2BWES

The crystal structure of the complex between the uba and ubl domains of dsk2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, U
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bweS00
2RPQA 3VUYA 3PLVA 1VCBA 5DPSA 5IAAC 1V81A 4A20A 1TGZB 2KN5A 2L0TA 4W9IA 3RCZA 4RM9A 2HE7A 3R66C 2W9NA 3PTFC 4GIVA 4NNJB 3PLUA 4BVUC 5DPWA 2G3QB 1WX8A 3W1SC 3QAQA 4TV3A 1WXVA 2LGYA 1OEYA 3Q3JA 2PE9A 3UF8A 1NI2A 4P7IA 4FJVB 4IWOA 3V60A 3UINB 3APCA 3IG3A 3A4RA 3VH3B 4AJYB 2GBJA 2AWTA 3B0AA 5D7GA 2KMCA 2N1VA 4ANVA 2CR5A 2MBEA 2WDTB 2BWFA 2KX3A 2KTRA 4HWIB 1V49A 4W9LA 4NJ7A 3A33B 4XZ4A 2KC1A 1WGHA 5L83A 1C1YB 3NS8A 4MJSA 4HVBA 2KO3A 4WWPA 4W9FA 3ZDMC 4DHJB 3W1YA 4GN1A 1GUAB 3T8MA 3L54A 3H7PA 5G55A 2LRWA 3PREA 3ZLZA 4IWPA 4PS8A 2IBIB 1K8RB 1J0GA 4MGIE 4TKNA 4GGQA 1UD7A 4ANUA 3PSEB 1Q1OA 4NQKE 3RYTA 2IO3B 4EZJA 3PRZA 5AZFA 3ZO5B 1TBEA 4WJQA 2D3GA 1G6JA 1UZXB 2UYZB 2MRPA 3OJ4B 4JQWC 3CF6E 3R7RA 2BF8B 2AEHA 3QWZB 2V4LA 3KUZA 3VUXA 4PS7A 3H9DA 3M62B 3OJ3A 5AEKB 2C60A 1L2NA 3N3KB 1WXMA 2XEWA 1SGHA 1FXTB 2CHXA 3DBSA 1XD3B 4MGKE 4K81A 2R2QA 4G11A 3WAOA 2HD5B 2L05A 3KUDB 3IBEA 4LJPB 3UIPB 2LASA 4CO7A 2KZRA 4I6NB 5D6JB 2BYFA 2IZVB 2RSUA 4BOZB 2ASQA 4I6LB 2OJRA 3ZTCA 1WMHB 3NZSA 2BKFA 3UGBB 3ZKJC 1Z2MA 2KHWB 1WJ6A 4NY0A 2DYMA 1I42A 1UH6A 4KIKB 1GJZA 2R2OA 3L17A 5C1ZA 4AUQC 1C3TA 3CSFA 4BKGA 1GC6A 4FULA 5CTRC 2FIFA 1WGGA 2NBWB 2BWES 2KANA 1KJTA 3VUWA 3TIXA 3TMPB 4HPLB 2GMIC 2RR9A 3H6NA 5E6NA 3D32A 2C7MB 4MGYE 1Q5WB 1ISNA 4ASWC 2Y5BB 4HCNB 2KD0A 2VRRB 2JT4B 1WJNA 4K1RB 1KOTA 4OVVA 2WX1A 2C9WB 2MBQA 1YX6B 2K6DB 1WF9A 3C0RB 4FA6A 4KV2A 4DXAB 4G3XB 3VDZA 1GG3A 1WZ3A 3RD2A 4HPMB 1E5WA 1V6EA 1WGRA 3L08A 2C7NB 3DCGA 2BPSA 2D10A 3V61A 2K6QA 2ZVOA 2O6VB 1WXSA 3JYUA 1I35A 2N7EA 3A9KA 1KM7A 2K8HA 2KTRB 4MM3A 4AJWA 3M3JA 1JRUA 2PE6B 3O65B 4IM0A 4LDTB 5J18A 2KJRA 4G0NB 3PZDA 4MJSB 2JZ3B 3ONSA 3TL5A 1ZW7A 2N9EB 3VH4B 3DOWA 3L10B 4NQLB 4F1SA 2JPHA 2FUHB 2ZZPB 1WI0A 4PYZA 1PQSA 3N30A 3ZNGC 4AOFA 2G4DB 3JVZX 4LJOB 2MCNB 3WALA 2FCSA 1L7YA 3DQVA 3UQBA 4IG7B 2GBMA 2NBUA 3ALBA 3ZUNA 2KFKA 5IA7A 1U4AA 2KDIA 2L3ZA 3MTNB 4JL9A 4KZ0A 3PRMB 3V62A 1NDDA 3L16A 1YD8U 4DWFA 3H1UA 4KDIC 1E7VA 2IO0B 4MSQB 2KQSA 4WJNA 2Z0DB 1V80A 2QHOA 4MEMA 3PHXB 3WAMA 5LXHA 1WFYA 2ZCBA 1E8WA 1ZKHA 1LXDA 3S2AA 3PHWB 3B08A 3ZVVA 2M1MA 2ZNVB 1SE9A 1EF1A 3DVNV 4M8MA 5DCNA 5DPRA 2NS5A 4GOCA 2KWVB 4GSWA 1OTRB 2C5LC 4XC2A 1BT0A 1WGDA 4AP4C 2Z59B 2NPTA 3TBLD 3QA8A 3ZIMA 2N1WA 2KWUB 4GB9A 4WWOA 4MELA 2D11A 4E74A 2AYOB 4HK2A 5TR5A 3X0WA 2MBHA 1EUVB 2AL3A 1LM8B 3R3MA 4TUUA 1QZEA 2XBBC 2K8BA 2NR2A 2KJHB 3APDA 2RGFA 1UBQA 2PEAA 2ZPYA 4XX5A 4BBNC 1MG8A 3QQ8B 4HLEA 5BO4B 4IW0A 2A4ZA 1UELA 2JRIB 5FR6A 5G2NA 3AULA 4E71A 3ML8A 2KK8A 3A4SC 3NZUA 2WX0A 1P0RA 2GBNA 2DAFA 2M4NA 3QX1A 5E6PA 3DVGX 4FN2A 2WWZA 4FHKA 2KDFB 4I6PA 5E6OA 3QJZA 4KSKC 2BKRB 3JSVA 2CHWA 1WH3A 4PYUA 4G50A 3HHMA 2LXAA 1UBIA 5JZEB 3ENEA 1SIFA 1WE7A 3IVFA 2JF5A 2C7HA 4BKSD 1P9DU 2KWCA 4ZYNA 4GDKA 3SDLC 2O6VD 3M63B 2JUOA 5D94A 2LI5A 2ZNVC 4GDLA 4IWQA 3WA0A 2IYDB 5KHOA 2UWQA 3N32A 4LDTD 1YIWA 2CS4A 2AL6A 2MBBB 3CMMB 4RMAA 2LJ5A 4URKA 3VVWB 1CMXB 3AXCA 3EHVA 1RFAA 4W9EA 3K9OB 4BKTA 2MWSB 2ZVNA 1WE6A 1YJ1A 4IM3A 1E8YA 2V1YA 3ZNZB 2GOWA 3A9KB 2ZPNA 2JXXA 4MGZE 3A9JA 3NHEB 3VFKA 2MP2A 4NAWA 3EC8A 3AI5A 1EF5A 2XK5A 1Q0WB 2IO1B 1RRBA 1P3QU 3WIMA 2K1FA 3QIJA 4ZRKA 2LXCA 2MBOA 3LJ3A 4WAAA 4ANWA 1M94A 2A5UA 2I1KA 3PGEA 2Z0EB 3EECA 3U7DA 3Q3FA 1HE8A 4BOSC 2EMSA 4GXBA 4CHKA 3A1QA 3K9PB 4K7UA 2KKCA 3GOEA 3ML9A 4WJOA 4EFOA 2J0MA 3CSTA 3MJWA 5HKHA 4KZCA 5J17A 4DBGA 3PT2B 2KFKB 3SU8X 1KLVA 4W9KA 1YQBA 2FCQA 2REXA 5D2MB 1IYFA 1R4NI 1RLFA 2KLGA 1TZ1A 1EO6A 1V9JA 4FBJB 5CHFA 2KTFA 3VAWA 5JH5C 2KJ6A 1P98A 3HM6X 3HK0A 2DZMA 4DHJD 4II2B 1LFDA 4K7SA 2B3AA 1P1AA 5CHVC 3PPAA 3U30A 1GNUA 5LXIB 4IM2A 3QHTA 4ICUA 3RULA 3X23A 3ZRCA 3DVGY 2KFJA 2EMTA 3BY4B 4MDKE 2G45B 5EDSA 3RT3B 2JWZA 1H8CA 3H7PB 4F7ZA 3T9LA 4J6IA 2D07B 2L00B 4TQ1A 2MSED 1T0YA 2LGDA 1WX9A 3W1SA 2DZJA 3M95A 5JHAA 2FCNA 1WYWB 3AU5A 5AZHA 2NPTB 2KXJA 2N7DA 5GMVA 1GC7A 3EFUA 4NPNA 4KVGB 1IPGA 3WAPA 3KVFB 4HCPB 2ZJDA 3IHPC 2IO2B 2KVRA 2NVUI 2CKHB 2O2VA 3RZWC 4MSMB 1V2YA 2YLMA 4JIOU 1E90A 2BYEA 1X1MA 1E8XA 2DZKA 4W9HA 2HTHA 2J0KA 3ZNHB 2LZ6A 1OGWA 3KUCB 3KW5B 2DX5B 4CYEA 4EZLA 4B6WA 4BBNF 2L8JA 3VQIA 3KH0A 3B1LX 1VD2A 4BKSA 4LCDE 1XT9B 4DDID 2O6VA 3SHQA 1WM3A 4WQOB 1R4MI 2M8SA 1Y8RC 2N4FA 3ZNID 2LWPA 1WGYA 2DENB 2LVQA 2NBVB 1WIAA 2LRUA 2ZEQA 3JSVB 3QCAA 4OVUA 2KDEB 2EKEC 2OOBB 1E7UA 4HXDA 1S3SG 3HM3A 2BGFA 3TJPA 2N9XA 3SD5A 2M17A 1J19A 5JHBA 4FJYA 3V6CB 2BYVE 4GDKB 4ANXA 2G4SA 1V86A 2ZCCA 4GDLB 4K7WA 4WJPA 1WXAA 1TTNA 3P2BA 4KDLB 2FIDA 1WY8A 1YX5B 2KC2A 1RAXA 4ICVA 3RUIB 2MW5A 3PS6A 2DHZA 4EUTA 1AARA 2DZIA 2KDBA 3DVNU 4GU2A 4WWNA 3VHTC 4ZRJA 4W9CA 5AZGA 2LGXA 1WR6E 4ZRIA 5J2RA 4AWJA 2LVPA 5KHQA 3ECIA 1WRDB 3A9JB 3NOBA 2MP2B 2K39A 4NAWB 1OEYJ 5L95C 2KQ7A 2IY1B 2XK5B 2I1JA 4FADA 4BFRA 3UQAA 1V5OA 2J7QB 4DDGD 4GMVA 2WYQA 4EKUA 3VTVA 5C23A 3A1QB 3RZFA 2FCMA 3KYDD 4IC7B 3ZW3A 4JGHB 4X57B 3QC8B 2KLCA 2JRHA 2MLBA 1WR1A 5LLIA 3ZRFA 2L7RA 3L13A 2NCNA 1A5RA 3PRPB 2V3SA 1WX7A 2J0JA 4DHZE 2GBRA 4ZDVA 3V6EB 4KSLC 3APFA 2PPHA 4N9F4 3L0WB 1NBFC 4B95A 5DPTA 1S1QB 1WJ4A 2FAZA 4W9JA 4EOYA 1D3ZA 1WJUA 3ZDTA 3GZNI 1UGMA 3HIZA 3PV1A 4IUMB 1WM2A 3ZTDA 2IY0B 4W9GA 3UIOB 1H4RA 1ZGUB 4DK5A 2DYBA 2MX2A 3VXWA 3NY5A 2KNBA 2LD9A 2LVOA 4F8CB 2CU1A 2KX0A 4YL8A 3H7SA 3PVLA 1V5TA 1IP9A 4B9KA 4E3CA 2JZZA 3QARA 4EZKA 4RM8A 4W9DA 3BINA 4HDQA 2KMAA 3MHSD 3OAWA 2RD0A 4PS3A 2GBKA 3WANA 4A3OA 2JY6A 2M0XA 4FLHA 2FNJB 2DAJA 3DDCB 2MQJA 2N9PC 4NJ6A 2L0FA 2LUEA 3DBRI 2D2QA 2MA9B 2O2VB 2PJHA 3I3TB 3R7QA 4FHJA 4DHZB 1XQQA 4MH0E 3OLMD 1J8CA 5CX3A 4II3B 4HJKA 4M0WB 2CHZA 3VTWA 1OQYA 1WMHA 1WZ0A 3VTUA 1E8ZA 3KYCD 2DYOA 3U8ZA 2L76A 3DBHI 1Z5SB 3IFWB 2YVCA 3JW0X 2K25A 3DBLI 4KIKA 2KOXA 4EEWA 3AU4A 2HJ8A 4FJZA 3QK0A 4JLCA 4HDOA 2JVCA 1F9JA 3DPDA 1LQBA 4TQ0A 4M8NA 3LDZE 3TCAA 4A3PA 5CHWA 2K8CA
chains in the Genus database with same CATH superfamily
5FR3A 3AMZA 3RI7C 1ESFA 2W9NA 3W1SC 1JWBD 4TV3A 3Q3JA 4RFBA 2J4XA 3UF8A 2PE9A 2QSDA 3V60A 3UINB 3APCA 2N1VA 2KTRA 4XZ4A 3A33B 3GZNB 3NS8A 4ARCA 4WWPA 2WHIA 2W55A 1T3QA 2RPVA 3L54A 3H7PA 5G55A 2J42A 4IWPA 2PMVA 1K8RB 1QOAA 2R61A 1V1OA 3RNBC 4ANUA 1DOXA 3PSEB 2KDMA 3V3XA 1TBEA 2MRPA 3AB5A 1FNUA 1YMHE 3R7RA 2D5GA 1UGJA 2Y3AA 1KF6B 3VUXA 1XXGA 2C60A 3N3KB 1C4CA 1FXTB 2CHXA 2N9LA 2FBWB 2R2QA 1FFUA 3Q8EA 4KKIA 2HD5B 2L05A 1TS5A 1JCKB 1KLGD 2KZRA 2D3CA 1FM0D 2IZVB 4AQ7A 2ASQA 4YSXB 2MJDA 2OJRA 2RDBC 3ZTCA 3J9CA 1YOVB 3ZKJC 2ON8A 1GJZA 1HQRD 2WNMA 2OHFA 4BKGA 1NI3A 4LK0M 2FIFA 1V97A 2NBWB 1UNSA 3VUWA 1SF0A 2NTTA 2W3RA 2W54A 2AQ2B 2RR9A 3D32A 1FXAA 1Q5WB 1ISNA 2M56B 1KOTA 1YQ4B 2JT4B 2M19A 1YX6B 4LNKA 4G3XB 3VDZA 3ZJUA 4HPMB 3AEEB 3SFDB 2JXTA 2C7NB 4XWWA 2BPSA 3V61A 2ZVOA 2N7EA 4KGRA 3UI3A 3O65B 4G0NB 4ZHPA 3IXSA 1Q10A 2ACZB 3BVMA 2JPHA 1JWAD 4NJCA 3GE8C 3JVZX 5AUKA 1L7YA 3ZUNA 5IA7A 2KT7A 3R8BA 5T8IA 2IGHA 1NDDA 3L16A 3H1UA 4MSQB 3P42A 2QHOA 2V0GA 3PHXB 5LXHA 1D5MC 4K3BA 1PUTA 1V1PA 1SE9A 2ZNVB 2KWVB 3DWMA 4GSWA 4AP4C 3ZIMA 4N6EB 5TR5A 1LM8B 1VZ7A 2K8BA 2KJHB 2ZPYA 4HLEA 1MG8A 4IW0A 1VDVA 1UELA 4C80A 3AULA 2MEKA 1FD6A 1JWUD 3RPFC 4MH8A 2GBNA 3QX1A 4FHKA 4KSKC 2KACA 1UBIA 2IJ0A 5JZEB 2GI9A 3NVYA 1WE7A 3IVFA 2WGSA 2C7HA 2ICIA 2KWCA 3M63B 3WA0A 1N63A 2WXRA 4Q2JA 2UWQA 4YTMB 4LDTD 1YIWA 4URKA 2WQYB 2LJ5A 3AXCA 3EHVA 1RFAA 2JXXA 3A9JA 3NHEB 2MP2A 3N20C 2SAKA 2K1FA 3QIJA 4ANWA 4C7YA 1M94A 1UWMA 2Z0EB 3EECA 2EMSA 3ETRA 3A1QA 3P4SB 1TS4A 3CSTA 1E7PB 5J17A 4W9KA 1EWCA 2REXA 3DHGC 1RLFA 2KWDA 1D5ZC 2JQRB 1SJED 5CHFA 2KJ6A 1WGKA 5FK9C 4YT0B 3TSSA 4S0RA 3U30A 1SIJA 3QHTA 4ICUA 2KFJA 3BY4B 3T9LA 3M95A 4ZYSA 5JHAA 2FCNA 3KQ4A 1GC7A 1VJKA 3AV8A 4NPNA 4KVGB 1PFDA 2IO2B 2NVUI 3FC4A 2O2VA 4MSMB 3NJTA 2BYEA 1PDXA 1X1MA 2HTHA 1QQRA 4ZOHC 2LZ6A 4JPSA 3KUCB 3KW5B 4CYEA 4BBNF 2QMTA 1YQ3B 4DDID 1XT9B 4NZLB 1JQ4A 3SHQA 1R4MI 4A9AA 2M8SA 2LHDA 4OVUA 2ZEQA 3URYA 1NENB 2OOBB 1S3SG 4JE3B 1RWSA 4FJYA 2KVZA 4GDKB 1B9RA 4GDLB 4K7WA 2FIDA 2KC2A 5EE3A 3NRZA 2DHZA 2DZIA 3LB8C 1EM7A 1QOFA 4AWJA 1I4PA 5KHQA 1WRDB 4HRSA 3NOBA 3Q8CA 4NAWB 4IKGA 2KQ7A 2XK5B 4REZA 1V5OA 2J7QB 4DDGD 1LO5D 2N0SB 4IC7B 1WR1A 2J52A 2V3SA 1TS2A 2QC8A 4ZDVA 2HJ1A 3SEBA 1LGRA 3U2SC 2X8XX 4JX1C 3ZDTA 1KH0A 1HXYD 4DK5A 1SJHD 2I38A 4YL8A 1IP9A 1C78A 4E3CA 3QARA 4RM8A 5D3IB 3OAWA 2GBKA 4HKZE 2D3BA 1R7SA 2JY6A 1F52A 2MQJA 2N9PC 1SE4A 4NAMA 3I3TB 4FHJA 1XQQA 1V8CA 4M0WB 3VTWA 3CIRB 1E8ZA 3Q14C 2L76A 4ARIA 1T6BX 3DBLI 1HEZE 3BWUD 3FILB 1P7FA 2JVCA 5JXVA 2HDEA 1LQBA 3U7ZA 5CHWA 5C3JB 2K8CA 1F2RI 1RFKA 3VUYA 3PLVA 1VCBA 1L0YB 3ZJTA 4W9IA 1L0XB 3EFCA 3PTFC 4NNJB 3PLUA 2G3QB 3QAQA 2LGYA 3VR8B 3A4RA 2AWTA 3B0AA 5D7GA 2WDTB 2BWFA 2KX3A 1V49A 3Q8BA 1WSPA 1GUAB 3W5UB 3PREA 2IBIB 1L5PA 1J0GA 1F77A 4MGIE 4C4VB 3W5VB 5BMIA 1CZPA 1KFYB 4M01A 3E9SA 4NQKE 2IDYA 1K53A 3AE5B 5BMGA 4JQWC 3HVDA 3Q3MC 3KUZA 3OJ3A 1WXMA 1L4ZB 4C00A 1C4PA 1SGHA 1XD3B 2Y5PA 4M02A 3WAOA 2HTME 2PTLA 3IBEA 3KUDB 4LJPB 2WS3B 1WXQA 2JWUA 4CO7A 1NEKB 2OJWA 4WQMA 3LYYA 3AEFB 1WMHB 4YTPB 3NZSA 1L4DB 3MJ5A 1I42A 1UH6A 1KRHA 3L17A 4AUQC 1MHHE 1OFFA 1YN3A 1TKGA 3NUHB 3TMPB 1FCCC 4LTUA 5E6NA 3T3OA 2GRIA 2YEPB 2DNFA 2KD0A 2VRRB 4K1RB 5IO9A 3NVZA 3TEYA 1DGJA 2WX1A 2C9WB 2VH2A 2K9XA 1E0ZA 1XF5L 2EELA 4A8XC 2K6DB 4FA6A 4DXAB 1GG3A 1WZ3A 1E5WA 1N62A 1WGRA 1I4XA 1XEEA 2D10A 2K6QA 1I35A 1WXSA 1NYQA 3NG0A 4YXDB 3A9KA 5FKAC 2K8HA 4AJWA 3U52E 5J18A 2PE6B 4LDTB 1F2RC 4MJSB 2JZ3B 3ONSA 3TL5A 3DOWA 4NQLB 3ZNGC 4YWGG 4LJOB 2MCNB 1UWXA 3CWIA 2NBUA 1T0QC 1U4AA 1AWDA 1T0SC 2H89B 2KQSA 4WJNA 2WP9B 2Z0DB 1V80A 1N5WA 3WAMA 4M0WA 3B08A 4M8MA 1EF1A 1ET6A 5DCNA 2NS5A 4GOCA 3R2IA 2C5LC 1K51A 2Z59B 4GB9A 1XCTL 2AYOB 3X0WA 2MBHA 2WDQB 3BK2A 1TT5B 1C9FA 2RGFA 3L4PA 3KLSX 4E71A 2RDHA 1IBXB 2M4NA 1XLNA 5E6PA 4FN2A 1WRIA 2KDFB 4I6PA 4D2KA 3GP7A 5E6OA 3JSVA 2CHWA 4PYUA 1SIFA 4ZYNA 1I4QA 5H92C 4IWQA 2IYDB 1KTKA 5KHOA 3N32A 3P63A 2KQ4X 2AL6A 4RMAA 3CMMB 3DHHC 1CMXB 3DHIC 2Q5WD 1WE6A 1YJ1A 2WU2B 3Q3OC 4IM3A 1FCLA 2LHEA 4JWSC 4MM3B 1C77A 1SBBB 3VFKA 3TEZA 1Q0WB 2IO1B 1RRBA 1P3QU 4ZRKA 2MBOA 3C19A 2PLPA 2A5UA 3PGEA 1HE8A 2LGSA 4GXBA 3ZXVA 4CHKA 5AUIA 4BZAA 4K7UA 2QDFA 4KZCA 2WXGA 2KFKB 2BQQA 2FCQA 4B0MA 1R4NI 2DLBA 1TZ1A 5EE1A 1EO6A 2IGDA 2KTFA 3T3NA 1BXTA 1N61A 5CHVC 3X23A 3DVGY 2EMTA 2YEPF 3RT3B 4ACFA 2D07B 3BVGA 1ROEA 4S17A 1GAQB 5AZHA 2NPTB 2LGIA 2N7DA 5GMVA 1IPGA 3KVFB 4HCPB 3IHPC 4YSZB 4C7ZA 3Q6BA 4WURA 1V2YA 2SEBD 2YLMA 4JIOU 1E90A 1YN4A 1ZP0B 3KWVA 5HI1A 2J0KA 3ZNHB 5IOIA 1OGWA 3RNGC 2DX5B 3GE3C 4B6WA 2E3TA 4XGAB 3Q3NC 2LFIA 1WM3A 4WQOB 2XN9C 3AE8B 2LWPA 2G9HD 3QCAA 2NBVB 2LRUA 5BMHA 1MHXA 2KDEB 5IN7A 3B2GA 1QOBA 2ZCCA 2BW2A 4WJPA 4KDLB 5G5GA 1WY8A 2JZPA 1SE2A 1AARA 4GU2A 3DVNU 4ZRJA 4W9CA 2LGXA 3ECIA 5L95C 2I1JA 2IGGA 4KGTA 3TEWA 2V9HA 4GMVA 2WYQA 4EKUA 5IKCM 2KLCA 4A6QA 2JRHA 5LLIA 2DWQA 2L7RA 1D6EC 1QKZA 2JX5A 1XLPA 2PPHA 3HRDD 4MACA 2IPKD 1WJ4A 4W9JA 3GZNI 3HIZA 1WM2A 4W9GA 3UIOB 1H4RA 1ZGUB 2DYBA 2V3PA 3NY5A 2KNBA 2LD9A 2KX0A 1V5TA 2JU6X 5HFYA 1XO3A 3BYTB 2JZZA 2QILA 4W9DA 4J3OD 1SB3C 4OZCA 4HDQA 2KMAA 3MHSD 2RD0A 1ACCA 2MJEA 4FLHA 2FNJB 2K22A 1NYRA 1MVKA 3OWEB 4WH4A 2D2QA 2MA9B 5D3DA 3R7QA 3SFEB 2OEDA 3W2DA 4DHZB 4OVZA 1OQYA 3VTUA 1EU3A 3KYCD 3AEBB 5HG2A 1MG4A 1F0ZA 3JW0X 4UDUC 4EEWA 3QK0A 2X38A 1TIFA 1F9JA 1CQVA 4O1NA 4M8NA 3LDZE 3TCAA 1KLUD 5DPSA 5IAAC 1HTQA 4P6VF 3AN1A 4N59A 3HUIA 4JWUC 2HE7A 4GIVA 4BVUC 5DPWA 1WX8A 1WXVA 1OEYA 1NI2A 4FJVB 1VR9A 4IWOA 3VH3B 4AJYB 2GBJA 2KMCA 5BYSA 2CR5A 4OZBA 1YJJA 4HWIB 3N1ZC 4NJ7A 3HVZA 1SXTA 1WGHA 5L83A 3BZDB 2PW9A 2KO3A 4W9FA 1PGBA 4DHJB 3ZJVA 3N1XC 3B2FA 4GN1A 2LRWA 1XLQA 4RCOA 4PS8A 4HJGE 4BAXA 4L23A 4TKNA 4GGQA 1UD7A 3RFZB 1Q1OA 4HKQA 3RYTA 2IO3B 3DBRB 5AZFA 3ZO5B 4WJQA 2D3GA 1G6JA 2LMCA 2AQ1B 3CF6E 5GXGB 2AEHA 3QWZB 2V4LA 4PS7A 1FO4A 4P16A 5AEKB 1L2NA 3DBHB 2ZW1A 3DBSA 4K81A 1PGXA 2JYTA 4G11A 3UIPB 2LASA 3OG5A 2N9KA 1PGAA 5D6JB 2BYFA 1TY0A 1J7BA 1JWSD 5LNK1 1DOIA 1XCQL 3UGBB 2KHWB 1WJ6A 4NY0A 2DYMA 3VRBB 4A55A 3Q69A 3PO0A 4KIKB 2R2OA 5C1ZA 3IT6B 4EE2A 4FULA 5CTRC 5TSSA 3WCQA 1WGGA 2INPE 1YJIA 1KJTA 2KANA 1JWMD 2GMIC 3H6NA 2C7MB 2Z8LA 4HCNB 4QAYA 4RGMA 4OVVA 2BTEA 2MBQA 4R3DA 1TJEA 3C0RB 2H88B 2NMQA 3RD2A 3RNFC 1VZ8A 3L08A 3DCGA 2LEKA 3JYUA 1FRRA 2KTRB 2PIAA 4IM0A 1SE3A 3ABVB 1ZW7A 2N9EB 4P1CC 2WXIA 3L10B 4WAFA 2ZZPB 2CJOA 1WI0A 3MC8A 4LNFA 2G1EA 4PYZA 3EA6A 3RNEC 1PQSA 4AOFA 3WALA 2FCSA 2GBMA 2BB5A 1J7AA 3ALBA 1FNWA 2KDIA 3MTNB 3TEXA 3V62A 1TKYA 1YD8U 4PT5A 1E7VA 3AEAB 2L52A 4MEMA 4ZRQA 1WFYA 1ZKHA 1LXDA 3PHWB 3ZVVA 1JALA 2M1MA 3DVNV 5DPRA 1FMAD 1ZDXA 1M4VA 1OTRB 5G5HA 2K0PA 3EGRA 2BS4B 1BT0A 4XC2A 1T5XD 3TBLD 3AE2B 2KWUB 4WWOA 4MELA 2MH7A 3IT4B 4YTNB 2AL3A 3R3MA 1QZEA 3AEDB 2LUMA 2NR2A 4F1SA 1UBQA 4BBNC 4K3CA 3QQ8B 3GS2A 5BO4B 2AX5A 2JRIB 4USAA 5G2NA 3NZ3A 2KK8A 2WX0A 1ZUD2 2WWZA 5MPOA 3Q8AA 2BKRB 1WH3A 4G50A 3HHMA 2LXAA 2W82A 4KGSA 2JF5A 4RF0A 4BKSD 1P9DU 2INDC 4GDKA 3SDLC 2O6VD 2JUOA 5D94A 2LI5A 2ZNVC 4GDLA 3O13A 2KMMA 2CS4A 3VVWB 2FUG1 1FNVA 4PK1A 3K9OB 3E56A 2ZVNA 2WXLA 1E8YA 1VZ6A 3ZNZB 2GOWA 4NAWA 4L1BA 3ZYYX 2XK5A 4DXGA 1ZDVA 2N7JA 2WXKA 4WAAA 1QOGA 3AM9A 1AYFA 3U7DA 4BOSC 1B1ZA 4WJOA 2KKCA 3GOEA 3ML9A 1ZE3D 2J0MA 1STEA 2WXOA 2DBYA 1RYJA 5D2MB 1IYFA 2KLGA 1PYWD 3VAWA 1P98A 3HK0A 3BK1A 2D3AA 4DHJD 1LFDA 1SSNA 1P1AA 1E6EB 3PPAA 1GNUA 4IM2A 4OHJA 3ZRCA 4HPPA 1UUPA 1HA5A 2G45B 1I4HA 2ONQA 1V1PB 4F7ZA 4J6IA 4HEA1 1WX9A 2DZJA 4IDIA 2BBCA 2ZW0A 2WXQA 3WAPA 2ZJDA 2KVRA 3RZWC 1FEHA 4M00A 1CK1A 4W9HA 4ZHOA 1N6ZA 2L8JA 2KN4A 2KAJA 3KH0A 1EU4A 3B1LX 3FILA 4H2AA 2N4FA 1Y8RC 3ZNID 2L1AA 3MC9A 1QT9A 4IOIE 2EKEC 3HM3A 4FXCA 2BGFA 4WIPA 2N9XA 2V4IB 1TYGB 2M17A 1J19A 5JHBA 2BYVE 4ANXA 2G4SA 4WWMA 3RN9C 1WXAA 4XE0A 1RAXA 2WXNA 2INCC 2MW5A 3PS6A 4WWNA 1WR6E 3A9JB 2MP2B 4XWTA 1OEYJ 2IY1B 4P1BC 3Q2AC 2CJNA 4FADA 4BFRA 4LNNA 3A1QB 3RZFA 3ZW3A 4JGHB 3QC8B 3ZRFA 3L13A 2BVCA 3PZ7A 1A5RA 1JRPA 3PRPB 4C4VA 1CJEA 2J0JA 4DHZE 3SR6A 3N1YC 4KSLC 3APFA 3L0WB 1BMLC 1NBFC 4B95A 1S1QB 1D3ZA 3ZTDA 2BT6A 2IY0B 2MX2A 2INNE 1D5XC 3BIID 3AE6B 4B0EA 2LVOA 3PVLA 2WDRB 4B9KA 5E6JA 3R2TA 1IGDA 3N9YC 3NVVA 4CQNA 4KKJA 4PS3A 3WANA 1R4MB 2VH1A 2L0FA 2LUEA 2O2VB 3EUB2 1J8CA 2PVGC 5CX3A 1ZPSA 4II3B 2CHZA 1WMHA 1WZ0A 2DYOA 1GB4A 1Z5SB 3IFWB 5I4DA 2KOXA 3AU4A 2HJ8A 4FJZA 4TQ0A 1K52A 2RPQA 1OQRA 3MC0B 4A20A 1V81A 1TGZB 2KN5A 1L6UA 2L0TA 3IAS1 1FIQA 3RCZA 4RM9A 2I2YA 3R66C 1MFWA 4P7IA 2Y5CA 4YSYB 3IG3A 3RNAC 4ANVA 2MBEA 1FRDA 4W9LA 2KC1A 2K5PA 4TMAB 3AE9B 1C1YB 4MJSA 4HVBA 3I9V1 2FE8A 3ZDMC 3W1YA 2TSSA 3T8MA 3ZLZA 3Q8FA 3AECB 3BVZA 1E9MA 4MT5A 1FPYA 3NVWA 3P4PB 5H8YE 4EZJA 3PRZA 1JW9D 1UZXB 2UYZB 3OJ4B 1IUEA 2BF8B 2WU5B 1VRAB 3V05A 1F1HA 3H9DA 3M62B 3I57A 3AE7B 1WYGA 2L83A 2XEWA 3AEGB 3DBLB 4MGKE 2MHJA 3GB1A 3H8HA 1SEBD 4I6NB 2RSUA 4BOZB 4I6LB 4C56C 1FXIA 2BKFA 4RF1A 1Z2MA 1YNTE 3AE1B 1IBXA 3MP9A 3ZXRA 4XYCA 1C3TA 3CSFA 1GC6A 1E10A 3RNCC 5BYQA 2BWES 3TIXA 4HPLB 2UU7A 4MGYE 4ASWC 2WXMA 2Y5BB 2EKIA 1WJNA 3VRAB 3FAHA 1JROA 2M0AA 1A70A 1BUIC 1WF9A 4KV2A 4OW0A 5HHDG 2L32A 3VR9B 1V6EA 3P4RB 4GLSC 1J7CA 2O6VB 2BS3B 2BYTA 3ZQ4A 1KM7A 4MM3A 3M3JA 1JRUA 2KJRA 2B76B 3PZDA 1NVID 3VH4B 1D4BA 2FUHB 1GPXA 4US8A 4XDDA 3N30A 1MI0A 2G4DB 4HROA 3BYYB 3DQVA 3UQBA 4IG7B 2KFKA 2L3ZA 1C79A 4LNIA 4JL9A 2WXFA 4KZ0A 2PKOA 3PRMB 4DWFA 4KDIC 3IAM1 1MPEA 2IO0B 1RM6C 2QIEB 1Y56A 2ZCBA 1E8WA 3FKYA 1C4AA 2WDVB 2VZKB 3S2AA 2RMMA 2RDGA 1WGDA 3ZGZA 2NPTA 5EE9A 3QA8A 4DXFA 2N1WA 3RMKC 2D11A 4E74A 4HK2A 1EUVB 3LXFA 4RGNA 4TUUA 5IP4D 2XBBC 3APDA 4XX5A 2PEAA 2A4ZA 3MFGA 5FR6A 3ML8A 1HZ6A 3A4SC 4OZAA 3NZUA 1P0RA 2GB1A 2DAFA 3NS1A 3DVGX 1K50A 3PZ8A 3QJZA 2JYEA 4KX6B 4XDCA 4DQOC 3ENEA 4RGOS 1AW7A 3P4QB 1I4RA 3AE4B 2J53A 2MJ3A 1YN5A 4ITKA 2MBBB 5EE0A 4W9EA 4BKTA 2MWSB 2V1YA 3A9KB 2ZPNA 4MGZE 1FFVA 3EC8A 1TS3A 2XNAC 1EF5A 3AI5A 1TKEA 1XLOA 3WIMA 2NTSA 2LXCA 3LJ3A 2I1KA 4L2YA 1C76A 3Q3FA 1ET9A 1L6VA 2CU3A 3K9PB 4EFOA 3U4EG 3MJWA 1N60A 4A90A 5HKHA 4DBGA 3PT2B 3SU8X 1KLVA 1YQBA 2JSVX 1V9JA 4FBJB 5JH5C 3HM6X 2DZMA 4II2B 4K7SA 2B3AA 4ZRPA 5LXIB 3RULA 1HZ5A 4MDKE 5EDSA 1JMLA 2JWZA 1H8CA 3H7PB 2W3SA 2L00B 4TQ1A 4TSSA 1I7HA 1T0YA 1TZOA 2MSED 2LGDA 3W1SA 1DYQA 1WYWB 3AU5A 2KXJA 3EFUA 3P1MA 3I63C 2CKHB 2AQ3B 2WXHA 1GOZA 2WXPA 1E8XA 2DZKA 2QCZA 3KWLA 2QJLA 4EZLA 3W9CB 3VQIA 3I5JC 2WLBA 1VD2A 4BKSA 4LCDE 2O6VA 1WGYA 2DENB 2LVQA 3JSVB 1WIAA 4LNOA 4HXDA 1E7UA 3TJPA 3SD5A 1DOYA 1ENFA 3AH7A 3V6CB 1V86A 4RGTA 1EWYC 1ZXIA 2BB6A 1TTNA 1ZOYB 3P2BA 1YX5B 1TY2A 4ICVA 3RUIB 1QLBB 4EUTA 2KDBA 3VHTC 5AZGA 1R4NB 4ZRIA 5J2RA 2WXJA 2LVPA 3DWGC 2K39A 4N58A 3AE3B 3UQAA 1OQQA 4LLGM 3VTVA 5C23A 1HTOA 2FCMA 3KYDD 4X57B 1GB1A 2MLBA 1I4GA 2NCNA 2V3NA 1WX7A 2LJIA 2GBRA 2GLSA 3V6EB 2K3UA 4N9F4 1MJDA 5DPTA 2FAZA 4EOYA 1WJUA 1UGMA 3PV1A 4IUMB 1T0RC 1QF6A 3VXWA 1IGCA 4F8CB 2CU1A 3H7SA 2KYWA 4RNAA 1QILA 4EZKA 1L0VB 3BINA 1VLBA 2QEJC 2BS2B 4A3OA 2M0XA 2DAJA 3DDCB 3TUOA 4NJ6A 2E6XA 1P7EA 2VZKD 3DBRI 2PJHA 3MHZA 3B9JA 5C2TB 4MH0E 1UF0A 3OLMD 5BYRA 4HJKA 1ZXHA 2PVOD 3U8ZA 3DBHI 4US9A 1AN8A 2YVCA 4KIKA 2K25A 4JLCA 4HDOA 3DPDA 1N5XA 3C8YA 4AS1A 4RH6A 1WWTA 4A3PA
chains in the Genus database with same CATH topology
2RPQA 3VUYA 3PLVA 1VCBA 5DPSA 5IAAC 1V81A 4A20A 1TGZB 2KN5A 2L0TA 4W9IA 3RCZA 4RM9A 2HE7A 3R66C 2W9NA 3PTFC 4GIVA 4NNJB 3PLUA 4BVUC 5DPWA 2G3QB 1WX8A 3W1SC 3QAQA 4TV3A 1WXVA 2LGYA 1OEYA 3Q3JA 2PE9A 3UF8A 1NI2A 4P7IA 4FJVB 4IWOA 3V60A 3UINB 3APCA 3IG3A 3A4RA 3VH3B 4AJYB 2GBJA 2AWTA 3B0AA 5D7GA 2KMCA 2N1VA 4ANVA 2CR5A 2MBEA 2WDTB 2BWFA 2KX3A 2KTRA 4HWIB 1V49A 4W9LA 4NJ7A 3A33B 4XZ4A 2KC1A 1WGHA 5L83A 1C1YB 3NS8A 4MJSA 4HVBA 2KO3A 4WWPA 4W9FA 3ZDMC 4DHJB 3W1YA 4GN1A 1GUAB 3T8MA 3L54A 3H7PA 5G55A 2LRWA 3PREA 3ZLZA 4IWPA 4PS8A 2IBIB 1K8RB 1J0GA 4MGIE 4TKNA 4GGQA 1UD7A 4ANUA 3PSEB 1Q1OA 4NQKE 3RYTA 2IO3B 4EZJA 3PRZA 5AZFA 3ZO5B 1TBEA 4WJQA 2D3GA 1G6JA 1UZXB 2UYZB 2MRPA 3OJ4B 4JQWC 3CF6E 3R7RA 2BF8B 2AEHA 3QWZB 2V4LA 3KUZA 3VUXA 4PS7A 3H9DA 3M62B 3OJ3A 5AEKB 2C60A 1L2NA 3N3KB 1WXMA 2XEWA 1SGHA 1FXTB 2CHXA 3DBSA 1XD3B 4MGKE 4K81A 2R2QA 4G11A 3WAOA 2HD5B 2L05A 3KUDB 3IBEA 4LJPB 3UIPB 2LASA 4CO7A 2KZRA 4I6NB 5D6JB 2BYFA 2IZVB 2RSUA 4BOZB 2ASQA 4I6LB 2OJRA 3ZTCA 1WMHB 3NZSA 2BKFA 3UGBB 3ZKJC 1Z2MA 2KHWB 1WJ6A 4NY0A 2DYMA 1I42A 1UH6A 4KIKB 1GJZA 2R2OA 3L17A 5C1ZA 4AUQC 1C3TA 3CSFA 4BKGA 1GC6A 4FULA 5CTRC 2FIFA 1WGGA 2NBWB 2BWES 2KANA 1KJTA 3VUWA 3TIXA 3TMPB 4HPLB 2GMIC 2RR9A 3H6NA 5E6NA 3D32A 2C7MB 4MGYE 1Q5WB 1ISNA 4ASWC 2Y5BB 4HCNB 2KD0A 2VRRB 2JT4B 1WJNA 4K1RB 1KOTA 4OVVA 2WX1A 2C9WB 2MBQA 1YX6B 2K6DB 1WF9A 3C0RB 4FA6A 4KV2A 4DXAB 4G3XB 3VDZA 1GG3A 1WZ3A 3RD2A 4HPMB 1E5WA 1V6EA 1WGRA 3L08A 2C7NB 3DCGA 2BPSA 2D10A 3V61A 2K6QA 2ZVOA 2O6VB 1WXSA 3JYUA 1I35A 2N7EA 3A9KA 1KM7A 2K8HA 2KTRB 4MM3A 4AJWA 3M3JA 1JRUA 2PE6B 3O65B 4IM0A 4LDTB 5J18A 2KJRA 4G0NB 3PZDA 4MJSB 2JZ3B 3ONSA 3TL5A 1ZW7A 2N9EB 3VH4B 3DOWA 3L10B 4NQLB 4F1SA 2JPHA 2FUHB 2ZZPB 1WI0A 4PYZA 1PQSA 3N30A 3ZNGC 4AOFA 2G4DB 3JVZX 4LJOB 2MCNB 3WALA 2FCSA 1L7YA 3DQVA 3UQBA 4IG7B 2GBMA 2NBUA 3ALBA 3ZUNA 2KFKA 5IA7A 1U4AA 2KDIA 2L3ZA 3MTNB 4JL9A 4KZ0A 3PRMB 3V62A 1NDDA 3L16A 1YD8U 4DWFA 3H1UA 4KDIC 1E7VA 2IO0B 4MSQB 2KQSA 4WJNA 2Z0DB 1V80A 2QHOA 4MEMA 3PHXB 3WAMA 5LXHA 1WFYA 2ZCBA 1E8WA 1ZKHA 1LXDA 3S2AA 3PHWB 3B08A 3ZVVA 2M1MA 2ZNVB 1SE9A 1EF1A 3DVNV 4M8MA 5DCNA 5DPRA 2NS5A 4GOCA 2KWVB 4GSWA 1OTRB 2C5LC 4XC2A 1BT0A 1WGDA 4AP4C 2Z59B 2NPTA 3TBLD 3QA8A 3ZIMA 2N1WA 2KWUB 4GB9A 4WWOA 4MELA 2D11A 4E74A 2AYOB 4HK2A 5TR5A 3X0WA 2MBHA 1EUVB 2AL3A 1LM8B 3R3MA 4TUUA 1QZEA 2XBBC 2K8BA 2NR2A 2KJHB 3APDA 2RGFA 1UBQA 2PEAA 2ZPYA 4XX5A 4BBNC 1MG8A 3QQ8B 4HLEA 5BO4B 4IW0A 2A4ZA 1UELA 2JRIB 5FR6A 5G2NA 3AULA 4E71A 3ML8A 2KK8A 3A4SC 3NZUA 2WX0A 1P0RA 2GBNA 2DAFA 2M4NA 3QX1A 5E6PA 3DVGX 4FN2A 2WWZA 4FHKA 2KDFB 4I6PA 5E6OA 3QJZA 4KSKC 2BKRB 3JSVA 2CHWA 1WH3A 4PYUA 4G50A 3HHMA 2LXAA 1UBIA 5JZEB 3ENEA 1SIFA 1WE7A 3IVFA 2JF5A 2C7HA 4BKSD 1P9DU 2KWCA 4ZYNA 4GDKA 3SDLC 2O6VD 3M63B 2JUOA 5D94A 2LI5A 2ZNVC 4GDLA 4IWQA 3WA0A 2IYDB 5KHOA 2UWQA 3N32A 4LDTD 1YIWA 2CS4A 2AL6A 2MBBB 3CMMB 4RMAA 2LJ5A 4URKA 3VVWB 1CMXB 3AXCA 3EHVA 1RFAA 4W9EA 3K9OB 4BKTA 2MWSB 2ZVNA 1WE6A 1YJ1A 4IM3A 1E8YA 2V1YA 3ZNZB 2GOWA 3A9KB 2ZPNA 2JXXA 4MGZE 3A9JA 3NHEB 3VFKA 2MP2A 4NAWA 3EC8A 3AI5A 1EF5A 2XK5A 1Q0WB 2IO1B 1RRBA 1P3QU 3WIMA 2K1FA 3QIJA 4ZRKA 2LXCA 2MBOA 3LJ3A 4WAAA 4ANWA 1M94A 2A5UA 2I1KA 3PGEA 2Z0EB 3EECA 3U7DA 3Q3FA 1HE8A 4BOSC 2EMSA 4GXBA 4CHKA 3A1QA 3K9PB 4K7UA 2KKCA 3GOEA 3ML9A 4WJOA 4EFOA 2J0MA 3CSTA 3MJWA 5HKHA 4KZCA 5J17A 4DBGA 3PT2B 2KFKB 3SU8X 1KLVA 4W9KA 1YQBA 2FCQA 2REXA 5D2MB 1IYFA 1R4NI 1RLFA 2KLGA 1TZ1A 1EO6A 1V9JA 4FBJB 5CHFA 2KTFA 3VAWA 5JH5C 2KJ6A 1P98A 3HM6X 3HK0A 2DZMA 4DHJD 4II2B 1LFDA 4K7SA 2B3AA 1P1AA 5CHVC 3PPAA 3U30A 1GNUA 5LXIB 4IM2A 3QHTA 4ICUA 3RULA 3X23A 3ZRCA 3DVGY 2KFJA 2EMTA 3BY4B 4MDKE 2G45B 5EDSA 3RT3B 2JWZA 1H8CA 3H7PB 4F7ZA 3T9LA 4J6IA 2D07B 2L00B 4TQ1A 2MSED 1T0YA 2LGDA 1WX9A 3W1SA 2DZJA 3M95A 5JHAA 2FCNA 1WYWB 3AU5A 5AZHA 2NPTB 2KXJA 2N7DA 5GMVA 1GC7A 3EFUA 4NPNA 4KVGB 1IPGA 3WAPA 3KVFB 4HCPB 2ZJDA 3IHPC 2IO2B 2KVRA 2NVUI 2CKHB 2O2VA 3RZWC 4MSMB 1V2YA 2YLMA 4JIOU 1E90A 2BYEA 1X1MA 1E8XA 2DZKA 4W9HA 2HTHA 2J0KA 3ZNHB 2LZ6A 1OGWA 3KUCB 3KW5B 2DX5B 4CYEA 4EZLA 4B6WA 4BBNF 2L8JA 3VQIA 3KH0A 3B1LX 1VD2A 4BKSA 4LCDE 1XT9B 4DDID 2O6VA 3SHQA 1WM3A 4WQOB 1R4MI 2M8SA 1Y8RC 2N4FA 3ZNID 2LWPA 1WGYA 2DENB 2LVQA 2NBVB 1WIAA 2LRUA 2ZEQA 3JSVB 3QCAA 4OVUA 2KDEB 2EKEC 2OOBB 1E7UA 4HXDA 1S3SG 3HM3A 2BGFA 3TJPA 2N9XA 3SD5A 2M17A 1J19A 5JHBA 4FJYA 3V6CB 2BYVE 4GDKB 4ANXA 2G4SA 1V86A 2ZCCA 4GDLB 4K7WA 4WJPA 1WXAA 1TTNA 3P2BA 4KDLB 2FIDA 1WY8A 1YX5B 2KC2A 1RAXA 4ICVA 3RUIB 2MW5A 3PS6A 2DHZA 4EUTA 1AARA 2DZIA 2KDBA 3DVNU 4GU2A 4WWNA 3VHTC 4ZRJA 4W9CA 5AZGA 2LGXA 1WR6E 4ZRIA 5J2RA 4AWJA 2LVPA 5KHQA 3ECIA 1WRDB 3A9JB 3NOBA 2MP2B 2K39A 4NAWB 1OEYJ 5L95C 2KQ7A 2IY1B 2XK5B 2I1JA 4FADA 4BFRA 3UQAA 1V5OA 2J7QB 4DDGD 4GMVA 2WYQA 4EKUA 3VTVA 5C23A 3A1QB 3RZFA 2FCMA 3KYDD 4IC7B 3ZW3A 4JGHB 4X57B 3QC8B 2KLCA 2JRHA 2MLBA 1WR1A 5LLIA 3ZRFA 2L7RA 3L13A 2NCNA 1A5RA 3PRPB 2V3SA 1WX7A 2J0JA 4DHZE 2GBRA 4ZDVA 3V6EB 4KSLC 3APFA 2PPHA 4N9F4 3L0WB 1NBFC 4B95A 5DPTA 1S1QB 1WJ4A 2FAZA 4W9JA 4EOYA 1D3ZA 1WJUA 3ZDTA 3GZNI 1UGMA 3HIZA 3PV1A 4IUMB 1WM2A 3ZTDA 2IY0B 4W9GA 3UIOB 1H4RA 1ZGUB 4DK5A 2DYBA 2MX2A 3VXWA 3NY5A 2KNBA 2LD9A 2LVOA 4F8CB 2CU1A 2KX0A 4YL8A 3H7SA 3PVLA 1V5TA 1IP9A 4B9KA 4E3CA 2JZZA 3QARA 4EZKA 4RM8A 4W9DA 3BINA 4HDQA 2KMAA 3MHSD 3OAWA 2RD0A 4PS3A 2GBKA 3WANA 4A3OA 2JY6A 2M0XA 4FLHA 2FNJB 2DAJA 3DDCB 2MQJA 2N9PC 4NJ6A 2L0FA 2LUEA 3DBRI 2D2QA 2MA9B 2O2VB 2PJHA 3I3TB 3R7QA 4FHJA 4DHZB 1XQQA 4MH0E 3OLMD 1J8CA 5CX3A 4II3B 4HJKA 4M0WB 2CHZA 3VTWA 1OQYA 1WMHA 1WZ0A 3VTUA 1E8ZA 3KYCD 2DYOA 3U8ZA 2L76A 3DBHI 1Z5SB 3IFWB 2YVCA 3JW0X 2K25A 3DBLI 4KIKA 2KOXA 4EEWA 3AU4A 2HJ8A 4FJZA 3QK0A 4JLCA 4HDOA 2JVCA 1F9JA 3DPDA 1LQBA 4TQ0A 4M8NA 3LDZE 3TCAA 4A3PA 5CHWA 2K8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPQ A;  3VUY A;  3PLV A;  1VCB A;  5DPS A;  5IAA C;  1V81 A;  4A20 A;  1TGZ B;  2KN5 A;  2L0T A;  4W9I A;  3RCZ A;  4RM9 A;  2HE7 A;  3R66 C;  2W9N A;  3PTF C;  4GIV A;  4NNJ B;  3PLU A;  4BVU C;  5DPW A;  2G3Q B;  1WX8 A;  3W1S C;  3QAQ A;  4TV3 A;  1WXV A;  2LGY A;  1OEY A;  3Q3J A;  2PE9 A;  3UF8 A;  1NI2 A;  4P7I A;  4FJV B;  4IWO A;  3V60 A;  3UIN B;  3APC A;  3IG3 A;  3A4R A;  3VH3 B;  4AJY B;  2GBJ A;  2AWT A;  3B0A A;  5D7G A;  2KMC A;  2N1V A;  4ANV A;  2CR5 A;  2MBE A;  2WDT B;  2BWF A;  2KX3 A;  2KTR A;  4HWI B;  1V49 A;  4W9L A;  4NJ7 A;  3A33 B;  4XZ4 A;  2KC1 A;  1WGH A;  5L83 A;  1C1Y B;  3NS8 A;  4MJS A;  4HVB A;  2KO3 A;  4WWP A;  4W9F A;  3ZDM C;  4DHJ B;  3W1Y A;  4GN1 A;  1GUA B;  3T8M A;  3L54 A;  3H7P A;  5G55 A;  2LRW A;  3PRE A;  3ZLZ A;  4IWP A;  4PS8 A;  2IBI B;  1K8R B;  1J0G A;  4MGI E;  4TKN A;  4GGQ A;  1UD7 A;  4ANU A;  3PSE B;  1Q1O A;  4NQK E;  3RYT A;  2IO3 B;  4EZJ A;  3PRZ A;  5AZF A;  3ZO5 B;  1TBE A;  4WJQ A;  2D3G A;  1G6J A;  1UZX B;  2UYZ B;  2MRP A;  3OJ4 B;  4JQW C;  3CF6 E;  3R7R A;  2BF8 B;  2AEH A;  3QWZ B;  2V4L A;  3KUZ A;  3VUX A;  4PS7 A;  3H9D A;  3M62 B;  3OJ3 A;  5AEK B;  2C60 A;  1L2N A;  3N3K B;  1WXM A;  2XEW A;  1SGH A;  1FXT B;  2CHX A;  3DBS A;  1XD3 B;  4MGK E;  4K81 A;  2R2Q A;  4G11 A;  3WAO A;  2HD5 B;  2L05 A;  3KUD B;  3IBE A;  4LJP B;  3UIP B;  2LAS A;  4CO7 A;  2KZR A;  4I6N B;  5D6J B;  2BYF A;  2IZV B;  2RSU A;  4BOZ B;  2ASQ A;  4I6L B;  2OJR A;  3ZTC A;  1WMH B;  3NZS A;  2BKF A;  3UGB B;  3ZKJ C;  1Z2M A;  2KHW B;  1WJ6 A;  4NY0 A;  2DYM A;  1I42 A;  1UH6 A;  4KIK B;  1GJZ A;  2R2O A;  3L17 A;  5C1Z A;  4AUQ C;  1C3T A;  3CSF A;  4BKG A;  1GC6 A;  4FUL A;  5CTR C;  2FIF A;  1WGG A;  2NBW B;  2BWE S;  2KAN A;  1KJT A;  3VUW A;  3TIX A;  3TMP B;  4HPL B;  2GMI C;  2RR9 A;  3H6N A;  5E6N A;  3D32 A;  2C7M B;  4MGY E;  1Q5W B;  1ISN A;  4ASW C;  2Y5B B;  4HCN B;  2KD0 A;  2VRR B;  2JT4 B;  1WJN A;  4K1R B;  1KOT A;  4OVV A;  2WX1 A;  2C9W B;  2MBQ A;  1YX6 B;  2K6D B;  1WF9 A;  3C0R B;  4FA6 A;  4KV2 A;  4DXA B;  4G3X B;  3VDZ A;  1GG3 A;  1WZ3 A;  3RD2 A;  4HPM B;  1E5W A;  1V6E A;  1WGR A;  3L08 A;  2C7N B;  3DCG A;  2BPS A;  2D10 A;  3V61 A;  2K6Q A;  2ZVO A;  2O6V B;  1WXS A;  3JYU A;  1I35 A;  2N7E A;  3A9K A;  1KM7 A;  2K8H A;  2KTR B;  4MM3 A;  4AJW A;  3M3J A;  1JRU A;  2PE6 B;  3O65 B;  4IM0 A;  4LDT B;  5J18 A;  2KJR A;  4G0N B;  3PZD A;  4MJS B;  2JZ3 B;  3ONS A;  3TL5 A;  1ZW7 A;  2N9E B;  3VH4 B;  3DOW A;  3L10 B;  4NQL B;  4F1S A;  2JPH A;  2FUH B;  2ZZP B;  1WI0 A;  4PYZ A;  1PQS A;  3N30 A;  3ZNG C;  4AOF A;  2G4D B;  3JVZ X;  4LJO B;  2MCN B;  3WAL A;  2FCS A;  1L7Y A;  3DQV A;  3UQB A;  4IG7 B;  2GBM A;  2NBU A;  3ALB A;  3ZUN A;  2KFK A;  5IA7 A;  1U4A A;  2KDI A;  2L3Z A;  3MTN B;  4JL9 A;  4KZ0 A;  3PRM B;  3V62 A;  1NDD A;  3L16 A;  1YD8 U;  4DWF A;  3H1U A;  4KDI C;  1E7V A;  2IO0 B;  4MSQ B;  2KQS A;  4WJN A;  2Z0D B;  1V80 A;  2QHO A;  4MEM A;  3PHX B;  3WAM A;  5LXH A;  1WFY A;  2ZCB A;  1E8W A;  1ZKH A;  1LXD A;  3S2A A;  3PHW B;  3B08 A;  3ZVV A;  2M1M A;  2ZNV B;  1SE9 A;  1EF1 A;  3DVN V;  4M8M A;  5DCN A;  5DPR A;  2NS5 A;  4GOC A;  2KWV B;  4GSW A;  1OTR B;  2C5L C;  4XC2 A;  1BT0 A;  1WGD A;  4AP4 C;  2Z59 B;  2NPT A;  3TBL D;  3QA8 A;  3ZIM A;  2N1W A;  2KWU B;  4GB9 A;  4WWO A;  4MEL A;  2D11 A;  4E74 A;  2AYO B;  4HK2 A;  5TR5 A;  3X0W A;  2MBH A;  1EUV B;  2AL3 A;  1LM8 B;  3R3M A;  4TUU A;  1QZE A;  2XBB C;  2K8B A;  2NR2 A;  2KJH B;  3APD A;  2RGF A;  1UBQ A;  2PEA A;  2ZPY A;  4XX5 A;  4BBN C;  1MG8 A;  3QQ8 B;  4HLE A;  5BO4 B;  4IW0 A;  2A4Z A;  1UEL A;  2JRI B;  5FR6 A;  5G2N A;  3AUL A;  4E71 A;  3ML8 A;  2KK8 A;  3A4S C;  3NZU A;  2WX0 A;  1P0R A;  2GBN A;  2DAF A;  2M4N A;  3QX1 A;  5E6P A;  3DVG X;  4FN2 A;  2WWZ A;  4FHK A;  2KDF B;  4I6P A;  5E6O A;  3QJZ A;  4KSK C;  2BKR B;  3JSV A;  2CHW A;  1WH3 A;  4PYU A;  4G50 A;  3HHM A;  2LXA A;  1UBI A;  5JZE B;  3ENE A;  1SIF A;  1WE7 A;  3IVF A;  2JF5 A;  2C7H A;  4BKS D;  1P9D U;  2KWC A;  4ZYN A;  4GDK A;  3SDL C;  2O6V D;  3M63 B;  2JUO A;  5D94 A;  2LI5 A;  2ZNV C;  4GDL A;  4IWQ A;  3WA0 A;  2IYD B;  5KHO A;  2UWQ A;  3N32 A;  4LDT D;  1YIW A;  2CS4 A;  2AL6 A;  2MBB B;  3CMM B;  4RMA A;  2LJ5 A;  4URK A;  3VVW B;  1CMX B;  3AXC A;  3EHV A;  1RFA A;  4W9E A;  3K9O B;  4BKT A;  2MWS B;  2ZVN A;  1WE6 A;  1YJ1 A;  4IM3 A;  1E8Y A;  2V1Y A;  3ZNZ B;  2GOW A;  3A9K B;  2ZPN A;  2JXX A;  4MGZ E;  3A9J A;  3NHE B;  3VFK A;  2MP2 A;  4NAW A;  3EC8 A;  3AI5 A;  1EF5 A;  2XK5 A;  1Q0W B;  2IO1 B;  1RRB A;  1P3Q U;  3WIM A;  2K1F A;  3QIJ A;  4ZRK A;  2LXC A;  2MBO A;  3LJ3 A;  4WAA A;  4ANW A;  1M94 A;  2A5U A;  2I1K A;  3PGE A;  2Z0E B;  3EEC A;  3U7D A;  3Q3F A;  1HE8 A;  4BOS C;  2EMS A;  4GXB A;  4CHK A;  3A1Q A;  3K9P B;  4K7U A;  2KKC A;  3GOE A;  3ML9 A;  4WJO A;  4EFO A;  2J0M A;  3CST A;  3MJW A;  5HKH A;  4KZC A;  5J17 A;  4DBG A;  3PT2 B;  2KFK B;  3SU8 X;  1KLV A;  4W9K A;  1YQB A;  2FCQ A;  2REX A;  5D2M B;  1IYF A;  1R4N I;  1RLF A;  2KLG A;  1TZ1 A;  1EO6 A;  1V9J A;  4FBJ B;  5CHF A;  2KTF A;  3VAW A;  5JH5 C;  2KJ6 A;  1P98 A;  3HM6 X;  3HK0 A;  2DZM A;  4DHJ D;  4II2 B;  1LFD A;  4K7S A;  2B3A A;  1P1A A;  5CHV C;  3PPA A;  3U30 A;  1GNU A;  5LXI B;  4IM2 A;  3QHT A;  4ICU A;  3RUL A;  3X23 A;  3ZRC A;  3DVG Y;  2KFJ A;  2EMT A;  3BY4 B;  4MDK E;  2G45 B;  5EDS A;  3RT3 B;  2JWZ A;  1H8C A;  3H7P B;  4F7Z A;  3T9L A;  4J6I A;  2D07 B;  2L00 B;  4TQ1 A;  2MSE D;  1T0Y A;  2LGD A;  1WX9 A;  3W1S A;  2DZJ A;  3M95 A;  5JHA A;  2FCN A;  1WYW B;  3AU5 A;  5AZH A;  2NPT B;  2KXJ A;  2N7D A;  5GMV A;  1GC7 A;  3EFU A;  4NPN A;  4KVG B;  1IPG A;  3WAP A;  3KVF B;  4HCP B;  2ZJD A;  3IHP C;  2IO2 B;  2KVR A;  2NVU I;  2CKH B;  2O2V A;  3RZW C;  4MSM B;  1V2Y A;  2YLM A;  4JIO U;  1E90 A;  2BYE A;  1X1M A;  1E8X A;  2DZK A;  4W9H A;  2HTH A;  2J0K A;  3ZNH B;  2LZ6 A;  1OGW A;  3KUC B;  3KW5 B;  2DX5 B;  4CYE A;  4EZL A;  4B6W A;  4BBN F;  2L8J A;  3VQI A;  3KH0 A;  3B1L X;  1VD2 A;  4BKS A;  4LCD E;  1XT9 B;  4DDI D;  2O6V A;  3SHQ A;  1WM3 A;  4WQO B;  1R4M I;  2M8S A;  1Y8R C;  2N4F A;  3ZNI D;  2LWP A;  1WGY A;  2DEN B;  2LVQ A;  2NBV B;  1WIA A;  2LRU A;  2ZEQ A;  3JSV B;  3QCA A;  4OVU A;  2KDE B;  2EKE C;  2OOB B;  1E7U A;  4HXD A;  1S3S G;  3HM3 A;  2BGF A;  3TJP A;  2N9X A;  3SD5 A;  2M17 A;  1J19 A;  5JHB A;  4FJY A;  3V6C B;  2BYV E;  4GDK B;  4ANX A;  2G4S A;  1V86 A;  2ZCC A;  4GDL B;  4K7W A;  4WJP A;  1WXA A;  1TTN A;  3P2B A;  4KDL B;  2FID A;  1WY8 A;  1YX5 B;  2KC2 A;  1RAX A;  4ICV A;  3RUI B;  2MW5 A;  3PS6 A;  2DHZ A;  4EUT A;  1AAR A;  2DZI A;  2KDB A;  3DVN U;  4GU2 A;  4WWN A;  3VHT C;  4ZRJ A;  4W9C A;  5AZG A;  2LGX A;  1WR6 E;  4ZRI A;  5J2R A;  4AWJ A;  2LVP A;  5KHQ A;  3ECI A;  1WRD B;  3A9J B;  3NOB A;  2MP2 B;  2K39 A;  4NAW B;  1OEY J;  5L95 C;  2KQ7 A;  2IY1 B;  2XK5 B;  2I1J A;  4FAD A;  4BFR A;  3UQA A;  1V5O A;  2J7Q B;  4DDG D;  4GMV A;  2WYQ A;  4EKU A;  3VTV A;  5C23 A;  3A1Q B;  3RZF A;  2FCM A;  3KYD D;  4IC7 B;  3ZW3 A;  4JGH B;  4X57 B;  3QC8 B;  2KLC A;  2JRH A;  2MLB A;  1WR1 A;  5LLI A;  3ZRF A;  2L7R A;  3L13 A;  2NCN A;  1A5R A;  3PRP B;  2V3S A;  1WX7 A;  2J0J A;  4DHZ E;  2GBR A;  4ZDV A;  3V6E B;  4KSL C;  3APF A;  2PPH A;  4N9F 4;  3L0W B;  1NBF C;  4B95 A;  5DPT A;  1S1Q B;  1WJ4 A;  2FAZ A;  4W9J A;  4EOY A;  1D3Z A;  1WJU A;  3ZDT A;  3GZN I;  1UGM A;  3HIZ A;  3PV1 A;  4IUM B;  1WM2 A;  3ZTD A;  2IY0 B;  4W9G A;  3UIO B;  1H4R A;  1ZGU B;  4DK5 A;  2DYB A;  2MX2 A;  3VXW A;  3NY5 A;  2KNB A;  2LD9 A;  2LVO A;  4F8C B;  2CU1 A;  2KX0 A;  4YL8 A;  3H7S A;  3PVL A;  1V5T A;  1IP9 A;  4B9K A;  4E3C A;  2JZZ A;  3QAR A;  4EZK A;  4RM8 A;  4W9D A;  3BIN A;  4HDQ A;  2KMA A;  3MHS D;  3OAW A;  2RD0 A;  4PS3 A;  2GBK A;  3WAN A;  4A3O A;  2JY6 A;  2M0X A;  4FLH A;  2FNJ B;  2DAJ A;  3DDC B;  2MQJ A;  2N9P C;  4NJ6 A;  2L0F A;  2LUE A;  3DBR I;  2D2Q A;  2MA9 B;  2O2V B;  2PJH A;  3I3T B;  3R7Q A;  4FHJ A;  4DHZ B;  1XQQ A;  4MH0 E;  3OLM D;  1J8C A;  5CX3 A;  4II3 B;  4HJK A;  4M0W B;  2CHZ A;  3VTW A;  1OQY A;  1WMH A;  1WZ0 A;  3VTU A;  1E8Z A;  3KYC D;  2DYO A;  3U8Z A;  2L76 A;  3DBH I;  1Z5S B;  3IFW B;  2YVC A;  3JW0 X;  2K25 A;  3DBL I;  4KIK A;  2KOX A;  4EEW A;  3AU4 A;  2HJ8 A;  4FJZ A;  3QK0 A;  4JLC A;  4HDO A;  2JVC A;  1F9J A;  3DPD A;  1LQB A;  4TQ0 A;  4M8N A;  3LDZ E;  3TCA A;  4A3P A;  5CHW A;  2K8C A; 
#chains in the Genus database with same CATH topology
 5FR3 A;  3AMZ A;  3RI7 C;  1ESF A;  2W9N A;  3W1S C;  1JWB D;  4TV3 A;  3Q3J A;  4RFB A;  2J4X A;  3UF8 A;  2PE9 A;  2QSD A;  3V60 A;  3UIN B;  3APC A;  2N1V A;  2KTR A;  4XZ4 A;  3A33 B;  3GZN B;  3NS8 A;  4ARC A;  4WWP A;  2WHI A;  2W55 A;  1T3Q A;  2RPV A;  3L54 A;  3H7P A;  5G55 A;  2J42 A;  4IWP A;  2PMV A;  1K8R B;  1QOA A;  2R61 A;  1V1O A;  3RNB C;  4ANU A;  1DOX A;  3PSE B;  2KDM A;  3V3X A;  1TBE A;  2MRP A;  3AB5 A;  1FNU A;  1YMH E;  3R7R A;  2D5G A;  1UGJ A;  2Y3A A;  1KF6 B;  3VUX A;  1XXG A;  2C60 A;  3N3K B;  1C4C A;  1FXT B;  2CHX A;  2N9L A;  2FBW B;  2R2Q A;  1FFU A;  3Q8E A;  4KKI A;  2HD5 B;  2L05 A;  1TS5 A;  1JCK B;  1KLG D;  2KZR A;  2D3C A;  1FM0 D;  2IZV B;  4AQ7 A;  2ASQ A;  4YSX B;  2MJD A;  2OJR A;  2RDB C;  3ZTC A;  3J9C A;  1YOV B;  3ZKJ C;  2ON8 A;  1GJZ A;  1HQR D;  2WNM A;  2OHF A;  4BKG A;  1NI3 A;  4LK0 M;  2FIF A;  1V97 A;  2NBW B;  1UNS A;  3VUW A;  1SF0 A;  2NTT A;  2W3R A;  2W54 A;  2AQ2 B;  2RR9 A;  3D32 A;  1FXA A;  1Q5W B;  1ISN A;  2M56 B;  1KOT A;  1YQ4 B;  2JT4 B;  2M19 A;  1YX6 B;  4LNK A;  4G3X B;  3VDZ A;  3ZJU A;  4HPM B;  3AEE B;  3SFD B;  2JXT A;  2C7N B;  4XWW A;  2BPS A;  3V61 A;  2ZVO A;  2N7E A;  4KGR A;  3UI3 A;  3O65 B;  4G0N B;  4ZHP A;  3IXS A;  1Q10 A;  2ACZ B;  3BVM A;  2JPH A;  1JWA D;  4NJC A;  3GE8 C;  3JVZ X;  5AUK A;  1L7Y A;  3ZUN A;  5IA7 A;  2KT7 A;  3R8B A;  5T8I A;  2IGH A;  1NDD A;  3L16 A;  3H1U A;  4MSQ B;  3P42 A;  2QHO A;  2V0G A;  3PHX B;  5LXH A;  1D5M C;  4K3B A;  1PUT A;  1V1P A;  1SE9 A;  2ZNV B;  2KWV B;  3DWM A;  4GSW A;  4AP4 C;  3ZIM A;  4N6E B;  5TR5 A;  1LM8 B;  1VZ7 A;  2K8B A;  2KJH B;  2ZPY A;  4HLE A;  1MG8 A;  4IW0 A;  1VDV A;  1UEL A;  4C80 A;  3AUL A;  2MEK A;  1FD6 A;  1JWU D;  3RPF C;  4MH8 A;  2GBN A;  3QX1 A;  4FHK A;  4KSK C;  2KAC A;  1UBI A;  2IJ0 A;  5JZE B;  2GI9 A;  3NVY A;  1WE7 A;  3IVF A;  2WGS A;  2C7H A;  2ICI A;  2KWC A;  3M63 B;  3WA0 A;  1N63 A;  2WXR A;  4Q2J A;  2UWQ A;  4YTM B;  4LDT D;  1YIW A;  4URK A;  2WQY B;  2LJ5 A;  3AXC A;  3EHV A;  1RFA A;  2JXX A;  3A9J A;  3NHE B;  2MP2 A;  3N20 C;  2SAK A;  2K1F A;  3QIJ A;  4ANW A;  4C7Y A;  1M94 A;  1UWM A;  2Z0E B;  3EEC A;  2EMS A;  3ETR A;  3A1Q A;  3P4S B;  1TS4 A;  3CST A;  1E7P B;  5J17 A;  4W9K A;  1EWC A;  2REX A;  3DHG C;  1RLF A;  2KWD A;  1D5Z C;  2JQR B;  1SJE D;  5CHF A;  2KJ6 A;  1WGK A;  5FK9 C;  4YT0 B;  3TSS A;  4S0R A;  3U30 A;  1SIJ A;  3QHT A;  4ICU A;  2KFJ A;  3BY4 B;  3T9L A;  3M95 A;  4ZYS A;  5JHA A;  2FCN A;  3KQ4 A;  1GC7 A;  1VJK A;  3AV8 A;  4NPN A;  4KVG B;  1PFD A;  2IO2 B;  2NVU I;  3FC4 A;  2O2V A;  4MSM B;  3NJT A;  2BYE A;  1PDX A;  1X1M A;  2HTH A;  1QQR A;  4ZOH C;  2LZ6 A;  4JPS A;  3KUC B;  3KW5 B;  4CYE A;  4BBN F;  2QMT A;  1YQ3 B;  4DDI D;  1XT9 B;  4NZL B;  1JQ4 A;  3SHQ A;  1R4M I;  4A9A A;  2M8S A;  2LHD A;  4OVU A;  2ZEQ A;  3URY A;  1NEN B;  2OOB B;  1S3S G;  4JE3 B;  1RWS A;  4FJY A;  2KVZ A;  4GDK B;  1B9R A;  4GDL B;  4K7W A;  2FID A;  2KC2 A;  5EE3 A;  3NRZ A;  2DHZ A;  2DZI A;  3LB8 C;  1EM7 A;  1QOF A;  4AWJ A;  1I4P A;  5KHQ A;  1WRD B;  4HRS A;  3NOB A;  3Q8C A;  4NAW B;  4IKG A;  2KQ7 A;  2XK5 B;  4REZ A;  1V5O A;  2J7Q B;  4DDG D;  1LO5 D;  2N0S B;  4IC7 B;  1WR1 A;  2J52 A;  2V3S A;  1TS2 A;  2QC8 A;  4ZDV A;  2HJ1 A;  3SEB A;  1LGR A;  3U2S C;  2X8X X;  4JX1 C;  3ZDT A;  1KH0 A;  1HXY D;  4DK5 A;  1SJH D;  2I38 A;  4YL8 A;  1IP9 A;  1C78 A;  4E3C A;  3QAR A;  4RM8 A;  5D3I B;  3OAW A;  2GBK A;  4HKZ E;  2D3B A;  1R7S A;  2JY6 A;  1F52 A;  2MQJ A;  2N9P C;  1SE4 A;  4NAM A;  3I3T B;  4FHJ A;  1XQQ A;  1V8C A;  4M0W B;  3VTW A;  3CIR B;  1E8Z A;  3Q14 C;  2L76 A;  4ARI A;  1T6B X;  3DBL I;  1HEZ E;  3BWU D;  3FIL B;  1P7F A;  2JVC A;  5JXV A;  2HDE A;  1LQB A;  3U7Z A;  5CHW A;  5C3J B;  2K8C A;  1F2R I;  1RFK A;  3VUY A;  3PLV A;  1VCB A;  1L0Y B;  3ZJT A;  4W9I A;  1L0X B;  3EFC A;  3PTF C;  4NNJ B;  3PLU A;  2G3Q B;  3QAQ A;  2LGY A;  3VR8 B;  3A4R A;  2AWT A;  3B0A A;  5D7G A;  2WDT B;  2BWF A;  2KX3 A;  1V49 A;  3Q8B A;  1WSP A;  1GUA B;  3W5U B;  3PRE A;  2IBI B;  1L5P A;  1J0G A;  1F77 A;  4MGI E;  4C4V B;  3W5V B;  5BMI A;  1CZP A;  1KFY B;  4M01 A;  3E9S A;  4NQK E;  2IDY A;  1K53 A;  3AE5 B;  5BMG A;  4JQW C;  3HVD A;  3Q3M C;  3KUZ A;  3OJ3 A;  1WXM A;  1L4Z B;  4C00 A;  1C4P A;  1SGH A;  1XD3 B;  2Y5P A;  4M02 A;  3WAO A;  2HTM E;  2PTL A;  3IBE A;  3KUD B;  4LJP B;  2WS3 B;  1WXQ A;  2JWU A;  4CO7 A;  1NEK B;  2OJW A;  4WQM A;  3LYY A;  3AEF B;  1WMH B;  4YTP B;  3NZS A;  1L4D B;  3MJ5 A;  1I42 A;  1UH6 A;  1KRH A;  3L17 A;  4AUQ C;  1MHH E;  1OFF A;  1YN3 A;  1TKG A;  3NUH B;  3TMP B;  1FCC C;  4LTU A;  5E6N A;  3T3O A;  2GRI A;  2YEP B;  2DNF A;  2KD0 A;  2VRR B;  4K1R B;  5IO9 A;  3NVZ A;  3TEY A;  1DGJ A;  2WX1 A;  2C9W B;  2VH2 A;  2K9X A;  1E0Z A;  1XF5 L;  2EEL A;  4A8X C;  2K6D B;  4FA6 A;  4DXA B;  1GG3 A;  1WZ3 A;  1E5W A;  1N62 A;  1WGR A;  1I4X A;  1XEE A;  2D10 A;  2K6Q A;  1I35 A;  1WXS A;  1NYQ A;  3NG0 A;  4YXD B;  3A9K A;  5FKA C;  2K8H A;  4AJW A;  3U52 E;  5J18 A;  2PE6 B;  4LDT B;  1F2R C;  4MJS B;  2JZ3 B;  3ONS A;  3TL5 A;  3DOW A;  4NQL B;  3ZNG C;  4YWG G;  4LJO B;  2MCN B;  1UWX A;  3CWI A;  2NBU A;  1T0Q C;  1U4A A;  1AWD A;  1T0S C;  2H89 B;  2KQS A;  4WJN A;  2WP9 B;  2Z0D B;  1V80 A;  1N5W A;  3WAM A;  4M0W A;  3B08 A;  4M8M A;  1EF1 A;  1ET6 A;  5DCN A;  2NS5 A;  4GOC A;  3R2I A;  2C5L C;  1K51 A;  2Z59 B;  4GB9 A;  1XCT L;  2AYO B;  3X0W A;  2MBH A;  2WDQ B;  3BK2 A;  1TT5 B;  1C9F A;  2RGF A;  3L4P A;  3KLS X;  4E71 A;  2RDH A;  1IBX B;  2M4N A;  1XLN A;  5E6P A;  4FN2 A;  1WRI A;  2KDF B;  4I6P A;  4D2K A;  3GP7 A;  5E6O A;  3JSV A;  2CHW A;  4PYU A;  1SIF A;  4ZYN A;  1I4Q A;  5H92 C;  4IWQ A;  2IYD B;  1KTK A;  5KHO A;  3N32 A;  3P63 A;  2KQ4 X;  2AL6 A;  4RMA A;  3CMM B;  3DHH C;  1CMX B;  3DHI C;  2Q5W D;  1WE6 A;  1YJ1 A;  2WU2 B;  3Q3O C;  4IM3 A;  1FCL A;  2LHE A;  4JWS C;  4MM3 B;  1C77 A;  1SBB B;  3VFK A;  3TEZ A;  1Q0W B;  2IO1 B;  1RRB A;  1P3Q U;  4ZRK A;  2MBO A;  3C19 A;  2PLP A;  2A5U A;  3PGE A;  1HE8 A;  2LGS A;  4GXB A;  3ZXV A;  4CHK A;  5AUI A;  4BZA A;  4K7U A;  2QDF A;  4KZC A;  2WXG A;  2KFK B;  2BQQ A;  2FCQ A;  4B0M A;  1R4N I;  2DLB A;  1TZ1 A;  5EE1 A;  1EO6 A;  2IGD A;  2KTF A;  3T3N A;  1BXT A;  1N61 A;  5CHV C;  3X23 A;  3DVG Y;  2EMT A;  2YEP F;  3RT3 B;  4ACF A;  2D07 B;  3BVG A;  1ROE A;  4S17 A;  1GAQ B;  5AZH A;  2NPT B;  2LGI A;  2N7D A;  5GMV A;  1IPG A;  3KVF B;  4HCP B;  3IHP C;  4YSZ B;  4C7Z A;  3Q6B A;  4WUR A;  1V2Y A;  2SEB D;  2YLM A;  4JIO U;  1E90 A;  1YN4 A;  1ZP0 B;  3KWV A;  5HI1 A;  2J0K A;  3ZNH B;  5IOI A;  1OGW A;  3RNG C;  2DX5 B;  3GE3 C;  4B6W A;  2E3T A;  4XGA B;  3Q3N C;  2LFI A;  1WM3 A;  4WQO B;  2XN9 C;  3AE8 B;  2LWP A;  2G9H D;  3QCA A;  2NBV B;  2LRU A;  5BMH A;  1MHX A;  2KDE B;  5IN7 A;  3B2G A;  1QOB A;  2ZCC A;  2BW2 A;  4WJP A;  4KDL B;  5G5G A;  1WY8 A;  2JZP A;  1SE2 A;  1AAR A;  4GU2 A;  3DVN U;  4ZRJ A;  4W9C A;  2LGX A;  3ECI A;  5L95 C;  2I1J A;  2IGG A;  4KGT A;  3TEW A;  2V9H A;  4GMV A;  2WYQ A;  4EKU A;  5IKC M;  2KLC A;  4A6Q A;  2JRH A;  5LLI A;  2DWQ A;  2L7R A;  1D6E C;  1QKZ A;  2JX5 A;  1XLP A;  2PPH A;  3HRD D;  4MAC A;  2IPK D;  1WJ4 A;  4W9J A;  3GZN I;  3HIZ A;  1WM2 A;  4W9G A;  3UIO B;  1H4R A;  1ZGU B;  2DYB A;  2V3P A;  3NY5 A;  2KNB A;  2LD9 A;  2KX0 A;  1V5T A;  2JU6 X;  5HFY A;  1XO3 A;  3BYT B;  2JZZ A;  2QIL A;  4W9D A;  4J3O D;  1SB3 C;  4OZC A;  4HDQ A;  2KMA A;  3MHS D;  2RD0 A;  1ACC A;  2MJE A;  4FLH A;  2FNJ B;  2K22 A;  1NYR A;  1MVK A;  3OWE B;  4WH4 A;  2D2Q A;  2MA9 B;  5D3D A;  3R7Q A;  3SFE B;  2OED A;  3W2D A;  4DHZ B;  4OVZ A;  1OQY A;  3VTU A;  1EU3 A;  3KYC D;  3AEB B;  5HG2 A;  1MG4 A;  1F0Z A;  3JW0 X;  4UDU C;  4EEW A;  3QK0 A;  2X38 A;  1TIF A;  1F9J A;  1CQV A;  4O1N A;  4M8N A;  3LDZ E;  3TCA A;  1KLU D;  5DPS A;  5IAA C;  1HTQ A;  4P6V F;  3AN1 A;  4N59 A;  3HUI A;  4JWU C;  2HE7 A;  4GIV A;  4BVU C;  5DPW A;  1WX8 A;  1WXV A;  1OEY A;  1NI2 A;  4FJV B;  1VR9 A;  4IWO A;  3VH3 B;  4AJY B;  2GBJ A;  2KMC A;  5BYS A;  2CR5 A;  4OZB A;  1YJJ A;  4HWI B;  3N1Z C;  4NJ7 A;  3HVZ A;  1SXT A;  1WGH A;  5L83 A;  3BZD B;  2PW9 A;  2KO3 A;  4W9F A;  1PGB A;  4DHJ B;  3ZJV A;  3N1X C;  3B2F A;  4GN1 A;  2LRW A;  1XLQ A;  4RCO A;  4PS8 A;  4HJG E;  4BAX A;  4L23 A;  4TKN A;  4GGQ A;  1UD7 A;  3RFZ B;  1Q1O A;  4HKQ A;  3RYT A;  2IO3 B;  3DBR B;  5AZF A;  3ZO5 B;  4WJQ A;  2D3G A;  1G6J A;  2LMC A;  2AQ1 B;  3CF6 E;  5GXG B;  2AEH A;  3QWZ B;  2V4L A;  4PS7 A;  1FO4 A;  4P16 A;  5AEK B;  1L2N A;  3DBH B;  2ZW1 A;  3DBS A;  4K81 A;  1PGX A;  2JYT A;  4G11 A;  3UIP B;  2LAS A;  3OG5 A;  2N9K A;  1PGA A;  5D6J B;  2BYF A;  1TY0 A;  1J7B A;  1JWS D;  5LNK 1;  1DOI A;  1XCQ L;  3UGB B;  2KHW B;  1WJ6 A;  4NY0 A;  2DYM A;  3VRB B;  4A55 A;  3Q69 A;  3PO0 A;  4KIK B;  2R2O A;  5C1Z A;  3IT6 B;  4EE2 A;  4FUL A;  5CTR C;  5TSS A;  3WCQ A;  1WGG A;  2INP E;  1YJI A;  1KJT A;  2KAN A;  1JWM D;  2GMI C;  3H6N A;  2C7M B;  2Z8L A;  4HCN B;  4QAY A;  4RGM A;  4OVV A;  2BTE A;  2MBQ A;  4R3D A;  1TJE A;  3C0R B;  2H88 B;  2NMQ A;  3RD2 A;  3RNF C;  1VZ8 A;  3L08 A;  3DCG A;  2LEK A;  3JYU A;  1FRR A;  2KTR B;  2PIA A;  4IM0 A;  1SE3 A;  3ABV B;  1ZW7 A;  2N9E B;  4P1C C;  2WXI A;  3L10 B;  4WAF A;  2ZZP B;  2CJO A;  1WI0 A;  3MC8 A;  4LNF A;  2G1E A;  4PYZ A;  3EA6 A;  3RNE C;  1PQS A;  4AOF A;  3WAL A;  2FCS A;  2GBM A;  2BB5 A;  1J7A A;  3ALB A;  1FNW A;  2KDI A;  3MTN B;  3TEX A;  3V62 A;  1TKY A;  1YD8 U;  4PT5 A;  1E7V A;  3AEA B;  2L52 A;  4MEM A;  4ZRQ A;  1WFY A;  1ZKH A;  1LXD A;  3PHW B;  3ZVV A;  1JAL A;  2M1M A;  3DVN V;  5DPR A;  1FMA D;  1ZDX A;  1M4V A;  1OTR B;  5G5H A;  2K0P A;  3EGR A;  2BS4 B;  1BT0 A;  4XC2 A;  1T5X D;  3TBL D;  3AE2 B;  2KWU B;  4WWO A;  4MEL A;  2MH7 A;  3IT4 B;  4YTN B;  2AL3 A;  3R3M A;  1QZE A;  3AED B;  2LUM A;  2NR2 A;  4F1S A;  1UBQ A;  4BBN C;  4K3C A;  3QQ8 B;  3GS2 A;  5BO4 B;  2AX5 A;  2JRI B;  4USA A;  5G2N A;  3NZ3 A;  2KK8 A;  2WX0 A;  1ZUD 2;  2WWZ A;  5MPO A;  3Q8A A;  2BKR B;  1WH3 A;  4G50 A;  3HHM A;  2LXA A;  2W82 A;  4KGS A;  2JF5 A;  4RF0 A;  4BKS D;  1P9D U;  2IND C;  4GDK A;  3SDL C;  2O6V D;  2JUO A;  5D94 A;  2LI5 A;  2ZNV C;  4GDL A;  3O13 A;  2KMM A;  2CS4 A;  3VVW B;  2FUG 1;  1FNV A;  4PK1 A;  3K9O B;  3E56 A;  2ZVN A;  2WXL A;  1E8Y A;  1VZ6 A;  3ZNZ B;  2GOW A;  4NAW A;  4L1B A;  3ZYY X;  2XK5 A;  4DXG A;  1ZDV A;  2N7J A;  2WXK A;  4WAA A;  1QOG A;  3AM9 A;  1AYF A;  3U7D A;  4BOS C;  1B1Z A;  4WJO A;  2KKC A;  3GOE A;  3ML9 A;  1ZE3 D;  2J0M A;  1STE A;  2WXO A;  2DBY A;  1RYJ A;  5D2M B;  1IYF A;  2KLG A;  1PYW D;  3VAW A;  1P98 A;  3HK0 A;  3BK1 A;  2D3A A;  4DHJ D;  1LFD A;  1SSN A;  1P1A A;  1E6E B;  3PPA A;  1GNU A;  4IM2 A;  4OHJ A;  3ZRC A;  4HPP A;  1UUP A;  1HA5 A;  2G45 B;  1I4H A;  2ONQ A;  1V1P B;  4F7Z A;  4J6I A;  4HEA 1;  1WX9 A;  2DZJ A;  4IDI A;  2BBC A;  2ZW0 A;  2WXQ A;  3WAP A;  2ZJD A;  2KVR A;  3RZW C;  1FEH A;  4M00 A;  1CK1 A;  4W9H A;  4ZHO A;  1N6Z A;  2L8J A;  2KN4 A;  2KAJ A;  3KH0 A;  1EU4 A;  3B1L X;  3FIL A;  4H2A A;  2N4F A;  1Y8R C;  3ZNI D;  2L1A A;  3MC9 A;  1QT9 A;  4IOI E;  2EKE C;  3HM3 A;  4FXC A;  2BGF A;  4WIP A;  2N9X A;  2V4I B;  1TYG B;  2M17 A;  1J19 A;  5JHB A;  2BYV E;  4ANX A;  2G4S A;  4WWM A;  3RN9 C;  1WXA A;  4XE0 A;  1RAX A;  2WXN A;  2INC C;  2MW5 A;  3PS6 A;  4WWN A;  1WR6 E;  3A9J B;  2MP2 B;  4XWT A;  1OEY J;  2IY1 B;  4P1B C;  3Q2A C;  2CJN A;  4FAD A;  4BFR A;  4LNN A;  3A1Q B;  3RZF A;  3ZW3 A;  4JGH B;  3QC8 B;  3ZRF A;  3L13 A;  2BVC A;  3PZ7 A;  1A5R A;  1JRP A;  3PRP B;  4C4V A;  1CJE A;  2J0J A;  4DHZ E;  3SR6 A;  3N1Y C;  4KSL C;  3APF A;  3L0W B;  1BML C;  1NBF C;  4B95 A;  1S1Q B;  1D3Z A;  3ZTD A;  2BT6 A;  2IY0 B;  2MX2 A;  2INN E;  1D5X C;  3BII D;  3AE6 B;  4B0E A;  2LVO A;  3PVL A;  2WDR B;  4B9K A;  5E6J A;  3R2T A;  1IGD A;  3N9Y C;  3NVV A;  4CQN A;  4KKJ A;  4PS3 A;  3WAN A;  1R4M B;  2VH1 A;  2L0F A;  2LUE A;  2O2V B;  3EUB 2;  1J8C A;  2PVG C;  5CX3 A;  1ZPS A;  4II3 B;  2CHZ A;  1WMH A;  1WZ0 A;  2DYO A;  1GB4 A;  1Z5S B;  3IFW B;  5I4D A;  2KOX A;  3AU4 A;  2HJ8 A;  4FJZ A;  4TQ0 A;  1K52 A;  2RPQ A;  1OQR A;  3MC0 B;  4A20 A;  1V81 A;  1TGZ B;  2KN5 A;  1L6U A;  2L0T A;  3IAS 1;  1FIQ A;  3RCZ A;  4RM9 A;  2I2Y A;  3R66 C;  1MFW A;  4P7I A;  2Y5C A;  4YSY B;  3IG3 A;  3RNA C;  4ANV A;  2MBE A;  1FRD A;  4W9L A;  2KC1 A;  2K5P A;  4TMA B;  3AE9 B;  1C1Y B;  4MJS A;  4HVB A;  3I9V 1;  2FE8 A;  3ZDM C;  3W1Y A;  2TSS A;  3T8M A;  3ZLZ A;  3Q8F A;  3AEC B;  3BVZ A;  1E9M A;  4MT5 A;  1FPY A;  3NVW A;  3P4P B;  5H8Y E;  4EZJ A;  3PRZ A;  1JW9 D;  1UZX B;  2UYZ B;  3OJ4 B;  1IUE A;  2BF8 B;  2WU5 B;  1VRA B;  3V05 A;  1F1H A;  3H9D A;  3M62 B;  3I57 A;  3AE7 B;  1WYG A;  2L83 A;  2XEW A;  3AEG B;  3DBL B;  4MGK E;  2MHJ A;  3GB1 A;  3H8H A;  1SEB D;  4I6N B;  2RSU A;  4BOZ B;  4I6L B;  4C56 C;  1FXI A;  2BKF A;  4RF1 A;  1Z2M A;  1YNT E;  3AE1 B;  1IBX A;  3MP9 A;  3ZXR A;  4XYC A;  1C3T A;  3CSF A;  1GC6 A;  1E10 A;  3RNC C;  5BYQ A;  2BWE S;  3TIX A;  4HPL B;  2UU7 A;  4MGY E;  4ASW C;  2WXM A;  2Y5B B;  2EKI A;  1WJN A;  3VRA B;  3FAH A;  1JRO A;  2M0A A;  1A70 A;  1BUI C;  1WF9 A;  4KV2 A;  4OW0 A;  5HHD G;  2L32 A;  3VR9 B;  1V6E A;  3P4R B;  4GLS C;  1J7C A;  2O6V B;  2BS3 B;  2BYT A;  3ZQ4 A;  1KM7 A;  4MM3 A;  3M3J A;  1JRU A;  2KJR A;  2B76 B;  3PZD A;  1NVI D;  3VH4 B;  1D4B A;  2FUH B;  1GPX A;  4US8 A;  4XDD A;  3N30 A;  1MI0 A;  2G4D B;  4HRO A;  3BYY B;  3DQV A;  3UQB A;  4IG7 B;  2KFK A;  2L3Z A;  1C79 A;  4LNI A;  4JL9 A;  2WXF A;  4KZ0 A;  2PKO A;  3PRM B;  4DWF A;  4KDI C;  3IAM 1;  1MPE A;  2IO0 B;  1RM6 C;  2QIE B;  1Y56 A;  2ZCB A;  1E8W A;  3FKY A;  1C4A A;  2WDV B;  2VZK B;  3S2A A;  2RMM A;  2RDG A;  1WGD A;  3ZGZ A;  2NPT A;  5EE9 A;  3QA8 A;  4DXF A;  2N1W A;  3RMK C;  2D11 A;  4E74 A;  4HK2 A;  1EUV B;  3LXF A;  4RGN A;  4TUU A;  5IP4 D;  2XBB C;  3APD A;  4XX5 A;  2PEA A;  2A4Z A;  3MFG A;  5FR6 A;  3ML8 A;  1HZ6 A;  3A4S C;  4OZA A;  3NZU A;  1P0R A;  2GB1 A;  2DAF A;  3NS1 A;  3DVG X;  1K50 A;  3PZ8 A;  3QJZ A;  2JYE A;  4KX6 B;  4XDC A;  4DQO C;  3ENE A;  4RGO S;  1AW7 A;  3P4Q B;  1I4R A;  3AE4 B;  2J53 A;  2MJ3 A;  1YN5 A;  4ITK A;  2MBB B;  5EE0 A;  4W9E A;  4BKT A;  2MWS B;  2V1Y A;  3A9K B;  2ZPN A;  4MGZ E;  1FFV A;  3EC8 A;  1TS3 A;  2XNA C;  1EF5 A;  3AI5 A;  1TKE A;  1XLO A;  3WIM A;  2NTS A;  2LXC A;  3LJ3 A;  2I1K A;  4L2Y A;  1C76 A;  3Q3F A;  1ET9 A;  1L6V A;  2CU3 A;  3K9P B;  4EFO A;  3U4E G;  3MJW A;  1N60 A;  4A90 A;  5HKH A;  4DBG A;  3PT2 B;  3SU8 X;  1KLV A;  1YQB A;  2JSV X;  1V9J A;  4FBJ B;  5JH5 C;  3HM6 X;  2DZM A;  4II2 B;  4K7S A;  2B3A A;  4ZRP A;  5LXI B;  3RUL A;  1HZ5 A;  4MDK E;  5EDS A;  1JML A;  2JWZ A;  1H8C A;  3H7P B;  2W3S A;  2L00 B;  4TQ1 A;  4TSS A;  1I7H A;  1T0Y A;  1TZO A;  2MSE D;  2LGD A;  3W1S A;  1DYQ A;  1WYW B;  3AU5 A;  2KXJ A;  3EFU A;  3P1M A;  3I63 C;  2CKH B;  2AQ3 B;  2WXH A;  1GOZ A;  2WXP A;  1E8X A;  2DZK A;  2QCZ A;  3KWL A;  2QJL A;  4EZL A;  3W9C B;  3VQI A;  3I5J C;  2WLB A;  1VD2 A;  4BKS A;  4LCD E;  2O6V A;  1WGY A;  2DEN B;  2LVQ A;  3JSV B;  1WIA A;  4LNO A;  4HXD A;  1E7U A;  3TJP A;  3SD5 A;  1DOY A;  1ENF A;  3AH7 A;  3V6C B;  1V86 A;  4RGT A;  1EWY C;  1ZXI A;  2BB6 A;  1TTN A;  1ZOY B;  3P2B A;  1YX5 B;  1TY2 A;  4ICV A;  3RUI B;  1QLB B;  4EUT A;  2KDB A;  3VHT C;  5AZG A;  1R4N B;  4ZRI A;  5J2R A;  2WXJ A;  2LVP A;  3DWG C;  2K39 A;  4N58 A;  3AE3 B;  3UQA A;  1OQQ A;  4LLG M;  3VTV A;  5C23 A;  1HTO A;  2FCM A;  3KYD D;  4X57 B;  1GB1 A;  2MLB A;  1I4G A;  2NCN A;  2V3N A;  1WX7 A;  2LJI A;  2GBR A;  2GLS A;  3V6E B;  2K3U A;  4N9F 4;  1MJD A;  5DPT A;  2FAZ A;  4EOY A;  1WJU A;  1UGM A;  3PV1 A;  4IUM B;  1T0R C;  1QF6 A;  3VXW A;  1IGC A;  4F8C B;  2CU1 A;  3H7S A;  2KYW A;  4RNA A;  1QIL A;  4EZK A;  1L0V B;  3BIN A;  1VLB A;  2QEJ C;  2BS2 B;  4A3O A;  2M0X A;  2DAJ A;  3DDC B;  3TUO A;  4NJ6 A;  2E6X A;  1P7E A;  2VZK D;  3DBR I;  2PJH A;  3MHZ A;  3B9J A;  5C2T B;  4MH0 E;  1UF0 A;  3OLM D;  5BYR A;  4HJK A;  1ZXH A;  2PVO D;  3U8Z A;  3DBH I;  4US9 A;  1AN8 A;  2YVC A;  4KIK A;  2K25 A;  4JLC A;  4HDO A;  3DPD A;  1N5X A;  3C8Y A;  4AS1 A;  4RH6 A;  1WWT A;  4A3P A; 
#chains in the Genus database with same CATH homology
 2RPQ A;  3VUY A;  3PLV A;  1VCB A;  5DPS A;  5IAA C;  1V81 A;  4A20 A;  1TGZ B;  2KN5 A;  2L0T A;  4W9I A;  3RCZ A;  4RM9 A;  2HE7 A;  3R66 C;  2W9N A;  3PTF C;  4GIV A;  4NNJ B;  3PLU A;  4BVU C;  5DPW A;  2G3Q B;  1WX8 A;  3W1S C;  3QAQ A;  4TV3 A;  1WXV A;  2LGY A;  1OEY A;  3Q3J A;  2PE9 A;  3UF8 A;  1NI2 A;  4P7I A;  4FJV B;  4IWO A;  3V60 A;  3UIN B;  3APC A;  3IG3 A;  3A4R A;  3VH3 B;  4AJY B;  2GBJ A;  2AWT A;  3B0A A;  5D7G A;  2KMC A;  2N1V A;  4ANV A;  2CR5 A;  2MBE A;  2WDT B;  2BWF A;  2KX3 A;  2KTR A;  4HWI B;  1V49 A;  4W9L A;  4NJ7 A;  3A33 B;  4XZ4 A;  2KC1 A;  1WGH A;  5L83 A;  1C1Y B;  3NS8 A;  4MJS A;  4HVB A;  2KO3 A;  4WWP A;  4W9F A;  3ZDM C;  4DHJ B;  3W1Y A;  4GN1 A;  1GUA B;  3T8M A;  3L54 A;  3H7P A;  5G55 A;  2LRW A;  3PRE A;  3ZLZ A;  4IWP A;  4PS8 A;  2IBI B;  1K8R B;  1J0G A;  4MGI E;  4TKN A;  4GGQ A;  1UD7 A;  4ANU A;  3PSE B;  1Q1O A;  4NQK E;  3RYT A;  2IO3 B;  4EZJ A;  3PRZ A;  5AZF A;  3ZO5 B;  1TBE A;  4WJQ A;  2D3G A;  1G6J A;  1UZX B;  2UYZ B;  2MRP A;  3OJ4 B;  4JQW C;  3CF6 E;  3R7R A;  2BF8 B;  2AEH A;  3QWZ B;  2V4L A;  3KUZ A;  3VUX A;  4PS7 A;  3H9D A;  3M62 B;  3OJ3 A;  5AEK B;  2C60 A;  1L2N A;  3N3K B;  1WXM A;  2XEW A;  1SGH A;  1FXT B;  2CHX A;  3DBS A;  1XD3 B;  4MGK E;  4K81 A;  2R2Q A;  4G11 A;  3WAO A;  2HD5 B;  2L05 A;  3KUD B;  3IBE A;  4LJP B;  3UIP B;  2LAS A;  4CO7 A;  2KZR A;  4I6N B;  5D6J B;  2BYF A;  2IZV B;  2RSU A;  4BOZ B;  2ASQ A;  4I6L B;  2OJR A;  3ZTC A;  1WMH B;  3NZS A;  2BKF A;  3UGB B;  3ZKJ C;  1Z2M A;  2KHW B;  1WJ6 A;  4NY0 A;  2DYM A;  1I42 A;  1UH6 A;  4KIK B;  1GJZ A;  2R2O A;  3L17 A;  5C1Z A;  4AUQ C;  1C3T A;  3CSF A;  4BKG A;  1GC6 A;  4FUL A;  5CTR C;  2FIF A;  1WGG A;  2NBW B;  2BWE S;  2KAN A;  1KJT A;  3VUW A;  3TIX A;  3TMP B;  4HPL B;  2GMI C;  2RR9 A;  3H6N A;  5E6N A;  3D32 A;  2C7M B;  4MGY E;  1Q5W B;  1ISN A;  4ASW C;  2Y5B B;  4HCN B;  2KD0 A;  2VRR B;  2JT4 B;  1WJN A;  4K1R B;  1KOT A;  4OVV A;  2WX1 A;  2C9W B;  2MBQ A;  1YX6 B;  2K6D B;  1WF9 A;  3C0R B;  4FA6 A;  4KV2 A;  4DXA B;  4G3X B;  3VDZ A;  1GG3 A;  1WZ3 A;  3RD2 A;  4HPM B;  1E5W A;  1V6E A;  1WGR A;  3L08 A;  2C7N B;  3DCG A;  2BPS A;  2D10 A;  3V61 A;  2K6Q A;  2ZVO A;  2O6V B;  1WXS A;  3JYU A;  1I35 A;  2N7E A;  3A9K A;  1KM7 A;  2K8H A;  2KTR B;  4MM3 A;  4AJW A;  3M3J A;  1JRU A;  2PE6 B;  3O65 B;  4IM0 A;  4LDT B;  5J18 A;  2KJR A;  4G0N B;  3PZD A;  4MJS B;  2JZ3 B;  3ONS A;  3TL5 A;  1ZW7 A;  2N9E B;  3VH4 B;  3DOW A;  3L10 B;  4NQL B;  4F1S A;  2JPH A;  2FUH B;  2ZZP B;  1WI0 A;  4PYZ A;  1PQS A;  3N30 A;  3ZNG C;  4AOF A;  2G4D B;  3JVZ X;  4LJO B;  2MCN B;  3WAL A;  2FCS A;  1L7Y A;  3DQV A;  3UQB A;  4IG7 B;  2GBM A;  2NBU A;  3ALB A;  3ZUN A;  2KFK A;  5IA7 A;  1U4A A;  2KDI A;  2L3Z A;  3MTN B;  4JL9 A;  4KZ0 A;  3PRM B;  3V62 A;  1NDD A;  3L16 A;  1YD8 U;  4DWF A;  3H1U A;  4KDI C;  1E7V A;  2IO0 B;  4MSQ B;  2KQS A;  4WJN A;  2Z0D B;  1V80 A;  2QHO A;  4MEM A;  3PHX B;  3WAM A;  5LXH A;  1WFY A;  2ZCB A;  1E8W A;  1ZKH A;  1LXD A;  3S2A A;  3PHW B;  3B08 A;  3ZVV A;  2M1M A;  2ZNV B;  1SE9 A;  1EF1 A;  3DVN V;  4M8M A;  5DCN A;  5DPR A;  2NS5 A;  4GOC A;  2KWV B;  4GSW A;  1OTR B;  2C5L C;  4XC2 A;  1BT0 A;  1WGD A;  4AP4 C;  2Z59 B;  2NPT A;  3TBL D;  3QA8 A;  3ZIM A;  2N1W A;  2KWU B;  4GB9 A;  4WWO A;  4MEL A;  2D11 A;  4E74 A;  2AYO B;  4HK2 A;  5TR5 A;  3X0W A;  2MBH A;  1EUV B;  2AL3 A;  1LM8 B;  3R3M A;  4TUU A;  1QZE A;  2XBB C;  2K8B A;  2NR2 A;  2KJH B;  3APD A;  2RGF A;  1UBQ A;  2PEA A;  2ZPY A;  4XX5 A;  4BBN C;  1MG8 A;  3QQ8 B;  4HLE A;  5BO4 B;  4IW0 A;  2A4Z A;  1UEL A;  2JRI B;  5FR6 A;  5G2N A;  3AUL A;  4E71 A;  3ML8 A;  2KK8 A;  3A4S C;  3NZU A;  2WX0 A;  1P0R A;  2GBN A;  2DAF A;  2M4N A;  3QX1 A;  5E6P A;  3DVG X;  4FN2 A;  2WWZ A;  4FHK A;  2KDF B;  4I6P A;  5E6O A;  3QJZ A;  4KSK C;  2BKR B;  3JSV A;  2CHW A;  1WH3 A;  4PYU A;  4G50 A;  3HHM A;  2LXA A;  1UBI A;  5JZE B;  3ENE A;  1SIF A;  1WE7 A;  3IVF A;  2JF5 A;  2C7H A;  4BKS D;  1P9D U;  2KWC A;  4ZYN A;  4GDK A;  3SDL C;  2O6V D;  3M63 B;  2JUO A;  5D94 A;  2LI5 A;  2ZNV C;  4GDL A;  4IWQ A;  3WA0 A;  2IYD B;  5KHO A;  2UWQ A;  3N32 A;  4LDT D;  1YIW A;  2CS4 A;  2AL6 A;  2MBB B;  3CMM B;  4RMA A;  2LJ5 A;  4URK A;  3VVW B;  1CMX B;  3AXC A;  3EHV A;  1RFA A;  4W9E A;  3K9O B;  4BKT A;  2MWS B;  2ZVN A;  1WE6 A;  1YJ1 A;  4IM3 A;  1E8Y A;  2V1Y A;  3ZNZ B;  2GOW A;  3A9K B;  2ZPN A;  2JXX A;  4MGZ E;  3A9J A;  3NHE B;  3VFK A;  2MP2 A;  4NAW A;  3EC8 A;  3AI5 A;  1EF5 A;  2XK5 A;  1Q0W B;  2IO1 B;  1RRB A;  1P3Q U;  3WIM A;  2K1F A;  3QIJ A;  4ZRK A;  2LXC A;  2MBO A;  3LJ3 A;  4WAA A;  4ANW A;  1M94 A;  2A5U A;  2I1K A;  3PGE A;  2Z0E B;  3EEC A;  3U7D A;  3Q3F A;  1HE8 A;  4BOS C;  2EMS A;  4GXB A;  4CHK A;  3A1Q A;  3K9P B;  4K7U A;  2KKC A;  3GOE A;  3ML9 A;  4WJO A;  4EFO A;  2J0M A;  3CST A;  3MJW A;  5HKH A;  4KZC A;  5J17 A;  4DBG A;  3PT2 B;  2KFK B;  3SU8 X;  1KLV A;  4W9K A;  1YQB A;  2FCQ A;  2REX A;  5D2M B;  1IYF A;  1R4N I;  1RLF A;  2KLG A;  1TZ1 A;  1EO6 A;  1V9J A;  4FBJ B;  5CHF A;  2KTF A;  3VAW A;  5JH5 C;  2KJ6 A;  1P98 A;  3HM6 X;  3HK0 A;  2DZM A;  4DHJ D;  4II2 B;  1LFD A;  4K7S A;  2B3A A;  1P1A A;  5CHV C;  3PPA A;  3U30 A;  1GNU A;  5LXI B;  4IM2 A;  3QHT A;  4ICU A;  3RUL A;  3X23 A;  3ZRC A;  3DVG Y;  2KFJ A;  2EMT A;  3BY4 B;  4MDK E;  2G45 B;  5EDS A;  3RT3 B;  2JWZ A;  1H8C A;  3H7P B;  4F7Z A;  3T9L A;  4J6I A;  2D07 B;  2L00 B;  4TQ1 A;  2MSE D;  1T0Y A;  2LGD A;  1WX9 A;  3W1S A;  2DZJ A;  3M95 A;  5JHA A;  2FCN A;  1WYW B;  3AU5 A;  5AZH A;  2NPT B;  2KXJ A;  2N7D A;  5GMV A;  1GC7 A;  3EFU A;  4NPN A;  4KVG B;  1IPG A;  3WAP A;  3KVF B;  4HCP B;  2ZJD A;  3IHP C;  2IO2 B;  2KVR A;  2NVU I;  2CKH B;  2O2V A;  3RZW C;  4MSM B;  1V2Y A;  2YLM A;  4JIO U;  1E90 A;  2BYE A;  1X1M A;  1E8X A;  2DZK A;  4W9H A;  2HTH A;  2J0K A;  3ZNH B;  2LZ6 A;  1OGW A;  3KUC B;  3KW5 B;  2DX5 B;  4CYE A;  4EZL A;  4B6W A;  4BBN F;  2L8J A;  3VQI A;  3KH0 A;  3B1L X;  1VD2 A;  4BKS A;  4LCD E;  1XT9 B;  4DDI D;  2O6V A;  3SHQ A;  1WM3 A;  4WQO B;  1R4M I;  2M8S A;  1Y8R C;  2N4F A;  3ZNI D;  2LWP A;  1WGY A;  2DEN B;  2LVQ A;  2NBV B;  1WIA A;  2LRU A;  2ZEQ A;  3JSV B;  3QCA A;  4OVU A;  2KDE B;  2EKE C;  2OOB B;  1E7U A;  4HXD A;  1S3S G;  3HM3 A;  2BGF A;  3TJP A;  2N9X A;  3SD5 A;  2M17 A;  1J19 A;  5JHB A;  4FJY A;  3V6C B;  2BYV E;  4GDK B;  4ANX A;  2G4S A;  1V86 A;  2ZCC A;  4GDL B;  4K7W A;  4WJP A;  1WXA A;  1TTN A;  3P2B A;  4KDL B;  2FID A;  1WY8 A;  1YX5 B;  2KC2 A;  1RAX A;  4ICV A;  3RUI B;  2MW5 A;  3PS6 A;  2DHZ A;  4EUT A;  1AAR A;  2DZI A;  2KDB A;  3DVN U;  4GU2 A;  4WWN A;  3VHT C;  4ZRJ A;  4W9C A;  5AZG A;  2LGX A;  1WR6 E;  4ZRI A;  5J2R A;  4AWJ A;  2LVP A;  5KHQ A;  3ECI A;  1WRD B;  3A9J B;  3NOB A;  2MP2 B;  2K39 A;  4NAW B;  1OEY J;  5L95 C;  2KQ7 A;  2IY1 B;  2XK5 B;  2I1J A;  4FAD A;  4BFR A;  3UQA A;  1V5O A;  2J7Q B;  4DDG D;  4GMV A;  2WYQ A;  4EKU A;  3VTV A;  5C23 A;  3A1Q B;  3RZF A;  2FCM A;  3KYD D;  4IC7 B;  3ZW3 A;  4JGH B;  4X57 B;  3QC8 B;  2KLC A;  2JRH A;  2MLB A;  1WR1 A;  5LLI A;  3ZRF A;  2L7R A;  3L13 A;  2NCN A;  1A5R A;  3PRP B;  2V3S A;  1WX7 A;  2J0J A;  4DHZ E;  2GBR A;  4ZDV A;  3V6E B;  4KSL C;  3APF A;  2PPH A;  4N9F 4;  3L0W B;  1NBF C;  4B95 A;  5DPT A;  1S1Q B;  1WJ4 A;  2FAZ A;  4W9J A;  4EOY A;  1D3Z A;  1WJU A;  3ZDT A;  3GZN I;  1UGM A;  3HIZ A;  3PV1 A;  4IUM B;  1WM2 A;  3ZTD A;  2IY0 B;  4W9G A;  3UIO B;  1H4R A;  1ZGU B;  4DK5 A;  2DYB A;  2MX2 A;  3VXW A;  3NY5 A;  2KNB A;  2LD9 A;  2LVO A;  4F8C B;  2CU1 A;  2KX0 A;  4YL8 A;  3H7S A;  3PVL A;  1V5T A;  1IP9 A;  4B9K A;  4E3C A;  2JZZ A;  3QAR A;  4EZK A;  4RM8 A;  4W9D A;  3BIN A;  4HDQ A;  2KMA A;  3MHS D;  3OAW A;  2RD0 A;  4PS3 A;  2GBK A;  3WAN A;  4A3O A;  2JY6 A;  2M0X A;  4FLH A;  2FNJ B;  2DAJ A;  3DDC B;  2MQJ A;  2N9P C;  4NJ6 A;  2L0F A;  2LUE A;  3DBR I;  2D2Q A;  2MA9 B;  2O2V B;  2PJH A;  3I3T B;  3R7Q A;  4FHJ A;  4DHZ B;  1XQQ A;  4MH0 E;  3OLM D;  1J8C A;  5CX3 A;  4II3 B;  4HJK A;  4M0W B;  2CHZ A;  3VTW A;  1OQY A;  1WMH A;  1WZ0 A;  3VTU A;  1E8Z A;  3KYC D;  2DYO A;  3U8Z A;  2L76 A;  3DBH I;  1Z5S B;  3IFW B;  2YVC A;  3JW0 X;  2K25 A;  3DBL I;  4KIK A;  2KOX A;  4EEW A;  3AU4 A;  2HJ8 A;  4FJZ A;  3QK0 A;  4JLC A;  4HDO A;  2JVC A;  1F9J A;  3DPD A;  1LQB A;  4TQ0 A;  4M8N A;  3LDZ E;  3TCA A;  4A3P A;  5CHW A;  2K8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...