1KF6B

E. coli quinol-fumarate reductase with bound inhibitor hqno
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
total genus 73
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kf6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kf6B01
3B9JA 3CF4A 2DWQA 3PO0A 1T3QA 3AE2B 1NYQA 5H92C 2WLBA 2EKIA 1JW9D 3AE1B 1ZUD2 3SR6A 3P1MA 2WDRB 1VJKA 1L0VB 3B2GA 1JRPA 1N63A 1CZPA 5C2TB 3FAHA 4YTMB 3CIRB 3VR9B 1JROA 2MJDA 3VRAB 1J7CA 1RFKA 3BIID 1QF6A 1E7PB 1JWAD 3AM9A 1L6UA 5H8YE 4C7ZA 1YJJA 1QOFA 1WXQA 3W9CB 3W5UB 2WS3B 1OQRA 3HUIA 3AH7A 5MPOA 3VRBB 3AMZA 1N61A 1FM0D 1E9MA 4ITKA 2K22A 2W3RA 4WQMA 4YT0B 1NVID 1SB3C 2PIAA 2B76B 5EE0A 1V8CA 1B9RA 1FRRA 1PFDA 2H88B 1QOBA 3DWMA 4JWSC 1NENB 1WYGA 4JWUC 3HRDD 1KF6B 1JWBD 1TKGA 1V97A 3ABVB 2W54A 3NVZA 1F0ZA 1XLPA 1FFUA 1FFVA 2M56B 3P4PB 1KFYB 4YSXB 1DGJA 3AN1A 2M19A 4P6VF 4US9A 1N5WA 2JQRB 1YQ4B 2KAJA 1N62A 3L4PA 1IUEA 1AWDA 4YSYB 3FC4A 5G5HA 1GTEA 1FO4A 3HVZA 1QOGA 4A9AA 3AE4B 1RYJA 4KX6B 1OQQA 2LEKA 2W55A 4N6EB 1DOYA 1QT9A 3W5VB 3AEAB 1JQ4A 4JX1C 3KWLA 1ROEA 1GTHA 4YTPB 3EUB2 1VLBA 2WU5B 2Y5CA 1VDVA 2CJNA 3NVWA 3AV8A 1ZP0B 1RM6C 1RWSA 1QLBB 1J7AA 1SF0A 3VR8B 4FXCA 4USAA 5GXGB 3ZYYX 2BS4B 4ZHPA 3WCQA 1GT8A 2QIEB 2MJEA 1WWTA 4WWMA 2K9XA 1FIQA 1UWMA 1L5PA 3P63A 1E0ZA 2PVGC 2H89B 3AE8B 2WQYB 3SFEB 2WDQB 1OFFA 2G1EA 3DWGC 1FXIA 1J7BA 2HTME 5EE9A 1NI3A 1A70A 1GAQB 1SIJA 1NEKB 2WP9B 2N0SB 3NVVA 3AE6B 3SFDB 1I7HA 1YJIA 1NYRA 4HROA 3AECB 3P4RB 3AE3B 3AE7B 1KRHA 1TYGB 1WGKA 1FXAA 1TJEA 1TKEA 2Q5WD 1L6VA 3AEFB 1N60A 3LXFA 2BS3B 1AYFA 4N59A 4N58A 1JALA 5C3JB 1QOAA 5AUKA 1DOXA 2MJ3A 2KMMA 2WDVB 5EE1A 4C7YA 1ZXIA 1TKYA 2PVOD 2FBWB 2OHFA 3P4SB 5EE3A 1FMAD 1WRIA 4LTUA 1EWYC 4YTNB 4ZOHC 5G5GA 1H7XA 3NVYA 5AUIA 2L52A 1PDXA 3AEDB 1CJEA 2PKOA 2AX5A 2JX5A 2QJLA 1XLQA 3NS1A 1XLNA 2ACZB 1DOIA 4ZHOA 2E3TA 3AE5B 2W3SA 3AEEB 1YQ3B 1GPXA 1H7WA 3ETRA 2BS2B 3B2FA 1E6EB 1ZOYB 3P4QB 4YSZB 2WU2B 3AEBB 2MH7A 3CWIA 1PUTA 1N5XA 4US8A 2BT6A 1R7SA 2CJOA 1XLOA 2L83A 1FRDA 3AE9B 4HRSA 2DBYA 3AEGB 3RPFC 3NRZA 1XO3A 2CU3A 2K5PA 3AB5A 1E10A 4YXDB 3LB8C 4IDIA 4C80A
chains in the Genus database with same CATH superfamily
1ZW7A 2O2VA 1E5WA 4PS8A 4ANUA 3Q8CA 2WXHA 4C4VA 2ZNVB 4K7WA 4MGZE 1VJKA 3B2GA 1CZPA 3FAHA 2NTTA 2BYTA 3AU4A 3R66C 3M95A 5H8YE 3Q14C 3ZW3A 1QILA 1PGXA 5MPOA 4WIPA 3C8YA 3PVLA 4OVVA 1E90A 2INNE 3HRDD 3RD2A 4F8CB 1C1YB 2M1MA 5E6OA 2JSVX 2JQRB 3ZDMC 1M4VA 3DHGC 2TSSA 1I4QA 3RNBC 1RYJA 1LFDA 1KJTA 1VLBA 4A20A 1P0RA 4HK2A 3JW0X 1HXYD 1EF5A 1T6BX 4RGTA 3K9PB 4BAXA 3PLUA 3JSVB 3NZ3A 2N0SB 2SAKA 4JE3B 4KKIA 4OW0A 3AE6B 1ZE3D 1CQVA 2BQQA 3BYYB 1L0YB 1JALA 1TS5A 2KWVB 3EA6A 3N20C 3WA0A 2DZJA 3T8MA 4BKSD 1PDXA 3ZNHB 3BZDB 3DBHI 4ZRQA 2YLMA 1Q1OA 1Y8RC 1TT5B 2ZPYA 4M00A 4FJZA 2Z8LA 2D3GA 2KDMA 2CU3A 5IAAC 3LB8C 1I4PA 4YL8A 2UU7A 4GDLB 4RGOS 2KWCA 1C3TA 1WXAA 3AE1B 1F2RI 1QKZA 5T8IA 4RF0A 1UNSA 1TY0A 5TSSA 3W2DA 2Y5BB 2M8SA 2DYMA 1WXQA 3I5JC 2K22A 1XCTL 1VZ7A 3NY5A 4OZAA 3DWMA 1WF9A 1L7YA 5BMIA 4XYCA 4P1CC 4WWNA 4ZRIA 1KM7A 1GTEA 4NQKE 2LEKA 2CKHB 4CQNA 3L0WB 3NVWA 3B08A 3KUZA 2LXAA 1SF0A 4FULA 3ZYYX 4ZYNA 4A90A 3IXSA 2MCNB 3ZNZB 1FIQA 3P63A 3GOEA 1YIWA 3U30A 3B1LX 4G0NB 3IFWB 4FHJA 1ZDXA 2KD0A 4M8NA 4S0RA 1LM8B 2MBEA 2LFIA 3N3KB 3OJ4B 1H7XA 1STEA 4HPPA 2N1VA 2ACZB 3RZWC 2W3SA 1LO5D 3ONSA 2JXTA 3I9V1 1I4XA 3VFKA 3MC9A 1PYWD 4MJSA 4M01A 4BKGA 4BOZB 1FNVA 1K51A 2Z0DB 4IDIA 2G9HD 4WH4A 1T0QC 2EKIA 2LJIA 3O65B 4DDID 2KTRB 3HHMA 3Q2AC 1V9JA 2FCNA 4YTMB 2DZKA 1PGAA 1YQBA 3NOBA 1CMXB 2CHXA 2LVOA 1FM0D 1E9MA 2OOBB 4ZRPA 1C76A 3ZXRA 3BWUD 2MX2A 1GJZA 5JZEB 1FFVA 3RCZA 3FILB 4YSXB 4KGSA 3W1SA 2GBRA 1SXTA 2J42A 1GG3A 1YX6B 1IUEA 2LASA 1V5OA 3VAWA 5IKCM 2W55A 4XZ4A 3KWLA 2KC2A 4JGHB 2V1YA 2JY6A 3A1QA 4GDKB 1RM6C 1RWSA 1WGRA 3R2IA 1L4DB 3R7QA 4EE2A 1D5MC 3DOWA 2V3NA 1ZKHA 5FR6A 4ACFA 4W9IA 1KTKA 5EE9A 1A70A 2M0AA 3ECIA 3NVVA 2YVCA 4X57B 3P4RB 2N7DA 5TR5A 4ICUA 2ZVNA 3AXCA 3L08A 2M0XA 2BS3B 2PPHA 4IOIE 4N59A 2ASQA 2KN4A 3VDZA 1E8WA 4OVUA 1WRIA 3FKYA 4G3XB 3A4SC 3IT6B 3KQ4A 3MC8A 1L0XB 3AEEB 2FNJB 2ZJDA 3DVGX 3WALA 1JWMD 3EECA 3Q3OC 4ICVA 2BKRB 2WXPA 1LGRA 2NBWB 1IBXB 4ANVA 2O6VD 3NRZA 5J17A 1D5XC 2NBUA 1WR1A 2L8JA 4KZCA 4Q2JA 4A3PA 2V3PA 1JW9D 2WDRB 2WXMA 4J3OD 2J7QB 2FAZA 3QAQA 4RNAA 1QF6A 3OAWA 3DBSA 3DBLI 2ICIA 2VH1A 2MEKA 1QOFA 4HLEA 2LHDA 4KDIC 3AMZA 4WAFA 3TIXA 1GB1A 2JYTA 4OVZA 4HKQA 2NS5A 2WXIA 1GNUA 3U52E 3APDA 4REZA 5CHFA 4PYUA 2GBMA 1N5WA 5L83A 1XEEA 2UYZB 1EF1A 3HVZA 1I42A 3AE4B 1ROEA 3JSVA 5DPRA 3V62A 3IAS1 1RAXA 3GE8C 2ZW1A 4CYEA 1V80A 2WNMA 4FXCA 1WR6E 3ML8A 1C9FA 4C56C 2ZEQA 2K8HA 2QIEB 1M94A 4FADA 2DX5B 3RNAC 1GC6A 1L5PA 3E56A 2AQ2B 3SFDB 2GBNA 1UBIA 3AE7B 1TYGB 1TJEA 4MGKE 3AEFB 4N58A 2LJ5A 5EE1A 1I4RA 3TEWA 2J0JA 3VQIA 2KT7A 4LTUA 3O13A 2KYWA 2WX1A 1HZ6A 3V60A 3ZKJC 4DK5A 2L52A 3X0WA 2QJLA 1EO6A 1WX8A 4ZRJA 1WGDA 5AEKB 1JRUA 2J53A 3AEBB 4C4VB 1N6ZA 2FCQA 1WM3A 2N4FA 2L32A 2Y5PA 2O2VB 2D07B 2WDTB 4W9CA 2NCNA 4YXDB 1WFYA 2HJ1A 3QIJA 2RDBC 3SR6A 2JPHA 1TIFA 3PPAA 2Z59B 1WSPA 4FJVB 4GOCA 2L00B 4MELA 3VRAB 4OHJA 1RFKA 2LI5A 2BYFA 3VRBB 4IKGA 4WQMA 2MW5A 3A9KA 4DXGA 3ABVB 2M56B 4II2B 1J8CA 3RZFA 5BO4B 2IGHA 1YQ4B 3VVWB 5AZFA 1SE9A 3QA8A 3QJZA 3L17A 2INPE 4LNFA 1MI0A 2CJNA 4GIVA 3AV8A 2WXFA 1WXVA 3PREA 4W9HA 3Q8AA 5HG2A 1A5RA 4FHKA 4WJNA 3N9YC 1E0ZA 4K7SA 4XWTA 4W9GA 3QC8B 3U2SC 3UINB 1OGWA 4GGQA 5JH5C 1SIJA 4O1NA 2LGDA 3ZJVA 4MGIE 1IGDA 3U7ZA 4HVBA 3RNGC 4MACA 1FCLA 2JWUA 1C77A 2W82A 3N30A 3DVNV 3AEDB 2L3ZA 4IUMB 3NS1A 4YWGG 2A5UA 2KFJA 3ETRA 2ZNVC 1HTOA 3H7SA 2LVQA 2C5LC 2GBKA 3APCA 1T0SC 4TKNA 3IG3A 3H6NA 2D2QA 3IT4B 4DHJD 1C4PA 2LGXA 4NAWA 2DYBA 2JWZA 2WLBA 2C7HA 5BMHA 1HA5A 3RULA 1JRPA 1N63A 2J0MA 3BK2A 2R61A 1E7PB 2KJ6A 3AM9A 2IO1B 2WS3B 2KDEB 3PLVA 5HFYA 4YT0B 1NDDA 3RI7C 2JYEA 2NTSA 4K81A 1JWBD 3GZNI 1KFYB 2EMTA 3I57A 4US9A 1N62A 1WJ6A 4KGRA 2LGSA 1SSNA 2LXCA 1LQBA 1V81A 2WXJA 4DHZB 2WU5B 3PS6A 3DBHB 3ZIMA 5KHQA 1J0GA 3TUOA 1YD8U 4K1RB 4KIKB 3IVFA 2WXQA 3APFA 1GT8A 2MJEA 2KWUB 3DCGA 2L7RA 3URYA 2YEPF 3T3NA 2BYEA 4NPNA 2K3UA 4PK1A 2LWPA 4IWPA 4MSMB 2MBBB 1GAQB 3RN9C 1HEZE 4I6PA 1C79A 1FXAA 4PYZA 2D3CA 4JPSA 2LGYA 1QOAA 3BK1A 3DVGY 5FR3A 1HZ5A 2PEAA 4LNIA 1UGMA 4ZOHC 2XBBC 3DPDA 3KWVA 4IM0A 4CHKA 1AARA 1XLNA 1D6EC 4WWOA 1E6EB 2PE6B 1WJNA 5J2RA 3A9KB 3CWIA 2CJOA 2IPKD 1XLOA 4HRSA 1YN3A 1F9JA 5JXVA 2KZRA 3DVNU 4WJQA 3PZ8A 2FCSA 2KX0A 4ASWC 2WX0A 3P1MA 4K3CA 4GN1A 4WWPA 3ZRCA 3DBRB 4IW0A 4MH0E 3EGRA 3RMKC 1SE3A 1Q10A 1YN5A 4IM3A 2AQ3B 1MHHE 3R7RA 1NVID 5D6JB 5JHAA 1V1PB 4JWSC 1KF6B 2QSDA 1IP9A 2MWSB 4BOSC 3HIZA 1Z2MA 4LJOB 3MHSD 1P98A 5G55A 4P6VF 4CO7A 1VD2A 5CHWA 3ZTCA 4YSYB 3ZQ4A 1QOGA 4DXAB 2AWTA 3PRPB 4P7IA 1XCQL 2Y5CA 4TUUA 1VDVA 4W9FA 3UF8A 1QQRA 2AL3A 1D5ZC 3GB1A 4EFOA 2OJWA 1WWTA 3ALBA 4A8XC 2GBJA 4RCOA 3NJTA 1NBFC 1AW7A 2HTME 2DZMA 3SD5A 3CF6E 1WGKA 1XXGA 1EM7A 3R8BA 1AYFA 2OJRA 2BF8B 5CHVC 2C7NB 2KLGA 2N7EA 4A55A 3UIPB 1WX9A 2O6VA 2JX5A 3GP7A 2JVCA 3Q3FA 1P7FA 3P4QB 3TSSA 2EKEC 3V6CB 2MHJA 2IBIB 2JUOA 2D10A 1WH3A 5E6PA 2KDFB 3A4RA 2L83A 2DBYA 1E8XA 1I4HA 4E74A 4NJ6A 5GMVA 2K5PA 4GB9A 4LLGM 1V86A 3ZNGC 3V6EB 5L95C 2K8CA 1TBEA 2QC8A 1WXMA 3AE2B 3WAMA 1BT0A 2XK5B 5LXHA 3EHVA 4M0WB 5IA7A 3VTVA 4AP4C 3BIID 2V4LA 1TY2A 4KKJA 1OQRA 4ZRKA 1CK1A 4K7UA 5EE0A 2BVCA 2H88B 4W9JA 2ONQA 4B0MA 1LXDA 2GI9A 1C4AA 4A9AA 2GB1A 4NQLB 4URKA 2K6DB 4LNOA 1Q5WB 2WXKA 4KGTA 2N1WA 1OEYJ 5DPWA 1UZXB 2WDQB 1OFFA 2V9HA 4NJ7A 1WE6A 1NI3A 3BVGA 2WP9B 1E7UA 4LNKA 1YJIA 4MT5A 1TS3A 3AECB 3AE3B 2V4IB 4HJKA 3BINA 1MJDA 1N60A 1UELA 1V5TA 2BW2A 3PT2B 3A1QB 2WDVB 4C7YA 1ZXIA 1WX7A 2MSED 1IGCA 3QARA 2KVZA 3RNFC 3KYDD 4XGAB 4IWQA 2ZW0A 4NZLB 1V6EA 5D7GA 4DBGA 4W9LA 2D5GA 1UBQA 1R4MB 4L1BA 1Z5SB 3RNEC 1VZ6A 3PGEA 4NAMA 2RSUA 1YOVB 2K25A 2MP2B 3RPFC 5I4DA 3TEYA 2FUHB 4HEA1 2RDHA 3B9JA 2QEJC 4XWWA 2DZIA 2X8XX 3N32A 5LLIA 1NYQA 3HM6X 2KTRA 3N1XC 1F77A 2IJ0A 1YX5B 1I4GA 1JWUD 1RRBA 3UGBB 4C7ZA 2RD0A 2KFKB 3EFUA 4ITKA 2W3RA 3T9LA 1B1ZA 4ANXA 1FRRA 4PS7A 2I1JA 3NVZA 2I38A 3UI3A 4ARCA 1DGJA 2NVUI 2KAJA 3MFGA 1UGJA 1FO4A 1L2NA 4KX6B 3ZNID 2JZ3B 2J4XA 2LRWA 3W5VB 3K9OB 4JX1C 2DLBA 3LJ3A 2KMCA 2LRUA 2WXNA 4EKUA 2IGGA 1HE8A 2M4NA 2E6XA 3PZDA 2G4SA 1TZOA 1EWCA 3WAPA 2N7JA 4WWMA 1P3QU 2N9XA 1XT9B 3AE8B 1KLUD 4HKZE 3AULA 4EOYA 2KWDA 2JT4B 2W9NA 3SDLC 4XE0A 2A4ZA 1TKYA 4HPLB 1FXTB 4AQ7A 5IOIA 3P4SB 4GDKA 2XEWA 4YTNB 3NS8A 4K3BA 3ZUNA 3DDCB 1XF5L 2M17A 4ZHOA 1IPGA 2DAFA 1JWSD 1WI0A 3PHWB 3FILA 1PUTA 3ZLZA 1GC7A 3V3XA 1UUPA 3TJPA 1D3ZA 3KUCB 3M3JA 2KDBA 1JCKB 3AB5A 1E10A 2OEDA 2BBCA 1MVKA 3I63C 1WZ3A 2WXGA 3CSFA 2FIFA 3DBRI 2KACA 4GDLA 3L16A 2BB5A 1U4AA 3H1UA 3RUIB 1YJJA 3R3MA 4WURA 4MM3B 2AYOB 1PGBA 2C60A 1YN4A 3NG0A 4S17A 3W1YA 2G4DB 2PIAA 4FJYA 2AEHA 1WIAA 4XDDA 3PZ7A 1YNTE 4MJSB 4JLCA 1S3SG 3L4PA 3Q6BA 1HTQA 4OZBA 4BVUC 1SEBD 3Q8FA 2DENB 1SE2A 1EUVB 3ZDTA 4HDOA 3DBLB 3DHIC 2VRRB 2IYDB 3VR8B 5GXGB 2BS4B 3WCQA 3L54A 2MBQA 2DAJA 1SBBB 1VZ8A 2SEBD 3DWGC 4BFRA 3OWEB 1E8ZA 3J9CA 4WAAA 4RH6A 3RFZB 3LXFA 2LVPA 3NZSA 1DOXA 2JRIB 2L1AA 1QZEA 3WIMA 3C19A 4TSSA 2IY1B 2QDFA 4B9KA 4TV3A 4YSZB 4BBNF 2WYQA 4RGNA 2LZ6A 1XO3A 5HHDG 1GUAB 2N9KA 1F1HA 3TMPB 3PO0A 1R4MI 3N1YC 2KK8A 5IP4D 4LCDE 4F1SA 5C2TB 4KV2A 4W9KA 3VR9B 1JROA 4OZCA 3H9DA 1YJ1A 3ZXVA 2X38A 3MTNB 2MRPA 3S2AA 4FBJB 2HJ8A 1R4NI 1B9RA 1OTRB 2KQ7A 2PW9A 4JWUC 1V97A 2JU6X 4GLSC 2XK5A 3H8HA 2MBOA 4E3CA 1XD3B 1AWDA 2RMMA 4LNNA 1E8YA 3HM3A 1R4NB 1ZP0B 3LDZE 4A3OA 1F2RC 4P1BC 5G2NA 1G6JA 2L0FA 4TMAB 4RM9A 1SJED 3ZO5B 3C0RB 2H89B 4MGYE 2QILA 3WAOA 1J7BA 2O6VB 1V1OA 1NYRA 2IDYA 3QWZB 2JZPA 1XQQA 2PJHA 2BTEA 4ZYSA 1WJUA 5AUKA 2KQ4X 3DHHC 2KX3A 1EWYC 3NZUA 3U4EG 4MM3A 4LJPB 4RM8A 3MJ5A 2VZKB 3P2BA 2LD9A 4GMVA 2AX5A 5FK9C 3OG5A 3PV1A 3B2FA 1EU4A 3PRMB 3A33B 4KDLB 1C78A 1P9DU 3TL5A 3AEGB 2WXLA 1H8CA 3SU8X 2K0PA 1FCCC 4KSKC 1WY8A 3CF4A 2L05A 3VUWA 2GMIC 4J6IA 1T5XD 1ACCA 3VH3B 5IN7A 1BUIC 1SJHD 2KDIA 2ZCBA 3VUXA 3ZJTA 2GLSA 3CIRB 4DXFA 5CX3A 3ZVVA 3ZJUA 4I6LB 1VR9A 4AJWA 3OJ3A 4AUQC 1FFUA 3U8ZA 1ZDVA 2HTHA 4HCNB 4C00A 4NJCA 2FCMA 4B0EA 2CR5A 4ARIA 1DOYA 2RGFA 1KOTA 1QT9A 3MHZA 4WJOA 2BWES 1TZ1A 1UF0A 1FD6A 1VRAB 5D3DA 2PE9A 1J7AA 1TGZB 5LNK1 1F52A 2ZVOA 2NBVB 2BYVE 3MJWA 2VZKD 1PQSA 2KQSA 5BYSA 3UIOB 2I2YA 1ZPSA 4QAYA 4IC7B 1RFAA 1ENFA 2PVGC 4KZ0A 2G1EA 1FXIA 1ESFA 1NEKB 2KC1A 5AZGA 3N1ZC 1L6VA 2C7MB 2IGDA 5D2MB 2RDGA 4MSQB 2PVOD 2EELA 2KFKA 4FN2A 1WRDB 5EE3A 2NR2A 4BKTA 3T3OA 1IYFA 2GRIA 4EEWA 2PTLA 1DOIA 3UQBA 4JQWC 4IWOA 3VHTC 1WGHA 2MH7A 4A6QA 1N5XA 2LGIA 3H7PB 3IHPC 1MPEA 2K8BA 2CHWA 1FRDA 3AE9B 4II3B 3MP9A 3DQVA 2KJRA 4RF1A 2MP2A 1Q0WB 3HK0A 4DHJB 1ZUD2 4I6NB 2CS4A 2QHOA 2R2QA 3RYTA 1L0VB 4F7ZA 5J18A 4PT5A 1GB4A 2G3QB 1WMHA 3HUIA 3Q8BA 1N61A 1WE7A 4XX5A 1UWXA 2K1FA 2KOXA 1WYGA 2RPVA 3GZNB 4W9EA 2ZPNA 3P4PB 4BZAA 2IO3B 4L2YA 1SGHA 1J19A 1MG4A 2BWFA 1JQ4A 1GTHA 5C1ZA 2FUG1 3Q3MC 3QQ8B 2BGFA 4USAA 4HWIB 5DPSA 1GOZA 4ZDVA 3KW5B 1UWMA 1YMHE 3A9JB 1ET6A 2MQJA 1I7HA 2PLPA 1KRHA 4B6WA 1E7VA 3TBLD 3NUHB 2C9WB 4DHZE 2JRHA 5C3JB 2KMMA 2V3SA 2OHFA 4G11A 3GE3C 1ISNA 2AQ1B 5AUIA 2PKOA 3KUDB 3AE5B 3B0AA 4M0WA 2LMCA 2Y3AA 3Q3NC 1AN8A 2J0KA 4DQOC 1ZGUB 2REXA 4GXBA 3BY4B 3GS2A 2DWQA 5H92C 3BVMA 2NPTB 2NMQA 3UQAA 2IO2B 4AS1A 4ANWA 1WZ0A 2K6QA 2MJDA 1J7CA 2IZVB 1OEYA 5EDSA 1JWAD 2ZZPB 4NNJB 3VXWA 1X1MA 2WGSA 2KVRA 3AH7A 3AI5A 4TQ0A 4EUTA 2B76B 4DWFA 1QOBA 1NENB 3KH0A 3PSEB 2W54A 3TCAA 2G45B 2HDEA 3QK0A 2M19A 1WYWB 4HJGE 4EZKA 4XDCA 1K53A 5E6JA 3EC8A 5BMGA 3SHQA 4ZHPA 2RPQA 3L13A 3ML9A 1WJ4A 3JVZX 3M62B 2L0TA 2PMVA 2IO0B 4XC2A 2L76A 3IBEA 2WWZA 4HROA 2KANA 5LXIB 1FEHA 2FE8A 1TKEA 4D2KA 1KLGD 4FLHA 1V1PA 3OLMD 3KYCD 1FNWA 4UDUC 1BXTA 2KMAA 5G5GA 2Z0EB 5D3IB 1NI2A 1CJEA 1I35A 5HI1A 3ZTDA 4HDQA 1YQ3B 1DYQA 1H7WA 4MDKE 1S1QB 1WXSA 2CU1A 4N9F4 3PRZA 4NY0A 4R3DA 5FKAC 4AJYB 4M02A 2B3AA 2BT6A 1FNUA 2HE7A 3I3TB 4M8MA 4C80A 4LDTB 2ZCCA 4RMAA 4RGMA 3U7DA 3L10B 2KNBA 2D3AA 2VH2A 2KO3A 4W9DA 5HKHA 2NPTA 1MFWA 4HXDA 3RT3B 3R2TA 4WQOB 3RNCC 2N9PC 4H2AA 3W5UB 1T0YA 3HVDA 1MG8A 1HQRD 2D3BA 1SB3C 2HD5B 3H7PA 1MHXA 2KN5A 4IG7B 1TS2A 1PFDA 3KLSX 1XLPA 5C23A 2MA9B 1TTNA 2CHZA 3FC4A 5G5HA 1TS4A 2LUEA 4N6EB 2JZZA 2LUMA 3MC0B 4DDGD 4YTPB 4BKSA 3ZRFA 1QLBB 3PTFC 2V0GA 4KIKA 1KLVA 2IY0B 1IBXA 2K39A 2QMTA 4MEMA 5KHOA 1SE4A 2K9XA 3NHEB 1JMLA 4BBNC 1VCBA 5DPTA 2FIDA 4B95A 3Q8EA 3QCAA 1WGGA 1H4RA 3A9JA 4GSWA 3CSTA 2MLBA 4HCPB 2LHEA 4L23A 1P1AA 3VH4B 1UH6A 1V49A 2WHIA 3IAM1 5BYQA 1WM2A 5JHBA 2INDC 1K52A 1FMAD 4JIOU 1V2YA 3JYUA 2WXRA 2E3TA 3VTWA 1FPYA 4P16A 2BS2B 1ZOYB 3ZGZA 4WJPA 1T0RC 3ENEA 4E71A 1D4BA 1R7SA 2YEPB 4NAWB 3BYTB 2BPSA 2KKCA 2QCZA 2AL6A 2J52A 2KLCA 1WMHB 1T3QA 3Q69A 2RR9A 4IM2A 2JXXA 3M63B 3D32A 2DYOA 3V61A 3VTUA 2BB6A 1K50A 3X23A 1K8RB 3SEBA 1ET9A 1Y56A 1L4ZB 1OQYA 1L6UA 2KJHB 4EZLA 3TEZA 3P42A 3W9CB 3LYYA 3KVFB 1C4CA 1V8CA 2DNFA 1BMLC 1TKGA 3CMMB 1RLFA 5BYRA 2UWQA 2KHWB 2KXJA 1F0ZA 4GU2A 4LK0M 3AN1A 3BVZA 1SIFA 5E6NA 1EU3A 3E9SA 3EFCA 4HPMB 1OQQA 1P7EA 2D11A 3WANA 1UD7A 3AEAB 4EZJA 3EUB2 2XN9C 5DCNA 2EMSA 4KVGB 2GOWA 4MH8A 4RFBA 5CTRC 2N9LA 2DHZA 4PS3A 3QX1A 5AZHA 2WQYB 3SFEB 1WGYA 2JF5A 2I1KA 3V05A 5D94A 2Q5WD 2INCC 4AWJA 3QHTA 2BKFA 2MJ3A 1ZXHA 4JL9A 2FBWB 4G50A 3PHXB 2MBHA 2WXOA 2XNAC 3NVYA 3VUYA 1KH0A 4LDTD 1XLQA 2KTFA 2ON8A 3W1SC 1GPXA 2R2OA 2N9EB 3TEXA 4KSLC 2WU2B 4AOFA 4FA6A 3AU5A 4TQ1A 5IO9A 3Q3JA 4US8A
chains in the Genus database with same CATH topology
3B9JA 2QEJC 4XWWA 4RF1A 3Q8CA 1NYQA 2WXHA 1ZUD2 3SR6A 1F77A 2IJ0A 1VJKA 1L0VB 3B2GA 1CZPA 3FAHA 2NTTA 1WSPA 2BYTA 4PT5A 3VRAB 4OHJA 1RFKA 1I4GA 1GB4A 1JWUD 5H8YE 4C7ZA 1QILA 3HUIA 1PGXA 5MPOA 3VRBB 3Q8BA 4WIPA 4IKGA 1N61A 4ITKA 4WQMA 2W3RA 1B1ZA 1UWXA 3C8YA 1FRRA 2INNE 1WYGA 2RPVA 3HRDD 4DXGA 3ABVB 3NVZA 2M56B 2I38A 3UI3A 3P4PB 4ARCA 1DGJA 2IGHA 2JQRB 1YQ4B 2JSVX 2KAJA 3MFGA 4L2YA 1M4VA 1UGJA 2TSSA 1I4QA 1FO4A 1RYJA 4KX6B 2J4XA 3W5VB 1JQ4A 4JX1C 2INPE 2DLBA 1GTHA 1MI0A 1VLBA 2WXNA 2CJNA 2FUG1 3AV8A 2IGGA 2WXFA 4USAA 1HXYD 2E6XA 3Q8AA 5HG2A 1GOZA 1TZOA 1EWCA 1T6BX 4RGTA 2N7JA 4WWMA 3N9YC 1UWMA 1E0ZA 3NZ3A 3AE8B 1KLUD 4XWTA 3U2SC 4HKZE 1YMHE 1SIJA 1ET6A 2N0SB 2SAKA 4JE3B 4KKIA 4OW0A 3AE6B 1I7HA 2KWDA 1ZE3D 4O1NA 1CQVA 2PLPA 1KRHA 3ZJVA 3NUHB 3BYYB 4XE0A 1L0YB 1IGDA 1JALA 5C3JB 1TS5A 3U7ZA 2KMMA 1TKYA 3EA6A 2OHFA 4MACA 2JWUA 4AQ7A 1FCLA 3P4SB 1C77A 2W82A 4YTNB 2AQ1B 5AUIA 1PDXA 3AEDB 2PKOA 1XF5L 3NS1A 4YWGG 4ZHOA 3AE5B 3BZDB 4ZRQA 3ETRA 4M0WA 2LMCA 2Y3AA 1JWSD 3FILA 1AN8A 1PUTA 3V3XA 1UUPA 4DQOC 2Z8LA 2KDMA 1JCKB 2CU3A 3AB5A 1E10A 3IT4B 3LB8C 1C4PA 1I4PA 2OEDA 3GS2A 2BBCA 2DWQA 1MVKA 4GDLB 4RGOS 2WXGA 5H92C 2WLBA 3AE1B 1F2RI 1QKZA 3BVMA 5T8IA 4RF0A 5BMHA 1HA5A 2KACA 2NMQA 1JRPA 1N63A 1UNSA 4AS1A 2MJDA 1TY0A 2R61A 1J7CA 3BK2A 5TSSA 2BB5A 3W2DA 1E7PB 1JWAD 3AM9A 2DYMA 1YJJA 1WXQA 4WURA 4MM3B 2WS3B 3AH7A 1PGBA 5HFYA 1YN4A 2K22A 1XCTL 4YT0B 4TQ0A 2PIAA 2B76B 2JYEA 1VZ7A 2NTSA 4OZAA 3DWMA 1QOBA 1NENB 1JWBD 4XDDA 2W54A 3PZ7A 1YNTE 2HDEA 5BMIA 1KFYB 3I57A 2M19A 4US9A 1N62A 3L4PA 4KGRA 4HJGE 1GTEA 1SSNA 4OZBA 4XDCA 1SEBD 3Q8FA 2LEKA 1SE2A 4CQNA 2WXJA 1K53A 2WU5B 3NVWA 5E6JA 3TUOA 1SF0A 5BMGA 3ZYYX 3VR8B 5GXGB 2BS4B 4A90A 2WXQA 4ZHPA 3WCQA 1GT8A 3IXSA 2MJEA 1SBBB 1FIQA 3URYA 1VZ8A 2YEPF 3P63A 2SEBD 3T3NA 3DWGC 2PMVA 2K3UA 3OWEB 1GAQB 1HEZE 3J9CA 4HROA 1C79A 1FEHA 2FE8A 1FXAA 1ZDXA 4RH6A 1TKEA 3RFZB 3LXFA 4D2KA 4JPSA 1KLGD 1QOAA 3BK1A 1DOXA 1V1PA 4UDUC 1FNWA 1BXTA 2L1AA 2LFIA 5FR3A 1HZ5A 4ZOHC 5G5GA 1H7XA 3KWVA 1STEA 4TSSA 5D3IB 1CJEA 5HI1A 1XLNA 2ACZB 1D6EC 2W3SA 1YQ3B 1DYQA 1H7WA 1LO5D 1E6EB 2JXTA 3I9V1 1I4XA 4R3DA 5FKAC 4YSZB 1PYWD 3CWIA 4RGNA 4US8A 2BT6A 2IPKD 2CJOA 1XLOA 4HRSA 1FNVA 1XO3A 1YN3A 1K51A 5HHDG 1FNUA 2N9KA 4IDIA 4C80A 5JXVA 3PO0A 2G9HD 3PZ8A 4WH4A 4RGMA 2EKIA 2LJIA 3P1MA 5C2TB 4YTMB 3VR9B 1JROA 3EGRA 3R2TA 4OZCA 2X38A 1SE3A 1PGAA 1Q10A 1YN5A 4H2AA 3W5UB 2AQ3B 1MHHE 3HVDA 1FM0D 1E9MA 1HQRD 1SB3C 1NVID 1MHXA 4ZRPA 1B9RA 1PFDA 1TS2A 1C76A 1V1PB 2PW9A 4JWSC 4JWUC 3KLSX 3BWUD 1KF6B 1V97A 2QSDA 1XLPA 1FFVA 2JU6X 3FILB 4YSXB 4GLSC 4KGSA 4P6VF 3W1SA 1SXTA 2J42A 3H8HA 1IUEA 1AWDA 4YSYB 3FC4A 5G5HA 3ZQ4A 1QOGA 1TS4A 2W55A 4N6EB 2RMMA 2LUMA 3KWLA 3MC0B 1XCQL 4YTPB 2Y5CA 1VDVA 1ZP0B 1RM6C 1RWSA 4GDKB 3R2IA 1F2RC 1QLBB 1QQRA 2V0GA 1L4DB 4EE2A 1D5ZC 3GB1A 1IBXA 2QMTA 1D5MC 4TMAB 1WWTA 1SJED 1SE4A 2K9XA 2V3NA 4A8XC 1JMLA 2H89B 4RCOA 2QILA 1KTKA 1AW7A 1J7BA 2HTME 5EE9A 1A70A 2M0AA 3Q8EA 3NVVA 1V1OA 1NYRA 2IDYA 1WGKA 3P4RB 2JZPA 1XXGA 2BTEA 1EM7A 3R8BA 2BS3B 1AYFA 4IOIE 4N59A 4ZYSA 2LHEA 5AUKA 4L23A 2KQ4X 2KN4A 5BYQA 3IAM1 1K52A 4A55A 1FMAD 1WRIA 1EWYC 3U4EG 3MJ5A 2VZKB 2AX5A 2JX5A 3IT6B 3KQ4A 5FK9C 1L0XB 2WXRA 2E3TA 3GP7A 3AEEB 1JWMD 1P7FA 2BS2B 3B2FA 4P16A 1ZOYB 3P4QB 3TSSA 3ZGZA 1EU4A 1C78A 2WXPA 1D4BA 1IBXB 1R7SA 2L83A 2YEPB 2DBYA 3AEGB 3BYTB 3NRZA 4NAWB 2WXLA 1I4HA 2K0PA 2K5PA 1FCCC 1D5XC 4LLGM 2J52A 3CF4A 4Q2JA 1T3QA 3AE2B 3Q69A 2V3PA 1JW9D 1T5XD 1ACCA 2DYOA 2WDRB 1BUIC 1SJHD 3ZJTA 2WXMA 4J3OD 3CIRB 1K50A 2BB6A 4DXFA 3SEBA 3BIID 4RNAA 1QF6A 1ET9A 1Y56A 1L4ZB 2ICIA 1TY2A 1L6UA 3TEZA 2MEKA 4KKJA 1QOFA 3P42A 3W9CB 3ZJUA 3LYYA 1OQRA 2LHDA 3AMZA 4WAFA 1GB1A 1C4CA 1CK1A 1VR9A 2JYTA 4OVZA 4HKQA 5EE0A 1V8CA 2H88B 2WXIA 1BMLC 1TKGA 3U52E 5BYRA 1F0ZA 1FFUA 1ZDVA 4LK0M 4REZA 3AN1A 3BVZA 1N5WA 2ONQA 4B0MA 4NJCA 4B0EA 1XEEA 1EU3A 2GI9A 1C4AA 3HVZA 3E9SA 4A9AA 3AE4B 4ARIA 2GB1A 1OQQA 1P7EA 1DOYA 1QT9A 3MHZA 3AEAB 1ROEA 3EUB2 2XN9C 1FD6A 3IAS1 2ZW1A 1VRAB 5D3DA 1J7AA 2WXKA 4FXCA 2WNMA 5LNK1 1C9FA 4MH8A 4C56C 4RFBA 4KGTA 2N9LA 2QIEB 2VZKD 5BYSA 2I2YA 1ZPSA 1L5PA 3E56A 1ENFA 2PVGC 2WQYB 3SFEB 2WDQB 1OFFA 2G1EA 1FXIA 1NI3A 3BVGA 1ESFA 1NEKB 2WP9B 3V05A 2AQ2B 3SFDB 1YJIA 4MT5A 1TS3A 3AECB 3AE3B 3AE7B 1TYGB 2V4IB 1TJEA 2Q5WD 1L6VA 3AEFB 1N60A 2IGDA 4N58A 2BW2A 2RDGA 2MJ3A 2WDVB 5EE1A 1ZXHA 1ZXIA 4C7YA 1I4RA 1IGCA 2FBWB 2PVOD 2EELA 3TEWA 5EE3A 3VQIA 4LTUA 3O13A 2ZW0A 2WXOA 2XNAC 1HZ6A 3NVYA 4NZLB 5D7GA 1KH0A 3T3OA 2L52A 2GRIA 2QJLA 1XLQA 2PTLA 1DOIA 2D5GA 2ON8A 1GPXA 4L1BA 1VZ6A 3TEXA 2WU2B 2J53A 3AEBB 2MH7A 4A6QA 1N5XA 2LGIA 4TQ1A 1MPEA 4NAMA 3RPFC 1FRDA 3AE9B 2L32A 2Y5PA 5I4DA 3TEYA 3MP9A 4YXDB 4HEA1 2RDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  3CF4 A;  2DWQ A;  3PO0 A;  1T3Q A;  3AE2 B;  1NYQ A;  5H92 C;  2WLB A;  2EKI A;  1JW9 D;  3AE1 B;  1ZUD 2;  3SR6 A;  3P1M A;  2WDR B;  1VJK A;  1L0V B;  3B2G A;  1JRP A;  1N63 A;  1CZP A;  5C2T B;  3FAH A;  4YTM B;  3CIR B;  3VR9 B;  1JRO A;  2MJD A;  3VRA B;  1J7C A;  1RFK A;  3BII D;  1QF6 A;  1E7P B;  1JWA D;  3AM9 A;  1L6U A;  5H8Y E;  4C7Z A;  1YJJ A;  1QOF A;  1WXQ A;  3W9C B;  3W5U B;  2WS3 B;  1OQR A;  3HUI A;  3AH7 A;  5MPO A;  3VRB B;  3AMZ A;  1N61 A;  1FM0 D;  1E9M A;  4ITK A;  2K22 A;  2W3R A;  4WQM A;  4YT0 B;  1NVI D;  1SB3 C;  2PIA A;  2B76 B;  5EE0 A;  1V8C A;  1B9R A;  1FRR A;  1PFD A;  2H88 B;  1QOB A;  3DWM A;  4JWS C;  1NEN B;  1WYG A;  4JWU C;  3HRD D;  1KF6 B;  1JWB D;  1TKG A;  1V97 A;  3ABV B;  2W54 A;  3NVZ A;  1F0Z A;  1XLP A;  1FFU A;  1FFV A;  2M56 B;  3P4P B;  1KFY B;  4YSX B;  1DGJ A;  3AN1 A;  2M19 A;  4P6V F;  4US9 A;  1N5W A;  2JQR B;  1YQ4 B;  2KAJ A;  1N62 A;  3L4P A;  1IUE A;  1AWD A;  4YSY B;  3FC4 A;  5G5H A;  1GTE A;  1FO4 A;  3HVZ A;  1QOG A;  4A9A A;  3AE4 B;  1RYJ A;  4KX6 B;  1OQQ A;  2LEK A;  2W55 A;  4N6E B;  1DOY A;  1QT9 A;  3W5V B;  3AEA B;  1JQ4 A;  4JX1 C;  3KWL A;  1ROE A;  1GTH A;  4YTP B;  3EUB 2;  1VLB A;  2WU5 B;  2Y5C A;  1VDV A;  2CJN A;  3NVW A;  3AV8 A;  1ZP0 B;  1RM6 C;  1RWS A;  1QLB B;  1J7A A;  1SF0 A;  3VR8 B;  4FXC A;  4USA A;  5GXG B;  3ZYY X;  2BS4 B;  4ZHP A;  3WCQ A;  1GT8 A;  2QIE B;  2MJE A;  1WWT A;  4WWM A;  2K9X A;  1FIQ A;  1UWM A;  1L5P A;  3P63 A;  1E0Z A;  2PVG C;  2H89 B;  3AE8 B;  2WQY B;  3SFE B;  2WDQ B;  1OFF A;  2G1E A;  3DWG C;  1FXI A;  1J7B A;  2HTM E;  5EE9 A;  1NI3 A;  1A70 A;  1GAQ B;  1SIJ A;  1NEK B;  2WP9 B;  2N0S B;  3NVV A;  3AE6 B;  3SFD B;  1I7H A;  1YJI A;  1NYR A;  4HRO A;  3AEC B;  3P4R B;  3AE3 B;  3AE7 B;  1KRH A;  1TYG B;  1WGK A;  1FXA A;  1TJE A;  1TKE A;  2Q5W D;  1L6V A;  3AEF B;  1N60 A;  3LXF A;  2BS3 B;  1AYF A;  4N59 A;  4N58 A;  1JAL A;  5C3J B;  1QOA A;  5AUK A;  1DOX A;  2MJ3 A;  2KMM A;  2WDV B;  5EE1 A;  4C7Y A;  1ZXI A;  1TKY A;  2PVO D;  2FBW B;  2OHF A;  3P4S B;  5EE3 A;  1FMA D;  1WRI A;  4LTU A;  1EWY C;  4YTN B;  4ZOH C;  5G5G A;  1H7X A;  3NVY A;  5AUI A;  2L52 A;  1PDX A;  3AED B;  1CJE A;  2PKO A;  2AX5 A;  2JX5 A;  2QJL A;  1XLQ A;  3NS1 A;  1XLN A;  2ACZ B;  1DOI A;  4ZHO A;  2E3T A;  3AE5 B;  2W3S A;  3AEE B;  1YQ3 B;  1GPX A;  1H7W A;  3ETR A;  2BS2 B;  3B2F A;  1E6E B;  1ZOY B;  3P4Q B;  4YSZ B;  2WU2 B;  3AEB B;  2MH7 A;  3CWI A;  1PUT A;  1N5X A;  4US8 A;  2BT6 A;  1R7S A;  2CJO A;  1XLO A;  2L83 A;  1FRD A;  3AE9 B;  4HRS A;  2DBY A;  3AEG B;  3RPF C;  3NRZ A;  1XO3 A;  2CU3 A;  2K5P A;  3AB5 A;  1E10 A;  4YXD B;  3LB8 C;  4IDI A;  4C80 A; 
#chains in the Genus database with same CATH topology
 1ZW7 A;  2O2V A;  1E5W A;  4PS8 A;  4ANU A;  3Q8C A;  2WXH A;  4C4V A;  2ZNV B;  4K7W A;  4MGZ E;  1VJK A;  3B2G A;  1CZP A;  3FAH A;  2NTT A;  2BYT A;  3AU4 A;  3R66 C;  3M95 A;  5H8Y E;  3Q14 C;  3ZW3 A;  1QIL A;  1PGX A;  5MPO A;  4WIP A;  3C8Y A;  3PVL A;  4OVV A;  1E90 A;  2INN E;  3HRD D;  3RD2 A;  4F8C B;  1C1Y B;  2M1M A;  5E6O A;  2JSV X;  2JQR B;  3ZDM C;  1M4V A;  3DHG C;  2TSS A;  1I4Q A;  3RNB C;  1RYJ A;  1LFD A;  1KJT A;  1VLB A;  4A20 A;  1P0R A;  4HK2 A;  3JW0 X;  1HXY D;  1EF5 A;  1T6B X;  4RGT A;  3K9P B;  4BAX A;  3PLU A;  3JSV B;  3NZ3 A;  2N0S B;  2SAK A;  4JE3 B;  4KKI A;  4OW0 A;  3AE6 B;  1ZE3 D;  1CQV A;  2BQQ A;  3BYY B;  1L0Y B;  1JAL A;  1TS5 A;  2KWV B;  3EA6 A;  3N20 C;  3WA0 A;  2DZJ A;  3T8M A;  4BKS D;  1PDX A;  3ZNH B;  3BZD B;  3DBH I;  4ZRQ A;  2YLM A;  1Q1O A;  1Y8R C;  1TT5 B;  2ZPY A;  4M00 A;  4FJZ A;  2Z8L A;  2D3G A;  2KDM A;  2CU3 A;  5IAA C;  3LB8 C;  1I4P A;  4YL8 A;  2UU7 A;  4GDL B;  4RGO S;  2KWC A;  1C3T A;  1WXA A;  3AE1 B;  1F2R I;  1QKZ A;  5T8I A;  4RF0 A;  1UNS A;  1TY0 A;  5TSS A;  3W2D A;  2Y5B B;  2M8S A;  2DYM A;  1WXQ A;  3I5J C;  2K22 A;  1XCT L;  1VZ7 A;  3NY5 A;  4OZA A;  3DWM A;  1WF9 A;  1L7Y A;  5BMI A;  4XYC A;  4P1C C;  4WWN A;  4ZRI A;  1KM7 A;  1GTE A;  4NQK E;  2LEK A;  2CKH B;  4CQN A;  3L0W B;  3NVW A;  3B08 A;  3KUZ A;  2LXA A;  1SF0 A;  4FUL A;  3ZYY X;  4ZYN A;  4A90 A;  3IXS A;  2MCN B;  3ZNZ B;  1FIQ A;  3P63 A;  3GOE A;  1YIW A;  3U30 A;  3B1L X;  4G0N B;  3IFW B;  4FHJ A;  1ZDX A;  2KD0 A;  4M8N A;  4S0R A;  1LM8 B;  2MBE A;  2LFI A;  3N3K B;  3OJ4 B;  1H7X A;  1STE A;  4HPP A;  2N1V A;  2ACZ B;  3RZW C;  2W3S A;  1LO5 D;  3ONS A;  2JXT A;  3I9V 1;  1I4X A;  3VFK A;  3MC9 A;  1PYW D;  4MJS A;  4M01 A;  4BKG A;  4BOZ B;  1FNV A;  1K51 A;  2Z0D B;  4IDI A;  2G9H D;  4WH4 A;  1T0Q C;  2EKI A;  2LJI A;  3O65 B;  4DDI D;  2KTR B;  3HHM A;  3Q2A C;  1V9J A;  2FCN A;  4YTM B;  2DZK A;  1PGA A;  1YQB A;  3NOB A;  1CMX B;  2CHX A;  2LVO A;  1FM0 D;  1E9M A;  2OOB B;  4ZRP A;  1C76 A;  3ZXR A;  3BWU D;  2MX2 A;  1GJZ A;  5JZE B;  1FFV A;  3RCZ A;  3FIL B;  4YSX B;  4KGS A;  3W1S A;  2GBR A;  1SXT A;  2J42 A;  1GG3 A;  1YX6 B;  1IUE A;  2LAS A;  1V5O A;  3VAW A;  5IKC M;  2W55 A;  4XZ4 A;  3KWL A;  2KC2 A;  4JGH B;  2V1Y A;  2JY6 A;  3A1Q A;  4GDK B;  1RM6 C;  1RWS A;  1WGR A;  3R2I A;  1L4D B;  3R7Q A;  4EE2 A;  1D5M C;  3DOW A;  2V3N A;  1ZKH A;  5FR6 A;  4ACF A;  4W9I A;  1KTK A;  5EE9 A;  1A70 A;  2M0A A;  3ECI A;  3NVV A;  2YVC A;  4X57 B;  3P4R B;  2N7D A;  5TR5 A;  4ICU A;  2ZVN A;  3AXC A;  3L08 A;  2M0X A;  2BS3 B;  2PPH A;  4IOI E;  4N59 A;  2ASQ A;  2KN4 A;  3VDZ A;  1E8W A;  4OVU A;  1WRI A;  3FKY A;  4G3X B;  3A4S C;  3IT6 B;  3KQ4 A;  3MC8 A;  1L0X B;  3AEE B;  2FNJ B;  2ZJD A;  3DVG X;  3WAL A;  1JWM D;  3EEC A;  3Q3O C;  4ICV A;  2BKR B;  2WXP A;  1LGR A;  2NBW B;  1IBX B;  4ANV A;  2O6V D;  3NRZ A;  5J17 A;  1D5X C;  2NBU A;  1WR1 A;  2L8J A;  4KZC A;  4Q2J A;  4A3P A;  2V3P A;  1JW9 D;  2WDR B;  2WXM A;  4J3O D;  2J7Q B;  2FAZ A;  3QAQ A;  4RNA A;  1QF6 A;  3OAW A;  3DBS A;  3DBL I;  2ICI A;  2VH1 A;  2MEK A;  1QOF A;  4HLE A;  2LHD A;  4KDI C;  3AMZ A;  4WAF A;  3TIX A;  1GB1 A;  2JYT A;  4OVZ A;  4HKQ A;  2NS5 A;  2WXI A;  1GNU A;  3U52 E;  3APD A;  4REZ A;  5CHF A;  4PYU A;  2GBM A;  1N5W A;  5L83 A;  1XEE A;  2UYZ B;  1EF1 A;  3HVZ A;  1I42 A;  3AE4 B;  1ROE A;  3JSV A;  5DPR A;  3V62 A;  3IAS 1;  1RAX A;  3GE8 C;  2ZW1 A;  4CYE A;  1V80 A;  2WNM A;  4FXC A;  1WR6 E;  3ML8 A;  1C9F A;  4C56 C;  2ZEQ A;  2K8H A;  2QIE B;  1M94 A;  4FAD A;  2DX5 B;  3RNA C;  1GC6 A;  1L5P A;  3E56 A;  2AQ2 B;  3SFD B;  2GBN A;  1UBI A;  3AE7 B;  1TYG B;  1TJE A;  4MGK E;  3AEF B;  4N58 A;  2LJ5 A;  5EE1 A;  1I4R A;  3TEW A;  2J0J A;  3VQI A;  2KT7 A;  4LTU A;  3O13 A;  2KYW A;  2WX1 A;  1HZ6 A;  3V60 A;  3ZKJ C;  4DK5 A;  2L52 A;  3X0W A;  2QJL A;  1EO6 A;  1WX8 A;  4ZRJ A;  1WGD A;  5AEK B;  1JRU A;  2J53 A;  3AEB B;  4C4V B;  1N6Z A;  2FCQ A;  1WM3 A;  2N4F A;  2L32 A;  2Y5P A;  2O2V B;  2D07 B;  2WDT B;  4W9C A;  2NCN A;  4YXD B;  1WFY A;  2HJ1 A;  3QIJ A;  2RDB C;  3SR6 A;  2JPH A;  1TIF A;  3PPA A;  2Z59 B;  1WSP A;  4FJV B;  4GOC A;  2L00 B;  4MEL A;  3VRA B;  4OHJ A;  1RFK A;  2LI5 A;  2BYF A;  3VRB B;  4IKG A;  4WQM A;  2MW5 A;  3A9K A;  4DXG A;  3ABV B;  2M56 B;  4II2 B;  1J8C A;  3RZF A;  5BO4 B;  2IGH A;  1YQ4 B;  3VVW B;  5AZF A;  1SE9 A;  3QA8 A;  3QJZ A;  3L17 A;  2INP E;  4LNF A;  1MI0 A;  2CJN A;  4GIV A;  3AV8 A;  2WXF A;  1WXV A;  3PRE A;  4W9H A;  3Q8A A;  5HG2 A;  1A5R A;  4FHK A;  4WJN A;  3N9Y C;  1E0Z A;  4K7S A;  4XWT A;  4W9G A;  3QC8 B;  3U2S C;  3UIN B;  1OGW A;  4GGQ A;  5JH5 C;  1SIJ A;  4O1N A;  2LGD A;  3ZJV A;  4MGI E;  1IGD A;  3U7Z A;  4HVB A;  3RNG C;  4MAC A;  1FCL A;  2JWU A;  1C77 A;  2W82 A;  3N30 A;  3DVN V;  3AED B;  2L3Z A;  4IUM B;  3NS1 A;  4YWG G;  2A5U A;  2KFJ A;  3ETR A;  2ZNV C;  1HTO A;  3H7S A;  2LVQ A;  2C5L C;  2GBK A;  3APC A;  1T0S C;  4TKN A;  3IG3 A;  3H6N A;  2D2Q A;  3IT4 B;  4DHJ D;  1C4P A;  2LGX A;  4NAW A;  2DYB A;  2JWZ A;  2WLB A;  2C7H A;  5BMH A;  1HA5 A;  3RUL A;  1JRP A;  1N63 A;  2J0M A;  3BK2 A;  2R61 A;  1E7P B;  2KJ6 A;  3AM9 A;  2IO1 B;  2WS3 B;  2KDE B;  3PLV A;  5HFY A;  4YT0 B;  1NDD A;  3RI7 C;  2JYE A;  2NTS A;  4K81 A;  1JWB D;  3GZN I;  1KFY B;  2EMT A;  3I57 A;  4US9 A;  1N62 A;  1WJ6 A;  4KGR A;  2LGS A;  1SSN A;  2LXC A;  1LQB A;  1V81 A;  2WXJ A;  4DHZ B;  2WU5 B;  3PS6 A;  3DBH B;  3ZIM A;  5KHQ A;  1J0G A;  3TUO A;  1YD8 U;  4K1R B;  4KIK B;  3IVF A;  2WXQ A;  3APF A;  1GT8 A;  2MJE A;  2KWU B;  3DCG A;  2L7R A;  3URY A;  2YEP F;  3T3N A;  2BYE A;  4NPN A;  2K3U A;  4PK1 A;  2LWP A;  4IWP A;  4MSM B;  2MBB B;  1GAQ B;  3RN9 C;  1HEZ E;  4I6P A;  1C79 A;  1FXA A;  4PYZ A;  2D3C A;  4JPS A;  2LGY A;  1QOA A;  3BK1 A;  3DVG Y;  5FR3 A;  1HZ5 A;  2PEA A;  4LNI A;  1UGM A;  4ZOH C;  2XBB C;  3DPD A;  3KWV A;  4IM0 A;  4CHK A;  1AAR A;  1XLN A;  1D6E C;  4WWO A;  1E6E B;  2PE6 B;  1WJN A;  5J2R A;  3A9K B;  3CWI A;  2CJO A;  2IPK D;  1XLO A;  4HRS A;  1YN3 A;  1F9J A;  5JXV A;  2KZR A;  3DVN U;  4WJQ A;  3PZ8 A;  2FCS A;  2KX0 A;  4ASW C;  2WX0 A;  3P1M A;  4K3C A;  4GN1 A;  4WWP A;  3ZRC A;  3DBR B;  4IW0 A;  4MH0 E;  3EGR A;  3RMK C;  1SE3 A;  1Q10 A;  1YN5 A;  4IM3 A;  2AQ3 B;  1MHH E;  3R7R A;  1NVI D;  5D6J B;  5JHA A;  1V1P B;  4JWS C;  1KF6 B;  2QSD A;  1IP9 A;  2MWS B;  4BOS C;  3HIZ A;  1Z2M A;  4LJO B;  3MHS D;  1P98 A;  5G55 A;  4P6V F;  4CO7 A;  1VD2 A;  5CHW A;  3ZTC A;  4YSY B;  3ZQ4 A;  1QOG A;  4DXA B;  2AWT A;  3PRP B;  4P7I A;  1XCQ L;  2Y5C A;  4TUU A;  1VDV A;  4W9F A;  3UF8 A;  1QQR A;  2AL3 A;  1D5Z C;  3GB1 A;  4EFO A;  2OJW A;  1WWT A;  3ALB A;  4A8X C;  2GBJ A;  4RCO A;  3NJT A;  1NBF C;  1AW7 A;  2HTM E;  2DZM A;  3SD5 A;  3CF6 E;  1WGK A;  1XXG A;  1EM7 A;  3R8B A;  1AYF A;  2OJR A;  2BF8 B;  5CHV C;  2C7N B;  2KLG A;  2N7E A;  4A55 A;  3UIP B;  1WX9 A;  2O6V A;  2JX5 A;  3GP7 A;  2JVC A;  3Q3F A;  1P7F A;  3P4Q B;  3TSS A;  2EKE C;  3V6C B;  2MHJ A;  2IBI B;  2JUO A;  2D10 A;  1WH3 A;  5E6P A;  2KDF B;  3A4R A;  2L83 A;  2DBY A;  1E8X A;  1I4H A;  4E74 A;  4NJ6 A;  5GMV A;  2K5P A;  4GB9 A;  4LLG M;  1V86 A;  3ZNG C;  3V6E B;  5L95 C;  2K8C A;  1TBE A;  2QC8 A;  1WXM A;  3AE2 B;  3WAM A;  1BT0 A;  2XK5 B;  5LXH A;  3EHV A;  4M0W B;  5IA7 A;  3VTV A;  4AP4 C;  3BII D;  2V4L A;  1TY2 A;  4KKJ A;  1OQR A;  4ZRK A;  1CK1 A;  4K7U A;  5EE0 A;  2BVC A;  2H88 B;  4W9J A;  2ONQ A;  4B0M A;  1LXD A;  2GI9 A;  1C4A A;  4A9A A;  2GB1 A;  4NQL B;  4URK A;  2K6D B;  4LNO A;  1Q5W B;  2WXK A;  4KGT A;  2N1W A;  1OEY J;  5DPW A;  1UZX B;  2WDQ B;  1OFF A;  2V9H A;  4NJ7 A;  1WE6 A;  1NI3 A;  3BVG A;  2WP9 B;  1E7U A;  4LNK A;  1YJI A;  4MT5 A;  1TS3 A;  3AEC B;  3AE3 B;  2V4I B;  4HJK A;  3BIN A;  1MJD A;  1N60 A;  1UEL A;  1V5T A;  2BW2 A;  3PT2 B;  3A1Q B;  2WDV B;  4C7Y A;  1ZXI A;  1WX7 A;  2MSE D;  1IGC A;  3QAR A;  2KVZ A;  3RNF C;  3KYD D;  4XGA B;  4IWQ A;  2ZW0 A;  4NZL B;  1V6E A;  5D7G A;  4DBG A;  4W9L A;  2D5G A;  1UBQ A;  1R4M B;  4L1B A;  1Z5S B;  3RNE C;  1VZ6 A;  3PGE A;  4NAM A;  2RSU A;  1YOV B;  2K25 A;  2MP2 B;  3RPF C;  5I4D A;  3TEY A;  2FUH B;  4HEA 1;  2RDH A;  3B9J A;  2QEJ C;  4XWW A;  2DZI A;  2X8X X;  3N32 A;  5LLI A;  1NYQ A;  3HM6 X;  2KTR A;  3N1X C;  1F77 A;  2IJ0 A;  1YX5 B;  1I4G A;  1JWU D;  1RRB A;  3UGB B;  4C7Z A;  2RD0 A;  2KFK B;  3EFU A;  4ITK A;  2W3R A;  3T9L A;  1B1Z A;  4ANX A;  1FRR A;  4PS7 A;  2I1J A;  3NVZ A;  2I38 A;  3UI3 A;  4ARC A;  1DGJ A;  2NVU I;  2KAJ A;  3MFG A;  1UGJ A;  1FO4 A;  1L2N A;  4KX6 B;  3ZNI D;  2JZ3 B;  2J4X A;  2LRW A;  3W5V B;  3K9O B;  4JX1 C;  2DLB A;  3LJ3 A;  2KMC A;  2LRU A;  2WXN A;  4EKU A;  2IGG A;  1HE8 A;  2M4N A;  2E6X A;  3PZD A;  2G4S A;  1TZO A;  1EWC A;  3WAP A;  2N7J A;  4WWM A;  1P3Q U;  2N9X A;  1XT9 B;  3AE8 B;  1KLU D;  4HKZ E;  3AUL A;  4EOY A;  2KWD A;  2JT4 B;  2W9N A;  3SDL C;  4XE0 A;  2A4Z A;  1TKY A;  4HPL B;  1FXT B;  4AQ7 A;  5IOI A;  3P4S B;  4GDK A;  2XEW A;  4YTN B;  3NS8 A;  4K3B A;  3ZUN A;  3DDC B;  1XF5 L;  2M17 A;  4ZHO A;  1IPG A;  2DAF A;  1JWS D;  1WI0 A;  3PHW B;  3FIL A;  1PUT A;  3ZLZ A;  1GC7 A;  3V3X A;  1UUP A;  3TJP A;  1D3Z A;  3KUC B;  3M3J A;  2KDB A;  1JCK B;  3AB5 A;  1E10 A;  2OED A;  2BBC A;  1MVK A;  3I63 C;  1WZ3 A;  2WXG A;  3CSF A;  2FIF A;  3DBR I;  2KAC A;  4GDL A;  3L16 A;  2BB5 A;  1U4A A;  3H1U A;  3RUI B;  1YJJ A;  3R3M A;  4WUR A;  4MM3 B;  2AYO B;  1PGB A;  2C60 A;  1YN4 A;  3NG0 A;  4S17 A;  3W1Y A;  2G4D B;  2PIA A;  4FJY A;  2AEH A;  1WIA A;  4XDD A;  3PZ7 A;  1YNT E;  4MJS B;  4JLC A;  1S3S G;  3L4P A;  3Q6B A;  1HTQ A;  4OZB A;  4BVU C;  1SEB D;  3Q8F A;  2DEN B;  1SE2 A;  1EUV B;  3ZDT A;  4HDO A;  3DBL B;  3DHI C;  2VRR B;  2IYD B;  3VR8 B;  5GXG B;  2BS4 B;  3WCQ A;  3L54 A;  2MBQ A;  2DAJ A;  1SBB B;  1VZ8 A;  2SEB D;  3DWG C;  4BFR A;  3OWE B;  1E8Z A;  3J9C A;  4WAA A;  4RH6 A;  3RFZ B;  3LXF A;  2LVP A;  3NZS A;  1DOX A;  2JRI B;  2L1A A;  1QZE A;  3WIM A;  3C19 A;  4TSS A;  2IY1 B;  2QDF A;  4B9K A;  4TV3 A;  4YSZ B;  4BBN F;  2WYQ A;  4RGN A;  2LZ6 A;  1XO3 A;  5HHD G;  1GUA B;  2N9K A;  1F1H A;  3TMP B;  3PO0 A;  1R4M I;  3N1Y C;  2KK8 A;  5IP4 D;  4LCD E;  4F1S A;  5C2T B;  4KV2 A;  4W9K A;  3VR9 B;  1JRO A;  4OZC A;  3H9D A;  1YJ1 A;  3ZXV A;  2X38 A;  3MTN B;  2MRP A;  3S2A A;  4FBJ B;  2HJ8 A;  1R4N I;  1B9R A;  1OTR B;  2KQ7 A;  2PW9 A;  4JWU C;  1V97 A;  2JU6 X;  4GLS C;  2XK5 A;  3H8H A;  2MBO A;  4E3C A;  1XD3 B;  1AWD A;  2RMM A;  4LNN A;  1E8Y A;  3HM3 A;  1R4N B;  1ZP0 B;  3LDZ E;  4A3O A;  1F2R C;  4P1B C;  5G2N A;  1G6J A;  2L0F A;  4TMA B;  4RM9 A;  1SJE D;  3ZO5 B;  3C0R B;  2H89 B;  4MGY E;  2QIL A;  3WAO A;  1J7B A;  2O6V B;  1V1O A;  1NYR A;  2IDY A;  3QWZ B;  2JZP A;  1XQQ A;  2PJH A;  2BTE A;  4ZYS A;  1WJU A;  5AUK A;  2KQ4 X;  3DHH C;  2KX3 A;  1EWY C;  3NZU A;  3U4E G;  4MM3 A;  4LJP B;  4RM8 A;  3MJ5 A;  2VZK B;  3P2B A;  2LD9 A;  4GMV A;  2AX5 A;  5FK9 C;  3OG5 A;  3PV1 A;  3B2F A;  1EU4 A;  3PRM B;  3A33 B;  4KDL B;  1C78 A;  1P9D U;  3TL5 A;  3AEG B;  2WXL A;  1H8C A;  3SU8 X;  2K0P A;  1FCC C;  4KSK C;  1WY8 A;  3CF4 A;  2L05 A;  3VUW A;  2GMI C;  4J6I A;  1T5X D;  1ACC A;  3VH3 B;  5IN7 A;  1BUI C;  1SJH D;  2KDI A;  2ZCB A;  3VUX A;  3ZJT A;  2GLS A;  3CIR B;  4DXF A;  5CX3 A;  3ZVV A;  3ZJU A;  4I6L B;  1VR9 A;  4AJW A;  3OJ3 A;  4AUQ C;  1FFU A;  3U8Z A;  1ZDV A;  2HTH A;  4HCN B;  4C00 A;  4NJC A;  2FCM A;  4B0E A;  2CR5 A;  4ARI A;  1DOY A;  2RGF A;  1KOT A;  1QT9 A;  3MHZ A;  4WJO A;  2BWE S;  1TZ1 A;  1UF0 A;  1FD6 A;  1VRA B;  5D3D A;  2PE9 A;  1J7A A;  1TGZ B;  5LNK 1;  1F52 A;  2ZVO A;  2NBV B;  2BYV E;  3MJW A;  2VZK D;  1PQS A;  2KQS A;  5BYS A;  3UIO B;  2I2Y A;  1ZPS A;  4QAY A;  4IC7 B;  1RFA A;  1ENF A;  2PVG C;  4KZ0 A;  2G1E A;  1FXI A;  1ESF A;  1NEK B;  2KC1 A;  5AZG A;  3N1Z C;  1L6V A;  2C7M B;  2IGD A;  5D2M B;  2RDG A;  4MSQ B;  2PVO D;  2EEL A;  2KFK A;  4FN2 A;  1WRD B;  5EE3 A;  2NR2 A;  4BKT A;  3T3O A;  1IYF A;  2GRI A;  4EEW A;  2PTL A;  1DOI A;  3UQB A;  4JQW C;  4IWO A;  3VHT C;  1WGH A;  2MH7 A;  4A6Q A;  1N5X A;  2LGI A;  3H7P B;  3IHP C;  1MPE A;  2K8B A;  2CHW A;  1FRD A;  3AE9 B;  4II3 B;  3MP9 A;  3DQV A;  2KJR A;  4RF1 A;  2MP2 A;  1Q0W B;  3HK0 A;  4DHJ B;  1ZUD 2;  4I6N B;  2CS4 A;  2QHO A;  2R2Q A;  3RYT A;  1L0V B;  4F7Z A;  5J18 A;  4PT5 A;  1GB4 A;  2G3Q B;  1WMH A;  3HUI A;  3Q8B A;  1N61 A;  1WE7 A;  4XX5 A;  1UWX A;  2K1F A;  2KOX A;  1WYG A;  2RPV A;  3GZN B;  4W9E A;  2ZPN A;  3P4P B;  4BZA A;  2IO3 B;  4L2Y A;  1SGH A;  1J19 A;  1MG4 A;  2BWF A;  1JQ4 A;  1GTH A;  5C1Z A;  2FUG 1;  3Q3M C;  3QQ8 B;  2BGF A;  4USA A;  4HWI B;  5DPS A;  1GOZ A;  4ZDV A;  3KW5 B;  1UWM A;  1YMH E;  3A9J B;  1ET6 A;  2MQJ A;  1I7H A;  2PLP A;  1KRH A;  4B6W A;  1E7V A;  3TBL D;  3NUH B;  2C9W B;  4DHZ E;  2JRH A;  5C3J B;  2KMM A;  2V3S A;  2OHF A;  4G11 A;  3GE3 C;  1ISN A;  2AQ1 B;  5AUI A;  2PKO A;  3KUD B;  3AE5 B;  3B0A A;  4M0W A;  2LMC A;  2Y3A A;  3Q3N C;  1AN8 A;  2J0K A;  4DQO C;  1ZGU B;  2REX A;  4GXB A;  3BY4 B;  3GS2 A;  2DWQ A;  5H92 C;  3BVM A;  2NPT B;  2NMQ A;  3UQA A;  2IO2 B;  4AS1 A;  4ANW A;  1WZ0 A;  2K6Q A;  2MJD A;  1J7C A;  2IZV B;  1OEY A;  5EDS A;  1JWA D;  2ZZP B;  4NNJ B;  3VXW A;  1X1M A;  2WGS A;  2KVR A;  3AH7 A;  3AI5 A;  4TQ0 A;  4EUT A;  2B76 B;  4DWF A;  1QOB A;  1NEN B;  3KH0 A;  3PSE B;  2W54 A;  3TCA A;  2G45 B;  2HDE A;  3QK0 A;  2M19 A;  1WYW B;  4HJG E;  4EZK A;  4XDC A;  1K53 A;  5E6J A;  3EC8 A;  5BMG A;  3SHQ A;  4ZHP A;  2RPQ A;  3L13 A;  3ML9 A;  1WJ4 A;  3JVZ X;  3M62 B;  2L0T A;  2PMV A;  2IO0 B;  4XC2 A;  2L76 A;  3IBE A;  2WWZ A;  4HRO A;  2KAN A;  5LXI B;  1FEH A;  2FE8 A;  1TKE A;  4D2K A;  1KLG D;  4FLH A;  1V1P A;  3OLM D;  3KYC D;  1FNW A;  4UDU C;  1BXT A;  2KMA A;  5G5G A;  2Z0E B;  5D3I B;  1NI2 A;  1CJE A;  1I35 A;  5HI1 A;  3ZTD A;  4HDQ A;  1YQ3 B;  1DYQ A;  1H7W A;  4MDK E;  1S1Q B;  1WXS A;  2CU1 A;  4N9F 4;  3PRZ A;  4NY0 A;  4R3D A;  5FKA C;  4AJY B;  4M02 A;  2B3A A;  2BT6 A;  1FNU A;  2HE7 A;  3I3T B;  4M8M A;  4C80 A;  4LDT B;  2ZCC A;  4RMA A;  4RGM A;  3U7D A;  3L10 B;  2KNB A;  2D3A A;  2VH2 A;  2KO3 A;  4W9D A;  5HKH A;  2NPT A;  1MFW A;  4HXD A;  3RT3 B;  3R2T A;  4WQO B;  3RNC C;  2N9P C;  4H2A A;  3W5U B;  1T0Y A;  3HVD A;  1MG8 A;  1HQR D;  2D3B A;  1SB3 C;  2HD5 B;  3H7P A;  1MHX A;  2KN5 A;  4IG7 B;  1TS2 A;  1PFD A;  3KLS X;  1XLP A;  5C23 A;  2MA9 B;  1TTN A;  2CHZ A;  3FC4 A;  5G5H A;  1TS4 A;  2LUE A;  4N6E B;  2JZZ A;  2LUM A;  3MC0 B;  4DDG D;  4YTP B;  4BKS A;  3ZRF A;  1QLB B;  3PTF C;  2V0G A;  4KIK A;  1KLV A;  2IY0 B;  1IBX A;  2K39 A;  2QMT A;  4MEM A;  5KHO A;  1SE4 A;  2K9X A;  3NHE B;  1JML A;  4BBN C;  1VCB A;  5DPT A;  2FID A;  4B95 A;  3Q8E A;  3QCA A;  1WGG A;  1H4R A;  3A9J A;  4GSW A;  3CST A;  2MLB A;  4HCP B;  2LHE A;  4L23 A;  1P1A A;  3VH4 B;  1UH6 A;  1V49 A;  2WHI A;  3IAM 1;  5BYQ A;  1WM2 A;  5JHB A;  2IND C;  1K52 A;  1FMA D;  4JIO U;  1V2Y A;  3JYU A;  2WXR A;  2E3T A;  3VTW A;  1FPY A;  4P16 A;  2BS2 B;  1ZOY B;  3ZGZ A;  4WJP A;  1T0R C;  3ENE A;  4E71 A;  1D4B A;  1R7S A;  2YEP B;  4NAW B;  3BYT B;  2BPS A;  2KKC A;  2QCZ A;  2AL6 A;  2J52 A;  2KLC A;  1WMH B;  1T3Q A;  3Q69 A;  2RR9 A;  4IM2 A;  2JXX A;  3M63 B;  3D32 A;  2DYO A;  3V61 A;  3VTU A;  2BB6 A;  1K50 A;  3X23 A;  1K8R B;  3SEB A;  1ET9 A;  1Y56 A;  1L4Z B;  1OQY A;  1L6U A;  2KJH B;  4EZL A;  3TEZ A;  3P42 A;  3W9C B;  3LYY A;  3KVF B;  1C4C A;  1V8C A;  2DNF A;  1BML C;  1TKG A;  3CMM B;  1RLF A;  5BYR A;  2UWQ A;  2KHW B;  2KXJ A;  1F0Z A;  4GU2 A;  4LK0 M;  3AN1 A;  3BVZ A;  1SIF A;  5E6N A;  1EU3 A;  3E9S A;  3EFC A;  4HPM B;  1OQQ A;  1P7E A;  2D11 A;  3WAN A;  1UD7 A;  3AEA B;  4EZJ A;  3EUB 2;  2XN9 C;  5DCN A;  2EMS A;  4KVG B;  2GOW A;  4MH8 A;  4RFB A;  5CTR C;  2N9L A;  2DHZ A;  4PS3 A;  3QX1 A;  5AZH A;  2WQY B;  3SFE B;  1WGY A;  2JF5 A;  2I1K A;  3V05 A;  5D94 A;  2Q5W D;  2INC C;  4AWJ A;  3QHT A;  2BKF A;  2MJ3 A;  1ZXH A;  4JL9 A;  2FBW B;  4G50 A;  3PHX B;  2MBH A;  2WXO A;  2XNA C;  3NVY A;  3VUY A;  1KH0 A;  4LDT D;  1XLQ A;  2KTF A;  2ON8 A;  3W1S C;  1GPX A;  2R2O A;  2N9E B;  3TEX A;  4KSL C;  2WU2 B;  4AOF A;  4FA6 A;  3AU5 A;  4TQ1 A;  5IO9 A;  3Q3J A;  4US8 A; 
#chains in the Genus database with same CATH homology
 3B9J A;  2QEJ C;  4XWW A;  4RF1 A;  3Q8C A;  1NYQ A;  2WXH A;  1ZUD 2;  3SR6 A;  1F77 A;  2IJ0 A;  1VJK A;  1L0V B;  3B2G A;  1CZP A;  3FAH A;  2NTT A;  1WSP A;  2BYT A;  4PT5 A;  3VRA B;  4OHJ A;  1RFK A;  1I4G A;  1GB4 A;  1JWU D;  5H8Y E;  4C7Z A;  1QIL A;  3HUI A;  1PGX A;  5MPO A;  3VRB B;  3Q8B A;  4WIP A;  4IKG A;  1N61 A;  4ITK A;  4WQM A;  2W3R A;  1B1Z A;  1UWX A;  3C8Y A;  1FRR A;  2INN E;  1WYG A;  2RPV A;  3HRD D;  4DXG A;  3ABV B;  3NVZ A;  2M56 B;  2I38 A;  3UI3 A;  3P4P B;  4ARC A;  1DGJ A;  2IGH A;  2JQR B;  1YQ4 B;  2JSV X;  2KAJ A;  3MFG A;  4L2Y A;  1M4V A;  1UGJ A;  2TSS A;  1I4Q A;  1FO4 A;  1RYJ A;  4KX6 B;  2J4X A;  3W5V B;  1JQ4 A;  4JX1 C;  2INP E;  2DLB A;  1GTH A;  1MI0 A;  1VLB A;  2WXN A;  2CJN A;  2FUG 1;  3AV8 A;  2IGG A;  2WXF A;  4USA A;  1HXY D;  2E6X A;  3Q8A A;  5HG2 A;  1GOZ A;  1TZO A;  1EWC A;  1T6B X;  4RGT A;  2N7J A;  4WWM A;  3N9Y C;  1UWM A;  1E0Z A;  3NZ3 A;  3AE8 B;  1KLU D;  4XWT A;  3U2S C;  4HKZ E;  1YMH E;  1SIJ A;  1ET6 A;  2N0S B;  2SAK A;  4JE3 B;  4KKI A;  4OW0 A;  3AE6 B;  1I7H A;  2KWD A;  1ZE3 D;  4O1N A;  1CQV A;  2PLP A;  1KRH A;  3ZJV A;  3NUH B;  3BYY B;  4XE0 A;  1L0Y B;  1IGD A;  1JAL A;  5C3J B;  1TS5 A;  3U7Z A;  2KMM A;  1TKY A;  3EA6 A;  2OHF A;  4MAC A;  2JWU A;  4AQ7 A;  1FCL A;  3P4S B;  1C77 A;  2W82 A;  4YTN B;  2AQ1 B;  5AUI A;  1PDX A;  3AED B;  2PKO A;  1XF5 L;  3NS1 A;  4YWG G;  4ZHO A;  3AE5 B;  3BZD B;  4ZRQ A;  3ETR A;  4M0W A;  2LMC A;  2Y3A A;  1JWS D;  3FIL A;  1AN8 A;  1PUT A;  3V3X A;  1UUP A;  4DQO C;  2Z8L A;  2KDM A;  1JCK B;  2CU3 A;  3AB5 A;  1E10 A;  3IT4 B;  3LB8 C;  1C4P A;  1I4P A;  2OED A;  3GS2 A;  2BBC A;  2DWQ A;  1MVK A;  4GDL B;  4RGO S;  2WXG A;  5H92 C;  2WLB A;  3AE1 B;  1F2R I;  1QKZ A;  3BVM A;  5T8I A;  4RF0 A;  5BMH A;  1HA5 A;  2KAC A;  2NMQ A;  1JRP A;  1N63 A;  1UNS A;  4AS1 A;  2MJD A;  1TY0 A;  2R61 A;  1J7C A;  3BK2 A;  5TSS A;  2BB5 A;  3W2D A;  1E7P B;  1JWA D;  3AM9 A;  2DYM A;  1YJJ A;  1WXQ A;  4WUR A;  4MM3 B;  2WS3 B;  3AH7 A;  1PGB A;  5HFY A;  1YN4 A;  2K22 A;  1XCT L;  4YT0 B;  4TQ0 A;  2PIA A;  2B76 B;  2JYE A;  1VZ7 A;  2NTS A;  4OZA A;  3DWM A;  1QOB A;  1NEN B;  1JWB D;  4XDD A;  2W54 A;  3PZ7 A;  1YNT E;  2HDE A;  5BMI A;  1KFY B;  3I57 A;  2M19 A;  4US9 A;  1N62 A;  3L4P A;  4KGR A;  4HJG E;  1GTE A;  1SSN A;  4OZB A;  4XDC A;  1SEB D;  3Q8F A;  2LEK A;  1SE2 A;  4CQN A;  2WXJ A;  1K53 A;  2WU5 B;  3NVW A;  5E6J A;  3TUO A;  1SF0 A;  5BMG A;  3ZYY X;  3VR8 B;  5GXG B;  2BS4 B;  4A90 A;  2WXQ A;  4ZHP A;  3WCQ A;  1GT8 A;  3IXS A;  2MJE A;  1SBB B;  1FIQ A;  3URY A;  1VZ8 A;  2YEP F;  3P63 A;  2SEB D;  3T3N A;  3DWG C;  2PMV A;  2K3U A;  3OWE B;  1GAQ B;  1HEZ E;  3J9C A;  4HRO A;  1C79 A;  1FEH A;  2FE8 A;  1FXA A;  1ZDX A;  4RH6 A;  1TKE A;  3RFZ B;  3LXF A;  4D2K A;  4JPS A;  1KLG D;  1QOA A;  3BK1 A;  1DOX A;  1V1P A;  4UDU C;  1FNW A;  1BXT A;  2L1A A;  2LFI A;  5FR3 A;  1HZ5 A;  4ZOH C;  5G5G A;  1H7X A;  3KWV A;  1STE A;  4TSS A;  5D3I B;  1CJE A;  5HI1 A;  1XLN A;  2ACZ B;  1D6E C;  2W3S A;  1YQ3 B;  1DYQ A;  1H7W A;  1LO5 D;  1E6E B;  2JXT A;  3I9V 1;  1I4X A;  4R3D A;  5FKA C;  4YSZ B;  1PYW D;  3CWI A;  4RGN A;  4US8 A;  2BT6 A;  2IPK D;  2CJO A;  1XLO A;  4HRS A;  1FNV A;  1XO3 A;  1YN3 A;  1K51 A;  5HHD G;  1FNU A;  2N9K A;  4IDI A;  4C80 A;  5JXV A;  3PO0 A;  2G9H D;  3PZ8 A;  4WH4 A;  4RGM A;  2EKI A;  2LJI A;  3P1M A;  5C2T B;  4YTM B;  3VR9 B;  1JRO A;  3EGR A;  3R2T A;  4OZC A;  2X38 A;  1SE3 A;  1PGA A;  1Q10 A;  1YN5 A;  4H2A A;  3W5U B;  2AQ3 B;  1MHH E;  3HVD A;  1FM0 D;  1E9M A;  1HQR D;  1SB3 C;  1NVI D;  1MHX A;  4ZRP A;  1B9R A;  1PFD A;  1TS2 A;  1C76 A;  1V1P B;  2PW9 A;  4JWS C;  4JWU C;  3KLS X;  3BWU D;  1KF6 B;  1V97 A;  2QSD A;  1XLP A;  1FFV A;  2JU6 X;  3FIL B;  4YSX B;  4GLS C;  4KGS A;  4P6V F;  3W1S A;  1SXT A;  2J42 A;  3H8H A;  1IUE A;  1AWD A;  4YSY B;  3FC4 A;  5G5H A;  3ZQ4 A;  1QOG A;  1TS4 A;  2W55 A;  4N6E B;  2RMM A;  2LUM A;  3KWL A;  3MC0 B;  1XCQ L;  4YTP B;  2Y5C A;  1VDV A;  1ZP0 B;  1RM6 C;  1RWS A;  4GDK B;  3R2I A;  1F2R C;  1QLB B;  1QQR A;  2V0G A;  1L4D B;  4EE2 A;  1D5Z C;  3GB1 A;  1IBX A;  2QMT A;  1D5M C;  4TMA B;  1WWT A;  1SJE D;  1SE4 A;  2K9X A;  2V3N A;  4A8X C;  1JML A;  2H89 B;  4RCO A;  2QIL A;  1KTK A;  1AW7 A;  1J7B A;  2HTM E;  5EE9 A;  1A70 A;  2M0A A;  3Q8E A;  3NVV A;  1V1O A;  1NYR A;  2IDY A;  1WGK A;  3P4R B;  2JZP A;  1XXG A;  2BTE A;  1EM7 A;  3R8B A;  2BS3 B;  1AYF A;  4IOI E;  4N59 A;  4ZYS A;  2LHE A;  5AUK A;  4L23 A;  2KQ4 X;  2KN4 A;  5BYQ A;  3IAM 1;  1K52 A;  4A55 A;  1FMA D;  1WRI A;  1EWY C;  3U4E G;  3MJ5 A;  2VZK B;  2AX5 A;  2JX5 A;  3IT6 B;  3KQ4 A;  5FK9 C;  1L0X B;  2WXR A;  2E3T A;  3GP7 A;  3AEE B;  1JWM D;  1P7F A;  2BS2 B;  3B2F A;  4P16 A;  1ZOY B;  3P4Q B;  3TSS A;  3ZGZ A;  1EU4 A;  1C78 A;  2WXP A;  1D4B A;  1IBX B;  1R7S A;  2L83 A;  2YEP B;  2DBY A;  3AEG B;  3BYT B;  3NRZ A;  4NAW B;  2WXL A;  1I4H A;  2K0P A;  2K5P A;  1FCC C;  1D5X C;  4LLG M;  2J52 A;  3CF4 A;  4Q2J A;  1T3Q A;  3AE2 B;  3Q69 A;  2V3P A;  1JW9 D;  1T5X D;  1ACC A;  2DYO A;  2WDR B;  1BUI C;  1SJH D;  3ZJT A;  2WXM A;  4J3O D;  3CIR B;  1K50 A;  2BB6 A;  4DXF A;  3SEB A;  3BII D;  4RNA A;  1QF6 A;  1ET9 A;  1Y56 A;  1L4Z B;  2ICI A;  1TY2 A;  1L6U A;  3TEZ A;  2MEK A;  4KKJ A;  1QOF A;  3P42 A;  3W9C B;  3ZJU A;  3LYY A;  1OQR A;  2LHD A;  3AMZ A;  4WAF A;  1GB1 A;  1C4C A;  1CK1 A;  1VR9 A;  2JYT A;  4OVZ A;  4HKQ A;  5EE0 A;  1V8C A;  2H88 B;  2WXI A;  1BML C;  1TKG A;  3U52 E;  5BYR A;  1F0Z A;  1FFU A;  1ZDV A;  4LK0 M;  4REZ A;  3AN1 A;  3BVZ A;  1N5W A;  2ONQ A;  4B0M A;  4NJC A;  4B0E A;  1XEE A;  1EU3 A;  2GI9 A;  1C4A A;  3HVZ A;  3E9S A;  4A9A A;  3AE4 B;  4ARI A;  2GB1 A;  1OQQ A;  1P7E A;  1DOY A;  1QT9 A;  3MHZ A;  3AEA B;  1ROE A;  3EUB 2;  2XN9 C;  1FD6 A;  3IAS 1;  2ZW1 A;  1VRA B;  5D3D A;  1J7A A;  2WXK A;  4FXC A;  2WNM A;  5LNK 1;  1C9F A;  4MH8 A;  4C56 C;  4RFB A;  4KGT A;  2N9L A;  2QIE B;  2VZK D;  5BYS A;  2I2Y A;  1ZPS A;  1L5P A;  3E56 A;  1ENF A;  2PVG C;  2WQY B;  3SFE B;  2WDQ B;  1OFF A;  2G1E A;  1FXI A;  1NI3 A;  3BVG A;  1ESF A;  1NEK B;  2WP9 B;  3V05 A;  2AQ2 B;  3SFD B;  1YJI A;  4MT5 A;  1TS3 A;  3AEC B;  3AE3 B;  3AE7 B;  1TYG B;  2V4I B;  1TJE A;  2Q5W D;  1L6V A;  3AEF B;  1N60 A;  2IGD A;  4N58 A;  2BW2 A;  2RDG A;  2MJ3 A;  2WDV B;  5EE1 A;  1ZXH A;  1ZXI A;  4C7Y A;  1I4R A;  1IGC A;  2FBW B;  2PVO D;  2EEL A;  3TEW A;  5EE3 A;  3VQI A;  4LTU A;  3O13 A;  2ZW0 A;  2WXO A;  2XNA C;  1HZ6 A;  3NVY A;  4NZL B;  5D7G A;  1KH0 A;  3T3O A;  2L52 A;  2GRI A;  2QJL A;  1XLQ A;  2PTL A;  1DOI A;  2D5G A;  2ON8 A;  1GPX A;  4L1B A;  1VZ6 A;  3TEX A;  2WU2 B;  2J53 A;  3AEB B;  2MH7 A;  4A6Q A;  1N5X A;  2LGI A;  4TQ1 A;  1MPE A;  4NAM A;  3RPF C;  1FRD A;  3AE9 B;  2L32 A;  2Y5P A;  5I4D A;  3TEY A;  3MP9 A;  4YXD B;  4HEA 1;  2RDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...