1YQ4B

Avian respiratory complex ii with 3-nitropropionate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq4B01
3AE3B 1YJJA 3VRAB 4N58A 3CF4A 3EUB2 1FRDA 2AX5A 4YT0B 3NVYA 5EE1A 1N60A 5C3JB 1CZPA 1VJKA 1KFYB 1WXQA 2WP9B 1JWAD 4N59A 1DGJA 3W9CB 2ACZB 1VDVA 2WS3B 2WQYB 2MH7A 1DOXA 1JALA 3P4PB 2H88B 3AEFB 1RFKA 3HUIA 1NYRA 1YQ3B 3LXFA 2Y5CA 1RYJA 4US9A 1JQ4A 1VLBA 1FXIA 2K22A 1L5PA 2WLBA 1N5WA 3NVVA 4USAA 1FMAD 5GXGB 1NI3A 1E0ZA 1WGKA 4LTUA 1ROEA 4YSZB 1R7SA 3CWIA 1AWDA 2KAJA 2MJEA 1SB3C 4P6VF 5H92C 1JW9D 1B9RA 1QOFA 1IUEA 1WYGA 3AN1A 1E9MA 3FC4A 1A70A 4C7ZA 3DWGC 1SIJA 3VR9B 1GAQB 2K9XA 2OHFA 1XLNA 3AECB 1N5XA 1V97A 1I7HA 1T3QA 3AEAB 3VRBB 3FAHA 1J7CA 2MJDA 3NVZA 2WDQB 1GTEA 2JX5A 2BS3B 4YXDB 4YSYB 2MJ3A 1WWTA 3AM9A 4N6EB 4WWMA 2BS4B 1DOYA 1TJEA 1N61A 2JQRB 3HVZA 2WDVB 2W3RA 3DWMA 1ZUD2 2PVOD 1XLOA 4US8A 1TKYA 3PO0A 1TKEA 2FBWB 5G5GA 1FFUA 1KRHA 1WRIA 3AEBB 4WQMA 1UWMA 1FFVA 2W55A 1L6UA 1QF6A 1EWYC 2KMMA 1ZOYB 2W54A 3ABVB 3LB8C 4JWUC 1GT8A 3B2FA 1SF0A 2WDRB 2PVGC 2G1EA 3SR6A 4JWSC 3AE5B 2H89B 3AE2B 4IDIA 2BS2B 1DOIA 4ITKA 4C7YA 1PFDA 1YJIA 3AE8B 1JRPA 2BT6A 1YQ4B 4HROA 1GTHA 1E6EB 1QT9A 1XLPA 5EE0A 4YTMB 1NVID 1JWBD 3L4PA 1JROA 4ZHPA 1H7XA 1TYGB 5AUIA 1FXAA 2K5PA 1OQQA 3W5VB 3P4RB 4ZHOA 1N63A 5AUKA 3AEEB 3B2GA 3AE4B 1QLBB 2L52A 3ZYYX 1RWSA 2DWQA 3P1MA 1KF6B 1TKGA 3AEGB 1NEKB 3P4QB 2DBYA 3AE9B 2M19A 5MPOA 1J7AA 1GPXA 2HTME 2W3SA 1FM0D 4ZOHC 4KX6B 1L0VB 5EE3A 4YSXB 3RPFC 1H7WA 1RM6C 2L83A 3KWLA 1E7PB 2B76B 3NVWA 2M56B 1V8CA 2QJLA 3P4SB 3BIID 3ETRA 2CJNA 3AMZA 3AB5A 3AV8A 4C80A 1NYQA 1QOBA 2CU3A 2QIEB 1FRRA 2N0SB 3B9JA 3SFDB 3HRDD 5EE9A 3W5UB 4YTPB 3SFEB 3WCQA 3P63A 4FXCA 3AH7A 1AYFA 5C2TB 2Q5WD 2PKOA 4A9AA 1NENB 1N62A 1ZP0B 5H8YE 3AE6B 1E10A 1ZXIA 4JX1C 1FO4A 2WU2B 3VR8B 5G5HA 3CIRB 1L6VA 3AE1B 1J7BA 1XO3A 1QOAA 3AE7B 1FIQA 2WU5B 2LEKA 3NS1A 1XLQA 1OFFA 1OQRA 1PDXA 3NRZA 1CJEA 2PIAA 4HRSA 1PUTA 1F0ZA 2CJOA 4YTNB 2EKIA 3AEDB 2E3TA 1QOGA
chains in the Genus database with same CATH superfamily
3ZXVA 4GMVA 5C3JB 1JWUD 2K8HA 3TJPA 4RH6A 1YD8U 2MJEA 4I6NB 4G3XB 3H7SA 2KDIA 1WYGA 2KC1A 4HJGE 3FC4A 4P1CC 5BMGA 1WE6A 2FCQA 1N5XA 2IO1B 3ZIMA 1I7HA 1SBBB 3RNBC 2JX5A 3KYCD 4A6QA 4YXDB 4ASWC 2D5GA 3AM9A 5HG2A 3DWMA 4RF1A 3SEBA 3PO0A 1VZ6A 1L2NA 4WQMA 4R3DA 1WXMA 2X38A 1OTRB 2WWZA 4MH0E 3IHPC 1XCQL 2XBBC 1ZXHA 3DBLB 2DYMA 2KQ4X 1PYWD 1GTHA 1D5MC 1XLPA 3EECA 3L0WB 4FULA 3VUXA 2MP2A 4KV2A 3AEEB 1BXTA 3TUOA 3AE4B 2BWFA 1WI0A 1WR1A 1D5XC 2NBWB 1E7PB 3N30A 3UGBB 5L83A 3H7PA 4MGIE 2CU3A 5EE9A 1SXTA 3GE8C 4ICUA 1P0RA 2N9LA 2V9HA 1ZP0B 4REZA 1IGCA 4BBNF 3VR8B 2ZVOA 5G5HA 3ZVVA 4FA6A 1QOAA 2L0TA 3BYYB 1A5RA 3SU8X 3APDA 2IO0B 2BYTA 1YX5B 4BZAA 1R4MI 2RDGA 4ZRPA 1PUTA 2IPKD 2K0PA 1C4AA 3VH3B 4RMAA 5LXIB 3RNCC 2VH1A 2E3TA 3U52E 4TSSA 1WJ4A 3A1QA 1EM7A 1MFWA 3W9CB 4KGTA 4YWGG 3PHXB 3D32A 1D6EC 3PVLA 3NVVA 5GXGB 1T0YA 1WZ3A 2FIDA 3VH4B 4JGHB 3ML9A 1JW9D 1UGJA 3Q69A 4DHJD 3VTWA 3Q14C 4OVUA 3E56A 2KQ7A 4GDLB 1LO5D 3N1YC 2WXIA 3KVFB 1QKZA 1P9DU 1C78A 2LUMA 4BOSC 1WRIA 4BAXA 2K8BA 1QF6A 2KZRA 1T6BX 3ABVB 2KMCA 1L0XB 4JWSC 4ITKA 2XN9C 2LVPA 1YIWA 2G9HD 1WX7A 2KACA 4W9LA 1FXAA 1OQQA 3U7ZA 1L4DB 2LWPA 2NPTB 2J0KA 2YLMA 4WJNA 2M19A 2DBYA 2BGFA 3AE9B 2KFJA 4KX6B 1TBEA 3NVWA 1WY8A 2IY1B 3AMZA 2GI9A 3AV8A 5IA7A 2HJ1A 3W5UB 1HE8A 1K8RB 3AE6B 2JYTA 3ZNZB 3ZNHB 1FNVA 3NZUA 2SEBD 1EO6A 4B0EA 1CK1A 3U8ZA 1GJZA 2O6VD 1PDXA 1XD3B 2ZVNA 2L05A 3K9PB 4N58A 5AUKA 4FLHA 4CO7A 4W9CA 2JF5A 5FKAC 1P98A 3A9JA 1RFKA 1KOTA 2LJIA 3UF8A 3QHTA 2AQ1B 1AN8A 1R4MB 4A8XC 3J9CA 1NBFC 4IG7B 4EZJA 1UWXA 1XF5L 2PPHA 2K39A 4M8MA 3DWGC 2IGHA 4YL8A 3VRBB 2ICIA 4I6PA 1KH0A 5HHDG 1MG4A 2INNE 5FK9C 1ZUD2 3MJWA 4K7WA 2PVOD 2WYQA 2JUOA 2JYEA 3AEBB 2PMVA 3WA0A 1EWYC 3T8MA 1WXSA 2GBRA 2NVUI 4LDTB 5JH5C 2M4NA 1CQVA 3MHZA 4EFOA 2H89B 2BS2B 4C7YA 3ZJVA 1D3ZA 3C0RB 3AE8B 2BT6A 2NS5A 3SDLC 2ZJDA 3IVFA 5L95C 4HPPA 3W2DA 1JCKB 1F9JA 2FNJB 1EUVB 4WWOA 3L13A 2WXPA 1RWSA 1I4XA 2MBBB 5HFYA 1GPXA 5DPSA 3RPFC 1SJHD 2G45B 3KYDD 2M0AA 1UBIA 2D10A 3SFDB 3Q8BA 3ZTCA 2K3UA 2WXLA 2Y5BB 2KFKB 2GBMA 4WH4A 3C19A 3ML8A 5H8YE 2L0FA 2XK5A 1TS2A 1KLUD 4S0RA 5TR5A 1YNTE 1WGYA 3DOWA 1GG3A 4C4VB 4ANWA 1KJTA 2LUEA 4XWTA 1LXDA 1FCLA 2BYVE 1YJ1A 2WS3B 1KLVA 3P4PB 2KWVB 1VLBA 4B0MA 4G0NB 4K1RB 1J19A 1C9FA 5IKCM 2BWES 2RPVA 1IUEA 3E9SA 2WGSA 2EMTA 1K53A 1EWCA 2DAFA 2N9PC 5JHAA 2K6QA 2DZJA 1VCBA 2MSED 3BVZA 5EDSA 4LK0M 5AEKB 3WAMA 5D3IB 1TJEA 1FNUA 2PJHA 1OEYA 4CHKA 4KGRA 1RAXA 1G6JA 2N1WA 2LGIA 1UWMA 3HM3A 1WJUA 2PLPA 2O2VB 4EUTA 4EZKA 3Q3MC 4EKUA 4JL9A 1PFDA 5LNK1 3RNEC 1PGXA 2XNAC 2JXTA 2I38A 2NBUA 1BUIC 2Z8LA 3BK2A 1ZPSA 1GC6A 4W9EA 2M17A 3VUWA 1GC7A 2DZIA 2KT7A 2JWZA 3HHMA 1J7AA 4ARCA 1E90A 4ZRIA 4WQOB 3PLUA 5C1ZA 4NJCA 4YSXB 3VUYA 2M56B 1KTKA 3SFEB 3WCQA 3NZ3A 2B3AA 5JZEB 1TS5A 1TT5B 5IO9A 3PHWB 1I4PA 4HXDA 2ASQA 4ZRKA 3I3TB 2LD9A 1HTQA 4RCOA 1F77A 2WXKA 4HRSA 2KNBA 4EE2A 4YTNB 3VVWB 2MW5A 4GDLA 2LFIA 3CF4A 1FCCC 4TV3A 2WP9B 2ACZB 2BTEA 2WQYB 2Z59B 4A3PA 4KIKA 3TBLD 4BBNC 2LVOA 4II2B 1R4NI 2ZNVB 1HZ5A 1T0RC 2IZVB 2KTFA 3LJ3A 4DDID 1J8CA 1WMHB 4C7ZA 3ZRFA 3FILA 4M0WB 2V3NA 1I35A 2MJ3A 2KJRA 2WXGA 3ZTDA 2NPTA 1Z2MA 2LXCA 2D11A 4BVUC 2W55A 2KTRA 3W1SA 1IPGA 3TEZA 1GT8A 2ZEQA 2WDRB 2LVQA 2GRIA 3SR6A 3V3XA 2WX1A 2C7MB 1PQSA 1JRPA 4L1BA 3S2AA 4GDKA 1QT9A 5KHQA 2WHIA 3C8YA 1NVID 1JWBD 3IFWB 4URKA 4GGQA 2FE8A 4XC2A 1ZDXA 3B2GA 3TIXA 3QC8B 3MC9A 1EF1A 1XEEA 1SJED 1Y56A 2B76B 1VZ8A 3BIID 4IWQA 4F8CB 1I4QA 3M3JA 3DHGC 5TSSA 3KUCB 1NENB 3ECIA 4DHZE 2YEPF 3IG3A 3AE7B 1FD6A 3KW5B 4QAYA 4KSLC 1HEZE 4AS1A 2WXNA 2WXRA 1N5WA 4DHZB 3UI3A 3I57A 3EUB2 3PZ8A 2BBCA 1DYQA 2NTTA 4TQ1A 4YSZB 1R7SA 1TY0A 1B9RA 1WXVA 4MT5A 1VD2A 4WJPA 4A55A 4HCNB 3SD5A 1M94A 2LJ5A 3X0WA 3TEWA 2ZPNA 4MEMA 4XYCA 1EU3A 3U30A 1IBXB 5G55A 4IM0A 4W9DA 1MVKA 2JT4B 3L08A 2DNFA 4K81A 2JXXA 1SF0A 3BWUD 2LGXA 3PRZA 2J53A 4ZRJA 1JROA 2QEJC 1H7XA 2UU7A 5J2RA 1WF9A 1E7VA 3N32A 4W9IA 1UF0A 2INDC 4TQ0A 4GLSC 1GNUA 4DBGA 1NEKB 1FM0D 3M63B 2L8JA 5FR3A 3RNAC 4K7SA 3NG0A 5DPWA 3AB5A 1KLGD 3Q8FA 5C2TB 1T0SC 1SE3A 4KDIC 2WXOA 1ZGUB 2CU1A 4JLCA 1UH6A 4F1SA 4NJ7A 5JHBA 4HPMB 3BYTB 1IGDA 2MWSB 3ZJTA 3RNFC 4YT0B 1VJKA 4W9JA 4C00A 3A9KA 2RR9A 3B0AA 2JZPA 2AEHA 2KHWB 3UINB 1E8YA 3LXFA 4DHJB 3ZNGC 3ZW3A 4LCDE 1FMAD 3LYYA 2KAJA 2N9KA 3BVGA 2LI5A 1BT0A 2MBHA 1A70A 2K9XA 3T3OA 2LMCA 3ZUNA 1FPYA 3P42A 1WGRA 4CYEA 2KQSA 4K3CA 1WM3A 4TKNA 3NHEB 4JIOU 4II3B 4US8A 3QK0A 1TKEA 1P1AA 4FBJB 2W54A 5CHWA 2LRWA 3B2FA 4HCPB 2DX5B 3AE5B 4RF0A 2BB5A 3R7RA 4HROA 1E6EB 1WX9A 2KO3A 2L1AA 3IAM1 4AJWA 1F52A 4B95A 2KLCA 2KWDA 5HKHA 2V1YA 1QLBB 2KMAA 4WAAA 2FCSA 4FJVB 2CS4A 4PYZA 1GB1A 1WE7A 2RDBC 3VAWA 2K8CA 1C1YB 3AH7A 4AQ7A 2O6VB 3CF6E 4JE3B 4NAWB 1V86A 3R7QA 3DBSA 2JY6A 5G2NA 3CIRB 3AE1B 1E8WA 3R2TA 1XLQA 3L16A 1OQRA 3U7DA 2IGGA 2CHWA 1ESFA 4MGYE 2IY0B 3WAOA 3ZO5B 1XLNA 2PE9A 4LNFA 2LHEA 2KWCA 2FIFA 2J4XA 5AZGA 3KQ4A 1TS3A 4HPLB 4MM3A 4US9A 1AW7A 4USAA 3I63C 3V62A 3CWIA 3VXWA 3QIJA 1IYFA 1K51A 5IN7A 1L4ZB 2I1JA 2V3SA 1YN4A 1TY2A 4BKGA 4NQKE 2YVCA 1WFYA 1OQYA 1TTNA 3Q2AC 3T9LA 5LLIA 4YSYB 5BYSA 3HVZA 2K25A 1C79A 2GBNA 2D3BA 2JZZA 3ZQ4A 4OZAA 3TCAA 4LLGM 4JWUC 4DXFA 3RMKC 2WDTB 2AQ2B 2FCNA 2QSDA 1WZ0A 4P7IA 2ZCBA 3QJZA 3L4PA 3A4RA 2K5PA 4ZHOA 3IBEA 2CKHB 4IM3A 4HK2A 1MI0A 4AOFA 3OWEB 4IM2A 2AWTA 4LJOB 1L0VB 4BOZB 1VRAB 2L83A 2QJLA 1SE4A 1C76A 4OZCA 4YTPB 1D5ZC 2AL3A 4MJSB 4ANXA 4K3BA 2DYOA 4WIPA 1J7BA 1XO3A 2QMTA 1OFFA 3DQVA 2HE7A 2PIAA 1UUPA 2WXMA 1WIAA 2V4LA 2A5UA 4A90A 4KSKC 2CHZA 3QAQA 1C77A 1FRDA 1N6ZA 2L7RA 1CZPA 1V80A 4BKSD 1JWAD 2M1MA 1VDVA 2MH7A 1Y8RC 1JALA 4PS7A 1WSPA 2WLBA 3NJTA 4WJQA 3PREA 3PSEB 1J0GA 2GBKA 1TS4A 1PGAA 3VR9B 1GAQB 4G50A 1QILA 4HDOA 3BY4B 4LNNA 1U4AA 2BS3B 3QCAA 1DOYA 2BS4B 2MQJA 3AU5A 3H9DA 3WANA 1NDDA 2WXQA 2PW9A 3V6CB 3V05A 2BW2A 1ZKHA 3AE2B 4GB9A 3V61A 5BYQA 3CSTA 2DZMA 4J3OD 2KX0A 1S1QB 2MP2B 3KWVA 1V9JA 3Q8AA 3W5VB 4ZDVA 2HTHA 1N63A 4FJYA 2KN5A 3Q3FA 3I5JC 2W3SA 4HJKA 2FUHB 4KZCA 3DBHI 1YN3A 1FRRA 2N0SB 3MP9A 2NMQA 3P63A 1C3TA 2J42A 3R2IA 1N62A 3VHTC 2KKCA 2JRHA 4JX1C 1TGZB 4MH8A 1FIQA 3ZNID 3AEDB 3PTFC 2JRIB 5EE1A 1I4RA 1VZ7A 2AX5A 3A1QB 2D3AA 4MGKE 1WYWB 3QWZB 4IC7B 4S17A 1YQBA 4W9GA 1NYRA 1UNSA 1YQ3B 4OVZA 4PS8A 2M8SA 2LRUA 2BYFA 2KDEB 1ROEA 3RUIB 1P7EA 1PGBA 3PLVA 4NNJB 4J6IA 4MACA 2MBQA 2KWUB 2VRRB 2DZKA 2WXHA 3Q8CA 2MRPA 3CMMB 3ALBA 4GSWA 3FAHA 3OAWA 3MHSD 2WDQB 1L7YA 5CTRC 2KOXA 2C5LC 1WWTA 4HLEA 1MG8A 4FN2A 3P2BA 2Y3AA 2UYZB 3RD2A 1ZW7A 2V3PA 1ZDVA 3AXCA 1GOZA 3LB8C 1F1HA 2ZPYA 4HVBA 2D2QA 1L0YB 2DYBA 2HD5B 2LASA 2GOWA 5EE0A 4YTMB 4NAWA 2FCMA 2QHOA 3ZLZA 2GLSA 5E6NA 4RM9A 2GMIC 3DVGX 1TKGA 1QZEA 2LZ6A 4M01A 3VDZA 4MDKE 3RI7C 5CHVC 1NYQA 3RZWC 2J52A 3B9JA 4W9FA 2LHDA 1E7UA 2ZW0A 2J7QB 2BKRB 1E8XA 3DBHB 1QQRA 1FXTB 3NS1A 3CSFA 3RYTA 3QQ8B 1V1OA 3JSVB 3TEXA 3V60A 1XT9B 3ETRA 3AE3B 3VRAB 3GZNI 1VR9A 3GP7A 4WJOA 3UQAA 3A9JB 1JWSD 4O1NA 2MLBA 3U2SC 1ZE3D 1L5PA 2OEDA 2C9WB 2BKFA 5E6OA 1QOFA 4LNKA 4HWIB 4EOYA 2KDMA 4RGOS 1T3QA 3Q6BA 3AEAB 2IJ0A 2G3QB 1J7CA 2EKEC 4N9F4 2VZKB 4M8NA 4TUUA 1NI2A 2JQRB 1ENFA 2R2QA 1XLOA 2FBWB 2N9EB 5BMIA 1KRHA 3HVDA 1ZOYB 3B08A 3DHHC 4Q2JA 2BF8B 1R4NB 4HEA1 2KLGA 2WX0A 5FR6A 3P4RB 1UELA 1V6EA 2L3ZA 3R66C 1UBQA 2VZKD 3DBRI 1UZXB 3DCGA 1CMXB 5KHOA 5EE3A 2KJHB 1H7WA 4NZLB 3PZDA 4P16A 4XWWA 3HK0A 3UIOB 2KFKA 2MBOA 2PKOA 4A9AA 1V5TA 1STEA 1E10A 4F7ZA 2XK5B 1WRDB 3L54A 5CHFA 3PZ7A 2NBVB 4KKIA 2KANA 2KDBA 1WGDA 1H8CA 3WALA 3NUHB 1F0ZA 4C4VA 4IWPA 4K7UA 3TEYA 5I4DA 1QOGA 1XXGA 4E74A 1N60A 4N59A 3RT3B 1OGWA 1DGJA 1TZOA 3OJ3A 4I6LB 3EFUA 3WIMA 4B6WA 1F2RC 1HZ6A 1WGKA 1SEBD 2KVRA 3GZNB 2BQQA 2QCZA 2R61A 3PT2B 2DLBA 2PEAA 2KXJA 4WWNA 2J0JA 2KX3A 4GXBA 1ACCA 1UD7A 4DXGA 4XDCA 3Q8EA 4OZBA 2WDVB 5BYRA 1TKYA 1P7FA 1I4GA 2KJ6A 2HDEA 2JSVX 3L17A 1JMLA 2OJWA 1WX8A 1YMHE 1TZ1A 1YX6B 2O2VA 2N4FA 1B1ZA 3L10B 4D2KA 2C7HA 2FAZA 2L76A 5BO4B 4IW0A 2MEKA 4P1BC 2XEWA 5CX3A 5AZFA 3TL5A 2NR2A 1LQBA 1E8ZA 2L52A 3W1SC 2JWUA 5MPOA 3O65B 4WWPA 3DVGY 4M02A 4FHKA 1IP9A 2ZZPB 5GMVA 3BVMA 4HKQA 2CHXA 1RRBA 3P4SB 4DK5A 3RFZB 4MGZE 1HTOA 4XE0A 3DBRB 4H2AA 2K1FA 2MX2A 2WXJA 3T3NA 2IO3B 1AARA 2EELA 2V0GA 5E6JA 5E6PA 1H4RA 1JRUA 3NRZA 3MFGA 2R2OA 4KDLB 1JWMD 4EZLA 1K52A 3K9OB 1YJJA 3NVYA 3IT4B 1KFYB 3Q3NC 3U4EG 4KIKB 2QC8A 2X8XX 2H88B 2PTLA 4PK1A 1RYJA 2I1KA 1FXIA 2K22A 2UWQA 3VQIA 1X1MA 3NS8A 1WR6E 1S3SG 1WJ6A 3VTVA 1SGHA 1WMHA 2ONQA 2IO2B 2OHFA 3AECB 3RZFA 4AP4C 3DHIC 3FILB 2MA9B 3IT6B 4IOIE 2QDFA 1GTEA 3GS2A 1WH3A 4M0WA 2IDYA 3MJ5A 4ICVA 4RGTA 3RNGC 1BMLC 4UDUC 3EHVA 3M95A 3BK1A 2W82A 1EU4A 2KTRB 1FFVA 2IBIB 3EC8A 3NZSA 3WAPA 1T5XD 1RLFA 2REXA 2GB1A 2G1EA 2LGSA 4TMAB 5D94A 1LGRA 2BB6A 3PRPB 2KD0A 3RN9C 2OJRA 3X23A 4GDKB 3W1YA 1V5OA 1K50A 4KZ0A 4NPNA 1ET6A 1V1PB 2G4DB 4ANVA 2AYOB 2Y5PA 4FADA 2FUG1 1GUAB 2RD0A 3R3MA 4IKGA 3JSVA 2DAJA 1HA5A 3KWLA 2D3CA 2KN4A 4C80A 4NAMA 2KYWA 2QIEB 5T8IA 3HIZA 3M62B 1V49A 2Q5WD 3JW0X 5IP4D 1HXYD 4KKJA 3NY5A 2N7JA 1ZXIA 3ENEA 2WU2B 4G11A 1TIFA 4MSQB 4OHJA 3FKYA 3EA6A 2NTSA 4ZYNA 4AJYB 2MBEA 3PPAA 4ACFA 1SE2A 2L00B 4OVVA 1C4PA 3ZJUA 4BKTA 3AULA 4W9HA 2QILA 3IXSA 3QX1A 4WURA 3OJ4B 3RULA 1Q0WB 1JQ4A 1C4CA 1XQQA 2KC2A 1E0ZA 2DENB 1NI3A 4LTUA 1AWDA 4L2YA 5H92C 1E9MA 4NJ6A 5D7GA 1V97A 3VFKA 1M4VA 2RMMA 1ISNA 3GB1A 3Q3JA 3APCA 4AWJA 1P3QU 2Z0EB 2J0MA 4WWMA 1IBXA 5IOIA 3PV1A 1Q5WB 3DPDA 2RDHA 1L6UA 3AU4A 3EGRA 2AL6A 2N9XA 4HKZE 1DOIA 1YJIA 1YQ4B 1GB4A 2KVZA 2MCNB 4ZHPA 4LDTD 4ZRQA 4DQOC 1YN5A 4E71A 2JU6X 2C7NB 2DWQA 5C23A 3P4QB 2MHJA 3N9YC 3ZRCA 1RM6C 3GE3C 1WJNA 4GN1A 4P6VF 2Z0DB 1Q1OA 2CJNA 2EMSA 3H6NA 4MELA 4IUMB 4ZYSA 3HRDD 3UIPB 4FXCA 5D6JB 2HJ8A 5J17A 3HM6X 3BZDB 3IAS1 2KK8A 2LEKA 4OW0A 3AI5A 1CJEA 1SE9A 3OLMD 3ZDMC 4A20A 1Q10A 2CJOA 2LGYA 1RFAA 2JVCA 3H7PB 3H1UA 3A9KB 1WXQA 1ET9A 4AUQC 3I9V1 4JPSA 4PS3A 3URYA 3HUIA 2INPE 3ZGZA 2Y5CA 1MHHE 2ZNVC 2YEPB 1Z5SB 2CR5A 4ARIA 4RGMA 4BFRA 1SB3C 4X57B 3AN1A 3O13A 2ON8A 2RSUA 1SIJA 1D4BA 3ZKJC 2WXFA 1HQRD 4KGSA 2A4ZA 2ZW1A 3KH0A 5DPTA 2MJDA 3NVZA 1FNWA 3BINA 3N3KB 2W9NA 2IYDB 4B9KA 2AQ3B 2W3RA 5J18A 2N1VA 2LGDA 3ONSA 2DHZA 1XCTL 1WM2A 3TMPB 3DVNU 1FFUA 2D07B 2BPSA 2JPHA 3A33B 2PVGC 2K6DB 4IDIA 4XGAB 4KVGB 3Q3OC 2JZ3B 4FHJA 1TYGB 3TSSA 1EF5A 4XDDA 2NCNA 2L32A 3ZYYX 3P1MA 4DDGD 1KF6B 1OEYJ 2HTME 4ZOHC 2V4IB 1KM7A 3QARA 1V8CA 3MC0B 1QOBA 5BMHA 5DCNA 2D3GA 3V6EB 4MSMB 1AYFA 2BYEA 2O6VA 2IGDA 4C56C 3VTUA 2E6XA 1WXAA 3N1ZC 4LNIA 4RM8A 2RGFA 4RFBA 2WU5B 3QA8A 5D3DA 2TSSA 3SHQA 3NOBA 2GBJA 3KUDB 2EKIA 1UGMA 4HDQA 3N1XC 2VH2A 4GOCA 2INCC 4IWOA 1DOXA 2I2YA 3AEFB 4MM3B 4GIVA 4GU2A 2PE6B 3PS6A 5HI1A 3MC8A 4EEWA 1T0QC 2N7DA 3MTNB 3H8HA 3A4SC 1I42A 4RGNA 1E5WA 3ZXRA 3UQBA 1I4HA 2ZCCA 2G4SA 4XZ4A 5LXHA 1V1PA 3R8BA 4N6EB 3DBLI 1N61A 4DXAB 3GOEA 1MPEA 2BVCA 5D2MB 5G5GA 3LDZE 1LM8B 1YOVB 2C60A 2RPQA 3B1LX 4ANUA 5IAAC 2KMMA 3APFA 5AZHA 3DDCB 4A3OA 4NY0A 4DWFA 4L23A 2WNMA 2SAKA 1SIFA 4XX5A 1V81A 3EFCA 2M0XA 4NQLB 5AUIA 1MHXA 1LFDA 4M00A 2OOBB 4CQNA 3DVNV 4RNAA 3JYUA 3AEGB 4BKSA 3PGEA 2KDFB 3KLSX 3JVZX 2LXAA 3KUZA 4PYUA 4LJPB 3PRMB 1MJDA 3OG5A 3ZDTA 1WGGA 1SSNA 1WGHA 4MJSA 4LNOA 3N20C 1FO4A 4WAFA 2N7EA 4PT5A 1L6VA 1V2YA 4E3CA 4FJZA 5JXVA 1FEHA 5DPRA 4W9KA 4JQWC 1F2RI 3RCZA
chains in the Genus database with same CATH topology
1YJJA 2LFIA 3CF4A 1C77A 1FCCC 1FRDA 3NVYA 5C3JB 1CZPA 3IT4B 1KFYB 2WP9B 1JWAD 2ACZB 1VDVA 2MH7A 2WQYB 3U4EG 2BTEA 1JALA 2H88B 2PTLA 1RYJA 1WSPA 1FXIA 2K22A 1JWUD 3VQIA 2WLBA 1HZ5A 4RH6A 2MJEA 2ONQA 1TS4A 1PGAA 1WYGA 3FC4A 4HJGE 5BMGA 4C7ZA 3VR9B 1GAQB 2OHFA 3AECB 1N5XA 1I7HA 3FILB 1QILA 3FILA 1SBBB 3IT6B 4IOIE 1GTEA 2JX5A 2V3NA 3GS2A 2IDYA 4M0WA 2BS3B 4YXDB 2MJ3A 4A6QA 2D5GA 3AM9A 3MJ5A 1DOYA 2BS4B 5HG2A 4RGTA 3DWMA 2WXGA 4RF1A 1BMLC 3PO0A 4UDUC 3SEBA 1VZ6A 3BK1A 2W82A 2WXQA 1EU4A 4WQMA 4R3DA 1FFVA 2W55A 2PW9A 3W1SA 3V05A 2X38A 1XCQL 1T5XD 3TEZA 1GT8A 1ZXHA 2BW2A 2WDRB 2GB1A 2DYMA 2G1EA 2GRIA 2KQ4X 4TMAB 3SR6A 3AE2B 3V3XA 1PYWD 2BB6A 5BYQA 1JRPA 4L1BA 4GDKB 1K50A 1GTHA 1D5MC 1QT9A 1XLPA 4J3OD 3C8YA 1NVID 1ET6A 1JWBD 1V1PB 2FE8A 3KWVA 3Q8AA 3W5VB 1N63A 2Y5PA 3AEEB 1BXTA 1ZDXA 3TUOA 3B2GA 3AE4B 2FUG1 2W3SA 4IKGA 1D5XC 1HA5A 1XEEA 3KWLA 1SJED 1Y56A 1E7PB 2B76B 1VZ8A 2KN4A 3BIID 1YN3A 4C80A 4NAMA 2CU3A 2QIEB 1FRRA 1SXTA 2N0SB 3MP9A 5EE9A 1I4QA 2NMQA 3P63A 5T8IA 2J42A 5TSSA 2Q5WD 2N9LA 3R2IA 1NENB 1HXYD 1ZP0B 1N62A 4KKJA 4REZA 2N7JA 1ZXIA 4JX1C 1IGCA 2WU2B 3VR8B 4MH8A 5G5HA 2YEPF 1QOAA 3AE7B 1FIQA 4OHJA 3BYYB 1FD6A 3EA6A 2NTSA 1HEZE 2BYTA 4AS1A 4ZRPA 2RDGA 1PUTA 2IPKD 2K0PA 1C4AA 2WXNA 2WXRA 1N5WA 3AEDB 2E3TA 3U52E 1SE2A 3UI3A 4TSSA 5EE1A 1I4RA 3I57A 3EUB2 1VZ7A 2AX5A 1C4PA 1EM7A 3ZJUA 3W9CB 3PZ8A 4KGTA 2QILA 3IXSA 4YWGG 2BBCA 4WURA 1DYQA 1NYRA 1UNSA 1YQ3B 2NTTA 1JQ4A 1C4CA 4OVZA 4TQ1A 1D6EC 3NVVA 5GXGB 1E0ZA 1NI3A 4LTUA 1ROEA 4YSZB 1R7SA 1TY0A 1AWDA 1P7EA 1PGBA 4L2YA 5H92C 1JW9D 1B9RA 1E9MA 4MT5A 1UGJA 4MACA 4A55A 3Q69A 5D7GA 1V97A 1M4VA 2RMMA 2WXHA 3GB1A 3E56A 3Q8CA 4GDLB 3FAHA 1LO5D 2WDQB 3TEWA 2WXIA 1EU3A 1WWTA 4WWMA 1IBXB 1IBXA 1QKZA 2Y3AA 1C78A 2LUMA 1MVKA 2V3PA 1WRIA 1ZDVA 1QF6A 2RDHA 1L6UA 1GOZA 1T6BX 3ABVB 3EGRA 3LB8C 1SF0A 1L0XB 3BWUD 4JWSC 4HKZE 1L0YB 1DOIA 4ITKA 1YJIA 2J53A 2XN9C 1YQ4B 5EE0A 4YTMB 1GB4A 1JROA 2G9HD 4ZHPA 4ZRQA 2QEJC 1H7XA 2KACA 1FXAA 1OQQA 4DQOC 1YN5A 3U7ZA 1L4DB 4TQ0A 4GLSC 2JU6X 2DWQA 1TKGA 3P4QB 1NEKB 2DBYA 2M19A 3AE9B 3N9YC 1FM0D 4KX6B 5FR3A 1RM6C 3NVWA 4P6VF 2CJNA 3AMZA 2GI9A 3AB5A 3AV8A 1NYQA 2J52A 3B9JA 1KLGD 3W5UB 4ZYSA 3HRDD 2LHDA 3Q8FA 2ZW0A 4FXCA 5C2TB 3AE6B 2JYTA 1FNVA 3BZDB 1SE3A 2WXOA 3IAS1 2SEBD 1QQRA 2LEKA 3NS1A 4B0EA 1CK1A 4OW0A 1PDXA 1V1OA 1CJEA 3TEXA 1Q10A 2CJOA 3ETRA 3AE3B 4N58A 3VRAB 1IGDA 3BYTB 5AUKA 3ZJTA 4YT0B 1VR9A 1WXQA 1VJKA 3GP7A 1ET9A 5FKAC 4YTNB 2JZPA 3I9V1 1RFKA 4JPSA 1JWSD 3URYA 2LJIA 4O1NA 3HUIA 2INPE 3ZGZA 3LXFA 3U2SC 2Y5CA 1MHHE 2AQ1B 1ZE3D 1AN8A 4A8XC 1L5PA 3J9CA 2YEPB 1FMAD 2OEDA 3LYYA 4ARIA 4RGMA 1UWXA 2KAJA 1SB3C 2N9KA 1XF5L 3BVGA 1QOFA 3AN1A 3O13A 2ON8A 1A70A 3DWGC 1SIJA 2KDMA 2K9XA 2IGHA 4RGOS 3T3OA 1D4BA 1T3QA 2LMCA 2WXFA 1HQRD 3AEAB 4KGSA 3VRBB 2IJ0A 2ZW1A 3P42A 1J7CA 2MJDA 3NVZA 2ICIA 2VZKB 1FNWA 1KH0A 5HHDG 2INNE 2JQRB 2AQ3B 1ENFA 2W3RA 5FK9C 1ZUD2 2PVOD 1XLOA 4US8A 1XCTL 1TKEA 2FBWB 5BMIA 1FFUA 1KRHA 2JYEA 3AEBB 3HVDA 2PMVA 1EWYC 1ZOYB 2W54A 3B2FA 1CQVA 4Q2JA 2PVGC 3MHZA 4RF0A 3AE5B 2H89B 4IDIA 2BS2B 4C7YA 2BB5A 3ZJVA 3AE8B 4HEA1 2BT6A 4HROA 1E6EB 2L1AA 3W2DA 1JCKB 1TYGB 3IAM1 3TSSA 4XDDA 3P4RB 2L32A 2WXPA 2KWDA 1QLBB 2VZKD 3ZYYX 1RWSA 3P1MA 1KF6B 1I4XA 5HFYA 1GPXA 2HTME 4ZOHC 5EE3A 1SJHD 3RPFC 1H7WA 2V4IB 4NZLB 2M0AA 1GB1A 1V8CA 3MC0B 1QOBA 5BMHA 3SFDB 3Q8BA 2K3UA 4P16A 4XWWA 2WXLA 3AH7A 1AYFA 4WH4A 2PKOA 4A9AA 4AQ7A 4NAWB 4JE3B 5H8YE 1STEA 1E10A 2IGDA 4C56C 1TS2A 2E6XA 3PZ7A 1KLUD 3CIRB 3AE1B 4KKIA 4RFBA 2WU5B 1YNTE 3R2TA 5D3DA 1XLQA 2TSSA 1OQRA 2IGGA 3NUHB 1ESFA 1F0ZA 3TEYA 2EKIA 4XWTA 5I4DA 1XLNA 1QOGA 1XXGA 1FCLA 2LHEA 1N60A 4N59A 2J4XA 1DGJA 2WS3B 1DOXA 3KQ4A 1TZOA 2I2YA 3P4PB 3AEFB 1TS3A 4MM3B 4US9A 1AW7A 1VLBA 4B0MA 1F2RC 1HZ6A 4USAA 5HI1A 1WGKA 1C9FA 3CWIA 1SEBD 2RPVA 1IUEA 2R61A 1K51A 3E9SA 3H8HA 1K53A 1EWCA 1L4ZB 1YN4A 4RGNA 1TY2A 2DLBA 1I4HA 1ACCA 3BVZA 4YSYB 1V1PA 5BYSA 4LK0M 3R8BA 4N6EB 4XDCA 5D3IB 4DXGA 1TJEA 1N61A 3HVZA 3Q8EA 4OZBA 2WDVB 1FNUA 5BYRA 1MPEA 4KGRA 1C79A 1TKYA 1P7FA 1I4GA 5G5GA 2LGIA 1UWMA 3ZQ4A 2HDEA 2JSVX 4OZAA 4LLGM 1JMLA 2KMMA 2PLPA 4JWUC 4DXFA 1YMHE 1B1ZA 2AQ2B 4L23A 2WNMA 2QSDA 2SAKA 1PFDA 5LNK1 4D2KA 1PGXA 2XNAC 3L4PA 2JXTA 2I38A 5AUIA 1MHXA 2K5PA 4ZHOA 1BUIC 2Z8LA 4CQNA 3BK2A 2MEKA 1ZPSA 4RNAA 1MI0A 2L52A 3OWEB 3AEGB 2JWUA 5MPOA 1J7AA 4ARCA 1L0VB 4NJCA 4YSXB 3KLSX 3BVMA 1VRAB 2L83A 4HKQA 2M56B 2QJLA 3P4SB 1SE4A 1C76A 3RFZB 1KTKA 4OZCA 4XE0A 4YTPB 3SFEB 3WCQA 4H2AA 3NZ3A 1D5ZC 2WXJA 3T3NA 1SSNA 1TS5A 1FO4A 4WAFA 4PT5A 2EELA 2DYOA 2V0GA 1L6VA 5E6JA 4WIPA 1J7BA 1I4PA 1XO3A 2QMTA 1OFFA 5JXVA 3NRZA 1FEHA 3MFGA 2PIAA 4RCOA 1UUPA 2WXMA 1F77A 2WXKA 4HRSA 4EE2A 1JWMD 1F2RI 4A90A 1K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 B;  1YJJ A;  3VRA B;  4N58 A;  3CF4 A;  3EUB 2;  1FRD A;  2AX5 A;  4YT0 B;  3NVY A;  5EE1 A;  1N60 A;  5C3J B;  1CZP A;  1VJK A;  1KFY B;  1WXQ A;  2WP9 B;  1JWA D;  4N59 A;  1DGJ A;  3W9C B;  2ACZ B;  1VDV A;  2WS3 B;  2WQY B;  2MH7 A;  1DOX A;  1JAL A;  3P4P B;  2H88 B;  3AEF B;  1RFK A;  3HUI A;  1NYR A;  1YQ3 B;  3LXF A;  2Y5C A;  1RYJ A;  4US9 A;  1JQ4 A;  1VLB A;  1FXI A;  2K22 A;  1L5P A;  2WLB A;  1N5W A;  3NVV A;  4USA A;  1FMA D;  5GXG B;  1NI3 A;  1E0Z A;  1WGK A;  4LTU A;  1ROE A;  4YSZ B;  1R7S A;  3CWI A;  1AWD A;  2KAJ A;  2MJE A;  1SB3 C;  4P6V F;  5H92 C;  1JW9 D;  1B9R A;  1QOF A;  1IUE A;  1WYG A;  3AN1 A;  1E9M A;  3FC4 A;  1A70 A;  4C7Z A;  3DWG C;  1SIJ A;  3VR9 B;  1GAQ B;  2K9X A;  2OHF A;  1XLN A;  3AEC B;  1N5X A;  1V97 A;  1I7H A;  1T3Q A;  3AEA B;  3VRB B;  3FAH A;  1J7C A;  2MJD A;  3NVZ A;  2WDQ B;  1GTE A;  2JX5 A;  2BS3 B;  4YXD B;  4YSY B;  2MJ3 A;  1WWT A;  3AM9 A;  4N6E B;  4WWM A;  2BS4 B;  1DOY A;  1TJE A;  1N61 A;  2JQR B;  3HVZ A;  2WDV B;  2W3R A;  3DWM A;  1ZUD 2;  2PVO D;  1XLO A;  4US8 A;  1TKY A;  3PO0 A;  1TKE A;  2FBW B;  5G5G A;  1FFU A;  1KRH A;  1WRI A;  3AEB B;  4WQM A;  1UWM A;  1FFV A;  2W55 A;  1L6U A;  1QF6 A;  1EWY C;  2KMM A;  1ZOY B;  2W54 A;  3ABV B;  3LB8 C;  4JWU C;  1GT8 A;  3B2F A;  1SF0 A;  2WDR B;  2PVG C;  2G1E A;  3SR6 A;  4JWS C;  3AE5 B;  2H89 B;  3AE2 B;  4IDI A;  2BS2 B;  1DOI A;  4ITK A;  4C7Y A;  1PFD A;  1YJI A;  3AE8 B;  1JRP A;  2BT6 A;  1YQ4 B;  4HRO A;  1GTH A;  1E6E B;  1QT9 A;  1XLP A;  5EE0 A;  4YTM B;  1NVI D;  1JWB D;  3L4P A;  1JRO A;  4ZHP A;  1H7X A;  1TYG B;  5AUI A;  1FXA A;  2K5P A;  1OQQ A;  3W5V B;  3P4R B;  4ZHO A;  1N63 A;  5AUK A;  3AEE B;  3B2G A;  3AE4 B;  1QLB B;  2L52 A;  3ZYY X;  1RWS A;  2DWQ A;  3P1M A;  1KF6 B;  1TKG A;  3AEG B;  1NEK B;  3P4Q B;  2DBY A;  3AE9 B;  2M19 A;  5MPO A;  1J7A A;  1GPX A;  2HTM E;  2W3S A;  1FM0 D;  4ZOH C;  4KX6 B;  1L0V B;  5EE3 A;  4YSX B;  3RPF C;  1H7W A;  1RM6 C;  2L83 A;  3KWL A;  1E7P B;  2B76 B;  3NVW A;  2M56 B;  1V8C A;  2QJL A;  3P4S B;  3BII D;  3ETR A;  2CJN A;  3AMZ A;  3AB5 A;  3AV8 A;  4C80 A;  1NYQ A;  1QOB A;  2CU3 A;  2QIE B;  1FRR A;  2N0S B;  3B9J A;  3SFD B;  3HRD D;  5EE9 A;  3W5U B;  4YTP B;  3SFE B;  3WCQ A;  3P63 A;  4FXC A;  3AH7 A;  1AYF A;  5C2T B;  2Q5W D;  2PKO A;  4A9A A;  1NEN B;  1N62 A;  1ZP0 B;  5H8Y E;  3AE6 B;  1E10 A;  1ZXI A;  4JX1 C;  1FO4 A;  2WU2 B;  3VR8 B;  5G5H A;  3CIR B;  1L6V A;  3AE1 B;  1J7B A;  1XO3 A;  1QOA A;  3AE7 B;  1FIQ A;  2WU5 B;  2LEK A;  3NS1 A;  1XLQ A;  1OFF A;  1OQR A;  1PDX A;  3NRZ A;  1CJE A;  2PIA A;  4HRS A;  1PUT A;  1F0Z A;  2CJO A;  4YTN B;  2EKI A;  3AED B;  2E3T A;  1QOG A; 
#chains in the Genus database with same CATH topology
 3ZXV A;  4GMV A;  5C3J B;  1JWU D;  2K8H A;  3TJP A;  4RH6 A;  1YD8 U;  2MJE A;  4I6N B;  4G3X B;  3H7S A;  2KDI A;  1WYG A;  2KC1 A;  4HJG E;  3FC4 A;  4P1C C;  5BMG A;  1WE6 A;  2FCQ A;  1N5X A;  2IO1 B;  3ZIM A;  1I7H A;  1SBB B;  3RNB C;  2JX5 A;  3KYC D;  4A6Q A;  4YXD B;  4ASW C;  2D5G A;  3AM9 A;  5HG2 A;  3DWM A;  4RF1 A;  3SEB A;  3PO0 A;  1VZ6 A;  1L2N A;  4WQM A;  4R3D A;  1WXM A;  2X38 A;  1OTR B;  2WWZ A;  4MH0 E;  3IHP C;  1XCQ L;  2XBB C;  1ZXH A;  3DBL B;  2DYM A;  2KQ4 X;  1PYW D;  1GTH A;  1D5M C;  1XLP A;  3EEC A;  3L0W B;  4FUL A;  3VUX A;  2MP2 A;  4KV2 A;  3AEE B;  1BXT A;  3TUO A;  3AE4 B;  2BWF A;  1WI0 A;  1WR1 A;  1D5X C;  2NBW B;  1E7P B;  3N30 A;  3UGB B;  5L83 A;  3H7P A;  4MGI E;  2CU3 A;  5EE9 A;  1SXT A;  3GE8 C;  4ICU A;  1P0R A;  2N9L A;  2V9H A;  1ZP0 B;  4REZ A;  1IGC A;  4BBN F;  3VR8 B;  2ZVO A;  5G5H A;  3ZVV A;  4FA6 A;  1QOA A;  2L0T A;  3BYY B;  1A5R A;  3SU8 X;  3APD A;  2IO0 B;  2BYT A;  1YX5 B;  4BZA A;  1R4M I;  2RDG A;  4ZRP A;  1PUT A;  2IPK D;  2K0P A;  1C4A A;  3VH3 B;  4RMA A;  5LXI B;  3RNC C;  2VH1 A;  2E3T A;  3U52 E;  4TSS A;  1WJ4 A;  3A1Q A;  1EM7 A;  1MFW A;  3W9C B;  4KGT A;  4YWG G;  3PHX B;  3D32 A;  1D6E C;  3PVL A;  3NVV A;  5GXG B;  1T0Y A;  1WZ3 A;  2FID A;  3VH4 B;  4JGH B;  3ML9 A;  1JW9 D;  1UGJ A;  3Q69 A;  4DHJ D;  3VTW A;  3Q14 C;  4OVU A;  3E56 A;  2KQ7 A;  4GDL B;  1LO5 D;  3N1Y C;  2WXI A;  3KVF B;  1QKZ A;  1P9D U;  1C78 A;  2LUM A;  4BOS C;  1WRI A;  4BAX A;  2K8B A;  1QF6 A;  2KZR A;  1T6B X;  3ABV B;  2KMC A;  1L0X B;  4JWS C;  4ITK A;  2XN9 C;  2LVP A;  1YIW A;  2G9H D;  1WX7 A;  2KAC A;  4W9L A;  1FXA A;  1OQQ A;  3U7Z A;  1L4D B;  2LWP A;  2NPT B;  2J0K A;  2YLM A;  4WJN A;  2M19 A;  2DBY A;  2BGF A;  3AE9 B;  2KFJ A;  4KX6 B;  1TBE A;  3NVW A;  1WY8 A;  2IY1 B;  3AMZ A;  2GI9 A;  3AV8 A;  5IA7 A;  2HJ1 A;  3W5U B;  1HE8 A;  1K8R B;  3AE6 B;  2JYT A;  3ZNZ B;  3ZNH B;  1FNV A;  3NZU A;  2SEB D;  1EO6 A;  4B0E A;  1CK1 A;  3U8Z A;  1GJZ A;  2O6V D;  1PDX A;  1XD3 B;  2ZVN A;  2L05 A;  3K9P B;  4N58 A;  5AUK A;  4FLH A;  4CO7 A;  4W9C A;  2JF5 A;  5FKA C;  1P98 A;  3A9J A;  1RFK A;  1KOT A;  2LJI A;  3UF8 A;  3QHT A;  2AQ1 B;  1AN8 A;  1R4M B;  4A8X C;  3J9C A;  1NBF C;  4IG7 B;  4EZJ A;  1UWX A;  1XF5 L;  2PPH A;  2K39 A;  4M8M A;  3DWG C;  2IGH A;  4YL8 A;  3VRB B;  2ICI A;  4I6P A;  1KH0 A;  5HHD G;  1MG4 A;  2INN E;  5FK9 C;  1ZUD 2;  3MJW A;  4K7W A;  2PVO D;  2WYQ A;  2JUO A;  2JYE A;  3AEB B;  2PMV A;  3WA0 A;  1EWY C;  3T8M A;  1WXS A;  2GBR A;  2NVU I;  4LDT B;  5JH5 C;  2M4N A;  1CQV A;  3MHZ A;  4EFO A;  2H89 B;  2BS2 B;  4C7Y A;  3ZJV A;  1D3Z A;  3C0R B;  3AE8 B;  2BT6 A;  2NS5 A;  3SDL C;  2ZJD A;  3IVF A;  5L95 C;  4HPP A;  3W2D A;  1JCK B;  1F9J A;  2FNJ B;  1EUV B;  4WWO A;  3L13 A;  2WXP A;  1RWS A;  1I4X A;  2MBB B;  5HFY A;  1GPX A;  5DPS A;  3RPF C;  1SJH D;  2G45 B;  3KYD D;  2M0A A;  1UBI A;  2D10 A;  3SFD B;  3Q8B A;  3ZTC A;  2K3U A;  2WXL A;  2Y5B B;  2KFK B;  2GBM A;  4WH4 A;  3C19 A;  3ML8 A;  5H8Y E;  2L0F A;  2XK5 A;  1TS2 A;  1KLU D;  4S0R A;  5TR5 A;  1YNT E;  1WGY A;  3DOW A;  1GG3 A;  4C4V B;  4ANW A;  1KJT A;  2LUE A;  4XWT A;  1LXD A;  1FCL A;  2BYV E;  1YJ1 A;  2WS3 B;  1KLV A;  3P4P B;  2KWV B;  1VLB A;  4B0M A;  4G0N B;  4K1R B;  1J19 A;  1C9F A;  5IKC M;  2BWE S;  2RPV A;  1IUE A;  3E9S A;  2WGS A;  2EMT A;  1K53 A;  1EWC A;  2DAF A;  2N9P C;  5JHA A;  2K6Q A;  2DZJ A;  1VCB A;  2MSE D;  3BVZ A;  5EDS A;  4LK0 M;  5AEK B;  3WAM A;  5D3I B;  1TJE A;  1FNU A;  2PJH A;  1OEY A;  4CHK A;  4KGR A;  1RAX A;  1G6J A;  2N1W A;  2LGI A;  1UWM A;  3HM3 A;  1WJU A;  2PLP A;  2O2V B;  4EUT A;  4EZK A;  3Q3M C;  4EKU A;  4JL9 A;  1PFD A;  5LNK 1;  3RNE C;  1PGX A;  2XNA C;  2JXT A;  2I38 A;  2NBU A;  1BUI C;  2Z8L A;  3BK2 A;  1ZPS A;  1GC6 A;  4W9E A;  2M17 A;  3VUW A;  1GC7 A;  2DZI A;  2KT7 A;  2JWZ A;  3HHM A;  1J7A A;  4ARC A;  1E90 A;  4ZRI A;  4WQO B;  3PLU A;  5C1Z A;  4NJC A;  4YSX B;  3VUY A;  2M56 B;  1KTK A;  3SFE B;  3WCQ A;  3NZ3 A;  2B3A A;  5JZE B;  1TS5 A;  1TT5 B;  5IO9 A;  3PHW B;  1I4P A;  4HXD A;  2ASQ A;  4ZRK A;  3I3T B;  2LD9 A;  1HTQ A;  4RCO A;  1F77 A;  2WXK A;  4HRS A;  2KNB A;  4EE2 A;  4YTN B;  3VVW B;  2MW5 A;  4GDL A;  2LFI A;  3CF4 A;  1FCC C;  4TV3 A;  2WP9 B;  2ACZ B;  2BTE A;  2WQY B;  2Z59 B;  4A3P A;  4KIK A;  3TBL D;  4BBN C;  2LVO A;  4II2 B;  1R4N I;  2ZNV B;  1HZ5 A;  1T0R C;  2IZV B;  2KTF A;  3LJ3 A;  4DDI D;  1J8C A;  1WMH B;  4C7Z A;  3ZRF A;  3FIL A;  4M0W B;  2V3N A;  1I35 A;  2MJ3 A;  2KJR A;  2WXG A;  3ZTD A;  2NPT A;  1Z2M A;  2LXC A;  2D11 A;  4BVU C;  2W55 A;  2KTR A;  3W1S A;  1IPG A;  3TEZ A;  1GT8 A;  2ZEQ A;  2WDR B;  2LVQ A;  2GRI A;  3SR6 A;  3V3X A;  2WX1 A;  2C7M B;  1PQS A;  1JRP A;  4L1B A;  3S2A A;  4GDK A;  1QT9 A;  5KHQ A;  2WHI A;  3C8Y A;  1NVI D;  1JWB D;  3IFW B;  4URK A;  4GGQ A;  2FE8 A;  4XC2 A;  1ZDX A;  3B2G A;  3TIX A;  3QC8 B;  3MC9 A;  1EF1 A;  1XEE A;  1SJE D;  1Y56 A;  2B76 B;  1VZ8 A;  3BII D;  4IWQ A;  4F8C B;  1I4Q A;  3M3J A;  3DHG C;  5TSS A;  3KUC B;  1NEN B;  3ECI A;  4DHZ E;  2YEP F;  3IG3 A;  3AE7 B;  1FD6 A;  3KW5 B;  4QAY A;  4KSL C;  1HEZ E;  4AS1 A;  2WXN A;  2WXR A;  1N5W A;  4DHZ B;  3UI3 A;  3I57 A;  3EUB 2;  3PZ8 A;  2BBC A;  1DYQ A;  2NTT A;  4TQ1 A;  4YSZ B;  1R7S A;  1TY0 A;  1B9R A;  1WXV A;  4MT5 A;  1VD2 A;  4WJP A;  4A55 A;  4HCN B;  3SD5 A;  1M94 A;  2LJ5 A;  3X0W A;  3TEW A;  2ZPN A;  4MEM A;  4XYC A;  1EU3 A;  3U30 A;  1IBX B;  5G55 A;  4IM0 A;  4W9D A;  1MVK A;  2JT4 B;  3L08 A;  2DNF A;  4K81 A;  2JXX A;  1SF0 A;  3BWU D;  2LGX A;  3PRZ A;  2J53 A;  4ZRJ A;  1JRO A;  2QEJ C;  1H7X A;  2UU7 A;  5J2R A;  1WF9 A;  1E7V A;  3N32 A;  4W9I A;  1UF0 A;  2IND C;  4TQ0 A;  4GLS C;  1GNU A;  4DBG A;  1NEK B;  1FM0 D;  3M63 B;  2L8J A;  5FR3 A;  3RNA C;  4K7S A;  3NG0 A;  5DPW A;  3AB5 A;  1KLG D;  3Q8F A;  5C2T B;  1T0S C;  1SE3 A;  4KDI C;  2WXO A;  1ZGU B;  2CU1 A;  4JLC A;  1UH6 A;  4F1S A;  4NJ7 A;  5JHB A;  4HPM B;  3BYT B;  1IGD A;  2MWS B;  3ZJT A;  3RNF C;  4YT0 B;  1VJK A;  4W9J A;  4C00 A;  3A9K A;  2RR9 A;  3B0A A;  2JZP A;  2AEH A;  2KHW B;  3UIN B;  1E8Y A;  3LXF A;  4DHJ B;  3ZNG C;  3ZW3 A;  4LCD E;  1FMA D;  3LYY A;  2KAJ A;  2N9K A;  3BVG A;  2LI5 A;  1BT0 A;  2MBH A;  1A70 A;  2K9X A;  3T3O A;  2LMC A;  3ZUN A;  1FPY A;  3P42 A;  1WGR A;  4CYE A;  2KQS A;  4K3C A;  1WM3 A;  4TKN A;  3NHE B;  4JIO U;  4II3 B;  4US8 A;  3QK0 A;  1TKE A;  1P1A A;  4FBJ B;  2W54 A;  5CHW A;  2LRW A;  3B2F A;  4HCP B;  2DX5 B;  3AE5 B;  4RF0 A;  2BB5 A;  3R7R A;  4HRO A;  1E6E B;  1WX9 A;  2KO3 A;  2L1A A;  3IAM 1;  4AJW A;  1F52 A;  4B95 A;  2KLC A;  2KWD A;  5HKH A;  2V1Y A;  1QLB B;  2KMA A;  4WAA A;  2FCS A;  4FJV B;  2CS4 A;  4PYZ A;  1GB1 A;  1WE7 A;  2RDB C;  3VAW A;  2K8C A;  1C1Y B;  3AH7 A;  4AQ7 A;  2O6V B;  3CF6 E;  4JE3 B;  4NAW B;  1V86 A;  3R7Q A;  3DBS A;  2JY6 A;  5G2N A;  3CIR B;  3AE1 B;  1E8W A;  3R2T A;  1XLQ A;  3L16 A;  1OQR A;  3U7D A;  2IGG A;  2CHW A;  1ESF A;  4MGY E;  2IY0 B;  3WAO A;  3ZO5 B;  1XLN A;  2PE9 A;  4LNF A;  2LHE A;  2KWC A;  2FIF A;  2J4X A;  5AZG A;  3KQ4 A;  1TS3 A;  4HPL B;  4MM3 A;  4US9 A;  1AW7 A;  4USA A;  3I63 C;  3V62 A;  3CWI A;  3VXW A;  3QIJ A;  1IYF A;  1K51 A;  5IN7 A;  1L4Z B;  2I1J A;  2V3S A;  1YN4 A;  1TY2 A;  4BKG A;  4NQK E;  2YVC A;  1WFY A;  1OQY A;  1TTN A;  3Q2A C;  3T9L A;  5LLI A;  4YSY B;  5BYS A;  3HVZ A;  2K25 A;  1C79 A;  2GBN A;  2D3B A;  2JZZ A;  3ZQ4 A;  4OZA A;  3TCA A;  4LLG M;  4JWU C;  4DXF A;  3RMK C;  2WDT B;  2AQ2 B;  2FCN A;  2QSD A;  1WZ0 A;  4P7I A;  2ZCB A;  3QJZ A;  3L4P A;  3A4R A;  2K5P A;  4ZHO A;  3IBE A;  2CKH B;  4IM3 A;  4HK2 A;  1MI0 A;  4AOF A;  3OWE B;  4IM2 A;  2AWT A;  4LJO B;  1L0V B;  4BOZ B;  1VRA B;  2L83 A;  2QJL A;  1SE4 A;  1C76 A;  4OZC A;  4YTP B;  1D5Z C;  2AL3 A;  4MJS B;  4ANX A;  4K3B A;  2DYO A;  4WIP A;  1J7B A;  1XO3 A;  2QMT A;  1OFF A;  3DQV A;  2HE7 A;  2PIA A;  1UUP A;  2WXM A;  1WIA A;  2V4L A;  2A5U A;  4A90 A;  4KSK C;  2CHZ A;  3QAQ A;  1C77 A;  1FRD A;  1N6Z A;  2L7R A;  1CZP A;  1V80 A;  4BKS D;  1JWA D;  2M1M A;  1VDV A;  2MH7 A;  1Y8R C;  1JAL A;  4PS7 A;  1WSP A;  2WLB A;  3NJT A;  4WJQ A;  3PRE A;  3PSE B;  1J0G A;  2GBK A;  1TS4 A;  1PGA A;  3VR9 B;  1GAQ B;  4G50 A;  1QIL A;  4HDO A;  3BY4 B;  4LNN A;  1U4A A;  2BS3 B;  3QCA A;  1DOY A;  2BS4 B;  2MQJ A;  3AU5 A;  3H9D A;  3WAN A;  1NDD A;  2WXQ A;  2PW9 A;  3V6C B;  3V05 A;  2BW2 A;  1ZKH A;  3AE2 B;  4GB9 A;  3V61 A;  5BYQ A;  3CST A;  2DZM A;  4J3O D;  2KX0 A;  1S1Q B;  2MP2 B;  3KWV A;  1V9J A;  3Q8A A;  3W5V B;  4ZDV A;  2HTH A;  1N63 A;  4FJY A;  2KN5 A;  3Q3F A;  3I5J C;  2W3S A;  4HJK A;  2FUH B;  4KZC A;  3DBH I;  1YN3 A;  1FRR A;  2N0S B;  3MP9 A;  2NMQ A;  3P63 A;  1C3T A;  2J42 A;  3R2I A;  1N62 A;  3VHT C;  2KKC A;  2JRH A;  4JX1 C;  1TGZ B;  4MH8 A;  1FIQ A;  3ZNI D;  3AED B;  3PTF C;  2JRI B;  5EE1 A;  1I4R A;  1VZ7 A;  2AX5 A;  3A1Q B;  2D3A A;  4MGK E;  1WYW B;  3QWZ B;  4IC7 B;  4S17 A;  1YQB A;  4W9G A;  1NYR A;  1UNS A;  1YQ3 B;  4OVZ A;  4PS8 A;  2M8S A;  2LRU A;  2BYF A;  2KDE B;  1ROE A;  3RUI B;  1P7E A;  1PGB A;  3PLV A;  4NNJ B;  4J6I A;  4MAC A;  2MBQ A;  2KWU B;  2VRR B;  2DZK A;  2WXH A;  3Q8C A;  2MRP A;  3CMM B;  3ALB A;  4GSW A;  3FAH A;  3OAW A;  3MHS D;  2WDQ B;  1L7Y A;  5CTR C;  2KOX A;  2C5L C;  1WWT A;  4HLE A;  1MG8 A;  4FN2 A;  3P2B A;  2Y3A A;  2UYZ B;  3RD2 A;  1ZW7 A;  2V3P A;  1ZDV A;  3AXC A;  1GOZ A;  3LB8 C;  1F1H A;  2ZPY A;  4HVB A;  2D2Q A;  1L0Y B;  2DYB A;  2HD5 B;  2LAS A;  2GOW A;  5EE0 A;  4YTM B;  4NAW A;  2FCM A;  2QHO A;  3ZLZ A;  2GLS A;  5E6N A;  4RM9 A;  2GMI C;  3DVG X;  1TKG A;  1QZE A;  2LZ6 A;  4M01 A;  3VDZ A;  4MDK E;  3RI7 C;  5CHV C;  1NYQ A;  3RZW C;  2J52 A;  3B9J A;  4W9F A;  2LHD A;  1E7U A;  2ZW0 A;  2J7Q B;  2BKR B;  1E8X A;  3DBH B;  1QQR A;  1FXT B;  3NS1 A;  3CSF A;  3RYT A;  3QQ8 B;  1V1O A;  3JSV B;  3TEX A;  3V60 A;  1XT9 B;  3ETR A;  3AE3 B;  3VRA B;  3GZN I;  1VR9 A;  3GP7 A;  4WJO A;  3UQA A;  3A9J B;  1JWS D;  4O1N A;  2MLB A;  3U2S C;  1ZE3 D;  1L5P A;  2OED A;  2C9W B;  2BKF A;  5E6O A;  1QOF A;  4LNK A;  4HWI B;  4EOY A;  2KDM A;  4RGO S;  1T3Q A;  3Q6B A;  3AEA B;  2IJ0 A;  2G3Q B;  1J7C A;  2EKE C;  4N9F 4;  2VZK B;  4M8N A;  4TUU A;  1NI2 A;  2JQR B;  1ENF A;  2R2Q A;  1XLO A;  2FBW B;  2N9E B;  5BMI A;  1KRH A;  3HVD A;  1ZOY B;  3B08 A;  3DHH C;  4Q2J A;  2BF8 B;  1R4N B;  4HEA 1;  2KLG A;  2WX0 A;  5FR6 A;  3P4R B;  1UEL A;  1V6E A;  2L3Z A;  3R66 C;  1UBQ A;  2VZK D;  3DBR I;  1UZX B;  3DCG A;  1CMX B;  5KHO A;  5EE3 A;  2KJH B;  1H7W A;  4NZL B;  3PZD A;  4P16 A;  4XWW A;  3HK0 A;  3UIO B;  2KFK A;  2MBO A;  2PKO A;  4A9A A;  1V5T A;  1STE A;  1E10 A;  4F7Z A;  2XK5 B;  1WRD B;  3L54 A;  5CHF A;  3PZ7 A;  2NBV B;  4KKI A;  2KAN A;  2KDB A;  1WGD A;  1H8C A;  3WAL A;  3NUH B;  1F0Z A;  4C4V A;  4IWP A;  4K7U A;  3TEY A;  5I4D A;  1QOG A;  1XXG A;  4E74 A;  1N60 A;  4N59 A;  3RT3 B;  1OGW A;  1DGJ A;  1TZO A;  3OJ3 A;  4I6L B;  3EFU A;  3WIM A;  4B6W A;  1F2R C;  1HZ6 A;  1WGK A;  1SEB D;  2KVR A;  3GZN B;  2BQQ A;  2QCZ A;  2R61 A;  3PT2 B;  2DLB A;  2PEA A;  2KXJ A;  4WWN A;  2J0J A;  2KX3 A;  4GXB A;  1ACC A;  1UD7 A;  4DXG A;  4XDC A;  3Q8E A;  4OZB A;  2WDV B;  5BYR A;  1TKY A;  1P7F A;  1I4G A;  2KJ6 A;  2HDE A;  2JSV X;  3L17 A;  1JML A;  2OJW A;  1WX8 A;  1YMH E;  1TZ1 A;  1YX6 B;  2O2V A;  2N4F A;  1B1Z A;  3L10 B;  4D2K A;  2C7H A;  2FAZ A;  2L76 A;  5BO4 B;  4IW0 A;  2MEK A;  4P1B C;  2XEW A;  5CX3 A;  5AZF A;  3TL5 A;  2NR2 A;  1LQB A;  1E8Z A;  2L52 A;  3W1S C;  2JWU A;  5MPO A;  3O65 B;  4WWP A;  3DVG Y;  4M02 A;  4FHK A;  1IP9 A;  2ZZP B;  5GMV A;  3BVM A;  4HKQ A;  2CHX A;  1RRB A;  3P4S B;  4DK5 A;  3RFZ B;  4MGZ E;  1HTO A;  4XE0 A;  3DBR B;  4H2A A;  2K1F A;  2MX2 A;  2WXJ A;  3T3N A;  2IO3 B;  1AAR A;  2EEL A;  2V0G A;  5E6J A;  5E6P A;  1H4R A;  1JRU A;  3NRZ A;  3MFG A;  2R2O A;  4KDL B;  1JWM D;  4EZL A;  1K52 A;  3K9O B;  1YJJ A;  3NVY A;  3IT4 B;  1KFY B;  3Q3N C;  3U4E G;  4KIK B;  2QC8 A;  2X8X X;  2H88 B;  2PTL A;  4PK1 A;  1RYJ A;  2I1K A;  1FXI A;  2K22 A;  2UWQ A;  3VQI A;  1X1M A;  3NS8 A;  1WR6 E;  1S3S G;  1WJ6 A;  3VTV A;  1SGH A;  1WMH A;  2ONQ A;  2IO2 B;  2OHF A;  3AEC B;  3RZF A;  4AP4 C;  3DHI C;  3FIL B;  2MA9 B;  3IT6 B;  4IOI E;  2QDF A;  1GTE A;  3GS2 A;  1WH3 A;  4M0W A;  2IDY A;  3MJ5 A;  4ICV A;  4RGT A;  3RNG C;  1BML C;  4UDU C;  3EHV A;  3M95 A;  3BK1 A;  2W82 A;  1EU4 A;  2KTR B;  1FFV A;  2IBI B;  3EC8 A;  3NZS A;  3WAP A;  1T5X D;  1RLF A;  2REX A;  2GB1 A;  2G1E A;  2LGS A;  4TMA B;  5D94 A;  1LGR A;  2BB6 A;  3PRP B;  2KD0 A;  3RN9 C;  2OJR A;  3X23 A;  4GDK B;  3W1Y A;  1V5O A;  1K50 A;  4KZ0 A;  4NPN A;  1ET6 A;  1V1P B;  2G4D B;  4ANV A;  2AYO B;  2Y5P A;  4FAD A;  2FUG 1;  1GUA B;  2RD0 A;  3R3M A;  4IKG A;  3JSV A;  2DAJ A;  1HA5 A;  3KWL A;  2D3C A;  2KN4 A;  4C80 A;  4NAM A;  2KYW A;  2QIE B;  5T8I A;  3HIZ A;  3M62 B;  1V49 A;  2Q5W D;  3JW0 X;  5IP4 D;  1HXY D;  4KKJ A;  3NY5 A;  2N7J A;  1ZXI A;  3ENE A;  2WU2 B;  4G11 A;  1TIF A;  4MSQ B;  4OHJ A;  3FKY A;  3EA6 A;  2NTS A;  4ZYN A;  4AJY B;  2MBE A;  3PPA A;  4ACF A;  1SE2 A;  2L00 B;  4OVV A;  1C4P A;  3ZJU A;  4BKT A;  3AUL A;  4W9H A;  2QIL A;  3IXS A;  3QX1 A;  4WUR A;  3OJ4 B;  3RUL A;  1Q0W B;  1JQ4 A;  1C4C A;  1XQQ A;  2KC2 A;  1E0Z A;  2DEN B;  1NI3 A;  4LTU A;  1AWD A;  4L2Y A;  5H92 C;  1E9M A;  4NJ6 A;  5D7G A;  1V97 A;  3VFK A;  1M4V A;  2RMM A;  1ISN A;  3GB1 A;  3Q3J A;  3APC A;  4AWJ A;  1P3Q U;  2Z0E B;  2J0M A;  4WWM A;  1IBX A;  5IOI A;  3PV1 A;  1Q5W B;  3DPD A;  2RDH A;  1L6U A;  3AU4 A;  3EGR A;  2AL6 A;  2N9X A;  4HKZ E;  1DOI A;  1YJI A;  1YQ4 B;  1GB4 A;  2KVZ A;  2MCN B;  4ZHP A;  4LDT D;  4ZRQ A;  4DQO C;  1YN5 A;  4E71 A;  2JU6 X;  2C7N B;  2DWQ A;  5C23 A;  3P4Q B;  2MHJ A;  3N9Y C;  3ZRC A;  1RM6 C;  3GE3 C;  1WJN A;  4GN1 A;  4P6V F;  2Z0D B;  1Q1O A;  2CJN A;  2EMS A;  3H6N A;  4MEL A;  4IUM B;  4ZYS A;  3HRD D;  3UIP B;  4FXC A;  5D6J B;  2HJ8 A;  5J17 A;  3HM6 X;  3BZD B;  3IAS 1;  2KK8 A;  2LEK A;  4OW0 A;  3AI5 A;  1CJE A;  1SE9 A;  3OLM D;  3ZDM C;  4A20 A;  1Q10 A;  2CJO A;  2LGY A;  1RFA A;  2JVC A;  3H7P B;  3H1U A;  3A9K B;  1WXQ A;  1ET9 A;  4AUQ C;  3I9V 1;  4JPS A;  4PS3 A;  3URY A;  3HUI A;  2INP E;  3ZGZ A;  2Y5C A;  1MHH E;  2ZNV C;  2YEP B;  1Z5S B;  2CR5 A;  4ARI A;  4RGM A;  4BFR A;  1SB3 C;  4X57 B;  3AN1 A;  3O13 A;  2ON8 A;  2RSU A;  1SIJ A;  1D4B A;  3ZKJ C;  2WXF A;  1HQR D;  4KGS A;  2A4Z A;  2ZW1 A;  3KH0 A;  5DPT A;  2MJD A;  3NVZ A;  1FNW A;  3BIN A;  3N3K B;  2W9N A;  2IYD B;  4B9K A;  2AQ3 B;  2W3R A;  5J18 A;  2N1V A;  2LGD A;  3ONS A;  2DHZ A;  1XCT L;  1WM2 A;  3TMP B;  3DVN U;  1FFU A;  2D07 B;  2BPS A;  2JPH A;  3A33 B;  2PVG C;  2K6D B;  4IDI A;  4XGA B;  4KVG B;  3Q3O C;  2JZ3 B;  4FHJ A;  1TYG B;  3TSS A;  1EF5 A;  4XDD A;  2NCN A;  2L32 A;  3ZYY X;  3P1M A;  4DDG D;  1KF6 B;  1OEY J;  2HTM E;  4ZOH C;  2V4I B;  1KM7 A;  3QAR A;  1V8C A;  3MC0 B;  1QOB A;  5BMH A;  5DCN A;  2D3G A;  3V6E B;  4MSM B;  1AYF A;  2BYE A;  2O6V A;  2IGD A;  4C56 C;  3VTU A;  2E6X A;  1WXA A;  3N1Z C;  4LNI A;  4RM8 A;  2RGF A;  4RFB A;  2WU5 B;  3QA8 A;  5D3D A;  2TSS A;  3SHQ A;  3NOB A;  2GBJ A;  3KUD B;  2EKI A;  1UGM A;  4HDQ A;  3N1X C;  2VH2 A;  4GOC A;  2INC C;  4IWO A;  1DOX A;  2I2Y A;  3AEF B;  4MM3 B;  4GIV A;  4GU2 A;  2PE6 B;  3PS6 A;  5HI1 A;  3MC8 A;  4EEW A;  1T0Q C;  2N7D A;  3MTN B;  3H8H A;  3A4S C;  1I42 A;  4RGN A;  1E5W A;  3ZXR A;  3UQB A;  1I4H A;  2ZCC A;  2G4S A;  4XZ4 A;  5LXH A;  1V1P A;  3R8B A;  4N6E B;  3DBL I;  1N61 A;  4DXA B;  3GOE A;  1MPE A;  2BVC A;  5D2M B;  5G5G A;  3LDZ E;  1LM8 B;  1YOV B;  2C60 A;  2RPQ A;  3B1L X;  4ANU A;  5IAA C;  2KMM A;  3APF A;  5AZH A;  3DDC B;  4A3O A;  4NY0 A;  4DWF A;  4L23 A;  2WNM A;  2SAK A;  1SIF A;  4XX5 A;  1V81 A;  3EFC A;  2M0X A;  4NQL B;  5AUI A;  1MHX A;  1LFD A;  4M00 A;  2OOB B;  4CQN A;  3DVN V;  4RNA A;  3JYU A;  3AEG B;  4BKS A;  3PGE A;  2KDF B;  3KLS X;  3JVZ X;  2LXA A;  3KUZ A;  4PYU A;  4LJP B;  3PRM B;  1MJD A;  3OG5 A;  3ZDT A;  1WGG A;  1SSN A;  1WGH A;  4MJS A;  4LNO A;  3N20 C;  1FO4 A;  4WAF A;  2N7E A;  4PT5 A;  1L6V A;  1V2Y A;  4E3C A;  4FJZ A;  5JXV A;  1FEH A;  5DPR A;  4W9K A;  4JQW C;  1F2R I;  3RCZ A; 
#chains in the Genus database with same CATH homology
 1YJJ A;  2LFI A;  3CF4 A;  1C77 A;  1FCC C;  1FRD A;  3NVY A;  5C3J B;  1CZP A;  3IT4 B;  1KFY B;  2WP9 B;  1JWA D;  2ACZ B;  1VDV A;  2MH7 A;  2WQY B;  3U4E G;  2BTE A;  1JAL A;  2H88 B;  2PTL A;  1RYJ A;  1WSP A;  1FXI A;  2K22 A;  1JWU D;  3VQI A;  2WLB A;  1HZ5 A;  4RH6 A;  2MJE A;  2ONQ A;  1TS4 A;  1PGA A;  1WYG A;  3FC4 A;  4HJG E;  5BMG A;  4C7Z A;  3VR9 B;  1GAQ B;  2OHF A;  3AEC B;  1N5X A;  1I7H A;  3FIL B;  1QIL A;  3FIL A;  1SBB B;  3IT6 B;  4IOI E;  1GTE A;  2JX5 A;  2V3N A;  3GS2 A;  2IDY A;  4M0W A;  2BS3 B;  4YXD B;  2MJ3 A;  4A6Q A;  2D5G A;  3AM9 A;  3MJ5 A;  1DOY A;  2BS4 B;  5HG2 A;  4RGT A;  3DWM A;  2WXG A;  4RF1 A;  1BML C;  3PO0 A;  4UDU C;  3SEB A;  1VZ6 A;  3BK1 A;  2W82 A;  2WXQ A;  1EU4 A;  4WQM A;  4R3D A;  1FFV A;  2W55 A;  2PW9 A;  3W1S A;  3V05 A;  2X38 A;  1XCQ L;  1T5X D;  3TEZ A;  1GT8 A;  1ZXH A;  2BW2 A;  2WDR B;  2GB1 A;  2DYM A;  2G1E A;  2GRI A;  2KQ4 X;  4TMA B;  3SR6 A;  3AE2 B;  3V3X A;  1PYW D;  2BB6 A;  5BYQ A;  1JRP A;  4L1B A;  4GDK B;  1K50 A;  1GTH A;  1D5M C;  1QT9 A;  1XLP A;  4J3O D;  3C8Y A;  1NVI D;  1ET6 A;  1JWB D;  1V1P B;  2FE8 A;  3KWV A;  3Q8A A;  3W5V B;  1N63 A;  2Y5P A;  3AEE B;  1BXT A;  1ZDX A;  3TUO A;  3B2G A;  3AE4 B;  2FUG 1;  2W3S A;  4IKG A;  1D5X C;  1HA5 A;  1XEE A;  3KWL A;  1SJE D;  1Y56 A;  1E7P B;  2B76 B;  1VZ8 A;  2KN4 A;  3BII D;  1YN3 A;  4C80 A;  4NAM A;  2CU3 A;  2QIE B;  1FRR A;  1SXT A;  2N0S B;  3MP9 A;  5EE9 A;  1I4Q A;  2NMQ A;  3P63 A;  5T8I A;  2J42 A;  5TSS A;  2Q5W D;  2N9L A;  3R2I A;  1NEN B;  1HXY D;  1ZP0 B;  1N62 A;  4KKJ A;  4REZ A;  2N7J A;  1ZXI A;  4JX1 C;  1IGC A;  2WU2 B;  3VR8 B;  4MH8 A;  5G5H A;  2YEP F;  1QOA A;  3AE7 B;  1FIQ A;  4OHJ A;  3BYY B;  1FD6 A;  3EA6 A;  2NTS A;  1HEZ E;  2BYT A;  4AS1 A;  4ZRP A;  2RDG A;  1PUT A;  2IPK D;  2K0P A;  1C4A A;  2WXN A;  2WXR A;  1N5W A;  3AED B;  2E3T A;  3U52 E;  1SE2 A;  3UI3 A;  4TSS A;  5EE1 A;  1I4R A;  3I57 A;  3EUB 2;  1VZ7 A;  2AX5 A;  1C4P A;  1EM7 A;  3ZJU A;  3W9C B;  3PZ8 A;  4KGT A;  2QIL A;  3IXS A;  4YWG G;  2BBC A;  4WUR A;  1DYQ A;  1NYR A;  1UNS A;  1YQ3 B;  2NTT A;  1JQ4 A;  1C4C A;  4OVZ A;  4TQ1 A;  1D6E C;  3NVV A;  5GXG B;  1E0Z A;  1NI3 A;  4LTU A;  1ROE A;  4YSZ B;  1R7S A;  1TY0 A;  1AWD A;  1P7E A;  1PGB A;  4L2Y A;  5H92 C;  1JW9 D;  1B9R A;  1E9M A;  4MT5 A;  1UGJ A;  4MAC A;  4A55 A;  3Q69 A;  5D7G A;  1V97 A;  1M4V A;  2RMM A;  2WXH A;  3GB1 A;  3E56 A;  3Q8C A;  4GDL B;  3FAH A;  1LO5 D;  2WDQ B;  3TEW A;  2WXI A;  1EU3 A;  1WWT A;  4WWM A;  1IBX B;  1IBX A;  1QKZ A;  2Y3A A;  1C78 A;  2LUM A;  1MVK A;  2V3P A;  1WRI A;  1ZDV A;  1QF6 A;  2RDH A;  1L6U A;  1GOZ A;  1T6B X;  3ABV B;  3EGR A;  3LB8 C;  1SF0 A;  1L0X B;  3BWU D;  4JWS C;  4HKZ E;  1L0Y B;  1DOI A;  4ITK A;  1YJI A;  2J53 A;  2XN9 C;  1YQ4 B;  5EE0 A;  4YTM B;  1GB4 A;  1JRO A;  2G9H D;  4ZHP A;  4ZRQ A;  2QEJ C;  1H7X A;  2KAC A;  1FXA A;  1OQQ A;  4DQO C;  1YN5 A;  3U7Z A;  1L4D B;  4TQ0 A;  4GLS C;  2JU6 X;  2DWQ A;  1TKG A;  3P4Q B;  1NEK B;  2DBY A;  2M19 A;  3AE9 B;  3N9Y C;  1FM0 D;  4KX6 B;  5FR3 A;  1RM6 C;  3NVW A;  4P6V F;  2CJN A;  3AMZ A;  2GI9 A;  3AB5 A;  3AV8 A;  1NYQ A;  2J52 A;  3B9J A;  1KLG D;  3W5U B;  4ZYS A;  3HRD D;  2LHD A;  3Q8F A;  2ZW0 A;  4FXC A;  5C2T B;  3AE6 B;  2JYT A;  1FNV A;  3BZD B;  1SE3 A;  2WXO A;  3IAS 1;  2SEB D;  1QQR A;  2LEK A;  3NS1 A;  4B0E A;  1CK1 A;  4OW0 A;  1PDX A;  1V1O A;  1CJE A;  3TEX A;  1Q10 A;  2CJO A;  3ETR A;  3AE3 B;  4N58 A;  3VRA B;  1IGD A;  3BYT B;  5AUK A;  3ZJT A;  4YT0 B;  1VR9 A;  1WXQ A;  1VJK A;  3GP7 A;  1ET9 A;  5FKA C;  4YTN B;  2JZP A;  3I9V 1;  1RFK A;  4JPS A;  1JWS D;  3URY A;  2LJI A;  4O1N A;  3HUI A;  2INP E;  3ZGZ A;  3LXF A;  3U2S C;  2Y5C A;  1MHH E;  2AQ1 B;  1ZE3 D;  1AN8 A;  4A8X C;  1L5P A;  3J9C A;  2YEP B;  1FMA D;  2OED A;  3LYY A;  4ARI A;  4RGM A;  1UWX A;  2KAJ A;  1SB3 C;  2N9K A;  1XF5 L;  3BVG A;  1QOF A;  3AN1 A;  3O13 A;  2ON8 A;  1A70 A;  3DWG C;  1SIJ A;  2KDM A;  2K9X A;  2IGH A;  4RGO S;  3T3O A;  1D4B A;  1T3Q A;  2LMC A;  2WXF A;  1HQR D;  3AEA B;  4KGS A;  3VRB B;  2IJ0 A;  2ZW1 A;  3P42 A;  1J7C A;  2MJD A;  3NVZ A;  2ICI A;  2VZK B;  1FNW A;  1KH0 A;  5HHD G;  2INN E;  2JQR B;  2AQ3 B;  1ENF A;  2W3R A;  5FK9 C;  1ZUD 2;  2PVO D;  1XLO A;  4US8 A;  1XCT L;  1TKE A;  2FBW B;  5BMI A;  1FFU A;  1KRH A;  2JYE A;  3AEB B;  3HVD A;  2PMV A;  1EWY C;  1ZOY B;  2W54 A;  3B2F A;  1CQV A;  4Q2J A;  2PVG C;  3MHZ A;  4RF0 A;  3AE5 B;  2H89 B;  4IDI A;  2BS2 B;  4C7Y A;  2BB5 A;  3ZJV A;  3AE8 B;  4HEA 1;  2BT6 A;  4HRO A;  1E6E B;  2L1A A;  3W2D A;  1JCK B;  1TYG B;  3IAM 1;  3TSS A;  4XDD A;  3P4R B;  2L32 A;  2WXP A;  2KWD A;  1QLB B;  2VZK D;  3ZYY X;  1RWS A;  3P1M A;  1KF6 B;  1I4X A;  5HFY A;  1GPX A;  2HTM E;  4ZOH C;  5EE3 A;  1SJH D;  3RPF C;  1H7W A;  2V4I B;  4NZL B;  2M0A A;  1GB1 A;  1V8C A;  3MC0 B;  1QOB A;  5BMH A;  3SFD B;  3Q8B A;  2K3U A;  4P16 A;  4XWW A;  2WXL A;  3AH7 A;  1AYF A;  4WH4 A;  2PKO A;  4A9A A;  4AQ7 A;  4NAW B;  4JE3 B;  5H8Y E;  1STE A;  1E10 A;  2IGD A;  4C56 C;  1TS2 A;  2E6X A;  3PZ7 A;  1KLU D;  3CIR B;  3AE1 B;  4KKI A;  4RFB A;  2WU5 B;  1YNT E;  3R2T A;  5D3D A;  1XLQ A;  2TSS A;  1OQR A;  2IGG A;  3NUH B;  1ESF A;  1F0Z A;  3TEY A;  2EKI A;  4XWT A;  5I4D A;  1XLN A;  1QOG A;  1XXG A;  1FCL A;  2LHE A;  1N60 A;  4N59 A;  2J4X A;  1DGJ A;  2WS3 B;  1DOX A;  3KQ4 A;  1TZO A;  2I2Y A;  3P4P B;  3AEF B;  1TS3 A;  4MM3 B;  4US9 A;  1AW7 A;  1VLB A;  4B0M A;  1F2R C;  1HZ6 A;  4USA A;  5HI1 A;  1WGK A;  1C9F A;  3CWI A;  1SEB D;  2RPV A;  1IUE A;  2R61 A;  1K51 A;  3E9S A;  3H8H A;  1K53 A;  1EWC A;  1L4Z B;  1YN4 A;  4RGN A;  1TY2 A;  2DLB A;  1I4H A;  1ACC A;  3BVZ A;  4YSY B;  1V1P A;  5BYS A;  4LK0 M;  3R8B A;  4N6E B;  4XDC A;  5D3I B;  4DXG A;  1TJE A;  1N61 A;  3HVZ A;  3Q8E A;  4OZB A;  2WDV B;  1FNU A;  5BYR A;  1MPE A;  4KGR A;  1C79 A;  1TKY A;  1P7F A;  1I4G A;  5G5G A;  2LGI A;  1UWM A;  3ZQ4 A;  2HDE A;  2JSV X;  4OZA A;  4LLG M;  1JML A;  2KMM A;  2PLP A;  4JWU C;  4DXF A;  1YMH E;  1B1Z A;  2AQ2 B;  4L23 A;  2WNM A;  2QSD A;  2SAK A;  1PFD A;  5LNK 1;  4D2K A;  1PGX A;  2XNA C;  3L4P A;  2JXT A;  2I38 A;  5AUI A;  1MHX A;  2K5P A;  4ZHO A;  1BUI C;  2Z8L A;  4CQN A;  3BK2 A;  2MEK A;  1ZPS A;  4RNA A;  1MI0 A;  2L52 A;  3OWE B;  3AEG B;  2JWU A;  5MPO A;  1J7A A;  4ARC A;  1L0V B;  4NJC A;  4YSX B;  3KLS X;  3BVM A;  1VRA B;  2L83 A;  4HKQ A;  2M56 B;  2QJL A;  3P4S B;  1SE4 A;  1C76 A;  3RFZ B;  1KTK A;  4OZC A;  4XE0 A;  4YTP B;  3SFE B;  3WCQ A;  4H2A A;  3NZ3 A;  1D5Z C;  2WXJ A;  3T3N A;  1SSN A;  1TS5 A;  1FO4 A;  4WAF A;  4PT5 A;  2EEL A;  2DYO A;  2V0G A;  1L6V A;  5E6J A;  4WIP A;  1J7B A;  1I4P A;  1XO3 A;  2QMT A;  1OFF A;  5JXV A;  3NRZ A;  1FEH A;  3MFG A;  2PIA A;  4RCO A;  1UUP A;  2WXM A;  1F77 A;  2WXK A;  4HRS A;  4EE2 A;  1JWM D;  1F2R I;  4A90 A;  1K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...