1GB4A

Hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MTTFKLIINGKTLKGEITIEAVDAAEAEKIFKQYANDNGIDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GB1-C3B4
publication title Design, structure and stability of a hyperthermophilic protein variant.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Hyperthermophile
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gb4A00
4KGSA 2J52A 4IOIE 5HI1A 2LHDA 1MVKA 2KQ4X 1YMHE 2PW9A 1IBXA 2JU6X 2LUMA 1K50A 1QKZA 2IGDA 2J53A 4OZBA 2RMMA 1GB4A 2JSVX 2GB1A 4OZCA 1IGDA 2NMQA 4KGTA 3FILA 4HJGE 1P7EA 1HZ6A 1K51A 4WH4A 2KWDA 1EM7A 3GB1A 2N9LA 1YNTE 4GLSC 3V3XA 1F2RI 1IBXB 2EELA 1K53A 1HEZE 2LGIA 5HG2A 2IGHA 2KN4A 1XCTL 1XF5L 1K52A 1JMLA 5BMHA 1KH0A 2ONQA 2OEDA 5BMIA 4D2KA 2JWUA 3FILB 1GB1A 2JXTA 2IGGA 1ZXHA 2ZW0A 1UWXA 1MPEA 1MI0A 2K0PA 1Q10A 1PGXA 2PTLA 2I38A 4HKZE 2N9KA 4KGRA 3UI3A 4MACA 1D4BA 4IKGA 4OZAA 1PGBA 5JXVA 2N7JA 1MHHE 1F2RC 1FD6A 1XCQL 5HFYA 1C9FA 2ZW1A 1FCCC 5BMGA 1HZ5A 2PLPA 1MHXA 1P7FA 1FCLA 2GI9A 2QMTA 1IGCA 2QSDA 2KDMA 5HHDG 2KACA 3MP9A 2JZPA 2I2YA 2ON8A 2RPVA 2LHEA 1PGAA
chains in the Genus database with same CATH superfamily
3DHGC 2HD5B 5EE3A 1NYRA 3B08A 3L17A 1TY0A 1MG8A 4EZKA 3BYYB 2QCZA 1DGJA 4N6EB 5CHVC 1QT9A 3OJ3A 4ICVA 3AE3B 1ZGUB 4DHZE 1SBBB 3TEWA 1JWUD 5GMVA 1I4PA 2RSUA 3ZO5B 4G0NB 4HDQA 2J0KA 3OWEB 1TS3A 4C7YA 1TJEA 3LJ3A 3RNGC 2WXQA 2NPTA 3ZKJC 3KUDB 2PEAA 4ACFA 3PT2B 2H89B 3C19A 1XD3B 2OOBB 2QDFA 3A1QB 3V3XA 5AZFA 4LNIA 1KLUD 1Z2MA 1N62A 1WGDA 3HK0A 1A70A 3PHXB 3X23A 1YJ1A 1SIJA 1UELA 3N9YC 2BWES 5IAAC 2JXTA 2WXOA 2QC8A 2AWTA 2L52A 2PKOA 3PRPB 1T0YA 1Y56A 4RH6A 1F1HA 5AUIA 2WNMA 1WX7A 2WXKA 4W9FA 1V9JA 4P1CC 4C56C 1J8CA 5E6NA 2Y5PA 4IDIA 4EE2A 2KDIA 3GOEA 3VRBB 3URYA 2MWSB 1DOYA 1HXYD 2KMCA 3QX1A 1OEYA 4DHJB 1JRPA 2JWZA 4M00A 2MJDA 3Q8CA 2JPHA 1BMLC 3SHQA 1TKGA 1C4PA 1NI3A 2DAJA 2M0XA 1IYFA 2LXAA 2UYZB 4RGMA 4JPSA 2IDYA 2Z8LA 3TL5A 2WX0A 4MGKE 3W5UB 1DOXA 5TSSA 2NR2A 1R7SA 1XLPA 1FFVA 2W9NA 2KYWA 3EECA 5D94A 2DZKA 3R66C 4MEMA 4PS8A 2D2QA 2LVOA 3AM9A 4I6PA 4NAWB 3W1YA 5L95C 2PE6B 3L16A 4P16A 1WMHA 1HQRD 3ML9A 3PGEA 2DLBA 2MP2A 1YJIA 3Q8AA 1SE4A 1YD8U 4WJQA 3QAQA 3BZDB 2UU7A 3AE4B 1E8WA 2LVPA 1K51A 4WWMA 2C7NB 2K22A 4A3OA 3PHWB 1JWAD 4KIKB 4AQ7A 1SE3A 1TT5B 4TV3A 2L76A 5LNK1 2KDEB 1XT9B 1UD7A 3B2FA 1NDDA 3E9SA 3O13A 3RI7C 3A33B 1N6ZA 3WCQA 3HM3A 2QEJC 1J0GA 4ZRJA 2BPSA 3PRZA 3K9OB 3V61A 3KW5B 1XLQA 2KQ7A 1E7UA 4HPLB 4KDIC 1EWYC 3DHIC 1P98A 4KGRA 2MJ3A 1HA5A 3H9DA 2M56B 2AYOB 4Q2JA 1JWSD 2MBHA 3NVWA 1JRUA 3Q3FA 4K3BA 2ZNVC 3DBLB 1NYQA 3IVFA 4TUUA 4X57B 2C7MB 4LNNA 1L0VB 3W9CB 1E9MA 2FUHB 4AWJA 1C77A 3H1UA 4B9KA 4USAA 3K9PB 4HK2A 2D3CA 3R3MA 4RNAA 1WXMA 1IBXA 1RWSA 4DXGA 2SEBD 1WJUA 1FRDA 1C4AA 1HE8A 4ANXA 4JX1C 3JW0X 3DDCB 2VZKD 1OGWA 2XEWA 4KGTA 2XNAC 4RGTA 3AEBB 4MELA 1WZ3A 4GSWA 2MQJA 3ZDTA 4ZRQA 3X0WA 1V5OA 2KJRA 5JH5C 2EELA 3CSTA 3DVGX 3VH3B 1WSPA 3QQ8B 1TS5A 2L8JA 3AECB 4YWGG 1K52A 3ALBA 2DYMA 1WJ6A 2KFKB 4MH0E 3I9V1 2WXRA 5IOIA 3ZNZB 1ZDXA 2NBVB 2ONQA 2ZEQA 3TMPB 2NPTB 3AXCA 1E0ZA 2IO3B 1FM0D 1L7YA 2LWPA 1WRIA 2ZPNA 4GGQA 1E8ZA 1MPEA 1QOGA 3TCAA 1F52A 3BVZA 3MFGA 1FXIA 1N63A 2M8SA 1D6EC 3GE3C 2KVRA 1VR9A 4RF1A 2BS2B 4P1BC 2CKHB 5HFYA 1L0YB 3RZFA 2RGFA 3GE8C 4ZYNA 3L54A 3QARA 4M02A 4OVZA 3OAWA 1V80A 3ZRCA 4EOYA 2KDMA 2HDEA 2KACA 3RNFC 4WQOB 3TEXA 1KFYB 3QK0A 1AYFA 3EA6A 4JLCA 3TEZA 3HIZA 2MHJA 5HI1A 2FCSA 3KYCD 3DOWA 2K1FA 1FRRA 2VH1A 3A4RA 4KSLC 3ZIMA 1N5WA 1IGDA 1J7BA 1OQRA 3TSSA 2YEPF 3SFDB 3AE1B 4NQLB 3VUYA 4M8MA 3W1SA 1NBFC 3BINA 3KWVA 4OVVA 3DVNU 3AU4A 2ZZPB 3ZDMC 3LXFA 3RPFC 1K53A 3NY5A 1WMHB 3AEAB 2GBMA 1UBIA 3JSVA 2MP2B 3VQIA 5D7GA 1PUTA 2LD9A 1XO3A 2FUG1 3I63C 1M94A 2DZIA 3A9KA 4NJ6A 2N1VA 3PZDA 4PT5A 4XDDA 1WXVA 2WS3B 2JF5A 3AMZA 1KTKA 4IM2A 4DHJD 3ML8A 2V3NA 4WWNA 3ZW3A 1OEYJ 2N7JA 2AQ1B 2IO0B 1VJKA 1P9DU 1FNVA 3KH0A 2L0FA 4J6IA 2N7DA 3ZQ4A 5IN7A 4US9A 3N1XC 1FNWA 5HHDG 3HRDD 3FKYA 2JZPA 1A5RA 2ON8A 3C0RB 4LTUA 5C3JB 1TTNA 1XEEA 4MGZE 2PMVA 1SSNA 2DNFA 4OVUA 1N5XA 5IA7A 3RULA 4MGIE 5E6OA 3CIRB 1J19A 3J9CA 4FHKA 3CMMB 2KTRA 4N58A 3QWZB 5C2TB 2DYOA 3TBLD 1B9RA 1TYGB 3VH4B 3VTUA 3FILA 1K8RB 4F1SA 5EE9A 1P7EA 2LJIA 1FXAA 2BKRB 2WDQB 4KIKA 1KOTA 1EM7A 2N9XA 3U2SC 2MA9B 3NZ3A 1MG4A 1E6EB 2HJ1A 1IBXB 3AE7B 2MEKA 2JZ3B 3H6NA 4K7WA 2K6QA 5KHOA 1WGGA 1JWBD 1XF5L 4K1RB 3PRMB 1JMLA 1ZW7A 3EHVA 3IAM1 2HE7A 1E8YA 3P63A 3APDA 3P4PB 3VVWB 4LCDE 2G9HD 2HTME 2VZKB 3D32A 3BVMA 2ZW0A 4IG7B 3BWUD 4JWUC 1Q10A 1YIWA 5JHAA 2LRWA 1L6VA 1WZ0A 1JW9D 3TUOA 2KX0A 4CO7A 4GMVA 2FCMA 3HM6X 4E74A 2K39A 1KRHA 4A90A 1FD6A 2JQRB 1TZOA 2K6DB 1QOBA 2KANA 1YX5B 4C7ZA 2BTEA 5G55A 1GPXA 4JIOU 1P0RA 3N30A 2JU6X 3ZGZA 2KDBA 2YLMA 3HVZA 3O65B 3C8YA 2J52A 3B0AA 2D3AA 4RGNA 1WGKA 3TJPA 1GOZA 2FIFA 1V97A 3NUHB 3T9LA 4P6VF 4S0RA 5J18A 1VRAB 4FLHA 3SU8X 5FK9C 3I3TB 3ZTCA 3BK1A 3A9JA 4GXBA 2WXPA 4KSKC 3EGRA 1OQYA 3LDZE 3DBSA 3P1MA 2PIAA 3NJTA 5E6JA 3E56A 2NTSA 4LNFA 3SEBA 4C4VA 1SE9A 4TMAB 1NEKB 1XCTL 2KFKA 5TR5A 4FJYA 4W9EA 1AW7A 2KOXA 4NJCA 2JUOA 3MTNB 3N32A 3RFZB 4LLGM 4D2KA 5BMIA 2MSED 4KKIA 3JYUA 2NTTA 2DBYA 3RCZA 5GXGB 1GG3A 2IPKD 5J2RA 2K0PA 4HLEA 3V62A 1D5XC 3NG0A 3N20C 3RT3B 2JZZA 2DAFA 1N60A 1RFAA 2AL3A 1M4VA 1WJ4A 1UUPA 1SJED 3JSVB 4WIPA 4ZHPA 2BVCA 1GNUA 3JVZX 4MM3A 1S1QB 2MJEA 3LYYA 2SAKA 4DQOC 3HUIA 3A9KB 1IP9A 2ZJDA 2MLBA 2KX3A 1QZEA 4ANWA 1P3QU 1XLOA 3MJ5A 1ENFA 2ASQA 2V1YA 5C1ZA 3M3JA 2LZ6A 4IWOA 1ZE3D 1QOAA 1QKZA 2J53A 1TGZB 2CU3A 4QAYA 3RNBC 2K25A 1SXTA 4BBNC 2AX5A 2NMQA 2INNE 3ZJUA 4OW0A 4TSSA 4OHJA 3P2BA 1CQVA 4I6NB 2ZVOA 4M8NA 1OQQA 4MSQB 2M19A 3EUB2 1WYWB 2DENB 2KTRB 4DDGD 3ONSA 4W9IA 1I42A 2N4FA 2N9EB 4FULA 5G5GA 5DPTA 5BMHA 1NI2A 4WAFA 4KV2A 3SD5A 3Q69A 3FILB 1ZKHA 3IAS1 1BXTA 2WXLA 1OTRB 5LLIA 3RN9C 3RYTA 2D3BA 3WA0A 4K81A 1SJHD 4BOZB 5LXHA 3WALA 1WJNA 2JYTA 2WXNA 2FCNA 4XGAB 4A9AA 3VDZA 5MPOA 1XCQL 1WWTA 1C9FA 3L0WB 1CK1A 3VAWA 3VXWA 1WF9A 4YTPB 3SFEB 2FCQA 2QIEB 5HKHA 3KWLA 1C1YB 4MSMB 2LVQA 2OHFA 1JQ4A 2KK8A 2G4SA 4MJSA 4GDKA 1F0ZA 1YN3A 2KMAA 2KVZA 4GIVA 4RGOS 3V05A 4WAAA 5FR3A 2BYFA 3ZNID 1V5TA 3ZVVA 5AZGA 1TS4A 1F77A 3AB5A 3NS1A 2KQ4X 3U8ZA 4K7UA 1K50A 3W5VB 4OZBA 2JRHA 5EE0A 4FXCA 2INPE 4FJZA 4GOCA 2KO3A 3NZSA 4KVGB 1ZXIA 4ZHOA 3T8MA 1RAXA 2CU1A 2N0SB 1TY2A 2CS4A 3P4SB 2EMSA 2W3SA 3MHSD 2KN5A 4WH4A 2I1KA 1RYJA 1VLBA 3HVDA 1C76A 2IJ0A 4ZRPA 3EC8A 1IPGA 2WHIA 3ZXRA 1HEZE 5HG2A 2IGHA 2KN4A 3LB8C 2HJ8A 2NBUA 2EKEC 2J42A 3N3KB 2WQYB 4L2YA 4RCOA 4AJWA 4AS1A 2LI5A 3A9JB 4KZCA 3BYTB 1C3TA 2OEDA 2K9XA 2ZCBA 4ASWC 1WXQA 1ET9A 3DBLI 2MX2A 1UZXB 2JVCA 2E3TA 2DZJA 2FBWB 2KDFB 3QCAA 4LJOB 4A20A 1L2NA 1XXGA 4C4VB 2G45B 5CHFA 1V49A 4YTMB 2KLGA 1FCCC 5BMGA 3MC8A 2KXJA 2WLBA 1P1AA 1D3ZA 4F7ZA 4II2B 1F9JA 2VRRB 2GI9A 2W54A 3Q14C 4NJ7A 2Z59B 2KQSA 3U52E 4ANUA 4EEWA 2KLCA 2LEKA 4NY0A 4GDLA 1Q1OA 3KQ4A 4LNOA 1DOIA 1LM8B 4IW0A 1ROEA 4HEA1 2QILA 1I4RA 4MM3B 1QLBB 2IGDA 4B0EA 4F8CB 4W9CA 3APFA 1PFDA 1TKEA 3PTFC 1WGRA 1T5XD 5IO9A 1STEA 3RNCC 4XWTA 4W9KA 3Q3NC 2ACZB 3PV1A 2KKCA 2Q5WD 1LQBA 2ZVNA 4BKTA 3S2AA 4GLSC 1F2RI 2IO2B 5CX3A 1JCKB 2L05A 4XDCA 3W1SC 1WI0A 3IT4B 1GJZA 2H88B 2KJ6A 2WU5B 3T3NA 1V86A 2L1AA 1EUVB 4DXFA 2J0JA 2LGDA 2INCC 3M63B 3BIID 2CJNA 4JWSC 4H2AA 1QILA 1GUAB 1PGXA 1EU3A 2FAZA 3AN1A 4PYZA 1JALA 2KTFA 2YEPB 4HKZE 2N9KA 2WWZA 3MC9A 1D4BA 2Y3AA 3Q3MC 3KYDD 3NVZA 4OZAA 1Y8RC 1ISNA 3AEEB 5FR6A 1R4NB 3RUIB 3VFKA 2Y5CA 3AULA 2KWUB 1AWDA 1ZOYB 4AUQC 1ZUD2 3Q8FA 3R7RA 5BYQA 1P7FA 1KJTA 4MDKE 2C60A 2W3RA 2A5UA 3I57A 1ACCA 3MP9A 1QF6A 1GAQB 2I2YA 4IWPA 4NZLB 3Q3OC 3AEGB 1YQBA 1FXTB 4M0WA 1YQ3B 3M95A 4PK1A 5C23A 1MVKA 4N59A 4W9GA 2DWQA 5H92C 1EF5A 3ZJVA 4AOFA 2WXFA 2L7RA 2D10A 2FE8A 1WE6A 4YSYB 4MJSB 4WQMA 4GDKB 4DBGA 3Q8BA 1WRDB 3VTWA 1T3QA 1R4NI 5D6JB 2GBKA 2BS4B 5BYSA 1TZ1A 3DBRB 2UWQA 2CHZA 3B1LX 1N61A 1SIFA 1R4MB 2LGYA 4ZOHC 2V0GA 1D5ZC 3NVYA 3OG5A 1KH0A 4IC7B 4KZ0A 3UF8A 2KC2A 3RNAC 2WDTB 4M01A 2J0MA 4HWIB 2DZMA 2CR5A 4C80A 2KD0A 4GU2A 1ZXHA 3B2GA 2GRIA 1EWCA 2PTLA 2BW2A 3P4QB 4JGHB 4G11A 1FPYA 4A8XC 2C7HA 3WIMA 3R8BA 4WJOA 1LO5D 1QQRA 3WAOA 4RMAA 3H8HA 2QJLA 4AP4C 4ITKA 3DBRI 1V8CA 5L83A 4ARCA 2O6VD 4O1NA 1R4MI 1YQ4B 1KLGD 2PVOD 2O6VA 2OJRA 2O2VA 2Y5BB 3CF6E 2AQ3B 3H7PB 3AE2B 2WX1A 1YMHE 1GC6A 1WFYA 2R2OA 3BY4B 1GB4A 1UF0A 4GN1A 2GBNA 4IUMB 3L13A 4OZCA 1DYQA 2V4IB 3NHEB 3DCGA 1WH3A 1WR6E 1ZDVA 4GDLB 2KFJA 2XBBC 2QHOA 3UGBB 1OFFA 2C5LC 2KWDA 1T0QC 2K8BA 3PZ8A 5LXIB 1L0XB 2VH2A 2BYVE 3PLVA 3PO0A 4S17A 3EFCA 3GS2A 4EFOA 2RR9A 3DWMA 3AE5B 4RM8A 4BZAA 4EZLA 1C79A 1TS2A 3U30A 2BYEA 2XN9C 3AV8A 2YVCA 3NS8A 5BO4B 2MH7A 4KX6B 2IGGA 4XC2A 3B9JA 1MI0A 2KT7A 4BVUC 1I4HA 2JXXA 2AEHA 3Q2AC 1CJEA 2KZRA 2CHWA 4AJYB 1L6UA 2BF8B 1V2YA 2CJOA 3AE6B 4WJPA 4DXAB 2L32A 2MBOA 4MACA 4IKGA 4YXDB 1AARA 4MT5A 1NENB 1F2RC 1YN5A 1RM6C 4C00A 1HZ5A 2NVUI 1MHXA 1VCBA 2NBWB 1UWMA 3ZUNA 2JT4B 4A6QA 4DDID 4FHJA 2BGFA 1V6EA 1YOVB 3Q6BA 2PE9A 3V6CB 4KGSA 4IOIE 2KHWB 2BWFA 4MH8A 3WAPA 1RRBA 3PLUA 2IBIB 3ZTDA 5KHQA 2LASA 2FNJB 1E5WA 2I1JA 2E6XA 3UQAA 2LJ5A 2PVGC 2BB5A 4PS3A 3I5JC 1FEHA 2NCNA 3U4EG 1J7CA 4L1BA 2LFIA 3PZ7A 4ZRIA 4BKGA 1JROA 4M0WB 3R7QA 4FBJB 2V4LA 1TIFA 1V1OA 5H8YE 3ECIA 1FIQA 1T0RC 2MCNB 1ET6A 5E6PA 1WR1A 4B0MA 2RDGA 2K8HA 3P4RB 4K3CA 5D3DA 3BK2A 4BFRA 5T8IA 3AU5A 2K3UA 4TQ0A 3DWGC 4RFBA 4URKA 3QA8A 2WP9B 4YSXB 4NPNA 2KJHB 4FJVB 4RF0A 3CSFA 2G4DB 3FC4A 1PDXA 3MC0B 1CZPA 2X8XX 1IUEA 1LGRA 3U7ZA 4WJNA 2M1MA 3HHMA 5JZEB 3IXSA 1X1MA 2QMTA 1UGMA 2AL6A 4XZ4A 2IY1B 2RD0A 2RDHA 2C9WB 3PSEB 4ZRKA 3DQVA 1PGAA 4II3B 4LDTB 3KLSX 4EUTA 3IFWB 1WGYA 2DX5B 1WY8A 2PPHA 3R2IA 4LK0M 2WU2B 2RMMA 2GB1A 4US8A 3SDLC 4LJPB 2GBJA 3QIJA 2D3GA 2KMMA 4R3DA 1E10A 2O6VB 2O2VB 2MW5A 3BVGA 4B95A 1QOFA 2KC1A 3IBEA 4HVBA 2WXJA 4N9F4 1EO6A 3KUZA 2XK5A 1WIAA 2BS3B 2V9HA 4FADA 4K7SA 4XYCA 3CWIA 1KF6B 1J7AA 2EKIA 4G50A 1UBQA 1V1PB 2PJHA 2LGIA 3RZWC 1UGJA 1EU4A 3DVGY 3ZYYX 1Q0WB 2MBEA 4KDLB 1WX9A 1ZPSA 3PVLA 2JYEA 3T3OA 4W9LA 4DHZB 2N9PC 1MJDA 2ZPYA 1RFKA 4RM9A 4W9JA 2L3ZA 1D5MC 2WYQA 3W2DA 4IM3A 4HXDA 5J17A 3A4SC 4P7IA 2JRIB 2K5PA 1HTQA 3L08A 3ZNHB 1UH6A 2BBCA 1PGBA 2GMIC 1XQQA 3RMKC 2BKFA 4PS7A 3QHTA 2R61A 3AE8B 4HRSA 1PYWD 2BB6A 2L00B 2X38A 4BKSD 4NAMA 2LMCA 2ICIA 1I4GA 3ZLZA 4BKSA 3H7PA 3V60A 3VR8B 3H7SA 4HJKA 3ZXVA 3KUCB 3UIPB 4BOSC 4J3OD 3DVNV 3N1ZC 4E71A 1C78A 2PW9A 2W55A 3KVFB 5I4DA 2AQ2B 1I4XA 5IP4D 5BYRA 2JSVX 4I6LB 2R2QA 2BQQA 4IWQA 1SE2A 4PYUA 3AEFB 4G3XB 4HROA 5D3IB 4HCPB 4JE3B 4HJGE 2MRPA 3Q3JA 3WAMA 4EKUA 3VRAB 3IHPC 3GP7A 4YSZB 4KKJA 4EZJA 2D11A 3V6EB 2KNBA 1I4QA 3IG3A 2CHXA 1VDVA 1JWMD 2INDC 1EF1A 2N7EA 3EFUA 2NS5A 3NOBA 1GC7A 3AH7A 2KAJA 4LNKA 1WM2A 3U7DA 4B6WA 1GB1A 2L83A 4FN2A 3SR6A 5AZHA 1I35A 1VD2A 1UWXA 4GB9A 5EE1A 1MFWA 5DCNA 2I38A 1WXAA 1E7VA 5JHBA 3NZUA 4TKNA 3DBHB 2REXA 3UI3A 3DPDA 2LUEA 2M17A 2WDRB 2J7QB 4WWOA 2LGSA 1MHHE 3APCA 1WM3A 1SEBD 2WXGA 3M62B 4W9DA 2N1WA 2PLPA 1WX8A 3AEDB 4A55A 2W82A 4YT0B 1T6BX 4BBNF 1G6JA 2B3AA 1HTOA 2D07B 2FIDA 3QJZA 4ANVA 3TEYA 3NRZA 3AE9B 4XWWA 1L4DB 3P42A 2WXMA 2MBBB 3WANA 2LHDA 3TIXA 4CQNA 2L0TA 1VZ8A 3A1QA 1I7HA 3R2TA 3OJ4B 4MGYE 1PQSA 1FFUA 4JQWC 2LRUA 3DBHI 1WGHA 4WWPA 2IY0B 2IYDB 2B76B 3ZRFA 3UQBA 3UINB 5AEKB 2G1EA 5DPWA 2GLSA 4NQKE 2DHZA 4DWFA 4ARIA 3VTVA 2LGXA 1HZ6A 1VZ6A 4NNJB 2N9LA 3GB1A 1RLFA 2MBQA 3ENEA 5AUKA 3RD2A 4JL9A 2OJWA 3N1YC 1Q5WB 3GZNB 3ZNGC 2Z0EB 3FAHA 2KWVB 3L4PA 4CHKA 2DYBA 1WYGA 2WXHA 3ETRA 2JWUA 2V3PA 4E3CA 1Z5SB 4DK5A 2D5GA 1H4RA 1SB3C 2BT6A 5FKAC 3MJWA 2EMTA 2XK5B 1UNSA 2K8CA 1L4ZB 3VHTC 2RDBC 1S3SG 2WGSA 3AI5A 5DPSA 2LXCA 4W9HA 1L5PA 4YL8A 3NVVA 5EDSA 5CTRC 3IT6B 2IO1B 4HKQA 4NAWA 2GBRA 2A4ZA 1CMXB 1ZP0B 2WXIA 4HPPA 3GZNI 1B1ZA 1IGCA 4LDTD 2JX5A 1KLVA 2RPVA 2ZNVB 3QC8B 1U4AA 2M4NA 2G3QB 3UIOB 4CYEA 1H8CA 1BT0A 1WXSA 3Q8EA 1YN4A 2WDVB 4ICUA 2TSSA 2LUMA 2M0AA 4L23A 1KM7A 2IZVB 1WE7A 3ABVB 3OLMD 1AN8A 5G2NA 1NVID 4XE0A 4HDOA 3DHHC 1YX6B 1E8XA 5IKCM 2BYTA 1E7PB 3VR9B 3PPAA 4ZYSA 3MHZA 3RNEC 1XLNA 5G5HA 1LXDA 1YNTE 4HPMB 1V1PA 2JY6A 1BUIC 4XX5A 4IM0A 1V81A 4BAXA 1SGHA 1LFDA 3VUXA 2V3SA 4A3PA 3ZJTA 5D2MB 2HTHA 2Z0DB 1C4CA 4ZDVA 4REZA 1FNUA 2RPQA 4YTNB 4TQ1A 1FMAD 5CHWA 1E90A 1TKYA 4HCNB 1ESFA 1VZ7A 3VUWA 2J4XA 1SF0A 5JXVA 3PREA 5DPRA 1FO4A 3L10B 1YJJA 2ZW1A 3PS6A 4FA6A 1FCLA 1T0SC 4UDUC 1TBEA 2QSDA 2KWCA 2GOWA 2ZCCA 4WURA 2LHEA
chains in the Genus database with same CATH topology
1XEEA 2LEKA 1SSNA 2PMVA 3KLSX 5EE3A 1NYRA 1N5XA 1TY0A 3KQ4A 3BYYB 1DOIA 1ROEA 1DGJA 4N6EB 4HEA1 3R2IA 4LK0M 1QT9A 2QILA 1I4RA 3CIRB 4MM3B 3J9CA 3AE3B 1QLBB 2IGDA 4B0EA 1SBBB 2WU2B 3TEWA 2RMMA 1JWUD 4N58A 1PFDA 1I4PA 2GB1A 1TKEA 5C2TB 2DYOA 3OWEB 1TS3A 4US8A 1T5XD 4C7YA 1B9RA 2KMMA 4R3DA 1TJEA 1E10A 1STEA 1TYGB 2WXQA 4XWTA 3BVGA 3FILA 5EE9A 1QOFA 1P7EA 2WXJA 2LJIA 2ACZB 1FXAA 2WDQB 2BS3B 2Q5WD 1EM7A 3U2SC 2H89B 3NZ3A 3CWIA 1E6EB 4GLSC 3V3XA 1F2RI 1IBXB 1KF6B 1J7AA 2EKIA 3AE7B 2MEKA 1V1PB 1KLUD 1JCKB 2LGIA 1UGJA 1EU4A 1JWBD 4XDCA 1N62A 1XF5L 3ZYYX 1A70A 3IT4B 1JMLA 3IAM1 1ZPSA 2H88B 2WU5B 2JYEA 3T3NA 3T3OA 2L1AA 4DXFA 1SIJA 3N9YC 3P63A 3P4PB 2JXTA 2WXOA 5C3JB 2G9HD 2HTME 2VZKB 2L52A 2PKOA 3BIID 2CJNA 3BVMA 4JWSC 2ZW0A 1Y56A 4H2AA 1RFKA 4RH6A 5AUIA 3BWUD 1QILA 2WNMA 4JWUC 1D5MC 1PGXA 1EU3A 1Q10A 2WXKA 3W2DA 3AN1A 1JALA 4C56C 1L6VA 2YEPB 4HKZE 1JW9D 2N9KA 2K5PA 3TUOA 2Y5PA 4IDIA 4EE2A 1D4BA 3VRBB 2Y3AA 3URYA 1KRHA 3NVZA 2BBCA 4OZAA 1PGBA 1DOYA 1HXYD 4A90A 1FD6A 3AEEB 2JQRB 1TZOA 1JRPA 2Y5CA 2MJDA 1AWDA 1ZOYB 1ZUD2 3Q8CA 3Q8FA 1QOBA 5BYQA 2R61A 1P7FA 1BMLC 3AE8B 4C7ZA 1TKGA 2W3RA 4HRSA 1C4PA 1NI3A 3I57A 1PYWD 2BB6A 2X38A 2BTEA 1GPXA 4NAMA 4RGMA 1ACCA 2LMCA 3MP9A 1QF6A 1GAQB 4JPSA 2I2YA 4NZLB 2ICIA 1I4GA 2JU6X 3ZGZA 2IDYA 2Z8LA 3VR8B 3W5UB 3AEGB 1DOXA 5TSSA 1R7SA 1XLPA 3HVZA 1FFVA 3C8YA 4J3OD 2J52A 4M0WA 1YQ3B 1C78A 3AM9A 1MVKA 4N59A 1WGKA 2PW9A 2W55A 4NAWB 4RGNA 2DWQA 5I4DA 2AQ2B 5H92C 1I4XA 4P16A 3ZJVA 5BYRA 1GOZA 2WXFA 2JSVX 1HQRD 1V97A 3NUHB 4P6VF 1VRAB 2FE8A 1SE2A 5FK9C 2DLBA 3BK1A 4YSYB 4WQMA 4GDKB 1YJIA 3Q8BA 3Q8AA 1SE4A 3AEFB 4HROA 5D3IB 2WXPA 1T3QA 4JE3B 4HJGE 3EGRA 3VRAB 3BZDB 2BS4B 3GP7A 3AE4B 5BYSA 4YSZB 1K51A 4WWMA 4KKJA 2K22A 1JWAD 3P1MA 2PIAA 5E6JA 1I4QA 3E56A 2NTSA 4AQ7A 1SE3A 1VDVA 1JWMD 1N61A 3SEBA 4TMAB 5LNK1 1NEKB 1XCTL 3B2FA 4ZOHC 3E9SA 3O13A 2V0GA 1D5ZC 1AW7A 3NVYA 1KH0A 3AH7A 2KAJA 4NJCA 3WCQA 3RFZB 2QEJC 4LLGM 4D2KA 5BMIA 1GB1A 2L83A 4KKIA 3SR6A 4C80A 2NTTA 2DBYA 5GXGB 1ZXHA 3B2GA 1UWXA 2GRIA 2IPKD 1XLQA 5EE1A 2K0PA 1EWCA 2PTLA 2BW2A 2I38A 1D5XC 3P4QB 4A8XC 1EWYC 3R8BA 4KGRA 1N60A 3UI3A 2MJ3A 1HA5A 1M4VA 1LO5D 1UUPA 2M56B 2WDRB 1SJED 1QQRA 4Q2JA 4WIPA 1JWSD 4ZHPA 1MHHE 3H8HA 3NVWA 1SEBD 2WXGA 2QJLA 2PLPA 4ITKA 2MJEA 1V8CA 1NYQA 3AEDB 2SAKA 3LYYA 4A55A 4DQOC 2W82A 4ARCA 3HUIA 4O1NA 1YQ4B 4YT0B 1KLGD 1T6BX 2PVOD 1L0VB 3W9CB 3TEYA 1E9MA 3NRZA 2AQ3B 3AE9B 4XWWA 1C77A 1L4DB 3P42A 2WXMA 4USAA 1XLOA 3MJ5A 1ENFA 3AE2B 2LHDA 4CQNA 4RNAA 1YMHE 1VZ8A 1IBXA 1I7HA 1RWSA 3R2TA 1ZE3D 1QOAA 4DXGA 1QKZA 2J53A 2SEBD 1GB4A 2CU3A 1FRDA 1FFUA 1C4AA 1SXTA 4JX1C 2AX5A 4OZCA 1DYQA 2B76B 2VZKD 2NMQA 2INNE 2V4IB 2G1EA 2XNAC 4KGTA 4RGTA 4OW0A 3ZJUA 4TSSA 3AEBB 4ARIA 4OHJA 1ZDVA 4GDLB 4ZRQA 1HZ6A 1VZ6A 1OFFA 1CQVA 2KWDA 2N9LA 3GB1A 1OQQA 5AUKA 3PZ8A 2EELA 2M19A 1L0XB 3EUB2 3PO0A 1WSPA 3FAHA 1TS5A 3AECB 4YWGG 1K52A 3GS2A 3L4PA 5G5GA 2DYMA 3DWMA 3I9V1 5BMHA 2WXRA 3AE5B 1ZDXA 1WYGA 2WXHA 3ETRA 2ONQA 1C79A 1TS2A 4WAFA 3Q69A 2JWUA 1E0ZA 2V3PA 3FILB 2XN9C 3AV8A 1FM0D 2D5GA 3IAS1 1WRIA 1BXTA 1SB3C 2BT6A 2MH7A 4KX6B 5FKAC 2WXLA 2IGGA 1UNSA 1L4ZB 1MPEA 3B9JA 1MI0A 1I4HA 1QOGA 1CJEA 3BVZA 1L5PA 1SJHD 3MFGA 1FXIA 1L6UA 1N63A 2CJOA 1D6EC 3AE6B 2JYTA 2L32A 2WXNA 3NVVA 4MACA 1VR9A 4IKGA 4YXDB 4MT5A 4RF1A 1NENB 2BS2B 1F2RC 4A9AA 5MPOA 3IT6B 1YN5A 1XCQL 4HKQA 1RM6C 5HFYA 1WWTA 1C9FA 1L0YB 1CK1A 1HZ5A 4YTPB 1MHXA 3SFEB 2QIEB 1ZP0B 2WXIA 3KWLA 4OVZA 1UWMA 1B1ZA 1IGCA 2OHFA 1JQ4A 2JX5A 2KDMA 2HDEA 2KACA 1F0ZA 1YN3A 4A6QA 2RPVA 3TEXA 1KFYB 1AYFA 3EA6A 4RGOS 3V05A 3TEZA 4KGSA 4IOIE 5FR3A 3Q8EA 5HI1A 1TS4A 1YN4A 1F77A 2WDVB 3AB5A 3NS1A 2KQ4X 2TSSA 4MH8A 2LUMA 1K50A 2M0AA 3W5VB 4OZBA 1FRRA 4L23A 3ABVB 1AN8A 1NVID 5EE0A 4XE0A 4FXCA 2INPE 1N5WA 2E6XA 1IGDA 1J7BA 1OQRA 2PVGC 3TSSA 1ZXIA 2BB5A 2YEPF 3SFDB 3AE1B 1FEHA 3U4EG 1E7PB 4ZHOA 2BYTA 1J7CA 2N0SB 4L1BA 1TY2A 2LFIA 3W1SA 3KWVA 3VR9B 3P4SB 3PZ7A 4ZYSA 3MHZA 2W3SA 4WH4A 1JROA 1XLNA 5G5HA 1RYJA 1VLBA 3HVDA 1YNTE 1C76A 2IJ0A 1V1PA 1V1OA 3LXFA 1BUIC 4ZRPA 3RPFC 5H8YE 1K53A 1HEZE 1FIQA 5HG2A 3AEAB 2IGHA 2KN4A 3LB8C 1ET6A 2J42A 2WQYB 4L2YA 4RCOA 4AS1A 4B0MA 2RDGA 3P4RB 3BYTB 5D3DA 3VQIA 3BK2A 2OEDA 5D7GA 1PUTA 2K9XA 5T8IA 2K3UA 1XO3A 3ZJTA 4TQ0A 1WXQA 2FUG1 3DWGC 4RFBA 1ET9A 1C4CA 4PT5A 2E3TA 4REZA 2FBWB 2WP9B 1FNUA 4YTNB 4XDDA 4TQ1A 1FMAD 2WS3B 4YSXB 1TKYA 1XXGA 1ESFA 3AMZA 1KTKA 4RF0A 1VZ7A 2V3NA 3FC4A 2J4XA 1SF0A 1PDXA 3MC0B 1CZPA 4YTMB 5JXVA 2N7JA 2AQ1B 1IUEA 1VJKA 1FO4A 1YJJA 3U7ZA 2ZW1A 1FCCC 1FNVA 5BMGA 2WLBA 3ZQ4A 4US9A 1FCLA 2GI9A 3IXSA 1FNWA 2W54A 4UDUC 2QMTA 3U52E 2QSDA 5HHDG 3HRDD 2RDHA 2JZPA 2ON8A 4LTUA 4WURA 2LHEA 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGS A;  2J52 A;  4IOI E;  5HI1 A;  2LHD A;  1MVK A;  2KQ4 X;  1YMH E;  2PW9 A;  1IBX A;  2JU6 X;  2LUM A;  1K50 A;  1QKZ A;  2IGD A;  2J53 A;  4OZB A;  2RMM A;  1GB4 A;  2JSV X;  2GB1 A;  4OZC A;  1IGD A;  2NMQ A;  4KGT A;  3FIL A;  4HJG E;  1P7E A;  1HZ6 A;  1K51 A;  4WH4 A;  2KWD A;  1EM7 A;  3GB1 A;  2N9L A;  1YNT E;  4GLS C;  3V3X A;  1F2R I;  1IBX B;  2EEL A;  1K53 A;  1HEZ E;  2LGI A;  5HG2 A;  2IGH A;  2KN4 A;  1XCT L;  1XF5 L;  1K52 A;  1JML A;  5BMH A;  1KH0 A;  2ONQ A;  2OED A;  5BMI A;  4D2K A;  2JWU A;  3FIL B;  1GB1 A;  2JXT A;  2IGG A;  1ZXH A;  2ZW0 A;  1UWX A;  1MPE A;  1MI0 A;  2K0P A;  1Q10 A;  1PGX A;  2PTL A;  2I38 A;  4HKZ E;  2N9K A;  4KGR A;  3UI3 A;  4MAC A;  1D4B A;  4IKG A;  4OZA A;  1PGB A;  5JXV A;  2N7J A;  1MHH E;  1F2R C;  1FD6 A;  1XCQ L;  5HFY A;  1C9F A;  2ZW1 A;  1FCC C;  5BMG A;  1HZ5 A;  2PLP A;  1MHX A;  1P7F A;  1FCL A;  2GI9 A;  2QMT A;  1IGC A;  2QSD A;  2KDM A;  5HHD G;  2KAC A;  3MP9 A;  2JZP A;  2I2Y A;  2ON8 A;  2RPV A;  2LHE A;  1PGA A; 
#chains in the Genus database with same CATH topology
 3DHG C;  2HD5 B;  5EE3 A;  1NYR A;  3B08 A;  3L17 A;  1TY0 A;  1MG8 A;  4EZK A;  3BYY B;  2QCZ A;  1DGJ A;  4N6E B;  5CHV C;  1QT9 A;  3OJ3 A;  4ICV A;  3AE3 B;  1ZGU B;  4DHZ E;  1SBB B;  3TEW A;  1JWU D;  5GMV A;  1I4P A;  2RSU A;  3ZO5 B;  4G0N B;  4HDQ A;  2J0K A;  3OWE B;  1TS3 A;  4C7Y A;  1TJE A;  3LJ3 A;  3RNG C;  2WXQ A;  2NPT A;  3ZKJ C;  3KUD B;  2PEA A;  4ACF A;  3PT2 B;  2H89 B;  3C19 A;  1XD3 B;  2OOB B;  2QDF A;  3A1Q B;  3V3X A;  5AZF A;  4LNI A;  1KLU D;  1Z2M A;  1N62 A;  1WGD A;  3HK0 A;  1A70 A;  3PHX B;  3X23 A;  1YJ1 A;  1SIJ A;  1UEL A;  3N9Y C;  2BWE S;  5IAA C;  2JXT A;  2WXO A;  2QC8 A;  2AWT A;  2L52 A;  2PKO A;  3PRP B;  1T0Y A;  1Y56 A;  4RH6 A;  1F1H A;  5AUI A;  2WNM A;  1WX7 A;  2WXK A;  4W9F A;  1V9J A;  4P1C C;  4C56 C;  1J8C A;  5E6N A;  2Y5P A;  4IDI A;  4EE2 A;  2KDI A;  3GOE A;  3VRB B;  3URY A;  2MWS B;  1DOY A;  1HXY D;  2KMC A;  3QX1 A;  1OEY A;  4DHJ B;  1JRP A;  2JWZ A;  4M00 A;  2MJD A;  3Q8C A;  2JPH A;  1BML C;  3SHQ A;  1TKG A;  1C4P A;  1NI3 A;  2DAJ A;  2M0X A;  1IYF A;  2LXA A;  2UYZ B;  4RGM A;  4JPS A;  2IDY A;  2Z8L A;  3TL5 A;  2WX0 A;  4MGK E;  3W5U B;  1DOX A;  5TSS A;  2NR2 A;  1R7S A;  1XLP A;  1FFV A;  2W9N A;  2KYW A;  3EEC A;  5D94 A;  2DZK A;  3R66 C;  4MEM A;  4PS8 A;  2D2Q A;  2LVO A;  3AM9 A;  4I6P A;  4NAW B;  3W1Y A;  5L95 C;  2PE6 B;  3L16 A;  4P16 A;  1WMH A;  1HQR D;  3ML9 A;  3PGE A;  2DLB A;  2MP2 A;  1YJI A;  3Q8A A;  1SE4 A;  1YD8 U;  4WJQ A;  3QAQ A;  3BZD B;  2UU7 A;  3AE4 B;  1E8W A;  2LVP A;  1K51 A;  4WWM A;  2C7N B;  2K22 A;  4A3O A;  3PHW B;  1JWA D;  4KIK B;  4AQ7 A;  1SE3 A;  1TT5 B;  4TV3 A;  2L76 A;  5LNK 1;  2KDE B;  1XT9 B;  1UD7 A;  3B2F A;  1NDD A;  3E9S A;  3O13 A;  3RI7 C;  3A33 B;  1N6Z A;  3WCQ A;  3HM3 A;  2QEJ C;  1J0G A;  4ZRJ A;  2BPS A;  3PRZ A;  3K9O B;  3V61 A;  3KW5 B;  1XLQ A;  2KQ7 A;  1E7U A;  4HPL B;  4KDI C;  1EWY C;  3DHI C;  1P98 A;  4KGR A;  2MJ3 A;  1HA5 A;  3H9D A;  2M56 B;  2AYO B;  4Q2J A;  1JWS D;  2MBH A;  3NVW A;  1JRU A;  3Q3F A;  4K3B A;  2ZNV C;  3DBL B;  1NYQ A;  3IVF A;  4TUU A;  4X57 B;  2C7M B;  4LNN A;  1L0V B;  3W9C B;  1E9M A;  2FUH B;  4AWJ A;  1C77 A;  3H1U A;  4B9K A;  4USA A;  3K9P B;  4HK2 A;  2D3C A;  3R3M A;  4RNA A;  1WXM A;  1IBX A;  1RWS A;  4DXG A;  2SEB D;  1WJU A;  1FRD A;  1C4A A;  1HE8 A;  4ANX A;  4JX1 C;  3JW0 X;  3DDC B;  2VZK D;  1OGW A;  2XEW A;  4KGT A;  2XNA C;  4RGT A;  3AEB B;  4MEL A;  1WZ3 A;  4GSW A;  2MQJ A;  3ZDT A;  4ZRQ A;  3X0W A;  1V5O A;  2KJR A;  5JH5 C;  2EEL A;  3CST A;  3DVG X;  3VH3 B;  1WSP A;  3QQ8 B;  1TS5 A;  2L8J A;  3AEC B;  4YWG G;  1K52 A;  3ALB A;  2DYM A;  1WJ6 A;  2KFK B;  4MH0 E;  3I9V 1;  2WXR A;  5IOI A;  3ZNZ B;  1ZDX A;  2NBV B;  2ONQ A;  2ZEQ A;  3TMP B;  2NPT B;  3AXC A;  1E0Z A;  2IO3 B;  1FM0 D;  1L7Y A;  2LWP A;  1WRI A;  2ZPN A;  4GGQ A;  1E8Z A;  1MPE A;  1QOG A;  3TCA A;  1F52 A;  3BVZ A;  3MFG A;  1FXI A;  1N63 A;  2M8S A;  1D6E C;  3GE3 C;  2KVR A;  1VR9 A;  4RF1 A;  2BS2 B;  4P1B C;  2CKH B;  5HFY A;  1L0Y B;  3RZF A;  2RGF A;  3GE8 C;  4ZYN A;  3L54 A;  3QAR A;  4M02 A;  4OVZ A;  3OAW A;  1V80 A;  3ZRC A;  4EOY A;  2KDM A;  2HDE A;  2KAC A;  3RNF C;  4WQO B;  3TEX A;  1KFY B;  3QK0 A;  1AYF A;  3EA6 A;  4JLC A;  3TEZ A;  3HIZ A;  2MHJ A;  5HI1 A;  2FCS A;  3KYC D;  3DOW A;  2K1F A;  1FRR A;  2VH1 A;  3A4R A;  4KSL C;  3ZIM A;  1N5W A;  1IGD A;  1J7B A;  1OQR A;  3TSS A;  2YEP F;  3SFD B;  3AE1 B;  4NQL B;  3VUY A;  4M8M A;  3W1S A;  1NBF C;  3BIN A;  3KWV A;  4OVV A;  3DVN U;  3AU4 A;  2ZZP B;  3ZDM C;  3LXF A;  3RPF C;  1K53 A;  3NY5 A;  1WMH B;  3AEA B;  2GBM A;  1UBI A;  3JSV A;  2MP2 B;  3VQI A;  5D7G A;  1PUT A;  2LD9 A;  1XO3 A;  2FUG 1;  3I63 C;  1M94 A;  2DZI A;  3A9K A;  4NJ6 A;  2N1V A;  3PZD A;  4PT5 A;  4XDD A;  1WXV A;  2WS3 B;  2JF5 A;  3AMZ A;  1KTK A;  4IM2 A;  4DHJ D;  3ML8 A;  2V3N A;  4WWN A;  3ZW3 A;  1OEY J;  2N7J A;  2AQ1 B;  2IO0 B;  1VJK A;  1P9D U;  1FNV A;  3KH0 A;  2L0F A;  4J6I A;  2N7D A;  3ZQ4 A;  5IN7 A;  4US9 A;  3N1X C;  1FNW A;  5HHD G;  3HRD D;  3FKY A;  2JZP A;  1A5R A;  2ON8 A;  3C0R B;  4LTU A;  5C3J B;  1TTN A;  1XEE A;  4MGZ E;  2PMV A;  1SSN A;  2DNF A;  4OVU A;  1N5X A;  5IA7 A;  3RUL A;  4MGI E;  5E6O A;  3CIR B;  1J19 A;  3J9C A;  4FHK A;  3CMM B;  2KTR A;  4N58 A;  3QWZ B;  5C2T B;  2DYO A;  3TBL D;  1B9R A;  1TYG B;  3VH4 B;  3VTU A;  3FIL A;  1K8R B;  4F1S A;  5EE9 A;  1P7E A;  2LJI A;  1FXA A;  2BKR B;  2WDQ B;  4KIK A;  1KOT A;  1EM7 A;  2N9X A;  3U2S C;  2MA9 B;  3NZ3 A;  1MG4 A;  1E6E B;  2HJ1 A;  1IBX B;  3AE7 B;  2MEK A;  2JZ3 B;  3H6N A;  4K7W A;  2K6Q A;  5KHO A;  1WGG A;  1JWB D;  1XF5 L;  4K1R B;  3PRM B;  1JML A;  1ZW7 A;  3EHV A;  3IAM 1;  2HE7 A;  1E8Y A;  3P63 A;  3APD A;  3P4P B;  3VVW B;  4LCD E;  2G9H D;  2HTM E;  2VZK B;  3D32 A;  3BVM A;  2ZW0 A;  4IG7 B;  3BWU D;  4JWU C;  1Q10 A;  1YIW A;  5JHA A;  2LRW A;  1L6V A;  1WZ0 A;  1JW9 D;  3TUO A;  2KX0 A;  4CO7 A;  4GMV A;  2FCM A;  3HM6 X;  4E74 A;  2K39 A;  1KRH A;  4A90 A;  1FD6 A;  2JQR B;  1TZO A;  2K6D B;  1QOB A;  2KAN A;  1YX5 B;  4C7Z A;  2BTE A;  5G55 A;  1GPX A;  4JIO U;  1P0R A;  3N30 A;  2JU6 X;  3ZGZ A;  2KDB A;  2YLM A;  3HVZ A;  3O65 B;  3C8Y A;  2J52 A;  3B0A A;  2D3A A;  4RGN A;  1WGK A;  3TJP A;  1GOZ A;  2FIF A;  1V97 A;  3NUH B;  3T9L A;  4P6V F;  4S0R A;  5J18 A;  1VRA B;  4FLH A;  3SU8 X;  5FK9 C;  3I3T B;  3ZTC A;  3BK1 A;  3A9J A;  4GXB A;  2WXP A;  4KSK C;  3EGR A;  1OQY A;  3LDZ E;  3DBS A;  3P1M A;  2PIA A;  3NJT A;  5E6J A;  3E56 A;  2NTS A;  4LNF A;  3SEB A;  4C4V A;  1SE9 A;  4TMA B;  1NEK B;  1XCT L;  2KFK A;  5TR5 A;  4FJY A;  4W9E A;  1AW7 A;  2KOX A;  4NJC A;  2JUO A;  3MTN B;  3N32 A;  3RFZ B;  4LLG M;  4D2K A;  5BMI A;  2MSE D;  4KKI A;  3JYU A;  2NTT A;  2DBY A;  3RCZ A;  5GXG B;  1GG3 A;  2IPK D;  5J2R A;  2K0P A;  4HLE A;  3V62 A;  1D5X C;  3NG0 A;  3N20 C;  3RT3 B;  2JZZ A;  2DAF A;  1N60 A;  1RFA A;  2AL3 A;  1M4V A;  1WJ4 A;  1UUP A;  1SJE D;  3JSV B;  4WIP A;  4ZHP A;  2BVC A;  1GNU A;  3JVZ X;  4MM3 A;  1S1Q B;  2MJE A;  3LYY A;  2SAK A;  4DQO C;  3HUI A;  3A9K B;  1IP9 A;  2ZJD A;  2MLB A;  2KX3 A;  1QZE A;  4ANW A;  1P3Q U;  1XLO A;  3MJ5 A;  1ENF A;  2ASQ A;  2V1Y A;  5C1Z A;  3M3J A;  2LZ6 A;  4IWO A;  1ZE3 D;  1QOA A;  1QKZ A;  2J53 A;  1TGZ B;  2CU3 A;  4QAY A;  3RNB C;  2K25 A;  1SXT A;  4BBN C;  2AX5 A;  2NMQ A;  2INN E;  3ZJU A;  4OW0 A;  4TSS A;  4OHJ A;  3P2B A;  1CQV A;  4I6N B;  2ZVO A;  4M8N A;  1OQQ A;  4MSQ B;  2M19 A;  3EUB 2;  1WYW B;  2DEN B;  2KTR B;  4DDG D;  3ONS A;  4W9I A;  1I42 A;  2N4F A;  2N9E B;  4FUL A;  5G5G A;  5DPT A;  5BMH A;  1NI2 A;  4WAF A;  4KV2 A;  3SD5 A;  3Q69 A;  3FIL B;  1ZKH A;  3IAS 1;  1BXT A;  2WXL A;  1OTR B;  5LLI A;  3RN9 C;  3RYT A;  2D3B A;  3WA0 A;  4K81 A;  1SJH D;  4BOZ B;  5LXH A;  3WAL A;  1WJN A;  2JYT A;  2WXN A;  2FCN A;  4XGA B;  4A9A A;  3VDZ A;  5MPO A;  1XCQ L;  1WWT A;  1C9F A;  3L0W B;  1CK1 A;  3VAW A;  3VXW A;  1WF9 A;  4YTP B;  3SFE B;  2FCQ A;  2QIE B;  5HKH A;  3KWL A;  1C1Y B;  4MSM B;  2LVQ A;  2OHF A;  1JQ4 A;  2KK8 A;  2G4S A;  4MJS A;  4GDK A;  1F0Z A;  1YN3 A;  2KMA A;  2KVZ A;  4GIV A;  4RGO S;  3V05 A;  4WAA A;  5FR3 A;  2BYF A;  3ZNI D;  1V5T A;  3ZVV A;  5AZG A;  1TS4 A;  1F77 A;  3AB5 A;  3NS1 A;  2KQ4 X;  3U8Z A;  4K7U A;  1K50 A;  3W5V B;  4OZB A;  2JRH A;  5EE0 A;  4FXC A;  2INP E;  4FJZ A;  4GOC A;  2KO3 A;  3NZS A;  4KVG B;  1ZXI A;  4ZHO A;  3T8M A;  1RAX A;  2CU1 A;  2N0S B;  1TY2 A;  2CS4 A;  3P4S B;  2EMS A;  2W3S A;  3MHS D;  2KN5 A;  4WH4 A;  2I1K A;  1RYJ A;  1VLB A;  3HVD A;  1C76 A;  2IJ0 A;  4ZRP A;  3EC8 A;  1IPG A;  2WHI A;  3ZXR A;  1HEZ E;  5HG2 A;  2IGH A;  2KN4 A;  3LB8 C;  2HJ8 A;  2NBU A;  2EKE C;  2J42 A;  3N3K B;  2WQY B;  4L2Y A;  4RCO A;  4AJW A;  4AS1 A;  2LI5 A;  3A9J B;  4KZC A;  3BYT B;  1C3T A;  2OED A;  2K9X A;  2ZCB A;  4ASW C;  1WXQ A;  1ET9 A;  3DBL I;  2MX2 A;  1UZX B;  2JVC A;  2E3T A;  2DZJ A;  2FBW B;  2KDF B;  3QCA A;  4LJO B;  4A20 A;  1L2N A;  1XXG A;  4C4V B;  2G45 B;  5CHF A;  1V49 A;  4YTM B;  2KLG A;  1FCC C;  5BMG A;  3MC8 A;  2KXJ A;  2WLB A;  1P1A A;  1D3Z A;  4F7Z A;  4II2 B;  1F9J A;  2VRR B;  2GI9 A;  2W54 A;  3Q14 C;  4NJ7 A;  2Z59 B;  2KQS A;  3U52 E;  4ANU A;  4EEW A;  2KLC A;  2LEK A;  4NY0 A;  4GDL A;  1Q1O A;  3KQ4 A;  4LNO A;  1DOI A;  1LM8 B;  4IW0 A;  1ROE A;  4HEA 1;  2QIL A;  1I4R A;  4MM3 B;  1QLB B;  2IGD A;  4B0E A;  4F8C B;  4W9C A;  3APF A;  1PFD A;  1TKE A;  3PTF C;  1WGR A;  1T5X D;  5IO9 A;  1STE A;  3RNC C;  4XWT A;  4W9K A;  3Q3N C;  2ACZ B;  3PV1 A;  2KKC A;  2Q5W D;  1LQB A;  2ZVN A;  4BKT A;  3S2A A;  4GLS C;  1F2R I;  2IO2 B;  5CX3 A;  1JCK B;  2L05 A;  4XDC A;  3W1S C;  1WI0 A;  3IT4 B;  1GJZ A;  2H88 B;  2KJ6 A;  2WU5 B;  3T3N A;  1V86 A;  2L1A A;  1EUV B;  4DXF A;  2J0J A;  2LGD A;  2INC C;  3M63 B;  3BII D;  2CJN A;  4JWS C;  4H2A A;  1QIL A;  1GUA B;  1PGX A;  1EU3 A;  2FAZ A;  3AN1 A;  4PYZ A;  1JAL A;  2KTF A;  2YEP B;  4HKZ E;  2N9K A;  2WWZ A;  3MC9 A;  1D4B A;  2Y3A A;  3Q3M C;  3KYD D;  3NVZ A;  4OZA A;  1Y8R C;  1ISN A;  3AEE B;  5FR6 A;  1R4N B;  3RUI B;  3VFK A;  2Y5C A;  3AUL A;  2KWU B;  1AWD A;  1ZOY B;  4AUQ C;  1ZUD 2;  3Q8F A;  3R7R A;  5BYQ A;  1P7F A;  1KJT A;  4MDK E;  2C60 A;  2W3R A;  2A5U A;  3I57 A;  1ACC A;  3MP9 A;  1QF6 A;  1GAQ B;  2I2Y A;  4IWP A;  4NZL B;  3Q3O C;  3AEG B;  1YQB A;  1FXT B;  4M0W A;  1YQ3 B;  3M95 A;  4PK1 A;  5C23 A;  1MVK A;  4N59 A;  4W9G A;  2DWQ A;  5H92 C;  1EF5 A;  3ZJV A;  4AOF A;  2WXF A;  2L7R A;  2D10 A;  2FE8 A;  1WE6 A;  4YSY B;  4MJS B;  4WQM A;  4GDK B;  4DBG A;  3Q8B A;  1WRD B;  3VTW A;  1T3Q A;  1R4N I;  5D6J B;  2GBK A;  2BS4 B;  5BYS A;  1TZ1 A;  3DBR B;  2UWQ A;  2CHZ A;  3B1L X;  1N61 A;  1SIF A;  1R4M B;  2LGY A;  4ZOH C;  2V0G A;  1D5Z C;  3NVY A;  3OG5 A;  1KH0 A;  4IC7 B;  4KZ0 A;  3UF8 A;  2KC2 A;  3RNA C;  2WDT B;  4M01 A;  2J0M A;  4HWI B;  2DZM A;  2CR5 A;  4C80 A;  2KD0 A;  4GU2 A;  1ZXH A;  3B2G A;  2GRI A;  1EWC A;  2PTL A;  2BW2 A;  3P4Q B;  4JGH B;  4G11 A;  1FPY A;  4A8X C;  2C7H A;  3WIM A;  3R8B A;  4WJO A;  1LO5 D;  1QQR A;  3WAO A;  4RMA A;  3H8H A;  2QJL A;  4AP4 C;  4ITK A;  3DBR I;  1V8C A;  5L83 A;  4ARC A;  2O6V D;  4O1N A;  1R4M I;  1YQ4 B;  1KLG D;  2PVO D;  2O6V A;  2OJR A;  2O2V A;  2Y5B B;  3CF6 E;  2AQ3 B;  3H7P B;  3AE2 B;  2WX1 A;  1YMH E;  1GC6 A;  1WFY A;  2R2O A;  3BY4 B;  1GB4 A;  1UF0 A;  4GN1 A;  2GBN A;  4IUM B;  3L13 A;  4OZC A;  1DYQ A;  2V4I B;  3NHE B;  3DCG A;  1WH3 A;  1WR6 E;  1ZDV A;  4GDL B;  2KFJ A;  2XBB C;  2QHO A;  3UGB B;  1OFF A;  2C5L C;  2KWD A;  1T0Q C;  2K8B A;  3PZ8 A;  5LXI B;  1L0X B;  2VH2 A;  2BYV E;  3PLV A;  3PO0 A;  4S17 A;  3EFC A;  3GS2 A;  4EFO A;  2RR9 A;  3DWM A;  3AE5 B;  4RM8 A;  4BZA A;  4EZL A;  1C79 A;  1TS2 A;  3U30 A;  2BYE A;  2XN9 C;  3AV8 A;  2YVC A;  3NS8 A;  5BO4 B;  2MH7 A;  4KX6 B;  2IGG A;  4XC2 A;  3B9J A;  1MI0 A;  2KT7 A;  4BVU C;  1I4H A;  2JXX A;  2AEH A;  3Q2A C;  1CJE A;  2KZR A;  2CHW A;  4AJY B;  1L6U A;  2BF8 B;  1V2Y A;  2CJO A;  3AE6 B;  4WJP A;  4DXA B;  2L32 A;  2MBO A;  4MAC A;  4IKG A;  4YXD B;  1AAR A;  4MT5 A;  1NEN B;  1F2R C;  1YN5 A;  1RM6 C;  4C00 A;  1HZ5 A;  2NVU I;  1MHX A;  1VCB A;  2NBW B;  1UWM A;  3ZUN A;  2JT4 B;  4A6Q A;  4DDI D;  4FHJ A;  2BGF A;  1V6E A;  1YOV B;  3Q6B A;  2PE9 A;  3V6C B;  4KGS A;  4IOI E;  2KHW B;  2BWF A;  4MH8 A;  3WAP A;  1RRB A;  3PLU A;  2IBI B;  3ZTD A;  5KHQ A;  2LAS A;  2FNJ B;  1E5W A;  2I1J A;  2E6X A;  3UQA A;  2LJ5 A;  2PVG C;  2BB5 A;  4PS3 A;  3I5J C;  1FEH A;  2NCN A;  3U4E G;  1J7C A;  4L1B A;  2LFI A;  3PZ7 A;  4ZRI A;  4BKG A;  1JRO A;  4M0W B;  3R7Q A;  4FBJ B;  2V4L A;  1TIF A;  1V1O A;  5H8Y E;  3ECI A;  1FIQ A;  1T0R C;  2MCN B;  1ET6 A;  5E6P A;  1WR1 A;  4B0M A;  2RDG A;  2K8H A;  3P4R B;  4K3C A;  5D3D A;  3BK2 A;  4BFR A;  5T8I A;  3AU5 A;  2K3U A;  4TQ0 A;  3DWG C;  4RFB A;  4URK A;  3QA8 A;  2WP9 B;  4YSX B;  4NPN A;  2KJH B;  4FJV B;  4RF0 A;  3CSF A;  2G4D B;  3FC4 A;  1PDX A;  3MC0 B;  1CZP A;  2X8X X;  1IUE A;  1LGR A;  3U7Z A;  4WJN A;  2M1M A;  3HHM A;  5JZE B;  3IXS A;  1X1M A;  2QMT A;  1UGM A;  2AL6 A;  4XZ4 A;  2IY1 B;  2RD0 A;  2RDH A;  2C9W B;  3PSE B;  4ZRK A;  3DQV A;  1PGA A;  4II3 B;  4LDT B;  3KLS X;  4EUT A;  3IFW B;  1WGY A;  2DX5 B;  1WY8 A;  2PPH A;  3R2I A;  4LK0 M;  2WU2 B;  2RMM A;  2GB1 A;  4US8 A;  3SDL C;  4LJP B;  2GBJ A;  3QIJ A;  2D3G A;  2KMM A;  4R3D A;  1E10 A;  2O6V B;  2O2V B;  2MW5 A;  3BVG A;  4B95 A;  1QOF A;  2KC1 A;  3IBE A;  4HVB A;  2WXJ A;  4N9F 4;  1EO6 A;  3KUZ A;  2XK5 A;  1WIA A;  2BS3 B;  2V9H A;  4FAD A;  4K7S A;  4XYC A;  3CWI A;  1KF6 B;  1J7A A;  2EKI A;  4G50 A;  1UBQ A;  1V1P B;  2PJH A;  2LGI A;  3RZW C;  1UGJ A;  1EU4 A;  3DVG Y;  3ZYY X;  1Q0W B;  2MBE A;  4KDL B;  1WX9 A;  1ZPS A;  3PVL A;  2JYE A;  3T3O A;  4W9L A;  4DHZ B;  2N9P C;  1MJD A;  2ZPY A;  1RFK A;  4RM9 A;  4W9J A;  2L3Z A;  1D5M C;  2WYQ A;  3W2D A;  4IM3 A;  4HXD A;  5J17 A;  3A4S C;  4P7I A;  2JRI B;  2K5P A;  1HTQ A;  3L08 A;  3ZNH B;  1UH6 A;  2BBC A;  1PGB A;  2GMI C;  1XQQ A;  3RMK C;  2BKF A;  4PS7 A;  3QHT A;  2R61 A;  3AE8 B;  4HRS A;  1PYW D;  2BB6 A;  2L00 B;  2X38 A;  4BKS D;  4NAM A;  2LMC A;  2ICI A;  1I4G A;  3ZLZ A;  4BKS A;  3H7P A;  3V60 A;  3VR8 B;  3H7S A;  4HJK A;  3ZXV A;  3KUC B;  3UIP B;  4BOS C;  4J3O D;  3DVN V;  3N1Z C;  4E71 A;  1C78 A;  2PW9 A;  2W55 A;  3KVF B;  5I4D A;  2AQ2 B;  1I4X A;  5IP4 D;  5BYR A;  2JSV X;  4I6L B;  2R2Q A;  2BQQ A;  4IWQ A;  1SE2 A;  4PYU A;  3AEF B;  4G3X B;  4HRO A;  5D3I B;  4HCP B;  4JE3 B;  4HJG E;  2MRP A;  3Q3J A;  3WAM A;  4EKU A;  3VRA B;  3IHP C;  3GP7 A;  4YSZ B;  4KKJ A;  4EZJ A;  2D11 A;  3V6E B;  2KNB A;  1I4Q A;  3IG3 A;  2CHX A;  1VDV A;  1JWM D;  2IND C;  1EF1 A;  2N7E A;  3EFU A;  2NS5 A;  3NOB A;  1GC7 A;  3AH7 A;  2KAJ A;  4LNK A;  1WM2 A;  3U7D A;  4B6W A;  1GB1 A;  2L83 A;  4FN2 A;  3SR6 A;  5AZH A;  1I35 A;  1VD2 A;  1UWX A;  4GB9 A;  5EE1 A;  1MFW A;  5DCN A;  2I38 A;  1WXA A;  1E7V A;  5JHB A;  3NZU A;  4TKN A;  3DBH B;  2REX A;  3UI3 A;  3DPD A;  2LUE A;  2M17 A;  2WDR B;  2J7Q B;  4WWO A;  2LGS A;  1MHH E;  3APC A;  1WM3 A;  1SEB D;  2WXG A;  3M62 B;  4W9D A;  2N1W A;  2PLP A;  1WX8 A;  3AED B;  4A55 A;  2W82 A;  4YT0 B;  1T6B X;  4BBN F;  1G6J A;  2B3A A;  1HTO A;  2D07 B;  2FID A;  3QJZ A;  4ANV A;  3TEY A;  3NRZ A;  3AE9 B;  4XWW A;  1L4D B;  3P42 A;  2WXM A;  2MBB B;  3WAN A;  2LHD A;  3TIX A;  4CQN A;  2L0T A;  1VZ8 A;  3A1Q A;  1I7H A;  3R2T A;  3OJ4 B;  4MGY E;  1PQS A;  1FFU A;  4JQW C;  2LRU A;  3DBH I;  1WGH A;  4WWP A;  2IY0 B;  2IYD B;  2B76 B;  3ZRF A;  3UQB A;  3UIN B;  5AEK B;  2G1E A;  5DPW A;  2GLS A;  4NQK E;  2DHZ A;  4DWF A;  4ARI A;  3VTV A;  2LGX A;  1HZ6 A;  1VZ6 A;  4NNJ B;  2N9L A;  3GB1 A;  1RLF A;  2MBQ A;  3ENE A;  5AUK A;  3RD2 A;  4JL9 A;  2OJW A;  3N1Y C;  1Q5W B;  3GZN B;  3ZNG C;  2Z0E B;  3FAH A;  2KWV B;  3L4P A;  4CHK A;  2DYB A;  1WYG A;  2WXH A;  3ETR A;  2JWU A;  2V3P A;  4E3C A;  1Z5S B;  4DK5 A;  2D5G A;  1H4R A;  1SB3 C;  2BT6 A;  5FKA C;  3MJW A;  2EMT A;  2XK5 B;  1UNS A;  2K8C A;  1L4Z B;  3VHT C;  2RDB C;  1S3S G;  2WGS A;  3AI5 A;  5DPS A;  2LXC A;  4W9H A;  1L5P A;  4YL8 A;  3NVV A;  5EDS A;  5CTR C;  3IT6 B;  2IO1 B;  4HKQ A;  4NAW A;  2GBR A;  2A4Z A;  1CMX B;  1ZP0 B;  2WXI A;  4HPP A;  3GZN I;  1B1Z A;  1IGC A;  4LDT D;  2JX5 A;  1KLV A;  2RPV A;  2ZNV B;  3QC8 B;  1U4A A;  2M4N A;  2G3Q B;  3UIO B;  4CYE A;  1H8C A;  1BT0 A;  1WXS A;  3Q8E A;  1YN4 A;  2WDV B;  4ICU A;  2TSS A;  2LUM A;  2M0A A;  4L23 A;  1KM7 A;  2IZV B;  1WE7 A;  3ABV B;  3OLM D;  1AN8 A;  5G2N A;  1NVI D;  4XE0 A;  4HDO A;  3DHH C;  1YX6 B;  1E8X A;  5IKC M;  2BYT A;  1E7P B;  3VR9 B;  3PPA A;  4ZYS A;  3MHZ A;  3RNE C;  1XLN A;  5G5H A;  1LXD A;  1YNT E;  4HPM B;  1V1P A;  2JY6 A;  1BUI C;  4XX5 A;  4IM0 A;  1V81 A;  4BAX A;  1SGH A;  1LFD A;  3VUX A;  2V3S A;  4A3P A;  3ZJT A;  5D2M B;  2HTH A;  2Z0D B;  1C4C A;  4ZDV A;  4REZ A;  1FNU A;  2RPQ A;  4YTN B;  4TQ1 A;  1FMA D;  5CHW A;  1E90 A;  1TKY A;  4HCN B;  1ESF A;  1VZ7 A;  3VUW A;  2J4X A;  1SF0 A;  5JXV A;  3PRE A;  5DPR A;  1FO4 A;  3L10 B;  1YJJ A;  2ZW1 A;  3PS6 A;  4FA6 A;  1FCL A;  1T0S C;  4UDU C;  1TBE A;  2QSD A;  2KWC A;  2GOW A;  2ZCC A;  4WUR A;  2LHE A; 
#chains in the Genus database with same CATH homology
 1XEE A;  2LEK A;  1SSN A;  2PMV A;  3KLS X;  5EE3 A;  1NYR A;  1N5X A;  1TY0 A;  3KQ4 A;  3BYY B;  1DOI A;  1ROE A;  1DGJ A;  4N6E B;  4HEA 1;  3R2I A;  4LK0 M;  1QT9 A;  2QIL A;  1I4R A;  3CIR B;  4MM3 B;  3J9C A;  3AE3 B;  1QLB B;  2IGD A;  4B0E A;  1SBB B;  2WU2 B;  3TEW A;  2RMM A;  1JWU D;  4N58 A;  1PFD A;  1I4P A;  2GB1 A;  1TKE A;  5C2T B;  2DYO A;  3OWE B;  1TS3 A;  4US8 A;  1T5X D;  4C7Y A;  1B9R A;  2KMM A;  4R3D A;  1TJE A;  1E10 A;  1STE A;  1TYG B;  2WXQ A;  4XWT A;  3BVG A;  3FIL A;  5EE9 A;  1QOF A;  1P7E A;  2WXJ A;  2LJI A;  2ACZ B;  1FXA A;  2WDQ B;  2BS3 B;  2Q5W D;  1EM7 A;  3U2S C;  2H89 B;  3NZ3 A;  3CWI A;  1E6E B;  4GLS C;  3V3X A;  1F2R I;  1IBX B;  1KF6 B;  1J7A A;  2EKI A;  3AE7 B;  2MEK A;  1V1P B;  1KLU D;  1JCK B;  2LGI A;  1UGJ A;  1EU4 A;  1JWB D;  4XDC A;  1N62 A;  1XF5 L;  3ZYY X;  1A70 A;  3IT4 B;  1JML A;  3IAM 1;  1ZPS A;  2H88 B;  2WU5 B;  2JYE A;  3T3N A;  3T3O A;  2L1A A;  4DXF A;  1SIJ A;  3N9Y C;  3P63 A;  3P4P B;  2JXT A;  2WXO A;  5C3J B;  2G9H D;  2HTM E;  2VZK B;  2L52 A;  2PKO A;  3BII D;  2CJN A;  3BVM A;  4JWS C;  2ZW0 A;  1Y56 A;  4H2A A;  1RFK A;  4RH6 A;  5AUI A;  3BWU D;  1QIL A;  2WNM A;  4JWU C;  1D5M C;  1PGX A;  1EU3 A;  1Q10 A;  2WXK A;  3W2D A;  3AN1 A;  1JAL A;  4C56 C;  1L6V A;  2YEP B;  4HKZ E;  1JW9 D;  2N9K A;  2K5P A;  3TUO A;  2Y5P A;  4IDI A;  4EE2 A;  1D4B A;  3VRB B;  2Y3A A;  3URY A;  1KRH A;  3NVZ A;  2BBC A;  4OZA A;  1PGB A;  1DOY A;  1HXY D;  4A90 A;  1FD6 A;  3AEE B;  2JQR B;  1TZO A;  1JRP A;  2Y5C A;  2MJD A;  1AWD A;  1ZOY B;  1ZUD 2;  3Q8C A;  3Q8F A;  1QOB A;  5BYQ A;  2R61 A;  1P7F A;  1BML C;  3AE8 B;  4C7Z A;  1TKG A;  2W3R A;  4HRS A;  1C4P A;  1NI3 A;  3I57 A;  1PYW D;  2BB6 A;  2X38 A;  2BTE A;  1GPX A;  4NAM A;  4RGM A;  1ACC A;  2LMC A;  3MP9 A;  1QF6 A;  1GAQ B;  4JPS A;  2I2Y A;  4NZL B;  2ICI A;  1I4G A;  2JU6 X;  3ZGZ A;  2IDY A;  2Z8L A;  3VR8 B;  3W5U B;  3AEG B;  1DOX A;  5TSS A;  1R7S A;  1XLP A;  3HVZ A;  1FFV A;  3C8Y A;  4J3O D;  2J52 A;  4M0W A;  1YQ3 B;  1C78 A;  3AM9 A;  1MVK A;  4N59 A;  1WGK A;  2PW9 A;  2W55 A;  4NAW B;  4RGN A;  2DWQ A;  5I4D A;  2AQ2 B;  5H92 C;  1I4X A;  4P16 A;  3ZJV A;  5BYR A;  1GOZ A;  2WXF A;  2JSV X;  1HQR D;  1V97 A;  3NUH B;  4P6V F;  1VRA B;  2FE8 A;  1SE2 A;  5FK9 C;  2DLB A;  3BK1 A;  4YSY B;  4WQM A;  4GDK B;  1YJI A;  3Q8B A;  3Q8A A;  1SE4 A;  3AEF B;  4HRO A;  5D3I B;  2WXP A;  1T3Q A;  4JE3 B;  4HJG E;  3EGR A;  3VRA B;  3BZD B;  2BS4 B;  3GP7 A;  3AE4 B;  5BYS A;  4YSZ B;  1K51 A;  4WWM A;  4KKJ A;  2K22 A;  1JWA D;  3P1M A;  2PIA A;  5E6J A;  1I4Q A;  3E56 A;  2NTS A;  4AQ7 A;  1SE3 A;  1VDV A;  1JWM D;  1N61 A;  3SEB A;  4TMA B;  5LNK 1;  1NEK B;  1XCT L;  3B2F A;  4ZOH C;  3E9S A;  3O13 A;  2V0G A;  1D5Z C;  1AW7 A;  3NVY A;  1KH0 A;  3AH7 A;  2KAJ A;  4NJC A;  3WCQ A;  3RFZ B;  2QEJ C;  4LLG M;  4D2K A;  5BMI A;  1GB1 A;  2L83 A;  4KKI A;  3SR6 A;  4C80 A;  2NTT A;  2DBY A;  5GXG B;  1ZXH A;  3B2G A;  1UWX A;  2GRI A;  2IPK D;  1XLQ A;  5EE1 A;  2K0P A;  1EWC A;  2PTL A;  2BW2 A;  2I38 A;  1D5X C;  3P4Q B;  4A8X C;  1EWY C;  3R8B A;  4KGR A;  1N60 A;  3UI3 A;  2MJ3 A;  1HA5 A;  1M4V A;  1LO5 D;  1UUP A;  2M56 B;  2WDR B;  1SJE D;  1QQR A;  4Q2J A;  4WIP A;  1JWS D;  4ZHP A;  1MHH E;  3H8H A;  3NVW A;  1SEB D;  2WXG A;  2QJL A;  2PLP A;  4ITK A;  2MJE A;  1V8C A;  1NYQ A;  3AED B;  2SAK A;  3LYY A;  4A55 A;  4DQO C;  2W82 A;  4ARC A;  3HUI A;  4O1N A;  1YQ4 B;  4YT0 B;  1KLG D;  1T6B X;  2PVO D;  1L0V B;  3W9C B;  3TEY A;  1E9M A;  3NRZ A;  2AQ3 B;  3AE9 B;  4XWW A;  1C77 A;  1L4D B;  3P42 A;  2WXM A;  4USA A;  1XLO A;  3MJ5 A;  1ENF A;  3AE2 B;  2LHD A;  4CQN A;  4RNA A;  1YMH E;  1VZ8 A;  1IBX A;  1I7H A;  1RWS A;  3R2T A;  1ZE3 D;  1QOA A;  4DXG A;  1QKZ A;  2J53 A;  2SEB D;  1GB4 A;  2CU3 A;  1FRD A;  1FFU A;  1C4A A;  1SXT A;  4JX1 C;  2AX5 A;  4OZC A;  1DYQ A;  2B76 B;  2VZK D;  2NMQ A;  2INN E;  2V4I B;  2G1E A;  2XNA C;  4KGT A;  4RGT A;  4OW0 A;  3ZJU A;  4TSS A;  3AEB B;  4ARI A;  4OHJ A;  1ZDV A;  4GDL B;  4ZRQ A;  1HZ6 A;  1VZ6 A;  1OFF A;  1CQV A;  2KWD A;  2N9L A;  3GB1 A;  1OQQ A;  5AUK A;  3PZ8 A;  2EEL A;  2M19 A;  1L0X B;  3EUB 2;  3PO0 A;  1WSP A;  3FAH A;  1TS5 A;  3AEC B;  4YWG G;  1K52 A;  3GS2 A;  3L4P A;  5G5G A;  2DYM A;  3DWM A;  3I9V 1;  5BMH A;  2WXR A;  3AE5 B;  1ZDX A;  1WYG A;  2WXH A;  3ETR A;  2ONQ A;  1C79 A;  1TS2 A;  4WAF A;  3Q69 A;  2JWU A;  1E0Z A;  2V3P A;  3FIL B;  2XN9 C;  3AV8 A;  1FM0 D;  2D5G A;  3IAS 1;  1WRI A;  1BXT A;  1SB3 C;  2BT6 A;  2MH7 A;  4KX6 B;  5FKA C;  2WXL A;  2IGG A;  1UNS A;  1L4Z B;  1MPE A;  3B9J A;  1MI0 A;  1I4H A;  1QOG A;  1CJE A;  3BVZ A;  1L5P A;  1SJH D;  3MFG A;  1FXI A;  1L6U A;  1N63 A;  2CJO A;  1D6E C;  3AE6 B;  2JYT A;  2L32 A;  2WXN A;  3NVV A;  4MAC A;  1VR9 A;  4IKG A;  4YXD B;  4MT5 A;  4RF1 A;  1NEN B;  2BS2 B;  1F2R C;  4A9A A;  5MPO A;  3IT6 B;  1YN5 A;  1XCQ L;  4HKQ A;  1RM6 C;  5HFY A;  1WWT A;  1C9F A;  1L0Y B;  1CK1 A;  1HZ5 A;  4YTP B;  1MHX A;  3SFE B;  2QIE B;  1ZP0 B;  2WXI A;  3KWL A;  4OVZ A;  1UWM A;  1B1Z A;  1IGC A;  2OHF A;  1JQ4 A;  2JX5 A;  2KDM A;  2HDE A;  2KAC A;  1F0Z A;  1YN3 A;  4A6Q A;  2RPV A;  3TEX A;  1KFY B;  1AYF A;  3EA6 A;  4RGO S;  3V05 A;  3TEZ A;  4KGS A;  4IOI E;  5FR3 A;  3Q8E A;  5HI1 A;  1TS4 A;  1YN4 A;  1F77 A;  2WDV B;  3AB5 A;  3NS1 A;  2KQ4 X;  2TSS A;  4MH8 A;  2LUM A;  1K50 A;  2M0A A;  3W5V B;  4OZB A;  1FRR A;  4L23 A;  3ABV B;  1AN8 A;  1NVI D;  5EE0 A;  4XE0 A;  4FXC A;  2INP E;  1N5W A;  2E6X A;  1IGD A;  1J7B A;  1OQR A;  2PVG C;  3TSS A;  1ZXI A;  2BB5 A;  2YEP F;  3SFD B;  3AE1 B;  1FEH A;  3U4E G;  1E7P B;  4ZHO A;  2BYT A;  1J7C A;  2N0S B;  4L1B A;  1TY2 A;  2LFI A;  3W1S A;  3KWV A;  3VR9 B;  3P4S B;  3PZ7 A;  4ZYS A;  3MHZ A;  2W3S A;  4WH4 A;  1JRO A;  1XLN A;  5G5H A;  1RYJ A;  1VLB A;  3HVD A;  1YNT E;  1C76 A;  2IJ0 A;  1V1P A;  1V1O A;  3LXF A;  1BUI C;  4ZRP A;  3RPF C;  5H8Y E;  1K53 A;  1HEZ E;  1FIQ A;  5HG2 A;  3AEA B;  2IGH A;  2KN4 A;  3LB8 C;  1ET6 A;  2J42 A;  2WQY B;  4L2Y A;  4RCO A;  4AS1 A;  4B0M A;  2RDG A;  3P4R B;  3BYT B;  5D3D A;  3VQI A;  3BK2 A;  2OED A;  5D7G A;  1PUT A;  2K9X A;  5T8I A;  2K3U A;  1XO3 A;  3ZJT A;  4TQ0 A;  1WXQ A;  2FUG 1;  3DWG C;  4RFB A;  1ET9 A;  1C4C A;  4PT5 A;  2E3T A;  4REZ A;  2FBW B;  2WP9 B;  1FNU A;  4YTN B;  4XDD A;  4TQ1 A;  1FMA D;  2WS3 B;  4YSX B;  1TKY A;  1XXG A;  1ESF A;  3AMZ A;  1KTK A;  4RF0 A;  1VZ7 A;  2V3N A;  3FC4 A;  2J4X A;  1SF0 A;  1PDX A;  3MC0 B;  1CZP A;  4YTM B;  5JXV A;  2N7J A;  2AQ1 B;  1IUE A;  1VJK A;  1FO4 A;  1YJJ A;  3U7Z A;  2ZW1 A;  1FCC C;  1FNV A;  5BMG A;  2WLB A;  3ZQ4 A;  4US9 A;  1FCL A;  2GI9 A;  3IXS A;  1FNW A;  2W54 A;  4UDU C;  2QMT A;  3U52 E;  2QSD A;  5HHD G;  3HRD D;  2RDH A;  2JZP A;  2ON8 A;  4LTU A;  4WUR A;  2LHE A;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...