1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
2KAJA 3AE3B 3AEGB 2K9XA 3AV8A 1V97A 1H7WA 1T3QA 2KMMA 1NYRA 1CZPA 3NRZA 1A70A 3ETRA 4A9AA 1NEKB 1GTEA 3AEAB 3P1MA 1OFFA 4JWUC 4ZHOA 1XO3A 2L52A 5MPOA 1UWMA 3CF4A 5EE3A 2PKOA 1TYGB 3AE1B 1ZUD2 3AE9B 1J7AA 2HTME 2H89B 1FXIA 1GAQB 2W55A 2CJNA 2MH7A 2AX5A 1FM0D 1NVID 3AB5A 2K5PA 3P4QB 1WYGA 1F0ZA 4ZHPA 1TKEA 3BIID 3AEEB 3SFEB 1RM6C 3AE2B 3B9JA 3NVWA 1TKYA 3VR8B 3L4PA 5EE9A 3AEFB 4YTNB 3NVZA 1YJJA 3AEBB 2OHFA 3W5UB 2WU5B 1L0VB 2M19A 3P4SB 1ROEA 1WGKA 2L83A 1OQQA 1DOYA 1TKGA 3AM9A 2W54A 3AE5B 1L5PA 4P6VF 3ZYYX 2PVGC 4JWSC 3SR6A 3LXFA 2DBYA 5AUKA 2MJEA 3RPFC 1RFKA 4C80A 3P4RB 1DOXA 1ZXIA 1GTHA 1R7SA 1YQ3B 3AEDB 1QOGA 1NI3A 1JWBD 2JQRB 1JQ4A 5G5GA 3HUIA 1XLQA 4N6EB 1QOAA 1NENB 1SB3C 1FIQA 3B2FA 1I7HA 3LB8C 1YJIA 2BS4B 1AWDA 1L6VA 2WLBA 1N5WA 4YSZB 4ZOHC 2MJ3A 1QT9A 1WRIA 2W3SA 2BT6A 1AYFA 3NS1A 2QIEB 3AE8B 2E3TA 1N5XA 2WU2B 4USAA 1N60A 3VR9B 3P4PB 1OQRA 1WXQA 4YT0B 1YQ4B 3P63A 1EWYC 1PDXA 1L6UA 1XLNA 2CU3A 2H88B 1J7BA 1FXAA 1IUEA 3HVZA 2K22A 1FFVA 1XLPA 1VJKA 1RWSA 3FAHA 1E7PB 1FRDA 1JRPA 1N63A 1JWAD 3NVYA 1N61A 3CWIA 2PIAA 4N59A 1JROA 1QOBA 1QOFA 1FRRA 4IDIA 4C7ZA 4LTUA 1PFDA 2Y5CA 2CJOA 3KWLA 2ACZB 5C2TB 5GXGB 3W5VB 2MJDA 3SFDB 3DWMA 4WWMA 2FBWB 2W3RA 2G1EA 1H7XA 1KRHA 1KFYB 1RYJA 1GT8A 1QLBB 1E6EB 3NVVA 2Q5WD 1B9RA 3AE4B 1SF0A 3AH7A 3AMZA 2PVOD 5EE1A 1QF6A 1N62A 4ITKA 3AE7B 1WWTA 2QJLA 1ZOYB 5H92C 3PO0A 1VLBA 4WQMA 3ABVB 2M56B 3VRAB 1KF6B 1E0ZA 2WQYB 4HROA 2N0SB 3FC4A 1VDVA 1NYQA 3CIRB 2B76B 4YXDB 5G5HA 4C7YA 1SIJA 1ZP0B 4YSYB 1E10A 2JX5A 3AECB 4KX6B 3AN1A 4US9A 1FMAD 1GPXA 2WDRB 4YSXB 1E9MA 1XLOA 3B2GA 4HRSA 4US8A 4YTPB 4JX1C 5C3JB 2DWQA 2WDQB 4YTMB 1TJEA 3HRDD 3EUB2 2WS3B 2LEKA 3DWGC 3WCQA 1FO4A 2EKIA 3VRBB 3AE6B 1CJEA 1J7CA 1JW9D 4FXCA 5H8YE 1JALA 2BS3B 4N58A 1V8CA 5EE0A 1DOIA 2WP9B 2WDVB 5AUIA 3W9CB 2BS2B 1DGJA 1PUTA 1FFUA
chains in the Genus database with same CATH superfamily
2R2OA 1RAXA 1N6ZA 4EZKA 2W82A 1GTEA 4K3CA 3P1MA 4B0EA 2LXCA 4II3B 2NPTB 4C4VA 3EFCA 2W55A 1L4ZB 2N1WA 3SFEB 1WX9A 1TT5B 4DXAB 2WU5B 3MJWA 2DAJA 1TS5A 4TMAB 3BINA 3ZW3A 4W9KA 3EFUA 1HE8A 2L8JA 2ZCBA 4HJKA 4KZCA 3NZUA 3N30A 1YQ3B 1JWBD 4W9JA 1JMLA 2PLPA 1SB3C 1NDDA 1N5WA 2JZ3B 4B6WA 2KMAA 1G6JA 1XXGA 4GDKA 1N61A 1JROA 1QOFA 4JGHB 4ANVA 4ARCA 2BWFA 4FN2A 1GT8A 4A3PA 4KSLC 2DENB 4FULA 3AH7A 3AMZA 3WANA 1F2RI 1UBQA 4GMVA 1UBIA 4XGAB 2PEAA 2PE6B 2WQYB 1ISNA 5JXVA 5CHWA 4MSMB 3DBRI 5G2NA 3A1QA 4ANUA 3KUDB 3ZDTA 2DZIA 4LNKA 2G4DB 4ZRPA 2J4XA 2PE9A 1HEZE 3WA0A 3DHHC 4IKGA 2IO2B 2A5UA 2KNBA 1JW9D 3L13A 1D5XC 2N9XA 2G9HD 2BS2B 3RZFA 3URYA 2M0AA 4GU2A 3NRZA 4RGMA 2KZRA 4HJGE 3QQ8B 4KDIC 2JXXA 1ZUD2 2RD0A 2MP2A 1GAQB 1SJED 1PGXA 1VD2A 3ZIMA 2NTTA 2RMMA 1A5RA 2BQQA 3Q6BA 4FJZA 1QZEA 3LXFA 2JWZA 1GTHA 1TY0A 3I5JC 3NUHB 4MDKE 1UELA 3HM3A 2BGFA 3TEXA 1JQ4A 2L1AA 1YN3A 2KDMA 2MBQA 5BO4B 3K9PB 2L0FA 3PS6A 2DZMA 3NHEB 4D2KA 3R3MA 2E6XA 1Y56A 2KANA 4IWOA 2CU3A 3Q2AC 1FXAA 3HVZA 4MGZE 4XWWA 3A9KA 1VJKA 3GE3C 1OQYA 3NOBA 4WJQA 3M3JA 1N63A 1UUPA 1JWAD 2ZVOA 3PZ8A 2ON8A 3V3XA 1GNUA 2BYTA 1E8XA 4DK5A 2ONQA 4NQKE 3SD5A 1XCTL 2CKHB 1WMHA 4RH6A 2GBRA 3UINB 2IO1B 3NG0A 2KFJA 4MACA 4AJWA 2CR5A 4BZAA 3OG5A 3PRPB 4WURA 3JSVA 2QHOA 1V86A 4DXGA 1K53A 2JX5A 2C7NB 1Y8RC 2D10A 4YTPB 5J2RA 1WR1A 1AARA 2WS3B 2LI5A 3DVGX 3U7DA 3IT4B 5H8YE 1SIFA 4MGKE 3AEGB 3N1XC 2WXHA 4TUUA 3AEAB 3I57A 2L52A 1C4CA 3RCZA 3AE9B 5AZGA 3SHQA 5E6PA 2MH7A 2LUEA 2L05A 4NJ6A 4RFBA 4G3XB 3NVZA 2OHFA 1HZ5A 1QILA 2KJ6A 4BBNF 2BPSA 4E71A 2LRWA 2Z8LA 1L4DB 5AUKA 4OVUA 1F77A 3ZJTA 3MJ5A 2V1YA 1KTKA 3MC0B 1PGBA 1AWDA 2QSDA 5KHQA 2KFKA 1GB4A 2E3TA 3DBLB 1L0YB 4M8MA 4BOSC 4RCOA 2GBMA 4HKZE 4H2AA 1QOBA 2HTHA 1YNTE 2BTEA 4NJCA 3EC8A 2EMSA 4HPPA 2W3RA 4WWOA 1BMLC 2WXMA 3U52E 3L0WB 3H6NA 4FBJB 3KUCB 4GDKB 4KKIA 4GLSC 3ZUNA 4IM2A 1SBBB 3DBHB 5G5HA 2K8CA 1LFDA 4LNIA 3RNBC 2LVPA 1E10A 1PQSA 1GPXA 1TGZB 2ZNVC 2GI9A 1LO5D 2BB6A 2NTSA 3EUB2 2WXGA 4HKQA 4URKA 5BMGA 2D2QA 2DZKA 3V6CB 1DGJA 3CF6E 2O6VA 2MBEA 4MEMA 3B0AA 2BYEA 3H9DA 5J17A 2HTME 2G4SA 2MRPA 4DXFA 1I4XA 1IBXA 3P4QB 3GZNB 1TKEA 5EE9A 5J18A 4OZAA 4TV3A 1GOZA 3W5UB 3R66C 2GMIC 2KX0A 1MVKA 4C80A 3T3NA 1SXTA 2JSVX 3A4SC 5DPSA 4MGYE 1NENB 1FIQA 2IZVB 3KWVA 2RDBC 3ZXVA 2W3SA 1CQVA 2QIEB 2FCMA 2K8BA 1ET9A 3P4PB 2WXJA 1BXTA 2LJIA 1WZ3A 2JXTA 2JU6X 1RWSA 2N9KA 4BAXA 4NQLB 3VH4B 1C4AA 4NJ7A 1Q10A 2Y5CA 1EM7A 3RI7C 2L3ZA 4FJYA 4PYUA 2JYTA 2Q5WD 4TKNA 2INNE 1RLFA 2DLBA 2GOWA 5LXHA 4W9DA 2QJLA 2ZVNA 3VTVA 2I2YA 2GBNA 3HIZA 2BKRB 3L10B 4HROA 4LJOB 5BMHA 4YXDB 3VTUA 2VRRB 3UIOB 3ZTDA 1L7YA 4JX1C 3T8MA 4HK2A 2EKIA 2MQJA 2PMVA 3N32A 2I1KA 4ANWA 2J0JA 1IBXB 2KDEB 1T3QA 1D5MC 2JPHA 3JVZX 5IAAC 4JWUC 2KACA 3MFGA 3QIJA 3ZRFA 3EHVA 3ALBA 2KWVB 2ZNVB 3W1YA 3AXCA 1GJZA 2QMTA 3VHTC 4W9GA 1I4HA 3OLMD 3DBSA 3AM9A 2LD9A 3KLSX 1EO6A 2O6VD 4HEA1 1WGYA 4RNAA 2KHWB 3RUIB 3V62A 1SE9A 2JF5A 5G5GA 3VFKA 4M8NA 4HXDA 1I7HA 5JZEB 2RPQA 4FHJA 3N1YC 2K6QA 2IO0B 2ZW1A 4USAA 5LXIB 2M8SA 4EE2A 2KYWA 2K22A 3DPDA 2WXPA 1GG3A 3VH3B 3NZSA 3QWZB 2N1VA 2IY0B 4G0NB 3QK0A 2ACZB 1UGJA 4KIKA 1GB1A 3PHWB 1VRAB 3TEYA 1C78A 4M01A 1GC7A 5EE1A 1QF6A 3KVFB 2WXLA 2C9WB 3A4RA 1JWMD 1X1MA 3TEWA 3VRAB 1KF6B 2VZKB 4ZYNA 1C4PA 1WE7A 3GP7A 1MPEA 3NZ3A 1UZXB 3W1SA 1I35A 1WM2A 3NY5A 4L2YA 2M0XA 3VRBB 5HFYA 1CJEA 2KN4A 5E6OA 3Q8BA 3W9CB 2KD0A 3PRZA 1V97A 4HPLB 1EU3A 1F2RC 4K81A 4A9AA 1IGCA 3D32A 4HDOA 1ZKHA 4AP4C 2QEJC 2HJ1A 4WJPA 2WXOA 1OTRB 2C60A 2AWTA 4TSSA 4ZHPA 2N4FA 4LDTB 4BBNC 2O6VB 1YJJA 4DDGD 1WGKA 1WXAA 2W54A 3DDCB 4RGNA 1E8YA 4NY0A 1MJDA 2JWUA 2RDGA 3Q8AA 1XLQA 1SGHA 2MBBB 1L6VA 1BT0A 1WRIA 1AYFA 1V1PA 3RNCC 3RT3B 3DQVA 3QHTA 2KX3A 2RR9A 1CMXB 5GMVA 3MC9A 1SJHD 3ZNZB 2FAZA 5JHAA 2PIAA 1R4MB 2GLSA 2EKEC 4G11A 2CJOA 5C2TB 1IP9A 3ZXRA 3O13A 2V3SA 1MHXA 3BK1A 1N62A 3KUZA 4ITKA 4OVVA 3AE7B 5AZHA 5H92C 2KJHB 1YMHE 1VZ6A 2LHEA 3Q8CA 2O2VB 3BYYB 4GB9A 1TZ1A 2J52A 5D2MB 1KJTA 3RFZB 2KTFA 4US9A 1IYFA 3GE8C 4RF0A 3WCQA 1HA5A 3R2IA 4TQ0A 4IG7B 4XYCA 2WP9B 4QAYA 3Q3JA 3ZNHB 3U8ZA 1LM8B 4ANXA 1TYGB 4ZRJA 4EZLA 2BB5A 2INCC 3VQIA 3H7PA 2WXKA 4MELA 2DHZA 2NCNA 4W9IA 2AQ1B 3BIID 2BYVE 4KGRA 4FLHA 5IA7A 4W9HA 1P1AA 1ZDXA 5IKCM 1TKGA 1UWXA 1M4VA 1YJ1A 2D3CA 5DCNA 3BWUD 1RFAA 2MW5A 3ONSA 1YOVB 5E6NA 2X38A 2MBHA 1STEA 1N5XA 3P42A 3BZDB 2JZPA 2D3AA 4F8CB 1J0GA 3A33B 1V1OA 4WWNA 2PTLA 2J42A 3TEZA 2KWUB 2CHZA 3T9LA 1MI0A 1E6EB 4OVZA 2MSED 1K51A 1M94A 3KQ4A 3Q3FA 4BFRA 2BKFA 3MP9A 1UGMA 4ZRKA 2NMQA 4KGSA 1WH3A 1C9FA 4WAFA 2BWES 1MG8A 5HHDG 5AZFA 4C7YA 4O1NA 2ZPYA 4WAAA 2KMCA 4BKSA 3R7RA 4US8A 2XBBC 4LCDE 3MHSD 4GOCA 2BS3B 1HQRD 3RD2A 2KMMA 1NEKB 1WJUA 4ZHOA 3IFWB 3RNGC 5EE3A 2PKOA 3AE1B 1J7AA 2PPHA 4XE0A 3A9JA 3WAOA 1WM3A 2CJNA 1XQQA 1NVID 4GDLB 2V4IB 2ZW0A 4NZLB 3TL5A 2X8XX 2KQ4X 3KH0A 3GOEA 2JYEA 4CO7A 3IBEA 3M63B 2CU1A 3KYCD 4P7IA 4A3OA 2JQRB 3BVMA 1FCLA 1PYWD 1D3ZA 3MTNB 3DVGY 2V3NA 1R4NI 4HCNB 4ZOHC 2MJ3A 4F1SA 3NS1A 2WU2B 2KQ7A 4GXBA 1WXQA 3E56A 3P63A 2FE8A 1SEBD 3QARA 5BYQA 3QJZA 2MCNB 4LNNA 4G50A 4X57B 3NVYA 2WXNA 1YX6B 4IM0A 1HZ6A 2WX0A 4PS3A 5GXGB 4WWMA 3ZDMC 2GRIA 3NVVA 4W9LA 1T0SC 4M0WA 4UDUC 3OJ3A 5EDSA 4II2B 2JRHA 1VDVA 4EUTA 2LHDA 4IUMB 1HTQA 3AECB 1K50A 3B2GA 1EF1A 2K6DB 2FCSA 1XT9B 2DWQA 2DYMA 5IN7A 2FUG1 2NBUA 2AL6A 1T0YA 3DVNU 1DOIA 4ZRQA 1Q5WB 3UGBB 2OJRA 3T3OA 1EWCA 2LMCA 1A70A 1WX8A 4NAMA 2KT7A 1UH6A 4W9EA 3CF4A 4DDID 2C5LC 2WXIA 4MH0E 3UF8A 1T0RC 1F0ZA 1SE2A 3AE2B 1KLGD 2K1FA 2L76A 1K52A 1Z2MA 3P4SB 2L83A 4KGTA 1P3QU 4K1RB 3Q69A 1XEEA 1RFKA 4RGTA 2YLMA 1ZDVA 3I63C 3IG3A 5DPTA 2FCQA 2XNAC 3H7SA 4DBGA 4DHZB 2K25A 1UD7A 1J19A 5BMIA 3VR9B 1OQRA 1XF5L 4FHKA 4ZDVA 5LNK1 2NBWB 1XLPA 2G45B 1I4QA 3H8HA 1WJ4A 5DPRA 2FUHB 1E7VA 4IDIA 4F7ZA 1MG4A 2HDEA 4OZBA 3PLUA 2Z59B 4XX5A 1SSNA 2IGDA 4BKTA 4OHJA 2N7JA 1WWTA 3PO0A 3ZVVA 1E7UA 3ABVB 3N1ZC 2M56B 3TCAA 2MLBA 3APFA 1T5XD 4S17A 4XWTA 1FD6A 1ZP0B 1V49A 2B3AA 1FMAD 1WY8A 4YSXB 5D3IB 5D94A 4IM3A 2CS4A 3DHIC 4LLGM 1WF9A 1XD3B 2LXAA 2FIFA 3ZQ4A 2LJ5A 5HG2A 1WIAA 4JLCA 1C79A 2KTRB 5AUIA 2KLCA 1E8ZA 3ZNGC 2JT4B 1TIFA 4WJOA 5IOIA 2WXRA 3QA8A 2V3PA 2XN9C 3VVWB 4BOZB 3C19A 1YN4A 3TSSA 5C1ZA 3DBHI 3V6EB 1FXIA 2EELA 2L0TA 3NVWA 3JSVB 3AEFB 4YTNB 1JWSD 1KLUD 1DOYA 2PVGC 2PW9A 1TS4A 1YQBA 2D3GA 4HCPB 2KDBA 1QOGA 3AEDB 3TUOA 4MJSB 3HUIA 4N6EB 2ZEQA 1XCQL 2LVOA 4RMAA 4MGIE 3QX1A 3BY4B 2L32A 1TS2A 3O65B 3CSFA 2HE7A 1V6EA 4XDCA 1UNSA 1IUEA 3B1LX 3L54A 3W1SC 2D11A 3FAHA 1FPYA 2QILA 3PV1A 2KDIA 3CWIA 2IDYA 1MFWA 3RMKC 2LUMA 5BYSA 3DCGA 3WIMA 1D5ZC 3W5VB 2MJDA 2XK5A 2G1EA 1E8WA 2INPE 1T6BX 1SF0A 3HHMA 3Q3OC 2BF8B 4R3DA 3ZNID 5TSSA 4AS1A 2QDFA 2OEDA 3R2TA 3AN1A 2KLGA 3ZTCA 4KIKB 2K3UA 3EGRA 1TZOA 1BUIC 4FXCA 4Q2JA 1JALA 3L08A 3DHGC 2WDVB 3PGEA 1RRBA 2K9XA 3N20C 1H7WA 5CHFA 1OEYJ 1TBEA 1ZPSA 1XO3A 4OW0A 4CYEA 2RPVA 4YWGG 2WDTB 3AB5A 1WGDA 4EOYA 5I4DA 4IWPA 2I38A 4MM3B 2KKCA 2RSUA 3QAQA 4XC2A 3TBLD 3PVLA 5JHBA 1EF5A 4AJYB 2KC1A 1DOXA 1ZXIA 4PS8A 3VTWA 2EMTA 1V81A 3CMMB 3L17A 4DHJD 4KVGB 3BVGA 3B2FA 4HDQA 1QKZA 2MP2B 3LB8C 4LDTD 3VUYA 3IXSA 3TJPA 3KYDD 4LK0M 3OJ4B 1EWYC 3VUXA 1LQBA 4WIPA 1VZ7A 4PS7A 1JRPA 2L7RA 1H8CA 1P9DU 4ZRIA 4DWFA 4MSQB 1FRRA 4AOFA 1SE4A 3ECIA 2ZZPB 4LTUA 2Y5PA 3C8YA 3ZJVA 3IHPC 1RYJA 2N7DA 2L00B 1C76A 1V80A 1B9RA 2PVOD 4K7SA 4RM9A 1ZOYB 1IPGA 1S1QB 4AUQC 4IWQA 3UQBA 2J0KA 2J53A 2AQ2B 5TR5A 3S2AA 3VUWA 1K8RB 2WNMA 5JH5C 1ZW7A 4PK1A 2SAKA 1KOTA 1WYWB 5T8IA 3HRDD 1H4RA 5D7GA 2D3BA 3LJ3A 2M1MA 1IGDA 3AE3B 2JRIB 3AV8A 3I9V1 2DX5B 1NYRA 1YN5A 2QCZA 1OFFA 1B1ZA 2KC2A 2V0GA 2IJ0A 3LDZE 3Q14C 3RZWC 2KTRA 3Q3NC 3N9YC 4BKGA 2QC8A 3B9JA 1TKYA 2J0MA 1T0QC 1V5TA 4DQOC 3PZ7A 1OQQA 1L5PA 4AWJA 2AEHA 3FILB 2MJEA 1YIWA 3GB1A 3PHXB 3IT6B 3R8BA 5KHOA 2Y3AA 4HLEA 2LASA 4A20A 5LLIA 1L2NA 3OAWA 1JRUA 3PZDA 4YSZB 4GDLA 2K0PA 2WYQA 3AE8B 1FNVA 1N60A 4GN1A 1ZE3D 4YL8A 2DNFA 4YT0B 2YEPF 1J7BA 1L0XB 5FR3A 4NPNA 3TIXA 3Q3MC 4JL9A 3IAM1 4RGOS 5FK9C 2GBJA 1WXSA 3DWMA 3SDLC 5FR6A 1WJ6A 3BVZA 3AE4B 4OZCA 3PT2B 3RNEC 3A9KB 1FXTB 1E0ZA 3PTFC 4IW0A 4TQ1A 3TMPB 2FCNA 1GUAB 4FA6A 3U2SC 2KN5A 5AEKB 1WJNA 4NNJB 1PGAA 3LYYA 2WDRB 2JY6A 4DHZE 2NR2A 2WDQB 4YTMB 4A90A 3DBLI 2ZPNA 4ACFA 4EEWA 1J7CA 1V5OA 3PRMB 3WAMA 1FEHA 4EFOA 1WGHA 2AQ3B 5MPOA 2ZCCA 1UWMA 2DZJA 3UQAA 2H89B 4KSKC 3ZGZA 1AW7A 2SEBD 3BK2A 1WI0A 3QC8B 4CHKA 2VZKD 1FM0D 1TS3A 3AEEB 3JW0X 5C23A 1J8CA 3AE5B 3EECA 3RN9C 2MA9B 4JWSC 3V60A 4ASWC 3N3KB 4ARIA 3NJTA 1VZ8A 2BYFA 1P98A 2KDFB 5D3DA 2LGDA 2RDHA 1F52A 4RF1A 3PREA 2BS4B 2KK8A 1HTOA 2XK5B 1P7FA 2UWQA 2KWDA 4J3OD 4BKSD 3X0WA 5HKHA 2CHXA 1XLNA 4M02A 4DHJB 2BVCA 2TSSA 1F1HA 2GB1A 1E7PB 4L23A 3VXWA 1ESFA 3FKYA 3MHZA 2IYDB 4ZYSA 1LGRA 1Q1OA 3KWLA 4WH4A 5IO9A 5IP4D 3ZLZA 4L1BA 1WGRA 3UI3A 1HXYD 1JCKB 1C1YB 1VLBA 2NS5A 3U7ZA 2B76B 3OWEB 4REZA 1S3SG 2BW2A 4YSYB 2R2QA 3IVFA 3X23A 3DOWA 1WXMA 2J7QB 1D4BA 4I6LB 3VDZA 1FO4A 4WJNA 2KVZA 3AE6B 4N58A 1EUVB 2ICIA 1I42A 2VH1A 2IPKD 2INDC 2BT6A 2KAJA 1FCCC 3ETRA 5CX3A 4MJSA 1MHHE 2MHJA 4K3BA 3PLVA 3WALA 3SU8X 3V05A 4AQ7A 2UYZB 2ASQA 4KV2A 2AX5A 2UU7A 4FJVB 2AL3A 4MT5A 2WGSA 3KW5B 3VR8B 2IGGA 2KWCA 3L4PA 1L0VB 3ZJUA 2C7MB 4NAWB 1I4GA 4RM8A 4B0MA 2KVRA 2DBYA 2HD5B 3P4RB 2WWZA 4C00A 5L83A 5DPWA 4W9FA 1ACCA 1V9JA 1WGGA 2M17A 2W9NA 3UIPB 2NPTA 4C4VB 3MC8A 3ML9A 3GS2A 5FKAC 3R7QA 4GIVA 1V2YA 3ZRCA 2LRUA 2NVUI 2IY1B 4JPSA 2ZJDA 4B9KA 3H7PB 4P16A 2KOXA 2D07B 1I4RA 2LGXA 3Q8EA 3L16A 1WE6A 2N9LA 4B95A 2OJWA 1PFDA 2Z0EB 3GZNI 1QLBB 2K39A 1R4MI 2V9HA 2REXA 3JYUA 4A6QA 3M62B 1E90A 1WRDB 4I6NB 2JVCA 5HI1A 4ICUA 2Y5BB 1NYQA 2IGHA 2HJ8A 4IOIE 2LGSA 4EKUA 3NS8A 1KM7A 4KX6B 3SEBA 1LXDA 1ZGUB 4CQNA 4HRSA 4P1BC 1AN8A 3ML8A 3C0RB 4MM3A 2LEKA 3DWGC 3PPAA 1DYQA 1JWUD 4XZ4A 3WAPA 1WSPA 2C7HA 1Q0WB 3APDA 1PUTA 1FFUA 3RNFC 3FILA 2KJRA 1Z5SB 1CZPA 1V1PB 4EZJA 4IC7B 3QCAA 2WXQA 3W2DA 2D5GA 3HK0A 3VAWA 2AYOB 1KLVA 4HWIB 3ZO5B 4C56C 1WYGA 1RM6C 1NI2A 3AEBB 5G55A 2WX1A 4P6VF 4K7UA 1TY2A 2GBKA 2YVCA 1R7SA 4N9F4 1NI3A 1WX7A 1QT9A 1FNUA 4HVBA 2K8HA 4E74A 1OGWA 1L6UA 2H88B 1FNWA 4M0WB 1FFVA 5L95C 2V4LA 1FRDA 3APCA 3ENEA 5BYRA 3HM6X 1D6EC 3Q8FA 1ZXHA 3M95A 2N7EA 3U4EG 4C7ZA 2M4NA 2DAFA 3SFDB 4J6IA 2CHWA 2FBWB 1H7XA 2MWSB 1TTNA 1NBFC 3A1QB 3EA6A 1EU4A 1I4PA 2N9EB 4JE3B 3CSTA 4WQMA 1YX5B 4WQOB 3RYTA 5CHVC 3AI5A 4LJPB 3AU4A 4WWPA 4KZ0A 2N0SB 4MH8A 2XEWA 2YEPB 3CIRB 1KH0A 4I6PA 4PYZA 1SIJA 1YD8U 2MX2A 4HPMB 1E9MA 1XLOA 3ZKJC 5C3JB 1ET6A 3AULA 1WR6E 1VR9A 5EE0A 1GC6A 1P0RA 1C77A 2OOBB 4GGQA 2RGFA 3H1UA 2MEKA 5CTRC 3HVDA 4GSWA 1SE3A 4W9CA 4K7WA 2DYOA 3AU5A 2K5PA 2NBVB 3B08A 4E3CA 3K9OB 4JIOU 2BBCA 4PT5A 1VCBA 2FIDA 2M19A 1ROEA 3ZYYX 3I3TB 3SR6A 2LGIA 3RPFC 1P7EA 3DVNV 1ENFA 2WHIA 1QOAA 4LNFA 1YJIA 3RNAC 3RULA 4S0RA 2WLBA 1CK1A 3IAS1 3J9CA 4A8XC 1WZ0A 2Z0DB 4JQWC 2IBIB 1YQ4B 2PJHA 3E9SA 1OEYA 3BYTB 1PDXA 2G3QB 1UF0A 2R61A 4ICVA 2A4ZA 1WMHB 2LGYA 4A55A 2JUOA 2VH2A 4N59A 2JZZA 1C3TA 4NAWA 3PSEB 1R4NB 2LWPA 3U30A 2KFKB 5E6JA 1KRHA 1KFYB 2IO3B 1QQRA 2WXFA 2KQSA 2FNJB 1F9JA 2DYBA 2LFIA 4P1CC 3A9JB 5D6JB 1WFYA 3FC4A 2KXJA 4LNOA 4XDDA 4KKJA 4FADA 4KDLB 1WXVA 3V61A 3P2BA 1U4AA 1E5WA 2KO3A 4BVUC 4M00A 2I1JA 2LZ6A 1TJEA 2LVQA 2MBOA 2N9PC 2O2VA 3DBRB 1V8CA
chains in the Genus database with same CATH topology
3T3OA 1IBXB 1EWCA 1T3QA 1D5MC 2LMCA 1A70A 2W82A 1GTEA 1FEHA 4NAMA 4JWUC 3P1MA 2KACA 2AQ3B 3MFGA 5MPOA 4B0EA 1UWMA 3CF4A 2WXIA 2H89B 3ZGZA 1AW7A 2SEBD 3BK2A 2W55A 1L4ZB 2VZKD 1FM0D 1TS3A 1F0ZA 3AEEB 3SFEB 1SE2A 3AE2B 2QMTA 1KLGD 1I4HA 1K52A 2WU5B 3P4SB 2L83A 1TS5A 4TMAB 4KGTA 3AM9A 3AE5B 4JWSC 3KLSX 3Q69A 1XEEA 1RFKA 4HEA1 4RNAA 4RGTA 4ARIA 1YQ3B 1VZ8A 1JWBD 5G5GA 1ZDVA 1JMLA 2PLPA 5D3DA 1SB3C 2RDHA 1I7HA 4RF1A 2BS4B 2XNAC 1N5WA 1P7FA 2KWDA 2ZW1A 4USAA 4J3OD 5BMIA 3VR9B 1OQRA 1XF5L 5LNK1 1XLNA 4EE2A 2K22A 1XXGA 1XLPA 2TSSA 2WXPA 2GB1A 1E7PB 1I4QA 4L23A 3H8HA 1N61A 1ESFA 3MHZA 4ZYSA 1JROA 1QOFA 4IDIA 3KWLA 2HDEA 4OZBA 4WH4A 2ACZB 4ARCA 1UGJA 1GB1A 1GT8A 1VRAB 1SSNA 2IGDA 1C78A 4L1BA 3TEYA 3AH7A 3AMZA 5EE1A 1QF6A 4OHJA 1HXYD 3UI3A 2N7JA 1JCKB 2WXLA 1WWTA 1F2RI 3PO0A 1VLBA 3ABVB 1JWMD 2M56B 3TEWA 3VRAB 1KF6B 2WQYB 2VZKB 3U7ZA 1T5XD 1C4PA 2B76B 3GP7A 1MPEA 3NZ3A 4XWTA 3OWEB 4REZA 5JXVA 1FD6A 1ZP0B 4YSYB 2BW2A 3W1SA 1FMAD 4YSXB 5D3IB 1D4BA 4ZRPA 2J4XA 4L2YA 1HEZE 4LLGM 4IKGA 3ZQ4A 1FO4A 3VRBB 5HG2A 5HFYA 3AE6B 1CJEA 1JW9D 2KN4A 1D5XC 4N58A 2G9HD 2ICIA 1C79A 3Q8BA 5AUIA 3W9CB 2IPKD 2BS2B 2BT6A 2KAJA 3URYA 2M0AA 1V97A 1FCCC 2WXRA 2V3PA 2XN9C 3NRZA 3ETRA 1EU3A 1F2RC 4RGMA 4A9AA 1IGCA 4HJGE 1MHHE 2QEJC 1YN4A 2WXOA 3TSSA 3V05A 1ZUD2 4AQ7A 1FXIA 1GAQB 1SJED 2AX5A 2EELA 1PGXA 4TSSA 4MT5A 4ZHPA 3NVWA 3VR8B 2IGGA 3L4PA 3AEFB 2NTTA 4YTNB 2RMMA 1YJJA 1JWSD 1L0VB 1KLUD 3ZJUA 1WGKA 1DOYA 4NAWB 2W54A 1I4GA 2PVGC 4RGNA 4B0MA 3LXFA 2DBYA 2PW9A 1TS4A 3P4RB 1GTHA 1TY0A 3NUHB 1ACCA 1QOGA 3AEDB 3TEXA 3TUOA 2JWUA 2RDGA 1JQ4A 2L1AA 3HUIA 1XLQA 3Q8AA 4N6EB 1XCQL 1YN3A 2KDMA 1L6VA 3GS2A 5FKAC 1WRIA 1AYFA 1V1PA 4D2KA 2L32A 1TS2A 2E6XA 4JPSA 1Y56A 2CU3A 1FXAA 4XDCA 1UNSA 1IUEA 3HVZA 4P16A 4XWWA 1VJKA 1SJHD 1I4RA 3FAHA 3Q8EA 2QILA 1N63A 1UUPA 1JWAD 2N9LA 3CWIA 3PZ8A 2ON8A 2PIAA 3V3XA 2IDYA 2BYTA 2ONQA 1XCTL 2LUMA 5BYSA 1PFDA 2CJOA 1D5ZC 5C2TB 3W5VB 2MJDA 2G1EA 3O13A 4RH6A 1QLBB 1MHXA 1T6BX 2INPE 3BK1A 1SF0A 1N62A 4ITKA 3AE7B 4MACA 5H92C 4A6QA 4R3DA 1YMHE 5TSSA 5HI1A 4AS1A 1VZ6A 2LHEA 4WURA 1NYQA 3Q8CA 2IGHA 4IOIE 2OEDA 3BYYB 2J52A 4DXGA 3R2TA 1K53A 2JX5A 3RFZB 4KX6B 3AN1A 3SEBA 4US9A 4CQNA 4HRSA 1AN8A 4YTPB 4RF0A 2K3UA 3WCQA 2WS3B 1HA5A 2LEKA 3DWGC 1TZOA 3EGRA 3IT4B 1BUIC 1DYQA 3R2IA 1JWUD 4TQ0A 4FXCA 5H8YE 4Q2JA 1JALA 1WSPA 2WP9B 2WDVB 1PUTA 1FFUA 2K9XA 3AEGB 3FILA 1H7WA 1CZPA 1V1PB 2WXHA 3AEAB 3I57A 1ZPSA 1XO3A 2L52A 4OW0A 1C4CA 1TYGB 3AE9B 2WXQA 3W2DA 2BB5A 2RPVA 3VQIA 4YWGG 2D5GA 2WXKA 2MH7A 3AB5A 4C56C 1WYGA 2AQ1B 3BIID 1RM6C 5I4DA 4RFBA 2I38A 4MM3B 4KGRA 3NVZA 3AEBB 2OHFA 1HZ5A 1QILA 1ZDXA 1TKGA 1UWXA 1M4VA 4P6VF 2Z8LA 1L4DB 5AUKA 1TY2A 3BWUD 1DOXA 1ZXIA 1F77A 1R7SA 1NI3A 3ZJTA 3MJ5A 3BVGA 3B2FA 1KTKA 1QKZA 2X38A 3LB8C 3MC0B 1PGBA 1AWDA 1STEA 3IXSA 1QT9A 2QSDA 1FNUA 1GB4A 2E3TA 1N5XA 4LK0M 3P42A 1EWYC 3BZDB 1L0YB 1L6UA 2H88B 1FNWA 4RCOA 4WIPA 1FFVA 1VZ7A 2JZPA 4HKZE 1V1OA 1FRDA 4H2AA 5BYRA 1JRPA 1D6EC 2J42A 2PTLA 3Q8FA 1ZXHA 3TEZA 1QOBA 1YNTE 1FRRA 2BTEA 3U4EG 1SE4A 4C7ZA 4LTUA 4NJCA 2Y5PA 3C8YA 3ZJVA 1MI0A 3SFDB 2FBWB 2W3RA 1H7XA 1RYJA 1BMLC 1E6EB 1C76A 2WXMA 1B9RA 4OVZA 3U52E 3KQ4A 1K51A 2PVOD 3EA6A 1EU4A 1I4PA 3MP9A 1ZOYB 4JE3B 4WQMA 2NMQA 2J53A 4KGSA 2AQ2B 1C9FA 4GDKB 2N0SB 4GLSC 4KKIA 4MH8A 4WAFA 2YEPB 3CIRB 1KH0A 1SBBB 5HHDG 5G5HA 4C7YA 4O1NA 1SIJA 2WNMA 1E10A 1GPXA 1E9MA 1XLOA 2SAKA 4US8A 2GI9A 5C3JB 1LO5D 5T8IA 2BB6A 3HRDD 2NTSA 3EUB2 5D7GA 1ET6A 2WXGA 2BS3B 4HKQA 1VR9A 5EE0A 5BMGA 1DGJA 1C77A 1IGDA 3AE3B 1HQRD 3AV8A 3I9V1 2KMMA 1NYRA 1YN5A 2MEKA 1NEKB 1OFFA 1B1ZA 4ZHOA 2V0GA 2IJ0A 3HVDA 5EE3A 1SE3A 2PKOA 3AE1B 2HTME 1J7AA 4XE0A 2DYOA 2CJNA 1I4XA 3N9YC 4DXFA 1NVID 1IBXA 4GDLB 2K5PA 3P4QB 2V4IB 2ZW0A 2BBCA 1TKEA 4NZLB 4PT5A 3B9JA 5EE9A 2KQ4X 4OZAA 1TKYA 1GOZA 3W5UB 2JYEA 3PZ7A 2M19A 4DQOC 1ROEA 1OQQA 3ZYYX 1L5PA 3SR6A 3FILB 1MVKA 2LGIA 2MJEA 1P7EA 3RPFC 4C80A 3GB1A 1ENFA 3T3NA 1SXTA 3IT6B 2JSVX 2JQRB 3BVMA 3R8BA 1FCLA 1PYWD 2Y3AA 1QOAA 1NENB 1FIQA 3KWVA 1YJIA 2V3NA 2WLBA 4YSZB 4ZOHC 1CK1A 2MJ3A 3IAS1 2W3SA 3J9CA 4A8XC 2K0PA 1CQVA 2QIEB 3NS1A 3AE8B 1ET9A 1FNVA 2WU2B 1N60A 3P4PB 1WXQA 1ZE3D 2WXJA 4YT0B 1BXTA 1YQ4B 3E56A 3E9SA 3P63A 2LJIA 3BYTB 1PDXA 2YEPF 2FE8A 1J7BA 1SEBD 1L0XB 5BYQA 2R61A 2JXTA 2JU6X 1RWSA 2N9KA 4A55A 3NVYA 5FR3A 2WXNA 4N59A 1C4AA 1HZ6A 3IAM1 4RGOS 5FK9C 1Q10A 2Y5CA 1EM7A 5GXGB 4WWMA 3DWMA 5E6JA 1KRHA 1KFYB 2JYTA 2GRIA 3NVVA 3BVZA 1QQRA 2Q5WD 2WXFA 3AE4B 2INNE 4OZCA 2DLBA 2QJLA 2LFIA 4M0WA 2I2YA 4UDUC 1E0ZA 4TQ1A 4HROA 3FC4A 1VDVA 4XDDA 3U2SC 5BMHA 4KKJA 4YXDB 2LHDA 1PGAA 3AECB 1K50A 3LYYA 2WDRB 3B2GA 4JX1C 2DWQA 2DYMA 2WDQB 4YTMB 4A90A 1TJEA 2EKIA 2PMVA 2FUG1 1J7CA 1V8CA 1DOIA 4ZRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAJ A;  3AE3 B;  3AEG B;  2K9X A;  3AV8 A;  1V97 A;  1H7W A;  1T3Q A;  2KMM A;  1NYR A;  1CZP A;  3NRZ A;  1A70 A;  3ETR A;  4A9A A;  1NEK B;  1GTE A;  3AEA B;  3P1M A;  1OFF A;  4JWU C;  4ZHO A;  1XO3 A;  2L52 A;  5MPO A;  1UWM A;  3CF4 A;  5EE3 A;  2PKO A;  1TYG B;  3AE1 B;  1ZUD 2;  3AE9 B;  1J7A A;  2HTM E;  2H89 B;  1FXI A;  1GAQ B;  2W55 A;  2CJN A;  2MH7 A;  2AX5 A;  1FM0 D;  1NVI D;  3AB5 A;  2K5P A;  3P4Q B;  1WYG A;  1F0Z A;  4ZHP A;  1TKE A;  3BII D;  3AEE B;  3SFE B;  1RM6 C;  3AE2 B;  3B9J A;  3NVW A;  1TKY A;  3VR8 B;  3L4P A;  5EE9 A;  3AEF B;  4YTN B;  3NVZ A;  1YJJ A;  3AEB B;  2OHF A;  3W5U B;  2WU5 B;  1L0V B;  2M19 A;  3P4S B;  1ROE A;  1WGK A;  2L83 A;  1OQQ A;  1DOY A;  1TKG A;  3AM9 A;  2W54 A;  3AE5 B;  1L5P A;  4P6V F;  3ZYY X;  2PVG C;  4JWS C;  3SR6 A;  3LXF A;  2DBY A;  5AUK A;  2MJE A;  3RPF C;  1RFK A;  4C80 A;  3P4R B;  1DOX A;  1ZXI A;  1GTH A;  1R7S A;  1YQ3 B;  3AED B;  1QOG A;  1NI3 A;  1JWB D;  2JQR B;  1JQ4 A;  5G5G A;  3HUI A;  1XLQ A;  4N6E B;  1QOA A;  1NEN B;  1SB3 C;  1FIQ A;  3B2F A;  1I7H A;  3LB8 C;  1YJI A;  2BS4 B;  1AWD A;  1L6V A;  2WLB A;  1N5W A;  4YSZ B;  4ZOH C;  2MJ3 A;  1QT9 A;  1WRI A;  2W3S A;  2BT6 A;  1AYF A;  3NS1 A;  2QIE B;  3AE8 B;  2E3T A;  1N5X A;  2WU2 B;  4USA A;  1N60 A;  3VR9 B;  3P4P B;  1OQR A;  1WXQ A;  4YT0 B;  1YQ4 B;  3P63 A;  1EWY C;  1PDX A;  1L6U A;  1XLN A;  2CU3 A;  2H88 B;  1J7B A;  1FXA A;  1IUE A;  3HVZ A;  2K22 A;  1FFV A;  1XLP A;  1VJK A;  1RWS A;  3FAH A;  1E7P B;  1FRD A;  1JRP A;  1N63 A;  1JWA D;  3NVY A;  1N61 A;  3CWI A;  2PIA A;  4N59 A;  1JRO A;  1QOB A;  1QOF A;  1FRR A;  4IDI A;  4C7Z A;  4LTU A;  1PFD A;  2Y5C A;  2CJO A;  3KWL A;  2ACZ B;  5C2T B;  5GXG B;  3W5V B;  2MJD A;  3SFD B;  3DWM A;  4WWM A;  2FBW B;  2W3R A;  2G1E A;  1H7X A;  1KRH A;  1KFY B;  1RYJ A;  1GT8 A;  1QLB B;  1E6E B;  3NVV A;  2Q5W D;  1B9R A;  3AE4 B;  1SF0 A;  3AH7 A;  3AMZ A;  2PVO D;  5EE1 A;  1QF6 A;  1N62 A;  4ITK A;  3AE7 B;  1WWT A;  2QJL A;  1ZOY B;  5H92 C;  3PO0 A;  1VLB A;  4WQM A;  3ABV B;  2M56 B;  3VRA B;  1KF6 B;  1E0Z A;  2WQY B;  4HRO A;  2N0S B;  3FC4 A;  1VDV A;  1NYQ A;  3CIR B;  2B76 B;  4YXD B;  5G5H A;  4C7Y A;  1SIJ A;  1ZP0 B;  4YSY B;  1E10 A;  2JX5 A;  3AEC B;  4KX6 B;  3AN1 A;  4US9 A;  1FMA D;  1GPX A;  2WDR B;  4YSX B;  1E9M A;  1XLO A;  3B2G A;  4HRS A;  4US8 A;  4YTP B;  4JX1 C;  5C3J B;  2DWQ A;  2WDQ B;  4YTM B;  1TJE A;  3HRD D;  3EUB 2;  2WS3 B;  2LEK A;  3DWG C;  3WCQ A;  1FO4 A;  2EKI A;  3VRB B;  3AE6 B;  1CJE A;  1J7C A;  1JW9 D;  4FXC A;  5H8Y E;  1JAL A;  2BS3 B;  4N58 A;  1V8C A;  5EE0 A;  1DOI A;  2WP9 B;  2WDV B;  5AUI A;  3W9C B;  2BS2 B;  1DGJ A;  1PUT A;  1FFU A; 
#chains in the Genus database with same CATH topology
 2R2O A;  1RAX A;  1N6Z A;  4EZK A;  2W82 A;  1GTE A;  4K3C A;  3P1M A;  4B0E A;  2LXC A;  4II3 B;  2NPT B;  4C4V A;  3EFC A;  2W55 A;  1L4Z B;  2N1W A;  3SFE B;  1WX9 A;  1TT5 B;  4DXA B;  2WU5 B;  3MJW A;  2DAJ A;  1TS5 A;  4TMA B;  3BIN A;  3ZW3 A;  4W9K A;  3EFU A;  1HE8 A;  2L8J A;  2ZCB A;  4HJK A;  4KZC A;  3NZU A;  3N30 A;  1YQ3 B;  1JWB D;  4W9J A;  1JML A;  2PLP A;  1SB3 C;  1NDD A;  1N5W A;  2JZ3 B;  4B6W A;  2KMA A;  1G6J A;  1XXG A;  4GDK A;  1N61 A;  1JRO A;  1QOF A;  4JGH B;  4ANV A;  4ARC A;  2BWF A;  4FN2 A;  1GT8 A;  4A3P A;  4KSL C;  2DEN B;  4FUL A;  3AH7 A;  3AMZ A;  3WAN A;  1F2R I;  1UBQ A;  4GMV A;  1UBI A;  4XGA B;  2PEA A;  2PE6 B;  2WQY B;  1ISN A;  5JXV A;  5CHW A;  4MSM B;  3DBR I;  5G2N A;  3A1Q A;  4ANU A;  3KUD B;  3ZDT A;  2DZI A;  4LNK A;  2G4D B;  4ZRP A;  2J4X A;  2PE9 A;  1HEZ E;  3WA0 A;  3DHH C;  4IKG A;  2IO2 B;  2A5U A;  2KNB A;  1JW9 D;  3L13 A;  1D5X C;  2N9X A;  2G9H D;  2BS2 B;  3RZF A;  3URY A;  2M0A A;  4GU2 A;  3NRZ A;  4RGM A;  2KZR A;  4HJG E;  3QQ8 B;  4KDI C;  2JXX A;  1ZUD 2;  2RD0 A;  2MP2 A;  1GAQ B;  1SJE D;  1PGX A;  1VD2 A;  3ZIM A;  2NTT A;  2RMM A;  1A5R A;  2BQQ A;  3Q6B A;  4FJZ A;  1QZE A;  3LXF A;  2JWZ A;  1GTH A;  1TY0 A;  3I5J C;  3NUH B;  4MDK E;  1UEL A;  3HM3 A;  2BGF A;  3TEX A;  1JQ4 A;  2L1A A;  1YN3 A;  2KDM A;  2MBQ A;  5BO4 B;  3K9P B;  2L0F A;  3PS6 A;  2DZM A;  3NHE B;  4D2K A;  3R3M A;  2E6X A;  1Y56 A;  2KAN A;  4IWO A;  2CU3 A;  3Q2A C;  1FXA A;  3HVZ A;  4MGZ E;  4XWW A;  3A9K A;  1VJK A;  3GE3 C;  1OQY A;  3NOB A;  4WJQ A;  3M3J A;  1N63 A;  1UUP A;  1JWA D;  2ZVO A;  3PZ8 A;  2ON8 A;  3V3X A;  1GNU A;  2BYT A;  1E8X A;  4DK5 A;  2ONQ A;  4NQK E;  3SD5 A;  1XCT L;  2CKH B;  1WMH A;  4RH6 A;  2GBR A;  3UIN B;  2IO1 B;  3NG0 A;  2KFJ A;  4MAC A;  4AJW A;  2CR5 A;  4BZA A;  3OG5 A;  3PRP B;  4WUR A;  3JSV A;  2QHO A;  1V86 A;  4DXG A;  1K53 A;  2JX5 A;  2C7N B;  1Y8R C;  2D10 A;  4YTP B;  5J2R A;  1WR1 A;  1AAR A;  2WS3 B;  2LI5 A;  3DVG X;  3U7D A;  3IT4 B;  5H8Y E;  1SIF A;  4MGK E;  3AEG B;  3N1X C;  2WXH A;  4TUU A;  3AEA B;  3I57 A;  2L52 A;  1C4C A;  3RCZ A;  3AE9 B;  5AZG A;  3SHQ A;  5E6P A;  2MH7 A;  2LUE A;  2L05 A;  4NJ6 A;  4RFB A;  4G3X B;  3NVZ A;  2OHF A;  1HZ5 A;  1QIL A;  2KJ6 A;  4BBN F;  2BPS A;  4E71 A;  2LRW A;  2Z8L A;  1L4D B;  5AUK A;  4OVU A;  1F77 A;  3ZJT A;  3MJ5 A;  2V1Y A;  1KTK A;  3MC0 B;  1PGB A;  1AWD A;  2QSD A;  5KHQ A;  2KFK A;  1GB4 A;  2E3T A;  3DBL B;  1L0Y B;  4M8M A;  4BOS C;  4RCO A;  2GBM A;  4HKZ E;  4H2A A;  1QOB A;  2HTH A;  1YNT E;  2BTE A;  4NJC A;  3EC8 A;  2EMS A;  4HPP A;  2W3R A;  4WWO A;  1BML C;  2WXM A;  3U52 E;  3L0W B;  3H6N A;  4FBJ B;  3KUC B;  4GDK B;  4KKI A;  4GLS C;  3ZUN A;  4IM2 A;  1SBB B;  3DBH B;  5G5H A;  2K8C A;  1LFD A;  4LNI A;  3RNB C;  2LVP A;  1E10 A;  1PQS A;  1GPX A;  1TGZ B;  2ZNV C;  2GI9 A;  1LO5 D;  2BB6 A;  2NTS A;  3EUB 2;  2WXG A;  4HKQ A;  4URK A;  5BMG A;  2D2Q A;  2DZK A;  3V6C B;  1DGJ A;  3CF6 E;  2O6V A;  2MBE A;  4MEM A;  3B0A A;  2BYE A;  3H9D A;  5J17 A;  2HTM E;  2G4S A;  2MRP A;  4DXF A;  1I4X A;  1IBX A;  3P4Q B;  3GZN B;  1TKE A;  5EE9 A;  5J18 A;  4OZA A;  4TV3 A;  1GOZ A;  3W5U B;  3R66 C;  2GMI C;  2KX0 A;  1MVK A;  4C80 A;  3T3N A;  1SXT A;  2JSV X;  3A4S C;  5DPS A;  4MGY E;  1NEN B;  1FIQ A;  2IZV B;  3KWV A;  2RDB C;  3ZXV A;  2W3S A;  1CQV A;  2QIE B;  2FCM A;  2K8B A;  1ET9 A;  3P4P B;  2WXJ A;  1BXT A;  2LJI A;  1WZ3 A;  2JXT A;  2JU6 X;  1RWS A;  2N9K A;  4BAX A;  4NQL B;  3VH4 B;  1C4A A;  4NJ7 A;  1Q10 A;  2Y5C A;  1EM7 A;  3RI7 C;  2L3Z A;  4FJY A;  4PYU A;  2JYT A;  2Q5W D;  4TKN A;  2INN E;  1RLF A;  2DLB A;  2GOW A;  5LXH A;  4W9D A;  2QJL A;  2ZVN A;  3VTV A;  2I2Y A;  2GBN A;  3HIZ A;  2BKR B;  3L10 B;  4HRO A;  4LJO B;  5BMH A;  4YXD B;  3VTU A;  2VRR B;  3UIO B;  3ZTD A;  1L7Y A;  4JX1 C;  3T8M A;  4HK2 A;  2EKI A;  2MQJ A;  2PMV A;  3N32 A;  2I1K A;  4ANW A;  2J0J A;  1IBX B;  2KDE B;  1T3Q A;  1D5M C;  2JPH A;  3JVZ X;  5IAA C;  4JWU C;  2KAC A;  3MFG A;  3QIJ A;  3ZRF A;  3EHV A;  3ALB A;  2KWV B;  2ZNV B;  3W1Y A;  3AXC A;  1GJZ A;  2QMT A;  3VHT C;  4W9G A;  1I4H A;  3OLM D;  3DBS A;  3AM9 A;  2LD9 A;  3KLS X;  1EO6 A;  2O6V D;  4HEA 1;  1WGY A;  4RNA A;  2KHW B;  3RUI B;  3V62 A;  1SE9 A;  2JF5 A;  5G5G A;  3VFK A;  4M8N A;  4HXD A;  1I7H A;  5JZE B;  2RPQ A;  4FHJ A;  3N1Y C;  2K6Q A;  2IO0 B;  2ZW1 A;  4USA A;  5LXI B;  2M8S A;  4EE2 A;  2KYW A;  2K22 A;  3DPD A;  2WXP A;  1GG3 A;  3VH3 B;  3NZS A;  3QWZ B;  2N1V A;  2IY0 B;  4G0N B;  3QK0 A;  2ACZ B;  1UGJ A;  4KIK A;  1GB1 A;  3PHW B;  1VRA B;  3TEY A;  1C78 A;  4M01 A;  1GC7 A;  5EE1 A;  1QF6 A;  3KVF B;  2WXL A;  2C9W B;  3A4R A;  1JWM D;  1X1M A;  3TEW A;  3VRA B;  1KF6 B;  2VZK B;  4ZYN A;  1C4P A;  1WE7 A;  3GP7 A;  1MPE A;  3NZ3 A;  1UZX B;  3W1S A;  1I35 A;  1WM2 A;  3NY5 A;  4L2Y A;  2M0X A;  3VRB B;  5HFY A;  1CJE A;  2KN4 A;  5E6O A;  3Q8B A;  3W9C B;  2KD0 A;  3PRZ A;  1V97 A;  4HPL B;  1EU3 A;  1F2R C;  4K81 A;  4A9A A;  1IGC A;  3D32 A;  4HDO A;  1ZKH A;  4AP4 C;  2QEJ C;  2HJ1 A;  4WJP A;  2WXO A;  1OTR B;  2C60 A;  2AWT A;  4TSS A;  4ZHP A;  2N4F A;  4LDT B;  4BBN C;  2O6V B;  1YJJ A;  4DDG D;  1WGK A;  1WXA A;  2W54 A;  3DDC B;  4RGN A;  1E8Y A;  4NY0 A;  1MJD A;  2JWU A;  2RDG A;  3Q8A A;  1XLQ A;  1SGH A;  2MBB B;  1L6V A;  1BT0 A;  1WRI A;  1AYF A;  1V1P A;  3RNC C;  3RT3 B;  3DQV A;  3QHT A;  2KX3 A;  2RR9 A;  1CMX B;  5GMV A;  3MC9 A;  1SJH D;  3ZNZ B;  2FAZ A;  5JHA A;  2PIA A;  1R4M B;  2GLS A;  2EKE C;  4G11 A;  2CJO A;  5C2T B;  1IP9 A;  3ZXR A;  3O13 A;  2V3S A;  1MHX A;  3BK1 A;  1N62 A;  3KUZ A;  4ITK A;  4OVV A;  3AE7 B;  5AZH A;  5H92 C;  2KJH B;  1YMH E;  1VZ6 A;  2LHE A;  3Q8C A;  2O2V B;  3BYY B;  4GB9 A;  1TZ1 A;  2J52 A;  5D2M B;  1KJT A;  3RFZ B;  2KTF A;  4US9 A;  1IYF A;  3GE8 C;  4RF0 A;  3WCQ A;  1HA5 A;  3R2I A;  4TQ0 A;  4IG7 B;  4XYC A;  2WP9 B;  4QAY A;  3Q3J A;  3ZNH B;  3U8Z A;  1LM8 B;  4ANX A;  1TYG B;  4ZRJ A;  4EZL A;  2BB5 A;  2INC C;  3VQI A;  3H7P A;  2WXK A;  4MEL A;  2DHZ A;  2NCN A;  4W9I A;  2AQ1 B;  3BII D;  2BYV E;  4KGR A;  4FLH A;  5IA7 A;  4W9H A;  1P1A A;  1ZDX A;  5IKC M;  1TKG A;  1UWX A;  1M4V A;  1YJ1 A;  2D3C A;  5DCN A;  3BWU D;  1RFA A;  2MW5 A;  3ONS A;  1YOV B;  5E6N A;  2X38 A;  2MBH A;  1STE A;  1N5X A;  3P42 A;  3BZD B;  2JZP A;  2D3A A;  4F8C B;  1J0G A;  3A33 B;  1V1O A;  4WWN A;  2PTL A;  2J42 A;  3TEZ A;  2KWU B;  2CHZ A;  3T9L A;  1MI0 A;  1E6E B;  4OVZ A;  2MSE D;  1K51 A;  1M94 A;  3KQ4 A;  3Q3F A;  4BFR A;  2BKF A;  3MP9 A;  1UGM A;  4ZRK A;  2NMQ A;  4KGS A;  1WH3 A;  1C9F A;  4WAF A;  2BWE S;  1MG8 A;  5HHD G;  5AZF A;  4C7Y A;  4O1N A;  2ZPY A;  4WAA A;  2KMC A;  4BKS A;  3R7R A;  4US8 A;  2XBB C;  4LCD E;  3MHS D;  4GOC A;  2BS3 B;  1HQR D;  3RD2 A;  2KMM A;  1NEK B;  1WJU A;  4ZHO A;  3IFW B;  3RNG C;  5EE3 A;  2PKO A;  3AE1 B;  1J7A A;  2PPH A;  4XE0 A;  3A9J A;  3WAO A;  1WM3 A;  2CJN A;  1XQQ A;  1NVI D;  4GDL B;  2V4I B;  2ZW0 A;  4NZL B;  3TL5 A;  2X8X X;  2KQ4 X;  3KH0 A;  3GOE A;  2JYE A;  4CO7 A;  3IBE A;  3M63 B;  2CU1 A;  3KYC D;  4P7I A;  4A3O A;  2JQR B;  3BVM A;  1FCL A;  1PYW D;  1D3Z A;  3MTN B;  3DVG Y;  2V3N A;  1R4N I;  4HCN B;  4ZOH C;  2MJ3 A;  4F1S A;  3NS1 A;  2WU2 B;  2KQ7 A;  4GXB A;  1WXQ A;  3E56 A;  3P63 A;  2FE8 A;  1SEB D;  3QAR A;  5BYQ A;  3QJZ A;  2MCN B;  4LNN A;  4G50 A;  4X57 B;  3NVY A;  2WXN A;  1YX6 B;  4IM0 A;  1HZ6 A;  2WX0 A;  4PS3 A;  5GXG B;  4WWM A;  3ZDM C;  2GRI A;  3NVV A;  4W9L A;  1T0S C;  4M0W A;  4UDU C;  3OJ3 A;  5EDS A;  4II2 B;  2JRH A;  1VDV A;  4EUT A;  2LHD A;  4IUM B;  1HTQ A;  3AEC B;  1K50 A;  3B2G A;  1EF1 A;  2K6D B;  2FCS A;  1XT9 B;  2DWQ A;  2DYM A;  5IN7 A;  2FUG 1;  2NBU A;  2AL6 A;  1T0Y A;  3DVN U;  1DOI A;  4ZRQ A;  1Q5W B;  3UGB B;  2OJR A;  3T3O A;  1EWC A;  2LMC A;  1A70 A;  1WX8 A;  4NAM A;  2KT7 A;  1UH6 A;  4W9E A;  3CF4 A;  4DDI D;  2C5L C;  2WXI A;  4MH0 E;  3UF8 A;  1T0R C;  1F0Z A;  1SE2 A;  3AE2 B;  1KLG D;  2K1F A;  2L76 A;  1K52 A;  1Z2M A;  3P4S B;  2L83 A;  4KGT A;  1P3Q U;  4K1R B;  3Q69 A;  1XEE A;  1RFK A;  4RGT A;  2YLM A;  1ZDV A;  3I63 C;  3IG3 A;  5DPT A;  2FCQ A;  2XNA C;  3H7S A;  4DBG A;  4DHZ B;  2K25 A;  1UD7 A;  1J19 A;  5BMI A;  3VR9 B;  1OQR A;  1XF5 L;  4FHK A;  4ZDV A;  5LNK 1;  2NBW B;  1XLP A;  2G45 B;  1I4Q A;  3H8H A;  1WJ4 A;  5DPR A;  2FUH B;  1E7V A;  4IDI A;  4F7Z A;  1MG4 A;  2HDE A;  4OZB A;  3PLU A;  2Z59 B;  4XX5 A;  1SSN A;  2IGD A;  4BKT A;  4OHJ A;  2N7J A;  1WWT A;  3PO0 A;  3ZVV A;  1E7U A;  3ABV B;  3N1Z C;  2M56 B;  3TCA A;  2MLB A;  3APF A;  1T5X D;  4S17 A;  4XWT A;  1FD6 A;  1ZP0 B;  1V49 A;  2B3A A;  1FMA D;  1WY8 A;  4YSX B;  5D3I B;  5D94 A;  4IM3 A;  2CS4 A;  3DHI C;  4LLG M;  1WF9 A;  1XD3 B;  2LXA A;  2FIF A;  3ZQ4 A;  2LJ5 A;  5HG2 A;  1WIA A;  4JLC A;  1C79 A;  2KTR B;  5AUI A;  2KLC A;  1E8Z A;  3ZNG C;  2JT4 B;  1TIF A;  4WJO A;  5IOI A;  2WXR A;  3QA8 A;  2V3P A;  2XN9 C;  3VVW B;  4BOZ B;  3C19 A;  1YN4 A;  3TSS A;  5C1Z A;  3DBH I;  3V6E B;  1FXI A;  2EEL A;  2L0T A;  3NVW A;  3JSV B;  3AEF B;  4YTN B;  1JWS D;  1KLU D;  1DOY A;  2PVG C;  2PW9 A;  1TS4 A;  1YQB A;  2D3G A;  4HCP B;  2KDB A;  1QOG A;  3AED B;  3TUO A;  4MJS B;  3HUI A;  4N6E B;  2ZEQ A;  1XCQ L;  2LVO A;  4RMA A;  4MGI E;  3QX1 A;  3BY4 B;  2L32 A;  1TS2 A;  3O65 B;  3CSF A;  2HE7 A;  1V6E A;  4XDC A;  1UNS A;  1IUE A;  3B1L X;  3L54 A;  3W1S C;  2D11 A;  3FAH A;  1FPY A;  2QIL A;  3PV1 A;  2KDI A;  3CWI A;  2IDY A;  1MFW A;  3RMK C;  2LUM A;  5BYS A;  3DCG A;  3WIM A;  1D5Z C;  3W5V B;  2MJD A;  2XK5 A;  2G1E A;  1E8W A;  2INP E;  1T6B X;  1SF0 A;  3HHM A;  3Q3O C;  2BF8 B;  4R3D A;  3ZNI D;  5TSS A;  4AS1 A;  2QDF A;  2OED A;  3R2T A;  3AN1 A;  2KLG A;  3ZTC A;  4KIK B;  2K3U A;  3EGR A;  1TZO A;  1BUI C;  4FXC A;  4Q2J A;  1JAL A;  3L08 A;  3DHG C;  2WDV B;  3PGE A;  1RRB A;  2K9X A;  3N20 C;  1H7W A;  5CHF A;  1OEY J;  1TBE A;  1ZPS A;  1XO3 A;  4OW0 A;  4CYE A;  2RPV A;  4YWG G;  2WDT B;  3AB5 A;  1WGD A;  4EOY A;  5I4D A;  4IWP A;  2I38 A;  4MM3 B;  2KKC A;  2RSU A;  3QAQ A;  4XC2 A;  3TBL D;  3PVL A;  5JHB A;  1EF5 A;  4AJY B;  2KC1 A;  1DOX A;  1ZXI A;  4PS8 A;  3VTW A;  2EMT A;  1V81 A;  3CMM B;  3L17 A;  4DHJ D;  4KVG B;  3BVG A;  3B2F A;  4HDQ A;  1QKZ A;  2MP2 B;  3LB8 C;  4LDT D;  3VUY A;  3IXS A;  3TJP A;  3KYD D;  4LK0 M;  3OJ4 B;  1EWY C;  3VUX A;  1LQB A;  4WIP A;  1VZ7 A;  4PS7 A;  1JRP A;  2L7R A;  1H8C A;  1P9D U;  4ZRI A;  4DWF A;  4MSQ B;  1FRR A;  4AOF A;  1SE4 A;  3ECI A;  2ZZP B;  4LTU A;  2Y5P A;  3C8Y A;  3ZJV A;  3IHP C;  1RYJ A;  2N7D A;  2L00 B;  1C76 A;  1V80 A;  1B9R A;  2PVO D;  4K7S A;  4RM9 A;  1ZOY B;  1IPG A;  1S1Q B;  4AUQ C;  4IWQ A;  3UQB A;  2J0K A;  2J53 A;  2AQ2 B;  5TR5 A;  3S2A A;  3VUW A;  1K8R B;  2WNM A;  5JH5 C;  1ZW7 A;  4PK1 A;  2SAK A;  1KOT A;  1WYW B;  5T8I A;  3HRD D;  1H4R A;  5D7G A;  2D3B A;  3LJ3 A;  2M1M A;  1IGD A;  3AE3 B;  2JRI B;  3AV8 A;  3I9V 1;  2DX5 B;  1NYR A;  1YN5 A;  2QCZ A;  1OFF A;  1B1Z A;  2KC2 A;  2V0G A;  2IJ0 A;  3LDZ E;  3Q14 C;  3RZW C;  2KTR A;  3Q3N C;  3N9Y C;  4BKG A;  2QC8 A;  3B9J A;  1TKY A;  2J0M A;  1T0Q C;  1V5T A;  4DQO C;  3PZ7 A;  1OQQ A;  1L5P A;  4AWJ A;  2AEH A;  3FIL B;  2MJE A;  1YIW A;  3GB1 A;  3PHX B;  3IT6 B;  3R8B A;  5KHO A;  2Y3A A;  4HLE A;  2LAS A;  4A20 A;  5LLI A;  1L2N A;  3OAW A;  1JRU A;  3PZD A;  4YSZ B;  4GDL A;  2K0P A;  2WYQ A;  3AE8 B;  1FNV A;  1N60 A;  4GN1 A;  1ZE3 D;  4YL8 A;  2DNF A;  4YT0 B;  2YEP F;  1J7B A;  1L0X B;  5FR3 A;  4NPN A;  3TIX A;  3Q3M C;  4JL9 A;  3IAM 1;  4RGO S;  5FK9 C;  2GBJ A;  1WXS A;  3DWM A;  3SDL C;  5FR6 A;  1WJ6 A;  3BVZ A;  3AE4 B;  4OZC A;  3PT2 B;  3RNE C;  3A9K B;  1FXT B;  1E0Z A;  3PTF C;  4IW0 A;  4TQ1 A;  3TMP B;  2FCN A;  1GUA B;  4FA6 A;  3U2S C;  2KN5 A;  5AEK B;  1WJN A;  4NNJ B;  1PGA A;  3LYY A;  2WDR B;  2JY6 A;  4DHZ E;  2NR2 A;  2WDQ B;  4YTM B;  4A90 A;  3DBL I;  2ZPN A;  4ACF A;  4EEW A;  1J7C A;  1V5O A;  3PRM B;  3WAM A;  1FEH A;  4EFO A;  1WGH A;  2AQ3 B;  5MPO A;  2ZCC A;  1UWM A;  2DZJ A;  3UQA A;  2H89 B;  4KSK C;  3ZGZ A;  1AW7 A;  2SEB D;  3BK2 A;  1WI0 A;  3QC8 B;  4CHK A;  2VZK D;  1FM0 D;  1TS3 A;  3AEE B;  3JW0 X;  5C23 A;  1J8C A;  3AE5 B;  3EEC A;  3RN9 C;  2MA9 B;  4JWS C;  3V60 A;  4ASW C;  3N3K B;  4ARI A;  3NJT A;  1VZ8 A;  2BYF A;  1P98 A;  2KDF B;  5D3D A;  2LGD A;  2RDH A;  1F52 A;  4RF1 A;  3PRE A;  2BS4 B;  2KK8 A;  1HTO A;  2XK5 B;  1P7F A;  2UWQ A;  2KWD A;  4J3O D;  4BKS D;  3X0W A;  5HKH A;  2CHX A;  1XLN A;  4M02 A;  4DHJ B;  2BVC A;  2TSS A;  1F1H A;  2GB1 A;  1E7P B;  4L23 A;  3VXW A;  1ESF A;  3FKY A;  3MHZ A;  2IYD B;  4ZYS A;  1LGR A;  1Q1O A;  3KWL A;  4WH4 A;  5IO9 A;  5IP4 D;  3ZLZ A;  4L1B A;  1WGR A;  3UI3 A;  1HXY D;  1JCK B;  1C1Y B;  1VLB A;  2NS5 A;  3U7Z A;  2B76 B;  3OWE B;  4REZ A;  1S3S G;  2BW2 A;  4YSY B;  2R2Q A;  3IVF A;  3X23 A;  3DOW A;  1WXM A;  2J7Q B;  1D4B A;  4I6L B;  3VDZ A;  1FO4 A;  4WJN A;  2KVZ A;  3AE6 B;  4N58 A;  1EUV B;  2ICI A;  1I42 A;  2VH1 A;  2IPK D;  2IND C;  2BT6 A;  2KAJ A;  1FCC C;  3ETR A;  5CX3 A;  4MJS A;  1MHH E;  2MHJ A;  4K3B A;  3PLV A;  3WAL A;  3SU8 X;  3V05 A;  4AQ7 A;  2UYZ B;  2ASQ A;  4KV2 A;  2AX5 A;  2UU7 A;  4FJV B;  2AL3 A;  4MT5 A;  2WGS A;  3KW5 B;  3VR8 B;  2IGG A;  2KWC A;  3L4P A;  1L0V B;  3ZJU A;  2C7M B;  4NAW B;  1I4G A;  4RM8 A;  4B0M A;  2KVR A;  2DBY A;  2HD5 B;  3P4R B;  2WWZ A;  4C00 A;  5L83 A;  5DPW A;  4W9F A;  1ACC A;  1V9J A;  1WGG A;  2M17 A;  2W9N A;  3UIP B;  2NPT A;  4C4V B;  3MC8 A;  3ML9 A;  3GS2 A;  5FKA C;  3R7Q A;  4GIV A;  1V2Y A;  3ZRC A;  2LRU A;  2NVU I;  2IY1 B;  4JPS A;  2ZJD A;  4B9K A;  3H7P B;  4P16 A;  2KOX A;  2D07 B;  1I4R A;  2LGX A;  3Q8E A;  3L16 A;  1WE6 A;  2N9L A;  4B95 A;  2OJW A;  1PFD A;  2Z0E B;  3GZN I;  1QLB B;  2K39 A;  1R4M I;  2V9H A;  2REX A;  3JYU A;  4A6Q A;  3M62 B;  1E90 A;  1WRD B;  4I6N B;  2JVC A;  5HI1 A;  4ICU A;  2Y5B B;  1NYQ A;  2IGH A;  2HJ8 A;  4IOI E;  2LGS A;  4EKU A;  3NS8 A;  1KM7 A;  4KX6 B;  3SEB A;  1LXD A;  1ZGU B;  4CQN A;  4HRS A;  4P1B C;  1AN8 A;  3ML8 A;  3C0R B;  4MM3 A;  2LEK A;  3DWG C;  3PPA A;  1DYQ A;  1JWU D;  4XZ4 A;  3WAP A;  1WSP A;  2C7H A;  1Q0W B;  3APD A;  1PUT A;  1FFU A;  3RNF C;  3FIL A;  2KJR A;  1Z5S B;  1CZP A;  1V1P B;  4EZJ A;  4IC7 B;  3QCA A;  2WXQ A;  3W2D A;  2D5G A;  3HK0 A;  3VAW A;  2AYO B;  1KLV A;  4HWI B;  3ZO5 B;  4C56 C;  1WYG A;  1RM6 C;  1NI2 A;  3AEB B;  5G55 A;  2WX1 A;  4P6V F;  4K7U A;  1TY2 A;  2GBK A;  2YVC A;  1R7S A;  4N9F 4;  1NI3 A;  1WX7 A;  1QT9 A;  1FNU A;  4HVB A;  2K8H A;  4E74 A;  1OGW A;  1L6U A;  2H88 B;  1FNW A;  4M0W B;  1FFV A;  5L95 C;  2V4L A;  1FRD A;  3APC A;  3ENE A;  5BYR A;  3HM6 X;  1D6E C;  3Q8F A;  1ZXH A;  3M95 A;  2N7E A;  3U4E G;  4C7Z A;  2M4N A;  2DAF A;  3SFD B;  4J6I A;  2CHW A;  2FBW B;  1H7X A;  2MWS B;  1TTN A;  1NBF C;  3A1Q B;  3EA6 A;  1EU4 A;  1I4P A;  2N9E B;  4JE3 B;  3CST A;  4WQM A;  1YX5 B;  4WQO B;  3RYT A;  5CHV C;  3AI5 A;  4LJP B;  3AU4 A;  4WWP A;  4KZ0 A;  2N0S B;  4MH8 A;  2XEW A;  2YEP B;  3CIR B;  1KH0 A;  4I6P A;  4PYZ A;  1SIJ A;  1YD8 U;  2MX2 A;  4HPM B;  1E9M A;  1XLO A;  3ZKJ C;  5C3J B;  1ET6 A;  3AUL A;  1WR6 E;  1VR9 A;  5EE0 A;  1GC6 A;  1P0R A;  1C77 A;  2OOB B;  4GGQ A;  2RGF A;  3H1U A;  2MEK A;  5CTR C;  3HVD A;  4GSW A;  1SE3 A;  4W9C A;  4K7W A;  2DYO A;  3AU5 A;  2K5P A;  2NBV B;  3B08 A;  4E3C A;  3K9O B;  4JIO U;  2BBC A;  4PT5 A;  1VCB A;  2FID A;  2M19 A;  1ROE A;  3ZYY X;  3I3T B;  3SR6 A;  2LGI A;  3RPF C;  1P7E A;  3DVN V;  1ENF A;  2WHI A;  1QOA A;  4LNF A;  1YJI A;  3RNA C;  3RUL A;  4S0R A;  2WLB A;  1CK1 A;  3IAS 1;  3J9C A;  4A8X C;  1WZ0 A;  2Z0D B;  4JQW C;  2IBI B;  1YQ4 B;  2PJH A;  3E9S A;  1OEY A;  3BYT B;  1PDX A;  2G3Q B;  1UF0 A;  2R61 A;  4ICV A;  2A4Z A;  1WMH B;  2LGY A;  4A55 A;  2JUO A;  2VH2 A;  4N59 A;  2JZZ A;  1C3T A;  4NAW A;  3PSE B;  1R4N B;  2LWP A;  3U30 A;  2KFK B;  5E6J A;  1KRH A;  1KFY B;  2IO3 B;  1QQR A;  2WXF A;  2KQS A;  2FNJ B;  1F9J A;  2DYB A;  2LFI A;  4P1C C;  3A9J B;  5D6J B;  1WFY A;  3FC4 A;  2KXJ A;  4LNO A;  4XDD A;  4KKJ A;  4FAD A;  4KDL B;  1WXV A;  3V61 A;  3P2B A;  1U4A A;  1E5W A;  2KO3 A;  4BVU C;  4M00 A;  2I1J A;  2LZ6 A;  1TJE A;  2LVQ A;  2MBO A;  2N9P C;  2O2V A;  3DBR B;  1V8C A; 
#chains in the Genus database with same CATH homology
 3T3O A;  1IBX B;  1EWC A;  1T3Q A;  1D5M C;  2LMC A;  1A70 A;  2W82 A;  1GTE A;  1FEH A;  4NAM A;  4JWU C;  3P1M A;  2KAC A;  2AQ3 B;  3MFG A;  5MPO A;  4B0E A;  1UWM A;  3CF4 A;  2WXI A;  2H89 B;  3ZGZ A;  1AW7 A;  2SEB D;  3BK2 A;  2W55 A;  1L4Z B;  2VZK D;  1FM0 D;  1TS3 A;  1F0Z A;  3AEE B;  3SFE B;  1SE2 A;  3AE2 B;  2QMT A;  1KLG D;  1I4H A;  1K52 A;  2WU5 B;  3P4S B;  2L83 A;  1TS5 A;  4TMA B;  4KGT A;  3AM9 A;  3AE5 B;  4JWS C;  3KLS X;  3Q69 A;  1XEE A;  1RFK A;  4HEA 1;  4RNA A;  4RGT A;  4ARI A;  1YQ3 B;  1VZ8 A;  1JWB D;  5G5G A;  1ZDV A;  1JML A;  2PLP A;  5D3D A;  1SB3 C;  2RDH A;  1I7H A;  4RF1 A;  2BS4 B;  2XNA C;  1N5W A;  1P7F A;  2KWD A;  2ZW1 A;  4USA A;  4J3O D;  5BMI A;  3VR9 B;  1OQR A;  1XF5 L;  5LNK 1;  1XLN A;  4EE2 A;  2K22 A;  1XXG A;  1XLP A;  2TSS A;  2WXP A;  2GB1 A;  1E7P B;  1I4Q A;  4L23 A;  3H8H A;  1N61 A;  1ESF A;  3MHZ A;  4ZYS A;  1JRO A;  1QOF A;  4IDI A;  3KWL A;  2HDE A;  4OZB A;  4WH4 A;  2ACZ B;  4ARC A;  1UGJ A;  1GB1 A;  1GT8 A;  1VRA B;  1SSN A;  2IGD A;  1C78 A;  4L1B A;  3TEY A;  3AH7 A;  3AMZ A;  5EE1 A;  1QF6 A;  4OHJ A;  1HXY D;  3UI3 A;  2N7J A;  1JCK B;  2WXL A;  1WWT A;  1F2R I;  3PO0 A;  1VLB A;  3ABV B;  1JWM D;  2M56 B;  3TEW A;  3VRA B;  1KF6 B;  2WQY B;  2VZK B;  3U7Z A;  1T5X D;  1C4P A;  2B76 B;  3GP7 A;  1MPE A;  3NZ3 A;  4XWT A;  3OWE B;  4REZ A;  5JXV A;  1FD6 A;  1ZP0 B;  4YSY B;  2BW2 A;  3W1S A;  1FMA D;  4YSX B;  5D3I B;  1D4B A;  4ZRP A;  2J4X A;  4L2Y A;  1HEZ E;  4LLG M;  4IKG A;  3ZQ4 A;  1FO4 A;  3VRB B;  5HG2 A;  5HFY A;  3AE6 B;  1CJE A;  1JW9 D;  2KN4 A;  1D5X C;  4N58 A;  2G9H D;  2ICI A;  1C79 A;  3Q8B A;  5AUI A;  3W9C B;  2IPK D;  2BS2 B;  2BT6 A;  2KAJ A;  3URY A;  2M0A A;  1V97 A;  1FCC C;  2WXR A;  2V3P A;  2XN9 C;  3NRZ A;  3ETR A;  1EU3 A;  1F2R C;  4RGM A;  4A9A A;  1IGC A;  4HJG E;  1MHH E;  2QEJ C;  1YN4 A;  2WXO A;  3TSS A;  3V05 A;  1ZUD 2;  4AQ7 A;  1FXI A;  1GAQ B;  1SJE D;  2AX5 A;  2EEL A;  1PGX A;  4TSS A;  4MT5 A;  4ZHP A;  3NVW A;  3VR8 B;  2IGG A;  3L4P A;  3AEF B;  2NTT A;  4YTN B;  2RMM A;  1YJJ A;  1JWS D;  1L0V B;  1KLU D;  3ZJU A;  1WGK A;  1DOY A;  4NAW B;  2W54 A;  1I4G A;  2PVG C;  4RGN A;  4B0M A;  3LXF A;  2DBY A;  2PW9 A;  1TS4 A;  3P4R B;  1GTH A;  1TY0 A;  3NUH B;  1ACC A;  1QOG A;  3AED B;  3TEX A;  3TUO A;  2JWU A;  2RDG A;  1JQ4 A;  2L1A A;  3HUI A;  1XLQ A;  3Q8A A;  4N6E B;  1XCQ L;  1YN3 A;  2KDM A;  1L6V A;  3GS2 A;  5FKA C;  1WRI A;  1AYF A;  1V1P A;  4D2K A;  2L32 A;  1TS2 A;  2E6X A;  4JPS A;  1Y56 A;  2CU3 A;  1FXA A;  4XDC A;  1UNS A;  1IUE A;  3HVZ A;  4P16 A;  4XWW A;  1VJK A;  1SJH D;  1I4R A;  3FAH A;  3Q8E A;  2QIL A;  1N63 A;  1UUP A;  1JWA D;  2N9L A;  3CWI A;  3PZ8 A;  2ON8 A;  2PIA A;  3V3X A;  2IDY A;  2BYT A;  2ONQ A;  1XCT L;  2LUM A;  5BYS A;  1PFD A;  2CJO A;  1D5Z C;  5C2T B;  3W5V B;  2MJD A;  2G1E A;  3O13 A;  4RH6 A;  1QLB B;  1MHX A;  1T6B X;  2INP E;  3BK1 A;  1SF0 A;  1N62 A;  4ITK A;  3AE7 B;  4MAC A;  5H92 C;  4A6Q A;  4R3D A;  1YMH E;  5TSS A;  5HI1 A;  4AS1 A;  1VZ6 A;  2LHE A;  4WUR A;  1NYQ A;  3Q8C A;  2IGH A;  4IOI E;  2OED A;  3BYY B;  2J52 A;  4DXG A;  3R2T A;  1K53 A;  2JX5 A;  3RFZ B;  4KX6 B;  3AN1 A;  3SEB A;  4US9 A;  4CQN A;  4HRS A;  1AN8 A;  4YTP B;  4RF0 A;  2K3U A;  3WCQ A;  2WS3 B;  1HA5 A;  2LEK A;  3DWG C;  1TZO A;  3EGR A;  3IT4 B;  1BUI C;  1DYQ A;  3R2I A;  1JWU D;  4TQ0 A;  4FXC A;  5H8Y E;  4Q2J A;  1JAL A;  1WSP A;  2WP9 B;  2WDV B;  1PUT A;  1FFU A;  2K9X A;  3AEG B;  3FIL A;  1H7W A;  1CZP A;  1V1P B;  2WXH A;  3AEA B;  3I57 A;  1ZPS A;  1XO3 A;  2L52 A;  4OW0 A;  1C4C A;  1TYG B;  3AE9 B;  2WXQ A;  3W2D A;  2BB5 A;  2RPV A;  3VQI A;  4YWG G;  2D5G A;  2WXK A;  2MH7 A;  3AB5 A;  4C56 C;  1WYG A;  2AQ1 B;  3BII D;  1RM6 C;  5I4D A;  4RFB A;  2I38 A;  4MM3 B;  4KGR A;  3NVZ A;  3AEB B;  2OHF A;  1HZ5 A;  1QIL A;  1ZDX A;  1TKG A;  1UWX A;  1M4V A;  4P6V F;  2Z8L A;  1L4D B;  5AUK A;  1TY2 A;  3BWU D;  1DOX A;  1ZXI A;  1F77 A;  1R7S A;  1NI3 A;  3ZJT A;  3MJ5 A;  3BVG A;  3B2F A;  1KTK A;  1QKZ A;  2X38 A;  3LB8 C;  3MC0 B;  1PGB A;  1AWD A;  1STE A;  3IXS A;  1QT9 A;  2QSD A;  1FNU A;  1GB4 A;  2E3T A;  1N5X A;  4LK0 M;  3P42 A;  1EWY C;  3BZD B;  1L0Y B;  1L6U A;  2H88 B;  1FNW A;  4RCO A;  4WIP A;  1FFV A;  1VZ7 A;  2JZP A;  4HKZ E;  1V1O A;  1FRD A;  4H2A A;  5BYR A;  1JRP A;  1D6E C;  2J42 A;  2PTL A;  3Q8F A;  1ZXH A;  3TEZ A;  1QOB A;  1YNT E;  1FRR A;  2BTE A;  3U4E G;  1SE4 A;  4C7Z A;  4LTU A;  4NJC A;  2Y5P A;  3C8Y A;  3ZJV A;  1MI0 A;  3SFD B;  2FBW B;  2W3R A;  1H7X A;  1RYJ A;  1BML C;  1E6E B;  1C76 A;  2WXM A;  1B9R A;  4OVZ A;  3U52 E;  3KQ4 A;  1K51 A;  2PVO D;  3EA6 A;  1EU4 A;  1I4P A;  3MP9 A;  1ZOY B;  4JE3 B;  4WQM A;  2NMQ A;  2J53 A;  4KGS A;  2AQ2 B;  1C9F A;  4GDK B;  2N0S B;  4GLS C;  4KKI A;  4MH8 A;  4WAF A;  2YEP B;  3CIR B;  1KH0 A;  1SBB B;  5HHD G;  5G5H A;  4C7Y A;  4O1N A;  1SIJ A;  2WNM A;  1E10 A;  1GPX A;  1E9M A;  1XLO A;  2SAK A;  4US8 A;  2GI9 A;  5C3J B;  1LO5 D;  5T8I A;  2BB6 A;  3HRD D;  2NTS A;  3EUB 2;  5D7G A;  1ET6 A;  2WXG A;  2BS3 B;  4HKQ A;  1VR9 A;  5EE0 A;  5BMG A;  1DGJ A;  1C77 A;  1IGD A;  3AE3 B;  1HQR D;  3AV8 A;  3I9V 1;  2KMM A;  1NYR A;  1YN5 A;  2MEK A;  1NEK B;  1OFF A;  1B1Z A;  4ZHO A;  2V0G A;  2IJ0 A;  3HVD A;  5EE3 A;  1SE3 A;  2PKO A;  3AE1 B;  2HTM E;  1J7A A;  4XE0 A;  2DYO A;  2CJN A;  1I4X A;  3N9Y C;  4DXF A;  1NVI D;  1IBX A;  4GDL B;  2K5P A;  3P4Q B;  2V4I B;  2ZW0 A;  2BBC A;  1TKE A;  4NZL B;  4PT5 A;  3B9J A;  5EE9 A;  2KQ4 X;  4OZA A;  1TKY A;  1GOZ A;  3W5U B;  2JYE A;  3PZ7 A;  2M19 A;  4DQO C;  1ROE A;  1OQQ A;  3ZYY X;  1L5P A;  3SR6 A;  3FIL B;  1MVK A;  2LGI A;  2MJE A;  1P7E A;  3RPF C;  4C80 A;  3GB1 A;  1ENF A;  3T3N A;  1SXT A;  3IT6 B;  2JSV X;  2JQR B;  3BVM A;  3R8B A;  1FCL A;  1PYW D;  2Y3A A;  1QOA A;  1NEN B;  1FIQ A;  3KWV A;  1YJI A;  2V3N A;  2WLB A;  4YSZ B;  4ZOH C;  1CK1 A;  2MJ3 A;  3IAS 1;  2W3S A;  3J9C A;  4A8X C;  2K0P A;  1CQV A;  2QIE B;  3NS1 A;  3AE8 B;  1ET9 A;  1FNV A;  2WU2 B;  1N60 A;  3P4P B;  1WXQ A;  1ZE3 D;  2WXJ A;  4YT0 B;  1BXT A;  1YQ4 B;  3E56 A;  3E9S A;  3P63 A;  2LJI A;  3BYT B;  1PDX A;  2YEP F;  2FE8 A;  1J7B A;  1SEB D;  1L0X B;  5BYQ A;  2R61 A;  2JXT A;  2JU6 X;  1RWS A;  2N9K A;  4A55 A;  3NVY A;  5FR3 A;  2WXN A;  4N59 A;  1C4A A;  1HZ6 A;  3IAM 1;  4RGO S;  5FK9 C;  1Q10 A;  2Y5C A;  1EM7 A;  5GXG B;  4WWM A;  3DWM A;  5E6J A;  1KRH A;  1KFY B;  2JYT A;  2GRI A;  3NVV A;  3BVZ A;  1QQR A;  2Q5W D;  2WXF A;  3AE4 B;  2INN E;  4OZC A;  2DLB A;  2QJL A;  2LFI A;  4M0W A;  2I2Y A;  4UDU C;  1E0Z A;  4TQ1 A;  4HRO A;  3FC4 A;  1VDV A;  4XDD A;  3U2S C;  5BMH A;  4KKJ A;  4YXD B;  2LHD A;  1PGA A;  3AEC B;  1K50 A;  3LYY A;  2WDR B;  3B2G A;  4JX1 C;  2DWQ A;  2DYM A;  2WDQ B;  4YTM B;  4A90 A;  1TJE A;  2EKI A;  2PMV A;  2FUG 1;  1J7C A;  1V8C A;  1DOI A;  4ZRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...