1GB4A

Hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGEITIEAVDAAEAEKIFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GB1-C3B4
publication title Design, structure and stability of a hyperthermophilic protein variant.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Hyperthermophile
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gb4A00
1IBXB 2N7JA 1HEZE 2LHEA 1P7FA 1HZ5A 1F2RC 1FCLA 4HKZE 1XF5L 1HZ6A 2GI9A 1K51A 2RMMA 1YMHE 1K52A 2KDMA 2GB1A 1MI0A 4GLSC 2KWDA 2JZPA 1K50A 3UI3A 2ZW1A 2NMQA 5HHDG 2I38A 1QKZA 2IGGA 3MP9A 2PTLA 1F2RI 1PGBA 5BMIA 1PGXA 1GB1A 1IGCA 2J52A 2N9KA 2J53A 4OZBA 1MHHE 1C9FA 1PGAA 2ON8A 1P7EA 1MVKA 3V3XA 2LGIA 4D2KA 2I2YA 2IGDA 4IOIE 5HFYA 1D4BA 2KACA 4IKGA 1MPEA 2RPVA 1KH0A 2LHDA 2K0PA 2KQ4X 4KGSA 2LUMA 2IGHA 5BMGA 3FILA 1FCCC 2ZW0A 1MHXA 1IBXA 4KGTA 2JSVX 1ZXHA 1Q10A 5HI1A 4MACA 4KGRA 5JXVA 2JU6X 1IGDA 1EM7A 4OZAA 1FD6A 1K53A 2PW9A 2JWUA 3GB1A 1YNTE 1UWXA 5BMHA 2QMTA 2PLPA 4OZCA 1GB4A 1JMLA 4HJGE 2QSDA 5HG2A 2OEDA 4WH4A 1XCQL 2N9LA 3FILB 2KN4A 2EELA 2JXTA 1XCTL 2ONQA
chains in the Genus database with same CATH superfamily
2YEPF 3DWMA 3U4EG 4LK0M 1YMHE 3DOWA 1TT5B 4XDDA 3K9OB 5EDSA 4N9F4 3RNCC 2PVGC 4YWGG 2D3AA 2MJ3A 4JE3B 2WXOA 1SE2A 2C60A 1HQRD 1SE9A 3MJ5A 3L13A 4EKUA 3VTWA 1R7SA 1OGWA 4KDIC 1Q0WB 1E8WA 1JRPA 3NRZA 4PT5A 4II3B 4BKSA 2ZEQA 5CX3A 2IY0B 3BINA 5IKCM 2EMTA 1S1QB 2WXLA 4BFRA 1E0ZA 2Y3AA 3NZ3A 1TKYA 1D4BA 3HHMA 2BYFA 2FE8A 2BGFA 2KJHB 2RDGA 1HE8A 2LFIA 5BMGA 2WYQA 2JX5A 2JZZA 4DK5A 4C7YA 4KGTA 1ZXHA 2BF8B 2KDIA 4KGRA 1L6UA 3BVMA 4NQLB 1P98A 1GPXA 3R66C 4XX5A 2INNE 4A3OA 3JVZX 1KF6B 3IBEA 1RRBA 3KLSX 2NBWB 1FRRA 2M0AA 4EZLA 1CZPA 2XNAC 1YX6B 2RDBC 4G11A 4HXDA 1ENFA 4CQNA 1OQRA 2JT4B 1MFWA 2JPHA 4MSQB 1XCTL 1NENB 2N7JA 3WANA 1FXTB 3WCQA 2XEWA 3GZNI 2D07B 1ZW7A 2K39A 1HZ6A 4M0WB 2RSUA 5KHOA 4WAAA 4BOZB 2PEAA 4LLGM 2KMAA 1BXTA 2K8HA 2ZVNA 2UYZB 4K7WA 1L7YA 3N32A 4KZCA 1WGGA 2LJIA 4EE2A 2X38A 4RCOA 3W1YA 3APDA 4LJOB 1NDDA 2GBJA 2WXIA 1C1YB 3AN1A 4F8CB 4WWPA 2DBYA 3KYDD 2KVZA 2JXXA 1V86A 1XQQA 4NAMA 3I63C 3ZJVA 2L8JA 3QX1A 4RMAA 2HE7A 2C9WB 3SFDB 2J0KA 3DCGA 4RM9A 4IW0A 1J0GA 2GBNA 2Z59B 3DBLB 1OQYA 2KWVB 2WQYB 3L54A 3PZDA 1TZ1A 4WIPA 4KVGB 2MBHA 4ICUA 2AX5A 3V6CB 3LJ3A 1T0QC 2YEPB 2LD9A 2QDFA 4KSKC 1YN5A 1GOZA 1GUAB 4J3OD 2KOXA 1TS5A 4LNNA 2GRIA 3AI5A 1I4XA 2KDFB 2AQ3B 1JWUD 2JU6X 1WMHB 2L7RA 4F1SA 4KKIA 1E5WA 4A8XC 3UIOB 1J7AA 4NY0A 1C78A 3ONSA 2QILA 2ZPYA 2MX2A 2LI5A 2JWZA 2MH7A 2KD0A 2BYEA 2KMCA 3DVNU 4AP4C 1VZ6A 4HKQA 2KAJA 4WH4A 3GE8C 3QQ8B 2H89B 5JH5C 2ONQA 1IBXB 2A5UA 3RNEC 2RD0A 1YQBA 3VR8B 2CJOA 1D5MC 3P1MA 4LDTD 2KHWB 3ZNHB 2WX1A 3RYTA 2QCZA 3A33B 5E6OA 4B95A 1I35A 1V1PB 2D5GA 4LNOA 3VTUA 4J6IA 3APCA 3X23A 1AWDA 3K9PB 2WDTB 3PRPB 1ZE3D 2KJRA 2JVCA 1B1ZA 2NMQA 3HVDA 4AQ7A 1QKZA 4TKNA 2D11A 4A9AA 3NVWA 2AEHA 4XC2A 5FKAC 2BT6A 3AH7A 2BKFA 2LEKA 4RNAA 1C9FA 1H4RA 4AJWA 2UWQA 3NVZA 2GLSA 2KK8A 1XXGA 1JALA 3BIID 2LGIA 4MSMB 1L0YB 1E8ZA 2JF5A 2MQJA 3LYYA 2JY6A 4MDKE 4WAFA 2JUOA 3A4SC 2HJ8A 3SU8X 3DHGC 5BYSA 1YJJA 1T0SC 4JX1C 2NBVB 4WWNA 5G5GA 1A5RA 2MJDA 4GXBA 2PW9A 2BYVE 2O2VB 3LB8C 1VDVA 1TKEA 3DHHC 3TSSA 1YX5B 3P4QB 2ZPNA 3EFCA 4MGIE 1N60A 1P9DU 3VR9B 4HDQA 1WZ0A 3ETRA 3H7PA 3BZDB 4FA6A 1FMAD 3ZNGC 3AEEB 2KN5A 3TUOA 1XF5L 1UH6A 3RNFC 1PYWD 2RMMA 2VRRB 3ZW3A 2KDMA 2MBOA 1JW9D 1F1HA 3UQAA 2DYMA 2KTFA 1EU4A 1F9JA 1L0XB 3N3KB 1VZ8A 4OHJA 1FNUA 1WXSA 1WGKA 2V4IB 4BKGA 1JWSD 1EWCA 4OVZA 3NJTA 1KFYB 2FIFA 1WXVA 3FC4A 2HDEA 4FJZA 2J52A 2Y5PA 4MEMA 2BYTA 2FAZA 1I4QA 2ON8A 1YQ3B 4DXAB 2M8SA 3Q8CA 2XK5A 3OJ4B 3BWUD 1QOFA 2LVQA 3Q6BA 4M01A 4W9CA 2PKOA 3QJZA 3W2DA 3Q8EA 2W3RA 4WWOA 1SIFA 3P42A 1N62A 1UWMA 2LUMA 3ZXRA 3Q8AA 3HUIA 3AULA 2KZRA 4LNFA 5AUIA 1VLBA 3VTVA 2REXA 3RPFC 3X0WA 4C4VA 3PREA 3U30A 2KNBA 1TIFA 3A4RA 4DHJD 1TS3A 1V49A 1AW7A 3ZUNA 2NS5A 2FNJB 1WJ6A 4M8MA 1JMLA 1DYQA 2CU3A 2L83A 5LXHA 2LWPA 4ZRQA 3DVGX 3B08A 3ZO5B 1WR6E 4KV2A 3V61A 4DHZE 3FKYA 4HLEA 1FCLA 1YOVB 2B76B 1RYJA 2GB1A 2GBKA 4A6QA 1XLNA 1FFUA 4XE0A 1DOXA 2WU5B 4XGAB 3U7ZA 1TS4A 1P0RA 1R4NB 5HHDG 1D6EC 4CHKA 4HCNB 2PTLA 1WFYA 3R7QA 3PSEB 2LRUA 3KQ4A 1N63A 2C7HA 2KWCA 2JQRB 1JWAD 1LXDA 3L17A 2KT7A 1WJUA 2FCMA 3VVWB 2N7EA 3M62B 3C8YA 4E74A 2M17A 1J7BA 1HA5A 1X1MA 2EKEC 5J18A 1E10A 2BB5A 3EFUA 2D10A 3Q2AC 3TEWA 2J42A 4JWUC 2ZJDA 1Z2MA 2DAJA 1LGRA 1XLPA 2M0XA 5D7GA 2B3AA 2BBCA 4ACFA 4ZYNA 3TBLD 4LCDE 1WGYA 3QK0A 2AL6A 2IJ0A 2CHZA 1WXAA 4PS3A 5D94A 3AV8A 2ASQA 2MW5A 3RULA 4C00A 1RFKA 2JXTA 1RAXA 2LHEA 1FRDA 2WGSA 1NYRA 4BZAA 4FN2A 3RCZA 3NHEB 1VJKA 2EMSA 3PRMB 4KKJA 1Q1OA 1UUPA 2DWQA 4HDOA 3ZQ4A 3GP7A 1EU3A 1CQVA 2W55A 1C76A 3EGRA 5IO9A 3RZFA 4W9GA 5E6JA 1F52A 1E9MA 2KFKA 4A90A 3U8ZA 3AEFB 1V81A 5TR5A 4K3BA 3UGBB 2BVCA 2G3QB 3IG3A 2IO2B 2QEJC 2N9XA 4KZ0A 2KDEB 2LVOA 4X57B 1NBFC 2K1FA 2J0MA 1ZGUB 1YN3A 1TBEA 2H88B 2KDBA 4RGNA 4IC7B 4XWWA 4GDKA 4D2KA 1ZP0B 2LJ5A 2RR9A 1WR1A 2V3NA 4HPPA 2K6DB 3JW0X 3TEZA 4N59A 1KH0A 2XBBC 4P6VF 2KJ6A 4ARCA 3KVFB 3H9DA 4G0NB 3AE3B 3QCAA 2IDYA 3URYA 2HD5B 2MP2A 4MACA 2AQ2B 5DPRA 3IAM1 4KDLB 2L0TA 1K53A 1ZDXA 2IO1B 3BYYB 1VZ7A 1UWXA 1OFFA 1C4CA 1ZDVA 1CJEA 3B2GA 2D3CA 5AZHA 1TYGB 2M19A 2C5LC 3AMZA 4HPMB 2WXHA 3AM9A 1E8XA 4AS1A 5EE1A 4RFBA 4FBJB 3MC8A 3B2FA 2IPKD 4C80A 1WX8A 3AEGB 3RNBC 4ANVA 1S3SG 2KMMA 3TMPB 3ZXVA 1J19A 2WXKA 2CS4A 2NBUA 1L4DB 2E6XA 3BYTB 4FLHA 3CWIA 4M00A 2WP9B 3Q3OC 4JQWC 2AWTA 1PGBA 3PTFC 3H7PB 4NAWA 3Q8FA 4A20A 4TQ0A 3B1LX 1IGCA 2MLBA 2N9KA 2MBQA 3SD5A 1OEYA 2R61A 3L0WB 5AZFA 1SXTA 3P4SB 4HCPB 1XT9B 2I1JA 2G1EA 1SIJA 5LLIA 3DBSA 5IOIA 4YTPB 4EOYA 5J17A 2INDC 3O65B 2KC1A 4NNJB 4KGSA 2N1VA 2WXQA 3FILA 1WF9A 3KWVA 3RNGC 1I4HA 1I7HA 2LZ6A 1Q10A 2OHFA 4L2YA 3TL5A 2PPHA 1YD8U 4N58A 4IM3A 3VXWA 1FD6A 4IG7B 1UGJA 2XK5B 3ENEA 4DXFA 3CSFA 2K8BA 2MA9B 4XYCA 2OEDA 4REZA 4GOCA 3PPAA 2DZJA 2RPQA 3PHXB 2V3PA 2KN4A 4W9JA 1FPYA 3AU4A 3D32A 3AE1B 4YSYB 2M1MA 4BVUC 1WJ4A 2BS4B 2JZ3B 3ZRFA 1WI0A 4C4VB 3SR6A 1QOAA 2ACZB 2KX0A 4LNIA 4YTNB 1JQ4A 2MSED 3NVYA 3R2TA 2N9EB 2OOBB 3ZDMC 3W5UB 3PO0A 4YL8A 2Q5WD 3T9LA 3RFZB 2QIEB 1V6EA 3PV1A 3V62A 4USAA 4C56C 3LDZE 2HTHA 3LXFA 4WURA 1KLVA 3VUWA 3Q3MC 5C3JB 2V3SA 2BS3B 3M63B 4LTUA 3ZNZB 3EHVA 1SEBD 1MVKA 2QC8A 2K3UA 1ZKHA 5FR3A 3AE6B 2WDQB 3HM3A 3KUZA 3QWZB 2VH1A 1H8CA 1A70A 4PK1A 2O6VD 2LGSA 3WAMA 2WDRB 5LXIB 4MJSA 5G55A 1KLUD 5DPWA 2GOWA 3AE7B 4GB9A 1UBQA 2KQSA 3ZTCA 4RGTA 1KOTA 4S0RA 1MG4A 2KFJA 4DQOC 4RM8A 1U4AA 1L5PA 2QMTA 2XN9C 3N20C 4HK2A 2DHZA 3Q3JA 1YQ4B 4HJGE 2MEKA 2KQ7A 3VH3B 1TJEA 4P1CC 2PE9A 5D6JB 3MC0B 2Z0EB 3AB5A 4HWIB 4EEWA 1N6ZA 5G5HA 3PZ7A 2OJWA 4WJQA 1IP9A 2WXPA 2WXMA 1V5OA 3P4PB 3IFWB 2N7DA 2V1YA 2DAFA 1I42A 1UF0A 3DVNV 1C79A 1QOGA 5J2RA 3E9SA 4DHZB 4EZJA 2IGGA 3VUYA 3W1SA 3U2SC 5BMIA 3AEAB 4ZHOA 2M56B 4BBNC 1GB1A 2FUHB 3ZLZA 5JZEB 2CU1A 2N4FA 1MHHE 2LMCA 4TMAB 3U52E 4DXGA 1WJNA 2W82A 4FJYA 2IGDA 2BTEA 3HM6X 5IA7A 1RFAA 1SGHA 3Q3NC 1WZ3A 3RUIB 3T8MA 3DBLI 3MHSD 3GOEA 5TSSA 4ARIA 2J7QB 3P63A 2KFKB 1XO3A 2ZVOA 4NJ7A 2LXAA 1FFVA 4PS8A 2I1KA 2V4LA 2AQ1B 2MBBB 4GGQA 5CHWA 3Q14C 3A9JA 2WNMA 3FAHA 4YTMB 5L95C 3TJPA 3C19A 4OVVA 5BYRA 3N1YC 4GDKB 3QC8B 3P4RB 3W5VB 1UBIA 1D3ZA 3VRAB 4IDIA 4W9HA 2L52A 5CTRC 5GXGB 1KLGD 1D5ZC 2KLGA 2WXFA 5C1ZA 1HEZE 2ICIA 2MP2B 2M4NA 3M3JA 1E7PB 2L1AA 5H92C 2DZKA 1HZ5A 1F2RC 1VD2A 1T5XD 4JIOU 2R2QA 4JL9A 5BYQA 2D3GA 4GU2A 1HXYD 5DPTA 1MI0A 2Y5BB 4MELA 4YT0B 3W1SC 3SFEB 1WRDB 3CMMB 2FBWB 2KKCA 4MGKE 4ASWC 3IVFA 2W3SA 1KTKA 3ZKJC 2YVCA 2ZCCA 4US8A 4ITKA 4FXCA 4II2B 1E90A 1V5TA 4I6PA 1C77A 3MP9A 3H7SA 4AWJA 1PGXA 3KUCB 2DYOA 2L76A 3IXSA 1SF0A 2K9XA 2J4XA 2WXJA 5CHVC 4OZBA 1I4RA 1PGAA 3U7DA 1WWTA 2NTSA 4KSLC 4K7UA 2PMVA 3R8BA 1Y56A 1E6EB 1N5XA 2NVUI 3RMKC 4B6WA 3PLVA 2GBMA 3HIZA 2RPVA 3MHZA 2LHDA 2K0PA 1AYFA 1KM7A 1WGDA 2NPTA 1UGMA 3PGEA 2ZNVC 4RH6A 4NAWB 2JSVX 4ZHPA 1WGHA 1ET6A 3NOBA 4HEA1 3EUB2 2C7NB 1TY2A 3DHIC 1TZOA 4OZAA 2JWUA 2WXRA 1R4MB 1JROA 1GJZA 5BMHA 1EF5A 2FIDA 4C7ZA 1J8CA 1PUTA 3L4PA 1EF1A 2K6QA 2N9LA 3FILB 3ABVB 1CK1A 2L3ZA 4AJYB 1VR9A 1ZUD2 4HJKA 3WAOA 5IP4D 2Z8LA 2WU2B 1BUIC 1DOYA 4TSSA 3NZUA 3DVGY 2LGYA 4RF1A 1K51A 4UDUC 4N6EB 5FK9C 1T3QA 1N61A 3TIXA 3RZWC 3VFKA 3UI3A 3L08A 3NS8A 4FADA 2I38A 3O13A 1GAQB 5AZGA 4P1BC 3DBRB 2L0FA 3UQBA 1SJHD 4PYZA 2BS2B 3QAQA 5IN7A 2MHJA 5G2NA 4OW0A 2KWUB 2E3TA 3I5JC 1K8RB 1GC6A 4EFOA 1DGJA 5GMVA 1FXAA 3UIPB 1MG8A 4IOIE 3A9KA 5D2MB 2INCC 5HFYA 4L1BA 3BY4B 2KACA 3RI7C 1EUVB 3SDLC 3V6EB 1FCCC 1MJDA 4S17A 1P3QU 4H2AA 1TY0A 3E56A 1NI3A 2IO0B 4DHJB 3DBHB 3TCAA 4ZRIA 2K8CA 4IWPA 1L0VB 3CIRB 3OG5A 4MGZE 4F7ZA 1BMLC 2IO3B 2JYTA 4JLCA 4B9KA 1D5XC 1L2NA 4FHJA 3AE9B 2FCSA 1T6BX 4CO7A 3KW5B 2BWFA 2J0JA 2MRPA 2QSDA 5HG2A 4MM3A 1JRUA 3EC8A 4R3DA 4MJSB 2BPSA 4GDLB 1VRAB 3DDCB 4PYUA 2L00B 3AECB 2D3BA 1G6JA 1JWMD 4HRSA 3IHPC 4GMVA 3JSVA 1M4VA 1YJIA 3WA0A 2V0GA 2O6VA 3WIMA 4RF0A 4RGOS 5C2TB 2K25A 4ZOHC 1ACCA 3JYUA 4WWMA 1C4AA 4ANXA 1YJ1A 4QAYA 3KYCD 4IM0A 1UZXB 2WLBA 3WAPA 1R4NI 4TUUA 2AYOB 3I3TB 4E3CA 4HPLB 4G3XB 1HTQA 3SEBA 2Y5CA 2TSSA 2FUG1 2X8XX 1PQSA 1OTRB 2JRIB 2KANA 4W9EA 3CSTA 2G4SA 1I4PA 3ZRCA 3ZDTA 3AE2B 5HKHA 4XZ4A 1R4MI 3HRDD 1E7VA 3IAS1 5T8IA 3Q3FA 2LXCA 2DZIA 3AU5A 3H1UA 4NQKE 2PVOD 4ZYSA 5HI1A 5JXVA 1BT0A 3RD2A 1QILA 1YN4A 4ANWA 3DQVA 4WJOA 4I6LB 1HTOA 3GB1A 3APFA 2KX3A 1SSNA 3N30A 4W9LA 1I4GA 2N0SB 2NR2A 4DDGD 4EUTA 2W9NA 2MJEA 1FIQA 2WX0A 4JWSC 4GN1A 1LFDA 1WX7A 3AEBB 1P7FA 3A9JB 3TEXA 3VH4B 4W9KA 2LGXA 2Z0DB 4GSWA 4DBGA 1UD7A 3GE3C 5JHAA 2FCNA 1CMXB 2LASA 2VZKB 3DBRI 1JCKB 3MC9A 1LM8B 3KWLA 2ZNVB 4WQMA 4L23A 1ZXIA 2JZPA 4IWOA 2A4ZA 3PS6A 4K1RB 5I4DA 1LQBA 1WYWB 3N1ZC 4B0MA 1TGZB 3ZVVA 4KIKA 2PE6B 2DX5B 1V8CA 2MBEA 5E6NA 4FHKA 3R3MA 2KTRA 2WHIA 3A1QA 4NPNA 1AN8A 4A55A 1JWBD 3DPDA 2R2OA 2CHWA 2IYDB 1P7EA 3QHTA 1E8YA 3VHTC 3DBHI 2WXNA 2HJ1A 3AEDB 1C4PA 3ZIMA 4JPSA 2K22A 3VAWA 2IGHA 2RDHA 2ZW0A 3UF8A 2PIAA 4W9FA 1NI2A 3TEYA 3ZGZA 4FULA 4US9A 1ZPSA 3BVGA 4ICVA 1C3TA 1WRIA 3T3OA 2ZCBA 4AUQC 4BKSD 2PLPA 2IBIB 4OZCA 1WYGA 1WM2A 1RM6C 3J9CA 4NJ6A 4GDLA 3L10B 3QIJA 3AXCA 1XD3B 1L6VA 3ZTDA 1T0RC 2NPTB 4FJVB 4EZKA 1M94A 3MFGA 1KRHA 4URKA 2DENB 1F0ZA 1UELA 4BKTA 3V60A 3R2IA 3I57A 1F77A 1WGRA 2VH2A 4ZRKA 3N9YC 4GLSC 1NVID 3V05A 5H8YE 1ZOYB 3UINB 1GC7A 1QZEA 5AEKB 4MH8A 3IT6B 2YLMA 1IYFA 3ZJTA 3OLMD 1V1OA 4IWQA 2DNFA 2N1WA 4BOSC 1WE6A 1F2RI 1ISNA 1V9JA 5CHFA 3BK1A 1Y8RC 1WXQA 1WX9A 3VQIA 3QA8A 1WM3A 1QQRA 5L83A 3OAWA 3QARA 4IM2A 3V3XA 1Z5SB 3T3NA 2HTME 3H8HA 2V9HA 3PZ8A 4XDCA 4A3PA 3ML9A 1ROEA 4M8NA 2ZZPB 1FEHA 1GNUA 3Q8BA 2DZMA 2L32A 2QHOA 1EWYC 4GIVA 1IUEA 5FR6A 2BB6A 2BKRB 3ZNID 3AE4B 1EM7A 3DWGC 4M0WA 3HK0A 4M02A 3M95A 2JRHA 3ALBA 3HVZA 1SB3C 4YXDB 2DLBA 1T0YA 3A9KB 1EO6A 1V80A 3P2BA 2K5PA 3MJWA 1GB4A 3OJ3A 1NEKB 4K81A 3BVZA 5LNK1 3ECIA 4MT5A 2UU7A 2WWZA 1XEEA 3H6NA 1YIWA 4WJNA 5JHBA 1KJTA 2FCQA 3B9JA 4Q2JA 3PLUA 4HKZE 1STEA 1QT9A 2GI9A 4YSZB 2BW2A 3BK2A 4ZDVA 1FNVA 1K52A 1ESFA 1Q5WB 4G50A 1B9RA 2EKIA 3PVLA 2KWDA 3C0RB 4MM3B 4LDTB 3VRBB 2LGDA 2JYEA 1FNWA 2WXGA 2ZW1A 4TQ1A 2KLCA 4P7IA 2KVRA 4AOFA 1V97A 1FO4A 3JSVB 2J53A 1WMHA 3GS2A 3ZJUA 3L16A 4YSXB 1OQQA 1VCBA 2O6VB 4B0EA 1L4ZB 5E6PA 2NCNA 4BBNF 1WXMA 4IKGA 1RWSA 2WDVB 1TTNA 2N9PC 2BQQA 2L05A 5EE3A 2G9HD 2IZVB 1P1AA 4JGHB 1PFDA 3I9V1 1J7CA 4K7SA 1OEYJ 1IBXA 1N5WA 2WS3B 3WALA 1ET9A 2DYBA 5EE9A 1SBBB 1AARA 2INPE 2CHXA 5KHQA 3PT2B 2CR5A 2NTTA 2SEBD 5BO4B 2SAKA 1YNTE 4IUMB 1WE7A 2KC2A 3NS1A 1V1PA 4KX6B 2LRWA 2QJLA 1QLBB 3RN9C 4HVBA 3AE8B 4ANUA 4BAXA 2EELA 1XLQA 3SHQA 3NY5A 1WY8A 3IT4B 4LNKA 5DCNA 1IPGA 1QOBA 3KH0A 4P16A 3NUHB 3VUXA 4DDID 4O1NA 1V2YA 3RNAC 3NG0A 3RT3B 1NYQA 1XLOA 3ZYYX 1TKGA 1DOIA 1SJED 5DPSA 1E7UA 1K50A 4ZRJA 3EA6A 2OJRA 2LVPA 3AE5B 3GZNB 4WJPA 3Q69A 5C23A 2MWSB 4K3CA 4TV3A 4W9IA 2C7MB 4MGYE 5IAAC 2AL3A 2LUEA 1TS2A 2KYWA 4OVUA 1FM0D 4NZLB 3B0AA 3OWEB 3PHWB 2RGFA 2G45B 2W54A 2MCNB 2O2VA 3EECA 2I2YA 1LO5D 1MPEA 4HROA 1WIAA 4RGMA 4E71A 5D3IB 1SE4A 3MTNB 3NVVA 4MH0E 2KQ4X 3CF6E 2KO3A 4KIKB 4WQOB 4XWTA 4W9DA 3R7RA 4DWFA 1UNSA 1MHXA 1SE3A 5D3DA 4CYEA 2KTRB 3A1QB 1PDXA 2PJHA 5EE0A 3N1XC 1WSPA 2KXJA 1IGDA 3KUDB 1QF6A 1WH3A 2D2QA 3PRZA 1RLFA 1GG3A 4ZRPA 4I6NB 5AUKA 3S2AA 3VDZA 5MPOA 4LJPB 2GMIC 3ML8A 3NZSA 1XCQL 2IY1B 2G4DB 1FXIA 2CJNA 2CKHB 2GBRA 2VZKD 3W9CB 2BWES 4NJCA 4PS7A
chains in the Genus database with same CATH topology
2YEPF 3AB5A 3AEBB 1P7FA 3TEXA 3DWMA 5G5HA 1FCLA 3PZ7A 3U4EG 2WXPA 2B76B 2WXMA 3P4PB 4LK0M 2VZKB 1YMHE 1JCKB 1RYJA 2GB1A 4XDDA 3KWLA 4A6QA 1XLNA 1FFUA 4XE0A 1DOXA 4WQMA 2WU5B 4L23A 2PVGC 1ZXIA 4YWGG 2JZPA 2MJ3A 4JE3B 1TS4A 1C79A 2WXOA 3U7ZA 1SE2A 1QOGA 1HQRD 3MJ5A 5I4DA 3E9SA 4B0MA 1R7SA 5HHDG 1D6EC 2IGGA 1V8CA 3W1SA 2PTLA 3U2SC 5BMIA 3AEAB 4ZHOA 2M56B 1GB1A 3KQ4A 1N63A 1JRPA 3NRZA 1AN8A 4PT5A 1JWBD 4A55A 2JQRB 1JWAD 1MHHE 2LMCA 4TMAB 3U52E 4DXGA 1P7EA 2W82A 2WXLA 3C8YA 2IGDA 2BTEA 1E0ZA 2Y3AA 3NZ3A 1J7BA 1TKYA 2WXNA 1D4BA 1HA5A 2FE8A 1C4PA 3AEDB 5TSSA 4JPSA 4ARIA 1E10A 2K22A 2BB5A 2RDGA 3P63A 1XO3A 3TEWA 2J42A 4JWUC 2IGHA 2LFIA 5BMGA 1FFVA 2RDHA 2ZW0A 2JX5A 2AQ1B 2PIAA 4C7YA 1XLPA 4KGTA 3TEYA 5D7GA 3ZGZA 1ZXHA 4US9A 4KGRA 1L6UA 3BVMA 2WNMA 3FAHA 4YTMB 1ZPSA 3BVGA 5BYRA 1WRIA 2BBCA 1GPXA 3T3OA 2INNE 1KF6B 4GDKB 3KLSX 2PLPA 3P4RB 4OZCA 1FRRA 1WYGA 2M0AA 1RM6C 3J9CA 1CZPA 2IJ0A 3W5VB 2XNAC 3VRAB 4IDIA 1ENFA 4CQNA 1OQRA 2L52A 3AV8A 1L6VA 5GXGB 1KLGD 1RFKA 1D5ZC 2WXFA 2JXTA 1XCTL 1NENB 2N7JA 1HEZE 3MFGA 2ICIA 2LHEA 1KRHA 1FRDA 1E7PB 2L1AA 5H92C 3WCQA 1F0ZA 1HZ5A 1F2RC 1T5XD 1NYRA 1HZ6A 5BYQA 3R2IA 1VJKA 1HXYD 3I57A 1F77A 4KKJA 4LLGM 1BXTA 3N9YC 1UUPA 1MI0A 2DWQA 4GLSC 1NVID 4YT0B 3V05A 3ZQ4A 3GP7A 3SFEB 1EU3A 1CQVA 5H8YE 1ZOYB 2FBWB 2W55A 4MH8A 1C76A 3EGRA 3IT6B 2W3SA 1KTKA 2LJIA 5E6JA 2X38A 4RCOA 4EE2A 4US8A 4ITKA 4FXCA 3ZJTA 4A90A 1E9MA 3AEFB 2WXIA 1V1OA 3MP9A 1C77A 3AN1A 1F2RI 2QEJC 2DBYA 1PGXA 2DYOA 3IXSA 1SF0A 2K9XA 2J4XA 2WXJA 3BK1A 1WXQA 4OZBA 1I4RA 3VQIA 4NAMA 3ZJVA 1PGAA 1QQRA 1YN3A 2H88B 1WWTA 2NTSA 4RGNA 3V3XA 3SFDB 4XWWA 3T3NA 2HTME 4D2KA 2PMVA 1ZP0B 3R8BA 1Y56A 1E6EB 2V3NA 3H8HA 3PZ8A 4XDCA 1N5XA 2WQYB 3TEZA 4N59A 4WIPA 2RPVA 3MHZA 1KH0A 2LHDA 1ROEA 4P6VF 2AX5A 4ARCA 2K0PA 2YEPB 1AYFA 1YN5A 1GOZA 1FEHA 3AE3B 2L32A 3Q8BA 4J3OD 1TS5A 2GRIA 1EWYC 2IDYA 4RH6A 4NAWB 1IUEA 1I4XA 2JSVX 3URYA 4ZHPA 2AQ3B 2BB6A 1ET6A 4MACA 3EUB2 1JWUD 2AQ2B 2JU6X 4HEA1 1TY2A 3IAM1 1TZOA 4KKIA 3AE4B 1EM7A 3DWGC 4OZAA 4M0WA 1K53A 4A8XC 1ZDXA 1J7AA 1C78A 2JWUA 2QILA 2WXRA 1VZ7A 3BYYB 3HVZA 1JROA 1SB3C 4YXDB 1UWXA 2MH7A 2DLBA 5BMHA 1OFFA 2K5PA 1GB4A 1C4CA 1ZDVA 1NEKB 1CJEA 3B2GA 4C7ZA 4HKQA 1VZ6A 1PUTA 3L4PA 1TYGB 3BVZA 5LNK1 2KAJA 4WH4A 2M19A 2N9LA 4MT5A 3FILB 3ABVB 1CK1A 1XEEA 2H89B 2ONQA 1IBXB 3AMZA 1VR9A 1ZUD2 2WXHA 3AM9A 2Z8LA 4AS1A 5EE1A 3B9JA 2WU2B 1BUIC 4Q2JA 3VR8B 4RFBA 1DOYA 2CJOA 4TSSA 4HKZE 1D5MC 1STEA 3P1MA 1QT9A 2GI9A 4RF1A 3B2FA 4YSZB 2BW2A 1K51A 3BK2A 4UDUC 1FNVA 1K52A 2IPKD 4C80A 1ESFA 1B9RA 2EKIA 4N6EB 5FK9C 3AEGB 2KWDA 1T3QA 1V1PB 2KMMA 1N61A 2D5GA 2WXKA 1AWDA 4MM3B 1L4DB 3VRBB 3UI3A 1ZE3D 2E6XA 2JYEA 1FNWA 2WXGA 3BYTB 2ZW1A 1B1ZA 4TQ1A 2NMQA 3CWIA 3HVDA 4AQ7A 2I38A 1QKZA 1GAQB 2WP9B 3O13A 4A9AA 3NVWA 1PGBA 5FKAC 2BT6A 3AH7A 1V97A 3Q8FA 1SJHD 4TQ0A 2BS2B 1IGCA 2LEKA 1FO4A 2N9KA 2J53A 3ZJUA 3GS2A 4RNAA 1C9FA 4YSXB 1OQQA 3NVZA 4OW0A 1XXGA 2E3TA 1JALA 2R61A 4B0EA 1L4ZB 1SXTA 3BIID 2LGIA 3P4SB 1L0YB 1DGJA 1FXAA 2G1EA 1SIJA 4IOIE 5HFYA 4L1BA 2KACA 4IKGA 1RWSA 3LYYA 4YTPB 2WDVB 4KGSA 5EE3A 2G9HD 4WAFA 2WXQA 3FILA 1PFDA 1FCCC 3I9V1 1J7CA 3KWVA 1I4HA 4H2AA 1TY0A 5BYSA 1IBXA 1NI3A 1N5WA 1YJJA 3E56A 1I7HA 1Q10A 2OHFA 2WS3B 4JX1C 4L2YA 1L0VB 1ET9A 5G5GA 5EE9A 1SBBB 3CIRB 4N58A 1BMLC 2JYTA 2MJDA 2INPE 1D5XC 1FD6A 2NTTA 2PW9A 1UGJA 3AE9B 2SEBD 2SAKA 1YNTE 4DXFA 1T6BX 3LB8C 3NS1A 1VDVA 1V1PA 4KX6B 2QSDA 1TKEA 2QJLA 5HG2A 1QLBB 3TSSA 2OEDA 4REZA 3P4QB 4R3DA 3AE8B 4GDLB 2V3PA 1VRAB 1N60A 2KN4A 4YSYB 3AE1B 3VR9B 2EELA 3AECB 1XLQA 3ETRA 3BZDB 2BS4B 1FMAD 1JWMD 3AEEB 4HRSA 3TUOA 3IT4B 1M4VA 1XF5L 1QOBA 1YJIA 3SR6A 1QOAA 4P16A 3NUHB 1PYWD 2ACZB 2RMMA 2V0GA 4O1NA 2KDMA 4YTNB 1JQ4A 1JW9D 3NVYA 3R2TA 1NYQA 4RF0A 4RGOS 5C2TB 1XLOA 3ZYYX 2DYMA 1EU4A 1TKGA 1DOIA 1SJED 3W5UB 4ZOHC 3PO0A 1L0XB 1VZ8A 2Q5WD 1ACCA 4WWMA 1C4AA 1K50A 4OHJA 3RFZB 1FNUA 2QIEB 3EA6A 3AE5B 1WGKA 2V4IB 3Q69A 4USAA 4C56C 2WLBA 1JWSD 1EWCA 3LXFA 4WURA 4OVZA 1KFYB 3FC4A 2HDEA 2J52A 5C3JB 1TS2A 2Y5PA 2BYTA 1FM0D 1I4QA 2BS3B 4NZLB 2ON8A 3OWEB 1YQ3B 4LTUA 1SEBD 1MVKA 3Q8CA 3SEBA 2W54A 2Y5CA 2TSSA 2K3UA 2I2YA 2FUG1 3BWUD 1QOFA 5FR3A 1LO5D 2WDQB 3AE6B 2PKOA 3W2DA 1I4PA 1A70A 1MPEA 2W3RA 3Q8EA 4HROA 3AE2B 4RGMA 3P42A 1N62A 1SE4A 5D3IB 2WDRB 3HRDD 3NVVA 3IAS1 2KQ4X 1UWMA 5T8IA 2LUMA 1KLUD 4XWTA 3Q8AA 1UNSA 3HUIA 1MHXA 1SE3A 3AE7B 5D3DA 5AUIA 2PVOD 1VLBA 4ZYSA 4RGTA 5HI1A 1PDXA 5JXVA 5EE0A 1WSPA 3RPFC 1QILA 1IGDA 1YN4A 1QF6A 4DQOC 3GB1A 1TS3A 1L5PA 1SSNA 2QMTA 4ZRPA 1AW7A 2XN9C 1I4GA 5AUKA 5MPOA 1JMLA 1YQ4B 4HJGE 1DYQA 2CU3A 2MEKA 2L83A 2N0SB 2MJEA 1FIQA 1TJEA 4ZRQA 1XCQL 4JWSC 1FXIA 2CJNA 2VZKD 3MC0B 3W9CB 4NJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBX B;  2N7J A;  1HEZ E;  2LHE A;  1P7F A;  1HZ5 A;  1F2R C;  1FCL A;  4HKZ E;  1XF5 L;  1HZ6 A;  2GI9 A;  1K51 A;  2RMM A;  1YMH E;  1K52 A;  2KDM A;  2GB1 A;  1MI0 A;  4GLS C;  2KWD A;  2JZP A;  1K50 A;  3UI3 A;  2ZW1 A;  2NMQ A;  5HHD G;  2I38 A;  1QKZ A;  2IGG A;  3MP9 A;  2PTL A;  1F2R I;  1PGB A;  5BMI A;  1PGX A;  1GB1 A;  1IGC A;  2J52 A;  2N9K A;  2J53 A;  4OZB A;  1MHH E;  1C9F A;  1PGA A;  2ON8 A;  1P7E A;  1MVK A;  3V3X A;  2LGI A;  4D2K A;  2I2Y A;  2IGD A;  4IOI E;  5HFY A;  1D4B A;  2KAC A;  4IKG A;  1MPE A;  2RPV A;  1KH0 A;  2LHD A;  2K0P A;  2KQ4 X;  4KGS A;  2LUM A;  2IGH A;  5BMG A;  3FIL A;  1FCC C;  2ZW0 A;  1MHX A;  1IBX A;  4KGT A;  2JSV X;  1ZXH A;  1Q10 A;  5HI1 A;  4MAC A;  4KGR A;  5JXV A;  2JU6 X;  1IGD A;  1EM7 A;  4OZA A;  1FD6 A;  1K53 A;  2PW9 A;  2JWU A;  3GB1 A;  1YNT E;  1UWX A;  5BMH A;  2QMT A;  2PLP A;  4OZC A;  1GB4 A;  1JML A;  4HJG E;  2QSD A;  5HG2 A;  2OED A;  4WH4 A;  1XCQ L;  2N9L A;  3FIL B;  2KN4 A;  2EEL A;  2JXT A;  1XCT L;  2ONQ A; 
#chains in the Genus database with same CATH topology
 2YEP F;  3DWM A;  3U4E G;  4LK0 M;  1YMH E;  3DOW A;  1TT5 B;  4XDD A;  3K9O B;  5EDS A;  4N9F 4;  3RNC C;  2PVG C;  4YWG G;  2D3A A;  2MJ3 A;  4JE3 B;  2WXO A;  1SE2 A;  2C60 A;  1HQR D;  1SE9 A;  3MJ5 A;  3L13 A;  4EKU A;  3VTW A;  1R7S A;  1OGW A;  4KDI C;  1Q0W B;  1E8W A;  1JRP A;  3NRZ A;  4PT5 A;  4II3 B;  4BKS A;  2ZEQ A;  5CX3 A;  2IY0 B;  3BIN A;  5IKC M;  2EMT A;  1S1Q B;  2WXL A;  4BFR A;  1E0Z A;  2Y3A A;  3NZ3 A;  1TKY A;  1D4B A;  3HHM A;  2BYF A;  2FE8 A;  2BGF A;  2KJH B;  2RDG A;  1HE8 A;  2LFI A;  5BMG A;  2WYQ A;  2JX5 A;  2JZZ A;  4DK5 A;  4C7Y A;  4KGT A;  1ZXH A;  2BF8 B;  2KDI A;  4KGR A;  1L6U A;  3BVM A;  4NQL B;  1P98 A;  1GPX A;  3R66 C;  4XX5 A;  2INN E;  4A3O A;  3JVZ X;  1KF6 B;  3IBE A;  1RRB A;  3KLS X;  2NBW B;  1FRR A;  2M0A A;  4EZL A;  1CZP A;  2XNA C;  1YX6 B;  2RDB C;  4G11 A;  4HXD A;  1ENF A;  4CQN A;  1OQR A;  2JT4 B;  1MFW A;  2JPH A;  4MSQ B;  1XCT L;  1NEN B;  2N7J A;  3WAN A;  1FXT B;  3WCQ A;  2XEW A;  3GZN I;  2D07 B;  1ZW7 A;  2K39 A;  1HZ6 A;  4M0W B;  2RSU A;  5KHO A;  4WAA A;  4BOZ B;  2PEA A;  4LLG M;  2KMA A;  1BXT A;  2K8H A;  2ZVN A;  2UYZ B;  4K7W A;  1L7Y A;  3N32 A;  4KZC A;  1WGG A;  2LJI A;  4EE2 A;  2X38 A;  4RCO A;  3W1Y A;  3APD A;  4LJO B;  1NDD A;  2GBJ A;  2WXI A;  1C1Y B;  3AN1 A;  4F8C B;  4WWP A;  2DBY A;  3KYD D;  2KVZ A;  2JXX A;  1V86 A;  1XQQ A;  4NAM A;  3I63 C;  3ZJV A;  2L8J A;  3QX1 A;  4RMA A;  2HE7 A;  2C9W B;  3SFD B;  2J0K A;  3DCG A;  4RM9 A;  4IW0 A;  1J0G A;  2GBN A;  2Z59 B;  3DBL B;  1OQY A;  2KWV B;  2WQY B;  3L54 A;  3PZD A;  1TZ1 A;  4WIP A;  4KVG B;  2MBH A;  4ICU A;  2AX5 A;  3V6C B;  3LJ3 A;  1T0Q C;  2YEP B;  2LD9 A;  2QDF A;  4KSK C;  1YN5 A;  1GOZ A;  1GUA B;  4J3O D;  2KOX A;  1TS5 A;  4LNN A;  2GRI A;  3AI5 A;  1I4X A;  2KDF B;  2AQ3 B;  1JWU D;  2JU6 X;  1WMH B;  2L7R A;  4F1S A;  4KKI A;  1E5W A;  4A8X C;  3UIO B;  1J7A A;  4NY0 A;  1C78 A;  3ONS A;  2QIL A;  2ZPY A;  2MX2 A;  2LI5 A;  2JWZ A;  2MH7 A;  2KD0 A;  2BYE A;  2KMC A;  3DVN U;  4AP4 C;  1VZ6 A;  4HKQ A;  2KAJ A;  4WH4 A;  3GE8 C;  3QQ8 B;  2H89 B;  5JH5 C;  2ONQ A;  1IBX B;  2A5U A;  3RNE C;  2RD0 A;  1YQB A;  3VR8 B;  2CJO A;  1D5M C;  3P1M A;  4LDT D;  2KHW B;  3ZNH B;  2WX1 A;  3RYT A;  2QCZ A;  3A33 B;  5E6O A;  4B95 A;  1I35 A;  1V1P B;  2D5G A;  4LNO A;  3VTU A;  4J6I A;  3APC A;  3X23 A;  1AWD A;  3K9P B;  2WDT B;  3PRP B;  1ZE3 D;  2KJR A;  2JVC A;  1B1Z A;  2NMQ A;  3HVD A;  4AQ7 A;  1QKZ A;  4TKN A;  2D11 A;  4A9A A;  3NVW A;  2AEH A;  4XC2 A;  5FKA C;  2BT6 A;  3AH7 A;  2BKF A;  2LEK A;  4RNA A;  1C9F A;  1H4R A;  4AJW A;  2UWQ A;  3NVZ A;  2GLS A;  2KK8 A;  1XXG A;  1JAL A;  3BII D;  2LGI A;  4MSM B;  1L0Y B;  1E8Z A;  2JF5 A;  2MQJ A;  3LYY A;  2JY6 A;  4MDK E;  4WAF A;  2JUO A;  3A4S C;  2HJ8 A;  3SU8 X;  3DHG C;  5BYS A;  1YJJ A;  1T0S C;  4JX1 C;  2NBV B;  4WWN A;  5G5G A;  1A5R A;  2MJD A;  4GXB A;  2PW9 A;  2BYV E;  2O2V B;  3LB8 C;  1VDV A;  1TKE A;  3DHH C;  3TSS A;  1YX5 B;  3P4Q B;  2ZPN A;  3EFC A;  4MGI E;  1N60 A;  1P9D U;  3VR9 B;  4HDQ A;  1WZ0 A;  3ETR A;  3H7P A;  3BZD B;  4FA6 A;  1FMA D;  3ZNG C;  3AEE B;  2KN5 A;  3TUO A;  1XF5 L;  1UH6 A;  3RNF C;  1PYW D;  2RMM A;  2VRR B;  3ZW3 A;  2KDM A;  2MBO A;  1JW9 D;  1F1H A;  3UQA A;  2DYM A;  2KTF A;  1EU4 A;  1F9J A;  1L0X B;  3N3K B;  1VZ8 A;  4OHJ A;  1FNU A;  1WXS A;  1WGK A;  2V4I B;  4BKG A;  1JWS D;  1EWC A;  4OVZ A;  3NJT A;  1KFY B;  2FIF A;  1WXV A;  3FC4 A;  2HDE A;  4FJZ A;  2J52 A;  2Y5P A;  4MEM A;  2BYT A;  2FAZ A;  1I4Q A;  2ON8 A;  1YQ3 B;  4DXA B;  2M8S A;  3Q8C A;  2XK5 A;  3OJ4 B;  3BWU D;  1QOF A;  2LVQ A;  3Q6B A;  4M01 A;  4W9C A;  2PKO A;  3QJZ A;  3W2D A;  3Q8E A;  2W3R A;  4WWO A;  1SIF A;  3P42 A;  1N62 A;  1UWM A;  2LUM A;  3ZXR A;  3Q8A A;  3HUI A;  3AUL A;  2KZR A;  4LNF A;  5AUI A;  1VLB A;  3VTV A;  2REX A;  3RPF C;  3X0W A;  4C4V A;  3PRE A;  3U30 A;  2KNB A;  1TIF A;  3A4R A;  4DHJ D;  1TS3 A;  1V49 A;  1AW7 A;  3ZUN A;  2NS5 A;  2FNJ B;  1WJ6 A;  4M8M A;  1JML A;  1DYQ A;  2CU3 A;  2L83 A;  5LXH A;  2LWP A;  4ZRQ A;  3DVG X;  3B08 A;  3ZO5 B;  1WR6 E;  4KV2 A;  3V61 A;  4DHZ E;  3FKY A;  4HLE A;  1FCL A;  1YOV B;  2B76 B;  1RYJ A;  2GB1 A;  2GBK A;  4A6Q A;  1XLN A;  1FFU A;  4XE0 A;  1DOX A;  2WU5 B;  4XGA B;  3U7Z A;  1TS4 A;  1P0R A;  1R4N B;  5HHD G;  1D6E C;  4CHK A;  4HCN B;  2PTL A;  1WFY A;  3R7Q A;  3PSE B;  2LRU A;  3KQ4 A;  1N63 A;  2C7H A;  2KWC A;  2JQR B;  1JWA D;  1LXD A;  3L17 A;  2KT7 A;  1WJU A;  2FCM A;  3VVW B;  2N7E A;  3M62 B;  3C8Y A;  4E74 A;  2M17 A;  1J7B A;  1HA5 A;  1X1M A;  2EKE C;  5J18 A;  1E10 A;  2BB5 A;  3EFU A;  2D10 A;  3Q2A C;  3TEW A;  2J42 A;  4JWU C;  2ZJD A;  1Z2M A;  2DAJ A;  1LGR A;  1XLP A;  2M0X A;  5D7G A;  2B3A A;  2BBC A;  4ACF A;  4ZYN A;  3TBL D;  4LCD E;  1WGY A;  3QK0 A;  2AL6 A;  2IJ0 A;  2CHZ A;  1WXA A;  4PS3 A;  5D94 A;  3AV8 A;  2ASQ A;  2MW5 A;  3RUL A;  4C00 A;  1RFK A;  2JXT A;  1RAX A;  2LHE A;  1FRD A;  2WGS A;  1NYR A;  4BZA A;  4FN2 A;  3RCZ A;  3NHE B;  1VJK A;  2EMS A;  3PRM B;  4KKJ A;  1Q1O A;  1UUP A;  2DWQ A;  4HDO A;  3ZQ4 A;  3GP7 A;  1EU3 A;  1CQV A;  2W55 A;  1C76 A;  3EGR A;  5IO9 A;  3RZF A;  4W9G A;  5E6J A;  1F52 A;  1E9M A;  2KFK A;  4A90 A;  3U8Z A;  3AEF B;  1V81 A;  5TR5 A;  4K3B A;  3UGB B;  2BVC A;  2G3Q B;  3IG3 A;  2IO2 B;  2QEJ C;  2N9X A;  4KZ0 A;  2KDE B;  2LVO A;  4X57 B;  1NBF C;  2K1F A;  2J0M A;  1ZGU B;  1YN3 A;  1TBE A;  2H88 B;  2KDB A;  4RGN A;  4IC7 B;  4XWW A;  4GDK A;  4D2K A;  1ZP0 B;  2LJ5 A;  2RR9 A;  1WR1 A;  2V3N A;  4HPP A;  2K6D B;  3JW0 X;  3TEZ A;  4N59 A;  1KH0 A;  2XBB C;  4P6V F;  2KJ6 A;  4ARC A;  3KVF B;  3H9D A;  4G0N B;  3AE3 B;  3QCA A;  2IDY A;  3URY A;  2HD5 B;  2MP2 A;  4MAC A;  2AQ2 B;  5DPR A;  3IAM 1;  4KDL B;  2L0T A;  1K53 A;  1ZDX A;  2IO1 B;  3BYY B;  1VZ7 A;  1UWX A;  1OFF A;  1C4C A;  1ZDV A;  1CJE A;  3B2G A;  2D3C A;  5AZH A;  1TYG B;  2M19 A;  2C5L C;  3AMZ A;  4HPM B;  2WXH A;  3AM9 A;  1E8X A;  4AS1 A;  5EE1 A;  4RFB A;  4FBJ B;  3MC8 A;  3B2F A;  2IPK D;  4C80 A;  1WX8 A;  3AEG B;  3RNB C;  4ANV A;  1S3S G;  2KMM A;  3TMP B;  3ZXV A;  1J19 A;  2WXK A;  2CS4 A;  2NBU A;  1L4D B;  2E6X A;  3BYT B;  4FLH A;  3CWI A;  4M00 A;  2WP9 B;  3Q3O C;  4JQW C;  2AWT A;  1PGB A;  3PTF C;  3H7P B;  4NAW A;  3Q8F A;  4A20 A;  4TQ0 A;  3B1L X;  1IGC A;  2MLB A;  2N9K A;  2MBQ A;  3SD5 A;  1OEY A;  2R61 A;  3L0W B;  5AZF A;  1SXT A;  3P4S B;  4HCP B;  1XT9 B;  2I1J A;  2G1E A;  1SIJ A;  5LLI A;  3DBS A;  5IOI A;  4YTP B;  4EOY A;  5J17 A;  2IND C;  3O65 B;  2KC1 A;  4NNJ B;  4KGS A;  2N1V A;  2WXQ A;  3FIL A;  1WF9 A;  3KWV A;  3RNG C;  1I4H A;  1I7H A;  2LZ6 A;  1Q10 A;  2OHF A;  4L2Y A;  3TL5 A;  2PPH A;  1YD8 U;  4N58 A;  4IM3 A;  3VXW A;  1FD6 A;  4IG7 B;  1UGJ A;  2XK5 B;  3ENE A;  4DXF A;  3CSF A;  2K8B A;  2MA9 B;  4XYC A;  2OED A;  4REZ A;  4GOC A;  3PPA A;  2DZJ A;  2RPQ A;  3PHX B;  2V3P A;  2KN4 A;  4W9J A;  1FPY A;  3AU4 A;  3D32 A;  3AE1 B;  4YSY B;  2M1M A;  4BVU C;  1WJ4 A;  2BS4 B;  2JZ3 B;  3ZRF A;  1WI0 A;  4C4V B;  3SR6 A;  1QOA A;  2ACZ B;  2KX0 A;  4LNI A;  4YTN B;  1JQ4 A;  2MSE D;  3NVY A;  3R2T A;  2N9E B;  2OOB B;  3ZDM C;  3W5U B;  3PO0 A;  4YL8 A;  2Q5W D;  3T9L A;  3RFZ B;  2QIE B;  1V6E A;  3PV1 A;  3V62 A;  4USA A;  4C56 C;  3LDZ E;  2HTH A;  3LXF A;  4WUR A;  1KLV A;  3VUW A;  3Q3M C;  5C3J B;  2V3S A;  2BS3 B;  3M63 B;  4LTU A;  3ZNZ B;  3EHV A;  1SEB D;  1MVK A;  2QC8 A;  2K3U A;  1ZKH A;  5FR3 A;  3AE6 B;  2WDQ B;  3HM3 A;  3KUZ A;  3QWZ B;  2VH1 A;  1H8C A;  1A70 A;  4PK1 A;  2O6V D;  2LGS A;  3WAM A;  2WDR B;  5LXI B;  4MJS A;  5G55 A;  1KLU D;  5DPW A;  2GOW A;  3AE7 B;  4GB9 A;  1UBQ A;  2KQS A;  3ZTC A;  4RGT A;  1KOT A;  4S0R A;  1MG4 A;  2KFJ A;  4DQO C;  4RM8 A;  1U4A A;  1L5P A;  2QMT A;  2XN9 C;  3N20 C;  4HK2 A;  2DHZ A;  3Q3J A;  1YQ4 B;  4HJG E;  2MEK A;  2KQ7 A;  3VH3 B;  1TJE A;  4P1C C;  2PE9 A;  5D6J B;  3MC0 B;  2Z0E B;  3AB5 A;  4HWI B;  4EEW A;  1N6Z A;  5G5H A;  3PZ7 A;  2OJW A;  4WJQ A;  1IP9 A;  2WXP A;  2WXM A;  1V5O A;  3P4P B;  3IFW B;  2N7D A;  2V1Y A;  2DAF A;  1I42 A;  1UF0 A;  3DVN V;  1C79 A;  1QOG A;  5J2R A;  3E9S A;  4DHZ B;  4EZJ A;  2IGG A;  3VUY A;  3W1S A;  3U2S C;  5BMI A;  3AEA B;  4ZHO A;  2M56 B;  4BBN C;  1GB1 A;  2FUH B;  3ZLZ A;  5JZE B;  2CU1 A;  2N4F A;  1MHH E;  2LMC A;  4TMA B;  3U52 E;  4DXG A;  1WJN A;  2W82 A;  4FJY A;  2IGD A;  2BTE A;  3HM6 X;  5IA7 A;  1RFA A;  1SGH A;  3Q3N C;  1WZ3 A;  3RUI B;  3T8M A;  3DBL I;  3MHS D;  3GOE A;  5TSS A;  4ARI A;  2J7Q B;  3P63 A;  2KFK B;  1XO3 A;  2ZVO A;  4NJ7 A;  2LXA A;  1FFV A;  4PS8 A;  2I1K A;  2V4L A;  2AQ1 B;  2MBB B;  4GGQ A;  5CHW A;  3Q14 C;  3A9J A;  2WNM A;  3FAH A;  4YTM B;  5L95 C;  3TJP A;  3C19 A;  4OVV A;  5BYR A;  3N1Y C;  4GDK B;  3QC8 B;  3P4R B;  3W5V B;  1UBI A;  1D3Z A;  3VRA B;  4IDI A;  4W9H A;  2L52 A;  5CTR C;  5GXG B;  1KLG D;  1D5Z C;  2KLG A;  2WXF A;  5C1Z A;  1HEZ E;  2ICI A;  2MP2 B;  2M4N A;  3M3J A;  1E7P B;  2L1A A;  5H92 C;  2DZK A;  1HZ5 A;  1F2R C;  1VD2 A;  1T5X D;  4JIO U;  2R2Q A;  4JL9 A;  5BYQ A;  2D3G A;  4GU2 A;  1HXY D;  5DPT A;  1MI0 A;  2Y5B B;  4MEL A;  4YT0 B;  3W1S C;  3SFE B;  1WRD B;  3CMM B;  2FBW B;  2KKC A;  4MGK E;  4ASW C;  3IVF A;  2W3S A;  1KTK A;  3ZKJ C;  2YVC A;  2ZCC A;  4US8 A;  4ITK A;  4FXC A;  4II2 B;  1E90 A;  1V5T A;  4I6P A;  1C77 A;  3MP9 A;  3H7S A;  4AWJ A;  1PGX A;  3KUC B;  2DYO A;  2L76 A;  3IXS A;  1SF0 A;  2K9X A;  2J4X A;  2WXJ A;  5CHV C;  4OZB A;  1I4R A;  1PGA A;  3U7D A;  1WWT A;  2NTS A;  4KSL C;  4K7U A;  2PMV A;  3R8B A;  1Y56 A;  1E6E B;  1N5X A;  2NVU I;  3RMK C;  4B6W A;  3PLV A;  2GBM A;  3HIZ A;  2RPV A;  3MHZ A;  2LHD A;  2K0P A;  1AYF A;  1KM7 A;  1WGD A;  2NPT A;  1UGM A;  3PGE A;  2ZNV C;  4RH6 A;  4NAW B;  2JSV X;  4ZHP A;  1WGH A;  1ET6 A;  3NOB A;  4HEA 1;  3EUB 2;  2C7N B;  1TY2 A;  3DHI C;  1TZO A;  4OZA A;  2JWU A;  2WXR A;  1R4M B;  1JRO A;  1GJZ A;  5BMH A;  1EF5 A;  2FID A;  4C7Z A;  1J8C A;  1PUT A;  3L4P A;  1EF1 A;  2K6Q A;  2N9L A;  3FIL B;  3ABV B;  1CK1 A;  2L3Z A;  4AJY B;  1VR9 A;  1ZUD 2;  4HJK A;  3WAO A;  5IP4 D;  2Z8L A;  2WU2 B;  1BUI C;  1DOY A;  4TSS A;  3NZU A;  3DVG Y;  2LGY A;  4RF1 A;  1K51 A;  4UDU C;  4N6E B;  5FK9 C;  1T3Q A;  1N61 A;  3TIX A;  3RZW C;  3VFK A;  3UI3 A;  3L08 A;  3NS8 A;  4FAD A;  2I38 A;  3O13 A;  1GAQ B;  5AZG A;  4P1B C;  3DBR B;  2L0F A;  3UQB A;  1SJH D;  4PYZ A;  2BS2 B;  3QAQ A;  5IN7 A;  2MHJ A;  5G2N A;  4OW0 A;  2KWU B;  2E3T A;  3I5J C;  1K8R B;  1GC6 A;  4EFO A;  1DGJ A;  5GMV A;  1FXA A;  3UIP B;  1MG8 A;  4IOI E;  3A9K A;  5D2M B;  2INC C;  5HFY A;  4L1B A;  3BY4 B;  2KAC A;  3RI7 C;  1EUV B;  3SDL C;  3V6E B;  1FCC C;  1MJD A;  4S17 A;  1P3Q U;  4H2A A;  1TY0 A;  3E56 A;  1NI3 A;  2IO0 B;  4DHJ B;  3DBH B;  3TCA A;  4ZRI A;  2K8C A;  4IWP A;  1L0V B;  3CIR B;  3OG5 A;  4MGZ E;  4F7Z A;  1BML C;  2IO3 B;  2JYT A;  4JLC A;  4B9K A;  1D5X C;  1L2N A;  4FHJ A;  3AE9 B;  2FCS A;  1T6B X;  4CO7 A;  3KW5 B;  2BWF A;  2J0J A;  2MRP A;  2QSD A;  5HG2 A;  4MM3 A;  1JRU A;  3EC8 A;  4R3D A;  4MJS B;  2BPS A;  4GDL B;  1VRA B;  3DDC B;  4PYU A;  2L00 B;  3AEC B;  2D3B A;  1G6J A;  1JWM D;  4HRS A;  3IHP C;  4GMV A;  3JSV A;  1M4V A;  1YJI A;  3WA0 A;  2V0G A;  2O6V A;  3WIM A;  4RF0 A;  4RGO S;  5C2T B;  2K25 A;  4ZOH C;  1ACC A;  3JYU A;  4WWM A;  1C4A A;  4ANX A;  1YJ1 A;  4QAY A;  3KYC D;  4IM0 A;  1UZX B;  2WLB A;  3WAP A;  1R4N I;  4TUU A;  2AYO B;  3I3T B;  4E3C A;  4HPL B;  4G3X B;  1HTQ A;  3SEB A;  2Y5C A;  2TSS A;  2FUG 1;  2X8X X;  1PQS A;  1OTR B;  2JRI B;  2KAN A;  4W9E A;  3CST A;  2G4S A;  1I4P A;  3ZRC A;  3ZDT A;  3AE2 B;  5HKH A;  4XZ4 A;  1R4M I;  3HRD D;  1E7V A;  3IAS 1;  5T8I A;  3Q3F A;  2LXC A;  2DZI A;  3AU5 A;  3H1U A;  4NQK E;  2PVO D;  4ZYS A;  5HI1 A;  5JXV A;  1BT0 A;  3RD2 A;  1QIL A;  1YN4 A;  4ANW A;  3DQV A;  4WJO A;  4I6L B;  1HTO A;  3GB1 A;  3APF A;  2KX3 A;  1SSN A;  3N30 A;  4W9L A;  1I4G A;  2N0S B;  2NR2 A;  4DDG D;  4EUT A;  2W9N A;  2MJE A;  1FIQ A;  2WX0 A;  4JWS C;  4GN1 A;  1LFD A;  1WX7 A;  3AEB B;  1P7F A;  3A9J B;  3TEX A;  3VH4 B;  4W9K A;  2LGX A;  2Z0D B;  4GSW A;  4DBG A;  1UD7 A;  3GE3 C;  5JHA A;  2FCN A;  1CMX B;  2LAS A;  2VZK B;  3DBR I;  1JCK B;  3MC9 A;  1LM8 B;  3KWL A;  2ZNV B;  4WQM A;  4L23 A;  1ZXI A;  2JZP A;  4IWO A;  2A4Z A;  3PS6 A;  4K1R B;  5I4D A;  1LQB A;  1WYW B;  3N1Z C;  4B0M A;  1TGZ B;  3ZVV A;  4KIK A;  2PE6 B;  2DX5 B;  1V8C A;  2MBE A;  5E6N A;  4FHK A;  3R3M A;  2KTR A;  2WHI A;  3A1Q A;  4NPN A;  1AN8 A;  4A55 A;  1JWB D;  3DPD A;  2R2O A;  2CHW A;  2IYD B;  1P7E A;  3QHT A;  1E8Y A;  3VHT C;  3DBH I;  2WXN A;  2HJ1 A;  3AED B;  1C4P A;  3ZIM A;  4JPS A;  2K22 A;  3VAW A;  2IGH A;  2RDH A;  2ZW0 A;  3UF8 A;  2PIA A;  4W9F A;  1NI2 A;  3TEY A;  3ZGZ A;  4FUL A;  4US9 A;  1ZPS A;  3BVG A;  4ICV A;  1C3T A;  1WRI A;  3T3O A;  2ZCB A;  4AUQ C;  4BKS D;  2PLP A;  2IBI B;  4OZC A;  1WYG A;  1WM2 A;  1RM6 C;  3J9C A;  4NJ6 A;  4GDL A;  3L10 B;  3QIJ A;  3AXC A;  1XD3 B;  1L6V A;  3ZTD A;  1T0R C;  2NPT B;  4FJV B;  4EZK A;  1M94 A;  3MFG A;  1KRH A;  4URK A;  2DEN B;  1F0Z A;  1UEL A;  4BKT A;  3V60 A;  3R2I A;  3I57 A;  1F77 A;  1WGR A;  2VH2 A;  4ZRK A;  3N9Y C;  4GLS C;  1NVI D;  3V05 A;  5H8Y E;  1ZOY B;  3UIN B;  1GC7 A;  1QZE A;  5AEK B;  4MH8 A;  3IT6 B;  2YLM A;  1IYF A;  3ZJT A;  3OLM D;  1V1O A;  4IWQ A;  2DNF A;  2N1W A;  4BOS C;  1WE6 A;  1F2R I;  1ISN A;  1V9J A;  5CHF A;  3BK1 A;  1Y8R C;  1WXQ A;  1WX9 A;  3VQI A;  3QA8 A;  1WM3 A;  1QQR A;  5L83 A;  3OAW A;  3QAR A;  4IM2 A;  3V3X A;  1Z5S B;  3T3N A;  2HTM E;  3H8H A;  2V9H A;  3PZ8 A;  4XDC A;  4A3P A;  3ML9 A;  1ROE A;  4M8N A;  2ZZP B;  1FEH A;  1GNU A;  3Q8B A;  2DZM A;  2L32 A;  2QHO A;  1EWY C;  4GIV A;  1IUE A;  5FR6 A;  2BB6 A;  2BKR B;  3ZNI D;  3AE4 B;  1EM7 A;  3DWG C;  4M0W A;  3HK0 A;  4M02 A;  3M95 A;  2JRH A;  3ALB A;  3HVZ A;  1SB3 C;  4YXD B;  2DLB A;  1T0Y A;  3A9K B;  1EO6 A;  1V80 A;  3P2B A;  2K5P A;  3MJW A;  1GB4 A;  3OJ3 A;  1NEK B;  4K81 A;  3BVZ A;  5LNK 1;  3ECI A;  4MT5 A;  2UU7 A;  2WWZ A;  1XEE A;  3H6N A;  1YIW A;  4WJN A;  5JHB A;  1KJT A;  2FCQ A;  3B9J A;  4Q2J A;  3PLU A;  4HKZ E;  1STE A;  1QT9 A;  2GI9 A;  4YSZ B;  2BW2 A;  3BK2 A;  4ZDV A;  1FNV A;  1K52 A;  1ESF A;  1Q5W B;  4G50 A;  1B9R A;  2EKI A;  3PVL A;  2KWD A;  3C0R B;  4MM3 B;  4LDT B;  3VRB B;  2LGD A;  2JYE A;  1FNW A;  2WXG A;  2ZW1 A;  4TQ1 A;  2KLC A;  4P7I A;  2KVR A;  4AOF A;  1V97 A;  1FO4 A;  3JSV B;  2J53 A;  1WMH A;  3GS2 A;  3ZJU A;  3L16 A;  4YSX B;  1OQQ A;  1VCB A;  2O6V B;  4B0E A;  1L4Z B;  5E6P A;  2NCN A;  4BBN F;  1WXM A;  4IKG A;  1RWS A;  2WDV B;  1TTN A;  2N9P C;  2BQQ A;  2L05 A;  5EE3 A;  2G9H D;  2IZV B;  1P1A A;  4JGH B;  1PFD A;  3I9V 1;  1J7C A;  4K7S A;  1OEY J;  1IBX A;  1N5W A;  2WS3 B;  3WAL A;  1ET9 A;  2DYB A;  5EE9 A;  1SBB B;  1AAR A;  2INP E;  2CHX A;  5KHQ A;  3PT2 B;  2CR5 A;  2NTT A;  2SEB D;  5BO4 B;  2SAK A;  1YNT E;  4IUM B;  1WE7 A;  2KC2 A;  3NS1 A;  1V1P A;  4KX6 B;  2LRW A;  2QJL A;  1QLB B;  3RN9 C;  4HVB A;  3AE8 B;  4ANU A;  4BAX A;  2EEL A;  1XLQ A;  3SHQ A;  3NY5 A;  1WY8 A;  3IT4 B;  4LNK A;  5DCN A;  1IPG A;  1QOB A;  3KH0 A;  4P16 A;  3NUH B;  3VUX A;  4DDI D;  4O1N A;  1V2Y A;  3RNA C;  3NG0 A;  3RT3 B;  1NYQ A;  1XLO A;  3ZYY X;  1TKG A;  1DOI A;  1SJE D;  5DPS A;  1E7U A;  1K50 A;  4ZRJ A;  3EA6 A;  2OJR A;  2LVP A;  3AE5 B;  3GZN B;  4WJP A;  3Q69 A;  5C23 A;  2MWS B;  4K3C A;  4TV3 A;  4W9I A;  2C7M B;  4MGY E;  5IAA C;  2AL3 A;  2LUE A;  1TS2 A;  2KYW A;  4OVU A;  1FM0 D;  4NZL B;  3B0A A;  3OWE B;  3PHW B;  2RGF A;  2G45 B;  2W54 A;  2MCN B;  2O2V A;  3EEC A;  2I2Y A;  1LO5 D;  1MPE A;  4HRO A;  1WIA A;  4RGM A;  4E71 A;  5D3I B;  1SE4 A;  3MTN B;  3NVV A;  4MH0 E;  2KQ4 X;  3CF6 E;  2KO3 A;  4KIK B;  4WQO B;  4XWT A;  4W9D A;  3R7R A;  4DWF A;  1UNS A;  1MHX A;  1SE3 A;  5D3D A;  4CYE A;  2KTR B;  3A1Q B;  1PDX A;  2PJH A;  5EE0 A;  3N1X C;  1WSP A;  2KXJ A;  1IGD A;  3KUD B;  1QF6 A;  1WH3 A;  2D2Q A;  3PRZ A;  1RLF A;  1GG3 A;  4ZRP A;  4I6N B;  5AUK A;  3S2A A;  3VDZ A;  5MPO A;  4LJP B;  2GMI C;  3ML8 A;  3NZS A;  1XCQ L;  2IY1 B;  2G4D B;  1FXI A;  2CJN A;  2CKH B;  2GBR A;  2VZK D;  3W9C B;  2BWE S;  4NJC A;  4PS7 A; 
#chains in the Genus database with same CATH homology
 2YEP F;  3AB5 A;  3AEB B;  1P7F A;  3TEX A;  3DWM A;  5G5H A;  1FCL A;  3PZ7 A;  3U4E G;  2WXP A;  2B76 B;  2WXM A;  3P4P B;  4LK0 M;  2VZK B;  1YMH E;  1JCK B;  1RYJ A;  2GB1 A;  4XDD A;  3KWL A;  4A6Q A;  1XLN A;  1FFU A;  4XE0 A;  1DOX A;  4WQM A;  2WU5 B;  4L23 A;  2PVG C;  1ZXI A;  4YWG G;  2JZP A;  2MJ3 A;  4JE3 B;  1TS4 A;  1C79 A;  2WXO A;  3U7Z A;  1SE2 A;  1QOG A;  1HQR D;  3MJ5 A;  5I4D A;  3E9S A;  4B0M A;  1R7S A;  5HHD G;  1D6E C;  2IGG A;  1V8C A;  3W1S A;  2PTL A;  3U2S C;  5BMI A;  3AEA B;  4ZHO A;  2M56 B;  1GB1 A;  3KQ4 A;  1N63 A;  1JRP A;  3NRZ A;  1AN8 A;  4PT5 A;  1JWB D;  4A55 A;  2JQR B;  1JWA D;  1MHH E;  2LMC A;  4TMA B;  3U52 E;  4DXG A;  1P7E A;  2W82 A;  2WXL A;  3C8Y A;  2IGD A;  2BTE A;  1E0Z A;  2Y3A A;  3NZ3 A;  1J7B A;  1TKY A;  2WXN A;  1D4B A;  1HA5 A;  2FE8 A;  1C4P A;  3AED B;  5TSS A;  4JPS A;  4ARI A;  1E10 A;  2K22 A;  2BB5 A;  2RDG A;  3P63 A;  1XO3 A;  3TEW A;  2J42 A;  4JWU C;  2IGH A;  2LFI A;  5BMG A;  1FFV A;  2RDH A;  2ZW0 A;  2JX5 A;  2AQ1 B;  2PIA A;  4C7Y A;  1XLP A;  4KGT A;  3TEY A;  5D7G A;  3ZGZ A;  1ZXH A;  4US9 A;  4KGR A;  1L6U A;  3BVM A;  2WNM A;  3FAH A;  4YTM B;  1ZPS A;  3BVG A;  5BYR A;  1WRI A;  2BBC A;  1GPX A;  3T3O A;  2INN E;  1KF6 B;  4GDK B;  3KLS X;  2PLP A;  3P4R B;  4OZC A;  1FRR A;  1WYG A;  2M0A A;  1RM6 C;  3J9C A;  1CZP A;  2IJ0 A;  3W5V B;  2XNA C;  3VRA B;  4IDI A;  1ENF A;  4CQN A;  1OQR A;  2L52 A;  3AV8 A;  1L6V A;  5GXG B;  1KLG D;  1RFK A;  1D5Z C;  2WXF A;  2JXT A;  1XCT L;  1NEN B;  2N7J A;  1HEZ E;  3MFG A;  2ICI A;  2LHE A;  1KRH A;  1FRD A;  1E7P B;  2L1A A;  5H92 C;  3WCQ A;  1F0Z A;  1HZ5 A;  1F2R C;  1T5X D;  1NYR A;  1HZ6 A;  5BYQ A;  3R2I A;  1VJK A;  1HXY D;  3I57 A;  1F77 A;  4KKJ A;  4LLG M;  1BXT A;  3N9Y C;  1UUP A;  1MI0 A;  2DWQ A;  4GLS C;  1NVI D;  4YT0 B;  3V05 A;  3ZQ4 A;  3GP7 A;  3SFE B;  1EU3 A;  1CQV A;  5H8Y E;  1ZOY B;  2FBW B;  2W55 A;  4MH8 A;  1C76 A;  3EGR A;  3IT6 B;  2W3S A;  1KTK A;  2LJI A;  5E6J A;  2X38 A;  4RCO A;  4EE2 A;  4US8 A;  4ITK A;  4FXC A;  3ZJT A;  4A90 A;  1E9M A;  3AEF B;  2WXI A;  1V1O A;  3MP9 A;  1C77 A;  3AN1 A;  1F2R I;  2QEJ C;  2DBY A;  1PGX A;  2DYO A;  3IXS A;  1SF0 A;  2K9X A;  2J4X A;  2WXJ A;  3BK1 A;  1WXQ A;  4OZB A;  1I4R A;  3VQI A;  4NAM A;  3ZJV A;  1PGA A;  1QQR A;  1YN3 A;  2H88 B;  1WWT A;  2NTS A;  4RGN A;  3V3X A;  3SFD B;  4XWW A;  3T3N A;  2HTM E;  4D2K A;  2PMV A;  1ZP0 B;  3R8B A;  1Y56 A;  1E6E B;  2V3N A;  3H8H A;  3PZ8 A;  4XDC A;  1N5X A;  2WQY B;  3TEZ A;  4N59 A;  4WIP A;  2RPV A;  3MHZ A;  1KH0 A;  2LHD A;  1ROE A;  4P6V F;  2AX5 A;  4ARC A;  2K0P A;  2YEP B;  1AYF A;  1YN5 A;  1GOZ A;  1FEH A;  3AE3 B;  2L32 A;  3Q8B A;  4J3O D;  1TS5 A;  2GRI A;  1EWY C;  2IDY A;  4RH6 A;  4NAW B;  1IUE A;  1I4X A;  2JSV X;  3URY A;  4ZHP A;  2AQ3 B;  2BB6 A;  1ET6 A;  4MAC A;  3EUB 2;  1JWU D;  2AQ2 B;  2JU6 X;  4HEA 1;  1TY2 A;  3IAM 1;  1TZO A;  4KKI A;  3AE4 B;  1EM7 A;  3DWG C;  4OZA A;  4M0W A;  1K53 A;  4A8X C;  1ZDX A;  1J7A A;  1C78 A;  2JWU A;  2QIL A;  2WXR A;  1VZ7 A;  3BYY B;  3HVZ A;  1JRO A;  1SB3 C;  4YXD B;  1UWX A;  2MH7 A;  2DLB A;  5BMH A;  1OFF A;  2K5P A;  1GB4 A;  1C4C A;  1ZDV A;  1NEK B;  1CJE A;  3B2G A;  4C7Z A;  4HKQ A;  1VZ6 A;  1PUT A;  3L4P A;  1TYG B;  3BVZ A;  5LNK 1;  2KAJ A;  4WH4 A;  2M19 A;  2N9L A;  4MT5 A;  3FIL B;  3ABV B;  1CK1 A;  1XEE A;  2H89 B;  2ONQ A;  1IBX B;  3AMZ A;  1VR9 A;  1ZUD 2;  2WXH A;  3AM9 A;  2Z8L A;  4AS1 A;  5EE1 A;  3B9J A;  2WU2 B;  1BUI C;  4Q2J A;  3VR8 B;  4RFB A;  1DOY A;  2CJO A;  4TSS A;  4HKZ E;  1D5M C;  1STE A;  3P1M A;  1QT9 A;  2GI9 A;  4RF1 A;  3B2F A;  4YSZ B;  2BW2 A;  1K51 A;  3BK2 A;  4UDU C;  1FNV A;  1K52 A;  2IPK D;  4C80 A;  1ESF A;  1B9R A;  2EKI A;  4N6E B;  5FK9 C;  3AEG B;  2KWD A;  1T3Q A;  1V1P B;  2KMM A;  1N61 A;  2D5G A;  2WXK A;  1AWD A;  4MM3 B;  1L4D B;  3VRB B;  3UI3 A;  1ZE3 D;  2E6X A;  2JYE A;  1FNW A;  2WXG A;  3BYT B;  2ZW1 A;  1B1Z A;  4TQ1 A;  2NMQ A;  3CWI A;  3HVD A;  4AQ7 A;  2I38 A;  1QKZ A;  1GAQ B;  2WP9 B;  3O13 A;  4A9A A;  3NVW A;  1PGB A;  5FKA C;  2BT6 A;  3AH7 A;  1V97 A;  3Q8F A;  1SJH D;  4TQ0 A;  2BS2 B;  1IGC A;  2LEK A;  1FO4 A;  2N9K A;  2J53 A;  3ZJU A;  3GS2 A;  4RNA A;  1C9F A;  4YSX B;  1OQQ A;  3NVZ A;  4OW0 A;  1XXG A;  2E3T A;  1JAL A;  2R61 A;  4B0E A;  1L4Z B;  1SXT A;  3BII D;  2LGI A;  3P4S B;  1L0Y B;  1DGJ A;  1FXA A;  2G1E A;  1SIJ A;  4IOI E;  5HFY A;  4L1B A;  2KAC A;  4IKG A;  1RWS A;  3LYY A;  4YTP B;  2WDV B;  4KGS A;  5EE3 A;  2G9H D;  4WAF A;  2WXQ A;  3FIL A;  1PFD A;  1FCC C;  3I9V 1;  1J7C A;  3KWV A;  1I4H A;  4H2A A;  1TY0 A;  5BYS A;  1IBX A;  1NI3 A;  1N5W A;  1YJJ A;  3E56 A;  1I7H A;  1Q10 A;  2OHF A;  2WS3 B;  4JX1 C;  4L2Y A;  1L0V B;  1ET9 A;  5G5G A;  5EE9 A;  1SBB B;  3CIR B;  4N58 A;  1BML C;  2JYT A;  2MJD A;  2INP E;  1D5X C;  1FD6 A;  2NTT A;  2PW9 A;  1UGJ A;  3AE9 B;  2SEB D;  2SAK A;  1YNT E;  4DXF A;  1T6B X;  3LB8 C;  3NS1 A;  1VDV A;  1V1P A;  4KX6 B;  2QSD A;  1TKE A;  2QJL A;  5HG2 A;  1QLB B;  3TSS A;  2OED A;  4REZ A;  3P4Q B;  4R3D A;  3AE8 B;  4GDL B;  2V3P A;  1VRA B;  1N60 A;  2KN4 A;  4YSY B;  3AE1 B;  3VR9 B;  2EEL A;  3AEC B;  1XLQ A;  3ETR A;  3BZD B;  2BS4 B;  1FMA D;  1JWM D;  3AEE B;  4HRS A;  3TUO A;  3IT4 B;  1M4V A;  1XF5 L;  1QOB A;  1YJI A;  3SR6 A;  1QOA A;  4P16 A;  3NUH B;  1PYW D;  2ACZ B;  2RMM A;  2V0G A;  4O1N A;  2KDM A;  4YTN B;  1JQ4 A;  1JW9 D;  3NVY A;  3R2T A;  1NYQ A;  4RF0 A;  4RGO S;  5C2T B;  1XLO A;  3ZYY X;  2DYM A;  1EU4 A;  1TKG A;  1DOI A;  1SJE D;  3W5U B;  4ZOH C;  3PO0 A;  1L0X B;  1VZ8 A;  2Q5W D;  1ACC A;  4WWM A;  1C4A A;  1K50 A;  4OHJ A;  3RFZ B;  1FNU A;  2QIE B;  3EA6 A;  3AE5 B;  1WGK A;  2V4I B;  3Q69 A;  4USA A;  4C56 C;  2WLB A;  1JWS D;  1EWC A;  3LXF A;  4WUR A;  4OVZ A;  1KFY B;  3FC4 A;  2HDE A;  2J52 A;  5C3J B;  1TS2 A;  2Y5P A;  2BYT A;  1FM0 D;  1I4Q A;  2BS3 B;  4NZL B;  2ON8 A;  3OWE B;  1YQ3 B;  4LTU A;  1SEB D;  1MVK A;  3Q8C A;  3SEB A;  2W54 A;  2Y5C A;  2TSS A;  2K3U A;  2I2Y A;  2FUG 1;  3BWU D;  1QOF A;  5FR3 A;  1LO5 D;  2WDQ B;  3AE6 B;  2PKO A;  3W2D A;  1I4P A;  1A70 A;  1MPE A;  2W3R A;  3Q8E A;  4HRO A;  3AE2 B;  4RGM A;  3P42 A;  1N62 A;  1SE4 A;  5D3I B;  2WDR B;  3HRD D;  3NVV A;  3IAS 1;  2KQ4 X;  1UWM A;  5T8I A;  2LUM A;  1KLU D;  4XWT A;  3Q8A A;  1UNS A;  3HUI A;  1MHX A;  1SE3 A;  3AE7 B;  5D3D A;  5AUI A;  2PVO D;  1VLB A;  4ZYS A;  4RGT A;  5HI1 A;  1PDX A;  5JXV A;  5EE0 A;  1WSP A;  3RPF C;  1QIL A;  1IGD A;  1YN4 A;  1QF6 A;  4DQO C;  3GB1 A;  1TS3 A;  1L5P A;  1SSN A;  2QMT A;  4ZRP A;  1AW7 A;  2XN9 C;  1I4G A;  5AUK A;  5MPO A;  1JML A;  1YQ4 B;  4HJG E;  1DYQ A;  2CU3 A;  2MEK A;  2L83 A;  2N0S B;  2MJE A;  1FIQ A;  1TJE A;  4ZRQ A;  1XCQ L;  4JWS C;  1FXI A;  2CJN A;  2VZK D;  3MC0 B;  3W9C B;  4NJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...