3ZKJC

Crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
70
Chain Sequence
DVFLMIRRHKTTIFTDAKSTVFELKRIVEGILKRPPKDDQLFTSQTARPQAPATVEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANKYRIN REPEAT AND SOCS BOX PROTEIN 9
publication title Molecular Architecture of the Ankyrin Socs Box Family of Cul5-Dependent E3 Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 70
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zkjC00
4B9KA 2XK5A 4EZKA 2DZJA 5IA7A 3ZDTA 2AYOB 2N9PC 1K8RB 3B0AA 2IZVB 4GDKA 4KIKB 1UBQA 3AU4A 5CTRC 2IYDB 4URKA 1E8YA 3DBLI 3RCZA 1WJUA 1GG3A 3EHVA 3IFWB 4E3CA 1P1AA 3ONSA 2K1FA 2OJRA 3A9KB 2K6QA 3RULA 3PRZA 4LJOB 4WJOA 3DCGA 4JL9A 1WZ3A 1WX8A 1SIFA 2BF8B 2KDBA 3OJ4B 4MM3A 1CMXB 2BKFA 2D07B 3KYCD 4OVUA 3AU5A 2CHZA 2L00B 2BYFA 3QA8A 1P3QU 1UELA 1T0YA 1V2YA 1ZKHA 1I42A 2EKEC 2LVPA 2WDTB 3PRMB 3PS6A 1E7VA 4DDID 2PE9A 4XX5A 2NR2A 4HPLB 4MJSB 3H9DA 3RYTA 4BKSA 2V1YA 4FHJA 3ML9A 2MSED 1E8XA 1JRUA 4IWPA 3M3JA 3MHSD 1A5RA 2L7RA 1V81A 4BFRA 3ZNHB 2NPTB 3VHTC 1WE6A 1GJZA 4ASWC 5AZGA 3PGEA 4M0WB 4MSMB 2MA9B 2JZZA 4K7UA 2LD9A 4ZRIA 2G4SA 4JIOU 4AWJA 5LXIB 2A4ZA 1WJ4A 2KJ6A 1WGDA 1ZGUB 2RR9A 3N3KB 2DAFA 2W9NA 4NQKE 4NY0A 1J8CA 2BWES 4FHKA 3ZKJC 2KHWB 3PVLA 2Z59B 1GUAB 4BOZB 1KOTA 4TQ1A 4A3PA 1FXTB 4W9EA 3L0WB 5G55A 3S2AA 3RZWC 4BBNC 1P0RA 3A9JB 4EZLA 3NS8A 2M0XA 2LGDA 1YJ1A 4PYZA 1KM7A 5DPWA 1G6JA 2IO1B 3TMPB 4BOSC 3ZDMC 4WWNA 4KZ0A 3UGBB 2ZCBA 4W9FA 2JPHA 4I6LB 4ANWA 3ML8A 3HM6X 2MWSB 2LUEA 1VCBA 3UIPB 2ZCCA 2KK8A 3APDA 2V3SA 4LDTB 2J0JA 3RUIB 4WJNA 3TJPA 3WAPA 2R2QA 1OTRB 3JVZX 5L95C 3ZRCA 2DYBA 2L8JA 2LASA 2KKCA 3PSEB 3ZNID 2D11A 2KDEB 4ANXA 2FCMA 4KSLC 2JVCA 4DBGA 3PHXB 4HDOA 4W9IA 1Z2MA 4MJSA 4K81A 4W9GA 2BYVE 3IHPC 3RZFA 1Y8RC 3SU8X 1TBEA 4HPMB 4A3OA 4KV2A 3VQIA 5J18A 1NI2A 2L76A 2NPTA 3PT2B 2ZZPB 3A33B 3H6NA 2RPQA 2C60A 2KANA 2KQ7A 2AL3A 2K8CA 3KH0A 3APCA 1SE9A 4W9JA 4AJWA 1Z5SB 2GBMA 1UBIA 3HK0A 2KTFA 1WIAA 4OVVA 4CHKA 1GNUA 2ZVNA 1TGZB 1WI0A 3QHTA 4TV3A 2BPSA 3WIMA 3Q3FA 5AZHA 3T8MA 4J6IA 2KMCA 3DQVA 4PS3A 3RT3B 4DHJB 3BINA 2UYZB 2ZEQA 3N32A 3RD2A 2Z0DB 5D94A 2KWUB 1WXSA 2ZNVB 3KUZA 3R7QA 2O6VD 3V6EB 5DPSA 5GMVA 4ZDVA 4ZRJA 2KQSA 4CO7A 2NBUA 1ISNA 3K9OB 3UIOB 3ZTDA 3P2BA 3OLMD 3UF8A 2GBNA 2J7QB 4HVBA 3H1UA 4BVUC 3HHMA 3JSVA 2KFKA 3BY4B 4ICVA 4TKNA 5CHFA 4HCPB 2AEHA 4NAWB 4MGKE 3V62A 3M63B 5L83A 3B1LX 2JRIB 1YX6B 2LXCA 2FIFA 3H7PB 3L08A 1WXVA 3PZDA 2FAZA 2LVOA 3SHQA 3CF6E 1L2NA 1HE8A 1WX9A 1RLFA 3QCAA 4HLEA 2LI5A 1GC6A 5KHOA 2HE7A 2L3ZA 3QX1A 1U4AA 3R3MA 2XBBC 2ZPYA 3UQAA 2BYEA 2FIDA 1LFDA 2DX5B 2MBEA 2MBOA 2Z0EB 4BKSD 2KC2A 3ZNGC 1EUVB 2CKHB 1WGHA 3QARA 2A5UA 4GN1A 4KZCA 4FJYA 1WJNA 2C9WB 2NS5A 2HTHA 3U30A 2DYOA 2WX1A 1P9DU 3LJ3A 4MGYE 4KDLB 4AP4C 2EMTA 3L16A 2DZIA 2ZVOA 3QWZB 4JLCA 1UZXB 4CYEA 2QHOA 3CSTA 3ZNZB 2N1VA 1SGHA 2V4LA 1IP9A 3LDZE 1XQQA 1H4RA 3U8ZA 4BBNF 1IPGA 2MLBA 2MP2B 5DPRA 1TTNA 2O2VA 3DVGX 3NZSA 3VTUA 3WA0A 3ZRFA 2L0FA 5D6JB 2KTRA 4DDGD 1WGRA 2KN5A 4ANUA 1WMHB 4ZYNA 2PPHA 2R2OA 3VFKA 4IM0A 4MDKE 3JW0X 2NBVB 2KMAA 1WGGA 4W9LA 3TIXA 4BKTA 2G3QB 2L0TA 4K7WA 3U7DA 2C5LC 2N1WA 3QC8B 4RM9A 3VDZA 3WAOA 3A1QB 4KIKA 4EEWA 5JH5C 4F8CB 1WH3A 4LCDE 1RFAA 3H7PA 3PLUA 3R7RA 1PQSA 1NBFC 2B3AA 3TCAA 4EFOA 3A9KA 3PPAA 1WM2A 4WJQA 2KOXA 3VUXA 2KLCA 3AI5A 1J0GA 2DAJA 2FCSA 2RD0A 1S1QB 2NBWB 4G3XB 3QIJA 3OJ3A 1OEYA 1UGMA 1WF9A 2BGFA 2LXAA 2VRRB 5E6OA 4YL8A 1LXDA 2CHXA 2KWVB 1X1MA 1YD8U 4HWIB 4AOFA 2GBKA 4DXAB 2O6VB 4MH0E 1C3TA 1EF1A 3TL5A 1OGWA 2PJHA 2LGYA 1WM3A 2XK5B 2FCNA 2MX2A 3KYDD 2IY1B 1UD7A 3ZLZA 4IC7B 4RM8A 2GMIC 3L13A 5D7GA 5D2MB 4W9DA 3DVNU 3Q3JA 4EOYA 3WAMA 2JXXA 1M94A 2C7MB 5BO4B 1OQYA 4HCNB 2L05A 3ZTCA 1V6EA 2N9EB 2LJ5A 5C1ZA 4IM2A 3ENEA 3M62B 2BWFA 3QK0A 4I6PA 4M8NA 3A4SC 2GOWA 3DBRI 3PTFC 3UQBA 1BT0A 2IY0B 3IG3A 2FCQA 2M17A 2IO0B 4WWOA 3NOBA 3V61A 5HKHA 4ZRKA 2I1JA 4DWFA 3W1SA 4WAAA 2YVCA 4E71A 2FUHB 2LWPA 4AJYB 4G50A 1YQBA 1E7UA 2JY6A 3A9JA 3L10B 5LXHA 2K39A 1Q5WB 3A1QA 5AZFA 2IO2B 1F9JA 3TBLD 3IVFA 4A20A 1WYWB 2M8SA 3MTNB 1WRDB 2GBRA 2RGFA 3WANA 4DK5A 3V6CB 2K25A 2KJRA 1V49A 2EMSA 1WY8A 3SDLC 3AULA 1WR1A 3PRPB 2C7HA 2OOBB 3MJWA 2YLMA 4B6WA 4ANVA 1WJ6A 4PYUA 2MCNB 2DZMA 3WALA 1C1YB 4MELA 1WE7A 1Q1OA 3O65B 5J17A 2KO3A 2MRPA 4EUTA 2J0KA 3KVFB 1YIWA 4BKGA 1E5WA 3VH4B 3D32A 2UWQA 3W1SC 3M95A 1V5TA 5JZEB 4FBJB 1MG8A 3DBHI 1E8ZA 4E74A 4I6NB 3CSFA 2JF5A 5CHWA 2KZRA 1VD2A 3L17A 2D3GA 4JQWC 3APFA 3PREA 3VXWA 1WXAA 4IW0A 5CHVC 2ASQA 1AARA 1V5OA 1GC7A 2KVRA 5IAAC 2GBJA 2M1MA 4ICUA 3VAWA 3VH3B 2K8HA 1S3SG 2N7DA 3L54A 5CX3A 1R4NI 2N4FA 4DHJD 3GZNI 4W9CA 4FADA 1LQBA 4IWOA 2KDIA 3EECA 2MQJA 4HDQA 4TUUA 3HIZA 1E90A 2XEWA 3IBEA 3OAWA 2KNBA 1Q0WB 4WWPA 1WGYA 2KD0A 3VUYA 1E8WA 2CHWA 2MW5A 4G0NB 2JZ3B 2KXJA 3N30A 4NJ7A 4P7IA 4IUMB 4EKUA 2G45B 3VUWA 3DVGY 1NDDA 3CMMB 4KDIC 1EO6A 5TR5A 4GB9A 2WWZA 5J2RA 4GU2A 4NNJB 3K9PB 3PLVA 3A4RA 2PEAA 3PHWB 4G11A 4WQOB 1IYFA 2DHZA 4HJKA 3NZUA 1I35A 4W9HA 4DHZB 2DZKA 2RSUA 3DDCB 2I1KA 4PS7A 4II3B 4NAWA 4GOCA 2KX3A 2D2QA 4XZ4A 2G4DB 2JWZA 1XD3B 2LRWA 2CR5A 1WX7A 5E6NA 3SD5A 2CS4A 3ALBA 3KW5B 1TZ1A 3QJZA 4RMAA 5DPTA 4X57B 2Y5BB 4GDLB 3H7SA 5LLIA 2KC1A 3ZUNA 4FJZA 4FULA 2C7NB 4FJVB 3VTVA 1YX5B 2ZNVC 2AL6A 4PS8A 2DENB 3QQ8B 3ZVVA 4IG7B 4K1RB 1WR6E 2KDFB 4WJPA 1UH6A 4NJ6A 2ZJDA 1XT9B 4GMVA 4KVGB 2WYQA 1R4MI 2HJ8A 1V80A 2K6DB 3DOWA 3KUCB 4M8MA 3V60A 3JSVB 5FR6A 1OEYJ 2KFKB 3W1YA 4TQ0A 5AEKB 1V9JA 2IO3B 4EZJA 3ECIA 3C0RB 4HK2A 3AXCA 4XC2A 3VVWB 2WX0A 1EF5A 4GDKB 2KLGA 2ZPNA 2M4NA 2LZ6A 1KJTA 3QAQA 3T9LA 1L7YA 3ZW3A 2FNJB 5EDSA 2N9XA 1H8CA 2MP2A 4IWQA 3X23A 2PE6B 2JRHA 3HM3A 5JHBA 2JT4B 3NY5A 1D3ZA 2K8BA 2CU1A 3EFUA 4F7ZA 3DPDA 4KSKC 4JGHB 2J0MA 4LJPB 1WMHA 1LM8B 4GSWA 3R66C 4MGZE 2KFJA 5C23A 2BKRB 2D10A 3B08A 3PV1A 5G2NA 4MSQB 3DBSA 4FLHA 4GXBA 2DYMA 3NHEB 3KUDB 5KHQA 4FA6A 2MBQA 4GIVA 1V86A 2KJHB 4B95A 4DHZE 2N7EA 2REXA 3DVNV 3JYUA 2MBBB 1J19A 4LDTD 3UINB 4GDLA 4MGIE 4NQLB 4GGQA 1QZEA 2MBHA 3I3TB 4N9F4 1WXMA 3ZIMA 2LRUA 1KLVA 2LGXA 2IBIB 4K7SA 5JHAA 1ZW7A 2HD5B 3EC8A 4II2B 3VTWA 2KWCA 4IM3A 2O2VB 3X0WA 4MEMA 1WZ0A 1WFYA 1RAXA 2KTRB 4F1SA 2JUOA 4AUQC 4W9KA 2KX0A 2NCNA 4NPNA 3ZO5B 2O6VA 4FN2A 2NVUI 5DCNA 5E6PA 2AWTA 3GOEA 1P98A 1RRBA 4HXDA 2LVQA
chains in the Genus database with same CATH superfamily
4EZKA 2NTSA 4WAFA 3ZDTA 2N9PC 1L6UA 1NEKB 3PO0A 2IZVB 4XDDA 4URKA 4HRSA 2N7JA 3MJ5A 3ONSA 2OJRA 2WXRA 3DCGA 5BMHA 2MH7A 1QKZA 2BKFA 4HEA1 1FFUA 2BYTA 3AU5A 3QA8A 1UELA 4S17A 2LVPA 4DDID 1F2RC 4XX5A 3U4EG 2L83A 3AB5A 2V1YA 1E8XA 1K53A 2L7RA 3U2SC 4BFRA 3ZNHB 1QOBA 3NVVA 1FPYA 1TKEA 3E9SA 3N3KB 1TKGA 3HUIA 4NY0A 3SFDB 1J8CA 2BWES 2L32A 1XLNA 1KOTA 4US9A 1FXTB 2JU6X 5G55A 5G5HA 3NS8A 3TSSA 4PYZA 3TMPB 4BOSC 4KZ0A 4NAMA 4ANWA 1YN4A 3NG0A 2N9KA 3UIPB 2ZCCA 3CWIA 1BXTA 1WRIA 2CJOA 1C76A 1QQRA 3WAPA 1OTRB 5L95C 2D11A 2KDEB 4KSLC 2JVCA 2DNFA 3PHXB 4W9IA 1V1PB 4TMAB 4MJSA 1T0SC 4K81A 4W9GA 3IHPC 1XF5L 1Y8RC 1TBEA 5J18A 3OWEB 1JWMD 2NPTA 3PT2B 1ZE3D 1D5MC 2C60A 2K8CA 4M01A 3HK0A 1WIAA 1GNUA 2BB6A 2CU3A 4J6IA 1YQ3B 2GRIA 3BINA 1NVID 2ZEQA 3RD2A 1YOVB 4JX1C 2O6VD 3FKYA 1ISNA 1JRPA 3SEBA 3UIOB 4BAXA 3OLMD 3UF8A 3H1UA 3JSVA 2KFKA 3BY4B 4NAWB 2MJDA 3I57A 1PGXA 1L6VA 1XLPA 2LGIA 1OQRA 3ZGZA 1YX6B 2H89B 2FIFA 2LXCA 4ZOHC 4HROA 3H7PB 2LVOA 5G5GA 3MC0B 1WX9A 5KHOA 2L3ZA 1U4AA 5FK9C 3V05A 2ZPYA 1MPEA 2BYEA 1JROA 2DX5B 2BBCA 2MBOA 2KC2A 3TEWA 2CKHB 1DOXA 4KZCA 4L2YA 2C9WB 2NS5A 5AUIA 2WX1A 4MGYE 3P63A 2ZVOA 4XWWA 2N1VA 1D5XC 1UUPA 2W82A 1TS3A 5DPRA 2V4IB 1C4PA 4YSYB 1VDVA 1SE3A 2L0FA 5D6JB 3SR6A 4C7YA 2BW2A 2M0AA 4MDKE 2WXNA 3O13A 1WGGA 1KH0A 2G3QB 2L0TA 4A9AA 1KF6B 1XLQA 3VDZA 3PZ7A 5JH5C 2IGGA 5EE9A 3N9YC 4LTUA 4LCDE 4MACA 5HI1A 3VUXA 1J0GA 2OHFA 2DAJA 4ITKA 1WF9A 4YL8A 4OZAA 2ACZB 4HWIB 4AOFA 2PVOD 1C3TA 1OGWA 4CQNA 2KACA 1GPXA 1ZUD2 2LGYA 1MI0A 4R3DA 3ZJTA 3Q8CA 2KDMA 3P4SB 3ZYYX 4W9DA 1VRAB 4EOYA 3WAMA 5BO4B 2C7MB 1ZPSA 1K51A 3QK0A 4I6PA 3Q6BA 1D5ZC 2WXHA 1BT0A 3IG3A 2FCQA 2IO0B 4HPPA 3TEZA 2RMMA 2JY6A 5LXHA 3A1QA 5AZFA 4YXDB 2IO2B 2M8SA 2BVCA 3ZJVA 2W3RA 2FE8A 1V49A 1B1ZA 1A70A 1WR1A 2C7HA 4HKQA 3DHHC 4B6WA 1TZOA 3RNAC 2KMMA 5J17A 2KO3A 2KAJA 3KVFB 4BKGA 3Q8FA 1E5WA 1I4XA 1V1PA 1FXIA 1V5TA 3MHZA 4I6NB 5CHWA 2KZRA 1VD2A 3L17A 3VXWA 5I4DA 1EWCA 1GB4A 1IUEA 2M1MA 4YTNB 3WCQA 2K8HA 3RNGC 1S3SG 5CX3A 2LJIA 1N62A 4DHJD 4FADA 3EECA 4KKIA 4TUUA 1E90A 4N58A 3W2DA 1Q0WB 4WWPA 3OG5A 4C7ZA 1SEBD 1ZDXA 2MW5A 1IBXB 4XGAB 2KXJA 4P7IA 4P16A 1HTQA 4KDIC 3CMMB 1CZPA 1JWBD 2BB5A 3L4PA 5TR5A 4GU2A 3BK2A 4NNJB 3K9PB 3PLVA 1SSNA 1HEZE 2JYEA 1C78A 2RSUA 4II3B 4NAWA 2D2QA 2PVGC 2INPE 1SBBB 1XD3B 2WDRB 2CR5A 1WX7A 3SD5A 2WXIA 3KW5B 1JWAD 4X57B 1E10A 1NI3A 1L0YB 2C7NB 4FJVB 3VTVA 3NVWA 3QQ8B 4YTPB 4PK1A 5IKCM 1UH6A 2L1AA 1EWYC 4KVGB 2WYQA 1Y56A 3V60A 4TQ0A 5FR6A 1V9JA 4EZJA 3ECIA 4ZYSA 3C0RB 5GXGB 3VVWB 3IXSA 2KLGA 2ZPNA 1KTKA 3QAQA 2FNJB 5EDSA 4QAYA 1FM0D 3X23A 1TS5A 2JT4B 2JQRB 2K8BA 1ET9A 1DYQA 3EFUA 3AH7A 4KSKC 2WLBA 1WWTA 4MGZE 2LUMA 2WXQA 1D4BA 3PV1A 4MSQB 2JXTA 3KUDB 4FA6A 4ARCA 4DHZE 3UINB 3AM9A 3AECB 2MBHA 3ZIMA 1NENB 4Q2JA 1KLVA 2LGXA 2JZPA 1ZW7A 3EC8A 5BMGA 4RGTA 3R8BA 1WZ0A 4W9KA 4FN2A 2LVQA 4USAA 2K5PA 3RPFC 2WGSA 2M19A 2QSDA 1I4HA 1CQVA 1SIJA 3B0AA 4GDKA 1UBQA 5CTRC 1XEEA 1FRRA 2GLSA 3EHVA 4E3CA 1P1AA 3IAS1 1QOFA 3A9KB 3RULA 1STEA 4M02A 2WXLA 4JL9A 1WZ3A 3AE3B 2HJ1A 2KDBA 1CMXB 4OVUA 1SJED 2L00B 1C79A 3NVYA 1T0YA 2WDQB 2INNE 2WDTB 3PRMB 4A90A 1YN3A 4MJSB 2JYTA 4FHJA 5HG2A 3M3JA 4OZCA 1V81A 2K0PA 2NPTB 3HVZA 2JWUA 2KJ6A 1WGDA 3NJTA 2W9NA 1E7PB 2KHWB 1E6EB 4BOZB 3Q2AC 3AEFB 3RZWC 3S2AA 4B0MA 4EZLA 1JQ4A 4KGRA 1G6JA 1KM7A 2IO1B 3ZDMC 2VH2A 2BS2B 5BYRA 1M4VA 4I6LB 1IGDA 1F1HA 2MWSB 1JW9D 3RNEC 3IT4B 4LDTB 2J0JA 4WQMA 3GE3C 3JVZX 3ZNID 4HDOA 2PW9A 1ZXIA 2BYVE 3SU8X 4A3OA 4KV2A 2L76A 2ZZPB 3A33B 4M0WA 3KH0A 4W9JA 3Q8BA 4D2KA 1SE9A 1T5XD 4AJWA 3AE7B 2HDEA 4TV3A 5AZHA 4PS3A 2KMCA 4K3BA 4DHJB 3ZQ4A 2UYZB 3AE5B 5D94A 1WXSA 1N6ZA 2ZNVB 3R7QA 3V6EB 1FO4A 3PZ8A 1SE4A 3GE8C 2NBUA 3K9OB 2WXKA 2E6XA 2GBNA 1J7BA 1EM7A 4TKNA 3EUB2 2Y5CA 3BVGA 3FAHA 2JRIB 3W9CB 3SHQA 3CF6E 4YTMB 1ZOYB 3BZDB 1GC6A 5IOIA 4RCOA 3TEYA 2OEDA 2HE7A 3QX1A 1ESFA 1R4NB 4ZRQA 3GZNB 2XBBC 4BZAA 2AQ1B 5BMIA 3AEDB 1LFDA 2X8XX 2N0SB 2Z0EB 1TS2A 3QARA 4KDLB 2DZIA 1C4CA 1QLBB 3QWZB 1UZXB 2QHOA 3CSTA 3ZNZB 1SGHA 1IP9A 1XQQA 4BBNF 1IPGA 5LNK1 2I2YA 2MLBA 5D3DA 1PDXA 3ZRFA 3VTUA 2PTLA 2IJ0A 4DDGD 2QEJC 2KN5A 1WMHB 2R2OA 2ONQA 4IM0A 2KMAA 4M00A 4K7WA 3A1QB 1NYQA 3BYYB 3KWLA 1RFAA 3R7RA 1PQSA 1NBFC 3BWUD 3A9KA 1JWUD 1R4MB 3AI5A 4A8XC 2RD0A 4G3XB 3QIJA 3W5UB 3OJ3A 1UGMA 2BGFA 5E6OA 2KWVB 4DQOC 1HQRD 2GBKA 1EF1A 3AEAB 2PLPA 3URYA 1WM3A 1K52A 2FCNA 2WHIA 2MX2A 1HZ6A 1MG4A 3KYDD 2IY1B 1UD7A 4NZLB 3L13A 1VR9A 2BTEA 3DVNU 4C00A 2NMQA 2JXXA 2L05A 2N9EB 4IM2A 3ENEA 1TKYA 4MM3B 3UQBA 3MFGA 1HA5A 3NOBA 4ZRKA 3W1SA 3RNCC 2LWPA 1FNVA 3RMKC 3AEGB 4LLGM 5D3IB 2K39A 4DXFA 2DWQA 3IVFA 4A20A 3MTNB 1I4RA 3WANA 4DK5A 3V6CB 3GS2A 4L1BA 3KWVA 3SDLC 2QCZA 5T8IA 2ZW1A 2OOBB 4PYUA 3U7ZA 1C1YB 3VRBB 1Q1OA 3TEXA 4EUTA 3DBLB 2L52A 3AMZA 4FBJB 1MG8A 2WXPA 4E74A 2D3GA 3DWGC 3PREA 1WXAA 4OHJA 2ASQA 1AARA 1MVKA 2GBJA 1SE2A 3VAWA 2N4FA 4KGTA 4IWOA 2KDIA 3DHGC 1PGAA 3HIZA 4P1CC 4XE0A 1WGYA 1E8WA 4RGMA 2WU5B 2PKOA 4XDCA 4B0EA 4NJ7A 1OQQA 4EKUA 3VUWA 3AE4B 3DVGY 1EO6A 3A4RA 2EELA 1IYFA 4HJKA 4W9HA 3LYYA 1YJIA 4PS7A 4GOCA 2KX3A 1UWXA 2JWZA 1K50A 4RNAA 4RMAA 2WU2B 3H7SA 3ZUNA 2QMTA 3KLSX 4FULA 2BT6A 4K1RB 1FIQA 1WR6E 3VR9B 2ZJDA 2V3PA 2QIEB 1XT9B 2N9LA 4GMVA 2V9HA 3DOWA 1D6EC 3KUCB 1FEHA 5BYSA 3NVZA 1RFKA 4HK2A 2KN4A 1EF5A 2WX0A 4GDKB 2J42A 2M4NA 3T9LA 3ZW3A 2LFIA 3MC9A 2IGDA 2JX5A 4JWSC 3NY5A 3VR8B 1D3ZA 4F7ZA 1V8CA 4JGHB 4LJPB 1WMHA 1LM8B 2KFJA 2SAKA 1P7EA 1CJEA 2BKRB 3Q3MC 3DBSA 4FLHA 4GXBA 2Z8LA 2MJEA 2N7EA 3JYUA 4LDTD 1J19A 4GGQA 1WXMA 2FBWB 2D3BA 4RGNA 4K7SA 1XLOA 1UWMA 2O2VB 3X0WA 4P1BC 1SJHD 1WFYA 2KTRB 1FD6A 2QJLA 2KX0A 5E6PA 1TS4A 4ARIA 1RWSA 3MC8A 4B9KA 2DZJA 5IA7A 4ZRPA 3N1ZC 2KQ4X 3T3OA 1J7CA 3AE2B 2R61A 2Y3AA 3IFWB 2WDVB 2K6QA 3PRZA 4LJOB 4WJOA 1ZDVA 1WX8A 1SIFA 3N1XC 3OJ4B 4MM3A 2DLBA 2CHZA 1P3QU 4AS1A 1I42A 3PS6A 2PE9A 2NR2A 1QOGA 3GP7A 3H9DA 3RYTA 4BKSA 1DOYA 3LXFA 3ML9A 1JRUA 4MT5A 3MHSD 1A5RA 3VHTC 1WE6A 1GJZA 4M0WB 4MSMB 1WSPA 2MA9B 2JZZA 2VH1A 4K7UA 2LD9A 4JE3B 4ZRIA 2A4ZA 4PT5A 1VZ7A 2RR9A 1KLGD 4JPSA 2DAFA 2Z59B 1GUAB 4W9EA 1P0RA 2LHDA 4WWNA 3AEBB 3RN9C 2ZCBA 3Q8EA 2JPHA 2MEKA 4W9FA 4LNNA 1MFWA 2LUEA 1VCBA 4K3CA 5JXVA 4WJNA 3Q8AA 2DYBA 2L8JA 2LASA 3PSEB 4OW0A 4A55A 4ANXA 2FCMA 4DBGA 4XWTA 3FILB 4WH4A 2RDBC 3RNFC 4HPMB 3DBRB 3VQIA 1ENFA 3NUHB 3H6NA 2AL3A 3APCA 1MJDA 1UBIA 2ZVNA 1TGZB 3Q3FA 2IPKD 3RT3B 3N32A 1KRHA 2W3SA 2KWUB 3KUZA 1F0ZA 5DPSA 5GMVA 4ZDVA 1XCQL 1HZ5A 2KQSA 3ZTDA 4N59A 4LK0M 4HVBA 3HHMA 2G1EA 3B2FA 3Q14C 1I4GA 4UDUC 1J7AA 4MGKE 3V62A 3M63B 5L83A 3DBHB 2V0GA 3PZDA 3L08A 1WXVA 2FAZA 1L2NA 1HE8A 2LI5A 2INDC 2MBEA 4BKSD 3ZNGC 1EUVB 1OFFA 4GN1A 3ZXVA 2EKIA 4FJYA 4OZBA 2HTHA 3U30A 3LJ3A 4AP4C 3L16A 2I38A 4JLCA 4EE2A 2V4LA 3U8ZA 4XYCA 4LNKA 3DVGX 2O2VA 3NZSA 3WA0A 3IT6B 1XO3A 2KTRA 1F52A 1WGKA 2KYWA 3BYTB 4OVZA 3P42A 4ANUA 4ZYNA 1FXAA 2PPHA 3VRAB 3JW0X 4BKTA 3U7DA 2C5LC 3AE9B 4RM9A 3WAOA 3T3NA 1SXTA 4S0RA 3PLUA 4EFOA 2B3AA 3TCAA 1WM2A 4WJQA 2YEPB 3EA6A 4FXCA 1S1QB 2NBWB 4ZHPA 3TUOA 2DBYA 2LXAA 2VRRB 1LXDA 2CHXA 3BIID 5TSSA 1FNWA 5AUKA 2PJHA 1YN5A 1YJJA 2J4XA 2XK5B 2WXGA 3ZLZA 4RFBA 2GMIC 1FRDA 3EFCA 1PYWD 3NS1A 1L4ZB 1GOZA 3ZTCA 1OQYA 4HCNB 1T3QA 2LJ5A 3M62B 3R2IA 2K9XA 3AE8B 4HJGE 2GOWA 3PTFC 4WWOA 2M17A 2FUG1 3V61A 2YVCA 2ICIA 2FUHB 3V3XA 4AJYB 2KWDA 4E71A 3L10B 1Q5WB 1F9JA 2KVZA 1WYWB 3AEEB 2RGFA 1E9MA 1WY8A 1ZXHA 4RF0A 3P4PB 2YLMA 1DGJA 4ANVA 1PUTA 1EU3A 4MELA 1PGBA 3Q3OC 1WE7A 1ZP0B 1N5WA 2LHEA 1L4DB 2D3CA 1YIWA 2LEKA 3VH4B 3D32A 2CJNA 3FILA 3W1SC 1SB3C 1E8ZA 1SF0A 3CSFA 2JF5A 4JQWC 5CHVC 3L54A 1R4NI 3GZNI 4W9CA 1AWDA 4RF1A 4O1NA 4HDQA 2XEWA 3OAWA 2KNBA 2KD0A 4RGOS 3VUYA 3DHIC 2CHWA 1Q10A 4G0NB 2JZ3B 3U52E 1N63A 2KT7A 4IUMB 4AQ7A 1V97A 2PEAA 4G11A 3NZUA 1I35A 1DOIA 3DDCB 3ZJUA 3ETRA 2X38A 3KQ4A 4XZ4A 2QC8A 2LRWA 2WXFA 3DWMA 3ALBA 1TZ1A 3QJZA 2M56B 2Y5BB 5LLIA 1N61A 4DXGA 1T0QC 1L0VB 1FFVA 4FJZA 1V1OA 1YX5B 2ZNVC 4PS8A 2DENB 4KGSA 2KDFB 4WJPA 2V3NA 1R7SA 1FMAD 2ON8A 1R4MI 1I7HA 1V80A 4M8MA 1HTOA 1OEYJ 2IO3B 1T6BX 3EGRA 2BS4B 5IO9A 4KX6B 2LZ6A 1L7YA 2N9XA 1N60A 2JRHA 3HM3A 1F77A 4C4VB 3I5JC 3HVDA 5EE0A 2VZKB 3I9V1 3R66C 5C23A 2D10A 3B08A 4LNIA 3NHEB 5KHQA 4GIVA 2KJHB 3DVNV 2MBBB 1XCTL 4GDLA 1MHXA 4NQLB 1QZEA 1YQ4B 3I3TB 4N9F4 2IBIB 4A6QA 5JHAA 2HD5B 2LMCA 4MEMA 4KKJA 1QILA 1RAXA 2GI9A 2JUOA 1JMLA 2RPVA 2NCNA 3ZO5B 4C56C 2NVUI 3GOEA 1RRBA 3UI3A 4HXDA 2OJWA 2XK5A 4ZHOA 2AYOB 1K8RB 4KIKB 1I4PA 3AU4A 1MHHE 2IYDB 1E8YA 2QDFA 3DBLI 3RCZA 1WJUA 1GG3A 2K1FA 1N5XA 1JALA 1NYRA 1CK1A 2XNAC 2WQYB 2BQQA 2BF8B 2PIAA 2D07B 3KYCD 1FCCC 1C77A 2BYFA 5FR3A 1V2YA 1ZKHA 2EKEC 1UF0A 1E7VA 4HPLB 4RH6A 2MSED 4IWPA 3BVZA 2IDYA 2AQ2B 4ASWC 5AZGA 3PGEA 3GB1A 5HFYA 4AWJA 2G4SA 4JIOU 5LXIB 1WJ4A 1ZGUB 3ABVB 4NQKE 2RDHA 2WXJA 2Y5PA 4FHKA 3ZKJC 2JSVX 3PVLA 4TQ1A 4A3PA 1WXQA 3L0WB 4WIPA 4BBNC 2WNMA 3A9JB 2M0XA 2LGDA 1YJ1A 3AE1B 5DPWA 4YSZB 3UGBB 2K22A 3R2TA 3P1MA 3ML8A 5FKAC 3HM6X 2PMVA 2Q5WD 2J53A 2KK8A 3APDA 2V3SA 3RUIB 2J52A 3TJPA 3RI7C 2R2QA 2TSSA 3ZRCA 2KKCA 1JCKB 1YNTE 1LO5D 2WXMA 3AE6B 1Z2MA 3RZFA 3MP9A 5MPOA 4L23A 3P4QB 1NI2A 2RPQA 2KANA 2KQ7A 2B76B 4N6EB 1LGRA 1Z5SB 2GBMA 1QT9A 2KTFA 4OVVA 4CHKA 1WI0A 3QHTA 2BPSA 3WIMA 3T8MA 1E0ZA 3DQVA 1IGCA 2Z0DB 2G9HD 4ZRJA 4CO7A 3P2BA 1L0XB 2J7QB 4BVUC 5CHFA 4ICVA 4HCPB 2AEHA 1P7FA 1FCLA 4IDIA 5BYQA 2SEBD 3B1LX 1AN8A 1ROEA 1RLFA 3QCAA 4HLEA 4YSXB 5EE1A 3R3MA 3E56A 4C4VA 3B2GA 2QILA 3UQAA 2FIDA 1QOAA 4NJCA 2NTTA 2W54A 1WGHA 2A5UA 5H8YE 1WJNA 2MJ3A 2DYOA 3Q69A 1P9DU 2EMTA 4CYEA 5C3JB 3AV8A 1WYGA 3LDZE 1H4RA 1TT5B 2MP2B 1TTNA 4IKGA 1WGRA 1TY2A 1AW7A 2K3UA 3VFKA 1TY0A 2NBVB 4TSSA 4W9LA 3TIXA 5IN7A 5E6JA 2N1WA 3QC8B 4EEWA 4KIKA 4F8CB 1WH3A 2AQ3B 3H7PA 3PPAA 2KOXA 2KLCA 2FCSA 1QF6A 2AX5A 1OEYA 1TJEA 3NRZA 4J3OD 1BUIC 1X1MA 1YD8U 3SFEB 4DXAB 1AYFA 2O6VB 4MH0E 3TL5A 2E3TA 2ZW0A 3LB8C 1EU4A 1C4AA 1RYJA 4JWUC 2LGSA 4IC7B 4RM8A 2MHJA 5D7GA 5D2MB 1UNSA 2H88B 2UU7A 3Q3JA 4YT0B 1TYGB 1M94A 5C1ZA 1V6EA 2BWFA 2INCC 3C8YA 4WURA 4M8NA 3A4SC 3DBRI 2IY0B 5HKHA 4DWFA 2I1JA 4WAAA 1VLBA 1VZ6A 4G50A 1YQBA 1E7UA 3A9JA 3IAM1 2YEPF 1UGJA 1XXGA 3TBLD 1WRDB 2GBRA 1VJKA 3B9JA 2K25A 2KJRA 3I63C 4REZA 5EE3A 1JWSD 2EMSA 3AULA 3PRPB 4HKZE 3MJWA 1WJ6A 2MCNB 2RDGA 2DZMA 3WALA 1C9FA 3O65B 2MRPA 1HXYD 3Q3NC 3RNBC 2J0KA 3N1YC 2VZKD 2UWQA 3M95A 4H2AA 5JZEB 3DBHI 4C80A 3J9CA 2D5GA 3APFA 1RM6C 1GB1A 4IW0A 1V5OA 1GC7A 2KVRA 5IAAC 4GLSC 4ICUA 3VH3B 2BS3B 2N7DA 1ACCA 1KFYB 3P4RB 2XN9C 1LQBA 4P6VF 2MQJA 3IBEA 4LNFA 4MH8A 3N30A 2G45B 1NDDA 4GB9A 2WWZA 5J2RA 3NZ3A 1FNUA 3PHWB 1YMHE 4WQOB 2DHZA 2W55A 4DHZB 2DZKA 2I1KA 2G4DB 1GAQB 5IP4D 5HHDG 3AN1A 2D3AA 5E6NA 1TIFA 2CS4A 4ACFA 5DPTA 4GDLB 2KC1A 2GB1A 2AL6A 5C2TB 3ZVVA 1PFDA 4IG7B 4IOIE 1B9RA 4NJ6A 4US8A 2HJ8A 2K6DB 3JSVB 3W1YA 5AEKB 2KFKB 3AXCA 4XC2A 1T0RC 1KJTA 1L5PA 1H8CA 3H8HA 3CIRB 1IBXA 1F2RI 1VZ8A 2MP2A 4IWQA 2PE6B 3FC4A 5JHBA 2CU1A 3DPDA 2J0MA 1BMLC 4GSWA 4YWGG 4WWMA 5G2NA 3W5VB 2DYMA 3BK1A 1I4QA 2MBQA 4B95A 1V86A 3RFZB 2REXA 2WXOA 2IGHA 2WP9B 4MGIE 2WS3B 5H92C 1ET6A 4LNOA 2LRUA 3BVMA 4II2B 3VTWA 2KWCA 3ZXRA 4IM3A 4F1SA 4AUQC 4NPNA 2HTME 2O6VA 5DCNA 3N20C 2AWTA 3C19A 1KLUD 1P98A 3HRDD
chains in the Genus database with same CATH topology
4B9KA 2XK5A 4EZKA 2DZJA 5IA7A 3ZDTA 2AYOB 2N9PC 1K8RB 3B0AA 2IZVB 4GDKA 4KIKB 1UBQA 3AU4A 5CTRC 2IYDB 4URKA 1E8YA 3DBLI 3RCZA 1WJUA 1GG3A 3EHVA 3IFWB 4E3CA 1P1AA 3ONSA 2K1FA 2OJRA 3A9KB 2K6QA 3RULA 3PRZA 4LJOB 4WJOA 3DCGA 4JL9A 1WZ3A 1WX8A 1SIFA 2BF8B 2KDBA 3OJ4B 4MM3A 1CMXB 2BKFA 2D07B 3KYCD 4OVUA 3AU5A 2CHZA 2L00B 2BYFA 3QA8A 1P3QU 1UELA 1T0YA 1V2YA 1ZKHA 1I42A 2EKEC 2LVPA 2WDTB 3PRMB 3PS6A 1E7VA 4DDID 2PE9A 4XX5A 2NR2A 4HPLB 4MJSB 3H9DA 3RYTA 4BKSA 2V1YA 4FHJA 3ML9A 2MSED 1E8XA 1JRUA 4IWPA 3M3JA 3MHSD 1A5RA 2L7RA 1V81A 4BFRA 3ZNHB 2NPTB 3VHTC 1WE6A 1GJZA 4ASWC 5AZGA 3PGEA 4M0WB 4MSMB 2MA9B 2JZZA 4K7UA 2LD9A 4ZRIA 2G4SA 4JIOU 4AWJA 5LXIB 2A4ZA 1WJ4A 2KJ6A 1WGDA 1ZGUB 2RR9A 3N3KB 2DAFA 2W9NA 4NQKE 4NY0A 1J8CA 2BWES 4FHKA 3ZKJC 2KHWB 3PVLA 2Z59B 1GUAB 4BOZB 1KOTA 4TQ1A 4A3PA 1FXTB 4W9EA 3L0WB 5G55A 3S2AA 3RZWC 4BBNC 1P0RA 3A9JB 4EZLA 3NS8A 2M0XA 2LGDA 1YJ1A 4PYZA 1KM7A 5DPWA 1G6JA 2IO1B 3TMPB 4BOSC 3ZDMC 4WWNA 4KZ0A 3UGBB 2ZCBA 4W9FA 2JPHA 4I6LB 4ANWA 3ML8A 3HM6X 2MWSB 2LUEA 1VCBA 3UIPB 2ZCCA 2KK8A 3APDA 2V3SA 4LDTB 2J0JA 3RUIB 4WJNA 3TJPA 3WAPA 2R2QA 1OTRB 3JVZX 5L95C 3ZRCA 2DYBA 2L8JA 2LASA 2KKCA 3PSEB 3ZNID 2D11A 2KDEB 4ANXA 2FCMA 4KSLC 2JVCA 4DBGA 3PHXB 4HDOA 4W9IA 1Z2MA 4MJSA 4K81A 4W9GA 2BYVE 3IHPC 3RZFA 1Y8RC 3SU8X 1TBEA 4HPMB 4A3OA 4KV2A 3VQIA 5J18A 1NI2A 2L76A 2NPTA 3PT2B 2ZZPB 3A33B 3H6NA 2RPQA 2C60A 2KANA 2KQ7A 2AL3A 2K8CA 3KH0A 3APCA 1SE9A 4W9JA 4AJWA 1Z5SB 2GBMA 1UBIA 3HK0A 2KTFA 1WIAA 4OVVA 4CHKA 1GNUA 2ZVNA 1TGZB 1WI0A 3QHTA 4TV3A 2BPSA 3WIMA 3Q3FA 5AZHA 3T8MA 4J6IA 2KMCA 3DQVA 4PS3A 3RT3B 4DHJB 3BINA 2UYZB 2ZEQA 3N32A 3RD2A 2Z0DB 5D94A 2KWUB 1WXSA 2ZNVB 3KUZA 3R7QA 2O6VD 3V6EB 5DPSA 5GMVA 4ZDVA 4ZRJA 2KQSA 4CO7A 2NBUA 1ISNA 3K9OB 3UIOB 3ZTDA 3P2BA 3OLMD 3UF8A 2GBNA 2J7QB 4HVBA 3H1UA 4BVUC 3HHMA 3JSVA 2KFKA 3BY4B 4ICVA 4TKNA 5CHFA 4HCPB 2AEHA 4NAWB 4MGKE 3V62A 3M63B 5L83A 3B1LX 2JRIB 1YX6B 2LXCA 2FIFA 3H7PB 3L08A 1WXVA 3PZDA 2FAZA 2LVOA 3SHQA 3CF6E 1L2NA 1HE8A 1WX9A 1RLFA 3QCAA 4HLEA 2LI5A 1GC6A 5KHOA 2HE7A 2L3ZA 3QX1A 1U4AA 3R3MA 2XBBC 2ZPYA 3UQAA 2BYEA 2FIDA 1LFDA 2DX5B 2MBEA 2MBOA 2Z0EB 4BKSD 2KC2A 3ZNGC 1EUVB 2CKHB 1WGHA 3QARA 2A5UA 4GN1A 4KZCA 4FJYA 1WJNA 2C9WB 2NS5A 2HTHA 3U30A 2DYOA 2WX1A 1P9DU 3LJ3A 4MGYE 4KDLB 4AP4C 2EMTA 3L16A 2DZIA 2ZVOA 3QWZB 4JLCA 1UZXB 4CYEA 2QHOA 3CSTA 3ZNZB 2N1VA 1SGHA 2V4LA 1IP9A 3LDZE 1XQQA 1H4RA 3U8ZA 4BBNF 1IPGA 2MLBA 2MP2B 5DPRA 1TTNA 2O2VA 3DVGX 3NZSA 3VTUA 3WA0A 3ZRFA 2L0FA 5D6JB 2KTRA 4DDGD 1WGRA 2KN5A 4ANUA 1WMHB 4ZYNA 2PPHA 2R2OA 3VFKA 4IM0A 4MDKE 3JW0X 2NBVB 2KMAA 1WGGA 4W9LA 3TIXA 4BKTA 2G3QB 2L0TA 4K7WA 3U7DA 2C5LC 2N1WA 3QC8B 4RM9A 3VDZA 3WAOA 3A1QB 4KIKA 4EEWA 5JH5C 4F8CB 1WH3A 4LCDE 1RFAA 3H7PA 3PLUA 3R7RA 1PQSA 1NBFC 2B3AA 3TCAA 4EFOA 3A9KA 3PPAA 1WM2A 4WJQA 2KOXA 3VUXA 2KLCA 3AI5A 1J0GA 2DAJA 2FCSA 2RD0A 1S1QB 2NBWB 4G3XB 3QIJA 3OJ3A 1OEYA 1UGMA 1WF9A 2BGFA 2LXAA 2VRRB 5E6OA 4YL8A 1LXDA 2CHXA 2KWVB 1X1MA 1YD8U 4HWIB 4AOFA 2GBKA 4DXAB 2O6VB 4MH0E 1C3TA 1EF1A 3TL5A 1OGWA 2PJHA 2LGYA 1WM3A 2XK5B 2FCNA 2MX2A 3KYDD 2IY1B 1UD7A 3ZLZA 4IC7B 4RM8A 2GMIC 3L13A 5D7GA 5D2MB 4W9DA 3DVNU 3Q3JA 4EOYA 3WAMA 2JXXA 1M94A 2C7MB 5BO4B 1OQYA 4HCNB 2L05A 3ZTCA 1V6EA 2N9EB 2LJ5A 5C1ZA 4IM2A 3ENEA 3M62B 2BWFA 3QK0A 4I6PA 4M8NA 3A4SC 2GOWA 3DBRI 3PTFC 3UQBA 1BT0A 2IY0B 3IG3A 2FCQA 2M17A 2IO0B 4WWOA 3NOBA 3V61A 5HKHA 4ZRKA 2I1JA 4DWFA 3W1SA 4WAAA 2YVCA 4E71A 2FUHB 2LWPA 4AJYB 4G50A 1YQBA 1E7UA 2JY6A 3A9JA 3L10B 5LXHA 2K39A 1Q5WB 3A1QA 5AZFA 2IO2B 1F9JA 3TBLD 3IVFA 4A20A 1WYWB 2M8SA 3MTNB 1WRDB 2GBRA 2RGFA 3WANA 4DK5A 3V6CB 2K25A 2KJRA 1V49A 2EMSA 1WY8A 3SDLC 3AULA 1WR1A 3PRPB 2C7HA 2OOBB 3MJWA 2YLMA 4B6WA 4ANVA 1WJ6A 4PYUA 2MCNB 2DZMA 3WALA 1C1YB 4MELA 1WE7A 1Q1OA 3O65B 5J17A 2KO3A 2MRPA 4EUTA 2J0KA 3KVFB 1YIWA 4BKGA 1E5WA 3VH4B 3D32A 2UWQA 3W1SC 3M95A 1V5TA 5JZEB 4FBJB 1MG8A 3DBHI 1E8ZA 4E74A 4I6NB 3CSFA 2JF5A 5CHWA 2KZRA 1VD2A 3L17A 2D3GA 4JQWC 3APFA 3PREA 3VXWA 1WXAA 4IW0A 5CHVC 2ASQA 1AARA 1V5OA 1GC7A 2KVRA 5IAAC 2GBJA 2M1MA 4ICUA 3VAWA 3VH3B 2K8HA 1S3SG 2N7DA 3L54A 5CX3A 1R4NI 2N4FA 4DHJD 3GZNI 4W9CA 4FADA 1LQBA 4IWOA 2KDIA 3EECA 2MQJA 4HDQA 4TUUA 3HIZA 1E90A 2XEWA 3IBEA 3OAWA 2KNBA 1Q0WB 4WWPA 1WGYA 2KD0A 3VUYA 1E8WA 2CHWA 2MW5A 4G0NB 2JZ3B 2KXJA 3N30A 4NJ7A 4P7IA 4IUMB 4EKUA 2G45B 3VUWA 3DVGY 1NDDA 3CMMB 4KDIC 1EO6A 5TR5A 4GB9A 2WWZA 5J2RA 4GU2A 4NNJB 3K9PB 3PLVA 3A4RA 2PEAA 3PHWB 4G11A 4WQOB 1IYFA 2DHZA 4HJKA 3NZUA 1I35A 4W9HA 4DHZB 2DZKA 2RSUA 3DDCB 2I1KA 4PS7A 4II3B 4NAWA 4GOCA 2KX3A 2D2QA 4XZ4A 2G4DB 2JWZA 1XD3B 2LRWA 2CR5A 1WX7A 5E6NA 3SD5A 2CS4A 3ALBA 3KW5B 1TZ1A 3QJZA 4RMAA 5DPTA 4X57B 2Y5BB 4GDLB 3H7SA 5LLIA 2KC1A 3ZUNA 4FJZA 4FULA 2C7NB 4FJVB 3VTVA 1YX5B 2ZNVC 2AL6A 4PS8A 2DENB 3QQ8B 3ZVVA 4IG7B 4K1RB 1WR6E 2KDFB 4WJPA 1UH6A 4NJ6A 2ZJDA 1XT9B 4GMVA 4KVGB 2WYQA 1R4MI 2HJ8A 1V80A 2K6DB 3DOWA 3KUCB 4M8MA 3V60A 3JSVB 5FR6A 1OEYJ 2KFKB 3W1YA 4TQ0A 5AEKB 1V9JA 2IO3B 4EZJA 3ECIA 3C0RB 4HK2A 3AXCA 4XC2A 3VVWB 2WX0A 1EF5A 4GDKB 2KLGA 2ZPNA 2M4NA 2LZ6A 1KJTA 3QAQA 3T9LA 1L7YA 3ZW3A 2FNJB 5EDSA 2N9XA 1H8CA 2MP2A 4IWQA 3X23A 2PE6B 2JRHA 3HM3A 5JHBA 2JT4B 3NY5A 1D3ZA 2K8BA 2CU1A 3EFUA 4F7ZA 3DPDA 4KSKC 4JGHB 2J0MA 4LJPB 1WMHA 1LM8B 4GSWA 3R66C 4MGZE 2KFJA 5C23A 2BKRB 2D10A 3B08A 3PV1A 5G2NA 4MSQB 3DBSA 4FLHA 4GXBA 2DYMA 3NHEB 3KUDB 5KHQA 4FA6A 2MBQA 4GIVA 1V86A 2KJHB 4B95A 4DHZE 2N7EA 2REXA 3DVNV 3JYUA 2MBBB 1J19A 4LDTD 3UINB 4GDLA 4MGIE 4NQLB 4GGQA 1QZEA 2MBHA 3I3TB 4N9F4 1WXMA 3ZIMA 2LRUA 1KLVA 2LGXA 2IBIB 4K7SA 5JHAA 1ZW7A 2HD5B 3EC8A 4II2B 3VTWA 2KWCA 4IM3A 2O2VB 3X0WA 4MEMA 1WZ0A 1WFYA 1RAXA 2KTRB 4F1SA 2JUOA 4AUQC 4W9KA 2KX0A 2NCNA 4NPNA 3ZO5B 2O6VA 4FN2A 2NVUI 5DCNA 5E6PA 2AWTA 3GOEA 1P98A 1RRBA 4HXDA 2LVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9K A;  2XK5 A;  4EZK A;  2DZJ A;  5IA7 A;  3ZDT A;  2AYO B;  2N9P C;  1K8R B;  3B0A A;  2IZV B;  4GDK A;  4KIK B;  1UBQ A;  3AU4 A;  5CTR C;  2IYD B;  4URK A;  1E8Y A;  3DBL I;  3RCZ A;  1WJU A;  1GG3 A;  3EHV A;  3IFW B;  4E3C A;  1P1A A;  3ONS A;  2K1F A;  2OJR A;  3A9K B;  2K6Q A;  3RUL A;  3PRZ A;  4LJO B;  4WJO A;  3DCG A;  4JL9 A;  1WZ3 A;  1WX8 A;  1SIF A;  2BF8 B;  2KDB A;  3OJ4 B;  4MM3 A;  1CMX B;  2BKF A;  2D07 B;  3KYC D;  4OVU A;  3AU5 A;  2CHZ A;  2L00 B;  2BYF A;  3QA8 A;  1P3Q U;  1UEL A;  1T0Y A;  1V2Y A;  1ZKH A;  1I42 A;  2EKE C;  2LVP A;  2WDT B;  3PRM B;  3PS6 A;  1E7V A;  4DDI D;  2PE9 A;  4XX5 A;  2NR2 A;  4HPL B;  4MJS B;  3H9D A;  3RYT A;  4BKS A;  2V1Y A;  4FHJ A;  3ML9 A;  2MSE D;  1E8X A;  1JRU A;  4IWP A;  3M3J A;  3MHS D;  1A5R A;  2L7R A;  1V81 A;  4BFR A;  3ZNH B;  2NPT B;  3VHT C;  1WE6 A;  1GJZ A;  4ASW C;  5AZG A;  3PGE A;  4M0W B;  4MSM B;  2MA9 B;  2JZZ A;  4K7U A;  2LD9 A;  4ZRI A;  2G4S A;  4JIO U;  4AWJ A;  5LXI B;  2A4Z A;  1WJ4 A;  2KJ6 A;  1WGD A;  1ZGU B;  2RR9 A;  3N3K B;  2DAF A;  2W9N A;  4NQK E;  4NY0 A;  1J8C A;  2BWE S;  4FHK A;  3ZKJ C;  2KHW B;  3PVL A;  2Z59 B;  1GUA B;  4BOZ B;  1KOT A;  4TQ1 A;  4A3P A;  1FXT B;  4W9E A;  3L0W B;  5G55 A;  3S2A A;  3RZW C;  4BBN C;  1P0R A;  3A9J B;  4EZL A;  3NS8 A;  2M0X A;  2LGD A;  1YJ1 A;  4PYZ A;  1KM7 A;  5DPW A;  1G6J A;  2IO1 B;  3TMP B;  4BOS C;  3ZDM C;  4WWN A;  4KZ0 A;  3UGB B;  2ZCB A;  4W9F A;  2JPH A;  4I6L B;  4ANW A;  3ML8 A;  3HM6 X;  2MWS B;  2LUE A;  1VCB A;  3UIP B;  2ZCC A;  2KK8 A;  3APD A;  2V3S A;  4LDT B;  2J0J A;  3RUI B;  4WJN A;  3TJP A;  3WAP A;  2R2Q A;  1OTR B;  3JVZ X;  5L95 C;  3ZRC A;  2DYB A;  2L8J A;  2LAS A;  2KKC A;  3PSE B;  3ZNI D;  2D11 A;  2KDE B;  4ANX A;  2FCM A;  4KSL C;  2JVC A;  4DBG A;  3PHX B;  4HDO A;  4W9I A;  1Z2M A;  4MJS A;  4K81 A;  4W9G A;  2BYV E;  3IHP C;  3RZF A;  1Y8R C;  3SU8 X;  1TBE A;  4HPM B;  4A3O A;  4KV2 A;  3VQI A;  5J18 A;  1NI2 A;  2L76 A;  2NPT A;  3PT2 B;  2ZZP B;  3A33 B;  3H6N A;  2RPQ A;  2C60 A;  2KAN A;  2KQ7 A;  2AL3 A;  2K8C A;  3KH0 A;  3APC A;  1SE9 A;  4W9J A;  4AJW A;  1Z5S B;  2GBM A;  1UBI A;  3HK0 A;  2KTF A;  1WIA A;  4OVV A;  4CHK A;  1GNU A;  2ZVN A;  1TGZ B;  1WI0 A;  3QHT A;  4TV3 A;  2BPS A;  3WIM A;  3Q3F A;  5AZH A;  3T8M A;  4J6I A;  2KMC A;  3DQV A;  4PS3 A;  3RT3 B;  4DHJ B;  3BIN A;  2UYZ B;  2ZEQ A;  3N32 A;  3RD2 A;  2Z0D B;  5D94 A;  2KWU B;  1WXS A;  2ZNV B;  3KUZ A;  3R7Q A;  2O6V D;  3V6E B;  5DPS A;  5GMV A;  4ZDV A;  4ZRJ A;  2KQS A;  4CO7 A;  2NBU A;  1ISN A;  3K9O B;  3UIO B;  3ZTD A;  3P2B A;  3OLM D;  3UF8 A;  2GBN A;  2J7Q B;  4HVB A;  3H1U A;  4BVU C;  3HHM A;  3JSV A;  2KFK A;  3BY4 B;  4ICV A;  4TKN A;  5CHF A;  4HCP B;  2AEH A;  4NAW B;  4MGK E;  3V62 A;  3M63 B;  5L83 A;  3B1L X;  2JRI B;  1YX6 B;  2LXC A;  2FIF A;  3H7P B;  3L08 A;  1WXV A;  3PZD A;  2FAZ A;  2LVO A;  3SHQ A;  3CF6 E;  1L2N A;  1HE8 A;  1WX9 A;  1RLF A;  3QCA A;  4HLE A;  2LI5 A;  1GC6 A;  5KHO A;  2HE7 A;  2L3Z A;  3QX1 A;  1U4A A;  3R3M A;  2XBB C;  2ZPY A;  3UQA A;  2BYE A;  2FID A;  1LFD A;  2DX5 B;  2MBE A;  2MBO A;  2Z0E B;  4BKS D;  2KC2 A;  3ZNG C;  1EUV B;  2CKH B;  1WGH A;  3QAR A;  2A5U A;  4GN1 A;  4KZC A;  4FJY A;  1WJN A;  2C9W B;  2NS5 A;  2HTH A;  3U30 A;  2DYO A;  2WX1 A;  1P9D U;  3LJ3 A;  4MGY E;  4KDL B;  4AP4 C;  2EMT A;  3L16 A;  2DZI A;  2ZVO A;  3QWZ B;  4JLC A;  1UZX B;  4CYE A;  2QHO A;  3CST A;  3ZNZ B;  2N1V A;  1SGH A;  2V4L A;  1IP9 A;  3LDZ E;  1XQQ A;  1H4R A;  3U8Z A;  4BBN F;  1IPG A;  2MLB A;  2MP2 B;  5DPR A;  1TTN A;  2O2V A;  3DVG X;  3NZS A;  3VTU A;  3WA0 A;  3ZRF A;  2L0F A;  5D6J B;  2KTR A;  4DDG D;  1WGR A;  2KN5 A;  4ANU A;  1WMH B;  4ZYN A;  2PPH A;  2R2O A;  3VFK A;  4IM0 A;  4MDK E;  3JW0 X;  2NBV B;  2KMA A;  1WGG A;  4W9L A;  3TIX A;  4BKT A;  2G3Q B;  2L0T A;  4K7W A;  3U7D A;  2C5L C;  2N1W A;  3QC8 B;  4RM9 A;  3VDZ A;  3WAO A;  3A1Q B;  4KIK A;  4EEW A;  5JH5 C;  4F8C B;  1WH3 A;  4LCD E;  1RFA A;  3H7P A;  3PLU A;  3R7R A;  1PQS A;  1NBF C;  2B3A A;  3TCA A;  4EFO A;  3A9K A;  3PPA A;  1WM2 A;  4WJQ A;  2KOX A;  3VUX A;  2KLC A;  3AI5 A;  1J0G A;  2DAJ A;  2FCS A;  2RD0 A;  1S1Q B;  2NBW B;  4G3X B;  3QIJ A;  3OJ3 A;  1OEY A;  1UGM A;  1WF9 A;  2BGF A;  2LXA A;  2VRR B;  5E6O A;  4YL8 A;  1LXD A;  2CHX A;  2KWV B;  1X1M A;  1YD8 U;  4HWI B;  4AOF A;  2GBK A;  4DXA B;  2O6V B;  4MH0 E;  1C3T A;  1EF1 A;  3TL5 A;  1OGW A;  2PJH A;  2LGY A;  1WM3 A;  2XK5 B;  2FCN A;  2MX2 A;  3KYD D;  2IY1 B;  1UD7 A;  3ZLZ A;  4IC7 B;  4RM8 A;  2GMI C;  3L13 A;  5D7G A;  5D2M B;  4W9D A;  3DVN U;  3Q3J A;  4EOY A;  3WAM A;  2JXX A;  1M94 A;  2C7M B;  5BO4 B;  1OQY A;  4HCN B;  2L05 A;  3ZTC A;  1V6E A;  2N9E B;  2LJ5 A;  5C1Z A;  4IM2 A;  3ENE A;  3M62 B;  2BWF A;  3QK0 A;  4I6P A;  4M8N A;  3A4S C;  2GOW A;  3DBR I;  3PTF C;  3UQB A;  1BT0 A;  2IY0 B;  3IG3 A;  2FCQ A;  2M17 A;  2IO0 B;  4WWO A;  3NOB A;  3V61 A;  5HKH A;  4ZRK A;  2I1J A;  4DWF A;  3W1S A;  4WAA A;  2YVC A;  4E71 A;  2FUH B;  2LWP A;  4AJY B;  4G50 A;  1YQB A;  1E7U A;  2JY6 A;  3A9J A;  3L10 B;  5LXH A;  2K39 A;  1Q5W B;  3A1Q A;  5AZF A;  2IO2 B;  1F9J A;  3TBL D;  3IVF A;  4A20 A;  1WYW B;  2M8S A;  3MTN B;  1WRD B;  2GBR A;  2RGF A;  3WAN A;  4DK5 A;  3V6C B;  2K25 A;  2KJR A;  1V49 A;  2EMS A;  1WY8 A;  3SDL C;  3AUL A;  1WR1 A;  3PRP B;  2C7H A;  2OOB B;  3MJW A;  2YLM A;  4B6W A;  4ANV A;  1WJ6 A;  4PYU A;  2MCN B;  2DZM A;  3WAL A;  1C1Y B;  4MEL A;  1WE7 A;  1Q1O A;  3O65 B;  5J17 A;  2KO3 A;  2MRP A;  4EUT A;  2J0K A;  3KVF B;  1YIW A;  4BKG A;  1E5W A;  3VH4 B;  3D32 A;  2UWQ A;  3W1S C;  3M95 A;  1V5T A;  5JZE B;  4FBJ B;  1MG8 A;  3DBH I;  1E8Z A;  4E74 A;  4I6N B;  3CSF A;  2JF5 A;  5CHW A;  2KZR A;  1VD2 A;  3L17 A;  2D3G A;  4JQW C;  3APF A;  3PRE A;  3VXW A;  1WXA A;  4IW0 A;  5CHV C;  2ASQ A;  1AAR A;  1V5O A;  1GC7 A;  2KVR A;  5IAA C;  2GBJ A;  2M1M A;  4ICU A;  3VAW A;  3VH3 B;  2K8H A;  1S3S G;  2N7D A;  3L54 A;  5CX3 A;  1R4N I;  2N4F A;  4DHJ D;  3GZN I;  4W9C A;  4FAD A;  1LQB A;  4IWO A;  2KDI A;  3EEC A;  2MQJ A;  4HDQ A;  4TUU A;  3HIZ A;  1E90 A;  2XEW A;  3IBE A;  3OAW A;  2KNB A;  1Q0W B;  4WWP A;  1WGY A;  2KD0 A;  3VUY A;  1E8W A;  2CHW A;  2MW5 A;  4G0N B;  2JZ3 B;  2KXJ A;  3N30 A;  4NJ7 A;  4P7I A;  4IUM B;  4EKU A;  2G45 B;  3VUW A;  3DVG Y;  1NDD A;  3CMM B;  4KDI C;  1EO6 A;  5TR5 A;  4GB9 A;  2WWZ A;  5J2R A;  4GU2 A;  4NNJ B;  3K9P B;  3PLV A;  3A4R A;  2PEA A;  3PHW B;  4G11 A;  4WQO B;  1IYF A;  2DHZ A;  4HJK A;  3NZU A;  1I35 A;  4W9H A;  4DHZ B;  2DZK A;  2RSU A;  3DDC B;  2I1K A;  4PS7 A;  4II3 B;  4NAW A;  4GOC A;  2KX3 A;  2D2Q A;  4XZ4 A;  2G4D B;  2JWZ A;  1XD3 B;  2LRW A;  2CR5 A;  1WX7 A;  5E6N A;  3SD5 A;  2CS4 A;  3ALB A;  3KW5 B;  1TZ1 A;  3QJZ A;  4RMA A;  5DPT A;  4X57 B;  2Y5B B;  4GDL B;  3H7S A;  5LLI A;  2KC1 A;  3ZUN A;  4FJZ A;  4FUL A;  2C7N B;  4FJV B;  3VTV A;  1YX5 B;  2ZNV C;  2AL6 A;  4PS8 A;  2DEN B;  3QQ8 B;  3ZVV A;  4IG7 B;  4K1R B;  1WR6 E;  2KDF B;  4WJP A;  1UH6 A;  4NJ6 A;  2ZJD A;  1XT9 B;  4GMV A;  4KVG B;  2WYQ A;  1R4M I;  2HJ8 A;  1V80 A;  2K6D B;  3DOW A;  3KUC B;  4M8M A;  3V60 A;  3JSV B;  5FR6 A;  1OEY J;  2KFK B;  3W1Y A;  4TQ0 A;  5AEK B;  1V9J A;  2IO3 B;  4EZJ A;  3ECI A;  3C0R B;  4HK2 A;  3AXC A;  4XC2 A;  3VVW B;  2WX0 A;  1EF5 A;  4GDK B;  2KLG A;  2ZPN A;  2M4N A;  2LZ6 A;  1KJT A;  3QAQ A;  3T9L A;  1L7Y A;  3ZW3 A;  2FNJ B;  5EDS A;  2N9X A;  1H8C A;  2MP2 A;  4IWQ A;  3X23 A;  2PE6 B;  2JRH A;  3HM3 A;  5JHB A;  2JT4 B;  3NY5 A;  1D3Z A;  2K8B A;  2CU1 A;  3EFU A;  4F7Z A;  3DPD A;  4KSK C;  4JGH B;  2J0M A;  4LJP B;  1WMH A;  1LM8 B;  4GSW A;  3R66 C;  4MGZ E;  2KFJ A;  5C23 A;  2BKR B;  2D10 A;  3B08 A;  3PV1 A;  5G2N A;  4MSQ B;  3DBS A;  4FLH A;  4GXB A;  2DYM A;  3NHE B;  3KUD B;  5KHQ A;  4FA6 A;  2MBQ A;  4GIV A;  1V86 A;  2KJH B;  4B95 A;  4DHZ E;  2N7E A;  2REX A;  3DVN V;  3JYU A;  2MBB B;  1J19 A;  4LDT D;  3UIN B;  4GDL A;  4MGI E;  4NQL B;  4GGQ A;  1QZE A;  2MBH A;  3I3T B;  4N9F 4;  1WXM A;  3ZIM A;  2LRU A;  1KLV A;  2LGX A;  2IBI B;  4K7S A;  5JHA A;  1ZW7 A;  2HD5 B;  3EC8 A;  4II2 B;  3VTW A;  2KWC A;  4IM3 A;  2O2V B;  3X0W A;  4MEM A;  1WZ0 A;  1WFY A;  1RAX A;  2KTR B;  4F1S A;  2JUO A;  4AUQ C;  4W9K A;  2KX0 A;  2NCN A;  4NPN A;  3ZO5 B;  2O6V A;  4FN2 A;  2NVU I;  5DCN A;  5E6P A;  2AWT A;  3GOE A;  1P98 A;  1RRB A;  4HXD A;  2LVQ A; 
#chains in the Genus database with same CATH topology
 4EZK A;  2NTS A;  4WAF A;  3ZDT A;  2N9P C;  1L6U A;  1NEK B;  3PO0 A;  2IZV B;  4XDD A;  4URK A;  4HRS A;  2N7J A;  3MJ5 A;  3ONS A;  2OJR A;  2WXR A;  3DCG A;  5BMH A;  2MH7 A;  1QKZ A;  2BKF A;  4HEA 1;  1FFU A;  2BYT A;  3AU5 A;  3QA8 A;  1UEL A;  4S17 A;  2LVP A;  4DDI D;  1F2R C;  4XX5 A;  3U4E G;  2L83 A;  3AB5 A;  2V1Y A;  1E8X A;  1K53 A;  2L7R A;  3U2S C;  4BFR A;  3ZNH B;  1QOB A;  3NVV A;  1FPY A;  1TKE A;  3E9S A;  3N3K B;  1TKG A;  3HUI A;  4NY0 A;  3SFD B;  1J8C A;  2BWE S;  2L32 A;  1XLN A;  1KOT A;  4US9 A;  1FXT B;  2JU6 X;  5G55 A;  5G5H A;  3NS8 A;  3TSS A;  4PYZ A;  3TMP B;  4BOS C;  4KZ0 A;  4NAM A;  4ANW A;  1YN4 A;  3NG0 A;  2N9K A;  3UIP B;  2ZCC A;  3CWI A;  1BXT A;  1WRI A;  2CJO A;  1C76 A;  1QQR A;  3WAP A;  1OTR B;  5L95 C;  2D11 A;  2KDE B;  4KSL C;  2JVC A;  2DNF A;  3PHX B;  4W9I A;  1V1P B;  4TMA B;  4MJS A;  1T0S C;  4K81 A;  4W9G A;  3IHP C;  1XF5 L;  1Y8R C;  1TBE A;  5J18 A;  3OWE B;  1JWM D;  2NPT A;  3PT2 B;  1ZE3 D;  1D5M C;  2C60 A;  2K8C A;  4M01 A;  3HK0 A;  1WIA A;  1GNU A;  2BB6 A;  2CU3 A;  4J6I A;  1YQ3 B;  2GRI A;  3BIN A;  1NVI D;  2ZEQ A;  3RD2 A;  1YOV B;  4JX1 C;  2O6V D;  3FKY A;  1ISN A;  1JRP A;  3SEB A;  3UIO B;  4BAX A;  3OLM D;  3UF8 A;  3H1U A;  3JSV A;  2KFK A;  3BY4 B;  4NAW B;  2MJD A;  3I57 A;  1PGX A;  1L6V A;  1XLP A;  2LGI A;  1OQR A;  3ZGZ A;  1YX6 B;  2H89 B;  2FIF A;  2LXC A;  4ZOH C;  4HRO A;  3H7P B;  2LVO A;  5G5G A;  3MC0 B;  1WX9 A;  5KHO A;  2L3Z A;  1U4A A;  5FK9 C;  3V05 A;  2ZPY A;  1MPE A;  2BYE A;  1JRO A;  2DX5 B;  2BBC A;  2MBO A;  2KC2 A;  3TEW A;  2CKH B;  1DOX A;  4KZC A;  4L2Y A;  2C9W B;  2NS5 A;  5AUI A;  2WX1 A;  4MGY E;  3P63 A;  2ZVO A;  4XWW A;  2N1V A;  1D5X C;  1UUP A;  2W82 A;  1TS3 A;  5DPR A;  2V4I B;  1C4P A;  4YSY B;  1VDV A;  1SE3 A;  2L0F A;  5D6J B;  3SR6 A;  4C7Y A;  2BW2 A;  2M0A A;  4MDK E;  2WXN A;  3O13 A;  1WGG A;  1KH0 A;  2G3Q B;  2L0T A;  4A9A A;  1KF6 B;  1XLQ A;  3VDZ A;  3PZ7 A;  5JH5 C;  2IGG A;  5EE9 A;  3N9Y C;  4LTU A;  4LCD E;  4MAC A;  5HI1 A;  3VUX A;  1J0G A;  2OHF A;  2DAJ A;  4ITK A;  1WF9 A;  4YL8 A;  4OZA A;  2ACZ B;  4HWI B;  4AOF A;  2PVO D;  1C3T A;  1OGW A;  4CQN A;  2KAC A;  1GPX A;  1ZUD 2;  2LGY A;  1MI0 A;  4R3D A;  3ZJT A;  3Q8C A;  2KDM A;  3P4S B;  3ZYY X;  4W9D A;  1VRA B;  4EOY A;  3WAM A;  5BO4 B;  2C7M B;  1ZPS A;  1K51 A;  3QK0 A;  4I6P A;  3Q6B A;  1D5Z C;  2WXH A;  1BT0 A;  3IG3 A;  2FCQ A;  2IO0 B;  4HPP A;  3TEZ A;  2RMM A;  2JY6 A;  5LXH A;  3A1Q A;  5AZF A;  4YXD B;  2IO2 B;  2M8S A;  2BVC A;  3ZJV A;  2W3R A;  2FE8 A;  1V49 A;  1B1Z A;  1A70 A;  1WR1 A;  2C7H A;  4HKQ A;  3DHH C;  4B6W A;  1TZO A;  3RNA C;  2KMM A;  5J17 A;  2KO3 A;  2KAJ A;  3KVF B;  4BKG A;  3Q8F A;  1E5W A;  1I4X A;  1V1P A;  1FXI A;  1V5T A;  3MHZ A;  4I6N B;  5CHW A;  2KZR A;  1VD2 A;  3L17 A;  3VXW A;  5I4D A;  1EWC A;  1GB4 A;  1IUE A;  2M1M A;  4YTN B;  3WCQ A;  2K8H A;  3RNG C;  1S3S G;  5CX3 A;  2LJI A;  1N62 A;  4DHJ D;  4FAD A;  3EEC A;  4KKI A;  4TUU A;  1E90 A;  4N58 A;  3W2D A;  1Q0W B;  4WWP A;  3OG5 A;  4C7Z A;  1SEB D;  1ZDX A;  2MW5 A;  1IBX B;  4XGA B;  2KXJ A;  4P7I A;  4P16 A;  1HTQ A;  4KDI C;  3CMM B;  1CZP A;  1JWB D;  2BB5 A;  3L4P A;  5TR5 A;  4GU2 A;  3BK2 A;  4NNJ B;  3K9P B;  3PLV A;  1SSN A;  1HEZ E;  2JYE A;  1C78 A;  2RSU A;  4II3 B;  4NAW A;  2D2Q A;  2PVG C;  2INP E;  1SBB B;  1XD3 B;  2WDR B;  2CR5 A;  1WX7 A;  3SD5 A;  2WXI A;  3KW5 B;  1JWA D;  4X57 B;  1E10 A;  1NI3 A;  1L0Y B;  2C7N B;  4FJV B;  3VTV A;  3NVW A;  3QQ8 B;  4YTP B;  4PK1 A;  5IKC M;  1UH6 A;  2L1A A;  1EWY C;  4KVG B;  2WYQ A;  1Y56 A;  3V60 A;  4TQ0 A;  5FR6 A;  1V9J A;  4EZJ A;  3ECI A;  4ZYS A;  3C0R B;  5GXG B;  3VVW B;  3IXS A;  2KLG A;  2ZPN A;  1KTK A;  3QAQ A;  2FNJ B;  5EDS A;  4QAY A;  1FM0 D;  3X23 A;  1TS5 A;  2JT4 B;  2JQR B;  2K8B A;  1ET9 A;  1DYQ A;  3EFU A;  3AH7 A;  4KSK C;  2WLB A;  1WWT A;  4MGZ E;  2LUM A;  2WXQ A;  1D4B A;  3PV1 A;  4MSQ B;  2JXT A;  3KUD B;  4FA6 A;  4ARC A;  4DHZ E;  3UIN B;  3AM9 A;  3AEC B;  2MBH A;  3ZIM A;  1NEN B;  4Q2J A;  1KLV A;  2LGX A;  2JZP A;  1ZW7 A;  3EC8 A;  5BMG A;  4RGT A;  3R8B A;  1WZ0 A;  4W9K A;  4FN2 A;  2LVQ A;  4USA A;  2K5P A;  3RPF C;  2WGS A;  2M19 A;  2QSD A;  1I4H A;  1CQV A;  1SIJ A;  3B0A A;  4GDK A;  1UBQ A;  5CTR C;  1XEE A;  1FRR A;  2GLS A;  3EHV A;  4E3C A;  1P1A A;  3IAS 1;  1QOF A;  3A9K B;  3RUL A;  1STE A;  4M02 A;  2WXL A;  4JL9 A;  1WZ3 A;  3AE3 B;  2HJ1 A;  2KDB A;  1CMX B;  4OVU A;  1SJE D;  2L00 B;  1C79 A;  3NVY A;  1T0Y A;  2WDQ B;  2INN E;  2WDT B;  3PRM B;  4A90 A;  1YN3 A;  4MJS B;  2JYT A;  4FHJ A;  5HG2 A;  3M3J A;  4OZC A;  1V81 A;  2K0P A;  2NPT B;  3HVZ A;  2JWU A;  2KJ6 A;  1WGD A;  3NJT A;  2W9N A;  1E7P B;  2KHW B;  1E6E B;  4BOZ B;  3Q2A C;  3AEF B;  3RZW C;  3S2A A;  4B0M A;  4EZL A;  1JQ4 A;  4KGR A;  1G6J A;  1KM7 A;  2IO1 B;  3ZDM C;  2VH2 A;  2BS2 B;  5BYR A;  1M4V A;  4I6L B;  1IGD A;  1F1H A;  2MWS B;  1JW9 D;  3RNE C;  3IT4 B;  4LDT B;  2J0J A;  4WQM A;  3GE3 C;  3JVZ X;  3ZNI D;  4HDO A;  2PW9 A;  1ZXI A;  2BYV E;  3SU8 X;  4A3O A;  4KV2 A;  2L76 A;  2ZZP B;  3A33 B;  4M0W A;  3KH0 A;  4W9J A;  3Q8B A;  4D2K A;  1SE9 A;  1T5X D;  4AJW A;  3AE7 B;  2HDE A;  4TV3 A;  5AZH A;  4PS3 A;  2KMC A;  4K3B A;  4DHJ B;  3ZQ4 A;  2UYZ B;  3AE5 B;  5D94 A;  1WXS A;  1N6Z A;  2ZNV B;  3R7Q A;  3V6E B;  1FO4 A;  3PZ8 A;  1SE4 A;  3GE8 C;  2NBU A;  3K9O B;  2WXK A;  2E6X A;  2GBN A;  1J7B A;  1EM7 A;  4TKN A;  3EUB 2;  2Y5C A;  3BVG A;  3FAH A;  2JRI B;  3W9C B;  3SHQ A;  3CF6 E;  4YTM B;  1ZOY B;  3BZD B;  1GC6 A;  5IOI A;  4RCO A;  3TEY A;  2OED A;  2HE7 A;  3QX1 A;  1ESF A;  1R4N B;  4ZRQ A;  3GZN B;  2XBB C;  4BZA A;  2AQ1 B;  5BMI A;  3AED B;  1LFD A;  2X8X X;  2N0S B;  2Z0E B;  1TS2 A;  3QAR A;  4KDL B;  2DZI A;  1C4C A;  1QLB B;  3QWZ B;  1UZX B;  2QHO A;  3CST A;  3ZNZ B;  1SGH A;  1IP9 A;  1XQQ A;  4BBN F;  1IPG A;  5LNK 1;  2I2Y A;  2MLB A;  5D3D A;  1PDX A;  3ZRF A;  3VTU A;  2PTL A;  2IJ0 A;  4DDG D;  2QEJ C;  2KN5 A;  1WMH B;  2R2O A;  2ONQ A;  4IM0 A;  2KMA A;  4M00 A;  4K7W A;  3A1Q B;  1NYQ A;  3BYY B;  3KWL A;  1RFA A;  3R7R A;  1PQS A;  1NBF C;  3BWU D;  3A9K A;  1JWU D;  1R4M B;  3AI5 A;  4A8X C;  2RD0 A;  4G3X B;  3QIJ A;  3W5U B;  3OJ3 A;  1UGM A;  2BGF A;  5E6O A;  2KWV B;  4DQO C;  1HQR D;  2GBK A;  1EF1 A;  3AEA B;  2PLP A;  3URY A;  1WM3 A;  1K52 A;  2FCN A;  2WHI A;  2MX2 A;  1HZ6 A;  1MG4 A;  3KYD D;  2IY1 B;  1UD7 A;  4NZL B;  3L13 A;  1VR9 A;  2BTE A;  3DVN U;  4C00 A;  2NMQ A;  2JXX A;  2L05 A;  2N9E B;  4IM2 A;  3ENE A;  1TKY A;  4MM3 B;  3UQB A;  3MFG A;  1HA5 A;  3NOB A;  4ZRK A;  3W1S A;  3RNC C;  2LWP A;  1FNV A;  3RMK C;  3AEG B;  4LLG M;  5D3I B;  2K39 A;  4DXF A;  2DWQ A;  3IVF A;  4A20 A;  3MTN B;  1I4R A;  3WAN A;  4DK5 A;  3V6C B;  3GS2 A;  4L1B A;  3KWV A;  3SDL C;  2QCZ A;  5T8I A;  2ZW1 A;  2OOB B;  4PYU A;  3U7Z A;  1C1Y B;  3VRB B;  1Q1O A;  3TEX A;  4EUT A;  3DBL B;  2L52 A;  3AMZ A;  4FBJ B;  1MG8 A;  2WXP A;  4E74 A;  2D3G A;  3DWG C;  3PRE A;  1WXA A;  4OHJ A;  2ASQ A;  1AAR A;  1MVK A;  2GBJ A;  1SE2 A;  3VAW A;  2N4F A;  4KGT A;  4IWO A;  2KDI A;  3DHG C;  1PGA A;  3HIZ A;  4P1C C;  4XE0 A;  1WGY A;  1E8W A;  4RGM A;  2WU5 B;  2PKO A;  4XDC A;  4B0E A;  4NJ7 A;  1OQQ A;  4EKU A;  3VUW A;  3AE4 B;  3DVG Y;  1EO6 A;  3A4R A;  2EEL A;  1IYF A;  4HJK A;  4W9H A;  3LYY A;  1YJI A;  4PS7 A;  4GOC A;  2KX3 A;  1UWX A;  2JWZ A;  1K50 A;  4RNA A;  4RMA A;  2WU2 B;  3H7S A;  3ZUN A;  2QMT A;  3KLS X;  4FUL A;  2BT6 A;  4K1R B;  1FIQ A;  1WR6 E;  3VR9 B;  2ZJD A;  2V3P A;  2QIE B;  1XT9 B;  2N9L A;  4GMV A;  2V9H A;  3DOW A;  1D6E C;  3KUC B;  1FEH A;  5BYS A;  3NVZ A;  1RFK A;  4HK2 A;  2KN4 A;  1EF5 A;  2WX0 A;  4GDK B;  2J42 A;  2M4N A;  3T9L A;  3ZW3 A;  2LFI A;  3MC9 A;  2IGD A;  2JX5 A;  4JWS C;  3NY5 A;  3VR8 B;  1D3Z A;  4F7Z A;  1V8C A;  4JGH B;  4LJP B;  1WMH A;  1LM8 B;  2KFJ A;  2SAK A;  1P7E A;  1CJE A;  2BKR B;  3Q3M C;  3DBS A;  4FLH A;  4GXB A;  2Z8L A;  2MJE A;  2N7E A;  3JYU A;  4LDT D;  1J19 A;  4GGQ A;  1WXM A;  2FBW B;  2D3B A;  4RGN A;  4K7S A;  1XLO A;  1UWM A;  2O2V B;  3X0W A;  4P1B C;  1SJH D;  1WFY A;  2KTR B;  1FD6 A;  2QJL A;  2KX0 A;  5E6P A;  1TS4 A;  4ARI A;  1RWS A;  3MC8 A;  4B9K A;  2DZJ A;  5IA7 A;  4ZRP A;  3N1Z C;  2KQ4 X;  3T3O A;  1J7C A;  3AE2 B;  2R61 A;  2Y3A A;  3IFW B;  2WDV B;  2K6Q A;  3PRZ A;  4LJO B;  4WJO A;  1ZDV A;  1WX8 A;  1SIF A;  3N1X C;  3OJ4 B;  4MM3 A;  2DLB A;  2CHZ A;  1P3Q U;  4AS1 A;  1I42 A;  3PS6 A;  2PE9 A;  2NR2 A;  1QOG A;  3GP7 A;  3H9D A;  3RYT A;  4BKS A;  1DOY A;  3LXF A;  3ML9 A;  1JRU A;  4MT5 A;  3MHS D;  1A5R A;  3VHT C;  1WE6 A;  1GJZ A;  4M0W B;  4MSM B;  1WSP A;  2MA9 B;  2JZZ A;  2VH1 A;  4K7U A;  2LD9 A;  4JE3 B;  4ZRI A;  2A4Z A;  4PT5 A;  1VZ7 A;  2RR9 A;  1KLG D;  4JPS A;  2DAF A;  2Z59 B;  1GUA B;  4W9E A;  1P0R A;  2LHD A;  4WWN A;  3AEB B;  3RN9 C;  2ZCB A;  3Q8E A;  2JPH A;  2MEK A;  4W9F A;  4LNN A;  1MFW A;  2LUE A;  1VCB A;  4K3C A;  5JXV A;  4WJN A;  3Q8A A;  2DYB A;  2L8J A;  2LAS A;  3PSE B;  4OW0 A;  4A55 A;  4ANX A;  2FCM A;  4DBG A;  4XWT A;  3FIL B;  4WH4 A;  2RDB C;  3RNF C;  4HPM B;  3DBR B;  3VQI A;  1ENF A;  3NUH B;  3H6N A;  2AL3 A;  3APC A;  1MJD A;  1UBI A;  2ZVN A;  1TGZ B;  3Q3F A;  2IPK D;  3RT3 B;  3N32 A;  1KRH A;  2W3S A;  2KWU B;  3KUZ A;  1F0Z A;  5DPS A;  5GMV A;  4ZDV A;  1XCQ L;  1HZ5 A;  2KQS A;  3ZTD A;  4N59 A;  4LK0 M;  4HVB A;  3HHM A;  2G1E A;  3B2F A;  3Q14 C;  1I4G A;  4UDU C;  1J7A A;  4MGK E;  3V62 A;  3M63 B;  5L83 A;  3DBH B;  2V0G A;  3PZD A;  3L08 A;  1WXV A;  2FAZ A;  1L2N A;  1HE8 A;  2LI5 A;  2IND C;  2MBE A;  4BKS D;  3ZNG C;  1EUV B;  1OFF A;  4GN1 A;  3ZXV A;  2EKI A;  4FJY A;  4OZB A;  2HTH A;  3U30 A;  3LJ3 A;  4AP4 C;  3L16 A;  2I38 A;  4JLC A;  4EE2 A;  2V4L A;  3U8Z A;  4XYC A;  4LNK A;  3DVG X;  2O2V A;  3NZS A;  3WA0 A;  3IT6 B;  1XO3 A;  2KTR A;  1F52 A;  1WGK A;  2KYW A;  3BYT B;  4OVZ A;  3P42 A;  4ANU A;  4ZYN A;  1FXA A;  2PPH A;  3VRA B;  3JW0 X;  4BKT A;  3U7D A;  2C5L C;  3AE9 B;  4RM9 A;  3WAO A;  3T3N A;  1SXT A;  4S0R A;  3PLU A;  4EFO A;  2B3A A;  3TCA A;  1WM2 A;  4WJQ A;  2YEP B;  3EA6 A;  4FXC A;  1S1Q B;  2NBW B;  4ZHP A;  3TUO A;  2DBY A;  2LXA A;  2VRR B;  1LXD A;  2CHX A;  3BII D;  5TSS A;  1FNW A;  5AUK A;  2PJH A;  1YN5 A;  1YJJ A;  2J4X A;  2XK5 B;  2WXG A;  3ZLZ A;  4RFB A;  2GMI C;  1FRD A;  3EFC A;  1PYW D;  3NS1 A;  1L4Z B;  1GOZ A;  3ZTC A;  1OQY A;  4HCN B;  1T3Q A;  2LJ5 A;  3M62 B;  3R2I A;  2K9X A;  3AE8 B;  4HJG E;  2GOW A;  3PTF C;  4WWO A;  2M17 A;  2FUG 1;  3V61 A;  2YVC A;  2ICI A;  2FUH B;  3V3X A;  4AJY B;  2KWD A;  4E71 A;  3L10 B;  1Q5W B;  1F9J A;  2KVZ A;  1WYW B;  3AEE B;  2RGF A;  1E9M A;  1WY8 A;  1ZXH A;  4RF0 A;  3P4P B;  2YLM A;  1DGJ A;  4ANV A;  1PUT A;  1EU3 A;  4MEL A;  1PGB A;  3Q3O C;  1WE7 A;  1ZP0 B;  1N5W A;  2LHE A;  1L4D B;  2D3C A;  1YIW A;  2LEK A;  3VH4 B;  3D32 A;  2CJN A;  3FIL A;  3W1S C;  1SB3 C;  1E8Z A;  1SF0 A;  3CSF A;  2JF5 A;  4JQW C;  5CHV C;  3L54 A;  1R4N I;  3GZN I;  4W9C A;  1AWD A;  4RF1 A;  4O1N A;  4HDQ A;  2XEW A;  3OAW A;  2KNB A;  2KD0 A;  4RGO S;  3VUY A;  3DHI C;  2CHW A;  1Q10 A;  4G0N B;  2JZ3 B;  3U52 E;  1N63 A;  2KT7 A;  4IUM B;  4AQ7 A;  1V97 A;  2PEA A;  4G11 A;  3NZU A;  1I35 A;  1DOI A;  3DDC B;  3ZJU A;  3ETR A;  2X38 A;  3KQ4 A;  4XZ4 A;  2QC8 A;  2LRW A;  2WXF A;  3DWM A;  3ALB A;  1TZ1 A;  3QJZ A;  2M56 B;  2Y5B B;  5LLI A;  1N61 A;  4DXG A;  1T0Q C;  1L0V B;  1FFV A;  4FJZ A;  1V1O A;  1YX5 B;  2ZNV C;  4PS8 A;  2DEN B;  4KGS A;  2KDF B;  4WJP A;  2V3N A;  1R7S A;  1FMA D;  2ON8 A;  1R4M I;  1I7H A;  1V80 A;  4M8M A;  1HTO A;  1OEY J;  2IO3 B;  1T6B X;  3EGR A;  2BS4 B;  5IO9 A;  4KX6 B;  2LZ6 A;  1L7Y A;  2N9X A;  1N60 A;  2JRH A;  3HM3 A;  1F77 A;  4C4V B;  3I5J C;  3HVD A;  5EE0 A;  2VZK B;  3I9V 1;  3R66 C;  5C23 A;  2D10 A;  3B08 A;  4LNI A;  3NHE B;  5KHQ A;  4GIV A;  2KJH B;  3DVN V;  2MBB B;  1XCT L;  4GDL A;  1MHX A;  4NQL B;  1QZE A;  1YQ4 B;  3I3T B;  4N9F 4;  2IBI B;  4A6Q A;  5JHA A;  2HD5 B;  2LMC A;  4MEM A;  4KKJ A;  1QIL A;  1RAX A;  2GI9 A;  2JUO A;  1JML A;  2RPV A;  2NCN A;  3ZO5 B;  4C56 C;  2NVU I;  3GOE A;  1RRB A;  3UI3 A;  4HXD A;  2OJW A;  2XK5 A;  4ZHO A;  2AYO B;  1K8R B;  4KIK B;  1I4P A;  3AU4 A;  1MHH E;  2IYD B;  1E8Y A;  2QDF A;  3DBL I;  3RCZ A;  1WJU A;  1GG3 A;  2K1F A;  1N5X A;  1JAL A;  1NYR A;  1CK1 A;  2XNA C;  2WQY B;  2BQQ A;  2BF8 B;  2PIA A;  2D07 B;  3KYC D;  1FCC C;  1C77 A;  2BYF A;  5FR3 A;  1V2Y A;  1ZKH A;  2EKE C;  1UF0 A;  1E7V A;  4HPL B;  4RH6 A;  2MSE D;  4IWP A;  3BVZ A;  2IDY A;  2AQ2 B;  4ASW C;  5AZG A;  3PGE A;  3GB1 A;  5HFY A;  4AWJ A;  2G4S A;  4JIO U;  5LXI B;  1WJ4 A;  1ZGU B;  3ABV B;  4NQK E;  2RDH A;  2WXJ A;  2Y5P A;  4FHK A;  3ZKJ C;  2JSV X;  3PVL A;  4TQ1 A;  4A3P A;  1WXQ A;  3L0W B;  4WIP A;  4BBN C;  2WNM A;  3A9J B;  2M0X A;  2LGD A;  1YJ1 A;  3AE1 B;  5DPW A;  4YSZ B;  3UGB B;  2K22 A;  3R2T A;  3P1M A;  3ML8 A;  5FKA C;  3HM6 X;  2PMV A;  2Q5W D;  2J53 A;  2KK8 A;  3APD A;  2V3S A;  3RUI B;  2J52 A;  3TJP A;  3RI7 C;  2R2Q A;  2TSS A;  3ZRC A;  2KKC A;  1JCK B;  1YNT E;  1LO5 D;  2WXM A;  3AE6 B;  1Z2M A;  3RZF A;  3MP9 A;  5MPO A;  4L23 A;  3P4Q B;  1NI2 A;  2RPQ A;  2KAN A;  2KQ7 A;  2B76 B;  4N6E B;  1LGR A;  1Z5S B;  2GBM A;  1QT9 A;  2KTF A;  4OVV A;  4CHK A;  1WI0 A;  3QHT A;  2BPS A;  3WIM A;  3T8M A;  1E0Z A;  3DQV A;  1IGC A;  2Z0D B;  2G9H D;  4ZRJ A;  4CO7 A;  3P2B A;  1L0X B;  2J7Q B;  4BVU C;  5CHF A;  4ICV A;  4HCP B;  2AEH A;  1P7F A;  1FCL A;  4IDI A;  5BYQ A;  2SEB D;  3B1L X;  1AN8 A;  1ROE A;  1RLF A;  3QCA A;  4HLE A;  4YSX B;  5EE1 A;  3R3M A;  3E56 A;  4C4V A;  3B2G A;  2QIL A;  3UQA A;  2FID A;  1QOA A;  4NJC A;  2NTT A;  2W54 A;  1WGH A;  2A5U A;  5H8Y E;  1WJN A;  2MJ3 A;  2DYO A;  3Q69 A;  1P9D U;  2EMT A;  4CYE A;  5C3J B;  3AV8 A;  1WYG A;  3LDZ E;  1H4R A;  1TT5 B;  2MP2 B;  1TTN A;  4IKG A;  1WGR A;  1TY2 A;  1AW7 A;  2K3U A;  3VFK A;  1TY0 A;  2NBV B;  4TSS A;  4W9L A;  3TIX A;  5IN7 A;  5E6J A;  2N1W A;  3QC8 B;  4EEW A;  4KIK A;  4F8C B;  1WH3 A;  2AQ3 B;  3H7P A;  3PPA A;  2KOX A;  2KLC A;  2FCS A;  1QF6 A;  2AX5 A;  1OEY A;  1TJE A;  3NRZ A;  4J3O D;  1BUI C;  1X1M A;  1YD8 U;  3SFE B;  4DXA B;  1AYF A;  2O6V B;  4MH0 E;  3TL5 A;  2E3T A;  2ZW0 A;  3LB8 C;  1EU4 A;  1C4A A;  1RYJ A;  4JWU C;  2LGS A;  4IC7 B;  4RM8 A;  2MHJ A;  5D7G A;  5D2M B;  1UNS A;  2H88 B;  2UU7 A;  3Q3J A;  4YT0 B;  1TYG B;  1M94 A;  5C1Z A;  1V6E A;  2BWF A;  2INC C;  3C8Y A;  4WUR A;  4M8N A;  3A4S C;  3DBR I;  2IY0 B;  5HKH A;  4DWF A;  2I1J A;  4WAA A;  1VLB A;  1VZ6 A;  4G50 A;  1YQB A;  1E7U A;  3A9J A;  3IAM 1;  2YEP F;  1UGJ A;  1XXG A;  3TBL D;  1WRD B;  2GBR A;  1VJK A;  3B9J A;  2K25 A;  2KJR A;  3I63 C;  4REZ A;  5EE3 A;  1JWS D;  2EMS A;  3AUL A;  3PRP B;  4HKZ E;  3MJW A;  1WJ6 A;  2MCN B;  2RDG A;  2DZM A;  3WAL A;  1C9F A;  3O65 B;  2MRP A;  1HXY D;  3Q3N C;  3RNB C;  2J0K A;  3N1Y C;  2VZK D;  2UWQ A;  3M95 A;  4H2A A;  5JZE B;  3DBH I;  4C80 A;  3J9C A;  2D5G A;  3APF A;  1RM6 C;  1GB1 A;  4IW0 A;  1V5O A;  1GC7 A;  2KVR A;  5IAA C;  4GLS C;  4ICU A;  3VH3 B;  2BS3 B;  2N7D A;  1ACC A;  1KFY B;  3P4R B;  2XN9 C;  1LQB A;  4P6V F;  2MQJ A;  3IBE A;  4LNF A;  4MH8 A;  3N30 A;  2G45 B;  1NDD A;  4GB9 A;  2WWZ A;  5J2R A;  3NZ3 A;  1FNU A;  3PHW B;  1YMH E;  4WQO B;  2DHZ A;  2W55 A;  4DHZ B;  2DZK A;  2I1K A;  2G4D B;  1GAQ B;  5IP4 D;  5HHD G;  3AN1 A;  2D3A A;  5E6N A;  1TIF A;  2CS4 A;  4ACF A;  5DPT A;  4GDL B;  2KC1 A;  2GB1 A;  2AL6 A;  5C2T B;  3ZVV A;  1PFD A;  4IG7 B;  4IOI E;  1B9R A;  4NJ6 A;  4US8 A;  2HJ8 A;  2K6D B;  3JSV B;  3W1Y A;  5AEK B;  2KFK B;  3AXC A;  4XC2 A;  1T0R C;  1KJT A;  1L5P A;  1H8C A;  3H8H A;  3CIR B;  1IBX A;  1F2R I;  1VZ8 A;  2MP2 A;  4IWQ A;  2PE6 B;  3FC4 A;  5JHB A;  2CU1 A;  3DPD A;  2J0M A;  1BML C;  4GSW A;  4YWG G;  4WWM A;  5G2N A;  3W5V B;  2DYM A;  3BK1 A;  1I4Q A;  2MBQ A;  4B95 A;  1V86 A;  3RFZ B;  2REX A;  2WXO A;  2IGH A;  2WP9 B;  4MGI E;  2WS3 B;  5H92 C;  1ET6 A;  4LNO A;  2LRU A;  3BVM A;  4II2 B;  3VTW A;  2KWC A;  3ZXR A;  4IM3 A;  4F1S A;  4AUQ C;  4NPN A;  2HTM E;  2O6V A;  5DCN A;  3N20 C;  2AWT A;  3C19 A;  1KLU D;  1P98 A;  3HRD D; 
#chains in the Genus database with same CATH homology
 4B9K A;  2XK5 A;  4EZK A;  2DZJ A;  5IA7 A;  3ZDT A;  2AYO B;  2N9P C;  1K8R B;  3B0A A;  2IZV B;  4GDK A;  4KIK B;  1UBQ A;  3AU4 A;  5CTR C;  2IYD B;  4URK A;  1E8Y A;  3DBL I;  3RCZ A;  1WJU A;  1GG3 A;  3EHV A;  3IFW B;  4E3C A;  1P1A A;  3ONS A;  2K1F A;  2OJR A;  3A9K B;  2K6Q A;  3RUL A;  3PRZ A;  4LJO B;  4WJO A;  3DCG A;  4JL9 A;  1WZ3 A;  1WX8 A;  1SIF A;  2BF8 B;  2KDB A;  3OJ4 B;  4MM3 A;  1CMX B;  2BKF A;  2D07 B;  3KYC D;  4OVU A;  3AU5 A;  2CHZ A;  2L00 B;  2BYF A;  3QA8 A;  1P3Q U;  1UEL A;  1T0Y A;  1V2Y A;  1ZKH A;  1I42 A;  2EKE C;  2LVP A;  2WDT B;  3PRM B;  3PS6 A;  1E7V A;  4DDI D;  2PE9 A;  4XX5 A;  2NR2 A;  4HPL B;  4MJS B;  3H9D A;  3RYT A;  4BKS A;  2V1Y A;  4FHJ A;  3ML9 A;  2MSE D;  1E8X A;  1JRU A;  4IWP A;  3M3J A;  3MHS D;  1A5R A;  2L7R A;  1V81 A;  4BFR A;  3ZNH B;  2NPT B;  3VHT C;  1WE6 A;  1GJZ A;  4ASW C;  5AZG A;  3PGE A;  4M0W B;  4MSM B;  2MA9 B;  2JZZ A;  4K7U A;  2LD9 A;  4ZRI A;  2G4S A;  4JIO U;  4AWJ A;  5LXI B;  2A4Z A;  1WJ4 A;  2KJ6 A;  1WGD A;  1ZGU B;  2RR9 A;  3N3K B;  2DAF A;  2W9N A;  4NQK E;  4NY0 A;  1J8C A;  2BWE S;  4FHK A;  3ZKJ C;  2KHW B;  3PVL A;  2Z59 B;  1GUA B;  4BOZ B;  1KOT A;  4TQ1 A;  4A3P A;  1FXT B;  4W9E A;  3L0W B;  5G55 A;  3S2A A;  3RZW C;  4BBN C;  1P0R A;  3A9J B;  4EZL A;  3NS8 A;  2M0X A;  2LGD A;  1YJ1 A;  4PYZ A;  1KM7 A;  5DPW A;  1G6J A;  2IO1 B;  3TMP B;  4BOS C;  3ZDM C;  4WWN A;  4KZ0 A;  3UGB B;  2ZCB A;  4W9F A;  2JPH A;  4I6L B;  4ANW A;  3ML8 A;  3HM6 X;  2MWS B;  2LUE A;  1VCB A;  3UIP B;  2ZCC A;  2KK8 A;  3APD A;  2V3S A;  4LDT B;  2J0J A;  3RUI B;  4WJN A;  3TJP A;  3WAP A;  2R2Q A;  1OTR B;  3JVZ X;  5L95 C;  3ZRC A;  2DYB A;  2L8J A;  2LAS A;  2KKC A;  3PSE B;  3ZNI D;  2D11 A;  2KDE B;  4ANX A;  2FCM A;  4KSL C;  2JVC A;  4DBG A;  3PHX B;  4HDO A;  4W9I A;  1Z2M A;  4MJS A;  4K81 A;  4W9G A;  2BYV E;  3IHP C;  3RZF A;  1Y8R C;  3SU8 X;  1TBE A;  4HPM B;  4A3O A;  4KV2 A;  3VQI A;  5J18 A;  1NI2 A;  2L76 A;  2NPT A;  3PT2 B;  2ZZP B;  3A33 B;  3H6N A;  2RPQ A;  2C60 A;  2KAN A;  2KQ7 A;  2AL3 A;  2K8C A;  3KH0 A;  3APC A;  1SE9 A;  4W9J A;  4AJW A;  1Z5S B;  2GBM A;  1UBI A;  3HK0 A;  2KTF A;  1WIA A;  4OVV A;  4CHK A;  1GNU A;  2ZVN A;  1TGZ B;  1WI0 A;  3QHT A;  4TV3 A;  2BPS A;  3WIM A;  3Q3F A;  5AZH A;  3T8M A;  4J6I A;  2KMC A;  3DQV A;  4PS3 A;  3RT3 B;  4DHJ B;  3BIN A;  2UYZ B;  2ZEQ A;  3N32 A;  3RD2 A;  2Z0D B;  5D94 A;  2KWU B;  1WXS A;  2ZNV B;  3KUZ A;  3R7Q A;  2O6V D;  3V6E B;  5DPS A;  5GMV A;  4ZDV A;  4ZRJ A;  2KQS A;  4CO7 A;  2NBU A;  1ISN A;  3K9O B;  3UIO B;  3ZTD A;  3P2B A;  3OLM D;  3UF8 A;  2GBN A;  2J7Q B;  4HVB A;  3H1U A;  4BVU C;  3HHM A;  3JSV A;  2KFK A;  3BY4 B;  4ICV A;  4TKN A;  5CHF A;  4HCP B;  2AEH A;  4NAW B;  4MGK E;  3V62 A;  3M63 B;  5L83 A;  3B1L X;  2JRI B;  1YX6 B;  2LXC A;  2FIF A;  3H7P B;  3L08 A;  1WXV A;  3PZD A;  2FAZ A;  2LVO A;  3SHQ A;  3CF6 E;  1L2N A;  1HE8 A;  1WX9 A;  1RLF A;  3QCA A;  4HLE A;  2LI5 A;  1GC6 A;  5KHO A;  2HE7 A;  2L3Z A;  3QX1 A;  1U4A A;  3R3M A;  2XBB C;  2ZPY A;  3UQA A;  2BYE A;  2FID A;  1LFD A;  2DX5 B;  2MBE A;  2MBO A;  2Z0E B;  4BKS D;  2KC2 A;  3ZNG C;  1EUV B;  2CKH B;  1WGH A;  3QAR A;  2A5U A;  4GN1 A;  4KZC A;  4FJY A;  1WJN A;  2C9W B;  2NS5 A;  2HTH A;  3U30 A;  2DYO A;  2WX1 A;  1P9D U;  3LJ3 A;  4MGY E;  4KDL B;  4AP4 C;  2EMT A;  3L16 A;  2DZI A;  2ZVO A;  3QWZ B;  4JLC A;  1UZX B;  4CYE A;  2QHO A;  3CST A;  3ZNZ B;  2N1V A;  1SGH A;  2V4L A;  1IP9 A;  3LDZ E;  1XQQ A;  1H4R A;  3U8Z A;  4BBN F;  1IPG A;  2MLB A;  2MP2 B;  5DPR A;  1TTN A;  2O2V A;  3DVG X;  3NZS A;  3VTU A;  3WA0 A;  3ZRF A;  2L0F A;  5D6J B;  2KTR A;  4DDG D;  1WGR A;  2KN5 A;  4ANU A;  1WMH B;  4ZYN A;  2PPH A;  2R2O A;  3VFK A;  4IM0 A;  4MDK E;  3JW0 X;  2NBV B;  2KMA A;  1WGG A;  4W9L A;  3TIX A;  4BKT A;  2G3Q B;  2L0T A;  4K7W A;  3U7D A;  2C5L C;  2N1W A;  3QC8 B;  4RM9 A;  3VDZ A;  3WAO A;  3A1Q B;  4KIK A;  4EEW A;  5JH5 C;  4F8C B;  1WH3 A;  4LCD E;  1RFA A;  3H7P A;  3PLU A;  3R7R A;  1PQS A;  1NBF C;  2B3A A;  3TCA A;  4EFO A;  3A9K A;  3PPA A;  1WM2 A;  4WJQ A;  2KOX A;  3VUX A;  2KLC A;  3AI5 A;  1J0G A;  2DAJ A;  2FCS A;  2RD0 A;  1S1Q B;  2NBW B;  4G3X B;  3QIJ A;  3OJ3 A;  1OEY A;  1UGM A;  1WF9 A;  2BGF A;  2LXA A;  2VRR B;  5E6O A;  4YL8 A;  1LXD A;  2CHX A;  2KWV B;  1X1M A;  1YD8 U;  4HWI B;  4AOF A;  2GBK A;  4DXA B;  2O6V B;  4MH0 E;  1C3T A;  1EF1 A;  3TL5 A;  1OGW A;  2PJH A;  2LGY A;  1WM3 A;  2XK5 B;  2FCN A;  2MX2 A;  3KYD D;  2IY1 B;  1UD7 A;  3ZLZ A;  4IC7 B;  4RM8 A;  2GMI C;  3L13 A;  5D7G A;  5D2M B;  4W9D A;  3DVN U;  3Q3J A;  4EOY A;  3WAM A;  2JXX A;  1M94 A;  2C7M B;  5BO4 B;  1OQY A;  4HCN B;  2L05 A;  3ZTC A;  1V6E A;  2N9E B;  2LJ5 A;  5C1Z A;  4IM2 A;  3ENE A;  3M62 B;  2BWF A;  3QK0 A;  4I6P A;  4M8N A;  3A4S C;  2GOW A;  3DBR I;  3PTF C;  3UQB A;  1BT0 A;  2IY0 B;  3IG3 A;  2FCQ A;  2M17 A;  2IO0 B;  4WWO A;  3NOB A;  3V61 A;  5HKH A;  4ZRK A;  2I1J A;  4DWF A;  3W1S A;  4WAA A;  2YVC A;  4E71 A;  2FUH B;  2LWP A;  4AJY B;  4G50 A;  1YQB A;  1E7U A;  2JY6 A;  3A9J A;  3L10 B;  5LXH A;  2K39 A;  1Q5W B;  3A1Q A;  5AZF A;  2IO2 B;  1F9J A;  3TBL D;  3IVF A;  4A20 A;  1WYW B;  2M8S A;  3MTN B;  1WRD B;  2GBR A;  2RGF A;  3WAN A;  4DK5 A;  3V6C B;  2K25 A;  2KJR A;  1V49 A;  2EMS A;  1WY8 A;  3SDL C;  3AUL A;  1WR1 A;  3PRP B;  2C7H A;  2OOB B;  3MJW A;  2YLM A;  4B6W A;  4ANV A;  1WJ6 A;  4PYU A;  2MCN B;  2DZM A;  3WAL A;  1C1Y B;  4MEL A;  1WE7 A;  1Q1O A;  3O65 B;  5J17 A;  2KO3 A;  2MRP A;  4EUT A;  2J0K A;  3KVF B;  1YIW A;  4BKG A;  1E5W A;  3VH4 B;  3D32 A;  2UWQ A;  3W1S C;  3M95 A;  1V5T A;  5JZE B;  4FBJ B;  1MG8 A;  3DBH I;  1E8Z A;  4E74 A;  4I6N B;  3CSF A;  2JF5 A;  5CHW A;  2KZR A;  1VD2 A;  3L17 A;  2D3G A;  4JQW C;  3APF A;  3PRE A;  3VXW A;  1WXA A;  4IW0 A;  5CHV C;  2ASQ A;  1AAR A;  1V5O A;  1GC7 A;  2KVR A;  5IAA C;  2GBJ A;  2M1M A;  4ICU A;  3VAW A;  3VH3 B;  2K8H A;  1S3S G;  2N7D A;  3L54 A;  5CX3 A;  1R4N I;  2N4F A;  4DHJ D;  3GZN I;  4W9C A;  4FAD A;  1LQB A;  4IWO A;  2KDI A;  3EEC A;  2MQJ A;  4HDQ A;  4TUU A;  3HIZ A;  1E90 A;  2XEW A;  3IBE A;  3OAW A;  2KNB A;  1Q0W B;  4WWP A;  1WGY A;  2KD0 A;  3VUY A;  1E8W A;  2CHW A;  2MW5 A;  4G0N B;  2JZ3 B;  2KXJ A;  3N30 A;  4NJ7 A;  4P7I A;  4IUM B;  4EKU A;  2G45 B;  3VUW A;  3DVG Y;  1NDD A;  3CMM B;  4KDI C;  1EO6 A;  5TR5 A;  4GB9 A;  2WWZ A;  5J2R A;  4GU2 A;  4NNJ B;  3K9P B;  3PLV A;  3A4R A;  2PEA A;  3PHW B;  4G11 A;  4WQO B;  1IYF A;  2DHZ A;  4HJK A;  3NZU A;  1I35 A;  4W9H A;  4DHZ B;  2DZK A;  2RSU A;  3DDC B;  2I1K A;  4PS7 A;  4II3 B;  4NAW A;  4GOC A;  2KX3 A;  2D2Q A;  4XZ4 A;  2G4D B;  2JWZ A;  1XD3 B;  2LRW A;  2CR5 A;  1WX7 A;  5E6N A;  3SD5 A;  2CS4 A;  3ALB A;  3KW5 B;  1TZ1 A;  3QJZ A;  4RMA A;  5DPT A;  4X57 B;  2Y5B B;  4GDL B;  3H7S A;  5LLI A;  2KC1 A;  3ZUN A;  4FJZ A;  4FUL A;  2C7N B;  4FJV B;  3VTV A;  1YX5 B;  2ZNV C;  2AL6 A;  4PS8 A;  2DEN B;  3QQ8 B;  3ZVV A;  4IG7 B;  4K1R B;  1WR6 E;  2KDF B;  4WJP A;  1UH6 A;  4NJ6 A;  2ZJD A;  1XT9 B;  4GMV A;  4KVG B;  2WYQ A;  1R4M I;  2HJ8 A;  1V80 A;  2K6D B;  3DOW A;  3KUC B;  4M8M A;  3V60 A;  3JSV B;  5FR6 A;  1OEY J;  2KFK B;  3W1Y A;  4TQ0 A;  5AEK B;  1V9J A;  2IO3 B;  4EZJ A;  3ECI A;  3C0R B;  4HK2 A;  3AXC A;  4XC2 A;  3VVW B;  2WX0 A;  1EF5 A;  4GDK B;  2KLG A;  2ZPN A;  2M4N A;  2LZ6 A;  1KJT A;  3QAQ A;  3T9L A;  1L7Y A;  3ZW3 A;  2FNJ B;  5EDS A;  2N9X A;  1H8C A;  2MP2 A;  4IWQ A;  3X23 A;  2PE6 B;  2JRH A;  3HM3 A;  5JHB A;  2JT4 B;  3NY5 A;  1D3Z A;  2K8B A;  2CU1 A;  3EFU A;  4F7Z A;  3DPD A;  4KSK C;  4JGH B;  2J0M A;  4LJP B;  1WMH A;  1LM8 B;  4GSW A;  3R66 C;  4MGZ E;  2KFJ A;  5C23 A;  2BKR B;  2D10 A;  3B08 A;  3PV1 A;  5G2N A;  4MSQ B;  3DBS A;  4FLH A;  4GXB A;  2DYM A;  3NHE B;  3KUD B;  5KHQ A;  4FA6 A;  2MBQ A;  4GIV A;  1V86 A;  2KJH B;  4B95 A;  4DHZ E;  2N7E A;  2REX A;  3DVN V;  3JYU A;  2MBB B;  1J19 A;  4LDT D;  3UIN B;  4GDL A;  4MGI E;  4NQL B;  4GGQ A;  1QZE A;  2MBH A;  3I3T B;  4N9F 4;  1WXM A;  3ZIM A;  2LRU A;  1KLV A;  2LGX A;  2IBI B;  4K7S A;  5JHA A;  1ZW7 A;  2HD5 B;  3EC8 A;  4II2 B;  3VTW A;  2KWC A;  4IM3 A;  2O2V B;  3X0W A;  4MEM A;  1WZ0 A;  1WFY A;  1RAX A;  2KTR B;  4F1S A;  2JUO A;  4AUQ C;  4W9K A;  2KX0 A;  2NCN A;  4NPN A;  3ZO5 B;  2O6V A;  4FN2 A;  2NVU I;  5DCN A;  5E6P A;  2AWT A;  3GOE A;  1P98 A;  1RRB A;  4HXD A;  2LVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...