3ZKJC

Crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
70
Chain Sequence
DVFLMIRRHKTTIFTDAKSTVFELKRIVEGILKRPPKDDQLFTSQTARPQAPATVEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ANKYRIN REPEAT AND SOCS BOX PROTEIN 9
publication title Molecular Architecture of the Ankyrin Socs Box Family of Cul5-Dependent E3 Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 70
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zkjC00
5GMVA 3N30A 4FULA 3VTVA 4IW0A 2LVPA 4DHZE 1WZ0A 3I3TB 1V49A 4HCPB 2DYOA 4FJVB 4LJPB 5E6PA 3VUXA 2WWZA 4K81A 1D3ZA 4KIKA 2BKRB 4K7WA 1YX6B 1PQSA 3QJZA 1OGWA 3A4RA 3U30A 4AJWA 4BOSC 1YX5B 1WE7A 2JZZA 2KC2A 3O65B 3TIXA 5JHBA 3HM3A 1IYFA 1GG3A 4A3PA 1ZW7A 3VTUA 4W9EA 2MP2A 3B0AA 1E8YA 2IO0B 4ZRKA 4DHJB 4EZLA 2J0JA 1WJUA 1GJZA 2G4DB 2FNJB 3VVWB 1E8WA 3VDZA 1V9JA 3ZLZA 4JQWC 1S1QB 1IP9A 2I1KA 1G6JA 3KYCD 3IFWB 1LXDA 4W9IA 3CSTA 5LLIA 4E74A 2LI5A 3H9DA 2JY6A 2L05A 4KDLB 2KFKA 4LDTD 2ZCCA 3QWZB 4NY0A 2PJHA 3PREA 4MDKE 3KUDB 2R2OA 4XZ4A 3QIJA 2L8JA 3OAWA 5FR6A 2O6VD 2JUOA 2K6QA 1V86A 3A1QA 2KLCA 4FLHA 3V6CB 4PS8A 3K9OB 4W9KA 5CHVC 1ZGUB 4AUQC 2KHWB 3X0WA 2KDIA 4FADA 2RR9A 1WMHB 1R4NI 3VQIA 2DZKA 2KN5A 3ZTDA 2REXA 4BFRA 2KNBA 2UYZB 4K7UA 4IM3A 3SD5A 5D94A 2KXJA 2LVOA 2MW5A 2JRIB 1Q0WB 4M8MA 5D7GA 4GB9A 4K7SA 5DPSA 5J17A 3L16A 1T0YA 2KX0A 4K1RB 2ZVOA 3R7QA 4LJOB 5C23A 3HK0A 3PSEB 3SHQA 3DBHI 1WXAA 4KIKB 3ZNID 1U4AA 2DENB 4NAWA 1J0GA 4AWJA 2D3GA 5DPWA 2YVCA 3ZO5B 3L17A 1E90A 4NQKE 2LZ6A 2ZJDA 3EFUA 3KYDD 2MP2B 3HIZA 4NPNA 3PLVA 2BKFA 4RMAA 2IO3B 2MSED 2KDBA 2K1FA 4KV2A 1WX7A 3Q3FA 1ZKHA 1H8CA 2KQSA 3ML9A 1RAXA 1V5TA 2V4LA 2CKHB 5LXIB 4ANWA 2A4ZA 2ZPYA 3SU8X 4ZYNA 2GBMA 1KJTA 3ENEA 2LASA 3OJ4B 3VFKA 2AL3A 3JSVB 1WM3A 4GN1A 4HPMB 2HTHA 3WAPA 1J8CA 2MBHA 1WJ4A 2NPTA 3B08A 3V62A 1L7YA 5CHFA 4DXAB 1S3SG 2N1VA 4DK5A 1I35A 2MQJA 2JPHA 3OLMD 3H7PB 3H7SA 2KVRA 3KUCB 1E8XA 4B9KA 2N9XA 2ZNVB 2NS5A 4MGZE 1P0RA 3ZNHB 3DBSA 4KZCA 5G55A 4TKNA 3PLUA 3PZDA 3QAQA 2JWZA 2D07B 4W9GA 3NZUA 3H1UA 2L7RA 1WM2A 2Y5BB 3SDLC 2KTFA 1RLFA 3M3JA 3QA8A 4RM9A 2JXXA 1EF1A 2OOBB 3ZIMA 4KDIC 3ECIA 4FHKA 1TGZB 4EZJA 3ZNGC 4GOCA 3PGEA 3PT2B 2KJ6A 2BYEA 2DZJA 2MA9B 5JH5C 3RULA 2NBWB 2ASQA 4NQLB 1YJ1A 4NAWB 2OJRA 2BYVE 2N7DA 4MGIE 5G2NA 4MEMA 3UGBB 3VH4B 3ZKJC 5CX3A 2C7MB 2FUHB 3APCA 4FJYA 5CTRC 1L2NA 4HCNB 4DHJD 3UIOB 3VAWA 2KO3A 1WIAA 2FIFA 1X1MA 4MM3A 1ISNA 1SIFA 3WAOA 4FJZA 2KJRA 1V80A 3ZNZB 4EKUA 4MJSA 1AARA 2GBKA 2O6VA 4W9LA 4URKA 4CYEA 4EUTA 1K8RB 2MBEA 2KANA 1WGGA 3DOWA 4HWIB 4WWNA 1RFAA 2LXCA 2KOXA 4ANXA 2DZIA 4ANVA 2NPTB 2K39A 4AP4C 3M63B 4KVGB 4E71A 2Z0DB 3RZFA 3UQAA 3ZTCA 3QX1A 3TL5A 3UF8A 3V61A 3ZDTA 1KM7A 1F9JA 2D10A 5JZEB 3TJPA 3KUZA 4JIOU 3VXWA 2KWUB 3AU5A 2LJ5A 2Z0EB 2C7NB 2O2VA 2M4NA 1XQQA 3A9JB 1J19A 2ZNVC 3LDZE 2MX2A 2M0XA 2FCNA 2IBIB 2J7QB 1P1AA 1WGYA 4MH0E 5KHQA 1UZXB 2KQ7A 4W9HA 3TMPB 1VCBA 2C9WB 4HDQA 3V6EB 2WX0A 3IBEA 3H6NA 4M0WB 5E6OA 3TCAA 2L76A 1WGRA 4IM0A 4AOFA 1OEYJ 3NZSA 2WYQA 4GDKB 1GUAB 3N3KB 1WXSA 4PYUA 3B1LX 1P98A 2JT4B 3ZVVA 3ZRFA 2XEWA 5D2MB 4B6WA 3ONSA 2KTRB 3JW0X 4GXBA 2HJ8A 4KSKC 2C7HA 5AEKB 2CS4A 5KHOA 3WAMA 4TQ0A 1MG8A 3HM6X 3NY5A 4E3CA 2EKEC 3GZNI 3PHWB 1CMXB 5IAAC 1WF9A 3X23A 4ICVA 2MCNB 2FCSA 2J0MA 4B95A 3ALBA 4DWFA 4EOYA 1OTRB 2FCQA 2L0TA 4WJPA 3W1SC 2JZ3B 3WANA 3U7DA 5IA7A 5BO4B 2N7EA 4A20A 4HLEA 3PHXB 2L0FA 4GIVA 1V81A 1UD7A 1NBFC 4II2B 2MBBB 3VH3B 3MHSD 4G0NB 3UQBA 2R2QA 1WI0A 1LQBA 3ZRCA 2K8CA 1YIWA 2DX5B 3APDA 1E7UA 4GDLA 2L3ZA 4WJOA 3T8MA 2IY0B 1WZ3A 3AI5A 1UELA 2LWPA 3KH0A 4LCDE 1HE8A 2B3AA 2IO2B 1UH6A 3IVFA 2AEHA 1EF5A 3OJ3A 4BKSA 5J18A 2V1YA 2K8BA 2KD0A 1C1YB 3PRZA 1EO6A 4W9DA 2KFKB 2DAJA 2DHZA 2N1WA 2N9PC 2D11A 4GGQA 1WGDA 2KWVB 2M8SA 1WY8A 4IWPA 2BWES 5DCNA 1WR6E 3A1QB 3ML8A 4II3B 1NDDA 2C5LC 3QCAA 3NOBA 3VHTC 2RSUA 4ZDVA 1Q1OA 3AULA 4HXDA 1WFYA 2NBVB 4RM8A 2LXAA 3UIPB 2LGDA 3QK0A 3BY4B 2RGFA 1GC6A 4BVUC 2ZEQA 4ANUA 2AWTA 4A3OA 2K8HA 3WA0A 2WX1A 4GSWA 3MTNB 2BF8B 2NR2A 2K6DB 3PTFC 4XX5A 2AYOB 2Z59B 1UBIA 3RCZA 3PRMB 3L10B 1NI2A 2KLGA 1GC7A 4JLCA 5L95C 1EUVB 3GOEA 5TR5A 3T9LA 4EFOA 1TBEA 1V6EA 1H4RA 4TQ1A 1V2YA 2BPSA 2G3QB 5HKHA 1VD2A 2AL6A 2BWFA 2I1JA 2YLMA 3DCGA 3D32A 4W9FA 3RZWC 2MRPA 2LRWA 3JVZX 4IWQA 4BOZB 3CF6E 3DVNU 4F7ZA 1LM8B 2D2QA 1RRBA 2MWSB 3L0WB 2KMCA 3L13A 4BBNF 2GOWA 3PV1A 4EEWA 3PS6A 2FCMA 3A4SC 3RD2A 3U8ZA 1WMHA 3L54A 1QZEA 3DVGX 4BBNC 4NJ7A 1WE6A 1WGHA 3CMMB 2KKCA 2EMSA 3K9PB 1YD8U 2IZVB 3L08A 3APFA 2PE9A 5AZGA 3TBLD 2CU1A 1IPGA 1WXVA 4NNJB 2JRHA 2N9EB 3EC8A 3EHVA 3V60A 3A33B 3UINB 2G4SA 2G45B 4KZ0A 4PS7A 1WRDB 2M17A 3N32A 2CHXA 4F1SA 3RUIB 5DPRA 2CR5A 5J2RA 4XC2A 3ZDMC 3LJ3A 5JHAA 4WJNA 2LGXA 4OVVA 3DVNV 4MSQB 4IUMB 1Y8RC 2MBOA 3R3MA 2LGYA 4HJKA 4I6NB 4PYZA 4IG7B 2ZVNA 4EZKA 3DBLI 4FBJB 4P7IA 2LD9A 4G50A 4ASWC 3BINA 2WDTB 4J6IA 2HD5B 2PE6B 3QHTA 2IYDB 2KDEB 1Q5WB 1KOTA 3PRPB 3VUYA 4WQOB 3DBRI 2ZCBA 4NJ6A 3M95A 3CSFA 2XK5A 3EECA 3JSVA 4WAAA 1M94A 2JVCA 1WX9A 1FXTB 2GBNA 1OEYA 1TTNA 4GMVA 4CHKA 1WJNA 4WJQA 2GMIC 2L00B 1BT0A 3H7PA 4F8CB 4HVBA 2A5UA 4M8NA 1R4MI 3AU4A 3PPAA 2C60A 4BKGA 1WX8A 3RT3B 4G11A 4ZRJA 4MGYE 2IY1B 4LDTB 3R7RA 3NS8A 5EDSA 1UBQA 4WWOA 4MGKE 1WXMA 2QHOA 4MJSB 1XT9B 3R66C 2O6VB 4I6LB 5LXHA 1JRUA 2MBQA 2LRUA 3VTWA 1I42A 4KSLC 1SGHA 2V3SA 3KW5B 4FA6A 4CO7A 2DZMA 2RPQA 3M62B 2GBRA 4HK2A 1E5WA 4DHZB 2K25A 3DPDA 2NCNA 3IG3A 4IM2A 2GBJA 4HDOA 4JGHB 2KC1A 2DYMA 4MSMB 1YQBA 4DBGA 3MJWA 3QQ8B 4DDGD 2J0KA 3HHMA 4N9F4 3QARA 1SE9A 2KDFB 3A9KA 3JYUA 2O2VB 2PEAA 2EMTA 1KLVA 4FHJA 2DYBA 2KZRA 4MELA 3VUWA 2XBBC 3C0RB 4YL8A 2PPHA 1Z5SB 4GU2A 3S2AA 3AXCA 5C1ZA 2KJHB 1WR1A 4OVUA 5D6JB 3W1SA 2HE7A 2UWQA 3Q3JA 2MLBA 3DVGY 1WYWB 2NVUI 2IO1B 2KK8A 4ZRIA 2BGFA 3QC8B 5E6NA 2XK5B 3RYTA 4IC7B 4TUUA 4FN2A 3W1YA 2N4FA 1V5OA 4WWPA 3ZW3A 1WH3A 2CHZA 2VRRB 3PVLA 5L83A 3WIMA 5DPTA 1WJ6A 1Z2MA 1GNUA 2KWCA 2M1MA 2DAFA 2CHWA 1LFDA 3IHPC 2ZZPB 2NBUA 2ZPNA 3A9JA 4G3XB 3NHEB 2FAZA 1E8ZA 1A5RA 3DDCB 1UGMA 1XD3B 5AZFA 3WALA 1OQYA 1TZ1A 4IWOA 2JF5A 4DDID 4I6PA 4X57B 3DQVA 2W9NA 3P2BA 1C3TA 4W9JA 5AZHA 4BKSD 2BYFA 4W9CA 2LVQA 5CHWA 1P3QU 2LUEA 4AJYB 2KX3A 1E7VA 2RD0A 4GDLB 4GDKA 3KVFB 4TV3A 2KFJA 3ZUNA 4BKTA 2KMAA 4ICUA 1P9DU 4JL9A 3A9KB 2FIDA 4PS3A 4HPLB 2KTRA
chains in the Genus database with same CATH superfamily
1K51A 3N30A 3BVGA 3I3TB 1I4RA 2DYOA 4HCPB 3VUXA 1FM0D 1I4PA 4LLGM 5FR3A 3RNFC 2BKRB 1PQSA 3A4RA 2KC2A 2JZZA 4K3CA 4NZLB 1GG3A 3VTUA 2WXIA 2IO0B 4EZLA 2J0JA 1N63A 4OHJA 3ZLZA 2AX5A 2K5PA 3KYCD 1UF0A 5HHDG 4W9IA 5LLIA 3BYYB 1EU3A 2PW9A 2LI5A 2JY6A 4LDTD 2PJHA 3MFGA 2BS4B 3QIJA 2L8JA 2JUOA 3K9OB 4W9KA 1ZGUB 4AUQC 2KVZA 3X0WA 1WMHB 3HRDD 3SD5A 2WXNA 1Q0WB 4K7SA 5DPSA 1AN8A 2OEDA 1T0YA 1JW9D 3SHQA 3DBHI 2X38A 2DENB 4NAWA 4AWJA 2D3GA 1N61A 2D5GA 1NYQA 2LZ6A 1TKYA 3EFUA 3KYDD 2D3BA 4HPPA 3O13A 3HIZA 2IO3B 3SFDB 1WX7A 1FRRA 1ZKHA 4KGSA 1V8CA 3MP9A 3Q14C 2ZPYA 1NVID 2LASA 3VFKA 1J8CA 4GN1A 3JSVB 2JU6X 2NPTA 3PO0A 2BS3B 1L7YA 4XE0A 5CHFA 1S3SG 4A90A 3OLMD 3H7PB 3LB8C 2KVRA 2V4IB 3KUCB 2N9XA 2ZNVB 2NS5A 1PDXA 1P0RA 4NJCA 3BWUD 3CWIA 3Q2AC 5G55A 2IGDA 3PZDA 1CJEA 1WM2A 1ZE3D 1RLFA 2LEKA 3ZIMA 2DNFA 3PGEA 4XGAB 3RULA 2NBWB 3AE1B 3FKYA 2BYVE 4MEMA 1YOVB 4KX6B 1TY2A 2RMMA 2AQ2B 1BUIC 1LGRA 3PZ8A 4MM3A 3WAOA 2J4XA 2KJRA 1ZDVA 2UU7A 4MJSA 1KTKA 1AARA 2GBKA 4W9LA 1MG4A 2KANA 3R2IA 1WGGA 1RM6C 2LXCA 2KACA 2Q5WD 4XDCA 4ANVA 2K39A 4AP4C 2CJOA 4E71A 3UQAA 2NTSA 1PYWD 3U7ZA 3TJPA 5IP4D 3KUZA 1TY0A 3AU5A 2Z0EB 4REZA 2C7NB 4ITKA 2M4NA 3FC4A 1QF6A 4D2KA 2MX2A 3DHHC 2FCNA 2IBIB 1P1AA 5KHQA 2KQ7A 4P1BC 2MEKA 1VCBA 1Q10A 4IM0A 1OEYJ 1N60A 1GUAB 4PYUA 3EGRA 2QIEB 3ZRFA 2XEWA 5D2MB 2LGSA 1IUEA 2KTRB 1T6BX 1VR9A 2C7HA 4IDIA 4TQ0A 3HM6X 1FNUA 4M01A 4B95A 2W3SA 2FCQA 3NUHB 2JZ3B 5IA7A 3U7DA 2ZW1A 2N7EA 4A20A 1UD7A 4G0NB 4RGTA 3UQBA 1WI0A 1XLPA 4N6EB 3FILA 3ZRCA 1YIWA 2DX5B 1UELA 3IXSA 4XWWA 3AB5A 1YJJA 3P63A 1EF5A 4BKSA 2V1YA 4RF0A 2K8BA 1GB1A 5IO9A 5I4DA 1BMLC 3I5JC 2KFKB 4RNAA 1WR6E 3A1QB 3ML8A 2C5LC 4R3DA 2RSUA 4ARIA 4ZDVA 1Q1OA 3AULA 1R4NB 2NBVB 2LXAA 2I38A 3P4SB 4L2YA 2M19A 3QK0A 3BY4B 2RGFA 1MHXA 1GOZA 1L5PA 4ANUA 2AWTA 4A3OA 2K8HA 2GB1A 4GSWA 1KH0A 3PTFC 2AYOB 3AEEB 3PRMB 1HTOA 2WDRB 1V2YA 3DCGA 3D32A 3RZWC 3U4EG 2WHIA 4IWQA 4BOZB 1LM8B 2JSVX 1RRBA 2KMCA 3L13A 1XCQL 2OHFA 4EEWA 1CQVA 1WMHA 2BT6A 1ZPSA 2EMSA 3K9PB 2LJIA 3APFA 4RGOS 2KYWA 2JYEA 1WXVA 4NNJB 4PT5A 3V60A 4DQOC 3UINB 2QEJC 1FFVA 4KZ0A 4DXFA 2FE8A 4LNKA 3I57A 3ZDMC 1T0RC 5JHAA 4WJNA 3NVVA 3W9CB 3IAM1 4QAYA 1Y8RC 2MBOA 2LGYA 4P7IA 1NEKB 2ACZB 4ASWC 4A6QA 1K52A 3PRPB 3RNEC 2ZCBA 3CSFA 2XK5A 3JSVA 1TTNA 5H92C 3AM9A 2GMIC 2L00B 3H7PA 1C4PA 1R4MI 3PPAA 2C60A 2H89B 4MGYE 4ZRPA 1UBQA 4WWOA 3VTWA 2LHDA 2V3SA 4CO7A 1FXIA 2DZMA 2RPQA 2DWQA 3OG5A 1EM7A 4ZOHC 3IG3A 1QT9A 1YQBA 2PVOD 1SE4A 1R7SA 1F0ZA 2PEAA 2DYBA 3VUWA 2PPHA 4GU2A 3AE3B 3AXCA 1WR1A 4LTUA 4JE3B 4N59A 3DBRB 2IO1B 4IOIE 1E7PB 3QC8B 5E6NA 3MC0B 4IC7B 4KKJA 1V5OA 2CHZA 1E10A 5L83A 1Z2MA 4H2AA 4WAFA 2ZZPB 2ZPNA 2L32A 4P16A 5D3DA 5E6JA 1OQYA 1TZ1A 3GE8C 4K3BA 5G5HA 4DDID 2V3PA 2W9NA 3P2BA 4JWUC 1TT5B 2LUEA 1E7VA 2RD0A 1FRDA 4GDLB 4TV3A 2KDMA 4PS3A 2KTRA 4FULA 1YJIA 2LVPA 1WZ0A 3BK1A 4KIKA 4K7WA 1YX6B 3U30A 4BOSC 1YX5B 5JHBA 3HM3A 1IYFA 3B0AA 1E8YA 1J7CA 1V1PB 4JX1C 3VDZA 3Q69A 3AEDB 2I1KA 5FK9C 3IFWB 1TS3A 1L0YB 1ESFA 4N58A 1LXDA 1TJEA 4EE2A 1TS2A 4E74A 1CZPA 2L05A 2KFKA 3QWZB 4NY0A 3OAWA 1PFDA 3A1QA 2KLCA 2QDFA 4FLHA 2D3CA 4FADA 3IT6B 2K0PA 1R4NI 1FXAA 3VQIA 3ZJUA 3AE5B 2KN5A 2JZPA 2KNBA 4M8MA 5J17A 2BW2A 3L16A 2WP9B 2KX0A 4K1RB 5C23A 3HK0A 3Q8CA 1L0XB 1WXAA 1U4AA 1WXQA 5DPWA 1E90A 4WURA 2MP2B 1E9MA 4ACFA 4NPNA 1WWTA 4RMAA 5LNK1 2KDBA 4WWMA 1FIQA 3Q8FA 2AQ1B 3Q3FA 1H8CA 3PZ7A 1C76A 4WQMA 4B0MA 2HDEA 5LXIB 3TEYA 3SU8X 1KJTA 3ENEA 5HG2A 2AL3A 3B08A 2N0SB 3EA6A 2N1VA 1I35A 2RDHA 5EE9A 1E8XA 1KF6B 4B9KA 4KZCA 3Q3MC 3IT4B 4TKNA 4W9GA 2BYTA 2JWZA 5AUIA 2L7RA 2Y5BB 3SDLC 3NRZA 2RDGA 2INCC 1QOFA 3QA8A 3MJ5A 4RM9A 2JXXA 4M0WA 4MACA 3ECIA 4FHKA 4EZJA 3ZNGC 2L83A 3PT2B 2WXMA 2BYEA 2WDVB 5JH5C 2ASQA 1YJ1A 3N20C 4MGIE 3LXFA 3UGBB 2WS3B 3VH4B 3ZKJC 5CX3A 5CTRC 3APCA 1L2NA 3BYTB 1X1MA 1RYJA 3BZDB 4EKUA 3DOWA 4HWIB 1HQRD 1I4GA 2J53A 1SSNA 1JWUD 3M63B 3N9YC 3RZFA 2IGGA 1C77A 3HVDA 3QX1A 3UF8A 3AEAB 1FMAD 2SAKA 3VR9B 1M4VA 4TMAB 3N1XC 3LDZE 2J7QB 1WGYA 4MH0E 1JROA 4W9HA 2C9WB 3V6EB 3IBEA 3H6NA 5E6OA 1PGXA 1WGRA 4AOFA 2WYQA 4RGMA 2PKOA 1WXSA 1P98A 2JT4B 3ZVVA 1L4DB 1F77A 4KSKC 3WAMA 3OWEB 1MG8A 1VJKA 4E3CA 1UUPA 1CMXB 4ICVA 4WIPA 2MCNB 4ZHPA 2J0MA 1OTRB 3W1SC 4OZAA 3WANA 5BO4B 2TSSA 3ETRA 1HEZE 1YN5A 3APDA 4GDLA 1E7UA 2BS2B 2B3AA 2JX5A 2KD0A 2WXPA 1EO6A 1IGCA 2DHZA 5D3IB 1DYQA 4BAXA 4GGQA 1N62A 2BWES 5DCNA 1I4QA 2DBYA 3VHTC 2CJNA 3MHZA 4AQ7A 4LNIA 2LGDA 1V1PA 1JWBD 1L6VA 1MFWA 2NR2A 2RPVA 3SFEB 3RCZA 4JLCA 1EUVB 3T9LA 5BMHA 1TBEA 1V6EA 3TSSA 3UI3A 1H4RA 2G3QB 4BZAA 5HKHA 2AL6A 2BWFA 4W9FA 2CU3A 2LRWA 3JVZX 4F7ZA 3CF6E 3DVNU 1NI3A 3PS6A 1TYGB 3U8ZA 3L54A 1N6ZA 3J9CA 4BBNC 2ONQA 5HI1A 1WE6A 2WXRA 4HEA1 2HTME 2IZVB 1I4XA 5T8IA 2WU5B 1SXTA 1E0ZA 3P4RB 2G1EA 3ZXVA 2G4SA 4PS7A 4OVZA 3N32A 5DPRA 3ZYYX 4XC2A 3AMZA 3RPFC 4OVVA 4C80A 4MSQB 1L0VB 4HJKA 4I6NB 4EZKA 4FBJB 2LD9A 2HD5B 2PE6B 1Q5WB 2BBCA 3MC8A 2Y5CA 1KOTA 3U2SC 2H88B 1AWDA 2JXTA 4WAAA 1M94A 1WX9A 1FXTB 2GBNA 4GMVA 4CHKA 4RGNA 1WJNA 5EE0A 1QILA 4ARCA 4M8NA 4BKGA 1WX8A 3RT3B 4G11A 5EDSA 2IY1B 3NS8A 1TIFA 4MGKE 2QHOA 4C7ZA 3R66C 4Q2JA 1I42A 4KSLC 3KW5B 4FA6A 3M62B 1E5WA 4US8A 2NCNA 4HDOA 2DYMA 4MH8A 2QMTA 2E6XA 3MJWA 4DDGD 2J0KA 3QARA 1SE9A 2KDFB 3A9KA 3JYUA 2MHJA 2EMTA 3SR6A 2KZRA 4MELA 4YL8A 1MHHE 3BVMA 1Z5SB 2KJHB 1PUTA 3AE4B 2HE7A 5TSSA 3DVGY 1WYWB 2NVUI 4ZRIA 1L6UA 1MJDA 2KK8A 1ET9A 3RYTA 3W1YA 3ZW3A 2VRRB 1GNUA 2M1MA 1K53A 3V05A 1E8ZA 1A5RA 3DDCB 1UGMA 3WALA 1ZUD2 1YQ3B 4P6VF 4X57B 3NVWA 3Q8AA 3BK2A 2LUMA 2KX3A 3ZUNA 4JPSA 4BKTA 3EUB2 1EWYC 2FIDA 1MPEA 3RI7C 3VTVA 2VH1A 4IW0A 1IGDA 3RNBC 5E6PA 1HTQA 3AEBB 4K81A 4L1BA 1D3ZA 1OGWA 4AJWA 1WE7A 4A3PA 1GB4A 2E3TA 2LFIA 4W9EA 4MT5A 3ZXRA 1E8WA 1JRPA 4C4VB 1V9JA 4JQWC 3B2GA 1S1QB 1IP9A 3Q8EA 1TKEA 1XO3A 3CSTA 4YSXB 2YEPB 2MJDA 3H9DA 4KDLB 4MDKE 1HZ5A 3KUDB 2D3AA 2R2OA 3H8HA 3W5VB 1V86A 1XLQA 4PS8A 5CHVC 3KWLA 2KDIA 2RR9A 1SE3A 3ZTDA 2REXA 1FEHA 2QJLA 2QC8A 4K7UA 3HVZA 3W5UB 5D94A 2KXJA 1D5ZC 1YN3A 2INNE 1IBXB 3R7QA 4LJOB 3C19A 3PSEB 4OW0A 5MPOA 1YNTE 1F2RI 3ZNID 1J0GA 4NQKE 2NMQA 2ZJDA 1YN4A 1ZXHA 3PLVA 2WXLA 1RAXA 2BVCA 3I63C 4ANWA 2A4ZA 4B0EA 5BYRA 2EELA 2GBMA 3DHIC 3OJ4B 4HPMB 1WM3A 3WAPA 2HTHA 3V62A 2KQ4X 1B9RA 1MVKA 4DXAB 4DK5A 2MQJA 2PVGC 3H7SA 2JQRB 3ZNHB 3DBSA 1FO4A 3B2FA 1KRHA 1OQRA 3PLUA 3QAQA 2D07B 1T0SC 3H1UA 4DXGA 3W2DA 2N9LA 1EF1A 4KDIC 1TGZB 4GOCA 3T3NA 2WXOA 3DBHB 2KJ6A 2MA9B 2AQ3B 4NAWB 5G2NA 2C7MB 2FUHB 4FJYA 2BTEA 1DOYA 3UIOB 3VAWA 2KO3A 3MC9A 4PK1A 1SIFA 4KGTA 4FJZA 1V80A 2ZW0A 3LYYA 3VRAB 4CYEA 4EUTA 4WWNA 4ANXA 2VH2A 2DZIA 2NPTB 2K3UA 2Z0DB 5HFYA 3ZTCA 4LK0M 3TL5A 2WU2B 3V61A 2V0GA 1PGAA 3VXWA 4JIOU 2VZKB 2KWUB 4NAMA 1VZ7A 1C4AA 3A9JB 1ENFA 1J19A 2M0XA 1RFKA 4USAA 1T3QA 3Q8BA 2V3NA 1ROEA 3TMPB 3B9JA 4HDQA 1HZ6A 2L76A 4P1CC 3NZSA 3KLSX 1D5MC 4GDKB 2Y5PA 4J3OD 4B6WA 4WH4A 5IN7A 4KGRA 2HJ8A 1OFFA 1V1OA 2CS4A 5KHOA 1UWMA 3NY5A 3PHWB 1N5XA 4EOYA 2L0TA 3VR8B 4WJPA 1T5XD 5GXGB 4HLEA 2JWUA 3PHXB 2L0FA 1JWSD 4GIVA 4RFBA 2LGIA 4II2B 3VH3B 2MBBB 2WXJA 2R2QA 1LQBA 2K8CA 4WJOA 4YSZB 3T8MA 1WZ3A 3AI5A 4LCDE 3KH0A 4JWSC 1HE8A 3OJ3A 5J18A 2MJEA 3P1MA 2DAJA 2N9PC 2D11A 4IKGA 5BYQA 1FCCC 1WGDA 5G5GA 2LMCA 2M8SA 2MH7A 4IWPA 1NDDA 1STEA 4C00A 3QCAA 2R61A 4OZCA 2B76B 2ON8A 3RFZB 1WFYA 2IDYA 4C56C 4S0RA 3V3XA 1VLBA 1QQRA 2J52A 4RCOA 1AW7A 1GC6A 4BVUC 4YT0B 3L4PA 2I2YA 4C4VA 3WA0A 3MTNB 4XX5A 1XLNA 1UBIA 2Z59B 3L10B 1NI2A 3TEWA 5TR5A 3GOEA 4EFOA 1FPYA 1VD2A 1UNSA 2D2QA 2MWSB 2GOWA 2FCMA 3ZGZA 3A4SC 4S17A 3RD2A 1QZEA 3DVGX 2IJ0A 2KKCA 1YD8U 2VZKD 2PE9A 3AN1A 3TBLD 4UDUC 1IBXA 1IPGA 2N9EB 2WXHA 3EC8A 2G45B 1WRDB 4F1SA 3RUIB 3P4PB 1FNVA 1Y56A 3LJ3A 1JWAD 1F1HA 2FUG1 1KFYB 4PYZA 4IG7B 2ZVNA 1NYRA 4G50A 1C78A 3BINA 2WDTB 4J6IA 3VUYA 2N9KA 3I9V1 3N1YC 3DBRI 4NJ6A 2JVCA 3E56A 1OEYA 4WJQA 4YWGG 1PGBA 2IGHA 4F8CB 3NJTA 2A5UA 4LNOA 1FD6A 3ZJVA 3RN9C 2Y3AA 3TEZA 2O6VB 4XDDA 2MBQA 2LRUA 2KT7A 4FXCA 1UGJA 1XF5L 1XLOA 2GLSA 2GBRA 4DHZB 3DPDA 1WYGA 4DBGA 3QQ8B 4N9F4 2KAJA 2O2VB 3NG0A 3RNAC 3AEFB 5C3JB 2PMVA 2PTLA 4HJGE 4YTNB 3CIRB 1JMLA 1YQ4B 4ZYSA 5D6JB 3W1SA 3Q3JA 1XCTL 2UWQA 1D5XC 2MLBA 1ZOYB 2BQQA 2NTTA 2BGFA 2ICIA 2XK5B 2N4FA 3E9SA 1UWXA 1WH3A 3WIMA 4C7YA 1JALA 1R4MB 5DPTA 3U52E 1DGJA 3GB1A 2KWCA 3RNCC 3GZNB 1QOGA 3ZQ4A 1I4HA 2NBUA 3A9JA 1N5WA 4G3XB 4L23A 4HKZE 1VZ8A 2QILA 1LO5D 2N7JA 1L4ZB 5IOIA 4YSYB 1C3TA 5AZHA 4BKSD 2EKIA 2BYFA 4W9CA 1T0QC 2PIAA 3DWMA 2W54A 4GDKA 2L52A 1HXYD 3AE2B 2INDC 5GMVA 4DHZE 1V49A 4FJVB 4LJPB 2WXGA 3WCQA 2WWZA 3QJZA 3O65B 3TIXA 1VDVA 4OZBA 1ZW7A 2JYTA 2MP2A 2FBWB 4ZRKA 4DHJB 1WJUA 1GJZA 2G4DB 2FNJB 3VVWB 1DOXA 2QSDA 5JXVA 3RNGC 2J42A 1G6JA 5AUKA 1GAQB 2WGSA 5EE3A 2ZCCA 3PREA 4XZ4A 1TS5A 3AE6B 4A9AA 3AEGB 5FR6A 2O6VD 2K6QA 1YMHE 3HUIA 3V6CB 4LNNA 2KHWB 2XNAC 2DZKA 4BFRA 3RMKC 2UYZB 2HJ1A 4IM3A 2LVOA 3FAHA 2MW5A 2JRIB 5D7GA 2WXFA 4GB9A 3URYA 2ZVOA 5C2TB 4ZRQA 3TUOA 3EFCA 3Q6BA 1EU4A 4KIKB 3GP7A 1SF0A 3TEXA 2YVCA 3ZO5B 3L17A 5BYSA 2BB6A 3BVZA 4XWTA 2BKFA 2MSED 4A8XC 2K1FA 4KV2A 3DBLB 5FKAC 2KQSA 3ML9A 4YTMB 1V5TA 2V4LA 2CKHB 5EE1A 4ZYNA 1E6EB 2YEPF 2MBHA 1WJ4A 2IPKD 2JPHA 3P4QB 4MGZE 1ACCA 3NZUA 1J7AA 2KTFA 3M3JA 2OOBB 4AS1A 3SEBA 1TS4A 1WRIA 2DZJA 4M00A 4NQLB 2OJRA 2L1AA 2N7DA 1WSPA 3AE7B 4HCNB 4DHJD 1WIAA 2FIFA 1ISNA 2LHEA 3ZNZB 2O6VA 4URKA 1VZ6A 4RF1A 4CQNA 1K8RB 2MBEA 1RFAA 3NVZA 2KOXA 3R8BA 2RDBC 1OQQA 4M02A 4KVGB 1QKZA 3R2TA 1P7FA 3ZDTA 2KWDA 1KM7A 1F9JA 2D10A 5JZEB 3GS2A 2LJ5A 2O2VA 1ZDXA 1XQQA 3N1ZC 3Q3NC 2ZNVC 2K22A 3T3OA 1UZXB 1CK1A 1SIJA 2WX0A 4M0WB 3P42A 3TCAA 3N3KB 3B1LX 1DOIA 3ONSA 1F2RC 3JW0X 4GXBA 1RWSA 1J7BA 5AEKB 1TZOA 3Q3OC 1JQ4A 1VRAB 2EKEC 2WLBA 3GZNI 1F52A 5IAAC 1WF9A 3X23A 1B1ZA 2FCSA 3ALBA 4DWFA 2INPE 1V81A 1NBFC 3MHSD 3NS1A 1D6EC 1P7EA 2KMMA 2K9XA 2M0AA 2L3ZA 2IY0B 5BMIA 2LWPA 1JCKB 3IVFA 2IO2B 1UH6A 1SEBD 1SJED 2AEHA 2XN9C 4A55A 1C1YB 3PRZA 4W9DA 2V9HA 2WQYB 5H8YE 1HA5A 2N1WA 2KWVB 1WY8A 3NZ3A 2WDQB 4II3B 3NOBA 4US9A 1JWMD 4HXDA 4RM8A 3UIPB 1A70A 2ZEQA 3IAS1 4TSSA 1AYFA 2WX1A 2SEBD 1WGKA 2BF8B 2K6DB 2KLGA 1GC7A 5L95C 3DWGC 4TQ1A 1QLBB 2BPSA 2GRIA 2PLPA 2I1JA 2YLMA 2W3RA 2MRPA 4BBNF 3L0WB 1BXTA 2KN4A 3PV1A 1SB3C 4NJ7A 1WGHA 3DHGC 3NVYA 3CMMB 1SBBB 1ET6A 1SE2A 1EWCA 1D4BA 3L08A 4LNFA 5AZGA 4HRSA 2CU1A 3AECB 2JRHA 3EHVA 4ZHOA 3A33B 1XEEA 1MI0A 2M17A 1ZP0B 2CHXA 2CR5A 5J2RA 1KLUD 2LGXA 3DVNV 2G9HD 3AV8A 1QOBA 4IUMB 1C9FA 3R3MA 3DBLI 2WXQA 3QHTA 2IYDB 2KDEB 3AH7A 4WQOB 4O1NA 3M95A 3BIID 2Z8LA 3EECA 2WXKA 2GI9A 1BT0A 4HVBA 1KLGD 2QCZA 1GPXA 3AU4A 4ZRJA 4LDTB 3R7RA 4MM3B 1WXMA 4HROA 4MJSB 1XT9B 2BB5A 4I6LB 2DLBA 5LXHA 1JRUA 1SGHA 2W82A 2W55A 1ZXIA 4RH6A 4HK2A 4YTPB 2K25A 4IM2A 2GBJA 4JGHB 3C8YA 2KC1A 4MSMB 1K50A 3HHMA 2OJWA 2WNMA 1FCLA 2M56B 1SJHD 1KLVA 4FHJA 2MJ3A 2XBBC 3C0RB 3S2AA 2X8XX 5C1ZA 4KKIA 4OVUA 3KWVA 3KQ4A 1C4CA 1TKGA 1FNWA 3AE9B 4TUUA 4FN2A 4YXDB 4WWPA 3PVLA 3ZJTA 1I7HA 3AE8B 1XXGA 1WJ6A 4XYCA 1FFUA 5BMGA 2DAFA 2CHWA 1LFDA 3IHPC 3NHEB 2FAZA 1XD3B 5AZFA 1QOAA 4IWOA 2JF5A 4I6PA 3DQVA 3VRBB 3GE3C 1C79A 1V97A 4W9JA 1NENB 2LVQA 5CHWA 1P3QU 4AJYB 3FILB 3ABVB 3KVFB 2KFJA 4GLSC 2KMAA 4ICUA 5IKCM 1P9DU 4JL9A 4HKQA 3A9KB 4HPLB
chains in the Genus database with same CATH topology
5GMVA 3N30A 4FULA 3VTVA 4IW0A 2LVPA 4DHZE 1WZ0A 3I3TB 1V49A 4HCPB 2DYOA 4FJVB 4LJPB 5E6PA 3VUXA 2WWZA 4K81A 1D3ZA 4KIKA 2BKRB 4K7WA 1YX6B 1PQSA 3QJZA 1OGWA 3A4RA 3U30A 4AJWA 4BOSC 1YX5B 1WE7A 2JZZA 2KC2A 3O65B 3TIXA 5JHBA 3HM3A 1IYFA 1GG3A 4A3PA 1ZW7A 3VTUA 4W9EA 2MP2A 3B0AA 1E8YA 2IO0B 4ZRKA 4DHJB 4EZLA 2J0JA 1WJUA 1GJZA 2G4DB 2FNJB 3VVWB 1E8WA 3VDZA 1V9JA 3ZLZA 4JQWC 1S1QB 1IP9A 2I1KA 1G6JA 3KYCD 3IFWB 1LXDA 4W9IA 3CSTA 5LLIA 4E74A 2LI5A 3H9DA 2JY6A 2L05A 4KDLB 2KFKA 4LDTD 2ZCCA 3QWZB 4NY0A 2PJHA 3PREA 4MDKE 3KUDB 2R2OA 4XZ4A 3QIJA 2L8JA 3OAWA 5FR6A 2O6VD 2JUOA 2K6QA 1V86A 3A1QA 2KLCA 4FLHA 3V6CB 4PS8A 3K9OB 4W9KA 5CHVC 1ZGUB 4AUQC 2KHWB 3X0WA 2KDIA 4FADA 2RR9A 1WMHB 1R4NI 3VQIA 2DZKA 2KN5A 3ZTDA 2REXA 4BFRA 2KNBA 2UYZB 4K7UA 4IM3A 3SD5A 5D94A 2KXJA 2LVOA 2MW5A 2JRIB 1Q0WB 4M8MA 5D7GA 4GB9A 4K7SA 5DPSA 5J17A 3L16A 1T0YA 2KX0A 4K1RB 2ZVOA 3R7QA 4LJOB 5C23A 3HK0A 3PSEB 3SHQA 3DBHI 1WXAA 4KIKB 3ZNID 1U4AA 2DENB 4NAWA 1J0GA 4AWJA 2D3GA 5DPWA 2YVCA 3ZO5B 3L17A 1E90A 4NQKE 2LZ6A 2ZJDA 3EFUA 3KYDD 2MP2B 3HIZA 4NPNA 3PLVA 2BKFA 4RMAA 2IO3B 2MSED 2KDBA 2K1FA 4KV2A 1WX7A 3Q3FA 1ZKHA 1H8CA 2KQSA 3ML9A 1RAXA 1V5TA 2V4LA 2CKHB 5LXIB 4ANWA 2A4ZA 2ZPYA 3SU8X 4ZYNA 2GBMA 1KJTA 3ENEA 2LASA 3OJ4B 3VFKA 2AL3A 3JSVB 1WM3A 4GN1A 4HPMB 2HTHA 3WAPA 1J8CA 2MBHA 1WJ4A 2NPTA 3B08A 3V62A 1L7YA 5CHFA 4DXAB 1S3SG 2N1VA 4DK5A 1I35A 2MQJA 2JPHA 3OLMD 3H7PB 3H7SA 2KVRA 3KUCB 1E8XA 4B9KA 2N9XA 2ZNVB 2NS5A 4MGZE 1P0RA 3ZNHB 3DBSA 4KZCA 5G55A 4TKNA 3PLUA 3PZDA 3QAQA 2JWZA 2D07B 4W9GA 3NZUA 3H1UA 2L7RA 1WM2A 2Y5BB 3SDLC 2KTFA 1RLFA 3M3JA 3QA8A 4RM9A 2JXXA 1EF1A 2OOBB 3ZIMA 4KDIC 3ECIA 4FHKA 1TGZB 4EZJA 3ZNGC 4GOCA 3PGEA 3PT2B 2KJ6A 2BYEA 2DZJA 2MA9B 5JH5C 3RULA 2NBWB 2ASQA 4NQLB 1YJ1A 4NAWB 2OJRA 2BYVE 2N7DA 4MGIE 5G2NA 4MEMA 3UGBB 3VH4B 3ZKJC 5CX3A 2C7MB 2FUHB 3APCA 4FJYA 5CTRC 1L2NA 4HCNB 4DHJD 3UIOB 3VAWA 2KO3A 1WIAA 2FIFA 1X1MA 4MM3A 1ISNA 1SIFA 3WAOA 4FJZA 2KJRA 1V80A 3ZNZB 4EKUA 4MJSA 1AARA 2GBKA 2O6VA 4W9LA 4URKA 4CYEA 4EUTA 1K8RB 2MBEA 2KANA 1WGGA 3DOWA 4HWIB 4WWNA 1RFAA 2LXCA 2KOXA 4ANXA 2DZIA 4ANVA 2NPTB 2K39A 4AP4C 3M63B 4KVGB 4E71A 2Z0DB 3RZFA 3UQAA 3ZTCA 3QX1A 3TL5A 3UF8A 3V61A 3ZDTA 1KM7A 1F9JA 2D10A 5JZEB 3TJPA 3KUZA 4JIOU 3VXWA 2KWUB 3AU5A 2LJ5A 2Z0EB 2C7NB 2O2VA 2M4NA 1XQQA 3A9JB 1J19A 2ZNVC 3LDZE 2MX2A 2M0XA 2FCNA 2IBIB 2J7QB 1P1AA 1WGYA 4MH0E 5KHQA 1UZXB 2KQ7A 4W9HA 3TMPB 1VCBA 2C9WB 4HDQA 3V6EB 2WX0A 3IBEA 3H6NA 4M0WB 5E6OA 3TCAA 2L76A 1WGRA 4IM0A 4AOFA 1OEYJ 3NZSA 2WYQA 4GDKB 1GUAB 3N3KB 1WXSA 4PYUA 3B1LX 1P98A 2JT4B 3ZVVA 3ZRFA 2XEWA 5D2MB 4B6WA 3ONSA 2KTRB 3JW0X 4GXBA 2HJ8A 4KSKC 2C7HA 5AEKB 2CS4A 5KHOA 3WAMA 4TQ0A 1MG8A 3HM6X 3NY5A 4E3CA 2EKEC 3GZNI 3PHWB 1CMXB 5IAAC 1WF9A 3X23A 4ICVA 2MCNB 2FCSA 2J0MA 4B95A 3ALBA 4DWFA 4EOYA 1OTRB 2FCQA 2L0TA 4WJPA 3W1SC 2JZ3B 3WANA 3U7DA 5IA7A 5BO4B 2N7EA 4A20A 4HLEA 3PHXB 2L0FA 4GIVA 1V81A 1UD7A 1NBFC 4II2B 2MBBB 3VH3B 3MHSD 4G0NB 3UQBA 2R2QA 1WI0A 1LQBA 3ZRCA 2K8CA 1YIWA 2DX5B 3APDA 1E7UA 4GDLA 2L3ZA 4WJOA 3T8MA 2IY0B 1WZ3A 3AI5A 1UELA 2LWPA 3KH0A 4LCDE 1HE8A 2B3AA 2IO2B 1UH6A 3IVFA 2AEHA 1EF5A 3OJ3A 4BKSA 5J18A 2V1YA 2K8BA 2KD0A 1C1YB 3PRZA 1EO6A 4W9DA 2KFKB 2DAJA 2DHZA 2N1WA 2N9PC 2D11A 4GGQA 1WGDA 2KWVB 2M8SA 1WY8A 4IWPA 2BWES 5DCNA 1WR6E 3A1QB 3ML8A 4II3B 1NDDA 2C5LC 3QCAA 3NOBA 3VHTC 2RSUA 4ZDVA 1Q1OA 3AULA 4HXDA 1WFYA 2NBVB 4RM8A 2LXAA 3UIPB 2LGDA 3QK0A 3BY4B 2RGFA 1GC6A 4BVUC 2ZEQA 4ANUA 2AWTA 4A3OA 2K8HA 3WA0A 2WX1A 4GSWA 3MTNB 2BF8B 2NR2A 2K6DB 3PTFC 4XX5A 2AYOB 2Z59B 1UBIA 3RCZA 3PRMB 3L10B 1NI2A 2KLGA 1GC7A 4JLCA 5L95C 1EUVB 3GOEA 5TR5A 3T9LA 4EFOA 1TBEA 1V6EA 1H4RA 4TQ1A 1V2YA 2BPSA 2G3QB 5HKHA 1VD2A 2AL6A 2BWFA 2I1JA 2YLMA 3DCGA 3D32A 4W9FA 3RZWC 2MRPA 2LRWA 3JVZX 4IWQA 4BOZB 3CF6E 3DVNU 4F7ZA 1LM8B 2D2QA 1RRBA 2MWSB 3L0WB 2KMCA 3L13A 4BBNF 2GOWA 3PV1A 4EEWA 3PS6A 2FCMA 3A4SC 3RD2A 3U8ZA 1WMHA 3L54A 1QZEA 3DVGX 4BBNC 4NJ7A 1WE6A 1WGHA 3CMMB 2KKCA 2EMSA 3K9PB 1YD8U 2IZVB 3L08A 3APFA 2PE9A 5AZGA 3TBLD 2CU1A 1IPGA 1WXVA 4NNJB 2JRHA 2N9EB 3EC8A 3EHVA 3V60A 3A33B 3UINB 2G4SA 2G45B 4KZ0A 4PS7A 1WRDB 2M17A 3N32A 2CHXA 4F1SA 3RUIB 5DPRA 2CR5A 5J2RA 4XC2A 3ZDMC 3LJ3A 5JHAA 4WJNA 2LGXA 4OVVA 3DVNV 4MSQB 4IUMB 1Y8RC 2MBOA 3R3MA 2LGYA 4HJKA 4I6NB 4PYZA 4IG7B 2ZVNA 4EZKA 3DBLI 4FBJB 4P7IA 2LD9A 4G50A 4ASWC 3BINA 2WDTB 4J6IA 2HD5B 2PE6B 3QHTA 2IYDB 2KDEB 1Q5WB 1KOTA 3PRPB 3VUYA 4WQOB 3DBRI 2ZCBA 4NJ6A 3M95A 3CSFA 2XK5A 3EECA 3JSVA 4WAAA 1M94A 2JVCA 1WX9A 1FXTB 2GBNA 1OEYA 1TTNA 4GMVA 4CHKA 1WJNA 4WJQA 2GMIC 2L00B 1BT0A 3H7PA 4F8CB 4HVBA 2A5UA 4M8NA 1R4MI 3AU4A 3PPAA 2C60A 4BKGA 1WX8A 3RT3B 4G11A 4ZRJA 4MGYE 2IY1B 4LDTB 3R7RA 3NS8A 5EDSA 1UBQA 4WWOA 4MGKE 1WXMA 2QHOA 4MJSB 1XT9B 3R66C 2O6VB 4I6LB 5LXHA 1JRUA 2MBQA 2LRUA 3VTWA 1I42A 4KSLC 1SGHA 2V3SA 3KW5B 4FA6A 4CO7A 2DZMA 2RPQA 3M62B 2GBRA 4HK2A 1E5WA 4DHZB 2K25A 3DPDA 2NCNA 3IG3A 4IM2A 2GBJA 4HDOA 4JGHB 2KC1A 2DYMA 4MSMB 1YQBA 4DBGA 3MJWA 3QQ8B 4DDGD 2J0KA 3HHMA 4N9F4 3QARA 1SE9A 2KDFB 3A9KA 3JYUA 2O2VB 2PEAA 2EMTA 1KLVA 4FHJA 2DYBA 2KZRA 4MELA 3VUWA 2XBBC 3C0RB 4YL8A 2PPHA 1Z5SB 4GU2A 3S2AA 3AXCA 5C1ZA 2KJHB 1WR1A 4OVUA 5D6JB 3W1SA 2HE7A 2UWQA 3Q3JA 2MLBA 3DVGY 1WYWB 2NVUI 2IO1B 2KK8A 4ZRIA 2BGFA 3QC8B 5E6NA 2XK5B 3RYTA 4IC7B 4TUUA 4FN2A 3W1YA 2N4FA 1V5OA 4WWPA 3ZW3A 1WH3A 2CHZA 2VRRB 3PVLA 5L83A 3WIMA 5DPTA 1WJ6A 1Z2MA 1GNUA 2KWCA 2M1MA 2DAFA 2CHWA 1LFDA 3IHPC 2ZZPB 2NBUA 2ZPNA 3A9JA 4G3XB 3NHEB 2FAZA 1E8ZA 1A5RA 3DDCB 1UGMA 1XD3B 5AZFA 3WALA 1OQYA 1TZ1A 4IWOA 2JF5A 4DDID 4I6PA 4X57B 3DQVA 2W9NA 3P2BA 1C3TA 4W9JA 5AZHA 4BKSD 2BYFA 4W9CA 2LVQA 5CHWA 1P3QU 2LUEA 4AJYB 2KX3A 1E7VA 2RD0A 4GDLB 4GDKA 3KVFB 4TV3A 2KFJA 3ZUNA 4BKTA 2KMAA 4ICUA 1P9DU 4JL9A 3A9KB 2FIDA 4PS3A 4HPLB 2KTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMV A;  3N30 A;  4FUL A;  3VTV A;  4IW0 A;  2LVP A;  4DHZ E;  1WZ0 A;  3I3T B;  1V49 A;  4HCP B;  2DYO A;  4FJV B;  4LJP B;  5E6P A;  3VUX A;  2WWZ A;  4K81 A;  1D3Z A;  4KIK A;  2BKR B;  4K7W A;  1YX6 B;  1PQS A;  3QJZ A;  1OGW A;  3A4R A;  3U30 A;  4AJW A;  4BOS C;  1YX5 B;  1WE7 A;  2JZZ A;  2KC2 A;  3O65 B;  3TIX A;  5JHB A;  3HM3 A;  1IYF A;  1GG3 A;  4A3P A;  1ZW7 A;  3VTU A;  4W9E A;  2MP2 A;  3B0A A;  1E8Y A;  2IO0 B;  4ZRK A;  4DHJ B;  4EZL A;  2J0J A;  1WJU A;  1GJZ A;  2G4D B;  2FNJ B;  3VVW B;  1E8W A;  3VDZ A;  1V9J A;  3ZLZ A;  4JQW C;  1S1Q B;  1IP9 A;  2I1K A;  1G6J A;  3KYC D;  3IFW B;  1LXD A;  4W9I A;  3CST A;  5LLI A;  4E74 A;  2LI5 A;  3H9D A;  2JY6 A;  2L05 A;  4KDL B;  2KFK A;  4LDT D;  2ZCC A;  3QWZ B;  4NY0 A;  2PJH A;  3PRE A;  4MDK E;  3KUD B;  2R2O A;  4XZ4 A;  3QIJ A;  2L8J A;  3OAW A;  5FR6 A;  2O6V D;  2JUO A;  2K6Q A;  1V86 A;  3A1Q A;  2KLC A;  4FLH A;  3V6C B;  4PS8 A;  3K9O B;  4W9K A;  5CHV C;  1ZGU B;  4AUQ C;  2KHW B;  3X0W A;  2KDI A;  4FAD A;  2RR9 A;  1WMH B;  1R4N I;  3VQI A;  2DZK A;  2KN5 A;  3ZTD A;  2REX A;  4BFR A;  2KNB A;  2UYZ B;  4K7U A;  4IM3 A;  3SD5 A;  5D94 A;  2KXJ A;  2LVO A;  2MW5 A;  2JRI B;  1Q0W B;  4M8M A;  5D7G A;  4GB9 A;  4K7S A;  5DPS A;  5J17 A;  3L16 A;  1T0Y A;  2KX0 A;  4K1R B;  2ZVO A;  3R7Q A;  4LJO B;  5C23 A;  3HK0 A;  3PSE B;  3SHQ A;  3DBH I;  1WXA A;  4KIK B;  3ZNI D;  1U4A A;  2DEN B;  4NAW A;  1J0G A;  4AWJ A;  2D3G A;  5DPW A;  2YVC A;  3ZO5 B;  3L17 A;  1E90 A;  4NQK E;  2LZ6 A;  2ZJD A;  3EFU A;  3KYD D;  2MP2 B;  3HIZ A;  4NPN A;  3PLV A;  2BKF A;  4RMA A;  2IO3 B;  2MSE D;  2KDB A;  2K1F A;  4KV2 A;  1WX7 A;  3Q3F A;  1ZKH A;  1H8C A;  2KQS A;  3ML9 A;  1RAX A;  1V5T A;  2V4L A;  2CKH B;  5LXI B;  4ANW A;  2A4Z A;  2ZPY A;  3SU8 X;  4ZYN A;  2GBM A;  1KJT A;  3ENE A;  2LAS A;  3OJ4 B;  3VFK A;  2AL3 A;  3JSV B;  1WM3 A;  4GN1 A;  4HPM B;  2HTH A;  3WAP A;  1J8C A;  2MBH A;  1WJ4 A;  2NPT A;  3B08 A;  3V62 A;  1L7Y A;  5CHF A;  4DXA B;  1S3S G;  2N1V A;  4DK5 A;  1I35 A;  2MQJ A;  2JPH A;  3OLM D;  3H7P B;  3H7S A;  2KVR A;  3KUC B;  1E8X A;  4B9K A;  2N9X A;  2ZNV B;  2NS5 A;  4MGZ E;  1P0R A;  3ZNH B;  3DBS A;  4KZC A;  5G55 A;  4TKN A;  3PLU A;  3PZD A;  3QAQ A;  2JWZ A;  2D07 B;  4W9G A;  3NZU A;  3H1U A;  2L7R A;  1WM2 A;  2Y5B B;  3SDL C;  2KTF A;  1RLF A;  3M3J A;  3QA8 A;  4RM9 A;  2JXX A;  1EF1 A;  2OOB B;  3ZIM A;  4KDI C;  3ECI A;  4FHK A;  1TGZ B;  4EZJ A;  3ZNG C;  4GOC A;  3PGE A;  3PT2 B;  2KJ6 A;  2BYE A;  2DZJ A;  2MA9 B;  5JH5 C;  3RUL A;  2NBW B;  2ASQ A;  4NQL B;  1YJ1 A;  4NAW B;  2OJR A;  2BYV E;  2N7D A;  4MGI E;  5G2N A;  4MEM A;  3UGB B;  3VH4 B;  3ZKJ C;  5CX3 A;  2C7M B;  2FUH B;  3APC A;  4FJY A;  5CTR C;  1L2N A;  4HCN B;  4DHJ D;  3UIO B;  3VAW A;  2KO3 A;  1WIA A;  2FIF A;  1X1M A;  4MM3 A;  1ISN A;  1SIF A;  3WAO A;  4FJZ A;  2KJR A;  1V80 A;  3ZNZ B;  4EKU A;  4MJS A;  1AAR A;  2GBK A;  2O6V A;  4W9L A;  4URK A;  4CYE A;  4EUT A;  1K8R B;  2MBE A;  2KAN A;  1WGG A;  3DOW A;  4HWI B;  4WWN A;  1RFA A;  2LXC A;  2KOX A;  4ANX A;  2DZI A;  4ANV A;  2NPT B;  2K39 A;  4AP4 C;  3M63 B;  4KVG B;  4E71 A;  2Z0D B;  3RZF A;  3UQA A;  3ZTC A;  3QX1 A;  3TL5 A;  3UF8 A;  3V61 A;  3ZDT A;  1KM7 A;  1F9J A;  2D10 A;  5JZE B;  3TJP A;  3KUZ A;  4JIO U;  3VXW A;  2KWU B;  3AU5 A;  2LJ5 A;  2Z0E B;  2C7N B;  2O2V A;  2M4N A;  1XQQ A;  3A9J B;  1J19 A;  2ZNV C;  3LDZ E;  2MX2 A;  2M0X A;  2FCN A;  2IBI B;  2J7Q B;  1P1A A;  1WGY A;  4MH0 E;  5KHQ A;  1UZX B;  2KQ7 A;  4W9H A;  3TMP B;  1VCB A;  2C9W B;  4HDQ A;  3V6E B;  2WX0 A;  3IBE A;  3H6N A;  4M0W B;  5E6O A;  3TCA A;  2L76 A;  1WGR A;  4IM0 A;  4AOF A;  1OEY J;  3NZS A;  2WYQ A;  4GDK B;  1GUA B;  3N3K B;  1WXS A;  4PYU A;  3B1L X;  1P98 A;  2JT4 B;  3ZVV A;  3ZRF A;  2XEW A;  5D2M B;  4B6W A;  3ONS A;  2KTR B;  3JW0 X;  4GXB A;  2HJ8 A;  4KSK C;  2C7H A;  5AEK B;  2CS4 A;  5KHO A;  3WAM A;  4TQ0 A;  1MG8 A;  3HM6 X;  3NY5 A;  4E3C A;  2EKE C;  3GZN I;  3PHW B;  1CMX B;  5IAA C;  1WF9 A;  3X23 A;  4ICV A;  2MCN B;  2FCS A;  2J0M A;  4B95 A;  3ALB A;  4DWF A;  4EOY A;  1OTR B;  2FCQ A;  2L0T A;  4WJP A;  3W1S C;  2JZ3 B;  3WAN A;  3U7D A;  5IA7 A;  5BO4 B;  2N7E A;  4A20 A;  4HLE A;  3PHX B;  2L0F A;  4GIV A;  1V81 A;  1UD7 A;  1NBF C;  4II2 B;  2MBB B;  3VH3 B;  3MHS D;  4G0N B;  3UQB A;  2R2Q A;  1WI0 A;  1LQB A;  3ZRC A;  2K8C A;  1YIW A;  2DX5 B;  3APD A;  1E7U A;  4GDL A;  2L3Z A;  4WJO A;  3T8M A;  2IY0 B;  1WZ3 A;  3AI5 A;  1UEL A;  2LWP A;  3KH0 A;  4LCD E;  1HE8 A;  2B3A A;  2IO2 B;  1UH6 A;  3IVF A;  2AEH A;  1EF5 A;  3OJ3 A;  4BKS A;  5J18 A;  2V1Y A;  2K8B A;  2KD0 A;  1C1Y B;  3PRZ A;  1EO6 A;  4W9D A;  2KFK B;  2DAJ A;  2DHZ A;  2N1W A;  2N9P C;  2D11 A;  4GGQ A;  1WGD A;  2KWV B;  2M8S A;  1WY8 A;  4IWP A;  2BWE S;  5DCN A;  1WR6 E;  3A1Q B;  3ML8 A;  4II3 B;  1NDD A;  2C5L C;  3QCA A;  3NOB A;  3VHT C;  2RSU A;  4ZDV A;  1Q1O A;  3AUL A;  4HXD A;  1WFY A;  2NBV B;  4RM8 A;  2LXA A;  3UIP B;  2LGD A;  3QK0 A;  3BY4 B;  2RGF A;  1GC6 A;  4BVU C;  2ZEQ A;  4ANU A;  2AWT A;  4A3O A;  2K8H A;  3WA0 A;  2WX1 A;  4GSW A;  3MTN B;  2BF8 B;  2NR2 A;  2K6D B;  3PTF C;  4XX5 A;  2AYO B;  2Z59 B;  1UBI A;  3RCZ A;  3PRM B;  3L10 B;  1NI2 A;  2KLG A;  1GC7 A;  4JLC A;  5L95 C;  1EUV B;  3GOE A;  5TR5 A;  3T9L A;  4EFO A;  1TBE A;  1V6E A;  1H4R A;  4TQ1 A;  1V2Y A;  2BPS A;  2G3Q B;  5HKH A;  1VD2 A;  2AL6 A;  2BWF A;  2I1J A;  2YLM A;  3DCG A;  3D32 A;  4W9F A;  3RZW C;  2MRP A;  2LRW A;  3JVZ X;  4IWQ A;  4BOZ B;  3CF6 E;  3DVN U;  4F7Z A;  1LM8 B;  2D2Q A;  1RRB A;  2MWS B;  3L0W B;  2KMC A;  3L13 A;  4BBN F;  2GOW A;  3PV1 A;  4EEW A;  3PS6 A;  2FCM A;  3A4S C;  3RD2 A;  3U8Z A;  1WMH A;  3L54 A;  1QZE A;  3DVG X;  4BBN C;  4NJ7 A;  1WE6 A;  1WGH A;  3CMM B;  2KKC A;  2EMS A;  3K9P B;  1YD8 U;  2IZV B;  3L08 A;  3APF A;  2PE9 A;  5AZG A;  3TBL D;  2CU1 A;  1IPG A;  1WXV A;  4NNJ B;  2JRH A;  2N9E B;  3EC8 A;  3EHV A;  3V60 A;  3A33 B;  3UIN B;  2G4S A;  2G45 B;  4KZ0 A;  4PS7 A;  1WRD B;  2M17 A;  3N32 A;  2CHX A;  4F1S A;  3RUI B;  5DPR A;  2CR5 A;  5J2R A;  4XC2 A;  3ZDM C;  3LJ3 A;  5JHA A;  4WJN A;  2LGX A;  4OVV A;  3DVN V;  4MSQ B;  4IUM B;  1Y8R C;  2MBO A;  3R3M A;  2LGY A;  4HJK A;  4I6N B;  4PYZ A;  4IG7 B;  2ZVN A;  4EZK A;  3DBL I;  4FBJ B;  4P7I A;  2LD9 A;  4G50 A;  4ASW C;  3BIN A;  2WDT B;  4J6I A;  2HD5 B;  2PE6 B;  3QHT A;  2IYD B;  2KDE B;  1Q5W B;  1KOT A;  3PRP B;  3VUY A;  4WQO B;  3DBR I;  2ZCB A;  4NJ6 A;  3M95 A;  3CSF A;  2XK5 A;  3EEC A;  3JSV A;  4WAA A;  1M94 A;  2JVC A;  1WX9 A;  1FXT B;  2GBN A;  1OEY A;  1TTN A;  4GMV A;  4CHK A;  1WJN A;  4WJQ A;  2GMI C;  2L00 B;  1BT0 A;  3H7P A;  4F8C B;  4HVB A;  2A5U A;  4M8N A;  1R4M I;  3AU4 A;  3PPA A;  2C60 A;  4BKG A;  1WX8 A;  3RT3 B;  4G11 A;  4ZRJ A;  4MGY E;  2IY1 B;  4LDT B;  3R7R A;  3NS8 A;  5EDS A;  1UBQ A;  4WWO A;  4MGK E;  1WXM A;  2QHO A;  4MJS B;  1XT9 B;  3R66 C;  2O6V B;  4I6L B;  5LXH A;  1JRU A;  2MBQ A;  2LRU A;  3VTW A;  1I42 A;  4KSL C;  1SGH A;  2V3S A;  3KW5 B;  4FA6 A;  4CO7 A;  2DZM A;  2RPQ A;  3M62 B;  2GBR A;  4HK2 A;  1E5W A;  4DHZ B;  2K25 A;  3DPD A;  2NCN A;  3IG3 A;  4IM2 A;  2GBJ A;  4HDO A;  4JGH B;  2KC1 A;  2DYM A;  4MSM B;  1YQB A;  4DBG A;  3MJW A;  3QQ8 B;  4DDG D;  2J0K A;  3HHM A;  4N9F 4;  3QAR A;  1SE9 A;  2KDF B;  3A9K A;  3JYU A;  2O2V B;  2PEA A;  2EMT A;  1KLV A;  4FHJ A;  2DYB A;  2KZR A;  4MEL A;  3VUW A;  2XBB C;  3C0R B;  4YL8 A;  2PPH A;  1Z5S B;  4GU2 A;  3S2A A;  3AXC A;  5C1Z A;  2KJH B;  1WR1 A;  4OVU A;  5D6J B;  3W1S A;  2HE7 A;  2UWQ A;  3Q3J A;  2MLB A;  3DVG Y;  1WYW B;  2NVU I;  2IO1 B;  2KK8 A;  4ZRI A;  2BGF A;  3QC8 B;  5E6N A;  2XK5 B;  3RYT A;  4IC7 B;  4TUU A;  4FN2 A;  3W1Y A;  2N4F A;  1V5O A;  4WWP A;  3ZW3 A;  1WH3 A;  2CHZ A;  2VRR B;  3PVL A;  5L83 A;  3WIM A;  5DPT A;  1WJ6 A;  1Z2M A;  1GNU A;  2KWC A;  2M1M A;  2DAF A;  2CHW A;  1LFD A;  3IHP C;  2ZZP B;  2NBU A;  2ZPN A;  3A9J A;  4G3X B;  3NHE B;  2FAZ A;  1E8Z A;  1A5R A;  3DDC B;  1UGM A;  1XD3 B;  5AZF A;  3WAL A;  1OQY A;  1TZ1 A;  4IWO A;  2JF5 A;  4DDI D;  4I6P A;  4X57 B;  3DQV A;  2W9N A;  3P2B A;  1C3T A;  4W9J A;  5AZH A;  4BKS D;  2BYF A;  4W9C A;  2LVQ A;  5CHW A;  1P3Q U;  2LUE A;  4AJY B;  2KX3 A;  1E7V A;  2RD0 A;  4GDL B;  4GDK A;  3KVF B;  4TV3 A;  2KFJ A;  3ZUN A;  4BKT A;  2KMA A;  4ICU A;  1P9D U;  4JL9 A;  3A9K B;  2FID A;  4PS3 A;  4HPL B;  2KTR A; 
#chains in the Genus database with same CATH topology
 1K51 A;  3N30 A;  3BVG A;  3I3T B;  1I4R A;  2DYO A;  4HCP B;  3VUX A;  1FM0 D;  1I4P A;  4LLG M;  5FR3 A;  3RNF C;  2BKR B;  1PQS A;  3A4R A;  2KC2 A;  2JZZ A;  4K3C A;  4NZL B;  1GG3 A;  3VTU A;  2WXI A;  2IO0 B;  4EZL A;  2J0J A;  1N63 A;  4OHJ A;  3ZLZ A;  2AX5 A;  2K5P A;  3KYC D;  1UF0 A;  5HHD G;  4W9I A;  5LLI A;  3BYY B;  1EU3 A;  2PW9 A;  2LI5 A;  2JY6 A;  4LDT D;  2PJH A;  3MFG A;  2BS4 B;  3QIJ A;  2L8J A;  2JUO A;  3K9O B;  4W9K A;  1ZGU B;  4AUQ C;  2KVZ A;  3X0W A;  1WMH B;  3HRD D;  3SD5 A;  2WXN A;  1Q0W B;  4K7S A;  5DPS A;  1AN8 A;  2OED A;  1T0Y A;  1JW9 D;  3SHQ A;  3DBH I;  2X38 A;  2DEN B;  4NAW A;  4AWJ A;  2D3G A;  1N61 A;  2D5G A;  1NYQ A;  2LZ6 A;  1TKY A;  3EFU A;  3KYD D;  2D3B A;  4HPP A;  3O13 A;  3HIZ A;  2IO3 B;  3SFD B;  1WX7 A;  1FRR A;  1ZKH A;  4KGS A;  1V8C A;  3MP9 A;  3Q14 C;  2ZPY A;  1NVI D;  2LAS A;  3VFK A;  1J8C A;  4GN1 A;  3JSV B;  2JU6 X;  2NPT A;  3PO0 A;  2BS3 B;  1L7Y A;  4XE0 A;  5CHF A;  1S3S G;  4A90 A;  3OLM D;  3H7P B;  3LB8 C;  2KVR A;  2V4I B;  3KUC B;  2N9X A;  2ZNV B;  2NS5 A;  1PDX A;  1P0R A;  4NJC A;  3BWU D;  3CWI A;  3Q2A C;  5G55 A;  2IGD A;  3PZD A;  1CJE A;  1WM2 A;  1ZE3 D;  1RLF A;  2LEK A;  3ZIM A;  2DNF A;  3PGE A;  4XGA B;  3RUL A;  2NBW B;  3AE1 B;  3FKY A;  2BYV E;  4MEM A;  1YOV B;  4KX6 B;  1TY2 A;  2RMM A;  2AQ2 B;  1BUI C;  1LGR A;  3PZ8 A;  4MM3 A;  3WAO A;  2J4X A;  2KJR A;  1ZDV A;  2UU7 A;  4MJS A;  1KTK A;  1AAR A;  2GBK A;  4W9L A;  1MG4 A;  2KAN A;  3R2I A;  1WGG A;  1RM6 C;  2LXC A;  2KAC A;  2Q5W D;  4XDC A;  4ANV A;  2K39 A;  4AP4 C;  2CJO A;  4E71 A;  3UQA A;  2NTS A;  1PYW D;  3U7Z A;  3TJP A;  5IP4 D;  3KUZ A;  1TY0 A;  3AU5 A;  2Z0E B;  4REZ A;  2C7N B;  4ITK A;  2M4N A;  3FC4 A;  1QF6 A;  4D2K A;  2MX2 A;  3DHH C;  2FCN A;  2IBI B;  1P1A A;  5KHQ A;  2KQ7 A;  4P1B C;  2MEK A;  1VCB A;  1Q10 A;  4IM0 A;  1OEY J;  1N60 A;  1GUA B;  4PYU A;  3EGR A;  2QIE B;  3ZRF A;  2XEW A;  5D2M B;  2LGS A;  1IUE A;  2KTR B;  1T6B X;  1VR9 A;  2C7H A;  4IDI A;  4TQ0 A;  3HM6 X;  1FNU A;  4M01 A;  4B95 A;  2W3S A;  2FCQ A;  3NUH B;  2JZ3 B;  5IA7 A;  3U7D A;  2ZW1 A;  2N7E A;  4A20 A;  1UD7 A;  4G0N B;  4RGT A;  3UQB A;  1WI0 A;  1XLP A;  4N6E B;  3FIL A;  3ZRC A;  1YIW A;  2DX5 B;  1UEL A;  3IXS A;  4XWW A;  3AB5 A;  1YJJ A;  3P63 A;  1EF5 A;  4BKS A;  2V1Y A;  4RF0 A;  2K8B A;  1GB1 A;  5IO9 A;  5I4D A;  1BML C;  3I5J C;  2KFK B;  4RNA A;  1WR6 E;  3A1Q B;  3ML8 A;  2C5L C;  4R3D A;  2RSU A;  4ARI A;  4ZDV A;  1Q1O A;  3AUL A;  1R4N B;  2NBV B;  2LXA A;  2I38 A;  3P4S B;  4L2Y A;  2M19 A;  3QK0 A;  3BY4 B;  2RGF A;  1MHX A;  1GOZ A;  1L5P A;  4ANU A;  2AWT A;  4A3O A;  2K8H A;  2GB1 A;  4GSW A;  1KH0 A;  3PTF C;  2AYO B;  3AEE B;  3PRM B;  1HTO A;  2WDR B;  1V2Y A;  3DCG A;  3D32 A;  3RZW C;  3U4E G;  2WHI A;  4IWQ A;  4BOZ B;  1LM8 B;  2JSV X;  1RRB A;  2KMC A;  3L13 A;  1XCQ L;  2OHF A;  4EEW A;  1CQV A;  1WMH A;  2BT6 A;  1ZPS A;  2EMS A;  3K9P B;  2LJI A;  3APF A;  4RGO S;  2KYW A;  2JYE A;  1WXV A;  4NNJ B;  4PT5 A;  3V60 A;  4DQO C;  3UIN B;  2QEJ C;  1FFV A;  4KZ0 A;  4DXF A;  2FE8 A;  4LNK A;  3I57 A;  3ZDM C;  1T0R C;  5JHA A;  4WJN A;  3NVV A;  3W9C B;  3IAM 1;  4QAY A;  1Y8R C;  2MBO A;  2LGY A;  4P7I A;  1NEK B;  2ACZ B;  4ASW C;  4A6Q A;  1K52 A;  3PRP B;  3RNE C;  2ZCB A;  3CSF A;  2XK5 A;  3JSV A;  1TTN A;  5H92 C;  3AM9 A;  2GMI C;  2L00 B;  3H7P A;  1C4P A;  1R4M I;  3PPA A;  2C60 A;  2H89 B;  4MGY E;  4ZRP A;  1UBQ A;  4WWO A;  3VTW A;  2LHD A;  2V3S A;  4CO7 A;  1FXI A;  2DZM A;  2RPQ A;  2DWQ A;  3OG5 A;  1EM7 A;  4ZOH C;  3IG3 A;  1QT9 A;  1YQB A;  2PVO D;  1SE4 A;  1R7S A;  1F0Z A;  2PEA A;  2DYB A;  3VUW A;  2PPH A;  4GU2 A;  3AE3 B;  3AXC A;  1WR1 A;  4LTU A;  4JE3 B;  4N59 A;  3DBR B;  2IO1 B;  4IOI E;  1E7P B;  3QC8 B;  5E6N A;  3MC0 B;  4IC7 B;  4KKJ A;  1V5O A;  2CHZ A;  1E10 A;  5L83 A;  1Z2M A;  4H2A A;  4WAF A;  2ZZP B;  2ZPN A;  2L32 A;  4P16 A;  5D3D A;  5E6J A;  1OQY A;  1TZ1 A;  3GE8 C;  4K3B A;  5G5H A;  4DDI D;  2V3P A;  2W9N A;  3P2B A;  4JWU C;  1TT5 B;  2LUE A;  1E7V A;  2RD0 A;  1FRD A;  4GDL B;  4TV3 A;  2KDM A;  4PS3 A;  2KTR A;  4FUL A;  1YJI A;  2LVP A;  1WZ0 A;  3BK1 A;  4KIK A;  4K7W A;  1YX6 B;  3U30 A;  4BOS C;  1YX5 B;  5JHB A;  3HM3 A;  1IYF A;  3B0A A;  1E8Y A;  1J7C A;  1V1P B;  4JX1 C;  3VDZ A;  3Q69 A;  3AED B;  2I1K A;  5FK9 C;  3IFW B;  1TS3 A;  1L0Y B;  1ESF A;  4N58 A;  1LXD A;  1TJE A;  4EE2 A;  1TS2 A;  4E74 A;  1CZP A;  2L05 A;  2KFK A;  3QWZ B;  4NY0 A;  3OAW A;  1PFD A;  3A1Q A;  2KLC A;  2QDF A;  4FLH A;  2D3C A;  4FAD A;  3IT6 B;  2K0P A;  1R4N I;  1FXA A;  3VQI A;  3ZJU A;  3AE5 B;  2KN5 A;  2JZP A;  2KNB A;  4M8M A;  5J17 A;  2BW2 A;  3L16 A;  2WP9 B;  2KX0 A;  4K1R B;  5C23 A;  3HK0 A;  3Q8C A;  1L0X B;  1WXA A;  1U4A A;  1WXQ A;  5DPW A;  1E90 A;  4WUR A;  2MP2 B;  1E9M A;  4ACF A;  4NPN A;  1WWT A;  4RMA A;  5LNK 1;  2KDB A;  4WWM A;  1FIQ A;  3Q8F A;  2AQ1 B;  3Q3F A;  1H8C A;  3PZ7 A;  1C76 A;  4WQM A;  4B0M A;  2HDE A;  5LXI B;  3TEY A;  3SU8 X;  1KJT A;  3ENE A;  5HG2 A;  2AL3 A;  3B08 A;  2N0S B;  3EA6 A;  2N1V A;  1I35 A;  2RDH A;  5EE9 A;  1E8X A;  1KF6 B;  4B9K A;  4KZC A;  3Q3M C;  3IT4 B;  4TKN A;  4W9G A;  2BYT A;  2JWZ A;  5AUI A;  2L7R A;  2Y5B B;  3SDL C;  3NRZ A;  2RDG A;  2INC C;  1QOF A;  3QA8 A;  3MJ5 A;  4RM9 A;  2JXX A;  4M0W A;  4MAC A;  3ECI A;  4FHK A;  4EZJ A;  3ZNG C;  2L83 A;  3PT2 B;  2WXM A;  2BYE A;  2WDV B;  5JH5 C;  2ASQ A;  1YJ1 A;  3N20 C;  4MGI E;  3LXF A;  3UGB B;  2WS3 B;  3VH4 B;  3ZKJ C;  5CX3 A;  5CTR C;  3APC A;  1L2N A;  3BYT B;  1X1M A;  1RYJ A;  3BZD B;  4EKU A;  3DOW A;  4HWI B;  1HQR D;  1I4G A;  2J53 A;  1SSN A;  1JWU D;  3M63 B;  3N9Y C;  3RZF A;  2IGG A;  1C77 A;  3HVD A;  3QX1 A;  3UF8 A;  3AEA B;  1FMA D;  2SAK A;  3VR9 B;  1M4V A;  4TMA B;  3N1X C;  3LDZ E;  2J7Q B;  1WGY A;  4MH0 E;  1JRO A;  4W9H A;  2C9W B;  3V6E B;  3IBE A;  3H6N A;  5E6O A;  1PGX A;  1WGR A;  4AOF A;  2WYQ A;  4RGM A;  2PKO A;  1WXS A;  1P98 A;  2JT4 B;  3ZVV A;  1L4D B;  1F77 A;  4KSK C;  3WAM A;  3OWE B;  1MG8 A;  1VJK A;  4E3C A;  1UUP A;  1CMX B;  4ICV A;  4WIP A;  2MCN B;  4ZHP A;  2J0M A;  1OTR B;  3W1S C;  4OZA A;  3WAN A;  5BO4 B;  2TSS A;  3ETR A;  1HEZ E;  1YN5 A;  3APD A;  4GDL A;  1E7U A;  2BS2 B;  2B3A A;  2JX5 A;  2KD0 A;  2WXP A;  1EO6 A;  1IGC A;  2DHZ A;  5D3I B;  1DYQ A;  4BAX A;  4GGQ A;  1N62 A;  2BWE S;  5DCN A;  1I4Q A;  2DBY A;  3VHT C;  2CJN A;  3MHZ A;  4AQ7 A;  4LNI A;  2LGD A;  1V1P A;  1JWB D;  1L6V A;  1MFW A;  2NR2 A;  2RPV A;  3SFE B;  3RCZ A;  4JLC A;  1EUV B;  3T9L A;  5BMH A;  1TBE A;  1V6E A;  3TSS A;  3UI3 A;  1H4R A;  2G3Q B;  4BZA A;  5HKH A;  2AL6 A;  2BWF A;  4W9F A;  2CU3 A;  2LRW A;  3JVZ X;  4F7Z A;  3CF6 E;  3DVN U;  1NI3 A;  3PS6 A;  1TYG B;  3U8Z A;  3L54 A;  1N6Z A;  3J9C A;  4BBN C;  2ONQ A;  5HI1 A;  1WE6 A;  2WXR A;  4HEA 1;  2HTM E;  2IZV B;  1I4X A;  5T8I A;  2WU5 B;  1SXT A;  1E0Z A;  3P4R B;  2G1E A;  3ZXV A;  2G4S A;  4PS7 A;  4OVZ A;  3N32 A;  5DPR A;  3ZYY X;  4XC2 A;  3AMZ A;  3RPF C;  4OVV A;  4C80 A;  4MSQ B;  1L0V B;  4HJK A;  4I6N B;  4EZK A;  4FBJ B;  2LD9 A;  2HD5 B;  2PE6 B;  1Q5W B;  2BBC A;  3MC8 A;  2Y5C A;  1KOT A;  3U2S C;  2H88 B;  1AWD A;  2JXT A;  4WAA A;  1M94 A;  1WX9 A;  1FXT B;  2GBN A;  4GMV A;  4CHK A;  4RGN A;  1WJN A;  5EE0 A;  1QIL A;  4ARC A;  4M8N A;  4BKG A;  1WX8 A;  3RT3 B;  4G11 A;  5EDS A;  2IY1 B;  3NS8 A;  1TIF A;  4MGK E;  2QHO A;  4C7Z A;  3R66 C;  4Q2J A;  1I42 A;  4KSL C;  3KW5 B;  4FA6 A;  3M62 B;  1E5W A;  4US8 A;  2NCN A;  4HDO A;  2DYM A;  4MH8 A;  2QMT A;  2E6X A;  3MJW A;  4DDG D;  2J0K A;  3QAR A;  1SE9 A;  2KDF B;  3A9K A;  3JYU A;  2MHJ A;  2EMT A;  3SR6 A;  2KZR A;  4MEL A;  4YL8 A;  1MHH E;  3BVM A;  1Z5S B;  2KJH B;  1PUT A;  3AE4 B;  2HE7 A;  5TSS A;  3DVG Y;  1WYW B;  2NVU I;  4ZRI A;  1L6U A;  1MJD A;  2KK8 A;  1ET9 A;  3RYT A;  3W1Y A;  3ZW3 A;  2VRR B;  1GNU A;  2M1M A;  1K53 A;  3V05 A;  1E8Z A;  1A5R A;  3DDC B;  1UGM A;  3WAL A;  1ZUD 2;  1YQ3 B;  4P6V F;  4X57 B;  3NVW A;  3Q8A A;  3BK2 A;  2LUM A;  2KX3 A;  3ZUN A;  4JPS A;  4BKT A;  3EUB 2;  1EWY C;  2FID A;  1MPE A;  3RI7 C;  3VTV A;  2VH1 A;  4IW0 A;  1IGD A;  3RNB C;  5E6P A;  1HTQ A;  3AEB B;  4K81 A;  4L1B A;  1D3Z A;  1OGW A;  4AJW A;  1WE7 A;  4A3P A;  1GB4 A;  2E3T A;  2LFI A;  4W9E A;  4MT5 A;  3ZXR A;  1E8W A;  1JRP A;  4C4V B;  1V9J A;  4JQW C;  3B2G A;  1S1Q B;  1IP9 A;  3Q8E A;  1TKE A;  1XO3 A;  3CST A;  4YSX B;  2YEP B;  2MJD A;  3H9D A;  4KDL B;  4MDK E;  1HZ5 A;  3KUD B;  2D3A A;  2R2O A;  3H8H A;  3W5V B;  1V86 A;  1XLQ A;  4PS8 A;  5CHV C;  3KWL A;  2KDI A;  2RR9 A;  1SE3 A;  3ZTD A;  2REX A;  1FEH A;  2QJL A;  2QC8 A;  4K7U A;  3HVZ A;  3W5U B;  5D94 A;  2KXJ A;  1D5Z C;  1YN3 A;  2INN E;  1IBX B;  3R7Q A;  4LJO B;  3C19 A;  3PSE B;  4OW0 A;  5MPO A;  1YNT E;  1F2R I;  3ZNI D;  1J0G A;  4NQK E;  2NMQ A;  2ZJD A;  1YN4 A;  1ZXH A;  3PLV A;  2WXL A;  1RAX A;  2BVC A;  3I63 C;  4ANW A;  2A4Z A;  4B0E A;  5BYR A;  2EEL A;  2GBM A;  3DHI C;  3OJ4 B;  4HPM B;  1WM3 A;  3WAP A;  2HTH A;  3V62 A;  2KQ4 X;  1B9R A;  1MVK A;  4DXA B;  4DK5 A;  2MQJ A;  2PVG C;  3H7S A;  2JQR B;  3ZNH B;  3DBS A;  1FO4 A;  3B2F A;  1KRH A;  1OQR A;  3PLU A;  3QAQ A;  2D07 B;  1T0S C;  3H1U A;  4DXG A;  3W2D A;  2N9L A;  1EF1 A;  4KDI C;  1TGZ B;  4GOC A;  3T3N A;  2WXO A;  3DBH B;  2KJ6 A;  2MA9 B;  2AQ3 B;  4NAW B;  5G2N A;  2C7M B;  2FUH B;  4FJY A;  2BTE A;  1DOY A;  3UIO B;  3VAW A;  2KO3 A;  3MC9 A;  4PK1 A;  1SIF A;  4KGT A;  4FJZ A;  1V80 A;  2ZW0 A;  3LYY A;  3VRA B;  4CYE A;  4EUT A;  4WWN A;  4ANX A;  2VH2 A;  2DZI A;  2NPT B;  2K3U A;  2Z0D B;  5HFY A;  3ZTC A;  4LK0 M;  3TL5 A;  2WU2 B;  3V61 A;  2V0G A;  1PGA A;  3VXW A;  4JIO U;  2VZK B;  2KWU B;  4NAM A;  1VZ7 A;  1C4A A;  3A9J B;  1ENF A;  1J19 A;  2M0X A;  1RFK A;  4USA A;  1T3Q A;  3Q8B A;  2V3N A;  1ROE A;  3TMP B;  3B9J A;  4HDQ A;  1HZ6 A;  2L76 A;  4P1C C;  3NZS A;  3KLS X;  1D5M C;  4GDK B;  2Y5P A;  4J3O D;  4B6W A;  4WH4 A;  5IN7 A;  4KGR A;  2HJ8 A;  1OFF A;  1V1O A;  2CS4 A;  5KHO A;  1UWM A;  3NY5 A;  3PHW B;  1N5X A;  4EOY A;  2L0T A;  3VR8 B;  4WJP A;  1T5X D;  5GXG B;  4HLE A;  2JWU A;  3PHX B;  2L0F A;  1JWS D;  4GIV A;  4RFB A;  2LGI A;  4II2 B;  3VH3 B;  2MBB B;  2WXJ A;  2R2Q A;  1LQB A;  2K8C A;  4WJO A;  4YSZ B;  3T8M A;  1WZ3 A;  3AI5 A;  4LCD E;  3KH0 A;  4JWS C;  1HE8 A;  3OJ3 A;  5J18 A;  2MJE A;  3P1M A;  2DAJ A;  2N9P C;  2D11 A;  4IKG A;  5BYQ A;  1FCC C;  1WGD A;  5G5G A;  2LMC A;  2M8S A;  2MH7 A;  4IWP A;  1NDD A;  1STE A;  4C00 A;  3QCA A;  2R61 A;  4OZC A;  2B76 B;  2ON8 A;  3RFZ B;  1WFY A;  2IDY A;  4C56 C;  4S0R A;  3V3X A;  1VLB A;  1QQR A;  2J52 A;  4RCO A;  1AW7 A;  1GC6 A;  4BVU C;  4YT0 B;  3L4P A;  2I2Y A;  4C4V A;  3WA0 A;  3MTN B;  4XX5 A;  1XLN A;  1UBI A;  2Z59 B;  3L10 B;  1NI2 A;  3TEW A;  5TR5 A;  3GOE A;  4EFO A;  1FPY A;  1VD2 A;  1UNS A;  2D2Q A;  2MWS B;  2GOW A;  2FCM A;  3ZGZ A;  3A4S C;  4S17 A;  3RD2 A;  1QZE A;  3DVG X;  2IJ0 A;  2KKC A;  1YD8 U;  2VZK D;  2PE9 A;  3AN1 A;  3TBL D;  4UDU C;  1IBX A;  1IPG A;  2N9E B;  2WXH A;  3EC8 A;  2G45 B;  1WRD B;  4F1S A;  3RUI B;  3P4P B;  1FNV A;  1Y56 A;  3LJ3 A;  1JWA D;  1F1H A;  2FUG 1;  1KFY B;  4PYZ A;  4IG7 B;  2ZVN A;  1NYR A;  4G50 A;  1C78 A;  3BIN A;  2WDT B;  4J6I A;  3VUY A;  2N9K A;  3I9V 1;  3N1Y C;  3DBR I;  4NJ6 A;  2JVC A;  3E56 A;  1OEY A;  4WJQ A;  4YWG G;  1PGB A;  2IGH A;  4F8C B;  3NJT A;  2A5U A;  4LNO A;  1FD6 A;  3ZJV A;  3RN9 C;  2Y3A A;  3TEZ A;  2O6V B;  4XDD A;  2MBQ A;  2LRU A;  2KT7 A;  4FXC A;  1UGJ A;  1XF5 L;  1XLO A;  2GLS A;  2GBR A;  4DHZ B;  3DPD A;  1WYG A;  4DBG A;  3QQ8 B;  4N9F 4;  2KAJ A;  2O2V B;  3NG0 A;  3RNA C;  3AEF B;  5C3J B;  2PMV A;  2PTL A;  4HJG E;  4YTN B;  3CIR B;  1JML A;  1YQ4 B;  4ZYS A;  5D6J B;  3W1S A;  3Q3J A;  1XCT L;  2UWQ A;  1D5X C;  2MLB A;  1ZOY B;  2BQQ A;  2NTT A;  2BGF A;  2ICI A;  2XK5 B;  2N4F A;  3E9S A;  1UWX A;  1WH3 A;  3WIM A;  4C7Y A;  1JAL A;  1R4M B;  5DPT A;  3U52 E;  1DGJ A;  3GB1 A;  2KWC A;  3RNC C;  3GZN B;  1QOG A;  3ZQ4 A;  1I4H A;  2NBU A;  3A9J A;  1N5W A;  4G3X B;  4L23 A;  4HKZ E;  1VZ8 A;  2QIL A;  1LO5 D;  2N7J A;  1L4Z B;  5IOI A;  4YSY B;  1C3T A;  5AZH A;  4BKS D;  2EKI A;  2BYF A;  4W9C A;  1T0Q C;  2PIA A;  3DWM A;  2W54 A;  4GDK A;  2L52 A;  1HXY D;  3AE2 B;  2IND C;  5GMV A;  4DHZ E;  1V49 A;  4FJV B;  4LJP B;  2WXG A;  3WCQ A;  2WWZ A;  3QJZ A;  3O65 B;  3TIX A;  1VDV A;  4OZB A;  1ZW7 A;  2JYT A;  2MP2 A;  2FBW B;  4ZRK A;  4DHJ B;  1WJU A;  1GJZ A;  2G4D B;  2FNJ B;  3VVW B;  1DOX A;  2QSD A;  5JXV A;  3RNG C;  2J42 A;  1G6J A;  5AUK A;  1GAQ B;  2WGS A;  5EE3 A;  2ZCC A;  3PRE A;  4XZ4 A;  1TS5 A;  3AE6 B;  4A9A A;  3AEG B;  5FR6 A;  2O6V D;  2K6Q A;  1YMH E;  3HUI A;  3V6C B;  4LNN A;  2KHW B;  2XNA C;  2DZK A;  4BFR A;  3RMK C;  2UYZ B;  2HJ1 A;  4IM3 A;  2LVO A;  3FAH A;  2MW5 A;  2JRI B;  5D7G A;  2WXF A;  4GB9 A;  3URY A;  2ZVO A;  5C2T B;  4ZRQ A;  3TUO A;  3EFC A;  3Q6B A;  1EU4 A;  4KIK B;  3GP7 A;  1SF0 A;  3TEX A;  2YVC A;  3ZO5 B;  3L17 A;  5BYS A;  2BB6 A;  3BVZ A;  4XWT A;  2BKF A;  2MSE D;  4A8X C;  2K1F A;  4KV2 A;  3DBL B;  5FKA C;  2KQS A;  3ML9 A;  4YTM B;  1V5T A;  2V4L A;  2CKH B;  5EE1 A;  4ZYN A;  1E6E B;  2YEP F;  2MBH A;  1WJ4 A;  2IPK D;  2JPH A;  3P4Q B;  4MGZ E;  1ACC A;  3NZU A;  1J7A A;  2KTF A;  3M3J A;  2OOB B;  4AS1 A;  3SEB A;  1TS4 A;  1WRI A;  2DZJ A;  4M00 A;  4NQL B;  2OJR A;  2L1A A;  2N7D A;  1WSP A;  3AE7 B;  4HCN B;  4DHJ D;  1WIA A;  2FIF A;  1ISN A;  2LHE A;  3ZNZ B;  2O6V A;  4URK A;  1VZ6 A;  4RF1 A;  4CQN A;  1K8R B;  2MBE A;  1RFA A;  3NVZ A;  2KOX A;  3R8B A;  2RDB C;  1OQQ A;  4M02 A;  4KVG B;  1QKZ A;  3R2T A;  1P7F A;  3ZDT A;  2KWD A;  1KM7 A;  1F9J A;  2D10 A;  5JZE B;  3GS2 A;  2LJ5 A;  2O2V A;  1ZDX A;  1XQQ A;  3N1Z C;  3Q3N C;  2ZNV C;  2K22 A;  3T3O A;  1UZX B;  1CK1 A;  1SIJ A;  2WX0 A;  4M0W B;  3P42 A;  3TCA A;  3N3K B;  3B1L X;  1DOI A;  3ONS A;  1F2R C;  3JW0 X;  4GXB A;  1RWS A;  1J7B A;  5AEK B;  1TZO A;  3Q3O C;  1JQ4 A;  1VRA B;  2EKE C;  2WLB A;  3GZN I;  1F52 A;  5IAA C;  1WF9 A;  3X23 A;  1B1Z A;  2FCS A;  3ALB A;  4DWF A;  2INP E;  1V81 A;  1NBF C;  3MHS D;  3NS1 A;  1D6E C;  1P7E A;  2KMM A;  2K9X A;  2M0A A;  2L3Z A;  2IY0 B;  5BMI A;  2LWP A;  1JCK B;  3IVF A;  2IO2 B;  1UH6 A;  1SEB D;  1SJE D;  2AEH A;  2XN9 C;  4A55 A;  1C1Y B;  3PRZ A;  4W9D A;  2V9H A;  2WQY B;  5H8Y E;  1HA5 A;  2N1W A;  2KWV B;  1WY8 A;  3NZ3 A;  2WDQ B;  4II3 B;  3NOB A;  4US9 A;  1JWM D;  4HXD A;  4RM8 A;  3UIP B;  1A70 A;  2ZEQ A;  3IAS 1;  4TSS A;  1AYF A;  2WX1 A;  2SEB D;  1WGK A;  2BF8 B;  2K6D B;  2KLG A;  1GC7 A;  5L95 C;  3DWG C;  4TQ1 A;  1QLB B;  2BPS A;  2GRI A;  2PLP A;  2I1J A;  2YLM A;  2W3R A;  2MRP A;  4BBN F;  3L0W B;  1BXT A;  2KN4 A;  3PV1 A;  1SB3 C;  4NJ7 A;  1WGH A;  3DHG C;  3NVY A;  3CMM B;  1SBB B;  1ET6 A;  1SE2 A;  1EWC A;  1D4B A;  3L08 A;  4LNF A;  5AZG A;  4HRS A;  2CU1 A;  3AEC B;  2JRH A;  3EHV A;  4ZHO A;  3A33 B;  1XEE A;  1MI0 A;  2M17 A;  1ZP0 B;  2CHX A;  2CR5 A;  5J2R A;  1KLU D;  2LGX A;  3DVN V;  2G9H D;  3AV8 A;  1QOB A;  4IUM B;  1C9F A;  3R3M A;  3DBL I;  2WXQ A;  3QHT A;  2IYD B;  2KDE B;  3AH7 A;  4WQO B;  4O1N A;  3M95 A;  3BII D;  2Z8L A;  3EEC A;  2WXK A;  2GI9 A;  1BT0 A;  4HVB A;  1KLG D;  2QCZ A;  1GPX A;  3AU4 A;  4ZRJ A;  4LDT B;  3R7R A;  4MM3 B;  1WXM A;  4HRO A;  4MJS B;  1XT9 B;  2BB5 A;  4I6L B;  2DLB A;  5LXH A;  1JRU A;  1SGH A;  2W82 A;  2W55 A;  1ZXI A;  4RH6 A;  4HK2 A;  4YTP B;  2K25 A;  4IM2 A;  2GBJ A;  4JGH B;  3C8Y A;  2KC1 A;  4MSM B;  1K50 A;  3HHM A;  2OJW A;  2WNM A;  1FCL A;  2M56 B;  1SJH D;  1KLV A;  4FHJ A;  2MJ3 A;  2XBB C;  3C0R B;  3S2A A;  2X8X X;  5C1Z A;  4KKI A;  4OVU A;  3KWV A;  3KQ4 A;  1C4C A;  1TKG A;  1FNW A;  3AE9 B;  4TUU A;  4FN2 A;  4YXD B;  4WWP A;  3PVL A;  3ZJT A;  1I7H A;  3AE8 B;  1XXG A;  1WJ6 A;  4XYC A;  1FFU A;  5BMG A;  2DAF A;  2CHW A;  1LFD A;  3IHP C;  3NHE B;  2FAZ A;  1XD3 B;  5AZF A;  1QOA A;  4IWO A;  2JF5 A;  4I6P A;  3DQV A;  3VRB B;  3GE3 C;  1C79 A;  1V97 A;  4W9J A;  1NEN B;  2LVQ A;  5CHW A;  1P3Q U;  4AJY B;  3FIL B;  3ABV B;  3KVF B;  2KFJ A;  4GLS C;  2KMA A;  4ICU A;  5IKC M;  1P9D U;  4JL9 A;  4HKQ A;  3A9K B;  4HPL B; 
#chains in the Genus database with same CATH homology
 5GMV A;  3N30 A;  4FUL A;  3VTV A;  4IW0 A;  2LVP A;  4DHZ E;  1WZ0 A;  3I3T B;  1V49 A;  4HCP B;  2DYO A;  4FJV B;  4LJP B;  5E6P A;  3VUX A;  2WWZ A;  4K81 A;  1D3Z A;  4KIK A;  2BKR B;  4K7W A;  1YX6 B;  1PQS A;  3QJZ A;  1OGW A;  3A4R A;  3U30 A;  4AJW A;  4BOS C;  1YX5 B;  1WE7 A;  2JZZ A;  2KC2 A;  3O65 B;  3TIX A;  5JHB A;  3HM3 A;  1IYF A;  1GG3 A;  4A3P A;  1ZW7 A;  3VTU A;  4W9E A;  2MP2 A;  3B0A A;  1E8Y A;  2IO0 B;  4ZRK A;  4DHJ B;  4EZL A;  2J0J A;  1WJU A;  1GJZ A;  2G4D B;  2FNJ B;  3VVW B;  1E8W A;  3VDZ A;  1V9J A;  3ZLZ A;  4JQW C;  1S1Q B;  1IP9 A;  2I1K A;  1G6J A;  3KYC D;  3IFW B;  1LXD A;  4W9I A;  3CST A;  5LLI A;  4E74 A;  2LI5 A;  3H9D A;  2JY6 A;  2L05 A;  4KDL B;  2KFK A;  4LDT D;  2ZCC A;  3QWZ B;  4NY0 A;  2PJH A;  3PRE A;  4MDK E;  3KUD B;  2R2O A;  4XZ4 A;  3QIJ A;  2L8J A;  3OAW A;  5FR6 A;  2O6V D;  2JUO A;  2K6Q A;  1V86 A;  3A1Q A;  2KLC A;  4FLH A;  3V6C B;  4PS8 A;  3K9O B;  4W9K A;  5CHV C;  1ZGU B;  4AUQ C;  2KHW B;  3X0W A;  2KDI A;  4FAD A;  2RR9 A;  1WMH B;  1R4N I;  3VQI A;  2DZK A;  2KN5 A;  3ZTD A;  2REX A;  4BFR A;  2KNB A;  2UYZ B;  4K7U A;  4IM3 A;  3SD5 A;  5D94 A;  2KXJ A;  2LVO A;  2MW5 A;  2JRI B;  1Q0W B;  4M8M A;  5D7G A;  4GB9 A;  4K7S A;  5DPS A;  5J17 A;  3L16 A;  1T0Y A;  2KX0 A;  4K1R B;  2ZVO A;  3R7Q A;  4LJO B;  5C23 A;  3HK0 A;  3PSE B;  3SHQ A;  3DBH I;  1WXA A;  4KIK B;  3ZNI D;  1U4A A;  2DEN B;  4NAW A;  1J0G A;  4AWJ A;  2D3G A;  5DPW A;  2YVC A;  3ZO5 B;  3L17 A;  1E90 A;  4NQK E;  2LZ6 A;  2ZJD A;  3EFU A;  3KYD D;  2MP2 B;  3HIZ A;  4NPN A;  3PLV A;  2BKF A;  4RMA A;  2IO3 B;  2MSE D;  2KDB A;  2K1F A;  4KV2 A;  1WX7 A;  3Q3F A;  1ZKH A;  1H8C A;  2KQS A;  3ML9 A;  1RAX A;  1V5T A;  2V4L A;  2CKH B;  5LXI B;  4ANW A;  2A4Z A;  2ZPY A;  3SU8 X;  4ZYN A;  2GBM A;  1KJT A;  3ENE A;  2LAS A;  3OJ4 B;  3VFK A;  2AL3 A;  3JSV B;  1WM3 A;  4GN1 A;  4HPM B;  2HTH A;  3WAP A;  1J8C A;  2MBH A;  1WJ4 A;  2NPT A;  3B08 A;  3V62 A;  1L7Y A;  5CHF A;  4DXA B;  1S3S G;  2N1V A;  4DK5 A;  1I35 A;  2MQJ A;  2JPH A;  3OLM D;  3H7P B;  3H7S A;  2KVR A;  3KUC B;  1E8X A;  4B9K A;  2N9X A;  2ZNV B;  2NS5 A;  4MGZ E;  1P0R A;  3ZNH B;  3DBS A;  4KZC A;  5G55 A;  4TKN A;  3PLU A;  3PZD A;  3QAQ A;  2JWZ A;  2D07 B;  4W9G A;  3NZU A;  3H1U A;  2L7R A;  1WM2 A;  2Y5B B;  3SDL C;  2KTF A;  1RLF A;  3M3J A;  3QA8 A;  4RM9 A;  2JXX A;  1EF1 A;  2OOB B;  3ZIM A;  4KDI C;  3ECI A;  4FHK A;  1TGZ B;  4EZJ A;  3ZNG C;  4GOC A;  3PGE A;  3PT2 B;  2KJ6 A;  2BYE A;  2DZJ A;  2MA9 B;  5JH5 C;  3RUL A;  2NBW B;  2ASQ A;  4NQL B;  1YJ1 A;  4NAW B;  2OJR A;  2BYV E;  2N7D A;  4MGI E;  5G2N A;  4MEM A;  3UGB B;  3VH4 B;  3ZKJ C;  5CX3 A;  2C7M B;  2FUH B;  3APC A;  4FJY A;  5CTR C;  1L2N A;  4HCN B;  4DHJ D;  3UIO B;  3VAW A;  2KO3 A;  1WIA A;  2FIF A;  1X1M A;  4MM3 A;  1ISN A;  1SIF A;  3WAO A;  4FJZ A;  2KJR A;  1V80 A;  3ZNZ B;  4EKU A;  4MJS A;  1AAR A;  2GBK A;  2O6V A;  4W9L A;  4URK A;  4CYE A;  4EUT A;  1K8R B;  2MBE A;  2KAN A;  1WGG A;  3DOW A;  4HWI B;  4WWN A;  1RFA A;  2LXC A;  2KOX A;  4ANX A;  2DZI A;  4ANV A;  2NPT B;  2K39 A;  4AP4 C;  3M63 B;  4KVG B;  4E71 A;  2Z0D B;  3RZF A;  3UQA A;  3ZTC A;  3QX1 A;  3TL5 A;  3UF8 A;  3V61 A;  3ZDT A;  1KM7 A;  1F9J A;  2D10 A;  5JZE B;  3TJP A;  3KUZ A;  4JIO U;  3VXW A;  2KWU B;  3AU5 A;  2LJ5 A;  2Z0E B;  2C7N B;  2O2V A;  2M4N A;  1XQQ A;  3A9J B;  1J19 A;  2ZNV C;  3LDZ E;  2MX2 A;  2M0X A;  2FCN A;  2IBI B;  2J7Q B;  1P1A A;  1WGY A;  4MH0 E;  5KHQ A;  1UZX B;  2KQ7 A;  4W9H A;  3TMP B;  1VCB A;  2C9W B;  4HDQ A;  3V6E B;  2WX0 A;  3IBE A;  3H6N A;  4M0W B;  5E6O A;  3TCA A;  2L76 A;  1WGR A;  4IM0 A;  4AOF A;  1OEY J;  3NZS A;  2WYQ A;  4GDK B;  1GUA B;  3N3K B;  1WXS A;  4PYU A;  3B1L X;  1P98 A;  2JT4 B;  3ZVV A;  3ZRF A;  2XEW A;  5D2M B;  4B6W A;  3ONS A;  2KTR B;  3JW0 X;  4GXB A;  2HJ8 A;  4KSK C;  2C7H A;  5AEK B;  2CS4 A;  5KHO A;  3WAM A;  4TQ0 A;  1MG8 A;  3HM6 X;  3NY5 A;  4E3C A;  2EKE C;  3GZN I;  3PHW B;  1CMX B;  5IAA C;  1WF9 A;  3X23 A;  4ICV A;  2MCN B;  2FCS A;  2J0M A;  4B95 A;  3ALB A;  4DWF A;  4EOY A;  1OTR B;  2FCQ A;  2L0T A;  4WJP A;  3W1S C;  2JZ3 B;  3WAN A;  3U7D A;  5IA7 A;  5BO4 B;  2N7E A;  4A20 A;  4HLE A;  3PHX B;  2L0F A;  4GIV A;  1V81 A;  1UD7 A;  1NBF C;  4II2 B;  2MBB B;  3VH3 B;  3MHS D;  4G0N B;  3UQB A;  2R2Q A;  1WI0 A;  1LQB A;  3ZRC A;  2K8C A;  1YIW A;  2DX5 B;  3APD A;  1E7U A;  4GDL A;  2L3Z A;  4WJO A;  3T8M A;  2IY0 B;  1WZ3 A;  3AI5 A;  1UEL A;  2LWP A;  3KH0 A;  4LCD E;  1HE8 A;  2B3A A;  2IO2 B;  1UH6 A;  3IVF A;  2AEH A;  1EF5 A;  3OJ3 A;  4BKS A;  5J18 A;  2V1Y A;  2K8B A;  2KD0 A;  1C1Y B;  3PRZ A;  1EO6 A;  4W9D A;  2KFK B;  2DAJ A;  2DHZ A;  2N1W A;  2N9P C;  2D11 A;  4GGQ A;  1WGD A;  2KWV B;  2M8S A;  1WY8 A;  4IWP A;  2BWE S;  5DCN A;  1WR6 E;  3A1Q B;  3ML8 A;  4II3 B;  1NDD A;  2C5L C;  3QCA A;  3NOB A;  3VHT C;  2RSU A;  4ZDV A;  1Q1O A;  3AUL A;  4HXD A;  1WFY A;  2NBV B;  4RM8 A;  2LXA A;  3UIP B;  2LGD A;  3QK0 A;  3BY4 B;  2RGF A;  1GC6 A;  4BVU C;  2ZEQ A;  4ANU A;  2AWT A;  4A3O A;  2K8H A;  3WA0 A;  2WX1 A;  4GSW A;  3MTN B;  2BF8 B;  2NR2 A;  2K6D B;  3PTF C;  4XX5 A;  2AYO B;  2Z59 B;  1UBI A;  3RCZ A;  3PRM B;  3L10 B;  1NI2 A;  2KLG A;  1GC7 A;  4JLC A;  5L95 C;  1EUV B;  3GOE A;  5TR5 A;  3T9L A;  4EFO A;  1TBE A;  1V6E A;  1H4R A;  4TQ1 A;  1V2Y A;  2BPS A;  2G3Q B;  5HKH A;  1VD2 A;  2AL6 A;  2BWF A;  2I1J A;  2YLM A;  3DCG A;  3D32 A;  4W9F A;  3RZW C;  2MRP A;  2LRW A;  3JVZ X;  4IWQ A;  4BOZ B;  3CF6 E;  3DVN U;  4F7Z A;  1LM8 B;  2D2Q A;  1RRB A;  2MWS B;  3L0W B;  2KMC A;  3L13 A;  4BBN F;  2GOW A;  3PV1 A;  4EEW A;  3PS6 A;  2FCM A;  3A4S C;  3RD2 A;  3U8Z A;  1WMH A;  3L54 A;  1QZE A;  3DVG X;  4BBN C;  4NJ7 A;  1WE6 A;  1WGH A;  3CMM B;  2KKC A;  2EMS A;  3K9P B;  1YD8 U;  2IZV B;  3L08 A;  3APF A;  2PE9 A;  5AZG A;  3TBL D;  2CU1 A;  1IPG A;  1WXV A;  4NNJ B;  2JRH A;  2N9E B;  3EC8 A;  3EHV A;  3V60 A;  3A33 B;  3UIN B;  2G4S A;  2G45 B;  4KZ0 A;  4PS7 A;  1WRD B;  2M17 A;  3N32 A;  2CHX A;  4F1S A;  3RUI B;  5DPR A;  2CR5 A;  5J2R A;  4XC2 A;  3ZDM C;  3LJ3 A;  5JHA A;  4WJN A;  2LGX A;  4OVV A;  3DVN V;  4MSQ B;  4IUM B;  1Y8R C;  2MBO A;  3R3M A;  2LGY A;  4HJK A;  4I6N B;  4PYZ A;  4IG7 B;  2ZVN A;  4EZK A;  3DBL I;  4FBJ B;  4P7I A;  2LD9 A;  4G50 A;  4ASW C;  3BIN A;  2WDT B;  4J6I A;  2HD5 B;  2PE6 B;  3QHT A;  2IYD B;  2KDE B;  1Q5W B;  1KOT A;  3PRP B;  3VUY A;  4WQO B;  3DBR I;  2ZCB A;  4NJ6 A;  3M95 A;  3CSF A;  2XK5 A;  3EEC A;  3JSV A;  4WAA A;  1M94 A;  2JVC A;  1WX9 A;  1FXT B;  2GBN A;  1OEY A;  1TTN A;  4GMV A;  4CHK A;  1WJN A;  4WJQ A;  2GMI C;  2L00 B;  1BT0 A;  3H7P A;  4F8C B;  4HVB A;  2A5U A;  4M8N A;  1R4M I;  3AU4 A;  3PPA A;  2C60 A;  4BKG A;  1WX8 A;  3RT3 B;  4G11 A;  4ZRJ A;  4MGY E;  2IY1 B;  4LDT B;  3R7R A;  3NS8 A;  5EDS A;  1UBQ A;  4WWO A;  4MGK E;  1WXM A;  2QHO A;  4MJS B;  1XT9 B;  3R66 C;  2O6V B;  4I6L B;  5LXH A;  1JRU A;  2MBQ A;  2LRU A;  3VTW A;  1I42 A;  4KSL C;  1SGH A;  2V3S A;  3KW5 B;  4FA6 A;  4CO7 A;  2DZM A;  2RPQ A;  3M62 B;  2GBR A;  4HK2 A;  1E5W A;  4DHZ B;  2K25 A;  3DPD A;  2NCN A;  3IG3 A;  4IM2 A;  2GBJ A;  4HDO A;  4JGH B;  2KC1 A;  2DYM A;  4MSM B;  1YQB A;  4DBG A;  3MJW A;  3QQ8 B;  4DDG D;  2J0K A;  3HHM A;  4N9F 4;  3QAR A;  1SE9 A;  2KDF B;  3A9K A;  3JYU A;  2O2V B;  2PEA A;  2EMT A;  1KLV A;  4FHJ A;  2DYB A;  2KZR A;  4MEL A;  3VUW A;  2XBB C;  3C0R B;  4YL8 A;  2PPH A;  1Z5S B;  4GU2 A;  3S2A A;  3AXC A;  5C1Z A;  2KJH B;  1WR1 A;  4OVU A;  5D6J B;  3W1S A;  2HE7 A;  2UWQ A;  3Q3J A;  2MLB A;  3DVG Y;  1WYW B;  2NVU I;  2IO1 B;  2KK8 A;  4ZRI A;  2BGF A;  3QC8 B;  5E6N A;  2XK5 B;  3RYT A;  4IC7 B;  4TUU A;  4FN2 A;  3W1Y A;  2N4F A;  1V5O A;  4WWP A;  3ZW3 A;  1WH3 A;  2CHZ A;  2VRR B;  3PVL A;  5L83 A;  3WIM A;  5DPT A;  1WJ6 A;  1Z2M A;  1GNU A;  2KWC A;  2M1M A;  2DAF A;  2CHW A;  1LFD A;  3IHP C;  2ZZP B;  2NBU A;  2ZPN A;  3A9J A;  4G3X B;  3NHE B;  2FAZ A;  1E8Z A;  1A5R A;  3DDC B;  1UGM A;  1XD3 B;  5AZF A;  3WAL A;  1OQY A;  1TZ1 A;  4IWO A;  2JF5 A;  4DDI D;  4I6P A;  4X57 B;  3DQV A;  2W9N A;  3P2B A;  1C3T A;  4W9J A;  5AZH A;  4BKS D;  2BYF A;  4W9C A;  2LVQ A;  5CHW A;  1P3Q U;  2LUE A;  4AJY B;  2KX3 A;  1E7V A;  2RD0 A;  4GDL B;  4GDK A;  3KVF B;  4TV3 A;  2KFJ A;  3ZUN A;  4BKT A;  2KMA A;  4ICU A;  1P9D U;  4JL9 A;  3A9K B;  2FID A;  4PS3 A;  4HPL B;  2KTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...