4ICUA

Ubiquitin-like domain of human tubulin folding cofactor e - crystal from a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
QLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Tubulin-specific chaperone E
publication title The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4icuA00
3ZTDA 3W1YA 2KO3A 2KHWB 2NPTB 2UYZB 2VRRB 3A9JB 4FJYA 4KSKC 5DPSA 4OVVA 4ZRJA 1UH6A 2EMTA 4KVGB 1Z2MA 3RZFA 4I6NB 4WAAA 4W9JA 3QWZB 2W9NA 1NI2A 4ZRIA 3ZO5B 4MGZE 3KUZA 4DDID 5CTRC 2JVCA 1GC7A 4BOZB 3ONSA 3VHTC 1V86A 3KUDB 1LFDA 3IHPC 4FJZA 4I6PA 2MBEA 1V81A 1XT9B 4ICUA 4XZ4A 4DK5A 4W9EA 4HDOA 3ZRFA 4PYZA 4MJSA 2KVRA 1RAXA 2N1VA 3QC8B 1NBFC 1WGHA 4W9DA 2V1YA 3UGBB 4KDIC 1X1MA 2LGXA 4WJOA 4IM3A 2IO3B 3ML8A 3LDZE 4LJPB 2DAFA 3A4RA 1WFYA 2IZVB 1WXVA 2WWZA 3PSEB 2L7RA 2GBKA 3B08A 3JYUA 1R4MI 2LI5A 3ZLZA 3N32A 4BFRA 4MELA 1VCBA 3HHMA 2CR5A 3VQIA 3SD5A 3SHQA 3NZUA 1G6JA 2M17A 3MHSD 2DYOA 2DHZA 4WJQA 2LGDA 1GUAB 2C7HA 4WQOB 2MWSB 1IPGA 4ICVA 2LUEA 4TUUA 3W1SA 4I6LB 2XK5B 3NY5A 2D3GA 4IWOA 3S2AA 4MEMA 3PTFC 5EDSA 2O6VD 2KDBA 2NPTA 3A9JA 1P3QU 2MP2A 2ZVOA 2M4NA 3CF6E 2AWTA 3A9KB 2ZEQA 3SDLC 5DPWA 1OQYA 2WX1A 2ZNVC 4KIKB 2K6DB 2EKEC 1H8CA 1RLFA 1WXAA 3B0AA 2JXXA 2JY6A 2GBJA 4AUQC 2MQJA 2BYVE 3EECA 3UF8A 3WANA 1E8WA 2LWPA 1V2YA 3KVFB 3PLVA 4M8NA 5JH5C 2N9XA 3H6NA 3HM6X 2MX2A 4GU2A 2L00B 4JLCA 1ISNA 3QARA 2KJRA 3DVNU 2ZPNA 3IVFA 3DBHI 4GN1A 5L83A 5J2RA 4CYEA 2G45B 4GDLA 4GMVA 1WX8A 4MSMB 3L0WB 3TL5A 3L16A 2C5LC 4HCPB 4FHJA 1WGDA 2KMAA 3APDA 2N7EA 3ZIMA 4EZKA 2L76A 2O6VB 2YVCA 4EEWA 4EKUA 5KHQA 3ZNHB 4CO7A 2N7DA 1OGWA 3NZSA 2FCMA 1V6EA 4HCNB 2MBBB 2IO2B 3Q3JA 5JHAA 3ZTCA 4A3PA 3QCAA 3QIJA 4ASWC 4AJWA 4DHZB 3QX1A 2ASQA 2XK5A 2KXJA 3VTUA 3OLMD 4DDGD 4BKTA 2FIFA 2LZ6A 2Z59B 4JL9A 1P98A 3A9KA 3EFUA 2DX5B 1Z5SB 3P2BA 4KZ0A 3UIPB 3R3MA 1WM2A 3QQ8B 4KIKA 4BKSD 3MTNB 2BYEA 3M63B 4N9F4 1D3ZA 4W9GA 4GSWA 5E6NA 2FIDA 3VFKA 1EO6A 2LGYA 1UBQA 2V3SA 4W9HA 2MCNB 2CKHB 2IYDB 1GJZA 2N9EB 3I3TB 1WR1A 5JZEB 2K6QA 2ZNVB 3UQAA 1J0GA 3JSVB 1YD8U 2MSED 2RGFA 4MM3A 3CMMB 1WXSA 2KMCA 4W9CA 3KH0A 4BOSC 1XD3B 2K25A 4NAWB 2MBHA 3R7RA 4ZRKA 3HIZA 1P9DU 2LASA 2O6VA 2IO1B 4NQLB 1S1QB 4DWFA 1WRDB 1Q1OA 3WAPA 2DYBA 4AWJA 1EF1A 2NR2A 1T0YA 2D2QA 4IWQA 4AJYB 2G4SA 2BPSA 3DBLI 3R7QA 3AI5A 4NJ7A 2MBOA 3OAWA 2LRWA 4RM8A 4HLEA 1QZEA 2K8CA 4JGHB 3QJZA 2M1MA 3WIMA 2ZPYA 2HD5B 2RSUA 3H7PB 4MGYE 3KYCD 1KM7A 2FUHB 4GB9A 2Z0EB 4KSLC 4FULA 2KDIA 1OEYA 2KOXA 4FHKA 4MSQB 3ZW3A 3ZKJC 1TBEA 2ZJDA 2N1WA 3V62A 4E3CA 1SGHA 4G3XB 1XQQA 2M0XA 1V5TA 2D11A 2GMIC 1S3SG 3VUXA 1CMXB 1YX6B 3HM3A 4FN2A 3Q3FA 2K39A 2WDTB 1U4AA 4NNJB 1E7UA 2I1KA 2C9WB 1WY8A 1E8XA 1LQBA 2IY1B 1TGZB 4GOCA 3RZWC 5C1ZA 2PPHA 1WMHB 2KNBA 3ZDMC 4ANWA 1PQSA 1TTNA 4NAWA 3KUCB 2LVQA 2KTRB 1WGGA 1H4RA 4DHJD 4URKA 3APCA 2C60A 1L2NA 2KTFA 2RPQA 1P0RA 2JUOA 2KDFB 1UGMA 3VH3B 2CHZA 4EOYA 2CU1A 2BKRB 2KQSA 4A20A 2L8JA 4W9LA 1WE7A 4G11A 2KWCA 4G50A 4BKSA 1GC6A 2OJRA 2KLGA 2ZCCA 2PE6B 3AULA 4IG7B 3ENEA 2YLMA 5D6JB 3UIOB 1LXDA 4LJOB 4WJPA 4FBJB 1IP9A 2CHXA 4ZDVA 4HVBA 3VAWA 5IAAC 2KWUB 3GZNI 1C1YB 4B6WA 2CHWA 2KDEB 3PRZA 4K81A 2JZ3B 1RRBA 2J0KA 4CHKA 2L0FA 3K9PB 4II2B 2HTHA 5D7GA 1J8CA 3MJWA 3PV1A 3V61A 2KKCA 1WJNA 2FCQA 2LVOA 1F9JA 2NBUA 2OOBB 4GDKB 3D32A 5GMVA 1WF9A 2K8BA 4DHJB 3VTWA 3LJ3A 4IM2A 3PRMB 4XX5A 4ANUA 2L3ZA 2BWES 2KLCA 1Y8RC 2LXCA 1SE9A 3UINB 1WJ6A 2MLBA 4NY0A 1GG3A 3HK0A 3QK0A 4MDKE 5CHFA 3T9LA 3IG3A 3KYDD 3PRPB 1UD7A 4WWNA 3O65B 2ZZPB 5J18A 2XBBC 4F7ZA 3A4SC 3IBEA 4IM0A 1WX9A 3U30A 4WJNA 1HE8A 2KK8A 4W9FA 2DZIA 3WAMA 4MGIE 4WWOA 1R4NI 3PVLA 4EZLA 5BO4B 3EHVA 3DPDA 3M95A 2JZZA 4A3OA 2KX0A 4B9KA 3PGEA 2WX0A 1KOTA 2G4DB 2EMSA 2Z0DB 4RMAA 5E6PA 5FR6A 4NQKE 2DYMA 1YX5B 2D07B 2RR9A 1AARA 5J17A 2J0JA 1MG8A 2LRUA 3TCAA 3RYTA 2FNJB 1Q0WB 1WGYA 2RD0A 4MH0E 2KQ7A 4KV2A 2IO0B 2MA9B 4EFOA 2V4LA 2K1FA 3DVGX 4FA6A 2PJHA 2NBWB 1WZ3A 4PS7A 4W9KA 4GXBA 3ZUNA 3TBLD 1OTRB 1WM3A 3VVWB 3AU5A 1YIWA 3DBRI 3X23A 3VH4B 2UWQA 3VUWA 2LJ5A 2ZCBA 3V6EB 2J7QB 1EF5A 3CSFA 3ZNZB 5DPTA 3UQBA 4TQ0A 2JPHA 2KC2A 4PYUA 3PZDA 2KANA 2KX3A 3OJ4B 4IC7B 4KDLB 3ALBA 3DOWA 1WZ0A 4JIOU 4FLHA 3X0WA 4IWPA 3WA0A 4HDQA 5D94A 3ZNGC 1UELA 2KJHB 3M3JA 5AZGA 3ZNID 3NS8A 2JF5A 1WE6A 4NPNA 2R2QA 5LLIA 2NBVB 3RULA 2JT4B 2MP2B 2DENB 2KJ6A 3EC8A 4HPMB 1JRUA 1YQBA 2ZVNA 3QHTA 4LDTD 1M94A 3L17A 4HXDA 2HJ8A 5JHBA 4IW0A 4K1RB 2IBIB 5DPRA 3U8ZA 1A5RA 2DZJA 1V9JA 2KD0A 3AU4A 3PLUA 2JWZA 1WIAA 3JSVA 3PT2B 4B95A 4K7UA 1UZXB 1I35A 3QA8A 3BY4B 1WXMA 2PE9A 2PEAA 2DAJA 4BBNF 3ML9A 3B1LX 2AL3A 2MW5A 4DXAB 2GOWA 3A1QB 2BKFA 4GDLB 1WJ4A 2N9PC 1C3TA 3RUIB 5DCNA 1E8ZA 1V80A 2LXAA 1P1AA 1IYFA 1V49A 1WX7A 3DVGY 4HPLB 4RM9A 3PPAA 4PS3A 2DZKA 2GBRA 2AL6A 3JW0X 3VTVA 4M0WB 3PREA 2BWFA 3APFA 2BYFA 3A33B 2N4FA 4ZYNA 5AEKB 5IA7A 3RT3B 3M62B 4II3B 4LDTB 3L10B 3QAQA 4FADA 2JRIB 5AZFA 2J0MA 3H7PA 3V60A 2MBQA 4AP4C 5KHOA 2XEWA 3JVZX 3NOBA 3RCZA 3WAOA 2NVUI 5L95C 3CSTA 2IY0B 2O2VB 4HJKA 4OVUA 3SU8X 1E90A 3VXWA 3IFWB 4FJVB 2D10A 4ANVA 2A4ZA 2DZMA 5D2MB 4TQ1A 2QHOA 2G3QB 1WJUA 5E6OA 3TIXA 1E5WA 4X57B 4TKNA 1OEYJ 2BGFA 1KJTA 3W1SC 4E71A 4K7WA 1SIFA 1WMHA 4GGQA 3L13A 3OJ3A 3V6CB 3AXCA 1L7YA 2NCNA 4J6IA 1YJ1A 2KTRA 5G2NA 4IUMB 1WH3A 5CHVC 3A1QA 1VD2A 1LM8B 4P7IA 1I42A 2KFKB 2CS4A 3ZDTA 4EZJA 1WGRA 4MGKE 1RFAA 1WI0A 3ZVVA 5TR5A 4K7SA 4DBGA 4EUTA 4F8CB 2FCNA 2L0TA 3ZRCA 4JQWC 3VUYA 4WWPA 3DCGA 2KC1A 4YL8A 4KZCA 5LXIB 3N3KB 2BF8B 2GBMA 1TZ1A 1E8YA 4BVUC 2KN5A 2JRHA 2WYQA 5CX3A 3K9OB 2C7NB 2REXA 4TV3A 4GIVA 2R2OA 4ANXA 2MRPA 1ZW7A 1NDDA 1K8RB 2KFJA 2FAZA 2KZRA 2O2VA 3DDCB 3DQVA 4M8MA 2AYOB 2KWVB 1FXTB 1J19A 4GDKA 2I1JA 2GBNA 4LCDE 4G0NB 3L08A 1V5OA 4MJSB 1EUVB 3PHXB 2L05A 4DHZE 3PHWB 2C7MB 2HE7A 3R66C 3H1UA 3L54A 3PS6A 1ZGUB 2LVPA 4PS8A 3C0RB 4HWIB 3RD2A 3WALA 2AEHA 4XC2A 4F1SA 2B3AA 5AZHA 4E74A 1UBIA 2Y5BB 1E7VA 3NHEB 1KLVA 4W9IA 2K8HA 5HKHA 3BINA 4BKGA 4NJ6A 1BT0A 3GOEA 5CHWA 1ZKHA 3TMPB 1Q5WB 3U7DA 2FCSA 3VDZA 4BBNC 2LD9A 2A5UA 2KFKA 1GNUA 3DBSA 4HK2A 5C23A 1WR6E 5G55A 3KW5B 3H7SA 1WYWB 3TJPA 3T8MA 3H9DA 3N30A 4AOFA 3DVNV 2NS5A 2M8SA 5LXHA 3ECIA
chains in the Genus database with same CATH superfamily
3ZTDA 2L52A 1B9RA 3W1YA 4KSKC 4ZRJA 4KVGB 1WWTA 3Q3NC 5BYRA 2WXFA 5CTRC 4JE3B 2JVCA 4YWGG 3VHTC 1V86A 3RNBC 1LFDA 4FJZA 2VH1A 4I6PA 2MBEA 1V81A 1XT9B 4XZ4A 3KQ4A 4W9DA 5C2TB 2V1YA 2HJ1A 1X1MA 4WJOA 4IM3A 2LGIA 2DAFA 2IZVB 2YEPF 4M00A 2GBKA 2LI5A 2H89B 3N32A 2IGDA 4HEA1 4MELA 3SD5A 3NZUA 1G6JA 2M17A 1B1ZA 3H8HA 1GUAB 2MWSB 1IPGA 1FD6A 1ACCA 2LUEA 4TUUA 4I6LB 5EDSA 2MP2A 2ZVOA 2OEDA 2AWTA 3A9KB 2ZEQA 1Y56A 1L5PA 1YJIA 2EKEC 1WXAA 3IT6B 2GBJA 3EECA 3UF8A 2L1AA 1V2YA 1M4VA 1UGJA 2KJRA 2Q5WD 1R7SA 5L83A 4XDDA 3N1YC 1GPXA 3B2FA 4MH8A 2H88B 4YSYB 2BS2B 3L16A 2C5LC 3AEAB 1WGDA 2KMAA 3ZIMA 2PLPA 4EKUA 5KHQA 4CO7A 4B0EA 2FCMA 2M56B 2QC8A 2IO2B 1HZ6A 2OHFA 3Q69A 4DHZB 3QX1A 2XK5A 3OLMD 4DDGD 2BB6A 4LNNA 2WXHA 1HEZE 3E56A 3UIPB 3R3MA 2MH7A 4BKSD 1D3ZA 4W9GA 5HHDG 2MCNB 4A55A 2V3SA 1GJZA 1ET6A 2N9EB 1WR1A 1PYWD 5AUKA 2ZNVB 5BMGA 1YD8U 3RNFC 3P1MA 3CMMB 1WXSA 4BOSC 2JWUA 1P9DU 4NQLB 4DWFA 2NR2A 4ITKA 3N1ZC 2BB5A 3PZ7A 3R7QA 5BYQA 4HLEA 3QJZA 3WIMA 3KYCD 1KM7A 2FUHB 4KSLC 1STEA 2M19A 4FHKA 4MSQB 3ZW3A 1C4CA 1SGHA 2WU5B 1XQQA 1N61A 2RDHA 4FN2A 1E10A 1E8XA 2VH2A 2IY1B 3DWGC 5C1ZA 5EE3A 2PPHA 2VZKB 3W5UB 4DHJD 1V1PA 1WXQA 2RPQA 1V97A 4TSSA 1E7PB 5AUIA 4EOYA 2BKRB 4KGRA 4A20A 2L8JA 4RF0A 1WE7A 1GC6A 4R3DA 2ZCCA 3AULA 3LYYA 4RFBA 3ENEA 5D6JB 4FBJB 4ZDVA 1BXTA 1HZ5A 2YEPB 3RPFC 1D4BA 2KWUB 1IBXA 3PRZA 2JZ3B 4CHKA 2M0AA 5D7GA 2KKCA 2NBUA 4GDKB 2BBCA 5GMVA 1TKYA 4DHJB 2J53A 2X8XX 4ANUA 3IT4B 2IGHA 1NVID 1K51A 3HK0A 3T9LA 2ZZPB 1QOFA 5J18A 2WP9B 3IBEA 4IM0A 1WX9A 4M01A 1Q10A 3V05A 4W9FA 2BQQA 1FRDA 2IPKD 3PVLA 1VJKA 3EHVA 1VZ8A 1FXIA 3AEBB 1FCLA 3FKYA 2KWDA 3PGEA 1KOTA 2WDQB 1ENFA 4NQKE 2RR9A 2LRUA 2KAJA 3Q8AA 5I4DA 2RD0A 4L2YA 4KV2A 2QILA 4FA6A 2CJOA 3ZUNA 3Q14C 1VZ6A 2W55A 3GZNB 2NTSA 3EGRA 1YIWA 4RH6A 3VUWA 2ZCBA 3UI3A 2J7QB 2WXKA 4TQ0A 3WCQA 3TEZA 4PYUA 2LJIA 3PZDA 4C56C 2KANA 2WXIA 2JSVX 1L6UA 1FM0D 2AQ1B 3WA0A 2PVOD 4HDQA 1UELA 3M3JA 3MC8A 3NS8A 2JF5A 4YTNB 2R2QA 5LLIA 2JT4B 3EC8A 4HPMB 1YQBA 4LDTD 1M94A 3L17A 3DHHC 4P6VF 3ZQ4A 5DPRA 2BS4B 1V9JA 2KD0A 4K7UA 5BYSA 1I35A 4LNFA 1WGKA 4ZRQA 2N9PC 3N20C 1E9MA 2WXNA 1ZUD2 1WX7A 4LNKA 2DZKA 3DWMA 3APFA 3RT3B 3M62B 4LDTB 1RM6C 1K52A 1L6VA 5AZFA 3DBRB 4AP4C 3WAOA 3NOBA 2D3AA 3CSTA 2O2VB 3Q2AC 4HJKA 3EA6A 4US9A 3IFWB 4ANVA 4C00A 5D2MB 2DBYA 4TQ1A 1WJUA 5H92C 4HKZE 1OEYJ 5IKCM 2CU3A 1C78A 4GGQA 3V6CB 2NCNA 3AE4B 3RNGC 2KFKB 2CS4A 3ZDTA 1WGRA 4MGKE 1KLUD 4A8XC 4F8CB 2FCNA 3ZRCA 4P16A 4WWPA 2KC1A 5LXIB 1SE4A 4YT0B 1L0VB 2WYQA 5CX3A 3K9OB 4TV3A 2R2OA 1KTKA 1ZW7A 5G5HA 1NDDA 2KFJA 4RGNA 2FAZA 4UDUC 1J19A 4GDKA 2SAKA 2GBNA 4LCDE 2HE7A 2MHJA 2QSDA 4A6QA 4O1NA 2B3AA 1DGJA 5EE9A 2K8HA 5IN7A 4ACFA 2IJ0A 1Q5WB 1L0XB 2SEBD 3NZ3A 3U7DA 2LD9A 4JX1C 5C23A 1PUTA 3DBSA 1YN3A 1WR6E 5G55A 4B0MA 3H9DA 3N30A 4AOFA 1D5XC 4OZCA 1DYQA 1TS3A 1ZXIA 2UYZB 4FJYA 4OVVA 1UH6A 2EMTA 5LNK1 1Z2MA 4WURA 3RZFA 1KF6B 4I6NB 4WAAA 1NI2A 4MGZE 3RFZB 4ZYSA 1GC7A 3ZXVA 1L0YB 1FNUA 2MJ3A 4DK5A 4W9EA 4HDOA 3ZRFA 4PYZA 2N1VA 4AQ7A 3OWEB 2IO3B 1I4PA 3GS2A 1WFYA 3P42A 3PSEB 2L7RA 3I63C 3B08A 5D3DA 4RGMA 3W9CB 2ACZB 4BFRA 1ESFA 3HHMA 2CR5A 2V4IB 1T0QC 4BZAA 3MHSD 2DYOA 3AE3B 4WJQA 1SSNA 2C7HA 4WQOB 2V0GA 4YTPB 2WHIA 3W1SA 1KLGD 2XK5B 4IWOA 3S2AA 1C79A 3PTFC 2KACA 2NPTA 1FMAD 4RNAA 2BTEA 5DPWA 2ZNVC 4M02A 2K6DB 1XXGA 3ZXRA 3B0AA 3AEFB 2RMMA 2LWPA 3Q8FA 3B9JA 2N9XA 4M8NA 3SFEB 2MX2A 5JH5C 4GU2A 2L00B 3QARA 1J7BA 3IXSA 4GN1A 1C9FA 5J2RA 1P7EA 1EWCA 3NVWA 2EELA 1AW7A 3L0WB 3TL5A 1DOXA 2HDEA 2N7EA 4EZKA 2YVCA 2MJDA 2I38A 3ZNHB 2N7DA 1OGWA 3NZSA 1QOGA 2PTLA 1IGDA 1NEKB 3Q3JA 5JHAA 2JXTA 1JROA 3ZTCA 1HTOA 2LGSA 4HJGE 3QIJA 4AJWA 1MFWA 2V9HA 2KXJA 2DLBA 2Z59B 3EFUA 1CZPA 2DX5B 2KYWA 1WM2A 4KIKA 2NTTA 3MTNB 2BYEA 1SBBB 3TUOA 1JWBD 3ZYYX 1CJEA 2LGYA 1C76A 2G9HD 4W9HA 2N9LA 3I3TB 3KLSX 5JZEB 1JRPA 1J7AA 5H8YE 2BT6A 3JSVB 2MSED 2RGFA 4HPPA 4N6EB 4HKQA 3C19A 3HUIA 1FEHA 2K25A 2X38A 2O6VA 5IP4D 2IO1B 1V1PB 2ZW0A 2WLBA 4K3CA 2DWQA 1C4AA 2G4SA 2BPSA 3Q3MC 3DBLI 2AX5A 1ZPSA 3OAWA 1IBXB 2RSUA 1PGXA 1MHHE 2QEJC 4N58A 1UUPA 1FRRA 1TS2A 3E9SA 3VUXA 1T5XD 4PT5A 5BMHA 2I1KA 1I4XA 1LQBA 3OG5A 2KNBA 3DHIC 3ZDMC 2GB1A 1PQSA 1FXAA 3KUCB 1ROEA 1VLBA 2KTRB 3P63A 3HVDA 2C60A 2ONQA 4USAA 4XDCA 1P0RA 2JUOA 3NG0A 2N7JA 1PFDA 2CHZA 2KQSA 3AE5B 5FKAC 3MC0B 2KLGA 4IG7B 2YLMA 1GAQB 3UIOB 1LXDA 4LJOB 4WJPA 1YJJA 4PK1A 1BMLC 5IAAC 4K3BA 2FUG1 3GZNI 1C1YB 1ZE3D 2UU7A 4K81A 2J0KA 1ZP0B 3K9PB 1HTQA 1J8CA 2WXLA 3V61A 3J9CA 2WQYB 1JALA 1A70A 1T0RC 1UNSA 3LJ3A 1HQRD 3MFGA 3PRMB 4IM2A 4XX5A 2BWES 2I2YA 1I7HA 3UINB 2MLBA 5IO9A 2RDGA 4C7YA 3IG3A 3PRPB 4RGTA 3N1XC 3LXFA 4C4VB 3U30A 3FC4A 1HE8A 2KK8A 3NVVA 4WWMA 3WAMA 4MGIE 5BO4B 3DPDA 3ZJVA 2JZZA 4RF1A 4DQOC 1L4DB 2G4DB 5E6PA 1C4PA 1AARA 4KGSA 1Q0WB 4MH0E 2BYTA 2KQ7A 2MA9B 1XO3A 2NBWB 1WZ3A 2KDMA 1FIQA 4YTMB 1WM3A 3VVWB 3DBRI 1RYJA 4RGOS 4XWTA 2VZKD 3V6EB 2WXRA 3ZNZB 3UQBA 2KC2A 1FCCC 2KX3A 3OJ4B 3ZJUA 1WZ0A 4FLHA 4IWPA 2QJLA 3HVZA 4US8A 3BK1A 4XE0A 2KJHB 3ZNID 5BMIA 1XLPA 2KJ6A 3ETRA 3W5VB 4HXDA 5JHBA 1JWSD 4REZA 1F52A 3PLUA 1TYGB 3JSVA 2ZW1A 2WXQA 3QA8A 3BY4B 1TT5B 1AWDA 1ZDXA 2PE9A 3BVZA 4XGAB 4BBNF 2MW5A 3T3OA 2R61A 4HRSA 2GOWA 2BKFA 4GDLB 1WJ4A 1IYFA 4H2AA 3VTVA 2L83A 1QF6A 1VDVA 4ZYNA 5AEKB 5IA7A 4HROA 3L10B 2JRIB 2INCC 1JWUD 3V3XA 5KHOA 2XEWA 3GE8C 2IY0B 2FBWB 3AM9A 3SU8X 5C3JB 3DBLB 2N0SB 4FJVB 1K53A 2QHOA 5E6OA 1JQ4A 5JXVA 4K7WA 1SIFA 4OVZA 1DOYA 3P4QB 3OJ3A 3AXCA 4J6IA 2KTRA 5G2NA 3NRZA 2QCZA 1YMHE 3A1QA 1CQVA 2LMCA 1I42A 1RFAA 5TR5A 4M0WA 2HTME 4EUTA 2L0TA 3N9YC 3CWIA 3VRAB 1TY2A 1E8YA 2C7NB 1MPEA 1E6EB 5GXGB 2KZRA 3DQVA 2AYOB 1FXTB 2I1JA 3BYTB 4G0NB 3L08A 1EUVB 3PHXB 2BVCA 3BK2A 2C7MB 3R66C 4DXGA 2Y5CA 3L54A 3PS6A 1IP9A 3RD2A 3WALA 1MI0A 1UBIA 3NHEB 5EE0A 5HKHA 2K5PA 5G5GA 4C4VA 3HRDD 3Q8EA 5TSSA 3BWUD 2NPTB 2VRRB 1JWAD 5DPSA 1JWMD 2L32A 4JWSC 3B2GA 3PO0A 2W9NA 3ZO5B 3KUZA 4DDID 4BOZB 3ONSA 1OFFA 3KUDB 1XLQA 4ICUA 2Y3AA 3MP9A 2LUMA 2KVRA 1RAXA 4MJSA 1WGHA 3UGBB 2LGXA 1K50A 4LJPB 3A4RA 1WXVA 3AEDB 3SHQA 2ON8A 2W82A 2DHZA 1L4ZB 2LGDA 3I5JC 4S0RA 4ICVA 4MEMA 2O6VD 3A9JA 1P3QU 2M4NA 1NI3A 1QKZA 2W3RA 2WX1A 4KIKB 1QOBA 1H8CA 1RLFA 2JY6A 3AEGB 2MQJA 2BYVE 3WANA 4OW0A 3KVFB 3PLVA 2WDVB 3H6NA 4JLCA 5IOIA 1ISNA 1JMLA 1HXYD 3Q3OC 3DVNU 2ZPNA 3URYA 3DBHI 3O13A 2G45B 4GDLA 4LTUA 4FHJA 3APDA 2O6VB 1C77A 3BZDB 2N9KA 1V6EA 4HCNB 4ASWC 2LHDA 3AE7B 3VTUA 1EM7A 2Z8LA 1DOIA 1R4MB 4JL9A 1P98A 1Z5SB 3P2BA 4RCOA 3QQ8B 1LGRA 1V1OA 3M63B 4N9F4 2PMVA 4GSWA 3AE9B 5E6NA 2FIDA 1UBQA 2IYDB 1YN5A 4ARIA 2K6QA 3Q8BA 1J0GA 4MM3A 4NJCA 2JU6X 2KMCA 4W9CA 3KH0A 1XD3B 3R7RA 4KKIA 1SJHD 1BUIC 1S1QB 1WRDB 1RFKA 3WAPA 4AWJA 1EF1A 2INDC 1XF5L 2MEKA 1OQQA 4L23A 3ZGZA 1T0YA 3ZJTA 3AE2B 3AI5A 4N59A 2LRWA 4RM8A 2K8CA 4JGHB 2M1MA 2ZPYA 1TZOA 2HD5B 1UF0A 3H7PB 4MGYE 1GB4A 4GB9A 2Z0EB 4FULA 1OEYA 2KOXA 2ZJDA 2N1WA 3V62A 1N6ZA 4G3XB 1V5TA 2GMIC 3RMKC 2WXMA 2WDRB 2K39A 1U4AA 1E7UA 1WY8A 1SB3C 2XNAC 4GOCA 1QOAA 3RZWC 1WMHB 4OZBA 4NAWA 1FFVA 2K0PA 1WGGA 1YN4A 1YQ4B 1TY0A 1L2NA 2KTFA 3AB5A 2KDFB 1UGMA 3VH3B 4W9LA 4G11A 4G50A 3AV8A 4HVBA 2KVZA 4B6WA 2CHWA 2KDEB 1RRBA 1F2RI 4CQNA 1F2RC 4II2B 3BIID 3MJWA 1MHXA 3PV1A 1WJNA 2FCQA 2LVOA 3D32A 3VR8B 3RN9C 1Y8RC 1MG4A 3U7ZA 1WJ6A 4NY0A 1XCQL 4XWWA 5CHFA 3MHZA 4ZOHC 1UD7A 4WWNA 2WS3B 4F7ZA 4AS1A 4WJNA 4WWOA 1R4NI 4EZLA 2V3PA 4OZAA 2KX0A 4B9KA 4YXDB 2WX0A 4RMAA 1YX5B 2D07B 3BVGA 1MG8A 3TSSA 4LLGM 1WGYA 2IO0B 3DVGX 3L4PA 2PKOA 3TBLD 3AU5A 3X23A 4LK0M 3VH4B 3RI7C 2UWQA 1I4GA 2LJ5A 3DBHB 3AN1A 4BAXA 2JPHA 2JZPA 4IC7B 3DOWA 1NENB 5D94A 3ZNGC 2WGSA 4NPNA 2WXOA 2GI9A 2NBVB 4LNOA 3RULA 2DENB 1JRUA 3QHTA 1SE2A 2HJ8A 4IW0A 3U8ZA 2DZJA 3AU4A 3PT2B 4IDIA 4B95A 1E0ZA 1ZDVA 2Y5PA 5MPOA 1N5XA 1WXMA 3EUB2 3U52E 2PEAA 2DAJA 1D5MC 3ML9A 2AL3A 2D3BA 3A1QB 2E6XA 4Q2JA 5DCNA 2LXAA 1V49A 1TS5A 3DVGY 4RM9A 1ZXHA 3JW0X 4PS3A 2AL6A 4ZHOA 1UWMA 4M0WB 3PREA 2BWFA 2BYFA 3A33B 2N4FA 5EE1A 3C8YA 3QAQA 4FADA 1HA5A 1D5ZC 3NVYA 2J0MA 4S17A 3H7PA 2K3UA 3V60A 4A9AA 3JVZX 2NVUI 1E90A 3I9V1 2D10A 3NVZA 2G3QB 3TIXA 2V3NA 4GLSC 2BGFA 1KJTA 3W1SC 1WMHA 4C7ZA 3L13A 3CIRB 1RWSA 1L7YA 4P1CC 3RNCC 1YJ1A 4IUMB 2D3CA 2INNE 1LM8B 4P7IA 4WH4A 1EWYC 1AN8A 3IAM1 4EZJA 3ZVVA 1XEEA 3VUYA 4YL8A 1PGBA 4KZCA 2BF8B 2OJWA 4BVUC 2JRHA 3BYYB 5HG2A 3PZ8A 4ZRPA 1K8RB 3DDCB 4M8MA 2KQ4X 3MC9A 1VRAB 4MJSB 2L05A 1UWXA 3AMZA 1N63A 2WXPA 3BVMA 2QIEB 1T6BX 1ZGUB 4PS8A 2IGGA 4F1SA 2AEHA 2QMTA 1SIJA 4XC2A 5AZHA 4E74A 2PW9A 4C80A 2Y5BB 1E7VA 4W9IA 3BINA 4NJ6A 1BT0A 1F0ZA 5CHWA 1ZKHA 4BBNC 3VDZA 1GNUA 2XN9C 3KW5B 3TJPA 1WYWB 4D2KA 3DVNV 5LXHA 2KO3A 2KHWB 3A9JB 1IUEA 3P4SB 3DHGC 3R2TA 4W9JA 3QWZB 4ZRIA 1GB1A 1GOZA 1R4NB 2BW2A 3IHPC 3T3NA 1N5WA 3QC8B 1NBFC 4KDIC 3ML8A 3LDZE 3FILA 1EU4A 2WWZA 3JYUA 3ZLZA 1R4MI 1SE3A 3AE6B 1VCBA 3VQIA 2K9XA 3AH7A 1VR9A 1FNVA 4L1BA 3MJ5A 3AE1B 1EU3A 1SJED 3NUHB 3NY5A 2D3GA 2KDBA 1SEBD 3CF6E 2NMQA 3SDLC 1OQYA 1T0SC 2FE8A 2JXXA 1FFUA 2AQ3B 4AUQC 1E8WA 3HM6X 4P1BC 3IVFA 3GP7A 4CYEA 4MM3B 4GMVA 1WX8A 1XCTL 4MSMB 3P4PB 3AEEB 4MT5A 4HCPB 2L76A 4TMAB 4EEWA 2W54A 4NZLB 2MBBB 1OQRA 3SR6A 4A3PA 5HFYA 1I4QA 3QCAA 2ASQA 2WNMA 4BKTA 2JYEA 2FIFA 2LZ6A 3A9KA 1CK1A 4KZ0A 3TEXA 5T8IA 2JX5A 2LFIA 3Q6BA 3KWLA 2IDYA 3VFKA 1EO6A 2CKHB 5FK9C 3UQAA 3TEYA 1VZ7A 5HI1A 2B76B 1FO4A 1ZOYB 4NAWB 2MBHA 4ZRKA 3HIZA 4ZHPA 4LNIA 2LASA 3SFDB 3EFCA 1Q1OA 2DYBA 2INPE 3TEWA 2D2QA 4IWQA 4AJYB 4NJ7A 2MBOA 1SF0A 1QZEA 1WSPA 4YSZB 3ABVB 3R8BA 3SEBA 2WU2B 2KDIA 2JYTA 3ZKJC 1TBEA 3VRBB 4OHJA 4E3CA 1AYFA 2M0XA 2D11A 2KT7A 1S3SG 1MJDA 1CMXB 1YX6B 3HM3A 3Q3FA 1WRIA 2WDTB 4NNJB 2C9WB 1TGZB 4ANWA 4A90A 2RDBC 1TTNA 5FR3A 2LVQA 1H4RA 4URKA 3APCA 2W3SA 1F1HA 2CU1A 4JPSA 1TKGA 2KWCA 4BKSA 2OJRA 1IGCA 2PE6B 2CHXA 3VAWA 2BS3B 3RNEC 3FAHA 2LEKA 1YNTE 2JQRB 2L0FA 1FPYA 2HTHA 4FXCA 1TS4A 4WQMA 1I4RA 1P7FA 1F9JA 2OOBB 1XLOA 3IAS1 1WF9A 2K8BA 5D3IB 3VTWA 4KX6B 2L3ZA 2KLCA 4DXFA 2LXCA 1SE9A 1JW9D 1GG3A 2WXJA 3QK0A 4MDKE 3KYDD 3O65B 2XBBC 3A4SC 2DZIA 4NAMA 3M95A 4A3OA 4MACA 2G1EA 2MJEA 2QDFA 2PVGC 2LHEA 2EMSA 2Z0DB 5FR6A 2DYMA 4EE2A 4YSXB 5J17A 2J0JA 3I57A 3TCAA 4WAFA 3RYTA 3W2DA 1QLBB 2FNJB 1WYGA 1TKEA 4EFOA 2V4LA 2K1FA 2GLSA 2D5GA 2KMMA 2PJHA 1QQRA 2J52A 4PS7A 4W9KA 4GXBA 2E3TA 1MVKA 1OTRB 4KKJA 1PGAA 4ARCA 1N60A 1EF5A 3AECB 3CSFA 5DPTA 1TJEA 4KDLB 3NJTA 3ALBA 2J4XA 4JIOU 3X0WA 1SXTA 2ICIA 5AZGA 1WE6A 2MP2B 3U2SC 2ZVNA 2WXGA 1FNWA 4K1RB 2IBIB 1A5RA 1KFYB 2JWZA 1WIAA 1UZXB 1NYQA 2J42A 1QT9A 3U4EG 3B1LX 4DXAB 1YOVB 1KRHA 1C3TA 3RUIB 1TIFA 1E8ZA 1V80A 3RNAC 4JWUC 1P1AA 3GE3C 4HPLB 3PPAA 2GBRA 3NS1A 4II3B 4XYCA 3P4RB 2MBQA 2K22A 3RCZA 5L95C 1N62A 4OVUA 3VXWA 3GB1A 3R2IA 2AQ2B 1YQ3B 3KWVA 1QILA 2A4ZA 2KN4A 2DZMA 1KH0A 1E5WA 4X57B 4TKNA 4E71A 2DNFA 4WIPA 4QAYA 2TSSA 1PDXA 2RPVA 4IKGA 1WH3A 5CHVC 1F77A 1VD2A 2CJNA 1LO5D 4J3OD 1ET9A 1WI0A 1J7CA 4K7SA 4DBGA 4JQWC 4KGTA 3DCGA 3VR9B 1D6EC 3N3KB 2GBMA 1TZ1A 5E6JA 2KN5A 2REXA 4GIVA 2EKIA 4ANXA 2MRPA 2O2VA 2KWVB 2GRIA 1XLNA 3AE8B 3LB8C 1V5OA 4DHZE 3PHWB 3H1UA 2LVPA 3C0RB 1V8CA 4HWIB 3FILB 3Q8CA 1KLVA 4IOIE 2PIAA 4BKGA 1NYRA 3GOEA 3TMPB 2FCSA 1I4HA 2A5UA 2KFKA 4HK2A 1JCKB 3H7SA 3T8MA 2NS5A 2M8SA 1T3QA 3ECIA
chains in the Genus database with same CATH topology
3ZTDA 3W1YA 2KO3A 2KHWB 2NPTB 2UYZB 2VRRB 3A9JB 4FJYA 4KSKC 5DPSA 4OVVA 4ZRJA 1UH6A 2EMTA 4KVGB 1Z2MA 3RZFA 4I6NB 4WAAA 4W9JA 3QWZB 2W9NA 1NI2A 4ZRIA 3ZO5B 4MGZE 3KUZA 4DDID 5CTRC 2JVCA 1GC7A 4BOZB 3ONSA 3VHTC 1V86A 3KUDB 1LFDA 3IHPC 4FJZA 4I6PA 2MBEA 1V81A 1XT9B 4ICUA 4XZ4A 4DK5A 4W9EA 4HDOA 3ZRFA 4PYZA 4MJSA 2KVRA 1RAXA 2N1VA 3QC8B 1NBFC 1WGHA 4W9DA 2V1YA 3UGBB 4KDIC 1X1MA 2LGXA 4WJOA 4IM3A 2IO3B 3ML8A 3LDZE 4LJPB 2DAFA 3A4RA 1WFYA 2IZVB 1WXVA 2WWZA 3PSEB 2L7RA 2GBKA 3B08A 3JYUA 1R4MI 2LI5A 3ZLZA 3N32A 4BFRA 4MELA 1VCBA 3HHMA 2CR5A 3VQIA 3SD5A 3SHQA 3NZUA 1G6JA 2M17A 3MHSD 2DYOA 2DHZA 4WJQA 2LGDA 1GUAB 2C7HA 4WQOB 2MWSB 1IPGA 4ICVA 2LUEA 4TUUA 3W1SA 4I6LB 2XK5B 3NY5A 2D3GA 4IWOA 3S2AA 4MEMA 3PTFC 5EDSA 2O6VD 2KDBA 2NPTA 3A9JA 1P3QU 2MP2A 2ZVOA 2M4NA 3CF6E 2AWTA 3A9KB 2ZEQA 3SDLC 5DPWA 1OQYA 2WX1A 2ZNVC 4KIKB 2K6DB 2EKEC 1H8CA 1RLFA 1WXAA 3B0AA 2JXXA 2JY6A 2GBJA 4AUQC 2MQJA 2BYVE 3EECA 3UF8A 3WANA 1E8WA 2LWPA 1V2YA 3KVFB 3PLVA 4M8NA 5JH5C 2N9XA 3H6NA 3HM6X 2MX2A 4GU2A 2L00B 4JLCA 1ISNA 3QARA 2KJRA 3DVNU 2ZPNA 3IVFA 3DBHI 4GN1A 5L83A 5J2RA 4CYEA 2G45B 4GDLA 4GMVA 1WX8A 4MSMB 3L0WB 3TL5A 3L16A 2C5LC 4HCPB 4FHJA 1WGDA 2KMAA 3APDA 2N7EA 3ZIMA 4EZKA 2L76A 2O6VB 2YVCA 4EEWA 4EKUA 5KHQA 3ZNHB 4CO7A 2N7DA 1OGWA 3NZSA 2FCMA 1V6EA 4HCNB 2MBBB 2IO2B 3Q3JA 5JHAA 3ZTCA 4A3PA 3QCAA 3QIJA 4ASWC 4AJWA 4DHZB 3QX1A 2ASQA 2XK5A 2KXJA 3VTUA 3OLMD 4DDGD 4BKTA 2FIFA 2LZ6A 2Z59B 4JL9A 1P98A 3A9KA 3EFUA 2DX5B 1Z5SB 3P2BA 4KZ0A 3UIPB 3R3MA 1WM2A 3QQ8B 4KIKA 4BKSD 3MTNB 2BYEA 3M63B 4N9F4 1D3ZA 4W9GA 4GSWA 5E6NA 2FIDA 3VFKA 1EO6A 2LGYA 1UBQA 2V3SA 4W9HA 2MCNB 2CKHB 2IYDB 1GJZA 2N9EB 3I3TB 1WR1A 5JZEB 2K6QA 2ZNVB 3UQAA 1J0GA 3JSVB 1YD8U 2MSED 2RGFA 4MM3A 3CMMB 1WXSA 2KMCA 4W9CA 3KH0A 4BOSC 1XD3B 2K25A 4NAWB 2MBHA 3R7RA 4ZRKA 3HIZA 1P9DU 2LASA 2O6VA 2IO1B 4NQLB 1S1QB 4DWFA 1WRDB 1Q1OA 3WAPA 2DYBA 4AWJA 1EF1A 2NR2A 1T0YA 2D2QA 4IWQA 4AJYB 2G4SA 2BPSA 3DBLI 3R7QA 3AI5A 4NJ7A 2MBOA 3OAWA 2LRWA 4RM8A 4HLEA 1QZEA 2K8CA 4JGHB 3QJZA 2M1MA 3WIMA 2ZPYA 2HD5B 2RSUA 3H7PB 4MGYE 3KYCD 1KM7A 2FUHB 4GB9A 2Z0EB 4KSLC 4FULA 2KDIA 1OEYA 2KOXA 4FHKA 4MSQB 3ZW3A 3ZKJC 1TBEA 2ZJDA 2N1WA 3V62A 4E3CA 1SGHA 4G3XB 1XQQA 2M0XA 1V5TA 2D11A 2GMIC 1S3SG 3VUXA 1CMXB 1YX6B 3HM3A 4FN2A 3Q3FA 2K39A 2WDTB 1U4AA 4NNJB 1E7UA 2I1KA 2C9WB 1WY8A 1E8XA 1LQBA 2IY1B 1TGZB 4GOCA 3RZWC 5C1ZA 2PPHA 1WMHB 2KNBA 3ZDMC 4ANWA 1PQSA 1TTNA 4NAWA 3KUCB 2LVQA 2KTRB 1WGGA 1H4RA 4DHJD 4URKA 3APCA 2C60A 1L2NA 2KTFA 2RPQA 1P0RA 2JUOA 2KDFB 1UGMA 3VH3B 2CHZA 4EOYA 2CU1A 2BKRB 2KQSA 4A20A 2L8JA 4W9LA 1WE7A 4G11A 2KWCA 4G50A 4BKSA 1GC6A 2OJRA 2KLGA 2ZCCA 2PE6B 3AULA 4IG7B 3ENEA 2YLMA 5D6JB 3UIOB 1LXDA 4LJOB 4WJPA 4FBJB 1IP9A 2CHXA 4ZDVA 4HVBA 3VAWA 5IAAC 2KWUB 3GZNI 1C1YB 4B6WA 2CHWA 2KDEB 3PRZA 4K81A 2JZ3B 1RRBA 2J0KA 4CHKA 2L0FA 3K9PB 4II2B 2HTHA 5D7GA 1J8CA 3MJWA 3PV1A 3V61A 2KKCA 1WJNA 2FCQA 2LVOA 1F9JA 2NBUA 2OOBB 4GDKB 3D32A 5GMVA 1WF9A 2K8BA 4DHJB 3VTWA 3LJ3A 4IM2A 3PRMB 4XX5A 4ANUA 2L3ZA 2BWES 2KLCA 1Y8RC 2LXCA 1SE9A 3UINB 1WJ6A 2MLBA 4NY0A 1GG3A 3HK0A 3QK0A 4MDKE 5CHFA 3T9LA 3IG3A 3KYDD 3PRPB 1UD7A 4WWNA 3O65B 2ZZPB 5J18A 2XBBC 4F7ZA 3A4SC 3IBEA 4IM0A 1WX9A 3U30A 4WJNA 1HE8A 2KK8A 4W9FA 2DZIA 3WAMA 4MGIE 4WWOA 1R4NI 3PVLA 4EZLA 5BO4B 3EHVA 3DPDA 3M95A 2JZZA 4A3OA 2KX0A 4B9KA 3PGEA 2WX0A 1KOTA 2G4DB 2EMSA 2Z0DB 4RMAA 5E6PA 5FR6A 4NQKE 2DYMA 1YX5B 2D07B 2RR9A 1AARA 5J17A 2J0JA 1MG8A 2LRUA 3TCAA 3RYTA 2FNJB 1Q0WB 1WGYA 2RD0A 4MH0E 2KQ7A 4KV2A 2IO0B 2MA9B 4EFOA 2V4LA 2K1FA 3DVGX 4FA6A 2PJHA 2NBWB 1WZ3A 4PS7A 4W9KA 4GXBA 3ZUNA 3TBLD 1OTRB 1WM3A 3VVWB 3AU5A 1YIWA 3DBRI 3X23A 3VH4B 2UWQA 3VUWA 2LJ5A 2ZCBA 3V6EB 2J7QB 1EF5A 3CSFA 3ZNZB 5DPTA 3UQBA 4TQ0A 2JPHA 2KC2A 4PYUA 3PZDA 2KANA 2KX3A 3OJ4B 4IC7B 4KDLB 3ALBA 3DOWA 1WZ0A 4JIOU 4FLHA 3X0WA 4IWPA 3WA0A 4HDQA 5D94A 3ZNGC 1UELA 2KJHB 3M3JA 5AZGA 3ZNID 3NS8A 2JF5A 1WE6A 4NPNA 2R2QA 5LLIA 2NBVB 3RULA 2JT4B 2MP2B 2DENB 2KJ6A 3EC8A 4HPMB 1JRUA 1YQBA 2ZVNA 3QHTA 4LDTD 1M94A 3L17A 4HXDA 2HJ8A 5JHBA 4IW0A 4K1RB 2IBIB 5DPRA 3U8ZA 1A5RA 2DZJA 1V9JA 2KD0A 3AU4A 3PLUA 2JWZA 1WIAA 3JSVA 3PT2B 4B95A 4K7UA 1UZXB 1I35A 3QA8A 3BY4B 1WXMA 2PE9A 2PEAA 2DAJA 4BBNF 3ML9A 3B1LX 2AL3A 2MW5A 4DXAB 2GOWA 3A1QB 2BKFA 4GDLB 1WJ4A 2N9PC 1C3TA 3RUIB 5DCNA 1E8ZA 1V80A 2LXAA 1P1AA 1IYFA 1V49A 1WX7A 3DVGY 4HPLB 4RM9A 3PPAA 4PS3A 2DZKA 2GBRA 2AL6A 3JW0X 3VTVA 4M0WB 3PREA 2BWFA 3APFA 2BYFA 3A33B 2N4FA 4ZYNA 5AEKB 5IA7A 3RT3B 3M62B 4II3B 4LDTB 3L10B 3QAQA 4FADA 2JRIB 5AZFA 2J0MA 3H7PA 3V60A 2MBQA 4AP4C 5KHOA 2XEWA 3JVZX 3NOBA 3RCZA 3WAOA 2NVUI 5L95C 3CSTA 2IY0B 2O2VB 4HJKA 4OVUA 3SU8X 1E90A 3VXWA 3IFWB 4FJVB 2D10A 4ANVA 2A4ZA 2DZMA 5D2MB 4TQ1A 2QHOA 2G3QB 1WJUA 5E6OA 3TIXA 1E5WA 4X57B 4TKNA 1OEYJ 2BGFA 1KJTA 3W1SC 4E71A 4K7WA 1SIFA 1WMHA 4GGQA 3L13A 3OJ3A 3V6CB 3AXCA 1L7YA 2NCNA 4J6IA 1YJ1A 2KTRA 5G2NA 4IUMB 1WH3A 5CHVC 3A1QA 1VD2A 1LM8B 4P7IA 1I42A 2KFKB 2CS4A 3ZDTA 4EZJA 1WGRA 4MGKE 1RFAA 1WI0A 3ZVVA 5TR5A 4K7SA 4DBGA 4EUTA 4F8CB 2FCNA 2L0TA 3ZRCA 4JQWC 3VUYA 4WWPA 3DCGA 2KC1A 4YL8A 4KZCA 5LXIB 3N3KB 2BF8B 2GBMA 1TZ1A 1E8YA 4BVUC 2KN5A 2JRHA 2WYQA 5CX3A 3K9OB 2C7NB 2REXA 4TV3A 4GIVA 2R2OA 4ANXA 2MRPA 1ZW7A 1NDDA 1K8RB 2KFJA 2FAZA 2KZRA 2O2VA 3DDCB 3DQVA 4M8MA 2AYOB 2KWVB 1FXTB 1J19A 4GDKA 2I1JA 2GBNA 4LCDE 4G0NB 3L08A 1V5OA 4MJSB 1EUVB 3PHXB 2L05A 4DHZE 3PHWB 2C7MB 2HE7A 3R66C 3H1UA 3L54A 3PS6A 1ZGUB 2LVPA 4PS8A 3C0RB 4HWIB 3RD2A 3WALA 2AEHA 4XC2A 4F1SA 2B3AA 5AZHA 4E74A 1UBIA 2Y5BB 1E7VA 3NHEB 1KLVA 4W9IA 2K8HA 5HKHA 3BINA 4BKGA 4NJ6A 1BT0A 3GOEA 5CHWA 1ZKHA 3TMPB 1Q5WB 3U7DA 2FCSA 3VDZA 4BBNC 2LD9A 2A5UA 2KFKA 1GNUA 3DBSA 4HK2A 5C23A 1WR6E 5G55A 3KW5B 3H7SA 1WYWB 3TJPA 3T8MA 3H9DA 3N30A 4AOFA 3DVNV 2NS5A 2M8SA 5LXHA 3ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTD A;  3W1Y A;  2KO3 A;  2KHW B;  2NPT B;  2UYZ B;  2VRR B;  3A9J B;  4FJY A;  4KSK C;  5DPS A;  4OVV A;  4ZRJ A;  1UH6 A;  2EMT A;  4KVG B;  1Z2M A;  3RZF A;  4I6N B;  4WAA A;  4W9J A;  3QWZ B;  2W9N A;  1NI2 A;  4ZRI A;  3ZO5 B;  4MGZ E;  3KUZ A;  4DDI D;  5CTR C;  2JVC A;  1GC7 A;  4BOZ B;  3ONS A;  3VHT C;  1V86 A;  3KUD B;  1LFD A;  3IHP C;  4FJZ A;  4I6P A;  2MBE A;  1V81 A;  1XT9 B;  4ICU A;  4XZ4 A;  4DK5 A;  4W9E A;  4HDO A;  3ZRF A;  4PYZ A;  4MJS A;  2KVR A;  1RAX A;  2N1V A;  3QC8 B;  1NBF C;  1WGH A;  4W9D A;  2V1Y A;  3UGB B;  4KDI C;  1X1M A;  2LGX A;  4WJO A;  4IM3 A;  2IO3 B;  3ML8 A;  3LDZ E;  4LJP B;  2DAF A;  3A4R A;  1WFY A;  2IZV B;  1WXV A;  2WWZ A;  3PSE B;  2L7R A;  2GBK A;  3B08 A;  3JYU A;  1R4M I;  2LI5 A;  3ZLZ A;  3N32 A;  4BFR A;  4MEL A;  1VCB A;  3HHM A;  2CR5 A;  3VQI A;  3SD5 A;  3SHQ A;  3NZU A;  1G6J A;  2M17 A;  3MHS D;  2DYO A;  2DHZ A;  4WJQ A;  2LGD A;  1GUA B;  2C7H A;  4WQO B;  2MWS B;  1IPG A;  4ICV A;  2LUE A;  4TUU A;  3W1S A;  4I6L B;  2XK5 B;  3NY5 A;  2D3G A;  4IWO A;  3S2A A;  4MEM A;  3PTF C;  5EDS A;  2O6V D;  2KDB A;  2NPT A;  3A9J A;  1P3Q U;  2MP2 A;  2ZVO A;  2M4N A;  3CF6 E;  2AWT A;  3A9K B;  2ZEQ A;  3SDL C;  5DPW A;  1OQY A;  2WX1 A;  2ZNV C;  4KIK B;  2K6D B;  2EKE C;  1H8C A;  1RLF A;  1WXA A;  3B0A A;  2JXX A;  2JY6 A;  2GBJ A;  4AUQ C;  2MQJ A;  2BYV E;  3EEC A;  3UF8 A;  3WAN A;  1E8W A;  2LWP A;  1V2Y A;  3KVF B;  3PLV A;  4M8N A;  5JH5 C;  2N9X A;  3H6N A;  3HM6 X;  2MX2 A;  4GU2 A;  2L00 B;  4JLC A;  1ISN A;  3QAR A;  2KJR A;  3DVN U;  2ZPN A;  3IVF A;  3DBH I;  4GN1 A;  5L83 A;  5J2R A;  4CYE A;  2G45 B;  4GDL A;  4GMV A;  1WX8 A;  4MSM B;  3L0W B;  3TL5 A;  3L16 A;  2C5L C;  4HCP B;  4FHJ A;  1WGD A;  2KMA A;  3APD A;  2N7E A;  3ZIM A;  4EZK A;  2L76 A;  2O6V B;  2YVC A;  4EEW A;  4EKU A;  5KHQ A;  3ZNH B;  4CO7 A;  2N7D A;  1OGW A;  3NZS A;  2FCM A;  1V6E A;  4HCN B;  2MBB B;  2IO2 B;  3Q3J A;  5JHA A;  3ZTC A;  4A3P A;  3QCA A;  3QIJ A;  4ASW C;  4AJW A;  4DHZ B;  3QX1 A;  2ASQ A;  2XK5 A;  2KXJ A;  3VTU A;  3OLM D;  4DDG D;  4BKT A;  2FIF A;  2LZ6 A;  2Z59 B;  4JL9 A;  1P98 A;  3A9K A;  3EFU A;  2DX5 B;  1Z5S B;  3P2B A;  4KZ0 A;  3UIP B;  3R3M A;  1WM2 A;  3QQ8 B;  4KIK A;  4BKS D;  3MTN B;  2BYE A;  3M63 B;  4N9F 4;  1D3Z A;  4W9G A;  4GSW A;  5E6N A;  2FID A;  3VFK A;  1EO6 A;  2LGY A;  1UBQ A;  2V3S A;  4W9H A;  2MCN B;  2CKH B;  2IYD B;  1GJZ A;  2N9E B;  3I3T B;  1WR1 A;  5JZE B;  2K6Q A;  2ZNV B;  3UQA A;  1J0G A;  3JSV B;  1YD8 U;  2MSE D;  2RGF A;  4MM3 A;  3CMM B;  1WXS A;  2KMC A;  4W9C A;  3KH0 A;  4BOS C;  1XD3 B;  2K25 A;  4NAW B;  2MBH A;  3R7R A;  4ZRK A;  3HIZ A;  1P9D U;  2LAS A;  2O6V A;  2IO1 B;  4NQL B;  1S1Q B;  4DWF A;  1WRD B;  1Q1O A;  3WAP A;  2DYB A;  4AWJ A;  1EF1 A;  2NR2 A;  1T0Y A;  2D2Q A;  4IWQ A;  4AJY B;  2G4S A;  2BPS A;  3DBL I;  3R7Q A;  3AI5 A;  4NJ7 A;  2MBO A;  3OAW A;  2LRW A;  4RM8 A;  4HLE A;  1QZE A;  2K8C A;  4JGH B;  3QJZ A;  2M1M A;  3WIM A;  2ZPY A;  2HD5 B;  2RSU A;  3H7P B;  4MGY E;  3KYC D;  1KM7 A;  2FUH B;  4GB9 A;  2Z0E B;  4KSL C;  4FUL A;  2KDI A;  1OEY A;  2KOX A;  4FHK A;  4MSQ B;  3ZW3 A;  3ZKJ C;  1TBE A;  2ZJD A;  2N1W A;  3V62 A;  4E3C A;  1SGH A;  4G3X B;  1XQQ A;  2M0X A;  1V5T A;  2D11 A;  2GMI C;  1S3S G;  3VUX A;  1CMX B;  1YX6 B;  3HM3 A;  4FN2 A;  3Q3F A;  2K39 A;  2WDT B;  1U4A A;  4NNJ B;  1E7U A;  2I1K A;  2C9W B;  1WY8 A;  1E8X A;  1LQB A;  2IY1 B;  1TGZ B;  4GOC A;  3RZW C;  5C1Z A;  2PPH A;  1WMH B;  2KNB A;  3ZDM C;  4ANW A;  1PQS A;  1TTN A;  4NAW A;  3KUC B;  2LVQ A;  2KTR B;  1WGG A;  1H4R A;  4DHJ D;  4URK A;  3APC A;  2C60 A;  1L2N A;  2KTF A;  2RPQ A;  1P0R A;  2JUO A;  2KDF B;  1UGM A;  3VH3 B;  2CHZ A;  4EOY A;  2CU1 A;  2BKR B;  2KQS A;  4A20 A;  2L8J A;  4W9L A;  1WE7 A;  4G11 A;  2KWC A;  4G50 A;  4BKS A;  1GC6 A;  2OJR A;  2KLG A;  2ZCC A;  2PE6 B;  3AUL A;  4IG7 B;  3ENE A;  2YLM A;  5D6J B;  3UIO B;  1LXD A;  4LJO B;  4WJP A;  4FBJ B;  1IP9 A;  2CHX A;  4ZDV A;  4HVB A;  3VAW A;  5IAA C;  2KWU B;  3GZN I;  1C1Y B;  4B6W A;  2CHW A;  2KDE B;  3PRZ A;  4K81 A;  2JZ3 B;  1RRB A;  2J0K A;  4CHK A;  2L0F A;  3K9P B;  4II2 B;  2HTH A;  5D7G A;  1J8C A;  3MJW A;  3PV1 A;  3V61 A;  2KKC A;  1WJN A;  2FCQ A;  2LVO A;  1F9J A;  2NBU A;  2OOB B;  4GDK B;  3D32 A;  5GMV A;  1WF9 A;  2K8B A;  4DHJ B;  3VTW A;  3LJ3 A;  4IM2 A;  3PRM B;  4XX5 A;  4ANU A;  2L3Z A;  2BWE S;  2KLC A;  1Y8R C;  2LXC A;  1SE9 A;  3UIN B;  1WJ6 A;  2MLB A;  4NY0 A;  1GG3 A;  3HK0 A;  3QK0 A;  4MDK E;  5CHF A;  3T9L A;  3IG3 A;  3KYD D;  3PRP B;  1UD7 A;  4WWN A;  3O65 B;  2ZZP B;  5J18 A;  2XBB C;  4F7Z A;  3A4S C;  3IBE A;  4IM0 A;  1WX9 A;  3U30 A;  4WJN A;  1HE8 A;  2KK8 A;  4W9F A;  2DZI A;  3WAM A;  4MGI E;  4WWO A;  1R4N I;  3PVL A;  4EZL A;  5BO4 B;  3EHV A;  3DPD A;  3M95 A;  2JZZ A;  4A3O A;  2KX0 A;  4B9K A;  3PGE A;  2WX0 A;  1KOT A;  2G4D B;  2EMS A;  2Z0D B;  4RMA A;  5E6P A;  5FR6 A;  4NQK E;  2DYM A;  1YX5 B;  2D07 B;  2RR9 A;  1AAR A;  5J17 A;  2J0J A;  1MG8 A;  2LRU A;  3TCA A;  3RYT A;  2FNJ B;  1Q0W B;  1WGY A;  2RD0 A;  4MH0 E;  2KQ7 A;  4KV2 A;  2IO0 B;  2MA9 B;  4EFO A;  2V4L A;  2K1F A;  3DVG X;  4FA6 A;  2PJH A;  2NBW B;  1WZ3 A;  4PS7 A;  4W9K A;  4GXB A;  3ZUN A;  3TBL D;  1OTR B;  1WM3 A;  3VVW B;  3AU5 A;  1YIW A;  3DBR I;  3X23 A;  3VH4 B;  2UWQ A;  3VUW A;  2LJ5 A;  2ZCB A;  3V6E B;  2J7Q B;  1EF5 A;  3CSF A;  3ZNZ B;  5DPT A;  3UQB A;  4TQ0 A;  2JPH A;  2KC2 A;  4PYU A;  3PZD A;  2KAN A;  2KX3 A;  3OJ4 B;  4IC7 B;  4KDL B;  3ALB A;  3DOW A;  1WZ0 A;  4JIO U;  4FLH A;  3X0W A;  4IWP A;  3WA0 A;  4HDQ A;  5D94 A;  3ZNG C;  1UEL A;  2KJH B;  3M3J A;  5AZG A;  3ZNI D;  3NS8 A;  2JF5 A;  1WE6 A;  4NPN A;  2R2Q A;  5LLI A;  2NBV B;  3RUL A;  2JT4 B;  2MP2 B;  2DEN B;  2KJ6 A;  3EC8 A;  4HPM B;  1JRU A;  1YQB A;  2ZVN A;  3QHT A;  4LDT D;  1M94 A;  3L17 A;  4HXD A;  2HJ8 A;  5JHB A;  4IW0 A;  4K1R B;  2IBI B;  5DPR A;  3U8Z A;  1A5R A;  2DZJ A;  1V9J A;  2KD0 A;  3AU4 A;  3PLU A;  2JWZ A;  1WIA A;  3JSV A;  3PT2 B;  4B95 A;  4K7U A;  1UZX B;  1I35 A;  3QA8 A;  3BY4 B;  1WXM A;  2PE9 A;  2PEA A;  2DAJ A;  4BBN F;  3ML9 A;  3B1L X;  2AL3 A;  2MW5 A;  4DXA B;  2GOW A;  3A1Q B;  2BKF A;  4GDL B;  1WJ4 A;  2N9P C;  1C3T A;  3RUI B;  5DCN A;  1E8Z A;  1V80 A;  2LXA A;  1P1A A;  1IYF A;  1V49 A;  1WX7 A;  3DVG Y;  4HPL B;  4RM9 A;  3PPA A;  4PS3 A;  2DZK A;  2GBR A;  2AL6 A;  3JW0 X;  3VTV A;  4M0W B;  3PRE A;  2BWF A;  3APF A;  2BYF A;  3A33 B;  2N4F A;  4ZYN A;  5AEK B;  5IA7 A;  3RT3 B;  3M62 B;  4II3 B;  4LDT B;  3L10 B;  3QAQ A;  4FAD A;  2JRI B;  5AZF A;  2J0M A;  3H7P A;  3V60 A;  2MBQ A;  4AP4 C;  5KHO A;  2XEW A;  3JVZ X;  3NOB A;  3RCZ A;  3WAO A;  2NVU I;  5L95 C;  3CST A;  2IY0 B;  2O2V B;  4HJK A;  4OVU A;  3SU8 X;  1E90 A;  3VXW A;  3IFW B;  4FJV B;  2D10 A;  4ANV A;  2A4Z A;  2DZM A;  5D2M B;  4TQ1 A;  2QHO A;  2G3Q B;  1WJU A;  5E6O A;  3TIX A;  1E5W A;  4X57 B;  4TKN A;  1OEY J;  2BGF A;  1KJT A;  3W1S C;  4E71 A;  4K7W A;  1SIF A;  1WMH A;  4GGQ A;  3L13 A;  3OJ3 A;  3V6C B;  3AXC A;  1L7Y A;  2NCN A;  4J6I A;  1YJ1 A;  2KTR A;  5G2N A;  4IUM B;  1WH3 A;  5CHV C;  3A1Q A;  1VD2 A;  1LM8 B;  4P7I A;  1I42 A;  2KFK B;  2CS4 A;  3ZDT A;  4EZJ A;  1WGR A;  4MGK E;  1RFA A;  1WI0 A;  3ZVV A;  5TR5 A;  4K7S A;  4DBG A;  4EUT A;  4F8C B;  2FCN A;  2L0T A;  3ZRC A;  4JQW C;  3VUY A;  4WWP A;  3DCG A;  2KC1 A;  4YL8 A;  4KZC A;  5LXI B;  3N3K B;  2BF8 B;  2GBM A;  1TZ1 A;  1E8Y A;  4BVU C;  2KN5 A;  2JRH A;  2WYQ A;  5CX3 A;  3K9O B;  2C7N B;  2REX A;  4TV3 A;  4GIV A;  2R2O A;  4ANX A;  2MRP A;  1ZW7 A;  1NDD A;  1K8R B;  2KFJ A;  2FAZ A;  2KZR A;  2O2V A;  3DDC B;  3DQV A;  4M8M A;  2AYO B;  2KWV B;  1FXT B;  1J19 A;  4GDK A;  2I1J A;  2GBN A;  4LCD E;  4G0N B;  3L08 A;  1V5O A;  4MJS B;  1EUV B;  3PHX B;  2L05 A;  4DHZ E;  3PHW B;  2C7M B;  2HE7 A;  3R66 C;  3H1U A;  3L54 A;  3PS6 A;  1ZGU B;  2LVP A;  4PS8 A;  3C0R B;  4HWI B;  3RD2 A;  3WAL A;  2AEH A;  4XC2 A;  4F1S A;  2B3A A;  5AZH A;  4E74 A;  1UBI A;  2Y5B B;  1E7V A;  3NHE B;  1KLV A;  4W9I A;  2K8H A;  5HKH A;  3BIN A;  4BKG A;  4NJ6 A;  1BT0 A;  3GOE A;  5CHW A;  1ZKH A;  3TMP B;  1Q5W B;  3U7D A;  2FCS A;  3VDZ A;  4BBN C;  2LD9 A;  2A5U A;  2KFK A;  1GNU A;  3DBS A;  4HK2 A;  5C23 A;  1WR6 E;  5G55 A;  3KW5 B;  3H7S A;  1WYW B;  3TJP A;  3T8M A;  3H9D A;  3N30 A;  4AOF A;  3DVN V;  2NS5 A;  2M8S A;  5LXH A;  3ECI A; 
#chains in the Genus database with same CATH topology
 3ZTD A;  2L52 A;  1B9R A;  3W1Y A;  4KSK C;  4ZRJ A;  4KVG B;  1WWT A;  3Q3N C;  5BYR A;  2WXF A;  5CTR C;  4JE3 B;  2JVC A;  4YWG G;  3VHT C;  1V86 A;  3RNB C;  1LFD A;  4FJZ A;  2VH1 A;  4I6P A;  2MBE A;  1V81 A;  1XT9 B;  4XZ4 A;  3KQ4 A;  4W9D A;  5C2T B;  2V1Y A;  2HJ1 A;  1X1M A;  4WJO A;  4IM3 A;  2LGI A;  2DAF A;  2IZV B;  2YEP F;  4M00 A;  2GBK A;  2LI5 A;  2H89 B;  3N32 A;  2IGD A;  4HEA 1;  4MEL A;  3SD5 A;  3NZU A;  1G6J A;  2M17 A;  1B1Z A;  3H8H A;  1GUA B;  2MWS B;  1IPG A;  1FD6 A;  1ACC A;  2LUE A;  4TUU A;  4I6L B;  5EDS A;  2MP2 A;  2ZVO A;  2OED A;  2AWT A;  3A9K B;  2ZEQ A;  1Y56 A;  1L5P A;  1YJI A;  2EKE C;  1WXA A;  3IT6 B;  2GBJ A;  3EEC A;  3UF8 A;  2L1A A;  1V2Y A;  1M4V A;  1UGJ A;  2KJR A;  2Q5W D;  1R7S A;  5L83 A;  4XDD A;  3N1Y C;  1GPX A;  3B2F A;  4MH8 A;  2H88 B;  4YSY B;  2BS2 B;  3L16 A;  2C5L C;  3AEA B;  1WGD A;  2KMA A;  3ZIM A;  2PLP A;  4EKU A;  5KHQ A;  4CO7 A;  4B0E A;  2FCM A;  2M56 B;  2QC8 A;  2IO2 B;  1HZ6 A;  2OHF A;  3Q69 A;  4DHZ B;  3QX1 A;  2XK5 A;  3OLM D;  4DDG D;  2BB6 A;  4LNN A;  2WXH A;  1HEZ E;  3E56 A;  3UIP B;  3R3M A;  2MH7 A;  4BKS D;  1D3Z A;  4W9G A;  5HHD G;  2MCN B;  4A55 A;  2V3S A;  1GJZ A;  1ET6 A;  2N9E B;  1WR1 A;  1PYW D;  5AUK A;  2ZNV B;  5BMG A;  1YD8 U;  3RNF C;  3P1M A;  3CMM B;  1WXS A;  4BOS C;  2JWU A;  1P9D U;  4NQL B;  4DWF A;  2NR2 A;  4ITK A;  3N1Z C;  2BB5 A;  3PZ7 A;  3R7Q A;  5BYQ A;  4HLE A;  3QJZ A;  3WIM A;  3KYC D;  1KM7 A;  2FUH B;  4KSL C;  1STE A;  2M19 A;  4FHK A;  4MSQ B;  3ZW3 A;  1C4C A;  1SGH A;  2WU5 B;  1XQQ A;  1N61 A;  2RDH A;  4FN2 A;  1E10 A;  1E8X A;  2VH2 A;  2IY1 B;  3DWG C;  5C1Z A;  5EE3 A;  2PPH A;  2VZK B;  3W5U B;  4DHJ D;  1V1P A;  1WXQ A;  2RPQ A;  1V97 A;  4TSS A;  1E7P B;  5AUI A;  4EOY A;  2BKR B;  4KGR A;  4A20 A;  2L8J A;  4RF0 A;  1WE7 A;  1GC6 A;  4R3D A;  2ZCC A;  3AUL A;  3LYY A;  4RFB A;  3ENE A;  5D6J B;  4FBJ B;  4ZDV A;  1BXT A;  1HZ5 A;  2YEP B;  3RPF C;  1D4B A;  2KWU B;  1IBX A;  3PRZ A;  2JZ3 B;  4CHK A;  2M0A A;  5D7G A;  2KKC A;  2NBU A;  4GDK B;  2BBC A;  5GMV A;  1TKY A;  4DHJ B;  2J53 A;  2X8X X;  4ANU A;  3IT4 B;  2IGH A;  1NVI D;  1K51 A;  3HK0 A;  3T9L A;  2ZZP B;  1QOF A;  5J18 A;  2WP9 B;  3IBE A;  4IM0 A;  1WX9 A;  4M01 A;  1Q10 A;  3V05 A;  4W9F A;  2BQQ A;  1FRD A;  2IPK D;  3PVL A;  1VJK A;  3EHV A;  1VZ8 A;  1FXI A;  3AEB B;  1FCL A;  3FKY A;  2KWD A;  3PGE A;  1KOT A;  2WDQ B;  1ENF A;  4NQK E;  2RR9 A;  2LRU A;  2KAJ A;  3Q8A A;  5I4D A;  2RD0 A;  4L2Y A;  4KV2 A;  2QIL A;  4FA6 A;  2CJO A;  3ZUN A;  3Q14 C;  1VZ6 A;  2W55 A;  3GZN B;  2NTS A;  3EGR A;  1YIW A;  4RH6 A;  3VUW A;  2ZCB A;  3UI3 A;  2J7Q B;  2WXK A;  4TQ0 A;  3WCQ A;  3TEZ A;  4PYU A;  2LJI A;  3PZD A;  4C56 C;  2KAN A;  2WXI A;  2JSV X;  1L6U A;  1FM0 D;  2AQ1 B;  3WA0 A;  2PVO D;  4HDQ A;  1UEL A;  3M3J A;  3MC8 A;  3NS8 A;  2JF5 A;  4YTN B;  2R2Q A;  5LLI A;  2JT4 B;  3EC8 A;  4HPM B;  1YQB A;  4LDT D;  1M94 A;  3L17 A;  3DHH C;  4P6V F;  3ZQ4 A;  5DPR A;  2BS4 B;  1V9J A;  2KD0 A;  4K7U A;  5BYS A;  1I35 A;  4LNF A;  1WGK A;  4ZRQ A;  2N9P C;  3N20 C;  1E9M A;  2WXN A;  1ZUD 2;  1WX7 A;  4LNK A;  2DZK A;  3DWM A;  3APF A;  3RT3 B;  3M62 B;  4LDT B;  1RM6 C;  1K52 A;  1L6V A;  5AZF A;  3DBR B;  4AP4 C;  3WAO A;  3NOB A;  2D3A A;  3CST A;  2O2V B;  3Q2A C;  4HJK A;  3EA6 A;  4US9 A;  3IFW B;  4ANV A;  4C00 A;  5D2M B;  2DBY A;  4TQ1 A;  1WJU A;  5H92 C;  4HKZ E;  1OEY J;  5IKC M;  2CU3 A;  1C78 A;  4GGQ A;  3V6C B;  2NCN A;  3AE4 B;  3RNG C;  2KFK B;  2CS4 A;  3ZDT A;  1WGR A;  4MGK E;  1KLU D;  4A8X C;  4F8C B;  2FCN A;  3ZRC A;  4P16 A;  4WWP A;  2KC1 A;  5LXI B;  1SE4 A;  4YT0 B;  1L0V B;  2WYQ A;  5CX3 A;  3K9O B;  4TV3 A;  2R2O A;  1KTK A;  1ZW7 A;  5G5H A;  1NDD A;  2KFJ A;  4RGN A;  2FAZ A;  4UDU C;  1J19 A;  4GDK A;  2SAK A;  2GBN A;  4LCD E;  2HE7 A;  2MHJ A;  2QSD A;  4A6Q A;  4O1N A;  2B3A A;  1DGJ A;  5EE9 A;  2K8H A;  5IN7 A;  4ACF A;  2IJ0 A;  1Q5W B;  1L0X B;  2SEB D;  3NZ3 A;  3U7D A;  2LD9 A;  4JX1 C;  5C23 A;  1PUT A;  3DBS A;  1YN3 A;  1WR6 E;  5G55 A;  4B0M A;  3H9D A;  3N30 A;  4AOF A;  1D5X C;  4OZC A;  1DYQ A;  1TS3 A;  1ZXI A;  2UYZ B;  4FJY A;  4OVV A;  1UH6 A;  2EMT A;  5LNK 1;  1Z2M A;  4WUR A;  3RZF A;  1KF6 B;  4I6N B;  4WAA A;  1NI2 A;  4MGZ E;  3RFZ B;  4ZYS A;  1GC7 A;  3ZXV A;  1L0Y B;  1FNU A;  2MJ3 A;  4DK5 A;  4W9E A;  4HDO A;  3ZRF A;  4PYZ A;  2N1V A;  4AQ7 A;  3OWE B;  2IO3 B;  1I4P A;  3GS2 A;  1WFY A;  3P42 A;  3PSE B;  2L7R A;  3I63 C;  3B08 A;  5D3D A;  4RGM A;  3W9C B;  2ACZ B;  4BFR A;  1ESF A;  3HHM A;  2CR5 A;  2V4I B;  1T0Q C;  4BZA A;  3MHS D;  2DYO A;  3AE3 B;  4WJQ A;  1SSN A;  2C7H A;  4WQO B;  2V0G A;  4YTP B;  2WHI A;  3W1S A;  1KLG D;  2XK5 B;  4IWO A;  3S2A A;  1C79 A;  3PTF C;  2KAC A;  2NPT A;  1FMA D;  4RNA A;  2BTE A;  5DPW A;  2ZNV C;  4M02 A;  2K6D B;  1XXG A;  3ZXR A;  3B0A A;  3AEF B;  2RMM A;  2LWP A;  3Q8F A;  3B9J A;  2N9X A;  4M8N A;  3SFE B;  2MX2 A;  5JH5 C;  4GU2 A;  2L00 B;  3QAR A;  1J7B A;  3IXS A;  4GN1 A;  1C9F A;  5J2R A;  1P7E A;  1EWC A;  3NVW A;  2EEL A;  1AW7 A;  3L0W B;  3TL5 A;  1DOX A;  2HDE A;  2N7E A;  4EZK A;  2YVC A;  2MJD A;  2I38 A;  3ZNH B;  2N7D A;  1OGW A;  3NZS A;  1QOG A;  2PTL A;  1IGD A;  1NEK B;  3Q3J A;  5JHA A;  2JXT A;  1JRO A;  3ZTC A;  1HTO A;  2LGS A;  4HJG E;  3QIJ A;  4AJW A;  1MFW A;  2V9H A;  2KXJ A;  2DLB A;  2Z59 B;  3EFU A;  1CZP A;  2DX5 B;  2KYW A;  1WM2 A;  4KIK A;  2NTT A;  3MTN B;  2BYE A;  1SBB B;  3TUO A;  1JWB D;  3ZYY X;  1CJE A;  2LGY A;  1C76 A;  2G9H D;  4W9H A;  2N9L A;  3I3T B;  3KLS X;  5JZE B;  1JRP A;  1J7A A;  5H8Y E;  2BT6 A;  3JSV B;  2MSE D;  2RGF A;  4HPP A;  4N6E B;  4HKQ A;  3C19 A;  3HUI A;  1FEH A;  2K25 A;  2X38 A;  2O6V A;  5IP4 D;  2IO1 B;  1V1P B;  2ZW0 A;  2WLB A;  4K3C A;  2DWQ A;  1C4A A;  2G4S A;  2BPS A;  3Q3M C;  3DBL I;  2AX5 A;  1ZPS A;  3OAW A;  1IBX B;  2RSU A;  1PGX A;  1MHH E;  2QEJ C;  4N58 A;  1UUP A;  1FRR A;  1TS2 A;  3E9S A;  3VUX A;  1T5X D;  4PT5 A;  5BMH A;  2I1K A;  1I4X A;  1LQB A;  3OG5 A;  2KNB A;  3DHI C;  3ZDM C;  2GB1 A;  1PQS A;  1FXA A;  3KUC B;  1ROE A;  1VLB A;  2KTR B;  3P63 A;  3HVD A;  2C60 A;  2ONQ A;  4USA A;  4XDC A;  1P0R A;  2JUO A;  3NG0 A;  2N7J A;  1PFD A;  2CHZ A;  2KQS A;  3AE5 B;  5FKA C;  3MC0 B;  2KLG A;  4IG7 B;  2YLM A;  1GAQ B;  3UIO B;  1LXD A;  4LJO B;  4WJP A;  1YJJ A;  4PK1 A;  1BML C;  5IAA C;  4K3B A;  2FUG 1;  3GZN I;  1C1Y B;  1ZE3 D;  2UU7 A;  4K81 A;  2J0K A;  1ZP0 B;  3K9P B;  1HTQ A;  1J8C A;  2WXL A;  3V61 A;  3J9C A;  2WQY B;  1JAL A;  1A70 A;  1T0R C;  1UNS A;  3LJ3 A;  1HQR D;  3MFG A;  3PRM B;  4IM2 A;  4XX5 A;  2BWE S;  2I2Y A;  1I7H A;  3UIN B;  2MLB A;  5IO9 A;  2RDG A;  4C7Y A;  3IG3 A;  3PRP B;  4RGT A;  3N1X C;  3LXF A;  4C4V B;  3U30 A;  3FC4 A;  1HE8 A;  2KK8 A;  3NVV A;  4WWM A;  3WAM A;  4MGI E;  5BO4 B;  3DPD A;  3ZJV A;  2JZZ A;  4RF1 A;  4DQO C;  1L4D B;  2G4D B;  5E6P A;  1C4P A;  1AAR A;  4KGS A;  1Q0W B;  4MH0 E;  2BYT A;  2KQ7 A;  2MA9 B;  1XO3 A;  2NBW B;  1WZ3 A;  2KDM A;  1FIQ A;  4YTM B;  1WM3 A;  3VVW B;  3DBR I;  1RYJ A;  4RGO S;  4XWT A;  2VZK D;  3V6E B;  2WXR A;  3ZNZ B;  3UQB A;  2KC2 A;  1FCC C;  2KX3 A;  3OJ4 B;  3ZJU A;  1WZ0 A;  4FLH A;  4IWP A;  2QJL A;  3HVZ A;  4US8 A;  3BK1 A;  4XE0 A;  2KJH B;  3ZNI D;  5BMI A;  1XLP A;  2KJ6 A;  3ETR A;  3W5V B;  4HXD A;  5JHB A;  1JWS D;  4REZ A;  1F52 A;  3PLU A;  1TYG B;  3JSV A;  2ZW1 A;  2WXQ A;  3QA8 A;  3BY4 B;  1TT5 B;  1AWD A;  1ZDX A;  2PE9 A;  3BVZ A;  4XGA B;  4BBN F;  2MW5 A;  3T3O A;  2R61 A;  4HRS A;  2GOW A;  2BKF A;  4GDL B;  1WJ4 A;  1IYF A;  4H2A A;  3VTV A;  2L83 A;  1QF6 A;  1VDV A;  4ZYN A;  5AEK B;  5IA7 A;  4HRO A;  3L10 B;  2JRI B;  2INC C;  1JWU D;  3V3X A;  5KHO A;  2XEW A;  3GE8 C;  2IY0 B;  2FBW B;  3AM9 A;  3SU8 X;  5C3J B;  3DBL B;  2N0S B;  4FJV B;  1K53 A;  2QHO A;  5E6O A;  1JQ4 A;  5JXV A;  4K7W A;  1SIF A;  4OVZ A;  1DOY A;  3P4Q B;  3OJ3 A;  3AXC A;  4J6I A;  2KTR A;  5G2N A;  3NRZ A;  2QCZ A;  1YMH E;  3A1Q A;  1CQV A;  2LMC A;  1I42 A;  1RFA A;  5TR5 A;  4M0W A;  2HTM E;  4EUT A;  2L0T A;  3N9Y C;  3CWI A;  3VRA B;  1TY2 A;  1E8Y A;  2C7N B;  1MPE A;  1E6E B;  5GXG B;  2KZR A;  3DQV A;  2AYO B;  1FXT B;  2I1J A;  3BYT B;  4G0N B;  3L08 A;  1EUV B;  3PHX B;  2BVC A;  3BK2 A;  2C7M B;  3R66 C;  4DXG A;  2Y5C A;  3L54 A;  3PS6 A;  1IP9 A;  3RD2 A;  3WAL A;  1MI0 A;  1UBI A;  3NHE B;  5EE0 A;  5HKH A;  2K5P A;  5G5G A;  4C4V A;  3HRD D;  3Q8E A;  5TSS A;  3BWU D;  2NPT B;  2VRR B;  1JWA D;  5DPS A;  1JWM D;  2L32 A;  4JWS C;  3B2G A;  3PO0 A;  2W9N A;  3ZO5 B;  3KUZ A;  4DDI D;  4BOZ B;  3ONS A;  1OFF A;  3KUD B;  1XLQ A;  4ICU A;  2Y3A A;  3MP9 A;  2LUM A;  2KVR A;  1RAX A;  4MJS A;  1WGH A;  3UGB B;  2LGX A;  1K50 A;  4LJP B;  3A4R A;  1WXV A;  3AED B;  3SHQ A;  2ON8 A;  2W82 A;  2DHZ A;  1L4Z B;  2LGD A;  3I5J C;  4S0R A;  4ICV A;  4MEM A;  2O6V D;  3A9J A;  1P3Q U;  2M4N A;  1NI3 A;  1QKZ A;  2W3R A;  2WX1 A;  4KIK B;  1QOB A;  1H8C A;  1RLF A;  2JY6 A;  3AEG B;  2MQJ A;  2BYV E;  3WAN A;  4OW0 A;  3KVF B;  3PLV A;  2WDV B;  3H6N A;  4JLC A;  5IOI A;  1ISN A;  1JML A;  1HXY D;  3Q3O C;  3DVN U;  2ZPN A;  3URY A;  3DBH I;  3O13 A;  2G45 B;  4GDL A;  4LTU A;  4FHJ A;  3APD A;  2O6V B;  1C77 A;  3BZD B;  2N9K A;  1V6E A;  4HCN B;  4ASW C;  2LHD A;  3AE7 B;  3VTU A;  1EM7 A;  2Z8L A;  1DOI A;  1R4M B;  4JL9 A;  1P98 A;  1Z5S B;  3P2B A;  4RCO A;  3QQ8 B;  1LGR A;  1V1O A;  3M63 B;  4N9F 4;  2PMV A;  4GSW A;  3AE9 B;  5E6N A;  2FID A;  1UBQ A;  2IYD B;  1YN5 A;  4ARI A;  2K6Q A;  3Q8B A;  1J0G A;  4MM3 A;  4NJC A;  2JU6 X;  2KMC A;  4W9C A;  3KH0 A;  1XD3 B;  3R7R A;  4KKI A;  1SJH D;  1BUI C;  1S1Q B;  1WRD B;  1RFK A;  3WAP A;  4AWJ A;  1EF1 A;  2IND C;  1XF5 L;  2MEK A;  1OQQ A;  4L23 A;  3ZGZ A;  1T0Y A;  3ZJT A;  3AE2 B;  3AI5 A;  4N59 A;  2LRW A;  4RM8 A;  2K8C A;  4JGH B;  2M1M A;  2ZPY A;  1TZO A;  2HD5 B;  1UF0 A;  3H7P B;  4MGY E;  1GB4 A;  4GB9 A;  2Z0E B;  4FUL A;  1OEY A;  2KOX A;  2ZJD A;  2N1W A;  3V62 A;  1N6Z A;  4G3X B;  1V5T A;  2GMI C;  3RMK C;  2WXM A;  2WDR B;  2K39 A;  1U4A A;  1E7U A;  1WY8 A;  1SB3 C;  2XNA C;  4GOC A;  1QOA A;  3RZW C;  1WMH B;  4OZB A;  4NAW A;  1FFV A;  2K0P A;  1WGG A;  1YN4 A;  1YQ4 B;  1TY0 A;  1L2N A;  2KTF A;  3AB5 A;  2KDF B;  1UGM A;  3VH3 B;  4W9L A;  4G11 A;  4G50 A;  3AV8 A;  4HVB A;  2KVZ A;  4B6W A;  2CHW A;  2KDE B;  1RRB A;  1F2R I;  4CQN A;  1F2R C;  4II2 B;  3BII D;  3MJW A;  1MHX A;  3PV1 A;  1WJN A;  2FCQ A;  2LVO A;  3D32 A;  3VR8 B;  3RN9 C;  1Y8R C;  1MG4 A;  3U7Z A;  1WJ6 A;  4NY0 A;  1XCQ L;  4XWW A;  5CHF A;  3MHZ A;  4ZOH C;  1UD7 A;  4WWN A;  2WS3 B;  4F7Z A;  4AS1 A;  4WJN A;  4WWO A;  1R4N I;  4EZL A;  2V3P A;  4OZA A;  2KX0 A;  4B9K A;  4YXD B;  2WX0 A;  4RMA A;  1YX5 B;  2D07 B;  3BVG A;  1MG8 A;  3TSS A;  4LLG M;  1WGY A;  2IO0 B;  3DVG X;  3L4P A;  2PKO A;  3TBL D;  3AU5 A;  3X23 A;  4LK0 M;  3VH4 B;  3RI7 C;  2UWQ A;  1I4G A;  2LJ5 A;  3DBH B;  3AN1 A;  4BAX A;  2JPH A;  2JZP A;  4IC7 B;  3DOW A;  1NEN B;  5D94 A;  3ZNG C;  2WGS A;  4NPN A;  2WXO A;  2GI9 A;  2NBV B;  4LNO A;  3RUL A;  2DEN B;  1JRU A;  3QHT A;  1SE2 A;  2HJ8 A;  4IW0 A;  3U8Z A;  2DZJ A;  3AU4 A;  3PT2 B;  4IDI A;  4B95 A;  1E0Z A;  1ZDV A;  2Y5P A;  5MPO A;  1N5X A;  1WXM A;  3EUB 2;  3U52 E;  2PEA A;  2DAJ A;  1D5M C;  3ML9 A;  2AL3 A;  2D3B A;  3A1Q B;  2E6X A;  4Q2J A;  5DCN A;  2LXA A;  1V49 A;  1TS5 A;  3DVG Y;  4RM9 A;  1ZXH A;  3JW0 X;  4PS3 A;  2AL6 A;  4ZHO A;  1UWM A;  4M0W B;  3PRE A;  2BWF A;  2BYF A;  3A33 B;  2N4F A;  5EE1 A;  3C8Y A;  3QAQ A;  4FAD A;  1HA5 A;  1D5Z C;  3NVY A;  2J0M A;  4S17 A;  3H7P A;  2K3U A;  3V60 A;  4A9A A;  3JVZ X;  2NVU I;  1E90 A;  3I9V 1;  2D10 A;  3NVZ A;  2G3Q B;  3TIX A;  2V3N A;  4GLS C;  2BGF A;  1KJT A;  3W1S C;  1WMH A;  4C7Z A;  3L13 A;  3CIR B;  1RWS A;  1L7Y A;  4P1C C;  3RNC C;  1YJ1 A;  4IUM B;  2D3C A;  2INN E;  1LM8 B;  4P7I A;  4WH4 A;  1EWY C;  1AN8 A;  3IAM 1;  4EZJ A;  3ZVV A;  1XEE A;  3VUY A;  4YL8 A;  1PGB A;  4KZC A;  2BF8 B;  2OJW A;  4BVU C;  2JRH A;  3BYY B;  5HG2 A;  3PZ8 A;  4ZRP A;  1K8R B;  3DDC B;  4M8M A;  2KQ4 X;  3MC9 A;  1VRA B;  4MJS B;  2L05 A;  1UWX A;  3AMZ A;  1N63 A;  2WXP A;  3BVM A;  2QIE B;  1T6B X;  1ZGU B;  4PS8 A;  2IGG A;  4F1S A;  2AEH A;  2QMT A;  1SIJ A;  4XC2 A;  5AZH A;  4E74 A;  2PW9 A;  4C80 A;  2Y5B B;  1E7V A;  4W9I A;  3BIN A;  4NJ6 A;  1BT0 A;  1F0Z A;  5CHW A;  1ZKH A;  4BBN C;  3VDZ A;  1GNU A;  2XN9 C;  3KW5 B;  3TJP A;  1WYW B;  4D2K A;  3DVN V;  5LXH A;  2KO3 A;  2KHW B;  3A9J B;  1IUE A;  3P4S B;  3DHG C;  3R2T A;  4W9J A;  3QWZ B;  4ZRI A;  1GB1 A;  1GOZ A;  1R4N B;  2BW2 A;  3IHP C;  3T3N A;  1N5W A;  3QC8 B;  1NBF C;  4KDI C;  3ML8 A;  3LDZ E;  3FIL A;  1EU4 A;  2WWZ A;  3JYU A;  3ZLZ A;  1R4M I;  1SE3 A;  3AE6 B;  1VCB A;  3VQI A;  2K9X A;  3AH7 A;  1VR9 A;  1FNV A;  4L1B A;  3MJ5 A;  3AE1 B;  1EU3 A;  1SJE D;  3NUH B;  3NY5 A;  2D3G A;  2KDB A;  1SEB D;  3CF6 E;  2NMQ A;  3SDL C;  1OQY A;  1T0S C;  2FE8 A;  2JXX A;  1FFU A;  2AQ3 B;  4AUQ C;  1E8W A;  3HM6 X;  4P1B C;  3IVF A;  3GP7 A;  4CYE A;  4MM3 B;  4GMV A;  1WX8 A;  1XCT L;  4MSM B;  3P4P B;  3AEE B;  4MT5 A;  4HCP B;  2L76 A;  4TMA B;  4EEW A;  2W54 A;  4NZL B;  2MBB B;  1OQR A;  3SR6 A;  4A3P A;  5HFY A;  1I4Q A;  3QCA A;  2ASQ A;  2WNM A;  4BKT A;  2JYE A;  2FIF A;  2LZ6 A;  3A9K A;  1CK1 A;  4KZ0 A;  3TEX A;  5T8I A;  2JX5 A;  2LFI A;  3Q6B A;  3KWL A;  2IDY A;  3VFK A;  1EO6 A;  2CKH B;  5FK9 C;  3UQA A;  3TEY A;  1VZ7 A;  5HI1 A;  2B76 B;  1FO4 A;  1ZOY B;  4NAW B;  2MBH A;  4ZRK A;  3HIZ A;  4ZHP A;  4LNI A;  2LAS A;  3SFD B;  3EFC A;  1Q1O A;  2DYB A;  2INP E;  3TEW A;  2D2Q A;  4IWQ A;  4AJY B;  4NJ7 A;  2MBO A;  1SF0 A;  1QZE A;  1WSP A;  4YSZ B;  3ABV B;  3R8B A;  3SEB A;  2WU2 B;  2KDI A;  2JYT A;  3ZKJ C;  1TBE A;  3VRB B;  4OHJ A;  4E3C A;  1AYF A;  2M0X A;  2D11 A;  2KT7 A;  1S3S G;  1MJD A;  1CMX B;  1YX6 B;  3HM3 A;  3Q3F A;  1WRI A;  2WDT B;  4NNJ B;  2C9W B;  1TGZ B;  4ANW A;  4A90 A;  2RDB C;  1TTN A;  5FR3 A;  2LVQ A;  1H4R A;  4URK A;  3APC A;  2W3S A;  1F1H A;  2CU1 A;  4JPS A;  1TKG A;  2KWC A;  4BKS A;  2OJR A;  1IGC A;  2PE6 B;  2CHX A;  3VAW A;  2BS3 B;  3RNE C;  3FAH A;  2LEK A;  1YNT E;  2JQR B;  2L0F A;  1FPY A;  2HTH A;  4FXC A;  1TS4 A;  4WQM A;  1I4R A;  1P7F A;  1F9J A;  2OOB B;  1XLO A;  3IAS 1;  1WF9 A;  2K8B A;  5D3I B;  3VTW A;  4KX6 B;  2L3Z A;  2KLC A;  4DXF A;  2LXC A;  1SE9 A;  1JW9 D;  1GG3 A;  2WXJ A;  3QK0 A;  4MDK E;  3KYD D;  3O65 B;  2XBB C;  3A4S C;  2DZI A;  4NAM A;  3M95 A;  4A3O A;  4MAC A;  2G1E A;  2MJE A;  2QDF A;  2PVG C;  2LHE A;  2EMS A;  2Z0D B;  5FR6 A;  2DYM A;  4EE2 A;  4YSX B;  5J17 A;  2J0J A;  3I57 A;  3TCA A;  4WAF A;  3RYT A;  3W2D A;  1QLB B;  2FNJ B;  1WYG A;  1TKE A;  4EFO A;  2V4L A;  2K1F A;  2GLS A;  2D5G A;  2KMM A;  2PJH A;  1QQR A;  2J52 A;  4PS7 A;  4W9K A;  4GXB A;  2E3T A;  1MVK A;  1OTR B;  4KKJ A;  1PGA A;  4ARC A;  1N60 A;  1EF5 A;  3AEC B;  3CSF A;  5DPT A;  1TJE A;  4KDL B;  3NJT A;  3ALB A;  2J4X A;  4JIO U;  3X0W A;  1SXT A;  2ICI A;  5AZG A;  1WE6 A;  2MP2 B;  3U2S C;  2ZVN A;  2WXG A;  1FNW A;  4K1R B;  2IBI B;  1A5R A;  1KFY B;  2JWZ A;  1WIA A;  1UZX B;  1NYQ A;  2J42 A;  1QT9 A;  3U4E G;  3B1L X;  4DXA B;  1YOV B;  1KRH A;  1C3T A;  3RUI B;  1TIF A;  1E8Z A;  1V80 A;  3RNA C;  4JWU C;  1P1A A;  3GE3 C;  4HPL B;  3PPA A;  2GBR A;  3NS1 A;  4II3 B;  4XYC A;  3P4R B;  2MBQ A;  2K22 A;  3RCZ A;  5L95 C;  1N62 A;  4OVU A;  3VXW A;  3GB1 A;  3R2I A;  2AQ2 B;  1YQ3 B;  3KWV A;  1QIL A;  2A4Z A;  2KN4 A;  2DZM A;  1KH0 A;  1E5W A;  4X57 B;  4TKN A;  4E71 A;  2DNF A;  4WIP A;  4QAY A;  2TSS A;  1PDX A;  2RPV A;  4IKG A;  1WH3 A;  5CHV C;  1F77 A;  1VD2 A;  2CJN A;  1LO5 D;  4J3O D;  1ET9 A;  1WI0 A;  1J7C A;  4K7S A;  4DBG A;  4JQW C;  4KGT A;  3DCG A;  3VR9 B;  1D6E C;  3N3K B;  2GBM A;  1TZ1 A;  5E6J A;  2KN5 A;  2REX A;  4GIV A;  2EKI A;  4ANX A;  2MRP A;  2O2V A;  2KWV B;  2GRI A;  1XLN A;  3AE8 B;  3LB8 C;  1V5O A;  4DHZ E;  3PHW B;  3H1U A;  2LVP A;  3C0R B;  1V8C A;  4HWI B;  3FIL B;  3Q8C A;  1KLV A;  4IOI E;  2PIA A;  4BKG A;  1NYR A;  3GOE A;  3TMP B;  2FCS A;  1I4H A;  2A5U A;  2KFK A;  4HK2 A;  1JCK B;  3H7S A;  3T8M A;  2NS5 A;  2M8S A;  1T3Q A;  3ECI A; 
#chains in the Genus database with same CATH homology
 3ZTD A;  3W1Y A;  2KO3 A;  2KHW B;  2NPT B;  2UYZ B;  2VRR B;  3A9J B;  4FJY A;  4KSK C;  5DPS A;  4OVV A;  4ZRJ A;  1UH6 A;  2EMT A;  4KVG B;  1Z2M A;  3RZF A;  4I6N B;  4WAA A;  4W9J A;  3QWZ B;  2W9N A;  1NI2 A;  4ZRI A;  3ZO5 B;  4MGZ E;  3KUZ A;  4DDI D;  5CTR C;  2JVC A;  1GC7 A;  4BOZ B;  3ONS A;  3VHT C;  1V86 A;  3KUD B;  1LFD A;  3IHP C;  4FJZ A;  4I6P A;  2MBE A;  1V81 A;  1XT9 B;  4ICU A;  4XZ4 A;  4DK5 A;  4W9E A;  4HDO A;  3ZRF A;  4PYZ A;  4MJS A;  2KVR A;  1RAX A;  2N1V A;  3QC8 B;  1NBF C;  1WGH A;  4W9D A;  2V1Y A;  3UGB B;  4KDI C;  1X1M A;  2LGX A;  4WJO A;  4IM3 A;  2IO3 B;  3ML8 A;  3LDZ E;  4LJP B;  2DAF A;  3A4R A;  1WFY A;  2IZV B;  1WXV A;  2WWZ A;  3PSE B;  2L7R A;  2GBK A;  3B08 A;  3JYU A;  1R4M I;  2LI5 A;  3ZLZ A;  3N32 A;  4BFR A;  4MEL A;  1VCB A;  3HHM A;  2CR5 A;  3VQI A;  3SD5 A;  3SHQ A;  3NZU A;  1G6J A;  2M17 A;  3MHS D;  2DYO A;  2DHZ A;  4WJQ A;  2LGD A;  1GUA B;  2C7H A;  4WQO B;  2MWS B;  1IPG A;  4ICV A;  2LUE A;  4TUU A;  3W1S A;  4I6L B;  2XK5 B;  3NY5 A;  2D3G A;  4IWO A;  3S2A A;  4MEM A;  3PTF C;  5EDS A;  2O6V D;  2KDB A;  2NPT A;  3A9J A;  1P3Q U;  2MP2 A;  2ZVO A;  2M4N A;  3CF6 E;  2AWT A;  3A9K B;  2ZEQ A;  3SDL C;  5DPW A;  1OQY A;  2WX1 A;  2ZNV C;  4KIK B;  2K6D B;  2EKE C;  1H8C A;  1RLF A;  1WXA A;  3B0A A;  2JXX A;  2JY6 A;  2GBJ A;  4AUQ C;  2MQJ A;  2BYV E;  3EEC A;  3UF8 A;  3WAN A;  1E8W A;  2LWP A;  1V2Y A;  3KVF B;  3PLV A;  4M8N A;  5JH5 C;  2N9X A;  3H6N A;  3HM6 X;  2MX2 A;  4GU2 A;  2L00 B;  4JLC A;  1ISN A;  3QAR A;  2KJR A;  3DVN U;  2ZPN A;  3IVF A;  3DBH I;  4GN1 A;  5L83 A;  5J2R A;  4CYE A;  2G45 B;  4GDL A;  4GMV A;  1WX8 A;  4MSM B;  3L0W B;  3TL5 A;  3L16 A;  2C5L C;  4HCP B;  4FHJ A;  1WGD A;  2KMA A;  3APD A;  2N7E A;  3ZIM A;  4EZK A;  2L76 A;  2O6V B;  2YVC A;  4EEW A;  4EKU A;  5KHQ A;  3ZNH B;  4CO7 A;  2N7D A;  1OGW A;  3NZS A;  2FCM A;  1V6E A;  4HCN B;  2MBB B;  2IO2 B;  3Q3J A;  5JHA A;  3ZTC A;  4A3P A;  3QCA A;  3QIJ A;  4ASW C;  4AJW A;  4DHZ B;  3QX1 A;  2ASQ A;  2XK5 A;  2KXJ A;  3VTU A;  3OLM D;  4DDG D;  4BKT A;  2FIF A;  2LZ6 A;  2Z59 B;  4JL9 A;  1P98 A;  3A9K A;  3EFU A;  2DX5 B;  1Z5S B;  3P2B A;  4KZ0 A;  3UIP B;  3R3M A;  1WM2 A;  3QQ8 B;  4KIK A;  4BKS D;  3MTN B;  2BYE A;  3M63 B;  4N9F 4;  1D3Z A;  4W9G A;  4GSW A;  5E6N A;  2FID A;  3VFK A;  1EO6 A;  2LGY A;  1UBQ A;  2V3S A;  4W9H A;  2MCN B;  2CKH B;  2IYD B;  1GJZ A;  2N9E B;  3I3T B;  1WR1 A;  5JZE B;  2K6Q A;  2ZNV B;  3UQA A;  1J0G A;  3JSV B;  1YD8 U;  2MSE D;  2RGF A;  4MM3 A;  3CMM B;  1WXS A;  2KMC A;  4W9C A;  3KH0 A;  4BOS C;  1XD3 B;  2K25 A;  4NAW B;  2MBH A;  3R7R A;  4ZRK A;  3HIZ A;  1P9D U;  2LAS A;  2O6V A;  2IO1 B;  4NQL B;  1S1Q B;  4DWF A;  1WRD B;  1Q1O A;  3WAP A;  2DYB A;  4AWJ A;  1EF1 A;  2NR2 A;  1T0Y A;  2D2Q A;  4IWQ A;  4AJY B;  2G4S A;  2BPS A;  3DBL I;  3R7Q A;  3AI5 A;  4NJ7 A;  2MBO A;  3OAW A;  2LRW A;  4RM8 A;  4HLE A;  1QZE A;  2K8C A;  4JGH B;  3QJZ A;  2M1M A;  3WIM A;  2ZPY A;  2HD5 B;  2RSU A;  3H7P B;  4MGY E;  3KYC D;  1KM7 A;  2FUH B;  4GB9 A;  2Z0E B;  4KSL C;  4FUL A;  2KDI A;  1OEY A;  2KOX A;  4FHK A;  4MSQ B;  3ZW3 A;  3ZKJ C;  1TBE A;  2ZJD A;  2N1W A;  3V62 A;  4E3C A;  1SGH A;  4G3X B;  1XQQ A;  2M0X A;  1V5T A;  2D11 A;  2GMI C;  1S3S G;  3VUX A;  1CMX B;  1YX6 B;  3HM3 A;  4FN2 A;  3Q3F A;  2K39 A;  2WDT B;  1U4A A;  4NNJ B;  1E7U A;  2I1K A;  2C9W B;  1WY8 A;  1E8X A;  1LQB A;  2IY1 B;  1TGZ B;  4GOC A;  3RZW C;  5C1Z A;  2PPH A;  1WMH B;  2KNB A;  3ZDM C;  4ANW A;  1PQS A;  1TTN A;  4NAW A;  3KUC B;  2LVQ A;  2KTR B;  1WGG A;  1H4R A;  4DHJ D;  4URK A;  3APC A;  2C60 A;  1L2N A;  2KTF A;  2RPQ A;  1P0R A;  2JUO A;  2KDF B;  1UGM A;  3VH3 B;  2CHZ A;  4EOY A;  2CU1 A;  2BKR B;  2KQS A;  4A20 A;  2L8J A;  4W9L A;  1WE7 A;  4G11 A;  2KWC A;  4G50 A;  4BKS A;  1GC6 A;  2OJR A;  2KLG A;  2ZCC A;  2PE6 B;  3AUL A;  4IG7 B;  3ENE A;  2YLM A;  5D6J B;  3UIO B;  1LXD A;  4LJO B;  4WJP A;  4FBJ B;  1IP9 A;  2CHX A;  4ZDV A;  4HVB A;  3VAW A;  5IAA C;  2KWU B;  3GZN I;  1C1Y B;  4B6W A;  2CHW A;  2KDE B;  3PRZ A;  4K81 A;  2JZ3 B;  1RRB A;  2J0K A;  4CHK A;  2L0F A;  3K9P B;  4II2 B;  2HTH A;  5D7G A;  1J8C A;  3MJW A;  3PV1 A;  3V61 A;  2KKC A;  1WJN A;  2FCQ A;  2LVO A;  1F9J A;  2NBU A;  2OOB B;  4GDK B;  3D32 A;  5GMV A;  1WF9 A;  2K8B A;  4DHJ B;  3VTW A;  3LJ3 A;  4IM2 A;  3PRM B;  4XX5 A;  4ANU A;  2L3Z A;  2BWE S;  2KLC A;  1Y8R C;  2LXC A;  1SE9 A;  3UIN B;  1WJ6 A;  2MLB A;  4NY0 A;  1GG3 A;  3HK0 A;  3QK0 A;  4MDK E;  5CHF A;  3T9L A;  3IG3 A;  3KYD D;  3PRP B;  1UD7 A;  4WWN A;  3O65 B;  2ZZP B;  5J18 A;  2XBB C;  4F7Z A;  3A4S C;  3IBE A;  4IM0 A;  1WX9 A;  3U30 A;  4WJN A;  1HE8 A;  2KK8 A;  4W9F A;  2DZI A;  3WAM A;  4MGI E;  4WWO A;  1R4N I;  3PVL A;  4EZL A;  5BO4 B;  3EHV A;  3DPD A;  3M95 A;  2JZZ A;  4A3O A;  2KX0 A;  4B9K A;  3PGE A;  2WX0 A;  1KOT A;  2G4D B;  2EMS A;  2Z0D B;  4RMA A;  5E6P A;  5FR6 A;  4NQK E;  2DYM A;  1YX5 B;  2D07 B;  2RR9 A;  1AAR A;  5J17 A;  2J0J A;  1MG8 A;  2LRU A;  3TCA A;  3RYT A;  2FNJ B;  1Q0W B;  1WGY A;  2RD0 A;  4MH0 E;  2KQ7 A;  4KV2 A;  2IO0 B;  2MA9 B;  4EFO A;  2V4L A;  2K1F A;  3DVG X;  4FA6 A;  2PJH A;  2NBW B;  1WZ3 A;  4PS7 A;  4W9K A;  4GXB A;  3ZUN A;  3TBL D;  1OTR B;  1WM3 A;  3VVW B;  3AU5 A;  1YIW A;  3DBR I;  3X23 A;  3VH4 B;  2UWQ A;  3VUW A;  2LJ5 A;  2ZCB A;  3V6E B;  2J7Q B;  1EF5 A;  3CSF A;  3ZNZ B;  5DPT A;  3UQB A;  4TQ0 A;  2JPH A;  2KC2 A;  4PYU A;  3PZD A;  2KAN A;  2KX3 A;  3OJ4 B;  4IC7 B;  4KDL B;  3ALB A;  3DOW A;  1WZ0 A;  4JIO U;  4FLH A;  3X0W A;  4IWP A;  3WA0 A;  4HDQ A;  5D94 A;  3ZNG C;  1UEL A;  2KJH B;  3M3J A;  5AZG A;  3ZNI D;  3NS8 A;  2JF5 A;  1WE6 A;  4NPN A;  2R2Q A;  5LLI A;  2NBV B;  3RUL A;  2JT4 B;  2MP2 B;  2DEN B;  2KJ6 A;  3EC8 A;  4HPM B;  1JRU A;  1YQB A;  2ZVN A;  3QHT A;  4LDT D;  1M94 A;  3L17 A;  4HXD A;  2HJ8 A;  5JHB A;  4IW0 A;  4K1R B;  2IBI B;  5DPR A;  3U8Z A;  1A5R A;  2DZJ A;  1V9J A;  2KD0 A;  3AU4 A;  3PLU A;  2JWZ A;  1WIA A;  3JSV A;  3PT2 B;  4B95 A;  4K7U A;  1UZX B;  1I35 A;  3QA8 A;  3BY4 B;  1WXM A;  2PE9 A;  2PEA A;  2DAJ A;  4BBN F;  3ML9 A;  3B1L X;  2AL3 A;  2MW5 A;  4DXA B;  2GOW A;  3A1Q B;  2BKF A;  4GDL B;  1WJ4 A;  2N9P C;  1C3T A;  3RUI B;  5DCN A;  1E8Z A;  1V80 A;  2LXA A;  1P1A A;  1IYF A;  1V49 A;  1WX7 A;  3DVG Y;  4HPL B;  4RM9 A;  3PPA A;  4PS3 A;  2DZK A;  2GBR A;  2AL6 A;  3JW0 X;  3VTV A;  4M0W B;  3PRE A;  2BWF A;  3APF A;  2BYF A;  3A33 B;  2N4F A;  4ZYN A;  5AEK B;  5IA7 A;  3RT3 B;  3M62 B;  4II3 B;  4LDT B;  3L10 B;  3QAQ A;  4FAD A;  2JRI B;  5AZF A;  2J0M A;  3H7P A;  3V60 A;  2MBQ A;  4AP4 C;  5KHO A;  2XEW A;  3JVZ X;  3NOB A;  3RCZ A;  3WAO A;  2NVU I;  5L95 C;  3CST A;  2IY0 B;  2O2V B;  4HJK A;  4OVU A;  3SU8 X;  1E90 A;  3VXW A;  3IFW B;  4FJV B;  2D10 A;  4ANV A;  2A4Z A;  2DZM A;  5D2M B;  4TQ1 A;  2QHO A;  2G3Q B;  1WJU A;  5E6O A;  3TIX A;  1E5W A;  4X57 B;  4TKN A;  1OEY J;  2BGF A;  1KJT A;  3W1S C;  4E71 A;  4K7W A;  1SIF A;  1WMH A;  4GGQ A;  3L13 A;  3OJ3 A;  3V6C B;  3AXC A;  1L7Y A;  2NCN A;  4J6I A;  1YJ1 A;  2KTR A;  5G2N A;  4IUM B;  1WH3 A;  5CHV C;  3A1Q A;  1VD2 A;  1LM8 B;  4P7I A;  1I42 A;  2KFK B;  2CS4 A;  3ZDT A;  4EZJ A;  1WGR A;  4MGK E;  1RFA A;  1WI0 A;  3ZVV A;  5TR5 A;  4K7S A;  4DBG A;  4EUT A;  4F8C B;  2FCN A;  2L0T A;  3ZRC A;  4JQW C;  3VUY A;  4WWP A;  3DCG A;  2KC1 A;  4YL8 A;  4KZC A;  5LXI B;  3N3K B;  2BF8 B;  2GBM A;  1TZ1 A;  1E8Y A;  4BVU C;  2KN5 A;  2JRH A;  2WYQ A;  5CX3 A;  3K9O B;  2C7N B;  2REX A;  4TV3 A;  4GIV A;  2R2O A;  4ANX A;  2MRP A;  1ZW7 A;  1NDD A;  1K8R B;  2KFJ A;  2FAZ A;  2KZR A;  2O2V A;  3DDC B;  3DQV A;  4M8M A;  2AYO B;  2KWV B;  1FXT B;  1J19 A;  4GDK A;  2I1J A;  2GBN A;  4LCD E;  4G0N B;  3L08 A;  1V5O A;  4MJS B;  1EUV B;  3PHX B;  2L05 A;  4DHZ E;  3PHW B;  2C7M B;  2HE7 A;  3R66 C;  3H1U A;  3L54 A;  3PS6 A;  1ZGU B;  2LVP A;  4PS8 A;  3C0R B;  4HWI B;  3RD2 A;  3WAL A;  2AEH A;  4XC2 A;  4F1S A;  2B3A A;  5AZH A;  4E74 A;  1UBI A;  2Y5B B;  1E7V A;  3NHE B;  1KLV A;  4W9I A;  2K8H A;  5HKH A;  3BIN A;  4BKG A;  4NJ6 A;  1BT0 A;  3GOE A;  5CHW A;  1ZKH A;  3TMP B;  1Q5W B;  3U7D A;  2FCS A;  3VDZ A;  4BBN C;  2LD9 A;  2A5U A;  2KFK A;  1GNU A;  3DBS A;  4HK2 A;  5C23 A;  1WR6 E;  5G55 A;  3KW5 B;  3H7S A;  1WYW B;  3TJP A;  3T8M A;  3H9D A;  3N30 A;  4AOF A;  3DVN V;  2NS5 A;  2M8S A;  5LXH A;  3ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...