1YQ4B

Avian respiratory complex ii with 3-nitropropionate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase flavoprotein subunit
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq4B01
1E10A 1CJEA 3AE9B 1QOAA 3P4RB 3SFDB 4YT0B 1WXQA 3DWGC 1T3QA 1ZOYB 1TKGA 4US8A 3AEFB 3P4QB 3HUIA 1SF0A 2Q5WD 2WDVB 2G1EA 2BS4B 1JRPA 2BS2B 1OQQA 1SIJA 1QOFA 2DBYA 4C7YA 4ITKA 2BT6A 3VR8B 1E7PB 1GTEA 3AEDB 1N5WA 1R7SA 3B2FA 4HRSA 1NVID 4A9AA 4JX1C 2CU3A 3LB8C 1IUEA 2WP9B 1L0VB 3ABVB 1UWMA 2WS3B 1NYQA 1OFFA 2K22A 1PFDA 2CJOA 2QJLA 1JQ4A 4N58A 3NRZA 3HVZA 2PVGC 2K9XA 5EE9A 1FFUA 1JROA 2LEKA 4ZHPA 3NVZA 2FBWB 1ROEA 1WRIA 1XLNA 3CIRB 3LXFA 4N59A 3W9CB 3AEEB 1GT8A 1KRHA 2PIAA 3CF4A 3HRDD 3NVWA 5MPOA 5G5GA 4HROA 1E6EB 1E9MA 1N63A 1OQRA 3RPFC 3VRAB 1FRDA 2E3TA 3AM9A 2B76B 1NENB 3AEAB 1AWDA 2W3SA 1RYJA 1YQ4B 2MJEA 3W5UB 3VR9B 3AEGB 1A70A 2W55A 1JWBD 4WQMA 4USAA 1B9RA 1QLBB 2WDQB 1EWYC 1V8CA 4JWSC 4C7ZA 1QOBA 3EUB2 1RM6C 1GPXA 2EKIA 4YSZB 4YSYB 4YXDB 1NI3A 1L5PA 3AE6B 3NS1A 2Y5CA 2PKOA 3P4PB 1L6VA 1XO3A 1NEKB 1ZUD2 1YQ3B 3AN1A 2QIEB 4C80A 4ZOHC 3P63A 3VRBB 5GXGB 3AE8B 2H88B 3P1MA 1H7XA 2M56B 1J7AA 1TKEA 3CWIA 4ZHOA 5C2TB 1KF6B 5AUKA 3BIID 4YSXB 1E0ZA 1FRRA 1F0ZA 3ZYYX 2BS3B 1QT9A 1V97A 1RWSA 3SFEB 2WU2B 2WDRB 2WU5B 1XLQA 1VLBA 2M19A 5G5HA 1WWTA 5C3JB 3L4PA 2W54A 2L52A 1DGJA 1H7WA 4WWMA 1N60A 2N0SB 1JWAD 1NYRA 2MH7A 2HTME 4N6EB 1XLOA 1YJIA 2CJNA 3AEBB 3FC4A 5EE0A 3NVYA 3W5VB 1FMAD 1QF6A 3SR6A 1JALA 4YTPB 2PVOD 1PUTA 3FAHA 1AYFA 2WQYB 4KX6B 1FXIA 1WGKA 3AE2B 5AUIA 2KAJA 3WCQA 3AE5B 1XLPA 4YTMB 1VDVA 3KWLA 5EE1A 1FM0D 1DOYA 2ACZB 1DOIA 1FO4A 1YJJA 1PDXA 3AE7B 1FXAA 2L83A 1J7CA 1CZPA 1L6UA 2DWQA 1TJEA 2MJDA 3AB5A 3AH7A 3AMZA 4IDIA 1DOXA 1SB3C 2WLBA 2K5PA 1FIQA 5EE3A 3P4SB 2KMMA 1KFYB 3B2GA 3NVVA 1J7BA 2AX5A 4FXCA 4JWUC 3AECB 1JW9D 4YTNB 3B9JA 3PO0A 1N5XA 5H8YE 1WYGA 3ETRA 3AE4B 1TYGB 2MJ3A 2OHFA 1VJKA 1ZXIA 2W3RA 4LTUA 3DWMA 3AE3B 1GTHA 1I7HA 1N61A 1TKYA 1QOGA 3AV8A 1N62A 1RFKA 1FFVA 2JQRB 4P6VF 2H89B 1ZP0B 2JX5A 4US9A 5H92C 1GAQB 3AE1B
chains in the Genus database with same CATH superfamily
3KYCD 2IGDA 2HD5B 2WHIA 4AOFA 4US8A 1A5RA 2G1EA 1HZ5A 2DBYA 3P2BA 3AEDB 4AUQC 2LHDA 1S1QB 1R4NB 2J0MA 2KDFB 1WRIA 2RD0A 2M8SA 5MPOA 2KJHB 1I42A 1FCLA 4C4VA 2VZKD 4XWWA 3O65B 4GOCA 5BYQA 2K1FA 4KZCA 4NJCA 1J19A 4PT5A 2ZCBA 3NZSA 4C80A 1GJZA 1J7AA 2IPKD 1E5WA 3BINA 2WU2B 1ENFA 2A4ZA 4A3PA 5DPSA 2CHWA 2KMAA 3E9SA 2LGSA 4GDLA 4II3B 3ZNGC 1OTRB 1WR6E 4FULA 1E8WA 4OZAA 3A9JB 3ONSA 3AE2B 3RD2A 5AZFA 1FM0D 4Q2JA 3AE7B 3J9CA 4BFRA 1J7CA 2V3PA 2AL6A 2DZJA 1ET6A 4FXCA 4K7WA 4K7SA 2D3BA 4LTUA 2I2YA 1WJNA 3KUZA 4ANXA 1ZE3D 1V81A 1E10A 2X8XX 1T3QA 2RSUA 1SF0A 1P1AA 1ZDXA 2PE6B 1I4PA 4AP4C 1I4HA 1YX5B 2PPHA 1P9DU 2C9WB 2WYQA 3B2FA 1JWMD 4A55A 3QIJA 2Y5PA 4NAMA 1NYQA 3TL5A 1JQ4A 4LJOB 1P7EA 1UBQA 5J17A 3A9JA 2PIAA 3PREA 3TEWA 3RNCC 3HHMA 1HEZE 2JY6A 1E9MA 1VR9A 2D3AA 2WWZA 1FNVA 4E3CA 2DENB 1ET9A 4IM3A 3W5UB 4OZBA 4JPSA 4ZRQA 1J8CA 4L2YA 2BKRB 2EKIA 3P4PB 2MHJA 1H8CA 4XYCA 2BYTA 1Y56A 2WX0A 3HK0A 5DCNA 4MGZE 2INNE 2MBQA 1ACCA 4E71A 4XWTA 5HKHA 3Q8CA 1DGJA 2WGSA 3JVZX 3HIZA 4ZYNA 1BMLC 4A8XC 2WXLA 2QDFA 4RF1A 2PVOD 1Z2MA 2WX1A 3FAHA 3Q14C 4FADA 1HTOA 4FN2A 1HE8A 1VDVA 1VZ8A 3V05A 3DBLB 2VZKB 3AH7A 2MJDA 5BMGA 2B3AA 2M4NA 3DHIC 5BMHA 1DYQA 4MJSB 3B2GA 2Z59B 3PHWB 4G11A 1GC6A 2GOWA 3RNAC 1WX8A 2N9EB 4MGYE 3N9YC 1YX6B 4MH0E 2INDC 2H89B 4LDTD 3L08A 3AE1B 1QOAA 3WALA 2Q5WD 2WDVB 1YIWA 2L0TA 3VTUA 3L54A 2M1MA 4K1RB 1K53A 4ITKA 3NZ3A 2DLBA 3CF6E 3HM6X 5CX3A 3OG5A 4N58A 3GP7A 1I4RA 5EE9A 4JGHB 1FFUA 1E8XA 2N9KA 3RI7C 1ZPSA 4N59A 2IO3B 2CHZA 2KDEB 3CF4A 3X23A 3RPFC 1D3ZA 2GLSA 4HWIB 3RZWC 4JWSC 1RM6C 3LYYA 2R61A 1AARA 3TUOA 2Y5CA 2PKOA 3RNGC 1J0GA 4WWOA 4MM3B 2KFKB 4OVVA 3GE3C 1QQRA 2KFKA 1RWSA 3ZDMC 2BPSA 2WDRB 2D07B 1NYRA 2DYOA 2PEAA 2CJNA 5AZGA 3I57A 4YTPB 2DNFA 2GBMA 1C1YB 1K52A 5FR3A 2RR9A 4XC2A 2O6VD 3GE8C 3TJPA 3CSFA 1SIFA 1VZ6A 2KTFA 2GBJA 1HA5A 4DHJD 4LJPB 2Y5BB 1FXAA 4ANVA 1SE4A 1ZGUB 1C4AA 3AULA 4XX5A 3ETRA 2VH1A 4NJ6A 1ZXIA 1WXMA 2GBNA 3DBRI 4DXFA 3IBEA 4GLSC 4MGKE 1EO6A 2JQRB 3UI3A 1UF0A 4HPLB 4CYEA 2KVZA 3DWGC 2NPTB 3EGRA 1C3TA 1WFYA 4W9EA 1N5WA 4HRSA 4ZRIA 3I9V1 2C7HA 2WP9B 2FE8A 3PS6A 3ZNHB 4NAWA 2L00B 2J0KA 3PRPB 3V3XA 1JROA 4MDKE 2C5LC 3H1UA 2KJ6A 2NR2A 1GT8A 3MC0B 4KGRA 4D2KA 3VRAB 3PLUA 1RYJA 4CHKA 1F2RC 1L7YA 1JWBD 5LXHA 3BVGA 3RCZA 1LQBA 1TZ1A 2LASA 2JWZA 3ZKJC 1FXTB 4IG7B 3UIPB 1BUIC 2L0FA 1WX9A 2GMIC 2YEPF 4ZOHC 2AQ1B 4MELA 2YVCA 4YSXB 3DVNU 2ZVNA 1WRDB 2REXA 1F9JA 5JZEB 3VXWA 1XLQA 4XDCA 4TMAB 4WJQA 1IP9A 2ON8A 5C23A 2ZW0A 2KWCA 3RN9C 4LLGM 4B6WA 1V1PB 2N9PC 1HTQA 4HK2A 1MHHE 3UINB 1WXSA 2JF5A 1V6EA 4ANWA 3SU8X 3AE5B 4CO7A 2JRIB 4HPMB 4PK1A 2DAJA 1PDXA 3EA6A 2FUG1 3I5JC 2DWQA 4TKNA 5LLIA 3RMKC 2AQ2B 1WMHB 4KIKB 2NBWB 4UDUC 4YTNB 2INCC 4MGIE 2L76A 1K8RB 2W3RA 3SHQA 4WWNA 2MQJA 4DHJB 1QOGA 3DHGC 3V60A 2KC2A 4FJZA 3QARA 2KTRB 3SFDB 1P3QU 3PT2B 1R4MB 2IGHA 2BT6A 5CHVC 3DCGA 1WZ3A 4JX1C 2DZMA 2MLBA 3H7PA 3ABVB 4JLCA 1YJ1A 4KKIA 3P42A 2NTTA 4G50A 1XLNA 3UQAA 2Z8LA 3NVWA 1WM3A 2DHZA 2V4LA 2HTHA 3AXCA 1WIAA 4AJYB 4TSSA 2W3SA 3EFUA 1TTNA 3WAOA 4P1BC 3APFA 3BYTB 4RCOA 1UUPA 1YN5A 3M95A 2AQ3B 1MJDA 4W9KA 4BKSA 2AL3A 3P63A 4BAXA 1RAXA 1H7XA 3CWIA 2NCNA 1XQQA 3BIID 5L95C 1C79A 1KLVA 3NJTA 2K39A 1V49A 1WWTA 3L16A 4WJPA 4RMAA 2RDGA 1JWAD 4TUUA 1PGAA 3WAPA 1ZXHA 4MACA 1XF5L 2N1WA 4IUMB 3WCQA 4L23A 2K8BA 1Q10A 4M00A 3ZNZB 1V5TA 2O2VB 2EMTA 2WXRA 3U30A 3L13A 4IDIA 2V3SA 1SB3C 2WXMA 1U4AA 4JWUC 1HQRD 1JW9D 2IZVB 3ZRCA 2NMQA 3M62B 2BGFA 2KFJA 4IWPA 4EZJA 2JX5A 5D6JB 3W5VB 4NY0A 4HJKA 3R8BA 3JSVB 1NDDA 1WM2A 1T6BX 2BS2B 2K0PA 1NVID 2GB1A 4FBJB 1Q0WB 1V86A 2K22A 3S2AA 3Q6BA 2WXKA 2C60A 3PRZA 3QX1A 3NVZA 3E56A 2G45B 1WGHA 2IJ0A 4TQ0A 5G5GA 3TEYA 2LVQA 4EFOA 3R2IA 1FRDA 3AM9A 2B76B 1AWDA 3PHXB 3AEGB 1QLBB 2D3CA 3M63B 4RGMA 1D5MC 3ZXRA 3DBRB 2KANA 5J2RA 2MBBB 4OHJA 2NPTA 4XDDA 3R7QA 4EUTA 5C2TB 3TCAA 4BVUC 4GU2A 1IYFA 1SJED 3ZYYX 3DOWA 4PYUA 1SEBD 1HZ6A 2SEBD 5C3JB 2LGIA 4A90A 2D2QA 2Y3AA 1YJIA 4RH6A 3TEZA 5EE0A 5J18A 2WDTB 3VTWA 1T0YA 3SEBA 4H2AA 5CTRC 2KAJA 2KYWA 1DOIA 3FILA 1YNTE 2FAZA 3DVGX 2BB6A 3IHPC 4IWQA 1CZPA 4FHJA 4FJVB 1DOXA 3U52E 2BQQA 1WJUA 2ZPYA 3RNEC 4HXDA 3W1YA 3DBHI 1TYGB 2ZNVC 4KGSA 4URKA 2N7DA 3VH3B 4B0MA 1FCCC 2GI9A 2MEKA 4IW0A 4JE3B 2K3UA 4WH4A 3P4QB 2FIDA 1IGCA 3TMPB 2EMSA 4GB9A 1OQQA 2JWUA 3VFKA 1M94A 1V2YA 4A9AA 3LB8C 1IUEA 4PS8A 1L0VB 2QJLA 1GC7A 4YL8A 3APDA 1GOZA 2OEDA 2PVGC 1XEEA 2LEKA 4R3DA 3C19A 5HHDG 2MWSB 3WIMA 2N9LA 1D6EC 2KOXA 2N7JA 3JSVA 2IBIB 3TEXA 4EEWA 1N6ZA 1LGRA 2JSVX 1WI0A 5IA7A 4HVBA 3MC9A 4B9KA 5HG2A 4YSZB 2JYTA 5D3DA 3ZW3A 4S17A 3V6CB 2SAKA 1E7VA 1WXAA 2ZW1A 2ONQA 3EC8A 3Q2AC 4M8NA 3RULA 2LUMA 2BTEA 3PPAA 3O13A 3V61A 2IYDB 3Q8AA 2W54A 2BYFA 2JRHA 1N60A 3PTFC 2LJ5A 2OJWA 1FMAD 1WH3A 1JALA 2UWQA 2C7MB 3N1YC 4IWOA 4M01A 5L83A 1WY8A 4TQ1A 4BZAA 2KMMA 3A9KA 4GMVA 3N32A 2AEHA 4E74A 1SXTA 1N5XA 3AE4B 2MRPA 1PQSA 3OLMD 1Q1OA 2X38A 3BYYB 1I7HA 5E6PA 1N62A 1V1OA 4L1BA 4KVGB 1ZP0B 2DYBA 1HXYD 5H92C 5FK9C 4RGNA 3K9OB 4YT0B 2TSSA 1GG3A 3HUIA 4HKZE 1UWXA 1UZXB 3DDCB 5BMIA 4KDLB 4MSQB 4NQLB 3FKYA 1WR1A 3DVGY 2R2QA 1MPEA 2JT4B 2FBWB 3BVMA 3KQ4A 3Q3FA 4DXGA 3AEEB 3RNBC 1WE6A 4K7UA 4O1NA 3OJ4B 2WXNA 3M3JA 2LXCA 3V62A 3EECA 3NS8A 1XCTL 2RDBC 4IC7B 1IBXB 4FA6A 3QCAA 4HCPB 5TSSA 1L6VA 1NEKB 3C0RB 1VRAB 3WAMA 3AU5A 3VUYA 1TKEA 3NY5A 2FUHB 5AUKA 3KW5B 4BKSD 3ZO5B 3MHZA 1H7WA 4M02A 2UYZB 2JZZA 4A20A 1AYFA 3U7DA 1GUAB 3BY4B 4WQOB 1L4ZB 2MX2A 2GBKA 4GDLB 2RGFA 3VVWB 2KVRA 2M0XA 2W82A 2WLBA 3P4SB 4IM2A 1CQVA 1E8YA 1JWSD 1JWUD 4EZKA 2K8HA 2ZPNA 5DPRA 2K6DB 1GTHA 3GZNI 1FFVA 4XZ4A 2RMMA 3N3KB 4IOIE 4HDQA 5GMVA 3VAWA 1ZOYB 1SSNA 3KVFB 3AEFB 5DPTA 4EKUA 4JIOU 1T0SC 2CU3A 2KKCA 1P98A 1OFFA 3PZDA 3NRZA 1G6JA 2D11A 2XK5A 1EU3A 1I4GA 4ZRJA 1WGYA 2XK5B 4PYZA 1KOTA 3T9LA 4N9F4 3N30A 2FCMA 3AEAB 4W9GA 1D5XC 4OVZA 2O2VA 3OJ3A 3IG3A 3EUB2 3CSTA 3EFCA 3DBHB 3GB1A 1NI3A 3AE6B 2IGGA 3NS1A 3K9PB 1E8ZA 3P1MA 4GSWA 4AJWA 2UU7A 4EE2A 1YMHE 3VDZA 4XE0A 3RYTA 1TGZB 2L8JA 2PTLA 5G5HA 2PW9A 2JXTA 4WWMA 1UGMA 5HFYA 3V6EB 3NZUA 2GRIA 1V5OA 4RM9A 1MG4A 2JZPA 5HI1A 1KTKA 1PGBA 5EE1A 4WURA 3KUCB 3Q8BA 1LXDA 2KXJA 2QCZA 4WAFA 1OGWA 2Z0DB 4AWJA 3IFWB 3DQVA 2V4IB 2KWDA 1L2NA 1KFYB 1J7BA 1LO5D 3H6NA 1SGHA 2BF8B 1XT9B 2Z0EB 3DVNV 4LK0M 1KLUD 2BKFA 3KUDB 3NOBA 1YN3A 4X57B 2FCSA 2K8CA 3ZVVA 2KHWB 3JW0X 1Q5WB 2D10A 2BS4B 1JMLA 1CMXB 2KDBA 4KIKA 1KLGD 1R7SA 2IY0B 1F1HA 4W9IA 1KH0A 2I38A 1ISNA 1PFDA 2CJOA 2FCQA 4F1SA 3ZIMA 5FR6A 4NNJB 4JL9A 2KTRA 2O6VA 4DBGA 2KT7A 3GOEA 1GB4A 4ZDVA 3B0AA 1S3SG 3URYA 4LNIA 3R2TA 4ASWC 4MH8A 4ARCA 1WE7A 5I4DA 1BT0A 2A5UA 1TT5B 2BWFA 3AU4A 4HDOA 2BVCA 1R4NI 4WJOA 2KX3A 2XN9C 5GXGB 2PE9A 2M56B 1SE3A 2BYVE 4ANUA 2YEPB 4DDID 3QK0A 3ZQ4A 2V0GA 2JU6X 1F0ZA 3ZDTA 2K6QA 2EKEC 5BYRA 2DAFA 2L05A 2J53A 1FEHA 1ZKHA 2ASQA 3QHTA 2WXGA 2KLGA 2L32A 3IVFA 1T0RC 1RFAA 3NVYA 1SBBB 1TIFA 1FPYA 2HJ1A 2G4SA 2N9XA 1PYWD 3PZ7A 2WNMA 4AQ7A 4RGTA 1TJEA 2KD0A 3W1SA 4K3CA 3X0WA 4NJ7A 3MFGA 2CS4A 3NHEB 3PV1A 4GIVA 2LHEA 3I3TB 1TKYA 1N61A 1T5XD 4P6VF 4NAWB 1EUVB 3EHVA 5JHAA 2RPVA 1WXQA 3IT4B 2LGDA 3PVLA 2D3GA 4I6LB 4BOZB 1SIJA 4ACFA 4DQOC 3NG0A 2CHXA 4KSLC 4EOYA 3HM3A 1YQBA 1YOVB 1UWMA 5D94A 4RGOS 2ZCCA 2IO1B 1D4BA 2AYOB 3RFZB 3W9CB 3LXFA 1KRHA 3N1XC 2L7RA 3DHHC 4M0WA 3GS2A 4OW0A 2AWTA 4J3OD 2JUOA 3VR9B 2W9NA 4P7IA 4HKQA 2ICIA 4BKGA 4KKJA 4HEA1 2EELA 3AE8B 1TS5A 4WAAA 1E90A 3Q8EA 2KWUB 1I4XA 3ZRFA 1E0ZA 3MP9A 1TBEA 3OAWA 2KJRA 2XNAC 1K50A 4IM0A 3GZNB 3KYDD 3U8ZA 4DWFA 1QKZA 1WMHA 5LNK1 2MCNB 2KX0A 4M0WB 4P16A 4LNOA 2NBVB 2ACZB 3H8HA 4I6PA 5D3IB 5JHBA 4I6NB 2PJHA 2CR5A 3UIOB 1UELA 3AB5A 2D5GA 4LNNA 1FIQA 1EU4A 1VCBA 3AECB 2WXHA 2J42A 3B9JA 3PO0A 5BO4B 4NQKE 2MA9B 2J4XA 4REZA 4GDKB 2MSED 4FJYA 4KV2A 1RFKA 3R66C 3U7ZA 4HPPA 2OJRA 1RLFA 1T0QC 1QZEA 3ECIA 1JRPA 3QC8B 2L3ZA 2VRRB 1MHXA 1QOFA 5IAAC 1WXVA 3BK1A 1TY0A 3NUHB 1LM8B 3BVZA 1L4DB 1OQYA 4W9DA 1ROEA 4DDGD 4AS1A 1AW7A 2C7NB 2BBCA 2KQ4X 1E6EB 1IGDA 1SE2A 2FCNA 2N7EA 1C4CA 2KNBA 4DHZB 3W2DA 3I63C 2WDQB 1GPXA 1WGRA 2BW2A 4GGQA 2QILA 1ZUD2 1YQ3B 3AN1A 2KQSA 2M17A 1EF1A 2H88B 2WXOA 1ZW7A 2LRUA 2FIFA 2LD9A 1OEYJ 4ICVA 3DPDA 1QT9A 3BK2A 3VH4B 3SFEB 3RNFC 3Q3NC 2YLMA 3L17A 2L52A 2LVPA 4LDTB 3UGBB 3LJ3A 2KMCA 3UQBA 1WGKA 2MP2A 1C9FA 1YJJA 2XBBC 1R4MI 1F2RI 2QMTA 1V9JA 1C76A 1L6UA 2NVUI 1WJ4A 2J0JA 2MBHA 2LXAA 2NBUA 3QAQA 5E6NA 4KZ0A 2LRWA 3NVVA 1STEA 4GXBA 3PGEA 2QEJC 3DWMA 3AE3B 3VUWA 2HJ8A 1LFDA 3ML8A 4US9A 5E6OA 1CJEA 1WZ0A 1WGDA 1WJ6A 5BYSA 4W9HA 2N1VA 3D32A 1X1MA 3PLVA 3ZJTA 3HVDA 2DZIA 1E7PB 2WXQA 3FILB 1ESFA 1C4PA 5DPWA 4K3BA 4W9JA 5IO9A 3CIRB 5KHQA 1WYWB 1C77A 4HROA 1N63A 1FNWA 1IPGA 3ENEA 3IAS1 4A6QA 2WXJA 4MSMB 1NENB 1AN8A 2MJEA 2CKHB 4WQMA 5D7GA 4P1CC 2DZKA 5G55A 1V1PA 4B0EA 4YSYB 4ZRKA 1XO3A 4EZLA 2XEWA 1UGJA 3VRBB 3H9DA 5AZHA 3TBLD 3AI5A 1KF6B 2LMCA 1Y8RC 1Z5SB 2BS3B 2LZ6A 4OZCA 3TSSA 2WU5B 1M4VA 3L4PA 2LJIA 4N6EB 2HTME 5G2NA 1SJHD 3DBSA 3T3NA 4WWPA 3IT6B 4KDIC 3R7RA 1PUTA 2WQYB 1SE9A 2KK8A 3KWLA 3MJ5A 2LGXA 2QSDA 1FO4A 4C00A 2LGYA 2L83A 4XGAB 3PZ8A 2DYMA 3ALBA 1YN4A 2LWPA 3RZFA 1OEYA 1VJKA 2NTSA 2ZEQA 3U4EG 3WANA 3KH0A 1P0RA 3R3MA 1BXTA 3B08A 4A3OA 1E7UA 3AE9B 3SD5A 4BBNF 4HLEA 3Q69A 4C7YA 4HJGE 1GTEA 4C4VB 2FNJB 3U2SC 5IP4D 4DHZE 2M0AA 1F52A 5CHWA 2J52A 3QJZA 2L1AA 4DXAB 3HRDD 1L0XB 1GNUA 3WA0A 1VZ7A 4GDKA 4F8CB 4LCDE 5E6JA 3MJWA 1A70A 4RFBA 4USAA 3OWEB 1EWYC 4QAYA 4YXDB 3N1ZC 5IKCM 4G3XB 3L10B 4LNFA 3Q3OC 2ZJDA 1I4QA 3QWZB 1EWCA 3ML9A 4W9CA 2JVCA 2GBRA 2MH7A 2V3NA 1XLOA 3AEBB 2K25A 4MM3A 4RF0A 1XXGA 4BOSC 2NS5A 1TS3A 3T3OA 2OOBB 1JCKB 2V9HA 2DX5B 3VHTC 5LXIB 2KWVB 2MP2B 1TS4A 1L0YB 1CK1A 3AMZA 4IKGA 1WSPA 3KWVA 5EE3A 5TR5A 5JXVA 2KC1A 2MBEA 2RPQA 2I1JA 3PSEB 5H8YE 3PRMB 4WIPA 2CU1A 2WXFA 2ZNVB 3VUXA 2JPHA 3ZJVA 2G4DB 1QILA 3ZUNA 1I35A 1NBFC 2KN4A 3VR8B 3Q3MC 2J7QB 3IXSA 2ZZPB 4WJNA 2V1YA 4GN1A 3HVZA 4MJSA 2K9XA 5KHOA 2G9HD 4ARIA 4NZLB 1MFWA 4W9FA 4LNKA 1YQ4B 4M8MA 1F77A 1GB1A 5JH5C 1K51A 1B9RA 1PGXA 2KO3A 1V8CA 3TIXA 1XD3B 3QA8A 3KLSX 1L5PA 4K81A 1TY2A 2PMVA 3Q3JA 3C8YA 2R2OA 3JYUA 3W1SC 2QIEB 3B1LX 1V80A 2INPE 5IOIA 1UH6A 1WGGA 2HE7A 1MI0A 1V97A 4PS3A 3A4RA 2M19A 1JRUA 4YWGG 1TZOA 4JQWC 4KGTA 1QF6A 2I1KA 3SR6A 1FXIA 4KX6B 2WXPA 2BWES 5EDSA 1DOYA 4YTMB 4NPNA 3ZTCA 3H7SA 4CQNA 2KQ7A 5D2MB 2O6VB 3VTVA 1FNUA 3A1QB 1VD2A 3BWUD 3ZTDA 4ZYSA 4MT5A 3ZXVA 4ZRPA 3UF8A 2AX5A 4FLHA 2IDYA 3RT3B 2JYEA 1WYGA 2MJ3A 5C1ZA 1FD6A 4KSKC 1H4RA 4OVUA 2G3QB 2LI5A 1P7FA 3AV8A 1WX7A 3VQIA 1GAQB 2ZVOA 3P4RB 3N20C 4RNAA 1TKGA 4B95A 1ZDVA 3A33B 1IBXA 2HDEA 2LFIA 3L0WB 1YD8U 2JXXA 3SDLC 3RUIB 3MC8A 1B1ZA 4PS7A 4RM8A 2WS3B 3IAM1 1MVKA 1RRBA 2N4FA 1D5ZC 3Q8FA 4ZHPA 3APCA 2LUEA 1OQRA 2IO0B 1EM7A 2KDMA 2E3TA 3H7PB 3ZNID 3QQ8B 2MW5A 3A1QA 2W55A 2IY1B 2LVOA 2QC8A 3ZLZA 4BBNC 4C7ZA 2VH2A 4TV3A 1QOBA 1NI2A 2IO2B 2KACA 4DK5A 1WF9A 5CHFA 4MEMA 4G0NB 2RDHA 2JZ3B 4F7ZA 4ZHOA 4FHKA 1EF5A 3DBLI 4II2B 1FRRA 2MBOA 2KDIA 1VLBA 1C78A 1KM7A 3ZJUA 2N0SB 3LDZE 5IN7A 2E6XA 3MTNB 3FC4A 4BKTA 1UD7A 3A4SC 3A9KB 5FKAC 2BYEA 2BB5A 4HCNB 1TS2A 4J6IA 5AUIA 1XLPA 1UBIA 2WXIA 4S0RA 2KLCA 1UNSA 1XCQL 5AEKB 2K5PA 2KZRA 1KJTA 2PLPA 2QHOA 4W9LA 1MG8A 3T8MA 2OHFA 2KN5A 3BZDB 3MHSD 4C56C 3CMMB 4ICUA 5T8IA 3ZGZA
chains in the Genus database with same CATH topology
1CJEA 2IGDA 3SFDB 5BYSA 1ZOYB 1SSNA 4US8A 3AEFB 2G1EA 2IGHA 1HZ5A 3ZJTA 3HVDA 2DBYA 2BT6A 1E7PB 3AEDB 2WXQA 1ESFA 1C4PA 3FILB 4JX1C 2CU3A 3ABVB 1OFFA 4KKIA 2LHDA 3P42A 3NRZA 1EU3A 2NTTA 1WRIA 1I4GA 1XLNA 3CIRB 2Z8LA 3NVWA 5MPOA 1C77A 4HROA 1N63A 1FNWA 4TSSA 3IAS1 4A6QA 2WXJA 1FCLA 1NENB 3AEAB 2W3SA 1D5XC 1AN8A 2MJEA 2VZKD 4OVZA 4WQMA 5D7GA 4XWWA 1V1PA 3BYTB 4RCOA 1UUPA 1YN5A 3EUB2 2AQ3B 4B0EA 3GB1A 4YSYB 1NI3A 5BYQA 3AE6B 2IGGA 3NS1A 4NJCA 4PT5A 1XO3A 4C80A 3P63A 1UGJA 3VRBB 3P1MA 1H7XA 3CWIA 1J7AA 1KF6B 2LMCA 2IPKD 1YMHE 3BIID 4EE2A 1C79A 2BS3B 4XE0A 4OZCA 3TSSA 2WU2B 2WU5B 1ENFA 1M4VA 5G5HA 1WWTA 2PTLA 3L4PA 3E9SA 2PW9A 2JXTA 2LJIA 4WWMA 2RDGA 1JWAD 4N6EB 1PGAA 2HTME 5HFYA 1SJHD 2GRIA 3T3NA 1ZXHA 2JZPA 5HI1A 1KTKA 3IT6B 4MACA 1PUTA 1XF5L 2WQYB 4OZAA 1PGBA 3WCQA 3AE2B 5EE1A 3KWLA 3MJ5A 3Q8BA 4L23A 1FM0D 4WURA 4HKQA 1Q10A 4WAFA 2QSDA 1FO4A 4Q2JA 3AE7B 2WXRA 3J9CA 2V4IB 2L83A 1J7CA 2KWDA 2V3PA 4IDIA 3PZ8A 1SB3C 2WXMA 2DYMA 1KFYB 1J7BA 1ET6A 4FXCA 1HQRD 4JWUC 1YN4A 1JW9D 4LTUA 1LO5D 1VJKA 2NTSA 3U4EG 2I2YA 2NMQA 1BXTA 4LK0M 1KLUD 2JX5A 1ZE3D 3W5VB 1E10A 1YN3A 3AE9B 1T3QA 3R8BA 1SF0A 1ZDXA 1I4PA 2BS4B 1T6BX 2BS2B 1JMLA 1I4HA 2K0PA 3Q69A 4C7YA 1KLGD 1R7SA 1GTEA 3B2FA 4HJGE 1NVID 1JWMD 4A55A 2Y5PA 3U2SC 1KH0A 2GB1A 2I38A 1NYQA 2K22A 4NAMA 1PFDA 2CJOA 2WXKA 2M0AA 1JQ4A 2J52A 3E56A 3NVZA 2L1AA 1P7EA 2PIAA 2IJ0A 3HRDD 4TQ0A 1L0XB 3TEWA 5G5GA 1HEZE 3TEYA 1E9MA 1VR9A 1GB4A 3R2IA 1FRDA 3AM9A 2B76B 1FNVA 1AWDA 1VZ7A 1ET9A 3W5UB 5E6JA 3AEGB 1A70A 4RFBA 3R2TA 3URYA 4USAA 3OWEB 4OZBA 4JPSA 4MH8A 1QLBB 1EWYC 4ZRQA 4ARCA 5I4DA 4L2YA 4RGMA 2EKIA 4YXDB 1D5MC 3P4PB 2XN9C 4OHJA 4XDDA 5GXGB 1I4QA 2M56B 1EWCA 1SE3A 2YEPB 5C2TB 2BYTA 1Y56A 3ZQ4A 1SJED 2V0GA 2JU6X 3ZYYX 1F0ZA 2INNE 1SEBD 1ACCA 5BYRA 1HZ6A 2SEBD 5C3JB 2J53A 2LGIA 4XWTA 1FEHA 3Q8CA 1DGJA 2WXGA 4A90A 2MH7A 2V3NA 2L32A 2Y3AA 1XLOA 1YJIA 4RH6A 3AEBB 3TEZA 5EE0A 1BMLC 4A8XC 2WXLA 3NVYA 1SBBB 4RF0A 1XXGA 4RF1A 3SEBA 4H2AA 2PVOD 3FAHA 1TS3A 3T3OA 2KAJA 1JCKB 1VDVA 1PYWD 1DOIA 3FILA 3PZ7A 2WNMA 1VZ8A 1YNTE 4AQ7A 2BB6A 3V05A 4RGTA 2VZKB 1TS4A 1L0YB 1CZPA 1CK1A 1TJEA 2MJDA 3AH7A 3AMZA 4IKGA 5BMGA 1DOXA 1WSPA 3KWVA 3U52E 5BMHA 1DYQA 5EE3A 3W1SA 5JXVA 3B2GA 3MFGA 5H8YE 1TYGB 4KGSA 4WIPA 2LHEA 4B0MA 1TKYA 2WXFA 1N61A 1T5XD 3N9YC 4P6VF 4NAWB 2H89B 1FCCC 2GI9A 2MEKA 3AE1B 2RPVA 1QOAA 4JE3B 1WXQA 2K3UA 3IT4B 4WH4A 3P4QB 1IGCA 2Q5WD 2WDVB 3ZJVA 1OQQA 1QILA 1SIJA 4DQOC 1K53A 2KN4A 4ITKA 3VR8B 2JWUA 3NZ3A 4A9AA 2DLBA 3LB8C 1IUEA 3IXSA 1L0VB 1UWMA 2QJLA 4RGOS 4N58A 3GP7A 1I4RA 3HVZA 1GOZA 2OEDA 2K9XA 2PVGC 1XEEA 1FFUA 5EE9A 2LEKA 1D4BA 2N9KA 1ZPSA 3RFZB 4R3DA 4N59A 3LXFA 3W9CB 1KRHA 3CF4A 2G9HD 5HHDG 4ARIA 2N9LA 1D6EC 4M0WA 4NZLB 3GS2A 2N7JA 3RPFC 4OW0A 4J3OD 1YQ4B 3TEXA 1F77A 1GB1A 2JSVX 3VR9B 1K51A 1B9RA 1PGXA 1V8CA 4JWSC 5HG2A 1RM6C 2ICIA 3KLSX 4YSZB 2JYTA 2R61A 3LYYA 1L5PA 4KKJA 1TY2A 2PMVA 5D3DA 3TUOA 2Y5CA 2PKOA 3C8YA 2QIEB 2SAKA 4HEA1 2EELA 2ZW1A 3AE8B 1TS5A 2ONQA 3Q8EA 4MM3B 2LUMA 1I4XA 2INPE 1E0ZA 2BTEA 1QQRA 3MP9A 1MI0A 1V97A 3O13A 1RWSA 2XNAC 3Q8AA 1K50A 2WDRB 2M19A 2W54A 4YWGG 1N60A 1TZOA 1NYRA 2DYOA 1QKZA 2CJNA 4KGTA 3I57A 1FMAD 1QF6A 3SR6A 1JALA 4YTPB 5LNK1 1FXIA 4KX6B 2WXPA 1K52A 5FR3A 4P16A 1DOYA 4YTMB 2ACZB 3H8HA 1VZ6A 5D3IB 1HA5A 4CQNA 4TQ1A 1FXAA 1FNUA 3BWUD 3AB5A 2D5GA 1FIQA 4ZYSA 4MT5A 2KMMA 4ZRPA 1SE4A 1EU4A 2AX5A 2IDYA 3AECB 2WXHA 2JYEA 2J42A 3B9JA 1SXTA 1N5XA 1C4AA 3PO0A 1WYGA 2J4XA 3ETRA 3AE4B 2MJ3A 4REZA 4GDKB 1FD6A 1ZXIA 2X38A 3BYYB 4DXFA 1P7FA 4GLSC 1I7HA 3AV8A 1N62A 1V1OA 1RFKA 4L1BA 2JQRB 3UI3A 1ZP0B 3U7ZA 3VQIA 1HXYD 5H92C 1GAQB 5FK9C 4RGNA 3P4RB 4YT0B 3DWGC 4RNAA 1TKGA 1ZDVA 2TSSA 3HUIA 1IBXA 2HDEA 3EGRA 1JRPA 2LFIA 4HKZE 1MHXA 1UWXA 1QOFA 1N5WA 1B1ZA 4HRSA 5BMIA 3BK1A 1TY0A 3I9V1 2WP9B 2FE8A 2WS3B 3NUHB 3IAM1 1MVKA 3V3XA 1D5ZC 1JROA 1L4DB 1MPEA 3BVZA 3Q8FA 4ZHPA 2FBWB 1ROEA 3BVMA 3KQ4A 4AS1A 4DXGA 1AW7A 3AEEB 1GT8A 3MC0B 2BBCA 2KQ4X 4KGRA 4D2KA 4O1NA 1E6EB 1IGDA 1OQRA 3VRAB 1EM7A 1SE2A 2KDMA 2E3TA 2WXNA 1C4CA 1RYJA 1F2RC 2W55A 1JWBD 3W2DA 3BVGA 2WDQB 1XCTL 4C7ZA 1IBXB 1QOBA 1GPXA 5TSSA 2BW2A 1L6VA 2KACA 2QILA 1NEKB 1BUIC 1ZUD2 2YEPF 1YQ3B 3AN1A 4ZOHC 1VRAB 2AQ1B 2H88B 2RDHA 2WXOA 1TKEA 4ZHOA 5AUKA 4YSXB 1FRRA 3MHZA 1QT9A 3BK2A 3SFEB 1XLQA 1VLBA 4TMAB 4XDCA 1C78A 2ON8A 2L52A 1H7WA 3ZJUA 2N0SB 2ZW0A 2E6XA 3FC4A 4LLGM 5FKAC 1V1PB 2BB5A 1AYFA 1MHHE 1TS2A 1WGKA 5AUIA 3AE5B 1XLPA 2WXIA 1L4ZB 1C9FA 1YJJA 1PDXA 1UNSA 3EA6A 2FUG1 1F2RI 1XCQL 2QMTA 1C76A 2DWQA 1L6UA 4GDLB 2W82A 2AQ2B 2K5PA 2WLBA 3P4SB 2PLPA 3NVVA 1CQVA 4UDUC 1STEA 4YTNB 1JWSD 2W3RA 1JWUD 2OHFA 2QEJC 3BZDB 3DWMA 3AE3B 1GTHA 1QOGA 4C56C 1FFVA 2RMMA 4IOIE 5T8IA 4US9A 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E10 A;  1CJE A;  3AE9 B;  1QOA A;  3P4R B;  3SFD B;  4YT0 B;  1WXQ A;  3DWG C;  1T3Q A;  1ZOY B;  1TKG A;  4US8 A;  3AEF B;  3P4Q B;  3HUI A;  1SF0 A;  2Q5W D;  2WDV B;  2G1E A;  2BS4 B;  1JRP A;  2BS2 B;  1OQQ A;  1SIJ A;  1QOF A;  2DBY A;  4C7Y A;  4ITK A;  2BT6 A;  3VR8 B;  1E7P B;  1GTE A;  3AED B;  1N5W A;  1R7S A;  3B2F A;  4HRS A;  1NVI D;  4A9A A;  4JX1 C;  2CU3 A;  3LB8 C;  1IUE A;  2WP9 B;  1L0V B;  3ABV B;  1UWM A;  2WS3 B;  1NYQ A;  1OFF A;  2K22 A;  1PFD A;  2CJO A;  2QJL A;  1JQ4 A;  4N58 A;  3NRZ A;  3HVZ A;  2PVG C;  2K9X A;  5EE9 A;  1FFU A;  1JRO A;  2LEK A;  4ZHP A;  3NVZ A;  2FBW B;  1ROE A;  1WRI A;  1XLN A;  3CIR B;  3LXF A;  4N59 A;  3W9C B;  3AEE B;  1GT8 A;  1KRH A;  2PIA A;  3CF4 A;  3HRD D;  3NVW A;  5MPO A;  5G5G A;  4HRO A;  1E6E B;  1E9M A;  1N63 A;  1OQR A;  3RPF C;  3VRA B;  1FRD A;  2E3T A;  3AM9 A;  2B76 B;  1NEN B;  3AEA B;  1AWD A;  2W3S A;  1RYJ A;  1YQ4 B;  2MJE A;  3W5U B;  3VR9 B;  3AEG B;  1A70 A;  2W55 A;  1JWB D;  4WQM A;  4USA A;  1B9R A;  1QLB B;  2WDQ B;  1EWY C;  1V8C A;  4JWS C;  4C7Z A;  1QOB A;  3EUB 2;  1RM6 C;  1GPX A;  2EKI A;  4YSZ B;  4YSY B;  4YXD B;  1NI3 A;  1L5P A;  3AE6 B;  3NS1 A;  2Y5C A;  2PKO A;  3P4P B;  1L6V A;  1XO3 A;  1NEK B;  1ZUD 2;  1YQ3 B;  3AN1 A;  2QIE B;  4C80 A;  4ZOH C;  3P63 A;  3VRB B;  5GXG B;  3AE8 B;  2H88 B;  3P1M A;  1H7X A;  2M56 B;  1J7A A;  1TKE A;  3CWI A;  4ZHO A;  5C2T B;  1KF6 B;  5AUK A;  3BII D;  4YSX B;  1E0Z A;  1FRR A;  1F0Z A;  3ZYY X;  2BS3 B;  1QT9 A;  1V97 A;  1RWS A;  3SFE B;  2WU2 B;  2WDR B;  2WU5 B;  1XLQ A;  1VLB A;  2M19 A;  5G5H A;  1WWT A;  5C3J B;  3L4P A;  2W54 A;  2L52 A;  1DGJ A;  1H7W A;  4WWM A;  1N60 A;  2N0S B;  1JWA D;  1NYR A;  2MH7 A;  2HTM E;  4N6E B;  1XLO A;  1YJI A;  2CJN A;  3AEB B;  3FC4 A;  5EE0 A;  3NVY A;  3W5V B;  1FMA D;  1QF6 A;  3SR6 A;  1JAL A;  4YTP B;  2PVO D;  1PUT A;  3FAH A;  1AYF A;  2WQY B;  4KX6 B;  1FXI A;  1WGK A;  3AE2 B;  5AUI A;  2KAJ A;  3WCQ A;  3AE5 B;  1XLP A;  4YTM B;  1VDV A;  3KWL A;  5EE1 A;  1FM0 D;  1DOY A;  2ACZ B;  1DOI A;  1FO4 A;  1YJJ A;  1PDX A;  3AE7 B;  1FXA A;  2L83 A;  1J7C A;  1CZP A;  1L6U A;  2DWQ A;  1TJE A;  2MJD A;  3AB5 A;  3AH7 A;  3AMZ A;  4IDI A;  1DOX A;  1SB3 C;  2WLB A;  2K5P A;  1FIQ A;  5EE3 A;  3P4S B;  2KMM A;  1KFY B;  3B2G A;  3NVV A;  1J7B A;  2AX5 A;  4FXC A;  4JWU C;  3AEC B;  1JW9 D;  4YTN B;  3B9J A;  3PO0 A;  1N5X A;  5H8Y E;  1WYG A;  3ETR A;  3AE4 B;  1TYG B;  2MJ3 A;  2OHF A;  1VJK A;  1ZXI A;  2W3R A;  4LTU A;  3DWM A;  3AE3 B;  1GTH A;  1I7H A;  1N61 A;  1TKY A;  1QOG A;  3AV8 A;  1N62 A;  1RFK A;  1FFV A;  2JQR B;  4P6V F;  2H89 B;  1ZP0 B;  2JX5 A;  4US9 A;  5H92 C;  1GAQ B;  3AE1 B; 
#chains in the Genus database with same CATH topology
 3KYC D;  2IGD A;  2HD5 B;  2WHI A;  4AOF A;  4US8 A;  1A5R A;  2G1E A;  1HZ5 A;  2DBY A;  3P2B A;  3AED B;  4AUQ C;  2LHD A;  1S1Q B;  1R4N B;  2J0M A;  2KDF B;  1WRI A;  2RD0 A;  2M8S A;  5MPO A;  2KJH B;  1I42 A;  1FCL A;  4C4V A;  2VZK D;  4XWW A;  3O65 B;  4GOC A;  5BYQ A;  2K1F A;  4KZC A;  4NJC A;  1J19 A;  4PT5 A;  2ZCB A;  3NZS A;  4C80 A;  1GJZ A;  1J7A A;  2IPK D;  1E5W A;  3BIN A;  2WU2 B;  1ENF A;  2A4Z A;  4A3P A;  5DPS A;  2CHW A;  2KMA A;  3E9S A;  2LGS A;  4GDL A;  4II3 B;  3ZNG C;  1OTR B;  1WR6 E;  4FUL A;  1E8W A;  4OZA A;  3A9J B;  3ONS A;  3AE2 B;  3RD2 A;  5AZF A;  1FM0 D;  4Q2J A;  3AE7 B;  3J9C A;  4BFR A;  1J7C A;  2V3P A;  2AL6 A;  2DZJ A;  1ET6 A;  4FXC A;  4K7W A;  4K7S A;  2D3B A;  4LTU A;  2I2Y A;  1WJN A;  3KUZ A;  4ANX A;  1ZE3 D;  1V81 A;  1E10 A;  2X8X X;  1T3Q A;  2RSU A;  1SF0 A;  1P1A A;  1ZDX A;  2PE6 B;  1I4P A;  4AP4 C;  1I4H A;  1YX5 B;  2PPH A;  1P9D U;  2C9W B;  2WYQ A;  3B2F A;  1JWM D;  4A55 A;  3QIJ A;  2Y5P A;  4NAM A;  1NYQ A;  3TL5 A;  1JQ4 A;  4LJO B;  1P7E A;  1UBQ A;  5J17 A;  3A9J A;  2PIA A;  3PRE A;  3TEW A;  3RNC C;  3HHM A;  1HEZ E;  2JY6 A;  1E9M A;  1VR9 A;  2D3A A;  2WWZ A;  1FNV A;  4E3C A;  2DEN B;  1ET9 A;  4IM3 A;  3W5U B;  4OZB A;  4JPS A;  4ZRQ A;  1J8C A;  4L2Y A;  2BKR B;  2EKI A;  3P4P B;  2MHJ A;  1H8C A;  4XYC A;  2BYT A;  1Y56 A;  2WX0 A;  3HK0 A;  5DCN A;  4MGZ E;  2INN E;  2MBQ A;  1ACC A;  4E71 A;  4XWT A;  5HKH A;  3Q8C A;  1DGJ A;  2WGS A;  3JVZ X;  3HIZ A;  4ZYN A;  1BML C;  4A8X C;  2WXL A;  2QDF A;  4RF1 A;  2PVO D;  1Z2M A;  2WX1 A;  3FAH A;  3Q14 C;  4FAD A;  1HTO A;  4FN2 A;  1HE8 A;  1VDV A;  1VZ8 A;  3V05 A;  3DBL B;  2VZK B;  3AH7 A;  2MJD A;  5BMG A;  2B3A A;  2M4N A;  3DHI C;  5BMH A;  1DYQ A;  4MJS B;  3B2G A;  2Z59 B;  3PHW B;  4G11 A;  1GC6 A;  2GOW A;  3RNA C;  1WX8 A;  2N9E B;  4MGY E;  3N9Y C;  1YX6 B;  4MH0 E;  2IND C;  2H89 B;  4LDT D;  3L08 A;  3AE1 B;  1QOA A;  3WAL A;  2Q5W D;  2WDV B;  1YIW A;  2L0T A;  3VTU A;  3L54 A;  2M1M A;  4K1R B;  1K53 A;  4ITK A;  3NZ3 A;  2DLB A;  3CF6 E;  3HM6 X;  5CX3 A;  3OG5 A;  4N58 A;  3GP7 A;  1I4R A;  5EE9 A;  4JGH B;  1FFU A;  1E8X A;  2N9K A;  3RI7 C;  1ZPS A;  4N59 A;  2IO3 B;  2CHZ A;  2KDE B;  3CF4 A;  3X23 A;  3RPF C;  1D3Z A;  2GLS A;  4HWI B;  3RZW C;  4JWS C;  1RM6 C;  3LYY A;  2R61 A;  1AAR A;  3TUO A;  2Y5C A;  2PKO A;  3RNG C;  1J0G A;  4WWO A;  4MM3 B;  2KFK B;  4OVV A;  3GE3 C;  1QQR A;  2KFK A;  1RWS A;  3ZDM C;  2BPS A;  2WDR B;  2D07 B;  1NYR A;  2DYO A;  2PEA A;  2CJN A;  5AZG A;  3I57 A;  4YTP B;  2DNF A;  2GBM A;  1C1Y B;  1K52 A;  5FR3 A;  2RR9 A;  4XC2 A;  2O6V D;  3GE8 C;  3TJP A;  3CSF A;  1SIF A;  1VZ6 A;  2KTF A;  2GBJ A;  1HA5 A;  4DHJ D;  4LJP B;  2Y5B B;  1FXA A;  4ANV A;  1SE4 A;  1ZGU B;  1C4A A;  3AUL A;  4XX5 A;  3ETR A;  2VH1 A;  4NJ6 A;  1ZXI A;  1WXM A;  2GBN A;  3DBR I;  4DXF A;  3IBE A;  4GLS C;  4MGK E;  1EO6 A;  2JQR B;  3UI3 A;  1UF0 A;  4HPL B;  4CYE A;  2KVZ A;  3DWG C;  2NPT B;  3EGR A;  1C3T A;  1WFY A;  4W9E A;  1N5W A;  4HRS A;  4ZRI A;  3I9V 1;  2C7H A;  2WP9 B;  2FE8 A;  3PS6 A;  3ZNH B;  4NAW A;  2L00 B;  2J0K A;  3PRP B;  3V3X A;  1JRO A;  4MDK E;  2C5L C;  3H1U A;  2KJ6 A;  2NR2 A;  1GT8 A;  3MC0 B;  4KGR A;  4D2K A;  3VRA B;  3PLU A;  1RYJ A;  4CHK A;  1F2R C;  1L7Y A;  1JWB D;  5LXH A;  3BVG A;  3RCZ A;  1LQB A;  1TZ1 A;  2LAS A;  2JWZ A;  3ZKJ C;  1FXT B;  4IG7 B;  3UIP B;  1BUI C;  2L0F A;  1WX9 A;  2GMI C;  2YEP F;  4ZOH C;  2AQ1 B;  4MEL A;  2YVC A;  4YSX B;  3DVN U;  2ZVN A;  1WRD B;  2REX A;  1F9J A;  5JZE B;  3VXW A;  1XLQ A;  4XDC A;  4TMA B;  4WJQ A;  1IP9 A;  2ON8 A;  5C23 A;  2ZW0 A;  2KWC A;  3RN9 C;  4LLG M;  4B6W A;  1V1P B;  2N9P C;  1HTQ A;  4HK2 A;  1MHH E;  3UIN B;  1WXS A;  2JF5 A;  1V6E A;  4ANW A;  3SU8 X;  3AE5 B;  4CO7 A;  2JRI B;  4HPM B;  4PK1 A;  2DAJ A;  1PDX A;  3EA6 A;  2FUG 1;  3I5J C;  2DWQ A;  4TKN A;  5LLI A;  3RMK C;  2AQ2 B;  1WMH B;  4KIK B;  2NBW B;  4UDU C;  4YTN B;  2INC C;  4MGI E;  2L76 A;  1K8R B;  2W3R A;  3SHQ A;  4WWN A;  2MQJ A;  4DHJ B;  1QOG A;  3DHG C;  3V60 A;  2KC2 A;  4FJZ A;  3QAR A;  2KTR B;  3SFD B;  1P3Q U;  3PT2 B;  1R4M B;  2IGH A;  2BT6 A;  5CHV C;  3DCG A;  1WZ3 A;  4JX1 C;  2DZM A;  2MLB A;  3H7P A;  3ABV B;  4JLC A;  1YJ1 A;  4KKI A;  3P42 A;  2NTT A;  4G50 A;  1XLN A;  3UQA A;  2Z8L A;  3NVW A;  1WM3 A;  2DHZ A;  2V4L A;  2HTH A;  3AXC A;  1WIA A;  4AJY B;  4TSS A;  2W3S A;  3EFU A;  1TTN A;  3WAO A;  4P1B C;  3APF A;  3BYT B;  4RCO A;  1UUP A;  1YN5 A;  3M95 A;  2AQ3 B;  1MJD A;  4W9K A;  4BKS A;  2AL3 A;  3P63 A;  4BAX A;  1RAX A;  1H7X A;  3CWI A;  2NCN A;  1XQQ A;  3BII D;  5L95 C;  1C79 A;  1KLV A;  3NJT A;  2K39 A;  1V49 A;  1WWT A;  3L16 A;  4WJP A;  4RMA A;  2RDG A;  1JWA D;  4TUU A;  1PGA A;  3WAP A;  1ZXH A;  4MAC A;  1XF5 L;  2N1W A;  4IUM B;  3WCQ A;  4L23 A;  2K8B A;  1Q10 A;  4M00 A;  3ZNZ B;  1V5T A;  2O2V B;  2EMT A;  2WXR A;  3U30 A;  3L13 A;  4IDI A;  2V3S A;  1SB3 C;  2WXM A;  1U4A A;  4JWU C;  1HQR D;  1JW9 D;  2IZV B;  3ZRC A;  2NMQ A;  3M62 B;  2BGF A;  2KFJ A;  4IWP A;  4EZJ A;  2JX5 A;  5D6J B;  3W5V B;  4NY0 A;  4HJK A;  3R8B A;  3JSV B;  1NDD A;  1WM2 A;  1T6B X;  2BS2 B;  2K0P A;  1NVI D;  2GB1 A;  4FBJ B;  1Q0W B;  1V86 A;  2K22 A;  3S2A A;  3Q6B A;  2WXK A;  2C60 A;  3PRZ A;  3QX1 A;  3NVZ A;  3E56 A;  2G45 B;  1WGH A;  2IJ0 A;  4TQ0 A;  5G5G A;  3TEY A;  2LVQ A;  4EFO A;  3R2I A;  1FRD A;  3AM9 A;  2B76 B;  1AWD A;  3PHX B;  3AEG B;  1QLB B;  2D3C A;  3M63 B;  4RGM A;  1D5M C;  3ZXR A;  3DBR B;  2KAN A;  5J2R A;  2MBB B;  4OHJ A;  2NPT A;  4XDD A;  3R7Q A;  4EUT A;  5C2T B;  3TCA A;  4BVU C;  4GU2 A;  1IYF A;  1SJE D;  3ZYY X;  3DOW A;  4PYU A;  1SEB D;  1HZ6 A;  2SEB D;  5C3J B;  2LGI A;  4A90 A;  2D2Q A;  2Y3A A;  1YJI A;  4RH6 A;  3TEZ A;  5EE0 A;  5J18 A;  2WDT B;  3VTW A;  1T0Y A;  3SEB A;  4H2A A;  5CTR C;  2KAJ A;  2KYW A;  1DOI A;  3FIL A;  1YNT E;  2FAZ A;  3DVG X;  2BB6 A;  3IHP C;  4IWQ A;  1CZP A;  4FHJ A;  4FJV B;  1DOX A;  3U52 E;  2BQQ A;  1WJU A;  2ZPY A;  3RNE C;  4HXD A;  3W1Y A;  3DBH I;  1TYG B;  2ZNV C;  4KGS A;  4URK A;  2N7D A;  3VH3 B;  4B0M A;  1FCC C;  2GI9 A;  2MEK A;  4IW0 A;  4JE3 B;  2K3U A;  4WH4 A;  3P4Q B;  2FID A;  1IGC A;  3TMP B;  2EMS A;  4GB9 A;  1OQQ A;  2JWU A;  3VFK A;  1M94 A;  1V2Y A;  4A9A A;  3LB8 C;  1IUE A;  4PS8 A;  1L0V B;  2QJL A;  1GC7 A;  4YL8 A;  3APD A;  1GOZ A;  2OED A;  2PVG C;  1XEE A;  2LEK A;  4R3D A;  3C19 A;  5HHD G;  2MWS B;  3WIM A;  2N9L A;  1D6E C;  2KOX A;  2N7J A;  3JSV A;  2IBI B;  3TEX A;  4EEW A;  1N6Z A;  1LGR A;  2JSV X;  1WI0 A;  5IA7 A;  4HVB A;  3MC9 A;  4B9K A;  5HG2 A;  4YSZ B;  2JYT A;  5D3D A;  3ZW3 A;  4S17 A;  3V6C B;  2SAK A;  1E7V A;  1WXA A;  2ZW1 A;  2ONQ A;  3EC8 A;  3Q2A C;  4M8N A;  3RUL A;  2LUM A;  2BTE A;  3PPA A;  3O13 A;  3V61 A;  2IYD B;  3Q8A A;  2W54 A;  2BYF A;  2JRH A;  1N60 A;  3PTF C;  2LJ5 A;  2OJW A;  1FMA D;  1WH3 A;  1JAL A;  2UWQ A;  2C7M B;  3N1Y C;  4IWO A;  4M01 A;  5L83 A;  1WY8 A;  4TQ1 A;  4BZA A;  2KMM A;  3A9K A;  4GMV A;  3N32 A;  2AEH A;  4E74 A;  1SXT A;  1N5X A;  3AE4 B;  2MRP A;  1PQS A;  3OLM D;  1Q1O A;  2X38 A;  3BYY B;  1I7H A;  5E6P A;  1N62 A;  1V1O A;  4L1B A;  4KVG B;  1ZP0 B;  2DYB A;  1HXY D;  5H92 C;  5FK9 C;  4RGN A;  3K9O B;  4YT0 B;  2TSS A;  1GG3 A;  3HUI A;  4HKZ E;  1UWX A;  1UZX B;  3DDC B;  5BMI A;  4KDL B;  4MSQ B;  4NQL B;  3FKY A;  1WR1 A;  3DVG Y;  2R2Q A;  1MPE A;  2JT4 B;  2FBW B;  3BVM A;  3KQ4 A;  3Q3F A;  4DXG A;  3AEE B;  3RNB C;  1WE6 A;  4K7U A;  4O1N A;  3OJ4 B;  2WXN A;  3M3J A;  2LXC A;  3V62 A;  3EEC A;  3NS8 A;  1XCT L;  2RDB C;  4IC7 B;  1IBX B;  4FA6 A;  3QCA A;  4HCP B;  5TSS A;  1L6V A;  1NEK B;  3C0R B;  1VRA B;  3WAM A;  3AU5 A;  3VUY A;  1TKE A;  3NY5 A;  2FUH B;  5AUK A;  3KW5 B;  4BKS D;  3ZO5 B;  3MHZ A;  1H7W A;  4M02 A;  2UYZ B;  2JZZ A;  4A20 A;  1AYF A;  3U7D A;  1GUA B;  3BY4 B;  4WQO B;  1L4Z B;  2MX2 A;  2GBK A;  4GDL B;  2RGF A;  3VVW B;  2KVR A;  2M0X A;  2W82 A;  2WLB A;  3P4S B;  4IM2 A;  1CQV A;  1E8Y A;  1JWS D;  1JWU D;  4EZK A;  2K8H A;  2ZPN A;  5DPR A;  2K6D B;  1GTH A;  3GZN I;  1FFV A;  4XZ4 A;  2RMM A;  3N3K B;  4IOI E;  4HDQ A;  5GMV A;  3VAW A;  1ZOY B;  1SSN A;  3KVF B;  3AEF B;  5DPT A;  4EKU A;  4JIO U;  1T0S C;  2CU3 A;  2KKC A;  1P98 A;  1OFF A;  3PZD A;  3NRZ A;  1G6J A;  2D11 A;  2XK5 A;  1EU3 A;  1I4G A;  4ZRJ A;  1WGY A;  2XK5 B;  4PYZ A;  1KOT A;  3T9L A;  4N9F 4;  3N30 A;  2FCM A;  3AEA B;  4W9G A;  1D5X C;  4OVZ A;  2O2V A;  3OJ3 A;  3IG3 A;  3EUB 2;  3CST A;  3EFC A;  3DBH B;  3GB1 A;  1NI3 A;  3AE6 B;  2IGG A;  3NS1 A;  3K9P B;  1E8Z A;  3P1M A;  4GSW A;  4AJW A;  2UU7 A;  4EE2 A;  1YMH E;  3VDZ A;  4XE0 A;  3RYT A;  1TGZ B;  2L8J A;  2PTL A;  5G5H A;  2PW9 A;  2JXT A;  4WWM A;  1UGM A;  5HFY A;  3V6E B;  3NZU A;  2GRI A;  1V5O A;  4RM9 A;  1MG4 A;  2JZP A;  5HI1 A;  1KTK A;  1PGB A;  5EE1 A;  4WUR A;  3KUC B;  3Q8B A;  1LXD A;  2KXJ A;  2QCZ A;  4WAF A;  1OGW A;  2Z0D B;  4AWJ A;  3IFW B;  3DQV A;  2V4I B;  2KWD A;  1L2N A;  1KFY B;  1J7B A;  1LO5 D;  3H6N A;  1SGH A;  2BF8 B;  1XT9 B;  2Z0E B;  3DVN V;  4LK0 M;  1KLU D;  2BKF A;  3KUD B;  3NOB A;  1YN3 A;  4X57 B;  2FCS A;  2K8C A;  3ZVV A;  2KHW B;  3JW0 X;  1Q5W B;  2D10 A;  2BS4 B;  1JML A;  1CMX B;  2KDB A;  4KIK A;  1KLG D;  1R7S A;  2IY0 B;  1F1H A;  4W9I A;  1KH0 A;  2I38 A;  1ISN A;  1PFD A;  2CJO A;  2FCQ A;  4F1S A;  3ZIM A;  5FR6 A;  4NNJ B;  4JL9 A;  2KTR A;  2O6V A;  4DBG A;  2KT7 A;  3GOE A;  1GB4 A;  4ZDV A;  3B0A A;  1S3S G;  3URY A;  4LNI A;  3R2T A;  4ASW C;  4MH8 A;  4ARC A;  1WE7 A;  5I4D A;  1BT0 A;  2A5U A;  1TT5 B;  2BWF A;  3AU4 A;  4HDO A;  2BVC A;  1R4N I;  4WJO A;  2KX3 A;  2XN9 C;  5GXG B;  2PE9 A;  2M56 B;  1SE3 A;  2BYV E;  4ANU A;  2YEP B;  4DDI D;  3QK0 A;  3ZQ4 A;  2V0G A;  2JU6 X;  1F0Z A;  3ZDT A;  2K6Q A;  2EKE C;  5BYR A;  2DAF A;  2L05 A;  2J53 A;  1FEH A;  1ZKH A;  2ASQ A;  3QHT A;  2WXG A;  2KLG A;  2L32 A;  3IVF A;  1T0R C;  1RFA A;  3NVY A;  1SBB B;  1TIF A;  1FPY A;  2HJ1 A;  2G4S A;  2N9X A;  1PYW D;  3PZ7 A;  2WNM A;  4AQ7 A;  4RGT A;  1TJE A;  2KD0 A;  3W1S A;  4K3C A;  3X0W A;  4NJ7 A;  3MFG A;  2CS4 A;  3NHE B;  3PV1 A;  4GIV A;  2LHE A;  3I3T B;  1TKY A;  1N61 A;  1T5X D;  4P6V F;  4NAW B;  1EUV B;  3EHV A;  5JHA A;  2RPV A;  1WXQ A;  3IT4 B;  2LGD A;  3PVL A;  2D3G A;  4I6L B;  4BOZ B;  1SIJ A;  4ACF A;  4DQO C;  3NG0 A;  2CHX A;  4KSL C;  4EOY A;  3HM3 A;  1YQB A;  1YOV B;  1UWM A;  5D94 A;  4RGO S;  2ZCC A;  2IO1 B;  1D4B A;  2AYO B;  3RFZ B;  3W9C B;  3LXF A;  1KRH A;  3N1X C;  2L7R A;  3DHH C;  4M0W A;  3GS2 A;  4OW0 A;  2AWT A;  4J3O D;  2JUO A;  3VR9 B;  2W9N A;  4P7I A;  4HKQ A;  2ICI A;  4BKG A;  4KKJ A;  4HEA 1;  2EEL A;  3AE8 B;  1TS5 A;  4WAA A;  1E90 A;  3Q8E A;  2KWU B;  1I4X A;  3ZRF A;  1E0Z A;  3MP9 A;  1TBE A;  3OAW A;  2KJR A;  2XNA C;  1K50 A;  4IM0 A;  3GZN B;  3KYD D;  3U8Z A;  4DWF A;  1QKZ A;  1WMH A;  5LNK 1;  2MCN B;  2KX0 A;  4M0W B;  4P16 A;  4LNO A;  2NBV B;  2ACZ B;  3H8H A;  4I6P A;  5D3I B;  5JHB A;  4I6N B;  2PJH A;  2CR5 A;  3UIO B;  1UEL A;  3AB5 A;  2D5G A;  4LNN A;  1FIQ A;  1EU4 A;  1VCB A;  3AEC B;  2WXH A;  2J42 A;  3B9J A;  3PO0 A;  5BO4 B;  4NQK E;  2MA9 B;  2J4X A;  4REZ A;  4GDK B;  2MSE D;  4FJY A;  4KV2 A;  1RFK A;  3R66 C;  3U7Z A;  4HPP A;  2OJR A;  1RLF A;  1T0Q C;  1QZE A;  3ECI A;  1JRP A;  3QC8 B;  2L3Z A;  2VRR B;  1MHX A;  1QOF A;  5IAA C;  1WXV A;  3BK1 A;  1TY0 A;  3NUH B;  1LM8 B;  3BVZ A;  1L4D B;  1OQY A;  4W9D A;  1ROE A;  4DDG D;  4AS1 A;  1AW7 A;  2C7N B;  2BBC A;  2KQ4 X;  1E6E B;  1IGD A;  1SE2 A;  2FCN A;  2N7E A;  1C4C A;  2KNB A;  4DHZ B;  3W2D A;  3I63 C;  2WDQ B;  1GPX A;  1WGR A;  2BW2 A;  4GGQ A;  2QIL A;  1ZUD 2;  1YQ3 B;  3AN1 A;  2KQS A;  2M17 A;  1EF1 A;  2H88 B;  2WXO A;  1ZW7 A;  2LRU A;  2FIF A;  2LD9 A;  1OEY J;  4ICV A;  3DPD A;  1QT9 A;  3BK2 A;  3VH4 B;  3SFE B;  3RNF C;  3Q3N C;  2YLM A;  3L17 A;  2L52 A;  2LVP A;  4LDT B;  3UGB B;  3LJ3 A;  2KMC A;  3UQB A;  1WGK A;  2MP2 A;  1C9F A;  1YJJ A;  2XBB C;  1R4M I;  1F2R I;  2QMT A;  1V9J A;  1C76 A;  1L6U A;  2NVU I;  1WJ4 A;  2J0J A;  2MBH A;  2LXA A;  2NBU A;  3QAQ A;  5E6N A;  4KZ0 A;  2LRW A;  3NVV A;  1STE A;  4GXB A;  3PGE A;  2QEJ C;  3DWM A;  3AE3 B;  3VUW A;  2HJ8 A;  1LFD A;  3ML8 A;  4US9 A;  5E6O A;  1CJE A;  1WZ0 A;  1WGD A;  1WJ6 A;  5BYS A;  4W9H A;  2N1V A;  3D32 A;  1X1M A;  3PLV A;  3ZJT A;  3HVD A;  2DZI A;  1E7P B;  2WXQ A;  3FIL B;  1ESF A;  1C4P A;  5DPW A;  4K3B A;  4W9J A;  5IO9 A;  3CIR B;  5KHQ A;  1WYW B;  1C77 A;  4HRO A;  1N63 A;  1FNW A;  1IPG A;  3ENE A;  3IAS 1;  4A6Q A;  2WXJ A;  4MSM B;  1NEN B;  1AN8 A;  2MJE A;  2CKH B;  4WQM A;  5D7G A;  4P1C C;  2DZK A;  5G55 A;  1V1P A;  4B0E A;  4YSY B;  4ZRK A;  1XO3 A;  4EZL A;  2XEW A;  1UGJ A;  3VRB B;  3H9D A;  5AZH A;  3TBL D;  3AI5 A;  1KF6 B;  2LMC A;  1Y8R C;  1Z5S B;  2BS3 B;  2LZ6 A;  4OZC A;  3TSS A;  2WU5 B;  1M4V A;  3L4P A;  2LJI A;  4N6E B;  2HTM E;  5G2N A;  1SJH D;  3DBS A;  3T3N A;  4WWP A;  3IT6 B;  4KDI C;  3R7R A;  1PUT A;  2WQY B;  1SE9 A;  2KK8 A;  3KWL A;  3MJ5 A;  2LGX A;  2QSD A;  1FO4 A;  4C00 A;  2LGY A;  2L83 A;  4XGA B;  3PZ8 A;  2DYM A;  3ALB A;  1YN4 A;  2LWP A;  3RZF A;  1OEY A;  1VJK A;  2NTS A;  2ZEQ A;  3U4E G;  3WAN A;  3KH0 A;  1P0R A;  3R3M A;  1BXT A;  3B08 A;  4A3O A;  1E7U A;  3AE9 B;  3SD5 A;  4BBN F;  4HLE A;  3Q69 A;  4C7Y A;  4HJG E;  1GTE A;  4C4V B;  2FNJ B;  3U2S C;  5IP4 D;  4DHZ E;  2M0A A;  1F52 A;  5CHW A;  2J52 A;  3QJZ A;  2L1A A;  4DXA B;  3HRD D;  1L0X B;  1GNU A;  3WA0 A;  1VZ7 A;  4GDK A;  4F8C B;  4LCD E;  5E6J A;  3MJW A;  1A70 A;  4RFB A;  4USA A;  3OWE B;  1EWY C;  4QAY A;  4YXD B;  3N1Z C;  5IKC M;  4G3X B;  3L10 B;  4LNF A;  3Q3O C;  2ZJD A;  1I4Q A;  3QWZ B;  1EWC A;  3ML9 A;  4W9C A;  2JVC A;  2GBR A;  2MH7 A;  2V3N A;  1XLO A;  3AEB B;  2K25 A;  4MM3 A;  4RF0 A;  1XXG A;  4BOS C;  2NS5 A;  1TS3 A;  3T3O A;  2OOB B;  1JCK B;  2V9H A;  2DX5 B;  3VHT C;  5LXI B;  2KWV B;  2MP2 B;  1TS4 A;  1L0Y B;  1CK1 A;  3AMZ A;  4IKG A;  1WSP A;  3KWV A;  5EE3 A;  5TR5 A;  5JXV A;  2KC1 A;  2MBE A;  2RPQ A;  2I1J A;  3PSE B;  5H8Y E;  3PRM B;  4WIP A;  2CU1 A;  2WXF A;  2ZNV B;  3VUX A;  2JPH A;  3ZJV A;  2G4D B;  1QIL A;  3ZUN A;  1I35 A;  1NBF C;  2KN4 A;  3VR8 B;  3Q3M C;  2J7Q B;  3IXS A;  2ZZP B;  4WJN A;  2V1Y A;  4GN1 A;  3HVZ A;  4MJS A;  2K9X A;  5KHO A;  2G9H D;  4ARI A;  4NZL B;  1MFW A;  4W9F A;  4LNK A;  1YQ4 B;  4M8M A;  1F77 A;  1GB1 A;  5JH5 C;  1K51 A;  1B9R A;  1PGX A;  2KO3 A;  1V8C A;  3TIX A;  1XD3 B;  3QA8 A;  3KLS X;  1L5P A;  4K81 A;  1TY2 A;  2PMV A;  3Q3J A;  3C8Y A;  2R2O A;  3JYU A;  3W1S C;  2QIE B;  3B1L X;  1V80 A;  2INP E;  5IOI A;  1UH6 A;  1WGG A;  2HE7 A;  1MI0 A;  1V97 A;  4PS3 A;  3A4R A;  2M19 A;  1JRU A;  4YWG G;  1TZO A;  4JQW C;  4KGT A;  1QF6 A;  2I1K A;  3SR6 A;  1FXI A;  4KX6 B;  2WXP A;  2BWE S;  5EDS A;  1DOY A;  4YTM B;  4NPN A;  3ZTC A;  3H7S A;  4CQN A;  2KQ7 A;  5D2M B;  2O6V B;  3VTV A;  1FNU A;  3A1Q B;  1VD2 A;  3BWU D;  3ZTD A;  4ZYS A;  4MT5 A;  3ZXV A;  4ZRP A;  3UF8 A;  2AX5 A;  4FLH A;  2IDY A;  3RT3 B;  2JYE A;  1WYG A;  2MJ3 A;  5C1Z A;  1FD6 A;  4KSK C;  1H4R A;  4OVU A;  2G3Q B;  2LI5 A;  1P7F A;  3AV8 A;  1WX7 A;  3VQI A;  1GAQ B;  2ZVO A;  3P4R B;  3N20 C;  4RNA A;  1TKG A;  4B95 A;  1ZDV A;  3A33 B;  1IBX A;  2HDE A;  2LFI A;  3L0W B;  1YD8 U;  2JXX A;  3SDL C;  3RUI B;  3MC8 A;  1B1Z A;  4PS7 A;  4RM8 A;  2WS3 B;  3IAM 1;  1MVK A;  1RRB A;  2N4F A;  1D5Z C;  3Q8F A;  4ZHP A;  3APC A;  2LUE A;  1OQR A;  2IO0 B;  1EM7 A;  2KDM A;  2E3T A;  3H7P B;  3ZNI D;  3QQ8 B;  2MW5 A;  3A1Q A;  2W55 A;  2IY1 B;  2LVO A;  2QC8 A;  3ZLZ A;  4BBN C;  4C7Z A;  2VH2 A;  4TV3 A;  1QOB A;  1NI2 A;  2IO2 B;  2KAC A;  4DK5 A;  1WF9 A;  5CHF A;  4MEM A;  4G0N B;  2RDH A;  2JZ3 B;  4F7Z A;  4ZHO A;  4FHK A;  1EF5 A;  3DBL I;  4II2 B;  1FRR A;  2MBO A;  2KDI A;  1VLB A;  1C78 A;  1KM7 A;  3ZJU A;  2N0S B;  3LDZ E;  5IN7 A;  2E6X A;  3MTN B;  3FC4 A;  4BKT A;  1UD7 A;  3A4S C;  3A9K B;  5FKA C;  2BYE A;  2BB5 A;  4HCN B;  1TS2 A;  4J6I A;  5AUI A;  1XLP A;  1UBI A;  2WXI A;  4S0R A;  2KLC A;  1UNS A;  1XCQ L;  5AEK B;  2K5P A;  2KZR A;  1KJT A;  2PLP A;  2QHO A;  4W9L A;  1MG8 A;  3T8M A;  2OHF A;  2KN5 A;  3BZD B;  3MHS D;  4C56 C;  3CMM B;  4ICU A;  5T8I A;  3ZGZ A; 
#chains in the Genus database with same CATH homology
 1CJE A;  2IGD A;  3SFD B;  5BYS A;  1ZOY B;  1SSN A;  4US8 A;  3AEF B;  2G1E A;  2IGH A;  1HZ5 A;  3ZJT A;  3HVD A;  2DBY A;  2BT6 A;  1E7P B;  3AED B;  2WXQ A;  1ESF A;  1C4P A;  3FIL B;  4JX1 C;  2CU3 A;  3ABV B;  1OFF A;  4KKI A;  2LHD A;  3P42 A;  3NRZ A;  1EU3 A;  2NTT A;  1WRI A;  1I4G A;  1XLN A;  3CIR B;  2Z8L A;  3NVW A;  5MPO A;  1C77 A;  4HRO A;  1N63 A;  1FNW A;  4TSS A;  3IAS 1;  4A6Q A;  2WXJ A;  1FCL A;  1NEN B;  3AEA B;  2W3S A;  1D5X C;  1AN8 A;  2MJE A;  2VZK D;  4OVZ A;  4WQM A;  5D7G A;  4XWW A;  1V1P A;  3BYT B;  4RCO A;  1UUP A;  1YN5 A;  3EUB 2;  2AQ3 B;  4B0E A;  3GB1 A;  4YSY B;  1NI3 A;  5BYQ A;  3AE6 B;  2IGG A;  3NS1 A;  4NJC A;  4PT5 A;  1XO3 A;  4C80 A;  3P63 A;  1UGJ A;  3VRB B;  3P1M A;  1H7X A;  3CWI A;  1J7A A;  1KF6 B;  2LMC A;  2IPK D;  1YMH E;  3BII D;  4EE2 A;  1C79 A;  2BS3 B;  4XE0 A;  4OZC A;  3TSS A;  2WU2 B;  2WU5 B;  1ENF A;  1M4V A;  5G5H A;  1WWT A;  2PTL A;  3L4P A;  3E9S A;  2PW9 A;  2JXT A;  2LJI A;  4WWM A;  2RDG A;  1JWA D;  4N6E B;  1PGA A;  2HTM E;  5HFY A;  1SJH D;  2GRI A;  3T3N A;  1ZXH A;  2JZP A;  5HI1 A;  1KTK A;  3IT6 B;  4MAC A;  1PUT A;  1XF5 L;  2WQY B;  4OZA A;  1PGB A;  3WCQ A;  3AE2 B;  5EE1 A;  3KWL A;  3MJ5 A;  3Q8B A;  4L23 A;  1FM0 D;  4WUR A;  4HKQ A;  1Q10 A;  4WAF A;  2QSD A;  1FO4 A;  4Q2J A;  3AE7 B;  2WXR A;  3J9C A;  2V4I B;  2L83 A;  1J7C A;  2KWD A;  2V3P A;  4IDI A;  3PZ8 A;  1SB3 C;  2WXM A;  2DYM A;  1KFY B;  1J7B A;  1ET6 A;  4FXC A;  1HQR D;  4JWU C;  1YN4 A;  1JW9 D;  4LTU A;  1LO5 D;  1VJK A;  2NTS A;  3U4E G;  2I2Y A;  2NMQ A;  1BXT A;  4LK0 M;  1KLU D;  2JX5 A;  1ZE3 D;  3W5V B;  1E10 A;  1YN3 A;  3AE9 B;  1T3Q A;  3R8B A;  1SF0 A;  1ZDX A;  1I4P A;  2BS4 B;  1T6B X;  2BS2 B;  1JML A;  1I4H A;  2K0P A;  3Q69 A;  4C7Y A;  1KLG D;  1R7S A;  1GTE A;  3B2F A;  4HJG E;  1NVI D;  1JWM D;  4A55 A;  2Y5P A;  3U2S C;  1KH0 A;  2GB1 A;  2I38 A;  1NYQ A;  2K22 A;  4NAM A;  1PFD A;  2CJO A;  2WXK A;  2M0A A;  1JQ4 A;  2J52 A;  3E56 A;  3NVZ A;  2L1A A;  1P7E A;  2PIA A;  2IJ0 A;  3HRD D;  4TQ0 A;  1L0X B;  3TEW A;  5G5G A;  1HEZ E;  3TEY A;  1E9M A;  1VR9 A;  1GB4 A;  3R2I A;  1FRD A;  3AM9 A;  2B76 B;  1FNV A;  1AWD A;  1VZ7 A;  1ET9 A;  3W5U B;  5E6J A;  3AEG B;  1A70 A;  4RFB A;  3R2T A;  3URY A;  4USA A;  3OWE B;  4OZB A;  4JPS A;  4MH8 A;  1QLB B;  1EWY C;  4ZRQ A;  4ARC A;  5I4D A;  4L2Y A;  4RGM A;  2EKI A;  4YXD B;  1D5M C;  3P4P B;  2XN9 C;  4OHJ A;  4XDD A;  5GXG B;  1I4Q A;  2M56 B;  1EWC A;  1SE3 A;  2YEP B;  5C2T B;  2BYT A;  1Y56 A;  3ZQ4 A;  1SJE D;  2V0G A;  2JU6 X;  3ZYY X;  1F0Z A;  2INN E;  1SEB D;  1ACC A;  5BYR A;  1HZ6 A;  2SEB D;  5C3J B;  2J53 A;  2LGI A;  4XWT A;  1FEH A;  3Q8C A;  1DGJ A;  2WXG A;  4A90 A;  2MH7 A;  2V3N A;  2L32 A;  2Y3A A;  1XLO A;  1YJI A;  4RH6 A;  3AEB B;  3TEZ A;  5EE0 A;  1BML C;  4A8X C;  2WXL A;  3NVY A;  1SBB B;  4RF0 A;  1XXG A;  4RF1 A;  3SEB A;  4H2A A;  2PVO D;  3FAH A;  1TS3 A;  3T3O A;  2KAJ A;  1JCK B;  1VDV A;  1PYW D;  1DOI A;  3FIL A;  3PZ7 A;  2WNM A;  1VZ8 A;  1YNT E;  4AQ7 A;  2BB6 A;  3V05 A;  4RGT A;  2VZK B;  1TS4 A;  1L0Y B;  1CZP A;  1CK1 A;  1TJE A;  2MJD A;  3AH7 A;  3AMZ A;  4IKG A;  5BMG A;  1DOX A;  1WSP A;  3KWV A;  3U52 E;  5BMH A;  1DYQ A;  5EE3 A;  3W1S A;  5JXV A;  3B2G A;  3MFG A;  5H8Y E;  1TYG B;  4KGS A;  4WIP A;  2LHE A;  4B0M A;  1TKY A;  2WXF A;  1N61 A;  1T5X D;  3N9Y C;  4P6V F;  4NAW B;  2H89 B;  1FCC C;  2GI9 A;  2MEK A;  3AE1 B;  2RPV A;  1QOA A;  4JE3 B;  1WXQ A;  2K3U A;  3IT4 B;  4WH4 A;  3P4Q B;  1IGC A;  2Q5W D;  2WDV B;  3ZJV A;  1OQQ A;  1QIL A;  1SIJ A;  4DQO C;  1K53 A;  2KN4 A;  4ITK A;  3VR8 B;  2JWU A;  3NZ3 A;  4A9A A;  2DLB A;  3LB8 C;  1IUE A;  3IXS A;  1L0V B;  1UWM A;  2QJL A;  4RGO S;  4N58 A;  3GP7 A;  1I4R A;  3HVZ A;  1GOZ A;  2OED A;  2K9X A;  2PVG C;  1XEE A;  1FFU A;  5EE9 A;  2LEK A;  1D4B A;  2N9K A;  1ZPS A;  3RFZ B;  4R3D A;  4N59 A;  3LXF A;  3W9C B;  1KRH A;  3CF4 A;  2G9H D;  5HHD G;  4ARI A;  2N9L A;  1D6E C;  4M0W A;  4NZL B;  3GS2 A;  2N7J A;  3RPF C;  4OW0 A;  4J3O D;  1YQ4 B;  3TEX A;  1F77 A;  1GB1 A;  2JSV X;  3VR9 B;  1K51 A;  1B9R A;  1PGX A;  1V8C A;  4JWS C;  5HG2 A;  1RM6 C;  2ICI A;  3KLS X;  4YSZ B;  2JYT A;  2R61 A;  3LYY A;  1L5P A;  4KKJ A;  1TY2 A;  2PMV A;  5D3D A;  3TUO A;  2Y5C A;  2PKO A;  3C8Y A;  2QIE B;  2SAK A;  4HEA 1;  2EEL A;  2ZW1 A;  3AE8 B;  1TS5 A;  2ONQ A;  3Q8E A;  4MM3 B;  2LUM A;  1I4X A;  2INP E;  1E0Z A;  2BTE A;  1QQR A;  3MP9 A;  1MI0 A;  1V97 A;  3O13 A;  1RWS A;  2XNA C;  3Q8A A;  1K50 A;  2WDR B;  2M19 A;  2W54 A;  4YWG G;  1N60 A;  1TZO A;  1NYR A;  2DYO A;  1QKZ A;  2CJN A;  4KGT A;  3I57 A;  1FMA D;  1QF6 A;  3SR6 A;  1JAL A;  4YTP B;  5LNK 1;  1FXI A;  4KX6 B;  2WXP A;  1K52 A;  5FR3 A;  4P16 A;  1DOY A;  4YTM B;  2ACZ B;  3H8H A;  1VZ6 A;  5D3I B;  1HA5 A;  4CQN A;  4TQ1 A;  1FXA A;  1FNU A;  3BWU D;  3AB5 A;  2D5G A;  1FIQ A;  4ZYS A;  4MT5 A;  2KMM A;  4ZRP A;  1SE4 A;  1EU4 A;  2AX5 A;  2IDY A;  3AEC B;  2WXH A;  2JYE A;  2J42 A;  3B9J A;  1SXT A;  1N5X A;  1C4A A;  3PO0 A;  1WYG A;  2J4X A;  3ETR A;  3AE4 B;  2MJ3 A;  4REZ A;  4GDK B;  1FD6 A;  1ZXI A;  2X38 A;  3BYY B;  4DXF A;  1P7F A;  4GLS C;  1I7H A;  3AV8 A;  1N62 A;  1V1O A;  1RFK A;  4L1B A;  2JQR B;  3UI3 A;  1ZP0 B;  3U7Z A;  3VQI A;  1HXY D;  5H92 C;  1GAQ B;  5FK9 C;  4RGN A;  3P4R B;  4YT0 B;  3DWG C;  4RNA A;  1TKG A;  1ZDV A;  2TSS A;  3HUI A;  1IBX A;  2HDE A;  3EGR A;  1JRP A;  2LFI A;  4HKZ E;  1MHX A;  1UWX A;  1QOF A;  1N5W A;  1B1Z A;  4HRS A;  5BMI A;  3BK1 A;  1TY0 A;  3I9V 1;  2WP9 B;  2FE8 A;  2WS3 B;  3NUH B;  3IAM 1;  1MVK A;  3V3X A;  1D5Z C;  1JRO A;  1L4D B;  1MPE A;  3BVZ A;  3Q8F A;  4ZHP A;  2FBW B;  1ROE A;  3BVM A;  3KQ4 A;  4AS1 A;  4DXG A;  1AW7 A;  3AEE B;  1GT8 A;  3MC0 B;  2BBC A;  2KQ4 X;  4KGR A;  4D2K A;  4O1N A;  1E6E B;  1IGD A;  1OQR A;  3VRA B;  1EM7 A;  1SE2 A;  2KDM A;  2E3T A;  2WXN A;  1C4C A;  1RYJ A;  1F2R C;  2W55 A;  1JWB D;  3W2D A;  3BVG A;  2WDQ B;  1XCT L;  4C7Z A;  1IBX B;  1QOB A;  1GPX A;  5TSS A;  2BW2 A;  1L6V A;  2KAC A;  2QIL A;  1NEK B;  1BUI C;  1ZUD 2;  2YEP F;  1YQ3 B;  3AN1 A;  4ZOH C;  1VRA B;  2AQ1 B;  2H88 B;  2RDH A;  2WXO A;  1TKE A;  4ZHO A;  5AUK A;  4YSX B;  1FRR A;  3MHZ A;  1QT9 A;  3BK2 A;  3SFE B;  1XLQ A;  1VLB A;  4TMA B;  4XDC A;  1C78 A;  2ON8 A;  2L52 A;  1H7W A;  3ZJU A;  2N0S B;  2ZW0 A;  2E6X A;  3FC4 A;  4LLG M;  5FKA C;  1V1P B;  2BB5 A;  1AYF A;  1MHH E;  1TS2 A;  1WGK A;  5AUI A;  3AE5 B;  1XLP A;  2WXI A;  1L4Z B;  1C9F A;  1YJJ A;  1PDX A;  1UNS A;  3EA6 A;  2FUG 1;  1F2R I;  1XCQ L;  2QMT A;  1C76 A;  2DWQ A;  1L6U A;  4GDL B;  2W82 A;  2AQ2 B;  2K5P A;  2WLB A;  3P4S B;  2PLP A;  3NVV A;  1CQV A;  4UDU C;  1STE A;  4YTN B;  1JWS D;  2W3R A;  1JWU D;  2OHF A;  2QEJ C;  3BZD B;  3DWM A;  3AE3 B;  1GTH A;  1QOG A;  4C56 C;  1FFV A;  2RMM A;  4IOI E;  5T8I A;  4US9 A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...