4ICUA

Ubiquitin-like domain of human tubulin folding cofactor e - crystal from a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
QLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin-specific chaperone E
publication title The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 24
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4icuA00
5GMVA 3L08A 4NAWB 4TKNA 4W9EA 2HE7A 4II2B 4ZYNA 3A4RA 2JZZA 1I42A 2QHOA 2NBWB 4NJ7A 2LXAA 4AOFA 5E6OA 2KLGA 1OEYA 2IY0B 2YLMA 1E7UA 5IA7A 2DAJA 4EZKA 3VAWA 4IC7B 2MRPA 4GSWA 4WJOA 4KVGB 3RT3B 4YL8A 2LRUA 5DCNA 5LXHA 2G4SA 4FBJB 3DBRI 1FXTB 3IFWB 4HPLB 2RSUA 3NZSA 4II3B 3KYCD 4MSQB 2CHZA 3X23A 2K6QA 4GOCA 2LVPA 2IBIB 5AZFA 1WX7A 3ONSA 2KJRA 1J8CA 1LFDA 3L0WB 4GN1A 5D7GA 2DZJA 4OVUA 1UBIA 4FLHA 1V81A 3P2BA 5G55A 1ZGUB 2BWFA 2JY6A 2FIDA 4KSKC 3VUWA 3GZNI 1OEYJ 3N3KB 4ICUA 1YD8U 4JL9A 1LQBA 1WXVA 3T8MA 3ZTDA 2Z0EB 2AL6A 1E7VA 2KHWB 1M94A 2KMAA 4GXBA 3QQ8B 1G6JA 1GUAB 4DHZE 3KUCB 1LXDA 4MH0E 3A9KB 2ZNVC 4MGIE 4LJPB 3DVGX 4JQWC 1UGMA 4DWFA 3I3TB 4IW0A 4M0WB 2LGXA 4WJQA 4EUTA 2JRHA 3JSVB 4NJ6A 2C60A 3PHWB 4IM0A 4PYUA 2DYMA 2GBNA 3EHVA 1WZ3A 4G50A 4ICVA 4AUQC 3C0RB 3V60A 4F7ZA 2L7RA 4I6PA 4I6NB 4K1RB 1I35A 3AU5A 4LDTD 2KN5A 4NAWA 2ZCBA 4EZLA 1E8ZA 2KTFA 3KH0A 3AULA 2A4ZA 2K6DB 3PS6A 1H8CA 2BPSA 1WE6A 3VUXA 2V4LA 2EMSA 1V49A 3W1SC 4A3OA 2LD9A 2KOXA 3VQIA 4DK5A 1Y8RC 2NCNA 2LI5A 1ISNA 4B9KA 4URKA 3K9PB 2K8BA 3CF6E 2L0TA 4FADA 3IBEA 4BOZB 4W9LA 2W9NA 3WAMA 2EMTA 2LUEA 2CS4A 2N9XA 2MW5A 2JWZA 2KO3A 2D11A 2IYDB 3WAOA 4EFOA 2G3QB 2M1MA 2XK5B 5L83A 3H7SA 4GU2A 3UF8A 1U4AA 2JVCA 1ZKHA 2KC1A 2BGFA 2JXXA 4DHZB 2N7EA 2YVCA 2GMIC 2GBKA 4FHJA 2IO0B 4F8CB 1IPGA 4WWNA 5E6NA 3T9LA 4GDKB 1V5OA 4AJYB 2C7MB 4LCDE 4GIVA 2CU1A 2MQJA 3A9KA 3VVWB 1J0GA 2L76A 2MBBB 4EEWA 5EDSA 3ZVVA 2JT4B 3HIZA 2B3AA 4JIOU 2K1FA 1NI2A 2WYQA 3JSVA 1A5RA 4CYEA 4G0NB 4MDKE 1EO6A 2I1KA 1R4MI 4ANXA 4FN2A 3M95A 1P9DU 3AI5A 2KD0A 2Z59B 2LGDA 3A9JB 1E5WA 4HLEA 3GOEA 2KDIA 2ZPYA 2PJHA 1UH6A 2N7DA 1KM7A 3KYDD 4IG7B 3WALA 5J2RA 4AP4C 4K7WA 4DHJB 2C7HA 3L13A 1WJ6A 4NY0A 4KZCA 4XZ4A 2KXJA 2KC2A 3V6EB 4MGZE 3PT2B 3QK0A 3QCAA 1YX6B 4G3XB 4CO7A 4IWPA 5D94A 1NDDA 3U7DA 3IG3A 1EUVB 5AEKB 2OOBB 1GC6A 1PQSA 2GOWA 1C1YB 2MBHA 2O2VB 3VTVA 1KOTA 2NPTB 4GMVA 2REXA 5LXIB 1GNUA 2KDBA 1WY8A 1WGDA 2MBOA 4EZJA 3RZFA 2XK5A 2MP2B 3OJ3A 4JGHB 4GDLA 3CSFA 1WXMA 4E74A 4DDGD 4FJYA 2JRIB 3R7QA 3Q3FA 3QWZB 3RD2A 2D2QA 4GDKA 3W1SA 3R7RA 1X1MA 2GBMA 2LGYA 2MCNB 4PS3A 3DVNU 3O65B 1Z5SB 2DX5B 4KSLC 4TQ1A 3PSEB 3H7PA 1IYFA 2FUHB 4BBNC 5E6PA 1SIFA 2LVOA 3UIPB 2MBQA 3NOBA 5DPWA 4F1SA 3VH4B 2J0MA 2J0KA 4RM9A 1RFAA 2DAFA 4K7SA 3A1QA 3ZNGC 2MLBA 2PEAA 3SDLC 1BT0A 3KVFB 4WJNA 2I1JA 1GC7A 3KUDB 3A9JA 1WX9A 3JVZX 4BOSC 2KWCA 1WJNA 3ZDTA 2WWZA 4NQKE 4FJVB 5AZHA 4EKUA 2DZMA 3M62B 3PRPB 4KZ0A 4XC2A 3HM6X 2JF5A 3ZKJC 3QC8B 5JH5C 4BFRA 1WF9A 1NBFC 4MGKE 3RCZA 4MJSB 2K25A 1P0RA 3QX1A 2KFKB 2ZVNA 2EKEC 1P3QU 3VH3B 3D32A 1UD7A 3SD5A 3OLMD 4A20A 4DHJD 3ZNZB 2N9EB 3AXCA 2CHWA 3ML8A 3EECA 5CHWA 3ZW3A 2M17A 5JHAA 2BKRB 2O2VA 3MHSD 4GGQA 2BKFA 3PREA 3VUYA 3NS8A 3DOWA 2KJHB 1MG8A 4HCPB 4W9IA 1WGHA 1WMHB 1R4NI 2K8CA 2MP2A 1S1QB 3H6NA 3V6CB 4AJWA 3HHMA 4G11A 1V2YA 4J6IA 1Q0WB 4BKGA 3DVGY 3ZRFA 3KW5B 5D6JB 3MJWA 2GBJA 3VFKA 4OVVA 3PZDA 3UIOB 1YX5B 2M4NA 2NVUI 3W1YA 1WGGA 3H9DA 2M0XA 5FR6A 2ZZPB 3ZNID 3TMPB 4DXAB 1VD2A 4KV2A 4W9CA 3ZIMA 3UINB 4IUMB 2CR5A 2LZ6A 2GBRA 4GB9A 1OQYA 2LVQA 2NBUA 2KDEB 2BF8B 2KWVB 4HVBA 3SHQA 2ZJDA 2D3GA 2DYBA 3M3JA 4KDLB 4AWJA 3L17A 3R3MA 1OTRB 1TGZB 2ZVOA 3BINA 3UQBA 2FCNA 4N9F4 5KHOA 3PLUA 2CKHB 2KTRB 3U30A 1QZEA 1WIAA 1WR1A 3WIMA 1E8WA 2PPHA 1E90A 4CHKA 4HK2A 1V6EA 2N1WA 4W9GA 2LRWA 1Z2MA 4W9FA 2KFKA 5DPSA 3Q3JA 4ANUA 2L00B 3ML9A 3OAWA 4HDQA 4KDIC 4HPMB 1SE9A 1HE8A 2V3SA 4TUUA 4MELA 4WAAA 2DYOA 2DZKA 2L05A 3ALBA 5CHFA 2K39A 3DPDA 3A33B 3X0WA 1RRBA 4RMAA 2KQSA 1V9JA 3DBLI 3ZO5B 3DBHI 2ASQA 2DZIA 2IO2B 2RPQA 3RZWC 1WMHA 2C7NB 2MWSB 1TBEA 2L3ZA 3B1LX 4B6WA 4ZRKA 1WR6E 4FJZA 1V5TA 1F9JA 1KLVA 1XT9B 3ZDMC 2IY1B 3ZTCA 3QARA 4NNJB 2KWUB 2NR2A 3PLVA 1WYWB 1LM8B 2G4DB 4B95A 1EF5A 2WDTB 2D07B 3JYUA 1RLFA 4LJOB 5C1ZA 1XD3B 2ZCCA 2XBBC 1WZ0A 2IO3B 2KZRA 3QHTA 1TZ1A 1WXSA 1WJ4A 2FCSA 4JLCA 4HJKA 5J18A 4IM3A 3DDCB 4WWPA 4K81A 1D3ZA 4A3PA 2PE9A 2MBEA 1WH3A 3NHEB 2Y5BB 1WGYA 4KIKB 4M8NA 1WFYA 2KX3A 4MM3A 4RM8A 3L16A 4TV3A 3VXWA 4MSMB 4HDOA 2K8HA 2KX0A 3ZUNA 2AYOB 4W9DA 3RUIB 1WGRA 4MGYE 1EF1A 2BWES 2XEWA 5CTRC 2KTRA 3TL5A 4WQOB 4FA6A 5HKHA 2KFJA 2FNJB 2O6VB 1TTNA 1AARA 2KQ7A 3QAQA 1UZXB 3KUZA 3PPAA 1WE7A 4ZRJA 2C5LC 1WRDB 2KJ6A 4PS8A 2KK8A 5CX3A 4E71A 2L8JA 4WJPA 4FHKA 2ZEQA 2J0JA 3M63B 4PS7A 3QA8A 2MX2A 3EC8A 4BVUC 2BYEA 2KLCA 2ZPNA 1WXAA 5DPRA 5JZEB 3IVFA 2LASA 3WAPA 2R2QA 3MTNB 3VDZA 4NQLB 4EOYA 4ANVA 4FULA 1IP9A 3LDZE 3VTWA 4IWQA 3DQVA 1P98A 4PYZA 3WANA 2N4FA 2KNBA 1SGHA 3RULA 1Q5WB 1ZW7A 2RGFA 3VHTC 3ZNHB 1T0YA 3WA0A 2NPTA 2WX0A 1UBQA 2KMCA 3A4SC 3TJPA 3PTFC 2FCMA 5LLIA 2D10A 2BYVE 2CHXA 4IWOA 4BKTA 4TQ0A 1Q1OA 2AL3A 3SU8X 2N1VA 4DBGA 1YJ1A 4ZDVA 1H4RA 2G45B 2L0FA 3ECIA 3PRZA 1K8RB 4XX5A 1GG3A 3BY4B 2A5UA 2UWQA 2HJ8A 5C23A 3S2AA 4ANWA 4W9JA 3ENEA 2IO1B 3H1UA 4M8MA 2MA9B 2Z0DB 1WM2A 4KIKA 1V80A 4HCNB 5KHQA 3L54A 5D2MB 1GJZA 2UYZB 2V1YA 5CHVC 2BYFA 2RD0A 3NZUA 2FAZA 3PGEA 1VCBA 3JW0X 1WI0A 1OGWA 2ZNVB 2R2OA 5BO4B 1S3SG 3HK0A 5J17A 5IAAC 3DCGA 2O6VA 4DDID 2LXCA 5TR5A 4HWIB 3ZLZA 3VTUA 2NBVB 3APFA 3CMMB 3CSTA 4IM2A 3EFUA 3R66C 2NS5A 4BKSA 1JRUA 3DVNV 3IHPC 3QIJA 2O6VD 3V62A 4GDLB 2LJ5A 4MEMA 4HXDA 2FIFA 5L95C 4BKSD 3PVLA 5G2NA 4MJSA 4ASWC 1WM3A 1YQBA 3PHXB 1KJTA 1P1AA 2AWTA 1E8XA 1WJUA 5JHBA 2J7QB 1L7YA 3UQAA 1CMXB 4BBNF 5AZGA 1RAXA 3B08A 3B0AA 3H7PB 1YIWA 3TIXA 4X57B 3PV1A 2MSED 1J19A 2RR9A 3N30A 3TCAA 1C3TA 2KDFB 2FCQA 3HM3A 3N32A 1L2NA 2HTHA 1V86A 2KKCA 4P7IA 3A1QB 4NPNA 3V61A 3LJ3A 2HD5B 2JUOA 2WX1A 4E3CA 5DPTA 3ZRCA 2KANA 2JPHA 3U8ZA 2PE6B 3APDA 3QJZA 2N9PC 2OJRA 1E8YA 4W9HA 4ZRIA 3NY5A 1UELA 4LDTB 2M8SA 4K7UA 3RYTA 2DENB 3APCA 3AU4A 4WWOA 1XQQA 2JZ3B 1WX8A 3K9OB 3UGBB 2C9WB 2VRRB 3PRMB 2LWPA 2AEHA 2IZVB 3L10B 4I6LB 3TBLD 4W9KA 2DHZA 3DBSA 3OJ4B 2KVRA
chains in the Genus database with same CATH superfamily
4NAWB 2HE7A 4II2B 4ZYNA 2JZZA 1F77A 3U52E 4NJ7A 2V0GA 2KLGA 2IY0B 5EE0A 5IA7A 4EZKA 1VZ7A 4KKJA 2ZW0A 2WXFA 4KVGB 1MPEA 4YL8A 5EE9A 3RT3B 4XGAB 2D5GA 1FXTB 3IFWB 4HPLB 3LXFA 2CHZA 3CWIA 1BXTA 5AZFA 1J8CA 3RNAC 3L0WB 4GN1A 2DZJA 4FLHA 1V81A 1GAQB 3CIRB 1ZGUB 2BWFA 2FIDA 3TEXA 4ICUA 4JL9A 1LQBA 1WXVA 2WGSA 1G6JA 2AL6A 1E7VA 1MFWA 4LJPB 3DVGX 4DWFA 3I3TB 1C77A 4M0WB 5IKCM 2C60A 4IM0A 3J9CA 1GOZA 4HEA1 2BW2A 3BYTB 4FXCA 1ZXHA 1PGXA 1I35A 2WXPA 4LLGM 1YQ4B 3DWGC 1WWTA 4NZLB 1I4RA 3URYA 2WXQA 2WU2B 4JE3B 4DK5A 2BBCA 3V05A 3CF6E 4RF0A 1L5PA 4YT0B 3WAOA 2ICIA 3H7SA 3UF8A 1ZKHA 1KH0A 3HUIA 2JXXA 2N7EA 1JW9D 3ZJUA 2IO0B 1FFUA 2W82A 3T9LA 4XE0A 3RPFC 2CU1A 2MQJA 1FCLA 3A9KA 2L76A 4EEWA 5EDSA 1GB1A 1T0SC 2WHIA 2LHDA 4OHJA 1P9DU 3AI5A 3AE1B 4JWSC 1E5WA 2W3SA 1KM7A 3WALA 5J2RA 4K7WA 4DHJB 2C7HA 3MC0B 4XZ4A 3T3OA 3QK0A 1TY0A 4IWPA 3U7DA 1EUVB 2QCZA 1XLOA 1QOAA 5AEKB 1VDVA 4RH6A 1PQSA 2GOWA 2O2VB 1KOTA 2SAKA 1WY8A 2E6XA 4GDLA 3W5UB 1JCKB 3CSFA 5E6JA 4K3CA 3EA6A 1TS4A 4ZHOA 2GBMA 5GXGB 4PS3A 3O65B 2DX5B 4KSLC 5FKAC 1IYFA 3I63C 2XNAC 2LVOA 1GPXA 1TY2A 2J0MA 4K7SA 1K53A 2MLBA 1C79A 4C00A 1EU4A 1GC7A 2I1JA 1MHHE 3SEBA 4XC2A 2JF5A 2G1EA 1WF9A 4MJSB 5BYSA 1P0RA 2INCC 2EKEC 1EWYC 1NEKB 1QKZA 2H88B 2N9EB 2R61A 3ML8A 3EECA 2GRIA 3VUYA 2BKFA 5BYQA 3N1XC 4DXFA 2KJHB 1WGHA 1WMHB 1L0YB 1S1QB 2WP9B 4J6IA 4WAFA 3DBRB 3MJWA 2M4NA 1FXAA 2PKOA 3H9DA 2KQ4X 1ZDVA 3ZNID 2J4XA 1ZOYB 1LO5D 2QILA 4HVBA 2LVQA 2KDEB 2BF8B 3SHQA 3GZNB 1YOVB 4M02A 1OTRB 1TGZB 3UQBA 4C56C 4N9F4 5KHOA 2JQRB 2CKHB 3U30A 1QZEA 3DHIC 1E90A 1DOYA 2D3BA 2IGHA 4HK2A 1FM0D 2CJOA 2N1WA 3C8YA 2KFKA 1ESFA 4HDQA 3P4PB 2ACZB 4MELA 1FD6A 4LNFA 3DPDA 3P63A 3AE4B 1Q10A 3LB8C 3N20C 2DZIA 3RZWC 2RPQA 2MWSB 3B1LX 3MC9A 4FJZA 1F9JA 1TIFA 2QC8A 3ZDMC 2KACA 1RM6C 4B95A 2WDTB 3RNGC 2ZCCA 2XBBC 1TZ1A 4RFBA 4P6VF 2PE9A 2MBEA 3NHEB 4LNNA 2KX3A 3VXWA 4MSMB 2K8HA 2KX0A 3ZUNA 2AYOB 3RUIB 1EF1A 2XEWA 1XXGA 1I4QA 4OVZA 2O6VB 3DWMA 1V1PA 1T3QA 1TKYA 1WE7A 3PPAA 1R4MB 4HKQA 3U4EG 2CJNA 2WXKA 2J0JA 3KWVA 3N9YC 4BVUC 1JROA 3IVFA 4ZHPA 3WAPA 3VDZA 4EOYA 2N9LA 3AE7B 1IP9A 3LDZE 2EELA 1P98A 5T8IA 4PYZA 3WANA 1Q5WB 1F2RI 2RGFA 4ARCA 1ZDXA 2D10A 2CHXA 4BKTA 4TQ0A 2WDQB 4JPSA 2N1VA 3PRZA 4XX5A 2UWQA 3RFZB 4ANWA 1ZUD2 3ENEA 2M56B 4M8MA 2MA9B 1WM2A 4KIKA 2BS2B 3L54A 2UYZB 2V1YA 3AB5A 2XN9C 1VCBA 3O13A 2K5PA 1WI0A 3AEDB 1S3SG 2PTLA 3HK0A 4DDID 4AS1A 5TR5A 3ZLZA 2VZKB 1N60A 4RGOS 4P16A 3V62A 4GDLB 3AEFB 4MEMA 2FIFA 4A90A 1WM3A 1YQBA 3PHXB 1KJTA 1L7YA 1N61A 3UQAA 1YIWA 3TIXA 4X57B 1NYQA 3AE5B 2VH1A 2FCQA 3HM3A 3N32A 2KKCA 3LJ3A 2W54A 3EGRA 3MHZA 1OQRA 4ZRIA 3NY5A 3GS2A 2M0AA 3DHGC 3APCA 1XQQA 2JZ3B 3UGBB 1JWSD 2LWPA 2IZVB 3L10B 4I6LB 3TBLD 2N0SB 3SFEB 4A8XC 2KVRA 1SE3A 4WQMA 2B76B 4B0MA 4W9EA 3A4RA 2WDVB 1VRAB 4US9A 1I42A 2PMVA 2QHOA 2NBWB 3H8HA 1L6VA 4AOFA 5E6OA 1PYWD 1TT5B 2DAJA 4IC7B 1AW7A 4MT5A 4WJOA 1ZP0B 1J7CA 3MFGA 5LXHA 2LRUA 5DCNA 2G4SA 2RSUA 2BB5A 4II3B 4Q2JA 2K6QA 2IBIB 1WX7A 3ONSA 1BUIC 1LFDA 1FO4A 4OVUA 3P2BA 2X8XX 1SIJA 1OEYJ 2KHWB 2KT7A 3MC8A 3QQ8B 1HA5A 2YEPB 1UNSA 4MH0E 2ZNVC 2WXLA 1F1HA 1UGMA 4EUTA 3JSVB 3I57A 4PYUA 1P7EA 2GBNA 3EHVA 2LUMA 4AUQC 3C0RB 4F7ZA 2L7RA 4I6PA 3Q3MC 2BTEA 3AU5A 3NVWA 2KN5A 2ZCBA 1E8ZA 3TEYA 3PS6A 1H8CA 2BPSA 1P7FA 1L0VB 2LD9A 2KOXA 3VQIA 1FNWA 1C4CA 1ACCA 2LI5A 1ISNA 4B9KA 3K9PB 3P4SB 2WU5B 1YN4A 3IBEA 4YWGG 3WAMA 3N1ZC 2LUEA 3Q69A 5L83A 2G3QB 2M1MA 2BYTA 1U4AA 2JVCA 4TMAB 2JYTA 1IBXA 1IPGA 4WWNA 4GDKB 4AJYB 2C7MB 1TS5A 5H92C 5HHDG 1J0GA 2JT4B 3HIZA 2TSSA 2B3AA 4JIOU 4G0NB 1SE2A 2I1KA 1V1PB 3A9JB 2Y3AA 2RMMA 2WXNA 2FBWB 1WGKA 2HJ1A 1FNVA 1VZ6A 3L13A 5BMGA 2KXJA 1VJKA 1T5XD 4G3XB 3BVZA 1NDDA 3IG3A 1JWMD 1C1YB 2KDBA 1JWBD 4YTPB 4EZJA 2XK5A 1F52A 3NG0A 1WXMA 3W2DA 4FJYA 2WS3B 3Q3FA 3QWZB 2D2QA 3W1SA 4KKIA 3R7RA 1TJEA 1LGRA 1Z5SB 2N7JA 4TQ1A 4ZRQA 3Q8BA 1WYGA 5E6PA 1SIFA 5LNK1 2KDMA 4M00A 3NOBA 1ENFA 4HROA 3VH4B 4F1SA 1N63A 4RM9A 3ZNGC 3KUDB 3JVZX 3DBLB 2BB6A 4FJVB 4EKUA 2WXIA 2DZMA 4KZ0A 5BYRA 1UUPA 4BFRA 1RWSA 2WLBA 3NUHB 2ZVNA 1P3QU 3AXCA 2L52A 3RNFC 5CHWA 1MVKA 2M17A 5D3DA 3OWEB 3VR8B 5AUKA 3DOWA 4W9IA 4IOIE 1R4NI 2K8CA 2MP2A 2OEDA 2GB1A 1D5ZC 1D5XC 1Q0WB 3BYYB 3DVGY 5BMHA 3KW5B 5D6JB 3KLSX 2J42A 3PZDA 3W1YA 1WGGA 4C7ZA 3TMPB 5IO9A 2Q5WD 3ZIMA 4GLSC 4IUMB 2CR5A 1J7AA 1QOBA 1OQYA 1CQVA 2INPE 2FUG1 3M3JA 4KDLB 3R3MA 2KTRB 1JRPA 1KRHA 1WIAA 1SJHD 1KLUD 3P4RB 4S0RA 4CHKA 4CQNA 1FMAD 3ETRA 1SJED 2LRWA 4N59A 3Q3JA 2BS3B 3NJTA 1HE8A 3ZJTA 2DZKA 4OZAA 2K39A 2HDEA 3X0WA 3RNCC 4LTUA 4WIPA 4RMAA 2KQSA 3DBLI 1YNTE 2ASQA 2GI9A 2WXOA 1TBEA 4B6WA 2INNE 1WR6E 1V5TA 1AYFA 3PO0A 1WYWB 1EF5A 1XCTL 2D07B 4LJOB 1QT9A 4ARIA 1XD3B 2RPVA 2KZRA 4K3BA 2L1AA 2FCSA 1WJ4A 4JLCA 3KQ4A 3Q8EA 1WGYA 4MM3A 3L16A 2RDGA 4WQOB 4MACA 1TTNA 1ROEA 4XWTA 3ZXVA 3QAQA 1C9FA 4ZRJA 5CX3A 2ZEQA 3EFCA 3QA8A 3EC8A 3AV8A 1WSPA 5JZEB 1IBXB 2PW9A 3MTNB 4NQLB 4EE2A 4IDIA 1PGBA 3DQVA 3R2IA 2N4FA 4S17A 1ZW7A 3VHTC 1JQ4A 2QIEB 2NPTA 1UBQA 1YN3A 3TJPA 2FCMA 5LLIA 4L1BA 1KLGD 1Q1OA 2AL3A 2PVGC 1QF6A 2W3RA 4DBGA 4ZDVA 4XYCA 1K8RB 5IP4D 1GG3A 1JWUD 2Z0DB 5KHQA 1V80A 3B2FA 5D2MB 2NTTA 2RD0A 1TKGA 2FAZA 2LMCA 3PGEA 2CU3A 3ZYYX 1OGWA 2R2OA 3HVZA 5J17A 2YEPF 5IAAC 3ZQ4A 2J52A 4WWMA 3APFA 3AH7A 4XWWA 3EFUA 2NS5A 4YTNB 2ONQA 1B9RA 1FRRA 4HXDA 3PVLA 5G2NA 1QOGA 4LNKA 3TEWA 1VR9A 2X38A 1QQRA 4P1CC 2RDHA 3FKYA 1WJUA 4BBNF 2LGSA 3B08A 4M01A 2MSED 1J19A 3AEEB 1K52A 3B9JA 4P7IA 2HD5B 2JUOA 5DPTA 3U8ZA 2JPHA 2Z8LA 1K51A 1SE4A 2KMMA 2M8SA 4K7UA 2ZW1A 1WX8A 5FK9C 3OJ4B 1V1OA 5GMVA 3AN1A 2AQ3B 1OFFA 3ZGZA 1NENB 5HI1A 4RF1A 1E9MA 3Q14C 1E7PB 4GSWA 2EKIA 2IGDA 3AE8B 2AQ1B 2PLPA 3DBRI 4RGTA 1XLPA 3NZSA 2I2YA 4L2YA 1FFVA 4USAA 4YSXB 2V9HA 1XF5L 2WXRA 5D7GA 1UBIA 4DQOC 3AM9A 5G55A 2IGGA 2JY6A 2OHFA 2WNMA 4KSKC 3GZNI 1YD8U 3R8BA 3T8MA 3ZTDA 2KMAA 1M94A 4GXBA 1HXYD 4RCOA 3KUCB 1LXDA 3A9KB 4JQWC 3BZDB 1L6UA 4NJ6A 2D3AA 1YQ3B 1WZ3A 4ICVA 3GE3C 4DXGA 4LDTD 4NAWA 3KH0A 3AULA 2A4ZA 1WE6A 1I4GA 4A3OA 1TKEA 4XDCA 1Y8RC 2NCNA 3NZ3A 2IJ0A 3RNBC 2K8BA 1PDXA 4ACFA 4FADA 1IGDA 5C3JB 2EMTA 3NS1A 3P4QB 2JWZA 2KO3A 2D11A 2IYDB 4GU2A 3IT4B 3TEZA 2KC1A 3BIID 2BGFA 4DHZB 5JXVA 2YVCA 3IXSA 4F8CB 5E6NA 1AWDA 1V5OA 3Q8AA 4LCDE 4MM3B 3VVWB 1QILA 3VRAB 2AQ2B 4M0WA 2K1FA 1NI2A 2WYQA 1A5RA 1I7HA 2NTSA 4CYEA 4MDKE 1EO6A 1R4MI 4WURA 3DHHC 2MEKA 2LGDA 2WQYB 2ZPYA 5EE3A 2N7DA 1JALA 4AP4C 1NVID 1MI0A 3HRDD 3AEGB 3V6EB 3AE2B 3PT2B 1YX6B 4CO7A 5D94A 5G5GA 3NVZA 3AE3B 1GC6A 1E0ZA 2NPTB 5IOIA 4HRSA 5LXIB 1GNUA 2MBOA 1KFYB 3OJ3A 4JGHB 2DLBA 4MH8A 1XCQL 3R7QA 2LGYA 2PIAA 2MCNB 5I4DA 3H7PA 1HTOA 2FUHB 3AE6B 4BBNC 1ZPSA 2JYEA 1IUEA 1RFAA 3A1QA 2PEAA 2Y5PA 2JU6X 3DBHB 1WJNA 1NYRA 3ZDTA 2WWZA 4NQKE 4US8A 2JWUA 3M62B 3HM6X 2DBYA 3ZKJC 3QC8B 5JH5C 1NBFC 2LEKA 3RCZA 3VR9B 2RDBC 2K25A 3QX1A 2KFKB 1VZ8A 1UWMA 3VH3B 1UD7A 4A20A 2V3NA 1RYJA 3ZNZB 4DHJD 2W55A 2O2VA 4GGQA 3PREA 3NS8A 2KN4A 4JWUC 1MG8A 1SB3C 4YSYB 3HHMA 4G11A 3RNEC 4BKGA 3UI3A 1TZOA 1OQQA 1FPYA 3VFKA 3UIOB 3V3XA 1YX5B 5H8YE 2G9HD 4OZBA 3BK2A 2M0XA 5FR6A 4DXAB 2LFIA 2GBRA 1D5MC 3RN9C 4GB9A 2NBUA 5FR3A 2KWVB 2ZJDA 2DYBA 4AWJA 2ZVOA 2QEJC 2PVOD 1C76A 1T6BX 3E56A 1KF6B 1WR1A 3WIMA 4TSSA 2PPHA 3I9V1 1Z2MA 3WCQA 3AE9B 4ANUA 3ML9A 3OAWA 4KDIC 4HPMB 1SE9A 3KWLA 4ZRPA 1ET9A 2DWQA 2ON8A 4TUUA 4WAAA 2QMTA 2DYOA 3PZ8A 1FNUA 4OW0A 4PK1A 1RRBA 3HVDA 2J53A 1V9JA 3DBHI 1C78A 2IO2B 4J3OD 1WMHA 4PT5A 4ZRKA 4YTMB 1A70A 4BZAA 1SF0A 2IY1B 3ZTCA 4NNJB 2KWUB 3FILA 3PLVA 2G4DB 1LM8B 1RLFA 5C1ZA 2QDFA 1UF0A 1FCCC 1WXSA 3IAS1 5J18A 4WWPA 4KIKB 3MJ5A 2Y5BB 4M8NA 1WFYA 5AUIA 4RM8A 1WGRA 4OZCA 1YJIA 5CTRC 1L4DB 1ZXIA 4FA6A 2KFJA 2KQ7A 3KUZA 1WRDB 4PS8A 4N58A 2L8JA 4WJPA 5G5HA 2BYEA 3L4PA 5DPRA 2MH7A 2LASA 2R2QA 3ZXRA 1XO3A 4ANVA 4FULA 2BVCA 2I38A 3VTWA 4IWQA 4KGRA 3WA0A 2WX0A 2KWDA 3PTFC 4D2KA 3P42A 3SU8X 1XEEA 5HFYA 3BY4B 2A5UA 2INDC 5C23A 4W9JA 1HZ5A 2L32A 3H1UA 3Q3NC 4BAXA 1AN8A 1R7SA 2BYFA 1CK1A 3NZUA 4HPPA 5BO4B 1IGCA 3T3NA 2O6VA 2LXCA 4HWIB 3CMMB 3CSTA 4IM2A 3AMZA 1DOIA 4UDUC 3FC4A 3DVNV 3QIJA 2O6VD 4ASWC 1EU3A 5JHBA 1SSNA 2J7QB 1CMXB 1QOFA 3H7PB 2WXMA 4C7YA 3PV1A 2RR9A 1C3TA 1L2NA 2HTHA 3A1QB 4NPNA 3U7ZA 4A55A 4E3CA 3ZRCA 3QJZA 2PE6B 3APDA 1JMLA 2N9PC 2OJRA 1UELA 3RYTA 2BT6A 2DENB 4WWOA 2VH2A 2VRRB 3U2SC 2AEHA 3DBSA 5TSSA 2QSDA 4ITKA 3L08A 2LHEA 4TKNA 1RFKA 2DNFA 4REZA 4KGTA 4WH4A 2LXAA 2KYWA 1OEYA 2YLMA 1E7UA 3MP9A 3VAWA 4KX6B 1FEHA 2MRPA 1HZ6A 4FBJB 2OJWA 2MJ3A 2VZKD 3KYCD 4MSQB 3X23A 1YJJA 4GOCA 2LVPA 2KJRA 4XDDA 1YN5A 1J7BA 1I4PA 3VUWA 3N3KB 3W5VB 2Z0EB 1GUAB 4DHZE 1CJEA 4MGIE 4LNIA 3I5JC 4IW0A 3AEBB 2LGXA 1N5WA 3PZ7A 4WJQA 2JRHA 3NVVA 1C4PA 3PHWB 4JX1C 2DYMA 4G50A 4R3DA 3V60A 3BVMA 4I6NB 4K1RB 4EZLA 2KTFA 1TYGB 2K6DB 1KTKA 3VUXA 1EWCA 5BMIA 2V4LA 2EMSA 1E6EB 1V49A 4HJGE 3W1SC 3TUOA 1N6ZA 3AEAB 4URKA 2L0TA 1UGJA 4BOZB 1XLNA 4W9LA 2W9NA 4RNAA 1F2RC 2CS4A 2N9XA 2MW5A 4LNOA 3FILB 4EFOA 2XK5B 1FXIA 2MHJA 1T0QC 1L0XB 3N1YC 2GMIC 2GBKA 4FHJA 2GLSA 2FE8A 3BK1A 4GIVA 3VRBB 2MBBB 3ZVVA 3JSVA 4P1BC 4ANXA 4FN2A 3M95A 2WXHA 2KD0A 4C80A 2V4IB 2Z59B 4HLEA 3GOEA 4L23A 2K9XA 2KDIA 2PJHA 4YSZB 1UH6A 1MJDA 3R2TA 3KYDD 4IG7B 4N6EB 2LJIA 2D3CA 1DGJA 1D6EC 1SBBB 1WJ6A 4NY0A 4KZCA 2KC2A 4MGZE 3QCAA 2K22A 2JX5A 1STEA 3AECB 1DOXA 2OOBB 1N62A 2MBHA 3VTVA 4GMVA 2IDYA 2REXA 2SEBD 1WGDA 2E3TA 3RZFA 4AQ7A 2MP2B 5IN7A 2MJEA 4E74A 4DDGD 1GB4A 1EM7A 2JRIB 3RD2A 1WRIA 4GDKA 1X1MA 1UWXA 3DVNU 3PSEB 3UIPB 2MBQA 5DPWA 2J0KA 1PGAA 1T0RC 2DAFA 1V8CA 3SDLC 5EE1A 1BT0A 3KVFB 4WJNA 1Y56A 3A9JA 1WX9A 2MJDA 1ET6A 4BOSC 2KWCA 3SFDB 5AZHA 3PRPB 4O1NA 4C4VA 2N9KA 3EUB2 2WDRB 4MGKE 3NRZA 2M19A 3D32A 3SD5A 3OLMD 2CHWA 3ZW3A 1NI3A 2L83A 5JHAA 2BKRB 3MHSD 1F0ZA 3Q6BA 4HCPB 3H6NA 3FAHA 3V6CB 4AJWA 1V2YA 1WXQA 1YMHE 3ZRFA 4LK0M 2JZPA 2GBJA 4OVVA 4HKZE 2NVUI 2IPKD 2BS4B 2ZZPB 1ZE3D 2KVZA 1V97A 1VD2A 4KV2A 4W9CA 3UINB 4RGNA 1PUTA 1FRDA 2LZ6A 3SR6A 2D3GA 3W9CB 3BWUD 4NJCA 3L17A 3BINA 2FCNA 3PLUA 3OG5A 1E8WA 4A9AA 1V6EA 1HTQA 4W9GA 4W9FA 5DPSA 3IAM1 3Q8CA 2L00B 2V3SA 2V3PA 2LGIA 4YXDB 5CHFA 2L05A 3ALBA 3A33B 2KAJA 3ZO5B 4RGMA 2C7NB 3BVGA 2HTME 2L3ZA 5MPOA 1XLQA 2K3UA 1D4BA 1VLBA 1KLVA 1XT9B 2H89B 3QARA 4NAMA 2NR2A 3JYUA 1I4XA 1WZ0A 2IO3B 3QHTA 1MHXA 1L4ZB 3B2GA 4HJKA 2WXJA 4IM3A 3DDCB 4B0EA 4K81A 1D3ZA 4A3PA 1MG4A 1WH3A 3ZJVA 4TV3A 4HDOA 1DYQA 3GP7A 4W9DA 4MGYE 2BWES 3TL5A 2KTRA 5HKHA 2FNJB 1AARA 1UZXB 2C5LC 2KJ6A 2AX5A 2KK8A 4E71A 4FHKA 3M63B 3Q3OC 4PS7A 2MX2A 2KLCA 2ZPNA 1WXAA 4ZYSA 4IKGA 2UU7A 1FIQA 3NVYA 3GB1A 2NMQA 4ZOHC 4A6QA 2KNBA 1SGHA 3RULA 5D3IB 1CZPA 3ZNHB 1C4AA 1T0YA 2KMCA 1E10A 1HEZE 1PFDA 3A4SC 3Q8FA 2BYVE 5HG2A 4IWOA 2JSVX 1YJ1A 2Y5CA 1H4RA 2G45B 2L0FA 3ECIA 2HJ8A 3Q2AC 3S2AA 1I4HA 2IO1B 3RMKC 2K0PA 1BMLC 4HCNB 3P1MA 1GJZA 5CHVC 1SXTA 3IT6B 3JW0X 2ZNVB 3DCGA 1M4VA 2QJLA 3E9SA 3VTUA 2NBVB 3R66C 3C19A 4QAYA 4BKSA 2JXTA 1TS3A 1JRUA 1QLBB 3IHPC 2LJ5A 5C2TB 1TS2A 5L95C 4BKSD 4MJSA 1SEBD 1HQRD 1P1AA 2AWTA 1E8XA 1N5XA 3ABVB 1JWAD 5AZGA 1RAXA 3B0AA 3TCAA 3N30A 4H2AA 2BQQA 2KDFB 1B1ZA 3GE8C 1V86A 3LYYA 3V61A 1K50A 2WX1A 2KANA 3TSSA 4KGSA 4W9HA 1E8YA 4LDTB 3RI7C 1R4NB 3AU4A 2WXGA 4C4VB 3K9OB 2C9WB 3PRMB 4W9KA 2DHZA
chains in the Genus database with same CATH topology
5GMVA 3L08A 4NAWB 4TKNA 4W9EA 2HE7A 4II2B 4ZYNA 3A4RA 2JZZA 1I42A 2QHOA 2NBWB 4NJ7A 2LXAA 4AOFA 5E6OA 2KLGA 1OEYA 2IY0B 2YLMA 1E7UA 5IA7A 2DAJA 4EZKA 3VAWA 4IC7B 2MRPA 4GSWA 4WJOA 4KVGB 3RT3B 4YL8A 2LRUA 5DCNA 5LXHA 2G4SA 4FBJB 3DBRI 1FXTB 3IFWB 4HPLB 2RSUA 3NZSA 4II3B 3KYCD 4MSQB 2CHZA 3X23A 2K6QA 4GOCA 2LVPA 2IBIB 5AZFA 1WX7A 3ONSA 2KJRA 1J8CA 1LFDA 3L0WB 4GN1A 5D7GA 2DZJA 4OVUA 1UBIA 4FLHA 1V81A 3P2BA 5G55A 1ZGUB 2BWFA 2JY6A 2FIDA 4KSKC 3VUWA 3GZNI 1OEYJ 3N3KB 4ICUA 1YD8U 4JL9A 1LQBA 1WXVA 3T8MA 3ZTDA 2Z0EB 2AL6A 1E7VA 2KHWB 1M94A 2KMAA 4GXBA 3QQ8B 1G6JA 1GUAB 4DHZE 3KUCB 1LXDA 4MH0E 3A9KB 2ZNVC 4MGIE 4LJPB 3DVGX 4JQWC 1UGMA 4DWFA 3I3TB 4IW0A 4M0WB 2LGXA 4WJQA 4EUTA 2JRHA 3JSVB 4NJ6A 2C60A 3PHWB 4IM0A 4PYUA 2DYMA 2GBNA 3EHVA 1WZ3A 4G50A 4ICVA 4AUQC 3C0RB 3V60A 4F7ZA 2L7RA 4I6PA 4I6NB 4K1RB 1I35A 3AU5A 4LDTD 2KN5A 4NAWA 2ZCBA 4EZLA 1E8ZA 2KTFA 3KH0A 3AULA 2A4ZA 2K6DB 3PS6A 1H8CA 2BPSA 1WE6A 3VUXA 2V4LA 2EMSA 1V49A 3W1SC 4A3OA 2LD9A 2KOXA 3VQIA 4DK5A 1Y8RC 2NCNA 2LI5A 1ISNA 4B9KA 4URKA 3K9PB 2K8BA 3CF6E 2L0TA 4FADA 3IBEA 4BOZB 4W9LA 2W9NA 3WAMA 2EMTA 2LUEA 2CS4A 2N9XA 2MW5A 2JWZA 2KO3A 2D11A 2IYDB 3WAOA 4EFOA 2G3QB 2M1MA 2XK5B 5L83A 3H7SA 4GU2A 3UF8A 1U4AA 2JVCA 1ZKHA 2KC1A 2BGFA 2JXXA 4DHZB 2N7EA 2YVCA 2GMIC 2GBKA 4FHJA 2IO0B 4F8CB 1IPGA 4WWNA 5E6NA 3T9LA 4GDKB 1V5OA 4AJYB 2C7MB 4LCDE 4GIVA 2CU1A 2MQJA 3A9KA 3VVWB 1J0GA 2L76A 2MBBB 4EEWA 5EDSA 3ZVVA 2JT4B 3HIZA 2B3AA 4JIOU 2K1FA 1NI2A 2WYQA 3JSVA 1A5RA 4CYEA 4G0NB 4MDKE 1EO6A 2I1KA 1R4MI 4ANXA 4FN2A 3M95A 1P9DU 3AI5A 2KD0A 2Z59B 2LGDA 3A9JB 1E5WA 4HLEA 3GOEA 2KDIA 2ZPYA 2PJHA 1UH6A 2N7DA 1KM7A 3KYDD 4IG7B 3WALA 5J2RA 4AP4C 4K7WA 4DHJB 2C7HA 3L13A 1WJ6A 4NY0A 4KZCA 4XZ4A 2KXJA 2KC2A 3V6EB 4MGZE 3PT2B 3QK0A 3QCAA 1YX6B 4G3XB 4CO7A 4IWPA 5D94A 1NDDA 3U7DA 3IG3A 1EUVB 5AEKB 2OOBB 1GC6A 1PQSA 2GOWA 1C1YB 2MBHA 2O2VB 3VTVA 1KOTA 2NPTB 4GMVA 2REXA 5LXIB 1GNUA 2KDBA 1WY8A 1WGDA 2MBOA 4EZJA 3RZFA 2XK5A 2MP2B 3OJ3A 4JGHB 4GDLA 3CSFA 1WXMA 4E74A 4DDGD 4FJYA 2JRIB 3R7QA 3Q3FA 3QWZB 3RD2A 2D2QA 4GDKA 3W1SA 3R7RA 1X1MA 2GBMA 2LGYA 2MCNB 4PS3A 3DVNU 3O65B 1Z5SB 2DX5B 4KSLC 4TQ1A 3PSEB 3H7PA 1IYFA 2FUHB 4BBNC 5E6PA 1SIFA 2LVOA 3UIPB 2MBQA 3NOBA 5DPWA 4F1SA 3VH4B 2J0MA 2J0KA 4RM9A 1RFAA 2DAFA 4K7SA 3A1QA 3ZNGC 2MLBA 2PEAA 3SDLC 1BT0A 3KVFB 4WJNA 2I1JA 1GC7A 3KUDB 3A9JA 1WX9A 3JVZX 4BOSC 2KWCA 1WJNA 3ZDTA 2WWZA 4NQKE 4FJVB 5AZHA 4EKUA 2DZMA 3M62B 3PRPB 4KZ0A 4XC2A 3HM6X 2JF5A 3ZKJC 3QC8B 5JH5C 4BFRA 1WF9A 1NBFC 4MGKE 3RCZA 4MJSB 2K25A 1P0RA 3QX1A 2KFKB 2ZVNA 2EKEC 1P3QU 3VH3B 3D32A 1UD7A 3SD5A 3OLMD 4A20A 4DHJD 3ZNZB 2N9EB 3AXCA 2CHWA 3ML8A 3EECA 5CHWA 3ZW3A 2M17A 5JHAA 2BKRB 2O2VA 3MHSD 4GGQA 2BKFA 3PREA 3VUYA 3NS8A 3DOWA 2KJHB 1MG8A 4HCPB 4W9IA 1WGHA 1WMHB 1R4NI 2K8CA 2MP2A 1S1QB 3H6NA 3V6CB 4AJWA 3HHMA 4G11A 1V2YA 4J6IA 1Q0WB 4BKGA 3DVGY 3ZRFA 3KW5B 5D6JB 3MJWA 2GBJA 3VFKA 4OVVA 3PZDA 3UIOB 1YX5B 2M4NA 2NVUI 3W1YA 1WGGA 3H9DA 2M0XA 5FR6A 2ZZPB 3ZNID 3TMPB 4DXAB 1VD2A 4KV2A 4W9CA 3ZIMA 3UINB 4IUMB 2CR5A 2LZ6A 2GBRA 4GB9A 1OQYA 2LVQA 2NBUA 2KDEB 2BF8B 2KWVB 4HVBA 3SHQA 2ZJDA 2D3GA 2DYBA 3M3JA 4KDLB 4AWJA 3L17A 3R3MA 1OTRB 1TGZB 2ZVOA 3BINA 3UQBA 2FCNA 4N9F4 5KHOA 3PLUA 2CKHB 2KTRB 3U30A 1QZEA 1WIAA 1WR1A 3WIMA 1E8WA 2PPHA 1E90A 4CHKA 4HK2A 1V6EA 2N1WA 4W9GA 2LRWA 1Z2MA 4W9FA 2KFKA 5DPSA 3Q3JA 4ANUA 2L00B 3ML9A 3OAWA 4HDQA 4KDIC 4HPMB 1SE9A 1HE8A 2V3SA 4TUUA 4MELA 4WAAA 2DYOA 2DZKA 2L05A 3ALBA 5CHFA 2K39A 3DPDA 3A33B 3X0WA 1RRBA 4RMAA 2KQSA 1V9JA 3DBLI 3ZO5B 3DBHI 2ASQA 2DZIA 2IO2B 2RPQA 3RZWC 1WMHA 2C7NB 2MWSB 1TBEA 2L3ZA 3B1LX 4B6WA 4ZRKA 1WR6E 4FJZA 1V5TA 1F9JA 1KLVA 1XT9B 3ZDMC 2IY1B 3ZTCA 3QARA 4NNJB 2KWUB 2NR2A 3PLVA 1WYWB 1LM8B 2G4DB 4B95A 1EF5A 2WDTB 2D07B 3JYUA 1RLFA 4LJOB 5C1ZA 1XD3B 2ZCCA 2XBBC 1WZ0A 2IO3B 2KZRA 3QHTA 1TZ1A 1WXSA 1WJ4A 2FCSA 4JLCA 4HJKA 5J18A 4IM3A 3DDCB 4WWPA 4K81A 1D3ZA 4A3PA 2PE9A 2MBEA 1WH3A 3NHEB 2Y5BB 1WGYA 4KIKB 4M8NA 1WFYA 2KX3A 4MM3A 4RM8A 3L16A 4TV3A 3VXWA 4MSMB 4HDOA 2K8HA 2KX0A 3ZUNA 2AYOB 4W9DA 3RUIB 1WGRA 4MGYE 1EF1A 2BWES 2XEWA 5CTRC 2KTRA 3TL5A 4WQOB 4FA6A 5HKHA 2KFJA 2FNJB 2O6VB 1TTNA 1AARA 2KQ7A 3QAQA 1UZXB 3KUZA 3PPAA 1WE7A 4ZRJA 2C5LC 1WRDB 2KJ6A 4PS8A 2KK8A 5CX3A 4E71A 2L8JA 4WJPA 4FHKA 2ZEQA 2J0JA 3M63B 4PS7A 3QA8A 2MX2A 3EC8A 4BVUC 2BYEA 2KLCA 2ZPNA 1WXAA 5DPRA 5JZEB 3IVFA 2LASA 3WAPA 2R2QA 3MTNB 3VDZA 4NQLB 4EOYA 4ANVA 4FULA 1IP9A 3LDZE 3VTWA 4IWQA 3DQVA 1P98A 4PYZA 3WANA 2N4FA 2KNBA 1SGHA 3RULA 1Q5WB 1ZW7A 2RGFA 3VHTC 3ZNHB 1T0YA 3WA0A 2NPTA 2WX0A 1UBQA 2KMCA 3A4SC 3TJPA 3PTFC 2FCMA 5LLIA 2D10A 2BYVE 2CHXA 4IWOA 4BKTA 4TQ0A 1Q1OA 2AL3A 3SU8X 2N1VA 4DBGA 1YJ1A 4ZDVA 1H4RA 2G45B 2L0FA 3ECIA 3PRZA 1K8RB 4XX5A 1GG3A 3BY4B 2A5UA 2UWQA 2HJ8A 5C23A 3S2AA 4ANWA 4W9JA 3ENEA 2IO1B 3H1UA 4M8MA 2MA9B 2Z0DB 1WM2A 4KIKA 1V80A 4HCNB 5KHQA 3L54A 5D2MB 1GJZA 2UYZB 2V1YA 5CHVC 2BYFA 2RD0A 3NZUA 2FAZA 3PGEA 1VCBA 3JW0X 1WI0A 1OGWA 2ZNVB 2R2OA 5BO4B 1S3SG 3HK0A 5J17A 5IAAC 3DCGA 2O6VA 4DDID 2LXCA 5TR5A 4HWIB 3ZLZA 3VTUA 2NBVB 3APFA 3CMMB 3CSTA 4IM2A 3EFUA 3R66C 2NS5A 4BKSA 1JRUA 3DVNV 3IHPC 3QIJA 2O6VD 3V62A 4GDLB 2LJ5A 4MEMA 4HXDA 2FIFA 5L95C 4BKSD 3PVLA 5G2NA 4MJSA 4ASWC 1WM3A 1YQBA 3PHXB 1KJTA 1P1AA 2AWTA 1E8XA 1WJUA 5JHBA 2J7QB 1L7YA 3UQAA 1CMXB 4BBNF 5AZGA 1RAXA 3B08A 3B0AA 3H7PB 1YIWA 3TIXA 4X57B 3PV1A 2MSED 1J19A 2RR9A 3N30A 3TCAA 1C3TA 2KDFB 2FCQA 3HM3A 3N32A 1L2NA 2HTHA 1V86A 2KKCA 4P7IA 3A1QB 4NPNA 3V61A 3LJ3A 2HD5B 2JUOA 2WX1A 4E3CA 5DPTA 3ZRCA 2KANA 2JPHA 3U8ZA 2PE6B 3APDA 3QJZA 2N9PC 2OJRA 1E8YA 4W9HA 4ZRIA 3NY5A 1UELA 4LDTB 2M8SA 4K7UA 3RYTA 2DENB 3APCA 3AU4A 4WWOA 1XQQA 2JZ3B 1WX8A 3K9OB 3UGBB 2C9WB 2VRRB 3PRMB 2LWPA 2AEHA 2IZVB 3L10B 4I6LB 3TBLD 4W9KA 2DHZA 3DBSA 3OJ4B 2KVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMV A;  3L08 A;  4NAW B;  4TKN A;  4W9E A;  2HE7 A;  4II2 B;  4ZYN A;  3A4R A;  2JZZ A;  1I42 A;  2QHO A;  2NBW B;  4NJ7 A;  2LXA A;  4AOF A;  5E6O A;  2KLG A;  1OEY A;  2IY0 B;  2YLM A;  1E7U A;  5IA7 A;  2DAJ A;  4EZK A;  3VAW A;  4IC7 B;  2MRP A;  4GSW A;  4WJO A;  4KVG B;  3RT3 B;  4YL8 A;  2LRU A;  5DCN A;  5LXH A;  2G4S A;  4FBJ B;  3DBR I;  1FXT B;  3IFW B;  4HPL B;  2RSU A;  3NZS A;  4II3 B;  3KYC D;  4MSQ B;  2CHZ A;  3X23 A;  2K6Q A;  4GOC A;  2LVP A;  2IBI B;  5AZF A;  1WX7 A;  3ONS A;  2KJR A;  1J8C A;  1LFD A;  3L0W B;  4GN1 A;  5D7G A;  2DZJ A;  4OVU A;  1UBI A;  4FLH A;  1V81 A;  3P2B A;  5G55 A;  1ZGU B;  2BWF A;  2JY6 A;  2FID A;  4KSK C;  3VUW A;  3GZN I;  1OEY J;  3N3K B;  4ICU A;  1YD8 U;  4JL9 A;  1LQB A;  1WXV A;  3T8M A;  3ZTD A;  2Z0E B;  2AL6 A;  1E7V A;  2KHW B;  1M94 A;  2KMA A;  4GXB A;  3QQ8 B;  1G6J A;  1GUA B;  4DHZ E;  3KUC B;  1LXD A;  4MH0 E;  3A9K B;  2ZNV C;  4MGI E;  4LJP B;  3DVG X;  4JQW C;  1UGM A;  4DWF A;  3I3T B;  4IW0 A;  4M0W B;  2LGX A;  4WJQ A;  4EUT A;  2JRH A;  3JSV B;  4NJ6 A;  2C60 A;  3PHW B;  4IM0 A;  4PYU A;  2DYM A;  2GBN A;  3EHV A;  1WZ3 A;  4G50 A;  4ICV A;  4AUQ C;  3C0R B;  3V60 A;  4F7Z A;  2L7R A;  4I6P A;  4I6N B;  4K1R B;  1I35 A;  3AU5 A;  4LDT D;  2KN5 A;  4NAW A;  2ZCB A;  4EZL A;  1E8Z A;  2KTF A;  3KH0 A;  3AUL A;  2A4Z A;  2K6D B;  3PS6 A;  1H8C A;  2BPS A;  1WE6 A;  3VUX A;  2V4L A;  2EMS A;  1V49 A;  3W1S C;  4A3O A;  2LD9 A;  2KOX A;  3VQI A;  4DK5 A;  1Y8R C;  2NCN A;  2LI5 A;  1ISN A;  4B9K A;  4URK A;  3K9P B;  2K8B A;  3CF6 E;  2L0T A;  4FAD A;  3IBE A;  4BOZ B;  4W9L A;  2W9N A;  3WAM A;  2EMT A;  2LUE A;  2CS4 A;  2N9X A;  2MW5 A;  2JWZ A;  2KO3 A;  2D11 A;  2IYD B;  3WAO A;  4EFO A;  2G3Q B;  2M1M A;  2XK5 B;  5L83 A;  3H7S A;  4GU2 A;  3UF8 A;  1U4A A;  2JVC A;  1ZKH A;  2KC1 A;  2BGF A;  2JXX A;  4DHZ B;  2N7E A;  2YVC A;  2GMI C;  2GBK A;  4FHJ A;  2IO0 B;  4F8C B;  1IPG A;  4WWN A;  5E6N A;  3T9L A;  4GDK B;  1V5O A;  4AJY B;  2C7M B;  4LCD E;  4GIV A;  2CU1 A;  2MQJ A;  3A9K A;  3VVW B;  1J0G A;  2L76 A;  2MBB B;  4EEW A;  5EDS A;  3ZVV A;  2JT4 B;  3HIZ A;  2B3A A;  4JIO U;  2K1F A;  1NI2 A;  2WYQ A;  3JSV A;  1A5R A;  4CYE A;  4G0N B;  4MDK E;  1EO6 A;  2I1K A;  1R4M I;  4ANX A;  4FN2 A;  3M95 A;  1P9D U;  3AI5 A;  2KD0 A;  2Z59 B;  2LGD A;  3A9J B;  1E5W A;  4HLE A;  3GOE A;  2KDI A;  2ZPY A;  2PJH A;  1UH6 A;  2N7D A;  1KM7 A;  3KYD D;  4IG7 B;  3WAL A;  5J2R A;  4AP4 C;  4K7W A;  4DHJ B;  2C7H A;  3L13 A;  1WJ6 A;  4NY0 A;  4KZC A;  4XZ4 A;  2KXJ A;  2KC2 A;  3V6E B;  4MGZ E;  3PT2 B;  3QK0 A;  3QCA A;  1YX6 B;  4G3X B;  4CO7 A;  4IWP A;  5D94 A;  1NDD A;  3U7D A;  3IG3 A;  1EUV B;  5AEK B;  2OOB B;  1GC6 A;  1PQS A;  2GOW A;  1C1Y B;  2MBH A;  2O2V B;  3VTV A;  1KOT A;  2NPT B;  4GMV A;  2REX A;  5LXI B;  1GNU A;  2KDB A;  1WY8 A;  1WGD A;  2MBO A;  4EZJ A;  3RZF A;  2XK5 A;  2MP2 B;  3OJ3 A;  4JGH B;  4GDL A;  3CSF A;  1WXM A;  4E74 A;  4DDG D;  4FJY A;  2JRI B;  3R7Q A;  3Q3F A;  3QWZ B;  3RD2 A;  2D2Q A;  4GDK A;  3W1S A;  3R7R A;  1X1M A;  2GBM A;  2LGY A;  2MCN B;  4PS3 A;  3DVN U;  3O65 B;  1Z5S B;  2DX5 B;  4KSL C;  4TQ1 A;  3PSE B;  3H7P A;  1IYF A;  2FUH B;  4BBN C;  5E6P A;  1SIF A;  2LVO A;  3UIP B;  2MBQ A;  3NOB A;  5DPW A;  4F1S A;  3VH4 B;  2J0M A;  2J0K A;  4RM9 A;  1RFA A;  2DAF A;  4K7S A;  3A1Q A;  3ZNG C;  2MLB A;  2PEA A;  3SDL C;  1BT0 A;  3KVF B;  4WJN A;  2I1J A;  1GC7 A;  3KUD B;  3A9J A;  1WX9 A;  3JVZ X;  4BOS C;  2KWC A;  1WJN A;  3ZDT A;  2WWZ A;  4NQK E;  4FJV B;  5AZH A;  4EKU A;  2DZM A;  3M62 B;  3PRP B;  4KZ0 A;  4XC2 A;  3HM6 X;  2JF5 A;  3ZKJ C;  3QC8 B;  5JH5 C;  4BFR A;  1WF9 A;  1NBF C;  4MGK E;  3RCZ A;  4MJS B;  2K25 A;  1P0R A;  3QX1 A;  2KFK B;  2ZVN A;  2EKE C;  1P3Q U;  3VH3 B;  3D32 A;  1UD7 A;  3SD5 A;  3OLM D;  4A20 A;  4DHJ D;  3ZNZ B;  2N9E B;  3AXC A;  2CHW A;  3ML8 A;  3EEC A;  5CHW A;  3ZW3 A;  2M17 A;  5JHA A;  2BKR B;  2O2V A;  3MHS D;  4GGQ A;  2BKF A;  3PRE A;  3VUY A;  3NS8 A;  3DOW A;  2KJH B;  1MG8 A;  4HCP B;  4W9I A;  1WGH A;  1WMH B;  1R4N I;  2K8C A;  2MP2 A;  1S1Q B;  3H6N A;  3V6C B;  4AJW A;  3HHM A;  4G11 A;  1V2Y A;  4J6I A;  1Q0W B;  4BKG A;  3DVG Y;  3ZRF A;  3KW5 B;  5D6J B;  3MJW A;  2GBJ A;  3VFK A;  4OVV A;  3PZD A;  3UIO B;  1YX5 B;  2M4N A;  2NVU I;  3W1Y A;  1WGG A;  3H9D A;  2M0X A;  5FR6 A;  2ZZP B;  3ZNI D;  3TMP B;  4DXA B;  1VD2 A;  4KV2 A;  4W9C A;  3ZIM A;  3UIN B;  4IUM B;  2CR5 A;  2LZ6 A;  2GBR A;  4GB9 A;  1OQY A;  2LVQ A;  2NBU A;  2KDE B;  2BF8 B;  2KWV B;  4HVB A;  3SHQ A;  2ZJD A;  2D3G A;  2DYB A;  3M3J A;  4KDL B;  4AWJ A;  3L17 A;  3R3M A;  1OTR B;  1TGZ B;  2ZVO A;  3BIN A;  3UQB A;  2FCN A;  4N9F 4;  5KHO A;  3PLU A;  2CKH B;  2KTR B;  3U30 A;  1QZE A;  1WIA A;  1WR1 A;  3WIM A;  1E8W A;  2PPH A;  1E90 A;  4CHK A;  4HK2 A;  1V6E A;  2N1W A;  4W9G A;  2LRW A;  1Z2M A;  4W9F A;  2KFK A;  5DPS A;  3Q3J A;  4ANU A;  2L00 B;  3ML9 A;  3OAW A;  4HDQ A;  4KDI C;  4HPM B;  1SE9 A;  1HE8 A;  2V3S A;  4TUU A;  4MEL A;  4WAA A;  2DYO A;  2DZK A;  2L05 A;  3ALB A;  5CHF A;  2K39 A;  3DPD A;  3A33 B;  3X0W A;  1RRB A;  4RMA A;  2KQS A;  1V9J A;  3DBL I;  3ZO5 B;  3DBH I;  2ASQ A;  2DZI A;  2IO2 B;  2RPQ A;  3RZW C;  1WMH A;  2C7N B;  2MWS B;  1TBE A;  2L3Z A;  3B1L X;  4B6W A;  4ZRK A;  1WR6 E;  4FJZ A;  1V5T A;  1F9J A;  1KLV A;  1XT9 B;  3ZDM C;  2IY1 B;  3ZTC A;  3QAR A;  4NNJ B;  2KWU B;  2NR2 A;  3PLV A;  1WYW B;  1LM8 B;  2G4D B;  4B95 A;  1EF5 A;  2WDT B;  2D07 B;  3JYU A;  1RLF A;  4LJO B;  5C1Z A;  1XD3 B;  2ZCC A;  2XBB C;  1WZ0 A;  2IO3 B;  2KZR A;  3QHT A;  1TZ1 A;  1WXS A;  1WJ4 A;  2FCS A;  4JLC A;  4HJK A;  5J18 A;  4IM3 A;  3DDC B;  4WWP A;  4K81 A;  1D3Z A;  4A3P A;  2PE9 A;  2MBE A;  1WH3 A;  3NHE B;  2Y5B B;  1WGY A;  4KIK B;  4M8N A;  1WFY A;  2KX3 A;  4MM3 A;  4RM8 A;  3L16 A;  4TV3 A;  3VXW A;  4MSM B;  4HDO A;  2K8H A;  2KX0 A;  3ZUN A;  2AYO B;  4W9D A;  3RUI B;  1WGR A;  4MGY E;  1EF1 A;  2BWE S;  2XEW A;  5CTR C;  2KTR A;  3TL5 A;  4WQO B;  4FA6 A;  5HKH A;  2KFJ A;  2FNJ B;  2O6V B;  1TTN A;  1AAR A;  2KQ7 A;  3QAQ A;  1UZX B;  3KUZ A;  3PPA A;  1WE7 A;  4ZRJ A;  2C5L C;  1WRD B;  2KJ6 A;  4PS8 A;  2KK8 A;  5CX3 A;  4E71 A;  2L8J A;  4WJP A;  4FHK A;  2ZEQ A;  2J0J A;  3M63 B;  4PS7 A;  3QA8 A;  2MX2 A;  3EC8 A;  4BVU C;  2BYE A;  2KLC A;  2ZPN A;  1WXA A;  5DPR A;  5JZE B;  3IVF A;  2LAS A;  3WAP A;  2R2Q A;  3MTN B;  3VDZ A;  4NQL B;  4EOY A;  4ANV A;  4FUL A;  1IP9 A;  3LDZ E;  3VTW A;  4IWQ A;  3DQV A;  1P98 A;  4PYZ A;  3WAN A;  2N4F A;  2KNB A;  1SGH A;  3RUL A;  1Q5W B;  1ZW7 A;  2RGF A;  3VHT C;  3ZNH B;  1T0Y A;  3WA0 A;  2NPT A;  2WX0 A;  1UBQ A;  2KMC A;  3A4S C;  3TJP A;  3PTF C;  2FCM A;  5LLI A;  2D10 A;  2BYV E;  2CHX A;  4IWO A;  4BKT A;  4TQ0 A;  1Q1O A;  2AL3 A;  3SU8 X;  2N1V A;  4DBG A;  1YJ1 A;  4ZDV A;  1H4R A;  2G45 B;  2L0F A;  3ECI A;  3PRZ A;  1K8R B;  4XX5 A;  1GG3 A;  3BY4 B;  2A5U A;  2UWQ A;  2HJ8 A;  5C23 A;  3S2A A;  4ANW A;  4W9J A;  3ENE A;  2IO1 B;  3H1U A;  4M8M A;  2MA9 B;  2Z0D B;  1WM2 A;  4KIK A;  1V80 A;  4HCN B;  5KHQ A;  3L54 A;  5D2M B;  1GJZ A;  2UYZ B;  2V1Y A;  5CHV C;  2BYF A;  2RD0 A;  3NZU A;  2FAZ A;  3PGE A;  1VCB A;  3JW0 X;  1WI0 A;  1OGW A;  2ZNV B;  2R2O A;  5BO4 B;  1S3S G;  3HK0 A;  5J17 A;  5IAA C;  3DCG A;  2O6V A;  4DDI D;  2LXC A;  5TR5 A;  4HWI B;  3ZLZ A;  3VTU A;  2NBV B;  3APF A;  3CMM B;  3CST A;  4IM2 A;  3EFU A;  3R66 C;  2NS5 A;  4BKS A;  1JRU A;  3DVN V;  3IHP C;  3QIJ A;  2O6V D;  3V62 A;  4GDL B;  2LJ5 A;  4MEM A;  4HXD A;  2FIF A;  5L95 C;  4BKS D;  3PVL A;  5G2N A;  4MJS A;  4ASW C;  1WM3 A;  1YQB A;  3PHX B;  1KJT A;  1P1A A;  2AWT A;  1E8X A;  1WJU A;  5JHB A;  2J7Q B;  1L7Y A;  3UQA A;  1CMX B;  4BBN F;  5AZG A;  1RAX A;  3B08 A;  3B0A A;  3H7P B;  1YIW A;  3TIX A;  4X57 B;  3PV1 A;  2MSE D;  1J19 A;  2RR9 A;  3N30 A;  3TCA A;  1C3T A;  2KDF B;  2FCQ A;  3HM3 A;  3N32 A;  1L2N A;  2HTH A;  1V86 A;  2KKC A;  4P7I A;  3A1Q B;  4NPN A;  3V61 A;  3LJ3 A;  2HD5 B;  2JUO A;  2WX1 A;  4E3C A;  5DPT A;  3ZRC A;  2KAN A;  2JPH A;  3U8Z A;  2PE6 B;  3APD A;  3QJZ A;  2N9P C;  2OJR A;  1E8Y A;  4W9H A;  4ZRI A;  3NY5 A;  1UEL A;  4LDT B;  2M8S A;  4K7U A;  3RYT A;  2DEN B;  3APC A;  3AU4 A;  4WWO A;  1XQQ A;  2JZ3 B;  1WX8 A;  3K9O B;  3UGB B;  2C9W B;  2VRR B;  3PRM B;  2LWP A;  2AEH A;  2IZV B;  3L10 B;  4I6L B;  3TBL D;  4W9K A;  2DHZ A;  3DBS A;  3OJ4 B;  2KVR A; 
#chains in the Genus database with same CATH topology
 4NAW B;  2HE7 A;  4II2 B;  4ZYN A;  2JZZ A;  1F77 A;  3U52 E;  4NJ7 A;  2V0G A;  2KLG A;  2IY0 B;  5EE0 A;  5IA7 A;  4EZK A;  1VZ7 A;  4KKJ A;  2ZW0 A;  2WXF A;  4KVG B;  1MPE A;  4YL8 A;  5EE9 A;  3RT3 B;  4XGA B;  2D5G A;  1FXT B;  3IFW B;  4HPL B;  3LXF A;  2CHZ A;  3CWI A;  1BXT A;  5AZF A;  1J8C A;  3RNA C;  3L0W B;  4GN1 A;  2DZJ A;  4FLH A;  1V81 A;  1GAQ B;  3CIR B;  1ZGU B;  2BWF A;  2FID A;  3TEX A;  4ICU A;  4JL9 A;  1LQB A;  1WXV A;  2WGS A;  1G6J A;  2AL6 A;  1E7V A;  1MFW A;  4LJP B;  3DVG X;  4DWF A;  3I3T B;  1C77 A;  4M0W B;  5IKC M;  2C60 A;  4IM0 A;  3J9C A;  1GOZ A;  4HEA 1;  2BW2 A;  3BYT B;  4FXC A;  1ZXH A;  1PGX A;  1I35 A;  2WXP A;  4LLG M;  1YQ4 B;  3DWG C;  1WWT A;  4NZL B;  1I4R A;  3URY A;  2WXQ A;  2WU2 B;  4JE3 B;  4DK5 A;  2BBC A;  3V05 A;  3CF6 E;  4RF0 A;  1L5P A;  4YT0 B;  3WAO A;  2ICI A;  3H7S A;  3UF8 A;  1ZKH A;  1KH0 A;  3HUI A;  2JXX A;  2N7E A;  1JW9 D;  3ZJU A;  2IO0 B;  1FFU A;  2W82 A;  3T9L A;  4XE0 A;  3RPF C;  2CU1 A;  2MQJ A;  1FCL A;  3A9K A;  2L76 A;  4EEW A;  5EDS A;  1GB1 A;  1T0S C;  2WHI A;  2LHD A;  4OHJ A;  1P9D U;  3AI5 A;  3AE1 B;  4JWS C;  1E5W A;  2W3S A;  1KM7 A;  3WAL A;  5J2R A;  4K7W A;  4DHJ B;  2C7H A;  3MC0 B;  4XZ4 A;  3T3O A;  3QK0 A;  1TY0 A;  4IWP A;  3U7D A;  1EUV B;  2QCZ A;  1XLO A;  1QOA A;  5AEK B;  1VDV A;  4RH6 A;  1PQS A;  2GOW A;  2O2V B;  1KOT A;  2SAK A;  1WY8 A;  2E6X A;  4GDL A;  3W5U B;  1JCK B;  3CSF A;  5E6J A;  4K3C A;  3EA6 A;  1TS4 A;  4ZHO A;  2GBM A;  5GXG B;  4PS3 A;  3O65 B;  2DX5 B;  4KSL C;  5FKA C;  1IYF A;  3I63 C;  2XNA C;  2LVO A;  1GPX A;  1TY2 A;  2J0M A;  4K7S A;  1K53 A;  2MLB A;  1C79 A;  4C00 A;  1EU4 A;  1GC7 A;  2I1J A;  1MHH E;  3SEB A;  4XC2 A;  2JF5 A;  2G1E A;  1WF9 A;  4MJS B;  5BYS A;  1P0R A;  2INC C;  2EKE C;  1EWY C;  1NEK B;  1QKZ A;  2H88 B;  2N9E B;  2R61 A;  3ML8 A;  3EEC A;  2GRI A;  3VUY A;  2BKF A;  5BYQ A;  3N1X C;  4DXF A;  2KJH B;  1WGH A;  1WMH B;  1L0Y B;  1S1Q B;  2WP9 B;  4J6I A;  4WAF A;  3DBR B;  3MJW A;  2M4N A;  1FXA A;  2PKO A;  3H9D A;  2KQ4 X;  1ZDV A;  3ZNI D;  2J4X A;  1ZOY B;  1LO5 D;  2QIL A;  4HVB A;  2LVQ A;  2KDE B;  2BF8 B;  3SHQ A;  3GZN B;  1YOV B;  4M02 A;  1OTR B;  1TGZ B;  3UQB A;  4C56 C;  4N9F 4;  5KHO A;  2JQR B;  2CKH B;  3U30 A;  1QZE A;  3DHI C;  1E90 A;  1DOY A;  2D3B A;  2IGH A;  4HK2 A;  1FM0 D;  2CJO A;  2N1W A;  3C8Y A;  2KFK A;  1ESF A;  4HDQ A;  3P4P B;  2ACZ B;  4MEL A;  1FD6 A;  4LNF A;  3DPD A;  3P63 A;  3AE4 B;  1Q10 A;  3LB8 C;  3N20 C;  2DZI A;  3RZW C;  2RPQ A;  2MWS B;  3B1L X;  3MC9 A;  4FJZ A;  1F9J A;  1TIF A;  2QC8 A;  3ZDM C;  2KAC A;  1RM6 C;  4B95 A;  2WDT B;  3RNG C;  2ZCC A;  2XBB C;  1TZ1 A;  4RFB A;  4P6V F;  2PE9 A;  2MBE A;  3NHE B;  4LNN A;  2KX3 A;  3VXW A;  4MSM B;  2K8H A;  2KX0 A;  3ZUN A;  2AYO B;  3RUI B;  1EF1 A;  2XEW A;  1XXG A;  1I4Q A;  4OVZ A;  2O6V B;  3DWM A;  1V1P A;  1T3Q A;  1TKY A;  1WE7 A;  3PPA A;  1R4M B;  4HKQ A;  3U4E G;  2CJN A;  2WXK A;  2J0J A;  3KWV A;  3N9Y C;  4BVU C;  1JRO A;  3IVF A;  4ZHP A;  3WAP A;  3VDZ A;  4EOY A;  2N9L A;  3AE7 B;  1IP9 A;  3LDZ E;  2EEL A;  1P98 A;  5T8I A;  4PYZ A;  3WAN A;  1Q5W B;  1F2R I;  2RGF A;  4ARC A;  1ZDX A;  2D10 A;  2CHX A;  4BKT A;  4TQ0 A;  2WDQ B;  4JPS A;  2N1V A;  3PRZ A;  4XX5 A;  2UWQ A;  3RFZ B;  4ANW A;  1ZUD 2;  3ENE A;  2M56 B;  4M8M A;  2MA9 B;  1WM2 A;  4KIK A;  2BS2 B;  3L54 A;  2UYZ B;  2V1Y A;  3AB5 A;  2XN9 C;  1VCB A;  3O13 A;  2K5P A;  1WI0 A;  3AED B;  1S3S G;  2PTL A;  3HK0 A;  4DDI D;  4AS1 A;  5TR5 A;  3ZLZ A;  2VZK B;  1N60 A;  4RGO S;  4P16 A;  3V62 A;  4GDL B;  3AEF B;  4MEM A;  2FIF A;  4A90 A;  1WM3 A;  1YQB A;  3PHX B;  1KJT A;  1L7Y A;  1N61 A;  3UQA A;  1YIW A;  3TIX A;  4X57 B;  1NYQ A;  3AE5 B;  2VH1 A;  2FCQ A;  3HM3 A;  3N32 A;  2KKC A;  3LJ3 A;  2W54 A;  3EGR A;  3MHZ A;  1OQR A;  4ZRI A;  3NY5 A;  3GS2 A;  2M0A A;  3DHG C;  3APC A;  1XQQ A;  2JZ3 B;  3UGB B;  1JWS D;  2LWP A;  2IZV B;  3L10 B;  4I6L B;  3TBL D;  2N0S B;  3SFE B;  4A8X C;  2KVR A;  1SE3 A;  4WQM A;  2B76 B;  4B0M A;  4W9E A;  3A4R A;  2WDV B;  1VRA B;  4US9 A;  1I42 A;  2PMV A;  2QHO A;  2NBW B;  3H8H A;  1L6V A;  4AOF A;  5E6O A;  1PYW D;  1TT5 B;  2DAJ A;  4IC7 B;  1AW7 A;  4MT5 A;  4WJO A;  1ZP0 B;  1J7C A;  3MFG A;  5LXH A;  2LRU A;  5DCN A;  2G4S A;  2RSU A;  2BB5 A;  4II3 B;  4Q2J A;  2K6Q A;  2IBI B;  1WX7 A;  3ONS A;  1BUI C;  1LFD A;  1FO4 A;  4OVU A;  3P2B A;  2X8X X;  1SIJ A;  1OEY J;  2KHW B;  2KT7 A;  3MC8 A;  3QQ8 B;  1HA5 A;  2YEP B;  1UNS A;  4MH0 E;  2ZNV C;  2WXL A;  1F1H A;  1UGM A;  4EUT A;  3JSV B;  3I57 A;  4PYU A;  1P7E A;  2GBN A;  3EHV A;  2LUM A;  4AUQ C;  3C0R B;  4F7Z A;  2L7R A;  4I6P A;  3Q3M C;  2BTE A;  3AU5 A;  3NVW A;  2KN5 A;  2ZCB A;  1E8Z A;  3TEY A;  3PS6 A;  1H8C A;  2BPS A;  1P7F A;  1L0V B;  2LD9 A;  2KOX A;  3VQI A;  1FNW A;  1C4C A;  1ACC A;  2LI5 A;  1ISN A;  4B9K A;  3K9P B;  3P4S B;  2WU5 B;  1YN4 A;  3IBE A;  4YWG G;  3WAM A;  3N1Z C;  2LUE A;  3Q69 A;  5L83 A;  2G3Q B;  2M1M A;  2BYT A;  1U4A A;  2JVC A;  4TMA B;  2JYT A;  1IBX A;  1IPG A;  4WWN A;  4GDK B;  4AJY B;  2C7M B;  1TS5 A;  5H92 C;  5HHD G;  1J0G A;  2JT4 B;  3HIZ A;  2TSS A;  2B3A A;  4JIO U;  4G0N B;  1SE2 A;  2I1K A;  1V1P B;  3A9J B;  2Y3A A;  2RMM A;  2WXN A;  2FBW B;  1WGK A;  2HJ1 A;  1FNV A;  1VZ6 A;  3L13 A;  5BMG A;  2KXJ A;  1VJK A;  1T5X D;  4G3X B;  3BVZ A;  1NDD A;  3IG3 A;  1JWM D;  1C1Y B;  2KDB A;  1JWB D;  4YTP B;  4EZJ A;  2XK5 A;  1F52 A;  3NG0 A;  1WXM A;  3W2D A;  4FJY A;  2WS3 B;  3Q3F A;  3QWZ B;  2D2Q A;  3W1S A;  4KKI A;  3R7R A;  1TJE A;  1LGR A;  1Z5S B;  2N7J A;  4TQ1 A;  4ZRQ A;  3Q8B A;  1WYG A;  5E6P A;  1SIF A;  5LNK 1;  2KDM A;  4M00 A;  3NOB A;  1ENF A;  4HRO A;  3VH4 B;  4F1S A;  1N63 A;  4RM9 A;  3ZNG C;  3KUD B;  3JVZ X;  3DBL B;  2BB6 A;  4FJV B;  4EKU A;  2WXI A;  2DZM A;  4KZ0 A;  5BYR A;  1UUP A;  4BFR A;  1RWS A;  2WLB A;  3NUH B;  2ZVN A;  1P3Q U;  3AXC A;  2L52 A;  3RNF C;  5CHW A;  1MVK A;  2M17 A;  5D3D A;  3OWE B;  3VR8 B;  5AUK A;  3DOW A;  4W9I A;  4IOI E;  1R4N I;  2K8C A;  2MP2 A;  2OED A;  2GB1 A;  1D5Z C;  1D5X C;  1Q0W B;  3BYY B;  3DVG Y;  5BMH A;  3KW5 B;  5D6J B;  3KLS X;  2J42 A;  3PZD A;  3W1Y A;  1WGG A;  4C7Z A;  3TMP B;  5IO9 A;  2Q5W D;  3ZIM A;  4GLS C;  4IUM B;  2CR5 A;  1J7A A;  1QOB A;  1OQY A;  1CQV A;  2INP E;  2FUG 1;  3M3J A;  4KDL B;  3R3M A;  2KTR B;  1JRP A;  1KRH A;  1WIA A;  1SJH D;  1KLU D;  3P4R B;  4S0R A;  4CHK A;  4CQN A;  1FMA D;  3ETR A;  1SJE D;  2LRW A;  4N59 A;  3Q3J A;  2BS3 B;  3NJT A;  1HE8 A;  3ZJT A;  2DZK A;  4OZA A;  2K39 A;  2HDE A;  3X0W A;  3RNC C;  4LTU A;  4WIP A;  4RMA A;  2KQS A;  3DBL I;  1YNT E;  2ASQ A;  2GI9 A;  2WXO A;  1TBE A;  4B6W A;  2INN E;  1WR6 E;  1V5T A;  1AYF A;  3PO0 A;  1WYW B;  1EF5 A;  1XCT L;  2D07 B;  4LJO B;  1QT9 A;  4ARI A;  1XD3 B;  2RPV A;  2KZR A;  4K3B A;  2L1A A;  2FCS A;  1WJ4 A;  4JLC A;  3KQ4 A;  3Q8E A;  1WGY A;  4MM3 A;  3L16 A;  2RDG A;  4WQO B;  4MAC A;  1TTN A;  1ROE A;  4XWT A;  3ZXV A;  3QAQ A;  1C9F A;  4ZRJ A;  5CX3 A;  2ZEQ A;  3EFC A;  3QA8 A;  3EC8 A;  3AV8 A;  1WSP A;  5JZE B;  1IBX B;  2PW9 A;  3MTN B;  4NQL B;  4EE2 A;  4IDI A;  1PGB A;  3DQV A;  3R2I A;  2N4F A;  4S17 A;  1ZW7 A;  3VHT C;  1JQ4 A;  2QIE B;  2NPT A;  1UBQ A;  1YN3 A;  3TJP A;  2FCM A;  5LLI A;  4L1B A;  1KLG D;  1Q1O A;  2AL3 A;  2PVG C;  1QF6 A;  2W3R A;  4DBG A;  4ZDV A;  4XYC A;  1K8R B;  5IP4 D;  1GG3 A;  1JWU D;  2Z0D B;  5KHQ A;  1V80 A;  3B2F A;  5D2M B;  2NTT A;  2RD0 A;  1TKG A;  2FAZ A;  2LMC A;  3PGE A;  2CU3 A;  3ZYY X;  1OGW A;  2R2O A;  3HVZ A;  5J17 A;  2YEP F;  5IAA C;  3ZQ4 A;  2J52 A;  4WWM A;  3APF A;  3AH7 A;  4XWW A;  3EFU A;  2NS5 A;  4YTN B;  2ONQ A;  1B9R A;  1FRR A;  4HXD A;  3PVL A;  5G2N A;  1QOG A;  4LNK A;  3TEW A;  1VR9 A;  2X38 A;  1QQR A;  4P1C C;  2RDH A;  3FKY A;  1WJU A;  4BBN F;  2LGS A;  3B08 A;  4M01 A;  2MSE D;  1J19 A;  3AEE B;  1K52 A;  3B9J A;  4P7I A;  2HD5 B;  2JUO A;  5DPT A;  3U8Z A;  2JPH A;  2Z8L A;  1K51 A;  1SE4 A;  2KMM A;  2M8S A;  4K7U A;  2ZW1 A;  1WX8 A;  5FK9 C;  3OJ4 B;  1V1O A;  5GMV A;  3AN1 A;  2AQ3 B;  1OFF A;  3ZGZ A;  1NEN B;  5HI1 A;  4RF1 A;  1E9M A;  3Q14 C;  1E7P B;  4GSW A;  2EKI A;  2IGD A;  3AE8 B;  2AQ1 B;  2PLP A;  3DBR I;  4RGT A;  1XLP A;  3NZS A;  2I2Y A;  4L2Y A;  1FFV A;  4USA A;  4YSX B;  2V9H A;  1XF5 L;  2WXR A;  5D7G A;  1UBI A;  4DQO C;  3AM9 A;  5G55 A;  2IGG A;  2JY6 A;  2OHF A;  2WNM A;  4KSK C;  3GZN I;  1YD8 U;  3R8B A;  3T8M A;  3ZTD A;  2KMA A;  1M94 A;  4GXB A;  1HXY D;  4RCO A;  3KUC B;  1LXD A;  3A9K B;  4JQW C;  3BZD B;  1L6U A;  4NJ6 A;  2D3A A;  1YQ3 B;  1WZ3 A;  4ICV A;  3GE3 C;  4DXG A;  4LDT D;  4NAW A;  3KH0 A;  3AUL A;  2A4Z A;  1WE6 A;  1I4G A;  4A3O A;  1TKE A;  4XDC A;  1Y8R C;  2NCN A;  3NZ3 A;  2IJ0 A;  3RNB C;  2K8B A;  1PDX A;  4ACF A;  4FAD A;  1IGD A;  5C3J B;  2EMT A;  3NS1 A;  3P4Q B;  2JWZ A;  2KO3 A;  2D11 A;  2IYD B;  4GU2 A;  3IT4 B;  3TEZ A;  2KC1 A;  3BII D;  2BGF A;  4DHZ B;  5JXV A;  2YVC A;  3IXS A;  4F8C B;  5E6N A;  1AWD A;  1V5O A;  3Q8A A;  4LCD E;  4MM3 B;  3VVW B;  1QIL A;  3VRA B;  2AQ2 B;  4M0W A;  2K1F A;  1NI2 A;  2WYQ A;  1A5R A;  1I7H A;  2NTS A;  4CYE A;  4MDK E;  1EO6 A;  1R4M I;  4WUR A;  3DHH C;  2MEK A;  2LGD A;  2WQY B;  2ZPY A;  5EE3 A;  2N7D A;  1JAL A;  4AP4 C;  1NVI D;  1MI0 A;  3HRD D;  3AEG B;  3V6E B;  3AE2 B;  3PT2 B;  1YX6 B;  4CO7 A;  5D94 A;  5G5G A;  3NVZ A;  3AE3 B;  1GC6 A;  1E0Z A;  2NPT B;  5IOI A;  4HRS A;  5LXI B;  1GNU A;  2MBO A;  1KFY B;  3OJ3 A;  4JGH B;  2DLB A;  4MH8 A;  1XCQ L;  3R7Q A;  2LGY A;  2PIA A;  2MCN B;  5I4D A;  3H7P A;  1HTO A;  2FUH B;  3AE6 B;  4BBN C;  1ZPS A;  2JYE A;  1IUE A;  1RFA A;  3A1Q A;  2PEA A;  2Y5P A;  2JU6 X;  3DBH B;  1WJN A;  1NYR A;  3ZDT A;  2WWZ A;  4NQK E;  4US8 A;  2JWU A;  3M62 B;  3HM6 X;  2DBY A;  3ZKJ C;  3QC8 B;  5JH5 C;  1NBF C;  2LEK A;  3RCZ A;  3VR9 B;  2RDB C;  2K25 A;  3QX1 A;  2KFK B;  1VZ8 A;  1UWM A;  3VH3 B;  1UD7 A;  4A20 A;  2V3N A;  1RYJ A;  3ZNZ B;  4DHJ D;  2W55 A;  2O2V A;  4GGQ A;  3PRE A;  3NS8 A;  2KN4 A;  4JWU C;  1MG8 A;  1SB3 C;  4YSY B;  3HHM A;  4G11 A;  3RNE C;  4BKG A;  3UI3 A;  1TZO A;  1OQQ A;  1FPY A;  3VFK A;  3UIO B;  3V3X A;  1YX5 B;  5H8Y E;  2G9H D;  4OZB A;  3BK2 A;  2M0X A;  5FR6 A;  4DXA B;  2LFI A;  2GBR A;  1D5M C;  3RN9 C;  4GB9 A;  2NBU A;  5FR3 A;  2KWV B;  2ZJD A;  2DYB A;  4AWJ A;  2ZVO A;  2QEJ C;  2PVO D;  1C76 A;  1T6B X;  3E56 A;  1KF6 B;  1WR1 A;  3WIM A;  4TSS A;  2PPH A;  3I9V 1;  1Z2M A;  3WCQ A;  3AE9 B;  4ANU A;  3ML9 A;  3OAW A;  4KDI C;  4HPM B;  1SE9 A;  3KWL A;  4ZRP A;  1ET9 A;  2DWQ A;  2ON8 A;  4TUU A;  4WAA A;  2QMT A;  2DYO A;  3PZ8 A;  1FNU A;  4OW0 A;  4PK1 A;  1RRB A;  3HVD A;  2J53 A;  1V9J A;  3DBH I;  1C78 A;  2IO2 B;  4J3O D;  1WMH A;  4PT5 A;  4ZRK A;  4YTM B;  1A70 A;  4BZA A;  1SF0 A;  2IY1 B;  3ZTC A;  4NNJ B;  2KWU B;  3FIL A;  3PLV A;  2G4D B;  1LM8 B;  1RLF A;  5C1Z A;  2QDF A;  1UF0 A;  1FCC C;  1WXS A;  3IAS 1;  5J18 A;  4WWP A;  4KIK B;  3MJ5 A;  2Y5B B;  4M8N A;  1WFY A;  5AUI A;  4RM8 A;  1WGR A;  4OZC A;  1YJI A;  5CTR C;  1L4D B;  1ZXI A;  4FA6 A;  2KFJ A;  2KQ7 A;  3KUZ A;  1WRD B;  4PS8 A;  4N58 A;  2L8J A;  4WJP A;  5G5H A;  2BYE A;  3L4P A;  5DPR A;  2MH7 A;  2LAS A;  2R2Q A;  3ZXR A;  1XO3 A;  4ANV A;  4FUL A;  2BVC A;  2I38 A;  3VTW A;  4IWQ A;  4KGR A;  3WA0 A;  2WX0 A;  2KWD A;  3PTF C;  4D2K A;  3P42 A;  3SU8 X;  1XEE A;  5HFY A;  3BY4 B;  2A5U A;  2IND C;  5C23 A;  4W9J A;  1HZ5 A;  2L32 A;  3H1U A;  3Q3N C;  4BAX A;  1AN8 A;  1R7S A;  2BYF A;  1CK1 A;  3NZU A;  4HPP A;  5BO4 B;  1IGC A;  3T3N A;  2O6V A;  2LXC A;  4HWI B;  3CMM B;  3CST A;  4IM2 A;  3AMZ A;  1DOI A;  4UDU C;  3FC4 A;  3DVN V;  3QIJ A;  2O6V D;  4ASW C;  1EU3 A;  5JHB A;  1SSN A;  2J7Q B;  1CMX B;  1QOF A;  3H7P B;  2WXM A;  4C7Y A;  3PV1 A;  2RR9 A;  1C3T A;  1L2N A;  2HTH A;  3A1Q B;  4NPN A;  3U7Z A;  4A55 A;  4E3C A;  3ZRC A;  3QJZ A;  2PE6 B;  3APD A;  1JML A;  2N9P C;  2OJR A;  1UEL A;  3RYT A;  2BT6 A;  2DEN B;  4WWO A;  2VH2 A;  2VRR B;  3U2S C;  2AEH A;  3DBS A;  5TSS A;  2QSD A;  4ITK A;  3L08 A;  2LHE A;  4TKN A;  1RFK A;  2DNF A;  4REZ A;  4KGT A;  4WH4 A;  2LXA A;  2KYW A;  1OEY A;  2YLM A;  1E7U A;  3MP9 A;  3VAW A;  4KX6 B;  1FEH A;  2MRP A;  1HZ6 A;  4FBJ B;  2OJW A;  2MJ3 A;  2VZK D;  3KYC D;  4MSQ B;  3X23 A;  1YJJ A;  4GOC A;  2LVP A;  2KJR A;  4XDD A;  1YN5 A;  1J7B A;  1I4P A;  3VUW A;  3N3K B;  3W5V B;  2Z0E B;  1GUA B;  4DHZ E;  1CJE A;  4MGI E;  4LNI A;  3I5J C;  4IW0 A;  3AEB B;  2LGX A;  1N5W A;  3PZ7 A;  4WJQ A;  2JRH A;  3NVV A;  1C4P A;  3PHW B;  4JX1 C;  2DYM A;  4G50 A;  4R3D A;  3V60 A;  3BVM A;  4I6N B;  4K1R B;  4EZL A;  2KTF A;  1TYG B;  2K6D B;  1KTK A;  3VUX A;  1EWC A;  5BMI A;  2V4L A;  2EMS A;  1E6E B;  1V49 A;  4HJG E;  3W1S C;  3TUO A;  1N6Z A;  3AEA B;  4URK A;  2L0T A;  1UGJ A;  4BOZ B;  1XLN A;  4W9L A;  2W9N A;  4RNA A;  1F2R C;  2CS4 A;  2N9X A;  2MW5 A;  4LNO A;  3FIL B;  4EFO A;  2XK5 B;  1FXI A;  2MHJ A;  1T0Q C;  1L0X B;  3N1Y C;  2GMI C;  2GBK A;  4FHJ A;  2GLS A;  2FE8 A;  3BK1 A;  4GIV A;  3VRB B;  2MBB B;  3ZVV A;  3JSV A;  4P1B C;  4ANX A;  4FN2 A;  3M95 A;  2WXH A;  2KD0 A;  4C80 A;  2V4I B;  2Z59 B;  4HLE A;  3GOE A;  4L23 A;  2K9X A;  2KDI A;  2PJH A;  4YSZ B;  1UH6 A;  1MJD A;  3R2T A;  3KYD D;  4IG7 B;  4N6E B;  2LJI A;  2D3C A;  1DGJ A;  1D6E C;  1SBB B;  1WJ6 A;  4NY0 A;  4KZC A;  2KC2 A;  4MGZ E;  3QCA A;  2K22 A;  2JX5 A;  1STE A;  3AEC B;  1DOX A;  2OOB B;  1N62 A;  2MBH A;  3VTV A;  4GMV A;  2IDY A;  2REX A;  2SEB D;  1WGD A;  2E3T A;  3RZF A;  4AQ7 A;  2MP2 B;  5IN7 A;  2MJE A;  4E74 A;  4DDG D;  1GB4 A;  1EM7 A;  2JRI B;  3RD2 A;  1WRI A;  4GDK A;  1X1M A;  1UWX A;  3DVN U;  3PSE B;  3UIP B;  2MBQ A;  5DPW A;  2J0K A;  1PGA A;  1T0R C;  2DAF A;  1V8C A;  3SDL C;  5EE1 A;  1BT0 A;  3KVF B;  4WJN A;  1Y56 A;  3A9J A;  1WX9 A;  2MJD A;  1ET6 A;  4BOS C;  2KWC A;  3SFD B;  5AZH A;  3PRP B;  4O1N A;  4C4V A;  2N9K A;  3EUB 2;  2WDR B;  4MGK E;  3NRZ A;  2M19 A;  3D32 A;  3SD5 A;  3OLM D;  2CHW A;  3ZW3 A;  1NI3 A;  2L83 A;  5JHA A;  2BKR B;  3MHS D;  1F0Z A;  3Q6B A;  4HCP B;  3H6N A;  3FAH A;  3V6C B;  4AJW A;  1V2Y A;  1WXQ A;  1YMH E;  3ZRF A;  4LK0 M;  2JZP A;  2GBJ A;  4OVV A;  4HKZ E;  2NVU I;  2IPK D;  2BS4 B;  2ZZP B;  1ZE3 D;  2KVZ A;  1V97 A;  1VD2 A;  4KV2 A;  4W9C A;  3UIN B;  4RGN A;  1PUT A;  1FRD A;  2LZ6 A;  3SR6 A;  2D3G A;  3W9C B;  3BWU D;  4NJC A;  3L17 A;  3BIN A;  2FCN A;  3PLU A;  3OG5 A;  1E8W A;  4A9A A;  1V6E A;  1HTQ A;  4W9G A;  4W9F A;  5DPS A;  3IAM 1;  3Q8C A;  2L00 B;  2V3S A;  2V3P A;  2LGI A;  4YXD B;  5CHF A;  2L05 A;  3ALB A;  3A33 B;  2KAJ A;  3ZO5 B;  4RGM A;  2C7N B;  3BVG A;  2HTM E;  2L3Z A;  5MPO A;  1XLQ A;  2K3U A;  1D4B A;  1VLB A;  1KLV A;  1XT9 B;  2H89 B;  3QAR A;  4NAM A;  2NR2 A;  3JYU A;  1I4X A;  1WZ0 A;  2IO3 B;  3QHT A;  1MHX A;  1L4Z B;  3B2G A;  4HJK A;  2WXJ A;  4IM3 A;  3DDC B;  4B0E A;  4K81 A;  1D3Z A;  4A3P A;  1MG4 A;  1WH3 A;  3ZJV A;  4TV3 A;  4HDO A;  1DYQ A;  3GP7 A;  4W9D A;  4MGY E;  2BWE S;  3TL5 A;  2KTR A;  5HKH A;  2FNJ B;  1AAR A;  1UZX B;  2C5L C;  2KJ6 A;  2AX5 A;  2KK8 A;  4E71 A;  4FHK A;  3M63 B;  3Q3O C;  4PS7 A;  2MX2 A;  2KLC A;  2ZPN A;  1WXA A;  4ZYS A;  4IKG A;  2UU7 A;  1FIQ A;  3NVY A;  3GB1 A;  2NMQ A;  4ZOH C;  4A6Q A;  2KNB A;  1SGH A;  3RUL A;  5D3I B;  1CZP A;  3ZNH B;  1C4A A;  1T0Y A;  2KMC A;  1E10 A;  1HEZ E;  1PFD A;  3A4S C;  3Q8F A;  2BYV E;  5HG2 A;  4IWO A;  2JSV X;  1YJ1 A;  2Y5C A;  1H4R A;  2G45 B;  2L0F A;  3ECI A;  2HJ8 A;  3Q2A C;  3S2A A;  1I4H A;  2IO1 B;  3RMK C;  2K0P A;  1BML C;  4HCN B;  3P1M A;  1GJZ A;  5CHV C;  1SXT A;  3IT6 B;  3JW0 X;  2ZNV B;  3DCG A;  1M4V A;  2QJL A;  3E9S A;  3VTU A;  2NBV B;  3R66 C;  3C19 A;  4QAY A;  4BKS A;  2JXT A;  1TS3 A;  1JRU A;  1QLB B;  3IHP C;  2LJ5 A;  5C2T B;  1TS2 A;  5L95 C;  4BKS D;  4MJS A;  1SEB D;  1HQR D;  1P1A A;  2AWT A;  1E8X A;  1N5X A;  3ABV B;  1JWA D;  5AZG A;  1RAX A;  3B0A A;  3TCA A;  3N30 A;  4H2A A;  2BQQ A;  2KDF B;  1B1Z A;  3GE8 C;  1V86 A;  3LYY A;  3V61 A;  1K50 A;  2WX1 A;  2KAN A;  3TSS A;  4KGS A;  4W9H A;  1E8Y A;  4LDT B;  3RI7 C;  1R4N B;  3AU4 A;  2WXG A;  4C4V B;  3K9O B;  2C9W B;  3PRM B;  4W9K A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 5GMV A;  3L08 A;  4NAW B;  4TKN A;  4W9E A;  2HE7 A;  4II2 B;  4ZYN A;  3A4R A;  2JZZ A;  1I42 A;  2QHO A;  2NBW B;  4NJ7 A;  2LXA A;  4AOF A;  5E6O A;  2KLG A;  1OEY A;  2IY0 B;  2YLM A;  1E7U A;  5IA7 A;  2DAJ A;  4EZK A;  3VAW A;  4IC7 B;  2MRP A;  4GSW A;  4WJO A;  4KVG B;  3RT3 B;  4YL8 A;  2LRU A;  5DCN A;  5LXH A;  2G4S A;  4FBJ B;  3DBR I;  1FXT B;  3IFW B;  4HPL B;  2RSU A;  3NZS A;  4II3 B;  3KYC D;  4MSQ B;  2CHZ A;  3X23 A;  2K6Q A;  4GOC A;  2LVP A;  2IBI B;  5AZF A;  1WX7 A;  3ONS A;  2KJR A;  1J8C A;  1LFD A;  3L0W B;  4GN1 A;  5D7G A;  2DZJ A;  4OVU A;  1UBI A;  4FLH A;  1V81 A;  3P2B A;  5G55 A;  1ZGU B;  2BWF A;  2JY6 A;  2FID A;  4KSK C;  3VUW A;  3GZN I;  1OEY J;  3N3K B;  4ICU A;  1YD8 U;  4JL9 A;  1LQB A;  1WXV A;  3T8M A;  3ZTD A;  2Z0E B;  2AL6 A;  1E7V A;  2KHW B;  1M94 A;  2KMA A;  4GXB A;  3QQ8 B;  1G6J A;  1GUA B;  4DHZ E;  3KUC B;  1LXD A;  4MH0 E;  3A9K B;  2ZNV C;  4MGI E;  4LJP B;  3DVG X;  4JQW C;  1UGM A;  4DWF A;  3I3T B;  4IW0 A;  4M0W B;  2LGX A;  4WJQ A;  4EUT A;  2JRH A;  3JSV B;  4NJ6 A;  2C60 A;  3PHW B;  4IM0 A;  4PYU A;  2DYM A;  2GBN A;  3EHV A;  1WZ3 A;  4G50 A;  4ICV A;  4AUQ C;  3C0R B;  3V60 A;  4F7Z A;  2L7R A;  4I6P A;  4I6N B;  4K1R B;  1I35 A;  3AU5 A;  4LDT D;  2KN5 A;  4NAW A;  2ZCB A;  4EZL A;  1E8Z A;  2KTF A;  3KH0 A;  3AUL A;  2A4Z A;  2K6D B;  3PS6 A;  1H8C A;  2BPS A;  1WE6 A;  3VUX A;  2V4L A;  2EMS A;  1V49 A;  3W1S C;  4A3O A;  2LD9 A;  2KOX A;  3VQI A;  4DK5 A;  1Y8R C;  2NCN A;  2LI5 A;  1ISN A;  4B9K A;  4URK A;  3K9P B;  2K8B A;  3CF6 E;  2L0T A;  4FAD A;  3IBE A;  4BOZ B;  4W9L A;  2W9N A;  3WAM A;  2EMT A;  2LUE A;  2CS4 A;  2N9X A;  2MW5 A;  2JWZ A;  2KO3 A;  2D11 A;  2IYD B;  3WAO A;  4EFO A;  2G3Q B;  2M1M A;  2XK5 B;  5L83 A;  3H7S A;  4GU2 A;  3UF8 A;  1U4A A;  2JVC A;  1ZKH A;  2KC1 A;  2BGF A;  2JXX A;  4DHZ B;  2N7E A;  2YVC A;  2GMI C;  2GBK A;  4FHJ A;  2IO0 B;  4F8C B;  1IPG A;  4WWN A;  5E6N A;  3T9L A;  4GDK B;  1V5O A;  4AJY B;  2C7M B;  4LCD E;  4GIV A;  2CU1 A;  2MQJ A;  3A9K A;  3VVW B;  1J0G A;  2L76 A;  2MBB B;  4EEW A;  5EDS A;  3ZVV A;  2JT4 B;  3HIZ A;  2B3A A;  4JIO U;  2K1F A;  1NI2 A;  2WYQ A;  3JSV A;  1A5R A;  4CYE A;  4G0N B;  4MDK E;  1EO6 A;  2I1K A;  1R4M I;  4ANX A;  4FN2 A;  3M95 A;  1P9D U;  3AI5 A;  2KD0 A;  2Z59 B;  2LGD A;  3A9J B;  1E5W A;  4HLE A;  3GOE A;  2KDI A;  2ZPY A;  2PJH A;  1UH6 A;  2N7D A;  1KM7 A;  3KYD D;  4IG7 B;  3WAL A;  5J2R A;  4AP4 C;  4K7W A;  4DHJ B;  2C7H A;  3L13 A;  1WJ6 A;  4NY0 A;  4KZC A;  4XZ4 A;  2KXJ A;  2KC2 A;  3V6E B;  4MGZ E;  3PT2 B;  3QK0 A;  3QCA A;  1YX6 B;  4G3X B;  4CO7 A;  4IWP A;  5D94 A;  1NDD A;  3U7D A;  3IG3 A;  1EUV B;  5AEK B;  2OOB B;  1GC6 A;  1PQS A;  2GOW A;  1C1Y B;  2MBH A;  2O2V B;  3VTV A;  1KOT A;  2NPT B;  4GMV A;  2REX A;  5LXI B;  1GNU A;  2KDB A;  1WY8 A;  1WGD A;  2MBO A;  4EZJ A;  3RZF A;  2XK5 A;  2MP2 B;  3OJ3 A;  4JGH B;  4GDL A;  3CSF A;  1WXM A;  4E74 A;  4DDG D;  4FJY A;  2JRI B;  3R7Q A;  3Q3F A;  3QWZ B;  3RD2 A;  2D2Q A;  4GDK A;  3W1S A;  3R7R A;  1X1M A;  2GBM A;  2LGY A;  2MCN B;  4PS3 A;  3DVN U;  3O65 B;  1Z5S B;  2DX5 B;  4KSL C;  4TQ1 A;  3PSE B;  3H7P A;  1IYF A;  2FUH B;  4BBN C;  5E6P A;  1SIF A;  2LVO A;  3UIP B;  2MBQ A;  3NOB A;  5DPW A;  4F1S A;  3VH4 B;  2J0M A;  2J0K A;  4RM9 A;  1RFA A;  2DAF A;  4K7S A;  3A1Q A;  3ZNG C;  2MLB A;  2PEA A;  3SDL C;  1BT0 A;  3KVF B;  4WJN A;  2I1J A;  1GC7 A;  3KUD B;  3A9J A;  1WX9 A;  3JVZ X;  4BOS C;  2KWC A;  1WJN A;  3ZDT A;  2WWZ A;  4NQK E;  4FJV B;  5AZH A;  4EKU A;  2DZM A;  3M62 B;  3PRP B;  4KZ0 A;  4XC2 A;  3HM6 X;  2JF5 A;  3ZKJ C;  3QC8 B;  5JH5 C;  4BFR A;  1WF9 A;  1NBF C;  4MGK E;  3RCZ A;  4MJS B;  2K25 A;  1P0R A;  3QX1 A;  2KFK B;  2ZVN A;  2EKE C;  1P3Q U;  3VH3 B;  3D32 A;  1UD7 A;  3SD5 A;  3OLM D;  4A20 A;  4DHJ D;  3ZNZ B;  2N9E B;  3AXC A;  2CHW A;  3ML8 A;  3EEC A;  5CHW A;  3ZW3 A;  2M17 A;  5JHA A;  2BKR B;  2O2V A;  3MHS D;  4GGQ A;  2BKF A;  3PRE A;  3VUY A;  3NS8 A;  3DOW A;  2KJH B;  1MG8 A;  4HCP B;  4W9I A;  1WGH A;  1WMH B;  1R4N I;  2K8C A;  2MP2 A;  1S1Q B;  3H6N A;  3V6C B;  4AJW A;  3HHM A;  4G11 A;  1V2Y A;  4J6I A;  1Q0W B;  4BKG A;  3DVG Y;  3ZRF A;  3KW5 B;  5D6J B;  3MJW A;  2GBJ A;  3VFK A;  4OVV A;  3PZD A;  3UIO B;  1YX5 B;  2M4N A;  2NVU I;  3W1Y A;  1WGG A;  3H9D A;  2M0X A;  5FR6 A;  2ZZP B;  3ZNI D;  3TMP B;  4DXA B;  1VD2 A;  4KV2 A;  4W9C A;  3ZIM A;  3UIN B;  4IUM B;  2CR5 A;  2LZ6 A;  2GBR A;  4GB9 A;  1OQY A;  2LVQ A;  2NBU A;  2KDE B;  2BF8 B;  2KWV B;  4HVB A;  3SHQ A;  2ZJD A;  2D3G A;  2DYB A;  3M3J A;  4KDL B;  4AWJ A;  3L17 A;  3R3M A;  1OTR B;  1TGZ B;  2ZVO A;  3BIN A;  3UQB A;  2FCN A;  4N9F 4;  5KHO A;  3PLU A;  2CKH B;  2KTR B;  3U30 A;  1QZE A;  1WIA A;  1WR1 A;  3WIM A;  1E8W A;  2PPH A;  1E90 A;  4CHK A;  4HK2 A;  1V6E A;  2N1W A;  4W9G A;  2LRW A;  1Z2M A;  4W9F A;  2KFK A;  5DPS A;  3Q3J A;  4ANU A;  2L00 B;  3ML9 A;  3OAW A;  4HDQ A;  4KDI C;  4HPM B;  1SE9 A;  1HE8 A;  2V3S A;  4TUU A;  4MEL A;  4WAA A;  2DYO A;  2DZK A;  2L05 A;  3ALB A;  5CHF A;  2K39 A;  3DPD A;  3A33 B;  3X0W A;  1RRB A;  4RMA A;  2KQS A;  1V9J A;  3DBL I;  3ZO5 B;  3DBH I;  2ASQ A;  2DZI A;  2IO2 B;  2RPQ A;  3RZW C;  1WMH A;  2C7N B;  2MWS B;  1TBE A;  2L3Z A;  3B1L X;  4B6W A;  4ZRK A;  1WR6 E;  4FJZ A;  1V5T A;  1F9J A;  1KLV A;  1XT9 B;  3ZDM C;  2IY1 B;  3ZTC A;  3QAR A;  4NNJ B;  2KWU B;  2NR2 A;  3PLV A;  1WYW B;  1LM8 B;  2G4D B;  4B95 A;  1EF5 A;  2WDT B;  2D07 B;  3JYU A;  1RLF A;  4LJO B;  5C1Z A;  1XD3 B;  2ZCC A;  2XBB C;  1WZ0 A;  2IO3 B;  2KZR A;  3QHT A;  1TZ1 A;  1WXS A;  1WJ4 A;  2FCS A;  4JLC A;  4HJK A;  5J18 A;  4IM3 A;  3DDC B;  4WWP A;  4K81 A;  1D3Z A;  4A3P A;  2PE9 A;  2MBE A;  1WH3 A;  3NHE B;  2Y5B B;  1WGY A;  4KIK B;  4M8N A;  1WFY A;  2KX3 A;  4MM3 A;  4RM8 A;  3L16 A;  4TV3 A;  3VXW A;  4MSM B;  4HDO A;  2K8H A;  2KX0 A;  3ZUN A;  2AYO B;  4W9D A;  3RUI B;  1WGR A;  4MGY E;  1EF1 A;  2BWE S;  2XEW A;  5CTR C;  2KTR A;  3TL5 A;  4WQO B;  4FA6 A;  5HKH A;  2KFJ A;  2FNJ B;  2O6V B;  1TTN A;  1AAR A;  2KQ7 A;  3QAQ A;  1UZX B;  3KUZ A;  3PPA A;  1WE7 A;  4ZRJ A;  2C5L C;  1WRD B;  2KJ6 A;  4PS8 A;  2KK8 A;  5CX3 A;  4E71 A;  2L8J A;  4WJP A;  4FHK A;  2ZEQ A;  2J0J A;  3M63 B;  4PS7 A;  3QA8 A;  2MX2 A;  3EC8 A;  4BVU C;  2BYE A;  2KLC A;  2ZPN A;  1WXA A;  5DPR A;  5JZE B;  3IVF A;  2LAS A;  3WAP A;  2R2Q A;  3MTN B;  3VDZ A;  4NQL B;  4EOY A;  4ANV A;  4FUL A;  1IP9 A;  3LDZ E;  3VTW A;  4IWQ A;  3DQV A;  1P98 A;  4PYZ A;  3WAN A;  2N4F A;  2KNB A;  1SGH A;  3RUL A;  1Q5W B;  1ZW7 A;  2RGF A;  3VHT C;  3ZNH B;  1T0Y A;  3WA0 A;  2NPT A;  2WX0 A;  1UBQ A;  2KMC A;  3A4S C;  3TJP A;  3PTF C;  2FCM A;  5LLI A;  2D10 A;  2BYV E;  2CHX A;  4IWO A;  4BKT A;  4TQ0 A;  1Q1O A;  2AL3 A;  3SU8 X;  2N1V A;  4DBG A;  1YJ1 A;  4ZDV A;  1H4R A;  2G45 B;  2L0F A;  3ECI A;  3PRZ A;  1K8R B;  4XX5 A;  1GG3 A;  3BY4 B;  2A5U A;  2UWQ A;  2HJ8 A;  5C23 A;  3S2A A;  4ANW A;  4W9J A;  3ENE A;  2IO1 B;  3H1U A;  4M8M A;  2MA9 B;  2Z0D B;  1WM2 A;  4KIK A;  1V80 A;  4HCN B;  5KHQ A;  3L54 A;  5D2M B;  1GJZ A;  2UYZ B;  2V1Y A;  5CHV C;  2BYF A;  2RD0 A;  3NZU A;  2FAZ A;  3PGE A;  1VCB A;  3JW0 X;  1WI0 A;  1OGW A;  2ZNV B;  2R2O A;  5BO4 B;  1S3S G;  3HK0 A;  5J17 A;  5IAA C;  3DCG A;  2O6V A;  4DDI D;  2LXC A;  5TR5 A;  4HWI B;  3ZLZ A;  3VTU A;  2NBV B;  3APF A;  3CMM B;  3CST A;  4IM2 A;  3EFU A;  3R66 C;  2NS5 A;  4BKS A;  1JRU A;  3DVN V;  3IHP C;  3QIJ A;  2O6V D;  3V62 A;  4GDL B;  2LJ5 A;  4MEM A;  4HXD A;  2FIF A;  5L95 C;  4BKS D;  3PVL A;  5G2N A;  4MJS A;  4ASW C;  1WM3 A;  1YQB A;  3PHX B;  1KJT A;  1P1A A;  2AWT A;  1E8X A;  1WJU A;  5JHB A;  2J7Q B;  1L7Y A;  3UQA A;  1CMX B;  4BBN F;  5AZG A;  1RAX A;  3B08 A;  3B0A A;  3H7P B;  1YIW A;  3TIX A;  4X57 B;  3PV1 A;  2MSE D;  1J19 A;  2RR9 A;  3N30 A;  3TCA A;  1C3T A;  2KDF B;  2FCQ A;  3HM3 A;  3N32 A;  1L2N A;  2HTH A;  1V86 A;  2KKC A;  4P7I A;  3A1Q B;  4NPN A;  3V61 A;  3LJ3 A;  2HD5 B;  2JUO A;  2WX1 A;  4E3C A;  5DPT A;  3ZRC A;  2KAN A;  2JPH A;  3U8Z A;  2PE6 B;  3APD A;  3QJZ A;  2N9P C;  2OJR A;  1E8Y A;  4W9H A;  4ZRI A;  3NY5 A;  1UEL A;  4LDT B;  2M8S A;  4K7U A;  3RYT A;  2DEN B;  3APC A;  3AU4 A;  4WWO A;  1XQQ A;  2JZ3 B;  1WX8 A;  3K9O B;  3UGB B;  2C9W B;  2VRR B;  3PRM B;  2LWP A;  2AEH A;  2IZV B;  3L10 B;  4I6L B;  3TBL D;  4W9K A;  2DHZ A;  3DBS A;  3OJ4 B;  2KVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...