4HJKA

U7ub7 disulfide variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
AMQIFVKCLTGKTNTLEVEPSDTIENVKAKIQDKIGYPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHCVRRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization
rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords Ubiquitin
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hjkA00
2UWQA 1F9JA 3KW5B 4EUTA 2GOWA 3OLMD 1WJNA 3CMMB 2CHZA 3VDZA 2ZVNA 2JUOA 4K7SA 3QWZB 3MTNB 4RMAA 1H8CA 4NAWA 3I3TB 5BO4B 2EMTA 3A33B 1L2NA 3AI5A 4MSMB 1V9JA 1XT9B 1WGHA 1WJ6A 2HD5B 4FN2A 4BKTA 4B95A 2M1MA 4GB9A 4FHKA 4A3PA 2GBKA 2NCNA 3U7DA 2WDTB 2KANA 2CR5A 3L08A 4IM0A 2C7HA 2L8JA 4FBJB 4WJNA 2KNBA 3M63B 1OGWA 2IZVB 2KJ6A 3VAWA 3ONSA 2HJ8A 3RZFA 2RGFA 2G45B 1UBIA 1S1QB 1TTNA 1WM3A 2O6VB 3PSEB 1WE7A 4GDKA 3A9KB 2ZNVB 4NQLB 4A20A 2ZPYA 3OAWA 4FLHA 1Z5SB 4HVBA 1D3ZA 1UBQA 1WXSA 2L3ZA 5IA7A 5E6OA 4MJSB 1V86A 1XD3B 2LVPA 4ZRJA 5LLIA 2WWZA 4FA6A 2MP2A 2K8HA 4IWQA 4KDLB 4TQ1A 1C1YB 3RYTA 1IP9A 1G6JA 2FCMA 1YD8U 3JW0X 2LWPA 2N9EB 3WIMA 2WYQA 2KFJA 3PPAA 1Z2MA 2NBVB 3QA8A 1X1MA 5CHWA 2BKFA 3KUZA 2J7QB 2CS4A 1UD7A 1E8YA 5IAAC 1P1AA 1WR1A 4OVVA 3RUIB 2C7MB 2N1WA 4XC2A 2CHXA 3SHQA 2MQJA 1WX9A 3X0WA 1WJ4A 4WJQA 5EDSA 4BOZB 1V80A 1ZKHA 2BYFA 1UH6A 3DVGX 3IHPC 4IG7B 2OJRA 1VCBA 1C3TA 3EC8A 1WM2A 3PGEA 2KK8A 2LZ6A 3UF8A 3UINB 3B08A 4NAWB 3RD2A 2ZEQA 3ZW3A 1E7UA 2MBQA 2NR2A 4HLEA 1WGDA 2L00B 3NHEB 3A1QA 4F8CB 2I1JA 2KMAA 4TQ0A 2MBBB 2KX3A 3NOBA 3QJZA 3X23A 3APDA 2AWTA 3H7PA 4G11A 4W9GA 4B9KA 4TKNA 4ICVA 4MEMA 3ZRFA 1XQQA 2L7RA 2WX0A 4KDIC 5J18A 3BINA 2BWFA 4GN1A 2LD9A 2AEHA 4II3B 4NPNA 2NS5A 1OTRB 3A4RA 2JPHA 2PJHA 3DBRI 4MGIE 4DDGD 4LJOB 3DPDA 4WWOA 1KJTA 1FXTB 2MA9B 2JZ3B 5G55A 4MGYE 3SU8X 3VVWB 5D7GA 1E7VA 2NPTA 3ZLZA 4RM8A 4KSKC 2RPQA 4KZ0A 3B0AA 1Y8RC 3QX1A 1U4AA 3W1SA 1GNUA 1TGZB 3MJWA 4FJZA 1SIFA 2DZJA 2KMCA 3ZDMC 4ZRIA 1GC7A 1RFAA 4W9LA 4YL8A 2KX0A 4IW0A 3T8MA 4MM3A 4E71A 2BF8B 1EO6A 3APCA 3V61A 2JF5A 4BFRA 3HM6X 3PS6A 4IWOA 5JHBA 2VRRB 2REXA 1WMHA 2NVUI 3AULA 5CHVC 2MBOA 2MSED 1Q5WB 4URKA 2GBRA 4EZJA 2FUHB 3A1QB 4WJPA 1H4RA 2D3GA 2FAZA 2KFKA 4II2B 4RM9A 4GGQA 2UYZB 4DDID 2GBJA 2FNJB 2C60A 2GMIC 2YLMA 1YJ1A 1CMXB 1GG3A 2KXJA 2N4FA 2R2QA 1WGGA 3WAPA 3RULA 2WX1A 3QIJA 1KLVA 2W9NA 3QQ8B 4EKUA 1V49A 2KJRA 4LDTD 3VHTC 5L83A 2ZNVC 2ZJDA 2L0TA 2BGFA 1WF9A 1WXMA 1YQBA 4MELA 4WAAA 4EFOA 5D2MB 2KOXA 1V81A 3GZNI 4IWPA 3LJ3A 4NQKE 2AL6A 3Q3JA 1V6EA 4HCPB 4KSLC 1OEYA 4PS7A 3VH3B 4PYUA 3IBEA 3TIXA 3RCZA 2J0KA 2KHWB 4GXBA 2KTFA 3PREA 2MP2B 1BT0A 2JXXA 2PE9A 4ANXA 4IM3A 2C9WB 2KTRA 3PLVA 4M8NA 4AJWA 4P7IA 3NS8A 2DHZA 3ML8A 3JVZX 4XX5A 2FIFA 4HDOA 5AEKB 3QARA 4BBNC 2KWCA 3S2AA 1ZW7A 2IO3B 1I35A 1LQBA 4ZRKA 3ZVVA 2DZIA 4GIVA 3V62A 1WMHB 4LCDE 4DXAB 3PTFC 2PPHA 5JHAA 2KWVB 2GBMA 4DHZE 4PYZA 4EEWA 5LXIB 2DYOA 5HKHA 2KZRA 5KHQA 3H7PB 2L05A 1KM7A 3H9DA 3KYCD 1MG8A 3V6EB 3ZDTA 1RAXA 4IM2A 3W1YA 3CSFA 1WXAA 4F7ZA 1WH3A 2DAFA 2D11A 2K8BA 3K9PB 4KV2A 4WWPA 4HXDA 1J0GA 2NPTB 4W9DA 3M62B 1SE9A 2DAJA 1GC6A 1WXVA 2IO1B 3EHVA 2IBIB 3A9JA 4DWFA 2LXCA 3ZKJC 2AYOB 4HDQA 4ANWA 1K8RB 1E8XA 1E90A 2K8CA 2A5UA 2G4SA 4MSQB 5AZGA 5AZHA 3ZO5B 2JY6A 2L0FA 4HPMB 4JL9A 2KC1A 1WYWB 2V4LA 1P9DU 3PV1A 4E3CA 1TBEA 4BOSC 1P0RA 4HWIB 2K6QA 1PQSA 3OJ4B 4PS8A 2JZZA 3K9OB 4HJKA 2CHWA 1V5TA 3RT3B 4W9IA 5L95C 2KQ7A 1P3QU 4WJOA 3T9LA 1OEYJ 1YIWA 2ASQA 2EMSA 3CF6E 2JRHA 2LVOA 5JH5C 4ANVA 1GUAB 2G4DB 2IYDB 3C0RB 2LASA 3DCGA 4NJ7A 3L13A 2J0MA 3A9JB 3PRMB 2QHOA 3VFKA 4I6PA 2MCNB 2JRIB 3DBLI 1WJUA 2BYEA 1SGHA 3OJ3A 3JSVA 1IYFA 4KIKB 1V2YA 3ZRCA 2OOBB 1WR6E 2LGYA 3A9KA 4X57B 4G0NB 4M8MA 3L17A 4EOYA 5J2RA 3KH0A 4NJ6A 1NI2A 3QC8B 2XBBC 4GOCA 4ZDVA 4K1RB 3GOEA 2K25A 2FCSA 1TZ1A 1NBFC 2O6VD 3ENEA 4B6WA 2MX2A 1J8CA 1WGRA 2KJHB 2O2VB 4EZLA 5KHOA 1E8WA 2MLBA 2LRWA 4AWJA 4NY0A 3TJPA 2N9PC 1WGYA 2L76A 4TUUA 3PVLA 3R3MA 4DHZB 4A3OA 3V60A 3UIOB 4MGKE 4MH0E 3U30A 3AU4A 4GSWA 3ZIMA 2Z0EB 4W9HA 3TMPB 1UGMA 4WWNA 1IPGA 1J19A 3PT2B 3IFWB 3Q3FA 4K7UA 3QHTA 2IY0B 2BKRB 3TL5A 3W1SC 1GJZA 4F1SA 4I6LB 2KQSA 2N7DA 3DDCB 2K39A 2D10A 4CYEA 2O6VA 4GDKB 3VUWA 2ZVOA 3WANA 4W9CA 3A4SC 3L0WB 3L54A 2AL3A 3QAQA 1UZXB 2LUEA 1WI0A 2G3QB 3WA0A 2LRUA 1YX6B 3DBHI 3DOWA 2KDFB 5D6JB 4NNJB 5G2NA 3ZNHB 2KKCA 2CU1A 4KZCA 1WZ0A 5CHFA 3VTUA 2C5LC 4ANUA 2BWES 3VH4B 4FJYA 2DX5B 2JVCA 4MGZE 2XK5B 3PRZA 3PHXB 2MW5A 3DVNV 4JQWC 5DPTA 1LFDA 3QCAA 1S3SG 4IC7B 4IUMB 3ZNID 1EF5A 2NBWB 4GMVA 3AU5A 5E6PA 1R4MI 4M0WB 1RRBA 5DPSA 4LJPB 4BKGA 3H6NA 1M94A 1LXDA 2KD0A 2K6DB 1Q1OA 3N3KB 5FR6A 4WQOB 4E74A 1NDDA 5D94A 3TBLD 3VXWA 1QZEA 3NY5A 4ICUA 3ZUNA 1WIAA 3NZUA 2KVRA 2GBNA 3B1LX 4ZYNA 2IY1B 3PHWB 2LXAA 1HE8A 3U8ZA 3ZNGC 2FIDA 3VTWA 2KTRB 3ML9A 2KDEB 5DPRA 2M0XA 4KIKA 3EFUA 4KVGB 1WE6A 2KDIA 1VD2A 3HHMA 2RSUA 3L16A 5GMVA 3KUDB 2J0JA 2N7EA 4W9FA 3IG3A 2IO2B 2RD0A 3ECIA 2M4NA 1UELA 1R4NI 2EKEC 3CSTA 2BYVE 4K7WA 4MJSA 5CTRC 3WAOA 4TV3A 2A4ZA 4G3XB 3R66C 2D2QA 3P2BA 2R2OA 3H7SA 2KDBA 2ZZPB 5JZEB 5J17A 2LVQA 2D07B 2Y5BB 3M95A 2MWSB 3PZDA 4AUQC 3KUCB 4DBGA 1I42A 5LXHA 3WAMA 1ZGUB 2RR9A 3PLUA 2PE6B 2MBEA 2FCNA 4HPLB 1E8ZA 2KN5A 1V5OA 2V1YA 1ISNA 2Z0DB 1L7YA 2JWZA 4MDKE 3WALA 3N30A 1T0YA 3HIZA 5E6NA 2JT4B 2NBUA 2LGDA 3ALBA 3L10B 4J6IA 2DZKA 1WX8A 4GDLB 5TR5A 4HCNB 4FJVB 1JRUA 3VUYA 1A5RA 4W9JA 4JLCA 2LGXA 2Z59B 3DBSA 2HE7A 1WY8A 2N1VA 5C1ZA 3MHSD 4AJYB 4PS3A 2MBHA 2BPSA 4OVUA 2KFKB 2HTHA 3DQVA 4W9KA 2DYMA 2KO3A 3UGBB 4I6NB 3QK0A 3VUXA 3AXCA 4BBNF 4GDLA 4W9EA 1WZ3A 3ZNZB 4CO7A 1WX7A 4BKSD 4JIOU 3LDZE 1KOTA 5C23A 3JYUA 4FADA 3SDLC 3KYDD 2M8SA 2O2VA 3DVNU 4K81A 4N9F4 1OQYA 3ZTCA 4GU2A 4AOFA 3UQAA 1P98A 2CKHB 2MRPA 4AP4C 4EZKA 2FCQA 3VTVA 1AARA 2LI5A 1E5WA 4JGHB 4ASWC 2XEWA 2IO0B 4BVUC 2C7NB 2ZCBA 3JSVB 3DVGY 3H1UA 4DHJD 5DPWA 2M17A 2V3SA 3APFA 3R7QA 3IVFA 3EECA 4XZ4A 4FULA 5DCNA 3TCAA 5AZFA 2I1KA 4FHJA 2DYBA 1EF1A 1EUVB 1Q0WB 3NZSA 1RLFA 3HK0A 2ZCCA 4HK2A 3VQIA 1WFYA 2K1FA 4CHKA 3M3JA 3UQBA 3V6CB 2KWUB 5CX3A 3R7RA 2DENB 3HM3A 2KLGA 3KVFB 3SD5A 2PEAA 3O65B 3D32A 2ZPNA 4BKSA 1WRDB 3ZTDA 3RZWC 2N9XA 1LM8B 2KLCA 3UIPB 1YX5B 4G50A 3BY4B 3N32A 2B3AA 4DHJB 3PRPB 4LDTB 2DZMA 4DK5A 2YVCA 2XK5A 2KC2A 2LJ5A
chains in the Genus database with same CATH superfamily
3B2GA 4XE0A 4XWWA 1F9JA 3KW5B 4EUTA 2GOWA 3OLMD 4QAYA 1QT9A 1HTOA 2B76B 1V1OA 1TT5B 4K7SA 2EMTA 3A33B 1XT9B 2HD5B 2JQRB 1E6EB 2M1MA 4GB9A 4IM0A 3NVWA 3U7ZA 1AN8A 4FBJB 2KNBA 3M63B 1OGWA 3VAWA 2VH1A 1S1QB 2O6VB 1QOAA 4GDKA 3VR8B 2ZNVB 2ZPYA 4P1BC 5I4DA 1Z5SB 3Q8FA 5IA7A 4FA6A 3BK2A 4HKQA 2WHIA 1C1YB 1L6UA 3JW0X 3WIMA 2WYQA 2KFJA 3QA8A 2BKFA 3KUZA 2J7QB 1J7AA 2J42A 1WRIA 1UD7A 1WR1A 4XC2A 2MQJA 4RGNA 1WJ4A 5EDSA 2BYFA 4REZA 4IG7B 2OJRA 1GPXA 1WYGA 3PGEA 2KK8A 3UF8A 2L52A 1UF0A 2WNMA 2BW2A 4MT5A 2MBQA 4M02A 2CJNA 2NR2A 2D3AA 1WGDA 1L4DB 3NHEB 2NTSA 4F8CB 2KMMA 1ACCA 3NOBA 4TKNA 3W5VB 4ZRPA 3MC0B 4KDIC 4GN1A 2DLBA 4LJOB 4C7ZA 2WXGA 2BBCA 4LTUA 3VVWB 5D7GA 1D4BA 2FUG1 4YSZB 4KZ0A 1K53A 4ARCA 3KQ4A 3QX1A 3DWMA 1YN3A 4FJZA 4AQ7A 4ZRIA 1GC7A 4YL8A 3MFGA 4IW0A 1QKZA 4MM3A 4E71A 2BF8B 1EO6A 3APCA 3HM6X 3PS6A 4S0RA 1WMHA 3N1XC 1MPEA 2BS2B 1T5XD 4ARIA 3A1QB 4II2B 2KFKA 3H8HA 1DOXA 2UYZB 1D5XC 1F52A 5HG2A 2YLMA 1YJ1A 1GOZA 2VZKB 3WAPA 3RULA 3T3NA 1TY2A 5L83A 2KJRA 5D3DA 2L0TA 4MELA 2WLBA 2J53A 2PMVA 2KOXA 1V81A 3OWEB 4XDDA 3FKYA 3VH3B 4PYUA 3IBEA 3RCZA 4GXBA 3PREA 2MP2B 2KTRA 2IGHA 3ML8A 3JVZX 3NG0A 4HDOA 2V3PA 2XNAC 2IO3B 3RNCC 2ACZB 2DZIA 3PTFC 2PPHA 5TSSA 2R61A 3V6EB 3NS1A 1ZP0B 1RAXA 4L23A 3W1YA 3CSFA 4F7ZA 1WH3A 2DAFA 2D11A 1J0GA 4HXDA 4YTMB 2IO1B 4DWFA 2OHFA 1HQRD 4HDQA 2NMQA 1E8XA 1E90A 2K8CA 4MSQB 5AZHA 2JY6A 2WXQA 4HPMB 3HUIA 4JL9A 2ON8A 1L0XB 4E3CA 1TS2A 4PS8A 2JZZA 3AECB 1LGRA 1MHHE 1R4MB 3T9LA 1VJKA 4H2AA 1YIWA 2ASQA 2L32A 3AN1A 1MG4A 2LASA 1IGCA 2J0MA 2QHOA 4US8A 1WJUA 1SGHA 3OJ3A 5FK9C 2WXFA 3C8YA 4HKZE 3A9KA 5J2RA 3KH0A 5H92C 2N0SB 5IP4D 1XXGA 2K25A 2FCSA 3ENEA 2MX2A 5H8YE 1J8CA 2KJHB 4AWJA 4TUUA 3PZ8A 4MGKE 3U30A 3AU4A 2LUMA 1F2RI 2AQ1B 3RFZB 1IBXA 2L83A 1XEEA 3WANA 3L54A 2AL3A 2WXJA 2LFIA 3RPFC 2HJ1A 2LRUA 1YX6B 2WXHA 3DOWA 2VZKD 5D6JB 3DBHB 3AH7A 1V1PB 2KKCA 3VTUA 2JX5A 2BWES 1P7FA 4FJYA 1ET6A 4TSSA 2G1EA 5DPTA 1S3SG 3RNEC 2WGSA 1EF5A 2XN9C 4OZAA 1RFKA 4P1CC 2KD0A 3SEBA 1FXIA 1NDDA 1NYRA 2GBNA 4RF0A 3B1LX 4ZYNA 1MVKA 3ZNGC 3U8ZA 3ML9A 1ZXHA 4UDUC 3GE8C 1VD2A 4OZBA 1SE4A 2J0JA 2N7EA 4MJSA 5IOIA 3CSTA 4TV3A 1NYQA 1FRDA 3R8BA 2LEKA 3Q6BA 1EU3A 2Y5BB 4AUQC 1TIFA 1ZGUB 2RR9A 1CZPA 2MBEA 1V5OA 1SJHD 2JWZA 1YJJA 2WXLA 5E6NA 3ALBA 3L10B 4J6IA 5G5HA 1EM7A 1A5RA 4W9JA 4JLCA 4LLGM 1WY8A 2GLSA 2N1VA 3EA6A 1ESFA 3Q3MC 4OVUA 2KFKB 2KO3A 3VUXA 4W9EA 4JIOU 3LDZE 4YXDB 2M8SA 3DVNU 4K81A 4N9F4 4PK1A 3ZYYX 4AOFA 2CKHB 2MRPA 4AP4C 2FCQA 4ASWC 2LI5A 1E5WA 1ZOYB 4XYCA 2C7NB 3EFCA 3JSVB 5DPWA 2M17A 2AQ3B 1GB1A 3AEGB 3M3JA 3UQBA 1VZ7A 2DENB 3P42A 2Z8LA 3RNBC 2BYTA 4BKSA 1ZPSA 1WRDB 3ZTDA 1LM8B 1YX5B 4G50A 3ZXVA 3N32A 3PRPB 1ZXIA 5AUIA 3I57A 3HVDA 2I38A 3PZ7A 4GLSC 4BKTA 2UWQA 4ACFA 3P63A 2CHZA 2WQYB 5D3IB 3I3TB 3AI5A 1V9JA 3BWUD 5C3JB 4FN2A 1EWCA 3ZXRA 2WDTB 2KANA 3L08A 2C7HA 4S17A 2HJ8A 4XDCA 1UBIA 1TTNA 3BYTB 1WE7A 1YN4A 1M4VA 1D3ZA 3OAWA 2L3ZA 2BTEA 1XD3B 5HKHA 2WWZA 1IP9A 1G6JA 2K8HA 2LWPA 3AMZA 1E7PB 2G9HD 1K50A 2RMMA 4HROA 1I7HA 4OVVA 2CHXA 5T8IA 4N6EB 4BOZB 1UH6A 2HTME 1VCBA 1PGAA 4BZAA 2ZEQA 3ZW3A 1L4ZB 4KKJA 2ZW0A 1FCCC 2KMAA 4TQ0A 2KX3A 3QJZA 3APDA 3P4RB 4G11A 3N1YC 4W9GA 1AYFA 2GRIA 1YOVB 2WDVB 5J18A 2LD9A 1CK1A 3A4RA 2JPHA 4R3DA 1FNVA 2PJHA 3DHHC 4MGIE 3NUHB 4WWOA 3Q8BA 1KJTA 1FXTB 1J7BA 4DXGA 4MGYE 4YWGG 4B0MA 1D6EC 4IOIE 4BAXA 2RPQA 1T3QA 1U4AA 1TGZB 1N60A 1QOGA 3ZDMC 1RFAA 4W9LA 2M0AA 2KX0A 2QIEB 3V61A 1YQ3B 3VR9B 2N9KA 4BFRA 2VRRB 3AULA 2NVUI 5CHVC 2MBOA 2MSED 2BS4B 3BK1A 4WH4A 2GBRA 4EZJA 2D3GA 4GGQA 1XO3A 3BIID 2GBJA 3DHIC 2C60A 1T0QC 3TEWA 2W3SA 1GG3A 2R2QA 1WGGA 3RI7C 2QSDA 2BGFA 1WXMA 1YQBA 4L2YA 4WAAA 4EFOA 3N1ZC 3GZNI 5IN7A 3ZJVA 4NQKE 1XCQL 3W2DA 4B0EA 4J3OD 3IXSA 2JXXA 4ANXA 2Q5WD 2C9WB 2DHZA 2GB1A 5AEKB 3AE5B 2KWCA 3S2AA 1ZW7A 2X8XX 1LQBA 4ZRKA 3B9JA 1WMHB 4LCDE 2KWVB 2GBMA 1UUPA 3I5JC 3H7PB 4L1BA 1MG8A 4WAFA 3ZDTA 5IKCM 1WXAA 3FAHA 4XGAB 2K8BA 4KV2A 4WWPA 2WXKA 4W9DA 3A9JA 1N5WA 2LXCA 1UWMA 1K8RB 1TYGB 3ZO5B 1V8CA 2QDFA 1P9DU 2IJ0A 4BOSC 1P0RA 3OJ4B 2BT6A 1V5TA 3RT3B 5L95C 4WQMA 5BMHA 1JWAD 2FE8A 2QMTA 3CF6E 2JRHA 1HZ5A 4ANVA 4HRSA 4CQNA 4NJ7A 2KDMA 4YSXB 3A9JB 4I6PA 2MCNB 2JRIB 1SB3C 3AE4B 3JSVA 1V2YA 2EELA 3NVZA 2OOBB 1KLGD 1WR6E 1VR9A 4M8MA 4NJ6A 3AB5A 3U52E 4ZDVA 4GOCA 2SAKA 4K1RB 2MEKA 1TZ1A 1NBFC 1YMHE 2BB5A 4B6WA 2PLPA 1WGRA 2O2VB 4EZLA 5KHOA 2N9PC 1E0ZA 4A3OA 3V60A 5HI1A 1L0YB 4NAMA 2CJOA 3AE8B 4KGTA 3IFWB 3RN9C 1QILA 2BKRB 1GJZA 4F1SA 2ZW1A 4I6LB 3AM9A 2K39A 2O6VA 4GDKB 3RNGC 2ZVOA 3VUWA 3A4SC 1YQ4B 1UZXB 1RYJA 1WI0A 1WWTA 1K51A 2W3RA 3TEZA 1F2RC 2SEBD 3WA0A 3AE1B 2KDFB 3NVVA 4NNJB 1WGKA 3DHGC 1WZ0A 2E6XA 5CHFA 3HVZA 4KGRA 3DBLB 3PHXB 5FR3A 4JQWC 1L6VA 3LXFA 2NBWB 4GMVA 5BMIA 4M0WB 1RRBA 1OQRA 5DPSA 2W82A 3H6NA 1M94A 1YNTE 4P6VF 4RGTA 4E74A 5D94A 1MJDA 3TBLD 3NY5A 3ZUNA 1FPYA 3NZUA 2KVRA 2KACA 2IY1B 2LXAA 1HE8A 2FIDA 2WU2B 3VTWA 2KDEB 2M0XA 4WWMA 3AE9B 4WURA 2K9XA 2KDIA 2RSUA 1I4PA 1V1PA 3CWIA 3TMPB 3IG3A 2M4NA 2EKEC 1R4NI 3WAOA 4K7WA 4D2KA 2KYWA 2KDBA 5JZEB 5J17A 2LVQA 3M95A 2E3TA 5LXHA 3PLUA 2FCNA 1FNWA 1E8ZA 2KN5A 1ISNA 1IBXB 1SSNA 4K3BA 1T0YA 1TS4A 4LK0M 3RNFC 4HCNB 3P4PB 3P4SB 3AV8A 3MC8A 2Z59B 5MPOA 2MH7A 4AJYB 1D5ZC 1HZ6A 3DBRB 2BPSA 1HXYD 3N20C 1SBBB 2HTHA 4I6NB 3FILB 3QK0A 1B9RA 2INDC 1KOTA 5C23A 1FRRA 4FADA 3SDLC 4OVZA 2O2VA 1OQYA 4EZKA 3VTVA 3H1UA 2V3SA 1N61A 3Q8EA 1NEKB 1T6BX 3EECA 3IVFA 4XZ4A 2I1KA 5BYRA 3NJTA 1RLFA 1HEZE 4HPPA 4CHKA 2KWUB 3R7RA 1UNSA 5LNK1 1FXAA 3Q2AC 3SD5A 1FO4A 1SE3A 3O65B 3D32A 2AX5A 1PDXA 3RZWC 1TS5A 2N9XA 2KLCA 2B3AA 2MJ3A 2DZMA 4DK5A 3Q8AA 4A90A 2IGDA 2UU7A 1WJNA 3CMMB 2BS3B 3MTNB 4RMAA 2QC8A 3HRDD 1H8CA 4NAWA 1TY0A 4MH8A 4YT0B 1WJ6A 4A3PA 1E9MA 3U7DA 4KKIA 2L8JA 4OW0A 2K22A 4WJNA 4M01A 4US9A 3ONSA 3RZFA 1QF6A 4NQLB 4KGSA 3TEXA 3PSEB 4A20A 4FLHA 4HVBA 1UBQA 1WXSA 3SFEB 4MJSB 2LVPA 4ZRJA 5LLIA 5AUKA 2MP2A 1I4GA 2DWQA 4KDLB 4TQ1A 3RYTA 3LB8C 1YD8U 2N9EB 4RGMA 3PPAA 2NBVB 5CHWA 1X1MA 1BUIC 4ZOHC 2MJEA 4OHJA 4TMAB 2INCC 1E8YA 5IAAC 3RUIB 2C7MB 1MHXA 4PT5A 1WX9A 1MI0A 4WJQA 1V80A 3DVGX 2RDHA 3EC8A 2LMCA 3UINB 3B08A 4NAWB 2M56B 1E7UA 2WXIA 3SR6A 1XLNA 4M00A 4HLEA 2L00B 3EUB2 2FBWB 2I1JA 1FD6A 3E9SA 1K52A 1J7CA 3DWGC 1C79A 4C80A 2AWTA 3H7PA 3KWVA 4B9KA 4ICVA 2L7RA 3BINA 4II3B 2NS5A 1OTRB 1YJIA 3DBRI 4O1NA 4DDGD 1ZE3D 2JZPA 2QILA 1FIQA 1N63A 4AS1A 2CU3A 2MA9B 5G55A 1DGJA 2GI9A 2KWDA 1E7VA 2NPTA 1CQVA 1Y8RC 2WDQB 1BXTA 1GNUA 3OG5A 3MC9A 2KMCA 4FXCA 3R2IA 3FC4A 1KF6B 1ZDVA 2N9LA 2JF5A 4IWOA 1V97A 4URKA 4WJPA 2FAZA 4RM9A 2KT7A 4A8XC 4DDID 2PKOA 3TUOA 2FNJB 1MFWA 2PW9A 2RPVA 2WXMA 3V3XA 2N4FA 3GS2A 2J52A 2WX1A 2W9NA 3QQ8B 4EKUA 1V49A 3Q14C 1TS3A 1WF9A 1JWUD 5D2MB 4JX1C 4IWPA 2AL6A 3Q3JA 1V6EA 2QEJC 1ROEA 5BYQA 4LNFA 3TIXA 2KHWB 2JU6X 2DBYA 4USAA 4IM3A 2V4IB 4M8NA 4AJWA 4P7IA 3NS8A 4N59A 4XX5A 4BBNC 5HHDG 4JPSA 1I35A 4DXAB 3V62A 3GB1A 4DHZE 3AEDB 4M0WA 2DYOA 5KHQA 1VLBA 4N58A 1KM7A 3H9DA 4IM2A 1KLUD 1GAQB 3K9PB 2Y3AA 1QLBB 4JE3B 5C2TB 1WXVA 3EHVA 2IBIB 4C00A 3ZKJC 2AYOB 4ANWA 3KLSX 2KC1A 1WYWB 3PV1A 5G5GA 3BVGA 4HWIB 2K6QA 3K9OB 2ONQA 4HJKA 2CHWA 4DXFA 4W9IA 1P3QU 4WJOA 1OEYJ 1L5PA 2EMSA 5JH5C 3DCGA 3PRMB 1VDVA 1IYFA 2V9HA 2LGYA 4X57B 1ET9A 2V0GA 4C7YA 1TKEA 1NI2A 3V05A 3GOEA 2V3NA 4LNNA 2O6VD 1N5XA 3ZJUA 2MLBA 2LRWA 4LNKA 3TJPA 3IAM1 1WGYA 2LGIA 3PVLA 3R3MA 3UIOB 1CJEA 2JYTA 1N62A 1UGMA 1IPGA 1J19A 3PT2B 3IAS1 3QHTA 2IY0B 1ZDXA 4IDIA 3TL5A 3W1SC 1WXQA 2KQSA 2N7DA 2ICIA 3DDCB 2D10A 4CYEA 4JWSC 3TEYA 4W9CA 1SF0A 3N9YC 2WP9B 1FMAD 3B2FA 2KQ4X 2LUEA 1B1ZA 2PVGC 2K5PA 1PGBA 3ZNHB 1DOIA 2CU1A 3AE2B 2DX5B 2H89B 4MGZE 2XK5B 5HFYA 3DVNV 1LFDA 4IUMB 1FM0D 1C77A 1RWSA 3ZNID 1UGJA 1R4MI 4LJPB 2D3BA 2K6DB 1T0SC 1NENB 4WQOB 3VXWA 1WIAA 4HJGE 4RGOS 1P7EA 3PHWB 3AEBB 4KIKA 3EFUA 1WE6A 3L16A 5GMVA 3KUDB 1XF5L 3UI3A 1VZ6A 1AW7A 3R66C 1QOBA 2ZZPB 3U4EG 4EE2A 3KUCB 1RM6C 4ZHOA 2V1YA 2JXTA 1L7YA 4ZHPA 4MDKE 3N30A 2JT4B 4K3CA 2NBUA 1OFFA 1VRAB 1WX8A 4GDLB 5TR5A 4FJVB 3IT4B 3VUYA 2LGXA 3DBSA 5EE3A 1SJED 2X38A 4YTPB 3MHZA 2MBHA 3J9CA 1PUTA 2DYMA 1I42A 3UGBB 3AXCA 4BBNF 4GDLA 1VZ8A 1WZ3A 3ZNZB 1WX7A 4BKSD 3JYUA 3KYDD 1I4HA 3ZTCA 4GU2A 3W9CB 1R7SA 3FILA 1AARA 1EWYC 3ABVB 2IO0B 4ITKA 3R7QA 1JMLA 4FULA 5DCNA 3TCAA 5AZFA 4FHJA 1EU4A 2DYBA 5JXVA 1EF1A 3NZSA 3HK0A 3VQIA 3NVYA 2RDBC 2KLGA 2DNFA 2ZPNA 4ZYSA 1KFYB 3UIPB 4LDTB 3O13A 2XK5A 2LJ5A 2KVZA 2WXPA 2KN4A 3VDZA 2ZVNA 2JUOA 1SE2A 2LGSA 3QWZB 5BO4B 1L2NA 3CIRB 4MSMB 1I4XA 1WGHA 4B95A 1LO5D 1KTKA 4FHKA 2GBKA 1SEBD 2NCNA 2CR5A 1XLPA 2K3UA 3BZDB 2IZVB 2KJ6A 1XLOA 2WS3B 2RGFA 3Q3OC 2G45B 1WM3A 1R4NB 5E6JA 3A9KB 5IO9A 1AWDA 5E6OA 1V86A 4IWQA 2M19A 2FCMA 1ZUD2 1DYQA 3T3OA 1Z2MA 2CS4A 1F0ZA 1YN5A 2HDEA 1P1AA 2N1WA 3I9V1 3SHQA 3ZGZA 1HTQA 3X0WA 1ZKHA 3SFDB 1IGDA 3IHPC 1QOFA 3R2TA 1C3TA 1WM2A 2LZ6A 1Y56A 3RD2A 3ZQ4A 1C76A 2KAJA 3A1QA 1KH0A 2MBBB 3X23A 4MEMA 3ZRFA 1XQQA 5EE9A 2WX0A 1I4RA 2WDRB 2BWFA 2AEHA 4NPNA 4Q2JA 3AE7B 3DPDA 1TKGA 2JWUA 1HA5A 2JZ3B 1C4AA 1C4CA 3SU8X 3I63C 3ZLZA 4RM8A 4RNAA 4KSKC 2JSVX 3AEAB 2WXNA 3B0AA 3W1SA 3MJWA 1SIFA 2DZJA 2QJLA 1JWSD 1A70A 3T8MA 3URYA 5JHBA 2REXA 4A6QA 3VRBB 2TSSA 3KWLA 1Q5WB 2FUHB 1H4RA 2BB6A 1JQ4A 2JYEA 2GMIC 4OZCA 1CMXB 3MJ5A 2KXJA 2PVOD 3IT6B 3QIJA 1KLVA 4LDTD 3VHTC 2YEPF 2ZNVC 4A55A 2ZJDA 2IGGA 4MM3B 3WCQA 4RF1A 3NRZA 3LJ3A 4HEA1 3BVZA 2LJIA 4HCPB 1FNUA 4KSLC 1OEYA 4PS7A 3LYYA 3RNAC 2J0KA 2KTFA 1XCTL 1BT0A 2PE9A 3PLVA 2FIFA 2BVCA 3QARA 2NTTA 3ZVVA 4GIVA 2IDYA 2Y5PA 2N7JA 5JHAA 2LHDA 4PYZA 3AE3B 4ZRQA 4EEWA 5LXIB 2KZRA 2L05A 1FEHA 3KYCD 1C78A 3VRAB 2LHEA 4XWTA 3Q3NC 2NPTB 1IUEA 3M62B 1SE9A 2DAJA 1GC6A 3Q8CA 5BMGA 1PFDA 2A5UA 2G4SA 5AZGA 2L0FA 2V4LA 1D5MC 3E56A 4IKGA 4P16A 1TBEA 3U2SC 1PQSA 2INNE 2Y5CA 1KRHA 2KQ7A 3ETRA 1XLQA 5EE0A 4JWUC 2W55A 2LVOA 1GUAB 2G4DB 1STEA 2IYDB 3C0RB 2BQQA 3L13A 1QQRA 3TSSA 2AQ2B 3Q69A 3VFKA 5EE1A 3DBLI 1E10A 2BYEA 4KIKB 3ZRCA 2WXRA 1JCKB 1FCLA 1JW9D 1NI3A 2QCZA 4G0NB 3L17A 4EOYA 4NJCA 1WSPA 3QC8B 4C4VB 2XBBC 1BMLC 1TZOA 1E8WA 1SXTA 4NY0A 3L4PA 2L76A 4DHZB 1JWMD 3GP7A 2OEDA 2VH2A 4MH0E 1JALA 4GSWA 3ZIMA 1F1HA 2Z0EB 4W9HA 4WWNA 3AE6B 3Q3FA 4K7UA 4NZLB 2EKIA 1C4PA 3C19A 3MP9A 1L0VB 1Q10A 1PYWD 3L0WB 2WXOA 2IPKD 3P4QB 3QAQA 2K0PA 2G3QB 4RH6A 4A9AA 1JROA 1I4QA 3ZJTA 3DBHI 4YTNB 5BYSA 5G2NA 2WU5B 2I2YA 4KZCA 2C5LC 4ANUA 1GB4A 3VH4B 2JVCA 3PRZA 2MW5A 1ENFA 3P1MA 3QCAA 4IC7B 1JWBD 5FKAC 3AU5A 4KX6B 5E6PA 3RMKC 4RCOA 1TJEA 1FFVA 4BKGA 1LXDA 1Q1OA 2D5GA 3N3KB 5FR6A 1QZEA 4ICUA 2KTRB 5DPRA 4MACA 3PO0A 4KVGB 4RFBA 3HHMA 2PTLA 4W9FA 1UWXA 2IO2B 2RD0A 3ECIA 1UELA 2BYVE 5CTRC 4LNIA 2A4ZA 4G3XB 2D2QA 3P2BA 2R2OA 3H7SA 2D07B 1DOYA 2MWSB 2W54A 3PZDA 4DBGA 3WAMA 2PE6B 4HPLB 2Z0DB 3WALA 3HIZA 3AEFB 2LGDA 1FFUA 2DZKA 1T0RC 2H88B 1JRUA 2RDGA 2YEPB 1PGXA 3GE3C 2HE7A 2PIAA 5C1ZA 3AEEB 3MHSD 4PS3A 3DQVA 2OJWA 4W9KA 4LNOA 2INPE 1OQQA 2MJDA 3GZNB 3UQAA 1P98A 4C4VA 4JGHB 2XEWA 4BVUC 2ZCBA 3DVGY 2D3CA 3NZ3A 1C9FA 4DHJD 4WIPA 2J4XA 3APFA 4C56C 4YSYB 1TKYA 3BYYB 1EUVB 1Q0WB 4HK2A 2ZCCA 1WFYA 2K1FA 3V6CB 5CX3A 3W5UB 3HM3A 3KVFB 2PEAA 5GXGB 4DQOC 3EGRA 1N6ZA 1F77A 4DHJB 3BVMA 3BY4B 2L1AA 2MHJA 1NVID 1JRPA 2YVCA 1SIJA 2KC2A 4CO7A
chains in the Genus database with same CATH topology
2UWQA 1F9JA 3KW5B 4EUTA 2GOWA 3OLMD 1WJNA 3CMMB 2CHZA 3VDZA 2ZVNA 2JUOA 4K7SA 3QWZB 3MTNB 4RMAA 1H8CA 4NAWA 3I3TB 5BO4B 2EMTA 3A33B 1L2NA 3AI5A 4MSMB 1V9JA 1XT9B 1WGHA 1WJ6A 2HD5B 4FN2A 4BKTA 4B95A 2M1MA 4GB9A 4FHKA 4A3PA 2GBKA 2NCNA 3U7DA 2WDTB 2KANA 2CR5A 3L08A 4IM0A 2C7HA 2L8JA 4FBJB 4WJNA 2KNBA 3M63B 1OGWA 2IZVB 2KJ6A 3VAWA 3ONSA 2HJ8A 3RZFA 2RGFA 2G45B 1UBIA 1S1QB 1TTNA 1WM3A 2O6VB 3PSEB 1WE7A 4GDKA 3A9KB 2ZNVB 4NQLB 4A20A 2ZPYA 3OAWA 4FLHA 1Z5SB 4HVBA 1D3ZA 1UBQA 1WXSA 2L3ZA 5IA7A 5E6OA 4MJSB 1V86A 1XD3B 2LVPA 4ZRJA 5LLIA 2WWZA 4FA6A 2MP2A 2K8HA 4IWQA 4KDLB 4TQ1A 1C1YB 3RYTA 1IP9A 1G6JA 2FCMA 1YD8U 3JW0X 2LWPA 2N9EB 3WIMA 2WYQA 2KFJA 3PPAA 1Z2MA 2NBVB 3QA8A 1X1MA 5CHWA 2BKFA 3KUZA 2J7QB 2CS4A 1UD7A 1E8YA 5IAAC 1P1AA 1WR1A 4OVVA 3RUIB 2C7MB 2N1WA 4XC2A 2CHXA 3SHQA 2MQJA 1WX9A 3X0WA 1WJ4A 4WJQA 5EDSA 4BOZB 1V80A 1ZKHA 2BYFA 1UH6A 3DVGX 3IHPC 4IG7B 2OJRA 1VCBA 1C3TA 3EC8A 1WM2A 3PGEA 2KK8A 2LZ6A 3UF8A 3UINB 3B08A 4NAWB 3RD2A 2ZEQA 3ZW3A 1E7UA 2MBQA 2NR2A 4HLEA 1WGDA 2L00B 3NHEB 3A1QA 4F8CB 2I1JA 2KMAA 4TQ0A 2MBBB 2KX3A 3NOBA 3QJZA 3X23A 3APDA 2AWTA 3H7PA 4G11A 4W9GA 4B9KA 4TKNA 4ICVA 4MEMA 3ZRFA 1XQQA 2L7RA 2WX0A 4KDIC 5J18A 3BINA 2BWFA 4GN1A 2LD9A 2AEHA 4II3B 4NPNA 2NS5A 1OTRB 3A4RA 2JPHA 2PJHA 3DBRI 4MGIE 4DDGD 4LJOB 3DPDA 4WWOA 1KJTA 1FXTB 2MA9B 2JZ3B 5G55A 4MGYE 3SU8X 3VVWB 5D7GA 1E7VA 2NPTA 3ZLZA 4RM8A 4KSKC 2RPQA 4KZ0A 3B0AA 1Y8RC 3QX1A 1U4AA 3W1SA 1GNUA 1TGZB 3MJWA 4FJZA 1SIFA 2DZJA 2KMCA 3ZDMC 4ZRIA 1GC7A 1RFAA 4W9LA 4YL8A 2KX0A 4IW0A 3T8MA 4MM3A 4E71A 2BF8B 1EO6A 3APCA 3V61A 2JF5A 4BFRA 3HM6X 3PS6A 4IWOA 5JHBA 2VRRB 2REXA 1WMHA 2NVUI 3AULA 5CHVC 2MBOA 2MSED 1Q5WB 4URKA 2GBRA 4EZJA 2FUHB 3A1QB 4WJPA 1H4RA 2D3GA 2FAZA 2KFKA 4II2B 4RM9A 4GGQA 2UYZB 4DDID 2GBJA 2FNJB 2C60A 2GMIC 2YLMA 1YJ1A 1CMXB 1GG3A 2KXJA 2N4FA 2R2QA 1WGGA 3WAPA 3RULA 2WX1A 3QIJA 1KLVA 2W9NA 3QQ8B 4EKUA 1V49A 2KJRA 4LDTD 3VHTC 5L83A 2ZNVC 2ZJDA 2L0TA 2BGFA 1WF9A 1WXMA 1YQBA 4MELA 4WAAA 4EFOA 5D2MB 2KOXA 1V81A 3GZNI 4IWPA 3LJ3A 4NQKE 2AL6A 3Q3JA 1V6EA 4HCPB 4KSLC 1OEYA 4PS7A 3VH3B 4PYUA 3IBEA 3TIXA 3RCZA 2J0KA 2KHWB 4GXBA 2KTFA 3PREA 2MP2B 1BT0A 2JXXA 2PE9A 4ANXA 4IM3A 2C9WB 2KTRA 3PLVA 4M8NA 4AJWA 4P7IA 3NS8A 2DHZA 3ML8A 3JVZX 4XX5A 2FIFA 4HDOA 5AEKB 3QARA 4BBNC 2KWCA 3S2AA 1ZW7A 2IO3B 1I35A 1LQBA 4ZRKA 3ZVVA 2DZIA 4GIVA 3V62A 1WMHB 4LCDE 4DXAB 3PTFC 2PPHA 5JHAA 2KWVB 2GBMA 4DHZE 4PYZA 4EEWA 5LXIB 2DYOA 5HKHA 2KZRA 5KHQA 3H7PB 2L05A 1KM7A 3H9DA 3KYCD 1MG8A 3V6EB 3ZDTA 1RAXA 4IM2A 3W1YA 3CSFA 1WXAA 4F7ZA 1WH3A 2DAFA 2D11A 2K8BA 3K9PB 4KV2A 4WWPA 4HXDA 1J0GA 2NPTB 4W9DA 3M62B 1SE9A 2DAJA 1GC6A 1WXVA 2IO1B 3EHVA 2IBIB 3A9JA 4DWFA 2LXCA 3ZKJC 2AYOB 4HDQA 4ANWA 1K8RB 1E8XA 1E90A 2K8CA 2A5UA 2G4SA 4MSQB 5AZGA 5AZHA 3ZO5B 2JY6A 2L0FA 4HPMB 4JL9A 2KC1A 1WYWB 2V4LA 1P9DU 3PV1A 4E3CA 1TBEA 4BOSC 1P0RA 4HWIB 2K6QA 1PQSA 3OJ4B 4PS8A 2JZZA 3K9OB 4HJKA 2CHWA 1V5TA 3RT3B 4W9IA 5L95C 2KQ7A 1P3QU 4WJOA 3T9LA 1OEYJ 1YIWA 2ASQA 2EMSA 3CF6E 2JRHA 2LVOA 5JH5C 4ANVA 1GUAB 2G4DB 2IYDB 3C0RB 2LASA 3DCGA 4NJ7A 3L13A 2J0MA 3A9JB 3PRMB 2QHOA 3VFKA 4I6PA 2MCNB 2JRIB 3DBLI 1WJUA 2BYEA 1SGHA 3OJ3A 3JSVA 1IYFA 4KIKB 1V2YA 3ZRCA 2OOBB 1WR6E 2LGYA 3A9KA 4X57B 4G0NB 4M8MA 3L17A 4EOYA 5J2RA 3KH0A 4NJ6A 1NI2A 3QC8B 2XBBC 4GOCA 4ZDVA 4K1RB 3GOEA 2K25A 2FCSA 1TZ1A 1NBFC 2O6VD 3ENEA 4B6WA 2MX2A 1J8CA 1WGRA 2KJHB 2O2VB 4EZLA 5KHOA 1E8WA 2MLBA 2LRWA 4AWJA 4NY0A 3TJPA 2N9PC 1WGYA 2L76A 4TUUA 3PVLA 3R3MA 4DHZB 4A3OA 3V60A 3UIOB 4MGKE 4MH0E 3U30A 3AU4A 4GSWA 3ZIMA 2Z0EB 4W9HA 3TMPB 1UGMA 4WWNA 1IPGA 1J19A 3PT2B 3IFWB 3Q3FA 4K7UA 3QHTA 2IY0B 2BKRB 3TL5A 3W1SC 1GJZA 4F1SA 4I6LB 2KQSA 2N7DA 3DDCB 2K39A 2D10A 4CYEA 2O6VA 4GDKB 3VUWA 2ZVOA 3WANA 4W9CA 3A4SC 3L0WB 3L54A 2AL3A 3QAQA 1UZXB 2LUEA 1WI0A 2G3QB 3WA0A 2LRUA 1YX6B 3DBHI 3DOWA 2KDFB 5D6JB 4NNJB 5G2NA 3ZNHB 2KKCA 2CU1A 4KZCA 1WZ0A 5CHFA 3VTUA 2C5LC 4ANUA 2BWES 3VH4B 4FJYA 2DX5B 2JVCA 4MGZE 2XK5B 3PRZA 3PHXB 2MW5A 3DVNV 4JQWC 5DPTA 1LFDA 3QCAA 1S3SG 4IC7B 4IUMB 3ZNID 1EF5A 2NBWB 4GMVA 3AU5A 5E6PA 1R4MI 4M0WB 1RRBA 5DPSA 4LJPB 4BKGA 3H6NA 1M94A 1LXDA 2KD0A 2K6DB 1Q1OA 3N3KB 5FR6A 4WQOB 4E74A 1NDDA 5D94A 3TBLD 3VXWA 1QZEA 3NY5A 4ICUA 3ZUNA 1WIAA 3NZUA 2KVRA 2GBNA 3B1LX 4ZYNA 2IY1B 3PHWB 2LXAA 1HE8A 3U8ZA 3ZNGC 2FIDA 3VTWA 2KTRB 3ML9A 2KDEB 5DPRA 2M0XA 4KIKA 3EFUA 4KVGB 1WE6A 2KDIA 1VD2A 3HHMA 2RSUA 3L16A 5GMVA 3KUDB 2J0JA 2N7EA 4W9FA 3IG3A 2IO2B 2RD0A 3ECIA 2M4NA 1UELA 1R4NI 2EKEC 3CSTA 2BYVE 4K7WA 4MJSA 5CTRC 3WAOA 4TV3A 2A4ZA 4G3XB 3R66C 2D2QA 3P2BA 2R2OA 3H7SA 2KDBA 2ZZPB 5JZEB 5J17A 2LVQA 2D07B 2Y5BB 3M95A 2MWSB 3PZDA 4AUQC 3KUCB 4DBGA 1I42A 5LXHA 3WAMA 1ZGUB 2RR9A 3PLUA 2PE6B 2MBEA 2FCNA 4HPLB 1E8ZA 2KN5A 1V5OA 2V1YA 1ISNA 2Z0DB 1L7YA 2JWZA 4MDKE 3WALA 3N30A 1T0YA 3HIZA 5E6NA 2JT4B 2NBUA 2LGDA 3ALBA 3L10B 4J6IA 2DZKA 1WX8A 4GDLB 5TR5A 4HCNB 4FJVB 1JRUA 3VUYA 1A5RA 4W9JA 4JLCA 2LGXA 2Z59B 3DBSA 2HE7A 1WY8A 2N1VA 5C1ZA 3MHSD 4AJYB 4PS3A 2MBHA 2BPSA 4OVUA 2KFKB 2HTHA 3DQVA 4W9KA 2DYMA 2KO3A 3UGBB 4I6NB 3QK0A 3VUXA 3AXCA 4BBNF 4GDLA 4W9EA 1WZ3A 3ZNZB 4CO7A 1WX7A 4BKSD 4JIOU 3LDZE 1KOTA 5C23A 3JYUA 4FADA 3SDLC 3KYDD 2M8SA 2O2VA 3DVNU 4K81A 4N9F4 1OQYA 3ZTCA 4GU2A 4AOFA 3UQAA 1P98A 2CKHB 2MRPA 4AP4C 4EZKA 2FCQA 3VTVA 1AARA 2LI5A 1E5WA 4JGHB 4ASWC 2XEWA 2IO0B 4BVUC 2C7NB 2ZCBA 3JSVB 3DVGY 3H1UA 4DHJD 5DPWA 2M17A 2V3SA 3APFA 3R7QA 3IVFA 3EECA 4XZ4A 4FULA 5DCNA 3TCAA 5AZFA 2I1KA 4FHJA 2DYBA 1EF1A 1EUVB 1Q0WB 3NZSA 1RLFA 3HK0A 2ZCCA 4HK2A 3VQIA 1WFYA 2K1FA 4CHKA 3M3JA 3UQBA 3V6CB 2KWUB 5CX3A 3R7RA 2DENB 3HM3A 2KLGA 3KVFB 3SD5A 2PEAA 3O65B 3D32A 2ZPNA 4BKSA 1WRDB 3ZTDA 3RZWC 2N9XA 1LM8B 2KLCA 3UIPB 1YX5B 4G50A 3BY4B 3N32A 2B3AA 4DHJB 3PRPB 4LDTB 2DZMA 4DK5A 2YVCA 2XK5A 2KC2A 2LJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWQ A;  1F9J A;  3KW5 B;  4EUT A;  2GOW A;  3OLM D;  1WJN A;  3CMM B;  2CHZ A;  3VDZ A;  2ZVN A;  2JUO A;  4K7S A;  3QWZ B;  3MTN B;  4RMA A;  1H8C A;  4NAW A;  3I3T B;  5BO4 B;  2EMT A;  3A33 B;  1L2N A;  3AI5 A;  4MSM B;  1V9J A;  1XT9 B;  1WGH A;  1WJ6 A;  2HD5 B;  4FN2 A;  4BKT A;  4B95 A;  2M1M A;  4GB9 A;  4FHK A;  4A3P A;  2GBK A;  2NCN A;  3U7D A;  2WDT B;  2KAN A;  2CR5 A;  3L08 A;  4IM0 A;  2C7H A;  2L8J A;  4FBJ B;  4WJN A;  2KNB A;  3M63 B;  1OGW A;  2IZV B;  2KJ6 A;  3VAW A;  3ONS A;  2HJ8 A;  3RZF A;  2RGF A;  2G45 B;  1UBI A;  1S1Q B;  1TTN A;  1WM3 A;  2O6V B;  3PSE B;  1WE7 A;  4GDK A;  3A9K B;  2ZNV B;  4NQL B;  4A20 A;  2ZPY A;  3OAW A;  4FLH A;  1Z5S B;  4HVB A;  1D3Z A;  1UBQ A;  1WXS A;  2L3Z A;  5IA7 A;  5E6O A;  4MJS B;  1V86 A;  1XD3 B;  2LVP A;  4ZRJ A;  5LLI A;  2WWZ A;  4FA6 A;  2MP2 A;  2K8H A;  4IWQ A;  4KDL B;  4TQ1 A;  1C1Y B;  3RYT A;  1IP9 A;  1G6J A;  2FCM A;  1YD8 U;  3JW0 X;  2LWP A;  2N9E B;  3WIM A;  2WYQ A;  2KFJ A;  3PPA A;  1Z2M A;  2NBV B;  3QA8 A;  1X1M A;  5CHW A;  2BKF A;  3KUZ A;  2J7Q B;  2CS4 A;  1UD7 A;  1E8Y A;  5IAA C;  1P1A A;  1WR1 A;  4OVV A;  3RUI B;  2C7M B;  2N1W A;  4XC2 A;  2CHX A;  3SHQ A;  2MQJ A;  1WX9 A;  3X0W A;  1WJ4 A;  4WJQ A;  5EDS A;  4BOZ B;  1V80 A;  1ZKH A;  2BYF A;  1UH6 A;  3DVG X;  3IHP C;  4IG7 B;  2OJR A;  1VCB A;  1C3T A;  3EC8 A;  1WM2 A;  3PGE A;  2KK8 A;  2LZ6 A;  3UF8 A;  3UIN B;  3B08 A;  4NAW B;  3RD2 A;  2ZEQ A;  3ZW3 A;  1E7U A;  2MBQ A;  2NR2 A;  4HLE A;  1WGD A;  2L00 B;  3NHE B;  3A1Q A;  4F8C B;  2I1J A;  2KMA A;  4TQ0 A;  2MBB B;  2KX3 A;  3NOB A;  3QJZ A;  3X23 A;  3APD A;  2AWT A;  3H7P A;  4G11 A;  4W9G A;  4B9K A;  4TKN A;  4ICV A;  4MEM A;  3ZRF A;  1XQQ A;  2L7R A;  2WX0 A;  4KDI C;  5J18 A;  3BIN A;  2BWF A;  4GN1 A;  2LD9 A;  2AEH A;  4II3 B;  4NPN A;  2NS5 A;  1OTR B;  3A4R A;  2JPH A;  2PJH A;  3DBR I;  4MGI E;  4DDG D;  4LJO B;  3DPD A;  4WWO A;  1KJT A;  1FXT B;  2MA9 B;  2JZ3 B;  5G55 A;  4MGY E;  3SU8 X;  3VVW B;  5D7G A;  1E7V A;  2NPT A;  3ZLZ A;  4RM8 A;  4KSK C;  2RPQ A;  4KZ0 A;  3B0A A;  1Y8R C;  3QX1 A;  1U4A A;  3W1S A;  1GNU A;  1TGZ B;  3MJW A;  4FJZ A;  1SIF A;  2DZJ A;  2KMC A;  3ZDM C;  4ZRI A;  1GC7 A;  1RFA A;  4W9L A;  4YL8 A;  2KX0 A;  4IW0 A;  3T8M A;  4MM3 A;  4E71 A;  2BF8 B;  1EO6 A;  3APC A;  3V61 A;  2JF5 A;  4BFR A;  3HM6 X;  3PS6 A;  4IWO A;  5JHB A;  2VRR B;  2REX A;  1WMH A;  2NVU I;  3AUL A;  5CHV C;  2MBO A;  2MSE D;  1Q5W B;  4URK A;  2GBR A;  4EZJ A;  2FUH B;  3A1Q B;  4WJP A;  1H4R A;  2D3G A;  2FAZ A;  2KFK A;  4II2 B;  4RM9 A;  4GGQ A;  2UYZ B;  4DDI D;  2GBJ A;  2FNJ B;  2C60 A;  2GMI C;  2YLM A;  1YJ1 A;  1CMX B;  1GG3 A;  2KXJ A;  2N4F A;  2R2Q A;  1WGG A;  3WAP A;  3RUL A;  2WX1 A;  3QIJ A;  1KLV A;  2W9N A;  3QQ8 B;  4EKU A;  1V49 A;  2KJR A;  4LDT D;  3VHT C;  5L83 A;  2ZNV C;  2ZJD A;  2L0T A;  2BGF A;  1WF9 A;  1WXM A;  1YQB A;  4MEL A;  4WAA A;  4EFO A;  5D2M B;  2KOX A;  1V81 A;  3GZN I;  4IWP A;  3LJ3 A;  4NQK E;  2AL6 A;  3Q3J A;  1V6E A;  4HCP B;  4KSL C;  1OEY A;  4PS7 A;  3VH3 B;  4PYU A;  3IBE A;  3TIX A;  3RCZ A;  2J0K A;  2KHW B;  4GXB A;  2KTF A;  3PRE A;  2MP2 B;  1BT0 A;  2JXX A;  2PE9 A;  4ANX A;  4IM3 A;  2C9W B;  2KTR A;  3PLV A;  4M8N A;  4AJW A;  4P7I A;  3NS8 A;  2DHZ A;  3ML8 A;  3JVZ X;  4XX5 A;  2FIF A;  4HDO A;  5AEK B;  3QAR A;  4BBN C;  2KWC A;  3S2A A;  1ZW7 A;  2IO3 B;  1I35 A;  1LQB A;  4ZRK A;  3ZVV A;  2DZI A;  4GIV A;  3V62 A;  1WMH B;  4LCD E;  4DXA B;  3PTF C;  2PPH A;  5JHA A;  2KWV B;  2GBM A;  4DHZ E;  4PYZ A;  4EEW A;  5LXI B;  2DYO A;  5HKH A;  2KZR A;  5KHQ A;  3H7P B;  2L05 A;  1KM7 A;  3H9D A;  3KYC D;  1MG8 A;  3V6E B;  3ZDT A;  1RAX A;  4IM2 A;  3W1Y A;  3CSF A;  1WXA A;  4F7Z A;  1WH3 A;  2DAF A;  2D11 A;  2K8B A;  3K9P B;  4KV2 A;  4WWP A;  4HXD A;  1J0G A;  2NPT B;  4W9D A;  3M62 B;  1SE9 A;  2DAJ A;  1GC6 A;  1WXV A;  2IO1 B;  3EHV A;  2IBI B;  3A9J A;  4DWF A;  2LXC A;  3ZKJ C;  2AYO B;  4HDQ A;  4ANW A;  1K8R B;  1E8X A;  1E90 A;  2K8C A;  2A5U A;  2G4S A;  4MSQ B;  5AZG A;  5AZH A;  3ZO5 B;  2JY6 A;  2L0F A;  4HPM B;  4JL9 A;  2KC1 A;  1WYW B;  2V4L A;  1P9D U;  3PV1 A;  4E3C A;  1TBE A;  4BOS C;  1P0R A;  4HWI B;  2K6Q A;  1PQS A;  3OJ4 B;  4PS8 A;  2JZZ A;  3K9O B;  4HJK A;  2CHW A;  1V5T A;  3RT3 B;  4W9I A;  5L95 C;  2KQ7 A;  1P3Q U;  4WJO A;  3T9L A;  1OEY J;  1YIW A;  2ASQ A;  2EMS A;  3CF6 E;  2JRH A;  2LVO A;  5JH5 C;  4ANV A;  1GUA B;  2G4D B;  2IYD B;  3C0R B;  2LAS A;  3DCG A;  4NJ7 A;  3L13 A;  2J0M A;  3A9J B;  3PRM B;  2QHO A;  3VFK A;  4I6P A;  2MCN B;  2JRI B;  3DBL I;  1WJU A;  2BYE A;  1SGH A;  3OJ3 A;  3JSV A;  1IYF A;  4KIK B;  1V2Y A;  3ZRC A;  2OOB B;  1WR6 E;  2LGY A;  3A9K A;  4X57 B;  4G0N B;  4M8M A;  3L17 A;  4EOY A;  5J2R A;  3KH0 A;  4NJ6 A;  1NI2 A;  3QC8 B;  2XBB C;  4GOC A;  4ZDV A;  4K1R B;  3GOE A;  2K25 A;  2FCS A;  1TZ1 A;  1NBF C;  2O6V D;  3ENE A;  4B6W A;  2MX2 A;  1J8C A;  1WGR A;  2KJH B;  2O2V B;  4EZL A;  5KHO A;  1E8W A;  2MLB A;  2LRW A;  4AWJ A;  4NY0 A;  3TJP A;  2N9P C;  1WGY A;  2L76 A;  4TUU A;  3PVL A;  3R3M A;  4DHZ B;  4A3O A;  3V60 A;  3UIO B;  4MGK E;  4MH0 E;  3U30 A;  3AU4 A;  4GSW A;  3ZIM A;  2Z0E B;  4W9H A;  3TMP B;  1UGM A;  4WWN A;  1IPG A;  1J19 A;  3PT2 B;  3IFW B;  3Q3F A;  4K7U A;  3QHT A;  2IY0 B;  2BKR B;  3TL5 A;  3W1S C;  1GJZ A;  4F1S A;  4I6L B;  2KQS A;  2N7D A;  3DDC B;  2K39 A;  2D10 A;  4CYE A;  2O6V A;  4GDK B;  3VUW A;  2ZVO A;  3WAN A;  4W9C A;  3A4S C;  3L0W B;  3L54 A;  2AL3 A;  3QAQ A;  1UZX B;  2LUE A;  1WI0 A;  2G3Q B;  3WA0 A;  2LRU A;  1YX6 B;  3DBH I;  3DOW A;  2KDF B;  5D6J B;  4NNJ B;  5G2N A;  3ZNH B;  2KKC A;  2CU1 A;  4KZC A;  1WZ0 A;  5CHF A;  3VTU A;  2C5L C;  4ANU A;  2BWE S;  3VH4 B;  4FJY A;  2DX5 B;  2JVC A;  4MGZ E;  2XK5 B;  3PRZ A;  3PHX B;  2MW5 A;  3DVN V;  4JQW C;  5DPT A;  1LFD A;  3QCA A;  1S3S G;  4IC7 B;  4IUM B;  3ZNI D;  1EF5 A;  2NBW B;  4GMV A;  3AU5 A;  5E6P A;  1R4M I;  4M0W B;  1RRB A;  5DPS A;  4LJP B;  4BKG A;  3H6N A;  1M94 A;  1LXD A;  2KD0 A;  2K6D B;  1Q1O A;  3N3K B;  5FR6 A;  4WQO B;  4E74 A;  1NDD A;  5D94 A;  3TBL D;  3VXW A;  1QZE A;  3NY5 A;  4ICU A;  3ZUN A;  1WIA A;  3NZU A;  2KVR A;  2GBN A;  3B1L X;  4ZYN A;  2IY1 B;  3PHW B;  2LXA A;  1HE8 A;  3U8Z A;  3ZNG C;  2FID A;  3VTW A;  2KTR B;  3ML9 A;  2KDE B;  5DPR A;  2M0X A;  4KIK A;  3EFU A;  4KVG B;  1WE6 A;  2KDI A;  1VD2 A;  3HHM A;  2RSU A;  3L16 A;  5GMV A;  3KUD B;  2J0J A;  2N7E A;  4W9F A;  3IG3 A;  2IO2 B;  2RD0 A;  3ECI A;  2M4N A;  1UEL A;  1R4N I;  2EKE C;  3CST A;  2BYV E;  4K7W A;  4MJS A;  5CTR C;  3WAO A;  4TV3 A;  2A4Z A;  4G3X B;  3R66 C;  2D2Q A;  3P2B A;  2R2O A;  3H7S A;  2KDB A;  2ZZP B;  5JZE B;  5J17 A;  2LVQ A;  2D07 B;  2Y5B B;  3M95 A;  2MWS B;  3PZD A;  4AUQ C;  3KUC B;  4DBG A;  1I42 A;  5LXH A;  3WAM A;  1ZGU B;  2RR9 A;  3PLU A;  2PE6 B;  2MBE A;  2FCN A;  4HPL B;  1E8Z A;  2KN5 A;  1V5O A;  2V1Y A;  1ISN A;  2Z0D B;  1L7Y A;  2JWZ A;  4MDK E;  3WAL A;  3N30 A;  1T0Y A;  3HIZ A;  5E6N A;  2JT4 B;  2NBU A;  2LGD A;  3ALB A;  3L10 B;  4J6I A;  2DZK A;  1WX8 A;  4GDL B;  5TR5 A;  4HCN B;  4FJV B;  1JRU A;  3VUY A;  1A5R A;  4W9J A;  4JLC A;  2LGX A;  2Z59 B;  3DBS A;  2HE7 A;  1WY8 A;  2N1V A;  5C1Z A;  3MHS D;  4AJY B;  4PS3 A;  2MBH A;  2BPS A;  4OVU A;  2KFK B;  2HTH A;  3DQV A;  4W9K A;  2DYM A;  2KO3 A;  3UGB B;  4I6N B;  3QK0 A;  3VUX A;  3AXC A;  4BBN F;  4GDL A;  4W9E A;  1WZ3 A;  3ZNZ B;  4CO7 A;  1WX7 A;  4BKS D;  4JIO U;  3LDZ E;  1KOT A;  5C23 A;  3JYU A;  4FAD A;  3SDL C;  3KYD D;  2M8S A;  2O2V A;  3DVN U;  4K81 A;  4N9F 4;  1OQY A;  3ZTC A;  4GU2 A;  4AOF A;  3UQA A;  1P98 A;  2CKH B;  2MRP A;  4AP4 C;  4EZK A;  2FCQ A;  3VTV A;  1AAR A;  2LI5 A;  1E5W A;  4JGH B;  4ASW C;  2XEW A;  2IO0 B;  4BVU C;  2C7N B;  2ZCB A;  3JSV B;  3DVG Y;  3H1U A;  4DHJ D;  5DPW A;  2M17 A;  2V3S A;  3APF A;  3R7Q A;  3IVF A;  3EEC A;  4XZ4 A;  4FUL A;  5DCN A;  3TCA A;  5AZF A;  2I1K A;  4FHJ A;  2DYB A;  1EF1 A;  1EUV B;  1Q0W B;  3NZS A;  1RLF A;  3HK0 A;  2ZCC A;  4HK2 A;  3VQI A;  1WFY A;  2K1F A;  4CHK A;  3M3J A;  3UQB A;  3V6C B;  2KWU B;  5CX3 A;  3R7R A;  2DEN B;  3HM3 A;  2KLG A;  3KVF B;  3SD5 A;  2PEA A;  3O65 B;  3D32 A;  2ZPN A;  4BKS A;  1WRD B;  3ZTD A;  3RZW C;  2N9X A;  1LM8 B;  2KLC A;  3UIP B;  1YX5 B;  4G50 A;  3BY4 B;  3N32 A;  2B3A A;  4DHJ B;  3PRP B;  4LDT B;  2DZM A;  4DK5 A;  2YVC A;  2XK5 A;  2KC2 A;  2LJ5 A; 
#chains in the Genus database with same CATH topology
 3B2G A;  4XE0 A;  4XWW A;  1F9J A;  3KW5 B;  4EUT A;  2GOW A;  3OLM D;  4QAY A;  1QT9 A;  1HTO A;  2B76 B;  1V1O A;  1TT5 B;  4K7S A;  2EMT A;  3A33 B;  1XT9 B;  2HD5 B;  2JQR B;  1E6E B;  2M1M A;  4GB9 A;  4IM0 A;  3NVW A;  3U7Z A;  1AN8 A;  4FBJ B;  2KNB A;  3M63 B;  1OGW A;  3VAW A;  2VH1 A;  1S1Q B;  2O6V B;  1QOA A;  4GDK A;  3VR8 B;  2ZNV B;  2ZPY A;  4P1B C;  5I4D A;  1Z5S B;  3Q8F A;  5IA7 A;  4FA6 A;  3BK2 A;  4HKQ A;  2WHI A;  1C1Y B;  1L6U A;  3JW0 X;  3WIM A;  2WYQ A;  2KFJ A;  3QA8 A;  2BKF A;  3KUZ A;  2J7Q B;  1J7A A;  2J42 A;  1WRI A;  1UD7 A;  1WR1 A;  4XC2 A;  2MQJ A;  4RGN A;  1WJ4 A;  5EDS A;  2BYF A;  4REZ A;  4IG7 B;  2OJR A;  1GPX A;  1WYG A;  3PGE A;  2KK8 A;  3UF8 A;  2L52 A;  1UF0 A;  2WNM A;  2BW2 A;  4MT5 A;  2MBQ A;  4M02 A;  2CJN A;  2NR2 A;  2D3A A;  1WGD A;  1L4D B;  3NHE B;  2NTS A;  4F8C B;  2KMM A;  1ACC A;  3NOB A;  4TKN A;  3W5V B;  4ZRP A;  3MC0 B;  4KDI C;  4GN1 A;  2DLB A;  4LJO B;  4C7Z A;  2WXG A;  2BBC A;  4LTU A;  3VVW B;  5D7G A;  1D4B A;  2FUG 1;  4YSZ B;  4KZ0 A;  1K53 A;  4ARC A;  3KQ4 A;  3QX1 A;  3DWM A;  1YN3 A;  4FJZ A;  4AQ7 A;  4ZRI A;  1GC7 A;  4YL8 A;  3MFG A;  4IW0 A;  1QKZ A;  4MM3 A;  4E71 A;  2BF8 B;  1EO6 A;  3APC A;  3HM6 X;  3PS6 A;  4S0R A;  1WMH A;  3N1X C;  1MPE A;  2BS2 B;  1T5X D;  4ARI A;  3A1Q B;  4II2 B;  2KFK A;  3H8H A;  1DOX A;  2UYZ B;  1D5X C;  1F52 A;  5HG2 A;  2YLM A;  1YJ1 A;  1GOZ A;  2VZK B;  3WAP A;  3RUL A;  3T3N A;  1TY2 A;  5L83 A;  2KJR A;  5D3D A;  2L0T A;  4MEL A;  2WLB A;  2J53 A;  2PMV A;  2KOX A;  1V81 A;  3OWE B;  4XDD A;  3FKY A;  3VH3 B;  4PYU A;  3IBE A;  3RCZ A;  4GXB A;  3PRE A;  2MP2 B;  2KTR A;  2IGH A;  3ML8 A;  3JVZ X;  3NG0 A;  4HDO A;  2V3P A;  2XNA C;  2IO3 B;  3RNC C;  2ACZ B;  2DZI A;  3PTF C;  2PPH A;  5TSS A;  2R61 A;  3V6E B;  3NS1 A;  1ZP0 B;  1RAX A;  4L23 A;  3W1Y A;  3CSF A;  4F7Z A;  1WH3 A;  2DAF A;  2D11 A;  1J0G A;  4HXD A;  4YTM B;  2IO1 B;  4DWF A;  2OHF A;  1HQR D;  4HDQ A;  2NMQ A;  1E8X A;  1E90 A;  2K8C A;  4MSQ B;  5AZH A;  2JY6 A;  2WXQ A;  4HPM B;  3HUI A;  4JL9 A;  2ON8 A;  1L0X B;  4E3C A;  1TS2 A;  4PS8 A;  2JZZ A;  3AEC B;  1LGR A;  1MHH E;  1R4M B;  3T9L A;  1VJK A;  4H2A A;  1YIW A;  2ASQ A;  2L32 A;  3AN1 A;  1MG4 A;  2LAS A;  1IGC A;  2J0M A;  2QHO A;  4US8 A;  1WJU A;  1SGH A;  3OJ3 A;  5FK9 C;  2WXF A;  3C8Y A;  4HKZ E;  3A9K A;  5J2R A;  3KH0 A;  5H92 C;  2N0S B;  5IP4 D;  1XXG A;  2K25 A;  2FCS A;  3ENE A;  2MX2 A;  5H8Y E;  1J8C A;  2KJH B;  4AWJ A;  4TUU A;  3PZ8 A;  4MGK E;  3U30 A;  3AU4 A;  2LUM A;  1F2R I;  2AQ1 B;  3RFZ B;  1IBX A;  2L83 A;  1XEE A;  3WAN A;  3L54 A;  2AL3 A;  2WXJ A;  2LFI A;  3RPF C;  2HJ1 A;  2LRU A;  1YX6 B;  2WXH A;  3DOW A;  2VZK D;  5D6J B;  3DBH B;  3AH7 A;  1V1P B;  2KKC A;  3VTU A;  2JX5 A;  2BWE S;  1P7F A;  4FJY A;  1ET6 A;  4TSS A;  2G1E A;  5DPT A;  1S3S G;  3RNE C;  2WGS A;  1EF5 A;  2XN9 C;  4OZA A;  1RFK A;  4P1C C;  2KD0 A;  3SEB A;  1FXI A;  1NDD A;  1NYR A;  2GBN A;  4RF0 A;  3B1L X;  4ZYN A;  1MVK A;  3ZNG C;  3U8Z A;  3ML9 A;  1ZXH A;  4UDU C;  3GE8 C;  1VD2 A;  4OZB A;  1SE4 A;  2J0J A;  2N7E A;  4MJS A;  5IOI A;  3CST A;  4TV3 A;  1NYQ A;  1FRD A;  3R8B A;  2LEK A;  3Q6B A;  1EU3 A;  2Y5B B;  4AUQ C;  1TIF A;  1ZGU B;  2RR9 A;  1CZP A;  2MBE A;  1V5O A;  1SJH D;  2JWZ A;  1YJJ A;  2WXL A;  5E6N A;  3ALB A;  3L10 B;  4J6I A;  5G5H A;  1EM7 A;  1A5R A;  4W9J A;  4JLC A;  4LLG M;  1WY8 A;  2GLS A;  2N1V A;  3EA6 A;  1ESF A;  3Q3M C;  4OVU A;  2KFK B;  2KO3 A;  3VUX A;  4W9E A;  4JIO U;  3LDZ E;  4YXD B;  2M8S A;  3DVN U;  4K81 A;  4N9F 4;  4PK1 A;  3ZYY X;  4AOF A;  2CKH B;  2MRP A;  4AP4 C;  2FCQ A;  4ASW C;  2LI5 A;  1E5W A;  1ZOY B;  4XYC A;  2C7N B;  3EFC A;  3JSV B;  5DPW A;  2M17 A;  2AQ3 B;  1GB1 A;  3AEG B;  3M3J A;  3UQB A;  1VZ7 A;  2DEN B;  3P42 A;  2Z8L A;  3RNB C;  2BYT A;  4BKS A;  1ZPS A;  1WRD B;  3ZTD A;  1LM8 B;  1YX5 B;  4G50 A;  3ZXV A;  3N32 A;  3PRP B;  1ZXI A;  5AUI A;  3I57 A;  3HVD A;  2I38 A;  3PZ7 A;  4GLS C;  4BKT A;  2UWQ A;  4ACF A;  3P63 A;  2CHZ A;  2WQY B;  5D3I B;  3I3T B;  3AI5 A;  1V9J A;  3BWU D;  5C3J B;  4FN2 A;  1EWC A;  3ZXR A;  2WDT B;  2KAN A;  3L08 A;  2C7H A;  4S17 A;  2HJ8 A;  4XDC A;  1UBI A;  1TTN A;  3BYT B;  1WE7 A;  1YN4 A;  1M4V A;  1D3Z A;  3OAW A;  2L3Z A;  2BTE A;  1XD3 B;  5HKH A;  2WWZ A;  1IP9 A;  1G6J A;  2K8H A;  2LWP A;  3AMZ A;  1E7P B;  2G9H D;  1K50 A;  2RMM A;  4HRO A;  1I7H A;  4OVV A;  2CHX A;  5T8I A;  4N6E B;  4BOZ B;  1UH6 A;  2HTM E;  1VCB A;  1PGA A;  4BZA A;  2ZEQ A;  3ZW3 A;  1L4Z B;  4KKJ A;  2ZW0 A;  1FCC C;  2KMA A;  4TQ0 A;  2KX3 A;  3QJZ A;  3APD A;  3P4R B;  4G11 A;  3N1Y C;  4W9G A;  1AYF A;  2GRI A;  1YOV B;  2WDV B;  5J18 A;  2LD9 A;  1CK1 A;  3A4R A;  2JPH A;  4R3D A;  1FNV A;  2PJH A;  3DHH C;  4MGI E;  3NUH B;  4WWO A;  3Q8B A;  1KJT A;  1FXT B;  1J7B A;  4DXG A;  4MGY E;  4YWG G;  4B0M A;  1D6E C;  4IOI E;  4BAX A;  2RPQ A;  1T3Q A;  1U4A A;  1TGZ B;  1N60 A;  1QOG A;  3ZDM C;  1RFA A;  4W9L A;  2M0A A;  2KX0 A;  2QIE B;  3V61 A;  1YQ3 B;  3VR9 B;  2N9K A;  4BFR A;  2VRR B;  3AUL A;  2NVU I;  5CHV C;  2MBO A;  2MSE D;  2BS4 B;  3BK1 A;  4WH4 A;  2GBR A;  4EZJ A;  2D3G A;  4GGQ A;  1XO3 A;  3BII D;  2GBJ A;  3DHI C;  2C60 A;  1T0Q C;  3TEW A;  2W3S A;  1GG3 A;  2R2Q A;  1WGG A;  3RI7 C;  2QSD A;  2BGF A;  1WXM A;  1YQB A;  4L2Y A;  4WAA A;  4EFO A;  3N1Z C;  3GZN I;  5IN7 A;  3ZJV A;  4NQK E;  1XCQ L;  3W2D A;  4B0E A;  4J3O D;  3IXS A;  2JXX A;  4ANX A;  2Q5W D;  2C9W B;  2DHZ A;  2GB1 A;  5AEK B;  3AE5 B;  2KWC A;  3S2A A;  1ZW7 A;  2X8X X;  1LQB A;  4ZRK A;  3B9J A;  1WMH B;  4LCD E;  2KWV B;  2GBM A;  1UUP A;  3I5J C;  3H7P B;  4L1B A;  1MG8 A;  4WAF A;  3ZDT A;  5IKC M;  1WXA A;  3FAH A;  4XGA B;  2K8B A;  4KV2 A;  4WWP A;  2WXK A;  4W9D A;  3A9J A;  1N5W A;  2LXC A;  1UWM A;  1K8R B;  1TYG B;  3ZO5 B;  1V8C A;  2QDF A;  1P9D U;  2IJ0 A;  4BOS C;  1P0R A;  3OJ4 B;  2BT6 A;  1V5T A;  3RT3 B;  5L95 C;  4WQM A;  5BMH A;  1JWA D;  2FE8 A;  2QMT A;  3CF6 E;  2JRH A;  1HZ5 A;  4ANV A;  4HRS A;  4CQN A;  4NJ7 A;  2KDM A;  4YSX B;  3A9J B;  4I6P A;  2MCN B;  2JRI B;  1SB3 C;  3AE4 B;  3JSV A;  1V2Y A;  2EEL A;  3NVZ A;  2OOB B;  1KLG D;  1WR6 E;  1VR9 A;  4M8M A;  4NJ6 A;  3AB5 A;  3U52 E;  4ZDV A;  4GOC A;  2SAK A;  4K1R B;  2MEK A;  1TZ1 A;  1NBF C;  1YMH E;  2BB5 A;  4B6W A;  2PLP A;  1WGR A;  2O2V B;  4EZL A;  5KHO A;  2N9P C;  1E0Z A;  4A3O A;  3V60 A;  5HI1 A;  1L0Y B;  4NAM A;  2CJO A;  3AE8 B;  4KGT A;  3IFW B;  3RN9 C;  1QIL A;  2BKR B;  1GJZ A;  4F1S A;  2ZW1 A;  4I6L B;  3AM9 A;  2K39 A;  2O6V A;  4GDK B;  3RNG C;  2ZVO A;  3VUW A;  3A4S C;  1YQ4 B;  1UZX B;  1RYJ A;  1WI0 A;  1WWT A;  1K51 A;  2W3R A;  3TEZ A;  1F2R C;  2SEB D;  3WA0 A;  3AE1 B;  2KDF B;  3NVV A;  4NNJ B;  1WGK A;  3DHG C;  1WZ0 A;  2E6X A;  5CHF A;  3HVZ A;  4KGR A;  3DBL B;  3PHX B;  5FR3 A;  4JQW C;  1L6V A;  3LXF A;  2NBW B;  4GMV A;  5BMI A;  4M0W B;  1RRB A;  1OQR A;  5DPS A;  2W82 A;  3H6N A;  1M94 A;  1YNT E;  4P6V F;  4RGT A;  4E74 A;  5D94 A;  1MJD A;  3TBL D;  3NY5 A;  3ZUN A;  1FPY A;  3NZU A;  2KVR A;  2KAC A;  2IY1 B;  2LXA A;  1HE8 A;  2FID A;  2WU2 B;  3VTW A;  2KDE B;  2M0X A;  4WWM A;  3AE9 B;  4WUR A;  2K9X A;  2KDI A;  2RSU A;  1I4P A;  1V1P A;  3CWI A;  3TMP B;  3IG3 A;  2M4N A;  2EKE C;  1R4N I;  3WAO A;  4K7W A;  4D2K A;  2KYW A;  2KDB A;  5JZE B;  5J17 A;  2LVQ A;  3M95 A;  2E3T A;  5LXH A;  3PLU A;  2FCN A;  1FNW A;  1E8Z A;  2KN5 A;  1ISN A;  1IBX B;  1SSN A;  4K3B A;  1T0Y A;  1TS4 A;  4LK0 M;  3RNF C;  4HCN B;  3P4P B;  3P4S B;  3AV8 A;  3MC8 A;  2Z59 B;  5MPO A;  2MH7 A;  4AJY B;  1D5Z C;  1HZ6 A;  3DBR B;  2BPS A;  1HXY D;  3N20 C;  1SBB B;  2HTH A;  4I6N B;  3FIL B;  3QK0 A;  1B9R A;  2IND C;  1KOT A;  5C23 A;  1FRR A;  4FAD A;  3SDL C;  4OVZ A;  2O2V A;  1OQY A;  4EZK A;  3VTV A;  3H1U A;  2V3S A;  1N61 A;  3Q8E A;  1NEK B;  1T6B X;  3EEC A;  3IVF A;  4XZ4 A;  2I1K A;  5BYR A;  3NJT A;  1RLF A;  1HEZ E;  4HPP A;  4CHK A;  2KWU B;  3R7R A;  1UNS A;  5LNK 1;  1FXA A;  3Q2A C;  3SD5 A;  1FO4 A;  1SE3 A;  3O65 B;  3D32 A;  2AX5 A;  1PDX A;  3RZW C;  1TS5 A;  2N9X A;  2KLC A;  2B3A A;  2MJ3 A;  2DZM A;  4DK5 A;  3Q8A A;  4A90 A;  2IGD A;  2UU7 A;  1WJN A;  3CMM B;  2BS3 B;  3MTN B;  4RMA A;  2QC8 A;  3HRD D;  1H8C A;  4NAW A;  1TY0 A;  4MH8 A;  4YT0 B;  1WJ6 A;  4A3P A;  1E9M A;  3U7D A;  4KKI A;  2L8J A;  4OW0 A;  2K22 A;  4WJN A;  4M01 A;  4US9 A;  3ONS A;  3RZF A;  1QF6 A;  4NQL B;  4KGS A;  3TEX A;  3PSE B;  4A20 A;  4FLH A;  4HVB A;  1UBQ A;  1WXS A;  3SFE B;  4MJS B;  2LVP A;  4ZRJ A;  5LLI A;  5AUK A;  2MP2 A;  1I4G A;  2DWQ A;  4KDL B;  4TQ1 A;  3RYT A;  3LB8 C;  1YD8 U;  2N9E B;  4RGM A;  3PPA A;  2NBV B;  5CHW A;  1X1M A;  1BUI C;  4ZOH C;  2MJE A;  4OHJ A;  4TMA B;  2INC C;  1E8Y A;  5IAA C;  3RUI B;  2C7M B;  1MHX A;  4PT5 A;  1WX9 A;  1MI0 A;  4WJQ A;  1V80 A;  3DVG X;  2RDH A;  3EC8 A;  2LMC A;  3UIN B;  3B08 A;  4NAW B;  2M56 B;  1E7U A;  2WXI A;  3SR6 A;  1XLN A;  4M00 A;  4HLE A;  2L00 B;  3EUB 2;  2FBW B;  2I1J A;  1FD6 A;  3E9S A;  1K52 A;  1J7C A;  3DWG C;  1C79 A;  4C80 A;  2AWT A;  3H7P A;  3KWV A;  4B9K A;  4ICV A;  2L7R A;  3BIN A;  4II3 B;  2NS5 A;  1OTR B;  1YJI A;  3DBR I;  4O1N A;  4DDG D;  1ZE3 D;  2JZP A;  2QIL A;  1FIQ A;  1N63 A;  4AS1 A;  2CU3 A;  2MA9 B;  5G55 A;  1DGJ A;  2GI9 A;  2KWD A;  1E7V A;  2NPT A;  1CQV A;  1Y8R C;  2WDQ B;  1BXT A;  1GNU A;  3OG5 A;  3MC9 A;  2KMC A;  4FXC A;  3R2I A;  3FC4 A;  1KF6 B;  1ZDV A;  2N9L A;  2JF5 A;  4IWO A;  1V97 A;  4URK A;  4WJP A;  2FAZ A;  4RM9 A;  2KT7 A;  4A8X C;  4DDI D;  2PKO A;  3TUO A;  2FNJ B;  1MFW A;  2PW9 A;  2RPV A;  2WXM A;  3V3X A;  2N4F A;  3GS2 A;  2J52 A;  2WX1 A;  2W9N A;  3QQ8 B;  4EKU A;  1V49 A;  3Q14 C;  1TS3 A;  1WF9 A;  1JWU D;  5D2M B;  4JX1 C;  4IWP A;  2AL6 A;  3Q3J A;  1V6E A;  2QEJ C;  1ROE A;  5BYQ A;  4LNF A;  3TIX A;  2KHW B;  2JU6 X;  2DBY A;  4USA A;  4IM3 A;  2V4I B;  4M8N A;  4AJW A;  4P7I A;  3NS8 A;  4N59 A;  4XX5 A;  4BBN C;  5HHD G;  4JPS A;  1I35 A;  4DXA B;  3V62 A;  3GB1 A;  4DHZ E;  3AED B;  4M0W A;  2DYO A;  5KHQ A;  1VLB A;  4N58 A;  1KM7 A;  3H9D A;  4IM2 A;  1KLU D;  1GAQ B;  3K9P B;  2Y3A A;  1QLB B;  4JE3 B;  5C2T B;  1WXV A;  3EHV A;  2IBI B;  4C00 A;  3ZKJ C;  2AYO B;  4ANW A;  3KLS X;  2KC1 A;  1WYW B;  3PV1 A;  5G5G A;  3BVG A;  4HWI B;  2K6Q A;  3K9O B;  2ONQ A;  4HJK A;  2CHW A;  4DXF A;  4W9I A;  1P3Q U;  4WJO A;  1OEY J;  1L5P A;  2EMS A;  5JH5 C;  3DCG A;  3PRM B;  1VDV A;  1IYF A;  2V9H A;  2LGY A;  4X57 B;  1ET9 A;  2V0G A;  4C7Y A;  1TKE A;  1NI2 A;  3V05 A;  3GOE A;  2V3N A;  4LNN A;  2O6V D;  1N5X A;  3ZJU A;  2MLB A;  2LRW A;  4LNK A;  3TJP A;  3IAM 1;  1WGY A;  2LGI A;  3PVL A;  3R3M A;  3UIO B;  1CJE A;  2JYT A;  1N62 A;  1UGM A;  1IPG A;  1J19 A;  3PT2 B;  3IAS 1;  3QHT A;  2IY0 B;  1ZDX A;  4IDI A;  3TL5 A;  3W1S C;  1WXQ A;  2KQS A;  2N7D A;  2ICI A;  3DDC B;  2D10 A;  4CYE A;  4JWS C;  3TEY A;  4W9C A;  1SF0 A;  3N9Y C;  2WP9 B;  1FMA D;  3B2F A;  2KQ4 X;  2LUE A;  1B1Z A;  2PVG C;  2K5P A;  1PGB A;  3ZNH B;  1DOI A;  2CU1 A;  3AE2 B;  2DX5 B;  2H89 B;  4MGZ E;  2XK5 B;  5HFY A;  3DVN V;  1LFD A;  4IUM B;  1FM0 D;  1C77 A;  1RWS A;  3ZNI D;  1UGJ A;  1R4M I;  4LJP B;  2D3B A;  2K6D B;  1T0S C;  1NEN B;  4WQO B;  3VXW A;  1WIA A;  4HJG E;  4RGO S;  1P7E A;  3PHW B;  3AEB B;  4KIK A;  3EFU A;  1WE6 A;  3L16 A;  5GMV A;  3KUD B;  1XF5 L;  3UI3 A;  1VZ6 A;  1AW7 A;  3R66 C;  1QOB A;  2ZZP B;  3U4E G;  4EE2 A;  3KUC B;  1RM6 C;  4ZHO A;  2V1Y A;  2JXT A;  1L7Y A;  4ZHP A;  4MDK E;  3N30 A;  2JT4 B;  4K3C A;  2NBU A;  1OFF A;  1VRA B;  1WX8 A;  4GDL B;  5TR5 A;  4FJV B;  3IT4 B;  3VUY A;  2LGX A;  3DBS A;  5EE3 A;  1SJE D;  2X38 A;  4YTP B;  3MHZ A;  2MBH A;  3J9C A;  1PUT A;  2DYM A;  1I42 A;  3UGB B;  3AXC A;  4BBN F;  4GDL A;  1VZ8 A;  1WZ3 A;  3ZNZ B;  1WX7 A;  4BKS D;  3JYU A;  3KYD D;  1I4H A;  3ZTC A;  4GU2 A;  3W9C B;  1R7S A;  3FIL A;  1AAR A;  1EWY C;  3ABV B;  2IO0 B;  4ITK A;  3R7Q A;  1JML A;  4FUL A;  5DCN A;  3TCA A;  5AZF A;  4FHJ A;  1EU4 A;  2DYB A;  5JXV A;  1EF1 A;  3NZS A;  3HK0 A;  3VQI A;  3NVY A;  2RDB C;  2KLG A;  2DNF A;  2ZPN A;  4ZYS A;  1KFY B;  3UIP B;  4LDT B;  3O13 A;  2XK5 A;  2LJ5 A;  2KVZ A;  2WXP A;  2KN4 A;  3VDZ A;  2ZVN A;  2JUO A;  1SE2 A;  2LGS A;  3QWZ B;  5BO4 B;  1L2N A;  3CIR B;  4MSM B;  1I4X A;  1WGH A;  4B95 A;  1LO5 D;  1KTK A;  4FHK A;  2GBK A;  1SEB D;  2NCN A;  2CR5 A;  1XLP A;  2K3U A;  3BZD B;  2IZV B;  2KJ6 A;  1XLO A;  2WS3 B;  2RGF A;  3Q3O C;  2G45 B;  1WM3 A;  1R4N B;  5E6J A;  3A9K B;  5IO9 A;  1AWD A;  5E6O A;  1V86 A;  4IWQ A;  2M19 A;  2FCM A;  1ZUD 2;  1DYQ A;  3T3O A;  1Z2M A;  2CS4 A;  1F0Z A;  1YN5 A;  2HDE A;  1P1A A;  2N1W A;  3I9V 1;  3SHQ A;  3ZGZ A;  1HTQ A;  3X0W A;  1ZKH A;  3SFD B;  1IGD A;  3IHP C;  1QOF A;  3R2T A;  1C3T A;  1WM2 A;  2LZ6 A;  1Y56 A;  3RD2 A;  3ZQ4 A;  1C76 A;  2KAJ A;  3A1Q A;  1KH0 A;  2MBB B;  3X23 A;  4MEM A;  3ZRF A;  1XQQ A;  5EE9 A;  2WX0 A;  1I4R A;  2WDR B;  2BWF A;  2AEH A;  4NPN A;  4Q2J A;  3AE7 B;  3DPD A;  1TKG A;  2JWU A;  1HA5 A;  2JZ3 B;  1C4A A;  1C4C A;  3SU8 X;  3I63 C;  3ZLZ A;  4RM8 A;  4RNA A;  4KSK C;  2JSV X;  3AEA B;  2WXN A;  3B0A A;  3W1S A;  3MJW A;  1SIF A;  2DZJ A;  2QJL A;  1JWS D;  1A70 A;  3T8M A;  3URY A;  5JHB A;  2REX A;  4A6Q A;  3VRB B;  2TSS A;  3KWL A;  1Q5W B;  2FUH B;  1H4R A;  2BB6 A;  1JQ4 A;  2JYE A;  2GMI C;  4OZC A;  1CMX B;  3MJ5 A;  2KXJ A;  2PVO D;  3IT6 B;  3QIJ A;  1KLV A;  4LDT D;  3VHT C;  2YEP F;  2ZNV C;  4A55 A;  2ZJD A;  2IGG A;  4MM3 B;  3WCQ A;  4RF1 A;  3NRZ A;  3LJ3 A;  4HEA 1;  3BVZ A;  2LJI A;  4HCP B;  1FNU A;  4KSL C;  1OEY A;  4PS7 A;  3LYY A;  3RNA C;  2J0K A;  2KTF A;  1XCT L;  1BT0 A;  2PE9 A;  3PLV A;  2FIF A;  2BVC A;  3QAR A;  2NTT A;  3ZVV A;  4GIV A;  2IDY A;  2Y5P A;  2N7J A;  5JHA A;  2LHD A;  4PYZ A;  3AE3 B;  4ZRQ A;  4EEW A;  5LXI B;  2KZR A;  2L05 A;  1FEH A;  3KYC D;  1C78 A;  3VRA B;  2LHE A;  4XWT A;  3Q3N C;  2NPT B;  1IUE A;  3M62 B;  1SE9 A;  2DAJ A;  1GC6 A;  3Q8C A;  5BMG A;  1PFD A;  2A5U A;  2G4S A;  5AZG A;  2L0F A;  2V4L A;  1D5M C;  3E56 A;  4IKG A;  4P16 A;  1TBE A;  3U2S C;  1PQS A;  2INN E;  2Y5C A;  1KRH A;  2KQ7 A;  3ETR A;  1XLQ A;  5EE0 A;  4JWU C;  2W55 A;  2LVO A;  1GUA B;  2G4D B;  1STE A;  2IYD B;  3C0R B;  2BQQ A;  3L13 A;  1QQR A;  3TSS A;  2AQ2 B;  3Q69 A;  3VFK A;  5EE1 A;  3DBL I;  1E10 A;  2BYE A;  4KIK B;  3ZRC A;  2WXR A;  1JCK B;  1FCL A;  1JW9 D;  1NI3 A;  2QCZ A;  4G0N B;  3L17 A;  4EOY A;  4NJC A;  1WSP A;  3QC8 B;  4C4V B;  2XBB C;  1BML C;  1TZO A;  1E8W A;  1SXT A;  4NY0 A;  3L4P A;  2L76 A;  4DHZ B;  1JWM D;  3GP7 A;  2OED A;  2VH2 A;  4MH0 E;  1JAL A;  4GSW A;  3ZIM A;  1F1H A;  2Z0E B;  4W9H A;  4WWN A;  3AE6 B;  3Q3F A;  4K7U A;  4NZL B;  2EKI A;  1C4P A;  3C19 A;  3MP9 A;  1L0V B;  1Q10 A;  1PYW D;  3L0W B;  2WXO A;  2IPK D;  3P4Q B;  3QAQ A;  2K0P A;  2G3Q B;  4RH6 A;  4A9A A;  1JRO A;  1I4Q A;  3ZJT A;  3DBH I;  4YTN B;  5BYS A;  5G2N A;  2WU5 B;  2I2Y A;  4KZC A;  2C5L C;  4ANU A;  1GB4 A;  3VH4 B;  2JVC A;  3PRZ A;  2MW5 A;  1ENF A;  3P1M A;  3QCA A;  4IC7 B;  1JWB D;  5FKA C;  3AU5 A;  4KX6 B;  5E6P A;  3RMK C;  4RCO A;  1TJE A;  1FFV A;  4BKG A;  1LXD A;  1Q1O A;  2D5G A;  3N3K B;  5FR6 A;  1QZE A;  4ICU A;  2KTR B;  5DPR A;  4MAC A;  3PO0 A;  4KVG B;  4RFB A;  3HHM A;  2PTL A;  4W9F A;  1UWX A;  2IO2 B;  2RD0 A;  3ECI A;  1UEL A;  2BYV E;  5CTR C;  4LNI A;  2A4Z A;  4G3X B;  2D2Q A;  3P2B A;  2R2O A;  3H7S A;  2D07 B;  1DOY A;  2MWS B;  2W54 A;  3PZD A;  4DBG A;  3WAM A;  2PE6 B;  4HPL B;  2Z0D B;  3WAL A;  3HIZ A;  3AEF B;  2LGD A;  1FFU A;  2DZK A;  1T0R C;  2H88 B;  1JRU A;  2RDG A;  2YEP B;  1PGX A;  3GE3 C;  2HE7 A;  2PIA A;  5C1Z A;  3AEE B;  3MHS D;  4PS3 A;  3DQV A;  2OJW A;  4W9K A;  4LNO A;  2INP E;  1OQQ A;  2MJD A;  3GZN B;  3UQA A;  1P98 A;  4C4V A;  4JGH B;  2XEW A;  4BVU C;  2ZCB A;  3DVG Y;  2D3C A;  3NZ3 A;  1C9F A;  4DHJ D;  4WIP A;  2J4X A;  3APF A;  4C56 C;  4YSY B;  1TKY A;  3BYY B;  1EUV B;  1Q0W B;  4HK2 A;  2ZCC A;  1WFY A;  2K1F A;  3V6C B;  5CX3 A;  3W5U B;  3HM3 A;  3KVF B;  2PEA A;  5GXG B;  4DQO C;  3EGR A;  1N6Z A;  1F77 A;  4DHJ B;  3BVM A;  3BY4 B;  2L1A A;  2MHJ A;  1NVI D;  1JRP A;  2YVC A;  1SIJ A;  2KC2 A;  4CO7 A; 
#chains in the Genus database with same CATH homology
 2UWQ A;  1F9J A;  3KW5 B;  4EUT A;  2GOW A;  3OLM D;  1WJN A;  3CMM B;  2CHZ A;  3VDZ A;  2ZVN A;  2JUO A;  4K7S A;  3QWZ B;  3MTN B;  4RMA A;  1H8C A;  4NAW A;  3I3T B;  5BO4 B;  2EMT A;  3A33 B;  1L2N A;  3AI5 A;  4MSM B;  1V9J A;  1XT9 B;  1WGH A;  1WJ6 A;  2HD5 B;  4FN2 A;  4BKT A;  4B95 A;  2M1M A;  4GB9 A;  4FHK A;  4A3P A;  2GBK A;  2NCN A;  3U7D A;  2WDT B;  2KAN A;  2CR5 A;  3L08 A;  4IM0 A;  2C7H A;  2L8J A;  4FBJ B;  4WJN A;  2KNB A;  3M63 B;  1OGW A;  2IZV B;  2KJ6 A;  3VAW A;  3ONS A;  2HJ8 A;  3RZF A;  2RGF A;  2G45 B;  1UBI A;  1S1Q B;  1TTN A;  1WM3 A;  2O6V B;  3PSE B;  1WE7 A;  4GDK A;  3A9K B;  2ZNV B;  4NQL B;  4A20 A;  2ZPY A;  3OAW A;  4FLH A;  1Z5S B;  4HVB A;  1D3Z A;  1UBQ A;  1WXS A;  2L3Z A;  5IA7 A;  5E6O A;  4MJS B;  1V86 A;  1XD3 B;  2LVP A;  4ZRJ A;  5LLI A;  2WWZ A;  4FA6 A;  2MP2 A;  2K8H A;  4IWQ A;  4KDL B;  4TQ1 A;  1C1Y B;  3RYT A;  1IP9 A;  1G6J A;  2FCM A;  1YD8 U;  3JW0 X;  2LWP A;  2N9E B;  3WIM A;  2WYQ A;  2KFJ A;  3PPA A;  1Z2M A;  2NBV B;  3QA8 A;  1X1M A;  5CHW A;  2BKF A;  3KUZ A;  2J7Q B;  2CS4 A;  1UD7 A;  1E8Y A;  5IAA C;  1P1A A;  1WR1 A;  4OVV A;  3RUI B;  2C7M B;  2N1W A;  4XC2 A;  2CHX A;  3SHQ A;  2MQJ A;  1WX9 A;  3X0W A;  1WJ4 A;  4WJQ A;  5EDS A;  4BOZ B;  1V80 A;  1ZKH A;  2BYF A;  1UH6 A;  3DVG X;  3IHP C;  4IG7 B;  2OJR A;  1VCB A;  1C3T A;  3EC8 A;  1WM2 A;  3PGE A;  2KK8 A;  2LZ6 A;  3UF8 A;  3UIN B;  3B08 A;  4NAW B;  3RD2 A;  2ZEQ A;  3ZW3 A;  1E7U A;  2MBQ A;  2NR2 A;  4HLE A;  1WGD A;  2L00 B;  3NHE B;  3A1Q A;  4F8C B;  2I1J A;  2KMA A;  4TQ0 A;  2MBB B;  2KX3 A;  3NOB A;  3QJZ A;  3X23 A;  3APD A;  2AWT A;  3H7P A;  4G11 A;  4W9G A;  4B9K A;  4TKN A;  4ICV A;  4MEM A;  3ZRF A;  1XQQ A;  2L7R A;  2WX0 A;  4KDI C;  5J18 A;  3BIN A;  2BWF A;  4GN1 A;  2LD9 A;  2AEH A;  4II3 B;  4NPN A;  2NS5 A;  1OTR B;  3A4R A;  2JPH A;  2PJH A;  3DBR I;  4MGI E;  4DDG D;  4LJO B;  3DPD A;  4WWO A;  1KJT A;  1FXT B;  2MA9 B;  2JZ3 B;  5G55 A;  4MGY E;  3SU8 X;  3VVW B;  5D7G A;  1E7V A;  2NPT A;  3ZLZ A;  4RM8 A;  4KSK C;  2RPQ A;  4KZ0 A;  3B0A A;  1Y8R C;  3QX1 A;  1U4A A;  3W1S A;  1GNU A;  1TGZ B;  3MJW A;  4FJZ A;  1SIF A;  2DZJ A;  2KMC A;  3ZDM C;  4ZRI A;  1GC7 A;  1RFA A;  4W9L A;  4YL8 A;  2KX0 A;  4IW0 A;  3T8M A;  4MM3 A;  4E71 A;  2BF8 B;  1EO6 A;  3APC A;  3V61 A;  2JF5 A;  4BFR A;  3HM6 X;  3PS6 A;  4IWO A;  5JHB A;  2VRR B;  2REX A;  1WMH A;  2NVU I;  3AUL A;  5CHV C;  2MBO A;  2MSE D;  1Q5W B;  4URK A;  2GBR A;  4EZJ A;  2FUH B;  3A1Q B;  4WJP A;  1H4R A;  2D3G A;  2FAZ A;  2KFK A;  4II2 B;  4RM9 A;  4GGQ A;  2UYZ B;  4DDI D;  2GBJ A;  2FNJ B;  2C60 A;  2GMI C;  2YLM A;  1YJ1 A;  1CMX B;  1GG3 A;  2KXJ A;  2N4F A;  2R2Q A;  1WGG A;  3WAP A;  3RUL A;  2WX1 A;  3QIJ A;  1KLV A;  2W9N A;  3QQ8 B;  4EKU A;  1V49 A;  2KJR A;  4LDT D;  3VHT C;  5L83 A;  2ZNV C;  2ZJD A;  2L0T A;  2BGF A;  1WF9 A;  1WXM A;  1YQB A;  4MEL A;  4WAA A;  4EFO A;  5D2M B;  2KOX A;  1V81 A;  3GZN I;  4IWP A;  3LJ3 A;  4NQK E;  2AL6 A;  3Q3J A;  1V6E A;  4HCP B;  4KSL C;  1OEY A;  4PS7 A;  3VH3 B;  4PYU A;  3IBE A;  3TIX A;  3RCZ A;  2J0K A;  2KHW B;  4GXB A;  2KTF A;  3PRE A;  2MP2 B;  1BT0 A;  2JXX A;  2PE9 A;  4ANX A;  4IM3 A;  2C9W B;  2KTR A;  3PLV A;  4M8N A;  4AJW A;  4P7I A;  3NS8 A;  2DHZ A;  3ML8 A;  3JVZ X;  4XX5 A;  2FIF A;  4HDO A;  5AEK B;  3QAR A;  4BBN C;  2KWC A;  3S2A A;  1ZW7 A;  2IO3 B;  1I35 A;  1LQB A;  4ZRK A;  3ZVV A;  2DZI A;  4GIV A;  3V62 A;  1WMH B;  4LCD E;  4DXA B;  3PTF C;  2PPH A;  5JHA A;  2KWV B;  2GBM A;  4DHZ E;  4PYZ A;  4EEW A;  5LXI B;  2DYO A;  5HKH A;  2KZR A;  5KHQ A;  3H7P B;  2L05 A;  1KM7 A;  3H9D A;  3KYC D;  1MG8 A;  3V6E B;  3ZDT A;  1RAX A;  4IM2 A;  3W1Y A;  3CSF A;  1WXA A;  4F7Z A;  1WH3 A;  2DAF A;  2D11 A;  2K8B A;  3K9P B;  4KV2 A;  4WWP A;  4HXD A;  1J0G A;  2NPT B;  4W9D A;  3M62 B;  1SE9 A;  2DAJ A;  1GC6 A;  1WXV A;  2IO1 B;  3EHV A;  2IBI B;  3A9J A;  4DWF A;  2LXC A;  3ZKJ C;  2AYO B;  4HDQ A;  4ANW A;  1K8R B;  1E8X A;  1E90 A;  2K8C A;  2A5U A;  2G4S A;  4MSQ B;  5AZG A;  5AZH A;  3ZO5 B;  2JY6 A;  2L0F A;  4HPM B;  4JL9 A;  2KC1 A;  1WYW B;  2V4L A;  1P9D U;  3PV1 A;  4E3C A;  1TBE A;  4BOS C;  1P0R A;  4HWI B;  2K6Q A;  1PQS A;  3OJ4 B;  4PS8 A;  2JZZ A;  3K9O B;  4HJK A;  2CHW A;  1V5T A;  3RT3 B;  4W9I A;  5L95 C;  2KQ7 A;  1P3Q U;  4WJO A;  3T9L A;  1OEY J;  1YIW A;  2ASQ A;  2EMS A;  3CF6 E;  2JRH A;  2LVO A;  5JH5 C;  4ANV A;  1GUA B;  2G4D B;  2IYD B;  3C0R B;  2LAS A;  3DCG A;  4NJ7 A;  3L13 A;  2J0M A;  3A9J B;  3PRM B;  2QHO A;  3VFK A;  4I6P A;  2MCN B;  2JRI B;  3DBL I;  1WJU A;  2BYE A;  1SGH A;  3OJ3 A;  3JSV A;  1IYF A;  4KIK B;  1V2Y A;  3ZRC A;  2OOB B;  1WR6 E;  2LGY A;  3A9K A;  4X57 B;  4G0N B;  4M8M A;  3L17 A;  4EOY A;  5J2R A;  3KH0 A;  4NJ6 A;  1NI2 A;  3QC8 B;  2XBB C;  4GOC A;  4ZDV A;  4K1R B;  3GOE A;  2K25 A;  2FCS A;  1TZ1 A;  1NBF C;  2O6V D;  3ENE A;  4B6W A;  2MX2 A;  1J8C A;  1WGR A;  2KJH B;  2O2V B;  4EZL A;  5KHO A;  1E8W A;  2MLB A;  2LRW A;  4AWJ A;  4NY0 A;  3TJP A;  2N9P C;  1WGY A;  2L76 A;  4TUU A;  3PVL A;  3R3M A;  4DHZ B;  4A3O A;  3V60 A;  3UIO B;  4MGK E;  4MH0 E;  3U30 A;  3AU4 A;  4GSW A;  3ZIM A;  2Z0E B;  4W9H A;  3TMP B;  1UGM A;  4WWN A;  1IPG A;  1J19 A;  3PT2 B;  3IFW B;  3Q3F A;  4K7U A;  3QHT A;  2IY0 B;  2BKR B;  3TL5 A;  3W1S C;  1GJZ A;  4F1S A;  4I6L B;  2KQS A;  2N7D A;  3DDC B;  2K39 A;  2D10 A;  4CYE A;  2O6V A;  4GDK B;  3VUW A;  2ZVO A;  3WAN A;  4W9C A;  3A4S C;  3L0W B;  3L54 A;  2AL3 A;  3QAQ A;  1UZX B;  2LUE A;  1WI0 A;  2G3Q B;  3WA0 A;  2LRU A;  1YX6 B;  3DBH I;  3DOW A;  2KDF B;  5D6J B;  4NNJ B;  5G2N A;  3ZNH B;  2KKC A;  2CU1 A;  4KZC A;  1WZ0 A;  5CHF A;  3VTU A;  2C5L C;  4ANU A;  2BWE S;  3VH4 B;  4FJY A;  2DX5 B;  2JVC A;  4MGZ E;  2XK5 B;  3PRZ A;  3PHX B;  2MW5 A;  3DVN V;  4JQW C;  5DPT A;  1LFD A;  3QCA A;  1S3S G;  4IC7 B;  4IUM B;  3ZNI D;  1EF5 A;  2NBW B;  4GMV A;  3AU5 A;  5E6P A;  1R4M I;  4M0W B;  1RRB A;  5DPS A;  4LJP B;  4BKG A;  3H6N A;  1M94 A;  1LXD A;  2KD0 A;  2K6D B;  1Q1O A;  3N3K B;  5FR6 A;  4WQO B;  4E74 A;  1NDD A;  5D94 A;  3TBL D;  3VXW A;  1QZE A;  3NY5 A;  4ICU A;  3ZUN A;  1WIA A;  3NZU A;  2KVR A;  2GBN A;  3B1L X;  4ZYN A;  2IY1 B;  3PHW B;  2LXA A;  1HE8 A;  3U8Z A;  3ZNG C;  2FID A;  3VTW A;  2KTR B;  3ML9 A;  2KDE B;  5DPR A;  2M0X A;  4KIK A;  3EFU A;  4KVG B;  1WE6 A;  2KDI A;  1VD2 A;  3HHM A;  2RSU A;  3L16 A;  5GMV A;  3KUD B;  2J0J A;  2N7E A;  4W9F A;  3IG3 A;  2IO2 B;  2RD0 A;  3ECI A;  2M4N A;  1UEL A;  1R4N I;  2EKE C;  3CST A;  2BYV E;  4K7W A;  4MJS A;  5CTR C;  3WAO A;  4TV3 A;  2A4Z A;  4G3X B;  3R66 C;  2D2Q A;  3P2B A;  2R2O A;  3H7S A;  2KDB A;  2ZZP B;  5JZE B;  5J17 A;  2LVQ A;  2D07 B;  2Y5B B;  3M95 A;  2MWS B;  3PZD A;  4AUQ C;  3KUC B;  4DBG A;  1I42 A;  5LXH A;  3WAM A;  1ZGU B;  2RR9 A;  3PLU A;  2PE6 B;  2MBE A;  2FCN A;  4HPL B;  1E8Z A;  2KN5 A;  1V5O A;  2V1Y A;  1ISN A;  2Z0D B;  1L7Y A;  2JWZ A;  4MDK E;  3WAL A;  3N30 A;  1T0Y A;  3HIZ A;  5E6N A;  2JT4 B;  2NBU A;  2LGD A;  3ALB A;  3L10 B;  4J6I A;  2DZK A;  1WX8 A;  4GDL B;  5TR5 A;  4HCN B;  4FJV B;  1JRU A;  3VUY A;  1A5R A;  4W9J A;  4JLC A;  2LGX A;  2Z59 B;  3DBS A;  2HE7 A;  1WY8 A;  2N1V A;  5C1Z A;  3MHS D;  4AJY B;  4PS3 A;  2MBH A;  2BPS A;  4OVU A;  2KFK B;  2HTH A;  3DQV A;  4W9K A;  2DYM A;  2KO3 A;  3UGB B;  4I6N B;  3QK0 A;  3VUX A;  3AXC A;  4BBN F;  4GDL A;  4W9E A;  1WZ3 A;  3ZNZ B;  4CO7 A;  1WX7 A;  4BKS D;  4JIO U;  3LDZ E;  1KOT A;  5C23 A;  3JYU A;  4FAD A;  3SDL C;  3KYD D;  2M8S A;  2O2V A;  3DVN U;  4K81 A;  4N9F 4;  1OQY A;  3ZTC A;  4GU2 A;  4AOF A;  3UQA A;  1P98 A;  2CKH B;  2MRP A;  4AP4 C;  4EZK A;  2FCQ A;  3VTV A;  1AAR A;  2LI5 A;  1E5W A;  4JGH B;  4ASW C;  2XEW A;  2IO0 B;  4BVU C;  2C7N B;  2ZCB A;  3JSV B;  3DVG Y;  3H1U A;  4DHJ D;  5DPW A;  2M17 A;  2V3S A;  3APF A;  3R7Q A;  3IVF A;  3EEC A;  4XZ4 A;  4FUL A;  5DCN A;  3TCA A;  5AZF A;  2I1K A;  4FHJ A;  2DYB A;  1EF1 A;  1EUV B;  1Q0W B;  3NZS A;  1RLF A;  3HK0 A;  2ZCC A;  4HK2 A;  3VQI A;  1WFY A;  2K1F A;  4CHK A;  3M3J A;  3UQB A;  3V6C B;  2KWU B;  5CX3 A;  3R7R A;  2DEN B;  3HM3 A;  2KLG A;  3KVF B;  3SD5 A;  2PEA A;  3O65 B;  3D32 A;  2ZPN A;  4BKS A;  1WRD B;  3ZTD A;  3RZW C;  2N9X A;  1LM8 B;  2KLC A;  3UIP B;  1YX5 B;  4G50 A;  3BY4 B;  3N32 A;  2B3A A;  4DHJ B;  3PRP B;  4LDT B;  2DZM A;  4DK5 A;  2YVC A;  2XK5 A;  2KC2 A;  2LJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...