1YQ4B

Avian respiratory complex ii with 3-nitropropionate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq4B01
1YQ4B 5MPOA 2BS3B 2PVOD 1ZUD2 2BT6A 1CZPA 3AE3B 2L52A 3AE8B 1J7AA 1NYRA 2Q5WD 2M19A 3HVZA 1GAQB 1KRHA 1XLPA 2E3TA 3B2FA 1L6UA 1NVID 1WWTA 2Y5CA 4LTUA 2BS4B 3NVVA 1NI3A 2WQYB 5EE9A 3AE4B 1NENB 3VR9B 2K9XA 4HROA 4JWUC 2MJEA 3CIRB 1XLQA 3AV8A 1B9RA 4YTMB 3ETRA 1GTEA 3VRAB 1XLOA 3W5UB 3AEEB 1E0ZA 5C2TB 3ABVB 1JQ4A 3CWIA 1FRDA 3NS1A 1JROA 2PKOA 1YJIA 3AE9B 3SFEB 1XLNA 2WLBA 1KFYB 1FRRA 1I7HA 1GT8A 2H89B 3AEAB 1N63A 1DOIA 2MH7A 4JWSC 3AEFB 1PDXA 1L5PA 2KMMA 4JX1C 2B76B 2HTME 1NEKB 1E10A 3RPFC 2BS2B 2WU2B 3KWLA 2CJNA 1YQ3B 1ZP0B 1RWSA 2L83A 5AUIA 2MJ3A 3AEGB 1N62A 4HRSA 1N61A 4YT0B 1TKYA 1OQRA 3VRBB 1WYGA 2KAJA 4YXDB 1FFUA 2H88B 3AE6B 1NYQA 4YTNB 1QT9A 1XO3A 1ZXIA 3AN1A 4N6EB 5AUKA 2DWQA 1R7SA 4USAA 1QF6A 2QJLA 2WDVB 1TKEA 1AYFA 4P6VF 1DOXA 2ACZB 3WCQA 3B9JA 2WDRB 2K5PA 1EWYC 5G5HA 1OFFA 2OHFA 1A70A 2PIAA 3AM9A 1PFDA 1QOBA 3W5VB 2DBYA 3AH7A 1FFVA 2WP9B 5C3JB 1E9MA 1VJKA 4WQMA 3ZYYX 4US8A 3P1MA 3AE5B 1L0VB 1RFKA 3B2GA 1SF0A 5G5GA 1KF6B 1E6EB 1H7XA 3NVYA 1TKGA 3NVZA 4WWMA 3BIID 2EKIA 3EUB2 2WDQB 3W9CB 4C80A 3AE7B 1FO4A 1H7WA 5H92C 1WXQA 1N5WA 1V97A 5EE3A 5GXGB 1DGJA 4ZHOA 1FXAA 1F0ZA 1YJJA 1FXIA 2M56B 1ROEA 2AX5A 3P4PB 4IDIA 3SR6A 4US9A 3SFDB 2W54A 1FMAD 1N5XA 4N58A 2W3SA 3HUIA 1ZOYB 3P4QB 1GPXA 4YTPB 3FAHA 3AECB 2WU5B 1T3QA 2PVGC 1N60A 1JWBD 3AEDB 1RYJA 3VR8B 1JW9D 4KX6B 2CU3A 1WRIA 1GTHA 1QOAA 3AB5A 2W3RA 3P4RB 3CF4A 1QOFA 4YSZB 1J7BA 1JRPA 1V8CA 4N59A 2MJDA 4C7YA 2CJOA 1FM0D 1JWAD 2W55A 1VDVA 3L4PA 3NVWA 1QOGA 3DWMA 3NRZA 2WS3B 3DWGC 3PO0A 1VLBA 2JX5A 3LB8C 4YSYB 4YSXB 1JALA 1TJEA 4A9AA 1AWDA 1L6VA 3AEBB 3AE2B 2N0SB 1RM6C 1E7PB 3P4SB 1J7CA 1SB3C 2K22A 2G1EA 2QIEB 4ZOHC 5EE1A 1IUEA 3AMZA 3LXFA 5H8YE 4C7ZA 1OQQA 1QLBB 2JQRB 2FBWB 5EE0A 1CJEA 1FIQA 1TYGB 3P63A 1WGKA 4ZHPA 4ITKA 4FXCA 3HRDD 1PUTA 1UWMA 2LEKA 3AE1B 1SIJA 3FC4A 1DOYA
chains in the Genus database with same CATH superfamily
1P7FA 3QA8A 2PVOD 1CZPA 1P9DU 2D07B 3QHTA 3HVZA 2K39A 2LVPA 3WAOA 1FNVA 3PHXB 3N9YC 3VR9B 4BBNC 3T3OA 2JT4B 1ET6A 4BBNF 2KWUB 1NBFC 2LUMA 1IYFA 3AU4A 2OEDA 5DPSA 2WLBA 2VH2A 2JZZA 2V3NA 5IO9A 1WIAA 2KVRA 2ZZPB 3RULA 2MJ3A 2KAJA 4IC7B 3RPFC 1YJ1A 4MJSA 3DHIC 2V9HA 2MBEA 5G5HA 3R7QA 2C9WB 1XD3B 2WXJA 2NBVB 1KF6B 4M8NA 3W9CB 2HJ1A 2WDQB 1JWSD 1DGJA 2PE9A 2PPHA 3DDCB 2WWZA 4KDIC 3RNBC 2O6VB 1FMAD 1VZ7A 1L4ZB 3P4QB 4YTPB 3FAHA 5IP4D 4O1NA 4JGHB 2DLBA 2K8HA 3BVZA 3V05A 2WXGA 1GTHA 2MP2A 1EO6A 4GGQA 4NQLB 3RNEC 2AQ3B 4NJ6A 1GB1A 1P0RA 3ZNID 3NJTA 1A5RA 4RMAA 1E8YA 3TCAA 4ZRKA 5H8YE 1IUEA 2OOBB 4ZYNA 3W1YA 3V3XA 4KKIA 5LNK1 1WZ3A 4MACA 2FIFA 3KUCB 1ZGUB 1V86A 1HXYD 2INPE 1RAXA 3OJ3A 3VQIA 1TS5A 1MG8A 4LDTB 4GIVA 4WJNA 3AE4B 1C79A 1WX9A 2MJEA 5LXIB 3VRAB 2MRPA 5LLIA 4M8MA 2KMAA 2JRHA 2WXRA 1L7YA 4GXBA 3NZ3A 2B76B 4UDUC 3KWLA 3TL5A 4ZYSA 3JVZX 3PLVA 1GPXA 5AZHA 4YXDB 3DBLB 2QHOA 2AQ1B 4RGNA 5DPTA 3JYUA 4RM8A 3AULA 3RYTA 4WWNA 4KIKA 3RD2A 3AH7A 5LXHA 1F2RC 1SE4A 4XWTA 3Q2AC 5HHDG 2NPTA 5I4DA 2E6XA 1I4XA 2DZIA 4MGIE 4DHZE 3PZ7A 2W54A 4DXFA 1OEYA 3M63B 3DBHI 3VTVA 1RYJA 1OTRB 2G45B 1EF5A 2IJ0A 4OW0A 2D2QA 2KTRB 3VTUA 2LVQA 3QARA 3DWMA 1C9FA 2FCSA 2M8SA 4M02A 3I57A 4G11A 3B0AA 4WJOA 2LUEA 1J7CA 2QIEB 2KKCA 4FJVB 3PREA 3NHEB 1FIQA 4BOSC 1SE3A 3T9LA 2DZKA 2NR2A 2LEKA 1VZ8A 5TSSA 3H7PB 4K1RB 1C76A 2BT6A 5BO4B 3UQBA 1WRDB 2HE7A 2WXFA 5IKCM 3Q8FA 3CIRB 1XLQA 2UYZB 2QDFA 4BKSD 1GJZA 4E74A 3L10B 3Q8EA 2INDC 2PKOA 1XLNA 1E7UA 1FRRA 2AYOB 2A4ZA 1SXTA 4ANWA 5HI1A 1U4AA 2M4NA 5FR3A 4BKTA 1KH0A 2KX3A 2KWDA 3AB5A 3EHVA 2WXMA 3ALBA 3P42A 1ISNA 5AUKA 4MH0E 1KM7A 5IA7A 2ZW0A 3DVGX 1HZ5A 3U52E 2WDRB 2K6DB 2K25A 2K5PA 1EWYC 2KQSA 2PIAA 1TBEA 1FFVA 3BYTB 4DDID 2ZJDA 4PS3A 5HFYA 3AE7B 2IGHA 3ZXVA 3BZDB 4PYUA 1SGHA 1FXTB 3P4PB 4R3DA 2RR9A 3IAS1 3ZLZA 1SE2A 2MEKA 3ZUNA 1ESFA 3LYYA 3KQ4A 1OGWA 3URYA 2JX5A 1BT0A 4YSYB 2MX2A 2RSUA 4HCNB 4S17A 1AWDA 1L6VA 4ZRJA 3RNFC 1TZ1A 2JF5A 2KVZA 4A55A 5EDSA 4XDCA 2BBCA 1MFWA 2VH1A 3L08A 3L54A 2ZEQA 4LNOA 3U8ZA 3RCZA 2ZVNA 4FXCA 1Z5SB 1R4NI 1E8XA 1GC6A 4IUMB 3B2FA 2NS5A 1F1HA 3W2DA 2IDYA 3RZFA 1NENB 3Q3OC 1L0YB 1PGBA 2XEWA 4M01A 2KLGA 4GSWA 1WX8A 2Y5PA 3B08A 4G3XB 4OZAA 1YJIA 4AQ7A 3L13A 4FBJB 4CYEA 3ZNHB 5D3IB 3AEFB 1PDXA 1LO5D 3DVNV 4ACFA 2ZNVC 1IBXA 4HRSA 4ICVA 5J2RA 4YT0B 3U2SC 2RPVA 2LD9A 1DOXA 5DPWA 4MGZE 5FKAC 5G5GA 1Q1OA 1SF0A 3NVYA 4JIOU 3RZWC 2XNAC 4C80A 1SE9A 2KANA 2KDMA 1V97A 2QSDA 2MA9B 1ROEA 2AX5A 2ZCBA 1QKZA 1GOZA 4OHJA 1N5XA 1TTNA 2J52A 3HUIA 2BWFA 3M62B 1HEZE 1D5MC 1M94A 3A4SC 2NMQA 4KX6B 3ML9A 2IZVB 5J18A 1UF0A 2V4LA 3ZDMC 1WJ4A 4RF0A 4ARIA 4KVGB 4HK2A 4MEMA 4II3B 4GOCA 2L32A 5E6OA 2LGSA 2O2VB 1QLBB 1K51A 5G55A 4DHZB 3VXWA 1GC7A 3CF6E 3DCGA 2CHWA 1SJED 4ANVA 4W9FA 1ZUD2 2WXPA 2FE8A 4LTUA 3PHWB 3A9KA 4GN1A 2KYWA 3FILB 2DHZA 2PE6B 3NZSA 2BYFA 2JPHA 4DWFA 2DX5B 4B6WA 3NZUA 2FIDA 3AE9B 4NZLB 2YEPB 1I7HA 3T8MA 3R3MA 1YX6B 4JX1C 1JCKB 3IHPC 3DHGC 3RI7C 2CJNA 2I2YA 2WXKA 2J4XA 1YX5B 2H88B 1QF6A 2LJ5A 2Z0EB 1C4CA 1KLUD 2OHFA 1EF1A 1PFDA 2WP9B 5C3JB 4US8A 3P1MA 2WXLA 1WF9A 2LGDA 1UZXB 4EZJA 3BIID 2BGFA 3EUB2 2G4SA 4DQOC 2WHIA 1I4QA 3A9JA 1WFYA 1ZXHA 1HTQA 3DHHC 1KJTA 2KDIA 2L05A 2JYTA 4P1CC 3R2TA 3WA0A 5BMHA 2MBOA 1BUIC 1SEBD 3VR8B 1WRIA 4LNIA 1V8CA 1QOGA 4MM3B 4MELA 2L1AA 2Y3AA 1E7PB 3K9PB 2D3BA 3PRZA 3H7SA 3NOBA 2RDHA 2LGXA 3ZGZA 1YQBA 1QZEA 2JXTA 3D32A 4EEWA 1HZ6A 1PUTA 2KC1A 3X23A 1P1AA 2GBJA 2C60A 1WZ0A 1PYWD 1RLFA 2M19A 2HTHA 2Y5CA 1E7VA 2BS4B 1CQVA 3I63C 5E6JA 3J9CA 5GMVA 2EKEC 2KJRA 5C2TB 3HVDA 1D3ZA 3Q3NC 3AEAB 2H89B 1I4PA 1P98A 3B1LX 4G0NB 2ZPNA 3HK0A 5KHQA 5D6JB 5JXVA 2MBBB 1ZP0B 1T0YA 1WXSA 1LQBA 1VRAB 2G4DB 5AZFA 2LGIA 2Z8LA 1ZW7A 2SAKA 4HJKA 1HE8A 1L4DB 2KN5A 4H2AA 3V61A 4EFOA 2Y5BB 2BYVE 1XEEA 4BKGA 3QX1A 4TUUA 4HCPB 3K9OB 4PT5A 2KT7A 4LLGM 2RPQA 2LVOA 4IM3A 2N9EB 5C23A 3ZXRA 3ECIA 1SIFA 2LMCA 2GI9A 1YN4A 1YNTE 1P7EA 1JRPA 4N59A 2IY0B 2DYBA 4P16A 2INNE 3PO0A 1ENFA 2CR5A 2MBHA 4TSSA 2EMSA 2L7RA 4HXDA 4GB9A 3P4SB 3IT4B 3AMZA 2M1MA 2REXA 2X8XX 1C77A 4L2YA 3AE1B 3PLUA 5MPOA 3IXSA 3RNCC 4MDKE 2YLMA 1WMHA 2DYOA 1B9RA 5G2NA 4W9EA 2FUG1 2WXQA 2KDFB 3TUOA 1IPGA 1CMXB 3MJ5A 2ON8A 4XZ4A 2DAFA 4JWSC 2M0XA 1E90A 1TGZB 1WGDA 2AEHA 3QAQA 4YL8A 4AWJA 3SD5A 3L16A 3BVGA 1QT9A 1WR1A 2JU6X 1TS3A 3MHSD 2R61A 2ACZB 3JSVA 4M0WA 1FEHA 2NBWB 3I5JC 2CHZA 3PVLA 3I9V1 1E9MA 2I1KA 1YN3A 3NUHB 1E6EB 1H7XA 1TKGA 2LXCA 1MI0A 1H4RA 2WXOA 4ZRQA 4GDKA 2ZPYA 4LNFA 1T0RC 1MG4A 3A33B 2XN9C 1AARA 4BFRA 2WU5B 4B0EA 2PVGC 3AEDB 3TBLD 3NS8A 2LHDA 3V6CB 1J7BA 2CJOA 2KFKB 5IOIA 3NVWA 3Q8AA 1STEA 4A9AA 3AEBB 3AE2B 3WAPA 4GDLA 4RGMA 1UWXA 2AWTA 2JVCA 5EE1A 2FUHB 1TY2A 1XXGA 2G9HD 1TYGB 4ITKA 5T8IA 5DCNA 1YQ4B 2BS3B 3WAMA 2BPSA 4K7UA 2CHXA 4L1BA 3VH3B 1FCLA 1CK1A 2RGFA 3DPDA 3U4EG 3TSSA 3QCAA 1EU3A 2KOXA 3CMMB 4BOZB 3ABVB 2IY1B 4PYZA 1J0GA 1C1YB 3H9DA 4F1SA 1VD2A 4ICUA 2I38A 1UNSA 4OVUA 2A5UA 2MLBA 4M00A 3SHQA 4ZRIA 4P1BC 1F2RI 2L83A 2LJIA 5AUIA 3AEGB 1TKYA 3LDZE 2KTFA 5IN7A 1XO3A 2HDEA 2DWQA 1LGRA 2B3AA 4XGAB 1AYFA 3N3KB 2NTSA 3B9JA 1KTKA 3MHZA 2J0KA 3TEYA 3RUIB 2AL3A 2PEAA 1T6BX 5EE3A 4W9GA 1FXAA 2XK5A 4A6QA 4BKSA 1V1PA 3HM3A 4MSQB 5D7GA 1E5WA 4E3CA 4CHKA 5BYSA 4K81A 4A90A 4AJYB 2KDBA 3DQVA 4I6LB 2KMCA 2RDBC 4A20A 4YSZB 1OEYJ 1V80A 3DOWA 2RD0A 2WS3B 1VLBA 3LB8C 4EZLA 3RNAC 4K7WA 1F9JA 3DBHB 3VFKA 1MVKA 4NAWB 2NBUA 2YVCA 1YD8U 4PS7A 1AN8A 4EE2A 2KHWB 2NVUI 4IG7B 1T0QC 2SEBD 2BYEA 1PQSA 5CTRC 2LGYA 3AE3B 4RCOA 2V3PA 1J7AA 2QMTA 3TEWA 1KRHA 1XLPA 1L6UA 1WE7A 4A3PA 2OJRA 3N1YC 3KYCD 2JUOA 3OG5A 2JWUA 4KKJA 4HPPA 1E0ZA 1LXDA 2D3AA 3APCA 4C4VB 3SFEB 3QC8B 2PMVA 4AJWA 1DOIA 2PW9A 2YEPF 3HHMA 2KC2A 1R4MI 3GZNI 2N4FA 4WAFA 1RWSA 2KK8A 2GBMA 3NY5A 2O6VA 1V49A 3AE6B 4YTNB 4IM2A 5BMIA 3RNGC 1TKEA 3ZJUA 2JY6A 2LWPA 5L95C 1JWUD 4WQMA 3KVFB 1WR6E 4OZCA 2FCQA 1UGMA 1LM8B 1Y8RC 3B2GA 4JLCA 3NVZA 2LRWA 4DDGD 2WXHA 3VHTC 3UQAA 2M17A 4LNNA 2BW2A 4IDIA 3KYDD 4MJSB 3ZO5B 4QAYA 2HJ8A 1VCBA 2KXJA 1JW9D 3VUYA 4A8XC 3P4RB 3CF4A 4JPSA 4C7YA 1JWAD 4XC2A 4WH4A 4F7ZA 3N32A 2LHEA 3KWVA 3AXCA 2AL6A 1S3SG 1F52A 2G3QB 4GMVA 1IP9A 4B9KA 4HVBA 1XCQL 3HM6X 4HKZE 2LI5A 2GBKA 4HKQA 2MP2B 4EOYA 2C5LC 1YIWA 1J8CA 2D11A 4NAMA 2V3SA 1E8WA 2K9XA 3VAWA 3N1ZC 4HROA 3PTFC 1XLOA 5HKHA 4KSKC 1R4NB 1JQ4A 1FRDA 2BQQA 2WXNA 4W9HA 4P7IA 3VDZA 2KMMA 2IO3B 5JH5C 3BK2A 5C1ZA 1DYQA 5BMGA 3I3TB 3ZTDA 1WYGA 4RH6A 3Q8CA 3N20C 4G50A 4B95A 4P6VF 4WWPA 3BK1A 4XDDA 3V6EB 5L83A 4NQKE 5DPRA 3N1XC 1A70A 2R2QA 1V2YA 1VJKA 4W9DA 2KTRA 1RFKA 1OQYA 1RFAA 5E6NA 2L0TA 4ANXA 4D2KA 3WIMA 2MHJA 2ONQA 5CHFA 5JHBA 4ZHOA 1IGDA 3QK0A 2N1VA 3DBRI 3H8HA 1BMLC 3H7PA 1SSNA 4JE3B 3ZNGC 3UF8A 4IOIE 2UWQA 4TQ0A 3L0WB 1WXAA 2GB1A 3PRMB 1V5TA 2CU1A 1HQRD 4WIPA 2NPTB 4DK5A 2GBNA 1RM6C 1UGJA 4NNJB 1SB3C 4MH8A 4ARCA 1K53A 4WWOA 1Z2MA 4NJ7A 1C4PA 1TT5B 1UWMA 4FHKA 1DOYA 4KDLB 3PSEB 4AP4C 2ZCCA 1VZ6A 1PGXA 1D6EC 4HDQA 1WH3A 2WNMA 3WANA 1K50A 2MSED 1E8ZA 1EM7A 3EECA 4TKNA 1IGCA 2V4IB 3MC0B 4DHJB 1N63A 1NEKB 1AW7A 1GUAB 3O13A 1ZKHA 3VRBB 5H92C 1ZXIA 2WX0A 3BYYB 3AN1A 3GE3C 4Q2JA 1C4AA 2FNJB 3WCQA 1J19A 1HA5A 3CSFA 2M0AA 3UIOB 3VVWB 1Y56A 1D5XC 3AI5A 3IFWB 3HIZA 3EFUA 1WGRA 4CO7A 4IWQA 2JZPA 3VUXA 2WDTB 1WXQA 1N5WA 2UU7A 1V6EA 3DBSA 4KZ0A 2LZ6A 3ZIMA 2M56B 1FXIA 3SR6A 2N9PC 3E9SA 1WM3A 3AECB 1XT9B 2N7EA 3BINA 2W3RA 2DENB 3UGBB 1ZDVA 4TQ1A 5KHOA 1FM0D 1SJHD 3DWGC 5BYRA 1GNUA 1JRUA 1TJEA 4OVZA 4WAAA 4B0MA 4C00A 3E56A 4PS8A 3APDA 2G1EA 4C7ZA 4WURA 3LXFA 1OQQA 2FCNA 2JQRB 4FJYA 4IWPA 2FBWB 2BVCA 2BKRB 2KWVB 4ASWC 4GLSC 2QEJC 2INCC 2DZMA 1WGYA 2WXIA 2MCNB 2WX1A 1K52A 3R8BA 2KLCA 3NVVA 1MHXA 5EE9A 3S2AA 3Q3MC 3A1QB 1EU4A 1BXTA 4XE0A 4BVUC 4YTMB 1FCCC 3AEEB 3DBLI 2IBIB 4RGTA 2Z0DB 3U30A 1L0XB 3R2IA 1FD6A 1L5PA 2HTME 3OLMD 4I6NB 1YQ3B 2KDEB 2QILA 4DXGA 3W5VB 1OQRA 5J17A 3W1SA 2QJLA 4HEA1 1F77A 1WJ6A 3VH4B 3AM9A 5D2MB 5AZGA 4KGSA 1Q10A 1YOVB 3AE5B 3GP7A 3MC9A 2PJHA 3R66C 4KSLC 1ZE3D 4E71A 4RNAA 1IBXB 1S1QB 2O2VA 1D5ZC 2W3SA 1ZOYB 3FKYA 1D4BA 2VRRB 2TSSA 3T3NA 4FULA 1YN5A 2KX0A 3TEZA 1KOTA 1JWMD 1NDDA 4KGRA 4RGOS 5CX3A 1QOFA 2MJDA 3MP9A 3OJ4B 2D3GA 2K8BA 3FILA 2D3CA 2KWCA 3QIJA 2N0SB 1WM2A 1VR9A 1UBQA 2BB5A 3PGEA 1UD7A 1UBIA 1YMHE 2J7QB 4IM0A 1Q5WB 3FC4A 1ET9A 2JSVX 2KN4A 2Q5WD 1GAQB 2X38A 1NVID 4J3OD 2QC8A 3MFGA 2VZKD 4JL9A 4JWUC 2Z59B 4PK1A 1N6ZA 3AV8A 4REZA 1TS2A 3W5UB 5AEKB 2KFJA 2N9XA 3Q3JA 2KJHB 3CWIA 1GT8A 2MH7A 3KLSX 2N9LA 4FJZA 3IT6B 2OJWA 2NTTA 2WU2B 3APFA 4W9IA 4LJPB 4KGTA 2DZJA 1R7SA 4USAA 4FADA 3A9KB 2IO1B 4XX5A 3ZQ4A 1KLVA 2NCNA 2FAZA 1OFFA 2W9NA 3QQ8B 4II2B 1QOBA 3TEXA 1Q0WB 3IAM1 1WSPA 4DHJD 3PS6A 1L0VB 4WJQA 2GOWA 4MM3A 3H6NA 1H7WA 2K0PA 4K3CA 3GB1A 3N30A 1WXMA 2KNBA 5HG2A 4BZAA 1TY0A 3JW0X 2MW5A 4US9A 2DYMA 4N58A 2MBQA 2ASQA 4I6PA 3MJWA 4OZBA 2CU3A 1H8CA 1QOAA 2BWES 4L23A 2PTLA 4N9F4 1EUVB 1GG3A 1I4HA 3M95A 4EZKA 3GS2A 1UH6A 3UINB 1ZDXA 4MGKE 4YSXB 1JALA 4HPMB 3A9JB 2IO0B 1JMLA 1I42A 2LXAA 3Q8BA 3W1SC 1WX7A 3OAWA 5EE0A 2KD0A 4ZHPA 3HRDD 2DAJA 2JXXA 3U7DA 3KH0A 2J42A 4YWGG 4HLEA 4FA6A 3C19A 2WGSA 4FLHA 1NYRA 3TMPB 2IO2B 4EUTA 2KQ7A 3IG3A 1WJNA 1NI3A 4LJOB 2IYDB 2BB6A 2IGGA 2GMIC 1UELA 4FHJA 2N1WA 1T0SC 3PRPB 1UUPA 1EWCA 1WGHA 3NS1A 1JROA 4TV3A 3M3JA 4W9LA 4IWOA 1KLGD 5E6PA 1E10A 3ZKJC 4JQWC 2J53A 3V62A 4N6EB 2V0GA 2CKHB 2WDVB 4K3BA 1V81A 2HD5B 2BF8B 3EA6A 3RFZB 2BKFA 4S0RA 4IW0A 3RT3B 2RDGA 4RFBA 2ZVOA 2EKIA 4DXAB 1QQRA 3A1QA 3LJ3A 5GXGB 2RMMA 1NI2A 4RM9A 4OVVA 3ZDTA 2O6VD 3SFDB 1MJDA 4NY0A 4LK0M 3L17A 1WI0A 2N9KA 1T3QA 3TJPA 2I1JA 3SU8X 2BTEA 3A4RA 1WGGA 2DNFA 3IVFA 4URKA 3UIPB 1WJUA 3NRZA 3IBEA 4MSMB 4F8CB 1GB4A 4EKUA 5JZEB 1HTOA 2ICIA 3NG0A 2W82A 2LFIA 4BAXA 4ZDVA 1CJEA 3P63A 2XBBC 1B1ZA 2KO3A 4AUQC 1TS4A 2QCZA 3ZNZB 4J6IA 5FR6A 3EGRA 3DVGY 1FPYA 3R7RA 3AE8B 2JWZA 2LRUA 4C56C 2IGDA 4LDTD 3O65B 3Q6BA 3C0RB 2KQ4X 4NJCA 2IPKD 3TIXA 1KFYB 1X1MA 3GOEA 3EC8A 3P2BA 2BS2B 1ACCA 2R2OA 3MTNB 2C7NB 3ZRFA 1V9JA 1N62A 1N61A 3ZW3A 1NYQA 3U7ZA 1WMHB 4HPLB 4LCDE 3ML8A 4K7SA 2L0FA 3V60A 1R4MB 3H1UA 3GZNB 2JRIB 2DBYA 3PV1A 3ZYYX 2KFKA 3ZTCA 1I4RA 5D94A 1K8RB 4WWMA 5IAAC 2C7HA 3ZJTA 5JHAA 1LFDA 4ANUA 3RN9C 1M4VA 1FNUA 1QILA 1N60A 2GRIA 3BY4B 3JSVB 2JZ3B 4M0WB 3PZDA 3ZRCA 2L3ZA 3Q69A 2AQ2B 1VDVA 2K8CA 3SDLC 3KUDB 1RRBA 4CQNA 3WALA 4WJPA 1MHHE 4GU2A 2N7DA 4GDKB 1I35A 2K22A 4ZOHC 3SEBA 2K1FA 4XWWA 3QWZB 4AS1A 3PPAA 1XQQA 2WYQA 1SIJA 3Q3FA 4KIKB 5BYQA 3Q14C 2N7JA 2D10A 2J0MA 2L8JA 2L52A 2GLSA 2E3TA 2ZW1A 2KACA 1WWTA 2WQYB 2VZKB 4TMAB 1T5XD 4HWIB 3VUWA 3ETRA 1GTEA 4KZCA 1G6JA 4GDLB 3QJZA 4NPNA 4AOFA 5TR5A 4HJGE 1I4GA 4LNKA 3EFCA 2MWSB 2FCMA 2ZNVB 3C8YA 5FK9C 3BWUD 4ZRPA 4X57B 2V1YA 1XCTL 1V5OA 1TZOA 1WXVA 3MC8A 1WY8A 1L2NA 4RF1A 1V1OA 1FFUA 3CSTA 3AU5A 3PT2B 4A3OA 3ZJVA 2KZRA 4HDOA 1WYWB 1ZPSA 2D5GA 1SBBB 2L00B 2PLPA 2JYEA 4IKGA 2GBRA 1C78A 1FNWA 4W9JA 2L76A 1WE6A 2LASA 3OWEB 4FN2A 2EELA 1FO4A 1TIFA 1PGAA 5CHWA 2MQJA 4XYCA 3RMKC 1C3TA 5CHVC 3KW5B 4NAWA 2C7MB 1F0ZA 1YJJA 2J0JA 1MPEA 5D3DA 3ENEA 2CS4A 4KV2A 1JWBD 3ONSA 1P3QU 2KJ6A 3KUZA 2EMTA 1XF5L 2K6QA 4MT5A 3BVMA 2W55A 3L4PA 3ZVVA 4W9KA 2K3UA 3UI3A 3DVNU 4MGYE 2BYTA 3GE8C 3DBRB 4DBGA 4W9CA 2XK5B 4WQOB 1V1PB 3VTWA 4C4VA 3PZ8A 1WGKA 3X0WA
chains in the Genus database with same CATH topology
1SJED 1P7FA 2JSVX 2PVOD 1ZUD2 1CZPA 2WXPA 3AE3B 4RCOA 2KN4A 1J7AA 2FE8A 2Q5WD 2QMTA 2V3PA 1GAQB 1KRHA 1XLPA 2X38A 3HVZA 3TEWA 1L6UA 1FNVA 1NVID 4J3OD 4LTUA 3N9YC 3VR9B 2VZKD 3MFGA 3FILB 4JWUC 2JWUA 3T3OA 3AV8A 1ET6A 4REZA 1TS2A 4KKJA 3W5UB 1E0ZA 2LUMA 3CWIA 3AE9B 2OEDA 3SFEB 4NZLB 2WLBA 2YEPB 1I7HA 1GT8A 2PMVA 1DOIA 2MH7A 2PW9A 2YEPF 3KLSX 2N9LA 3IT6B 4JX1C 1JCKB 2NTTA 2WU2B 2V3NA 2CJNA 4WAFA 2I2YA 2WXKA 1RWSA 2MJ3A 2J4XA 2KAJA 4KGTA 2H88B 3AE6B 3RPFC 4YTNB 1QF6A 1R7SA 4USAA 5BMIA 3ZQ4A 1TKEA 3ZJUA 1C4CA 5G5HA 1KLUD 1OFFA 2OHFA 1PFDA 1QOBA 3TEXA 1JWUD 2WP9B 5C3JB 4WQMA 3IAM1 1WSPA 3P1MA 2WXLA 4US8A 4OZCA 2WXJA 1L0VB 3B2GA 1KF6B 3NVZA 3W9CB 3BIID 3EUB2 2WDQB 2WXHA 4DQOC 1H7WA 1JWSD 2K0PA 1I4QA 1ZXHA 3GB1A 1DGJA 2JYTA 5HG2A 2BW2A 4IDIA 1TY0A 3R2TA 4US9A 2DYMA 1FMAD 4N58A 1VZ7A 1L4ZB 3P4QB 5BMHA 4YTPB 1BUIC 1SEBD 3FAHA 4O1NA 2DLBA 3VR8B 3BVZA 3V05A 2WXGA 1JW9D 4OZBA 2CU3A 1WRIA 1GTHA 1QOAA 4A8XC 3P4RB 3CF4A 4L23A 1V8CA 4JPSA 4C7YA 2PTLA 1JWAD 1I4HA 1QOGA 4WH4A 3GS2A 4MM3B 2AQ3B 2LHEA 1ZDXA 1GB1A 2L1AA 4YSXB 1JALA 3KWVA 1JMLA 2Y3AA 1E7PB 5H8YE 1IUEA 3Q8BA 3V3XA 5EE0A 2RDHA 1XCQL 4KKIA 3ZGZA 2JXTA 5LNK1 4ZHPA 4MACA 4HKZE 1HZ6A 3HRDD 1PUTA 2J42A 1HXYD 4HKQA 4YWGG 2INPE 1PYWD 1NYRA 3VQIA 2M19A 1TS5A 2Y5CA 4NAMA 2BS4B 1NI3A 1CQVA 5E6JA 3AE4B 2K9XA 3J9CA 1C79A 4HROA 2MJEA 2BB6A 3VRAB 1XLOA 2IGGA 5C2TB 1JQ4A 3HVDA 1UUPA 1EWCA 1FRDA 3NS1A 1JROA 2WXNA 3AEAB 2H89B 1I4PA 2WXRA 2KMMA 3NZ3A 2B76B 1KLGD 4UDUC 1E10A 3BK2A 3KWLA 4ZYSA 5JXVA 1DYQA 5BMGA 1ZP0B 1GPXA 2J53A 1WYGA 4YXDB 4RH6A 4N6EB 3Q8CA 2V0GA 2AQ1B 4RGNA 2WDVB 4P6VF 3BK1A 1VRAB 3EA6A 4XDDA 3RFZB 1A70A 3W5VB 2LGIA 2Z8LA 3AH7A 1VJKA 2RDGA 1F2RC 1SE4A 1RFKA 2SAKA 4RFBA 4XWTA 4D2KA 2EKIA 1L4DB 5HHDG 4H2AA 1QQRA 5I4DA 1XEEA 2E6XA 2ONQA 5GXGB 1I4XA 4ZHOA 4PT5A 2RMMA 3PZ7A 1IGDA 4LLGM 3SFDB 2W54A 4LK0M 4DXFA 3H8HA 1BMLC 2N9KA 1T3QA 2LMCA 1RYJA 2GI9A 1YN4A 2BTEA 1YNTE 1SSNA 4JE3B 1P7EA 2IJ0A 4OW0A 1JRPA 4IOIE 4N59A 4TQ0A 4P16A 3DWMA 3NRZA 2INNE 2GB1A 3PO0A 1ENFA 1C9FA 1HQRD 1GB4A 3I57A 4WIPA 4TSSA 2ICIA 1RM6C 1UGJA 1J7CA 3P4SB 1SB3C 2QIEB 3IT4B 3AMZA 4MH8A 4ARCA 2W82A 1K53A 2LFIA 1CJEA 1FIQA 3P63A 1SE3A 1B1ZA 1C4PA 1UWMA 1C77A 1TS4A 2LEKA 3AE1B 4L2YA 1DOYA 1VZ8A 5TSSA 5MPOA 1VZ6A 1PGXA 3IXSA 1C76A 2BT6A 3EGRA 1D6EC 3AE8B 4C56C 2IGDA 2WXFA 2WNMA 3Q8FA 2DYOA 3CIRB 1K50A 1XLQA 1B9RA 1EM7A 2KQ4X 1IGCA 4NJCA 2FUG1 2IPKD 2V4IB 2WXQA 3Q8EA 2PKOA 3MC0B 3TUOA 1XLNA 1KFYB 1FRRA 3MJ5A 1N63A 2ON8A 4JWSC 1SXTA 5HI1A 1NEKB 2BS2B 1ACCA 1AW7A 5FR3A 3O13A 1KH0A 1N62A 2KWDA 1N61A 3AB5A 3BVGA 3VRBB 2WXMA 1QT9A 1NYQA 3P42A 1ZXIA 5AUKA 3BYYB 3AN1A 4Q2JA 5H92C 3U7ZA 1C4AA 2JU6X 1TS3A 2R61A 2ZW0A 1HZ5A 2ACZB 3U52E 3WCQA 2WDRB 4M0WA 1HA5A 2K5PA 1FEHA 1EWYC 2M0AA 2PIAA 2DBYA 3I9V1 1FFVA 1Y56A 1D5XC 1E9MA 3ZYYX 3BYTB 1YN3A 3NUHB 1E6EB 1H7XA 1I4RA 1TKGA 1MI0A 4WWMA 5HFYA 3AE7B 2IGHA 2JZPA 2WXOA 1WXQA 1N5WA 3BZDB 4ZRQA 3ZJTA 2M56B 1FXIA 3P4PB 3SR6A 4R3DA 3IAS1 1M4VA 1FNUA 2XN9C 3E9SA 1QILA 3AECB 2WU5B 1SE2A 2MEKA 2PVGC 1N60A 2GRIA 4B0EA 3AEDB 1ESFA 2LHDA 3LYYA 2W3RA 3KQ4A 1J7BA 1ZDVA 4TQ1A 2CJOA 1FM0D 2AQ2B 3Q69A 1SJHD 1VDVA 3URYA 3NVWA 3Q8AA 3DWGC 2JX5A 1STEA 4YSYB 5BYRA 4CQNA 1TJEA 4OVZA 4A9AA 1AWDA 1MHHE 4B0MA 1L6VA 3FC4A 3AEBB 3AE2B 3E56A 4GDKB 4RGMA 1UWXA 4A55A 2K22A 4XDCA 4ZOHC 2G1EA 2BBCA 5EE1A 4WURA 4C7ZA 3LXFA 1TY2A 1OQQA 2JQRB 2FBWB 1XXGA 3SEBA 2G9HD 1TYGB 4XWWA 4ITKA 4FXCA 4AS1A 1SIJA 5T8IA 4GLSC 1YQ4B 2BS3B 5BYQA 2N7JA 4L1BA 2QEJC 2WXIA 2L52A 1K52A 2E3TA 3B2FA 2ZW1A 3R8BA 2KACA 1WWTA 1FCLA 1CK1A 3W2DA 3NVVA 2IDYA 2WQYB 1MHXA 2VZKB 4TMAB 1NENB 5EE9A 1L0YB 1EU4A 1PGBA 3U4EG 1BXTA 3TSSA 1T5XD 4XE0A 4YTMB 1EU3A 1GTEA 1FCCC 3ETRA 3AEEB 4GDLB 3ABVB 2Y5PA 4OZAA 1YJIA 4RGTA 4AQ7A 4HJGE 1L0XB 1I4GA 5D3IB 3AEFB 1PDXA 3R2IA 1LO5D 1L5PA 1FD6A 2I38A 1UNSA 3C8YA 2HTME 5FK9C 3BWUD 4ZRPA 1YQ3B 2QILA 4DXGA 1IBXA 1F2RI 1XCTL 2L83A 2LJIA 3AEGB 4HRSA 1TZOA 5AUIA 4YT0B 1TKYA 1OQRA 4RF1A 1V1OA 1FFUA 3U2SC 1XO3A 2HDEA 2DWQA 3ZJVA 3W1SA 2QJLA 4HEA1 1AYFA 2RPVA 1DOXA 1F77A 1ZPSA 2D5GA 2NTSA 3B9JA 1SBBB 2PLPA 5FKAC 1KTKA 2JYEA 3AM9A 3MHZA 4IKGA 4KGSA 1Q10A 1C78A 3TEYA 3AE5B 1FNWA 5G5GA 1SF0A 3GP7A 3NVYA 3OWEB 2EELA 2XNAC 4C80A 1FO4A 1PGAA 1T6BX 1ZE3D 2KDMA 1V97A 5EE3A 4RNAA 4A6QA 1FXAA 2QSDA 1F0ZA 1IBXB 1V1PA 1YJJA 1ROEA 2AX5A 1QKZA 1GOZA 1MPEA 4OHJA 5D3DA 5D7GA 1D5ZC 1N5XA 2J52A 2W3SA 3HUIA 1ZOYB 5BYSA 1D4BA 1HEZE 1D5MC 1JWBD 4A90A 2TSSA 3T3NA 2NMQA 1YN5A 3TEZA 4KX6B 1JWMD 1XF5L 4KGRA 4RGOS 1QOFA 4MT5A 4YSZB 2MJDA 3MP9A 4RF0A 4ARIA 3BVMA 2W55A 3L4PA 2K3UA 3UI3A 2WS3B 1VLBA 2BYTA 3LB8C 3FILA 2N0SB 1MVKA 1VR9A 4NAWB 2L32A 2BB5A 1V1PB 1AN8A 4EE2A 1QLBB 3PZ8A 1K51A 1WGKA 1YMHE 2SEBD 1ET9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 B;  5MPO A;  2BS3 B;  2PVO D;  1ZUD 2;  2BT6 A;  1CZP A;  3AE3 B;  2L52 A;  3AE8 B;  1J7A A;  1NYR A;  2Q5W D;  2M19 A;  3HVZ A;  1GAQ B;  1KRH A;  1XLP A;  2E3T A;  3B2F A;  1L6U A;  1NVI D;  1WWT A;  2Y5C A;  4LTU A;  2BS4 B;  3NVV A;  1NI3 A;  2WQY B;  5EE9 A;  3AE4 B;  1NEN B;  3VR9 B;  2K9X A;  4HRO A;  4JWU C;  2MJE A;  3CIR B;  1XLQ A;  3AV8 A;  1B9R A;  4YTM B;  3ETR A;  1GTE A;  3VRA B;  1XLO A;  3W5U B;  3AEE B;  1E0Z A;  5C2T B;  3ABV B;  1JQ4 A;  3CWI A;  1FRD A;  3NS1 A;  1JRO A;  2PKO A;  1YJI A;  3AE9 B;  3SFE B;  1XLN A;  2WLB A;  1KFY B;  1FRR A;  1I7H A;  1GT8 A;  2H89 B;  3AEA B;  1N63 A;  1DOI A;  2MH7 A;  4JWS C;  3AEF B;  1PDX A;  1L5P A;  2KMM A;  4JX1 C;  2B76 B;  2HTM E;  1NEK B;  1E10 A;  3RPF C;  2BS2 B;  2WU2 B;  3KWL A;  2CJN A;  1YQ3 B;  1ZP0 B;  1RWS A;  2L83 A;  5AUI A;  2MJ3 A;  3AEG B;  1N62 A;  4HRS A;  1N61 A;  4YT0 B;  1TKY A;  1OQR A;  3VRB B;  1WYG A;  2KAJ A;  4YXD B;  1FFU A;  2H88 B;  3AE6 B;  1NYQ A;  4YTN B;  1QT9 A;  1XO3 A;  1ZXI A;  3AN1 A;  4N6E B;  5AUK A;  2DWQ A;  1R7S A;  4USA A;  1QF6 A;  2QJL A;  2WDV B;  1TKE A;  1AYF A;  4P6V F;  1DOX A;  2ACZ B;  3WCQ A;  3B9J A;  2WDR B;  2K5P A;  1EWY C;  5G5H A;  1OFF A;  2OHF A;  1A70 A;  2PIA A;  3AM9 A;  1PFD A;  1QOB A;  3W5V B;  2DBY A;  3AH7 A;  1FFV A;  2WP9 B;  5C3J B;  1E9M A;  1VJK A;  4WQM A;  3ZYY X;  4US8 A;  3P1M A;  3AE5 B;  1L0V B;  1RFK A;  3B2G A;  1SF0 A;  5G5G A;  1KF6 B;  1E6E B;  1H7X A;  3NVY A;  1TKG A;  3NVZ A;  4WWM A;  3BII D;  2EKI A;  3EUB 2;  2WDQ B;  3W9C B;  4C80 A;  3AE7 B;  1FO4 A;  1H7W A;  5H92 C;  1WXQ A;  1N5W A;  1V97 A;  5EE3 A;  5GXG B;  1DGJ A;  4ZHO A;  1FXA A;  1F0Z A;  1YJJ A;  1FXI A;  2M56 B;  1ROE A;  2AX5 A;  3P4P B;  4IDI A;  3SR6 A;  4US9 A;  3SFD B;  2W54 A;  1FMA D;  1N5X A;  4N58 A;  2W3S A;  3HUI A;  1ZOY B;  3P4Q B;  1GPX A;  4YTP B;  3FAH A;  3AEC B;  2WU5 B;  1T3Q A;  2PVG C;  1N60 A;  1JWB D;  3AED B;  1RYJ A;  3VR8 B;  1JW9 D;  4KX6 B;  2CU3 A;  1WRI A;  1GTH A;  1QOA A;  3AB5 A;  2W3R A;  3P4R B;  3CF4 A;  1QOF A;  4YSZ B;  1J7B A;  1JRP A;  1V8C A;  4N59 A;  2MJD A;  4C7Y A;  2CJO A;  1FM0 D;  1JWA D;  2W55 A;  1VDV A;  3L4P A;  3NVW A;  1QOG A;  3DWM A;  3NRZ A;  2WS3 B;  3DWG C;  3PO0 A;  1VLB A;  2JX5 A;  3LB8 C;  4YSY B;  4YSX B;  1JAL A;  1TJE A;  4A9A A;  1AWD A;  1L6V A;  3AEB B;  3AE2 B;  2N0S B;  1RM6 C;  1E7P B;  3P4S B;  1J7C A;  1SB3 C;  2K22 A;  2G1E A;  2QIE B;  4ZOH C;  5EE1 A;  1IUE A;  3AMZ A;  3LXF A;  5H8Y E;  4C7Z A;  1OQQ A;  1QLB B;  2JQR B;  2FBW B;  5EE0 A;  1CJE A;  1FIQ A;  1TYG B;  3P63 A;  1WGK A;  4ZHP A;  4ITK A;  4FXC A;  3HRD D;  1PUT A;  1UWM A;  2LEK A;  3AE1 B;  1SIJ A;  3FC4 A;  1DOY A; 
#chains in the Genus database with same CATH topology
 1P7F A;  3QA8 A;  2PVO D;  1CZP A;  1P9D U;  2D07 B;  3QHT A;  3HVZ A;  2K39 A;  2LVP A;  3WAO A;  1FNV A;  3PHX B;  3N9Y C;  3VR9 B;  4BBN C;  3T3O A;  2JT4 B;  1ET6 A;  4BBN F;  2KWU B;  1NBF C;  2LUM A;  1IYF A;  3AU4 A;  2OED A;  5DPS A;  2WLB A;  2VH2 A;  2JZZ A;  2V3N A;  5IO9 A;  1WIA A;  2KVR A;  2ZZP B;  3RUL A;  2MJ3 A;  2KAJ A;  4IC7 B;  3RPF C;  1YJ1 A;  4MJS A;  3DHI C;  2V9H A;  2MBE A;  5G5H A;  3R7Q A;  2C9W B;  1XD3 B;  2WXJ A;  2NBV B;  1KF6 B;  4M8N A;  3W9C B;  2HJ1 A;  2WDQ B;  1JWS D;  1DGJ A;  2PE9 A;  2PPH A;  3DDC B;  2WWZ A;  4KDI C;  3RNB C;  2O6V B;  1FMA D;  1VZ7 A;  1L4Z B;  3P4Q B;  4YTP B;  3FAH A;  5IP4 D;  4O1N A;  4JGH B;  2DLB A;  2K8H A;  3BVZ A;  3V05 A;  2WXG A;  1GTH A;  2MP2 A;  1EO6 A;  4GGQ A;  4NQL B;  3RNE C;  2AQ3 B;  4NJ6 A;  1GB1 A;  1P0R A;  3ZNI D;  3NJT A;  1A5R A;  4RMA A;  1E8Y A;  3TCA A;  4ZRK A;  5H8Y E;  1IUE A;  2OOB B;  4ZYN A;  3W1Y A;  3V3X A;  4KKI A;  5LNK 1;  1WZ3 A;  4MAC A;  2FIF A;  3KUC B;  1ZGU B;  1V86 A;  1HXY D;  2INP E;  1RAX A;  3OJ3 A;  3VQI A;  1TS5 A;  1MG8 A;  4LDT B;  4GIV A;  4WJN A;  3AE4 B;  1C79 A;  1WX9 A;  2MJE A;  5LXI B;  3VRA B;  2MRP A;  5LLI A;  4M8M A;  2KMA A;  2JRH A;  2WXR A;  1L7Y A;  4GXB A;  3NZ3 A;  2B76 B;  4UDU C;  3KWL A;  3TL5 A;  4ZYS A;  3JVZ X;  3PLV A;  1GPX A;  5AZH A;  4YXD B;  3DBL B;  2QHO A;  2AQ1 B;  4RGN A;  5DPT A;  3JYU A;  4RM8 A;  3AUL A;  3RYT A;  4WWN A;  4KIK A;  3RD2 A;  3AH7 A;  5LXH A;  1F2R C;  1SE4 A;  4XWT A;  3Q2A C;  5HHD G;  2NPT A;  5I4D A;  2E6X A;  1I4X A;  2DZI A;  4MGI E;  4DHZ E;  3PZ7 A;  2W54 A;  4DXF A;  1OEY A;  3M63 B;  3DBH I;  3VTV A;  1RYJ A;  1OTR B;  2G45 B;  1EF5 A;  2IJ0 A;  4OW0 A;  2D2Q A;  2KTR B;  3VTU A;  2LVQ A;  3QAR A;  3DWM A;  1C9F A;  2FCS A;  2M8S A;  4M02 A;  3I57 A;  4G11 A;  3B0A A;  4WJO A;  2LUE A;  1J7C A;  2QIE B;  2KKC A;  4FJV B;  3PRE A;  3NHE B;  1FIQ A;  4BOS C;  1SE3 A;  3T9L A;  2DZK A;  2NR2 A;  2LEK A;  1VZ8 A;  5TSS A;  3H7P B;  4K1R B;  1C76 A;  2BT6 A;  5BO4 B;  3UQB A;  1WRD B;  2HE7 A;  2WXF A;  5IKC M;  3Q8F A;  3CIR B;  1XLQ A;  2UYZ B;  2QDF A;  4BKS D;  1GJZ A;  4E74 A;  3L10 B;  3Q8E A;  2IND C;  2PKO A;  1XLN A;  1E7U A;  1FRR A;  2AYO B;  2A4Z A;  1SXT A;  4ANW A;  5HI1 A;  1U4A A;  2M4N A;  5FR3 A;  4BKT A;  1KH0 A;  2KX3 A;  2KWD A;  3AB5 A;  3EHV A;  2WXM A;  3ALB A;  3P42 A;  1ISN A;  5AUK A;  4MH0 E;  1KM7 A;  5IA7 A;  2ZW0 A;  3DVG X;  1HZ5 A;  3U52 E;  2WDR B;  2K6D B;  2K25 A;  2K5P A;  1EWY C;  2KQS A;  2PIA A;  1TBE A;  1FFV A;  3BYT B;  4DDI D;  2ZJD A;  4PS3 A;  5HFY A;  3AE7 B;  2IGH A;  3ZXV A;  3BZD B;  4PYU A;  1SGH A;  1FXT B;  3P4P B;  4R3D A;  2RR9 A;  3IAS 1;  3ZLZ A;  1SE2 A;  2MEK A;  3ZUN A;  1ESF A;  3LYY A;  3KQ4 A;  1OGW A;  3URY A;  2JX5 A;  1BT0 A;  4YSY B;  2MX2 A;  2RSU A;  4HCN B;  4S17 A;  1AWD A;  1L6V A;  4ZRJ A;  3RNF C;  1TZ1 A;  2JF5 A;  2KVZ A;  4A55 A;  5EDS A;  4XDC A;  2BBC A;  1MFW A;  2VH1 A;  3L08 A;  3L54 A;  2ZEQ A;  4LNO A;  3U8Z A;  3RCZ A;  2ZVN A;  4FXC A;  1Z5S B;  1R4N I;  1E8X A;  1GC6 A;  4IUM B;  3B2F A;  2NS5 A;  1F1H A;  3W2D A;  2IDY A;  3RZF A;  1NEN B;  3Q3O C;  1L0Y B;  1PGB A;  2XEW A;  4M01 A;  2KLG A;  4GSW A;  1WX8 A;  2Y5P A;  3B08 A;  4G3X B;  4OZA A;  1YJI A;  4AQ7 A;  3L13 A;  4FBJ B;  4CYE A;  3ZNH B;  5D3I B;  3AEF B;  1PDX A;  1LO5 D;  3DVN V;  4ACF A;  2ZNV C;  1IBX A;  4HRS A;  4ICV A;  5J2R A;  4YT0 B;  3U2S C;  2RPV A;  2LD9 A;  1DOX A;  5DPW A;  4MGZ E;  5FKA C;  5G5G A;  1Q1O A;  1SF0 A;  3NVY A;  4JIO U;  3RZW C;  2XNA C;  4C80 A;  1SE9 A;  2KAN A;  2KDM A;  1V97 A;  2QSD A;  2MA9 B;  1ROE A;  2AX5 A;  2ZCB A;  1QKZ A;  1GOZ A;  4OHJ A;  1N5X A;  1TTN A;  2J52 A;  3HUI A;  2BWF A;  3M62 B;  1HEZ E;  1D5M C;  1M94 A;  3A4S C;  2NMQ A;  4KX6 B;  3ML9 A;  2IZV B;  5J18 A;  1UF0 A;  2V4L A;  3ZDM C;  1WJ4 A;  4RF0 A;  4ARI A;  4KVG B;  4HK2 A;  4MEM A;  4II3 B;  4GOC A;  2L32 A;  5E6O A;  2LGS A;  2O2V B;  1QLB B;  1K51 A;  5G55 A;  4DHZ B;  3VXW A;  1GC7 A;  3CF6 E;  3DCG A;  2CHW A;  1SJE D;  4ANV A;  4W9F A;  1ZUD 2;  2WXP A;  2FE8 A;  4LTU A;  3PHW B;  3A9K A;  4GN1 A;  2KYW A;  3FIL B;  2DHZ A;  2PE6 B;  3NZS A;  2BYF A;  2JPH A;  4DWF A;  2DX5 B;  4B6W A;  3NZU A;  2FID A;  3AE9 B;  4NZL B;  2YEP B;  1I7H A;  3T8M A;  3R3M A;  1YX6 B;  4JX1 C;  1JCK B;  3IHP C;  3DHG C;  3RI7 C;  2CJN A;  2I2Y A;  2WXK A;  2J4X A;  1YX5 B;  2H88 B;  1QF6 A;  2LJ5 A;  2Z0E B;  1C4C A;  1KLU D;  2OHF A;  1EF1 A;  1PFD A;  2WP9 B;  5C3J B;  4US8 A;  3P1M A;  2WXL A;  1WF9 A;  2LGD A;  1UZX B;  4EZJ A;  3BII D;  2BGF A;  3EUB 2;  2G4S A;  4DQO C;  2WHI A;  1I4Q A;  3A9J A;  1WFY A;  1ZXH A;  1HTQ A;  3DHH C;  1KJT A;  2KDI A;  2L05 A;  2JYT A;  4P1C C;  3R2T A;  3WA0 A;  5BMH A;  2MBO A;  1BUI C;  1SEB D;  3VR8 B;  1WRI A;  4LNI A;  1V8C A;  1QOG A;  4MM3 B;  4MEL A;  2L1A A;  2Y3A A;  1E7P B;  3K9P B;  2D3B A;  3PRZ A;  3H7S A;  3NOB A;  2RDH A;  2LGX A;  3ZGZ A;  1YQB A;  1QZE A;  2JXT A;  3D32 A;  4EEW A;  1HZ6 A;  1PUT A;  2KC1 A;  3X23 A;  1P1A A;  2GBJ A;  2C60 A;  1WZ0 A;  1PYW D;  1RLF A;  2M19 A;  2HTH A;  2Y5C A;  1E7V A;  2BS4 B;  1CQV A;  3I63 C;  5E6J A;  3J9C A;  5GMV A;  2EKE C;  2KJR A;  5C2T B;  3HVD A;  1D3Z A;  3Q3N C;  3AEA B;  2H89 B;  1I4P A;  1P98 A;  3B1L X;  4G0N B;  2ZPN A;  3HK0 A;  5KHQ A;  5D6J B;  5JXV A;  2MBB B;  1ZP0 B;  1T0Y A;  1WXS A;  1LQB A;  1VRA B;  2G4D B;  5AZF A;  2LGI A;  2Z8L A;  1ZW7 A;  2SAK A;  4HJK A;  1HE8 A;  1L4D B;  2KN5 A;  4H2A A;  3V61 A;  4EFO A;  2Y5B B;  2BYV E;  1XEE A;  4BKG A;  3QX1 A;  4TUU A;  4HCP B;  3K9O B;  4PT5 A;  2KT7 A;  4LLG M;  2RPQ A;  2LVO A;  4IM3 A;  2N9E B;  5C23 A;  3ZXR A;  3ECI A;  1SIF A;  2LMC A;  2GI9 A;  1YN4 A;  1YNT E;  1P7E A;  1JRP A;  4N59 A;  2IY0 B;  2DYB A;  4P16 A;  2INN E;  3PO0 A;  1ENF A;  2CR5 A;  2MBH A;  4TSS A;  2EMS A;  2L7R A;  4HXD A;  4GB9 A;  3P4S B;  3IT4 B;  3AMZ A;  2M1M A;  2REX A;  2X8X X;  1C77 A;  4L2Y A;  3AE1 B;  3PLU A;  5MPO A;  3IXS A;  3RNC C;  4MDK E;  2YLM A;  1WMH A;  2DYO A;  1B9R A;  5G2N A;  4W9E A;  2FUG 1;  2WXQ A;  2KDF B;  3TUO A;  1IPG A;  1CMX B;  3MJ5 A;  2ON8 A;  4XZ4 A;  2DAF A;  4JWS C;  2M0X A;  1E90 A;  1TGZ B;  1WGD A;  2AEH A;  3QAQ A;  4YL8 A;  4AWJ A;  3SD5 A;  3L16 A;  3BVG A;  1QT9 A;  1WR1 A;  2JU6 X;  1TS3 A;  3MHS D;  2R61 A;  2ACZ B;  3JSV A;  4M0W A;  1FEH A;  2NBW B;  3I5J C;  2CHZ A;  3PVL A;  3I9V 1;  1E9M A;  2I1K A;  1YN3 A;  3NUH B;  1E6E B;  1H7X A;  1TKG A;  2LXC A;  1MI0 A;  1H4R A;  2WXO A;  4ZRQ A;  4GDK A;  2ZPY A;  4LNF A;  1T0R C;  1MG4 A;  3A33 B;  2XN9 C;  1AAR A;  4BFR A;  2WU5 B;  4B0E A;  2PVG C;  3AED B;  3TBL D;  3NS8 A;  2LHD A;  3V6C B;  1J7B A;  2CJO A;  2KFK B;  5IOI A;  3NVW A;  3Q8A A;  1STE A;  4A9A A;  3AEB B;  3AE2 B;  3WAP A;  4GDL A;  4RGM A;  1UWX A;  2AWT A;  2JVC A;  5EE1 A;  2FUH B;  1TY2 A;  1XXG A;  2G9H D;  1TYG B;  4ITK A;  5T8I A;  5DCN A;  1YQ4 B;  2BS3 B;  3WAM A;  2BPS A;  4K7U A;  2CHX A;  4L1B A;  3VH3 B;  1FCL A;  1CK1 A;  2RGF A;  3DPD A;  3U4E G;  3TSS A;  3QCA A;  1EU3 A;  2KOX A;  3CMM B;  4BOZ B;  3ABV B;  2IY1 B;  4PYZ A;  1J0G A;  1C1Y B;  3H9D A;  4F1S A;  1VD2 A;  4ICU A;  2I38 A;  1UNS A;  4OVU A;  2A5U A;  2MLB A;  4M00 A;  3SHQ A;  4ZRI A;  4P1B C;  1F2R I;  2L83 A;  2LJI A;  5AUI A;  3AEG B;  1TKY A;  3LDZ E;  2KTF A;  5IN7 A;  1XO3 A;  2HDE A;  2DWQ A;  1LGR A;  2B3A A;  4XGA B;  1AYF A;  3N3K B;  2NTS A;  3B9J A;  1KTK A;  3MHZ A;  2J0K A;  3TEY A;  3RUI B;  2AL3 A;  2PEA A;  1T6B X;  5EE3 A;  4W9G A;  1FXA A;  2XK5 A;  4A6Q A;  4BKS A;  1V1P A;  3HM3 A;  4MSQ B;  5D7G A;  1E5W A;  4E3C A;  4CHK A;  5BYS A;  4K81 A;  4A90 A;  4AJY B;  2KDB A;  3DQV A;  4I6L B;  2KMC A;  2RDB C;  4A20 A;  4YSZ B;  1OEY J;  1V80 A;  3DOW A;  2RD0 A;  2WS3 B;  1VLB A;  3LB8 C;  4EZL A;  3RNA C;  4K7W A;  1F9J A;  3DBH B;  3VFK A;  1MVK A;  4NAW B;  2NBU A;  2YVC A;  1YD8 U;  4PS7 A;  1AN8 A;  4EE2 A;  2KHW B;  2NVU I;  4IG7 B;  1T0Q C;  2SEB D;  2BYE A;  1PQS A;  5CTR C;  2LGY A;  3AE3 B;  4RCO A;  2V3P A;  1J7A A;  2QMT A;  3TEW A;  1KRH A;  1XLP A;  1L6U A;  1WE7 A;  4A3P A;  2OJR A;  3N1Y C;  3KYC D;  2JUO A;  3OG5 A;  2JWU A;  4KKJ A;  4HPP A;  1E0Z A;  1LXD A;  2D3A A;  3APC A;  4C4V B;  3SFE B;  3QC8 B;  2PMV A;  4AJW A;  1DOI A;  2PW9 A;  2YEP F;  3HHM A;  2KC2 A;  1R4M I;  3GZN I;  2N4F A;  4WAF A;  1RWS A;  2KK8 A;  2GBM A;  3NY5 A;  2O6V A;  1V49 A;  3AE6 B;  4YTN B;  4IM2 A;  5BMI A;  3RNG C;  1TKE A;  3ZJU A;  2JY6 A;  2LWP A;  5L95 C;  1JWU D;  4WQM A;  3KVF B;  1WR6 E;  4OZC A;  2FCQ A;  1UGM A;  1LM8 B;  1Y8R C;  3B2G A;  4JLC A;  3NVZ A;  2LRW A;  4DDG D;  2WXH A;  3VHT C;  3UQA A;  2M17 A;  4LNN A;  2BW2 A;  4IDI A;  3KYD D;  4MJS B;  3ZO5 B;  4QAY A;  2HJ8 A;  1VCB A;  2KXJ A;  1JW9 D;  3VUY A;  4A8X C;  3P4R B;  3CF4 A;  4JPS A;  4C7Y A;  1JWA D;  4XC2 A;  4WH4 A;  4F7Z A;  3N32 A;  2LHE A;  3KWV A;  3AXC A;  2AL6 A;  1S3S G;  1F52 A;  2G3Q B;  4GMV A;  1IP9 A;  4B9K A;  4HVB A;  1XCQ L;  3HM6 X;  4HKZ E;  2LI5 A;  2GBK A;  4HKQ A;  2MP2 B;  4EOY A;  2C5L C;  1YIW A;  1J8C A;  2D11 A;  4NAM A;  2V3S A;  1E8W A;  2K9X A;  3VAW A;  3N1Z C;  4HRO A;  3PTF C;  1XLO A;  5HKH A;  4KSK C;  1R4N B;  1JQ4 A;  1FRD A;  2BQQ A;  2WXN A;  4W9H A;  4P7I A;  3VDZ A;  2KMM A;  2IO3 B;  5JH5 C;  3BK2 A;  5C1Z A;  1DYQ A;  5BMG A;  3I3T B;  3ZTD A;  1WYG A;  4RH6 A;  3Q8C A;  3N20 C;  4G50 A;  4B95 A;  4P6V F;  4WWP A;  3BK1 A;  4XDD A;  3V6E B;  5L83 A;  4NQK E;  5DPR A;  3N1X C;  1A70 A;  2R2Q A;  1V2Y A;  1VJK A;  4W9D A;  2KTR A;  1RFK A;  1OQY A;  1RFA A;  5E6N A;  2L0T A;  4ANX A;  4D2K A;  3WIM A;  2MHJ A;  2ONQ A;  5CHF A;  5JHB A;  4ZHO A;  1IGD A;  3QK0 A;  2N1V A;  3DBR I;  3H8H A;  1BML C;  3H7P A;  1SSN A;  4JE3 B;  3ZNG C;  3UF8 A;  4IOI E;  2UWQ A;  4TQ0 A;  3L0W B;  1WXA A;  2GB1 A;  3PRM B;  1V5T A;  2CU1 A;  1HQR D;  4WIP A;  2NPT B;  4DK5 A;  2GBN A;  1RM6 C;  1UGJ A;  4NNJ B;  1SB3 C;  4MH8 A;  4ARC A;  1K53 A;  4WWO A;  1Z2M A;  4NJ7 A;  1C4P A;  1TT5 B;  1UWM A;  4FHK A;  1DOY A;  4KDL B;  3PSE B;  4AP4 C;  2ZCC A;  1VZ6 A;  1PGX A;  1D6E C;  4HDQ A;  1WH3 A;  2WNM A;  3WAN A;  1K50 A;  2MSE D;  1E8Z A;  1EM7 A;  3EEC A;  4TKN A;  1IGC A;  2V4I B;  3MC0 B;  4DHJ B;  1N63 A;  1NEK B;  1AW7 A;  1GUA B;  3O13 A;  1ZKH A;  3VRB B;  5H92 C;  1ZXI A;  2WX0 A;  3BYY B;  3AN1 A;  3GE3 C;  4Q2J A;  1C4A A;  2FNJ B;  3WCQ A;  1J19 A;  1HA5 A;  3CSF A;  2M0A A;  3UIO B;  3VVW B;  1Y56 A;  1D5X C;  3AI5 A;  3IFW B;  3HIZ A;  3EFU A;  1WGR A;  4CO7 A;  4IWQ A;  2JZP A;  3VUX A;  2WDT B;  1WXQ A;  1N5W A;  2UU7 A;  1V6E A;  3DBS A;  4KZ0 A;  2LZ6 A;  3ZIM A;  2M56 B;  1FXI A;  3SR6 A;  2N9P C;  3E9S A;  1WM3 A;  3AEC B;  1XT9 B;  2N7E A;  3BIN A;  2W3R A;  2DEN B;  3UGB B;  1ZDV A;  4TQ1 A;  5KHO A;  1FM0 D;  1SJH D;  3DWG C;  5BYR A;  1GNU A;  1JRU A;  1TJE A;  4OVZ A;  4WAA A;  4B0M A;  4C00 A;  3E56 A;  4PS8 A;  3APD A;  2G1E A;  4C7Z A;  4WUR A;  3LXF A;  1OQQ A;  2FCN A;  2JQR B;  4FJY A;  4IWP A;  2FBW B;  2BVC A;  2BKR B;  2KWV B;  4ASW C;  4GLS C;  2QEJ C;  2INC C;  2DZM A;  1WGY A;  2WXI A;  2MCN B;  2WX1 A;  1K52 A;  3R8B A;  2KLC A;  3NVV A;  1MHX A;  5EE9 A;  3S2A A;  3Q3M C;  3A1Q B;  1EU4 A;  1BXT A;  4XE0 A;  4BVU C;  4YTM B;  1FCC C;  3AEE B;  3DBL I;  2IBI B;  4RGT A;  2Z0D B;  3U30 A;  1L0X B;  3R2I A;  1FD6 A;  1L5P A;  2HTM E;  3OLM D;  4I6N B;  1YQ3 B;  2KDE B;  2QIL A;  4DXG A;  3W5V B;  1OQR A;  5J17 A;  3W1S A;  2QJL A;  4HEA 1;  1F77 A;  1WJ6 A;  3VH4 B;  3AM9 A;  5D2M B;  5AZG A;  4KGS A;  1Q10 A;  1YOV B;  3AE5 B;  3GP7 A;  3MC9 A;  2PJH A;  3R66 C;  4KSL C;  1ZE3 D;  4E71 A;  4RNA A;  1IBX B;  1S1Q B;  2O2V A;  1D5Z C;  2W3S A;  1ZOY B;  3FKY A;  1D4B A;  2VRR B;  2TSS A;  3T3N A;  4FUL A;  1YN5 A;  2KX0 A;  3TEZ A;  1KOT A;  1JWM D;  1NDD A;  4KGR A;  4RGO S;  5CX3 A;  1QOF A;  2MJD A;  3MP9 A;  3OJ4 B;  2D3G A;  2K8B A;  3FIL A;  2D3C A;  2KWC A;  3QIJ A;  2N0S B;  1WM2 A;  1VR9 A;  1UBQ A;  2BB5 A;  3PGE A;  1UD7 A;  1UBI A;  1YMH E;  2J7Q B;  4IM0 A;  1Q5W B;  3FC4 A;  1ET9 A;  2JSV X;  2KN4 A;  2Q5W D;  1GAQ B;  2X38 A;  1NVI D;  4J3O D;  2QC8 A;  3MFG A;  2VZK D;  4JL9 A;  4JWU C;  2Z59 B;  4PK1 A;  1N6Z A;  3AV8 A;  4REZ A;  1TS2 A;  3W5U B;  5AEK B;  2KFJ A;  2N9X A;  3Q3J A;  2KJH B;  3CWI A;  1GT8 A;  2MH7 A;  3KLS X;  2N9L A;  4FJZ A;  3IT6 B;  2OJW A;  2NTT A;  2WU2 B;  3APF A;  4W9I A;  4LJP B;  4KGT A;  2DZJ A;  1R7S A;  4USA A;  4FAD A;  3A9K B;  2IO1 B;  4XX5 A;  3ZQ4 A;  1KLV A;  2NCN A;  2FAZ A;  1OFF A;  2W9N A;  3QQ8 B;  4II2 B;  1QOB A;  3TEX A;  1Q0W B;  3IAM 1;  1WSP A;  4DHJ D;  3PS6 A;  1L0V B;  4WJQ A;  2GOW A;  4MM3 A;  3H6N A;  1H7W A;  2K0P A;  4K3C A;  3GB1 A;  3N30 A;  1WXM A;  2KNB A;  5HG2 A;  4BZA A;  1TY0 A;  3JW0 X;  2MW5 A;  4US9 A;  2DYM A;  4N58 A;  2MBQ A;  2ASQ A;  4I6P A;  3MJW A;  4OZB A;  2CU3 A;  1H8C A;  1QOA A;  2BWE S;  4L23 A;  2PTL A;  4N9F 4;  1EUV B;  1GG3 A;  1I4H A;  3M95 A;  4EZK A;  3GS2 A;  1UH6 A;  3UIN B;  1ZDX A;  4MGK E;  4YSX B;  1JAL A;  4HPM B;  3A9J B;  2IO0 B;  1JML A;  1I42 A;  2LXA A;  3Q8B A;  3W1S C;  1WX7 A;  3OAW A;  5EE0 A;  2KD0 A;  4ZHP A;  3HRD D;  2DAJ A;  2JXX A;  3U7D A;  3KH0 A;  2J42 A;  4YWG G;  4HLE A;  4FA6 A;  3C19 A;  2WGS A;  4FLH A;  1NYR A;  3TMP B;  2IO2 B;  4EUT A;  2KQ7 A;  3IG3 A;  1WJN A;  1NI3 A;  4LJO B;  2IYD B;  2BB6 A;  2IGG A;  2GMI C;  1UEL A;  4FHJ A;  2N1W A;  1T0S C;  3PRP B;  1UUP A;  1EWC A;  1WGH A;  3NS1 A;  1JRO A;  4TV3 A;  3M3J A;  4W9L A;  4IWO A;  1KLG D;  5E6P A;  1E10 A;  3ZKJ C;  4JQW C;  2J53 A;  3V62 A;  4N6E B;  2V0G A;  2CKH B;  2WDV B;  4K3B A;  1V81 A;  2HD5 B;  2BF8 B;  3EA6 A;  3RFZ B;  2BKF A;  4S0R A;  4IW0 A;  3RT3 B;  2RDG A;  4RFB A;  2ZVO A;  2EKI A;  4DXA B;  1QQR A;  3A1Q A;  3LJ3 A;  5GXG B;  2RMM A;  1NI2 A;  4RM9 A;  4OVV A;  3ZDT A;  2O6V D;  3SFD B;  1MJD A;  4NY0 A;  4LK0 M;  3L17 A;  1WI0 A;  2N9K A;  1T3Q A;  3TJP A;  2I1J A;  3SU8 X;  2BTE A;  3A4R A;  1WGG A;  2DNF A;  3IVF A;  4URK A;  3UIP B;  1WJU A;  3NRZ A;  3IBE A;  4MSM B;  4F8C B;  1GB4 A;  4EKU A;  5JZE B;  1HTO A;  2ICI A;  3NG0 A;  2W82 A;  2LFI A;  4BAX A;  4ZDV A;  1CJE A;  3P63 A;  2XBB C;  1B1Z A;  2KO3 A;  4AUQ C;  1TS4 A;  2QCZ A;  3ZNZ B;  4J6I A;  5FR6 A;  3EGR A;  3DVG Y;  1FPY A;  3R7R A;  3AE8 B;  2JWZ A;  2LRU A;  4C56 C;  2IGD A;  4LDT D;  3O65 B;  3Q6B A;  3C0R B;  2KQ4 X;  4NJC A;  2IPK D;  3TIX A;  1KFY B;  1X1M A;  3GOE A;  3EC8 A;  3P2B A;  2BS2 B;  1ACC A;  2R2O A;  3MTN B;  2C7N B;  3ZRF A;  1V9J A;  1N62 A;  1N61 A;  3ZW3 A;  1NYQ A;  3U7Z A;  1WMH B;  4HPL B;  4LCD E;  3ML8 A;  4K7S A;  2L0F A;  3V60 A;  1R4M B;  3H1U A;  3GZN B;  2JRI B;  2DBY A;  3PV1 A;  3ZYY X;  2KFK A;  3ZTC A;  1I4R A;  5D94 A;  1K8R B;  4WWM A;  5IAA C;  2C7H A;  3ZJT A;  5JHA A;  1LFD A;  4ANU A;  3RN9 C;  1M4V A;  1FNU A;  1QIL A;  1N60 A;  2GRI A;  3BY4 B;  3JSV B;  2JZ3 B;  4M0W B;  3PZD A;  3ZRC A;  2L3Z A;  3Q69 A;  2AQ2 B;  1VDV A;  2K8C A;  3SDL C;  3KUD B;  1RRB A;  4CQN A;  3WAL A;  4WJP A;  1MHH E;  4GU2 A;  2N7D A;  4GDK B;  1I35 A;  2K22 A;  4ZOH C;  3SEB A;  2K1F A;  4XWW A;  3QWZ B;  4AS1 A;  3PPA A;  1XQQ A;  2WYQ A;  1SIJ A;  3Q3F A;  4KIK B;  5BYQ A;  3Q14 C;  2N7J A;  2D10 A;  2J0M A;  2L8J A;  2L52 A;  2GLS A;  2E3T A;  2ZW1 A;  2KAC A;  1WWT A;  2WQY B;  2VZK B;  4TMA B;  1T5X D;  4HWI B;  3VUW A;  3ETR A;  1GTE A;  4KZC A;  1G6J A;  4GDL B;  3QJZ A;  4NPN A;  4AOF A;  5TR5 A;  4HJG E;  1I4G A;  4LNK A;  3EFC A;  2MWS B;  2FCM A;  2ZNV B;  3C8Y A;  5FK9 C;  3BWU D;  4ZRP A;  4X57 B;  2V1Y A;  1XCT L;  1V5O A;  1TZO A;  1WXV A;  3MC8 A;  1WY8 A;  1L2N A;  4RF1 A;  1V1O A;  1FFU A;  3CST A;  3AU5 A;  3PT2 B;  4A3O A;  3ZJV A;  2KZR A;  4HDO A;  1WYW B;  1ZPS A;  2D5G A;  1SBB B;  2L00 B;  2PLP A;  2JYE A;  4IKG A;  2GBR A;  1C78 A;  1FNW A;  4W9J A;  2L76 A;  1WE6 A;  2LAS A;  3OWE B;  4FN2 A;  2EEL A;  1FO4 A;  1TIF A;  1PGA A;  5CHW A;  2MQJ A;  4XYC A;  3RMK C;  1C3T A;  5CHV C;  3KW5 B;  4NAW A;  2C7M B;  1F0Z A;  1YJJ A;  2J0J A;  1MPE A;  5D3D A;  3ENE A;  2CS4 A;  4KV2 A;  1JWB D;  3ONS A;  1P3Q U;  2KJ6 A;  3KUZ A;  2EMT A;  1XF5 L;  2K6Q A;  4MT5 A;  3BVM A;  2W55 A;  3L4P A;  3ZVV A;  4W9K A;  2K3U A;  3UI3 A;  3DVN U;  4MGY E;  2BYT A;  3GE8 C;  3DBR B;  4DBG A;  4W9C A;  2XK5 B;  4WQO B;  1V1P B;  3VTW A;  4C4V A;  3PZ8 A;  1WGK A;  3X0W A; 
#chains in the Genus database with same CATH homology
 1SJE D;  1P7F A;  2JSV X;  2PVO D;  1ZUD 2;  1CZP A;  2WXP A;  3AE3 B;  4RCO A;  2KN4 A;  1J7A A;  2FE8 A;  2Q5W D;  2QMT A;  2V3P A;  1GAQ B;  1KRH A;  1XLP A;  2X38 A;  3HVZ A;  3TEW A;  1L6U A;  1FNV A;  1NVI D;  4J3O D;  4LTU A;  3N9Y C;  3VR9 B;  2VZK D;  3MFG A;  3FIL B;  4JWU C;  2JWU A;  3T3O A;  3AV8 A;  1ET6 A;  4REZ A;  1TS2 A;  4KKJ A;  3W5U B;  1E0Z A;  2LUM A;  3CWI A;  3AE9 B;  2OED A;  3SFE B;  4NZL B;  2WLB A;  2YEP B;  1I7H A;  1GT8 A;  2PMV A;  1DOI A;  2MH7 A;  2PW9 A;  2YEP F;  3KLS X;  2N9L A;  3IT6 B;  4JX1 C;  1JCK B;  2NTT A;  2WU2 B;  2V3N A;  2CJN A;  4WAF A;  2I2Y A;  2WXK A;  1RWS A;  2MJ3 A;  2J4X A;  2KAJ A;  4KGT A;  2H88 B;  3AE6 B;  3RPF C;  4YTN B;  1QF6 A;  1R7S A;  4USA A;  5BMI A;  3ZQ4 A;  1TKE A;  3ZJU A;  1C4C A;  5G5H A;  1KLU D;  1OFF A;  2OHF A;  1PFD A;  1QOB A;  3TEX A;  1JWU D;  2WP9 B;  5C3J B;  4WQM A;  3IAM 1;  1WSP A;  3P1M A;  2WXL A;  4US8 A;  4OZC A;  2WXJ A;  1L0V B;  3B2G A;  1KF6 B;  3NVZ A;  3W9C B;  3BII D;  3EUB 2;  2WDQ B;  2WXH A;  4DQO C;  1H7W A;  1JWS D;  2K0P A;  1I4Q A;  1ZXH A;  3GB1 A;  1DGJ A;  2JYT A;  5HG2 A;  2BW2 A;  4IDI A;  1TY0 A;  3R2T A;  4US9 A;  2DYM A;  1FMA D;  4N58 A;  1VZ7 A;  1L4Z B;  3P4Q B;  5BMH A;  4YTP B;  1BUI C;  1SEB D;  3FAH A;  4O1N A;  2DLB A;  3VR8 B;  3BVZ A;  3V05 A;  2WXG A;  1JW9 D;  4OZB A;  2CU3 A;  1WRI A;  1GTH A;  1QOA A;  4A8X C;  3P4R B;  3CF4 A;  4L23 A;  1V8C A;  4JPS A;  4C7Y A;  2PTL A;  1JWA D;  1I4H A;  1QOG A;  4WH4 A;  3GS2 A;  4MM3 B;  2AQ3 B;  2LHE A;  1ZDX A;  1GB1 A;  2L1A A;  4YSX B;  1JAL A;  3KWV A;  1JML A;  2Y3A A;  1E7P B;  5H8Y E;  1IUE A;  3Q8B A;  3V3X A;  5EE0 A;  2RDH A;  1XCQ L;  4KKI A;  3ZGZ A;  2JXT A;  5LNK 1;  4ZHP A;  4MAC A;  4HKZ E;  1HZ6 A;  3HRD D;  1PUT A;  2J42 A;  1HXY D;  4HKQ A;  4YWG G;  2INP E;  1PYW D;  1NYR A;  3VQI A;  2M19 A;  1TS5 A;  2Y5C A;  4NAM A;  2BS4 B;  1NI3 A;  1CQV A;  5E6J A;  3AE4 B;  2K9X A;  3J9C A;  1C79 A;  4HRO A;  2MJE A;  2BB6 A;  3VRA B;  1XLO A;  2IGG A;  5C2T B;  1JQ4 A;  3HVD A;  1UUP A;  1EWC A;  1FRD A;  3NS1 A;  1JRO A;  2WXN A;  3AEA B;  2H89 B;  1I4P A;  2WXR A;  2KMM A;  3NZ3 A;  2B76 B;  1KLG D;  4UDU C;  1E10 A;  3BK2 A;  3KWL A;  4ZYS A;  5JXV A;  1DYQ A;  5BMG A;  1ZP0 B;  1GPX A;  2J53 A;  1WYG A;  4YXD B;  4RH6 A;  4N6E B;  3Q8C A;  2V0G A;  2AQ1 B;  4RGN A;  2WDV B;  4P6V F;  3BK1 A;  1VRA B;  3EA6 A;  4XDD A;  3RFZ B;  1A70 A;  3W5V B;  2LGI A;  2Z8L A;  3AH7 A;  1VJK A;  2RDG A;  1F2R C;  1SE4 A;  1RFK A;  2SAK A;  4RFB A;  4XWT A;  4D2K A;  2EKI A;  1L4D B;  5HHD G;  4H2A A;  1QQR A;  5I4D A;  1XEE A;  2E6X A;  2ONQ A;  5GXG B;  1I4X A;  4ZHO A;  4PT5 A;  2RMM A;  3PZ7 A;  1IGD A;  4LLG M;  3SFD B;  2W54 A;  4LK0 M;  4DXF A;  3H8H A;  1BML C;  2N9K A;  1T3Q A;  2LMC A;  1RYJ A;  2GI9 A;  1YN4 A;  2BTE A;  1YNT E;  1SSN A;  4JE3 B;  1P7E A;  2IJ0 A;  4OW0 A;  1JRP A;  4IOI E;  4N59 A;  4TQ0 A;  4P16 A;  3DWM A;  3NRZ A;  2INN E;  2GB1 A;  3PO0 A;  1ENF A;  1C9F A;  1HQR D;  1GB4 A;  3I57 A;  4WIP A;  4TSS A;  2ICI A;  1RM6 C;  1UGJ A;  1J7C A;  3P4S B;  1SB3 C;  2QIE B;  3IT4 B;  3AMZ A;  4MH8 A;  4ARC A;  2W82 A;  1K53 A;  2LFI A;  1CJE A;  1FIQ A;  3P63 A;  1SE3 A;  1B1Z A;  1C4P A;  1UWM A;  1C77 A;  1TS4 A;  2LEK A;  3AE1 B;  4L2Y A;  1DOY A;  1VZ8 A;  5TSS A;  5MPO A;  1VZ6 A;  1PGX A;  3IXS A;  1C76 A;  2BT6 A;  3EGR A;  1D6E C;  3AE8 B;  4C56 C;  2IGD A;  2WXF A;  2WNM A;  3Q8F A;  2DYO A;  3CIR B;  1K50 A;  1XLQ A;  1B9R A;  1EM7 A;  2KQ4 X;  1IGC A;  4NJC A;  2FUG 1;  2IPK D;  2V4I B;  2WXQ A;  3Q8E A;  2PKO A;  3MC0 B;  3TUO A;  1XLN A;  1KFY B;  1FRR A;  3MJ5 A;  1N63 A;  2ON8 A;  4JWS C;  1SXT A;  5HI1 A;  1NEK B;  2BS2 B;  1ACC A;  1AW7 A;  5FR3 A;  3O13 A;  1KH0 A;  1N62 A;  2KWD A;  1N61 A;  3AB5 A;  3BVG A;  3VRB B;  2WXM A;  1QT9 A;  1NYQ A;  3P42 A;  1ZXI A;  5AUK A;  3BYY B;  3AN1 A;  4Q2J A;  5H92 C;  3U7Z A;  1C4A A;  2JU6 X;  1TS3 A;  2R61 A;  2ZW0 A;  1HZ5 A;  2ACZ B;  3U52 E;  3WCQ A;  2WDR B;  4M0W A;  1HA5 A;  2K5P A;  1FEH A;  1EWY C;  2M0A A;  2PIA A;  2DBY A;  3I9V 1;  1FFV A;  1Y56 A;  1D5X C;  1E9M A;  3ZYY X;  3BYT B;  1YN3 A;  3NUH B;  1E6E B;  1H7X A;  1I4R A;  1TKG A;  1MI0 A;  4WWM A;  5HFY A;  3AE7 B;  2IGH A;  2JZP A;  2WXO A;  1WXQ A;  1N5W A;  3BZD B;  4ZRQ A;  3ZJT A;  2M56 B;  1FXI A;  3P4P B;  3SR6 A;  4R3D A;  3IAS 1;  1M4V A;  1FNU A;  2XN9 C;  3E9S A;  1QIL A;  3AEC B;  2WU5 B;  1SE2 A;  2MEK A;  2PVG C;  1N60 A;  2GRI A;  4B0E A;  3AED B;  1ESF A;  2LHD A;  3LYY A;  2W3R A;  3KQ4 A;  1J7B A;  1ZDV A;  4TQ1 A;  2CJO A;  1FM0 D;  2AQ2 B;  3Q69 A;  1SJH D;  1VDV A;  3URY A;  3NVW A;  3Q8A A;  3DWG C;  2JX5 A;  1STE A;  4YSY B;  5BYR A;  4CQN A;  1TJE A;  4OVZ A;  4A9A A;  1AWD A;  1MHH E;  4B0M A;  1L6V A;  3FC4 A;  3AEB B;  3AE2 B;  3E56 A;  4GDK B;  4RGM A;  1UWX A;  4A55 A;  2K22 A;  4XDC A;  4ZOH C;  2G1E A;  2BBC A;  5EE1 A;  4WUR A;  4C7Z A;  3LXF A;  1TY2 A;  1OQQ A;  2JQR B;  2FBW B;  1XXG A;  3SEB A;  2G9H D;  1TYG B;  4XWW A;  4ITK A;  4FXC A;  4AS1 A;  1SIJ A;  5T8I A;  4GLS C;  1YQ4 B;  2BS3 B;  5BYQ A;  2N7J A;  4L1B A;  2QEJ C;  2WXI A;  2L52 A;  1K52 A;  2E3T A;  3B2F A;  2ZW1 A;  3R8B A;  2KAC A;  1WWT A;  1FCL A;  1CK1 A;  3W2D A;  3NVV A;  2IDY A;  2WQY B;  1MHX A;  2VZK B;  4TMA B;  1NEN B;  5EE9 A;  1L0Y B;  1EU4 A;  1PGB A;  3U4E G;  1BXT A;  3TSS A;  1T5X D;  4XE0 A;  4YTM B;  1EU3 A;  1GTE A;  1FCC C;  3ETR A;  3AEE B;  4GDL B;  3ABV B;  2Y5P A;  4OZA A;  1YJI A;  4RGT A;  4AQ7 A;  4HJG E;  1L0X B;  1I4G A;  5D3I B;  3AEF B;  1PDX A;  3R2I A;  1LO5 D;  1L5P A;  1FD6 A;  2I38 A;  1UNS A;  3C8Y A;  2HTM E;  5FK9 C;  3BWU D;  4ZRP A;  1YQ3 B;  2QIL A;  4DXG A;  1IBX A;  1F2R I;  1XCT L;  2L83 A;  2LJI A;  3AEG B;  4HRS A;  1TZO A;  5AUI A;  4YT0 B;  1TKY A;  1OQR A;  4RF1 A;  1V1O A;  1FFU A;  3U2S C;  1XO3 A;  2HDE A;  2DWQ A;  3ZJV A;  3W1S A;  2QJL A;  4HEA 1;  1AYF A;  2RPV A;  1DOX A;  1F77 A;  1ZPS A;  2D5G A;  2NTS A;  3B9J A;  1SBB B;  2PLP A;  5FKA C;  1KTK A;  2JYE A;  3AM9 A;  3MHZ A;  4IKG A;  4KGS A;  1Q10 A;  1C78 A;  3TEY A;  3AE5 B;  1FNW A;  5G5G A;  1SF0 A;  3GP7 A;  3NVY A;  3OWE B;  2EEL A;  2XNA C;  4C80 A;  1FO4 A;  1PGA A;  1T6B X;  1ZE3 D;  2KDM A;  1V97 A;  5EE3 A;  4RNA A;  4A6Q A;  1FXA A;  2QSD A;  1F0Z A;  1IBX B;  1V1P A;  1YJJ A;  1ROE A;  2AX5 A;  1QKZ A;  1GOZ A;  1MPE A;  4OHJ A;  5D3D A;  5D7G A;  1D5Z C;  1N5X A;  2J52 A;  2W3S A;  3HUI A;  1ZOY B;  5BYS A;  1D4B A;  1HEZ E;  1D5M C;  1JWB D;  4A90 A;  2TSS A;  3T3N A;  2NMQ A;  1YN5 A;  3TEZ A;  4KX6 B;  1JWM D;  1XF5 L;  4KGR A;  4RGO S;  1QOF A;  4MT5 A;  4YSZ B;  2MJD A;  3MP9 A;  4RF0 A;  4ARI A;  3BVM A;  2W55 A;  3L4P A;  2K3U A;  3UI3 A;  2WS3 B;  1VLB A;  2BYT A;  3LB8 C;  3FIL A;  2N0S B;  1MVK A;  1VR9 A;  4NAW B;  2L32 A;  2BB5 A;  1V1P B;  1AN8 A;  4EE2 A;  1QLB B;  3PZ8 A;  1K51 A;  1WGK A;  1YMH E;  2SEB D;  1ET9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...