2IPKD

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ipkD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ipkD01
1CHPD 1AW7A 1ET9A 1V1OA 1CHQD 5ELFA 1PYWD 1LTAD 1ESFA 1FD7D 1JR0D 2QEJC 1HTLD 3DWQA 1EU3A 1JWUD 1PRTB 3BVGA 4NZLB 3R2IA 1JWSD 1KLGD 1MD2D 1I4GA 2XNAC 1I4PA 2R61A 3SEBA 3BVMA 2WV6D 1LTTD 1HA5A 2IPKD 4BWGB 1BCPC 1RF2D 1PRTD 1EEID 4C56C 1G8ZD 3GP7A 1SJED 2XRSD 2NTTA 1S5ED 1YN3A 1I4HA 1XTCD 1SE2A 1EFID 1D6EC 1PTOC 1SJHD 1UNSA 4UDUC 3V05A 4RFBA 1LTRD 1FNWA 1LTID 2ICIA 3EFXD 4ZYSA 1SEBD 1KTKA 4RGMA 1BCPD 2CHBD 2TSSA 3MC0B 1ENFA 2G9HD 4DXGA 1EU4A 1LLRD 1T5XD 4RCOA 3O13A 3R8BA 1B1ZA 2Z8LA 3DWPA 5FKAC 1PRTF 1PTOD 1FNUA 1L0YB 1JWMD 2NTSA 1UUPA 5I4DA 3DWAA 3MFGA 3CHBD 4K6LA 2J4XA 1STEA 1YN5A 1I4XA 5ELEA 1LTBD 1TY2A 3W2DA 5FK9C 1LT6D 1BCPB 1S5FD 2AQ1B 5TSSA 1BCPF 1S5BD 1FGBD 2RDHA 4L63B 1LTSD 4L6TB 1S5CD 3OWEB 1TS2A 2IJ0A 1CQVA 1TS3A 2AQ2B 1PTOB 1B44D 1TS4A 4RGTA 2XRQD 1RDPD 1EWCA 1SBBB 1ET6A 1PZID 1SXTA 1AN8A 4TSSA 1L0XB 1S5DD 1DYQA 1SE3A 2O2LD 3KLSX 1I4RA 1GOZA 1FNVA 1JCKB 4RHRA 1RCVD 1CT1D 1F77A 1D5XC 1LTGD 1TY0A 1TS5A 2XN9C 1KLUD 1LT4D 4Z9CB 1M4VA 1D5ZC 1D5MC 4O1NA 1V1PB 1PRTC 5ELCA 4DXFA 5D3IB 1RD9D 1JQYD 3BYTB 2QILA 3EA6A 1CK1A 5D3DA 1I4QA 1XXGA 2AQ3B 1YN4A 5ELBA 1V1PA 1QILA 1PTOF 4RGNA 1HXYD 1EEFD 1PZKD 5ELDA 4OHJA 4RGOS 3BYYB 3BVZA 1BXTA 1PTOH 1LT5D 4RH6A 1DJRD 1LO5D 3URYA 1HQRD 2RDGA 3TSSA 2SEBD 1PZJD 3BZDB 4RHSA 3R2TA 1LT3D 1SE4A
chains in the Genus database with same CATH superfamily
4A6QA 1RJTA 2K8HA 4NAWA 3QOLA 2MSED 4IUVA 2AWTA 2L4NA 1CA5A 4GOPB 3K9OB 4ZCKA 3K0XA 2A69D 2NWGA 3AI5A 4C2MB 3EVQA 1WXQA 1C7YA 3DQVA 3MXPA 3GTJH 4HKZE 4J15A 1XLPA 1AYFA 3LDZE 2PNHA 4KKIA 3AEFB 3A9JB 3QARA 1F2RC 1EWYC 2Q2IA 3N9YC 3NS1A 3IAYA 2K5NA 5I2YA 1E7UA 2PNRC 3OJ3A 3SEBA 1WX7A 4YTNB 1LTTD 3CCJA 4KGSA 4DR5L 2IPKD 1LM8B 2DY8A 3QWZB 1RF2D 4A3BG 3BWUD 2MX2A 4A3FB 1E8YA 1MHWC 4XTCS 2A6EC 2M2LA 1X54A 2E2IB 4GNXB 1VS0A 1MG4A 2DX5B 3EC8A 1H9KA 4A3CG 4A76A 3MJ5A 2Z6KC 3CCVA 1PQSA 1WZ3A 2VRRB 2KWDA 2EYMA 1Y1WB 3N1XC 1I5FA 4IZ8A 3GV6A 4PMCA 3ZLZA 5KYLA 1YOVB 1P3QU 1KTKA 5H1SE 2XIWA 3PRPB 2SNMA 2CH4W 1VQNA 1F0ZA 3WALA 4R9WA 4HSPA 3CRKC 1XO3A 4HWIB 1WRIA 5IT9L 4CGYB 5M5XB 3I7FA 3RI7C 2KCCA 1N34L 2DN8A 1NCVA 4ZUIA 3SK5A 2LJ5A 1PA6A 3MP9A 4UP9A 2BS4B 2GBNA 3TS0A 3I3TB 3RMHA 3CHBD 3Q22A 3CCQA 1G2TA 1S3SG 4WFN3 2KO3A 2D2QA 2BOSA 4XYCA 4A8XC 4TQ0A 3NUCA 1IXRA 3B2GA 4USAA 4P2CB 2M00A 4REZA 1ZKHA 2A68C 2VUMH 1BF4A 4LJPB 5LLIA 4G3XB 3RYTA 3L54A 1T0SC 3J81c 4RGTA 4DPGA 2IGDA 1L1OB 2CKZB 2KEEA 2L9HA 2J0TD 3RN9C 3N6RA 1RWSA 4GSWA 1QNUA 3MZ5A 4TSSA 1CJEA 3NZUA 2NB0A 2BB6A 3ZTCA 3ZNHB 3TN2A 4XC2A 2JF5A 1E90A 4MSMB 1CKNB 1WXSA 1GPXA 2F0HA 1PFSA 3AMUA 1EM7A 2LVQA 2KBNA 1FRDA 2O4XA 2R93B 2B2UC 5AUIA 2MP1A 2EXDA 5E4XA 1EZ8A 2NVYH 2Z0DB 4LK1C 1ZW7A 1TY0A 1J5EQ 1MG8A 1LT4D 1GUNA 4JI2Q 3PF5A 3MFYA 3HOXB 4FHKA 3HKZG 1QOBA 2WXPA 4XDDA 5AEKB 5I6WA 1H9SA 3GTQH 2RPVA 4EUTA 4LF7Q 2E2HH 1X56A 3OWFA 3I4NG 3KLWA 4MTNA 4BXXH 1YN4A 2QEXA 2PIAA 4K81A 2K25A 2BE5D 1N5XA 4ZHPA 2MQHA 5IP7H 1C8CA 5AJ3Q 4MDKE 3A1QB 5EE1A 2ATWA 2INPE 4ANXA 1I94L 4HMJA 4HMIA 2SEBD 1QLBB 3ZRFA 4RHSA 4IPGA 1JRUA 4GIVA 2L1BA 1JB7A 2UXBL 1U4RA 1N32Q 3QK0A 4PS8A 3KJOA 3H7PB 5BN5A 4TV3A 1IBML 4NXMQ 2LHDA 2WQYB 4LJOB 2M56B 4MN3A 2DY7A 2GVAA 2V1CC 2K5HA 3H0GG 3OSOA 4DV6L 1E7PB 1WGHA 4KIKA 1V6EA 4HVBA 2EVBA 2QEJC 4YXDB 2CW0C 5IYDG 1JMCA 2JQOA 4JL9A 5DCNA 4KZCA 1XNRQ 4N58A 5AZGA 5GQOA 1P98A 1ZXHA 3HIZA 3X23A 3LNNA 3EN2A 1XD3B 1XF5L 4KGTA 3BDOA 4AYBG 3ALBA 3S17B 1C9OA 2KFKA 4K2KA 4EQ5A 4GN1A 4LLGM 3SU8X 5C44B 1PGXA 4EZKA 1VMPA 1C3TA 1WX8A 5E3FA 5J17A 3WAMA 1WD0A 2MWSB 2EMSA 2INNE 2N88A 3E0JA 1JJ2A 4DHJD 1Y1VG 3PHXB 4XIGS 2G1EA 4RKLA 1JOQA 4G7OC 1DOLA 3AB5A 4IUPA 1Q90A 4WWPA 4UHVA 2R3ZA 3NBIA 1A6XA 2K3UA 3K5OA 4G50A 3J80E 2LXKA 2Q2UA 4OONA 5C3JB 3WWVA 2DNFA 3ONSA 2FIFA 4ARIA 1OO9B 4QAYA 4FXDA 2NVUI 1L6UA 2GN5A 4X3SA 2DYOA 3HS0C 2JXMB 1RFAA 4B3SQ 1P7FA 5ELEA 4A3GB 3W5VB 3A5ZB 2WINB 4R4TA 1TY2A 4P1BC 5M3MH 1C0AA 1Y56A 1WGRA 3TDQA 3A9KA 2HDEA 1HNXQ 1S5BD 1FGBD 2R7ZB 4JI3Q 3SR1A 2ZM6L 4LTUA 2ZTCA 1SYCA 4KDIC 4MIUA 1B70B 4B08A 3HOYH 2B39A 1BR9A 1TS4A 1XNQQ 3C1FA 5M3FH 3KUCB 3NTIA 2AWNA 4QB4A 4LF8Q 1UGMA 4A3EB 2KUMA 2EMTA 2JY6A 3IHPC 3DBLB 4YWKA 3STBC 1CFMA 3KYHC 5C3WA 2J52A 2K33A 1WE6A 4LF9Q 1S1QB 4LUOA 2F0GA 2K7VA 3EECA 4IFDJ 3J7A5 2EOTA 1SRUA 1KQSA 4YL8A 1Q7YC 2E2JB 2L8JA 3PUWA 2QDFA 3KQ4A 1K52A 2M1MA 4BKGA 2VZAA 4K8JA 4HPPA 4GS3A 1X3FA 4H44C 5LL6X 1PHJA 3NZ3A 4HK2A 1QG7A 1KLUD 3GTPH 2MJEA 4OWWB 3Q8FA 3NXWA 5IOIA 4EGVA 1E7VA 4YCWA 3DBLI 1HTOA 4F1SA 2VW9A 3A56A 2YVCA 2EQSA 1N5WA 1I50B 4FXKC 2Z59B 3DEOA 3HHMA 2EPBA 1PDQA 4IWQA 3VQIA 3IKJA 1V1PA 1NI2A 4DK1A 4Y52H 1GAQB 3W1YA 4X3UA 2Z4HA 1E8XA 2K05A 3SGIA 2GLSA 3APFA 3SFEB 4KN7C 3F1ZA 5IT9E 3CMEA 2EKIA 5JHBA 4GLSC 2A6HD 4PNYA 5EBCA 2F0LA 2CQAA 3K7AB 3UE1A 4ZKBB 4GLAC 1LO5D 3URYA 3TSSA 3T51B 1PH9A 1J6QA 1WJJA 3I4OA 4YTMB 3R2TA 2B2TA 2UU7A 2CH4A 2MBQA 3AEAB 3GZNB 1TWCH 1RM6C 1EWHA 2CWAA 4B9KA 1EFWA 1RODA 4H7BA 4C3JB 4DV3L 4DV5L 4HN7A 1R4MB 1SSNA 4M8NA 1S4ZA 3L17A 1I3QB 1EUJA 4K3BA 3WOEA 3RNUA 1CI3M 2JXXA 2ENBA 3HOZH 1QUQB 2KDIA 3TIXA 1TWAH 1CKOA 3R2IA 4K5WA 4AJYB 1D1KA 3KUZA 3UIOB 3EFCA 4FF4A 2IZVB 2Y3AA 2B8GA 4NJCA 3K8AA 2GMIC 5FLMH 1MIUA 3BIID 4ITKA 1HA5A 1K0SA 4WQMA 5G55A 3RNAC 4A3KB 5EKLA 1AZPA 3OTOQ 3AE2B 2RDFA 1EF1A 1R4MI 2DENB 4PMBA 1SIJA 3SVMA 1VF7A 3U4EG 2I5MX 2MO1A 4LF4Q 1UWXA 2ZCCA 1WJNA 3I55A 3APCA 5C4JB 3RZDB 1DD2A 2HDLA 4MGKE 2KCNA 4L5QA 2VUMG 1WI0A 2KX3A 1VQEA 3J7YW 4DXGA 2NBWB 1NE3A 1SN8A 2WDQB 4KZ0A 5JJZA 2FNJB 4US8A 1UGJA 2KTRA 3O13A 2SDFA 4LJZC 3R8BA 2JA8B 2DLBA 3L0WB 3P63A 3DWGC 1WCMB 1E6EB 5I2XA 3FKIH 1R7SA 2IGGA 1TXYA 4KKJA 4NQKE 4ZRJA 1IBLL 1KRSA 3PIP3 1CSQA 1JJGA 2JPHA 1FJGL 4W9CA 1UD7A 5M9OA 2WGSA 2JSOA 5C3XA 3QJZA 4BKTA 2LXAA 1NMGA 1LT6D 3K58A 2L15A 2A4ZA 1B9NA 2MUYA 4APVA 3WAOA 3MXNA 3ITPA 2DHZA 1A3UA 5KRUA 1V8QA 2MO0A 5CC4A 4WJNA 1NUCA 3TEZA 4W9KA 4EVOA 2RA4A 3HOWH 1PTOB 1B44D 3GTLB 4BBSB 2WU5B 4BY1B 4UP8A 4FF1A 1WF9A 3A4RA 1QE6A 4FDBA 1PGBA 2YV5A 2N49A 2VS1A 4DUYL 3I56A 4JVZA 1QOFA 1T3QA 3MA2B 3VAWA 4CJ2C 2VNUD 3AE4B 2DJFC 1EY8A 3NVWA 4IQZA 2J42A 5IP7G 4JYAQ 3B2FA 1E2VA 3AN1A 1VCIA 4PQXA 1GHJA 1TS5A 3PUXA 4IALA 2W9NA 2WAQE 3K0YA 1XMOL 2A19A 3S1MB 4GZYC 1PRTC 4JWSC 2KACA 2EYHA 1RD9D 2WB1B 1S40A 3Q8AA 4CYEA 1TKGA 2MEKA 3I4MH 5CBAE 2CR5A 3GTGB 5IAAC 4LFAQ 2FBWB 2HTME 1VQPA 1PTOF 1IZ6A 3NWTA 5EPKA 5FLXc 2LGIA 2V3NA 1U4AA 4DV2L 1LTLA 2K22A 2L05A 4A3OA 5CV8A 3KDFA 3X3MA 3TUOA 1SAPA 4KTAA 4QUFA 1ACCA 3PZ7A 3DM1A 4DV0Q 3M4OH 4I6PA 4F8CB 3WCQA 3UQBA 2I2YA 1PUTA 2WACA 1KRTA 4ZYNA 1K8RB 4CKBA 2N8NA 3Q0AA 4HJ7A 4A3BB 2KN4A 4FBJB 3SD5A 1FFVA 1LTAD 2OEOA 5CX3A 4IUTA 2I1JA 4A20A 2BH8A 5IYBH 2RPQA 4OVZA 4OZAA 3E9HA 2E5LQ 4HAEA 3AECB 1I6VC 4PG3A 2MBBB 1AP0A 4AQYL 2R93G 1EY6A 2NPTB 1KLGD 2CKHB 4M0WB 4FNFA 4H2AA 1H9JA 5JJLA 1PH8A 1A63A 1ZGUB 4B3MQ 2BYEA 3IAM1 2WV6D 3PO2H 2K5VA 3TMPB 4KI0A 3L10B 1VQAA 1PRTD 1F1HA 2BTEA 2EYFA 1YQ3B 4IWOA 1D7QA 1XWEA 4WAAA 1HNZL 4HLEA 2F0IA 2N9EB 4BBRH 4CDFC 3SDLC 3QJYA 4YY3L 2FHTA 5M3MG 1O78A 3ULPA 1BCPD 2MHVA 2K1FA 2FMCA 3R7RA 4OWXB 1T5XD 1VQBA 2WKCA 3F2DA 4FF3A 4HCNB 2JZ3B 3HOYG 2I38A 2EELA 4X57B 5FKAC 5HHDG 2WLBA 1L0YB 3A7LA 2MJ8A 2NTSA 1WSPA 1MBYA 4P71A 3KYCD 4DAYA 1XMQL 1TT5B 4G57A 3HM6X 4BKSA 3E5SA 1MPEA 1UH6A 4GKJQ 2PMVA 5IGGA 3S1RB 2PPHA 1ZYRC 4PZ8A 2Y0SE 3NQIA 2V3SA 2D9UA 1ZOYB 4WQOB 2N9KA 3DVGY 4IDIA 3HEJA 4EOYA 1QVCA 3OWEB 2IJ0A 3ULJA 3W5OA 1FYCA 2AQ2B 1WIAA 4N8X1 2PI2E 1EWCA 2EYJA 1Q8IA 3U58A 1A70A 1JWAD 3ECIA 2WX1A 4W9FA 1ONLA 2WS3B 5D2MB 2H1EA 3HKZB 5C44G 1XLNA 2H89B 4E71A 5IWAQ 1XEEA 4N59A 1WH3A 3I4NB 4JI8L 4EX5A 5G5GA 4X3KA 2IGHA 3SK4A 2AKWB 2HQEA 3SHLA 1K8OA 1SMXA 4JV5L 2JWZA 3J9CA 1UWMA 3U2SC 3LXFA 4GDLB 1KAWA 4QCLA 2UUAL 3VUXA 1P9DU 5ELCA 4R4OA 1EF5A 1DOKA 2P5ZX 1HTPA 3TEYA 2WXFA 1XXGA 1QOGA 4MHEA 1G51A 3HVZA 2ZTDA 1MJEA 4A93G 1HXYD 1AE3A 4NXNQ 1YITA 1A3TA 2NN6I 4RGOS 3H0GB 3M7GA 1BXTA 4MJSA 1B3AA 2NZ1D 1LQBA 1HQRD 2FCMA 2PW7A 5FLMG 1LABA 3DPDA 3CCRA 3G7LA 1WTQA 5IE8A 4XDCA 5KIXA 2ZCBA 4HSVA 3RCZA 4G7HC 1V1OA 2EJFC 2F0PA 3D6CA 2YTXA 4UP7A 3Q23A 4K0KL 3J7AV 1F9JA 2WDVB 3R3OA 2JA6H 2HIXA 2Z0EB 5IT9c 2PQEA 1RIPA 2I46A 4NAMA 1YHAA 3DWQA 2OWOA 2W55A 3QQ8B 1OXTA 2IX3A 4IUUA 5E6JA 2HT1A 1I6HH 4M00A 2RBMA 1PH3A 2A5UA 1X3GA 3AEDB 1JROA 1A3VA 2NR2A 3V2TA 1Y1VB 3GTOB 4TKNA 1Y69U 2QDLA 3G71A 3PO3H 3A9JA 1T0RC 1EEID 1WXVA 1UEBA 3GP7A 4GN3B 2KX0A 1FCCC 2EY2A 4JI1L 1WI5A 4AYBE 4DR2L 1KJTA 1HR0Q 3U30A 1JE4A 1V9JA 4YHHL 1IGCA 3Q2AC 2B29A 3JVZX 1K83B 4X66L 4JGHB 3ZDTA 1SR3A 3VTWA 3PCOB 4LUZA 2MBEA 2ZNVC 3VYUA 4XWWA 3FHWA 4RGMA 4CJ1B 1VQ5A 3V6EB 2NN6H 3S1NH 1EU4A 2I07B 5LMUL 4BA2I 1K8AC 2GBMA 3BDLA 1U5KA 3FVQA 1E22A 2HHHQ 3HOWG 3VUWA 3BJUA 4EQPA 1IUEA 3VR4A 2AL3A 1ZE3D 3W1GA 1EOTA 1JWMD 2J53A 2ZXRA 5KHOA 3ZNID 4U673 2KHIA 2UYZB 2J4XA 1STEA 4RWSC 2BW2A 2F3VA 1SYEA 4URKA 1WJ6A 3NOBA 3W2DA 1HNWQ 4KHPL 4I6LB 4FHJA 2RSUA 5GXGB 5TSSA 2PMZE 2AHOB 4YCUA 1WWTA 3T3OA 5HGTA 1TU2B 1BNZA 1DOYA 1IW7C 2KN5A 1UZXB 3T8MA 1DXMA 4DR6Q 3PGZA 4AJWA 1DGJA 2AEHA 1SBBB 3KK7A 5EKIA 2JEBI 2WXOA 1AN8A 3CW2C 1DZ1A 3NBHA 3I4MG 3DBRI 3DVNV 3VH3B 3NZSA 5IGBA 4C1NK 1HZAA 4ZRIA 3M63B 1HQMC 3EUB2 3A8KE 1C4AA 2RD0A 4FLHA 2LMCB 3MHSD 1GO3E 2UXDQ 4N6EB 3GTJB 3GO5A 1Q5WB 1UBIA 1CKNA 2A8VA 2ZVOA 3ZDMC 2EDGA 4W9GA 1IGDA 4IM0A 4L5TA 1C78A 5T1IA 4L23A 1O7ZA 2VQFQ 4C3IH 3H8HA 2ZZPB 2VQEQ 2JN4A 1TT2A 3I57A 4AOFA 4ALPA 2RSOA 2ONQA 5EE3A 2F3IA 2PZTA 2KKCA 4RGNA 1RAXA 3NRZA 5IYBG 4YWMA 2A69C 2EY5A 2K52A 3L3OC 1RLFA 5LMNQ 2ZJRA 1VLBA 4IJHA 4GGQA 5AUKA 3S2AA 4KX6B 1NDDA 2I5LX 3HOVH 2KDMA 2IX1A 3E56A 4IM3A 1YNJD 3PO2G 1W6JA 2K9XA 2L32A 3HGBA 2M19A 1E2ZA 2F0NA 2OXPA 4BY1G 5BMHA 3TMEA 2LUEA 3KF6B 1NENB 1QNKA 3ENEA 4X65L 4IOCA 2VB3X 1IBKL 4L1BA 2B3GA 3GTKH 1L4DB 4HIMA 3P4RB 2A74C 3BG3A 4A3PA 2CHWA 1Q0WB 1Q1BA 5EJWA 2J0MA 1EOVA 2LFNA 1MD2D 3J80L 4IFDH 1SFOH 1I4GA 1CTMA 5CV5A 2B3AA 1YHQA 1WTOA 1L6VA 2VUMB 2KHSA 5CYUA 1CMXB 3C46A 1UBQA 3TQYA 4NNJB 1SJED 1HH2P 3P4PB 1EIGA 2NTTA 2XRSD 4KY5A 4QJFA 3PSEB 2RF4A 3E3XA 3GS2A 2C5LC 1U0LA 1V86A 5C0XI 4XT3B 2BS3B 3TJPA 1Z7TA 1K73C 4K7WA 4GDKA 1E2WA 4JI4L 4DR4Q 2ICEC 2L76A 3VYSA 2B2TC 4K5VA 1QVFA 3E6ZX 5DPWA 1SYGA 5JOBA 4P1CC 3AE5B 5JHAA 1WM3A 4B9WA 1X3QA 3PRZA 2BKRB 1K53A 2PVGC 2DZKA 4OW0A 2NVYB 1QCBD 2ZTEA 3ZNZB 2BT6A 3DDCB 3AEVA 1MSHA 2IY0B 2DAJA 3CMMB 3Q3OC 2KC2A 2REXA 3TP6A 3CSFA 4H0LC 4W9IA 5IGDA 2I1KA 3GTQB 3TZDA 2IO3B 4CDCC 1JQ4A 3TBIB 5HG2A 2IT1A 4ZKCB 2E2HB 2R6GA 5C2TB 3NHHA 4J8QA 3CAMA 3AE8B 2XK5B 3QX1A 3AFQA 1M90C 4JI7L 1M1KC 1GVPA 4C00A 1YNND 1BDOA 3H15A 1CA6A 4LF5L 1S5CD 3MC9A 1TIID 1TS2A 3NUHB 3A54A 3U50C 1PFBA 1VDZA 2MFIA 4A4IA 5IY0A 1RDPD 1U9RA 3BS1A 1IBXB 3UDFA 2K75A 2PO4A 2FCQA 2NZHA 3ML8A 4PYUA 4DV7L 3ZVVA 3X0WA 4X62L 4KMUC 2L3ZA 2OT2A 4NDXA 4CJ0B 5BYSA 2LRWA 1PVOA 1XCQL 4FJVB 4P7IA 3TCAA 2L0CA 4N8FA 2D07B 5C0XH 2JU6X 2H5XA 2INCC 1X55A 1IPGA 2MP2B 4RM8A 2UUCL 5EAYA 2KQSA 4EKUA 2BE5C 4HDOA 4OVUA 5JVH3 5JEAG 1JWBD 1VQ9A 4QQBX 2D10A 3FDTA 4DXFA 1PFDA 1A15A 1D2BA 4FO2A 1YI2A 4JX1C 4X64Q 2WP8J 3EA6A 5D3DA 4F88A 4ME5A 5BR8Q 5T1GA 2RSNA 4LNKA 3ZXVA 1SGHA 4M1UB 1PV4A 4YIJA 5D6JB 1O7YA 5G3LD 1CZGA 4TQUS 1V81A 4AS1A 3BYYB 4ZRPA 4QIWB 3G6EA 3UE0A 2JT4B 4BOZB 5IGCA 4K7UA 3R93A 5IP9H 2Q8IB 1JC7A 1T5EA 4OVVA 2K32A 3D0FA 2RR9A 3ZTDA 2K50A 2Z9HA 3PO3G 2VZKB 1STGA 4M02A 1SMYD 1MVKA 2KLGA 2WNMA 2YU9H 4DV6Q 1FD6A 4KHVA 4OIJA 5IODA 1RKNA 2LRUA 1JMLA 4S0RA 2V0GA 1LM0A 3KUPA 5HGQA 2WXGA 1WGGA 1A62A 2WXQA 5JVG3 1PRTB 1Q10A 4K2LA 2N7JA 2MBOA 3CCMA 4C2MH 1WTVA 4DV1L 3JSVA 2FJ2A 3KBXA 2NN6G 1QB5D 5M3MB 1L2FA 2O5IC 1V2YA 4C7ZA 3CCEA 4XXEA 4F7XA 2D3BA 3PLVA 2ZEQA 2BDNA 1AZQA 1HZ6A 4OZCA 4FULA 3K9PB 1YN3A 4A3LH 4ZRQA 3HOYB 3VTUA 4HJKA 1VQDA 4LF6Q 2BYFA 4RA8A 3QAQA 5BYQA 1XPUA 1D4BA 1VDVA 4OO1H 4A3FH 1UE7A 1LTRD 1XPRA 4P16A 4I65A 3T16A 3BDCA 3OIQA 1P16A 2NBVB 5C4HA 3DMUA 5DM73 4GB9A 2E75C 1OXSC 1CZPA 1DM0B 2VY3A 1ENFA 4F8MA 3WA0A 2LY7A 5LXHA 1UEAB 1WOCA 1TWGH 4DAVA 1YQ4B 1SNPA 3DWPA 3EJIA 1PRTF 1WE7A 2BS2B 4W9HA 2O5JC 5DPRA 2X38A 2MJ3A 1UUPA 3ZNGC 1TWFH 2HD5B 4BZAA 2XWBB 1Z2MA 2IY5B 4KD4A 4K6LA 2Q5WD 3IRBA 2L7RA 3HUIA 1VJKA 4K6DA 2V4IB 5TR5A 3VDYA 4M8MA 4DHZB 3FRPB 2N78A 4QGUA 4A3MH 4A3DH 2LJIA 1J5EL 4PMWA 3DHHC 4K3CA 3JW0X 2L55A 4JI2L 2A5HA 2VH1A 1BCPF 5IIFA 3PF4A 3TS2A 4DV4Q 4XYQA 1GJXA 1V5TA 2D62A 4LF7L 3LYYA 3C1EA 3AE7B 2W3SA 2K6AA 1H9RA 3W1SC 2R2QA 3ERSX 3LJ3A 4W9EA 4C3IG 2DZJA 1PH7A 2WWZA 1TWCB 4NAWB 4JI0Q 5AJ3L 3M4PA 1VQOA 2RDBC 1DCZA 4XWTA 1FNVA 4RHRA 2K8BA 3ONAB 2MCNB 4AP4C 2X69A 2I0QA 2GRIA 3OW7A 4A93B 2OHFA 3T1YQ 3C2PA 1K50A 2KT7A 2QCPX 4LAAA 4BY7H 1N32L 2XN9C 5L37A 2LASA 4JPBW 1TWAB 1ESRA 3BK1A 1J8CA 1KOTA 3HOVG 2A6HC 1Y8NB 4NXML 4A90A 1H8CA 1JQYD 3GTMH 1UE5A 2D0OA 1J19A 4ZHOA 4JI6L 2CS4A 1F2LA 1YZ6A 3K6OA 5E4WC 2IHEA 3U4VA 1XNRL 2CFMA 1B53A 2WDTB 3G6JB 5LHY1 3T1HQ 4CHTB 5M5WB 1NYQA 1EEFD 1TIFA 4S3SA 2F4VQ 2PVOD 3BY4B 4OEMB 2IY1B 1F2YA 1J8IA 2D2CC 3BZKA 4LWCA 1MHHE 5LL6S 2ON8A 3KLSA 4KHZA 2IBIB 3P2BA 4NW2A 3I9V1 4O42A 4IFDG 1TJEA 3RD4A 2FFKB 2O6VA 4C3HH 4KDLB 3T3NA 1CHPD 1AW7A 2UXCQ 3MAQA 2EJGC 3JAME 3Q8BA 5C23A 4BOSC 3W1BA 4Y7NH 3OW2A 2N7DA 4NPSA 1C4PA 2K5WA 2KJHB 3L13A 1JR0D 5L95C 2LKVA 4MSQB 2BYVE 3NE5B 1HTLD 2LSSA 2KJXA 2K1BA 4NZLB 2F1MA 1MGSA 4Q0FA 4ZRKA 4IW0A 4G0NB 4MGYE 2L52A 2ZJDA 4MM3A 4ARCA 3T9LA 1HZ9A 1VD2A 5JH5C 2EYLA 5KYIA 1YIWA 2C60A 4XDXA 1TZOA 1HUNA 4BKSD 4WORA 3Q6BA 4M0WA 2GI9A 1S5ED 4B3SL 2Z4IA 3HOWB 5K36H 1XTCD 3S24A 1A5RA 1EFID 2R92H 2WXHA 1W2BA 3WANA 4DR3Q 1HNXL 1B50A 1LTID 4JI3L 4R4IA 1YJ9A 3C3LA 2IO2B 3P4QB 4OZBA 5BO4B 2G45B 2HE7A 4ZQ3A 1XNQL 4R1JA 4A3IH 4ANVA 3Q3FA 4B6WA 3JC66 5HURA 5DNFA 2PKOA 4R4CA 4LF8L 3SFDB 2PQAA 1PH1A 1PFMA 3OMGA 4J6HA 5C4XH 1STHA 1IBLQ 4LF9L 4F7ZA 4NP5A 4XT1B 2GVBA 4KLKA 4QF4A 1FJGQ 2B76B 1H9SB 3MHBA 1B7YB 2PI2A 5C4ZA 3I4MB 1F9QA 1JOKA 3FPUB 1VQ8A 2K6QA 4IM2A 3VRAB 4X6AH 3ERQA 4E3CA 2AQ1B 5C0XG 1MI2A 4R8IA 1Z6HA 1RTOA 1EY7A 4GKKL 2CHXA 1VQLA 3IFDA 1N8RC 4LDTD 3F2CA 3CCUA 3U4ZA 5J3BA 3RNCC 1SDFA 1VMCA 5KNDA 4DXAB 1TKEA 3N52A 2BDOA 3FMCA 1GG3A 3VH4B 1ILQA 2ZNVB 2MA9B 1S5DD 2Z6KA 3KH0A 4EEWA 1SYBA 3ULLA 2O2LD 3KLSX 3K5MA 2KHWB 2KQ4X 4HPLB 3SK6A 1I4RA 2RGFA 1MFWA 3P4SB 3WAPA 2RMMA 1U4LA 1J7CA 4KIKB 3ZKJC 4B3RQ 2JVCA 3OPOA 3PSIA 1XMOQ 1JW9D 2G3QB 2LI5A 1UE6A 4HKQA 2R7FA 3PRMB 4FYDA 3KOJA 1XJVA 1QZGA 1IYFA 1L4ZB 3WDNA 1SROA 1ICFB 4NY0A 3V96A 3CQZH 2F0QA 2QC8A 1MJDA 3NWSA 2HJ8A 2AUJD 2IWHA 3S2DH 3PO2B 2PJHA 2F0WA 2ZW0A 3N20C 5ELBA 2KFKB 4GDLA 1DOXA 4JOIA 1WMHB 2PLPA 3UINB 1A2TA 1JB3A 4DK6C 3PHWB 4HJ5A 4BVUC 1X9NA 2L5TA 4BXXG 4BBRB 3DWMA 4RH6A 4HCPB 1NSNS 3ZJVA 2RDGA 3OTOL 3SHQA 4DR1Q 1EIFA 3AEBB 4NJ7A 5KHQA 4ID6A 4K14A 1EL0A 4ZAIA 4LF4L 1M94A 1PGAA 3K7AH 5FOBB 4M01A 3VHTC 3EIVA 3I90A 1X65A 5D65A 3EGRA 3TREA 1LFDA 2E2DC 4A3LG 2JYTA 2K5DA 1JALA 1KDAA 4JBKA 4YTPB 1UAPA 2DUDA 1BUIC 3FILA 2JA7H 1FM0D 4OO1G 4OX9Q 4RAUC 3KJPA 1NNXA 1WTWA 1FXAA 2PEAA 1VQCA 5G5HA 1PH4A 4HPMB 3VUYA 3TP8A 4JLCA 2M0XA 2E3TA 2BKFA 3A9KB 1J9OA 1X6OA 3Q24A 1BCPC 1PH6A 4C4VA 2CVRA 3M3YB 2HD3A 1D8LA 2GB1A 3PUZA 1WR6E 5IYCH 2C7MB 3GB1A 2WB1E 2SAKA 3CU7A 2IHFA 4JG2A 5BN4A 2D5DA 4CQNA 3EFXD 4A3MG 3J7AF 4A3DG 1UE1A 2NVTH 2M9VA 1KXLA 2JYEA 1SEBD 3EBEA 2NMQA 4LMQD 5CR3A 2D0PA 2CHBD 3KFUA 5CGKA 2GOWA 4LW1A 4ANWA 4RCOA 2N9LA 3PIOA 2YTYA 2AX5A 3ZJTA 2N55A 3LGJA 1I7HA 2YLMA 4RMFA 4DR7Q 5KGUA 1FGUA 2QW7A 4DUZQ 3H94A 4IUMB 4JYAL 5D7GA 2LGXA 1LTBD 5IGEA 2B63H 1ZP0B 3M3JA 1K28A 3Q8DA 1Y8PB 4WAFA 4L63B 4Q2JA 1BT0A 1BMLC 1AH9A 4GU2A 5D94A 3MHZA 4BY7G 4GLXA 4A55A 5J22A 1ET6A 1E5WA 1WYGA 4LFBL 5A2QE 1SYFA 2HIVA 2ZT9C 2QSDA 3FPPA 1EWIA 4BBSH 5D14A 2F0OA 5M3FG 2JRHA 2K39A 2RHQB 3RNBC 1SNOA 2WXKA 4MH8A 3ZW3A 1KHIA 3W9CB 1VQFA 2NBFA 1BQQT 4CBVA 2KDEB 2G9DA 2LXCA 1ML0D 2JA6B 4DV0L 2JZZA 2KMAA 3QOJA 1FO4A 4FXGC 1ZEQX 3AB9A 3GQBA 2Y5PA 1Q12A 4MH0E 4Z9CB 1HEZE 1FXIA 1D5ZC 1D5MC 3MVVA 1JICA 1K51A 2YEPB 1VCBA 1TKWB 4C3HG 2O2VA 4MT5A 1QZEA 4CKEA 1CK1A 1ENAA 3AEGB 3J80c 1C4QA 3MTSA 1E0ZA 3PO3B 3OOCA 2E5LL 5FJ8H 2INDC 3IFWB 2WYQA 3GV3A 3M4YA 3A0JA 4O0AA 5KNCA 3VA7A 1RRBA 1PZKD 2FINB 2N1WA 3DHGC 4IC7B 1JOOA 1YQBA 5H92C 2UUBL 3BINA 4B3ML 4C80A 4QUCA 3FC4A 3S16H 2JK8A 4LNNA 2KANA 4F87A 2LHEA 3A7AB 1GHKA 5FR6A 2EKEC 3PUYA 4GMVA 2UU9Q 3PMFA 1EY0A 4WWOA 2MGSA 1VQGA 3S1NB 2LZ6A 2KENA 2JWUA 5K36G 3GD7A 4RKBA 3PUVA 1RTNA 2KQ3A 3AFPA 3PV0A 3AULA 3CSTA 4RCNA 2YEPF 3IAS1 5CTRC 1IP9A 4HCSA 1EQTA 2R92G 4XX5A 5FO7B 3QHTA 3HKZE 2C7HA 4POGA 2F52A 3DXJC 1JWUD 4YT0B 3J81E 5ELOA 1VZ7A 1W6KA 2F0EA 1HZ5A 1SE8A 3DBHI 1N33Q 1FMAD 4A3IG 4B3TQ 1E24A 3HOZG 1NR2A 2IYDB 1JRPA 1VZ6A 2N1VA 5LMNW 3VFKA 5IP4D 3MXNB 4BWGB 4K7SA 5C4XG 3NK9A 1TWHH 2KOLA 4LNQA 4GKJL 2QGQA 2HDMA 1D6EC 5EE0A 4UDUC 2ALYB 3KF8A 4HIDA 1WZ0A 5C3EH 2B2WA 1TBEA 2PE9A 1R4QB 4ZOHC 1Y8OB 5J39A 5J1ZA 2BF8B 1V43A 5GMVA 3MC0B 4BS9A 2CU1A 3N1YC 2F0SA 4GOPA 2MRPA 4KSKC 1B1ZA 4ZDVA 2WXRA 3U7ZA 4XQJA 3UIPB 4MACA 3M9BA 5IWAL 2RKSA 1IKLA 3C0RB 1T9HA 3I72A 3NEMA 2FCSA 3RFZB 3S15B 1WJUA 3UQAA 1TZ1A 4C3IB 1Q82C 3OHXC 4DHJB 3FKIG 1N6ZA 2PZUA 1E3PA 3W5UB 5I9OA 3PPAA 4HRSA 1ISNA 4LFCQ 3F2UA 3N3KB 2ZW1A 1A8VA 1QT9A 4GNXA 3S1RH 2BVCA 1LACA 2FUHB 1QKZA 3RNEC 1FCLA 3KDFB 2E8GA 3J80i 4MGIE 3P7JA 1SXTA 1G2SA 1TR5A 4JK1C 5CV4A 5I9PA 3HOVB 4MZ9A 1VQ4A 3P75A 2VL6A 4NXNL 5FO8B 1SE3A 2DJGC 2CJOA 1F2ZA 2RQXA 3CKIB 4WIPA 1D1IA 3S2HH 2Z6BA 3CD6A 1SB3C 4FJYA 2CU3A 1RCVD 3AU5A 2HCIA 1HJPA 2G5DA 1CT1D 5IGFA 1C77A 1WGDA 1YJNA 4NPNA 2F0VA 1PYBA 1Q3LA 4B0MA 3NENA 2B2VA 1C4CA 3FAHA 3L2PA 2MP2A 3UGBB 2XWJB 1SFOB 1LYLA 2QILA 3E0EA 4DGZA 3F2BA 1GD7A 2V4DA 2NVXH 2PW5A 3R3MA 1YNJC 3LWEA 4L2YA 1J7AA 2L0FA 2K04A 3K80C 1F2MA 2KFJA 2JA7G 2EY1A 3VR9B 5ELDA 5FO9B 3BVZA 5FLXL 4K5XA 1N36Q 4JI5Q 4UAIA 2KJ6A 2W82A 2OEDA 2MW5A 1L1OA 1DJRD 1C48A 3IXSA 1PZJD 4IFDI 1ASYA 3EFUA 1O7LA 1Q46A 4CKCA 2JA5H 1IYJB 2JXTA 3CIRB 2J0KA 2DBYA 1HR0L 3HK0A 3NG0A 2NYZD 2QMTA 3HOUH 3HFZB 3AU7A 2IX0A 5IOCA 3RN5A 3ETRA 5IYCG 3A5UA 2KAJA 4ULLA 1V1QA 4DAYB 3AU4A 4ICUA 3PZDA 3S14H 1B3QA 2OF1A 3VRBB 2LVOA 3MJWA 1GKHA 2HHHL 1J0GA 3I63C 3Q14C 2V1YA 4M8AA 3BVMA 3CC4A 1FEHA 3R66C 3P1HA 5HFYA 4A3JH 5I6YA 2XSCA 3M62B 2V3PA 4K1RB 2M17A 3ZQ4A 1SE2A 3A1QA 4EQNA 1HNWL 1JT8A 3RNGC 4JI4Q 5BMGA 1ZXIA 3H1UA 3TEHB 3B08A 2B63G 5C5MA 2KDFB 1HPCA 4OIKA 2AL6A 4BBRG 4DDGD 3H7PA 2K03A 1E0BA 3CMAA 1KFYB 1OQYA 2EYOA 2IW3A 2Z8LA 2KMCA 1YNNC 4V190 1PTOD 4EZJA 3VVWB 2M0AA 4KSLC 4DR5Q 5DEHA 4FA6A 2RHSB 2GBJA 1IYUA 3KYDD 1HRJA 3MFGA 3P1MA 2WAQG 4ZK9B 4E6IA 4TMAB 1L2NA 4EE2A 1GB4A 1I4XA 2UXDL 2NVQH 2KC1A 1PYSB 4PZ6A 4IPCA 1RYJA 3SK8A 2TMPA 3ZUNA 2HTHA 3OLMD 2OQKA 2L83A 3PO0A 3S1QH 3U8ZA 1B9MA 4I6NB 2WXMA 3QWNA 2VQFL 1NBFC 4IKGA 1F9SA 1X3EA 2JSVX 5DPTA 2ZJPA 1PZID 1ASZA 1LXDA 5G2NA 1N34Q 5CBEE 1L7YA 4H13C 5FJ8G 4OELB 3JYUA 5LMNL 2FCNA 1WGYA 1JCKB 3D3RA 2YU9B 1SNCA 2C5CA 2O6VD 4AWJA 5GROA 1K8GA 3NTKA 1VQMA 3AQQA 3KLRA 1XT9B 5C6AA 2KD0A 1M4VA 2B8FA 1SNDA 3JAML 3Q3NC 2WXJA 2F4IA 3G48A 4KK7A 2JEAI 1QVGA 1SNQA 3RLFA 2JRIB 4PS3A 2CQOA 1BO0A 3BYTB 3NS8A 3Q3MC 2QIEB 4ICVA 3H3VH 2KVZA 2WP9B 2DGYA 1WYDA 2AQ3B 1EIHA 3V61A 2EJMA 1SMYC 3V6CB 4GOCA 3O65B 2J0JA 2JUOA 4KKUA 5M5YH 3RZOH 4DK5A 4YWLA 3Q3JA 4NQLB 4EZLA 1AE2A 1AARA 3ND9A 1H9MA 5K5PA 1VQHA 2F0UA 3RULA 3DCGA 3TL5A 1BKBA 4YWGG 4G4KA 3T56B 2HQLA 3R7QA 2C7NB 3NQTA 5CHFA 4TUUA 4AIMA 3NJTA 3FP9A 2X8XX 4YSXB 5EE9A 2LD9A 2L1AA 1VQIA 1TWGB 1E8WA 2KMMA 1HCZA 1IKMA 1HTQA 4HJGE 4DR4L 1ESFA 2OJWA 1R9TH 4IUNA 3B1LX 1VQ7A 4N9F4 2OCEA 1TWFB 4OO1I 2NUCA 5IKCM 5C3EG 1WTRA 3BVGA 4J1MA 3ABVB 3PIO3 1JWSD 1K0RA 4DV1Q 2N0SB 5EDSA 2JA6G 1KC8C 1OEYJ 4A3DB 5E1FA 1Z47A 4A3MB 1EQQA 2M8SA 3VR2A 4FF2A 3I4LA 1AWDA 1XTDA 4AUQC 1OXUA 2KVRA 1WD1A 1V97A 1E7ZA 2Y0SG 4IJLA 1I94Q 1H4RA 1OQQA 2MLBA 4IURA 4JOIC 5CV9A 5JEAJ 2UXBQ 3W3AA 5DAUA 1K3BC 1G291 5KNBA 4KY7A 4E74A 1BUVT 2KWCA 1L5PA 4JIOU 1IBMQ 2CWPA 3NBHB 1WXMA 3KW5B 1QF6A 1STAA 1RFKA 2KA7A 3CCSA 2KOXA 1U4MA 5CMDA 2A6ED 2DYMA 2NCNA 1MKHA 1JORA 1STBA 2LXJA 4QIWE 1II3A 3ZRCA 1JJCB 4BY7B 4ABNA 2MNAA 5JJKA 4BBNF 1B4OA 4DF7A 3I91A 3VR5A 4ACFA 1AEXA 1QUQA 2NZOA 3AE1B 5FLXE 2XVSA 1CZWA 1TKYA 3DWAA 3HM3A 3UI2A 1KABA 3CC2A 3C19A 4MEMA 2RCNA 1OGWA 3RT3B 1E1TA 3RPFC 2K5QA 3GTMB 1XLOA 3NY5A 4PK1A 2D3AA 1BCPB 1H95A 5M3FB 4HIOA 2K8CA 2WDRB 1WTHA 2EZVA 1LTSD 4XE0A 4WWNA 2DNCA 3OG5A 2E2IH 3U7DA 4JQWC 4X64L 1L0VB 2IO0B 3UDXA 5BR8L 1NR4A 3NHEB 1ICWA 1WXAA 5E6PA 1Y1WH 3VYRA 3KUDB 4C3HB 1VQJA 3IBEA 2V9HA 1DYQA 2A68D 5CHWA 3H91A 4RM9A 2Q2TA 4S17A 3GTPB 4DA2A 4HJ9A 3HVDA 1ZXTA 4Y7NB 4N9PA 2QJLA 4FADA 4DNIA 5M5XH 3A74A 3I2ZA 4XYOA 3DLLA 4KV6A 4O1NA 1OFFA 1EQVA 2KNBA 2JA5G 3A8JE 3LX0A 2ZM6Q 5GAGC 5HI1A 5J2RA 3AV8A 5IO9A 2IL8A 4WRDA 4JI6Q 3HOUG 3ZXRA 4RF0A 3VR3A 2JZPA 3K57A 3K59A 2E74C 3MXUA 4GLVB 1GXDC 3CWIA 3HP3A 3K5LA 4P6VF 4NB3A 2R92B 4HCEA 1LT5D 2PPBC 1FVIA 1OTCA 4DHZE 1WMHA 4GDKB 5T8IA 3T13A 3E9IA 4YCVA 1XYIA 1Q8KA 3GE3C 5COYA 4A3JG 1B9RA 3LB8C 1PDXA 2AUKA 4A3IB 4LF6L 3HOZB 2B2YA 1ET9A 2HJ1A 4IWPA 5CHVC 1CHQD 2WU2B 2R93H 2EYPA 2FE8A 1PYWD 2F0KA 4MTKA 4UPAA 3J81i 5C4XB 1FD7D 1KM7A 1ZPSA 2LGSA 4DK3C 1GUTA 1QWYA 4XQQA 1I42A 3QCAA 3V62A 1EU3A 3MXGA 3HOXH 4JWUC 4OXPA 3SE0A 2AYOB 3N30A 4QMGA 1C79A 1NEKB 1G91A 2ZXPA 4R3DA 2XEWA 2YTVA 1V9PA 1EYDA 3VR6A 3ZYYX 1VQ6A 1Y8RC 3H3VC 2WXNA 2BH2A 1R4PB 3L08A 5L83A 1E9MA 1L0WA 4FVMA 1G8ZD 3CXCA 1YJWA 1I4HA 2CW0D 4IO9A 4CDEC 2H88B 3AE6B 4OL7A 1UNSA 2BGFA 4DV3Q 4DV5Q 1ROEA 1V5OA 1V80A 3I73A 1XCTL 2ICIA 2WXIA 4DV4L 4KGRA 3PQIA 3T53B 4ZYSA 3T4AC 1HFNA 3FKIB 1GUSA 2G4SA 1WY8A 3NP8A 1LLRD 3IT6B 2YYZA 3V3XA 4A9AA 5A2QL 2A1AA 1VRAB 2LGDA 3PV1A 1B2TA 2LUMA 3KVFB 5E6NA 2PTLA 3AM9A 2SNSA 1P8LA 4JI0L 3K81C 4Q5VA 5CV6A 5MPOA 2CJNA 3D8GA 2NPTA 1SLJA 3CQZB 3RD2A 4PS7A 4IN3A 3TP7A 4HIKA 3T1YL 3S2DB 3HZXA 4GKKQ 3H9DA 3NTHA 1XQQA 3I8ZA 2K5PA 1Q86C 3S17H 2FXQA 4MGZE 5AZHA 3M85A 2N4FA 5C44H 2ASQA 4BFRA 1C1YB 2NS5A 4LNFA 1CQVA 4IPHA 1R4NB 2KYWA 2LFIA 4KD3A 5A35A 4KN4C 4P75A 3K5NA 3L7ZC 2F0DA 1YEZA 4R4QA 1OEYA 1XPOA 3ICEA 4HEA1 4FJZA 2B2WC 3T1HL 1L0XB 3IT4B 1RL2A 2F4VL 2CHZA 3RZFA 3DUZA 3B0AA 1C9FA 5AFWA 1N61A 3EQLC 1TGZB 4G11A 1TYGB 3GOEA 4HJAA 1PH5A 1S3OA 4GOPC 4YSYB 3D4RA 2ACZB 2Z1CA 4KKTA 1KRHA 1R4NI 2KZRA 2LVPA 5EBDA 1MSGA 3A55A 3B6YA 2JA7B 3HRDD 3PS6A 2HUGA 2WKDA 3TEWA 2LGYA 4HXDA 3STBD 3S9WA 3H6MA 2E76C 2L12A 4DN4M 4DNRB 2UXCL 2BPSA 4A93H 4US9A 4OWTB 4QL5A 2BQQA 4KVGB 3JSVB 3RN2A 4L5SA 4OGQC 2OTJA 3AMZA 4A3GH 2FAZA 4ODGA 5KEEA 1V8CA 3TBLD 3TEXA 4TVAB 3J81L 4TQ1A 3D4WA 4DUYQ 2R7ZH 3DBRB 3IG3A 1E10A 3M4OB 1OQRA 3GZNI 4H02A 4GNXC 3L9AX 3BK2A 3RMKC 4FP5D 4L5RC 1HA6A 1WFYA 1NBWA 2VB2X 4A3EH 3MEFA 5M5WH 3P20A 1HFGA 1LT3D 5C0XJ 2NVTB 1AFPA 2K01A 1WM2A 4B0EA 2WFWA 1SYDA 3F8TA 3SR6A 1GUAB 4RF1A 1GUOA 2J7QB 3IVFA 5IP9G 2F03A 4DR3L 2E2JH 1VF5C 4O2DA 2LS01 5ELFA 1QQRA 1NMFA 3AE9B 1EQRA 2SOBA 4J6IA 1YVCA 1HE8A 4BBNC 4WWMA 3J7ZC 1FR3A 3FEWX 2L11A 4HTHA 3QIJA 4WURA 1CUKA 1K3RA 3Q8EA 2B2VC 4IG7B 2JQRB 4TKOB 4GXBA 3NVVA 1ENCA 1I50H 4ZLTF 4DV2Q 1MHXA 3DVNU 1I4PA 2B63B 4PZ7A 2K6DB 4KKSA 1X3PA 3J81j 4J3OD 4CHKA 5JJIA 1KDCA 4GN5A 1Q81C 2IDYA 4D2KA 1WJ4A 1EYAA 3A4SC 3OMCA 1LUZA 2AMCB 2F0JA 2ZPYA 2PYKA 4X3TA 2X6LA 1VZ8A 2K0PA 2BCOA 1L1OC 3V05A 2WAQB 1KNEA 3M4QA 1NVID 5BN3A 1OXVA 1F9PA 4DAPA 4HJ8A 1HZCA 4A3FG 3EHVA 4ANUA 4AQYQ 4DNTB 2B2UA 3H09A 1IL2A 2BA1A 4C3JH 1G6ZA 1YNTE 1WTXA 2KWUB 2W54A 3WIMA 3WOFA 1I3QH 4POFA 4XQNA 1ZDXA 2KK8A 2KVMA 4CDDC 3C8YA 4PYZA 2KCMA 5ISRA 5IA7A 1Y1WG 2EXZA 4KY6A 1BVSA 4LNIA 5I4DA 2MBHA 3QG1A 1GC6A 1YN5A 1UELA 1FFUA 1HNZQ 4WJWA 3M7NA 2I5HA 4QY7A 4B3RL 4LCDE 1GJZA 4KJNA 4YY3Q 3L0OA 1P1AA 3HRZC 3D6WA 4A3KH 3VYTA 1EUVB 2RDHA 4IOAA 2NBUA 1MJCA 1YJ1A 3E9SA 4P74A 1UWVA 5EPLA 2AWOA 1SNMA 2RVLA 3ZIMA 5H8YE 3S16B 3DBSA 4LFBQ 3Q8CA 2KHJA 2L00B 2DYBA 4II2B 5C4JH 2O6VB 3RZDH 3DHIC 4HEDA 1XMQQ 1N63A 3RZWC 1GOZA 3GE8C 5F2DA 1T0YA 4DFAA 4DR1L 2ZXOA 3HKSA 2JA8H 5HKHA 1F77A 2R2OA 1D5XC 1LTGD 3HG9A 1WCMH 1HR0W 1UF0A 1P0RA 4KV2A 1A0IA 4DKAC 5JXVA 3L16A 1OXXK 1V1PB 3ZO5B 4C1NI 4LK0M 2VZKD 4MM3B 3B9JA 5DM63 1D3ZA 4OX9L 4DWFA 1P7EA 4LFAL 3AXCA 3QB3A 5DLQE 3CF5A 1YX6B 1LGRA 2BB5A 1DOMA 1ZDVA 2UUBQ 1SF0A 1TWHB 2WXLA 2ZPNA 4HDQA 3D31A 2ZJQA 3HOXG 3TZUA 1PTOH 3GTLH 3PGEA 1GUGA 3VA5A 3K7UC 5EKKA 4BY1H 2KQ7A 4JI8Q 2ES2A 2N9PC 5C3EB 2PE6B 4IUQA 1PH2A 2DZMA 3AE3B 4ZUJA 2QKIC 1EYCA 1Q1EA 2JYOA 1F52A 1KH0A 1SE4A 1X1MA 2DZIA 4JV5Q 2R7DA 2KLCA 3W1SA 3CPFA 2VXWA 3TP5A 3H6NA 2D3GA 1O7IA 3BU2A 2UUAQ 5BMIA 1BBXC 2PQAB 2Y0SB 1KF6B 1I6HB 2D5GA 2LMCA 1Z5SB 3X3NA 1E8ZA 3QA8A 1SE9A 4RNAA 5BYRA 1GNUA 1CQFA 2VH2A 3S1MH 3D32A 4YSZB 4DQOC 3CRLC 1TVXA 2R61A 4XGAB 3D4DA 3MC8A 4JCVE 3GTGH 3KWVA 4W9LA 4DR7L 1O80A 2LEKA 1F9RA 4DAMA 2QCZA 1YNXA 4DUZL 1BBWA 1IYVA 2MH7A 1N9WA 3NPPA 4PV1C 4DDID 4A75A 3DBHB 1WRDB 3UI3A 2ZVNA 1E1OA 3MEHA 4FN2A 3PT2B 1BBUA 1K8MA 3M3YH 3V60A 4K0KQ 3RNFC 2KTRB 5HY6A 4BAXA 1YMHE 3DEPA 1F2RI 4C7YA 1G6JA 3PZ8A 3S2HB 1KNAA 2TSSA 1WFQA 5G3LF 3KF6A 1KLVA 1A2UA 4JC0A 5CV7A 4A3BH 1HZBA 3Q6SA 2M4NA 4U68A 4W9JA 3ZJYC 4ZRZA 2F0TA 2V4LA 3EROA 1VQKA 5IN7A 2EIFA 4IOIE 1FL0A 4A3CH 2DWQA 1WTPA 3UDIA 1PXUA 3ZJUA 2X6GA 4I7ZC 4DR2Q 4JI1Q 3JAMc 4WH4A 3ZGZA 3VR8B 2NVXB 2OJRA 4YHHQ 1STNA 5FK9C 2BWES 4RMAA 3NSWA 3VTVA 4X66Q 4JBWA 2QA4A 3SXHA 3QC8B 4WJPA 2XGTA 3U9SA 3N1ZC 3A33B 1IL8A 1KDBA 4WJOA 2WX0A 1YBYA 2Z0SA 1FXTB 2LWPA 1WX9A 4DU9A 3Q69A 3LWUA 4WJQA 3VXWA 2HCCA 2XRQD 2K4KA 1EIYB 2D3CA 2XTIA 1DGSA 2PCFB 5LMUQ 2N3SA 4WJ4A 2Y5BB 5DPSA 2PW9A 4P72A 4A3GG 2JA5B 1ZYRD 2K28A 3DHQA 1NAPA 3VDZA 4ILWA 1BOSA 3OYYA 1HHVA 4AQ7A 2MJDA 3HOUB 1FPYA 2R7ZG 3TRZA 5JEAH 3RLOA 3RR5A 1U4PA 4LNOA 2QHOA 3FILB 3ND8A 4ME3A 2UU9L 4KHPQ 1XX8A 1HUMA 4AYBB 3S14B 2Q8RE 4A3EG 3L4PA 4EQOA 4GN4B 1Y14B 2XBBC 2KWVB 5CORA 4LUVA 4AH6A 2FMMA 5JPMC 4UY8C 1KD1C 1GB1A 2PZWA 4A3JB 2XK5A 5JAVA 1JE5A 3RUIB 4C4VB 4NJ6A 2GA4B 4DBGA 5JZEB 2G4DB 2KEDA 1N33L 4B3TL 4BA1I 2QF7A 1IBXA 2F0MA 2WIIB 2JP1A 1GM5A 1M8AA 2QDBA 1WVLA 3M95A 5FR3A 3BZDB 2DNEA 3GTKB 3IL8A 2OTLA 1SIFA 1G6PA 2JA9A 3KWLA 1CM9A 4G7ZC 1QJOA 2JE6I 2C9WB 2FIDA 4CO7A 1NY4A 1OTRB 3UDGA 3I4NH 2C9OA 1T0QC 1CKMA 2PMZB 1WGKA 4NKLA 1FRRA 1WYWB 4JE3B 4KJOA 1STYA 1YJJA 3NVZA 1YJIA 2MQJA 2IO1B 5ELNA 1YD8U 1J7BA 2DAFA 4V0BA 3AH7A 5E7NA 2NVQB 3CC7A 2OOBB 1I35A 1CSPA 2XNAC 2GBRA 1X32A 4WJ3M 3IFTA 1PFNA 4JBMA 3PREA 3RLNA 3I3CA 4C3JG 3APDA 1QOAA 4C56C 3S1QB 3I5JC 2EY6A 1TQOA 3A8IE 1V49A 2KDBA 4XZ4A 3JAMi 3AYHB 1YIJA 3H0GH 3QIAA 5LXIB 1SJHD 1PTOC 4B9XA 5GAHC 1EY5A 1MI0A 4X65Q 1IBKQ 4RFBA 5J18A 5IYDH 1FNWA 4LFCL 3PVLA 1EY4A 3QO2A 5NUCA 5EQ0A 3RUZA 1K9MC 1ILPA 1T6BX 3U52E 2BA0A 4A3KG 1KIXA 1C76A 1YX5B 2KXJA 3I70A 2G9HD 2B2YC 1LV9A 4B95A 5LNK1 3P42A 1TTNA 2BWFA 3CCLA 2L0TA 3CF6E 1KL9A 2Y5CA 2BBCA 2ID0A 5JPNC 1FNUA 4MNOA 2N9XA 3PLUA 5EGTA 1NTGA 3H7SA 4II3B 5GAEC 1DONA 1ZUD2 4I7AA 3BZCA 2O2VB 4PT5A 4HR7B 2KJRA 2BYTA 4TRDA 1PMRA 1NI3A 3N32A 3KBGA 1Y1VH 1S5FD 2C35B 3GTOH 3OIPA 3DVGX 4RG1A 2UWQA 1WR1A 2RCFA 2JA8G 3S15H 4L6TB 2A73B 4DK0A 2CCZA 1WCMG 3RZOB 5M5YB 1DOIA 4NMZA 3AEEB 5AZFA 2N7EA 1TS3A 4ASWC 1RHPA 3ER0A 1QZHA 4DR6L 5E6OA 5EPJA 1K83H 2KCTA 2Q2HA 1GC7A 2H4OA 2FUG1 4EFOA 3G4SA 4W9DA 2Q8TA 1VR9A 3H3VI 1YHBA 2OQ0A 3MWYW 5GADC 1ZKOA 1N60A 1N36L 4JI5L 2KTFA 3OJ4B 1EYGA 1IW7D 3MTNB 3PIPA 2MHJA 4LDTB 4N9TA 4MELA 5C5LA 2JX5A 1NYRA 1R9TB 4BBSG 4IPDA 3OAWA 4JBJA 3DM3A 1EY9A 4JI7Q 1PLFA 1KAAA 2F0FA 3NELA 3QR8A 3DOWA 3NVYA 1QOHA 2ASBA 4LF5Q 4HROA 3FKYA 1Q1OA 5D3IB 3ML9A 2KECA 1GUWA 2J7ZA 3GDEA 1FIQA 1I4QA 4L8JA 4R8NA 2K14A 3UF8A 3CPWA 4MJSB 2VQEL 1W3SA 1QILA 4DV7Q 4X62Q 5C1ZA 3CP0A 2JJQA 1EO6A 2W3RA 1XLQA 2MPMA 2F3WA 2E6XA 4JW0A 4OHJA 4JPSA 1Z9FA 1S72A 1NJIC 3PTFC 1B8AA 2WHIA 3U9OA 2GBKA 4K8IA 3KF8B 2D11A 4FXCA 3SDZA 1SSOA 1IHZA 2WB1G 2EE1A 1N62A 4P73A 2UUCQ 1EZ6A
chains in the Genus database with same CATH topology
4A6QA 1RJTA 3QOLA 4IUVA 2L4NA 1CA5A 2A69D 2NWGA 4C2MB 3EVQA 1WXQA 3MXPA 4HKZE 1XLPA 1AYFA 4KKIA 3AEFB 1F2RC 1EWYC 3N9YC 3NS1A 3IAYA 5I2YA 2PNRC 3SEBA 4YTNB 1LTTD 4KGSA 2IPKD 2DY8A 1RF2D 3BWUD 4A3FB 4XTCS 2A6EC 2M2LA 2E2IB 1H9KA 3MJ5A 2KWDA 2EYMA 1Y1WB 4IZ8A 3GV6A 4PMCA 5KYLA 1KTKA 2XIWA 2SNMA 1F0ZA 4R9WA 4HSPA 3CRKC 1XO3A 1WRIA 5IT9L 4CGYB 5M5XB 2KCCA 2DN8A 1NCVA 4ZUIA 3SK5A 3MP9A 2BS4B 3RMHA 3CHBD 3Q22A 1G2TA 4WFN3 2BOSA 4A8XC 4TQ0A 3NUCA 3B2GA 4USAA 4P2CB 2M00A 4REZA 2A68C 1BF4A 4RGTA 2IGDA 2KEEA 2L9HA 2J0TD 3N6RA 1RWSA 1QNUA 3MZ5A 4TSSA 1CJEA 2NB0A 2BB6A 3TN2A 1GPXA 2F0HA 3AMUA 1EM7A 1FRDA 2O4XA 2R93B 2B2UC 5AUIA 2MP1A 5E4XA 1EZ8A 4LK1C 1TY0A 1LT4D 1GUNA 3HOXB 3MFYA 2WXPA 1QOBA 4XDDA 5I6WA 1H9SA 2RPVA 3OWFA 1YN4A 2PIAA 2BE5D 1N5XA 4ZHPA 1C8CA 5EE1A 2INPE 4HMJA 4HMIA 2SEBD 1QLBB 4RHSA 2L1BA 1U4RA 5BN5A 2LHDA 2WQYB 2M56B 4MN3A 2DY7A 3OSOA 1E7PB 2EVBA 2QEJC 4YXDB 2CW0C 4N58A 1ZXHA 3LNNA 1XF5L 4KGTA 3BDOA 3S17B 4K2KA 4LLGM 5C44B 1PGXA 1VMPA 5E3FA 1WD0A 2INNE 2N88A 3E0JA 4XIGS 2G1EA 4RKLA 1JOQA 4G7OC 1DOLA 3AB5A 4IUPA 1Q90A 2R3ZA 3NBIA 1A6XA 2K3UA 3K5OA 3J80E 5C3JB 4ARIA 1OO9B 4FXDA 1L6UA 4X3SA 2DYOA 3HS0C 2JXMB 1P7FA 5ELEA 4A3GB 3W5VB 2WINB 1TY2A 1Y56A 3TDQA 2HDEA 1S5BD 1FGBD 2R7ZB 3SR1A 4LTUA 1SYCA 4MIUA 4B08A 2B39A 1BR9A 1TS4A 3C1FA 3NTIA 2AWNA 4QB4A 4A3EB 2KUMA 5C3WA 2J52A 1CFMA 2K33A 2F0GA 2K7VA 4IFDJ 2EOTA 2E2JB 3PUWA 3KQ4A 1K52A 4K8JA 4H44C 5LL6X 3NZ3A 1QG7A 1KLUD 2MJEA 3Q8FA 3NXWA 4EGVA 3A56A 1N5WA 1I50B 4FXKC 3DEOA 2EPBA 1PDQA 3VQIA 3IKJA 1V1PA 4DK1A 1GAQB 4X3UA 2Z4HA 2K05A 3SFEB 4KN7C 5IT9E 2EKIA 4GLSC 2A6HD 4PNYA 5EBCA 2F0LA 2CQAA 3K7AB 4ZKBB 1LO5D 3URYA 3TSSA 3T51B 4YTMB 3R2TA 2B2TA 3AEAB 1RM6C 1EWHA 1RODA 4H7BA 4C3JB 4HN7A 1SSNA 1S4ZA 1I3QB 3WOEA 1CI3M 2ENBA 3R2IA 4K5WA 1D1KA 4FF4A 2Y3AA 2B8GA 4NJCA 3BIID 4ITKA 4WQMA 1HA5A 4A3KB 5EKLA 1AZPA 3AE2B 2RDFA 4PMBA 1SIJA 3SVMA 1VF7A 3U4EG 1UWXA 5C4JB 3RZDB 1DD2A 2HDLA 2KCNA 3J7YW 4DXGA 2WDQB 5JJZA 4US8A 1UGJA 3P63A 2SDFA 3O13A 3R8BA 4LJZC 2JA8B 2DLBA 3DWGC 1WCMB 1E6EB 5I2XA 1R7SA 2IGGA 4KKJA 3PIP3 5M9OA 2JSOA 5C3XA 1LT6D 3K58A 1B9NA 2MUYA 3MXNA 3ITPA 1A3UA 5KRUA 1V8QA 5CC4A 3TEZA 1NUCA 4EVOA 2RA4A 1PTOB 1B44D 3GTLB 4BBSB 2WU5B 4BY1B 3ZGZA 4FF1A 1QE6A 1PGBA 1QOFA 1T3QA 3MA2B 4CJ2C 2VNUD 3AE4B 1EY8A 3NVWA 4IQZA 2J42A 3B2FA 1E2VA 3AN1A 1VCIA 4PQXA 1GHJA 1TS5A 3PUXA 4IALA 3K0YA 3S1MB 4GZYC 1PRTC 4JWSC 2KACA 2EYHA 1RD9D 2WB1B 3Q8AA 1TKGA 2MEKA 5CBAE 3GTGB 2FBWB 2HTME 1PTOF 3NWTA 2LGIA 5EPKA 2V3NA 2K22A 5CV8A 3X3MA 3TUOA 1SAPA 4KTAA 4QUFA 1ACCA 3PZ7A 3DM1A 2I2YA 3WCQA 1PUTA 2WACA 4CKBA 3Q0AA 4A3BB 2KN4A 1FFVA 1LTAD 2OEOA 4IUTA 4OVZA 4OZAA 4HAEA 3AECB 1I6VC 1AP0A 1EY6A 1KLGD 4FNFA 4H2AA 1H9JA 3IAM1 2WV6D 4KI0A 1PRTD 2BTEA 2EYFA 1YQ3B 1XWEA 2F0IA 3QJYA 2FHTA 1O78A 1BCPD 2MHVA 2FMCA 1T5XD 2WKCA 4FF3A 5HHDG 2I38A 2EELA 5FKAC 2WLBA 1L0YB 3A7LA 2MJ8A 2NTSA 1WSPA 1MBYA 4DAYA 4G57A 3E5SA 1MPEA 2PMVA 5IGGA 3S1RB 1ZYRC 3NQIA 2D9UA 1ZOYB 2N9KA 4IDIA 3HEJA 3OWEB 2IJ0A 1FYCA 2AQ2B 1A70A 1EWCA 2EYJA 1Q8IA 1JWAD 1ONLA 2WS3B 2H1EA 3HKZB 1XLNA 2H89B 1XEEA 4N59A 3I4NB 5G5GA 4X3KA 2IGHA 3SK4A 2HQEA 3SHLA 1K8OA 3J9CA 1UWMA 3U2SC 3LXFA 4GDLB 4QCLA 5ELCA 1DOKA 1HTPA 3TEYA 2WXFA 1XXGA 1QOGA 4MHEA 3HVZA 1HXYD 1A3TA 2NN6I 4RGOS 3H0GB 3M7GA 1BXTA 1B3AA 2NZ1D 1HQRD 2PW7A 1LABA 3G7LA 1WTQA 4XDCA 5KIXA 4HSVA 4G7HC 1V1OA 2EJFC 2F0PA 3D6CA 3Q23A 2WDVB 3J7AV 3R3OA 2PQEA 2I46A 3DWQA 2W55A 1OXTA 2IX3A 4IUUA 5E6JA 2RBMA 3AEDB 1JROA 1A3VA 3V2TA 1Y1VB 3GTOB 1Y69U 1EEID 3GP7A 1FCCC 2EY2A 1JE4A 1IGCA 1K83B 3VYUA 4XWWA 4RGMA 4CJ1B 2NN6H 1EU4A 2I07B 4BA2I 3BDLA 3FVQA 4EQPA 1IUEA 3VR4A 1ZE3D 1EOTA 1JWMD 2J53A 2ZXRA 4U673 2J4XA 1STEA 4RWSC 2BW2A 2F3VA 1SYEA 3W2DA 5GXGB 5TSSA 3T3OA 1DOYA 1WWTA 5HGTA 1TU2B 1BNZA 1IW7C 1DXMA 1DGJA 1SBBB 3KK7A 5EKIA 2JEBI 2WXOA 1AN8A 1DZ1A 3NBHA 5IGBA 4C1NK 1HQMC 3EUB2 3A8KE 1C4AA 2LMCB 4N6EB 3GTJB 3GO5A 2EDGA 1IGDA 1C78A 5T1IA 4L23A 1O7ZA 3H8HA 1TT2A 3I57A 2RSOA 2ONQA 5EE3A 2PZTA 4RGNA 3NRZA 2A69C 2EY5A 3L3OC 1VLBA 5AUKA 4KX6B 2KDMA 3E56A 2IX1A 1YNJD 1W6JA 2K9XA 2L32A 3HGBA 2M19A 1E2ZA 2F0NA 2OXPA 5BMHA 3TMEA 1NENB 1QNKA 4L1BA 2VB3X 1L4DB 3P4RB 2A74C 3BG3A 1Q1BA 5EJWA 2LFNA 1MD2D 3J80L 4IFDH 1I4GA 1CTMA 5CV5A 1WTOA 1L6VA 2VUMB 2KHSA 5CYUA 3C46A 1SJED 3P4PB 1EIGA 2NTTA 2XRSD 4KY5A 3GS2A 5C0XI 4XT3B 2BS3B 1Z7TA 1E2WA 2ICEC 3VYSA 2B2TC 4K5VA 3E6ZX 1SYGA 5JOBA 3AE5B 4B9WA 1X3QA 1K53A 2PVGC 4OW0A 2NVYB 1QCBD 2BT6A 1MSHA 3TP6A 4H0LC 5IGDA 3GTQB 3TZDA 1JQ4A 3TBIB 5HG2A 2IT1A 4ZKCB 2E2HB 2R6GA 5C2TB 3NHHA 4J8QA 3AE8B 1YNND 1BDOA 1CA6A 1S5CD 1TIID 1TS2A 3NUHB 3A54A 1PFBA 1VDZA 1IBXB 1RDPD 1U9RA 3BS1A 2PO4A 4KMUC 2OT2A 4NDXA 4CJ0B 5BYSA 1XCQL 2L0CA 5C0XH 2JU6X 2BE5C 5JVH3 5JEAG 1JWBD 3FDTA 4DXFA 1PFDA 1A15A 1D2BA 4FO2A 4JX1C 2WP8J 3EA6A 5D3DA 4F88A 4ME5A 5T1GA 2RSNA 4M1UB 4YIJA 1O7YA 5G3LD 1CZGA 4TQUS 4AS1A 3BYYB 4ZRPA 4QIWB 5IGCA 3R93A 2Q8IB 1JC7A 1T5EA 2K32A 2VZKB 1STGA 1SMYD 1MVKA 2WNMA 1FD6A 4KHVA 4OIJA 5IODA 1RKNA 1JMLA 2V0GA 2WXGA 3KUPA 2WXQA 5JVG3 1PRTB 1Q10A 4K2LA 2N7JA 1WTVA 2FJ2A 3KBXA 2NN6G 1QB5D 5M3MB 2O5IC 4C7ZA 4XXEA 4F7XA 2BDNA 1AZQA 1HZ6A 4OZCA 1YN3A 4ZRQA 3HOYB 1D4BA 4RA8A 5BYQA 1VDVA 4OO1H 1LTRD 4P16A 4I65A 3T16A 3BDCA 3OIQA 5C4HA 3DMUA 5DM73 2E75C 1OXSC 1CZPA 1DM0B 1ENFA 4F8MA 2LY7A 1UEAB 4DAVA 1YQ4B 1SNPA 3DWPA 3EJIA 1PRTF 2BS2B 2O5JC 2X38A 2MJ3A 1UUPA 2XWBB 2Q5WD 4KD4A 4K6LA 3HUIA 1VJKA 4K6DA 2V4IB 3FRPB 2LJIA 4PMWA 2L55A 2A5HA 1BCPF 5IIFA 4XYQA 1GJXA 2D62A 3LYYA 3C1EA 3AE7B 2W3SA 2K6AA 1H9RA 4C3IG 1TWCB 4NAWB 1DCZA 4XWTA 1FNVA 4RHRA 3ONAB 2X69A 2GRIA 3OW7A 4A93B 2OHFA 3C2PA 1K50A 2QCPX 4LAAA 2XN9C 1TWAB 1ESRA 3BK1A 2A6HC 1Y8NB 4A90A 1JQYD 4ZHOA 1F2LA 3K6OA 5E4WC 1B53A 3G6JB 5LHY1 1NYQA 4CHTB 5M5WB 1EEFD 2PVOD 4S3SA 1F2YA 1J8IA 2D2CC 1MHHE 5LL6S 2ON8A 3KLSA 4KHZA 4NW2A 3I9V1 4O42A 4IFDG 1TJEA 3RD4A 2FFKB 3T3NA 1CHPD 1AW7A 3MAQA 2EJGC 3JAME 3Q8BA 1C4PA 2K5WA 1JR0D 2LKVA 3NE5B 1HTLD 2KJXA 2K1BA 4NZLB 2F1MA 1MGSA 4Q0FA 2L52A 4ARCA 2EYLA 5KYIA 4XDXA 1TZOA 1HUNA 4WORA 4M0WA 2GI9A 1S5ED 5K36H 2Z4IA 3HOWB 1XTCD 1EFID 2WXHA 1B50A 1LTID 3C3LA 3P4QB 4OZBA 4ZQ3A 5HURA 2PKOA 5DNFA 3SFDB 1PFMA 3OMGA 4J6HA 1STHA 4NP5A 4XT1B 4QF4A 2B76B 1H9SB 3MHBA 5C4ZA 3I4MB 1F9QA 1JOKA 3FPUB 3VRAB 3ERQA 2AQ1B 5C0XG 1MI2A 4R8IA 1Z6HA 1RTOA 1EY7A 3IFDA 1SDFA 1VMCA 5KNDA 1TKEA 2BDOA 3FMCA 3N52A 1ILQA 1S5DD 1SYBA 2O2LD 3KLSX 3K5MA 2KQ4X 3SK6A 1I4RA 3P4SB 2RMMA 1U4LA 1J7CA 3OPOA 1JW9D 4HKQA 4FYDA 1L4ZB 3WDNA 3V96A 2F0QA 4TQ1A 3NWSA 2AUJD 2IWHA 3PO2B 2ZW0A 2F0WA 5ELBA 1DOXA 2PLPA 1A2TA 1JB3A 2L5TA 4BBRB 3DWMA 4RH6A 1NSNS 3ZJVA 2RDGA 3AEBB 4K14A 4ID6A 1EL0A 4ZAIA 1PGAA 5FOBB 3I90A 5D65A 3EGRA 2E2DC 2JYTA 2K5DA 1JALA 1KDAA 4YTPB 1UAPA 1BUIC 3FILA 1FM0D 4OO1G 4RAUC 1WTWA 1FXAA 5G5HA 3TP8A 2E3TA 1J9OA 3Q24A 1BCPC 2CVRA 3M3YB 2GB1A 3PUZA 3GB1A 2SAKA 3CU7A 5BN4A 2D5DA 4CQNA 3EFXD 3J7AF 2M9VA 2JYEA 1SEBD 2NMQA 4LMQD 5CR3A 2CHBD 5CGKA 4RCOA 2N9LA 2AX5A 3ZJTA 2N55A 1I7HA 5KGUA 3H94A 5D7GA 1LTBD 5IGEA 1ZP0B 1Y8PB 4WAFA 4L63B 4Q2JA 1BMLC 3MHZA 4A55A 5J22A 1ET6A 1WYGA 5A2QE 1SYFA 2ZT9C 3FPPA 5D14A 2F0OA 1SNOA 2WXKA 4MH8A 3W9CB 2NBFA 1BQQT 4CBVA 2G9DA 1ML0D 2JA6B 1FO4A 3QOJA 4FXGC 1ZEQX 3AB9A 3GQBA 2Y5PA 1Q12A 4Z9CB 1HEZE 1FXIA 1D5ZC 1D5MC 3MVVA 1JICA 1K51A 2YEPB 1TKWB 4C3HG 4MT5A 4CKEA 1CK1A 1ENAA 3AEGB 1C4QA 3MTSA 1E0ZA 3PO3B 3OOCA 3GV3A 3M4YA 5KNCA 3VA7A 1PZKD 2FINB 1JOOA 5H92C 4C80A 4QUCA 3FC4A 4F87A 2LHEA 3A7AB 1GHKA 3PUYA 3PMFA 1EY0A 2MGSA 3S1NB 2JWUA 5K36G 3GD7A 4RKBA 1RTNA 3PUVA 2KQ3A 3PV0A 4RCNA 2YEPF 3IAS1 4HCSA 1EQTA 5FO7B 3DXJC 1JWUD 4YT0B 3J81E 1VZ7A 1W6KA 2F0EA 1HZ5A 1FMAD 4NAMA 1NR2A 1JRPA 1VZ6A 4BWGB 3NK9A 2KOLA 2HDMA 1D6EC 5EE0A 4UDUC 3KF8A 2B2WA 1R4QB 4ZOHC 1Y8OB 5J39A 5J1ZA 1V43A 3MC0B 4BS9A 2F0SA 1B1ZA 2WXRA 3U7ZA 4XQJA 4MACA 2RKSA 1IKLA 3I72A 3RFZB 3S15B 4C3IB 3OHXC 2PZUA 3W5UB 5I9OA 4HRSA 3F2UA 2ZW1A 1QT9A 1LACA 1QKZA 1FCLA 3P7JA 1SXTA 1G2SA 1TR5A 4JK1C 5CV4A 5I9PA 3HOVB 3P75A 5FO8B 1SE3A 2CJOA 1F2ZA 2RQXA 3CKIB 4WIPA 1D1IA 1SB3C 2CU3A 1RCVD 2HCIA 1CT1D 5IGFA 1C77A 2F0VA 1Q3LA 4B0MA 2B2VA 1C4CA 3FAHA 2XWJB 1SFOB 2QILA 4DGZA 2V4DA 2PW5A 1YNJC 3LWEA 4L2YA 1J7AA 2K04A 1F2MA 2EY1A 3VR9B 5ELDA 5FO9B 3BVZA 5FLXL 4K5XA 2W82A 4UAIA 2OEDA 1DJRD 1C48A 3IXSA 1PZJD 4IFDI 1O7LA 2JXTA 4CKCA 3CIRB 2DBYA 2NYZD 2QMTA 3AU7A 2IX0A 5IOCA 3ETRA 2KAJA 4ULLA 3VRBB 2OF1A 4M8AA 3BVMA 1FEHA 3P1HA 5HFYA 5I6YA 2XSCA 3ZQ4A 2V3PA 1SE2A 4EQNA 5BMGA 1ZXIA 5C5MA 1HPCA 4OIKA 2K03A 1E0BA 1KFYB 2EYOA 2IW3A 2Z8LA 1YNNC 4V190 1PTOD 2M0AA 5DEHA 1IYUA 1HRJA 3MFGA 3P1MA 4ZK9B 4E6IA 4TMAB 4EE2A 1GB4A 1I4XA 1RYJA 3SK8A 2TMPA 3PO0A 2L83A 1B9MA 2WXMA 3QWNA 4IKGA 1F9SA 2JSVX 1PZID 5CBEE 4H13C 1JCKB 3D3RA 2YU9B 1SNCA 2C5CA 3NTKA 3KLRA 5C6AA 1M4VA 2B8FA 1SNDA 3JAML 2WXJA 2F4IA 4KK7A 2JEAI 1SNQA 3RLFA 1BO0A 3BYTB 2QIEB 2WP9B 2AQ3B 1EIHA 2EJMA 1SMYC 4KKUA 3ND9A 1H9MA 5K5PA 2F0UA 4YWGG 4G4KA 3T56B 3NQTA 4YSXB 5EE9A 2L1AA 1TWGB 2KMMA 1HCZA 1IKMA 4HJGE 1ESFA 4IUNA 1TWFB 4OO1I 2NUCA 1WTRA 3BVGA 4J1MA 3ABVB 3PIO3 1JWSD 2N0SB 4A3DB 5E1FA 1Z47A 4A3MB 3VR2A 4FF2A 3I4LA 1AWDA 1OXUA 1WD1A 1V97A 1OQQA 4IURA 5CV9A 5JEAJ 3W3AA 5DAUA 1G291 5KNBA 4KY7A 1BUVT 1L5PA 1QF6A 1STAA 1RFKA 2KA7A 1U4MA 5CMDA 2A6ED 2DYMA 1JORA 1STBA 1II3A 4BY7B 4ABNA 1B4OA 4DF7A 3I91A 3VR5A 1AEXA 3AE1B 5FLXE 2XVSA 1CZWA 1TKYA 3DWAA 3UI2A 1KABA 3RPFC 2K5QA 3GTMB 1XLOA 1BCPB 5M3FB 2WDRB 2EZVA 1LTSD 4XE0A 2DNCA 1L0VB 1NR4A 1ICWA 3VYRA 4C3HB 1DYQA 2A68D 3H91A 3GTPB 4DA2A 3HVDA 1ZXTA 4Y7NB 4N9PA 2QJLA 4XYOA 4KV6A 4O1NA 1OFFA 1EQVA 3A8JE 3LX0A 5HI1A 3AV8A 2IL8A 4WRDA 4RF0A 3VR3A 2JZPA 3K57A 3K59A 2E74C 3MXUA 1GXDC 3CWIA 3HP3A 3K5LA 4P6VF 2R92B 4HCEA 1LT5D 2PPBC 4GDKB 5T8IA 3T13A 1XYIA 5COYA 1B9RA 3LB8C 1PDXA 2AUKA 4A3IB 3HOZB 2B2YA 1ET9A 1CHQD 2WU2B 2EYPA 2FE8A 1PYWD 2F0KA 2QSDA 5C4XB 1FD7D 1ZPSA 1GUTA 1QWYA 4XQQA 1EU3A 3MXGA 4JWUC 3SE0A 4QMGA 1C79A 1NEKB 1G91A 2ZXPA 4R3DA 3ZYYX 3VR6A 1EYDA 2WXNA 3H3VC 1R4PB 1E9MA 4FVMA 1G8ZD 1I4HA 2CW0D 2H88B 3AE6B 4OL7A 1UNSA 1ROEA 3I73A 1XCTL 2ICIA 2WXIA 4KGRA 3T53B 4ZYSA 3T4AC 1HFNA 3FKIB 1GUSA 3NP8A 1LLRD 3IT6B 2YYZA 3V3XA 4A9AA 5A2QL 1VRAB 1B2TA 2LUMA 2PTLA 3AM9A 2SNSA 5MPOA 4Q5VA 5CV6A 2CJNA 3D8GA 3CQZB 4IN3A 3TP7A 3S2DB 3HZXA 3NTHA 3I8ZA 2K5PA 3M85A 1CQVA 2LFIA 4KD3A 5A35A 4KN4C 3K5NA 3L7ZC 2F0DA 4HEA1 2B2WC 1L0XB 3IT4B 3DUZA 1C9FA 5AFWA 1N61A 3EQLC 1TYGB 4YSYB 3D4RA 2ACZB 2Z1CA 4KKTA 1KRHA 5EBDA 1MSGA 3A55A 2JA7B 3HRDD 2HUGA 2WKDA 3TEWA 3S9WA 3H6MA 2E76C 2L12A 4DN4M 4DNRB 4US9A 3AMZA 4OGQC 4ODGA 5KEEA 1V8CA 3TEXA 3J81L 3D4WA 1E10A 3M4OB 1OQRA 3L9AX 3BK2A 4FP5D 1HA6A 2VB2X 5C0XJ 3P20A 1HFGA 1LT3D 2NVTB 1AFPA 2K01A 4B0EA 1SYDA 3SR6A 4RF1A 1GUOA 2F03A 1VF5C 5ELFA 2LS01 1QQRA 3AE9B 2SOBA 4WWMA 4WURA 1FR3A 3FEWX 2L11A 4HTHA 3Q8EA 2B2VC 2JQRB 4TKOB 3NVVA 1ENCA 1MHXA 4ZLTF 1I4PA 2B63B 4J3OD 4KKSA 1X3PA 1KDCA 2IDYA 4D2KA 1EYAA 3OMCA 2F0JA 2PYKA 4X3TA 2X6LA 1VZ8A 2K0PA 2BCOA 3V05A 2WAQB 1KNEA 1NVID 5BN3A 1OXVA 1F9PA 4DAPA 4DNTB 2B2UA 3H09A 2BA1A 1G6ZA 1YNTE 1WTXA 2W54A 3WOFA 4XQNA 1ZDXA 2KVMA 3C8YA 5ISRA 2EXZA 4KY6A 5I4DA 3QG1A 1YN5A 1FFUA 4WJWA 3M7NA 4KJNA 3HRZC 3D6WA 3VYTA 2RDHA 3E9SA 5EPLA 2AWOA 1SNMA 2RVLA 5H8YE 3S16B 3Q8CA 4HEDA 1N63A 1GOZA 5F2DA 4DFAA 2ZXOA 1F77A 1D5XC 1LTGD 3HG9A 5JXVA 1OXXK 1V1PB 4C1NI 4LK0M 2VZKD 4MM3B 3B9JA 5DM63 1P7EA 3QB3A 2BB5A 1DOMA 1ZDVA 1SF0A 2WXLA 1TWHB 3D31A 3TZUA 1PTOH 1GUGA 3VA5A 5EKKA 5C3EB 4IUQA 3AE3B 4ZUJA 2QKIC 1EYCA 1Q1EA 2JYOA 1KH0A 1SE4A 3W1SA 2VXWA 3TP5A 5BMIA 1BBXC 2Y0SB 1KF6B 1I6HB 2D5GA 2LMCA 3X3NA 4RNAA 5BYRA 1CQFA 4YSZB 4DQOC 3CRLC 1TVXA 2R61A 3D4DA 3KWVA 1O80A 2LEKA 1F9RA 1IYVA 2MH7A 3NPPA 4PV1C 3UI3A 3MEHA 1K8MA 1YMHE 3DEPA 1F2RI 4C7YA 3PZ8A 3S2HB 1KNAA 2TSSA 5G3LF 1A2UA 5CV7A 3Q6SA 4U68A 4ZRZA 2F0TA 3EROA 4IOIE 2DWQA 1WTPA 3ZJUA 1PXUA 2X6GA 4I7ZC 4WH4A 3VR8B 2NVXB 1STNA 5FK9C 3NSWA 4JBWA 3SXHA 3U9SA 1IL8A 1KDBA 4DU9A 3Q69A 3LWUA 2HCCA 2XRQD 2PCFB 2PW9A 2JA5B 1ZYRD 2K28A 3DHQA 1NAPA 4ILWA 1BOSA 1HHVA 4AQ7A 2MJDA 3HOUB 5JEAH 1U4PA 3FILB 3ND8A 1XX8A 1HUMA 4AYBB 3S14B 2Q8RE 3L4PA 4EQOA 5CORA 2FMMA 5JPMC 1GB1A 2PZWA 4A3JB 5JAVA 2GA4B 2KEDA 4BA1I 2QF7A 1IBXA 2F0MA 2WIIB 2JP1A 1M8AA 2QDBA 1WVLA 5FR3A 3BZDB 2DNEA 3GTKB 3IL8A 3KWLA 1CM9A 4G7ZC 1QJOA 2JE6I 2C9OA 2PMZB 1WGKA 4NKLA 1FRRA 4JE3B 4KJOA 1STYA 1YJJA 3NVZA 1YJIA 1J7BA 4V0BA 3AH7A 2NVQB 2XNAC 1X32A 3IFTA 1PFNA 3I3CA 4C3JG 1QOAA 4C56C 3S1QB 2EY6A 1TQOA 3A8IE 3QIAA 1SJHD 1PTOC 4B9XA 1EY5A 1MI0A 4RFBA 1FNWA 1EY4A 3QO2A 5NUCA 5EQ0A 3RUZA 1ILPA 1T6BX 3U52E 2BA0A 1C76A 3I70A 2G9HD 2B2YC 1LV9A 5LNK1 3P42A 2Y5CA 2BBCA 2ID0A 5JPNC