1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
3WCQA 3AEEB 5H92C 1ROEA 1YJIA 3AH7A 3HVZA 1GTEA 2CJOA 4C7ZA 3VRBB 1DOIA 3AE3B 3CWIA 4N59A 2W55A 1XO3A 4FXCA 3W5VB 4YSYB 1GTHA 1WGKA 2K22A 3LXFA 1N5WA 5AUKA 4JWSC 1DOXA 2WDVB 1F0ZA 2CU3A 2W3RA 1AWDA 1A70A 3BIID 1J7BA 3AECB 2H88B 1L6UA 4WQMA 3VR8B 1NYRA 3FAHA 1YJJA 2BS3B 2PKOA 4YTMB 1PUTA 1QOGA 3NVWA 1VLBA 3AEDB 3VRAB 4WWMA 1RYJA 1XLPA 2DWQA 3AE1B 3B9JA 1NENB 3AEAB 1NI3A 3B2GA 3NVVA 5EE1A 1QT9A 1RM6C 3AE7B 1N61A 2AX5A 1VDVA 1ZP0B 2PVOD 5C2TB 1GAQB 2M56B 3CIRB 3SFEB 1QOFA 1PFDA 2LEKA 3ETRA 1L6VA 1NEKB 2FBWB 2OHFA 3AE2B 4HRSA 5EE9A 1KFYB 1QLBB 3P4SB 3NVZA 4ZHOA 3AMZA 3AEBB 3CF4A 3P4RB 1J7CA 5MPOA 1FM0D 1JWAD 1TKGA 1JALA 1JW9D 1ZUD2 2WP9B 2MH7A 3AB5A 3AEFB 4YSXB 3AE6B 5H8YE 1L0VB 1KF6B 1QOBA 1FXAA 1R7SA 2JQRB 2MJDA 2W54A 1RFKA 3W9CB 4YTPB 2ACZB 2KMMA 3ABVB 2PVGC 3DWGC 1XLQA 2WDRB 3P4PB 1RWSA 1N60A 1YQ4B 1WWTA 1XLNA 1JROA 2L83A 4P6VF 1XLOA 1E6EB 1FO4A 2H89B 1N5XA 3ZYYX 3VR9B 2K9XA 1OQRA 1I7HA 3AV8A 1OFFA 3HUIA 1EWYC 1OQQA 2G1EA 1FXIA 1CJEA 3DWMA 1JQ4A 1J7AA 1PDXA 1L5PA 4JWUC 3W5UB 1N62A 1VJKA 1V97A 1NVID 1FIQA 4ZHPA 2WDQB 2KAJA 3EUB2 1E9MA 3FC4A 5G5GA 1B9RA 1TYGB 4C7YA 1WXQA 2WU2B 3AE8B 3AEGB 1TJEA 1TKEA 2HTME 3AM9A 5G5HA 3RPFC 4YTNB 2E3TA 5AUIA 1IUEA 1WYGA 2M19A 1V8CA 1FFVA 3PO0A 3AE4B 2W3SA 2WU5B 2BT6A 3P1MA 3P63A 4USAA 4YT0B 2Q5WD 1E0ZA 2BS4B 1ZXIA 3L4PA 1H7WA 4US8A 1E10A 1GPXA 1KRHA 3AE5B 2MJEA 4ZOHC 2BS2B 2CJNA 5C3JB 1FRRA 2PIAA 2EKIA 4LTUA 3SFDB 1YQ3B 1FMAD 3HRDD 1NYQA 4C80A 2K5PA 1UWMA 4A9AA 1FFUA 1TKYA 3NS1A 4KX6B 4US9A 1E7PB 4YSZB 2N0SB 4JX1C 1N63A 1SF0A 5EE3A 2B76B 1SB3C 2QIEB 1AYFA 2DBYA 1QF6A 1ZOYB 3SR6A 4YXDB 2QJLA 1DGJA 2WLBA 2MJ3A 1DOYA 2Y5CA 2L52A 1T3QA 4HROA 4ITKA 3AE9B 1JWBD 3LB8C 1GT8A 1FRDA 1CZPA 3AN1A 3KWLA 3NRZA 5GXGB 2WQYB 4IDIA 1QOAA 1SIJA 1WRIA 1JRPA 2JX5A 3NVYA 4N6EB 5EE0A 2WS3B 3P4QB 1H7XA 3B2FA 4N58A
chains in the Genus database with same CATH superfamily
4E74A 1GUAB 1VZ7A 4KSLC 4HPPA 4C4VA 5C23A 1BT0A 3VFKA 2W55A 2TSSA 1YX6B 2WYQA 3A4SC 4ANXA 2KACA 4WQMA 3VR8B 1YJJA 3HM3A 1L4ZB 2MEKA 1I4GA 4M01A 1Z2MA 3MHZA 1WM2A 1BUIC 4HEA1 2VZKB 2ZW1A 3B0AA 4W9EA 2LUEA 1TZ1A 2KWVB 3QK0A 1HEZE 4O1NA 5J18A 3CF4A 4RGTA 1UGMA 1JWAD 1RLFA 3URYA 2LUMA 2WWZA 2XEWA 2KJRA 2KWDA 4JL9A 4URKA 2X8XX 1EU4A 4EZKA 3Q3JA 5DCNA 2GI9A 1WM3A 3AV8A 1V49A 2IZVB 3GP7A 3RULA 2V9HA 3EUB2 5G5GA 3SDLC 4A8XC 1TJEA 2K39A 2NPTA 1C78A 4W9FA 1HTOA 2CHXA 2JZPA 2KOXA 2QC8A 1YMHE 3P1MA 1HZ5A 1E8ZA 2DAFA 1FNWA 4OZCA 4YT0B 2Q5WD 2INCC 3BZDB 2NS5A 4K7SA 4KGSA 1H7WA 1H8CA 2V3SA 4TQ0A 1C9FA 3L54A 1A5RA 2M17A 5L95C 1ET9A 2N0SB 2MP2A 4AQ7A 2D10A 2QIEB 1ZOYB 2ZJDA 3HK0A 3KUDB 1DGJA 1I4QA 4ITKA 2GOWA 1QQRA 3AE9B 1LO5D 1NDDA 5HKHA 2NBUA 2L8JA 3KQ4A 2M0AA 1M4VA 3DHIC 1ROEA 4DBGA 4OZBA 2DZKA 3AE3B 3UI3A 4HLEA 3K9OB 3Q2AC 2J42A 1WGYA 4G11A 1SSNA 3LXFA 4JWSC 2C7HA 4XDCA 1A70A 1EF5A 3IT4B 1UD7A 2ICIA 2I2YA 3L0WB 4XGAB 3GZNI 1JMLA 3SFEB 1P7FA 3I9V1 1WFYA 3NUHB 5IP4D 4G50A 4ZHOA 4MM3A 4B9KA 1FM0D 3DVGX 2LJIA 4XDDA 4M00A 1Y56A 5BMIA 2PVGC 4OHJA 1XLQA 2MHJA 2Z8LA 3VUYA 3T3OA 1TY2A 4FULA 4C56C 3NG0A 4WJOA 1J7AA 1LM8B 4W9JA 4FADA 1AN8A 3ZXVA 1TYGB 1WXQA 2HTME 2A5UA 4MGIE 1SE9A 2HJ1A 4YTNB 5AUIA 1IUEA 2DYOA 4IG7B 1V8CA 4W9LA 2BT6A 2LVOA 3GOEA 1Q0WB 5AZFA 4BZAA 5DPWA 1E10A 3R2TA 4N9F4 4PS8A 2Z0EB 2LMCA 2EMTA 3H7PA 2ONQA 1EM7A 2QHOA 1V1PB 3ZW3A 4US9A 2HTHA 1XCQL 1SB3C 4K1RB 2GBNA 1GC6A 3WAOA 3Q3NC 1FNUA 3QQ8B 4OW0A 3MTNB 2RMMA 3VHTC 3P4QB 5J2RA 3H8HA 4WH4A 3KWVA 3W5VB 4FBJB 2MQJA 1N5WA 3KYCD 1F52A 4BKGA 5IKCM 4BOSC 3BIID 3AXCA 5CHFA 1VR9A 1JWSD 5I4DA 1CMXB 2AL3A 4GXBA 1LXDA 3AE1B 1FXTB 1NI3A 2IJ0A 1QT9A 2KKCA 3EA6A 4MSMB 2FBWB 3DBSA 3O65B 1MFWA 4GSWA 2N7JA 3AEBB 5MPOA 1WYWB 3T8MA 3PLUA 3AEFB 3AE6B 2ZW0A 4NNJB 1WJ6A 2FUHB 3DBHB 1YD8U 2KMMA 4BKSA 1I4RA 2PE6B 2RR9A 2FIFA 2H89B 3PRMB 4RGOS 2KT7A 4MJSB 2ZPNA 1OFFA 2JF5A 4M8NA 1JQ4A 4YWGG 4JWUC 4BKTA 2EELA 2KDFB 4HCPB 2WDQB 3TBLD 2HDEA 1VZ8A 4WJPA 1S1QB 3IAM1 2M19A 2K6DB 1TY0A 1R4MB 3SEBA 3ZNHB 3T3NA 2REXA 2LD9A 1T5XD 1ZKHA 4XWTA 2L32A 1FCCC 2A4ZA 3DDCB 4W9HA 3N20C 4MGKE 3MHSD 5DPSA 2DBYA 5IOIA 3MC9A 2QJLA 4MDKE 1SJHD 1V86A 3JSVB 2C60A 4BOZB 3VVWB 1D3ZA 3WAPA 5CX3A 5D7GA 1K50A 5EE0A 2WS3B 4REZA 4DHZB 3C0RB 1Q5WB 1WE6A 2ZNVB 3B08A 3A1QB 2BKRB 4FLHA 1D5XC 2PEAA 3ML8A 2OJWA 2KFJA 1ZE3D 2MLBA 4E3CA 3JYUA 2PMVA 3KH0A 2INDC 2RPQA 1JWUD 3ONSA 3EHVA 3NOBA 1GAQB 1YN3A 1IYFA 4Q2JA 4RF1A 3WA0A 2KLGA 4XC2A 3ZIMA 1NBFC 3IAS1 1T0SC 1QZEA 1TKGA 3IFWB 4EZJA 3APFA 3W9CB 5DPRA 2ACZB 1RWSA 2K0PA 3QA8A 4KZ0A 2CR5A 1CJEA 4K3BA 4XYCA 4NQLB 4PK1A 2N7EA 2WXOA 2LGXA 1WRDB 2N4FA 4F8CB 3VH4B 4ARCA 4MSQB 4QAYA 4B0EA 3NZUA 1GPXA 2KVZA 1MG8A 3QJZA 4NAMA 5FR6A 4K7UA 4C80A 3I63C 3K9PB 3WAMA 2LI5A 2GBRA 4ZYNA 2VRRB 3ZTCA 1P1AA 2BVCA 3Q14C 1HA5A 4RH6A 5D6JB 1F9JA 2LFIA 2KX3A 3HVDA 3NZSA 2WXMA 3AH7A 2V4LA 4J6IA 4MACA 4C7ZA 1DOIA 1XO3A 1UNSA 1SBBB 4GU2A 4G0NB 2H88B 1L6UA 1WX8A 3FAHA 1L7YA 5HHDG 3IHPC 1WXMA 1RYJA 2LJ5A 2KMAA 3VTVA 2AL6A 2AX5A 2DZIA 3RUIB 2HJ8A 4LLGM 5KHOA 1I42A 4IM0A 2GB1A 3BVMA 3CMMB 4YSXB 5H8YE 1KF6B 3RNBC 4YTPB 4AJYB 2AQ3B 3I5JC 1XLOA 4LJOB 3NJTA 4EZLA 4ZYSA 3L08A 1OQRA 3J9CA 4HKZE 2N9KA 4HPLB 1RRBA 3WIMA 1TKEA 3HHMA 5G5HA 2ZZPB 4ZRIA 4WAAA 3PO0A 3DBLB 1T0RC 2RDGA 1ZXIA 2O6VD 3A1QA 2CJNA 3M3JA 2O6VB 5C1ZA 1J0GA 4AWJA 1CK1A 2C7NB 1T3QA 1IGDA 3TL5A 3LB8C 5GXGB 2J53A 3DPDA 4MGZE 2JX5A 2JT4B 3RCZA 4A55A 3RPFC 3B2FA 2UU7A 2K8HA 2W82A 2MW5A 3AU4A 2JYTA 3KVFB 4GDKB 1F2RI 2CU3A 2WXIA 3PT2B 5IO9A 4EFOA 4AUQC 1M94A 2JZ3B 2BYEA 1TS4A 3FILB 3A4RA 2BW2A 4DXFA 2CHWA 2KMCA 1MG4A 5EE1A 2PVOD 3N1ZC 2IO1B 2J52A 3HIZA 4HRSA 2JXXA 4W9GA 4ZRPA 4RGNA 3AB5A 2FIDA 2JZZA 3NZ3A 3N1XC 3VUWA 3H6NA 3RZFA 4MJSA 3ZVVA 1V6EA 3RNEC 3PRZA 3ECIA 4HJGE 1DYQA 1XT9B 2PW9A 5FR3A 3ZDMC 1NI2A 2HD5B 4EKUA 1L5PA 2JRHA 4BAXA 1SJED 4G3XB 1VJKA 1BXTA 1XF5L 1UH6A 2JWZA 3L16A 4LNKA 1WJNA 2KQ4X 1WYGA 1YJ1A 2O2VA 2WU5B 1J19A 1L2NA 1E0ZA 2CHZA 3TEYA 1C77A 4LDTD 4HJKA 5JH5C 1V9JA 4NAWB 1ENFA 3U2SC 3PVLA 1C4PA 1R4NB 1WY8A 2RSUA 2WDTB 1OEYA 1TS2A 1N63A 1EUVB 4ZDVA 4EE2A 3U4EG 4RNAA 1DOYA 1SIFA 2LGDA 4S0RA 5LLIA 2J7QB 4TQ1A 2WXQA 3BVZA 4IDIA 1V5TA 4YL8A 3N9YC 2RD0A 1EF1A 3ZLZA 2IY0B 2KNBA 1P98A 2Y3AA 1YN5A 1KLVA 2V3NA 1OEYJ 1MVKA 3NY5A 4XE0A 3M95A 4YTMB 4BFRA 1YN4A 3AE7B 2ZPYA 3SR6A 1FCLA 2G4DB 3V6EB 2N7DA 2OHFA 2KJ6A 2XN9C 4DXGA 2NR2A 1C76A 2W54A 2FCQA 5BO4B 2O6VA 1JWMD 3OG5A 1JROA 4I6PA 5E6NA 3VDZA 4AS1A 1KLUD 3BYYB 2D3CA 3EFCA 4RM9A 2D3GA 2LRUA 4KIKB 4XZ4A 4C7YA 3AM9A 2N9PC 2WXKA 4AOFA 2R61A 2MRPA 2D2QA 3GS2A 3LDZE 4PYUA 1OTRB 2C7MB 3TEWA 3ZGZA 1E5WA 4PS7A 4RM8A 3Q6BA 3R3MA 2IGGA 1FMAD 2MCNB 3VAWA 2RPVA 2V3PA 2AEHA 1GNUA 2Y5BB 2WLBA 2KTFA 2WGSA 4MT5A 4HDOA 1LGRA 1ISNA 1C3TA 3EGRA 4N6EB 2VH2A 1GG3A 1Z5SB 2MX2A 2GLSA 2PJHA 1KJTA 1TZOA 2WXFA 2DENB 2BYVE 1GB1A 2CKHB 3ZJUA 4D2KA 4OVZA 5E6JA 4RFBA 4FXCA 4YSYB 3VUXA 1DOXA 2XNAC 3Q8EA 3T9LA 1AWDA 2NTTA 4OZAA 3AEDB 2G4SA 1EO6A 4IW0A 1UWXA 3LJ3A 3EFUA 3B2GA 3NVVA 2PLPA 2LRWA 4HROA 3CIRB 2LEKA 4OVUA 5JXVA 4A20A 2MBOA 4DWFA 2BQQA 3DOWA 3TJPA 1UF0A 4F7ZA 4XWWA 2MH7A 2YVCA 3QX1A 1VD2A 3DBRB 2JPHA 3OAWA 2WXHA 3DBRI 3DWGC 2PPHA 2G9HD 4NAWA 4P6VF 2K9XA 1OGWA 2R2OA 2OEDA 2J0JA 5CHVC 5JHBA 1NVID 5LXHA 2KX0A 2UYZB 1FIQA 2Z59B 1RAXA 1KLGD 1WSPA 1OQYA 1UBIA 1Q1OA 4JPSA 5LXIB 4K81A 4LCDE 3AE4B 5E6PA 1X1MA 2NPTB 3MP9A 2KZRA 1E8YA 4C00A 2JYEA 3DCGA 3PS6A 3QWZB 2MJEA 3Q8AA 1VZ6A 1QILA 2EKIA 3RNGC 4FJVB 4AJWA 5FK9C 1SE4A 4E71A 4KKIA 2L52A 3U52E 4WWOA 5HI1A 2WXNA 2MP2B 1JWBD 2L7RA 4GIVA 2WQYB 3RZWC 2D11A 1WXAA 2L76A 1ZPSA 1L0YB 5H92C 2FUG1 3HVZA 4GDKA 3VQIA 3Q8CA 4IKGA 4NZLB 4GMVA 5AUKA 3UF8A 1IGCA 2KO3A 1TS5A 2NBWB 3N1YC 2K25A 3PHWB 2IO3B 2CS4A 2DZJA 3NVWA 3I3TB 2FCSA 2LGIA 4DHJB 4FJYA 1RM6C 3ALBA 2K6QA 2FAZA 1PFDA 4TSSA 3IT6B 5G2NA 5EE9A 3MJ5A 4KZCA 3IBEA 4PT5A 1E8XA 3Q3OC 4LDTB 1T6BX 4M0WA 1WH3A 4WJNA 5TR5A 4KDIC 4IM3A 4MM3B 3OLMD 4ANWA 4DDID 5LNK1 3ZNZB 2N9XA 4B95A 2XK5B 3ML9A 2DAJA 1WGHA 2IO2B 1EWCA 3U30A 4NPNA 4HK2A 1U4AA 1UZXB 1KM7A 3U7DA 2O2VB 3AEGB 1S3SG 2GBKA 2KN4A 3TSSA 3ZDTA 1FFVA 3P2BA 5BYQA 2KXJA 1KH0A 3PTFC 3QHTA 3UQAA 3ZUNA 3RNAC 2BYTA 3UINB 4GGQA 1D4BA 2ASQA 1NYQA 2K5PA 2RDBC 1FPYA 4YSZB 4K3CA 1ZW7A 1XD3B 1V1PA 2FNJB 1V80A 2LHEA 4A90A 1AW7A 1WRIA 3Q3FA 4B6WA 4IM2A 2ZEQA 3TUOA 2EMSA 3W1SC 3P42A 3QC8B 1YNTE 4X57B 3D32A 1D5ZC 4N59A 3CWIA 2LVQA 1WXSA 3QARA 3MC0B 4PYZA 4P7IA 1F0ZA 4JIOU 2BKFA 3KYDD 1LQBA 5AZGA 3U7ZA 1WXVA 1GJZA 4GOCA 1PYWD 3AEAB 2SAKA 2WXJA 3GZNB 3RNCC 2C9WB 5J17A 1QOFA 3TEXA 1YQBA 3BK2A 2BWES 2FCNA 4GN1A 1E90A 1PGXA 3QCAA 1KFYB 3PREA 3S2AA 1IPGA 3AMZA 3PV1A 2QILA 1MPEA 2L00B 3L17A 2N1VA 4A3PA 3V61A 4EEWA 4MH0E 4DDGD 4RF0A 1GC7A 4LJPB 2JWUA 5HG2A 2DLBA 2KC1A 3FILA 1V81A 1EWYC 2JVCA 3PLVA 2DHZA 1N62A 4LNFA 5IN7A 2KAJA 2DNFA 5DPTA 2YEPF 4WIPA 3PRPB 1WJ4A 1MHXA 2GRIA 2BBCA 3KLSX 4ASWC 3DVNU 4USAA 1PGBA 2BS4B 4GDLB 4MEMA 4KGTA 3AE5B 4IC7B 3UQBA 2PIAA 2JXTA 2KDBA 1YQ3B 4DHZE 2WXGA 1HXYD 3W1SA 3ZJVA 5BMGA 2IO0B 4ACFA 5BMHA 2WNMA 5EE3A 5BYRA 4S17A 4DXAB 3U8ZA 1YOVB 4B0MA 2KN5A 1WMHB 2WX1A 2JSVX 4LNNA 4CO7A 2K8BA 3H7SA 2AQ1B 3JSVA 1UGJA 1XXGA 1MJDA 2KDIA 3A9KB 1YJIA 4DHJD 1YX5B 3RFZB 2BTEA 5KHQA 4KVGB 3Q69A 1WGKA 1WF9A 3BWUD 4P1BC 3E9SA 4CQNA 3JW0X 3L10B 3ZRCA 2BPSA 1K53A 2DWQA 2IGDA 1GB4A 3B9JA 1VDVA 3L13A 5AEKB 4DQOC 2V1YA 4RMAA 3ENEA 5FKAC 3NVZA 2DYBA 1JW9D 1L0VB 1R7SA 4NY0A 1E7UA 3M63B 2BWFA 2GBJA 1YQ4B 1WGRA 3HUIA 4LNOA 1RFAA 2I1JA 1TBEA 4L2YA 3CF6E 3MJWA 1EU3A 3R66C 1R4MI 3APCA 3P63A 4IUMB 4JGHB 1VRAB 2D07B 3PGEA 1H4RA 2QSDA 2BS2B 1FRRA 4M02A 2RGFA 3PPAA 1K51A 2LASA 1WX7A 1E7PB 4KDLB 3LYYA 5BYSA 2CU1A 2ZCCA 2L05A 1B1ZA 1GT8A 3KWLA 1CZPA 2KJHB 4M8MA 4EOYA 2NBVB 1SIJA 2YEPB 3ZNID 3NVYA 2VH1A 4WWNA 1D5MC 2CJOA 2N9EB 3VTUA 2K1FA 2KHWB 4MGYE 4HWIB 2K22A 3X0WA 2BF8B 3H1UA 2KLCA 4TMAB 2KC2A 1J7BA 1P9DU 2BS3B 1T0YA 1PUTA 3DHHC 2M4NA 3RYTA 2WXRA 1NENB 1E7VA 3V6CB 2MBHA 4NJCA 1ZP0B 2M56B 2C5LC 3AE2B 3AI5A 3R8BA 2N9LA 2WXLA 1ZUD2 5HFYA 1WIAA 1RFKA 2XK5A 1XLNA 5D3IB 5L83A 4BBNF 5AZHA 3ZYYX 1D6EC 3RD2A 4PS3A 3MC8A 2LHDA 3PZDA 5CHWA 2G3QB 4ZRQA 3AULA 1N6ZA 3QIJA 4KV2A 3R2IA 2I38A 2IBIB 3A9KA 2QMTA 3R7QA 4US8A 1MHHE 3Q3MC 5TSSA 2NVUI 4LTUA 4NJ6A 1UWMA 2IGHA 2ON8A 3JVZX 4W9KA 2KTRA 2J0KA 1FRDA 4JQWC 4WJQA 1ESFA 3OWEB 1WGGA 4HCNB 1K52A 2LWPA 1SXTA 1WI0A 2BGFA 2HE7A 4H2AA 2D3BA 3BINA 1CQVA 2OOBB 1BMLC 1Q10A 1L0XB 2K3UA 3W2DA 1VCBA 4IWOA 1V5OA 5D2MB 2KANA 4NQKE 1E8WA 5C2TB 2L3ZA 1WZ0A 1L6VA 1NEKB 1WZ3A 3IG3A 1R4NI 1YIWA 5IAAC 3P4SB 2JU6X 1KTKA 1STEA 2KFKB 1IBXB 2M1MA 2MJDA 2KYWA 2ZNVC 2WDRB 2L83A 3W1YA 3ZO5B 1SEBD 4P16A 1L4DB 1FO4A 1TTNA 2QCZA 1I4PA 1C4CA 2AQ2B 4DK5A 1V97A 3APDA 3PHXB 4FHKA 1MI0A 1B9RA 3FC4A 3AE8B 1I35A 4JLCA 2BB5A 3SU8X 2MBEA 4A3OA 4GDLA 3DBLI 2W3SA 4M0WB 3VXWA 1JRUA 2DYMA 2LXCA 4OVVA 2Z0DB 2L0FA 2KQ7A 1WJUA 1LFDA 2K8CA 1FFUA 4BBNC 1WMHA 3RT3B 1QF6A 4ICVA 2KQSA 2OJRA 4A6QA 1HTQA 3RN9C 3PZ8A 3NRZA 1WX9A 2NCNA 2QEJC 1UUPA 2FCMA 4WWPA 1P7EA 3N30A 2KWUB 3AEEB 3PZ7A 2YLMA 5T8IA 5G55A 3A9JB 5JHAA 1WR6E 2PE9A 5D94A 2AWTA 3GE3C 3AECB 4ICUA 4R3DA 4WWMA 1XLPA 1ZXHA 3BK1A 2LZ6A 2LXAA 1N61A 4LNIA 4FN2A 4WAFA 2LGYA 4RCOA 5E6OA 2KK8A 3KUCB 2AYOB 2JRIB 2D5GA 1QLBB 4FHJA 2XBBC 4ANUA 3ZTDA 1JALA 2NMQA 1UELA 1QOBA 4LK0M 2ZVNA 4HPMB 3ABVB 2BB6A 3RMKC 1N60A 4ZRKA 3Q8BA 1E6EB 1N5XA 3MFGA 3BY4B 1PGAA 2IYDB 2G1EA 4EUTA 1FXIA 1C1YB 2NTSA 1ZDXA 1ACCA 1TT5B 2KTRB 3I57A 2JY6A 3BYTB 4KKJA 4KIKA 4CYEA 2E6XA 2PTLA 3DVGY 2B3AA 1SE2A 4F1SA 1T0QC 2MSED 4IOIE 2GBMA 4BKSD 4ZOHC 2W9NA 3X23A 1I4XA 4BVUC 2VZKD 4IWPA 1PQSA 4KX6B 4FA6A 4GB9A 3V60A 2B76B 1AYFA 3BVGA 2Y5CA 5D3DA 2MWSB 3C8YA 3QAQA 3UGBB 1FNVA 1C4AA 4WURA 2ZCBA 1JRPA 2I1KA 3UIPB 3DVNV 1H7XA 2EKEC 4N58A 4ARIA 3WCQA 1GTEA 2V0GA 1IBXA 4HKQA 2R2QA 2RDHA 1GTHA 1G6JA 1WE7A 4I6NB 4W9IA 3ZKJC 4HVBA 2WDVB 2G45B 3EC8A 2J0MA 5JZEB 1NYRA 2INNE 2PKOA 3V05A 1QOGA 1JCKB 1VLBA 4HDQA 3VRAB 3FKYA 4JE3B 2WX0A 3ETRA 3GE8C 3EECA 1TIFA 5EDSA 1HZ6A 4MELA 1HE8A 3ZQ4A 1XCTL 2IPKD 1F77A 3P4RB 4IWQA 2KDMA 1V1OA 4C4VB 1V2YA 2WP9B 2ZVOA 2JQRB 3R7RA 3IXSA 3P4PB 1WWTA 4TKNA 3HM6X 3WALA 3OJ4B 4TV3A 1PDXA 5CTRC 1F1HA 2KVRA 3VTWA 2LVPA 2UWQA 2KWCA 3M62B 2WU2B 1HQRD 2SEBD 3TEZA 4UDUC 3KUZA 2M8SA 1Y8RC 3V3XA 2MBBB 1XEEA 4WQOB 1WR1A 3OJ3A 3O13A 1KRHA 3DQVA 4XX5A 4W9DA 5C3JB 3A9JA 1J8CA 3SFDB 1SE3A 4RGMA 2GMIC 3H7PB 4YXDB 2DX5B 2MJ3A 5GMVA 3Q8FA 3TIXA 3WANA 1AARA 3AN1A 3ZRFA 3RNFC 2L1AA 4KGRA 4I6LB 2IDYA 1GOZA 2LGSA 4L23A 1IP9A 3DBHI 2J4XA 2M0XA 4L1BA 3ZJTA 3NHEB 3VRBB 1P3QU 1ZGUB 2WHIA 1TGZB 2MA9B 2W3RA 3CSTA 3KW5B 3ZNGC 4KSKC 1QKZA 3UIOB 2QDFA 1KOTA 2X38A 4K7WA 3SHQA 2KFKA 3IVFA 2D3AA 3NS8A 3E56A 4P1CC 1J7CA 4II3B 4TUUA 1TS3A 1FXAA 2IY1B 1FD6A 3VH3B 3PSEB 1P0RA 2DZMA 3H9DA 1UBQA 4GLSC 4ANVA 4CHKA 2KD0A 3VR9B 3TCAA 3CSFA 1ZDVA 3SD5A 1I7HA 4J3OD 3DWMA 1OQQA 3GB1A 2WXPA 3W5UB 4ZHPA 3A33B 1E9MA 4II2B 2FE8A 1FEHA 4HXDA 3B1LX 1I4HA 3N3KB 1WGDA 3DHGC 2E3TA 4AP4C 3RI7C 4NJ7A 2Y5PA 3AU5A 1SGHA 1XQQA 3L4PA 2L0TA 1K8RB 3HRDD 4A9AA 1TKYA 3NS1A 2N1WA 2BYFA 1F2RC 2V4IB 4JX1C 1SF0A 5IA7A 3C19A 3ZXRA 2INPE 1C79A 4FJZA 4W9CA 4ZRJA 4MH8A 1ET6A 2KDEB 1QOAA 2JUOA 2MBQA 3TMPB 3V62A 3N32A
chains in the Genus database with same CATH topology
1SXTA 1ZPSA 2WXMA 1L0YB 5H92C 3AH7A 2FUG1 3HVZA 4H2AA 1VZ7A 3VQIA 4MACA 4C7ZA 1DOIA 3Q8CA 4IKGA 1CQVA 2W55A 1BMLC 4NZLB 1Q10A 1XO3A 2TSSA 1L0XB 1UNSA 1SBBB 2K3UA 5AUKA 1IGCA 3W2DA 1TS5A 2H88B 1L6UA 2KACA 4WQMA 3VR8B 3FAHA 1YJJA 5HHDG 1L4ZB 2MEKA 1I4GA 3NVWA 2LGIA 1RYJA 3MHZA 1RM6C 2AX5A 5C2TB 1BUIC 1PFDA 1L6VA 4HEA1 1NEKB 4TSSA 2VZKB 2ZW1A 3IT6B 4LLGM 5EE9A 3MJ5A 3P4SB 2JU6X 1KTKA 1HEZE 4O1NA 4PT5A 1STEA 3CF4A 1T6BX 4M0WA 4RGTA 1IBXB 1JWAD 2GB1A 3URYA 3BVMA 4YSXB 2LUMA 5H8YE 1KF6B 2MJDA 2KWDA 4MM3B 4YTPB 2AQ3B 5LNK1 2WDRB 2L83A 1EU4A 1XLOA 1SEBD 4P16A 1L4DB 2GI9A 1FO4A 4ZYSA 1OQRA 3J9CA 3AV8A 1I4PA 4HKZE 1C4CA 1EWCA 3GP7A 2AQ2B 1V97A 2N9KA 1MI0A 3EUB2 5G5GA 3FC4A 1B9RA 4A8XC 3AE8B 3AEGB 1TKEA 1TJEA 5G5HA 2BB5A 2KN4A 1C78A 3TSSA 2JZPA 1FFVA 1YMHE 3PO0A 2W3SA 5BYQA 3P1MA 1HZ5A 1FNWA 4YT0B 1KH0A 2DYMA 2Q5WD 3BZDB 4OZCA 2RDGA 4KGSA 1ZXIA 1H7WA 2BYTA 2CJNA 4TQ0A 1C9FA 1D4BA 1NYQA 2K5PA 1FFUA 4YSZB 1ET9A 2N0SB 4AQ7A 2QIEB 1QF6A 1ZOYB 1CK1A 1V1PA 1DGJA 1I4QA 4A6QA 1T3QA 1IGDA 4ITKA 1QQRA 3AE9B 3PZ8A 3LB8C 5GXGB 2J53A 3NRZA 2LHEA 4A90A 1LO5D 1AW7A 1UUPA 2QEJC 1WRIA 1P7EA 2JX5A 4A55A 3TUOA 3RPFC 3B2FA 3KQ4A 2M0AA 1M4VA 3AEEB 3P42A 2W82A 1ROEA 1YNTE 3PZ7A 1D5ZC 5T8IA 4OZBA 4N59A 3AE3B 3CWIA 3UI3A 2J42A 2JYTA 1SSNA 3MC0B 3LXFA 4GDKB 4JWSC 1F2RI 1F0ZA 2CU3A 2WXIA 4XDCA 1A70A 3AECB 3IT4B 1TS4A 3U7ZA 3FILB 2ICIA 4R3DA 4WWMA 2BW2A 1XLPA 2I2YA 1ZXHA 3BK1A 4DXFA 1PYWD 3AEAB 2SAKA 5EE1A 2WXJA 2PVOD 1N61A 1JMLA 3SFEB 1QOFA 4WAFA 3TEXA 1P7FA 2J52A 3BK2A 3I9V1 4RCOA 1PGXA 4HRSA 1KFYB 2D5GA 1QLBB 3NUHB 4ZHOA 3AMZA 4ZRPA 4RGNA 2QILA 1MPEA 1FM0D 3AB5A 1JALA 2NMQA 3NZ3A 1QOBA 4RF0A 4LK0M 2LJIA 4XDDA 1Y56A 5BMIA 3ABVB 2PVGC 4HJGE 4OHJA 1XLQA 1DYQA 2BB6A 2JWUA 1N60A 5HG2A 3Q8BA 2Z8LA 3T3OA 1E6EB 2PW9A 1TY2A 1N5XA 2DLBA 5FR3A 3MFGA 3FILA 4C56C 1PGAA 1EWYC 2G1EA 1FXIA 1J7AA 1L5PA 2NTSA 1SJED 1ACCA 1N62A 1VJKA 1ZDXA 1BXTA 1XF5L 3I57A 1AN8A 2KAJA 2YEPF 1TYGB 4WIPA 1WXQA 3BYTB 2HTME 4KKJA 4YTNB 1MHXA 2GRIA 2BBCA 3KLSX 1IUEA 2KQ4X 1WYGA 2DYOA 5AUIA 1V8CA 2E6XA 2PTLA 2WU5B 2BT6A 1SE2A 4USAA 1E0ZA 1PGBA 3TEYA 1C77A 4IOIE 2BS4B 1E10A 3R2TA 4GDLB 4KGTA 2LMCA 3AE5B 4ZOHC 2PIAA 2JXTA 4NAWB 1I4XA 2ONQA 1ENFA 1EM7A 1YQ3B 3U2SC 1C4PA 1V1PB 2VZKD 2WXGA 1HXYD 3W1SA 4KX6B 4US9A 5BMGA 3ZJVA 1XCQL 1TS2A 5BMHA 1N63A 2WNMA 5EE3A 2B76B 1SB3C 1AYFA 5BYRA 3BVGA 4B0MA 4EE2A 3U4EG 4RNAA 1DOYA 2Y5CA 2JSVX 5D3DA 3C8YA 4TQ1A 2WXQA 1FNVA 1FNUA 4OW0A 3BVZA 2RMMA 1C4AA 4WURA 4IDIA 2AQ1B 1JRPA 3N9YC 1UGJA 1XXGA 3P4QB 1H7XA 3H8HA 4N58A 4ARIA 3WCQA 1YJIA 1GTEA 2V0GA 1IBXA 2Y3AA 4HKQA 3RFZB 2BTEA 1YN5A 4WH4A 2V3NA 3KWVA 1MVKA 3Q69A 2RDHA 3W5VB 1GTHA 1WGKA 1N5WA 2WDVB 3BWUD 4XE0A 3BIID 3E9SA 1NYRA 2INNE 4CQNA 1VR9A 1JWSD 2PKOA 4YTMB 3V05A 5I4DA 1QOGA 1JCKB 1VLBA 3VRAB 1K53A 2DWQA 2IGDA 1GB4A 3AE1B 3B9JA 1NI3A 1YN4A 2IJ0A 1QT9A 1VDVA 3AE7B 3SR6A 4JE3B 3ETRA 3EA6A 4DQOC 1FCLA 1HZ6A 2FBWB 5FKAC 2OHFA 3ZQ4A 2XN9C 1XCTL 2IPKD 3NVZA 1F77A 2N7JA 3AEBB 4DXGA 3P4RB 1C76A 5MPOA 2KDMA 1V1OA 1JW9D 2WP9B 3AEFB 3AE6B 1L0VB 1R7SA 2ZW0A 2JQRB 2W54A 2KMMA 3IXSA 1I4RA 3P4PB 1WWTA 1YQ4B 1JWMD 1JROA 2H89B 4RGOS 4AS1A 1KLUD 3BYYB 3HUIA 1OFFA 1JQ4A 4YWGG 4JWUC 1PDXA 2EELA 2WDQB 2HDEA 1VZ8A 4C7YA 2WU2B 3AM9A 1HQRD 2SEBD 3TEZA 4UDUC 2WXKA 2R61A 3IAM1 4L2YA 3GS2A 2M19A 3V3XA 1EU3A 1TY0A 3P63A 3SEBA 1VRAB 3TEWA 1XEEA 3T3NA 3ZGZA 2QSDA 3O13A 1KRHA 2BS2B 5C3JB 1FRRA 1T5XD 4XWTA 2L32A 3SFDB 2IGGA 1FCCC 1FMAD 1K51A 1SE3A 4RGMA 1E7PB 2RPVA 2V3PA 3LYYA 5BYSA 2DBYA 4YXDB 2QJLA 2WLBA 1SJHD 2MJ3A 3Q8FA 4MT5A 1B1ZA 1GT8A 3KWLA 1CZPA 3AN1A 2L1AA 1SIJA 4KGRA 2YEPB 1K50A 3EGRA 5D7GA 4N6EB 3NVYA 5EE0A 2WS3B 2IDYA 4REZA 1GOZA 4L23A 1TZOA 2J4XA 2WXFA 1D5MC 4L1BA 1GB1A 2CJOA 3ZJTA 3ZJUA 3VRBB 4D2KA 4OVZA 5E6JA 4RFBA 4FXCA 4YSYB 2K22A 1D5XC 1DOXA 1ZE3D 2XNAC 3Q8EA 2W3RA 1AWDA 4TMAB 1J7BA 2NTTA 4OZAA 2BS3B 1QKZA 2PMVA 1PUTA 3AEDB 1JWUD 1UWXA 2X38A 2WXRA 1NENB 3B2GA 3NVVA 2PLPA 4HROA 4NJCA 1ZP0B 2M56B 1GAQB 3CIRB 2LEKA 1YN3A 4Q2JA 4RF1A 5JXVA 3AE2B 3E56A 3IAS1 1J7CA 3R8BA 1TKGA 2N9LA 2WXLA 1TS3A 1ZUD2 5HFYA 2MH7A 4XWWA 1FXAA 1RFKA 3W9CB 1FD6A 2ACZB 2WXHA 3DWGC 1XLNA 2G9HD 1RWSA 5D3IB 2K0PA 4P6VF 4GLSC 3ZYYX 3VR9B 1D6EC 2K9XA 1ZDVA 1I7HA 4J3OD 2OEDA 1OQQA 3DWMA 3GB1A 1CJEA 2LHDA 2WXPA 3W5UB 1NVID 1FIQA 4ZHPA 1E9MA 2WXOA 4ZRQA 1KLGD 2FE8A 1FEHA 1WSPA 1I4HA 4JPSA 2E3TA 4ARCA 2Y5PA 3R2IA 3AE4B 2I38A 4B0EA 2QMTA 3MP9A 3L4PA 2JYEA 4US8A 1GPXA 1MHHE 2MJEA 3Q8AA 5TSSA 1VZ6A 4NAMA 1QILA 2EKIA 4LTUA 3HRDD 4C80A 1UWMA 4A9AA 2IGHA 1TKYA 3NS1A 2ON8A 1F2RC 2V4IB 4JX1C 1SF0A 5FK9C 1SE4A 4KKIA 2INPE 1C79A 2L52A 3U52E 5HI1A 2WXNA 1JWBD 1FRDA 4MH8A 1HA5A 4RH6A 2WQYB 1ESFA 1ET6A 3OWEB 1QOAA 1K52A 2LFIA 3HVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCQ A;  3AEE B;  5H92 C;  1ROE A;  1YJI A;  3AH7 A;  3HVZ A;  1GTE A;  2CJO A;  4C7Z A;  3VRB B;  1DOI A;  3AE3 B;  3CWI A;  4N59 A;  2W55 A;  1XO3 A;  4FXC A;  3W5V B;  4YSY B;  1GTH A;  1WGK A;  2K22 A;  3LXF A;  1N5W A;  5AUK A;  4JWS C;  1DOX A;  2WDV B;  1F0Z A;  2CU3 A;  2W3R A;  1AWD A;  1A70 A;  3BII D;  1J7B A;  3AEC B;  2H88 B;  1L6U A;  4WQM A;  3VR8 B;  1NYR A;  3FAH A;  1YJJ A;  2BS3 B;  2PKO A;  4YTM B;  1PUT A;  1QOG A;  3NVW A;  1VLB A;  3AED B;  3VRA B;  4WWM A;  1RYJ A;  1XLP A;  2DWQ A;  3AE1 B;  3B9J A;  1NEN B;  3AEA B;  1NI3 A;  3B2G A;  3NVV A;  5EE1 A;  1QT9 A;  1RM6 C;  3AE7 B;  1N61 A;  2AX5 A;  1VDV A;  1ZP0 B;  2PVO D;  5C2T B;  1GAQ B;  2M56 B;  3CIR B;  3SFE B;  1QOF A;  1PFD A;  2LEK A;  3ETR A;  1L6V A;  1NEK B;  2FBW B;  2OHF A;  3AE2 B;  4HRS A;  5EE9 A;  1KFY B;  1QLB B;  3P4S B;  3NVZ A;  4ZHO A;  3AMZ A;  3AEB B;  3CF4 A;  3P4R B;  1J7C A;  5MPO A;  1FM0 D;  1JWA D;  1TKG A;  1JAL A;  1JW9 D;  1ZUD 2;  2WP9 B;  2MH7 A;  3AB5 A;  3AEF B;  4YSX B;  3AE6 B;  5H8Y E;  1L0V B;  1KF6 B;  1QOB A;  1FXA A;  1R7S A;  2JQR B;  2MJD A;  2W54 A;  1RFK A;  3W9C B;  4YTP B;  2ACZ B;  2KMM A;  3ABV B;  2PVG C;  3DWG C;  1XLQ A;  2WDR B;  3P4P B;  1RWS A;  1N60 A;  1YQ4 B;  1WWT A;  1XLN A;  1JRO A;  2L83 A;  4P6V F;  1XLO A;  1E6E B;  1FO4 A;  2H89 B;  1N5X A;  3ZYY X;  3VR9 B;  2K9X A;  1OQR A;  1I7H A;  3AV8 A;  1OFF A;  3HUI A;  1EWY C;  1OQQ A;  2G1E A;  1FXI A;  1CJE A;  3DWM A;  1JQ4 A;  1J7A A;  1PDX A;  1L5P A;  4JWU C;  3W5U B;  1N62 A;  1VJK A;  1V97 A;  1NVI D;  1FIQ A;  4ZHP A;  2WDQ B;  2KAJ A;  3EUB 2;  1E9M A;  3FC4 A;  5G5G A;  1B9R A;  1TYG B;  4C7Y A;  1WXQ A;  2WU2 B;  3AE8 B;  3AEG B;  1TJE A;  1TKE A;  2HTM E;  3AM9 A;  5G5H A;  3RPF C;  4YTN B;  2E3T A;  5AUI A;  1IUE A;  1WYG A;  2M19 A;  1V8C A;  1FFV A;  3PO0 A;  3AE4 B;  2W3S A;  2WU5 B;  2BT6 A;  3P1M A;  3P63 A;  4USA A;  4YT0 B;  2Q5W D;  1E0Z A;  2BS4 B;  1ZXI A;  3L4P A;  1H7W A;  4US8 A;  1E10 A;  1GPX A;  1KRH A;  3AE5 B;  2MJE A;  4ZOH C;  2BS2 B;  2CJN A;  5C3J B;  1FRR A;  2PIA A;  2EKI A;  4LTU A;  3SFD B;  1YQ3 B;  1FMA D;  3HRD D;  1NYQ A;  4C80 A;  2K5P A;  1UWM A;  4A9A A;  1FFU A;  1TKY A;  3NS1 A;  4KX6 B;  4US9 A;  1E7P B;  4YSZ B;  2N0S B;  4JX1 C;  1N63 A;  1SF0 A;  5EE3 A;  2B76 B;  1SB3 C;  2QIE B;  1AYF A;  2DBY A;  1QF6 A;  1ZOY B;  3SR6 A;  4YXD B;  2QJL A;  1DGJ A;  2WLB A;  2MJ3 A;  1DOY A;  2Y5C A;  2L52 A;  1T3Q A;  4HRO A;  4ITK A;  3AE9 B;  1JWB D;  3LB8 C;  1GT8 A;  1FRD A;  1CZP A;  3AN1 A;  3KWL A;  3NRZ A;  5GXG B;  2WQY B;  4IDI A;  1QOA A;  1SIJ A;  1WRI A;  1JRP A;  2JX5 A;  3NVY A;  4N6E B;  5EE0 A;  2WS3 B;  3P4Q B;  1H7X A;  3B2F A;  4N58 A; 
#chains in the Genus database with same CATH topology
 4E74 A;  1GUA B;  1VZ7 A;  4KSL C;  4HPP A;  4C4V A;  5C23 A;  1BT0 A;  3VFK A;  2W55 A;  2TSS A;  1YX6 B;  2WYQ A;  3A4S C;  4ANX A;  2KAC A;  4WQM A;  3VR8 B;  1YJJ A;  3HM3 A;  1L4Z B;  2MEK A;  1I4G A;  4M01 A;  1Z2M A;  3MHZ A;  1WM2 A;  1BUI C;  4HEA 1;  2VZK B;  2ZW1 A;  3B0A A;  4W9E A;  2LUE A;  1TZ1 A;  2KWV B;  3QK0 A;  1HEZ E;  4O1N A;  5J18 A;  3CF4 A;  4RGT A;  1UGM A;  1JWA D;  1RLF A;  3URY A;  2LUM A;  2WWZ A;  2XEW A;  2KJR A;  2KWD A;  4JL9 A;  4URK A;  2X8X X;  1EU4 A;  4EZK A;  3Q3J A;  5DCN A;  2GI9 A;  1WM3 A;  3AV8 A;  1V49 A;  2IZV B;  3GP7 A;  3RUL A;  2V9H A;  3EUB 2;  5G5G A;  3SDL C;  4A8X C;  1TJE A;  2K39 A;  2NPT A;  1C78 A;  4W9F A;  1HTO A;  2CHX A;  2JZP A;  2KOX A;  2QC8 A;  1YMH E;  3P1M A;  1HZ5 A;  1E8Z A;  2DAF A;  1FNW A;  4OZC A;  4YT0 B;  2Q5W D;  2INC C;  3BZD B;  2NS5 A;  4K7S A;  4KGS A;  1H7W A;  1H8C A;  2V3S A;  4TQ0 A;  1C9F A;  3L54 A;  1A5R A;  2M17 A;  5L95 C;  1ET9 A;  2N0S B;  2MP2 A;  4AQ7 A;  2D10 A;  2QIE B;  1ZOY B;  2ZJD A;  3HK0 A;  3KUD B;  1DGJ A;  1I4Q A;  4ITK A;  2GOW A;  1QQR A;  3AE9 B;  1LO5 D;  1NDD A;  5HKH A;  2NBU A;  2L8J A;  3KQ4 A;  2M0A A;  1M4V A;  3DHI C;  1ROE A;  4DBG A;  4OZB A;  2DZK A;  3AE3 B;  3UI3 A;  4HLE A;  3K9O B;  3Q2A C;  2J42 A;  1WGY A;  4G11 A;  1SSN A;  3LXF A;  4JWS C;  2C7H A;  4XDC A;  1A70 A;  1EF5 A;  3IT4 B;  1UD7 A;  2ICI A;  2I2Y A;  3L0W B;  4XGA B;  3GZN I;  1JML A;  3SFE B;  1P7F A;  3I9V 1;  1WFY A;  3NUH B;  5IP4 D;  4G50 A;  4ZHO A;  4MM3 A;  4B9K A;  1FM0 D;  3DVG X;  2LJI A;  4XDD A;  4M00 A;  1Y56 A;  5BMI A;  2PVG C;  4OHJ A;  1XLQ A;  2MHJ A;  2Z8L A;  3VUY A;  3T3O A;  1TY2 A;  4FUL A;  4C56 C;  3NG0 A;  4WJO A;  1J7A A;  1LM8 B;  4W9J A;  4FAD A;  1AN8 A;  3ZXV A;  1TYG B;  1WXQ A;  2HTM E;  2A5U A;  4MGI E;  1SE9 A;  2HJ1 A;  4YTN B;  5AUI A;  1IUE A;  2DYO A;  4IG7 B;  1V8C A;  4W9L A;  2BT6 A;  2LVO A;  3GOE A;  1Q0W B;  5AZF A;  4BZA A;  5DPW A;  1E10 A;  3R2T A;  4N9F 4;  4PS8 A;  2Z0E B;  2LMC A;  2EMT A;  3H7P A;  2ONQ A;  1EM7 A;  2QHO A;  1V1P B;  3ZW3 A;  4US9 A;  2HTH A;  1XCQ L;  1SB3 C;  4K1R B;  2GBN A;  1GC6 A;  3WAO A;  3Q3N C;  1FNU A;  3QQ8 B;  4OW0 A;  3MTN B;  2RMM A;  3VHT C;  3P4Q B;  5J2R A;  3H8H A;  4WH4 A;  3KWV A;  3W5V B;  4FBJ B;  2MQJ A;  1N5W A;  3KYC D;  1F52 A;  4BKG A;  5IKC M;  4BOS C;  3BII D;  3AXC A;  5CHF A;  1VR9 A;  1JWS D;  5I4D A;  1CMX B;  2AL3 A;  4GXB A;  1LXD A;  3AE1 B;  1FXT B;  1NI3 A;  2IJ0 A;  1QT9 A;  2KKC A;  3EA6 A;  4MSM B;  2FBW B;  3DBS A;  3O65 B;  1MFW A;  4GSW A;  2N7J A;  3AEB B;  5MPO A;  1WYW B;  3T8M A;  3PLU A;  3AEF B;  3AE6 B;  2ZW0 A;  4NNJ B;  1WJ6 A;  2FUH B;  3DBH B;  1YD8 U;  2KMM A;  4BKS A;  1I4R A;  2PE6 B;  2RR9 A;  2FIF A;  2H89 B;  3PRM B;  4RGO S;  2KT7 A;  4MJS B;  2ZPN A;  1OFF A;  2JF5 A;  4M8N A;  1JQ4 A;  4YWG G;  4JWU C;  4BKT A;  2EEL A;  2KDF B;  4HCP B;  2WDQ B;  3TBL D;  2HDE A;  1VZ8 A;  4WJP A;  1S1Q B;  3IAM 1;  2M19 A;  2K6D B;  1TY0 A;  1R4M B;  3SEB A;  3ZNH B;  3T3N A;  2REX A;  2LD9 A;  1T5X D;  1ZKH A;  4XWT A;  2L32 A;  1FCC C;  2A4Z A;  3DDC B;  4W9H A;  3N20 C;  4MGK E;  3MHS D;  5DPS A;  2DBY A;  5IOI A;  3MC9 A;  2QJL A;  4MDK E;  1SJH D;  1V86 A;  3JSV B;  2C60 A;  4BOZ B;  3VVW B;  1D3Z A;  3WAP A;  5CX3 A;  5D7G A;  1K50 A;  5EE0 A;  2WS3 B;  4REZ A;  4DHZ B;  3C0R B;  1Q5W B;  1WE6 A;  2ZNV B;  3B08 A;  3A1Q B;  2BKR B;  4FLH A;  1D5X C;  2PEA A;  3ML8 A;  2OJW A;  2KFJ A;  1ZE3 D;  2MLB A;  4E3C A;  3JYU A;  2PMV A;  3KH0 A;  2IND C;  2RPQ A;  1JWU D;  3ONS A;  3EHV A;  3NOB A;  1GAQ B;  1YN3 A;  1IYF A;  4Q2J A;  4RF1 A;  3WA0 A;  2KLG A;  4XC2 A;  3ZIM A;  1NBF C;  3IAS 1;  1T0S C;  1QZE A;  1TKG A;  3IFW B;  4EZJ A;  3APF A;  3W9C B;  5DPR A;  2ACZ B;  1RWS A;  2K0P A;  3QA8 A;  4KZ0 A;  2CR5 A;  1CJE A;  4K3B A;  4XYC A;  4NQL B;  4PK1 A;  2N7E A;  2WXO A;  2LGX A;  1WRD B;  2N4F A;  4F8C B;  3VH4 B;  4ARC A;  4MSQ B;  4QAY A;  4B0E A;  3NZU A;  1GPX A;  2KVZ A;  1MG8 A;  3QJZ A;  4NAM A;  5FR6 A;  4K7U A;  4C80 A;  3I63 C;  3K9P B;  3WAM A;  2LI5 A;  2GBR A;  4ZYN A;  2VRR B;  3ZTC A;  1P1A A;  2BVC A;  3Q14 C;  1HA5 A;  4RH6 A;  5D6J B;  1F9J A;  2LFI A;  2KX3 A;  3HVD A;  3NZS A;  2WXM A;  3AH7 A;  2V4L A;  4J6I A;  4MAC A;  4C7Z A;  1DOI A;  1XO3 A;  1UNS A;  1SBB B;  4GU2 A;  4G0N B;  2H88 B;  1L6U A;  1WX8 A;  3FAH A;  1L7Y A;  5HHD G;  3IHP C;  1WXM A;  1RYJ A;  2LJ5 A;  2KMA A;  3VTV A;  2AL6 A;  2AX5 A;  2DZI A;  3RUI B;  2HJ8 A;  4LLG M;  5KHO A;  1I42 A;  4IM0 A;  2GB1 A;  3BVM A;  3CMM B;  4YSX B;  5H8Y E;  1KF6 B;  3RNB C;  4YTP B;  4AJY B;  2AQ3 B;  3I5J C;  1XLO A;  4LJO B;  3NJT A;  4EZL A;  4ZYS A;  3L08 A;  1OQR A;  3J9C A;  4HKZ E;  2N9K A;  4HPL B;  1RRB A;  3WIM A;  1TKE A;  3HHM A;  5G5H A;  2ZZP B;  4ZRI A;  4WAA A;  3PO0 A;  3DBL B;  1T0R C;  2RDG A;  1ZXI A;  2O6V D;  3A1Q A;  2CJN A;  3M3J A;  2O6V B;  5C1Z A;  1J0G A;  4AWJ A;  1CK1 A;  2C7N B;  1T3Q A;  1IGD A;  3TL5 A;  3LB8 C;  5GXG B;  2J53 A;  3DPD A;  4MGZ E;  2JX5 A;  2JT4 B;  3RCZ A;  4A55 A;  3RPF C;  3B2F A;  2UU7 A;  2K8H A;  2W82 A;  2MW5 A;  3AU4 A;  2JYT A;  3KVF B;  4GDK B;  1F2R I;  2CU3 A;  2WXI A;  3PT2 B;  5IO9 A;  4EFO A;  4AUQ C;  1M94 A;  2JZ3 B;  2BYE A;  1TS4 A;  3FIL B;  3A4R A;  2BW2 A;  4DXF A;  2CHW A;  2KMC A;  1MG4 A;  5EE1 A;  2PVO D;  3N1Z C;  2IO1 B;  2J52 A;  3HIZ A;  4HRS A;  2JXX A;  4W9G A;  4ZRP A;  4RGN A;  3AB5 A;  2FID A;  2JZZ A;  3NZ3 A;  3N1X C;  3VUW A;  3H6N A;  3RZF A;  4MJS A;  3ZVV A;  1V6E A;  3RNE C;  3PRZ A;  3ECI A;  4HJG E;  1DYQ A;  1XT9 B;  2PW9 A;  5FR3 A;  3ZDM C;  1NI2 A;  2HD5 B;  4EKU A;  1L5P A;  2JRH A;  4BAX A;  1SJE D;  4G3X B;  1VJK A;  1BXT A;  1XF5 L;  1UH6 A;  2JWZ A;  3L16 A;  4LNK A;  1WJN A;  2KQ4 X;  1WYG A;  1YJ1 A;  2O2V A;  2WU5 B;  1J19 A;  1L2N A;  1E0Z A;  2CHZ A;  3TEY A;  1C77 A;  4LDT D;  4HJK A;  5JH5 C;  1V9J A;  4NAW B;  1ENF A;  3U2S C;  3PVL A;  1C4P A;  1R4N B;  1WY8 A;  2RSU A;  2WDT B;  1OEY A;  1TS2 A;  1N63 A;  1EUV B;  4ZDV A;  4EE2 A;  3U4E G;  4RNA A;  1DOY A;  1SIF A;  2LGD A;  4S0R A;  5LLI A;  2J7Q B;  4TQ1 A;  2WXQ A;  3BVZ A;  4IDI A;  1V5T A;  4YL8 A;  3N9Y C;  2RD0 A;  1EF1 A;  3ZLZ A;  2IY0 B;  2KNB A;  1P98 A;  2Y3A A;  1YN5 A;  1KLV A;  2V3N A;  1OEY J;  1MVK A;  3NY5 A;  4XE0 A;  3M95 A;  4YTM B;  4BFR A;  1YN4 A;  3AE7 B;  2ZPY A;  3SR6 A;  1FCL A;  2G4D B;  3V6E B;  2N7D A;  2OHF A;  2KJ6 A;  2XN9 C;  4DXG A;  2NR2 A;  1C76 A;  2W54 A;  2FCQ A;  5BO4 B;  2O6V A;  1JWM D;  3OG5 A;  1JRO A;  4I6P A;  5E6N A;  3VDZ A;  4AS1 A;  1KLU D;  3BYY B;  2D3C A;  3EFC A;  4RM9 A;  2D3G A;  2LRU A;  4KIK B;  4XZ4 A;  4C7Y A;  3AM9 A;  2N9P C;  2WXK A;  4AOF A;  2R61 A;  2MRP A;  2D2Q A;  3GS2 A;  3LDZ E;  4PYU A;  1OTR B;  2C7M B;  3TEW A;  3ZGZ A;  1E5W A;  4PS7 A;  4RM8 A;  3Q6B A;  3R3M A;  2IGG A;  1FMA D;  2MCN B;  3VAW A;  2RPV A;  2V3P A;  2AEH A;  1GNU A;  2Y5B B;  2WLB A;  2KTF A;  2WGS A;  4MT5 A;  4HDO A;  1LGR A;  1ISN A;  1C3T A;  3EGR A;  4N6E B;  2VH2 A;  1GG3 A;  1Z5S B;  2MX2 A;  2GLS A;  2PJH A;  1KJT A;  1TZO A;  2WXF A;  2DEN B;  2BYV E;  1GB1 A;  2CKH B;  3ZJU A;  4D2K A;  4OVZ A;  5E6J A;  4RFB A;  4FXC A;  4YSY B;  3VUX A;  1DOX A;  2XNA C;  3Q8E A;  3T9L A;  1AWD A;  2NTT A;  4OZA A;  3AED B;  2G4S A;  1EO6 A;  4IW0 A;  1UWX A;  3LJ3 A;  3EFU A;  3B2G A;  3NVV A;  2PLP A;  2LRW A;  4HRO A;  3CIR B;  2LEK A;  4OVU A;  5JXV A;  4A20 A;  2MBO A;  4DWF A;  2BQQ A;  3DOW A;  3TJP A;  1UF0 A;  4F7Z A;  4XWW A;  2MH7 A;  2YVC A;  3QX1 A;  1VD2 A;  3DBR B;  2JPH A;  3OAW A;  2WXH A;  3DBR I;  3DWG C;  2PPH A;  2G9H D;  4NAW A;  4P6V F;  2K9X A;  1OGW A;  2R2O A;  2OED A;  2J0J A;  5CHV C;  5JHB A;  1NVI D;  5LXH A;  2KX0 A;  2UYZ B;  1FIQ A;  2Z59 B;  1RAX A;  1KLG D;  1WSP A;  1OQY A;  1UBI A;  1Q1O A;  4JPS A;  5LXI B;  4K81 A;  4LCD E;  3AE4 B;  5E6P A;  1X1M A;  2NPT B;  3MP9 A;  2KZR A;  1E8Y A;  4C00 A;  2JYE A;  3DCG A;  3PS6 A;  3QWZ B;  2MJE A;  3Q8A A;  1VZ6 A;  1QIL A;  2EKI A;  3RNG C;  4FJV B;  4AJW A;  5FK9 C;  1SE4 A;  4E71 A;  4KKI A;  2L52 A;  3U52 E;  4WWO A;  5HI1 A;  2WXN A;  2MP2 B;  1JWB D;  2L7R A;  4GIV A;  2WQY B;  3RZW C;  2D11 A;  1WXA A;  2L76 A;  1ZPS A;  1L0Y B;  5H92 C;  2FUG 1;  3HVZ A;  4GDK A;  3VQI A;  3Q8C A;  4IKG A;  4NZL B;  4GMV A;  5AUK A;  3UF8 A;  1IGC A;  2KO3 A;  1TS5 A;  2NBW B;  3N1Y C;  2K25 A;  3PHW B;  2IO3 B;  2CS4 A;  2DZJ A;  3NVW A;  3I3T B;  2FCS A;  2LGI A;  4DHJ B;  4FJY A;  1RM6 C;  3ALB A;  2K6Q A;  2FAZ A;  1PFD A;  4TSS A;  3IT6 B;  5G2N A;  5EE9 A;  3MJ5 A;  4KZC A;  3IBE A;  4PT5 A;  1E8X A;  3Q3O C;  4LDT B;  1T6B X;  4M0W A;  1WH3 A;  4WJN A;  5TR5 A;  4KDI C;  4IM3 A;  4MM3 B;  3OLM D;  4ANW A;  4DDI D;  5LNK 1;  3ZNZ B;  2N9X A;  4B95 A;  2XK5 B;  3ML9 A;  2DAJ A;  1WGH A;  2IO2 B;  1EWC A;  3U30 A;  4NPN A;  4HK2 A;  1U4A A;  1UZX B;  1KM7 A;  3U7D A;  2O2V B;  3AEG B;  1S3S G;  2GBK A;  2KN4 A;  3TSS A;  3ZDT A;  1FFV A;  3P2B A;  5BYQ A;  2KXJ A;  1KH0 A;  3PTF C;  3QHT A;  3UQA A;  3ZUN A;  3RNA C;  2BYT A;  3UIN B;  4GGQ A;  1D4B A;  2ASQ A;  1NYQ A;  2K5P A;  2RDB C;  1FPY A;  4YSZ B;  4K3C A;  1ZW7 A;  1XD3 B;  1V1P A;  2FNJ B;  1V80 A;  2LHE A;  4A90 A;  1AW7 A;  1WRI A;  3Q3F A;  4B6W A;  4IM2 A;  2ZEQ A;  3TUO A;  2EMS A;  3W1S C;  3P42 A;  3QC8 B;  1YNT E;  4X57 B;  3D32 A;  1D5Z C;  4N59 A;  3CWI A;  2LVQ A;  1WXS A;  3QAR A;  3MC0 B;  4PYZ A;  4P7I A;  1F0Z A;  4JIO U;  2BKF A;  3KYD D;  1LQB A;  5AZG A;  3U7Z A;  1WXV A;  1GJZ A;  4GOC A;  1PYW D;  3AEA B;  2SAK A;  2WXJ A;  3GZN B;  3RNC C;  2C9W B;  5J17 A;  1QOF A;  3TEX A;  1YQB A;  3BK2 A;  2BWE S;  2FCN A;  4GN1 A;  1E90 A;  1PGX A;  3QCA A;  1KFY B;  3PRE A;  3S2A A;  1IPG A;  3AMZ A;  3PV1 A;  2QIL A;  1MPE A;  2L00 B;  3L17 A;  2N1V A;  4A3P A;  3V61 A;  4EEW A;  4MH0 E;  4DDG D;  4RF0 A;  1GC7 A;  4LJP B;  2JWU A;  5HG2 A;  2DLB A;  2KC1 A;  3FIL A;  1V81 A;  1EWY C;  2JVC A;  3PLV A;  2DHZ A;  1N62 A;  4LNF A;  5IN7 A;  2KAJ A;  2DNF A;  5DPT A;  2YEP F;  4WIP A;  3PRP B;  1WJ4 A;  1MHX A;  2GRI A;  2BBC A;  3KLS X;  4ASW C;  3DVN U;  4USA A;  1PGB A;  2BS4 B;  4GDL B;  4MEM A;  4KGT A;  3AE5 B;  4IC7 B;  3UQB A;  2PIA A;  2JXT A;  2KDB A;  1YQ3 B;  4DHZ E;  2WXG A;  1HXY D;  3W1S A;  3ZJV A;  5BMG A;  2IO0 B;  4ACF A;  5BMH A;  2WNM A;  5EE3 A;  5BYR A;  4S17 A;  4DXA B;  3U8Z A;  1YOV B;  4B0M A;  2KN5 A;  1WMH B;  2WX1 A;  2JSV X;  4LNN A;  4CO7 A;  2K8B A;  3H7S A;  2AQ1 B;  3JSV A;  1UGJ A;  1XXG A;  1MJD A;  2KDI A;  3A9K B;  1YJI A;  4DHJ D;  1YX5 B;  3RFZ B;  2BTE A;  5KHQ A;  4KVG B;  3Q69 A;  1WGK A;  1WF9 A;  3BWU D;  4P1B C;  3E9S A;  4CQN A;  3JW0 X;  3L10 B;  3ZRC A;  2BPS A;  1K53 A;  2DWQ A;  2IGD A;  1GB4 A;  3B9J A;  1VDV A;  3L13 A;  5AEK B;  4DQO C;  2V1Y A;  4RMA A;  3ENE A;  5FKA C;  3NVZ A;  2DYB A;  1JW9 D;  1L0V B;  1R7S A;  4NY0 A;  1E7U A;  3M63 B;  2BWF A;  2GBJ A;  1YQ4 B;  1WGR A;  3HUI A;  4LNO A;  1RFA A;  2I1J A;  1TBE A;  4L2Y A;  3CF6 E;  3MJW A;  1EU3 A;  3R66 C;  1R4M I;  3APC A;  3P63 A;  4IUM B;  4JGH B;  1VRA B;  2D07 B;  3PGE A;  1H4R A;  2QSD A;  2BS2 B;  1FRR A;  4M02 A;  2RGF A;  3PPA A;  1K51 A;  2LAS A;  1WX7 A;  1E7P B;  4KDL B;  3LYY A;  5BYS A;  2CU1 A;  2ZCC A;  2L05 A;  1B1Z A;  1GT8 A;  3KWL A;  1CZP A;  2KJH B;  4M8M A;  4EOY A;  2NBV B;  1SIJ A;  2YEP B;  3ZNI D;  3NVY A;  2VH1 A;  4WWN A;  1D5M C;  2CJO A;  2N9E B;  3VTU A;  2K1F A;  2KHW B;  4MGY E;  4HWI B;  2K22 A;  3X0W A;  2BF8 B;  3H1U A;  2KLC A;  4TMA B;  2KC2 A;  1J7B A;  1P9D U;  2BS3 B;  1T0Y A;  1PUT A;  3DHH C;  2M4N A;  3RYT A;  2WXR A;  1NEN B;  1E7V A;  3V6C B;  2MBH A;  4NJC A;  1ZP0 B;  2M56 B;  2C5L C;  3AE2 B;  3AI5 A;  3R8B A;  2N9L A;  2WXL A;  1ZUD 2;  5HFY A;  1WIA A;  1RFK A;  2XK5 A;  1XLN A;  5D3I B;  5L83 A;  4BBN F;  5AZH A;  3ZYY X;  1D6E C;  3RD2 A;  4PS3 A;  3MC8 A;  2LHD A;  3PZD A;  5CHW A;  2G3Q B;  4ZRQ A;  3AUL A;  1N6Z A;  3QIJ A;  4KV2 A;  3R2I A;  2I38 A;  2IBI B;  3A9K A;  2QMT A;  3R7Q A;  4US8 A;  1MHH E;  3Q3M C;  5TSS A;  2NVU I;  4LTU A;  4NJ6 A;  1UWM A;  2IGH A;  2ON8 A;  3JVZ X;  4W9K A;  2KTR A;  2J0K A;  1FRD A;  4JQW C;  4WJQ A;  1ESF A;  3OWE B;  1WGG A;  4HCN B;  1K52 A;  2LWP A;  1SXT A;  1WI0 A;  2BGF A;  2HE7 A;  4H2A A;  2D3B A;  3BIN A;  1CQV A;  2OOB B;  1BML C;  1Q10 A;  1L0X B;  2K3U A;  3W2D A;  1VCB A;  4IWO A;  1V5O A;  5D2M B;  2KAN A;  4NQK E;  1E8W A;  5C2T B;  2L3Z A;  1WZ0 A;  1L6V A;  1NEK B;  1WZ3 A;  3IG3 A;  1R4N I;  1YIW A;  5IAA C;  3P4S B;  2JU6 X;  1KTK A;  1STE A;  2KFK B;  1IBX B;  2M1M A;  2MJD A;  2KYW A;  2ZNV C;  2WDR B;  2L83 A;  3W1Y A;  3ZO5 B;  1SEB D;  4P16 A;  1L4D B;  1FO4 A;  1TTN A;  2QCZ A;  1I4P A;  1C4C A;  2AQ2 B;  4DK5 A;  1V97 A;  3APD A;  3PHX B;  4FHK A;  1MI0 A;  1B9R A;  3FC4 A;  3AE8 B;  1I35 A;  4JLC A;  2BB5 A;  3SU8 X;  2MBE A;  4A3O A;  4GDL A;  3DBL I;  2W3S A;  4M0W B;  3VXW A;  1JRU A;  2DYM A;  2LXC A;  4OVV A;  2Z0D B;  2L0F A;  2KQ7 A;  1WJU A;  1LFD A;  2K8C A;  1FFU A;  4BBN C;  1WMH A;  3RT3 B;  1QF6 A;  4ICV A;  2KQS A;  2OJR A;  4A6Q A;  1HTQ A;  3RN9 C;  3PZ8 A;  3NRZ A;  1WX9 A;  2NCN A;  2QEJ C;  1UUP A;  2FCM A;  4WWP A;  1P7E A;  3N30 A;  2KWU B;  3AEE B;  3PZ7 A;  2YLM A;  5T8I A;  5G55 A;  3A9J B;  5JHA A;  1WR6 E;  2PE9 A;  5D94 A;  2AWT A;  3GE3 C;  3AEC B;  4ICU A;  4R3D A;  4WWM A;  1XLP A;  1ZXH A;  3BK1 A;  2LZ6 A;  2LXA A;  1N61 A;  4LNI A;  4FN2 A;  4WAF A;  2LGY A;  4RCO A;  5E6O A;  2KK8 A;  3KUC B;  2AYO B;  2JRI B;  2D5G A;  1QLB B;  4FHJ A;  2XBB C;  4ANU A;  3ZTD A;  1JAL A;  2NMQ A;  1UEL A;  1QOB A;  4LK0 M;  2ZVN A;  4HPM B;  3ABV B;  2BB6 A;  3RMK C;  1N60 A;  4ZRK A;  3Q8B A;  1E6E B;  1N5X A;  3MFG A;  3BY4 B;  1PGA A;  2IYD B;  2G1E A;  4EUT A;  1FXI A;  1C1Y B;  2NTS A;  1ZDX A;  1ACC A;  1TT5 B;  2KTR B;  3I57 A;  2JY6 A;  3BYT B;  4KKJ A;  4KIK A;  4CYE A;  2E6X A;  2PTL A;  3DVG Y;  2B3A A;  1SE2 A;  4F1S A;  1T0Q C;  2MSE D;  4IOI E;  2GBM A;  4BKS D;  4ZOH C;  2W9N A;  3X23 A;  1I4X A;  4BVU C;  2VZK D;  4IWP A;  1PQS A;  4KX6 B;  4FA6 A;  4GB9 A;  3V60 A;  2B76 B;  1AYF A;  3BVG A;  2Y5C A;  5D3D A;  2MWS B;  3C8Y A;  3QAQ A;  3UGB B;  1FNV A;  1C4A A;  4WUR A;  2ZCB A;  1JRP A;  2I1K A;  3UIP B;  3DVN V;  1H7X A;  2EKE C;  4N58 A;  4ARI A;  3WCQ A;  1GTE A;  2V0G A;  1IBX A;  4HKQ A;  2R2Q A;  2RDH A;  1GTH A;  1G6J A;  1WE7 A;  4I6N B;  4W9I A;  3ZKJ C;  4HVB A;  2WDV B;  2G45 B;  3EC8 A;  2J0M A;  5JZE B;  1NYR A;  2INN E;  2PKO A;  3V05 A;  1QOG A;  1JCK B;  1VLB A;  4HDQ A;  3VRA B;  3FKY A;  4JE3 B;  2WX0 A;  3ETR A;  3GE8 C;  3EEC A;  1TIF A;  5EDS A;  1HZ6 A;  4MEL A;  1HE8 A;  3ZQ4 A;  1XCT L;  2IPK D;  1F77 A;  3P4R B;  4IWQ A;  2KDM A;  1V1O A;  4C4V B;  1V2Y A;  2WP9 B;  2ZVO A;  2JQR B;  3R7R A;  3IXS A;  3P4P B;  1WWT A;  4TKN A;  3HM6 X;  3WAL A;  3OJ4 B;  4TV3 A;  1PDX A;  5CTR C;  1F1H A;  2KVR A;  3VTW A;  2LVP A;  2UWQ A;  2KWC A;  3M62 B;  2WU2 B;  1HQR D;  2SEB D;  3TEZ A;  4UDU C;  3KUZ A;  2M8S A;  1Y8R C;  3V3X A;  2MBB B;  1XEE A;  4WQO B;  1WR1 A;  3OJ3 A;  3O13 A;  1KRH A;  3DQV A;  4XX5 A;  4W9D A;  5C3J B;  3A9J A;  1J8C A;  3SFD B;  1SE3 A;  4RGM A;  2GMI C;  3H7P B;  4YXD B;  2DX5 B;  2MJ3 A;  5GMV A;  3Q8F A;  3TIX A;  3WAN A;  1AAR A;  3AN1 A;  3ZRF A;  3RNF C;  2L1A A;  4KGR A;  4I6L B;  2IDY A;  1GOZ A;  2LGS A;  4L23 A;  1IP9 A;  3DBH I;  2J4X A;  2M0X A;  4L1B A;  3ZJT A;  3NHE B;  3VRB B;  1P3Q U;  1ZGU B;  2WHI A;  1TGZ B;  2MA9 B;  2W3R A;  3CST A;  3KW5 B;  3ZNG C;  4KSK C;  1QKZ A;  3UIO B;  2QDF A;  1KOT A;  2X38 A;  4K7W A;  3SHQ A;  2KFK A;  3IVF A;  2D3A A;  3NS8 A;  3E56 A;  4P1C C;  1J7C A;  4II3 B;  4TUU A;  1TS3 A;  1FXA A;  2IY1 B;  1FD6 A;  3VH3 B;  3PSE B;  1P0R A;  2DZM A;  3H9D A;  1UBQ A;  4GLS C;  4ANV A;  4CHK A;  2KD0 A;  3VR9 B;  3TCA A;  3CSF A;  1ZDV A;  3SD5 A;  1I7H A;  4J3O D;  3DWM A;  1OQQ A;  3GB1 A;  2WXP A;  3W5U B;  4ZHP A;  3A33 B;  1E9M A;  4II2 B;  2FE8 A;  1FEH A;  4HXD A;  3B1L X;  1I4H A;  3N3K B;  1WGD A;  3DHG C;  2E3T A;  4AP4 C;  3RI7 C;  4NJ7 A;  2Y5P A;  3AU5 A;  1SGH A;  1XQQ A;  3L4P A;  2L0T A;  1K8R B;  3HRD D;  4A9A A;  1TKY A;  3NS1 A;  2N1W A;  2BYF A;  1F2R C;  2V4I B;  4JX1 C;  1SF0 A;  5IA7 A;  3C19 A;  3ZXR A;  2INP E;  1C79 A;  4FJZ A;  4W9C A;  4ZRJ A;  4MH8 A;  1ET6 A;  2KDE B;  1QOA A;  2JUO A;  2MBQ A;  3TMP B;  3V62 A;  3N32 A; 
#chains in the Genus database with same CATH homology
 1SXT A;  1ZPS A;  2WXM A;  1L0Y B;  5H92 C;  3AH7 A;  2FUG 1;  3HVZ A;  4H2A A;  1VZ7 A;  3VQI A;  4MAC A;  4C7Z A;  1DOI A;  3Q8C A;  4IKG A;  1CQV A;  2W55 A;  1BML C;  4NZL B;  1Q10 A;  1XO3 A;  2TSS A;  1L0X B;  1UNS A;  1SBB B;  2K3U A;  5AUK A;  1IGC A;  3W2D A;  1TS5 A;  2H88 B;  1L6U A;  2KAC A;  4WQM A;  3VR8 B;  3FAH A;  1YJJ A;  5HHD G;  1L4Z B;  2MEK A;  1I4G A;  3NVW A;  2LGI A;  1RYJ A;  3MHZ A;  1RM6 C;  2AX5 A;  5C2T B;  1BUI C;  1PFD A;  1L6V A;  4HEA 1;  1NEK B;  4TSS A;  2VZK B;  2ZW1 A;  3IT6 B;  4LLG M;  5EE9 A;  3MJ5 A;  3P4S B;  2JU6 X;  1KTK A;  1HEZ E;  4O1N A;  4PT5 A;  1STE A;  3CF4 A;  1T6B X;  4M0W A;  4RGT A;  1IBX B;  1JWA D;  2GB1 A;  3URY A;  3BVM A;  4YSX B;  2LUM A;  5H8Y E;  1KF6 B;  2MJD A;  2KWD A;  4MM3 B;  4YTP B;  2AQ3 B;  5LNK 1;  2WDR B;  2L83 A;  1EU4 A;  1XLO A;  1SEB D;  4P16 A;  1L4D B;  2GI9 A;  1FO4 A;  4ZYS A;  1OQR A;  3J9C A;  3AV8 A;  1I4P A;  4HKZ E;  1C4C A;  1EWC A;  3GP7 A;  2AQ2 B;  1V97 A;  2N9K A;  1MI0 A;  3EUB 2;  5G5G A;  3FC4 A;  1B9R A;  4A8X C;  3AE8 B;  3AEG B;  1TKE A;  1TJE A;  5G5H A;  2BB5 A;  2KN4 A;  1C78 A;  3TSS A;  2JZP A;  1FFV A;  1YMH E;  3PO0 A;  2W3S A;  5BYQ A;  3P1M A;  1HZ5 A;  1FNW A;  4YT0 B;  1KH0 A;  2DYM A;  2Q5W D;  3BZD B;  4OZC A;  2RDG A;  4KGS A;  1ZXI A;  1H7W A;  2BYT A;  2CJN A;  4TQ0 A;  1C9F A;  1D4B A;  1NYQ A;  2K5P A;  1FFU A;  4YSZ B;  1ET9 A;  2N0S B;  4AQ7 A;  2QIE B;  1QF6 A;  1ZOY B;  1CK1 A;  1V1P A;  1DGJ A;  1I4Q A;  4A6Q A;  1T3Q A;  1IGD A;  4ITK A;  1QQR A;  3AE9 B;  3PZ8 A;  3LB8 C;  5GXG B;  2J53 A;  3NRZ A;  2LHE A;  4A90 A;  1LO5 D;  1AW7 A;  1UUP A;  2QEJ C;  1WRI A;  1P7E A;  2JX5 A;  4A55 A;  3TUO A;  3RPF C;  3B2F A;  3KQ4 A;  2M0A A;  1M4V A;  3AEE B;  3P42 A;  2W82 A;  1ROE A;  1YNT E;  3PZ7 A;  1D5Z C;  5T8I A;  4OZB A;  4N59 A;  3AE3 B;  3CWI A;  3UI3 A;  2J42 A;  2JYT A;  1SSN A;  3MC0 B;  3LXF A;  4GDK B;  4JWS C;  1F2R I;  1F0Z A;  2CU3 A;  2WXI A;  4XDC A;  1A70 A;  3AEC B;  3IT4 B;  1TS4 A;  3U7Z A;  3FIL B;  2ICI A;  4R3D A;  4WWM A;  2BW2 A;  1XLP A;  2I2Y A;  1ZXH A;  3BK1 A;  4DXF A;  1PYW D;  3AEA B;  2SAK A;  5EE1 A;  2WXJ A;  2PVO D;  1N61 A;  1JML A;  3SFE B;  1QOF A;  4WAF A;  3TEX A;  1P7F A;  2J52 A;  3BK2 A;  3I9V 1;  4RCO A;  1PGX A;  4HRS A;  1KFY B;  2D5G A;  1QLB B;  3NUH B;  4ZHO A;  3AMZ A;  4ZRP A;  4RGN A;  2QIL A;  1MPE A;  1FM0 D;  3AB5 A;  1JAL A;  2NMQ A;  3NZ3 A;  1QOB A;  4RF0 A;  4LK0 M;  2LJI A;  4XDD A;  1Y56 A;  5BMI A;  3ABV B;  2PVG C;  4HJG E;  4OHJ A;  1XLQ A;  1DYQ A;  2BB6 A;  2JWU A;  1N60 A;  5HG2 A;  3Q8B A;  2Z8L A;  3T3O A;  1E6E B;  2PW9 A;  1TY2 A;  1N5X A;  2DLB A;  5FR3 A;  3MFG A;  3FIL A;  4C56 C;  1PGA A;  1EWY C;  2G1E A;  1FXI A;  1J7A A;  1L5P A;  2NTS A;  1SJE D;  1ACC A;  1N62 A;  1VJK A;  1ZDX A;  1BXT A;  1XF5 L;  3I57 A;  1AN8 A;  2KAJ A;  2YEP F;  1TYG B;  4WIP A;  1WXQ A;  3BYT B;  2HTM E;  4KKJ A;  4YTN B;  1MHX A;  2GRI A;  2BBC A;  3KLS X;  1IUE A;  2KQ4 X;  1WYG A;  2DYO A;  5AUI A;  1V8C A;  2E6X A;  2PTL A;  2WU5 B;  2BT6 A;  1SE2 A;  4USA A;  1E0Z A;  1PGB A;  3TEY A;  1C77 A;  4IOI E;  2BS4 B;  1E10 A;  3R2T A;  4GDL B;  4KGT A;  2LMC A;  3AE5 B;  4ZOH C;  2PIA A;  2JXT A;  4NAW B;  1I4X A;  2ONQ A;  1ENF A;  1EM7 A;  1YQ3 B;  3U2S C;  1C4P A;  1V1P B;  2VZK D;  2WXG A;  1HXY D;  3W1S A;  4KX6 B;  4US9 A;  5BMG A;  3ZJV A;  1XCQ L;  1TS2 A;  5BMH A;  1N63 A;  2WNM A;  5EE3 A;  2B76 B;  1SB3 C;  1AYF A;  5BYR A;  3BVG A;  4B0M A;  4EE2 A;  3U4E G;  4RNA A;  1DOY A;  2Y5C A;  2JSV X;  5D3D A;  3C8Y A;  4TQ1 A;  2WXQ A;  1FNV A;  1FNU A;  4OW0 A;  3BVZ A;  2RMM A;  1C4A A;  4WUR A;  4IDI A;  2AQ1 B;  1JRP A;  3N9Y C;  1UGJ A;  1XXG A;  3P4Q B;  1H7X A;  3H8H A;  4N58 A;  4ARI A;  3WCQ A;  1YJI A;  1GTE A;  2V0G A;  1IBX A;  2Y3A A;  4HKQ A;  3RFZ B;  2BTE A;  1YN5 A;  4WH4 A;  2V3N A;  3KWV A;  1MVK A;  3Q69 A;  2RDH A;  3W5V B;  1GTH A;  1WGK A;  1N5W A;  2WDV B;  3BWU D;  4XE0 A;  3BII D;  3E9S A;  1NYR A;  2INN E;  4CQN A;  1VR9 A;  1JWS D;  2PKO A;  4YTM B;  3V05 A;  5I4D A;  1QOG A;  1JCK B;  1VLB A;  3VRA B;  1K53 A;  2DWQ A;  2IGD A;  1GB4 A;  3AE1 B;  3B9J A;  1NI3 A;  1YN4 A;  2IJ0 A;  1QT9 A;  1VDV A;  3AE7 B;  3SR6 A;  4JE3 B;  3ETR A;  3EA6 A;  4DQO C;  1FCL A;  1HZ6 A;  2FBW B;  5FKA C;  2OHF A;  3ZQ4 A;  2XN9 C;  1XCT L;  2IPK D;  3NVZ A;  1F77 A;  2N7J A;  3AEB B;  4DXG A;  3P4R B;  1C76 A;  5MPO A;  2KDM A;  1V1O A;  1JW9 D;  2WP9 B;  3AEF B;  3AE6 B;  1L0V B;  1R7S A;  2ZW0 A;  2JQR B;  2W54 A;  2KMM A;  3IXS A;  1I4R A;  3P4P B;  1WWT A;  1YQ4 B;  1JWM D;  1JRO A;  2H89 B;  4RGO S;  4AS1 A;  1KLU D;  3BYY B;  3HUI A;  1OFF A;  1JQ4 A;  4YWG G;  4JWU C;  1PDX A;  2EEL A;  2WDQ B;  2HDE A;  1VZ8 A;  4C7Y A;  2WU2 B;  3AM9 A;  1HQR D;  2SEB D;  3TEZ A;  4UDU C;  2WXK A;  2R61 A;  3IAM 1;  4L2Y A;  3GS2 A;  2M19 A;  3V3X A;  1EU3 A;  1TY0 A;  3P63 A;  3SEB A;  1VRA B;  3TEW A;  1XEE A;  3T3N A;  3ZGZ A;  2QSD A;  3O13 A;  1KRH A;  2BS2 B;  5C3J B;  1FRR A;  1T5X D;  4XWT A;  2L32 A;  3SFD B;  2IGG A;  1FCC C;  1FMA D;  1K51 A;  1SE3 A;  4RGM A;  1E7P B;  2RPV A;  2V3P A;  3LYY A;  5BYS A;  2DBY A;  4YXD B;  2QJL A;  2WLB A;  1SJH D;  2MJ3 A;  3Q8F A;  4MT5 A;  1B1Z A;  1GT8 A;  3KWL A;  1CZP A;  3AN1 A;  2L1A A;  1SIJ A;  4KGR A;  2YEP B;  1K50 A;  3EGR A;  5D7G A;  4N6E B;  3NVY A;  5EE0 A;  2WS3 B;  2IDY A;  4REZ A;  1GOZ A;  4L23 A;  1TZO A;  2J4X A;  2WXF A;  1D5M C;  4L1B A;  1GB1 A;  2CJO A;  3ZJT A;  3ZJU A;  3VRB B;  4D2K A;  4OVZ A;  5E6J A;  4RFB A;  4FXC A;  4YSY B;  2K22 A;  1D5X C;  1DOX A;  1ZE3 D;  2XNA C;  3Q8E A;  2W3R A;  1AWD A;  4TMA B;  1J7B A;  2NTT A;  4OZA A;  2BS3 B;  1QKZ A;  2PMV A;  1PUT A;  3AED B;  1JWU D;  1UWX A;  2X38 A;  2WXR A;  1NEN B;  3B2G A;  3NVV A;  2PLP A;  4HRO A;  4NJC A;  1ZP0 B;  2M56 B;  1GAQ B;  3CIR B;  2LEK A;  1YN3 A;  4Q2J A;  4RF1 A;  5JXV A;  3AE2 B;  3E56 A;  3IAS 1;  1J7C A;  3R8B A;  1TKG A;  2N9L A;  2WXL A;  1TS3 A;  1ZUD 2;  5HFY A;  2MH7 A;  4XWW A;  1FXA A;  1RFK A;  3W9C B;  1FD6 A;  2ACZ B;  2WXH A;  3DWG C;  1XLN A;  2G9H D;  1RWS A;  5D3I B;  2K0P A;  4P6V F;  4GLS C;  3ZYY X;  3VR9 B;  1D6E C;  2K9X A;  1ZDV A;  1I7H A;  4J3O D;  2OED A;  1OQQ A;  3DWM A;  3GB1 A;  1CJE A;  2LHD A;  2WXP A;  3W5U B;  1NVI D;  1FIQ A;  4ZHP A;  1E9M A;  2WXO A;  4ZRQ A;  1KLG D;  2FE8 A;  1FEH A;  1WSP A;  1I4H A;  4JPS A;  2E3T A;  4ARC A;  2Y5P A;  3R2I A;  3AE4 B;  2I38 A;  4B0E A;  2QMT A;  3MP9 A;  3L4P A;  2JYE A;  4US8 A;  1GPX A;  1MHH E;  2MJE A;  3Q8A A;  5TSS A;  1VZ6 A;  4NAM A;  1QIL A;  2EKI A;  4LTU A;  3HRD D;  4C80 A;  1UWM A;  4A9A A;  2IGH A;  1TKY A;  3NS1 A;  2ON8 A;  1F2R C;  2V4I B;  4JX1 C;  1SF0 A;  5FK9 C;  1SE4 A;  4KKI A;  2INP E;  1C79 A;  2L52 A;  3U52 E;  5HI1 A;  2WXN A;  1JWB D;  1FRD A;  4MH8 A;  1HA5 A;  4RH6 A;  2WQY B;  1ESF A;  1ET6 A;  3OWE B;  1QOA A;  1K52 A;  2LFI A;  3HVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...