4ICUA

Ubiquitin-like domain of human tubulin folding cofactor e - crystal from a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
QLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Tubulin-specific chaperone E
total genus 24
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4icuA00
4W9FA 4WJPA 2HE7A 2FIFA 2OJRA 4JQWC 4BOSC 3VTUA 4URKA 1UD7A 1C3TA 1ISNA 2DYOA 5IAAC 3VH4B 2KANA 1G6JA 2JVCA 1YJ1A 2ZVOA 4IM0A 1RRBA 4AJYB 4RM8A 3AU5A 3V6EB 1WGRA 3APDA 4HK2A 3OJ4B 2MBBB 1V80A 3SD5A 3ZNID 1EUVB 3UF8A 2BKFA 4YL8A 1OGWA 4EFOA 3NOBA 4WWOA 3ML8A 1P0RA 2KX0A 2N1WA 4MSQB 2PE6B 2LRUA 2N4FA 2KOXA 2L05A 2LVPA 4GOCA 1WXAA 2CHXA 2MA9B 4TKNA 2LWPA 2PJHA 4ZRKA 2DZKA 4M0WB 5G2NA 3PS6A 2C5LC 4GN1A 5CHWA 2G45B 2GOWA 3APCA 2W9NA 3RZFA 2K8HA 3A1QB 2LGDA 3DVGY 2LXAA 2ASQA 2M1MA 3VUXA 2BPSA 2K6DB 1WXMA 2BWES 4B95A 2FNJB 4HDQA 2KDIA 3M63B 2CR5A 3N32A 5IA7A 3L0WB 3WIMA 5JH5C 2JZ3B 2KFJA 3A9JB 4BKSD 1SE9A 4FA6A 3WAOA 3L54A 4FJYA 1H8CA 4NAWA 3DQVA 3IFWB 4MM3A 5D7GA 1UBQA 2PPHA 4BBNC 1GNUA 3VHTC 2C9WB 3X0WA 2O6VB 3GZNI 4W9HA 1TBEA 4G11A 2NBWB 4NPNA 2MQJA 4KDIC 2K8CA 2KZRA 3JSVA 5J17A 2C7HA 3N30A 4M8NA 2KJRA 2ZJDA 4F7ZA 1ZGUB 4ASWC 2L7RA 1OTRB 3A33B 3RZWC 5CX3A 4EEWA 5JHBA 3JSVB 2V1YA 1PQSA 3SHQA 2HD5B 4MDKE 1WE6A 1WR6E 2MBHA 5L95C 1EF5A 3EECA 4MGYE 4EZLA 3DBLI 3PRZA 2AL6A 3QJZA 5AEKB 2MBOA 3RD2A 3ZW3A 3ZNZB 2O6VA 4KZCA 3UQBA 3DBHI 2KWVB 2IZVB 3ZRCA 3ZDMC 1FXTB 5BO4B 1E7UA 3RULA 3VUWA 1UZXB 1V49A 4DXAB 1I42A 1IYFA 1WRDB 4KSLC 4IWQA 4NY0A 1V6EA 2K6QA 2KTFA 2IBIB 2ZCCA 3KYCD 2JPHA 2FUHB 3RT3B 2G3QB 3B1LX 1MG8A 3A1QA 4M8MA 1LM8B 1YX6B 2NS5A 2KWCA 2GBKA 2MBEA 2KQ7A 2LGXA 2C7MB 4JL9A 2IYDB 1L7YA 4WJOA 3VFKA 1TTNA 3LDZE 2L0FA 2FCNA 3T8MA 2BYVE 3OLMD 3QQ8B 5DPSA 2RPQA 4EZJA 1GC6A 3A9JA 3EFUA 1WZ0A 2HTHA 3ZNGC 2MSED 3K9PB 4W9KA 1WJNA 1WF9A 4IM3A 1P1AA 4AJWA 1BT0A 5LXIB 1H4RA 4GDLA 2KWUB 4GDKB 2D3GA 4W9JA 1WGDA 4FULA 1Q0WB 3QHTA 3ML9A 2UYZB 5CTRC 2FIDA 5JHAA 3UQAA 1OQYA 4A20A 4EOYA 1YX5B 3S2AA 1WYWB 2JUOA 3O65B 1Z2MA 3TJPA 4BKTA 1WH3A 2ZPYA 2J7QB 4FHJA 2AEHA 4I6PA 3M95A 3QA8A 4EKUA 4G3XB 2JZZA 4GMVA 4A3OA 1V5OA 3H9DA 5D94A 4W9GA 2AL3A 2DYBA 3PRMB 4DBGA 2KTRA 3EC8A 1E7VA 3DCGA 2NBVB 2KD0A 2EMTA 4KIKA 3ZTCA 3OAWA 1WGGA 5DPWA 3VAWA 1XT9B 4BBNF 4DWFA 1GJZA 1V9JA 3QCAA 5KHQA 1E8YA 1WMHB 1AARA 3WAPA 2DX5B 2GBRA 3AXCA 5EDSA 1V81A 4AP4C 3H7SA 3KUCB 2KLCA 4FJZA 2KN5A 4MSMB 2J0JA 4N9F4 5TR5A 4EZKA 2Z0EB 3CF6E 2IY0B 2D11A 2RD0A 5AZFA 4F1SA 1WX7A 2DZMA 4BOZB 1S3SG 2LI5A 2ZPNA 2G4DB 4MH0E 1YD8U 2JF5A 1HE8A 1WGHA 4IWOA 3NZUA 2N7EA 3BINA 2XK5B 2AWTA 3C0RB 4MGZE 4NAWB 3Q3FA 2IO3B 2XBBC 1WR1A 4WWNA 1KLVA 4W9LA 4XX5A 5E6OA 1P98A 1S1QB 3DDCB 3H7PB 3DPDA 3K9OB 5FR6A 3TCAA 1V86A 3U7DA 3VTWA 2KC2A 3JVZX 3L13A 4KIKB 3KYDD 3VQIA 3AI5A 4MEMA 4K7UA 4ZDVA 5G55A 2RSUA 2KFKB 1NDDA 2ZCBA 1YIWA 2A5UA 1WJ4A 3PGEA 1K8RB 4ZRIA 3X23A 2M17A 4CO7A 2Z0DB 4G0NB 1CMXB 1UBIA 1D3ZA 1XD3B 2D10A 3KVFB 1RLFA 4NQKE 1Z5SB 2V4LA 1WX8A 2EMSA 4K1RB 5E6PA 3HK0A 3A4SC 3HM6X 4GSWA 4HXDA 4NJ7A 2L76A 2JXXA 2LASA 2REXA 3CSTA 4PYZA 4TQ0A 2BGFA 3WANA 3IBEA 3QAQA 4B9KA 2QHOA 2JT4B 2KTRB 3A9KB 1WFYA 3PHXB 2GMIC 4JIOU 1WIAA 3PT2B 5DPTA 4B6WA 4PS7A 4W9DA 2NPTA 3TBLD 4HVBA 1UH6A 4HPLB 3RCZA 3NZSA 2WDTB 3NY5A 4GDKA 4TQ1A 2N9XA 4BKGA 2KNBA 3L16A 5D6JB 2MP2B 2WX1A 2ZEQA 2FCQA 3PSEB 4WWPA 4HCNB 2L3ZA 1P9DU 2KDEB 4ICUA 3WALA 4ZYNA 2WYQA 3R66C 4ANUA 4GU2A 4LCDE 3N3KB 3SDLC 2DZIA 4I6NB 1RAXA 2N7DA 4XC2A 3TIXA 3UGBB 2KVRA 3KUDB 1TGZB 5DCNA 1QZEA 2DENB 1VCBA 1WM3A 4BKSA 4DHJB 1EF1A 2JY6A 4IUMB 4IW0A 1P3QU 1Y8RC 3IHPC 2PE9A 3R3MA 4KZ0A 5DPRA 3ZO5B 3JYUA 4IC7B 2D07B 3DBRI 1J0GA 1SGHA 1U4AA 4IM2A 3Q3JA 1T0YA 1L2NA 2CU1A 1J8CA 3T9LA 3EHVA 4K7SA 1A5RA 3AU4A 2K39A 3NHEB 3PV1A 2L00B 1IP9A 4EUTA 3DVNV 1EO6A 1YQBA 2DAFA 3ZUNA 1R4MI 2IO0B 2BF8B 2LJ5A 3QIJA 4DK5A 3CSFA 1C1YB 3PVLA 2KMAA 2Y5BB 4FLHA 4MELA 4E3CA 5J18A 3QARA 3ZIMA 2BWFA 2KDBA 2KDFB 4NQLB 2YVCA 2LRWA 4ZRJA 3ZKJC 2IY1B 4I6LB 2CHWA 4CYEA 3QK0A 3UIPB 5LXHA 2KK8A 2XEWA 3ONSA 2ZNVB 3IG3A 4FJVB 4WAAA 1KOTA 1GUAB 2YLMA 2R2OA 4DHZB 2BKRB 2R2QA 2AYOB 2IO1B 1E8XA 4II3B 1GC7A 4RMAA 3VXWA 2M0XA 3HM3A 2CS4A 4RM9A 4NNJB 2NR2A 3V6CB 3ZRFA 4LJPB 3NS8A 2FAZA 4GB9A 5CHVC 3ECIA 2L8JA 4K81A 2KXJA 1WXSA 3ZDTA 2PEAA 1I35A 5J2RA 1WMHA 3B08A 2EKEC 4GIVA 2JRHA 3R7QA 4XZ4A 2MBQA 3RYTA 2WWZA 2B3AA 3ZVVA 5KHOA 1E5WA 1LFDA 3APFA 1WE7A 2K1FA 1Q5WB 4KDLB 2I1KA 4W9IA 4DDGD 3MTNB 2LGYA 5CHFA 2K8BA 3ENEA 4HJKA 3BY4B 3L17A 2GBMA 2LUEA 3PLVA 2KMCA 3W1SC 4BFRA 3VUYA 1KJTA 1V2YA 3RUIB 3QC8B 3WA0A 1JRUA 4MJSB 4WJQA 4TUUA 4LDTB 1SIFA 2KO3A 2MRPA 2KJHB 4AOFA 3PREA 4AWJA 4TV3A 3R7RA 2KC1A 2ZNVC 4E74A 2DZJA 2MP2A 3V62A 1WZ3A 5D2MB 4FADA 2O6VD 5AZHA 1E8ZA 2BYEA 2MWSB 4X57B 1IPGA 1XQQA 4F8CB 5AZGA 2O2VB 1GG3A 3D32A 2KKCA 4WQOB 2M8SA 3ZNHB 1VD2A 4GDLB 1KM7A 2A4ZA 4KV2A 2DYMA 2C7NB 1WY8A 2RR9A 2JWZA 2K25A 3GOEA 1R4NI 3HHMA 3UINB 3W1SA 2FCMA 2KX3A 5HKHA 3W1YA 3PRPB 1X1MA 3A9KA 4HLEA 4DDID 2LXCA 2N9PC 3WAMA 4ANWA 1RFAA 4IG7B 5C23A 5JZEB 1WX9A 2MW5A 4AUQC 2I1JA 4ICVA 2NCNA 1UELA 3DVGX 3ALBA 3TL5A 4II2B 2LVOA 4A3PA 1NI2A 3PPAA 4IWPA 1LXDA 1V5TA 4GGQA 2KFKA 2NPTB 4P7IA 3M62B 3VH3B 3L10B 3B0AA 3KH0A 1ZW7A 2DHZA 1J19A 1E90A 2KLGA 2NBUA 2ZVNA 3PZDA 4KSKC 2VRRB 2NVUI 2N9EB 4K7WA 3VVWB 4HPMB 3H1UA 4PYUA 2DAJA 2KHWB 4W9EA 1Q1OA 4MJSA 4OVUA 1TZ1A 3I3TB 3V60A 4E71A 3UIOB 4PS8A 4ANVA 4CHKA 5C1ZA 2ZZPB 3CMMB 4DHJD 3H6NA 2OOBB 5E6NA 4FBJB 1ZKHA 3ZLZA 3QWZB 2MLBA 2XK5A 3HIZA 4OVVA 2KQSA 4LDTD 1WI0A 2N1VA 3AULA 3MJWA 3SU8X 2G4SA 3KUZA 2C60A 3PLUA 2RGFA 3VTVA 3TMPB 4DHZE 1WXVA 2KJ6A 2UWQA 4FHKA 3V61A 2IO2B 4ANXA 3PHWB 2MCNB 3P2BA 1WGYA 4PS3A 1WJUA 2Z59B 3MHSD 4BVUC 3OJ3A 4HCPB 1LQBA 2J0MA 3H7PA 4MGIE 2GBNA 1WJ6A 5LLIA 3L08A 3DBSA 2BYFA 1UGMA 3PTFC 2J0KA 4KVGB 3M3JA 3ZTDA 2WX0A 4HDOA 3DVNU 4WJNA 1WM2A 2LZ6A 3IVFA 3U8ZA 4MGKE 2FCSA 4G50A 2CHZA 2LD9A 4LJOB 2GBJA 2O2VA 4JGHB 3LJ3A 4GXBA 1OEYJ 2JRIB 2L0TA 4JLCA 3QX1A 1F9JA 2V3SA 3KW5B 3VDZA 4FN2A 2D2QA 2MX2A 4J6IA 4W9CA 4NJ6A 3DOWA 3JW0X 5GMVA 5L83A 3U30A 1E8WA 1OEYA 2CKHB 4HWIB 1M94A 2HJ8A 2M4NA 1NBFC 3A4RA 2LVQA
chains in the Genus database with same CATH superfamily
4WJPA 2BYTA 4URKA 2OEDA 3GB1A 1QT9A 3VH4B 1V80A 1ZXIA 3NOBA 2KAJA 3BYYB 3ML8A 4WWOA 2PE6B 1KF6B 3N20C 1JCKB 3RNGC 1WXAA 2CHXA 2MA9B 1F52A 1DOIA 5G2NA 1TZOA 2LGIA 2C5LC 4RF1A 4JWSC 2LXAA 2ASQA 1UNSA 2WXOA 2K6DB 2BB5A 2MJEA 3NRZA 4HDQA 2KDIA 3M63B 5IA7A 3L0WB 3GE8C 2KFJA 4BKSD 2DNFA 2PTLA 4XE0A 1CZPA 2OHFA 3P1MA 3IFWB 1KLGD 2PPHA 3VHTC 2INDC 4WH4A 4O1NA 2NBWB 1YNTE 4C56C 4KDIC 3RI7C 3L4PA 2C7HA 2INCC 2L7RA 3EA6A 3AEEB 4MDKE 1WE6A 1WR6E 1FM0D 3PRZA 3RD2A 4KZCA 3UQBA 2IZVB 3AEDB 4CQNA 4NJCA 1EU3A 1WRDB 1XF5L 2GRIA 3MHZA 2V3NA 2IBIB 1ET6A 2YEPF 3RT3B 3A1QA 4M00A 1LM8B 1HQRD 1MI0A 2GBKA 4Q2JA 2KQ7A 2LGXA 1I4QA 1UUPA 3ZXVA 3CIRB 2FCNA 1SJHD 3OLMD 1WWTA 4YTPB 1GC6A 3A9JA 2WXMA 1CJEA 2HTHA 3ZNGC 1MHHE 4GDKB 4W9JA 3N9YC 2D5GA 5HFYA 3UQAA 4A20A 4EOYA 1YX5B 1WYWB 3O65B 1Z2MA 4BKTA 2QIEB 3M95A 3QA8A 3HUIA 4G3XB 4W9GA 4JWUC 1PGAA 3EGRA 3MC8A 3PRMB 4DBGA 2PW9A 4YSYB 3AE2B 1JALA 2KD0A 3AEFB 2EMTA 5DPWA 2DBYA 2K22A 1XT9B 4DWFA 1V9JA 4N59A 2H88B 1WMHB 1AARA 3RNEC 3WAPA 1E6EB 4AP4C 4MSMB 2J0JA 5TR5A 3PZ7A 4EZKA 2D11A 2WXHA 1WX7A 2LI5A 3ABVB 1N62A 2QMTA 1IGDA 2JF5A 3BINA 3Q3FA 3W5VB 2XBBC 4XX5A 5E6OA 3V3XA 2AQ1B 1NI3A 3H7PB 3DPDA 3K9OB 3TCAA 3ZGZA 3Q3MC 1N6ZA 1V86A 3U7DA 1TY0A 2KC2A 3L13A 5AUKA 3KYDD 3AI5A 2A5UA 4ZRIA 1HA5A 2M17A 5H92C 4YTMB 2V4LA 1WX8A 3CSTA 4PYZA 3IBEA 4D2KA 1FCLA 2KTRB 4LNNA 3A9KB 1GB4A 1NEKB 4JIOU 5DPTA 2AQ2B 1HTQA 2NPTA 3TBLD 1JWMD 4HVBA 4EE2A 1TKGA 4A55A 3NY5A 2KNBA 2LHDA 4ICUA 3WALA 4ZYNA 2WYQA 4LCDE 4I6NB 2N7DA 1VR9A 3NUHB 4DHJB 5BYQA 4IUMB 4IW0A 1Y8RC 2PE9A 3ZO5B 1RYJA 3B2FA 2E6XA 3Q3JA 4IM2A 4BAXA 1RFKA 2WXKA 3W5UB 3EHVA 2HTME 3AU4A 5FR3A 4EUTA 1PGXA 1YQBA 2WXQA 1R4MI 5J18A 1N63A 4AS1A 5D3IB 2BWFA 1YJIA 5C3JB 2YVCA 4ZRJA 3ZKJC 3ONSA 4LNIA 4FJVB 4WAAA 4NZLB 3I63C 1DOXA 2YEPB 1HEZE 1XCTL 2LFIA 2IO1B 3BK2A 2EELA 2M0XA 2BVCA 1L4ZB 1V1OA 3ZRFA 1YN3A 4LNKA 2FAZA 3ECIA 4GB9A 4ZHOA 2Y5CA 3RNAC 5J2RA 2KDMA 5IOIA 1WMHA 2EKEC 2JRHA 1AYFA 1WE7A 2K1FA 2I1KA 1TY2A 3W9CB 2ON8A 2GBMA 3NG0A 3PLVA 3RNBC 2KMCA 4YSZB 1XXGA 1L6VA 1KJTA 1FRDA 1JRUA 2H89B 4TUUA 1BMLC 4LDTB 4AOFA 4AWJA 1IBXB 2MP2A 3V62A 1WZ3A 3NZ3A 2O6VD 5AZHA 1XQQA 3BYTB 2KKCA 4WQOB 1VD2A 2JWUA 4GDLB 1KTKA 1QOBA 2C7NB 3DBRB 4YXDB 1GPXA 3RNFC 4LTUA 3W1YA 3PRPB 1TYGB 4DDID 3I5JC 4ANWA 3BWUD 4IG7B 4L23A 2I1JA 1UELA 3DVGX 2XNAC 1FCCC 1V5TA 4GGQA 3U52E 2LHEA 2NPTB 3M62B 2AQ3B 2KMMA 4RH6A 3B0AA 5FKAC 2KLGA 2VRRB 4K7WA 4YT0B 4DQOC 3V60A 4E71A 1GOZA 4CHKA 5C1ZA 1FO4A 2OOBB 3NS1A 2WDRB 4FBJB 1ZKHA 3QWZB 2XK5A 3HIZA 1ZE3D 4OVVA 4US9A 1MPEA 4LDTD 1WI0A 2N1VA 3AULA 3SU8X 3PLUA 2RGFA 5E6JA 2IO2B 4OZBA 3PHWB 2MCNB 3BZDB 3GS2A 2Z59B 3MHSD 4HCPB 3DBSA 3DVNU 2LZ6A 1K53A 1RM6C 4YTNB 1F2RI 2LD9A 4LJOB 4GXBA 2JRIB 2L0TA 3KW5B 4FN2A 2D2QA 4ARIA 4W9CA 3DOWA 3JW0X 3U30A 1C4CA 2HJ8A 2IGDA 1NBFC 4M01A 3ZQ4A 2OJRA 3ZJVA 4P6VF 1C3TA 5IAAC 2BQQA 1G6JA 1YJ1A 1RRBA 3ZNID 1D5MC 3B2GA 3RFZB 3N1ZC 1EWYC 2RMMA 2KX0A 4HEA1 4MSQB 2Z8LA 5BMHA 5I4DA 2PJHA 4ZRKA 3ZJTA 4GN1A 5BYRA 2G45B 2W9NA 3RZFA 2K8HA 1MJDA 2LGDA 3DVGY 1F1HA 2W3SA 2BPSA 2WS3B 3UI3A 1WXMA 4HRSA 4B95A 1MG4A 1SE3A 2FNJB 3BIID 1TKYA 5JH5C 3DBLB 4FA6A 3DQVA 1V8CA 4BBNC 1UBQA 3X0WA 3GZNI 4W9HA 2NTSA 4G11A 5J17A 1ZGUB 4ASWC 4YSXB 2OJWA 5JHBA 2RDHA 3SHQA 1EF5A 1ENFA 4RGOS 2M0AA 5AEKB 2MBOA 3ZW3A 3TEYA 2O6VA 2W55A 2KWVB 4RF0A 2IGHA 3ZDMC 2LMCA 1E7UA 3VUWA 2QDFA 1K50A 1I42A 3C19A 4IWQA 4RNAA 2K6QA 2ZCCA 2M19A 2KQ4X 3KYCD 2FUHB 2G3QB 3B1LX 4ZOHC 3Q8AA 1ZDVA 2C7MB 2JXTA 1A70A 4ACFA 1TTNA 3AV8A 3LDZE 4MM3B 2N0SB 3QQ8B 2INPE 3EFUA 1TS2A 4USAA 4W9KA 1WF9A 3J9CA 4IM3A 4AJWA 1H4RA 2KWUB 3QHTA 2FIDA 2JUOA 3TJPA 2ZPYA 4I6PA 4FHJA 1M4VA 2W54A 3H9DA 5D94A 2WXPA 1C4PA 2L32A 2JSVX 2AL3A 3OG5A 4S17A 1E7VA 5EE1A 2RDGA 1QLBB 4S0RA 3FKYA 4REZA 2CU3A 4A9AA 1L0YB 3VAWA 1HXYD 1JQ4A 2WQYB 1E8YA 4OZAA 1ESFA 1V81A 1T3QA 1L6UA 3FAHA 2RD0A 3AEGB 5TSSA 2DZMA 2FUG1 3TSSA 1JROA 1D5ZC 3P4QB 1YD8U 2WP9B 4IWOA 3AEAB 4MGZE 4NAWB 1FPYA 1KLVA 4W9LA 1P98A 3O13A 3AB5A 3DDCB 2QSDA 1I4GA 2V3PA 3VTWA 1TS4A 5G55A 1NDDA 2ZCBA 3PGEA 2D3BA 2Z0DB 1UBIA 2D10A 1YOVB 1VJKA 3DBHB 4K1RB 5E6PA 4GSWA 3A4SC 3HM6X 4HXDA 4NJ7A 3AE5B 4KKJA 2LASA 2REXA 4TQ0A 3T3NA 1WFYA 1PGBA 4L2YA 4OHJA 2WU5B 4PS7A 1FNVA 2VZKB 3AE8B 2WLBA 3NZSA 4TQ1A 3MP9A 4GDKA 4P1CC 2N9XA 4BKGA 3L16A 5D6JB 3AE9B 3V05A 3Q8FA 4WWPA 2L3ZA 1P9DU 2KDEB 3R66C 3FILA 3SDLC 2DZIA 1RAXA 1DOYA 1TGZB 4RFBA 2J4XA 1CQVA 1D5XC 1NENB 1P3QU 3IHPC 4KZ0A 2QC8A 3EUB2 5DPRA 3JYUA 3DBRI 3LYYA 1J0GA 1U4AA 1L2NA 1VRAB 1Q10A 2PLPA 1J8CA 3T9LA 4K7SA 3FC4A 3NHEB 3R8BA 1LO5D 3DVNV 3ZUNA 1LGRA 3IT4B 2BF8B 3CSFA 1C1YB 4MELA 4E3CA 3QARA 3ZIMA 2WXFA 2KDBA 2CJNA 4NQLB 1P7EA 4P1BC 1XLQA 4I6LB 3BVGA 3SR6A 2XEWA 2ZNVB 2ACZB 2YLMA 1FNWA 4KGTA 4RMAA 3VXWA 3V6CB 4LJPB 1EM7A 2AX5A 2QJLA 1ZPSA 1QKZA 1R4MB 3B08A 4GIVA 3R7QA 4TSSA 2MBQA 4XZ4A 5KHOA 1LFDA 3APFA 4W9IA 1Q5WB 3MTNB 5CHFA 2K8BA 2LUEA 2MJDA 3W1SC 1B1ZA 4N58A 4OW0A 3VUYA 3MC9A 2EKIA 1V2YA 3AE6B 5EE0A 1NVID 5EE9A 4WJQA 1L0XB 1YN5A 1ROEA 2KO3A 2MRPA 3PREA 2KWDA 3HVZA 4FADA 4X57B 3AE4B 1C76A 3P42A 2M8SA 4RGTA 4NAMA 1KM7A 2A4ZA 2DYMA 1SE4A 3GOEA 1R4NI 2KX3A 3FILB 1X1MA 1VZ6A 3A9KA 3Q3NC 2RPVA 3MJ5A 2WNMA 2BS4B 4FXCA 1RFAA 5C23A 2IJ0A 2PIAA 2I38A 4L1BA 1J19A 2NBUA 3DHHC 2NVUI 3LB8C 1YJJA 3H1UA 1Q1OA 2W3RA 4MJSA 2KYWA 4OVUA 3BVMA 1HZ5A 2B76B 3CMMB 3GP7A 2DWQA 2KQSA 3MJWA 2C60A 1WXVA 1UWXA 2KJ6A 3V61A 4IKGA 4ANXA 3P2BA 4PS3A 1WJUA 4BVUC 2R61A 4P16A 1FXAA 1FEHA 3PTFC 2J0KA 2WX0A 2J53A 4H2AA 1FFVA 1WRIA 2GBJA 4JGHB 1YQ4B 3QX1A 1F9JA 1HTOA 1QOGA 3IT6B 5L83A 3VR9B 2CKHB 2FCQA 2HE7A 1F2RC 3VTUA 3KWLA 1UD7A 1ISNA 1MVKA 2DYOA 2KANA 2JVCA 2KT7A 1T0RC 3AU5A 3SFDB 3SD5A 1NYQA 1EUVB 3UF8A 2BKFA 4LK0M 2LEKA 4EFOA 1ZDXA 2N1WA 2LRUA 4WIPA 1F77A 2N4FA 2KOXA 4GOCA 4TKNA 2DZKA 3DHIC 3PS6A 2VH1A 1JW9D 3A1QB 2ONQA 1RWSA 3VUXA 2MHJA 2N9LA 2BWES 2CR5A 2V4IB 1SE9A 4FJYA 4NAWA 2E3TA 4MM3A 5D7GA 2C9WB 2ZW1A 4MH8A 4OZCA 4J3OD 2ICIA 4NPNA 2MQJA 4K3CA 1WGKA 3JSVA 2LGSA 4RCOA 5D3DA 1T6BX 4F7ZA 2D3CA 5CX3A 2NTTA 4EEWA 3JSVB 2V1YA 2WU2B 3RPFC 2HD5B 5L95C 2MBHA 2ZW0A 3AE1B 1DGJA 3DBLI 2AL6A 2VZKD 1TS3A 2VH2A 1T5XD 3ZNZB 1FFUA 1FXTB 4ARCA 3KLSX 2Q5WD 4DXAB 4KSLC 1V6EA 2KTFA 2V9HA 2BTEA 2JPHA 3NVYA 4MACA 2HDEA 1MG8A 1R4NB 1YX6B 1VDVA 2MBEA 4ZHPA 1L7YA 3VFKA 1K52A 2RPQA 4EZJA 1WZ0A 3T3OA 2MSED 3K9PB 2TSSA 1P1AA 1BT0A 5LXIB 4GDLA 2D3GA 4FULA 1Q0WB 1E0ZA 1BUIC 2UYZB 1OQYA 1R7SA 1WH3A 1KFYB 2AEHA 4EKUA 1SEBD 3KQ4A 3EC8A 3IAM1 3DCGA 2NBVB 2IPKD 2QILA 1E9MA 2FBWB 4KIKA 1AN8A 1WGGA 3PZ8A 4BBNF 1GJZA 3TEZA 2N7JA 3RNCC 4PT5A 5G5GA 2DX5B 3AH7A 5EDSA 3DWMA 4FJZA 2KN5A 2Z0EB 3Q8BA 3E9SA 1JMLA 2G4DB 4MH0E 1PUTA 1HE8A 1WGHA 1D4BA 3NZUA 1JWSD 2V0GA 2N7EA 1DYQA 1AWDA 1T0QC 1SSNA 1GAQB 2IO3B 1WR1A 4WWNA 1OFFA 5H8YE 5FR6A 2X38A 4KIKB 2IDYA 3AEBB 2RSUA 1I4XA 2KFKB 2L83A 3I57A 1YIWA 2CJOA 3X23A 4CO7A 1CMXB 1D3ZA 4NQKE 2BT6A 1JWAD 3HK0A 1ACCA 2L76A 2BW2A 4ZYSA 3QAQA 4B9KA 2QHOA 1MFWA 2WDVB 3PHXB 2GMIC 1WIAA 4B6WA 4W9DA 3MC0B 4KX6B 2WXGA 1UH6A 4HPLB 2PVOD 3N1YC 3PSEB 1FD6A 4HCNB 3BK1A 1SJED 4WAFA 2PVGC 4ANUA 2JYEA 3UGBB 1XCQL 2KVRA 3KUDB 2WXRA 1TJEA 1QZEA 3PO0A 5MPOA 1VCBA 3OWEB 1WM3A 1EF1A 1E10A 3R3MA 2D07B 4RGNA 1MHXA 1SGHA 2CU1A 3U2SC 5IP4D 1D6EC 3PV1A 4C80A 2GLSA 1EO6A 2IO0B 5HG2A 1T0SC 3NJTA 2KDFB 4A8XC 2LRWA 3IXSA 1VLBA 2WXLA 4CYEA 3QK0A 3IG3A 4C4VA 2R2OA 4DHZB 1UF0A 3LXFA 2R2QA 4II3B 1E8XA 2L1AA 4KGSA 4RM9A 3Q69A 4NNJB 3P4PB 3NS8A 4K81A 2KXJA 3ZDTA 1N5XA 2PEAA 2XN9C 1I35A 2PKOA 3MFGA 2Y5PA 2W82A 2WWZA 2WXNA 3ZVVA 1E5WA 4KDLB 1C4AA 4DDGD 1XLPA 2LGYA 3ENEA 4HJKA 3BY4B 3L17A 1TT5B 2D3AA 4BZAA 3AMZA 3RUIB 2QEJC 4AQ7A 4MJSB 3RMKC 4A90A 4TV3A 1SF0A 1YQ3B 3R7RA 4E74A 1L4DB 1E8ZA 2BYEA 2MWSB 1IPGA 1GG3A 3ZNHB 1FXIA 4KV2A 1WY8A 2RR9A 2JWZA 3HHMA 3W1SA 4QAYA 3I9V1 5HKHA 1TIFA 1OQRA 1ZP0B 2N9PC 2X8XX 1WX9A 4ICVA 1J7AA 2G9HD 3TL5A 1P7FA 4II2B 2LVOA 4A3PA 1I4HA 3P4SB 1YN4A 5IO9A 1I4RA 3PZDA 4KSKC 2ZVNA 1QOAA 3Q3OC 2DAJA 2KHWB 4W9EA 3I3TB 2DLBA 2ZZPB 4DHJD 1UGJA 3P4RB 3ZJUA 5LNK1 2G4SA 3KUZA 4XWWA 1VZ8A 3DHGC 3VTVA 4DHZE 1K51A 1WGYA 1IGCA 3R2IA 1LQBA 3H7PA 1C77A 2GI9A 4MGIE 5LLIA 3L08A 1QF6A 2BYFA 1UGMA 4KVGB 1N61A 3M3JA 3B9JA 4IOIE 1WM2A 1N5WA 1QQRA 2FCSA 4M02A 2CHZA 2O2VA 2JYTA 3LJ3A 4JLCA 3VDZA 2BB6A 2V3SA 3SFEB 4DXGA 2MX2A 3AE7B 4J6IA 5GMVA 1E8WA 1OEYA 2M4NA 3A4RA 3NVWA 4W9FA 1SXTA 4JQWC 2FIFA 1GB1A 4BOSC 2Y3AA 2IGGA 1C9FA 4PK1A 2ZVOA 4IM0A 4AJYB 4RM8A 3V6EB 1WGRA 3APDA 4HK2A 3OJ4B 2MBBB 4XGAB 4YL8A 1I7HA 2PMVA 1OGWA 3URYA 1P0RA 2LUMA 1TKEA 2L05A 2LVPA 3C8YA 2LWPA 1SBBB 4M0WB 1ET9A 2FE8A 1PYWD 2G1EA 5CHWA 2GOWA 3N1XC 3APCA 1IBXA 3P63A 2M1MA 4XWTA 1UWMA 3N32A 3WIMA 3ZYYX 2JZ3B 4KGRA 3A9JB 3KWVA 3WAOA 3L54A 5EE3A 1H8CA 4US8A 1GNUA 2O6VB 1TBEA 2K8CA 2KZRA 4A6QA 3N30A 4M8NA 2KJRA 2ZJDA 1VZ7A 2MEKA 3Q8CA 4WWMA 1OQQA 3AE3B 1OTRB 3A33B 3RZWC 2KN4A 4C00A 1PQSA 3AECB 1EU4A 4MGYE 3EECA 4EZLA 1CK1A 3QJZA 1TS5A 5BMIA 2QCZA 3VRAB 3DBHI 3ZRCA 5BO4B 3RULA 3IAS1 1UZXB 1V49A 4HKZE 5BMGA 2MH7A 1IYFA 2I2YA 4NY0A 2SAKA 2LJIA 4K3BA 1J7CA 1E7PB 4M8MA 3NVVA 4C7ZA 2NS5A 2KWCA 3R2TA 3ETRA 4GLSC 4ZRPA 4JL9A 2IYDB 4WJOA 4B0MA 3AN1A 2KACA 2L0FA 3T8MA 2BYVE 5DPSA 2K9XA 1FRRA 2KVZA 2K5PA 1WJNA 4JPSA 1FMAD 1WGDA 4WURA 3ML9A 5CTRC 5JHAA 3S2AA 4XYCA 2J7QB 1B9RA 5IKCM 3BVZA 2JZZA 4GMVA 4A3OA 1V5OA 3U7ZA 1EWCA 3GE3C 2DYBA 2KTRA 5JXVA 3NVZA 2HJ1A 3ZTCA 3OAWA 3QCAA 5KHQA 1BXTA 2GBRA 3AXCA 4C7YA 5T8IA 3H7SA 3KUCB 2KLCA 4N9F4 4N6EB 3CF6E 2IY0B 2GB1A 1V1PB 5GXGB 4ITKA 5AZFA 4F1SA 1NYRA 2MJ3A 4BOZB 1S3SG 2ZPNA 1L5PA 3Q6BA 1KRHA 1V1PA 2UU7A 2XK5B 2AWTA 3C0RB 3EFCA 2K0PA 5AUIA 1S1QB 2WDQB 3ZXRA 2BS3B 3JVZX 3VQIA 4MEMA 3TEXA 4K7UA 1FIQA 4ZDVA 1F0ZA 1WJ4A 1K8RB 3CWIA 4G0NB 1XD3B 3KVFB 1RLFA 2JQRB 1QOFA 1Z5SB 2EMSA 2JXXA 2BGFA 3WANA 4JX1C 3VRBB 2JT4B 2WXJA 4LNOA 4TMAB 3PT2B 1I4PA 5C2TB 1V97A 3RCZA 2WDTB 1PFDA 2MP2B 2WX1A 2ZEQA 1L0VB 4GU2A 3N3KB 3TIXA 4XC2A 5DCNA 4HJGE 3HVDA 3GZNB 2DENB 4BKSA 2JY6A 1Y56A 2JU6X 4IC7B 4ZRQA 1T0YA 2SEBD 3WCQA 1C79A 3TEWA 1A5RA 2K39A 4IDIA 2L00B 1WSPA 1IP9A 3RN9C 2DAFA 1AW7A 3QIJA 1JWBD 2LJ5A 4DK5A 1WXQA 4UDUC 3PVLA 2KMAA 2Y5BB 4FLHA 1SIJA 1N60A 2IY1B 2CHWA 3UIPB 5LXHA 1JWUD 2KK8A 1KOTA 1STEA 1C78A 1GUAB 4DXFA 2BKRB 2AYOB 1GC7A 1JRPA 3HM3A 1SE2A 1ZXHA 2CS4A 1SB3C 2NR2A 3Q14C 1XEEA 5CHVC 2L8JA 1WXSA 2JZPA 4M0WA 2WHIA 3AM9A 3RYTA 5IN7A 2B3AA 2BS2B 4HKQA 2J52A 4BFRA 4R3DA 4XDCA 4RGMA 3QC8B 4LNFA 3WA0A 2L52A 3TUOA 1SIFA 2KJHB 2BBCA 2KC1A 2ZNVC 2M56B 2DZJA 5D2MB 1ZOYB 1KH0A 1KLUD 2WGSA 5AZGA 1XLNA 4F8CB 2O2VB 3D32A 1XO3A 2K25A 1J7BA 3UINB 2FCMA 5G5HA 4HLEA 2RDBC 2WXIA 2LXCA 3WAMA 4JE3B 5JZEB 1WYGA 2MW5A 4AUQC 2NCNA 1ZUD2 3ALBA 1NI2A 3PPAA 4IWPA 1LXDA 3SEBA 5HI1A 2KFKA 3VH3B 4P7IA 3VR8B 3L10B 3KH0A 1ZW7A 2DHZA 1E90A 2N9EB 3VVWB 5BYSA 4HPMB 4PYUA 1TZ1A 2J42A 4XDDA 3UIOB 4PS8A 3HRDD 3DWGC 4ANVA 3H6NA 5E6NA 3ZLZA 2N9KA 2MLBA 1QILA 1PDXA 3W2DA 1FNUA 1YMHE 4WQMA 3TMPB 2UWQA 4FHKA 1IUEA 4OVZA 4C4VB 3OJ3A 2J0MA 1XLOA 2GBNA 1WJ6A 4YWGG 2JX5A 3Q8EA 3ZTDA 4HDOA 4WJNA 3IVFA 3U8ZA 2INNE 4MGKE 4MT5A 2NMQA 4G50A 5HHDG 4KKIA 1HZ6A 1OEYJ 3E56A 3Q2AC 4NJ6A 3U4EG 3H8HA 4LLGM 4HWIB 4HPPA 1M94A 2K3UA 4HROA 4B0EA 5FK9C 2LVQA
chains in the Genus database with same CATH topology
4W9FA 4WJPA 2HE7A 2FIFA 2OJRA 4JQWC 4BOSC 3VTUA 4URKA 1UD7A 1C3TA 1ISNA 2DYOA 5IAAC 3VH4B 2KANA 1G6JA 2JVCA 1YJ1A 2ZVOA 4IM0A 1RRBA 4AJYB 4RM8A 3AU5A 3V6EB 1WGRA 3APDA 4HK2A 3OJ4B 2MBBB 1V80A 3SD5A 3ZNID 1EUVB 3UF8A 2BKFA 4YL8A 1OGWA 4EFOA 3NOBA 4WWOA 3ML8A 1P0RA 2KX0A 2N1WA 4MSQB 2PE6B 2LRUA 2N4FA 2KOXA 2L05A 2LVPA 4GOCA 1WXAA 2CHXA 2MA9B 4TKNA 2LWPA 2PJHA 4ZRKA 2DZKA 4M0WB 5G2NA 3PS6A 2C5LC 4GN1A 5CHWA 2G45B 2GOWA 3APCA 2W9NA 3RZFA 2K8HA 3A1QB 2LGDA 3DVGY 2LXAA 2ASQA 2M1MA 3VUXA 2BPSA 2K6DB 1WXMA 2BWES 4B95A 2FNJB 4HDQA 2KDIA 3M63B 2CR5A 3N32A 5IA7A 3L0WB 3WIMA 5JH5C 2JZ3B 2KFJA 3A9JB 4BKSD 1SE9A 4FA6A 3WAOA 3L54A 4FJYA 1H8CA 4NAWA 3DQVA 3IFWB 4MM3A 5D7GA 1UBQA 2PPHA 4BBNC 1GNUA 3VHTC 2C9WB 3X0WA 2O6VB 3GZNI 4W9HA 1TBEA 4G11A 2NBWB 4NPNA 2MQJA 4KDIC 2K8CA 2KZRA 3JSVA 5J17A 2C7HA 3N30A 4M8NA 2KJRA 2ZJDA 4F7ZA 1ZGUB 4ASWC 2L7RA 1OTRB 3A33B 3RZWC 5CX3A 4EEWA 5JHBA 3JSVB 2V1YA 1PQSA 3SHQA 2HD5B 4MDKE 1WE6A 1WR6E 2MBHA 5L95C 1EF5A 3EECA 4MGYE 4EZLA 3DBLI 3PRZA 2AL6A 3QJZA 5AEKB 2MBOA 3RD2A 3ZW3A 3ZNZB 2O6VA 4KZCA 3UQBA 3DBHI 2KWVB 2IZVB 3ZRCA 3ZDMC 1FXTB 5BO4B 1E7UA 3RULA 3VUWA 1UZXB 1V49A 4DXAB 1I42A 1IYFA 1WRDB 4KSLC 4IWQA 4NY0A 1V6EA 2K6QA 2KTFA 2IBIB 2ZCCA 3KYCD 2JPHA 2FUHB 3RT3B 2G3QB 3B1LX 1MG8A 3A1QA 4M8MA 1LM8B 1YX6B 2NS5A 2KWCA 2GBKA 2MBEA 2KQ7A 2LGXA 2C7MB 4JL9A 2IYDB 1L7YA 4WJOA 3VFKA 1TTNA 3LDZE 2L0FA 2FCNA 3T8MA 2BYVE 3OLMD 3QQ8B 5DPSA 2RPQA 4EZJA 1GC6A 3A9JA 3EFUA 1WZ0A 2HTHA 3ZNGC 2MSED 3K9PB 4W9KA 1WJNA 1WF9A 4IM3A 1P1AA 4AJWA 1BT0A 5LXIB 1H4RA 4GDLA 2KWUB 4GDKB 2D3GA 4W9JA 1WGDA 4FULA 1Q0WB 3QHTA 3ML9A 2UYZB 5CTRC 2FIDA 5JHAA 3UQAA 1OQYA 4A20A 4EOYA 1YX5B 3S2AA 1WYWB 2JUOA 3O65B 1Z2MA 3TJPA 4BKTA 1WH3A 2ZPYA 2J7QB 4FHJA 2AEHA 4I6PA 3M95A 3QA8A 4EKUA 4G3XB 2JZZA 4GMVA 4A3OA 1V5OA 3H9DA 5D94A 4W9GA 2AL3A 2DYBA 3PRMB 4DBGA 2KTRA 3EC8A 1E7VA 3DCGA 2NBVB 2KD0A 2EMTA 4KIKA 3ZTCA 3OAWA 1WGGA 5DPWA 3VAWA 1XT9B 4BBNF 4DWFA 1GJZA 1V9JA 3QCAA 5KHQA 1E8YA 1WMHB 1AARA 3WAPA 2DX5B 2GBRA 3AXCA 5EDSA 1V81A 4AP4C 3H7SA 3KUCB 2KLCA 4FJZA 2KN5A 4MSMB 2J0JA 4N9F4 5TR5A 4EZKA 2Z0EB 3CF6E 2IY0B 2D11A 2RD0A 5AZFA 4F1SA 1WX7A 2DZMA 4BOZB 1S3SG 2LI5A 2ZPNA 2G4DB 4MH0E 1YD8U 2JF5A 1HE8A 1WGHA 4IWOA 3NZUA 2N7EA 3BINA 2XK5B 2AWTA 3C0RB 4MGZE 4NAWB 3Q3FA 2IO3B 2XBBC 1WR1A 4WWNA 1KLVA 4W9LA 4XX5A 5E6OA 1P98A 1S1QB 3DDCB 3H7PB 3DPDA 3K9OB 5FR6A 3TCAA 1V86A 3U7DA 3VTWA 2KC2A 3JVZX 3L13A 4KIKB 3KYDD 3VQIA 3AI5A 4MEMA 4K7UA 4ZDVA 5G55A 2RSUA 2KFKB 1NDDA 2ZCBA 1YIWA 2A5UA 1WJ4A 3PGEA 1K8RB 4ZRIA 3X23A 2M17A 4CO7A 2Z0DB 4G0NB 1CMXB 1UBIA 1D3ZA 1XD3B 2D10A 3KVFB 1RLFA 4NQKE 1Z5SB 2V4LA 1WX8A 2EMSA 4K1RB 5E6PA 3HK0A 3A4SC 3HM6X 4GSWA 4HXDA 4NJ7A 2L76A 2JXXA 2LASA 2REXA 3CSTA 4PYZA 4TQ0A 2BGFA 3WANA 3IBEA 3QAQA 4B9KA 2QHOA 2JT4B 2KTRB 3A9KB 1WFYA 3PHXB 2GMIC 4JIOU 1WIAA 3PT2B 5DPTA 4B6WA 4PS7A 4W9DA 2NPTA 3TBLD 4HVBA 1UH6A 4HPLB 3RCZA 3NZSA 2WDTB 3NY5A 4GDKA 4TQ1A 2N9XA 4BKGA 2KNBA 3L16A 5D6JB 2MP2B 2WX1A 2ZEQA 2FCQA 3PSEB 4WWPA 4HCNB 2L3ZA 1P9DU 2KDEB 4ICUA 3WALA 4ZYNA 2WYQA 3R66C 4ANUA 4GU2A 4LCDE 3N3KB 3SDLC 2DZIA 4I6NB 1RAXA 2N7DA 4XC2A 3TIXA 3UGBB 2KVRA 3KUDB 1TGZB 5DCNA 1QZEA 2DENB 1VCBA 1WM3A 4BKSA 4DHJB 1EF1A 2JY6A 4IUMB 4IW0A 1P3QU 1Y8RC 3IHPC 2PE9A 3R3MA 4KZ0A 5DPRA 3ZO5B 3JYUA 4IC7B 2D07B 3DBRI 1J0GA 1SGHA 1U4AA 4IM2A 3Q3JA 1T0YA 1L2NA 2CU1A 1J8CA 3T9LA 3EHVA 4K7SA 1A5RA 3AU4A 2K39A 3NHEB 3PV1A 2L00B 1IP9A 4EUTA 3DVNV 1EO6A 1YQBA 2DAFA 3ZUNA 1R4MI 2IO0B 2BF8B 2LJ5A 3QIJA 4DK5A 3CSFA 1C1YB 3PVLA 2KMAA 2Y5BB 4FLHA 4MELA 4E3CA 5J18A 3QARA 3ZIMA 2BWFA 2KDBA 2KDFB 4NQLB 2YVCA 2LRWA 4ZRJA 3ZKJC 2IY1B 4I6LB 2CHWA 4CYEA 3QK0A 3UIPB 5LXHA 2KK8A 2XEWA 3ONSA 2ZNVB 3IG3A 4FJVB 4WAAA 1KOTA 1GUAB 2YLMA 2R2OA 4DHZB 2BKRB 2R2QA 2AYOB 2IO1B 1E8XA 4II3B 1GC7A 4RMAA 3VXWA 2M0XA 3HM3A 2CS4A 4RM9A 4NNJB 2NR2A 3V6CB 3ZRFA 4LJPB 3NS8A 2FAZA 4GB9A 5CHVC 3ECIA 2L8JA 4K81A 2KXJA 1WXSA 3ZDTA 2PEAA 1I35A 5J2RA 1WMHA 3B08A 2EKEC 4GIVA 2JRHA 3R7QA 4XZ4A 2MBQA 3RYTA 2WWZA 2B3AA 3ZVVA 5KHOA 1E5WA 1LFDA 3APFA 1WE7A 2K1FA 1Q5WB 4KDLB 2I1KA 4W9IA 4DDGD 3MTNB 2LGYA 5CHFA 2K8BA 3ENEA 4HJKA 3BY4B 3L17A 2GBMA 2LUEA 3PLVA 2KMCA 3W1SC 4BFRA 3VUYA 1KJTA 1V2YA 3RUIB 3QC8B 3WA0A 1JRUA 4MJSB 4WJQA 4TUUA 4LDTB 1SIFA 2KO3A 2MRPA 2KJHB 4AOFA 3PREA 4AWJA 4TV3A 3R7RA 2KC1A 2ZNVC 4E74A 2DZJA 2MP2A 3V62A 1WZ3A 5D2MB 4FADA 2O6VD 5AZHA 1E8ZA 2BYEA 2MWSB 4X57B 1IPGA 1XQQA 4F8CB 5AZGA 2O2VB 1GG3A 3D32A 2KKCA 4WQOB 2M8SA 3ZNHB 1VD2A 4GDLB 1KM7A 2A4ZA 4KV2A 2DYMA 2C7NB 1WY8A 2RR9A 2JWZA 2K25A 3GOEA 1R4NI 3HHMA 3UINB 3W1SA 2FCMA 2KX3A 5HKHA 3W1YA 3PRPB 1X1MA 3A9KA 4HLEA 4DDID 2LXCA 2N9PC 3WAMA 4ANWA 1RFAA 4IG7B 5C23A 5JZEB 1WX9A 2MW5A 4AUQC 2I1JA 4ICVA 2NCNA 1UELA 3DVGX 3ALBA 3TL5A 4II2B 2LVOA 4A3PA 1NI2A 3PPAA 4IWPA 1LXDA 1V5TA 4GGQA 2KFKA 2NPTB 4P7IA 3M62B 3VH3B 3L10B 3B0AA 3KH0A 1ZW7A 2DHZA 1J19A 1E90A 2KLGA 2NBUA 2ZVNA 3PZDA 4KSKC 2VRRB 2NVUI 2N9EB 4K7WA 3VVWB 4HPMB 3H1UA 4PYUA 2DAJA 2KHWB 4W9EA 1Q1OA 4MJSA 4OVUA 1TZ1A 3I3TB 3V60A 4E71A 3UIOB 4PS8A 4ANVA 4CHKA 5C1ZA 2ZZPB 3CMMB 4DHJD 3H6NA 2OOBB 5E6NA 4FBJB 1ZKHA 3ZLZA 3QWZB 2MLBA 2XK5A 3HIZA 4OVVA 2KQSA 4LDTD 1WI0A 2N1VA 3AULA 3MJWA 3SU8X 2G4SA 3KUZA 2C60A 3PLUA 2RGFA 3VTVA 3TMPB 4DHZE 1WXVA 2KJ6A 2UWQA 4FHKA 3V61A 2IO2B 4ANXA 3PHWB 2MCNB 3P2BA 1WGYA 4PS3A 1WJUA 2Z59B 3MHSD 4BVUC 3OJ3A 4HCPB 1LQBA 2J0MA 3H7PA 4MGIE 2GBNA 1WJ6A 5LLIA 3L08A 3DBSA 2BYFA 1UGMA 3PTFC 2J0KA 4KVGB 3M3JA 3ZTDA 2WX0A 4HDOA 3DVNU 4WJNA 1WM2A 2LZ6A 3IVFA 3U8ZA 4MGKE 2FCSA 4G50A 2CHZA 2LD9A 4LJOB 2GBJA 2O2VA 4JGHB 3LJ3A 4GXBA 1OEYJ 2JRIB 2L0TA 4JLCA 3QX1A 1F9JA 2V3SA 3KW5B 3VDZA 4FN2A 2D2QA 2MX2A 4J6IA 4W9CA 4NJ6A 3DOWA 3JW0X 5GMVA 5L83A 3U30A 1E8WA 1OEYA 2CKHB 4HWIB 1M94A 2HJ8A 2M4NA 1NBFC 3A4RA 2LVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9F A;  4WJP A;  2HE7 A;  2FIF A;  2OJR A;  4JQW C;  4BOS C;  3VTU A;  4URK A;  1UD7 A;  1C3T A;  1ISN A;  2DYO A;  5IAA C;  3VH4 B;  2KAN A;  1G6J A;  2JVC A;  1YJ1 A;  2ZVO A;  4IM0 A;  1RRB A;  4AJY B;  4RM8 A;  3AU5 A;  3V6E B;  1WGR A;  3APD A;  4HK2 A;  3OJ4 B;  2MBB B;  1V80 A;  3SD5 A;  3ZNI D;  1EUV B;  3UF8 A;  2BKF A;  4YL8 A;  1OGW A;  4EFO A;  3NOB A;  4WWO A;  3ML8 A;  1P0R A;  2KX0 A;  2N1W A;  4MSQ B;  2PE6 B;  2LRU A;  2N4F A;  2KOX A;  2L05 A;  2LVP A;  4GOC A;  1WXA A;  2CHX A;  2MA9 B;  4TKN A;  2LWP A;  2PJH A;  4ZRK A;  2DZK A;  4M0W B;  5G2N A;  3PS6 A;  2C5L C;  4GN1 A;  5CHW A;  2G45 B;  2GOW A;  3APC A;  2W9N A;  3RZF A;  2K8H A;  3A1Q B;  2LGD A;  3DVG Y;  2LXA A;  2ASQ A;  2M1M A;  3VUX A;  2BPS A;  2K6D B;  1WXM A;  2BWE S;  4B95 A;  2FNJ B;  4HDQ A;  2KDI A;  3M63 B;  2CR5 A;  3N32 A;  5IA7 A;  3L0W B;  3WIM A;  5JH5 C;  2JZ3 B;  2KFJ A;  3A9J B;  4BKS D;  1SE9 A;  4FA6 A;  3WAO A;  3L54 A;  4FJY A;  1H8C A;  4NAW A;  3DQV A;  3IFW B;  4MM3 A;  5D7G A;  1UBQ A;  2PPH A;  4BBN C;  1GNU A;  3VHT C;  2C9W B;  3X0W A;  2O6V B;  3GZN I;  4W9H A;  1TBE A;  4G11 A;  2NBW B;  4NPN A;  2MQJ A;  4KDI C;  2K8C A;  2KZR A;  3JSV A;  5J17 A;  2C7H A;  3N30 A;  4M8N A;  2KJR A;  2ZJD A;  4F7Z A;  1ZGU B;  4ASW C;  2L7R A;  1OTR B;  3A33 B;  3RZW C;  5CX3 A;  4EEW A;  5JHB A;  3JSV B;  2V1Y A;  1PQS A;  3SHQ A;  2HD5 B;  4MDK E;  1WE6 A;  1WR6 E;  2MBH A;  5L95 C;  1EF5 A;  3EEC A;  4MGY E;  4EZL A;  3DBL I;  3PRZ A;  2AL6 A;  3QJZ A;  5AEK B;  2MBO A;  3RD2 A;  3ZW3 A;  3ZNZ B;  2O6V A;  4KZC A;  3UQB A;  3DBH I;  2KWV B;  2IZV B;  3ZRC A;  3ZDM C;  1FXT B;  5BO4 B;  1E7U A;  3RUL A;  3VUW A;  1UZX B;  1V49 A;  4DXA B;  1I42 A;  1IYF A;  1WRD B;  4KSL C;  4IWQ A;  4NY0 A;  1V6E A;  2K6Q A;  2KTF A;  2IBI B;  2ZCC A;  3KYC D;  2JPH A;  2FUH B;  3RT3 B;  2G3Q B;  3B1L X;  1MG8 A;  3A1Q A;  4M8M A;  1LM8 B;  1YX6 B;  2NS5 A;  2KWC A;  2GBK A;  2MBE A;  2KQ7 A;  2LGX A;  2C7M B;  4JL9 A;  2IYD B;  1L7Y A;  4WJO A;  3VFK A;  1TTN A;  3LDZ E;  2L0F A;  2FCN A;  3T8M A;  2BYV E;  3OLM D;  3QQ8 B;  5DPS A;  2RPQ A;  4EZJ A;  1GC6 A;  3A9J A;  3EFU A;  1WZ0 A;  2HTH A;  3ZNG C;  2MSE D;  3K9P B;  4W9K A;  1WJN A;  1WF9 A;  4IM3 A;  1P1A A;  4AJW A;  1BT0 A;  5LXI B;  1H4R A;  4GDL A;  2KWU B;  4GDK B;  2D3G A;  4W9J A;  1WGD A;  4FUL A;  1Q0W B;  3QHT A;  3ML9 A;  2UYZ B;  5CTR C;  2FID A;  5JHA A;  3UQA A;  1OQY A;  4A20 A;  4EOY A;  1YX5 B;  3S2A A;  1WYW B;  2JUO A;  3O65 B;  1Z2M A;  3TJP A;  4BKT A;  1WH3 A;  2ZPY A;  2J7Q B;  4FHJ A;  2AEH A;  4I6P A;  3M95 A;  3QA8 A;  4EKU A;  4G3X B;  2JZZ A;  4GMV A;  4A3O A;  1V5O A;  3H9D A;  5D94 A;  4W9G A;  2AL3 A;  2DYB A;  3PRM B;  4DBG A;  2KTR A;  3EC8 A;  1E7V A;  3DCG A;  2NBV B;  2KD0 A;  2EMT A;  4KIK A;  3ZTC A;  3OAW A;  1WGG A;  5DPW A;  3VAW A;  1XT9 B;  4BBN F;  4DWF A;  1GJZ A;  1V9J A;  3QCA A;  5KHQ A;  1E8Y A;  1WMH B;  1AAR A;  3WAP A;  2DX5 B;  2GBR A;  3AXC A;  5EDS A;  1V81 A;  4AP4 C;  3H7S A;  3KUC B;  2KLC A;  4FJZ A;  2KN5 A;  4MSM B;  2J0J A;  4N9F 4;  5TR5 A;  4EZK A;  2Z0E B;  3CF6 E;  2IY0 B;  2D11 A;  2RD0 A;  5AZF A;  4F1S A;  1WX7 A;  2DZM A;  4BOZ B;  1S3S G;  2LI5 A;  2ZPN A;  2G4D B;  4MH0 E;  1YD8 U;  2JF5 A;  1HE8 A;  1WGH A;  4IWO A;  3NZU A;  2N7E A;  3BIN A;  2XK5 B;  2AWT A;  3C0R B;  4MGZ E;  4NAW B;  3Q3F A;  2IO3 B;  2XBB C;  1WR1 A;  4WWN A;  1KLV A;  4W9L A;  4XX5 A;  5E6O A;  1P98 A;  1S1Q B;  3DDC B;  3H7P B;  3DPD A;  3K9O B;  5FR6 A;  3TCA A;  1V86 A;  3U7D A;  3VTW A;  2KC2 A;  3JVZ X;  3L13 A;  4KIK B;  3KYD D;  3VQI A;  3AI5 A;  4MEM A;  4K7U A;  4ZDV A;  5G55 A;  2RSU A;  2KFK B;  1NDD A;  2ZCB A;  1YIW A;  2A5U A;  1WJ4 A;  3PGE A;  1K8R B;  4ZRI A;  3X23 A;  2M17 A;  4CO7 A;  2Z0D B;  4G0N B;  1CMX B;  1UBI A;  1D3Z A;  1XD3 B;  2D10 A;  3KVF B;  1RLF A;  4NQK E;  1Z5S B;  2V4L A;  1WX8 A;  2EMS A;  4K1R B;  5E6P A;  3HK0 A;  3A4S C;  3HM6 X;  4GSW A;  4HXD A;  4NJ7 A;  2L76 A;  2JXX A;  2LAS A;  2REX A;  3CST A;  4PYZ A;  4TQ0 A;  2BGF A;  3WAN A;  3IBE A;  3QAQ A;  4B9K A;  2QHO A;  2JT4 B;  2KTR B;  3A9K B;  1WFY A;  3PHX B;  2GMI C;  4JIO U;  1WIA A;  3PT2 B;  5DPT A;  4B6W A;  4PS7 A;  4W9D A;  2NPT A;  3TBL D;  4HVB A;  1UH6 A;  4HPL B;  3RCZ A;  3NZS A;  2WDT B;  3NY5 A;  4GDK A;  4TQ1 A;  2N9X A;  4BKG A;  2KNB A;  3L16 A;  5D6J B;  2MP2 B;  2WX1 A;  2ZEQ A;  2FCQ A;  3PSE B;  4WWP A;  4HCN B;  2L3Z A;  1P9D U;  2KDE B;  4ICU A;  3WAL A;  4ZYN A;  2WYQ A;  3R66 C;  4ANU A;  4GU2 A;  4LCD E;  3N3K B;  3SDL C;  2DZI A;  4I6N B;  1RAX A;  2N7D A;  4XC2 A;  3TIX A;  3UGB B;  2KVR A;  3KUD B;  1TGZ B;  5DCN A;  1QZE A;  2DEN B;  1VCB A;  1WM3 A;  4BKS A;  4DHJ B;  1EF1 A;  2JY6 A;  4IUM B;  4IW0 A;  1P3Q U;  1Y8R C;  3IHP C;  2PE9 A;  3R3M A;  4KZ0 A;  5DPR A;  3ZO5 B;  3JYU A;  4IC7 B;  2D07 B;  3DBR I;  1J0G A;  1SGH A;  1U4A A;  4IM2 A;  3Q3J A;  1T0Y A;  1L2N A;  2CU1 A;  1J8C A;  3T9L A;  3EHV A;  4K7S A;  1A5R A;  3AU4 A;  2K39 A;  3NHE B;  3PV1 A;  2L00 B;  1IP9 A;  4EUT A;  3DVN V;  1EO6 A;  1YQB A;  2DAF A;  3ZUN A;  1R4M I;  2IO0 B;  2BF8 B;  2LJ5 A;  3QIJ A;  4DK5 A;  3CSF A;  1C1Y B;  3PVL A;  2KMA A;  2Y5B B;  4FLH A;  4MEL A;  4E3C A;  5J18 A;  3QAR A;  3ZIM A;  2BWF A;  2KDB A;  2KDF B;  4NQL B;  2YVC A;  2LRW A;  4ZRJ A;  3ZKJ C;  2IY1 B;  4I6L B;  2CHW A;  4CYE A;  3QK0 A;  3UIP B;  5LXH A;  2KK8 A;  2XEW A;  3ONS A;  2ZNV B;  3IG3 A;  4FJV B;  4WAA A;  1KOT A;  1GUA B;  2YLM A;  2R2O A;  4DHZ B;  2BKR B;  2R2Q A;  2AYO B;  2IO1 B;  1E8X A;  4II3 B;  1GC7 A;  4RMA A;  3VXW A;  2M0X A;  3HM3 A;  2CS4 A;  4RM9 A;  4NNJ B;  2NR2 A;  3V6C B;  3ZRF A;  4LJP B;  3NS8 A;  2FAZ A;  4GB9 A;  5CHV C;  3ECI A;  2L8J A;  4K81 A;  2KXJ A;  1WXS A;  3ZDT A;  2PEA A;  1I35 A;  5J2R A;  1WMH A;  3B08 A;  2EKE C;  4GIV A;  2JRH A;  3R7Q A;  4XZ4 A;  2MBQ A;  3RYT A;  2WWZ A;  2B3A A;  3ZVV A;  5KHO A;  1E5W A;  1LFD A;  3APF A;  1WE7 A;  2K1F A;  1Q5W B;  4KDL B;  2I1K A;  4W9I A;  4DDG D;  3MTN B;  2LGY A;  5CHF A;  2K8B A;  3ENE A;  4HJK A;  3BY4 B;  3L17 A;  2GBM A;  2LUE A;  3PLV A;  2KMC A;  3W1S C;  4BFR A;  3VUY A;  1KJT A;  1V2Y A;  3RUI B;  3QC8 B;  3WA0 A;  1JRU A;  4MJS B;  4WJQ A;  4TUU A;  4LDT B;  1SIF A;  2KO3 A;  2MRP A;  2KJH B;  4AOF A;  3PRE A;  4AWJ A;  4TV3 A;  3R7R A;  2KC1 A;  2ZNV C;  4E74 A;  2DZJ A;  2MP2 A;  3V62 A;  1WZ3 A;  5D2M B;  4FAD A;  2O6V D;  5AZH A;  1E8Z A;  2BYE A;  2MWS B;  4X57 B;  1IPG A;  1XQQ A;  4F8C B;  5AZG A;  2O2V B;  1GG3 A;  3D32 A;  2KKC A;  4WQO B;  2M8S A;  3ZNH B;  1VD2 A;  4GDL B;  1KM7 A;  2A4Z A;  4KV2 A;  2DYM A;  2C7N B;  1WY8 A;  2RR9 A;  2JWZ A;  2K25 A;  3GOE A;  1R4N I;  3HHM A;  3UIN B;  3W1S A;  2FCM A;  2KX3 A;  5HKH A;  3W1Y A;  3PRP B;  1X1M A;  3A9K A;  4HLE A;  4DDI D;  2LXC A;  2N9P C;  3WAM A;  4ANW A;  1RFA A;  4IG7 B;  5C23 A;  5JZE B;  1WX9 A;  2MW5 A;  4AUQ C;  2I1J A;  4ICV A;  2NCN A;  1UEL A;  3DVG X;  3ALB A;  3TL5 A;  4II2 B;  2LVO A;  4A3P A;  1NI2 A;  3PPA A;  4IWP A;  1LXD A;  1V5T A;  4GGQ A;  2KFK A;  2NPT B;  4P7I A;  3M62 B;  3VH3 B;  3L10 B;  3B0A A;  3KH0 A;  1ZW7 A;  2DHZ A;  1J19 A;  1E90 A;  2KLG A;  2NBU A;  2ZVN A;  3PZD A;  4KSK C;  2VRR B;  2NVU I;  2N9E B;  4K7W A;  3VVW B;  4HPM B;  3H1U A;  4PYU A;  2DAJ A;  2KHW B;  4W9E A;  1Q1O A;  4MJS A;  4OVU A;  1TZ1 A;  3I3T B;  3V60 A;  4E71 A;  3UIO B;  4PS8 A;  4ANV A;  4CHK A;  5C1Z A;  2ZZP B;  3CMM B;  4DHJ D;  3H6N A;  2OOB B;  5E6N A;  4FBJ B;  1ZKH A;  3ZLZ A;  3QWZ B;  2MLB A;  2XK5 A;  3HIZ A;  4OVV A;  2KQS A;  4LDT D;  1WI0 A;  2N1V A;  3AUL A;  3MJW A;  3SU8 X;  2G4S A;  3KUZ A;  2C60 A;  3PLU A;  2RGF A;  3VTV A;  3TMP B;  4DHZ E;  1WXV A;  2KJ6 A;  2UWQ A;  4FHK A;  3V61 A;  2IO2 B;  4ANX A;  3PHW B;  2MCN B;  3P2B A;  1WGY A;  4PS3 A;  1WJU A;  2Z59 B;  3MHS D;  4BVU C;  3OJ3 A;  4HCP B;  1LQB A;  2J0M A;  3H7P A;  4MGI E;  2GBN A;  1WJ6 A;  5LLI A;  3L08 A;  3DBS A;  2BYF A;  1UGM A;  3PTF C;  2J0K A;  4KVG B;  3M3J A;  3ZTD A;  2WX0 A;  4HDO A;  3DVN U;  4WJN A;  1WM2 A;  2LZ6 A;  3IVF A;  3U8Z A;  4MGK E;  2FCS A;  4G50 A;  2CHZ A;  2LD9 A;  4LJO B;  2GBJ A;  2O2V A;  4JGH B;  3LJ3 A;  4GXB A;  1OEY J;  2JRI B;  2L0T A;  4JLC A;  3QX1 A;  1F9J A;  2V3S A;  3KW5 B;  3VDZ A;  4FN2 A;  2D2Q A;  2MX2 A;  4J6I A;  4W9C A;  4NJ6 A;  3DOW A;  3JW0 X;  5GMV A;  5L83 A;  3U30 A;  1E8W A;  1OEY A;  2CKH B;  4HWI B;  1M94 A;  2HJ8 A;  2M4N A;  1NBF C;  3A4R A;  2LVQ A; 
#chains in the Genus database with same CATH topology
 4WJP A;  2BYT A;  4URK A;  2OED A;  3GB1 A;  1QT9 A;  3VH4 B;  1V80 A;  1ZXI A;  3NOB A;  2KAJ A;  3BYY B;  3ML8 A;  4WWO A;  2PE6 B;  1KF6 B;  3N20 C;  1JCK B;  3RNG C;  1WXA A;  2CHX A;  2MA9 B;  1F52 A;  1DOI A;  5G2N A;  1TZO A;  2LGI A;  2C5L C;  4RF1 A;  4JWS C;  2LXA A;  2ASQ A;  1UNS A;  2WXO A;  2K6D B;  2BB5 A;  2MJE A;  3NRZ A;  4HDQ A;  2KDI A;  3M63 B;  5IA7 A;  3L0W B;  3GE8 C;  2KFJ A;  4BKS D;  2DNF A;  2PTL A;  4XE0 A;  1CZP A;  2OHF A;  3P1M A;  3IFW B;  1KLG D;  2PPH A;  3VHT C;  2IND C;  4WH4 A;  4O1N A;  2NBW B;  1YNT E;  4C56 C;  4KDI C;  3RI7 C;  3L4P A;  2C7H A;  2INC C;  2L7R A;  3EA6 A;  3AEE B;  4MDK E;  1WE6 A;  1WR6 E;  1FM0 D;  3PRZ A;  3RD2 A;  4KZC A;  3UQB A;  2IZV B;  3AED B;  4CQN A;  4NJC A;  1EU3 A;  1WRD B;  1XF5 L;  2GRI A;  3MHZ A;  2V3N A;  2IBI B;  1ET6 A;  2YEP F;  3RT3 B;  3A1Q A;  4M00 A;  1LM8 B;  1HQR D;  1MI0 A;  2GBK A;  4Q2J A;  2KQ7 A;  2LGX A;  1I4Q A;  1UUP A;  3ZXV A;  3CIR B;  2FCN A;  1SJH D;  3OLM D;  1WWT A;  4YTP B;  1GC6 A;  3A9J A;  2WXM A;  1CJE A;  2HTH A;  3ZNG C;  1MHH E;  4GDK B;  4W9J A;  3N9Y C;  2D5G A;  5HFY A;  3UQA A;  4A20 A;  4EOY A;  1YX5 B;  1WYW B;  3O65 B;  1Z2M A;  4BKT A;  2QIE B;  3M95 A;  3QA8 A;  3HUI A;  4G3X B;  4W9G A;  4JWU C;  1PGA A;  3EGR A;  3MC8 A;  3PRM B;  4DBG A;  2PW9 A;  4YSY B;  3AE2 B;  1JAL A;  2KD0 A;  3AEF B;  2EMT A;  5DPW A;  2DBY A;  2K22 A;  1XT9 B;  4DWF A;  1V9J A;  4N59 A;  2H88 B;  1WMH B;  1AAR A;  3RNE C;  3WAP A;  1E6E B;  4AP4 C;  4MSM B;  2J0J A;  5TR5 A;  3PZ7 A;  4EZK A;  2D11 A;  2WXH A;  1WX7 A;  2LI5 A;  3ABV B;  1N62 A;  2QMT A;  1IGD A;  2JF5 A;  3BIN A;  3Q3F A;  3W5V B;  2XBB C;  4XX5 A;  5E6O A;  3V3X A;  2AQ1 B;  1NI3 A;  3H7P B;  3DPD A;  3K9O B;  3TCA A;  3ZGZ A;  3Q3M C;  1N6Z A;  1V86 A;  3U7D A;  1TY0 A;  2KC2 A;  3L13 A;  5AUK A;  3KYD D;  3AI5 A;  2A5U A;  4ZRI A;  1HA5 A;  2M17 A;  5H92 C;  4YTM B;  2V4L A;  1WX8 A;  3CST A;  4PYZ A;  3IBE A;  4D2K A;  1FCL A;  2KTR B;  4LNN A;  3A9K B;  1GB4 A;  1NEK B;  4JIO U;  5DPT A;  2AQ2 B;  1HTQ A;  2NPT A;  3TBL D;  1JWM D;  4HVB A;  4EE2 A;  1TKG A;  4A55 A;  3NY5 A;  2KNB A;  2LHD A;  4ICU A;  3WAL A;  4ZYN A;  2WYQ A;  4LCD E;  4I6N B;  2N7D A;  1VR9 A;  3NUH B;  4DHJ B;  5BYQ A;  4IUM B;  4IW0 A;  1Y8R C;  2PE9 A;  3ZO5 B;  1RYJ A;  3B2F A;  2E6X A;  3Q3J A;  4IM2 A;  4BAX A;  1RFK A;  2WXK A;  3W5U B;  3EHV A;  2HTM E;  3AU4 A;  5FR3 A;  4EUT A;  1PGX A;  1YQB A;  2WXQ A;  1R4M I;  5J18 A;  1N63 A;  4AS1 A;  5D3I B;  2BWF A;  1YJI A;  5C3J B;  2YVC A;  4ZRJ A;  3ZKJ C;  3ONS A;  4LNI A;  4FJV B;  4WAA A;  4NZL B;  3I63 C;  1DOX A;  2YEP B;  1HEZ E;  1XCT L;  2LFI A;  2IO1 B;  3BK2 A;  2EEL A;  2M0X A;  2BVC A;  1L4Z B;  1V1O A;  3ZRF A;  1YN3 A;  4LNK A;  2FAZ A;  3ECI A;  4GB9 A;  4ZHO A;  2Y5C A;  3RNA C;  5J2R A;  2KDM A;  5IOI A;  1WMH A;  2EKE C;  2JRH A;  1AYF A;  1WE7 A;  2K1F A;  2I1K A;  1TY2 A;  3W9C B;  2ON8 A;  2GBM A;  3NG0 A;  3PLV A;  3RNB C;  2KMC A;  4YSZ B;  1XXG A;  1L6V A;  1KJT A;  1FRD A;  1JRU A;  2H89 B;  4TUU A;  1BML C;  4LDT B;  4AOF A;  4AWJ A;  1IBX B;  2MP2 A;  3V62 A;  1WZ3 A;  3NZ3 A;  2O6V D;  5AZH A;  1XQQ A;  3BYT B;  2KKC A;  4WQO B;  1VD2 A;  2JWU A;  4GDL B;  1KTK A;  1QOB A;  2C7N B;  3DBR B;  4YXD B;  1GPX A;  3RNF C;  4LTU A;  3W1Y A;  3PRP B;  1TYG B;  4DDI D;  3I5J C;  4ANW A;  3BWU D;  4IG7 B;  4L23 A;  2I1J A;  1UEL A;  3DVG X;  2XNA C;  1FCC C;  1V5T A;  4GGQ A;  3U52 E;  2LHE A;  2NPT B;  3M62 B;  2AQ3 B;  2KMM A;  4RH6 A;  3B0A A;  5FKA C;  2KLG A;  2VRR B;  4K7W A;  4YT0 B;  4DQO C;  3V60 A;  4E71 A;  1GOZ A;  4CHK A;  5C1Z A;  1FO4 A;  2OOB B;  3NS1 A;  2WDR B;  4FBJ B;  1ZKH A;  3QWZ B;  2XK5 A;  3HIZ A;  1ZE3 D;  4OVV A;  4US9 A;  1MPE A;  4LDT D;  1WI0 A;  2N1V A;  3AUL A;  3SU8 X;  3PLU A;  2RGF A;  5E6J A;  2IO2 B;  4OZB A;  3PHW B;  2MCN B;  3BZD B;  3GS2 A;  2Z59 B;  3MHS D;  4HCP B;  3DBS A;  3DVN U;  2LZ6 A;  1K53 A;  1RM6 C;  4YTN B;  1F2R I;  2LD9 A;  4LJO B;  4GXB A;  2JRI B;  2L0T A;  3KW5 B;  4FN2 A;  2D2Q A;  4ARI A;  4W9C A;  3DOW A;  3JW0 X;  3U30 A;  1C4C A;  2HJ8 A;  2IGD A;  1NBF C;  4M01 A;  3ZQ4 A;  2OJR A;  3ZJV A;  4P6V F;  1C3T A;  5IAA C;  2BQQ A;  1G6J A;  1YJ1 A;  1RRB A;  3ZNI D;  1D5M C;  3B2G A;  3RFZ B;  3N1Z C;  1EWY C;  2RMM A;  2KX0 A;  4HEA 1;  4MSQ B;  2Z8L A;  5BMH A;  5I4D A;  2PJH A;  4ZRK A;  3ZJT A;  4GN1 A;  5BYR A;  2G45 B;  2W9N A;  3RZF A;  2K8H A;  1MJD A;  2LGD A;  3DVG Y;  1F1H A;  2W3S A;  2BPS A;  2WS3 B;  3UI3 A;  1WXM A;  4HRS A;  4B95 A;  1MG4 A;  1SE3 A;  2FNJ B;  3BII D;  1TKY A;  5JH5 C;  3DBL B;  4FA6 A;  3DQV A;  1V8C A;  4BBN C;  1UBQ A;  3X0W A;  3GZN I;  4W9H A;  2NTS A;  4G11 A;  5J17 A;  1ZGU B;  4ASW C;  4YSX B;  2OJW A;  5JHB A;  2RDH A;  3SHQ A;  1EF5 A;  1ENF A;  4RGO S;  2M0A A;  5AEK B;  2MBO A;  3ZW3 A;  3TEY A;  2O6V A;  2W55 A;  2KWV B;  4RF0 A;  2IGH A;  3ZDM C;  2LMC A;  1E7U A;  3VUW A;  2QDF A;  1K50 A;  1I42 A;  3C19 A;  4IWQ A;  4RNA A;  2K6Q A;  2ZCC A;  2M19 A;  2KQ4 X;  3KYC D;  2FUH B;  2G3Q B;  3B1L X;  4ZOH C;  3Q8A A;  1ZDV A;  2C7M B;  2JXT A;  1A70 A;  4ACF A;  1TTN A;  3AV8 A;  3LDZ E;  4MM3 B;  2N0S B;  3QQ8 B;  2INP E;  3EFU A;  1TS2 A;  4USA A;  4W9K A;  1WF9 A;  3J9C A;  4IM3 A;  4AJW A;  1H4R A;  2KWU B;  3QHT A;  2FID A;  2JUO A;  3TJP A;  2ZPY A;  4I6P A;  4FHJ A;  1M4V A;  2W54 A;  3H9D A;  5D94 A;  2WXP A;  1C4P A;  2L32 A;  2JSV X;  2AL3 A;  3OG5 A;  4S17 A;  1E7V A;  5EE1 A;  2RDG A;  1QLB B;  4S0R A;  3FKY A;  4REZ A;  2CU3 A;  4A9A A;  1L0Y B;  3VAW A;  1HXY D;  1JQ4 A;  2WQY B;  1E8Y A;  4OZA A;  1ESF A;  1V81 A;  1T3Q A;  1L6U A;  3FAH A;  2RD0 A;  3AEG B;  5TSS A;  2DZM A;  2FUG 1;  3TSS A;  1JRO A;  1D5Z C;  3P4Q B;  1YD8 U;  2WP9 B;  4IWO A;  3AEA B;  4MGZ E;  4NAW B;  1FPY A;  1KLV A;  4W9L A;  1P98 A;  3O13 A;  3AB5 A;  3DDC B;  2QSD A;  1I4G A;  2V3P A;  3VTW A;  1TS4 A;  5G55 A;  1NDD A;  2ZCB A;  3PGE A;  2D3B A;  2Z0D B;  1UBI A;  2D10 A;  1YOV B;  1VJK A;  3DBH B;  4K1R B;  5E6P A;  4GSW A;  3A4S C;  3HM6 X;  4HXD A;  4NJ7 A;  3AE5 B;  4KKJ A;  2LAS A;  2REX A;  4TQ0 A;  3T3N A;  1WFY A;  1PGB A;  4L2Y A;  4OHJ A;  2WU5 B;  4PS7 A;  1FNV A;  2VZK B;  3AE8 B;  2WLB A;  3NZS A;  4TQ1 A;  3MP9 A;  4GDK A;  4P1C C;  2N9X A;  4BKG A;  3L16 A;  5D6J B;  3AE9 B;  3V05 A;  3Q8F A;  4WWP A;  2L3Z A;  1P9D U;  2KDE B;  3R66 C;  3FIL A;  3SDL C;  2DZI A;  1RAX A;  1DOY A;  1TGZ B;  4RFB A;  2J4X A;  1CQV A;  1D5X C;  1NEN B;  1P3Q U;  3IHP C;  4KZ0 A;  2QC8 A;  3EUB 2;  5DPR A;  3JYU A;  3DBR I;  3LYY A;  1J0G A;  1U4A A;  1L2N A;  1VRA B;  1Q10 A;  2PLP A;  1J8C A;  3T9L A;  4K7S A;  3FC4 A;  3NHE B;  3R8B A;  1LO5 D;  3DVN V;  3ZUN A;  1LGR A;  3IT4 B;  2BF8 B;  3CSF A;  1C1Y B;  4MEL A;  4E3C A;  3QAR A;  3ZIM A;  2WXF A;  2KDB A;  2CJN A;  4NQL B;  1P7E A;  4P1B C;  1XLQ A;  4I6L B;  3BVG A;  3SR6 A;  2XEW A;  2ZNV B;  2ACZ B;  2YLM A;  1FNW A;  4KGT A;  4RMA A;  3VXW A;  3V6C B;  4LJP B;  1EM7 A;  2AX5 A;  2QJL A;  1ZPS A;  1QKZ A;  1R4M B;  3B08 A;  4GIV A;  3R7Q A;  4TSS A;  2MBQ A;  4XZ4 A;  5KHO A;  1LFD A;  3APF A;  4W9I A;  1Q5W B;  3MTN B;  5CHF A;  2K8B A;  2LUE A;  2MJD A;  3W1S C;  1B1Z A;  4N58 A;  4OW0 A;  3VUY A;  3MC9 A;  2EKI A;  1V2Y A;  3AE6 B;  5EE0 A;  1NVI D;  5EE9 A;  4WJQ A;  1L0X B;  1YN5 A;  1ROE A;  2KO3 A;  2MRP A;  3PRE A;  2KWD A;  3HVZ A;  4FAD A;  4X57 B;  3AE4 B;  1C76 A;  3P42 A;  2M8S A;  4RGT A;  4NAM A;  1KM7 A;  2A4Z A;  2DYM A;  1SE4 A;  3GOE A;  1R4N I;  2KX3 A;  3FIL B;  1X1M A;  1VZ6 A;  3A9K A;  3Q3N C;  2RPV A;  3MJ5 A;  2WNM A;  2BS4 B;  4FXC A;  1RFA A;  5C23 A;  2IJ0 A;  2PIA A;  2I38 A;  4L1B A;  1J19 A;  2NBU A;  3DHH C;  2NVU I;  3LB8 C;  1YJJ A;  3H1U A;  1Q1O A;  2W3R A;  4MJS A;  2KYW A;  4OVU A;  3BVM A;  1HZ5 A;  2B76 B;  3CMM B;  3GP7 A;  2DWQ A;  2KQS A;  3MJW A;  2C60 A;  1WXV A;  1UWX A;  2KJ6 A;  3V61 A;  4IKG A;  4ANX A;  3P2B A;  4PS3 A;  1WJU A;  4BVU C;  2R61 A;  4P16 A;  1FXA A;  1FEH A;  3PTF C;  2J0K A;  2WX0 A;  2J53 A;  4H2A A;  1FFV A;  1WRI A;  2GBJ A;  4JGH B;  1YQ4 B;  3QX1 A;  1F9J A;  1HTO A;  1QOG A;  3IT6 B;  5L83 A;  3VR9 B;  2CKH B;  2FCQ A;  2HE7 A;  1F2R C;  3VTU A;  3KWL A;  1UD7 A;  1ISN A;  1MVK A;  2DYO A;  2KAN A;  2JVC A;  2KT7 A;  1T0R C;  3AU5 A;  3SFD B;  3SD5 A;  1NYQ A;  1EUV B;  3UF8 A;  2BKF A;  4LK0 M;  2LEK A;  4EFO A;  1ZDX A;  2N1W A;  2LRU A;  4WIP A;  1F77 A;  2N4F A;  2KOX A;  4GOC A;  4TKN A;  2DZK A;  3DHI C;  3PS6 A;  2VH1 A;  1JW9 D;  3A1Q B;  2ONQ A;  1RWS A;  3VUX A;  2MHJ A;  2N9L A;  2BWE S;  2CR5 A;  2V4I B;  1SE9 A;  4FJY A;  4NAW A;  2E3T A;  4MM3 A;  5D7G A;  2C9W B;  2ZW1 A;  4MH8 A;  4OZC A;  4J3O D;  2ICI A;  4NPN A;  2MQJ A;  4K3C A;  1WGK A;  3JSV A;  2LGS A;  4RCO A;  5D3D A;  1T6B X;  4F7Z A;  2D3C A;  5CX3 A;  2NTT A;  4EEW A;  3JSV B;  2V1Y A;  2WU2 B;  3RPF C;  2HD5 B;  5L95 C;  2MBH A;  2ZW0 A;  3AE1 B;  1DGJ A;  3DBL I;  2AL6 A;  2VZK D;  1TS3 A;  2VH2 A;  1T5X D;  3ZNZ B;  1FFU A;  1FXT B;  4ARC A;  3KLS X;  2Q5W D;  4DXA B;  4KSL C;  1V6E A;  2KTF A;  2V9H A;  2BTE A;  2JPH A;  3NVY A;  4MAC A;  2HDE A;  1MG8 A;  1R4N B;  1YX6 B;  1VDV A;  2MBE A;  4ZHP A;  1L7Y A;  3VFK A;  1K52 A;  2RPQ A;  4EZJ A;  1WZ0 A;  3T3O A;  2MSE D;  3K9P B;  2TSS A;  1P1A A;  1BT0 A;  5LXI B;  4GDL A;  2D3G A;  4FUL A;  1Q0W B;  1E0Z A;  1BUI C;  2UYZ B;  1OQY A;  1R7S A;  1WH3 A;  1KFY B;  2AEH A;  4EKU A;  1SEB D;  3KQ4 A;  3EC8 A;  3IAM 1;  3DCG A;  2NBV B;  2IPK D;  2QIL A;  1E9M A;  2FBW B;  4KIK A;  1AN8 A;  1WGG A;  3PZ8 A;  4BBN F;  1GJZ A;  3TEZ A;  2N7J A;  3RNC C;  4PT5 A;  5G5G A;  2DX5 B;  3AH7 A;  5EDS A;  3DWM A;  4FJZ A;  2KN5 A;  2Z0E B;  3Q8B A;  3E9S A;  1JML A;  2G4D B;  4MH0 E;  1PUT A;  1HE8 A;  1WGH A;  1D4B A;  3NZU A;  1JWS D;  2V0G A;  2N7E A;  1DYQ A;  1AWD A;  1T0Q C;  1SSN A;  1GAQ B;  2IO3 B;  1WR1 A;  4WWN A;  1OFF A;  5H8Y E;  5FR6 A;  2X38 A;  4KIK B;  2IDY A;  3AEB B;  2RSU A;  1I4X A;  2KFK B;  2L83 A;  3I57 A;  1YIW A;  2CJO A;  3X23 A;  4CO7 A;  1CMX B;  1D3Z A;  4NQK E;  2BT6 A;  1JWA D;  3HK0 A;  1ACC A;  2L76 A;  2BW2 A;  4ZYS A;  3QAQ A;  4B9K A;  2QHO A;  1MFW A;  2WDV B;  3PHX B;  2GMI C;  1WIA A;  4B6W A;  4W9D A;  3MC0 B;  4KX6 B;  2WXG A;  1UH6 A;  4HPL B;  2PVO D;  3N1Y C;  3PSE B;  1FD6 A;  4HCN B;  3BK1 A;  1SJE D;  4WAF A;  2PVG C;  4ANU A;  2JYE A;  3UGB B;  1XCQ L;  2KVR A;  3KUD B;  2WXR A;  1TJE A;  1QZE A;  3PO0 A;  5MPO A;  1VCB A;  3OWE B;  1WM3 A;  1EF1 A;  1E10 A;  3R3M A;  2D07 B;  4RGN A;  1MHX A;  1SGH A;  2CU1 A;  3U2S C;  5IP4 D;  1D6E C;  3PV1 A;  4C80 A;  2GLS A;  1EO6 A;  2IO0 B;  5HG2 A;  1T0S C;  3NJT A;  2KDF B;  4A8X C;  2LRW A;  3IXS A;  1VLB A;  2WXL A;  4CYE A;  3QK0 A;  3IG3 A;  4C4V A;  2R2O A;  4DHZ B;  1UF0 A;  3LXF A;  2R2Q A;  4II3 B;  1E8X A;  2L1A A;  4KGS A;  4RM9 A;  3Q69 A;  4NNJ B;  3P4P B;  3NS8 A;  4K81 A;  2KXJ A;  3ZDT A;  1N5X A;  2PEA A;  2XN9 C;  1I35 A;  2PKO A;  3MFG A;  2Y5P A;  2W82 A;  2WWZ A;  2WXN A;  3ZVV A;  1E5W A;  4KDL B;  1C4A A;  4DDG D;  1XLP A;  2LGY A;  3ENE A;  4HJK A;  3BY4 B;  3L17 A;  1TT5 B;  2D3A A;  4BZA A;  3AMZ A;  3RUI B;  2QEJ C;  4AQ7 A;  4MJS B;  3RMK C;  4A90 A;  4TV3 A;  1SF0 A;  1YQ3 B;  3R7R A;  4E74 A;  1L4D B;  1E8Z A;  2BYE A;  2MWS B;  1IPG A;  1GG3 A;  3ZNH B;  1FXI A;  4KV2 A;  1WY8 A;  2RR9 A;  2JWZ A;  3HHM A;  3W1S A;  4QAY A;  3I9V 1;  5HKH A;  1TIF A;  1OQR A;  1ZP0 B;  2N9P C;  2X8X X;  1WX9 A;  4ICV A;  1J7A A;  2G9H D;  3TL5 A;  1P7F A;  4II2 B;  2LVO A;  4A3P A;  1I4H A;  3P4S B;  1YN4 A;  5IO9 A;  1I4R A;  3PZD A;  4KSK C;  2ZVN A;  1QOA A;  3Q3O C;  2DAJ A;  2KHW B;  4W9E A;  3I3T B;  2DLB A;  2ZZP B;  4DHJ D;  1UGJ A;  3P4R B;  3ZJU A;  5LNK 1;  2G4S A;  3KUZ A;  4XWW A;  1VZ8 A;  3DHG C;  3VTV A;  4DHZ E;  1K51 A;  1WGY A;  1IGC A;  3R2I A;  1LQB A;  3H7P A;  1C77 A;  2GI9 A;  4MGI E;  5LLI A;  3L08 A;  1QF6 A;  2BYF A;  1UGM A;  4KVG B;  1N61 A;  3M3J A;  3B9J A;  4IOI E;  1WM2 A;  1N5W A;  1QQR A;  2FCS A;  4M02 A;  2CHZ A;  2O2V A;  2JYT A;  3LJ3 A;  4JLC A;  3VDZ A;  2BB6 A;  2V3S A;  3SFE B;  4DXG A;  2MX2 A;  3AE7 B;  4J6I A;  5GMV A;  1E8W A;  1OEY A;  2M4N A;  3A4R A;  3NVW A;  4W9F A;  1SXT A;  4JQW C;  2FIF A;  1GB1 A;  4BOS C;  2Y3A A;  2IGG A;  1C9F A;  4PK1 A;  2ZVO A;  4IM0 A;  4AJY B;  4RM8 A;  3V6E B;  1WGR A;  3APD A;  4HK2 A;  3OJ4 B;  2MBB B;  4XGA B;  4YL8 A;  1I7H A;  2PMV A;  1OGW A;  3URY A;  1P0R A;  2LUM A;  1TKE A;  2L05 A;  2LVP A;  3C8Y A;  2LWP A;  1SBB B;  4M0W B;  1ET9 A;  2FE8 A;  1PYW D;  2G1E A;  5CHW A;  2GOW A;  3N1X C;  3APC A;  1IBX A;  3P63 A;  2M1M A;  4XWT A;  1UWM A;  3N32 A;  3WIM A;  3ZYY X;  2JZ3 B;  4KGR A;  3A9J B;  3KWV A;  3WAO A;  3L54 A;  5EE3 A;  1H8C A;  4US8 A;  1GNU A;  2O6V B;  1TBE A;  2K8C A;  2KZR A;  4A6Q A;  3N30 A;  4M8N A;  2KJR A;  2ZJD A;  1VZ7 A;  2MEK A;  3Q8C A;  4WWM A;  1OQQ A;  3AE3 B;  1OTR B;  3A33 B;  3RZW C;  2KN4 A;  4C00 A;  1PQS A;  3AEC B;  1EU4 A;  4MGY E;  3EEC A;  4EZL A;  1CK1 A;  3QJZ A;  1TS5 A;  5BMI A;  2QCZ A;  3VRA B;  3DBH I;  3ZRC A;  5BO4 B;  3RUL A;  3IAS 1;  1UZX B;  1V49 A;  4HKZ E;  5BMG A;  2MH7 A;  1IYF A;  2I2Y A;  4NY0 A;  2SAK A;  2LJI A;  4K3B A;  1J7C A;  1E7P B;  4M8M A;  3NVV A;  4C7Z A;  2NS5 A;  2KWC A;  3R2T A;  3ETR A;  4GLS C;  4ZRP A;  4JL9 A;  2IYD B;  4WJO A;  4B0M A;  3AN1 A;  2KAC A;  2L0F A;  3T8M A;  2BYV E;  5DPS A;  2K9X A;  1FRR A;  2KVZ A;  2K5P A;  1WJN A;  4JPS A;  1FMA D;  1WGD A;  4WUR A;  3ML9 A;  5CTR C;  5JHA A;  3S2A A;  4XYC A;  2J7Q B;  1B9R A;  5IKC M;  3BVZ A;  2JZZ A;  4GMV A;  4A3O A;  1V5O A;  3U7Z A;  1EWC A;  3GE3 C;  2DYB A;  2KTR A;  5JXV A;  3NVZ A;  2HJ1 A;  3ZTC A;  3OAW A;  3QCA A;  5KHQ A;  1BXT A;  2GBR A;  3AXC A;  4C7Y A;  5T8I A;  3H7S A;  3KUC B;  2KLC A;  4N9F 4;  4N6E B;  3CF6 E;  2IY0 B;  2GB1 A;  1V1P B;  5GXG B;  4ITK A;  5AZF A;  4F1S A;  1NYR A;  2MJ3 A;  4BOZ B;  1S3S G;  2ZPN A;  1L5P A;  3Q6B A;  1KRH A;  1V1P A;  2UU7 A;  2XK5 B;  2AWT A;  3C0R B;  3EFC A;  2K0P A;  5AUI A;  1S1Q B;  2WDQ B;  3ZXR A;  2BS3 B;  3JVZ X;  3VQI A;  4MEM A;  3TEX A;  4K7U A;  1FIQ A;  4ZDV A;  1F0Z A;  1WJ4 A;  1K8R B;  3CWI A;  4G0N B;  1XD3 B;  3KVF B;  1RLF A;  2JQR B;  1QOF A;  1Z5S B;  2EMS A;  2JXX A;  2BGF A;  3WAN A;  4JX1 C;  3VRB B;  2JT4 B;  2WXJ A;  4LNO A;  4TMA B;  3PT2 B;  1I4P A;  5C2T B;  1V97 A;  3RCZ A;  2WDT B;  1PFD A;  2MP2 B;  2WX1 A;  2ZEQ A;  1L0V B;  4GU2 A;  3N3K B;  3TIX A;  4XC2 A;  5DCN A;  4HJG E;  3HVD A;  3GZN B;  2DEN B;  4BKS A;  2JY6 A;  1Y56 A;  2JU6 X;  4IC7 B;  4ZRQ A;  1T0Y A;  2SEB D;  3WCQ A;  1C79 A;  3TEW A;  1A5R A;  2K39 A;  4IDI A;  2L00 B;  1WSP A;  1IP9 A;  3RN9 C;  2DAF A;  1AW7 A;  3QIJ A;  1JWB D;  2LJ5 A;  4DK5 A;  1WXQ A;  4UDU C;  3PVL A;  2KMA A;  2Y5B B;  4FLH A;  1SIJ A;  1N60 A;  2IY1 B;  2CHW A;  3UIP B;  5LXH A;  1JWU D;  2KK8 A;  1KOT A;  1STE A;  1C78 A;  1GUA B;  4DXF A;  2BKR B;  2AYO B;  1GC7 A;  1JRP A;  3HM3 A;  1SE2 A;  1ZXH A;  2CS4 A;  1SB3 C;  2NR2 A;  3Q14 C;  1XEE A;  5CHV C;  2L8J A;  1WXS A;  2JZP A;  4M0W A;  2WHI A;  3AM9 A;  3RYT A;  5IN7 A;  2B3A A;  2BS2 B;  4HKQ A;  2J52 A;  4BFR A;  4R3D A;  4XDC A;  4RGM A;  3QC8 B;  4LNF A;  3WA0 A;  2L52 A;  3TUO A;  1SIF A;  2KJH B;  2BBC A;  2KC1 A;  2ZNV C;  2M56 B;  2DZJ A;  5D2M B;  1ZOY B;  1KH0 A;  1KLU D;  2WGS A;  5AZG A;  1XLN A;  4F8C B;  2O2V B;  3D32 A;  1XO3 A;  2K25 A;  1J7B A;  3UIN B;  2FCM A;  5G5H A;  4HLE A;  2RDB C;  2WXI A;  2LXC A;  3WAM A;  4JE3 B;  5JZE B;  1WYG A;  2MW5 A;  4AUQ C;  2NCN A;  1ZUD 2;  3ALB A;  1NI2 A;  3PPA A;  4IWP A;  1LXD A;  3SEB A;  5HI1 A;  2KFK A;  3VH3 B;  4P7I A;  3VR8 B;  3L10 B;  3KH0 A;  1ZW7 A;  2DHZ A;  1E90 A;  2N9E B;  3VVW B;  5BYS A;  4HPM B;  4PYU A;  1TZ1 A;  2J42 A;  4XDD A;  3UIO B;  4PS8 A;  3HRD D;  3DWG C;  4ANV A;  3H6N A;  5E6N A;  3ZLZ A;  2N9K A;  2MLB A;  1QIL A;  1PDX A;  3W2D A;  1FNU A;  1YMH E;  4WQM A;  3TMP B;  2UWQ A;  4FHK A;  1IUE A;  4OVZ A;  4C4V B;  3OJ3 A;  2J0M A;  1XLO A;  2GBN A;  1WJ6 A;  4YWG G;  2JX5 A;  3Q8E A;  3ZTD A;  4HDO A;  4WJN A;  3IVF A;  3U8Z A;  2INN E;  4MGK E;  4MT5 A;  2NMQ A;  4G50 A;  5HHD G;  4KKI A;  1HZ6 A;  1OEY J;  3E56 A;  3Q2A C;  4NJ6 A;  3U4E G;  3H8H A;  4LLG M;  4HWI B;  4HPP A;  1M94 A;  2K3U A;  4HRO A;  4B0E A;  5FK9 C;  2LVQ A; 
#chains in the Genus database with same CATH homology
 4W9F A;  4WJP A;  2HE7 A;  2FIF A;  2OJR A;  4JQW C;  4BOS C;  3VTU A;  4URK A;  1UD7 A;  1C3T A;  1ISN A;  2DYO A;  5IAA C;  3VH4 B;  2KAN A;  1G6J A;  2JVC A;  1YJ1 A;  2ZVO A;  4IM0 A;  1RRB A;  4AJY B;  4RM8 A;  3AU5 A;  3V6E B;  1WGR A;  3APD A;  4HK2 A;  3OJ4 B;  2MBB B;  1V80 A;  3SD5 A;  3ZNI D;  1EUV B;  3UF8 A;  2BKF A;  4YL8 A;  1OGW A;  4EFO A;  3NOB A;  4WWO A;  3ML8 A;  1P0R A;  2KX0 A;  2N1W A;  4MSQ B;  2PE6 B;  2LRU A;  2N4F A;  2KOX A;  2L05 A;  2LVP A;  4GOC A;  1WXA A;  2CHX A;  2MA9 B;  4TKN A;  2LWP A;  2PJH A;  4ZRK A;  2DZK A;  4M0W B;  5G2N A;  3PS6 A;  2C5L C;  4GN1 A;  5CHW A;  2G45 B;  2GOW A;  3APC A;  2W9N A;  3RZF A;  2K8H A;  3A1Q B;  2LGD A;  3DVG Y;  2LXA A;  2ASQ A;  2M1M A;  3VUX A;  2BPS A;  2K6D B;  1WXM A;  2BWE S;  4B95 A;  2FNJ B;  4HDQ A;  2KDI A;  3M63 B;  2CR5 A;  3N32 A;  5IA7 A;  3L0W B;  3WIM A;  5JH5 C;  2JZ3 B;  2KFJ A;  3A9J B;  4BKS D;  1SE9 A;  4FA6 A;  3WAO A;  3L54 A;  4FJY A;  1H8C A;  4NAW A;  3DQV A;  3IFW B;  4MM3 A;  5D7G A;  1UBQ A;  2PPH A;  4BBN C;  1GNU A;  3VHT C;  2C9W B;  3X0W A;  2O6V B;  3GZN I;  4W9H A;  1TBE A;  4G11 A;  2NBW B;  4NPN A;  2MQJ A;  4KDI C;  2K8C A;  2KZR A;  3JSV A;  5J17 A;  2C7H A;  3N30 A;  4M8N A;  2KJR A;  2ZJD A;  4F7Z A;  1ZGU B;  4ASW C;  2L7R A;  1OTR B;  3A33 B;  3RZW C;  5CX3 A;  4EEW A;  5JHB A;  3JSV B;  2V1Y A;  1PQS A;  3SHQ A;  2HD5 B;  4MDK E;  1WE6 A;  1WR6 E;  2MBH A;  5L95 C;  1EF5 A;  3EEC A;  4MGY E;  4EZL A;  3DBL I;  3PRZ A;  2AL6 A;  3QJZ A;  5AEK B;  2MBO A;  3RD2 A;  3ZW3 A;  3ZNZ B;  2O6V A;  4KZC A;  3UQB A;  3DBH I;  2KWV B;  2IZV B;  3ZRC A;  3ZDM C;  1FXT B;  5BO4 B;  1E7U A;  3RUL A;  3VUW A;  1UZX B;  1V49 A;  4DXA B;  1I42 A;  1IYF A;  1WRD B;  4KSL C;  4IWQ A;  4NY0 A;  1V6E A;  2K6Q A;  2KTF A;  2IBI B;  2ZCC A;  3KYC D;  2JPH A;  2FUH B;  3RT3 B;  2G3Q B;  3B1L X;  1MG8 A;  3A1Q A;  4M8M A;  1LM8 B;  1YX6 B;  2NS5 A;  2KWC A;  2GBK A;  2MBE A;  2KQ7 A;  2LGX A;  2C7M B;  4JL9 A;  2IYD B;  1L7Y A;  4WJO A;  3VFK A;  1TTN A;  3LDZ E;  2L0F A;  2FCN A;  3T8M A;  2BYV E;  3OLM D;  3QQ8 B;  5DPS A;  2RPQ A;  4EZJ A;  1GC6 A;  3A9J A;  3EFU A;  1WZ0 A;  2HTH A;  3ZNG C;  2MSE D;  3K9P B;  4W9K A;  1WJN A;  1WF9 A;  4IM3 A;  1P1A A;  4AJW A;  1BT0 A;  5LXI B;  1H4R A;  4GDL A;  2KWU B;  4GDK B;  2D3G A;  4W9J A;  1WGD A;  4FUL A;  1Q0W B;  3QHT A;  3ML9 A;  2UYZ B;  5CTR C;  2FID A;  5JHA A;  3UQA A;  1OQY A;  4A20 A;  4EOY A;  1YX5 B;  3S2A A;  1WYW B;  2JUO A;  3O65 B;  1Z2M A;  3TJP A;  4BKT A;  1WH3 A;  2ZPY A;  2J7Q B;  4FHJ A;  2AEH A;  4I6P A;  3M95 A;  3QA8 A;  4EKU A;  4G3X B;  2JZZ A;  4GMV A;  4A3O A;  1V5O A;  3H9D A;  5D94 A;  4W9G A;  2AL3 A;  2DYB A;  3PRM B;  4DBG A;  2KTR A;  3EC8 A;  1E7V A;  3DCG A;  2NBV B;  2KD0 A;  2EMT A;  4KIK A;  3ZTC A;  3OAW A;  1WGG A;  5DPW A;  3VAW A;  1XT9 B;  4BBN F;  4DWF A;  1GJZ A;  1V9J A;  3QCA A;  5KHQ A;  1E8Y A;  1WMH B;  1AAR A;  3WAP A;  2DX5 B;  2GBR A;  3AXC A;  5EDS A;  1V81 A;  4AP4 C;  3H7S A;  3KUC B;  2KLC A;  4FJZ A;  2KN5 A;  4MSM B;  2J0J A;  4N9F 4;  5TR5 A;  4EZK A;  2Z0E B;  3CF6 E;  2IY0 B;  2D11 A;  2RD0 A;  5AZF A;  4F1S A;  1WX7 A;  2DZM A;  4BOZ B;  1S3S G;  2LI5 A;  2ZPN A;  2G4D B;  4MH0 E;  1YD8 U;  2JF5 A;  1HE8 A;  1WGH A;  4IWO A;  3NZU A;  2N7E A;  3BIN A;  2XK5 B;  2AWT A;  3C0R B;  4MGZ E;  4NAW B;  3Q3F A;  2IO3 B;  2XBB C;  1WR1 A;  4WWN A;  1KLV A;  4W9L A;  4XX5 A;  5E6O A;  1P98 A;  1S1Q B;  3DDC B;  3H7P B;  3DPD A;  3K9O B;  5FR6 A;  3TCA A;  1V86 A;  3U7D A;  3VTW A;  2KC2 A;  3JVZ X;  3L13 A;  4KIK B;  3KYD D;  3VQI A;  3AI5 A;  4MEM A;  4K7U A;  4ZDV A;  5G55 A;  2RSU A;  2KFK B;  1NDD A;  2ZCB A;  1YIW A;  2A5U A;  1WJ4 A;  3PGE A;  1K8R B;  4ZRI A;  3X23 A;  2M17 A;  4CO7 A;  2Z0D B;  4G0N B;  1CMX B;  1UBI A;  1D3Z A;  1XD3 B;  2D10 A;  3KVF B;  1RLF A;  4NQK E;  1Z5S B;  2V4L A;  1WX8 A;  2EMS A;  4K1R B;  5E6P A;  3HK0 A;  3A4S C;  3HM6 X;  4GSW A;  4HXD A;  4NJ7 A;  2L76 A;  2JXX A;  2LAS A;  2REX A;  3CST A;  4PYZ A;  4TQ0 A;  2BGF A;  3WAN A;  3IBE A;  3QAQ A;  4B9K A;  2QHO A;  2JT4 B;  2KTR B;  3A9K B;  1WFY A;  3PHX B;  2GMI C;  4JIO U;  1WIA A;  3PT2 B;  5DPT A;  4B6W A;  4PS7 A;  4W9D A;  2NPT A;  3TBL D;  4HVB A;  1UH6 A;  4HPL B;  3RCZ A;  3NZS A;  2WDT B;  3NY5 A;  4GDK A;  4TQ1 A;  2N9X A;  4BKG A;  2KNB A;  3L16 A;  5D6J B;  2MP2 B;  2WX1 A;  2ZEQ A;  2FCQ A;  3PSE B;  4WWP A;  4HCN B;  2L3Z A;  1P9D U;  2KDE B;  4ICU A;  3WAL A;  4ZYN A;  2WYQ A;  3R66 C;  4ANU A;  4GU2 A;  4LCD E;  3N3K B;  3SDL C;  2DZI A;  4I6N B;  1RAX A;  2N7D A;  4XC2 A;  3TIX A;  3UGB B;  2KVR A;  3KUD B;  1TGZ B;  5DCN A;  1QZE A;  2DEN B;  1VCB A;  1WM3 A;  4BKS A;  4DHJ B;  1EF1 A;  2JY6 A;  4IUM B;  4IW0 A;  1P3Q U;  1Y8R C;  3IHP C;  2PE9 A;  3R3M A;  4KZ0 A;  5DPR A;  3ZO5 B;  3JYU A;  4IC7 B;  2D07 B;  3DBR I;  1J0G A;  1SGH A;  1U4A A;  4IM2 A;  3Q3J A;  1T0Y A;  1L2N A;  2CU1 A;  1J8C A;  3T9L A;  3EHV A;  4K7S A;  1A5R A;  3AU4 A;  2K39 A;  3NHE B;  3PV1 A;  2L00 B;  1IP9 A;  4EUT A;  3DVN V;  1EO6 A;  1YQB A;  2DAF A;  3ZUN A;  1R4M I;  2IO0 B;  2BF8 B;  2LJ5 A;  3QIJ A;  4DK5 A;  3CSF A;  1C1Y B;  3PVL A;  2KMA A;  2Y5B B;  4FLH A;  4MEL A;  4E3C A;  5J18 A;  3QAR A;  3ZIM A;  2BWF A;  2KDB A;  2KDF B;  4NQL B;  2YVC A;  2LRW A;  4ZRJ A;  3ZKJ C;  2IY1 B;  4I6L B;  2CHW A;  4CYE A;  3QK0 A;  3UIP B;  5LXH A;  2KK8 A;  2XEW A;  3ONS A;  2ZNV B;  3IG3 A;  4FJV B;  4WAA A;  1KOT A;  1GUA B;  2YLM A;  2R2O A;  4DHZ B;  2BKR B;  2R2Q A;  2AYO B;  2IO1 B;  1E8X A;  4II3 B;  1GC7 A;  4RMA A;  3VXW A;  2M0X A;  3HM3 A;  2CS4 A;  4RM9 A;  4NNJ B;  2NR2 A;  3V6C B;  3ZRF A;  4LJP B;  3NS8 A;  2FAZ A;  4GB9 A;  5CHV C;  3ECI A;  2L8J A;  4K81 A;  2KXJ A;  1WXS A;  3ZDT A;  2PEA A;  1I35 A;  5J2R A;  1WMH A;  3B08 A;  2EKE C;  4GIV A;  2JRH A;  3R7Q A;  4XZ4 A;  2MBQ A;  3RYT A;  2WWZ A;  2B3A A;  3ZVV A;  5KHO A;  1E5W A;  1LFD A;  3APF A;  1WE7 A;  2K1F A;  1Q5W B;  4KDL B;  2I1K A;  4W9I A;  4DDG D;  3MTN B;  2LGY A;  5CHF A;  2K8B A;  3ENE A;  4HJK A;  3BY4 B;  3L17 A;  2GBM A;  2LUE A;  3PLV A;  2KMC A;  3W1S C;  4BFR A;  3VUY A;  1KJT A;  1V2Y A;  3RUI B;  3QC8 B;  3WA0 A;  1JRU A;  4MJS B;  4WJQ A;  4TUU A;  4LDT B;  1SIF A;  2KO3 A;  2MRP A;  2KJH B;  4AOF A;  3PRE A;  4AWJ A;  4TV3 A;  3R7R A;  2KC1 A;  2ZNV C;  4E74 A;  2DZJ A;  2MP2 A;  3V62 A;  1WZ3 A;  5D2M B;  4FAD A;  2O6V D;  5AZH A;  1E8Z A;  2BYE A;  2MWS B;  4X57 B;  1IPG A;  1XQQ A;  4F8C B;  5AZG A;  2O2V B;  1GG3 A;  3D32 A;  2KKC A;  4WQO B;  2M8S A;  3ZNH B;  1VD2 A;  4GDL B;  1KM7 A;  2A4Z A;  4KV2 A;  2DYM A;  2C7N B;  1WY8 A;  2RR9 A;  2JWZ A;  2K25 A;  3GOE A;  1R4N I;  3HHM A;  3UIN B;  3W1S A;  2FCM A;  2KX3 A;  5HKH A;  3W1Y A;  3PRP B;  1X1M A;  3A9K A;  4HLE A;  4DDI D;  2LXC A;  2N9P C;  3WAM A;  4ANW A;  1RFA A;  4IG7 B;  5C23 A;  5JZE B;  1WX9 A;  2MW5 A;  4AUQ C;  2I1J A;  4ICV A;  2NCN A;  1UEL A;  3DVG X;  3ALB A;  3TL5 A;  4II2 B;  2LVO A;  4A3P A;  1NI2 A;  3PPA A;  4IWP A;  1LXD A;  1V5T A;  4GGQ A;  2KFK A;  2NPT B;  4P7I A;  3M62 B;  3VH3 B;  3L10 B;  3B0A A;  3KH0 A;  1ZW7 A;  2DHZ A;  1J19 A;  1E90 A;  2KLG A;  2NBU A;  2ZVN A;  3PZD A;  4KSK C;  2VRR B;  2NVU I;  2N9E B;  4K7W A;  3VVW B;  4HPM B;  3H1U A;  4PYU A;  2DAJ A;  2KHW B;  4W9E A;  1Q1O A;  4MJS A;  4OVU A;  1TZ1 A;  3I3T B;  3V60 A;  4E71 A;  3UIO B;  4PS8 A;  4ANV A;  4CHK A;  5C1Z A;  2ZZP B;  3CMM B;  4DHJ D;  3H6N A;  2OOB B;  5E6N A;  4FBJ B;  1ZKH A;  3ZLZ A;  3QWZ B;  2MLB A;  2XK5 A;  3HIZ A;  4OVV A;  2KQS A;  4LDT D;  1WI0 A;  2N1V A;  3AUL A;  3MJW A;  3SU8 X;  2G4S A;  3KUZ A;  2C60 A;  3PLU A;  2RGF A;  3VTV A;  3TMP B;  4DHZ E;  1WXV A;  2KJ6 A;  2UWQ A;  4FHK A;  3V61 A;  2IO2 B;  4ANX A;  3PHW B;  2MCN B;  3P2B A;  1WGY A;  4PS3 A;  1WJU A;  2Z59 B;  3MHS D;  4BVU C;  3OJ3 A;  4HCP B;  1LQB A;  2J0M A;  3H7P A;  4MGI E;  2GBN A;  1WJ6 A;  5LLI A;  3L08 A;  3DBS A;  2BYF A;  1UGM A;  3PTF C;  2J0K A;  4KVG B;  3M3J A;  3ZTD A;  2WX0 A;  4HDO A;  3DVN U;  4WJN A;  1WM2 A;  2LZ6 A;  3IVF A;  3U8Z A;  4MGK E;  2FCS A;  4G50 A;  2CHZ A;  2LD9 A;  4LJO B;  2GBJ A;  2O2V A;  4JGH B;  3LJ3 A;  4GXB A;  1OEY J;  2JRI B;  2L0T A;  4JLC A;  3QX1 A;  1F9J A;  2V3S A;  3KW5 B;  3VDZ A;  4FN2 A;  2D2Q A;  2MX2 A;  4J6I A;  4W9C A;  4NJ6 A;  3DOW A;  3JW0 X;  5GMV A;  5L83 A;  3U30 A;  1E8W A;  1OEY A;  2CKH B;  4HWI B;  1M94 A;  2HJ8 A;  2M4N A;  1NBF C;  3A4R A;  2LVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...