4HJKA

U7ub7 disulfide variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'AMQIFVKCLTGKTNTLEVEPSDTIENVKAKIQDKIGYPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHCVRRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization
rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hjkA00
4WAAA 2IY0B 3WANA 1IP9A 2MQJA 4OVUA 4FHKA 4JGHB 3RULA 2IY1B 2KNBA 2ZCCA 3BY4B 4J6IA 2AYOB 1OEYA 1WGHA 2J0MA 2N7EA 2LZ6A 1EF5A 4DHJB 1GC7A 1NBFC 1AARA 2L7RA 2KJHB 2N1VA 4WJQA 3RD2A 3VH3B 5LXIB 1E90A 2LWPA 3QJZA 4RM9A 4W9DA 2FNJB 2ASQA 2WX0A 2K6QA 2CU1A 3A33B 2GBNA 2KDFB 4GIVA 5LLIA 2DENB 4AP4C 2KKCA 4EZKA 3AU4A 4ZYNA 1H8CA 4NPNA 3KVFB 2W9NA 4BKTA 3DBLI 2C60A 2NR2A 2DZJA 1F9JA 4E74A 4EUTA 4OVVA 3V6CB 2LVQA 1YQBA 3DQVA 4IM3A 2MBBB 4M0WB 1D3ZA 1WMHB 1GJZA 1J0GA 2UWQA 4IM2A 2LI5A 4PS3A 1C3TA 2FCSA 2G4DB 1V81A 2LXAA 2BF8B 4KV2A 2BWES 3U7DA 4W9CA 2BWFA 1S3SG 3GOEA 2JWZA 5AEKB 1U4AA 3R7RA 4G0NB 4WWOA 2LRUA 4RMAA 1RLFA 3QARA 4IM0A 4DK5A 3MTNB 3B0AA 2ZPNA 2C5LC 1UGMA 3QHTA 2KWCA 4W9JA 5JHAA 4NAWA 3MJWA 4G3XB 2XEWA 3V60A 5CHFA 2HD5B 4JLCA 2KMAA 2DZIA 2K8CA 2N9EB 2R2OA 2KQ7A 2WX1A 2DZKA 4ZRIA 2JT4B 3Q3JA 3QC8B 4CYEA 4KDIC 1LFDA 4K81A 4KZ0A 5CHWA 5D7GA 3CSFA 3PRPB 3ZNHB 1WF9A 2MBOA 3JVZX 4A3OA 1R4NI 2AL3A 3ZNZB 2R2QA 2WWZA 3TL5A 2FAZA 2AEHA 3KW5B 4F8CB 1GC6A 4WJOA 3S2AA 5KHQA 4W9LA 2ZPYA 2NBWB 2G3QB 3A1QB 4IC7B 3NOBA 1LXDA 2KVRA 4M8NA 4HLEA 4FADA 4DWFA 1WRDB 4BKSD 2MSED 1X1MA 3DDCB 3H1UA 3H7SA 2LGDA 2ZZPB 2K25A 4HDOA 3B08A 1Q1OA 4G50A 4GDLB 5AZHA 1ZW7A 4GU2A 3HK0A 5FR6A 3IFWB 2GMIC 2KLGA 2M0XA 4AOFA 2FIFA 2IO0B 3N30A 4MDKE 1E8XA 5C23A 4AJYB 2DAJA 2D11A 3ZNGC 1WR1A 2MP2B 2RD0A 3K9PB 4LDTD 4X57B 3PRZA 2PE9A 2O6VA 2REXA 1WX8A 4MJSB 5CTRC 3HIZA 3PREA 2VRRB 4GDKA 3B1LX 2FIDA 4F1SA 4GN1A 3IHPC 1V6EA 1G6JA 2RR9A 3P2BA 3PV1A 4ICUA 2NS5A 3SDLC 3ZIMA 3CF6E 2KFJA 1GNUA 3JSVB 2D2QA 3QX1A 2JVCA 4HJKA 1P0RA 4B6WA 2G4SA 5CHVC 4PYUA 2D07B 3L54A 3RYTA 3RZWC 2GBJA 5CX3A 4HCNB 1RRBA 4PS8A 3X23A 3UF8A 2D10A 2V4LA 5AZFA 2KDEB 4BOZB 3APDA 3PHXB 3QCAA 2KC2A 4LDTB 1KJTA 2JXXA 1J8CA 1MG8A 3A4SC 4W9HA 4ASWC 3VHTC 4MGKE 2RGFA 3M3JA 1SGHA 4GOCA 2EMTA 3R3MA 3AXCA 3ZKJC 2J0KA 3PRMB 1KOTA 2CKHB 2IO1B 3ML9A 1WH3A 2KANA 4TQ1A 2LD9A 3ZTCA 2B3AA 4HPLB 1E8WA 2DYBA 1WYWB 3ECIA 1EUVB 1VD2A 5AZGA 1V86A 2JY6A 2CHXA 3PTFC 4NQKE 3H7PB 3ZRCA 3ZO5B 2A4ZA 2PPHA 2KLCA 2O2VB 2LRWA 4JQWC 2PJHA 2J0JA 2Y5BB 4ZRJA 4W9KA 1FXTB 1GG3A 2AWTA 2N7DA 2NPTA 2DYMA 4K7SA 2GBKA 5BO4B 3UIPB 5D6JB 3DOWA 2KJRA 4W9FA 4ZDVA 4URKA 2QHOA 3IBEA 2JF5A 2ZNVB 3DVNV 4NY0A 3W1YA 3WA0A 3WAPA 2KJ6A 2KDIA 3R7QA 2RPQA 4BBNF 4MELA 3ML8A 4MEMA 2JRIB 3VH4B 1WGGA 1Q0WB 3N32A 1H4RA 3SD5A 2K8BA 2BPSA 2ZNVC 4FN2A 4B9KA 3DPDA 4NJ6A 2ZVNA 1ZGUB 2OOBB 1IYFA 1KM7A 4XX5A 1QZEA 1WXSA 2OJRA 3EECA 3N3KB 3GZNI 1IPGA 3L0WB 3VFKA 3HM6X 3ONSA 2C7NB 4FHJA 4W9EA 4WQOB 3WAOA 4ANVA 4LJOB 2KOXA 3EFUA 5JZEB 1GUAB 4FJVB 1YD8U 3DVGX 4IWPA 3KYCD 1UBIA 1WMHA 3RUIB 3UGBB 4ICVA 1P3QU 2HJ8A 2KFKB 2MCNB 3ZVVA 2DHZA 1E7UA 3IG3A 2PE6B 1XD3B 2M8SA 4FJZA 1WZ3A 2G45B 2KHWB 3LJ3A 3WALA 3ZNID 2MX2A 1TTNA 3LDZE 5D94A 3M95A 2CHWA 2L76A 3A4RA 2BYEA 1V5TA 3ZDTA 2EMSA 4GSWA 3NS8A 4ANUA 1NI2A 2XK5B 3QQ8B 3X0WA 4EOYA 5GMVA 3NZSA 1JRUA 2Z0DB 3V62A 2JUOA 2JRHA 2KZRA 3ZW3A 2KMCA 3C0RB 4KVGB 5IAAC 1ISNA 4TUUA 4ANWA 1A5RA 1UELA 2IYDB 3DBSA 1LQBA 2GOWA 4WWPA 5J2RA 4KSLC 4KZCA 4KDLB 1BT0A 1TZ1A 3D32A 3W1SC 5LXHA 3VAWA 3A9KB 1R4MI 4TQ0A 3CSTA 2KTFA 4GGQA 1K8RB 5E6PA 1I42A 4EFOA 3ZLZA 3A9JA 2LGXA 1WGRA 2MBQA 3A1QA 5J17A 3L13A 4A20A 3VTWA 4JL9A 1XT9B 1WY8A 1V2YA 1WIAA 1WM3A 3ALBA 2NBVB 4FULA 1WFYA 5JH5C 5E6OA 4FLHA 2Z0EB 2FCNA 4GXBA 3CMMB 4GDLA 4MM3A 1WGDA 2LGYA 3TJPA 4A3PA 2ZJDA 3PS6A 3QA8A 4BFRA 2XBBC 3UQBA 4K7UA 4AJWA 1WR6E 3PZDA 4N9F4 4MGZE 2ZVOA 4AUQC 2MLBA 4CHKA 1WE6A 2LJ5A 3DCGA 3QWZB 2MP2A 5KHOA 4BOSC 4TV3A 4M8MA 2L0FA 3ENEA 2DAFA 3QIJA 1L7YA 1WJUA 3H6NA 3KUCB 2GBMA 1KLVA 5J18A 1WI0A 3IVFA 4DHZE 3VUXA 2MBEA 3TIXA 3NHEB 1Z5SB 2KTRA 3PSEB 4HPMB 3VQIA 2N9PC 4GMVA 4HCPB 4BKSA 3APCA 1ZKHA 2I1KA 2KXJA 1YX6B 2LVPA 2KK8A 1E7VA 2IZVB 3RZFA 2LUEA 3NY5A 4XZ4A 3TMPB 3H9DA 4ZRKA 1V80A 3L08A 2FCQA 2WDTB 2KD0A 3PT2B 2LVOA 2PEAA 3HHMA 1E8YA 4MSQB 2YVCA 4EEWA 1WJ6A 2BKRB 2KN5A 2K39A 3VTUA 3O65B 3T8MA 2L0TA 2M17A 4KIKA 1V5OA 4NQLB 2RSUA 4B95A 2NPTB 1WJNA 3DVNU 4HK2A 2KX0A 4KSKC 5DPRA 3SHQA 2GBRA 4BBNC 3SU8X 2YLMA 4GB9A 2MA9B 3OJ3A 2L8JA 1WM2A 2ZCBA 4F7ZA 2WYQA 4P7IA 1RAXA 3K9OB 4G11A 2L3ZA 1UBQA 4II3B 1UZXB 4TKNA 1UD7A 3PLUA 4IUMB 3H7PA 4IG7B 3QK0A 4DXAB 2K1FA 3VVWB 3M63B 4NAWB 2O2VA 3UIOB 1YX5B 3PPAA 2LXCA 3HM3A 2IO2B 2V3SA 5JHBA 1OGWA 4NNJB 1EF1A 1P1AA 2MW5A 2L05A 1Y8RC 4JIOU 5DPWA 3EHVA 2KQSA 5TR5A 3KYDD 1WGYA 1SIFA 3DBRI 3KH0A 3AI5A 3I3TB 4PYZA 2FCMA 2A5UA 2BYFA 2UYZB 4WWNA 4WJNA 4BKGA 2K6DB 2AL6A 2C7MB 3VUWA 1SE9A 3BINA 2KX3A 2O6VD 2M1MA 2J7QB 3NZUA 1YIWA 2N9XA 4HXDA 2HE7A 3VDZA 1I35A 1NDDA 4MSMB 3EC8A 2KO3A 2N4FA 3ZTDA 3DVGY 2M4NA 3KUZA 3TBLD 3RCZA 1L2NA 3L16A 4DDGD 1C1YB 1V49A 3ZRFA 4EZLA 2KWVB 4I6PA 1OEYJ 2ZEQA 4E71A 2BGFA 4K1RB 5G55A 2MRPA 3Q3FA 1E8ZA 1WXAA 2KFKA 1PQSA 2DZMA 4MGIE 2KC1A 3RT3B 3ZUNA 4DDID 3AULA 3PVLA 1WXVA 5DCNA 1TGZB 4IWOA 3ZDMC 1YJ1A 4HVBA 1LM8B 3A9JB 2NCNA 2CHZA 4IW0A 2C7HA 4ANXA 4I6NB 2O6VB 1WX7A 3AU5A 2MBHA 3PLVA 4GDKB 3VUYA 2XK5A 3UQAA 4CO7A 3APFA 5DPSA 3PGEA 2BKFA 2C9WB 1Z2MA 2EKEC 1OTRB 2JPHA 3OAWA 3JW0X 2K8HA 3W1SA 2Z59B 1WZ0A 5IA7A 2NVUI 4II2B 4IWQA 5L83A 5C1ZA 3OJ4B 2D3GA 3R66C 4BVUC 4EKUA 1TBEA 3PHWB 5L95C 2JZ3B 1WXMA 4AWJA 4K7WA 2CS4A 1WJ4A 2L00B 3L17A 3A9KA 1WX9A 1S1QB 1CMXB 2KWUB 4DHZB 1J19A 1XQQA 2N1WA 1HE8A 4LJPB 4PS7A 2LASA 2MWSB 4WJPA 3V6EB 3WAMA 1RFAA 5E6NA 4E3CA 5EDSA 3VXWA 4LCDE 3VTVA 4FJYA 3JYUA 1EO6A 2IO3B 4MJSA 3UINB 4DBGA 2KTRB 1T0YA 2FUHB 2V1YA 4DHJD 3T9LA 3V61A 1WE7A 4I6LB 3OLMD 4FA6A 1P9DU 2CR5A 3L10B 1OQYA 4NJ7A 4EZJA 2DYOA 1VCBA 5HKHA 1V9JA 3M62B 3JSVA 4W9GA 2JZZA 3U30A 2IBIB 2NBUA 3U8ZA 4MH0E 1P98A 3DBHI 3QAQA 2DX5B 2KDBA 4YL8A 5D2MB 5DPTA 1UH6A 2HTHA 3TCAA 3MHSD 4HDQA 4MGYE 4XC2A 1E5WA 2BYVE 2I1JA 4RM8A 4W9IA 4FBJB 1M94A 3WIMA 3KUDB 4KIKB 1Q5WB 5G2NA 4HWIB
chains in the Genus database with same CATH superfamily
4K3CA 4WAAA 1ZXIA 4FHKA 4JGHB 1DOIA 3BY4B 3BVMA 2PLPA 1OEYA 2J0MA 2LZ6A 4RGOS 1EF5A 2WXRA 4DHJB 1DGJA 1GC7A 2L7RA 2N1VA 1E90A 2ASQA 3A33B 2DENB 2HDEA 2KKCA 1H8CA 4BKTA 2K5PA 5EE0A 2DZJA 2IJ0A 4E74A 3BIID 4OVVA 4DQOC 1FEHA 1J0GA 1HTOA 1FFUA 4RNAA 4FXCA 1JCKB 4OZBA 5AEKB 3U2SC 4YXDB 1RLFA 3QARA 2BS2B 2AX5A 3QHTA 3MJWA 4G3XB 5CHFA 3RNAC 1ACCA 2KQ7A 2WX1A 4ZRIA 2JT4B 3DBLB 1LFDA 4KZ0A 3CSFA 1XLQA 3JVZX 2AL3A 3TL5A 2AEHA 3AB5A 4W9LA 2EKIA 2NBWB 3NOBA 1LXDA 3ZXVA 3P42A 1TS3A 2KYWA 4RGNA 2MSED 1Q10A 3DDCB 1T0RC 4K3BA 2LGDA 3IT4B 4G50A 4IKGA 1GAQB 4N6EB 3CWIA 3HK0A 2GMIC 2WQYB 1PFDA 2FIFA 5GXGB 4HKQA 1TS4A 1E8XA 4AJYB 4ZHOA 2LMCA 3ZNGC 2WXJA 1ET9A 1OQQA 3K9PB 2V9HA 1M4VA 1FNVA 3AE8B 1ZUD2 4MJSB 5CTRC 2PKOA 4ZOHC 4F1SA 3B1LX 2FIDA 2V3PA 3W5UB 3P4RB 3GP7A 3ZIMA 3JSVB 2JVCA 5IKCM 4HJKA 2G1EA 5CHVC 2D07B 3DHGC 3L54A 1SBBB 3RZWC 1F0ZA 3P4SB 2D10A 2G9HD 2V4LA 2KDEB 3APDA 2KC2A 1MG8A 3VHTC 1SIJA 3M3JA 3ZKJC 2RPVA 2KANA 2PW9A 1XCQL 2QDFA 5AZGA 1VD2A 3PTFC 1D4BA 4YTNB 3SEBA 2A4ZA 3CIRB 2O2VB 4W9KA 2N7DA 2MJEA 3NVYA 3UIPB 4K7SA 2GBKA 1MFWA 5BO4B 3DOWA 4C7YA 4NY0A 3WAPA 3U52E 4YSYB 4BBNF 3ML8A 4MEMA 4OW0A 3N32A 1H4RA 2ZNVC 2BPSA 4OZAA 4P6VF 1QZEA 3GZNI 1TKGA 3L0WB 4M01A 2C7NB 1JROA 3WAOA 4JE3B 4JWSC 2BS3B 1FD6A 4IWPA 1VRAB 1YNTE 3RUIB 4ICVA 1ZP0B 2KFKB 4WWMA 4P1BC 3IG3A 2PE6B 3RPFC 2CHWA 3A4RA 2I2YA 2BYEA 1V5TA 4ANUA 1NI2A 4L23A 4XDDA 3BK2A 2JRHA 1QKZA 3AE6B 1FMAD 5FR3A 3DBSA 4XWWA 4LNNA 4WWPA 4KSLC 2Q5WD 3W1SC 5LXHA 5E6PA 4ZRQA 4EFOA 3IT6B 2MBQA 3A1QA 4B0EA 3L13A 3P63A 1F2RI 1XT9B 2N9KA 4S17A 1I4GA 2FCNA 4GDLA 1WGDA 2LGYA 2ZJDA 3QA8A 4BFRA 3UQBA 2WXKA 4AJWA 2J4XA 3PZDA 4MGZE 2Y5PA 1WE6A 3MC0B 4BOSC 4TV3A 2DAFA 2SEBD 1L7YA 2W3RA 4DHZE 3VUXA 2MBEA 2KTRA 3I5JC 2WXFA 3APCA 3H8HA 1ZKHA 4XZ4A 3H9DA 3HVDA 4KX6B 3RNCC 3BYYB 2KD0A 4KKIA 2PEAA 2IDYA 1C4AA 2INPE 1K50A 4EEWA 1WJ6A 2BTEA 3W9CB 3EGRA 4NQLB 4B95A 1E9MA 3DVNU 2KX0A 1NENB 4LNIA 2YLMA 4XGAB 4C56C 1HEZE 3OJ3A 3SFEB 1FNWA 3NVZA 1WM2A 4PT5A 2ZCBA 1L6VA 2QIEB 4G11A 2L3ZA 2MHJA 2Y3AA 4IUMB 1YX5B 3PO0A 2LXCA 2IO2B 1ENFA 2L05A 1Y8RC 1L0XB 5DPWA 3Q8CA 4XWTA 3KYDD 1SIFA 3KH0A 2WXOA 3I3TB 4PYZA 1UWMA 4MH8A 3Q6BA 3ZGZA 2M1MA 2NTSA 2J7QB 4NAMA 3VDZA 2HE7A 3HVZA 2HJ1A 3EC8A 1YQ3B 2WXPA 2M4NA 1V8CA 3TBLD 3RCZA 2OEDA 4L2YA 1L2NA 3LB8C 4DDGD 1C1YB 3FILB 2KWVB 4E71A 3R2IA 2MRPA 5AUKA 4DDID 3AULA 4WURA 3IAS1 3PVLA 2K22A 4IWOA 3ZDMC 1YJ1A 3A9JB 2IGDA 4RFBA 3ZQ4A 2AQ3B 4I6NB 4GDKB 3VUYA 3PGEA 2BKFA 2C9WB 2LHEA 2JPHA 2K8HA 2Z59B 3FAHA 1YN3A 5FK9C 1TBEA 5L95C 1QLBB 3AEEB 4K7WA 1WJ4A 3I57A 2JXTA 3V3XA 1LGRA 1S1QB 4LJPB 3PZ7A 2LASA 2H88B 5D3DA 4JX1C 1ZDXA 4OHJA 2RDBC 1YJJA 2H89B 2CJNA 3JYUA 4MT5A 1DOYA 4DBGA 1T0YA 4ITKA 2CR5A 3PZ8A 3P4PB 2JZZA 4MH0E 1P98A 3DBHI 4HEA1 2DX5B 2KDBA 1T5XD 5EE3A 2HTHA 4MGYE 1ZXHA 1E5WA 1FO4A 3C19A 4RM8A 4YSXB 2BYTA 3KUDB 2W82A 1ZE3D 3WANA 2MQJA 1F2RC 2X8XX 4J6IA 4REZA 2ACZB 1I4RA 1P7FA 1AARA 3VH3B 2FNJB 2K6QA 2FBWB 3B9JA 2V4IB 4AP4C 1C9FA 4EZKA 4A9AA 3NUHB 5C2TB 2NR2A 1NYRA 2VH1A 3SFDB 2E6XA 2RDGA 3AE5B 3UI3A 1QOFA 2MBBB 3Q8AA 1WMHB 3TEWA 1NVID 1DYQA 2LI5A 4IM2A 4KV2A 2BWES 3DHIC 1S3SG 3GOEA 2TSSA 4WWOA 4DK5A 2C5LC 2KWCA 4W9JA 1BUIC 2KAJA 4JLCA 4OZCA 1DOXA 2DZIA 2K8CA 2R2OA 3Q3JA 3QC8B 4KDIC 1MJDA 3PRPB 1WF9A 1I4QA 2R2QA 1QOAA 2FAZA 3EFCA 1GC6A 3S2AA 3ABVB 3ZJVA 1FCLA 2IGGA 1KFYB 2JZPA 4FADA 3Q69A 3B08A 5EE1A 1XF5L 1J7CA 5AZHA 3OG5A 4AOFA 3N30A 4MDKE 1N5WA 3N1YC 2RD0A 4X57B 1T0SC 4R3DA 1TKYA 1T6BX 2O6VA 1WX8A 1UWXA 3HIZA 3N9YC 2VRRB 3PREA 4C00A 3AEGB 4DXFA 1V6EA 3SDLC 1SE3A 1NEKB 3CF6E 2D2QA 4BZAA 1KF6B 1XLPA 1B9RA 3TEZA 2GBJA 2HTME 4MACA 4PS8A 3PHXB 3OWEB 1HTQA 1KJTA 1ROEA 3FKYA 3AXCA 2CKHB 3ML9A 1WH3A 1JW9D 4TQ1A 2LD9A 1YMHE 1CJEA 1FCCC 4HPLB 1E8WA 1N6ZA 3ECIA 1FM0D 2JY6A 3ZRCA 2PPHA 2KLCA 3DHHC 2LRWA 4HPPA 4JQWC 1PYWD 2KVZA 2WXLA 2Y5BB 1FXTB 2AWTA 2NPTA 2XN9C 1CQVA 4W9FA 3AE2B 2JF5A 3DVNV 3WA0A 2KJ6A 2KDIA 3R7QA 3AM9A 3VH4B 1V1PB 1WGGA 2D3BA 3SD5A 3DWGC 4B9KA 1TY0A 3J9CA 2ZW1A 2K0PA 4XX5A 1YN4A 3EECA 1IPGA 4FHJA 3ONSA 4WQOB 4LNFA 4ANVA 2KOXA 1D5XC 3R2TA 4S0RA 1GUAB 1XD3B 3LJ3A 1GB1A 5BYSA 2L76A 1WSPA 1VZ6A 3ZDTA 2EMSA 4GSWA 2XK5B 1K51A 4LLGM 5T8IA 2JUOA 2KZRA 3ZW3A 3C0RB 4NZLB 4ANWA 1A5RA 2PVGC 2N0SB 2IYDB 1L4DB 1QILA 1STEA 2M56B 3GZNB 4KZCA 1TZ1A 1E6EB 2QMTA 3ZYYX 3A9KB 1R4MI 3CSTA 1V1OA 3ZLZA 5J17A 1WGKA 2ON8A 2DWQA 3T3NA 1PGXA 3U4EG 1V2YA 3IXSA 2Z0EB 4GXBA 3CMMB 3TJPA 4YWGG 1EWYC 1Y56A 4K7UA 2GRIA 1WR6E 1FXAA 3DCGA 3QWZB 5FKAC 2R61A 4OVZA 1XO3A 2DLBA 3KUCB 1WI0A 3VRBB 1LO5D 2BB6A 4XYCA 4GMVA 4BKSA 2I1KA 1YX6B 2IZVB 2LUEA 4ZRKA 1V80A 3L08A 1SXTA 4TMAB 3PT2B 1SF0A 1HZ6A 5HI1A 5IP4D 1FRDA 1V5OA 2RSUA 1WJNA 3SHQA 1TZOA 2IGHA 3AV8A 2B76B 2WYQA 1RAXA 3KWVA 4TKNA 3PLUA 3P1MA 1D5ZC 3QK0A 3VVWB 3B2FA 2ONQA 3M63B 4NAWB 2O2VA 2L32A 2V3SA 2KT7A 5JHBA 1OGWA 1P1AA 1K52A 1TT5B 3EHVA 3DBRI 1T3QA 4M0WA 2A5UA 2BYFA 2UYZB 4BKGA 1C4CA 1SE9A 1IBXB 4RCOA 4LK0M 1VZ8A 3NZUA 2N9XA 2D3AA 5I4DA 1I35A 1NDDA 2BBCA 4MSMB 2LHDA 3ZTDA 1KTKA 1QOGA 4WIPA 1XLNA 2WGSA 3ZRFA 4EZLA 1OEYJ 1VZ7A 2ZEQA 4O1NA 4K1RB 2M19A 4Q2JA 1MHXA 1L4ZB 2KFKA 2DZMA 4KKJA 4MGIE 4ARIA 1AYFA 1SE4A 3ZUNA 2GI9A 1FNUA 1ZDVA 2Y5CA 2QEJC 2CHZA 4IW0A 3ZJTA 1WX7A 3AU5A 2VZKB 2GB1A 4B0MA 3APFA 2WXGA 3OAWA 5IA7A 3BZDB 2NVUI 5C1ZA 4EKUA 1UGJA 3PHWB 2JZ3B 2CS4A 2L00B 1WX9A 1WRIA 1N60A 1J19A 4PS7A 4NJCA 1I4PA 2BVCA 1EU3A 4C7ZA 3WAMA 1RFAA 5E6NA 2KTRB 2QJLA 2V1YA 3T9LA 1WE7A 4I6LB 3OLMD 3RI7C 3L10B 5IN7A 5HKHA 3M62B 3BK1A 3U30A 2IBIB 2NBUA 3U8ZA 5D2MB 5DPTA 3BVZA 1UH6A 2RMMA 3MHSD 2QC8A 4FBJB 1M94A 3C8YA 2IY0B 1IP9A 3MC8A 4OVUA 1JWAD 3RULA 2IY1B 2ZCCA 3AE1B 2AYOB 2N7EA 2KACA 1OQRA 3RD2A 3AEDB 1TIFA 5LXIB 4RM9A 4W9DA 2WX0A 3V05A 2CU1A 2GBNA 2KDFB 3GE8C 4GIVA 5LLIA 2WS3B 4ZYNA 4ARCA 4NPNA 2W9NA 2C60A 5TSSA 3DBHB 1F9JA 1KH0A 4EUTA 2LUMA 4HJGE 2LVQA 1F1HA 1AW7A 1YQBA 3DQVA 2INCC 1D3ZA 1C3TA 2G4DB 2BF8B 2BWFA 5BMIA 1D5MC 4M00A 1N63A 4G0NB 2W55A 4IM0A 2VZKD 3W2DA 3B0AA 2ZPNA 4RGTA 2XEWA 1PUTA 4AQ7A 3V60A 3N1ZC 2N9EB 3TUOA 4K81A 1RFKA 5D7GA 5CHWA 1R4NI 3ZNZB 1N5XA 5LNK1 3KW5B 5KHQA 2QCZA 4A6QA 2L83A 2NMQA 1HQRD 2G3QB 2WLBA 4M8NA 4LNOA 4YTMB 3MJ5A 1JWSD 3MP9A 1X1MA 3H7SA 2WXHA 2ZZPB 3E56A 1Q1OA 4MM3B 5FR6A 2M0XA 2FUG1 3RN9C 1IGDA 2VH2A 2D11A 1WR1A 2MP2B 4LDTD 3KWLA 2PE9A 2REXA 4GDKA 2YEPB 4GN1A 3IHPC 2K9XA 3PV1A 3BWUD 4PK1A 1TJEA 4ICUA 1E7PB 2RDHA 2KFJA 1GNUA 3QX1A 1P0RA 4HCNB 1RRBA 2KWDA 3X23A 5AZFA 3P4QB 3QCAA 1GPXA 1J8CA 2JXXA 4MGKE 1HXYD 1OFFA 1SGHA 4GOCA 2EMTA 3R3MA 2J0KA 2IO1B 1D6EC 2B3AA 1WYWB 1EUVB 4NQKE 1QOBA 3H7PB 2MJDA 3ZO5B 1GOZA 3KLSX 2KN4A 2WDQB 3AE7B 1JQ4A 2J0JA 1FPYA 4ZRJA 1P7EA 1JRPA 2PTLA 2EELA 4P1CC 4ZDVA 4URKA 2QHOA 3IBEA 2ZNVB 2BB5A 3Q8FA 2RPQA 5HHDG 4MELA 1WXQA 2JRIB 1Q0WB 2K8BA 4FN2A 3DPDA 1YN5A 2ZVNA 4NJ6A 1IYFA 2CJOA 2BS4B 2N9LA 3N3KB 3IAM1 3VFKA 3HM6X 3TEYA 4LJOB 5EE9A 3EFUA 1TS5A 5JZEB 1YOVB 4BAXA 1XLOA 3DVGX 1WMHA 1F77A 2DHZA 4FJZA 1E7UA 2WHIA 3WALA 1WZ3A 2KHWB 2AQ1B 3EA6A 3RNBC 4KGSA 4M02A 1I4XA 4C4VB 3QQ8B 3X0WA 4EOYA 3NZSA 1JRUA 2Z0DB 5IAAC 1SB3C 1ISNA 1UELA 1PDXA 1SJED 2QSDA 3BVGA 1LQBA 3Q8BA 5J2RA 1UUPA 4KDLB 1ESFA 1BT0A 3D32A 3VAWA 2KTFA 4GGQA 1FFVA 1K8RB 2DBYA 3NVVA 5D3IB 1RWSA 4A20A 1XXGA 2ICIA 3BYTB 4H2AA 5E6OA 1CZPA 1TY2A 4A3PA 2D5GA 3PS6A 3AH7A 2MLBA 4CHKA 2LJ5A 2JSVX 4RH6A 4M8MA 2L0FA 3QIJA 4USAA 1BMLC 3H6NA 1KLVA 1BXTA 1EWCA 3IVFA 2WXMA 1R4MB 3TIXA 4LTUA 4HPMB 1HZ5A 3VQIA 2N9PC 4N59A 5H8YE 1XEEA 2KXJA 2LVPA 3E9SA 4US8A 1E7VA 1MPEA 3NY5A 1SEBD 2LVOA 2JQRB 3HHMA 4A55A 2YVCA 3TEXA 2M17A 4KIKA 3VRAB 2NPTB 5BMGA 4HK2A 2LGIA 5DPRA 3AE3B 3SU8X 3GE3C 3KQ4A 4GB9A 4A8XC 2MA9B 1VLBA 4F7ZA 4P7IA 2KQ4X 4II3B 2K3UA 4GLSC 1UD7A 1KLUD 3NRZA 3MFGA 1VDVA 4DXAB 1N61A 2K1FA 4RF0A 3UIOB 1TYGB 3PPAA 4NNJB 2MW5A 5BYRA 1GB4A 5C3JB 1WGYA 4YSZB 3AI5A 4WWNA 1RM6C 2WDVB 2AL6A 2V0GA 1V1PA 2KMMA 2O6VD 4HXDA 1YIWA 2MH7A 2KO3A 3DVGY 2WP9B 1PGAA 1V49A 2AQ2B 4I6PA 2BGFA 2E3TA 3Q3FA 1E8ZA 4ACFA 1WXAA 1PQSA 1E10A 1TGZB 2JX5A 2PMVA 1LM8B 3Q2AC 2NCNA 1I7HA 2JYEA 4ANXA 3DBRB 1FRRA 2XK5A 4CO7A 2EKEC 4IOIE 1WZ0A 4ZYSA 4IWQA 4BVUC 3R66C 1B1ZA 1PGBA 1NYQA 1WXMA 3MC9A 3L17A 3A9KA 2KWUB 1EU4A 4WJPA 3V6EB 3I63C 3Q3NC 4E3CA 4LNKA 4LCDE 1C76A 2WDRB 3AEFB 4MJSA 2IO3B 3UINB 4DHJD 2FUHB 3V61A 1P9DU 4NJ7A 2DYOA 1VCBA 1V9JA 3VR8B 3JSVA 4WH4A 4AS1A 1JMLA 4YL8A 4XC2A 1V97A 2INDC 1KLGD 1Q5WB 2KNBA 1WGHA 5IO9A 3DWMA 4XDCA 3I9V1 1NBFC 2KJHB 4WJQA 2LWPA 3QJZA 2J52A 3HUIA 3AU4A 3KVFB 1MHHE 3DBLI 3Q14C 3N20C 1JALA 3V6CB 1F52A 2LJIA 4IM3A 4M0WB 1GJZA 2UWQA 3ZXRA 4PS3A 2FCSA 1V81A 2LXAA 3U7DA 4W9CA 1I4HA 2JWZA 4WAFA 4D2KA 1U4AA 3R7RA 3W5VB 2LRUA 4RMAA 1WYGA 2MEKA 3MTNB 4A90A 1UGMA 5JHAA 4NAWA 2IPKD 4KGRA 4ZHPA 1RYJA 2HD5B 2KMAA 2OJWA 1NI3A 2DZKA 1R7SA 2BQQA 4CYEA 3ZNHB 3RNFC 2MBOA 4A3OA 2WWZA 1IBXA 4F8CB 4WJOA 3Q8EA 2ZPYA 3A1QB 4IC7B 5H92C 2KVRA 4HLEA 4DWFA 5BYQA 1WRDB 4BKSD 3H1UA 2K25A 4HDOA 1E0ZA 4YT0B 4GDLB 1C4PA 1ZW7A 4GU2A 2L52A 3IFWB 2KLGA 4P16A 4YTPB 1ZOYB 2IO0B 2N7JA 5C23A 1KRHA 2DAJA 1J7AA 3VR9B 2WXNA 3PRZA 4HKZE 3RMKC 3RNEC 3AEAB 4J3OD 2WU5B 1G6JA 3P2BA 2RR9A 1R4NB 1JWMD 2NS5A 2J53A 2LEKA 4JWUC 2W3SA 2DNFA 2JWUA 2G4SA 4B6WA 5BMHA 4PYUA 3NS1A 3RYTA 4C80A 5CX3A 4CQNA 4TSSA 3UF8A 4BOZB 4EE2A 2NTTA 1MVKA 4LDTB 4ASWC 3A4SC 4W9HA 4US9A 1FIQA 2RGFA 2I38A 3PRMB 1KOTA 3ZTCA 1XCTL 2DYBA 3WCQA 1V86A 2CHXA 3B2GA 1UF0A 2GLSA 2PJHA 1GG3A 2L1AA 1SE2A 2DYMA 1IGCA 5D6JB 3N1XC 2KJRA 2FE8A 3W1YA 2UU7A 1JWUD 1HA5A 2SAKA 1ZGUB 2OOBB 1UNSA 1KM7A 1WXSA 2OJRA 3RNGC 5JXVA 2W54A 4W9EA 4JPSA 1ET6A 3AECB 4FJVB 1YD8U 3KYCD 1UBIA 3UGBB 3T3OA 1P3QU 2HJ8A 4RGMA 2MCNB 3ZVVA 2M8SA 2G45B 3GB1A 3ZNID 2KDMA 2MX2A 1TTNA 3NG0A 3LDZE 5D94A 3M95A 2LGSA 3NS8A 2LFIA 1YQ4B 3NVWA 1QF6A 2X38A 3R8BA 5GMVA 3V62A 2KMCA 4KVGB 4TUUA 1FXIA 2INNE 3FILA 4IDIA 2GOWA 2WXIA 4L1BA 4TQ0A 2Z8LA 1SSNA 1I42A 2QILA 1L0YB 1AWDA 3A9JA 2LGXA 1WGRA 2BT6A 3VTWA 4JL9A 3O13A 3U7ZA 1WY8A 2WXQA 1WIAA 1WM3A 3ALBA 2JU6X 2NBVB 2WU2B 4FULA 1WFYA 5JH5C 4FLHA 1C78A 4MM3A 2XBBC 1ZPSA 5IOIA 4N9F4 2ZW0A 2YEPF 2ZVOA 4AUQC 1CK1A 2MP2A 4DXGA 5KHOA 3ENEA 1WJUA 3AN1A 2GBMA 5J18A 5HG2A 3ETRA 3NHEB 1Z5SB 3PSEB 4HCPB 2KK8A 2V3NA 3RZFA 1SJHD 3Q3OC 3TMPB 2XNAC 4HROA 2FCQA 2WDTB 3LYYA 1E8YA 4MSQB 5MPOA 5G5GA 2BKRB 2KN5A 2K39A 3VTUA 3O65B 3L4PA 1YJIA 2L0TA 3T8MA 1QT9A 4ZRPA 3ZJUA 4KSKC 2GBRA 4BBNC 3RFZB 2BW2A 1MI0A 2L8JA 4KGTA 1L6UA 5G5HA 3K9OB 1UBQA 1UZXB 3H7PA 4IG7B 1WWTA 3MHZA 3HM3A 3Q3MC 1EF1A 4JIOU 4XE0A 2D3CA 2KQSA 5TR5A 3HRDD 2FCMA 1AN8A 3GS2A 4WJNA 2K6DB 2C7MB 3VUWA 4N58A 3BINA 1C79A 2KX3A 3FC4A 1T0QC 4WQMA 5HFYA 3NZ3A 2MJ3A 2N4FA 3KUZA 3L16A 2PIAA 1TS2A 3AE4B 5G55A 3AMZA 3AEBB 2KC1A 3RT3B 2OHFA 1MG4A 1VJKA 1WXVA 5DCNA 1A70A 2CU3A 4HVBA 1C77A 2C7HA 3AE9B 2M0AA 2O6VB 3PLVA 1K53A 2MBHA 4C4VA 3UQAA 4RF1A 5DPSA 3LXFA 1Z2MA 1L0VB 1OTRB 3JW0X 3W1SA 1J7BA 1EM7A 4II2B 5L83A 3OJ4B 2D3GA 4UDUC 4AWJA 3EUB2 4QAYA 1CMXB 4DHZB 1IUEA 1XQQA 2N1WA 1HE8A 1N62A 2MWSB 1QQRA 5EDSA 5AUIA 2PVOD 3VXWA 3VTVA 4FJYA 3URYA 1EO6A 4HRSA 1TKEA 4FA6A 4EZJA 1OQYA 2J42A 3SR6A 2JYTA 4W9GA 5E6JA 1JWBD 3QAQA 3TSSA 2WNMA 3TCAA 4HDQA 3NJTA 2BYVE 1L5PA 2I1JA 4W9IA 1VR9A 3WIMA 4KIKB 5G2NA 4HWIB
chains in the Genus database with same CATH topology
4WAAA 2IY0B 3WANA 1IP9A 2MQJA 4OVUA 4FHKA 4JGHB 3RULA 2IY1B 2KNBA 2ZCCA 3BY4B 4J6IA 2AYOB 1OEYA 1WGHA 2J0MA 2N7EA 2LZ6A 1EF5A 4DHJB 1GC7A 1NBFC 1AARA 2L7RA 2KJHB 2N1VA 4WJQA 3RD2A 3VH3B 5LXIB 1E90A 2LWPA 3QJZA 4RM9A 4W9DA 2FNJB 2ASQA 2WX0A 2K6QA 2CU1A 3A33B 2GBNA 2KDFB 4GIVA 5LLIA 2DENB 4AP4C 2KKCA 4EZKA 3AU4A 4ZYNA 1H8CA 4NPNA 3KVFB 2W9NA 4BKTA 3DBLI 2C60A 2NR2A 2DZJA 1F9JA 4E74A 4EUTA 4OVVA 3V6CB 2LVQA 1YQBA 3DQVA 4IM3A 2MBBB 4M0WB 1D3ZA 1WMHB 1GJZA 1J0GA 2UWQA 4IM2A 2LI5A 4PS3A 1C3TA 2FCSA 2G4DB 1V81A 2LXAA 2BF8B 4KV2A 2BWES 3U7DA 4W9CA 2BWFA 1S3SG 3GOEA 2JWZA 5AEKB 1U4AA 3R7RA 4G0NB 4WWOA 2LRUA 4RMAA 1RLFA 3QARA 4IM0A 4DK5A 3MTNB 3B0AA 2ZPNA 2C5LC 1UGMA 3QHTA 2KWCA 4W9JA 5JHAA 4NAWA 3MJWA 4G3XB 2XEWA 3V60A 5CHFA 2HD5B 4JLCA 2KMAA 2DZIA 2K8CA 2N9EB 2R2OA 2KQ7A 2WX1A 2DZKA 4ZRIA 2JT4B 3Q3JA 3QC8B 4CYEA 4KDIC 1LFDA 4K81A 4KZ0A 5CHWA 5D7GA 3CSFA 3PRPB 3ZNHB 1WF9A 2MBOA 3JVZX 4A3OA 1R4NI 2AL3A 3ZNZB 2R2QA 2WWZA 3TL5A 2FAZA 2AEHA 3KW5B 4F8CB 1GC6A 4WJOA 3S2AA 5KHQA 4W9LA 2ZPYA 2NBWB 2G3QB 3A1QB 4IC7B 3NOBA 1LXDA 2KVRA 4M8NA 4HLEA 4FADA 4DWFA 1WRDB 4BKSD 2MSED 1X1MA 3DDCB 3H1UA 3H7SA 2LGDA 2ZZPB 2K25A 4HDOA 3B08A 1Q1OA 4G50A 4GDLB 5AZHA 1ZW7A 4GU2A 3HK0A 5FR6A 3IFWB 2GMIC 2KLGA 2M0XA 4AOFA 2FIFA 2IO0B 3N30A 4MDKE 1E8XA 5C23A 4AJYB 2DAJA 2D11A 3ZNGC 1WR1A 2MP2B 2RD0A 3K9PB 4LDTD 4X57B 3PRZA 2PE9A 2O6VA 2REXA 1WX8A 4MJSB 5CTRC 3HIZA 3PREA 2VRRB 4GDKA 3B1LX 2FIDA 4F1SA 4GN1A 3IHPC 1V6EA 1G6JA 2RR9A 3P2BA 3PV1A 4ICUA 2NS5A 3SDLC 3ZIMA 3CF6E 2KFJA 1GNUA 3JSVB 2D2QA 3QX1A 2JVCA 4HJKA 1P0RA 4B6WA 2G4SA 5CHVC 4PYUA 2D07B 3L54A 3RYTA 3RZWC 2GBJA 5CX3A 4HCNB 1RRBA 4PS8A 3X23A 3UF8A 2D10A 2V4LA 5AZFA 2KDEB 4BOZB 3APDA 3PHXB 3QCAA 2KC2A 4LDTB 1KJTA 2JXXA 1J8CA 1MG8A 3A4SC 4W9HA 4ASWC 3VHTC 4MGKE 2RGFA 3M3JA 1SGHA 4GOCA 2EMTA 3R3MA 3AXCA 3ZKJC 2J0KA 3PRMB 1KOTA 2CKHB 2IO1B 3ML9A 1WH3A 2KANA 4TQ1A 2LD9A 3ZTCA 2B3AA 4HPLB 1E8WA 2DYBA 1WYWB 3ECIA 1EUVB 1VD2A 5AZGA 1V86A 2JY6A 2CHXA 3PTFC 4NQKE 3H7PB 3ZRCA 3ZO5B 2A4ZA 2PPHA 2KLCA 2O2VB 2LRWA 4JQWC 2PJHA 2J0JA 2Y5BB 4ZRJA 4W9KA 1FXTB 1GG3A 2AWTA 2N7DA 2NPTA 2DYMA 4K7SA 2GBKA 5BO4B 3UIPB 5D6JB 3DOWA 2KJRA 4W9FA 4ZDVA 4URKA 2QHOA 3IBEA 2JF5A 2ZNVB 3DVNV 4NY0A 3W1YA 3WA0A 3WAPA 2KJ6A 2KDIA 3R7QA 2RPQA 4BBNF 4MELA 3ML8A 4MEMA 2JRIB 3VH4B 1WGGA 1Q0WB 3N32A 1H4RA 3SD5A 2K8BA 2BPSA 2ZNVC 4FN2A 4B9KA 3DPDA 4NJ6A 2ZVNA 1ZGUB 2OOBB 1IYFA 1KM7A 4XX5A 1QZEA 1WXSA 2OJRA 3EECA 3N3KB 3GZNI 1IPGA 3L0WB 3VFKA 3HM6X 3ONSA 2C7NB 4FHJA 4W9EA 4WQOB 3WAOA 4ANVA 4LJOB 2KOXA 3EFUA 5JZEB 1GUAB 4FJVB 1YD8U 3DVGX 4IWPA 3KYCD 1UBIA 1WMHA 3RUIB 3UGBB 4ICVA 1P3QU 2HJ8A 2KFKB 2MCNB 3ZVVA 2DHZA 1E7UA 3IG3A 2PE6B 1XD3B 2M8SA 4FJZA 1WZ3A 2G45B 2KHWB 3LJ3A 3WALA 3ZNID 2MX2A 1TTNA 3LDZE 5D94A 3M95A 2CHWA 2L76A 3A4RA 2BYEA 1V5TA 3ZDTA 2EMSA 4GSWA 3NS8A 4ANUA 1NI2A 2XK5B 3QQ8B 3X0WA 4EOYA 5GMVA 3NZSA 1JRUA 2Z0DB 3V62A 2JUOA 2JRHA 2KZRA 3ZW3A 2KMCA 3C0RB 4KVGB 5IAAC 1ISNA 4TUUA 4ANWA 1A5RA 1UELA 2IYDB 3DBSA 1LQBA 2GOWA 4WWPA 5J2RA 4KSLC 4KZCA 4KDLB 1BT0A 1TZ1A 3D32A 3W1SC 5LXHA 3VAWA 3A9KB 1R4MI 4TQ0A 3CSTA 2KTFA 4GGQA 1K8RB 5E6PA 1I42A 4EFOA 3ZLZA 3A9JA 2LGXA 1WGRA 2MBQA 3A1QA 5J17A 3L13A 4A20A 3VTWA 4JL9A 1XT9B 1WY8A 1V2YA 1WIAA 1WM3A 3ALBA 2NBVB 4FULA 1WFYA 5JH5C 5E6OA 4FLHA 2Z0EB 2FCNA 4GXBA 3CMMB 4GDLA 4MM3A 1WGDA 2LGYA 3TJPA 4A3PA 2ZJDA 3PS6A 3QA8A 4BFRA 2XBBC 3UQBA 4K7UA 4AJWA 1WR6E 3PZDA 4N9F4 4MGZE 2ZVOA 4AUQC 2MLBA 4CHKA 1WE6A 2LJ5A 3DCGA 3QWZB 2MP2A 5KHOA 4BOSC 4TV3A 4M8MA 2L0FA 3ENEA 2DAFA 3QIJA 1L7YA 1WJUA 3H6NA 3KUCB 2GBMA 1KLVA 5J18A 1WI0A 3IVFA 4DHZE 3VUXA 2MBEA 3TIXA 3NHEB 1Z5SB 2KTRA 3PSEB 4HPMB 3VQIA 2N9PC 4GMVA 4HCPB 4BKSA 3APCA 1ZKHA 2I1KA 2KXJA 1YX6B 2LVPA 2KK8A 1E7VA 2IZVB 3RZFA 2LUEA 3NY5A 4XZ4A 3TMPB 3H9DA 4ZRKA 1V80A 3L08A 2FCQA 2WDTB 2KD0A 3PT2B 2LVOA 2PEAA 3HHMA 1E8YA 4MSQB 2YVCA 4EEWA 1WJ6A 2BKRB 2KN5A 2K39A 3VTUA 3O65B 3T8MA 2L0TA 2M17A 4KIKA 1V5OA 4NQLB 2RSUA 4B95A 2NPTB 1WJNA 3DVNU 4HK2A 2KX0A 4KSKC 5DPRA 3SHQA 2GBRA 4BBNC 3SU8X 2YLMA 4GB9A 2MA9B 3OJ3A 2L8JA 1WM2A 2ZCBA 4F7ZA 2WYQA 4P7IA 1RAXA 3K9OB 4G11A 2L3ZA 1UBQA 4II3B 1UZXB 4TKNA 1UD7A 3PLUA 4IUMB 3H7PA 4IG7B 3QK0A 4DXAB 2K1FA 3VVWB 3M63B 4NAWB 2O2VA 3UIOB 1YX5B 3PPAA 2LXCA 3HM3A 2IO2B 2V3SA 5JHBA 1OGWA 4NNJB 1EF1A 1P1AA 2MW5A 2L05A 1Y8RC 4JIOU 5DPWA 3EHVA 2KQSA 5TR5A 3KYDD 1WGYA 1SIFA 3DBRI 3KH0A 3AI5A 3I3TB 4PYZA 2FCMA 2A5UA 2BYFA 2UYZB 4WWNA 4WJNA 4BKGA 2K6DB 2AL6A 2C7MB 3VUWA 1SE9A 3BINA 2KX3A 2O6VD 2M1MA 2J7QB 3NZUA 1YIWA 2N9XA 4HXDA 2HE7A 3VDZA 1I35A 1NDDA 4MSMB 3EC8A 2KO3A 2N4FA 3ZTDA 3DVGY 2M4NA 3KUZA 3TBLD 3RCZA 1L2NA 3L16A 4DDGD 1C1YB 1V49A 3ZRFA 4EZLA 2KWVB 4I6PA 1OEYJ 2ZEQA 4E71A 2BGFA 4K1RB 5G55A 2MRPA 3Q3FA 1E8ZA 1WXAA 2KFKA 1PQSA 2DZMA 4MGIE 2KC1A 3RT3B 3ZUNA 4DDID 3AULA 3PVLA 1WXVA 5DCNA 1TGZB 4IWOA 3ZDMC 1YJ1A 4HVBA 1LM8B 3A9JB 2NCNA 2CHZA 4IW0A 2C7HA 4ANXA 4I6NB 2O6VB 1WX7A 3AU5A 2MBHA 3PLVA 4GDKB 3VUYA 2XK5A 3UQAA 4CO7A 3APFA 5DPSA 3PGEA 2BKFA 2C9WB 1Z2MA 2EKEC 1OTRB 2JPHA 3OAWA 3JW0X 2K8HA 3W1SA 2Z59B 1WZ0A 5IA7A 2NVUI 4II2B 4IWQA 5L83A 5C1ZA 3OJ4B 2D3GA 3R66C 4BVUC 4EKUA 1TBEA 3PHWB 5L95C 2JZ3B 1WXMA 4AWJA 4K7WA 2CS4A 1WJ4A 2L00B 3L17A 3A9KA 1WX9A 1S1QB 1CMXB 2KWUB 4DHZB 1J19A 1XQQA 2N1WA 1HE8A 4LJPB 4PS7A 2LASA 2MWSB 4WJPA 3V6EB 3WAMA 1RFAA 5E6NA 4E3CA 5EDSA 3VXWA 4LCDE 3VTVA 4FJYA 3JYUA 1EO6A 2IO3B 4MJSA 3UINB 4DBGA 2KTRB 1T0YA 2FUHB 2V1YA 4DHJD 3T9LA 3V61A 1WE7A 4I6LB 3OLMD 4FA6A 1P9DU 2CR5A 3L10B 1OQYA 4NJ7A 4EZJA 2DYOA 1VCBA 5HKHA 1V9JA 3M62B 3JSVA 4W9GA 2JZZA 3U30A 2IBIB 2NBUA 3U8ZA 4MH0E 1P98A 3DBHI 3QAQA 2DX5B 2KDBA 4YL8A 5D2MB 5DPTA 1UH6A 2HTHA 3TCAA 3MHSD 4HDQA 4MGYE 4XC2A 1E5WA 2BYVE 2I1JA 4RM8A 4W9IA 4FBJB 1M94A 3WIMA 3KUDB 4KIKB 1Q5WB 5G2NA 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAA A;  2IY0 B;  3WAN A;  1IP9 A;  2MQJ A;  4OVU A;  4FHK A;  4JGH B;  3RUL A;  2IY1 B;  2KNB A;  2ZCC A;  3BY4 B;  4J6I A;  2AYO B;  1OEY A;  1WGH A;  2J0M A;  2N7E A;  2LZ6 A;  1EF5 A;  4DHJ B;  1GC7 A;  1NBF C;  1AAR A;  2L7R A;  2KJH B;  2N1V A;  4WJQ A;  3RD2 A;  3VH3 B;  5LXI B;  1E90 A;  2LWP A;  3QJZ A;  4RM9 A;  4W9D A;  2FNJ B;  2ASQ A;  2WX0 A;  2K6Q A;  2CU1 A;  3A33 B;  2GBN A;  2KDF B;  4GIV A;  5LLI A;  2DEN B;  4AP4 C;  2KKC A;  4EZK A;  3AU4 A;  4ZYN A;  1H8C A;  4NPN A;  3KVF B;  2W9N A;  4BKT A;  3DBL I;  2C60 A;  2NR2 A;  2DZJ A;  1F9J A;  4E74 A;  4EUT A;  4OVV A;  3V6C B;  2LVQ A;  1YQB A;  3DQV A;  4IM3 A;  2MBB B;  4M0W B;  1D3Z A;  1WMH B;  1GJZ A;  1J0G A;  2UWQ A;  4IM2 A;  2LI5 A;  4PS3 A;  1C3T A;  2FCS A;  2G4D B;  1V81 A;  2LXA A;  2BF8 B;  4KV2 A;  2BWE S;  3U7D A;  4W9C A;  2BWF A;  1S3S G;  3GOE A;  2JWZ A;  5AEK B;  1U4A A;  3R7R A;  4G0N B;  4WWO A;  2LRU A;  4RMA A;  1RLF A;  3QAR A;  4IM0 A;  4DK5 A;  3MTN B;  3B0A A;  2ZPN A;  2C5L C;  1UGM A;  3QHT A;  2KWC A;  4W9J A;  5JHA A;  4NAW A;  3MJW A;  4G3X B;  2XEW A;  3V60 A;  5CHF A;  2HD5 B;  4JLC A;  2KMA A;  2DZI A;  2K8C A;  2N9E B;  2R2O A;  2KQ7 A;  2WX1 A;  2DZK A;  4ZRI A;  2JT4 B;  3Q3J A;  3QC8 B;  4CYE A;  4KDI C;  1LFD A;  4K81 A;  4KZ0 A;  5CHW A;  5D7G A;  3CSF A;  3PRP B;  3ZNH B;  1WF9 A;  2MBO A;  3JVZ X;  4A3O A;  1R4N I;  2AL3 A;  3ZNZ B;  2R2Q A;  2WWZ A;  3TL5 A;  2FAZ A;  2AEH A;  3KW5 B;  4F8C B;  1GC6 A;  4WJO A;  3S2A A;  5KHQ A;  4W9L A;  2ZPY A;  2NBW B;  2G3Q B;  3A1Q B;  4IC7 B;  3NOB A;  1LXD A;  2KVR A;  4M8N A;  4HLE A;  4FAD A;  4DWF A;  1WRD B;  4BKS D;  2MSE D;  1X1M A;  3DDC B;  3H1U A;  3H7S A;  2LGD A;  2ZZP B;  2K25 A;  4HDO A;  3B08 A;  1Q1O A;  4G50 A;  4GDL B;  5AZH A;  1ZW7 A;  4GU2 A;  3HK0 A;  5FR6 A;  3IFW B;  2GMI C;  2KLG A;  2M0X A;  4AOF A;  2FIF A;  2IO0 B;  3N30 A;  4MDK E;  1E8X A;  5C23 A;  4AJY B;  2DAJ A;  2D11 A;  3ZNG C;  1WR1 A;  2MP2 B;  2RD0 A;  3K9P B;  4LDT D;  4X57 B;  3PRZ A;  2PE9 A;  2O6V A;  2REX A;  1WX8 A;  4MJS B;  5CTR C;  3HIZ A;  3PRE A;  2VRR B;  4GDK A;  3B1L X;  2FID A;  4F1S A;  4GN1 A;  3IHP C;  1V6E A;  1G6J A;  2RR9 A;  3P2B A;  3PV1 A;  4ICU A;  2NS5 A;  3SDL C;  3ZIM A;  3CF6 E;  2KFJ A;  1GNU A;  3JSV B;  2D2Q A;  3QX1 A;  2JVC A;  4HJK A;  1P0R A;  4B6W A;  2G4S A;  5CHV C;  4PYU A;  2D07 B;  3L54 A;  3RYT A;  3RZW C;  2GBJ A;  5CX3 A;  4HCN B;  1RRB A;  4PS8 A;  3X23 A;  3UF8 A;  2D10 A;  2V4L A;  5AZF A;  2KDE B;  4BOZ B;  3APD A;  3PHX B;  3QCA A;  2KC2 A;  4LDT B;  1KJT A;  2JXX A;  1J8C A;  1MG8 A;  3A4S C;  4W9H A;  4ASW C;  3VHT C;  4MGK E;  2RGF A;  3M3J A;  1SGH A;  4GOC A;  2EMT A;  3R3M A;  3AXC A;  3ZKJ C;  2J0K A;  3PRM B;  1KOT A;  2CKH B;  2IO1 B;  3ML9 A;  1WH3 A;  2KAN A;  4TQ1 A;  2LD9 A;  3ZTC A;  2B3A A;  4HPL B;  1E8W A;  2DYB A;  1WYW B;  3ECI A;  1EUV B;  1VD2 A;  5AZG A;  1V86 A;  2JY6 A;  2CHX A;  3PTF C;  4NQK E;  3H7P B;  3ZRC A;  3ZO5 B;  2A4Z A;  2PPH A;  2KLC A;  2O2V B;  2LRW A;  4JQW C;  2PJH A;  2J0J A;  2Y5B B;  4ZRJ A;  4W9K A;  1FXT B;  1GG3 A;  2AWT A;  2N7D A;  2NPT A;  2DYM A;  4K7S A;  2GBK A;  5BO4 B;  3UIP B;  5D6J B;  3DOW A;  2KJR A;  4W9F A;  4ZDV A;  4URK A;  2QHO A;  3IBE A;  2JF5 A;  2ZNV B;  3DVN V;  4NY0 A;  3W1Y A;  3WA0 A;  3WAP A;  2KJ6 A;  2KDI A;  3R7Q A;  2RPQ A;  4BBN F;  4MEL A;  3ML8 A;  4MEM A;  2JRI B;  3VH4 B;  1WGG A;  1Q0W B;  3N32 A;  1H4R A;  3SD5 A;  2K8B A;  2BPS A;  2ZNV C;  4FN2 A;  4B9K A;  3DPD A;  4NJ6 A;  2ZVN A;  1ZGU B;  2OOB B;  1IYF A;  1KM7 A;  4XX5 A;  1QZE A;  1WXS A;  2OJR A;  3EEC A;  3N3K B;  3GZN I;  1IPG A;  3L0W B;  3VFK A;  3HM6 X;  3ONS A;  2C7N B;  4FHJ A;  4W9E A;  4WQO B;  3WAO A;  4ANV A;  4LJO B;  2KOX A;  3EFU A;  5JZE B;  1GUA B;  4FJV B;  1YD8 U;  3DVG X;  4IWP A;  3KYC D;  1UBI A;  1WMH A;  3RUI B;  3UGB B;  4ICV A;  1P3Q U;  2HJ8 A;  2KFK B;  2MCN B;  3ZVV A;  2DHZ A;  1E7U A;  3IG3 A;  2PE6 B;  1XD3 B;  2M8S A;  4FJZ A;  1WZ3 A;  2G45 B;  2KHW B;  3LJ3 A;  3WAL A;  3ZNI D;  2MX2 A;  1TTN A;  3LDZ E;  5D94 A;  3M95 A;  2CHW A;  2L76 A;  3A4R A;  2BYE A;  1V5T A;  3ZDT A;  2EMS A;  4GSW A;  3NS8 A;  4ANU A;  1NI2 A;  2XK5 B;  3QQ8 B;  3X0W A;  4EOY A;  5GMV A;  3NZS A;  1JRU A;  2Z0D B;  3V62 A;  2JUO A;  2JRH A;  2KZR A;  3ZW3 A;  2KMC A;  3C0R B;  4KVG B;  5IAA C;  1ISN A;  4TUU A;  4ANW A;  1A5R A;  1UEL A;  2IYD B;  3DBS A;  1LQB A;  2GOW A;  4WWP A;  5J2R A;  4KSL C;  4KZC A;  4KDL B;  1BT0 A;  1TZ1 A;  3D32 A;  3W1S C;  5LXH A;  3VAW A;  3A9K B;  1R4M I;  4TQ0 A;  3CST A;  2KTF A;  4GGQ A;  1K8R B;  5E6P A;  1I42 A;  4EFO A;  3ZLZ A;  3A9J A;  2LGX A;  1WGR A;  2MBQ A;  3A1Q A;  5J17 A;  3L13 A;  4A20 A;  3VTW A;  4JL9 A;  1XT9 B;  1WY8 A;  1V2Y A;  1WIA A;  1WM3 A;  3ALB A;  2NBV B;  4FUL A;  1WFY A;  5JH5 C;  5E6O A;  4FLH A;  2Z0E B;  2FCN A;  4GXB A;  3CMM B;  4GDL A;  4MM3 A;  1WGD A;  2LGY A;  3TJP A;  4A3P A;  2ZJD A;  3PS6 A;  3QA8 A;  4BFR A;  2XBB C;  3UQB A;  4K7U A;  4AJW A;  1WR6 E;  3PZD A;  4N9F 4;  4MGZ E;  2ZVO A;  4AUQ C;  2MLB A;  4CHK A;  1WE6 A;  2LJ5 A;  3DCG A;  3QWZ B;  2MP2 A;  5KHO A;  4BOS C;  4TV3 A;  4M8M A;  2L0F A;  3ENE A;  2DAF A;  3QIJ A;  1L7Y A;  1WJU A;  3H6N A;  3KUC B;  2GBM A;  1KLV A;  5J18 A;  1WI0 A;  3IVF A;  4DHZ E;  3VUX A;  2MBE A;  3TIX A;  3NHE B;  1Z5S B;  2KTR A;  3PSE B;  4HPM B;  3VQI A;  2N9P C;  4GMV A;  4HCP B;  4BKS A;  3APC A;  1ZKH A;  2I1K A;  2KXJ A;  1YX6 B;  2LVP A;  2KK8 A;  1E7V A;  2IZV B;  3RZF A;  2LUE A;  3NY5 A;  4XZ4 A;  3TMP B;  3H9D A;  4ZRK A;  1V80 A;  3L08 A;  2FCQ A;  2WDT B;  2KD0 A;  3PT2 B;  2LVO A;  2PEA A;  3HHM A;  1E8Y A;  4MSQ B;  2YVC A;  4EEW A;  1WJ6 A;  2BKR B;  2KN5 A;  2K39 A;  3VTU A;  3O65 B;  3T8M A;  2L0T A;  2M17 A;  4KIK A;  1V5O A;  4NQL B;  2RSU A;  4B95 A;  2NPT B;  1WJN A;  3DVN U;  4HK2 A;  2KX0 A;  4KSK C;  5DPR A;  3SHQ A;  2GBR A;  4BBN C;  3SU8 X;  2YLM A;  4GB9 A;  2MA9 B;  3OJ3 A;  2L8J A;  1WM2 A;  2ZCB A;  4F7Z A;  2WYQ A;  4P7I A;  1RAX A;  3K9O B;  4G11 A;  2L3Z A;  1UBQ A;  4II3 B;  1UZX B;  4TKN A;  1UD7 A;  3PLU A;  4IUM B;  3H7P A;  4IG7 B;  3QK0 A;  4DXA B;  2K1F A;  3VVW B;  3M63 B;  4NAW B;  2O2V A;  3UIO B;  1YX5 B;  3PPA A;  2LXC A;  3HM3 A;  2IO2 B;  2V3S A;  5JHB A;  1OGW A;  4NNJ B;  1EF1 A;  1P1A A;  2MW5 A;  2L05 A;  1Y8R C;  4JIO U;  5DPW A;  3EHV A;  2KQS A;  5TR5 A;  3KYD D;  1WGY A;  1SIF A;  3DBR I;  3KH0 A;  3AI5 A;  3I3T B;  4PYZ A;  2FCM A;  2A5U A;  2BYF A;  2UYZ B;  4WWN A;  4WJN A;  4BKG A;  2K6D B;  2AL6 A;  2C7M B;  3VUW A;  1SE9 A;  3BIN A;  2KX3 A;  2O6V D;  2M1M A;  2J7Q B;  3NZU A;  1YIW A;  2N9X A;  4HXD A;  2HE7 A;  3VDZ A;  1I35 A;  1NDD A;  4MSM B;  3EC8 A;  2KO3 A;  2N4F A;  3ZTD A;  3DVG Y;  2M4N A;  3KUZ A;  3TBL D;  3RCZ A;  1L2N A;  3L16 A;  4DDG D;  1C1Y B;  1V49 A;  3ZRF A;  4EZL A;  2KWV B;  4I6P A;  1OEY J;  2ZEQ A;  4E71 A;  2BGF A;  4K1R B;  5G55 A;  2MRP A;  3Q3F A;  1E8Z A;  1WXA A;  2KFK A;  1PQS A;  2DZM A;  4MGI E;  2KC1 A;  3RT3 B;  3ZUN A;  4DDI D;  3AUL A;  3PVL A;  1WXV A;  5DCN A;  1TGZ B;  4IWO A;  3ZDM C;  1YJ1 A;  4HVB A;  1LM8 B;  3A9J B;  2NCN A;  2CHZ A;  4IW0 A;  2C7H A;  4ANX A;  4I6N B;  2O6V B;  1WX7 A;  3AU5 A;  2MBH A;  3PLV A;  4GDK B;  3VUY A;  2XK5 A;  3UQA A;  4CO7 A;  3APF A;  5DPS A;  3PGE A;  2BKF A;  2C9W B;  1Z2M A;  2EKE C;  1OTR B;  2JPH A;  3OAW A;  3JW0 X;  2K8H A;  3W1S A;  2Z59 B;  1WZ0 A;  5IA7 A;  2NVU I;  4II2 B;  4IWQ A;  5L83 A;  5C1Z A;  3OJ4 B;  2D3G A;  3R66 C;  4BVU C;  4EKU A;  1TBE A;  3PHW B;  5L95 C;  2JZ3 B;  1WXM A;  4AWJ A;  4K7W A;  2CS4 A;  1WJ4 A;  2L00 B;  3L17 A;  3A9K A;  1WX9 A;  1S1Q B;  1CMX B;  2KWU B;  4DHZ B;  1J19 A;  1XQQ A;  2N1W A;  1HE8 A;  4LJP B;  4PS7 A;  2LAS A;  2MWS B;  4WJP A;  3V6E B;  3WAM A;  1RFA A;  5E6N A;  4E3C A;  5EDS A;  3VXW A;  4LCD E;  3VTV A;  4FJY A;  3JYU A;  1EO6 A;  2IO3 B;  4MJS A;  3UIN B;  4DBG A;  2KTR B;  1T0Y A;  2FUH B;  2V1Y A;  4DHJ D;  3T9L A;  3V61 A;  1WE7 A;  4I6L B;  3OLM D;  4FA6 A;  1P9D U;  2CR5 A;  3L10 B;  1OQY A;  4NJ7 A;  4EZJ A;  2DYO A;  1VCB A;  5HKH A;  1V9J A;  3M62 B;  3JSV A;  4W9G A;  2JZZ A;  3U30 A;  2IBI B;  2NBU A;  3U8Z A;  4MH0 E;  1P98 A;  3DBH I;  3QAQ A;  2DX5 B;  2KDB A;  4YL8 A;  5D2M B;  5DPT A;  1UH6 A;  2HTH A;  3TCA A;  3MHS D;  4HDQ A;  4MGY E;  4XC2 A;  1E5W A;  2BYV E;  2I1J A;  4RM8 A;  4W9I A;  4FBJ B;  1M94 A;  3WIM A;  3KUD B;  4KIK B;  1Q5W B;  5G2N A;  4HWI B; 
#chains in the Genus database with same CATH topology
 4K3C A;  4WAA A;  1ZXI A;  4FHK A;  4JGH B;  1DOI A;  3BY4 B;  3BVM A;  2PLP A;  1OEY A;  2J0M A;  2LZ6 A;  4RGO S;  1EF5 A;  2WXR A;  4DHJ B;  1DGJ A;  1GC7 A;  2L7R A;  2N1V A;  1E90 A;  2ASQ A;  3A33 B;  2DEN B;  2HDE A;  2KKC A;  1H8C A;  4BKT A;  2K5P A;  5EE0 A;  2DZJ A;  2IJ0 A;  4E74 A;  3BII D;  4OVV A;  4DQO C;  1FEH A;  1J0G A;  1HTO A;  1FFU A;  4RNA A;  4FXC A;  1JCK B;  4OZB A;  5AEK B;  3U2S C;  4YXD B;  1RLF A;  3QAR A;  2BS2 B;  2AX5 A;  3QHT A;  3MJW A;  4G3X B;  5CHF A;  3RNA C;  1ACC A;  2KQ7 A;  2WX1 A;  4ZRI A;  2JT4 B;  3DBL B;  1LFD A;  4KZ0 A;  3CSF A;  1XLQ A;  3JVZ X;  2AL3 A;  3TL5 A;  2AEH A;  3AB5 A;  4W9L A;  2EKI A;  2NBW B;  3NOB A;  1LXD A;  3ZXV A;  3P42 A;  1TS3 A;  2KYW A;  4RGN A;  2MSE D;  1Q10 A;  3DDC B;  1T0R C;  4K3B A;  2LGD A;  3IT4 B;  4G50 A;  4IKG A;  1GAQ B;  4N6E B;  3CWI A;  3HK0 A;  2GMI C;  2WQY B;  1PFD A;  2FIF A;  5GXG B;  4HKQ A;  1TS4 A;  1E8X A;  4AJY B;  4ZHO A;  2LMC A;  3ZNG C;  2WXJ A;  1ET9 A;  1OQQ A;  3K9P B;  2V9H A;  1M4V A;  1FNV A;  3AE8 B;  1ZUD 2;  4MJS B;  5CTR C;  2PKO A;  4ZOH C;  4F1S A;  3B1L X;  2FID A;  2V3P A;  3W5U B;  3P4R B;  3GP7 A;  3ZIM A;  3JSV B;  2JVC A;  5IKC M;  4HJK A;  2G1E A;  5CHV C;  2D07 B;  3DHG C;  3L54 A;  1SBB B;  3RZW C;  1F0Z A;  3P4S B;  2D10 A;  2G9H D;  2V4L A;  2KDE B;  3APD A;  2KC2 A;  1MG8 A;  3VHT C;  1SIJ A;  3M3J A;  3ZKJ C;  2RPV A;  2KAN A;  2PW9 A;  1XCQ L;  2QDF A;  5AZG A;  1VD2 A;  3PTF C;  1D4B A;  4YTN B;  3SEB A;  2A4Z A;  3CIR B;  2O2V B;  4W9K A;  2N7D A;  2MJE A;  3NVY A;  3UIP B;  4K7S A;  2GBK A;  1MFW A;  5BO4 B;  3DOW A;  4C7Y A;  4NY0 A;  3WAP A;  3U52 E;  4YSY B;  4BBN F;  3ML8 A;  4MEM A;  4OW0 A;  3N32 A;  1H4R A;  2ZNV C;  2BPS A;  4OZA A;  4P6V F;  1QZE A;  3GZN I;  1TKG A;  3L0W B;  4M01 A;  2C7N B;  1JRO A;  3WAO A;  4JE3 B;  4JWS C;  2BS3 B;  1FD6 A;  4IWP A;  1VRA B;  1YNT E;  3RUI B;  4ICV A;  1ZP0 B;  2KFK B;  4WWM A;  4P1B C;  3IG3 A;  2PE6 B;  3RPF C;  2CHW A;  3A4R A;  2I2Y A;  2BYE A;  1V5T A;  4ANU A;  1NI2 A;  4L23 A;  4XDD A;  3BK2 A;  2JRH A;  1QKZ A;  3AE6 B;  1FMA D;  5FR3 A;  3DBS A;  4XWW A;  4LNN A;  4WWP A;  4KSL C;  2Q5W D;  3W1S C;  5LXH A;  5E6P A;  4ZRQ A;  4EFO A;  3IT6 B;  2MBQ A;  3A1Q A;  4B0E A;  3L13 A;  3P63 A;  1F2R I;  1XT9 B;  2N9K A;  4S17 A;  1I4G A;  2FCN A;  4GDL A;  1WGD A;  2LGY A;  2ZJD A;  3QA8 A;  4BFR A;  3UQB A;  2WXK A;  4AJW A;  2J4X A;  3PZD A;  4MGZ E;  2Y5P A;  1WE6 A;  3MC0 B;  4BOS C;  4TV3 A;  2DAF A;  2SEB D;  1L7Y A;  2W3R A;  4DHZ E;  3VUX A;  2MBE A;  2KTR A;  3I5J C;  2WXF A;  3APC A;  3H8H A;  1ZKH A;  4XZ4 A;  3H9D A;  3HVD A;  4KX6 B;  3RNC C;  3BYY B;  2KD0 A;  4KKI A;  2PEA A;  2IDY A;  1C4A A;  2INP E;  1K50 A;  4EEW A;  1WJ6 A;  2BTE A;  3W9C B;  3EGR A;  4NQL B;  4B95 A;  1E9M A;  3DVN U;  2KX0 A;  1NEN B;  4LNI A;  2YLM A;  4XGA B;  4C56 C;  1HEZ E;  3OJ3 A;  3SFE B;  1FNW A;  3NVZ A;  1WM2 A;  4PT5 A;  2ZCB A;  1L6V A;  2QIE B;  4G11 A;  2L3Z A;  2MHJ A;  2Y3A A;  4IUM B;  1YX5 B;  3PO0 A;  2LXC A;  2IO2 B;  1ENF A;  2L05 A;  1Y8R C;  1L0X B;  5DPW A;  3Q8C A;  4XWT A;  3KYD D;  1SIF A;  3KH0 A;  2WXO A;  3I3T B;  4PYZ A;  1UWM A;  4MH8 A;  3Q6B A;  3ZGZ A;  2M1M A;  2NTS A;  2J7Q B;  4NAM A;  3VDZ A;  2HE7 A;  3HVZ A;  2HJ1 A;  3EC8 A;  1YQ3 B;  2WXP A;  2M4N A;  1V8C A;  3TBL D;  3RCZ A;  2OED A;  4L2Y A;  1L2N A;  3LB8 C;  4DDG D;  1C1Y B;  3FIL B;  2KWV B;  4E71 A;  3R2I A;  2MRP A;  5AUK A;  4DDI D;  3AUL A;  4WUR A;  3IAS 1;  3PVL A;  2K22 A;  4IWO A;  3ZDM C;  1YJ1 A;  3A9J B;  2IGD A;  4RFB A;  3ZQ4 A;  2AQ3 B;  4I6N B;  4GDK B;  3VUY A;  3PGE A;  2BKF A;  2C9W B;  2LHE A;  2JPH A;  2K8H A;  2Z59 B;  3FAH A;  1YN3 A;  5FK9 C;  1TBE A;  5L95 C;  1QLB B;  3AEE B;  4K7W A;  1WJ4 A;  3I57 A;  2JXT A;  3V3X A;  1LGR A;  1S1Q B;  4LJP B;  3PZ7 A;  2LAS A;  2H88 B;  5D3D A;  4JX1 C;  1ZDX A;  4OHJ A;  2RDB C;  1YJJ A;  2H89 B;  2CJN A;  3JYU A;  4MT5 A;  1DOY A;  4DBG A;  1T0Y A;  4ITK A;  2CR5 A;  3PZ8 A;  3P4P B;  2JZZ A;  4MH0 E;  1P98 A;  3DBH I;  4HEA 1;  2DX5 B;  2KDB A;  1T5X D;  5EE3 A;  2HTH A;  4MGY E;  1ZXH A;  1E5W A;  1FO4 A;  3C19 A;  4RM8 A;  4YSX B;  2BYT A;  3KUD B;  2W82 A;  1ZE3 D;  3WAN A;  2MQJ A;  1F2R C;  2X8X X;  4J6I A;  4REZ A;  2ACZ B;  1I4R A;  1P7F A;  1AAR A;  3VH3 B;  2FNJ B;  2K6Q A;  2FBW B;  3B9J A;  2V4I B;  4AP4 C;  1C9F A;  4EZK A;  4A9A A;  3NUH B;  5C2T B;  2NR2 A;  1NYR A;  2VH1 A;  3SFD B;  2E6X A;  2RDG A;  3AE5 B;  3UI3 A;  1QOF A;  2MBB B;  3Q8A A;  1WMH B;  3TEW A;  1NVI D;  1DYQ A;  2LI5 A;  4IM2 A;  4KV2 A;  2BWE S;  3DHI C;  1S3S G;  3GOE A;  2TSS A;  4WWO A;  4DK5 A;  2C5L C;  2KWC A;  4W9J A;  1BUI C;  2KAJ A;  4JLC A;  4OZC A;  1DOX A;  2DZI A;  2K8C A;  2R2O A;  3Q3J A;  3QC8 B;  4KDI C;  1MJD A;  3PRP B;  1WF9 A;  1I4Q A;  2R2Q A;  1QOA A;  2FAZ A;  3EFC A;  1GC6 A;  3S2A A;  3ABV B;  3ZJV A;  1FCL A;  2IGG A;  1KFY B;  2JZP A;  4FAD A;  3Q69 A;  3B08 A;  5EE1 A;  1XF5 L;  1J7C A;  5AZH A;  3OG5 A;  4AOF A;  3N30 A;  4MDK E;  1N5W A;  3N1Y C;  2RD0 A;  4X57 B;  1T0S C;  4R3D A;  1TKY A;  1T6B X;  2O6V A;  1WX8 A;  1UWX A;  3HIZ A;  3N9Y C;  2VRR B;  3PRE A;  4C00 A;  3AEG B;  4DXF A;  1V6E A;  3SDL C;  1SE3 A;  1NEK B;  3CF6 E;  2D2Q A;  4BZA A;  1KF6 B;  1XLP A;  1B9R A;  3TEZ A;  2GBJ A;  2HTM E;  4MAC A;  4PS8 A;  3PHX B;  3OWE B;  1HTQ A;  1KJT A;  1ROE A;  3FKY A;  3AXC A;  2CKH B;  3ML9 A;  1WH3 A;  1JW9 D;  4TQ1 A;  2LD9 A;  1YMH E;  1CJE A;  1FCC C;  4HPL B;  1E8W A;  1N6Z A;  3ECI A;  1FM0 D;  2JY6 A;  3ZRC A;  2PPH A;  2KLC A;  3DHH C;  2LRW A;  4HPP A;  4JQW C;  1PYW D;  2KVZ A;  2WXL A;  2Y5B B;  1FXT B;  2AWT A;  2NPT A;  2XN9 C;  1CQV A;  4W9F A;  3AE2 B;  2JF5 A;  3DVN V;  3WA0 A;  2KJ6 A;  2KDI A;  3R7Q A;  3AM9 A;  3VH4 B;  1V1P B;  1WGG A;  2D3B A;  3SD5 A;  3DWG C;  4B9K A;  1TY0 A;  3J9C A;  2ZW1 A;  2K0P A;  4XX5 A;  1YN4 A;  3EEC A;  1IPG A;  4FHJ A;  3ONS A;  4WQO B;  4LNF A;  4ANV A;  2KOX A;  1D5X C;  3R2T A;  4S0R A;  1GUA B;  1XD3 B;  3LJ3 A;  1GB1 A;  5BYS A;  2L76 A;  1WSP A;  1VZ6 A;  3ZDT A;  2EMS A;  4GSW A;  2XK5 B;  1K51 A;  4LLG M;  5T8I A;  2JUO A;  2KZR A;  3ZW3 A;  3C0R B;  4NZL B;  4ANW A;  1A5R A;  2PVG C;  2N0S B;  2IYD B;  1L4D B;  1QIL A;  1STE A;  2M56 B;  3GZN B;  4KZC A;  1TZ1 A;  1E6E B;  2QMT A;  3ZYY X;  3A9K B;  1R4M I;  3CST A;  1V1O A;  3ZLZ A;  5J17 A;  1WGK A;  2ON8 A;  2DWQ A;  3T3N A;  1PGX A;  3U4E G;  1V2Y A;  3IXS A;  2Z0E B;  4GXB A;  3CMM B;  3TJP A;  4YWG G;  1EWY C;  1Y56 A;  4K7U A;  2GRI A;  1WR6 E;  1FXA A;  3DCG A;  3QWZ B;  5FKA C;  2R61 A;  4OVZ A;  1XO3 A;  2DLB A;  3KUC B;  1WI0 A;  3VRB B;  1LO5 D;  2BB6 A;  4XYC A;  4GMV A;  4BKS A;  2I1K A;  1YX6 B;  2IZV B;  2LUE A;  4ZRK A;  1V80 A;  3L08 A;  1SXT A;  4TMA B;  3PT2 B;  1SF0 A;  1HZ6 A;  5HI1 A;  5IP4 D;  1FRD A;  1V5O A;  2RSU A;  1WJN A;  3SHQ A;  1TZO A;  2IGH A;  3AV8 A;  2B76 B;  2WYQ A;  1RAX A;  3KWV A;  4TKN A;  3PLU A;  3P1M A;  1D5Z C;  3QK0 A;  3VVW B;  3B2F A;  2ONQ A;  3M63 B;  4NAW B;  2O2V A;  2L32 A;  2V3S A;  2KT7 A;  5JHB A;  1OGW A;  1P1A A;  1K52 A;  1TT5 B;  3EHV A;  3DBR I;  1T3Q A;  4M0W A;  2A5U A;  2BYF A;  2UYZ B;  4BKG A;  1C4C A;  1SE9 A;  1IBX B;  4RCO A;  4LK0 M;  1VZ8 A;  3NZU A;  2N9X A;  2D3A A;  5I4D A;  1I35 A;  1NDD A;  2BBC A;  4MSM B;  2LHD A;  3ZTD A;  1KTK A;  1QOG A;  4WIP A;  1XLN A;  2WGS A;  3ZRF A;  4EZL A;  1OEY J;  1VZ7 A;  2ZEQ A;  4O1N A;  4K1R B;  2M19 A;  4Q2J A;  1MHX A;  1L4Z B;  2KFK A;  2DZM A;  4KKJ A;  4MGI E;  4ARI A;  1AYF A;  1SE4 A;  3ZUN A;  2GI9 A;  1FNU A;  1ZDV A;  2Y5C A;  2QEJ C;  2CHZ A;  4IW0 A;  3ZJT A;  1WX7 A;  3AU5 A;  2VZK B;  2GB1 A;  4B0M A;  3APF A;  2WXG A;  3OAW A;  5IA7 A;  3BZD B;  2NVU I;  5C1Z A;  4EKU A;  1UGJ A;  3PHW B;  2JZ3 B;  2CS4 A;  2L00 B;  1WX9 A;  1WRI A;  1N60 A;  1J19 A;  4PS7 A;  4NJC A;  1I4P A;  2BVC A;  1EU3 A;  4C7Z A;  3WAM A;  1RFA A;  5E6N A;  2KTR B;  2QJL A;  2V1Y A;  3T9L A;  1WE7 A;  4I6L B;  3OLM D;  3RI7 C;  3L10 B;  5IN7 A;  5HKH A;  3M62 B;  3BK1 A;  3U30 A;  2IBI B;  2NBU A;  3U8Z A;  5D2M B;  5DPT A;  3BVZ A;  1UH6 A;  2RMM A;  3MHS D;  2QC8 A;  4FBJ B;  1M94 A;  3C8Y A;  2IY0 B;  1IP9 A;  3MC8 A;  4OVU A;  1JWA D;  3RUL A;  2IY1 B;  2ZCC A;  3AE1 B;  2AYO B;  2N7E A;  2KAC A;  1OQR A;  3RD2 A;  3AED B;  1TIF A;  5LXI B;  4RM9 A;  4W9D A;  2WX0 A;  3V05 A;  2CU1 A;  2GBN A;  2KDF B;  3GE8 C;  4GIV A;  5LLI A;  2WS3 B;  4ZYN A;  4ARC A;  4NPN A;  2W9N A;  2C60 A;  5TSS A;  3DBH B;  1F9J A;  1KH0 A;  4EUT A;  2LUM A;  4HJG E;  2LVQ A;  1F1H A;  1AW7 A;  1YQB A;  3DQV A;  2INC C;  1D3Z A;  1C3T A;  2G4D B;  2BF8 B;  2BWF A;  5BMI A;  1D5M C;  4M00 A;  1N63 A;  4G0N B;  2W55 A;  4IM0 A;  2VZK D;  3W2D A;  3B0A A;  2ZPN A;  4RGT A;  2XEW A;  1PUT A;  4AQ7 A;  3V60 A;  3N1Z C;  2N9E B;  3TUO A;  4K81 A;  1RFK A;  5D7G A;  5CHW A;  1R4N I;  3ZNZ B;  1N5X A;  5LNK 1;  3KW5 B;  5KHQ A;  2QCZ A;  4A6Q A;  2L83 A;  2NMQ A;  1HQR D;  2G3Q B;  2WLB A;  4M8N A;  4LNO A;  4YTM B;  3MJ5 A;  1JWS D;  3MP9 A;  1X1M A;  3H7S A;  2WXH A;  2ZZP B;  3E56 A;  1Q1O A;  4MM3 B;  5FR6 A;  2M0X A;  2FUG 1;  3RN9 C;  1IGD A;  2VH2 A;  2D11 A;  1WR1 A;  2MP2 B;  4LDT D;  3KWL A;  2PE9 A;  2REX A;  4GDK A;  2YEP B;  4GN1 A;  3IHP C;  2K9X A;  3PV1 A;  3BWU D;  4PK1 A;  1TJE A;  4ICU A;  1E7P B;  2RDH A;  2KFJ A;  1GNU A;  3QX1 A;  1P0R A;  4HCN B;  1RRB A;  2KWD A;  3X23 A;  5AZF A;  3P4Q B;  3QCA A;  1GPX A;  1J8C A;  2JXX A;  4MGK E;  1HXY D;  1OFF A;  1SGH A;  4GOC A;  2EMT A;  3R3M A;  2J0K A;  2IO1 B;  1D6E C;  2B3A A;  1WYW B;  1EUV B;  4NQK E;  1QOB A;  3H7P B;  2MJD A;  3ZO5 B;  1GOZ A;  3KLS X;  2KN4 A;  2WDQ B;  3AE7 B;  1JQ4 A;  2J0J A;  1FPY A;  4ZRJ A;  1P7E A;  1JRP A;  2PTL A;  2EEL A;  4P1C C;  4ZDV A;  4URK A;  2QHO A;  3IBE A;  2ZNV B;  2BB5 A;  3Q8F A;  2RPQ A;  5HHD G;  4MEL A;  1WXQ A;  2JRI B;  1Q0W B;  2K8B A;  4FN2 A;  3DPD A;  1YN5 A;  2ZVN A;  4NJ6 A;  1IYF A;  2CJO A;  2BS4 B;  2N9L A;  3N3K B;  3IAM 1;  3VFK A;  3HM6 X;  3TEY A;  4LJO B;  5EE9 A;  3EFU A;  1TS5 A;  5JZE B;  1YOV B;  4BAX A;  1XLO A;  3DVG X;  1WMH A;  1F77 A;  2DHZ A;  4FJZ A;  1E7U A;  2WHI A;  3WAL A;  1WZ3 A;  2KHW B;  2AQ1 B;  3EA6 A;  3RNB C;  4KGS A;  4M02 A;  1I4X A;  4C4V B;  3QQ8 B;  3X0W A;  4EOY A;  3NZS A;  1JRU A;  2Z0D B;  5IAA C;  1SB3 C;  1ISN A;  1UEL A;  1PDX A;  1SJE D;  2QSD A;  3BVG A;  1LQB A;  3Q8B A;  5J2R A;  1UUP A;  4KDL B;  1ESF A;  1BT0 A;  3D32 A;  3VAW A;  2KTF A;  4GGQ A;  1FFV A;  1K8R B;  2DBY A;  3NVV A;  5D3I B;  1RWS A;  4A20 A;  1XXG A;  2ICI A;  3BYT B;  4H2A A;  5E6O A;  1CZP A;  1TY2 A;  4A3P A;  2D5G A;  3PS6 A;  3AH7 A;  2MLB A;  4CHK A;  2LJ5 A;  2JSV X;  4RH6 A;  4M8M A;  2L0F A;  3QIJ A;  4USA A;  1BML C;  3H6N A;  1KLV A;  1BXT A;  1EWC A;  3IVF A;  2WXM A;  1R4M B;  3TIX A;  4LTU A;  4HPM B;  1HZ5 A;  3VQI A;  2N9P C;  4N59 A;  5H8Y E;  1XEE A;  2KXJ A;  2LVP A;  3E9S A;  4US8 A;  1E7V A;  1MPE A;  3NY5 A;  1SEB D;  2LVO A;  2JQR B;  3HHM A;  4A55 A;  2YVC A;  3TEX A;  2M17 A;  4KIK A;  3VRA B;  2NPT B;  5BMG A;  4HK2 A;  2LGI A;  5DPR A;  3AE3 B;  3SU8 X;  3GE3 C;  3KQ4 A;  4GB9 A;  4A8X C;  2MA9 B;  1VLB A;  4F7Z A;  4P7I A;  2KQ4 X;  4II3 B;  2K3U A;  4GLS C;  1UD7 A;  1KLU D;  3NRZ A;  3MFG A;  1VDV A;  4DXA B;  1N61 A;  2K1F A;  4RF0 A;  3UIO B;  1TYG B;  3PPA A;  4NNJ B;  2MW5 A;  5BYR A;  1GB4 A;  5C3J B;  1WGY A;  4YSZ B;  3AI5 A;  4WWN A;  1RM6 C;  2WDV B;  2AL6 A;  2V0G A;  1V1P A;  2KMM A;  2O6V D;  4HXD A;  1YIW A;  2MH7 A;  2KO3 A;  3DVG Y;  2WP9 B;  1PGA A;  1V49 A;  2AQ2 B;  4I6P A;  2BGF A;  2E3T A;  3Q3F A;  1E8Z A;  4ACF A;  1WXA A;  1PQS A;  1E10 A;  1TGZ B;  2JX5 A;  2PMV A;  1LM8 B;  3Q2A C;  2NCN A;  1I7H A;  2JYE A;  4ANX A;  3DBR B;  1FRR A;  2XK5 A;  4CO7 A;  2EKE C;  4IOI E;  1WZ0 A;  4ZYS A;  4IWQ A;  4BVU C;  3R66 C;  1B1Z A;  1PGB A;  1NYQ A;  1WXM A;  3MC9 A;  3L17 A;  3A9K A;  2KWU B;  1EU4 A;  4WJP A;  3V6E B;  3I63 C;  3Q3N C;  4E3C A;  4LNK A;  4LCD E;  1C76 A;  2WDR B;  3AEF B;  4MJS A;  2IO3 B;  3UIN B;  4DHJ D;  2FUH B;  3V61 A;  1P9D U;  4NJ7 A;  2DYO A;  1VCB A;  1V9J A;  3VR8 B;  3JSV A;  4WH4 A;  4AS1 A;  1JML A;  4YL8 A;  4XC2 A;  1V97 A;  2IND C;  1KLG D;  1Q5W B;  2KNB A;  1WGH A;  5IO9 A;  3DWM A;  4XDC A;  3I9V 1;  1NBF C;  2KJH B;  4WJQ A;  2LWP A;  3QJZ A;  2J52 A;  3HUI A;  3AU4 A;  3KVF B;  1MHH E;  3DBL I;  3Q14 C;  3N20 C;  1JAL A;  3V6C B;  1F52 A;  2LJI A;  4IM3 A;  4M0W B;  1GJZ A;  2UWQ A;  3ZXR A;  4PS3 A;  2FCS A;  1V81 A;  2LXA A;  3U7D A;  4W9C A;  1I4H A;  2JWZ A;  4WAF A;  4D2K A;  1U4A A;  3R7R A;  3W5V B;  2LRU A;  4RMA A;  1WYG A;  2MEK A;  3MTN B;  4A90 A;  1UGM A;  5JHA A;  4NAW A;  2IPK D;  4KGR A;  4ZHP A;  1RYJ A;  2HD5 B;  2KMA A;  2OJW A;  1NI3 A;  2DZK A;  1R7S A;  2BQQ A;  4CYE A;  3ZNH B;  3RNF C;  2MBO A;  4A3O A;  2WWZ A;  1IBX A;  4F8C B;  4WJO A;  3Q8E A;  2ZPY A;  3A1Q B;  4IC7 B;  5H92 C;  2KVR A;  4HLE A;  4DWF A;  5BYQ A;  1WRD B;  4BKS D;  3H1U A;  2K25 A;  4HDO A;  1E0Z A;  4YT0 B;  4GDL B;  1C4P A;  1ZW7 A;  4GU2 A;  2L52 A;  3IFW B;  2KLG A;  4P16 A;  4YTP B;  1ZOY B;  2IO0 B;  2N7J A;  5C23 A;  1KRH A;  2DAJ A;  1J7A A;  3VR9 B;  2WXN A;  3PRZ A;  4HKZ E;  3RMK C;  3RNE C;  3AEA B;  4J3O D;  2WU5 B;  1G6J A;  3P2B A;  2RR9 A;  1R4N B;  1JWM D;  2NS5 A;  2J53 A;  2LEK A;  4JWU C;  2W3S A;  2DNF A;  2JWU A;  2G4S A;  4B6W A;  5BMH A;  4PYU A;  3NS1 A;  3RYT A;  4C80 A;  5CX3 A;  4CQN A;  4TSS A;  3UF8 A;  4BOZ B;  4EE2 A;  2NTT A;  1MVK A;  4LDT B;  4ASW C;  3A4S C;  4W9H A;  4US9 A;  1FIQ A;  2RGF A;  2I38 A;  3PRM B;  1KOT A;  3ZTC A;  1XCT L;  2DYB A;  3WCQ A;  1V86 A;  2CHX A;  3B2G A;  1UF0 A;  2GLS A;  2PJH A;  1GG3 A;  2L1A A;  1SE2 A;  2DYM A;  1IGC A;  5D6J B;  3N1X C;  2KJR A;  2FE8 A;  3W1Y A;  2UU7 A;  1JWU D;  1HA5 A;  2SAK A;  1ZGU B;  2OOB B;  1UNS A;  1KM7 A;  1WXS A;  2OJR A;  3RNG C;  5JXV A;  2W54 A;  4W9E A;  4JPS A;  1ET6 A;  3AEC B;  4FJV B;  1YD8 U;  3KYC D;  1UBI A;  3UGB B;  3T3O A;  1P3Q U;  2HJ8 A;  4RGM A;  2MCN B;  3ZVV A;  2M8S A;  2G45 B;  3GB1 A;  3ZNI D;  2KDM A;  2MX2 A;  1TTN A;  3NG0 A;  3LDZ E;  5D94 A;  3M95 A;  2LGS A;  3NS8 A;  2LFI A;  1YQ4 B;  3NVW A;  1QF6 A;  2X38 A;  3R8B A;  5GMV A;  3V62 A;  2KMC A;  4KVG B;  4TUU A;  1FXI A;  2INN E;  3FIL A;  4IDI A;  2GOW A;  2WXI A;  4L1B A;  4TQ0 A;  2Z8L A;  1SSN A;  1I42 A;  2QIL A;  1L0Y B;  1AWD A;  3A9J A;  2LGX A;  1WGR A;  2BT6 A;  3VTW A;  4JL9 A;  3O13 A;  3U7Z A;  1WY8 A;  2WXQ A;  1WIA A;  1WM3 A;  3ALB A;  2JU6 X;  2NBV B;  2WU2 B;  4FUL A;  1WFY A;  5JH5 C;  4FLH A;  1C78 A;  4MM3 A;  2XBB C;  1ZPS A;  5IOI A;  4N9F 4;  2ZW0 A;  2YEP F;  2ZVO A;  4AUQ C;  1CK1 A;  2MP2 A;  4DXG A;  5KHO A;  3ENE A;  1WJU A;  3AN1 A;  2GBM A;  5J18 A;  5HG2 A;  3ETR A;  3NHE B;  1Z5S B;  3PSE B;  4HCP B;  2KK8 A;  2V3N A;  3RZF A;  1SJH D;  3Q3O C;  3TMP B;  2XNA C;  4HRO A;  2FCQ A;  2WDT B;  3LYY A;  1E8Y A;  4MSQ B;  5MPO A;  5G5G A;  2BKR B;  2KN5 A;  2K39 A;  3VTU A;  3O65 B;  3L4P A;  1YJI A;  2L0T A;  3T8M A;  1QT9 A;  4ZRP A;  3ZJU A;  4KSK C;  2GBR A;  4BBN C;  3RFZ B;  2BW2 A;  1MI0 A;  2L8J A;  4KGT A;  1L6U A;  5G5H A;  3K9O B;  1UBQ A;  1UZX B;  3H7P A;  4IG7 B;  1WWT A;  3MHZ A;  3HM3 A;  3Q3M C;  1EF1 A;  4JIO U;  4XE0 A;  2D3C A;  2KQS A;  5TR5 A;  3HRD D;  2FCM A;  1AN8 A;  3GS2 A;  4WJN A;  2K6D B;  2C7M B;  3VUW A;  4N58 A;  3BIN A;  1C79 A;  2KX3 A;  3FC4 A;  1T0Q C;  4WQM A;  5HFY A;  3NZ3 A;  2MJ3 A;  2N4F A;  3KUZ A;  3L16 A;  2PIA A;  1TS2 A;  3AE4 B;  5G55 A;  3AMZ A;  3AEB B;  2KC1 A;  3RT3 B;  2OHF A;  1MG4 A;  1VJK A;  1WXV A;  5DCN A;  1A70 A;  2CU3 A;  4HVB A;  1C77 A;  2C7H A;  3AE9 B;  2M0A A;  2O6V B;  3PLV A;  1K53 A;  2MBH A;  4C4V A;  3UQA A;  4RF1 A;  5DPS A;  3LXF A;  1Z2M A;  1L0V B;  1OTR B;  3JW0 X;  3W1S A;  1J7B A;  1EM7 A;  4II2 B;  5L83 A;  3OJ4 B;  2D3G A;  4UDU C;  4AWJ A;  3EUB 2;  4QAY A;  1CMX B;  4DHZ B;  1IUE A;  1XQQ A;  2N1W A;  1HE8 A;  1N62 A;  2MWS B;  1QQR A;  5EDS A;  5AUI A;  2PVO D;  3VXW A;  3VTV A;  4FJY A;  3URY A;  1EO6 A;  4HRS A;  1TKE A;  4FA6 A;  4EZJ A;  1OQY A;  2J42 A;  3SR6 A;  2JYT A;  4W9G A;  5E6J A;  1JWB D;  3QAQ A;  3TSS A;  2WNM A;  3TCA A;  4HDQ A;  3NJT A;  2BYV E;  1L5P A;  2I1J A;  4W9I A;  1VR9 A;  3WIM A;  4KIK B;  5G2N A;  4HWI B; 
#chains in the Genus database with same CATH homology
 4WAA A;  2IY0 B;  3WAN A;  1IP9 A;  2MQJ A;  4OVU A;  4FHK A;  4JGH B;  3RUL A;  2IY1 B;  2KNB A;  2ZCC A;  3BY4 B;  4J6I A;  2AYO B;  1OEY A;  1WGH A;  2J0M A;  2N7E A;  2LZ6 A;  1EF5 A;  4DHJ B;  1GC7 A;  1NBF C;  1AAR A;  2L7R A;  2KJH B;  2N1V A;  4WJQ A;  3RD2 A;  3VH3 B;  5LXI B;  1E90 A;  2LWP A;  3QJZ A;  4RM9 A;  4W9D A;  2FNJ B;  2ASQ A;  2WX0 A;  2K6Q A;  2CU1 A;  3A33 B;  2GBN A;  2KDF B;  4GIV A;  5LLI A;  2DEN B;  4AP4 C;  2KKC A;  4EZK A;  3AU4 A;  4ZYN A;  1H8C A;  4NPN A;  3KVF B;  2W9N A;  4BKT A;  3DBL I;  2C60 A;  2NR2 A;  2DZJ A;  1F9J A;  4E74 A;  4EUT A;  4OVV A;  3V6C B;  2LVQ A;  1YQB A;  3DQV A;  4IM3 A;  2MBB B;  4M0W B;  1D3Z A;  1WMH B;  1GJZ A;  1J0G A;  2UWQ A;  4IM2 A;  2LI5 A;  4PS3 A;  1C3T A;  2FCS A;  2G4D B;  1V81 A;  2LXA A;  2BF8 B;  4KV2 A;  2BWE S;  3U7D A;  4W9C A;  2BWF A;  1S3S G;  3GOE A;  2JWZ A;  5AEK B;  1U4A A;  3R7R A;  4G0N B;  4WWO A;  2LRU A;  4RMA A;  1RLF A;  3QAR A;  4IM0 A;  4DK5 A;  3MTN B;  3B0A A;  2ZPN A;  2C5L C;  1UGM A;  3QHT A;  2KWC A;  4W9J A;  5JHA A;  4NAW A;  3MJW A;  4G3X B;  2XEW A;  3V60 A;  5CHF A;  2HD5 B;  4JLC A;  2KMA A;  2DZI A;  2K8C A;  2N9E B;  2R2O A;  2KQ7 A;  2WX1 A;  2DZK A;  4ZRI A;  2JT4 B;  3Q3J A;  3QC8 B;  4CYE A;  4KDI C;  1LFD A;  4K81 A;  4KZ0 A;  5CHW A;  5D7G A;  3CSF A;  3PRP B;  3ZNH B;  1WF9 A;  2MBO A;  3JVZ X;  4A3O A;  1R4N I;  2AL3 A;  3ZNZ B;  2R2Q A;  2WWZ A;  3TL5 A;  2FAZ A;  2AEH A;  3KW5 B;  4F8C B;  1GC6 A;  4WJO A;  3S2A A;  5KHQ A;  4W9L A;  2ZPY A;  2NBW B;  2G3Q B;  3A1Q B;  4IC7 B;  3NOB A;  1LXD A;  2KVR A;  4M8N A;  4HLE A;  4FAD A;  4DWF A;  1WRD B;  4BKS D;  2MSE D;  1X1M A;  3DDC B;  3H1U A;  3H7S A;  2LGD A;  2ZZP B;  2K25 A;  4HDO A;  3B08 A;  1Q1O A;  4G50 A;  4GDL B;  5AZH A;  1ZW7 A;  4GU2 A;  3HK0 A;  5FR6 A;  3IFW B;  2GMI C;  2KLG A;  2M0X A;  4AOF A;  2FIF A;  2IO0 B;  3N30 A;  4MDK E;  1E8X A;  5C23 A;  4AJY B;  2DAJ A;  2D11 A;  3ZNG C;  1WR1 A;  2MP2 B;  2RD0 A;  3K9P B;  4LDT D;  4X57 B;  3PRZ A;  2PE9 A;  2O6V A;  2REX A;  1WX8 A;  4MJS B;  5CTR C;  3HIZ A;  3PRE A;  2VRR B;  4GDK A;  3B1L X;  2FID A;  4F1S A;  4GN1 A;  3IHP C;  1V6E A;  1G6J A;  2RR9 A;  3P2B A;  3PV1 A;  4ICU A;  2NS5 A;  3SDL C;  3ZIM A;  3CF6 E;  2KFJ A;  1GNU A;  3JSV B;  2D2Q A;  3QX1 A;  2JVC A;  4HJK A;  1P0R A;  4B6W A;  2G4S A;  5CHV C;  4PYU A;  2D07 B;  3L54 A;  3RYT A;  3RZW C;  2GBJ A;  5CX3 A;  4HCN B;  1RRB A;  4PS8 A;  3X23 A;  3UF8 A;  2D10 A;  2V4L A;  5AZF A;  2KDE B;  4BOZ B;  3APD A;  3PHX B;  3QCA A;  2KC2 A;  4LDT B;  1KJT A;  2JXX A;  1J8C A;  1MG8 A;  3A4S C;  4W9H A;  4ASW C;  3VHT C;  4MGK E;  2RGF A;  3M3J A;  1SGH A;  4GOC A;  2EMT A;  3R3M A;  3AXC A;  3ZKJ C;  2J0K A;  3PRM B;  1KOT A;  2CKH B;  2IO1 B;  3ML9 A;  1WH3 A;  2KAN A;  4TQ1 A;  2LD9 A;  3ZTC A;  2B3A A;  4HPL B;  1E8W A;  2DYB A;  1WYW B;  3ECI A;  1EUV B;  1VD2 A;  5AZG A;  1V86 A;  2JY6 A;  2CHX A;  3PTF C;  4NQK E;  3H7P B;  3ZRC A;  3ZO5 B;  2A4Z A;  2PPH A;  2KLC A;  2O2V B;  2LRW A;  4JQW C;  2PJH A;  2J0J A;  2Y5B B;  4ZRJ A;  4W9K A;  1FXT B;  1GG3 A;  2AWT A;  2N7D A;  2NPT A;  2DYM A;  4K7S A;  2GBK A;  5BO4 B;  3UIP B;  5D6J B;  3DOW A;  2KJR A;  4W9F A;  4ZDV A;  4URK A;  2QHO A;  3IBE A;  2JF5 A;  2ZNV B;  3DVN V;  4NY0 A;  3W1Y A;  3WA0 A;  3WAP A;  2KJ6 A;  2KDI A;  3R7Q A;  2RPQ A;  4BBN F;  4MEL A;  3ML8 A;  4MEM A;  2JRI B;  3VH4 B;  1WGG A;  1Q0W B;  3N32 A;  1H4R A;  3SD5 A;  2K8B A;  2BPS A;  2ZNV C;  4FN2 A;  4B9K A;  3DPD A;  4NJ6 A;  2ZVN A;  1ZGU B;  2OOB B;  1IYF A;  1KM7 A;  4XX5 A;  1QZE A;  1WXS A;  2OJR A;  3EEC A;  3N3K B;  3GZN I;  1IPG A;  3L0W B;  3VFK A;  3HM6 X;  3ONS A;  2C7N B;  4FHJ A;  4W9E A;  4WQO B;  3WAO A;  4ANV A;  4LJO B;  2KOX A;  3EFU A;  5JZE B;  1GUA B;  4FJV B;  1YD8 U;  3DVG X;  4IWP A;  3KYC D;  1UBI A;  1WMH A;  3RUI B;  3UGB B;  4ICV A;  1P3Q U;  2HJ8 A;  2KFK B;  2MCN B;  3ZVV A;  2DHZ A;  1E7U A;  3IG3 A;  2PE6 B;  1XD3 B;  2M8S A;  4FJZ A;  1WZ3 A;  2G45 B;  2KHW B;  3LJ3 A;  3WAL A;  3ZNI D;  2MX2 A;  1TTN A;  3LDZ E;  5D94 A;  3M95 A;  2CHW A;  2L76 A;  3A4R A;  2BYE A;  1V5T A;  3ZDT A;  2EMS A;  4GSW A;  3NS8 A;  4ANU A;  1NI2 A;  2XK5 B;  3QQ8 B;  3X0W A;  4EOY A;  5GMV A;  3NZS A;  1JRU A;  2Z0D B;  3V62 A;  2JUO A;  2JRH A;  2KZR A;  3ZW3 A;  2KMC A;  3C0R B;  4KVG B;  5IAA C;  1ISN A;  4TUU A;  4ANW A;  1A5R A;  1UEL A;  2IYD B;  3DBS A;  1LQB A;  2GOW A;  4WWP A;  5J2R A;  4KSL C;  4KZC A;  4KDL B;  1BT0 A;  1TZ1 A;  3D32 A;  3W1S C;  5LXH A;  3VAW A;  3A9K B;  1R4M I;  4TQ0 A;  3CST A;  2KTF A;  4GGQ A;  1K8R B;  5E6P A;  1I42 A;  4EFO A;  3ZLZ A;  3A9J A;  2LGX A;  1WGR A;  2MBQ A;  3A1Q A;  5J17 A;  3L13 A;  4A20 A;  3VTW A;  4JL9 A;  1XT9 B;  1WY8 A;  1V2Y A;  1WIA A;  1WM3 A;  3ALB A;  2NBV B;  4FUL A;  1WFY A;  5JH5 C;  5E6O A;  4FLH A;  2Z0E B;  2FCN A;  4GXB A;  3CMM B;  4GDL A;  4MM3 A;  1WGD A;  2LGY A;  3TJP A;  4A3P A;  2ZJD A;  3PS6 A;  3QA8 A;  4BFR A;  2XBB C;  3UQB A;  4K7U A;  4AJW A;  1WR6 E;  3PZD A;  4N9F 4;  4MGZ E;  2ZVO A;  4AUQ C;  2MLB A;  4CHK A;  1WE6 A;  2LJ5 A;  3DCG A;  3QWZ B;  2MP2 A;  5KHO A;  4BOS C;  4TV3 A;  4M8M A;  2L0F A;  3ENE A;  2DAF A;  3QIJ A;  1L7Y A;  1WJU A;  3H6N A;  3KUC B;  2GBM A;  1KLV A;  5J18 A;  1WI0 A;  3IVF A;  4DHZ E;  3VUX A;  2MBE A;  3TIX A;  3NHE B;  1Z5S B;  2KTR A;  3PSE B;  4HPM B;  3VQI A;  2N9P C;  4GMV A;  4HCP B;  4BKS A;  3APC A;  1ZKH A;  2I1K A;  2KXJ A;  1YX6 B;  2LVP A;  2KK8 A;  1E7V A;  2IZV B;  3RZF A;  2LUE A;  3NY5 A;  4XZ4 A;  3TMP B;  3H9D A;  4ZRK A;  1V80 A;  3L08 A;  2FCQ A;  2WDT B;  2KD0 A;  3PT2 B;  2LVO A;  2PEA A;  3HHM A;  1E8Y A;  4MSQ B;  2YVC A;  4EEW A;  1WJ6 A;  2BKR B;  2KN5 A;  2K39 A;  3VTU A;  3O65 B;  3T8M A;  2L0T A;  2M17 A;  4KIK A;  1V5O A;  4NQL B;  2RSU A;  4B95 A;  2NPT B;  1WJN A;  3DVN U;  4HK2 A;  2KX0 A;  4KSK C;  5DPR A;  3SHQ A;  2GBR A;  4BBN C;  3SU8 X;  2YLM A;  4GB9 A;  2MA9 B;  3OJ3 A;  2L8J A;  1WM2 A;  2ZCB A;  4F7Z A;  2WYQ A;  4P7I A;  1RAX A;  3K9O B;  4G11 A;  2L3Z A;  1UBQ A;  4II3 B;  1UZX B;  4TKN A;  1UD7 A;  3PLU A;  4IUM B;  3H7P A;  4IG7 B;  3QK0 A;  4DXA B;  2K1F A;  3VVW B;  3M63 B;  4NAW B;  2O2V A;  3UIO B;  1YX5 B;  3PPA A;  2LXC A;  3HM3 A;  2IO2 B;  2V3S A;  5JHB A;  1OGW A;  4NNJ B;  1EF1 A;  1P1A A;  2MW5 A;  2L05 A;  1Y8R C;  4JIO U;  5DPW A;  3EHV A;  2KQS A;  5TR5 A;  3KYD D;  1WGY A;  1SIF A;  3DBR I;  3KH0 A;  3AI5 A;  3I3T B;  4PYZ A;  2FCM A;  2A5U A;  2BYF A;  2UYZ B;  4WWN A;  4WJN A;  4BKG A;  2K6D B;  2AL6 A;  2C7M B;  3VUW A;  1SE9 A;  3BIN A;  2KX3 A;  2O6V D;  2M1M A;  2J7Q B;  3NZU A;  1YIW A;  2N9X A;  4HXD A;  2HE7 A;  3VDZ A;  1I35 A;  1NDD A;  4MSM B;  3EC8 A;  2KO3 A;  2N4F A;  3ZTD A;  3DVG Y;  2M4N A;  3KUZ A;  3TBL D;  3RCZ A;  1L2N A;  3L16 A;  4DDG D;  1C1Y B;  1V49 A;  3ZRF A;  4EZL A;  2KWV B;  4I6P A;  1OEY J;  2ZEQ A;  4E71 A;  2BGF A;  4K1R B;  5G55 A;  2MRP A;  3Q3F A;  1E8Z A;  1WXA A;  2KFK A;  1PQS A;  2DZM A;  4MGI E;  2KC1 A;  3RT3 B;  3ZUN A;  4DDI D;  3AUL A;  3PVL A;  1WXV A;  5DCN A;  1TGZ B;  4IWO A;  3ZDM C;  1YJ1 A;  4HVB A;  1LM8 B;  3A9J B;  2NCN A;  2CHZ A;  4IW0 A;  2C7H A;  4ANX A;  4I6N B;  2O6V B;  1WX7 A;  3AU5 A;  2MBH A;  3PLV A;  4GDK B;  3VUY A;  2XK5 A;  3UQA A;  4CO7 A;  3APF A;  5DPS A;  3PGE A;  2BKF A;  2C9W B;  1Z2M A;  2EKE C;  1OTR B;  2JPH A;  3OAW A;  3JW0 X;  2K8H A;  3W1S A;  2Z59 B;  1WZ0 A;  5IA7 A;  2NVU I;  4II2 B;  4IWQ A;  5L83 A;  5C1Z A;  3OJ4 B;  2D3G A;  3R66 C;  4BVU C;  4EKU A;  1TBE A;  3PHW B;  5L95 C;  2JZ3 B;  1WXM A;  4AWJ A;  4K7W A;  2CS4 A;  1WJ4 A;  2L00 B;  3L17 A;  3A9K A;  1WX9 A;  1S1Q B;  1CMX B;  2KWU B;  4DHZ B;  1J19 A;  1XQQ A;  2N1W A;  1HE8 A;  4LJP B;  4PS7 A;  2LAS A;  2MWS B;  4WJP A;  3V6E B;  3WAM A;  1RFA A;  5E6N A;  4E3C A;  5EDS A;  3VXW A;  4LCD E;  3VTV A;  4FJY A;  3JYU A;  1EO6 A;  2IO3 B;  4MJS A;  3UIN B;  4DBG A;  2KTR B;  1T0Y A;  2FUH B;  2V1Y A;  4DHJ D;  3T9L A;  3V61 A;  1WE7 A;  4I6L B;  3OLM D;  4FA6 A;  1P9D U;  2CR5 A;  3L10 B;  1OQY A;  4NJ7 A;  4EZJ A;  2DYO A;  1VCB A;  5HKH A;  1V9J A;  3M62 B;  3JSV A;  4W9G A;  2JZZ A;  3U30 A;  2IBI B;  2NBU A;  3U8Z A;  4MH0 E;  1P98 A;  3DBH I;  3QAQ A;  2DX5 B;  2KDB A;  4YL8 A;  5D2M B;  5DPT A;  1UH6 A;  2HTH A;  3TCA A;  3MHS D;  4HDQ A;  4MGY E;  4XC2 A;  1E5W A;  2BYV E;  2I1J A;  4RM8 A;  4W9I A;  4FBJ B;  1M94 A;  3WIM A;  3KUD B;  4KIK B;  1Q5W B;  5G2N A;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...