1YQ4B

Avian respiratory complex ii with 3-nitropropionate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
b'AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq4B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq4B01
4ZOHC 3WCQA 1FIQA 2JX5A 3FAHA 1GPXA 2ACZB 3AE7B 3AB5A 1PUTA 2KMMA 2Y5CA 5AUKA 3NS1A 3AECB 1NYRA 3LXFA 1AWDA 2LEKA 3AE1B 1J7CA 1ROEA 2PKOA 3RPFC 2WDQB 1QLBB 4JWUC 3SR6A 1XLOA 1KRHA 2E3TA 1I7HA 5EE0A 1E0ZA 2B76B 2PIAA 4IDIA 1GT8A 2W55A 1FFUA 3NVYA 4C7ZA 1FFVA 1VJKA 1XLPA 3AEBB 2MH7A 2QJLA 3AN1A 5G5HA 1NENB 5AUIA 5EE9A 2N0SB 1JWAD 3AEAB 5EE3A 3P4SB 1E10A 2KAJA 1N60A 4FXCA 2CJNA 5EE1A 3AE9B 4KX6B 1FRDA 1SB3C 1UWMA 2EKIA 4N59A 2M56B 1ZOYB 3VRAB 1J7BA 1OQRA 1ZP0B 2AX5A 1V97A 2W3RA 3DWMA 3AE3B 1F0ZA 3AE4B 3SFDB 1GTEA 1QOGA 4P6VF 4YSXB 4YSZB 3P1MA 4US9A 1E6EB 1FRRA 1TJEA 3AE6B 1RYJA 2QIEB 2W3SA 1H7WA 3L4PA 1XLNA 4US8A 3ZYYX 1JQ4A 2MJ3A 2MJEA 1FXAA 2K22A 1N61A 1J7AA 1T3QA 3AEGB 2WDVB 1L6UA 3AM9A 2L52A 4HRSA 3VR8B 3B2GA 1N5XA 1E7PB 1CJEA 2CU3A 3CIRB 3DWGC 2PVGC 2WP9B 1L6VA 3LB8C 1WYGA 3P4PB 1XO3A 1IUEA 4YTNB 1QOBA 1TYGB 3HRDD 1TKYA 3NVWA 1JWBD 1E9MA 2BT6A 4YTPB 1EWYC 3W9CB 1DOXA 1N63A 3KWLA 3AEFB 3VRBB 5G5GA 3CWIA 1JROA 1ZXIA 4YTMB 1FMAD 3AEDB 2WS3B 1RFKA 1H7XA 1WGKA 1YQ3B 1PFDA 3NVZA 3BIID 2MJDA 3B9JA 3SFEB 1OFFA 1TKGA 1VDVA 1JALA 2H89B 2H88B 3CF4A 1JRPA 1QOAA 1YJJA 2G1EA 1YQ4B 1L0VB 1CZPA 1OQQA 2DWQA 2OHFA 4WWMA 1NVID 1QOFA 2HTME 3EUB2 5MPOA 4ZHPA 1B9RA 1QF6A 3HUIA 4YSYB 1NI3A 1WXQA 3NVVA 4YT0B 2L83A 1FM0D 1DGJA 3AV8A 3PO0A 4YXDB 1YJIA 4LTUA 1DOYA 3FC4A 1SF0A 4JWSC 3HVZA 5H92C 2W54A 3AE5B 1AYFA 1N5WA 3W5VB 1KFYB 4WQMA 4USAA 3AE8B 1XLQA 4JX1C 2WDRB 1L5PA 5C3JB 1RM6C 1KF6B 1PDXA 1DOIA 2BS3B 2Q5WD 2FBWB 1GAQB 3AH7A 1FXIA 1JW9D 2CJOA 1QT9A 3AEEB 5GXGB 5H8YE 2K5PA 3AE2B 2JQRB 3W5UB 1V8CA 5C2TB 1N62A 3P63A 1SIJA 1TKEA 3B2FA 3P4QB 1NEKB 3P4RB 2DBYA 3AMZA 4C7YA 4ITKA 3ETRA 4N58A 1A70A 4N6EB 1GTHA 3VR9B 2M19A 1ZUD2 1FO4A 2K9XA 2PVOD 1WRIA 1NYQA 3NRZA 2BS2B 4A9AA 3ABVB 4HROA 2WU2B 2BS4B 2WLBA 1R7SA 2WQYB 4C80A 1RWSA 1VLBA 4ZHOA 1WWTA 2WU5B
chains in the Genus database with same CATH superfamily
1FIQA 1F52A 2PJHA 1K52A 2Y5CA 2YVCA 2DZKA 1J19A 1GB1A 1J7CA 3VXWA 3RNGC 2N4FA 1I7HA 2MH7A 4EE2A 1J0GA 1JWAD 3ZNZB 3AEAB 3NS8A 4LNOA 1PGXA 2KOXA 3L0WB 4MJSA 4A3PA 3APCA 2JT4B 3TBLD 1XXGA 4AJWA 3QC8B 5C23A 4W9KA 1FXTB 1MJDA 3DWGC 5AZHA 2WP9B 2LHDA 3UQAA 1KOTA 1XD3B 2KFKB 3T3NA 2AL6A 2X8XX 3ZKJC 3Q8BA 3SHQA 2WXHA 3VFKA 3JVZX 1ZXIA 2NR2A 4FHJA 1FMAD 4GDLB 4KIKB 4FADA 4RF0A 4XDDA 2FUHB 3BVZA 3RNBC 4B6WA 2Y3AA 1L2NA 1TZ1A 1QKZA 2KT7A 1PGBA 5DPTA 4HJGE 4YSYB 2IGHA 1IPGA 3CSTA 3Q8EA 3AE5B 1XLQA 2O2VB 1DOIA 2BS3B 1HEZE 2BB5A 1GAQB 3KUCB 1FXIA 3PS6A 4MSMB 1V80A 4ANWA 2ZNVB 3AE2B 2E6XA 4GOCA 1FO4A 2K9XA 3IT6B 4EZKA 2J0KA 2WXQA 5G55A 2DHZA 4CQNA 2ZVOA 5BYRA 1R7SA 4MGIE 4PS8A 3UF8A 1XF5L 4AJYB 3NS1A 1C77A 1FNUA 2IBIB 4F8CB 2BBCA 4E71A 2B76B 4LK0M 1YD8U 2LJ5A 1D4BA 3KWVA 3FILB 2LGIA 4KSLC 2N9PC 3QIJA 4PT5A 3RCZA 3U7DA 1WM3A 3Q8FA 2DYBA 1GOZA 1T0QC 1C4CA 2AQ3B 1OEYJ 2LGSA 3V05A 2KDIA 3ZVVA 4EZLA 2KN4A 3ML9A 4L2YA 2MBBB 2XK5A 1B1ZA 1TKYA 1FEHA 1WJNA 2WNMA 4HCNB 1UELA 2TSSA 1TY2A 2M1MA 2BYVE 2L7RA 4RF1A 2WXFA 2DAJA 3CF4A 2VH1A 3R7RA 5TSSA 1CZPA 2LHEA 2KWVB 3QK0A 1F2RC 3NVVA 2L83A 2IY0B 1FM0D 3PO0A 4FN2A 1YJIA 2WGSA 2O6VA 1JWMD 3B1LX 2I2YA 1R4MI 1YNTE 2JRHA 4USAA 1MPEA 2AQ1B 3PLVA 2ZPNA 2C7HA 3IBEA 3V3XA 3NY5A 4WURA 4DQOC 4P6VF 2JY6A 3ZQ4A 2DBYA 3JSVA 4GSWA 4C4VB 1IYFA 3NJTA 1V5TA 4HDOA 2KWCA 1M4VA 4MGZE 3KUDB 1L4ZB 1Q10A 4J6IA 3OAWA 4ASWC 2KVZA 1VLBA 3W1SC 4PS3A 3FAHA 1J8CA 5TR5A 1NBFC 4MSQB 1QLBB 1ACCA 5EE0A 2X38A 2HD5B 2HJ1A 5KHQA 4RGNA 2SEBD 3I63C 4ZRJA 1C79A 2WDTB 4WAAA 1Q1OA 1C4PA 1PGAA 2LXCA 1J7BA 1F0ZA 2QHOA 4FULA 4FBJB 2MP2B 4XGAB 3AE6B 1H7WA 4LNKA 2LMCA 2DENB 4HRSA 3B2GA 1QQRA 1E7PB 4DHZB 5JXVA 4E3CA 2PVGC 2LVOA 4MACA 3NG0A 2YLMA 1UZXB 2MA9B 4C56C 2GBNA 2O2VA 3Q3NC 4AP4C 4YTMB 3ZJVA 3ALBA 4TSSA 3NZSA 1WX7A 4LCDE 3BINA 1YJJA 1YJ1A 4K7UA 1P7FA 1WIAA 3DHGC 4CYEA 4BAXA 4JLCA 1GG3A 3L10B 4M00A 2O6VD 1AYFA 1E7UA 2MW5A 4M01A 2FBWB 2D3GA 2K5PA 3P63A 1Y8RC 1E7VA 4D2KA 2ZPYA 3DVNV 1L7YA 1C9FA 4P7IA 3PSEB 5HFYA 3FILA 2HE7A 5J2RA 3OJ4B 3MFGA 2BS4B 2WQYB 3PLUA 1WH3A 3RMKC 3NUHB 2KDEB 1UGJA 2KO3A 4AQ7A 2R2QA 1IBXB 1JWSD 1XLOA 3RNCC 3V62A 4W9DA 1E8YA 2N1VA 3RN9C 1WZ3A 3AE9B 2KC1A 3ZDTA 2I1KA 1I4RA 1GTEA 4GU2A 3TEYA 2KHWB 1R4NI 2KZRA 2QIEB 3PZDA 1D6EC 2MJ3A 4AWJA 1WYGA 1YQBA 4L23A 1DOXA 1C78A 1P98A 3NOBA 3DVNU 4RM9A 2GBMA 2M4NA 2D3CA 3ZIMA 4W9CA 1OFFA 4GIVA 2J0MA 2YEPF 2CS4A 4C4VA 2OHFA 1NVID 3EUB2 4ZHPA 2JYEA 4EUTA 3TIXA 3GB1A 5EDSA 1WM2A 4B95A 3QAQA 1IGCA 4KKIA 5FR3A 2GMIC 3FC4A 1SF0A 5KHOA 2KWUB 1BUIC 3AE8B 1P0RA 2G4SA 4IWOA 1CQVA 3TMPB 4AOFA 4DHJB 2DZMA 2JXTA 3B2FA 2KQ7A 1EM7A 3P4QB 5BYQA 4ITKA 1VRAB 3M3JA 4GXBA 1WRIA 1H8CA 3L17A 1HZ6A 1WRDB 2SAKA 4ZDVA 3DVGX 4WWNA 2IJ0A 2MP2A 1MHHE 2WHIA 3ZNGC 2WX1A 3DCGA 2ZEQA 2KMAA 3H9DA 5BYSA 4IWQA 1UUPA 1AN8A 1QILA 4IWPA 3AEBB 3N30A 4JIOU 2CR5A 3A33B 3PRZA 4W9EA 3E56A 2BYTA 2GI9A 3ENEA 2RGFA 2D10A 3A9KA 4OZAA 1J7AA 2WDVB 3HK0A 3KYCD 2KVRA 5HKHA 3RFZB 5T8IA 3P4PB 1WGGA 1I4QA 1X1MA 1YX6B 2J53A 2FNJB 2INNE 2JVCA 1WSPA 3DBLB 2BWES 2ASQA 1K8RB 2W3RA 4ANXA 1V1OA 1F9JA 1SE3A 1VDVA 1UBQA 2Y5PA 1Q5WB 3EA6A 1I4HA 1MVKA 2WX0A 2DWQA 4PK1A 2QEJC 2N1WA 4DXAB 2AQ2B 1I4XA 3DQVA 2KLGA 4WJOA 5H92C 4RNAA 1KFYB 1ZXHA 3W5VB 5LXIB 3ZJUA 4LNFA 4OHJA 5L83A 4O1NA 3Q8CA 1IBXA 2DYOA 3PHWB 4NZLB 2KDMA 3L08A 3BYTB 3BVGA 4N6EB 4NQLB 2JXXA 2RMMA 4MM3B 2K0PA 3KW5B 3QWZB 1SJHD 4C80A 2WU5B 2J42A 3N32A 3Q3JA 2JZZA 3KYDD 1P1AA 2KMCA 4UDUC 4K1RB 3AECB 3BK2A 1YIWA 1NYRA 1Q0WB 2LEKA 4JPSA 2ZCCA 4LNNA 1V5OA 2WDQB 4OZCA 4JWUC 2NPTA 1E0ZA 2WXJA 4IDIA 1GT8A 4OVUA 1FFVA 1WFYA 1XLPA 3APFA 3VDZA 3C0RB 1V1PB 2L05A 2N0SB 1TS5A 2N9KA 3I57A 5GMVA 3X0WA 1XCQL 2N9EB 1ZP0B 2BWFA 1EF5A 3OWEB 1FRRA 3UINB 2C7NB 2ZNVC 3AU4A 4K3CA 1T3QA 3MC9A 3TJPA 2BB6A 1I42A 5BMHA 3VR8B 1N5XA 3PZ7A 1TIFA 2WXLA 4A3OA 3M95A 1V6EA 4MH0E 2C7MB 3DVGY 4G0NB 2JF5A 2PE6B 3H8HA 4HVBA 4HLEA 2JU6X 3WAPA 4XDCA 3WIMA 3PTFC 4A90A 4TQ1A 1ZKHA 2D3AA 3CF6E 4L1BA 1T0YA 3R66C 4WAFA 1SE9A 2MBOA 4NNJB 1WXQA 5BMIA 2HJ8A 2BYEA 1XCTL 2FE8A 4W9FA 5IKCM 2GBJA 2ZCBA 2RR9A 3AEEB 2JQRB 1C1YB 2RDHA 1TKEA 2JUOA 3AMZA 5D2MB 3P4RB 3DBHI 3VVWB 3ZDMC 1GB4A 3TL5A 2J7QB 2NBUA 3JW0X 1D3ZA 3NZUA 3VH4B 3KUZA 2WLBA 1EWCA 2GLSA 1LGRA 3ZLZA 4K81A 3NHEB 1VR9A 4I6NB 2KMMA 3ZNHB 1UGMA 2AWTA 3HHMA 2L3ZA 2D11A 3BYYB 2M0XA 2V4LA 2LD9A 2W55A 3NVYA 1NENB 3VTWA 3VUXA 3AXCA 2AYOB 3Q14C 3FKYA 1E8ZA 3IXSA 2C9WB 3SFDB 3A1QA 2WXMA 2JYTA 1L0YB 4A55A 4I6LB 1WGHA 3ZYYX 3AEGB 1OQYA 2BVCA 4P1BC 3Q3FA 1CJEA 2QMTA 3LDZE 2WXKA 1E9MA 1GUAB 2BT6A 1N63A 4E74A 3KWLA 4KZ0A 3QCAA 1LFDA 2WS3B 3ZXVA 2EMSA 4DHJD 2K1FA 4BVUC 2V3SA 4EKUA 1L0VB 4WH4A 1QOFA 1TS3A 4MM3A 3Q2AC 5CHWA 2LGYA 3I3TB 1TBEA 3SDLC 3VUYA 2OOBB 3EFCA 2EELA 2ON8A 3HVZA 2BW2A 5DPSA 2RDBC 2DAFA 2D5GA 2BTEA 1MHXA 2N7EA 5CTRC 4DDGD 2XNAC 5FK9C 3AH7A 4JQWC 2CKHB 1ET9A 3K9OB 2WWZA 2KXJA 2M19A 1ZUD2 3MJWA 4ARCA 2J52A 4M0WA 2MHJA 4WQOB 1SJED 4ICVA 3CMMB 2BKFA 1UH6A 5EE1A 3Q6BA 3AB5A 5HHDG 4RGMA 3AE1B 3SR6A 3DHIC 3TEXA 2PIAA 3N1ZC 2DLBA 5CX3A 1QZEA 5EE9A 2WXGA 2KAJA 1UWMA 4B0MA 3J9CA 4S0RA 2AX5A 4PS7A 4YSXB 4YSZB 2K3UA 1E6EB 1V9JA 4US8A 3PT2B 2UU7A 1T6BX 2CHXA 3ZW3A 4HXDA 2PMVA 4KV2A 1YX5B 3HRDD 2KFKA 4ZYNA 3NVWA 4RFBA 1V86A 1XT9B 3W9CB 1U4AA 2LVQA 3BWUD 3DBRB 3A9JB 3VRBB 4GDLA 4KIKA 5HI1A 2L0TA 4HPLB 4KDLB 2V0GA 3NVZA 2KD0A 4K7WA 3WANA 2ZJDA 4G11A 3B9JA 3N3KB 4W9GA 5IO9A 2NS5A 2PLPA 3PPAA 1FCLA 2FIFA 3DDCB 1FNVA 4ARIA 4GLSC 4WQMA 3GZNB 1C3TA 1KF6B 1JW9D 1DYQA 2MLBA 3VTUA 1M94A 1RLFA 1MG4A 3TSSA 3TCAA 2M0AA 3ZXRA 4XX5A 4WWOA 1KTKA 1P9DU 2ZW1A 1RWSA 3HVDA 2LGDA 1JCKB 4HPPA 1WZ0A 2RPQA 5L95C 3IFWB 5AUKA 2AL3A 1KH0A 1ZE3D 3ZGZA 3N1XC 1K53A 1HZ5A 3ONSA 3T3OA 2RD0A 2IO1B 3GE8C 3EFUA 1YN4A 2KYWA 5E6PA 2N9LA 4EEWA 2M56B 5FR6A 2Z0DB 3RNAC 3P1MA 1S3SG 2D07B 3DBSA 4OVZA 5D6JB 1BXTA 5DPWA 4H2AA 3AM9A 1PYWD 2XBBC 4XWTA 3KH0A 3CIRB 1JRUA 3RULA 4DHZE 2I38A 1IUEA 1JWBD 3CSFA 3IAS1 3UGBB 3V60A 1HTOA 4HCPB 2JPHA 4URKA 4NJ6A 1YQ3B 3EC8A 2LGXA 1D5MC 2UWQA 3TEZA 3LJ3A 3UQBA 3RUIB 3ML8A 3H7PB 1JRPA 4GB9A 2G1EA 1OQQA 1EU3A 3U2SC 3U7ZA 2FCMA 2HTME 5MPOA 2CHZA 4K7SA 1QF6A 2KQSA 4KVGB 1RRBA 4LLGM 2IO3B 4G50A 1E8XA 1WGRA 4IC7B 3UI3A 1K50A 2ONQA 4OVVA 1EU4A 5H8YE 4ICUA 2CJOA 3W5UB 2UYZB 3DHHC 3D32A 4N58A 3GP7A 3VR9B 1HA5A 3K9PB 4LDTB 3SU8X 3AI5A 3O13A 3N9YC 2IO0B 1VZ7A 2A5UA 1PUTA 4RCOA 3PRPB 1SGHA 2V9HA 3ZNID 2E3TA 1F2RI 2MBQA 4QAYA 2W9NA 2NTSA 1SBBB 4NAMA 4IUMB 1OTRB 5EE3A 4ZRPA 2CJNA 1SB3C 1FRDA 2JZPA 3GS2A 3Q3OC 2M8SA 1ESFA 3U8ZA 4MJSB 4US9A 2K39A 3ZRFA 5BMGA 1VZ6A 1L6UA 2Y5BB 2L0FA 2L1AA 3C19A 2IYDB 4YTNB 3UIOB 1RFAA 2JWUA 2MBEA 3IAM1 1BMLC 1FCCC 2DZIA 2J0JA 1KLUD 1STEA 5FKAC 4A20A 4W9LA 2MSED 3AEDB 2GBRA 4I6PA 4MDKE 4XE0A 4YL8A 4A6QA 1QOAA 2LASA 1YQ4B 4LNIA 2WXOA 4M02A 1KJTA 5I4DA 2EKEC 4EOYA 1LO5D 2D3BA 4KGSA 4PYUA 3I9V1 1N5WA 2FAZA 3W1SA 2L00B 1T5XD 2KX0A 4II2B 3H7SA 4Q2JA 1RM6C 5IN7A 1N62A 4WJNA 4MH8A 4OZBA 4RGOS 3A4RA 4K3BA 4DXFA 5BO4B 3PREA 2GBKA 3PRMB 1SE4A 4P16A 2MQJA 4GMVA 2PKOA 3ECIA 1ZGUB 1KM7A 2B3AA 3RI7C 5E6JA 2IY1B 3IVFA 1KLVA 2KN5A 4RM8A 2LVPA 4KGTA 4RGTA 1FPYA 2IO2B 1A5RA 3P4SB 1E10A 4BOZB 3L13A 3M63B 3Q3MC 1WY8A 1C76A 4M8NA 1XLNA 3EECA 2IGGA 2K22A 5D7GA 3QHTA 2KK8A 3RZFA 1P7EA 1UD7A 1ZDXA 4CHKA 2WXPA 2OJRA 1SEBD 3MHSD 4HKQA 3M62B 3TEWA 2K25A 3A4SC 2ZW0A 1JROA 2Z0EB 1RFKA 4MGYE 1VD2A 3KLSX 1ENFA 2PTLA 3V6EB 3MJ5A 5E6OA 3EHVA 1UBIA 1ISNA 1D5XC 1F77A 3TUOA 4P1CC 4GDKB 1DGJA 3R3MA 1ET6A 3PGEA 2LJIA 4LTUA 2W54A 2OEDA 2KACA 4HKZE 1WGDA 4IW0A 5CHFA 1YN3A 2WDRB 3MC0B 3T9LA 3U30A 1XEEA 2BGFA 4FA6A 5GXGB 5AZFA 4DBGA 1SE2A 1NI2A 3ETRA 3JSVB 1GTHA 2PVOD 1NYQA 2BS2B 4KGRA 2G4DB 1ZPSA 4JGHB 5LXHA 4IM3A 4XWWA 1TS4A 4TKNA 2WXRA 4ZHOA 3MHZA 1WWTA 1GPXA 2Z8LA 3LXFA 1R4MB 1VZ8A 2ICIA 3B08A 4S17A 4PYZA 1F1HA 1MFWA 1NDDA 3AN1A 5AUIA 2ZVNA 1WXVA 2LZ6A 3DBLI 4YWGG 3PZ8A 4XZ4A 5D3DA 1OQRA 2FCQA 1MG8A 4RMAA 3QA8A 2IZVB 2W3SA 3HIZA 3VTVA 4NY0A 2DZJA 4MGKE 4GN1A 2CU3A 1LM8B 3LB8C 1ZW7A 1XO3A 2QSDA 1QOBA 5AZGA 1TYGB 4XC2A 4J3OD 2PEAA 1VCBA 3AEFB 1L4DB 1TS2A 3MP9A 2L32A 2MJDA 4BBNC 1GNUA 4ANVA 3SFEB 2H89B 2RSUA 2K6QA 1YN5A 4ZRQA 3WAMA 4LDTD 2JSVX 1B9RA 4DXGA 4B0EA 1T0RC 2GOWA 2N9XA 4KKJA 3W1YA 5JZEB 2KTRB 1D5ZC 3QARA 4ANUA 3ZTCA 1E5WA 3S2AA 1WMHB 3KQ4A 2KDBA 2R2OA 2G3QB 5LLIA 1V8CA 1PQSA 1SIJA 2JZ3B 1LXDA 3RD2A 3NRZA 3QX1A 2RPVA 4DWFA 3ZO5B 2FIDA 2NBVB 2MEKA 2ZZPB 3VHTC 1WI0A 2WXIA 3AE7B 5D3IB 2VRRB 4WWPA 2QILA 4NAWB 4ZRKA 5DCNA 5JHBA 4B9KA 3AULA 1ROEA 2N7DA 3RPFC 2G45B 3OJ3A 4KDIC 4HK2A 1IP9A 4G3XB 1FFUA 4C7ZA 1V1PA 1N6ZA 1E90A 4HPMB 5J18A 3PVLA 3VUWA 4KX6B 3DWMA 1ZOYB 4W9IA 1GJZA 3AE3B 4OW0A 3WAOA 2IGDA 4N9F4 1QOGA 2PE9A 4JE3B 3ZRCA 1RYJA 2LUMA 3L4PA 2K6DB 1N61A 3RT3B 4AS1A 4ZRIA 2L52A 4MELA 2INCC 1Y56A 2A4ZA 4GDKA 5E6NA 5IA7A 1L6VA 2LRWA 2JWZA 3BY4B 4IKGA 3WA0A 2CU1A 2GB1A 2M17A 2NBWB 4YTPB 2KANA 3E9SA 1V2YA 1S1QB 3CWIA 2LXAA 2MRPA 4IM2A 3V6CB 2IDYA 1R4NB 1WX8A 3GOEA 1XQQA 1SIFA 3NZ3A 2KFJA 2MCNB 4JL9A 2KTFA 2R61A 3IHPC 4LJPB 4EFOA 1YOVB 5DPRA 1K51A 2WYQA 2BQQA 2K8CA 2QC8A 3N20C 4ZYSA 5C2TB 3HM3A 4R3DA 4BKTA 4XYCA 3R7QA 1A70A 3BVMA 1YMHE 3DOWA 2VZKB 2NCNA 4A9AA 2C60A 3ABVB 2DX5B 1TT5B 4NQKE 4BZAA 3WCQA 4BBNF 4DK5A 2ACZB 5IP4D 1LQBA 3MTNB 2I1JA 3QQ8B 2HTHA 4W9JA 2K8BA 3C8YA 2IPKD 2W82A 4LJOB 1UNSA 2QJLA 5G5HA 1N60A 4N59A 4TV3A 4HWIB 2KLCA 3L54A 4BFRA 4TQ0A 1FXAA 4AUQC 5JHAA 3A9KB 2KX3A 4RH6A 1WJ6A 2KQ4X 1WX9A 1Z2MA 3T8MA 5G2NA 3RYTA 4WJQA 1WXAA 2KTRA 1EF1A 1ZDVA 1AW7A 3U52E 1SXTA 3ZTDA 5AEKB 5G5GA 1WMHA 1EUVB 3RNFC 1PFDA 4REZA 3P42A 2NMQA 1HTQA 2J4XA 1I4GA 3SD5A 2KJ6A 2H88B 4EZJA 1IGDA 4F1SA 3HUIA 2YEPB 4II3B 4WIPA 3AV8A 3L16A 1OGWA 4NJ7A 3RNEC 4YXDB 4KSKC 1JWUD 1AARA 4JWSC 1H4RA 4X57B 1L0XB 3VQIA 4NAWA 4JX1C 1L5PA 5C3JB 2Q5WD 2XEWA 2L76A 1HXYD 3BK1A 1NEKB 3URYA 3Q69A 4BOSC 4FJVB 3H1UA 1HQRD 4WJPA 3W2DA 2EMTA 1FD6A 2PW9A 2WU2B 1OEYA 2CHWA 2JRIB 1P3QU 2V4IB 2JX5A 3JYUA 1TTNA 2BF8B 3VH3B 1TY0A 1KRHA 1CK1A 4BKGA 2REXA 1T0SC 2NPTB 4ACFA 1V81A 2VH2A 2AEHA 1Z5SB 4HJKA 3DBRI 4HDQA 3U4EG 1E8WA 4FXCA 2EKIA 1RAXA 1V97A 2LI5A 2G9HD 1MI0A 3WALA 1TJEA 2MWSB 4FLHA 1JQ4A 2MJEA 3R2IA 3MC8A 4F7ZA 1WJ4A 2HDEA 2WXNA 1WF9A 5CHVC 3PV1A 5LNK1 5IOIA 4FJZA 3GZNI 1EWYC 3A9JA 3B0AA 1KLGD 1GC6A 5HG2A 1G6JA 3R8BA 1EO6A 3DPDA 2DYMA 1H7XA 3UIPB 4IG7B 3BIID 1JALA 2QDFA 1BT0A 4WWMA 4MEMA 1JMLA 2BYFA 2FUG1 1GC7A 4YT0B 2KJHB 2QCZA 4CO7A 1DOYA 2LFIA 3O65B 4MT5A 3IT4B 1FNWA 2BKRB 1HE8A 4IOIE 1PDXA 1V49A 2PPHA 1QT9A 3APDA 2LRUA 1WR1A 4C7YA 4BKSA 2K8HA 1CMXB 4TUUA 4HROA 3OG5A 2MX2A 1WYWB 2DNFA 2Z59B 4ZOHC 3AU5A 3IG3A 1WXSA 2OJWA 2FCSA 1AWDA 1WE7A 4C00A 4NJCA 1TZOA 3Q8AA 2LUEA 5IAAC 1VJKA 2KWDA 1UF0A 3DBHB 1UWXA 1SSNA 2LWPA 1I4PA 3VRAB 3R2TA 4NPNA 2N7JA 4A8XC 5J17A 4IM0A 3AE4B 1WGYA 3A1QB 2KDFB 3HM6X 3I5JC 1C4AA 3SEBA 3PHXB 1TGZB 2INDC 3N1YC 3P2BA 5D94A 2KJRA 4W9HA 1WR6E 1WXMA 3QJZA 1I35A 4M8MA 3KVFB 4TMAB 2GRIA 4GGQA 3OLMD 2V3NA 1WGKA 2NTTA 3EGRA 5C1ZA 2KNBA 2FCNA 2RDGA 3ZJTA 1TKGA 3H7PA 4DDID 2V3PA 3LYYA 2VZKD 3V61A 1NI3A 2C5LC 4HEA1 2XK5B 2NVUI 1WE6A 2KKCA 3VAWA 5JH5C 3BZDB 4KZCA 2BPSA 3GE3C 2MBHA 3RZWC 3H6NA 4BKSD 1WJUA 2INPE 2KC2A 2V1YA 4FHKA 4M0WB 2D2QA 4FJYA 3ZUNA 2L8JA 2XN9C 2O6VB 3X23A
chains in the Genus database with same CATH topology
1JCKB 1FIQA 1K52A 2WXIA 3AE7B 5D3IB 1MHHE 2Y5CA 5AUKA 2QILA 4NAWB 1GB1A 1KH0A 1J7CA 1ROEA 1ZE3D 3ZGZA 3RPFC 1K53A 1HZ5A 3T3OA 5BYSA 1I7HA 1UUPA 1FFUA 4C7ZA 1AN8A 1QILA 1V1PA 3AEBB 2MH7A 4EE2A 4N58A 1JWAD 1YN4A 3AEAB 2N9LA 4KX6B 1PGXA 1ZOYB 2M56B 3DWMA 3AE3B 4OW0A 2IGDA 3E56A 2BYTA 2GI9A 1QOGA 3P1MA 4JE3B 4OVZA 1RYJA 2LUMA 3L4PA 1XXGA 4OZAA 1BXTA 1N61A 1J7AA 4H2AA 4AS1A 2WDVB 3AM9A 1PYWD 2L52A 4XWTA 1Y56A 3CIRB 3DWGC 2WP9B 1L6VA 3RFZB 2I38A 2LHDA 5T8IA 3P4PB 1IUEA 1I4QA 4IKGA 1JWBD 2GB1A 2XN9C 2J53A 3IAS1 3T3NA 4YTPB 2INNE 3E9SA 3Q8BA 1WSPA 2WXHA 3CWIA 1ZXIA 2W3RA 4GDLB 1FMAD 4RF0A 4XDDA 1YQ3B 1V1OA 1SE3A 1D5MC 3BVZA 3TEZA 2Y3AA 1VDVA 1QKZA 2Y5PA 2IDYA 1JRPA 3EA6A 1I4HA 1MVKA 2G1EA 1OQQA 1EU3A 2DWQA 3U2SC 3U7ZA 2HTME 1PGBA 2QEJC 5MPOA 4HJGE 1QF6A 4YSYB 2AQ2B 3NZ3A 2IGHA 1I4XA 4LLGM 2R61A 5H92C 3Q8EA 3AE5B 4RNAA 1KFYB 1ZXHA 3W5VB 3UI3A 1K51A 1K50A 1XLQA 3ZJUA 2ONQA 4OHJA 4O1NA 1DOIA 2BS3B 1HEZE 1EU4A 1GAQB 2BB5A 1FXIA 2CJOA 2DYOA 3Q8CA 5H8YE 1IBXA 4ZYSA 3AE2B 3W5UB 4NZLB 5C2TB 4R3DA 2KDMA 2E6XA 3BYTB 1A70A 3BVMA 3VR9B 1YMHE 1HA5A 3BVGA 3GP7A 4N6EB 2K9XA 3IT6B 1FO4A 2RMMA 2VZKB 4A9AA 2WXQA 4MM3B 3ABVB 2K0PA 4CQNA 5BYRA 1SJHD 3O13A 3N9YC 1R7SA 1VZ7A 4C80A 2WU5B 2J42A 3WCQA 2ACZB 1PUTA 1XF5L 4RCOA 4UDUC 3NS1A 3AECB 3BK2A 1NYRA 2LEKA 4JPSA 1C77A 1FNUA 2WDQB 4OZCA 4JWUC 2E3TA 2BBCA 1F2RI 1E0ZA 2B76B 2WXJA 4IDIA 3C8YA 1GT8A 2IPKD 2W82A 4LK0M 1FFVA 1UNSA 1XLPA 2NTSA 2QJLA 1D4BA 1V1PB 5G5HA 1SBBB 4NAMA 2N0SB 3KWVA 5EE3A 3FILB 1TS5A 2LGIA 2N9KA 1N60A 4ZRPA 2CJNA 1SB3C 4N59A 1FRDA 4PT5A 3I57A 2JZPA 3GS2A 1XCQL 1ZP0B 1ESFA 3Q8FA 4US9A 3OWEB 1GOZA 1FRRA 1C4CA 4TQ0A 5BMGA 1FXAA 2AQ3B 1T3QA 1VZ6A 1L6UA 2BB6A 3V05A 5BMHA 4RH6A 3VR8B 1N5XA 2KN4A 3PZ7A 4L2YA 2L1AA 2KQ4X 2WXLA 4YTNB 1B1ZA 1TKYA 1FEHA 2WNMA 2JWUA 3IAM1 1BMLC 1FCCC 1ZDVA 1AW7A 3U52E 1SXTA 1KLUD 1STEA 2TSSA 5FKAC 5G5GA 1TY2A 3H8HA 2JU6X 3AEDB 1PFDA 4REZA 3P42A 2NMQA 4XDCA 4XE0A 4RF1A 2J4XA 4A90A 1I4GA 2WXFA 4TQ1A 4A6QA 2H88B 3CF4A 1QOAA 4L1BA 1YQ4B 1CZPA 1IGDA 5TSSA 2WXOA 2LHEA 4WAFA 5I4DA 1F2RC 1LO5D 2YEPB 3HUIA 1WXQA 3NVVA 4WIPA 2L83A 1FM0D 3AV8A 3PO0A 4YXDB 1YJIA 5BMIA 1JWUD 4KGSA 4JWSC 1JWMD 1L0XB 2I2YA 3I9V1 1N5WA 1XCTL 2FE8A 3W1SA 1YNTE 4USAA 3VQIA 1MPEA 1T5XD 2AQ1B 4JX1C 1L5PA 5C3JB 4Q2JA 1RM6C 3V3XA 2Q5WD 3AEEB 4WURA 2JQRB 4DQOC 2RDHA 1HXYD 1N62A 4P6VF 3BK1A 1TKEA 3AMZA 1NEKB 3P4RB 2DBYA 4MH8A 3Q69A 4OZBA 4RGOS 3URYA 3ZQ4A 1GB4A 4DXFA 1HQRD 3W2DA 1FD6A 1M4VA 1L4ZB 2PW9A 2WU2B 1Q10A 2WLBA 1EWCA 1VLBA 1SE4A 4P16A 2V4IB 2JX5A 3FAHA 1VR9A 2KMMA 3BYYB 2PKOA 1QLBB 5E6JA 1ACCA 1TY0A 1KRHA 5EE0A 1CK1A 2X38A 2W55A 3NVYA 1NENB 2SEBD 4KGTA 4RGTA 4RGNA 3U4EG 3P4SB 1E10A 1C79A 4FXCA 2EKIA 1C4PA 1PGAA 1V97A 1J7BA 1F0ZA 3IXSA 3SFDB 2G9HD 2WXMA 1MI0A 2JYTA 1C76A 1L0YB 4A55A 1TJEA 3AE6B 1H7WA 1XLNA 3ZYYX 1JQ4A 2LMCA 2IGGA 2MJEA 2K22A 5D7GA 3AEGB 3R2IA 4HRSA 1P7EA 3B2GA 1QQRA 1E7PB 1CJEA 1ZDXA 2QMTA 5JXVA 2WXPA 2PVGC 2HDEA 2WXNA 1SEBD 4MACA 4HKQA 2WXKA 5LNK1 1E9MA 2BT6A 3TEWA 1EWYC 1N63A 1KLGD 5HG2A 3KWLA 4C56C 3R8BA 2ZW0A 1JROA 4YTMB 1RFKA 2WS3B 2DYMA 1H7XA 3ZJVA 3BIID 4TSSA 3KLSX 1ENFA 2PTLA 3MJ5A 1JALA 1D5XC 1F77A 1YJJA 1L0VB 1P7FA 4WH4A 3TUOA 4WWMA 1QOFA 1TS3A 1JMLA 2FUG1 4GDKB 4YT0B 1DGJA 1ET6A 2LJIA 4LTUA 2EELA 2ON8A 1DOYA 2LFIA 3HVZA 2BW2A 2W54A 2OEDA 2KACA 1AYFA 2D5GA 3IT4B 4HKZE 4MT5A 1MHXA 2BTEA 1FNWA 1YN3A 2WDRB 3MC0B 1XEEA 2XNAC 4IOIE 1PDXA 5FK9C 2FBWB 3AH7A 1QT9A 5GXGB 2K5PA 1SE2A 1ET9A 3P63A 4C7YA 3ETRA 4D2KA 1GTHA 2M19A 1ZUD2 1C9FA 2PVOD 5HFYA 3FILA 1NYQA 4ARCA 2BS2B 2J52A 4KGRA 4M0WA 1SJED 4HROA 1ZPSA 3MFGA 2BS4B 2WQYB 4XWWA 1TS4A 2WXRA 3NUHB 3MHZA 1WWTA 5EE1A 4ZOHC 4ZHOA 1UGJA 1GPXA 3AB5A 2Z8LA 5HHDG 3LXFA 1AWDA 1VZ8A 2ICIA 4RGMA 3AE1B 4AQ7A 1IBXB 4NJCA 1JWSD 3SR6A 1XLOA 1TZOA 3TEXA 2PIAA 3Q8AA 1VJKA 2KWDA 2DLBA 3AN1A 5AUIA 5EE9A 1UWXA 2WXGA 4YWGG 1SSNA 2KAJA 3PZ8A 3AE9B 1UWMA 5D3DA 4B0MA 3J9CA 1I4PA 3VRAB 1OQRA 3R2TA 2N7JA 2AX5A 4A8XC 3AE4B 1I4RA 1GTEA 3TEYA 4YSXB 4YSZB 2K3UA 1E6EB 2QIEB 2W3SA 1C4AA 1D6EC 4US8A 3SEBA 2MJ3A 1T6BX 2CU3A 3LB8C 1WYGA 1XO3A 2QSDA 1QOBA 2PMVA 1TYGB 4TMAB 3HRDD 3NVWA 4J3OD 4RFBA 4L23A 1DOXA 3W9CB 2GRIA 3BWUD 1C78A 3AEFB 3VRBB 5HI1A 2V3NA 1WGKA 1L4DB 1TS2A 2NTTA 3EGRA 3MP9A 3NVZA 2V0GA 2L32A 2MJDA 3B9JA 3SFEB 1OFFA 2RDGA 3ZJTA 1TKGA 2YEPF 2H89B 2PLPA 2V3PA 2OHFA 1YN5A 3LYYA 4ZRQA 1NVID 3EUB2 2VZKD 4ZHPA 2JYEA 2JSVX 1B9RA 4DXGA 1NI3A 3GB1A 1FCLA 4B0EA 1IGCA 4HEA1 4KKIA 5FR3A 3FC4A 1FNVA 1SF0A 4KKJA 4ARIA 4GLSC 1D5ZC 4WQMA 1BUIC 3AE8B 1KF6B 3KQ4A 1JW9D 1CQVA 3BZDB 1DYQA 1V8CA 2JXTA 1SIJA 3B2FA 1EM7A 3P4QB 5BYQA 4ITKA 1VRAB 2INPE 3TSSA 1WRIA 3NRZA 1HZ6A 2M0AA 2SAKA 2RPVA 1KTKA 2ZW1A 1RWSA 3HVDA 2IJ0A 2MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOH C;  3WCQ A;  1FIQ A;  2JX5 A;  3FAH A;  1GPX A;  2ACZ B;  3AE7 B;  3AB5 A;  1PUT A;  2KMM A;  2Y5C A;  5AUK A;  3NS1 A;  3AEC B;  1NYR A;  3LXF A;  1AWD A;  2LEK A;  3AE1 B;  1J7C A;  1ROE A;  2PKO A;  3RPF C;  2WDQ B;  1QLB B;  4JWU C;  3SR6 A;  1XLO A;  1KRH A;  2E3T A;  1I7H A;  5EE0 A;  1E0Z A;  2B76 B;  2PIA A;  4IDI A;  1GT8 A;  2W55 A;  1FFU A;  3NVY A;  4C7Z A;  1FFV A;  1VJK A;  1XLP A;  3AEB B;  2MH7 A;  2QJL A;  3AN1 A;  5G5H A;  1NEN B;  5AUI A;  5EE9 A;  2N0S B;  1JWA D;  3AEA B;  5EE3 A;  3P4S B;  1E10 A;  2KAJ A;  1N60 A;  4FXC A;  2CJN A;  5EE1 A;  3AE9 B;  4KX6 B;  1FRD A;  1SB3 C;  1UWM A;  2EKI A;  4N59 A;  2M56 B;  1ZOY B;  3VRA B;  1J7B A;  1OQR A;  1ZP0 B;  2AX5 A;  1V97 A;  2W3R A;  3DWM A;  3AE3 B;  1F0Z A;  3AE4 B;  3SFD B;  1GTE A;  1QOG A;  4P6V F;  4YSX B;  4YSZ B;  3P1M A;  4US9 A;  1E6E B;  1FRR A;  1TJE A;  3AE6 B;  1RYJ A;  2QIE B;  2W3S A;  1H7W A;  3L4P A;  1XLN A;  4US8 A;  3ZYY X;  1JQ4 A;  2MJ3 A;  2MJE A;  1FXA A;  2K22 A;  1N61 A;  1J7A A;  1T3Q A;  3AEG B;  2WDV B;  1L6U A;  3AM9 A;  2L52 A;  4HRS A;  3VR8 B;  3B2G A;  1N5X A;  1E7P B;  1CJE A;  2CU3 A;  3CIR B;  3DWG C;  2PVG C;  2WP9 B;  1L6V A;  3LB8 C;  1WYG A;  3P4P B;  1XO3 A;  1IUE A;  4YTN B;  1QOB A;  1TYG B;  3HRD D;  1TKY A;  3NVW A;  1JWB D;  1E9M A;  2BT6 A;  4YTP B;  1EWY C;  3W9C B;  1DOX A;  1N63 A;  3KWL A;  3AEF B;  3VRB B;  5G5G A;  3CWI A;  1JRO A;  1ZXI A;  4YTM B;  1FMA D;  3AED B;  2WS3 B;  1RFK A;  1H7X A;  1WGK A;  1YQ3 B;  1PFD A;  3NVZ A;  3BII D;  2MJD A;  3B9J A;  3SFE B;  1OFF A;  1TKG A;  1VDV A;  1JAL A;  2H89 B;  2H88 B;  3CF4 A;  1JRP A;  1QOA A;  1YJJ A;  2G1E A;  1YQ4 B;  1L0V B;  1CZP A;  1OQQ A;  2DWQ A;  2OHF A;  4WWM A;  1NVI D;  1QOF A;  2HTM E;  3EUB 2;  5MPO A;  4ZHP A;  1B9R A;  1QF6 A;  3HUI A;  4YSY B;  1NI3 A;  1WXQ A;  3NVV A;  4YT0 B;  2L83 A;  1FM0 D;  1DGJ A;  3AV8 A;  3PO0 A;  4YXD B;  1YJI A;  4LTU A;  1DOY A;  3FC4 A;  1SF0 A;  4JWS C;  3HVZ A;  5H92 C;  2W54 A;  3AE5 B;  1AYF A;  1N5W A;  3W5V B;  1KFY B;  4WQM A;  4USA A;  3AE8 B;  1XLQ A;  4JX1 C;  2WDR B;  1L5P A;  5C3J B;  1RM6 C;  1KF6 B;  1PDX A;  1DOI A;  2BS3 B;  2Q5W D;  2FBW B;  1GAQ B;  3AH7 A;  1FXI A;  1JW9 D;  2CJO A;  1QT9 A;  3AEE B;  5GXG B;  5H8Y E;  2K5P A;  3AE2 B;  2JQR B;  3W5U B;  1V8C A;  5C2T B;  1N62 A;  3P63 A;  1SIJ A;  1TKE A;  3B2F A;  3P4Q B;  1NEK B;  3P4R B;  2DBY A;  3AMZ A;  4C7Y A;  4ITK A;  3ETR A;  4N58 A;  1A70 A;  4N6E B;  1GTH A;  3VR9 B;  2M19 A;  1ZUD 2;  1FO4 A;  2K9X A;  2PVO D;  1WRI A;  1NYQ A;  3NRZ A;  2BS2 B;  4A9A A;  3ABV B;  4HRO A;  2WU2 B;  2BS4 B;  2WLB A;  1R7S A;  2WQY B;  4C80 A;  1RWS A;  1VLB A;  4ZHO A;  1WWT A;  2WU5 B; 
#chains in the Genus database with same CATH topology
 1FIQ A;  1F52 A;  2PJH A;  1K52 A;  2Y5C A;  2YVC A;  2DZK A;  1J19 A;  1GB1 A;  1J7C A;  3VXW A;  3RNG C;  2N4F A;  1I7H A;  2MH7 A;  4EE2 A;  1J0G A;  1JWA D;  3ZNZ B;  3AEA B;  3NS8 A;  4LNO A;  1PGX A;  2KOX A;  3L0W B;  4MJS A;  4A3P A;  3APC A;  2JT4 B;  3TBL D;  1XXG A;  4AJW A;  3QC8 B;  5C23 A;  4W9K A;  1FXT B;  1MJD A;  3DWG C;  5AZH A;  2WP9 B;  2LHD A;  3UQA A;  1KOT A;  1XD3 B;  2KFK B;  3T3N A;  2AL6 A;  2X8X X;  3ZKJ C;  3Q8B A;  3SHQ A;  2WXH A;  3VFK A;  3JVZ X;  1ZXI A;  2NR2 A;  4FHJ A;  1FMA D;  4GDL B;  4KIK B;  4FAD A;  4RF0 A;  4XDD A;  2FUH B;  3BVZ A;  3RNB C;  4B6W A;  2Y3A A;  1L2N A;  1TZ1 A;  1QKZ A;  2KT7 A;  1PGB A;  5DPT A;  4HJG E;  4YSY B;  2IGH A;  1IPG A;  3CST A;  3Q8E A;  3AE5 B;  1XLQ A;  2O2V B;  1DOI A;  2BS3 B;  1HEZ E;  2BB5 A;  1GAQ B;  3KUC B;  1FXI A;  3PS6 A;  4MSM B;  1V80 A;  4ANW A;  2ZNV B;  3AE2 B;  2E6X A;  4GOC A;  1FO4 A;  2K9X A;  3IT6 B;  4EZK A;  2J0K A;  2WXQ A;  5G55 A;  2DHZ A;  4CQN A;  2ZVO A;  5BYR A;  1R7S A;  4MGI E;  4PS8 A;  3UF8 A;  1XF5 L;  4AJY B;  3NS1 A;  1C77 A;  1FNU A;  2IBI B;  4F8C B;  2BBC A;  4E71 A;  2B76 B;  4LK0 M;  1YD8 U;  2LJ5 A;  1D4B A;  3KWV A;  3FIL B;  2LGI A;  4KSL C;  2N9P C;  3QIJ A;  4PT5 A;  3RCZ A;  3U7D A;  1WM3 A;  3Q8F A;  2DYB A;  1GOZ A;  1T0Q C;  1C4C A;  2AQ3 B;  1OEY J;  2LGS A;  3V05 A;  2KDI A;  3ZVV A;  4EZL A;  2KN4 A;  3ML9 A;  4L2Y A;  2MBB B;  2XK5 A;  1B1Z A;  1TKY A;  1FEH A;  1WJN A;  2WNM A;  4HCN B;  1UEL A;  2TSS A;  1TY2 A;  2M1M A;  2BYV E;  2L7R A;  4RF1 A;  2WXF A;  2DAJ A;  3CF4 A;  2VH1 A;  3R7R A;  5TSS A;  1CZP A;  2LHE A;  2KWV B;  3QK0 A;  1F2R C;  3NVV A;  2L83 A;  2IY0 B;  1FM0 D;  3PO0 A;  4FN2 A;  1YJI A;  2WGS A;  2O6V A;  1JWM D;  3B1L X;  2I2Y A;  1R4M I;  1YNT E;  2JRH A;  4USA A;  1MPE A;  2AQ1 B;  3PLV A;  2ZPN A;  2C7H A;  3IBE A;  3V3X A;  3NY5 A;  4WUR A;  4DQO C;  4P6V F;  2JY6 A;  3ZQ4 A;  2DBY A;  3JSV A;  4GSW A;  4C4V B;  1IYF A;  3NJT A;  1V5T A;  4HDO A;  2KWC A;  1M4V A;  4MGZ E;  3KUD B;  1L4Z B;  1Q10 A;  4J6I A;  3OAW A;  4ASW C;  2KVZ A;  1VLB A;  3W1S C;  4PS3 A;  3FAH A;  1J8C A;  5TR5 A;  1NBF C;  4MSQ B;  1QLB B;  1ACC A;  5EE0 A;  2X38 A;  2HD5 B;  2HJ1 A;  5KHQ A;  4RGN A;  2SEB D;  3I63 C;  4ZRJ A;  1C79 A;  2WDT B;  4WAA A;  1Q1O A;  1C4P A;  1PGA A;  2LXC A;  1J7B A;  1F0Z A;  2QHO A;  4FUL A;  4FBJ B;  2MP2 B;  4XGA B;  3AE6 B;  1H7W A;  4LNK A;  2LMC A;  2DEN B;  4HRS A;  3B2G A;  1QQR A;  1E7P B;  4DHZ B;  5JXV A;  4E3C A;  2PVG C;  2LVO A;  4MAC A;  3NG0 A;  2YLM A;  1UZX B;  2MA9 B;  4C56 C;  2GBN A;  2O2V A;  3Q3N C;  4AP4 C;  4YTM B;  3ZJV A;  3ALB A;  4TSS A;  3NZS A;  1WX7 A;  4LCD E;  3BIN A;  1YJJ A;  1YJ1 A;  4K7U A;  1P7F A;  1WIA A;  3DHG C;  4CYE A;  4BAX A;  4JLC A;  1GG3 A;  3L10 B;  4M00 A;  2O6V D;  1AYF A;  1E7U A;  2MW5 A;  4M01 A;  2FBW B;  2D3G A;  2K5P A;  3P63 A;  1Y8R C;  1E7V A;  4D2K A;  2ZPY A;  3DVN V;  1L7Y A;  1C9F A;  4P7I A;  3PSE B;  5HFY A;  3FIL A;  2HE7 A;  5J2R A;  3OJ4 B;  3MFG A;  2BS4 B;  2WQY B;  3PLU A;  1WH3 A;  3RMK C;  3NUH B;  2KDE B;  1UGJ A;  2KO3 A;  4AQ7 A;  2R2Q A;  1IBX B;  1JWS D;  1XLO A;  3RNC C;  3V62 A;  4W9D A;  1E8Y A;  2N1V A;  3RN9 C;  1WZ3 A;  3AE9 B;  2KC1 A;  3ZDT A;  2I1K A;  1I4R A;  1GTE A;  4GU2 A;  3TEY A;  2KHW B;  1R4N I;  2KZR A;  2QIE B;  3PZD A;  1D6E C;  2MJ3 A;  4AWJ A;  1WYG A;  1YQB A;  4L23 A;  1DOX A;  1C78 A;  1P98 A;  3NOB A;  3DVN U;  4RM9 A;  2GBM A;  2M4N A;  2D3C A;  3ZIM A;  4W9C A;  1OFF A;  4GIV A;  2J0M A;  2YEP F;  2CS4 A;  4C4V A;  2OHF A;  1NVI D;  3EUB 2;  4ZHP A;  2JYE A;  4EUT A;  3TIX A;  3GB1 A;  5EDS A;  1WM2 A;  4B95 A;  3QAQ A;  1IGC A;  4KKI A;  5FR3 A;  2GMI C;  3FC4 A;  1SF0 A;  5KHO A;  2KWU B;  1BUI C;  3AE8 B;  1P0R A;  2G4S A;  4IWO A;  1CQV A;  3TMP B;  4AOF A;  4DHJ B;  2DZM A;  2JXT A;  3B2F A;  2KQ7 A;  1EM7 A;  3P4Q B;  5BYQ A;  4ITK A;  1VRA B;  3M3J A;  4GXB A;  1WRI A;  1H8C A;  3L17 A;  1HZ6 A;  1WRD B;  2SAK A;  4ZDV A;  3DVG X;  4WWN A;  2IJ0 A;  2MP2 A;  1MHH E;  2WHI A;  3ZNG C;  2WX1 A;  3DCG A;  2ZEQ A;  2KMA A;  3H9D A;  5BYS A;  4IWQ A;  1UUP A;  1AN8 A;  1QIL A;  4IWP A;  3AEB B;  3N30 A;  4JIO U;  2CR5 A;  3A33 B;  3PRZ A;  4W9E A;  3E56 A;  2BYT A;  2GI9 A;  3ENE A;  2RGF A;  2D10 A;  3A9K A;  4OZA A;  1J7A A;  2WDV B;  3HK0 A;  3KYC D;  2KVR A;  5HKH A;  3RFZ B;  5T8I A;  3P4P B;  1WGG A;  1I4Q A;  1X1M A;  1YX6 B;  2J53 A;  2FNJ B;  2INN E;  2JVC A;  1WSP A;  3DBL B;  2BWE S;  2ASQ A;  1K8R B;  2W3R A;  4ANX A;  1V1O A;  1F9J A;  1SE3 A;  1VDV A;  1UBQ A;  2Y5P A;  1Q5W B;  3EA6 A;  1I4H A;  1MVK A;  2WX0 A;  2DWQ A;  4PK1 A;  2QEJ C;  2N1W A;  4DXA B;  2AQ2 B;  1I4X A;  3DQV A;  2KLG A;  4WJO A;  5H92 C;  4RNA A;  1KFY B;  1ZXH A;  3W5V B;  5LXI B;  3ZJU A;  4LNF A;  4OHJ A;  5L83 A;  4O1N A;  3Q8C A;  1IBX A;  2DYO A;  3PHW B;  4NZL B;  2KDM A;  3L08 A;  3BYT B;  3BVG A;  4N6E B;  4NQL B;  2JXX A;  2RMM A;  4MM3 B;  2K0P A;  3KW5 B;  3QWZ B;  1SJH D;  4C80 A;  2WU5 B;  2J42 A;  3N32 A;  3Q3J A;  2JZZ A;  3KYD D;  1P1A A;  2KMC A;  4UDU C;  4K1R B;  3AEC B;  3BK2 A;  1YIW A;  1NYR A;  1Q0W B;  2LEK A;  4JPS A;  2ZCC A;  4LNN A;  1V5O A;  2WDQ B;  4OZC A;  4JWU C;  2NPT A;  1E0Z A;  2WXJ A;  4IDI A;  1GT8 A;  4OVU A;  1FFV A;  1WFY A;  1XLP A;  3APF A;  3VDZ A;  3C0R B;  1V1P B;  2L05 A;  2N0S B;  1TS5 A;  2N9K A;  3I57 A;  5GMV A;  3X0W A;  1XCQ L;  2N9E B;  1ZP0 B;  2BWF A;  1EF5 A;  3OWE B;  1FRR A;  3UIN B;  2C7N B;  2ZNV C;  3AU4 A;  4K3C A;  1T3Q A;  3MC9 A;  3TJP A;  2BB6 A;  1I42 A;  5BMH A;  3VR8 B;  1N5X A;  3PZ7 A;  1TIF A;  2WXL A;  4A3O A;  3M95 A;  1V6E A;  4MH0 E;  2C7M B;  3DVG Y;  4G0N B;  2JF5 A;  2PE6 B;  3H8H A;  4HVB A;  4HLE A;  2JU6 X;  3WAP A;  4XDC A;  3WIM A;  3PTF C;  4A90 A;  4TQ1 A;  1ZKH A;  2D3A A;  3CF6 E;  4L1B A;  1T0Y A;  3R66 C;  4WAF A;  1SE9 A;  2MBO A;  4NNJ B;  1WXQ A;  5BMI A;  2HJ8 A;  2BYE A;  1XCT L;  2FE8 A;  4W9F A;  5IKC M;  2GBJ A;  2ZCB A;  2RR9 A;  3AEE B;  2JQR B;  1C1Y B;  2RDH A;  1TKE A;  2JUO A;  3AMZ A;  5D2M B;  3P4R B;  3DBH I;  3VVW B;  3ZDM C;  1GB4 A;  3TL5 A;  2J7Q B;  2NBU A;  3JW0 X;  1D3Z A;  3NZU A;  3VH4 B;  3KUZ A;  2WLB A;  1EWC A;  2GLS A;  1LGR A;  3ZLZ A;  4K81 A;  3NHE B;  1VR9 A;  4I6N B;  2KMM A;  3ZNH B;  1UGM A;  2AWT A;  3HHM A;  2L3Z A;  2D11 A;  3BYY B;  2M0X A;  2V4L A;  2LD9 A;  2W55 A;  3NVY A;  1NEN B;  3VTW A;  3VUX A;  3AXC A;  2AYO B;  3Q14 C;  3FKY A;  1E8Z A;  3IXS A;  2C9W B;  3SFD B;  3A1Q A;  2WXM A;  2JYT A;  1L0Y B;  4A55 A;  4I6L B;  1WGH A;  3ZYY X;  3AEG B;  1OQY A;  2BVC A;  4P1B C;  3Q3F A;  1CJE A;  2QMT A;  3LDZ E;  2WXK A;  1E9M A;  1GUA B;  2BT6 A;  1N63 A;  4E74 A;  3KWL A;  4KZ0 A;  3QCA A;  1LFD A;  2WS3 B;  3ZXV A;  2EMS A;  4DHJ D;  2K1F A;  4BVU C;  2V3S A;  4EKU A;  1L0V B;  4WH4 A;  1QOF A;  1TS3 A;  4MM3 A;  3Q2A C;  5CHW A;  2LGY A;  3I3T B;  1TBE A;  3SDL C;  3VUY A;  2OOB B;  3EFC A;  2EEL A;  2ON8 A;  3HVZ A;  2BW2 A;  5DPS A;  2RDB C;  2DAF A;  2D5G A;  2BTE A;  1MHX A;  2N7E A;  5CTR C;  4DDG D;  2XNA C;  5FK9 C;  3AH7 A;  4JQW C;  2CKH B;  1ET9 A;  3K9O B;  2WWZ A;  2KXJ A;  2M19 A;  1ZUD 2;  3MJW A;  4ARC A;  2J52 A;  4M0W A;  2MHJ A;  4WQO B;  1SJE D;  4ICV A;  3CMM B;  2BKF A;  1UH6 A;  5EE1 A;  3Q6B A;  3AB5 A;  5HHD G;  4RGM A;  3AE1 B;  3SR6 A;  3DHI C;  3TEX A;  2PIA A;  3N1Z C;  2DLB A;  5CX3 A;  1QZE A;  5EE9 A;  2WXG A;  2KAJ A;  1UWM A;  4B0M A;  3J9C A;  4S0R A;  2AX5 A;  4PS7 A;  4YSX B;  4YSZ B;  2K3U A;  1E6E B;  1V9J A;  4US8 A;  3PT2 B;  2UU7 A;  1T6B X;  2CHX A;  3ZW3 A;  4HXD A;  2PMV A;  4KV2 A;  1YX5 B;  3HRD D;  2KFK A;  4ZYN A;  3NVW A;  4RFB A;  1V86 A;  1XT9 B;  3W9C B;  1U4A A;  2LVQ A;  3BWU D;  3DBR B;  3A9J B;  3VRB B;  4GDL A;  4KIK A;  5HI1 A;  2L0T A;  4HPL B;  4KDL B;  2V0G A;  3NVZ A;  2KD0 A;  4K7W A;  3WAN A;  2ZJD A;  4G11 A;  3B9J A;  3N3K B;  4W9G A;  5IO9 A;  2NS5 A;  2PLP A;  3PPA A;  1FCL A;  2FIF A;  3DDC B;  1FNV A;  4ARI A;  4GLS C;  4WQM A;  3GZN B;  1C3T A;  1KF6 B;  1JW9 D;  1DYQ A;  2MLB A;  3VTU A;  1M94 A;  1RLF A;  1MG4 A;  3TSS A;  3TCA A;  2M0A A;  3ZXR A;  4XX5 A;  4WWO A;  1KTK A;  1P9D U;  2ZW1 A;  1RWS A;  3HVD A;  2LGD A;  1JCK B;  4HPP A;  1WZ0 A;  2RPQ A;  5L95 C;  3IFW B;  5AUK A;  2AL3 A;  1KH0 A;  1ZE3 D;  3ZGZ A;  3N1X C;  1K53 A;  1HZ5 A;  3ONS A;  3T3O A;  2RD0 A;  2IO1 B;  3GE8 C;  3EFU A;  1YN4 A;  2KYW A;  5E6P A;  2N9L A;  4EEW A;  2M56 B;  5FR6 A;  2Z0D B;  3RNA C;  3P1M A;  1S3S G;  2D07 B;  3DBS A;  4OVZ A;  5D6J B;  1BXT A;  5DPW A;  4H2A A;  3AM9 A;  1PYW D;  2XBB C;  4XWT A;  3KH0 A;  3CIR B;  1JRU A;  3RUL A;  4DHZ E;  2I38 A;  1IUE A;  1JWB D;  3CSF A;  3IAS 1;  3UGB B;  3V60 A;  1HTO A;  4HCP B;  2JPH A;  4URK A;  4NJ6 A;  1YQ3 B;  3EC8 A;  2LGX A;  1D5M C;  2UWQ A;  3TEZ A;  3LJ3 A;  3UQB A;  3RUI B;  3ML8 A;  3H7P B;  1JRP A;  4GB9 A;  2G1E A;  1OQQ A;  1EU3 A;  3U2S C;  3U7Z A;  2FCM A;  2HTM E;  5MPO A;  2CHZ A;  4K7S A;  1QF6 A;  2KQS A;  4KVG B;  1RRB A;  4LLG M;  2IO3 B;  4G50 A;  1E8X A;  1WGR A;  4IC7 B;  3UI3 A;  1K50 A;  2ONQ A;  4OVV A;  1EU4 A;  5H8Y E;  4ICU A;  2CJO A;  3W5U B;  2UYZ B;  3DHH C;  3D32 A;  4N58 A;  3GP7 A;  3VR9 B;  1HA5 A;  3K9P B;  4LDT B;  3SU8 X;  3AI5 A;  3O13 A;  3N9Y C;  2IO0 B;  1VZ7 A;  2A5U A;  1PUT A;  4RCO A;  3PRP B;  1SGH A;  2V9H A;  3ZNI D;  2E3T A;  1F2R I;  2MBQ A;  4QAY A;  2W9N A;  2NTS A;  1SBB B;  4NAM A;  4IUM B;  1OTR B;  5EE3 A;  4ZRP A;  2CJN A;  1SB3 C;  1FRD A;  2JZP A;  3GS2 A;  3Q3O C;  2M8S A;  1ESF A;  3U8Z A;  4MJS B;  4US9 A;  2K39 A;  3ZRF A;  5BMG A;  1VZ6 A;  1L6U A;  2Y5B B;  2L0F A;  2L1A A;  3C19 A;  2IYD B;  4YTN B;  3UIO B;  1RFA A;  2JWU A;  2MBE A;  3IAM 1;  1BML C;  1FCC C;  2DZI A;  2J0J A;  1KLU D;  1STE A;  5FKA C;  4A20 A;  4W9L A;  2MSE D;  3AED B;  2GBR A;  4I6P A;  4MDK E;  4XE0 A;  4YL8 A;  4A6Q A;  1QOA A;  2LAS A;  1YQ4 B;  4LNI A;  2WXO A;  4M02 A;  1KJT A;  5I4D A;  2EKE C;  4EOY A;  1LO5 D;  2D3B A;  4KGS A;  4PYU A;  3I9V 1;  1N5W A;  2FAZ A;  3W1S A;  2L00 B;  1T5X D;  2KX0 A;  4II2 B;  3H7S A;  4Q2J A;  1RM6 C;  5IN7 A;  1N62 A;  4WJN A;  4MH8 A;  4OZB A;  4RGO S;  3A4R A;  4K3B A;  4DXF A;  5BO4 B;  3PRE A;  2GBK A;  3PRM B;  1SE4 A;  4P16 A;  2MQJ A;  4GMV A;  2PKO A;  3ECI A;  1ZGU B;  1KM7 A;  2B3A A;  3RI7 C;  5E6J A;  2IY1 B;  3IVF A;  1KLV A;  2KN5 A;  4RM8 A;  2LVP A;  4KGT A;  4RGT A;  1FPY A;  2IO2 B;  1A5R A;  3P4S B;  1E10 A;  4BOZ B;  3L13 A;  3M63 B;  3Q3M C;  1WY8 A;  1C76 A;  4M8N A;  1XLN A;  3EEC A;  2IGG A;  2K22 A;  5D7G A;  3QHT A;  2KK8 A;  3RZF A;  1P7E A;  1UD7 A;  1ZDX A;  4CHK A;  2WXP A;  2OJR A;  1SEB D;  3MHS D;  4HKQ A;  3M62 B;  3TEW A;  2K25 A;  3A4S C;  2ZW0 A;  1JRO A;  2Z0E B;  1RFK A;  4MGY E;  1VD2 A;  3KLS X;  1ENF A;  2PTL A;  3V6E B;  3MJ5 A;  5E6O A;  3EHV A;  1UBI A;  1ISN A;  1D5X C;  1F77 A;  3TUO A;  4P1C C;  4GDK B;  1DGJ A;  3R3M A;  1ET6 A;  3PGE A;  2LJI A;  4LTU A;  2W54 A;  2OED A;  2KAC A;  4HKZ E;  1WGD A;  4IW0 A;  5CHF A;  1YN3 A;  2WDR B;  3MC0 B;  3T9L A;  3U30 A;  1XEE A;  2BGF A;  4FA6 A;  5GXG B;  5AZF A;  4DBG A;  1SE2 A;  1NI2 A;  3ETR A;  3JSV B;  1GTH A;  2PVO D;  1NYQ A;  2BS2 B;  4KGR A;  2G4D B;  1ZPS A;  4JGH B;  5LXH A;  4IM3 A;  4XWW A;  1TS4 A;  4TKN A;  2WXR A;  4ZHO A;  3MHZ A;  1WWT A;  1GPX A;  2Z8L A;  3LXF A;  1R4M B;  1VZ8 A;  2ICI A;  3B08 A;  4S17 A;  4PYZ A;  1F1H A;  1MFW A;  1NDD A;  3AN1 A;  5AUI A;  2ZVN A;  1WXV A;  2LZ6 A;  3DBL I;  4YWG G;  3PZ8 A;  4XZ4 A;  5D3D A;  1OQR A;  2FCQ A;  1MG8 A;  4RMA A;  3QA8 A;  2IZV B;  2W3S A;  3HIZ A;  3VTV A;  4NY0 A;  2DZJ A;  4MGK E;  4GN1 A;  2CU3 A;  1LM8 B;  3LB8 C;  1ZW7 A;  1XO3 A;  2QSD A;  1QOB A;  5AZG A;  1TYG B;  4XC2 A;  4J3O D;  2PEA A;  1VCB A;  3AEF B;  1L4D B;  1TS2 A;  3MP9 A;  2L32 A;  2MJD A;  4BBN C;  1GNU A;  4ANV A;  3SFE B;  2H89 B;  2RSU A;  2K6Q A;  1YN5 A;  4ZRQ A;  3WAM A;  4LDT D;  2JSV X;  1B9R A;  4DXG A;  4B0E A;  1T0R C;  2GOW A;  2N9X A;  4KKJ A;  3W1Y A;  5JZE B;  2KTR B;  1D5Z C;  3QAR A;  4ANU A;  3ZTC A;  1E5W A;  3S2A A;  1WMH B;  3KQ4 A;  2KDB A;  2R2O A;  2G3Q B;  5LLI A;  1V8C A;  1PQS A;  1SIJ A;  2JZ3 B;  1LXD A;  3RD2 A;  3NRZ A;  3QX1 A;  2RPV A;  4DWF A;  3ZO5 B;  2FID A;  2NBV B;  2MEK A;  2ZZP B;  3VHT C;  1WI0 A;  2WXI A;  3AE7 B;  5D3I B;  2VRR B;  4WWP A;  2QIL A;  4NAW B;  4ZRK A;  5DCN A;  5JHB A;  4B9K A;  3AUL A;  1ROE A;  2N7D A;  3RPF C;  2G45 B;  3OJ3 A;  4KDI C;  4HK2 A;  1IP9 A;  4G3X B;  1FFU A;  4C7Z A;  1V1P A;  1N6Z A;  1E90 A;  4HPM B;  5J18 A;  3PVL A;  3VUW A;  4KX6 B;  3DWM A;  1ZOY B;  4W9I A;  1GJZ A;  3AE3 B;  4OW0 A;  3WAO A;  2IGD A;  4N9F 4;  1QOG A;  2PE9 A;  4JE3 B;  3ZRC A;  1RYJ A;  2LUM A;  3L4P A;  2K6D B;  1N61 A;  3RT3 B;  4AS1 A;  4ZRI A;  2L52 A;  4MEL A;  2INC C;  1Y56 A;  2A4Z A;  4GDK A;  5E6N A;  5IA7 A;  1L6V A;  2LRW A;  2JWZ A;  3BY4 B;  4IKG A;  3WA0 A;  2CU1 A;  2GB1 A;  2M17 A;  2NBW B;  4YTP B;  2KAN A;  3E9S A;  1V2Y A;  1S1Q B;  3CWI A;  2LXA A;  2MRP A;  4IM2 A;  3V6C B;  2IDY A;  1R4N B;  1WX8 A;  3GOE A;  1XQQ A;  1SIF A;  3NZ3 A;  2KFJ A;  2MCN B;  4JL9 A;  2KTF A;  2R61 A;  3IHP C;  4LJP B;  4EFO A;  1YOV B;  5DPR A;  1K51 A;  2WYQ A;  2BQQ A;  2K8C A;  2QC8 A;  3N20 C;  4ZYS A;  5C2T B;  3HM3 A;  4R3D A;  4BKT A;  4XYC A;  3R7Q A;  1A70 A;  3BVM A;  1YMH E;  3DOW A;  2VZK B;  2NCN A;  4A9A A;  2C60 A;  3ABV B;  2DX5 B;  1TT5 B;  4NQK E;  4BZA A;  3WCQ A;  4BBN F;  4DK5 A;  2ACZ B;  5IP4 D;  1LQB A;  3MTN B;  2I1J A;  3QQ8 B;  2HTH A;  4W9J A;  2K8B A;  3C8Y A;  2IPK D;  2W82 A;  4LJO B;  1UNS A;  2QJL A;  5G5H A;  1N60 A;  4N59 A;  4TV3 A;  4HWI B;  2KLC A;  3L54 A;  4BFR A;  4TQ0 A;  1FXA A;  4AUQ C;  5JHA A;  3A9K B;  2KX3 A;  4RH6 A;  1WJ6 A;  2KQ4 X;  1WX9 A;  1Z2M A;  3T8M A;  5G2N A;  3RYT A;  4WJQ A;  1WXA A;  2KTR A;  1EF1 A;  1ZDV A;  1AW7 A;  3U52 E;  1SXT A;  3ZTD A;  5AEK B;  5G5G A;  1WMH A;  1EUV B;  3RNF C;  1PFD A;  4REZ A;  3P42 A;  2NMQ A;  1HTQ A;  2J4X A;  1I4G A;  3SD5 A;  2KJ6 A;  2H88 B;  4EZJ A;  1IGD A;  4F1S A;  3HUI A;  2YEP B;  4II3 B;  4WIP A;  3AV8 A;  3L16 A;  1OGW A;  4NJ7 A;  3RNE C;  4YXD B;  4KSK C;  1JWU D;  1AAR A;  4JWS C;  1H4R A;  4X57 B;  1L0X B;  3VQI A;  4NAW A;  4JX1 C;  1L5P A;  5C3J B;  2Q5W D;  2XEW A;  2L76 A;  1HXY D;  3BK1 A;  1NEK B;  3URY A;  3Q69 A;  4BOS C;  4FJV B;  3H1U A;  1HQR D;  4WJP A;  3W2D A;  2EMT A;  1FD6 A;  2PW9 A;  2WU2 B;  1OEY A;  2CHW A;  2JRI B;  1P3Q U;  2V4I B;  2JX5 A;  3JYU A;  1TTN A;  2BF8 B;  3VH3 B;  1TY0 A;  1KRH A;  1CK1 A;  4BKG A;  2REX A;  1T0S C;  2NPT B;  4ACF A;  1V81 A;  2VH2 A;  2AEH A;  1Z5S B;  4HJK A;  3DBR I;  4HDQ A;  3U4E G;  1E8W A;  4FXC A;  2EKI A;  1RAX A;  1V97 A;  2LI5 A;  2G9H D;  1MI0 A;  3WAL A;  1TJE A;  2MWS B;  4FLH A;  1JQ4 A;  2MJE A;  3R2I A;  3MC8 A;  4F7Z A;  1WJ4 A;  2HDE A;  2WXN A;  1WF9 A;  5CHV C;  3PV1 A;  5LNK 1;  5IOI A;  4FJZ A;  3GZN I;  1EWY C;  3A9J A;  3B0A A;  1KLG D;  1GC6 A;  5HG2 A;  1G6J A;  3R8B A;  1EO6 A;  3DPD A;  2DYM A;  1H7X A;  3UIP B;  4IG7 B;  3BII D;  1JAL A;  2QDF A;  1BT0 A;  4WWM A;  4MEM A;  1JML A;  2BYF A;  2FUG 1;  1GC7 A;  4YT0 B;  2KJH B;  2QCZ A;  4CO7 A;  1DOY A;  2LFI A;  3O65 B;  4MT5 A;  3IT4 B;  1FNW A;  2BKR B;  1HE8 A;  4IOI E;  1PDX A;  1V49 A;  2PPH A;  1QT9 A;  3APD A;  2LRU A;  1WR1 A;  4C7Y A;  4BKS A;  2K8H A;  1CMX B;  4TUU A;  4HRO A;  3OG5 A;  2MX2 A;  1WYW B;  2DNF A;  2Z59 B;  4ZOH C;  3AU5 A;  3IG3 A;  1WXS A;  2OJW A;  2FCS A;  1AWD A;  1WE7 A;  4C00 A;  4NJC A;  1TZO A;  3Q8A A;  2LUE A;  5IAA C;  1VJK A;  2KWD A;  1UF0 A;  3DBH B;  1UWX A;  1SSN A;  2LWP A;  1I4P A;  3VRA B;  3R2T A;  4NPN A;  2N7J A;  4A8X C;  5J17 A;  4IM0 A;  3AE4 B;  1WGY A;  3A1Q B;  2KDF B;  3HM6 X;  3I5J C;  1C4A A;  3SEB A;  3PHX B;  1TGZ B;  2IND C;  3N1Y C;  3P2B A;  5D94 A;  2KJR A;  4W9H A;  1WR6 E;  1WXM A;  3QJZ A;  1I35 A;  4M8M A;  3KVF B;  4TMA B;  2GRI A;  4GGQ A;  3OLM D;  2V3N A;  1WGK A;  2NTT A;  3EGR A;  5C1Z A;  2KNB A;  2FCN A;  2RDG A;  3ZJT A;  1TKG A;  3H7P A;  4DDI D;  2V3P A;  3LYY A;  2VZK D;  3V61 A;  1NI3 A;  2C5L C;  4HEA 1;  2XK5 B;  2NVU I;  1WE6 A;  2KKC A;  3VAW A;  5JH5 C;  3BZD B;  4KZC A;  2BPS A;  3GE3 C;  2MBH A;  3RZW C;  3H6N A;  4BKS D;  1WJU A;  2INP E;  2KC2 A;  2V1Y A;  4FHK A;  4M0W B;  2D2Q A;  4FJY A;  3ZUN A;  2L8J A;  2XN9 C;  2O6V B;  3X23 A; 
#chains in the Genus database with same CATH homology
 1JCK B;  1FIQ A;  1K52 A;  2WXI A;  3AE7 B;  5D3I B;  1MHH E;  2Y5C A;  5AUK A;  2QIL A;  4NAW B;  1GB1 A;  1KH0 A;  1J7C A;  1ROE A;  1ZE3 D;  3ZGZ A;  3RPF C;  1K53 A;  1HZ5 A;  3T3O A;  5BYS A;  1I7H A;  1UUP A;  1FFU A;  4C7Z A;  1AN8 A;  1QIL A;  1V1P A;  3AEB B;  2MH7 A;  4EE2 A;  4N58 A;  1JWA D;  1YN4 A;  3AEA B;  2N9L A;  4KX6 B;  1PGX A;  1ZOY B;  2M56 B;  3DWM A;  3AE3 B;  4OW0 A;  2IGD A;  3E56 A;  2BYT A;  2GI9 A;  1QOG A;  3P1M A;  4JE3 B;  4OVZ A;  1RYJ A;  2LUM A;  3L4P A;  1XXG A;  4OZA A;  1BXT A;  1N61 A;  1J7A A;  4H2A A;  4AS1 A;  2WDV B;  3AM9 A;  1PYW D;  2L52 A;  4XWT A;  1Y56 A;  3CIR B;  3DWG C;  2WP9 B;  1L6V A;  3RFZ B;  2I38 A;  2LHD A;  5T8I A;  3P4P B;  1IUE A;  1I4Q A;  4IKG A;  1JWB D;  2GB1 A;  2XN9 C;  2J53 A;  3IAS 1;  3T3N A;  4YTP B;  2INN E;  3E9S A;  3Q8B A;  1WSP A;  2WXH A;  3CWI A;  1ZXI A;  2W3R A;  4GDL B;  1FMA D;  4RF0 A;  4XDD A;  1YQ3 B;  1V1O A;  1SE3 A;  1D5M C;  3BVZ A;  3TEZ A;  2Y3A A;  1VDV A;  1QKZ A;  2Y5P A;  2IDY A;  1JRP A;  3EA6 A;  1I4H A;  1MVK A;  2G1E A;  1OQQ A;  1EU3 A;  2DWQ A;  3U2S C;  3U7Z A;  2HTM E;  1PGB A;  2QEJ C;  5MPO A;  4HJG E;  1QF6 A;  4YSY B;  2AQ2 B;  3NZ3 A;  2IGH A;  1I4X A;  4LLG M;  2R61 A;  5H92 C;  3Q8E A;  3AE5 B;  4RNA A;  1KFY B;  1ZXH A;  3W5V B;  3UI3 A;  1K51 A;  1K50 A;  1XLQ A;  3ZJU A;  2ONQ A;  4OHJ A;  4O1N A;  1DOI A;  2BS3 B;  1HEZ E;  1EU4 A;  1GAQ B;  2BB5 A;  1FXI A;  2CJO A;  2DYO A;  3Q8C A;  5H8Y E;  1IBX A;  4ZYS A;  3AE2 B;  3W5U B;  4NZL B;  5C2T B;  4R3D A;  2KDM A;  2E6X A;  3BYT B;  1A70 A;  3BVM A;  3VR9 B;  1YMH E;  1HA5 A;  3BVG A;  3GP7 A;  4N6E B;  2K9X A;  3IT6 B;  1FO4 A;  2RMM A;  2VZK B;  4A9A A;  2WXQ A;  4MM3 B;  3ABV B;  2K0P A;  4CQN A;  5BYR A;  1SJH D;  3O13 A;  3N9Y C;  1R7S A;  1VZ7 A;  4C80 A;  2WU5 B;  2J42 A;  3WCQ A;  2ACZ B;  1PUT A;  1XF5 L;  4RCO A;  4UDU C;  3NS1 A;  3AEC B;  3BK2 A;  1NYR A;  2LEK A;  4JPS A;  1C77 A;  1FNU A;  2WDQ B;  4OZC A;  4JWU C;  2E3T A;  2BBC A;  1F2R I;  1E0Z A;  2B76 B;  2WXJ A;  4IDI A;  3C8Y A;  1GT8 A;  2IPK D;  2W82 A;  4LK0 M;  1FFV A;  1UNS A;  1XLP A;  2NTS A;  2QJL A;  1D4B A;  1V1P B;  5G5H A;  1SBB B;  4NAM A;  2N0S B;  3KWV A;  5EE3 A;  3FIL B;  1TS5 A;  2LGI A;  2N9K A;  1N60 A;  4ZRP A;  2CJN A;  1SB3 C;  4N59 A;  1FRD A;  4PT5 A;  3I57 A;  2JZP A;  3GS2 A;  1XCQ L;  1ZP0 B;  1ESF A;  3Q8F A;  4US9 A;  3OWE B;  1GOZ A;  1FRR A;  1C4C A;  4TQ0 A;  5BMG A;  1FXA A;  2AQ3 B;  1T3Q A;  1VZ6 A;  1L6U A;  2BB6 A;  3V05 A;  5BMH A;  4RH6 A;  3VR8 B;  1N5X A;  2KN4 A;  3PZ7 A;  4L2Y A;  2L1A A;  2KQ4 X;  2WXL A;  4YTN B;  1B1Z A;  1TKY A;  1FEH A;  2WNM A;  2JWU A;  3IAM 1;  1BML C;  1FCC C;  1ZDV A;  1AW7 A;  3U52 E;  1SXT A;  1KLU D;  1STE A;  2TSS A;  5FKA C;  5G5G A;  1TY2 A;  3H8H A;  2JU6 X;  3AED B;  1PFD A;  4REZ A;  3P42 A;  2NMQ A;  4XDC A;  4XE0 A;  4RF1 A;  2J4X A;  4A90 A;  1I4G A;  2WXF A;  4TQ1 A;  4A6Q A;  2H88 B;  3CF4 A;  1QOA A;  4L1B A;  1YQ4 B;  1CZP A;  1IGD A;  5TSS A;  2WXO A;  2LHE A;  4WAF A;  5I4D A;  1F2R C;  1LO5 D;  2YEP B;  3HUI A;  1WXQ A;  3NVV A;  4WIP A;  2L83 A;  1FM0 D;  3AV8 A;  3PO0 A;  4YXD B;  1YJI A;  5BMI A;  1JWU D;  4KGS A;  4JWS C;  1JWM D;  1L0X B;  2I2Y A;  3I9V 1;  1N5W A;  1XCT L;  2FE8 A;  3W1S A;  1YNT E;  4USA A;  3VQI A;  1MPE A;  1T5X D;  2AQ1 B;  4JX1 C;  1L5P A;  5C3J B;  4Q2J A;  1RM6 C;  3V3X A;  2Q5W D;  3AEE B;  4WUR A;  2JQR B;  4DQO C;  2RDH A;  1HXY D;  1N62 A;  4P6V F;  3BK1 A;  1TKE A;  3AMZ A;  1NEK B;  3P4R B;  2DBY A;  4MH8 A;  3Q69 A;  4OZB A;  4RGO S;  3URY A;  3ZQ4 A;  1GB4 A;  4DXF A;  1HQR D;  3W2D A;  1FD6 A;  1M4V A;  1L4Z B;  2PW9 A;  2WU2 B;  1Q10 A;  2WLB A;  1EWC A;  1VLB A;  1SE4 A;  4P16 A;  2V4I B;  2JX5 A;  3FAH A;  1VR9 A;  2KMM A;  3BYY B;  2PKO A;  1QLB B;  5E6J A;  1ACC A;  1TY0 A;  1KRH A;  5EE0 A;  1CK1 A;  2X38 A;  2W55 A;  3NVY A;  1NEN B;  2SEB D;  4KGT A;  4RGT A;  4RGN A;  3U4E G;  3P4S B;  1E10 A;  1C79 A;  4FXC A;  2EKI A;  1C4P A;  1PGA A;  1V97 A;  1J7B A;  1F0Z A;  3IXS A;  3SFD B;  2G9H D;  2WXM A;  1MI0 A;  2JYT A;  1C76 A;  1L0Y B;  4A55 A;  1TJE A;  3AE6 B;  1H7W A;  1XLN A;  3ZYY X;  1JQ4 A;  2LMC A;  2IGG A;  2MJE A;  2K22 A;  5D7G A;  3AEG B;  3R2I A;  4HRS A;  1P7E A;  3B2G A;  1QQR A;  1E7P B;  1CJE A;  1ZDX A;  2QMT A;  5JXV A;  2WXP A;  2PVG C;  2HDE A;  2WXN A;  1SEB D;  4MAC A;  4HKQ A;  2WXK A;  5LNK 1;  1E9M A;  2BT6 A;  3TEW A;  1EWY C;  1N63 A;  1KLG D;  5HG2 A;  3KWL A;  4C56 C;  3R8B A;  2ZW0 A;  1JRO A;  4YTM B;  1RFK A;  2WS3 B;  2DYM A;  1H7X A;  3ZJV A;  3BII D;  4TSS A;  3KLS X;  1ENF A;  2PTL A;  3MJ5 A;  1JAL A;  1D5X C;  1F77 A;  1YJJ A;  1L0V B;  1P7F A;  4WH4 A;  3TUO A;  4WWM A;  1QOF A;  1TS3 A;  1JML A;  2FUG 1;  4GDK B;  4YT0 B;  1DGJ A;  1ET6 A;  2LJI A;  4LTU A;  2EEL A;  2ON8 A;  1DOY A;  2LFI A;  3HVZ A;  2BW2 A;  2W54 A;  2OED A;  2KAC A;  1AYF A;  2D5G A;  3IT4 B;  4HKZ E;  4MT5 A;  1MHX A;  2BTE A;  1FNW A;  1YN3 A;  2WDR B;  3MC0 B;  1XEE A;  2XNA C;  4IOI E;  1PDX A;  5FK9 C;  2FBW B;  3AH7 A;  1QT9 A;  5GXG B;  2K5P A;  1SE2 A;  1ET9 A;  3P63 A;  4C7Y A;  3ETR A;  4D2K A;  1GTH A;  2M19 A;  1ZUD 2;  1C9F A;  2PVO D;  5HFY A;  3FIL A;  1NYQ A;  4ARC A;  2BS2 B;  2J52 A;  4KGR A;  4M0W A;  1SJE D;  4HRO A;  1ZPS A;  3MFG A;  2BS4 B;  2WQY B;  4XWW A;  1TS4 A;  2WXR A;  3NUH B;  3MHZ A;  1WWT A;  5EE1 A;  4ZOH C;  4ZHO A;  1UGJ A;  1GPX A;  3AB5 A;  2Z8L A;  5HHD G;  3LXF A;  1AWD A;  1VZ8 A;  2ICI A;  4RGM A;  3AE1 B;  4AQ7 A;  1IBX B;  4NJC A;  1JWS D;  3SR6 A;  1XLO A;  1TZO A;  3TEX A;  2PIA A;  3Q8A A;  1VJK A;  2KWD A;  2DLB A;  3AN1 A;  5AUI A;  5EE9 A;  1UWX A;  2WXG A;  4YWG G;  1SSN A;  2KAJ A;  3PZ8 A;  3AE9 B;  1UWM A;  5D3D A;  4B0M A;  3J9C A;  1I4P A;  3VRA B;  1OQR A;  3R2T A;  2N7J A;  2AX5 A;  4A8X C;  3AE4 B;  1I4R A;  1GTE A;  3TEY A;  4YSX B;  4YSZ B;  2K3U A;  1E6E B;  2QIE B;  2W3S A;  1C4A A;  1D6E C;  4US8 A;  3SEB A;  2MJ3 A;  1T6B X;  2CU3 A;  3LB8 C;  1WYG A;  1XO3 A;  2QSD A;  1QOB A;  2PMV A;  1TYG B;  4TMA B;  3HRD D;  3NVW A;  4J3O D;  4RFB A;  4L23 A;  1DOX A;  3W9C B;  2GRI A;  3BWU D;  1C78 A;  3AEF B;  3VRB B;  5HI1 A;  2V3N A;  1WGK A;  1L4D B;  1TS2 A;  2NTT A;  3EGR A;  3MP9 A;  3NVZ A;  2V0G A;  2L32 A;  2MJD A;  3B9J A;  3SFE B;  1OFF A;  2RDG A;  3ZJT A;  1TKG A;  2YEP F;  2H89 B;  2PLP A;  2V3P A;  2OHF A;  1YN5 A;  3LYY A;  4ZRQ A;  1NVI D;  3EUB 2;  2VZK D;  4ZHP A;  2JYE A;  2JSV X;  1B9R A;  4DXG A;  1NI3 A;  3GB1 A;  1FCL A;  4B0E A;  1IGC A;  4HEA 1;  4KKI A;  5FR3 A;  3FC4 A;  1FNV A;  1SF0 A;  4KKJ A;  4ARI A;  4GLS C;  1D5Z C;  4WQM A;  1BUI C;  3AE8 B;  1KF6 B;  3KQ4 A;  1JW9 D;  1CQV A;  3BZD B;  1DYQ A;  1V8C A;  2JXT A;  1SIJ A;  3B2F A;  1EM7 A;  3P4Q B;  5BYQ A;  4ITK A;  1VRA B;  2INP E;  3TSS A;  1WRI A;  3NRZ A;  1HZ6 A;  2M0A A;  2SAK A;  2RPV A;  1KTK A;  2ZW1 A;  1RWS A;  3HVD A;  2IJ0 A;  2MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...