA 3KF6B 3VH3B 2K5NA 3AE1B 3K5OA 4BBSH 3QQ8B 4J3OD 1B1ZA 2ATWA 2K1FA 3A9JA 4YTPB 4YTNB 2IBIB 2EYFA 2MO0A 4K5VA 5JJLA 4N9F4 1UE7A 3EQLC 4GDLA 4ZHOA 1HFNA 1XJVA 5EE3A 3ZVVA 1YBYA 2GVAA 1SSOA 3W9CB 4N59A 2R3ZA 4R4OA 2V3SA 4JG2A 3NTIA 2M4NA 2IGDA 1X65A 1BT0A 4LTUA 4FN2A 2DJFC 1EZ6A 3KF6A 3VA5A 3MC8A 4IDIA 5BYSA 1QUQB 1LT3D 1SAPA 3RZOB 5ELNA 5IT9c 2YEPB 4IWQA 5FOBB 2UUCL 3RNFC 1HTOA 2YLMA 4RM8A 2JA5B 1N34L 3CQZB 3TSSA 1XNRL 4EUTA 5BMIA 2BS2B 4BAXA 4A3GB 3NHEB 3DHHC 4MH8A 1HTPA 4ICUA 4HLEA 5GMVA 5AUIA 1EWCA 1IBKQ 1YJJA 3PV1A 3TP6A 4DV7Q 3CC2A 3VR9B 2AUJD 2HD5B 4DR5Q 1QUQA 3RZDB 1G291 1VQ8A 1Y8OB 3TUOA 4AQ7A 3PHWB 1F9PA 2HIVA 2WFWA 3DWQA 1FFUA 1OEYA 1PHJA 1A3UA 4DUYL 1FXTB 4DXAB 4W9EA 1MHXA 2MO1A 1QVGA 1N5XA 3OOCA 5HY6A 2HCCA 3KFUA 2V3PA 2ZZPB 1QILA 2J0TD 4A3EB 2WX1A 1WIAA 1TS5A 1GUTA 2IGHA 2KVRA 3S15H 4IPDA 3HS0C 5JEAH 3HOZH 1XNQL 1XTCD 1Y14B 3OW2A 1WGRA 1QQRA 2AQ3B 2AUKA 2EY6A 1D8LA 3TREA 1AWDA 2PLPA 4US8A 4N9TA 2A19A 4HIOA 3S17B 5C0XI 2AWOA 2WIIB 3H7PA 1SIJA 2C5LC 4X66Q 3V6EB 3M62B 4H02A 4A3MB 3ONSA 3ULLA 1NNXA 3JAMi 1PH9A 3IFWB 3D6WA 3I63C 1I4RA 1C9OA 1UEAB 2ICEC 1S4ZA 2EYPA 4B3RL 4GIVA 3E3XA 2DBYA 1YMHE 2IZVB 4TV3A 2DX5B 2BYTA 2JRIB 4B9WA 3S1QB 2XNAC 1TWCH 1WI0A 4GNXA 1HQMC 4NP5A 2MJDA 1MI0A 1JOKA 2DNEA 1UAPA 3B6YA 4K14A 3CCLA 1J7AA 4WWPA 2ZPNA 3PIOA 4IG7B 3KUPA 2JZ3B 3HOWB 4LFBL 3K57A 4PZ7A 1NUCA 3TQYA 2K8BA 2UYZB 2OF1A 4IM3A 1V43A 1QKZA 1WXAA 5KGUA 3CW2C 4NXML 3I4NG 1E7VA 3UI3A 3DXJC 1GHJA 2N1WA 2YEPF 5I9OA 2G45B 1ILQA 1GXDC 5LNK1 5KNDA 5HI1A 3PIPA 2YTVA 1RODA 4DGZA 3UQAA 1SNDA 1J7BA 2KQ7A 3U9SA 2KUMA 1PTOC 2F0OA 3P2BA 4YSXB 2D0OA 2M17A 2G1EA 4FO2A 3S1NB 1V81A 2NVTH 2DWQA 2H89B 3CP0A 1I50B 1TY2A 3HKZG 4NPNA 4C7ZA 1V49A 4BKGA 1SE2A 1VQNA 2EY1A 4A93B 3VHTC 1IGCA 5EQ0A 3T3OA 3R7RA 3U30A 4BOZB 2NZHA 2NN6H 3QOJA 3PSEB 3TBIB 1I4XA 2KCMA 2FMMA 2R2QA 3V2TA 2PE9A 3B1LX 2NVYH 1SMYC 2Q5WD 1RTNA 3SXHA 2WXHA 3MXNA 5JXVA 5BYRA 3RI7C 1QF6A 4OZAA 1UBIA 4JLCA 3M63B 3I91A 2FAZA 3WA0A 4YSZB 3H0GG 2DY7A 3Q3JA 3OSOA 2HIXA 3GS2A 4OZBA 1S5BD 2EYHA 2OXPA 2KCCA 3DUZA 4LK1C 3S1RB 4LF9Q 1FO4A 4DXFA 1WTQA 3DBRB 2VS1A 1EUVB 1STAA 1YVCA 2L00B 4PYUA 1HQRD 2GB1A 2G9DA 2HDLA 4TQ1A 5D94A 3D0FA 2K04A 1AE3A 3A33B 4HTHA 4DAMA 2IY5B 2J7QB 3VR5A 2IX1A 1L2NA 4RGMA 1B2TA 4DV0Q 3DQVA 5DLQE 1HR0L 5EGTA 5CORA 4JOIC 4G57A 4EZJA 3MFGA 4QJFA 1XYIA 2G3QB 2WHIA 5DCNA 2F0PA 2WXPA 4BBSG 4IALA 1JWMD 1PGAA 1XLOA 2PKOA 4AJYB 3QOLA 3Q24A 2ZPYA 1YJ1A 2KXJA 4FP5D 3PO2H 3UINB 2K7VA 1VF7A 3K0YA 2PYKA 3SHLA 3AQQA 3CXCA 4IO9A 1L5PA 1WI5A 1P3QU 3MEFA 1A3TA 5DAUA 2J53A 4JI2Q 2LJIA 2Y5BB 2RVLA 1NVID 1WX8A 3KYCD 5KHQA 1IKLA 2J0KA 4FXKC 3T9LA 2EXDA 3BS1A 2QKIC 3NG0A 3TCAA 1S5ED 4KKIA 2KHIA 4HEA1 4DFAA 2HJ8A 1TTNA 3GE3C 1SE9A 1KNEA 1JWBD 4P2CB 3H8HA 3I3TB 2BB6A 3I9V1 5LMNW 3KLWA 1WTWA 3U50C 2UXDQ 1AH9A 5IN7A 3HVDA 1MKHA 4DN4M 1YNNC 4F88A 3FKIB 5M3FH 4NAMA 4BBNF 1WX7A 2ASBA 3AMUA 3U7ZA 2QEJC 1B44D 3P4RB 4IKGA 1A63A 5CGKA 2F0UA 4X62L 2CQOA 1UE1A 2KDBA 2F0SA 1QZEA 2SDFA 4R9WA 1Y1VB 2FCSA 4E3CA 4MSQB 1F9SA 3TJPA 1XLNA 1FGUA 1P16A 1RD9D 4L5RC 5MPOA 1B4OA 3HOXH 2CHWA 1RHPA 4ZRZA 3PZDA 4L1BA 4AOFA 1HA5A 4E74A 2CCZA 1HE8A 2MBBB 3EGRA 4IWPA 4A3PA 2ZTEA 3DHQA 5JEAG 2ZXOA 2G5DA 3HOZG 1DOLA 5LHY1 1KFYB 2VY3A 3KF8B 1OTRB 5EAYA 1HCZA 1P9DU 2K3UA 3DBRI 1PXUA 5IE8A 2EYMA 4XQJA 4POGA 3E9HA 4HDQA 4FHJA 1A8VA 2V1YA 4IPCA 2MCNB 4XQQA 1AP0A 2REXA 1UWMA 4JI1Q 1VQ4A 3E56A 1IL8A 5EKIA 2HDEA 1I4QA 4AQYQ 2M9VA 5JJZA 2L7RA 2LKVA 2OWOA 1K9MC 3NRZA 2LS01 3Q3NC 4GLXA 4DXGA 1DCZA 1U5KA 4X66L 4TUUA 3RMKC 3KF8A 3O65B 4A3JB 3CAMA 2PZTA 3SGIA 2GI9A 1N33Q 1CKOA 5C4HA 4GDKB 4W9HA 1LABA 3BDOA 3VA7A 1GKHA 4ZK9B 5IYDH 3T1HL 3DWGC 5FLMH 3GB1A 3WOFA 3PLVA 2A69D 3HKSA 1L1OB 5E3FA 4XT1B 2E2IB 4IFDI 3RZFA 3NHHA 3VDZA 3GP7A 2KC1A 2IWHA 4B9XA 4OELB 1A6XA 1YN3A 4NQKE 3ND8A 4YCUA 1EIYB 1TWGH 4K81A 5IA7A 3GTGH 2EIFA 4GDKA 4YWGG 4HSVA 1E2VA 4XXEA 4DR3L 2LY7A 4W9CA 2N3SA 4H44C 2N49A 5D7GA 1JALA 3T1YQ 2RSOA 4EOYA 4JGHB 3RLNA 3UF8A 1L1OA 1HNXL 3M7GA 5DPWA 4YTMB 4DV1L 5C3EB 1UELA 5A2QL 2MBQA 1E10A 1I94Q 1XPRA 4C1NI 1V9PA 1M90C 1VQ7A 5IKCM 4IPHA 5IP7H 3NQIA 2NCNA 2RSUA 1IL2A 4EFOA 2F0KA 4BY1H 1E7PB 2NN6G 1JOOA 1IXRA 3VDYA 1GPXA 2AQ1B 2ALYB 4MDKE 3VR3A 2Y0SB 1JW9D 1LT5D 3PUZA 1YD8U 3CC7A 1STNA 3KDFB 1HNWL 1PTOH 2F52A 4EX5A 1MSHA 1PYSB 2DAFA 5BN5A 3IG3A 3MJ5A 3RULA 2CJNA 4WFN3 1EFWA 3HUIA 1TKWB 1VDVA 2WACA 2L83A 2FCMA 2VH2A 4CKCA 3HM6X 4DK5A 1TXYA 4BA1I 2K5QA 3FHWA 4I7ZC 3NS1A 5JPMC 4A55A 3BJUA 1KRHA 4XT3B 1K52A 5EE9A 1IBLL 2QA4A 2CWAA 3KDFA 1J6QA 3AECB 3PUVA 3ECIA 3QARA 1PZID 4QF4A 4PS8A 3IFTA 4CQNA 5I4DA 1X3GA 1WTRA 3M3YB 1L7YA 4MN3A 4NXNQ 1EYAA 2C60A 1X6OA 4FVMA 2RPVA 1K50A 2HD3A 2J0MA 1J8IA 3PO2G 3A54A 4K7UA 1IHZA 5ELEA 4LJZC 2UUAL 2WU5B 2KJ6A 1SMXA 1Z9FA 2MEKA 1BBUA 1CQFA 2LSSA 4C3JH 2CH4W 2V4IB 1F9RA 1XXGA 4QIWB 3PLUA 4LNKA 3RUZA 1JWUD 2KEDA 3MWYW 3GTPB 4Y52H 1E8ZA 4Y7NH 2NVQB 3DPDA 4GN3B 3KBGA 2KN5A 4CKEA 1V8QA 2W54A 3DCGA 1SEBD 1OTCA 1ZXTA 3SVMA 2RHQB 4JYAQ 1D7QA 1U4PA 5M3FG 5M5YB 2PW9A 3P4PB 4GMVA 2L8JA 4FBJB 2WXNA 1YQBA 2MBEA 2MHVA 2R92B 1C78A 3M4YA 4QY7A 1OQRA 2DJGC 3L4PA 4L5SA 2D3GA 4IUQA 5LXHA 1RF2D 3J7YW 1WTXA 4LF5Q 3D32A 1VQLA 2K14A 3B2FA 1D4BA 5D65A 4LF8Q 1STYA 1I3QB 1SYDA 3CMEA 3HOVB 4DV5Q 2LUMA 3PVLA 3MVVA 5M5WB 4BBRB 1SE8A 2K01A 2AL3A 3EJIA 2VUMH 4S3SA 3Q22A 3GTKB 4GU2A 2K50A 2JA6B 3HOXG 2QDFA 4MGZE 5IWAQ 4P6VF 3S2DH 1Y1WH 1CKNB 2RA4A 4W9LA 2DZMA 2N9LA 4ANWA 2N9KA 3SK8A 5E4WC 4A3KH 3N32A 1ILPA 2D11A 3KOJA 2BCOA 3Q14C 4LF4Q 1E1TA 4BZAA 1HZ5A 2MLBA 4DBGA 1GG3A 2PZUA 1JB7A 2F4IA 3TEXA 5TSSA 3K8AA 3PZ8A 2DYOA 4P73A 1UGJA 2BGFA 3PCOB 2KFJA 2INNE 5CHVC 2B2YC 3GTJH 1CKNA 1P8LA 4WORA 5C3WA 2UU9L 1FMAD 1XQQA 5GADC 2W3SA 2IHEA 4YHHQ 1NCVA 2KQSA 4K0KQ 3ML9A 1V80A 1KHIA 3QWZB 4GLAC 1KAAA 3W1GA 4JPSA 2HT1A 5ELCA 4C2MB 2K8CA 2WGSA 2ZNVB 5IYDG 3S1MB 1IYVA 3CWIA 3Q0AA 5FLMG 2IGGA 1TZOA 3GTQB 5AUKA 4OVZA 5E6PA 1RCVD 3OMGA 1EUJA 2RDFA 1ISNA 1YEZA 2MBOA 4II3B 3FPPA 2XRQD 4S0RA 2MUYA 2IO3B 4IURA 3AMZA 4TKOB 1S40A 3E9SA 1YNTE 1YHQA 1LT4D 5IGGA 4GN1A 1EYCA 4XDDA 2KQ4X 4MH0E 5JAVA 3G6JB 4BXXH 2JWUA 2OT2A 5IGEA 2X6GA 4B3MQ 4DV3Q 3VVWB 1VQBA 1BBWA 5KRUA 3AE8B 3B2GA 1I6HH 2MGSA 3JAME 3S2HB 1J0GA 3P1MA 1TZ1A 4HKZE 4A8XC 5EDSA 5IP7G 2CFMA 3KQ4A 5J18A 2XEWA 2QMTA 3K81C 2MQHA 1BF4A 1I94L 2K5WA 1TGZB 4KHVA 4BY1G 4DPGA 1AYFA 1WXVA 4WJOA 3K7AB 3AE3B 1PRTD 1VQPA 2BVCA 4UP7A 1ZW7A 2F0HA 4K6DA 2MPMA 3ENEA 1EWHA 3N20C 1DOIA 3JSVA 1Q82C 3AEVA 5E1FA 1C77A 5AFWA 5H8YE 1KQSA 2D5DA 2KYWA 4RFBA 2ZXPA 2LGSA 3KUZA 4MM3B 1QOGA 3L13A 3OWEB 4NPSA 2OOBB 1WXMA 1R7SA 1HZCA 2AX5A 3VUYA 3S9WA 2N9XA 1EY9A 3EFUA 4P16A 3A56A 1E0BA 4JW0A 1N36L 3NSWA 2I38A 4YY3L 4BVUC 1UF0A 4IPGA 1GUAB 4GOCA 1W3SA 5D3IB 1P98A 3DHGC 1HZBA 4MM3A 2FJ2A 2VNUD 1VJKA 4LUVA 2KZRA 2Q8RE 1WF9A 3NUCA 1Y8PB 2Q8IB 3QWNA 1WJ4A 2KCNA 3T3NA 3RR5A 5E6NA 5J3BA 1OQQA 4ME5A 1W6JA 1N61A 1YQ4B 3NY5A 2B8FA 3M9BA 3HRZC 2J42A 2RDGA 3NJTA 2QCPX 2LXCA 3PUXA 4C3JG 1N34Q 1WR6E 4RG1A 1XNRQ 2BB5A 3L0OA 1CSQA 1BO0A 4R4QA 5ISRA 4GKKL 3W1SC 4LUOA 2CS4A 2DYBA 2MP2B 1K51A 2D9UA 1RL2A 3HKZB 4B95A 1GB1A 2H5XA 1C4CA 2YU9B 1QZHA 1WZ3A 1G51A 3IAM1 2NYZD 4M0WB 4ME3A 3I4OA 1F2ZA 2EVBA 4A75A 4J6HA 4X65L 1YITA 2KTRB 1GVPA 5JJKA 4ARIA 1YIJA 2EQSA 4WJWA 1MFWA 2E3TA 1T0RC 2K9XA 2MHJA 2ID0A 2KHJA 1VZ7A 2JUOA 2MP2A 1Q86C 5FLXL 1UGMA 2GBRA 3H0GB 4DDID 3E0JA 4HMIA 1UNSA 4M0WA 3URYA 3J81i 3HRDD 3AB5A 1SDFA 1KLGD 3NS8A 3RNGC 4U68A 4B3SL 3C1FA 1BVSA 1VQDA 2AHOB 1XNQQ 2KTRA 4HCPB 4PS3A 2PW7A 1EQRA 2VUMG 1I4GA 4X64Q 1RIPA 3MC0B 2LFIA 4LF7Q 3CSFA 3FRPB 1NBFC 3J7A5 2HHHL 2MA9B 3Q8CA 2K52A 4FXGC 2I5HA 2A68C 4BWGB 1Y1WG 3APCA 1HUNA 1A2TA 4USAA 5H92C 3IFDA 1Q7YC 4BBSB 4A3KG 2L0CA 3ALBA 3ZDMC 1L2FA 2XRSD 1OGWA 3V61A 4BKSD 4B3RQ 3F8TA 2LHDA 3LDZE 1XPUA 5CHFA 4PG3A 3D8GA 3VAWA 3Q8DA 3NTHA 2KCTA 3EFXD 3PO3H 2OJWA 1PZJD 4FF3A 5C44H 1NEKB 2FBWB 2INCC 2A74C 2ZXRA 1RRBA 1GUNA 4JV5L 3VTVA 2ENBA 2O5IC 2BYFA 4CHTB 2D62A 2E8GA 1CZWA 1ENAA 3CCMA 4LFBQ 1PGBA 2DHZA 2LEKA 2SAKA 2CKHB 4NXMQ 1EWYC 4W9KA 4N58A 1KTKA 4YHHL 5ELFA 1BCPC 4HXDA 1T5EA 4TRDA 3ITPA 2FXQA 3MTSA 2BWFA 1XCQL 2F0EA 3Q3FA 1VQAA 2XBBC 1FNVA 5CBAE 4H7BA 4KKUA 2YVCA 1EM7A 3O13A 1O7ZA 3IRBA 1WGYA 3Q8BA 4WWOA 3AEDB 4EZLA 1NBWA 2F0QA 4UP9A 1O7LA 1PRTB 4HEDA 2ZCBA 2ZEQA 4BXXG 1MG4A 3FKYA 4S17A 2CHZA 2LMCB 4DV6Q 5L37A 4F7ZA 3AB9A 2RSNA 3WDNA 3S15B 3EBEA 3HOZB 2FIDA 4A3LH 3NWSA 3BVGA 2K39A 2JXXA 3AFPA 5IT9L 1SYFA 4DK3C 4DV3L 4B3ML 1I5FA 4RWSC 1MSGA 1T3QA 2KEEA 4DR7Q 2Z0EB 3BDCA 3V05A 1V2YA 4FXCA 1SLJA 1WTPA 1LXDA 1YHAA 1ZYRD 1MVKA 3ZLZA 1EU4A 5L95C 3J7AV 1IW7C 3T4AC 1T6BX 2LMCA 1PA6A 4PMCA 2XK5B 4AUQC 1CFMA 3TEYA 2RKSA 3I56A 1QE6A 1RFKA 4I6NB 4W9FA 4IUMB 1EOVA 4XIGS 1NYQA 1KXLA 1VDZA 3SR1A 4HPMB 1PYBA 3SHQA 4TQ0A 1HR0Q 1E90A 2MSED 1I35A 1TWCB 5J1ZA 3DM3A 1SXTA 4OO1H 3MXPA 2F0VA 3TRZA 2IY1B 4L2YA 1ICWA 1U4RA 3NWTA 3UDFA 1LFDA 3W2DA 2L32A 1P0RA 1B53A 4DR2Q 1K8GA 1WX9A 2KDIA 2XK5A 1JWSD 2WQYB 1KABA 1EWIA 3RPFC 3N52A 2GA4B 4C3HH 1WRDB 1FCLA 3AE4B 2PO4A 3BDLA 3J7AF 4ZHPA 1MHWC 2PI2A 1HEZE 3DBHB 4LNIA 5BYQA 2CJOA 1CZPA 4B3TL 2XVSA 2KK8A 2JQRB 2CWPA 4FYDA 4LUZA 4XYQA 1ZKHA 4IN3A 4JI7Q 3F2UA 2HTME 3VRBB 2NVTB 3LGJA 3JAMc 3UDXA 1FRDA 2WXMA 2ACZB 4K5XA 1GUWA 1WSPA 4HJGE 4B6WA 4RCNA 1NJIC 4APVA 2Z1CA 1WCMH 1V86A 4P74A 1HUMA 2F0NA 5FR6A 3OJ3A 4X62Q 4KIKB 3RLFA 3NPPA 1R4MB 3L54A 2NVYB 1PRTF 5IGDA 1F52A 1VQ9A 3RUIB 1E2WA 1DGJA 2JU6X 2KX3A 1V1QA 4JI3Q 3FILB 4M8AA 1BOSA 5IGFA 1PH1A 2KDEB 1V6EA 3VTUA 2IJ0A 2O2LD 3F2CA 3L2PA 4D2KA 3H7PB 5GROA 3S2AA 2A6EC 1C7YA 2G4SA 3AEAB 3ZUNA 3A1QB 1CHQD 4KIKA 1AZQA 1NENB 4LWCA 4KMUC 1IKMA 3J7ZC 4LLGM 3ICEA 1PTOD 4RAUC 3A8JE 5E4XA 5GAEC 2KENA 1DJRD 3FILA 4C3IH 1SFOH 3R93A 2A6HC 3OPOA 1D2BA 5G55A 4X64L 1VQFA 2PNRC 4GKJL 1UD7A 3N1XC 3EA6A 4LF7L 4GNXB 3A5ZB 4HCNB 1WM2A 3PO2B 1Z7TA 5E7NA 1A62A 4BKSA 4JBKA 1J19A 1M4VA 2MFIA 4GS3A 1RKNA 4JVZA 3GTMH 1GM5A 4G0NB 3TMEA 3A1QA 4F8CB 4LFAQ 4IUNA 1P1AA 2PMVA 2Z6KC 3C3LA 1DXMA 3J80i 3PO3G 4QQBX 3T1HQ 5C44G 4R1JA 4OX9Q 1ZDXA 3C2PA 3QC8B 4ZUJA 1JR0D 1FPYA 1GC6A 4PYZA 2VZKD 1K0SA 4JX1C 3DBHI 5EBCA 2B2WC 4BA2I 2AL6A 4AIMA 2QDLA 3DLLA 1WYGA 3RNEC 5A35A 3MEHA 2KBNA 2PIAA 1DM0B 4ITKA 4L23A 3VUXA 2B3GA 1PDQA 2B76B 4FLHA 1G2TA 3CC4A 5M3FB 2WDQB 3KYDD 2PI2E 2KLGA 4DR3Q 1X3QA 2QDBA 2BW2A 3RN9C 1GJXA 2JZPA 1B70B 1HNXQ 2Z0SA 3A8IE 4DV1Q 1RAXA 3BWUD 2MNAA 1PH5A 3HOYH 2AYOB 5GAHC 4ZLTF 1BNZA 3A74A 2D3BA 2NN6I 3AH7A 3SDLC 4G7OC 3BZKA 2PTLA 1R4MI 2LRWA 3MXNB 1XTDA 3M7NA 4KSLC 4KZCA 1GNUA 3GE8C 3VUWA 3HOXB 2HJ1A 2B2UA 3KJPA 1JQ4A 1PZKD 1SSNA 4G7ZC 2R7ZH 1OFFA 1HJPA 2KA7A 3PUWA 4IJHA 3VXWA 1IYFA 2IHFA 4A3LG 3SK4A 1HNWQ 1KDAA 1XMOL 3UGBB 4DV6L 1MG8A 3KLSX 3ER0A 5CX3A 1G2SA 3EC8A 1NTGA 1I6VC 1X54A 3NXWA 5CV5A 2KKCA 2IX3A 4FA6A 2M00A 4DK0A 1A0IA 3HGBA 4TQUS 1YNND 4UPAA 3M4OH 4DR7L 2BT6A 4A20A 3UQBA 5C4ZA 1DZ1A 1XX8A 2KO3A 4RGNA 2PVOD 4O2DA 4IWOA 3F2DA 1IBLQ 2ZTCA 1F2YA 1YNJC 3CQZH 4EGVA 1B3QA 1EEFD 1Q5WB 2B2TA 2QGQA 3T53B 2LGYA 4DR4L 3Q69A 4OO1G 1BKBA 4I65A 3FVQA 4FNFA 1EFID 2J7ZA 4X6AH 5GXGB 2UUAQ 1RLFA 2MBHA 1P7EA 2NBWB 2E6XA 1EQTA 1STGA 1J9OA 1WXQA 4C3HG 2CKZB 2AKWB 2LFNA 4KD4A 3ETRA 1E7ZA 2KFKB 2D2CC 1TWGB 4DR2L 4MJSB 2VB2X 3GTGB 2CHXA 1WE6A 3H15A 1PH3A 1Y8NB 4DHJD 3U4ZA 2EYJA 4L63B 4GXBA 1F1HA 3QR8A 2IO2B 2SNSA 4KVGB 4HIDA 3LWUA 1L6VA 4UP8A 2XTIA 5IODA 1F9JA 1TKEA 2AWNA 1Z2MA 1LTAD 4FF1A 2K6AA 3TEZA 2FIFA 2O6VD 4NB3A 5K5PA 3CIRB 2KFKA 1QNUA 2JYTA 4MJSA 1M1KC 4JI7L 2CW0C 4OWTB 4BY1B 3NBIA 3FMCA 1WCMG 1IPGA 2XWBB 2IO1B 5BR8L 2DNFA 5EE1A 4A3CH 2PCFB 5I6YA 4WRDA 2GBJA 4K7WA 3DVNV 1HTQA 4NAWB 5IIFA 2KWDA 5KNCA 4HMJA 1PTOB 4JBMA 1VD2A 4XX5A 1NSNS 1FXAA 5CV7A 1CJEA 4H0LC 1K83H 1JRPA 3S1QH 2F0FA 1KD1C 5DEHA 4DKAC 2F0JA 4JI3L 4BY7H 2JX5A 1EY8A 2HUGA 5JVH3 2GVBA 2GBKA 3BINA 3ONAB 3ZJTA 4JI5L 3ERSX 4NAWA 4ABNA 1Y8RC 2BS4B 1KDCA 5ELDA 2G9HD 4KKTA 1VZ8A 4C3IG 2BE5C 4CDFC 4DUZQ 2WLBA 4WH4A 2VZKB 3X0WA 2WXRA 1JMLA 3AE2B 1RM6C 1BR9A 1PQSA 2DNCA 4KJNA 4R8IA 3N3KB 1MJCA 1SNMA 2UU9Q 3OHXC 3KLSA 1PH6A 1FJGQ 1HZAA 3W1YA 4A9AA 5C0XJ 4QUFA 3CCRA 2K32A 4H13C 2E2DC 2KANA 4DQOC 2C9OA 1ZPSA 3DEOA 4ODGA 4CDDC 1E8XA 4IOIE 2OQKA 3FP9A 3MHSD 1JQYD 3TP7A 3TDQA 4LFAL 2JYEA 3EIVA 1LTLA 2IL8A 3IVFA 4HIMA 4Y7NB 2JXMB 2NBUA 3J81E 1K73C 2NVXH 4OX9L 1PFBA 5AZGA 1WTHA 4L6TB 4EQOA 3JVZX 5CR3A 3WAMA 1EF5A 1D5ZC 1PUTA 1B9MA 3EFCA 2X69A 2N7EA 3BK2A 2JY6A 4AWJA 1MI2A 3ZIMA 3ZRCA 3DHIC 4QL5A 4JBJA 2QSDA 1TKGA 2LXJA 4JOIA 3PPAA 1V1PB 1XD3B 3HOYG 3U8ZA 1KRSA 1OEYJ 3MP9A 4V0BA 1O80A 2F0WA 2F0TA 3AULA 1FR3A 4FJZA 5FO9B 1R9TB 4R8NA 3UDGA 2KOXA 3P4QB 2VUMB 1WRIA 2CVRA 4O42A 3PZ7A 1YNXA 4JL9A
chains in the Genus database with same CATH topology
2WXKA 4FXDA 2ZT9C 1ZDVA 1OXTA 3KLRA 3S2DB 4IOIE 5HHDG 1PTOF 1Y1WB 1B3AA 1L4DB 1V1PA 2W3RA 4A3KB 4KHZA 1D1KA 1LO5D 3TN2A 3K58A 1ACCA 2BOSA 2V3NA 1BDOA 3GTJB 5T8IA 1ZKOA 1WGKA 1CT1D 4IUVA 4OGQC 3N9YC 1RYJA 1LV9A 3D31A 2FHTA 1C8CA 2QILA 3V3XA 1SYCA 4KGSA 1HZ6A 4HR7B 5T1IA 1C48A 4HKQA 1QG7A 1L6UA 5DM73 2EZVA 4U673 4TSSA 2X38A 1N63A 2JSVX 3P4SB 3AU7A 2EJGC 5T1GA 1I6HB 1O78A 3H6MA 1L0VB 4ZAIA 5E6JA 1PLFA 4ZRPA 1OXSC 1V97A 1VR9A 2EXZA 4FF2A 4XQNA 1FD6A 1RTOA 1X32A 2IPKD 5BN3A 1E6EB 5K36H 1GUSA 4XWTA 3IAYA 2RQXA 3PIO3 1YQ3B 1FNUA 3T56B 1A3VA 5EE0A 4EE2A 1VMPA 1QOBA 1XWEA 3BZDB 2OEOA 3I3CA 3PIP3 1WVLA 2F0DA 2WV6D 1TT2A 1I7HA 2RBMA 2VB3X 2L5TA 2I07B 2IDYA 4EQNA 4JE3B 2DN8A 4X3KA 2N55A 4JWUC 2F3VA 3VYTA 2M19A 2WKCA 1Y69U 4KI0A 1TVXA 2EE1A 3Q8AA 1KF6B 4US9A 3KWVA 4CJ0B 2B2VA 3BVZA 3ND9A 4ZUIA 1OXXK 1HXYD 4C7YA 2KDMA 5KEEA 1LTID 5CV6A 5DNFA 1U4MA 4UAIA 2FINB 5D14A 1YJIA 2QJLA 3SK5A 4ULLA 3OW7A 3X3MA 4IFDJ 5D3DA 3IXSA 4KY5A 1PFMA 3K5MA 1OXUA 5KNBA 1FEHA 2Z4HA 4K2KA 3ZQ4A 1TS2A 1U4LA 4E6IA 1S5DD 3H3VC 2I2YA 4ZKCB 3J80E 2F03A 3ZGZA 1STEA 2QIEB 1G91A 1EOTA 1TQOA 5FO8B 3UI2A 1Q12A 1V8CA 4J1MA 1SNQA 3EROA 2PPBC 1MD2D 2WINB 4OIJA 1L0YB 1XO3A 1PFNA 3PO3B 1D1IA 5J39A 5C44B 1X3PA 2EJMA 1ZXIA 3KK7A 4OW0A 4DAVA 2WXGA 3H91A 1Z6HA 4IUUA 3HEJA 1HTLD 4QCLA 2WXOA 4IUTA 1QOFA 5F2DA 3I4NB 1F77A 1FD7D 1ET9A 4ILWA 4HRSA 5EPKA 1UWXA 3D4DA 1E0ZA 1TS3A 1LACA 2JP1A 2RDHA 3VR2A 5C6AA 5C3XA 4RF0A 2CU3A 2F3WA 2WP9B 3ABVB 1C9FA 1IBXB 1ZEQX 1Y56A 2B2YA 1MPEA 1TS4A 1NAPA 2E75C 4JBWA 1TYGB 3BYTB 3GV6A 5JVG3 1GAQB 1IBXA 4KV6A 5K36G 1BCPD 2WS3B 1D5XC 3X3NA 3D4RA 3M85A 3QG1A 2BS3B 3DMUA 3P75A 3VYRA 1WTOA 2BA1A 4LAAA 3RD4A 1VZ6A 1EY4A 3SFEB 5FKAC 3HVZA 1B9NA 4ZRQA 1VCIA 2F0GA 1GUOA 3NVYA 4C3HB 4K8JA 3GV3A 1YN5A 2WDVB 3IAS1 3A8KE 1QNKA 1F0ZA 5COYA 1IW7D 2B39A 4GLSC 4PMWA 5JPNC 4B0EA 4Q2JA 2K22A 3IT4B 3T16A 4K2LA 3W3AA 4NKLA 2KN4A 4HN7A 3A7AB 1S5FD 5KYIA 1P7FA 4PNYA 3WOEA 2EY5A 4KTAA 1FIQA 1XCTL 2OEDA 1LTTD 3TZUA 4A90A 5J22A 5CYUA 3I8ZA 4V190 1CA6A 3G7LA 4CKBA 1DOKA 1XF5L 3C8YA 1EIGA 3OWFA 4DNRB 3VRAB 3W1SA 3K5NA 4C3IB 4NMZA 3JAML 1SFOB 3VR8B 4ZKBB 3NVZA 4DF7A 3QO2A 4N6EB 1AZPA 4OO1I 4L8JA 3GTMB 3D3RA 1K8MA 1STBA 5I2YA 1C76A 2Y5PA 1ENCA 3NVWA 3AE5B 1SJED 3FAHA 2GRIA 1Q8IA 4NJCA 2PQEA 2K05A 2DY8A 2L12A 1EIHA 3PMFA 4XDCA 1II3A 2KACA 3CU7A 4YXDB 4IZ8A 3V96A 4PV1C 1WWTA 1Z47A 2W55A 4KJOA 3A7LA 1EYDA 2MJEA 2KECA 4MT5A 3BK1A 1PYWD 3SFDB 2A6HD 3TZDA 3HOYB 4KX6B 1VF5C 1ZUD2 5ELBA 3IT6B 3I4LA 1XLQA 5C2TB 4B0MA 2TMPA 2WXJA 1K8OA 3NTKA 2QF7A 5CMDA 1F2MA 2F0MA 2R7ZB 3AN1A 2OHFA 4PQXA 1U9RA 3IKJA 3NP8A 3U4EG 3ZYYX 5BN4A 4WURA 4LK0M 1GB4A 2K03A 1LTSD 1C79A 4R3DA 2B2UC 1K53A 1N60A 4AS1A 3M4OB 4OL7A 5IGBA 3MHBA 4QMGA 3W5UB 3VR4A 1ZYRC 1TJEA 3E6ZX 2EY2A 4DU9A 3PUYA 1C4PA 3WCQA 1EY6A 1Q1BA 3KWLA 2B2TC 1KDBA 1HFGA 4K5WA 3D6CA 3AE9B 4M1UB 4X3TA 1CTMA 1ZXHA 1WD0A 3CRLC 1D5MC 1SMYD 3NK9A 3NUHB 4KY6A 3AM9A 1CHPD 2SEBD 3EVQA 4IUPA 1JCKB 2V0GA 1TU2B 3RMHA 4O1NA 1YNJD 3MXUA 1F2RI 2L9HA 2EELA 4ZOHC 4OHJA 1EL0A 3LNNA 1JORA 4KKJA 2IW3A 5C5MA 1AN8A 5FK9C 1FXIA 1DONA 3SK6A 4ARCA 2M2LA 1TIID 1BCPF 2F1MA 1H9JA 1K83B 3BVMA 5C0XH 4BY7B 2HCIA 1LT6D 2BDOA 2SOBA 4CGYB 1Q3LA 1IGDA 3U52E 3HG9A 4C80A 4RF1A 2CW0D 2JEAI 5A2QE 4WWMA 1JC7A 2A73B 5G3LD 3ZJUA 2O4XA 4RKBA 1N62A 3A55A 1Q90A 1V1OA 2WXLA 2NVXB 2E76C 1NR2A 2H4OA 3NBHA 1TKYA 1JB3A 2N7JA 1OXVA 1EY0A 1ENFA 4RNAA 1JICA 1STHA 4XE0A 3FEWX 4XDXA 2A5HA 2K28A 2EPBA 3P63A 2BE5D 2H88B 4F7XA 2KJXA 5IOCA 1I4HA 2IT1A 4KGRA 4TMAB 4KK7A 4A6QA 3LYYA 1ESRA 1EY5A 2NUCA 2WP8J 2Y5CA 4X3SA 3K6OA 3BIID 1BBXC 2WXIA 1LTRD 1QLBB 1C4QA 1L0XB 4RH6A 1FCCC 2H1EA 1SE3A 4QUCA 1VLBA 1O7YA 2ICIA 2B2WA 4OIKA 2Y3AA 3DWPA 2NTSA 3K59A 3BYYB 2WXFA 1B50A 1XEEA 3I90A 1DOMA 4LMQD 5JEAJ 3MA2B 4BS9A 1QJOA 2K5DA 5DM63 1HHVA 2R6GA 4YSYB 2L1BA 5JOBA 3I57A 1ML0D 3B9JA 2Q8TA 2NWGA 4NZLB 1Q10A 4KN7C 4K6LA 4DNTB 4C3JB 3P42A 3DM1A 2X6LA 1RDPD 1LLRD 4PMBA 4C1NK 1PFDA 3R3OA 3GTLB 4REZA 2XSCA 1ONLA 1T5XD 3R8BA 2WNMA 2NMQA 1EQVA 3LWEA 1WTVA 1FFVA 5M9OA 4KGTA 4HAEA 2K0PA 2WU2B 3R2TA 4FF4A 1NYRA 3HZXA 4A3FB 2KQ3A 2HQEA 5C0XG 1A70A 3P20A 1F2LA 4AYBB 3EUB2 5I6WA 3U9OA 4JWSC 1JOQA 4RGOS 3C1EA 1SYGA 3H09A 3E5SA 4G4KA 4C56C 2PZWA 2K5PA 3VR6A 1MGSA 1GUGA 3S16B 2WB1B 3Q23A 3SDZA 1SE4A 3SE0A 5LL6S 4IFDH 4DA2A 1AFPA 2DLBA 3NQTA 4Z9CB 3MZ5A 3QB3A 1VMCA 1A15A 5CBEE 2SNMA 3QJYA 5CV8A 2L11A 5LL6X 1QOHA 4F8MA 1VRAB 2L4NA 2XIWA 3L7ZC 2B2VC 2MJ8A 1WD1A 1AEXA 1ROEA 3NE5B 4CJ1B 3PV0A 2L55A 2CHBD 4Q5VA 4A3IB 5HGTA 5C3JB 3FDTA 2A69C 3QIAA 1FGBD 2ZW1A 4OZCA 2FE8A 3NZ3A 3OIPA 4XWWA 3FPUB 2WXQA 1GOZA 2RMMA 4NDXA 2EDGA 2K33A 4KN4C 2VXWA 1OO9B 5I2XA 1RWSA 1IYUA 4YT0B 1EY7A 1CK1A 3K5LA 1TWFB 4RHRA 4MIUA 2Z4IA 3U2SC 5G5GA 5M3MB 1JE4A 1C4AA 2WAQB 4ID6A 3Q8FA 4RHSA 3CHBD 1JROA 2L1AA 2BA0A 3ZJVA 1ZOYB 5EPJA 5G3LF 1KH0A 5CC4A 3T51B 3I4MB 1BQQT 1SJHD 1H9MA 4X3UA 1QT9A 2KOLA 3LX0A 3VYSA 1E2ZA 2D5GA 5C4XB 1PDXA 3AE6B 3BG3A 4WQMA 5FLXE 3RFZB 2KAJA 1NR4A 1TY0A 1CI3M 1SB3C 2MH7A 1JWAD 3TEWA 2ZW0A 2R61A 4B08A 2I46A 2JXTA 1H9SB 2K1BA 2E2JB 4ZQ3A 3AEGB 3P7JA 2JEBI 5I9PA 5C4JB 3MAQA 2EKIA 3AV8A 2JA8B 3W5VB 2N0SB 4DK1A 4XTCS 5G5HA 1BMLC 1FRRA 5KYLA 2M56B 1H9SA 2F0LA 2XN9C 4K8IA 4RCOA 3J81L 1IUEA 3SR6A 3CRKC 2FUG1 1SBBB 2CQAA 1L4ZB 3P1HA 1QWYA 2MJ3A 1H9KA 1GHKA 5BMHA 1KNAA 1SF0A 1SYEA 3Q8EA 1F9QA 2N88A 1BUIC 5HFYA 2NB0A 3Q6SA 1MHHE 5EKKA 2JE6I 3MFYA 3VQIA 1I4PA 4NW2A 1ZP0B 4GZYC 5EBDA 1G8ZD 1MBYA 2EYLA 1PGXA 2XWJB 1SNOA 5CV4A 1DYQA 1AW7A 5EJWA 1A2UA 2NTTA 4G7HC 3ERQA 4IFDG 1CM9A 2WDRB 4QB4A 1TWAB 3MXGA 5IT9E 3S14B 4A3DB 1QB5D 3LXFA 3DWMA 4J8QA 2R93B 2B63B 2MP1A 2INPE 4RGTA 5FO7B 1SNCA 2Z8LA 2F0IA 1BUVT 2JA7B 1SNPA 3VYUA 4CBVA 3DWAA 5M5XB 1J7CA 2TSSA 3CKIB 1CA5A 1ESFA 1R4QB 1H9RA 1D6EC 2A68D 3SEBA 1ZE3D 1KLUD 3N6RA 1SYBA 2IX0A 4JK1C 3KBXA 3NVVA 2HDMA 1TWHB 3L9AX 5BMGA 2B8GA 4PT5A 2NZ1D 3OIQA 2LHEA 3GTOB 2FMCA 4DAPA 2PVGC 3TP5A 2KVMA 4RA8A 3L3OC 4N9PA 4HSPA 2V4DA 4KD3A 4DAYA 3D4WA 4IQZA 2BTEA 3TP8A 5HG2A 1PRTC 4KY7A 2WKDA 3FC4A 1HA6A 1ET6A 1CZGA 3DEPA 1R4PB 4CJ2C 3R2IA 5EPLA 1EZ8A 1CQVA 1PMRA 2EJFC 1HPCA 2ON8A 1S5CD 4F87A 5KIXA 1M8AA 4H2AA 1FYCA 3T13A 1QOAA 1W6KA 2JSOA 1G6ZA 3AE7B 3GO5A 2NBFA 4Q0FA 4KKSA 1XLPA 2YYZA 2BBCA 3J9CA 5C5LA 1WCMB 1NI3A 1UUPA 5CV9A 1E9MA 2DYMA 1TR5A 5FR3A 1EU3A 4A3BB 4XYOA 3AEEB 2J52A 2EOTA 2W82A 3H94A 3OMCA 4YIJA 1FM0D 1F2RC 4WAFA 2C5CA 3HP3A 2FFKB 2E2HB 1YN4A 2PW5A 1DOYA 1DOXA 2KHSA 2KMMA 5NUCA 2BDNA 2EYOA 4MACA 4WIPA 3J80L 5IGCA 1N5WA 4MHEA 1EEID 4UDUC 4RKLA 2JYOA 4HCEA 2PMZB 4ZYSA 3MHZA 4EQPA 5HURA 2O5JC 2M0AA 3HOUB 3PO0A 4HROA 4HCSA 3IL8A 2J4XA 1RJTA 2L52A 1DD2A 1Q1EA 2A6ED 4EVOA 3AEFB 1HRJA 3GD7A 3GQBA 1LTGD 3I72A 1QCBD 3C46A 2ONQA 1B9RA 3AEBB 2E74C 1BXTA 1LTBD 3I70A 4GDLB 3I73A 2LGIA 2AQ2B 5EKLA 3LB8C 1BCPB 1FNWA 3AE1B 3K5OA 4J3OD 1B1ZA 4YTPB 4YTNB 2EYFA 4K5VA 3EQLC 4ZHOA 1HFNA 5EE3A 1SSOA 3W9CB 4N59A 2R3ZA 3NTIA 2IGDA 4LTUA 1EZ6A 4IDIA 3VA5A 5BYSA 1LT3D 1SAPA 3RZOB 2YEPB 5FOBB 2JA5B 3CQZB 3TSSA 5BMIA 2BS2B 4A3GB 4MH8A 1HTPA 5AUIA 1EWCA 1YJJA 3TP6A 3VR9B 2AUJD 3RZDB 3TUOA 1G291 4AQ7A 1Y8OB 1F9PA 3DWQA 1FFUA 1A3UA 1MHXA 1N5XA 3OOCA 2HCCA 2V3PA 1QILA 2J0TD 4A3EB 1TS5A 1GUTA 2IGHA 3HS0C 5JEAH 1XTCD 1QQRA 2AQ3B 2AUKA 2EY6A 2PLPA 1AWDA 4US8A 4N9TA 3S17B 5C0XI 2AWOA 2WIIB 1SIJA 4A3MB 3D6WA 1I4RA 1UEAB 2ICEC 1S4ZA 2EYPA 2DBYA 1YMHE 2BYTA 4B9WA 3S1QB 2XNAC 1HQMC 4NP5A 2MJDA 1MI0A 1JOKA 2DNEA 1UAPA 4K14A 1J7AA 3KUPA 3HOWB 3K57A 1NUCA 2OF1A 1V43A 1QKZA 5KGUA 3UI3A 1GHJA 3DXJC 2YEPF 5I9OA 1ILQA 1GXDC 5LNK1 5KNDA 5HI1A 1RODA 4DGZA 1SNDA 1J7BA 3U9SA 2KUMA 1PTOC 2F0OA 2G1EA 4FO2A 3S1NB 2DWQA 2H89B 1I50B 1TY2A 4C7ZA 1SE2A 2EY1A 4A93B 1IGCA 5EQ0A 3T3OA 2NN6H 3QOJA 3TBIB 1I4XA 2FMMA 3V2TA 1SMYC 2Q5WD 1RTNA 3SXHA 2WXHA 3MXNA 5JXVA 5BYRA 1QF6A 4OZAA 3I91A 4YSZB 2DY7A 3OSOA 3GS2A 4OZBA 1S5BD 2EYHA 2OXPA 2KCCA 3DUZA 4LK1C 3S1RB 1FO4A 4DXFA 1WTQA 1STAA 1HQRD 2GB1A 2G9DA 2HDLA 4TQ1A 2K04A 4HTHA 3VR5A 2IX1A 4RGMA 1B2TA 5EGTA 5CORA 4G57A 3MFGA 1XYIA 2F0PA 2WXPA 4IALA 1JWMD 1PGAA 1XLOA 2PKOA 3QOLA 3Q24A 4FP5D 2K7VA 1VF7A 3K0YA 2PYKA 3SHLA 1L5PA 1A3TA 5DAUA 2J53A 2LJIA 2RVLA 1NVID 1IKLA 4FXKC 3BS1A 2QKIC 1S5ED 4KKIA 4HEA1 4DFAA 1KNEA 1JWBD 4P2CB 3H8HA 2BB6A 3I9V1 1WTWA 3HVDA 4DN4M 1YNNC 4F88A 3FKIB 4NAMA 3AMUA 3U7ZA 2QEJC 1B44D 3P4RB 4IKGA 5CGKA 2F0UA 2F0SA 2SDFA 4R9WA 1Y1VB 1F9SA 1XLNA 1RD9D 5MPOA 1B4OA 1RHPA 4ZRZA 4L1BA 1HA5A 3EGRA 5JEAG 3DHQA 2ZXOA 1DOLA 5LHY1 1KFYB 1HCZA 2K3UA 1PXUA 2EYMA 4XQJA 4XQQA 1AP0A 1UWMA 3E56A 1IL8A 5EKIA 2HDEA 1I4QA 2M9VA 5JJZA 2LKVA 3NRZA 2LS01 4DXGA 1DCZA 3KF8A 4A3JB 2PZTA 2GI9A 5C4HA 4GDKB 1LABA 3BDOA 3VA7A 4ZK9B 3DWGC 3GB1A 3WOFA 2A69D 5E3FA 4XT1B 2E2IB 4IFDI 3NHHA 3GP7A 2IWHA 4B9XA 1A6XA 1YN3A 3ND8A 4YWGG 4HSVA 1E2VA 4XXEA 2LY7A 4H44C 5D7GA 1JALA 2RSOA 3M7GA 4YTMB 5C3EB 5A2QL 1E10A 4C1NI 3NQIA 2F0KA 1E7PB 2NN6G 1JOOA 1GPXA 2AQ1B 3VR3A 2Y0SB 1JW9D 1LT5D 3PUZA 1STNA 1PTOH 3MJ5A 1MSHA 5BN5A 2CJNA 4WFN3 3HUIA 1TKWB 1VDVA 2WACA 2L83A 4CKCA 4BA1I 2K5QA 4I7ZC 3NS1A 5JPMC 4A55A 1KRHA 4XT3B 1K52A 5EE9A 3AECB 3PUVA 1PZID 4QF4A 3IFTA 4CQNA 5I4DA 1WTRA 3M3YB 4MN3A 1EYAA 4FVMA 2RPVA 1K50A 1J8IA 3A54A 1IHZA 5ELEA 4LJZC 2WU5B 2MEKA 1CQFA 2V4IB 1F9RA 1XXGA 4QIWB 3RUZA 1JWUD 2KEDA 3MWYW 3GTPB 2NVQB 3KBGA 4CKEA 1V8QA 2W54A 1SEBD 2PW9A 1ZXTA 3SVMA 3P4PB 1U4PA 5M5YB 2WXNA 2MHVA 2R92B 1C78A 3M4YA 1OQRA 3L4PA 4IUQA 1RF2D 3J7YW 1WTXA 1D4BA 3B2FA 5D65A 1STYA 1I3QB 1SYDA 2LUMA 3HOVB 3MVVA 5M5WB 4BBRB 2K01A 3EJIA 4S3SA 3Q22A 3GTKB 2JA6B 4P6VF 2RA4A 2N9LA 2N9KA 3SK8A 5E4WC 1ILPA 2BCOA 1HZ5A 2PZUA 3TEXA 2F4IA 5TSSA 3PZ8A 2DYOA 1UGJA 2INNE 2B2YC 4WORA 5C3WA 1FMAD 2W3SA 1NCVA 1KAAA 4JPSA 5ELCA 4C2MB 3S1MB 1IYVA 3CWIA 3Q0AA 2IGGA 1TZOA 3GTQB 5AUKA 4OVZA 1RCVD 3OMGA 2RDFA 3FPPA 2XRQD 2MUYA 4IURA 3AMZA 4TKOB 3E9SA 1YNTE 1LT4D 5IGGA 1EYCA 4XDDA 2KQ4X 5JAVA 3G6JB 2JWUA 2OT2A 5IGEA 2X6GA 5KRUA 3AE8B 3B2GA 2MGSA 3JAME 3S2HB 3P1MA 4A8XC 4HKZE 3KQ4A 2QMTA 1BF4A 2K5WA 4KHVA 1AYFA 3K7AB 3AE3B 1PRTD 2F0HA 4K6DA 2MPMA 1EWHA 1DOIA 5E1FA 1C77A 5AFWA 5H8YE 2D5DA 4MM3B 4RFBA 2ZXPA 1QOGA 3OWEB 1R7SA 2AX5A 3S9WA 1EY9A 4P16A 3A56A 1E0BA 2I38A 3NSWA 5D3IB 2FJ2A 2VNUD 1VJKA 2Q8RE 3NUCA 1Y8PB 2Q8IB 3QWNA 2KCNA 3T3NA 1OQQA 4ME5A 1W6JA 1N61A 1YQ4B 2B8FA 3HRZC 2J42A 2RDGA 2QCPX 3PUXA 4C3JG 2BB5A 5ISRA 1BO0A 1K51A 2D9UA 3HKZB 1GB1A 1C4CA 2YU9B 3IAM1 2NYZD 1F2ZA 2EVBA 4J6HA 4ARIA 4WJWA 2E3TA 2K9XA 2ID0A 1VZ7A 5FLXL 3H0GB 3E0JA 4HMIA 1UNSA 4M0WA 3URYA 3HRDD 3AB5A 1SDFA 1KLGD 4U68A 3C1FA 2PW7A 1I4GA 3MC0B 2LFIA 3FRPB 3Q8CA 4FXGC 5H92C 2A68C 4BWGB 4USAA 4YSXB 1HUNA 1A2TA 3IFDA 4BBSB 2L0CA 2XRSD 2LHDA 3D8GA 3NTHA 3EFXD 1PZJD 4FF3A 1NEKB 2FBWB 2A74C 2ZXRA 1GUNA 2ENBA 2O5IC 4CHTB 2D62A 2LEKA 1CZWA 1ENAA 1PGBA 2SAKA 1EWYC 4N58A 1KTKA 5ELFA 1BCPC 1T5EA 4TRDA 3ITPA 3MTSA 1XCQL 2F0EA 1FNVA 5CBAE 4H7BA 4KKUA 1EM7A 3O13A 1O7ZA 3Q8BA 3AEDB 2F0QA 1O7LA 1PRTB 4HEDA 2LMCB 3AB9A 2RSNA 3WDNA 3S15B 3HOZB 3NWSA 3BVGA 5IT9L 1SYFA 4RWSC 1MSGA 1T3QA 2KEEA 3BDCA 3V05A 4FXCA 1WTPA 1ZYRD 1MVKA 1EU4A 3J7AV 1IW7C 3T4AC 1T6BX 2LMCA 4PMCA 1CFMA 3TEYA 2RKSA 1QE6A 1RFKA 4XIGS 1NYQA 1VDZA 3SR1A 4TQ0A 1TWCB 5J1ZA 1SXTA 4OO1H 3MXPA 2F0VA 4L2YA 1ICWA 1U4RA 3NWTA 2L32A 3W2DA 1B53A 1JWSD 2WQYB 1KABA 3RPFC 3N52A 2GA4B 1FCLA 3AE4B 2PO4A 3BDLA 3J7AF 4ZHPA 1HEZE 5BYQA 2CJOA 1CZPA 2XVSA 2JQRB 4FYDA 4XYQA 4IN3A 3F2UA 2HTME 3VRBB 2NVTB 1FRDA 2WXMA 2ACZB 4K5XA 1GUWA 1WSPA 4HJGE 4RCNA 2Z1CA 1HUMA 2F0NA 3RLFA 3NPPA 2NVYB 1PRTF 5IGDA 1E2WA 1DGJA 2JU6X 3FILB 4M8AA 1BOSA 5IGFA 2IJ0A 2O2LD 4D2KA 2A6EC 3AEAB 1CHQD 1AZQA 1NENB 4KMUC 1IKMA 4LLGM 1PTOD 4RAUC 3A8JE 5E4XA 1DJRD 3FILA 3R93A 2A6HC 3OPOA 1D2BA 2PNRC 3EA6A 3PO2B 1Z7TA 1M4VA 1RKNA 3TMEA 4IUNA 2PMVA 3C3LA 1DXMA 1ZDXA 3C2PA 4ZUJA 1JR0D 2VZKD 4JX1C 5EBCA 2B2WC 4BA2I 1WYGA 5A35A 3MEHA 2PIAA 1DM0B 4ITKA 4L23A 1PDQA 2B76B 1G2TA 2WDQB 5M3FB 1X3QA 2QDBA 2BW2A 1GJXA 2JZPA 3A8IE 3BWUD 1BNZA 4ZLTF 2NN6I 3AH7A 4G7OC 2PTLA 3M7NA 3HOXB 2B2UA 1JQ4A 1PZKD 1SSNA 4G7ZC 1OFFA 2KA7A 3PUWA 3SK4A 1KDAA 3KLSX 1G2SA 1I6VC 3NXWA 5CV5A 2IX3A 2M00A 4DK0A 3HGBA 4TQUS 1YNND 2BT6A 5C4ZA 1DZ1A 1XX8A 4RGNA 2PVOD 1F2YA 1YNJC 4EGVA 1EEFD 2B2TA 3T53B 3Q69A 4OO1G 4I65A 3FVQA 4FNFA 1EFID 2J7ZA 5GXGB 1P7EA 2E6XA 1EQTA 1STGA 1J9OA 1WXQA 4C3HG 2LFNA 4KD4A 3ETRA 2D2CC 1TWGB 2VB2X 3GTGB 1Y8NB 2EYJA 4L63B 2SNSA 3LWUA 1L6VA 5IODA 1TKEA 2AWNA 1LTAD 4FF1A 2K6AA 3TEZA 5K5PA 3CIRB 1QNUA 2JYTA 2CW0C 4BY1B 3NBIA 3FMCA 2XWBB 5EE1A 2PCFB 5I6YA 4WRDA 4NAWB 5IIFA 2KWDA 5KNCA 4HMJA 1PTOB 1NSNS 1FXAA 5CV7A 1CJEA 4H0LC 1JRPA 2F0FA 5DEHA 2JX5A 2F0JA 1EY8A 2HUGA 5JVH3 3ONAB 3ZJTA 4ABNA