1ESFA

Staphylococcal enterotoxin a
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
229
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A
publication title Crystal structure of the superantigen staphylococcal enterotoxin type A.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 71
structure length 229
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1esfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1esfA02
1PRTB 2XNAC 1QILA 5ELCA 1KLUD 1LTTD 2CHBD 2IPKD 2XN9C 2R61A 1SEBD 2ICIA 1HA5A 5D3IB 2NTTA 1HQRD 2AQ1B 3BZDB 3EA6A 1V1OA 1PTOD 3V05A 1KLGD 2O2LD 1SE2A 3KLSX 2QEJC 1I4PA 3W2DA 2SEBD 1DJRD 1B44D 1LTGD 1BXTA 1FGBD 1HTLD 1HXYD 2XRQD 1PTOB 1UNSA 4RGMA 4RH6A 1DYQA 1G8ZD 4NZLB 1JWUD 1I4RA 1XXGA 4UDUC 3TSSA 1BCPF 1GOZA 1LO5D 1EEFD 1SJED 1LLRD 2QILA 4RHSA 3OWEB 2RDGA 2TSSA 3EFXD 1JCKB 1SE4A 1UUPA 1JWSD 1TS5A 4RGTA 1PRTF 3MFGA 1JR0D 1ET9A 4L6TB 1ESFA 1YN5A 1JQYD 1FD7D 2G9HD 1TS4A 1TY0A 5FKAC 5ELEA 1BCPC 3DWAA 5ELDA 2AQ2B 1D5XC 1SBBB 1CT1D 5D3DA 1FNVA 1EU4A 3BYYB 1B1ZA 1YN4A 4L63B 1ENFA 1LTRD 1PZKD 2Z8LA 4RGNA 5FK9C 1SJHD 4DXFA 4RGOS 1PRTC 1LT4D 1PTOF 1LT5D 1D5MC 1MD2D 1KTKA 1LT3D 3DWPA 2WV6D 3MC0B 1L0YB 4DXGA 5I4DA 2AQ3B 1L0XB 1SE3A 1I4QA 4K6LA 1FNWA 1EEID 1V1PA 3R8BA 1PTOH 1I4XA 1CHPD 1T5XD 3SEBA 1D6EC 1PTOC 1TS2A 1F77A 1TS3A 2NTSA 4TSSA 1EFID 1LTID 1S5FD 1S5BD 3O13A 4BWGB 1PZID 1PYWD 3BVGA 2J4XA 4RCOA 1EWCA 5ELFA 1STEA 3GP7A 2XRSD 4O1NA 5ELBA 1RCVD 1RF2D 3BYTB 1AW7A 1FNUA 1JWMD 3R2TA 1D5ZC 3URYA 1AN8A 3R2IA 4OHJA 2IJ0A 2RDHA 1TY2A 1BCPD 4ZYSA 1LT6D 1PZJD 1RD9D 1M4VA 1V1PB 1XTCD 3BVZA 5TSSA 4C56C 1EU3A 1CQVA 1RDPD 4Z9CB 1S5DD 3BVMA 3CHBD 3DWQA 1BCPB 1YN3A 1PRTD 1CK1A 1I4HA 1LTAD 4RFBA 1LTBD 1LTSD 1SXTA 1I4GA 1ET6A 1S5ED 1S5CD 4RHRA 1CHQD
chains in the Genus database with same CATH superfamily
4ACFA 2CKHB 5JEAJ 2CJNA 3MJWA 3TZDA 4DU9A 2BH2A 3X23A 3NBIA 3PUXA 2I5MX 1MSHA 2KHSA 1MJDA 1PFDA 3DVGY 3Q8EA 2JEBI 3VVWB 3ZDMC 4EKUA 1ZYRC 3GTJB 2OHFA 3BZDB 2ZTEA 2K03A 4HJAA 4IDIA 4KHPQ 4WFN3 3KJOA 3TP5A 1X9NA 3TCAA 1WJ4A 4IWOA 4MACA 1N8RC 2QEJC 3AE2B 4DNTB 3VYRA 1VQ8A 2F0KA 3U4VA 4B9KA 2YEPF 3D3RA 3OW7A 2INCC 3KBXA 4IJLA 2KNBA 2LHEA 2RA4A 4NZLB 3VR9B 2KDFB 3RI7C 1C78A 4MELA 1VS0A 1SYFA 2O4XA 5AZFA 3SGIA 3OWEB 2WU5B 2TSSA 3U9SA 3ZQ4A 1AE3A 3HOVG 2HCIA 2QEXA 5C0XH 4UAIA 5EE3A 3VAWA 1FFVA 2NB0A 1QQRA 4DV2Q 1HTPA 2MGSA 2ZZPB 4JBWA 5AJ3Q 1IL8A 1E22A 4FXDA 1N62A 2MBHA 5ELEA 5C3EH 3HOVB 2QA4A 2EYMA 4RM9A 1GUTA 2QCZA 2LXCA 2MW5A 2CR5A 5CGKA 2LXKA 2A69C 3CKIB 5LXHA 5EJWA 3V3XA 3I4MG 4IZ8A 2B2TA 4B3SL 4YWLA 1A3VA 4EZKA 2MJ8A 1JOQA 4E3CA 2PCFB 3CRLC 1W3SA 2I46A 1N34Q 4YSXB 3PRMB 1E8ZA 4X3KA 3AEVA 3C2PA 1CZPA 3I4MB 1OXTA 1KTKA 1LT3D 1EIGA 2CH4W 3MC0B 4IFDH 1PFMA 4A20A 4HKZE 3T9LA 1E0ZA 1XNQL 4JV5Q 3CMMB 3WOFA 4DR7L 1ICFB 1SFOB 3PO2G 2R3ZA 5D7GA 3AE7B 2OQKA 2ATWA 2JA7H 1CHPD 3VH4B 2VQFL 4HJKA 2G1EA 3TJPA 4XQNA 3RLFA 1Z5SB 1DOYA 1F77A 1NUCA 4OVVA 3I3CA 3B2GA 5LMNL 5BMHA 1NAPA 2J0TD 4BXXH 3L17A 1SAPA 2KJXA 4WH4A 2EJGC 2F0IA 1D1KA 2OQ0A 2PO4A 3U58A 2G3QB 2WS3B 2DHZA 1PDXA 2VUMH 1A0IA 1X3PA 1SIFA 2BKRB 1SF0A 2IGHA 4HIDA 1I5FA 1E90A 5GAHC 3FILA 2YTVA 1VDZA 4FF3A 1XO3A 5I2YA 3R2TA 3HKSA 2HUGA 1QVGA 3NBHB 4JGHB 1EL0A 5J2RA 1AN8A 3U50C 3S2HH 1EM7A 3DVNU 2BF8B 1IYFA 1UGMA 1KDCA 4JBJA 4OEMB 1NY4A 4LF4Q 2FCMA 1YHAA 2WAQG 2NVQB 3VRBB 4AP4C 5G3LD 1FIQA 2F0SA 2Z0DB 5JH5C 1RWSA 1I4HA 1ENCA 4HCPB 1HCZA 4OL7A 3GTPH 3NUCA 3C3LA 1D8LA 1C48A 1XPRA 1YQ4B 2VZKB 1ZXHA 3W1GA 3GZNI 3MEHA 1Q81C 1WCMG 1PRTB 1QILA 2BA0A 4EQPA 5C4ZA 3S17H 3TDQA 1X55A 1VQNA 1TWFH 2ICIA 4LFCL 2R93H 2WP8J 3A9KA 4ICVA 3PHWB 4B3TQ 1WCMB 2AYOB 1I6VC 1SB3C 3CP0A 3J81E 2WXQA 4OWTB 4G57A 4C3IG 4HPLB 3DBSA 2B2TC 2JP1A 2D5DA 4OX9Q 1B44D 3CMAA 4E74A 4RGMA 2Z6BA 2C60A 1DYQA 3ZGZA 4CJ2C 1PH4A 5L37A 2UUAQ 4C3IB 4JI1L 3JAMc 4HIKA 2KX3A 4BFRA 1LO5D 4MN3A 2N9PC 3SFEB 3DBRB 1BKBA 4A4IA 4JWSC 3NEMA 4S17A 4IPCA 1SE4A 2K0PA 2F0FA 4QUCA 4BOZB 2EY5A 4R4QA 5JJIA 3P4QB 2LASA 4DV5Q 1B8AA 1SYEA 5M3FH 4A3IG 1FJGL 4DWFA 1YN5A 1SSOA 3GTGB 5FLMH 1Z7TA 1H9KA 1LUZA 2F52A 4DBGA 2MJ3A 5FKAC 2PE9A 1K3BC 4FJZA 3VR2A 1IBMQ 1ZXTA 3A8JE 4ULLA 3BDOA 2QDLA 3DUZA 3VR3A 1EUJA 1KABA 4U673 4A3IB 3KQ4A 2EZVA 1Y8PB 4ZYNA 4FADA 2WKCA 4XTCS 2WHIA 1GNUA 4DV6Q 3ZJTA 2BQQA 3M62B 3ND8A 4BY7G 2WAQE 3MC9A 2KVRA 4K5VA 4BKSA 1V8CA 4IALA 2V4IB 3AE8B 2ENBA 1JJCB 2EY1A 4QAYA 4ZHPA 3GTKH 4M00A 2V3NA 4JL9A 4WQOB 3BU2A 5E4XA 2LHDA 2QDFA 3MHZA 2EMTA 1B3AA 4A3BG 4K7SA 2KCCA 3MEFA 2IWHA 5M5WH 4TSSA 2ZM6Q 3OJ4B 1ZW7A 1DZ1A 4DK1A 3Q8BA 5GAEC 1JQ4A 4BOSC 5C44G 4KI0A 2L0FA 1NTGA 3S16H 3NY5A 1N63A 4A3BB 1WH3A 1R9TH 1VJKA 3H0GG 1NBWA 4IUNA 4LF5Q 5I2XA 1FD6A 5C5LA 4JI5L 2G9DA 5GQOA 2EYJA 4DUYL 2IO1B 2PQAA 1CZGA 1F0ZA 2FIFA 2Q5WD 5FLXE 1OEYJ 2Q8RE 1FCLA 5EKIA 3M7GA 5C44B 1EY4A 4EX5A 3RZOH 2DAFA 4DDID 4MTNA 2FNJB 2FUHB 1S3SG 3H0GB 3QIJA 4US9A 1PZJD 2B2WA 4C7ZA 1D2BA 5DNFA 4I6PA 2XK5A 4ZUJA 2L11A 2EY2A 2LGIA 1EIFA 1Q0WB 1L0WA 3NVWA 5E3FA 1KHIA 4M01A 1SNQA 2B3AA 3SU8X 2VZKD 3A8IE 2KJ6A 1PRTD 2Y5BB 4GS3A 5C0XI 4A6QA 2MHJA 4N59A 3E3XA 4PS7A 5FO9B 1W6KA 2QMTA 1VCIA 2XNAC 3AEBB 1X3FA 1Q86C 2GBRA 1WFYA 1HZAA 4OZCA 2LGYA 5D3IB 1ENAA 5IA7A 5IYCG 2IGDA 4JI7L 2MJEA 2MWSB 4AUQC 4NDXA 2F0EA 2KMCA 3HOUG 4X3SA 2O6VA 3RT3B 3UIPB 4LMQD 2MP1A 1QVFA 3RNCC 1YQBA 1LYLA 1Z6HA 4CJ0B 1K0SA 1S72A 1FGBD 1J7AA 3KF8A 1TTNA 3PGZA 3NTIA 4K0KQ 3EJIA 3M4QA 1PDQA 1NDDA 3NHHA 4IFDI 3P42A 3OW2A 3HOUB 4MM3A 3OIPA 4JI4L 1XEEA 2EYOA 3DVGX 2ZVOA 4P1CC 4HLEA 3T3NA 1S4ZA 5LHY1 2INNE 5C3JB 3VYTA 2MO1A 2IW3A 4X65Q 2HE7A 2L7RA 5BO4B 3U4ZA 4ZRKA 4I65A 1C8CA 4RGTA 3HOWG 1K83B 2WXFA 4EE2A 1VQEA 4CDCC 1WTHA 1V49A 3I2ZA 2PIAA 3AE9B 2M8SA 2JZZA 5D6JB 3P75A 4HAEA 5C3WA 2JXTA 2MHVA 4JBKA 4JOIA 3AFPA 2F4VQ 1B1ZA 1V97A 1ACCA 4C2MB 4TKNA 3TIXA 1WVLA 1A3TA 2KX0A 1YJIA 3GTLH 4APVA 5K36G 3IAM1 4JI6Q 2PMVA 2FBWB 1EQQA 2PPHA 5JJLA 3QJYA 4G7ZC 4BKGA 4FXGC 1M1KC 1VZ6A 3I70A 4JE3B 1E3PA 2KCTA 1GB4A 2R7FA 3OTOL 1WTOA 5EKLA 2B2WC 2H1EA 3B0AA 4GU2A 4KX6B 1SE3A 1CSPA 1HZBA 1ZKOA 2PYKA 4HJ5A 2ZPYA 2UU9Q 4DK5A 3CC7A 2LI5A 3NS8A 2L8JA 3B2FA 3H15A 3RD4A 1DOLA 3S14B 3TRZA 4ZRPA 3QO2A 1J5EQ 1I35A 2B8FA 2I1JA 2WKDA 4DV1Q 1ILPA 4FHKA 4C1NI 4RCOA 1TWCH 4OIKA 3KUZA 1MJEA 3OPOA 1RM6C 2IBIB 2L9HA 3S2DB 1XCTL 3HUIA 3E5SA 4HPPA 2WXGA 3VQIA 4A3LH 1PH5A 1VQKA 3L7ZC 3A8KE 3URYA 1WF9A 2HDEA 3J80c 2NPTA 3ZO5B 1U4MA 1HNWQ 2KBNA 4FF4A 5IODA 2NZOA 3NXWA 1VQ9A 3PRPB 4DNRB 1BUVT 3LGJA 1XTCD 1Y8RC 1R4MI 2PE6B 3AYHB 5CC4A 1YNND 2FAZA 1QZGA 5C4HA 2BBCA 4J1MA 1N36Q 1STGA 2E2JB 1JALA 4LNOA 3WIMA 3TMEA 2UUBQ 2JA8G 4DR3L 2GBKA 3GTQB 5CV5A 1S5ED 3ZYYX 1CMXB 1WX7A 2JK8A 5EQ0A 1AH9A 2N7DA 3H8HA 4IG7B 5IP7G 5CYUA 5IKCM 3K5LA 4DV0Q 1SE8A 2UXCL 2IY1B 3OMGA 4HROA 4JWUC 1EFWA 2R6GA 2JA8B 1EQVA 3N6RA 1SEBD 2RCNA 5A2QL 3HKZG 3KWLA 3AH7A 1T3QA 3HK0A 3CW2C 3GQBA 5G55A 1TT2A 4DV3L 2A6HD 2O2LD 4WJWA 4GKJL 4JOIC 1QKZA 2RMMA 5E6PA 4IQZA 4BBNF 4LWCA 5CBEE 2CHXA 4HEDA 2QC8A 2B63H 3HKZB 1C76A 4DQOC 4B3MQ 1PTOB 4A55A 1VQJA 2NN6H 4C80A 1L1OB 1ML0D 3TREA 1V5OA 2DX5B 2LUEA 2O2VA 4NQKE 2JVCA 3QJZA 3Q6SA 4USAA 5AZGA 3IVFA 2KWUB 4OGQC 2A68C 2BH8A 2V0GA 4FULA 2BKFA 4MZ9A 1WI5A 2WXLA 4IW0A 2N3SA 4XQQA 1WGYA 1Q46A 4B9WA 1PRTF 1JQYD 1FD7D 2K5VA 4O42A 3CCJA 2JPHA 3SHQA 2MUYA 3TP7A 4L5SA 1IGDA 2E6XA 3DBLB 4A3EH 4NMZA 2F3VA 4KN7C 3M9BA 1SYDA 5J17A 2MBEA 1VMPA 4TQ0A 5M3MH 2JA9A 3S1MH 1WSPA 5ISRA 4NP5A 2L32A 3F2CA 2BS2B 4HMJA 2YU9H 4X3UA 1NBFC 3NUHB 5FJ8G 3J81j 4KV2A 3FEWX 1E8WA 3EN2A 4RGOS 1CQFA 3KUCB 1KJTA 4MNOA 3ZTDA 4K2KA 4YWMA 1KRSA 4JI2L 3EFCA 2UXDL 5JEAG 5T1IA 2QKIC 4DAPA 3G6EA 1TZOA 2E3TA 4LNNA 5I4DA 5LL6X 4B0EA 5IAAC 2AWTA 3D0FA 3IBEA 1HHVA 1YHQA 2XWJB 3RD2A 3A5ZB 4DDGD 3S1NB 1ZXIA 3L10B 2JN4A 1V1PA 1T5XD 2LY7A 1K51A 2JYOA 4GOPB 4ZK9B 2JWZA 4PT5A 3HKZE 2SNSA 3HFZB 2KACA 1B9NA 2KDIA 2KZRA 2V9HA 2VQEQ 2CWAA 2UXBQ 4GB9A 3I73A 2VB3X 2X6GA 2N1VA 3P1HA 2OJRA 3I9V1 1PGAA 3K7AB 4ZCKA 3VTUA 1XF5L 2VH2A 1G6JA 4UHVA 1IPGA 1VQPA 3RCZA 1RKNA 4DV4Q 2DNFA 4OONA 3UINB 5CTRC 4Y7NH 5C4XG 3IT4B 4FBJB 3TEWA 1K0RA 1YNJD 2F0LA 2KC2A 3AU7A 2XK5B 3U7DA 2AUJD 3HOYH 2EIFA 3ZRFA 1JW9D 4CDFC 2WXKA 3C19A 1L6VA 1YN3A 5C4XB 2NVXB 3I91A 3AU4A 3EIVA 3T4AC 1CJEA 5FR6A 3D4DA 4ZQ3A 1XQQA 2F0GA 5IGFA 4LLGM 4K2LA 3I8ZA 3MVVA 5DAUA 5IYDG 5EPJA 2JX5A 4WIPA 3AEDB 2Z0SA 4JVZA 2LGXA 3J81c 2KOLA 2MO0A 2GMIC 2PW9A 2WDTB 1TWAH 1LV9A 1ZGUB 1PFNA 2L52A 4KIKB 1VF7A 5IE8A 2UUCL 3O65B 1HQRD 4XYOA 4KTAA 1OQQA 1PTOD 2EYHA 1Q8KA 2LXJA 1JORA 4F1SA 4DAYA 4BA1I 3T1HL 2N49A 4NPSA 2F03A 1Y1VG 3AE5B 3JSVB 3NRZA 3ML9A 4DK3C 4OO1H 1BXTA 2CW0C 1FM0D 4K3BA 4M8NA 1WX8A 2HTHA 2I5HA 3RZDB 1NVID 3QWZB 2ZNVC 5GMVA 4K14A 2OTLA 1N5XA 3NZ3A 3SHLA 3KUDB 5D2MB 4CO7A 3EFUA 4BBRH 1Y1VB 1PUTA 4WWOA 4XYCA 5KHOA 1F9SA 1I50B 4QMGA 1OQRA 3E0JA 1ESRA 3BJUA 1BT0A 4DN4M 1YQ3B 4V0BA 2C9OA 1YJNA 4X62L 2WU2B 1Q8IA 1YITA 1ESFA 4DXAB 3AE4B 2K04A 4K81A 4KMUC 3L4PA 1WE6A 4XC2A 2EQSA 2ZXPA 2YTXA 2AQ2B 5KYLA 4C3HH 5D3DA 4PMWA 1FNVA 1SMYC 2RSNA 3BYYB 4WAAA 2F0UA 1LTRD 2L4NA 1EYDA 3ABVB 2ZTDA 2BB6A 2OEDA 2ALYB 3DHGC 2BTEA 4GMVA 4A3JG 4DKAC 1O7IA 3CCUA 3UIOB 3S9WA 1C4AA 1YNXA 5E4WC 3E9SA 2MH7A 2A73B 3QIAA 2RGFA 2Q8IB 4US8A 4H02A 1OTRB 4HTHA 4BVUC 1WR6E 4A3JB 1AZPA 5IP4D 1A6XA 4WJ4A 4PZ8A 1FNWA 4KHPL 2JF5A 2I1KA 2KFKA 4W9FA 1DONA 3TP8A 5D14A 2ICEC 1H9JA 4QIWE 5JXVA 1QUQA 4GNXA 3BINA 3PZDA 3CCQA 4CDEC 3CAMA 3N1ZC 4POFA 4K7UA 3BDLA 4ZRQA 1W6JA 1S5FD 2CKZB 3H91A 2DENB 4BWGB 3T53B 3PREA 2R7ZG 3CC4A 1YHBA 1VQDA 4A3GG 2RSOA 1V5TA 3VR6A 2MEKA 1JWAD 4H13C 1VLBA 4CHKA 1GHJA 4ZLTF 3DMUA 1EYCA 5EE9A 4U68A 4A90A 1AW7A 2H4OA 2GA4B 5C0XG 3GTMH 4PG3A 2R7ZB 5HHDG 3WDNA 3MXNB 4A3GB 3F8TA 5D94A 4A8XC 4YHHQ 1Q12A 4DV2L 1AFPA 2FCSA 4PYUA 2F3WA 4M0WB 5JJKA 4ZYSA 3I56A 4A3DH 1CTMA 5AJ3L 4W9CA 2NN6I 2SOBA 4C56C 3UE1A 3BZCA 1S40A 1T6BX 3KYCD 2M2LA 1WJ6A 3BVMA 1WIAA 1T0QC 1BCPB 4ILWA 2YLMA 3KLSA 3MP9A 5BMIA 1CM9A 1TIFA 2BYFA 1ZDVA 4WORA 1OO9B 2L55A 1N34L 2J0KA 3PSIA 5E7NA 5EE1A 1ZP0B 4ZUIA 3I4NG 1V81A 1II3A 4BZAA 1FEHA 1KLUD 1LTTD 4B08A 5M5YB 1OGWA 1IBLQ 2N9LA 4JV5L 3K59A 2D5GA 3PO0A 1K52A 2JA7G 4IUMB 4EQNA 2D9UA 1KLGD 2Z4HA 3I4NB 2CJOA 2JT4B 3X0WA 4JW0A 2PVGC 4MHEA 4DK0A 3SK5A 1ICWA 3W2DA 1PH8A 2IO2B 4R4OA 1G2SA 1F2YA 3J80E 1QWYA 4MGZE 4M8AA 2Y3AA 1TKGA 1WJJA 2JA7B 2NZHA 2X69A 1FR3A 1CKOA 4GZYC 3KW5B 4IOIE 4RH6A 3D32A 3RMKC 5J1ZA 1KDAA 2MNAA 4LF6Q 5EAYA 2D3CA 1GAQB 3LDZE 2KJRA 4KHVA 1PFBA 2WXIA 3RNFC 4XE0A 2K8HA 4IPGA 1E1OA 1BBXC 1XLNA 1K28A 3DBHI 2SNMA 3C46A 2KWDA 3EFXD 5IP9H 4P6VF 5HI1A 4KK7A 4KY6A 4A3MB 2V3SA 3DDCB 3WWVA 3M4OH 4W9IA 1K8AC 2LSSA 3PZ8A 2F0VA 2JA5G 4LF4L 3TEZA 2HD5B 4GNXC 1WTXA 3VH3B 4KDIC 1TS4A 2KUMA 3VA5A 1MJCA 3DM1A 4GDKB 4ZHOA 1I7HA 5AEKB 4M02A 1EYAA 1HR0Q 1LM8B 4BY1G 4ZRIA 2JA5B 3ULJA 1V43A 4C3JG 1M94A 3KOJA 3LWEA 2B39A 1E9MA 1BBWA 2Z8LA 5CHFA 5EPLA 1Z9FA 4II3B 3ZW3A 1WTPA 1PTOF 3K7UC 5DEHA 4BY1B 4PYZA 4B0MA 3EECA 4XDDA 4WAFA 4IOAA 2L12A 4C3JB 1I94Q 4GGQA 4W9LA 4K8IA 1YBYA 4YCUA 3RNGC 4B3TL 2FMCA 4ZRJA 4KLKA 4DR5Q 4R8NA 3RNAC 1ZKHA 2K6AA 2DN8A 4NXNQ 3PIPA 1YJ9A 4OX9L 1V86A 2V4LA 3AV8A 1TBEA 1TS2A 3C1EA 3HOZG 3KUPA 1W2BA 2NVYH 5T8IA 2UUAL 4L23A 2BDOA 1B4OA 2BWES 1JROA 1B9RA 2E2IH 1IW7D 2NZ1D 2KVZA 1KFYB 4X57B 1A2UA 3A55A 3T1YQ 3HOZB 2K8CA 5BMGA 4N8FA 2XRSD 4B9XA 4B3RL 4GLXA 2BE5D 4FO2A 4G7HC 1R4MB 3AE3B 3UF8A 5IYBG 3J9CA 1M8AA 1JB3A 3FKIH 4CKCA 4X64Q 1V9JA 2A6EC 4DV5L 3STBC 1TWHH 1R4NB 1HRJA 4OO1I 1BCPD 2IT1A 2JYTA 4O2DA 2N9KA 5ELOA 2JUOA 4G50A 4HPMB 1RD9D 1P9DU 3R93A 5CMDA 3J7A5 2LD9A 3U52E 1X54A 3R3OA 2LXAA 4K7WA 1O7YA 1K8OA 1IBML 3AI5A 1YX5B 4FNFA 3AQQA 3ERSX 3ZNGC 2M4NA 3DEOA 3K81C 5C4JB 1CK1A 1JICA 3QC8B 2F3IA 2IX0A 2WFWA 3PO2B 4W9GA 3OMCA 4BS9A 4DV6L 1Y1WG 3Q3JA 3RR5A 1I6HH 2VRRB 3W5VB 1S5CD 1TWGB 3ZVVA 3VXWA 1PYBA 1U9RA 2YV5A 1KF6B 4DGZA 5EE0A 2LRWA 1RFAA 4DFAA 2M17A 1N61A 1J8CA 1Y1WB 3S1QB 4F7ZA 2LKVA 2WDVB 3DHHC 1UEBA 2K05A 4XWWA 4LK1C 1BR9A 2YYZA 4NB3A 2KEDA 5BN5A 3OG5A 1SNCA 2PEAA 1E7PB 1HFGA 3G6JB 1GUAB 4MGIE 2AHOB 2JXMB 3AE1B 4LNFA 1I4PA 3Q14C 5FO7B 1ASYA 2C7NB 2ZM6L 2HHHQ 2KDMA 1WMHB 2HDLA 5IT9c 2WX1A 3SK4A 2NCNA 2PZUA 2L0TA 4QY7A 2E76C 1UAPA 1GHKA 1T0RC 3AEEB 3ONAB 2PVOD 3CCMA 3UI2A 1C9OA 4LF5L 4ZDVA 2KENA 3MXUA 3GTJH 1LLRD 1WGGA 2QILA 3QHTA 4WURA 4TV3A 2WAQB 3N3KB 1Q1BA 3KYHC 2ZJPA 4KVGB 1J6QA 3L13A 2OEOA 4H44C 2J0JA 1WXVA 4LJPB 2REXA 2F0WA 3N32A 1C3TA 4L6TB 4XT3B 2KTFA 3VUWA 2EPBA 4R4IA 1L4ZB 1WRDB 3VYSA 2W3SA 3ZNHB 2KAJA 1PH2A 3CCEA 1T5EA 3RZOB 4UPAA 3EGRA 2RDBC 1K8RB 4ANUA 2EKEC 4ZOHC 1CT1D 2F0TA 2E2HH 3U4EG 1YZ6A 3VUYA 4DR4Q 3NTHA 4L1BA 2B2VA 4GOCA 4W9KA 2K6QA 2FXQA 1ASZA 1GO3E 4IWQA 4WJ3M 4NAWA 3CC2A 2QIEB 1D5MC 4OVZA 4IUUA 2KK8A 1IYJB 5C0XJ 5EGTA 3W5OA 3GE8C 1IUEA 4TMAB 2KLGA 3AFQA 3HOVH 3K5OA 5BR8Q 3JC66 4F8MA 4KZ0A 1VQAA 1WZ3A 2N4FA 1STNA 1JMCA 4JQWC 2F0PA 3KYDD 2HD3A 4WJQA 1XMOQ 2R92G 3K5NA 3MFYA 3WOEA 1O7ZA 1DD2A 2RR9A 1FL0A 4DK6C 4OVUA 4K0KL 1LTID 1YEZA 3I4MH 2BYTA 1S3OA 4YY3Q 4A3FH 4A93G 2K22A 2M19A 3CSTA 3TMPB 1OFFA 5L83A 1XMQQ 4AOFA 2R92B 2WXHA 3M63B 3WAPA 1EY5A 2MCNB 5IGBA 2MP2A 5AFWA 4ME5A 2LMCB 4IFDJ 1HPCA 2VB2X 4X65L 3KLRA 1VQLA 2ZJDA 1WYWB 1JOKA 1CKMA 4DAMA 3NQTA 4A93B 2IJ0A 1SNPA 1PH9A 1WXAA 3NS1A 1E6EB 3QG1A 2WDQB 3G71A 4H0LC 1EY8A 1Q10A 3Q3MC 4ANVA 4BY7B 4EZJA 1HZCA 3IFTA 4EGVA 2B76B 5J18A 1Y14B 2F0MA 3N9YC 1Q90A 4II2B 3VRAB 4TVAB 3I57A 3ZJYC 2F4VL 3ETRA 3PMFA 3CXCA 4XQJA 3RFZB 5AUKA 4R3DA 3S15B 3RYTA 1LTBD 2CS4A 4MSMB 1UBQA 2GN5A 3AEAB 4A3OA 4JI6L 1NI2A 5KRUA 5JHAA 1IYVA 2WACA 3T16A 3IL8A 1F2ZA 4IUVA 4C7YA 4ME3A 3T56B 4ICUA 3H6NA 2D62A 2R61A 1H4RA 1ZDXA 3JW0X 5J3BA 3J7YW 3VA7A 2NVQH 3VUXA 4E71A 2HIVA 1BOSA 4ARIA 4DR1Q 1QOBA 1HJPA 4YCVA 2UU9L 2Y5PA 4KY7A 3AB5A 3J81L 2NVTB 4DUZQ 2C5CA 3DCGA 2XTIA 3AECB 1QVCA 3U8ZA 1F1HA 1KD1C 4OW0A 2K5QA 4LK0M 2B2VC 5HGQA 1C4PA 1J5EL 4DV1L 1S1QB 1UD7A 2IY0B 3DVNV 3K0XA 1BCPF 4AH6A 4LUVA 4FN2A 4UP9A 5C5MA 1EEFD 4MGKE 4LDTB 4CKEA 3T3OA 3SXHA 1WCMH 1VDVA 2FE8A 3Q22A 2QHOA 1CFMA 1TWCB 1BBUA 4OZAA 3T13A 4DV7Q 1HNWL 1TS5A 2GOWA 2OTJA 1JR0D 4L8JA 1XNRQ 2UWQA 5AZHA 2HDMA 3LXFA 1XWEA 4HSVA 2Z59B 1EYGA 1E1TA 4PNYA 1NNXA 4AQYQ 5IGCA 4FXCA 3W1YA 1NMFA 2JA6G 2WGSA 1YVCA 4C3IH 1N36L 2A4ZA 1KLVA 3CMEA 2J0MA 2ZJQA 3PPAA 2UUBL 1NE3A 4HCSA 1I3QB 5I6WA 4BBSG 4DXFA 1L2FA 4L5RC 4EOYA 1TKEA 2JA6B 1WY8A 4A75A 2KA7A 4DV0L 4R4TA 2N78A 1Q1OA 3GTGH 4GN1A 1OXUA 1ZYRD 3IKJA 1U4PA 1L0YB 2GVBA 4LCDE 3Q24A 4BBSB 2L76A 4JI3Q 1D1IA 1X3EA 2L5TA 3M7NA 1HNZQ 1GC6A 2M0XA 1FJGQ 1I42A 1SFOH 3PIP3 1IBKQ 4A3IH 1G291 2JSOA 3RZWC 4FHJA 2HCCA 1FRRA 4HXDA 4C1NK 4YIJA 4YSZB 1QNUA 2NN6G 4B3ML 2A74C 3HOWB 3C8YA 3O13A 3NENA 5I9PA 1YX6B 1PYWD 1SN8A 2K28A 3MXGA 4AQ7A 4KSKC 1D4BA 1TJEA 2IDYA 4AS1A 2CQAA 1SR3A 2EVBA 4A3KG 1BDOA 5ELFA 1GM5A 2RBMA 3CQZB 1UF0A 1WJNA 4HDQA 3ZJVA 2RVLA 1FXTB 4O1NA 1D7QA 3BYTB 1RHPA 3QR8A 3CRKC 5FLXL 4ZKCB 3JAMi 2WXOA 2MQHA 3N30A 5E6JA 3Q23A 4TQ1A 1GJZA 2DWQA 3RNEC 3P63A 1VQFA 2K5NA 2RDHA 2FMMA 4IN3A 4A3KB 2X8XX 1VQCA 3V62A 2NBFA 5LNK1 4GLVB 3EC8A 3CSFA 1TGZB 1CUKA 2A69D 2FFKB 2KC1A 1HUMA 4AIMA 4EVOA 1CQVA 4Q5VA 4A3BH 2K52A 4RNAA 5C2TB 1FGUA 3D6WA 3M85A 4IKGA 4AYBG 1GB1A 1I4GA 4L5TA 2L3ZA 1LGRA 5G5HA 1STYA 1ET6A 1J19A 5C44H 2N7EA 4DA2A 4WWNA 4KV6A 4F8CB 3ONSA 1P0RA 3H0GH 4J6HA 5IGEA 3FILB 2J7ZA 3RPFC 4A3CG 1NEKB 1LQBA 3FP9A 3DLLA 4AYBB 2K25A 3B9JA 2V4DA 1ZPSA 4RF0A 2MQJA 4C4VA 2FCQA 3NOBA 3L08A 3ZNID 2WXPA 3V05A 1WR1A 1V1QA 1HR0W 4AJYB 1SE2A 4LW1A 1SGHA 2BVCA 1SNMA 2D07B 2KQ3A 3W5UB 3NELA 1ZOYB 2WXRA 3Q3NC 3OLMD 3KF6A 4P2CB 3MZ5A 4LDTD 3ZTCA 5HG2A 2VQEL 3PUVA 2UXBL 4FDBA 4HJ8A 1IZ6A 1QJOA 4CGYB 1KNEA 3JVZX 3HOXG 1KRHA 2L15A 3V60A 4UDUC 1LTLA 5CV7A 1N32Q 2A5HA 1X65A 4NJCA 1ONLA 4DV4L 2OF1A 3RMHA 4HWIB 2V3PA 3HOXB 1E8XA 2EXDA 1PH1A 3BS1A 3W1SA 4V190 3PGEA 2BWFA 3A9KB 4PZ6A 4N8X1 3HOYG 5C3XA 5LMUQ 3HOUH 3VR5A 1A8VA 3VTVA 1JB7A 4IUPA 5NUCA 3N52A 4O0AA 1FFUA 2K8BA 3U2SC 1VD2A 4L63B 1DOKA 3HOYB 3RLNA 1IXRA 3A1QA 1M90C 3EUB2 2JJQA 4RGNA 1SE9A 4WWPA 2HIXA 4PV1C 2MBBB 1QOAA 4NAWB 1K83H 3TN2A 3NPPA 2K5HA 5CBAE 1D3ZA 3A9JA 4IURA 2KANA 2NBVB 1YMHE 3H09A 5IT9E 2IX1A 4AYBE 2EELA 2WV6D 3E6ZX 1FRDA 3GOEA 3PTFC 2IYDB 4DNIA 3A33B 2KMAA 2LGSA 3H7PA 1FYCA 2KKCA 4J15A 4P1BC 1I4QA 1RL2A 2VZAA 4KSLC 1EEID 2K75A 2OOBB 1TWAB 1NR4A 4C2MH 4N58A 4HK2A 1XT9B 2D3AA 2NBWB 4QQBX 1G6ZA 3IG3A 2PPBC 2KO3A 3MAQA 2BGFA 3PF5A 3VYUA 1N33Q 1STBA 1PZID 3BVGA 2JXXA 4YTPB 1ZEQX 2DGYA 1C4QA 1CKNA 3GTOB 3EHVA 1RODA 3A5UA 5K36H 4LF8Q 1STEA 4RAUC 4W9HA 2ASBA 3N1YC 3RNBC 1RF2D 5COYA 3ND9A 4JI0Q 1G6PA 4OHJA 3OTOQ 3CCRA 3RN5A 1Q7YC 1TY2A 2DLBA 1F2RI 3CF6E 4JC0A 1XPOA 2G45B 3AM9A 3S14H 5D65A 1B70B 5BN3A 4IOCA 1HE8A 2KXJA 1AWDA 2ZXOA 4ZKBB 1KDBA 1U4RA 2F0DA 1AEXA 1X3QA 2IO0B 1YJWA 2MJDA 3S2DH 1WZ0A 4CYEA 2Z6KA 4DR6Q 3NVVA 1AYFA 1XX8A 3M95A 4YT0B 1VQBA 1WJUA 5CV4A 3S1RB 4S3SA 1CHQD 4L5QA 3J7AF 3PHXB 3D4RA 3D6CA 2PQAB 4YTMB 4OIJA 1KC8C 4DPGA 3KVFB 3W1SC 5FOBB 3QCAA 3E56A 1FMAD 1BUIC 4MSQB 1J9OA 2WDRB 2Z0EB 2AQ1B 4X6AH 1EQRA 3OIQA 2E2JH 3L0WB 2J52A 3P20A 4DR2Q 3DBRI 4LF9Q 2D0PA 3KLSX 3GTQH 4LF7Q 2X38A 1U4LA 2D3GA 2N9XA 2E8GA 2F0OA 3GZNB 5JJZA 4YWGG 3PO3G 2ACZB 1YI2A 3MC8A 3H6MA 1LABA 4KHZA 4XWTA 2AKWB 1E2VA 1JWUD 1I4RA 2JA8H 2E5LQ 1TU2B 2KMMA 1JRPA 1SDFA 3AE6B 1MBYA 1P16A 1GVPA 3PO3B 2AEHA 2AX5A 3PV0A 1JCKB 1CZWA 1MG8A 3H7SA 4GKKQ 4YHHL 3UDGA 2LJIA 1EZ8A 2VS1A 3MFGA 3SK8A 3TP6A 1K50A 1V2YA 5IN7A 1WGKA 1P98A 3EROA 3J80i 3SDZA 1ROEA 4IC7B 4B6WA 5KNDA 2O6VB 2Q2UA 2JEAI 1WRIA 2ZVNA 4QIWB 2D10A 3NZSA 3A4RA 1FPYA 1P7EA 3KF8B 1ENFA 3B1LX 3BZKA 4OWWB 2LZ6A 3VDYA 4MM3B 3T51B 3SVMA 2EYFA 4MDKE 2A19A 4RMAA 4QUFA 2F0NA 3IHPC 2SAKA 3KWVA 1PMRA 2K6DB 1HTOA 3L16A 1EOVA 1J8IA 3P4SB 1QT9A 1Z47A 1NCVA 1VQ7A 3DWPA 2KN4A 1IBLL 2OT2A 3NBHA 3AEFB 3SDLC 3OYYA 1EWYC 1L0XB 5HGTA 1IL2A 1B50A 4XDCA 3JAML 1BMLC 4K6LA 4NXMQ 3OOCA 4YSYB 3APDA 4PMCA 3QA8A 3R8BA 3DWGC 1E7ZA 5K5PA 4R8IA 1WTWA 5C23A 1DXMA 2X6LA 3K0YA 3MA2B 3UDXA 1D6EC 5LMNW 3IAS1 2Z6KC 1HZ9A 4LNIA 2M0AA 1MI2A 3K5MA 4BKSD 2ZW1A 2I07B 4LF6L 2PZTA 2PKOA 4RM8A 5G2NA 4TUUA 3NWTA 3CU7A 5FJ8H 1TVXA 1EIHA 1C4CA 2PMZB 3P1MA 2RPVA 3QB3A 1Y8NB 5CHWA 1MI0A 3PV1A 1V6EA 2OXPA 4GN4B 1JWMD 3S1NH 1D5ZC 1EF5A 3HGBA 4I7AA 5FR3A 4IWPA 5JEAH 1K73C 2ID0A 1WD0A 2N0SB 2CH4A 4WJPA 3GV3A 4KD4A 4EUTA 1WYDA 4LAAA 2XEWA 3NHEB 3F2DA 1HR0L 2D3BA 3SR1A 2ZCBA 1F9RA 1KXLA 3K7AH 4P74A 4F7XA 1TIID 1MPEA 5FO8B 2PLPA 4RFBA 1MHHE 3TUOA 3F1ZA 2LUMA 2Y5CA 3V6CB 3CWIA 4FXKC 4RHRA 3I7FA 3CF5A 5BYRA 1JJ2A 1V9PA 3TEHB 3BK2A 3QQ8B 3I4LA 2XSCA 1BF4A 2HT1A 3AN1A 4JI8Q 1U5KA 2AMCB 3HG9A 5GADC 3DM3A 2IPKD 1I94L 2Q2TA 2ZXRA 2KJHB 4KGRA 4MGYE 2RHSB 4EZLA 2DYOA 3SK6A 4C4VB 1N5WA 2NPTB 2NTTA 2MX2A 1TQOA 3OWFA 1V1OA 5EPKA 4R9WA 5C4XH 4DR5L 1EF1A 2NVXH 2K7VA 4WJOA 5C3EG 3ALBA 4NXNL 4LUOA 4HCEA 1LFDA 1ISNA 5H92C 2MPMA 2SEBD 1DJRD 1SROA 4IPDA 1WFQA 1VQOA 3ML8A 1AZQA 1HTLD 1LTGD 2XRQD 2LS01 3BWUD 2NR2A 1G8ZD 4P72A 4RCNA 5C3EB 2ZJRA 2PMZE 3PT2B 3AU5A 2BDNA 5GROA 3TSSA 2D2CC 5LLIA 4AJWA 2PNRC 1G51A 3B6YA 3R66C 1SRUA 5IYDH 5CORA 5ELNA 1YJJA 2KTRA 4X64L 4IFDG 1HZ6A 2O6VD 4PS8A 2VY3A 2QJLA 3G4SA 5IOIA 1UUPA 1JWSD 4PQXA 3HEJA 2PW5A 1C0AA 1TR5A 2DUDA 1UGJA 1CI3M 3UQAA 4RMFA 2CFMA 1RIPA 2TMPA 3A54A 1JWBD 1PLFA 3RZDH 2DZJA 4KJOA 4QCLA 4JX1C 1FVIA 2KQ7A 1E5WA 4PS3A 4BXXG 4ANXA 1IKMA 1Y1VH 2XIWA 4CQNA 1GPXA 3HS0C 1I50H 1WM2A 1F2RC 3NQIA 4HJ9A 1SJHD 2VUMG 3APCA 2O2VB 5BYSA 1PRTC 5I9OA 2BT6A 2B29A 1LT5D 5KIXA 1RRBA 2B2UA 4F88A 5C6AA 1OXXK 4X66Q 2LWPA 1A2TA 1I6HB 1A3UA 1BQQT 2CQOA 4LJZC 1R7SA 4XXEA 1UEAB 2WQYB 2VUMB 2KEEA 3J81i 4DHZB 1XLOA 2JY6A 1T0YA 1RAXA 3K9PB 5JPMC 2W54A 5IWAQ 1QOGA 5KHQA 3NTKA 3S2HB 3Q6BA 3HM6X 1E10A 2RF4A 3A0JA 2HHHL 1N60A 3KDFA 2BS4B 1NR2A 1E7VA 5CX3A 1EFID 4FP5D 2JQOA 1KM7A 1AP0A 1AARA 2KCMA 3M4PA 3M4YA 1XTDA 2A68D 4KD3A 1F2LA 1J7BA 2LGDA 3CIRB 4A3JH 2ZNVB 1E7UA 3E0EA 4KKUA 3GTPB 3CCLA 1WYGA 4LFAQ 2R93G 2MSED 2K50A 4IUTA 1NJIC 3M3JA 1UE5A 1VQ6A 2WXMA 1PYSB 1IBXA 1P8LA 3NP8A 5HY6A 1NYRA 1VZ7A 3S17B 1V1PB 1TWFB 2R93B 1EWIA 4HJGE 2RKSA 2BW2A 4GIVA 1KNAA 3NWSA 2DJGC 3L2PA 4DR4L 1VQIA 3BIID 3P2BA 4HRSA 3TL5A 2BCOA 2LVOA 1JJGA 3TBIB 2G4SA 2R7ZH 1QF6A 4A3GH 2DAJA 3NJTA 3A56A 4MTKA 2E2HB 2ZPNA 2GVAA 2R7DA 3UE0A 4JK1C 4HSPA 1CA6A 3U7ZA 3TZUA 2I38A 4PZ7A 3M3YH 3FRPB 5M5XH 3I3TB 4ARCA 1MFWA 5BR8L 5IIFA 3Q69A 4KDLB 4DHZE 5M3FG 5JVH3 5FLMG 3EA6A 5BYQA 4HN7A 3B08A 2LFIA 1XMOL 2PNHA 2Z1CA 2EE1A 4MJSA 3J80L 5M3FB 1HFNA 2K5PA 4A3FG 1J7CA 2QF7A 1UNSA 4IM0A 4YY3L 3GDEA 1PV4A 1DGJA 5M5YH 1XMQL 3DBLI 5DCNA 2B2UC 2EMSA 3AMZA 5JPNC 4G3XB 1B7YB 1SJED 4QF4A 5EKKA 1PH6A 1L2NA 1RTNA 1C77A 2KQSA 3LX0A 4A3FB 5CR3A 3D4WA 5I6YA 3I4NH 3IRBA 1GUOA 2N8NA 5BN4A 3ICEA 1EUVB 1DOMA 2EYPA 1T0SC 3MTNB 1U4AA 4K5WA 5C1ZA 4JYAQ 2KN5A 4KY5A 5DPWA 1E2WA 1XLPA 4DHJB 3H1UA 3GTKB 4LFBQ 3DWAA 5ELDA 4DAYB 4EEWA 3WCQA 4CHTB 3DOWA 2NUCA 3J7ZC 1YNNC 1TZ1A 5JHBA 2INDC 5HKHA 1HNXQ 1WX9A 2KT7A 2LJ5A 4A3MH 1R4PB 4CBVA 3KK7A 1LT4D 1K8MA 4RKBA 5M5WB 1A5RA 1GD7A 2EDGA 3F2UA 4KKJA 1KAWA 4K6DA 1FXAA 3VR4A 1NMGA 3S16B 3PIO3 1R9TB 2DNEA 1WXSA 2D2QA 2NBUA 3VFKA 4PK1A 4DR1L 2ZTCA 3ZRCA 3ZNZB 2JA5H 4DUZL 2PTLA 2FJ2A 2CW0D 4NKLA 2A6HC 1F9QA 2N7JA 4BY1H 3Q3FA 2DBYA 4NY0A 5H8YE 1WTVA 4G4KA 4POGA 4C3JH 1X56A 2DZIA 5F2DA 2JZ3B 3UI3A 4MT5A 2BS3B 4NPNA 2QDBA 2J7QB 2RD0A 2F4IA 1L6UA 2XWBB 1JE4A 3PF4A 3ZDTA 1IKLA 1C79A 4DV7L 1GXDC 3R2IA 2EKIA 1UWMA 4GN5A 1HH2P 2K5DA 3NSWA 2AL3A 3A4SC 4LNKA 2I5LX 4OELB 5IOCA 1Y69U 1XNRL 2QSDA 4K8JA 3VTWA 4AQYL 2KFKB 3APFA 2F1MA 2C5LC 1SMYD 1QUQB 4GNXB 3HVZA 2IHFA 4CKBA 1O78A 4N9F4 2WP9B 1XLQA 3QARA 4FYDA 4FLHA 3HOZH 1WD1A 2JU6X 4HIOA 1DCZA 1LTAD 4B3SQ 2MBOA 5EBCA 1L1OA 1L0VB 1SXTA 3L9AX 3NVYA 2GB1A 3SFDB 3GO5A 5LXIB 3NE5B 1JC7A 3DPDA 4GN3B 1GG3A 1WXQA 1TXYA 1KQSA 5DPRA 3WAOA 1K53A 1T9HA 1K3RA 5JVG3 4B3RQ 1QNKA 2K14A 2KD0A 3GV6A 1YOVB 4URKA 3AULA 3Q3OC 5CV6A 2KDEB 3ZLZA 4JI3L 5IYBH 5IGDA 4Q0FA 4ZRZA 2XVSA 5JOBA 1HNZL 1HZ5A 2HJ1A 1XNQQ 3U9OA 2N55A 2RQXA 1IBKL 4DR7Q 3UQBA 5C4JH 1YNTE 1V8QA 4A9AA 3PO2H 4JG2A 4N9TA 3EBEA 3H3VH 1YD8U 4D2KA 3K6OA 1TWGH 3A7AB 2VQFQ 4JIOU 1GUWA 3SR6A 1DGSA 1PXUA 1EY0A 1Z2MA 5LMNQ 3L54A 1K9MC 2DY8A 3ER0A 2KYWA 1UWXA 2FUG1 2HQEA 1Y1WH 2PI2A 3Q8DA 2MFIA 3S1QH 4JLCA 1E0BA 1QOFA 3W9CB 2B8GA 4HR7B 2KTRB 2ZCCA 1H8CA 3UGBB 4DHJD 3PUWA 2BB5A 1G2TA 3GTLB 2H5XA 1BVSA 2RCFA 3I72A 3U30A 2B3GA 4NJ6A 5E1FA 1J0GA 4YWKA 4EQOA 3P7JA 4GOPA 1JE5A 3IFDA 1YNJC 1D5XC 4CDDC 2BYVE 4W9JA 3N1XC 3ZUNA 2RHQB 1SSNA 1KL9A 2DNCA 2GI9A 3HRDD 2L0CA 3HHMA 2A8VA 3IXSA 1LACA 1X32A 2E2DC 2CU3A 3WALA 1EY6A 1WGRA 3P4RB 1UE7A 2EYLA 3EQLC 4HMIA 2O5IC 4A3LG 3JYUA 2GBNA 1VQ5A 1SIJA 5H1SE 4FJVB 1YIWA 1DM0B 4LUZA 3K58A 1Q82C 2AQ3B 3OJ3A 4EFOA 3X3MA 4LFCQ 2O5JC 5DPSA 4DAVA 4HIMA 1BO0A 1XPUA 2J53A 2V1YA 3RUZA 1VMCA 3KDFB 1PTOC 2V1CC 2AWNA 2JSVX 1L1OC 1UE1A 1VF5C 4P16A 1S5BD 5DLQE 3K8AA 1Q3LA 4ZAIA 2WXNA 1HQMC 3RULA 5EDSA 1N32L 4R4CA 4LNQA 4B95A 4JI1Q 1KIXA 2QCPX 1FXIA 4G0NB 1P7FA 2LVQA 1RCVD 2OCEA 3QX1A 1KAAA 1EZ6A 1VQ4A 5LL6S 3Q2AC 5E6OA 1O80A 4KIKA 3WAMA 1IBXB 4GLAC 3RN2A 2W9NA 1CSQA 3X3NA 4YCWA 5LMUL 4FF2A 2W3RA 4KKSA 1R4QB 2BA1A 3MHBA 2B63G 4Z9CB 2J42A 2R92H 1ZUD2 2JRHA 2YVCA 3JSVA 3DWQA 3K57A 1A15A 1ILQA 4P75A 2NMQA 1A63A 1LTSD 5J22A 5IO9A 4A93H 3PVLA 4KKIA 3I63C 4MH8A 2B63B 1WGDA 3K80C 5G5GA 3KFUA 4BY7H 2KHWB 4YTNB 1VR9A 5ELCA 2AUKA 4N6EB 3FDTA 2VNUD 5TR5A 4REZA 1GUNA 2AL6A 5G3LF 4GDLA 5GXGB 4HVBA 5A2QE 1SMXA 1VQHA 1U0LA 5DM63 2L1BA 4GOPC 3QOJA 2MRPA 4QJFA 1E24A 4A3EG 3S15H 2GLSA 1MKHA 3I55A 3HZXA 4MJSB 5M3MG 2XBBC 2EY6A 2W82A 2K33A 4IO9A 1N33L 3PRZA 1AE2A 1Y8OB 4G11A 2INPE 4A3EB 3QK0A 1XXGA 2D0OA 3D8GA 2VXWA 4LF8L 5M3MB 3S1MB 2P5ZX 4QGUA 2ASQA 2A6ED 2YU9B 3A74A 3AEGB 1JOOA 4OWXB 2JE6I 3STBD 1Q1EA 1SYGA 4DUYQ 4JI0L 1MIUA 4JI5Q 5T1GA 2NVTH 3DEPA 4RF1A 2G4DB 4IPHA 2CCZA 1SYBA 5E6NA 4GLSC 1EO6A 2KVMA 3PS6A 1WE7A 1WWTA 3UDIA 1H9SA 4KGTA 2G9HD 3FAHA 3PCOB 3OHXC 4J3OD 4TRDA 5JAVA 3Q0AA 3Q8FA 2M9VA 3R7RA 3G7LA 1RTOA 5A35A 1HA6A 1L5PA 4HDOA 1EY7A 1EU4A 3CCSA 3HP3A 3DBHB 2FIDA 4DR6L 3OAWA 4H7BA 1TKWB 2MA9B 2IX3A 4NW2A 2Q8TA 1EQTA 2W55A 2Z4IA 1QLBB 3E9IA 3VHTC 3DHIC 1EY9A 2K4KA 1QZEA 2D11A 1SYCA 3MXNA 4N9PA 2OJWA 1MHWC 4A3PA 4M0WA 2GRIA 2IL8A 4DR2L 1F9PA 2NVUI 3V6EB 1IP9A 3DQVA 4JI7Q 3EVQA 4LF9L 1GC7A 4M8MA 1QCBD 1I3QH 5IYCH 2M1MA 3LJ3A 4WJNA 4XZ4A 2Y0SG 4LF7L 1PH3A 1V80A 2JA6H 1R4NI 4Y7NB 2OWOA 1EIYB 4ODGA 4YL8A 3S2AA 2E74C 2J4XA 3FVQA 4RG1A 2E5LL 2Y0SB 4BBSH 4JI4Q 3PLUA 2XGTA 3R7QA 3ZKJC 3ZJUA 3PSEB 1SNOA 1OXSC 2KCNA 3FPUB 1FCCC 2CWPA 3IAYA 2HJ8A 2M56B 4FVMA 2ZW0A 4C00A 2ES2A 1ZE3D 4GKKL 3H3VI 4P7IA 2N9EB 4I7ZC 3ZXRA 1MGSA 1OTCA 1PQSA 3ENEA 4G7OC 2H88B 3PUYA 3CD6A 3HOWH 2JRIB 1LT6D 5L95C 2KLCA 1E2ZA 4UP7A 1FO4A 4XIGS 2Q2IA 4P71A 5TSSA 3W3AA 1EU3A 2YEPB 1TYGB 1SNDA 1RDPD 1UELA 4TQUS 1QOHA 4OO1G 1JRUA 1NI3A 2L00B 3CQZH 3CHBD 3MXPA 3LWUA 3RNUA 2R2QA 5CHVC 1F9JA 5KEEA 2KWCA 4KGSA 2QGQA 4X3TA 1HEZE 4RWSC 4WQMA 1EOTA 4QB4A 2DZKA 3LNNA 4BBRG 4M1UB 4A3KH 1F52A 1EWHA 2MP2B 3VDZA 2GBMA 1GUSA 4KJNA 2WB1G 2K01A 1PGBA 2CHBD 2Q2HA 2C7HA 2VL6A 3S24A 2QW7A 1YJ1A 1A70A 1UWVA 1HA5A 2LRUA 1C9FA 1O7LA 4BBRB 4NXML 3A7LA 3ECIA 2FHTA 4F87A 4GDKA 3H94A 1NSNS 4MEMA 3FC4A 2WB1B 3MJ5A 3CCVA 4C3HG 1OEYA 2CHZA 2CU1A 2LEKA 2WWZA 2CHWA 3BY4B 3PQIA 3ULPA 3WA0A 1X6OA 2EJFC 2KHJA 4ID6A 1VQMA 2K39A 2Y0SE 3TS2A 1GOZA 2EXZA 4C3HB 4NQLB 3R3MA 3HVDA 4XX5A 1B3QA 2KWVB 2K9XA 5KYIA 4WWMA 1IW7C 1N9WA 2RDGA 2Z9HA 1DOXA 1B53A 1QG7A 3AXCA 4A3CH 2BYEA 1IHZA 2HTME 1WOCA 2IZVB 2ON8A 1C7YA 2BE5C 4AWJA 3JAME 4UP8A 1XJVA 2AWOA 4UY8C 2EOTA 2K5WA 2WINB 1VCBA 1LM0A 2L83A 5J39A 1TY0A 2ZEQA 4GXBA 1BCPC 3QAQA 2IY5B 4CJ1B 3ERQA 3G48A 5IY0A 1L4DB 4WRDA 1WI0A 3ZXVA 1K8GA 4XYQA 1DOIA 4Y52H 3SE0A 1PGXA 5FK9C 3GD7A 1RLFA 4DR3Q 3HOXH 3LB8C 5HURA 1JT8A 2KECA 2IGGA 1RJTA 4JI8L 4I6NB 1WXMA 5DPTA 1TKYA 4ITKA 2M00A 3NK9A 2F0QA 5IT9L 5IP7H 2B2YA 2DJFC 2UXCQ 1STHA 1WM3A 2JWUA 5MPOA 2F0HA 1IYUA 1UZXB 5CV9A 3SD5A 1PFSA 3AMUA 2LFNA 3W1BA 4XDXA 4RA8A 4A3DG 1NENB 1TT5B 3PUZA 1C1YB 2VH1A 2WB1E 3GTMB 4DV3Q 1PTOH 3SEBA 2I0QA 3K9OB 4HJ7A 4GKJQ 3PZ7A 3RZFA 2N88A 3KH0A 2FCNA 1YIJA 1TS3A 2NTSA 2PQEA 1VRAB 3FHWA 4A3DB 1MG4A 1WGHA 2DYMA 4XT1B 3L3OC 4BKTA 4FF1A 5KNBA 2PI2E 3CPWA 5JZEB 2N1WA 1EWCA 2WNMA 3BK1A 3MHSD 2JYEA 4DF7A 1H95A 2IO3B 3TBLD 2C9WB 3HIZA 3TEXA 4ALPA 5HFYA 2L1AA 2NS5A 2A1AA 1NYQA 2BPSA 3NZUA 4NAMA 1OQYA 4RKLA 5M9OA 2K32A 4IM2A 4TKOB 3UDFA 3DWMA 3BVZA 3PIOA 4MH0E 4NNJB 2K1FA 4Q2JA 4FJYA 3N20C 5DM73 3GTOH 3MWYW 2KQ4X 1VZ8A 4W9EA 3RN9C 1WMHA 3GS2A 2SDFA 2HQLA 3H9DA 4JPSA 1STAA 4MIUA 4ANWA 2C35B 1P1AA 2DYBA 3HRZC 5GAGC 4L2YA 4K5XA 1GJXA 3D31A 3OSOA 3PLVA 4X66L 2WYQA 1B9MA 5IP9G 1KOTA 3I4OA 4KN4C 1L7YA 2MLBA 2G5DA 4OXPA 4JI2Q 3CPFA 4GDLB 2XN9C 2UXDQ 3F2BA 5KGUA 1A62A 1GUGA 1WTRA 1XCQL 3FPPA 3KBGA 2KFJA 3V96A 5IWAL 1QB5D 2A5UA 2EJMA 2IHEA 5EBDA 3TQYA 3M4OB 2WLBA 3P4PB 5KNCA 2KDBA 1RFKA 2NYZD 4LTUA 4LJOB 4H2AA 3S1RH 1BNZA 3TEYA 1HXYD 3V2TA 4E6IA 5IGGA 3AB9A 1UH6A 3MTSA 3I90A 4HCNB 3KLWA 2UU7A 2H89B 1Y56A 1XD3B 2WIIB 2B2YC 2JQRB 1X3GA 2PJHA 4RHSA 5CV8A 2KOXA 4LFAL 2L05A 2R2OA 2RPQA 1UE6A 4IUQA 2RSUA 1H9SB 1ET9A 2K1BA 3TS0A 3LYYA 4ABNA 4KZCA 1VQGA 4EQ5A 1HTQA 4P73A 1N6ZA 3C0RB 1JMLA 3RLOA 4OZBA 2UYZB 4GSWA 1SBBB 2ZT9C 3KF6B 3H3VC 4HEA1 4QL5A 1YN4A 4KKTA 5FLXc 1B2TA 3PO3H 4HKQA 2PW7A 4S0RA 1PZKD 2VW9A 3BG3A 1WTQA 3T8MA 4ASWC 3T1YL 1QZHA 5AUIA 2NWGA 2NVYB 3BDCA 2LMCA 1MD2D 1XYIA 3FKIG 2E75C 4YXDB 2LVPA 3Q8AA 4BBNC 3C1FA 4IJHA 4DXGA 2E2IB 1CA5A 3DXJC 3L0OA 3ULLA 2YTYA 1MVKA 3M3YB 2K3UA 5M5XB 2UUCQ 3KJPA 2MBQA 2CVRA 1PHJA 1SLJA 3GB1A 3FKIB 1I4XA 1KRTA 1UBIA 3IFWB 1PA6A 4NJ7A 3NVZA 1OXVA 4A76A 4I6LB 3WANA 1TWHB 2RDFA 3T1HQ 1RYJA 3IT6B 3J7AV 4K1RB 1KH0A 1X1MA 4J8QA 4R1JA 3A1QB 1H9RA 4JPBW 1P3QU 2WXJA 2DZMA 2GBJA 3Q8CA 1E8YA 2PZWA 3ZIMA 1H9MA 1PVOA 1PH7A 3DHQA 3GP7A 5ELBA 3A9JB 2I2YA 1GKHA 4JBMA 3HM3A 1FNUA 2F0JA 3RUIB 1IGCA 4IM3A 3ITPA 1Q5WB 3E9HA 1G91A 1F2MA 3FMCA 4XGAB 3H7PB 4X62Q 4JYAL 3FKYA 3GE3C 1HUNA 2C7MB 2ONQA 2FINB 1M4VA 4K3CA 4LFBL 2WX0A 4W9DA 3VR8B 4BA2I 1S5DD 4FA6A 2KHIA 2BOSA 2JZPA 3NG0A 4A3MG 4JCVE 3QWNA 4PMBA 1HNXL 1QE6A 1LXDA 3I5JC 4J6IA 3V61A 1CKNB 1MHXA 1MSGA 2DY7A 4BAXA 3QOLA
chains in the Genus database with same CATH topology
5JEAJ 2CJNA 3TZDA 4DU9A 3NBIA 3PUXA 1PFDA 1MSHA 2KHSA 3Q8EA 2JEBI 1ZYRC 3GTJB 2OHFA 3BZDB 2K03A 4IDIA 4WFN3 3TP5A 4MACA 3AE2B 2QEJC 4DNTB 3VYRA 2F0KA 2YEPF 3D3RA 3OW7A 3KBXA 4NZLB 2LHEA 3VR9B 2RA4A 1C78A 2O4XA 1SYFA 3OWEB 2WU5B 2TSSA 3U9SA 3ZQ4A 2HCIA 5C0XH 4UAIA 5EE3A 1FFVA 2NB0A 1QQRA 1HTPA 2MGSA 4JBWA 1N62A 1IL8A 4FXDA 5ELEA 3HOVB 2EYMA 1GUTA 5CGKA 3CKIB 2A69C 5EJWA 3V3XA 4IZ8A 2B2TA 1A3VA 2MJ8A 1JOQA 2PCFB 3CRLC 2I46A 4YSXB 4X3KA 3C2PA 1CZPA 3I4MB 1OXTA 1KTKA 1LT3D 1EIGA 3MC0B 4IFDH 1PFMA 4HKZE 1E0ZA 3WOFA 2R3ZA 5D7GA 3AE7B 1CHPD 2G1EA 4XQNA 3RLFA 1DOYA 1F77A 1NUCA 3I3CA 3B2GA 5BMHA 1NAPA 2J0TD 1SAPA 2KJXA 4WH4A 2EJGC 2F0IA 1D1KA 2PO4A 2WS3B 1PDXA 1X3PA 1SF0A 2IGHA 3FILA 4FF3A 1VDZA 1XO3A 5I2YA 3R2TA 2HUGA 1EL0A 1AN8A 1EM7A 1KDCA 2NVQB 3VRBB 5G3LD 1FIQA 2F0SA 1RWSA 1I4HA 1ENCA 1HCZA 4OL7A 3NUCA 3C3LA 1C48A 1YQ4B 2VZKB 1ZXHA 3MEHA 1PRTB 1QILA 2BA0A 4EQPA 5C4ZA 3TDQA 2ICIA 2WP8J 1WCMB 1I6VC 1SB3C 3J81E 2WXQA 4G57A 4C3IG 2B2TC 2JP1A 2D5DA 1B44D 4RGMA 1DYQA 3ZGZA 4CJ2C 4C3IB 1LO5D 4MN3A 3SFEB 4JWSC 1SE4A 2K0PA 2F0FA 4QUCA 2EY5A 3P4QB 1SYEA 1YN5A 1SSOA 3GTGB 1Z7TA 1H9KA 2MJ3A 5FKAC 3VR2A 1ZXTA 3A8JE 4ULLA 3BDOA 3DUZA 4U673 3VR3A 1KABA 4A3IB 1SFOB 3KQ4A 2EZVA 1Y8PB 2WKCA 4XTCS 3ZJTA 3ND8A 4K5VA 1V8CA 4IALA 2V4IB 3AE8B 2ENBA 2EY1A 4ZHPA 2V3NA 5E4XA 2LHDA 3MHZA 1B3AA 2KCCA 2IWHA 4TSSA 1DZ1A 4DK1A 3Q8BA 1JQ4A 4KI0A 1N63A 4A3BB 1VJKA 4IUNA 5I2XA 1FD6A 5C5LA 1F0ZA 2G9DA 2EYJA 1CZGA 2Q5WD 5FLXE 2Q8RE 1FCLA 5EKIA 3M7GA 5C44B 1EY4A 3H0GB 4US9A 1PZJD 2B2WA 4C7ZA 1D2BA 5DNFA 4ZUJA 2L11A 2EY2A 2LGIA 3NVWA 5E3FA 1SNQA 2VZKD 3A8IE 1PRTD 5C0XI 4A6QA 4N59A 5FO9B 1W6KA 2QMTA 1VCIA 2XNAC 3AEBB 4OZCA 5D3IB 1ENAA 2IGDA 2MJEA 4NDXA 2F0EA 4X3SA 4LMQD 2MP1A 1Z6HA 4CJ0B 1FGBD 1J7AA 3KF8A 3NTIA 3EJIA 1PDQA 3NHHA 4IFDI 3P42A 3HOUB 3OIPA 1XEEA 2EYOA 3T3NA 1S4ZA 5LHY1 2INNE 5C3JB 3VYTA 2IW3A 4I65A 1C8CA 4RGTA 1K83B 2WXFA 4EE2A 2PIAA 3AE9B 3P75A 4HAEA 5C3WA 2JXTA 2MHVA 1V97A 1B1ZA 1ACCA 4C2MB 1WVLA 1A3TA 1YJIA 5K36G 3IAM1 2PMVA 2FBWB 3QJYA 4G7ZC 4FXGC 1VZ6A 4JE3B 3I70A 1GB4A 1WTOA 5EKLA 2B2WC 2H1EA 4KX6B 1SE3A 2PYKA 1ZKOA 3B2FA 3RD4A 1DOLA 3S14B 4ZRPA 3QO2A 2B8FA 2WKDA 1ILPA 4C1NI 4RCOA 4OIKA 3OPOA 1RM6C 2L9HA 3S2DB 1XCTL 3HUIA 3E5SA 3VQIA 2WXGA 3L7ZC 3A8KE 3URYA 2HDEA 1U4MA 4FF4A 5IODA 3NXWA 4DNRB 1BUVT 1XTCD 5CC4A 1YNND 5C4HA 2BBCA 4J1MA 2E2JB 1STGA 1JALA 3TMEA 3GTQB 5CV5A 1S5ED 3ZYYX 5EQ0A 3H8HA 5CYUA 3K5LA 4HROA 4JWUC 3OMGA 2R6GA 2JA8B 1EQVA 3N6RA 1SEBD 5A2QL 3KWLA 3AH7A 1T3QA 3GQBA 1TT2A 2A6HD 2O2LD 4WJWA 1QKZA 2RMMA 4IQZA 5CBEE 4HEDA 3HKZB 1C76A 4DQOC 1PTOB 4A55A 2NN6H 4C80A 1ML0D 4USAA 3Q6SA 4OGQC 2A68C 2V0GA 2WXLA 4XQQA 4B9WA 1PRTF 1JQYD 1FD7D 4O42A 2MUYA 3TP7A 2E6XA 1IGDA 4NMZA 2F3VA 4KN7C 1SYDA 1VMPA 4TQ0A 1WSPA 2L32A 5ISRA 4NP5A 2BS2B 4HMJA 4X3UA 3NUHB 3FEWX 4RGOS 1CQFA 4K2KA 5JEAG 5T1IA 2QKIC 4DAPA 1TZOA 2E3TA 4B0EA 5I4DA 5LL6X 1HHVA 2XWJB 3S1NB 1ZXIA 1V1PA 1T5XD 2LY7A 1K51A 2JYOA 4ZK9B 4PT5A 2SNSA 2KACA 1B9NA 3I73A 2VB3X 2X6GA 3P1HA 3I9V1 1PGAA 3K7AB 1XF5L 1RKNA 3IT4B 3TEWA 1YNJD 2F0LA 3AU7A 2AUJD 1JW9D 2WXKA 1L6VA 1YN3A 5C4XB 2NVXB 3I91A 3T4AC 1CJEA 3D4DA 4ZQ3A 2F0GA 5IGFA 4LLGM 4K2LA 3I8ZA 3MVVA 5DAUA 2JX5A 5EPJA 4WIPA 3AEDB 2KOLA 2PW9A 1LV9A 2L52A 1PFNA 1VF7A 1HQRD 4XYOA 4KTAA 1OQQA 1PTOD 2EYHA 1JORA 4DAYA 4BA1I 3AE5B 2F03A 3NRZA 4OO1H 1BXTA 2CW0C 1FM0D 3RZDB 1NVID 4K14A 1N5XA 3NZ3A 3SHLA 1Y1VB 1PUTA 1F9SA 1I50B 4QMGA 1OQRA 3E0JA 1ESRA 4DN4M 1YQ3B 4V0BA 2C9OA 2WU2B 1Q8IA 1ESFA 3AE4B 2K04A 4KMUC 3L4PA 2ZXPA 2AQ2B 5KYLA 5D3DA 4PMWA 1FNVA 1SMYC 2RSNA 3BYYB 2F0UA 1LTRD 2L4NA 1EYDA 3ABVB 2BB6A 2OEDA 2BTEA 3S9WA 1C4AA 5E4WC 3E9SA 2MH7A 2A73B 3QIAA 2Q8IB 4US8A 4HTHA 4A3JB 1AZPA 1A6XA 1FNWA 1DONA 3TP8A 5D14A 2ICEC 1H9JA 5JXVA 3BDLA 4ZRQA 1W6JA 1S5FD 3H91A 4BWGB 3T53B 2RSOA 3VR6A 2MEKA 1JWAD 4H13C 1VLBA 1GHJA 4ZLTF 3DMUA 1EYCA 5EE9A 4U68A 4A90A 1AW7A 2H4OA 2GA4B 5C0XG 2R7ZB 5HHDG 3WDNA 4A8XC 4A3GB 1Q12A 1AFPA 2F3WA 4ZYSA 1CTMA 2NN6I 2SOBA 4C56C 1T6BX 2M2LA 3BVMA 1BCPB 4ILWA 3KLSA 3MP9A 5BMIA 1CM9A 1ZDVA 4WORA 1OO9B 2L55A 5EE1A 1ZP0B 4ZUIA 1II3A 1FEHA 1KLUD 1LTTD 4B08A 5M5YB 2N9LA 3K59A 2D5GA 3PO0A 1K52A 4EQNA 2D9UA 1KLGD 2Z4HA 3I4NB 2CJOA 2PVGC 4MHEA 4DK0A 3SK5A 1ICWA 3W2DA 3J80E 1G2SA 1F2YA 1QWYA 4M8AA 2Y3AA 1TKGA 2JA7B 2X69A 1FR3A 4GZYC 4IOIE 4RH6A 5J1ZA 1KDAA 1GAQB 4KHVA 1PFBA 2WXIA 4XE0A 1XLNA 1BBXC 4P6VF 2SNMA 3C46A 2KWDA 3EFXD 5HI1A 4KK7A 4KY6A 4A3MB 3PZ8A 2F0VA 3TEZA 1WTXA 1TS4A 2KUMA 3VA5A 3DM1A 4GDKB 4ZHOA 1I7HA 1EYAA 2JA5B 1V43A 4C3JG 3LWEA 2B39A 1E9MA 2Z8LA 5EPLA 1WTPA 1PTOF 5DEHA 4BY1B 4B0MA 4XDDA 4WAFA 2L12A 4C3JB 4K8IA 2FMCA 4R8NA 2K6AA 2DN8A 3AV8A 1TS2A 3C1EA 3KUPA 5T8IA 4L23A 2BDOA 1B4OA 1JROA 1B9RA 1IW7D 2NZ1D 1KFYB 1A2UA 3A55A 3HOZB 5BMGA 2XRSD 4B9XA 2BE5D 4FO2A 4G7HC 3AE3B 3J9CA 1M8AA 1JB3A 4CKCA 2A6EC 1HRJA 4OO1I 1BCPD 2IT1A 2JYTA 2N9KA 1RD9D 3R93A 5CMDA 3U52E 3R3OA 1O7YA 1K8OA 4FNFA 3DEOA 5C4JB 1CK1A 1JICA 2IX0A 3PO2B 3OMCA 4BS9A 3W5VB 1S5CD 1TWGB 1KF6B 1U9RA 4DGZA 5EE0A 4DFAA 1N61A 1Y1WB 3S1QB 2LKVA 2WDVB 2K05A 4XWWA 4LK1C 1BR9A 2YYZA 2KEDA 5BN5A 1SNCA 1E7PB 1HFGA 3G6JB 3AE1B 2JXMB 1I4PA 5FO7B 2KDMA 2HDLA 3SK4A 2PZUA 2E76C 1UAPA 1GHKA 3AEEB 3ONAB 2PVOD 3UI2A 3MXUA 1LLRD 2QILA 4WURA 2WAQB 1Q1BA 2OEOA 4H44C 2F0WA 4L6TB 4XT3B 2EPBA 1L4ZB 3VYSA 2W3SA 2KAJA 1T5EA 3RZOB 3EGRA 4ZOHC 1CT1D 2F0TA 3U4EG 3NTHA 4L1BA 2B2VA 2QIEB 1D5MC 4OVZA 4IUUA 5C0XJ 5EGTA 1IUEA 4TMAB 3K5OA 4F8MA 1STNA 2F0PA 3K5NA 3MFYA 3WOEA 1O7ZA 1DD2A 1LTID 2BYTA 2M19A 2K22A 1OFFA 2R92B 2WXHA 1EY5A 5IGBA 5AFWA 4ME5A 2LMCB 4IFDJ 1HPCA 2VB2X 3KLRA 1JOKA 3NQTA 4A93B 2IJ0A 1SNPA 3NS1A 1E6EB 3QG1A 2WDQB 1Q10A 4H0LC 1EY8A 4BY7B 4EGVA 3IFTA 2B76B 2F0MA 3N9YC 1Q90A 3VRAB 3I57A 3ETRA 3PMFA 4XQJA 3RFZB 5AUKA 4R3DA 3S15B 1LTBD 3AEAB 5KRUA 1IYVA 2WACA 3T16A 3IL8A 1F2ZA 4IUVA 4C7YA 3T56B 2D62A 2R61A 1ZDXA 3J7YW 3VA7A 4ARIA 1BOSA 1QOBA 2Y5PA 4KY7A 3AB5A 3J81L 2NVTB 2C5CA 3AECB 4OW0A 2K5QA 4LK0M 2B2VC 1C4PA 1BCPF 5C5MA 1EEFD 4CKEA 3T3OA 3SXHA 1VDVA 2FE8A 3Q22A 1CFMA 1TWCB 4OZAA 3T13A 1TS5A 1JR0D 4L8JA 2HDMA 3LXFA 1XWEA 4HSVA 4PNYA 5IGCA 4FXCA 4HCSA 1I3QB 5I6WA 4DXFA 1TKEA 2JA6B 2KA7A 1OXUA 1ZYRD 3IKJA 1U4PA 1L0YB 3Q24A 4BBSB 1D1IA 2L5TA 3M7NA 3PIP3 1G291 2JSOA 2HCCA 1FRRA 4C1NK 4YIJA 4YSZB 1QNUA 2NN6G 3HOWB 2A74C 3C8YA 3O13A 5I9PA 1PYWD 2K28A 4AQ7A 3MXGA 1D4BA 1TJEA 2IDYA 4AS1A 2CQAA 2EVBA 1BDOA 5ELFA 2RBMA 3CQZB 3ZJVA 2RVLA 4O1NA 3BYTB 1RHPA 5E6JA 3CRKC 5FLXL 4ZKCB 2WXOA 3Q23A 4TQ1A 2DWQA 3P63A 2RDHA 2FMMA 4IN3A 4A3KB 2NBFA 5LNK1 2A69D 2FFKB 1HUMA 4EVOA 1CQVA 4Q5VA 5C2TB 4RNAA 3D6WA 3M85A 4IKGA 1GB1A 1I4GA 5G5HA 1STYA 1ET6A 4DA2A 4KV6A 4J6HA 5IGEA 3FILB 2J7ZA 3RPFC 1NEKB 4AYBB 3B9JA 2V4DA 1ZPSA 4RF0A 2WXPA 3V05A 1SE2A 1SNMA 3W5UB 2KQ3A 1ZOYB 2WXRA 4P2CB 3MZ5A 5HG2A 3PUVA 1QJOA 4CGYB 1KNEA 1KRHA 4UDUC 5CV7A 2A5HA 4NJCA 1ONLA 2OF1A 3RMHA 2V3PA 3HOXB 3BS1A 3W1SA 4V190 5C3XA 3VR5A 4IUPA 5NUCA 3N52A 1FFUA 3U2SC 4L63B 1DOKA 3HOYB 3EUB2 4RGNA 4PV1C 1QOAA 4NAWB 3TN2A 3NPPA 5CBAE 4IURA 1YMHE 3H09A 5IT9E 2IX1A 2EELA 2WV6D 3E6ZX 1FRDA 1FYCA 1I4QA 1EEID 1TWAB 1NR4A 4N58A 1G6ZA 2PPBC 3MAQA 3VYUA 1STBA 1PZID 3BVGA 4YTPB 1ZEQX 1C4QA 3GTOB 1RODA 5K36H 1STEA 4RAUC 1RF2D 5COYA 3ND9A 4OHJA 2DLBA 1TY2A 1F2RI 3AM9A 5D65A 5BN3A 1AWDA 2ZXOA 4ZKBB 1KDBA 1U4RA 2F0DA 1AEXA 1X3QA 2MJDA 3NVVA 1AYFA 1XX8A 4YT0B 5CV4A 3S1RB 4S3SA 1CHQD 3J7AF 3D4RA 3D6CA 4YTMB 4OIJA 5FOBB 3E56A 1FMAD 1BUIC 1J9OA 2WDRB 2AQ1B 3OIQA 2J52A 3P20A 3KLSX 2X38A 1U4LA 2F0OA 4YWGG 5JJZA 2ACZB 3H6MA 1LABA 4KHZA 4XWTA 1E2VA 1JWUD 1I4RA 2KMMA 1TU2B 1JRPA 1SDFA 3AE6B 1MBYA 3PO3B 2AX5A 3PV0A 1JCKB 1CZWA 2LJIA 1EZ8A 3SK8A 3MFGA 3TP6A 1K50A 1WGKA 1ROEA 3EROA 3SDZA 5KNDA 2JEAI 1WRIA 4QIWB 1P7EA 1ENFA 4MM3B 3T51B 3SVMA 2EYFA 4QUFA 2F0NA 3KWVA 2SAKA 3P4SB 1PMRA 1J8IA 1QT9A 1Z47A 1NCVA 3DWPA 2KN4A 3AEFB 2OT2A 3NBHA 1EWYC 1L0XB 5HGTA 1B50A 4XDCA 3JAML 1BMLC 4K6LA 3OOCA 4YSYB 4PMCA 3R8BA 3DWGC 5K5PA 4R8IA 1WTWA 1DXMA 2X6LA 3K0YA 3MA2B 3IAS1 1D6EC 2M0AA 1MI2A 3K5MA 2ZW1A 2I07B 2PZTA 2PKOA 3NWTA 3CU7A 1EIHA 1TVXA 1C4CA 2PMZB 3P1MA 2RPVA 3QB3A 1Y8NB 1MI0A 2OXPA 1JWMD 1D5ZC 5FR3A 3HGBA 5JEAH 2ID0A 1WD0A 2N0SB 3GV3A 4KD4A 4LAAA 3SR1A 1F9RA 4F7XA 1TIID 1MPEA 5FO8B 2PLPA 4RFBA 1MHHE 3TUOA 2LUMA 2Y5CA 3CWIA 4FXKC 4RHRA 5BYRA 3BK2A 3I4LA 2XSCA 1BF4A 3AN1A 3HG9A 2IPKD 2ZXRA 4KGRA 2DYOA 3SK6A 1N5WA 2NTTA 1TQOA 3OWFA 1V1OA 5EPKA 4R9WA 2K7VA 4HCEA 5H92C 2MPMA 2SEBD 1DJRD 1AZQA 1HTLD 1LTGD 2XRQD 2LS01 3BWUD 1G8ZD 4RCNA 5C3EB 2BDNA 3TSSA 2D2CC 2PNRC 5CORA 1YJJA 4IFDG 1HZ6A 2QJLA 1UUPA 1JWSD 4PQXA 3HEJA 2PW5A 1TR5A 1UGJA 1CI3M 2TMPA 3A54A 1JWBD 1PLFA 4KJOA 4QCLA 4JX1C 1IKMA 2XIWA 4CQNA 1GPXA 3HS0C 1F2RC 3NQIA 1SJHD 5BYSA 1PRTC 5I9OA 2BT6A 1LT5D 5KIXA 2B2UA 4F88A 5C6AA 1OXXK 1A2TA 1I6HB 1A3UA 1BQQT 4LJZC 1R7SA 4XXEA 1UEAB 2WQYB 2VUMB 2KEEA 1XLOA 5JPMC 2W54A 1QOGA 3NTKA 3S2HB 1E10A 1N60A 2BS4B 1NR2A 1EFID 4FP5D 1AP0A 3M4YA 2A68D 4KD3A 1F2LA 1J7BA 3CIRB 4KKUA 3GTPB 1WYGA 4IUTA 2WXMA 1IBXA 3NP8A 1NYRA 1VZ7A 3S17B 1V1PB 1TWFB 2R93B 4HJGE 2RKSA 2BW2A 1KNAA 3NWSA 4HRSA 3BIID 2BCOA 3TBIB 1QF6A 3A56A 2E2HB 4JK1C 4HSPA 1CA6A 3U7ZA 3TZUA 2I38A 4ARCA 3FRPB 5IIFA 3Q69A 5JVH3 3EA6A 5BYQA 4HN7A 2LFIA 2Z1CA 2EE1A 3J80L 5M3FB 1HFNA 2K5PA 1J7CA 2QF7A 1UNSA 1DGJA 2B2UC 3AMZA 5JPNC 1SJED 4QF4A 5EKKA 1RTNA 1C77A 3LX0A 4A3FB 5CR3A 3D4WA 5I6YA 1GUOA 5BN4A 1DOMA 2EYPA 4K5WA 4KY5A 1E2WA 1XLPA 3GTKB 3DWAA 5ELDA 3WCQA 4CHTB 2NUCA 1YNNC 1R4PB 4CBVA 3KK7A 1LT4D 1K8MA 4RKBA 5M5WB 2EDGA 3F2UA 4KKJA 4K6DA 1FXAA 3VR4A 3S16B 3PIO3 1R9TB 2DNEA 2PTLA 2FJ2A 2CW0D 4NKLA 2A6HC 1F9QA 2N7JA 2DBYA 5H8YE 1WTVA 4G4KA 5F2DA 3UI3A 4MT5A 2BS3B 2QDBA 2F4IA 1L6UA 2XWBB 1JE4A 1IKLA 1C79A 1GXDC 3R2IA 2EKIA 1UWMA 2K5DA 3NSWA 1Y69U 5IOCA 2QSDA 4K8JA 2F1MA 1SMYD 3HVZA 4CKBA 1O78A 2WP9B 1XLQA 4FYDA 1WD1A 2JU6X 1DCZA 1LTAD 5EBCA 1L0VB 1SXTA 3L9AX 3NVYA 2GB1A 3SFDB 3GO5A 3NE5B 1JC7A 1WXQA 1K53A 5JVG3 1QNKA 3GV6A 5CV6A 5IGDA 4Q0FA 4ZRZA 2XVSA 5JOBA 1HZ5A 3U9OA 2N55A 2RQXA 1YNTE 1V8QA 4A9AA 4N9TA 4D2KA 3K6OA 3A7AB 3SR6A 1GUWA 1PXUA 1EY0A 2DY8A 1UWXA 2FUG1 2HQEA 1E0BA 1QOFA 3W9CB 2B8GA 4HR7B 3PUWA 2BB5A 1G2TA 3GTLB 3I72A 5E1FA 4EQOA 3P7JA 3IFDA 1YNJC 1D5XC 1SSNA 2DNCA 2GI9A 3HRDD 2L0CA 3IXSA 1LACA 1X32A 2E2DC 2CU3A 1EY6A 3P4RB 2EYLA 3EQLC 4HMIA 2O5IC 1SIJA 1DM0B 3K58A 2AQ3B 3X3MA 2O5JC 4DAVA 1BO0A 2J53A 3RUZA 1VMCA 1PTOC 2AWNA 2JSVX 1VF5C 4P16A 1S5BD 4ZAIA 1Q3LA 2WXNA 1HQMC 1FXIA 2QCPX 1P7FA 1RCVD 1KAAA 1EZ6A 5LL6S 1O80A 1IBXB 3X3NA 4FF2A 2W3RA 4KKSA 1R4QB 2BA1A 3MHBA 2J42A 4Z9CB 1ZUD2 3DWQA 3K57A 1A15A 1ILQA 2NMQA 1LTSD 5J22A 4KKIA 4MH8A 2B63B 5G5GA 4YTNB 1VR9A 5ELCA 2AUKA 4N6EB 3FDTA 2VNUD 4REZA 1GUNA 5G3LF 5GXGB 5A2QE 5DM63 2L1BA 3QOJA 3HZXA 2EY6A 2W82A 2K33A 1Y8OB 2INPE 4A3EB 1XXGA 3D8GA 2VXWA 5M3MB 3S1MB 2A6ED 2YU9B 3AEGB 1JOOA 2JE6I 1Q1EA 1SYGA 5T1GA 3DEPA 4RF1A 1SYBA 4GLSC 2KVMA 1WWTA 1H9SA 4KGTA 2G9HD 3FAHA 3OHXC 4J3OD 4TRDA 5JAVA 3Q0AA 3Q8FA 2M9VA 3G7LA 1RTOA 5A35A 1HA6A 1L5PA 1EY7A 1EU4A 3HP3A 4H7BA 1TKWB 2IX3A 4NW2A 2Q8TA 1EQTA 2W55A 2Z4IA 1QLBB 1EY9A 1SYCA 3MXNA 4N9PA 4M0WA 2GRIA 2IL8A 1F9PA 3EVQA 1QCBD 4Y7NB 4ODGA 2E74C 2J4XA 3FVQA 2Y0SB 3ZJUA 1SNOA 1OXSC 2KCNA 3FPUB 1FCCC 3IAYA 2M56B 2ZW0A 4FVMA 1ZE3D 4I7ZC 1MGSA 4G7OC 2H88B 3PUYA 1LT6D 1E2ZA 1FO4A 4XIGS 5TSSA 3W3AA 1EU3A 2YEPB 1TYGB 1SNDA 1RDPD 4TQUS 1QOHA 4OO1G 1NI3A 3CHBD 3MXPA 3LWUA 5KEEA 4KGSA 4X3TA 1HEZE 4WQMA 4RWSC 1EOTA 4QB4A 3LNNA 4M1UB 1EWHA 1GUSA 4KJNA 2K01A 1PGBA 2CHBD 1A70A 1HA5A 1C9FA 1O7LA 4BBRB 3A7LA 2FHTA 4F87A 3H94A 1NSNS 3FC4A 2WB1B 3MJ5A 4C3HG 2LEKA 2EJFC 4ID6A 1GOZA 2EXZA 4C3HB 3HVDA 2K9XA 5KYIA 4WWMA 1IW7C 2RDGA 1DOXA 1B53A 1QG7A 1IHZA 2HTME 2ON8A 2BE5C 3JAME 2AWOA 2EOTA 2K5WA 2WINB 2L83A 5J39A 1TY0A 1BCPC 4CJ1B 3ERQA 1L4DB 4WRDA 4XYQA 1DOIA 3SE0A 1PGXA 5FK9C 3GD7A 3LB8C 5HURA 2KECA 2IGGA 1RJTA 1TKYA 4ITKA 2M00A 3NK9A 2F0QA 5IT9L 2B2YA 5MPOA 2JWUA 1STHA 2F0HA 1IYUA 5CV9A 3AMUA 2LFNA 4XDXA 4RA8A 1NENB 3PUZA 3GTMB 1PTOH 3SEBA 3PZ7A 2N88A 1TS3A 2NTSA 2PQEA 1VRAB 4A3DB 2DYMA 4XT1B 3L3OC 4FF1A 5KNBA 1EWCA 2WNMA 3BK1A 2JYEA 4DF7A 3TEXA 5HFYA 2L1AA 1NYQA 4NAMA 4RKLA 5M9OA 2K32A 4TKOB 3DWMA 3BVZA 4Q2JA 5DM73 3MWYW 2KQ4X 1VZ8A 3GS2A 4JPSA 2SDFA 1STAA 4MIUA 3HRZC 4L2YA 4K5XA 1GJXA 3D31A 3OSOA 1B9MA 4KN4C 4GDLB 2XN9C 5KGUA 1GUGA 1WTRA 1XCQL 3FPPA 3KBGA 3V96A 1QB5D 2EJMA 5EBDA 2WLBA 3M4OB 3P4PB 5KNCA 1RFKA 2NYZD 4LTUA 4H2AA 1BNZA 3TEYA 1HXYD 3V2TA 4E6IA 5IGGA 3AB9A 3MTSA 3I90A 2H89B 1Y56A 2WIIB 2B2YC 2JQRB 4RHSA 5CV8A 4IUQA 1H9SB 1ET9A 2K1BA 3LYYA 4ABNA 1JMLA 4OZBA 1SBBB 2ZT9C 3H3VC 4HEA1 1YN4A 4KKTA 1B2TA