1GB4A

Hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MTTFKLIINGKTLKGEITIEAVDAAEAEKIFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hyperthermophile
molecule keywords GB1-C3B4
publication title Design, structure and stability of a hyperthermophilic protein variant.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gb4A00
4MACA 1FCCC 1C9FA 5HHDG 1K52A 3FILA 1K51A 2N9KA 1MHXA 2EELA 1PGXA 2ON8A 1P7FA 2OEDA 1EM7A 1MVKA 2NMQA 1GB4A 4IOIE 3V3XA 1ZXHA 1FD6A 1XCTL 1F2RI 4HKZE 4KGTA 1D4BA 1PGAA 1MHHE 5BMHA 2PTLA 1F2RC 1YMHE 3FILB 2LGIA 1MPEA 2KQ4X 2I2YA 2J52A 2ONQA 1HZ5A 1UWXA 2IGGA 2ZW1A 1JMLA 2ZW0A 2QMTA 1K53A 4KGSA 5HFYA 1KH0A 3UI3A 1PGBA 4OZCA 2LHEA 2N7JA 2KDMA 2KWDA 2KN4A 2IGHA 1HZ6A 1FCLA 1IGDA 2JU6X 1IBXA 5BMGA 5BMIA 2JWUA 2JZPA 1XCQL 2PW9A 4D2KA 2J53A 4HJGE 2GB1A 4WH4A 1P7EA 1XF5L 1GB1A 1MI0A 5HG2A 2GI9A 4GLSC 4KGRA 1YNTE 2RMMA 2QSDA 2PLPA 2JXTA 2K0PA 2JSVX 1HEZE 1IBXB 2RPVA 1Q10A 2IGDA 1QKZA 2LUMA 1IGCA 1K50A 2N9LA 2I38A 4OZAA 4IKGA 4OZBA 5HI1A 2KACA 3MP9A 2LHDA 5JXVA 3GB1A
chains in the Genus database with same CATH superfamily
2O6VA 3PTFC 1TKGA 1WH3A 3FILA 3N1ZC 3AEDB 2GBKA 4CO7A 3X0WA 3I5JC 1E90A 1E8YA 1IUEA 3EECA 2NS5A 1AN8A 1L7YA 2A4ZA 3AECB 3ML9A 1MG4A 1F77A 4ARCA 3MTNB 1XCTL 3IT6B 1F2RI 1SE3A 2PTLA 1ACCA 4E3CA 4LLGM 5FKAC 3WCQA 2XK5B 1V5OA 2ZW1A 3QA8A 4FJZA 2MBEA 4BZAA 4KV2A 5HFYA 2PIAA 3UI3A 1E8WA 2DZMA 3ZXVA 1OQQA 1N5XA 1HZ6A 3TBLD 2R2QA 2EKEC 1QT9A 3W5VB 1DYQA 2WXHA 1AYFA 2KT7A 4XGAB 3W1YA 3AM9A 4NJ7A 3HK0A 2FCNA 3JYUA 3RNEC 4A8XC 3SD5A 2KVZA 2Y5CA 3VUWA 2L8JA 4DHJB 4K7UA 2QDFA 4BOZB 4ZRIA 1T0RC 4A6QA 3RPFC 1CMXB 1D5MC 3DWGC 2AQ1B 2WYQA 4OZBA 5C23A 2M19A 3AH7A 3DVNV 2FCQA 2PKOA 3EUB2 4CQNA 3A1QA 1L0XB 3KH0A 4B95A 4C00A 1KFYB 2TSSA 3RNFC 4B0EA 2Q5WD 5H8YE 2KKCA 1ESFA 5FR6A 1SJHD 4WURA 3U52E 3A9KA 2ACZB 3QC8B 4I6PA 5EE3A 2N1VA 4LJPB 4ASWC 2O2VB 1FNVA 3APFA 1GOZA 3K9PB 4NPNA 3L4PA 1MPEA 1GNUA 4MEMA 2NTTA 3OJ4B 1HZ5A 3WAOA 1JMLA 3ZNGC 5JH5C 4RH6A 3RUIB 4LK0M 3AE6B 1UELA 4TQ0A 3AMZA 2N4FA 2INPE 4JGHB 1OFFA 1F52A 2WDTB 1OEYJ 3C0RB 2BGFA 3HHMA 2CJOA 2KWVB 3ZTDA 1PDXA 4C7ZA 2AL6A 2J42A 2OJRA 3T3OA 2C9WB 3OJ3A 4I6NB 3PT2B 5KHOA 3TCAA 4HDOA 3PLVA 1TT5B 2L52A 4L2YA 3EC8A 4LNNA 1PFDA 3VDZA 2JRIB 3TMPB 2R61A 2BF8B 3ZNHB 5T8IA 5EDSA 1VRAB 2N1WA 3Q14C 2INCC 1SB3C 1S1QB 1IPGA 1Q10A 1WF9A 2NBUA 1V1OA 3E56A 2VH1A 3DBSA 4FA6A 2H89B 3CSTA 2L0FA 4ZDVA 1SSNA 2J4XA 1B1ZA 1JWSD 2PVOD 2LHDA 3IVFA 1V9JA 3HM6X 2IY0B 4LNOA 3PRPB 1C9FA 1SF0A 4CHKA 1MJDA 1WRDB 2M17A 3V6CB 1VR9A 2N9EB 3UGBB 4IWPA 2WXQA 1ET6A 2W3SA 3W1SA 3Q3MC 4K7WA 2BWES 2WLBA 1D4BA 4YT0B 1BMLC 3OLMD 1STEA 4WWMA 1CJEA 4A3PA 4NAMA 4B9KA 1SBBB 1F9JA 4ZRQA 3FKYA 2DAFA 3BYYB 4ACFA 5CTRC 1OTRB 1WMHB 2XN9C 1V5TA 4RCOA 4KGSA 3LJ3A 4HXDA 3U7DA 4MM3B 4G11A 4N58A 3ZRCA 1QOFA 1YOVB 5G5HA 3SEBA 3LYYA 1EWYC 2NBWB 4YTPB 4ZOHC 3OWEB 4JX1C 5D94A 3TIXA 4MSQB 2NCNA 2GRIA 3ZNZB 2BKRB 1XF5L 3HRDD 3A9JA 1PUTA 1P0RA 1V2YA 1WR1A 2PEAA 1MG8A 4JWSC 5D3IB 4AUQC 2JZZA 2L0TA 4BBNC 2J0MA 2BS3B 2WU2B 1J8CA 2R2OA 1RYJA 1CK1A 1UNSA 2KO3A 1P98A 1KRHA 4YSZB 3KWVA 1E7UA 2M0AA 2RD0A 1LO5D 4EEWA 1RFKA 3MJ5A 4LDTD 3VRAB 2MJ3A 3DOWA 3ZKJC 3BK1A 3AU4A 3C8YA 3IG3A 1K51A 1P7FA 2L32A 1TGZB 3VVWB 5I4DA 2KFKB 1ZP0B 2WWZA 2I1JA 2MBBB 1TS2A 3JSVA 5JHBA 2IJ0A 3GE8C 4A90A 3X23A 4ZRKA 1J7CA 1GC7A 2BYVE 1ET9A 2Y5BB 3QAQA 2I2YA 2I1KA 2IO3B 3R3MA 4WJPA 3N9YC 1YQ4B 1Z5SB 3AE2B 4EZLA 5L95C 4DHZE 3J9CA 3DVNU 4JL9A 2MQJA 2RR9A 1L5PA 2KX3A 2KDMA 3MJWA 3VRBB 2IGHA 1WE7A 1ZUD2 2KFJA 1OEYA 1NI3A 2DZKA 3VUYA 2K5PA 4MJSA 3CSFA 3KYDD 2MW5A 3ZJTA 2V3SA 4MELA 2JYTA 4K7SA 1HE8A 4ANUA 3S2AA 1TY2A 3NS1A 4WWPA 3D32A 2IBIB 4DWFA 1TS5A 2QSDA 3L13A 1SIJA 1C79A 2BW2A 2ZVNA 1QKZA 2RDHA 3ZO5B 4KZ0A 4HROA 1AARA 4NJ6A 4L23A 4G3XB 2X38A 3RFZB 3BZDB 3AEEB 1P1AA 3SR6A 2D5GA 3WALA 1L2NA 4P16A 2BB6A 1HXYD 3RNBC 4MDKE 3L54A 5AZGA 5IA7A 4W9IA 2DX5B 1QILA 3IAS1 1YJIA 1YX5B 1ZDXA 2O6VD 3N1XC 1FXIA 1B9RA 4HVBA 3R7RA 3AE9B 3LXFA 1L0VB 4OVZA 1TS3A 2KX0A 2L83A 1FD6A 3P2BA 1XLPA 2KMCA 1JWUD 3LB8C 3P1MA 4M0WA 4EE2A 1V1PA 4PK1A 3P63A 3BVZA 1WJ6A 3FC4A 3HIZA 3SFDB 2B76B 2V0GA 4HJKA 2IZVB 1DOIA 4O1NA 1P9DU 2ZW0A 4EKUA 2V3PA 2N7EA 1SE4A 5AEKB 1PGBA 3PO0A 2L7RA 1WGYA 2INNE 2AQ3B 1AW7A 4NJCA 3C19A 1RM6C 2BWFA 1TKEA 3H9DA 4W9DA 5BMIA 4E74A 2JWUA 2JZPA 3RMKC 2QIEB 3VH4B 1WWTA 1EU3A 3A33B 1SE9A 3P4SB 4BVUC 1BXTA 2M8SA 2WXJA 4N9F4 3SU8X 2IYDB 3UQAA 2GMIC 1NI2A 3QWZB 3WANA 4II2B 2VZKD 2OHFA 1XD3B 1UGJA 2LGYA 4HCNB 1I4RA 2XNAC 3P4QB 2C60A 1SXTA 2AL3A 3ML8A 2DLBA 2AQ2B 4B0MA 4KDIC 1KTKA 1HTQA 5JXVA 3A1QB 3NZ3A 1NYQA 3AEFB 2K1FA 2MH7A 3NJTA 3AU5A 1XLOA 1RAXA 3A9KB 4AOFA 2DZIA 2JYEA 1X1MA 3V60A 4YXDB 3AB5A 3RN9C 2MJEA 4ZHPA 4PS3A 4G50A 1JCKB 2EMSA 5D2MB 1FMAD 1PGAA 2QEJC 5BMHA 3QX1A 2N7DA 3ETRA 1HQRD 2KZRA 1WYGA 1WX9A 4YSXB 3KUDB 1WR6E 4W9FA 4TQ1A 4UDUC 5CHWA 5IOIA 4FADA 4YTNB 2C7MB 3R66C 2MBOA 2V3NA 2W55A 2JU6X 3NZSA 3VAWA 1IBXA 1P3QU 1J0GA 2PW9A 4LNIA 1T0SC 2UWQA 2L1AA 2D3GA 3SDLC 4C4VB 4ITKA 4S0RA 4KGRA 5JHAA 2YLMA 4OVUA 1SJED 4G0NB 4ARIA 1WXQA 2LXAA 1RFAA 4GGQA 2L05A 1EF5A 1JWMD 1RLFA 1E8XA 3PGEA 4XC2A 1WXMA 1FNWA 1GAQB 2E3TA 4KSKC 2KC1A 1N62A 3K9OB 2ZZPB 2N9PC 4TSSA 2PE6B 3CWIA 4HDQA 1I7HA 3ZIMA 2FNJB 5LXHA 3AE4B 4IC7B 1FNUA 1PGXA 4K1RB 4F8CB 1T3QA 4MGYE 1EM7A 2LVOA 4I6LB 1F1HA 2ICIA 1WRIA 3ONSA 1TBEA 3PSEB 1U4AA 3NY5A 3QK0A 4TMAB 1F2RC 2DAJA 1YMHE 2K6DB 1JW9D 2A5UA 3VXWA 1N61A 1NEKB 4W9EA 1VZ6A 1WJUA 4WWOA 3PRMB 4RGNA 4WAFA 3ZRFA 5DCNA 2LXCA 2KWCA 4PYUA 5BO4B 2IDYA 2HJ8A 3ZTCA 4JQWC 4FBJB 1WM3A 2WXGA 3WA0A 4BFRA 2NPTA 2CHZA 3EGRA 2LGSA 4A55A 3L17A 3H6NA 1C4PA 2LVPA 2BQQA 3I9V1 1IP9A 3DHHC 3ZNID 3HVZA 4LNFA 2QC8A 3W2DA 3A9JB 1YJ1A 2Z59B 3V62A 2M56B 2CU3A 3H7PB 2G1EA 3Q3OC 2KC2A 1XLNA 2RMMA 1V86A 4WQMA 3L0WB 4GDLB 4AP4C 2K9XA 1YN5A 1GC6A 2LUMA 5TR5A 4N6EB 2UU7A 3KUZA 4GDKB 2BPSA 5DPWA 3H1UA 1FIQA 1LXDA 4IW0A 4OZAA 3APDA 1GJZA 3PZDA 4URKA 4J6IA 1KF6B 3RZFA 2CU1A 4BOSC 4S17A 1VZ7A 1WJ4A 3I3TB 2FUG1 2OJWA 3MP9A 5C1ZA 3PZ7A 3LDZE 1QOGA 3R8BA 1H4RA 1JWBD 4MH0E 1NBFC 4GMVA 1WGDA 5IO9A 2X8XX 1SE2A 1Q5WB 2EELA 4IM0A 1N63A 1WI0A 4IM3A 4KIKB 4DBGA 2JQRB 3DWMA 3ECIA 1R7SA 2LJIA 3P4RB 3NVWA 1M4VA 5IP4D 5E6JA 2WDVB 2GBNA 2QHOA 4ZHOA 1L6UA 2M0XA 3N3KB 3DPDA 2DYOA 5E6PA 1LGRA 1UWXA 4W9HA 2VRRB 2JY6A 3VQIA 3DBRB 5AZHA 2V1YA 5D3DA 4XX5A 4PYZA 4F1SA 4OZCA 1EO6A 2IO1B 2LHEA 4FN2A 1D3ZA 1UBQA 2DBYA 4PS7A 2GLSA 1IYFA 3GZNB 1SIFA 3AE1B 4OW0A 2G4DB 4REZA 1FXAA 4RF1A 4D2KA 3HM3A 3RZWC 1QZEA 2Z0DB 4MSMB 1GB1A 4K81A 4KSLC 4RF0A 1DGJA 4KDLB 2G45B 3SHQA 2N0SB 3WAPA 2K8CA 1FRDA 1YNTE 3TEYA 3B1LX 4A3OA 3B0AA 5DPRA 1N60A 2JWZA 3PHWB 3VUXA 2IO0B 2GBJA 2FBWB 2RSUA 2JRHA 3N20C 5D6JB 1CQVA 2LJ5A 3U4EG 2D3AA 4IDIA 5BYRA 4BKSD 2ZCBA 1KOTA 3NHEB 4MGKE 3I57A 2M1MA 5JZEB 3O65B 3ZJUA 4GOCA 1PYWD 2BTEA 3ZYYX 5G5GA 4JPSA 4ANXA 4LNKA 4EFOA 2WGSA 2LRUA 2ON8A 2XEWA 1EF1A 4YSYB 3AN1A 3T9LA 1GB4A 4LDTB 5EE0A 1FFVA 4ANWA 2AYOB 2KDBA 1KJTA 1V1PB 3HUIA 2KN5A 4NAWB 4DK5A 2KTRA 5LXIB 2IO2B 1UZXB 2BYEA 3B9JA 3L08A 2J7QB 3TEZA 5AZFA 2IGGA 3B2GA 2SEBD 5E6OA 2KJRA 1XEEA 4HLEA 1ZPSA 1A70A 4NY0A 3AEGB 2J0JA 5E6NA 5H92C 5AUKA 1WX7A 1FCLA 3AE5B 2LI5A 3AI5A 4GSWA 1LQBA 1TS4A 4WJNA 1XQQA 2M4NA 3EA6A 2LMCA 1P7EA 2W82A 3DBRI 2WDRB 5BYSA 1Y8RC 2MP2B 3Q69A 1AWDA 5BYQA 2K6QA 1ZXIA 3V6EB 4RGOS 1V81A 1HEZE 2WX0A 2K22A 1KM7A 1RRBA 2D11A 2IGDA 3QQ8B 3L10B 5FR3A 2Z0EB 3MC0B 3KQ4A 4NNJB 2DWQA 3DVGX 3GZNI 2N9LA 3RT3B 2PJHA 2I38A 2WXRA 2RDGA 1L6VA 2MRPA 2KYWA 1YX6B 3Q8BA 3ZUNA 4HCPB 3ZDTA 4XWWA 5KHQA 2JPHA 2Z8LA 3IHPC 2W9NA 2LGIA 3RCZA 1FCCC 2CJNA 2SAKA 5HHDG 5C3JB 2K8HA 1R4NI 4IM2A 2MA9B 2WXNA 3DBLB 4BKSA 2RDBC 2WQYB 4M01A 1MVKA 2C5LC 4IOIE 3V3XA 1RWSA 3TSSA 3GE3C 3HVDA 4FXCA 2FIFA 3R7QA 2XBBC 4WJQA 4MM3A 2G4SA 3Q3FA 2O6VB 4KX6B 3FILB 4HKQA 3KYCD 2MCNB 4J3OD 4GU2A 1UD7A 2DNFA 3N1YC 4W9KA 4EUTA 2NBVB 3Q3JA 3SFEB 2WP9B 3DQVA 4C7YA 2L76A 1K53A 3VTWA 4EZKA 3BWUD 3DVGY 2WXPA 3QHTA 2DENB 1BT0A 1Q0WB 1WZ0A 4HWIB 4RMAA 3Q8AA 2Y3AA 1FFUA 3W9CB 2KVRA 3T3NA 2FUHB 4XDDA 1Z2MA 4EZJA 3DHGC 4TUUA 2KOXA 2J0KA 3DBHB 2KNBA 3PS6A 5CX3A 1XCQL 2QJLA 3PV1A 1L4DB 1LFDA 4WH4A 4HPMB 1ZGUB 2YVCA 2Y5PA 4GLSC 1XLQA 1WY8A 3T8MA 2JF5A 4DQOC 1C4AA 2AWTA 2BYFA 3QARA 2PLPA 1KLVA 2D3CA 1Y56A 3CIRB 1D5XC 3AE7B 4ZYSA 3N30A 4KKJA 1E6EB 4JIOU 2KHWB 3UF8A 4NZLB 2KLCA 3GOEA 4AWJA 5G55A 3KVFB 1D5ZC 1FEHA 3U8ZA 4F7ZA 2VZKB 1D6EC 2GOWA 4H2AA 3BYTB 4RNAA 1I4PA 1K52A 2QILA 2D10A 2WXOA 3ZQ4A 2V9HA 1UWMA 4FHJA 2UYZB 2KDIA 2EKIA 3DHIC 1MHHE 1TY0A 2FCSA 1ZKHA 1ZW7A 3IAM1 4W9JA 1ZOYB 1EUVB 4FULA 3GP7A 3WIMA 3Q8EA 2WXLA 2MJDA 1QOBA 1ENFA 2LASA 2C7HA 3DBLI 2ZPYA 5HKHA 5FK9C 2CHWA 3U7ZA 4YTMB 2WHIA 2PVGC 2QCZA 2CR5A 2FAZA 1VD2A 2LZ6A 5CHVC 1NYRA 4HPPA 2PE9A 3ZVVA 2AX5A 4HK2A 4HJGE 2FCMA 3BY4B 2NTSA 4DXAB 1YD8U 4WQOB 4PS8A 4W9GA 4P1CC 2GBRA 3R2IA 4M00A 4W9LA 1FO4A 4MH8A 1T0QC 1I4XA 5EE1A 1JROA 1JRPA 3ZDMC 1IGCA 1DOXA 4C80A 3DBHI 3AE3B 3M62B 1YJJA 2BB5A 2JXXA 4R3DA 1QF6A 1ISNA 1VJKA 1WXSA 3UIOB 4X57B 2HTHA 3Q8FA 1HA5A 1GG3A 2L3ZA 3AULA 3JW0X 1J19A 3UINB 4GXBA 2IY1B 1OQYA 4WIPA 1PQSA 3RNGC 1T6BX 1C4CA 3OAWA 2OEDA 5LNK1 3NVZA 1J7AA 4AJWA 1YIWA 2JT4B 1ZXHA 3Q6BA 3A4SC 2H88B 3Q8CA 3B2FA 4XE0A 2BT6A 2J52A 2WXIA 3NVVA 3O13A 1FM0D 4DDID 1Q1OA 1JQ4A 2BKFA 2LGDA 3W5UB 2QMTA 1WXAA 4DHZB 2JUOA 4P1BC 1I4HA 3OG5A 2LD9A 2L00B 1JRUA 4MGZE 2E6XA 5J2RA 2ZNVB 3VHTC 3TEXA 4DHJD 4XDCA 2KD0A 1R4MB 2KMMA 5D7GA 2VH2A 4ICVA 4BKGA 1WGHA 2REXA 1WJNA 1K8RB 3Q3NC 4JLCA 2KJHB 2B3AA 1ZDVA 2YEPF 5C2TB 3VFKA 1EWCA 4HRSA 5IAAC 3MHSD 1WGKA 1ROEA 2RPQA 4JWUC 4YL8A 1CZPA 1WX8A 1YN3A 1L4ZB 4C56C 1FRRA 2HDEA 4IUMB 1V97A 1MHXA 3I63C 2LRWA 1V49A 1WZ3A 4W9CA 2KQSA 1E7PB 4ZRJA 3V05A 2HJ1A 4A9AA 4Q2JA 2G9HD 1VDVA 4IWOA 4HKZE 2PMVA 1KLUD 2KTRB 1XXGA 2WS3B 5CHFA 4ZRPA 2ZCCA 4E71A 2K39A 1WSPA 4GIVA 1NENB 3M3JA 3ENEA 4GN1A 2KDFB 2XK5A 3PHXB 5G2NA 3M63B 3KWLA 3JSVB 2KAJA 3WAMA 4C4VA 3IXSA 1C3TA 3BVGA 3NG0A 1YN4A 2KWDA 2LVQA 2KN4A 5J17A 4RGMA 2MBQA 3URYA 2D2QA 1E0ZA 2INDC 4ANVA 4BKTA 2KQ7A 4DXGA 2KTFA 3CF6E 5MPOA 3MFGA 3RD2A 5HG2A 1OGWA 1T5XD 3IBEA 2AEHA 1MFWA 4MJSB 3JVZX 3R2TA 5L83A 1WE6A 2WU5B 2BBCA 2WDQB 2HD5B 1R4MI 2CS4A 1YQ3B 4YWGG 4US8A 3B08A 3UIPB 2JX5A 1UF0A 1V80A 4IKGA 1I42A 2PPHA 2WXKA 3P42A 2WXMA 3DDCB 3ALBA 2DHZA 4LTUA 4LCDE 3TJPA 4OHJA 3ZXRA 2N9XA 3NS8A 3ZGZA 1R4NB 1V8CA 4FLHA 1VCBA 3EFCA 4USAA 2EMTA 4CYEA 2O2VA 5J18A 3RNCC 1XT9B 4RFBA 1GUAB 1WIAA 4IG7B 4BBNF 3KUCB 4B6WA 2ONQA 1S3SG 4FJYA 1F0ZA 4ZYNA 1LM8B 1OQRA 1UUPA 3U2SC 4QAYA 4TV3A 1M94A 3ABVB 4M0WB 3H7PA 3RULA 3W1SC 4AQ7A 3DCGA 3M95A 4RGTA 2W3RA 4GDLA 3FAHA 2W54A 1SGHA 2ZJDA 3CMMB 1NVID 4KVGB 1UGMA 1HTOA 2ZNVC 2J53A 3L16A 4GDKA 4IWQA 2ZEQA 1T0YA 1MI0A 5AUIA 3MC9A 1WYWB 1C77A 1I35A 2WNMA 3Q2AC 3BIID 3IFWB 2C7NB 3AE8B 1WFYA 2JXTA 1FXTB 2HE7A 4AJYB 1H8CA 1TIFA 3ZW3A 1TZ1A 2RPVA 3V61A 4XWTA 4M02A 1N5WA 1WGRA 3AEAB 4US9A 1K50A 3PREA 2LEKA 2ZVOA 4OVVA 4KIKA 3ZLZA 3AV8A 5IKCM 2GBMA 4WWNA 1TJEA 3AXCA 2D07B 3IT4B 5HI1A 2KACA 1QOAA 2G3QB 2MX2A 3H7SA 2ZPNA 2KK8A 3KW5B 4MACA 4RM9A 4MT5A 3RI7C 1TZOA 2LWPA 1QQRA 5EE9A 4A20A 1YQBA 2JZ3B 4RM8A 2D3BA 2MHJA 1ZE3D 3GS2A 4FJVB 2FE8A 3MHZA 4TKNA 2DYMA 1G6JA 1VZ8A 3NUHB 2IPKD 3A4RA 1VLBA 2KMAA 1E5WA 1WM2A 1BUIC 4P7IA 1WMHA 1KH0A 4EOYA 3EHVA 1I4GA 4P6VF 3NVYA 3U30A 2N7JA 2HTME 3PLUA 1IGDA 2WXFA 4AS1A 2JVCA 1XO3A 1E9MA 2BVCA 4MGIE 4L1BA 4LJOB 1EU4A 2GB1A 3PRZA 3NZUA 1E7VA 4PT5A 2MWSB 2GI9A 3QIJA 1UH6A 4HEA1 2ASQA 1NDDA 2V4LA 1TTNA 1WGGA 3MC8A 1V6EA 4II3B 2KDEB 3EFUA 2FIDA 1A5RA 2K0PA 4M8MA 1L0YB 2JSVX 1IBXB 4JE3B 3VTVA 4WJOA 3TL5A 2KANA 4BAXA 3E9SA 2V4IB 3N32A 3ZJVA 1E8ZA 1UBIA 3RNAC 4NAWA 2K25A 1KLGD 3AEBB 3QCAA 2N9KA 3APCA 2KLGA 2YEPB 2BS4B 2NMQA 2KXJA 2KWUB 4NQKE 4DXFA 5GMVA 4KZCA 2CHXA 2KFKA 5GXGB 5LLIA 2MEKA 2LUEA 3BVMA 4KGTA 4NQLB 2BYTA 5DPSA 2MBHA 4ICUA 3QJZA 2NVUI 3PVLA 1GPXA 2KQ4X 1WXVA 4FHKA 5IN7A 1C76A 4XYCA 3TEWA 3RYTA 3BINA 3VR9B 2NR2A 2K3UA 2BS2B 3VTUA 3VH3B 1QLBB 1TYGB 4WAAA 5DPTA 2K8BA 4HPLB 3KLSX 2MP2A 3PZ8A 3BK2A 4N59A 5TSSA 1C78A 4DDGD 1E10A 1FPYA 5BMGA 2MLBA 1I4QA 3P4PB 2RGFA 1J7BA 2DYBA 1JALA 1SEBD 1DOYA 2NPTB 2LFIA 3NRZA 3VR8B 4K3BA 3NOBA 4M8NA 2LGXA 4GB9A 4K3CA 2OOBB 2WX1A 2CKHB 2MSED 4XZ4A 2DZJA 1C1YB 1JWAD 1TKYA 3UQBA 3H8HA 3TUOA 2KJ6A 3PPAA 4KKIA 3GB1A 1N6ZA
chains in the Genus database with same CATH topology
1TKGA 1QILA 3IAS1 1V97A 3FILA 3ZYYX 3AEDB 1YJIA 5G5GA 1ZDXA 1MHXA 4JPSA 1FXIA 1B9RA 2ON8A 1IUEA 1AN8A 3AE9B 4YSYB 3LXFA 1E7PB 3AECB 3V05A 4A9AA 1L0VB 3AN1A 4OVZA 4Q2JA 1GB4A 1TS3A 2G9HD 2L83A 1VDVA 1F77A 5EE0A 1FFVA 4ARCA 1FD6A 1XCTL 3IT6B 1F2RI 1SE3A 1XLPA 4HKZE 2PMVA 1KLUD 1V1PB 1JWUD 3LB8C 3HUIA 1XXGA 2PTLA 2WS3B 3P1MA 4M0WA 1ACCA 4NAWB 4ZRPA 4EE2A 1V1PA 3P63A 3BVZA 4LLGM 5FKAC 3FC4A 1WSPA 3B9JA 3SFDB 2B76B 2V0GA 1NENB 3TEZA 3WCQA 1DOIA 2IGGA 4O1NA 2ZW1A 2ZW0A 3B2GA 2SEBD 2V3PA 5HFYA 2PIAA 3UI3A 3KWLA 1SE4A 2KAJA 1PGBA 3PO0A 1XEEA 1ZPSA 1A70A 3IXSA 2INNE 3BVGA 2AQ3B 3AEGB 1AW7A 1YN4A 4NJCA 1OQQA 2KWDA 5H92C 1N5XA 2KN4A 5AUKA 1RM6C 1HZ6A 1TKEA 1FCLA 3AE5B 4RGMA 3URYA 1QT9A 3W5VB 1E0ZA 1DYQA 1TS4A 5BMIA 2WXHA 2JWUA 2JZPA 1AYFA 4DXGA 2QIEB 1WWTA 3EA6A 3AM9A 1EU3A 5MPOA 3MFGA 3P4SB 2LMCA 1P7EA 2W82A 5HG2A 1BXTA 2WDRB 5BYSA 1T5XD 2WXJA 4A8XC 2Y5CA 3Q69A 1AWDA 5BYQA 1ZXIA 4RGOS 2VZKD 1HEZE 2K22A 2IGDA 3R2TA 5FR3A 2OHFA 4A6QA 1UGJA 3MC0B 2WU5B 2BBCA 3RPFC 3KQ4A 2WDQB 2DWQA 1I4RA 2N9LA 2XNAC 3P4QB 2I38A 1YQ3B 1SXTA 4YWGG 1D5MC 2WXRA 2AQ1B 3DWGC 2RDGA 1L6VA 4US8A 2JX5A 4IKGA 2WXKA 3P42A 2WXMA 4OZBA 2DLBA 2AQ2B 3Q8BA 2M19A 3AH7A 4B0MA 1KTKA 4XWWA 4LTUA 5JXVA 2PKOA 2Z8LA 3EUB2 3NZ3A 1NYQA 4CQNA 2LGIA 4OHJA 1FCCC 3AEFB 2CJNA 2SAKA 5HHDG 1L0XB 1KFYB 2TSSA 2MH7A 3ZGZA 1XLOA 4B0EA 5C3JB 2Q5WD 5H8YE 1ESFA 2WXNA 2JYEA 1SJHD 4WURA 3U52E 4YXDB 2WQYB 2ACZB 1MVKA 3AB5A 5EE3A 1V8CA 2MJEA 4IOIE 3V3XA 4ZHPA 1RWSA 3TSSA 3HVDA 4FXCA 1JCKB 4USAA 1FMAD 1FNVA 1PGAA 2QEJC 1GOZA 5BMHA 4KX6B 3L4PA 4RFBA 3FILB 4HKQA 1MPEA 3ETRA 1HQRD 4J3OD 2NTTA 2ONQA 1HZ5A 3SFEB 1WYGA 1F0ZA 2WP9B 1JMLA 4C7YA 1OQRA 1UUPA 3U2SC 4YSXB 1K53A 3BWUD 4TQ1A 2WXPA 4RH6A 4UDUC 4LK0M 3ABVB 3Q8AA 3AE6B 2Y3AA 4YTNB 1FFUA 3W9CB 4TQ0A 3T3NA 3AMZA 4XDDA 4AQ7A 2INPE 2V3NA 2W55A 4RGTA 2W3RA 1OFFA 3FAHA 2JU6X 2W54A 1IBXA 1NVID 1XCQL 2PW9A 2QJLA 1L4DB 2CJOA 2J53A 1PDXA 4C7ZA 4WH4A 5AUIA 1MI0A 2J42A 2L1AA 3T3OA 2Y5PA 1C77A 4GLSC 1XLQA 2L52A 2WNMA 3BIID 4L2YA 4ITKA 1PFDA 4KGRA 3AE8B 4DQOC 1C4AA 2R61A 1SJED 2PLPA 1Y56A 2JXTA 3CIRB 4ARIA 5T8IA 1D5XC 1VRAB 3AE7B 1SB3C 2RPVA 1WXQA 1Q10A 4XWTA 4ZYSA 1V1OA 3E56A 1JWMD 1N5WA 4KKJA 1E6EB 3AEAB 4US9A 4NZLB 1K50A 2H89B 2LEKA 3AV8A 1FNWA 1D5ZC 1GAQB 1FEHA 1SSNA 2E3TA 1TJEA 2J4XA 1B1ZA 1JWSD 3IT4B 5HI1A 1N62A 2VZKB 2KACA 1QOAA 2PVOD 1D6EC 2LHDA 4H2AA 4TSSA 3BYTB 4RNAA 1I4PA 4MACA 3CWIA 1C9FA 1I7HA 4MT5A 1K52A 1TZOA 1SF0A 3AE4B 2QILA 1FNUA 1PGXA 1QQRA 2WXOA 5EE9A 3ZQ4A 1T3QA 1VR9A 1UWMA 1EM7A 2WXQA 1ET6A 2W3SA 2ICIA 1WRIA 3W1SA 1ZE3D 2EKIA 3GS2A 2WLBA 2FE8A 1D4BA 3MHZA 1MHHE 1TY0A 4YT0B 2DYMA 1BMLC 4TMAB 1F2RC 1STEA 1PYWD 1VZ8A 1YMHE 4WWMA 3NUHB 1CJEA 2IPKD 3IAM1 4NAMA 1JW9D 1VLBA 1N61A 1ZOYB 1SBBB 1NEKB 4ZRQA 3GP7A 1VZ6A 3BYYB 1BUIC 3Q8EA 2WXLA 2XN9C 2MJDA 4RGNA 4WAFA 1QOBA 4RCOA 1ENFA 4KGSA 1KH0A 5FK9C 3U7ZA 1I4GA 4MM3B 2IDYA 4P6VF 4YTMB 3NVYA 4N58A 1QOFA 2WXGA 2N7JA 2PVGC 2HTME 5G5HA 3SEBA 3LYYA 1NYRA 3EGRA 4A55A 1EWYC 1IGDA 1C4PA 2WXFA 4AS1A 4YTPB 4ZOHC 2AX5A 1XO3A 3I9V1 1E9MA 3OWEB 4JX1C 4L1BA 3HVZA 1EU4A 4HJGE 2GB1A 3W2DA 2GRIA 2NTSA 1XF5L 3HRDD 4PT5A 2GI9A 2CU3A 2M56B 1PUTA 2G1EA 4HEA1 3R2IA 1FO4A 1XLNA 2RMMA 4WQMA 4MH8A 1I4XA 4JWSC 5EE1A 4GDLB 2K0PA 1JROA 1L0YB 2JSVX 2K9XA 1JRPA 5D3IB 1IBXB 1YN5A 2BS3B 2WU2B 4JE3B 2LUMA 4N6EB 1IGCA 1RYJA 1CK1A 1UNSA 4GDKB 4C80A 1DOXA 1KRHA 4YSZB 3AE3B 3KWVA 1FIQA 4OZAA 1YJJA 2BB5A 2M0AA 4R3DA 1QF6A 1VJKA 1KF6B 1LO5D 3E9SA 1RFKA 3MJ5A 3Q8FA 2V4IB 1HA5A 1VZ7A 2FUG1 3VRAB 2MJ3A 3MP9A 3PZ7A 3ZJVA 1QOGA 3R8BA 3BK1A 1JWBD 3AEBB 1KLGD 4WIPA 3C8YA 1K51A 2N9KA 1T6BX 1SE2A 2EELA 2YEPB 1N63A 1P7FA 2L32A 1C4CA 2BS4B 2OEDA 2NMQA 5LNK1 3NVZA 1J7AA 5I4DA 2JQRB 1ZP0B 3DWMA 4DXFA 1R7SA 1ZXHA 2LJIA 3P4RB 3NVWA 1TS2A 1M4VA 5GXGB 2IJ0A 2MEKA 5E6JA 3BVMA 4KGTA 2BYTA 4A90A 2WDVB 2H88B 3Q8CA 1J7CA 3B2FA 4ZHOA 1GPXA 4XE0A 1L6UA 1ET9A 2KQ4X 2I2YA 2BT6A 2J52A 2WXIA 3NVVA 1C76A 2DYOA 3TEWA 3O13A 1FM0D 3VR9B 1JQ4A 1UWXA 3N9YC 1YQ4B 2K3UA 3W5UB 2QMTA 3VQIA 3AE2B 2BS2B 5D3DA 1QLBB 1TYGB 1I4HA 3J9CA 4OZCA 2LHEA 1L5PA 3KLSX 2KDMA 3VRBB 2IGHA 1ZUD2 3PZ8A 3BK2A 2E6XA 2DBYA 4N59A 5TSSA 1C78A 1NI3A 1E10A 3TEXA 4XDCA 2K5PA 3AE1B 4OW0A 4REZA 2KMMA 5D7GA 5BMGA 1FXAA 4RF1A 1I4QA 4D2KA 3ZJTA 2JYTA 3P4PB 1GB1A 1TY2A 1J7BA 1DGJA 4RF0A 1JALA 3NS1A 1SEBD 2N0SB 1ZDVA 2YEPF 1DOYA 1FRDA 1YNTE 2LFIA 5C2TB 3TEYA 1TS5A 2QSDA 3NRZA 1N60A 1SIJA 1EWCA 3VR8B 1C79A 2BW2A 4HRSA 2FBWB 1QKZA 2RDHA 1CQVA 1WGKA 4HROA 3U4EG 1ROEA 4IDIA 4L23A 2X38A 5BYRA 3RFZB 1JWAD 3BZDB 1TKYA 3AEEB 4JWUC 3SR6A 3H8HA 2D5GA 1CZPA 4P16A 2BB6A 3I57A 1HXYD 3ZJUA 1YN3A 3TUOA 1L4ZB 4C56C 1FRRA 4KKIA 3GB1A 2HDEA 2BTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAC A;  1FCC C;  1C9F A;  5HHD G;  1K52 A;  3FIL A;  1K51 A;  2N9K A;  1MHX A;  2EEL A;  1PGX A;  2ON8 A;  1P7F A;  2OED A;  1EM7 A;  1MVK A;  2NMQ A;  1GB4 A;  4IOI E;  3V3X A;  1ZXH A;  1FD6 A;  1XCT L;  1F2R I;  4HKZ E;  4KGT A;  1D4B A;  1PGA A;  1MHH E;  5BMH A;  2PTL A;  1F2R C;  1YMH E;  3FIL B;  2LGI A;  1MPE A;  2KQ4 X;  2I2Y A;  2J52 A;  2ONQ A;  1HZ5 A;  1UWX A;  2IGG A;  2ZW1 A;  1JML A;  2ZW0 A;  2QMT A;  1K53 A;  4KGS A;  5HFY A;  1KH0 A;  3UI3 A;  1PGB A;  4OZC A;  2LHE A;  2N7J A;  2KDM A;  2KWD A;  2KN4 A;  2IGH A;  1HZ6 A;  1FCL A;  1IGD A;  2JU6 X;  1IBX A;  5BMG A;  5BMI A;  2JWU A;  2JZP A;  1XCQ L;  2PW9 A;  4D2K A;  2J53 A;  4HJG E;  2GB1 A;  4WH4 A;  1P7E A;  1XF5 L;  1GB1 A;  1MI0 A;  5HG2 A;  2GI9 A;  4GLS C;  4KGR A;  1YNT E;  2RMM A;  2QSD A;  2PLP A;  2JXT A;  2K0P A;  2JSV X;  1HEZ E;  1IBX B;  2RPV A;  1Q10 A;  2IGD A;  1QKZ A;  2LUM A;  1IGC A;  1K50 A;  2N9L A;  2I38 A;  4OZA A;  4IKG A;  4OZB A;  5HI1 A;  2KAC A;  3MP9 A;  2LHD A;  5JXV A;  3GB1 A; 
#chains in the Genus database with same CATH topology
 2O6V A;  3PTF C;  1TKG A;  1WH3 A;  3FIL A;  3N1Z C;  3AED B;  2GBK A;  4CO7 A;  3X0W A;  3I5J C;  1E90 A;  1E8Y A;  1IUE A;  3EEC A;  2NS5 A;  1AN8 A;  1L7Y A;  2A4Z A;  3AEC B;  3ML9 A;  1MG4 A;  1F77 A;  4ARC A;  3MTN B;  1XCT L;  3IT6 B;  1F2R I;  1SE3 A;  2PTL A;  1ACC A;  4E3C A;  4LLG M;  5FKA C;  3WCQ A;  2XK5 B;  1V5O A;  2ZW1 A;  3QA8 A;  4FJZ A;  2MBE A;  4BZA A;  4KV2 A;  5HFY A;  2PIA A;  3UI3 A;  1E8W A;  2DZM A;  3ZXV A;  1OQQ A;  1N5X A;  1HZ6 A;  3TBL D;  2R2Q A;  2EKE C;  1QT9 A;  3W5V B;  1DYQ A;  2WXH A;  1AYF A;  2KT7 A;  4XGA B;  3W1Y A;  3AM9 A;  4NJ7 A;  3HK0 A;  2FCN A;  3JYU A;  3RNE C;  4A8X C;  3SD5 A;  2KVZ A;  2Y5C A;  3VUW A;  2L8J A;  4DHJ B;  4K7U A;  2QDF A;  4BOZ B;  4ZRI A;  1T0R C;  4A6Q A;  3RPF C;  1CMX B;  1D5M C;  3DWG C;  2AQ1 B;  2WYQ A;  4OZB A;  5C23 A;  2M19 A;  3AH7 A;  3DVN V;  2FCQ A;  2PKO A;  3EUB 2;  4CQN A;  3A1Q A;  1L0X B;  3KH0 A;  4B95 A;  4C00 A;  1KFY B;  2TSS A;  3RNF C;  4B0E A;  2Q5W D;  5H8Y E;  2KKC A;  1ESF A;  5FR6 A;  1SJH D;  4WUR A;  3U52 E;  3A9K A;  2ACZ B;  3QC8 B;  4I6P A;  5EE3 A;  2N1V A;  4LJP B;  4ASW C;  2O2V B;  1FNV A;  3APF A;  1GOZ A;  3K9P B;  4NPN A;  3L4P A;  1MPE A;  1GNU A;  4MEM A;  2NTT A;  3OJ4 B;  1HZ5 A;  3WAO A;  1JML A;  3ZNG C;  5JH5 C;  4RH6 A;  3RUI B;  4LK0 M;  3AE6 B;  1UEL A;  4TQ0 A;  3AMZ A;  2N4F A;  2INP E;  4JGH B;  1OFF A;  1F52 A;  2WDT B;  1OEY J;  3C0R B;  2BGF A;  3HHM A;  2CJO A;  2KWV B;  3ZTD A;  1PDX A;  4C7Z A;  2AL6 A;  2J42 A;  2OJR A;  3T3O A;  2C9W B;  3OJ3 A;  4I6N B;  3PT2 B;  5KHO A;  3TCA A;  4HDO A;  3PLV A;  1TT5 B;  2L52 A;  4L2Y A;  3EC8 A;  4LNN A;  1PFD A;  3VDZ A;  2JRI B;  3TMP B;  2R61 A;  2BF8 B;  3ZNH B;  5T8I A;  5EDS A;  1VRA B;  2N1W A;  3Q14 C;  2INC C;  1SB3 C;  1S1Q B;  1IPG A;  1Q10 A;  1WF9 A;  2NBU A;  1V1O A;  3E56 A;  2VH1 A;  3DBS A;  4FA6 A;  2H89 B;  3CST A;  2L0F A;  4ZDV A;  1SSN A;  2J4X A;  1B1Z A;  1JWS D;  2PVO D;  2LHD A;  3IVF A;  1V9J A;  3HM6 X;  2IY0 B;  4LNO A;  3PRP B;  1C9F A;  1SF0 A;  4CHK A;  1MJD A;  1WRD B;  2M17 A;  3V6C B;  1VR9 A;  2N9E B;  3UGB B;  4IWP A;  2WXQ A;  1ET6 A;  2W3S A;  3W1S A;  3Q3M C;  4K7W A;  2BWE S;  2WLB A;  1D4B A;  4YT0 B;  1BML C;  3OLM D;  1STE A;  4WWM A;  1CJE A;  4A3P A;  4NAM A;  4B9K A;  1SBB B;  1F9J A;  4ZRQ A;  3FKY A;  2DAF A;  3BYY B;  4ACF A;  5CTR C;  1OTR B;  1WMH B;  2XN9 C;  1V5T A;  4RCO A;  4KGS A;  3LJ3 A;  4HXD A;  3U7D A;  4MM3 B;  4G11 A;  4N58 A;  3ZRC A;  1QOF A;  1YOV B;  5G5H A;  3SEB A;  3LYY A;  1EWY C;  2NBW B;  4YTP B;  4ZOH C;  3OWE B;  4JX1 C;  5D94 A;  3TIX A;  4MSQ B;  2NCN A;  2GRI A;  3ZNZ B;  2BKR B;  1XF5 L;  3HRD D;  3A9J A;  1PUT A;  1P0R A;  1V2Y A;  1WR1 A;  2PEA A;  1MG8 A;  4JWS C;  5D3I B;  4AUQ C;  2JZZ A;  2L0T A;  4BBN C;  2J0M A;  2BS3 B;  2WU2 B;  1J8C A;  2R2O A;  1RYJ A;  1CK1 A;  1UNS A;  2KO3 A;  1P98 A;  1KRH A;  4YSZ B;  3KWV A;  1E7U A;  2M0A A;  2RD0 A;  1LO5 D;  4EEW A;  1RFK A;  3MJ5 A;  4LDT D;  3VRA B;  2MJ3 A;  3DOW A;  3ZKJ C;  3BK1 A;  3AU4 A;  3C8Y A;  3IG3 A;  1K51 A;  1P7F A;  2L32 A;  1TGZ B;  3VVW B;  5I4D A;  2KFK B;  1ZP0 B;  2WWZ A;  2I1J A;  2MBB B;  1TS2 A;  3JSV A;  5JHB A;  2IJ0 A;  3GE8 C;  4A90 A;  3X23 A;  4ZRK A;  1J7C A;  1GC7 A;  2BYV E;  1ET9 A;  2Y5B B;  3QAQ A;  2I2Y A;  2I1K A;  2IO3 B;  3R3M A;  4WJP A;  3N9Y C;  1YQ4 B;  1Z5S B;  3AE2 B;  4EZL A;  5L95 C;  4DHZ E;  3J9C A;  3DVN U;  4JL9 A;  2MQJ A;  2RR9 A;  1L5P A;  2KX3 A;  2KDM A;  3MJW A;  3VRB B;  2IGH A;  1WE7 A;  1ZUD 2;  2KFJ A;  1OEY A;  1NI3 A;  2DZK A;  3VUY A;  2K5P A;  4MJS A;  3CSF A;  3KYD D;  2MW5 A;  3ZJT A;  2V3S A;  4MEL A;  2JYT A;  4K7S A;  1HE8 A;  4ANU A;  3S2A A;  1TY2 A;  3NS1 A;  4WWP A;  3D32 A;  2IBI B;  4DWF A;  1TS5 A;  2QSD A;  3L13 A;  1SIJ A;  1C79 A;  2BW2 A;  2ZVN A;  1QKZ A;  2RDH A;  3ZO5 B;  4KZ0 A;  4HRO A;  1AAR A;  4NJ6 A;  4L23 A;  4G3X B;  2X38 A;  3RFZ B;  3BZD B;  3AEE B;  1P1A A;  3SR6 A;  2D5G A;  3WAL A;  1L2N A;  4P16 A;  2BB6 A;  1HXY D;  3RNB C;  4MDK E;  3L54 A;  5AZG A;  5IA7 A;  4W9I A;  2DX5 B;  1QIL A;  3IAS 1;  1YJI A;  1YX5 B;  1ZDX A;  2O6V D;  3N1X C;  1FXI A;  1B9R A;  4HVB A;  3R7R A;  3AE9 B;  3LXF A;  1L0V B;  4OVZ A;  1TS3 A;  2KX0 A;  2L83 A;  1FD6 A;  3P2B A;  1XLP A;  2KMC A;  1JWU D;  3LB8 C;  3P1M A;  4M0W A;  4EE2 A;  1V1P A;  4PK1 A;  3P63 A;  3BVZ A;  1WJ6 A;  3FC4 A;  3HIZ A;  3SFD B;  2B76 B;  2V0G A;  4HJK A;  2IZV B;  1DOI A;  4O1N A;  1P9D U;  2ZW0 A;  4EKU A;  2V3P A;  2N7E A;  1SE4 A;  5AEK B;  1PGB A;  3PO0 A;  2L7R A;  1WGY A;  2INN E;  2AQ3 B;  1AW7 A;  4NJC A;  3C19 A;  1RM6 C;  2BWF A;  1TKE A;  3H9D A;  4W9D A;  5BMI A;  4E74 A;  2JWU A;  2JZP A;  3RMK C;  2QIE B;  3VH4 B;  1WWT A;  1EU3 A;  3A33 B;  1SE9 A;  3P4S B;  4BVU C;  1BXT A;  2M8S A;  2WXJ A;  4N9F 4;  3SU8 X;  2IYD B;  3UQA A;  2GMI C;  1NI2 A;  3QWZ B;  3WAN A;  4II2 B;  2VZK D;  2OHF A;  1XD3 B;  1UGJ A;  2LGY A;  4HCN B;  1I4R A;  2XNA C;  3P4Q B;  2C60 A;  1SXT A;  2AL3 A;  3ML8 A;  2DLB A;  2AQ2 B;  4B0M A;  4KDI C;  1KTK A;  1HTQ A;  5JXV A;  3A1Q B;  3NZ3 A;  1NYQ A;  3AEF B;  2K1F A;  2MH7 A;  3NJT A;  3AU5 A;  1XLO A;  1RAX A;  3A9K B;  4AOF A;  2DZI A;  2JYE A;  1X1M A;  3V60 A;  4YXD B;  3AB5 A;  3RN9 C;  2MJE A;  4ZHP A;  4PS3 A;  4G50 A;  1JCK B;  2EMS A;  5D2M B;  1FMA D;  1PGA A;  2QEJ C;  5BMH A;  3QX1 A;  2N7D A;  3ETR A;  1HQR D;  2KZR A;  1WYG A;  1WX9 A;  4YSX B;  3KUD B;  1WR6 E;  4W9F A;  4TQ1 A;  4UDU C;  5CHW A;  5IOI A;  4FAD A;  4YTN B;  2C7M B;  3R66 C;  2MBO A;  2V3N A;  2W55 A;  2JU6 X;  3NZS A;  3VAW A;  1IBX A;  1P3Q U;  1J0G A;  2PW9 A;  4LNI A;  1T0S C;  2UWQ A;  2L1A A;  2D3G A;  3SDL C;  4C4V B;  4ITK A;  4S0R A;  4KGR A;  5JHA A;  2YLM A;  4OVU A;  1SJE D;  4G0N B;  4ARI A;  1WXQ A;  2LXA A;  1RFA A;  4GGQ A;  2L05 A;  1EF5 A;  1JWM D;  1RLF A;  1E8X A;  3PGE A;  4XC2 A;  1WXM A;  1FNW A;  1GAQ B;  2E3T A;  4KSK C;  2KC1 A;  1N62 A;  3K9O B;  2ZZP B;  2N9P C;  4TSS A;  2PE6 B;  3CWI A;  4HDQ A;  1I7H A;  3ZIM A;  2FNJ B;  5LXH A;  3AE4 B;  4IC7 B;  1FNU A;  1PGX A;  4K1R B;  4F8C B;  1T3Q A;  4MGY E;  1EM7 A;  2LVO A;  4I6L B;  1F1H A;  2ICI A;  1WRI A;  3ONS A;  1TBE A;  3PSE B;  1U4A A;  3NY5 A;  3QK0 A;  4TMA B;  1F2R C;  2DAJ A;  1YMH E;  2K6D B;  1JW9 D;  2A5U A;  3VXW A;  1N61 A;  1NEK B;  4W9E A;  1VZ6 A;  1WJU A;  4WWO A;  3PRM B;  4RGN A;  4WAF A;  3ZRF A;  5DCN A;  2LXC A;  2KWC A;  4PYU A;  5BO4 B;  2IDY A;  2HJ8 A;  3ZTC A;  4JQW C;  4FBJ B;  1WM3 A;  2WXG A;  3WA0 A;  4BFR A;  2NPT A;  2CHZ A;  3EGR A;  2LGS A;  4A55 A;  3L17 A;  3H6N A;  1C4P A;  2LVP A;  2BQQ A;  3I9V 1;  1IP9 A;  3DHH C;  3ZNI D;  3HVZ A;  4LNF A;  2QC8 A;  3W2D A;  3A9J B;  1YJ1 A;  2Z59 B;  3V62 A;  2M56 B;  2CU3 A;  3H7P B;  2G1E A;  3Q3O C;  2KC2 A;  1XLN A;  2RMM A;  1V86 A;  4WQM A;  3L0W B;  4GDL B;  4AP4 C;  2K9X A;  1YN5 A;  1GC6 A;  2LUM A;  5TR5 A;  4N6E B;  2UU7 A;  3KUZ A;  4GDK B;  2BPS A;  5DPW A;  3H1U A;  1FIQ A;  1LXD A;  4IW0 A;  4OZA A;  3APD A;  1GJZ A;  3PZD A;  4URK A;  4J6I A;  1KF6 B;  3RZF A;  2CU1 A;  4BOS C;  4S17 A;  1VZ7 A;  1WJ4 A;  3I3T B;  2FUG 1;  2OJW A;  3MP9 A;  5C1Z A;  3PZ7 A;  3LDZ E;  1QOG A;  3R8B A;  1H4R A;  1JWB D;  4MH0 E;  1NBF C;  4GMV A;  1WGD A;  5IO9 A;  2X8X X;  1SE2 A;  1Q5W B;  2EEL A;  4IM0 A;  1N63 A;  1WI0 A;  4IM3 A;  4KIK B;  4DBG A;  2JQR B;  3DWM A;  3ECI A;  1R7S A;  2LJI A;  3P4R B;  3NVW A;  1M4V A;  5IP4 D;  5E6J A;  2WDV B;  2GBN A;  2QHO A;  4ZHO A;  1L6U A;  2M0X A;  3N3K B;  3DPD A;  2DYO A;  5E6P A;  1LGR A;  1UWX A;  4W9H A;  2VRR B;  2JY6 A;  3VQI A;  3DBR B;  5AZH A;  2V1Y A;  5D3D A;  4XX5 A;  4PYZ A;  4F1S A;  4OZC A;  1EO6 A;  2IO1 B;  2LHE A;  4FN2 A;  1D3Z A;  1UBQ A;  2DBY A;  4PS7 A;  2GLS A;  1IYF A;  3GZN B;  1SIF A;  3AE1 B;  4OW0 A;  2G4D B;  4REZ A;  1FXA A;  4RF1 A;  4D2K A;  3HM3 A;  3RZW C;  1QZE A;  2Z0D B;  4MSM B;  1GB1 A;  4K81 A;  4KSL C;  4RF0 A;  1DGJ A;  4KDL B;  2G45 B;  3SHQ A;  2N0S B;  3WAP A;  2K8C A;  1FRD A;  1YNT E;  3TEY A;  3B1L X;  4A3O A;  3B0A A;  5DPR A;  1N60 A;  2JWZ A;  3PHW B;  3VUX A;  2IO0 B;  2GBJ A;  2FBW B;  2RSU A;  2JRH A;  3N20 C;  5D6J B;  1CQV A;  2LJ5 A;  3U4E G;  2D3A A;  4IDI A;  5BYR A;  4BKS D;  2ZCB A;  1KOT A;  3NHE B;  4MGK E;  3I57 A;  2M1M A;  5JZE B;  3O65 B;  3ZJU A;  4GOC A;  1PYW D;  2BTE A;  3ZYY X;  5G5G A;  4JPS A;  4ANX A;  4LNK A;  4EFO A;  2WGS A;  2LRU A;  2ON8 A;  2XEW A;  1EF1 A;  4YSY B;  3AN1 A;  3T9L A;  1GB4 A;  4LDT B;  5EE0 A;  1FFV A;  4ANW A;  2AYO B;  2KDB A;  1KJT A;  1V1P B;  3HUI A;  2KN5 A;  4NAW B;  4DK5 A;  2KTR A;  5LXI B;  2IO2 B;  1UZX B;  2BYE A;  3B9J A;  3L08 A;  2J7Q B;  3TEZ A;  5AZF A;  2IGG A;  3B2G A;  2SEB D;  5E6O A;  2KJR A;  1XEE A;  4HLE A;  1ZPS A;  1A70 A;  4NY0 A;  3AEG B;  2J0J A;  5E6N A;  5H92 C;  5AUK A;  1WX7 A;  1FCL A;  3AE5 B;  2LI5 A;  3AI5 A;  4GSW A;  1LQB A;  1TS4 A;  4WJN A;  1XQQ A;  2M4N A;  3EA6 A;  2LMC A;  1P7E A;  2W82 A;  3DBR I;  2WDR B;  5BYS A;  1Y8R C;  2MP2 B;  3Q69 A;  1AWD A;  5BYQ A;  2K6Q A;  1ZXI A;  3V6E B;  4RGO S;  1V81 A;  1HEZ E;  2WX0 A;  2K22 A;  1KM7 A;  1RRB A;  2D11 A;  2IGD A;  3QQ8 B;  3L10 B;  5FR3 A;  2Z0E B;  3MC0 B;  3KQ4 A;  4NNJ B;  2DWQ A;  3DVG X;  3GZN I;  2N9L A;  3RT3 B;  2PJH A;  2I38 A;  2WXR A;  2RDG A;  1L6V A;  2MRP A;  2KYW A;  1YX6 B;  3Q8B A;  3ZUN A;  4HCP B;  3ZDT A;  4XWW A;  5KHQ A;  2JPH A;  2Z8L A;  3IHP C;  2W9N A;  2LGI A;  3RCZ A;  1FCC C;  2CJN A;  2SAK A;  5HHD G;  5C3J B;  2K8H A;  1R4N I;  4IM2 A;  2MA9 B;  2WXN A;  3DBL B;  4BKS A;  2RDB C;  2WQY B;  4M01 A;  1MVK A;  2C5L C;  4IOI E;  3V3X A;  1RWS A;  3TSS A;  3GE3 C;  3HVD A;  4FXC A;  2FIF A;  3R7Q A;  2XBB C;  4WJQ A;  4MM3 A;  2G4S A;  3Q3F A;  2O6V B;  4KX6 B;  3FIL B;  4HKQ A;  3KYC D;  2MCN B;  4J3O D;  4GU2 A;  1UD7 A;  2DNF A;  3N1Y C;  4W9K A;  4EUT A;  2NBV B;  3Q3J A;  3SFE B;  2WP9 B;  3DQV A;  4C7Y A;  2L76 A;  1K53 A;  3VTW A;  4EZK A;  3BWU D;  3DVG Y;  2WXP A;  3QHT A;  2DEN B;  1BT0 A;  1Q0W B;  1WZ0 A;  4HWI B;  4RMA A;  3Q8A A;  2Y3A A;  1FFU A;  3W9C B;  2KVR A;  3T3N A;  2FUH B;  4XDD A;  1Z2M A;  4EZJ A;  3DHG C;  4TUU A;  2KOX A;  2J0K A;  3DBH B;  2KNB A;  3PS6 A;  5CX3 A;  1XCQ L;  2QJL A;  3PV1 A;  1L4D B;  1LFD A;  4WH4 A;  4HPM B;  1ZGU B;  2YVC A;  2Y5P A;  4GLS C;  1XLQ A;  1WY8 A;  3T8M A;  2JF5 A;  4DQO C;  1C4A A;  2AWT A;  2BYF A;  3QAR A;  2PLP A;  1KLV A;  2D3C A;  1Y56 A;  3CIR B;  1D5X C;  3AE7 B;  4ZYS A;  3N30 A;  4KKJ A;  1E6E B;  4JIO U;  2KHW B;  3UF8 A;  4NZL B;  2KLC A;  3GOE A;  4AWJ A;  5G55 A;  3KVF B;  1D5Z C;  1FEH A;  3U8Z A;  4F7Z A;  2VZK B;  1D6E C;  2GOW A;  4H2A A;  3BYT B;  4RNA A;  1I4P A;  1K52 A;  2QIL A;  2D10 A;  2WXO A;  3ZQ4 A;  2V9H A;  1UWM A;  4FHJ A;  2UYZ B;  2KDI A;  2EKI A;  3DHI C;  1MHH E;  1TY0 A;  2FCS A;  1ZKH A;  1ZW7 A;  3IAM 1;  4W9J A;  1ZOY B;  1EUV B;  4FUL A;  3GP7 A;  3WIM A;  3Q8E A;  2WXL A;  2MJD A;  1QOB A;  1ENF A;  2LAS A;  2C7H A;  3DBL I;  2ZPY A;  5HKH A;  5FK9 C;  2CHW A;  3U7Z A;  4YTM B;  2WHI A;  2PVG C;  2QCZ A;  2CR5 A;  2FAZ A;  1VD2 A;  2LZ6 A;  5CHV C;  1NYR A;  4HPP A;  2PE9 A;  3ZVV A;  2AX5 A;  4HK2 A;  4HJG E;  2FCM A;  3BY4 B;  2NTS A;  4DXA B;  1YD8 U;  4WQO B;  4PS8 A;  4W9G A;  4P1C C;  2GBR A;  3R2I A;  4M00 A;  4W9L A;  1FO4 A;  4MH8 A;  1T0Q C;  1I4X A;  5EE1 A;  1JRO A;  1JRP A;  3ZDM C;  1IGC A;  1DOX A;  4C80 A;  3DBH I;  3AE3 B;  3M62 B;  1YJJ A;  2BB5 A;  2JXX A;  4R3D A;  1QF6 A;  1ISN A;  1VJK A;  1WXS A;  3UIO B;  4X57 B;  2HTH A;  3Q8F A;  1HA5 A;  1GG3 A;  2L3Z A;  3AUL A;  3JW0 X;  1J19 A;  3UIN B;  4GXB A;  2IY1 B;  1OQY A;  4WIP A;  1PQS A;  3RNG C;  1T6B X;  1C4C A;  3OAW A;  2OED A;  5LNK 1;  3NVZ A;  1J7A A;  4AJW A;  1YIW A;  2JT4 B;  1ZXH A;  3Q6B A;  3A4S C;  2H88 B;  3Q8C A;  3B2F A;  4XE0 A;  2BT6 A;  2J52 A;  2WXI A;  3NVV A;  3O13 A;  1FM0 D;  4DDI D;  1Q1O A;  1JQ4 A;  2BKF A;  2LGD A;  3W5U B;  2QMT A;  1WXA A;  4DHZ B;  2JUO A;  4P1B C;  1I4H A;  3OG5 A;  2LD9 A;  2L00 B;  1JRU A;  4MGZ E;  2E6X A;  5J2R A;  2ZNV B;  3VHT C;  3TEX A;  4DHJ D;  4XDC A;  2KD0 A;  1R4M B;  2KMM A;  5D7G A;  2VH2 A;  4ICV A;  4BKG A;  1WGH A;  2REX A;  1WJN A;  1K8R B;  3Q3N C;  4JLC A;  2KJH B;  2B3A A;  1ZDV A;  2YEP F;  5C2T B;  3VFK A;  1EWC A;  4HRS A;  5IAA C;  3MHS D;  1WGK A;  1ROE A;  2RPQ A;  4JWU C;  4YL8 A;  1CZP A;  1WX8 A;  1YN3 A;  1L4Z B;  4C56 C;  1FRR A;  2HDE A;  4IUM B;  1V97 A;  1MHX A;  3I63 C;  2LRW A;  1V49 A;  1WZ3 A;  4W9C A;  2KQS A;  1E7P B;  4ZRJ A;  3V05 A;  2HJ1 A;  4A9A A;  4Q2J A;  2G9H D;  1VDV A;  4IWO A;  4HKZ E;  2PMV A;  1KLU D;  2KTR B;  1XXG A;  2WS3 B;  5CHF A;  4ZRP A;  2ZCC A;  4E71 A;  2K39 A;  1WSP A;  4GIV A;  1NEN B;  3M3J A;  3ENE A;  4GN1 A;  2KDF B;  2XK5 A;  3PHX B;  5G2N A;  3M63 B;  3KWL A;  3JSV B;  2KAJ A;  3WAM A;  4C4V A;  3IXS A;  1C3T A;  3BVG A;  3NG0 A;  1YN4 A;  2KWD A;  2LVQ A;  2KN4 A;  5J17 A;  4RGM A;  2MBQ A;  3URY A;  2D2Q A;  1E0Z A;  2IND C;  4ANV A;  4BKT A;  2KQ7 A;  4DXG A;  2KTF A;  3CF6 E;  5MPO A;  3MFG A;  3RD2 A;  5HG2 A;  1OGW A;  1T5X D;  3IBE A;  2AEH A;  1MFW A;  4MJS B;  3JVZ X;  3R2T A;  5L83 A;  1WE6 A;  2WU5 B;  2BBC A;  2WDQ B;  2HD5 B;  1R4M I;  2CS4 A;  1YQ3 B;  4YWG G;  4US8 A;  3B08 A;  3UIP B;  2JX5 A;  1UF0 A;  1V80 A;  4IKG A;  1I42 A;  2PPH A;  2WXK A;  3P42 A;  2WXM A;  3DDC B;  3ALB A;  2DHZ A;  4LTU A;  4LCD E;  3TJP A;  4OHJ A;  3ZXR A;  2N9X A;  3NS8 A;  3ZGZ A;  1R4N B;  1V8C A;  4FLH A;  1VCB A;  3EFC A;  4USA A;  2EMT A;  4CYE A;  2O2V A;  5J18 A;  3RNC C;  1XT9 B;  4RFB A;  1GUA B;  1WIA A;  4IG7 B;  4BBN F;  3KUC B;  4B6W A;  2ONQ A;  1S3S G;  4FJY A;  1F0Z A;  4ZYN A;  1LM8 B;  1OQR A;  1UUP A;  3U2S C;  4QAY A;  4TV3 A;  1M94 A;  3ABV B;  4M0W B;  3H7P A;  3RUL A;  3W1S C;  4AQ7 A;  3DCG A;  3M95 A;  4RGT A;  2W3R A;  4GDL A;  3FAH A;  2W54 A;  1SGH A;  2ZJD A;  3CMM B;  1NVI D;  4KVG B;  1UGM A;  1HTO A;  2ZNV C;  2J53 A;  3L16 A;  4GDK A;  4IWQ A;  2ZEQ A;  1T0Y A;  1MI0 A;  5AUI A;  3MC9 A;  1WYW B;  1C77 A;  1I35 A;  2WNM A;  3Q2A C;  3BII D;  3IFW B;  2C7N B;  3AE8 B;  1WFY A;  2JXT A;  1FXT B;  2HE7 A;  4AJY B;  1H8C A;  1TIF A;  3ZW3 A;  1TZ1 A;  2RPV A;  3V61 A;  4XWT A;  4M02 A;  1N5W A;  1WGR A;  3AEA B;  4US9 A;  1K50 A;  3PRE A;  2LEK A;  2ZVO A;  4OVV A;  4KIK A;  3ZLZ A;  3AV8 A;  5IKC M;  2GBM A;  4WWN A;  1TJE A;  3AXC A;  2D07 B;  3IT4 B;  5HI1 A;  2KAC A;  1QOA A;  2G3Q B;  2MX2 A;  3H7S A;  2ZPN A;  2KK8 A;  3KW5 B;  4MAC A;  4RM9 A;  4MT5 A;  3RI7 C;  1TZO A;  2LWP A;  1QQR A;  5EE9 A;  4A20 A;  1YQB A;  2JZ3 B;  4RM8 A;  2D3B A;  2MHJ A;  1ZE3 D;  3GS2 A;  4FJV B;  2FE8 A;  3MHZ A;  4TKN A;  2DYM A;  1G6J A;  1VZ8 A;  3NUH B;  2IPK D;  3A4R A;  1VLB A;  2KMA A;  1E5W A;  1WM2 A;  1BUI C;  4P7I A;  1WMH A;  1KH0 A;  4EOY A;  3EHV A;  1I4G A;  4P6V F;  3NVY A;  3U30 A;  2N7J A;  2HTM E;  3PLU A;  1IGD A;  2WXF A;  4AS1 A;  2JVC A;  1XO3 A;  1E9M A;  2BVC A;  4MGI E;  4L1B A;  4LJO B;  1EU4 A;  2GB1 A;  3PRZ A;  3NZU A;  1E7V A;  4PT5 A;  2MWS B;  2GI9 A;  3QIJ A;  1UH6 A;  4HEA 1;  2ASQ A;  1NDD A;  2V4L A;  1TTN A;  1WGG A;  3MC8 A;  1V6E A;  4II3 B;  2KDE B;  3EFU A;  2FID A;  1A5R A;  2K0P A;  4M8M A;  1L0Y B;  2JSV X;  1IBX B;  4JE3 B;  3VTV A;  4WJO A;  3TL5 A;  2KAN A;  4BAX A;  3E9S A;  2V4I B;  3N32 A;  3ZJV A;  1E8Z A;  1UBI A;  3RNA C;  4NAW A;  2K25 A;  1KLG D;  3AEB B;  3QCA A;  2N9K A;  3APC A;  2KLG A;  2YEP B;  2BS4 B;  2NMQ A;  2KXJ A;  2KWU B;  4NQK E;  4DXF A;  5GMV A;  4KZC A;  2CHX A;  2KFK A;  5GXG B;  5LLI A;  2MEK A;  2LUE A;  3BVM A;  4KGT A;  4NQL B;  2BYT A;  5DPS A;  2MBH A;  4ICU A;  3QJZ A;  2NVU I;  3PVL A;  1GPX A;  2KQ4 X;  1WXV A;  4FHK A;  5IN7 A;  1C76 A;  4XYC A;  3TEW A;  3RYT A;  3BIN A;  3VR9 B;  2NR2 A;  2K3U A;  2BS2 B;  3VTU A;  3VH3 B;  1QLB B;  1TYG B;  4WAA A;  5DPT A;  2K8B A;  4HPL B;  3KLS X;  2MP2 A;  3PZ8 A;  3BK2 A;  4N59 A;  5TSS A;  1C78 A;  4DDG D;  1E10 A;  1FPY A;  5BMG A;  2MLB A;  1I4Q A;  3P4P B;  2RGF A;  1J7B A;  2DYB A;  1JAL A;  1SEB D;  1DOY A;  2NPT B;  2LFI A;  3NRZ A;  3VR8 B;  4K3B A;  3NOB A;  4M8N A;  2LGX A;  4GB9 A;  4K3C A;  2OOB B;  2WX1 A;  2CKH B;  2MSE D;  4XZ4 A;  2DZJ A;  1C1Y B;  1JWA D;  1TKY A;  3UQB A;  3H8H A;  3TUO A;  2KJ6 A;  3PPA A;  4KKI A;  3GB1 A;  1N6Z A; 
#chains in the Genus database with same CATH homology
 1TKG A;  1QIL A;  3IAS 1;  1V97 A;  3FIL A;  3ZYY X;  3AED B;  1YJI A;  5G5G A;  1ZDX A;  1MHX A;  4JPS A;  1FXI A;  1B9R A;  2ON8 A;  1IUE A;  1AN8 A;  3AE9 B;  4YSY B;  3LXF A;  1E7P B;  3AEC B;  3V05 A;  4A9A A;  1L0V B;  3AN1 A;  4OVZ A;  4Q2J A;  1GB4 A;  1TS3 A;  2G9H D;  2L83 A;  1VDV A;  1F77 A;  5EE0 A;  1FFV A;  4ARC A;  1FD6 A;  1XCT L;  3IT6 B;  1F2R I;  1SE3 A;  1XLP A;  4HKZ E;  2PMV A;  1KLU D;  1V1P B;  1JWU D;  3LB8 C;  3HUI A;  1XXG A;  2PTL A;  2WS3 B;  3P1M A;  4M0W A;  1ACC A;  4NAW B;  4ZRP A;  4EE2 A;  1V1P A;  3P63 A;  3BVZ A;  4LLG M;  5FKA C;  3FC4 A;  1WSP A;  3B9J A;  3SFD B;  2B76 B;  2V0G A;  1NEN B;  3TEZ A;  3WCQ A;  1DOI A;  2IGG A;  4O1N A;  2ZW1 A;  2ZW0 A;  3B2G A;  2SEB D;  2V3P A;  5HFY A;  2PIA A;  3UI3 A;  3KWL A;  1SE4 A;  2KAJ A;  1PGB A;  3PO0 A;  1XEE A;  1ZPS A;  1A70 A;  3IXS A;  2INN E;  3BVG A;  2AQ3 B;  3AEG B;  1AW7 A;  1YN4 A;  4NJC A;  1OQQ A;  2KWD A;  5H92 C;  1N5X A;  2KN4 A;  5AUK A;  1RM6 C;  1HZ6 A;  1TKE A;  1FCL A;  3AE5 B;  4RGM A;  3URY A;  1QT9 A;  3W5V B;  1E0Z A;  1DYQ A;  1TS4 A;  5BMI A;  2WXH A;  2JWU A;  2JZP A;  1AYF A;  4DXG A;  2QIE B;  1WWT A;  3EA6 A;  3AM9 A;  1EU3 A;  5MPO A;  3MFG A;  3P4S B;  2LMC A;  1P7E A;  2W82 A;  5HG2 A;  1BXT A;  2WDR B;  5BYS A;  1T5X D;  2WXJ A;  4A8X C;  2Y5C A;  3Q69 A;  1AWD A;  5BYQ A;  1ZXI A;  4RGO S;  2VZK D;  1HEZ E;  2K22 A;  2IGD A;  3R2T A;  5FR3 A;  2OHF A;  4A6Q A;  1UGJ A;  3MC0 B;  2WU5 B;  2BBC A;  3RPF C;  3KQ4 A;  2WDQ B;  2DWQ A;  1I4R A;  2N9L A;  2XNA C;  3P4Q B;  2I38 A;  1YQ3 B;  1SXT A;  4YWG G;  1D5M C;  2WXR A;  2AQ1 B;  3DWG C;  2RDG A;  1L6V A;  4US8 A;  2JX5 A;  4IKG A;  2WXK A;  3P42 A;  2WXM A;  4OZB A;  2DLB A;  2AQ2 B;  3Q8B A;  2M19 A;  3AH7 A;  4B0M A;  1KTK A;  4XWW A;  4LTU A;  5JXV A;  2PKO A;  2Z8L A;  3EUB 2;  3NZ3 A;  1NYQ A;  4CQN A;  2LGI A;  4OHJ A;  1FCC C;  3AEF B;  2CJN A;  2SAK A;  5HHD G;  1L0X B;  1KFY B;  2TSS A;  2MH7 A;  3ZGZ A;  1XLO A;  4B0E A;  5C3J B;  2Q5W D;  5H8Y E;  1ESF A;  2WXN A;  2JYE A;  1SJH D;  4WUR A;  3U52 E;  4YXD B;  2WQY B;  2ACZ B;  1MVK A;  3AB5 A;  5EE3 A;  1V8C A;  2MJE A;  4IOI E;  3V3X A;  4ZHP A;  1RWS A;  3TSS A;  3HVD A;  4FXC A;  1JCK B;  4USA A;  1FMA D;  1FNV A;  1PGA A;  2QEJ C;  1GOZ A;  5BMH A;  4KX6 B;  3L4P A;  4RFB A;  3FIL B;  4HKQ A;  1MPE A;  3ETR A;  1HQR D;  4J3O D;  2NTT A;  2ONQ A;  1HZ5 A;  3SFE B;  1WYG A;  1F0Z A;  2WP9 B;  1JML A;  4C7Y A;  1OQR A;  1UUP A;  3U2S C;  4YSX B;  1K53 A;  3BWU D;  4TQ1 A;  2WXP A;  4RH6 A;  4UDU C;  4LK0 M;  3ABV B;  3Q8A A;  3AE6 B;  2Y3A A;  4YTN B;  1FFU A;  3W9C B;  4TQ0 A;  3T3N A;  3AMZ A;  4XDD A;  4AQ7 A;  2INP E;  2V3N A;  2W55 A;  4RGT A;  2W3R A;  1OFF A;  3FAH A;  2JU6 X;  2W54 A;  1IBX A;  1NVI D;  1XCQ L;  2PW9 A;  2QJL A;  1L4D B;  2CJO A;  2J53 A;  1PDX A;  4C7Z A;  4WH4 A;  5AUI A;  1MI0 A;  2J42 A;  2L1A A;  3T3O A;  2Y5P A;  1C77 A;  4GLS C;  1XLQ A;  2L52 A;  2WNM A;  3BII D;  4L2Y A;  4ITK A;  1PFD A;  4KGR A;  3AE8 B;  4DQO C;  1C4A A;  2R61 A;  1SJE D;  2PLP A;  1Y56 A;  2JXT A;  3CIR B;  4ARI A;  5T8I A;  1D5X C;  1VRA B;  3AE7 B;  1SB3 C;  2RPV A;  1WXQ A;  1Q10 A;  4XWT A;  4ZYS A;  1V1O A;  3E56 A;  1JWM D;  1N5W A;  4KKJ A;  1E6E B;  3AEA B;  4US9 A;  4NZL B;  1K50 A;  2H89 B;  2LEK A;  3AV8 A;  1FNW A;  1D5Z C;  1GAQ B;  1FEH A;  1SSN A;  2E3T A;  1TJE A;  2J4X A;  1B1Z A;  1JWS D;  3IT4 B;  5HI1 A;  1N62 A;  2VZK B;  2KAC A;  1QOA A;  2PVO D;  1D6E C;  2LHD A;  4H2A A;  4TSS A;  3BYT B;  4RNA A;  1I4P A;  4MAC A;  3CWI A;  1C9F A;  1I7H A;  4MT5 A;  1K52 A;  1TZO A;  1SF0 A;  3AE4 B;  2QIL A;  1FNU A;  1PGX A;  1QQR A;  2WXO A;  5EE9 A;  3ZQ4 A;  1T3Q A;  1VR9 A;  1UWM A;  1EM7 A;  2WXQ A;  1ET6 A;  2W3S A;  2ICI A;  1WRI A;  3W1S A;  1ZE3 D;  2EKI A;  3GS2 A;  2WLB A;  2FE8 A;  1D4B A;  3MHZ A;  1MHH E;  1TY0 A;  4YT0 B;  2DYM A;  1BML C;  4TMA B;  1F2R C;  1STE A;  1PYW D;  1VZ8 A;  1YMH E;  4WWM A;  3NUH B;  1CJE A;  2IPK D;  3IAM 1;  4NAM A;  1JW9 D;  1VLB A;  1N61 A;  1ZOY B;  1SBB B;  1NEK B;  4ZRQ A;  3GP7 A;  1VZ6 A;  3BYY B;  1BUI C;  3Q8E A;  2WXL A;  2XN9 C;  2MJD A;  4RGN A;  4WAF A;  1QOB A;  4RCO A;  1ENF A;  4KGS A;  1KH0 A;  5FK9 C;  3U7Z A;  1I4G A;  4MM3 B;  2IDY A;  4P6V F;  4YTM B;  3NVY A;  4N58 A;  1QOF A;  2WXG A;  2N7J A;  2PVG C;  2HTM E;  5G5H A;  3SEB A;  3LYY A;  1NYR A;  3EGR A;  4A55 A;  1EWY C;  1IGD A;  1C4P A;  2WXF A;  4AS1 A;  4YTP B;  4ZOH C;  2AX5 A;  1XO3 A;  3I9V 1;  1E9M A;  3OWE B;  4JX1 C;  4L1B A;  3HVZ A;  1EU4 A;  4HJG E;  2GB1 A;  3W2D A;  2GRI A;  2NTS A;  1XF5 L;  3HRD D;  4PT5 A;  2GI9 A;  2CU3 A;  2M56 B;  1PUT A;  2G1E A;  4HEA 1;  3R2I A;  1FO4 A;  1XLN A;  2RMM A;  4WQM A;  4MH8 A;  1I4X A;  4JWS C;  5EE1 A;  4GDL B;  2K0P A;  1JRO A;  1L0Y B;  2JSV X;  2K9X A;  1JRP A;  5D3I B;  1IBX B;  1YN5 A;  2BS3 B;  2WU2 B;  4JE3 B;  2LUM A;  4N6E B;  1IGC A;  1RYJ A;  1CK1 A;  1UNS A;  4GDK B;  4C80 A;  1DOX A;  1KRH A;  4YSZ B;  3AE3 B;  3KWV A;  1FIQ A;  4OZA A;  1YJJ A;  2BB5 A;  2M0A A;  4R3D A;  1QF6 A;  1VJK A;  1KF6 B;  1LO5 D;  3E9S A;  1RFK A;  3MJ5 A;  3Q8F A;  2V4I B;  1HA5 A;  1VZ7 A;  2FUG 1;  3VRA B;  2MJ3 A;  3MP9 A;  3PZ7 A;  3ZJV A;  1QOG A;  3R8B A;  3BK1 A;  1JWB D;  3AEB B;  1KLG D;  4WIP A;  3C8Y A;  1K51 A;  2N9K A;  1T6B X;  1SE2 A;  2EEL A;  2YEP B;  1N63 A;  1P7F A;  2L32 A;  1C4C A;  2BS4 B;  2OED A;  2NMQ A;  5LNK 1;  3NVZ A;  1J7A A;  5I4D A;  2JQR B;  1ZP0 B;  3DWM A;  4DXF A;  1R7S A;  1ZXH A;  2LJI A;  3P4R B;  3NVW A;  1TS2 A;  1M4V A;  5GXG B;  2IJ0 A;  2MEK A;  5E6J A;  3BVM A;  4KGT A;  2BYT A;  4A90 A;  2WDV B;  2H88 B;  3Q8C A;  1J7C A;  3B2F A;  4ZHO A;  1GPX A;  4XE0 A;  1L6U A;  1ET9 A;  2KQ4 X;  2I2Y A;  2BT6 A;  2J52 A;  2WXI A;  3NVV A;  1C76 A;  2DYO A;  3TEW A;  3O13 A;  1FM0 D;  3VR9 B;  1JQ4 A;  1UWX A;  3N9Y C;  1YQ4 B;  2K3U A;  3W5U B;  2QMT A;  3VQI A;  3AE2 B;  2BS2 B;  5D3D A;  1QLB B;  1TYG B;  1I4H A;  3J9C A;  4OZC A;  2LHE A;  1L5P A;  3KLS X;  2KDM A;  3VRB B;  2IGH A;  1ZUD 2;  3PZ8 A;  3BK2 A;  2E6X A;  2DBY A;  4N59 A;  5TSS A;  1C78 A;  1NI3 A;  1E10 A;  3TEX A;  4XDC A;  2K5P A;  3AE1 B;  4OW0 A;  4REZ A;  2KMM A;  5D7G A;  5BMG A;  1FXA A;  4RF1 A;  1I4Q A;  4D2K A;  3ZJT A;  2JYT A;  3P4P B;  1GB1 A;  1TY2 A;  1J7B A;  1DGJ A;  4RF0 A;  1JAL A;  3NS1 A;  1SEB D;  2N0S B;  1ZDV A;  2YEP F;  1DOY A;  1FRD A;  1YNT E;  2LFI A;  5C2T B;  3TEY A;  1TS5 A;  2QSD A;  3NRZ A;  1N60 A;  1SIJ A;  1EWC A;  3VR8 B;  1C79 A;  2BW2 A;  4HRS A;  2FBW B;  1QKZ A;  2RDH A;  1CQV A;  1WGK A;  4HRO A;  3U4E G;  1ROE A;  4IDI A;  4L23 A;  2X38 A;  5BYR A;  3RFZ B;  1JWA D;  3BZD B;  1TKY A;  3AEE B;  4JWU C;  3SR6 A;  3H8H A;  2D5G A;  1CZP A;  4P16 A;  2BB6 A;  3I57 A;  1HXY D;  3ZJU A;  1YN3 A;  3TUO A;  1L4Z B;  4C56 C;  1FRR A;  4KKI A;  3GB1 A;  2HDE A;  2BTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...