1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
3NVWA 1IUEA 3AH7A 4USAA 1NYQA 3P1MA 3AEGB 1QOBA 3AB5A 3AE8B 1DOIA 5EE9A 1SIJA 3CF4A 3P4PB 4C7ZA 1WWTA 2MH7A 5EE0A 1KFYB 2WDVB 3AECB 1H7WA 1EWYC 2BS4B 1XLPA 2WU5B 1RWSA 1TYGB 1FXIA 3B2GA 1L0VB 2E3TA 3LB8C 1E7PB 1GAQB 1L6UA 2WP9B 1OQQA 1UWMA 1B9RA 1OFFA 3EUB2 3HUIA 3SR6A 3AEFB 1FO4A 3P4QB 5AUKA 3FC4A 2AX5A 4C80A 3AEDB 3ABVB 3VRBB 1PFDA 1N5XA 1JROA 1TKYA 1V8CA 3LXFA 2QJLA 3PO0A 4P6VF 3AE3B 1J7BA 2M19A 2Q5WD 3NVYA 3WCQA 2W54A 4A9AA 4ZHOA 1PDXA 2PVGC 2H88B 2OHFA 2W3RA 3ETRA 3W9CB 3NS1A 3NVZA 1NYRA 4IDIA 3AE9B 2KMMA 5G5GA 3AE4B 3AE7B 1QLBB 1AWDA 1N5WA 1GT8A 2WU2B 4YTNB 1V97A 1R7SA 2BT6A 3B9JA 3AE2B 1WYGA 1NENB 1GTEA 3DWMA 4C7YA 2PKOA 2BS2B 5C2TB 3AE1B 1RFKA 3AMZA 2PVOD 1JWBD 1YJIA 5GXGB 3ZYYX 2N0SB 4ZOHC 3SFDB 5G5HA 1E0ZA 1L5PA 2HTME 1N62A 1RYJA 3AEAB 1QT9A 1DGJA 1VDVA 1QOFA 2JX5A 3RPFC 3AE5B 1FRRA 4N58A 1A70A 1N61A 4YSZB 3AV8A 1T3QA 3VR9B 2H89B 4US9A 5EE1A 1JALA 3VRAB 2M56B 3AEEB 1CZPA 3NRZA 4HROA 2QIEB 1YQ3B 4N59A 1DOXA 1NI3A 4ITKA 1VJKA 2DBYA 3HVZA 1ZXIA 4YTMB 2LEKA 3CIRB 4WWMA 5C3JB 2W55A 3KWLA 2PIAA 1E6EB 1JWAD 1QOGA 3NVVA 1ZP0B 1FFUA 1YJJA 1GTHA 2DWQA 1FIQA 2WS3B 1QF6A 1F0ZA 3AE6B 1FMAD 2CU3A 2W3SA 3DWGC 1KRHA 5H8YE 3CWIA 2B76B 1FFVA 1WGKA 2K9XA 2MJDA 1JRPA 3L4PA 4US8A 4HRSA 1KF6B 3W5VB 1J7CA 2L83A 2WQYB 2FBWB 3P4SB 3P4RB 1XO3A 2CJNA 4KX6B 5MPOA 1ZOYB 1CJEA 3B2FA 1E10A 4YXDB 1ZUD2 1RM6C 1FRDA 1QOAA 1NEKB 2WLBA 5H92C 2EKIA 2WDQB 1N63A 1I7HA 2G1EA 4ZHPA 2CJOA 1OQRA 1SB3C 5AUIA 3VR8B 1JW9D 1VLBA 2K5PA 3AM9A 1TJEA 1N60A 1NVID 1WXQA 1L6VA 4WQMA 4YSXB 1TKGA 3HRDD 3P63A 1GPXA 1PUTA 1ROEA 2WDRB 2L52A 4YSYB 1AYFA 1SF0A 1DOYA 1E9MA 2MJEA 2KAJA 1XLOA 4LTUA 1TKEA 1FXAA 1JQ4A 1XLNA 1H7XA 2JQRB 4JWUC 2ACZB 2K22A 3W5UB 4FXCA 2MJ3A 4YTPB 2Y5CA 3SFEB 4N6EB 4YT0B 1WRIA 3AN1A 4JWSC 3AEBB 1FM0D 2BS3B 3FAHA 1J7AA 4JX1C 1YQ4B 5EE3A 1XLQA 3BIID
chains in the Genus database with same CATH superfamily
2L76A 3URYA 5IAAC 2D10A 3M3JA 4FULA 1IYFA 1LQBA 3UIPB 3Q69A 2E3TA 2XBBC 3PZ8A 4BKSD 3BY4B 2WDTB 4BOZB 4AQ7A 1WF9A 2R2OA 2CU1A 2ZEQA 3LYYA 3U2SC 3ZDMC 3AEDB 3VRBB 3R8BA 3DVNU 2QJLA 4X57B 2KDIA 3NVYA 2O2VA 4W9KA 3W1SA 2O6VB 1NI2A 1PDXA 4LDTD 4TUUA 3EFCA 1NYRA 4LJOB 2C60A 2KX3A 3RI7C 3IG3A 1GTEA 1RFAA 4HJKA 1OGWA 2AQ3B 1QOFA 3AE5B 4N58A 4C4VA 2ZVNA 2CR5A 3DHIC 4A90A 2LMCA 1SIFA 2NPTB 2HDEA 4HXDA 1L0XB 3VDZA 3KWLA 3ENEA 1UNSA 3UIOB 2LRWA 1SEBD 3NZSA 1HE8A 4A20A 1ZUD2 1RM6C 3TEXA 1FNUA 1WJ4A 2N9XA 2PMVA 2G1EA 4ZHPA 1Y56A 3U30A 1KTKA 5IOIA 3U7ZA 3VHTC 4R3DA 1ROEA 1LGRA 2AQ2B 2XN9C 1AYFA 4BKGA 1J19A 2IO2B 1E9MA 2V3PA 3RNBC 1ET6A 5D94A 3ZQ4A 2KDBA 1WRIA 2ONQA 3BZDB 3FAHA 1IBXA 1Z5SB 3N3KB 4MGKE 1J0GA 1YX6B 3TUOA 3CF4A 3P4PB 2K8CA 4C7ZA 4P16A 2CS4A 1OEYJ 2DYOA 4XGAB 1ZGUB 2WXLA 5JHBA 2KWCA 2AX5A 3DBRB 2EMSA 2K6QA 3PRZA 4KSKC 2MWSB 1CQVA 1AW7A 4C80A 2WXIA 2K6DB 1L7YA 3BVZA 1D5ZC 1Q10A 5C23A 2JY6A 3NVZA 3W1YA 3Q3MC 1QLBB 1T0YA 2L0TA 1WMHA 2V1YA 1TT5B 2N9EB 4ZOHC 1STEA 3ZYYX 1E90A 3H7PB 3I63C 1PGXA 2MBBB 3U4EG 2RR9A 2JVCA 4MSMB 1E8XA 1DOXA 2UYZB 2WXOA 2KLGA 2CKHB 1GTHA 3BYTB 1QF6A 1FCLA 1GJZA 2IPKD 5LXHA 1WGKA 1K52A 1ZOYB 4K7UA 3VFKA 4B9KA 1YOVB 4JGHB 1SSNA 4ZRQA 4KSLC 1WXQA 3A9JB 2QMTA 4MH0E 1VRAB 3ZJTA 3TMPB 2G4DB 3DBSA 3NY5A 3RNGC 2NCNA 4WJOA 2D5GA 3RNFC 2DZIA 4ICVA 3L54A 1Q1OA 3HM6X 1BUIC 4GOCA 4AUQC 4B95A 3KLSX 1EM7A 1UWMA 1YIWA 3TEYA 4GDKB 3AEFB 2ZVOA 3DHGC 1C1YB 3C19A 1ESFA 3I5JC 2KDMA 2WXPA 3MC0B 4HCNB 2RPVA 1WGDA 3JVZX 1V80A 4DXGA 1GNUA 1KOTA 2GOWA 3WIMA 4I6LB 1QZEA 3PV1A 3EA6A 1YD8U 4NNJB 5IKCM 1DYQA 3GZNB 1YN4A 1F52A 1M94A 3RNEC 4G11A 1KM7A 4MGIE 1L5PA 1QT9A 2LFIA 4BZAA 1T3QA 2H89B 1HTQA 2AL3A 1V86A 2M56B 1CZPA 4GMVA 1YQ3B 1FNWA 3L08A 3HVZA 3CMMB 1V6EA 2NS5A 2M1MA 4EFOA 5D3IB 2WS3B 4AOFA 1F2RC 4BAXA 1CK1A 2O2VB 1GC6A 2IYDB 1F2RI 1RLFA 3ZDTA 3WAPA 1GOZA 1N6ZA 2IY1B 2J42A 3R2IA 1ISNA 4P7IA 1TY0A 2RDBC 3DBLB 1C9FA 1NDDA 3T3NA 2IDYA 4IOIE 1XLOA 3IT4B 4C4VB 1WZ0A 2MEKA 1XLNA 2K22A 3W5UB 3FKYA 3ML8A 4G3XB 4JX1C 1SE9A 3AH7A 2ZCCA 5C1ZA 3AB5A 4II2B 2VZKB 1XT9B 2KDFB 4ANWA 1YJ1A 3H9DA 2KX0A 4OVUA 4OVVA 3GE3C 2ON8A 4JL9A 5AUKA 1I4GA 2GLSA 2JU6X 4MT5A 1TS3A 2OOBB 4E74A 2Y5PA 4OW0A 3Q8BA 1MG8A 2C9WB 1G6JA 3AE3B 4UDUC 4OHJA 2L32A 3K9PB 4WIPA 4YL8A 2WXRA 3S2AA 1AWDA 1I35A 1HXYD 3RMKC 2I2YA 3P42A 4MM3B 4K81A 2L3ZA 1VDVA 5E6PA 3W2DA 4II3B 2V3SA 4PYUA 2CHWA 2KK8A 2PJHA 4B0EA 2KC1A 2BKRB 1SJED 4FN2A 1WIAA 1NI3A 4URKA 1CMXB 1F77A 2W55A 4IM3A 2KANA 2KMCA 4W9EA 2B76B 3VUWA 2ZCBA 3DBRI 4EE2A 3DDCB 2L83A 5MPOA 1E10A 5DPWA 3B2FA 1FRDA 2WLBA 2L05A 2J53A 4W9FA 1WMHB 3L13A 4ZRJA 4IWPA 3GE8C 5T8IA 4KKIA 2KNBA 2MJEA 3L10B 2N9PC 1FEHA 5FKAC 5BMHA 1V49A 3AEBB 4ICUA 1LM8B 2LVOA 2YEPF 1QOBA 5AZFA 1I4RA 4NAWA 2DLBA 2Y3AA 1R4NB 2MA9B 2SEBD 3ONSA 2WDVB 3ZRCA 4ANVA 5D3DA 4A8XC 3Q3FA 3RZFA 2I1KA 2PW9A 1HZ6A 3P4QB 3B1LX 4DHZB 2L0FA 4XDDA 3DVGX 2HE7A 3CSTA 3IFWB 4QAYA 2LXAA 5FR6A 1HEZE 2HTHA 3JSVA 3IAM1 4S17A 5G5GA 1GB4A 2J52A 2KVRA 3B9JA 3AE2B 1WYGA 3DWMA 5L95C 4PK1A 2PLPA 1YJIA 4REZA 4MEMA 4M8NA 1H4RA 2R2QA 1N62A 1WR1A 2KC2A 3KWVA 2J0JA 4RNAA 4DHJB 3JW0X 2FCMA 4MSQB 4KDIC 2DWQA 4ANXA 2MSED 2QSDA 3DWGC 4AJWA 4EUTA 2NMQA 4XWWA 2MQJA 1J7CA 3ZO5B 4BKSA 4TV3A 3OJ4B 4XX5A 1UF0A 2INPE 3L0WB 4YSXB 1TKGA 4ZYSA 3WANA 1NBFC 2BYTA 1GPXA 2NBVB 1JQ4A 2L1AA 2KFJA 3GZNI 3WALA 1JWMD 4W9CA 3AN1A 1VD2A 3Q3NC 2A5UA 3BK1A 4JQWC 3P1MA 2DNFA 4KKJA 1SIJA 1YN5A 3R2TA 4OZAA 3AECB 4ANUA 1XLPA 4PS3A 2HJ1A 3N1YC 4MACA 1E7PB 2G4SA 1GAQB 4DDID 4GU2A 3W1SC 3QCAA 3RD2A 1WGGA 2LVQA 2KVZA 3NS8A 4F7ZA 3PRPB 5BYSA 2KN5A 3PRMB 4O1NA 3Q8EA 4LK0M 1T0QC 2CHXA 1J7BA 2Q5WD 3WCQA 5DPTA 2H88B 3VH3B 2PE9A 3QQ8B 4WJPA 2KWDA 3DBLI 4WJNA 1FCCC 2X38A 1NENB 2BB5A 2I1JA 2BS2B 3AMZA 2KFKA 1FRRA 4MGZE 4FLHA 1ACCA 2WXHA 4N59A 3MHSD 3V3XA 2QILA 3BINA 2PIAA 1E6EB 3PHXB 1WXSA 1KLUD 3ZKJC 1XQQA 5IN7A 1VZ8A 3DVGY 4EZJA 2AEHA 1P1AA 4M01A 1V2YA 3N20C 3T3OA 2KJ6A 1YQBA 1E7VA 1C4PA 2MCNB 1NVID 1K8RB 1YN3A 3L16A 4RM9A 4IM2A 2Y5CA 1YQ4B 3X0WA 2NTTA 2ZPNA 4JPSA 2KOXA 2M8SA 4DXFA 1KLVA 1KFYB 1EU4A 3R7RA 1TYGB 4F1SA 2LZ6A 3C8YA 2DAJA 3ZNGC 2R61A 1Q5WB 5LLIA 3TBLD 4L23A 2LGYA 2XK5A 3KW5B 3AXCA 1JWSD 2KKCA 2KYWA 3ZW3A 5HFYA 3APCA 3A33B 5BMIA 5FR3A 2EMTA 2K1FA 1V97A 1R7SA 2JXTA 3UQAA 3OAWA 1JWBD 4NAWB 1C76A 2N0SB 4EOYA 3QJZA 3R3MA 2GMIC 1DGJA 2GB1A 2IO1B 2IY0B 3N1XC 5CX3A 1R4NI 2RSUA 2WXKA 1B1ZA 2LD9A 4WWMA 2BPSA 3ZRFA 2D3BA 2IGGA 1T6BX 5BYRA 2BBCA 4ZRKA 2ZNVC 1T0SC 4E3CA 1EF1A 3CWIA 3H8HA 3ZNID 3I57A 2MJDA 1LO5D 4WAFA 2IGDA 3JSVB 3UF8A 1UZXB 3PPAA 1OQRA 4EEWA 1M4VA 1ZDVA 2G9HD 1PUTA 2MBOA 1VR9A 4YSYB 3UI3A 1EUVB 2LVPA 2KTRA 2N4FA 4FXCA 4HPMB 1TY2A 2IBIB 1XLQA 2LXCA 3NG0A 1NYQA 3EFUA 1L0YB 2L7RA 2VH1A 1X1MA 2QEJC 3B0AA 2GBNA 3E9SA 4DDGD 4M00A 3Q14C 3O13A 1B9RA 1JCKB 4RGOS 2FCSA 3AU5A 3SR6A 1MHHE 4MDKE 1GUAB 2YVCA 2Z0DB 1V8CA 3GS2A 1UUPA 1KH0A 4LDTB 2GBJA 4GSWA 2BW2A 4WAAA 4IW0A 4NJ6A 2RD0A 4NAMA 5FK9C 1I4HA 4N9F4 4S0RA 4YTNB 2D3GA 3M95A 4W9JA 2V4IB 2BYVE 3SD5A 1UBQA 2G45B 2MHJA 3CSFA 3V05A 2LWPA 1LFDA 3MP9A 4PS8A 2ZW0A 2V3NA 3AV8A 4YSZB 1VCBA 3RT3B 2KMAA 3NRZA 2KO3A 2QIEB 3VTVA 1S3SG 1MG4A 4ITKA 2MBHA 5AZHA 2CU3A 1KRHA 3ML9A 4IM0A 1FFVA 4KGRA 3H1UA 1SE4A 1XO3A 4NQKE 4KV2A 2PTLA 4KIKA 5D6JB 2K5PA 1WXVA 2KFKB 1D5MC 3SHQA 3Q6BA 2JUOA 2WDRB 2DHZA 4FA6A 1UBIA 1FXAA 3OG5A 1WGHA 5LNK1 1LXDA 2KWUB 2WX0A 3RNAC 1J7AA 4OVZA 1XXGA 2BWES 4USAA 1IUEA 2FE8A 5DPRA 2LASA 1DOIA 1F1HA 4M0WA 4DWFA 1R4MB 2GRIA 1XD3B 2OEDA 1RWSA 2HJ8A 3PZ7A 1L6UA 5AZGA 5EDSA 1BT0A 2V4LA 1IGDA 1C4AA 4RFBA 1ZKHA 2KJRA 1AARA 4RM8A 2N7DA 3BVMA 1TBEA 3KUDB 4FHKA 4LNOA 2IO0B 3DHHC 1TTNA 4HCPB 3EC8A 4DHJD 2Z59B 3PT2B 1K50A 1MVKA 5JHAA 2PPHA 3BVGA 5C2TB 4IWQA 2C7HA 5GXGB 2PVOD 2C5LC 3AU4A 1GB1A 3MHZA 3M62B 3DBHB 3SFDB 2HTME 3NZUA 3A4RA 4AWJA 2WWZA 2K39A 3BWUD 2DAFA 2J4XA 2JWUA 3AEEB 4HROA 1FNVA 3OWEB 1VJKA 2NBWB 2ASQA 2CHZA 3ZTCA 2LEKA 3CIRB 2PEAA 1FFUA 2LUEA 1IBXB 5E6NA 1F0ZA 2XK5B 1FMAD 4RGMA 1TS2A 3K9OB 3L4PA 4US8A 3WAMA 3P4SB 3A9KA 4NQLB 2FAZA 1MHXA 2ZPYA 2LGXA 2LGIA 4OZBA 3DQVA 2V9HA 3DOWA 3DVNV 3ZUNA 1P3QU 1U4AA 1WZ3A 2WNMA 2JWZA 3VXWA 1FPYA 3PS6A 2JYEA 3WAOA 2G3QB 3SU8X 4FBJB 3LJ3A 2FNJB 2DYMA 2A4ZA 2RDGA 5BO4B 1V5OA 1FM0D 5EE3A 3NZ3A 3RUIB 3BIID 3NVWA 1ZXHA 4HVBA 3KYDD 4A6QA 1GG3A 3BYYB 2MP2A 4WH4A 4WWOA 1H7WA 2BS4B 3NOBA 4TMAB 3PHWB 1OFFA 3EUB2 4IC7B 1D3ZA 1N5XA 1WE7A 2KXJA 1C78A 2O6VD 1K51A 2KTRB 2J0KA 2C7NB 4JIOU 2KMMA 1UGJA 3RN9C 1GT8A 2BF8B 1WX8A 4MH8A 1RFKA 3AE1B 4B6WA 1WI0A 2LJIA 4G0NB 4RCOA 5G5HA 2JX5A 2J7QB 3ZVVA 4ARCA 4WURA 3U7DA 3MFGA 1XF5L 5EE1A 5IO9A 1IP9A 3Q3JA 3TJPA 4ARIA 3VTUA 3APFA 4GGQA 5GMVA 2LGDA 4Q2JA 1P7EA 2N7JA 1KF6B 2CJNA 1NEKB 4RGNA 2EELA 4BBNC 2EKIA 1MFWA 4WWPA 2HD5B 4JLCA 2CJOA 2DENB 2JT4B 1L6VA 4RMAA 5HKHA 2LHEA 2LJ5A 1TIFA 2LI5A 4P1BC 2FCQA 4K3BA 3QHTA 4GIVA 3B08A 2ACZB 1H8CA 2QHOA 1PGAA 3ALBA 2C7MB 4YT0B 4YWGG 2JZPA 2ZJDA 1VZ7A 3C0RB 1WWTA 1WJ6A 3IBEA 2ZW1A 1FXIA 1L0VB 1WY8A 3LB8C 2MBQA 4D2KA 4NJ7A 1OQQA 3QC8B 4RF1A 3Q3OC 4KIKB 4HKZE 5CHWA 3DPDA 2WGSA 4TKNA 1C3TA 1JROA 4HLEA 1PYWD 1BXTA 3L17A 2M19A 2D2QA 4CO7A 5E6OA 3MTNB 5HHDG 2PVGC 3W9CB 3M63B 4RF0A 4DQOC 2KQ7A 4IDIA 1A5RA 3AE9B 3QK0A 4LNNA 2E6XA 3ZXRA 4KVGB 2WU2B 3V6CB 3N1ZC 4L2YA 1YMHE 4MGYE 4RH6A 1WH3A 3IAS1 4M0WB 1E0ZA 3UINB 4M02A 3RPFC 3N32A 1WGRA 3ZLZA 1R4MI 4LJPB 1WRDB 2KZRA 4CHKA 4EKUA 2DBYA 3V60A 1L4DB 1V1PA 1WM2A 3NVVA 1Z2MA 3OJ3A 4NZLB 1TS5A 1XCTL 2XNAC 4LLGM 2KN4A 4KX6B 2I38A 2MRPA 2WDQB 2NR2A 4BKTA 3GOEA 2JZ3B 4LNKA 1YNTE 1ZDXA 5D7GA 3ECIA 1V81A 1UD7A 1SF0A 1DOYA 2BVCA 3OLMD 2K3UA 1I4QA 2JQRB 2JPHA 2N9KA 1L2NA 4LNFA 2WYQA 3DBHI 2BS3B 5KHOA 2K25A 2RMMA 2YEPB 2AQ1B 1S1QB 4XZ4A 3TIXA 1WM3A 2KHWB 3APDA 3VVWB 2D3CA 3AE8B 1I42A 2WHIA 1TZOA 4K7WA 4BBNF 4BVUC 4ZRIA 3GP7A 4MELA 4DK5A 2LHDA 2QDFA 2BKFA 3A9KB 1F9JA 5BYQA 4ASWC 1XCQL 1I4PA 2VRRB 1I4XA 3PTFC 1WX9A 5JZEB 3I3TB 4ZRPA 3TSSA 3U8ZA 2DZMA 2IZVB 1TKYA 1HZ5A 2Z8LA 1WGYA 5E6JA 4P6VF 3N9YC 3IT6B 4HEA1 3QX1A 3NJTA 4MJSA 1PQSA 3EHVA 3HK0A 2D07B 1C79A 3V62A 4WQOB 1JWUD 4PT5A 4C7YA 3MC9A 3V6EB 1SJHD 4EZLA 2MP2B 4FJZA 2YLMA 2DX5B 4KGSA 4EZKA 1L4ZB 1WE6A 3HVDA 1JRUA 1J8CA 3MC8A 2INNE 2L00B 1QILA 3TCAA 3ZNHB 3ZIMA 1ZP0B 2K8BA 3SEBA 2PE6B 4HPPA 4OZCA 4P1CC 1D4BA 1Y8RC 1E5WA 3W5VB 3KQ4A 4JE3B 1CJEA 1TGZB 2GI9A 4XDCA 1QOAA 5H92C 4MM3A 2V0GA 4NPNA 4DBGA 3RCZA 2Z0EB 1JW9D 2DZJA 3NUHB 2WXJA 3LDZE 5J17A 1FD6A 2JRHA 4HKQA 2K8HA 2Y5BB 2MW5A 4ACFA 3I9V1 1ZPSA 3H6NA 1K53A 1QKZA 2VZKD 4AJYB 2OJRA 1EWYC 1EO6A 3X23A 4BOSC 3B2GA 3Q8FA 4W9DA 3HM3A 3HIZA 4NJCA 4HWIB 3TEWA 1WXAA 1FO4A 4WJQA 2NVUI 3FC4A 3PSEB 3ABVB 1PFDA 4K7SA 4I6PA 3VH4B 3T9LA 1UGMA 2JZZA 3AE4B 1N5WA 4KZ0A 3IXSA 5HI1A 2PKOA 3VQIA 1T0RC 4GLSC 3AEAB 1C77A 4DHZE 2AL6A 4GB9A 2FUHB 1OTRB 2W82A 2M0AA 3QIJA 4L1BA 1FXTB 3GB1A 3FILA 3AE6B 4A3PA 3VUYA 3ZNZB 2K9XA 4W9GA 2WQYB 3PZDA 3EGRA 3HRDD 4HPLB 3P63A 1JMLA 1MPEA 2INCC 1TKEA 1PGBA 5CHVC 2BWFA 4JWUC 3A4SC 2MJ3A 2BTEA 1E8WA 3TEZA 3D32A 1WFYA 1V1PB 3VTWA 2EKEC 4XC2A 5AEKB 1Q0WB 2KJHB 4CQNA 2WU5B 2ZZPB 1HA5A 2GBKA 3RNCC 5L83A 4GDLA 3DCGA 2GBRA 4GXBA 1WJUA 3KYCD 4ZYNA 1MJDA 1ET9A 2WX1A 2D3AA 2KTFA 2BT6A 3AULA 4KZCA 5CTRC 2MBEA 3AI5A 1SBBB 1SE2A 4IWOA 5TSSA 4H2AA 1XEEA 2KACA 2J0MA 3UGBB 4AS1A 4FADA 2BB6A 1RYJA 1UWXA 2M4NA 1OQYA 2LRUA 1N61A 1P7FA 4US9A 4XWTA 1E8ZA 3A1QA 3QWZB 3R66C 2KDEB 4E71A 1KJTA 1ZXIA 4YTMB 4J6IA 1ENFA 4HK2A 2WXMA 1E8YA 5C3JB 2KLCA 2LGSA 1MI0A 1UELA 2WXNA 3Q2AC 2JF5A 5H8YE 2MLBA 2RDHA 2UU7A 1AN8A 1JRPA 1WR6E 4HRSA 3P2BA 5DPSA 2N7EA 2IJ0A 4MJSB 5KHQA 2JXXA 1N63A 4ZDVA 4KDLB 3VR8B 1T5XD 3MJWA 1N60A 3PVLA 4TQ1A 1ZE3D 2WXFA 3VUXA 4TQ0A 2KD0A 2L52A 2O6VA 3HHMA 4KGTA 2KAJA 4LTUA 2L8JA 4PYZA 1H7XA 3O65B 2FUG1 4N6EB 4F8CB 4K1RB 3SDLC 2N1WA 3AEGB 2WXGA 4IG7B 5EE9A 2INDC 4WWNA 4CYEA 2MH7A 2WXQA 4FHJA 1RRBA 2FIFA 1P98A 1UH6A 1EWCA 1RAXA 2NPTA 1KLGD 3BK2A 3MJ5A 3ZJVA 3TL5A 5LXIB 2KT7A 1SGHA 1P0RA 4B0MA 2LUMA 1SXTA 3LXFA 2QC8A 4A9AA 2DYBA 2BYEA 2OHFA 1WJNA 4C56C 1SE3A 1WSPA 3J9CA 1BMLC 3AE7B 3UQBA 3RZWC 2FCNA 1HTOA 3PLUA 4G50A 4C00A 3KH0A 4TSSA 5IA7A 4NY0A 4W9LA 3VR9B 5G2NA 4LCDE 2KQSA 3VAWA 3ZTDA 5JXVA 1JWAD 1QOGA 3Q8CA 1WXMA 1FIQA 1WX7A 3IHPC 2W3SA 4HJGE 2BQQA 2RPQA 5TR5A 1HQRD 3P4RB 3RULA 2JRIB 4YXDB 1IPGA 3KUZA 1GC7A 3QARA 2N9LA 4A3OA 1SB3C 5AUIA 2B3AA 2K0PA 2BYFA 2X8XX 4FJYA 2AYOB 4WQMA 4PS7A 1IGCA 2DZKA 3H7SA 3QAQA 4K3CA 1D6EC 2SAKA 1C4CA 1V9JA 2ZNVB 4IUMB 4LNIA 3RYTA 3SFEB 3ZGZA 1V1OA 2JSVX 2QCZA 1WYWB 2XEWA 2IO3B 2ICIA 4HDOA 3FILB 3NHEB 2GBMA 3T8MA 4RGTA 3PLVA 1P9DU 2M17A 2VH2A 5EE0A 3H7PA 5IP4D 4J3OD 3PREA 4HDQA 2M0XA 4I6NB 1ZW7A 2WP9B 4M8MA 1OEYA 3HUIA 1V5TA 3KUCB 2KWVB 3PGEA 2NTSA 4FJVB 3PO0A 3ZXVA 2KQ4X 4DXAB 2W54A 4ZHOA 5I4DA 1VZ6A 4A55A 2W3RA 3ETRA 5J2RA 3NS1A 1QQRA 2FIDA 1EF5A 2REXA 3KVFB 3CF6E 3RFZB 5DCNA 3ZJUA 2JYTA 3A9JA 4BFRA 3R7QA 5G55A 2IGHA 3WA0A 2BGFA 5JH5C 1E7UA 2N1VA 1A70A 3U52E 2OJWA 1JALA 3VRAB 4XYCA 3Q8AA 4GDLB 4AP4C 1YJJA 2MX2A 1EU3A 3V61A 5J18A 3N30A 2FBWB 4W9IA 4W9HA 1D5XC 1YX5B 4GDKA 1I7HA 4IKGA 1TZ1A 3E56A 2RGFA 1VLBA 3AM9A 2TSSA 1TJEA 5BMGA 5CHFA 3EECA 2W9NA 3QA8A 5D2MB 5HG2A 2D11A 4GN1A 4YTPB 1TS4A 3A1QB 2UWQA 3JYUA 4JWSC 2NBUA 3IVFA 2AWTA 4XE0A
chains in the Genus database with same CATH topology
4USAA 1IUEA 2FE8A 2YEPF 1K53A 1QOBA 1I4RA 3URYA 1DOIA 1QKZA 4M0WA 2DLBA 2Y3AA 2GRIA 2VZKD 2SEBD 2WDVB 1EWYC 2OEDA 1RWSA 3B2GA 3Q69A 2E3TA 3Q8FA 5D3DA 4A8XC 3PZ8A 3PZ7A 1L6UA 4NJCA 2PW9A 4AQ7A 3TEWA 1FO4A 1HZ6A 3P4QB 3FC4A 1IGDA 1C4AA 3LYYA 3U2SC 4RFBA 3AEDB 3ABVB 3VRBB 1PFDA 4XDDA 3R8BA 2QJLA 3NVYA 3BVMA 3W1SA 1PDXA 1HEZE 1NYRA 3IAM1 5G5GA 3AE4B 1GB4A 2J52A 1N5WA 1K50A 3B9JA 1MVKA 3AE2B 1WYGA 3DWMA 1GTEA 3BVGA 3IXSA 2PKOA 5HI1A 5C2TB 5GXGB 2PLPA 1YJIA 2PVOD 4REZA 3VQIA 3MHZA 1GB1A 4GLSC 3SFDB 2HTME 1N62A 3AEAB 2AQ3B 1C77A 1QOFA 3AE5B 4N58A 3BWUD 3KWVA 4A90A 2LMCA 2J4XA 2JWUA 2HDEA 3AEEB 2W82A 4HROA 1L0XB 1FNVA 3OWEB 2M0AA 1VJKA 4RNAA 4L1BA 2LEKA 3CIRB 3GB1A 3KWLA 3FILA 1FFUA 1UNSA 2DWQA 1IBXB 2QSDA 3AE6B 1FMAD 3DWGC 1F0ZA 4RGMA 1TS2A 2NMQA 2K9XA 1SEBD 3L4PA 4US8A 4XWWA 1J7CA 2WQYB 3P4SB 1ZUD2 1RM6C 3TEXA 2INPE 1MHXA 1FNUA 2PMVA 2LGIA 2G1EA 4OZBA 4ZHPA 3EGRA 1Y56A 4YSXB 1KTKA 1TKGA 3HRDD 4ZYSA 3U7ZA 2BYTA 3P63A 1JMLA 2WNMA 1MPEA 1GPXA 4R3DA 1ROEA 2AQ2B 2XN9C 1AYFA 1E9MA 2V3PA 2JYEA 1TKEA 1JQ4A 1PGBA 2L1AA 1ET6A 4JWUC 2DYMA 2MJ3A 3ZQ4A 2BTEA 1JWMD 2RDGA 1WRIA 3AN1A 3TEZA 1FM0D 2ONQA 3BZDB 3FAHA 5EE3A 3NZ3A 1IBXA 3BIID 3BK1A 1ZXHA 3NVWA 3P1MA 4A6QA 1V1PB 3BYYB 4KKJA 1SIJA 1YN5A 3R2TA 3TUOA 4WH4A 3CF4A 3P4PB 4C7ZA 4OZAA 3AECB 1H7WA 4CQNA 1XLPA 2BS4B 2WU5B 4MACA 4P16A 1HA5A 2DYOA 1E7PB 1GAQB 4TMAB 2WXLA 1OFFA 3EUB2 2AX5A 1CQVA 1AW7A 4C80A 2WXIA 5BYSA 1N5XA 4O1NA 3Q8EA 4LK0M 1J7BA 2Q5WD 3WCQA 3BVZA 1C78A 1D5ZC 1Q10A 1K51A 2H88B 3NVZA 2KWDA 2KMMA 1ET9A 1QLBB 1FCCC 2X38A 1UGJA 1GT8A 2BT6A 1NENB 2BB5A 4MH8A 2BS2B 1RFKA 3AE1B 1SBBB 1SE2A 3AMZA 2LJIA 4RCOA 5TSSA 4H2AA 1XEEA 2KACA 4ZOHC 4AS1A 1STEA 5G5HA 2BB6A 1RYJA 3ZYYX 2JX5A 1UWXA 1FRRA 1PGXA 3U4EG 4ARCA 1N61A 4WURA 1P7FA 1ACCA 4US9A 3MFGA 1XF5L 4XWTA 5EE1A 1DOXA 2WXHA 4N59A 2WXOA 4ARIA 3V3XA 1ZXIA 4YTMB 1ENFA 2WXMA 2QILA 5C3JB 1MI0A 1E6EB 2PIAA 2WXNA 4Q2JA 1GTHA 1KLUD 3BYTB 1QF6A 1P7EA 5H8YE 2RDHA 2N7JA 1FCLA 2IPKD 1WGKA 1VZ8A 1AN8A 1JRPA 1K52A 4HRSA 1KF6B 2IJ0A 2CJNA 1ZOYB 3T3OA 1NEKB 4RGNA 2EELA 2EKIA 1N63A 2CJOA 3VR8B 1C4PA 1T5XD 1SSNA 4ZRQA 1N60A 1NVID 1WXQA 1L6VA 4TQ1A 1ZE3D 1YN3A 2WXFA 2QMTA 2LHEA 4TQ0A 1VRAB 3ZJTA 2L52A 4KGTA 2KAJA 4LTUA 1H7XA 2ACZB 2Y5CA 1PGAA 2FUG1 4N6EB 4YT0B 4YWGG 1YQ4B 2D5GA 2JZPA 2NTTA 3AEGB 2WXGA 4JPSA 1VZ7A 5EE9A 1BUIC 1WWTA 2MH7A 4DXFA 2WXQA 1KFYB 1EU4A 2ZW1A 1TYGB 1FXIA 3KLSX 1L0VB 3LB8C 1EM7A 4D2KA 1EWCA 1OQQA 1KLGD 1UWMA 3BK2A 4RF1A 3TEYA 3C8YA 3MJ5A 3ZJVA 4GDKB 3AEFB 4HKZE 2R61A 1ESFA 2KDMA 2WXPA 2LUMA 1SXTA 4B0MA 3MC0B 4L23A 1JROA 3LXFA 1PYWD 1JWSD 1BXTA 2M19A 2RPVA 4A9AA 4DXGA 5HHDG 2PVGC 2OHFA 3W9CB 4C56C 5HFYA 4DQOC 4RF0A 1SE3A 1WSPA 3J9CA 4IDIA 5BMIA 3AE9B 5FR3A 1BMLC 3AE7B 2E6XA 1V97A 2WU2B 3EA6A 1R7SA 4L2YA 1YMHE 2JXTA 4RH6A 1DYQA 1YN4A 4TSSA 1JWBD 4NAWB 3IAS1 1C76A 2N0SB 1E0ZA 1L5PA 1QT9A 3RPFC 1DGJA 2LFIA 2GB1A 1T3QA 3VR9B 2H89B 2M56B 1CZPA 2WXKA 1YQ3B 1B1ZA 2DBYA 1FNWA 1L4DB 3HVZA 4WWMA 5JXVA 1JWAD 1QOGA 1V1PA 2IGGA 1T6BX 3NVVA 3Q8CA 5D3IB 5BYRA 2BBCA 1FIQA 2WS3B 4NZLB 2W3SA 1F2RC 4HJGE 3CWIA 3H8HA 1TS5A 1CK1A 3I57A 2MJDA 1LO5D 1XCTL 1F2RI 4WAFA 2XNAC 4LLGM 2IGDA 1HQRD 3P4RB 2KN4A 4KX6B 2I38A 4YXDB 1GOZA 2WDQB 2N9LA 2J42A 1OQRA 1SB3C 3R2IA 5AUIA 2K0PA 1TY0A 1M4VA 1YNTE 4WQMA 1ZDXA 1ZDVA 2G9HD 5D7GA 1C9FA 1IGCA 3T3NA 1PUTA 1VR9A 2IDYA 4IOIE 4YSYB 3UI3A 1D6EC 1SF0A 1DOYA 2SAKA 1XLOA 1C4CA 3IT4B 2K3UA 1I4QA 2MEKA 1XLNA 2JQRB 2K22A 3W5UB 2N9KA 4FXCA 3SFEB 1TY2A 3ZGZA 1V1OA 2JSVX 4JX1C 2BS3B 2RMMA 2YEPB 2AQ1B 1XLQA 3AH7A 1NYQA 2ICIA 3AB5A 3AE8B 3FILB 2VZKB 1L0YB 1TZOA 4RGTA 2QEJC 5EE0A 4J3OD 3GP7A 3E9SA 2LHDA 2ON8A 2WP9B 3O13A 5BYQA 1B9RA 1JCKB 1XCQL 4RGOS 1I4PA 3HUIA 3SR6A 5AUKA 1I4XA 1MHHE 1I4GA 2JU6X 4ZRPA 2NTSA 1TS3A 4MT5A 3TSSA 2Y5PA 1TKYA 1HZ5A 1V8CA 2Z8LA 3GS2A 3Q8BA 4OW0A 5E6JA 3PO0A 4P6VF 3AE3B 1UUPA 1KH0A 2KQ4X 3N9YC 4UDUC 2W54A 4ZHOA 3IT6B 4OHJA 4HEA1 5I4DA 2L32A 1VZ6A 4A55A 4WIPA 2W3RA 2BW2A 3ETRA 3NS1A 4NAMA 1QQRA 2WXRA 5FK9C 1C79A 1AWDA 1I4HA 4YTNB 1JWUD 3RFZB 1HXYD 4PT5A 2V4IB 3ZJUA 2JYTA 4C7YA 2I2YA 3P42A 4MM3B 1SJHD 3V05A 3MP9A 2IGHA 2ZW0A 4KGSA 1VDVA 1A70A 2V3NA 3AV8A 4YSZB 3U52E 3W2DA 1L4ZB 3HVDA 1JALA 4B0EA 3VRAB 1SJED 3NRZA 2QIEB 1NI3A 4ITKA 2INNE 3Q8AA 1F77A 4GDLB 1QILA 2W55A 1ZP0B 1YJJA 3SEBA 1EU3A 4OZCA 2CU3A 1KRHA 2B76B 1FFVA 1D4BA 4KGRA 1SE4A 4EE2A 3W5VB 2L83A 2FBWB 3KQ4A 1XO3A 4JE3B 5MPOA 1E10A 1CJEA 3B2FA 2GI9A 1FRDA 1QOAA 2PTLA 2WLBA 4XDCA 1D5XC 5H92C 2J53A 2V0GA 1I7HA 4IKGA 3E56A 1JW9D 1VLBA 2K5PA 3AM9A 2TSSA 1TJEA 5BMGA 1D5MC 3NUHB 2WXJA 5HG2A 1FD6A 2WDRB 5T8IA 4KKIA 2MJEA 1FXAA 4HKQA 1FEHA 5FKAC 5BMHA 4YTPB 5LNK1 1TS4A 3I9V1 1ZPSA 4JWSC 3AEBB 1J7AA 4OVZA 1XXGA 4XE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVW A;  1IUE A;  3AH7 A;  4USA A;  1NYQ A;  3P1M A;  3AEG B;  1QOB A;  3AB5 A;  3AE8 B;  1DOI A;  5EE9 A;  1SIJ A;  3CF4 A;  3P4P B;  4C7Z A;  1WWT A;  2MH7 A;  5EE0 A;  1KFY B;  2WDV B;  3AEC B;  1H7W A;  1EWY C;  2BS4 B;  1XLP A;  2WU5 B;  1RWS A;  1TYG B;  1FXI A;  3B2G A;  1L0V B;  2E3T A;  3LB8 C;  1E7P B;  1GAQ B;  1L6U A;  2WP9 B;  1OQQ A;  1UWM A;  1B9R A;  1OFF A;  3EUB 2;  3HUI A;  3SR6 A;  3AEF B;  1FO4 A;  3P4Q B;  5AUK A;  3FC4 A;  2AX5 A;  4C80 A;  3AED B;  3ABV B;  3VRB B;  1PFD A;  1N5X A;  1JRO A;  1TKY A;  1V8C A;  3LXF A;  2QJL A;  3PO0 A;  4P6V F;  3AE3 B;  1J7B A;  2M19 A;  2Q5W D;  3NVY A;  3WCQ A;  2W54 A;  4A9A A;  4ZHO A;  1PDX A;  2PVG C;  2H88 B;  2OHF A;  2W3R A;  3ETR A;  3W9C B;  3NS1 A;  3NVZ A;  1NYR A;  4IDI A;  3AE9 B;  2KMM A;  5G5G A;  3AE4 B;  3AE7 B;  1QLB B;  1AWD A;  1N5W A;  1GT8 A;  2WU2 B;  4YTN B;  1V97 A;  1R7S A;  2BT6 A;  3B9J A;  3AE2 B;  1WYG A;  1NEN B;  1GTE A;  3DWM A;  4C7Y A;  2PKO A;  2BS2 B;  5C2T B;  3AE1 B;  1RFK A;  3AMZ A;  2PVO D;  1JWB D;  1YJI A;  5GXG B;  3ZYY X;  2N0S B;  4ZOH C;  3SFD B;  5G5H A;  1E0Z A;  1L5P A;  2HTM E;  1N62 A;  1RYJ A;  3AEA B;  1QT9 A;  1DGJ A;  1VDV A;  1QOF A;  2JX5 A;  3RPF C;  3AE5 B;  1FRR A;  4N58 A;  1A70 A;  1N61 A;  4YSZ B;  3AV8 A;  1T3Q A;  3VR9 B;  2H89 B;  4US9 A;  5EE1 A;  1JAL A;  3VRA B;  2M56 B;  3AEE B;  1CZP A;  3NRZ A;  4HRO A;  2QIE B;  1YQ3 B;  4N59 A;  1DOX A;  1NI3 A;  4ITK A;  1VJK A;  2DBY A;  3HVZ A;  1ZXI A;  4YTM B;  2LEK A;  3CIR B;  4WWM A;  5C3J B;  2W55 A;  3KWL A;  2PIA A;  1E6E B;  1JWA D;  1QOG A;  3NVV A;  1ZP0 B;  1FFU A;  1YJJ A;  1GTH A;  2DWQ A;  1FIQ A;  2WS3 B;  1QF6 A;  1F0Z A;  3AE6 B;  1FMA D;  2CU3 A;  2W3S A;  3DWG C;  1KRH A;  5H8Y E;  3CWI A;  2B76 B;  1FFV A;  1WGK A;  2K9X A;  2MJD A;  1JRP A;  3L4P A;  4US8 A;  4HRS A;  1KF6 B;  3W5V B;  1J7C A;  2L83 A;  2WQY B;  2FBW B;  3P4S B;  3P4R B;  1XO3 A;  2CJN A;  4KX6 B;  5MPO A;  1ZOY B;  1CJE A;  3B2F A;  1E10 A;  4YXD B;  1ZUD 2;  1RM6 C;  1FRD A;  1QOA A;  1NEK B;  2WLB A;  5H92 C;  2EKI A;  2WDQ B;  1N63 A;  1I7H A;  2G1E A;  4ZHP A;  2CJO A;  1OQR A;  1SB3 C;  5AUI A;  3VR8 B;  1JW9 D;  1VLB A;  2K5P A;  3AM9 A;  1TJE A;  1N60 A;  1NVI D;  1WXQ A;  1L6V A;  4WQM A;  4YSX B;  1TKG A;  3HRD D;  3P63 A;  1GPX A;  1PUT A;  1ROE A;  2WDR B;  2L52 A;  4YSY B;  1AYF A;  1SF0 A;  1DOY A;  1E9M A;  2MJE A;  2KAJ A;  1XLO A;  4LTU A;  1TKE A;  1FXA A;  1JQ4 A;  1XLN A;  1H7X A;  2JQR B;  4JWU C;  2ACZ B;  2K22 A;  3W5U B;  4FXC A;  2MJ3 A;  4YTP B;  2Y5C A;  3SFE B;  4N6E B;  4YT0 B;  1WRI A;  3AN1 A;  4JWS C;  3AEB B;  1FM0 D;  2BS3 B;  3FAH A;  1J7A A;  4JX1 C;  1YQ4 B;  5EE3 A;  1XLQ A;  3BII D; 
#chains in the Genus database with same CATH topology
 2L76 A;  3URY A;  5IAA C;  2D10 A;  3M3J A;  4FUL A;  1IYF A;  1LQB A;  3UIP B;  3Q69 A;  2E3T A;  2XBB C;  3PZ8 A;  4BKS D;  3BY4 B;  2WDT B;  4BOZ B;  4AQ7 A;  1WF9 A;  2R2O A;  2CU1 A;  2ZEQ A;  3LYY A;  3U2S C;  3ZDM C;  3AED B;  3VRB B;  3R8B A;  3DVN U;  2QJL A;  4X57 B;  2KDI A;  3NVY A;  2O2V A;  4W9K A;  3W1S A;  2O6V B;  1NI2 A;  1PDX A;  4LDT D;  4TUU A;  3EFC A;  1NYR A;  4LJO B;  2C60 A;  2KX3 A;  3RI7 C;  3IG3 A;  1GTE A;  1RFA A;  4HJK A;  1OGW A;  2AQ3 B;  1QOF A;  3AE5 B;  4N58 A;  4C4V A;  2ZVN A;  2CR5 A;  3DHI C;  4A90 A;  2LMC A;  1SIF A;  2NPT B;  2HDE A;  4HXD A;  1L0X B;  3VDZ A;  3KWL A;  3ENE A;  1UNS A;  3UIO B;  2LRW A;  1SEB D;  3NZS A;  1HE8 A;  4A20 A;  1ZUD 2;  1RM6 C;  3TEX A;  1FNU A;  1WJ4 A;  2N9X A;  2PMV A;  2G1E A;  4ZHP A;  1Y56 A;  3U30 A;  1KTK A;  5IOI A;  3U7Z A;  3VHT C;  4R3D A;  1ROE A;  1LGR A;  2AQ2 B;  2XN9 C;  1AYF A;  4BKG A;  1J19 A;  2IO2 B;  1E9M A;  2V3P A;  3RNB C;  1ET6 A;  5D94 A;  3ZQ4 A;  2KDB A;  1WRI A;  2ONQ A;  3BZD B;  3FAH A;  1IBX A;  1Z5S B;  3N3K B;  4MGK E;  1J0G A;  1YX6 B;  3TUO A;  3CF4 A;  3P4P B;  2K8C A;  4C7Z A;  4P16 A;  2CS4 A;  1OEY J;  2DYO A;  4XGA B;  1ZGU B;  2WXL A;  5JHB A;  2KWC A;  2AX5 A;  3DBR B;  2EMS A;  2K6Q A;  3PRZ A;  4KSK C;  2MWS B;  1CQV A;  1AW7 A;  4C80 A;  2WXI A;  2K6D B;  1L7Y A;  3BVZ A;  1D5Z C;  1Q10 A;  5C23 A;  2JY6 A;  3NVZ A;  3W1Y A;  3Q3M C;  1QLB B;  1T0Y A;  2L0T A;  1WMH A;  2V1Y A;  1TT5 B;  2N9E B;  4ZOH C;  1STE A;  3ZYY X;  1E90 A;  3H7P B;  3I63 C;  1PGX A;  2MBB B;  3U4E G;  2RR9 A;  2JVC A;  4MSM B;  1E8X A;  1DOX A;  2UYZ B;  2WXO A;  2KLG A;  2CKH B;  1GTH A;  3BYT B;  1QF6 A;  1FCL A;  1GJZ A;  2IPK D;  5LXH A;  1WGK A;  1K52 A;  1ZOY B;  4K7U A;  3VFK A;  4B9K A;  1YOV B;  4JGH B;  1SSN A;  4ZRQ A;  4KSL C;  1WXQ A;  3A9J B;  2QMT A;  4MH0 E;  1VRA B;  3ZJT A;  3TMP B;  2G4D B;  3DBS A;  3NY5 A;  3RNG C;  2NCN A;  4WJO A;  2D5G A;  3RNF C;  2DZI A;  4ICV A;  3L54 A;  1Q1O A;  3HM6 X;  1BUI C;  4GOC A;  4AUQ C;  4B95 A;  3KLS X;  1EM7 A;  1UWM A;  1YIW A;  3TEY A;  4GDK B;  3AEF B;  2ZVO A;  3DHG C;  1C1Y B;  3C19 A;  1ESF A;  3I5J C;  2KDM A;  2WXP A;  3MC0 B;  4HCN B;  2RPV A;  1WGD A;  3JVZ X;  1V80 A;  4DXG A;  1GNU A;  1KOT A;  2GOW A;  3WIM A;  4I6L B;  1QZE A;  3PV1 A;  3EA6 A;  1YD8 U;  4NNJ B;  5IKC M;  1DYQ A;  3GZN B;  1YN4 A;  1F52 A;  1M94 A;  3RNE C;  4G11 A;  1KM7 A;  4MGI E;  1L5P A;  1QT9 A;  2LFI A;  4BZA A;  1T3Q A;  2H89 B;  1HTQ A;  2AL3 A;  1V86 A;  2M56 B;  1CZP A;  4GMV A;  1YQ3 B;  1FNW A;  3L08 A;  3HVZ A;  3CMM B;  1V6E A;  2NS5 A;  2M1M A;  4EFO A;  5D3I B;  2WS3 B;  4AOF A;  1F2R C;  4BAX A;  1CK1 A;  2O2V B;  1GC6 A;  2IYD B;  1F2R I;  1RLF A;  3ZDT A;  3WAP A;  1GOZ A;  1N6Z A;  2IY1 B;  2J42 A;  3R2I A;  1ISN A;  4P7I A;  1TY0 A;  2RDB C;  3DBL B;  1C9F A;  1NDD A;  3T3N A;  2IDY A;  4IOI E;  1XLO A;  3IT4 B;  4C4V B;  1WZ0 A;  2MEK A;  1XLN A;  2K22 A;  3W5U B;  3FKY A;  3ML8 A;  4G3X B;  4JX1 C;  1SE9 A;  3AH7 A;  2ZCC A;  5C1Z A;  3AB5 A;  4II2 B;  2VZK B;  1XT9 B;  2KDF B;  4ANW A;  1YJ1 A;  3H9D A;  2KX0 A;  4OVU A;  4OVV A;  3GE3 C;  2ON8 A;  4JL9 A;  5AUK A;  1I4G A;  2GLS A;  2JU6 X;  4MT5 A;  1TS3 A;  2OOB B;  4E74 A;  2Y5P A;  4OW0 A;  3Q8B A;  1MG8 A;  2C9W B;  1G6J A;  3AE3 B;  4UDU C;  4OHJ A;  2L32 A;  3K9P B;  4WIP A;  4YL8 A;  2WXR A;  3S2A A;  1AWD A;  1I35 A;  1HXY D;  3RMK C;  2I2Y A;  3P42 A;  4MM3 B;  4K81 A;  2L3Z A;  1VDV A;  5E6P A;  3W2D A;  4II3 B;  2V3S A;  4PYU A;  2CHW A;  2KK8 A;  2PJH A;  4B0E A;  2KC1 A;  2BKR B;  1SJE D;  4FN2 A;  1WIA A;  1NI3 A;  4URK A;  1CMX B;  1F77 A;  2W55 A;  4IM3 A;  2KAN A;  2KMC A;  4W9E A;  2B76 B;  3VUW A;  2ZCB A;  3DBR I;  4EE2 A;  3DDC B;  2L83 A;  5MPO A;  1E10 A;  5DPW A;  3B2F A;  1FRD A;  2WLB A;  2L05 A;  2J53 A;  4W9F A;  1WMH B;  3L13 A;  4ZRJ A;  4IWP A;  3GE8 C;  5T8I A;  4KKI A;  2KNB A;  2MJE A;  3L10 B;  2N9P C;  1FEH A;  5FKA C;  5BMH A;  1V49 A;  3AEB B;  4ICU A;  1LM8 B;  2LVO A;  2YEP F;  1QOB A;  5AZF A;  1I4R A;  4NAW A;  2DLB A;  2Y3A A;  1R4N B;  2MA9 B;  2SEB D;  3ONS A;  2WDV B;  3ZRC A;  4ANV A;  5D3D A;  4A8X C;  3Q3F A;  3RZF A;  2I1K A;  2PW9 A;  1HZ6 A;  3P4Q B;  3B1L X;  4DHZ B;  2L0F A;  4XDD A;  3DVG X;  2HE7 A;  3CST A;  3IFW B;  4QAY A;  2LXA A;  5FR6 A;  1HEZ E;  2HTH A;  3JSV A;  3IAM 1;  4S17 A;  5G5G A;  1GB4 A;  2J52 A;  2KVR A;  3B9J A;  3AE2 B;  1WYG A;  3DWM A;  5L95 C;  4PK1 A;  2PLP A;  1YJI A;  4REZ A;  4MEM A;  4M8N A;  1H4R A;  2R2Q A;  1N62 A;  1WR1 A;  2KC2 A;  3KWV A;  2J0J A;  4RNA A;  4DHJ B;  3JW0 X;  2FCM A;  4MSQ B;  4KDI C;  2DWQ A;  4ANX A;  2MSE D;  2QSD A;  3DWG C;  4AJW A;  4EUT A;  2NMQ A;  4XWW A;  2MQJ A;  1J7C A;  3ZO5 B;  4BKS A;  4TV3 A;  3OJ4 B;  4XX5 A;  1UF0 A;  2INP E;  3L0W B;  4YSX B;  1TKG A;  4ZYS A;  3WAN A;  1NBF C;  2BYT A;  1GPX A;  2NBV B;  1JQ4 A;  2L1A A;  2KFJ A;  3GZN I;  3WAL A;  1JWM D;  4W9C A;  3AN1 A;  1VD2 A;  3Q3N C;  2A5U A;  3BK1 A;  4JQW C;  3P1M A;  2DNF A;  4KKJ A;  1SIJ A;  1YN5 A;  3R2T A;  4OZA A;  3AEC B;  4ANU A;  1XLP A;  4PS3 A;  2HJ1 A;  3N1Y C;  4MAC A;  1E7P B;  2G4S A;  1GAQ B;  4DDI D;  4GU2 A;  3W1S C;  3QCA A;  3RD2 A;  1WGG A;  2LVQ A;  2KVZ A;  3NS8 A;  4F7Z A;  3PRP B;  5BYS A;  2KN5 A;  3PRM B;  4O1N A;  3Q8E A;  4LK0 M;  1T0Q C;  2CHX A;  1J7B A;  2Q5W D;  3WCQ A;  5DPT A;  2H88 B;  3VH3 B;  2PE9 A;  3QQ8 B;  4WJP A;  2KWD A;  3DBL I;  4WJN A;  1FCC C;  2X38 A;  1NEN B;  2BB5 A;  2I1J A;  2BS2 B;  3AMZ A;  2KFK A;  1FRR A;  4MGZ E;  4FLH A;  1ACC A;  2WXH A;  4N59 A;  3MHS D;  3V3X A;  2QIL A;  3BIN A;  2PIA A;  1E6E B;  3PHX B;  1WXS A;  1KLU D;  3ZKJ C;  1XQQ A;  5IN7 A;  1VZ8 A;  3DVG Y;  4EZJ A;  2AEH A;  1P1A A;  4M01 A;  1V2Y A;  3N20 C;  3T3O A;  2KJ6 A;  1YQB A;  1E7V A;  1C4P A;  2MCN B;  1NVI D;  1K8R B;  1YN3 A;  3L16 A;  4RM9 A;  4IM2 A;  2Y5C A;  1YQ4 B;  3X0W A;  2NTT A;  2ZPN A;  4JPS A;  2KOX A;  2M8S A;  4DXF A;  1KLV A;  1KFY B;  1EU4 A;  3R7R A;  1TYG B;  4F1S A;  2LZ6 A;  3C8Y A;  2DAJ A;  3ZNG C;  2R61 A;  1Q5W B;  5LLI A;  3TBL D;  4L23 A;  2LGY A;  2XK5 A;  3KW5 B;  3AXC A;  1JWS D;  2KKC A;  2KYW A;  3ZW3 A;  5HFY A;  3APC A;  3A33 B;  5BMI A;  5FR3 A;  2EMT A;  2K1F A;  1V97 A;  1R7S A;  2JXT A;  3UQA A;  3OAW A;  1JWB D;  4NAW B;  1C76 A;  2N0S B;  4EOY A;  3QJZ A;  3R3M A;  2GMI C;  1DGJ A;  2GB1 A;  2IO1 B;  2IY0 B;  3N1X C;  5CX3 A;  1R4N I;  2RSU A;  2WXK A;  1B1Z A;  2LD9 A;  4WWM A;  2BPS A;  3ZRF A;  2D3B A;  2IGG A;  1T6B X;  5BYR A;  2BBC A;  4ZRK A;  2ZNV C;  1T0S C;  4E3C A;  1EF1 A;  3CWI A;  3H8H A;  3ZNI D;  3I57 A;  2MJD A;  1LO5 D;  4WAF A;  2IGD A;  3JSV B;  3UF8 A;  1UZX B;  3PPA A;  1OQR A;  4EEW A;  1M4V A;  1ZDV A;  2G9H D;  1PUT A;  2MBO A;  1VR9 A;  4YSY B;  3UI3 A;  1EUV B;  2LVP A;  2KTR A;  2N4F A;  4FXC A;  4HPM B;  1TY2 A;  2IBI B;  1XLQ A;  2LXC A;  3NG0 A;  1NYQ A;  3EFU A;  1L0Y B;  2L7R A;  2VH1 A;  1X1M A;  2QEJ C;  3B0A A;  2GBN A;  3E9S A;  4DDG D;  4M00 A;  3Q14 C;  3O13 A;  1B9R A;  1JCK B;  4RGO S;  2FCS A;  3AU5 A;  3SR6 A;  1MHH E;  4MDK E;  1GUA B;  2YVC A;  2Z0D B;  1V8C A;  3GS2 A;  1UUP A;  1KH0 A;  4LDT B;  2GBJ A;  4GSW A;  2BW2 A;  4WAA A;  4IW0 A;  4NJ6 A;  2RD0 A;  4NAM A;  5FK9 C;  1I4H A;  4N9F 4;  4S0R A;  4YTN B;  2D3G A;  3M95 A;  4W9J A;  2V4I B;  2BYV E;  3SD5 A;  1UBQ A;  2G45 B;  2MHJ A;  3CSF A;  3V05 A;  2LWP A;  1LFD A;  3MP9 A;  4PS8 A;  2ZW0 A;  2V3N A;  3AV8 A;  4YSZ B;  1VCB A;  3RT3 B;  2KMA A;  3NRZ A;  2KO3 A;  2QIE B;  3VTV A;  1S3S G;  1MG4 A;  4ITK A;  2MBH A;  5AZH A;  2CU3 A;  1KRH A;  3ML9 A;  4IM0 A;  1FFV A;  4KGR A;  3H1U A;  1SE4 A;  1XO3 A;  4NQK E;  4KV2 A;  2PTL A;  4KIK A;  5D6J B;  2K5P A;  1WXV A;  2KFK B;  1D5M C;  3SHQ A;  3Q6B A;  2JUO A;  2WDR B;  2DHZ A;  4FA6 A;  1UBI A;  1FXA A;  3OG5 A;  1WGH A;  5LNK 1;  1LXD A;  2KWU B;  2WX0 A;  3RNA C;  1J7A A;  4OVZ A;  1XXG A;  2BWE S;  4USA A;  1IUE A;  2FE8 A;  5DPR A;  2LAS A;  1DOI A;  1F1H A;  4M0W A;  4DWF A;  1R4M B;  2GRI A;  1XD3 B;  2OED A;  1RWS A;  2HJ8 A;  3PZ7 A;  1L6U A;  5AZG A;  5EDS A;  1BT0 A;  2V4L A;  1IGD A;  1C4A A;  4RFB A;  1ZKH A;  2KJR A;  1AAR A;  4RM8 A;  2N7D A;  3BVM A;  1TBE A;  3KUD B;  4FHK A;  4LNO A;  2IO0 B;  3DHH C;  1TTN A;  4HCP B;  3EC8 A;  4DHJ D;  2Z59 B;  3PT2 B;  1K50 A;  1MVK A;  5JHA A;  2PPH A;  3BVG A;  5C2T B;  4IWQ A;  2C7H A;  5GXG B;  2PVO D;  2C5L C;  3AU4 A;  1GB1 A;  3MHZ A;  3M62 B;  3DBH B;  3SFD B;  2HTM E;  3NZU A;  3A4R A;  4AWJ A;  2WWZ A;  2K39 A;  3BWU D;  2DAF A;  2J4X A;  2JWU A;  3AEE B;  4HRO A;  1FNV A;  3OWE B;  1VJK A;  2NBW B;  2ASQ A;  2CHZ A;  3ZTC A;  2LEK A;  3CIR B;  2PEA A;  1FFU A;  2LUE A;  1IBX B;  5E6N A;  1F0Z A;  2XK5 B;  1FMA D;  4RGM A;  1TS2 A;  3K9O B;  3L4P A;  4US8 A;  3WAM A;  3P4S B;  3A9K A;  4NQL B;  2FAZ A;  1MHX A;  2ZPY A;  2LGX A;  2LGI A;  4OZB A;  3DQV A;  2V9H A;  3DOW A;  3DVN V;  3ZUN A;  1P3Q U;  1U4A A;  1WZ3 A;  2WNM A;  2JWZ A;  3VXW A;  1FPY A;  3PS6 A;  2JYE A;  3WAO A;  2G3Q B;  3SU8 X;  4FBJ B;  3LJ3 A;  2FNJ B;  2DYM A;  2A4Z A;  2RDG A;  5BO4 B;  1V5O A;  1FM0 D;  5EE3 A;  3NZ3 A;  3RUI B;  3BII D;  3NVW A;  1ZXH A;  4HVB A;  3KYD D;  4A6Q A;  1GG3 A;  3BYY B;  2MP2 A;  4WH4 A;  4WWO A;  1H7W A;  2BS4 B;  3NOB A;  4TMA B;  3PHW B;  1OFF A;  3EUB 2;  4IC7 B;  1D3Z A;  1N5X A;  1WE7 A;  2KXJ A;  1C78 A;  2O6V D;  1K51 A;  2KTR B;  2J0K A;  2C7N B;  4JIO U;  2KMM A;  1UGJ A;  3RN9 C;  1GT8 A;  2BF8 B;  1WX8 A;  4MH8 A;  1RFK A;  3AE1 B;  4B6W A;  1WI0 A;  2LJI A;  4G0N B;  4RCO A;  5G5H A;  2JX5 A;  2J7Q B;  3ZVV A;  4ARC A;  4WUR A;  3U7D A;  3MFG A;  1XF5 L;  5EE1 A;  5IO9 A;  1IP9 A;  3Q3J A;  3TJP A;  4ARI A;  3VTU A;  3APF A;  4GGQ A;  5GMV A;  2LGD A;  4Q2J A;  1P7E A;  2N7J A;  1KF6 B;  2CJN A;  1NEK B;  4RGN A;  2EEL A;  4BBN C;  2EKI A;  1MFW A;  4WWP A;  2HD5 B;  4JLC A;  2CJO A;  2DEN B;  2JT4 B;  1L6V A;  4RMA A;  5HKH A;  2LHE A;  2LJ5 A;  1TIF A;  2LI5 A;  4P1B C;  2FCQ A;  4K3B A;  3QHT A;  4GIV A;  3B08 A;  2ACZ B;  1H8C A;  2QHO A;  1PGA A;  3ALB A;  2C7M B;  4YT0 B;  4YWG G;  2JZP A;  2ZJD A;  1VZ7 A;  3C0R B;  1WWT A;  1WJ6 A;  3IBE A;  2ZW1 A;  1FXI A;  1L0V B;  1WY8 A;  3LB8 C;  2MBQ A;  4D2K A;  4NJ7 A;  1OQQ A;  3QC8 B;  4RF1 A;  3Q3O C;  4KIK B;  4HKZ E;  5CHW A;  3DPD A;  2WGS A;  4TKN A;  1C3T A;  1JRO A;  4HLE A;  1PYW D;  1BXT A;  3L17 A;  2M19 A;  2D2Q A;  4CO7 A;  5E6O A;  3MTN B;  5HHD G;  2PVG C;  3W9C B;  3M63 B;  4RF0 A;  4DQO C;  2KQ7 A;  4IDI A;  1A5R A;  3AE9 B;  3QK0 A;  4LNN A;  2E6X A;  3ZXR A;  4KVG B;  2WU2 B;  3V6C B;  3N1Z C;  4L2Y A;  1YMH E;  4MGY E;  4RH6 A;  1WH3 A;  3IAS 1;  4M0W B;  1E0Z A;  3UIN B;  4M02 A;  3RPF C;  3N32 A;  1WGR A;  3ZLZ A;  1R4M I;  4LJP B;  1WRD B;  2KZR A;  4CHK A;  4EKU A;  2DBY A;  3V60 A;  1L4D B;  1V1P A;  1WM2 A;  3NVV A;  1Z2M A;  3OJ3 A;  4NZL B;  1TS5 A;  1XCT L;  2XNA C;  4LLG M;  2KN4 A;  4KX6 B;  2I38 A;  2MRP A;  2WDQ B;  2NR2 A;  4BKT A;  3GOE A;  2JZ3 B;  4LNK A;  1YNT E;  1ZDX A;  5D7G A;  3ECI A;  1V81 A;  1UD7 A;  1SF0 A;  1DOY A;  2BVC A;  3OLM D;  2K3U A;  1I4Q A;  2JQR B;  2JPH A;  2N9K A;  1L2N A;  4LNF A;  2WYQ A;  3DBH I;  2BS3 B;  5KHO A;  2K25 A;  2RMM A;  2YEP B;  2AQ1 B;  1S1Q B;  4XZ4 A;  3TIX A;  1WM3 A;  2KHW B;  3APD A;  3VVW B;  2D3C A;  3AE8 B;  1I42 A;  2WHI A;  1TZO A;  4K7W A;  4BBN F;  4BVU C;  4ZRI A;  3GP7 A;  4MEL A;  4DK5 A;  2LHD A;  2QDF A;  2BKF A;  3A9K B;  1F9J A;  5BYQ A;  4ASW C;  1XCQ L;  1I4P A;  2VRR B;  1I4X A;  3PTF C;  1WX9 A;  5JZE B;  3I3T B;  4ZRP A;  3TSS A;  3U8Z A;  2DZM A;  2IZV B;  1TKY A;  1HZ5 A;  2Z8L A;  1WGY A;  5E6J A;  4P6V F;  3N9Y C;  3IT6 B;  4HEA 1;  3QX1 A;  3NJT A;  4MJS A;  1PQS A;  3EHV A;  3HK0 A;  2D07 B;  1C79 A;  3V62 A;  4WQO B;  1JWU D;  4PT5 A;  4C7Y A;  3MC9 A;  3V6E B;  1SJH D;  4EZL A;  2MP2 B;  4FJZ A;  2YLM A;  2DX5 B;  4KGS A;  4EZK A;  1L4Z B;  1WE6 A;  3HVD A;  1JRU A;  1J8C A;  3MC8 A;  2INN E;  2L00 B;  1QIL A;  3TCA A;  3ZNH B;  3ZIM A;  1ZP0 B;  2K8B A;  3SEB A;  2PE6 B;  4HPP A;  4OZC A;  4P1C C;  1D4B A;  1Y8R C;  1E5W A;  3W5V B;  3KQ4 A;  4JE3 B;  1CJE A;  1TGZ B;  2GI9 A;  4XDC A;  1QOA A;  5H92 C;  4MM3 A;  2V0G A;  4NPN A;  4DBG A;  3RCZ A;  2Z0E B;  1JW9 D;  2DZJ A;  3NUH B;  2WXJ A;  3LDZ E;  5J17 A;  1FD6 A;  2JRH A;  4HKQ A;  2K8H A;  2Y5B B;  2MW5 A;  4ACF A;  3I9V 1;  1ZPS A;  3H6N A;  1K53 A;  1QKZ A;  2VZK D;  4AJY B;  2OJR A;  1EWY C;  1EO6 A;  3X23 A;  4BOS C;  3B2G A;  3Q8F A;  4W9D A;  3HM3 A;  3HIZ A;  4NJC A;  4HWI B;  3TEW A;  1WXA A;  1FO4 A;  4WJQ A;  2NVU I;  3FC4 A;  3PSE B;  3ABV B;  1PFD A;  4K7S A;  4I6P A;  3VH4 B;  3T9L A;  1UGM A;  2JZZ A;  3AE4 B;  1N5W A;  4KZ0 A;  3IXS A;  5HI1 A;  2PKO A;  3VQI A;  1T0R C;  4GLS C;  3AEA B;  1C77 A;  4DHZ E;  2AL6 A;  4GB9 A;  2FUH B;  1OTR B;  2W82 A;  2M0A A;  3QIJ A;  4L1B A;  1FXT B;  3GB1 A;  3FIL A;  3AE6 B;  4A3P A;  3VUY A;  3ZNZ B;  2K9X A;  4W9G A;  2WQY B;  3PZD A;  3EGR A;  3HRD D;  4HPL B;  3P63 A;  1JML A;  1MPE A;  2INC C;  1TKE A;  1PGB A;  5CHV C;  2BWF A;  4JWU C;  3A4S C;  2MJ3 A;  2BTE A;  1E8W A;  3TEZ A;  3D32 A;  1WFY A;  1V1P B;  3VTW A;  2EKE C;  4XC2 A;  5AEK B;  1Q0W B;  2KJH B;  4CQN A;  2WU5 B;  2ZZP B;  1HA5 A;  2GBK A;  3RNC C;  5L83 A;  4GDL A;  3DCG A;  2GBR A;  4GXB A;  1WJU A;  3KYC D;  4ZYN A;  1MJD A;  1ET9 A;  2WX1 A;  2D3A A;  2KTF A;  2BT6 A;  3AUL A;  4KZC A;  5CTR C;  2MBE A;  3AI5 A;  1SBB B;  1SE2 A;  4IWO A;  5TSS A;  4H2A A;  1XEE A;  2KAC A;  2J0M A;  3UGB B;  4AS1 A;  4FAD A;  2BB6 A;  1RYJ A;  1UWX A;  2M4N A;  1OQY A;  2LRU A;  1N61 A;  1P7F A;  4US9 A;  4XWT A;  1E8Z A;  3A1Q A;  3QWZ B;  3R66 C;  2KDE B;  4E71 A;  1KJT A;  1ZXI A;  4YTM B;  4J6I A;  1ENF A;  4HK2 A;  2WXM A;  1E8Y A;  5C3J B;  2KLC A;  2LGS A;  1MI0 A;  1UEL A;  2WXN A;  3Q2A C;  2JF5 A;  5H8Y E;  2MLB A;  2RDH A;  2UU7 A;  1AN8 A;  1JRP A;  1WR6 E;  4HRS A;  3P2B A;  5DPS A;  2N7E A;  2IJ0 A;  4MJS B;  5KHQ A;  2JXX A;  1N63 A;  4ZDV A;  4KDL B;  3VR8 B;  1T5X D;  3MJW A;  1N60 A;  3PVL A;  4TQ1 A;  1ZE3 D;  2WXF A;  3VUX A;  4TQ0 A;  2KD0 A;  2L52 A;  2O6V A;  3HHM A;  4KGT A;  2KAJ A;  4LTU A;  2L8J A;  4PYZ A;  1H7X A;  3O65 B;  2FUG 1;  4N6E B;  4F8C B;  4K1R B;  3SDL C;  2N1W A;  3AEG B;  2WXG A;  4IG7 B;  5EE9 A;  2IND C;  4WWN A;  4CYE A;  2MH7 A;  2WXQ A;  4FHJ A;  1RRB A;  2FIF A;  1P98 A;  1UH6 A;  1EWC A;  1RAX A;  2NPT A;  1KLG D;  3BK2 A;  3MJ5 A;  3ZJV A;  3TL5 A;  5LXI B;  2KT7 A;  1SGH A;  1P0R A;  4B0M A;  2LUM A;  1SXT A;  3LXF A;  2QC8 A;  4A9A A;  2DYB A;  2BYE A;  2OHF A;  1WJN A;  4C56 C;  1SE3 A;  1WSP A;  3J9C A;  1BML C;  3AE7 B;  3UQB A;  3RZW C;  2FCN A;  1HTO A;  3PLU A;  4G50 A;  4C00 A;  3KH0 A;  4TSS A;  5IA7 A;  4NY0 A;  4W9L A;  3VR9 B;  5G2N A;  4LCD E;  2KQS A;  3VAW A;  3ZTD A;  5JXV A;  1JWA D;  1QOG A;  3Q8C A;  1WXM A;  1FIQ A;  1WX7 A;  3IHP C;  2W3S A;  4HJG E;  2BQQ A;  2RPQ A;  5TR5 A;  1HQR D;  3P4R B;  3RUL A;  2JRI B;  4YXD B;  1IPG A;  3KUZ A;  1GC7 A;  3QAR A;  2N9L A;  4A3O A;  1SB3 C;  5AUI A;  2B3A A;  2K0P A;  2BYF A;  2X8X X;  4FJY A;  2AYO B;  4WQM A;  4PS7 A;  1IGC A;  2DZK A;  3H7S A;  3QAQ A;  4K3C A;  1D6E C;  2SAK A;  1C4C A;  1V9J A;  2ZNV B;  4IUM B;  4LNI A;  3RYT A;  3SFE B;  3ZGZ A;  1V1O A;  2JSV X;  2QCZ A;  1WYW B;  2XEW A;  2IO3 B;  2ICI A;  4HDO A;  3FIL B;  3NHE B;  2GBM A;  3T8M A;  4RGT A;  3PLV A;  1P9D U;  2M17 A;  2VH2 A;  5EE0 A;  3H7P A;  5IP4 D;  4J3O D;  3PRE A;  4HDQ A;  2M0X A;  4I6N B;  1ZW7 A;  2WP9 B;  4M8M A;  1OEY A;  3HUI A;  1V5T A;  3KUC B;  2KWV B;  3PGE A;  2NTS A;  4FJV B;  3PO0 A;  3ZXV A;  2KQ4 X;  4DXA B;  2W54 A;  4ZHO A;  5I4D A;  1VZ6 A;  4A55 A;  2W3R A;  3ETR A;  5J2R A;  3NS1 A;  1QQR A;  2FID A;  1EF5 A;  2REX A;  3KVF B;  3CF6 E;  3RFZ B;  5DCN A;  3ZJU A;  2JYT A;  3A9J A;  4BFR A;  3R7Q A;  5G55 A;  2IGH A;  3WA0 A;  2BGF A;  5JH5 C;  1E7U A;  2N1V A;  1A70 A;  3U52 E;  2OJW A;  1JAL A;  3VRA B;  4XYC A;  3Q8A A;  4GDL B;  4AP4 C;  1YJJ A;  2MX2 A;  1EU3 A;  3V61 A;  5J18 A;  3N30 A;  2FBW B;  4W9I A;  4W9H A;  1D5X C;  1YX5 B;  4GDK A;  1I7H A;  4IKG A;  1TZ1 A;  3E56 A;  2RGF A;  1VLB A;  3AM9 A;  2TSS A;  1TJE A;  5BMG A;  5CHF A;  3EEC A;  2W9N A;  3QA8 A;  5D2M B;  5HG2 A;  2D11 A;  4GN1 A;  4YTP B;  1TS4 A;  3A1Q B;  2UWQ A;  3JYU A;  4JWS C;  2NBU A;  3IVF A;  2AWT A;  4XE0 A; 
#chains in the Genus database with same CATH homology
 4USA A;  1IUE A;  2FE8 A;  2YEP F;  1K53 A;  1QOB A;  1I4R A;  3URY A;  1DOI A;  1QKZ A;  4M0W A;  2DLB A;  2Y3A A;  2GRI A;  2VZK D;  2SEB D;  2WDV B;  1EWY C;  2OED A;  1RWS A;  3B2G A;  3Q69 A;  2E3T A;  3Q8F A;  5D3D A;  4A8X C;  3PZ8 A;  3PZ7 A;  1L6U A;  4NJC A;  2PW9 A;  4AQ7 A;  3TEW A;  1FO4 A;  1HZ6 A;  3P4Q B;  3FC4 A;  1IGD A;  1C4A A;  3LYY A;  3U2S C;  4RFB A;  3AED B;  3ABV B;  3VRB B;  1PFD A;  4XDD A;  3R8B A;  2QJL A;  3NVY A;  3BVM A;  3W1S A;  1PDX A;  1HEZ E;  1NYR A;  3IAM 1;  5G5G A;  3AE4 B;  1GB4 A;  2J52 A;  1N5W A;  1K50 A;  3B9J A;  1MVK A;  3AE2 B;  1WYG A;  3DWM A;  1GTE A;  3BVG A;  3IXS A;  2PKO A;  5HI1 A;  5C2T B;  5GXG B;  2PLP A;  1YJI A;  2PVO D;  4REZ A;  3VQI A;  3MHZ A;  1GB1 A;  4GLS C;  3SFD B;  2HTM E;  1N62 A;  3AEA B;  2AQ3 B;  1C77 A;  1QOF A;  3AE5 B;  4N58 A;  3BWU D;  3KWV A;  4A90 A;  2LMC A;  2J4X A;  2JWU A;  2HDE A;  3AEE B;  2W82 A;  4HRO A;  1L0X B;  1FNV A;  3OWE B;  2M0A A;  1VJK A;  4RNA A;  4L1B A;  2LEK A;  3CIR B;  3GB1 A;  3KWL A;  3FIL A;  1FFU A;  1UNS A;  2DWQ A;  1IBX B;  2QSD A;  3AE6 B;  1FMA D;  3DWG C;  1F0Z A;  4RGM A;  1TS2 A;  2NMQ A;  2K9X A;  1SEB D;  3L4P A;  4US8 A;  4XWW A;  1J7C A;  2WQY B;  3P4S B;  1ZUD 2;  1RM6 C;  3TEX A;  2INP E;  1MHX A;  1FNU A;  2PMV A;  2LGI A;  2G1E A;  4OZB A;  4ZHP A;  3EGR A;  1Y56 A;  4YSX B;  1KTK A;  1TKG A;  3HRD D;  4ZYS A;  3U7Z A;  2BYT A;  3P63 A;  1JML A;  2WNM A;  1MPE A;  1GPX A;  4R3D A;  1ROE A;  2AQ2 B;  2XN9 C;  1AYF A;  1E9M A;  2V3P A;  2JYE A;  1TKE A;  1JQ4 A;  1PGB A;  2L1A A;  1ET6 A;  4JWU C;  2DYM A;  2MJ3 A;  3ZQ4 A;  2BTE A;  1JWM D;  2RDG A;  1WRI A;  3AN1 A;  3TEZ A;  1FM0 D;  2ONQ A;  3BZD B;  3FAH A;  5EE3 A;  3NZ3 A;  1IBX A;  3BII D;  3BK1 A;  1ZXH A;  3NVW A;  3P1M A;  4A6Q A;  1V1P B;  3BYY B;  4KKJ A;  1SIJ A;  1YN5 A;  3R2T A;  3TUO A;  4WH4 A;  3CF4 A;  3P4P B;  4C7Z A;  4OZA A;  3AEC B;  1H7W A;  4CQN A;  1XLP A;  2BS4 B;  2WU5 B;  4MAC A;  4P16 A;  1HA5 A;  2DYO A;  1E7P B;  1GAQ B;  4TMA B;  2WXL A;  1OFF A;  3EUB 2;  2AX5 A;  1CQV A;  1AW7 A;  4C80 A;  2WXI A;  5BYS A;  1N5X A;  4O1N A;  3Q8E A;  4LK0 M;  1J7B A;  2Q5W D;  3WCQ A;  3BVZ A;  1C78 A;  1D5Z C;  1Q10 A;  1K51 A;  2H88 B;  3NVZ A;  2KWD A;  2KMM A;  1ET9 A;  1QLB B;  1FCC C;  2X38 A;  1UGJ A;  1GT8 A;  2BT6 A;  1NEN B;  2BB5 A;  4MH8 A;  2BS2 B;  1RFK A;  3AE1 B;  1SBB B;  1SE2 A;  3AMZ A;  2LJI A;  4RCO A;  5TSS A;  4H2A A;  1XEE A;  2KAC A;  4ZOH C;  4AS1 A;  1STE A;  5G5H A;  2BB6 A;  1RYJ A;  3ZYY X;  2JX5 A;  1UWX A;  1FRR A;  1PGX A;  3U4E G;  4ARC A;  1N61 A;  4WUR A;  1P7F A;  1ACC A;  4US9 A;  3MFG A;  1XF5 L;  4XWT A;  5EE1 A;  1DOX A;  2WXH A;  4N59 A;  2WXO A;  4ARI A;  3V3X A;  1ZXI A;  4YTM B;  1ENF A;  2WXM A;  2QIL A;  5C3J B;  1MI0 A;  1E6E B;  2PIA A;  2WXN A;  4Q2J A;  1GTH A;  1KLU D;  3BYT B;  1QF6 A;  1P7E A;  5H8Y E;  2RDH A;  2N7J A;  1FCL A;  2IPK D;  1WGK A;  1VZ8 A;  1AN8 A;  1JRP A;  1K52 A;  4HRS A;  1KF6 B;  2IJ0 A;  2CJN A;  1ZOY B;  3T3O A;  1NEK B;  4RGN A;  2EEL A;  2EKI A;  1N63 A;  2CJO A;  3VR8 B;  1C4P A;  1T5X D;  1SSN A;  4ZRQ A;  1N60 A;  1NVI D;  1WXQ A;  1L6V A;  4TQ1 A;  1ZE3 D;  1YN3 A;  2WXF A;  2QMT A;  2LHE A;  4TQ0 A;  1VRA B;  3ZJT A;  2L52 A;  4KGT A;  2KAJ A;  4LTU A;  1H7X A;  2ACZ B;  2Y5C A;  1PGA A;  2FUG 1;  4N6E B;  4YT0 B;  4YWG G;  1YQ4 B;  2D5G A;  2JZP A;  2NTT A;  3AEG B;  2WXG A;  4JPS A;  1VZ7 A;  5EE9 A;  1BUI C;  1WWT A;  2MH7 A;  4DXF A;  2WXQ A;  1KFY B;  1EU4 A;  2ZW1 A;  1TYG B;  1FXI A;  3KLS X;  1L0V B;  3LB8 C;  1EM7 A;  4D2K A;  1EWC A;  1OQQ A;  1KLG D;  1UWM A;  3BK2 A;  4RF1 A;  3TEY A;  3C8Y A;  3MJ5 A;  3ZJV A;  4GDK B;  3AEF B;  4HKZ E;  2R61 A;  1ESF A;  2KDM A;  2WXP A;  2LUM A;  1SXT A;  4B0M A;  3MC0 B;  4L23 A;  1JRO A;  3LXF A;  1PYW D;  1JWS D;  1BXT A;  2M19 A;  2RPV A;  4A9A A;  4DXG A;  5HHD G;  2PVG C;  2OHF A;  3W9C B;  4C56 C;  5HFY A;  4DQO C;  4RF0 A;  1SE3 A;  1WSP A;  3J9C A;  4IDI A;  5BMI A;  3AE9 B;  5FR3 A;  1BML C;  3AE7 B;  2E6X A;  1V97 A;  2WU2 B;  3EA6 A;  1R7S A;  4L2Y A;  1YMH E;  2JXT A;  4RH6 A;  1DYQ A;  1YN4 A;  4TSS A;  1JWB D;  4NAW B;  3IAS 1;  1C76 A;  2N0S B;  1E0Z A;  1L5P A;  1QT9 A;  3RPF C;  1DGJ A;  2LFI A;  2GB1 A;  1T3Q A;  3VR9 B;  2H89 B;  2M56 B;  1CZP A;  2WXK A;  1YQ3 B;  1B1Z A;  2DBY A;  1FNW A;  1L4D B;  3HVZ A;  4WWM A;  5JXV A;  1JWA D;  1QOG A;  1V1P A;  2IGG A;  1T6B X;  3NVV A;  3Q8C A;  5D3I B;  5BYR A;  2BBC A;  1FIQ A;  2WS3 B;  4NZL B;  2W3S A;  1F2R C;  4HJG E;  3CWI A;  3H8H A;  1TS5 A;  1CK1 A;  3I57 A;  2MJD A;  1LO5 D;  1XCT L;  1F2R I;  4WAF A;  2XNA C;  4LLG M;  2IGD A;  1HQR D;  3P4R B;  2KN4 A;  4KX6 B;  2I38 A;  4YXD B;  1GOZ A;  2WDQ B;  2N9L A;  2J42 A;  1OQR A;  1SB3 C;  3R2I A;  5AUI A;  2K0P A;  1TY0 A;  1M4V A;  1YNT E;  4WQM A;  1ZDX A;  1ZDV A;  2G9H D;  5D7G A;  1C9F A;  1IGC A;  3T3N A;  1PUT A;  1VR9 A;  2IDY A;  4IOI E;  4YSY B;  3UI3 A;  1D6E C;  1SF0 A;  1DOY A;  2SAK A;  1XLO A;  1C4C A;  3IT4 B;  2K3U A;  1I4Q A;  2MEK A;  1XLN A;  2JQR B;  2K22 A;  3W5U B;  2N9K A;  4FXC A;  3SFE B;  1TY2 A;  3ZGZ A;  1V1O A;  2JSV X;  4JX1 C;  2BS3 B;  2RMM A;  2YEP B;  2AQ1 B;  1XLQ A;  3AH7 A;  1NYQ A;  2ICI A;  3AB5 A;  3AE8 B;  3FIL B;  2VZK B;  1L0Y B;  1TZO A;  4RGT A;  2QEJ C;  5EE0 A;  4J3O D;  3GP7 A;  3E9S A;  2LHD A;  2ON8 A;  2WP9 B;  3O13 A;  5BYQ A;  1B9R A;  1JCK B;  1XCQ L;  4RGO S;  1I4P A;  3HUI A;  3SR6 A;  5AUK A;  1I4X A;  1MHH E;  1I4G A;  2JU6 X;  4ZRP A;  2NTS A;  1TS3 A;  4MT5 A;  3TSS A;  2Y5P A;  1TKY A;  1HZ5 A;  1V8C A;  2Z8L A;  3GS2 A;  3Q8B A;  4OW0 A;  5E6J A;  3PO0 A;  4P6V F;  3AE3 B;  1UUP A;  1KH0 A;  2KQ4 X;  3N9Y C;  4UDU C;  2W54 A;  4ZHO A;  3IT6 B;  4OHJ A;  4HEA 1;  5I4D A;  2L32 A;  1VZ6 A;  4A55 A;  4WIP A;  2W3R A;  2BW2 A;  3ETR A;  3NS1 A;  4NAM A;  1QQR A;  2WXR A;  5FK9 C;  1C79 A;  1AWD A;  1I4H A;  4YTN B;  1JWU D;  3RFZ B;  1HXY D;  4PT5 A;  2V4I B;  3ZJU A;  2JYT A;  4C7Y A;  2I2Y A;  3P42 A;  4MM3 B;  1SJH D;  3V05 A;  3MP9 A;  2IGH A;  2ZW0 A;  4KGS A;  1VDV A;  1A70 A;  2V3N A;  3AV8 A;  4YSZ B;  3U52 E;  3W2D A;  1L4Z B;  3HVD A;  1JAL A;  4B0E A;  3VRA B;  1SJE D;  3NRZ A;  2QIE B;  1NI3 A;  4ITK A;  2INN E;  3Q8A A;  1F77 A;  4GDL B;  1QIL A;  2W55 A;  1ZP0 B;  1YJJ A;  3SEB A;  1EU3 A;  4OZC A;  2CU3 A;  1KRH A;  2B76 B;  1FFV A;  1D4B A;  4KGR A;  1SE4 A;  4EE2 A;  3W5V B;  2L83 A;  2FBW B;  3KQ4 A;  1XO3 A;  4JE3 B;  5MPO A;  1E10 A;  1CJE A;  3B2F A;  2GI9 A;  1FRD A;  1QOA A;  2PTL A;  2WLB A;  4XDC A;  1D5X C;  5H92 C;  2J53 A;  2V0G A;  1I7H A;  4IKG A;  3E56 A;  1JW9 D;  1VLB A;  2K5P A;  3AM9 A;  2TSS A;  1TJE A;  5BMG A;  1D5M C;  3NUH B;  2WXJ A;  5HG2 A;  1FD6 A;  2WDR B;  5T8I A;  4KKI A;  2MJE A;  1FXA A;  4HKQ A;  1FEH A;  5FKA C;  5BMH A;  4YTP B;  5LNK 1;  1TS4 A;  3I9V 1;  1ZPS A;  4JWS C;  3AEB B;  1J7A A;  4OVZ A;  1XXG A;  4XE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...