4HJKA

U7ub7 disulfide variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AMQIFVKCLTGKTNTLEVEPSDTIENVKAKIQDKIGYPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHCVRRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization
rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords Ubiquitin
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hjkA00
5JHAA 4IWQA 3IHPC 5IAAC 2W9NA 4B95A 3DOWA 2DENB 3ZLZA 3U30A 2C7HA 2AL6A 3RT3B 2IYDB 2BYFA 3NY5A 4MELA 4G11A 3QC8B 4W9DA 2LVOA 4K81A 5D94A 2G45B 1UD7A 4HVBA 1WX9A 4NQKE 1WGHA 2ASQA 3PRZA 2NBUA 4E3CA 4F7ZA 4W9IA 2BF8B 1LQBA 3JYUA 1I42A 2R2OA 2D10A 3PZDA 1E8ZA 2O6VA 3VXWA 4GDKA 4ANVA 2B3AA 3RD2A 1WGRA 2LD9A 4DK5A 1QZEA 3QK0A 1Q0WB 2EKEC 3V6CB 4GOCA 4BKSA 4F1SA 2D3GA 2KKCA 2MBQA 2FCSA 4KIKB 4JQWC 2M1MA 5C1ZA 4HLEA 3TIXA 4RM9A 4MSMB 4KV2A 3QX1A 2KTFA 2L00B 3DCGA 1WXVA 4CHKA 2MQJA 5G2NA 3W1SA 2PJHA 3N32A 2O2VA 4B9KA 2ZVOA 1KLVA 1Z5SB 3WIMA 4K7SA 1WRDB 2D11A 3EC8A 1WGYA 3BINA 2IBIB 4FN2A 1V9JA 2PE9A 2FIDA 3QHTA 3PRPB 5DPTA 3C0RB 3B1LX 2KHWB 3DBLI 3Q3FA 4BBNF 1UZXB 3R7QA 3HHMA 2K1FA 3AULA 3ZKJC 2DYBA 2GMIC 3QAQA 2N1VA 3IG3A 5DPSA 3WAPA 4XZ4A 1V2YA 4WJOA 3A9KB 2M8SA 1WJUA 3IVFA 3CSFA 2JUOA 4GXBA 3VDZA 1OEYJ 5CHFA 2AYOB 1AARA 3U8ZA 1L7YA 3OJ3A 3ZTCA 2MRPA 4TKNA 2LI5A 1ISNA 4PYZA 3NS8A 1WR6E 3WAMA 4IUMB 4ZDVA 3A4SC 2A4ZA 3H7SA 4RM8A 4HPLB 4W9CA 5FR6A 1XQQA 1WMHA 3VUYA 3APCA 3M3JA 3TCAA 2KDEB 2LWPA 4ANXA 5LXHA 1V5OA 2EMTA 2L76A 4AOFA 2MP2B 4HK2A 2KC1A 2DZKA 3DBSA 2M0XA 4NAWB 4MGZE 2L0TA 2LUEA 2MP2A 1P3QU 3PPAA 4ASWC 4M8NA 1ZGUB 4A3OA 1EF5A 3OLMD 3PLVA 1FXTB 4P7IA 4MGYE 3WAOA 2O2VB 4AP4C 5AZGA 4LDTD 5E6PA 3H6NA 4JL9A 3PV1A 2JF5A 2ZCCA 2V1YA 2KWVB 2O6VD 3KUCB 3JW0X 4NY0A 4TV3A 1MG8A 2IO1B 4IM2A 1WJ6A 1RLFA 3ALBA 5D2MB 3VH4B 1IYFA 3V61A 4GDKB 5GMVA 1SE9A 2HE7A 3KW5B 4JLCA 4W9LA 3W1YA 3ZO5B 2J7QB 1GNUA 4MSQB 3U7DA 3APFA 1E8WA 4PS7A 4DXAB 2WWZA 2V3SA 1BT0A 2K6DB 3QQ8B 3R7RA 4K7UA 5LLIA 2J0MA 1LXDA 3DDCB 2FUHB 1WX7A 3VFKA 2KTRB 2QHOA 3JVZX 2IO3B 2KXJA 2GBKA 4NQLB 3VH3B 3QWZB 4WAAA 1WXSA 2JWZA 3ZVVA 4BVUC 2JT4B 1WM3A 1YQBA 3S2AA 1KJTA 3TL5A 5JHBA 1TBEA 5AZFA 1UELA 4OVUA 2CHXA 1EF1A 4LDTB 2IY0B 2GBRA 3M95A 1E7UA 2XK5B 3EHVA 4ZRJA 3H9DA 3SD5A 4ICUA 2JRIB 4K1RB 4IM0A 3AU5A 2C60A 4HCPB 3ZNID 2N9EB 2BYEA 3RULA 4ANWA 3LJ3A 4AWJA 5DPWA 3PHWB 1X1MA 3SDLC 4TQ1A 4BOSC 3DBHI 3A1QA 3NZUA 2I1JA 3L17A 5IA7A 2LGXA 2RSUA 3L08A 3V60A 1V80A 2Z59B 3ONSA 3P2BA 4GSWA 5AEKB 2LXAA 2XBBC 3AI5A 1R4NI 2G4SA 1WXAA 4IC7B 4CO7A 2C9WB 4J6IA 4FJYA 3PSEB 1V49A 2KN5A 1YX5B 3UINB 4EOYA 1S3SG 2OJRA 2KK8A 4W9FA 1PQSA 3WA0A 3NOBA 3VUXA 2D2QA 4B6WA 3ZUNA 1WFYA 2DX5B 3K9OB 4LCDE 3L13A 2BWFA 3QIJA 4BBNC 4IWPA 1WX8A 4N9F4 1P0RA 3H7PB 2K8HA 4GGQA 3W1SC 1GC6A 2KJHB 3N30A 1V6EA 2KTRA 3N3KB 3PGEA 4HDQA 2GOWA 4YL8A 5EDSA 1G6JA 2MSED 3CSTA 2O6VB 5KHQA 4FHKA 2KD0A 3IBEA 2MCNB 3DQVA 2G3QB 1OEYA 2NR2A 4IW0A 1JRUA 2LGYA 2K39A 2YLMA 1WH3A 2JXXA 2L05A 3B08A 4GDLA 1P98A 5CX3A 1WYWB 1SIFA 1VD2A 2GBNA 2MWSB 4HXDA 4W9HA 1LFDA 3ZNZB 2FCMA 1NBFC 3B0AA 1SGHA 4XC2A 2L7RA 2IO0B 3K9PB 2ZVNA 4OVVA 1EUVB 4BKTA 4WWPA 3DBRI 4II2B 4WWOA 1V86A 2D07B 4EUTA 2GBJA 4FBJB 1V81A 3KUDB 1OQYA 2IO2B 2KDFB 4I6LB 2KJ6A 2MX2A 4BOZB 1WE6A 5J18A 5DPRA 5BO4B 2R2QA 2ZJDA 2LJ5A 2YVCA 2HTHA 3ZNGC 2KNBA 5E6NA 2KQSA 3BY4B 4FHJA 5CHWA 1WY8A 4A20A 1WJNA 3X23A 5L95C 2KMAA 1GG3A 4KSKC 3ZDMC 3ECIA 3ZRFA 2REXA 4FLHA 4DBGA 4JIOU 2PEAA 1H8CA 4KDIC 1E7VA 2LASA 2GBMA 3VQIA 4XX5A 4G50A 1Q1OA 2VRRB 2J0KA 3R66C 5D7GA 2N9XA 1J8CA 2LGDA 2ZNVB 1E8XA 2Z0DB 3PRMB 1EO6A 3RUIB 3VUWA 2AWTA 1TGZB 2N1WA 2K8BA 4E71A 1KM7A 3TJPA 4IG7B 5DCNA 4ZYNA 4PS3A 1WE7A 3KYDD 1J0GA 1WF9A 2WX0A 4KZ0A 1WZ3A 2LZ6A 1S1QB 4FADA 3MJWA 2ZCBA 2ZPYA 3VTVA 4I6PA 4NJ6A 2MBBB 2BKRB 3L54A 4MM3A 3RCZA 4ZRIA 2MBHA 3OAWA 1OGWA 1XT9B 3APDA 2RD0A 5JH5C 1P1AA 3CF6E 3DVGY 1GC7A 1LM8B 4HDOA 3UGBB 2K6QA 2PPHA 1ZW7A 3TMPB 4II3B 2KOXA 4MEMA 4TQ0A 3PHXB 1VCBA 4JGHB 2KX3A 2DZMA 2N7EA 4KZCA 1L2NA 1M94A 2KFKA 4W9EA 1GJZA 2DHZA 2I1KA 1YX6B 2HJ8A 2N7DA 2NPTA 2C7NB 3DVNV 2XK5A 4DHJB 1NI2A 3H7PA 3HM3A 1I35A 2M17A 3CMMB 2NS5A 4FJVB 4E74A 2JVCA 4FJZA 2ZZPB 4A3PA 4BFRA 3RYTA 3UQAA 4MH0E 3VHTC 2NBVB 2NBWB 1UBQA 1Q5WB 5E6OA 1IPGA 1WIAA 1WGGA 3EFUA 3PLUA 3VTUA 1KOTA 2FIFA 1Y8RC 2WX1A 4LJOB 4X57B 4HWIB 2XEWA 2JY6A 3QCAA 3KH0A 2BGFA 2AEHA 1GUAB 4TUUA 4PS8A 1P9DU 3ZTDA 3ML8A 3ZNHB 2KO3A 1YIWA 4GB9A 3WANA 5LXIB 1Z2MA 2KDIA 3X0WA 3V6EB 4PYUA 4IWOA 3V62A 2CKHB 2BKFA 1WXMA 2FCQA 2JPHA 4F8CB 5J17A 4DDGD 1WM2A 4DHZB 1R4MI 4LJPB 2WDTB 3ML9A 1C1YB 2KQ7A 3VTWA 2FAZA 2N4FA 3JSVB 4MJSB 4M0WB 4MJSA 1T0YA 5CTRC 2KZRA 2CU1A 1WJ4A 4ANUA 3QA8A 3QJZA 2DZJA 2EMSA 2ZEQA 5KHOA 4EZLA 5JZEB 4WQOB 3A9KA 3T9LA 3AXCA 5CHVC 2CR5A 4ZRKA 2L3ZA 2RPQA 2K8CA 1CMXB 2LRWA 4M8MA 4NNJB 1A5RA 3M62B 2MBEA 2LXCA 2KFJA 4W9KA 2C7MB 1WI0A 1WZ0A 3GOEA 4URKA 3I3TB 3A1QB 3VAWA 3A33B 2KMCA 3L16A 2Y5BB 3NHEB 3L0WB 2WYQA 3PTFC 2JRHA 3MHSD 4RMAA 3SU8X 1WMHB 2MW5A 1H4RA 3JSVA 4HJKA 3A9JB 3RZFA 4NJ7A 3PVLA 5AZHA 3TBLD 3IFWB 2KFKB 3VVWB 1YJ1A 3AU4A 3NZSA 5D6JB 2N9PC 2MA9B 3M63B 1C3TA 3OJ4B 3T8MA 2JZZA 1YD8U 2V4LA 4DHZE 4EEWA 3RZWC 2L0FA 2CS4A 1WR1A 4DWFA 2DYOA 2KVRA 2DYMA 2JZ3B 3UIOB 4NPNA 5J2RA 2CHZA 2KC2A 3A4RA 3H1UA 4G3XB 2LVQA 2NPTB 3PS6A 3MTNB 4KIKA 4WJPA 1HE8A 2IZVB 4AUQC 1E90A 3GZNI 3SHQA 4BKSD 4EZKA 4FA6A 5L83A 2A5UA 2OOBB 2MBOA 1NDDA 2CHWA 2KDBA 2KWUB 3PREA 4EFOA 2Z0EB 4AJWA 1TZ1A 3WALA 2IY1B 2DAFA 4FULA 1U4AA 4HCNB 4IM3A 2J0JA 1XD3B 1UGMA 2FCNA 2KLCA 3UIPB 2BWES 2ZNVC 3ZW3A 3O65B 4GN1A 2HD5B 4BKGA 3D32A 1J19A 3KUZA 4EKUA 2AL3A 3HIZA 1E8YA 1UBIA 2DZIA 2MLBA 2NCNA 4CYEA 2KWCA 3DVGX 1IP9A 3ENEA 4KVGB 3ZDTA 4DDID 4GDLB 2LRUA 3R3MA 4MGKE 4GU2A 4G0NB 3DPDA 4W9JA 4WJNA 3KVFB 1WGDA 4KDLB 4GIVA 4KSLC 4EZJA 3KYCD 2L8JA 4K7WA 3ZRCA 2KX0A 1OTRB 2BYVE 2M4NA 3EECA 4AJYB 4ICVA 3Q3JA 5C23A 3UF8A 1K8RB 1RRBA 1UH6A 2BPSA 2KJRA 2ZPNA 2LVPA 2PE6B 2G4DB 1RAXA 1V5TA 4WWNA 2RR9A 3ZIMA 3HM6X 4WJQA 4I6NB 1F9JA 4DHJD 2UYZB 3UQBA 4HPMB 5G55A 5TR5A 3L10B 2C5LC 2DAJA 1TTNA 2KLGA 3HK0A 2KANA 4GMVA 1D3ZA 4MGIE 4NAWA 1RFAA 2FNJB 2UWQA 1ZKHA 4W9GA 3PT2B 5HKHA 4MDKE 3A9JA 3LDZE 2K25A 1E5WA 2NVUI 2RGFA 3DVNU 3QARA
chains in the Genus database with same CATH superfamily
3NVWA 4WURA 5IAAC 4ARCA 2W9NA 1D5XC 1PGXA 2HDEA 1ZE3D 2KVZA 1QOBA 3ZGZA 1N60A 1WX9A 4WH4A 1TS3A 1LQBA 1I4HA 2IGDA 1E8ZA 4YSYB 2DNFA 3BYYB 2LD9A 2EKEC 1OFFA 1T0RC 3Q8BA 1E9MA 1OQQA 4MSMB 1P7EA 3N1YC 1R4NB 2KT7A 2KTFA 2L00B 4CHKA 3W1SA 2K9XA 2OEDA 4K7SA 1WRDB 4JX1C 3ZJTA 1ACCA 2K3UA 2PE9A 2FIDA 3QHTA 3AE6B 3R8BA 3B1LX 2K1FA 2W3RA 3RNEC 1V2YA 4WJOA 3A9KB 3CSFA 2JUOA 1V8CA 3U8ZA 1FNVA 4ZRQA 3Q2AC 2WU2B 2E6XA 2MRPA 4TKNA 1N63A 3MJ5A 5GXGB 4RM8A 1DGJA 4BZAA 4HPLB 4W9CA 2R61A 2IPKD 2ON8A 2L76A 4L23A 2MP2B 2KC1A 3Q6BA 3DBSA 2M0XA 1WWTA 2WDRB 3FKYA 2BT6A 4MGZE 2BTEA 2MP2A 4ASWC 3SR6A 3OLMD 2WXRA 2O2VB 1ET9A 4P1BC 2KWVB 2O6VD 1C78A 4QAYA 5IKCM 3ALBA 2V9HA 3V61A 1QQRA 1SE9A 2HE7A 5G5HA 4MSQB 1E8WA 2V3SA 3QQ8B 4K7UA 2J0MA 3DDCB 1WX7A 3VFKA 2QHOA 3JVZX 1QT9A 3QWZB 4WAAA 1WXSA 1JWMD 4BVUC 2JT4B 2WXHA 1WM3A 2ONQA 1KJTA 1UWXA 4TSSA 1UGJA 1J7CA 1AW7A 2XK5B 3H9DA 4K1RB 3AU5A 2BS3B 3ZNID 2BYEA 3KWLA 4BOSC 2I1JA 1XCTL 3AE8B 2Z59B 4GSWA 3ONSA 2LXAA 2G4SA 4CO7A 3R2IA 1PFDA 1PQSA 1KLUD 4NJCA 4DXGA 2KYWA 5AUIA 1WFYA 3K9OB 3L13A 3Q14C 1JQ4A 4GGQA 3W1SC 3N3KB 4YL8A 2MSED 4M00A 4R3DA 5BYSA 2G3QB 4IW0A 1M4VA 1P98A 1VD2A 1ROEA 1EWYC 1QOFA 4RGTA 3P1MA 3K9PB 2WXNA 2ZVNA 3ZXRA 3AEAB 4BKTA 2K5PA 2MH7A 3AE1B 3KQ4A 4WWOA 4GLSC 4FXCA 4BOZB 1JWBD 1YOVB 1T0SC 5BO4B 4XYCA 2D5GA 2YVCA 2GI9A 3ABVB 4ZOHC 4WQMA 3H8HA 3B2FA 2KQSA 4A20A 3ZDMC 1GG3A 4ACFA 2REXA 1L4ZB 1H8CA 4XX5A 1J8CA 3RNAC 1E8XA 1F2RI 3RNFC 1PGAA 1C4PA 1EO6A 2PW9A 4E71A 4ZHPA 4ZYNA 1WE7A 1J0GA 1D6EC 1WF9A 2WX0A 4KZ0A 1PYWD 1WZ3A 3MJWA 1JALA 4I6PA 2J4XA 4ZRIA 5LNK1 5JH5C 3DVGY 1GC7A 1LM8B 5D3DA 3RFZB 2K6QA 3AV8A 1F1HA 2J42A 3MP9A 4TQ0A 4JGHB 1L2NA 2KFKA 2PMVA 2DHZA 4M01A 1YX6B 2DWQA 4YTPB 2HJ8A 2WXPA 3CMMB 2JVCA 3RYTA 3UQAA 5BYRA 2NBVB 2KACA 1IPGA 3EFUA 1WGGA 3PLUA 3VTUA 1ET6A 5FK9C 2JXTA 3KH0A 2BGFA 4JWUC 4XGAB 1J7AA 2KO3A 1YIWA 3WANA 3J9CA 4IWOA 2CKHB 1WXMA 4ITKA 4DHZB 3ML9A 1F0ZA 2N4FA 2X38A 1I4GA 4MJSB 4M0WB 4KGRA 2CU1A 1SB3C 3AE2B 5KHOA 1MPEA 3T9LA 3A9KA 2ACZB 2L3ZA 2X8XX 3M62B 2IDYA 1I4RA 3NZ3A 1WZ0A 3GOEA 4URKA 3I3TB 3A1QB 3A33B 3NHEB 1TKYA 3C8YA 1YQ3B 1WMHB 2MW5A 2INPE 3JSVA 3U52E 4NJ7A 1A70A 1V1PB 5EE1A 2MJDA 3NZSA 4USAA 3BIID 4DHZE 4EEWA 1V97A 3HVZA 2D3CA 4RH6A 2JZ3B 4KX6B 4G3XB 1CZPA 3MC8A 1ZP0B 2LVQA 2NPTB 3PS6A 3MTNB 1SF0A 4WJPA 1KRHA 4YXDB 1JRPA 4EZKA 4FA6A 5L83A 2A5UA 2OOBB 2AQ2B 2CHWA 2W55A 2KDBA 1TZ1A 5EE0A 4YTMB 4S0RA 2RDBC 3ZW3A 4GN1A 4L2YA 1J19A 2NTTA 2AL3A 4EKUA 1UBIA 2DZIA 1ZUD2 2NCNA 1XLNA 4W9JA 4WJNA 4KDLB 4JPSA 4K7WA 1FNUA 1OTRB 1GOZA 2H88B 5C23A 3DHHC 4N6EB 1RAXA 3DBLB 4A8XC 1Q10A 1F9JA 1I4QA 2JX5A 2WXKA 3HK0A 1TTNA 2KLGA 4NAWA 2FNJB 1ZKHA 3N1XC 4MDKE 3LDZE 3DVNU 2ZJDA 4IDIA 1E5WA 1DYQA 3QARA 3TEXA 5AUKA 1TT5B 4B95A 3DOWA 2DENB 3ZLZA 3U30A 2C7HA 4C80A 1TY2A 1D4BA 3RT3B 5HG2A 2IYDB 3DHGC 2JYTA 3NY5A 4G11A 2LVOA 4K81A 5D94A 1C79A 1RFKA 1UD7A 2I2YA 3AN1A 4K3CA 2ASQA 2NBUA 4E3CA 1YN4A 3JYUA 2QILA 4RGMA 3AB5A 2D10A 1K52A 3VXWA 4GDKA 1WGRA 3N1ZC 4GOCA 1WSPA 4KKIA 4BKSA 4MT5A 1EU3A 2D3GA 3NJTA 2MBQA 2KAJA 1B9RA 3QX1A 3DCGA 1E6EB 2MQJA 5G2NA 1EM7A 2O2VA 3NVYA 1Z5SB 2D11A 3EA6A 1T5XD 1WGYA 4DXFA 2IBIB 3C0RB 3DBLI 5HHDG 2BB6A 1UZXB 2GLSA 4RGOS 3R7QA 3HHMA 3AULA 3ZKJC 2GMIC 3QAQA 2LMCA 2N1VA 1SE3A 3AEBB 3Q3OC 4XZ4A 1WJUA 3IVFA 2XN9C 1C9FA 5FR3A 1D5MC 1SE2A 1DOYA 5I4DA 1L7YA 2W3SA 1QOAA 3ZTCA 5IOIA 2D3BA 3WAMA 5BMHA 3A4SC 4LNKA 3DBHB 5HI1A 5FR6A 2ICIA 1WMHA 3AH7A 5LXHA 1L0VB 2EMTA 4AOFA 1TZOA 2DZKA 2MJEA 4NAWB 4PT5A 4WIPA 2IJ0A 2K0PA 4HRSA 4M8NA 2LHEA 3Q3MC 4MGYE 4AP4C 3MHZA 2JF5A 3MFGA 4NY0A 1J7BA 1D5ZC 1WJ6A 1RLFA 1FCCC 5GMVA 4JLCA 1WXQA 4W9LA 4MH8A 3APFA 4DXAB 4ZRPA 2WWZA 4AQ7A 3R7RA 2FE8A 3GE8C 3N20C 5BMGA 1LXDA 3VH3B 2OHFA 1N62A 3ZVVA 3EUB2 1UELA 1UF0A 3M95A 4ZRJA 3TEWA 4HCPB 3RULA 4ANWA 5DPWA 3PHWB 4OW0A 2IGGA 4TQ1A 3SEBA 5IA7A 2RSUA 3NG0A 3AI5A 1R4NI 1HZ5A 1HZ6A 2C9WB 1V49A 1YX5B 2KK8A 4W9FA 2D2QA 1FFVA 3NVZA 1LO5D 4LCDE 4HKZE 3QIJA 1L6VA 2BWFA 3U4EG 1WX8A 2WP9B 2K8HA 4C00A 1GC6A 3N30A 1V6EA 3V05A 1SIJA 2O6VB 4N59A 3DQVA 1OEYA 2QEJC 2YLMA 4A90A 4GDLA 1WYWB 3PO0A 1SGHA 1EU4A 5IN7A 4OVVA 3HUIA 3I57A 4BAXA 4WWPA 4II2B 1V86A 2D07B 2JWUA 4EUTA 1CQVA 1OQYA 1WE6A 2W54A 2Q5WD 2HTHA 2KNBA 3BY4B 1WY8A 1WJNA 3X23A 3RNGC 3ZRFA 4KDIC 4G50A 3P4RB 2LGDA 3Q8FA 5E6JA 2Z0DB 3PRMB 1I4PA 3RUIB 1TGZB 4C7YA 5EE3A 3RN9C 4IG7B 5DCNA 4PS3A 2FUG1 2LZ6A 2LGSA 2YEPF 1MHXA 2BS2B 2ZCBA 3RCZA 2MBHA 1C77A 2BW2A 4RCOA 1XT9B 2WXOA 2WDVB 2RD0A 3CF6E 3UGBB 2DLBA 3Q8AA 2PPHA 1HA5A 2B76B 4XDCA 1P7FA 3HRDD 1XLOA 3IXSA 4W9EA 2I1KA 5H8YE 2XK5A 2M17A 3AM9A 4FJVB 2RDGA 4A3PA 2J53A 4MH0E 1UBQA 1V1PA 1ZDVA 2WS3B 3I9V1 4M0WA 3B2GA 2FIFA 1MHHE 4LJOB 3GP7A 4HWIB 3QCAA 4LTUA 5TSSA 1YQ4B 2AEHA 4PS8A 3ZTDA 3FC4A 1C4CA 5BMIA 3AECB 1Z2MA 3V6EB 3V62A 1QOGA 1TS4A 2JPHA 2IGHA 4DDGD 4OVZA 1QLBB 2JYEA 2CJNA 2WDTB 3GZNB 3VTWA 2FAZA 3JSVB 1VR9A 2ZW1A 2SEBD 5CTRC 4ANUA 3RNCC 3QA8A 3QJZA 2DZJA 4WQOB 4LNFA 1BMLC 2LFIA 2RPQA 2LRWA 3NUHB 4C7ZA 3Q8EA 4A9AA 1YNTE 3VAWA 4HPPA 3P42A 3L0WB 1STEA 3A9JB 3PVLA 5AZHA 3URYA 3AU4A 1C3TA 2N9PC 2MA9B 3M63B 1L5PA 3OJ4B 3T3NA 3AEEB 2L0FA 2N7JA 2DYMA 5J2RA 3H1UA 2KC2A 1HE8A 1NYQA 1VLBA 3AE3B 3GZNI 4IOIE 3OWEB 5EE9A 2MBOA 2KWUB 4EFOA 2Z0EB 1K50A 3AE5B 3BK2A 4FULA 2DAFA 1U4AA 1QILA 2J0JA 2Y5PA 1XD3B 2E3TA 3BK1A 3O65B 2HD5B 1WGKA 1JW9D 1YJJA 2WXJA 3D32A 2WXLA 3KUZA 4N58A 3WCQA 4CYEA 1E8YA 2NTSA 4C4VA 3ZDTA 4DDID 4GDLB 2LRUA 4WWMA 3BYTB 3KYCD 2KX0A 2L1AA 3EECA 4LNOA 1K8RB 1RRBA 1UH6A 2KJRA 2LVPA 3ZIMA 5G55A 3VR8B 3TEYA 2DAJA 3ZQ4A 1VJKA 4MGIE 1FEHA 2UWQA 5HKHA 2K25A 3OJ3A 2NVUI 5HFYA 5JHAA 3IHPC 2WGSA 4HKQA 2WNMA 4KKJA 3QC8B 5IO9A 2G45B 3IT6B 4NQKE 1WGHA 3PRZA 4F7ZA 4W9IA 1I42A 1E7PB 2R2OA 4RFBA 2WLBA 3KLSX 3RD2A 4DK5A 1QZEA 3QK0A 1Q0WB 3V6CB 3BVMA 2KKCA 1N61A 2FCSA 2MJ3A 2I38A 3TIXA 4KV2A 1NEKB 1NVID 3N32A 5FKAC 1KLVA 3WIMA 1FCLA 3IT4B 3BINA 3ZJUA 3PRPB 3Q3FA 3IAM1 4BBNF 1JWUD 5DPSA 3WAPA 2BQQA 2M8SA 3AEGB 4GXBA 1OEYJ 1K53A 2D3AA 1TJEA 2AYOB 1AARA 3Q69A 3RMKC 1AWDA 2HJ1A 2QIEB 3NS8A 1XCQL 1WR6E 4ZDVA 3H7SA 4LK0M 3BWUD 1SJHD 1XQQA 1T6BX 3M3JA 3TSSA 2KDEB 2LWPA 1GPXA 1V5OA 4HK2A 1B1ZA 3U2SC 1UWMA 1ZDXA 2LUEA 1ZGUB 4A3OA 1DOXA 5IP4D 1FXTB 4P7IA 4LDTD 2ZCCA 2WU5B 2M19A 3KUCB 3JW0X 1GB4A 2M0AA 2IO1B 3IAS1 4IM2A 2QCZA 4YSXB 5D2MB 3VH4B 1IYFA 4GDKB 3FILA 3ZO5B 1YN3A 1FO4A 1GNUA 4O1NA 4P16A 4PS7A 1BT0A 5LLIA 2RMMA 1KH0A 3DWGC 2IO3B 2QMTA 1TKGA 3NS1A 2JWZA 1YQBA 3S2AA 3TL5A 5JHBA 1TBEA 2KN4A 2CHXA 4LDTB 2GBRA 3KWVA 3EHVA 3SD5A 1YJIA 2N9EB 4AWJA 2Y3AA 1X1MA 3SDLC 3A1QA 3NZUA 2PIAA 3L17A 2LGXA 3GE3C 3L08A 1V80A 1ZOYB 5AEKB 4L1BA 2AQ1B 2XBBC 1WXAA 1EWCA 5JXVA 4IC7B 4MACA 4FJYA 1I7HA 1L0XB 3UINB 2OJRA 3W5VB 3WA0A 3NOBA 4B6WA 2DX5B 4IWPA 4N9F4 4LNIA 3PGEA 4HDQA 1FD6A 5EDSA 4RF0A 1IBXA 5KHQA 4FHKA 4A6QA 2KD0A 1JWSD 1ZPSA 3T3OA 2MCNB 1AYFA 1UNSA 2K39A 3FILB 1NENB 2PLPA 4HVBA 2GBNA 4W9HA 1LFDA 4HJGE 2FCMA 1HXYD 2L7RA 2IO0B 1EUVB 2GRIA 2N0SB 3CIRB 3DBRI 4FBJB 1V81A 1TKEA 1VDVA 2KDFB 3KUDB 5J18A 2MX2A 5DPRA 3LB8C 2R2QA 4Q2JA 4A55A 1FRDA 3ZNGC 1VZ6A 2BB5A 4FHJA 4P1CC 2KMAA 1HEZE 2Y5CA 4DBGA 4JIOU 3VQIA 1XEEA 3BZDB 5D7GA 1QF6A 2LEKA 2ZNVB 3W9CB 2N1WA 1KM7A 3TJPA 2INNE 3KYDD 2N9KA 3BVZA 4FADA 3AE4B 1SBBB 2H89B 2WXGA 3APDA 3LYYA 4DQOC 2BS4B 1P1AA 4HDOA 3PZ7A 2JU6X 3TMPB 1ZW7A 1R4MB 4II3B 3R2TA 2KOXA 4MEMA 1VCBA 2N7EA 1F52A 1IGCA 1KF6B 1GJZA 3E9SA 3AE7B 1UUPA 3DVNV 3NVVA 1NI2A 3HM3A 1I35A 2NS5A 4E74A 1MVKA 1FPYA 2J52A 4BFRA 2V4IB 1YMHE 2JSVX 2NBWB 2KWDA 5E6OA 1KOTA 1Y8RC 1MFWA 3I5JC 4X57B 2INCC 4S17A 2JY6A 1GUAB 2G9HD 3HVDA 1P9DU 3VRBB 1XLQA 4PYUA 2ZW0A 2BKFA 2FCQA 2Z8LA 5J17A 1FRRA 1HQRD 4LJPB 2WXFA 1C76A 3MC9A 2EMSA 4P6VF 4TMAB 5CHVC 3EGRA 2VZKB 2QDFA 4M8MA 2K8CA 4NNJB 1BXTA 2LXCA 2KFJA 4W9KA 1WI0A 3LXFA 1L4DB 2KMCA 3L16A 2Y5BB 2JRHA 1FM0D 3RZFA 1RM6C 3TBLD 3IFWB 2KFKB 2DBYA 5D6JB 3T8MA 1YD8U 3VRAB 2LUMA 3RZWC 4KGTA 1I4XA 1WR1A 1PUTA 1ZXIA 2DYOA 2KVRA 1Y56A 3UIOB 4NPNA 2CHZA 3A4RA 4RGNA 3P63A 4KIKA 2IZVB 1E90A 4PK1A 4KGSA 1NDDA 1E0ZA 3PREA 5H92C 1V1OA 4AJWA 3WALA 3RPFC 4AS1A 4HCNB 4J3OD 1KTKA 1VZ7A 1UGMA 2KLCA 2BWES 5D3IB 2ZNVC 2BVCA 4BKGA 2KDMA 3HIZA 2MLBA 1IP9A 2VH1A 2KWCA 4C4VB 3ENEA 4OZBA 3R3MA 4GU2A 3ZXVA 2UU7A 3DPDA 4GIVA 2CU3A 3DBRB 2MEKA 2L8JA 3ZRCA 2BYVE 3W5UB 4AJYB 1MG4A 4ICVA 3UF8A 2ZPNA 2BPSA 1CK1A 1KFYB 2PE6B 2G4DB 2RR9A 3HM6X 4DHJD 1ZXHA 2UYZB 5T8IA 4HPMB 3UQBA 5TR5A 2C5LC 3BVGA 3ETRA 4W9GA 4EE2A 3A9JA 1PGBA 2RGFA 1DOIA 1HTOA 2BYTA 1LGRA 4IWQA 1IBXB 4ARIA 2AL6A 4OZCA 1R7SA 3TEZA 3AMZA 1N5WA 2BYFA 3DWMA 4MELA 4W9DA 3ZYYX 4XWTA 1SE4A 2L83A 2BF8B 2CJOA 1TS5A 1C4AA 2O6VA 3PZDA 4ZHOA 4ANVA 2B3AA 5MPOA 3VR9B 2RPVA 1JROA 4F1SA 4KIKB 2TSSA 4JQWC 2M1MA 5C1ZA 4HLEA 4RM9A 1JWAD 1WXVA 2PJHA 2PTLA 4B9KA 2PVOD 2ZVOA 3EC8A 1SJED 2RDHA 2WXMA 1V9JA 4FN2A 2AQ3B 5DPTA 2KHWB 2K22A 2KMMA 2DYBA 1F2RC 3AEFB 1FXAA 3IG3A 3L4PA 3VDZA 2V3PA 5CHFA 4YSZB 1FIQA 2LI5A 1ISNA 4PYZA 3MC0B 4JWSC 4IUMB 2A4ZA 2PVGC 3VUYA 3APCA 3TCAA 1WYGA 1N5XA 2L0TA 4YWGG 2V3NA 1P3QU 3PPAA 4ZYSA 1EF5A 3PLVA 3WAOA 5AZGA 5E6PA 2VH2A 4MM3B 3H6NA 4JL9A 3PV1A 5G5GA 2EKIA 2V1YA 1MI0A 2NMQA 4TV3A 1MG8A 3KW5B 3W1YA 1IGDA 2J7QB 3U7DA 2PKOA 3B9JA 2K6DB 2SAKA 3NRZA 2FUHB 2KTRB 4NQLB 2KXJA 2GBKA 1OQRA 5AZFA 4YT0B 4OVUA 5C3JB 1EF1A 2IY0B 1E7UA 4ICUA 2JRIB 4IM0A 2C60A 2G1EA 3E56A 1E10A 3LJ3A 4HEA1 3DBHI 4NAMA 5BYQA 3V60A 3P2BA 2LJIA 4OZAA 3Q3NC 4J6IA 4YTNB 3PSEB 2KN5A 4LNNA 4EOYA 1S3SG 3GS2A 2WDQB 4H2AA 3VUXA 2BBCA 3ZUNA 2N9LA 4BBNC 1RWSA 1P0RA 3H7PB 1L6UA 3OG5A 2KJHB 2KTRA 2GOWA 2WQYB 1G6JA 3CSTA 1YN5A 4D2KA 2XNAC 3IBEA 2NR2A 1JRUA 4M02A 1F77A 2LHDA 2LGYA 1WH3A 2JXXA 2L05A 3B08A 5CX3A 4ANXA 1SIFA 4HXDA 3ZNZB 2MWSB 1VRAB 1NBFC 3B0AA 3I63C 4B0MA 4JE3B 4XC2A 3ZJVA 1TIFA 4LLGM 2QC8A 2GBJA 3AEDB 4I6LB 2IO2B 2KJ6A 1T3QA 2LJ5A 3P4PB 1JMLA 1NI3A 3O13A 5E6NA 1L0YB 2HTME 5CHWA 5L95C 1NYRA 4KSKC 3EFCA 2W82A 3ECIA 2WXQA 1IUEA 4FLHA 2PEAA 4IKGA 1E7VA 2LASA 2GBMA 1Q1OA 2MHJA 2VRRB 1AN8A 2J0KA 3R66C 2N9XA 1T0QC 1XO3A 1ENFA 2WHIA 1TY0A 3VUWA 2AWTA 2K8BA 3UI3A 2VZKD 1RYJA 1FFUA 2JQRB 2AX5A 1S1QB 3Q8CA 1XLPA 2ZPYA 3VTVA 4NJ6A 2MBBB 2BKRB 1FMAD 3GB1A 3L54A 4MM3A 4US8A 2L32A 1OGWA 3OAWA 1WRIA 3SFDB 3DHIC 2OJWA 1SXTA 4NZLB 1N6ZA 3PHXB 2KX3A 2DZMA 4KZCA 4XWWA 1M94A 1FNWA 3FAHA 2N7DA 2NPTA 2C7NB 4DHJB 3H7PA 3V3XA 2QSDA 4FJZA 1TS2A 2ZZPB 4XDDA 2V0GA 4RNAA 3VHTC 4OHJA 1TYGB 1Q5WB 1WIAA 1ESFA 2YEPB 2WX1A 3RI7C 2XEWA 1GB1A 4TUUA 3ML8A 3ZNHB 4GB9A 5LXIB 2KDIA 3X0WA 1KLGD 2M56B 4F8CB 3SFEB 1WM2A 1R4MI 1C1YB 2KQ7A 3P4SB 4MJSA 1T0YA 2KZRA 1WJ4A 2QJLA 2ZEQA 4EZLA 5JZEB 3AXCA 2CR5A 4ZRKA 2KQ4X 1CMXB 1A5RA 2MBEA 2C7MB 2EELA 1XF5L 2WYQA 2GB1A 3MHSD 3PTFC 4RMAA 1HTQA 3SU8X 1H4RA 4HJKA 5C2TB 3W2DA 3PZ8A 4XE0A 4UDUC 3VVWB 1YJ1A 4B0EA 2JZZA 2V4LA 2CS4A 4DWFA 1K51A 1FXIA 1CJEA 3CWIA 4CQNA 4AUQC 3SHQA 4BKSD 1VZ8A 1SEBD 4HROA 1BUIC 2JZPA 4K3BA 2IY1B 4IM3A 4WAFA 2INDC 2L52A 2FCNA 3UIPB 3U7ZA 3AE9B 3N9YC 4REZA 3DVGX 4KVGB 4MGKE 4G0NB 3C19A 1QKZA 3KVFB 1WGDA 4EZJA 4KSLC 2FBWB 4C56C 1XXGA 2M4NA 1GAQB 4RF1A 3Q3JA 2WXIA 4US9A 1V5TA 4WWNA 1JCKB 3RNBC 4WJQA 4I6NB 3L10B 2KANA 4GMVA 3P4QB 1D3ZA 1MJDA 1PDXA 1RFAA 3PT2B 3TUOA 1SSNA 2LGIA
chains in the Genus database with same CATH topology
5JHAA 4IWQA 3IHPC 5IAAC 2W9NA 4B95A 3DOWA 2DENB 3ZLZA 3U30A 2C7HA 2AL6A 3RT3B 2IYDB 2BYFA 3NY5A 4MELA 4G11A 3QC8B 4W9DA 2LVOA 4K81A 5D94A 2G45B 1UD7A 4HVBA 1WX9A 4NQKE 1WGHA 2ASQA 3PRZA 2NBUA 4E3CA 4F7ZA 4W9IA 2BF8B 1LQBA 3JYUA 1I42A 2R2OA 2D10A 3PZDA 1E8ZA 2O6VA 3VXWA 4GDKA 4ANVA 2B3AA 3RD2A 1WGRA 2LD9A 4DK5A 1QZEA 3QK0A 1Q0WB 2EKEC 3V6CB 4GOCA 4BKSA 4F1SA 2D3GA 2KKCA 2MBQA 2FCSA 4KIKB 4JQWC 2M1MA 5C1ZA 4HLEA 3TIXA 4RM9A 4MSMB 4KV2A 3QX1A 2KTFA 2L00B 3DCGA 1WXVA 4CHKA 2MQJA 5G2NA 3W1SA 2PJHA 3N32A 2O2VA 4B9KA 2ZVOA 1KLVA 1Z5SB 3WIMA 4K7SA 1WRDB 2D11A 3EC8A 1WGYA 3BINA 2IBIB 4FN2A 1V9JA 2PE9A 2FIDA 3QHTA 3PRPB 5DPTA 3C0RB 3B1LX 2KHWB 3DBLI 3Q3FA 4BBNF 1UZXB 3R7QA 3HHMA 2K1FA 3AULA 3ZKJC 2DYBA 2GMIC 3QAQA 2N1VA 3IG3A 5DPSA 3WAPA 4XZ4A 1V2YA 4WJOA 3A9KB 2M8SA 1WJUA 3IVFA 3CSFA 2JUOA 4GXBA 3VDZA 1OEYJ 5CHFA 2AYOB 1AARA 3U8ZA 1L7YA 3OJ3A 3ZTCA 2MRPA 4TKNA 2LI5A 1ISNA 4PYZA 3NS8A 1WR6E 3WAMA 4IUMB 4ZDVA 3A4SC 2A4ZA 3H7SA 4RM8A 4HPLB 4W9CA 5FR6A 1XQQA 1WMHA 3VUYA 3APCA 3M3JA 3TCAA 2KDEB 2LWPA 4ANXA 5LXHA 1V5OA 2EMTA 2L76A 4AOFA 2MP2B 4HK2A 2KC1A 2DZKA 3DBSA 2M0XA 4NAWB 4MGZE 2L0TA 2LUEA 2MP2A 1P3QU 3PPAA 4ASWC 4M8NA 1ZGUB 4A3OA 1EF5A 3OLMD 3PLVA 1FXTB 4P7IA 4MGYE 3WAOA 2O2VB 4AP4C 5AZGA 4LDTD 5E6PA 3H6NA 4JL9A 3PV1A 2JF5A 2ZCCA 2V1YA 2KWVB 2O6VD 3KUCB 3JW0X 4NY0A 4TV3A 1MG8A 2IO1B 4IM2A 1WJ6A 1RLFA 3ALBA 5D2MB 3VH4B 1IYFA 3V61A 4GDKB 5GMVA 1SE9A 2HE7A 3KW5B 4JLCA 4W9LA 3W1YA 3ZO5B 2J7QB 1GNUA 4MSQB 3U7DA 3APFA 1E8WA 4PS7A 4DXAB 2WWZA 2V3SA 1BT0A 2K6DB 3QQ8B 3R7RA 4K7UA 5LLIA 2J0MA 1LXDA 3DDCB 2FUHB 1WX7A 3VFKA 2KTRB 2QHOA 3JVZX 2IO3B 2KXJA 2GBKA 4NQLB 3VH3B 3QWZB 4WAAA 1WXSA 2JWZA 3ZVVA 4BVUC 2JT4B 1WM3A 1YQBA 3S2AA 1KJTA 3TL5A 5JHBA 1TBEA 5AZFA 1UELA 4OVUA 2CHXA 1EF1A 4LDTB 2IY0B 2GBRA 3M95A 1E7UA 2XK5B 3EHVA 4ZRJA 3H9DA 3SD5A 4ICUA 2JRIB 4K1RB 4IM0A 3AU5A 2C60A 4HCPB 3ZNID 2N9EB 2BYEA 3RULA 4ANWA 3LJ3A 4AWJA 5DPWA 3PHWB 1X1MA 3SDLC 4TQ1A 4BOSC 3DBHI 3A1QA 3NZUA 2I1JA 3L17A 5IA7A 2LGXA 2RSUA 3L08A 3V60A 1V80A 2Z59B 3ONSA 3P2BA 4GSWA 5AEKB 2LXAA 2XBBC 3AI5A 1R4NI 2G4SA 1WXAA 4IC7B 4CO7A 2C9WB 4J6IA 4FJYA 3PSEB 1V49A 2KN5A 1YX5B 3UINB 4EOYA 1S3SG 2OJRA 2KK8A 4W9FA 1PQSA 3WA0A 3NOBA 3VUXA 2D2QA 4B6WA 3ZUNA 1WFYA 2DX5B 3K9OB 4LCDE 3L13A 2BWFA 3QIJA 4BBNC 4IWPA 1WX8A 4N9F4 1P0RA 3H7PB 2K8HA 4GGQA 3W1SC 1GC6A 2KJHB 3N30A 1V6EA 2KTRA 3N3KB 3PGEA 4HDQA 2GOWA 4YL8A 5EDSA 1G6JA 2MSED 3CSTA 2O6VB 5KHQA 4FHKA 2KD0A 3IBEA 2MCNB 3DQVA 2G3QB 1OEYA 2NR2A 4IW0A 1JRUA 2LGYA 2K39A 2YLMA 1WH3A 2JXXA 2L05A 3B08A 4GDLA 1P98A 5CX3A 1WYWB 1SIFA 1VD2A 2GBNA 2MWSB 4HXDA 4W9HA 1LFDA 3ZNZB 2FCMA 1NBFC 3B0AA 1SGHA 4XC2A 2L7RA 2IO0B 3K9PB 2ZVNA 4OVVA 1EUVB 4BKTA 4WWPA 3DBRI 4II2B 4WWOA 1V86A 2D07B 4EUTA 2GBJA 4FBJB 1V81A 3KUDB 1OQYA 2IO2B 2KDFB 4I6LB 2KJ6A 2MX2A 4BOZB 1WE6A 5J18A 5DPRA 5BO4B 2R2QA 2ZJDA 2LJ5A 2YVCA 2HTHA 3ZNGC 2KNBA 5E6NA 2KQSA 3BY4B 4FHJA 5CHWA 1WY8A 4A20A 1WJNA 3X23A 5L95C 2KMAA 1GG3A 4KSKC 3ZDMC 3ECIA 3ZRFA 2REXA 4FLHA 4DBGA 4JIOU 2PEAA 1H8CA 4KDIC 1E7VA 2LASA 2GBMA 3VQIA 4XX5A 4G50A 1Q1OA 2VRRB 2J0KA 3R66C 5D7GA 2N9XA 1J8CA 2LGDA 2ZNVB 1E8XA 2Z0DB 3PRMB 1EO6A 3RUIB 3VUWA 2AWTA 1TGZB 2N1WA 2K8BA 4E71A 1KM7A 3TJPA 4IG7B 5DCNA 4ZYNA 4PS3A 1WE7A 3KYDD 1J0GA 1WF9A 2WX0A 4KZ0A 1WZ3A 2LZ6A 1S1QB 4FADA 3MJWA 2ZCBA 2ZPYA 3VTVA 4I6PA 4NJ6A 2MBBB 2BKRB 3L54A 4MM3A 3RCZA 4ZRIA 2MBHA 3OAWA 1OGWA 1XT9B 3APDA 2RD0A 5JH5C 1P1AA 3CF6E 3DVGY 1GC7A 1LM8B 4HDOA 3UGBB 2K6QA 2PPHA 1ZW7A 3TMPB 4II3B 2KOXA 4MEMA 4TQ0A 3PHXB 1VCBA 4JGHB 2KX3A 2DZMA 2N7EA 4KZCA 1L2NA 1M94A 2KFKA 4W9EA 1GJZA 2DHZA 2I1KA 1YX6B 2HJ8A 2N7DA 2NPTA 2C7NB 3DVNV 2XK5A 4DHJB 1NI2A 3H7PA 3HM3A 1I35A 2M17A 3CMMB 2NS5A 4FJVB 4E74A 2JVCA 4FJZA 2ZZPB 4A3PA 4BFRA 3RYTA 3UQAA 4MH0E 3VHTC 2NBVB 2NBWB 1UBQA 1Q5WB 5E6OA 1IPGA 1WIAA 1WGGA 3EFUA 3PLUA 3VTUA 1KOTA 2FIFA 1Y8RC 2WX1A 4LJOB 4X57B 4HWIB 2XEWA 2JY6A 3QCAA 3KH0A 2BGFA 2AEHA 1GUAB 4TUUA 4PS8A 1P9DU 3ZTDA 3ML8A 3ZNHB 2KO3A 1YIWA 4GB9A 3WANA 5LXIB 1Z2MA 2KDIA 3X0WA 3V6EB 4PYUA 4IWOA 3V62A 2CKHB 2BKFA 1WXMA 2FCQA 2JPHA 4F8CB 5J17A 4DDGD 1WM2A 4DHZB 1R4MI 4LJPB 2WDTB 3ML9A 1C1YB 2KQ7A 3VTWA 2FAZA 2N4FA 3JSVB 4MJSB 4M0WB 4MJSA 1T0YA 5CTRC 2KZRA 2CU1A 1WJ4A 4ANUA 3QA8A 3QJZA 2DZJA 2EMSA 2ZEQA 5KHOA 4EZLA 5JZEB 4WQOB 3A9KA 3T9LA 3AXCA 5CHVC 2CR5A 4ZRKA 2L3ZA 2RPQA 2K8CA 1CMXB 2LRWA 4M8MA 4NNJB 1A5RA 3M62B 2MBEA 2LXCA 2KFJA 4W9KA 2C7MB 1WI0A 1WZ0A 3GOEA 4URKA 3I3TB 3A1QB 3VAWA 3A33B 2KMCA 3L16A 2Y5BB 3NHEB 3L0WB 2WYQA 3PTFC 2JRHA 3MHSD 4RMAA 3SU8X 1WMHB 2MW5A 1H4RA 3JSVA 4HJKA 3A9JB 3RZFA 4NJ7A 3PVLA 5AZHA 3TBLD 3IFWB 2KFKB 3VVWB 1YJ1A 3AU4A 3NZSA 5D6JB 2N9PC 2MA9B 3M63B 1C3TA 3OJ4B 3T8MA 2JZZA 1YD8U 2V4LA 4DHZE 4EEWA 3RZWC 2L0FA 2CS4A 1WR1A 4DWFA 2DYOA 2KVRA 2DYMA 2JZ3B 3UIOB 4NPNA 5J2RA 2CHZA 2KC2A 3A4RA 3H1UA 4G3XB 2LVQA 2NPTB 3PS6A 3MTNB 4KIKA 4WJPA 1HE8A 2IZVB 4AUQC 1E90A 3GZNI 3SHQA 4BKSD 4EZKA 4FA6A 5L83A 2A5UA 2OOBB 2MBOA 1NDDA 2CHWA 2KDBA 2KWUB 3PREA 4EFOA 2Z0EB 4AJWA 1TZ1A 3WALA 2IY1B 2DAFA 4FULA 1U4AA 4HCNB 4IM3A 2J0JA 1XD3B 1UGMA 2FCNA 2KLCA 3UIPB 2BWES 2ZNVC 3ZW3A 3O65B 4GN1A 2HD5B 4BKGA 3D32A 1J19A 3KUZA 4EKUA 2AL3A 3HIZA 1E8YA 1UBIA 2DZIA 2MLBA 2NCNA 4CYEA 2KWCA 3DVGX 1IP9A 3ENEA 4KVGB 3ZDTA 4DDID 4GDLB 2LRUA 3R3MA 4MGKE 4GU2A 4G0NB 3DPDA 4W9JA 4WJNA 3KVFB 1WGDA 4KDLB 4GIVA 4KSLC 4EZJA 3KYCD 2L8JA 4K7WA 3ZRCA 2KX0A 1OTRB 2BYVE 2M4NA 3EECA 4AJYB 4ICVA 3Q3JA 5C23A 3UF8A 1K8RB 1RRBA 1UH6A 2BPSA 2KJRA 2ZPNA 2LVPA 2PE6B 2G4DB 1RAXA 1V5TA 4WWNA 2RR9A 3ZIMA 3HM6X 4WJQA 4I6NB 1F9JA 4DHJD 2UYZB 3UQBA 4HPMB 5G55A 5TR5A 3L10B 2C5LC 2DAJA 1TTNA 2KLGA 3HK0A 2KANA 4GMVA 1D3ZA 4MGIE 4NAWA 1RFAA 2FNJB 2UWQA 1ZKHA 4W9GA 3PT2B 5HKHA 4MDKE 3A9JA 3LDZE 2K25A 1E5WA 2NVUI 2RGFA 3DVNU 3QARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHA A;  4IWQ A;  3IHP C;  5IAA C;  2W9N A;  4B95 A;  3DOW A;  2DEN B;  3ZLZ A;  3U30 A;  2C7H A;  2AL6 A;  3RT3 B;  2IYD B;  2BYF A;  3NY5 A;  4MEL A;  4G11 A;  3QC8 B;  4W9D A;  2LVO A;  4K81 A;  5D94 A;  2G45 B;  1UD7 A;  4HVB A;  1WX9 A;  4NQK E;  1WGH A;  2ASQ A;  3PRZ A;  2NBU A;  4E3C A;  4F7Z A;  4W9I A;  2BF8 B;  1LQB A;  3JYU A;  1I42 A;  2R2O A;  2D10 A;  3PZD A;  1E8Z A;  2O6V A;  3VXW A;  4GDK A;  4ANV A;  2B3A A;  3RD2 A;  1WGR A;  2LD9 A;  4DK5 A;  1QZE A;  3QK0 A;  1Q0W B;  2EKE C;  3V6C B;  4GOC A;  4BKS A;  4F1S A;  2D3G A;  2KKC A;  2MBQ A;  2FCS A;  4KIK B;  4JQW C;  2M1M A;  5C1Z A;  4HLE A;  3TIX A;  4RM9 A;  4MSM B;  4KV2 A;  3QX1 A;  2KTF A;  2L00 B;  3DCG A;  1WXV A;  4CHK A;  2MQJ A;  5G2N A;  3W1S A;  2PJH A;  3N32 A;  2O2V A;  4B9K A;  2ZVO A;  1KLV A;  1Z5S B;  3WIM A;  4K7S A;  1WRD B;  2D11 A;  3EC8 A;  1WGY A;  3BIN A;  2IBI B;  4FN2 A;  1V9J A;  2PE9 A;  2FID A;  3QHT A;  3PRP B;  5DPT A;  3C0R B;  3B1L X;  2KHW B;  3DBL I;  3Q3F A;  4BBN F;  1UZX B;  3R7Q A;  3HHM A;  2K1F A;  3AUL A;  3ZKJ C;  2DYB A;  2GMI C;  3QAQ A;  2N1V A;  3IG3 A;  5DPS A;  3WAP A;  4XZ4 A;  1V2Y A;  4WJO A;  3A9K B;  2M8S A;  1WJU A;  3IVF A;  3CSF A;  2JUO A;  4GXB A;  3VDZ A;  1OEY J;  5CHF A;  2AYO B;  1AAR A;  3U8Z A;  1L7Y A;  3OJ3 A;  3ZTC A;  2MRP A;  4TKN A;  2LI5 A;  1ISN A;  4PYZ A;  3NS8 A;  1WR6 E;  3WAM A;  4IUM B;  4ZDV A;  3A4S C;  2A4Z A;  3H7S A;  4RM8 A;  4HPL B;  4W9C A;  5FR6 A;  1XQQ A;  1WMH A;  3VUY A;  3APC A;  3M3J A;  3TCA A;  2KDE B;  2LWP A;  4ANX A;  5LXH A;  1V5O A;  2EMT A;  2L76 A;  4AOF A;  2MP2 B;  4HK2 A;  2KC1 A;  2DZK A;  3DBS A;  2M0X A;  4NAW B;  4MGZ E;  2L0T A;  2LUE A;  2MP2 A;  1P3Q U;  3PPA A;  4ASW C;  4M8N A;  1ZGU B;  4A3O A;  1EF5 A;  3OLM D;  3PLV A;  1FXT B;  4P7I A;  4MGY E;  3WAO A;  2O2V B;  4AP4 C;  5AZG A;  4LDT D;  5E6P A;  3H6N A;  4JL9 A;  3PV1 A;  2JF5 A;  2ZCC A;  2V1Y A;  2KWV B;  2O6V D;  3KUC B;  3JW0 X;  4NY0 A;  4TV3 A;  1MG8 A;  2IO1 B;  4IM2 A;  1WJ6 A;  1RLF A;  3ALB A;  5D2M B;  3VH4 B;  1IYF A;  3V61 A;  4GDK B;  5GMV A;  1SE9 A;  2HE7 A;  3KW5 B;  4JLC A;  4W9L A;  3W1Y A;  3ZO5 B;  2J7Q B;  1GNU A;  4MSQ B;  3U7D A;  3APF A;  1E8W A;  4PS7 A;  4DXA B;  2WWZ A;  2V3S A;  1BT0 A;  2K6D B;  3QQ8 B;  3R7R A;  4K7U A;  5LLI A;  2J0M A;  1LXD A;  3DDC B;  2FUH B;  1WX7 A;  3VFK A;  2KTR B;  2QHO A;  3JVZ X;  2IO3 B;  2KXJ A;  2GBK A;  4NQL B;  3VH3 B;  3QWZ B;  4WAA A;  1WXS A;  2JWZ A;  3ZVV A;  4BVU C;  2JT4 B;  1WM3 A;  1YQB A;  3S2A A;  1KJT A;  3TL5 A;  5JHB A;  1TBE A;  5AZF A;  1UEL A;  4OVU A;  2CHX A;  1EF1 A;  4LDT B;  2IY0 B;  2GBR A;  3M95 A;  1E7U A;  2XK5 B;  3EHV A;  4ZRJ A;  3H9D A;  3SD5 A;  4ICU A;  2JRI B;  4K1R B;  4IM0 A;  3AU5 A;  2C60 A;  4HCP B;  3ZNI D;  2N9E B;  2BYE A;  3RUL A;  4ANW A;  3LJ3 A;  4AWJ A;  5DPW A;  3PHW B;  1X1M A;  3SDL C;  4TQ1 A;  4BOS C;  3DBH I;  3A1Q A;  3NZU A;  2I1J A;  3L17 A;  5IA7 A;  2LGX A;  2RSU A;  3L08 A;  3V60 A;  1V80 A;  2Z59 B;  3ONS A;  3P2B A;  4GSW A;  5AEK B;  2LXA A;  2XBB C;  3AI5 A;  1R4N I;  2G4S A;  1WXA A;  4IC7 B;  4CO7 A;  2C9W B;  4J6I A;  4FJY A;  3PSE B;  1V49 A;  2KN5 A;  1YX5 B;  3UIN B;  4EOY A;  1S3S G;  2OJR A;  2KK8 A;  4W9F A;  1PQS A;  3WA0 A;  3NOB A;  3VUX A;  2D2Q A;  4B6W A;  3ZUN A;  1WFY A;  2DX5 B;  3K9O B;  4LCD E;  3L13 A;  2BWF A;  3QIJ A;  4BBN C;  4IWP A;  1WX8 A;  4N9F 4;  1P0R A;  3H7P B;  2K8H A;  4GGQ A;  3W1S C;  1GC6 A;  2KJH B;  3N30 A;  1V6E A;  2KTR A;  3N3K B;  3PGE A;  4HDQ A;  2GOW A;  4YL8 A;  5EDS A;  1G6J A;  2MSE D;  3CST A;  2O6V B;  5KHQ A;  4FHK A;  2KD0 A;  3IBE A;  2MCN B;  3DQV A;  2G3Q B;  1OEY A;  2NR2 A;  4IW0 A;  1JRU A;  2LGY A;  2K39 A;  2YLM A;  1WH3 A;  2JXX A;  2L05 A;  3B08 A;  4GDL A;  1P98 A;  5CX3 A;  1WYW B;  1SIF A;  1VD2 A;  2GBN A;  2MWS B;  4HXD A;  4W9H A;  1LFD A;  3ZNZ B;  2FCM A;  1NBF C;  3B0A A;  1SGH A;  4XC2 A;  2L7R A;  2IO0 B;  3K9P B;  2ZVN A;  4OVV A;  1EUV B;  4BKT A;  4WWP A;  3DBR I;  4II2 B;  4WWO A;  1V86 A;  2D07 B;  4EUT A;  2GBJ A;  4FBJ B;  1V81 A;  3KUD B;  1OQY A;  2IO2 B;  2KDF B;  4I6L B;  2KJ6 A;  2MX2 A;  4BOZ B;  1WE6 A;  5J18 A;  5DPR A;  5BO4 B;  2R2Q A;  2ZJD A;  2LJ5 A;  2YVC A;  2HTH A;  3ZNG C;  2KNB A;  5E6N A;  2KQS A;  3BY4 B;  4FHJ A;  5CHW A;  1WY8 A;  4A20 A;  1WJN A;  3X23 A;  5L95 C;  2KMA A;  1GG3 A;  4KSK C;  3ZDM C;  3ECI A;  3ZRF A;  2REX A;  4FLH A;  4DBG A;  4JIO U;  2PEA A;  1H8C A;  4KDI C;  1E7V A;  2LAS A;  2GBM A;  3VQI A;  4XX5 A;  4G50 A;  1Q1O A;  2VRR B;  2J0K A;  3R66 C;  5D7G A;  2N9X A;  1J8C A;  2LGD A;  2ZNV B;  1E8X A;  2Z0D B;  3PRM B;  1EO6 A;  3RUI B;  3VUW A;  2AWT A;  1TGZ B;  2N1W A;  2K8B A;  4E71 A;  1KM7 A;  3TJP A;  4IG7 B;  5DCN A;  4ZYN A;  4PS3 A;  1WE7 A;  3KYD D;  1J0G A;  1WF9 A;  2WX0 A;  4KZ0 A;  1WZ3 A;  2LZ6 A;  1S1Q B;  4FAD A;  3MJW A;  2ZCB A;  2ZPY A;  3VTV A;  4I6P A;  4NJ6 A;  2MBB B;  2BKR B;  3L54 A;  4MM3 A;  3RCZ A;  4ZRI A;  2MBH A;  3OAW A;  1OGW A;  1XT9 B;  3APD A;  2RD0 A;  5JH5 C;  1P1A A;  3CF6 E;  3DVG Y;  1GC7 A;  1LM8 B;  4HDO A;  3UGB B;  2K6Q A;  2PPH A;  1ZW7 A;  3TMP B;  4II3 B;  2KOX A;  4MEM A;  4TQ0 A;  3PHX B;  1VCB A;  4JGH B;  2KX3 A;  2DZM A;  2N7E A;  4KZC A;  1L2N A;  1M94 A;  2KFK A;  4W9E A;  1GJZ A;  2DHZ A;  2I1K A;  1YX6 B;  2HJ8 A;  2N7D A;  2NPT A;  2C7N B;  3DVN V;  2XK5 A;  4DHJ B;  1NI2 A;  3H7P A;  3HM3 A;  1I35 A;  2M17 A;  3CMM B;  2NS5 A;  4FJV B;  4E74 A;  2JVC A;  4FJZ A;  2ZZP B;  4A3P A;  4BFR A;  3RYT A;  3UQA A;  4MH0 E;  3VHT C;  2NBV B;  2NBW B;  1UBQ A;  1Q5W B;  5E6O A;  1IPG A;  1WIA A;  1WGG A;  3EFU A;  3PLU A;  3VTU A;  1KOT A;  2FIF A;  1Y8R C;  2WX1 A;  4LJO B;  4X57 B;  4HWI B;  2XEW A;  2JY6 A;  3QCA A;  3KH0 A;  2BGF A;  2AEH A;  1GUA B;  4TUU A;  4PS8 A;  1P9D U;  3ZTD A;  3ML8 A;  3ZNH B;  2KO3 A;  1YIW A;  4GB9 A;  3WAN A;  5LXI B;  1Z2M A;  2KDI A;  3X0W A;  3V6E B;  4PYU A;  4IWO A;  3V62 A;  2CKH B;  2BKF A;  1WXM A;  2FCQ A;  2JPH A;  4F8C B;  5J17 A;  4DDG D;  1WM2 A;  4DHZ B;  1R4M I;  4LJP B;  2WDT B;  3ML9 A;  1C1Y B;  2KQ7 A;  3VTW A;  2FAZ A;  2N4F A;  3JSV B;  4MJS B;  4M0W B;  4MJS A;  1T0Y A;  5CTR C;  2KZR A;  2CU1 A;  1WJ4 A;  4ANU A;  3QA8 A;  3QJZ A;  2DZJ A;  2EMS A;  2ZEQ A;  5KHO A;  4EZL A;  5JZE B;  4WQO B;  3A9K A;  3T9L A;  3AXC A;  5CHV C;  2CR5 A;  4ZRK A;  2L3Z A;  2RPQ A;  2K8C A;  1CMX B;  2LRW A;  4M8M A;  4NNJ B;  1A5R A;  3M62 B;  2MBE A;  2LXC A;  2KFJ A;  4W9K A;  2C7M B;  1WI0 A;  1WZ0 A;  3GOE A;  4URK A;  3I3T B;  3A1Q B;  3VAW A;  3A33 B;  2KMC A;  3L16 A;  2Y5B B;  3NHE B;  3L0W B;  2WYQ A;  3PTF C;  2JRH A;  3MHS D;  4RMA A;  3SU8 X;  1WMH B;  2MW5 A;  1H4R A;  3JSV A;  4HJK A;  3A9J B;  3RZF A;  4NJ7 A;  3PVL A;  5AZH A;  3TBL D;  3IFW B;  2KFK B;  3VVW B;  1YJ1 A;  3AU4 A;  3NZS A;  5D6J B;  2N9P C;  2MA9 B;  3M63 B;  1C3T A;  3OJ4 B;  3T8M A;  2JZZ A;  1YD8 U;  2V4L A;  4DHZ E;  4EEW A;  3RZW C;  2L0F A;  2CS4 A;  1WR1 A;  4DWF A;  2DYO A;  2KVR A;  2DYM A;  2JZ3 B;  3UIO B;  4NPN A;  5J2R A;  2CHZ A;  2KC2 A;  3A4R A;  3H1U A;  4G3X B;  2LVQ A;  2NPT B;  3PS6 A;  3MTN B;  4KIK A;  4WJP A;  1HE8 A;  2IZV B;  4AUQ C;  1E90 A;  3GZN I;  3SHQ A;  4BKS D;  4EZK A;  4FA6 A;  5L83 A;  2A5U A;  2OOB B;  2MBO A;  1NDD A;  2CHW A;  2KDB A;  2KWU B;  3PRE A;  4EFO A;  2Z0E B;  4AJW A;  1TZ1 A;  3WAL A;  2IY1 B;  2DAF A;  4FUL A;  1U4A A;  4HCN B;  4IM3 A;  2J0J A;  1XD3 B;  1UGM A;  2FCN A;  2KLC A;  3UIP B;  2BWE S;  2ZNV C;  3ZW3 A;  3O65 B;  4GN1 A;  2HD5 B;  4BKG A;  3D32 A;  1J19 A;  3KUZ A;  4EKU A;  2AL3 A;  3HIZ A;  1E8Y A;  1UBI A;  2DZI A;  2MLB A;  2NCN A;  4CYE A;  2KWC A;  3DVG X;  1IP9 A;  3ENE A;  4KVG B;  3ZDT A;  4DDI D;  4GDL B;  2LRU A;  3R3M A;  4MGK E;  4GU2 A;  4G0N B;  3DPD A;  4W9J A;  4WJN A;  3KVF B;  1WGD A;  4KDL B;  4GIV A;  4KSL C;  4EZJ A;  3KYC D;  2L8J A;  4K7W A;  3ZRC A;  2KX0 A;  1OTR B;  2BYV E;  2M4N A;  3EEC A;  4AJY B;  4ICV A;  3Q3J A;  5C23 A;  3UF8 A;  1K8R B;  1RRB A;  1UH6 A;  2BPS A;  2KJR A;  2ZPN A;  2LVP A;  2PE6 B;  2G4D B;  1RAX A;  1V5T A;  4WWN A;  2RR9 A;  3ZIM A;  3HM6 X;  4WJQ A;  4I6N B;  1F9J A;  4DHJ D;  2UYZ B;  3UQB A;  4HPM B;  5G55 A;  5TR5 A;  3L10 B;  2C5L C;  2DAJ A;  1TTN A;  2KLG A;  3HK0 A;  2KAN A;  4GMV A;  1D3Z A;  4MGI E;  4NAW A;  1RFA A;  2FNJ B;  2UWQ A;  1ZKH A;  4W9G A;  3PT2 B;  5HKH A;  4MDK E;  3A9J A;  3LDZ E;  2K25 A;  1E5W A;  2NVU I;  2RGF A;  3DVN U;  3QAR A; 
#chains in the Genus database with same CATH topology
 3NVW A;  4WUR A;  5IAA C;  4ARC A;  2W9N A;  1D5X C;  1PGX A;  2HDE A;  1ZE3 D;  2KVZ A;  1QOB A;  3ZGZ A;  1N60 A;  1WX9 A;  4WH4 A;  1TS3 A;  1LQB A;  1I4H A;  2IGD A;  1E8Z A;  4YSY B;  2DNF A;  3BYY B;  2LD9 A;  2EKE C;  1OFF A;  1T0R C;  3Q8B A;  1E9M A;  1OQQ A;  4MSM B;  1P7E A;  3N1Y C;  1R4N B;  2KT7 A;  2KTF A;  2L00 B;  4CHK A;  3W1S A;  2K9X A;  2OED A;  4K7S A;  1WRD B;  4JX1 C;  3ZJT A;  1ACC A;  2K3U A;  2PE9 A;  2FID A;  3QHT A;  3AE6 B;  3R8B A;  3B1L X;  2K1F A;  2W3R A;  3RNE C;  1V2Y A;  4WJO A;  3A9K B;  3CSF A;  2JUO A;  1V8C A;  3U8Z A;  1FNV A;  4ZRQ A;  3Q2A C;  2WU2 B;  2E6X A;  2MRP A;  4TKN A;  1N63 A;  3MJ5 A;  5GXG B;  4RM8 A;  1DGJ A;  4BZA A;  4HPL B;  4W9C A;  2R61 A;  2IPK D;  2ON8 A;  2L76 A;  4L23 A;  2MP2 B;  2KC1 A;  3Q6B A;  3DBS A;  2M0X A;  1WWT A;  2WDR B;  3FKY A;  2BT6 A;  4MGZ E;  2BTE A;  2MP2 A;  4ASW C;  3SR6 A;  3OLM D;  2WXR A;  2O2V B;  1ET9 A;  4P1B C;  2KWV B;  2O6V D;  1C78 A;  4QAY A;  5IKC M;  3ALB A;  2V9H A;  3V61 A;  1QQR A;  1SE9 A;  2HE7 A;  5G5H A;  4MSQ B;  1E8W A;  2V3S A;  3QQ8 B;  4K7U A;  2J0M A;  3DDC B;  1WX7 A;  3VFK A;  2QHO A;  3JVZ X;  1QT9 A;  3QWZ B;  4WAA A;  1WXS A;  1JWM D;  4BVU C;  2JT4 B;  2WXH A;  1WM3 A;  2ONQ A;  1KJT A;  1UWX A;  4TSS A;  1UGJ A;  1J7C A;  1AW7 A;  2XK5 B;  3H9D A;  4K1R B;  3AU5 A;  2BS3 B;  3ZNI D;  2BYE A;  3KWL A;  4BOS C;  2I1J A;  1XCT L;  3AE8 B;  2Z59 B;  4GSW A;  3ONS A;  2LXA A;  2G4S A;  4CO7 A;  3R2I A;  1PFD A;  1PQS A;  1KLU D;  4NJC A;  4DXG A;  2KYW A;  5AUI A;  1WFY A;  3K9O B;  3L13 A;  3Q14 C;  1JQ4 A;  4GGQ A;  3W1S C;  3N3K B;  4YL8 A;  2MSE D;  4M00 A;  4R3D A;  5BYS A;  2G3Q B;  4IW0 A;  1M4V A;  1P98 A;  1VD2 A;  1ROE A;  1EWY C;  1QOF A;  4RGT A;  3P1M A;  3K9P B;  2WXN A;  2ZVN A;  3ZXR A;  3AEA B;  4BKT A;  2K5P A;  2MH7 A;  3AE1 B;  3KQ4 A;  4WWO A;  4GLS C;  4FXC A;  4BOZ B;  1JWB D;  1YOV B;  1T0S C;  5BO4 B;  4XYC A;  2D5G A;  2YVC A;  2GI9 A;  3ABV B;  4ZOH C;  4WQM A;  3H8H A;  3B2F A;  2KQS A;  4A20 A;  3ZDM C;  1GG3 A;  4ACF A;  2REX A;  1L4Z B;  1H8C A;  4XX5 A;  1J8C A;  3RNA C;  1E8X A;  1F2R I;  3RNF C;  1PGA A;  1C4P A;  1EO6 A;  2PW9 A;  4E71 A;  4ZHP A;  4ZYN A;  1WE7 A;  1J0G A;  1D6E C;  1WF9 A;  2WX0 A;  4KZ0 A;  1PYW D;  1WZ3 A;  3MJW A;  1JAL A;  4I6P A;  2J4X A;  4ZRI A;  5LNK 1;  5JH5 C;  3DVG Y;  1GC7 A;  1LM8 B;  5D3D A;  3RFZ B;  2K6Q A;  3AV8 A;  1F1H A;  2J42 A;  3MP9 A;  4TQ0 A;  4JGH B;  1L2N A;  2KFK A;  2PMV A;  2DHZ A;  4M01 A;  1YX6 B;  2DWQ A;  4YTP B;  2HJ8 A;  2WXP A;  3CMM B;  2JVC A;  3RYT A;  3UQA A;  5BYR A;  2NBV B;  2KAC A;  1IPG A;  3EFU A;  1WGG A;  3PLU A;  3VTU A;  1ET6 A;  5FK9 C;  2JXT A;  3KH0 A;  2BGF A;  4JWU C;  4XGA B;  1J7A A;  2KO3 A;  1YIW A;  3WAN A;  3J9C A;  4IWO A;  2CKH B;  1WXM A;  4ITK A;  4DHZ B;  3ML9 A;  1F0Z A;  2N4F A;  2X38 A;  1I4G A;  4MJS B;  4M0W B;  4KGR A;  2CU1 A;  1SB3 C;  3AE2 B;  5KHO A;  1MPE A;  3T9L A;  3A9K A;  2ACZ B;  2L3Z A;  2X8X X;  3M62 B;  2IDY A;  1I4R A;  3NZ3 A;  1WZ0 A;  3GOE A;  4URK A;  3I3T B;  3A1Q B;  3A33 B;  3NHE B;  1TKY A;  3C8Y A;  1YQ3 B;  1WMH B;  2MW5 A;  2INP E;  3JSV A;  3U52 E;  4NJ7 A;  1A70 A;  1V1P B;  5EE1 A;  2MJD A;  3NZS A;  4USA A;  3BII D;  4DHZ E;  4EEW A;  1V97 A;  3HVZ A;  2D3C A;  4RH6 A;  2JZ3 B;  4KX6 B;  4G3X B;  1CZP A;  3MC8 A;  1ZP0 B;  2LVQ A;  2NPT B;  3PS6 A;  3MTN B;  1SF0 A;  4WJP A;  1KRH A;  4YXD B;  1JRP A;  4EZK A;  4FA6 A;  5L83 A;  2A5U A;  2OOB B;  2AQ2 B;  2CHW A;  2W55 A;  2KDB A;  1TZ1 A;  5EE0 A;  4YTM B;  4S0R A;  2RDB C;  3ZW3 A;  4GN1 A;  4L2Y A;  1J19 A;  2NTT A;  2AL3 A;  4EKU A;  1UBI A;  2DZI A;  1ZUD 2;  2NCN A;  1XLN A;  4W9J A;  4WJN A;  4KDL B;  4JPS A;  4K7W A;  1FNU A;  1OTR B;  1GOZ A;  2H88 B;  5C23 A;  3DHH C;  4N6E B;  1RAX A;  3DBL B;  4A8X C;  1Q10 A;  1F9J A;  1I4Q A;  2JX5 A;  2WXK A;  3HK0 A;  1TTN A;  2KLG A;  4NAW A;  2FNJ B;  1ZKH A;  3N1X C;  4MDK E;  3LDZ E;  3DVN U;  2ZJD A;  4IDI A;  1E5W A;  1DYQ A;  3QAR A;  3TEX A;  5AUK A;  1TT5 B;  4B95 A;  3DOW A;  2DEN B;  3ZLZ A;  3U30 A;  2C7H A;  4C80 A;  1TY2 A;  1D4B A;  3RT3 B;  5HG2 A;  2IYD B;  3DHG C;  2JYT A;  3NY5 A;  4G11 A;  2LVO A;  4K81 A;  5D94 A;  1C79 A;  1RFK A;  1UD7 A;  2I2Y A;  3AN1 A;  4K3C A;  2ASQ A;  2NBU A;  4E3C A;  1YN4 A;  3JYU A;  2QIL A;  4RGM A;  3AB5 A;  2D10 A;  1K52 A;  3VXW A;  4GDK A;  1WGR A;  3N1Z C;  4GOC A;  1WSP A;  4KKI A;  4BKS A;  4MT5 A;  1EU3 A;  2D3G A;  3NJT A;  2MBQ A;  2KAJ A;  1B9R A;  3QX1 A;  3DCG A;  1E6E B;  2MQJ A;  5G2N A;  1EM7 A;  2O2V A;  3NVY A;  1Z5S B;  2D11 A;  3EA6 A;  1T5X D;  1WGY A;  4DXF A;  2IBI B;  3C0R B;  3DBL I;  5HHD G;  2BB6 A;  1UZX B;  2GLS A;  4RGO S;  3R7Q A;  3HHM A;  3AUL A;  3ZKJ C;  2GMI C;  3QAQ A;  2LMC A;  2N1V A;  1SE3 A;  3AEB B;  3Q3O C;  4XZ4 A;  1WJU A;  3IVF A;  2XN9 C;  1C9F A;  5FR3 A;  1D5M C;  1SE2 A;  1DOY A;  5I4D A;  1L7Y A;  2W3S A;  1QOA A;  3ZTC A;  5IOI A;  2D3B A;  3WAM A;  5BMH A;  3A4S C;  4LNK A;  3DBH B;  5HI1 A;  5FR6 A;  2ICI A;  1WMH A;  3AH7 A;  5LXH A;  1L0V B;  2EMT A;  4AOF A;  1TZO A;  2DZK A;  2MJE A;  4NAW B;  4PT5 A;  4WIP A;  2IJ0 A;  2K0P A;  4HRS A;  4M8N A;  2LHE A;  3Q3M C;  4MGY E;  4AP4 C;  3MHZ A;  2JF5 A;  3MFG A;  4NY0 A;  1J7B A;  1D5Z C;  1WJ6 A;  1RLF A;  1FCC C;  5GMV A;  4JLC A;  1WXQ A;  4W9L A;  4MH8 A;  3APF A;  4DXA B;  4ZRP A;  2WWZ A;  4AQ7 A;  3R7R A;  2FE8 A;  3GE8 C;  3N20 C;  5BMG A;  1LXD A;  3VH3 B;  2OHF A;  1N62 A;  3ZVV A;  3EUB 2;  1UEL A;  1UF0 A;  3M95 A;  4ZRJ A;  3TEW A;  4HCP B;  3RUL A;  4ANW A;  5DPW A;  3PHW B;  4OW0 A;  2IGG A;  4TQ1 A;  3SEB A;  5IA7 A;  2RSU A;  3NG0 A;  3AI5 A;  1R4N I;  1HZ5 A;  1HZ6 A;  2C9W B;  1V49 A;  1YX5 B;  2KK8 A;  4W9F A;  2D2Q A;  1FFV A;  3NVZ A;  1LO5 D;  4LCD E;  4HKZ E;  3QIJ A;  1L6V A;  2BWF A;  3U4E G;  1WX8 A;  2WP9 B;  2K8H A;  4C00 A;  1GC6 A;  3N30 A;  1V6E A;  3V05 A;  1SIJ A;  2O6V B;  4N59 A;  3DQV A;  1OEY A;  2QEJ C;  2YLM A;  4A90 A;  4GDL A;  1WYW B;  3PO0 A;  1SGH A;  1EU4 A;  5IN7 A;  4OVV A;  3HUI A;  3I57 A;  4BAX A;  4WWP A;  4II2 B;  1V86 A;  2D07 B;  2JWU A;  4EUT A;  1CQV A;  1OQY A;  1WE6 A;  2W54 A;  2Q5W D;  2HTH A;  2KNB A;  3BY4 B;  1WY8 A;  1WJN A;  3X23 A;  3RNG C;  3ZRF A;  4KDI C;  4G50 A;  3P4R B;  2LGD A;  3Q8F A;  5E6J A;  2Z0D B;  3PRM B;  1I4P A;  3RUI B;  1TGZ B;  4C7Y A;  5EE3 A;  3RN9 C;  4IG7 B;  5DCN A;  4PS3 A;  2FUG 1;  2LZ6 A;  2LGS A;  2YEP F;  1MHX A;  2BS2 B;  2ZCB A;  3RCZ A;  2MBH A;  1C77 A;  2BW2 A;  4RCO A;  1XT9 B;  2WXO A;  2WDV B;  2RD0 A;  3CF6 E;  3UGB B;  2DLB A;  3Q8A A;  2PPH A;  1HA5 A;  2B76 B;  4XDC A;  1P7F A;  3HRD D;  1XLO A;  3IXS A;  4W9E A;  2I1K A;  5H8Y E;  2XK5 A;  2M17 A;  3AM9 A;  4FJV B;  2RDG A;  4A3P A;  2J53 A;  4MH0 E;  1UBQ A;  1V1P A;  1ZDV A;  2WS3 B;  3I9V 1;  4M0W A;  3B2G A;  2FIF A;  1MHH E;  4LJO B;  3GP7 A;  4HWI B;  3QCA A;  4LTU A;  5TSS A;  1YQ4 B;  2AEH A;  4PS8 A;  3ZTD A;  3FC4 A;  1C4C A;  5BMI A;  3AEC B;  1Z2M A;  3V6E B;  3V62 A;  1QOG A;  1TS4 A;  2JPH A;  2IGH A;  4DDG D;  4OVZ A;  1QLB B;  2JYE A;  2CJN A;  2WDT B;  3GZN B;  3VTW A;  2FAZ A;  3JSV B;  1VR9 A;  2ZW1 A;  2SEB D;  5CTR C;  4ANU A;  3RNC C;  3QA8 A;  3QJZ A;  2DZJ A;  4WQO B;  4LNF A;  1BML C;  2LFI A;  2RPQ A;  2LRW A;  3NUH B;  4C7Z A;  3Q8E A;  4A9A A;  1YNT E;  3VAW A;  4HPP A;  3P42 A;  3L0W B;  1STE A;  3A9J B;  3PVL A;  5AZH A;  3URY A;  3AU4 A;  1C3T A;  2N9P C;  2MA9 B;  3M63 B;  1L5P A;  3OJ4 B;  3T3N A;  3AEE B;  2L0F A;  2N7J A;  2DYM A;  5J2R A;  3H1U A;  2KC2 A;  1HE8 A;  1NYQ A;  1VLB A;  3AE3 B;  3GZN I;  4IOI E;  3OWE B;  5EE9 A;  2MBO A;  2KWU B;  4EFO A;  2Z0E B;  1K50 A;  3AE5 B;  3BK2 A;  4FUL A;  2DAF A;  1U4A A;  1QIL A;  2J0J A;  2Y5P A;  1XD3 B;  2E3T A;  3BK1 A;  3O65 B;  2HD5 B;  1WGK A;  1JW9 D;  1YJJ A;  2WXJ A;  3D32 A;  2WXL A;  3KUZ A;  4N58 A;  3WCQ A;  4CYE A;  1E8Y A;  2NTS A;  4C4V A;  3ZDT A;  4DDI D;  4GDL B;  2LRU A;  4WWM A;  3BYT B;  3KYC D;  2KX0 A;  2L1A A;  3EEC A;  4LNO A;  1K8R B;  1RRB A;  1UH6 A;  2KJR A;  2LVP A;  3ZIM A;  5G55 A;  3VR8 B;  3TEY A;  2DAJ A;  3ZQ4 A;  1VJK A;  4MGI E;  1FEH A;  2UWQ A;  5HKH A;  2K25 A;  3OJ3 A;  2NVU I;  5HFY A;  5JHA A;  3IHP C;  2WGS A;  4HKQ A;  2WNM A;  4KKJ A;  3QC8 B;  5IO9 A;  2G45 B;  3IT6 B;  4NQK E;  1WGH A;  3PRZ A;  4F7Z A;  4W9I A;  1I42 A;  1E7P B;  2R2O A;  4RFB A;  2WLB A;  3KLS X;  3RD2 A;  4DK5 A;  1QZE A;  3QK0 A;  1Q0W B;  3V6C B;  3BVM A;  2KKC A;  1N61 A;  2FCS A;  2MJ3 A;  2I38 A;  3TIX A;  4KV2 A;  1NEK B;  1NVI D;  3N32 A;  5FKA C;  1KLV A;  3WIM A;  1FCL A;  3IT4 B;  3BIN A;  3ZJU A;  3PRP B;  3Q3F A;  3IAM 1;  4BBN F;  1JWU D;  5DPS A;  3WAP A;  2BQQ A;  2M8S A;  3AEG B;  4GXB A;  1OEY J;  1K53 A;  2D3A A;  1TJE A;  2AYO B;  1AAR A;  3Q69 A;  3RMK C;  1AWD A;  2HJ1 A;  2QIE B;  3NS8 A;  1XCQ L;  1WR6 E;  4ZDV A;  3H7S A;  4LK0 M;  3BWU D;  1SJH D;  1XQQ A;  1T6B X;  3M3J A;  3TSS A;  2KDE B;  2LWP A;  1GPX A;  1V5O A;  4HK2 A;  1B1Z A;  3U2S C;  1UWM A;  1ZDX A;  2LUE A;  1ZGU B;  4A3O A;  1DOX A;  5IP4 D;  1FXT B;  4P7I A;  4LDT D;  2ZCC A;  2WU5 B;  2M19 A;  3KUC B;  3JW0 X;  1GB4 A;  2M0A A;  2IO1 B;  3IAS 1;  4IM2 A;  2QCZ A;  4YSX B;  5D2M B;  3VH4 B;  1IYF A;  4GDK B;  3FIL A;  3ZO5 B;  1YN3 A;  1FO4 A;  1GNU A;  4O1N A;  4P16 A;  4PS7 A;  1BT0 A;  5LLI A;  2RMM A;  1KH0 A;  3DWG C;  2IO3 B;  2QMT A;  1TKG A;  3NS1 A;  2JWZ A;  1YQB A;  3S2A A;  3TL5 A;  5JHB A;  1TBE A;  2KN4 A;  2CHX A;  4LDT B;  2GBR A;  3KWV A;  3EHV A;  3SD5 A;  1YJI A;  2N9E B;  4AWJ A;  2Y3A A;  1X1M A;  3SDL C;  3A1Q A;  3NZU A;  2PIA A;  3L17 A;  2LGX A;  3GE3 C;  3L08 A;  1V80 A;  1ZOY B;  5AEK B;  4L1B A;  2AQ1 B;  2XBB C;  1WXA A;  1EWC A;  5JXV A;  4IC7 B;  4MAC A;  4FJY A;  1I7H A;  1L0X B;  3UIN B;  2OJR A;  3W5V B;  3WA0 A;  3NOB A;  4B6W A;  2DX5 B;  4IWP A;  4N9F 4;  4LNI A;  3PGE A;  4HDQ A;  1FD6 A;  5EDS A;  4RF0 A;  1IBX A;  5KHQ A;  4FHK A;  4A6Q A;  2KD0 A;  1JWS D;  1ZPS A;  3T3O A;  2MCN B;  1AYF A;  1UNS A;  2K39 A;  3FIL B;  1NEN B;  2PLP A;  4HVB A;  2GBN A;  4W9H A;  1LFD A;  4HJG E;  2FCM A;  1HXY D;  2L7R A;  2IO0 B;  1EUV B;  2GRI A;  2N0S B;  3CIR B;  3DBR I;  4FBJ B;  1V81 A;  1TKE A;  1VDV A;  2KDF B;  3KUD B;  5J18 A;  2MX2 A;  5DPR A;  3LB8 C;  2R2Q A;  4Q2J A;  4A55 A;  1FRD A;  3ZNG C;  1VZ6 A;  2BB5 A;  4FHJ A;  4P1C C;  2KMA A;  1HEZ E;  2Y5C A;  4DBG A;  4JIO U;  3VQI A;  1XEE A;  3BZD B;  5D7G A;  1QF6 A;  2LEK A;  2ZNV B;  3W9C B;  2N1W A;  1KM7 A;  3TJP A;  2INN E;  3KYD D;  2N9K A;  3BVZ A;  4FAD A;  3AE4 B;  1SBB B;  2H89 B;  2WXG A;  3APD A;  3LYY A;  4DQO C;  2BS4 B;  1P1A A;  4HDO A;  3PZ7 A;  2JU6 X;  3TMP B;  1ZW7 A;  1R4M B;  4II3 B;  3R2T A;  2KOX A;  4MEM A;  1VCB A;  2N7E A;  1F52 A;  1IGC A;  1KF6 B;  1GJZ A;  3E9S A;  3AE7 B;  1UUP A;  3DVN V;  3NVV A;  1NI2 A;  3HM3 A;  1I35 A;  2NS5 A;  4E74 A;  1MVK A;  1FPY A;  2J52 A;  4BFR A;  2V4I B;  1YMH E;  2JSV X;  2NBW B;  2KWD A;  5E6O A;  1KOT A;  1Y8R C;  1MFW A;  3I5J C;  4X57 B;  2INC C;  4S17 A;  2JY6 A;  1GUA B;  2G9H D;  3HVD A;  1P9D U;  3VRB B;  1XLQ A;  4PYU A;  2ZW0 A;  2BKF A;  2FCQ A;  2Z8L A;  5J17 A;  1FRR A;  1HQR D;  4LJP B;  2WXF A;  1C76 A;  3MC9 A;  2EMS A;  4P6V F;  4TMA B;  5CHV C;  3EGR A;  2VZK B;  2QDF A;  4M8M A;  2K8C A;  4NNJ B;  1BXT A;  2LXC A;  2KFJ A;  4W9K A;  1WI0 A;  3LXF A;  1L4D B;  2KMC A;  3L16 A;  2Y5B B;  2JRH A;  1FM0 D;  3RZF A;  1RM6 C;  3TBL D;  3IFW B;  2KFK B;  2DBY A;  5D6J B;  3T8M A;  1YD8 U;  3VRA B;  2LUM A;  3RZW C;  4KGT A;  1I4X A;  1WR1 A;  1PUT A;  1ZXI A;  2DYO A;  2KVR A;  1Y56 A;  3UIO B;  4NPN A;  2CHZ A;  3A4R A;  4RGN A;  3P63 A;  4KIK A;  2IZV B;  1E90 A;  4PK1 A;  4KGS A;  1NDD A;  1E0Z A;  3PRE A;  5H92 C;  1V1O A;  4AJW A;  3WAL A;  3RPF C;  4AS1 A;  4HCN B;  4J3O D;  1KTK A;  1VZ7 A;  1UGM A;  2KLC A;  2BWE S;  5D3I B;  2ZNV C;  2BVC A;  4BKG A;  2KDM A;  3HIZ A;  2MLB A;  1IP9 A;  2VH1 A;  2KWC A;  4C4V B;  3ENE A;  4OZB A;  3R3M A;  4GU2 A;  3ZXV A;  2UU7 A;  3DPD A;  4GIV A;  2CU3 A;  3DBR B;  2MEK A;  2L8J A;  3ZRC A;  2BYV E;  3W5U B;  4AJY B;  1MG4 A;  4ICV A;  3UF8 A;  2ZPN A;  2BPS A;  1CK1 A;  1KFY B;  2PE6 B;  2G4D B;  2RR9 A;  3HM6 X;  4DHJ D;  1ZXH A;  2UYZ B;  5T8I A;  4HPM B;  3UQB A;  5TR5 A;  2C5L C;  3BVG A;  3ETR A;  4W9G A;  4EE2 A;  3A9J A;  1PGB A;  2RGF A;  1DOI A;  1HTO A;  2BYT A;  1LGR A;  4IWQ A;  1IBX B;  4ARI A;  2AL6 A;  4OZC A;  1R7S A;  3TEZ A;  3AMZ A;  1N5W A;  2BYF A;  3DWM A;  4MEL A;  4W9D A;  3ZYY X;  4XWT A;  1SE4 A;  2L83 A;  2BF8 B;  2CJO A;  1TS5 A;  1C4A A;  2O6V A;  3PZD A;  4ZHO A;  4ANV A;  2B3A A;  5MPO A;  3VR9 B;  2RPV A;  1JRO A;  4F1S A;  4KIK B;  2TSS A;  4JQW C;  2M1M A;  5C1Z A;  4HLE A;  4RM9 A;  1JWA D;  1WXV A;  2PJH A;  2PTL A;  4B9K A;  2PVO D;  2ZVO A;  3EC8 A;  1SJE D;  2RDH A;  2WXM A;  1V9J A;  4FN2 A;  2AQ3 B;  5DPT A;  2KHW B;  2K22 A;  2KMM A;  2DYB A;  1F2R C;  3AEF B;  1FXA A;  3IG3 A;  3L4P A;  3VDZ A;  2V3P A;  5CHF A;  4YSZ B;  1FIQ A;  2LI5 A;  1ISN A;  4PYZ A;  3MC0 B;  4JWS C;  4IUM B;  2A4Z A;  2PVG C;  3VUY A;  3APC A;  3TCA A;  1WYG A;  1N5X A;  2L0T A;  4YWG G;  2V3N A;  1P3Q U;  3PPA A;  4ZYS A;  1EF5 A;  3PLV A;  3WAO A;  5AZG A;  5E6P A;  2VH2 A;  4MM3 B;  3H6N A;  4JL9 A;  3PV1 A;  5G5G A;  2EKI A;  2V1Y A;  1MI0 A;  2NMQ A;  4TV3 A;  1MG8 A;  3KW5 B;  3W1Y A;  1IGD A;  2J7Q B;  3U7D A;  2PKO A;  3B9J A;  2K6D B;  2SAK A;  3NRZ A;  2FUH B;  2KTR B;  4NQL B;  2KXJ A;  2GBK A;  1OQR A;  5AZF A;  4YT0 B;  4OVU A;  5C3J B;  1EF1 A;  2IY0 B;  1E7U A;  4ICU A;  2JRI B;  4IM0 A;  2C60 A;  2G1E A;  3E56 A;  1E10 A;  3LJ3 A;  4HEA 1;  3DBH I;  4NAM A;  5BYQ A;  3V60 A;  3P2B A;  2LJI A;  4OZA A;  3Q3N C;  4J6I A;  4YTN B;  3PSE B;  2KN5 A;  4LNN A;  4EOY A;  1S3S G;  3GS2 A;  2WDQ B;  4H2A A;  3VUX A;  2BBC A;  3ZUN A;  2N9L A;  4BBN C;  1RWS A;  1P0R A;  3H7P B;  1L6U A;  3OG5 A;  2KJH B;  2KTR A;  2GOW A;  2WQY B;  1G6J A;  3CST A;  1YN5 A;  4D2K A;  2XNA C;  3IBE A;  2NR2 A;  1JRU A;  4M02 A;  1F77 A;  2LHD A;  2LGY A;  1WH3 A;  2JXX A;  2L05 A;  3B08 A;  5CX3 A;  4ANX A;  1SIF A;  4HXD A;  3ZNZ B;  2MWS B;  1VRA B;  1NBF C;  3B0A A;  3I63 C;  4B0M A;  4JE3 B;  4XC2 A;  3ZJV A;  1TIF A;  4LLG M;  2QC8 A;  2GBJ A;  3AED B;  4I6L B;  2IO2 B;  2KJ6 A;  1T3Q A;  2LJ5 A;  3P4P B;  1JML A;  1NI3 A;  3O13 A;  5E6N A;  1L0Y B;  2HTM E;  5CHW A;  5L95 C;  1NYR A;  4KSK C;  3EFC A;  2W82 A;  3ECI A;  2WXQ A;  1IUE A;  4FLH A;  2PEA A;  4IKG A;  1E7V A;  2LAS A;  2GBM A;  1Q1O A;  2MHJ A;  2VRR B;  1AN8 A;  2J0K A;  3R66 C;  2N9X A;  1T0Q C;  1XO3 A;  1ENF A;  2WHI A;  1TY0 A;  3VUW A;  2AWT A;  2K8B A;  3UI3 A;  2VZK D;  1RYJ A;  1FFU A;  2JQR B;  2AX5 A;  1S1Q B;  3Q8C A;  1XLP A;  2ZPY A;  3VTV A;  4NJ6 A;  2MBB B;  2BKR B;  1FMA D;  3GB1 A;  3L54 A;  4MM3 A;  4US8 A;  2L32 A;  1OGW A;  3OAW A;  1WRI A;  3SFD B;  3DHI C;  2OJW A;  1SXT A;  4NZL B;  1N6Z A;  3PHX B;  2KX3 A;  2DZM A;  4KZC A;  4XWW A;  1M94 A;  1FNW A;  3FAH A;  2N7D A;  2NPT A;  2C7N B;  4DHJ B;  3H7P A;  3V3X A;  2QSD A;  4FJZ A;  1TS2 A;  2ZZP B;  4XDD A;  2V0G A;  4RNA A;  3VHT C;  4OHJ A;  1TYG B;  1Q5W B;  1WIA A;  1ESF A;  2YEP B;  2WX1 A;  3RI7 C;  2XEW A;  1GB1 A;  4TUU A;  3ML8 A;  3ZNH B;  4GB9 A;  5LXI B;  2KDI A;  3X0W A;  1KLG D;  2M56 B;  4F8C B;  3SFE B;  1WM2 A;  1R4M I;  1C1Y B;  2KQ7 A;  3P4S B;  4MJS A;  1T0Y A;  2KZR A;  1WJ4 A;  2QJL A;  2ZEQ A;  4EZL A;  5JZE B;  3AXC A;  2CR5 A;  4ZRK A;  2KQ4 X;  1CMX B;  1A5R A;  2MBE A;  2C7M B;  2EEL A;  1XF5 L;  2WYQ A;  2GB1 A;  3MHS D;  3PTF C;  4RMA A;  1HTQ A;  3SU8 X;  1H4R A;  4HJK A;  5C2T B;  3W2D A;  3PZ8 A;  4XE0 A;  4UDU C;  3VVW B;  1YJ1 A;  4B0E A;  2JZZ A;  2V4L A;  2CS4 A;  4DWF A;  1K51 A;  1FXI A;  1CJE A;  3CWI A;  4CQN A;  4AUQ C;  3SHQ A;  4BKS D;  1VZ8 A;  1SEB D;  4HRO A;  1BUI C;  2JZP A;  4K3B A;  2IY1 B;  4IM3 A;  4WAF A;  2IND C;  2L52 A;  2FCN A;  3UIP B;  3U7Z A;  3AE9 B;  3N9Y C;  4REZ A;  3DVG X;  4KVG B;  4MGK E;  4G0N B;  3C19 A;  1QKZ A;  3KVF B;  1WGD A;  4EZJ A;  4KSL C;  2FBW B;  4C56 C;  1XXG A;  2M4N A;  1GAQ B;  4RF1 A;  3Q3J A;  2WXI A;  4US9 A;  1V5T A;  4WWN A;  1JCK B;  3RNB C;  4WJQ A;  4I6N B;  3L10 B;  2KAN A;  4GMV A;  3P4Q B;  1D3Z A;  1MJD A;  1PDX A;  1RFA A;  3PT2 B;  3TUO A;  1SSN A;  2LGI A; 
#chains in the Genus database with same CATH homology
 5JHA A;  4IWQ A;  3IHP C;  5IAA C;  2W9N A;  4B95 A;  3DOW A;  2DEN B;  3ZLZ A;  3U30 A;  2C7H A;  2AL6 A;  3RT3 B;  2IYD B;  2BYF A;  3NY5 A;  4MEL A;  4G11 A;  3QC8 B;  4W9D A;  2LVO A;  4K81 A;  5D94 A;  2G45 B;  1UD7 A;  4HVB A;  1WX9 A;  4NQK E;  1WGH A;  2ASQ A;  3PRZ A;  2NBU A;  4E3C A;  4F7Z A;  4W9I A;  2BF8 B;  1LQB A;  3JYU A;  1I42 A;  2R2O A;  2D10 A;  3PZD A;  1E8Z A;  2O6V A;  3VXW A;  4GDK A;  4ANV A;  2B3A A;  3RD2 A;  1WGR A;  2LD9 A;  4DK5 A;  1QZE A;  3QK0 A;  1Q0W B;  2EKE C;  3V6C B;  4GOC A;  4BKS A;  4F1S A;  2D3G A;  2KKC A;  2MBQ A;  2FCS A;  4KIK B;  4JQW C;  2M1M A;  5C1Z A;  4HLE A;  3TIX A;  4RM9 A;  4MSM B;  4KV2 A;  3QX1 A;  2KTF A;  2L00 B;  3DCG A;  1WXV A;  4CHK A;  2MQJ A;  5G2N A;  3W1S A;  2PJH A;  3N32 A;  2O2V A;  4B9K A;  2ZVO A;  1KLV A;  1Z5S B;  3WIM A;  4K7S A;  1WRD B;  2D11 A;  3EC8 A;  1WGY A;  3BIN A;  2IBI B;  4FN2 A;  1V9J A;  2PE9 A;  2FID A;  3QHT A;  3PRP B;  5DPT A;  3C0R B;  3B1L X;  2KHW B;  3DBL I;  3Q3F A;  4BBN F;  1UZX B;  3R7Q A;  3HHM A;  2K1F A;  3AUL A;  3ZKJ C;  2DYB A;  2GMI C;  3QAQ A;  2N1V A;  3IG3 A;  5DPS A;  3WAP A;  4XZ4 A;  1V2Y A;  4WJO A;  3A9K B;  2M8S A;  1WJU A;  3IVF A;  3CSF A;  2JUO A;  4GXB A;  3VDZ A;  1OEY J;  5CHF A;  2AYO B;  1AAR A;  3U8Z A;  1L7Y A;  3OJ3 A;  3ZTC A;  2MRP A;  4TKN A;  2LI5 A;  1ISN A;  4PYZ A;  3NS8 A;  1WR6 E;  3WAM A;  4IUM B;  4ZDV A;  3A4S C;  2A4Z A;  3H7S A;  4RM8 A;  4HPL B;  4W9C A;  5FR6 A;  1XQQ A;  1WMH A;  3VUY A;  3APC A;  3M3J A;  3TCA A;  2KDE B;  2LWP A;  4ANX A;  5LXH A;  1V5O A;  2EMT A;  2L76 A;  4AOF A;  2MP2 B;  4HK2 A;  2KC1 A;  2DZK A;  3DBS A;  2M0X A;  4NAW B;  4MGZ E;  2L0T A;  2LUE A;  2MP2 A;  1P3Q U;  3PPA A;  4ASW C;  4M8N A;  1ZGU B;  4A3O A;  1EF5 A;  3OLM D;  3PLV A;  1FXT B;  4P7I A;  4MGY E;  3WAO A;  2O2V B;  4AP4 C;  5AZG A;  4LDT D;  5E6P A;  3H6N A;  4JL9 A;  3PV1 A;  2JF5 A;  2ZCC A;  2V1Y A;  2KWV B;  2O6V D;  3KUC B;  3JW0 X;  4NY0 A;  4TV3 A;  1MG8 A;  2IO1 B;  4IM2 A;  1WJ6 A;  1RLF A;  3ALB A;  5D2M B;  3VH4 B;  1IYF A;  3V61 A;  4GDK B;  5GMV A;  1SE9 A;  2HE7 A;  3KW5 B;  4JLC A;  4W9L A;  3W1Y A;  3ZO5 B;  2J7Q B;  1GNU A;  4MSQ B;  3U7D A;  3APF A;  1E8W A;  4PS7 A;  4DXA B;  2WWZ A;  2V3S A;  1BT0 A;  2K6D B;  3QQ8 B;  3R7R A;  4K7U A;  5LLI A;  2J0M A;  1LXD A;  3DDC B;  2FUH B;  1WX7 A;  3VFK A;  2KTR B;  2QHO A;  3JVZ X;  2IO3 B;  2KXJ A;  2GBK A;  4NQL B;  3VH3 B;  3QWZ B;  4WAA A;  1WXS A;  2JWZ A;  3ZVV A;  4BVU C;  2JT4 B;  1WM3 A;  1YQB A;  3S2A A;  1KJT A;  3TL5 A;  5JHB A;  1TBE A;  5AZF A;  1UEL A;  4OVU A;  2CHX A;  1EF1 A;  4LDT B;  2IY0 B;  2GBR A;  3M95 A;  1E7U A;  2XK5 B;  3EHV A;  4ZRJ A;  3H9D A;  3SD5 A;  4ICU A;  2JRI B;  4K1R B;  4IM0 A;  3AU5 A;  2C60 A;  4HCP B;  3ZNI D;  2N9E B;  2BYE A;  3RUL A;  4ANW A;  3LJ3 A;  4AWJ A;  5DPW A;  3PHW B;  1X1M A;  3SDL C;  4TQ1 A;  4BOS C;  3DBH I;  3A1Q A;  3NZU A;  2I1J A;  3L17 A;  5IA7 A;  2LGX A;  2RSU A;  3L08 A;  3V60 A;  1V80 A;  2Z59 B;  3ONS A;  3P2B A;  4GSW A;  5AEK B;  2LXA A;  2XBB C;  3AI5 A;  1R4N I;  2G4S A;  1WXA A;  4IC7 B;  4CO7 A;  2C9W B;  4J6I A;  4FJY A;  3PSE B;  1V49 A;  2KN5 A;  1YX5 B;  3UIN B;  4EOY A;  1S3S G;  2OJR A;  2KK8 A;  4W9F A;  1PQS A;  3WA0 A;  3NOB A;  3VUX A;  2D2Q A;  4B6W A;  3ZUN A;  1WFY A;  2DX5 B;  3K9O B;  4LCD E;  3L13 A;  2BWF A;  3QIJ A;  4BBN C;  4IWP A;  1WX8 A;  4N9F 4;  1P0R A;  3H7P B;  2K8H A;  4GGQ A;  3W1S C;  1GC6 A;  2KJH B;  3N30 A;  1V6E A;  2KTR A;  3N3K B;  3PGE A;  4HDQ A;  2GOW A;  4YL8 A;  5EDS A;  1G6J A;  2MSE D;  3CST A;  2O6V B;  5KHQ A;  4FHK A;  2KD0 A;  3IBE A;  2MCN B;  3DQV A;  2G3Q B;  1OEY A;  2NR2 A;  4IW0 A;  1JRU A;  2LGY A;  2K39 A;  2YLM A;  1WH3 A;  2JXX A;  2L05 A;  3B08 A;  4GDL A;  1P98 A;  5CX3 A;  1WYW B;  1SIF A;  1VD2 A;  2GBN A;  2MWS B;  4HXD A;  4W9H A;  1LFD A;  3ZNZ B;  2FCM A;  1NBF C;  3B0A A;  1SGH A;  4XC2 A;  2L7R A;  2IO0 B;  3K9P B;  2ZVN A;  4OVV A;  1EUV B;  4BKT A;  4WWP A;  3DBR I;  4II2 B;  4WWO A;  1V86 A;  2D07 B;  4EUT A;  2GBJ A;  4FBJ B;  1V81 A;  3KUD B;  1OQY A;  2IO2 B;  2KDF B;  4I6L B;  2KJ6 A;  2MX2 A;  4BOZ B;  1WE6 A;  5J18 A;  5DPR A;  5BO4 B;  2R2Q A;  2ZJD A;  2LJ5 A;  2YVC A;  2HTH A;  3ZNG C;  2KNB A;  5E6N A;  2KQS A;  3BY4 B;  4FHJ A;  5CHW A;  1WY8 A;  4A20 A;  1WJN A;  3X23 A;  5L95 C;  2KMA A;  1GG3 A;  4KSK C;  3ZDM C;  3ECI A;  3ZRF A;  2REX A;  4FLH A;  4DBG A;  4JIO U;  2PEA A;  1H8C A;  4KDI C;  1E7V A;  2LAS A;  2GBM A;  3VQI A;  4XX5 A;  4G50 A;  1Q1O A;  2VRR B;  2J0K A;  3R66 C;  5D7G A;  2N9X A;  1J8C A;  2LGD A;  2ZNV B;  1E8X A;  2Z0D B;  3PRM B;  1EO6 A;  3RUI B;  3VUW A;  2AWT A;  1TGZ B;  2N1W A;  2K8B A;  4E71 A;  1KM7 A;  3TJP A;  4IG7 B;  5DCN A;  4ZYN A;  4PS3 A;  1WE7 A;  3KYD D;  1J0G A;  1WF9 A;  2WX0 A;  4KZ0 A;  1WZ3 A;  2LZ6 A;  1S1Q B;  4FAD A;  3MJW A;  2ZCB A;  2ZPY A;  3VTV A;  4I6P A;  4NJ6 A;  2MBB B;  2BKR B;  3L54 A;  4MM3 A;  3RCZ A;  4ZRI A;  2MBH A;  3OAW A;  1OGW A;  1XT9 B;  3APD A;  2RD0 A;  5JH5 C;  1P1A A;  3CF6 E;  3DVG Y;  1GC7 A;  1LM8 B;  4HDO A;  3UGB B;  2K6Q A;  2PPH A;  1ZW7 A;  3TMP B;  4II3 B;  2KOX A;  4MEM A;  4TQ0 A;  3PHX B;  1VCB A;  4JGH B;  2KX3 A;  2DZM A;  2N7E A;  4KZC A;  1L2N A;  1M94 A;  2KFK A;  4W9E A;  1GJZ A;  2DHZ A;  2I1K A;  1YX6 B;  2HJ8 A;  2N7D A;  2NPT A;  2C7N B;  3DVN V;  2XK5 A;  4DHJ B;  1NI2 A;  3H7P A;  3HM3 A;  1I35 A;  2M17 A;  3CMM B;  2NS5 A;  4FJV B;  4E74 A;  2JVC A;  4FJZ A;  2ZZP B;  4A3P A;  4BFR A;  3RYT A;  3UQA A;  4MH0 E;  3VHT C;  2NBV B;  2NBW B;  1UBQ A;  1Q5W B;  5E6O A;  1IPG A;  1WIA A;  1WGG A;  3EFU A;  3PLU A;  3VTU A;  1KOT A;  2FIF A;  1Y8R C;  2WX1 A;  4LJO B;  4X57 B;  4HWI B;  2XEW A;  2JY6 A;  3QCA A;  3KH0 A;  2BGF A;  2AEH A;  1GUA B;  4TUU A;  4PS8 A;  1P9D U;  3ZTD A;  3ML8 A;  3ZNH B;  2KO3 A;  1YIW A;  4GB9 A;  3WAN A;  5LXI B;  1Z2M A;  2KDI A;  3X0W A;  3V6E B;  4PYU A;  4IWO A;  3V62 A;  2CKH B;  2BKF A;  1WXM A;  2FCQ A;  2JPH A;  4F8C B;  5J17 A;  4DDG D;  1WM2 A;  4DHZ B;  1R4M I;  4LJP B;  2WDT B;  3ML9 A;  1C1Y B;  2KQ7 A;  3VTW A;  2FAZ A;  2N4F A;  3JSV B;  4MJS B;  4M0W B;  4MJS A;  1T0Y A;  5CTR C;  2KZR A;  2CU1 A;  1WJ4 A;  4ANU A;  3QA8 A;  3QJZ A;  2DZJ A;  2EMS A;  2ZEQ A;  5KHO A;  4EZL A;  5JZE B;  4WQO B;  3A9K A;  3T9L A;  3AXC A;  5CHV C;  2CR5 A;  4ZRK A;  2L3Z A;  2RPQ A;  2K8C A;  1CMX B;  2LRW A;  4M8M A;  4NNJ B;  1A5R A;  3M62 B;  2MBE A;  2LXC A;  2KFJ A;  4W9K A;  2C7M B;  1WI0 A;  1WZ0 A;  3GOE A;  4URK A;  3I3T B;  3A1Q B;  3VAW A;  3A33 B;  2KMC A;  3L16 A;  2Y5B B;  3NHE B;  3L0W B;  2WYQ A;  3PTF C;  2JRH A;  3MHS D;  4RMA A;  3SU8 X;  1WMH B;  2MW5 A;  1H4R A;  3JSV A;  4HJK A;  3A9J B;  3RZF A;  4NJ7 A;  3PVL A;  5AZH A;  3TBL D;  3IFW B;  2KFK B;  3VVW B;  1YJ1 A;  3AU4 A;  3NZS A;  5D6J B;  2N9P C;  2MA9 B;  3M63 B;  1C3T A;  3OJ4 B;  3T8M A;  2JZZ A;  1YD8 U;  2V4L A;  4DHZ E;  4EEW A;  3RZW C;  2L0F A;  2CS4 A;  1WR1 A;  4DWF A;  2DYO A;  2KVR A;  2DYM A;  2JZ3 B;  3UIO B;  4NPN A;  5J2R A;  2CHZ A;  2KC2 A;  3A4R A;  3H1U A;  4G3X B;  2LVQ A;  2NPT B;  3PS6 A;  3MTN B;  4KIK A;  4WJP A;  1HE8 A;  2IZV B;  4AUQ C;  1E90 A;  3GZN I;  3SHQ A;  4BKS D;  4EZK A;  4FA6 A;  5L83 A;  2A5U A;  2OOB B;  2MBO A;  1NDD A;  2CHW A;  2KDB A;  2KWU B;  3PRE A;  4EFO A;  2Z0E B;  4AJW A;  1TZ1 A;  3WAL A;  2IY1 B;  2DAF A;  4FUL A;  1U4A A;  4HCN B;  4IM3 A;  2J0J A;  1XD3 B;  1UGM A;  2FCN A;  2KLC A;  3UIP B;  2BWE S;  2ZNV C;  3ZW3 A;  3O65 B;  4GN1 A;  2HD5 B;  4BKG A;  3D32 A;  1J19 A;  3KUZ A;  4EKU A;  2AL3 A;  3HIZ A;  1E8Y A;  1UBI A;  2DZI A;  2MLB A;  2NCN A;  4CYE A;  2KWC A;  3DVG X;  1IP9 A;  3ENE A;  4KVG B;  3ZDT A;  4DDI D;  4GDL B;  2LRU A;  3R3M A;  4MGK E;  4GU2 A;  4G0N B;  3DPD A;  4W9J A;  4WJN A;  3KVF B;  1WGD A;  4KDL B;  4GIV A;  4KSL C;  4EZJ A;  3KYC D;  2L8J A;  4K7W A;  3ZRC A;  2KX0 A;  1OTR B;  2BYV E;  2M4N A;  3EEC A;  4AJY B;  4ICV A;  3Q3J A;  5C23 A;  3UF8 A;  1K8R B;  1RRB A;  1UH6 A;  2BPS A;  2KJR A;  2ZPN A;  2LVP A;  2PE6 B;  2G4D B;  1RAX A;  1V5T A;  4WWN A;  2RR9 A;  3ZIM A;  3HM6 X;  4WJQ A;  4I6N B;  1F9J A;  4DHJ D;  2UYZ B;  3UQB A;  4HPM B;  5G55 A;  5TR5 A;  3L10 B;  2C5L C;  2DAJ A;  1TTN A;  2KLG A;  3HK0 A;  2KAN A;  4GMV A;  1D3Z A;  4MGI E;  4NAW A;  1RFA A;  2FNJ B;  2UWQ A;  1ZKH A;  4W9G A;  3PT2 B;  5HKH A;  4MDK E;  3A9J A;  3LDZ E;  2K25 A;  1E5W A;  2NVU I;  2RGF A;  3DVN U;  3QAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...