1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
3SR6A 3AECB 2W3SA 5MPOA 2WU5B 2WDQB 1TKGA 5EE3A 1E7PB 2B76B 3AEDB 2HTME 2MH7A 1DOXA 2K9XA 2MJDA 3NVYA 4LTUA 2H88B 1E6EB 1FRRA 2BS4B 5C3JB 3AMZA 5GXGB 3AE4B 2PIAA 5G5HA 2JQRB 5EE1A 2WQYB 3AE3B 1YJIA 4N6EB 4USAA 1ZUD2 1I7HA 4N58A 4HROA 1YQ3B 1H7WA 2WDRB 2Q5WD 1E10A 1QOFA 4YTMB 2PVOD 2L52A 2E3TA 1E9MA 3HVZA 1FRDA 3AE6B 1ZXIA 4IDIA 4FXCA 3VR9B 4A9AA 1WGKA 1WWTA 1KRHA 4YT0B 1A70A 1FXAA 2DBYA 4WWMA 1RFKA 4ZOHC 1H7XA 2WS3B 1RWSA 2M19A 3B2FA 3NVZA 2PVGC 5AUKA 5G5GA 3DWMA 4JWSC 4JX1C 1YQ4B 1JWAD 3FC4A 2K22A 1N5WA 2Y5CA 3CWIA 1XLPA 1SIJA 4C7YA 1YJJA 3VRBB 3EUB2 4ZHOA 3P4PB 1QLBB 4WQMA 1FFUA 1WYGA 3VR8B 1ROEA 1FIQA 3AE2B 3B2GA 3HUIA 3NRZA 3NVVA 1RM6C 3AEFB 3AEEB 1KFYB 2W55A 1JW9D 2BT6A 4YXDB 3AB5A 2PKOA 5H92C 3VRAB 4ITKA 2CJNA 2ACZB 1JWBD 2K5PA 3HRDD 2OHFA 1DOYA 2M56B 1CZPA 2BS2B 3AEGB 1L5PA 3ABVB 2CJOA 2EKIA 1RYJA 1QT9A 1GT8A 1EWYC 1TKEA 1F0ZA 1N60A 5H8YE 2H89B 3NVWA 2MJ3A 2N0SB 3W9CB 1SF0A 3AE7B 4N59A 4US9A 4C80A 3CF4A 4US8A 1QOGA 3P63A 1NENB 1FO4A 2KAJA 1N61A 2L83A 1FXIA 1VLBA 3KWLA 2BS3B 1NYQA 3SFDB 2QIEB 3SFEB 2WP9B 3DWGC 1GAQB 1QOBA 2WDVB 3P4RB 1FMAD 1TKYA 2KMMA 2LEKA 3AE1B 1N63A 1VJKA 1UWMA 1AYFA 1FFVA 1N5XA 1OFFA 4P6VF 3L4PA 1L6UA 4KX6B 4JWUC 4YSXB 1OQQA 3LB8C 3AE8B 3RPFC 3NS1A 3WCQA 1J7AA 1XLOA 3AEAB 1WRIA 1PDXA 5EE0A 3BIID 2DWQA 3LXFA 5EE9A 2FBWB 2JX5A 1DGJA 1L0VB 3CIRB 2AX5A 3W5UB 1JQ4A 1IUEA 1NVID 1TJEA 1NEKB 1OQRA 1T3QA 1TYGB 1V97A 2MJEA 1JROA 1SB3C 2QJLA 1XLQA 2W3RA 3AV8A 3AN1A 3ETRA 1JRPA 4C7ZA 3AE5B 1N62A 3P4SB 5AUIA 1XO3A 1ZP0B 4HRSA 1R7SA 3P4QB 1CJEA 5C2TB 1FM0D 1PUTA 1VDVA 1JALA 2G1EA 1L6VA 1J7CA 3FAHA 1V8CA 2WU2B 3P1MA 1DOIA 3AH7A 3AE9B 3PO0A 2W54A 3ZYYX 1KF6B 1GTHA 1J7BA 2CU3A 4ZHPA 1AWDA 1ZOYB 1QF6A 1NI3A 1XLNA 1NYRA 1QOAA 4YSYB 3AEBB 1WXQA 1PFDA 2WLBA 3B9JA 1B9RA 1E0ZA 1GTEA 1GPXA 3W5VB 4YSZB 4YTNB 3AM9A 4YTPB
chains in the Genus database with same CATH superfamily
1WI0A 4BKGA 4DXFA 2K9XA 3NVYA 4IWOA 4XWTA 1N6ZA 3RZWC 5C3JB 1UGMA 3J9CA 2WQYB 1I4RA 2D2QA 1WGHA 2N1VA 4YTMB 2PVOD 5BO4B 4DBGA 4CYEA 2WS3B 1RWSA 2CU1A 4XC2A 3VRBB 2GBJA 4A20A 1K52A 1FFUA 1WYGA 3RULA 1YOVB 1FIQA 1YJ1A 1C1YB 2KOXA 1OEYJ 3ZO5B 4CHKA 2BT6A 1K53A 1SEBD 2MBHA 2KC1A 3TL5A 3SEBA 4RMAA 3BZDB 3VHTC 2L7RA 2JZPA 2MJ3A 4M8MA 1UWXA 2NBVB 1R4MI 2AYOB 4RGTA 4K7SA 2LJIA 1D5XC 1FFVA 1V1PA 1D5MC 2M4NA 4L2YA 4JWUC 3LB8C 1JWMD 3N32A 2KXJA 1SE9A 2NBWB 3V6CB 4YL8A 3DBSA 2D3AA 1Q5WB 4TV3A 3AV8A 4HPPA 3HIZA 5AEKB 4XYCA 3PLVA 2RDHA 4AWJA 1ZP0B 3N1YC 2J53A 4ASWC 5G2NA 3MTNB 1E8ZA 2CU3A 1SGHA 4NAWB 3ZKJC 2QHOA 4FADA 3T9LA 2MBQA 1EM7A 3W5VB 4MSQB 4EZLA 2CHWA 4W9KA 1P7EA 4M8NA 4W9GA 1PGBA 4FHJA 4IC7B 4C4VA 2LI5A 2RPQA 3X23A 3VQIA 4P7IA 3N3KB 2PIAA 4DXGA 1VZ6A 1XCQL 2HDEA 1XQQA 2REXA 5CHWA 2E3TA 3RZFA 2FUHB 1WGKA 3IAS1 4YT0B 4ZOHC 3IVFA 4ICVA 2M19A 4M02A 4AJYB 3Q8AA 4KKJA 3TEXA 1XLPA 3N30A 1L0XB 1HZ5A 3V62A 4MH8A 3FILB 4ANXA 1RM6C 1JWUD 1Q1OA 4EZJA 1P3QU 3B08A 3VRAB 2NS5A 1V6EA 2BGFA 1WGRA 4XDCA 4HDQA 3PZ8A 2DYMA 3QAQA 2GOWA 4OW0A 1EF5A 4UDUC 3AI5A 4NY0A 1BXTA 1FO4A 3H7PB 5JXVA 5DPSA 4M0WA 2LXCA 1UBIA 1WM3A 1WMHA 4JLCA 4FN2A 4OZBA 2PE6B 2JT4B 3OG5A 2LD9A 4WAFA 3ECIA 1WRIA 2MWSB 1C3TA 4WWOA 3CIRB 3W1SC 2L1AA 1T3QA 1XF5L 5D3IB 2L76A 3TEWA 2D3GA 1E8YA 4NQLB 1SJED 1J7CA 2BYFA 2K3UA 3ZYYX 3AXCA 1VR9A 3PREA 1LQBA 1XLNA 3VUWA 5I4DA 1GTEA 5JZEB 3ENEA 2JWUA 2OJWA 2KFKA 2PTLA 2JU6X 3U8ZA 1V5TA 2DX5B 2GBNA 1MHXA 3RYTA 4D2KA 4PT5A 5L83A 4N6EB 3B1LX 2PPHA 1YQ3B 5JH5C 1MG4A 5TR5A 4GSWA 1FRDA 2GB1A 4IDIA 4KSLC 1LO5D 1WWTA 2OOBB 4NPNA 4II3B 1QZEA 3CWIA 2ZJDA 4TSSA 4W9DA 4WJNA 2AQ3B 4GDKA 4ARIA 4ZYSA 3NS8A 3AEEB 1JW9D 5FK9C 4RH6A 3UF8A 4A55A 3A4SC 4EOYA 2OHFA 2M56B 1E8WA 1CZPA 1TS4A 5H8YE 1E5WA 3I9V1 5LNK1 3HK0A 3EFUA 1N61A 3NUHB 1NYQA 3V61A 3RNEC 2DZMA 2WP9B 3QWZB 1FMAD 1ZDVA 2M0AA 2LEKA 3VTUA 1VJKA 1UWMA 4GN1A 1WZ0A 3EA6A 3RPFC 1IBXA 1U4AA 1K50A 3A1QB 2XK5A 3P42A 3ZRCA 2O6VD 3GE3C 1WM2A 3Q8FA 4G0NB 4XE0A 2DHZA 3RCZA 2K8HA 5D2MB 1UNSA 4E3CA 3P4SB 5AUIA 3OWEB 1FM0D 1V1PB 4P1BC 2Z8LA 1C9FA 4ZHPA 2K1FA 1NYRA 1QOAA 1HEZE 3L16A 3ZDMC 2MBEA 3JVZX 3WA0A 2X8XX 4BKSD 2M17A 4GB9A 1ET6A 1ZXHA 2YVCA 3OLMD 2L52A 1MI0A 4DQOC 2WXGA 1IYFA 2KD0A 2JXXA 1WSPA 4HPLB 1M4VA 2PVGC 4BOZB 4JX1C 2NTTA 2LMCA 1IGDA 2UYZB 3C19A 3EUB2 1YD8U 5J17A 2D11A 2WXPA 1E8XA 3Q6BA 5CHFA 5AZFA 3TUOA 3ABVB 2VZKD 1F52A 5J2RA 4PK1A 1WIAA 1C77A 2RGFA 1MFWA 4LLGM 4FHKA 1FNVA 1VZ7A 1HXYD 2WXJA 3SFDB 3L10B 3SFEB 2QIEB 1GAQB 3KQ4A 4H2AA 4DDID 1TKYA 2KN4A 2LGDA 3L4PA 2NR2A 4YSXB 4CQNA 4W9LA 4IG7B 1G6JA 1D3ZA 5JHAA 2V0GA 2IY0B 3N9YC 3LXFA 4MGIE 2AL6A 1IUEA 1SB3C 2KWDA 1N62A 1RFAA 4ICUA 4MSMB 2JXTA 2R2QA 2KACA 1PUTA 2SEBD 1V8CA 3P1MA 3AE9B 3ZJVA 2C60A 2W54A 1V9JA 3EFCA 4A3PA 2AQ1B 1F1HA 4B6WA 1E0ZA 4NAWA 1GPXA 4YTNB 2FIDA 4W9FA 1PGXA 4IWQA 3IG3A 4BVUC 4JPSA 3BK2A 3PZDA 2RMMA 4DK5A 3QX1A 4QAYA 3UQBA 3ML9A 2KKCA 4MELA 2FUG1 2LVQA 2ON8A 1WGDA 5E6JA 2BKFA 2WDRB 1V5OA 3TJPA 3IFWB 3APCA 3U52E 3X0WA 3K9OB 5BYSA 4N9F4 2L0TA 3A9JB 1FCLA 3B2FA 2BKRB 1YQ4B 1ZKHA 3MFGA 3GP7A 1SIJA 1I4GA 1HE8A 1TIFA 2MA9B 2WDTB 4PYZA 2KVRA 1YX6B 5H92C 1OTRB 1FD6A 2KWVB 3FILA 2O2VA 1I35A 2FCQA 2JWZA 3RNFC 1F0ZA 4K3BA 3BINA 2KDBA 4WWNA 1SF0A 4N59A 1WR1A 2V4IB 2OEDA 1HQRD 2V3SA 3PZ7A 2C7MB 3BK1A 4ZRPA 2EKEC 1QOBA 1F77A 5TSSA 2ZZPB 1L0YB 3ZTCA 2V1YA 1PDXA 4B0MA 3ZDTA 2JX5A 1L2NA 2N9EB 1F2RC 2MJEA 1XLQA 3M3JA 3DQVA 3E56A 4K81A 3ZGZA 2UWQA 5C23A 2K5PA 1VDVA 3ZLZA 1JALA 2LUMA 4Q2JA 4AS1A 1WH3A 4NJCA 1TS5A 1WX8A 3KYDD 2BQQA 3SR6A 3LDZE 3DVNU 2J42A 3PS6A 2RR9A 3GE8C 2WX0A 3UINB 2C9WB 2MBBB 4LNOA 5EE1A 1GC6A 4BFRA 1CK1A 2KDFB 4KV2A 3DDCB 3E9SA 1RFKA 5AUKA 2QMTA 3C8YA 4EZKA 1IGCA 3VFKA 4WQMA 2N9XA 2V4LA 3VR8B 4FA6A 3HUIA 3M63B 4ACFA 1LXDA 2JF5A 1J19A 1I4QA 3QQ8B 3DBLI 1JCKB 4J6IA 4GU2A 1D5ZC 1C78A 3K9PB 1X1MA 2JPHA 4GOCA 2QC8A 4OZAA 4DDGD 4C00A 2LJ5A 1KJTA 1YQBA 3A4RA 4JE3B 5C1ZA 1GJZA 2PW9A 3KLSX 4EKUA 1FXTB 3ZUNA 5LLIA 3AEAB 2N7EA 3NZSA 1JQ4A 3A1QA 3EC8A 1TYGB 1Z2MA 1GUAB 2VH1A 3KW5B 4I6NB 2ASQA 2WU2B 2FIFA 3T8MA 1ISNA 1TBEA 3PLUA 2D5GA 5D94A 1QF6A 3L17A 2LXAA 1E7UA 4G50A 3UI3A 3HM3A 4YSYB 3VUYA 4GLSC 3L08A 3FKYA 3RT3B 1OGWA 3DBRI 2FNJB 2WYQA 4RF0A 1V49A 5JHBA 2KX3A 2G9HD 4TKNA 4F1SA 1SIFA 4RGOS 3BYYB 4HVBA 2MCNB 2JZ3B 2MP2B 2IBIB 3AULA 2Z59B 5J18A 3MC9A 2HTHA 1H7XA 4DHZB 2CR5A 3NVZA 1R4NI 3ZXVA 1NI2A 3PRPB 1JWAD 3DBHI 3H8HA 3A9KA 1ROEA 4TUUA 4XWWA 3NRZA 2RPVA 1ZDXA 3U7ZA 3HRDD 1WR6E 2KLCA 2BWES 2BS2B 4A3OA 3SU8X 2GI9A 4A8XC 1UD7A 4GDLB 3W9CB 1DYQA 4US9A 1CQVA 1L4ZB 3R2IA 5AZHA 2O2VB 2BTEA 3DVNV 2J0KA 1SE3A 2MRPA 3MJWA 4W9HA 3QC8B 1PQSA 3MC0B 1L0VB 2AX5A 1V97A 1NEKB 2LUEA 2NTSA 2AL3A 3EHVA 4RNAA 1BMLC 2WNMA 2WXMA 2J7QB 3SD5A 2D3BA 3RUIB 1YN3A 3NHEB 3URYA 4F7ZA 5BYRA 4K1RB 2KQSA 3BVZA 4A90A 3DVGY 4HDOA 2BW2A 1K51A 1TZOA 2G4DB 3W1SA 2KWUB 1E90A 3JW0X 3PVLA 1XCTL 2AQ2B 1FPYA 3I63C 5KHOA 1FNWA 3QARA 4W9IA 2HTME 2B76B 2MH7A 5EE3A 3NZUA 3L54A 2H88B 1FRRA 2KYWA 1WJ6A 1EF1A 2WWZA 4RCOA 3VR9B 1E7VA 1KRHA 4WWMA 2I38A 2UU7A 3W2DA 1MVKA 3WANA 5CTRC 3A9JA 1SJHD 4PS3A 2J4XA 4G11A 5D7GA 2KNBA 4J3OD 3KH0A 3GZNI 1WE6A 4JGHB 3TCAA 3BVGA 2V3NA 4ITKA 2MEKA 1OQYA 5E6NA 3P2BA 4P16A 4OHJA 3RN9C 4HKQA 2L83A 2CJOA 4NJ6A 1N60A 1HTQA 2H89B 2FAZA 2BYTA 1KOTA 3IBEA 4DHZE 3PTFC 4MDKE 2ZCBA 3D32A 2WXOA 2D10A 3KWLA 2K0PA 3ZVVA 1C4CA 3IT4B 2JRIB 2SAKA 2VH2A 2BB6A 2KMMA 1N63A 1TTNA 4HEA1 4X57B 2NCNA 4IWPA 1KLGD 1E10A 1OQRA 2KJRA 3H9DA 2OJRA 3Q3OC 4M01A 1JRPA 2KX0A 5C2TB 4HK2A 1L6VA 3V6EB 3AH7A 1ACCA 2JUOA 2BYEA 1J7BA 2YEPF 2IGHA 1L4DB 3TSSA 5LXHA 1STEA 2GLSA 4TQ0A 4YTPB 2LGSA 2BPSA 2W3SA 5MPOA 1R4MB 3L13A 3ONSA 2GBRA 2WDQB 5CHVC 2PJHA 3UGBB 3UQAA 1ZGUB 1DOXA 3VXWA 2MJDA 2N4FA 1E6EB 2DZIA 2ZNVC 3PPAA 4NNJB 3M95A 3GS2A 4N58A 3GB1A 1ZW7A 2WGSA 3AE6B 1FXAA 2KZRA 1B1ZA 5BMGA 3W1YA 3R2TA 2IO0B 4JWSC 1N5WA 1Y56A 2LRUA 4HJKA 2FE8A 3Q2AC 4K7WA 5HFYA 4EEWA 1WXMA 3LYYA 4L23A 2ZPYA 2CJNA 4JQWC 4RM8A 1DOYA 2HJ1A 1FNUA 2J52A 3MJ5A 3WAMA 2N0SB 3DHGC 2KWCA 4US8A 2IPKD 3C0RB 3A9KB 2KTFA 1WX9A 1T5XD 4KIKB 3DWGC 4II2B 1SBBB 2C7HA 3NY5A 1HA5A 1KLVA 2K39A 4HJGE 5GMVA 2L05A 3BIID 4XDDA 3TEZA 1MJDA 5FKAC 1EO6A 2MLBA 3N20C 1MG8A 4URKA 1NBFC 1TJEA 3ETRA 2YLMA 2CKHB 4C7ZA 3Q8EA 5EDSA 3P4QB 3ZNGC 1T0YA 5AZGA 1K8RB 4KZ0A 2BF8B 3V60A 3AEBB 3O65B 5IP4D 3IHPC 1P7FA 3IAM1 1J0GA 3N1ZC 2WU5B 2WX1A 1WGGA 5BMHA 1GB4A 3KVFB 4WURA 1H4RA 2TSSA 3U4EG 4REZA 4MACA 4MJSB 3DHHC 3N1XC 3SDLC 1WXAA 1E9MA 2KTRB 2I1JA 2MP2A 4W9CA 3A33B 2ZW1A 3U30A 4LCDE 2WHIA 5HG2A 2O6VB 4ANVA 3AB5A 3EGRA 5D6JB 2ZPNA 2LZ6A 4I6LB 3UIPB 1RYJA 4IW0A 5DPTA 2CS4A 2DAFA 1QOGA 4GDLA 3KWVA 4OVVA 2D07B 4GGQA 2MQJA 3BWUD 5BMIA 3TMPB 2JZZA 1YMHE 3DVGX 5L95C 3Q14C 2XNAC 3PRMB 5EE0A 3CF6E 2DWQA 3DCGA 1TZ1A 1P1AA 2LASA 3AN1A 5CX3A 1GC7A 4B9KA 3VUXA 1V2YA 1CJEA 5KHQA 1GOZA 1T0SC 1GNUA 4BAXA 2N7JA 3TIXA 1T0RC 2KT7A 5T8IA 1WXQA 2KO3A 3QHTA 4IM0A 4CO7A 4BZAA 3AM9A 2MX2A 3R66C 3PSEB 3RNAC 4LNNA 2WXFA 3AEDB 2EMTA 5IO9A 1C76A 3SHQA 1XXGA 1Z5SB 2K6DB 1PYWD 2VZKB 4FBJB 4KSKC 4USAA 2VRRB 4AOFA 1JMLA 1P0RA 1H7WA 4WAAA 2IDYA 4KGRA 2BB5A 2BWFA 2QDFA 3HVZA 3RMKC 3NJTA 4A9AA 2L00B 1QILA 2LGXA 2RDGA 2KJ6A 2ZNVB 4FJZA 2K22A 4AQ7A 1SSNA 4KGSA 4EE2A 4WQOB 1TY2A 3JYUA 3CMMB 4OZCA 1JWBD 1WRDB 3PV1A 4S17A 3WAPA 1EWYC 4OVUA 2WXQA 3NZ3A 3VH4B 4BBNF 4C80A 2IY1B 2ZEQA 3BY4B 2KAJA 1IPGA 1TY0A 2INCC 4WJQA 3I5JC 3PGEA 3VTWA 3PT2B 4ZDVA 2WDVB 1T0QC 2G3QB 1AYFA 1OFFA 2DNFA 2KC2A 2KANA 1XLOA 5EE9A 4KGTA 4DXAB 1H8CA 4L1BA 3DHIC 2W3RA 1XEEA 4NAMA 1V1OA 4HKZE 1XO3A 1GG3A 4PYUA 3H1UA 1VD2A 2LVOA 1F9JA 2NPTB 2WLBA 1PFDA 2WXIA 3MC8A 2LFIA 4PS8A 1YX5B 5HKHA 2DAJA 2AEHA 2YEPB 1Y8RC 3AMZA 2ZVNA 3HM6X 2JQRB 3HVDA 2KVZA 3AE3B 1I7HA 4KDIC 1A5RA 3V3XA 3Q8CA 2KN5A 2JY6A 3I3TB 4RM9A 2INPE 1SE2A 4WJOA 4G3XB 5DCNA 2GBMA 3MHSD 2BYVE 1EWCA 1QLBB 1M94A 2L0FA 5IAAC 4B0EA 4JL9A 4AP4C 3CSFA 1RRBA 2BVCA 2J0MA 1UH6A 3ALBA 3QJZA 4WJPA 3ZW3A 3BYTB 3H7SA 4ARCA 4XGAB 3I57A 3AE7B 3Q3JA 1WY8A 3PHWB 4XX5A 2W82A 4BBNC 3P63A 3U2SC 1UZXB 3P4RB 2GBKA 4IOIE 4DHJD 4KIKA 2HJ8A 3AE8B 4E71A 2KHWB 1GB1A 1D4BA 3APFA 4LJOB 1WGYA 1HTOA 2GRIA 2V9HA 3R7RA 4W9JA 3NOBA 2ICIA 2GMIC 3MHZA 2K6QA 2ZVOA 3Q69A 4KVGB 1KF6B 1GTHA 1ZOYB 3TBLD 4DWFA 3R7QA 3QIJA 3AECB 5IOIA 1S1QB 2KQ4X 1UUPA 2QSDA 2X38A 2WXLA 4K3CA 1E7PB 2LRWA 2QCZA 3GOEA 4FLHA 1J8CA 2BS4B 1I4XA 5GXGB 5G5HA 4A6QA 3ML8A 1ESFA 2INDC 1D6EC 2PEAA 3U7DA 3L0WB 3VH3B 2I1KA 2KMCA 2IGDA 4MJSA 1MHHE 4PS7A 2FCNA 1XT9B 2CHZA 3LJ3A 2KTRA 3PHXB 1VRAB 4C7YA 2A5UA 4LDTD 3P4PB 3AE2B 1VZ8A 4EUTA 4NQKE 3NVVA 1KFYB 2A4ZA 4YXDB 2LGIA 1QQRA 2ACZB 1UGJA 3DOWA 3Q3NC 4ZRQA 2O6VA 3AEGB 1Q10A 4XZ4A 3WIMA 3R3MA 5BYQA 3NVWA 2INNE 4TMAB 3IXSA 3JSVB 1TS2A 2N9PC 3RD2A 1VLBA 2M1MA 2LHEA 5DPWA 2BS3B 4GIVA 2RSUA 4WIPA 2KDMA 2N9KA 1OQQA 3NS1A 4KDLB 3WCQA 1QKZA 2LHDA 4ZRJA 4GXBA 3AU5A 4TQ1A 2MSED 3OAWA 4KZCA 4BKSA 1WJ4A 3DPDA 4MM3B 2B3AA 4MEMA 3RNGC 5IKCM 1FEHA 3AE5B 4HRSA 2G1EA 3FAHA 1DOIA 1AN8A 1EUVB 2CHXA 4ZYNA 3DBLB 1Q0WB 5IA7A 1NI3A 2JYTA 2G4SA 1AW7A 2DYOA 1WF9A 2K8CA 3NG0A 1UF0A 2MBOA 1TKGA 4DHJB 2E6XA 1NDDA 2KLGA 4EFOA 4LTUA 1JRUA 3TEYA 1FCCC 3ZNID 3OJ3A 2XN9C 1WYWB 2KJHB 2XBBC 4HROA 4R3DA 4MGKE 1YIWA 1V81A 2L8JA 1ZXIA 1A70A 2XEWA 1EU4A 1RAXA 4HLEA 4LNIA 2J0JA 5DPRA 5LXIB 2Y5CA 1LGRA 1WZ3A 1WFYA 1LFDA 4P1CC 1P98A 3KUZA 1I4HA 2KQ7A 3UIOB 4GMVA 1C79A 3VVWB 2IO1B 3ZRFA 3V05A 2EKIA 1QT9A 4FULA 2JRHA 2MW5A 2N7DA 3DBRB 3WAOA 1LM8B 2RDBC 5HHDG 3CF4A 4JIOU 1RLFA 2HD5B 2KK8A 2R61A 2DLBA 1FXIA 4FJVB 1P9DU 4LK0M 4LJPB 1OEYA 4WH4A 2G45B 1WE7A 1N5XA 3RNBC 4IM2A 1YN5A 4AUQC 4HPMB 3PRZA 2D3CA 1BT0A 4LDTB 2R2OA 2FBWB 3O13A 3T3NA 1WXSA 1R4NB 2JVCA 3PO0A 2L3ZA 2W55A 2JSVX 5IN7A 3DBHB 4C56C 3B0AA 4LNKA 1YN4A 4NJ7A 3ZNHB 2WXKA 1AWDA 2DENB 2LVPA 4LNFA 4M00A 1WX7A 4W9EA 2Z0EB 3B9JA 2NPTA 4C4VB 2I2YA 2IJ0A 1ET9A 1WXVA 4NZLB 3CSTA 1HZ6A 2N1WA 3VTVA 2PMVA 1UELA 1TT5B 2N9LA 5D3DA 4RGMA 2WXRA 3T3OA 2Y3AA 2Z0DB 2KDEB 1QOFA 2K8BA 2RD0A 1EU3A 2DBYA 3ZIMA 2NBUA 4MGYE 2NMQA 5G5GA 3H6NA 3DWMA 1L7YA 2IZVB 2KMAA 1BUIC 2MHJA 2DZKA 2KFJA 3ZTDA 2DYBA 4MGZE 4BKTA 2PKOA 4I6PA 4ANUA 1TGZB 5FR3A 3Q3FA 2WXNA 1L5PA 3RI7C 3IT6B 1GT8A 1TKEA 3KUCB 2K25A 4ZRIA 1XD3B 3HHMA 1S3SG 3ZXRA 4M0WB 4HXDA 1NENB 2HE7A 4AJWA 3Q8BA 1WMHB 2BBCA 1SE4A 4ZRKA 2IYDB 2JYEA 3AE1B 2FCSA 2EELA 2AWTA 2W9NA 3R8BA 1L6UA 4KX6B 2EMSA 3KYCD 2IO3B 1ZE3D 1DGJA 3QA8A 3W5UB 4S0RA 3ZQ4A 4K7UA 1NVID 1JROA 1WJNA 1KLUD 4HCNB 2NVUI 1R7SA 4O1NA 2QILA 3GZNB 4RFBA 5HI1A 5FR6A 3BVMA 1C4AA 1KH0A 4B95A 2KDIA 2KFKB 2M8SA 2WXHA 2ONQA 4WWPA 1I42A 3RNCC 4RGNA 1SXTA 1UBQA 1PGAA 2IO2B 1WJUA 3EECA 4FJYA 1AARA 2M0XA 4MH0E 2Y5BB 3AE4B 4YWGG 2L32A 1YJIA 1ZUD2 2Q5WD 2Y5PA 4IM3A 1C4PA 3ZNZB 4FXCA 3WALA 1JWSD 1ENFA 4IUMB 3APDA 4KKIA 2C5LC 4GDKB 3FC4A 3KUDB 1YJJA 4ZHOA 1KM7A 4OVZA 3VAWA 3M62B 1MPEA 3H7PA 3B2GA 3AEFB 2IGGA 5G55A 3VDZA 3QCAA 4RF1A 5E6OA 1TS3A 2FCMA 1F2RI 3ZJTA 1CMXB 3QK0A 2LWPA 4F8CB 2LGYA 2QEJC 1IP9A 4E74A 4ANWA 1V80A 2PE9A 1T6BX 1KTKA 2ZCCA 3JSVA 3ZJUA 1I4PA 1ZPSA 1VCBA 1IBXB 4HWIB 2XK5B 4P6VF 5E6PA 4HCPB 1J7AA 2PLPA 3Q3MC 1V86A 4IKGA 1YNTE 3AU4A 2C7NB 3S2AA 4MT5A 2QJLA 4MM3A 2DZJA 4BOSC 3OJ4B 2V3PA 3RFZB 3MP9A 1B9RA 2ZW0A 4YSZB
chains in the Genus database with same CATH topology
3AECB 1PGXA 2W3SA 5MPOA 4JPSA 4DXFA 3BK2A 2KQ4X 2WDQB 1UUPA 2QSDA 2RMMA 2X38A 2WXLA 1E7PB 1DOXA 2K9XA 2MJDA 3NVYA 1E6EB 4XWTA 2FUG1 2BS4B 5C3JB 1I4XA 2ON8A 3J9CA 5GXGB 5G5HA 4A6QA 5E6JA 1ESFA 2WQYB 1D6EC 1I4RA 3GS2A 4N58A 2WDRB 3GB1A 4YTMB 2PVOD 3U52E 2IGDA 1MHHE 5BYSA 3AE6B 1FXAA 1B1ZA 5BMGA 2WS3B 1RWSA 1FCLA 3B2FA 3R2TA 4JWSC 1VRAB 1YQ4B 3MFGA 1N5WA 1Y56A 3GP7A 1SIJA 4C7YA 3VRBB 3P4PB 1I4GA 1K52A 2FE8A 1FFUA 1WYGA 5HFYA 1FIQA 3AE2B 1VZ8A 3LYYA 3NVVA 4L23A 1KFYB 2BT6A 4YXDB 5H92C 2LGIA 1QQRA 1K53A 2CJNA 2ACZB 1UGJA 1SEBD 1FD6A 3FILA 4ZRQA 1DOYA 1FNUA 3SEBA 3AEGB 1Q10A 2J52A 3MJ5A 1F0ZA 5BYQA 3BZDB 3NVWA 2MJ3A 2INNE 2JZPA 2N0SB 1SF0A 3IXSA 1UWXA 4TMAB 4N59A 2V4IB 4US8A 2IPKD 1TS2A 2OEDA 1HQRD 3PZ7A 1VLBA 2LHEA 2BS3B 1T5XD 3BK1A 4ZRPA 3DWGC 4WIPA 1QOBA 2KDMA 1SBBB 4RGTA 2LJIA 1D5XC 1F77A 1FFVA 1D5MC 1V1PA 4L2YA 2N9KA 5TSSA 4JWUC 1HA5A 1OQQA 3LB8C 1L0YB 1JWMD 3NS1A 3WCQA 1QKZA 4HJGE 2LHDA 1PDXA 4TQ1A 3BIID 4XDDA 4B0MA 3TEZA 2JX5A 5FKAC 4MM3B 1TJEA 1F2RC 3AV8A 2MJEA 1XLQA 3ETRA 1FEHA 4C7ZA 3AE5B 3E56A 2RDHA 3Q8EA 3ZGZA 1ZP0B 4HRSA 3P4QB 1VDVA 2K5PA 1JALA 2G1EA 3FAHA 2LUMA 2J53A 4Q2JA 4AS1A 1DOIA 1AN8A 4NJCA 1TS5A 2CU3A 4NAWB 1NI3A 2JYTA 3AEBB 1AW7A 1EM7A 2DYOA 3W5VB 1P7FA 3SR6A 3IAM1 2J42A 1P7EA 2WU5B 1PGBA 1TKGA 2E6XA 5BMHA 1GB4A 4LTUA 3VQIA 4WURA 3TEYA 1FCCC 2XN9C 2PIAA 4DXGA 1VZ6A 1XCQL 2TSSA 5EE1A 3U4EG 4REZA 2HDEA 4MACA 4HROA 1CK1A 4R3DA 2E3TA 1E9MA 1ZXIA 1WGKA 3E9SA 3IAS1 4YT0B 1A70A 4ZOHC 1RFKA 2ZW1A 1EU4A 2M19A 2QMTA 5AUKA 3C8YA 3Q8AA 4KKJA 1IGCA 3TEXA 2Y5CA 1XLPA 1L0XB 1HZ5A 4WQMA 3VR8B 4MH8A 5HG2A 3HUIA 3FILB 1RM6C 1JWUD 3AB5A 1I4HA 3EGRA 1I4QA 3VRAB 1C79A 1JCKB 4XDCA 3V05A 1D5ZC 1RYJA 1C78A 1QT9A 2EKIA 3PZ8A 2DYMA 5HHDG 4OW0A 4OZAA 3CF4A 4UDUC 1QOGA 1BXTA 2R61A 1FO4A 3KWVA 2DLBA 1FXIA 5JXVA 4LK0M 4M0WA 4WH4A 3BWUD 5BMIA 4JE3B 1N5XA 1YN5A 1YMHE 2PW9A 3KLSX 4OZBA 4WAFA 3AEAB 2XNAC 1WRIA 5EE0A 2DWQA 2FBWB 3O13A 3T3NA 3CIRB 1JQ4A 2L1AA 3PO0A 1T3QA 1TYGB 2W55A 2JSVX 1XF5L 3AN1A 5D3IB 4C56C 3TEWA 1YN4A 1SJED 1CJEA 1GOZA 1J7CA 2WU2B 2K3UA 2WXKA 3ZYYX 2N7JA 2D5GA 1AWDA 1QF6A 1VR9A 1XLNA 5T8IA 3UI3A 4YSYB 1WXQA 3B9JA 5I4DA 1GTEA 4GLSC 3AM9A 2JWUA 2PTLA 2I2YA 2IJ0A 2JU6X 1ET9A 4RF0A 2WXFA 4NZLB 1HZ6A 3AEDB 2PMVA 1C76A 1XXGA 1PYWD 2N9LA 5D3DA 1MHXA 2G9HD 4RGMA 2VZKB 4RGOS 2WXRA 4D2KA 4PT5A 3BYYB 2Y3AA 4N6EB 4USAA 3T3OA 1JMLA 1YQ3B 1H7WA 1QOFA 2IDYA 4KGRA 2BB5A 3HVZA 1FRDA 2GB1A 4IDIA 4A9AA 1LO5D 1WWTA 1QILA 1EU3A 2DBYA 2RDGA 2NMQA 1H7XA 5G5GA 3NVZA 3DWMA 1JWAD 2K22A 4AQ7A 3CWIA 1SSNA 4KGSA 1BUIC 4EE2A 4TSSA 3H8HA 4ARIA 2AQ3B 1TY2A 4ZYSA 1ROEA 4XWWA 4OZCA 3NRZA 3AEEB 1JW9D 2RPVA 5FK9C 2PKOA 4RH6A 1ZDXA 1JWBD 3U7ZA 4A55A 3HRDD 5FR3A 2OHFA 2M56B 1TS4A 1CZPA 2BS2B 1L5PA 2WXNA 3IT6B 1GT8A 1EWYC 1TKEA 5H8YE 2GI9A 2WXQA 4A8XC 4GDLB 3W9CB 3NZ3A 1DYQA 3I9V1 4US9A 5LNK1 4C80A 1CQVA 1NENB 2KAJA 1N61A 1TY0A 3Q8BA 3NUHB 2BBCA 1L4ZB 1NYQA 3R2IA 1SE4A 2WP9B 2WDVB 1FMAD 1ZDVA 2M0AA 2JYEA 2LEKA 3AE1B 2BTEA 1VJKA 1UWMA 1AYFA 2EELA 1OFFA 3R8BA 1L6UA 4KX6B 3EA6A 3RPFC 1IBXA 1XLOA 1SE3A 1K50A 3P42A 5EE9A 1ZE3D 3MC0B 1DGJA 1L0VB 2AX5A 4KGTA 3W5UB 3Q8FA 3ZQ4A 4XE0A 1NVID 1V97A 1NEKB 4L1BA 2NTSA 2W3RA 1JROA 1XEEA 4NAMA 1UNSA 4RNAA 1BMLC 3P4SB 1KLUD 1V1OA 1XO3A 2WNMA 4HKZE 2WXMA 5AUIA 1R7SA 4O1NA 3OWEB 1FM0D 2QILA 1V1PB 2Z8LA 4RFBA 5HI1A 1YN3A 1C9FA 3URYA 5BYRA 4ZHPA 3BVMA 1C4AA 3BVZA 4A90A 1NYRA 1KH0A 1QOAA 1HEZE 2WLBA 1PFDA 2WXIA 2BW2A 1K51A 2WXHA 1TZOA 2ONQA 3W1SA 1XCTL 2LFIA 4RGNA 2AQ2B 1SXTA 1FNWA 1PGAA 5EE3A 2HTME 2B76B 2MH7A 2YEPB 2H88B 1FRRA 3AMZA 3AE4B 2JQRB 3HVDA 4YWGG 3AE3B 2L32A 1YJIA 1ET6A 1ZUD2 1I7HA 3V3XA 3Q8CA 1ZXHA 2Q5WD 2Y5PA 2L52A 1MI0A 1C4PA 4RCOA 2INPE 4DQOC 2WXGA 3VR9B 1SE2A 4FXCA 1JWSD 1ENFA 1KRHA 4WWMA 4KKIA 1WSPA 2I38A 1M4VA 2PVGC 4JX1C 2NTTA 4GDKB 2LMCA 1IGDA 3FC4A 3W2DA 1MVKA 1SJHD 1YJJA 3EUB2 4ZHOA 2J4XA 1EWCA 1QLBB 4OVZA 1MPEA 5D7GA 4J3OD 3B2GA 3AEFB 2IGGA 4B0EA 3BVGA 2V3NA 4ITKA 2MEKA 2WXPA 4RF1A 4P16A 1TS3A 4OHJA 4HKQA 1F2RI 2CJOA 2L83A 3TUOA 3ABVB 2VZKD 3ZJTA 1N60A 2H89B 3BYTB 2QEJC 2BYTA 4ARCA 3I57A 3AE7B 1C77A 4LLGM 2WXOA 2W82A 1T6BX 1KTKA 3P63A 1FNVA 1VZ7A 1HXYD 3U2SC 2WXJA 3KWLA 2K0PA 3ZJUA 1I4PA 3SFDB 1C4CA 3SFEB 2QIEB 3IT4B 2SAKA 1ZPSA 1GAQB 3KQ4A 3P4RB 4H2AA 1TKYA 2BB6A 2KMMA 2KN4A 1IBXB 1N63A 4IOIE 4HEA1 4P6VF 3L4PA 4YSXB 4CQNA 3AE8B 1J7AA 2PLPA 2V0GA 3N9YC 1GB1A 3LXFA 4IKGA 1D4BA 1YNTE 1IUEA 1KLGD 4MT5A 1OQRA 1E10A 2QJLA 1SB3C 2KWDA 2GRIA 1JRPA 1N62A 2JXTA 2ICIA 2KACA 5C2TB 1PUTA 3MHZA 1L6VA 2SEBD 1V8CA 3P1MA 1ACCA 3AE9B 3AH7A 2W54A 3Q69A 3ZJVA 1KF6B 1GTHA 2YEPF 1J7BA 2V3PA 1ZOYB 2IGHA 3RFZB 1L4DB 3TSSA 2AQ1B 1STEA 3MP9A 1B9RA 2ZW0A 1E0ZA 1GPXA 4YSZB 4YTNB 4TQ0A 4YTPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 A;  3AEC B;  2W3S A;  5MPO A;  2WU5 B;  2WDQ B;  1TKG A;  5EE3 A;  1E7P B;  2B76 B;  3AED B;  2HTM E;  2MH7 A;  1DOX A;  2K9X A;  2MJD A;  3NVY A;  4LTU A;  2H88 B;  1E6E B;  1FRR A;  2BS4 B;  5C3J B;  3AMZ A;  5GXG B;  3AE4 B;  2PIA A;  5G5H A;  2JQR B;  5EE1 A;  2WQY B;  3AE3 B;  1YJI A;  4N6E B;  4USA A;  1ZUD 2;  1I7H A;  4N58 A;  4HRO A;  1YQ3 B;  1H7W A;  2WDR B;  2Q5W D;  1E10 A;  1QOF A;  4YTM B;  2PVO D;  2L52 A;  2E3T A;  1E9M A;  3HVZ A;  1FRD A;  3AE6 B;  1ZXI A;  4IDI A;  4FXC A;  3VR9 B;  4A9A A;  1WGK A;  1WWT A;  1KRH A;  4YT0 B;  1A70 A;  1FXA A;  2DBY A;  4WWM A;  1RFK A;  4ZOH C;  1H7X A;  2WS3 B;  1RWS A;  2M19 A;  3B2F A;  3NVZ A;  2PVG C;  5AUK A;  5G5G A;  3DWM A;  4JWS C;  4JX1 C;  1YQ4 B;  1JWA D;  3FC4 A;  2K22 A;  1N5W A;  2Y5C A;  3CWI A;  1XLP A;  1SIJ A;  4C7Y A;  1YJJ A;  3VRB B;  3EUB 2;  4ZHO A;  3P4P B;  1QLB B;  4WQM A;  1FFU A;  1WYG A;  3VR8 B;  1ROE A;  1FIQ A;  3AE2 B;  3B2G A;  3HUI A;  3NRZ A;  3NVV A;  1RM6 C;  3AEF B;  3AEE B;  1KFY B;  2W55 A;  1JW9 D;  2BT6 A;  4YXD B;  3AB5 A;  2PKO A;  5H92 C;  3VRA B;  4ITK A;  2CJN A;  2ACZ B;  1JWB D;  2K5P A;  3HRD D;  2OHF A;  1DOY A;  2M56 B;  1CZP A;  2BS2 B;  3AEG B;  1L5P A;  3ABV B;  2CJO A;  2EKI A;  1RYJ A;  1QT9 A;  1GT8 A;  1EWY C;  1TKE A;  1F0Z A;  1N60 A;  5H8Y E;  2H89 B;  3NVW A;  2MJ3 A;  2N0S B;  3W9C B;  1SF0 A;  3AE7 B;  4N59 A;  4US9 A;  4C80 A;  3CF4 A;  4US8 A;  1QOG A;  3P63 A;  1NEN B;  1FO4 A;  2KAJ A;  1N61 A;  2L83 A;  1FXI A;  1VLB A;  3KWL A;  2BS3 B;  1NYQ A;  3SFD B;  2QIE B;  3SFE B;  2WP9 B;  3DWG C;  1GAQ B;  1QOB A;  2WDV B;  3P4R B;  1FMA D;  1TKY A;  2KMM A;  2LEK A;  3AE1 B;  1N63 A;  1VJK A;  1UWM A;  1AYF A;  1FFV A;  1N5X A;  1OFF A;  4P6V F;  3L4P A;  1L6U A;  4KX6 B;  4JWU C;  4YSX B;  1OQQ A;  3LB8 C;  3AE8 B;  3RPF C;  3NS1 A;  3WCQ A;  1J7A A;  1XLO A;  3AEA B;  1WRI A;  1PDX A;  5EE0 A;  3BII D;  2DWQ A;  3LXF A;  5EE9 A;  2FBW B;  2JX5 A;  1DGJ A;  1L0V B;  3CIR B;  2AX5 A;  3W5U B;  1JQ4 A;  1IUE A;  1NVI D;  1TJE A;  1NEK B;  1OQR A;  1T3Q A;  1TYG B;  1V97 A;  2MJE A;  1JRO A;  1SB3 C;  2QJL A;  1XLQ A;  2W3R A;  3AV8 A;  3AN1 A;  3ETR A;  1JRP A;  4C7Z A;  3AE5 B;  1N62 A;  3P4S B;  5AUI A;  1XO3 A;  1ZP0 B;  4HRS A;  1R7S A;  3P4Q B;  1CJE A;  5C2T B;  1FM0 D;  1PUT A;  1VDV A;  1JAL A;  2G1E A;  1L6V A;  1J7C A;  3FAH A;  1V8C A;  2WU2 B;  3P1M A;  1DOI A;  3AH7 A;  3AE9 B;  3PO0 A;  2W54 A;  3ZYY X;  1KF6 B;  1GTH A;  1J7B A;  2CU3 A;  4ZHP A;  1AWD A;  1ZOY B;  1QF6 A;  1NI3 A;  1XLN A;  1NYR A;  1QOA A;  4YSY B;  3AEB B;  1WXQ A;  1PFD A;  2WLB A;  3B9J A;  1B9R A;  1E0Z A;  1GTE A;  1GPX A;  3W5V B;  4YSZ B;  4YTN B;  3AM9 A;  4YTP B; 
#chains in the Genus database with same CATH topology
 1WI0 A;  4BKG A;  4DXF A;  2K9X A;  3NVY A;  4IWO A;  4XWT A;  1N6Z A;  3RZW C;  5C3J B;  1UGM A;  3J9C A;  2WQY B;  1I4R A;  2D2Q A;  1WGH A;  2N1V A;  4YTM B;  2PVO D;  5BO4 B;  4DBG A;  4CYE A;  2WS3 B;  1RWS A;  2CU1 A;  4XC2 A;  3VRB B;  2GBJ A;  4A20 A;  1K52 A;  1FFU A;  1WYG A;  3RUL A;  1YOV B;  1FIQ A;  1YJ1 A;  1C1Y B;  2KOX A;  1OEY J;  3ZO5 B;  4CHK A;  2BT6 A;  1K53 A;  1SEB D;  2MBH A;  2KC1 A;  3TL5 A;  3SEB A;  4RMA A;  3BZD B;  3VHT C;  2L7R A;  2JZP A;  2MJ3 A;  4M8M A;  1UWX A;  2NBV B;  1R4M I;  2AYO B;  4RGT A;  4K7S A;  2LJI A;  1D5X C;  1FFV A;  1V1P A;  1D5M C;  2M4N A;  4L2Y A;  4JWU C;  3LB8 C;  1JWM D;  3N32 A;  2KXJ A;  1SE9 A;  2NBW B;  3V6C B;  4YL8 A;  3DBS A;  2D3A A;  1Q5W B;  4TV3 A;  3AV8 A;  4HPP A;  3HIZ A;  5AEK B;  4XYC A;  3PLV A;  2RDH A;  4AWJ A;  1ZP0 B;  3N1Y C;  2J53 A;  4ASW C;  5G2N A;  3MTN B;  1E8Z A;  2CU3 A;  1SGH A;  4NAW B;  3ZKJ C;  2QHO A;  4FAD A;  3T9L A;  2MBQ A;  1EM7 A;  3W5V B;  4MSQ B;  4EZL A;  2CHW A;  4W9K A;  1P7E A;  4M8N A;  4W9G A;  1PGB A;  4FHJ A;  4IC7 B;  4C4V A;  2LI5 A;  2RPQ A;  3X23 A;  3VQI A;  4P7I A;  3N3K B;  2PIA A;  4DXG A;  1VZ6 A;  1XCQ L;  2HDE A;  1XQQ A;  2REX A;  5CHW A;  2E3T A;  3RZF A;  2FUH B;  1WGK A;  3IAS 1;  4YT0 B;  4ZOH C;  3IVF A;  4ICV A;  2M19 A;  4M02 A;  4AJY B;  3Q8A A;  4KKJ A;  3TEX A;  1XLP A;  3N30 A;  1L0X B;  1HZ5 A;  3V62 A;  4MH8 A;  3FIL B;  4ANX A;  1RM6 C;  1JWU D;  1Q1O A;  4EZJ A;  1P3Q U;  3B08 A;  3VRA B;  2NS5 A;  1V6E A;  2BGF A;  1WGR A;  4XDC A;  4HDQ A;  3PZ8 A;  2DYM A;  3QAQ A;  2GOW A;  4OW0 A;  1EF5 A;  4UDU C;  3AI5 A;  4NY0 A;  1BXT A;  1FO4 A;  3H7P B;  5JXV A;  5DPS A;  4M0W A;  2LXC A;  1UBI A;  1WM3 A;  1WMH A;  4JLC A;  4FN2 A;  4OZB A;  2PE6 B;  2JT4 B;  3OG5 A;  2LD9 A;  4WAF A;  3ECI A;  1WRI A;  2MWS B;  1C3T A;  4WWO A;  3CIR B;  3W1S C;  2L1A A;  1T3Q A;  1XF5 L;  5D3I B;  2L76 A;  3TEW A;  2D3G A;  1E8Y A;  4NQL B;  1SJE D;  1J7C A;  2BYF A;  2K3U A;  3ZYY X;  3AXC A;  1VR9 A;  3PRE A;  1LQB A;  1XLN A;  3VUW A;  5I4D A;  1GTE A;  5JZE B;  3ENE A;  2JWU A;  2OJW A;  2KFK A;  2PTL A;  2JU6 X;  3U8Z A;  1V5T A;  2DX5 B;  2GBN A;  1MHX A;  3RYT A;  4D2K A;  4PT5 A;  5L83 A;  4N6E B;  3B1L X;  2PPH A;  1YQ3 B;  5JH5 C;  1MG4 A;  5TR5 A;  4GSW A;  1FRD A;  2GB1 A;  4IDI A;  4KSL C;  1LO5 D;  1WWT A;  2OOB B;  4NPN A;  4II3 B;  1QZE A;  3CWI A;  2ZJD A;  4TSS A;  4W9D A;  4WJN A;  2AQ3 B;  4GDK A;  4ARI A;  4ZYS A;  3NS8 A;  3AEE B;  1JW9 D;  5FK9 C;  4RH6 A;  3UF8 A;  4A55 A;  3A4S C;  4EOY A;  2OHF A;  2M56 B;  1E8W A;  1CZP A;  1TS4 A;  5H8Y E;  1E5W A;  3I9V 1;  5LNK 1;  3HK0 A;  3EFU A;  1N61 A;  3NUH B;  1NYQ A;  3V61 A;  3RNE C;  2DZM A;  2WP9 B;  3QWZ B;  1FMA D;  1ZDV A;  2M0A A;  2LEK A;  3VTU A;  1VJK A;  1UWM A;  4GN1 A;  1WZ0 A;  3EA6 A;  3RPF C;  1IBX A;  1U4A A;  1K50 A;  3A1Q B;  2XK5 A;  3P42 A;  3ZRC A;  2O6V D;  3GE3 C;  1WM2 A;  3Q8F A;  4G0N B;  4XE0 A;  2DHZ A;  3RCZ A;  2K8H A;  5D2M B;  1UNS A;  4E3C A;  3P4S B;  5AUI A;  3OWE B;  1FM0 D;  1V1P B;  4P1B C;  2Z8L A;  1C9F A;  4ZHP A;  2K1F A;  1NYR A;  1QOA A;  1HEZ E;  3L16 A;  3ZDM C;  2MBE A;  3JVZ X;  3WA0 A;  2X8X X;  4BKS D;  2M17 A;  4GB9 A;  1ET6 A;  1ZXH A;  2YVC A;  3OLM D;  2L52 A;  1MI0 A;  4DQO C;  2WXG A;  1IYF A;  2KD0 A;  2JXX A;  1WSP A;  4HPL B;  1M4V A;  2PVG C;  4BOZ B;  4JX1 C;  2NTT A;  2LMC A;  1IGD A;  2UYZ B;  3C19 A;  3EUB 2;  1YD8 U;  5J17 A;  2D11 A;  2WXP A;  1E8X A;  3Q6B A;  5CHF A;  5AZF A;  3TUO A;  3ABV B;  2VZK D;  1F52 A;  5J2R A;  4PK1 A;  1WIA A;  1C77 A;  2RGF A;  1MFW A;  4LLG M;  4FHK A;  1FNV A;  1VZ7 A;  1HXY D;  2WXJ A;  3SFD B;  3L10 B;  3SFE B;  2QIE B;  1GAQ B;  3KQ4 A;  4H2A A;  4DDI D;  1TKY A;  2KN4 A;  2LGD A;  3L4P A;  2NR2 A;  4YSX B;  4CQN A;  4W9L A;  4IG7 B;  1G6J A;  1D3Z A;  5JHA A;  2V0G A;  2IY0 B;  3N9Y C;  3LXF A;  4MGI E;  2AL6 A;  1IUE A;  1SB3 C;  2KWD A;  1N62 A;  1RFA A;  4ICU A;  4MSM B;  2JXT A;  2R2Q A;  2KAC A;  1PUT A;  2SEB D;  1V8C A;  3P1M A;  3AE9 B;  3ZJV A;  2C60 A;  2W54 A;  1V9J A;  3EFC A;  4A3P A;  2AQ1 B;  1F1H A;  4B6W A;  1E0Z A;  4NAW A;  1GPX A;  4YTN B;  2FID A;  4W9F A;  1PGX A;  4IWQ A;  3IG3 A;  4BVU C;  4JPS A;  3BK2 A;  3PZD A;  2RMM A;  4DK5 A;  3QX1 A;  4QAY A;  3UQB A;  3ML9 A;  2KKC A;  4MEL A;  2FUG 1;  2LVQ A;  2ON8 A;  1WGD A;  5E6J A;  2BKF A;  2WDR B;  1V5O A;  3TJP A;  3IFW B;  3APC A;  3U52 E;  3X0W A;  3K9O B;  5BYS A;  4N9F 4;  2L0T A;  3A9J B;  1FCL A;  3B2F A;  2BKR B;  1YQ4 B;  1ZKH A;  3MFG A;  3GP7 A;  1SIJ A;  1I4G A;  1HE8 A;  1TIF A;  2MA9 B;  2WDT B;  4PYZ A;  2KVR A;  1YX6 B;  5H92 C;  1OTR B;  1FD6 A;  2KWV B;  3FIL A;  2O2V A;  1I35 A;  2FCQ A;  2JWZ A;  3RNF C;  1F0Z A;  4K3B A;  3BIN A;  2KDB A;  4WWN A;  1SF0 A;  4N59 A;  1WR1 A;  2V4I B;  2OED A;  1HQR D;  2V3S A;  3PZ7 A;  2C7M B;  3BK1 A;  4ZRP A;  2EKE C;  1QOB A;  1F77 A;  5TSS A;  2ZZP B;  1L0Y B;  3ZTC A;  2V1Y A;  1PDX A;  4B0M A;  3ZDT A;  2JX5 A;  1L2N A;  2N9E B;  1F2R C;  2MJE A;  1XLQ A;  3M3J A;  3DQV A;  3E56 A;  4K81 A;  3ZGZ A;  2UWQ A;  5C23 A;  2K5P A;  1VDV A;  3ZLZ A;  1JAL A;  2LUM A;  4Q2J A;  4AS1 A;  1WH3 A;  4NJC A;  1TS5 A;  1WX8 A;  3KYD D;  2BQQ A;  3SR6 A;  3LDZ E;  3DVN U;  2J42 A;  3PS6 A;  2RR9 A;  3GE8 C;  2WX0 A;  3UIN B;  2C9W B;  2MBB B;  4LNO A;  5EE1 A;  1GC6 A;  4BFR A;  1CK1 A;  2KDF B;  4KV2 A;  3DDC B;  3E9S A;  1RFK A;  5AUK A;  2QMT A;  3C8Y A;  4EZK A;  1IGC A;  3VFK A;  4WQM A;  2N9X A;  2V4L A;  3VR8 B;  4FA6 A;  3HUI A;  3M63 B;  4ACF A;  1LXD A;  2JF5 A;  1J19 A;  1I4Q A;  3QQ8 B;  3DBL I;  1JCK B;  4J6I A;  4GU2 A;  1D5Z C;  1C78 A;  3K9P B;  1X1M A;  2JPH A;  4GOC A;  2QC8 A;  4OZA A;  4DDG D;  4C00 A;  2LJ5 A;  1KJT A;  1YQB A;  3A4R A;  4JE3 B;  5C1Z A;  1GJZ A;  2PW9 A;  3KLS X;  4EKU A;  1FXT B;  3ZUN A;  5LLI A;  3AEA B;  2N7E A;  3NZS A;  1JQ4 A;  3A1Q A;  3EC8 A;  1TYG B;  1Z2M A;  1GUA B;  2VH1 A;  3KW5 B;  4I6N B;  2ASQ A;  2WU2 B;  2FIF A;  3T8M A;  1ISN A;  1TBE A;  3PLU A;  2D5G A;  5D94 A;  1QF6 A;  3L17 A;  2LXA A;  1E7U A;  4G50 A;  3UI3 A;  3HM3 A;  4YSY B;  3VUY A;  4GLS C;  3L08 A;  3FKY A;  3RT3 B;  1OGW A;  3DBR I;  2FNJ B;  2WYQ A;  4RF0 A;  1V49 A;  5JHB A;  2KX3 A;  2G9H D;  4TKN A;  4F1S A;  1SIF A;  4RGO S;  3BYY B;  4HVB A;  2MCN B;  2JZ3 B;  2MP2 B;  2IBI B;  3AUL A;  2Z59 B;  5J18 A;  3MC9 A;  2HTH A;  1H7X A;  4DHZ B;  2CR5 A;  3NVZ A;  1R4N I;  3ZXV A;  1NI2 A;  3PRP B;  1JWA D;  3DBH I;  3H8H A;  3A9K A;  1ROE A;  4TUU A;  4XWW A;  3NRZ A;  2RPV A;  1ZDX A;  3U7Z A;  3HRD D;  1WR6 E;  2KLC A;  2BWE S;  2BS2 B;  4A3O A;  3SU8 X;  2GI9 A;  4A8X C;  1UD7 A;  4GDL B;  3W9C B;  1DYQ A;  4US9 A;  1CQV A;  1L4Z B;  3R2I A;  5AZH A;  2O2V B;  2BTE A;  3DVN V;  2J0K A;  1SE3 A;  2MRP A;  3MJW A;  4W9H A;  3QC8 B;  1PQS A;  3MC0 B;  1L0V B;  2AX5 A;  1V97 A;  1NEK B;  2LUE A;  2NTS A;  2AL3 A;  3EHV A;  4RNA A;  1BML C;  2WNM A;  2WXM A;  2J7Q B;  3SD5 A;  2D3B A;  3RUI B;  1YN3 A;  3NHE B;  3URY A;  4F7Z A;  5BYR A;  4K1R B;  2KQS A;  3BVZ A;  4A90 A;  3DVG Y;  4HDO A;  2BW2 A;  1K51 A;  1TZO A;  2G4D B;  3W1S A;  2KWU B;  1E90 A;  3JW0 X;  3PVL A;  1XCT L;  2AQ2 B;  1FPY A;  3I63 C;  5KHO A;  1FNW A;  3QAR A;  4W9I A;  2HTM E;  2B76 B;  2MH7 A;  5EE3 A;  3NZU A;  3L54 A;  2H88 B;  1FRR A;  2KYW A;  1WJ6 A;  1EF1 A;  2WWZ A;  4RCO A;  3VR9 B;  1E7V A;  1KRH A;  4WWM A;  2I38 A;  2UU7 A;  3W2D A;  1MVK A;  3WAN A;  5CTR C;  3A9J A;  1SJH D;  4PS3 A;  2J4X A;  4G11 A;  5D7G A;  2KNB A;  4J3O D;  3KH0 A;  3GZN I;  1WE6 A;  4JGH B;  3TCA A;  3BVG A;  2V3N A;  4ITK A;  2MEK A;  1OQY A;  5E6N A;  3P2B A;  4P16 A;  4OHJ A;  3RN9 C;  4HKQ A;  2L83 A;  2CJO A;  4NJ6 A;  1N60 A;  1HTQ A;  2H89 B;  2FAZ A;  2BYT A;  1KOT A;  3IBE A;  4DHZ E;  3PTF C;  4MDK E;  2ZCB A;  3D32 A;  2WXO A;  2D10 A;  3KWL A;  2K0P A;  3ZVV A;  1C4C A;  3IT4 B;  2JRI B;  2SAK A;  2VH2 A;  2BB6 A;  2KMM A;  1N63 A;  1TTN A;  4HEA 1;  4X57 B;  2NCN A;  4IWP A;  1KLG D;  1E10 A;  1OQR A;  2KJR A;  3H9D A;  2OJR A;  3Q3O C;  4M01 A;  1JRP A;  2KX0 A;  5C2T B;  4HK2 A;  1L6V A;  3V6E B;  3AH7 A;  1ACC A;  2JUO A;  2BYE A;  1J7B A;  2YEP F;  2IGH A;  1L4D B;  3TSS A;  5LXH A;  1STE A;  2GLS A;  4TQ0 A;  4YTP B;  2LGS A;  2BPS A;  2W3S A;  5MPO A;  1R4M B;  3L13 A;  3ONS A;  2GBR A;  2WDQ B;  5CHV C;  2PJH A;  3UGB B;  3UQA A;  1ZGU B;  1DOX A;  3VXW A;  2MJD A;  2N4F A;  1E6E B;  2DZI A;  2ZNV C;  3PPA A;  4NNJ B;  3M95 A;  3GS2 A;  4N58 A;  3GB1 A;  1ZW7 A;  2WGS A;  3AE6 B;  1FXA A;  2KZR A;  1B1Z A;  5BMG A;  3W1Y A;  3R2T A;  2IO0 B;  4JWS C;  1N5W A;  1Y56 A;  2LRU A;  4HJK A;  2FE8 A;  3Q2A C;  4K7W A;  5HFY A;  4EEW A;  1WXM A;  3LYY A;  4L23 A;  2ZPY A;  2CJN A;  4JQW C;  4RM8 A;  1DOY A;  2HJ1 A;  1FNU A;  2J52 A;  3MJ5 A;  3WAM A;  2N0S B;  3DHG C;  2KWC A;  4US8 A;  2IPK D;  3C0R B;  3A9K B;  2KTF A;  1WX9 A;  1T5X D;  4KIK B;  3DWG C;  4II2 B;  1SBB B;  2C7H A;  3NY5 A;  1HA5 A;  1KLV A;  2K39 A;  4HJG E;  5GMV A;  2L05 A;  3BII D;  4XDD A;  3TEZ A;  1MJD A;  5FKA C;  1EO6 A;  2MLB A;  3N20 C;  1MG8 A;  4URK A;  1NBF C;  1TJE A;  3ETR A;  2YLM A;  2CKH B;  4C7Z A;  3Q8E A;  5EDS A;  3P4Q B;  3ZNG C;  1T0Y A;  5AZG A;  1K8R B;  4KZ0 A;  2BF8 B;  3V60 A;  3AEB B;  3O65 B;  5IP4 D;  3IHP C;  1P7F A;  3IAM 1;  1J0G A;  3N1Z C;  2WU5 B;  2WX1 A;  1WGG A;  5BMH A;  1GB4 A;  3KVF B;  4WUR A;  1H4R A;  2TSS A;  3U4E G;  4REZ A;  4MAC A;  4MJS B;  3DHH C;  3N1X C;  3SDL C;  1WXA A;  1E9M A;  2KTR B;  2I1J A;  2MP2 A;  4W9C A;  3A33 B;  2ZW1 A;  3U30 A;  4LCD E;  2WHI A;  5HG2 A;  2O6V B;  4ANV A;  3AB5 A;  3EGR A;  5D6J B;  2ZPN A;  2LZ6 A;  4I6L B;  3UIP B;  1RYJ A;  4IW0 A;  5DPT A;  2CS4 A;  2DAF A;  1QOG A;  4GDL A;  3KWV A;  4OVV A;  2D07 B;  4GGQ A;  2MQJ A;  3BWU D;  5BMI A;  3TMP B;  2JZZ A;  1YMH E;  3DVG X;  5L95 C;  3Q14 C;  2XNA C;  3PRM B;  5EE0 A;  3CF6 E;  2DWQ A;  3DCG A;  1TZ1 A;  1P1A A;  2LAS A;  3AN1 A;  5CX3 A;  1GC7 A;  4B9K A;  3VUX A;  1V2Y A;  1CJE A;  5KHQ A;  1GOZ A;  1T0S C;  1GNU A;  4BAX A;  2N7J A;  3TIX A;  1T0R C;  2KT7 A;  5T8I A;  1WXQ A;  2KO3 A;  3QHT A;  4IM0 A;  4CO7 A;  4BZA A;  3AM9 A;  2MX2 A;  3R66 C;  3PSE B;  3RNA C;  4LNN A;  2WXF A;  3AED B;  2EMT A;  5IO9 A;  1C76 A;  3SHQ A;  1XXG A;  1Z5S B;  2K6D B;  1PYW D;  2VZK B;  4FBJ B;  4KSK C;  4USA A;  2VRR B;  4AOF A;  1JML A;  1P0R A;  1H7W A;  4WAA A;  2IDY A;  4KGR A;  2BB5 A;  2BWF A;  2QDF A;  3HVZ A;  3RMK C;  3NJT A;  4A9A A;  2L00 B;  1QIL A;  2LGX A;  2RDG A;  2KJ6 A;  2ZNV B;  4FJZ A;  2K22 A;  4AQ7 A;  1SSN A;  4KGS A;  4EE2 A;  4WQO B;  1TY2 A;  3JYU A;  3CMM B;  4OZC A;  1JWB D;  1WRD B;  3PV1 A;  4S17 A;  3WAP A;  1EWY C;  4OVU A;  2WXQ A;  3NZ3 A;  3VH4 B;  4BBN F;  4C80 A;  2IY1 B;  2ZEQ A;  3BY4 B;  2KAJ A;  1IPG A;  1TY0 A;  2INC C;  4WJQ A;  3I5J C;  3PGE A;  3VTW A;  3PT2 B;  4ZDV A;  2WDV B;  1T0Q C;  2G3Q B;  1AYF A;  1OFF A;  2DNF A;  2KC2 A;  2KAN A;  1XLO A;  5EE9 A;  4KGT A;  4DXA B;  1H8C A;  4L1B A;  3DHI C;  2W3R A;  1XEE A;  4NAM A;  1V1O A;  4HKZ E;  1XO3 A;  1GG3 A;  4PYU A;  3H1U A;  1VD2 A;  2LVO A;  1F9J A;  2NPT B;  2WLB A;  1PFD A;  2WXI A;  3MC8 A;  2LFI A;  4PS8 A;  1YX5 B;  5HKH A;  2DAJ A;  2AEH A;  2YEP B;  1Y8R C;  3AMZ A;  2ZVN A;  3HM6 X;  2JQR B;  3HVD A;  2KVZ A;  3AE3 B;  1I7H A;  4KDI C;  1A5R A;  3V3X A;  3Q8C A;  2KN5 A;  2JY6 A;  3I3T B;  4RM9 A;  2INP E;  1SE2 A;  4WJO A;  4G3X B;  5DCN A;  2GBM A;  3MHS D;  2BYV E;  1EWC A;  1QLB B;  1M94 A;  2L0F A;  5IAA C;  4B0E A;  4JL9 A;  4AP4 C;  3CSF A;  1RRB A;  2BVC A;  2J0M A;  1UH6 A;  3ALB A;  3QJZ A;  4WJP A;  3ZW3 A;  3BYT B;  3H7S A;  4ARC A;  4XGA B;  3I57 A;  3AE7 B;  3Q3J A;  1WY8 A;  3PHW B;  4XX5 A;  2W82 A;  4BBN C;  3P63 A;  3U2S C;  1UZX B;  3P4R B;  2GBK A;  4IOI E;  4DHJ D;  4KIK A;  2HJ8 A;  3AE8 B;  4E71 A;  2KHW B;  1GB1 A;  1D4B A;  3APF A;  4LJO B;  1WGY A;  1HTO A;  2GRI A;  2V9H A;  3R7R A;  4W9J A;  3NOB A;  2ICI A;  2GMI C;  3MHZ A;  2K6Q A;  2ZVO A;  3Q69 A;  4KVG B;  1KF6 B;  1GTH A;  1ZOY B;  3TBL D;  4DWF A;  3R7Q A;  3QIJ A;  3AEC B;  5IOI A;  1S1Q B;  2KQ4 X;  1UUP A;  2QSD A;  2X38 A;  2WXL A;  4K3C A;  1E7P B;  2LRW A;  2QCZ A;  3GOE A;  4FLH A;  1J8C A;  2BS4 B;  1I4X A;  5GXG B;  5G5H A;  4A6Q A;  3ML8 A;  1ESF A;  2IND C;  1D6E C;  2PEA A;  3U7D A;  3L0W B;  3VH3 B;  2I1K A;  2KMC A;  2IGD A;  4MJS A;  1MHH E;  4PS7 A;  2FCN A;  1XT9 B;  2CHZ A;  3LJ3 A;  2KTR A;  3PHX B;  1VRA B;  4C7Y A;  2A5U A;  4LDT D;  3P4P B;  3AE2 B;  1VZ8 A;  4EUT A;  4NQK E;  3NVV A;  1KFY B;  2A4Z A;  4YXD B;  2LGI A;  1QQR A;  2ACZ B;  1UGJ A;  3DOW A;  3Q3N C;  4ZRQ A;  2O6V A;  3AEG B;  1Q10 A;  4XZ4 A;  3WIM A;  3R3M A;  5BYQ A;  3NVW A;  2INN E;  4TMA B;  3IXS A;  3JSV B;  1TS2 A;  2N9P C;  3RD2 A;  1VLB A;  2M1M A;  2LHE A;  5DPW A;  2BS3 B;  4GIV A;  2RSU A;  4WIP A;  2KDM A;  2N9K A;  1OQQ A;  3NS1 A;  4KDL B;  3WCQ A;  1QKZ A;  2LHD A;  4ZRJ A;  4GXB A;  3AU5 A;  4TQ1 A;  2MSE D;  3OAW A;  4KZC A;  4BKS A;  1WJ4 A;  3DPD A;  4MM3 B;  2B3A A;  4MEM A;  3RNG C;  5IKC M;  1FEH A;  3AE5 B;  4HRS A;  2G1E A;  3FAH A;  1DOI A;  1AN8 A;  1EUV B;  2CHX A;  4ZYN A;  3DBL B;  1Q0W B;  5IA7 A;  1NI3 A;  2JYT A;  2G4S A;  1AW7 A;  2DYO A;  1WF9 A;  2K8C A;  3NG0 A;  1UF0 A;  2MBO A;  1TKG A;  4DHJ B;  2E6X A;  1NDD A;  2KLG A;  4EFO A;  4LTU A;  1JRU A;  3TEY A;  1FCC C;  3ZNI D;  3OJ3 A;  2XN9 C;  1WYW B;  2KJH B;  2XBB C;  4HRO A;  4R3D A;  4MGK E;  1YIW A;  1V81 A;  2L8J A;  1ZXI A;  1A70 A;  2XEW A;  1EU4 A;  1RAX A;  4HLE A;  4LNI A;  2J0J A;  5DPR A;  5LXI B;  2Y5C A;  1LGR A;  1WZ3 A;  1WFY A;  1LFD A;  4P1C C;  1P98 A;  3KUZ A;  1I4H A;  2KQ7 A;  3UIO B;  4GMV A;  1C79 A;  3VVW B;  2IO1 B;  3ZRF A;  3V05 A;  2EKI A;  1QT9 A;  4FUL A;  2JRH A;  2MW5 A;  2N7D A;  3DBR B;  3WAO A;  1LM8 B;  2RDB C;  5HHD G;  3CF4 A;  4JIO U;  1RLF A;  2HD5 B;  2KK8 A;  2R61 A;  2DLB A;  1FXI A;  4FJV B;  1P9D U;  4LK0 M;  4LJP B;  1OEY A;  4WH4 A;  2G45 B;  1WE7 A;  1N5X A;  3RNB C;  4IM2 A;  1YN5 A;  4AUQ C;  4HPM B;  3PRZ A;  2D3C A;  1BT0 A;  4LDT B;  2R2O A;  2FBW B;  3O13 A;  3T3N A;  1WXS A;  1R4N B;  2JVC A;  3PO0 A;  2L3Z A;  2W55 A;  2JSV X;  5IN7 A;  3DBH B;  4C56 C;  3B0A A;  4LNK A;  1YN4 A;  4NJ7 A;  3ZNH B;  2WXK A;  1AWD A;  2DEN B;  2LVP A;  4LNF A;  4M00 A;  1WX7 A;  4W9E A;  2Z0E B;  3B9J A;  2NPT A;  4C4V B;  2I2Y A;  2IJ0 A;  1ET9 A;  1WXV A;  4NZL B;  3CST A;  1HZ6 A;  2N1W A;  3VTV A;  2PMV A;  1UEL A;  1TT5 B;  2N9L A;  5D3D A;  4RGM A;  2WXR A;  3T3O A;  2Y3A A;  2Z0D B;  2KDE B;  1QOF A;  2K8B A;  2RD0 A;  1EU3 A;  2DBY A;  3ZIM A;  2NBU A;  4MGY E;  2NMQ A;  5G5G A;  3H6N A;  3DWM A;  1L7Y A;  2IZV B;  2KMA A;  1BUI C;  2MHJ A;  2DZK A;  2KFJ A;  3ZTD A;  2DYB A;  4MGZ E;  4BKT A;  2PKO A;  4I6P A;  4ANU A;  1TGZ B;  5FR3 A;  3Q3F A;  2WXN A;  1L5P A;  3RI7 C;  3IT6 B;  1GT8 A;  1TKE A;  3KUC B;  2K25 A;  4ZRI A;  1XD3 B;  3HHM A;  1S3S G;  3ZXR A;  4M0W B;  4HXD A;  1NEN B;  2HE7 A;  4AJW A;  3Q8B A;  1WMH B;  2BBC A;  1SE4 A;  4ZRK A;  2IYD B;  2JYE A;  3AE1 B;  2FCS A;  2EEL A;  2AWT A;  2W9N A;  3R8B A;  1L6U A;  4KX6 B;  2EMS A;  3KYC D;  2IO3 B;  1ZE3 D;  1DGJ A;  3QA8 A;  3W5U B;  4S0R A;  3ZQ4 A;  4K7U A;  1NVI D;  1JRO A;  1WJN A;  1KLU D;  4HCN B;  2NVU I;  1R7S A;  4O1N A;  2QIL A;  3GZN B;  4RFB A;  5HI1 A;  5FR6 A;  3BVM A;  1C4A A;  1KH0 A;  4B95 A;  2KDI A;  2KFK B;  2M8S A;  2WXH A;  2ONQ A;  4WWP A;  1I42 A;  3RNC C;  4RGN A;  1SXT A;  1UBQ A;  1PGA A;  2IO2 B;  1WJU A;  3EEC A;  4FJY A;  1AAR A;  2M0X A;  4MH0 E;  2Y5B B;  3AE4 B;  4YWG G;  2L32 A;  1YJI A;  1ZUD 2;  2Q5W D;  2Y5P A;  4IM3 A;  1C4P A;  3ZNZ B;  4FXC A;  3WAL A;  1JWS D;  1ENF A;  4IUM B;  3APD A;  4KKI A;  2C5L C;  4GDK B;  3FC4 A;  3KUD B;  1YJJ A;  4ZHO A;  1KM7 A;  4OVZ A;  3VAW A;  3M62 B;  1MPE A;  3H7P A;  3B2G A;  3AEF B;  2IGG A;  5G55 A;  3VDZ A;  3QCA A;  4RF1 A;  5E6O A;  1TS3 A;  2FCM A;  1F2R I;  3ZJT A;  1CMX B;  3QK0 A;  2LWP A;  4F8C B;  2LGY A;  2QEJ C;  1IP9 A;  4E74 A;  4ANW A;  1V80 A;  2PE9 A;  1T6B X;  1KTK A;  2ZCC A;  3JSV A;  3ZJU A;  1I4P A;  1ZPS A;  1VCB A;  1IBX B;  4HWI B;  2XK5 B;  4P6V F;  5E6P A;  4HCP B;  1J7A A;  2PLP A;  3Q3M C;  1V86 A;  4IKG A;  1YNT E;  3AU4 A;  2C7N B;  3S2A A;  4MT5 A;  2QJL A;  4MM3 A;  2DZJ A;  4BOS C;  3OJ4 B;  2V3P A;  3RFZ B;  3MP9 A;  1B9R A;  2ZW0 A;  4YSZ B; 
#chains in the Genus database with same CATH homology
 3AEC B;  1PGX A;  2W3S A;  5MPO A;  4JPS A;  4DXF A;  3BK2 A;  2KQ4 X;  2WDQ B;  1UUP A;  2QSD A;  2RMM A;  2X38 A;  2WXL A;  1E7P B;  1DOX A;  2K9X A;  2MJD A;  3NVY A;  1E6E B;  4XWT A;  2FUG 1;  2BS4 B;  5C3J B;  1I4X A;  2ON8 A;  3J9C A;  5GXG B;  5G5H A;  4A6Q A;  5E6J A;  1ESF A;  2WQY B;  1D6E C;  1I4R A;  3GS2 A;  4N58 A;  2WDR B;  3GB1 A;  4YTM B;  2PVO D;  3U52 E;  2IGD A;  1MHH E;  5BYS A;  3AE6 B;  1FXA A;  1B1Z A;  5BMG A;  2WS3 B;  1RWS A;  1FCL A;  3B2F A;  3R2T A;  4JWS C;  1VRA B;  1YQ4 B;  3MFG A;  1N5W A;  1Y56 A;  3GP7 A;  1SIJ A;  4C7Y A;  3VRB B;  3P4P B;  1I4G A;  1K52 A;  2FE8 A;  1FFU A;  1WYG A;  5HFY A;  1FIQ A;  3AE2 B;  1VZ8 A;  3LYY A;  3NVV A;  4L23 A;  1KFY B;  2BT6 A;  4YXD B;  5H92 C;  2LGI A;  1QQR A;  1K53 A;  2CJN A;  2ACZ B;  1UGJ A;  1SEB D;  1FD6 A;  3FIL A;  4ZRQ A;  1DOY A;  1FNU A;  3SEB A;  3AEG B;  1Q10 A;  2J52 A;  3MJ5 A;  1F0Z A;  5BYQ A;  3BZD B;  3NVW A;  2MJ3 A;  2INN E;  2JZP A;  2N0S B;  1SF0 A;  3IXS A;  1UWX A;  4TMA B;  4N59 A;  2V4I B;  4US8 A;  2IPK D;  1TS2 A;  2OED A;  1HQR D;  3PZ7 A;  1VLB A;  2LHE A;  2BS3 B;  1T5X D;  3BK1 A;  4ZRP A;  3DWG C;  4WIP A;  1QOB A;  2KDM A;  1SBB B;  4RGT A;  2LJI A;  1D5X C;  1F77 A;  1FFV A;  1D5M C;  1V1P A;  4L2Y A;  2N9K A;  5TSS A;  4JWU C;  1HA5 A;  1OQQ A;  3LB8 C;  1L0Y B;  1JWM D;  3NS1 A;  3WCQ A;  1QKZ A;  4HJG E;  2LHD A;  1PDX A;  4TQ1 A;  3BII D;  4XDD A;  4B0M A;  3TEZ A;  2JX5 A;  5FKA C;  4MM3 B;  1TJE A;  1F2R C;  3AV8 A;  2MJE A;  1XLQ A;  3ETR A;  1FEH A;  4C7Z A;  3AE5 B;  3E56 A;  2RDH A;  3Q8E A;  3ZGZ A;  1ZP0 B;  4HRS A;  3P4Q B;  1VDV A;  2K5P A;  1JAL A;  2G1E A;  3FAH A;  2LUM A;  2J53 A;  4Q2J A;  4AS1 A;  1DOI A;  1AN8 A;  4NJC A;  1TS5 A;  2CU3 A;  4NAW B;  1NI3 A;  2JYT A;  3AEB B;  1AW7 A;  1EM7 A;  2DYO A;  3W5V B;  1P7F A;  3SR6 A;  3IAM 1;  2J42 A;  1P7E A;  2WU5 B;  1PGB A;  1TKG A;  2E6X A;  5BMH A;  1GB4 A;  4LTU A;  3VQI A;  4WUR A;  3TEY A;  1FCC C;  2XN9 C;  2PIA A;  4DXG A;  1VZ6 A;  1XCQ L;  2TSS A;  5EE1 A;  3U4E G;  4REZ A;  2HDE A;  4MAC A;  4HRO A;  1CK1 A;  4R3D A;  2E3T A;  1E9M A;  1ZXI A;  1WGK A;  3E9S A;  3IAS 1;  4YT0 B;  1A70 A;  4ZOH C;  1RFK A;  2ZW1 A;  1EU4 A;  2M19 A;  2QMT A;  5AUK A;  3C8Y A;  3Q8A A;  4KKJ A;  1IGC A;  3TEX A;  2Y5C A;  1XLP A;  1L0X B;  1HZ5 A;  4WQM A;  3VR8 B;  4MH8 A;  5HG2 A;  3HUI A;  3FIL B;  1RM6 C;  1JWU D;  3AB5 A;  1I4H A;  3EGR A;  1I4Q A;  3VRA B;  1C79 A;  1JCK B;  4XDC A;  3V05 A;  1D5Z C;  1RYJ A;  1C78 A;  1QT9 A;  2EKI A;  3PZ8 A;  2DYM A;  5HHD G;  4OW0 A;  4OZA A;  3CF4 A;  4UDU C;  1QOG A;  1BXT A;  2R61 A;  1FO4 A;  3KWV A;  2DLB A;  1FXI A;  5JXV A;  4LK0 M;  4M0W A;  4WH4 A;  3BWU D;  5BMI A;  4JE3 B;  1N5X A;  1YN5 A;  1YMH E;  2PW9 A;  3KLS X;  4OZB A;  4WAF A;  3AEA B;  2XNA C;  1WRI A;  5EE0 A;  2DWQ A;  2FBW B;  3O13 A;  3T3N A;  3CIR B;  1JQ4 A;  2L1A A;  3PO0 A;  1T3Q A;  1TYG B;  2W55 A;  2JSV X;  1XF5 L;  3AN1 A;  5D3I B;  4C56 C;  3TEW A;  1YN4 A;  1SJE D;  1CJE A;  1GOZ A;  1J7C A;  2WU2 B;  2K3U A;  2WXK A;  3ZYY X;  2N7J A;  2D5G A;  1AWD A;  1QF6 A;  1VR9 A;  1XLN A;  5T8I A;  3UI3 A;  4YSY B;  1WXQ A;  3B9J A;  5I4D A;  1GTE A;  4GLS C;  3AM9 A;  2JWU A;  2PTL A;  2I2Y A;  2IJ0 A;  2JU6 X;  1ET9 A;  4RF0 A;  2WXF A;  4NZL B;  1HZ6 A;  3AED B;  2PMV A;  1C76 A;  1XXG A;  1PYW D;  2N9L A;  5D3D A;  1MHX A;  2G9H D;  4RGM A;  2VZK B;  4RGO S;  2WXR A;  4D2K A;  4PT5 A;  3BYY B;  2Y3A A;  4N6E B;  4USA A;  3T3O A;  1JML A;  1YQ3 B;  1H7W A;  1QOF A;  2IDY A;  4KGR A;  2BB5 A;  3HVZ A;  1FRD A;  2GB1 A;  4IDI A;  4A9A A;  1LO5 D;  1WWT A;  1QIL A;  1EU3 A;  2DBY A;  2RDG A;  2NMQ A;  1H7X A;  5G5G A;  3NVZ A;  3DWM A;  1JWA D;  2K22 A;  4AQ7 A;  3CWI A;  1SSN A;  4KGS A;  1BUI C;  4EE2 A;  4TSS A;  3H8H A;  4ARI A;  2AQ3 B;  1TY2 A;  4ZYS A;  1ROE A;  4XWW A;  4OZC A;  3NRZ A;  3AEE B;  1JW9 D;  2RPV A;  5FK9 C;  2PKO A;  4RH6 A;  1ZDX A;  1JWB D;  3U7Z A;  4A55 A;  3HRD D;  5FR3 A;  2OHF A;  2M56 B;  1TS4 A;  1CZP A;  2BS2 B;  1L5P A;  2WXN A;  3IT6 B;  1GT8 A;  1EWY C;  1TKE A;  5H8Y E;  2GI9 A;  2WXQ A;  4A8X C;  4GDL B;  3W9C B;  3NZ3 A;  1DYQ A;  3I9V 1;  4US9 A;  5LNK 1;  4C80 A;  1CQV A;  1NEN B;  2KAJ A;  1N61 A;  1TY0 A;  3Q8B A;  3NUH B;  2BBC A;  1L4Z B;  1NYQ A;  3R2I A;  1SE4 A;  2WP9 B;  2WDV B;  1FMA D;  1ZDV A;  2M0A A;  2JYE A;  2LEK A;  3AE1 B;  2BTE A;  1VJK A;  1UWM A;  1AYF A;  2EEL A;  1OFF A;  3R8B A;  1L6U A;  4KX6 B;  3EA6 A;  3RPF C;  1IBX A;  1XLO A;  1SE3 A;  1K50 A;  3P42 A;  5EE9 A;  1ZE3 D;  3MC0 B;  1DGJ A;  1L0V B;  2AX5 A;  4KGT A;  3W5U B;  3Q8F A;  3ZQ4 A;  4XE0 A;  1NVI D;  1V97 A;  1NEK B;  4L1B A;  2NTS A;  2W3R A;  1JRO A;  1XEE A;  4NAM A;  1UNS A;  4RNA A;  1BML C;  3P4S B;  1KLU D;  1V1O A;  1XO3 A;  2WNM A;  4HKZ E;  2WXM A;  5AUI A;  1R7S A;  4O1N A;  3OWE B;  1FM0 D;  2QIL A;  1V1P B;  2Z8L A;  4RFB A;  5HI1 A;  1YN3 A;  1C9F A;  3URY A;  5BYR A;  4ZHP A;  3BVM A;  1C4A A;  3BVZ A;  4A90 A;  1NYR A;  1KH0 A;  1QOA A;  1HEZ E;  2WLB A;  1PFD A;  2WXI A;  2BW2 A;  1K51 A;  2WXH A;  1TZO A;  2ONQ A;  3W1S A;  1XCT L;  2LFI A;  4RGN A;  2AQ2 B;  1SXT A;  1FNW A;  1PGA A;  5EE3 A;  2HTM E;  2B76 B;  2MH7 A;  2YEP B;  2H88 B;  1FRR A;  3AMZ A;  3AE4 B;  2JQR B;  3HVD A;  4YWG G;  3AE3 B;  2L32 A;  1YJI A;  1ET6 A;  1ZUD 2;  1I7H A;  3V3X A;  3Q8C A;  1ZXH A;  2Q5W D;  2Y5P A;  2L52 A;  1MI0 A;  1C4P A;  4RCO A;  2INP E;  4DQO C;  2WXG A;  3VR9 B;  1SE2 A;  4FXC A;  1JWS D;  1ENF A;  1KRH A;  4WWM A;  4KKI A;  1WSP A;  2I38 A;  1M4V A;  2PVG C;  4JX1 C;  2NTT A;  4GDK B;  2LMC A;  1IGD A;  3FC4 A;  3W2D A;  1MVK A;  1SJH D;  1YJJ A;  3EUB 2;  4ZHO A;  2J4X A;  1EWC A;  1QLB B;  4OVZ A;  1MPE A;  5D7G A;  4J3O D;  3B2G A;  3AEF B;  2IGG A;  4B0E A;  3BVG A;  2V3N A;  4ITK A;  2MEK A;  2WXP A;  4RF1 A;  4P16 A;  1TS3 A;  4OHJ A;  4HKQ A;  1F2R I;  2CJO A;  2L83 A;  3TUO A;  3ABV B;  2VZK D;  3ZJT A;  1N60 A;  2H89 B;  3BYT B;  2QEJ C;  2BYT A;  4ARC A;  3I57 A;  3AE7 B;  1C77 A;  4LLG M;  2WXO A;  2W82 A;  1T6B X;  1KTK A;  3P63 A;  1FNV A;  1VZ7 A;  1HXY D;  3U2S C;  2WXJ A;  3KWL A;  2K0P A;  3ZJU A;  1I4P A;  3SFD B;  1C4C A;  3SFE B;  2QIE B;  3IT4 B;  2SAK A;  1ZPS A;  1GAQ B;  3KQ4 A;  3P4R B;  4H2A A;  1TKY A;  2BB6 A;  2KMM A;  2KN4 A;  1IBX B;  1N63 A;  4IOI E;  4HEA 1;  4P6V F;  3L4P A;  4YSX B;  4CQN A;  3AE8 B;  1J7A A;  2PLP A;  2V0G A;  3N9Y C;  1GB1 A;  3LXF A;  4IKG A;  1D4B A;  1YNT E;  1IUE A;  1KLG D;  4MT5 A;  1OQR A;  1E10 A;  2QJL A;  1SB3 C;  2KWD A;  2GRI A;  1JRP A;  1N62 A;  2JXT A;  2ICI A;  2KAC A;  5C2T B;  1PUT A;  3MHZ A;  1L6V A;  2SEB D;  1V8C A;  3P1M A;  1ACC A;  3AE9 B;  3AH7 A;  2W54 A;  3Q69 A;  3ZJV A;  1KF6 B;  1GTH A;  2YEP F;  1J7B A;  2V3P A;  1ZOY B;  2IGH A;  3RFZ B;  1L4D B;  3TSS A;  2AQ1 B;  1STE A;  3MP9 A;  1B9R A;  2ZW0 A;  1E0Z A;  1GPX A;  4YSZ B;  4YTN B;  4TQ0 A;  4YTP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...