3Q3JA

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
111
structure length
102
Chain Sequence
LIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKQRPRAVDMDLEWRQGRIARVVLQDEDITTKIKRLNTLMHYQVSDRSVVALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/protein binding
molecule keywords Plexin-A2
publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
total genus 23
structure length 102
sequence length 111
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3q3jA00
1WXVA 2FIFA 1RFAA 1G6JA 2L05A 2JZ3B 2ZVNA 1E7UA 3VUYA 3KYCD 1H8CA 3KYDD 4WJNA 4HDOA 2DHZA 2GOWA 4EZJA 4TUUA 1P0RA 4W9GA 2L7RA 2WX1A 1E8YA 1S3SG 2FNJB 2MSED 1GC7A 2CHWA 4KSKC 2B3AA 2KO3A 3VXWA 2XEWA 3APFA 3AU4A 1WGHA 5J17A 4K7WA 5AZHA 3JW0X 4AJYB 2FUHB 2L76A 4E71A 1XQQA 2M4NA 3DVGX 4A3OA 1WX8A 4AOFA 1V5TA 2KFJA 4JGHB 2M17A 4JLCA 2Z0DB 2XK5B 1EUVB 2OJRA 2LGYA 3UQAA 5CHWA 2M1MA 5FR6A 3A9JB 4PS3A 4WWOA 1SE9A 2DZMA 2IO1B 4GMVA 4NQKE 3V6CB 3TL5A 1P9DU 3H7PB 3APDA 2O2VA 3L10B 4NY0A 1VD2A 4KIKB 1WY8A 3VH4B 1UZXB 4G11A 4TQ0A 3EC8A 2N1WA 2ZZPB 1AARA 2MW5A 1WFYA 2LWPA 1V6EA 2LXCA 4AUQC 3ZVVA 1WM3A 2KWCA 3RUIB 2BWFA 4YL8A 2A5UA 1I42A 2L8JA 4II3B 3ZRFA 2M8SA 4RMAA 1WF9A 2MBEA 1V86A 2Z59B 3GZNI 2L0FA 3QQ8B 3ZNID 4GDKB 2MRPA 1UBQA 2A4ZA 1X1MA 1WI0A 2HJ8A 1K8RB 2O6VD 4W9KA 4DHZE 3TBLD 4TKNA 3QAQA 2NCNA 3IG3A 4MDKE 2IZVB 1HE8A 1A5RA 1KJTA 2KFKA 4ZDVA 4E3CA 3M95A 3PRZA 1KOTA 1YIWA 4MGKE 3KUDB 4JQWC 4IWOA 2MBOA 3D32A 3A9KB 1GUAB 3OAWA 1E90A 3L16A 2R2QA 1WXAA 2WYQA 1MG8A 2G4DB 4I6NB 2NPTA 4ANWA 3QCAA 3APCA 4FN2A 1IPGA 1P1AA 2CU1A 2WX0A 3VH3B 1I35A 2KMCA 3R7RA 3R66C 2AWTA 5E6NA 3SHQA 3V6EB 4DK5A 2K39A 1GJZA 1KLVA 4BKTA 2LRWA 1IP9A 4KDIC 3Q3FA 1PQSA 4F7ZA 2DYMA 4LJOB 2D10A 5HKHA 3DOWA 1IYFA 4EZLA 2BYVE 4FADA 1WJ4A 2MX2A 1WGDA 1WE6A 2L00B 3B1LX 1JRUA 2JF5A 3PREA 4GXBA 4EFOA 5DCNA 2PE9A 2I1KA 3PT2B 2Z0EB 4IC7B 1Q1OA 2BPSA 4A20A 2LVOA 4GSWA 5D2MB 2DENB 2LD9A 2KTRA 3M62B 4X57B 1WJNA 2JVCA 3M3JA 5L83A 2BF8B 3ML9A 5BO4B 3QIJA 4GDLA 1E8XA 2K8CA 4DHJB 3PSEB 1NI2A 4N9F4 4FJYA 2KVRA 3DBSA 4FHJA 1LXDA 3KH0A 1FXTB 2G4SA 5C23A 3T9LA 4B9KA 2N7EA 2RR9A 4G50A 3PGEA 1RRBA 1P3QU 3TMPB 1WMHB 1E5WA 1LFDA 1P98A 2DAFA 4WJQA 2V4LA 3ZTCA 3ZRCA 1YX6B 4EZKA 2L0TA 4IM0A 3DBLI 3SD5A 3RZWC 3U7DA 2KTFA 2MLBA 3JVZX 2LRUA 2CKHB 2VRRB 4PYZA 3W1YA 3R3MA 3L0WB 4FA6A 4FULA 2GMIC 4FJVB 5J2RA 2KLGA 2DAJA 2JT4B 2MP2B 2MWSB 4GU2A 2JY6A 4ANVA 4MELA 3ZKJC 2KD0A 3DPDA 3RT3B 4II2B 1WZ3A 3ZNGC 3JSVB 2IYDB 3IBEA 5JHAA 3A1QB 4GN1A 2R2OA 1V2YA 4M8NA 1BT0A 1OGWA 3PHXB 4W9IA 2BKRB 4RM8A 4M0WB 3VUXA 1E8WA 1R4NI 1UGMA 2LGDA 3DVNU 3UIPB 4CYEA 5AZFA 4EEWA 2FCNA 2IY1B 5IA7A 2GBRA 2KDEB 4W9DA 4B6WA 4G0NB 2JZZA 1WGRA 4ASWC 2J0MA 2N9XA 3SDLC 3QHTA 2K6QA 3W1SC 1EF1A 4MSQB 1Q0WB 5CHVC 2KX0A 1M94A 3VAWA 3ZIMA 4AJWA 2AL3A 2NBUA 4F1SA 1ISNA 2LUEA 1YJ1A 4HJKA 1V49A 3UQBA 1WXMA 2ASQA 3QWZB 2ZEQA 3U30A 2KHWB 3RYTA 2KDIA 1C1YB 4XX5A 3H9DA 3IHPC 2GBNA 4HCPB 2C9WB 2Y5BB 2BYFA 3ZNHB 3NY5A 2CHXA 3PRMB 3IVFA 3C0RB 1GG3A 1UH6A 2NVUI 2KOXA 4MEMA 5CTRC 4TV3A 2GBMA 1ZKHA 4OVUA 3AULA 3PVLA 4MJSA 4BBNC 5G55A 4DHJD 3WALA 5AZGA 1L7YA 3PRPB 1UBIA 3QJZA 3PV1A 4M8MA 4PS8A 4W9CA 4MH0E 5D6JB 3PTFC 3TIXA 4DDGD 2CHZA 2O6VA 2KKCA 3CF6E 3SU8X 5DPRA 5GMVA 1S1QB 3B0AA 4FBJB 5D94A 3OLMD 3MJWA 2BKFA 3ZW3A 1U4AA 3ZO5B 2KNBA 1WGGA 2GBJA 2D3GA 3RULA 3LDZE 3ZTDA 3NOBA 1Y8RC 2FIDA 4WQOB 1F9JA 4OVVA 2K1FA 2N4FA 4KZ0A 3ENEA 4BKSD 2RPQA 2KN5A 2K8BA 3WIMA 1LQBA 2EMSA 4ICUA 2NBVB 3AXCA 3W1SA 2W9NA 3ONSA 1RAXA 2AL6A 1WZ0A 2WWZA 1C3TA 1TBEA 4NJ6A 3DCGA 3ZDTA 3M63B 3RCZA 2HE7A 2JXXA 1WX9A 3HK0A 3Q3JA 1NBFC 2O2VB 4EKUA 1SGHA 1Q5WB 3KW5B 4WAAA 3UGBB 4JIOU 3RZFA 4WWPA 1V9JA 4XZ4A 5DPSA 3DVGY 3PS6A 2IO2B 3N3KB 3VVWB 3AU5A 2ZNVB 1J19A 3NZSA 4FLHA 4HLEA 5J18A 3ZLZA 4FHKA 5LXHA 3UIOB 1XD3B 4W9EA 2ZCCA 1V80A 1EO6A 2V3SA 3CSTA 3V62A 1J8CA 4GOCA 2XK5A 4W9JA 4FJZA 2LASA 2KMAA 4EOYA 3K9PB 1WX7A 1Z2MA 2KZRA 2LI5A 4F8CB 2BGFA 2KK8A 3A9JA 3TCAA 5C1ZA 4URKA 3EFUA 2MBHA 2UYZB 3AI5A 3H7PA 2KFKB 4KIKA 4IW0A 3X0WA 2XBBC 4LJPB 2PPHA 2N1VA 5JHBA 1TGZB 4PS7A 4W9FA 4DHZB 4E74A 4IM3A 4A3PA 3KVFB 2YLMA 3KUCB 3DBHI 2ZCBA 4ICVA 2DZKA 2KDFB 3WAPA 2JPHA 3ML8A 4MM3A 2JUOA 3HHMA 3VHTC 1LM8B 2NPTB 3PZDA 3N32A 2OOBB 3JYUA 3L54A 2L3ZA 3TJPA 2D07B 4MGYE 2LVQA 2ZNVC 4GDKA 4ZRIA 4NQLB 4AWJA 1WM2A 2DZIA 2NBWB 2FAZA 2K8HA 2JWZA 1RLFA 4GGQA 1VCBA 4NNJB 1ZW7A 2MCNB 2KWUB 2QHOA 2I1JA 5G2NA 2G45B 2KQSA 3H7SA 4IWPA 3ALBA 1YQBA 2KX3A 3VUWA 3DBRI 1ZGUB 4CHKA 4NAWB 2ZPNA 3U8ZA 3OJ3A 3N30A 4KDLB 2PEAA 3A9KA 4BBNF 1E8ZA 3GOEA 4NPNA 2ZJDA 4RM9A 2FCMA 5L95C 3HM6X 5AEKB 4AP4C 3A33B 1OQYA 1XT9B 1QZEA 2HTHA 2KTRB 2MBBB 3VQIA 4DBGA 5KHOA 2NS5A 4GDLB 3ZDMC 2J0KA 4HCNB 4HWIB 1T0YA 2EMTA 4IG7B 4CO7A 1OTRB 2FCSA 2GBKA 3IFWB 2YVCA 4ZRKA 4HXDA 4K7SA 4ANXA 1WIAA 4MSMB 3PPAA 2LGXA 3P2BA 4JL9A 5DPWA 2ZVOA 3B08A 2BWES 4HDQA 3UINB 4W9HA 2C7MB 2FCQA 2C60A 3S2AA 2K6DB 3OJ4B 2WDTB 4GB9A 1WXSA 5LXIB 2IY0B 1GNUA 4HPLB 3QA8A 4WJOA 3QARA 2KJHB 4J6IA 5CX3A 2G3QB 2KWVB 3WAOA 3X23A 1V5OA 2REXA 4ANUA 3WA0A 2KC1A 3UF8A 4PYUA 2LZ6A 3KUZA 3L17A 1TZ1A 4K1RB 5E6OA 4BKGA 2UWQA 4XC2A 3DQVA 2PJHA 3WANA 4KSLC 2EKEC 4KVGB 3V60A 2AEHA 3QC8B 3BINA 3QX1A 5DPTA 2DZJA 4WJPA 3HIZA 2LVPA 3VTUA 1WMHA 4DWFA 2KC2A 2N7DA 2C7HA 2K25A 4WWNA 1EF5A 2KLCA 3LJ3A 2CS4A 4LCDE 4P7IA 5LLIA 3RD2A 1E7VA 2N9PC 3H6NA 2BYEA 3A4RA 4ZRJA 3WAMA 5JZEB 1WR1A 1Z5SB 4EUTA 5D7GA 5JH5C 4BVUC 1KM7A 1WYWB 4DDID 1YX5B 2IO3B 2AYOB 5E6PA 3H1UA 4ZYNA 3DDCB 4DXAB 4LDTD 4KZCA 2ZPYA 2C5LC 3HM3A 3T8MA 1WGYA 2V1YA 4BKSA 3BY4B 1UD7A 1WJ6A 2KJ6A 5KHQA 1R4MI 2MBQA 3ZUNA 1OEYJ 2J7QB 1WR6E 2D11A 2MP2A 1TTNA 2JRIB 2MQJA 4I6LB 1NDDA 2JRHA 3O65B 4W9LA 4KV2A 3JSVA 4GIVA 4HK2A 3A1QA 4TQ1A 5TR5A 3VDZA 3QK0A 3V61A 3L08A 4BOZB 4K81A 3L13A 2NR2A 2IBIB 3CMMB 4HVBA 4NAWA 1D3ZA 2J0JA 3NZUA 4HPMB 4BFRA 3EHVA 1GC6A 2RSUA 4IWQA 1CMXB 2LXAA 4MJSB 3NHEB 5CHFA 4K7UA 2HD5B 5EDSA 4BOSC 2KDBA 1H4RA 4G3XB 4B95A 3EECA 2MA9B 4IM2A 2RD0A 3CSFA 3K9OB 1OEYA 2DX5B 1J0GA 2O6VB 3R7QA 2PE6B 2DYBA 4NJ7A 1UELA 1WE7A 2IO0B 3MTNB 4MGZE 2C7NB 3I3TB 4I6PA 2DYOA 2CR5A 1WH3A 3VTVA 1YD8U 2KQ7A 3VFKA 3ECIA 3MHSD 3PHWB 3A4SC 2M0XA 4LDTB 1SIFA 2N9EB 5IAAC 2KXJA 1WJUA 1V81A 2LJ5A 2D2QA 3PLVA 3NS8A 3ZNZB 3PLUA 2KJRA 3VTWA 1L2NA 1WRDB 4IUMB 2RGFA 4MGIE 2KANA 3DVNV
chains in the Genus database with same CATH superfamily
4YTPB 2L05A 2WDQB 4DXFA 4A9AA 1FFVA 1ZE3D 3KYDD 1DGJA 1NENB 4US8A 1VZ7A 2WX1A 2WXFA 1GC7A 4AQ7A 3VXWA 2BYTA 5J17A 4K7WA 5AZHA 3VR9B 3R2TA 1CQVA 4E71A 1XQQA 2M4NA 4JGHB 4YTMB 4JLCA 2OJRA 2LGYA 1WXQA 2PVOD 3L4PA 3P4PB 1CK1A 3TL5A 3CWIA 1VD2A 4KIKB 2LGIA 4G11A 2YEPB 1XCQL 5HFYA 3E9SA 1KLUD 2LWPA 2LXCA 1L4DB 3ZVVA 2WU2B 3RUIB 1WF9A 2KMMA 1V86A 2L0FA 3ZNID 4GDKB 2MRPA 2A4ZA 4P16A 1X1MA 2O6VD 3QAQA 1L5PA 1HE8A 4E3CA 3M95A 3KUDB 3A9KB 1KFYB 2WYQA 2NPTA 1ACCA 2PMVA 2W54A 2DWQA 3SHQA 3V6EB 1XLQA 1IP9A 1PQSA 4UDUC 2N0SB 2Q5WD 1IYFA 3R8BA 4JE3B 1SE4A 3B1LX 2JF5A 1DOXA 2PE9A 4IC7B 4K3BA 2DENB 4X57B 1GPXA 1AW7A 2JZPA 2XN9C 3QIJA 4MACA 3BIID 3DBSA 1C79A 2RR9A 3PGEA 1P3QU 1K52A 3EUB2 1I4HA 1SEBD 4A6QA 2V4LA 1N63A 3MFGA 4PYZA 4A55A 3R3MA 1FEHA 4FULA 3RNCC 4FJVB 2KLGA 2INPE 3BYTB 2MWSB 3AE1B 2KT7A 3ZKJC 3RT3B 4II2B 2LHDA 4JX1C 3IBEA 1K51A 5BMHA 1V2YA 3VUXA 1RWSA 1STEA 2LGDA 3DVNU 5EE1A 3UIPB 4CYEA 1D4BA 5IA7A 1JRPA 4YTNB 1D6EC 1RYJA 5CHVC 3BK1A 2V0GA 2NBUA 1ISNA 4HJKA 2BBCA 2NTSA 3U30A 2JSVX 2VZKD 2Y5BB 2KYWA 1UH6A 2NVUI 4OW0A 4OVUA 4YWGG 2N9LA 3FILB 3H8HA 5AZGA 1L6UA 4PS8A 4XWWA 1SE2A 2O6VA 2BS3B 3W9CB 3Q3MC 4LLGM 3KWLA 3P4RB 3OLMD 1T5XD 2BKFA 2PLPA 3BWUD 2J4XA 1SJED 1T0SC 3HVZA 1Y8RC 1F9JA 2WXJA 4BKSD 2V9HA 2WXPA 2KN5A 3WIMA 2WXMA 1WZ0A 2M56B 1JWSD 1FM0D 1D5XC 2D3BA 1GOZA 3ZDTA 3M63B 1TKYA 1WX9A 2WXHA 3UGBB 3RZFA 1V9JA 1E6EB 3ETRA 3PS6A 3NZ3A 2WQYB 4XDCA 1JCKB 2J53A 3O13A 4FLHA 4J3OD 4HLEA 5BYSA 1V80A 1EO6A 1J8CA 4GOCA 1ZUD2 4JWSC 1C4CA 1WX7A 2KZRA 2LI5A 1ZP0B 3Q8EA 2KK8A 2JWUA 3A9JA 3TCAA 2KFKB 3Q2AC 4IW0A 4WURA 1DOYA 4NJCA 1TGZB 4W9FA 4DXGA 4XDDA 1QOAA 3FC4A 3KUCB 1ZXIA 1J7BA 4ICVA 4R3DA 3WAPA 1KH0A 3HHMA 1LM8B 2AX5A 3B2FA 4TSSA 2D07B 2LVQA 4NQLB 1VJKA 5IOIA 2WXIA 1RLFA 1UWXA 1VCBA 1YQ4B 1ZW7A 4GGQA 2KWUB 1L0VB 2KQSA 2K22A 3ALBA 1ZGUB 1F77A 3U8ZA 4S17A 1MPEA 2PEAA 4M02A 4NPNA 4AP4C 3A33B 3VQIA 4DBGA 2LMCA 3KLSX 1JMLA 4XE0A 3ZDMC 4IG7B 1OTRB 2FCSA 2YEPF 2K5PA 2LGXA 1UGJA 4JL9A 5DPWA 1NYQA 2ZVOA 2BWES 3W5UB 4W9HA 3S2AA 3OJ4B 5LNK1 1XXGA 2IY0B 4HPLB 3QA8A 3QARA 2Y5PA 1IGDA 5CX3A 4HKZE 4MH8A 1T0RC 2KWVB 1V5OA 4ANUA 5D3IB 3UF8A 1ROEA 3KUZA 2INDC 4K1RB 2K0PA 5FR3A 1AN8A 2PJHA 4KSLC 3DWGC 5AUKA 3V60A 2V4IB 3B9JA 4ZHOA 2V3NA 3HIZA 2LVPA 3AECB 3VTUA 4DWFA 2N7DA 2C7HA 4WWNA 1EF5A 3LJ3A 4RGMA 1E7VA 1C78A 5H8YE 1J7CA 2OJWA 5JZEB 5JH5C 4HJGE 1KM7A 2IO3B 5E6PA 5C3JB 1QOBA 3H1UA 2V3PA 3HM3A 4BKSA 3BY4B 1JW9D 4B0EA 1WR6E 1TTNA 2JRIB 1FRRA 3O65B 2IJ0A 1YQ3B 4W9LA 4KV2A 2BS4B 3KWVA 2MEKA 4TQ1A 2D3CA 5TR5A 3V61A 3L08A 4M0WA 2NR2A 3CMMB 1D3ZA 3Q6BA 3MC8A 1I4PA 1PUTA 4MJSB 3NHEB 1AYFA 2HD5B 1EM7A 1SSNA 2EKIA 1H4RA 3NUHB 4G3XB 4B95A 1MHXA 1TS3A 2QCZA 3K9OB 2DX5B 1J0GA 2G9HD 3R7QA 2L32A 1TY2A 4P1CC 2C7NB 3W5VB 1ZDVA 3VFKA 3MHSD 1VR9A 1TZOA 2N9EB 1SBBB 1V81A 1PGBA 3VTWA 2RGFA 2KANA 4OHJA 3P42A 2FIFA 1RFAA 4LNIA 1K50A 3VUYA 2QMTA 1H8CA 2DHZA 4EZJA 1JWAD 4K3CA 4W9GA 2B3AA 1IBXA 2XEWA 1NVID 1MI0A 1WGHA 2FUHB 1MG4A 2L76A 2DNFA 3TEXA 1WX8A 4AOFA 4OZBA 1XLPA 2WP9B 4PS3A 3WCQA 4GMVA 3H7PB 3RPFC 3APDA 3DHGC 1CJEA 3EC8A 2MW5A 1WFYA 1UUPA 1V1PB 3P4QB 2BWFA 4YL8A 1VLBA 2JXTA 3MHZA 2L8JA 4MM3B 1L6VA 2MJ3A 4II3B 4RMAA 4H2AA 5H92C 1K8RB 4W9KA 1N6ZA 2W3RA 2WXLA 2NCNA 4MDKE 1TT5B 4US9A 4ARIA 3PRZA 2NTTA 2CJNA 1K53A 3D32A 2ZW1A 3AEEB 3L16A 3Q3OC 1WXAA 1MG8A 2G4DB 1FXAA 4ANWA 3APCA 3Q8FA 3DBLB 3VH3B 2KMCA 3HRDD 3R7RA 5E6NA 1GJZA 3AEAB 1F2RI 2X8XX 4KDIC 3Q3FA 1J7AA 2DYMA 5HKHA 2DLBA 1WJ4A 2MX2A 1C76A 3DWMA 4GXBA 1JRUA 4EFOA 2Z0EB 3TUOA 2LVOA 2PKOA 4GSWA 1MJDA 5L83A 1FMAD 1NI2A 4FJYA 4FHJA 1WYGA 2G4SA 4TMAB 3IXSA 3TMPB 4YSXB 1E5WA 1PFDA 4ZOHC 1P98A 3ZTCA 3ZRCA 2L0TA 3DBLI 1OQQA 3RZWC 3JVZX 2MLBA 3NS1A 1XO3A 2CKHB 2GMIC 2LFIA 4RH6A 3T3OA 2ZW0A 2MP2B 2WXKA 3TEZA 4ANVA 1WZ3A 3ZJVA 3JSVB 4GN1A 2EELA 2LEKA 4M8NA 4C7YA 1E10A 4EEWA 5TSSA 1NEKB 2IY1B 4W9DA 2JZZA 2BTEA 2K6QA 1EF1A 2KX0A 4ZYSA 4AJWA 1UNSA 4M00A 3QWZB 1C1YB 1IGCA 3H9DA 3ZJUA 1EWCA 4LNFA 3J9CA 3ZNHB 1WSPA 2CHXA 3NY5A 3P1MA 1R4MB 4MEMA 4TV3A 2GBMA 4BBNC 3WALA 1E7PB 3PRPB 4M8MA 1SB3C 4EE2A 5D3DA 2W82A 3TIXA 3SEBA 2CHZA 4N58A 2KKCA 3SU8X 5DPRA 1I7HA 5GMVA 3B0AA 2J52A 5D94A 3MJWA 1N5XA 3ZO5B 3LDZE 2FIDA 4KZ0A 2WGSA 5G5GA 2RPQA 4FXCA 2K8BA 1B1ZA 1LQBA 4YT0B 3W1SA 2K9XA 2BB6A 3GB1A 3OG5A 2HE7A 2JXXA 2O2VB 1SGHA 1Q5WB 3KW5B 4RFBA 4WAAA 2IGHA 3ZGZA 4XZ4A 4JPSA 3DBRB 3N3KB 1SE3A 1J19A 2WNMA 5LXHA 1VZ8A 3UIOB 4W9EA 2WXNA 2ZCCA 2V3SA 3CSTA 3V62A 2BS2B 2BB5A 2LASA 3K9PB 1PGXA 1XEEA 4URKA 3EFUA 4KIKA 2WLBA 2XBBC 4LNOA 1YMHE 3AH7A 5BYRA 3E56A 4DHZB 2IPKD 4A3PA 2YLMA 2Y3AA 3LB8C 2DZKA 2KAJA 3ML8A 2JUOA 2G1EA 3N32A 1NI3A 3L54A 1QILA 2B76B 4MGYE 4GDKA 4ZRIA 1WM2A 1N62A 1VRAB 2DZIA 2NBWB 2JWZA 2X38A 2INNE 3IT6B 1N60A 3H7SA 2KX3A 3DBRI 2CJOA 4NAWB 2QC8A 3GZNB 4N6EB 3N30A 4ZRPA 4KDLB 1KLGD 1RFKA 1E8ZA 3A9KA 2FCMA 2KTRB 4KGTA 2MBBB 5KHOA 4GDLB 1UF0A 3AEDB 1TS5A 3IFWB 4GLSC 4ZRKA 4K7SA 1SF0A 4MSMB 1FPYA 3P2BA 4HDQA 3UINB 3VRAB 4ACFA 2FCQA 2K6DB 1L0YB 2WXOA 1WXSA 1GNUA 3NG0A 5GXGB 4XYCA 3X23A 3WA0A 4PYUA 1TZ1A 4BKGA 4LTUA 3WANA 3I63C 1QF6A 3QC8B 3BINA 2DZJA 3EFCA 5MPOA 2W3SA 4P7IA 1TJEA 2WXGA 2KQ4X 2D3AA 3A4RA 3WAMA 1L0XB 2D5GA 1HEZE 5D7GA 4BVUC 3DDCB 3MJ5A 4RF1A 3SFEB 4LDTD 2ZPYA 2V1YA 3V3XA 1WJ6A 1R7SA 4ZHPA 5KHQA 2MBQA 4M01A 3ZUNA 2MQJA 3BVZA 4ARCA 1FNUA 1JWMD 1TKEA 3C8YA 3Q14C 1FRDA 3AE6B 4NAWA 2GLSA 4HPMB 5IKCM 4IWQA 1GC6A 3BVMA 2LXAA 1YN5A 5CHFA 4K7UA 2FE8A 3RMKC 3I57A 1ZXHA 3MC9A 3NJTA 4S0RA 2MA9B 4IM2A 2RD0A 2ACZB 1WE7A 1EU3A 4I6PA 2FBWB 2KQ7A 4HROA 3PZ7A 4LDTB 1WJUA 2IGGA 3FILA 3NS8A 1JALA 2JYTA 4IUMB 4MGIE 1WXVA 2QILA 1G6JA 2ZVNA 1E7UA 1XF5L 1QOGA 4WJNA 4HDOA 2GOWA 4KGRA 2L7RA 1S3SG 4C4VB 2MSED 2CHWA 4KSKC 3N9YC 3APFA 3AU4A 2SAKA 3BVGA 2MJDA 3U7ZA 5HG2A 2XK5B 1EUVB 4WQMA 5CHWA 3Q8CA 1SE9A 2GI9A 4NQKE 3V6CB 3L10B 4L2YA 4NY0A 1WY8A 3VH4B 1UZXB 4TQ0A 3AE8B 1AARA 2BVCA 2INCC 1QOFA 3ABVB 1C4AA 1WM3A 4HPPA 4L23A 1I42A 2A5UA 2W55A 3ZRFA 4KX6B 2Z59B 4USAA 3C19A 1UBQA 2WDVB 1WI0A 2HJ8A 3TBLD 4TKNA 3IG3A 1QKZA 2KFKA 1FXIA 1YIWA 4MGKE 4KKIA 4IWOA 2MBOA 1F2RC 1QLBB 1GUAB 1E90A 1LO5D 2CU3A 4I6NB 1YJIA 3QCAA 4FN2A 2CU1A 2H89B 2WX0A 4RGNA 2RPVA 4DK5A 3URYA 2K39A 4F7ZA 2D10A 3N1YC 3DOWA 2WXQA 2MJEA 2BYVE 3AE5B 1WE6A 2L00B 3PREA 5IO9A 5HHDG 1F52A 3ZXVA 2ON8A 2BPSA 3AN1A 2KWDA 2LD9A 3M62B 1WJNA 3M3JA 3V05A 4P6VF 1Y56A 2K8CA 4DHJB 1R4NB 3PSEB 1Q10A 1T6BX 4N9F4 2KVRA 2WS3B 3KH0A 3T9LA 5C23A 2PIAA 3MP9A 2N7EA 4G50A 1TKGA 1WMHB 3Q8AA 2DAFA 1QQRA 4ITKA 2KTFA 1ET9A 2LRUA 2VRRB 3W1YA 2JQRB 3VRBB 4FA6A 5J2RA 2DAJA 2JT4B 1NYRA 2JY6A 2KD0A 1I4XA 4WWMA 3IAM1 3ZNGC 3AE2B 1ZDXA 2IYDB 1ZOYB 5JHAA 1TS4A 3A1QB 1YNTE 2R2OA 4W9IA 1E8WA 1R4NI 2KDEB 1AWDA 4B6WA 2N9XA 3Q69A 1I4QA 3SDLC 1F0ZA 4RF0A 3W1SC 4MSQB 3ZIMA 3VAWA 1WGKA 2AL3A 2I38A 4F1SA 1WXMA 3GP7A 1GB1A 2KHWB 2KDIA 4L1BA 3IHPC 2GBNA 1KF6B 4P1BC 2C9WB 4XWTA 3PRMB 1GG3A 2JYEA 3AULA 4MJSA 5G55A 2JU6X 4Q2JA 1L7YA 1UBIA 1XCTL 3PV1A 1IUEA 5D6JB 3B2GA 4DDGD 3AEGB 3RN9C 4IKGA 3NVWA 1EU4A 3ZW3A 2AQ3B 1U4AA 2KNBA 2HDEA 1WGGA 2GBJA 2D3GA 2VH1A 3RULA 3AB5A 4BAXA 2MHJA 3ENEA 2EMSA 4ICUA 3DBHB 2NBVB 3AXCA 3ONSA 2WWZA 1TBEA 4NJ6A 3HK0A 3Q3JA 4QAYA 4IDIA 1HZ5A 3BK2A 5BYQA 4MT5A 4JIOU 4WWPA 5DPSA 4OZAA 1BUIC 2IO2B 5EE0A 3VVWB 3AU5A 2ZNVB 5J18A 3ZLZA 4FHKA 2HTME 1T3QA 4FJZA 4RNAA 1Z2MA 4KKJA 2BGFA 5C1ZA 5BMIA 2QSDA 2MBHA 2UYZB 3H7PA 4YXDB 4N59A 2PPHA 1HTQA 5JHBA 4E74A 2NMQA 4IM3A 3KVFB 1V1PA 1GB4A 3DBHI 1LGRA 2JPHA 3SFDB 4MM3A 3VHTC 2NPTB 3PZDA 1ENFA 2N7JA 3JYUA 3TJPA 2L3ZA 3Q8BA 4WH4A 4YSZB 3CIRB 2K8HA 5AUIA 1F1HA 1HZ6A 4PK1A 4NNJB 2MCNB 2QHOA 2I1JA 4HRSA 2R61A 3DHHC 3AM9A 4CHKA 2ZPNA 4C80A 3GOEA 5EE3A 2ZJDA 1XLOA 5AEKB 5FK9C 1XT9B 2HTHA 1KTKA 3AE7B 2NS5A 2J0KA 4HCNB 1T0YA 2EMTA 4CO7A 2GBKA 4ANXA 1WIAA 3PPAA 3B08A 2C7MB 2WDTB 3OWEB 1HXYD 1DOIA 2HJ1A 3NVYA 2GRIA 1FCLA 2KJHB 4J6IA 2G3QB 3NVZA 2REXA 2KC1A 2LZ6A 4JWUC 3L17A 3RNBC 1YJJA 2KVZA 5E6OA 3DQVA 4C56C 4KVGB 1DYQA 2AEHA 3QX1A 4RGOS 1FNVA 4WIPA 2K25A 3RD2A 2KLCA 2CS4A 3RNGC 5LLIA 2N9PC 3NVVA 1WYWB 4DDID 1YX5B 2AYOB 2VH2A 3LYYA 4DXAB 2RDHA 3T8MA 1WGYA 2KJ6A 1R4MI 1OFFA 1OEYJ 4OZCA 2MP2A 5G5HA 3JSVA 4HK2A 3VR8B 3VDZA 4ZRQA 2KDMA 3L13A 2K3UA 4A90A 2L1AA 3EHVA 2RSUA 1E0ZA 1V1OA 1WRIA 2IGDA 5EDSA 2KDBA 3EECA 1GAQB 3TEWA 2O6VB 3U52E 4NJ7A 1UELA 2IO0B 3MTNB 1CZPA 4LNKA 2DYOA 2CR5A 1WH3A 3ECIA 1RM6C 4KGSA 3PHWB 2M0XA 2D2QA 5IN7A 2BQQA 2KJRA 3UI3A 1WRDB 3DVNV 1PDXA 2Z8LA 2ICIA 2JZ3B 2OHFA 3KYCD 3T3NA 4TUUA 1P0RA 3AEBB 1E8YA 2FNJB 1TY0A 4HKQA 2KO3A 1FFUA 3GE8C 1SIJA 3MC0B 3JW0X 4AJYB 3DVGX 4A3OA 1V5TA 2KFJA 2M17A 2KN4A 3I9V1 2Z0DB 3UQAA 2M1MA 1TIFA 5FR6A 2JX5A 2RDGA 3A9JB 4WWOA 2DZMA 2IO1B 1P9DU 1V8CA 2O2VA 1M4VA 1D5ZC 2ONQA 2N1WA 2ZZPB 2LHEA 1SJHD 4AS1A 1V6EA 4AUQC 2KWCA 2BT6A 1A70A 1OQRA 1VZ6A 2M8SA 2MBEA 3QQ8B 3GZNI 4HEA1 4DHZE 2IZVB 1A5RA 1KJTA 4ZDVA 1KOTA 4OVZA 4JQWC 5HI1A 2LJIA 3OAWA 5FKAC 3RNAC 2R2QA 1ZPSA 4O1NA 1IPGA 1P1AA 4WAFA 3IT4B 1I35A 3R66C 2AWTA 4REZA 1KLVA 1KRHA 4BKTA 2LRWA 1YN3A 2BW2A 4LJOB 3ZYYX 3GS2A 4EZLA 4FADA 2VZKB 1WGDA 5DCNA 2I1KA 3PT2B 3N20C 1Q1OA 4NZLB 4A20A 1BXTA 5D2MB 2KTRA 2JVCA 2BF8B 3ML9A 5BO4B 3AEFB 4GDLA 1E8XA 4B9KA 1LXDA 1FXTB 3U4EG 2TSSA 1RRBA 2DBYA 3TSSA 1FNWA 1JWUD 1LFDA 1SXTA 4WJQA 1YX6B 4EZKA 4IM0A 1VDVA 1XLNA 2QIEB 3SD5A 3U7DA 4RGTA 3L0WB 2N9KA 1HA5A 4GU2A 1QT9A 4MELA 3DPDA 3RNFC 2GB1A 2I2YA 4CQNA 3AE9B 2QDFA 3BYYB 1BT0A 1OGWA 1TYGB 3PHXB 2BKRB 1PGAA 4M0WB 4RM8A 2WXRA 1UGMA 3AMZA 2L83A 5AZFA 2FCNA 4D2KA 1FIQA 2GBRA 4G0NB 2E6XA 1WGRA 3KQ4A 4ASWC 2J0MA 3QHTA 1Q0WB 1M94A 2LUEA 1YJ1A 1V49A 3UQBA 2ASQA 1FO4A 2ZEQA 3TEYA 3RYTA 3HUIA 2UU7A 3ZXRA 4XX5A 3SR6A 1MVKA 4HCPB 2BYFA 2H88B 3IVFA 2E3TA 3C0RB 2KOXA 5CTRC 1ZKHA 3PVLA 4DHJD 1PYWD 3QJZA 4B0MA 4W9CA 4MH0E 5T8IA 3PTFC 3I5JC 4YSYB 3CF6E 1S1QB 1YN4A 4FBJB 1FCCC 3N1XC 1IBXB 3ZTDA 2J42A 3NOBA 1C9FA 4WQOB 1V97A 4OVVA 3ZJTA 2K1FA 2N4FA 3AE4B 2Y5CA 5C2TB 2L52A 2W9NA 1RAXA 2AL6A 1HTOA 1C3TA 1L4ZB 2RMMA 3DCGA 1ESFA 3RCZA 1NBFC 4EKUA 3AV8A 4C4VA 1EWYC 3DVGY 4BZAA 3DHIC 3NZSA 1P7EA 1TS2A 3Q3NC 5EE9A 2QEJC 1XD3B 1I4GA 2LUMA 2XK5A 4W9JA 4EOYA 2KMAA 2FUG1 2PW9A 4F8CB 3GE3C 3AI5A 1B9RA 2LGSA 3X0WA 4LJPB 2MH7A 2N1VA 2XNAC 4PS7A 1T0QC 1D5MC 1ET6A 5IP4D 1MHHE 2ZCBA 3FAHA 2KDFB 3LXFA 1HQRD 3P4SB 2OOBB 2WHIA 2ZNVC 4AWJA 2AQ1B 3U2SC 2FAZA 5G2NA 2G45B 4IWPA 1YQBA 1UWMA 3VUWA 1JQ4A 2M0AA 3OJ3A 2IDYA 3FKYA 4BBNF 4RM9A 4RCOA 5L95C 3HM6X 2KACA 1OQYA 1QZEA 2SEBD 3R2IA 1FD6A 2WDRB 3RNEC 3N1ZC 4LK0M 1BMLC 2RDBC 3BZDB 1C77A 2YVCA 4HXDA 2PVGC 4DQOC 1JROA 3RFZB 1MFWA 2C60A 4GB9A 5LXIB 4WJOA 5BMGA 2AQ2B 3P63A 2WU5B 4NAMA 3WAOA 2OEDA 2M19A 2UWQA 4XC2A 2EKEC 3EGRA 5DPTA 4WJPA 1WMHA 1WWTA 2KC2A 3ZQ4A 5I4DA 4LCDE 3H6NA 2BYEA 4ZRJA 1WR1A 1Z5SB 4EUTA 4ZYNA 1P7FA 3RI7C 4A8XC 4KZCA 2C5LC 3NRZA 1N61A 1UD7A 2J7QB 4C00A 2D11A 4I6LB 1NDDA 4XGAB 2JRHA 5E6JA 4PT5A 2QJLA 4GIVA 3A1QA 3IAS1 3QK0A 5JXVA 4BOZB 4K81A 3AE3B 2IBIB 3HVDA 4HVBA 2J0JA 3NZUA 4BFRA 1C4PA 1CMXB 1YOVB 4LNNA 4BOSC 3PZ8A 1N5WA 3CSFA 1OEYA 3EA6A 2PE6B 2DYBA 3PO0A 1E9MA 4MGZE 4C7ZA 3I3TB 3VTVA 1I4RA 1YD8U 3W2DA 3A4SC 1JWBD 1SIFA 5IAAC 3PLVA 2KXJA 2LJ5A 3ZNZB 3PLUA 2PTLA 1L2NA 4HWIB 4IOIE
chains in the Genus database with same CATH topology
1WXVA 2FIFA 1RFAA 1G6JA 2L05A 2JZ3B 2ZVNA 1E7UA 3VUYA 3KYCD 1H8CA 3KYDD 4WJNA 4HDOA 2DHZA 2GOWA 4EZJA 4TUUA 1P0RA 4W9GA 2L7RA 2WX1A 1E8YA 1S3SG 2FNJB 2MSED 1GC7A 2CHWA 4KSKC 2B3AA 2KO3A 3VXWA 2XEWA 3APFA 3AU4A 1WGHA 5J17A 4K7WA 5AZHA 3JW0X 4AJYB 2FUHB 2L76A 4E71A 1XQQA 2M4NA 3DVGX 4A3OA 1WX8A 4AOFA 1V5TA 2KFJA 4JGHB 2M17A 4JLCA 2Z0DB 2XK5B 1EUVB 2OJRA 2LGYA 3UQAA 5CHWA 2M1MA 5FR6A 3A9JB 4PS3A 4WWOA 1SE9A 2DZMA 2IO1B 4GMVA 4NQKE 3V6CB 3TL5A 1P9DU 3H7PB 3APDA 2O2VA 3L10B 4NY0A 1VD2A 4KIKB 1WY8A 3VH4B 1UZXB 4G11A 4TQ0A 3EC8A 2N1WA 2ZZPB 1AARA 2MW5A 1WFYA 2LWPA 1V6EA 2LXCA 4AUQC 3ZVVA 1WM3A 2KWCA 3RUIB 2BWFA 4YL8A 2A5UA 1I42A 2L8JA 4II3B 3ZRFA 2M8SA 4RMAA 1WF9A 2MBEA 1V86A 2Z59B 3GZNI 2L0FA 3QQ8B 3ZNID 4GDKB 2MRPA 1UBQA 2A4ZA 1X1MA 1WI0A 2HJ8A 1K8RB 2O6VD 4W9KA 4DHZE 3TBLD 4TKNA 3QAQA 2NCNA 3IG3A 4MDKE 2IZVB 1HE8A 1A5RA 1KJTA 2KFKA 4ZDVA 4E3CA 3M95A 3PRZA 1KOTA 1YIWA 4MGKE 3KUDB 4JQWC 4IWOA 2MBOA 3D32A 3A9KB 1GUAB 3OAWA 1E90A 3L16A 2R2QA 1WXAA 2WYQA 1MG8A 2G4DB 4I6NB 2NPTA 4ANWA 3QCAA 3APCA 4FN2A 1IPGA 1P1AA 2CU1A 2WX0A 3VH3B 1I35A 2KMCA 3R7RA 3R66C 2AWTA 5E6NA 3SHQA 3V6EB 4DK5A 2K39A 1GJZA 1KLVA 4BKTA 2LRWA 1IP9A 4KDIC 3Q3FA 1PQSA 4F7ZA 2DYMA 4LJOB 2D10A 5HKHA 3DOWA 1IYFA 4EZLA 2BYVE 4FADA 1WJ4A 2MX2A 1WGDA 1WE6A 2L00B 3B1LX 1JRUA 2JF5A 3PREA 4GXBA 4EFOA 5DCNA 2PE9A 2I1KA 3PT2B 2Z0EB 4IC7B 1Q1OA 2BPSA 4A20A 2LVOA 4GSWA 5D2MB 2DENB 2LD9A 2KTRA 3M62B 4X57B 1WJNA 2JVCA 3M3JA 5L83A 2BF8B 3ML9A 5BO4B 3QIJA 4GDLA 1E8XA 2K8CA 4DHJB 3PSEB 1NI2A 4N9F4 4FJYA 2KVRA 3DBSA 4FHJA 1LXDA 3KH0A 1FXTB 2G4SA 5C23A 3T9LA 4B9KA 2N7EA 2RR9A 4G50A 3PGEA 1RRBA 1P3QU 3TMPB 1WMHB 1E5WA 1LFDA 1P98A 2DAFA 4WJQA 2V4LA 3ZTCA 3ZRCA 1YX6B 4EZKA 2L0TA 4IM0A 3DBLI 3SD5A 3RZWC 3U7DA 2KTFA 2MLBA 3JVZX 2LRUA 2CKHB 2VRRB 4PYZA 3W1YA 3R3MA 3L0WB 4FA6A 4FULA 2GMIC 4FJVB 5J2RA 2KLGA 2DAJA 2JT4B 2MP2B 2MWSB 4GU2A 2JY6A 4ANVA 4MELA 3ZKJC 2KD0A 3DPDA 3RT3B 4II2B 1WZ3A 3ZNGC 3JSVB 2IYDB 3IBEA 5JHAA 3A1QB 4GN1A 2R2OA 1V2YA 4M8NA 1BT0A 1OGWA 3PHXB 4W9IA 2BKRB 4RM8A 4M0WB 3VUXA 1E8WA 1R4NI 1UGMA 2LGDA 3DVNU 3UIPB 4CYEA 5AZFA 4EEWA 2FCNA 2IY1B 5IA7A 2GBRA 2KDEB 4W9DA 4B6WA 4G0NB 2JZZA 1WGRA 4ASWC 2J0MA 2N9XA 3SDLC 3QHTA 2K6QA 3W1SC 1EF1A 4MSQB 1Q0WB 5CHVC 2KX0A 1M94A 3VAWA 3ZIMA 4AJWA 2AL3A 2NBUA 4F1SA 1ISNA 2LUEA 1YJ1A 4HJKA 1V49A 3UQBA 1WXMA 2ASQA 3QWZB 2ZEQA 3U30A 2KHWB 3RYTA 2KDIA 1C1YB 4XX5A 3H9DA 3IHPC 2GBNA 4HCPB 2C9WB 2Y5BB 2BYFA 3ZNHB 3NY5A 2CHXA 3PRMB 3IVFA 3C0RB 1GG3A 1UH6A 2NVUI 2KOXA 4MEMA 5CTRC 4TV3A 2GBMA 1ZKHA 4OVUA 3AULA 3PVLA 4MJSA 4BBNC 5G55A 4DHJD 3WALA 5AZGA 1L7YA 3PRPB 1UBIA 3QJZA 3PV1A 4M8MA 4PS8A 4W9CA 4MH0E 5D6JB 3PTFC 3TIXA 4DDGD 2CHZA 2O6VA 2KKCA 3CF6E 3SU8X 5DPRA 5GMVA 1S1QB 3B0AA 4FBJB 5D94A 3OLMD 3MJWA 2BKFA 3ZW3A 1U4AA 3ZO5B 2KNBA 1WGGA 2GBJA 2D3GA 3RULA 3LDZE 3ZTDA 3NOBA 1Y8RC 2FIDA 4WQOB 1F9JA 4OVVA 2K1FA 2N4FA 4KZ0A 3ENEA 4BKSD 2RPQA 2KN5A 2K8BA 3WIMA 1LQBA 2EMSA 4ICUA 2NBVB 3AXCA 3W1SA 2W9NA 3ONSA 1RAXA 2AL6A 1WZ0A 2WWZA 1C3TA 1TBEA 4NJ6A 3DCGA 3ZDTA 3M63B 3RCZA 2HE7A 2JXXA 1WX9A 3HK0A 3Q3JA 1NBFC 2O2VB 4EKUA 1SGHA 1Q5WB 3KW5B 4WAAA 3UGBB 4JIOU 3RZFA 4WWPA 1V9JA 4XZ4A 5DPSA 3DVGY 3PS6A 2IO2B 3N3KB 3VVWB 3AU5A 2ZNVB 1J19A 3NZSA 4FLHA 4HLEA 5J18A 3ZLZA 4FHKA 5LXHA 3UIOB 1XD3B 4W9EA 2ZCCA 1V80A 1EO6A 2V3SA 3CSTA 3V62A 1J8CA 4GOCA 2XK5A 4W9JA 4FJZA 2LASA 2KMAA 4EOYA 3K9PB 1WX7A 1Z2MA 2KZRA 2LI5A 4F8CB 2BGFA 2KK8A 3A9JA 3TCAA 5C1ZA 4URKA 3EFUA 2MBHA 2UYZB 3AI5A 3H7PA 2KFKB 4KIKA 4IW0A 3X0WA 2XBBC 4LJPB 2PPHA 2N1VA 5JHBA 1TGZB 4PS7A 4W9FA 4DHZB 4E74A 4IM3A 4A3PA 3KVFB 2YLMA 3KUCB 3DBHI 2ZCBA 4ICVA 2DZKA 2KDFB 3WAPA 2JPHA 3ML8A 4MM3A 2JUOA 3HHMA 3VHTC 1LM8B 2NPTB 3PZDA 3N32A 2OOBB 3JYUA 3L54A 2L3ZA 3TJPA 2D07B 4MGYE 2LVQA 2ZNVC 4GDKA 4ZRIA 4NQLB 4AWJA 1WM2A 2DZIA 2NBWB 2FAZA 2K8HA 2JWZA 1RLFA 4GGQA 1VCBA 4NNJB 1ZW7A 2MCNB 2KWUB 2QHOA 2I1JA 5G2NA 2G45B 2KQSA 3H7SA 4IWPA 3ALBA 1YQBA 2KX3A 3VUWA 3DBRI 1ZGUB 4CHKA 4NAWB 2ZPNA 3U8ZA 3OJ3A 3N30A 4KDLB 2PEAA 3A9KA 4BBNF 1E8ZA 3GOEA 4NPNA 2ZJDA 4RM9A 2FCMA 5L95C 3HM6X 5AEKB 4AP4C 3A33B 1OQYA 1XT9B 1QZEA 2HTHA 2KTRB 2MBBB 3VQIA 4DBGA 5KHOA 2NS5A 4GDLB 3ZDMC 2J0KA 4HCNB 4HWIB 1T0YA 2EMTA 4IG7B 4CO7A 1OTRB 2FCSA 2GBKA 3IFWB 2YVCA 4ZRKA 4HXDA 4K7SA 4ANXA 1WIAA 4MSMB 3PPAA 2LGXA 3P2BA 4JL9A 5DPWA 2ZVOA 3B08A 2BWES 4HDQA 3UINB 4W9HA 2C7MB 2FCQA 2C60A 3S2AA 2K6DB 3OJ4B 2WDTB 4GB9A 1WXSA 5LXIB 2IY0B 1GNUA 4HPLB 3QA8A 4WJOA 3QARA 2KJHB 4J6IA 5CX3A 2G3QB 2KWVB 3WAOA 3X23A 1V5OA 2REXA 4ANUA 3WA0A 2KC1A 3UF8A 4PYUA 2LZ6A 3KUZA 3L17A 1TZ1A 4K1RB 5E6OA 4BKGA 2UWQA 4XC2A 3DQVA 2PJHA 3WANA 4KSLC 2EKEC 4KVGB 3V60A 2AEHA 3QC8B 3BINA 3QX1A 5DPTA 2DZJA 4WJPA 3HIZA 2LVPA 3VTUA 1WMHA 4DWFA 2KC2A 2N7DA 2C7HA 2K25A 4WWNA 1EF5A 2KLCA 3LJ3A 2CS4A 4LCDE 4P7IA 5LLIA 3RD2A 1E7VA 2N9PC 3H6NA 2BYEA 3A4RA 4ZRJA 3WAMA 5JZEB 1WR1A 1Z5SB 4EUTA 5D7GA 5JH5C 4BVUC 1KM7A 1WYWB 4DDID 1YX5B 2IO3B 2AYOB 5E6PA 3H1UA 4ZYNA 3DDCB 4DXAB 4LDTD 4KZCA 2ZPYA 2C5LC 3HM3A 3T8MA 1WGYA 2V1YA 4BKSA 3BY4B 1UD7A 1WJ6A 2KJ6A 5KHQA 1R4MI 2MBQA 3ZUNA 1OEYJ 2J7QB 1WR6E 2D11A 2MP2A 1TTNA 2JRIB 2MQJA 4I6LB 1NDDA 2JRHA 3O65B 4W9LA 4KV2A 3JSVA 4GIVA 4HK2A 3A1QA 4TQ1A 5TR5A 3VDZA 3QK0A 3V61A 3L08A 4BOZB 4K81A 3L13A 2NR2A 2IBIB 3CMMB 4HVBA 4NAWA 1D3ZA 2J0JA 3NZUA 4HPMB 4BFRA 3EHVA 1GC6A 2RSUA 4IWQA 1CMXB 2LXAA 4MJSB 3NHEB 5CHFA 4K7UA 2HD5B 5EDSA 4BOSC 2KDBA 1H4RA 4G3XB 4B95A 3EECA 2MA9B 4IM2A 2RD0A 3CSFA 3K9OB 1OEYA 2DX5B 1J0GA 2O6VB 3R7QA 2PE6B 2DYBA 4NJ7A 1UELA 1WE7A 2IO0B 3MTNB 4MGZE 2C7NB 3I3TB 4I6PA 2DYOA 2CR5A 1WH3A 3VTVA 1YD8U 2KQ7A 3VFKA 3ECIA 3MHSD 3PHWB 3A4SC 2M0XA 4LDTB 1SIFA 2N9EB 5IAAC 2KXJA 1WJUA 1V81A 2LJ5A 2D2QA 3PLVA 3NS8A 3ZNZB 3PLUA 2KJRA 3VTWA 1L2NA 1WRDB 4IUMB 2RGFA 4MGIE 2KANA 3DVNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXV A;  2FIF A;  1RFA A;  1G6J A;  2L05 A;  2JZ3 B;  2ZVN A;  1E7U A;  3VUY A;  3KYC D;  1H8C A;  3KYD D;  4WJN A;  4HDO A;  2DHZ A;  2GOW A;  4EZJ A;  4TUU A;  1P0R A;  4W9G A;  2L7R A;  2WX1 A;  1E8Y A;  1S3S G;  2FNJ B;  2MSE D;  1GC7 A;  2CHW A;  4KSK C;  2B3A A;  2KO3 A;  3VXW A;  2XEW A;  3APF A;  3AU4 A;  1WGH A;  5J17 A;  4K7W A;  5AZH A;  3JW0 X;  4AJY B;  2FUH B;  2L76 A;  4E71 A;  1XQQ A;  2M4N A;  3DVG X;  4A3O A;  1WX8 A;  4AOF A;  1V5T A;  2KFJ A;  4JGH B;  2M17 A;  4JLC A;  2Z0D B;  2XK5 B;  1EUV B;  2OJR A;  2LGY A;  3UQA A;  5CHW A;  2M1M A;  5FR6 A;  3A9J B;  4PS3 A;  4WWO A;  1SE9 A;  2DZM A;  2IO1 B;  4GMV A;  4NQK E;  3V6C B;  3TL5 A;  1P9D U;  3H7P B;  3APD A;  2O2V A;  3L10 B;  4NY0 A;  1VD2 A;  4KIK B;  1WY8 A;  3VH4 B;  1UZX B;  4G11 A;  4TQ0 A;  3EC8 A;  2N1W A;  2ZZP B;  1AAR A;  2MW5 A;  1WFY A;  2LWP A;  1V6E A;  2LXC A;  4AUQ C;  3ZVV A;  1WM3 A;  2KWC A;  3RUI B;  2BWF A;  4YL8 A;  2A5U A;  1I42 A;  2L8J A;  4II3 B;  3ZRF A;  2M8S A;  4RMA A;  1WF9 A;  2MBE A;  1V86 A;  2Z59 B;  3GZN I;  2L0F A;  3QQ8 B;  3ZNI D;  4GDK B;  2MRP A;  1UBQ A;  2A4Z A;  1X1M A;  1WI0 A;  2HJ8 A;  1K8R B;  2O6V D;  4W9K A;  4DHZ E;  3TBL D;  4TKN A;  3QAQ A;  2NCN A;  3IG3 A;  4MDK E;  2IZV B;  1HE8 A;  1A5R A;  1KJT A;  2KFK A;  4ZDV A;  4E3C A;  3M95 A;  3PRZ A;  1KOT A;  1YIW A;  4MGK E;  3KUD B;  4JQW C;  4IWO A;  2MBO A;  3D32 A;  3A9K B;  1GUA B;  3OAW A;  1E90 A;  3L16 A;  2R2Q A;  1WXA A;  2WYQ A;  1MG8 A;  2G4D B;  4I6N B;  2NPT A;  4ANW A;  3QCA A;  3APC A;  4FN2 A;  1IPG A;  1P1A A;  2CU1 A;  2WX0 A;  3VH3 B;  1I35 A;  2KMC A;  3R7R A;  3R66 C;  2AWT A;  5E6N A;  3SHQ A;  3V6E B;  4DK5 A;  2K39 A;  1GJZ A;  1KLV A;  4BKT A;  2LRW A;  1IP9 A;  4KDI C;  3Q3F A;  1PQS A;  4F7Z A;  2DYM A;  4LJO B;  2D10 A;  5HKH A;  3DOW A;  1IYF A;  4EZL A;  2BYV E;  4FAD A;  1WJ4 A;  2MX2 A;  1WGD A;  1WE6 A;  2L00 B;  3B1L X;  1JRU A;  2JF5 A;  3PRE A;  4GXB A;  4EFO A;  5DCN A;  2PE9 A;  2I1K A;  3PT2 B;  2Z0E B;  4IC7 B;  1Q1O A;  2BPS A;  4A20 A;  2LVO A;  4GSW A;  5D2M B;  2DEN B;  2LD9 A;  2KTR A;  3M62 B;  4X57 B;  1WJN A;  2JVC A;  3M3J A;  5L83 A;  2BF8 B;  3ML9 A;  5BO4 B;  3QIJ A;  4GDL A;  1E8X A;  2K8C A;  4DHJ B;  3PSE B;  1NI2 A;  4N9F 4;  4FJY A;  2KVR A;  3DBS A;  4FHJ A;  1LXD A;  3KH0 A;  1FXT B;  2G4S A;  5C23 A;  3T9L A;  4B9K A;  2N7E A;  2RR9 A;  4G50 A;  3PGE A;  1RRB A;  1P3Q U;  3TMP B;  1WMH B;  1E5W A;  1LFD A;  1P98 A;  2DAF A;  4WJQ A;  2V4L A;  3ZTC A;  3ZRC A;  1YX6 B;  4EZK A;  2L0T A;  4IM0 A;  3DBL I;  3SD5 A;  3RZW C;  3U7D A;  2KTF A;  2MLB A;  3JVZ X;  2LRU A;  2CKH B;  2VRR B;  4PYZ A;  3W1Y A;  3R3M A;  3L0W B;  4FA6 A;  4FUL A;  2GMI C;  4FJV B;  5J2R A;  2KLG A;  2DAJ A;  2JT4 B;  2MP2 B;  2MWS B;  4GU2 A;  2JY6 A;  4ANV A;  4MEL A;  3ZKJ C;  2KD0 A;  3DPD A;  3RT3 B;  4II2 B;  1WZ3 A;  3ZNG C;  3JSV B;  2IYD B;  3IBE A;  5JHA A;  3A1Q B;  4GN1 A;  2R2O A;  1V2Y A;  4M8N A;  1BT0 A;  1OGW A;  3PHX B;  4W9I A;  2BKR B;  4RM8 A;  4M0W B;  3VUX A;  1E8W A;  1R4N I;  1UGM A;  2LGD A;  3DVN U;  3UIP B;  4CYE A;  5AZF A;  4EEW A;  2FCN A;  2IY1 B;  5IA7 A;  2GBR A;  2KDE B;  4W9D A;  4B6W A;  4G0N B;  2JZZ A;  1WGR A;  4ASW C;  2J0M A;  2N9X A;  3SDL C;  3QHT A;  2K6Q A;  3W1S C;  1EF1 A;  4MSQ B;  1Q0W B;  5CHV C;  2KX0 A;  1M94 A;  3VAW A;  3ZIM A;  4AJW A;  2AL3 A;  2NBU A;  4F1S A;  1ISN A;  2LUE A;  1YJ1 A;  4HJK A;  1V49 A;  3UQB A;  1WXM A;  2ASQ A;  3QWZ B;  2ZEQ A;  3U30 A;  2KHW B;  3RYT A;  2KDI A;  1C1Y B;  4XX5 A;  3H9D A;  3IHP C;  2GBN A;  4HCP B;  2C9W B;  2Y5B B;  2BYF A;  3ZNH B;  3NY5 A;  2CHX A;  3PRM B;  3IVF A;  3C0R B;  1GG3 A;  1UH6 A;  2NVU I;  2KOX A;  4MEM A;  5CTR C;  4TV3 A;  2GBM A;  1ZKH A;  4OVU A;  3AUL A;  3PVL A;  4MJS A;  4BBN C;  5G55 A;  4DHJ D;  3WAL A;  5AZG A;  1L7Y A;  3PRP B;  1UBI A;  3QJZ A;  3PV1 A;  4M8M A;  4PS8 A;  4W9C A;  4MH0 E;  5D6J B;  3PTF C;  3TIX A;  4DDG D;  2CHZ A;  2O6V A;  2KKC A;  3CF6 E;  3SU8 X;  5DPR A;  5GMV A;  1S1Q B;  3B0A A;  4FBJ B;  5D94 A;  3OLM D;  3MJW A;  2BKF A;  3ZW3 A;  1U4A A;  3ZO5 B;  2KNB A;  1WGG A;  2GBJ A;  2D3G A;  3RUL A;  3LDZ E;  3ZTD A;  3NOB A;  1Y8R C;  2FID A;  4WQO B;  1F9J A;  4OVV A;  2K1F A;  2N4F A;  4KZ0 A;  3ENE A;  4BKS D;  2RPQ A;  2KN5 A;  2K8B A;  3WIM A;  1LQB A;  2EMS A;  4ICU A;  2NBV B;  3AXC A;  3W1S A;  2W9N A;  3ONS A;  1RAX A;  2AL6 A;  1WZ0 A;  2WWZ A;  1C3T A;  1TBE A;  4NJ6 A;  3DCG A;  3ZDT A;  3M63 B;  3RCZ A;  2HE7 A;  2JXX A;  1WX9 A;  3HK0 A;  3Q3J A;  1NBF C;  2O2V B;  4EKU A;  1SGH A;  1Q5W B;  3KW5 B;  4WAA A;  3UGB B;  4JIO U;  3RZF A;  4WWP A;  1V9J A;  4XZ4 A;  5DPS A;  3DVG Y;  3PS6 A;  2IO2 B;  3N3K B;  3VVW B;  3AU5 A;  2ZNV B;  1J19 A;  3NZS A;  4FLH A;  4HLE A;  5J18 A;  3ZLZ A;  4FHK A;  5LXH A;  3UIO B;  1XD3 B;  4W9E A;  2ZCC A;  1V80 A;  1EO6 A;  2V3S A;  3CST A;  3V62 A;  1J8C A;  4GOC A;  2XK5 A;  4W9J A;  4FJZ A;  2LAS A;  2KMA A;  4EOY A;  3K9P B;  1WX7 A;  1Z2M A;  2KZR A;  2LI5 A;  4F8C B;  2BGF A;  2KK8 A;  3A9J A;  3TCA A;  5C1Z A;  4URK A;  3EFU A;  2MBH A;  2UYZ B;  3AI5 A;  3H7P A;  2KFK B;  4KIK A;  4IW0 A;  3X0W A;  2XBB C;  4LJP B;  2PPH A;  2N1V A;  5JHB A;  1TGZ B;  4PS7 A;  4W9F A;  4DHZ B;  4E74 A;  4IM3 A;  4A3P A;  3KVF B;  2YLM A;  3KUC B;  3DBH I;  2ZCB A;  4ICV A;  2DZK A;  2KDF B;  3WAP A;  2JPH A;  3ML8 A;  4MM3 A;  2JUO A;  3HHM A;  3VHT C;  1LM8 B;  2NPT B;  3PZD A;  3N32 A;  2OOB B;  3JYU A;  3L54 A;  2L3Z A;  3TJP A;  2D07 B;  4MGY E;  2LVQ A;  2ZNV C;  4GDK A;  4ZRI A;  4NQL B;  4AWJ A;  1WM2 A;  2DZI A;  2NBW B;  2FAZ A;  2K8H A;  2JWZ A;  1RLF A;  4GGQ A;  1VCB A;  4NNJ B;  1ZW7 A;  2MCN B;  2KWU B;  2QHO A;  2I1J A;  5G2N A;  2G45 B;  2KQS A;  3H7S A;  4IWP A;  3ALB A;  1YQB A;  2KX3 A;  3VUW A;  3DBR I;  1ZGU B;  4CHK A;  4NAW B;  2ZPN A;  3U8Z A;  3OJ3 A;  3N30 A;  4KDL B;  2PEA A;  3A9K A;  4BBN F;  1E8Z A;  3GOE A;  4NPN A;  2ZJD A;  4RM9 A;  2FCM A;  5L95 C;  3HM6 X;  5AEK B;  4AP4 C;  3A33 B;  1OQY A;  1XT9 B;  1QZE A;  2HTH A;  2KTR B;  2MBB B;  3VQI A;  4DBG A;  5KHO A;  2NS5 A;  4GDL B;  3ZDM C;  2J0K A;  4HCN B;  4HWI B;  1T0Y A;  2EMT A;  4IG7 B;  4CO7 A;  1OTR B;  2FCS A;  2GBK A;  3IFW B;  2YVC A;  4ZRK A;  4HXD A;  4K7S A;  4ANX A;  1WIA A;  4MSM B;  3PPA A;  2LGX A;  3P2B A;  4JL9 A;  5DPW A;  2ZVO A;  3B08 A;  2BWE S;  4HDQ A;  3UIN B;  4W9H A;  2C7M B;  2FCQ A;  2C60 A;  3S2A A;  2K6D B;  3OJ4 B;  2WDT B;  4GB9 A;  1WXS A;  5LXI B;  2IY0 B;  1GNU A;  4HPL B;  3QA8 A;  4WJO A;  3QAR A;  2KJH B;  4J6I A;  5CX3 A;  2G3Q B;  2KWV B;  3WAO A;  3X23 A;  1V5O A;  2REX A;  4ANU A;  3WA0 A;  2KC1 A;  3UF8 A;  4PYU A;  2LZ6 A;  3KUZ A;  3L17 A;  1TZ1 A;  4K1R B;  5E6O A;  4BKG A;  2UWQ A;  4XC2 A;  3DQV A;  2PJH A;  3WAN A;  4KSL C;  2EKE C;  4KVG B;  3V60 A;  2AEH A;  3QC8 B;  3BIN A;  3QX1 A;  5DPT A;  2DZJ A;  4WJP A;  3HIZ A;  2LVP A;  3VTU A;  1WMH A;  4DWF A;  2KC2 A;  2N7D A;  2C7H A;  2K25 A;  4WWN A;  1EF5 A;  2KLC A;  3LJ3 A;  2CS4 A;  4LCD E;  4P7I A;  5LLI A;  3RD2 A;  1E7V A;  2N9P C;  3H6N A;  2BYE A;  3A4R A;  4ZRJ A;  3WAM A;  5JZE B;  1WR1 A;  1Z5S B;  4EUT A;  5D7G A;  5JH5 C;  4BVU C;  1KM7 A;  1WYW B;  4DDI D;  1YX5 B;  2IO3 B;  2AYO B;  5E6P A;  3H1U A;  4ZYN A;  3DDC B;  4DXA B;  4LDT D;  4KZC A;  2ZPY A;  2C5L C;  3HM3 A;  3T8M A;  1WGY A;  2V1Y A;  4BKS A;  3BY4 B;  1UD7 A;  1WJ6 A;  2KJ6 A;  5KHQ A;  1R4M I;  2MBQ A;  3ZUN A;  1OEY J;  2J7Q B;  1WR6 E;  2D11 A;  2MP2 A;  1TTN A;  2JRI B;  2MQJ A;  4I6L B;  1NDD A;  2JRH A;  3O65 B;  4W9L A;  4KV2 A;  3JSV A;  4GIV A;  4HK2 A;  3A1Q A;  4TQ1 A;  5TR5 A;  3VDZ A;  3QK0 A;  3V61 A;  3L08 A;  4BOZ B;  4K81 A;  3L13 A;  2NR2 A;  2IBI B;  3CMM B;  4HVB A;  4NAW A;  1D3Z A;  2J0J A;  3NZU A;  4HPM B;  4BFR A;  3EHV A;  1GC6 A;  2RSU A;  4IWQ A;  1CMX B;  2LXA A;  4MJS B;  3NHE B;  5CHF A;  4K7U A;  2HD5 B;  5EDS A;  4BOS C;  2KDB A;  1H4R A;  4G3X B;  4B95 A;  3EEC A;  2MA9 B;  4IM2 A;  2RD0 A;  3CSF A;  3K9O B;  1OEY A;  2DX5 B;  1J0G A;  2O6V B;  3R7Q A;  2PE6 B;  2DYB A;  4NJ7 A;  1UEL A;  1WE7 A;  2IO0 B;  3MTN B;  4MGZ E;  2C7N B;  3I3T B;  4I6P A;  2DYO A;  2CR5 A;  1WH3 A;  3VTV A;  1YD8 U;  2KQ7 A;  3VFK A;  3ECI A;  3MHS D;  3PHW B;  3A4S C;  2M0X A;  4LDT B;  1SIF A;  2N9E B;  5IAA C;  2KXJ A;  1WJU A;  1V81 A;  2LJ5 A;  2D2Q A;  3PLV A;  3NS8 A;  3ZNZ B;  3PLU A;  2KJR A;  3VTW A;  1L2N A;  1WRD B;  4IUM B;  2RGF A;  4MGI E;  2KAN A;  3DVN V; 
#chains in the Genus database with same CATH topology
 4YTP B;  2L05 A;  2WDQ B;  4DXF A;  4A9A A;  1FFV A;  1ZE3 D;  3KYD D;  1DGJ A;  1NEN B;  4US8 A;  1VZ7 A;  2WX1 A;  2WXF A;  1GC7 A;  4AQ7 A;  3VXW A;  2BYT A;  5J17 A;  4K7W A;  5AZH A;  3VR9 B;  3R2T A;  1CQV A;  4E71 A;  1XQQ A;  2M4N A;  4JGH B;  4YTM B;  4JLC A;  2OJR A;  2LGY A;  1WXQ A;  2PVO D;  3L4P A;  3P4P B;  1CK1 A;  3TL5 A;  3CWI A;  1VD2 A;  4KIK B;  2LGI A;  4G11 A;  2YEP B;  1XCQ L;  5HFY A;  3E9S A;  1KLU D;  2LWP A;  2LXC A;  1L4D B;  3ZVV A;  2WU2 B;  3RUI B;  1WF9 A;  2KMM A;  1V86 A;  2L0F A;  3ZNI D;  4GDK B;  2MRP A;  2A4Z A;  4P16 A;  1X1M A;  2O6V D;  3QAQ A;  1L5P A;  1HE8 A;  4E3C A;  3M95 A;  3KUD B;  3A9K B;  1KFY B;  2WYQ A;  2NPT A;  1ACC A;  2PMV A;  2W54 A;  2DWQ A;  3SHQ A;  3V6E B;  1XLQ A;  1IP9 A;  1PQS A;  4UDU C;  2N0S B;  2Q5W D;  1IYF A;  3R8B A;  4JE3 B;  1SE4 A;  3B1L X;  2JF5 A;  1DOX A;  2PE9 A;  4IC7 B;  4K3B A;  2DEN B;  4X57 B;  1GPX A;  1AW7 A;  2JZP A;  2XN9 C;  3QIJ A;  4MAC A;  3BII D;  3DBS A;  1C79 A;  2RR9 A;  3PGE A;  1P3Q U;  1K52 A;  3EUB 2;  1I4H A;  1SEB D;  4A6Q A;  2V4L A;  1N63 A;  3MFG A;  4PYZ A;  4A55 A;  3R3M A;  1FEH A;  4FUL A;  3RNC C;  4FJV B;  2KLG A;  2INP E;  3BYT B;  2MWS B;  3AE1 B;  2KT7 A;  3ZKJ C;  3RT3 B;  4II2 B;  2LHD A;  4JX1 C;  3IBE A;  1K51 A;  5BMH A;  1V2Y A;  3VUX A;  1RWS A;  1STE A;  2LGD A;  3DVN U;  5EE1 A;  3UIP B;  4CYE A;  1D4B A;  5IA7 A;  1JRP A;  4YTN B;  1D6E C;  1RYJ A;  5CHV C;  3BK1 A;  2V0G A;  2NBU A;  1ISN A;  4HJK A;  2BBC A;  2NTS A;  3U30 A;  2JSV X;  2VZK D;  2Y5B B;  2KYW A;  1UH6 A;  2NVU I;  4OW0 A;  4OVU A;  4YWG G;  2N9L A;  3FIL B;  3H8H A;  5AZG A;  1L6U A;  4PS8 A;  4XWW A;  1SE2 A;  2O6V A;  2BS3 B;  3W9C B;  3Q3M C;  4LLG M;  3KWL A;  3P4R B;  3OLM D;  1T5X D;  2BKF A;  2PLP A;  3BWU D;  2J4X A;  1SJE D;  1T0S C;  3HVZ A;  1Y8R C;  1F9J A;  2WXJ A;  4BKS D;  2V9H A;  2WXP A;  2KN5 A;  3WIM A;  2WXM A;  1WZ0 A;  2M56 B;  1JWS D;  1FM0 D;  1D5X C;  2D3B A;  1GOZ A;  3ZDT A;  3M63 B;  1TKY A;  1WX9 A;  2WXH A;  3UGB B;  3RZF A;  1V9J A;  1E6E B;  3ETR A;  3PS6 A;  3NZ3 A;  2WQY B;  4XDC A;  1JCK B;  2J53 A;  3O13 A;  4FLH A;  4J3O D;  4HLE A;  5BYS A;  1V80 A;  1EO6 A;  1J8C A;  4GOC A;  1ZUD 2;  4JWS C;  1C4C A;  1WX7 A;  2KZR A;  2LI5 A;  1ZP0 B;  3Q8E A;  2KK8 A;  2JWU A;  3A9J A;  3TCA A;  2KFK B;  3Q2A C;  4IW0 A;  4WUR A;  1DOY A;  4NJC A;  1TGZ B;  4W9F A;  4DXG A;  4XDD A;  1QOA A;  3FC4 A;  3KUC B;  1ZXI A;  1J7B A;  4ICV A;  4R3D A;  3WAP A;  1KH0 A;  3HHM A;  1LM8 B;  2AX5 A;  3B2F A;  4TSS A;  2D07 B;  2LVQ A;  4NQL B;  1VJK A;  5IOI A;  2WXI A;  1RLF A;  1UWX A;  1VCB A;  1YQ4 B;  1ZW7 A;  4GGQ A;  2KWU B;  1L0V B;  2KQS A;  2K22 A;  3ALB A;  1ZGU B;  1F77 A;  3U8Z A;  4S17 A;  1MPE A;  2PEA A;  4M02 A;  4NPN A;  4AP4 C;  3A33 B;  3VQI A;  4DBG A;  2LMC A;  3KLS X;  1JML A;  4XE0 A;  3ZDM C;  4IG7 B;  1OTR B;  2FCS A;  2YEP F;  2K5P A;  2LGX A;  1UGJ A;  4JL9 A;  5DPW A;  1NYQ A;  2ZVO A;  2BWE S;  3W5U B;  4W9H A;  3S2A A;  3OJ4 B;  5LNK 1;  1XXG A;  2IY0 B;  4HPL B;  3QA8 A;  3QAR A;  2Y5P A;  1IGD A;  5CX3 A;  4HKZ E;  4MH8 A;  1T0R C;  2KWV B;  1V5O A;  4ANU A;  5D3I B;  3UF8 A;  1ROE A;  3KUZ A;  2IND C;  4K1R B;  2K0P A;  5FR3 A;  1AN8 A;  2PJH A;  4KSL C;  3DWG C;  5AUK A;  3V60 A;  2V4I B;  3B9J A;  4ZHO A;  2V3N A;  3HIZ A;  2LVP A;  3AEC B;  3VTU A;  4DWF A;  2N7D A;  2C7H A;  4WWN A;  1EF5 A;  3LJ3 A;  4RGM A;  1E7V A;  1C78 A;  5H8Y E;  1J7C A;  2OJW A;  5JZE B;  5JH5 C;  4HJG E;  1KM7 A;  2IO3 B;  5E6P A;  5C3J B;  1QOB A;  3H1U A;  2V3P A;  3HM3 A;  4BKS A;  3BY4 B;  1JW9 D;  4B0E A;  1WR6 E;  1TTN A;  2JRI B;  1FRR A;  3O65 B;  2IJ0 A;  1YQ3 B;  4W9L A;  4KV2 A;  2BS4 B;  3KWV A;  2MEK A;  4TQ1 A;  2D3C A;  5TR5 A;  3V61 A;  3L08 A;  4M0W A;  2NR2 A;  3CMM B;  1D3Z A;  3Q6B A;  3MC8 A;  1I4P A;  1PUT A;  4MJS B;  3NHE B;  1AYF A;  2HD5 B;  1EM7 A;  1SSN A;  2EKI A;  1H4R A;  3NUH B;  4G3X B;  4B95 A;  1MHX A;  1TS3 A;  2QCZ A;  3K9O B;  2DX5 B;  1J0G A;  2G9H D;  3R7Q A;  2L32 A;  1TY2 A;  4P1C C;  2C7N B;  3W5V B;  1ZDV A;  3VFK A;  3MHS D;  1VR9 A;  1TZO A;  2N9E B;  1SBB B;  1V81 A;  1PGB A;  3VTW A;  2RGF A;  2KAN A;  4OHJ A;  3P42 A;  2FIF A;  1RFA A;  4LNI A;  1K50 A;  3VUY A;  2QMT A;  1H8C A;  2DHZ A;  4EZJ A;  1JWA D;  4K3C A;  4W9G A;  2B3A A;  1IBX A;  2XEW A;  1NVI D;  1MI0 A;  1WGH A;  2FUH B;  1MG4 A;  2L76 A;  2DNF A;  3TEX A;  1WX8 A;  4AOF A;  4OZB A;  1XLP A;  2WP9 B;  4PS3 A;  3WCQ A;  4GMV A;  3H7P B;  3RPF C;  3APD A;  3DHG C;  1CJE A;  3EC8 A;  2MW5 A;  1WFY A;  1UUP A;  1V1P B;  3P4Q B;  2BWF A;  4YL8 A;  1VLB A;  2JXT A;  3MHZ A;  2L8J A;  4MM3 B;  1L6V A;  2MJ3 A;  4II3 B;  4RMA A;  4H2A A;  5H92 C;  1K8R B;  4W9K A;  1N6Z A;  2W3R A;  2WXL A;  2NCN A;  4MDK E;  1TT5 B;  4US9 A;  4ARI A;  3PRZ A;  2NTT A;  2CJN A;  1K53 A;  3D32 A;  2ZW1 A;  3AEE B;  3L16 A;  3Q3O C;  1WXA A;  1MG8 A;  2G4D B;  1FXA A;  4ANW A;  3APC A;  3Q8F A;  3DBL B;  3VH3 B;  2KMC A;  3HRD D;  3R7R A;  5E6N A;  1GJZ A;  3AEA B;  1F2R I;  2X8X X;  4KDI C;  3Q3F A;  1J7A A;  2DYM A;  5HKH A;  2DLB A;  1WJ4 A;  2MX2 A;  1C76 A;  3DWM A;  4GXB A;  1JRU A;  4EFO A;  2Z0E B;  3TUO A;  2LVO A;  2PKO A;  4GSW A;  1MJD A;  5L83 A;  1FMA D;  1NI2 A;  4FJY A;  4FHJ A;  1WYG A;  2G4S A;  4TMA B;  3IXS A;  3TMP B;  4YSX B;  1E5W A;  1PFD A;  4ZOH C;  1P98 A;  3ZTC A;  3ZRC A;  2L0T A;  3DBL I;  1OQQ A;  3RZW C;  3JVZ X;  2MLB A;  3NS1 A;  1XO3 A;  2CKH B;  2GMI C;  2LFI A;  4RH6 A;  3T3O A;  2ZW0 A;  2MP2 B;  2WXK A;  3TEZ A;  4ANV A;  1WZ3 A;  3ZJV A;  3JSV B;  4GN1 A;  2EEL A;  2LEK A;  4M8N A;  4C7Y A;  1E10 A;  4EEW A;  5TSS A;  1NEK B;  2IY1 B;  4W9D A;  2JZZ A;  2BTE A;  2K6Q A;  1EF1 A;  2KX0 A;  4ZYS A;  4AJW A;  1UNS A;  4M00 A;  3QWZ B;  1C1Y B;  1IGC A;  3H9D A;  3ZJU A;  1EWC A;  4LNF A;  3J9C A;  3ZNH B;  1WSP A;  2CHX A;  3NY5 A;  3P1M A;  1R4M B;  4MEM A;  4TV3 A;  2GBM A;  4BBN C;  3WAL A;  1E7P B;  3PRP B;  4M8M A;  1SB3 C;  4EE2 A;  5D3D A;  2W82 A;  3TIX A;  3SEB A;  2CHZ A;  4N58 A;  2KKC A;  3SU8 X;  5DPR A;  1I7H A;  5GMV A;  3B0A A;  2J52 A;  5D94 A;  3MJW A;  1N5X A;  3ZO5 B;  3LDZ E;  2FID A;  4KZ0 A;  2WGS A;  5G5G A;  2RPQ A;  4FXC A;  2K8B A;  1B1Z A;  1LQB A;  4YT0 B;  3W1S A;  2K9X A;  2BB6 A;  3GB1 A;  3OG5 A;  2HE7 A;  2JXX A;  2O2V B;  1SGH A;  1Q5W B;  3KW5 B;  4RFB A;  4WAA A;  2IGH A;  3ZGZ A;  4XZ4 A;  4JPS A;  3DBR B;  3N3K B;  1SE3 A;  1J19 A;  2WNM A;  5LXH A;  1VZ8 A;  3UIO B;  4W9E A;  2WXN A;  2ZCC A;  2V3S A;  3CST A;  3V62 A;  2BS2 B;  2BB5 A;  2LAS A;  3K9P B;  1PGX A;  1XEE A;  4URK A;  3EFU A;  4KIK A;  2WLB A;  2XBB C;  4LNO A;  1YMH E;  3AH7 A;  5BYR A;  3E56 A;  4DHZ B;  2IPK D;  4A3P A;  2YLM A;  2Y3A A;  3LB8 C;  2DZK A;  2KAJ A;  3ML8 A;  2JUO A;  2G1E A;  3N32 A;  1NI3 A;  3L54 A;  1QIL A;  2B76 B;  4MGY E;  4GDK A;  4ZRI A;  1WM2 A;  1N62 A;  1VRA B;  2DZI A;  2NBW B;  2JWZ A;  2X38 A;  2INN E;  3IT6 B;  1N60 A;  3H7S A;  2KX3 A;  3DBR I;  2CJO A;  4NAW B;  2QC8 A;  3GZN B;  4N6E B;  3N30 A;  4ZRP A;  4KDL B;  1KLG D;  1RFK A;  1E8Z A;  3A9K A;  2FCM A;  2KTR B;  4KGT A;  2MBB B;  5KHO A;  4GDL B;  1UF0 A;  3AED B;  1TS5 A;  3IFW B;  4GLS C;  4ZRK A;  4K7S A;  1SF0 A;  4MSM B;  1FPY A;  3P2B A;  4HDQ A;  3UIN B;  3VRA B;  4ACF A;  2FCQ A;  2K6D B;  1L0Y B;  2WXO A;  1WXS A;  1GNU A;  3NG0 A;  5GXG B;  4XYC A;  3X23 A;  3WA0 A;  4PYU A;  1TZ1 A;  4BKG A;  4LTU A;  3WAN A;  3I63 C;  1QF6 A;  3QC8 B;  3BIN A;  2DZJ A;  3EFC A;  5MPO A;  2W3S A;  4P7I A;  1TJE A;  2WXG A;  2KQ4 X;  2D3A A;  3A4R A;  3WAM A;  1L0X B;  2D5G A;  1HEZ E;  5D7G A;  4BVU C;  3DDC B;  3MJ5 A;  4RF1 A;  3SFE B;  4LDT D;  2ZPY A;  2V1Y A;  3V3X A;  1WJ6 A;  1R7S A;  4ZHP A;  5KHQ A;  2MBQ A;  4M01 A;  3ZUN A;  2MQJ A;  3BVZ A;  4ARC A;  1FNU A;  1JWM D;  1TKE A;  3C8Y A;  3Q14 C;  1FRD A;  3AE6 B;  4NAW A;  2GLS A;  4HPM B;  5IKC M;  4IWQ A;  1GC6 A;  3BVM A;  2LXA A;  1YN5 A;  5CHF A;  4K7U A;  2FE8 A;  3RMK C;  3I57 A;  1ZXH A;  3MC9 A;  3NJT A;  4S0R A;  2MA9 B;  4IM2 A;  2RD0 A;  2ACZ B;  1WE7 A;  1EU3 A;  4I6P A;  2FBW B;  2KQ7 A;  4HRO A;  3PZ7 A;  4LDT B;  1WJU A;  2IGG A;  3FIL A;  3NS8 A;  1JAL A;  2JYT A;  4IUM B;  4MGI E;  1WXV A;  2QIL A;  1G6J A;  2ZVN A;  1E7U A;  1XF5 L;  1QOG A;  4WJN A;  4HDO A;  2GOW A;  4KGR A;  2L7R A;  1S3S G;  4C4V B;  2MSE D;  2CHW A;  4KSK C;  3N9Y C;  3APF A;  3AU4 A;  2SAK A;  3BVG A;  2MJD A;  3U7Z A;  5HG2 A;  2XK5 B;  1EUV B;  4WQM A;  5CHW A;  3Q8C A;  1SE9 A;  2GI9 A;  4NQK E;  3V6C B;  3L10 B;  4L2Y A;  4NY0 A;  1WY8 A;  3VH4 B;  1UZX B;  4TQ0 A;  3AE8 B;  1AAR A;  2BVC A;  2INC C;  1QOF A;  3ABV B;  1C4A A;  1WM3 A;  4HPP A;  4L23 A;  1I42 A;  2A5U A;  2W55 A;  3ZRF A;  4KX6 B;  2Z59 B;  4USA A;  3C19 A;  1UBQ A;  2WDV B;  1WI0 A;  2HJ8 A;  3TBL D;  4TKN A;  3IG3 A;  1QKZ A;  2KFK A;  1FXI A;  1YIW A;  4MGK E;  4KKI A;  4IWO A;  2MBO A;  1F2R C;  1QLB B;  1GUA B;  1E90 A;  1LO5 D;  2CU3 A;  4I6N B;  1YJI A;  3QCA A;  4FN2 A;  2CU1 A;  2H89 B;  2WX0 A;  4RGN A;  2RPV A;  4DK5 A;  3URY A;  2K39 A;  4F7Z A;  2D10 A;  3N1Y C;  3DOW A;  2WXQ A;  2MJE A;  2BYV E;  3AE5 B;  1WE6 A;  2L00 B;  3PRE A;  5IO9 A;  5HHD G;  1F52 A;  3ZXV A;  2ON8 A;  2BPS A;  3AN1 A;  2KWD A;  2LD9 A;  3M62 B;  1WJN A;  3M3J A;  3V05 A;  4P6V F;  1Y56 A;  2K8C A;  4DHJ B;  1R4N B;  3PSE B;  1Q10 A;  1T6B X;  4N9F 4;  2KVR A;  2WS3 B;  3KH0 A;  3T9L A;  5C23 A;  2PIA A;  3MP9 A;  2N7E A;  4G50 A;  1TKG A;  1WMH B;  3Q8A A;  2DAF A;  1QQR A;  4ITK A;  2KTF A;  1ET9 A;  2LRU A;  2VRR B;  3W1Y A;  2JQR B;  3VRB B;  4FA6 A;  5J2R A;  2DAJ A;  2JT4 B;  1NYR A;  2JY6 A;  2KD0 A;  1I4X A;  4WWM A;  3IAM 1;  3ZNG C;  3AE2 B;  1ZDX A;  2IYD B;  1ZOY B;  5JHA A;  1TS4 A;  3A1Q B;  1YNT E;  2R2O A;  4W9I A;  1E8W A;  1R4N I;  2KDE B;  1AWD A;  4B6W A;  2N9X A;  3Q69 A;  1I4Q A;  3SDL C;  1F0Z A;  4RF0 A;  3W1S C;  4MSQ B;  3ZIM A;  3VAW A;  1WGK A;  2AL3 A;  2I38 A;  4F1S A;  1WXM A;  3GP7 A;  1GB1 A;  2KHW B;  2KDI A;  4L1B A;  3IHP C;  2GBN A;  1KF6 B;  4P1B C;  2C9W B;  4XWT A;  3PRM B;  1GG3 A;  2JYE A;  3AUL A;  4MJS A;  5G55 A;  2JU6 X;  4Q2J A;  1L7Y A;  1UBI A;  1XCT L;  3PV1 A;  1IUE A;  5D6J B;  3B2G A;  4DDG D;  3AEG B;  3RN9 C;  4IKG A;  3NVW A;  1EU4 A;  3ZW3 A;  2AQ3 B;  1U4A A;  2KNB A;  2HDE A;  1WGG A;  2GBJ A;  2D3G A;  2VH1 A;  3RUL A;  3AB5 A;  4BAX A;  2MHJ A;  3ENE A;  2EMS A;  4ICU A;  3DBH B;  2NBV B;  3AXC A;  3ONS A;  2WWZ A;  1TBE A;  4NJ6 A;  3HK0 A;  3Q3J A;  4QAY A;  4IDI A;  1HZ5 A;  3BK2 A;  5BYQ A;  4MT5 A;  4JIO U;  4WWP A;  5DPS A;  4OZA A;  1BUI C;  2IO2 B;  5EE0 A;  3VVW B;  3AU5 A;  2ZNV B;  5J18 A;  3ZLZ A;  4FHK A;  2HTM E;  1T3Q A;  4FJZ A;  4RNA A;  1Z2M A;  4KKJ A;  2BGF A;  5C1Z A;  5BMI A;  2QSD A;  2MBH A;  2UYZ B;  3H7P A;  4YXD B;  4N59 A;  2PPH A;  1HTQ A;  5JHB A;  4E74 A;  2NMQ A;  4IM3 A;  3KVF B;  1V1P A;  1GB4 A;  3DBH I;  1LGR A;  2JPH A;  3SFD B;  4MM3 A;  3VHT C;  2NPT B;  3PZD A;  1ENF A;  2N7J A;  3JYU A;  3TJP A;  2L3Z A;  3Q8B A;  4WH4 A;  4YSZ B;  3CIR B;  2K8H A;  5AUI A;  1F1H A;  1HZ6 A;  4PK1 A;  4NNJ B;  2MCN B;  2QHO A;  2I1J A;  4HRS A;  2R61 A;  3DHH C;  3AM9 A;  4CHK A;  2ZPN A;  4C80 A;  3GOE A;  5EE3 A;  2ZJD A;  1XLO A;  5AEK B;  5FK9 C;  1XT9 B;  2HTH A;  1KTK A;  3AE7 B;  2NS5 A;  2J0K A;  4HCN B;  1T0Y A;  2EMT A;  4CO7 A;  2GBK A;  4ANX A;  1WIA A;  3PPA A;  3B08 A;  2C7M B;  2WDT B;  3OWE B;  1HXY D;  1DOI A;  2HJ1 A;  3NVY A;  2GRI A;  1FCL A;  2KJH B;  4J6I A;  2G3Q B;  3NVZ A;  2REX A;  2KC1 A;  2LZ6 A;  4JWU C;  3L17 A;  3RNB C;  1YJJ A;  2KVZ A;  5E6O A;  3DQV A;  4C56 C;  4KVG B;  1DYQ A;  2AEH A;  3QX1 A;  4RGO S;  1FNV A;  4WIP A;  2K25 A;  3RD2 A;  2KLC A;  2CS4 A;  3RNG C;  5LLI A;  2N9P C;  3NVV A;  1WYW B;  4DDI D;  1YX5 B;  2AYO B;  2VH2 A;  3LYY A;  4DXA B;  2RDH A;  3T8M A;  1WGY A;  2KJ6 A;  1R4M I;  1OFF A;  1OEY J;  4OZC A;  2MP2 A;  5G5H A;  3JSV A;  4HK2 A;  3VR8 B;  3VDZ A;  4ZRQ A;  2KDM A;  3L13 A;  2K3U A;  4A90 A;  2L1A A;  3EHV A;  2RSU A;  1E0Z A;  1V1O A;  1WRI A;  2IGD A;  5EDS A;  2KDB A;  3EEC A;  1GAQ B;  3TEW A;  2O6V B;  3U52 E;  4NJ7 A;  1UEL A;  2IO0 B;  3MTN B;  1CZP A;  4LNK A;  2DYO A;  2CR5 A;  1WH3 A;  3ECI A;  1RM6 C;  4KGS A;  3PHW B;  2M0X A;  2D2Q A;  5IN7 A;  2BQQ A;  2KJR A;  3UI3 A;  1WRD B;  3DVN V;  1PDX A;  2Z8L A;  2ICI A;  2JZ3 B;  2OHF A;  3KYC D;  3T3N A;  4TUU A;  1P0R A;  3AEB B;  1E8Y A;  2FNJ B;  1TY0 A;  4HKQ A;  2KO3 A;  1FFU A;  3GE8 C;  1SIJ A;  3MC0 B;  3JW0 X;  4AJY B;  3DVG X;  4A3O A;  1V5T A;  2KFJ A;  2M17 A;  2KN4 A;  3I9V 1;  2Z0D B;  3UQA A;  2M1M A;  1TIF A;  5FR6 A;  2JX5 A;  2RDG A;  3A9J B;  4WWO A;  2DZM A;  2IO1 B;  1P9D U;  1V8C A;  2O2V A;  1M4V A;  1D5Z C;  2ONQ A;  2N1W A;  2ZZP B;  2LHE A;  1SJH D;  4AS1 A;  1V6E A;  4AUQ C;  2KWC A;  2BT6 A;  1A70 A;  1OQR A;  1VZ6 A;  2M8S A;  2MBE A;  3QQ8 B;  3GZN I;  4HEA 1;  4DHZ E;  2IZV B;  1A5R A;  1KJT A;  4ZDV A;  1KOT A;  4OVZ A;  4JQW C;  5HI1 A;  2LJI A;  3OAW A;  5FKA C;  3RNA C;  2R2Q A;  1ZPS A;  4O1N A;  1IPG A;  1P1A A;  4WAF A;  3IT4 B;  1I35 A;  3R66 C;  2AWT A;  4REZ A;  1KLV A;  1KRH A;  4BKT A;  2LRW A;  1YN3 A;  2BW2 A;  4LJO B;  3ZYY X;  3GS2 A;  4EZL A;  4FAD A;  2VZK B;  1WGD A;  5DCN A;  2I1K A;  3PT2 B;  3N20 C;  1Q1O A;  4NZL B;  4A20 A;  1BXT A;  5D2M B;  2KTR A;  2JVC A;  2BF8 B;  3ML9 A;  5BO4 B;  3AEF B;  4GDL A;  1E8X A;  4B9K A;  1LXD A;  1FXT B;  3U4E G;  2TSS A;  1RRB A;  2DBY A;  3TSS A;  1FNW A;  1JWU D;  1LFD A;  1SXT A;  4WJQ A;  1YX6 B;  4EZK A;  4IM0 A;  1VDV A;  1XLN A;  2QIE B;  3SD5 A;  3U7D A;  4RGT A;  3L0W B;  2N9K A;  1HA5 A;  4GU2 A;  1QT9 A;  4MEL A;  3DPD A;  3RNF C;  2GB1 A;  2I2Y A;  4CQN A;  3AE9 B;  2QDF A;  3BYY B;  1BT0 A;  1OGW A;  1TYG B;  3PHX B;  2BKR B;  1PGA A;  4M0W B;  4RM8 A;  2WXR A;  1UGM A;  3AMZ A;  2L83 A;  5AZF A;  2FCN A;  4D2K A;  1FIQ A;  2GBR A;  4G0N B;  2E6X A;  1WGR A;  3KQ4 A;  4ASW C;  2J0M A;  3QHT A;  1Q0W B;  1M94 A;  2LUE A;  1YJ1 A;  1V49 A;  3UQB A;  2ASQ A;  1FO4 A;  2ZEQ A;  3TEY A;  3RYT A;  3HUI A;  2UU7 A;  3ZXR A;  4XX5 A;  3SR6 A;  1MVK A;  4HCP B;  2BYF A;  2H88 B;  3IVF A;  2E3T A;  3C0R B;  2KOX A;  5CTR C;  1ZKH A;  3PVL A;  4DHJ D;  1PYW D;  3QJZ A;  4B0M A;  4W9C A;  4MH0 E;  5T8I A;  3PTF C;  3I5J C;  4YSY B;  3CF6 E;  1S1Q B;  1YN4 A;  4FBJ B;  1FCC C;  3N1X C;  1IBX B;  3ZTD A;  2J42 A;  3NOB A;  1C9F A;  4WQO B;  1V97 A;  4OVV A;  3ZJT A;  2K1F A;  2N4F A;  3AE4 B;  2Y5C A;  5C2T B;  2L52 A;  2W9N A;  1RAX A;  2AL6 A;  1HTO A;  1C3T A;  1L4Z B;  2RMM A;  3DCG A;  1ESF A;  3RCZ A;  1NBF C;  4EKU A;  3AV8 A;  4C4V A;  1EWY C;  3DVG Y;  4BZA A;  3DHI C;  3NZS A;  1P7E A;  1TS2 A;  3Q3N C;  5EE9 A;  2QEJ C;  1XD3 B;  1I4G A;  2LUM A;  2XK5 A;  4W9J A;  4EOY A;  2KMA A;  2FUG 1;  2PW9 A;  4F8C B;  3GE3 C;  3AI5 A;  1B9R A;  2LGS A;  3X0W A;  4LJP B;  2MH7 A;  2N1V A;  2XNA C;  4PS7 A;  1T0Q C;  1D5M C;  1ET6 A;  5IP4 D;  1MHH E;  2ZCB A;  3FAH A;  2KDF B;  3LXF A;  1HQR D;  3P4S B;  2OOB B;  2WHI A;  2ZNV C;  4AWJ A;  2AQ1 B;  3U2S C;  2FAZ A;  5G2N A;  2G45 B;  4IWP A;  1YQB A;  1UWM A;  3VUW A;  1JQ4 A;  2M0A A;  3OJ3 A;  2IDY A;  3FKY A;  4BBN F;  4RM9 A;  4RCO A;  5L95 C;  3HM6 X;  2KAC A;  1OQY A;  1QZE A;  2SEB D;  3R2I A;  1FD6 A;  2WDR B;  3RNE C;  3N1Z C;  4LK0 M;  1BML C;  2RDB C;  3BZD B;  1C77 A;  2YVC A;  4HXD A;  2PVG C;  4DQO C;  1JRO A;  3RFZ B;  1MFW A;  2C60 A;  4GB9 A;  5LXI B;  4WJO A;  5BMG A;  2AQ2 B;  3P63 A;  2WU5 B;  4NAM A;  3WAO A;  2OED A;  2M19 A;  2UWQ A;  4XC2 A;  2EKE C;  3EGR A;  5DPT A;  4WJP A;  1WMH A;  1WWT A;  2KC2 A;  3ZQ4 A;  5I4D A;  4LCD E;  3H6N A;  2BYE A;  4ZRJ A;  1WR1 A;  1Z5S B;  4EUT A;  4ZYN A;  1P7F A;  3RI7 C;  4A8X C;  4KZC A;  2C5L C;  3NRZ A;  1N61 A;  1UD7 A;  2J7Q B;  4C00 A;  2D11 A;  4I6L B;  1NDD A;  4XGA B;  2JRH A;  5E6J A;  4PT5 A;  2QJL A;  4GIV A;  3A1Q A;  3IAS 1;  3QK0 A;  5JXV A;  4BOZ B;  4K81 A;  3AE3 B;  2IBI B;  3HVD A;  4HVB A;  2J0J A;  3NZU A;  4BFR A;  1C4P A;  1CMX B;  1YOV B;  4LNN A;  4BOS C;  3PZ8 A;  1N5W A;  3CSF A;  1OEY A;  3EA6 A;  2PE6 B;  2DYB A;  3PO0 A;  1E9M A;  4MGZ E;  4C7Z A;  3I3T B;  3VTV A;  1I4R A;  1YD8 U;  3W2D A;  3A4S C;  1JWB D;  1SIF A;  5IAA C;  3PLV A;  2KXJ A;  2LJ5 A;  3ZNZ B;  3PLU A;  2PTL A;  1L2N A;  4HWI B;  4IOI E; 
#chains in the Genus database with same CATH homology
 1WXV A;  2FIF A;  1RFA A;  1G6J A;  2L05 A;  2JZ3 B;  2ZVN A;  1E7U A;  3VUY A;  3KYC D;  1H8C A;  3KYD D;  4WJN A;  4HDO A;  2DHZ A;  2GOW A;  4EZJ A;  4TUU A;  1P0R A;  4W9G A;  2L7R A;  2WX1 A;  1E8Y A;  1S3S G;  2FNJ B;  2MSE D;  1GC7 A;  2CHW A;  4KSK C;  2B3A A;  2KO3 A;  3VXW A;  2XEW A;  3APF A;  3AU4 A;  1WGH A;  5J17 A;  4K7W A;  5AZH A;  3JW0 X;  4AJY B;  2FUH B;  2L76 A;  4E71 A;  1XQQ A;  2M4N A;  3DVG X;  4A3O A;  1WX8 A;  4AOF A;  1V5T A;  2KFJ A;  4JGH B;  2M17 A;  4JLC A;  2Z0D B;  2XK5 B;  1EUV B;  2OJR A;  2LGY A;  3UQA A;  5CHW A;  2M1M A;  5FR6 A;  3A9J B;  4PS3 A;  4WWO A;  1SE9 A;  2DZM A;  2IO1 B;  4GMV A;  4NQK E;  3V6C B;  3TL5 A;  1P9D U;  3H7P B;  3APD A;  2O2V A;  3L10 B;  4NY0 A;  1VD2 A;  4KIK B;  1WY8 A;  3VH4 B;  1UZX B;  4G11 A;  4TQ0 A;  3EC8 A;  2N1W A;  2ZZP B;  1AAR A;  2MW5 A;  1WFY A;  2LWP A;  1V6E A;  2LXC A;  4AUQ C;  3ZVV A;  1WM3 A;  2KWC A;  3RUI B;  2BWF A;  4YL8 A;  2A5U A;  1I42 A;  2L8J A;  4II3 B;  3ZRF A;  2M8S A;  4RMA A;  1WF9 A;  2MBE A;  1V86 A;  2Z59 B;  3GZN I;  2L0F A;  3QQ8 B;  3ZNI D;  4GDK B;  2MRP A;  1UBQ A;  2A4Z A;  1X1M A;  1WI0 A;  2HJ8 A;  1K8R B;  2O6V D;  4W9K A;  4DHZ E;  3TBL D;  4TKN A;  3QAQ A;  2NCN A;  3IG3 A;  4MDK E;  2IZV B;  1HE8 A;  1A5R A;  1KJT A;  2KFK A;  4ZDV A;  4E3C A;  3M95 A;  3PRZ A;  1KOT A;  1YIW A;  4MGK E;  3KUD B;  4JQW C;  4IWO A;  2MBO A;  3D32 A;  3A9K B;  1GUA B;  3OAW A;  1E90 A;  3L16 A;  2R2Q A;  1WXA A;  2WYQ A;  1MG8 A;  2G4D B;  4I6N B;  2NPT A;  4ANW A;  3QCA A;  3APC A;  4FN2 A;  1IPG A;  1P1A A;  2CU1 A;  2WX0 A;  3VH3 B;  1I35 A;  2KMC A;  3R7R A;  3R66 C;  2AWT A;  5E6N A;  3SHQ A;  3V6E B;  4DK5 A;  2K39 A;  1GJZ A;  1KLV A;  4BKT A;  2LRW A;  1IP9 A;  4KDI C;  3Q3F A;  1PQS A;  4F7Z A;  2DYM A;  4LJO B;  2D10 A;  5HKH A;  3DOW A;  1IYF A;  4EZL A;  2BYV E;  4FAD A;  1WJ4 A;  2MX2 A;  1WGD A;  1WE6 A;  2L00 B;  3B1L X;  1JRU A;  2JF5 A;  3PRE A;  4GXB A;  4EFO A;  5DCN A;  2PE9 A;  2I1K A;  3PT2 B;  2Z0E B;  4IC7 B;  1Q1O A;  2BPS A;  4A20 A;  2LVO A;  4GSW A;  5D2M B;  2DEN B;  2LD9 A;  2KTR A;  3M62 B;  4X57 B;  1WJN A;  2JVC A;  3M3J A;  5L83 A;  2BF8 B;  3ML9 A;  5BO4 B;  3QIJ A;  4GDL A;  1E8X A;  2K8C A;  4DHJ B;  3PSE B;  1NI2 A;  4N9F 4;  4FJY A;  2KVR A;  3DBS A;  4FHJ A;  1LXD A;  3KH0 A;  1FXT B;  2G4S A;  5C23 A;  3T9L A;  4B9K A;  2N7E A;  2RR9 A;  4G50 A;  3PGE A;  1RRB A;  1P3Q U;  3TMP B;  1WMH B;  1E5W A;  1LFD A;  1P98 A;  2DAF A;  4WJQ A;  2V4L A;  3ZTC A;  3ZRC A;  1YX6 B;  4EZK A;  2L0T A;  4IM0 A;  3DBL I;  3SD5 A;  3RZW C;  3U7D A;  2KTF A;  2MLB A;  3JVZ X;  2LRU A;  2CKH B;  2VRR B;  4PYZ A;  3W1Y A;  3R3M A;  3L0W B;  4FA6 A;  4FUL A;  2GMI C;  4FJV B;  5J2R A;  2KLG A;  2DAJ A;  2JT4 B;  2MP2 B;  2MWS B;  4GU2 A;  2JY6 A;  4ANV A;  4MEL A;  3ZKJ C;  2KD0 A;  3DPD A;  3RT3 B;  4II2 B;  1WZ3 A;  3ZNG C;  3JSV B;  2IYD B;  3IBE A;  5JHA A;  3A1Q B;  4GN1 A;  2R2O A;  1V2Y A;  4M8N A;  1BT0 A;  1OGW A;  3PHX B;  4W9I A;  2BKR B;  4RM8 A;  4M0W B;  3VUX A;  1E8W A;  1R4N I;  1UGM A;  2LGD A;  3DVN U;  3UIP B;  4CYE A;  5AZF A;  4EEW A;  2FCN A;  2IY1 B;  5IA7 A;  2GBR A;  2KDE B;  4W9D A;  4B6W A;  4G0N B;  2JZZ A;  1WGR A;  4ASW C;  2J0M A;  2N9X A;  3SDL C;  3QHT A;  2K6Q A;  3W1S C;  1EF1 A;  4MSQ B;  1Q0W B;  5CHV C;  2KX0 A;  1M94 A;  3VAW A;  3ZIM A;  4AJW A;  2AL3 A;  2NBU A;  4F1S A;  1ISN A;  2LUE A;  1YJ1 A;  4HJK A;  1V49 A;  3UQB A;  1WXM A;  2ASQ A;  3QWZ B;  2ZEQ A;  3U30 A;  2KHW B;  3RYT A;  2KDI A;  1C1Y B;  4XX5 A;  3H9D A;  3IHP C;  2GBN A;  4HCP B;  2C9W B;  2Y5B B;  2BYF A;  3ZNH B;  3NY5 A;  2CHX A;  3PRM B;  3IVF A;  3C0R B;  1GG3 A;  1UH6 A;  2NVU I;  2KOX A;  4MEM A;  5CTR C;  4TV3 A;  2GBM A;  1ZKH A;  4OVU A;  3AUL A;  3PVL A;  4MJS A;  4BBN C;  5G55 A;  4DHJ D;  3WAL A;  5AZG A;  1L7Y A;  3PRP B;  1UBI A;  3QJZ A;  3PV1 A;  4M8M A;  4PS8 A;  4W9C A;  4MH0 E;  5D6J B;  3PTF C;  3TIX A;  4DDG D;  2CHZ A;  2O6V A;  2KKC A;  3CF6 E;  3SU8 X;  5DPR A;  5GMV A;  1S1Q B;  3B0A A;  4FBJ B;  5D94 A;  3OLM D;  3MJW A;  2BKF A;  3ZW3 A;  1U4A A;  3ZO5 B;  2KNB A;  1WGG A;  2GBJ A;  2D3G A;  3RUL A;  3LDZ E;  3ZTD A;  3NOB A;  1Y8R C;  2FID A;  4WQO B;  1F9J A;  4OVV A;  2K1F A;  2N4F A;  4KZ0 A;  3ENE A;  4BKS D;  2RPQ A;  2KN5 A;  2K8B A;  3WIM A;  1LQB A;  2EMS A;  4ICU A;  2NBV B;  3AXC A;  3W1S A;  2W9N A;  3ONS A;  1RAX A;  2AL6 A;  1WZ0 A;  2WWZ A;  1C3T A;  1TBE A;  4NJ6 A;  3DCG A;  3ZDT A;  3M63 B;  3RCZ A;  2HE7 A;  2JXX A;  1WX9 A;  3HK0 A;  3Q3J A;  1NBF C;  2O2V B;  4EKU A;  1SGH A;  1Q5W B;  3KW5 B;  4WAA A;  3UGB B;  4JIO U;  3RZF A;  4WWP A;  1V9J A;  4XZ4 A;  5DPS A;  3DVG Y;  3PS6 A;  2IO2 B;  3N3K B;  3VVW B;  3AU5 A;  2ZNV B;  1J19 A;  3NZS A;  4FLH A;  4HLE A;  5J18 A;  3ZLZ A;  4FHK A;  5LXH A;  3UIO B;  1XD3 B;  4W9E A;  2ZCC A;  1V80 A;  1EO6 A;  2V3S A;  3CST A;  3V62 A;  1J8C A;  4GOC A;  2XK5 A;  4W9J A;  4FJZ A;  2LAS A;  2KMA A;  4EOY A;  3K9P B;  1WX7 A;  1Z2M A;  2KZR A;  2LI5 A;  4F8C B;  2BGF A;  2KK8 A;  3A9J A;  3TCA A;  5C1Z A;  4URK A;  3EFU A;  2MBH A;  2UYZ B;  3AI5 A;  3H7P A;  2KFK B;  4KIK A;  4IW0 A;  3X0W A;  2XBB C;  4LJP B;  2PPH A;  2N1V A;  5JHB A;  1TGZ B;  4PS7 A;  4W9F A;  4DHZ B;  4E74 A;  4IM3 A;  4A3P A;  3KVF B;  2YLM A;  3KUC B;  3DBH I;  2ZCB A;  4ICV A;  2DZK A;  2KDF B;  3WAP A;  2JPH A;  3ML8 A;  4MM3 A;  2JUO A;  3HHM A;  3VHT C;  1LM8 B;  2NPT B;  3PZD A;  3N32 A;  2OOB B;  3JYU A;  3L54 A;  2L3Z A;  3TJP A;  2D07 B;  4MGY E;  2LVQ A;  2ZNV C;  4GDK A;  4ZRI A;  4NQL B;  4AWJ A;  1WM2 A;  2DZI A;  2NBW B;  2FAZ A;  2K8H A;  2JWZ A;  1RLF A;  4GGQ A;  1VCB A;  4NNJ B;  1ZW7 A;  2MCN B;  2KWU B;  2QHO A;  2I1J A;  5G2N A;  2G45 B;  2KQS A;  3H7S A;  4IWP A;  3ALB A;  1YQB A;  2KX3 A;  3VUW A;  3DBR I;  1ZGU B;  4CHK A;  4NAW B;  2ZPN A;  3U8Z A;  3OJ3 A;  3N30 A;  4KDL B;  2PEA A;  3A9K A;  4BBN F;  1E8Z A;  3GOE A;  4NPN A;  2ZJD A;  4RM9 A;  2FCM A;  5L95 C;  3HM6 X;  5AEK B;  4AP4 C;  3A33 B;  1OQY A;  1XT9 B;  1QZE A;  2HTH A;  2KTR B;  2MBB B;  3VQI A;  4DBG A;  5KHO A;  2NS5 A;  4GDL B;  3ZDM C;  2J0K A;  4HCN B;  4HWI B;  1T0Y A;  2EMT A;  4IG7 B;  4CO7 A;  1OTR B;  2FCS A;  2GBK A;  3IFW B;  2YVC A;  4ZRK A;  4HXD A;  4K7S A;  4ANX A;  1WIA A;  4MSM B;  3PPA A;  2LGX A;  3P2B A;  4JL9 A;  5DPW A;  2ZVO A;  3B08 A;  2BWE S;  4HDQ A;  3UIN B;  4W9H A;  2C7M B;  2FCQ A;  2C60 A;  3S2A A;  2K6D B;  3OJ4 B;  2WDT B;  4GB9 A;  1WXS A;  5LXI B;  2IY0 B;  1GNU A;  4HPL B;  3QA8 A;  4WJO A;  3QAR A;  2KJH B;  4J6I A;  5CX3 A;  2G3Q B;  2KWV B;  3WAO A;  3X23 A;  1V5O A;  2REX A;  4ANU A;  3WA0 A;  2KC1 A;  3UF8 A;  4PYU A;  2LZ6 A;  3KUZ A;  3L17 A;  1TZ1 A;  4K1R B;  5E6O A;  4BKG A;  2UWQ A;  4XC2 A;  3DQV A;  2PJH A;  3WAN A;  4KSL C;  2EKE C;  4KVG B;  3V60 A;  2AEH A;  3QC8 B;  3BIN A;  3QX1 A;  5DPT A;  2DZJ A;  4WJP A;  3HIZ A;  2LVP A;  3VTU A;  1WMH A;  4DWF A;  2KC2 A;  2N7D A;  2C7H A;  2K25 A;  4WWN A;  1EF5 A;  2KLC A;  3LJ3 A;  2CS4 A;  4LCD E;  4P7I A;  5LLI A;  3RD2 A;  1E7V A;  2N9P C;  3H6N A;  2BYE A;  3A4R A;  4ZRJ A;  3WAM A;  5JZE B;  1WR1 A;  1Z5S B;  4EUT A;  5D7G A;  5JH5 C;  4BVU C;  1KM7 A;  1WYW B;  4DDI D;  1YX5 B;  2IO3 B;  2AYO B;  5E6P A;  3H1U A;  4ZYN A;  3DDC B;  4DXA B;  4LDT D;  4KZC A;  2ZPY A;  2C5L C;  3HM3 A;  3T8M A;  1WGY A;  2V1Y A;  4BKS A;  3BY4 B;  1UD7 A;  1WJ6 A;  2KJ6 A;  5KHQ A;  1R4M I;  2MBQ A;  3ZUN A;  1OEY J;  2J7Q B;  1WR6 E;  2D11 A;  2MP2 A;  1TTN A;  2JRI B;  2MQJ A;  4I6L B;  1NDD A;  2JRH A;  3O65 B;  4W9L A;  4KV2 A;  3JSV A;  4GIV A;  4HK2 A;  3A1Q A;  4TQ1 A;  5TR5 A;  3VDZ A;  3QK0 A;  3V61 A;  3L08 A;  4BOZ B;  4K81 A;  3L13 A;  2NR2 A;  2IBI B;  3CMM B;  4HVB A;  4NAW A;  1D3Z A;  2J0J A;  3NZU A;  4HPM B;  4BFR A;  3EHV A;  1GC6 A;  2RSU A;  4IWQ A;  1CMX B;  2LXA A;  4MJS B;  3NHE B;  5CHF A;  4K7U A;  2HD5 B;  5EDS A;  4BOS C;  2KDB A;  1H4R A;  4G3X B;  4B95 A;  3EEC A;  2MA9 B;  4IM2 A;  2RD0 A;  3CSF A;  3K9O B;  1OEY A;  2DX5 B;  1J0G A;  2O6V B;  3R7Q A;  2PE6 B;  2DYB A;  4NJ7 A;  1UEL A;  1WE7 A;  2IO0 B;  3MTN B;  4MGZ E;  2C7N B;  3I3T B;  4I6P A;  2DYO A;  2CR5 A;  1WH3 A;  3VTV A;  1YD8 U;  2KQ7 A;  3VFK A;  3ECI A;  3MHS D;  3PHW B;  3A4S C;  2M0X A;  4LDT B;  1SIF A;  2N9E B;  5IAA C;  2KXJ A;  1WJU A;  1V81 A;  2LJ5 A;  2D2Q A;  3PLV A;  3NS8 A;  3ZNZ B;  3PLU A;  2KJR A;  3VTW A;  1L2N A;  1WRD B;  4IUM B;  2RGF A;  4MGI E;  2KAN A;  3DVN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...