2BWES

The crystal structure of the complex between the uba and ubl domains of dsk2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, U
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bweS00
3QK0A 1KJTA 3LDZE 4FJZA 1GNUA 3RULA 2KQSA 4MJSB 1KLVA 2LVPA 2K8CA 4EKUA 3QHTA 2NR2A 3BINA 3JVZX 5CHFA 1IPGA 2MBQA 1LXDA 3WAPA 3NS8A 1WJ4A 2JT4B 3HHMA 1WJUA 3N30A 2WDTB 4FHJA 3APCA 4GDKA 3ZTCA 1V6EA 1XQQA 2MSED 3L13A 2KTFA 2JPHA 4ZDVA 2NVUI 3PHWB 4NAWA 1EF5A 3IBEA 4AJYB 2IBIB 2IO0B 2MLBA 3RD2A 4NNJB 3KH0A 3M63B 3D32A 1J0GA 3NY5A 1WX8A 4X57B 1H4RA 2GBKA 3DBSA 3V60A 2M1MA 4M8MA 4E74A 1UD7A 3DQVA 1JRUA 4F8CB 1WIAA 2N7DA 3T9LA 5IA7A 4YL8A 4W9DA 1GJZA 5D2MB 3R7RA 4IC7B 1IYFA 3QA8A 3PV1A 4BBNF 2NPTB 5J17A 3PPAA 4DXAB 2KDBA 2FIFA 1RFAA 1E7VA 2J0MA 4WAAA 4DBGA 3B08A 1NI2A 2NBWB 4WQOB 2WX0A 4KIKB 2L3ZA 1S1QB 3H7PA 4ICUA 3ZTDA 4ZRIA 4K7SA 1LM8B 1YX6B 2FCQA 3P2BA 4JL9A 1WR1A 2O6VB 4II2B 3X23A 1Q1OA 4MDKE 2J0JA 4FADA 2KVRA 3R3MA 4JLCA 1H8CA 4BVUC 1ISNA 2V4LA 2N9EB 2GBJA 2MX2A 3B0AA 3ML9A 3ZIMA 3ZNGC 4GMVA 3ZNZB 1AARA 2N9XA 2HTHA 3UINB 2NBUA 1V9JA 1D3ZA 4NQLB 2JRIB 4EUTA 2G4SA 2G3QB 2KKCA 2KWCA 4MSMB 3X0WA 4W9CA 5IAAC 1BT0A 1CMXB 2D2QA 2KFKB 1WH3A 4WJQA 2BKFA 2FAZA 3AU4A 3DVGX 1EO6A 2O2VB 2C9WB 1RAXA 1WM3A 2R2QA 4IWQA 1WR6E 4MGKE 3TJPA 1R4NI 4A20A 4J6IA 1SIFA 2XK5A 2UWQA 4NPNA 1OQYA 2C7NB 4DHZE 5CHWA 4BBNC 2I1KA 2JY6A 4BKSD 2G45B 3C0RB 3PREA 2D11A 3JSVA 3PT2B 1NBFC 2K39A 5CX3A 4EOYA 2MCNB 4NY0A 3NZSA 4HWIB 3IG3A 3BY4B 5FR6A 4P7IA 3TCAA 1I42A 5DPRA 3L16A 4W9FA 1FXTB 2KMCA 3IVFA 3IFWB 5DPSA 2CR5A 3W1SA 1OTRB 2ZZPB 1WJNA 4ANXA 3PLVA 2MBBB 2UYZB 3N32A 4GIVA 4LDTD 4XC2A 4HCNB 2O6VD 2YLMA 3KW5B 4GU2A 5JHBA 4M0WB 1VCBA 2FCMA 4XZ4A 3L54A 2LWPA 4MEMA 5C23A 2ZCCA 3APFA 3U7DA 2ZVOA 3AULA 3VH3B 4I6PA 4IWOA 4MGZE 3U30A 3KVFB 3DBRI 2N1VA 1WGRA 1X1MA 2MWSB 3TIXA 1TBEA 3L0WB 3V61A 2ASQA 1WFYA 2I1JA 3ALBA 3WAOA 2MA9B 3A4RA 3PTFC 4IG7B 3VUWA 3K9OB 1E7UA 1ZW7A 3HIZA 3PHXB 1K8RB 4ANUA 5JHAA 2KLCA 1GC7A 3UGBB 2A4ZA 1WXMA 2W9NA 4GDKB 4BOZB 3NZUA 4B9KA 2JRHA 2K6QA 4MSQB 5DCNA 4ZRKA 2BYEA 1LFDA 4NAWB 2OJRA 1OEYJ 4ANVA 2K1FA 1UBQA 2CKHB 2LGXA 2BPSA 2KX0A 4TQ0A 2JXXA 2IZVB 3JYUA 4OVVA 4DDID 3PZDA 4PS8A 2KWVB 1VD2A 1RLFA 2J0KA 2KZRA 1WGYA 2L0TA 3R7QA 4AUQC 4TV3A 3SD5A 5LLIA 3KYDD 3VVWB 4KDLB 4AOFA 1WGHA 3ZRCA 1G6JA 4CYEA 5CTRC 2L76A 3TL5A 2AYOB 3QIJA 4MM3A 1SGHA 4IUMB 4JGHB 4F1SA 3V6EB 2GBMA 4HK2A 4DK5A 4M8NA 2LXAA 2N4FA 3DOWA 2GOWA 3H9DA 3DBLI 4TQ1A 2KJRA 4W9GA 3VTVA 3H7PB 2Z0DB 4HLEA 3ZDMC 4A3OA 3PSEB 2ZNVC 2BWFA 1WM2A 3ONSA 4GOCA 1T0YA 2BWES 4ANWA 4DHJB 3DVNV 2JZZA 3SHQA 1P9DU 4ZRJA 2ZVNA 1YX5B 3CMMB 1WYWB 2KDEB 3NHEB 4PS7A 3HK0A 3QWZB 2MBOA 3QAQA 1WZ0A 3MHSD 1J19A 2BF8B 4KZCA 3UIOB 2FCSA 1Y8RC 3GZNI 4JIOU 1XD3B 3U8ZA 3QQ8B 3ZNHB 3PRZA 4B95A 4GGQA 1UZXB 5AZHA 2KMAA 1EF1A 2JVCA 2KJHB 2JF5A 4KSLC 5GMVA 2Y5BB 3RYTA 2KN5A 1WE6A 3CSTA 3VQIA 2L7RA 2JZ3B 3Q3FA 2KXJA 2XK5B 2IO3B 3UIPB 1TTNA 1V5OA 3KUDB 3ECIA 1HE8A 3M95A 1S3SG 3EFUA 3JSVB 3ZW3A 1WX7A 4MGYE 3EC8A 4AJWA 3ZVVA 4FHKA 3M62B 4KDIC 3PGEA 2IY1B 3ZKJC 3H1UA 4G0NB 3ZNID 4DHZB 1WRDB 4HJKA 2BYFA 2LUEA 4FULA 3PRPB 4FN2A 5DPTA 3N3KB 2Z59B 2R2OA 4BKSA 4HXDA 2PE9A 4AWJA 3DDCB 4BKGA 3CF6E 4IW0A 2V1YA 2KNBA 1UBIA 2DAFA 2WWZA 3DPDA 3JW0X 4EZLA 2LASA 3A9JA 3VDZA 2LRUA 2RD0A 3V62A 3WA0A 2MQJA 3APDA 2MBHA 2OOBB 3LJ3A 3RT3B 5TR5A 3RZFA 2G4DB 1UH6A 2ZJDA 2DZMA 1OEYA 3L10B 2AL3A 2L05A 2O6VA 1GG3A 4KZ0A 1KOTA 3T8MA 3A1QA 5E6PA 3VFKA 2C7HA 2DAJA 3W1YA 2DHZA 3UQAA 4EZKA 2MW5A 3TMPB 5EDSA 4A3PA 3L17A 1WMHA 4KV2A 2N9PC 2FNJB 2LVOA 4W9JA 1Q0WB 2KWUB 4FBJB 3VUXA 3H6NA 4BFRA 3I3TB 1NDDA 2AWTA 1L2NA 1WJ6A 2KTRB 1TZ1A 1WF9A 2GMIC 5E6NA 1P0RA 2LXCA 3R66C 2DENB 3ZO5B 2HJ8A 3VUYA 1MG8A 4PYUA 2K6DB 3AXCA 4W9IA 2KDFB 5HKHA 5D7GA 2CHXA 2L8JA 3QJZA 4LCDE 1GC6A 2AL6A 2D10A 2KX3A 2CHWA 2HE7A 3Q3JA 3MTNB 3RCZA 2C5LC 3A9KA 2YVCA 3HM3A 4EFOA 1WGGA 4E71A 2C60A 3SDLC 3QCAA 4RM8A 5LXHA 5J18A 1OGWA 2MRPA 2MP2A 1IP9A 2QHOA 3AI5A 5JZEB 1UGMA 3DCGA 1V80A 4IWPA 4HVBA 4GXBA 4LJOB 1PQSA 4IM0A 2M4NA 2M8SA 3B1LX 4OVUA 2RPQA 2JWZA 3QARA 3VH4B 1P1AA 2B3AA 3DVNU 2BYVE 2IO1B 3M3JA 1WZ3A 3ENEA 2KDIA 2AEHA 2ZPNA 4GDLA 1XT9B 1WXSA 4II3B 4TUUA 1WXAA 2DYOA 4RMAA 4CO7A 2L00B 3O65B 2RR9A 4W9LA 3QC8B 1V2YA 2EMSA 2KO3A 4WWPA 5KHQA 3VTUA 2XEWA 2LRWA 4I6NB 3PLUA 3L08A 2BGFA 3UQBA 2IYDB 3K9PB 3PVLA 3PS6A 2CU1A 1LQBA 2N1WA 2GBRA 2KK8A 4ZYNA 2L0FA 4K7UA 3DBHI 2LGDA 4EEWA 5JH5C 4WWOA 2CS4A 3OLMD 1V81A 2REXA 4MELA 4FA6A 5KHOA 5DPWA 3NOBA 1GUAB 2FUHB 2GBNA 4RM9A 4IM3A 4PYZA 1YQBA 4K1RB 2KHWB 4JQWC 2KLGA 3HM6X 1M94A 3DVGY 5E6OA 4MJSA 4WJOA 4G11A 3OJ3A 2LVQA 1V5TA 4N9F4 1F9JA 2PPHA 1I35A 3KUCB 1WY8A 4I6LB 4DWFA 4G50A 2DX5B 5J2RA 3VXWA 2LD9A 2FCNA 5G2NA 3S2AA 2N7EA 4GSWA 1ZKHA 4IM2A 4ASWC 4HPMB 2DYMA 2KOXA 3WANA 3ZLZA 3A9JB 1Z2MA 2WYQA 3MJWA 3PRMB 3OJ4B 2DZIA 2J7QB 3ML8A 3WIMA 2DYBA 2IO2B 1ZGUB 2M17A 3EECA 4LDTB 1P3QU 4BKTA 3ZUNA 5AEKB 2NS5A 4URKA 1EUVB 3CSFA 1E8YA 4DHJD 1C1YB 3A1QB 1U4AA 3UF8A 2RSUA 2VRRB 2IY0B 2NPTA 4W9KA 3V6CB 4K81A 5LXIB 2D07B 1WX9A 3KYCD 2EMTA 3KUZA 1WMHB 2KANA 3WALA 4ICVA 4KIKA 2XBBC 2PE6B 1WGDA 2LGYA 3SU8X 2C7MB 2D3GA 2ZEQA 3A4SC 4WWNA 2K8HA 1KM7A 3VHTC 2KFJA 2K25A 4DDGD 2KQ7A 4HDQA 2BKRB 4W9EA 4FJYA 5D94A 4E3CA 3ZDTA 4MH0E 1WXVA 4NJ6A 4CHKA 4XX5A 1WI0A 4FLHA 2DZJA 4NQKE 2M0XA 2NBVB 5AZFA 1E5WA 1E8XA 2EKEC 3A9KB 5L95C 2ZPYA 2PEAA 1RRBA 5BO4B 2KFKA 3GOEA 1YJ1A 2LI5A 4KSKC 2ZNVB 1V86A 2O2VA 3VTWA 4TKNA 4GN1A 2MBEA 2MP2B 3RZWC 4GB9A 1E90A 1A5RA 1YD8U 4KVGB 3RUIB 2K8BA 3EHVA 4EZJA 1V49A 2KD0A 4FJVB 2A5UA 1R4MI 2FIDA 2Z0EB 4BOSC 3AU5A 3IHPC 1YIWA 4W9HA 3A33B 2KC2A 4PS3A 3ZRFA 2KC1A 2KJ6A 1Z5SB 2CHZA 2WX1A 1L7YA 4GDLB 5AZGA 3WAMA 1Q5WB 5G55A 1SE9A 5C1ZA 3TBLD 1J8CA 2DZKA 5L83A 1TGZB 2JUOA 1P98A 4HCPB 5CHVC 2ZCBA 4WJPA 1QZEA 2RGFA 5D6JB 2LZ6A 4F7ZA 3W1SC 2PJHA 1C3TA 2HD5B 4HDOA 4WJNA 1WE7A 3QX1A 4B6WA 4HPLB 3VAWA 1UELA 2V3SA 1E8WA 3OAWA 4LJPB 4MGIE 4G3XB 2KTRA 2LJ5A 4K7WA 1E8ZA 4NJ7A 2NCNA 3H7SA 4AP4C
chains in the Genus database with same CATH superfamily
3LDZE 2KQSA 3NUHB 1VZ7A 4EE2A 2K8CA 3VR9B 2WXRA 1IPGA 1LXDA 3FAHA 2MSED 1EF5A 1YJJA 3B2GA 2IO0B 1F52A 1CK1A 1D4BA 1J0GA 1SEBD 1N63A 1WX8A 4F8CB 4E74A 1NYQA 1GB1A 5IA7A 2VZKD 5HI1A 5D2MB 1IYFA 3PPAA 1E7VA 4WAAA 3CIRB 4WQOB 3WCQA 2WX0A 4YTMB 2L3ZA 1K51A 3H7PA 4ICUA 2L52A 3ZTDA 4ZRIA 1HZ6A 1ISNA 3AE3B 2ZW1A 3B0AA 3TEYA 3HUIA 1QILA 2HTHA 2G4SA 4RNAA 4MSMB 1NI3A 4W9CA 5IAAC 2PMVA 4HROA 1L4ZB 2WXHA 1EO6A 1FD6A 1ZUD2 2O2VB 2R2QA 4MGKE 4J6IA 2UWQA 4NPNA 1PYWD 5BYSA 2I1KA 3Q3MC 5AUKA 1ENFA 1TS5A 4EOYA 4C4VB 3AH7A 3IG3A 3BY4B 2LHDA 4P7IA 3RN9C 3TCAA 3L16A 2HDEA 3IVFA 3W1SA 1OTRB 2MBBB 4YSXB 4LDTD 3Q3NC 2O6VD 1XCTL 2K9XA 2LWPA 4MEMA 4JX1C 3P63A 3Q8BA 2N1VA 1IUEA 2X8XX 3L0WB 2ASQA 3ALBA 4C80A 2CU3A 3RNFC 4ZOHC 1WWTA 3VUWA 2PKOA 1P7EA 2KLCA 1WXMA 2W9NA 4FXCA 4GLSC 1Y56A 2JRHA 2BYEA 1D6EC 4US9A 2OJRA 2K1FA 1UBQA 1HTQA 2KAJA 2CKHB 1T5XD 4WURA 3JYUA 3PZDA 4PS8A 2QIEB 1VD2A 1RLFA 3HRDD 3Q6BA 2J0KA 4RGTA 1WGYA 2L0TA 4TV3A 3VVWB 3KYDD 3SFEB 1WGHA 2MJ3A 5CTRC 1SGHA 4KGSA 1DYQA 3N20C 4IUMB 2M19A 2GOWA 3DBLI 4A3OA 2PVGC 3MC8A 3ONSA 4DHJB 4ANWA 3KLSX 1YX5B 1R4MB 3CMMB 4PS7A 3OG5A 1N6ZA 1WZ0A 1SF0A 5FR3A 1Y8RC 4YXDB 1SB3C 3ZNHB 4B95A 4L2YA 2J52A 2KMAA 1EF1A 2JVCA 3RYTA 4B0MA 1BXTA 1CZPA 2X38A 3Q3FA 2XK5B 2IO3B 1V5OA 4C7ZA 1N5XA 3ECIA 1S3SG 3EFUA 4MGYE 3ZVVA 4ZYSA 2QEJC 3ZQ4A 3ZNID 5EE9A 1WRDB 4C56C 2BYFA 2PVOD 2JZPA 1WRIA 1FCCC 3AE7B 2KVZA 2ZW0A 5BMIA 2WWZA 1V8CA 3DPDA 1OQRA 1L5PA 1RYJA 3LJ3A 3RT3B 5TR5A 4JPSA 2N9KA 2AL3A 2O6VA 2WU5B 1WXQA 2INCC 3AEGB 3DHGC 4KV2A 3ZXVA 2N9PC 1GAQB 2AX5A 1K52A 4BFRA 3I3TB 1WJ6A 1WF9A 2Z8LA 2LXCA 2OJWA 2DENB 2HJ8A 4PYUA 4KGRA 2B76B 2KDFB 2PLPA 2WXQA 4Q2JA 1B1ZA 2D10A 4BZAA 3MTNB 2C5LC 2YVCA 1SJHD 2C60A 4MM3B 2QSDA 3BYYB 4RM8A 2FBWB 5LNK1 1C4CA 4XDCA 3DCGA 4ARCA 4GXBA 2M8SA 2JWZA 3VH4B 3DVNU 3B2FA 2BYVE 2IO1B 3ENEA 2KDIA 2DYOA 1NEKB 1YMHE 2LGSA 3O65B 2RR9A 1KLGD 2I38A 3PLUA 2BGFA 2N9LA 5EE0A 3K9PB 3AN1A 4ZYNA 3R2IA 4LNNA 4EEWA 2CS4A 4PT5A 3AE4B 1C9FA 4A55A 1GUAB 2FUHB 4RM9A 2KLGA 3HM6X 2W54A 3DVGY 4WJOA 1UGJA 1HTOA 2PPHA 1RM6C 1WY8A 1GOZA 1L0XB 3S2AA 3E56A 4HPMB 3RNCC 3ZGZA 3BYTB 3A9JB 2WYQA 3IT6B 3PRMB 3BK2A 1ZE3D 1EU4A 1IGCA 2LHEA 3WIMA 2IO2B 1ZGUB 4BKTA 3CSFA 2JX5A 1T0QC 4YWGG 2M0AA 3KYCD 3GE3C 4DXGA 4KKIA 2KANA 4HKQA 3SU8X 4K3CA 2K8HA 3VHTC 3Q14C 1SBBB 1F2RC 2BKRB 4E3CA 4MH0E 4WH4A 3MC9A 3BVZA 2OEDA 2WXIA 4NQKE 2NBVB 1E5WA 3DHHC 2UU7A 1DOIA 2KFKA 2MJEA 4WIPA 4GN1A 4WWMA 4ZRPA 4DQOC 4GB9A 1E90A 1AWDA 5G5GA 1YD8U 4KVGB 1VZ6A 1TIFA 3EHVA 1CQVA 2KD0A 1IBXA 3IHPC 1YIWA 3ZRFA 2KJ6A 1JWUD 1KH0A 1SE9A 5C1ZA 4DXFA 3TBLD 1TZOA 2DZKA 2Y3AA 1MJDA 1TGZB 2JUOA 3I57A 1QZEA 2KMMA 4ACFA 4IKGA 2LZ6A 2PJHA 2HD5B 1WE7A 3PZ7A 2K22A 2WXJA 3N1XC 2KTRA 1E8ZA 3B9JA 2NCNA 4AP4C 5BMGA 1ZP0B 1GNUA 1HZ5A 4MJSB 2LVPA 4P6VF 4EKUA 3BINA 5EE3A 3NS8A 1WJ4A 3N30A 2W3SA 2N0SB 2WDTB 2KWDA 3TEXA 1XQQA 4B0EA 2NVUI 3PHWB 4NAWA 4RGMA 3IBEA 4AJYB 3P4QB 1RWSA 1MG4A 3NY5A 1ZPSA 4X57B 3DBSA 1UD7A 3DQVA 2N7DA 1GJZA 2IGGA 1WSPA 3R7RA 3MJ5A 3QA8A 3PV1A 3TUOA 1FM0D 1QOGA 4DXAB 4LNKA 2FIFA 4DBGA 1MVKA 3B08A 3AE2B 4KIKB 1S1QB 1KTKA 4K7SA 1LM8B 1YX6B 1JQ4A 1WR1A 1T0RC 3X23A 2J0JA 1N62A 1FRRA 4NZLB 1FNWA 2V4LA 2GBJA 2JWUA 2KN4A 3ZNGC 3ZIMA 4GMVA 1AARA 2N9XA 1QT9A 4EUTA 4XE0A 4C00A 1CMXB 2KDMA 1WH3A 2BKFA 3AU4A 2C9WB 1RAXA 1WR6E 2C7NB 4AQ7A 2CJOA 1N60A 1TJEA 2G45B 3PREA 2D11A 3JSVA 1TT5B 3ZYYX 4NY0A 3NZSA 2MJDA 3KWVA 3LYYA 5JXVA 4W9FA 4PK1A 3LXFA 5DPSA 2ZZPB 1WJNA 3BVMA 2UYZB 4GIVA 4HCNB 3MC0B 2J42A 5JHBA 1VCBA 3L54A 2QJLA 3DWMA 2ZCCA 1C78A 3U7DA 3AULA 5C3JB 3I63C 4IWOA 3U30A 3KVFB 5H92C 1WGRA 3AE9B 2INNE 1V1OA 2MWSB 1STEA 3N1YC 1TBEA 4XWTA 1WFYA 4YSZB 3WAOA 4RF0A 1ZW7A 3HIZA 1KLUD 1K8RB 2KT7A 5JHAA 3R2TA 4S0RA 2RDGA 4BAXA 2AQ1B 4ZRKA 1LFDA 1OEYJ 1N61A 4RCOA 2E3TA 4TQ0A 1R4NB 1KRHA 3I5JC 2WS3B 2KZRA 1JWMD 4P1CC 5LLIA 1G6JA 3L4PA 4CYEA 1FO4A 2K3UA 3QIJA 1F77A 1JWSD 2GBMA 4HK2A 2IGHA 4M8NA 2WXNA 3DOWA 3VTVA 2WHIA 3H7PB 4HLEA 3ZDMC 2BWFA 1T0YA 1ESFA 2V3NA 3SHQA 2ZVNA 3NHEB 1UWXA 3QWZB 4N6EB 4OZAA 1YN4A 3AE8B 1J19A 3DBRB 3UIOB 2FCSA 4NJCA 3P42A 3IAS1 1XD3B 3QQ8B 4GGQA 1UZXB 4HPPA 5GMVA 2KN5A 2MH7A 2R61A 1FFVA 2L7RA 3UIPB 1TTNA 2WDVB 3M95A 2ONQA 1FXAA 1WX7A 3ZW3A 2H88B 3J9CA 4FHKA 2LJIA 3P4SB 3ZKJC 4REZA 4G0NB 4DHZB 2JSVX 2BS4B 1N5WA 2L1AA 4FULA 2EELA 4RGOS 2R2OA 4OW0A 2PE9A 3U2SC 3DDCB 3HVZA 4D2KA 2V1YA 4EZLA 1UBIA 2DAFA 2KQ4X 4XYCA 2RD0A 3W5VB 2MBHA 1UH6A 2ZJDA 2DZMA 4RH6A 4QAYA 3RNEC 3AEFB 3SEBA 1KOTA 3AMZA 5E6PA 1JMLA 2CJNA 2DAJA 1YN5A 2K5PA 3W1YA 3TMPB 3L17A 4W9JA 1GB4A 3GZNB 1NDDA 2AWTA 3N9YC 1L2NA 2GMIC 1P0RA 3ZXRA 3R66C 3KQ4A 3MP9A 1LGRA 5HKHA 1AW7A 5D7GA 2L8JA 4LCDE 2CHWA 3RCZA 3A9KA 3HM3A 4LNFA 1WGGA 4E71A 1YQ4B 3QCAA 2VH2A 1UNSA 2MP2A 4LTUA 5JZEB 3HVDA 1UGMA 1KF6B 4IWPA 1I4RA 4HVBA 3B1LX 2G9HD 3QARA 1RFKA 1V1PA 4AS1A 1XT9B 1WXAA 4CO7A 2XEWA 3L08A 3UQBA 2IYDB 3PS6A 1HQRD 2GBRA 2ICIA 1NYRA 2LGDA 1V81A 2XNAC 4M01A 4YT0B 5DPWA 1PGBA 4CQNA 3SR6A 4IM3A 4USAA 4K1RB 4JQWC 3V05A 4US8A 5E6OA 1QKZA 3OJ3A 2YEPB 3KUCB 4I6LB 2WXGA 2DX5B 3NRZA 4ITKA 1FPYA 3EFCA 2LD9A 2FCNA 5G2NA 1JWAD 2N7EA 1ZKHA 4IM2A 2DYMA 5T8IA 1TS3A 2WNMA 1VZ8A 3MJWA 2WXOA 1FXIA 1EU3A 2DZIA 1XCQL 5AEKB 4LDTB 2NS5A 3IAM1 2JU6X 1E8YA 3Q8FA 1XLPA 3UF8A 1ACCA 2NPTA 4W9KA 3V6CB 4K81A 4WQMA 2EMTA 3WALA 2PE6B 5BYRA 1I4GA 1P7FA 2QDFA 4HDQA 4W9EA 5D94A 2D3CA 1WXVA 2GLSA 3OWEB 4FLHA 1E8XA 2EKEC 5L95C 2HTME 2KACA 2V0GA 1YJ1A 3UI3A 5HG2A 2ZNVB 4KKJA 2MBEA 5EE1A 2K8BA 4A90A 1DOXA 3AE6B 1TS4A 2A5UA 2Z0EB 1A70A 4W9HA 2KC2A 4PS3A 1I4QA 1Z5SB 2CHZA 2WX1A 3WAMA 5G55A 1ZDXA 4HCPB 1P98A 4KGTA 5D3DA 4M0WA 5E6JA 4F7ZA 3W1SC 1C3TA 1J7AA 4NJ7A 3VFKA 1KJTA 3VRAB 3RULA 3RNBC 2ON8A 2NR2A 5CHFA 4A8XC 1TYGB 2MBQA 1DGJA 1T3QA 3FILA 2JT4B 4FHJA 3O13A 1WJUA 2SAKA 4GDKA 2W55A 1WGKA 2JPHA 4LLGM 4MH8A 2WQYB 3GB1A 3LB8C 3AE1B 1XF5L 2MLBA 3RD2A 3KH0A 1FNVA 3Q2AC 3V60A 2EKIA 2QILA 4M8MA 4ZHPA 1JRUA 4UDUC 4W9DA 4IC7B 4BBNF 2KDBA 1RFAA 2J0MA 2NBWB 5MPOA 1MPEA 3BIID 1L0YB 3P2BA 4P16A 1Q1OA 4MDKE 1YN3A 4JLCA 1H8CA 4BVUC 2N9EB 2MX2A 1C4PA 3AEAB 2NBUA 2N7JA 4NQLB 1E7PB 2BS3B 2BBCA 3KWLA 3DWGC 1HA5A 2D2QA 2KFKB 3DVGX 1WM3A 1SJED 3TJPA 1R4NI 1QOFA 3Q8CA 1OQYA 1AN8A 5CHWA 4A9AA 2BVCA 4BKSD 4M00A 3C0RB 2JQRB 2MCNB 1XLOA 2WXFA 2L83A 4HWIB 1I42A 5DPRA 3NVVA 3AM9A 3EUB2 1JWBD 4ANXA 3PLVA 3N32A 1I4HA 3ZJUA 3KW5B 1UF0A 3T3NA 1XLNA 3ETRA 3NJTA 2IJ0A 3T3OA 5C23A 3CWIA 3VH3B 2ZVOA 4I6PA 4MGZE 3DBRI 1T0SC 1X1MA 3V61A 2I1JA 3A4RA 1TKEA 4IG7B 2AQ3B 3ABVB 1GC7A 3UGBB 3P4PB 4BOZB 1SSNA 2K6QA 3NVZA 5DCNA 1L6UA 4NAWB 2LMCA 4WAFA 3SFDB 2LGXA 2BPSA 4DDID 4JWUC 2KWVB 3H8HA 2K0PA 3R7QA 4AUQC 2WXLA 3SD5A 4KDLB 5IOIA 3TL5A 2AYOB 2WU2B 5IKCM 4F1SA 1L4DB 3V6EB 4DK5A 2LXAA 1XXGA 3H9DA 4TQ1A 4W9GA 3ZJVA 2Z0DB 3PSEB 2ZNVC 2BWES 4JE3B 3RMKC 2INPE 1P9DU 4ZRJA 2KDEB 2WP9B 3QAQA 1VLBA 1T6BX 2BF8B 3GZNI 3U8ZA 3PRZA 1J7CA 3C19A 1L6VA 3CSTA 3VQIA 1QLBB 2JZ3B 2WXMA 1AYFA 1DOYA 1HXYD 2YEPF 3KUDB 2OHFA 1HE8A 5HHDG 1R7SA 3JSVB 2DNFA 3NG0A 3PGEA 2IDYA 2M56B 2LUEA 3PRPB 2Z59B 4BKSA 4IW0A 3AEBB 1VJKA 3JW0X 3VDZA 2LRUA 3V62A 1TS2A 2MQJA 2G4DB 4M02A 2L05A 3R8BA 4KZ0A 3NVWA 2V9HA 3A1QA 4TSSA 3T8MA 1MHHE 2C7HA 1SE2A 2DHZA 3UQAA 2MW5A 5EDSA 1JROA 1WMHA 2FNJB 2LVOA 3GE8C 1Q0WB 4FBJB 5E6NA 1SXTA 3ZJTA 1ZXHA 3ZO5B 3VUYA 1MG8A 2BQQA 2K6DB 3AXCA 1QF6A 4RFBA 1VDVA 4LNOA 2AL6A 2KX3A 2J4XA 2SEBD 3Q3JA 3U52E 4EFOA 1V97A 4JWSC 3SDLC 3IXSA 5J18A 1OGWA 3AI5A 2W3RA 1UWMA 1V80A 4IM0A 1TKGA 3W5UB 2I2YA 3P4RB 1E0ZA 2ZPNA 4GDLA 1WXSA 4TUUA 4W9LA 3QC8B 1V2YA 2KO3A 4XDDA 4I6NB 1BUIC 1FRDA 2Y5PA 1LQBA 2N1WA 2FUG1 2D3BA 2DLBA 2IGDA 2RDBC 2REXA 3RPFC 5KHOA 2BB6A 2HJ1A 3NOBA 1E9MA 4PYZA 2KHWB 1MI0A 2LVQA 1KFYB 3C8YA 1F9JA 2L32A 4DWFA 1C79A 5J2RA 3VXWA 5G5HA 2WDRB 4ASWC 3WANA 2AQ2B 3AB5A 3V3XA 1EUVB 3TEZA 3DHIC 4YSYB 4DHJD 1U4AA 2RSUA 2IY0B 3BK1A 5LXIB 4OZCA 3KUZA 3GS2A 2XBBC 1WGDA 2LGYA 4HEA1 2C7MB 4WWNA 3A4SC 1KM7A 2K25A 4DDGD 3ZDTA 1B9RA 3U4EG 3DBHB 3URYA 4XX5A 2DZJA 2M0XA 4R3DA 1E6EB 3A9KB 2PEAA 1QOBA 1RRBA 3GOEA 1FFUA 2LI5A 1V86A 2O2VA 4MACA 3VTWA 1IGDA 2XN9C 4TKNA 2MP2B 3RZWC 1JW9D 3RUIB 2LFIA 4LK0M 4N58A 4EZJA 4LNIA 2FIDA 3AU5A 1V1PB 3A33B 3Q8AA 4C4VA 1L7YA 4TMAB 3RNGC 1Q5WB 1J8CA 3MHZA 5L83A 3NVYA 2ZCBA 1XO3A 5D6JB 2VZKB 3NZ3A 4HDOA 4IDIA 3TEWA 3I9V1 1D5ZC 3QX1A 4B6WA 4HPLB 3VAWA 1E8WA 4K7WA 2D5GA 3AEDB 3QK0A 4FJZA 1KLVA 5C2TB 1EM7A 3QHTA 3JVZX 2IPKD 3WAPA 3HHMA 1JRPA 3APCA 3ZTCA 1V6EA 3L13A 2KTFA 4ZDVA 2D3AA 2NTSA 2IBIB 4HKZE 4NNJB 3M63B 3D32A 1H4RA 2GBKA 3AE5B 2M1MA 1ZOYB 1M4VA 2WGSA 3AECB 1WIAA 3T9LA 1I4PA 4YL8A 2NPTB 5J17A 1YNTE 2GRIA 1NI2A 1OQQA 1UUPA 3Q3OC 2FCQA 4JL9A 2ACZB 2O6VB 2PTLA 1D5MC 2BB5A 4II2B 4FADA 2KVRA 3R3MA 3MFGA 1YJIA 1WYGA 4ZHOA 1E10A 3ML9A 2V4IB 1EWYC 3Q69A 3ZNZB 3UINB 1D3ZA 1V9JA 4J3OD 2JRIB 1FMAD 2G3QB 2KKCA 2KWCA 4C7YA 3X0WA 1BT0A 4WJQA 2FAZA 4IWQA 2J53A 4A20A 1SIFA 1NVID 2XK5A 3VR8B 4DHZE 4BBNC 2JY6A 1QQRA 4XWWA 1PUTA 3PT2B 2RPVA 1NBFC 2K39A 1I4XA 5CX3A 1PGXA 5FR6A 3PO0A 1FXTB 2KMCA 3IFWB 2TSSA 2CR5A 1F1HA 4S17A 4XC2A 3GP7A 4ZRQA 2PIAA 2YLMA 4GU2A 4M0WB 4XZ4A 2FCMA 5TSSA 3APFA 1TY0A 3TIXA 2VH1A 2BS2B 4L23A 4OZBA 3PZ8A 2MA9B 3PTFC 3K9OB 1E7UA 5D3IB 3PHXB 4ANUA 4L1BA 3FILB 2A4ZA 1J7BA 4GDKB 3TSSA 3NZUA 4B9KA 4MSQB 5FK9C 4NAMA 4YTPB 4ANVA 3BWUD 2KX0A 3BVGA 2JXXA 2IZVB 4OVVA 1FEHA 3FKYA 4AOFA 3ZRCA 2L76A 1XEEA 4MM3A 2V3PA 1TKYA 4JGHB 1ET9A 2N4FA 1ET6A 2KJRA 2PW9A 1SE4A 1WM2A 4GOCA 1F0ZA 3DVNV 2JZZA 1SIJA 3U7ZA 1WYWB 2Q5WD 3HK0A 2MBOA 5FKAC 2JYEA 3MHSD 3E9SA 4KZCA 4MT5A 2MHJA 4JIOU 5AZHA 2QC8A 2KJHB 2JF5A 4KSLC 2Y5BB 1WE6A 2KXJA 1C77A 4OHJA 3RNAC 2LEKA 1CJEA 4P1BC 3EGRA 3EC8A 4AJWA 5IN7A 1JALA 2WXPA 3M62B 4KDIC 1L0VB 1ROEA 2IY1B 3H1UA 5I4DA 2GB1A 4HJKA 4FN2A 5DPTA 3N3KB 4HXDA 4AWJA 1GPXA 4BKGA 3CF6E 2G1EA 2MEKA 1IBXB 2KNBA 2LASA 3A9JA 3WA0A 3APDA 2OOBB 3DBLB 3RZFA 4RGNA 1OEYA 1PDXA 1XLQA 3L10B 1GG3A 3RFZB 2QMTA 1ZDVA 4EZKA 5BMHA 1C4AA 4A3PA 2NMQA 1EWCA 2KWUB 3VUXA 3H6NA 1OFFA 2KTRB 1TZ1A 1HEZE 1LO5D 2LGIA 2BW2A 4OVZA 4W9IA 2DBYA 2CHXA 3QJZA 1GC6A 1MFWA 2HE7A 5IO9A 2RDHA 5LXHA 2WDQB 1ZXIA 2MRPA 1IP9A 2QHOA 1MHXA 1C76A 1QOAA 2INDC 2W82A 4LJOB 1PQSA 2M4NA 4OVUA 2RPQA 4H2AA 1Q10A 1P1AA 2B3AA 1YQ3B 3M3JA 1WZ3A 2AEHA 4II3B 2GI9A 4RMAA 1FNUA 2BYTA 2L00B 5KHQA 4WWPA 2EMSA 1PGAA 3VTUA 1VR9A 2LRWA 2WLBA 3PVLA 2CU1A 2KK8A 2L0FA 4K7UA 3DBHI 2Y5CA 5JH5C 4WWOA 3OLMD 4MELA 4FA6A 1TY2A 3W9CB 4K3BA 2GBNA 3AV8A 1YQBA 1M94A 4MJSA 4YTNB 4G11A 1V5TA 4N9F4 2BTEA 1I35A 3P1MA 4G50A 2RMMA 4GSWA 2KOXA 3ZLZA 1Z2MA 2KYWA 3OJ4B 2J7QB 3ML8A 2DYBA 2M17A 3EECA 1P3QU 4IOIE 3ZUNA 4URKA 2NTTA 3RI7C 3EA6A 1C1YB 3A1QB 2FE8A 2BT6A 2VRRB 2JXTA 1YOVB 4HRSA 2D07B 1WX9A 2H89B 1WMHB 1BMLC 2E6XA 4ICVA 4KIKA 5AUIA 1K53A 2D3GA 2ZEQA 2KFJA 5IP4D 4O1NA 2KQ7A 1SE3A 4FJYA 3VRBB 5H8YE 1FCLA 4NJ6A 4CHKA 1WI0A 4RF1A 1FIQA 1PFDA 5AZFA 3N1ZC 2ZPYA 5BO4B 1F2RI 4KSKC 3FC4A 3W2DA 5BYQA 5HFYA 3BZDB 4XGAB 4N59A 1A5RA 1I7HA 3AEEB 5GXGB 1D5XC 1JCKB 1V49A 4FJVB 1R4MI 4BOSC 4HJGE 2QCZA 2KC1A 4GDLB 5AZGA 4A6QA 2WXKA 2LUMA 1VRAB 4KX6B 5CHVC 4WJPA 2RGFA 2DWQA 3NS1A 3Q8EA 1NENB 4WJNA 2JYTA 1UELA 2V3SA 3OAWA 4LJPB 4MGIE 3IT4B 2LJ5A 4G3XB 4ARIA 3H7SA 1K50A
chains in the Genus database with same CATH topology
3QK0A 1KJTA 3LDZE 4FJZA 1GNUA 3RULA 2KQSA 4MJSB 1KLVA 2LVPA 2K8CA 4EKUA 3QHTA 2NR2A 3BINA 3JVZX 5CHFA 1IPGA 2MBQA 1LXDA 3WAPA 3NS8A 1WJ4A 2JT4B 3HHMA 1WJUA 3N30A 2WDTB 4FHJA 3APCA 4GDKA 3ZTCA 1V6EA 1XQQA 2MSED 3L13A 2KTFA 2JPHA 4ZDVA 2NVUI 3PHWB 4NAWA 1EF5A 3IBEA 4AJYB 2IBIB 2IO0B 2MLBA 3RD2A 4NNJB 3KH0A 3M63B 3D32A 1J0GA 3NY5A 1WX8A 4X57B 1H4RA 2GBKA 3DBSA 3V60A 2M1MA 4M8MA 4E74A 1UD7A 3DQVA 1JRUA 4F8CB 1WIAA 2N7DA 3T9LA 5IA7A 4YL8A 4W9DA 1GJZA 5D2MB 3R7RA 4IC7B 1IYFA 3QA8A 3PV1A 4BBNF 2NPTB 5J17A 3PPAA 4DXAB 2KDBA 2FIFA 1RFAA 1E7VA 2J0MA 4WAAA 4DBGA 3B08A 1NI2A 2NBWB 4WQOB 2WX0A 4KIKB 2L3ZA 1S1QB 3H7PA 4ICUA 3ZTDA 4ZRIA 4K7SA 1LM8B 1YX6B 2FCQA 3P2BA 4JL9A 1WR1A 2O6VB 4II2B 3X23A 1Q1OA 4MDKE 2J0JA 4FADA 2KVRA 3R3MA 4JLCA 1H8CA 4BVUC 1ISNA 2V4LA 2N9EB 2GBJA 2MX2A 3B0AA 3ML9A 3ZIMA 3ZNGC 4GMVA 3ZNZB 1AARA 2N9XA 2HTHA 3UINB 2NBUA 1V9JA 1D3ZA 4NQLB 2JRIB 4EUTA 2G4SA 2G3QB 2KKCA 2KWCA 4MSMB 3X0WA 4W9CA 5IAAC 1BT0A 1CMXB 2D2QA 2KFKB 1WH3A 4WJQA 2BKFA 2FAZA 3AU4A 3DVGX 1EO6A 2O2VB 2C9WB 1RAXA 1WM3A 2R2QA 4IWQA 1WR6E 4MGKE 3TJPA 1R4NI 4A20A 4J6IA 1SIFA 2XK5A 2UWQA 4NPNA 1OQYA 2C7NB 4DHZE 5CHWA 4BBNC 2I1KA 2JY6A 4BKSD 2G45B 3C0RB 3PREA 2D11A 3JSVA 3PT2B 1NBFC 2K39A 5CX3A 4EOYA 2MCNB 4NY0A 3NZSA 4HWIB 3IG3A 3BY4B 5FR6A 4P7IA 3TCAA 1I42A 5DPRA 3L16A 4W9FA 1FXTB 2KMCA 3IVFA 3IFWB 5DPSA 2CR5A 3W1SA 1OTRB 2ZZPB 1WJNA 4ANXA 3PLVA 2MBBB 2UYZB 3N32A 4GIVA 4LDTD 4XC2A 4HCNB 2O6VD 2YLMA 3KW5B 4GU2A 5JHBA 4M0WB 1VCBA 2FCMA 4XZ4A 3L54A 2LWPA 4MEMA 5C23A 2ZCCA 3APFA 3U7DA 2ZVOA 3AULA 3VH3B 4I6PA 4IWOA 4MGZE 3U30A 3KVFB 3DBRI 2N1VA 1WGRA 1X1MA 2MWSB 3TIXA 1TBEA 3L0WB 3V61A 2ASQA 1WFYA 2I1JA 3ALBA 3WAOA 2MA9B 3A4RA 3PTFC 4IG7B 3VUWA 3K9OB 1E7UA 1ZW7A 3HIZA 3PHXB 1K8RB 4ANUA 5JHAA 2KLCA 1GC7A 3UGBB 2A4ZA 1WXMA 2W9NA 4GDKB 4BOZB 3NZUA 4B9KA 2JRHA 2K6QA 4MSQB 5DCNA 4ZRKA 2BYEA 1LFDA 4NAWB 2OJRA 1OEYJ 4ANVA 2K1FA 1UBQA 2CKHB 2LGXA 2BPSA 2KX0A 4TQ0A 2JXXA 2IZVB 3JYUA 4OVVA 4DDID 3PZDA 4PS8A 2KWVB 1VD2A 1RLFA 2J0KA 2KZRA 1WGYA 2L0TA 3R7QA 4AUQC 4TV3A 3SD5A 5LLIA 3KYDD 3VVWB 4KDLB 4AOFA 1WGHA 3ZRCA 1G6JA 4CYEA 5CTRC 2L76A 3TL5A 2AYOB 3QIJA 4MM3A 1SGHA 4IUMB 4JGHB 4F1SA 3V6EB 2GBMA 4HK2A 4DK5A 4M8NA 2LXAA 2N4FA 3DOWA 2GOWA 3H9DA 3DBLI 4TQ1A 2KJRA 4W9GA 3VTVA 3H7PB 2Z0DB 4HLEA 3ZDMC 4A3OA 3PSEB 2ZNVC 2BWFA 1WM2A 3ONSA 4GOCA 1T0YA 2BWES 4ANWA 4DHJB 3DVNV 2JZZA 3SHQA 1P9DU 4ZRJA 2ZVNA 1YX5B 3CMMB 1WYWB 2KDEB 3NHEB 4PS7A 3HK0A 3QWZB 2MBOA 3QAQA 1WZ0A 3MHSD 1J19A 2BF8B 4KZCA 3UIOB 2FCSA 1Y8RC 3GZNI 4JIOU 1XD3B 3U8ZA 3QQ8B 3ZNHB 3PRZA 4B95A 4GGQA 1UZXB 5AZHA 2KMAA 1EF1A 2JVCA 2KJHB 2JF5A 4KSLC 5GMVA 2Y5BB 3RYTA 2KN5A 1WE6A 3CSTA 3VQIA 2L7RA 2JZ3B 3Q3FA 2KXJA 2XK5B 2IO3B 3UIPB 1TTNA 1V5OA 3KUDB 3ECIA 1HE8A 3M95A 1S3SG 3EFUA 3JSVB 3ZW3A 1WX7A 4MGYE 3EC8A 4AJWA 3ZVVA 4FHKA 3M62B 4KDIC 3PGEA 2IY1B 3ZKJC 3H1UA 4G0NB 3ZNID 4DHZB 1WRDB 4HJKA 2BYFA 2LUEA 4FULA 3PRPB 4FN2A 5DPTA 3N3KB 2Z59B 2R2OA 4BKSA 4HXDA 2PE9A 4AWJA 3DDCB 4BKGA 3CF6E 4IW0A 2V1YA 2KNBA 1UBIA 2DAFA 2WWZA 3DPDA 3JW0X 4EZLA 2LASA 3A9JA 3VDZA 2LRUA 2RD0A 3V62A 3WA0A 2MQJA 3APDA 2MBHA 2OOBB 3LJ3A 3RT3B 5TR5A 3RZFA 2G4DB 1UH6A 2ZJDA 2DZMA 1OEYA 3L10B 2AL3A 2L05A 2O6VA 1GG3A 4KZ0A 1KOTA 3T8MA 3A1QA 5E6PA 3VFKA 2C7HA 2DAJA 3W1YA 2DHZA 3UQAA 4EZKA 2MW5A 3TMPB 5EDSA 4A3PA 3L17A 1WMHA 4KV2A 2N9PC 2FNJB 2LVOA 4W9JA 1Q0WB 2KWUB 4FBJB 3VUXA 3H6NA 4BFRA 3I3TB 1NDDA 2AWTA 1L2NA 1WJ6A 2KTRB 1TZ1A 1WF9A 2GMIC 5E6NA 1P0RA 2LXCA 3R66C 2DENB 3ZO5B 2HJ8A 3VUYA 1MG8A 4PYUA 2K6DB 3AXCA 4W9IA 2KDFB 5HKHA 5D7GA 2CHXA 2L8JA 3QJZA 4LCDE 1GC6A 2AL6A 2D10A 2KX3A 2CHWA 2HE7A 3Q3JA 3MTNB 3RCZA 2C5LC 3A9KA 2YVCA 3HM3A 4EFOA 1WGGA 4E71A 2C60A 3SDLC 3QCAA 4RM8A 5LXHA 5J18A 1OGWA 2MRPA 2MP2A 1IP9A 2QHOA 3AI5A 5JZEB 1UGMA 3DCGA 1V80A 4IWPA 4HVBA 4GXBA 4LJOB 1PQSA 4IM0A 2M4NA 2M8SA 3B1LX 4OVUA 2RPQA 2JWZA 3QARA 3VH4B 1P1AA 2B3AA 3DVNU 2BYVE 2IO1B 3M3JA 1WZ3A 3ENEA 2KDIA 2AEHA 2ZPNA 4GDLA 1XT9B 1WXSA 4II3B 4TUUA 1WXAA 2DYOA 4RMAA 4CO7A 2L00B 3O65B 2RR9A 4W9LA 3QC8B 1V2YA 2EMSA 2KO3A 4WWPA 5KHQA 3VTUA 2XEWA 2LRWA 4I6NB 3PLUA 3L08A 2BGFA 3UQBA 2IYDB 3K9PB 3PVLA 3PS6A 2CU1A 1LQBA 2N1WA 2GBRA 2KK8A 4ZYNA 2L0FA 4K7UA 3DBHI 2LGDA 4EEWA 5JH5C 4WWOA 2CS4A 3OLMD 1V81A 2REXA 4MELA 4FA6A 5KHOA 5DPWA 3NOBA 1GUAB 2FUHB 2GBNA 4RM9A 4IM3A 4PYZA 1YQBA 4K1RB 2KHWB 4JQWC 2KLGA 3HM6X 1M94A 3DVGY 5E6OA 4MJSA 4WJOA 4G11A 3OJ3A 2LVQA 1V5TA 4N9F4 1F9JA 2PPHA 1I35A 3KUCB 1WY8A 4I6LB 4DWFA 4G50A 2DX5B 5J2RA 3VXWA 2LD9A 2FCNA 5G2NA 3S2AA 2N7EA 4GSWA 1ZKHA 4IM2A 4ASWC 4HPMB 2DYMA 2KOXA 3WANA 3ZLZA 3A9JB 1Z2MA 2WYQA 3MJWA 3PRMB 3OJ4B 2DZIA 2J7QB 3ML8A 3WIMA 2DYBA 2IO2B 1ZGUB 2M17A 3EECA 4LDTB 1P3QU 4BKTA 3ZUNA 5AEKB 2NS5A 4URKA 1EUVB 3CSFA 1E8YA 4DHJD 1C1YB 3A1QB 1U4AA 3UF8A 2RSUA 2VRRB 2IY0B 2NPTA 4W9KA 3V6CB 4K81A 5LXIB 2D07B 1WX9A 3KYCD 2EMTA 3KUZA 1WMHB 2KANA 3WALA 4ICVA 4KIKA 2XBBC 2PE6B 1WGDA 2LGYA 3SU8X 2C7MB 2D3GA 2ZEQA 3A4SC 4WWNA 2K8HA 1KM7A 3VHTC 2KFJA 2K25A 4DDGD 2KQ7A 4HDQA 2BKRB 4W9EA 4FJYA 5D94A 4E3CA 3ZDTA 4MH0E 1WXVA 4NJ6A 4CHKA 4XX5A 1WI0A 4FLHA 2DZJA 4NQKE 2M0XA 2NBVB 5AZFA 1E5WA 1E8XA 2EKEC 3A9KB 5L95C 2ZPYA 2PEAA 1RRBA 5BO4B 2KFKA 3GOEA 1YJ1A 2LI5A 4KSKC 2ZNVB 1V86A 2O2VA 3VTWA 4TKNA 4GN1A 2MBEA 2MP2B 3RZWC 4GB9A 1E90A 1A5RA 1YD8U 4KVGB 3RUIB 2K8BA 3EHVA 4EZJA 1V49A 2KD0A 4FJVB 2A5UA 1R4MI 2FIDA 2Z0EB 4BOSC 3AU5A 3IHPC 1YIWA 4W9HA 3A33B 2KC2A 4PS3A 3ZRFA 2KC1A 2KJ6A 1Z5SB 2CHZA 2WX1A 1L7YA 4GDLB 5AZGA 3WAMA 1Q5WB 5G55A 1SE9A 5C1ZA 3TBLD 1J8CA 2DZKA 5L83A 1TGZB 2JUOA 1P98A 4HCPB 5CHVC 2ZCBA 4WJPA 1QZEA 2RGFA 5D6JB 2LZ6A 4F7ZA 3W1SC 2PJHA 1C3TA 2HD5B 4HDOA 4WJNA 1WE7A 3QX1A 4B6WA 4HPLB 3VAWA 1UELA 2V3SA 1E8WA 3OAWA 4LJPB 4MGIE 4G3XB 2KTRA 2LJ5A 4K7WA 1E8ZA 4NJ7A 2NCNA 3H7SA 4AP4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK0 A;  1KJT A;  3LDZ E;  4FJZ A;  1GNU A;  3RUL A;  2KQS A;  4MJS B;  1KLV A;  2LVP A;  2K8C A;  4EKU A;  3QHT A;  2NR2 A;  3BIN A;  3JVZ X;  5CHF A;  1IPG A;  2MBQ A;  1LXD A;  3WAP A;  3NS8 A;  1WJ4 A;  2JT4 B;  3HHM A;  1WJU A;  3N30 A;  2WDT B;  4FHJ A;  3APC A;  4GDK A;  3ZTC A;  1V6E A;  1XQQ A;  2MSE D;  3L13 A;  2KTF A;  2JPH A;  4ZDV A;  2NVU I;  3PHW B;  4NAW A;  1EF5 A;  3IBE A;  4AJY B;  2IBI B;  2IO0 B;  2MLB A;  3RD2 A;  4NNJ B;  3KH0 A;  3M63 B;  3D32 A;  1J0G A;  3NY5 A;  1WX8 A;  4X57 B;  1H4R A;  2GBK A;  3DBS A;  3V60 A;  2M1M A;  4M8M A;  4E74 A;  1UD7 A;  3DQV A;  1JRU A;  4F8C B;  1WIA A;  2N7D A;  3T9L A;  5IA7 A;  4YL8 A;  4W9D A;  1GJZ A;  5D2M B;  3R7R A;  4IC7 B;  1IYF A;  3QA8 A;  3PV1 A;  4BBN F;  2NPT B;  5J17 A;  3PPA A;  4DXA B;  2KDB A;  2FIF A;  1RFA A;  1E7V A;  2J0M A;  4WAA A;  4DBG A;  3B08 A;  1NI2 A;  2NBW B;  4WQO B;  2WX0 A;  4KIK B;  2L3Z A;  1S1Q B;  3H7P A;  4ICU A;  3ZTD A;  4ZRI A;  4K7S A;  1LM8 B;  1YX6 B;  2FCQ A;  3P2B A;  4JL9 A;  1WR1 A;  2O6V B;  4II2 B;  3X23 A;  1Q1O A;  4MDK E;  2J0J A;  4FAD A;  2KVR A;  3R3M A;  4JLC A;  1H8C A;  4BVU C;  1ISN A;  2V4L A;  2N9E B;  2GBJ A;  2MX2 A;  3B0A A;  3ML9 A;  3ZIM A;  3ZNG C;  4GMV A;  3ZNZ B;  1AAR A;  2N9X A;  2HTH A;  3UIN B;  2NBU A;  1V9J A;  1D3Z A;  4NQL B;  2JRI B;  4EUT A;  2G4S A;  2G3Q B;  2KKC A;  2KWC A;  4MSM B;  3X0W A;  4W9C A;  5IAA C;  1BT0 A;  1CMX B;  2D2Q A;  2KFK B;  1WH3 A;  4WJQ A;  2BKF A;  2FAZ A;  3AU4 A;  3DVG X;  1EO6 A;  2O2V B;  2C9W B;  1RAX A;  1WM3 A;  2R2Q A;  4IWQ A;  1WR6 E;  4MGK E;  3TJP A;  1R4N I;  4A20 A;  4J6I A;  1SIF A;  2XK5 A;  2UWQ A;  4NPN A;  1OQY A;  2C7N B;  4DHZ E;  5CHW A;  4BBN C;  2I1K A;  2JY6 A;  4BKS D;  2G45 B;  3C0R B;  3PRE A;  2D11 A;  3JSV A;  3PT2 B;  1NBF C;  2K39 A;  5CX3 A;  4EOY A;  2MCN B;  4NY0 A;  3NZS A;  4HWI B;  3IG3 A;  3BY4 B;  5FR6 A;  4P7I A;  3TCA A;  1I42 A;  5DPR A;  3L16 A;  4W9F A;  1FXT B;  2KMC A;  3IVF A;  3IFW B;  5DPS A;  2CR5 A;  3W1S A;  1OTR B;  2ZZP B;  1WJN A;  4ANX A;  3PLV A;  2MBB B;  2UYZ B;  3N32 A;  4GIV A;  4LDT D;  4XC2 A;  4HCN B;  2O6V D;  2YLM A;  3KW5 B;  4GU2 A;  5JHB A;  4M0W B;  1VCB A;  2FCM A;  4XZ4 A;  3L54 A;  2LWP A;  4MEM A;  5C23 A;  2ZCC A;  3APF A;  3U7D A;  2ZVO A;  3AUL A;  3VH3 B;  4I6P A;  4IWO A;  4MGZ E;  3U30 A;  3KVF B;  3DBR I;  2N1V A;  1WGR A;  1X1M A;  2MWS B;  3TIX A;  1TBE A;  3L0W B;  3V61 A;  2ASQ A;  1WFY A;  2I1J A;  3ALB A;  3WAO A;  2MA9 B;  3A4R A;  3PTF C;  4IG7 B;  3VUW A;  3K9O B;  1E7U A;  1ZW7 A;  3HIZ A;  3PHX B;  1K8R B;  4ANU A;  5JHA A;  2KLC A;  1GC7 A;  3UGB B;  2A4Z A;  1WXM A;  2W9N A;  4GDK B;  4BOZ B;  3NZU A;  4B9K A;  2JRH A;  2K6Q A;  4MSQ B;  5DCN A;  4ZRK A;  2BYE A;  1LFD A;  4NAW B;  2OJR A;  1OEY J;  4ANV A;  2K1F A;  1UBQ A;  2CKH B;  2LGX A;  2BPS A;  2KX0 A;  4TQ0 A;  2JXX A;  2IZV B;  3JYU A;  4OVV A;  4DDI D;  3PZD A;  4PS8 A;  2KWV B;  1VD2 A;  1RLF A;  2J0K A;  2KZR A;  1WGY A;  2L0T A;  3R7Q A;  4AUQ C;  4TV3 A;  3SD5 A;  5LLI A;  3KYD D;  3VVW B;  4KDL B;  4AOF A;  1WGH A;  3ZRC A;  1G6J A;  4CYE A;  5CTR C;  2L76 A;  3TL5 A;  2AYO B;  3QIJ A;  4MM3 A;  1SGH A;  4IUM B;  4JGH B;  4F1S A;  3V6E B;  2GBM A;  4HK2 A;  4DK5 A;  4M8N A;  2LXA A;  2N4F A;  3DOW A;  2GOW A;  3H9D A;  3DBL I;  4TQ1 A;  2KJR A;  4W9G A;  3VTV A;  3H7P B;  2Z0D B;  4HLE A;  3ZDM C;  4A3O A;  3PSE B;  2ZNV C;  2BWF A;  1WM2 A;  3ONS A;  4GOC A;  1T0Y A;  2BWE S;  4ANW A;  4DHJ B;  3DVN V;  2JZZ A;  3SHQ A;  1P9D U;  4ZRJ A;  2ZVN A;  1YX5 B;  3CMM B;  1WYW B;  2KDE B;  3NHE B;  4PS7 A;  3HK0 A;  3QWZ B;  2MBO A;  3QAQ A;  1WZ0 A;  3MHS D;  1J19 A;  2BF8 B;  4KZC A;  3UIO B;  2FCS A;  1Y8R C;  3GZN I;  4JIO U;  1XD3 B;  3U8Z A;  3QQ8 B;  3ZNH B;  3PRZ A;  4B95 A;  4GGQ A;  1UZX B;  5AZH A;  2KMA A;  1EF1 A;  2JVC A;  2KJH B;  2JF5 A;  4KSL C;  5GMV A;  2Y5B B;  3RYT A;  2KN5 A;  1WE6 A;  3CST A;  3VQI A;  2L7R A;  2JZ3 B;  3Q3F A;  2KXJ A;  2XK5 B;  2IO3 B;  3UIP B;  1TTN A;  1V5O A;  3KUD B;  3ECI A;  1HE8 A;  3M95 A;  1S3S G;  3EFU A;  3JSV B;  3ZW3 A;  1WX7 A;  4MGY E;  3EC8 A;  4AJW A;  3ZVV A;  4FHK A;  3M62 B;  4KDI C;  3PGE A;  2IY1 B;  3ZKJ C;  3H1U A;  4G0N B;  3ZNI D;  4DHZ B;  1WRD B;  4HJK A;  2BYF A;  2LUE A;  4FUL A;  3PRP B;  4FN2 A;  5DPT A;  3N3K B;  2Z59 B;  2R2O A;  4BKS A;  4HXD A;  2PE9 A;  4AWJ A;  3DDC B;  4BKG A;  3CF6 E;  4IW0 A;  2V1Y A;  2KNB A;  1UBI A;  2DAF A;  2WWZ A;  3DPD A;  3JW0 X;  4EZL A;  2LAS A;  3A9J A;  3VDZ A;  2LRU A;  2RD0 A;  3V62 A;  3WA0 A;  2MQJ A;  3APD A;  2MBH A;  2OOB B;  3LJ3 A;  3RT3 B;  5TR5 A;  3RZF A;  2G4D B;  1UH6 A;  2ZJD A;  2DZM A;  1OEY A;  3L10 B;  2AL3 A;  2L05 A;  2O6V A;  1GG3 A;  4KZ0 A;  1KOT A;  3T8M A;  3A1Q A;  5E6P A;  3VFK A;  2C7H A;  2DAJ A;  3W1Y A;  2DHZ A;  3UQA A;  4EZK A;  2MW5 A;  3TMP B;  5EDS A;  4A3P A;  3L17 A;  1WMH A;  4KV2 A;  2N9P C;  2FNJ B;  2LVO A;  4W9J A;  1Q0W B;  2KWU B;  4FBJ B;  3VUX A;  3H6N A;  4BFR A;  3I3T B;  1NDD A;  2AWT A;  1L2N A;  1WJ6 A;  2KTR B;  1TZ1 A;  1WF9 A;  2GMI C;  5E6N A;  1P0R A;  2LXC A;  3R66 C;  2DEN B;  3ZO5 B;  2HJ8 A;  3VUY A;  1MG8 A;  4PYU A;  2K6D B;  3AXC A;  4W9I A;  2KDF B;  5HKH A;  5D7G A;  2CHX A;  2L8J A;  3QJZ A;  4LCD E;  1GC6 A;  2AL6 A;  2D10 A;  2KX3 A;  2CHW A;  2HE7 A;  3Q3J A;  3MTN B;  3RCZ A;  2C5L C;  3A9K A;  2YVC A;  3HM3 A;  4EFO A;  1WGG A;  4E71 A;  2C60 A;  3SDL C;  3QCA A;  4RM8 A;  5LXH A;  5J18 A;  1OGW A;  2MRP A;  2MP2 A;  1IP9 A;  2QHO A;  3AI5 A;  5JZE B;  1UGM A;  3DCG A;  1V80 A;  4IWP A;  4HVB A;  4GXB A;  4LJO B;  1PQS A;  4IM0 A;  2M4N A;  2M8S A;  3B1L X;  4OVU A;  2RPQ A;  2JWZ A;  3QAR A;  3VH4 B;  1P1A A;  2B3A A;  3DVN U;  2BYV E;  2IO1 B;  3M3J A;  1WZ3 A;  3ENE A;  2KDI A;  2AEH A;  2ZPN A;  4GDL A;  1XT9 B;  1WXS A;  4II3 B;  4TUU A;  1WXA A;  2DYO A;  4RMA A;  4CO7 A;  2L00 B;  3O65 B;  2RR9 A;  4W9L A;  3QC8 B;  1V2Y A;  2EMS A;  2KO3 A;  4WWP A;  5KHQ A;  3VTU A;  2XEW A;  2LRW A;  4I6N B;  3PLU A;  3L08 A;  2BGF A;  3UQB A;  2IYD B;  3K9P B;  3PVL A;  3PS6 A;  2CU1 A;  1LQB A;  2N1W A;  2GBR A;  2KK8 A;  4ZYN A;  2L0F A;  4K7U A;  3DBH I;  2LGD A;  4EEW A;  5JH5 C;  4WWO A;  2CS4 A;  3OLM D;  1V81 A;  2REX A;  4MEL A;  4FA6 A;  5KHO A;  5DPW A;  3NOB A;  1GUA B;  2FUH B;  2GBN A;  4RM9 A;  4IM3 A;  4PYZ A;  1YQB A;  4K1R B;  2KHW B;  4JQW C;  2KLG A;  3HM6 X;  1M94 A;  3DVG Y;  5E6O A;  4MJS A;  4WJO A;  4G11 A;  3OJ3 A;  2LVQ A;  1V5T A;  4N9F 4;  1F9J A;  2PPH A;  1I35 A;  3KUC B;  1WY8 A;  4I6L B;  4DWF A;  4G50 A;  2DX5 B;  5J2R A;  3VXW A;  2LD9 A;  2FCN A;  5G2N A;  3S2A A;  2N7E A;  4GSW A;  1ZKH A;  4IM2 A;  4ASW C;  4HPM B;  2DYM A;  2KOX A;  3WAN A;  3ZLZ A;  3A9J B;  1Z2M A;  2WYQ A;  3MJW A;  3PRM B;  3OJ4 B;  2DZI A;  2J7Q B;  3ML8 A;  3WIM A;  2DYB A;  2IO2 B;  1ZGU B;  2M17 A;  3EEC A;  4LDT B;  1P3Q U;  4BKT A;  3ZUN A;  5AEK B;  2NS5 A;  4URK A;  1EUV B;  3CSF A;  1E8Y A;  4DHJ D;  1C1Y B;  3A1Q B;  1U4A A;  3UF8 A;  2RSU A;  2VRR B;  2IY0 B;  2NPT A;  4W9K A;  3V6C B;  4K81 A;  5LXI B;  2D07 B;  1WX9 A;  3KYC D;  2EMT A;  3KUZ A;  1WMH B;  2KAN A;  3WAL A;  4ICV A;  4KIK A;  2XBB C;  2PE6 B;  1WGD A;  2LGY A;  3SU8 X;  2C7M B;  2D3G A;  2ZEQ A;  3A4S C;  4WWN A;  2K8H A;  1KM7 A;  3VHT C;  2KFJ A;  2K25 A;  4DDG D;  2KQ7 A;  4HDQ A;  2BKR B;  4W9E A;  4FJY A;  5D94 A;  4E3C A;  3ZDT A;  4MH0 E;  1WXV A;  4NJ6 A;  4CHK A;  4XX5 A;  1WI0 A;  4FLH A;  2DZJ A;  4NQK E;  2M0X A;  2NBV B;  5AZF A;  1E5W A;  1E8X A;  2EKE C;  3A9K B;  5L95 C;  2ZPY A;  2PEA A;  1RRB A;  5BO4 B;  2KFK A;  3GOE A;  1YJ1 A;  2LI5 A;  4KSK C;  2ZNV B;  1V86 A;  2O2V A;  3VTW A;  4TKN A;  4GN1 A;  2MBE A;  2MP2 B;  3RZW C;  4GB9 A;  1E90 A;  1A5R A;  1YD8 U;  4KVG B;  3RUI B;  2K8B A;  3EHV A;  4EZJ A;  1V49 A;  2KD0 A;  4FJV B;  2A5U A;  1R4M I;  2FID A;  2Z0E B;  4BOS C;  3AU5 A;  3IHP C;  1YIW A;  4W9H A;  3A33 B;  2KC2 A;  4PS3 A;  3ZRF A;  2KC1 A;  2KJ6 A;  1Z5S B;  2CHZ A;  2WX1 A;  1L7Y A;  4GDL B;  5AZG A;  3WAM A;  1Q5W B;  5G55 A;  1SE9 A;  5C1Z A;  3TBL D;  1J8C A;  2DZK A;  5L83 A;  1TGZ B;  2JUO A;  1P98 A;  4HCP B;  5CHV C;  2ZCB A;  4WJP A;  1QZE A;  2RGF A;  5D6J B;  2LZ6 A;  4F7Z A;  3W1S C;  2PJH A;  1C3T A;  2HD5 B;  4HDO A;  4WJN A;  1WE7 A;  3QX1 A;  4B6W A;  4HPL B;  3VAW A;  1UEL A;  2V3S A;  1E8W A;  3OAW A;  4LJP B;  4MGI E;  4G3X B;  2KTR A;  2LJ5 A;  4K7W A;  1E8Z A;  4NJ7 A;  2NCN A;  3H7S A;  4AP4 C; 
#chains in the Genus database with same CATH topology
 3LDZ E;  2KQS A;  3NUH B;  1VZ7 A;  4EE2 A;  2K8C A;  3VR9 B;  2WXR A;  1IPG A;  1LXD A;  3FAH A;  2MSE D;  1EF5 A;  1YJJ A;  3B2G A;  2IO0 B;  1F52 A;  1CK1 A;  1D4B A;  1J0G A;  1SEB D;  1N63 A;  1WX8 A;  4F8C B;  4E74 A;  1NYQ A;  1GB1 A;  5IA7 A;  2VZK D;  5HI1 A;  5D2M B;  1IYF A;  3PPA A;  1E7V A;  4WAA A;  3CIR B;  4WQO B;  3WCQ A;  2WX0 A;  4YTM B;  2L3Z A;  1K51 A;  3H7P A;  4ICU A;  2L52 A;  3ZTD A;  4ZRI A;  1HZ6 A;  1ISN A;  3AE3 B;  2ZW1 A;  3B0A A;  3TEY A;  3HUI A;  1QIL A;  2HTH A;  2G4S A;  4RNA A;  4MSM B;  1NI3 A;  4W9C A;  5IAA C;  2PMV A;  4HRO A;  1L4Z B;  2WXH A;  1EO6 A;  1FD6 A;  1ZUD 2;  2O2V B;  2R2Q A;  4MGK E;  4J6I A;  2UWQ A;  4NPN A;  1PYW D;  5BYS A;  2I1K A;  3Q3M C;  5AUK A;  1ENF A;  1TS5 A;  4EOY A;  4C4V B;  3AH7 A;  3IG3 A;  3BY4 B;  2LHD A;  4P7I A;  3RN9 C;  3TCA A;  3L16 A;  2HDE A;  3IVF A;  3W1S A;  1OTR B;  2MBB B;  4YSX B;  4LDT D;  3Q3N C;  2O6V D;  1XCT L;  2K9X A;  2LWP A;  4MEM A;  4JX1 C;  3P63 A;  3Q8B A;  2N1V A;  1IUE A;  2X8X X;  3L0W B;  2ASQ A;  3ALB A;  4C80 A;  2CU3 A;  3RNF C;  4ZOH C;  1WWT A;  3VUW A;  2PKO A;  1P7E A;  2KLC A;  1WXM A;  2W9N A;  4FXC A;  4GLS C;  1Y56 A;  2JRH A;  2BYE A;  1D6E C;  4US9 A;  2OJR A;  2K1F A;  1UBQ A;  1HTQ A;  2KAJ A;  2CKH B;  1T5X D;  4WUR A;  3JYU A;  3PZD A;  4PS8 A;  2QIE B;  1VD2 A;  1RLF A;  3HRD D;  3Q6B A;  2J0K A;  4RGT A;  1WGY A;  2L0T A;  4TV3 A;  3VVW B;  3KYD D;  3SFE B;  1WGH A;  2MJ3 A;  5CTR C;  1SGH A;  4KGS A;  1DYQ A;  3N20 C;  4IUM B;  2M19 A;  2GOW A;  3DBL I;  4A3O A;  2PVG C;  3MC8 A;  3ONS A;  4DHJ B;  4ANW A;  3KLS X;  1YX5 B;  1R4M B;  3CMM B;  4PS7 A;  3OG5 A;  1N6Z A;  1WZ0 A;  1SF0 A;  5FR3 A;  1Y8R C;  4YXD B;  1SB3 C;  3ZNH B;  4B95 A;  4L2Y A;  2J52 A;  2KMA A;  1EF1 A;  2JVC A;  3RYT A;  4B0M A;  1BXT A;  1CZP A;  2X38 A;  3Q3F A;  2XK5 B;  2IO3 B;  1V5O A;  4C7Z A;  1N5X A;  3ECI A;  1S3S G;  3EFU A;  4MGY E;  3ZVV A;  4ZYS A;  2QEJ C;  3ZQ4 A;  3ZNI D;  5EE9 A;  1WRD B;  4C56 C;  2BYF A;  2PVO D;  2JZP A;  1WRI A;  1FCC C;  3AE7 B;  2KVZ A;  2ZW0 A;  5BMI A;  2WWZ A;  1V8C A;  3DPD A;  1OQR A;  1L5P A;  1RYJ A;  3LJ3 A;  3RT3 B;  5TR5 A;  4JPS A;  2N9K A;  2AL3 A;  2O6V A;  2WU5 B;  1WXQ A;  2INC C;  3AEG B;  3DHG C;  4KV2 A;  3ZXV A;  2N9P C;  1GAQ B;  2AX5 A;  1K52 A;  4BFR A;  3I3T B;  1WJ6 A;  1WF9 A;  2Z8L A;  2LXC A;  2OJW A;  2DEN B;  2HJ8 A;  4PYU A;  4KGR A;  2B76 B;  2KDF B;  2PLP A;  2WXQ A;  4Q2J A;  1B1Z A;  2D10 A;  4BZA A;  3MTN B;  2C5L C;  2YVC A;  1SJH D;  2C60 A;  4MM3 B;  2QSD A;  3BYY B;  4RM8 A;  2FBW B;  5LNK 1;  1C4C A;  4XDC A;  3DCG A;  4ARC A;  4GXB A;  2M8S A;  2JWZ A;  3VH4 B;  3DVN U;  3B2F A;  2BYV E;  2IO1 B;  3ENE A;  2KDI A;  2DYO A;  1NEK B;  1YMH E;  2LGS A;  3O65 B;  2RR9 A;  1KLG D;  2I38 A;  3PLU A;  2BGF A;  2N9L A;  5EE0 A;  3K9P B;  3AN1 A;  4ZYN A;  3R2I A;  4LNN A;  4EEW A;  2CS4 A;  4PT5 A;  3AE4 B;  1C9F A;  4A55 A;  1GUA B;  2FUH B;  4RM9 A;  2KLG A;  3HM6 X;  2W54 A;  3DVG Y;  4WJO A;  1UGJ A;  1HTO A;  2PPH A;  1RM6 C;  1WY8 A;  1GOZ A;  1L0X B;  3S2A A;  3E56 A;  4HPM B;  3RNC C;  3ZGZ A;  3BYT B;  3A9J B;  2WYQ A;  3IT6 B;  3PRM B;  3BK2 A;  1ZE3 D;  1EU4 A;  1IGC A;  2LHE A;  3WIM A;  2IO2 B;  1ZGU B;  4BKT A;  3CSF A;  2JX5 A;  1T0Q C;  4YWG G;  2M0A A;  3KYC D;  3GE3 C;  4DXG A;  4KKI A;  2KAN A;  4HKQ A;  3SU8 X;  4K3C A;  2K8H A;  3VHT C;  3Q14 C;  1SBB B;  1F2R C;  2BKR B;  4E3C A;  4MH0 E;  4WH4 A;  3MC9 A;  3BVZ A;  2OED A;  2WXI A;  4NQK E;  2NBV B;  1E5W A;  3DHH C;  2UU7 A;  1DOI A;  2KFK A;  2MJE A;  4WIP A;  4GN1 A;  4WWM A;  4ZRP A;  4DQO C;  4GB9 A;  1E90 A;  1AWD A;  5G5G A;  1YD8 U;  4KVG B;  1VZ6 A;  1TIF A;  3EHV A;  1CQV A;  2KD0 A;  1IBX A;  3IHP C;  1YIW A;  3ZRF A;  2KJ6 A;  1JWU D;  1KH0 A;  1SE9 A;  5C1Z A;  4DXF A;  3TBL D;  1TZO A;  2DZK A;  2Y3A A;  1MJD A;  1TGZ B;  2JUO A;  3I57 A;  1QZE A;  2KMM A;  4ACF A;  4IKG A;  2LZ6 A;  2PJH A;  2HD5 B;  1WE7 A;  3PZ7 A;  2K22 A;  2WXJ A;  3N1X C;  2KTR A;  1E8Z A;  3B9J A;  2NCN A;  4AP4 C;  5BMG A;  1ZP0 B;  1GNU A;  1HZ5 A;  4MJS B;  2LVP A;  4P6V F;  4EKU A;  3BIN A;  5EE3 A;  3NS8 A;  1WJ4 A;  3N30 A;  2W3S A;  2N0S B;  2WDT B;  2KWD A;  3TEX A;  1XQQ A;  4B0E A;  2NVU I;  3PHW B;  4NAW A;  4RGM A;  3IBE A;  4AJY B;  3P4Q B;  1RWS A;  1MG4 A;  3NY5 A;  1ZPS A;  4X57 B;  3DBS A;  1UD7 A;  3DQV A;  2N7D A;  1GJZ A;  2IGG A;  1WSP A;  3R7R A;  3MJ5 A;  3QA8 A;  3PV1 A;  3TUO A;  1FM0 D;  1QOG A;  4DXA B;  4LNK A;  2FIF A;  4DBG A;  1MVK A;  3B08 A;  3AE2 B;  4KIK B;  1S1Q B;  1KTK A;  4K7S A;  1LM8 B;  1YX6 B;  1JQ4 A;  1WR1 A;  1T0R C;  3X23 A;  2J0J A;  1N62 A;  1FRR A;  4NZL B;  1FNW A;  2V4L A;  2GBJ A;  2JWU A;  2KN4 A;  3ZNG C;  3ZIM A;  4GMV A;  1AAR A;  2N9X A;  1QT9 A;  4EUT A;  4XE0 A;  4C00 A;  1CMX B;  2KDM A;  1WH3 A;  2BKF A;  3AU4 A;  2C9W B;  1RAX A;  1WR6 E;  2C7N B;  4AQ7 A;  2CJO A;  1N60 A;  1TJE A;  2G45 B;  3PRE A;  2D11 A;  3JSV A;  1TT5 B;  3ZYY X;  4NY0 A;  3NZS A;  2MJD A;  3KWV A;  3LYY A;  5JXV A;  4W9F A;  4PK1 A;  3LXF A;  5DPS A;  2ZZP B;  1WJN A;  3BVM A;  2UYZ B;  4GIV A;  4HCN B;  3MC0 B;  2J42 A;  5JHB A;  1VCB A;  3L54 A;  2QJL A;  3DWM A;  2ZCC A;  1C78 A;  3U7D A;  3AUL A;  5C3J B;  3I63 C;  4IWO A;  3U30 A;  3KVF B;  5H92 C;  1WGR A;  3AE9 B;  2INN E;  1V1O A;  2MWS B;  1STE A;  3N1Y C;  1TBE A;  4XWT A;  1WFY A;  4YSZ B;  3WAO A;  4RF0 A;  1ZW7 A;  3HIZ A;  1KLU D;  1K8R B;  2KT7 A;  5JHA A;  3R2T A;  4S0R A;  2RDG A;  4BAX A;  2AQ1 B;  4ZRK A;  1LFD A;  1OEY J;  1N61 A;  4RCO A;  2E3T A;  4TQ0 A;  1R4N B;  1KRH A;  3I5J C;  2WS3 B;  2KZR A;  1JWM D;  4P1C C;  5LLI A;  1G6J A;  3L4P A;  4CYE A;  1FO4 A;  2K3U A;  3QIJ A;  1F77 A;  1JWS D;  2GBM A;  4HK2 A;  2IGH A;  4M8N A;  2WXN A;  3DOW A;  3VTV A;  2WHI A;  3H7P B;  4HLE A;  3ZDM C;  2BWF A;  1T0Y A;  1ESF A;  2V3N A;  3SHQ A;  2ZVN A;  3NHE B;  1UWX A;  3QWZ B;  4N6E B;  4OZA A;  1YN4 A;  3AE8 B;  1J19 A;  3DBR B;  3UIO B;  2FCS A;  4NJC A;  3P42 A;  3IAS 1;  1XD3 B;  3QQ8 B;  4GGQ A;  1UZX B;  4HPP A;  5GMV A;  2KN5 A;  2MH7 A;  2R61 A;  1FFV A;  2L7R A;  3UIP B;  1TTN A;  2WDV B;  3M95 A;  2ONQ A;  1FXA A;  1WX7 A;  3ZW3 A;  2H88 B;  3J9C A;  4FHK A;  2LJI A;  3P4S B;  3ZKJ C;  4REZ A;  4G0N B;  4DHZ B;  2JSV X;  2BS4 B;  1N5W A;  2L1A A;  4FUL A;  2EEL A;  4RGO S;  2R2O A;  4OW0 A;  2PE9 A;  3U2S C;  3DDC B;  3HVZ A;  4D2K A;  2V1Y A;  4EZL A;  1UBI A;  2DAF A;  2KQ4 X;  4XYC A;  2RD0 A;  3W5V B;  2MBH A;  1UH6 A;  2ZJD A;  2DZM A;  4RH6 A;  4QAY A;  3RNE C;  3AEF B;  3SEB A;  1KOT A;  3AMZ A;  5E6P A;  1JML A;  2CJN A;  2DAJ A;  1YN5 A;  2K5P A;  3W1Y A;  3TMP B;  3L17 A;  4W9J A;  1GB4 A;  3GZN B;  1NDD A;  2AWT A;  3N9Y C;  1L2N A;  2GMI C;  1P0R A;  3ZXR A;  3R66 C;  3KQ4 A;  3MP9 A;  1LGR A;  5HKH A;  1AW7 A;  5D7G A;  2L8J A;  4LCD E;  2CHW A;  3RCZ A;  3A9K A;  3HM3 A;  4LNF A;  1WGG A;  4E71 A;  1YQ4 B;  3QCA A;  2VH2 A;  1UNS A;  2MP2 A;  4LTU A;  5JZE B;  3HVD A;  1UGM A;  1KF6 B;  4IWP A;  1I4R A;  4HVB A;  3B1L X;  2G9H D;  3QAR A;  1RFK A;  1V1P A;  4AS1 A;  1XT9 B;  1WXA A;  4CO7 A;  2XEW A;  3L08 A;  3UQB A;  2IYD B;  3PS6 A;  1HQR D;  2GBR A;  2ICI A;  1NYR A;  2LGD A;  1V81 A;  2XNA C;  4M01 A;  4YT0 B;  5DPW A;  1PGB A;  4CQN A;  3SR6 A;  4IM3 A;  4USA A;  4K1R B;  4JQW C;  3V05 A;  4US8 A;  5E6O A;  1QKZ A;  3OJ3 A;  2YEP B;  3KUC B;  4I6L B;  2WXG A;  2DX5 B;  3NRZ A;  4ITK A;  1FPY A;  3EFC A;  2LD9 A;  2FCN A;  5G2N A;  1JWA D;  2N7E A;  1ZKH A;  4IM2 A;  2DYM A;  5T8I A;  1TS3 A;  2WNM A;  1VZ8 A;  3MJW A;  2WXO A;  1FXI A;  1EU3 A;  2DZI A;  1XCQ L;  5AEK B;  4LDT B;  2NS5 A;  3IAM 1;  2JU6 X;  1E8Y A;  3Q8F A;  1XLP A;  3UF8 A;  1ACC A;  2NPT A;  4W9K A;  3V6C B;  4K81 A;  4WQM A;  2EMT A;  3WAL A;  2PE6 B;  5BYR A;  1I4G A;  1P7F A;  2QDF A;  4HDQ A;  4W9E A;  5D94 A;  2D3C A;  1WXV A;  2GLS A;  3OWE B;  4FLH A;  1E8X A;  2EKE C;  5L95 C;  2HTM E;  2KAC A;  2V0G A;  1YJ1 A;  3UI3 A;  5HG2 A;  2ZNV B;  4KKJ A;  2MBE A;  5EE1 A;  2K8B A;  4A90 A;  1DOX A;  3AE6 B;  1TS4 A;  2A5U A;  2Z0E B;  1A70 A;  4W9H A;  2KC2 A;  4PS3 A;  1I4Q A;  1Z5S B;  2CHZ A;  2WX1 A;  3WAM A;  5G55 A;  1ZDX A;  4HCP B;  1P98 A;  4KGT A;  5D3D A;  4M0W A;  5E6J A;  4F7Z A;  3W1S C;  1C3T A;  1J7A A;  4NJ7 A;  3VFK A;  1KJT A;  3VRA B;  3RUL A;  3RNB C;  2ON8 A;  2NR2 A;  5CHF A;  4A8X C;  1TYG B;  2MBQ A;  1DGJ A;  1T3Q A;  3FIL A;  2JT4 B;  4FHJ A;  3O13 A;  1WJU A;  2SAK A;  4GDK A;  2W55 A;  1WGK A;  2JPH A;  4LLG M;  4MH8 A;  2WQY B;  3GB1 A;  3LB8 C;  3AE1 B;  1XF5 L;  2MLB A;  3RD2 A;  3KH0 A;  1FNV A;  3Q2A C;  3V60 A;  2EKI A;  2QIL A;  4M8M A;  4ZHP A;  1JRU A;  4UDU C;  4W9D A;  4IC7 B;  4BBN F;  2KDB A;  1RFA A;  2J0M A;  2NBW B;  5MPO A;  1MPE A;  3BII D;  1L0Y B;  3P2B A;  4P16 A;  1Q1O A;  4MDK E;  1YN3 A;  4JLC A;  1H8C A;  4BVU C;  2N9E B;  2MX2 A;  1C4P A;  3AEA B;  2NBU A;  2N7J A;  4NQL B;  1E7P B;  2BS3 B;  2BBC A;  3KWL A;  3DWG C;  1HA5 A;  2D2Q A;  2KFK B;  3DVG X;  1WM3 A;  1SJE D;  3TJP A;  1R4N I;  1QOF A;  3Q8C A;  1OQY A;  1AN8 A;  5CHW A;  4A9A A;  2BVC A;  4BKS D;  4M00 A;  3C0R B;  2JQR B;  2MCN B;  1XLO A;  2WXF A;  2L83 A;  4HWI B;  1I42 A;  5DPR A;  3NVV A;  3AM9 A;  3EUB 2;  1JWB D;  4ANX A;  3PLV A;  3N32 A;  1I4H A;  3ZJU A;  3KW5 B;  1UF0 A;  3T3N A;  1XLN A;  3ETR A;  3NJT A;  2IJ0 A;  3T3O A;  5C23 A;  3CWI A;  3VH3 B;  2ZVO A;  4I6P A;  4MGZ E;  3DBR I;  1T0S C;  1X1M A;  3V61 A;  2I1J A;  3A4R A;  1TKE A;  4IG7 B;  2AQ3 B;  3ABV B;  1GC7 A;  3UGB B;  3P4P B;  4BOZ B;  1SSN A;  2K6Q A;  3NVZ A;  5DCN A;  1L6U A;  4NAW B;  2LMC A;  4WAF A;  3SFD B;  2LGX A;  2BPS A;  4DDI D;  4JWU C;  2KWV B;  3H8H A;  2K0P A;  3R7Q A;  4AUQ C;  2WXL A;  3SD5 A;  4KDL B;  5IOI A;  3TL5 A;  2AYO B;  2WU2 B;  5IKC M;  4F1S A;  1L4D B;  3V6E B;  4DK5 A;  2LXA A;  1XXG A;  3H9D A;  4TQ1 A;  4W9G A;  3ZJV A;  2Z0D B;  3PSE B;  2ZNV C;  2BWE S;  4JE3 B;  3RMK C;  2INP E;  1P9D U;  4ZRJ A;  2KDE B;  2WP9 B;  3QAQ A;  1VLB A;  1T6B X;  2BF8 B;  3GZN I;  3U8Z A;  3PRZ A;  1J7C A;  3C19 A;  1L6V A;  3CST A;  3VQI A;  1QLB B;  2JZ3 B;  2WXM A;  1AYF A;  1DOY A;  1HXY D;  2YEP F;  3KUD B;  2OHF A;  1HE8 A;  5HHD G;  1R7S A;  3JSV B;  2DNF A;  3NG0 A;  3PGE A;  2IDY A;  2M56 B;  2LUE A;  3PRP B;  2Z59 B;  4BKS A;  4IW0 A;  3AEB B;  1VJK A;  3JW0 X;  3VDZ A;  2LRU A;  3V62 A;  1TS2 A;  2MQJ A;  2G4D B;  4M02 A;  2L05 A;  3R8B A;  4KZ0 A;  3NVW A;  2V9H A;  3A1Q A;  4TSS A;  3T8M A;  1MHH E;  2C7H A;  1SE2 A;  2DHZ A;  3UQA A;  2MW5 A;  5EDS A;  1JRO A;  1WMH A;  2FNJ B;  2LVO A;  3GE8 C;  1Q0W B;  4FBJ B;  5E6N A;  1SXT A;  3ZJT A;  1ZXH A;  3ZO5 B;  3VUY A;  1MG8 A;  2BQQ A;  2K6D B;  3AXC A;  1QF6 A;  4RFB A;  1VDV A;  4LNO A;  2AL6 A;  2KX3 A;  2J4X A;  2SEB D;  3Q3J A;  3U52 E;  4EFO A;  1V97 A;  4JWS C;  3SDL C;  3IXS A;  5J18 A;  1OGW A;  3AI5 A;  2W3R A;  1UWM A;  1V80 A;  4IM0 A;  1TKG A;  3W5U B;  2I2Y A;  3P4R B;  1E0Z A;  2ZPN A;  4GDL A;  1WXS A;  4TUU A;  4W9L A;  3QC8 B;  1V2Y A;  2KO3 A;  4XDD A;  4I6N B;  1BUI C;  1FRD A;  2Y5P A;  1LQB A;  2N1W A;  2FUG 1;  2D3B A;  2DLB A;  2IGD A;  2RDB C;  2REX A;  3RPF C;  5KHO A;  2BB6 A;  2HJ1 A;  3NOB A;  1E9M A;  4PYZ A;  2KHW B;  1MI0 A;  2LVQ A;  1KFY B;  3C8Y A;  1F9J A;  2L32 A;  4DWF A;  1C79 A;  5J2R A;  3VXW A;  5G5H A;  2WDR B;  4ASW C;  3WAN A;  2AQ2 B;  3AB5 A;  3V3X A;  1EUV B;  3TEZ A;  3DHI C;  4YSY B;  4DHJ D;  1U4A A;  2RSU A;  2IY0 B;  3BK1 A;  5LXI B;  4OZC A;  3KUZ A;  3GS2 A;  2XBB C;  1WGD A;  2LGY A;  4HEA 1;  2C7M B;  4WWN A;  3A4S C;  1KM7 A;  2K25 A;  4DDG D;  3ZDT A;  1B9R A;  3U4E G;  3DBH B;  3URY A;  4XX5 A;  2DZJ A;  2M0X A;  4R3D A;  1E6E B;  3A9K B;  2PEA A;  1QOB A;  1RRB A;  3GOE A;  1FFU A;  2LI5 A;  1V86 A;  2O2V A;  4MAC A;  3VTW A;  1IGD A;  2XN9 C;  4TKN A;  2MP2 B;  3RZW C;  1JW9 D;  3RUI B;  2LFI A;  4LK0 M;  4N58 A;  4EZJ A;  4LNI A;  2FID A;  3AU5 A;  1V1P B;  3A33 B;  3Q8A A;  4C4V A;  1L7Y A;  4TMA B;  3RNG C;  1Q5W B;  1J8C A;  3MHZ A;  5L83 A;  3NVY A;  2ZCB A;  1XO3 A;  5D6J B;  2VZK B;  3NZ3 A;  4HDO A;  4IDI A;  3TEW A;  3I9V 1;  1D5Z C;  3QX1 A;  4B6W A;  4HPL B;  3VAW A;  1E8W A;  4K7W A;  2D5G A;  3AED B;  3QK0 A;  4FJZ A;  1KLV A;  5C2T B;  1EM7 A;  3QHT A;  3JVZ X;  2IPK D;  3WAP A;  3HHM A;  1JRP A;  3APC A;  3ZTC A;  1V6E A;  3L13 A;  2KTF A;  4ZDV A;  2D3A A;  2NTS A;  2IBI B;  4HKZ E;  4NNJ B;  3M63 B;  3D32 A;  1H4R A;  2GBK A;  3AE5 B;  2M1M A;  1ZOY B;  1M4V A;  2WGS A;  3AEC B;  1WIA A;  3T9L A;  1I4P A;  4YL8 A;  2NPT B;  5J17 A;  1YNT E;  2GRI A;  1NI2 A;  1OQQ A;  1UUP A;  3Q3O C;  2FCQ A;  4JL9 A;  2ACZ B;  2O6V B;  2PTL A;  1D5M C;  2BB5 A;  4II2 B;  4FAD A;  2KVR A;  3R3M A;  3MFG A;  1YJI A;  1WYG A;  4ZHO A;  1E10 A;  3ML9 A;  2V4I B;  1EWY C;  3Q69 A;  3ZNZ B;  3UIN B;  1D3Z A;  1V9J A;  4J3O D;  2JRI B;  1FMA D;  2G3Q B;  2KKC A;  2KWC A;  4C7Y A;  3X0W A;  1BT0 A;  4WJQ A;  2FAZ A;  4IWQ A;  2J53 A;  4A20 A;  1SIF A;  1NVI D;  2XK5 A;  3VR8 B;  4DHZ E;  4BBN C;  2JY6 A;  1QQR A;  4XWW A;  1PUT A;  3PT2 B;  2RPV A;  1NBF C;  2K39 A;  1I4X A;  5CX3 A;  1PGX A;  5FR6 A;  3PO0 A;  1FXT B;  2KMC A;  3IFW B;  2TSS A;  2CR5 A;  1F1H A;  4S17 A;  4XC2 A;  3GP7 A;  4ZRQ A;  2PIA A;  2YLM A;  4GU2 A;  4M0W B;  4XZ4 A;  2FCM A;  5TSS A;  3APF A;  1TY0 A;  3TIX A;  2VH1 A;  2BS2 B;  4L23 A;  4OZB A;  3PZ8 A;  2MA9 B;  3PTF C;  3K9O B;  1E7U A;  5D3I B;  3PHX B;  4ANU A;  4L1B A;  3FIL B;  2A4Z A;  1J7B A;  4GDK B;  3TSS A;  3NZU A;  4B9K A;  4MSQ B;  5FK9 C;  4NAM A;  4YTP B;  4ANV A;  3BWU D;  2KX0 A;  3BVG A;  2JXX A;  2IZV B;  4OVV A;  1FEH A;  3FKY A;  4AOF A;  3ZRC A;  2L76 A;  1XEE A;  4MM3 A;  2V3P A;  1TKY A;  4JGH B;  1ET9 A;  2N4F A;  1ET6 A;  2KJR A;  2PW9 A;  1SE4 A;  1WM2 A;  4GOC A;  1F0Z A;  3DVN V;  2JZZ A;  1SIJ A;  3U7Z A;  1WYW B;  2Q5W D;  3HK0 A;  2MBO A;  5FKA C;  2JYE A;  3MHS D;  3E9S A;  4KZC A;  4MT5 A;  2MHJ A;  4JIO U;  5AZH A;  2QC8 A;  2KJH B;  2JF5 A;  4KSL C;  2Y5B B;  1WE6 A;  2KXJ A;  1C77 A;  4OHJ A;  3RNA C;  2LEK A;  1CJE A;  4P1B C;  3EGR A;  3EC8 A;  4AJW A;  5IN7 A;  1JAL A;  2WXP A;  3M62 B;  4KDI C;  1L0V B;  1ROE A;  2IY1 B;  3H1U A;  5I4D A;  2GB1 A;  4HJK A;  4FN2 A;  5DPT A;  3N3K B;  4HXD A;  4AWJ A;  1GPX A;  4BKG A;  3CF6 E;  2G1E A;  2MEK A;  1IBX B;  2KNB A;  2LAS A;  3A9J A;  3WA0 A;  3APD A;  2OOB B;  3DBL B;  3RZF A;  4RGN A;  1OEY A;  1PDX A;  1XLQ A;  3L10 B;  1GG3 A;  3RFZ B;  2QMT A;  1ZDV A;  4EZK A;  5BMH A;  1C4A A;  4A3P A;  2NMQ A;  1EWC A;  2KWU B;  3VUX A;  3H6N A;  1OFF A;  2KTR B;  1TZ1 A;  1HEZ E;  1LO5 D;  2LGI A;  2BW2 A;  4OVZ A;  4W9I A;  2DBY A;  2CHX A;  3QJZ A;  1GC6 A;  1MFW A;  2HE7 A;  5IO9 A;  2RDH A;  5LXH A;  2WDQ B;  1ZXI A;  2MRP A;  1IP9 A;  2QHO A;  1MHX A;  1C76 A;  1QOA A;  2IND C;  2W82 A;  4LJO B;  1PQS A;  2M4N A;  4OVU A;  2RPQ A;  4H2A A;  1Q10 A;  1P1A A;  2B3A A;  1YQ3 B;  3M3J A;  1WZ3 A;  2AEH A;  4II3 B;  2GI9 A;  4RMA A;  1FNU A;  2BYT A;  2L00 B;  5KHQ A;  4WWP A;  2EMS A;  1PGA A;  3VTU A;  1VR9 A;  2LRW A;  2WLB A;  3PVL A;  2CU1 A;  2KK8 A;  2L0F A;  4K7U A;  3DBH I;  2Y5C A;  5JH5 C;  4WWO A;  3OLM D;  4MEL A;  4FA6 A;  1TY2 A;  3W9C B;  4K3B A;  2GBN A;  3AV8 A;  1YQB A;  1M94 A;  4MJS A;  4YTN B;  4G11 A;  1V5T A;  4N9F 4;  2BTE A;  1I35 A;  3P1M A;  4G50 A;  2RMM A;  4GSW A;  2KOX A;  3ZLZ A;  1Z2M A;  2KYW A;  3OJ4 B;  2J7Q B;  3ML8 A;  2DYB A;  2M17 A;  3EEC A;  1P3Q U;  4IOI E;  3ZUN A;  4URK A;  2NTT A;  3RI7 C;  3EA6 A;  1C1Y B;  3A1Q B;  2FE8 A;  2BT6 A;  2VRR B;  2JXT A;  1YOV B;  4HRS A;  2D07 B;  1WX9 A;  2H89 B;  1WMH B;  1BML C;  2E6X A;  4ICV A;  4KIK A;  5AUI A;  1K53 A;  2D3G A;  2ZEQ A;  2KFJ A;  5IP4 D;  4O1N A;  2KQ7 A;  1SE3 A;  4FJY A;  3VRB B;  5H8Y E;  1FCL A;  4NJ6 A;  4CHK A;  1WI0 A;  4RF1 A;  1FIQ A;  1PFD A;  5AZF A;  3N1Z C;  2ZPY A;  5BO4 B;  1F2R I;  4KSK C;  3FC4 A;  3W2D A;  5BYQ A;  5HFY A;  3BZD B;  4XGA B;  4N59 A;  1A5R A;  1I7H A;  3AEE B;  5GXG B;  1D5X C;  1JCK B;  1V49 A;  4FJV B;  1R4M I;  4BOS C;  4HJG E;  2QCZ A;  2KC1 A;  4GDL B;  5AZG A;  4A6Q A;  2WXK A;  2LUM A;  1VRA B;  4KX6 B;  5CHV C;  4WJP A;  2RGF A;  2DWQ A;  3NS1 A;  3Q8E A;  1NEN B;  4WJN A;  2JYT A;  1UEL A;  2V3S A;  3OAW A;  4LJP B;  4MGI E;  3IT4 B;  2LJ5 A;  4G3X B;  4ARI A;  3H7S A;  1K50 A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  1KJT A;  3LDZ E;  4FJZ A;  1GNU A;  3RUL A;  2KQS A;  4MJS B;  1KLV A;  2LVP A;  2K8C A;  4EKU A;  3QHT A;  2NR2 A;  3BIN A;  3JVZ X;  5CHF A;  1IPG A;  2MBQ A;  1LXD A;  3WAP A;  3NS8 A;  1WJ4 A;  2JT4 B;  3HHM A;  1WJU A;  3N30 A;  2WDT B;  4FHJ A;  3APC A;  4GDK A;  3ZTC A;  1V6E A;  1XQQ A;  2MSE D;  3L13 A;  2KTF A;  2JPH A;  4ZDV A;  2NVU I;  3PHW B;  4NAW A;  1EF5 A;  3IBE A;  4AJY B;  2IBI B;  2IO0 B;  2MLB A;  3RD2 A;  4NNJ B;  3KH0 A;  3M63 B;  3D32 A;  1J0G A;  3NY5 A;  1WX8 A;  4X57 B;  1H4R A;  2GBK A;  3DBS A;  3V60 A;  2M1M A;  4M8M A;  4E74 A;  1UD7 A;  3DQV A;  1JRU A;  4F8C B;  1WIA A;  2N7D A;  3T9L A;  5IA7 A;  4YL8 A;  4W9D A;  1GJZ A;  5D2M B;  3R7R A;  4IC7 B;  1IYF A;  3QA8 A;  3PV1 A;  4BBN F;  2NPT B;  5J17 A;  3PPA A;  4DXA B;  2KDB A;  2FIF A;  1RFA A;  1E7V A;  2J0M A;  4WAA A;  4DBG A;  3B08 A;  1NI2 A;  2NBW B;  4WQO B;  2WX0 A;  4KIK B;  2L3Z A;  1S1Q B;  3H7P A;  4ICU A;  3ZTD A;  4ZRI A;  4K7S A;  1LM8 B;  1YX6 B;  2FCQ A;  3P2B A;  4JL9 A;  1WR1 A;  2O6V B;  4II2 B;  3X23 A;  1Q1O A;  4MDK E;  2J0J A;  4FAD A;  2KVR A;  3R3M A;  4JLC A;  1H8C A;  4BVU C;  1ISN A;  2V4L A;  2N9E B;  2GBJ A;  2MX2 A;  3B0A A;  3ML9 A;  3ZIM A;  3ZNG C;  4GMV A;  3ZNZ B;  1AAR A;  2N9X A;  2HTH A;  3UIN B;  2NBU A;  1V9J A;  1D3Z A;  4NQL B;  2JRI B;  4EUT A;  2G4S A;  2G3Q B;  2KKC A;  2KWC A;  4MSM B;  3X0W A;  4W9C A;  5IAA C;  1BT0 A;  1CMX B;  2D2Q A;  2KFK B;  1WH3 A;  4WJQ A;  2BKF A;  2FAZ A;  3AU4 A;  3DVG X;  1EO6 A;  2O2V B;  2C9W B;  1RAX A;  1WM3 A;  2R2Q A;  4IWQ A;  1WR6 E;  4MGK E;  3TJP A;  1R4N I;  4A20 A;  4J6I A;  1SIF A;  2XK5 A;  2UWQ A;  4NPN A;  1OQY A;  2C7N B;  4DHZ E;  5CHW A;  4BBN C;  2I1K A;  2JY6 A;  4BKS D;  2G45 B;  3C0R B;  3PRE A;  2D11 A;  3JSV A;  3PT2 B;  1NBF C;  2K39 A;  5CX3 A;  4EOY A;  2MCN B;  4NY0 A;  3NZS A;  4HWI B;  3IG3 A;  3BY4 B;  5FR6 A;  4P7I A;  3TCA A;  1I42 A;  5DPR A;  3L16 A;  4W9F A;  1FXT B;  2KMC A;  3IVF A;  3IFW B;  5DPS A;  2CR5 A;  3W1S A;  1OTR B;  2ZZP B;  1WJN A;  4ANX A;  3PLV A;  2MBB B;  2UYZ B;  3N32 A;  4GIV A;  4LDT D;  4XC2 A;  4HCN B;  2O6V D;  2YLM A;  3KW5 B;  4GU2 A;  5JHB A;  4M0W B;  1VCB A;  2FCM A;  4XZ4 A;  3L54 A;  2LWP A;  4MEM A;  5C23 A;  2ZCC A;  3APF A;  3U7D A;  2ZVO A;  3AUL A;  3VH3 B;  4I6P A;  4IWO A;  4MGZ E;  3U30 A;  3KVF B;  3DBR I;  2N1V A;  1WGR A;  1X1M A;  2MWS B;  3TIX A;  1TBE A;  3L0W B;  3V61 A;  2ASQ A;  1WFY A;  2I1J A;  3ALB A;  3WAO A;  2MA9 B;  3A4R A;  3PTF C;  4IG7 B;  3VUW A;  3K9O B;  1E7U A;  1ZW7 A;  3HIZ A;  3PHX B;  1K8R B;  4ANU A;  5JHA A;  2KLC A;  1GC7 A;  3UGB B;  2A4Z A;  1WXM A;  2W9N A;  4GDK B;  4BOZ B;  3NZU A;  4B9K A;  2JRH A;  2K6Q A;  4MSQ B;  5DCN A;  4ZRK A;  2BYE A;  1LFD A;  4NAW B;  2OJR A;  1OEY J;  4ANV A;  2K1F A;  1UBQ A;  2CKH B;  2LGX A;  2BPS A;  2KX0 A;  4TQ0 A;  2JXX A;  2IZV B;  3JYU A;  4OVV A;  4DDI D;  3PZD A;  4PS8 A;  2KWV B;  1VD2 A;  1RLF A;  2J0K A;  2KZR A;  1WGY A;  2L0T A;  3R7Q A;  4AUQ C;  4TV3 A;  3SD5 A;  5LLI A;  3KYD D;  3VVW B;  4KDL B;  4AOF A;  1WGH A;  3ZRC A;  1G6J A;  4CYE A;  5CTR C;  2L76 A;  3TL5 A;  2AYO B;  3QIJ A;  4MM3 A;  1SGH A;  4IUM B;  4JGH B;  4F1S A;  3V6E B;  2GBM A;  4HK2 A;  4DK5 A;  4M8N A;  2LXA A;  2N4F A;  3DOW A;  2GOW A;  3H9D A;  3DBL I;  4TQ1 A;  2KJR A;  4W9G A;  3VTV A;  3H7P B;  2Z0D B;  4HLE A;  3ZDM C;  4A3O A;  3PSE B;  2ZNV C;  2BWF A;  1WM2 A;  3ONS A;  4GOC A;  1T0Y A;  2BWE S;  4ANW A;  4DHJ B;  3DVN V;  2JZZ A;  3SHQ A;  1P9D U;  4ZRJ A;  2ZVN A;  1YX5 B;  3CMM B;  1WYW B;  2KDE B;  3NHE B;  4PS7 A;  3HK0 A;  3QWZ B;  2MBO A;  3QAQ A;  1WZ0 A;  3MHS D;  1J19 A;  2BF8 B;  4KZC A;  3UIO B;  2FCS A;  1Y8R C;  3GZN I;  4JIO U;  1XD3 B;  3U8Z A;  3QQ8 B;  3ZNH B;  3PRZ A;  4B95 A;  4GGQ A;  1UZX B;  5AZH A;  2KMA A;  1EF1 A;  2JVC A;  2KJH B;  2JF5 A;  4KSL C;  5GMV A;  2Y5B B;  3RYT A;  2KN5 A;  1WE6 A;  3CST A;  3VQI A;  2L7R A;  2JZ3 B;  3Q3F A;  2KXJ A;  2XK5 B;  2IO3 B;  3UIP B;  1TTN A;  1V5O A;  3KUD B;  3ECI A;  1HE8 A;  3M95 A;  1S3S G;  3EFU A;  3JSV B;  3ZW3 A;  1WX7 A;  4MGY E;  3EC8 A;  4AJW A;  3ZVV A;  4FHK A;  3M62 B;  4KDI C;  3PGE A;  2IY1 B;  3ZKJ C;  3H1U A;  4G0N B;  3ZNI D;  4DHZ B;  1WRD B;  4HJK A;  2BYF A;  2LUE A;  4FUL A;  3PRP B;  4FN2 A;  5DPT A;  3N3K B;  2Z59 B;  2R2O A;  4BKS A;  4HXD A;  2PE9 A;  4AWJ A;  3DDC B;  4BKG A;  3CF6 E;  4IW0 A;  2V1Y A;  2KNB A;  1UBI A;  2DAF A;  2WWZ A;  3DPD A;  3JW0 X;  4EZL A;  2LAS A;  3A9J A;  3VDZ A;  2LRU A;  2RD0 A;  3V62 A;  3WA0 A;  2MQJ A;  3APD A;  2MBH A;  2OOB B;  3LJ3 A;  3RT3 B;  5TR5 A;  3RZF A;  2G4D B;  1UH6 A;  2ZJD A;  2DZM A;  1OEY A;  3L10 B;  2AL3 A;  2L05 A;  2O6V A;  1GG3 A;  4KZ0 A;  1KOT A;  3T8M A;  3A1Q A;  5E6P A;  3VFK A;  2C7H A;  2DAJ A;  3W1Y A;  2DHZ A;  3UQA A;  4EZK A;  2MW5 A;  3TMP B;  5EDS A;  4A3P A;  3L17 A;  1WMH A;  4KV2 A;  2N9P C;  2FNJ B;  2LVO A;  4W9J A;  1Q0W B;  2KWU B;  4FBJ B;  3VUX A;  3H6N A;  4BFR A;  3I3T B;  1NDD A;  2AWT A;  1L2N A;  1WJ6 A;  2KTR B;  1TZ1 A;  1WF9 A;  2GMI C;  5E6N A;  1P0R A;  2LXC A;  3R66 C;  2DEN B;  3ZO5 B;  2HJ8 A;  3VUY A;  1MG8 A;  4PYU A;  2K6D B;  3AXC A;  4W9I A;  2KDF B;  5HKH A;  5D7G A;  2CHX A;  2L8J A;  3QJZ A;  4LCD E;  1GC6 A;  2AL6 A;  2D10 A;  2KX3 A;  2CHW A;  2HE7 A;  3Q3J A;  3MTN B;  3RCZ A;  2C5L C;  3A9K A;  2YVC A;  3HM3 A;  4EFO A;  1WGG A;  4E71 A;  2C60 A;  3SDL C;  3QCA A;  4RM8 A;  5LXH A;  5J18 A;  1OGW A;  2MRP A;  2MP2 A;  1IP9 A;  2QHO A;  3AI5 A;  5JZE B;  1UGM A;  3DCG A;  1V80 A;  4IWP A;  4HVB A;  4GXB A;  4LJO B;  1PQS A;  4IM0 A;  2M4N A;  2M8S A;  3B1L X;  4OVU A;  2RPQ A;  2JWZ A;  3QAR A;  3VH4 B;  1P1A A;  2B3A A;  3DVN U;  2BYV E;  2IO1 B;  3M3J A;  1WZ3 A;  3ENE A;  2KDI A;  2AEH A;  2ZPN A;  4GDL A;  1XT9 B;  1WXS A;  4II3 B;  4TUU A;  1WXA A;  2DYO A;  4RMA A;  4CO7 A;  2L00 B;  3O65 B;  2RR9 A;  4W9L A;  3QC8 B;  1V2Y A;  2EMS A;  2KO3 A;  4WWP A;  5KHQ A;  3VTU A;  2XEW A;  2LRW A;  4I6N B;  3PLU A;  3L08 A;  2BGF A;  3UQB A;  2IYD B;  3K9P B;  3PVL A;  3PS6 A;  2CU1 A;  1LQB A;  2N1W A;  2GBR A;  2KK8 A;  4ZYN A;  2L0F A;  4K7U A;  3DBH I;  2LGD A;  4EEW A;  5JH5 C;  4WWO A;  2CS4 A;  3OLM D;  1V81 A;  2REX A;  4MEL A;  4FA6 A;  5KHO A;  5DPW A;  3NOB A;  1GUA B;  2FUH B;  2GBN A;  4RM9 A;  4IM3 A;  4PYZ A;  1YQB A;  4K1R B;  2KHW B;  4JQW C;  2KLG A;  3HM6 X;  1M94 A;  3DVG Y;  5E6O A;  4MJS A;  4WJO A;  4G11 A;  3OJ3 A;  2LVQ A;  1V5T A;  4N9F 4;  1F9J A;  2PPH A;  1I35 A;  3KUC B;  1WY8 A;  4I6L B;  4DWF A;  4G50 A;  2DX5 B;  5J2R A;  3VXW A;  2LD9 A;  2FCN A;  5G2N A;  3S2A A;  2N7E A;  4GSW A;  1ZKH A;  4IM2 A;  4ASW C;  4HPM B;  2DYM A;  2KOX A;  3WAN A;  3ZLZ A;  3A9J B;  1Z2M A;  2WYQ A;  3MJW A;  3PRM B;  3OJ4 B;  2DZI A;  2J7Q B;  3ML8 A;  3WIM A;  2DYB A;  2IO2 B;  1ZGU B;  2M17 A;  3EEC A;  4LDT B;  1P3Q U;  4BKT A;  3ZUN A;  5AEK B;  2NS5 A;  4URK A;  1EUV B;  3CSF A;  1E8Y A;  4DHJ D;  1C1Y B;  3A1Q B;  1U4A A;  3UF8 A;  2RSU A;  2VRR B;  2IY0 B;  2NPT A;  4W9K A;  3V6C B;  4K81 A;  5LXI B;  2D07 B;  1WX9 A;  3KYC D;  2EMT A;  3KUZ A;  1WMH B;  2KAN A;  3WAL A;  4ICV A;  4KIK A;  2XBB C;  2PE6 B;  1WGD A;  2LGY A;  3SU8 X;  2C7M B;  2D3G A;  2ZEQ A;  3A4S C;  4WWN A;  2K8H A;  1KM7 A;  3VHT C;  2KFJ A;  2K25 A;  4DDG D;  2KQ7 A;  4HDQ A;  2BKR B;  4W9E A;  4FJY A;  5D94 A;  4E3C A;  3ZDT A;  4MH0 E;  1WXV A;  4NJ6 A;  4CHK A;  4XX5 A;  1WI0 A;  4FLH A;  2DZJ A;  4NQK E;  2M0X A;  2NBV B;  5AZF A;  1E5W A;  1E8X A;  2EKE C;  3A9K B;  5L95 C;  2ZPY A;  2PEA A;  1RRB A;  5BO4 B;  2KFK A;  3GOE A;  1YJ1 A;  2LI5 A;  4KSK C;  2ZNV B;  1V86 A;  2O2V A;  3VTW A;  4TKN A;  4GN1 A;  2MBE A;  2MP2 B;  3RZW C;  4GB9 A;  1E90 A;  1A5R A;  1YD8 U;  4KVG B;  3RUI B;  2K8B A;  3EHV A;  4EZJ A;  1V49 A;  2KD0 A;  4FJV B;  2A5U A;  1R4M I;  2FID A;  2Z0E B;  4BOS C;  3AU5 A;  3IHP C;  1YIW A;  4W9H A;  3A33 B;  2KC2 A;  4PS3 A;  3ZRF A;  2KC1 A;  2KJ6 A;  1Z5S B;  2CHZ A;  2WX1 A;  1L7Y A;  4GDL B;  5AZG A;  3WAM A;  1Q5W B;  5G55 A;  1SE9 A;  5C1Z A;  3TBL D;  1J8C A;  2DZK A;  5L83 A;  1TGZ B;  2JUO A;  1P98 A;  4HCP B;  5CHV C;  2ZCB A;  4WJP A;  1QZE A;  2RGF A;  5D6J B;  2LZ6 A;  4F7Z A;  3W1S C;  2PJH A;  1C3T A;  2HD5 B;  4HDO A;  4WJN A;  1WE7 A;  3QX1 A;  4B6W A;  4HPL B;  3VAW A;  1UEL A;  2V3S A;  1E8W A;  3OAW A;  4LJP B;  4MGI E;  4G3X B;  2KTR A;  2LJ5 A;  4K7W A;  1E8Z A;  4NJ7 A;  2NCN A;  3H7S A;  4AP4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...