3Q3JA

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
111
structure length
102
Chain Sequence
LIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKQRPRAVDMDLEWRQGRIARVVLQDEDITTKIKRLNTLMHYQVSDRSVVALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
molecule keywords Plexin-A2
total genus 23
structure length 102
sequence length 111
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3q3jA00
1LM8B 3QCAA 5BO4B 4W9EA 5G2NA 4GSWA 2DHZA 4FJZA 1ZKHA 1S1QB 3ZVVA 2FCMA 2MCNB 3JYUA 4G0NB 4E71A 2DYOA 3CMMB 3QHTA 3B0AA 2J0KA 2L8JA 2MWSB 5JHAA 4AJYB 3DVGY 1PQSA 4LDTD 1OEYJ 2NPTA 3KH0A 1C3TA 4ZRJA 1RFAA 1JRUA 2MX2A 2KHWB 1BT0A 1P3QU 4RM8A 3APDA 1E8WA 4DBGA 5D2MB 4AWJA 2K6DB 2LI5A 5E6OA 1E8YA 3H7SA 4WWOA 2D07B 1WXVA 3KYCD 3L08A 3QC8B 2IO1B 4N9F4 1TBEA 2Z0EB 3RCZA 3D32A 1XD3B 2DYMA 3L54A 4BBNC 1V6EA 4RMAA 2QHOA 1Y8RC 4A3PA 4I6PA 4IM3A 4KVGB 4FHKA 4NJ7A 2ZVNA 3K9OB 4PYZA 2NPTB 2ASQA 4M8MA 2MRPA 1A5RA 1GG3A 2XBBC 4K7SA 4BKSD 3AULA 1UELA 4ANXA 3OLMD 3VH3B 2R2QA 2EMTA 4NQLB 2ZCCA 2CHWA 3IHPC 2KMCA 3Q3JA 2OOBB 2JZZA 1F9JA 3KUDB 3WALA 2AWTA 1LXDA 2XEWA 3NS8A 3VFKA 2Y5BB 3PV1A 2KMAA 2M8SA 3PPAA 2GBRA 2EMSA 3UIPB 5AEKB 2MBQA 1J0GA 2RR9A 3L0WB 2FCQA 4DHZB 5LXIB 1Q5WB 4PS8A 4FN2A 1GUAB 1P9DU 3UQBA 4KZ0A 4FADA 2MBEA 2KTFA 3DVNV 3NZSA 2PJHA 2K8HA 2KWVB 1J19A 2DZKA 2YVCA 4WAAA 2O6VD 2KDEB 1P98A 5DPSA 1WJNA 3V62A 1WF9A 1WRDB 2OJRA 4F1SA 2PE6B 2BYFA 3A4RA 4F8CB 3BINA 1AARA 4JQWC 2IY0B 3GOEA 3PS6A 4NNJB 5DCNA 2BF8B 2PEAA 2LZ6A 2KWCA 3LDZE 4NAWA 3RYTA 1D3ZA 4XC2A 2KWUB 1WJUA 2FNJB 1GC6A 2A5UA 2ZEQA 2ZZPB 4MDKE 1R4MI 3R3MA 2IO3B 2IO0B 3Q3FA 1U4AA 3AU4A 4M0WB 3R7RA 2DZIA 2N4FA 4GDKB 2KFKB 1Q1OA 5L95C 3ML8A 3QIJA 3TCAA 4E3CA 1CMXB 3N32A 1GNUA 4MJSA 2PE9A 5JH5C 3K9PB 2M1MA 3PTFC 5J17A 2ZJDA 3R66C 4HVBA 2JXXA 4HPLB 1UBIA 4MELA 2N7DA 2XK5A 3NOBA 3QAQA 3VH4B 4CYEA 5CTRC 2KKCA 2JWZA 4K7UA 2K1FA 2MP2A 3HM3A 2KO3A 4JL9A 1IYFA 3ZKJC 2NBUA 2G4DB 2KANA 3DOWA 1P0RA 3VUWA 1XQQA 2KJHB 2KJRA 4ZRIA 3QQ8B 4ZRKA 4KZCA 4MJSB 1T0YA 1UBQA 3RUIB 2ZNVC 5JZEB 3ZIMA 3DVGX 1V2YA 1SE9A 5DPRA 3CF6E 3VXWA 4MM3A 4AOFA 4FBJB 1R4NI 2C60A 3H9DA 3PRZA 3V61A 1YX5B 4LDTB 4OVUA 1Z2MA 3R7QA 2KNBA 2BGFA 2KJ6A 2ZCBA 4ASWC 4BBNF 4IM2A 1WJ6A 4EOYA 1KM7A 1I42A 2MSED 2LWPA 3UIOB 2ZNVB 4ANVA 4CO7A 2KTRA 1RAXA 3A1QB 3PSEB 1X1MA 4BKTA 4DDID 3AU5A 2CHZA 3QK0A 2WX1A 3EFUA 4WWPA 3OJ4B 1EO6A 2LRUA 1V9JA 4NJ6A 4GDLA 4WJQA 4W9GA 2KLCA 3VTWA 3QJZA 4MGYE 2ZPNA 1TZ1A 2LVOA 1IPGA 5D94A 1ZGUB 5E6NA 4FJYA 4XX5A 2D11A 2MP2B 1WR1A 2IZVB 3ZRCA 1SGHA 4RM9A 1ZW7A 3PLVA 2NR2A 4EKUA 4EUTA 2JRHA 3DDCB 4I6NB 2KK8A 4WJPA 3SD5A 3UINB 5HKHA 4HJKA 4FHJA 2MW5A 1UD7A 3IVFA 4MSQB 4LCDE 4EFOA 3U30A 4EZKA 4DHZE 3TL5A 3ZDTA 1G6JA 4G50A 1WX9A 2G4SA 2UYZB 1WI0A 5CHVC 3M3JA 4HPMB 1V5OA 1KLVA 4IUMB 3WAPA 1ISNA 4ICVA 1L2NA 2L05A 2BYVE 2KX0A 2MBOA 2KVRA 3DBLI 2DZJA 2IY1B 2KD0A 3IBEA 2B3AA 1YIWA 2JT4B 3S2AA 3RT3B 2L76A 5JHBA 2N1WA 3A9JA 2JY6A 1WFYA 1OGWA 5J18A 3WIMA 4TUUA 2HE7A 5KHOA 3JVZX 2BWES 3JW0X 3QX1A 1H8CA 3PGEA 2Z59B 5D7GA 3BY4B 1IP9A 3ZNZB 1FXTB 3H7PA 3OJ3A 4KDLB 3ZNID 1TTNA 4KIKA 1E8XA 5E6PA 2NBWB 1EF1A 4GIVA 5TR5A 1P1AA 1WY8A 1OTRB 2BWFA 2K39A 3VTUA 2BKRB 2LVQA 4FULA 4CHKA 4ICUA 3MHSD 3DBRI 2L0TA 2O6VB 1V80A 2M0XA 4MGZE 3UQAA 2C7MB 1V5TA 3EECA 3DQVA 1YD8U 3VVWB 2KDFB 1GC7A 1WXMA 2KQSA 4JGHB 3L17A 2MBHA 2CS4A 3PHWB 4A3OA 3PT2B 4DHJB 4PS3A 2GBKA 2LXAA 4TQ0A 2MLBA 4GXBA 5CHWA 3A9KB 2KDIA 2RSUA 3DPDA 1WGYA 2IYDB 4DWFA 2DAFA 2KC2A 2R2OA 3SU8X 5DPWA 2C9WB 4W9CA 1L7YA 3GZNI 1OQYA 3IFWB 3TJPA 2K6QA 4IC7B 4WQOB 2K25A 3EC8A 5FR6A 3KW5B 4W9LA 5CX3A 3U7DA 3WAMA 4GOCA 1J8CA 3APCA 2CKHB 1E90A 4B6WA 4TQ1A 1E7VA 3ALBA 3JSVA 1S3SG 1VCBA 4GGQA 3EHVA 3W1YA 3ZNHB 3PRPB 1SIFA 4MSMB 2WWZA 2PPHA 2JUOA 5J2RA 2LGXA 1WM2A 4MGKE 2D2QA 2CU1A 4F7ZA 3ZW3A 3ZRFA 3U8ZA 3WA0A 3T9LA 3NHEB 2GMIC 3VTVA 2J7QB 3O65B 1WR6E 3VDZA 2JRIB 4FJVB 2K8CA 3C0RB 4GMVA 4W9FA 3VUYA 2WX0A 1V49A 1TGZB 2O6VA 4HXDA 4X57B 2RPQA 3JSVB 4GDKA 2FCNA 2LASA 3ENEA 2KN5A 2UWQA 2JVCA 2N9XA 4KSLC 3ZTCA 3VQIA 4E74A 5L83A 2BKFA 3KUCB 4K1RB 2LGDA 2KQ7A 1Z5SB 2KDBA 2M17A 2LGYA 3QA8A 1WGRA 2LRWA 1M94A 5EDSA 2D10A 1Q0WB 2O2VB 5AZFA 2A4ZA 3MJWA 2G3QB 2CR5A 2YLMA 2IBIB 2FIDA 2HTHA 3PVLA 3AXCA 4IM0A 3T8MA 3M62B 2LUEA 1YJ1A 3B1LX 2LXCA 4B9KA 2AL3A 2N7EA 3KUZA 3VAWA 2FUHB 3DVNU 3OAWA 3H7PB 3H6NA 4EZLA 1WXSA 2REXA 2RD0A 1UZXB 3V60A 3V6CB 3L16A 1QZEA 4II2B 1YQBA 4MGIE 3H1UA 3ZUNA 1NBFC 2DYBA 3ML9A 3X0WA 1V86A 3TMPB 4GB9A 1V81A 1EUVB 1YX6B 4WJOA 4WJNA 1K8RB 4AP4C 2KZRA 3PRMB 2LJ5A 2C5LC 2KOXA 2WYQA 4MEMA 3ZLZA 3CSFA 3KYDD 4XZ4A 1WGDA 2C7NB 2N9PC 1WGHA 4J6IA 3ZDMC 2MBBB 2Z0DB 2L7RA 2ZPYA 2LD9A 3A4SC 3A1QA 4IWOA 3NZUA 3A9KA 5D6JB 3TIXA 4URKA 1E8ZA 3DBHI 3QARA 4W9DA 1HE8A 2NBVB 2V4LA 3AI5A 4W9JA 2M4NA 4NAWB 1UGMA 4II3B 1I35A 1EF5A 2L00B 3ZO5B 2O2VA 2N9EB 2JPHA 4IW0A 4PYUA 4GU2A 4FLHA 1WE6A 4G11A 2KLGA 4EEWA 3PREA 2GBNA 1LFDA 4PS7A 5LXHA 4IG7B 1E5WA 2MQJA 2NVUI 3RD2A 2LVPA 3UGBB 4BFRA 1WMHB 1WM3A 2EKEC 2RGFA 1WZ3A 3VHTC 3HIZA 1NDDA 3PLUA 4P7IA 4KV2A 4OVVA 3UF8A 3W1SC 2WDTB 2L0FA 2FCSA 4TV3A 2G45B 3W1SA 4WWNA 3KVFB 3HK0A 4HDOA 5DPTA 3SDLC 1LQBA 1WXAA 4HK2A 4ANUA 1WX8A 3I3TB 2KFJA 5AZHA 1WIAA 4HDQA 4HWIB 4DDGD 4ZDVA 4M8NA 5IAAC 2JF5A 3SHQA 3N3KB 2MA9B 3PZDA 2DENB 3M63B 2AL6A 3N30A 3NY5A 4ZYNA 4AJWA 2J0MA 2D3GA 4BOZB 4NQKE 5LLIA 4AUQC 2K8BA 3QWZB 3RZWC 4KSKC 2KC1A 3DBSA 1RRBA 4W9HA 2I1KA 3P2BA 4DHJD 3PHXB 2NS5A 4NY0A 1MG8A 1WYWB 3B08A 3X23A 1WZ0A 4G3XB 1RLFA 4BKGA 3ONSA 1H4RA 4K81A 3A9JB 3TBLD 3WAOA 5C1ZA 2I1JA 1NI2A 4HCPB 1C1YB 5AZGA 2DAJA 4A20A 2KFKA 4LJPB 3HHMA 1VD2A 2KXJA 4IWPA 2DX5B 4W9IA 1KOTA 2KTRB 1XT9B 2DZMA 3L13A 4IWQA 4JIOU 2AYOB 3RULA 3RZFA 3V6EB 3ECIA 5C23A 4FA6A 3ZTDA 3ZNGC 4BVUC 2ZVOA 2HD5B 4DXAB 2KX3A 2XK5B 1E7UA 2W9NA 2VRRB 4W9KA 3APFA 5KHQA 4GDLB 4K7WA 4B95A 5GMVA 4EZJA 2V1YA 4MH0E 1WX7A 5G55A 2IO2B 4ANWA 1WE7A 2HJ8A 4KIKB 4HCNB 4HLEA 2L3ZA 2J0JA 1OEYA 4BKSA 5IA7A 5CHFA 1WH3A 2GOWA 4GN1A 4DK5A 1GJZA 2GBJA 2BPSA 3L10B 3CSTA 2BYEA 4KDIC 4TKNA 4BOSC 1UH6A 3LJ3A 1KJTA 4LJOB 2N1VA 3VUXA 2C7HA 1WGGA 2AEHA 2NCNA 4NPNA 3M95A 2CHXA 3HM6X 3MTNB 2FIFA 3DCGA 2GBMA 4I6LB 4YL8A 2JZ3B 2FAZA 3IG3A 1WJ4A 1WMHA 3WANA 4JLCA 3A33B 2V3SA
chains in the Genus database with same CATH superfamily
5BO4B 4FJZA 3URYA 3BVGA 4G0NB 2L8JA 1FPYA 2MWSB 4HROA 5JHAA 2INPE 2M56B 3KH0A 1VJKA 1P3QU 1E8WA 4DBGA 3FILA 2WQYB 4HKQA 4AWJA 4GLSC 1CJEA 4WWOA 3H7SA 3KYCD 3L08A 2IO1B 3TEYA 2M0AA 4RMAA 3NZ3A 4A3PA 4KVGB 4FHKA 3K9OB 2ASQA 3FKYA 3AULA 2UU7A 3VH3B 2R2QA 2EMTA 4NQLB 3IHPC 4OZBA 1BXTA 2MEKA 2MJEA 2Y5BB 4RGMA 1J7BA 1IBXB 1JWAD 2J4XA 3KWVA 1J0GA 4DHZB 1KLUD 3BYTB 4FADA 3DVNV 1J19A 3V62A 2RPVA 1WF9A 2W82A 1N62A 5GXGB 1ET6A 4RF1A 3UI3A 2JZPA 1QOAA 5C3JB 1XO3A 2LZ6A 4XC2A 1V1PA 3V3XA 2K9XA 2FNJB 1GC6A 2ZEQA 1R4MI 1HXYD 3PZ8A 3AU4A 2DZIA 2SEBD 5BYRA 4GDKB 4FXCA 3ML8A 4XE0A 4M01A 4MJSA 2PE9A 3B2FA 3PTFC 1L6UA 1P7EA 2WXQA 4HPLB 1UBIA 1K53A 4MELA 3BZDB 2JWZA 3NJTA 2WXKA 2NBUA 3Q3OC 2KJRA 1HZ5A 3OWEB 4KZCA 2QC8A 4MJSB 1UBQA 4YT0B 3RUIB 3TUOA 3DVGX 2G1EA 4BZAA 2XNAC 1SE9A 3CF6E 3VXWA 3H9DA 1YX5B 1Z2MA 2ZCBA 2QEJC 4IM2A 3GS2A 3V05A 4HPPA 1I42A 2KN4A 4LNFA 4C7ZA 2PIAA 3PSEB 2J53A 4WWPA 3OJ4B 4KX6B 2V3NA 4ARIA 1SJED 4W9GA 1OQRA 4MGYE 1TZ1A 1IPGA 1HEZE 3MHZA 4EUTA 2KK8A 1N63A 3UINB 1ACCA 2MW5A 1UD7A 4REZA 4MSQB 1A70A 1G6JA 3P4QB 1FXIA 4HPMB 1KLVA 1T0QC 3H8HA 1MHHE 3BVMA 3Q14C 2KVRA 2D5GA 1HTQA 2AQ2B 4WQMA 1YIWA 1JW9D 2N1WA 3RPFC 1IBXA 2JY6A 3GE8C 1WFYA 1TKYA 1L0XB 5KHOA 1MHXA 2ON8A 1I4QA 4K3BA 3OJ3A 4KDLB 1E8XA 5E6PA 3EFCA 4GIVA 1P1AA 1OTRB 1YNTE 1NEKB 5BYQA 1T5XD 3DBRI 2M0XA 4MGZE 3EECA 1V5TA 3N9YC 4S0RA 1WXMA 1JWMD 1VDVA 2KQSA 4JGHB 2CS4A 1YJIA 4DHJB 4PS3A 2LXAA 2JYEA 1QLBB 1SBBB 3A9KB 1WGYA 2IYDB 4RCOA 4DWFA 2R2OA 3TJPA 3RNAC 4WQOB 2D3CA 5FR6A 4W9LA 3U7DA 3WAMA 3APCA 1N60A 1E7VA 1S3SG 3IAS1 4GGQA 3W1YA 3ZNHB 3KWLA 1TYGB 4MGKE 4D2KA 3MC8A 2GMIC 3GE3C 3O65B 3VDZA 2JRIB 1QILA 3MFGA 4HXDA 2RPQA 2FCNA 2KACA 5HG2A 2UWQA 5L83A 3KUCB 2KQ7A 1MG4A 5EDSA 3B9JA 2O2VB 2G3QB 4MT5A 3T8MA 2LUEA 1T0SC 1D6EC 1F2RC 3DVNU 2VZKB 4AS1A 3OAWA 3DBHB 3H7PB 1WXSA 2WXLA 3V60A 4II2B 3ZUNA 3H1UA 4ZHOA 3AEFB 3EGRA 1K8RB 1EU3A 1SSNA 4BAXA 1ZOYB 3PRMB 2LJ5A 3AN1A 3KYDD 2W54A 2C7NB 1WGHA 1STEA 2MBBB 2BS3B 2HTME 3A4SC 4IOIE 4RGTA 2NBVB 3EUB2 4II3B 1I35A 3EA6A 2BB6A 2LHEA 1E5WA 2NVUI 3UGBB 1WMHB 1WM3A 3HIZA 4P7IA 1VZ8A 2L0FA 3U4EG 1KTKA 3KVFB 4HDOA 3AEEB 4HRSA 3VR8B 1WX8A 4NAMA 5BMIA 4HWIB 4ZDVA 3SHQA 3GB1A 2V3PA 3NY5A 2IDYA 4AJWA 2D3GA 1UUPA 4NQKE 4BOZB 4YSXB 3SFDB 2Z8LA 3RNFC 4LLGM 1RRBA 4DHJD 4EE2A 3BK1A 3X23A 1WZ0A 1FNVA 5LNK1 3R2IA 1H4RA 1RM6C 3A9JB 1HQRD 5AZGA 2DAJA 4A20A 1SE3A 1PGBA 1MJDA 3KQ4A 1MI0A 3RULA 1FEHA 4FA6A 3ZTDA 3ZNGC 4AQ7A 2KX3A 1L4DB 2VRRB 1TJEA 4K7WA 1SIJA 1JWBD 2V1YA 2BT6A 4LTUA 4KIKB 2HJ8A 4HLEA 2MJDA 3AH7A 3AECB 4RGOS 2WGSA 4LNKA 5CHFA 1WH3A 2GOWA 1I4RA 4A6QA 2GBJA 2D3AA 4KDIC 1UH6A 4US9A 1PDXA 1WGGA 1QOGA 3M95A 2CHXA 3MTNB 3DCGA 1UNSA 4I6LB 4YL8A 2BS4B 2GI9A 4R3DA 3SEBA 4TSSA 3WANA 3A33B 1BMLC 1SE4A 4ACFA 1S1QB 4ZOHC 3RNBC 4E71A 3CMMB 1V8CA 3B0AA 1TS2A 1PQSA 2NPTA 3N1YC 4ZRJA 1JRUA 5D2MB 1JRPA 1K51A 2K6DB 2LI5A 1E8YA 2INCC 2Z0EB 2HJ1A 4L2YA 1KLGD 2QHOA 2VH2A 4MACA 3BVZA 2KAJA 2R61A 2NPTB 3AM9A 2ONQA 1A5RA 4K7SA 4BKSD 3OLMD 2ZCCA 1FO4A 3Q3JA 2JZZA 1F9JA 3I57A 3MC0B 2XEWA 3P4SB 3PPAA 1MPEA 4RNAA 2EMSA 3UIPB 1T3QA 5AEKB 5LXIB 1Q5WB 1P9DU 1QQRA 1SXTA 1TZOA 4KZ0A 2QMTA 2MBEA 4XGAB 4DXFA 5G5GA 2KWVB 4WAAA 5DPSA 1WJNA 4XWTA 1R7SA 4F8CB 3BINA 2PKOA 4PT5A 4JQWC 1XCQL 3GOEA 3PS6A 1EU4A 4NNJB 1QT9A 2PVGC 2KWCA 4NAWA 1WJUA 2A5UA 3BK2A 2ZZPB 2ICIA 1ENFA 2IO3B 2IO0B 4WWMA 2N4FA 3TCAA 3GZNB 3VR9B 4E3CA 3N32A 1E7PB 3K9PB 1XLQA 3R66C 4C4VA 1V1OA 4HVBA 4RGNA 1XCTL 2N7DA 4K7UA 2L52A 4JL9A 3ZKJC 1TS5A 1P0RA 2KJHB 3QQ8B 3ZJTA 4XYCA 1C4PA 2ZNVC 5JZEB 3ZIMA 1SF0A 5DPRA 4YWGG 1ZXHA 2C60A 3V61A 3P4PB 3MJ5A 3R7QA 3T3OA 4ASWC 1WJ6A 2LWPA 2KYWA 1X1MA 4XDCA 4BKTA 3QK0A 2RDBC 1EO6A 1V9JA 4NJ6A 3Q8BA 4WJQA 2KLCA 4B0EA 3QJZA 1C9FA 2LHDA 1ZGUB 1AWDA 1FMAD 2D11A 1WR1A 2MP2B 4RM9A 3NVVA 3PLVA 2Y3AA 2NR2A 4EKUA 2JRHA 1DGJA 3SD5A 1M4VA 1V1PB 4KKJA 3IVFA 4EFOA 4EZKA 2RMMA 2N7JA 4OVZA 3R8BA 1WX9A 2G4SA 2UYZB 1WI0A 5CHVC 1D5MC 4IUMB 4JWSC 3ZJUA 2MBOA 4OHJA 3L4PA 2IY1B 2KD0A 3IBEA 3S2AA 3NVWA 3RT3B 3A9JA 2LJIA 5J18A 4KGTA 2Z59B 5D7GA 3BY4B 1IP9A 3ZNZB 1FXTB 5D3IB 4KIKA 1KF6B 2W55A 2NMQA 1JMLA 2K39A 1XF5L 1SEBD 4ICUA 2O6VB 1C4AA 1V80A 1P7FA 1YD8U 1GC7A 3PHWB 3PT2B 1XXGA 2QILA 2MLBA 4GXBA 2KDIA 2RSUA 1DOXA 2DAFA 1L7YA 2K6QA 5EE0A 4KGRA 2QJLA 4NJCA 2K22A 4LNIA 5CX3A 4YTPB 1J8CA 4M00A 1KRHA 4TQ1A 1VCBA 1SIFA 4MSMB 1VZ7A 2JUOA 2L1AA 3TEXA 5J2RA 3Q6BA 2D2QA 2CU1A 4F7ZA 1K50A 3ZRFA 4Q2JA 3U8ZA 1LO5D 5IOIA 3VTVA 3DWGC 2L83A 3VUYA 2K8CA 3C0RB 1XEEA 1V49A 1IGDA 4ZRQA 3ZTCA 2KN5A 4KSLC 2JVCA 5IP4D 2LGDA 1Z5SB 2KDBA 1Y56A 2WXGA 5AZFA 1FNWA 2A4ZA 2CR5A 2WXOA 2FIDA 1UGJA 2HTHA 3AXCA 1KFYB 3M62B 1JCKB 3HVDA 3MC9A 2LXCA 4B9KA 2N7EA 3KUZA 1HZ6A 1C77A 4LK0M 3TSSA 3V6CB 1NBFC 3HUIA 3TEWA 3ML9A 1V81A 1YX6B 4WJOA 4WJNA 2FBWB 2C5LC 3E56A 4MEMA 4MH8A 3ZLZA 4XZ4A 3U52E 5IO9A 3NZUA 3A9KA 5D6JB 3TIXA 1E8ZA 2E3TA 1HE8A 4W9JA 3P42A 4NAWB 1UGMA 2WLBA 2L00B 1ZXIA 4IW0A 2JPHA 4EEWA 4FLHA 2KLGA 1I4PA 2GBNA 5LXHA 1QOFA 3W5UB 2LVPA 4BFRA 1NDDA 3PLUA 4KV2A 4OVVA 2FCSA 3AB5A 4WWNA 2OJWA 4ZHPA 2IGDA 3AE9B 3N1XC 1FNUA 4ANUA 2KFJA 2CU3A 2KQ4X 5AZHA 1ROEA 1WIAA 4DDGD 4M8NA 5IAAC 2DLBA 2BQQA 3N3KB 2MA9B 4S17A 2BBCA 2DENB 3M63B 2AL6A 3ZYYX 3Q3NC 4IDIA 4AUQC 2K8BA 3RZWC 4KSKC 1ZUD2 2KC1A 3DBSA 1FRRA 5C2TB 2I1KA 3P2BA 2NS5A 5BMHA 5H92C 4BKGA 4K81A 3TBLD 2I1JA 1NI2A 1C1YB 2FUG1 2KFKA 4IWPA 4W9IA 2WP9B 2DZMA 3L13A 4IWQA 3ECIA 5C23A 5D3DA 4BVUC 2HD5B 4DXAB 2N9KA 5KHQA 1DOIA 1C76A 4MH0E 4HCNB 2L3ZA 1TT5B 1SJHD 4YXDB 3ZQ4A 4DK5A 1GJZA 3L10B 3SFEB 2BYEA 1KJTA 4LJOB 2C7HA 2AEHA 4NPNA 3HM6X 5JXVA 2FIFA 2GBMA 1R4NB 4A90A 2JZ3B 4QAYA 3ZGZA 1WMHA 1QF6A 1YQ4B 4JLCA 1YOVB 5HFYA 1LM8B 2DHZA 4YTMB 3ZVVA 3KLSX 1J7CA 5I4DA 2V0GA 4L1BA 2MCNB 3QHTA 2J0KA 1L0VB 2LFIA 4AJYB 4ZRPA 1C79A 1OEYJ 3P1MA 2QSDA 2MX2A 1BT0A 1KH0A 3NVYA 4USAA 1WXVA 3QC8B 4N9F4 3D32A 1XD3B 1ZPSA 3L54A 1Y8RC 2ZVNA 2JX5A 4PYZA 2D3BA 4M8MA 4JE3B 2V4IB 1B1ZA 1GG3A 2XBBC 4ANXA 1AYFA 2CHWA 2NTSA 1IGCA 2OOBB 3WALA 2AWTA 4A9AA 4UDUC 3CIRB 2KMAA 4IKGA 2JQRB 3AEGB 2MBQA 4KGSA 3NVZA 3L0WB 2FCQA 4HJGE 1GUAB 3UQBA 2YEPF 2KTFA 3NZSA 2PJHA 2K8HA 1T0RC 4WH4A 2DZKA 2KDEB 2G9HD 2SAKA 4WIPA 3IT4B 1P98A 1ZE3D 1WRDB 4YSYB 2OJRA 4F1SA 2QDFA 1RYJA 3O13A 2PTLA 5FKAC 3A4RA 2IY0B 3LYYA 2QCZA 2OEDA 5DCNA 2BF8B 4C00A 3LDZE 3RYTA 2KWUB 4M02A 3DWMA 2QIEB 2YEPB 4RF0A 1GB1A 3Q3FA 4M0WB 3R7RA 4N59A 2KFKB 1Q1OA 5L95C 3ZXVA 1L5PA 2CJOA 1GNUA 5JH5C 1XLNA 2ZJDA 5J17A 2EKIA 2INNE 2JSVX 2JXXA 4RH6A 1BUIC 1PFDA 3QAQA 2KKCA 2WXFA 2B76B 2K1FA 2JWUA 1I4GA 1JALA 3NG0A 1T0YA 1WSPA 1R4MB 2LUMA 3OG5A 2H89B 2BGFA 4BBNF 3ZXRA 4EOYA 1KM7A 2MSED 4JWUC 2IGHA 4ANVA 4CO7A 2KTRA 2FE8A 1VZ6A 1MVKA 3AU5A 4DDID 2WX1A 4MM3B 1ZDVA 2LRUA 1QKZA 2ZPNA 2WXHA 5D94A 5E6NA 4FJYA 2K3UA 4LNNA 1SGHA 2M19A 1L4ZB 3LB8C 1ZW7A 1FM0D 1UF0A 2VZKD 4WJPA 5HKHA 1DYQA 4LNOA 4HJKA 4FHJA 3ZJVA 4DHZE 3TL5A 4DQOC 3M3JA 2KDMA 1YJJA 1ISNA 1L2NA 3E9SA 2PVOD 1TS3A 2BYVE 1NYRA 2KX0A 2J52A 2DZJA 1NENB 2B3AA 2JT4B 4O1NA 5EE3A 2L76A 5JHBA 3VRBB 3JVZX 2BWES 3JW0X 3QX1A 1H8CA 3VRAB 2PW9A 3AV8A 4L23A 2NBWB 1EF1A 5TR5A 1WXQA 3VTUA 2GLSA 2K0PA 2BKRB 4FULA 4CHKA 4OZAA 3MHSD 2L0TA 1GPXA 3UQAA 1F77A 2WDVB 3VVWB 2KDFB 3RN9C 5CHWA 3FILB 2KC2A 3SU8X 2C9WB 3GZNI 1OQYA 3IFWB 5BYSA 4IC7B 4P1CC 3NRZA 2K25A 1TKGA 3WCQA 2GRIA 2JU6X 1L6VA 5FK9C 2CKHB 1E90A 4B6WA 3ALBA 2HDEA 3EHVA 3AE1B 2PLPA 1D5ZC 2RDGA 2LGXA 1WM2A 2WDQB 3ZW3A 4J3OD 3NHEB 3GP7A 1WR6E 4W9FA 2BVCA 4X57B 2LASA 4US8A 1NI3A 2N9XA 1N6ZA 3VQIA 3T3NA 3Q8AA 4WURA 4K1RB 2M17A 3QA8A 2LRWA 3R2TA 1Q0WB 3MJWA 2YLMA 3PVLA 3B1LX 2AL3A 1FFUA 1WWTA 4JPSA 4EZLA 2NTTA 2RD0A 2WXMA 2DYBA 1NVID 1V86A 3J9CA 1F0ZA 2KZRA 1T6BX 3AE4B 2KOXA 2N9PC 4J6IA 4C4VB 2L7RA 3A1QA 3DBHI 2MJ3A 3QARA 4W9DA 1E9MA 3RNGC 4C80A 1FRDA 2WU5B 1EF5A 2O2VA 4DXGA 4GU2A 2X38A 1WE6A 3PREA 1LFDA 3RD2A 2RGFA 1WZ3A 3UF8A 2WDTB 4TV3A 2LEKA 4NZLB 3W1SA 4RFBA 4M0WA 2J42A 3Q8FA 4ARCA 3CWIA 3U7ZA 3AE2B 3FC4A 1HTOA 4ZYNA 1JQ4A 3Q2AC 3BWUD 3PHXB 4NY0A 1MG8A 3B08A 3I9V1 2I38A 3AE3B 3ONSA 2XN9C 1JWSD 5C1ZA 1TIFA 1RFKA 3HHMA 3U2SC 2DX5B 1KOTA 2KTRB 3SR6A 1HA5A 4JIOU 2AYOB 2ZVOA 2XK5B 1E7UA 3PO0A 4W9KA 3APFA 1F52A 4B95A 4EZJA 5G55A 2TSSA 4ANWA 4A8XC 1V97A 3W2DA 1OEYA 3BYYB 1GOZA 5HHDG 1GAQB 4GN1A 3HVZA 2IGGA 2K5PA 3CSTA 3LJ3A 3VUXA 4OW0A 4K3CA 2FAZA 1WJ4A 4P6VF 4GB9A 2V3SA 3QCAA 4W9EA 5G2NA 4GSWA 1ZKHA 2FCMA 3LXFA 1VLBA 3JYUA 2DYOA 3DVGY 4LDTD 1ZP0B 1C3TA 4C7YA 1PGXA 1YN4A 1RFAA 5TSSA 4RM8A 2KHWB 2W3RA 3APDA 1E10A 5E6OA 2D07B 1LGRA 1TBEA 1I4HA 3RCZA 2DYMA 4BBNC 1V6EA 4I6PA 4IM3A 3NUHB 1JROA 4NJ7A 1RWSA 2WXIA 2BS2B 2MRPA 3NS1A 1UELA 2AQ1B 3BIID 2KMCA 1N5WA 3KUDB 1XLPA 2LMCA 1LXDA 3NS8A 3VFKA 4CQNA 1ET9A 3B2GA 3PV1A 4ITKA 4JX1C 2M8SA 2GBRA 2WXRA 2I2YA 2E6XA 2RR9A 1WYGA 2GB1A 4PS8A 3IAM1 4FN2A 2N0SB 3Q8CA 3AE6B 3MP9A 2KWDA 1VR9A 3PZ7A 2YVCA 2O6VD 2LGSA 1L0YB 2PE6B 2WXPA 2BYFA 2DWQA 2X8XX 3N1ZC 1AARA 3AEBB 2BTEA 1ZDXA 2INDC 2PEAA 2OHFA 1D3ZA 2MHJA 2WU2B 4MDKE 3R3MA 2BYTA 1I4XA 1U4AA 1UWMA 3QIJA 2IPKD 1CMXB 2LGIA 2M1MA 3I63C 2BW2A 1PGAA 2XK5A 3NOBA 2JYTA 3VH4B 4CYEA 1UWXA 5CTRC 2MP2A 3HM3A 2KO3A 1IYFA 2G4DB 2KANA 3DOWA 3AMZA 3VUWA 1XQQA 4ZRIA 4ZRKA 2KVZA 3W5VB 1V2YA 3RI7C 4MM3A 4AOFA 4FBJB 1R4NI 3AE8B 3PRZA 4LDTB 4OVUA 2KNBA 1SB3C 4A55A 2KJ6A 3Q8EA 3UIOB 2ZNVB 2ZW1A 1RAXA 1VRAB 3A1QB 2CHZA 3EFUA 4KKIA 3P4RB 1YMHE 4GDLA 4XWWA 3AE5B 3VTWA 3ETRA 2CJNA 3DBLB 2LVOA 5AUKA 1E6EB 4XX5A 2IZVB 3ZRCA 2JXTA 1TKEA 1WGKA 3DDCB 4I6NB 3P63A 2Y5CA 4XDDA 1CQVA 1YN5A 1WRIA 4LCDE 3U30A 5T8IA 3ZDTA 1AW7A 4G50A 1V5OA 2Y5PA 3WAPA 4YTNB 2AX5A 4ICVA 3AEAB 2L05A 3Q3MC 2AQ3B 3DBLI 1JWUD 2IJ0A 4PK1A 1OGWA 2WS3B 3WIMA 4TUUA 2HE7A 1D5XC 3C8YA 3PGEA 1D4BA 4C56C 3H7PA 3TEZA 3ZNID 1TTNA 1OQQA 1N61A 1WY8A 2BWFA 2KMMA 2LVQA 1FXAA 1B9RA 3DBRB 1Q10A 2WDRB 2C7MB 3DQVA 3FAHA 4N6EB 3L17A 2MBHA 1SE2A 4A3OA 2GBKA 3N20C 4HKZE 4TQ0A 3DPDA 5DPWA 4W9CA 3C19A 1FCCC 2KT7A 3EC8A 2Q5WD 3KW5B 1OFFA 1XLOA 4GOCA 2DNFA 5E6JA 3JSVA 2VH1A 3PRPB 1CZPA 3RFZB 2WWZA 2PPHA 5IKCM 1FCLA 4TMAB 2WHIA 2DBYA 4B0MA 2ACZB 3WA0A 3T9LA 3AE7B 2J7QB 4FJVB 4GMVA 5BMGA 2WX0A 1FIQA 1TGZB 2O6VA 3JSVB 4P1BC 4GDKA 1J7AA 3ENEA 5IN7A 4E74A 1DOYA 2BKFA 3RNEC 2LGYA 1WGRA 1M94A 2D10A 5G5HA 2N9LA 4IM0A 2IBIB 1YJ1A 5FR3A 2EELA 3VAWA 1MFWA 2FUHB 2ZW0A 3H6NA 3I5JC 2REXA 1UZXB 2W3SA 3DHIC 3L16A 1QZEA 4MGIE 1YQBA 3DHHC 3X0WA 3TMPB 4WAFA 1EUVB 3ABVB 1F2RI 4AP4C 1YN3A 2WYQA 4N58A 3CSFA 4YSZB 1WGDA 1GB4A 3ZDMC 2Z0DB 2ZPYA 2LD9A 4IWOA 1C4CA 4URKA 3RNCC 1IUEA 2V4LA 3AI5A 4P16A 2M4NA 2V9HA 3ZO5B 1FFVA 2N9EB 4PYUA 4G11A 1YQ3B 4PS7A 3IXSA 4IG7B 2MQJA 2EKEC 3HRDD 1CK1A 5H8YE 3VHTC 1C78A 1ESFA 3Q69A 2H88B 3W1SC 2G45B 3IT6B 3HK0A 1I7HA 1PUTA 5DPTA 3SDLC 3W9CB 1LQBA 4ZYSA 1WXAA 4HK2A 3I3TB 4HDQA 2JF5A 2PMVA 3PZDA 3N30A 5MPOA 1TY2A 2J0MA 1TS4A 5LLIA 1EWYC 3QWZB 1NYQA 1AN8A 1EM7A 3DHGC 4W9HA 2RDHA 1WYWB 4G3XB 1RLFA 3WAOA 2WNMA 4HCPB 4OZCA 1F1HA 4LJPB 1QOBA 1VD2A 2KXJA 4H2AA 1XT9B 3RZFA 1FD6A 3V6EB 3RMKC 2MH7A 2W9NA 2L32A 4GDLB 5GMVA 1TY0A 1WX7A 2IO2B 1E0ZA 1PYWD 1WE7A 2WXNA 2WXJA 2J0JA 3AEDB 4BKSA 5HI1A 5IA7A 2BPSA 4TKNA 4BOSC 1N5XA 2N1VA 2NCNA 5EE9A 1K52A 4HEA1 2BB5A 3IG3A 5EE1A 5AUIA 1EWCA
chains in the Genus database with same CATH topology
1LM8B 3QCAA 5BO4B 4W9EA 5G2NA 4GSWA 2DHZA 4FJZA 1ZKHA 1S1QB 3ZVVA 2FCMA 2MCNB 3JYUA 4G0NB 4E71A 2DYOA 3CMMB 3QHTA 3B0AA 2J0KA 2L8JA 2MWSB 5JHAA 4AJYB 3DVGY 1PQSA 4LDTD 1OEYJ 2NPTA 3KH0A 1C3TA 4ZRJA 1RFAA 1JRUA 2MX2A 2KHWB 1BT0A 1P3QU 4RM8A 3APDA 1E8WA 4DBGA 5D2MB 4AWJA 2K6DB 2LI5A 5E6OA 1E8YA 3H7SA 4WWOA 2D07B 1WXVA 3KYCD 3L08A 3QC8B 2IO1B 4N9F4 1TBEA 2Z0EB 3RCZA 3D32A 1XD3B 2DYMA 3L54A 4BBNC 1V6EA 4RMAA 2QHOA 1Y8RC 4A3PA 4I6PA 4IM3A 4KVGB 4FHKA 4NJ7A 2ZVNA 3K9OB 4PYZA 2NPTB 2ASQA 4M8MA 2MRPA 1A5RA 1GG3A 2XBBC 4K7SA 4BKSD 3AULA 1UELA 4ANXA 3OLMD 3VH3B 2R2QA 2EMTA 4NQLB 2ZCCA 2CHWA 3IHPC 2KMCA 3Q3JA 2OOBB 2JZZA 1F9JA 3KUDB 3WALA 2AWTA 1LXDA 2XEWA 3NS8A 3VFKA 2Y5BB 3PV1A 2KMAA 2M8SA 3PPAA 2GBRA 2EMSA 3UIPB 5AEKB 2MBQA 1J0GA 2RR9A 3L0WB 2FCQA 4DHZB 5LXIB 1Q5WB 4PS8A 4FN2A 1GUAB 1P9DU 3UQBA 4KZ0A 4FADA 2MBEA 2KTFA 3DVNV 3NZSA 2PJHA 2K8HA 2KWVB 1J19A 2DZKA 2YVCA 4WAAA 2O6VD 2KDEB 1P98A 5DPSA 1WJNA 3V62A 1WF9A 1WRDB 2OJRA 4F1SA 2PE6B 2BYFA 3A4RA 4F8CB 3BINA 1AARA 4JQWC 2IY0B 3GOEA 3PS6A 4NNJB 5DCNA 2BF8B 2PEAA 2LZ6A 2KWCA 3LDZE 4NAWA 3RYTA 1D3ZA 4XC2A 2KWUB 1WJUA 2FNJB 1GC6A 2A5UA 2ZEQA 2ZZPB 4MDKE 1R4MI 3R3MA 2IO3B 2IO0B 3Q3FA 1U4AA 3AU4A 4M0WB 3R7RA 2DZIA 2N4FA 4GDKB 2KFKB 1Q1OA 5L95C 3ML8A 3QIJA 3TCAA 4E3CA 1CMXB 3N32A 1GNUA 4MJSA 2PE9A 5JH5C 3K9PB 2M1MA 3PTFC 5J17A 2ZJDA 3R66C 4HVBA 2JXXA 4HPLB 1UBIA 4MELA 2N7DA 2XK5A 3NOBA 3QAQA 3VH4B 4CYEA 5CTRC 2KKCA 2JWZA 4K7UA 2K1FA 2MP2A 3HM3A 2KO3A 4JL9A 1IYFA 3ZKJC 2NBUA 2G4DB 2KANA 3DOWA 1P0RA 3VUWA 1XQQA 2KJHB 2KJRA 4ZRIA 3QQ8B 4ZRKA 4KZCA 4MJSB 1T0YA 1UBQA 3RUIB 2ZNVC 5JZEB 3ZIMA 3DVGX 1V2YA 1SE9A 5DPRA 3CF6E 3VXWA 4MM3A 4AOFA 4FBJB 1R4NI 2C60A 3H9DA 3PRZA 3V61A 1YX5B 4LDTB 4OVUA 1Z2MA 3R7QA 2KNBA 2BGFA 2KJ6A 2ZCBA 4ASWC 4BBNF 4IM2A 1WJ6A 4EOYA 1KM7A 1I42A 2MSED 2LWPA 3UIOB 2ZNVB 4ANVA 4CO7A 2KTRA 1RAXA 3A1QB 3PSEB 1X1MA 4BKTA 4DDID 3AU5A 2CHZA 3QK0A 2WX1A 3EFUA 4WWPA 3OJ4B 1EO6A 2LRUA 1V9JA 4NJ6A 4GDLA 4WJQA 4W9GA 2KLCA 3VTWA 3QJZA 4MGYE 2ZPNA 1TZ1A 2LVOA 1IPGA 5D94A 1ZGUB 5E6NA 4FJYA 4XX5A 2D11A 2MP2B 1WR1A 2IZVB 3ZRCA 1SGHA 4RM9A 1ZW7A 3PLVA 2NR2A 4EKUA 4EUTA 2JRHA 3DDCB 4I6NB 2KK8A 4WJPA 3SD5A 3UINB 5HKHA 4HJKA 4FHJA 2MW5A 1UD7A 3IVFA 4MSQB 4LCDE 4EFOA 3U30A 4EZKA 4DHZE 3TL5A 3ZDTA 1G6JA 4G50A 1WX9A 2G4SA 2UYZB 1WI0A 5CHVC 3M3JA 4HPMB 1V5OA 1KLVA 4IUMB 3WAPA 1ISNA 4ICVA 1L2NA 2L05A 2BYVE 2KX0A 2MBOA 2KVRA 3DBLI 2DZJA 2IY1B 2KD0A 3IBEA 2B3AA 1YIWA 2JT4B 3S2AA 3RT3B 2L76A 5JHBA 2N1WA 3A9JA 2JY6A 1WFYA 1OGWA 5J18A 3WIMA 4TUUA 2HE7A 5KHOA 3JVZX 2BWES 3JW0X 3QX1A 1H8CA 3PGEA 2Z59B 5D7GA 3BY4B 1IP9A 3ZNZB 1FXTB 3H7PA 3OJ3A 4KDLB 3ZNID 1TTNA 4KIKA 1E8XA 5E6PA 2NBWB 1EF1A 4GIVA 5TR5A 1P1AA 1WY8A 1OTRB 2BWFA 2K39A 3VTUA 2BKRB 2LVQA 4FULA 4CHKA 4ICUA 3MHSD 3DBRI 2L0TA 2O6VB 1V80A 2M0XA 4MGZE 3UQAA 2C7MB 1V5TA 3EECA 3DQVA 1YD8U 3VVWB 2KDFB 1GC7A 1WXMA 2KQSA 4JGHB 3L17A 2MBHA 2CS4A 3PHWB 4A3OA 3PT2B 4DHJB 4PS3A 2GBKA 2LXAA 4TQ0A 2MLBA 4GXBA 5CHWA 3A9KB 2KDIA 2RSUA 3DPDA 1WGYA 2IYDB 4DWFA 2DAFA 2KC2A 2R2OA 3SU8X 5DPWA 2C9WB 4W9CA 1L7YA 3GZNI 1OQYA 3IFWB 3TJPA 2K6QA 4IC7B 4WQOB 2K25A 3EC8A 5FR6A 3KW5B 4W9LA 5CX3A 3U7DA 3WAMA 4GOCA 1J8CA 3APCA 2CKHB 1E90A 4B6WA 4TQ1A 1E7VA 3ALBA 3JSVA 1S3SG 1VCBA 4GGQA 3EHVA 3W1YA 3ZNHB 3PRPB 1SIFA 4MSMB 2WWZA 2PPHA 2JUOA 5J2RA 2LGXA 1WM2A 4MGKE 2D2QA 2CU1A 4F7ZA 3ZW3A 3ZRFA 3U8ZA 3WA0A 3T9LA 3NHEB 2GMIC 3VTVA 2J7QB 3O65B 1WR6E 3VDZA 2JRIB 4FJVB 2K8CA 3C0RB 4GMVA 4W9FA 3VUYA 2WX0A 1V49A 1TGZB 2O6VA 4HXDA 4X57B 2RPQA 3JSVB 4GDKA 2FCNA 2LASA 3ENEA 2KN5A 2UWQA 2JVCA 2N9XA 4KSLC 3ZTCA 3VQIA 4E74A 5L83A 2BKFA 3KUCB 4K1RB 2LGDA 2KQ7A 1Z5SB 2KDBA 2M17A 2LGYA 3QA8A 1WGRA 2LRWA 1M94A 5EDSA 2D10A 1Q0WB 2O2VB 5AZFA 2A4ZA 3MJWA 2G3QB 2CR5A 2YLMA 2IBIB 2FIDA 2HTHA 3PVLA 3AXCA 4IM0A 3T8MA 3M62B 2LUEA 1YJ1A 3B1LX 2LXCA 4B9KA 2AL3A 2N7EA 3KUZA 3VAWA 2FUHB 3DVNU 3OAWA 3H7PB 3H6NA 4EZLA 1WXSA 2REXA 2RD0A 1UZXB 3V60A 3V6CB 3L16A 1QZEA 4II2B 1YQBA 4MGIE 3H1UA 3ZUNA 1NBFC 2DYBA 3ML9A 3X0WA 1V86A 3TMPB 4GB9A 1V81A 1EUVB 1YX6B 4WJOA 4WJNA 1K8RB 4AP4C 2KZRA 3PRMB 2LJ5A 2C5LC 2KOXA 2WYQA 4MEMA 3ZLZA 3CSFA 3KYDD 4XZ4A 1WGDA 2C7NB 2N9PC 1WGHA 4J6IA 3ZDMC 2MBBB 2Z0DB 2L7RA 2ZPYA 2LD9A 3A4SC 3A1QA 4IWOA 3NZUA 3A9KA 5D6JB 3TIXA 4URKA 1E8ZA 3DBHI 3QARA 4W9DA 1HE8A 2NBVB 2V4LA 3AI5A 4W9JA 2M4NA 4NAWB 1UGMA 4II3B 1I35A 1EF5A 2L00B 3ZO5B 2O2VA 2N9EB 2JPHA 4IW0A 4PYUA 4GU2A 4FLHA 1WE6A 4G11A 2KLGA 4EEWA 3PREA 2GBNA 1LFDA 4PS7A 5LXHA 4IG7B 1E5WA 2MQJA 2NVUI 3RD2A 2LVPA 3UGBB 4BFRA 1WMHB 1WM3A 2EKEC 2RGFA 1WZ3A 3VHTC 3HIZA 1NDDA 3PLUA 4P7IA 4KV2A 4OVVA 3UF8A 3W1SC 2WDTB 2L0FA 2FCSA 4TV3A 2G45B 3W1SA 4WWNA 3KVFB 3HK0A 4HDOA 5DPTA 3SDLC 1LQBA 1WXAA 4HK2A 4ANUA 1WX8A 3I3TB 2KFJA 5AZHA 1WIAA 4HDQA 4HWIB 4DDGD 4ZDVA 4M8NA 5IAAC 2JF5A 3SHQA 3N3KB 2MA9B 3PZDA 2DENB 3M63B 2AL6A 3N30A 3NY5A 4ZYNA 4AJWA 2J0MA 2D3GA 4BOZB 4NQKE 5LLIA 4AUQC 2K8BA 3QWZB 3RZWC 4KSKC 2KC1A 3DBSA 1RRBA 4W9HA 2I1KA 3P2BA 4DHJD 3PHXB 2NS5A 4NY0A 1MG8A 1WYWB 3B08A 3X23A 1WZ0A 4G3XB 1RLFA 4BKGA 3ONSA 1H4RA 4K81A 3A9JB 3TBLD 3WAOA 5C1ZA 2I1JA 1NI2A 4HCPB 1C1YB 5AZGA 2DAJA 4A20A 2KFKA 4LJPB 3HHMA 1VD2A 2KXJA 4IWPA 2DX5B 4W9IA 1KOTA 2KTRB 1XT9B 2DZMA 3L13A 4IWQA 4JIOU 2AYOB 3RULA 3RZFA 3V6EB 3ECIA 5C23A 4FA6A 3ZTDA 3ZNGC 4BVUC 2ZVOA 2HD5B 4DXAB 2KX3A 2XK5B 1E7UA 2W9NA 2VRRB 4W9KA 3APFA 5KHQA 4GDLB 4K7WA 4B95A 5GMVA 4EZJA 2V1YA 4MH0E 1WX7A 5G55A 2IO2B 4ANWA 1WE7A 2HJ8A 4KIKB 4HCNB 4HLEA 2L3ZA 2J0JA 1OEYA 4BKSA 5IA7A 5CHFA 1WH3A 2GOWA 4GN1A 4DK5A 1GJZA 2GBJA 2BPSA 3L10B 3CSTA 2BYEA 4KDIC 4TKNA 4BOSC 1UH6A 3LJ3A 1KJTA 4LJOB 2N1VA 3VUXA 2C7HA 1WGGA 2AEHA 2NCNA 4NPNA 3M95A 2CHXA 3HM6X 3MTNB 2FIFA 3DCGA 2GBMA 4I6LB 4YL8A 2JZ3B 2FAZA 3IG3A 1WJ4A 1WMHA 3WANA 4JLCA 3A33B 2V3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM8 B;  3QCA A;  5BO4 B;  4W9E A;  5G2N A;  4GSW A;  2DHZ A;  4FJZ A;  1ZKH A;  1S1Q B;  3ZVV A;  2FCM A;  2MCN B;  3JYU A;  4G0N B;  4E71 A;  2DYO A;  3CMM B;  3QHT A;  3B0A A;  2J0K A;  2L8J A;  2MWS B;  5JHA A;  4AJY B;  3DVG Y;  1PQS A;  4LDT D;  1OEY J;  2NPT A;  3KH0 A;  1C3T A;  4ZRJ A;  1RFA A;  1JRU A;  2MX2 A;  2KHW B;  1BT0 A;  1P3Q U;  4RM8 A;  3APD A;  1E8W A;  4DBG A;  5D2M B;  4AWJ A;  2K6D B;  2LI5 A;  5E6O A;  1E8Y A;  3H7S A;  4WWO A;  2D07 B;  1WXV A;  3KYC D;  3L08 A;  3QC8 B;  2IO1 B;  4N9F 4;  1TBE A;  2Z0E B;  3RCZ A;  3D32 A;  1XD3 B;  2DYM A;  3L54 A;  4BBN C;  1V6E A;  4RMA A;  2QHO A;  1Y8R C;  4A3P A;  4I6P A;  4IM3 A;  4KVG B;  4FHK A;  4NJ7 A;  2ZVN A;  3K9O B;  4PYZ A;  2NPT B;  2ASQ A;  4M8M A;  2MRP A;  1A5R A;  1GG3 A;  2XBB C;  4K7S A;  4BKS D;  3AUL A;  1UEL A;  4ANX A;  3OLM D;  3VH3 B;  2R2Q A;  2EMT A;  4NQL B;  2ZCC A;  2CHW A;  3IHP C;  2KMC A;  3Q3J A;  2OOB B;  2JZZ A;  1F9J A;  3KUD B;  3WAL A;  2AWT A;  1LXD A;  2XEW A;  3NS8 A;  3VFK A;  2Y5B B;  3PV1 A;  2KMA A;  2M8S A;  3PPA A;  2GBR A;  2EMS A;  3UIP B;  5AEK B;  2MBQ A;  1J0G A;  2RR9 A;  3L0W B;  2FCQ A;  4DHZ B;  5LXI B;  1Q5W B;  4PS8 A;  4FN2 A;  1GUA B;  1P9D U;  3UQB A;  4KZ0 A;  4FAD A;  2MBE A;  2KTF A;  3DVN V;  3NZS A;  2PJH A;  2K8H A;  2KWV B;  1J19 A;  2DZK A;  2YVC A;  4WAA A;  2O6V D;  2KDE B;  1P98 A;  5DPS A;  1WJN A;  3V62 A;  1WF9 A;  1WRD B;  2OJR A;  4F1S A;  2PE6 B;  2BYF A;  3A4R A;  4F8C B;  3BIN A;  1AAR A;  4JQW C;  2IY0 B;  3GOE A;  3PS6 A;  4NNJ B;  5DCN A;  2BF8 B;  2PEA A;  2LZ6 A;  2KWC A;  3LDZ E;  4NAW A;  3RYT A;  1D3Z A;  4XC2 A;  2KWU B;  1WJU A;  2FNJ B;  1GC6 A;  2A5U A;  2ZEQ A;  2ZZP B;  4MDK E;  1R4M I;  3R3M A;  2IO3 B;  2IO0 B;  3Q3F A;  1U4A A;  3AU4 A;  4M0W B;  3R7R A;  2DZI A;  2N4F A;  4GDK B;  2KFK B;  1Q1O A;  5L95 C;  3ML8 A;  3QIJ A;  3TCA A;  4E3C A;  1CMX B;  3N32 A;  1GNU A;  4MJS A;  2PE9 A;  5JH5 C;  3K9P B;  2M1M A;  3PTF C;  5J17 A;  2ZJD A;  3R66 C;  4HVB A;  2JXX A;  4HPL B;  1UBI A;  4MEL A;  2N7D A;  2XK5 A;  3NOB A;  3QAQ A;  3VH4 B;  4CYE A;  5CTR C;  2KKC A;  2JWZ A;  4K7U A;  2K1F A;  2MP2 A;  3HM3 A;  2KO3 A;  4JL9 A;  1IYF A;  3ZKJ C;  2NBU A;  2G4D B;  2KAN A;  3DOW A;  1P0R A;  3VUW A;  1XQQ A;  2KJH B;  2KJR A;  4ZRI A;  3QQ8 B;  4ZRK A;  4KZC A;  4MJS B;  1T0Y A;  1UBQ A;  3RUI B;  2ZNV C;  5JZE B;  3ZIM A;  3DVG X;  1V2Y A;  1SE9 A;  5DPR A;  3CF6 E;  3VXW A;  4MM3 A;  4AOF A;  4FBJ B;  1R4N I;  2C60 A;  3H9D A;  3PRZ A;  3V61 A;  1YX5 B;  4LDT B;  4OVU A;  1Z2M A;  3R7Q A;  2KNB A;  2BGF A;  2KJ6 A;  2ZCB A;  4ASW C;  4BBN F;  4IM2 A;  1WJ6 A;  4EOY A;  1KM7 A;  1I42 A;  2MSE D;  2LWP A;  3UIO B;  2ZNV B;  4ANV A;  4CO7 A;  2KTR A;  1RAX A;  3A1Q B;  3PSE B;  1X1M A;  4BKT A;  4DDI D;  3AU5 A;  2CHZ A;  3QK0 A;  2WX1 A;  3EFU A;  4WWP A;  3OJ4 B;  1EO6 A;  2LRU A;  1V9J A;  4NJ6 A;  4GDL A;  4WJQ A;  4W9G A;  2KLC A;  3VTW A;  3QJZ A;  4MGY E;  2ZPN A;  1TZ1 A;  2LVO A;  1IPG A;  5D94 A;  1ZGU B;  5E6N A;  4FJY A;  4XX5 A;  2D11 A;  2MP2 B;  1WR1 A;  2IZV B;  3ZRC A;  1SGH A;  4RM9 A;  1ZW7 A;  3PLV A;  2NR2 A;  4EKU A;  4EUT A;  2JRH A;  3DDC B;  4I6N B;  2KK8 A;  4WJP A;  3SD5 A;  3UIN B;  5HKH A;  4HJK A;  4FHJ A;  2MW5 A;  1UD7 A;  3IVF A;  4MSQ B;  4LCD E;  4EFO A;  3U30 A;  4EZK A;  4DHZ E;  3TL5 A;  3ZDT A;  1G6J A;  4G50 A;  1WX9 A;  2G4S A;  2UYZ B;  1WI0 A;  5CHV C;  3M3J A;  4HPM B;  1V5O A;  1KLV A;  4IUM B;  3WAP A;  1ISN A;  4ICV A;  1L2N A;  2L05 A;  2BYV E;  2KX0 A;  2MBO A;  2KVR A;  3DBL I;  2DZJ A;  2IY1 B;  2KD0 A;  3IBE A;  2B3A A;  1YIW A;  2JT4 B;  3S2A A;  3RT3 B;  2L76 A;  5JHB A;  2N1W A;  3A9J A;  2JY6 A;  1WFY A;  1OGW A;  5J18 A;  3WIM A;  4TUU A;  2HE7 A;  5KHO A;  3JVZ X;  2BWE S;  3JW0 X;  3QX1 A;  1H8C A;  3PGE A;  2Z59 B;  5D7G A;  3BY4 B;  1IP9 A;  3ZNZ B;  1FXT B;  3H7P A;  3OJ3 A;  4KDL B;  3ZNI D;  1TTN A;  4KIK A;  1E8X A;  5E6P A;  2NBW B;  1EF1 A;  4GIV A;  5TR5 A;  1P1A A;  1WY8 A;  1OTR B;  2BWF A;  2K39 A;  3VTU A;  2BKR B;  2LVQ A;  4FUL A;  4CHK A;  4ICU A;  3MHS D;  3DBR I;  2L0T A;  2O6V B;  1V80 A;  2M0X A;  4MGZ E;  3UQA A;  2C7M B;  1V5T A;  3EEC A;  3DQV A;  1YD8 U;  3VVW B;  2KDF B;  1GC7 A;  1WXM A;  2KQS A;  4JGH B;  3L17 A;  2MBH A;  2CS4 A;  3PHW B;  4A3O A;  3PT2 B;  4DHJ B;  4PS3 A;  2GBK A;  2LXA A;  4TQ0 A;  2MLB A;  4GXB A;  5CHW A;  3A9K B;  2KDI A;  2RSU A;  3DPD A;  1WGY A;  2IYD B;  4DWF A;  2DAF A;  2KC2 A;  2R2O A;  3SU8 X;  5DPW A;  2C9W B;  4W9C A;  1L7Y A;  3GZN I;  1OQY A;  3IFW B;  3TJP A;  2K6Q A;  4IC7 B;  4WQO B;  2K25 A;  3EC8 A;  5FR6 A;  3KW5 B;  4W9L A;  5CX3 A;  3U7D A;  3WAM A;  4GOC A;  1J8C A;  3APC A;  2CKH B;  1E90 A;  4B6W A;  4TQ1 A;  1E7V A;  3ALB A;  3JSV A;  1S3S G;  1VCB A;  4GGQ A;  3EHV A;  3W1Y A;  3ZNH B;  3PRP B;  1SIF A;  4MSM B;  2WWZ A;  2PPH A;  2JUO A;  5J2R A;  2LGX A;  1WM2 A;  4MGK E;  2D2Q A;  2CU1 A;  4F7Z A;  3ZW3 A;  3ZRF A;  3U8Z A;  3WA0 A;  3T9L A;  3NHE B;  2GMI C;  3VTV A;  2J7Q B;  3O65 B;  1WR6 E;  3VDZ A;  2JRI B;  4FJV B;  2K8C A;  3C0R B;  4GMV A;  4W9F A;  3VUY A;  2WX0 A;  1V49 A;  1TGZ B;  2O6V A;  4HXD A;  4X57 B;  2RPQ A;  3JSV B;  4GDK A;  2FCN A;  2LAS A;  3ENE A;  2KN5 A;  2UWQ A;  2JVC A;  2N9X A;  4KSL C;  3ZTC A;  3VQI A;  4E74 A;  5L83 A;  2BKF A;  3KUC B;  4K1R B;  2LGD A;  2KQ7 A;  1Z5S B;  2KDB A;  2M17 A;  2LGY A;  3QA8 A;  1WGR A;  2LRW A;  1M94 A;  5EDS A;  2D10 A;  1Q0W B;  2O2V B;  5AZF A;  2A4Z A;  3MJW A;  2G3Q B;  2CR5 A;  2YLM A;  2IBI B;  2FID A;  2HTH A;  3PVL A;  3AXC A;  4IM0 A;  3T8M A;  3M62 B;  2LUE A;  1YJ1 A;  3B1L X;  2LXC A;  4B9K A;  2AL3 A;  2N7E A;  3KUZ A;  3VAW A;  2FUH B;  3DVN U;  3OAW A;  3H7P B;  3H6N A;  4EZL A;  1WXS A;  2REX A;  2RD0 A;  1UZX B;  3V60 A;  3V6C B;  3L16 A;  1QZE A;  4II2 B;  1YQB A;  4MGI E;  3H1U A;  3ZUN A;  1NBF C;  2DYB A;  3ML9 A;  3X0W A;  1V86 A;  3TMP B;  4GB9 A;  1V81 A;  1EUV B;  1YX6 B;  4WJO A;  4WJN A;  1K8R B;  4AP4 C;  2KZR A;  3PRM B;  2LJ5 A;  2C5L C;  2KOX A;  2WYQ A;  4MEM A;  3ZLZ A;  3CSF A;  3KYD D;  4XZ4 A;  1WGD A;  2C7N B;  2N9P C;  1WGH A;  4J6I A;  3ZDM C;  2MBB B;  2Z0D B;  2L7R A;  2ZPY A;  2LD9 A;  3A4S C;  3A1Q A;  4IWO A;  3NZU A;  3A9K A;  5D6J B;  3TIX A;  4URK A;  1E8Z A;  3DBH I;  3QAR A;  4W9D A;  1HE8 A;  2NBV B;  2V4L A;  3AI5 A;  4W9J A;  2M4N A;  4NAW B;  1UGM A;  4II3 B;  1I35 A;  1EF5 A;  2L00 B;  3ZO5 B;  2O2V A;  2N9E B;  2JPH A;  4IW0 A;  4PYU A;  4GU2 A;  4FLH A;  1WE6 A;  4G11 A;  2KLG A;  4EEW A;  3PRE A;  2GBN A;  1LFD A;  4PS7 A;  5LXH A;  4IG7 B;  1E5W A;  2MQJ A;  2NVU I;  3RD2 A;  2LVP A;  3UGB B;  4BFR A;  1WMH B;  1WM3 A;  2EKE C;  2RGF A;  1WZ3 A;  3VHT C;  3HIZ A;  1NDD A;  3PLU A;  4P7I A;  4KV2 A;  4OVV A;  3UF8 A;  3W1S C;  2WDT B;  2L0F A;  2FCS A;  4TV3 A;  2G45 B;  3W1S A;  4WWN A;  3KVF B;  3HK0 A;  4HDO A;  5DPT A;  3SDL C;  1LQB A;  1WXA A;  4HK2 A;  4ANU A;  1WX8 A;  3I3T B;  2KFJ A;  5AZH A;  1WIA A;  4HDQ A;  4HWI B;  4DDG D;  4ZDV A;  4M8N A;  5IAA C;  2JF5 A;  3SHQ A;  3N3K B;  2MA9 B;  3PZD A;  2DEN B;  3M63 B;  2AL6 A;  3N30 A;  3NY5 A;  4ZYN A;  4AJW A;  2J0M A;  2D3G A;  4BOZ B;  4NQK E;  5LLI A;  4AUQ C;  2K8B A;  3QWZ B;  3RZW C;  4KSK C;  2KC1 A;  3DBS A;  1RRB A;  4W9H A;  2I1K A;  3P2B A;  4DHJ D;  3PHX B;  2NS5 A;  4NY0 A;  1MG8 A;  1WYW B;  3B08 A;  3X23 A;  1WZ0 A;  4G3X B;  1RLF A;  4BKG A;  3ONS A;  1H4R A;  4K81 A;  3A9J B;  3TBL D;  3WAO A;  5C1Z A;  2I1J A;  1NI2 A;  4HCP B;  1C1Y B;  5AZG A;  2DAJ A;  4A20 A;  2KFK A;  4LJP B;  3HHM A;  1VD2 A;  2KXJ A;  4IWP A;  2DX5 B;  4W9I A;  1KOT A;  2KTR B;  1XT9 B;  2DZM A;  3L13 A;  4IWQ A;  4JIO U;  2AYO B;  3RUL A;  3RZF A;  3V6E B;  3ECI A;  5C23 A;  4FA6 A;  3ZTD A;  3ZNG C;  4BVU C;  2ZVO A;  2HD5 B;  4DXA B;  2KX3 A;  2XK5 B;  1E7U A;  2W9N A;  2VRR B;  4W9K A;  3APF A;  5KHQ A;  4GDL B;  4K7W A;  4B95 A;  5GMV A;  4EZJ A;  2V1Y A;  4MH0 E;  1WX7 A;  5G55 A;  2IO2 B;  4ANW A;  1WE7 A;  2HJ8 A;  4KIK B;  4HCN B;  4HLE A;  2L3Z A;  2J0J A;  1OEY A;  4BKS A;  5IA7 A;  5CHF A;  1WH3 A;  2GOW A;  4GN1 A;  4DK5 A;  1GJZ A;  2GBJ A;  2BPS A;  3L10 B;  3CST A;  2BYE A;  4KDI C;  4TKN A;  4BOS C;  1UH6 A;  3LJ3 A;  1KJT A;  4LJO B;  2N1V A;  3VUX A;  2C7H A;  1WGG A;  2AEH A;  2NCN A;  4NPN A;  3M95 A;  2CHX A;  3HM6 X;  3MTN B;  2FIF A;  3DCG A;  2GBM A;  4I6L B;  4YL8 A;  2JZ3 B;  2FAZ A;  3IG3 A;  1WJ4 A;  1WMH A;  3WAN A;  4JLC A;  3A33 B;  2V3S A; 
#chains in the Genus database with same CATH topology
 5BO4 B;  4FJZ A;  3URY A;  3BVG A;  4G0N B;  2L8J A;  1FPY A;  2MWS B;  4HRO A;  5JHA A;  2INP E;  2M56 B;  3KH0 A;  1VJK A;  1P3Q U;  1E8W A;  4DBG A;  3FIL A;  2WQY B;  4HKQ A;  4AWJ A;  4GLS C;  1CJE A;  4WWO A;  3H7S A;  3KYC D;  3L08 A;  2IO1 B;  3TEY A;  2M0A A;  4RMA A;  3NZ3 A;  4A3P A;  4KVG B;  4FHK A;  3K9O B;  2ASQ A;  3FKY A;  3AUL A;  2UU7 A;  3VH3 B;  2R2Q A;  2EMT A;  4NQL B;  3IHP C;  4OZB A;  1BXT A;  2MEK A;  2MJE A;  2Y5B B;  4RGM A;  1J7B A;  1IBX B;  1JWA D;  2J4X A;  3KWV A;  1J0G A;  4DHZ B;  1KLU D;  3BYT B;  4FAD A;  3DVN V;  1J19 A;  3V62 A;  2RPV A;  1WF9 A;  2W82 A;  1N62 A;  5GXG B;  1ET6 A;  4RF1 A;  3UI3 A;  2JZP A;  1QOA A;  5C3J B;  1XO3 A;  2LZ6 A;  4XC2 A;  1V1P A;  3V3X A;  2K9X A;  2FNJ B;  1GC6 A;  2ZEQ A;  1R4M I;  1HXY D;  3PZ8 A;  3AU4 A;  2DZI A;  2SEB D;  5BYR A;  4GDK B;  4FXC A;  3ML8 A;  4XE0 A;  4M01 A;  4MJS A;  2PE9 A;  3B2F A;  3PTF C;  1L6U A;  1P7E A;  2WXQ A;  4HPL B;  1UBI A;  1K53 A;  4MEL A;  3BZD B;  2JWZ A;  3NJT A;  2WXK A;  2NBU A;  3Q3O C;  2KJR A;  1HZ5 A;  3OWE B;  4KZC A;  2QC8 A;  4MJS B;  1UBQ A;  4YT0 B;  3RUI B;  3TUO A;  3DVG X;  2G1E A;  4BZA A;  2XNA C;  1SE9 A;  3CF6 E;  3VXW A;  3H9D A;  1YX5 B;  1Z2M A;  2ZCB A;  2QEJ C;  4IM2 A;  3GS2 A;  3V05 A;  4HPP A;  1I42 A;  2KN4 A;  4LNF A;  4C7Z A;  2PIA A;  3PSE B;  2J53 A;  4WWP A;  3OJ4 B;  4KX6 B;  2V3N A;  4ARI A;  1SJE D;  4W9G A;  1OQR A;  4MGY E;  1TZ1 A;  1IPG A;  1HEZ E;  3MHZ A;  4EUT A;  2KK8 A;  1N63 A;  3UIN B;  1ACC A;  2MW5 A;  1UD7 A;  4REZ A;  4MSQ B;  1A70 A;  1G6J A;  3P4Q B;  1FXI A;  4HPM B;  1KLV A;  1T0Q C;  3H8H A;  1MHH E;  3BVM A;  3Q14 C;  2KVR A;  2D5G A;  1HTQ A;  2AQ2 B;  4WQM A;  1YIW A;  1JW9 D;  2N1W A;  3RPF C;  1IBX A;  2JY6 A;  3GE8 C;  1WFY A;  1TKY A;  1L0X B;  5KHO A;  1MHX A;  2ON8 A;  1I4Q A;  4K3B A;  3OJ3 A;  4KDL B;  1E8X A;  5E6P A;  3EFC A;  4GIV A;  1P1A A;  1OTR B;  1YNT E;  1NEK B;  5BYQ A;  1T5X D;  3DBR I;  2M0X A;  4MGZ E;  3EEC A;  1V5T A;  3N9Y C;  4S0R A;  1WXM A;  1JWM D;  1VDV A;  2KQS A;  4JGH B;  2CS4 A;  1YJI A;  4DHJ B;  4PS3 A;  2LXA A;  2JYE A;  1QLB B;  1SBB B;  3A9K B;  1WGY A;  2IYD B;  4RCO A;  4DWF A;  2R2O A;  3TJP A;  3RNA C;  4WQO B;  2D3C A;  5FR6 A;  4W9L A;  3U7D A;  3WAM A;  3APC A;  1N60 A;  1E7V A;  1S3S G;  3IAS 1;  4GGQ A;  3W1Y A;  3ZNH B;  3KWL A;  1TYG B;  4MGK E;  4D2K A;  3MC8 A;  2GMI C;  3GE3 C;  3O65 B;  3VDZ A;  2JRI B;  1QIL A;  3MFG A;  4HXD A;  2RPQ A;  2FCN A;  2KAC A;  5HG2 A;  2UWQ A;  5L83 A;  3KUC B;  2KQ7 A;  1MG4 A;  5EDS A;  3B9J A;  2O2V B;  2G3Q B;  4MT5 A;  3T8M A;  2LUE A;  1T0S C;  1D6E C;  1F2R C;  3DVN U;  2VZK B;  4AS1 A;  3OAW A;  3DBH B;  3H7P B;  1WXS A;  2WXL A;  3V60 A;  4II2 B;  3ZUN A;  3H1U A;  4ZHO A;  3AEF B;  3EGR A;  1K8R B;  1EU3 A;  1SSN A;  4BAX A;  1ZOY B;  3PRM B;  2LJ5 A;  3AN1 A;  3KYD D;  2W54 A;  2C7N B;  1WGH A;  1STE A;  2MBB B;  2BS3 B;  2HTM E;  3A4S C;  4IOI E;  4RGT A;  2NBV B;  3EUB 2;  4II3 B;  1I35 A;  3EA6 A;  2BB6 A;  2LHE A;  1E5W A;  2NVU I;  3UGB B;  1WMH B;  1WM3 A;  3HIZ A;  4P7I A;  1VZ8 A;  2L0F A;  3U4E G;  1KTK A;  3KVF B;  4HDO A;  3AEE B;  4HRS A;  3VR8 B;  1WX8 A;  4NAM A;  5BMI A;  4HWI B;  4ZDV A;  3SHQ A;  3GB1 A;  2V3P A;  3NY5 A;  2IDY A;  4AJW A;  2D3G A;  1UUP A;  4NQK E;  4BOZ B;  4YSX B;  3SFD B;  2Z8L A;  3RNF C;  4LLG M;  1RRB A;  4DHJ D;  4EE2 A;  3BK1 A;  3X23 A;  1WZ0 A;  1FNV A;  5LNK 1;  3R2I A;  1H4R A;  1RM6 C;  3A9J B;  1HQR D;  5AZG A;  2DAJ A;  4A20 A;  1SE3 A;  1PGB A;  1MJD A;  3KQ4 A;  1MI0 A;  3RUL A;  1FEH A;  4FA6 A;  3ZTD A;  3ZNG C;  4AQ7 A;  2KX3 A;  1L4D B;  2VRR B;  1TJE A;  4K7W A;  1SIJ A;  1JWB D;  2V1Y A;  2BT6 A;  4LTU A;  4KIK B;  2HJ8 A;  4HLE A;  2MJD A;  3AH7 A;  3AEC B;  4RGO S;  2WGS A;  4LNK A;  5CHF A;  1WH3 A;  2GOW A;  1I4R A;  4A6Q A;  2GBJ A;  2D3A A;  4KDI C;  1UH6 A;  4US9 A;  1PDX A;  1WGG A;  1QOG A;  3M95 A;  2CHX A;  3MTN B;  3DCG A;  1UNS A;  4I6L B;  4YL8 A;  2BS4 B;  2GI9 A;  4R3D A;  3SEB A;  4TSS A;  3WAN A;  3A33 B;  1BML C;  1SE4 A;  4ACF A;  1S1Q B;  4ZOH C;  3RNB C;  4E71 A;  3CMM B;  1V8C A;  3B0A A;  1TS2 A;  1PQS A;  2NPT A;  3N1Y C;  4ZRJ A;  1JRU A;  5D2M B;  1JRP A;  1K51 A;  2K6D B;  2LI5 A;  1E8Y A;  2INC C;  2Z0E B;  2HJ1 A;  4L2Y A;  1KLG D;  2QHO A;  2VH2 A;  4MAC A;  3BVZ A;  2KAJ A;  2R61 A;  2NPT B;  3AM9 A;  2ONQ A;  1A5R A;  4K7S A;  4BKS D;  3OLM D;  2ZCC A;  1FO4 A;  3Q3J A;  2JZZ A;  1F9J A;  3I57 A;  3MC0 B;  2XEW A;  3P4S B;  3PPA A;  1MPE A;  4RNA A;  2EMS A;  3UIP B;  1T3Q A;  5AEK B;  5LXI B;  1Q5W B;  1P9D U;  1QQR A;  1SXT A;  1TZO A;  4KZ0 A;  2QMT A;  2MBE A;  4XGA B;  4DXF A;  5G5G A;  2KWV B;  4WAA A;  5DPS A;  1WJN A;  4XWT A;  1R7S A;  4F8C B;  3BIN A;  2PKO A;  4PT5 A;  4JQW C;  1XCQ L;  3GOE A;  3PS6 A;  1EU4 A;  4NNJ B;  1QT9 A;  2PVG C;  2KWC A;  4NAW A;  1WJU A;  2A5U A;  3BK2 A;  2ZZP B;  2ICI A;  1ENF A;  2IO3 B;  2IO0 B;  4WWM A;  2N4F A;  3TCA A;  3GZN B;  3VR9 B;  4E3C A;  3N32 A;  1E7P B;  3K9P B;  1XLQ A;  3R66 C;  4C4V A;  1V1O A;  4HVB A;  4RGN A;  1XCT L;  2N7D A;  4K7U A;  2L52 A;  4JL9 A;  3ZKJ C;  1TS5 A;  1P0R A;  2KJH B;  3QQ8 B;  3ZJT A;  4XYC A;  1C4P A;  2ZNV C;  5JZE B;  3ZIM A;  1SF0 A;  5DPR A;  4YWG G;  1ZXH A;  2C60 A;  3V61 A;  3P4P B;  3MJ5 A;  3R7Q A;  3T3O A;  4ASW C;  1WJ6 A;  2LWP A;  2KYW A;  1X1M A;  4XDC A;  4BKT A;  3QK0 A;  2RDB C;  1EO6 A;  1V9J A;  4NJ6 A;  3Q8B A;  4WJQ A;  2KLC A;  4B0E A;  3QJZ A;  1C9F A;  2LHD A;  1ZGU B;  1AWD A;  1FMA D;  2D11 A;  1WR1 A;  2MP2 B;  4RM9 A;  3NVV A;  3PLV A;  2Y3A A;  2NR2 A;  4EKU A;  2JRH A;  1DGJ A;  3SD5 A;  1M4V A;  1V1P B;  4KKJ A;  3IVF A;  4EFO A;  4EZK A;  2RMM A;  2N7J A;  4OVZ A;  3R8B A;  1WX9 A;  2G4S A;  2UYZ B;  1WI0 A;  5CHV C;  1D5M C;  4IUM B;  4JWS C;  3ZJU A;  2MBO A;  4OHJ A;  3L4P A;  2IY1 B;  2KD0 A;  3IBE A;  3S2A A;  3NVW A;  3RT3 B;  3A9J A;  2LJI A;  5J18 A;  4KGT A;  2Z59 B;  5D7G A;  3BY4 B;  1IP9 A;  3ZNZ B;  1FXT B;  5D3I B;  4KIK A;  1KF6 B;  2W55 A;  2NMQ A;  1JML A;  2K39 A;  1XF5 L;  1SEB D;  4ICU A;  2O6V B;  1C4A A;  1V80 A;  1P7F A;  1YD8 U;  1GC7 A;  3PHW B;  3PT2 B;  1XXG A;  2QIL A;  2MLB A;  4GXB A;  2KDI A;  2RSU A;  1DOX A;  2DAF A;  1L7Y A;  2K6Q A;  5EE0 A;  4KGR A;  2QJL A;  4NJC A;  2K22 A;  4LNI A;  5CX3 A;  4YTP B;  1J8C A;  4M00 A;  1KRH A;  4TQ1 A;  1VCB A;  1SIF A;  4MSM B;  1VZ7 A;  2JUO A;  2L1A A;  3TEX A;  5J2R A;  3Q6B A;  2D2Q A;  2CU1 A;  4F7Z A;  1K50 A;  3ZRF A;  4Q2J A;  3U8Z A;  1LO5 D;  5IOI A;  3VTV A;  3DWG C;  2L83 A;  3VUY A;  2K8C A;  3C0R B;  1XEE A;  1V49 A;  1IGD A;  4ZRQ A;  3ZTC A;  2KN5 A;  4KSL C;  2JVC A;  5IP4 D;  2LGD A;  1Z5S B;  2KDB A;  1Y56 A;  2WXG A;  5AZF A;  1FNW A;  2A4Z A;  2CR5 A;  2WXO A;  2FID A;  1UGJ A;  2HTH A;  3AXC A;  1KFY B;  3M62 B;  1JCK B;  3HVD A;  3MC9 A;  2LXC A;  4B9K A;  2N7E A;  3KUZ A;  1HZ6 A;  1C77 A;  4LK0 M;  3TSS A;  3V6C B;  1NBF C;  3HUI A;  3TEW A;  3ML9 A;  1V81 A;  1YX6 B;  4WJO A;  4WJN A;  2FBW B;  2C5L C;  3E56 A;  4MEM A;  4MH8 A;  3ZLZ A;  4XZ4 A;  3U52 E;  5IO9 A;  3NZU A;  3A9K A;  5D6J B;  3TIX A;  1E8Z A;  2E3T A;  1HE8 A;  4W9J A;  3P42 A;  4NAW B;  1UGM A;  2WLB A;  2L00 B;  1ZXI A;  4IW0 A;  2JPH A;  4EEW A;  4FLH A;  2KLG A;  1I4P A;  2GBN A;  5LXH A;  1QOF A;  3W5U B;  2LVP A;  4BFR A;  1NDD A;  3PLU A;  4KV2 A;  4OVV A;  2FCS A;  3AB5 A;  4WWN A;  2OJW A;  4ZHP A;  2IGD A;  3AE9 B;  3N1X C;  1FNU A;  4ANU A;  2KFJ A;  2CU3 A;  2KQ4 X;  5AZH A;  1ROE A;  1WIA A;  4DDG D;  4M8N A;  5IAA C;  2DLB A;  2BQQ A;  3N3K B;  2MA9 B;  4S17 A;  2BBC A;  2DEN B;  3M63 B;  2AL6 A;  3ZYY X;  3Q3N C;  4IDI A;  4AUQ C;  2K8B A;  3RZW C;  4KSK C;  1ZUD 2;  2KC1 A;  3DBS A;  1FRR A;  5C2T B;  2I1K A;  3P2B A;  2NS5 A;  5BMH A;  5H92 C;  4BKG A;  4K81 A;  3TBL D;  2I1J A;  1NI2 A;  1C1Y B;  2FUG 1;  2KFK A;  4IWP A;  4W9I A;  2WP9 B;  2DZM A;  3L13 A;  4IWQ A;  3ECI A;  5C23 A;  5D3D A;  4BVU C;  2HD5 B;  4DXA B;  2N9K A;  5KHQ A;  1DOI A;  1C76 A;  4MH0 E;  4HCN B;  2L3Z A;  1TT5 B;  1SJH D;  4YXD B;  3ZQ4 A;  4DK5 A;  1GJZ A;  3L10 B;  3SFE B;  2BYE A;  1KJT A;  4LJO B;  2C7H A;  2AEH A;  4NPN A;  3HM6 X;  5JXV A;  2FIF A;  2GBM A;  1R4N B;  4A90 A;  2JZ3 B;  4QAY A;  3ZGZ A;  1WMH A;  1QF6 A;  1YQ4 B;  4JLC A;  1YOV B;  5HFY A;  1LM8 B;  2DHZ A;  4YTM B;  3ZVV A;  3KLS X;  1J7C A;  5I4D A;  2V0G A;  4L1B A;  2MCN B;  3QHT A;  2J0K A;  1L0V B;  2LFI A;  4AJY B;  4ZRP A;  1C79 A;  1OEY J;  3P1M A;  2QSD A;  2MX2 A;  1BT0 A;  1KH0 A;  3NVY A;  4USA A;  1WXV A;  3QC8 B;  4N9F 4;  3D32 A;  1XD3 B;  1ZPS A;  3L54 A;  1Y8R C;  2ZVN A;  2JX5 A;  4PYZ A;  2D3B A;  4M8M A;  4JE3 B;  2V4I B;  1B1Z A;  1GG3 A;  2XBB C;  4ANX A;  1AYF A;  2CHW A;  2NTS A;  1IGC A;  2OOB B;  3WAL A;  2AWT A;  4A9A A;  4UDU C;  3CIR B;  2KMA A;  4IKG A;  2JQR B;  3AEG B;  2MBQ A;  4KGS A;  3NVZ A;  3L0W B;  2FCQ A;  4HJG E;  1GUA B;  3UQB A;  2YEP F;  2KTF A;  3NZS A;  2PJH A;  2K8H A;  1T0R C;  4WH4 A;  2DZK A;  2KDE B;  2G9H D;  2SAK A;  4WIP A;  3IT4 B;  1P98 A;  1ZE3 D;  1WRD B;  4YSY B;  2OJR A;  4F1S A;  2QDF A;  1RYJ A;  3O13 A;  2PTL A;  5FKA C;  3A4R A;  2IY0 B;  3LYY A;  2QCZ A;  2OED A;  5DCN A;  2BF8 B;  4C00 A;  3LDZ E;  3RYT A;  2KWU B;  4M02 A;  3DWM A;  2QIE B;  2YEP B;  4RF0 A;  1GB1 A;  3Q3F A;  4M0W B;  3R7R A;  4N59 A;  2KFK B;  1Q1O A;  5L95 C;  3ZXV A;  1L5P A;  2CJO A;  1GNU A;  5JH5 C;  1XLN A;  2ZJD A;  5J17 A;  2EKI A;  2INN E;  2JSV X;  2JXX A;  4RH6 A;  1BUI C;  1PFD A;  3QAQ A;  2KKC A;  2WXF A;  2B76 B;  2K1F A;  2JWU A;  1I4G A;  1JAL A;  3NG0 A;  1T0Y A;  1WSP A;  1R4M B;  2LUM A;  3OG5 A;  2H89 B;  2BGF A;  4BBN F;  3ZXR A;  4EOY A;  1KM7 A;  2MSE D;  4JWU C;  2IGH A;  4ANV A;  4CO7 A;  2KTR A;  2FE8 A;  1VZ6 A;  1MVK A;  3AU5 A;  4DDI D;  2WX1 A;  4MM3 B;  1ZDV A;  2LRU A;  1QKZ A;  2ZPN A;  2WXH A;  5D94 A;  5E6N A;  4FJY A;  2K3U A;  4LNN A;  1SGH A;  2M19 A;  1L4Z B;  3LB8 C;  1ZW7 A;  1FM0 D;  1UF0 A;  2VZK D;  4WJP A;  5HKH A;  1DYQ A;  4LNO A;  4HJK A;  4FHJ A;  3ZJV A;  4DHZ E;  3TL5 A;  4DQO C;  3M3J A;  2KDM A;  1YJJ A;  1ISN A;  1L2N A;  3E9S A;  2PVO D;  1TS3 A;  2BYV E;  1NYR A;  2KX0 A;  2J52 A;  2DZJ A;  1NEN B;  2B3A A;  2JT4 B;  4O1N A;  5EE3 A;  2L76 A;  5JHB A;  3VRB B;  3JVZ X;  2BWE S;  3JW0 X;  3QX1 A;  1H8C A;  3VRA B;  2PW9 A;  3AV8 A;  4L23 A;  2NBW B;  1EF1 A;  5TR5 A;  1WXQ A;  3VTU A;  2GLS A;  2K0P A;  2BKR B;  4FUL A;  4CHK A;  4OZA A;  3MHS D;  2L0T A;  1GPX A;  3UQA A;  1F77 A;  2WDV B;  3VVW B;  2KDF B;  3RN9 C;  5CHW A;  3FIL B;  2KC2 A;  3SU8 X;  2C9W B;  3GZN I;  1OQY A;  3IFW B;  5BYS A;  4IC7 B;  4P1C C;  3NRZ A;  2K25 A;  1TKG A;  3WCQ A;  2GRI A;  2JU6 X;  1L6V A;  5FK9 C;  2CKH B;  1E90 A;  4B6W A;  3ALB A;  2HDE A;  3EHV A;  3AE1 B;  2PLP A;  1D5Z C;  2RDG A;  2LGX A;  1WM2 A;  2WDQ B;  3ZW3 A;  4J3O D;  3NHE B;  3GP7 A;  1WR6 E;  4W9F A;  2BVC A;  4X57 B;  2LAS A;  4US8 A;  1NI3 A;  2N9X A;  1N6Z A;  3VQI A;  3T3N A;  3Q8A A;  4WUR A;  4K1R B;  2M17 A;  3QA8 A;  2LRW A;  3R2T A;  1Q0W B;  3MJW A;  2YLM A;  3PVL A;  3B1L X;  2AL3 A;  1FFU A;  1WWT A;  4JPS A;  4EZL A;  2NTT A;  2RD0 A;  2WXM A;  2DYB A;  1NVI D;  1V86 A;  3J9C A;  1F0Z A;  2KZR A;  1T6B X;  3AE4 B;  2KOX A;  2N9P C;  4J6I A;  4C4V B;  2L7R A;  3A1Q A;  3DBH I;  2MJ3 A;  3QAR A;  4W9D A;  1E9M A;  3RNG C;  4C80 A;  1FRD A;  2WU5 B;  1EF5 A;  2O2V A;  4DXG A;  4GU2 A;  2X38 A;  1WE6 A;  3PRE A;  1LFD A;  3RD2 A;  2RGF A;  1WZ3 A;  3UF8 A;  2WDT B;  4TV3 A;  2LEK A;  4NZL B;  3W1S A;  4RFB A;  4M0W A;  2J42 A;  3Q8F A;  4ARC A;  3CWI A;  3U7Z A;  3AE2 B;  3FC4 A;  1HTO A;  4ZYN A;  1JQ4 A;  3Q2A C;  3BWU D;  3PHX B;  4NY0 A;  1MG8 A;  3B08 A;  3I9V 1;  2I38 A;  3AE3 B;  3ONS A;  2XN9 C;  1JWS D;  5C1Z A;  1TIF A;  1RFK A;  3HHM A;  3U2S C;  2DX5 B;  1KOT A;  2KTR B;  3SR6 A;  1HA5 A;  4JIO U;  2AYO B;  2ZVO A;  2XK5 B;  1E7U A;  3PO0 A;  4W9K A;  3APF A;  1F52 A;  4B95 A;  4EZJ A;  5G55 A;  2TSS A;  4ANW A;  4A8X C;  1V97 A;  3W2D A;  1OEY A;  3BYY B;  1GOZ A;  5HHD G;  1GAQ B;  4GN1 A;  3HVZ A;  2IGG A;  2K5P A;  3CST A;  3LJ3 A;  3VUX A;  4OW0 A;  4K3C A;  2FAZ A;  1WJ4 A;  4P6V F;  4GB9 A;  2V3S A;  3QCA A;  4W9E A;  5G2N A;  4GSW A;  1ZKH A;  2FCM A;  3LXF A;  1VLB A;  3JYU A;  2DYO A;  3DVG Y;  4LDT D;  1ZP0 B;  1C3T A;  4C7Y A;  1PGX A;  1YN4 A;  1RFA A;  5TSS A;  4RM8 A;  2KHW B;  2W3R A;  3APD A;  1E10 A;  5E6O A;  2D07 B;  1LGR A;  1TBE A;  1I4H A;  3RCZ A;  2DYM A;  4BBN C;  1V6E A;  4I6P A;  4IM3 A;  3NUH B;  1JRO A;  4NJ7 A;  1RWS A;  2WXI A;  2BS2 B;  2MRP A;  3NS1 A;  1UEL A;  2AQ1 B;  3BII D;  2KMC A;  1N5W A;  3KUD B;  1XLP A;  2LMC A;  1LXD A;  3NS8 A;  3VFK A;  4CQN A;  1ET9 A;  3B2G A;  3PV1 A;  4ITK A;  4JX1 C;  2M8S A;  2GBR A;  2WXR A;  2I2Y A;  2E6X A;  2RR9 A;  1WYG A;  2GB1 A;  4PS8 A;  3IAM 1;  4FN2 A;  2N0S B;  3Q8C A;  3AE6 B;  3MP9 A;  2KWD A;  1VR9 A;  3PZ7 A;  2YVC A;  2O6V D;  2LGS A;  1L0Y B;  2PE6 B;  2WXP A;  2BYF A;  2DWQ A;  2X8X X;  3N1Z C;  1AAR A;  3AEB B;  2BTE A;  1ZDX A;  2IND C;  2PEA A;  2OHF A;  1D3Z A;  2MHJ A;  2WU2 B;  4MDK E;  3R3M A;  2BYT A;  1I4X A;  1U4A A;  1UWM A;  3QIJ A;  2IPK D;  1CMX B;  2LGI A;  2M1M A;  3I63 C;  2BW2 A;  1PGA A;  2XK5 A;  3NOB A;  2JYT A;  3VH4 B;  4CYE A;  1UWX A;  5CTR C;  2MP2 A;  3HM3 A;  2KO3 A;  1IYF A;  2G4D B;  2KAN A;  3DOW A;  3AMZ A;  3VUW A;  1XQQ A;  4ZRI A;  4ZRK A;  2KVZ A;  3W5V B;  1V2Y A;  3RI7 C;  4MM3 A;  4AOF A;  4FBJ B;  1R4N I;  3AE8 B;  3PRZ A;  4LDT B;  4OVU A;  2KNB A;  1SB3 C;  4A55 A;  2KJ6 A;  3Q8E A;  3UIO B;  2ZNV B;  2ZW1 A;  1RAX A;  1VRA B;  3A1Q B;  2CHZ A;  3EFU A;  4KKI A;  3P4R B;  1YMH E;  4GDL A;  4XWW A;  3AE5 B;  3VTW A;  3ETR A;  2CJN A;  3DBL B;  2LVO A;  5AUK A;  1E6E B;  4XX5 A;  2IZV B;  3ZRC A;  2JXT A;  1TKE A;  1WGK A;  3DDC B;  4I6N B;  3P63 A;  2Y5C A;  4XDD A;  1CQV A;  1YN5 A;  1WRI A;  4LCD E;  3U30 A;  5T8I A;  3ZDT A;  1AW7 A;  4G50 A;  1V5O A;  2Y5P A;  3WAP A;  4YTN B;  2AX5 A;  4ICV A;  3AEA B;  2L05 A;  3Q3M C;  2AQ3 B;  3DBL I;  1JWU D;  2IJ0 A;  4PK1 A;  1OGW A;  2WS3 B;  3WIM A;  4TUU A;  2HE7 A;  1D5X C;  3C8Y A;  3PGE A;  1D4B A;  4C56 C;  3H7P A;  3TEZ A;  3ZNI D;  1TTN A;  1OQQ A;  1N61 A;  1WY8 A;  2BWF A;  2KMM A;  2LVQ A;  1FXA A;  1B9R A;  3DBR B;  1Q10 A;  2WDR B;  2C7M B;  3DQV A;  3FAH A;  4N6E B;  3L17 A;  2MBH A;  1SE2 A;  4A3O A;  2GBK A;  3N20 C;  4HKZ E;  4TQ0 A;  3DPD A;  5DPW A;  4W9C A;  3C19 A;  1FCC C;  2KT7 A;  3EC8 A;  2Q5W D;  3KW5 B;  1OFF A;  1XLO A;  4GOC A;  2DNF A;  5E6J A;  3JSV A;  2VH1 A;  3PRP B;  1CZP A;  3RFZ B;  2WWZ A;  2PPH A;  5IKC M;  1FCL A;  4TMA B;  2WHI A;  2DBY A;  4B0M A;  2ACZ B;  3WA0 A;  3T9L A;  3AE7 B;  2J7Q B;  4FJV B;  4GMV A;  5BMG A;  2WX0 A;  1FIQ A;  1TGZ B;  2O6V A;  3JSV B;  4P1B C;  4GDK A;  1J7A A;  3ENE A;  5IN7 A;  4E74 A;  1DOY A;  2BKF A;  3RNE C;  2LGY A;  1WGR A;  1M94 A;  2D10 A;  5G5H A;  2N9L A;  4IM0 A;  2IBI B;  1YJ1 A;  5FR3 A;  2EEL A;  3VAW A;  1MFW A;  2FUH B;  2ZW0 A;  3H6N A;  3I5J C;  2REX A;  1UZX B;  2W3S A;  3DHI C;  3L16 A;  1QZE A;  4MGI E;  1YQB A;  3DHH C;  3X0W A;  3TMP B;  4WAF A;  1EUV B;  3ABV B;  1F2R I;  4AP4 C;  1YN3 A;  2WYQ A;  4N58 A;  3CSF A;  4YSZ B;  1WGD A;  1GB4 A;  3ZDM C;  2Z0D B;  2ZPY A;  2LD9 A;  4IWO A;  1C4C A;  4URK A;  3RNC C;  1IUE A;  2V4L A;  3AI5 A;  4P16 A;  2M4N A;  2V9H A;  3ZO5 B;  1FFV A;  2N9E B;  4PYU A;  4G11 A;  1YQ3 B;  4PS7 A;  3IXS A;  4IG7 B;  2MQJ A;  2EKE C;  3HRD D;  1CK1 A;  5H8Y E;  3VHT C;  1C78 A;  1ESF A;  3Q69 A;  2H88 B;  3W1S C;  2G45 B;  3IT6 B;  3HK0 A;  1I7H A;  1PUT A;  5DPT A;  3SDL C;  3W9C B;  1LQB A;  4ZYS A;  1WXA A;  4HK2 A;  3I3T B;  4HDQ A;  2JF5 A;  2PMV A;  3PZD A;  3N30 A;  5MPO A;  1TY2 A;  2J0M A;  1TS4 A;  5LLI A;  1EWY C;  3QWZ B;  1NYQ A;  1AN8 A;  1EM7 A;  3DHG C;  4W9H A;  2RDH A;  1WYW B;  4G3X B;  1RLF A;  3WAO A;  2WNM A;  4HCP B;  4OZC A;  1F1H A;  4LJP B;  1QOB A;  1VD2 A;  2KXJ A;  4H2A A;  1XT9 B;  3RZF A;  1FD6 A;  3V6E B;  3RMK C;  2MH7 A;  2W9N A;  2L32 A;  4GDL B;  5GMV A;  1TY0 A;  1WX7 A;  2IO2 B;  1E0Z A;  1PYW D;  1WE7 A;  2WXN A;  2WXJ A;  2J0J A;  3AED B;  4BKS A;  5HI1 A;  5IA7 A;  2BPS A;  4TKN A;  4BOS C;  1N5X A;  2N1V A;  2NCN A;  5EE9 A;  1K52 A;  4HEA 1;  2BB5 A;  3IG3 A;  5EE1 A;  5AUI A;  1EWC A; 
#chains in the Genus database with same CATH homology
 1LM8 B;  3QCA A;  5BO4 B;  4W9E A;  5G2N A;  4GSW A;  2DHZ A;  4FJZ A;  1ZKH A;  1S1Q B;  3ZVV A;  2FCM A;  2MCN B;  3JYU A;  4G0N B;  4E71 A;  2DYO A;  3CMM B;  3QHT A;  3B0A A;  2J0K A;  2L8J A;  2MWS B;  5JHA A;  4AJY B;  3DVG Y;  1PQS A;  4LDT D;  1OEY J;  2NPT A;  3KH0 A;  1C3T A;  4ZRJ A;  1RFA A;  1JRU A;  2MX2 A;  2KHW B;  1BT0 A;  1P3Q U;  4RM8 A;  3APD A;  1E8W A;  4DBG A;  5D2M B;  4AWJ A;  2K6D B;  2LI5 A;  5E6O A;  1E8Y A;  3H7S A;  4WWO A;  2D07 B;  1WXV A;  3KYC D;  3L08 A;  3QC8 B;  2IO1 B;  4N9F 4;  1TBE A;  2Z0E B;  3RCZ A;  3D32 A;  1XD3 B;  2DYM A;  3L54 A;  4BBN C;  1V6E A;  4RMA A;  2QHO A;  1Y8R C;  4A3P A;  4I6P A;  4IM3 A;  4KVG B;  4FHK A;  4NJ7 A;  2ZVN A;  3K9O B;  4PYZ A;  2NPT B;  2ASQ A;  4M8M A;  2MRP A;  1A5R A;  1GG3 A;  2XBB C;  4K7S A;  4BKS D;  3AUL A;  1UEL A;  4ANX A;  3OLM D;  3VH3 B;  2R2Q A;  2EMT A;  4NQL B;  2ZCC A;  2CHW A;  3IHP C;  2KMC A;  3Q3J A;  2OOB B;  2JZZ A;  1F9J A;  3KUD B;  3WAL A;  2AWT A;  1LXD A;  2XEW A;  3NS8 A;  3VFK A;  2Y5B B;  3PV1 A;  2KMA A;  2M8S A;  3PPA A;  2GBR A;  2EMS A;  3UIP B;  5AEK B;  2MBQ A;  1J0G A;  2RR9 A;  3L0W B;  2FCQ A;  4DHZ B;  5LXI B;  1Q5W B;  4PS8 A;  4FN2 A;  1GUA B;  1P9D U;  3UQB A;  4KZ0 A;  4FAD A;  2MBE A;  2KTF A;  3DVN V;  3NZS A;  2PJH A;  2K8H A;  2KWV B;  1J19 A;  2DZK A;  2YVC A;  4WAA A;  2O6V D;  2KDE B;  1P98 A;  5DPS A;  1WJN A;  3V62 A;  1WF9 A;  1WRD B;  2OJR A;  4F1S A;  2PE6 B;  2BYF A;  3A4R A;  4F8C B;  3BIN A;  1AAR A;  4JQW C;  2IY0 B;  3GOE A;  3PS6 A;  4NNJ B;  5DCN A;  2BF8 B;  2PEA A;  2LZ6 A;  2KWC A;  3LDZ E;  4NAW A;  3RYT A;  1D3Z A;  4XC2 A;  2KWU B;  1WJU A;  2FNJ B;  1GC6 A;  2A5U A;  2ZEQ A;  2ZZP B;  4MDK E;  1R4M I;  3R3M A;  2IO3 B;  2IO0 B;  3Q3F A;  1U4A A;  3AU4 A;  4M0W B;  3R7R A;  2DZI A;  2N4F A;  4GDK B;  2KFK B;  1Q1O A;  5L95 C;  3ML8 A;  3QIJ A;  3TCA A;  4E3C A;  1CMX B;  3N32 A;  1GNU A;  4MJS A;  2PE9 A;  5JH5 C;  3K9P B;  2M1M A;  3PTF C;  5J17 A;  2ZJD A;  3R66 C;  4HVB A;  2JXX A;  4HPL B;  1UBI A;  4MEL A;  2N7D A;  2XK5 A;  3NOB A;  3QAQ A;  3VH4 B;  4CYE A;  5CTR C;  2KKC A;  2JWZ A;  4K7U A;  2K1F A;  2MP2 A;  3HM3 A;  2KO3 A;  4JL9 A;  1IYF A;  3ZKJ C;  2NBU A;  2G4D B;  2KAN A;  3DOW A;  1P0R A;  3VUW A;  1XQQ A;  2KJH B;  2KJR A;  4ZRI A;  3QQ8 B;  4ZRK A;  4KZC A;  4MJS B;  1T0Y A;  1UBQ A;  3RUI B;  2ZNV C;  5JZE B;  3ZIM A;  3DVG X;  1V2Y A;  1SE9 A;  5DPR A;  3CF6 E;  3VXW A;  4MM3 A;  4AOF A;  4FBJ B;  1R4N I;  2C60 A;  3H9D A;  3PRZ A;  3V61 A;  1YX5 B;  4LDT B;  4OVU A;  1Z2M A;  3R7Q A;  2KNB A;  2BGF A;  2KJ6 A;  2ZCB A;  4ASW C;  4BBN F;  4IM2 A;  1WJ6 A;  4EOY A;  1KM7 A;  1I42 A;  2MSE D;  2LWP A;  3UIO B;  2ZNV B;  4ANV A;  4CO7 A;  2KTR A;  1RAX A;  3A1Q B;  3PSE B;  1X1M A;  4BKT A;  4DDI D;  3AU5 A;  2CHZ A;  3QK0 A;  2WX1 A;  3EFU A;  4WWP A;  3OJ4 B;  1EO6 A;  2LRU A;  1V9J A;  4NJ6 A;  4GDL A;  4WJQ A;  4W9G A;  2KLC A;  3VTW A;  3QJZ A;  4MGY E;  2ZPN A;  1TZ1 A;  2LVO A;  1IPG A;  5D94 A;  1ZGU B;  5E6N A;  4FJY A;  4XX5 A;  2D11 A;  2MP2 B;  1WR1 A;  2IZV B;  3ZRC A;  1SGH A;  4RM9 A;  1ZW7 A;  3PLV A;  2NR2 A;  4EKU A;  4EUT A;  2JRH A;  3DDC B;  4I6N B;  2KK8 A;  4WJP A;  3SD5 A;  3UIN B;  5HKH A;  4HJK A;  4FHJ A;  2MW5 A;  1UD7 A;  3IVF A;  4MSQ B;  4LCD E;  4EFO A;  3U30 A;  4EZK A;  4DHZ E;  3TL5 A;  3ZDT A;  1G6J A;  4G50 A;  1WX9 A;  2G4S A;  2UYZ B;  1WI0 A;  5CHV C;  3M3J A;  4HPM B;  1V5O A;  1KLV A;  4IUM B;  3WAP A;  1ISN A;  4ICV A;  1L2N A;  2L05 A;  2BYV E;  2KX0 A;  2MBO A;  2KVR A;  3DBL I;  2DZJ A;  2IY1 B;  2KD0 A;  3IBE A;  2B3A A;  1YIW A;  2JT4 B;  3S2A A;  3RT3 B;  2L76 A;  5JHB A;  2N1W A;  3A9J A;  2JY6 A;  1WFY A;  1OGW A;  5J18 A;  3WIM A;  4TUU A;  2HE7 A;  5KHO A;  3JVZ X;  2BWE S;  3JW0 X;  3QX1 A;  1H8C A;  3PGE A;  2Z59 B;  5D7G A;  3BY4 B;  1IP9 A;  3ZNZ B;  1FXT B;  3H7P A;  3OJ3 A;  4KDL B;  3ZNI D;  1TTN A;  4KIK A;  1E8X A;  5E6P A;  2NBW B;  1EF1 A;  4GIV A;  5TR5 A;  1P1A A;  1WY8 A;  1OTR B;  2BWF A;  2K39 A;  3VTU A;  2BKR B;  2LVQ A;  4FUL A;  4CHK A;  4ICU A;  3MHS D;  3DBR I;  2L0T A;  2O6V B;  1V80 A;  2M0X A;  4MGZ E;  3UQA A;  2C7M B;  1V5T A;  3EEC A;  3DQV A;  1YD8 U;  3VVW B;  2KDF B;  1GC7 A;  1WXM A;  2KQS A;  4JGH B;  3L17 A;  2MBH A;  2CS4 A;  3PHW B;  4A3O A;  3PT2 B;  4DHJ B;  4PS3 A;  2GBK A;  2LXA A;  4TQ0 A;  2MLB A;  4GXB A;  5CHW A;  3A9K B;  2KDI A;  2RSU A;  3DPD A;  1WGY A;  2IYD B;  4DWF A;  2DAF A;  2KC2 A;  2R2O A;  3SU8 X;  5DPW A;  2C9W B;  4W9C A;  1L7Y A;  3GZN I;  1OQY A;  3IFW B;  3TJP A;  2K6Q A;  4IC7 B;  4WQO B;  2K25 A;  3EC8 A;  5FR6 A;  3KW5 B;  4W9L A;  5CX3 A;  3U7D A;  3WAM A;  4GOC A;  1J8C A;  3APC A;  2CKH B;  1E90 A;  4B6W A;  4TQ1 A;  1E7V A;  3ALB A;  3JSV A;  1S3S G;  1VCB A;  4GGQ A;  3EHV A;  3W1Y A;  3ZNH B;  3PRP B;  1SIF A;  4MSM B;  2WWZ A;  2PPH A;  2JUO A;  5J2R A;  2LGX A;  1WM2 A;  4MGK E;  2D2Q A;  2CU1 A;  4F7Z A;  3ZW3 A;  3ZRF A;  3U8Z A;  3WA0 A;  3T9L A;  3NHE B;  2GMI C;  3VTV A;  2J7Q B;  3O65 B;  1WR6 E;  3VDZ A;  2JRI B;  4FJV B;  2K8C A;  3C0R B;  4GMV A;  4W9F A;  3VUY A;  2WX0 A;  1V49 A;  1TGZ B;  2O6V A;  4HXD A;  4X57 B;  2RPQ A;  3JSV B;  4GDK A;  2FCN A;  2LAS A;  3ENE A;  2KN5 A;  2UWQ A;  2JVC A;  2N9X A;  4KSL C;  3ZTC A;  3VQI A;  4E74 A;  5L83 A;  2BKF A;  3KUC B;  4K1R B;  2LGD A;  2KQ7 A;  1Z5S B;  2KDB A;  2M17 A;  2LGY A;  3QA8 A;  1WGR A;  2LRW A;  1M94 A;  5EDS A;  2D10 A;  1Q0W B;  2O2V B;  5AZF A;  2A4Z A;  3MJW A;  2G3Q B;  2CR5 A;  2YLM A;  2IBI B;  2FID A;  2HTH A;  3PVL A;  3AXC A;  4IM0 A;  3T8M A;  3M62 B;  2LUE A;  1YJ1 A;  3B1L X;  2LXC A;  4B9K A;  2AL3 A;  2N7E A;  3KUZ A;  3VAW A;  2FUH B;  3DVN U;  3OAW A;  3H7P B;  3H6N A;  4EZL A;  1WXS A;  2REX A;  2RD0 A;  1UZX B;  3V60 A;  3V6C B;  3L16 A;  1QZE A;  4II2 B;  1YQB A;  4MGI E;  3H1U A;  3ZUN A;  1NBF C;  2DYB A;  3ML9 A;  3X0W A;  1V86 A;  3TMP B;  4GB9 A;  1V81 A;  1EUV B;  1YX6 B;  4WJO A;  4WJN A;  1K8R B;  4AP4 C;  2KZR A;  3PRM B;  2LJ5 A;  2C5L C;  2KOX A;  2WYQ A;  4MEM A;  3ZLZ A;  3CSF A;  3KYD D;  4XZ4 A;  1WGD A;  2C7N B;  2N9P C;  1WGH A;  4J6I A;  3ZDM C;  2MBB B;  2Z0D B;  2L7R A;  2ZPY A;  2LD9 A;  3A4S C;  3A1Q A;  4IWO A;  3NZU A;  3A9K A;  5D6J B;  3TIX A;  4URK A;  1E8Z A;  3DBH I;  3QAR A;  4W9D A;  1HE8 A;  2NBV B;  2V4L A;  3AI5 A;  4W9J A;  2M4N A;  4NAW B;  1UGM A;  4II3 B;  1I35 A;  1EF5 A;  2L00 B;  3ZO5 B;  2O2V A;  2N9E B;  2JPH A;  4IW0 A;  4PYU A;  4GU2 A;  4FLH A;  1WE6 A;  4G11 A;  2KLG A;  4EEW A;  3PRE A;  2GBN A;  1LFD A;  4PS7 A;  5LXH A;  4IG7 B;  1E5W A;  2MQJ A;  2NVU I;  3RD2 A;  2LVP A;  3UGB B;  4BFR A;  1WMH B;  1WM3 A;  2EKE C;  2RGF A;  1WZ3 A;  3VHT C;  3HIZ A;  1NDD A;  3PLU A;  4P7I A;  4KV2 A;  4OVV A;  3UF8 A;  3W1S C;  2WDT B;  2L0F A;  2FCS A;  4TV3 A;  2G45 B;  3W1S A;  4WWN A;  3KVF B;  3HK0 A;  4HDO A;  5DPT A;  3SDL C;  1LQB A;  1WXA A;  4HK2 A;  4ANU A;  1WX8 A;  3I3T B;  2KFJ A;  5AZH A;  1WIA A;  4HDQ A;  4HWI B;  4DDG D;  4ZDV A;  4M8N A;  5IAA C;  2JF5 A;  3SHQ A;  3N3K B;  2MA9 B;  3PZD A;  2DEN B;  3M63 B;  2AL6 A;  3N30 A;  3NY5 A;  4ZYN A;  4AJW A;  2J0M A;  2D3G A;  4BOZ B;  4NQK E;  5LLI A;  4AUQ C;  2K8B A;  3QWZ B;  3RZW C;  4KSK C;  2KC1 A;  3DBS A;  1RRB A;  4W9H A;  2I1K A;  3P2B A;  4DHJ D;  3PHX B;  2NS5 A;  4NY0 A;  1MG8 A;  1WYW B;  3B08 A;  3X23 A;  1WZ0 A;  4G3X B;  1RLF A;  4BKG A;  3ONS A;  1H4R A;  4K81 A;  3A9J B;  3TBL D;  3WAO A;  5C1Z A;  2I1J A;  1NI2 A;  4HCP B;  1C1Y B;  5AZG A;  2DAJ A;  4A20 A;  2KFK A;  4LJP B;  3HHM A;  1VD2 A;  2KXJ A;  4IWP A;  2DX5 B;  4W9I A;  1KOT A;  2KTR B;  1XT9 B;  2DZM A;  3L13 A;  4IWQ A;  4JIO U;  2AYO B;  3RUL A;  3RZF A;  3V6E B;  3ECI A;  5C23 A;  4FA6 A;  3ZTD A;  3ZNG C;  4BVU C;  2ZVO A;  2HD5 B;  4DXA B;  2KX3 A;  2XK5 B;  1E7U A;  2W9N A;  2VRR B;  4W9K A;  3APF A;  5KHQ A;  4GDL B;  4K7W A;  4B95 A;  5GMV A;  4EZJ A;  2V1Y A;  4MH0 E;  1WX7 A;  5G55 A;  2IO2 B;  4ANW A;  1WE7 A;  2HJ8 A;  4KIK B;  4HCN B;  4HLE A;  2L3Z A;  2J0J A;  1OEY A;  4BKS A;  5IA7 A;  5CHF A;  1WH3 A;  2GOW A;  4GN1 A;  4DK5 A;  1GJZ A;  2GBJ A;  2BPS A;  3L10 B;  3CST A;  2BYE A;  4KDI C;  4TKN A;  4BOS C;  1UH6 A;  3LJ3 A;  1KJT A;  4LJO B;  2N1V A;  3VUX A;  2C7H A;  1WGG A;  2AEH A;  2NCN A;  4NPN A;  3M95 A;  2CHX A;  3HM6 X;  3MTN B;  2FIF A;  3DCG A;  2GBM A;  4I6L B;  4YL8 A;  2JZ3 B;  2FAZ A;  3IG3 A;  1WJ4 A;  1WMH A;  3WAN A;  4JLC A;  3A33 B;  2V3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...