2BWES

The crystal structure of the complex between the uba and ubl domains of dsk2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, U
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bweS00
4K7UA 2LI5A 4ZYNA 3LJ3A 1WJ4A 3H7SA 4DHJD 3TIXA 4DBGA 2MP2B 1WY8A 1ZKHA 3DQVA 4GDKB 5L83A 3B0AA 2LJ5A 2GBJA 3RCZA 1RRBA 1WZ3A 4BFRA 5JH5C 3VTWA 3L10B 2C5LC 2D2QA 2LRWA 3NZUA 2CHZA 2HTHA 2MWSB 4RM9A 4ASWC 1MG8A 4KSKC 4PYZA 3UF8A 1F9JA 3IHPC 2ZPNA 4M0WB 5DPSA 2IO2B 2XK5B 2KD0A 2MLBA 2MRPA 4ZRJA 4BOSC 1NBFC 1V5OA 2K39A 3V61A 4GIVA 3SDLC 3PVLA 3KUCB 5AZGA 2KMCA 1WM2A 3PZDA 1YX5B 3APDA 3KYCD 2N1VA 2K6DB 3ONSA 4GGQA 1GJZA 1GUAB 4A3OA 2J0JA 2JZ3B 1V49A 3UGBB 2MSED 3ML9A 2KOXA 1EO6A 2Z0EB 1P98A 4HDOA 3AI5A 1EF1A 1WGDA 1WJ6A 3A9KB 2AYOB 2K1FA 4II2B 1Z2MA 1WX8A 2Y5BB 4TUUA 3PV1A 4W9LA 5G55A 1TBEA 3H7PA 3JSVA 1V80A 3R7QA 4A3PA 2K8BA 1JRUA 1EF5A 2KLCA 2LASA 4IUMB 5DPRA 4IWOA 3VUYA 4YL8A 2JZZA 4NJ6A 1E7VA 1HE8A 2DHZA 2EKEC 2KMAA 3IG3A 2REXA 4W9DA 3OAWA 5GMVA 2M4NA 4BKSA 2L3ZA 2JWZA 4WWNA 4CYEA 3VTUA 3VHTC 2KJRA 1YIWA 1T0YA 2Z59B 3BY4B 3ZTDA 2ZVOA 3VH4B 3EC8A 1UBIA 3W1SC 5CHWA 3PGEA 3TCAA 3A4RA 2LRUA 3ZNID 3TL5A 3JVZX 5DPWA 2UWQA 3NOBA 3APCA 4KIKB 4WQOB 3WAOA 4NAWA 1OGWA 3VQIA 3QC8B 4BVUC 2FCNA 2KANA 4EZLA 2KO3A 2NCNA 2M8SA 2DZIA 3DBRI 4GU2A 3ZW3A 5IAAC 3VDZA 2R2QA 2IO0B 2LGYA 2KNBA 4FULA 2C7MB 4XZ4A 3DBSA 2KJHB 2O6VD 3QJZA 3QARA 5BO4B 4FN2A 5D6JB 3WAMA 2D3GA 1RFAA 4KVGB 2GBKA 4FJZA 2LXCA 2BF8B 3M62B 3PT2B 4MJSB 3IVFA 3T9LA 5EDSA 1SIFA 1ISNA 3ZRFA 3HM3A 4F1SA 2GBMA 1WMHB 1LQBA 2ZJDA 2KFKA 2KX3A 4KSLC 1Z5SB 4X57B 3ZNZB 4NQKE 4WJOA 4BKSD 4EZKA 3V6CB 5LXHA 1WGHA 2MBHA 2IZVB 3AULA 1ZW7A 4DK5A 2RD0A 2FUHB 5JHAA 4MDKE 3L17A 4DHZE 2FIFA 2FNJB 2BWFA 3ECIA 3DPDA 3ZNHB 1S3SG 3K9PB 1D3ZA 4WJQA 2MCNB 2N4FA 2KJ6A 1L2NA 2PE6B 2K25A 2NVUI 5E6NA 2QHOA 3BINA 4FHJA 5DCNA 3ZNGC 2L05A 3A4SC 3EECA 1YD8U 3D32A 2V1YA 1UELA 2IO3B 3N30A 1FXTB 3Q3FA 2HD5B 1WFYA 3VFKA 2O2VB 2L76A 3GOEA 4K1RB 2LVPA 3QIJA 2XEWA 2KFJA 1WJNA 3QA8A 3TJPA 5LXIB 3R66C 2KQSA 4MGIE 1V2YA 4WJNA 2GBNA 2FCSA 2KTRB 1TTNA 3ZTCA 2IO1B 2CS4A 1E8YA 1YJ1A 3DOWA 1WX9A 2N1WA 1RAXA 1H8CA 2IY1B 4HCPB 4GDLB 2L7RA 2WYQA 4DDID 3QQ8B 3V60A 2L8JA 2YLMA 2L0TA 3A9JB 4IM3A 4JQWC 4AJYB 1YQBA 4JIOU 3WIMA 3U8ZA 5CHFA 5DPTA 1I35A 4A20A 4JLCA 2CHWA 4ZRKA 5AZHA 4GB9A 2M17A 4ANUA 2N9EB 1UD7A 3M3JA 1WE6A 4HXDA 5AZFA 2K8HA 3L16A 2HJ8A 3MTNB 4F8CB 4W9FA 4BKTA 4LJOB 1AARA 4URKA 1Q0WB 2C7HA 2LD9A 2KWCA 2MP2A 4DDGD 5J2RA 2A5UA 2ZCCA 1E5WA 4WAAA 4P7IA 2O6VB 2KDEB 1E8ZA 1J19A 2KDIA 3UIPB 4W9HA 3ZLZA 4LDTD 4ICUA 4KDIC 2BYEA 2WWZA 4B9KA 1VCBA 4MH0E 2ASQA 4K81A 4G0NB 4W9KA 2HE7A 2YVCA 4IM0A 4AUQC 2XK5A 3N3KB 1P0RA 4GSWA 4F7ZA 2Z0DB 3OJ3A 4E3CA 5CHVC 2KK8A 3MJWA 1J0GA 1RLFA 1WYWB 2ZEQA 3VVWB 3AU5A 3QHTA 3SU8X 2BGFA 3U30A 4IWQA 1C3TA 4NNJB 3HIZA 2KWUB 4TV3A 1XD3B 3L08A 2A4ZA 4II3B 5E6OA 1WXSA 4JGHB 2MW5A 3RT3B 4NAWB 4G3XB 4I6PA 4AOFA 2JY6A 4N9F4 2KDFB 1P1AA 1LM8B 2CU1A 2IYDB 4CO7A 2CR5A 1H4RA 3A9KA 3V62A 1NDDA 1WJUA 3X23A 3TBLD 1WF9A 2GBRA 3GZNI 4GN1A 2RGFA 3DVNV 3PTFC 4HPLB 4MSQB 3S2AA 3U7DA 1WIAA 4DHJB 2DAJA 3A1QB 3ML8A 1WXMA 3V6EB 5CX3A 4GOCA 4B6WA 3DCGA 3HK0A 4EKUA 3DVGX 1WRDB 3RYTA 4BKGA 2D10A 2I1KA 5D94A 4KZ0A 4DWFA 2KTFA 3QX1A 3KVFB 1GG3A 2PJHA 1XQQA 2KFKB 3DBLI 4KZCA 1IYFA 2LWPA 2N7DA 3ENEA 2W9NA 3JYUA 4AJWA 4LJPB 3EHVA 3IBEA 3NY5A 4E74A 3PSEB 2JRHA 3UINB 3PRPB 2BKRB 1GNUA 2IY0B 4IW0A 2DZJA 4KIKA 2L00B 2LVQA 2VRRB 2KC2A 5G2NA 4MGYE 2R2OA 2WDTB 1UH6A 4AWJA 4J6IA 3VXWA 2EMSA 1WXVA 2L0FA 4ANWA 3X0WA 2NPTB 3PLVA 4BBNF 3KW5B 1WI0A 4RM8A 4HWIB 2EMTA 3KUDB 1Q5WB 2N7EA 2FAZA 1L7YA 4LDTB 2N9PC 2C60A 1V5TA 2KQ7A 4GMVA 3SHQA 4ZRIA 4HK2A 1BT0A 4MJSA 1IP9A 2PE9A 4FADA 3PREA 2D07B 4G11A 2J0KA 1WXAA 1GC6A 3QAQA 3WA0A 2JF5A 4RMAA 2JUOA 2NBUA 3R3MA 1WMHA 3Q3JA 4TQ1A 3M63B 3VH3B 4PS8A 5KHQA 2LVOA 2KKCA 1I42A 2BWES 3NS8A 1E8WA 2V3SA 3UQBA 5IA7A 1WGRA 2LXAA 4EEWA 2J7QB 2RPQA 4IG7B 3KUZA 1PQSA 1IPGA 3PHXB 3ZO5B 4DHZB 3DBHI 1LFDA 1GC7A 3IFWB 4MELA 3PHWB 2N9XA 5JHBA 4TQ0A 2MBQA 4OVVA 4I6LB 2KXJA 1UBQA 5JZEB 4MEMA 4OVUA 2M1MA 4ANVA 3K9OB 4G50A 1KJTA 4HJKA 2WX0A 2BYVE 5KHOA 3RZWC 3W1YA 2MX2A 2ZNVC 5TR5A 1OTRB 2NBVB 5J18A 3VAWA 1LXDA 3VTVA 3HM6X 1OEYA 3AXCA 2KX0A 1V86A 1WGYA 2O2VA 2LUEA 3R7RA 3I3TB 3VUXA 4EFOA 1WR6E 3ZKJC 2DYMA 2KZRA 2D11A 3W1SA 2DX5B 4KV2A 1P3QU 2J0MA 3CF6E 4TKNA 4GDKA 2G3QB 1SGHA 2KTRA 1Q1OA 4HLEA 2ZVNA 4FA6A 4EZJA 2GMIC 3N32A 4I6NB 4MGKE 2DYOA 2G4SA 1V9JA 3B08A 3CMMB 4ICVA 3H7PB 3JSVB 4PS3A 5L95C 3CSTA 4GDLA 2DZMA 4ANXA 3RD2A 3NZSA 4FHKA 2MBOA 2FCMA 2BKFA 2C9WB 3PRMB 3A9JA 4EUTA 2CKHB 2JVCA 4PS7A 3KYDD 3NHEB 4E71A 3LDZE 2IBIB 2K8CA 1WR1A 4ZDVA 2M0XA 4M8MA 3UIOB 3ZUNA 2MA9B 2GOWA 2JRIB 1E7UA 3EFUA 3P2BA 4XX5A 3ZDMC 3DVNU 4WWOA 1KLVA 4K7WA 4BBNC 3ALBA 4M8NA 5D2MB 4HVBA 3WANA 4CHKA 4EOYA 2V4LA 3QCAA 2K6QA 4FJVB 4NJ7A 1QZEA 1P9DU 2O6VA 5LLIA 4IM2A 3UQAA 5C1ZA 1CMXB 4W9JA 2AL6A 1KM7A 3MHSD 2NS5A 2CHXA 2KVRA 1WH3A 1Y8RC 4W9EA 4PYUA 1UZXB 1K8RB 3B1LX 3M95A 3KH0A 3PRZA 4GXBA 1WX7A 1XT9B 4MGZE 5E6PA 3L0WB 3C0RB 2AWTA 1E90A 2OJRA 3PLUA 3PPAA 2G4DB 2DZKA 2PEAA 2ZCBA 4IC7B 1UGMA 5D7GA 2MBEA 1YX6B 4K7SA 4IWPA 3VUWA 2FIDA 4JL9A 2MBBB 1M94A 3TMPB 3T8MA 2ZZPB 1KOTA 2BPSA 3O65B 4W9GA 2LGXA 1A5RA 3H9DA 2XBBC 3APFA 2I1JA 3ZIMA 3OLMD 2ZNVB 2LGDA 4B95A 4NY0A 2KLGA 3QWZB 2ZPYA 1V6EA 3ZDTA 2JPHA 3L13A 5CTRC 2KC1A 2JT4B 3RUIB 3QK0A 5FR6A 3H6NA 3WALA 2AEHA 3PS6A 4FLHA 1V81A 3ZRCA 3DDCB 1R4MI 2DENB 3SD5A 1NI2A 4BOZB 3H1UA 1OQYA 1WE7A 2UYZB 2PPHA 5HKHA 1C1YB 4HPMB 4DXAB 2DYBA 2B3AA 1TGZB 2KN5A 3A1QA 3A33B 3HHMA 4WWPA 5AEKB 1TZ1A 1WM3A 4NPNA 2NBWB 2FCQA 2NR2A 3JW0X 4FJYA 2KWVB 4XC2A 4W9IA 3ZVVA 4FBJB 3L54A 2LZ6A 3RULA 3WAPA 3OJ4B 1WGGA 4KDLB 2RSUA 1ZGUB 5J17A 1X1MA 1U4AA 2JXXA 2KHWB 4MM3A 4NQLB 4HCNB 2MQJA 2RR9A 4WJPA 4AP4C 1VD2A 1SE9A 2C7NB 1R4NI 4LCDE 1OEYJ 2G45B 5C23A 2BYFA 1J8CA 4MSMB 1EUVB 1S1QB 3CSFA 3AU4A 1WZ0A 1E8XA 3RZFA 1G6JA 4HDQA 3DVGY 2DAFA 2KDBA 2WX1A 4W9CA 2NPTA 2OOBB 2AL3A
chains in the Genus database with same CATH superfamily
2LI5A 2INDC 5T8IA 3H7SA 1ZUD2 4KGTA 2KYWA 1SB3C 2MP2B 1WY8A 4WH4A 3B0AA 4C56C 2LJ5A 1RRBA 5JH5C 1R7SA 3L10B 2D2QA 3NZUA 2CHZA 2MWSB 2Y5CA 1D6EC 1MG8A 2JWUA 1E10A 4M0WB 1ZE3D 2MLBA 2MRPA 4ZRJA 1NBFC 1V5OA 3AE4B 3AE5B 1KFYB 3RMKC 1Q10A 5AZGA 2G1EA 4N59A 1YX5B 4GLSC 2K5PA 2WXHA 2LMCA 3ONSA 4GGQA 2V4IB 3UGBB 4WAFA 1P98A 1V97A 2BVCA 1EF1A 1SSNA 2WXJA 3DBHB 4TUUA 2V3NA 3MJ5A 3PV1A 4LNKA 1QOBA 2KQ4X 3O13A 4IUMB 2WXNA 5DPRA 4IWOA 4FXCA 1KRHA 1HE8A 2KMAA 2M4NA 3VHTC 1YIWA 2Z59B 2ZVOA 1UBIA 1NVID 2PVGC 3BVZA 4TMAB 5I4DA 5C3JB 3TL5A 1OGWA 5G5HA 3U4EG 4EZLA 2NCNA 2M8SA 2DZIA 3ZW3A 5IAAC 3HVDA 2MJDA 2LGYA 2KNBA 3U2SC 2KJHB 4LNOA 2O6VD 3Q3MC 4FN2A 1RFAA 3PT2B 3M62B 1QOGA 3T9LA 1SIFA 2WLBA 1JW9D 4QAYA 4LLGM 2KFKA 4NQKE 4EZKA 4MH8A 4IOIE 1WGKA 2RD0A 4MDKE 2FIFA 2IGGA 3ECIA 3ZNHB 2PLPA 1L2NA 2MCNB 2NVUI 3BINA 4FHJA 5DCNA 2L05A 3D32A 4RGMA 2V1YA 2IO3B 4ARIA 2WDVB 1WFYA 3BYTB 2RDBC 5LXIB 3FILA 3LXFA 2KQSA 1TTNA 1WX9A 4GDLB 3V60A 2L0TA 4IM3A 4JQWC 4AJYB 4JIOU 3U8ZA 4JLCA 5AZHA 4GB9A 2N9EB 3M3JA 1E9MA 2K8HA 2HJ8A 1DGJA 1SEBD 4F8CB 4BKTA 1Q0WB 2C7HA 2KWCA 2MP2A 4DDGD 5J2RA 4KX6B 1FFUA 1E5WA 4WAAA 2KDIA 3UIPB 4ICUA 2BYEA 4B9KA 4MH0E 2MJEA 2W82A 1MI0A 4M0WA 3N3KB 4GSWA 3OJ3A 4E3CA 5CHVC 4OHJA 1JWSD 4EE2A 1RLFA 1WYWB 2WS3B 4YTNB 3RNCC 4IWQA 3L08A 2AQ3B 5E6OA 5EE1A 4HKQA 4I6PA 1XXGA 4N9F4 2KDFB 1P1AA 1H4RA 3TBLD 2QJLA 3GZNI 2QMTA 4MSQB 2IPKD 2FUG1 3RNEC 1RFKA 4DHJB 3A1QB 5H92C 2QCZA 5CX3A 4B6WA 1I4GA 5C2TB 3N1YC 1AN8A 4DWFA 2JYEA 3BIID 2PJHA 1XQQA 4KZCA 2LWPA 3EHVA 3UINB 2BKRB 2WGSA 3BVGA 2RDHA 3GE3C 4P1CC 5G2NA 4TSSA 4IDIA 1FMAD 4ANWA 2EMSA 1AWDA 3PLVA 1WI0A 4RM8A 2EMTA 1T0QC 1Q5WB 4LDTB 2N9PC 1YJIA 1XLPA 4HK2A 1BT0A 1IP9A 3GE8C 2PE9A 1WRIA 4FADA 2J0KA 2JF5A 3Q3JA 2G9HD 2V3SA 3RPFC 4KKJA 3VR9B 3PHXB 1Y56A 3DBHI 2SEBD 4MELA 4PT5A 1GB1A 4OVUA 1I7HA 2M1MA 4YSXB 3AV8A 3Q3OC 3NVWA 2M19A 2NBVB 1HXYD 1K52A 4LNNA 4RGTA 4EFOA 3HRDD 3ZKJC 4TKNA 4HLEA 1SGHA 1Q1OA 4EZJA 2CU3A 3E56A 1M4VA 4RFBA 3JSVB 3CSTA 4GDLA 2INCC 1TKGA 2C9WB 3W2DA 1MVKA 2J42A 2JZPA 4EUTA 1PGBA 3KYDD 3NHEB 3I5JC 2MA9B 3P2BA 3DVNU 1FCCC 3ALBA 2D5GA 4CHKA 3QCAA 1QZEA 1I4XA 5C1ZA 1I4PA 3MHSD 2ONQA 2KVRA 1WH3A 4W9EA 4PYUA 3BZDB 1UZXB 3B1LX 4MGZE 1TZOA 3P42A 4CQNA 3PLUA 3PPAA 1T5XD 2K9XA 5D7GA 4K7SA 3VUWA 2FIDA 3T8MA 1M94A 1BXTA 3MP9A 2BPSA 4JWUC 3O65B 1JRPA 1UUPA 2XBBC 2I1JA 3P4RB 1ZPSA 1L4ZB 3ZDTA 2JPHA 2YEPB 2KC1A 2KMMA 1F2RI 4JX1C 4M01A 4LK0M 1FNWA 2AX5A 5HKHA 4DXAB 1TGZB 3A1QA 3A33B 5AEKB 1TZ1A 1FCLA 1WM3A 2NR2A 4FJYA 3JW0X 2KWVB 4FBJB 3SR6A 4A8XC 1SE2A 2WXPA 4KDLB 2RSUA 4KKIA 1ZGUB 1HZ5A 1X1MA 1U4AA 2KHWB 4YWGG 2H88B 1VD2A 2KT7A 3IT4B 1QOFA 5C23A 3I63C 1E8XA 1PGAA 4N6EB 1G6JA 2WXQA 3J9CA 1VR9A 4MT5A 1JWAD 2DLBA 4R3DA 4NZLB 1FFVA 3LJ3A 4DHJD 1N61A 4YXDB 5L83A 2GBJA 4BFRA 3FC4A 3CIRB 2UU7A 1HEZE 3AM9A 2C5LC 1MG4A 2LRWA 1WWTA 2HTHA 4RM9A 1E0ZA 3NVZA 1F9JA 1A70A 2ZPNA 2XK5B 3H8HA 4KGRA 2K39A 3V61A 2WDRB 4GIVA 3OWEB 3KUCB 3FAHA 1PFDA 1I4QA 2KMCA 5GXGB 3VRAB 4K3BA 1R4NB 5FKAC 3BK2A 1GOZA 3Q8BA 2JYTA 4KGSA 1EO6A 4HDOA 4NAMA 4RNAA 3AE1B 1C77A 1Z2MA 4II2B 2Y5BB 4M02A 3JSVA 1JRUA 1EF5A 1HZ6A 1IGCA 3R2TA 4YL8A 2JZZA 2K22A 4L23A 4NJ6A 4C00A 1FPYA 4DHZB 2REXA 4W9DA 5GMVA 2L3ZA 2JWZA 3TUOA 4UDUC 3VTUA 4CYEA 2GB1A 1T0YA 3BY4B 3SFEB 5JXVA 1F2RC 3A4RA 2WXMA 3ZNID 3WAOA 2KO3A 4A55A 2R2QA 2IO0B 3ZYYX 1PUTA 3DBSA 1MPEA 3QARA 1EU3A 1NYRA 5D6JB 4FJZA 2BF8B 2M56B 3NJTA 2WU2B 1QKZA 1NYQA 4F1SA 4X57B 4ACFA 1EU4A 2K0PA 4WJOA 1WGHA 2MBHA 2MHJA 1UF0A 3SFDB 5JHAA 4XYCA 2LGIA 4DHZE 2FNJB 3MC8A 3DPDA 4XE0A 1S3SG 4N58A 1D3ZA 4WJQA 2KJ6A 2PE6B 1TY0A 4D2KA 2QDFA 2PTLA 1TYGB 4C7ZA 5IP4D 1D5ZC 2J53A 4OZBA 2XN9C 2O2VB 2L76A 3GOEA 2KDMA 1WJNA 1TS5A 3URYA 4WJNA 1V2YA 2IO1B 2CS4A 1R4MB 1NEKB 1RAXA 2JX5A 2IY1B 4HCPB 2CJNA 1L0VB 1K50A 2YLMA 1MHHE 3W9CB 2BT6A 4ZRKA 2CHWA 2R61A 1L0XB 4J3OD 4ANUA 2M17A 3AE9B 3V3XA 4S0RA 3RNBC 1YQ3B 4W9FA 1AARA 4Q2JA 4URKA 3Q8EA 2KN4A 2A5UA 1KH0A 2ZCCA 4P7IA 1QQRA 5IN7A 2BQQA 1WXQA 4KDIC 3EUB2 1VCBA 2ASQA 4K81A 4G0NB 2VH2A 4IM0A 2BBCA 5IO9A 2XK5A 3IXSA 3EA6A 2Z0DB 2W55A 3MJWA 3QHTA 3SU8X 3U30A 4NAWB 3AN1A 4CO7A 2CR5A 4C7YA 3V62A 1SBBB 3AMZA 5BMHA 2RGFA 3DVNV 3PTFC 3U7DA 1WSPA 3ML8A 2FE8A 3AEAB 2YEPF 1V1OA 2D10A 2I1KA 4KZ0A 1C4PA 3EGRA 3ZXVA 4MM3B 2Y5PA 3JYUA 1HTOA 1GNUA 1L0YB 2IY0B 2V0GA 2DZJA 1QT9A 3ZJVA 2KC2A 2DBYA 2WDTB 3BWUD 3VXWA 2L0FA 3X0WA 2N0SB 4BBNF 1T0SC 4K3CA 3KUDB 1UNSA 1YQ4B 5AUKA 1QOAA 4A9AA 4WURA 2WP9B 4GMVA 4ZRIA 3PREA 4G11A 1WXAA 3WA0A 2NBUA 4TQ1A 3M63B 2KKCA 2INPE 2LEKA 1JALA 1IBXB 3TSSA 2LXAA 2ZW1A 2RPQA 4IG7B 4ARCA 1MHXA 3KUZA 1QF6A 1IPGA 3ZO5B 1LFDA 2N9XA 2KXJA 5JZEB 3ZJUA 2WXIA 2JSVX 2NMQA 2BYVE 4B0MA 2MX2A 5TR5A 1XLNA 3Q2AC 3VAWA 1OEYA 2KX0A 1V86A 2O2VA 3VUXA 2BTEA 1KF6B 3W1SA 1P3QU 2G3QB 4ZRQA 2ZVNA 3CMMB 4PS3A 1HA5A 4RGOS 4ANXA 4FHKA 2BKFA 3PRMB 1ET9A 2CKHB 3LDZE 4ZDVA 3ZUNA 3EFUA 1GAQB 3AEEB 4XX5A 1STEA 4K7WA 4BBNC 2X8XX 3WANA 3KWLA 3IAS1 3I9V1 4NJ7A 3WCQA 3V05A 3Q3NC 3NRZA 2NS5A 1OFFA 1P7FA 3RNFC 4GXBA 3KH0A 4HPPA 3C0RB 1QLBB 2PEAA 5H8YE 4IC7B 1CK1A 3TMPB 2J4XA 4OZCA 2GI9A 1A5RA 3H9DA 3APFA 3ZIMA 2ZNVB 1ZXIA 2WQYB 1TIFA 2KLGA 4NY0A 5D3DA 2ZPYA 3L13A 3RUIB 2AEHA 3PS6A 1F0ZA 3KLSX 1PGXA 3DDCB 1R4MI 2DENB 4BOZB 3H1UA 2V3PA 1WE7A 4HPMB 1EM7A 1SE4A 2DYBA 3Q69A 2KN5A 3P4SB 1UWMA 1J7BA 1AYFA 1WGGA 4C4VB 2OJWA 2RMMA 4MM3A 4NQLB 4HCNB 4AP4C 1SE9A 4LCDE 2PMVA 2BYFA 4M00A 3AEBB 2VZKB 3DVGY 2DAFA 4W9CA 3RNAC 3FKYA 5HFYA 2OOBB 2AL6A 2JQRB 4K7UA 1OQQA 2WDQB 1TY2A 3AH7A 1XLQA 3N1XC 4DBGA 4GDKB 4OVZA 1C78A 1BMLC 3RCZA 1WZ3A 2BS3B 2QIEB 1DYQA 3C8YA 1IBXA 1ZP0B 3CWIA 4ASWC 3MFGA 3PZ8A 3IHPC 5EE9A 5DPSA 4WQMA 1FXIA 2KD0A 3B2GA 1GB4A 3ABVB 3TEYA 1N60A 3SDLC 3PVLA 5TSSA 1JROA 3AE8B 1WM2A 3PZDA 4YTPB 3APDA 1D5XC 2N1VA 3VR8B 3HVZA 1SF0A 1GUAB 1KLGD 1V49A 2MSED 3ML9A 2FBWB 1YN3A 2Z0EB 3AI5A 2JU6X 3A9KB 1C4CA 1F52A 5BYSA 2K1FA 2W3RA 4O1NA 1WX8A 3W5VB 4W9LA 1TBEA 2BB6A 2K8BA 3VUYA 1ROEA 3TEWA 2J52A 1E7VA 2EKEC 4HRSA 4BKSA 3ZTDA 1VLBA 3VH4B 1RYJA 3W1SC 5CHWA 4P16A 5HI1A 3PGEA 1HQRD 3DHGC 1VDVA 1KTKA 3NOBA 3APCA 4KIKB 1PYWD 1WYGA 4GU2A 3VDZA 2MJ3A 2C7MB 3PZ7A 3R8BA 5BO4B 3WAMA 2LUMA 2D3GA 4KVGB 2GBKA 2CJOA 2LXCA 3IVFA 5EDSA 1ISNA 3ZRFA 3HM3A 2GBMA 1LQBA 1J7CA 2D3AA 1K53A 1UGJA 2E6XA 4BKSD 1SE3A 3V6CB 5LXHA 2VH1A 3RI7C 3AULA 2FUHB 1TJEA 1T3QA 3L17A 2V9HA 4BAXA 2BS4B 2K25A 5E6NA 3SEBA 3EECA 1UELA 3N30A 1FXTB 3P63A 2HD5B 2LVPA 2I38A 2XEWA 2KFJA 4C4VA 1CZPA 3NZ3A 5LNK1 3AEGB 2PKOA 1K51A 2LGSA 4MGIE 2GBNA 2RPVA 1E8YA 1LGRA 4RF0A 2N1WA 1H8CA 2AQ2B 2MH7A 2L7RA 1YN5A 2WYQA 2L8JA 3Q8FA 1YQBA 5CHFA 4A20A 4WWMA 2WXOA 1V1PB 1UD7A 1WE6A 5AZFA 1BUIC 3AECB 3L16A 2KAJA 2LD9A 2O6VB 4LDTD 2MEKA 1XLOA 3VRBB 3DHIC 4ZHOA 4W9KA 2YVCA 4AUQC 4F7ZA 1FD6A 4P1BC 1J0GA 5FK9C 2IDYA 2BGFA 1J7AA 4XDCA 4NNJB 2KWUB 3AE3B 2A4ZA 4II3B 1WXSA 2N7JA 2NTSA 2MW5A 4G3XB 2EKIA 4AOFA 2JY6A 1LM8B 2IYDB 2HDEA 3A9KA 1ACCA 1NDDA 1WJUA 3N20C 3L4PA 2GBRA 4HPLB 3S2AA 1C9FA 1WIAA 2BW2A 3NUHB 1WXMA 3HK0A 4EKUA 3DVGX 3RYTA 2INNE 2KTFA 3QX1A 1GG3A 1SJED 2KFKB 1XO3A 1IYFA 3T3OA 4AJWA 3GB1A 3PSEB 2JRHA 4REZA 4IW0A 4KIKA 2VRRB 3KQ4A 4JWSC 4J6IA 2PVOD 1WXVA 2IJ0A 3KW5B 2N7EA 1VZ8A 2KACA 1L7YA 2C60A 4DXGA 4A6QA 2KQ7A 3SHQA 2D07B 1I35A 3QAQA 4RMAA 2JUOA 5KHQA 4PS8A 2LVOA 1E8WA 3DBRB 1QILA 3UQBA 5IA7A 1WGRA 4EEWA 1PQSA 3DWMA 1GC7A 1DOXA 2OHFA 5JHBA 1OQRA 3PHWB 4TQ0A 2MBQA 4I6LB 1FO4A 2DNFA 4MEMA 3ETRA 2XNAC 3K9OB 4HJKA 2WX0A 3W1YA 4ZYSA 2ZNVC 1LXDA 3GS2A 3HM6X 3AXCA 1WGYA 1FNVA 2DYMA 2N9KA 2DX5B 4KV2A 4XZ4A 2ACZB 1YMHE 4FA6A 2GMIC 4RGNA 1PDXA 2DYOA 2G4SA 4ICVA 3B08A 3H7PB 5L95C 3NVVA 2DZMA 3RD2A 3NZSA 2FCMA 1CQVA 2IBIB 2K8CA 1WR1A 5EE3A 2M0XA 3UIOB 2GOWA 1V1PA 4C80A 2GRIA 3ZDMC 4WWOA 2ICIA 4P6VF 1KLVA 1FXAA 4HVBA 2AQ1B 3AE2B 3I57A 2K6QA 2W3SA 2O6VA 5LLIA 1YNTE 3UQAA 4W9JA 1B9RA 1KM7A 2CHXA 1Y8RC 1XT9B 4YT0B 2DWQA 3L0WB 2AWTA 1E90A 1YJJA 2G4DB 2DZKA 1YX6B 2MBBB 1KOTA 4W9GA 3TEZA 4HJGE 1C76A 3OLMD 2LGDA 1VRAB 4B95A 3UI3A 1V6EA 2JT4B 1L4DB 3QK0A 5FR6A 3H6NA 4YSYB 5G5GA 3ZRCA 4PK1A 1NI2A 1TS4A 1OQYA 2LFIA 2UYZB 4AS1A 1C1YB 2B3AA 2BS2B 4WWPA 2NBWB 1VJKA 2FCQA 4XC2A 3RNGC 3B2FA 4W9IA 2PW9A 1ZOYB 3MC0B 2LZ6A 1IGDA 3OJ4B 2RDGA 3NS1A 5J17A 2JXXA 2KVZA 1F77A 1RWSA 1JMLA 1R4NI 2G45B 1DOYA 1EUVB 5IOIA 3RN9C 4HDQA 2KDBA 3ZQ4A 1ENFA 2TSSA 3DBLB 4ZYNA 3E9SA 1WJ4A 3U7ZA 3TIXA 2L1AA 1L5PA 2WXRA 1ZKHA 3AEDB 3DQVA 5BYQA 3VTWA 2WXLA 2ZW0A 2H89B 4HEA1 4KSKC 4PYZA 3UF8A 4LNIA 2IO2B 1SJHD 3AE7B 4OZAA 4BOSC 4RF1A 1D4BA 3AE6B 3KYCD 2K6DB 2HTME 4RCOA 1GJZA 4A3OA 2J0JA 2JZ3B 2D3BA 1N63A 3DWGC 1N62A 2KOXA 4HROA 1WGDA 1WJ6A 2AYOB 1IUEA 3TEXA 5G55A 1AW7A 3H7PA 1V80A 2IGHA 3R7QA 4A3PA 2KLCA 3GP7A 4YSZB 2LASA 2EELA 1B1ZA 4L1BA 2DHZA 3BVMA 3IG3A 3OAWA 5D3IB 3IT6B 4WWNA 2KJRA 4US9A 3EC8A 4YTMB 3EFCA 2NTTA 3TCAA 2BYTA 2LRUA 3JVZX 5DPWA 2UWQA 4WQOB 1N6ZA 4NAWA 3VQIA 3QC8B 4BVUC 2FCNA 2KANA 4OW0A 3DBRI 2WXGA 4JPSA 1ET6A 2WHIA 4FULA 3MHZA 3QJZA 4MJSB 4S17A 1L6VA 3BYYB 1WMHB 1DOIA 2ZJDA 2KX3A 4KSLC 1Z5SB 2KWDA 3ZNZB 1CJEA 2IZVB 1D5MC 1ZW7A 4DK5A 1TS2A 4XWWA 1E7PB 2BWFA 3K9PB 3T3NA 4XWTA 1SXTA 2N4FA 2QHOA 3ZNGC 3A4SC 1YD8U 2BB5A 2Q5WD 3C19A 1LO5D 2LHDA 2JXTA 3Q3FA 4XDDA 3VFKA 4K1RB 3QIJA 1E6EB 1ZDXA 2WNMA 3QA8A 3TJPA 3R66C 1JWUD 3AEFB 2FCSA 2KTRB 3ZTCA 1YJ1A 1ESFA 3DOWA 4DDID 3QQ8B 3P4QB 5EE0A 3A9JB 3ZXRA 3WIMA 5DPTA 4LNFA 1N5XA 4HXDA 2L32A 4RH6A 4DXFA 5HHDG 3MTNB 1ZDVA 1NENB 1YOVB 4LJOB 1V8CA 2KDEB 1E8ZA 1J19A 3ZLZA 4W9HA 4ZHPA 2WWZA 1TT5B 2HE7A 1P7EA 3KWVA 1C79A 2QC8A 1P0RA 2KK8A 2D3CA 2ZEQA 3VVWB 2QILA 3AU5A 5BYRA 1FM0D 1C3TA 3HIZA 4H2AA 4TV3A 1XD3B 5IKCM 4JGHB 3RT3B 1EWYC 1FRDA 2CU1A 2W54A 1FEHA 3X23A 1WF9A 1FIQA 2ON8A 4GN1A 2DAJA 3V6EB 4GOCA 3DCGA 1WRDB 2I2YA 2K3UA 4IKGA 4BKGA 1MJDA 5D94A 3KVFB 3DBLI 2N7DA 1KLUD 2E3TA 3ENEA 1TS3A 2W9NA 4JE3B 4LJPB 4USAA 3IBEA 3NY5A 4E74A 3PRPB 2GLSA 2N9LA 3MC9A 2L00B 2LVQA 4MGYE 2R2OA 1UH6A 3Q14C 4AWJA 1C4AA 5HG2A 2Y3AA 4NJCA 2NPTB 1EWCA 4HWIB 4ZOHC 3DHHC 2Z8LA 2FAZA 1V5TA 1JWBD 2PIAA 4A90A 3NG0A 3AB5A 4MJSA 3U52E 1N5WA 1GC6A 4XGAB 3R3MA 1WMHA 3VH3B 3RFZB 3Q6BA 3ZJTA 1VZ7A 1I42A 2IGDA 2BWES 3NS8A 2LJIA 3HUIA 4MACA 2J7QB 1JCKB 1XCQL 1ZXHA 1I4RA 3IFWB 3ZGZA 4OVVA 1UBQA 1FNUA 4BZAA 1HTQA 4ANVA 4G50A 1I4HA 1KJTA 5KHOA 3RZWC 2OEDA 1OTRB 3LYYA 4L2YA 5J18A 1YN4A 3VTVA 2X38A 3R7RA 2LUEA 3I3TB 1WR6E 2KZRA 3OG5A 3W5UB 1JWMD 2D11A 3Q8AA 2HJ1A 2J0MA 3CF6E 4GDKA 2KTRA 2B76B 5MPOA 3N32A 4I6NB 4MGKE 5BMGA 1V9JA 2WXFA 2MBOA 2QEJC 1T6BX 3A9JA 2WU5B 2JVCA 4PS7A 2QSDA 4E71A 4M8MA 2JRIB 3P4PB 1E7UA 2L83A 3P1MA 2L52A 4M8NA 5D2MB 3IAM1 1L6UA 2VZKD 4EOYA 2V4LA 4FJVB 1P9DU 4IM2A 4DQOC 3LB8C 1CMXB 5AUIA 4ZRPA 3M95A 1K8RB 3PRZA 1WX7A 1FRRA 1SIJA 5E6PA 2LHEA 2OJRA 4ITKA 2ZCBA 1UGMA 2MBEA 4IWPA 4JL9A 2ZZPB 2LGXA 1TKYA 2SAKA 3QWZB 5CTRC 4HKZE 1TKEA 3WALA 4FLHA 1V81A 1GPXA 4B0EA 2M0AA 4WIPA 3SD5A 2PPHA 1F1HA 3B9JA 3PO0A 1UWXA 3HHMA 1VZ6A 4NPNA 3NVYA 3ZVVA 4LTUA 3L54A 1XCTL 3N1ZC 1JQ4A 3RULA 3WAPA 3R2IA 1RM6C 3N9YC 3FILB 1MFWA 2MQJA 2RR9A 3Q8CA 4WJPA 2C7NB 1OEYJ 3GZNB 1XF5L 2WXKA 4AQ7A 1J8CA 4MSMB 1S1QB 3CSFA 1T0RC 3AU4A 3BK1A 1WZ0A 5BMIA 3RZFA 2WX1A 4US8A 1XEEA 5FR3A 1NI3A 2NPTA 5E6JA 2AL3A
chains in the Genus database with same CATH topology
4K7UA 2LI5A 4ZYNA 3LJ3A 1WJ4A 3H7SA 4DHJD 3TIXA 4DBGA 2MP2B 1WY8A 1ZKHA 3DQVA 4GDKB 5L83A 3B0AA 2LJ5A 2GBJA 3RCZA 1RRBA 1WZ3A 4BFRA 5JH5C 3VTWA 3L10B 2C5LC 2D2QA 2LRWA 3NZUA 2CHZA 2HTHA 2MWSB 4RM9A 4ASWC 1MG8A 4KSKC 4PYZA 3UF8A 1F9JA 3IHPC 2ZPNA 4M0WB 5DPSA 2IO2B 2XK5B 2KD0A 2MLBA 2MRPA 4ZRJA 4BOSC 1NBFC 1V5OA 2K39A 3V61A 4GIVA 3SDLC 3PVLA 3KUCB 5AZGA 2KMCA 1WM2A 3PZDA 1YX5B 3APDA 3KYCD 2N1VA 2K6DB 3ONSA 4GGQA 1GJZA 1GUAB 4A3OA 2J0JA 2JZ3B 1V49A 3UGBB 2MSED 3ML9A 2KOXA 1EO6A 2Z0EB 1P98A 4HDOA 3AI5A 1EF1A 1WGDA 1WJ6A 3A9KB 2AYOB 2K1FA 4II2B 1Z2MA 1WX8A 2Y5BB 4TUUA 3PV1A 4W9LA 5G55A 1TBEA 3H7PA 3JSVA 1V80A 3R7QA 4A3PA 2K8BA 1JRUA 1EF5A 2KLCA 2LASA 4IUMB 5DPRA 4IWOA 3VUYA 4YL8A 2JZZA 4NJ6A 1E7VA 1HE8A 2DHZA 2EKEC 2KMAA 3IG3A 2REXA 4W9DA 3OAWA 5GMVA 2M4NA 4BKSA 2L3ZA 2JWZA 4WWNA 4CYEA 3VTUA 3VHTC 2KJRA 1YIWA 1T0YA 2Z59B 3BY4B 3ZTDA 2ZVOA 3VH4B 3EC8A 1UBIA 3W1SC 5CHWA 3PGEA 3TCAA 3A4RA 2LRUA 3ZNID 3TL5A 3JVZX 5DPWA 2UWQA 3NOBA 3APCA 4KIKB 4WQOB 3WAOA 4NAWA 1OGWA 3VQIA 3QC8B 4BVUC 2FCNA 2KANA 4EZLA 2KO3A 2NCNA 2M8SA 2DZIA 3DBRI 4GU2A 3ZW3A 5IAAC 3VDZA 2R2QA 2IO0B 2LGYA 2KNBA 4FULA 2C7MB 4XZ4A 3DBSA 2KJHB 2O6VD 3QJZA 3QARA 5BO4B 4FN2A 5D6JB 3WAMA 2D3GA 1RFAA 4KVGB 2GBKA 4FJZA 2LXCA 2BF8B 3M62B 3PT2B 4MJSB 3IVFA 3T9LA 5EDSA 1SIFA 1ISNA 3ZRFA 3HM3A 4F1SA 2GBMA 1WMHB 1LQBA 2ZJDA 2KFKA 2KX3A 4KSLC 1Z5SB 4X57B 3ZNZB 4NQKE 4WJOA 4BKSD 4EZKA 3V6CB 5LXHA 1WGHA 2MBHA 2IZVB 3AULA 1ZW7A 4DK5A 2RD0A 2FUHB 5JHAA 4MDKE 3L17A 4DHZE 2FIFA 2FNJB 2BWFA 3ECIA 3DPDA 3ZNHB 1S3SG 3K9PB 1D3ZA 4WJQA 2MCNB 2N4FA 2KJ6A 1L2NA 2PE6B 2K25A 2NVUI 5E6NA 2QHOA 3BINA 4FHJA 5DCNA 3ZNGC 2L05A 3A4SC 3EECA 1YD8U 3D32A 2V1YA 1UELA 2IO3B 3N30A 1FXTB 3Q3FA 2HD5B 1WFYA 3VFKA 2O2VB 2L76A 3GOEA 4K1RB 2LVPA 3QIJA 2XEWA 2KFJA 1WJNA 3QA8A 3TJPA 5LXIB 3R66C 2KQSA 4MGIE 1V2YA 4WJNA 2GBNA 2FCSA 2KTRB 1TTNA 3ZTCA 2IO1B 2CS4A 1E8YA 1YJ1A 3DOWA 1WX9A 2N1WA 1RAXA 1H8CA 2IY1B 4HCPB 4GDLB 2L7RA 2WYQA 4DDID 3QQ8B 3V60A 2L8JA 2YLMA 2L0TA 3A9JB 4IM3A 4JQWC 4AJYB 1YQBA 4JIOU 3WIMA 3U8ZA 5CHFA 5DPTA 1I35A 4A20A 4JLCA 2CHWA 4ZRKA 5AZHA 4GB9A 2M17A 4ANUA 2N9EB 1UD7A 3M3JA 1WE6A 4HXDA 5AZFA 2K8HA 3L16A 2HJ8A 3MTNB 4F8CB 4W9FA 4BKTA 4LJOB 1AARA 4URKA 1Q0WB 2C7HA 2LD9A 2KWCA 2MP2A 4DDGD 5J2RA 2A5UA 2ZCCA 1E5WA 4WAAA 4P7IA 2O6VB 2KDEB 1E8ZA 1J19A 2KDIA 3UIPB 4W9HA 3ZLZA 4LDTD 4ICUA 4KDIC 2BYEA 2WWZA 4B9KA 1VCBA 4MH0E 2ASQA 4K81A 4G0NB 4W9KA 2HE7A 2YVCA 4IM0A 4AUQC 2XK5A 3N3KB 1P0RA 4GSWA 4F7ZA 2Z0DB 3OJ3A 4E3CA 5CHVC 2KK8A 3MJWA 1J0GA 1RLFA 1WYWB 2ZEQA 3VVWB 3AU5A 3QHTA 3SU8X 2BGFA 3U30A 4IWQA 1C3TA 4NNJB 3HIZA 2KWUB 4TV3A 1XD3B 3L08A 2A4ZA 4II3B 5E6OA 1WXSA 4JGHB 2MW5A 3RT3B 4NAWB 4G3XB 4I6PA 4AOFA 2JY6A 4N9F4 2KDFB 1P1AA 1LM8B 2CU1A 2IYDB 4CO7A 2CR5A 1H4RA 3A9KA 3V62A 1NDDA 1WJUA 3X23A 3TBLD 1WF9A 2GBRA 3GZNI 4GN1A 2RGFA 3DVNV 3PTFC 4HPLB 4MSQB 3S2AA 3U7DA 1WIAA 4DHJB 2DAJA 3A1QB 3ML8A 1WXMA 3V6EB 5CX3A 4GOCA 4B6WA 3DCGA 3HK0A 4EKUA 3DVGX 1WRDB 3RYTA 4BKGA 2D10A 2I1KA 5D94A 4KZ0A 4DWFA 2KTFA 3QX1A 3KVFB 1GG3A 2PJHA 1XQQA 2KFKB 3DBLI 4KZCA 1IYFA 2LWPA 2N7DA 3ENEA 2W9NA 3JYUA 4AJWA 4LJPB 3EHVA 3IBEA 3NY5A 4E74A 3PSEB 2JRHA 3UINB 3PRPB 2BKRB 1GNUA 2IY0B 4IW0A 2DZJA 4KIKA 2L00B 2LVQA 2VRRB 2KC2A 5G2NA 4MGYE 2R2OA 2WDTB 1UH6A 4AWJA 4J6IA 3VXWA 2EMSA 1WXVA 2L0FA 4ANWA 3X0WA 2NPTB 3PLVA 4BBNF 3KW5B 1WI0A 4RM8A 4HWIB 2EMTA 3KUDB 1Q5WB 2N7EA 2FAZA 1L7YA 4LDTB 2N9PC 2C60A 1V5TA 2KQ7A 4GMVA 3SHQA 4ZRIA 4HK2A 1BT0A 4MJSA 1IP9A 2PE9A 4FADA 3PREA 2D07B 4G11A 2J0KA 1WXAA 1GC6A 3QAQA 3WA0A 2JF5A 4RMAA 2JUOA 2NBUA 3R3MA 1WMHA 3Q3JA 4TQ1A 3M63B 3VH3B 4PS8A 5KHQA 2LVOA 2KKCA 1I42A 2BWES 3NS8A 1E8WA 2V3SA 3UQBA 5IA7A 1WGRA 2LXAA 4EEWA 2J7QB 2RPQA 4IG7B 3KUZA 1PQSA 1IPGA 3PHXB 3ZO5B 4DHZB 3DBHI 1LFDA 1GC7A 3IFWB 4MELA 3PHWB 2N9XA 5JHBA 4TQ0A 2MBQA 4OVVA 4I6LB 2KXJA 1UBQA 5JZEB 4MEMA 4OVUA 2M1MA 4ANVA 3K9OB 4G50A 1KJTA 4HJKA 2WX0A 2BYVE 5KHOA 3RZWC 3W1YA 2MX2A 2ZNVC 5TR5A 1OTRB 2NBVB 5J18A 3VAWA 1LXDA 3VTVA 3HM6X 1OEYA 3AXCA 2KX0A 1V86A 1WGYA 2O2VA 2LUEA 3R7RA 3I3TB 3VUXA 4EFOA 1WR6E 3ZKJC 2DYMA 2KZRA 2D11A 3W1SA 2DX5B 4KV2A 1P3QU 2J0MA 3CF6E 4TKNA 4GDKA 2G3QB 1SGHA 2KTRA 1Q1OA 4HLEA 2ZVNA 4FA6A 4EZJA 2GMIC 3N32A 4I6NB 4MGKE 2DYOA 2G4SA 1V9JA 3B08A 3CMMB 4ICVA 3H7PB 3JSVB 4PS3A 5L95C 3CSTA 4GDLA 2DZMA 4ANXA 3RD2A 3NZSA 4FHKA 2MBOA 2FCMA 2BKFA 2C9WB 3PRMB 3A9JA 4EUTA 2CKHB 2JVCA 4PS7A 3KYDD 3NHEB 4E71A 3LDZE 2IBIB 2K8CA 1WR1A 4ZDVA 2M0XA 4M8MA 3UIOB 3ZUNA 2MA9B 2GOWA 2JRIB 1E7UA 3EFUA 3P2BA 4XX5A 3ZDMC 3DVNU 4WWOA 1KLVA 4K7WA 4BBNC 3ALBA 4M8NA 5D2MB 4HVBA 3WANA 4CHKA 4EOYA 2V4LA 3QCAA 2K6QA 4FJVB 4NJ7A 1QZEA 1P9DU 2O6VA 5LLIA 4IM2A 3UQAA 5C1ZA 1CMXB 4W9JA 2AL6A 1KM7A 3MHSD 2NS5A 2CHXA 2KVRA 1WH3A 1Y8RC 4W9EA 4PYUA 1UZXB 1K8RB 3B1LX 3M95A 3KH0A 3PRZA 4GXBA 1WX7A 1XT9B 4MGZE 5E6PA 3L0WB 3C0RB 2AWTA 1E90A 2OJRA 3PLUA 3PPAA 2G4DB 2DZKA 2PEAA 2ZCBA 4IC7B 1UGMA 5D7GA 2MBEA 1YX6B 4K7SA 4IWPA 3VUWA 2FIDA 4JL9A 2MBBB 1M94A 3TMPB 3T8MA 2ZZPB 1KOTA 2BPSA 3O65B 4W9GA 2LGXA 1A5RA 3H9DA 2XBBC 3APFA 2I1JA 3ZIMA 3OLMD 2ZNVB 2LGDA 4B95A 4NY0A 2KLGA 3QWZB 2ZPYA 1V6EA 3ZDTA 2JPHA 3L13A 5CTRC 2KC1A 2JT4B 3RUIB 3QK0A 5FR6A 3H6NA 3WALA 2AEHA 3PS6A 4FLHA 1V81A 3ZRCA 3DDCB 1R4MI 2DENB 3SD5A 1NI2A 4BOZB 3H1UA 1OQYA 1WE7A 2UYZB 2PPHA 5HKHA 1C1YB 4HPMB 4DXAB 2DYBA 2B3AA 1TGZB 2KN5A 3A1QA 3A33B 3HHMA 4WWPA 5AEKB 1TZ1A 1WM3A 4NPNA 2NBWB 2FCQA 2NR2A 3JW0X 4FJYA 2KWVB 4XC2A 4W9IA 3ZVVA 4FBJB 3L54A 2LZ6A 3RULA 3WAPA 3OJ4B 1WGGA 4KDLB 2RSUA 1ZGUB 5J17A 1X1MA 1U4AA 2JXXA 2KHWB 4MM3A 4NQLB 4HCNB 2MQJA 2RR9A 4WJPA 4AP4C 1VD2A 1SE9A 2C7NB 1R4NI 4LCDE 1OEYJ 2G45B 5C23A 2BYFA 1J8CA 4MSMB 1EUVB 1S1QB 3CSFA 3AU4A 1WZ0A 1E8XA 3RZFA 1G6JA 4HDQA 3DVGY 2DAFA 2KDBA 2WX1A 4W9CA 2NPTA 2OOBB 2AL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7U A;  2LI5 A;  4ZYN A;  3LJ3 A;  1WJ4 A;  3H7S A;  4DHJ D;  3TIX A;  4DBG A;  2MP2 B;  1WY8 A;  1ZKH A;  3DQV A;  4GDK B;  5L83 A;  3B0A A;  2LJ5 A;  2GBJ A;  3RCZ A;  1RRB A;  1WZ3 A;  4BFR A;  5JH5 C;  3VTW A;  3L10 B;  2C5L C;  2D2Q A;  2LRW A;  3NZU A;  2CHZ A;  2HTH A;  2MWS B;  4RM9 A;  4ASW C;  1MG8 A;  4KSK C;  4PYZ A;  3UF8 A;  1F9J A;  3IHP C;  2ZPN A;  4M0W B;  5DPS A;  2IO2 B;  2XK5 B;  2KD0 A;  2MLB A;  2MRP A;  4ZRJ A;  4BOS C;  1NBF C;  1V5O A;  2K39 A;  3V61 A;  4GIV A;  3SDL C;  3PVL A;  3KUC B;  5AZG A;  2KMC A;  1WM2 A;  3PZD A;  1YX5 B;  3APD A;  3KYC D;  2N1V A;  2K6D B;  3ONS A;  4GGQ A;  1GJZ A;  1GUA B;  4A3O A;  2J0J A;  2JZ3 B;  1V49 A;  3UGB B;  2MSE D;  3ML9 A;  2KOX A;  1EO6 A;  2Z0E B;  1P98 A;  4HDO A;  3AI5 A;  1EF1 A;  1WGD A;  1WJ6 A;  3A9K B;  2AYO B;  2K1F A;  4II2 B;  1Z2M A;  1WX8 A;  2Y5B B;  4TUU A;  3PV1 A;  4W9L A;  5G55 A;  1TBE A;  3H7P A;  3JSV A;  1V80 A;  3R7Q A;  4A3P A;  2K8B A;  1JRU A;  1EF5 A;  2KLC A;  2LAS A;  4IUM B;  5DPR A;  4IWO A;  3VUY A;  4YL8 A;  2JZZ A;  4NJ6 A;  1E7V A;  1HE8 A;  2DHZ A;  2EKE C;  2KMA A;  3IG3 A;  2REX A;  4W9D A;  3OAW A;  5GMV A;  2M4N A;  4BKS A;  2L3Z A;  2JWZ A;  4WWN A;  4CYE A;  3VTU A;  3VHT C;  2KJR A;  1YIW A;  1T0Y A;  2Z59 B;  3BY4 B;  3ZTD A;  2ZVO A;  3VH4 B;  3EC8 A;  1UBI A;  3W1S C;  5CHW A;  3PGE A;  3TCA A;  3A4R A;  2LRU A;  3ZNI D;  3TL5 A;  3JVZ X;  5DPW A;  2UWQ A;  3NOB A;  3APC A;  4KIK B;  4WQO B;  3WAO A;  4NAW A;  1OGW A;  3VQI A;  3QC8 B;  4BVU C;  2FCN A;  2KAN A;  4EZL A;  2KO3 A;  2NCN A;  2M8S A;  2DZI A;  3DBR I;  4GU2 A;  3ZW3 A;  5IAA C;  3VDZ A;  2R2Q A;  2IO0 B;  2LGY A;  2KNB A;  4FUL A;  2C7M B;  4XZ4 A;  3DBS A;  2KJH B;  2O6V D;  3QJZ A;  3QAR A;  5BO4 B;  4FN2 A;  5D6J B;  3WAM A;  2D3G A;  1RFA A;  4KVG B;  2GBK A;  4FJZ A;  2LXC A;  2BF8 B;  3M62 B;  3PT2 B;  4MJS B;  3IVF A;  3T9L A;  5EDS A;  1SIF A;  1ISN A;  3ZRF A;  3HM3 A;  4F1S A;  2GBM A;  1WMH B;  1LQB A;  2ZJD A;  2KFK A;  2KX3 A;  4KSL C;  1Z5S B;  4X57 B;  3ZNZ B;  4NQK E;  4WJO A;  4BKS D;  4EZK A;  3V6C B;  5LXH A;  1WGH A;  2MBH A;  2IZV B;  3AUL A;  1ZW7 A;  4DK5 A;  2RD0 A;  2FUH B;  5JHA A;  4MDK E;  3L17 A;  4DHZ E;  2FIF A;  2FNJ B;  2BWF A;  3ECI A;  3DPD A;  3ZNH B;  1S3S G;  3K9P B;  1D3Z A;  4WJQ A;  2MCN B;  2N4F A;  2KJ6 A;  1L2N A;  2PE6 B;  2K25 A;  2NVU I;  5E6N A;  2QHO A;  3BIN A;  4FHJ A;  5DCN A;  3ZNG C;  2L05 A;  3A4S C;  3EEC A;  1YD8 U;  3D32 A;  2V1Y A;  1UEL A;  2IO3 B;  3N30 A;  1FXT B;  3Q3F A;  2HD5 B;  1WFY A;  3VFK A;  2O2V B;  2L76 A;  3GOE A;  4K1R B;  2LVP A;  3QIJ A;  2XEW A;  2KFJ A;  1WJN A;  3QA8 A;  3TJP A;  5LXI B;  3R66 C;  2KQS A;  4MGI E;  1V2Y A;  4WJN A;  2GBN A;  2FCS A;  2KTR B;  1TTN A;  3ZTC A;  2IO1 B;  2CS4 A;  1E8Y A;  1YJ1 A;  3DOW A;  1WX9 A;  2N1W A;  1RAX A;  1H8C A;  2IY1 B;  4HCP B;  4GDL B;  2L7R A;  2WYQ A;  4DDI D;  3QQ8 B;  3V60 A;  2L8J A;  2YLM A;  2L0T A;  3A9J B;  4IM3 A;  4JQW C;  4AJY B;  1YQB A;  4JIO U;  3WIM A;  3U8Z A;  5CHF A;  5DPT A;  1I35 A;  4A20 A;  4JLC A;  2CHW A;  4ZRK A;  5AZH A;  4GB9 A;  2M17 A;  4ANU A;  2N9E B;  1UD7 A;  3M3J A;  1WE6 A;  4HXD A;  5AZF A;  2K8H A;  3L16 A;  2HJ8 A;  3MTN B;  4F8C B;  4W9F A;  4BKT A;  4LJO B;  1AAR A;  4URK A;  1Q0W B;  2C7H A;  2LD9 A;  2KWC A;  2MP2 A;  4DDG D;  5J2R A;  2A5U A;  2ZCC A;  1E5W A;  4WAA A;  4P7I A;  2O6V B;  2KDE B;  1E8Z A;  1J19 A;  2KDI A;  3UIP B;  4W9H A;  3ZLZ A;  4LDT D;  4ICU A;  4KDI C;  2BYE A;  2WWZ A;  4B9K A;  1VCB A;  4MH0 E;  2ASQ A;  4K81 A;  4G0N B;  4W9K A;  2HE7 A;  2YVC A;  4IM0 A;  4AUQ C;  2XK5 A;  3N3K B;  1P0R A;  4GSW A;  4F7Z A;  2Z0D B;  3OJ3 A;  4E3C A;  5CHV C;  2KK8 A;  3MJW A;  1J0G A;  1RLF A;  1WYW B;  2ZEQ A;  3VVW B;  3AU5 A;  3QHT A;  3SU8 X;  2BGF A;  3U30 A;  4IWQ A;  1C3T A;  4NNJ B;  3HIZ A;  2KWU B;  4TV3 A;  1XD3 B;  3L08 A;  2A4Z A;  4II3 B;  5E6O A;  1WXS A;  4JGH B;  2MW5 A;  3RT3 B;  4NAW B;  4G3X B;  4I6P A;  4AOF A;  2JY6 A;  4N9F 4;  2KDF B;  1P1A A;  1LM8 B;  2CU1 A;  2IYD B;  4CO7 A;  2CR5 A;  1H4R A;  3A9K A;  3V62 A;  1NDD A;  1WJU A;  3X23 A;  3TBL D;  1WF9 A;  2GBR A;  3GZN I;  4GN1 A;  2RGF A;  3DVN V;  3PTF C;  4HPL B;  4MSQ B;  3S2A A;  3U7D A;  1WIA A;  4DHJ B;  2DAJ A;  3A1Q B;  3ML8 A;  1WXM A;  3V6E B;  5CX3 A;  4GOC A;  4B6W A;  3DCG A;  3HK0 A;  4EKU A;  3DVG X;  1WRD B;  3RYT A;  4BKG A;  2D10 A;  2I1K A;  5D94 A;  4KZ0 A;  4DWF A;  2KTF A;  3QX1 A;  3KVF B;  1GG3 A;  2PJH A;  1XQQ A;  2KFK B;  3DBL I;  4KZC A;  1IYF A;  2LWP A;  2N7D A;  3ENE A;  2W9N A;  3JYU A;  4AJW A;  4LJP B;  3EHV A;  3IBE A;  3NY5 A;  4E74 A;  3PSE B;  2JRH A;  3UIN B;  3PRP B;  2BKR B;  1GNU A;  2IY0 B;  4IW0 A;  2DZJ A;  4KIK A;  2L00 B;  2LVQ A;  2VRR B;  2KC2 A;  5G2N A;  4MGY E;  2R2O A;  2WDT B;  1UH6 A;  4AWJ A;  4J6I A;  3VXW A;  2EMS A;  1WXV A;  2L0F A;  4ANW A;  3X0W A;  2NPT B;  3PLV A;  4BBN F;  3KW5 B;  1WI0 A;  4RM8 A;  4HWI B;  2EMT A;  3KUD B;  1Q5W B;  2N7E A;  2FAZ A;  1L7Y A;  4LDT B;  2N9P C;  2C60 A;  1V5T A;  2KQ7 A;  4GMV A;  3SHQ A;  4ZRI A;  4HK2 A;  1BT0 A;  4MJS A;  1IP9 A;  2PE9 A;  4FAD A;  3PRE A;  2D07 B;  4G11 A;  2J0K A;  1WXA A;  1GC6 A;  3QAQ A;  3WA0 A;  2JF5 A;  4RMA A;  2JUO A;  2NBU A;  3R3M A;  1WMH A;  3Q3J A;  4TQ1 A;  3M63 B;  3VH3 B;  4PS8 A;  5KHQ A;  2LVO A;  2KKC A;  1I42 A;  2BWE S;  3NS8 A;  1E8W A;  2V3S A;  3UQB A;  5IA7 A;  1WGR A;  2LXA A;  4EEW A;  2J7Q B;  2RPQ A;  4IG7 B;  3KUZ A;  1PQS A;  1IPG A;  3PHX B;  3ZO5 B;  4DHZ B;  3DBH I;  1LFD A;  1GC7 A;  3IFW B;  4MEL A;  3PHW B;  2N9X A;  5JHB A;  4TQ0 A;  2MBQ A;  4OVV A;  4I6L B;  2KXJ A;  1UBQ A;  5JZE B;  4MEM A;  4OVU A;  2M1M A;  4ANV A;  3K9O B;  4G50 A;  1KJT A;  4HJK A;  2WX0 A;  2BYV E;  5KHO A;  3RZW C;  3W1Y A;  2MX2 A;  2ZNV C;  5TR5 A;  1OTR B;  2NBV B;  5J18 A;  3VAW A;  1LXD A;  3VTV A;  3HM6 X;  1OEY A;  3AXC A;  2KX0 A;  1V86 A;  1WGY A;  2O2V A;  2LUE A;  3R7R A;  3I3T B;  3VUX A;  4EFO A;  1WR6 E;  3ZKJ C;  2DYM A;  2KZR A;  2D11 A;  3W1S A;  2DX5 B;  4KV2 A;  1P3Q U;  2J0M A;  3CF6 E;  4TKN A;  4GDK A;  2G3Q B;  1SGH A;  2KTR A;  1Q1O A;  4HLE A;  2ZVN A;  4FA6 A;  4EZJ A;  2GMI C;  3N32 A;  4I6N B;  4MGK E;  2DYO A;  2G4S A;  1V9J A;  3B08 A;  3CMM B;  4ICV A;  3H7P B;  3JSV B;  4PS3 A;  5L95 C;  3CST A;  4GDL A;  2DZM A;  4ANX A;  3RD2 A;  3NZS A;  4FHK A;  2MBO A;  2FCM A;  2BKF A;  2C9W B;  3PRM B;  3A9J A;  4EUT A;  2CKH B;  2JVC A;  4PS7 A;  3KYD D;  3NHE B;  4E71 A;  3LDZ E;  2IBI B;  2K8C A;  1WR1 A;  4ZDV A;  2M0X A;  4M8M A;  3UIO B;  3ZUN A;  2MA9 B;  2GOW A;  2JRI B;  1E7U A;  3EFU A;  3P2B A;  4XX5 A;  3ZDM C;  3DVN U;  4WWO A;  1KLV A;  4K7W A;  4BBN C;  3ALB A;  4M8N A;  5D2M B;  4HVB A;  3WAN A;  4CHK A;  4EOY A;  2V4L A;  3QCA A;  2K6Q A;  4FJV B;  4NJ7 A;  1QZE A;  1P9D U;  2O6V A;  5LLI A;  4IM2 A;  3UQA A;  5C1Z A;  1CMX B;  4W9J A;  2AL6 A;  1KM7 A;  3MHS D;  2NS5 A;  2CHX A;  2KVR A;  1WH3 A;  1Y8R C;  4W9E A;  4PYU A;  1UZX B;  1K8R B;  3B1L X;  3M95 A;  3KH0 A;  3PRZ A;  4GXB A;  1WX7 A;  1XT9 B;  4MGZ E;  5E6P A;  3L0W B;  3C0R B;  2AWT A;  1E90 A;  2OJR A;  3PLU A;  3PPA A;  2G4D B;  2DZK A;  2PEA A;  2ZCB A;  4IC7 B;  1UGM A;  5D7G A;  2MBE A;  1YX6 B;  4K7S A;  4IWP A;  3VUW A;  2FID A;  4JL9 A;  2MBB B;  1M94 A;  3TMP B;  3T8M A;  2ZZP B;  1KOT A;  2BPS A;  3O65 B;  4W9G A;  2LGX A;  1A5R A;  3H9D A;  2XBB C;  3APF A;  2I1J A;  3ZIM A;  3OLM D;  2ZNV B;  2LGD A;  4B95 A;  4NY0 A;  2KLG A;  3QWZ B;  2ZPY A;  1V6E A;  3ZDT A;  2JPH A;  3L13 A;  5CTR C;  2KC1 A;  2JT4 B;  3RUI B;  3QK0 A;  5FR6 A;  3H6N A;  3WAL A;  2AEH A;  3PS6 A;  4FLH A;  1V81 A;  3ZRC A;  3DDC B;  1R4M I;  2DEN B;  3SD5 A;  1NI2 A;  4BOZ B;  3H1U A;  1OQY A;  1WE7 A;  2UYZ B;  2PPH A;  5HKH A;  1C1Y B;  4HPM B;  4DXA B;  2DYB A;  2B3A A;  1TGZ B;  2KN5 A;  3A1Q A;  3A33 B;  3HHM A;  4WWP A;  5AEK B;  1TZ1 A;  1WM3 A;  4NPN A;  2NBW B;  2FCQ A;  2NR2 A;  3JW0 X;  4FJY A;  2KWV B;  4XC2 A;  4W9I A;  3ZVV A;  4FBJ B;  3L54 A;  2LZ6 A;  3RUL A;  3WAP A;  3OJ4 B;  1WGG A;  4KDL B;  2RSU A;  1ZGU B;  5J17 A;  1X1M A;  1U4A A;  2JXX A;  2KHW B;  4MM3 A;  4NQL B;  4HCN B;  2MQJ A;  2RR9 A;  4WJP A;  4AP4 C;  1VD2 A;  1SE9 A;  2C7N B;  1R4N I;  4LCD E;  1OEY J;  2G45 B;  5C23 A;  2BYF A;  1J8C A;  4MSM B;  1EUV B;  1S1Q B;  3CSF A;  3AU4 A;  1WZ0 A;  1E8X A;  3RZF A;  1G6J A;  4HDQ A;  3DVG Y;  2DAF A;  2KDB A;  2WX1 A;  4W9C A;  2NPT A;  2OOB B;  2AL3 A; 
#chains in the Genus database with same CATH topology
 2LI5 A;  2IND C;  5T8I A;  3H7S A;  1ZUD 2;  4KGT A;  2KYW A;  1SB3 C;  2MP2 B;  1WY8 A;  4WH4 A;  3B0A A;  4C56 C;  2LJ5 A;  1RRB A;  5JH5 C;  1R7S A;  3L10 B;  2D2Q A;  3NZU A;  2CHZ A;  2MWS B;  2Y5C A;  1D6E C;  1MG8 A;  2JWU A;  1E10 A;  4M0W B;  1ZE3 D;  2MLB A;  2MRP A;  4ZRJ A;  1NBF C;  1V5O A;  3AE4 B;  3AE5 B;  1KFY B;  3RMK C;  1Q10 A;  5AZG A;  2G1E A;  4N59 A;  1YX5 B;  4GLS C;  2K5P A;  2WXH A;  2LMC A;  3ONS A;  4GGQ A;  2V4I B;  3UGB B;  4WAF A;  1P98 A;  1V97 A;  2BVC A;  1EF1 A;  1SSN A;  2WXJ A;  3DBH B;  4TUU A;  2V3N A;  3MJ5 A;  3PV1 A;  4LNK A;  1QOB A;  2KQ4 X;  3O13 A;  4IUM B;  2WXN A;  5DPR A;  4IWO A;  4FXC A;  1KRH A;  1HE8 A;  2KMA A;  2M4N A;  3VHT C;  1YIW A;  2Z59 B;  2ZVO A;  1UBI A;  1NVI D;  2PVG C;  3BVZ A;  4TMA B;  5I4D A;  5C3J B;  3TL5 A;  1OGW A;  5G5H A;  3U4E G;  4EZL A;  2NCN A;  2M8S A;  2DZI A;  3ZW3 A;  5IAA C;  3HVD A;  2MJD A;  2LGY A;  2KNB A;  3U2S C;  2KJH B;  4LNO A;  2O6V D;  3Q3M C;  4FN2 A;  1RFA A;  3PT2 B;  3M62 B;  1QOG A;  3T9L A;  1SIF A;  2WLB A;  1JW9 D;  4QAY A;  4LLG M;  2KFK A;  4NQK E;  4EZK A;  4MH8 A;  4IOI E;  1WGK A;  2RD0 A;  4MDK E;  2FIF A;  2IGG A;  3ECI A;  3ZNH B;  2PLP A;  1L2N A;  2MCN B;  2NVU I;  3BIN A;  4FHJ A;  5DCN A;  2L05 A;  3D32 A;  4RGM A;  2V1Y A;  2IO3 B;  4ARI A;  2WDV B;  1WFY A;  3BYT B;  2RDB C;  5LXI B;  3FIL A;  3LXF A;  2KQS A;  1TTN A;  1WX9 A;  4GDL B;  3V60 A;  2L0T A;  4IM3 A;  4JQW C;  4AJY B;  4JIO U;  3U8Z A;  4JLC A;  5AZH A;  4GB9 A;  2N9E B;  3M3J A;  1E9M A;  2K8H A;  2HJ8 A;  1DGJ A;  1SEB D;  4F8C B;  4BKT A;  1Q0W B;  2C7H A;  2KWC A;  2MP2 A;  4DDG D;  5J2R A;  4KX6 B;  1FFU A;  1E5W A;  4WAA A;  2KDI A;  3UIP B;  4ICU A;  2BYE A;  4B9K A;  4MH0 E;  2MJE A;  2W82 A;  1MI0 A;  4M0W A;  3N3K B;  4GSW A;  3OJ3 A;  4E3C A;  5CHV C;  4OHJ A;  1JWS D;  4EE2 A;  1RLF A;  1WYW B;  2WS3 B;  4YTN B;  3RNC C;  4IWQ A;  3L08 A;  2AQ3 B;  5E6O A;  5EE1 A;  4HKQ A;  4I6P A;  1XXG A;  4N9F 4;  2KDF B;  1P1A A;  1H4R A;  3TBL D;  2QJL A;  3GZN I;  2QMT A;  4MSQ B;  2IPK D;  2FUG 1;  3RNE C;  1RFK A;  4DHJ B;  3A1Q B;  5H92 C;  2QCZ A;  5CX3 A;  4B6W A;  1I4G A;  5C2T B;  3N1Y C;  1AN8 A;  4DWF A;  2JYE A;  3BII D;  2PJH A;  1XQQ A;  4KZC A;  2LWP A;  3EHV A;  3UIN B;  2BKR B;  2WGS A;  3BVG A;  2RDH A;  3GE3 C;  4P1C C;  5G2N A;  4TSS A;  4IDI A;  1FMA D;  4ANW A;  2EMS A;  1AWD A;  3PLV A;  1WI0 A;  4RM8 A;  2EMT A;  1T0Q C;  1Q5W B;  4LDT B;  2N9P C;  1YJI A;  1XLP A;  4HK2 A;  1BT0 A;  1IP9 A;  3GE8 C;  2PE9 A;  1WRI A;  4FAD A;  2J0K A;  2JF5 A;  3Q3J A;  2G9H D;  2V3S A;  3RPF C;  4KKJ A;  3VR9 B;  3PHX B;  1Y56 A;  3DBH I;  2SEB D;  4MEL A;  4PT5 A;  1GB1 A;  4OVU A;  1I7H A;  2M1M A;  4YSX B;  3AV8 A;  3Q3O C;  3NVW A;  2M19 A;  2NBV B;  1HXY D;  1K52 A;  4LNN A;  4RGT A;  4EFO A;  3HRD D;  3ZKJ C;  4TKN A;  4HLE A;  1SGH A;  1Q1O A;  4EZJ A;  2CU3 A;  3E56 A;  1M4V A;  4RFB A;  3JSV B;  3CST A;  4GDL A;  2INC C;  1TKG A;  2C9W B;  3W2D A;  1MVK A;  2J42 A;  2JZP A;  4EUT A;  1PGB A;  3KYD D;  3NHE B;  3I5J C;  2MA9 B;  3P2B A;  3DVN U;  1FCC C;  3ALB A;  2D5G A;  4CHK A;  3QCA A;  1QZE A;  1I4X A;  5C1Z A;  1I4P A;  3MHS D;  2ONQ A;  2KVR A;  1WH3 A;  4W9E A;  4PYU A;  3BZD B;  1UZX B;  3B1L X;  4MGZ E;  1TZO A;  3P42 A;  4CQN A;  3PLU A;  3PPA A;  1T5X D;  2K9X A;  5D7G A;  4K7S A;  3VUW A;  2FID A;  3T8M A;  1M94 A;  1BXT A;  3MP9 A;  2BPS A;  4JWU C;  3O65 B;  1JRP A;  1UUP A;  2XBB C;  2I1J A;  3P4R B;  1ZPS A;  1L4Z B;  3ZDT A;  2JPH A;  2YEP B;  2KC1 A;  2KMM A;  1F2R I;  4JX1 C;  4M01 A;  4LK0 M;  1FNW A;  2AX5 A;  5HKH A;  4DXA B;  1TGZ B;  3A1Q A;  3A33 B;  5AEK B;  1TZ1 A;  1FCL A;  1WM3 A;  2NR2 A;  4FJY A;  3JW0 X;  2KWV B;  4FBJ B;  3SR6 A;  4A8X C;  1SE2 A;  2WXP A;  4KDL B;  2RSU A;  4KKI A;  1ZGU B;  1HZ5 A;  1X1M A;  1U4A A;  2KHW B;  4YWG G;  2H88 B;  1VD2 A;  2KT7 A;  3IT4 B;  1QOF A;  5C23 A;  3I63 C;  1E8X A;  1PGA A;  4N6E B;  1G6J A;  2WXQ A;  3J9C A;  1VR9 A;  4MT5 A;  1JWA D;  2DLB A;  4R3D A;  4NZL B;  1FFV A;  3LJ3 A;  4DHJ D;  1N61 A;  4YXD B;  5L83 A;  2GBJ A;  4BFR A;  3FC4 A;  3CIR B;  2UU7 A;  1HEZ E;  3AM9 A;  2C5L C;  1MG4 A;  2LRW A;  1WWT A;  2HTH A;  4RM9 A;  1E0Z A;  3NVZ A;  1F9J A;  1A70 A;  2ZPN A;  2XK5 B;  3H8H A;  4KGR A;  2K39 A;  3V61 A;  2WDR B;  4GIV A;  3OWE B;  3KUC B;  3FAH A;  1PFD A;  1I4Q A;  2KMC A;  5GXG B;  3VRA B;  4K3B A;  1R4N B;  5FKA C;  3BK2 A;  1GOZ A;  3Q8B A;  2JYT A;  4KGS A;  1EO6 A;  4HDO A;  4NAM A;  4RNA A;  3AE1 B;  1C77 A;  1Z2M A;  4II2 B;  2Y5B B;  4M02 A;  3JSV A;  1JRU A;  1EF5 A;  1HZ6 A;  1IGC A;  3R2T A;  4YL8 A;  2JZZ A;  2K22 A;  4L23 A;  4NJ6 A;  4C00 A;  1FPY A;  4DHZ B;  2REX A;  4W9D A;  5GMV A;  2L3Z A;  2JWZ A;  3TUO A;  4UDU C;  3VTU A;  4CYE A;  2GB1 A;  1T0Y A;  3BY4 B;  3SFE B;  5JXV A;  1F2R C;  3A4R A;  2WXM A;  3ZNI D;  3WAO A;  2KO3 A;  4A55 A;  2R2Q A;  2IO0 B;  3ZYY X;  1PUT A;  3DBS A;  1MPE A;  3QAR A;  1EU3 A;  1NYR A;  5D6J B;  4FJZ A;  2BF8 B;  2M56 B;  3NJT A;  2WU2 B;  1QKZ A;  1NYQ A;  4F1S A;  4X57 B;  4ACF A;  1EU4 A;  2K0P A;  4WJO A;  1WGH A;  2MBH A;  2MHJ A;  1UF0 A;  3SFD B;  5JHA A;  4XYC A;  2LGI A;  4DHZ E;  2FNJ B;  3MC8 A;  3DPD A;  4XE0 A;  1S3S G;  4N58 A;  1D3Z A;  4WJQ A;  2KJ6 A;  2PE6 B;  1TY0 A;  4D2K A;  2QDF A;  2PTL A;  1TYG B;  4C7Z A;  5IP4 D;  1D5Z C;  2J53 A;  4OZB A;  2XN9 C;  2O2V B;  2L76 A;  3GOE A;  2KDM A;  1WJN A;  1TS5 A;  3URY A;  4WJN A;  1V2Y A;  2IO1 B;  2CS4 A;  1R4M B;  1NEK B;  1RAX A;  2JX5 A;  2IY1 B;  4HCP B;  2CJN A;  1L0V B;  1K50 A;  2YLM A;  1MHH E;  3W9C B;  2BT6 A;  4ZRK A;  2CHW A;  2R61 A;  1L0X B;  4J3O D;  4ANU A;  2M17 A;  3AE9 B;  3V3X A;  4S0R A;  3RNB C;  1YQ3 B;  4W9F A;  1AAR A;  4Q2J A;  4URK A;  3Q8E A;  2KN4 A;  2A5U A;  1KH0 A;  2ZCC A;  4P7I A;  1QQR A;  5IN7 A;  2BQQ A;  1WXQ A;  4KDI C;  3EUB 2;  1VCB A;  2ASQ A;  4K81 A;  4G0N B;  2VH2 A;  4IM0 A;  2BBC A;  5IO9 A;  2XK5 A;  3IXS A;  3EA6 A;  2Z0D B;  2W55 A;  3MJW A;  3QHT A;  3SU8 X;  3U30 A;  4NAW B;  3AN1 A;  4CO7 A;  2CR5 A;  4C7Y A;  3V62 A;  1SBB B;  3AMZ A;  5BMH A;  2RGF A;  3DVN V;  3PTF C;  3U7D A;  1WSP A;  3ML8 A;  2FE8 A;  3AEA B;  2YEP F;  1V1O A;  2D10 A;  2I1K A;  4KZ0 A;  1C4P A;  3EGR A;  3ZXV A;  4MM3 B;  2Y5P A;  3JYU A;  1HTO A;  1GNU A;  1L0Y B;  2IY0 B;  2V0G A;  2DZJ A;  1QT9 A;  3ZJV A;  2KC2 A;  2DBY A;  2WDT B;  3BWU D;  3VXW A;  2L0F A;  3X0W A;  2N0S B;  4BBN F;  1T0S C;  4K3C A;  3KUD B;  1UNS A;  1YQ4 B;  5AUK A;  1QOA A;  4A9A A;  4WUR A;  2WP9 B;  4GMV A;  4ZRI A;  3PRE A;  4G11 A;  1WXA A;  3WA0 A;  2NBU A;  4TQ1 A;  3M63 B;  2KKC A;  2INP E;  2LEK A;  1JAL A;  1IBX B;  3TSS A;  2LXA A;  2ZW1 A;  2RPQ A;  4IG7 B;  4ARC A;  1MHX A;  3KUZ A;  1QF6 A;  1IPG A;  3ZO5 B;  1LFD A;  2N9X A;  2KXJ A;  5JZE B;  3ZJU A;  2WXI A;  2JSV X;  2NMQ A;  2BYV E;  4B0M A;  2MX2 A;  5TR5 A;  1XLN A;  3Q2A C;  3VAW A;  1OEY A;  2KX0 A;  1V86 A;  2O2V A;  3VUX A;  2BTE A;  1KF6 B;  3W1S A;  1P3Q U;  2G3Q B;  4ZRQ A;  2ZVN A;  3CMM B;  4PS3 A;  1HA5 A;  4RGO S;  4ANX A;  4FHK A;  2BKF A;  3PRM B;  1ET9 A;  2CKH B;  3LDZ E;  4ZDV A;  3ZUN A;  3EFU A;  1GAQ B;  3AEE B;  4XX5 A;  1STE A;  4K7W A;  4BBN C;  2X8X X;  3WAN A;  3KWL A;  3IAS 1;  3I9V 1;  4NJ7 A;  3WCQ A;  3V05 A;  3Q3N C;  3NRZ A;  2NS5 A;  1OFF A;  1P7F A;  3RNF C;  4GXB A;  3KH0 A;  4HPP A;  3C0R B;  1QLB B;  2PEA A;  5H8Y E;  4IC7 B;  1CK1 A;  3TMP B;  2J4X A;  4OZC A;  2GI9 A;  1A5R A;  3H9D A;  3APF A;  3ZIM A;  2ZNV B;  1ZXI A;  2WQY B;  1TIF A;  2KLG A;  4NY0 A;  5D3D A;  2ZPY A;  3L13 A;  3RUI B;  2AEH A;  3PS6 A;  1F0Z A;  3KLS X;  1PGX A;  3DDC B;  1R4M I;  2DEN B;  4BOZ B;  3H1U A;  2V3P A;  1WE7 A;  4HPM B;  1EM7 A;  1SE4 A;  2DYB A;  3Q69 A;  2KN5 A;  3P4S B;  1UWM A;  1J7B A;  1AYF A;  1WGG A;  4C4V B;  2OJW A;  2RMM A;  4MM3 A;  4NQL B;  4HCN B;  4AP4 C;  1SE9 A;  4LCD E;  2PMV A;  2BYF A;  4M00 A;  3AEB B;  2VZK B;  3DVG Y;  2DAF A;  4W9C A;  3RNA C;  3FKY A;  5HFY A;  2OOB B;  2AL6 A;  2JQR B;  4K7U A;  1OQQ A;  2WDQ B;  1TY2 A;  3AH7 A;  1XLQ A;  3N1X C;  4DBG A;  4GDK B;  4OVZ A;  1C78 A;  1BML C;  3RCZ A;  1WZ3 A;  2BS3 B;  2QIE B;  1DYQ A;  3C8Y A;  1IBX A;  1ZP0 B;  3CWI A;  4ASW C;  3MFG A;  3PZ8 A;  3IHP C;  5EE9 A;  5DPS A;  4WQM A;  1FXI A;  2KD0 A;  3B2G A;  1GB4 A;  3ABV B;  3TEY A;  1N60 A;  3SDL C;  3PVL A;  5TSS A;  1JRO A;  3AE8 B;  1WM2 A;  3PZD A;  4YTP B;  3APD A;  1D5X C;  2N1V A;  3VR8 B;  3HVZ A;  1SF0 A;  1GUA B;  1KLG D;  1V49 A;  2MSE D;  3ML9 A;  2FBW B;  1YN3 A;  2Z0E B;  3AI5 A;  2JU6 X;  3A9K B;  1C4C A;  1F52 A;  5BYS A;  2K1F A;  2W3R A;  4O1N A;  1WX8 A;  3W5V B;  4W9L A;  1TBE A;  2BB6 A;  2K8B A;  3VUY A;  1ROE A;  3TEW A;  2J52 A;  1E7V A;  2EKE C;  4HRS A;  4BKS A;  3ZTD A;  1VLB A;  3VH4 B;  1RYJ A;  3W1S C;  5CHW A;  4P16 A;  5HI1 A;  3PGE A;  1HQR D;  3DHG C;  1VDV A;  1KTK A;  3NOB A;  3APC A;  4KIK B;  1PYW D;  1WYG A;  4GU2 A;  3VDZ A;  2MJ3 A;  2C7M B;  3PZ7 A;  3R8B A;  5BO4 B;  3WAM A;  2LUM A;  2D3G A;  4KVG B;  2GBK A;  2CJO A;  2LXC A;  3IVF A;  5EDS A;  1ISN A;  3ZRF A;  3HM3 A;  2GBM A;  1LQB A;  1J7C A;  2D3A A;  1K53 A;  1UGJ A;  2E6X A;  4BKS D;  1SE3 A;  3V6C B;  5LXH A;  2VH1 A;  3RI7 C;  3AUL A;  2FUH B;  1TJE A;  1T3Q A;  3L17 A;  2V9H A;  4BAX A;  2BS4 B;  2K25 A;  5E6N A;  3SEB A;  3EEC A;  1UEL A;  3N30 A;  1FXT B;  3P63 A;  2HD5 B;  2LVP A;  2I38 A;  2XEW A;  2KFJ A;  4C4V A;  1CZP A;  3NZ3 A;  5LNK 1;  3AEG B;  2PKO A;  1K51 A;  2LGS A;  4MGI E;  2GBN A;  2RPV A;  1E8Y A;  1LGR A;  4RF0 A;  2N1W A;  1H8C A;  2AQ2 B;  2MH7 A;  2L7R A;  1YN5 A;  2WYQ A;  2L8J A;  3Q8F A;  1YQB A;  5CHF A;  4A20 A;  4WWM A;  2WXO A;  1V1P B;  1UD7 A;  1WE6 A;  5AZF A;  1BUI C;  3AEC B;  3L16 A;  2KAJ A;  2LD9 A;  2O6V B;  4LDT D;  2MEK A;  1XLO A;  3VRB B;  3DHI C;  4ZHO A;  4W9K A;  2YVC A;  4AUQ C;  4F7Z A;  1FD6 A;  4P1B C;  1J0G A;  5FK9 C;  2IDY A;  2BGF A;  1J7A A;  4XDC A;  4NNJ B;  2KWU B;  3AE3 B;  2A4Z A;  4II3 B;  1WXS A;  2N7J A;  2NTS A;  2MW5 A;  4G3X B;  2EKI A;  4AOF A;  2JY6 A;  1LM8 B;  2IYD B;  2HDE A;  3A9K A;  1ACC A;  1NDD A;  1WJU A;  3N20 C;  3L4P A;  2GBR A;  4HPL B;  3S2A A;  1C9F A;  1WIA A;  2BW2 A;  3NUH B;  1WXM A;  3HK0 A;  4EKU A;  3DVG X;  3RYT A;  2INN E;  2KTF A;  3QX1 A;  1GG3 A;  1SJE D;  2KFK B;  1XO3 A;  1IYF A;  3T3O A;  4AJW A;  3GB1 A;  3PSE B;  2JRH A;  4REZ A;  4IW0 A;  4KIK A;  2VRR B;  3KQ4 A;  4JWS C;  4J6I A;  2PVO D;  1WXV A;  2IJ0 A;  3KW5 B;  2N7E A;  1VZ8 A;  2KAC A;  1L7Y A;  2C60 A;  4DXG A;  4A6Q A;  2KQ7 A;  3SHQ A;  2D07 B;  1I35 A;  3QAQ A;  4RMA A;  2JUO A;  5KHQ A;  4PS8 A;  2LVO A;  1E8W A;  3DBR B;  1QIL A;  3UQB A;  5IA7 A;  1WGR A;  4EEW A;  1PQS A;  3DWM A;  1GC7 A;  1DOX A;  2OHF A;  5JHB A;  1OQR A;  3PHW B;  4TQ0 A;  2MBQ A;  4I6L B;  1FO4 A;  2DNF A;  4MEM A;  3ETR A;  2XNA C;  3K9O B;  4HJK A;  2WX0 A;  3W1Y A;  4ZYS A;  2ZNV C;  1LXD A;  3GS2 A;  3HM6 X;  3AXC A;  1WGY A;  1FNV A;  2DYM A;  2N9K A;  2DX5 B;  4KV2 A;  4XZ4 A;  2ACZ B;  1YMH E;  4FA6 A;  2GMI C;  4RGN A;  1PDX A;  2DYO A;  2G4S A;  4ICV A;  3B08 A;  3H7P B;  5L95 C;  3NVV A;  2DZM A;  3RD2 A;  3NZS A;  2FCM A;  1CQV A;  2IBI B;  2K8C A;  1WR1 A;  5EE3 A;  2M0X A;  3UIO B;  2GOW A;  1V1P A;  4C80 A;  2GRI A;  3ZDM C;  4WWO A;  2ICI A;  4P6V F;  1KLV A;  1FXA A;  4HVB A;  2AQ1 B;  3AE2 B;  3I57 A;  2K6Q A;  2W3S A;  2O6V A;  5LLI A;  1YNT E;  3UQA A;  4W9J A;  1B9R A;  1KM7 A;  2CHX A;  1Y8R C;  1XT9 B;  4YT0 B;  2DWQ A;  3L0W B;  2AWT A;  1E90 A;  1YJJ A;  2G4D B;  2DZK A;  1YX6 B;  2MBB B;  1KOT A;  4W9G A;  3TEZ A;  4HJG E;  1C76 A;  3OLM D;  2LGD A;  1VRA B;  4B95 A;  3UI3 A;  1V6E A;  2JT4 B;  1L4D B;  3QK0 A;  5FR6 A;  3H6N A;  4YSY B;  5G5G A;  3ZRC A;  4PK1 A;  1NI2 A;  1TS4 A;  1OQY A;  2LFI A;  2UYZ B;  4AS1 A;  1C1Y B;  2B3A A;  2BS2 B;  4WWP A;  2NBW B;  1VJK A;  2FCQ A;  4XC2 A;  3RNG C;  3B2F A;  4W9I A;  2PW9 A;  1ZOY B;  3MC0 B;  2LZ6 A;  1IGD A;  3OJ4 B;  2RDG A;  3NS1 A;  5J17 A;  2JXX A;  2KVZ A;  1F77 A;  1RWS A;  1JML A;  1R4N I;  2G45 B;  1DOY A;  1EUV B;  5IOI A;  3RN9 C;  4HDQ A;  2KDB A;  3ZQ4 A;  1ENF A;  2TSS A;  3DBL B;  4ZYN A;  3E9S A;  1WJ4 A;  3U7Z A;  3TIX A;  2L1A A;  1L5P A;  2WXR A;  1ZKH A;  3AED B;  3DQV A;  5BYQ A;  3VTW A;  2WXL A;  2ZW0 A;  2H89 B;  4HEA 1;  4KSK C;  4PYZ A;  3UF8 A;  4LNI A;  2IO2 B;  1SJH D;  3AE7 B;  4OZA A;  4BOS C;  4RF1 A;  1D4B A;  3AE6 B;  3KYC D;  2K6D B;  2HTM E;  4RCO A;  1GJZ A;  4A3O A;  2J0J A;  2JZ3 B;  2D3B A;  1N63 A;  3DWG C;  1N62 A;  2KOX A;  4HRO A;  1WGD A;  1WJ6 A;  2AYO B;  1IUE A;  3TEX A;  5G55 A;  1AW7 A;  3H7P A;  1V80 A;  2IGH A;  3R7Q A;  4A3P A;  2KLC A;  3GP7 A;  4YSZ B;  2LAS A;  2EEL A;  1B1Z A;  4L1B A;  2DHZ A;  3BVM A;  3IG3 A;  3OAW A;  5D3I B;  3IT6 B;  4WWN A;  2KJR A;  4US9 A;  3EC8 A;  4YTM B;  3EFC A;  2NTT A;  3TCA A;  2BYT A;  2LRU A;  3JVZ X;  5DPW A;  2UWQ A;  4WQO B;  1N6Z A;  4NAW A;  3VQI A;  3QC8 B;  4BVU C;  2FCN A;  2KAN A;  4OW0 A;  3DBR I;  2WXG A;  4JPS A;  1ET6 A;  2WHI A;  4FUL A;  3MHZ A;  3QJZ A;  4MJS B;  4S17 A;  1L6V A;  3BYY B;  1WMH B;  1DOI A;  2ZJD A;  2KX3 A;  4KSL C;  1Z5S B;  2KWD A;  3ZNZ B;  1CJE A;  2IZV B;  1D5M C;  1ZW7 A;  4DK5 A;  1TS2 A;  4XWW A;  1E7P B;  2BWF A;  3K9P B;  3T3N A;  4XWT A;  1SXT A;  2N4F A;  2QHO A;  3ZNG C;  3A4S C;  1YD8 U;  2BB5 A;  2Q5W D;  3C19 A;  1LO5 D;  2LHD A;  2JXT A;  3Q3F A;  4XDD A;  3VFK A;  4K1R B;  3QIJ A;  1E6E B;  1ZDX A;  2WNM A;  3QA8 A;  3TJP A;  3R66 C;  1JWU D;  3AEF B;  2FCS A;  2KTR B;  3ZTC A;  1YJ1 A;  1ESF A;  3DOW A;  4DDI D;  3QQ8 B;  3P4Q B;  5EE0 A;  3A9J B;  3ZXR A;  3WIM A;  5DPT A;  4LNF A;  1N5X A;  4HXD A;  2L32 A;  4RH6 A;  4DXF A;  5HHD G;  3MTN B;  1ZDV A;  1NEN B;  1YOV B;  4LJO B;  1V8C A;  2KDE B;  1E8Z A;  1J19 A;  3ZLZ A;  4W9H A;  4ZHP A;  2WWZ A;  1TT5 B;  2HE7 A;  1P7E A;  3KWV A;  1C79 A;  2QC8 A;  1P0R A;  2KK8 A;  2D3C A;  2ZEQ A;  3VVW B;  2QIL A;  3AU5 A;  5BYR A;  1FM0 D;  1C3T A;  3HIZ A;  4H2A A;  4TV3 A;  1XD3 B;  5IKC M;  4JGH B;  3RT3 B;  1EWY C;  1FRD A;  2CU1 A;  2W54 A;  1FEH A;  3X23 A;  1WF9 A;  1FIQ A;  2ON8 A;  4GN1 A;  2DAJ A;  3V6E B;  4GOC A;  3DCG A;  1WRD B;  2I2Y A;  2K3U A;  4IKG A;  4BKG A;  1MJD A;  5D94 A;  3KVF B;  3DBL I;  2N7D A;  1KLU D;  2E3T A;  3ENE A;  1TS3 A;  2W9N A;  4JE3 B;  4LJP B;  4USA A;  3IBE A;  3NY5 A;  4E74 A;  3PRP B;  2GLS A;  2N9L A;  3MC9 A;  2L00 B;  2LVQ A;  4MGY E;  2R2O A;  1UH6 A;  3Q14 C;  4AWJ A;  1C4A A;  5HG2 A;  2Y3A A;  4NJC A;  2NPT B;  1EWC A;  4HWI B;  4ZOH C;  3DHH C;  2Z8L A;  2FAZ A;  1V5T A;  1JWB D;  2PIA A;  4A90 A;  3NG0 A;  3AB5 A;  4MJS A;  3U52 E;  1N5W A;  1GC6 A;  4XGA B;  3R3M A;  1WMH A;  3VH3 B;  3RFZ B;  3Q6B A;  3ZJT A;  1VZ7 A;  1I42 A;  2IGD A;  2BWE S;  3NS8 A;  2LJI A;  3HUI A;  4MAC A;  2J7Q B;  1JCK B;  1XCQ L;  1ZXH A;  1I4R A;  3IFW B;  3ZGZ A;  4OVV A;  1UBQ A;  1FNU A;  4BZA A;  1HTQ A;  4ANV A;  4G50 A;  1I4H A;  1KJT A;  5KHO A;  3RZW C;  2OED A;  1OTR B;  3LYY A;  4L2Y A;  5J18 A;  1YN4 A;  3VTV A;  2X38 A;  3R7R A;  2LUE A;  3I3T B;  1WR6 E;  2KZR A;  3OG5 A;  3W5U B;  1JWM D;  2D11 A;  3Q8A A;  2HJ1 A;  2J0M A;  3CF6 E;  4GDK A;  2KTR A;  2B76 B;  5MPO A;  3N32 A;  4I6N B;  4MGK E;  5BMG A;  1V9J A;  2WXF A;  2MBO A;  2QEJ C;  1T6B X;  3A9J A;  2WU5 B;  2JVC A;  4PS7 A;  2QSD A;  4E71 A;  4M8M A;  2JRI B;  3P4P B;  1E7U A;  2L83 A;  3P1M A;  2L52 A;  4M8N A;  5D2M B;  3IAM 1;  1L6U A;  2VZK D;  4EOY A;  2V4L A;  4FJV B;  1P9D U;  4IM2 A;  4DQO C;  3LB8 C;  1CMX B;  5AUI A;  4ZRP A;  3M95 A;  1K8R B;  3PRZ A;  1WX7 A;  1FRR A;  1SIJ A;  5E6P A;  2LHE A;  2OJR A;  4ITK A;  2ZCB A;  1UGM A;  2MBE A;  4IWP A;  4JL9 A;  2ZZP B;  2LGX A;  1TKY A;  2SAK A;  3QWZ B;  5CTR C;  4HKZ E;  1TKE A;  3WAL A;  4FLH A;  1V81 A;  1GPX A;  4B0E A;  2M0A A;  4WIP A;  3SD5 A;  2PPH A;  1F1H A;  3B9J A;  3PO0 A;  1UWX A;  3HHM A;  1VZ6 A;  4NPN A;  3NVY A;  3ZVV A;  4LTU A;  3L54 A;  1XCT L;  3N1Z C;  1JQ4 A;  3RUL A;  3WAP A;  3R2I A;  1RM6 C;  3N9Y C;  3FIL B;  1MFW A;  2MQJ A;  2RR9 A;  3Q8C A;  4WJP A;  2C7N B;  1OEY J;  3GZN B;  1XF5 L;  2WXK A;  4AQ7 A;  1J8C A;  4MSM B;  1S1Q B;  3CSF A;  1T0R C;  3AU4 A;  3BK1 A;  1WZ0 A;  5BMI A;  3RZF A;  2WX1 A;  4US8 A;  1XEE A;  5FR3 A;  1NI3 A;  2NPT A;  5E6J A;  2AL3 A; 
#chains in the Genus database with same CATH homology
 4K7U A;  2LI5 A;  4ZYN A;  3LJ3 A;  1WJ4 A;  3H7S A;  4DHJ D;  3TIX A;  4DBG A;  2MP2 B;  1WY8 A;  1ZKH A;  3DQV A;  4GDK B;  5L83 A;  3B0A A;  2LJ5 A;  2GBJ A;  3RCZ A;  1RRB A;  1WZ3 A;  4BFR A;  5JH5 C;  3VTW A;  3L10 B;  2C5L C;  2D2Q A;  2LRW A;  3NZU A;  2CHZ A;  2HTH A;  2MWS B;  4RM9 A;  4ASW C;  1MG8 A;  4KSK C;  4PYZ A;  3UF8 A;  1F9J A;  3IHP C;  2ZPN A;  4M0W B;  5DPS A;  2IO2 B;  2XK5 B;  2KD0 A;  2MLB A;  2MRP A;  4ZRJ A;  4BOS C;  1NBF C;  1V5O A;  2K39 A;  3V61 A;  4GIV A;  3SDL C;  3PVL A;  3KUC B;  5AZG A;  2KMC A;  1WM2 A;  3PZD A;  1YX5 B;  3APD A;  3KYC D;  2N1V A;  2K6D B;  3ONS A;  4GGQ A;  1GJZ A;  1GUA B;  4A3O A;  2J0J A;  2JZ3 B;  1V49 A;  3UGB B;  2MSE D;  3ML9 A;  2KOX A;  1EO6 A;  2Z0E B;  1P98 A;  4HDO A;  3AI5 A;  1EF1 A;  1WGD A;  1WJ6 A;  3A9K B;  2AYO B;  2K1F A;  4II2 B;  1Z2M A;  1WX8 A;  2Y5B B;  4TUU A;  3PV1 A;  4W9L A;  5G55 A;  1TBE A;  3H7P A;  3JSV A;  1V80 A;  3R7Q A;  4A3P A;  2K8B A;  1JRU A;  1EF5 A;  2KLC A;  2LAS A;  4IUM B;  5DPR A;  4IWO A;  3VUY A;  4YL8 A;  2JZZ A;  4NJ6 A;  1E7V A;  1HE8 A;  2DHZ A;  2EKE C;  2KMA A;  3IG3 A;  2REX A;  4W9D A;  3OAW A;  5GMV A;  2M4N A;  4BKS A;  2L3Z A;  2JWZ A;  4WWN A;  4CYE A;  3VTU A;  3VHT C;  2KJR A;  1YIW A;  1T0Y A;  2Z59 B;  3BY4 B;  3ZTD A;  2ZVO A;  3VH4 B;  3EC8 A;  1UBI A;  3W1S C;  5CHW A;  3PGE A;  3TCA A;  3A4R A;  2LRU A;  3ZNI D;  3TL5 A;  3JVZ X;  5DPW A;  2UWQ A;  3NOB A;  3APC A;  4KIK B;  4WQO B;  3WAO A;  4NAW A;  1OGW A;  3VQI A;  3QC8 B;  4BVU C;  2FCN A;  2KAN A;  4EZL A;  2KO3 A;  2NCN A;  2M8S A;  2DZI A;  3DBR I;  4GU2 A;  3ZW3 A;  5IAA C;  3VDZ A;  2R2Q A;  2IO0 B;  2LGY A;  2KNB A;  4FUL A;  2C7M B;  4XZ4 A;  3DBS A;  2KJH B;  2O6V D;  3QJZ A;  3QAR A;  5BO4 B;  4FN2 A;  5D6J B;  3WAM A;  2D3G A;  1RFA A;  4KVG B;  2GBK A;  4FJZ A;  2LXC A;  2BF8 B;  3M62 B;  3PT2 B;  4MJS B;  3IVF A;  3T9L A;  5EDS A;  1SIF A;  1ISN A;  3ZRF A;  3HM3 A;  4F1S A;  2GBM A;  1WMH B;  1LQB A;  2ZJD A;  2KFK A;  2KX3 A;  4KSL C;  1Z5S B;  4X57 B;  3ZNZ B;  4NQK E;  4WJO A;  4BKS D;  4EZK A;  3V6C B;  5LXH A;  1WGH A;  2MBH A;  2IZV B;  3AUL A;  1ZW7 A;  4DK5 A;  2RD0 A;  2FUH B;  5JHA A;  4MDK E;  3L17 A;  4DHZ E;  2FIF A;  2FNJ B;  2BWF A;  3ECI A;  3DPD A;  3ZNH B;  1S3S G;  3K9P B;  1D3Z A;  4WJQ A;  2MCN B;  2N4F A;  2KJ6 A;  1L2N A;  2PE6 B;  2K25 A;  2NVU I;  5E6N A;  2QHO A;  3BIN A;  4FHJ A;  5DCN A;  3ZNG C;  2L05 A;  3A4S C;  3EEC A;  1YD8 U;  3D32 A;  2V1Y A;  1UEL A;  2IO3 B;  3N30 A;  1FXT B;  3Q3F A;  2HD5 B;  1WFY A;  3VFK A;  2O2V B;  2L76 A;  3GOE A;  4K1R B;  2LVP A;  3QIJ A;  2XEW A;  2KFJ A;  1WJN A;  3QA8 A;  3TJP A;  5LXI B;  3R66 C;  2KQS A;  4MGI E;  1V2Y A;  4WJN A;  2GBN A;  2FCS A;  2KTR B;  1TTN A;  3ZTC A;  2IO1 B;  2CS4 A;  1E8Y A;  1YJ1 A;  3DOW A;  1WX9 A;  2N1W A;  1RAX A;  1H8C A;  2IY1 B;  4HCP B;  4GDL B;  2L7R A;  2WYQ A;  4DDI D;  3QQ8 B;  3V60 A;  2L8J A;  2YLM A;  2L0T A;  3A9J B;  4IM3 A;  4JQW C;  4AJY B;  1YQB A;  4JIO U;  3WIM A;  3U8Z A;  5CHF A;  5DPT A;  1I35 A;  4A20 A;  4JLC A;  2CHW A;  4ZRK A;  5AZH A;  4GB9 A;  2M17 A;  4ANU A;  2N9E B;  1UD7 A;  3M3J A;  1WE6 A;  4HXD A;  5AZF A;  2K8H A;  3L16 A;  2HJ8 A;  3MTN B;  4F8C B;  4W9F A;  4BKT A;  4LJO B;  1AAR A;  4URK A;  1Q0W B;  2C7H A;  2LD9 A;  2KWC A;  2MP2 A;  4DDG D;  5J2R A;  2A5U A;  2ZCC A;  1E5W A;  4WAA A;  4P7I A;  2O6V B;  2KDE B;  1E8Z A;  1J19 A;  2KDI A;  3UIP B;  4W9H A;  3ZLZ A;  4LDT D;  4ICU A;  4KDI C;  2BYE A;  2WWZ A;  4B9K A;  1VCB A;  4MH0 E;  2ASQ A;  4K81 A;  4G0N B;  4W9K A;  2HE7 A;  2YVC A;  4IM0 A;  4AUQ C;  2XK5 A;  3N3K B;  1P0R A;  4GSW A;  4F7Z A;  2Z0D B;  3OJ3 A;  4E3C A;  5CHV C;  2KK8 A;  3MJW A;  1J0G A;  1RLF A;  1WYW B;  2ZEQ A;  3VVW B;  3AU5 A;  3QHT A;  3SU8 X;  2BGF A;  3U30 A;  4IWQ A;  1C3T A;  4NNJ B;  3HIZ A;  2KWU B;  4TV3 A;  1XD3 B;  3L08 A;  2A4Z A;  4II3 B;  5E6O A;  1WXS A;  4JGH B;  2MW5 A;  3RT3 B;  4NAW B;  4G3X B;  4I6P A;  4AOF A;  2JY6 A;  4N9F 4;  2KDF B;  1P1A A;  1LM8 B;  2CU1 A;  2IYD B;  4CO7 A;  2CR5 A;  1H4R A;  3A9K A;  3V62 A;  1NDD A;  1WJU A;  3X23 A;  3TBL D;  1WF9 A;  2GBR A;  3GZN I;  4GN1 A;  2RGF A;  3DVN V;  3PTF C;  4HPL B;  4MSQ B;  3S2A A;  3U7D A;  1WIA A;  4DHJ B;  2DAJ A;  3A1Q B;  3ML8 A;  1WXM A;  3V6E B;  5CX3 A;  4GOC A;  4B6W A;  3DCG A;  3HK0 A;  4EKU A;  3DVG X;  1WRD B;  3RYT A;  4BKG A;  2D10 A;  2I1K A;  5D94 A;  4KZ0 A;  4DWF A;  2KTF A;  3QX1 A;  3KVF B;  1GG3 A;  2PJH A;  1XQQ A;  2KFK B;  3DBL I;  4KZC A;  1IYF A;  2LWP A;  2N7D A;  3ENE A;  2W9N A;  3JYU A;  4AJW A;  4LJP B;  3EHV A;  3IBE A;  3NY5 A;  4E74 A;  3PSE B;  2JRH A;  3UIN B;  3PRP B;  2BKR B;  1GNU A;  2IY0 B;  4IW0 A;  2DZJ A;  4KIK A;  2L00 B;  2LVQ A;  2VRR B;  2KC2 A;  5G2N A;  4MGY E;  2R2O A;  2WDT B;  1UH6 A;  4AWJ A;  4J6I A;  3VXW A;  2EMS A;  1WXV A;  2L0F A;  4ANW A;  3X0W A;  2NPT B;  3PLV A;  4BBN F;  3KW5 B;  1WI0 A;  4RM8 A;  4HWI B;  2EMT A;  3KUD B;  1Q5W B;  2N7E A;  2FAZ A;  1L7Y A;  4LDT B;  2N9P C;  2C60 A;  1V5T A;  2KQ7 A;  4GMV A;  3SHQ A;  4ZRI A;  4HK2 A;  1BT0 A;  4MJS A;  1IP9 A;  2PE9 A;  4FAD A;  3PRE A;  2D07 B;  4G11 A;  2J0K A;  1WXA A;  1GC6 A;  3QAQ A;  3WA0 A;  2JF5 A;  4RMA A;  2JUO A;  2NBU A;  3R3M A;  1WMH A;  3Q3J A;  4TQ1 A;  3M63 B;  3VH3 B;  4PS8 A;  5KHQ A;  2LVO A;  2KKC A;  1I42 A;  2BWE S;  3NS8 A;  1E8W A;  2V3S A;  3UQB A;  5IA7 A;  1WGR A;  2LXA A;  4EEW A;  2J7Q B;  2RPQ A;  4IG7 B;  3KUZ A;  1PQS A;  1IPG A;  3PHX B;  3ZO5 B;  4DHZ B;  3DBH I;  1LFD A;  1GC7 A;  3IFW B;  4MEL A;  3PHW B;  2N9X A;  5JHB A;  4TQ0 A;  2MBQ A;  4OVV A;  4I6L B;  2KXJ A;  1UBQ A;  5JZE B;  4MEM A;  4OVU A;  2M1M A;  4ANV A;  3K9O B;  4G50 A;  1KJT A;  4HJK A;  2WX0 A;  2BYV E;  5KHO A;  3RZW C;  3W1Y A;  2MX2 A;  2ZNV C;  5TR5 A;  1OTR B;  2NBV B;  5J18 A;  3VAW A;  1LXD A;  3VTV A;  3HM6 X;  1OEY A;  3AXC A;  2KX0 A;  1V86 A;  1WGY A;  2O2V A;  2LUE A;  3R7R A;  3I3T B;  3VUX A;  4EFO A;  1WR6 E;  3ZKJ C;  2DYM A;  2KZR A;  2D11 A;  3W1S A;  2DX5 B;  4KV2 A;  1P3Q U;  2J0M A;  3CF6 E;  4TKN A;  4GDK A;  2G3Q B;  1SGH A;  2KTR A;  1Q1O A;  4HLE A;  2ZVN A;  4FA6 A;  4EZJ A;  2GMI C;  3N32 A;  4I6N B;  4MGK E;  2DYO A;  2G4S A;  1V9J A;  3B08 A;  3CMM B;  4ICV A;  3H7P B;  3JSV B;  4PS3 A;  5L95 C;  3CST A;  4GDL A;  2DZM A;  4ANX A;  3RD2 A;  3NZS A;  4FHK A;  2MBO A;  2FCM A;  2BKF A;  2C9W B;  3PRM B;  3A9J A;  4EUT A;  2CKH B;  2JVC A;  4PS7 A;  3KYD D;  3NHE B;  4E71 A;  3LDZ E;  2IBI B;  2K8C A;  1WR1 A;  4ZDV A;  2M0X A;  4M8M A;  3UIO B;  3ZUN A;  2MA9 B;  2GOW A;  2JRI B;  1E7U A;  3EFU A;  3P2B A;  4XX5 A;  3ZDM C;  3DVN U;  4WWO A;  1KLV A;  4K7W A;  4BBN C;  3ALB A;  4M8N A;  5D2M B;  4HVB A;  3WAN A;  4CHK A;  4EOY A;  2V4L A;  3QCA A;  2K6Q A;  4FJV B;  4NJ7 A;  1QZE A;  1P9D U;  2O6V A;  5LLI A;  4IM2 A;  3UQA A;  5C1Z A;  1CMX B;  4W9J A;  2AL6 A;  1KM7 A;  3MHS D;  2NS5 A;  2CHX A;  2KVR A;  1WH3 A;  1Y8R C;  4W9E A;  4PYU A;  1UZX B;  1K8R B;  3B1L X;  3M95 A;  3KH0 A;  3PRZ A;  4GXB A;  1WX7 A;  1XT9 B;  4MGZ E;  5E6P A;  3L0W B;  3C0R B;  2AWT A;  1E90 A;  2OJR A;  3PLU A;  3PPA A;  2G4D B;  2DZK A;  2PEA A;  2ZCB A;  4IC7 B;  1UGM A;  5D7G A;  2MBE A;  1YX6 B;  4K7S A;  4IWP A;  3VUW A;  2FID A;  4JL9 A;  2MBB B;  1M94 A;  3TMP B;  3T8M A;  2ZZP B;  1KOT A;  2BPS A;  3O65 B;  4W9G A;  2LGX A;  1A5R A;  3H9D A;  2XBB C;  3APF A;  2I1J A;  3ZIM A;  3OLM D;  2ZNV B;  2LGD A;  4B95 A;  4NY0 A;  2KLG A;  3QWZ B;  2ZPY A;  1V6E A;  3ZDT A;  2JPH A;  3L13 A;  5CTR C;  2KC1 A;  2JT4 B;  3RUI B;  3QK0 A;  5FR6 A;  3H6N A;  3WAL A;  2AEH A;  3PS6 A;  4FLH A;  1V81 A;  3ZRC A;  3DDC B;  1R4M I;  2DEN B;  3SD5 A;  1NI2 A;  4BOZ B;  3H1U A;  1OQY A;  1WE7 A;  2UYZ B;  2PPH A;  5HKH A;  1C1Y B;  4HPM B;  4DXA B;  2DYB A;  2B3A A;  1TGZ B;  2KN5 A;  3A1Q A;  3A33 B;  3HHM A;  4WWP A;  5AEK B;  1TZ1 A;  1WM3 A;  4NPN A;  2NBW B;  2FCQ A;  2NR2 A;  3JW0 X;  4FJY A;  2KWV B;  4XC2 A;  4W9I A;  3ZVV A;  4FBJ B;  3L54 A;  2LZ6 A;  3RUL A;  3WAP A;  3OJ4 B;  1WGG A;  4KDL B;  2RSU A;  1ZGU B;  5J17 A;  1X1M A;  1U4A A;  2JXX A;  2KHW B;  4MM3 A;  4NQL B;  4HCN B;  2MQJ A;  2RR9 A;  4WJP A;  4AP4 C;  1VD2 A;  1SE9 A;  2C7N B;  1R4N I;  4LCD E;  1OEY J;  2G45 B;  5C23 A;  2BYF A;  1J8C A;  4MSM B;  1EUV B;  1S1Q B;  3CSF A;  3AU4 A;  1WZ0 A;  1E8X A;  3RZF A;  1G6J A;  4HDQ A;  3DVG Y;  2DAF A;  2KDB A;  2WX1 A;  4W9C A;  2NPT A;  2OOB B;  2AL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...