1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
3AE6B 3DWGC 1N60A 3LB8C 2AX5A 3AH7A 1NI3A 2MJEA 1E10A 1L0VB 3P4SB 2KAJA 2KMMA 3NVZA 1EWYC 3SFEB 1L6VA 2BS3B 3AEEB 1FMAD 1FXIA 1AWDA 5MPOA 3AE7B 3AEAB 2W54A 3KWLA 2BT6A 5EE3A 3BIID 3NRZA 4N59A 1GAQB 1V8CA 3FAHA 4HROA 1ZOYB 1E6EB 4YXDB 3DWMA 4JWUC 4C7YA 4JX1C 1F0ZA 1J7CA 1ROEA 3AEFB 4A9AA 2MJDA 5H92C 1QOGA 3AE4B 1GPXA 1FFVA 4FXCA 5AUIA 1TKYA 3P4QB 3NS1A 4WQMA 4ZHOA 3P4PB 1QF6A 2Q5WD 1FO4A 3AEGB 1OQQA 1XO3A 1WXQA 1QT9A 1KF6B 4YSXB 3P1MA 1H7WA 3AE1B 1N61A 2WS3B 3RPFC 2H88B 2WQYB 1JALA 3AE9B 1YJJA 2N0SB 3AV8A 2WDQB 1GT8A 2M19A 3CIRB 1GTHA 3PO0A 2B76B 4LTUA 1SIJA 1VDVA 2WU5B 1FIQA 3P63A 1DGJA 1NENB 2BS4B 1J7AA 1JW9D 3AE5B 5C3JB 1RYJA 3NVWA 2L83A 3W9CB 2WDRB 1QOAA 3ZYYX 1RFKA 1CZPA 2JQRB 1JRPA 3SR6A 4ZHPA 1V97A 2W3SA 5G5GA 4USAA 5H8YE 1E9MA 1RM6C 1JWBD 3HUIA 1N5WA 3ABVB 1GTEA 4YSZB 1AYFA 1L6UA 1CJEA 3FC4A 3AB5A 4HRSA 1TYGB 1VJKA 1ZXIA 2DBYA 3AE8B 1PFDA 2FBWB 2PVGC 1XLNA 2ACZB 3B2FA 3ETRA 3HVZA 3AEDB 4JWSC 2HTME 1FRDA 2MJ3A 4IDIA 3AE2B 2K9XA 2OHFA 5G5HA 1DOXA 3CWIA 1PDXA 5C2TB 2LEKA 2K5PA 4N58A 1H7XA 4US9A 3EUB2 2K22A 2QIEB 3CF4A 4KX6B 1YQ3B 1FM0D 1I7HA 4YTPB 1N63A 2M56B 4N6EB 5EE0A 5GXGB 4C80A 3LXFA 4WWMA 1JQ4A 2H89B 1RWSA 1SB3C 1VLBA 2PIAA 3AMZA 1B9RA 1KRHA 1NVID 1OFFA 3B9JA 4YTMB 1YJIA 2CJOA 2W55A 3AEBB 1JWAD 3W5VB 3VRBB 3AM9A 3W5UB 1XLPA 2WP9B 1DOYA 2JX5A 2BS2B 1N5XA 1WRIA 3NVVA 1L5PA 1J7BA 3WCQA 1DOIA 1WGKA 2EKIA 3AE3B 1E7PB 1TKEA 1OQRA 2QJLA 1TKGA 2E3TA 1QOBA 1FXAA 1NYRA 1XLQA 2WLBA 1E0ZA 2WDVB 4YT0B 1IUEA 4ZOHC 5EE1A 1WWTA 1QOFA 3B2GA 2PVOD 4US8A 1T3QA 1A70A 3SFDB 2Y5CA 2CU3A 1YQ4B 3VRAB 1ZP0B 2WU2B 3VR8B 2W3RA 1NEKB 3VR9B 1WYGA 2G1EA 1KFYB 3NVYA 1QLBB 2MH7A 4P6VF 1NYQA 2CJNA 1XLOA 2L52A 1TJEA 3HRDD 2DWQA 3L4PA 2PKOA 3AN1A 4C7ZA 4YTNB 1N62A 1PUTA 1SF0A 1FRRA 1ZUD2 1JROA 3AECB 5EE9A 4YSYB 1UWMA 1FFUA 3P4RB 1R7SA 5AUKA 4ITKA
chains in the Genus database with same CATH superfamily
4A3OA 2OOBB 2AQ1B 4RH6A 4TUUA 2CU1A 2X8XX 3NVZA 5BYQA 3SFEB 1L6VA 1YN4A 2OEDA 5MPOA 1HE8A 4RFBA 4M0WB 3L08A 4ANVA 4MM3B 1F0ZA 5HG2A 5H92C 2VRRB 3H8HA 4B0MA 4MDKE 1TKYA 4EZLA 2KZRA 4LDTB 1QKZA 2MLBA 1XCQL 2R2QA 2ZCCA 2Y3AA 4K1RB 4LTUA 4HK2A 3T3OA 1DGJA 2MQJA 1J7AA 4NQLB 4AQ7A 4GSWA 1GG3A 1QOAA 2ZNVC 2BWFA 3VDZA 4WAAA 1UNSA 1WM2A 3MC8A 2EMTA 1RRBA 4YSZB 3ETRA 3HVZA 2K6QA 3TIXA 1EUVB 2VZKD 3X23A 4RM9A 2LVOA 2ZW0A 2PPHA 4K7WA 3CWIA 1PDXA 3NZSA 2K5PA 3RNBC 3EUB2 2NBWB 2WX0A 4OVUA 1SB3C 3P2BA 4ARIA 4QAYA 2W55A 5L95C 4BBNF 1E8YA 2BS2B 2LXCA 1EU3A 4NAWA 1EO6A 1YX5B 3N30A 2E3TA 1QOBA 1I35A 3H7SA 4XE0A 3A33B 4ASWC 3V61A 5LXIB 5AZGA 3UIPB 4PS7A 2LVPA 3AU5A 4HLEA 3BYYB 2K8BA 1WGDA 2JWUA 2FE8A 2L76A 2J7QB 4YSYB 4S17A 4PS8A 2ZPNA 1V81A 2K6DB 4ICUA 5BMHA 2J0MA 5AZHA 3AEEB 3TUOA 2BT6A 2CKHB 3X0WA 2J42A 1EF5A 2CHWA 1L7YA 1BMLC 3PSEB 2C7NB 2RGFA 5D3IB 1KTKA 2KDMA 2MBHA 3P1MA 1PGAA 1UZXB 3PVLA 4F7ZA 1C77A 2KWDA 2WQYB 3AE9B 3QC8B 2RDHA 5IO9A 2BGFA 4KKJA 3PLUA 4W9CA 3TEZA 2INDC 2KOXA 3UGBB 3URYA 3M63B 1WRDB 2FUHB 4GDLB 4USAA 3OWEB 1P9DU 1RM6C 4WIPA 2WXNA 3IHPC 1AYFA 3PREA 4O1NA 4GIVA 1UUPA 1XD3B 3ZVVA 3EC8A 4HCPB 3D32A 1WIAA 2PIAA 1C1YB 2WXQA 2KANA 3ALBA 3QA8A 1YJIA 1R4MB 3AEBB 3TCAA 1VR9A 3ZNHB 2BYEA 3SHQA 2G9HD 4ZRIA 2MBBB 3TEWA 3RNGC 1PQSA 2IGHA 2D5GA 4H2AA 4REZA 5I4DA 2ASQA 1IGDA 5J17A 4B6WA 3VQIA 3H7PB 2KKCA 5CHVC 4N9F4 2MHJA 4L23A 2IYDB 2J53A 2DZJA 3Q3JA 3AEAB 4X57B 2B3AA 4HROA 4MSMB 2JXXA 2LGYA 3NS1A 4B0EA 3ZJVA 3AEGB 3NG0A 3JVZX 3AE1B 1DYQA 2WXLA 4C4VA 1TZOA 2QSDA 4AOFA 1TS5A 3T9LA 1LQBA 2IY1B 2WDRB 4RGMA 4MH8A 2GRIA 1RFKA 1JRPA 3MP9A 3SR6A 2OJWA 3UF8A 2L00B 2V3PA 1ET9A 1N5WA 3ABVB 3Q3FA 4KV2A 2MEKA 1OQYA 3RUIB 1Z2MA 2KQ4X 2IGGA 1R4NB 3ZRFA 4KIKA 2D3AA 4KX6B 2M56B 3LXFA 1JQ4A 1T0YA 3BZDB 2MP2B 5DCNA 2KWVB 3AM9A 1Y56A 5LNK1 1WMHB 2BYTA 1J7BA 1YIWA 4P1CC 4M00A 2ZCBA 2M1MA 3T3NA 1FCLA 4GN1A 4LJOB 1YQ4B 4HWIB 3ZTDA 1KFYB 3HRDD 2INNE 2DAFA 3AN1A 5IA7A 1N62A 4RMAA 1FRRA 3ZO5B 1F2RC 2FIDA 3B1LX 4BOZB 1UF0A 3DWGC 2UWQA 3GB1A 4BZAA 3A9JB 3P4SB 3OJ4B 1SBBB 1GJZA 3IAS1 1LXDA 4N59A 3RFZB 1GAQB 1VRAB 3FAHA 1E6EB 1QQRA 2N7JA 2QDFA 1HZ5A 4HEA1 2BF8B 2I1JA 1FNVA 3ENEA 3BVGA 4MJSA 1WXQA 1Q5WB 1H7WA 1F1HA 1N61A 3OAWA 3WALA 5EDSA 1VCBA 5FK9C 3FILB 4S0RA 3CIRB 1GTHA 5FR6A 5JZEB 3AE5B 4DBGA 4DHJB 2PE6B 5KHOA 2KN5A 3QAQA 1TZ1A 2CHXA 3V6CB 2BYVE 1SJED 3ML8A 1E9MA 1LO5D 3RZWC 4M01A 1SIFA 4WAFA 5BMIA 2NS5A 2DENB 3FC4A 2IPKD 2L7RA 3R7RA 5D7GA 1ZPSA 1ZXIA 3UQAA 3EGRA 2WXJA 4NZLB 1FRDA 4IDIA 3DCGA 3L17A 3DVGY 2EKEC 3W1SC 3PPAA 4N6EB 5AEKB 3AMZA 2I2YA 4OZAA 4Q2JA 3HM6X 2G45B 1DOYA 3NVVA 3KYDD 4IWPA 1EWCA 4TQ0A 2WDVB 4K3BA 5CX3A 2DZIA 2RSUA 4TKNA 4US8A 3DBLI 3CSFA 4FJZA 1KLGD 3KYCD 3N20C 5BMGA 1JWUD 1VD2A 2JUOA 1ZP0B 2W3RA 1NEKB 2LHEA 4ZRJA 1EM7A 2XK5A 1L4DB 1MG4A 1ZDVA 3VUYA 1P0RA 1R4MI 2PKOA 2D07B 2M0XA 1SF0A 4W9GA 2EELA 4NJCA 3LJ3A 1IYFA 3AE6B 1L0VB 2YLMA 2YEPB 3Q8AA 2IO0B 2NTSA 3K9OB 2LJ5A 3PRPB 4TQ1A 4XZ4A 1J19A 2KLGA 2W54A 2RMMA 4A90A 1C4CA 2HDEA 1HA5A 2AWTA 4KVGB 1C79A 3NJTA 2NTTA 1TGZB 3RNFC 1YD8U 2K25A 3L54A 3E9SA 4MACA 3Q3MC 2H88B 1ISNA 2HJ1A 3TEYA 3W2DA 3ZDTA 3VUWA 4DDID 2AYOB 2JPHA 1TT5B 4AJYB 2ZPYA 3RNCC 2A4ZA 4PT5A 4CQNA 3SU8X 1H8CA 4GB9A 3ZXVA 2WNMA 3IAM1 2ACZB 4DXAB 3QWZB 4ANWA 1WGRA 2ON8A 2V1YA 2KWCA 4BKTA 1L0XB 3CF4A 1YQ3B 3JSVB 4WWMA 2ICIA 1RWSA 3A1QA 3PTFC 2IJ0A 4I6LB 1V86A 3BY4B 2JZZA 2DHZA 3L13A 1WE7A 3MJ5A 5DPTA 3RN9C 4XYCA 2WGSA 1FXAA 1TS3A 4ZDVA 4IOIE 2ZVOA 4KGTA 4ARCA 3MHZA 3PLVA 2I38A 4NNJB 1U4AA 5D94A 4WJPA 4RF0A 3VR9B 4WJNA 4E3CA 1AN8A 2L3ZA 2GI9A 4A55A 5JHAA 3VFKA 3A4RA 1E10A 1IPGA 2MJEA 2PTLA 3VTUA 3M3JA 1V1PB 1V80A 3KVFB 1XT9B 2JXTA 2O6VD 2O6VA 5D6JB 2JYEA 3ZIMA 1ESFA 4IC7B 4PYZA 4L2YA 4WQMA 3P4PB 1WX7A 3ZJTA 1S3SG 2JSVX 1HXYD 4WURA 2KC2A 2Z0EB 3AV8A 2KACA 3WAPA 1NBFC 3PO0A 3NS8A 3PV1A 1GC7A 2A5UA 1JCKB 2XN9C 5FKAC 1KLVA 3A9KB 1LGRA 1I4GA 2C7HA 3B08A 1PGXA 4HVBA 2JYTA 4FJVB 4P16A 1H7XA 1WZ3A 3QIJA 4FHKA 4GLSC 4JLCA 1I7HA 1MHHE 3U30A 3GP7A 3B9JA 2GBMA 1V6EA 1I4RA 4M0WA 1FNWA 1TKEA 3ZGZA 4NJ7A 4MM3A 1E8XA 1S1QB 1WFYA 2DLBA 3N32A 4EEWA 2Z8LA 1XCTL 1V5OA 4NAWB 2PJHA 1UWXA 2V4IB 5JHBA 1GB4A 1HZ6A 1CK1A 2KD0A 1WH3A 4LNFA 2DWQA 3ZLZA 2W9NA 2JRIB 2IO2B 1PUTA 2DX5B 4XDCA 2O2VB 2N7DA 3AECB 2IY0B 2FAZA 1FFUA 4LNKA 2AX5A 3ZDMC 2KMMA 1EWYC 3EHVA 2TSSA 4G50A 3VTWA 5EE3A 4HKQA 2ONQA 1ROEA 4GU2A 3R2IA 1EU4A 1GPXA 4FXCA 2JRHA 4FULA 2KJHB 2ZW1A 3V3XA 1E90A 3M95A 3HVDA 1YJ1A 2WDQB 2XEWA 3R8BA 4NJ6A 3AXCA 4JGHB 1C4PA 1IBXB 3B0AA 5DPRA 3VXWA 2W3SA 4ZRPA 5G5GA 4EKUA 2FCQA 2BKFA 3C8YA 3O13A 2AQ2B 3APDA 2KO3A 3EFUA 3PRMB 1IGCA 4PK1A 3AEDB 4GDKB 4DHZB 1JMLA 4RNAA 3DPDA 1E7VA 3ZNGC 2KYWA 4URKA 2G4SA 2GMIC 4DHZE 2RPVA 3GE3C 4C80A 2KX3A 4P7IA 2LRWA 2QC8A 2LGXA 5E6OA 1V9JA 2N9KA 4M8NA 2KMCA 1QZEA 1N6ZA 3BYTB 1N5XA 1I4PA 2LI5A 1GB1A 1DOIA 3AE3B 2X38A 1TY0A 3Q2AC 4E74A 2V4LA 5EE1A 4RCOA 3HHMA 1QOFA 4AJWA 2Y5CA 3DBLB 4FLHA 1QLBB 4P6VF 2JZPA 2WHIA 2N7EA 4MH0E 3BK2A 4DXFA 1WY8A 3CMMB 4HDQA 1ZUD2 5IKCM 1JROA 5EE9A 3Q8BA 3P4RB 3KQ4A 1WX8A 1K53A 2LHDA 4II3B 4OW0A 1C3TA 3AH7A 2OJRA 4GDLA 1D5XC 1SXTA 1LM8B 4XDDA 3LDZE 1WM3A 2MSED 3KWLA 2K8HA 2M8SA 4EOYA 1ZOYB 1J7CA 2K1FA 4LLGM 2Z59B 4EZJA 5AUIA 3N3KB 4ZHOA 4IG7B 2Q5WD 1FO4A 2NBUA 1MVKA 2N0SB 3RI7C 3DHIC 3Q14C 3QHTA 1WSPA 2C7MB 4IWOA 1FIQA 1MHXA 2IGDA 1F52A 1SE9A 2DNFA 4JE3B 1CZPA 5CHFA 2IBIB 1V97A 1JWBD 2KJRA 4ZYSA 1GTEA 2WXRA 2LFIA 2KVRA 2M0AA 3RULA 1FPYA 4FADA 4JL9A 1BT0A 2KWUB 1SE4A 3BINA 2V0GA 3AE2B 3TMPB 3BK1A 5C1ZA 1BXTA 2LEKA 1E8WA 3CSTA 3EFCA 3Q8CA 2PW9A 1MI0A 2CR5A 3RMKC 2VH2A 4KGSA 1ZDXA 4XGAB 1WI0A 2L05A 2QILA 4OZBA 4TSSA 1NVID 4MGKE 2R2OA 2KT7A 4KIKB 2JU6X 3W5UB 1G6JA 3DVGX 4P1BC 3IXSA 3QARA 2J0JA 2INPE 3DHGC 3EA6A 3ZXRA 2PVOD 1T3QA 2CU3A 4C00A 3H1UA 2BB6A 4L1BA 4W9FA 4CO7A 2CJNA 1XLOA 1WJ4A 4WWNA 4YTNB 1UGJA 2HE7A 4XX5A 2BTEA 2VH1A 3P42A 1CQVA 2LMCA 3N1ZC 1AW7A 3PRZA 2DZKA 2MJDA 3SD5A 1WXAA 1H4RA 1RAXA 1WXSA 2BQQA 1Q0WB 2N9EB 3MTNB 1LFDA 1YQBA 3Q3OC 2KQSA 4HJGE 2NPTB 2REXA 1WGHA 5J2RA 3U52E 2MP2A 4KSKC 4M02A 1JW9D 1KJTA 2K3UA 2K0PA 2N9XA 4B95A 2AL6A 4LJPB 4M8MA 1RYJA 1WMHA 2NR2A 3ZNID 3ZYYX 4JIOU 1CMXB 4IWQA 3N1YC 1FEHA 4J6IA 1E7UA 1V49A 3SDLC 2D10A 1P7EA 3AU4A 4GMVA 3I3TB 1P1AA 2HTME 2K39A 2KK8A 5G5HA 5GMVA 1T0RC 3AI5A 5C2TB 4TV3A 4HCNB 3IG3A 5GXGB 4XWTA 2D11A 1C4AA 3J9CA 1WJUA 3A9JA 4II2B 1NYRA 1IUEA 1ZE3D 3V62A 3SFDB 2EMSA 3VRAB 2N4FA 3VR8B 1WYGA 4PYUA 3QJZA 4R3DA 2NVUI 1MJDA 1WE6A 2M17A 3L16A 1KM7A 3W1SA 1I4HA 1SE2A 4K3CA 1ZXHA 2G3QB 2BS3B 1FXIA 4W9HA 1WF9A 3BIID 4DDGD 4C7YA 2QEJC 4A9AA 1SGHA 4E71A 3NZ3A 1OQQA 3ZQ4A 1Y8RC 1SJHD 3I9V1 2IZVB 2HTHA 3P63A 2INCC 3EECA 2V3NA 2AEHA 3OG5A 2BB5A 2C9WB 3HUIA 3NZUA 5IAAC 3V60A 1YOVB 1WJNA 5L83A 1BUIC 1VJKA 2HD5B 2FCSA 2PVGC 2NCNA 1GOZA 1GNUA 4OHJA 5AZFA 2OHFA 4LNIA 2KN4A 1DOXA 3ECIA 3RNEC 1FM0D 3MC0B 1N63A 3TSSA 1NDDA 2E6XA 1YMHE 3U4EG 3H6NA 4HDOA 1TIFA 1WRIA 3ML9A 1WGKA 1MFWA 2KFKB 2KX0A 3DBRI 4AS1A 2WLBA 3UI3A 4YT0B 1TS4A 3DVNV 3B2GA 2M4NA 2KTRB 2MBQA 1OGWA 4EUTA 4LNNA 1T0QC 3E56A 4UDUC 2RD0A 3I63C 2CS4A 2FIFA 1YN5A 1D6EC 2MBOA 3HM3A 2L0FA 3DHHC 4YL8A 1UWMA 2WXFA 3TJPA 4RM8A 3DDCB 4ITKA 2GLSA 2BPSA 1FD6A 1WXMA 1XXGA 3AE7B 3VHTC 2JF5A 4ACFA 1YNTE 4JWUC 4IUMB 1SSNA 1QOGA 2JT4B 2KDFB 5D2MB 1QF6A 2GBNA 1KF6B 4DK5A 1YX6B 3JSVA 1JALA 1GT8A 4A20A 2WU5B 5E6NA 3VUXA 3NVWA 1V2YA 1TBEA 4HPMB 1ZKHA 4ZHPA 1T5XD 3FKYA 3PZDA 5T8IA 4CYEA 2J0KA 3B2FA 4GXBA 3APCA 3TL5A 1F9JA 1ENFA 2W82A 2MBEA 2QIEB 4FHJA 1VZ8A 5CTRC 1VLBA 1V1PA 1ACCA 3VRBB 3DOWA 4W9IA 1OEYJ 3IT4B 2GBJA 1OQRA 2QJLA 3ZTCA 1TKGA 4MT5A 2KDBA 1WYWB 4FN2A 4W9LA 4IM3A 3TBLD 2AL3A 2ZNVB 2FCMA 2G1EA 4OZCA 3MJWA 2FCNA 2VZKB 3L10B 1GUAB 4F1SA 1STEA 1UH6A 4K7SA 2M19A 5AUKA 3A9KA 1AARA 3LB8C 4XC2A 5G2NA 5G55A 4PS3A 4LDTD 3NRZA 1V8CA 4GGQA 5LLIA 4MEMA 4I6PA 2RDBC 2MA9B 1FCCC 3ZNZB 2LUEA 1WJ6A 1XO3A 1MG8A 3KUCB 4YSXB 4W9DA 1WR1A 1YJJA 3I5JC 3RD2A 4ANXA 4IW0A 5IN7A 3PT2B 2BW2A 1KH0A 3TEXA 2BWES 4HXDA 2QMTA 3WA0A 3GOEA 4BAXA 2WXKA 2I1KA 5HFYA 1GC6A 3VAWA 3H9DA 1WX9A 1HTQA 3Q8EA 1HQRD 4EZKA 1NI2A 1M94A 1PYWD 2LGSA 1UD7A 4HPLB 5IOIA 1C78A 1TS2A 1KLUD 4NPNA 2K22A 2L32A 2LGDA 2O2VA 3R66C 1V5TA 2DZMA 1VZ7A 2H89B 1F77A 2MX2A 2D3GA 4NY0A 3PHWB 4IM0A 4EE2A 4K81A 1OFFA 1HTOA 3R7QA 5TR5A 3DBHB 2LGIA 4A8XC 1P7FA 3RZFA 5JXVA 4DWFA 4MELA 3I57A 4A3PA 2NBVB 2RPQA 1E7PB 3CF6E 2KC1A 2IDYA 2ZZPB 4WH4A 2LASA 5DPWA 3BVZA 4WJQA 5FR3A 1FXTB 1UELA 2LZ6A 4D2KA 1OEYA 2KJ6A 2WX1A 1WZ0A 2L52A 4C7ZA 1XQQA 4MGIE 1X1MA 1IBXA 2N1VA 3GZNI 1TTNA 1JWSD 3VH3B 2KQ7A 1I42A 1N60A 4J3OD 4TMAB 1NI3A 1C76A 2KAJA 4C56C 3O65B 5HHDG 1I4XA 1XEEA 4EFOA 2GBRA 1JRUA 3DWMA 1UGMA 1V1OA 4GDKA 2K8CA 3ZKJC 5BO4B 3ZRCA 3U7ZA 3JW0X 2MWSB 2BVCA 2N9PC 2BYFA 1SEBD 2LRUA 3RPFC 3VTVA 3ZUNA 2XNAC 3HK0A 1VDVA 3MHSD 3UINB 5C3JB 2KVZA 1L4ZB 2L83A 2RR9A 2DAJA 2WWZA 3IFWB 3KUDB 5LXHA 2JQRB 1M4VA 2SAKA 2D3CA 3QQ8B 4KGRA 2XBBC 2G4DB 4HRSA 3AE8B 4NQKE 4FBJB 4JWSC 3Q6BA 2K9XA 3MC9A 2NMQA 2DYOA 4KDLB 5EE0A 4C4VB 4KKIA 2WXGA 3WAMA 2CJOA 3S2AA 4BVUC 2WP9B 3UQBA 4MGZE 2QCZA 2LUMA 3DBSA 3DBRB 3DQVA 4BKGA 4ZOHC 2L1AA 1JWMD 1T6BX 1A5RA 3RNAC 4LCDE 4RF1A 3NVYA 4G3XB 2MRPA 3VH4B 3H7PA 3R2TA 3QX1A 1E5WA 2GOWA 1B1ZA 3OJ3A 2WYQA 4K7UA 4BBNC 2Z0DB 2WXOA 2MW5A 3UIOB 3ZW3A 4ANUA 1I4QA 3PGEA 3C19A 3AE4B 2LXAA 2BKRB 2YEPF 2KDEB 1OTRB 2FNJB 5IP4D 3Q69A 3U8ZA 1Z5SB 1SE3A 1WXVA 2DYBA 3A4SC 2Y5BB 1SIJA 3L0WB 3RT3B 4LNOA 1NENB 1RFAA 1D5MC 4XWWA 4MSQB 1WR6E 3GS2A 1UBIA 1PGBA 4KZ0A 4BKSD 2DYMA 4BKSA 1K52A 2R61A 5J18A 2V9HA 4B9KA 2GBKA 4KSLC 1YN3A 2FBWB 4NAMA 1XLNA 3ZJUA 3WANA 1KOTA 2C60A 2L8JA 4CHKA 4AP4C 4FA6A 2MJ3A 2HJ8A 4OVZA 3Q8FA 4MJSB 2WXIA 3SEBA 5H8YE 3RCZA 1E8ZA 2D2QA 3V05A 1Q10A 1IP9A 1P98A 2RDGA 4IKGA 4W9EA 3HIZA 2JX5A 1XF5L 4KZCA 4F8CB 5JH5C 3KW5B 1D3ZA 1WWTA 1D5ZC 1A70A 5BYRA 3T8MA 4HPPA 4BOSC 1L0YB 4ICVA 2NPTA 3IBEA 2L0TA 3L4PA 1C9FA 3DBHI 2LD9A 2V3SA 2PEAA 4JQWC 1D4BA 2Y5PA 5KHQA 1FMAD 2UU7A 1AWDA 3U2SC 3AEFB 3DVNU 3KH0A 3PHXB 5D3DA 4WWPA 3FILA 5HI1A 3P4QB 3QCAA 1ET6A 4DHJD 2WS3B 3IVFA 2XK5B 2J4XA 1L2NA 2BS4B 4ZRQA 4HJKA 3K9PB 3NY5A 2PMVA 3KUZA 2MCNB 2PE9A 1FNUA 2LWPA 3KWVA 2ZJDA 3JYUA 1L6UA 4ZYNA 2KTFA 1TYGB 2DBYA 2WXPA 3RYTA 3WIMA 4JPSA 5DPSA 2JY6A 3AULA 3IT6B 4US9A 4DXGA 4OVVA 4AUQC 4A6QA 2ZVNA 4BFRA 2QHOA 1Q1OA 2D3BA 2SEBD 4WJOA 4WQOB 1B9RA 1KRHA 2GB1A 2IO3B 3C0RB 2JZ3B 2LJIA 3R3MA 4I6NB 5E6PA 3WCQA 2YVCA 2WXMA 4YWGG 3MFGA 4GOCA 4KDIC 1E0ZA 4RGTA 2BBCA 4FJYA 2N1WA 3W1YA 4WWOA 3PZ8A 3BVMA 3U7DA 2MH7A 2AQ3B 1NYQA 1TJEA 2CHZA 2WDTB 1EF1A 4RGNA 3WAOA 2KHWB 3Q3NC 5HKHA 3APFA 1RLFA 3GZNB 1R7SA 1WGGA 3A1QB 2KLCA 2PLPA 5C23A 2KXJA 3PS6A 1J0GA 1ZW7A 4MGYE 4HKZE 1ZGUB 4AWJA 4YXDB 3N9YC 4JX1C 1QILA 1FFVA 3VVWB 5TSSA 1QT9A 4IM2A 1J8CA 3QK0A 2B76B 3KLSX 5E6JA 3W9CB 4G11A 3NHEB 1K50A 2KFKA 4G0NB 1TY2A 2J52A 1P3QU 2O6VB 4RGOS 1CJEA 2KTRA 3AB5A 3NUHB 2FUG1 3M62B 1PFDA 2JWZA 5BYSA 2WXHA 2KDIA 2ZEQA 1R4NI 4N58A 3NOBA 1MPEA 4YTPB 3LYYA 1HEZE 1K8RB 2C5LC 4LK0M 1K51A 1WGYA 4YTMB 4W9KA 3W5VB 1JWAD 2IO1B 1XLPA 1T0SC 2KFJA 1L5PA 1F2RI 2EKIA 3BWUD 3N1XC 1XLQA 2KMAA 2UYZB 2KNBA 2JVCA 4DQOC 5CHWA 3GE8C 2WU2B 3OLMD 4ZRKA 1UBQA 2N9LA 3V6EB 1VZ6A 4W9JA 3PZ7A 2LVQA 3ONSA
chains in the Genus database with same CATH topology
3AE6B 1N60A 2AQ1B 4J3OD 4RH6A 1NI3A 4TMAB 1L0VB 1C76A 3P42A 2YEPB 2KAJA 3Q8AA 3NVZA 4C56C 5BYQA 2NTSA 3SFEB 1L6VA 1YN4A 5HHDG 1CQVA 4TQ1A 1I4XA 2OEDA 5MPOA 2W54A 1XEEA 4RFBA 2RMMA 2LMCA 4A90A 1C4CA 2HDEA 1AW7A 3DWMA 4MM3B 1HA5A 1F0ZA 5HG2A 1V1OA 2MJDA 5H92C 1C79A 3H8HA 4B0MA 2NTTA 3U7ZA 1TKYA 3E9SA 1QKZA 4MACA 1XCQL 1SEBD 4HJGE 3RPFC 2H88B 2XNAC 2Y3AA 3TEYA 3U52E 4LTUA 1VDVA 3W2DA 3T3OA 1DGJA 1J7AA 1JW9D 2K3UA 2K0PA 4AQ7A 5C3JB 1L4ZB 1RYJA 2L83A 1QOAA 3ZYYX 1UNSA 2JQRB 1M4VA 4PT5A 1FEHA 4CQNA 2SAKA 4YSZB 4KGRA 2WNMA 1P7EA 4HRSA 3AE8B 3IAM1 2ACZB 3ETRA 3HVZA 4JWSC 2VZKD 2HTME 2ZW0A 2K9XA 2ON8A 5G5HA 3CWIA 1PDXA 5C2TB 2NMQA 2K5PA 2DYOA 3EUB2 1L0XB 3CF4A 1YQ3B 5EE0A 5GXGB 4XWTA 4WWMA 2ICIA 1RWSA 1SB3C 4KKIA 4ARIA 1C4AA 2WXGA 3J9CA 2IJ0A 2CJOA 2W55A 2WP9B 2BS2B 1EU3A 3MJ5A 2LUMA 2E3TA 1QOBA 1FXAA 1NYRA 1TS3A 4IOIE 4XE0A 4KGTA 4ARCA 1IUEA 4ZOHC 1ZE3D 3MHZA 2L1AA 3SFDB 2I38A 3VRAB 1JWMD 3VR8B 1T6BX 4RF0A 3VR9B 1WYGA 3NVYA 4RF1A 3BYYB 4R3DA 2JWUA 2FE8A 3R2TA 1AN8A 4YSYB 2GI9A 1B1ZA 4A55A 3W1SA 1I4HA 1SE2A 1E10A 2PTLA 2MJEA 5BMHA 1ZXHA 1V1PB 2WXOA 2BS3B 3AEEB 1FXIA 2JXTA 3TUOA 1I4QA 2BT6A 3BIID 4C7YA 2JYEA 2QEJC 2J42A 4A9AA 1ESFA 3AE4B 1BMLC 2YEPF 5D3IB 4L2YA 1KTKA 4WQMA 3P4PB 2KDMA 3ZJTA 2JSVX 3NZ3A 1OQQA 1HXYD 1PGAA 3P1MA 4WURA 3ZQ4A 3Q69A 1C77A 2KWDA 2WQYB 1SJHD 3AE9B 3AV8A 3I9V1 1SE3A 2KACA 2RDHA 3PO0A 1SIJA 3P63A 4KKJA 1NENB 1D5MC 1JCKB 4XWWA 2XN9C 3TEZA 3GS2A 2V3NA 5FKAC 3URYA 1PGBA 4GDLB 2BB5A 4USAA 2DYMA 3OWEB 1I4GA 1RM6C 1K52A 3HUIA 4WIPA 2WXNA 2R61A 1AYFA 4O1NA 1BUIC 1VJKA 1YN3A 2FBWB 2PVGC 1XLNA 4NAMA 3ZJUA 1UUPA 1PGXA 1GOZA 2MJ3A 4OHJA 4OVZA 2OHFA 2JYTA 2KN4A 1DOXA 3Q8FA 4P16A 1H7XA 2WXIA 4GLSC 3SEBA 1FM0D 5H8YE 3MC0B 1I7HA 1N63A 3TSSA 3V05A 1MHHE 2E6XA 2PIAA 3GP7A 2WXQA 1YMHE 1Q10A 3U4EG 3B9JA 1YJIA 3AEBB 2RDGA 4IKGA 2JX5A 1VR9A 1WRIA 1I4RA 1WGKA 4M0WA 1FNWA 1TKEA 3ZGZA 4AS1A 2WLBA 1XF5L 3UI3A 2DLBA 4YT0B 1TS4A 1WWTA 1D5ZC 3B2GA 2Z8LA 1A70A 5BYRA 1XCTL 2G9HD 4NAWB 1L0YB 1UWXA 2V4IB 3E56A 4UDUC 3TEWA 1GB4A 1HZ6A 1CK1A 2IGHA 2D5GA 1YN5A 1D6EC 2DWQA 3L4PA 4H2AA 4REZA 5I4DA 1C9FA 1PUTA 4XDCA 1IGDA 3AECB 3VQIA 1UWMA 2WXFA 1FFUA 4ITKA 2AX5A 1D4BA 2Y5PA 2KMMA 1EWYC 4L23A 2J53A 1FMAD 1FD6A 2TSSA 1AWDA 1XXGA 3AE7B 3AEAB 5EE3A 4HKQA 4HROA 1YNTE 2ONQA 4JWUC 3U2SC 1ROEA 1SSNA 3AEFB 3R2IA 1EU4A 1QOGA 1GPXA 5D3DA 4FXCA 3FILA 5HI1A 3P4QB 3NS1A 1QF6A 1ET6A 4B0EA 3ZJVA 3AEGB 2ZW1A 3V3XA 1KF6B 3AE1B 3HVDA 2WS3B 1DYQA 1JALA 2WXLA 2WDQB 1GT8A 1TZOA 3R8BA 2J4XA 2WU5B 2BS4B 2QSDA 1TS5A 1C4PA 4ZRQA 3NVWA 1IBXB 2WDRB 4RGMA 4MH8A 2GRIA 1RFKA 2PMVA 1JRPA 3MP9A 3SR6A 4ZHPA 2W3SA 4ZRPA 5G5GA 1FNUA 2V3PA 3C8YA 3KWVA 3O13A 2AQ2B 1ET9A 1N5WA 1T5XD 3ABVB 1L6UA 5T8IA 2MEKA 1TYGB 2DBYA 1IGCA 2WXPA 3B2FA 3AEDB 4GDKB 1JMLA 4RNAA 2KQ4X 4JPSA 1ENFA 2W82A 2IGGA 3IT6B 4US9A 4DXGA 2QIEB 2RPVA 4A6QA 4KX6B 4C80A 2M56B 1VZ8A 3LXFA 1JQ4A 2SEBD 1VLBA 1B9RA 1KRHA 2GB1A 3BZDB 2N9KA 1V1PA 1ACCA 2LJIA 3VRBB 3AM9A 1Y56A 5LNK1 3BYTB 1N5XA 2BYTA 1I4PA 3IT4B 1GB1A 1J7BA 3WCQA 1DOIA 2WXMA 3AE3B 2X38A 1OQRA 1TY0A 2QJLA 1TKGA 4MT5A 4YWGG 3MFGA 1E0ZA 5EE1A 4RGTA 4RCOA 1QOFA 2BBCA 3T3NA 1FCLA 2Y5CA 1YQ4B 3PZ8A 2G1EA 4OZCA 3BVMA 1KFYB 1QLBB 2MH7A 2VZKB 2AQ3B 2JZPA 1NYQA 4P6VF 1TJEA 3HRDD 2INNE 3AN1A 3BK2A 1N62A 4DXFA 1STEA 4RGNA 1ZUD2 1FRRA 1JROA 1F2RC 5EE9A 3Q8BA 3P4RB 2M19A 1R7SA 3KQ4A 5AUKA 1K53A 2LHDA 3DWGC 3GB1A 3LB8C 4OW0A 3AH7A 3P4SB 1SBBB 1D5XC 2PLPA 1SXTA 3IAS1 4XDDA 3KWLA 3NRZA 4N59A 1GAQB 1V8CA 1VRAB 3FAHA 4HKZE 3RFZB 1ZOYB 1E6EB 4YXDB 1QQRA 2N7JA 3N9YC 1J7CA 1HZ5A 1QILA 4JX1C 4LLGM 4HEA1 1FFVA 1FNVA 5AUIA 1FCCC 4ZHOA 5TSSA 3BVGA 2Q5WD 1FO4A 1XO3A 1WXQA 1QT9A 4YSXB 1H7WA 1N61A 1MVKA 1YJJA 2N0SB 5FK9C 3FILB 3CIRB 1GTHA 2B76B 1WSPA 1FIQA 2BW2A 1KH0A 3KLSX 5E6JA 1MHXA 3AE5B 3TEXA 3W9CB 2QMTA 2IGDA 2WXKA 1K50A 5HFYA 4JE3B 1CZPA 1SJED 1V97A 1E9MA 1LO5D 1JWBD 4WAFA 1TY2A 2J52A 3Q8EA 4ZYSA 5BMIA 1GTEA 2WXRA 4RGOS 1HQRD 1CJEA 2IPKD 2LFIA 3AB5A 3FC4A 2FUG1 3NUHB 5D7GA 1ZPSA 1ZXIA 1PFDA 2M0AA 3EGRA 1PYWD 2WXJA 4NZLB 5BYSA 1FRDA 1SE4A 2WXHA 4IDIA 2V0GA 3AE2B 1C78A 1TS2A 3BK1A 1KLUD 1BXTA 2LEKA 4N58A 3Q8CA 2PW9A 1MI0A 2K22A 1MPEA 2L32A 4N6EB 4YTPB 3LYYA 4KGSA 1ZDXA 1HEZE 1VZ7A 2H89B 1F77A 3AMZA 4LK0M 2I2YA 2QILA 4OZBA 4TSSA 1K51A 1NVID 4OZAA 4EE2A 1OFFA 4Q2JA 4YTMB 3W5VB 1JWAD 2LGIA 2JU6X 4A8XC 1P7FA 5JXVA 3W5UB 1XLPA 3I57A 1DOYA 3NVVA 3IXSA 1L5PA 1F2RI 2EKIA 3BWUD 1E7PB 2INPE 1EWCA 3EA6A 4TQ0A 1XLQA 2WDVB 2IDYA 4WH4A 4DQOC 2PVOD 3BVZA 1T3QA 4US8A 2CU3A 1KLGD 5BMGA 1JWUD 5FR3A 1ZP0B 2WU2B 2W3RA 1NEKB 2LHEA 1EM7A 4D2KA 2BB6A 4L1BA 1L4DB 2CJNA 1XLOA 2L52A 2N9LA 1ZDVA 2PKOA 4C7ZA 4YTNB 1VZ6A 1UGJA 1SF0A 2EELA 3PZ7A 1IBXA 4NJCA 2BTEA 1JWSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 B;  3DWG C;  1N60 A;  3LB8 C;  2AX5 A;  3AH7 A;  1NI3 A;  2MJE A;  1E10 A;  1L0V B;  3P4S B;  2KAJ A;  2KMM A;  3NVZ A;  1EWY C;  3SFE B;  1L6V A;  2BS3 B;  3AEE B;  1FMA D;  1FXI A;  1AWD A;  5MPO A;  3AE7 B;  3AEA B;  2W54 A;  3KWL A;  2BT6 A;  5EE3 A;  3BII D;  3NRZ A;  4N59 A;  1GAQ B;  1V8C A;  3FAH A;  4HRO A;  1ZOY B;  1E6E B;  4YXD B;  3DWM A;  4JWU C;  4C7Y A;  4JX1 C;  1F0Z A;  1J7C A;  1ROE A;  3AEF B;  4A9A A;  2MJD A;  5H92 C;  1QOG A;  3AE4 B;  1GPX A;  1FFV A;  4FXC A;  5AUI A;  1TKY A;  3P4Q B;  3NS1 A;  4WQM A;  4ZHO A;  3P4P B;  1QF6 A;  2Q5W D;  1FO4 A;  3AEG B;  1OQQ A;  1XO3 A;  1WXQ A;  1QT9 A;  1KF6 B;  4YSX B;  3P1M A;  1H7W A;  3AE1 B;  1N61 A;  2WS3 B;  3RPF C;  2H88 B;  2WQY B;  1JAL A;  3AE9 B;  1YJJ A;  2N0S B;  3AV8 A;  2WDQ B;  1GT8 A;  2M19 A;  3CIR B;  1GTH A;  3PO0 A;  2B76 B;  4LTU A;  1SIJ A;  1VDV A;  2WU5 B;  1FIQ A;  3P63 A;  1DGJ A;  1NEN B;  2BS4 B;  1J7A A;  1JW9 D;  3AE5 B;  5C3J B;  1RYJ A;  3NVW A;  2L83 A;  3W9C B;  2WDR B;  1QOA A;  3ZYY X;  1RFK A;  1CZP A;  2JQR B;  1JRP A;  3SR6 A;  4ZHP A;  1V97 A;  2W3S A;  5G5G A;  4USA A;  5H8Y E;  1E9M A;  1RM6 C;  1JWB D;  3HUI A;  1N5W A;  3ABV B;  1GTE A;  4YSZ B;  1AYF A;  1L6U A;  1CJE A;  3FC4 A;  3AB5 A;  4HRS A;  1TYG B;  1VJK A;  1ZXI A;  2DBY A;  3AE8 B;  1PFD A;  2FBW B;  2PVG C;  1XLN A;  2ACZ B;  3B2F A;  3ETR A;  3HVZ A;  3AED B;  4JWS C;  2HTM E;  1FRD A;  2MJ3 A;  4IDI A;  3AE2 B;  2K9X A;  2OHF A;  5G5H A;  1DOX A;  3CWI A;  1PDX A;  5C2T B;  2LEK A;  2K5P A;  4N58 A;  1H7X A;  4US9 A;  3EUB 2;  2K22 A;  2QIE B;  3CF4 A;  4KX6 B;  1YQ3 B;  1FM0 D;  1I7H A;  4YTP B;  1N63 A;  2M56 B;  4N6E B;  5EE0 A;  5GXG B;  4C80 A;  3LXF A;  4WWM A;  1JQ4 A;  2H89 B;  1RWS A;  1SB3 C;  1VLB A;  2PIA A;  3AMZ A;  1B9R A;  1KRH A;  1NVI D;  1OFF A;  3B9J A;  4YTM B;  1YJI A;  2CJO A;  2W55 A;  3AEB B;  1JWA D;  3W5V B;  3VRB B;  3AM9 A;  3W5U B;  1XLP A;  2WP9 B;  1DOY A;  2JX5 A;  2BS2 B;  1N5X A;  1WRI A;  3NVV A;  1L5P A;  1J7B A;  3WCQ A;  1DOI A;  1WGK A;  2EKI A;  3AE3 B;  1E7P B;  1TKE A;  1OQR A;  2QJL A;  1TKG A;  2E3T A;  1QOB A;  1FXA A;  1NYR A;  1XLQ A;  2WLB A;  1E0Z A;  2WDV B;  4YT0 B;  1IUE A;  4ZOH C;  5EE1 A;  1WWT A;  1QOF A;  3B2G A;  2PVO D;  4US8 A;  1T3Q A;  1A70 A;  3SFD B;  2Y5C A;  2CU3 A;  1YQ4 B;  3VRA B;  1ZP0 B;  2WU2 B;  3VR8 B;  2W3R A;  1NEK B;  3VR9 B;  1WYG A;  2G1E A;  1KFY B;  3NVY A;  1QLB B;  2MH7 A;  4P6V F;  1NYQ A;  2CJN A;  1XLO A;  2L52 A;  1TJE A;  3HRD D;  2DWQ A;  3L4P A;  2PKO A;  3AN1 A;  4C7Z A;  4YTN B;  1N62 A;  1PUT A;  1SF0 A;  1FRR A;  1ZUD 2;  1JRO A;  3AEC B;  5EE9 A;  4YSY B;  1UWM A;  1FFU A;  3P4R B;  1R7S A;  5AUK A;  4ITK A; 
#chains in the Genus database with same CATH topology
 4A3O A;  2OOB B;  2AQ1 B;  4RH6 A;  4TUU A;  2CU1 A;  2X8X X;  3NVZ A;  5BYQ A;  3SFE B;  1L6V A;  1YN4 A;  2OED A;  5MPO A;  1HE8 A;  4RFB A;  4M0W B;  3L08 A;  4ANV A;  4MM3 B;  1F0Z A;  5HG2 A;  5H92 C;  2VRR B;  3H8H A;  4B0M A;  4MDK E;  1TKY A;  4EZL A;  2KZR A;  4LDT B;  1QKZ A;  2MLB A;  1XCQ L;  2R2Q A;  2ZCC A;  2Y3A A;  4K1R B;  4LTU A;  4HK2 A;  3T3O A;  1DGJ A;  2MQJ A;  1J7A A;  4NQL B;  4AQ7 A;  4GSW A;  1GG3 A;  1QOA A;  2ZNV C;  2BWF A;  3VDZ A;  4WAA A;  1UNS A;  1WM2 A;  3MC8 A;  2EMT A;  1RRB A;  4YSZ B;  3ETR A;  3HVZ A;  2K6Q A;  3TIX A;  1EUV B;  2VZK D;  3X23 A;  4RM9 A;  2LVO A;  2ZW0 A;  2PPH A;  4K7W A;  3CWI A;  1PDX A;  3NZS A;  2K5P A;  3RNB C;  3EUB 2;  2NBW B;  2WX0 A;  4OVU A;  1SB3 C;  3P2B A;  4ARI A;  4QAY A;  2W55 A;  5L95 C;  4BBN F;  1E8Y A;  2BS2 B;  2LXC A;  1EU3 A;  4NAW A;  1EO6 A;  1YX5 B;  3N30 A;  2E3T A;  1QOB A;  1I35 A;  3H7S A;  4XE0 A;  3A33 B;  4ASW C;  3V61 A;  5LXI B;  5AZG A;  3UIP B;  4PS7 A;  2LVP A;  3AU5 A;  4HLE A;  3BYY B;  2K8B A;  1WGD A;  2JWU A;  2FE8 A;  2L76 A;  2J7Q B;  4YSY B;  4S17 A;  4PS8 A;  2ZPN A;  1V81 A;  2K6D B;  4ICU A;  5BMH A;  2J0M A;  5AZH A;  3AEE B;  3TUO A;  2BT6 A;  2CKH B;  3X0W A;  2J42 A;  1EF5 A;  2CHW A;  1L7Y A;  1BML C;  3PSE B;  2C7N B;  2RGF A;  5D3I B;  1KTK A;  2KDM A;  2MBH A;  3P1M A;  1PGA A;  1UZX B;  3PVL A;  4F7Z A;  1C77 A;  2KWD A;  2WQY B;  3AE9 B;  3QC8 B;  2RDH A;  5IO9 A;  2BGF A;  4KKJ A;  3PLU A;  4W9C A;  3TEZ A;  2IND C;  2KOX A;  3UGB B;  3URY A;  3M63 B;  1WRD B;  2FUH B;  4GDL B;  4USA A;  3OWE B;  1P9D U;  1RM6 C;  4WIP A;  2WXN A;  3IHP C;  1AYF A;  3PRE A;  4O1N A;  4GIV A;  1UUP A;  1XD3 B;  3ZVV A;  3EC8 A;  4HCP B;  3D32 A;  1WIA A;  2PIA A;  1C1Y B;  2WXQ A;  2KAN A;  3ALB A;  3QA8 A;  1YJI A;  1R4M B;  3AEB B;  3TCA A;  1VR9 A;  3ZNH B;  2BYE A;  3SHQ A;  2G9H D;  4ZRI A;  2MBB B;  3TEW A;  3RNG C;  1PQS A;  2IGH A;  2D5G A;  4H2A A;  4REZ A;  5I4D A;  2ASQ A;  1IGD A;  5J17 A;  4B6W A;  3VQI A;  3H7P B;  2KKC A;  5CHV C;  4N9F 4;  2MHJ A;  4L23 A;  2IYD B;  2J53 A;  2DZJ A;  3Q3J A;  3AEA B;  4X57 B;  2B3A A;  4HRO A;  4MSM B;  2JXX A;  2LGY A;  3NS1 A;  4B0E A;  3ZJV A;  3AEG B;  3NG0 A;  3JVZ X;  3AE1 B;  1DYQ A;  2WXL A;  4C4V A;  1TZO A;  2QSD A;  4AOF A;  1TS5 A;  3T9L A;  1LQB A;  2IY1 B;  2WDR B;  4RGM A;  4MH8 A;  2GRI A;  1RFK A;  1JRP A;  3MP9 A;  3SR6 A;  2OJW A;  3UF8 A;  2L00 B;  2V3P A;  1ET9 A;  1N5W A;  3ABV B;  3Q3F A;  4KV2 A;  2MEK A;  1OQY A;  3RUI B;  1Z2M A;  2KQ4 X;  2IGG A;  1R4N B;  3ZRF A;  4KIK A;  2D3A A;  4KX6 B;  2M56 B;  3LXF A;  1JQ4 A;  1T0Y A;  3BZD B;  2MP2 B;  5DCN A;  2KWV B;  3AM9 A;  1Y56 A;  5LNK 1;  1WMH B;  2BYT A;  1J7B A;  1YIW A;  4P1C C;  4M00 A;  2ZCB A;  2M1M A;  3T3N A;  1FCL A;  4GN1 A;  4LJO B;  1YQ4 B;  4HWI B;  3ZTD A;  1KFY B;  3HRD D;  2INN E;  2DAF A;  3AN1 A;  5IA7 A;  1N62 A;  4RMA A;  1FRR A;  3ZO5 B;  1F2R C;  2FID A;  3B1L X;  4BOZ B;  1UF0 A;  3DWG C;  2UWQ A;  3GB1 A;  4BZA A;  3A9J B;  3P4S B;  3OJ4 B;  1SBB B;  1GJZ A;  3IAS 1;  1LXD A;  4N59 A;  3RFZ B;  1GAQ B;  1VRA B;  3FAH A;  1E6E B;  1QQR A;  2N7J A;  2QDF A;  1HZ5 A;  4HEA 1;  2BF8 B;  2I1J A;  1FNV A;  3ENE A;  3BVG A;  4MJS A;  1WXQ A;  1Q5W B;  1H7W A;  1F1H A;  1N61 A;  3OAW A;  3WAL A;  5EDS A;  1VCB A;  5FK9 C;  3FIL B;  4S0R A;  3CIR B;  1GTH A;  5FR6 A;  5JZE B;  3AE5 B;  4DBG A;  4DHJ B;  2PE6 B;  5KHO A;  2KN5 A;  3QAQ A;  1TZ1 A;  2CHX A;  3V6C B;  2BYV E;  1SJE D;  3ML8 A;  1E9M A;  1LO5 D;  3RZW C;  4M01 A;  1SIF A;  4WAF A;  5BMI A;  2NS5 A;  2DEN B;  3FC4 A;  2IPK D;  2L7R A;  3R7R A;  5D7G A;  1ZPS A;  1ZXI A;  3UQA A;  3EGR A;  2WXJ A;  4NZL B;  1FRD A;  4IDI A;  3DCG A;  3L17 A;  3DVG Y;  2EKE C;  3W1S C;  3PPA A;  4N6E B;  5AEK B;  3AMZ A;  2I2Y A;  4OZA A;  4Q2J A;  3HM6 X;  2G45 B;  1DOY A;  3NVV A;  3KYD D;  4IWP A;  1EWC A;  4TQ0 A;  2WDV B;  4K3B A;  5CX3 A;  2DZI A;  2RSU A;  4TKN A;  4US8 A;  3DBL I;  3CSF A;  4FJZ A;  1KLG D;  3KYC D;  3N20 C;  5BMG A;  1JWU D;  1VD2 A;  2JUO A;  1ZP0 B;  2W3R A;  1NEK B;  2LHE A;  4ZRJ A;  1EM7 A;  2XK5 A;  1L4D B;  1MG4 A;  1ZDV A;  3VUY A;  1P0R A;  1R4M I;  2PKO A;  2D07 B;  2M0X A;  1SF0 A;  4W9G A;  2EEL A;  4NJC A;  3LJ3 A;  1IYF A;  3AE6 B;  1L0V B;  2YLM A;  2YEP B;  3Q8A A;  2IO0 B;  2NTS A;  3K9O B;  2LJ5 A;  3PRP B;  4TQ1 A;  4XZ4 A;  1J19 A;  2KLG A;  2W54 A;  2RMM A;  4A90 A;  1C4C A;  2HDE A;  1HA5 A;  2AWT A;  4KVG B;  1C79 A;  3NJT A;  2NTT A;  1TGZ B;  3RNF C;  1YD8 U;  2K25 A;  3L54 A;  3E9S A;  4MAC A;  3Q3M C;  2H88 B;  1ISN A;  2HJ1 A;  3TEY A;  3W2D A;  3ZDT A;  3VUW A;  4DDI D;  2AYO B;  2JPH A;  1TT5 B;  4AJY B;  2ZPY A;  3RNC C;  2A4Z A;  4PT5 A;  4CQN A;  3SU8 X;  1H8C A;  4GB9 A;  3ZXV A;  2WNM A;  3IAM 1;  2ACZ B;  4DXA B;  3QWZ B;  4ANW A;  1WGR A;  2ON8 A;  2V1Y A;  2KWC A;  4BKT A;  1L0X B;  3CF4 A;  1YQ3 B;  3JSV B;  4WWM A;  2ICI A;  1RWS A;  3A1Q A;  3PTF C;  2IJ0 A;  4I6L B;  1V86 A;  3BY4 B;  2JZZ A;  2DHZ A;  3L13 A;  1WE7 A;  3MJ5 A;  5DPT A;  3RN9 C;  4XYC A;  2WGS A;  1FXA A;  1TS3 A;  4ZDV A;  4IOI E;  2ZVO A;  4KGT A;  4ARC A;  3MHZ A;  3PLV A;  2I38 A;  4NNJ B;  1U4A A;  5D94 A;  4WJP A;  4RF0 A;  3VR9 B;  4WJN A;  4E3C A;  1AN8 A;  2L3Z A;  2GI9 A;  4A55 A;  5JHA A;  3VFK A;  3A4R A;  1E10 A;  1IPG A;  2MJE A;  2PTL A;  3VTU A;  3M3J A;  1V1P B;  1V80 A;  3KVF B;  1XT9 B;  2JXT A;  2O6V D;  2O6V A;  5D6J B;  2JYE A;  3ZIM A;  1ESF A;  4IC7 B;  4PYZ A;  4L2Y A;  4WQM A;  3P4P B;  1WX7 A;  3ZJT A;  1S3S G;  2JSV X;  1HXY D;  4WUR A;  2KC2 A;  2Z0E B;  3AV8 A;  2KAC A;  3WAP A;  1NBF C;  3PO0 A;  3NS8 A;  3PV1 A;  1GC7 A;  2A5U A;  1JCK B;  2XN9 C;  5FKA C;  1KLV A;  3A9K B;  1LGR A;  1I4G A;  2C7H A;  3B08 A;  1PGX A;  4HVB A;  2JYT A;  4FJV B;  4P16 A;  1H7X A;  1WZ3 A;  3QIJ A;  4FHK A;  4GLS C;  4JLC A;  1I7H A;  1MHH E;  3U30 A;  3GP7 A;  3B9J A;  2GBM A;  1V6E A;  1I4R A;  4M0W A;  1FNW A;  1TKE A;  3ZGZ A;  4NJ7 A;  4MM3 A;  1E8X A;  1S1Q B;  1WFY A;  2DLB A;  3N32 A;  4EEW A;  2Z8L A;  1XCT L;  1V5O A;  4NAW B;  2PJH A;  1UWX A;  2V4I B;  5JHB A;  1GB4 A;  1HZ6 A;  1CK1 A;  2KD0 A;  1WH3 A;  4LNF A;  2DWQ A;  3ZLZ A;  2W9N A;  2JRI B;  2IO2 B;  1PUT A;  2DX5 B;  4XDC A;  2O2V B;  2N7D A;  3AEC B;  2IY0 B;  2FAZ A;  1FFU A;  4LNK A;  2AX5 A;  3ZDM C;  2KMM A;  1EWY C;  3EHV A;  2TSS A;  4G50 A;  3VTW A;  5EE3 A;  4HKQ A;  2ONQ A;  1ROE A;  4GU2 A;  3R2I A;  1EU4 A;  1GPX A;  4FXC A;  2JRH A;  4FUL A;  2KJH B;  2ZW1 A;  3V3X A;  1E90 A;  3M95 A;  3HVD A;  1YJ1 A;  2WDQ B;  2XEW A;  3R8B A;  4NJ6 A;  3AXC A;  4JGH B;  1C4P A;  1IBX B;  3B0A A;  5DPR A;  3VXW A;  2W3S A;  4ZRP A;  5G5G A;  4EKU A;  2FCQ A;  2BKF A;  3C8Y A;  3O13 A;  2AQ2 B;  3APD A;  2KO3 A;  3EFU A;  3PRM B;  1IGC A;  4PK1 A;  3AED B;  4GDK B;  4DHZ B;  1JML A;  4RNA A;  3DPD A;  1E7V A;  3ZNG C;  2KYW A;  4URK A;  2G4S A;  2GMI C;  4DHZ E;  2RPV A;  3GE3 C;  4C80 A;  2KX3 A;  4P7I A;  2LRW A;  2QC8 A;  2LGX A;  5E6O A;  1V9J A;  2N9K A;  4M8N A;  2KMC A;  1QZE A;  1N6Z A;  3BYT B;  1N5X A;  1I4P A;  2LI5 A;  1GB1 A;  1DOI A;  3AE3 B;  2X38 A;  1TY0 A;  3Q2A C;  4E74 A;  2V4L A;  5EE1 A;  4RCO A;  3HHM A;  1QOF A;  4AJW A;  2Y5C A;  3DBL B;  4FLH A;  1QLB B;  4P6V F;  2JZP A;  2WHI A;  2N7E A;  4MH0 E;  3BK2 A;  4DXF A;  1WY8 A;  3CMM B;  4HDQ A;  1ZUD 2;  5IKC M;  1JRO A;  5EE9 A;  3Q8B A;  3P4R B;  3KQ4 A;  1WX8 A;  1K53 A;  2LHD A;  4II3 B;  4OW0 A;  1C3T A;  3AH7 A;  2OJR A;  4GDL A;  1D5X C;  1SXT A;  1LM8 B;  4XDD A;  3LDZ E;  1WM3 A;  2MSE D;  3KWL A;  2K8H A;  2M8S A;  4EOY A;  1ZOY B;  1J7C A;  2K1F A;  4LLG M;  2Z59 B;  4EZJ A;  5AUI A;  3N3K B;  4ZHO A;  4IG7 B;  2Q5W D;  1FO4 A;  2NBU A;  1MVK A;  2N0S B;  3RI7 C;  3DHI C;  3Q14 C;  3QHT A;  1WSP A;  2C7M B;  4IWO A;  1FIQ A;  1MHX A;  2IGD A;  1F52 A;  1SE9 A;  2DNF A;  4JE3 B;  1CZP A;  5CHF A;  2IBI B;  1V97 A;  1JWB D;  2KJR A;  4ZYS A;  1GTE A;  2WXR A;  2LFI A;  2KVR A;  2M0A A;  3RUL A;  1FPY A;  4FAD A;  4JL9 A;  1BT0 A;  2KWU B;  1SE4 A;  3BIN A;  2V0G A;  3AE2 B;  3TMP B;  3BK1 A;  5C1Z A;  1BXT A;  2LEK A;  1E8W A;  3CST A;  3EFC A;  3Q8C A;  2PW9 A;  1MI0 A;  2CR5 A;  3RMK C;  2VH2 A;  4KGS A;  1ZDX A;  4XGA B;  1WI0 A;  2L05 A;  2QIL A;  4OZB A;  4TSS A;  1NVI D;  4MGK E;  2R2O A;  2KT7 A;  4KIK B;  2JU6 X;  3W5U B;  1G6J A;  3DVG X;  4P1B C;  3IXS A;  3QAR A;  2J0J A;  2INP E;  3DHG C;  3EA6 A;  3ZXR A;  2PVO D;  1T3Q A;  2CU3 A;  4C00 A;  3H1U A;  2BB6 A;  4L1B A;  4W9F A;  4CO7 A;  2CJN A;  1XLO A;  1WJ4 A;  4WWN A;  4YTN B;  1UGJ A;  2HE7 A;  4XX5 A;  2BTE A;  2VH1 A;  3P42 A;  1CQV A;  2LMC A;  3N1Z C;  1AW7 A;  3PRZ A;  2DZK A;  2MJD A;  3SD5 A;  1WXA A;  1H4R A;  1RAX A;  1WXS A;  2BQQ A;  1Q0W B;  2N9E B;  3MTN B;  1LFD A;  1YQB A;  3Q3O C;  2KQS A;  4HJG E;  2NPT B;  2REX A;  1WGH A;  5J2R A;  3U52 E;  2MP2 A;  4KSK C;  4M02 A;  1JW9 D;  1KJT A;  2K3U A;  2K0P A;  2N9X A;  4B95 A;  2AL6 A;  4LJP B;  4M8M A;  1RYJ A;  1WMH A;  2NR2 A;  3ZNI D;  3ZYY X;  4JIO U;  1CMX B;  4IWQ A;  3N1Y C;  1FEH A;  4J6I A;  1E7U A;  1V49 A;  3SDL C;  2D10 A;  1P7E A;  3AU4 A;  4GMV A;  3I3T B;  1P1A A;  2HTM E;  2K39 A;  2KK8 A;  5G5H A;  5GMV A;  1T0R C;  3AI5 A;  5C2T B;  4TV3 A;  4HCN B;  3IG3 A;  5GXG B;  4XWT A;  2D11 A;  1C4A A;  3J9C A;  1WJU A;  3A9J A;  4II2 B;  1NYR A;  1IUE A;  1ZE3 D;  3V62 A;  3SFD B;  2EMS A;  3VRA B;  2N4F A;  3VR8 B;  1WYG A;  4PYU A;  3QJZ A;  4R3D A;  2NVU I;  1MJD A;  1WE6 A;  2M17 A;  3L16 A;  1KM7 A;  3W1S A;  1I4H A;  1SE2 A;  4K3C A;  1ZXH A;  2G3Q B;  2BS3 B;  1FXI A;  4W9H A;  1WF9 A;  3BII D;  4DDG D;  4C7Y A;  2QEJ C;  4A9A A;  1SGH A;  4E71 A;  3NZ3 A;  1OQQ A;  3ZQ4 A;  1Y8R C;  1SJH D;  3I9V 1;  2IZV B;  2HTH A;  3P63 A;  2INC C;  3EEC A;  2V3N A;  2AEH A;  3OG5 A;  2BB5 A;  2C9W B;  3HUI A;  3NZU A;  5IAA C;  3V60 A;  1YOV B;  1WJN A;  5L83 A;  1BUI C;  1VJK A;  2HD5 B;  2FCS A;  2PVG C;  2NCN A;  1GOZ A;  1GNU A;  4OHJ A;  5AZF A;  2OHF A;  4LNI A;  2KN4 A;  1DOX A;  3ECI A;  3RNE C;  1FM0 D;  3MC0 B;  1N63 A;  3TSS A;  1NDD A;  2E6X A;  1YMH E;  3U4E G;  3H6N A;  4HDO A;  1TIF A;  1WRI A;  3ML9 A;  1WGK A;  1MFW A;  2KFK B;  2KX0 A;  3DBR I;  4AS1 A;  2WLB A;  3UI3 A;  4YT0 B;  1TS4 A;  3DVN V;  3B2G A;  2M4N A;  2KTR B;  2MBQ A;  1OGW A;  4EUT A;  4LNN A;  1T0Q C;  3E56 A;  4UDU C;  2RD0 A;  3I63 C;  2CS4 A;  2FIF A;  1YN5 A;  1D6E C;  2MBO A;  3HM3 A;  2L0F A;  3DHH C;  4YL8 A;  1UWM A;  2WXF A;  3TJP A;  4RM8 A;  3DDC B;  4ITK A;  2GLS A;  2BPS A;  1FD6 A;  1WXM A;  1XXG A;  3AE7 B;  3VHT C;  2JF5 A;  4ACF A;  1YNT E;  4JWU C;  4IUM B;  1SSN A;  1QOG A;  2JT4 B;  2KDF B;  5D2M B;  1QF6 A;  2GBN A;  1KF6 B;  4DK5 A;  1YX6 B;  3JSV A;  1JAL A;  1GT8 A;  4A20 A;  2WU5 B;  5E6N A;  3VUX A;  3NVW A;  1V2Y A;  1TBE A;  4HPM B;  1ZKH A;  4ZHP A;  1T5X D;  3FKY A;  3PZD A;  5T8I A;  4CYE A;  2J0K A;  3B2F A;  4GXB A;  3APC A;  3TL5 A;  1F9J A;  1ENF A;  2W82 A;  2MBE A;  2QIE B;  4FHJ A;  1VZ8 A;  5CTR C;  1VLB A;  1V1P A;  1ACC A;  3VRB B;  3DOW A;  4W9I A;  1OEY J;  3IT4 B;  2GBJ A;  1OQR A;  2QJL A;  3ZTC A;  1TKG A;  4MT5 A;  2KDB A;  1WYW B;  4FN2 A;  4W9L A;  4IM3 A;  3TBL D;  2AL3 A;  2ZNV B;  2FCM A;  2G1E A;  4OZC A;  3MJW A;  2FCN A;  2VZK B;  3L10 B;  1GUA B;  4F1S A;  1STE A;  1UH6 A;  4K7S A;  2M19 A;  5AUK A;  3A9K A;  1AAR A;  3LB8 C;  4XC2 A;  5G2N A;  5G55 A;  4PS3 A;  4LDT D;  3NRZ A;  1V8C A;  4GGQ A;  5LLI A;  4MEM A;  4I6P A;  2RDB C;  2MA9 B;  1FCC C;  3ZNZ B;  2LUE A;  1WJ6 A;  1XO3 A;  1MG8 A;  3KUC B;  4YSX B;  4W9D A;  1WR1 A;  1YJJ A;  3I5J C;  3RD2 A;  4ANX A;  4IW0 A;  5IN7 A;  3PT2 B;  2BW2 A;  1KH0 A;  3TEX A;  2BWE S;  4HXD A;  2QMT A;  3WA0 A;  3GOE A;  4BAX A;  2WXK A;  2I1K A;  5HFY A;  1GC6 A;  3VAW A;  3H9D A;  1WX9 A;  1HTQ A;  3Q8E A;  1HQR D;  4EZK A;  1NI2 A;  1M94 A;  1PYW D;  2LGS A;  1UD7 A;  4HPL B;  5IOI A;  1C78 A;  1TS2 A;  1KLU D;  4NPN A;  2K22 A;  2L32 A;  2LGD A;  2O2V A;  3R66 C;  1V5T A;  2DZM A;  1VZ7 A;  2H89 B;  1F77 A;  2MX2 A;  2D3G A;  4NY0 A;  3PHW B;  4IM0 A;  4EE2 A;  4K81 A;  1OFF A;  1HTO A;  3R7Q A;  5TR5 A;  3DBH B;  2LGI A;  4A8X C;  1P7F A;  3RZF A;  5JXV A;  4DWF A;  4MEL A;  3I57 A;  4A3P A;  2NBV B;  2RPQ A;  1E7P B;  3CF6 E;  2KC1 A;  2IDY A;  2ZZP B;  4WH4 A;  2LAS A;  5DPW A;  3BVZ A;  4WJQ A;  5FR3 A;  1FXT B;  1UEL A;  2LZ6 A;  4D2K A;  1OEY A;  2KJ6 A;  2WX1 A;  1WZ0 A;  2L52 A;  4C7Z A;  1XQQ A;  4MGI E;  1X1M A;  1IBX A;  2N1V A;  3GZN I;  1TTN A;  1JWS D;  3VH3 B;  2KQ7 A;  1I42 A;  1N60 A;  4J3O D;  4TMA B;  1NI3 A;  1C76 A;  2KAJ A;  4C56 C;  3O65 B;  5HHD G;  1I4X A;  1XEE A;  4EFO A;  2GBR A;  1JRU A;  3DWM A;  1UGM A;  1V1O A;  4GDK A;  2K8C A;  3ZKJ C;  5BO4 B;  3ZRC A;  3U7Z A;  3JW0 X;  2MWS B;  2BVC A;  2N9P C;  2BYF A;  1SEB D;  2LRU A;  3RPF C;  3VTV A;  3ZUN A;  2XNA C;  3HK0 A;  1VDV A;  3MHS D;  3UIN B;  5C3J B;  2KVZ A;  1L4Z B;  2L83 A;  2RR9 A;  2DAJ A;  2WWZ A;  3IFW B;  3KUD B;  5LXH A;  2JQR B;  1M4V A;  2SAK A;  2D3C A;  3QQ8 B;  4KGR A;  2XBB C;  2G4D B;  4HRS A;  3AE8 B;  4NQK E;  4FBJ B;  4JWS C;  3Q6B A;  2K9X A;  3MC9 A;  2NMQ A;  2DYO A;  4KDL B;  5EE0 A;  4C4V B;  4KKI A;  2WXG A;  3WAM A;  2CJO A;  3S2A A;  4BVU C;  2WP9 B;  3UQB A;  4MGZ E;  2QCZ A;  2LUM A;  3DBS A;  3DBR B;  3DQV A;  4BKG A;  4ZOH C;  2L1A A;  1JWM D;  1T6B X;  1A5R A;  3RNA C;  4LCD E;  4RF1 A;  3NVY A;  4G3X B;  2MRP A;  3VH4 B;  3H7P A;  3R2T A;  3QX1 A;  1E5W A;  2GOW A;  1B1Z A;  3OJ3 A;  2WYQ A;  4K7U A;  4BBN C;  2Z0D B;  2WXO A;  2MW5 A;  3UIO B;  3ZW3 A;  4ANU A;  1I4Q A;  3PGE A;  3C19 A;  3AE4 B;  2LXA A;  2BKR B;  2YEP F;  2KDE B;  1OTR B;  2FNJ B;  5IP4 D;  3Q69 A;  3U8Z A;  1Z5S B;  1SE3 A;  1WXV A;  2DYB A;  3A4S C;  2Y5B B;  1SIJ A;  3L0W B;  3RT3 B;  4LNO A;  1NEN B;  1RFA A;  1D5M C;  4XWW A;  4MSQ B;  1WR6 E;  3GS2 A;  1UBI A;  1PGB A;  4KZ0 A;  4BKS D;  2DYM A;  4BKS A;  1K52 A;  2R61 A;  5J18 A;  2V9H A;  4B9K A;  2GBK A;  4KSL C;  1YN3 A;  2FBW B;  4NAM A;  1XLN A;  3ZJU A;  3WAN A;  1KOT A;  2C60 A;  2L8J A;  4CHK A;  4AP4 C;  4FA6 A;  2MJ3 A;  2HJ8 A;  4OVZ A;  3Q8F A;  4MJS B;  2WXI A;  3SEB A;  5H8Y E;  3RCZ A;  1E8Z A;  2D2Q A;  3V05 A;  1Q10 A;  1IP9 A;  1P98 A;  2RDG A;  4IKG A;  4W9E A;  3HIZ A;  2JX5 A;  1XF5 L;  4KZC A;  4F8C B;  5JH5 C;  3KW5 B;  1D3Z A;  1WWT A;  1D5Z C;  1A70 A;  5BYR A;  3T8M A;  4HPP A;  4BOS C;  1L0Y B;  4ICV A;  2NPT A;  3IBE A;  2L0T A;  3L4P A;  1C9F A;  3DBH I;  2LD9 A;  2V3S A;  2PEA A;  4JQW C;  1D4B A;  2Y5P A;  5KHQ A;  1FMA D;  2UU7 A;  1AWD A;  3U2S C;  3AEF B;  3DVN U;  3KH0 A;  3PHX B;  5D3D A;  4WWP A;  3FIL A;  5HI1 A;  3P4Q B;  3QCA A;  1ET6 A;  4DHJ D;  2WS3 B;  3IVF A;  2XK5 B;  2J4X A;  1L2N A;  2BS4 B;  4ZRQ A;  4HJK A;  3K9P B;  3NY5 A;  2PMV A;  3KUZ A;  2MCN B;  2PE9 A;  1FNU A;  2LWP A;  3KWV A;  2ZJD A;  3JYU A;  1L6U A;  4ZYN A;  2KTF A;  1TYG B;  2DBY A;  2WXP A;  3RYT A;  3WIM A;  4JPS A;  5DPS A;  2JY6 A;  3AUL A;  3IT6 B;  4US9 A;  4DXG A;  4OVV A;  4AUQ C;  4A6Q A;  2ZVN A;  4BFR A;  2QHO A;  1Q1O A;  2D3B A;  2SEB D;  4WJO A;  4WQO B;  1B9R A;  1KRH A;  2GB1 A;  2IO3 B;  3C0R B;  2JZ3 B;  2LJI A;  3R3M A;  4I6N B;  5E6P A;  3WCQ A;  2YVC A;  2WXM A;  4YWG G;  3MFG A;  4GOC A;  4KDI C;  1E0Z A;  4RGT A;  2BBC A;  4FJY A;  2N1W A;  3W1Y A;  4WWO A;  3PZ8 A;  3BVM A;  3U7D A;  2MH7 A;  2AQ3 B;  1NYQ A;  1TJE A;  2CHZ A;  2WDT B;  1EF1 A;  4RGN A;  3WAO A;  2KHW B;  3Q3N C;  5HKH A;  3APF A;  1RLF A;  3GZN B;  1R7S A;  1WGG A;  3A1Q B;  2KLC A;  2PLP A;  5C23 A;  2KXJ A;  3PS6 A;  1J0G A;  1ZW7 A;  4MGY E;  4HKZ E;  1ZGU B;  4AWJ A;  4YXD B;  3N9Y C;  4JX1 C;  1QIL A;  1FFV A;  3VVW B;  5TSS A;  1QT9 A;  4IM2 A;  1J8C A;  3QK0 A;  2B76 B;  3KLS X;  5E6J A;  3W9C B;  4G11 A;  3NHE B;  1K50 A;  2KFK A;  4G0N B;  1TY2 A;  2J52 A;  1P3Q U;  2O6V B;  4RGO S;  1CJE A;  2KTR A;  3AB5 A;  3NUH B;  2FUG 1;  3M62 B;  1PFD A;  2JWZ A;  5BYS A;  2WXH A;  2KDI A;  2ZEQ A;  1R4N I;  4N58 A;  3NOB A;  1MPE A;  4YTP B;  3LYY A;  1HEZ E;  1K8R B;  2C5L C;  4LK0 M;  1K51 A;  1WGY A;  4YTM B;  4W9K A;  3W5V B;  1JWA D;  2IO1 B;  1XLP A;  1T0S C;  2KFJ A;  1L5P A;  1F2R I;  2EKI A;  3BWU D;  3N1X C;  1XLQ A;  2KMA A;  2UYZ B;  2KNB A;  2JVC A;  4DQO C;  5CHW A;  3GE8 C;  2WU2 B;  3OLM D;  4ZRK A;  1UBQ A;  2N9L A;  3V6E B;  1VZ6 A;  4W9J A;  3PZ7 A;  2LVQ A;  3ONS A; 
#chains in the Genus database with same CATH homology
 3AE6 B;  1N60 A;  2AQ1 B;  4J3O D;  4RH6 A;  1NI3 A;  4TMA B;  1L0V B;  1C76 A;  3P42 A;  2YEP B;  2KAJ A;  3Q8A A;  3NVZ A;  4C56 C;  5BYQ A;  2NTS A;  3SFE B;  1L6V A;  1YN4 A;  5HHD G;  1CQV A;  4TQ1 A;  1I4X A;  2OED A;  5MPO A;  2W54 A;  1XEE A;  4RFB A;  2RMM A;  2LMC A;  4A90 A;  1C4C A;  2HDE A;  1AW7 A;  3DWM A;  4MM3 B;  1HA5 A;  1F0Z A;  5HG2 A;  1V1O A;  2MJD A;  5H92 C;  1C79 A;  3H8H A;  4B0M A;  2NTT A;  3U7Z A;  1TKY A;  3E9S A;  1QKZ A;  4MAC A;  1XCQ L;  1SEB D;  4HJG E;  3RPF C;  2H88 B;  2XNA C;  2Y3A A;  3TEY A;  3U52 E;  4LTU A;  1VDV A;  3W2D A;  3T3O A;  1DGJ A;  1J7A A;  1JW9 D;  2K3U A;  2K0P A;  4AQ7 A;  5C3J B;  1L4Z B;  1RYJ A;  2L83 A;  1QOA A;  3ZYY X;  1UNS A;  2JQR B;  1M4V A;  4PT5 A;  1FEH A;  4CQN A;  2SAK A;  4YSZ B;  4KGR A;  2WNM A;  1P7E A;  4HRS A;  3AE8 B;  3IAM 1;  2ACZ B;  3ETR A;  3HVZ A;  4JWS C;  2VZK D;  2HTM E;  2ZW0 A;  2K9X A;  2ON8 A;  5G5H A;  3CWI A;  1PDX A;  5C2T B;  2NMQ A;  2K5P A;  2DYO A;  3EUB 2;  1L0X B;  3CF4 A;  1YQ3 B;  5EE0 A;  5GXG B;  4XWT A;  4WWM A;  2ICI A;  1RWS A;  1SB3 C;  4KKI A;  4ARI A;  1C4A A;  2WXG A;  3J9C A;  2IJ0 A;  2CJO A;  2W55 A;  2WP9 B;  2BS2 B;  1EU3 A;  3MJ5 A;  2LUM A;  2E3T A;  1QOB A;  1FXA A;  1NYR A;  1TS3 A;  4IOI E;  4XE0 A;  4KGT A;  4ARC A;  1IUE A;  4ZOH C;  1ZE3 D;  3MHZ A;  2L1A A;  3SFD B;  2I38 A;  3VRA B;  1JWM D;  3VR8 B;  1T6B X;  4RF0 A;  3VR9 B;  1WYG A;  3NVY A;  4RF1 A;  3BYY B;  4R3D A;  2JWU A;  2FE8 A;  3R2T A;  1AN8 A;  4YSY B;  2GI9 A;  1B1Z A;  4A55 A;  3W1S A;  1I4H A;  1SE2 A;  1E10 A;  2PTL A;  2MJE A;  5BMH A;  1ZXH A;  1V1P B;  2WXO A;  2BS3 B;  3AEE B;  1FXI A;  2JXT A;  3TUO A;  1I4Q A;  2BT6 A;  3BII D;  4C7Y A;  2JYE A;  2QEJ C;  2J42 A;  4A9A A;  1ESF A;  3AE4 B;  1BML C;  2YEP F;  5D3I B;  4L2Y A;  1KTK A;  4WQM A;  3P4P B;  2KDM A;  3ZJT A;  2JSV X;  3NZ3 A;  1OQQ A;  1HXY D;  1PGA A;  3P1M A;  4WUR A;  3ZQ4 A;  3Q69 A;  1C77 A;  2KWD A;  2WQY B;  1SJH D;  3AE9 B;  3AV8 A;  3I9V 1;  1SE3 A;  2KAC A;  2RDH A;  3PO0 A;  1SIJ A;  3P63 A;  4KKJ A;  1NEN B;  1D5M C;  1JCK B;  4XWW A;  2XN9 C;  3TEZ A;  3GS2 A;  2V3N A;  5FKA C;  3URY A;  1PGB A;  4GDL B;  2BB5 A;  4USA A;  2DYM A;  3OWE B;  1I4G A;  1RM6 C;  1K52 A;  3HUI A;  4WIP A;  2WXN A;  2R61 A;  1AYF A;  4O1N A;  1BUI C;  1VJK A;  1YN3 A;  2FBW B;  2PVG C;  1XLN A;  4NAM A;  3ZJU A;  1UUP A;  1PGX A;  1GOZ A;  2MJ3 A;  4OHJ A;  4OVZ A;  2OHF A;  2JYT A;  2KN4 A;  1DOX A;  3Q8F A;  4P16 A;  1H7X A;  2WXI A;  4GLS C;  3SEB A;  1FM0 D;  5H8Y E;  3MC0 B;  1I7H A;  1N63 A;  3TSS A;  3V05 A;  1MHH E;  2E6X A;  2PIA A;  3GP7 A;  2WXQ A;  1YMH E;  1Q10 A;  3U4E G;  3B9J A;  1YJI A;  3AEB B;  2RDG A;  4IKG A;  2JX5 A;  1VR9 A;  1WRI A;  1I4R A;  1WGK A;  4M0W A;  1FNW A;  1TKE A;  3ZGZ A;  4AS1 A;  2WLB A;  1XF5 L;  3UI3 A;  2DLB A;  4YT0 B;  1TS4 A;  1WWT A;  1D5Z C;  3B2G A;  2Z8L A;  1A70 A;  5BYR A;  1XCT L;  2G9H D;  4NAW B;  1L0Y B;  1UWX A;  2V4I B;  3E56 A;  4UDU C;  3TEW A;  1GB4 A;  1HZ6 A;  1CK1 A;  2IGH A;  2D5G A;  1YN5 A;  1D6E C;  2DWQ A;  3L4P A;  4H2A A;  4REZ A;  5I4D A;  1C9F A;  1PUT A;  4XDC A;  1IGD A;  3AEC B;  3VQI A;  1UWM A;  2WXF A;  1FFU A;  4ITK A;  2AX5 A;  1D4B A;  2Y5P A;  2KMM A;  1EWY C;  4L23 A;  2J53 A;  1FMA D;  1FD6 A;  2TSS A;  1AWD A;  1XXG A;  3AE7 B;  3AEA B;  5EE3 A;  4HKQ A;  4HRO A;  1YNT E;  2ONQ A;  4JWU C;  3U2S C;  1ROE A;  1SSN A;  3AEF B;  3R2I A;  1EU4 A;  1QOG A;  1GPX A;  5D3D A;  4FXC A;  3FIL A;  5HI1 A;  3P4Q B;  3NS1 A;  1QF6 A;  1ET6 A;  4B0E A;  3ZJV A;  3AEG B;  2ZW1 A;  3V3X A;  1KF6 B;  3AE1 B;  3HVD A;  2WS3 B;  1DYQ A;  1JAL A;  2WXL A;  2WDQ B;  1GT8 A;  1TZO A;  3R8B A;  2J4X A;  2WU5 B;  2BS4 B;  2QSD A;  1TS5 A;  1C4P A;  4ZRQ A;  3NVW A;  1IBX B;  2WDR B;  4RGM A;  4MH8 A;  2GRI A;  1RFK A;  2PMV A;  1JRP A;  3MP9 A;  3SR6 A;  4ZHP A;  2W3S A;  4ZRP A;  5G5G A;  1FNU A;  2V3P A;  3C8Y A;  3KWV A;  3O13 A;  2AQ2 B;  1ET9 A;  1N5W A;  1T5X D;  3ABV B;  1L6U A;  5T8I A;  2MEK A;  1TYG B;  2DBY A;  1IGC A;  2WXP A;  3B2F A;  3AED B;  4GDK B;  1JML A;  4RNA A;  2KQ4 X;  4JPS A;  1ENF A;  2W82 A;  2IGG A;  3IT6 B;  4US9 A;  4DXG A;  2QIE B;  2RPV A;  4A6Q A;  4KX6 B;  4C80 A;  2M56 B;  1VZ8 A;  3LXF A;  1JQ4 A;  2SEB D;  1VLB A;  1B9R A;  1KRH A;  2GB1 A;  3BZD B;  2N9K A;  1V1P A;  1ACC A;  2LJI A;  3VRB B;  3AM9 A;  1Y56 A;  5LNK 1;  3BYT B;  1N5X A;  2BYT A;  1I4P A;  3IT4 B;  1GB1 A;  1J7B A;  3WCQ A;  1DOI A;  2WXM A;  3AE3 B;  2X38 A;  1OQR A;  1TY0 A;  2QJL A;  1TKG A;  4MT5 A;  4YWG G;  3MFG A;  1E0Z A;  5EE1 A;  4RGT A;  4RCO A;  1QOF A;  2BBC A;  3T3N A;  1FCL A;  2Y5C A;  1YQ4 B;  3PZ8 A;  2G1E A;  4OZC A;  3BVM A;  1KFY B;  1QLB B;  2MH7 A;  2VZK B;  2AQ3 B;  2JZP A;  1NYQ A;  4P6V F;  1TJE A;  3HRD D;  2INN E;  3AN1 A;  3BK2 A;  1N62 A;  4DXF A;  1STE A;  4RGN A;  1ZUD 2;  1FRR A;  1JRO A;  1F2R C;  5EE9 A;  3Q8B A;  3P4R B;  2M19 A;  1R7S A;  3KQ4 A;  5AUK A;  1K53 A;  2LHD A;  3DWG C;  3GB1 A;  3LB8 C;  4OW0 A;  3AH7 A;  3P4S B;  1SBB B;  1D5X C;  2PLP A;  1SXT A;  3IAS 1;  4XDD A;  3KWL A;  3NRZ A;  4N59 A;  1GAQ B;  1V8C A;  1VRA B;  3FAH A;  4HKZ E;  3RFZ B;  1ZOY B;  1E6E B;  4YXD B;  1QQR A;  2N7J A;  3N9Y C;  1J7C A;  1HZ5 A;  1QIL A;  4JX1 C;  4LLG M;  4HEA 1;  1FFV A;  1FNV A;  5AUI A;  1FCC C;  4ZHO A;  5TSS A;  3BVG A;  2Q5W D;  1FO4 A;  1XO3 A;  1WXQ A;  1QT9 A;  4YSX B;  1H7W A;  1N61 A;  1MVK A;  1YJJ A;  2N0S B;  5FK9 C;  3FIL B;  3CIR B;  1GTH A;  2B76 B;  1WSP A;  1FIQ A;  2BW2 A;  1KH0 A;  3KLS X;  5E6J A;  1MHX A;  3AE5 B;  3TEX A;  3W9C B;  2QMT A;  2IGD A;  2WXK A;  1K50 A;  5HFY A;  4JE3 B;  1CZP A;  1SJE D;  1V97 A;  1E9M A;  1LO5 D;  1JWB D;  4WAF A;  1TY2 A;  2J52 A;  3Q8E A;  4ZYS A;  5BMI A;  1GTE A;  2WXR A;  4RGO S;  1HQR D;  1CJE A;  2IPK D;  2LFI A;  3AB5 A;  3FC4 A;  2FUG 1;  3NUH B;  5D7G A;  1ZPS A;  1ZXI A;  1PFD A;  2M0A A;  3EGR A;  1PYW D;  2WXJ A;  4NZL B;  5BYS A;  1FRD A;  1SE4 A;  2WXH A;  4IDI A;  2V0G A;  3AE2 B;  1C78 A;  1TS2 A;  3BK1 A;  1KLU D;  1BXT A;  2LEK A;  4N58 A;  3Q8C A;  2PW9 A;  1MI0 A;  2K22 A;  1MPE A;  2L32 A;  4N6E B;  4YTP B;  3LYY A;  4KGS A;  1ZDX A;  1HEZ E;  1VZ7 A;  2H89 B;  1F77 A;  3AMZ A;  4LK0 M;  2I2Y A;  2QIL A;  4OZB A;  4TSS A;  1K51 A;  1NVI D;  4OZA A;  4EE2 A;  1OFF A;  4Q2J A;  4YTM B;  3W5V B;  1JWA D;  2LGI A;  2JU6 X;  4A8X C;  1P7F A;  5JXV A;  3W5U B;  1XLP A;  3I57 A;  1DOY A;  3NVV A;  3IXS A;  1L5P A;  1F2R I;  2EKI A;  3BWU D;  1E7P B;  2INP E;  1EWC A;  3EA6 A;  4TQ0 A;  1XLQ A;  2WDV B;  2IDY A;  4WH4 A;  4DQO C;  2PVO D;  3BVZ A;  1T3Q A;  4US8 A;  2CU3 A;  1KLG D;  5BMG A;  1JWU D;  5FR3 A;  1ZP0 B;  2WU2 B;  2W3R A;  1NEK B;  2LHE A;  1EM7 A;  4D2K A;  2BB6 A;  4L1B A;  1L4D B;  2CJN A;  1XLO A;  2L52 A;  2N9L A;  1ZDV A;  2PKO A;  4C7Z A;  4YTN B;  1VZ6 A;  1UGJ A;  1SF0 A;  2EEL A;  3PZ7 A;  1IBX A;  4NJC A;  2BTE A;  1JWS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...