3Q3JA

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
111
structure length
102
Chain Sequence
LIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKQRPRAVDMDLEWRQGRIARVVLQDEDITTKIKRLNTLMHYQVSDRSVVALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
molecule keywords Plexin-A2
total genus 23
structure length 102
sequence length 111
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3q3jA00
4EZJA 2ZCCA 3ZUNA 2NPTB 3L10B 1NBFC 1S1QB 2BKRB 2PEAA 2WX0A 5DPTA 3R7QA 2KOXA 3QA8A 3WANA 2NBWB 4OVVA 4YL8A 2M1MA 4AUQC 5DPWA 3H7PA 3PZDA 3QQ8B 3VH3B 4BVUC 2KDBA 5DCNA 1E8WA 3PTFC 3PVLA 3L54A 4IG7B 2L3ZA 2O6VD 2DENB 2KFJA 2IO0B 2D07B 1TTNA 4AP4C 1YIWA 3CMMB 5LLIA 1V2YA 4BKGA 2WWZA 4NQLB 2MBOA 2KWUB 3Q3JA 2KZRA 2N4FA 3RUIB 2N9EB 1D3ZA 2DZMA 3M63B 2RSUA 3ONSA 2EMTA 4I6NB 3L0WB 2JVCA 4AJYB 1IPGA 4FULA 4GB9A 1EF1A 1GG3A 2N1VA 2D2QA 3PREA 4NAWB 4W9JA 2L0FA 3ZRFA 4LJPB 4BBNC 3RCZA 4N9F4 2LWPA 4W9LA 2LGXA 2GMIC 1OQYA 2XK5B 2OJRA 2RD0A 3RZFA 2KJHB 4TQ1A 1V49A 1JRUA 4DHZB 2Z0DB 1V9JA 2REXA 4GDKA 5KHOA 3A33B 3MJWA 1VCBA 2HD5B 4FN2A 3V61A 2V4LA 4K1RB 2FIDA 1WFYA 2HTHA 2LXCA 3AU5A 4GOCA 4NPNA 5FR6A 5GMVA 1LFDA 2FIFA 1UD7A 2GBMA 1WX9A 3NOBA 2JXXA 2ZPYA 1I42A 2KC1A 3JSVB 3PHWB 1S3SG 4IW0A 3RYTA 4B95A 1YX6B 2NBUA 1KM7A 4FHKA 2KLCA 4G0NB 1UGMA 2ZPNA 4URKA 2LVPA 2O6VB 1V80A 3SD5A 3APCA 3H7PB 1KLVA 2KVRA 3VFKA 1M94A 4EFOA 5CHFA 2BYEA 2DAFA 2K6DB 4II2B 4RM8A 4ZRJA 4K81A 3RZWC 4NY0A 5TR5A 4ASWC 4K7SA 2NBVB 3UQAA 3JSVA 1YJ1A 1WJ4A 2KKCA 2KO3A 4KIKA 1HE8A 4G11A 3IVFA 4G3XB 1ZW7A 3RD2A 3UQBA 2A4ZA 1U4AA 3W1SA 4DHZE 1V86A 2HE7A 4G50A 2W9NA 3ZW3A 3PT2B 3UGBB 2A5UA 1L2NA 3A1QB 4GU2A 2ZVOA 3MHSD 4BFRA 1P1AA 4PYZA 4NJ7A 1RFAA 5E6NA 3JYUA 5BO4B 4J6IA 5AZFA 4BKTA 3DDCB 4DXAB 1G6JA 2KFKB 1WY8A 3R3MA 3CF6E 3ALBA 3TJPA 3VDZA 1MG8A 1P9DU 4A3OA 1WJUA 1XD3B 2KXJA 4HLEA 1I35A 2N7EA 4GDKB 4GSWA 1H4RA 4XZ4A 3TMPB 5DPSA 3APFA 2WYQA 4WWNA 4IM2A 1WXSA 3ZNZB 4AOFA 4RM9A 2CHWA 2KDIA 3A1QA 4GDLB 1XT9B 4HDOA 4FBJB 2FCMA 2C60A 4JIOU 2BF8B 1WXAA 1V5OA 2R2OA 3AXCA 5C23A 4EZLA 3PV1A 2XEWA 4GIVA 2L0TA 1WGDA 4HDQA 2G4DB 2Z59B 4JQWC 5E6PA 1OTRB 1IYFA 1EUVB 2KK8A 4ZRIA 1WM2A 4IWPA 3DVNV 3S2AA 1WXMA 3KYDD 4FJVB 4M8MA 4IWOA 3N30A 1VD2A 3JW0X 3ECIA 4II3B 3VQIA 1P0RA 4KDIC 4WWPA 3DVGY 3IFWB 4EUTA 1E8YA 3EHVA 1WGRA 3KH0A 1TGZB 4MELA 4MH0E 3VTVA 2BPSA 1YD8U 1C1YB 4E74A 1WJ6A 3QWZB 2KQ7A 1WH3A 2Y5BB 1WZ3A 3HK0A 5LXIB 4ZRKA 4JLCA 1WJNA 1GC7A 1ZGUB 5JHAA 2L7RA 3AI5A 2QHOA 2LRUA 3B1LX 2KWCA 4KDLB 3KW5B 4TV3A 2JPHA 4IWQA 3R7RA 3ZDTA 3PRMB 2BGFA 1T0YA 2RPQA 2MW5A 2D11A 3DPDA 2ZVNA 5G55A 2C7MB 2KTRB 3HM6X 1PQSA 3K9PB 4HCPB 4K7UA 2MRPA 3ZNGC 1SGHA 3L13A 4B9KA 3DOWA 4GDLA 3ZO5B 2GOWA 2AWTA 1V81A 3K9OB 2KJ6A 4BOSC 3GOEA 4CHKA 4AJWA 1WGHA 2N1WA 2J0JA 3M3JA 4GN1A 2L05A 4KSKC 2ZCBA 2MLBA 3QHTA 2JT4B 3BINA 3V6EB 3TL5A 2N9PC 3BY4B 2KQSA 3A4RA 4W9CA 3UINB 4CYEA 2MBBB 4E3CA 2LXAA 1J0GA 3TIXA 5CTRC 3IG3A 4WWOA 4TQ0A 3B0AA 4DBGA 1K8RB 2MSED 4BKSA 5JZEB 3TBLD 4B6WA 1GNUA 1QZEA 3EECA 5D7GA 2D3GA 3KUCB 2K8HA 4PYUA 3ZNHB 1BT0A 1YQBA 3LJ3A 4GGQA 3PRZA 3H1UA 5EDSA 2DHZA 1UELA 3VHTC 1WM3A 3ML9A 5HKHA 3DBSA 3ZIMA 2YVCA 1GC6A 4X57B 4WJQA 2LASA 3WIMA 1V6EA 2DZIA 3EFUA 5G2NA 4EEWA 1H8CA 4ANVA 3B08A 1WYWB 3NS8A 3VXWA 2IZVB 3L08A 2L00B 5JHBA 4PS8A 1E90A 4IC7B 5IA7A 1WX7A 5CHWA 4JGHB 1RRBA 3GZNI 4F8CB 2CU1A 2M4NA 2JUOA 1V5TA 1WE7A 3ENEA 4RMAA 2IBIB 4P7IA 3WAPA 4BOZB 5AEKB 2LVQA 5J18A 3PS6A 3WAOA 1RLFA 2IYDB 5AZGA 4AWJA 4FA6A 2ASQA 4MGYE 4W9HA 1Z5SB 4MSMB 2AL6A 3AU4A 2C5LC 3UIPB 3PGEA 2N9XA 1YX5B 1P3QU 4EOYA 1WR1A 4HJKA 4DK5A 4MM3A 3VTUA 3WALA 4EKUA 4IM3A 4MGIE 3L16A 3A9KA 4LDTD 5CX3A 2FUHB 1Q1OA 3QIJA 2MBQA 3H7SA 4KZ0A 5C1ZA 3X23A 2V3SA 1GJZA 4HPLB 4WJNA 2C7HA 2M0XA 2NCNA 4E71A 2IY0B 2K39A 1NDDA 1EO6A 2KX0A 4OVUA 1SE9A 1GUAB 2KDEB 4WJPA 3ZRCA 2D10A 1ZKHA 4NAWA 2KX3A 4W9EA 1TBEA 4KV2A 1Z2MA 1J8CA 2CKHB 1WF9A 2C9WB 2MA9B 4LCDE 4HWIB 1E7UA 2KMAA 5J17A 2KTFA 3RT3B 5JH5C 1WRDB 3QX1A 5LXHA 3DCGA 3A9KB 3NZSA 2CS4A 2MWSB 2N7DA 4W9DA 4K7WA 2DX5B 2IO1B 3TCAA 2DAJA 2PE6B 4BKSD 4LDTB 3IBEA 2GBRA 3ZNID 3PSEB 2J7QB 1E8XA 1OEYA 3O65B 3VH4B 2KANA 2B3AA 2M17A 2KC2A 5CHVC 3CSTA 1E7VA 3VAWA 2CR5A 3H9DA 4ICUA 2LI5A 2JZ3B 1FXTB 4EZKA 5KHQA 4ZYNA 1EF5A 3PRPB 3WAMA 3LDZE 2NR2A 2IY1B 1Q5WB 2O2VB 2BWES 2K8BA 1C3TA 4NQKE 3U30A 2KDFB 3L17A 4DWFA 1F9JA 3PLUA 2ZNVB 1TZ1A 3DBLI 2PPHA 5J2RA 4KIKB 1CMXB 2IO2B 4HCNB 3U7DA 3VVWB 1UZXB 1WR6E 2IO3B 3DBHI 4NNJB 1RAXA 2WX1A 2K6QA 4PS3A 4ANWA 3HIZA 1IP9A 3VUXA 3VUWA 3APDA 3N3KB 4ZDVA 2XBBC 3U8ZA 3HHMA 3R66C 3VUYA 4GXBA 1UH6A 4MEMA 5AZHA 3KUDB 3PLVA 2DZJA 4W9GA 3UF8A 3PPAA 2AEHA 2ZNVC 2JRIB 4DDID 2UYZB 3A9JB 4LJOB 1NI2A 3M95A 3SDLC 2GBJA 3W1SC 1Y8RC 2KTRA 3QJZA 3V60A 2KFKA 2LJ5A 5L83A 2HJ8A 2KD0A 2ZEQA 2O6VA 3M62B 4M8NA 4ICVA 3H6NA 1WX8A 1KOTA 4HK2A 5D6JB 3PHXB 4MDKE 3T8MA 3SHQA 5IAAC 2GBKA 3DQVA 2LUEA 1LQBA 4I6PA 3JVZX 3Q3FA 2C7NB 2I1JA 1SIFA 2LRWA 2M8SA 1WGGA 3NHEB 2RR9A 3N32A 1WMHA 2GBNA 4WQOB 3QCAA 2BKFA 4DDGD 2OOBB 2FCQA 3ZVVA 4DHJD 2LD9A 4W9KA 4IUMB 3MTNB 2NPTA 2CHXA 2JRHA 4M0WB 4WJOA 1E5WA 2BYVE 2KLGA 2L76A 2KN5A 2L8JA 2FNJB 4HXDA 4KVGB 2G4SA 1OGWA 4A20A 1R4MI 2MP2A 4F1SA 2JZZA 4MGKE 2K25A 2MBHA 1WGYA 5L95C 2BYFA 2KHWB 3D32A 3WA0A 1LM8B 3NZUA 4KZCA 4XC2A 4FLHA 1Q0WB 2R2QA 3V6CB 3VTWA 1WIAA 5DPRA 2MX2A 3QK0A 3P2BA 1ISNA 2ZZPB 3C0RB 4TUUA 1A5RA 4IM0A 3DVGX 1KJTA 4HPMB 4PS7A 3OLMD 3I3TB 2PJHA 2FAZA 2MP2B 4I6LB 1X1MA 2BWFA 2RGFA 3EC8A 2DYMA 2LVOA 3A9JA 4FJZA 3RULA 2J0KA 2UWQA 2NS5A 3QC8B 2KMCA 1UBIA 2O2VA 4HVBA 1UBQA 5D94A 4XX5A 4MSQB 4TKNA 3OJ3A 3ZTDA 2VRRB 2EMSA 4MJSB 1LXDA 4ANUA 2FCNA 2AYOB 2XK5A 5E6OA 2LGDA 2MQJA 2G45B 3ML8A 2NVUI 2V1YA 3ZLZA 2DYBA 3X0WA 2KJRA 3QARA 3SU8X 2J0MA 4FHJA 2LGYA 2DYOA 3UIOB 3ZDMC 1J19A 2PE9A 1P98A 1AARA 2JWZA 2KWVB 1XQQA 2EKEC 1OEYJ 2MBEA 3V62A 4W9IA 2MCNB 1R4NI 2FCSA 3KVFB 2G3QB 2DZKA 3OJ4B 3QAQA 1WI0A 2AL3A 3T9LA 3DVNU 3KYCD 4JL9A 1E8ZA 1WZ0A 4CO7A 2JY6A 2JF5A 4MGZE 4W9FA 2YLMA 3A4SC 2Z0EB 4WAAA 3W1YA 3HM3A 4F7ZA 4FADA 1WE6A 4BBNF 2KNBA 2I1KA 3ZTCA 2ZJDA 3DBRI 3OAWA 3IHPC 4DHJB 2WDTB 3ZKJC 1WMHB 3KUZA 4A3PA 1L7YA 4MJSA 3CSFA 2K8CA 4GMVA 4KSLC 5D2MB 4ANXA 2K1FA 1WXVA 3AULA 4NJ6A 2CHZA 4FJYA 3NY5A 2LZ6A
chains in the Genus database with same CATH superfamily
4EZJA 2ZCCA 3T3OA 3L10B 1NBFC 2PEAA 2KOXA 3LB8C 1OQQA 1UUPA 3NZ3A 4ZHPA 4BVUC 2HJ1A 3PTFC 2DENB 2IO0B 3DWGC 1QILA 1VJKA 1V2YA 2INDC 2WP9B 4ZYSA 2IDYA 4NQLB 3Q3JA 1R7SA 1D6EC 2WXRA 2N9EB 3M63B 3NJTA 3L4PA 4AJYB 1GG3A 4XDCA 2LEKA 1C79A 2WXPA 4W9JA 2WXHA 4LJPB 3RCZA 4W9LA 2LGXA 2GMIC 2XK5B 3RNCC 2BS3B 1F52A 4TQ1A 3AN1A 5KHOA 3A33B 1G6JA 4GOCA 1WFYA 5FR6A 1SB3C 2ONQA 2ZPYA 2KC1A 3PHWB 4B95A 4M0WA 2NBUA 1UGMA 4IKGA 3AM9A 2KVRA 1M94A 2AX5A 2DAFA 2K6DB 5FKAC 1ENFA 3RZWC 1TZOA 2Y5CA 4KIKA 1YNTE 3AEDB 3IVFA 3KLSX 4MACA 3UQBA 1FFVA 1U4AA 3AEGB 1D4BA 1E9MA 2G1EA 2WXLA 1FXAA 4NJ7A 1RFAA 4BKTA 1UGJA 1XLPA 2BTEA 1N62A 3ALBA 3CF6E 3TJPA 1MG8A 4HLEA 4CQNA 1I35A 2KXJA 4GDKB 4GSWA 3TSSA 4XZ4A 3AB5A 3U4EG 4IM2A 3NVVA 3HRDD 3EGRA 3AE8B 1C4AA 1MG4A 1VRAB 4FBJB 2C60A 3AH7A 4A90A 2BB5A 1NYQA 4EZLA 2WXGA 1WGDA 1ZXHA 1OTRB 2D3CA 4IWPA 3KYDD 1TS3A 2GLSA 3VQIA 1QKZA 4KDIC 1LO5D 5G5HA 3EHVA 1WGRA 4M00A 1SE4A 4WURA 4MH0E 5EE3A 2QILA 1FD6A 1C1YB 1V8CA 1SEBD 1XCQL 1ZXIA 1GC7A 1ZGUB 2L7RA 2Y3AA 2QHOA 3B1LX 3KW5B 4YT0B 2QCZA 1T0YA 3VRBB 3ZXVA 2D11A 3W5VB 1L0VB 3HM6X 4HCPB 4OHJA 1PUTA 1BUIC 2WXJA 4GDLA 3P4RB 5IOIA 4HKQA 3HVDA 4AJWA 2N1WA 3AMZA 3IT4B 2KQSA 3P4SB 5CTRC 4DBGA 4OVZA 3EECA 2D3GA 2INPE 2K8HA 1K51A 3ZNHB 4GGQA 3H1UA 1YMHE 2DHZA 3AE5B 1WM3A 1GPXA 3DBSA 1VLBA 3ZIMA 4C4VA 5G2NA 3VXWA 2L00B 1TY2A 1FRRA 5CHWA 1RRBA 2ON8A 2CU1A 2M4NA 2JUOA 1V5TA 4RMAA 1R4NB 4P7IA 5AEKB 2LVQA 3T3NA 2INCC 3RMKC 4AWJA 2PTLA 1ZUD2 4NZLB 1T0SC 1Z5SB 2AL6A 3AU4A 2QIEB 1CK1A 1VDVA 1I7HA 4EKUA 3A9KA 5CX3A 1Q1OA 2JSVX 2MBQA 3RNEC 2NCNA 3FKYA 3RI7C 3NUHB 4E71A 2J52A 2KX0A 4OVUA 4WJPA 4NAWA 4W9EA 4KGRA 2MA9B 2BB6A 5FR3A 1E7UA 4A6QA 2LJIA 2IJ0A 2MH7A 1TIFA 3A9KB 3AE7B 1EWCA 4K7WA 4LDTB 5E6JA 2BVCA 2N9KA 1JRPA 3O65B 3VH4B 2KANA 3VAWA 3H9DA 3SFDB 2LI5A 2M0AA 1FXTB 4ZYNA 1BXTA 3FC4A 2NR2A 2BWES 1XLOA 2WHIA 3L17A 4DWFA 2PPHA 2IO2B 3HVZA 2IO3B 3DBHI 4ANWA 1F77A 1ZDXA 2XBBC 2JX5A 4KGTA 1I4PA 2JRIB 4RF1A 1J7CA 1NI2A 3M95A 2LGIA 3SDLC 2GBJA 3QJZA 1C4PA 2MJDA 2KD0A 3M62B 2ZW0A 3DHHC 3H6NA 1R4MB 1QT9A 4DXGA 3B2FA 4RGMA 3JVZX 1SIFA 2J42A 2W54A 2M8SA 1WGGA 2OOBB 4IUMB 2JRHA 2L76A 2KN5A 2L8JA 1GAQB 5IKCM 2JZZA 3WA0A 2J53A 3NZUA 2I38A 4REZA 2H89B 4P16A 1WIAA 2WQYB 1N6ZA 2FAZA 2INNE 4I6LB 1X1MA 3A9JA 4FJZA 3VR8B 3FILB 2O2VA 4HVBA 4MSQB 3ZTDA 1DGJA 4ANUA 4MJSB 1MHHE 1LXDA 1NENB 3CIRB 4MM3B 2NVUI 2V1YA 2KJRA 3QARA 2J0MA 3P63A 2D3AA 3UIOB 3ZDMC 2JWZA 2KWVB 1E6EB 5BYRA 1VZ7A 4W9IA 1XEEA 1R4NI 3KVFB 2DZKA 2K0PA 4JL9A 2WU2B 2R61A 3AE3B 2JY6A 2JF5A 4A55A 2Z0EB 1JMLA 3HM3A 1WE6A 4BBNF 3OAWA 2B76B 3MJ5A 3IHPC 4C56C 2N9LA 3KUZA 1L7YA 3B2GA 5D2MB 3E9SA 1WXQA 4FJYA 5I4DA 4N6EB 2LZ6A 2JQRB 2BKRB 5DPTA 3R7QA 3WANA 4YL8A 4AUQC 3N1YC 5DPWA 2KDBA 1L6UA 1E8WA 4IG7B 3L54A 2O6VD 2X38A 5BYSA 4ZRPA 4AP4C 2WXQA 3BVMA 3DBRB 3MC0B 3IT6B 2KZRA 2DZMA 3L0WB 1IPGA 4GB9A 1EF1A 2N1VA 2D2QA 3PREA 2ACZB 4BBNC 2LWPA 1OQYA 2OJRA 1QOFA 2KJHB 1V9JA 2REXA 3ZQ4A 1VCBA 4YWGG 5BYQA 5GMVA 4NPNA 1LFDA 3KQ4A 2GBMA 1WX9A 1I42A 3JSVB 1S3SG 3RYTA 1YX6B 4FHKA 3MC8A 4URKA 4G0NB 2ZPNA 2LVPA 3VFKA 1LGRA 2BYEA 4ZRJA 1ZDVA 4NY0A 5TR5A 4K7SA 3UQAA 4C80A 1YJ1A 2KKCA 2KO3A 2D3BA 4G3XB 1V86A 4G50A 2W9NA 5HG2A 3NS1A 2MHJA 2V9HA 4GU2A 5HHDG 2ZVOA 3MHSD 1UNSA 3GE8C 4BFRA 1N61A 5AUKA 2KACA 5E6NA 3JYUA 5BO4B 1OQRA 4J6IA 4DXAB 2KFKB 1KF6B 3OWEB 1XD3B 2WXNA 1WRIA 1QQRA 2D5GA 3APFA 1PFDA 2WYQA 1XO3A 2KT7A 1WXSA 3EA6A 2YEPB 2CHWA 2WS3B 1ESFA 1F2RC 4HDOA 3W9CB 2R2OA 1V5OA 3AXCA 3DHIC 2L0TA 4RGNA 1JCKB 1IYFA 1MI0A 2KK8A 4ZRIA 1DOYA 1WXMA 3GP7A 4L2YA 2K22A 4HEA1 2Q5WD 4IWOA 3GS2A 1CZPA 1VD2A 3JW0X 1P0RA 3P42A 2NMQA 1FO4A 2BPSA 2JYEA 1YD8U 4E74A 2IPKD 2W3RA 2KDMA 2KQ7A 3R2TA 1D5XC 4EE2A 1WZ3A 5LXIB 3DBLB 4YTNB 2CU3A 2WDVB 3R7RA 2RPQA 2WXMA 3DPDA 2C7MB 2V0GA 1PQSA 1SGHA 4HPPA 1KH0A 3L13A 4B9KA 1CJEA 4LNOA 1V81A 3K9OB 4BOSC 3TEXA 4CHKA 5BMIA 2RDBC 2J0JA 3AE9B 4KSKC 2W3SA 3QHTA 2JT4B 2N9PC 3UINB 4CYEA 1MVKA 1ET9A 4E3CA 3TIXA 3IG3A 4WWOA 2JU6X 2MSED 3TBLD 1QZEA 3KUCB 4WIPA 1FMAD 2XNAC 1BT0A 4USAA 3NRZA 3PRZA 2UU7A 3VHTC 3P4QB 2YVCA 4NJCA 4WJQA 3ZJVA 1AN8A 1FRDA 3WIMA 1V6EA 4B0MA 4EEWA 3B08A 3NS8A 1FNUA 2L52A 3L08A 4ZHOA 1YJJA 4IC7B 5G5GA 5IA7A 1GB1A 1N5XA 3GZNI 1I4RA 2IBIB 3WAPA 3ZYYX 4BOZB 1VZ6A 3AEAB 5AZGA 4FA6A 3PZ8A 1YX5B 1I4XA 1P3QU 1WR1A 4DK5A 5IO9A 2G9HD 3WALA 4AQ7A 4Q2JA 3L16A 4LDTD 4LK0M 3QIJA 4M02A 1N63A 3R8BA 3O13A 4YSXB 1EO6A 1SE9A 2D10A 1ZKHA 1FPYA 3BK1A 4S0RA 2WDRB 1J8CA 2CKHB 2C9WB 1NEKB 4HWIB 2KMAA 3AEFB 4PT5A 1DOXA 2WXOA 2KTFA 3RT3B 5LXHA 2LHEA 3DCGA 3NZSA 2CS4A 4W9DA 2L32A 1K52A 3U7ZA 2IO1B 2DAJA 2PE6B 3IBEA 2GI9A 2J7QB 4H2AA 3Q6BA 2M17A 2KC2A 1E7VA 2CR5A 1C9FA 1QF6A 5H92C 1EF5A 4OW0A 2JWUA 4JX1C 3U30A 1TZ1A 4KIKB 1CMXB 4HCNB 1UZXB 2LFIA 4R3DA 1QOAA 1IP9A 1RWSA 3N3KB 4P6VF 4ACFA 3I57A 3HHMA 4GXBA 1UH6A 2DZJA 4W9GA 1YN3A 2ZNVC 1VZ8A 2FUG1 4DDID 1TT5B 1OFFA 3W1SC 2RDGA 5L83A 1NYRA 3W2DA 4ICVA 1C78A 4GLSC 5D6JB 3PHXB 4MDKE 3SHQA 5IAAC 1SE3A 1TYGB 1LQBA 4I6PA 2C7NB 2I1JA 1JWSD 3NHEB 2GBNA 2BKFA 3VR9B 3ZVVA 4DHJD 3MTNB 2NPTA 5LNK1 3BYTB 1E5WA 2BYVE 2KLGA 4KVGB 1FNVA 1OGWA 1JWUD 5L95C 3D32A 1T3QA 1TY0A 3N9YC 1Q0WB 3VTWA 3V6CB 2MX2A 1F0ZA 2ZZPB 1A5RA 1KJTA 3I9V1 4PS7A 1PGBA 3OLMD 4JWSC 1MPEA 3BK2A 4XGAB 2BWFA 1L4DB 3EC8A 2DLBA 3AECB 2NS5A 5C2TB 3VRAB 5D94A 4TKNA 2EMSA 1ROEA 2FCNA 3ETRA 2LGDA 2CJNA 3ZLZA 2JZPA 1XXGA 4BAXA 3SU8X 5H8YE 2LGYA 4LTUA 1P98A 1C4CA 1XQQA 2EKEC 2MBEA 3GZNB 2G3QB 1FIQA 1L0XB 3T9LA 3KYCD 1E8ZA 2I2YA 4MGZE 1BMLC 3A4SC 3W1YA 4F7ZA 4RFBA 3LXFA 2KNBA 3W5UB 1WGKA 4XWTA 2ZJDA 1QOGA 4YSYB 4DHJB 2WDTB 3Q3OC 1JWAD 4KGSA 4MJSA 3CSFA 4OZBA 4ANXA 2XN9C 1P7EA 4NJ6A 2DNFA 3NY5A 2KVZA 2PW9A 3ZUNA 1S1QB 3QA8A 1UWMA 2NBWB 2PKOA 4S17A 3H7PA 3PZDA 1IGDA 1C77A 4LNFA 3VH3B 4A9AA 2Y5PA 3PVLA 2L3ZA 4N58A 2D07B 1TTNA 1YIWA 3CMMB 1K50A 2MBOA 2KWUB 5FK9C 3RUIB 5MPOA 1D3ZA 2DBYA 1EM7A 3ONSA 2EMTA 2JVCA 4FULA 3MP9A 1HEZE 1FFUA 2N0SB 1RFKA 3IXSA 4NAWB 4N9F4 4UDUC 3ZXRA 3BVZA 2RD0A 3RZFA 2GRIA 4DHZB 2Z0DB 3BWUD 4FN2A 2V4LA 2HTHA 3AE2B 1T5XD 1UD7A 2JXXA 4WWMA 3TEWA 3I5JC 4WQMA 2O6VB 3NVZA 1V97A 3APCA 1KLVA 1XLQA 5CHFA 2IGHA 4RM8A 4K81A 4ASWC 2NBVB 1FXIA 1SSNA 5EE9A 3OG5A 3RD2A 3BVGA 1GOZA 2A4ZA 2KAJA 1EU4A 3ZW3A 3PT2B 1L2NA 1SXTA 4LNNA 2WXKA 3EFCA 1EU3A 3DDCB 1WY8A 3R3MA 4A3OA 5C3JB 1P9DU 2N7EA 1DYQA 5DPSA 2JXTA 3Q3MC 3ZNZB 1D5ZC 2PMVA 2KDIA 4ITKA 1F1HA 5C23A 4HDQA 1QLBB 2G4DB 1EUVB 1WM2A 2Z8LA 3S2AA 4M8MA 3N30A 2PVGC 4II3B 2AQ2B 4C00A 1HQRD 2EKIA 3DVGY 4EUTA 4PK1A 2LUMA 1E8YA 3KH0A 3N1ZC 4MELA 2QEJC 3VTVA 4LNKA 3V3XA 4K3CA 4YSZB 1WJ6A 1WH3A 2Y5BB 3HK0A 4ARCA 2L83A 5JHAA 3AI5A 4C4VB 2LRUA 3ZDTA 1AYFA 2JPHA 3PRMB 2BGFA 4TSSA 2MW5A 2ZVNA 5G55A 3K9PB 2MRPA 2OHFA 4NAMA 4K3BA 3NVWA 2WLBA 2MEKA 1WYGA 3Q8FA 1PGXA 3P4PB 2KJ6A 1WGHA 3M3JA 2L05A 2ZCBA 1YQ3B 1QOBA 1SE2A 3TL5A 3TEYA 2KQ4X 4LLGM 3ZGZA 4KKIA 1J0GA 4JPSA 2OJWA 3AEEB 3DWMA 4B6WA 1GNUA 5D7GA 4PYUA 1T0RC 2WNMA 1PDXA 1YQBA 3LJ3A 3AV8A 2J4XA 5HKHA 3AE1B 2QC8A 4RNAA 3BYYB 2LASA 1WSPA 5JHBA 4PS8A 1JQ4A 1E90A 1WX7A 4JGHB 1WE7A 1Y56A 3ENEA 2IGDA 3PS6A 1I4QA 1RLFA 2NTSA 3WAOA 2PIAA 2ASQA 4MGYE 4W9HA 2C5LC 2RDHA 1SIJA 1UWXA 2N9XA 4EOYA 4HJKA 3Q8CA 4IM3A 2FUHB 1V1OA 1PYWD 3P1MA 4KZ0A 5C1ZA 4HPLB 1NDDA 3FILA 3Q8AA 1GUAB 1TBEA 4KV2A 1Z2MA 3GE3C 1WF9A 4LCDE 1ET6A 2VZKB 5J17A 5JH5C 1JWBD 1WRDB 3QX1A 4US8A 3AEBB 2AQ1B 3Q69A 2HDEA 4FXCA 3RNBC 1YOVB 5TSSA 1SJHD 3RNFC 3PSEB 2BW2A 2MJEA 5CHVC 1E0ZA 1IBXA 2LMCA 4ICUA 2WU5B 3PRPB 3WAMA 3LDZE 1V1PA 2PLPA 1HTQA 2IY1B 1UF0A 3Q8EA 3DBLI 4JWUC 4NNJB 2V3PA 4J3OD 3VUWA 3APDA 1ZOYB 1KTKA 3N20C 3U8ZA 4QAYA 3Q8BA 2N7JA 3UF8A 3ZJTA 5AUIA 2AEHA 4LJOB 1Y8RC 3V60A 2KFKA 2LJ5A 2ZEQA 1L0YB 2O6VA 4M8NA 1J7BA 1HXYD 1WX8A 1KOTA 3T8MA 4B0EA 3DQVA 3Q3FA 3FAHA 3N32A 2BQQA 1ZPSA 3QCAA 2FCQA 3Q3NC 2LD9A 2QSDA 4W9KA 2CHXA 2VH2A 4M0WB 2G4SA 4A20A 4F1SA 2MBHA 1WGYA 1C76A 2E3TA 2BYFA 1LM8B 5HI1A 4KZCA 4FLHA 2KMMA 1EWYC 5DPRA 3QK0A 3P2BA 4TUUA 1ISNA 3LYYA 3DVGX 3BZDB 2PJHA 2MP2B 2DYMA 2LVOA 5GXGB 1YN4A 2UWQA 1UBIA 1L6VA 1UBQA 4XX5A 1HA5A 3NVYA 2XK5A 5E6OA 4DXFA 2MQJA 3ML8A 4JE3B 1T6BX 2DYBA 1FM0D 3GB1A 2DYOA 2WDQB 3C8YA 4KKJA 1J19A 1AARA 1MFWA 1STEA 5IP4D 4A8XC 2MCNB 3OJ4B 3N1XC 1WZ0A 4CO7A 1KLGD 1PGAA 2YLMA 4FADA 4WAAA 1L5PA 2K3UA 3ZTCA 1ZP0B 3DBRI 4RGTA 3ZKJC 1IGCA 4A3PA 4KSLC 4GMVA 1WXVA 3AULA 2PVOD 3AE4B 2CHZA 3UI3A 5EE1A 2JYTA 2NPTB 2WX0A 4OVVA 1V1PB 3PO0A 2M1MA 1KRHA 3QQ8B 5DCNA 2DWQA 2KFJA 2V3NA 5LLIA 3U52E 4BKGA 2ZW1A 2WWZA 2N4FA 1N60A 2BBCA 2RSUA 4I6NB 3V05A 1DOIA 1F2RI 4RCOA 4ZOHC 2L0FA 3ZRFA 2HTME 1XCTL 2BT6A 1SJED 1SBBB 1V49A 1JRUA 1HZ5A 3C19A 2OEDA 4GDKA 5BMGA 3MJWA 3IAM1 2HD5B 3V61A 4K1RB 2FIDA 2LXCA 4XE0A 3AU5A 1YQ4B 2FIFA 1B1ZA 3NOBA 5D3DA 4YTPB 1I4HA 4IW0A 1KM7A 2KLCA 4BZAA 1V80A 3SD5A 3H7PB 4EFOA 2LGSA 2WGSA 4II2B 4C7ZA 2RPVA 2VZKD 3RNAC 4AS1A 3JSVA 1TKGA 2W55A 1WJ4A 1HE8A 4G11A 3RFZB 1JROA 1ZW7A 3SEBA 3W1SA 4HROA 4DHZE 2HE7A 1I4GA 2BYTA 4C7YA 3UGBB 2A5UA 2SEBD 3A1QB 1P1AA 4PYZA 2QMTA 4HRSA 2QDFA 2CJOA 5AZFA 3VDZA 1WJUA 1NVID 1N5WA 1H4RA 3TMPB 3EUB2 1KFYB 1NI3A 4WWNA 4AOFA 5HFYA 4RH6A 4RM9A 4DQOC 3A1QA 1MJDA 4GDLB 1XT9B 1VR9A 1Q10A 2FCMA 2EELA 2BF8B 4JIOU 1WXAA 3PV1A 2XEWA 4GIVA 1FCCC 2Z59B 4JQWC 4KX6B 5E6PA 3Q14C 4YTMB 4OZCA 3DVNV 4FJVB 4XDDA 1B9RA 2KN4A 4ARIA 3ECIA 3SR6A 1FNWA 1K53A 4WWPA 3IFWB 1XLNA 1TGZB 2M19A 1E10A 2KWDA 4LNIA 3KWVA 4HJGE 1TS4A 3IAS1 3QWZB 4P1BC 4ZRKA 2K5PA 2SAKA 4JLCA 1WJNA 2KWCA 4KDLB 1HTOA 4TV3A 4IWQA 2KTRB 3NG0A 3Q2AC 4K7UA 5T8IA 3ZNGC 3DOWA 4RF0A 3ZO5B 2GOWA 2X8XX 2AWTA 2H88B 3GOEA 3H8HA 2ICIA 3URYA 4GN1A 2VH1A 2MLBA 4L23A 3WCQA 3BINA 3V6EB 3BY4B 3A4RA 3AE6B 4W9CA 3MFGA 4WH4A 2MBBB 4YXDB 1KLUD 2LXAA 4TQ0A 3MC9A 3B0AA 1K8RB 4BKSA 5JZEB 4M01A 2GB1A 5EDSA 1UELA 2RMMA 3ML9A 1GC6A 4X57B 2DZIA 3EFUA 1H8CA 4ANVA 1WYWB 2IZVB 2KYWA 2YEPF 5EE0A 4D2KA 4XYCA 4F8CB 4ZRQA 5D3IB 5J18A 1YN5A 1E7PB 2IYDB 3RN9C 2BS2B 4IOIE 4MSMB 3UIPB 3BIID 3PGEA 4MM3A 3VTUA 4MGIE 3H7SA 3X23A 2V3SA 1AWDA 1GJZA 4WJNA 2C7HA 2M0XA 4RGOS 1MHXA 2IY0B 2K39A 2KDEB 3ZRCA 2KX3A 1HZ6A 2WXIA 3RPFC 3MHZA 4WAFA 4HKZE 1ZE3D 2MWSB 2N7DA 2DX5B 3TCAA 4OZAA 4BKSD 2GBRA 3ZNID 1XF5L 1RM6C 1FEHA 1E8XA 1OEYA 2LHDA 2B3AA 1TKYA 3CSTA 2JZ3B 4EZKA 5KHQA 3U2SC 2AQ3B 2O2VB 1Q5WB 2K8BA 1C3TA 2FBWB 1GB4A 4NQKE 1JALA 2KDFB 1M4VA 1F9JA 3PLUA 2M56B 2ZNVB 4L1BA 5J2RA 3U7DA 3VVWB 1WR6E 5IN7A 2W82A 1RAXA 2WX1A 2K6QA 4PS3A 4MT5A 1FCLA 3HIZA 1P7FA 3VUXA 4ZDVA 1TS5A 3R66C 3VUYA 4MEMA 3ABVB 5JXVA 2V4IB 5AZHA 2QJLA 3CWIA 3KUDB 3PLVA 3PPAA 2UYZB 3A9JB 1WWTA 4P1CC 2KTRA 2HJ8A 3I63C 3TUOA 4MH8A 1IBXB 3DBHB 4HK2A 3RNGC 2GBKA 4IDIA 2LUEA 2FE8A 1D5MC 1RYJA 2LRWA 2RR9A 1WMHA 4WQOB 4DDGD 1JW9D 1JWMD 4WJOA 1J7AA 2FNJB 4HXDA 3ZJUA 1R4MI 2MP2A 4MGKE 2K25A 2KHWB 2E6XA 4XC2A 2R2QA 2IGGA 3C0RB 4IM0A 4HPMB 3I3TB 5BMHA 1L4ZB 2RGFA 2NTTA 3RULA 2J0KA 3QC8B 2BS4B 2KMCA 3TEZA 3OJ3A 2K9XA 2VRRB 1T0QC 2AYOB 1TS2A 2G45B 3X0WA 4FHJA 1TKEA 1AW7A 2WXFA 1YJIA 2PE9A 1OEYJ 3J9CA 3V62A 2MJ3A 1A70A 2FCSA 2L1AA 3E56A 3QAQA 1WI0A 2AL3A 3DVNU 1CQVA 1TJEA 1SF0A 4W9FA 3DHGC 4N59A 4TMAB 2TSSA 1IUEA 2I1KA 4O1NA 3B9JA 3R2IA 4XWWA 1ACCA 3PZ7A 1WMHB 3HUIA 4US9A 2K8CA 3KWLA 2K1FA 3SFEB
chains in the Genus database with same CATH topology
4EZJA 2ZCCA 3ZUNA 2NPTB 3L10B 1NBFC 1S1QB 2BKRB 2PEAA 2WX0A 5DPTA 3R7QA 2KOXA 3QA8A 3WANA 2NBWB 4OVVA 4YL8A 2M1MA 4AUQC 5DPWA 3H7PA 3PZDA 3QQ8B 3VH3B 4BVUC 2KDBA 5DCNA 1E8WA 3PTFC 3PVLA 3L54A 4IG7B 2L3ZA 2O6VD 2DENB 2KFJA 2IO0B 2D07B 1TTNA 4AP4C 1YIWA 3CMMB 5LLIA 1V2YA 4BKGA 2WWZA 4NQLB 2MBOA 2KWUB 3Q3JA 2KZRA 2N4FA 3RUIB 2N9EB 1D3ZA 2DZMA 3M63B 2RSUA 3ONSA 2EMTA 4I6NB 3L0WB 2JVCA 4AJYB 1IPGA 4FULA 4GB9A 1EF1A 1GG3A 2N1VA 2D2QA 3PREA 4NAWB 4W9JA 2L0FA 3ZRFA 4LJPB 4BBNC 3RCZA 4N9F4 2LWPA 4W9LA 2LGXA 2GMIC 1OQYA 2XK5B 2OJRA 2RD0A 3RZFA 2KJHB 4TQ1A 1V49A 1JRUA 4DHZB 2Z0DB 1V9JA 2REXA 4GDKA 5KHOA 3A33B 3MJWA 1VCBA 2HD5B 4FN2A 3V61A 2V4LA 4K1RB 2FIDA 1WFYA 2HTHA 2LXCA 3AU5A 4GOCA 4NPNA 5FR6A 5GMVA 1LFDA 2FIFA 1UD7A 2GBMA 1WX9A 3NOBA 2JXXA 2ZPYA 1I42A 2KC1A 3JSVB 3PHWB 1S3SG 4IW0A 3RYTA 4B95A 1YX6B 2NBUA 1KM7A 4FHKA 2KLCA 4G0NB 1UGMA 2ZPNA 4URKA 2LVPA 2O6VB 1V80A 3SD5A 3APCA 3H7PB 1KLVA 2KVRA 3VFKA 1M94A 4EFOA 5CHFA 2BYEA 2DAFA 2K6DB 4II2B 4RM8A 4ZRJA 4K81A 3RZWC 4NY0A 5TR5A 4ASWC 4K7SA 2NBVB 3UQAA 3JSVA 1YJ1A 1WJ4A 2KKCA 2KO3A 4KIKA 1HE8A 4G11A 3IVFA 4G3XB 1ZW7A 3RD2A 3UQBA 2A4ZA 1U4AA 3W1SA 4DHZE 1V86A 2HE7A 4G50A 2W9NA 3ZW3A 3PT2B 3UGBB 2A5UA 1L2NA 3A1QB 4GU2A 2ZVOA 3MHSD 4BFRA 1P1AA 4PYZA 4NJ7A 1RFAA 5E6NA 3JYUA 5BO4B 4J6IA 5AZFA 4BKTA 3DDCB 4DXAB 1G6JA 2KFKB 1WY8A 3R3MA 3CF6E 3ALBA 3TJPA 3VDZA 1MG8A 1P9DU 4A3OA 1WJUA 1XD3B 2KXJA 4HLEA 1I35A 2N7EA 4GDKB 4GSWA 1H4RA 4XZ4A 3TMPB 5DPSA 3APFA 2WYQA 4WWNA 4IM2A 1WXSA 3ZNZB 4AOFA 4RM9A 2CHWA 2KDIA 3A1QA 4GDLB 1XT9B 4HDOA 4FBJB 2FCMA 2C60A 4JIOU 2BF8B 1WXAA 1V5OA 2R2OA 3AXCA 5C23A 4EZLA 3PV1A 2XEWA 4GIVA 2L0TA 1WGDA 4HDQA 2G4DB 2Z59B 4JQWC 5E6PA 1OTRB 1IYFA 1EUVB 2KK8A 4ZRIA 1WM2A 4IWPA 3DVNV 3S2AA 1WXMA 3KYDD 4FJVB 4M8MA 4IWOA 3N30A 1VD2A 3JW0X 3ECIA 4II3B 3VQIA 1P0RA 4KDIC 4WWPA 3DVGY 3IFWB 4EUTA 1E8YA 3EHVA 1WGRA 3KH0A 1TGZB 4MELA 4MH0E 3VTVA 2BPSA 1YD8U 1C1YB 4E74A 1WJ6A 3QWZB 2KQ7A 1WH3A 2Y5BB 1WZ3A 3HK0A 5LXIB 4ZRKA 4JLCA 1WJNA 1GC7A 1ZGUB 5JHAA 2L7RA 3AI5A 2QHOA 2LRUA 3B1LX 2KWCA 4KDLB 3KW5B 4TV3A 2JPHA 4IWQA 3R7RA 3ZDTA 3PRMB 2BGFA 1T0YA 2RPQA 2MW5A 2D11A 3DPDA 2ZVNA 5G55A 2C7MB 2KTRB 3HM6X 1PQSA 3K9PB 4HCPB 4K7UA 2MRPA 3ZNGC 1SGHA 3L13A 4B9KA 3DOWA 4GDLA 3ZO5B 2GOWA 2AWTA 1V81A 3K9OB 2KJ6A 4BOSC 3GOEA 4CHKA 4AJWA 1WGHA 2N1WA 2J0JA 3M3JA 4GN1A 2L05A 4KSKC 2ZCBA 2MLBA 3QHTA 2JT4B 3BINA 3V6EB 3TL5A 2N9PC 3BY4B 2KQSA 3A4RA 4W9CA 3UINB 4CYEA 2MBBB 4E3CA 2LXAA 1J0GA 3TIXA 5CTRC 3IG3A 4WWOA 4TQ0A 3B0AA 4DBGA 1K8RB 2MSED 4BKSA 5JZEB 3TBLD 4B6WA 1GNUA 1QZEA 3EECA 5D7GA 2D3GA 3KUCB 2K8HA 4PYUA 3ZNHB 1BT0A 1YQBA 3LJ3A 4GGQA 3PRZA 3H1UA 5EDSA 2DHZA 1UELA 3VHTC 1WM3A 3ML9A 5HKHA 3DBSA 3ZIMA 2YVCA 1GC6A 4X57B 4WJQA 2LASA 3WIMA 1V6EA 2DZIA 3EFUA 5G2NA 4EEWA 1H8CA 4ANVA 3B08A 1WYWB 3NS8A 3VXWA 2IZVB 3L08A 2L00B 5JHBA 4PS8A 1E90A 4IC7B 5IA7A 1WX7A 5CHWA 4JGHB 1RRBA 3GZNI 4F8CB 2CU1A 2M4NA 2JUOA 1V5TA 1WE7A 3ENEA 4RMAA 2IBIB 4P7IA 3WAPA 4BOZB 5AEKB 2LVQA 5J18A 3PS6A 3WAOA 1RLFA 2IYDB 5AZGA 4AWJA 4FA6A 2ASQA 4MGYE 4W9HA 1Z5SB 4MSMB 2AL6A 3AU4A 2C5LC 3UIPB 3PGEA 2N9XA 1YX5B 1P3QU 4EOYA 1WR1A 4HJKA 4DK5A 4MM3A 3VTUA 3WALA 4EKUA 4IM3A 4MGIE 3L16A 3A9KA 4LDTD 5CX3A 2FUHB 1Q1OA 3QIJA 2MBQA 3H7SA 4KZ0A 5C1ZA 3X23A 2V3SA 1GJZA 4HPLB 4WJNA 2C7HA 2M0XA 2NCNA 4E71A 2IY0B 2K39A 1NDDA 1EO6A 2KX0A 4OVUA 1SE9A 1GUAB 2KDEB 4WJPA 3ZRCA 2D10A 1ZKHA 4NAWA 2KX3A 4W9EA 1TBEA 4KV2A 1Z2MA 1J8CA 2CKHB 1WF9A 2C9WB 2MA9B 4LCDE 4HWIB 1E7UA 2KMAA 5J17A 2KTFA 3RT3B 5JH5C 1WRDB 3QX1A 5LXHA 3DCGA 3A9KB 3NZSA 2CS4A 2MWSB 2N7DA 4W9DA 4K7WA 2DX5B 2IO1B 3TCAA 2DAJA 2PE6B 4BKSD 4LDTB 3IBEA 2GBRA 3ZNID 3PSEB 2J7QB 1E8XA 1OEYA 3O65B 3VH4B 2KANA 2B3AA 2M17A 2KC2A 5CHVC 3CSTA 1E7VA 3VAWA 2CR5A 3H9DA 4ICUA 2LI5A 2JZ3B 1FXTB 4EZKA 5KHQA 4ZYNA 1EF5A 3PRPB 3WAMA 3LDZE 2NR2A 2IY1B 1Q5WB 2O2VB 2BWES 2K8BA 1C3TA 4NQKE 3U30A 2KDFB 3L17A 4DWFA 1F9JA 3PLUA 2ZNVB 1TZ1A 3DBLI 2PPHA 5J2RA 4KIKB 1CMXB 2IO2B 4HCNB 3U7DA 3VVWB 1UZXB 1WR6E 2IO3B 3DBHI 4NNJB 1RAXA 2WX1A 2K6QA 4PS3A 4ANWA 3HIZA 1IP9A 3VUXA 3VUWA 3APDA 3N3KB 4ZDVA 2XBBC 3U8ZA 3HHMA 3R66C 3VUYA 4GXBA 1UH6A 4MEMA 5AZHA 3KUDB 3PLVA 2DZJA 4W9GA 3UF8A 3PPAA 2AEHA 2ZNVC 2JRIB 4DDID 2UYZB 3A9JB 4LJOB 1NI2A 3M95A 3SDLC 2GBJA 3W1SC 1Y8RC 2KTRA 3QJZA 3V60A 2KFKA 2LJ5A 5L83A 2HJ8A 2KD0A 2ZEQA 2O6VA 3M62B 4M8NA 4ICVA 3H6NA 1WX8A 1KOTA 4HK2A 5D6JB 3PHXB 4MDKE 3T8MA 3SHQA 5IAAC 2GBKA 3DQVA 2LUEA 1LQBA 4I6PA 3JVZX 3Q3FA 2C7NB 2I1JA 1SIFA 2LRWA 2M8SA 1WGGA 3NHEB 2RR9A 3N32A 1WMHA 2GBNA 4WQOB 3QCAA 2BKFA 4DDGD 2OOBB 2FCQA 3ZVVA 4DHJD 2LD9A 4W9KA 4IUMB 3MTNB 2NPTA 2CHXA 2JRHA 4M0WB 4WJOA 1E5WA 2BYVE 2KLGA 2L76A 2KN5A 2L8JA 2FNJB 4HXDA 4KVGB 2G4SA 1OGWA 4A20A 1R4MI 2MP2A 4F1SA 2JZZA 4MGKE 2K25A 2MBHA 1WGYA 5L95C 2BYFA 2KHWB 3D32A 3WA0A 1LM8B 3NZUA 4KZCA 4XC2A 4FLHA 1Q0WB 2R2QA 3V6CB 3VTWA 1WIAA 5DPRA 2MX2A 3QK0A 3P2BA 1ISNA 2ZZPB 3C0RB 4TUUA 1A5RA 4IM0A 3DVGX 1KJTA 4HPMB 4PS7A 3OLMD 3I3TB 2PJHA 2FAZA 2MP2B 4I6LB 1X1MA 2BWFA 2RGFA 3EC8A 2DYMA 2LVOA 3A9JA 4FJZA 3RULA 2J0KA 2UWQA 2NS5A 3QC8B 2KMCA 1UBIA 2O2VA 4HVBA 1UBQA 5D94A 4XX5A 4MSQB 4TKNA 3OJ3A 3ZTDA 2VRRB 2EMSA 4MJSB 1LXDA 4ANUA 2FCNA 2AYOB 2XK5A 5E6OA 2LGDA 2MQJA 2G45B 3ML8A 2NVUI 2V1YA 3ZLZA 2DYBA 3X0WA 2KJRA 3QARA 3SU8X 2J0MA 4FHJA 2LGYA 2DYOA 3UIOB 3ZDMC 1J19A 2PE9A 1P98A 1AARA 2JWZA 2KWVB 1XQQA 2EKEC 1OEYJ 2MBEA 3V62A 4W9IA 2MCNB 1R4NI 2FCSA 3KVFB 2G3QB 2DZKA 3OJ4B 3QAQA 1WI0A 2AL3A 3T9LA 3DVNU 3KYCD 4JL9A 1E8ZA 1WZ0A 4CO7A 2JY6A 2JF5A 4MGZE 4W9FA 2YLMA 3A4SC 2Z0EB 4WAAA 3W1YA 3HM3A 4F7ZA 4FADA 1WE6A 4BBNF 2KNBA 2I1KA 3ZTCA 2ZJDA 3DBRI 3OAWA 3IHPC 4DHJB 2WDTB 3ZKJC 1WMHB 3KUZA 4A3PA 1L7YA 4MJSA 3CSFA 2K8CA 4GMVA 4KSLC 5D2MB 4ANXA 2K1FA 1WXVA 3AULA 4NJ6A 2CHZA 4FJYA 3NY5A 2LZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZJ A;  2ZCC A;  3ZUN A;  2NPT B;  3L10 B;  1NBF C;  1S1Q B;  2BKR B;  2PEA A;  2WX0 A;  5DPT A;  3R7Q A;  2KOX A;  3QA8 A;  3WAN A;  2NBW B;  4OVV A;  4YL8 A;  2M1M A;  4AUQ C;  5DPW A;  3H7P A;  3PZD A;  3QQ8 B;  3VH3 B;  4BVU C;  2KDB A;  5DCN A;  1E8W A;  3PTF C;  3PVL A;  3L54 A;  4IG7 B;  2L3Z A;  2O6V D;  2DEN B;  2KFJ A;  2IO0 B;  2D07 B;  1TTN A;  4AP4 C;  1YIW A;  3CMM B;  5LLI A;  1V2Y A;  4BKG A;  2WWZ A;  4NQL B;  2MBO A;  2KWU B;  3Q3J A;  2KZR A;  2N4F A;  3RUI B;  2N9E B;  1D3Z A;  2DZM A;  3M63 B;  2RSU A;  3ONS A;  2EMT A;  4I6N B;  3L0W B;  2JVC A;  4AJY B;  1IPG A;  4FUL A;  4GB9 A;  1EF1 A;  1GG3 A;  2N1V A;  2D2Q A;  3PRE A;  4NAW B;  4W9J A;  2L0F A;  3ZRF A;  4LJP B;  4BBN C;  3RCZ A;  4N9F 4;  2LWP A;  4W9L A;  2LGX A;  2GMI C;  1OQY A;  2XK5 B;  2OJR A;  2RD0 A;  3RZF A;  2KJH B;  4TQ1 A;  1V49 A;  1JRU A;  4DHZ B;  2Z0D B;  1V9J A;  2REX A;  4GDK A;  5KHO A;  3A33 B;  3MJW A;  1VCB A;  2HD5 B;  4FN2 A;  3V61 A;  2V4L A;  4K1R B;  2FID A;  1WFY A;  2HTH A;  2LXC A;  3AU5 A;  4GOC A;  4NPN A;  5FR6 A;  5GMV A;  1LFD A;  2FIF A;  1UD7 A;  2GBM A;  1WX9 A;  3NOB A;  2JXX A;  2ZPY A;  1I42 A;  2KC1 A;  3JSV B;  3PHW B;  1S3S G;  4IW0 A;  3RYT A;  4B95 A;  1YX6 B;  2NBU A;  1KM7 A;  4FHK A;  2KLC A;  4G0N B;  1UGM A;  2ZPN A;  4URK A;  2LVP A;  2O6V B;  1V80 A;  3SD5 A;  3APC A;  3H7P B;  1KLV A;  2KVR A;  3VFK A;  1M94 A;  4EFO A;  5CHF A;  2BYE A;  2DAF A;  2K6D B;  4II2 B;  4RM8 A;  4ZRJ A;  4K81 A;  3RZW C;  4NY0 A;  5TR5 A;  4ASW C;  4K7S A;  2NBV B;  3UQA A;  3JSV A;  1YJ1 A;  1WJ4 A;  2KKC A;  2KO3 A;  4KIK A;  1HE8 A;  4G11 A;  3IVF A;  4G3X B;  1ZW7 A;  3RD2 A;  3UQB A;  2A4Z A;  1U4A A;  3W1S A;  4DHZ E;  1V86 A;  2HE7 A;  4G50 A;  2W9N A;  3ZW3 A;  3PT2 B;  3UGB B;  2A5U A;  1L2N A;  3A1Q B;  4GU2 A;  2ZVO A;  3MHS D;  4BFR A;  1P1A A;  4PYZ A;  4NJ7 A;  1RFA A;  5E6N A;  3JYU A;  5BO4 B;  4J6I A;  5AZF A;  4BKT A;  3DDC B;  4DXA B;  1G6J A;  2KFK B;  1WY8 A;  3R3M A;  3CF6 E;  3ALB A;  3TJP A;  3VDZ A;  1MG8 A;  1P9D U;  4A3O A;  1WJU A;  1XD3 B;  2KXJ A;  4HLE A;  1I35 A;  2N7E A;  4GDK B;  4GSW A;  1H4R A;  4XZ4 A;  3TMP B;  5DPS A;  3APF A;  2WYQ A;  4WWN A;  4IM2 A;  1WXS A;  3ZNZ B;  4AOF A;  4RM9 A;  2CHW A;  2KDI A;  3A1Q A;  4GDL B;  1XT9 B;  4HDO A;  4FBJ B;  2FCM A;  2C60 A;  4JIO U;  2BF8 B;  1WXA A;  1V5O A;  2R2O A;  3AXC A;  5C23 A;  4EZL A;  3PV1 A;  2XEW A;  4GIV A;  2L0T A;  1WGD A;  4HDQ A;  2G4D B;  2Z59 B;  4JQW C;  5E6P A;  1OTR B;  1IYF A;  1EUV B;  2KK8 A;  4ZRI A;  1WM2 A;  4IWP A;  3DVN V;  3S2A A;  1WXM A;  3KYD D;  4FJV B;  4M8M A;  4IWO A;  3N30 A;  1VD2 A;  3JW0 X;  3ECI A;  4II3 B;  3VQI A;  1P0R A;  4KDI C;  4WWP A;  3DVG Y;  3IFW B;  4EUT A;  1E8Y A;  3EHV A;  1WGR A;  3KH0 A;  1TGZ B;  4MEL A;  4MH0 E;  3VTV A;  2BPS A;  1YD8 U;  1C1Y B;  4E74 A;  1WJ6 A;  3QWZ B;  2KQ7 A;  1WH3 A;  2Y5B B;  1WZ3 A;  3HK0 A;  5LXI B;  4ZRK A;  4JLC A;  1WJN A;  1GC7 A;  1ZGU B;  5JHA A;  2L7R A;  3AI5 A;  2QHO A;  2LRU A;  3B1L X;  2KWC A;  4KDL B;  3KW5 B;  4TV3 A;  2JPH A;  4IWQ A;  3R7R A;  3ZDT A;  3PRM B;  2BGF A;  1T0Y A;  2RPQ A;  2MW5 A;  2D11 A;  3DPD A;  2ZVN A;  5G55 A;  2C7M B;  2KTR B;  3HM6 X;  1PQS A;  3K9P B;  4HCP B;  4K7U A;  2MRP A;  3ZNG C;  1SGH A;  3L13 A;  4B9K A;  3DOW A;  4GDL A;  3ZO5 B;  2GOW A;  2AWT A;  1V81 A;  3K9O B;  2KJ6 A;  4BOS C;  3GOE A;  4CHK A;  4AJW A;  1WGH A;  2N1W A;  2J0J A;  3M3J A;  4GN1 A;  2L05 A;  4KSK C;  2ZCB A;  2MLB A;  3QHT A;  2JT4 B;  3BIN A;  3V6E B;  3TL5 A;  2N9P C;  3BY4 B;  2KQS A;  3A4R A;  4W9C A;  3UIN B;  4CYE A;  2MBB B;  4E3C A;  2LXA A;  1J0G A;  3TIX A;  5CTR C;  3IG3 A;  4WWO A;  4TQ0 A;  3B0A A;  4DBG A;  1K8R B;  2MSE D;  4BKS A;  5JZE B;  3TBL D;  4B6W A;  1GNU A;  1QZE A;  3EEC A;  5D7G A;  2D3G A;  3KUC B;  2K8H A;  4PYU A;  3ZNH B;  1BT0 A;  1YQB A;  3LJ3 A;  4GGQ A;  3PRZ A;  3H1U A;  5EDS A;  2DHZ A;  1UEL A;  3VHT C;  1WM3 A;  3ML9 A;  5HKH A;  3DBS A;  3ZIM A;  2YVC A;  1GC6 A;  4X57 B;  4WJQ A;  2LAS A;  3WIM A;  1V6E A;  2DZI A;  3EFU A;  5G2N A;  4EEW A;  1H8C A;  4ANV A;  3B08 A;  1WYW B;  3NS8 A;  3VXW A;  2IZV B;  3L08 A;  2L00 B;  5JHB A;  4PS8 A;  1E90 A;  4IC7 B;  5IA7 A;  1WX7 A;  5CHW A;  4JGH B;  1RRB A;  3GZN I;  4F8C B;  2CU1 A;  2M4N A;  2JUO A;  1V5T A;  1WE7 A;  3ENE A;  4RMA A;  2IBI B;  4P7I A;  3WAP A;  4BOZ B;  5AEK B;  2LVQ A;  5J18 A;  3PS6 A;  3WAO A;  1RLF A;  2IYD B;  5AZG A;  4AWJ A;  4FA6 A;  2ASQ A;  4MGY E;  4W9H A;  1Z5S B;  4MSM B;  2AL6 A;  3AU4 A;  2C5L C;  3UIP B;  3PGE A;  2N9X A;  1YX5 B;  1P3Q U;  4EOY A;  1WR1 A;  4HJK A;  4DK5 A;  4MM3 A;  3VTU A;  3WAL A;  4EKU A;  4IM3 A;  4MGI E;  3L16 A;  3A9K A;  4LDT D;  5CX3 A;  2FUH B;  1Q1O A;  3QIJ A;  2MBQ A;  3H7S A;  4KZ0 A;  5C1Z A;  3X23 A;  2V3S A;  1GJZ A;  4HPL B;  4WJN A;  2C7H A;  2M0X A;  2NCN A;  4E71 A;  2IY0 B;  2K39 A;  1NDD A;  1EO6 A;  2KX0 A;  4OVU A;  1SE9 A;  1GUA B;  2KDE B;  4WJP A;  3ZRC A;  2D10 A;  1ZKH A;  4NAW A;  2KX3 A;  4W9E A;  1TBE A;  4KV2 A;  1Z2M A;  1J8C A;  2CKH B;  1WF9 A;  2C9W B;  2MA9 B;  4LCD E;  4HWI B;  1E7U A;  2KMA A;  5J17 A;  2KTF A;  3RT3 B;  5JH5 C;  1WRD B;  3QX1 A;  5LXH A;  3DCG A;  3A9K B;  3NZS A;  2CS4 A;  2MWS B;  2N7D A;  4W9D A;  4K7W A;  2DX5 B;  2IO1 B;  3TCA A;  2DAJ A;  2PE6 B;  4BKS D;  4LDT B;  3IBE A;  2GBR A;  3ZNI D;  3PSE B;  2J7Q B;  1E8X A;  1OEY A;  3O65 B;  3VH4 B;  2KAN A;  2B3A A;  2M17 A;  2KC2 A;  5CHV C;  3CST A;  1E7V A;  3VAW A;  2CR5 A;  3H9D A;  4ICU A;  2LI5 A;  2JZ3 B;  1FXT B;  4EZK A;  5KHQ A;  4ZYN A;  1EF5 A;  3PRP B;  3WAM A;  3LDZ E;  2NR2 A;  2IY1 B;  1Q5W B;  2O2V B;  2BWE S;  2K8B A;  1C3T A;  4NQK E;  3U30 A;  2KDF B;  3L17 A;  4DWF A;  1F9J A;  3PLU A;  2ZNV B;  1TZ1 A;  3DBL I;  2PPH A;  5J2R A;  4KIK B;  1CMX B;  2IO2 B;  4HCN B;  3U7D A;  3VVW B;  1UZX B;  1WR6 E;  2IO3 B;  3DBH I;  4NNJ B;  1RAX A;  2WX1 A;  2K6Q A;  4PS3 A;  4ANW A;  3HIZ A;  1IP9 A;  3VUX A;  3VUW A;  3APD A;  3N3K B;  4ZDV A;  2XBB C;  3U8Z A;  3HHM A;  3R66 C;  3VUY A;  4GXB A;  1UH6 A;  4MEM A;  5AZH A;  3KUD B;  3PLV A;  2DZJ A;  4W9G A;  3UF8 A;  3PPA A;  2AEH A;  2ZNV C;  2JRI B;  4DDI D;  2UYZ B;  3A9J B;  4LJO B;  1NI2 A;  3M95 A;  3SDL C;  2GBJ A;  3W1S C;  1Y8R C;  2KTR A;  3QJZ A;  3V60 A;  2KFK A;  2LJ5 A;  5L83 A;  2HJ8 A;  2KD0 A;  2ZEQ A;  2O6V A;  3M62 B;  4M8N A;  4ICV A;  3H6N A;  1WX8 A;  1KOT A;  4HK2 A;  5D6J B;  3PHX B;  4MDK E;  3T8M A;  3SHQ A;  5IAA C;  2GBK A;  3DQV A;  2LUE A;  1LQB A;  4I6P A;  3JVZ X;  3Q3F A;  2C7N B;  2I1J A;  1SIF A;  2LRW A;  2M8S A;  1WGG A;  3NHE B;  2RR9 A;  3N32 A;  1WMH A;  2GBN A;  4WQO B;  3QCA A;  2BKF A;  4DDG D;  2OOB B;  2FCQ A;  3ZVV A;  4DHJ D;  2LD9 A;  4W9K A;  4IUM B;  3MTN B;  2NPT A;  2CHX A;  2JRH A;  4M0W B;  4WJO A;  1E5W A;  2BYV E;  2KLG A;  2L76 A;  2KN5 A;  2L8J A;  2FNJ B;  4HXD A;  4KVG B;  2G4S A;  1OGW A;  4A20 A;  1R4M I;  2MP2 A;  4F1S A;  2JZZ A;  4MGK E;  2K25 A;  2MBH A;  1WGY A;  5L95 C;  2BYF A;  2KHW B;  3D32 A;  3WA0 A;  1LM8 B;  3NZU A;  4KZC A;  4XC2 A;  4FLH A;  1Q0W B;  2R2Q A;  3V6C B;  3VTW A;  1WIA A;  5DPR A;  2MX2 A;  3QK0 A;  3P2B A;  1ISN A;  2ZZP B;  3C0R B;  4TUU A;  1A5R A;  4IM0 A;  3DVG X;  1KJT A;  4HPM B;  4PS7 A;  3OLM D;  3I3T B;  2PJH A;  2FAZ A;  2MP2 B;  4I6L B;  1X1M A;  2BWF A;  2RGF A;  3EC8 A;  2DYM A;  2LVO A;  3A9J A;  4FJZ A;  3RUL A;  2J0K A;  2UWQ A;  2NS5 A;  3QC8 B;  2KMC A;  1UBI A;  2O2V A;  4HVB A;  1UBQ A;  5D94 A;  4XX5 A;  4MSQ B;  4TKN A;  3OJ3 A;  3ZTD A;  2VRR B;  2EMS A;  4MJS B;  1LXD A;  4ANU A;  2FCN A;  2AYO B;  2XK5 A;  5E6O A;  2LGD A;  2MQJ A;  2G45 B;  3ML8 A;  2NVU I;  2V1Y A;  3ZLZ A;  2DYB A;  3X0W A;  2KJR A;  3QAR A;  3SU8 X;  2J0M A;  4FHJ A;  2LGY A;  2DYO A;  3UIO B;  3ZDM C;  1J19 A;  2PE9 A;  1P98 A;  1AAR A;  2JWZ A;  2KWV B;  1XQQ A;  2EKE C;  1OEY J;  2MBE A;  3V62 A;  4W9I A;  2MCN B;  1R4N I;  2FCS A;  3KVF B;  2G3Q B;  2DZK A;  3OJ4 B;  3QAQ A;  1WI0 A;  2AL3 A;  3T9L A;  3DVN U;  3KYC D;  4JL9 A;  1E8Z A;  1WZ0 A;  4CO7 A;  2JY6 A;  2JF5 A;  4MGZ E;  4W9F A;  2YLM A;  3A4S C;  2Z0E B;  4WAA A;  3W1Y A;  3HM3 A;  4F7Z A;  4FAD A;  1WE6 A;  4BBN F;  2KNB A;  2I1K A;  3ZTC A;  2ZJD A;  3DBR I;  3OAW A;  3IHP C;  4DHJ B;  2WDT B;  3ZKJ C;  1WMH B;  3KUZ A;  4A3P A;  1L7Y A;  4MJS A;  3CSF A;  2K8C A;  4GMV A;  4KSL C;  5D2M B;  4ANX A;  2K1F A;  1WXV A;  3AUL A;  4NJ6 A;  2CHZ A;  4FJY A;  3NY5 A;  2LZ6 A; 
#chains in the Genus database with same CATH topology
 4EZJ A;  2ZCC A;  3T3O A;  3L10 B;  1NBF C;  2PEA A;  2KOX A;  3LB8 C;  1OQQ A;  1UUP A;  3NZ3 A;  4ZHP A;  4BVU C;  2HJ1 A;  3PTF C;  2DEN B;  2IO0 B;  3DWG C;  1QIL A;  1VJK A;  1V2Y A;  2IND C;  2WP9 B;  4ZYS A;  2IDY A;  4NQL B;  3Q3J A;  1R7S A;  1D6E C;  2WXR A;  2N9E B;  3M63 B;  3NJT A;  3L4P A;  4AJY B;  1GG3 A;  4XDC A;  2LEK A;  1C79 A;  2WXP A;  4W9J A;  2WXH A;  4LJP B;  3RCZ A;  4W9L A;  2LGX A;  2GMI C;  2XK5 B;  3RNC C;  2BS3 B;  1F52 A;  4TQ1 A;  3AN1 A;  5KHO A;  3A33 B;  1G6J A;  4GOC A;  1WFY A;  5FR6 A;  1SB3 C;  2ONQ A;  2ZPY A;  2KC1 A;  3PHW B;  4B95 A;  4M0W A;  2NBU A;  1UGM A;  4IKG A;  3AM9 A;  2KVR A;  1M94 A;  2AX5 A;  2DAF A;  2K6D B;  5FKA C;  1ENF A;  3RZW C;  1TZO A;  2Y5C A;  4KIK A;  1YNT E;  3AED B;  3IVF A;  3KLS X;  4MAC A;  3UQB A;  1FFV A;  1U4A A;  3AEG B;  1D4B A;  1E9M A;  2G1E A;  2WXL A;  1FXA A;  4NJ7 A;  1RFA A;  4BKT A;  1UGJ A;  1XLP A;  2BTE A;  1N62 A;  3ALB A;  3CF6 E;  3TJP A;  1MG8 A;  4HLE A;  4CQN A;  1I35 A;  2KXJ A;  4GDK B;  4GSW A;  3TSS A;  4XZ4 A;  3AB5 A;  3U4E G;  4IM2 A;  3NVV A;  3HRD D;  3EGR A;  3AE8 B;  1C4A A;  1MG4 A;  1VRA B;  4FBJ B;  2C60 A;  3AH7 A;  4A90 A;  2BB5 A;  1NYQ A;  4EZL A;  2WXG A;  1WGD A;  1ZXH A;  1OTR B;  2D3C A;  4IWP A;  3KYD D;  1TS3 A;  2GLS A;  3VQI A;  1QKZ A;  4KDI C;  1LO5 D;  5G5H A;  3EHV A;  1WGR A;  4M00 A;  1SE4 A;  4WUR A;  4MH0 E;  5EE3 A;  2QIL A;  1FD6 A;  1C1Y B;  1V8C A;  1SEB D;  1XCQ L;  1ZXI A;  1GC7 A;  1ZGU B;  2L7R A;  2Y3A A;  2QHO A;  3B1L X;  3KW5 B;  4YT0 B;  2QCZ A;  1T0Y A;  3VRB B;  3ZXV A;  2D11 A;  3W5V B;  1L0V B;  3HM6 X;  4HCP B;  4OHJ A;  1PUT A;  1BUI C;  2WXJ A;  4GDL A;  3P4R B;  5IOI A;  4HKQ A;  3HVD A;  4AJW A;  2N1W A;  3AMZ A;  3IT4 B;  2KQS A;  3P4S B;  5CTR C;  4DBG A;  4OVZ A;  3EEC A;  2D3G A;  2INP E;  2K8H A;  1K51 A;  3ZNH B;  4GGQ A;  3H1U A;  1YMH E;  2DHZ A;  3AE5 B;  1WM3 A;  1GPX A;  3DBS A;  1VLB A;  3ZIM A;  4C4V A;  5G2N A;  3VXW A;  2L00 B;  1TY2 A;  1FRR A;  5CHW A;  1RRB A;  2ON8 A;  2CU1 A;  2M4N A;  2JUO A;  1V5T A;  4RMA A;  1R4N B;  4P7I A;  5AEK B;  2LVQ A;  3T3N A;  2INC C;  3RMK C;  4AWJ A;  2PTL A;  1ZUD 2;  4NZL B;  1T0S C;  1Z5S B;  2AL6 A;  3AU4 A;  2QIE B;  1CK1 A;  1VDV A;  1I7H A;  4EKU A;  3A9K A;  5CX3 A;  1Q1O A;  2JSV X;  2MBQ A;  3RNE C;  2NCN A;  3FKY A;  3RI7 C;  3NUH B;  4E71 A;  2J52 A;  2KX0 A;  4OVU A;  4WJP A;  4NAW A;  4W9E A;  4KGR A;  2MA9 B;  2BB6 A;  5FR3 A;  1E7U A;  4A6Q A;  2LJI A;  2IJ0 A;  2MH7 A;  1TIF A;  3A9K B;  3AE7 B;  1EWC A;  4K7W A;  4LDT B;  5E6J A;  2BVC A;  2N9K A;  1JRP A;  3O65 B;  3VH4 B;  2KAN A;  3VAW A;  3H9D A;  3SFD B;  2LI5 A;  2M0A A;  1FXT B;  4ZYN A;  1BXT A;  3FC4 A;  2NR2 A;  2BWE S;  1XLO A;  2WHI A;  3L17 A;  4DWF A;  2PPH A;  2IO2 B;  3HVZ A;  2IO3 B;  3DBH I;  4ANW A;  1F77 A;  1ZDX A;  2XBB C;  2JX5 A;  4KGT A;  1I4P A;  2JRI B;  4RF1 A;  1J7C A;  1NI2 A;  3M95 A;  2LGI A;  3SDL C;  2GBJ A;  3QJZ A;  1C4P A;  2MJD A;  2KD0 A;  3M62 B;  2ZW0 A;  3DHH C;  3H6N A;  1R4M B;  1QT9 A;  4DXG A;  3B2F A;  4RGM A;  3JVZ X;  1SIF A;  2J42 A;  2W54 A;  2M8S A;  1WGG A;  2OOB B;  4IUM B;  2JRH A;  2L76 A;  2KN5 A;  2L8J A;  1GAQ B;  5IKC M;  2JZZ A;  3WA0 A;  2J53 A;  3NZU A;  2I38 A;  4REZ A;  2H89 B;  4P16 A;  1WIA A;  2WQY B;  1N6Z A;  2FAZ A;  2INN E;  4I6L B;  1X1M A;  3A9J A;  4FJZ A;  3VR8 B;  3FIL B;  2O2V A;  4HVB A;  4MSQ B;  3ZTD A;  1DGJ A;  4ANU A;  4MJS B;  1MHH E;  1LXD A;  1NEN B;  3CIR B;  4MM3 B;  2NVU I;  2V1Y A;  2KJR A;  3QAR A;  2J0M A;  3P63 A;  2D3A A;  3UIO B;  3ZDM C;  2JWZ A;  2KWV B;  1E6E B;  5BYR A;  1VZ7 A;  4W9I A;  1XEE A;  1R4N I;  3KVF B;  2DZK A;  2K0P A;  4JL9 A;  2WU2 B;  2R61 A;  3AE3 B;  2JY6 A;  2JF5 A;  4A55 A;  2Z0E B;  1JML A;  3HM3 A;  1WE6 A;  4BBN F;  3OAW A;  2B76 B;  3MJ5 A;  3IHP C;  4C56 C;  2N9L A;  3KUZ A;  1L7Y A;  3B2G A;  5D2M B;  3E9S A;  1WXQ A;  4FJY A;  5I4D A;  4N6E B;  2LZ6 A;  2JQR B;  2BKR B;  5DPT A;  3R7Q A;  3WAN A;  4YL8 A;  4AUQ C;  3N1Y C;  5DPW A;  2KDB A;  1L6U A;  1E8W A;  4IG7 B;  3L54 A;  2O6V D;  2X38 A;  5BYS A;  4ZRP A;  4AP4 C;  2WXQ A;  3BVM A;  3DBR B;  3MC0 B;  3IT6 B;  2KZR A;  2DZM A;  3L0W B;  1IPG A;  4GB9 A;  1EF1 A;  2N1V A;  2D2Q A;  3PRE A;  2ACZ B;  4BBN C;  2LWP A;  1OQY A;  2OJR A;  1QOF A;  2KJH B;  1V9J A;  2REX A;  3ZQ4 A;  1VCB A;  4YWG G;  5BYQ A;  5GMV A;  4NPN A;  1LFD A;  3KQ4 A;  2GBM A;  1WX9 A;  1I42 A;  3JSV B;  1S3S G;  3RYT A;  1YX6 B;  4FHK A;  3MC8 A;  4URK A;  4G0N B;  2ZPN A;  2LVP A;  3VFK A;  1LGR A;  2BYE A;  4ZRJ A;  1ZDV A;  4NY0 A;  5TR5 A;  4K7S A;  3UQA A;  4C80 A;  1YJ1 A;  2KKC A;  2KO3 A;  2D3B A;  4G3X B;  1V86 A;  4G50 A;  2W9N A;  5HG2 A;  3NS1 A;  2MHJ A;  2V9H A;  4GU2 A;  5HHD G;  2ZVO A;  3MHS D;  1UNS A;  3GE8 C;  4BFR A;  1N61 A;  5AUK A;  2KAC A;  5E6N A;  3JYU A;  5BO4 B;  1OQR A;  4J6I A;  4DXA B;  2KFK B;  1KF6 B;  3OWE B;  1XD3 B;  2WXN A;  1WRI A;  1QQR A;  2D5G A;  3APF A;  1PFD A;  2WYQ A;  1XO3 A;  2KT7 A;  1WXS A;  3EA6 A;  2YEP B;  2CHW A;  2WS3 B;  1ESF A;  1F2R C;  4HDO A;  3W9C B;  2R2O A;  1V5O A;  3AXC A;  3DHI C;  2L0T A;  4RGN A;  1JCK B;  1IYF A;  1MI0 A;  2KK8 A;  4ZRI A;  1DOY A;  1WXM A;  3GP7 A;  4L2Y A;  2K22 A;  4HEA 1;  2Q5W D;  4IWO A;  3GS2 A;  1CZP A;  1VD2 A;  3JW0 X;  1P0R A;  3P42 A;  2NMQ A;  1FO4 A;  2BPS A;  2JYE A;  1YD8 U;  4E74 A;  2IPK D;  2W3R A;  2KDM A;  2KQ7 A;  3R2T A;  1D5X C;  4EE2 A;  1WZ3 A;  5LXI B;  3DBL B;  4YTN B;  2CU3 A;  2WDV B;  3R7R A;  2RPQ A;  2WXM A;  3DPD A;  2C7M B;  2V0G A;  1PQS A;  1SGH A;  4HPP A;  1KH0 A;  3L13 A;  4B9K A;  1CJE A;  4LNO A;  1V81 A;  3K9O B;  4BOS C;  3TEX A;  4CHK A;  5BMI A;  2RDB C;  2J0J A;  3AE9 B;  4KSK C;  2W3S A;  3QHT A;  2JT4 B;  2N9P C;  3UIN B;  4CYE A;  1MVK A;  1ET9 A;  4E3C A;  3TIX A;  3IG3 A;  4WWO A;  2JU6 X;  2MSE D;  3TBL D;  1QZE A;  3KUC B;  4WIP A;  1FMA D;  2XNA C;  1BT0 A;  4USA A;  3NRZ A;  3PRZ A;  2UU7 A;  3VHT C;  3P4Q B;  2YVC A;  4NJC A;  4WJQ A;  3ZJV A;  1AN8 A;  1FRD A;  3WIM A;  1V6E A;  4B0M A;  4EEW A;  3B08 A;  3NS8 A;  1FNU A;  2L52 A;  3L08 A;  4ZHO A;  1YJJ A;  4IC7 B;  5G5G A;  5IA7 A;  1GB1 A;  1N5X A;  3GZN I;  1I4R A;  2IBI B;  3WAP A;  3ZYY X;  4BOZ B;  1VZ6 A;  3AEA B;  5AZG A;  4FA6 A;  3PZ8 A;  1YX5 B;  1I4X A;  1P3Q U;  1WR1 A;  4DK5 A;  5IO9 A;  2G9H D;  3WAL A;  4AQ7 A;  4Q2J A;  3L16 A;  4LDT D;  4LK0 M;  3QIJ A;  4M02 A;  1N63 A;  3R8B A;  3O13 A;  4YSX B;  1EO6 A;  1SE9 A;  2D10 A;  1ZKH A;  1FPY A;  3BK1 A;  4S0R A;  2WDR B;  1J8C A;  2CKH B;  2C9W B;  1NEK B;  4HWI B;  2KMA A;  3AEF B;  4PT5 A;  1DOX A;  2WXO A;  2KTF A;  3RT3 B;  5LXH A;  2LHE A;  3DCG A;  3NZS A;  2CS4 A;  4W9D A;  2L32 A;  1K52 A;  3U7Z A;  2IO1 B;  2DAJ A;  2PE6 B;  3IBE A;  2GI9 A;  2J7Q B;  4H2A A;  3Q6B A;  2M17 A;  2KC2 A;  1E7V A;  2CR5 A;  1C9F A;  1QF6 A;  5H92 C;  1EF5 A;  4OW0 A;  2JWU A;  4JX1 C;  3U30 A;  1TZ1 A;  4KIK B;  1CMX B;  4HCN B;  1UZX B;  2LFI A;  4R3D A;  1QOA A;  1IP9 A;  1RWS A;  3N3K B;  4P6V F;  4ACF A;  3I57 A;  3HHM A;  4GXB A;  1UH6 A;  2DZJ A;  4W9G A;  1YN3 A;  2ZNV C;  1VZ8 A;  2FUG 1;  4DDI D;  1TT5 B;  1OFF A;  3W1S C;  2RDG A;  5L83 A;  1NYR A;  3W2D A;  4ICV A;  1C78 A;  4GLS C;  5D6J B;  3PHX B;  4MDK E;  3SHQ A;  5IAA C;  1SE3 A;  1TYG B;  1LQB A;  4I6P A;  2C7N B;  2I1J A;  1JWS D;  3NHE B;  2GBN A;  2BKF A;  3VR9 B;  3ZVV A;  4DHJ D;  3MTN B;  2NPT A;  5LNK 1;  3BYT B;  1E5W A;  2BYV E;  2KLG A;  4KVG B;  1FNV A;  1OGW A;  1JWU D;  5L95 C;  3D32 A;  1T3Q A;  1TY0 A;  3N9Y C;  1Q0W B;  3VTW A;  3V6C B;  2MX2 A;  1F0Z A;  2ZZP B;  1A5R A;  1KJT A;  3I9V 1;  4PS7 A;  1PGB A;  3OLM D;  4JWS C;  1MPE A;  3BK2 A;  4XGA B;  2BWF A;  1L4D B;  3EC8 A;  2DLB A;  3AEC B;  2NS5 A;  5C2T B;  3VRA B;  5D94 A;  4TKN A;  2EMS A;  1ROE A;  2FCN A;  3ETR A;  2LGD A;  2CJN A;  3ZLZ A;  2JZP A;  1XXG A;  4BAX A;  3SU8 X;  5H8Y E;  2LGY A;  4LTU A;  1P98 A;  1C4C A;  1XQQ A;  2EKE C;  2MBE A;  3GZN B;  2G3Q B;  1FIQ A;  1L0X B;  3T9L A;  3KYC D;  1E8Z A;  2I2Y A;  4MGZ E;  1BML C;  3A4S C;  3W1Y A;  4F7Z A;  4RFB A;  3LXF A;  2KNB A;  3W5U B;  1WGK A;  4XWT A;  2ZJD A;  1QOG A;  4YSY B;  4DHJ B;  2WDT B;  3Q3O C;  1JWA D;  4KGS A;  4MJS A;  3CSF A;  4OZB A;  4ANX A;  2XN9 C;  1P7E A;  4NJ6 A;  2DNF A;  3NY5 A;  2KVZ A;  2PW9 A;  3ZUN A;  1S1Q B;  3QA8 A;  1UWM A;  2NBW B;  2PKO A;  4S17 A;  3H7P A;  3PZD A;  1IGD A;  1C77 A;  4LNF A;  3VH3 B;  4A9A A;  2Y5P A;  3PVL A;  2L3Z A;  4N58 A;  2D07 B;  1TTN A;  1YIW A;  3CMM B;  1K50 A;  2MBO A;  2KWU B;  5FK9 C;  3RUI B;  5MPO A;  1D3Z A;  2DBY A;  1EM7 A;  3ONS A;  2EMT A;  2JVC A;  4FUL A;  3MP9 A;  1HEZ E;  1FFU A;  2N0S B;  1RFK A;  3IXS A;  4NAW B;  4N9F 4;  4UDU C;  3ZXR A;  3BVZ A;  2RD0 A;  3RZF A;  2GRI A;  4DHZ B;  2Z0D B;  3BWU D;  4FN2 A;  2V4L A;  2HTH A;  3AE2 B;  1T5X D;  1UD7 A;  2JXX A;  4WWM A;  3TEW A;  3I5J C;  4WQM A;  2O6V B;  3NVZ A;  1V97 A;  3APC A;  1KLV A;  1XLQ A;  5CHF A;  2IGH A;  4RM8 A;  4K81 A;  4ASW C;  2NBV B;  1FXI A;  1SSN A;  5EE9 A;  3OG5 A;  3RD2 A;  3BVG A;  1GOZ A;  2A4Z A;  2KAJ A;  1EU4 A;  3ZW3 A;  3PT2 B;  1L2N A;  1SXT A;  4LNN A;  2WXK A;  3EFC A;  1EU3 A;  3DDC B;  1WY8 A;  3R3M A;  4A3O A;  5C3J B;  1P9D U;  2N7E A;  1DYQ A;  5DPS A;  2JXT A;  3Q3M C;  3ZNZ B;  1D5Z C;  2PMV A;  2KDI A;  4ITK A;  1F1H A;  5C23 A;  4HDQ A;  1QLB B;  2G4D B;  1EUV B;  1WM2 A;  2Z8L A;  3S2A A;  4M8M A;  3N30 A;  2PVG C;  4II3 B;  2AQ2 B;  4C00 A;  1HQR D;  2EKI A;  3DVG Y;  4EUT A;  4PK1 A;  2LUM A;  1E8Y A;  3KH0 A;  3N1Z C;  4MEL A;  2QEJ C;  3VTV A;  4LNK A;  3V3X A;  4K3C A;  4YSZ B;  1WJ6 A;  1WH3 A;  2Y5B B;  3HK0 A;  4ARC A;  2L83 A;  5JHA A;  3AI5 A;  4C4V B;  2LRU A;  3ZDT A;  1AYF A;  2JPH A;  3PRM B;  2BGF A;  4TSS A;  2MW5 A;  2ZVN A;  5G55 A;  3K9P B;  2MRP A;  2OHF A;  4NAM A;  4K3B A;  3NVW A;  2WLB A;  2MEK A;  1WYG A;  3Q8F A;  1PGX A;  3P4P B;  2KJ6 A;  1WGH A;  3M3J A;  2L05 A;  2ZCB A;  1YQ3 B;  1QOB A;  1SE2 A;  3TL5 A;  3TEY A;  2KQ4 X;  4LLG M;  3ZGZ A;  4KKI A;  1J0G A;  4JPS A;  2OJW A;  3AEE B;  3DWM A;  4B6W A;  1GNU A;  5D7G A;  4PYU A;  1T0R C;  2WNM A;  1PDX A;  1YQB A;  3LJ3 A;  3AV8 A;  2J4X A;  5HKH A;  3AE1 B;  2QC8 A;  4RNA A;  3BYY B;  2LAS A;  1WSP A;  5JHB A;  4PS8 A;  1JQ4 A;  1E90 A;  1WX7 A;  4JGH B;  1WE7 A;  1Y56 A;  3ENE A;  2IGD A;  3PS6 A;  1I4Q A;  1RLF A;  2NTS A;  3WAO A;  2PIA A;  2ASQ A;  4MGY E;  4W9H A;  2C5L C;  2RDH A;  1SIJ A;  1UWX A;  2N9X A;  4EOY A;  4HJK A;  3Q8C A;  4IM3 A;  2FUH B;  1V1O A;  1PYW D;  3P1M A;  4KZ0 A;  5C1Z A;  4HPL B;  1NDD A;  3FIL A;  3Q8A A;  1GUA B;  1TBE A;  4KV2 A;  1Z2M A;  3GE3 C;  1WF9 A;  4LCD E;  1ET6 A;  2VZK B;  5J17 A;  5JH5 C;  1JWB D;  1WRD B;  3QX1 A;  4US8 A;  3AEB B;  2AQ1 B;  3Q69 A;  2HDE A;  4FXC A;  3RNB C;  1YOV B;  5TSS A;  1SJH D;  3RNF C;  3PSE B;  2BW2 A;  2MJE A;  5CHV C;  1E0Z A;  1IBX A;  2LMC A;  4ICU A;  2WU5 B;  3PRP B;  3WAM A;  3LDZ E;  1V1P A;  2PLP A;  1HTQ A;  2IY1 B;  1UF0 A;  3Q8E A;  3DBL I;  4JWU C;  4NNJ B;  2V3P A;  4J3O D;  3VUW A;  3APD A;  1ZOY B;  1KTK A;  3N20 C;  3U8Z A;  4QAY A;  3Q8B A;  2N7J A;  3UF8 A;  3ZJT A;  5AUI A;  2AEH A;  4LJO B;  1Y8R C;  3V60 A;  2KFK A;  2LJ5 A;  2ZEQ A;  1L0Y B;  2O6V A;  4M8N A;  1J7B A;  1HXY D;  1WX8 A;  1KOT A;  3T8M A;  4B0E A;  3DQV A;  3Q3F A;  3FAH A;  3N32 A;  2BQQ A;  1ZPS A;  3QCA A;  2FCQ A;  3Q3N C;  2LD9 A;  2QSD A;  4W9K A;  2CHX A;  2VH2 A;  4M0W B;  2G4S A;  4A20 A;  4F1S A;  2MBH A;  1WGY A;  1C76 A;  2E3T A;  2BYF A;  1LM8 B;  5HI1 A;  4KZC A;  4FLH A;  2KMM A;  1EWY C;  5DPR A;  3QK0 A;  3P2B A;  4TUU A;  1ISN A;  3LYY A;  3DVG X;  3BZD B;  2PJH A;  2MP2 B;  2DYM A;  2LVO A;  5GXG B;  1YN4 A;  2UWQ A;  1UBI A;  1L6V A;  1UBQ A;  4XX5 A;  1HA5 A;  3NVY A;  2XK5 A;  5E6O A;  4DXF A;  2MQJ A;  3ML8 A;  4JE3 B;  1T6B X;  2DYB A;  1FM0 D;  3GB1 A;  2DYO A;  2WDQ B;  3C8Y A;  4KKJ A;  1J19 A;  1AAR A;  1MFW A;  1STE A;  5IP4 D;  4A8X C;  2MCN B;  3OJ4 B;  3N1X C;  1WZ0 A;  4CO7 A;  1KLG D;  1PGA A;  2YLM A;  4FAD A;  4WAA A;  1L5P A;  2K3U A;  3ZTC A;  1ZP0 B;  3DBR I;  4RGT A;  3ZKJ C;  1IGC A;  4A3P A;  4KSL C;  4GMV A;  1WXV A;  3AUL A;  2PVO D;  3AE4 B;  2CHZ A;  3UI3 A;  5EE1 A;  2JYT A;  2NPT B;  2WX0 A;  4OVV A;  1V1P B;  3PO0 A;  2M1M A;  1KRH A;  3QQ8 B;  5DCN A;  2DWQ A;  2KFJ A;  2V3N A;  5LLI A;  3U52 E;  4BKG A;  2ZW1 A;  2WWZ A;  2N4F A;  1N60 A;  2BBC A;  2RSU A;  4I6N B;  3V05 A;  1DOI A;  1F2R I;  4RCO A;  4ZOH C;  2L0F A;  3ZRF A;  2HTM E;  1XCT L;  2BT6 A;  1SJE D;  1SBB B;  1V49 A;  1JRU A;  1HZ5 A;  3C19 A;  2OED A;  4GDK A;  5BMG A;  3MJW A;  3IAM 1;  2HD5 B;  3V61 A;  4K1R B;  2FID A;  2LXC A;  4XE0 A;  3AU5 A;  1YQ4 B;  2FIF A;  1B1Z A;  3NOB A;  5D3D A;  4YTP B;  1I4H A;  4IW0 A;  1KM7 A;  2KLC A;  4BZA A;  1V80 A;  3SD5 A;  3H7P B;  4EFO A;  2LGS A;  2WGS A;  4II2 B;  4C7Z A;  2RPV A;  2VZK D;  3RNA C;  4AS1 A;  3JSV A;  1TKG A;  2W55 A;  1WJ4 A;  1HE8 A;  4G11 A;  3RFZ B;  1JRO A;  1ZW7 A;  3SEB A;  3W1S A;  4HRO A;  4DHZ E;  2HE7 A;  1I4G A;  2BYT A;  4C7Y A;  3UGB B;  2A5U A;  2SEB D;  3A1Q B;  1P1A A;  4PYZ A;  2QMT A;  4HRS A;  2QDF A;  2CJO A;  5AZF A;  3VDZ A;  1WJU A;  1NVI D;  1N5W A;  1H4R A;  3TMP B;  3EUB 2;  1KFY B;  1NI3 A;  4WWN A;  4AOF A;  5HFY A;  4RH6 A;  4RM9 A;  4DQO C;  3A1Q A;  1MJD A;  4GDL B;  1XT9 B;  1VR9 A;  1Q10 A;  2FCM A;  2EEL A;  2BF8 B;  4JIO U;  1WXA A;  3PV1 A;  2XEW A;  4GIV A;  1FCC C;  2Z59 B;  4JQW C;  4KX6 B;  5E6P A;  3Q14 C;  4YTM B;  4OZC A;  3DVN V;  4FJV B;  4XDD A;  1B9R A;  2KN4 A;  4ARI A;  3ECI A;  3SR6 A;  1FNW A;  1K53 A;  4WWP A;  3IFW B;  1XLN A;  1TGZ B;  2M19 A;  1E10 A;  2KWD A;  4LNI A;  3KWV A;  4HJG E;  1TS4 A;  3IAS 1;  3QWZ B;  4P1B C;  4ZRK A;  2K5P A;  2SAK A;  4JLC A;  1WJN A;  2KWC A;  4KDL B;  1HTO A;  4TV3 A;  4IWQ A;  2KTR B;  3NG0 A;  3Q2A C;  4K7U A;  5T8I A;  3ZNG C;  3DOW A;  4RF0 A;  3ZO5 B;  2GOW A;  2X8X X;  2AWT A;  2H88 B;  3GOE A;  3H8H A;  2ICI A;  3URY A;  4GN1 A;  2VH1 A;  2MLB A;  4L23 A;  3WCQ A;  3BIN A;  3V6E B;  3BY4 B;  3A4R A;  3AE6 B;  4W9C A;  3MFG A;  4WH4 A;  2MBB B;  4YXD B;  1KLU D;  2LXA A;  4TQ0 A;  3MC9 A;  3B0A A;  1K8R B;  4BKS A;  5JZE B;  4M01 A;  2GB1 A;  5EDS A;  1UEL A;  2RMM A;  3ML9 A;  1GC6 A;  4X57 B;  2DZI A;  3EFU A;  1H8C A;  4ANV A;  1WYW B;  2IZV B;  2KYW A;  2YEP F;  5EE0 A;  4D2K A;  4XYC A;  4F8C B;  4ZRQ A;  5D3I B;  5J18 A;  1YN5 A;  1E7P B;  2IYD B;  3RN9 C;  2BS2 B;  4IOI E;  4MSM B;  3UIP B;  3BII D;  3PGE A;  4MM3 A;  3VTU A;  4MGI E;  3H7S A;  3X23 A;  2V3S A;  1AWD A;  1GJZ A;  4WJN A;  2C7H A;  2M0X A;  4RGO S;  1MHX A;  2IY0 B;  2K39 A;  2KDE B;  3ZRC A;  2KX3 A;  1HZ6 A;  2WXI A;  3RPF C;  3MHZ A;  4WAF A;  4HKZ E;  1ZE3 D;  2MWS B;  2N7D A;  2DX5 B;  3TCA A;  4OZA A;  4BKS D;  2GBR A;  3ZNI D;  1XF5 L;  1RM6 C;  1FEH A;  1E8X A;  1OEY A;  2LHD A;  2B3A A;  1TKY A;  3CST A;  2JZ3 B;  4EZK A;  5KHQ A;  3U2S C;  2AQ3 B;  2O2V B;  1Q5W B;  2K8B A;  1C3T A;  2FBW B;  1GB4 A;  4NQK E;  1JAL A;  2KDF B;  1M4V A;  1F9J A;  3PLU A;  2M56 B;  2ZNV B;  4L1B A;  5J2R A;  3U7D A;  3VVW B;  1WR6 E;  5IN7 A;  2W82 A;  1RAX A;  2WX1 A;  2K6Q A;  4PS3 A;  4MT5 A;  1FCL A;  3HIZ A;  1P7F A;  3VUX A;  4ZDV A;  1TS5 A;  3R66 C;  3VUY A;  4MEM A;  3ABV B;  5JXV A;  2V4I B;  5AZH A;  2QJL A;  3CWI A;  3KUD B;  3PLV A;  3PPA A;  2UYZ B;  3A9J B;  1WWT A;  4P1C C;  2KTR A;  2HJ8 A;  3I63 C;  3TUO A;  4MH8 A;  1IBX B;  3DBH B;  4HK2 A;  3RNG C;  2GBK A;  4IDI A;  2LUE A;  2FE8 A;  1D5M C;  1RYJ A;  2LRW A;  2RR9 A;  1WMH A;  4WQO B;  4DDG D;  1JW9 D;  1JWM D;  4WJO A;  1J7A A;  2FNJ B;  4HXD A;  3ZJU A;  1R4M I;  2MP2 A;  4MGK E;  2K25 A;  2KHW B;  2E6X A;  4XC2 A;  2R2Q A;  2IGG A;  3C0R B;  4IM0 A;  4HPM B;  3I3T B;  5BMH A;  1L4Z B;  2RGF A;  2NTT A;  3RUL A;  2J0K A;  3QC8 B;  2BS4 B;  2KMC A;  3TEZ A;  3OJ3 A;  2K9X A;  2VRR B;  1T0Q C;  2AYO B;  1TS2 A;  2G45 B;  3X0W A;  4FHJ A;  1TKE A;  1AW7 A;  2WXF A;  1YJI A;  2PE9 A;  1OEY J;  3J9C A;  3V62 A;  2MJ3 A;  1A70 A;  2FCS A;  2L1A A;  3E56 A;  3QAQ A;  1WI0 A;  2AL3 A;  3DVN U;  1CQV A;  1TJE A;  1SF0 A;  4W9F A;  3DHG C;  4N59 A;  4TMA B;  2TSS A;  1IUE A;  2I1K A;  4O1N A;  3B9J A;  3R2I A;  4XWW A;  1ACC A;  3PZ7 A;  1WMH B;  3HUI A;  4US9 A;  2K8C A;  3KWL A;  2K1F A;  3SFE B; 
#chains in the Genus database with same CATH homology
 4EZJ A;  2ZCC A;  3ZUN A;  2NPT B;  3L10 B;  1NBF C;  1S1Q B;  2BKR B;  2PEA A;  2WX0 A;  5DPT A;  3R7Q A;  2KOX A;  3QA8 A;  3WAN A;  2NBW B;  4OVV A;  4YL8 A;  2M1M A;  4AUQ C;  5DPW A;  3H7P A;  3PZD A;  3QQ8 B;  3VH3 B;  4BVU C;  2KDB A;  5DCN A;  1E8W A;  3PTF C;  3PVL A;  3L54 A;  4IG7 B;  2L3Z A;  2O6V D;  2DEN B;  2KFJ A;  2IO0 B;  2D07 B;  1TTN A;  4AP4 C;  1YIW A;  3CMM B;  5LLI A;  1V2Y A;  4BKG A;  2WWZ A;  4NQL B;  2MBO A;  2KWU B;  3Q3J A;  2KZR A;  2N4F A;  3RUI B;  2N9E B;  1D3Z A;  2DZM A;  3M63 B;  2RSU A;  3ONS A;  2EMT A;  4I6N B;  3L0W B;  2JVC A;  4AJY B;  1IPG A;  4FUL A;  4GB9 A;  1EF1 A;  1GG3 A;  2N1V A;  2D2Q A;  3PRE A;  4NAW B;  4W9J A;  2L0F A;  3ZRF A;  4LJP B;  4BBN C;  3RCZ A;  4N9F 4;  2LWP A;  4W9L A;  2LGX A;  2GMI C;  1OQY A;  2XK5 B;  2OJR A;  2RD0 A;  3RZF A;  2KJH B;  4TQ1 A;  1V49 A;  1JRU A;  4DHZ B;  2Z0D B;  1V9J A;  2REX A;  4GDK A;  5KHO A;  3A33 B;  3MJW A;  1VCB A;  2HD5 B;  4FN2 A;  3V61 A;  2V4L A;  4K1R B;  2FID A;  1WFY A;  2HTH A;  2LXC A;  3AU5 A;  4GOC A;  4NPN A;  5FR6 A;  5GMV A;  1LFD A;  2FIF A;  1UD7 A;  2GBM A;  1WX9 A;  3NOB A;  2JXX A;  2ZPY A;  1I42 A;  2KC1 A;  3JSV B;  3PHW B;  1S3S G;  4IW0 A;  3RYT A;  4B95 A;  1YX6 B;  2NBU A;  1KM7 A;  4FHK A;  2KLC A;  4G0N B;  1UGM A;  2ZPN A;  4URK A;  2LVP A;  2O6V B;  1V80 A;  3SD5 A;  3APC A;  3H7P B;  1KLV A;  2KVR A;  3VFK A;  1M94 A;  4EFO A;  5CHF A;  2BYE A;  2DAF A;  2K6D B;  4II2 B;  4RM8 A;  4ZRJ A;  4K81 A;  3RZW C;  4NY0 A;  5TR5 A;  4ASW C;  4K7S A;  2NBV B;  3UQA A;  3JSV A;  1YJ1 A;  1WJ4 A;  2KKC A;  2KO3 A;  4KIK A;  1HE8 A;  4G11 A;  3IVF A;  4G3X B;  1ZW7 A;  3RD2 A;  3UQB A;  2A4Z A;  1U4A A;  3W1S A;  4DHZ E;  1V86 A;  2HE7 A;  4G50 A;  2W9N A;  3ZW3 A;  3PT2 B;  3UGB B;  2A5U A;  1L2N A;  3A1Q B;  4GU2 A;  2ZVO A;  3MHS D;  4BFR A;  1P1A A;  4PYZ A;  4NJ7 A;  1RFA A;  5E6N A;  3JYU A;  5BO4 B;  4J6I A;  5AZF A;  4BKT A;  3DDC B;  4DXA B;  1G6J A;  2KFK B;  1WY8 A;  3R3M A;  3CF6 E;  3ALB A;  3TJP A;  3VDZ A;  1MG8 A;  1P9D U;  4A3O A;  1WJU A;  1XD3 B;  2KXJ A;  4HLE A;  1I35 A;  2N7E A;  4GDK B;  4GSW A;  1H4R A;  4XZ4 A;  3TMP B;  5DPS A;  3APF A;  2WYQ A;  4WWN A;  4IM2 A;  1WXS A;  3ZNZ B;  4AOF A;  4RM9 A;  2CHW A;  2KDI A;  3A1Q A;  4GDL B;  1XT9 B;  4HDO A;  4FBJ B;  2FCM A;  2C60 A;  4JIO U;  2BF8 B;  1WXA A;  1V5O A;  2R2O A;  3AXC A;  5C23 A;  4EZL A;  3PV1 A;  2XEW A;  4GIV A;  2L0T A;  1WGD A;  4HDQ A;  2G4D B;  2Z59 B;  4JQW C;  5E6P A;  1OTR B;  1IYF A;  1EUV B;  2KK8 A;  4ZRI A;  1WM2 A;  4IWP A;  3DVN V;  3S2A A;  1WXM A;  3KYD D;  4FJV B;  4M8M A;  4IWO A;  3N30 A;  1VD2 A;  3JW0 X;  3ECI A;  4II3 B;  3VQI A;  1P0R A;  4KDI C;  4WWP A;  3DVG Y;  3IFW B;  4EUT A;  1E8Y A;  3EHV A;  1WGR A;  3KH0 A;  1TGZ B;  4MEL A;  4MH0 E;  3VTV A;  2BPS A;  1YD8 U;  1C1Y B;  4E74 A;  1WJ6 A;  3QWZ B;  2KQ7 A;  1WH3 A;  2Y5B B;  1WZ3 A;  3HK0 A;  5LXI B;  4ZRK A;  4JLC A;  1WJN A;  1GC7 A;  1ZGU B;  5JHA A;  2L7R A;  3AI5 A;  2QHO A;  2LRU A;  3B1L X;  2KWC A;  4KDL B;  3KW5 B;  4TV3 A;  2JPH A;  4IWQ A;  3R7R A;  3ZDT A;  3PRM B;  2BGF A;  1T0Y A;  2RPQ A;  2MW5 A;  2D11 A;  3DPD A;  2ZVN A;  5G55 A;  2C7M B;  2KTR B;  3HM6 X;  1PQS A;  3K9P B;  4HCP B;  4K7U A;  2MRP A;  3ZNG C;  1SGH A;  3L13 A;  4B9K A;  3DOW A;  4GDL A;  3ZO5 B;  2GOW A;  2AWT A;  1V81 A;  3K9O B;  2KJ6 A;  4BOS C;  3GOE A;  4CHK A;  4AJW A;  1WGH A;  2N1W A;  2J0J A;  3M3J A;  4GN1 A;  2L05 A;  4KSK C;  2ZCB A;  2MLB A;  3QHT A;  2JT4 B;  3BIN A;  3V6E B;  3TL5 A;  2N9P C;  3BY4 B;  2KQS A;  3A4R A;  4W9C A;  3UIN B;  4CYE A;  2MBB B;  4E3C A;  2LXA A;  1J0G A;  3TIX A;  5CTR C;  3IG3 A;  4WWO A;  4TQ0 A;  3B0A A;  4DBG A;  1K8R B;  2MSE D;  4BKS A;  5JZE B;  3TBL D;  4B6W A;  1GNU A;  1QZE A;  3EEC A;  5D7G A;  2D3G A;  3KUC B;  2K8H A;  4PYU A;  3ZNH B;  1BT0 A;  1YQB A;  3LJ3 A;  4GGQ A;  3PRZ A;  3H1U A;  5EDS A;  2DHZ A;  1UEL A;  3VHT C;  1WM3 A;  3ML9 A;  5HKH A;  3DBS A;  3ZIM A;  2YVC A;  1GC6 A;  4X57 B;  4WJQ A;  2LAS A;  3WIM A;  1V6E A;  2DZI A;  3EFU A;  5G2N A;  4EEW A;  1H8C A;  4ANV A;  3B08 A;  1WYW B;  3NS8 A;  3VXW A;  2IZV B;  3L08 A;  2L00 B;  5JHB A;  4PS8 A;  1E90 A;  4IC7 B;  5IA7 A;  1WX7 A;  5CHW A;  4JGH B;  1RRB A;  3GZN I;  4F8C B;  2CU1 A;  2M4N A;  2JUO A;  1V5T A;  1WE7 A;  3ENE A;  4RMA A;  2IBI B;  4P7I A;  3WAP A;  4BOZ B;  5AEK B;  2LVQ A;  5J18 A;  3PS6 A;  3WAO A;  1RLF A;  2IYD B;  5AZG A;  4AWJ A;  4FA6 A;  2ASQ A;  4MGY E;  4W9H A;  1Z5S B;  4MSM B;  2AL6 A;  3AU4 A;  2C5L C;  3UIP B;  3PGE A;  2N9X A;  1YX5 B;  1P3Q U;  4EOY A;  1WR1 A;  4HJK A;  4DK5 A;  4MM3 A;  3VTU A;  3WAL A;  4EKU A;  4IM3 A;  4MGI E;  3L16 A;  3A9K A;  4LDT D;  5CX3 A;  2FUH B;  1Q1O A;  3QIJ A;  2MBQ A;  3H7S A;  4KZ0 A;  5C1Z A;  3X23 A;  2V3S A;  1GJZ A;  4HPL B;  4WJN A;  2C7H A;  2M0X A;  2NCN A;  4E71 A;  2IY0 B;  2K39 A;  1NDD A;  1EO6 A;  2KX0 A;  4OVU A;  1SE9 A;  1GUA B;  2KDE B;  4WJP A;  3ZRC A;  2D10 A;  1ZKH A;  4NAW A;  2KX3 A;  4W9E A;  1TBE A;  4KV2 A;  1Z2M A;  1J8C A;  2CKH B;  1WF9 A;  2C9W B;  2MA9 B;  4LCD E;  4HWI B;  1E7U A;  2KMA A;  5J17 A;  2KTF A;  3RT3 B;  5JH5 C;  1WRD B;  3QX1 A;  5LXH A;  3DCG A;  3A9K B;  3NZS A;  2CS4 A;  2MWS B;  2N7D A;  4W9D A;  4K7W A;  2DX5 B;  2IO1 B;  3TCA A;  2DAJ A;  2PE6 B;  4BKS D;  4LDT B;  3IBE A;  2GBR A;  3ZNI D;  3PSE B;  2J7Q B;  1E8X A;  1OEY A;  3O65 B;  3VH4 B;  2KAN A;  2B3A A;  2M17 A;  2KC2 A;  5CHV C;  3CST A;  1E7V A;  3VAW A;  2CR5 A;  3H9D A;  4ICU A;  2LI5 A;  2JZ3 B;  1FXT B;  4EZK A;  5KHQ A;  4ZYN A;  1EF5 A;  3PRP B;  3WAM A;  3LDZ E;  2NR2 A;  2IY1 B;  1Q5W B;  2O2V B;  2BWE S;  2K8B A;  1C3T A;  4NQK E;  3U30 A;  2KDF B;  3L17 A;  4DWF A;  1F9J A;  3PLU A;  2ZNV B;  1TZ1 A;  3DBL I;  2PPH A;  5J2R A;  4KIK B;  1CMX B;  2IO2 B;  4HCN B;  3U7D A;  3VVW B;  1UZX B;  1WR6 E;  2IO3 B;  3DBH I;  4NNJ B;  1RAX A;  2WX1 A;  2K6Q A;  4PS3 A;  4ANW A;  3HIZ A;  1IP9 A;  3VUX A;  3VUW A;  3APD A;  3N3K B;  4ZDV A;  2XBB C;  3U8Z A;  3HHM A;  3R66 C;  3VUY A;  4GXB A;  1UH6 A;  4MEM A;  5AZH A;  3KUD B;  3PLV A;  2DZJ A;  4W9G A;  3UF8 A;  3PPA A;  2AEH A;  2ZNV C;  2JRI B;  4DDI D;  2UYZ B;  3A9J B;  4LJO B;  1NI2 A;  3M95 A;  3SDL C;  2GBJ A;  3W1S C;  1Y8R C;  2KTR A;  3QJZ A;  3V60 A;  2KFK A;  2LJ5 A;  5L83 A;  2HJ8 A;  2KD0 A;  2ZEQ A;  2O6V A;  3M62 B;  4M8N A;  4ICV A;  3H6N A;  1WX8 A;  1KOT A;  4HK2 A;  5D6J B;  3PHX B;  4MDK E;  3T8M A;  3SHQ A;  5IAA C;  2GBK A;  3DQV A;  2LUE A;  1LQB A;  4I6P A;  3JVZ X;  3Q3F A;  2C7N B;  2I1J A;  1SIF A;  2LRW A;  2M8S A;  1WGG A;  3NHE B;  2RR9 A;  3N32 A;  1WMH A;  2GBN A;  4WQO B;  3QCA A;  2BKF A;  4DDG D;  2OOB B;  2FCQ A;  3ZVV A;  4DHJ D;  2LD9 A;  4W9K A;  4IUM B;  3MTN B;  2NPT A;  2CHX A;  2JRH A;  4M0W B;  4WJO A;  1E5W A;  2BYV E;  2KLG A;  2L76 A;  2KN5 A;  2L8J A;  2FNJ B;  4HXD A;  4KVG B;  2G4S A;  1OGW A;  4A20 A;  1R4M I;  2MP2 A;  4F1S A;  2JZZ A;  4MGK E;  2K25 A;  2MBH A;  1WGY A;  5L95 C;  2BYF A;  2KHW B;  3D32 A;  3WA0 A;  1LM8 B;  3NZU A;  4KZC A;  4XC2 A;  4FLH A;  1Q0W B;  2R2Q A;  3V6C B;  3VTW A;  1WIA A;  5DPR A;  2MX2 A;  3QK0 A;  3P2B A;  1ISN A;  2ZZP B;  3C0R B;  4TUU A;  1A5R A;  4IM0 A;  3DVG X;  1KJT A;  4HPM B;  4PS7 A;  3OLM D;  3I3T B;  2PJH A;  2FAZ A;  2MP2 B;  4I6L B;  1X1M A;  2BWF A;  2RGF A;  3EC8 A;  2DYM A;  2LVO A;  3A9J A;  4FJZ A;  3RUL A;  2J0K A;  2UWQ A;  2NS5 A;  3QC8 B;  2KMC A;  1UBI A;  2O2V A;  4HVB A;  1UBQ A;  5D94 A;  4XX5 A;  4MSQ B;  4TKN A;  3OJ3 A;  3ZTD A;  2VRR B;  2EMS A;  4MJS B;  1LXD A;  4ANU A;  2FCN A;  2AYO B;  2XK5 A;  5E6O A;  2LGD A;  2MQJ A;  2G45 B;  3ML8 A;  2NVU I;  2V1Y A;  3ZLZ A;  2DYB A;  3X0W A;  2KJR A;  3QAR A;  3SU8 X;  2J0M A;  4FHJ A;  2LGY A;  2DYO A;  3UIO B;  3ZDM C;  1J19 A;  2PE9 A;  1P98 A;  1AAR A;  2JWZ A;  2KWV B;  1XQQ A;  2EKE C;  1OEY J;  2MBE A;  3V62 A;  4W9I A;  2MCN B;  1R4N I;  2FCS A;  3KVF B;  2G3Q B;  2DZK A;  3OJ4 B;  3QAQ A;  1WI0 A;  2AL3 A;  3T9L A;  3DVN U;  3KYC D;  4JL9 A;  1E8Z A;  1WZ0 A;  4CO7 A;  2JY6 A;  2JF5 A;  4MGZ E;  4W9F A;  2YLM A;  3A4S C;  2Z0E B;  4WAA A;  3W1Y A;  3HM3 A;  4F7Z A;  4FAD A;  1WE6 A;  4BBN F;  2KNB A;  2I1K A;  3ZTC A;  2ZJD A;  3DBR I;  3OAW A;  3IHP C;  4DHJ B;  2WDT B;  3ZKJ C;  1WMH B;  3KUZ A;  4A3P A;  1L7Y A;  4MJS A;  3CSF A;  2K8C A;  4GMV A;  4KSL C;  5D2M B;  4ANX A;  2K1F A;  1WXV A;  3AUL A;  4NJ6 A;  2CHZ A;  4FJY A;  3NY5 A;  2LZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...