4HJKA

U7ub7 disulfide variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AMQIFVKCLTGKTNTLEVEPSDTIENVKAKIQDKIGYPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHCVRRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization
rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hjkA00
1WM3A 1S1QB 1EF5A 5HKHA 1GC6A 2LGXA 4HLEA 2I1JA 4IC7B 2D3GA 2KD0A 5LXIB 2NBVB 2C60A 3TL5A 1V9JA 2K8HA 3Q3JA 3WAOA 4EUTA 4GIVA 1V49A 2DZIA 3Q3FA 5FR6A 2L05A 1TBEA 4NJ7A 5D6JB 3WALA 2MQJA 3AXCA 3QIJA 3ZTDA 1U4AA 2KOXA 2XBBC 2OJRA 4ICUA 4A20A 1WXMA 1IPGA 2PPHA 2N9PC 4LDTB 5DPRA 1WJ6A 1NDDA 3AI5A 3DOWA 1TGZB 5JH5C 2K6QA 2WX1A 2LD9A 3A1QB 3NHEB 1RFAA 1WMHB 3L0WB 4FJVB 1YQBA 3WIMA 4GN1A 1UD7A 2N1VA 4F7ZA 2KFKB 3UIPB 4ANUA 4ZDVA 3PV1A 4KSLC 3DBLI 4KZ0A 4RM9A 3ZVVA 4BKSD 1RRBA 1WGYA 2KTRA 2KLGA 3HM3A 2HD5B 4BKTA 3I3TB 2L3ZA 1P98A 3D32A 3U30A 1C3TA 2L0FA 3M3JA 4K7SA 3VTUA 5LLIA 4KIKB 3H1UA 4RMAA 2G4DB 3VUXA 3M63B 2GBNA 1HE8A 4EKUA 1LFDA 2C9WB 2KXJA 4HCNB 2KX3A 2K39A 4W9GA 3B0AA 1UBQA 3ZIMA 4B95A 2K6DB 2O6VA 1R4MI 4MM3A 4IM2A 1L7YA 4GDKA 3KYCD 2KWCA 3V6CB 1EO6A 2LRWA 3GZNI 3QARA 1E8ZA 3PS6A 1KM7A 2FCQA 4KDIC 3ZW3A 4HPLB 4CYEA 2J7QB 2NCNA 2UYZB 2LGYA 5J17A 1Y8RC 1TTNA 4FHJA 3N30A 2HJ8A 3U7DA 2JY6A 3JW0X 4BBNC 5D94A 4GXBA 4MJSA 2DYMA 3RD2A 4DHJD 5DCNA 3VUYA 2BWES 4LCDE 4BVUC 3CSTA 1Z5SB 2O2VA 4JIOU 3ZDTA 2UWQA 4FLHA 2KDEB 1SE9A 1J8CA 3SD5A 2L0TA 3A33B 3HIZA 4KV2A 3K9OB 4AWJA 2JXXA 2NS5A 2DENB 2MBEA 2B3AA 2XK5A 4WWPA 3L17A 4E3CA 4JQWC 2KMAA 1NBFC 3SU8X 3IBEA 4A3OA 4PS7A 2KTFA 2KKCA 4OVVA 4F1SA 3MJWA 4KVGB 3DVNU 4I6PA 1P0RA 1OQYA 2D2QA 5IAAC 1XQQA 2IO0B 1WE7A 1L2NA 3C0RB 2YLMA 4GOCA 1WGHA 3HK0A 2K8CA 4M8MA 2D11A 2FAZA 1E8YA 4K7UA 1WR6E 2ZCBA 3PSEB 4ZYNA 2ZNVB 4DXAB 2EKEC 3ALBA 1T0YA 1KOTA 2HTHA 2MW5A 3UQBA 4LJOB 1YD8U 5E6NA 2K8BA 1GUAB 3A9KB 1WXAA 2DAFA 2L8JA 3W1SA 2L00B 3ZNZB 3NOBA 3NY5A 3WAMA 3B08A 2JUOA 1P3QU 3O65B 1YJ1A 2NR2A 3ZNID 1RLFA 3IFWB 4NAWB 4G0NB 1WH3A 2GBRA 2NPTA 4HCPB 4GDLB 5J18A 1WJNA 2LI5A 4MDKE 2KANA 3JYUA 5D2MB 2M8SA 3DVNV 2BPSA 4BKSA 4WJOA 4TKNA 1EF1A 3VAWA 3QAQA 4XC2A 1ZKHA 2LZ6A 1AARA 5KHQA 3PT2B 2CR5A 4DK5A 2BGFA 3L08A 3A4RA 2MWSB 4A3PA 1OTRB 4BKGA 4EZLA 2M1MA 2FNJB 1LXDA 2WX0A 2EMTA 2D07B 2ASQA 1UGMA 4IG7B 3QC8B 1I42A 1S3SG 2AYOB 4N9F4 3A9JB 3VUWA 4W9DA 2IY0B 4WAAA 5C23A 5G2NA 4ZRKA 5C1ZA 3ML9A 1BT0A 2ZJDA 2KC1A 2WYQA 1WXSA 4JL9A 3W1SC 2WWZA 3UGBB 2KHWB 3QA8A 1VD2A 3VVWB 2KDIA 3MHSD 3L13A 2KNBA 4DHZE 3DDCB 4K81A 3KUCB 2DX5B 4BFRA 3KYDD 2RGFA 4KDLB 1OGWA 3UINB 3KVFB 2WDTB 3OJ3A 4ICVA 2G45B 4JGHB 2FIFA 2RD0A 4NJ6A 3VQIA 3VTVA 4IWPA 4MSQB 3R66C 2IO2B 2PJHA 3IHPC 2ZPYA 4MGZE 2MX2A 1IYFA 2DZMA 1WY8A 2RR9A 3DVGX 2KTRB 4FA6A 5AZHA 2GBJA 4GU2A 2KN5A 4PS8A 2V1YA 3UIOB 3TCAA 3R3MA 4HJKA 2XEWA 4NNJB 2ZCCA 4W9CA 2FCMA 4XZ4A 2KWVB 2GMIC 3V62A 4NY0A 3ZRCA 2GOWA 3H9DA 4URKA 2L76A 2MBBB 3NS8A 4FHKA 4W9FA 2O6VB 4WJPA 2OOBB 2ZVOA 3PLUA 3QHTA 4HDOA 4EEWA 1A5RA 3H7PA 4GDKB 1XT9B 3EECA 2L7RA 4AP4C 1R4NI 3UQAA 2C7MB 3OJ4B 3V6EB 4MEMA 4KZCA 2CHXA 3M62B 3PRMB 2RSUA 4NQLB 1GG3A 4EZKA 3VTWA 1E8WA 1ZGUB 3PTFC 2CHWA 2MP2A 4LDTD 3ZLZA 2LXCA 3ZNHB 4PYUA 4E71A 3T8MA 2BYEA 3K9PB 3APCA 4FULA 3WA0A 4DHZB 4IW0A 1MG8A 4EZJA 1KJTA 3AU4A 4AJWA 1V5TA 4MJSB 3RUIB 2NVUI 3PREA 1H8CA 3N3KB 3OAWA 4WQOB 4MGKE 3DCGA 2D10A 2DZJA 3P2BA 1V5OA 2KK8A 2O2VB 2A5UA 1XD3B 1WX8A 2J0JA 1E5WA 3PRZA 1WE6A 3H7SA 4WJNA 2Z0EB 2XK5B 2DHZA 2R2OA 4OVUA 4HVBA 2QHOA 3PRPB 2G4SA 3WAPA 4ZRIA 2JT4B 4NQKE 1V80A 2AL3A 2LVPA 4AJYB 1WX9A 2KJ6A 1UBIA 2Y5BB 2DYBA 1C1YB 2I1KA 4FJZA 5DPTA 3QCAA 5L95C 3AU5A 2PEAA 4TQ1A 4II3B 2DAJA 4W9EA 2FIDA 2MBOA 1VCBA 2MBHA 3IG3A 2CS4A 2KO3A 4LJPB 2ZVNA 4GMVA 3QWZB 4ZRJA 1ZW7A 2N4FA 5JZEB 1V86A 2KQ7A 1WFYA 3ENEA 1SIFA 1G6JA 5G55A 4I6LB 3ECIA 1LQBA 3LDZE 5TR5A 4B9KA 2JRIB 2KC2A 4HXDA 2NPTB 3JSVA 2LVQA 2N7EA 3R7RA 4K1RB 3ZRFA 2KJRA 3L10B 1V2YA 1WGDA 2C5LC 5E6OA 3PHXB 3VHTC 3V61A 3ZKJC 1IP9A 2MSED 5DPSA 3KW5B 2MLBA 1OEYA 3RULA 1WJ4A 3ZO5B 3RCZA 3EC8A 2LRUA 4XX5A 3RYTA 4BBNF 3APDA 5CTRC 1JRUA 4NPNA 3VDZA 3SHQA 1SGHA 4ANXA 4FN2A 3V60A 4AUQC 1QZEA 1YX5B 3QX1A 4DBGA 3TBLD 2MCNB 2M0XA 4YL8A 1WF9A 4J6IA 2N7DA 5BO4B 2JZZA 2N9XA 3A4SC 1UZXB 3W1YA 5DPWA 4F8CB 4TQ0A 2A4ZA 2JVCA 1OEYJ 3NZUA 4WJQA 3T9LA 2CU1A 3TJPA 1LM8B 2LGDA 3BY4B 3CMMB 4IWQA 2W9NA 1J19A 1GNUA 2ZEQA 4HWIB 2BWFA 2VRRB 3APFA 3L54A 1WZ0A 4WWNA 3ZDMC 3VH4B 3DVGY 5LXHA 2KX0A 3QQ8B 5CHWA 4FJYA 2BF8B 2K1FA 1Q0WB 3A1QA 2C7NB 3X0WA 1PQSA 4EOYA 3B1LX 3DBSA 1WMHA 1RAXA 2GBMA 3VXWA 4IM0A 2KZRA 4W9KA 5AZFA 2BKFA 4DHJB 4IM3A 3TIXA 2KVRA 1WX7A 4FBJB 2V4LA 2KFKA 4II2B 5AEKB 2DYOA 1ISNA 3NZSA 2N9EB 3TMPB 1TZ1A 4K7WA 2ZZPB 4JLCA 3DBHI 3U8ZA 1KLVA 2IBIB 1CMXB 4GB9A 2BKRB 2LXAA 1UELA 3JVZX 4KIKA 3H6NA 2LASA 2NBWB 1V6EA 2LJ5A 1WI0A 5J2RA 2FCNA 2R2QA 1FXTB 2IO1B 4BOZB 4ANVA 3PHWB 5E6PA 3PPAA 3R7QA 5JHBA 3ONSA 5L83A 1V81A 3AULA 2FCSA 4DDGD 1H4RA 1E90A 1WR1A 3H7PB 3EHVA 2RPQA 4MGYE 4TUUA 3KH0A 3S2AA 2MA9B 2NBUA 1Q5WB 5CHVC 1WGGA 1D3ZA 2JRHA 4CO7A 2G3QB 2Z59B 4HDQA 1NI2A 4I6NB 4AOFA 1K8RB 3M95A 4G11A 3PVLA 2MP2B 3MTNB 1WRDB 4TV3A 3IVFA 2JPHA 2ZNVC 2KJHB 3RT3B 1UH6A 2JWZA 1YX6B 3L16A 4WWOA 3ZNGC 2LWPA 3N32A 2IZVB 2MBQA 4DDID 3RZFA 3ML8A 3PLVA 2BYFA 4M0WB 1P1AA 2AEHA 2K25A 1P9DU 2REXA 3VH3B 1WIAA 1WGRA 2CKHB 3LJ3A 4W9IA 1WJUA 2EMSA 3DQVA 2HE7A 4IWOA 4E74A 1EUVB 4G50A 2C7HA 2DZKA 3ZTCA 2IY1B 2JZ3B 5KHOA 2JF5A 2BYVE 3GOEA 4KSKC 4DWFA 4CHKA 2YVCA 3KUZA 2KWUB 2O6VD 3BINA 2MRPA 4BOSC 2GBKA 3OLMD 3UF8A 3VFKA 4P7IA 4W9LA 3SDLC 4EFOA 5CX3A 2PE6B 4MH0E 3A9KA 4IUMB 1I35A 2N1WA 4M8NA 4ANWA 3DBRI 2IO3B 1GJZA 2LUEA 3WANA 3KUDB 4GGQA 1Q1OA 2M4NA 2CHZA 3QK0A 3RZWC 4MSMB 4ASWC 2ZPNA 4PYZA 3HHMA 4MGIE 4B6WA 2FUHB 4RM8A 5GMVA 1M94A 2LVOA 3PZDA 4NAWA 3X23A 2KDBA 2KMCA 1E7VA 5JHAA 4GDLA 2J0MA 3QJZA 2IYDB 4X57B 3ZUNA 3JSVB 2J0KA 3DPDA 4FADA 3CSFA 1J0GA 2V3SA 5AZGA 4G3XB 3CF6E 4HK2A 4HPMB 2KQSA 4GSWA 1E8XA 1F9JA 1Z2MA 2KDFB 4W9JA 5CHFA 2KLCA 1WZ3A 1WXVA 5IA7A 4W9HA 2AWTA 1X1MA 2AL6A 3HM6X 2M17A 4PS3A 2PE9A 4MELA 1YIWA 2KFJA 3EFUA 1E7UA 3PGEA 5EDSA 1WYWB 3A9JA 2Z0DB 1GC7A 5D7GA 1WM2A
chains in the Genus database with same CATH superfamily
4WIPA 1GC6A 4NAMA 4IC7B 1IUEA 4O1NA 5LXIB 3MHZA 3TL5A 2K8HA 2DZIA 3Q3FA 3NRZA 3ZTDA 3AXCA 3QIJA 3NZ3A 1U4AA 2KOXA 1FMAD 4A20A 1WXMA 3KQ4A 4M02A 2N9LA 3GP7A 1V97A 3DOWA 2WX1A 1NEKB 4FJVB 3LXFA 1WGKA 3Q8FA 2N1VA 3WCQA 2OEDA 1VZ6A 2KFKB 2I2YA 4ANUA 4ZDVA 4RM9A 1WGYA 2KTRA 3B9JA 4LNKA 2HD5B 4BKTA 2L3ZA 1MVKA 1YNTE 5LLIA 1ZXHA 1YN5A 4HCNB 2PMVA 1TIFA 1YN3A 3B0AA 3ZIMA 4B95A 2K6DB 2O6VA 4IM2A 4MACA 3V6CB 3GZNI 1TKEA 3PS6A 1KLUD 1KM7A 4KDIC 1XXGA 4BZAA 4N58A 2H89B 4KKJA 1TS5A 2WP9B 1TTNA 2HJ8A 2JY6A 1HTQA 2CJNA 4MJSA 2LUMA 3NJTA 2BWES 4BVUC 1LGRA 3ZDTA 3DWMA 1J8CA 3A33B 4AWJA 2JXXA 4HRSA 1MI0A 2B3AA 2MBEA 3L17A 2BS3B 3R2TA 4PS7A 2KTFA 4ARIA 2KKCA 4OVVA 1BUIC 1FNWA 2V9HA 1AN8A 1OQYA 1XQQA 2JZPA 1SSNA 3C0RB 4GOCA 1WGHA 4L1BA 2K8CA 4M8MA 2D11A 2MHJA 2FAZA 2ZCBA 3PSEB 1FFUA 1VZ7A 2EKEC 3ALBA 1T0YA 1KOTA 3HUIA 5E6NA 2K8BA 1GUAB 3A9KB 2L8JA 3W1SA 2L00B 2I38A 3NY5A 3WAMA 3B08A 1HA5A 3DHHC 3O65B 4WURA 1PFDA 2NR2A 1RLFA 4NAWB 4G0NB 1WH3A 5J18A 5D2MB 2M8SA 4WJOA 2YEPF 4EE2A 1EF1A 1SE3A 2GRIA 1ZKHA 2MWSB 2M1MA 1M4VA 2EMTA 3URYA 4IG7B 3QC8B 1S3SG 3A9JB 3R2IA 3VUWA 4B0EA 2IY0B 3P4PB 5C1ZA 1BT0A 1ACCA 2WYQA 2BT6A 3W1SC 2WWZA 3UGBB 3ZXVA 2K22A 2DNFA 2KHWB 4DXGA 4C4VA 1VD2A 3FILA 2KDIA 3MHSD 3L13A 2KNBA 4JE3B 1KLGD 1LO5D 3PO0A 4K81A 2PIAA 2LMCA 3KYDD 3U4EG 3UINB 3OJ3A 4NJ6A 1FD6A 5FR3A 3R66C 3ZJTA 3AMZA 1WY8A 1TS4A 3DVGX 3UIOB 1FXAA 3RN9C 4P1CC 2KWVB 1RM6C 5IOIA 4LLGM 2M56B 3GZNB 3H9DA 2L76A 3MC9A 3RNFC 1R4NI 2MJDA 3RPFC 2M0AA 3VTWA 1E8WA 1SEBD 2MP2A 2KAJA 3T8MA 3K9PB 3APCA 4FULA 1R7SA 1MG8A 2IGDA 4EZJA 3RNEC 1V5TA 3PREA 1H8CA 3OAWA 4WQOB 1CJEA 4MGKE 3DCGA 2O2VB 2A5UA 1TKYA 2J0JA 3U7ZA 3ETRA 2DHZA 1E9MA 4HVBA 2QHOA 3PRPB 2G4SA 2ICIA 2TSSA 4NQKE 2LHDA 2DYBA 4FJZA 2MJEA 1JWBD 2DAJA 2FIDA 4ZOHC 2RDHA 2KO3A 4ZRJA 2WU2B 4A90A 5JXVA 5JZEB 1WFYA 3ENEA 1SIFA 1ENFA 1G6JA 2JRIB 4TMAB 2X8XX 4HXDA 4LNOA 2GB1A 1NYRA 2NPTB 3T3OA 2KJRA 3L10B 3PHXB 3VHTC 3ZKJC 2LGIA 3Q8CA 3DWGC 1CQVA 2WDQB 4ARCA 3AV8A 3VDZA 4ANXA 4AUQC 1I4RA 4J6IA 3A4SC 2KYWA 5DPWA 1MJDA 1SJED 1OEYJ 3NZUA 3T9LA 3TJPA 2LGDA 1L4ZB 4IDIA 3CMMB 4IWQA 4XGAB 4HWIB 2ZEQA 1RFKA 2BWFA 3APFA 3L54A 3DVGY 2KX0A 1FRDA 4FJYA 2BF8B 1GPXA 4KGRA 2DLBA 3X0WA 4EOYA 5C2TB 2W55A 1P7EA 1D5XC 2KFKA 3RMKC 4YT0B 3TMPB 1K50A 4K7WA 3BZDB 3AEDB 1DOXA 3RNCC 1CMXB 2LXAA 1DOYA 1JALA 3JVZX 1PYWD 3H6NA 1QKZA 1V6EA 3EGRA 4BOZB 1R4NB 3PPAA 3ONSA 1V81A 4L2YA 2FCSA 4DDGD 1H4RA 3Q69A 1HZ5A 1KTKA 1WGGA 3P42A 2XNAC 1L6VA 3BYTB 1WRDB 4TV3A 3TEYA 4OHJA 2JPHA 1JRPA 1UNSA 1UH6A 2JWZA 3CWIA 3IT4B 2BS4B 2B76B 3RNAC 2AEHA 3VH3B 3AM9A 1WIAA 4D2KA 5BMIA 3LJ3A 1WJUA 4IWOA 4E74A 3ZTCA 1AWDA 1NYQA 1JWUD 3OWEB 3KUZA 2BB6A 3BINA 1MHXA 1QOAA 3OLMD 4N59A 2RDGA 3VFKA 2IJ0A 2PE6B 3NUHB 4OZCA 3A9KA 1B9RA 1P7FA 3DBRI 4GGQA 1QOGA 3RZWC 4ASWC 4B6WA 3AEBB 1N5XA 4NAWA 3X23A 2KDBA 5JHAA 3HVZA 3JSVB 2N7JA 1C9FA 4FADA 5BYSA 2QCZA 2MEKA 5AZGA 1B1ZA 4HPMB 1D4BA 3I5JC 1WZ3A 3B2FA 4W9HA 3N9YC 1X1MA 3Q14C 3HM6X 2L1AA 1WYWB 3A9JA 1EF5A 2H88B 4HLEA 1MHHE 2D3GA 2LHEA 1C4PA 2UU7A 2C60A 2WXRA 5G5GA 3Q3OC 4EUTA 1KH0A 1QQRA 3E9SA 1IPGA 2N9PC 1T5XD 1I4PA 1L4DB 2K6QA 1YQBA 1SF0A 4GN1A 1CZPA 2WXHA 5AUKA 4BKSD 4XDDA 3HM3A 1KRHA 3D32A 2L0FA 1F2RC 3M3JA 2G9HD 2GBNA 1HE8A 1J7CA 2K39A 2EELA 2RMMA 2IGGA 1EO6A 1E8ZA 1XLNA 2L32A 2J7QB 3EUB2 4OW0A 2LGYA 5J17A 2FUG1 4M00A 1OFFA 4LCDE 4A55A 3CSTA 2O2VA 3OG5A 4JWUC 4JIOU 2KDEB 3AE4B 2L0TA 3HIZA 1QOFA 2DENB 4WWPA 3W9CB 2KMAA 3IBEA 2LEKA 1TJEA 2QJLA 3DVNU 2D2QA 2DBYA 2W3SA 1I4GA 2JYEA 1V8CA 1N63A 1NI3A 1WR6E 4ZYNA 5H8YE 3DBRB 4LNFA 4RNAA 4DXAB 2HTHA 2DAFA 3AEEB 3NOBA 4XWTA 4PK1A 2JUOA 3ZNID 4USAA 3IFWB 5IKCM 1TKGA 2NPTA 1UUPA 5BMGA 3NVZA 2BW2A 1VLBA 3JYUA 2PLPA 2BS2B 3DVNV 2BPSA 1V1PB 3VAWA 3QAQA 4XC2A 1AARA 2QMTA 4ACFA 1E0ZA 1F0ZA 3A4RA 4A3PA 1OTRB 2WX0A 3E56A 1F2RI 5EE0A 5C23A 2KC1A 1WXSA 3DHGC 1YQ3B 2JQRB 3VVWB 2D5GA 4MH8A 4DHZE 2BVCA 1SIJA 3KUCB 3W5UB 4A6QA 2YEPB 2RGFA 3AEGB 2WXLA 1FCLA 4KDLB 1OGWA 2DWQA 2WDTB 1TT5B 3VQIA 1ZDVA 1IYFA 2MX2A 1VRAB 2RR9A 3FAHA 4FA6A 4IKGA 3H8HA 4GU2A 4PS8A 1YMHE 3R3MA 4NNJB 4W9CA 2FCMA 4ZRQA 3V62A 2GOWA 4JWSC 1PUTA 4FHKA 3U2SC 1J7AA 2OOBB 3PLUA 3QHTA 2J4XA 4C7YA 4GDKB 1XT9B 4TSSA 4A8XC 3TEXA 5EE3A 4KZCA 5GXGB 3PRMB 1F77A 1ZGUB 3PTFC 4LDTD 3ZLZA 1PGBA 2QC8A 2BYEA 4DHZB 1L0XB 3CIRB 3RUIB 3ZQ4A 1FXIA 2DZJA 3P2BA 1SB3C 4YXDB 3PRZA 5IO9A 3VRAB 4WJNA 2Z0EB 2R2OA 3WAPA 4ZRIA 1V80A 2LVPA 2M19A 2E3TA 2WXPA 4B0MA 3AU5A 2MBOA 1VCBA 2INPE 2CS4A 3AE3B 1VZ8A 3QWZB 1ZW7A 1V86A 3IXSA 4I6LB 1LQBA 5T8IA 3I57A 3JSVA 2N7EA 2ONQA 1WGDA 2PKOA 3RNGC 1ESFA 2J42A 2MSED 5DPSA 3KW5B 3EC8A 4XX5A 3RYTA 4BBNF 5CTRC 1TYGB 1GAQB 1PDXA 1QZEA 2MCNB 4YL8A 4LNNA 2JVCA 1WWTA 1LM8B 3BY4B 2W9NA 1GNUA 4RCOA 1ZDXA 4HKQA 1WZ0A 4C00A 5LXHA 2SEBD 3QQ8B 2AX5A 5TSSA 2KMMA 1PGAA 3MJ5A 2C7NB 3B1LX 2GBMA 2SAKA 4W9KA 2J52A 1WX7A 2V4LA 4II2B 1AYFA 4RGNA 2KACA 3GE8C 2AQ1B 2ZZPB 1OQRA 2NBWB 3AE8B 1FPYA 1WI0A 2FCNA 2K5PA 3AEFB 5L83A 2EKIA 1E90A 2QIEB 3EHVA 4MGYE 1L6UA 1K51A 3AB5A 2NBUA 1N62A 1JQ4A 3M95A 1MG4A 3MTNB 1IBXB 3I63C 2OJWA 1FO4A 2KJHB 3BIID 3N1XC 2WXOA 3LB8C 3N32A 2IZVB 1VDVA 4M0WB 1P1AA 1P9DU 1WGRA 4FXCA 2EMSA 4G50A 2DZKA 3P63A 2JF5A 5FKAC 3GOEA 4KSKC 2ZW1A 2KWUB 2X38A 4HEA1 2MRPA 4BOSC 2GBKA 3UF8A 4OVZA 5CX3A 1QOBA 4ITKA 4IUMB 4ANWA 1GJZA 2LUEA 3BK2A 3AE7B 4K3BA 4PYZA 1XLPA 3HHMA 2FUHB 3N1YC 1M94A 1GB1A 2IYDB 3ZUNA 2J0KA 3DPDA 1EWYC 2WXJA 4G3XB 3TEZA 1V1PA 1Z2MA 2KLCA 5IP4D 5IA7A 2AWTA 2WDRB 2IPKD 4C56C 1F52A 5E6JA 4C7ZA 1KF6B 1E7UA 2Z0DB 3WANA 3BVGA 1S1QB 1MFWA 2LGXA 5FK9C 2NBVB 4GIVA 1V49A 4US8A 5FR6A 2L05A 2MQJA 2KDMA 3HRDD 2XBBC 5BMHA 4LDTB 1WJ6A 1XLOA 3AI5A 1TGZB 5JH5C 3A1QB 3SR6A 2WS3B 1RFAA 3WIMA 2WXFA 1TS2A 4F7ZA 4KSLC 3DBLI 4KZ0A 3ZVVA 3J9CA 1I7HA 3Q3MC 3I3TB 1C3TA 4K7SA 1QILA 4KIKB 2G4DB 4LK0M 2WXQA 3ZJUA 1LFDA 2PVOD 2RDBC 3LYYA 1L0VB 4W9GA 1UBQA 1R4MI 1HQRD 3V05A 1XF5L 1L7YA 4GDKA 3KYCD 3BVMA 2LRWA 3QARA 4BAXA 1WXQA 2HJ1A 3SFEB 1WYGA 4HPLB 4CYEA 1STEA 2NCNA 2RPVA 3C8YA 1FCCC 3JW0X 4BBNC 3AH7A 2DYMA 4DHJD 5DCNA 4YSZB 1UGJA 1FIQA 2UWQA 2JWUA 4FLHA 1SE9A 4KV2A 2Z8LA 1ZP0B 4E3CA 3R8BA 4JQWC 1NBFC 1GB4A 3Q3NC 3TUOA 1ZE3D 3MJWA 4KVGB 4Q2JA 4I6PA 2INCC 5IAAC 2KN4A 2YLMA 3HK0A 1E8YA 4K7UA 1XCTL 1EU3A 2WXGA 2ZNVB 4LJOB 3I9V1 1I4XA 1YD8U 2QSDA 4KKIA 1WXAA 1P3QU 1YJ1A 4HCPB 4GDLB 2LI5A 4MDKE 2KANA 1FM0D 4BKSA 4MT5A 3RFZB 1GOZA 3RNBC 2BBCA 2LZ6A 3PT2B 2CR5A 4DK5A 3L08A 2FNJB 2VH2A 4J3OD 3C19A 1I42A 2AYOB 1ET9A 4W9DA 1EM7A 1TS3A 5G2NA 5EE9A 3ML9A 2ZJDA 3AE9B 4WWMA 3QA8A 3DDCB 4HROA 1E7PB 4BFRA 1C77A 3DBLB 2RD0A 2AQ2B 4MSQB 2KVZA 3TSSA 5AZHA 2D3AA 2BB5A 2PW9A 1C78A 4HJKA 4XDCA 1R4MB 2ZCCA 4NY0A 4URKA 3L4PA 2MBBB 3NS8A 4WJPA 1VR9A 1A5RA 4MM3B 3EECA 2L7RA 3OJ4B 2OHFA 2D3BA 2FBWB 2W54A 2RSUA 1GG3A 4EZKA 4WH4A 2N0SB 4US9A 1IBXA 4E71A 3WA0A 1KJTA 4AJWA 1C4CA 2NVUI 4HKZE 1TZOA 4M0WA 1V5OA 2KK8A 1YJIA 3P4SB 1WE6A 2XK5B 4OVUA 1UF0A 3V3XA 1L5PA 2JT4B 2XN9C 2AL3A 4AJYB 2KJ6A 2I1KA 5L95C 4TQ1A 3IG3A 2ZVNA 4PT5A 1JMLA 4L23A 4RF1A 2GLSA 5G55A 3IAM1 1C76A 3LDZE 5TR5A 3P4QB 4LTUA 3TEWA 2KC2A 3R7RA 3ZRFA 1V2YA 2C5LC 5E6OA 4RF0A 4DQOC 3ZO5B 3NG0A 2LRUA 1JRUA 1SGHA 5LNK1 3QX1A 4H2AA 1K52A 2M0XA 1XCQL 2N7DA 5BO4B 3UI3A 3ZYYX 1XLQA 4TQ0A 2A4ZA 4WJQA 2CU1A 2WU5B 3W2DA 1J19A 2VRRB 3GE3C 3RI7C 1N61A 4JPSA 2K1FA 1Q0WB 3A1QA 3EA6A 3N1ZC 1PQSA 4IM0A 2BKFA 4DHJB 4IM3A 4FBJB 2KVRA 1ISNA 2N9EB 4GLSC 3DBHI 1KLVA 4P16A 1FEHA 2Y3AA 1SE2A 1C79A 2IBIB 1UELA 4KIKA 3BVZA 2WDVB 2LJ5A 2J53A 1FXTB 2IO1B 4ANVA 3PHWB 1XO3A 1FNUA 3R7QA 5JHBA 3AULA 1D6EC 1WR1A 3H7PB 2RPQA 3ABVB 1RYJA 4TUUA 1BMLC 4ZHPA 3S2AA 4RFBA 1Q5WB 5CHVC 1D3ZA 2LGSA 4YSYB 4HDQA 1NI2A 4I6NB 1K8RB 4G11A 3PVLA 3IVFA 3N20C 1ZOYB 2NTTA 3RT3B 1YX6B 3NS1A 3ZNGC 2JSVX 2LWPA 1HZ6A 2QEJC 2MBQA 3RZFA 3ML8A 2BYFA 5AUIA 2REXA 4RGMA 3FC4A 4N6EB 2JX5A 3VRBB 2HE7A 3VR8B 2C7HA 2JZ3B 5KHOA 3Q8AA 2BYVE 3PZ7A 4CHKA 2YVCA 2O6VD 1QT9A 4AQ7A 3P1MA 3ZJVA 4P7IA 4W9LA 4EFOA 2KWDA 3DHIC 4MH0E 2N1WA 4M8NA 2JU6X 2M4NA 2CHZA 4MSMB 2ZPNA 5HFYA 4XWWA 5GMVA 3PZDA 2KMCA 1E7VA 4GDLA 2IGHA 1JROA 2J0MA 3QJZA 1BXTA 2R61A 3CSFA 2Q5WD 3CF6E 4YTPB 4HK2A 1DYQA 4GSWA 2KDFB 3AECB 4W9JA 5CHFA 1FRRA 1WXVA 4A9AA 4WAFA 2WXIA 2W82A 2HDEA 1YIWA 2KFJA 3EFUA 2ZNVC 1GC7A 1YJJA 1WM2A 1WM3A 5HKHA 1ZXIA 3SFDB 2I1JA 3B2GA 2KD0A 1V9JA 2V4IB 3Q3JA 3WAOA 1PGXA 2Y5CA 1TBEA 4NJ7A 5D6JB 2GI9A 3WALA 2JYTA 2OJRA 4ICUA 2PPHA 2KT7A 5DPRA 4KGSA 1NDDA 2LD9A 3NHEB 1WMHB 3L0WB 1JWSD 5HG2A 1UD7A 3UIPB 3DBHB 3PV1A 1IGDA 2VZKD 4ZHOA 1RRBA 2PTLA 2V0GA 2KLGA 3U30A 1P98A 3VR9B 2AQ3B 3VTUA 2Y5PA 1T0SC 3H1UA 4RMAA 4P6VF 3VUXA 2K0PA 3M63B 5BYRA 4EKUA 2C9WB 2KXJA 3W5VB 2KX3A 1Y56A 2W3RA 5EE1A 1F1HA 4OZBA 4MM3A 2KWCA 1JW9D 3NVWA 2FCQA 1I4QA 3ZW3A 4R3DA 2IDYA 1KFYB 3NVYA 2WXMA 1I4HA 2UYZB 1Y8RC 4FHJA 3N30A 3U7DA 1IGCA 5D94A 4GXBA 4RGOS 4HJGE 3RD2A 2K3UA 3MC8A 3VUYA 1Z5SB 4NJCA 2G1EA 3SD5A 4YSXB 3K9OB 2NS5A 2XK5A 1T3QA 3IAS1 3SU8X 4A3OA 4F1SA 1WSPA 1P0RA 2IO0B 1WE7A 1L2NA 2QDFA 1ZPSA 1T0QC 1UWXA 3IT6B 2MW5A 1EWCA 3ZXRA 5HI1A 3T3NA 3AE1B 3ZNZB 1SBBB 1HTOA 3P4RB 2BYTA 2GBRA 2PVGC 1WJNA 2LFIA 4S17A 1V1OA 5G5HA 4TKNA 3AE2B 5KHQA 1D5MC 1SE4A 1QF6A 2BGFA 1K53A 4BKGA 4EZLA 4IOIE 3MFGA 1LXDA 2D07B 2ASQA 1UGMA 3HVDA 4N9F4 2LJIA 1Q10A 2ACZB 4WAAA 4ZRKA 1EU4A 4JL9A 2ON8A 4ZYSA 5IN7A 1QLBB 1TY2A 2MH7A 4YWGG 2DX5B 1AW7A 4DXFA 3KVFB 1YOVB 4ICVA 2G45B 4JGHB 2FIFA 1XEEA 2N9KA 4YTMB 3KWLA 3VTVA 4IWPA 2IO2B 2PJHA 3IHPC 2ZPYA 4MGZE 2DZMA 2KTRB 2GBJA 2KQ4X 5D3DA 1UWMA 2KN5A 2V1YA 3TCAA 4RH6A 2V3PA 2XEWA 4XZ4A 2GMIC 3ZRCA 1C4AA 1N6ZA 2E6XA 1ZUD2 4W9FA 2O6VB 4ZRPA 2ZVOA 4HDOA 4EEWA 3H7PA 2WNMA 3Q8BA 4AP4C 3UQAA 3PZ8A 2C7MB 3V6EB 4MEMA 2CHXA 3M62B 4NQLB 2CHWA 2LXCA 3EFCA 3ZNHB 4PYUA 4RGTA 4IW0A 3AU4A 1YQ4B 4MJSB 1MPEA 3N3KB 2WLBA 2D10A 1XD3B 1WX8A 1YN4A 1E5WA 5D3IB 1VJKA 4S0RA 2WQYB 3H7SA 1FNVA 4LNIA 1E10A 5H92C 2VH1A 1JWAD 2L83A 4K3CA 2WXNA 4P1BC 1WX9A 4WQMA 1UBIA 2Y5BB 1C1YB 5DPTA 1HXYD 3AN1A 2HTME 3QCAA 4YTNB 2PEAA 4II3B 4W9EA 1TY0A 2MBHA 1RWSA 4LJPB 4GMVA 2N4FA 2BQQA 2KQ7A 1D5ZC 3GB1A 3ECIA 4HPPA 4B9KA 4OZAA 2LVQA 3SEBA 4K1RB 1T0RC 1IP9A 3V61A 4M01A 1SXTA 2VZKB 2K9XA 2MLBA 1OEYA 3RULA 1WJ4A 5HHDG 1JWMD 2WHIA 3RCZA 1NENB 1CK1A 1A70A 3APDA 4KX6B 4NPNA 3SHQA 1L0YB 4FN2A 3V60A 1YX5B 4DBGA 2JXTA 3TBLD 2QILA 1WF9A 2JZZA 2N9XA 3Q6BA 1UZXB 3W1YA 4F8CB 1ET6A 2NTSA 1ROEA 3FKYA 4C4VB 4WWNA 3AEAB 3ZDMC 3FILB 3VH4B 3BWUD 5CHWA 4C80A 4NZLB 4XYCA 2WGSA 4JX1C 3DBSA 1WMHA 1RAXA 3O13A 3VXWA 2KZRA 5AZFA 3UQBA 3TIXA 4UDUC 5AEKB 2DYOA 3NZSA 3GS2A 3NVVA 1TZ1A 1T6BX 3MP9A 4JLCA 3U8ZA 4GB9A 2BKRB 1SJHD 2INDC 2LASA 5J2RA 4CQNA 2R2QA 3MC0B 2D3CA 5E6PA 3KH0A 2MA9B 1OQQA 2JRHA 4CO7A 2MJ3A 2G3QB 2Z59B 3U52E 4AOFA 1E6EB 2MP2B 5C3JB 2CJOA 5MPOA 3Q8EA 3L16A 2WXKA 4WWOA 4DDID 3PLVA 2K25A 2CKHB 4W9IA 3DQVA 1EUVB 3KWVA 2V3NA 3BK1A 2IY1B 1FFVA 3BYYB 2INNE 2ZW0A 4DWFA 1DOIA 5I4DA 1N60A 3SDLC 2CU3A 2L52A 1I35A 4XE0A 2IO3B 2BTEA 4REZA 3KUDB 3Q2AC 3AE5B 3KLSX 1Q1OA 3QK0A 4MGIE 3ZGZA 4AS1A 4RM8A 4QAYA 1DGJA 2LVOA 4X57B 3AE6B 5BYQA 2FE8A 1J0GA 2V3SA 2KQSA 1E8XA 1F9JA 1N5WA 1J7BA 2NMQA 4KGTA 1JCKB 2AL6A 2M17A 1WRIA 4PS3A 1NVID 2PE9A 4MELA 1HEZE 5EDSA 3PGEA 5D7GA
chains in the Genus database with same CATH topology
1WM3A 1S1QB 1EF5A 5HKHA 1GC6A 2LGXA 4HLEA 2I1JA 4IC7B 2D3GA 2KD0A 5LXIB 2NBVB 2C60A 3TL5A 1V9JA 2K8HA 3Q3JA 3WAOA 4EUTA 4GIVA 1V49A 2DZIA 3Q3FA 5FR6A 2L05A 1TBEA 4NJ7A 5D6JB 3WALA 2MQJA 3AXCA 3QIJA 3ZTDA 1U4AA 2KOXA 2XBBC 2OJRA 4ICUA 4A20A 1WXMA 1IPGA 2PPHA 2N9PC 4LDTB 5DPRA 1WJ6A 1NDDA 3AI5A 3DOWA 1TGZB 5JH5C 2K6QA 2WX1A 2LD9A 3A1QB 3NHEB 1RFAA 1WMHB 3L0WB 4FJVB 1YQBA 3WIMA 4GN1A 1UD7A 2N1VA 4F7ZA 2KFKB 3UIPB 4ANUA 4ZDVA 3PV1A 4KSLC 3DBLI 4KZ0A 4RM9A 3ZVVA 4BKSD 1RRBA 1WGYA 2KTRA 2KLGA 3HM3A 2HD5B 4BKTA 3I3TB 2L3ZA 1P98A 3D32A 3U30A 1C3TA 2L0FA 3M3JA 4K7SA 3VTUA 5LLIA 4KIKB 3H1UA 4RMAA 2G4DB 3VUXA 3M63B 2GBNA 1HE8A 4EKUA 1LFDA 2C9WB 2KXJA 4HCNB 2KX3A 2K39A 4W9GA 3B0AA 1UBQA 3ZIMA 4B95A 2K6DB 2O6VA 1R4MI 4MM3A 4IM2A 1L7YA 4GDKA 3KYCD 2KWCA 3V6CB 1EO6A 2LRWA 3GZNI 3QARA 1E8ZA 3PS6A 1KM7A 2FCQA 4KDIC 3ZW3A 4HPLB 4CYEA 2J7QB 2NCNA 2UYZB 2LGYA 5J17A 1Y8RC 1TTNA 4FHJA 3N30A 2HJ8A 3U7DA 2JY6A 3JW0X 4BBNC 5D94A 4GXBA 4MJSA 2DYMA 3RD2A 4DHJD 5DCNA 3VUYA 2BWES 4LCDE 4BVUC 3CSTA 1Z5SB 2O2VA 4JIOU 3ZDTA 2UWQA 4FLHA 2KDEB 1SE9A 1J8CA 3SD5A 2L0TA 3A33B 3HIZA 4KV2A 3K9OB 4AWJA 2JXXA 2NS5A 2DENB 2MBEA 2B3AA 2XK5A 4WWPA 3L17A 4E3CA 4JQWC 2KMAA 1NBFC 3SU8X 3IBEA 4A3OA 4PS7A 2KTFA 2KKCA 4OVVA 4F1SA 3MJWA 4KVGB 3DVNU 4I6PA 1P0RA 1OQYA 2D2QA 5IAAC 1XQQA 2IO0B 1WE7A 1L2NA 3C0RB 2YLMA 4GOCA 1WGHA 3HK0A 2K8CA 4M8MA 2D11A 2FAZA 1E8YA 4K7UA 1WR6E 2ZCBA 3PSEB 4ZYNA 2ZNVB 4DXAB 2EKEC 3ALBA 1T0YA 1KOTA 2HTHA 2MW5A 3UQBA 4LJOB 1YD8U 5E6NA 2K8BA 1GUAB 3A9KB 1WXAA 2DAFA 2L8JA 3W1SA 2L00B 3ZNZB 3NOBA 3NY5A 3WAMA 3B08A 2JUOA 1P3QU 3O65B 1YJ1A 2NR2A 3ZNID 1RLFA 3IFWB 4NAWB 4G0NB 1WH3A 2GBRA 2NPTA 4HCPB 4GDLB 5J18A 1WJNA 2LI5A 4MDKE 2KANA 3JYUA 5D2MB 2M8SA 3DVNV 2BPSA 4BKSA 4WJOA 4TKNA 1EF1A 3VAWA 3QAQA 4XC2A 1ZKHA 2LZ6A 1AARA 5KHQA 3PT2B 2CR5A 4DK5A 2BGFA 3L08A 3A4RA 2MWSB 4A3PA 1OTRB 4BKGA 4EZLA 2M1MA 2FNJB 1LXDA 2WX0A 2EMTA 2D07B 2ASQA 1UGMA 4IG7B 3QC8B 1I42A 1S3SG 2AYOB 4N9F4 3A9JB 3VUWA 4W9DA 2IY0B 4WAAA 5C23A 5G2NA 4ZRKA 5C1ZA 3ML9A 1BT0A 2ZJDA 2KC1A 2WYQA 1WXSA 4JL9A 3W1SC 2WWZA 3UGBB 2KHWB 3QA8A 1VD2A 3VVWB 2KDIA 3MHSD 3L13A 2KNBA 4DHZE 3DDCB 4K81A 3KUCB 2DX5B 4BFRA 3KYDD 2RGFA 4KDLB 1OGWA 3UINB 3KVFB 2WDTB 3OJ3A 4ICVA 2G45B 4JGHB 2FIFA 2RD0A 4NJ6A 3VQIA 3VTVA 4IWPA 4MSQB 3R66C 2IO2B 2PJHA 3IHPC 2ZPYA 4MGZE 2MX2A 1IYFA 2DZMA 1WY8A 2RR9A 3DVGX 2KTRB 4FA6A 5AZHA 2GBJA 4GU2A 2KN5A 4PS8A 2V1YA 3UIOB 3TCAA 3R3MA 4HJKA 2XEWA 4NNJB 2ZCCA 4W9CA 2FCMA 4XZ4A 2KWVB 2GMIC 3V62A 4NY0A 3ZRCA 2GOWA 3H9DA 4URKA 2L76A 2MBBB 3NS8A 4FHKA 4W9FA 2O6VB 4WJPA 2OOBB 2ZVOA 3PLUA 3QHTA 4HDOA 4EEWA 1A5RA 3H7PA 4GDKB 1XT9B 3EECA 2L7RA 4AP4C 1R4NI 3UQAA 2C7MB 3OJ4B 3V6EB 4MEMA 4KZCA 2CHXA 3M62B 3PRMB 2RSUA 4NQLB 1GG3A 4EZKA 3VTWA 1E8WA 1ZGUB 3PTFC 2CHWA 2MP2A 4LDTD 3ZLZA 2LXCA 3ZNHB 4PYUA 4E71A 3T8MA 2BYEA 3K9PB 3APCA 4FULA 3WA0A 4DHZB 4IW0A 1MG8A 4EZJA 1KJTA 3AU4A 4AJWA 1V5TA 4MJSB 3RUIB 2NVUI 3PREA 1H8CA 3N3KB 3OAWA 4WQOB 4MGKE 3DCGA 2D10A 2DZJA 3P2BA 1V5OA 2KK8A 2O2VB 2A5UA 1XD3B 1WX8A 2J0JA 1E5WA 3PRZA 1WE6A 3H7SA 4WJNA 2Z0EB 2XK5B 2DHZA 2R2OA 4OVUA 4HVBA 2QHOA 3PRPB 2G4SA 3WAPA 4ZRIA 2JT4B 4NQKE 1V80A 2AL3A 2LVPA 4AJYB 1WX9A 2KJ6A 1UBIA 2Y5BB 2DYBA 1C1YB 2I1KA 4FJZA 5DPTA 3QCAA 5L95C 3AU5A 2PEAA 4TQ1A 4II3B 2DAJA 4W9EA 2FIDA 2MBOA 1VCBA 2MBHA 3IG3A 2CS4A 2KO3A 4LJPB 2ZVNA 4GMVA 3QWZB 4ZRJA 1ZW7A 2N4FA 5JZEB 1V86A 2KQ7A 1WFYA 3ENEA 1SIFA 1G6JA 5G55A 4I6LB 3ECIA 1LQBA 3LDZE 5TR5A 4B9KA 2JRIB 2KC2A 4HXDA 2NPTB 3JSVA 2LVQA 2N7EA 3R7RA 4K1RB 3ZRFA 2KJRA 3L10B 1V2YA 1WGDA 2C5LC 5E6OA 3PHXB 3VHTC 3V61A 3ZKJC 1IP9A 2MSED 5DPSA 3KW5B 2MLBA 1OEYA 3RULA 1WJ4A 3ZO5B 3RCZA 3EC8A 2LRUA 4XX5A 3RYTA 4BBNF 3APDA 5CTRC 1JRUA 4NPNA 3VDZA 3SHQA 1SGHA 4ANXA 4FN2A 3V60A 4AUQC 1QZEA 1YX5B 3QX1A 4DBGA 3TBLD 2MCNB 2M0XA 4YL8A 1WF9A 4J6IA 2N7DA 5BO4B 2JZZA 2N9XA 3A4SC 1UZXB 3W1YA 5DPWA 4F8CB 4TQ0A 2A4ZA 2JVCA 1OEYJ 3NZUA 4WJQA 3T9LA 2CU1A 3TJPA 1LM8B 2LGDA 3BY4B 3CMMB 4IWQA 2W9NA 1J19A 1GNUA 2ZEQA 4HWIB 2BWFA 2VRRB 3APFA 3L54A 1WZ0A 4WWNA 3ZDMC 3VH4B 3DVGY 5LXHA 2KX0A 3QQ8B 5CHWA 4FJYA 2BF8B 2K1FA 1Q0WB 3A1QA 2C7NB 3X0WA 1PQSA 4EOYA 3B1LX 3DBSA 1WMHA 1RAXA 2GBMA 3VXWA 4IM0A 2KZRA 4W9KA 5AZFA 2BKFA 4DHJB 4IM3A 3TIXA 2KVRA 1WX7A 4FBJB 2V4LA 2KFKA 4II2B 5AEKB 2DYOA 1ISNA 3NZSA 2N9EB 3TMPB 1TZ1A 4K7WA 2ZZPB 4JLCA 3DBHI 3U8ZA 1KLVA 2IBIB 1CMXB 4GB9A 2BKRB 2LXAA 1UELA 3JVZX 4KIKA 3H6NA 2LASA 2NBWB 1V6EA 2LJ5A 1WI0A 5J2RA 2FCNA 2R2QA 1FXTB 2IO1B 4BOZB 4ANVA 3PHWB 5E6PA 3PPAA 3R7QA 5JHBA 3ONSA 5L83A 1V81A 3AULA 2FCSA 4DDGD 1H4RA 1E90A 1WR1A 3H7PB 3EHVA 2RPQA 4MGYE 4TUUA 3KH0A 3S2AA 2MA9B 2NBUA 1Q5WB 5CHVC 1WGGA 1D3ZA 2JRHA 4CO7A 2G3QB 2Z59B 4HDQA 1NI2A 4I6NB 4AOFA 1K8RB 3M95A 4G11A 3PVLA 2MP2B 3MTNB 1WRDB 4TV3A 3IVFA 2JPHA 2ZNVC 2KJHB 3RT3B 1UH6A 2JWZA 1YX6B 3L16A 4WWOA 3ZNGC 2LWPA 3N32A 2IZVB 2MBQA 4DDID 3RZFA 3ML8A 3PLVA 2BYFA 4M0WB 1P1AA 2AEHA 2K25A 1P9DU 2REXA 3VH3B 1WIAA 1WGRA 2CKHB 3LJ3A 4W9IA 1WJUA 2EMSA 3DQVA 2HE7A 4IWOA 4E74A 1EUVB 4G50A 2C7HA 2DZKA 3ZTCA 2IY1B 2JZ3B 5KHOA 2JF5A 2BYVE 3GOEA 4KSKC 4DWFA 4CHKA 2YVCA 3KUZA 2KWUB 2O6VD 3BINA 2MRPA 4BOSC 2GBKA 3OLMD 3UF8A 3VFKA 4P7IA 4W9LA 3SDLC 4EFOA 5CX3A 2PE6B 4MH0E 3A9KA 4IUMB 1I35A 2N1WA 4M8NA 4ANWA 3DBRI 2IO3B 1GJZA 2LUEA 3WANA 3KUDB 4GGQA 1Q1OA 2M4NA 2CHZA 3QK0A 3RZWC 4MSMB 4ASWC 2ZPNA 4PYZA 3HHMA 4MGIE 4B6WA 2FUHB 4RM8A 5GMVA 1M94A 2LVOA 3PZDA 4NAWA 3X23A 2KDBA 2KMCA 1E7VA 5JHAA 4GDLA 2J0MA 3QJZA 2IYDB 4X57B 3ZUNA 3JSVB 2J0KA 3DPDA 4FADA 3CSFA 1J0GA 2V3SA 5AZGA 4G3XB 3CF6E 4HK2A 4HPMB 2KQSA 4GSWA 1E8XA 1F9JA 1Z2MA 2KDFB 4W9JA 5CHFA 2KLCA 1WZ3A 1WXVA 5IA7A 4W9HA 2AWTA 1X1MA 2AL6A 3HM6X 2M17A 4PS3A 2PE9A 4MELA 1YIWA 2KFJA 3EFUA 1E7UA 3PGEA 5EDSA 1WYWB 3A9JA 2Z0DB 1GC7A 5D7GA 1WM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM3 A;  1S1Q B;  1EF5 A;  5HKH A;  1GC6 A;  2LGX A;  4HLE A;  2I1J A;  4IC7 B;  2D3G A;  2KD0 A;  5LXI B;  2NBV B;  2C60 A;  3TL5 A;  1V9J A;  2K8H A;  3Q3J A;  3WAO A;  4EUT A;  4GIV A;  1V49 A;  2DZI A;  3Q3F A;  5FR6 A;  2L05 A;  1TBE A;  4NJ7 A;  5D6J B;  3WAL A;  2MQJ A;  3AXC A;  3QIJ A;  3ZTD A;  1U4A A;  2KOX A;  2XBB C;  2OJR A;  4ICU A;  4A20 A;  1WXM A;  1IPG A;  2PPH A;  2N9P C;  4LDT B;  5DPR A;  1WJ6 A;  1NDD A;  3AI5 A;  3DOW A;  1TGZ B;  5JH5 C;  2K6Q A;  2WX1 A;  2LD9 A;  3A1Q B;  3NHE B;  1RFA A;  1WMH B;  3L0W B;  4FJV B;  1YQB A;  3WIM A;  4GN1 A;  1UD7 A;  2N1V A;  4F7Z A;  2KFK B;  3UIP B;  4ANU A;  4ZDV A;  3PV1 A;  4KSL C;  3DBL I;  4KZ0 A;  4RM9 A;  3ZVV A;  4BKS D;  1RRB A;  1WGY A;  2KTR A;  2KLG A;  3HM3 A;  2HD5 B;  4BKT A;  3I3T B;  2L3Z A;  1P98 A;  3D32 A;  3U30 A;  1C3T A;  2L0F A;  3M3J A;  4K7S A;  3VTU A;  5LLI A;  4KIK B;  3H1U A;  4RMA A;  2G4D B;  3VUX A;  3M63 B;  2GBN A;  1HE8 A;  4EKU A;  1LFD A;  2C9W B;  2KXJ A;  4HCN B;  2KX3 A;  2K39 A;  4W9G A;  3B0A A;  1UBQ A;  3ZIM A;  4B95 A;  2K6D B;  2O6V A;  1R4M I;  4MM3 A;  4IM2 A;  1L7Y A;  4GDK A;  3KYC D;  2KWC A;  3V6C B;  1EO6 A;  2LRW A;  3GZN I;  3QAR A;  1E8Z A;  3PS6 A;  1KM7 A;  2FCQ A;  4KDI C;  3ZW3 A;  4HPL B;  4CYE A;  2J7Q B;  2NCN A;  2UYZ B;  2LGY A;  5J17 A;  1Y8R C;  1TTN A;  4FHJ A;  3N30 A;  2HJ8 A;  3U7D A;  2JY6 A;  3JW0 X;  4BBN C;  5D94 A;  4GXB A;  4MJS A;  2DYM A;  3RD2 A;  4DHJ D;  5DCN A;  3VUY A;  2BWE S;  4LCD E;  4BVU C;  3CST A;  1Z5S B;  2O2V A;  4JIO U;  3ZDT A;  2UWQ A;  4FLH A;  2KDE B;  1SE9 A;  1J8C A;  3SD5 A;  2L0T A;  3A33 B;  3HIZ A;  4KV2 A;  3K9O B;  4AWJ A;  2JXX A;  2NS5 A;  2DEN B;  2MBE A;  2B3A A;  2XK5 A;  4WWP A;  3L17 A;  4E3C A;  4JQW C;  2KMA A;  1NBF C;  3SU8 X;  3IBE A;  4A3O A;  4PS7 A;  2KTF A;  2KKC A;  4OVV A;  4F1S A;  3MJW A;  4KVG B;  3DVN U;  4I6P A;  1P0R A;  1OQY A;  2D2Q A;  5IAA C;  1XQQ A;  2IO0 B;  1WE7 A;  1L2N A;  3C0R B;  2YLM A;  4GOC A;  1WGH A;  3HK0 A;  2K8C A;  4M8M A;  2D11 A;  2FAZ A;  1E8Y A;  4K7U A;  1WR6 E;  2ZCB A;  3PSE B;  4ZYN A;  2ZNV B;  4DXA B;  2EKE C;  3ALB A;  1T0Y A;  1KOT A;  2HTH A;  2MW5 A;  3UQB A;  4LJO B;  1YD8 U;  5E6N A;  2K8B A;  1GUA B;  3A9K B;  1WXA A;  2DAF A;  2L8J A;  3W1S A;  2L00 B;  3ZNZ B;  3NOB A;  3NY5 A;  3WAM A;  3B08 A;  2JUO A;  1P3Q U;  3O65 B;  1YJ1 A;  2NR2 A;  3ZNI D;  1RLF A;  3IFW B;  4NAW B;  4G0N B;  1WH3 A;  2GBR A;  2NPT A;  4HCP B;  4GDL B;  5J18 A;  1WJN A;  2LI5 A;  4MDK E;  2KAN A;  3JYU A;  5D2M B;  2M8S A;  3DVN V;  2BPS A;  4BKS A;  4WJO A;  4TKN A;  1EF1 A;  3VAW A;  3QAQ A;  4XC2 A;  1ZKH A;  2LZ6 A;  1AAR A;  5KHQ A;  3PT2 B;  2CR5 A;  4DK5 A;  2BGF A;  3L08 A;  3A4R A;  2MWS B;  4A3P A;  1OTR B;  4BKG A;  4EZL A;  2M1M A;  2FNJ B;  1LXD A;  2WX0 A;  2EMT A;  2D07 B;  2ASQ A;  1UGM A;  4IG7 B;  3QC8 B;  1I42 A;  1S3S G;  2AYO B;  4N9F 4;  3A9J B;  3VUW A;  4W9D A;  2IY0 B;  4WAA A;  5C23 A;  5G2N A;  4ZRK A;  5C1Z A;  3ML9 A;  1BT0 A;  2ZJD A;  2KC1 A;  2WYQ A;  1WXS A;  4JL9 A;  3W1S C;  2WWZ A;  3UGB B;  2KHW B;  3QA8 A;  1VD2 A;  3VVW B;  2KDI A;  3MHS D;  3L13 A;  2KNB A;  4DHZ E;  3DDC B;  4K81 A;  3KUC B;  2DX5 B;  4BFR A;  3KYD D;  2RGF A;  4KDL B;  1OGW A;  3UIN B;  3KVF B;  2WDT B;  3OJ3 A;  4ICV A;  2G45 B;  4JGH B;  2FIF A;  2RD0 A;  4NJ6 A;  3VQI A;  3VTV A;  4IWP A;  4MSQ B;  3R66 C;  2IO2 B;  2PJH A;  3IHP C;  2ZPY A;  4MGZ E;  2MX2 A;  1IYF A;  2DZM A;  1WY8 A;  2RR9 A;  3DVG X;  2KTR B;  4FA6 A;  5AZH A;  2GBJ A;  4GU2 A;  2KN5 A;  4PS8 A;  2V1Y A;  3UIO B;  3TCA A;  3R3M A;  4HJK A;  2XEW A;  4NNJ B;  2ZCC A;  4W9C A;  2FCM A;  4XZ4 A;  2KWV B;  2GMI C;  3V62 A;  4NY0 A;  3ZRC A;  2GOW A;  3H9D A;  4URK A;  2L76 A;  2MBB B;  3NS8 A;  4FHK A;  4W9F A;  2O6V B;  4WJP A;  2OOB B;  2ZVO A;  3PLU A;  3QHT A;  4HDO A;  4EEW A;  1A5R A;  3H7P A;  4GDK B;  1XT9 B;  3EEC A;  2L7R A;  4AP4 C;  1R4N I;  3UQA A;  2C7M B;  3OJ4 B;  3V6E B;  4MEM A;  4KZC A;  2CHX A;  3M62 B;  3PRM B;  2RSU A;  4NQL B;  1GG3 A;  4EZK A;  3VTW A;  1E8W A;  1ZGU B;  3PTF C;  2CHW A;  2MP2 A;  4LDT D;  3ZLZ A;  2LXC A;  3ZNH B;  4PYU A;  4E71 A;  3T8M A;  2BYE A;  3K9P B;  3APC A;  4FUL A;  3WA0 A;  4DHZ B;  4IW0 A;  1MG8 A;  4EZJ A;  1KJT A;  3AU4 A;  4AJW A;  1V5T A;  4MJS B;  3RUI B;  2NVU I;  3PRE A;  1H8C A;  3N3K B;  3OAW A;  4WQO B;  4MGK E;  3DCG A;  2D10 A;  2DZJ A;  3P2B A;  1V5O A;  2KK8 A;  2O2V B;  2A5U A;  1XD3 B;  1WX8 A;  2J0J A;  1E5W A;  3PRZ A;  1WE6 A;  3H7S A;  4WJN A;  2Z0E B;  2XK5 B;  2DHZ A;  2R2O A;  4OVU A;  4HVB A;  2QHO A;  3PRP B;  2G4S A;  3WAP A;  4ZRI A;  2JT4 B;  4NQK E;  1V80 A;  2AL3 A;  2LVP A;  4AJY B;  1WX9 A;  2KJ6 A;  1UBI A;  2Y5B B;  2DYB A;  1C1Y B;  2I1K A;  4FJZ A;  5DPT A;  3QCA A;  5L95 C;  3AU5 A;  2PEA A;  4TQ1 A;  4II3 B;  2DAJ A;  4W9E A;  2FID A;  2MBO A;  1VCB A;  2MBH A;  3IG3 A;  2CS4 A;  2KO3 A;  4LJP B;  2ZVN A;  4GMV A;  3QWZ B;  4ZRJ A;  1ZW7 A;  2N4F A;  5JZE B;  1V86 A;  2KQ7 A;  1WFY A;  3ENE A;  1SIF A;  1G6J A;  5G55 A;  4I6L B;  3ECI A;  1LQB A;  3LDZ E;  5TR5 A;  4B9K A;  2JRI B;  2KC2 A;  4HXD A;  2NPT B;  3JSV A;  2LVQ A;  2N7E A;  3R7R A;  4K1R B;  3ZRF A;  2KJR A;  3L10 B;  1V2Y A;  1WGD A;  2C5L C;  5E6O A;  3PHX B;  3VHT C;  3V61 A;  3ZKJ C;  1IP9 A;  2MSE D;  5DPS A;  3KW5 B;  2MLB A;  1OEY A;  3RUL A;  1WJ4 A;  3ZO5 B;  3RCZ A;  3EC8 A;  2LRU A;  4XX5 A;  3RYT A;  4BBN F;  3APD A;  5CTR C;  1JRU A;  4NPN A;  3VDZ A;  3SHQ A;  1SGH A;  4ANX A;  4FN2 A;  3V60 A;  4AUQ C;  1QZE A;  1YX5 B;  3QX1 A;  4DBG A;  3TBL D;  2MCN B;  2M0X A;  4YL8 A;  1WF9 A;  4J6I A;  2N7D A;  5BO4 B;  2JZZ A;  2N9X A;  3A4S C;  1UZX B;  3W1Y A;  5DPW A;  4F8C B;  4TQ0 A;  2A4Z A;  2JVC A;  1OEY J;  3NZU A;  4WJQ A;  3T9L A;  2CU1 A;  3TJP A;  1LM8 B;  2LGD A;  3BY4 B;  3CMM B;  4IWQ A;  2W9N A;  1J19 A;  1GNU A;  2ZEQ A;  4HWI B;  2BWF A;  2VRR B;  3APF A;  3L54 A;  1WZ0 A;  4WWN A;  3ZDM C;  3VH4 B;  3DVG Y;  5LXH A;  2KX0 A;  3QQ8 B;  5CHW A;  4FJY A;  2BF8 B;  2K1F A;  1Q0W B;  3A1Q A;  2C7N B;  3X0W A;  1PQS A;  4EOY A;  3B1L X;  3DBS A;  1WMH A;  1RAX A;  2GBM A;  3VXW A;  4IM0 A;  2KZR A;  4W9K A;  5AZF A;  2BKF A;  4DHJ B;  4IM3 A;  3TIX A;  2KVR A;  1WX7 A;  4FBJ B;  2V4L A;  2KFK A;  4II2 B;  5AEK B;  2DYO A;  1ISN A;  3NZS A;  2N9E B;  3TMP B;  1TZ1 A;  4K7W A;  2ZZP B;  4JLC A;  3DBH I;  3U8Z A;  1KLV A;  2IBI B;  1CMX B;  4GB9 A;  2BKR B;  2LXA A;  1UEL A;  3JVZ X;  4KIK A;  3H6N A;  2LAS A;  2NBW B;  1V6E A;  2LJ5 A;  1WI0 A;  5J2R A;  2FCN A;  2R2Q A;  1FXT B;  2IO1 B;  4BOZ B;  4ANV A;  3PHW B;  5E6P A;  3PPA A;  3R7Q A;  5JHB A;  3ONS A;  5L83 A;  1V81 A;  3AUL A;  2FCS A;  4DDG D;  1H4R A;  1E90 A;  1WR1 A;  3H7P B;  3EHV A;  2RPQ A;  4MGY E;  4TUU A;  3KH0 A;  3S2A A;  2MA9 B;  2NBU A;  1Q5W B;  5CHV C;  1WGG A;  1D3Z A;  2JRH A;  4CO7 A;  2G3Q B;  2Z59 B;  4HDQ A;  1NI2 A;  4I6N B;  4AOF A;  1K8R B;  3M95 A;  4G11 A;  3PVL A;  2MP2 B;  3MTN B;  1WRD B;  4TV3 A;  3IVF A;  2JPH A;  2ZNV C;  2KJH B;  3RT3 B;  1UH6 A;  2JWZ A;  1YX6 B;  3L16 A;  4WWO A;  3ZNG C;  2LWP A;  3N32 A;  2IZV B;  2MBQ A;  4DDI D;  3RZF A;  3ML8 A;  3PLV A;  2BYF A;  4M0W B;  1P1A A;  2AEH A;  2K25 A;  1P9D U;  2REX A;  3VH3 B;  1WIA A;  1WGR A;  2CKH B;  3LJ3 A;  4W9I A;  1WJU A;  2EMS A;  3DQV A;  2HE7 A;  4IWO A;  4E74 A;  1EUV B;  4G50 A;  2C7H A;  2DZK A;  3ZTC A;  2IY1 B;  2JZ3 B;  5KHO A;  2JF5 A;  2BYV E;  3GOE A;  4KSK C;  4DWF A;  4CHK A;  2YVC A;  3KUZ A;  2KWU B;  2O6V D;  3BIN A;  2MRP A;  4BOS C;  2GBK A;  3OLM D;  3UF8 A;  3VFK A;  4P7I A;  4W9L A;  3SDL C;  4EFO A;  5CX3 A;  2PE6 B;  4MH0 E;  3A9K A;  4IUM B;  1I35 A;  2N1W A;  4M8N A;  4ANW A;  3DBR I;  2IO3 B;  1GJZ A;  2LUE A;  3WAN A;  3KUD B;  4GGQ A;  1Q1O A;  2M4N A;  2CHZ A;  3QK0 A;  3RZW C;  4MSM B;  4ASW C;  2ZPN A;  4PYZ A;  3HHM A;  4MGI E;  4B6W A;  2FUH B;  4RM8 A;  5GMV A;  1M94 A;  2LVO A;  3PZD A;  4NAW A;  3X23 A;  2KDB A;  2KMC A;  1E7V A;  5JHA A;  4GDL A;  2J0M A;  3QJZ A;  2IYD B;  4X57 B;  3ZUN A;  3JSV B;  2J0K A;  3DPD A;  4FAD A;  3CSF A;  1J0G A;  2V3S A;  5AZG A;  4G3X B;  3CF6 E;  4HK2 A;  4HPM B;  2KQS A;  4GSW A;  1E8X A;  1F9J A;  1Z2M A;  2KDF B;  4W9J A;  5CHF A;  2KLC A;  1WZ3 A;  1WXV A;  5IA7 A;  4W9H A;  2AWT A;  1X1M A;  2AL6 A;  3HM6 X;  2M17 A;  4PS3 A;  2PE9 A;  4MEL A;  1YIW A;  2KFJ A;  3EFU A;  1E7U A;  3PGE A;  5EDS A;  1WYW B;  3A9J A;  2Z0D B;  1GC7 A;  5D7G A;  1WM2 A; 
#chains in the Genus database with same CATH topology
 4WIP A;  1GC6 A;  4NAM A;  4IC7 B;  1IUE A;  4O1N A;  5LXI B;  3MHZ A;  3TL5 A;  2K8H A;  2DZI A;  3Q3F A;  3NRZ A;  3ZTD A;  3AXC A;  3QIJ A;  3NZ3 A;  1U4A A;  2KOX A;  1FMA D;  4A20 A;  1WXM A;  3KQ4 A;  4M02 A;  2N9L A;  3GP7 A;  1V97 A;  3DOW A;  2WX1 A;  1NEK B;  4FJV B;  3LXF A;  1WGK A;  3Q8F A;  2N1V A;  3WCQ A;  2OED A;  1VZ6 A;  2KFK B;  2I2Y A;  4ANU A;  4ZDV A;  4RM9 A;  1WGY A;  2KTR A;  3B9J A;  4LNK A;  2HD5 B;  4BKT A;  2L3Z A;  1MVK A;  1YNT E;  5LLI A;  1ZXH A;  1YN5 A;  4HCN B;  2PMV A;  1TIF A;  1YN3 A;  3B0A A;  3ZIM A;  4B95 A;  2K6D B;  2O6V A;  4IM2 A;  4MAC A;  3V6C B;  3GZN I;  1TKE A;  3PS6 A;  1KLU D;  1KM7 A;  4KDI C;  1XXG A;  4BZA A;  4N58 A;  2H89 B;  4KKJ A;  1TS5 A;  2WP9 B;  1TTN A;  2HJ8 A;  2JY6 A;  1HTQ A;  2CJN A;  4MJS A;  2LUM A;  3NJT A;  2BWE S;  4BVU C;  1LGR A;  3ZDT A;  3DWM A;  1J8C A;  3A33 B;  4AWJ A;  2JXX A;  4HRS A;  1MI0 A;  2B3A A;  2MBE A;  3L17 A;  2BS3 B;  3R2T A;  4PS7 A;  2KTF A;  4ARI A;  2KKC A;  4OVV A;  1BUI C;  1FNW A;  2V9H A;  1AN8 A;  1OQY A;  1XQQ A;  2JZP A;  1SSN A;  3C0R B;  4GOC A;  1WGH A;  4L1B A;  2K8C A;  4M8M A;  2D11 A;  2MHJ A;  2FAZ A;  2ZCB A;  3PSE B;  1FFU A;  1VZ7 A;  2EKE C;  3ALB A;  1T0Y A;  1KOT A;  3HUI A;  5E6N A;  2K8B A;  1GUA B;  3A9K B;  2L8J A;  3W1S A;  2L00 B;  2I38 A;  3NY5 A;  3WAM A;  3B08 A;  1HA5 A;  3DHH C;  3O65 B;  4WUR A;  1PFD A;  2NR2 A;  1RLF A;  4NAW B;  4G0N B;  1WH3 A;  5J18 A;  5D2M B;  2M8S A;  4WJO A;  2YEP F;  4EE2 A;  1EF1 A;  1SE3 A;  2GRI A;  1ZKH A;  2MWS B;  2M1M A;  1M4V A;  2EMT A;  3URY A;  4IG7 B;  3QC8 B;  1S3S G;  3A9J B;  3R2I A;  3VUW A;  4B0E A;  2IY0 B;  3P4P B;  5C1Z A;  1BT0 A;  1ACC A;  2WYQ A;  2BT6 A;  3W1S C;  2WWZ A;  3UGB B;  3ZXV A;  2K22 A;  2DNF A;  2KHW B;  4DXG A;  4C4V A;  1VD2 A;  3FIL A;  2KDI A;  3MHS D;  3L13 A;  2KNB A;  4JE3 B;  1KLG D;  1LO5 D;  3PO0 A;  4K81 A;  2PIA A;  2LMC A;  3KYD D;  3U4E G;  3UIN B;  3OJ3 A;  4NJ6 A;  1FD6 A;  5FR3 A;  3R66 C;  3ZJT A;  3AMZ A;  1WY8 A;  1TS4 A;  3DVG X;  3UIO B;  1FXA A;  3RN9 C;  4P1C C;  2KWV B;  1RM6 C;  5IOI A;  4LLG M;  2M56 B;  3GZN B;  3H9D A;  2L76 A;  3MC9 A;  3RNF C;  1R4N I;  2MJD A;  3RPF C;  2M0A A;  3VTW A;  1E8W A;  1SEB D;  2MP2 A;  2KAJ A;  3T8M A;  3K9P B;  3APC A;  4FUL A;  1R7S A;  1MG8 A;  2IGD A;  4EZJ A;  3RNE C;  1V5T A;  3PRE A;  1H8C A;  3OAW A;  4WQO B;  1CJE A;  4MGK E;  3DCG A;  2O2V B;  2A5U A;  1TKY A;  2J0J A;  3U7Z A;  3ETR A;  2DHZ A;  1E9M A;  4HVB A;  2QHO A;  3PRP B;  2G4S A;  2ICI A;  2TSS A;  4NQK E;  2LHD A;  2DYB A;  4FJZ A;  2MJE A;  1JWB D;  2DAJ A;  2FID A;  4ZOH C;  2RDH A;  2KO3 A;  4ZRJ A;  2WU2 B;  4A90 A;  5JXV A;  5JZE B;  1WFY A;  3ENE A;  1SIF A;  1ENF A;  1G6J A;  2JRI B;  4TMA B;  2X8X X;  4HXD A;  4LNO A;  2GB1 A;  1NYR A;  2NPT B;  3T3O A;  2KJR A;  3L10 B;  3PHX B;  3VHT C;  3ZKJ C;  2LGI A;  3Q8C A;  3DWG C;  1CQV A;  2WDQ B;  4ARC A;  3AV8 A;  3VDZ A;  4ANX A;  4AUQ C;  1I4R A;  4J6I A;  3A4S C;  2KYW A;  5DPW A;  1MJD A;  1SJE D;  1OEY J;  3NZU A;  3T9L A;  3TJP A;  2LGD A;  1L4Z B;  4IDI A;  3CMM B;  4IWQ A;  4XGA B;  4HWI B;  2ZEQ A;  1RFK A;  2BWF A;  3APF A;  3L54 A;  3DVG Y;  2KX0 A;  1FRD A;  4FJY A;  2BF8 B;  1GPX A;  4KGR A;  2DLB A;  3X0W A;  4EOY A;  5C2T B;  2W55 A;  1P7E A;  1D5X C;  2KFK A;  3RMK C;  4YT0 B;  3TMP B;  1K50 A;  4K7W A;  3BZD B;  3AED B;  1DOX A;  3RNC C;  1CMX B;  2LXA A;  1DOY A;  1JAL A;  3JVZ X;  1PYW D;  3H6N A;  1QKZ A;  1V6E A;  3EGR A;  4BOZ B;  1R4N B;  3PPA A;  3ONS A;  1V81 A;  4L2Y A;  2FCS A;  4DDG D;  1H4R A;  3Q69 A;  1HZ5 A;  1KTK A;  1WGG A;  3P42 A;  2XNA C;  1L6V A;  3BYT B;  1WRD B;  4TV3 A;  3TEY A;  4OHJ A;  2JPH A;  1JRP A;  1UNS A;  1UH6 A;  2JWZ A;  3CWI A;  3IT4 B;  2BS4 B;  2B76 B;  3RNA C;  2AEH A;  3VH3 B;  3AM9 A;  1WIA A;  4D2K A;  5BMI A;  3LJ3 A;  1WJU A;  4IWO A;  4E74 A;  3ZTC A;  1AWD A;  1NYQ A;  1JWU D;  3OWE B;  3KUZ A;  2BB6 A;  3BIN A;  1MHX A;  1QOA A;  3OLM D;  4N59 A;  2RDG A;  3VFK A;  2IJ0 A;  2PE6 B;  3NUH B;  4OZC A;  3A9K A;  1B9R A;  1P7F A;  3DBR I;  4GGQ A;  1QOG A;  3RZW C;  4ASW C;  4B6W A;  3AEB B;  1N5X A;  4NAW A;  3X23 A;  2KDB A;  5JHA A;  3HVZ A;  3JSV B;  2N7J A;  1C9F A;  4FAD A;  5BYS A;  2QCZ A;  2MEK A;  5AZG A;  1B1Z A;  4HPM B;  1D4B A;  3I5J C;  1WZ3 A;  3B2F A;  4W9H A;  3N9Y C;  1X1M A;  3Q14 C;  3HM6 X;  2L1A A;  1WYW B;  3A9J A;  1EF5 A;  2H88 B;  4HLE A;  1MHH E;  2D3G A;  2LHE A;  1C4P A;  2UU7 A;  2C60 A;  2WXR A;  5G5G A;  3Q3O C;  4EUT A;  1KH0 A;  1QQR A;  3E9S A;  1IPG A;  2N9P C;  1T5X D;  1I4P A;  1L4D B;  2K6Q A;  1YQB A;  1SF0 A;  4GN1 A;  1CZP A;  2WXH A;  5AUK A;  4BKS D;  4XDD A;  3HM3 A;  1KRH A;  3D32 A;  2L0F A;  1F2R C;  3M3J A;  2G9H D;  2GBN A;  1HE8 A;  1J7C A;  2K39 A;  2EEL A;  2RMM A;  2IGG A;  1EO6 A;  1E8Z A;  1XLN A;  2L32 A;  2J7Q B;  3EUB 2;  4OW0 A;  2LGY A;  5J17 A;  2FUG 1;  4M00 A;  1OFF A;  4LCD E;  4A55 A;  3CST A;  2O2V A;  3OG5 A;  4JWU C;  4JIO U;  2KDE B;  3AE4 B;  2L0T A;  3HIZ A;  1QOF A;  2DEN B;  4WWP A;  3W9C B;  2KMA A;  3IBE A;  2LEK A;  1TJE A;  2QJL A;  3DVN U;  2D2Q A;  2DBY A;  2W3S A;  1I4G A;  2JYE A;  1V8C A;  1N63 A;  1NI3 A;  1WR6 E;  4ZYN A;  5H8Y E;  3DBR B;  4LNF A;  4RNA A;  4DXA B;  2HTH A;  2DAF A;  3AEE B;  3NOB A;  4XWT A;  4PK1 A;  2JUO A;  3ZNI D;  4USA A;  3IFW B;  5IKC M;  1TKG A;  2NPT A;  1UUP A;  5BMG A;  3NVZ A;  2BW2 A;  1VLB A;  3JYU A;  2PLP A;  2BS2 B;  3DVN V;  2BPS A;  1V1P B;  3VAW A;  3QAQ A;  4XC2 A;  1AAR A;  2QMT A;  4ACF A;  1E0Z A;  1F0Z A;  3A4R A;  4A3P A;  1OTR B;  2WX0 A;  3E56 A;  1F2R I;  5EE0 A;  5C23 A;  2KC1 A;  1WXS A;  3DHG C;  1YQ3 B;  2JQR B;  3VVW B;  2D5G A;  4MH8 A;  4DHZ E;  2BVC A;  1SIJ A;  3KUC B;  3W5U B;  4A6Q A;  2YEP B;  2RGF A;  3AEG B;  2WXL A;  1FCL A;  4KDL B;  1OGW A;  2DWQ A;  2WDT B;  1TT5 B;  3VQI A;  1ZDV A;  1IYF A;  2MX2 A;  1VRA B;  2RR9 A;  3FAH A;  4FA6 A;  4IKG A;  3H8H A;  4GU2 A;  4PS8 A;  1YMH E;  3R3M A;  4NNJ B;  4W9C A;  2FCM A;  4ZRQ A;  3V62 A;  2GOW A;  4JWS C;  1PUT A;  4FHK A;  3U2S C;  1J7A A;  2OOB B;  3PLU A;  3QHT A;  2J4X A;  4C7Y A;  4GDK B;  1XT9 B;  4TSS A;  4A8X C;  3TEX A;  5EE3 A;  4KZC A;  5GXG B;  3PRM B;  1F77 A;  1ZGU B;  3PTF C;  4LDT D;  3ZLZ A;  1PGB A;  2QC8 A;  2BYE A;  4DHZ B;  1L0X B;  3CIR B;  3RUI B;  3ZQ4 A;  1FXI A;  2DZJ A;  3P2B A;  1SB3 C;  4YXD B;  3PRZ A;  5IO9 A;  3VRA B;  4WJN A;  2Z0E B;  2R2O A;  3WAP A;  4ZRI A;  1V80 A;  2LVP A;  2M19 A;  2E3T A;  2WXP A;  4B0M A;  3AU5 A;  2MBO A;  1VCB A;  2INP E;  2CS4 A;  3AE3 B;  1VZ8 A;  3QWZ B;  1ZW7 A;  1V86 A;  3IXS A;  4I6L B;  1LQB A;  5T8I A;  3I57 A;  3JSV A;  2N7E A;  2ONQ A;  1WGD A;  2PKO A;  3RNG C;  1ESF A;  2J42 A;  2MSE D;  5DPS A;  3KW5 B;  3EC8 A;  4XX5 A;  3RYT A;  4BBN F;  5CTR C;  1TYG B;  1GAQ B;  1PDX A;  1QZE A;  2MCN B;  4YL8 A;  4LNN A;  2JVC A;  1WWT A;  1LM8 B;  3BY4 B;  2W9N A;  1GNU A;  4RCO A;  1ZDX A;  4HKQ A;  1WZ0 A;  4C00 A;  5LXH A;  2SEB D;  3QQ8 B;  2AX5 A;  5TSS A;  2KMM A;  1PGA A;  3MJ5 A;  2C7N B;  3B1L X;  2GBM A;  2SAK A;  4W9K A;  2J52 A;  1WX7 A;  2V4L A;  4II2 B;  1AYF A;  4RGN A;  2KAC A;  3GE8 C;  2AQ1 B;  2ZZP B;  1OQR A;  2NBW B;  3AE8 B;  1FPY A;  1WI0 A;  2FCN A;  2K5P A;  3AEF B;  5L83 A;  2EKI A;  1E90 A;  2QIE B;  3EHV A;  4MGY E;  1L6U A;  1K51 A;  3AB5 A;  2NBU A;  1N62 A;  1JQ4 A;  3M95 A;  1MG4 A;  3MTN B;  1IBX B;  3I63 C;  2OJW A;  1FO4 A;  2KJH B;  3BII D;  3N1X C;  2WXO A;  3LB8 C;  3N32 A;  2IZV B;  1VDV A;  4M0W B;  1P1A A;  1P9D U;  1WGR A;  4FXC A;  2EMS A;  4G50 A;  2DZK A;  3P63 A;  2JF5 A;  5FKA C;  3GOE A;  4KSK C;  2ZW1 A;  2KWU B;  2X38 A;  4HEA 1;  2MRP A;  4BOS C;  2GBK A;  3UF8 A;  4OVZ A;  5CX3 A;  1QOB A;  4ITK A;  4IUM B;  4ANW A;  1GJZ A;  2LUE A;  3BK2 A;  3AE7 B;  4K3B A;  4PYZ A;  1XLP A;  3HHM A;  2FUH B;  3N1Y C;  1M94 A;  1GB1 A;  2IYD B;  3ZUN A;  2J0K A;  3DPD A;  1EWY C;  2WXJ A;  4G3X B;  3TEZ A;  1V1P A;  1Z2M A;  2KLC A;  5IP4 D;  5IA7 A;  2AWT A;  2WDR B;  2IPK D;  4C56 C;  1F52 A;  5E6J A;  4C7Z A;  1KF6 B;  1E7U A;  2Z0D B;  3WAN A;  3BVG A;  1S1Q B;  1MFW A;  2LGX A;  5FK9 C;  2NBV B;  4GIV A;  1V49 A;  4US8 A;  5FR6 A;  2L05 A;  2MQJ A;  2KDM A;  3HRD D;  2XBB C;  5BMH A;  4LDT B;  1WJ6 A;  1XLO A;  3AI5 A;  1TGZ B;  5JH5 C;  3A1Q B;  3SR6 A;  2WS3 B;  1RFA A;  3WIM A;  2WXF A;  1TS2 A;  4F7Z A;  4KSL C;  3DBL I;  4KZ0 A;  3ZVV A;  3J9C A;  1I7H A;  3Q3M C;  3I3T B;  1C3T A;  4K7S A;  1QIL A;  4KIK B;  2G4D B;  4LK0 M;  2WXQ A;  3ZJU A;  1LFD A;  2PVO D;  2RDB C;  3LYY A;  1L0V B;  4W9G A;  1UBQ A;  1R4M I;  1HQR D;  3V05 A;  1XF5 L;  1L7Y A;  4GDK A;  3KYC D;  3BVM A;  2LRW A;  3QAR A;  4BAX A;  1WXQ A;  2HJ1 A;  3SFE B;  1WYG A;  4HPL B;  4CYE A;  1STE A;  2NCN A;  2RPV A;  3C8Y A;  1FCC C;  3JW0 X;  4BBN C;  3AH7 A;  2DYM A;  4DHJ D;  5DCN A;  4YSZ B;  1UGJ A;  1FIQ A;  2UWQ A;  2JWU A;  4FLH A;  1SE9 A;  4KV2 A;  2Z8L A;  1ZP0 B;  4E3C A;  3R8B A;  4JQW C;  1NBF C;  1GB4 A;  3Q3N C;  3TUO A;  1ZE3 D;  3MJW A;  4KVG B;  4Q2J A;  4I6P A;  2INC C;  5IAA C;  2KN4 A;  2YLM A;  3HK0 A;  1E8Y A;  4K7U A;  1XCT L;  1EU3 A;  2WXG A;  2ZNV B;  4LJO B;  3I9V 1;  1I4X A;  1YD8 U;  2QSD A;  4KKI A;  1WXA A;  1P3Q U;  1YJ1 A;  4HCP B;  4GDL B;  2LI5 A;  4MDK E;  2KAN A;  1FM0 D;  4BKS A;  4MT5 A;  3RFZ B;  1GOZ A;  3RNB C;  2BBC A;  2LZ6 A;  3PT2 B;  2CR5 A;  4DK5 A;  3L08 A;  2FNJ B;  2VH2 A;  4J3O D;  3C19 A;  1I42 A;  2AYO B;  1ET9 A;  4W9D A;  1EM7 A;  1TS3 A;  5G2N A;  5EE9 A;  3ML9 A;  2ZJD A;  3AE9 B;  4WWM A;  3QA8 A;  3DDC B;  4HRO A;  1E7P B;  4BFR A;  1C77 A;  3DBL B;  2RD0 A;  2AQ2 B;  4MSQ B;  2KVZ A;  3TSS A;  5AZH A;  2D3A A;  2BB5 A;  2PW9 A;  1C78 A;  4HJK A;  4XDC A;  1R4M B;  2ZCC A;  4NY0 A;  4URK A;  3L4P A;  2MBB B;  3NS8 A;  4WJP A;  1VR9 A;  1A5R A;  4MM3 B;  3EEC A;  2L7R A;  3OJ4 B;  2OHF A;  2D3B A;  2FBW B;  2W54 A;  2RSU A;  1GG3 A;  4EZK A;  4WH4 A;  2N0S B;  4US9 A;  1IBX A;  4E71 A;  3WA0 A;  1KJT A;  4AJW A;  1C4C A;  2NVU I;  4HKZ E;  1TZO A;  4M0W A;  1V5O A;  2KK8 A;  1YJI A;  3P4S B;  1WE6 A;  2XK5 B;  4OVU A;  1UF0 A;  3V3X A;  1L5P A;  2JT4 B;  2XN9 C;  2AL3 A;  4AJY B;  2KJ6 A;  2I1K A;  5L95 C;  4TQ1 A;  3IG3 A;  2ZVN A;  4PT5 A;  1JML A;  4L23 A;  4RF1 A;  2GLS A;  5G55 A;  3IAM 1;  1C76 A;  3LDZ E;  5TR5 A;  3P4Q B;  4LTU A;  3TEW A;  2KC2 A;  3R7R A;  3ZRF A;  1V2Y A;  2C5L C;  5E6O A;  4RF0 A;  4DQO C;  3ZO5 B;  3NG0 A;  2LRU A;  1JRU A;  1SGH A;  5LNK 1;  3QX1 A;  4H2A A;  1K52 A;  2M0X A;  1XCQ L;  2N7D A;  5BO4 B;  3UI3 A;  3ZYY X;  1XLQ A;  4TQ0 A;  2A4Z A;  4WJQ A;  2CU1 A;  2WU5 B;  3W2D A;  1J19 A;  2VRR B;  3GE3 C;  3RI7 C;  1N61 A;  4JPS A;  2K1F A;  1Q0W B;  3A1Q A;  3EA6 A;  3N1Z C;  1PQS A;  4IM0 A;  2BKF A;  4DHJ B;  4IM3 A;  4FBJ B;  2KVR A;  1ISN A;  2N9E B;  4GLS C;  3DBH I;  1KLV A;  4P16 A;  1FEH A;  2Y3A A;  1SE2 A;  1C79 A;  2IBI B;  1UEL A;  4KIK A;  3BVZ A;  2WDV B;  2LJ5 A;  2J53 A;  1FXT B;  2IO1 B;  4ANV A;  3PHW B;  1XO3 A;  1FNU A;  3R7Q A;  5JHB A;  3AUL A;  1D6E C;  1WR1 A;  3H7P B;  2RPQ A;  3ABV B;  1RYJ A;  4TUU A;  1BML C;  4ZHP A;  3S2A A;  4RFB A;  1Q5W B;  5CHV C;  1D3Z A;  2LGS A;  4YSY B;  4HDQ A;  1NI2 A;  4I6N B;  1K8R B;  4G11 A;  3PVL A;  3IVF A;  3N20 C;  1ZOY B;  2NTT A;  3RT3 B;  1YX6 B;  3NS1 A;  3ZNG C;  2JSV X;  2LWP A;  1HZ6 A;  2QEJ C;  2MBQ A;  3RZF A;  3ML8 A;  2BYF A;  5AUI A;  2REX A;  4RGM A;  3FC4 A;  4N6E B;  2JX5 A;  3VRB B;  2HE7 A;  3VR8 B;  2C7H A;  2JZ3 B;  5KHO A;  3Q8A A;  2BYV E;  3PZ7 A;  4CHK A;  2YVC A;  2O6V D;  1QT9 A;  4AQ7 A;  3P1M A;  3ZJV A;  4P7I A;  4W9L A;  4EFO A;  2KWD A;  3DHI C;  4MH0 E;  2N1W A;  4M8N A;  2JU6 X;  2M4N A;  2CHZ A;  4MSM B;  2ZPN A;  5HFY A;  4XWW A;  5GMV A;  3PZD A;  2KMC A;  1E7V A;  4GDL A;  2IGH A;  1JRO A;  2J0M A;  3QJZ A;  1BXT A;  2R61 A;  3CSF A;  2Q5W D;  3CF6 E;  4YTP B;  4HK2 A;  1DYQ A;  4GSW A;  2KDF B;  3AEC B;  4W9J A;  5CHF A;  1FRR A;  1WXV A;  4A9A A;  4WAF A;  2WXI A;  2W82 A;  2HDE A;  1YIW A;  2KFJ A;  3EFU A;  2ZNV C;  1GC7 A;  1YJJ A;  1WM2 A;  1WM3 A;  5HKH A;  1ZXI A;  3SFD B;  2I1J A;  3B2G A;  2KD0 A;  1V9J A;  2V4I B;  3Q3J A;  3WAO A;  1PGX A;  2Y5C A;  1TBE A;  4NJ7 A;  5D6J B;  2GI9 A;  3WAL A;  2JYT A;  2OJR A;  4ICU A;  2PPH A;  2KT7 A;  5DPR A;  4KGS A;  1NDD A;  2LD9 A;  3NHE B;  1WMH B;  3L0W B;  1JWS D;  5HG2 A;  1UD7 A;  3UIP B;  3DBH B;  3PV1 A;  1IGD A;  2VZK D;  4ZHO A;  1RRB A;  2PTL A;  2V0G A;  2KLG A;  3U30 A;  1P98 A;  3VR9 B;  2AQ3 B;  3VTU A;  2Y5P A;  1T0S C;  3H1U A;  4RMA A;  4P6V F;  3VUX A;  2K0P A;  3M63 B;  5BYR A;  4EKU A;  2C9W B;  2KXJ A;  3W5V B;  2KX3 A;  1Y56 A;  2W3R A;  5EE1 A;  1F1H A;  4OZB A;  4MM3 A;  2KWC A;  1JW9 D;  3NVW A;  2FCQ A;  1I4Q A;  3ZW3 A;  4R3D A;  2IDY A;  1KFY B;  3NVY A;  2WXM A;  1I4H A;  2UYZ B;  1Y8R C;  4FHJ A;  3N30 A;  3U7D A;  1IGC A;  5D94 A;  4GXB A;  4RGO S;  4HJG E;  3RD2 A;  2K3U A;  3MC8 A;  3VUY A;  1Z5S B;  4NJC A;  2G1E A;  3SD5 A;  4YSX B;  3K9O B;  2NS5 A;  2XK5 A;  1T3Q A;  3IAS 1;  3SU8 X;  4A3O A;  4F1S A;  1WSP A;  1P0R A;  2IO0 B;  1WE7 A;  1L2N A;  2QDF A;  1ZPS A;  1T0Q C;  1UWX A;  3IT6 B;  2MW5 A;  1EWC A;  3ZXR A;  5HI1 A;  3T3N A;  3AE1 B;  3ZNZ B;  1SBB B;  1HTO A;  3P4R B;  2BYT A;  2GBR A;  2PVG C;  1WJN A;  2LFI A;  4S17 A;  1V1O A;  5G5H A;  4TKN A;  3AE2 B;  5KHQ A;  1D5M C;  1SE4 A;  1QF6 A;  2BGF A;  1K53 A;  4BKG A;  4EZL A;  4IOI E;  3MFG A;  1LXD A;  2D07 B;  2ASQ A;  1UGM A;  3HVD A;  4N9F 4;  2LJI A;  1Q10 A;  2ACZ B;  4WAA A;  4ZRK A;  1EU4 A;  4JL9 A;  2ON8 A;  4ZYS A;  5IN7 A;  1QLB B;  1TY2 A;  2MH7 A;  4YWG G;  2DX5 B;  1AW7 A;  4DXF A;  3KVF B;  1YOV B;  4ICV A;  2G45 B;  4JGH B;  2FIF A;  1XEE A;  2N9K A;  4YTM B;  3KWL A;  3VTV A;  4IWP A;  2IO2 B;  2PJH A;  3IHP C;  2ZPY A;  4MGZ E;  2DZM A;  2KTR B;  2GBJ A;  2KQ4 X;  5D3D A;  1UWM A;  2KN5 A;  2V1Y A;  3TCA A;  4RH6 A;  2V3P A;  2XEW A;  4XZ4 A;  2GMI C;  3ZRC A;  1C4A A;  1N6Z A;  2E6X A;  1ZUD 2;  4W9F A;  2O6V B;  4ZRP A;  2ZVO A;  4HDO A;  4EEW A;  3H7P A;  2WNM A;  3Q8B A;  4AP4 C;  3UQA A;  3PZ8 A;  2C7M B;  3V6E B;  4MEM A;  2CHX A;  3M62 B;  4NQL B;  2CHW A;  2LXC A;  3EFC A;  3ZNH B;  4PYU A;  4RGT A;  4IW0 A;  3AU4 A;  1YQ4 B;  4MJS B;  1MPE A;  3N3K B;  2WLB A;  2D10 A;  1XD3 B;  1WX8 A;  1YN4 A;  1E5W A;  5D3I B;  1VJK A;  4S0R A;  2WQY B;  3H7S A;  1FNV A;  4LNI A;  1E10 A;  5H92 C;  2VH1 A;  1JWA D;  2L83 A;  4K3C A;  2WXN A;  4P1B C;  1WX9 A;  4WQM A;  1UBI A;  2Y5B B;  1C1Y B;  5DPT A;  1HXY D;  3AN1 A;  2HTM E;  3QCA A;  4YTN B;  2PEA A;  4II3 B;  4W9E A;  1TY0 A;  2MBH A;  1RWS A;  4LJP B;  4GMV A;  2N4F A;  2BQQ A;  2KQ7 A;  1D5Z C;  3GB1 A;  3ECI A;  4HPP A;  4B9K A;  4OZA A;  2LVQ A;  3SEB A;  4K1R B;  1T0R C;  1IP9 A;  3V61 A;  4M01 A;  1SXT A;  2VZK B;  2K9X A;  2MLB A;  1OEY A;  3RUL A;  1WJ4 A;  5HHD G;  1JWM D;  2WHI A;  3RCZ A;  1NEN B;  1CK1 A;  1A70 A;  3APD A;  4KX6 B;  4NPN A;  3SHQ A;  1L0Y B;  4FN2 A;  3V60 A;  1YX5 B;  4DBG A;  2JXT A;  3TBL D;  2QIL A;  1WF9 A;  2JZZ A;  2N9X A;  3Q6B A;  1UZX B;  3W1Y A;  4F8C B;  1ET6 A;  2NTS A;  1ROE A;  3FKY A;  4C4V B;  4WWN A;  3AEA B;  3ZDM C;  3FIL B;  3VH4 B;  3BWU D;  5CHW A;  4C80 A;  4NZL B;  4XYC A;  2WGS A;  4JX1 C;  3DBS A;  1WMH A;  1RAX A;  3O13 A;  3VXW A;  2KZR A;  5AZF A;  3UQB A;  3TIX A;  4UDU C;  5AEK B;  2DYO A;  3NZS A;  3GS2 A;  3NVV A;  1TZ1 A;  1T6B X;  3MP9 A;  4JLC A;  3U8Z A;  4GB9 A;  2BKR B;  1SJH D;  2IND C;  2LAS A;  5J2R A;  4CQN A;  2R2Q A;  3MC0 B;  2D3C A;  5E6P A;  3KH0 A;  2MA9 B;  1OQQ A;  2JRH A;  4CO7 A;  2MJ3 A;  2G3Q B;  2Z59 B;  3U52 E;  4AOF A;  1E6E B;  2MP2 B;  5C3J B;  2CJO A;  5MPO A;  3Q8E A;  3L16 A;  2WXK A;  4WWO A;  4DDI D;  3PLV A;  2K25 A;  2CKH B;  4W9I A;  3DQV A;  1EUV B;  3KWV A;  2V3N A;  3BK1 A;  2IY1 B;  1FFV A;  3BYY B;  2INN E;  2ZW0 A;  4DWF A;  1DOI A;  5I4D A;  1N60 A;  3SDL C;  2CU3 A;  2L52 A;  1I35 A;  4XE0 A;  2IO3 B;  2BTE A;  4REZ A;  3KUD B;  3Q2A C;  3AE5 B;  3KLS X;  1Q1O A;  3QK0 A;  4MGI E;  3ZGZ A;  4AS1 A;  4RM8 A;  4QAY A;  1DGJ A;  2LVO A;  4X57 B;  3AE6 B;  5BYQ A;  2FE8 A;  1J0G A;  2V3S A;  2KQS A;  1E8X A;  1F9J A;  1N5W A;  1J7B A;  2NMQ A;  4KGT A;  1JCK B;  2AL6 A;  2M17 A;  1WRI A;  4PS3 A;  1NVI D;  2PE9 A;  4MEL A;  1HEZ E;  5EDS A;  3PGE A;  5D7G A; 
#chains in the Genus database with same CATH homology
 1WM3 A;  1S1Q B;  1EF5 A;  5HKH A;  1GC6 A;  2LGX A;  4HLE A;  2I1J A;  4IC7 B;  2D3G A;  2KD0 A;  5LXI B;  2NBV B;  2C60 A;  3TL5 A;  1V9J A;  2K8H A;  3Q3J A;  3WAO A;  4EUT A;  4GIV A;  1V49 A;  2DZI A;  3Q3F A;  5FR6 A;  2L05 A;  1TBE A;  4NJ7 A;  5D6J B;  3WAL A;  2MQJ A;  3AXC A;  3QIJ A;  3ZTD A;  1U4A A;  2KOX A;  2XBB C;  2OJR A;  4ICU A;  4A20 A;  1WXM A;  1IPG A;  2PPH A;  2N9P C;  4LDT B;  5DPR A;  1WJ6 A;  1NDD A;  3AI5 A;  3DOW A;  1TGZ B;  5JH5 C;  2K6Q A;  2WX1 A;  2LD9 A;  3A1Q B;  3NHE B;  1RFA A;  1WMH B;  3L0W B;  4FJV B;  1YQB A;  3WIM A;  4GN1 A;  1UD7 A;  2N1V A;  4F7Z A;  2KFK B;  3UIP B;  4ANU A;  4ZDV A;  3PV1 A;  4KSL C;  3DBL I;  4KZ0 A;  4RM9 A;  3ZVV A;  4BKS D;  1RRB A;  1WGY A;  2KTR A;  2KLG A;  3HM3 A;  2HD5 B;  4BKT A;  3I3T B;  2L3Z A;  1P98 A;  3D32 A;  3U30 A;  1C3T A;  2L0F A;  3M3J A;  4K7S A;  3VTU A;  5LLI A;  4KIK B;  3H1U A;  4RMA A;  2G4D B;  3VUX A;  3M63 B;  2GBN A;  1HE8 A;  4EKU A;  1LFD A;  2C9W B;  2KXJ A;  4HCN B;  2KX3 A;  2K39 A;  4W9G A;  3B0A A;  1UBQ A;  3ZIM A;  4B95 A;  2K6D B;  2O6V A;  1R4M I;  4MM3 A;  4IM2 A;  1L7Y A;  4GDK A;  3KYC D;  2KWC A;  3V6C B;  1EO6 A;  2LRW A;  3GZN I;  3QAR A;  1E8Z A;  3PS6 A;  1KM7 A;  2FCQ A;  4KDI C;  3ZW3 A;  4HPL B;  4CYE A;  2J7Q B;  2NCN A;  2UYZ B;  2LGY A;  5J17 A;  1Y8R C;  1TTN A;  4FHJ A;  3N30 A;  2HJ8 A;  3U7D A;  2JY6 A;  3JW0 X;  4BBN C;  5D94 A;  4GXB A;  4MJS A;  2DYM A;  3RD2 A;  4DHJ D;  5DCN A;  3VUY A;  2BWE S;  4LCD E;  4BVU C;  3CST A;  1Z5S B;  2O2V A;  4JIO U;  3ZDT A;  2UWQ A;  4FLH A;  2KDE B;  1SE9 A;  1J8C A;  3SD5 A;  2L0T A;  3A33 B;  3HIZ A;  4KV2 A;  3K9O B;  4AWJ A;  2JXX A;  2NS5 A;  2DEN B;  2MBE A;  2B3A A;  2XK5 A;  4WWP A;  3L17 A;  4E3C A;  4JQW C;  2KMA A;  1NBF C;  3SU8 X;  3IBE A;  4A3O A;  4PS7 A;  2KTF A;  2KKC A;  4OVV A;  4F1S A;  3MJW A;  4KVG B;  3DVN U;  4I6P A;  1P0R A;  1OQY A;  2D2Q A;  5IAA C;  1XQQ A;  2IO0 B;  1WE7 A;  1L2N A;  3C0R B;  2YLM A;  4GOC A;  1WGH A;  3HK0 A;  2K8C A;  4M8M A;  2D11 A;  2FAZ A;  1E8Y A;  4K7U A;  1WR6 E;  2ZCB A;  3PSE B;  4ZYN A;  2ZNV B;  4DXA B;  2EKE C;  3ALB A;  1T0Y A;  1KOT A;  2HTH A;  2MW5 A;  3UQB A;  4LJO B;  1YD8 U;  5E6N A;  2K8B A;  1GUA B;  3A9K B;  1WXA A;  2DAF A;  2L8J A;  3W1S A;  2L00 B;  3ZNZ B;  3NOB A;  3NY5 A;  3WAM A;  3B08 A;  2JUO A;  1P3Q U;  3O65 B;  1YJ1 A;  2NR2 A;  3ZNI D;  1RLF A;  3IFW B;  4NAW B;  4G0N B;  1WH3 A;  2GBR A;  2NPT A;  4HCP B;  4GDL B;  5J18 A;  1WJN A;  2LI5 A;  4MDK E;  2KAN A;  3JYU A;  5D2M B;  2M8S A;  3DVN V;  2BPS A;  4BKS A;  4WJO A;  4TKN A;  1EF1 A;  3VAW A;  3QAQ A;  4XC2 A;  1ZKH A;  2LZ6 A;  1AAR A;  5KHQ A;  3PT2 B;  2CR5 A;  4DK5 A;  2BGF A;  3L08 A;  3A4R A;  2MWS B;  4A3P A;  1OTR B;  4BKG A;  4EZL A;  2M1M A;  2FNJ B;  1LXD A;  2WX0 A;  2EMT A;  2D07 B;  2ASQ A;  1UGM A;  4IG7 B;  3QC8 B;  1I42 A;  1S3S G;  2AYO B;  4N9F 4;  3A9J B;  3VUW A;  4W9D A;  2IY0 B;  4WAA A;  5C23 A;  5G2N A;  4ZRK A;  5C1Z A;  3ML9 A;  1BT0 A;  2ZJD A;  2KC1 A;  2WYQ A;  1WXS A;  4JL9 A;  3W1S C;  2WWZ A;  3UGB B;  2KHW B;  3QA8 A;  1VD2 A;  3VVW B;  2KDI A;  3MHS D;  3L13 A;  2KNB A;  4DHZ E;  3DDC B;  4K81 A;  3KUC B;  2DX5 B;  4BFR A;  3KYD D;  2RGF A;  4KDL B;  1OGW A;  3UIN B;  3KVF B;  2WDT B;  3OJ3 A;  4ICV A;  2G45 B;  4JGH B;  2FIF A;  2RD0 A;  4NJ6 A;  3VQI A;  3VTV A;  4IWP A;  4MSQ B;  3R66 C;  2IO2 B;  2PJH A;  3IHP C;  2ZPY A;  4MGZ E;  2MX2 A;  1IYF A;  2DZM A;  1WY8 A;  2RR9 A;  3DVG X;  2KTR B;  4FA6 A;  5AZH A;  2GBJ A;  4GU2 A;  2KN5 A;  4PS8 A;  2V1Y A;  3UIO B;  3TCA A;  3R3M A;  4HJK A;  2XEW A;  4NNJ B;  2ZCC A;  4W9C A;  2FCM A;  4XZ4 A;  2KWV B;  2GMI C;  3V62 A;  4NY0 A;  3ZRC A;  2GOW A;  3H9D A;  4URK A;  2L76 A;  2MBB B;  3NS8 A;  4FHK A;  4W9F A;  2O6V B;  4WJP A;  2OOB B;  2ZVO A;  3PLU A;  3QHT A;  4HDO A;  4EEW A;  1A5R A;  3H7P A;  4GDK B;  1XT9 B;  3EEC A;  2L7R A;  4AP4 C;  1R4N I;  3UQA A;  2C7M B;  3OJ4 B;  3V6E B;  4MEM A;  4KZC A;  2CHX A;  3M62 B;  3PRM B;  2RSU A;  4NQL B;  1GG3 A;  4EZK A;  3VTW A;  1E8W A;  1ZGU B;  3PTF C;  2CHW A;  2MP2 A;  4LDT D;  3ZLZ A;  2LXC A;  3ZNH B;  4PYU A;  4E71 A;  3T8M A;  2BYE A;  3K9P B;  3APC A;  4FUL A;  3WA0 A;  4DHZ B;  4IW0 A;  1MG8 A;  4EZJ A;  1KJT A;  3AU4 A;  4AJW A;  1V5T A;  4MJS B;  3RUI B;  2NVU I;  3PRE A;  1H8C A;  3N3K B;  3OAW A;  4WQO B;  4MGK E;  3DCG A;  2D10 A;  2DZJ A;  3P2B A;  1V5O A;  2KK8 A;  2O2V B;  2A5U A;  1XD3 B;  1WX8 A;  2J0J A;  1E5W A;  3PRZ A;  1WE6 A;  3H7S A;  4WJN A;  2Z0E B;  2XK5 B;  2DHZ A;  2R2O A;  4OVU A;  4HVB A;  2QHO A;  3PRP B;  2G4S A;  3WAP A;  4ZRI A;  2JT4 B;  4NQK E;  1V80 A;  2AL3 A;  2LVP A;  4AJY B;  1WX9 A;  2KJ6 A;  1UBI A;  2Y5B B;  2DYB A;  1C1Y B;  2I1K A;  4FJZ A;  5DPT A;  3QCA A;  5L95 C;  3AU5 A;  2PEA A;  4TQ1 A;  4II3 B;  2DAJ A;  4W9E A;  2FID A;  2MBO A;  1VCB A;  2MBH A;  3IG3 A;  2CS4 A;  2KO3 A;  4LJP B;  2ZVN A;  4GMV A;  3QWZ B;  4ZRJ A;  1ZW7 A;  2N4F A;  5JZE B;  1V86 A;  2KQ7 A;  1WFY A;  3ENE A;  1SIF A;  1G6J A;  5G55 A;  4I6L B;  3ECI A;  1LQB A;  3LDZ E;  5TR5 A;  4B9K A;  2JRI B;  2KC2 A;  4HXD A;  2NPT B;  3JSV A;  2LVQ A;  2N7E A;  3R7R A;  4K1R B;  3ZRF A;  2KJR A;  3L10 B;  1V2Y A;  1WGD A;  2C5L C;  5E6O A;  3PHX B;  3VHT C;  3V61 A;  3ZKJ C;  1IP9 A;  2MSE D;  5DPS A;  3KW5 B;  2MLB A;  1OEY A;  3RUL A;  1WJ4 A;  3ZO5 B;  3RCZ A;  3EC8 A;  2LRU A;  4XX5 A;  3RYT A;  4BBN F;  3APD A;  5CTR C;  1JRU A;  4NPN A;  3VDZ A;  3SHQ A;  1SGH A;  4ANX A;  4FN2 A;  3V60 A;  4AUQ C;  1QZE A;  1YX5 B;  3QX1 A;  4DBG A;  3TBL D;  2MCN B;  2M0X A;  4YL8 A;  1WF9 A;  4J6I A;  2N7D A;  5BO4 B;  2JZZ A;  2N9X A;  3A4S C;  1UZX B;  3W1Y A;  5DPW A;  4F8C B;  4TQ0 A;  2A4Z A;  2JVC A;  1OEY J;  3NZU A;  4WJQ A;  3T9L A;  2CU1 A;  3TJP A;  1LM8 B;  2LGD A;  3BY4 B;  3CMM B;  4IWQ A;  2W9N A;  1J19 A;  1GNU A;  2ZEQ A;  4HWI B;  2BWF A;  2VRR B;  3APF A;  3L54 A;  1WZ0 A;  4WWN A;  3ZDM C;  3VH4 B;  3DVG Y;  5LXH A;  2KX0 A;  3QQ8 B;  5CHW A;  4FJY A;  2BF8 B;  2K1F A;  1Q0W B;  3A1Q A;  2C7N B;  3X0W A;  1PQS A;  4EOY A;  3B1L X;  3DBS A;  1WMH A;  1RAX A;  2GBM A;  3VXW A;  4IM0 A;  2KZR A;  4W9K A;  5AZF A;  2BKF A;  4DHJ B;  4IM3 A;  3TIX A;  2KVR A;  1WX7 A;  4FBJ B;  2V4L A;  2KFK A;  4II2 B;  5AEK B;  2DYO A;  1ISN A;  3NZS A;  2N9E B;  3TMP B;  1TZ1 A;  4K7W A;  2ZZP B;  4JLC A;  3DBH I;  3U8Z A;  1KLV A;  2IBI B;  1CMX B;  4GB9 A;  2BKR B;  2LXA A;  1UEL A;  3JVZ X;  4KIK A;  3H6N A;  2LAS A;  2NBW B;  1V6E A;  2LJ5 A;  1WI0 A;  5J2R A;  2FCN A;  2R2Q A;  1FXT B;  2IO1 B;  4BOZ B;  4ANV A;  3PHW B;  5E6P A;  3PPA A;  3R7Q A;  5JHB A;  3ONS A;  5L83 A;  1V81 A;  3AUL A;  2FCS A;  4DDG D;  1H4R A;  1E90 A;  1WR1 A;  3H7P B;  3EHV A;  2RPQ A;  4MGY E;  4TUU A;  3KH0 A;  3S2A A;  2MA9 B;  2NBU A;  1Q5W B;  5CHV C;  1WGG A;  1D3Z A;  2JRH A;  4CO7 A;  2G3Q B;  2Z59 B;  4HDQ A;  1NI2 A;  4I6N B;  4AOF A;  1K8R B;  3M95 A;  4G11 A;  3PVL A;  2MP2 B;  3MTN B;  1WRD B;  4TV3 A;  3IVF A;  2JPH A;  2ZNV C;  2KJH B;  3RT3 B;  1UH6 A;  2JWZ A;  1YX6 B;  3L16 A;  4WWO A;  3ZNG C;  2LWP A;  3N32 A;  2IZV B;  2MBQ A;  4DDI D;  3RZF A;  3ML8 A;  3PLV A;  2BYF A;  4M0W B;  1P1A A;  2AEH A;  2K25 A;  1P9D U;  2REX A;  3VH3 B;  1WIA A;  1WGR A;  2CKH B;  3LJ3 A;  4W9I A;  1WJU A;  2EMS A;  3DQV A;  2HE7 A;  4IWO A;  4E74 A;  1EUV B;  4G50 A;  2C7H A;  2DZK A;  3ZTC A;  2IY1 B;  2JZ3 B;  5KHO A;  2JF5 A;  2BYV E;  3GOE A;  4KSK C;  4DWF A;  4CHK A;  2YVC A;  3KUZ A;  2KWU B;  2O6V D;  3BIN A;  2MRP A;  4BOS C;  2GBK A;  3OLM D;  3UF8 A;  3VFK A;  4P7I A;  4W9L A;  3SDL C;  4EFO A;  5CX3 A;  2PE6 B;  4MH0 E;  3A9K A;  4IUM B;  1I35 A;  2N1W A;  4M8N A;  4ANW A;  3DBR I;  2IO3 B;  1GJZ A;  2LUE A;  3WAN A;  3KUD B;  4GGQ A;  1Q1O A;  2M4N A;  2CHZ A;  3QK0 A;  3RZW C;  4MSM B;  4ASW C;  2ZPN A;  4PYZ A;  3HHM A;  4MGI E;  4B6W A;  2FUH B;  4RM8 A;  5GMV A;  1M94 A;  2LVO A;  3PZD A;  4NAW A;  3X23 A;  2KDB A;  2KMC A;  1E7V A;  5JHA A;  4GDL A;  2J0M A;  3QJZ A;  2IYD B;  4X57 B;  3ZUN A;  3JSV B;  2J0K A;  3DPD A;  4FAD A;  3CSF A;  1J0G A;  2V3S A;  5AZG A;  4G3X B;  3CF6 E;  4HK2 A;  4HPM B;  2KQS A;  4GSW A;  1E8X A;  1F9J A;  1Z2M A;  2KDF B;  4W9J A;  5CHF A;  2KLC A;  1WZ3 A;  1WXV A;  5IA7 A;  4W9H A;  2AWT A;  1X1M A;  2AL6 A;  3HM6 X;  2M17 A;  4PS3 A;  2PE9 A;  4MEL A;  1YIW A;  2KFJ A;  3EFU A;  1E7U A;  3PGE A;  5EDS A;  1WYW B;  3A9J A;  2Z0D B;  1GC7 A;  5D7G A;  1WM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...