1ESFA

Staphylococcal enterotoxin a
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
229
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the superantigen staphylococcal enterotoxin type A.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A
total genus 71
structure length 229
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1esfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1esfA02
3OWEB 2NTTA 5ELFA 1CHQD 3URYA 1PZJD 4RGTA 1SXTA 1BCPC 3CHBD 2SEBD 1LT4D 1EU4A 1SE4A 3MC0B 4NZLB 3R8BA 1BXTA 3KLSX 4RH6A 1SJHD 2XN9C 1YN4A 1BCPB 1FD7D 2CHBD 1MD2D 1ET9A 3DWQA 4RHRA 1S5CD 1HQRD 1SEBD 1T5XD 1CK1A 1CHPD 3BVMA 1RDPD 5D3IB 4ZYSA 1I4QA 3O13A 1L0YB 1LT3D 1RD9D 1SBBB 1ET6A 1TS4A 4TSSA 1BCPF 2G9HD 2J4XA 1ENFA 1RCVD 5FKAC 1PTOC 2TSSA 5TSSA 3R2TA 2AQ3B 1LO5D 4OHJA 4L6TB 4RCOA 2NTSA 4RFBA 1JR0D 3BYYB 1PRTB 1LTGD 1I4RA 1AN8A 4L63B 1S5DD 3EFXD 1FNUA 5ELEA 1YN5A 1HA5A 1ESFA 4RHSA 1LTRD 3EA6A 1JWSD 1EWCA 1DJRD 1PZKD 1CT1D 1PZID 1EFID 1TY0A 1TY2A 1EEID 1JCKB 2RDGA 1KLUD 1PRTF 1D6EC 1F77A 1B44D 4RGMA 1FNWA 2QEJC 1M4VA 1KTKA 2IJ0A 4DXGA 2WV6D 1LTBD 1PTOD 1AW7A 1V1OA 3BYTB 1JWUD 1PTOF 2XRQD 1KLGD 1LLRD 1STEA 2ICIA 3GP7A 1PYWD 5ELDA 3DWAA 1SJED 1RF2D 2O2LD 1LTAD 2AQ2B 4O1NA 1PRTD 1I4XA 1SE3A 1LTID 4Z9CB 3SEBA 1JQYD 1PRTC 1S5ED 1G8ZD 1TS2A 2Z8LA 1LTSD 4C56C 1PTOH 1FGBD 4BWGB 2R61A 1L0XB 1LT5D 1PTOB 1XTCD 1D5XC 3BZDB 4K6LA 5D3DA 3MFGA 3V05A 1YN3A 1I4PA 1TS5A 4RGNA 1HTLD 1D5ZC 1TS3A 1XXGA 5ELBA 4DXFA 1HXYD 1CQVA 2RDHA 1D5MC 1LT6D 3BVGA 1B1ZA 1QILA 2XRSD 1I4HA 3BVZA 1V1PA 2XNAC 2IPKD 4UDUC 1SE2A 1DYQA 1I4GA 1S5FD 1S5BD 1UNSA 2AQ1B 1V1PB 1EEFD 3DWPA 5FK9C 1FNVA 3W2DA 5ELCA 1JWMD 3TSSA 1EU3A 1BCPD 2QILA 1UUPA 1GOZA 3R2IA 4RGOS 5I4DA 1LTTD
chains in the Genus database with same CATH superfamily
3OWEB 3NWSA 2EYFA 5M3MB 4F8MA 5IIFA 5FLXE 5CBEE 1J7AA 5AJ3L 4TMAB 2R92G 4NZLB 3FP9A 4H7BA 3R8BA 3HIZA 5CHFA 1L0WA 2PQAB 4A3MB 3C1FA 4TKNA 1AE3A 2B8GA 2F0LA 1ICFB 2J7ZA 2O5IC 1WXVA 5IYBG 1XO3A 4FHKA 2FUHB 3PS6A 4A8XC 1CHPD 3DHGC 3IT6B 4JI6Q 3HUIA 2PPBC 2Y0SB 2KMMA 1TQOA 3CCUA 1KH0A 5G2NA 4ANXA 5JHAA 2A1AA 4ZUJA 4G4KA 3IHPC 4MGYE 1YNND 1E8WA 2Z6KA 4US8A 4DAYB 1K52A 3VA7A 1WF9A 1Y1VB 3AB5A 3ER0A 3ULPA 3ZXVA 1W6KA 5M5WB 1RAXA 1WRDB 4DR3Q 1LM8B 3WOEA 2UXDL 1U4AA 3J81E 1R4QB 1UBQA 2ATWA 3PO3H 2JUOA 2JP1A 2F0PA 2CKHB 3JVZX 4H0LC 2EJFC 3QCAA 1VS0A 3DM1A 1UH6A 2DZKA 1S5DD 4DV5Q 2QMTA 1II3A 2KHJA 1IBLL 1V97A 4DK3C 1K50A 2WU5B 2A73B 4CQNA 3VR8B 3PHXB 1JWSD 2HUGA 1IKMA 3ABVB 2GI9A 1NY4A 3QC8B 5JAVA 4ALPA 2FMMA 4BA1I 2CQAA 1SAPA 2BVCA 2LVOA 4FADA 5IT9E 1QCBD 2NCNA 1SMXA 2EYPA 3GQBA 1NI3A 3CF5A 1OXTA 4PYZA 4A3BG 2J0MA 2E2HH 1GUSA 1N33Q 4LF9Q 3KWLA 3PZDA 3QA8A 3NZSA 3OLMD 4R4IA 4PMBA 1BUVT 2UUBL 2I5HA 3IL8A 1E1TA 3K0YA 5KNBA 1JWUD 1VQOA 2KN5A 3T3OA 1OXVA 2ICIA 2SAKA 2A69C 3S17B 3S16H 1SJED 1Y8OB 3Q22A 3OTOQ 1WM3A 2D3AA 1HTOA 3KH0A 5DPRA 1C9FA 4O1NA 4B3SL 3I4MG 4QGUA 3RD2A 3ZTCA 4E3CA 3HFZB 1L1OC 4JI8Q 3CC7A 2A5UA 4YXDB 5FR3A 2MA9B 1LV9A 3DWMA 2PNHA 1GAQB 4EX5A 1XPUA 2M0AA 1WTXA 2PMZE 4FXDA 5KYIA 2MGSA 2P5ZX 4C4VA 2JF5A 4J8QA 3VRAB 2M00A 5GQOA 2BYEA 3J7AV 4W9LA 1YIJA 3HS0C 4K6LA 2K5NA 1I6HB 4M1UB 1QOBA 1UWXA 5IYCG 2KKCA 3H3VI 3EHVA 2L8JA 3PV1A 2F0EA 1GUOA 3HRZC 1XMOQ 1CKOA 1SROA 4AYBB 3NBHA 4JI1L 3V62A 4FF3A 1X3GA 1JC7A 2XSCA 2WQYB 2KENA 3K8AA 3DBHB 2E74C 3KDFB 4KY6A 4LF5Q 1HFNA 3Q8AA 2K05A 2G1EA 1SLJA 1C48A 4UDUC 1QOFA 3AMZA 1K0RA 1OTCA 3S1MH 1DOXA 1ZDXA 2LGSA 4X66Q 3UI2A 2K0PA 2K6QA 1Q3LA 4TQ0A 4KN7C 2JA6H 4GDKB 1IW7C 1KL9A 2DZIA 3SVMA 4JI4Q 4WJQA 3UQBA 4RGOS 1BO0A 4KJNA 1PH4A 4YSXB 1LTTD 1O7IA 4X3UA 2IDYA 2DUDA 1DOMA 2MSED 1PH3A 4LJPB 3PLVA 2MO1A 4GU2A 4HJ5A 2WDRB 3QO2A 3E3XA 3N1XC 5EE9A 3B2GA 1AFPA 2VS1A 1STBA 2JA8H 4C3IB 4IWOA 2BE5C 4FN2A 1PLFA 2Q8IB 1EIFA 3ZQ4A 2DY7A 1OTRB 2VUMH 1DGJA 2V0GA 1SF0A 1LACA 1YNNC 1QQRA 2L3ZA 4MELA 1QLBB 3SHLA 4C1NI 1WCMH 4BBRH 1XYIA 3GTOB 4CGYB 4W9HA 3MHBA 4TKOB 3HM6X 3DXJC 3Q2AC 4GDLB 4ARCA 5EQ0A 3CCMA 3NELA 4YY3Q 4GNXC 5C4HA 2JZ3B 2JA7G 4L23A 4ACFA 1BCPF 3FAHA 4DHJD 4Q0FA 2PPHA 1NYQA 1PTOC 2WWZA 4MH8A 5C0XI 3WIMA 3LNNA 1H95A 1ZYRC 3I73A 1V5OA 2RQXA 1PYSB 1IYFA 2AEHA 2NVQH 2SOBA 4IUVA 1YHQA 1WYGA 1YITA 3K58A 2GBNA 2L32A 2KC2A 4M02A 3GTMH 2J7QB 2LHEA 4LLGM 3KLRA 1E6EB 3SDZA 4EQOA 2PZTA 1HA5A 2K5VA 1HNXQ 2VRRB 1CSQA 3UDXA 2LWPA 3M4YA 1PH9A 1DOKA 4H02A 4YWGG 1CT1D 1GM5A 3AECB 3I9V1 3VUWA 4FJYA 2Y5PA 4G7HC 3CP0A 4FA6A 3FC4A 3KLWA 1RKNA 2F0SA 1EOTA 3M3YB 3FKIG 2IJ0A 4MZ9A 4J1MA 4FDBA 4WJ4A 4JW0A 2F3IA 2RDBC 4G57A 4FP5D 3NP8A 4A4IA 5C0XH 3EJIA 4LF4L 1PYWD 5HKHA 3ECIA 4B0MA 4UPAA 2AQ2B 1DM0B 1E0BA 1D8LA 4LFBL 5JEAH 4JI7Q 4YIJA 4APVA 4DV6Q 5EAYA 4N8FA 2HCCA 2I5LX 5AJ3Q 1QF6A 2L83A 4LK1C 3MVVA 1P16A 2ZZPB 3K81C 1EUJA 4RF1A 3F8TA 4RF0A 3SU8X 3VVWB 3GTOH 4C3HG 1EQTA 4CDCC 3MFGA 4LAAA 3MA2B 3K5OA 5DAUA 2JPHA 4NXNQ 1EZ8A 4X62Q 3Q8BA 2A6EC 3NK9A 1WTRA 3U58A 3HRDD 1PH7A 2NZOA 3S16B 1AYFA 1KD1C 2KDFB 3O65B 2NVTH 2F0HA 4C3JH 5DLQE 3ICEA 2CR5A 1QKZA 2RR9A 1H9MA 1I4GA 2WXRA 1T0YA 4KKIA 3D0FA 1OO9B 4DAYA 2NVYH 4DUYQ 4WH4A 1N32L 2RVLA 5EPLA 3W2DA 1EYDA 5I9OA 3PRPB 2WKCA 4LMQD 2VZKB 5DPSA 5ELOA 1UE5A 3HOYB 5JH5C 1STNA 3I8ZA 3UE0A 1PH1A 1QVCA 4IFDJ 4LFBQ 2EJGC 2F0WA 1PUTA 2KNBA 1W2BA 4HJ7A 5DNFA 3BY4B 4GIVA 4ZOHC 3KUDB 2EPBA 4JI0L 1VQHA 3K7AH 5KHQA 4DV5L 5IKCM 3KYHC 3ERQA 2RDFA 3HOUG 3AE3B 2SNSA 2B2TA 1A3TA 2PVOD 5M3MG 1CI3M 1MBYA 4LNQA 2ZPYA 3I4NH 3KW5B 3ZGZA 3KJOA 4BKGA 1K28A 2OTJA 5LMNQ 3I4NG 2F0GA 4LUOA 5BN3A 2WXLA 2IL8A 3H1UA 3ZNHB 1EQVA 2PMVA 3DBSA 4MIUA 4C80A 2ASQA 2VL6A 1N33L 3A5UA 2KWCA 3A7AB 5H92C 4CDFC 5CBAE 1WVLA 1I6HH 2CHZA 4KV2A 3HOXH 4KDIC 3RNCC 3W1YA 4DV3L 5IWAQ 2HD5B 1LT3D 1E22A 2OQKA 1RD9D 2EOTA 4MSQB 3H0GG 5CV8A 4YHHQ 5F2DA 4OO1H 1C78A 3TEYA 2BYVE 2OEDA 1HTPA 2KD0A 2E5LQ 4F88A 1WGRA 3QX1A 1OXUA 2D0PA 4BY1B 3AM9A 4RCNA 4XZ4A 3KDFA 2X69A 4LF4Q 4K3BA 4RG1A 3M85A 4HIKA 1VQNA 1JR0D 1RFKA 1SYGA 1Y56A 3NBHB 4KDLB 4AP4C 3BJUA 4HMJA 4JBWA 1IL8A 2VW9A 1AH9A 3DEPA 5M3MH 3RNGC 2OJWA 1EWCA 1A0IA 2INDC 1QJOA 1WTVA 3OHXC 2KVZA 2MJDA 2K04A 1ENCA 2FCQA 3HK0A 2K8CA 2R2QA 4KZ0A 4C4VB 3LWEA 2VB3X 2KEEA 2NVXH 1WMHA 3LJ3A 3PO2G 3SE0A 3PIO3 1OGWA 2Z1CA 1E7VA 3NOBA 4PNYA 2F4IA 4NMZA 4W9DA 2YU9H 4O42A 1EY7A 3QJYA 3TEHB 5C44B 2C5LC 5G55A 2O2LD 2J0JA 2R7FA 2D10A 1GKHA 3NVYA 3SK4A 1BNZA 1JOQA 4YCWA 1V5TA 5C2TB 1HUNA 5D2MB 4A3JB 5C4ZA 2PZUA 3W1BA 4MACA 4HSVA 2JSOA 3G4SA 3TZUA 1WTQA 1WD0A 2DZMA 3ZUNA 2LJIA 3K80C 1XCQL 3EFUA 4DNIA 4DGZA 3H3VH 5T8IA 1MSGA 3Q8DA 1WTOA 1D5XC 1HZCA 1C8CA 1YNJC 4OWXB 4ZRJA 1I4PA 3AE9B 4FXCA 4ZLTF 3ND9A 3OMCA 1J8IA 3M4PA 1VD2A 4HKZE 3WA0A 2LS01 2KLCA 5JOBA 2JK8A 4ZRZA 3VYRA 2REXA 1VQ7A 1WX8A 5C44H 3VH3B 2D2QA 3NS1A 2Y5CA 1G51A 4BKSD 3AB9A 3FRPB 3HOWB 1U4RA 3CCSA 1ZPSA 1I35A 1EY9A 3MWYW 1DXMA 1E7PB 1EY6A 3KF8A 2I38A 1NNXA 5FK9C 4N9F4 2IYDB 4PS7A 4CYEA 3BK2A 3J80E 4N58A 2CVRA 1IZ6A 3LGJA 4EGVA 2IW3A 5FLMH 1BCPD 1U4MA 1TZ1A 4GN4B 3C8YA 2D5DA 4NQKE 3VQIA 2LRWA 2DJFC 1K8RB 2F3WA 2Q8RE 1ROEA 1TZOA 3A8JE 1WJUA 1GPXA 3A8IE 5ELFA 3H8HA 2W3SA 1Q10A 4MH0E 3URYA 2MPMA 1OQRA 3OAWA 3ZJUA 3FHWA 2DGYA 4ZK9B 1SXTA 1VDZA 1O78A 1BOSA 1KXLA 3MC9A 4HJKA 3VFKA 5HFYA 4CDDC 2BOSA 2HDEA 4A20A 4RH6A 4DPGA 3DLLA 1GUWA 2KWDA 3R7RA 1D3ZA 1YQBA 1NUCA 1U5KA 1SSNA 2OJRA 1A15A 4A3LG 1E8YA 3ULJA 4A3JG 1ZUD2 2GRIA 2UU7A 1IBMQ 2BB5A 1YQ4B 3WCQA 1VJKA 2IZVB 1E8ZA 4DR2Q 1N5WA 2KJ6A 1VR9A 5D94A 2F0TA 4ZDVA 4WWPA 1WTHA 1R7SA 3W1SA 2IGGA 4OWWB 3EQLC 5TSSA 3MXNB 5DM73 1ACCA 1BBUA 4ME3A 3K59A 1Q0WB 2FE8A 1IBXA 2MBOA 2L0CA 5CV6A 4JPSA 2G4SA 4X64Q 1F2MA 4WURA 2F0KA 1L1OA 1A2UA 1FRDA 4B95A 4JOIC 1Y1WG 2ALYB 3ONAB 4L63B 5KNDA 1VQ9A 2UUAL 2ZJQA 4DDID 5JEAG 1E2WA 1UAPA 4RHSA 1I6VC 4IUUA 2Q2UA 3PRZA 3PZ8A 3ZTDA 3SHQA 1DGSA 1KRSA 2KDBA 4QIWB 1AZPA 5IOIA 1CKNA 5D65A 1F2RI 5C0XG 4TVAB 2A6HD 2HHHL 1TWHH 1JE4A 1TKWB 4GXBA 1HZ6A 1RRBA 3HOYH 2LHDA 3FKIH 3HEJA 2IO2B 2HIXA 4IUTA 2DYOA 4E74A 3AMUA 2DNCA 4JI8L 3K5LA 1H9SB 3AEDB 3U30A 1TT5B 3UF8A 1PXUA 2K5WA 1KC8C 2B2WC 3WANA 3RR5A 3HOWH 3QQ8B 4X3KA 3DWAA 3APCA 3IFDA 2E2JH 1M94A 2M19A 2WDVB 3U9SA 2PEAA 4KK7A 1PRTD 4JQWC 1S40A 1CQFA 2CCZA 1I4XA 4IOIE 4KGSA 1VQKA 3A7LA 5JVH3 3TRZA 2GBMA 4IQZA 1CZPA 4OX9L 1HZ9A 1QB5D 1PH8A 4RM9A 3J7A5 4OL7A 1SE8A 4FHJA 2SNMA 4DV1L 4KD4A 2Z6KC 2PJHA 2EY6A 2JZPA 3QARA 1ML0D 4EEWA 2L7RA 3QB3A 1I5FA 4NQLB 4K7SA 3A1QB 1TWFB 3BDCA 4DXFA 2VQEL 4II2B 3ZYYX 1HXYD 4A3GH 4WJOA 4EKUA 1FEHA 4B3TQ 4NJCA 2F0NA 3HOVB 4DV3Q 2IHFA 1YQ3B 4GLAC 3OTOL 3Q6SA 2CS4A 4P1CC 2X38A 3S14B 1JALA 2AUJD 3E9SA 5H1SE 4IOAA 3OMGA 1S1QB 3ZNZB 1QUQB 2LY7A 3N52A 5ELCA 1VQFA 1EUVB 4R8IA 1KIXA 3TSSA 4LF5L 2N3SA 3PLUA 4LW1A 5M3FG 2BKFA 1YEZA 1WGHA 3D8GA 4LFAL 3PT2B 5NUCA 2NTTA 3IT4B 2I2YA 3V6EB 3Q24A 4JYAL 1D7QA 3MHZA 4QY7A 3R3MA 1YJNA 5FO8B 4DNRB 1ZEQX 5G5GA 2HDMA 1TIFA 1X1MA 4JE3B 3TUOA 2W54A 4NPSA 1PFDA 2A6HC 1BCPB 3W5UB 5JPNC 5AZGA 2CHBD 2OT2A 4MSMB 3P75A 1MJDA 2KFJA 1J0GA 4ZCKA 1VQEA 3CCQA 2UU9Q 2INCC 4TV3A 3VYSA 2K5DA 2IY1B 2N0SB 2ZCBA 4R3DA 1HZBA 2F0VA 1Y8NB 4KV6A 5C6AA 3ZO5B 3VR5A 4X66L 1WGGA 3FVQA 5M5XB 4A93G 3K57A 1RL2A 2LFIA 1L0YB 2FIFA 3RNUA 1SBBB 4H44C 1XMQL 1Q7YC 1BF4A 3ALBA 4F87A 3Q3NC 3CQZH 2LVPA 4AUQC 1E2ZA 4BVUC 1FGUA 3NS8A 2E2JB 3NG0A 3GTGH 2FHTA 4IUNA 3I4NB 1YX5B 2INNE 2MBBB 3S1NH 4DV2L 1WOCA 1NBWA 3I4MH 2WAQB 5FO9B 3R93A 4JG2A 1LTRD 3K5MA 2GBJA 2WS3B 4HVBA 1K83H 1M8AA 4FF1A 5LXHA 1QOHA 1NYRA 2EIFA 3GOEA 2F52A 1C79A 1PZKD 4CKBA 3CPWA 3V96A 2KWUB 2IX3A 1F9SA 3SXHA 2KMCA 1GB4A 1PFSA 4A3FH 2HJ8A 2JQOA 3TP6A 2A68D 5IY0A 1AARA 2Z0EB 2M2LA 5E6OA 4DK0A 2Q2TA 2V1YA 3JAMc 1XLQA 2F0JA 1JW9D 1B4OA 4C3IG 1K0SA 3HKZE 5EJWA 1KDAA 3HOUH 1ONLA 1SYBA 3TMEA 2EXZA 2BH8A 4K81A 4UP8A 3J80c 1OQQA 1O7LA 2MQHA 3F2UA 5E3FA 2N9LA 3AE7B 1G6ZA 1NVID 1LTID 4ANUA 4L5TA 2MJ8A 1G8ZD 3DMUA 1R4NB 4C56C 1VQIA 2UXBL 1YHAA 4EFOA 2L5TA 4A3CH 1X9NA 3STBC 2WXJA 3VUYA 2XK5B 2N9EB 2WAQE 1PFBA 1YN3A 4XYQA 2O2VA 3AV8A 2LI5A 3DQVA 4JYAQ 4IURA 4A3IH 1CUKA 1B53A 2WXPA 1EY0A 2YTYA 2F03A 1V86A 2E75C 1WR6E 1B1ZA 3HOZB 3I55A 2BQQA 2CWAA 1PQSA 1O80A 1XEEA 2F0OA 1I4HA 2N7DA 4C1NK 3MHSD 4MGKE 2D9UA 5HI1A 2XNAC 3L13A 1XX8A 4XTCS 3M3YH 4B3RQ 2BH2A 4IFDI 3EGRA 3IAS1 5AEKB 1TXYA 1DZ1A 2WYQA 3N9YC 3GDEA 3CC2A 4YT0B 3CIRB 1IGDA 1B8AA 2I0QA 1L5PA 2KEDA 2EY2A 1NBFC 2JZZA 4GB9A 4ME5A 1GOZA 4CJ0B 2C7HA 3MXUA 1YX6B 4JI5Q 4IZ8A 4DUZL 2NVYB 3RZDH 1ASZA 4JWSC 3FDTA 1FYCA 4WAFA 4DKAC 2OTLA 3I4MB 2D11A 2LUMA 4K3CA 4MJSA 1SDFA 3X3MA 4XT1B 3CHBD 5IYDG 4K0KQ 1RIPA 2H4OA 5CYUA 1JOKA 4YTMB 4RKLA 3L7ZC 3KK7A 4JVZA 3AE6B 2DWQA 3A5ZB 2KQSA 4C00A 1FD7D 3AEBB 2DYMA 1J8CA 1L6VA 4R1JA 3NVVA 3H6MA 2B63H 1H8CA 1HQRD 3L3OC 1RDPD 2KYWA 1RODA 3U9OA 1J9OA 4XXEA 2CU3A 3VHTC 4AQYQ 3BZCA 2B2VC 2PQEA 1KABA 1BMLC 4FF2A 1YJ1A 4GKKL 4TSSA 1HZAA 4A3GG 4II3B 1Q5WB 2K22A 2CHWA 3L17A 3S2HH 5E6NA 1R4MI 2CFMA 2JA8B 1VQMA 3TEWA 3MXPA 3I90A 4ZKBB 1CKMA 1JMCA 2FUG1 1ZDVA 4DUZQ 2Z0SA 1F2YA 5IGFA 3L54A 3EFXD 5EGTA 3W5OA 3ZXRA 5GAEC 1MVKA 1BKBA 4P74A 1Y1VG 4JWUC 4ZHOA 4EE2A 2LFNA 1UWVA 4XDXA 3TQYA 2DAFA 3CMEA 4DWFA 2A8VA 3H9DA 1WFYA 4POFA 3D4DA 4BBNF 2K14A 1I3QH 5HGQA 1HQMC 2R93G 4HPPA 5BR8Q 1BUIC 4WJWA 1PRTF 2WXQA 4NKLA 2K8HA 5MPOA 2KCTA 5DPWA 1WFQA 3S14H 4DK1A 1CSPA 2NPTA 2WV6D 3LB8C 3DVGY 4WWMA 2K1BA 5IGEA 4DU9A 4IFDH 1JORA 1ZGUB 5IT9c 3HOVH 3D6CA 4BBSB 2DYBA 4KY7A 3DVNU 2L12A 2YYZA 3NBIA 4G7ZC 4POGA 4HWIB 4ZKCB 1XNQL 3PPAA 3BZKA 3S2HB 3PVLA 4R4TA 1OEYJ 1ZXHA 2ZXRA 4XWTA 1JQYD 5L37A 3ZIMA 1JE5A 4Q5VA 2JA6G 4QQBX 1L4ZB 4N6EB 1A70A 4A3KB 2QIEB 1NENB 4DV1Q 2MP2B 2BDNA 5IP7G 1WCMG 5EE3A 2PKOA 3CCRA 4DV4L 2D3BA 2IGHA 4IDIA 2OWOA 1ILPA 2B76B 3IBEA 1TS5A 4HCNB 1TS3A 4XDCA 1UE7A 2KQ4X 4IUPA 1LFDA 2DX5B 3JAME 3L16A 1QILA 3J7YW 4KY5A 2GN5A 2H89B 1O7ZA 1Z47A 4KI0A 4UY8C 1YMHE 3BDLA 1X65A 1Q1EA 1UEAB 1UNSA 1S5BD 1EYCA 5EPKA 2AX5A 3NQTA 2KQ7A 1MJEA 1PDQA 1JWMD 1F1HA 2F0FA 1EL0A 2EKIA 4C7ZA 2HTHA 2RHSB 1LTLA 3P7JA 3E0JA 5EE0A 1I50H 2FAZA 5BYSA 2RHQB 3VH4B 1CHQD 3T1YQ 3Q23A 2JX5A 2BKRB 2K32A 4HDQA 1GC7A 2LGXA 3CSFA 2B2UC 4JBJA 3PUVA 1MHWC 1CMXB 1RLFA 2ONQA 3GE3C 5JXVA 2N7JA 3J7AF 4K5VA 4HEDA 3HOZH 4HJ9A 1A5RA 3GTGB 1U4LA 3NENA 4CDEC 3P4QB 1NSNS 3DVNV 1BVSA 3HGBA 4JPBW 1FMAD 1S3SG 3I70A 4DR1L 1PH2A 3X3NA 5M5WH 2X6LA 2B2YA 5IGCA 3DWQA 2CJNA 2QF7A 5LL6X 1QOGA 1XWEA 4BXXG 2X8XX 4AJWA 4RWSC 3ZJTA 3NY5A 4YCUA 4X6AH 2PO4A 2BE5D 2YTVA 2A19A 5A2QL 1A63A 1IUEA 3HKZG 1HRJA 4ZRQA 5GROA 1UZXB 3AEFB 5AZFA 1QWYA 3FEWX 4IW0A 3TDQA 2KTFA 2LD9A 3RUIB 1E7UA 4TUUA 1ENFA 5CHWA 2MFIA 2TSSA 2IO0B 3R2TA 4IJHA 3H09A 4UHVA 4RCOA 4CKEA 3S17H 2MLBA 2JYEA 3U8ZA 2UXBQ 2NVUI 2B3AA 5FLXc 2MHVA 1LTGD 2ICEC 1SIJA 4K2KA 4REZA 4G0NB 1AN8A 3PF4A 4A3PA 2KVMA 3MTSA 4PMCA 3CPFA 4A3EB 4IWQA 4JC0A 5IYCH 2EKEC 2QDFA 3RT3B 3B0AA 2CH4W 3HKZB 1XCTL 4HCEA 3H0GB 3VTUA 4ANWA 1B7YB 3G6EA 1WM2A 1WE6A 3Q3OC 1EEID 2CH4A 1E24A 5JHBA 4K7WA 1B44D 4OEMB 1VMPA 2CW0C 2BB6A 2B2WA 3GV3A 2KUMA 3D31A 4BY1G 1FFUA 2D5GA 1GNUA 1E2VA 4W9GA 4WWNA 3PREA 2QCPX 3TP7A 2V1CC 1GHJA 2BA0A 3M3JA 2LXJA 1FCLA 5C4XH 4FNFA 2B2YC 1RWSA 4A3GB 1Z9FA 5C3EB 1Z7TA 1FXIA 4A3IG 3A9KB 4QF4A 4RNAA 4LDTB 1TVXA 4DV7L 1G291 3LXFA 5CV4A 2B2UA 4L5SA 2PQAA 4NP5A 5M5XH 1PTOB 1WCMB 4LWCA 2OQ0A 1CFMA 4JOIA 2NR2A 1WJ4A 4XQQA 3GV6A 4A3JH 1Y69U 2E2DC 2B63B 1SRUA 4HK2A 2KXJA 4K5XA 2C5CA 1T5EA 4HIDA 4A3KG 4KKTA 5G3LD 2DLBA 4BA2I 4PYUA 2QW7A 1W3SA 2F1MA 2LUEA 3SFDB 1G2TA 4OXPA 1EIHA 1QOAA 3IFTA 4K7UA 4KGRA 4OZBA 2B3GA 4G11A 1E9MA 1E8XA 2V4DA 4OW0A 1LXDA 2I46A 1JJ2A 3M4OB 2LJ5A 4ZYNA 1WGYA 2ZW1A 4FF4A 3CF6E 5CTRC 4A3OA 1RM6C 1X56A 3R2IA 5DM63 3KF6B 2JA6B 1TT2A 3S2AA 4MN3A 2JSVX 1NDDA 3W1GA 1VF7A 4WFN3 4ASWC 1HNZL 1EU4A 1E3PA 4M0WB 1U4PA 1C7YA 1F0ZA 1VQPA 3I91A 1G91A 1C3TA 3KVFB 3PGEA 1EO6A 5K36H 2BT6A 5IAAC 2VQFQ 5LMUL 2Y0SE 5ISRA 2OEOA 3VDYA 2LMCB 5GAHC 5D14A 3KWVA 4JIOU 5J22A 2OF1A 2N55A 1VCBA 4G50A 4JI2L 3NZUA 5FJ8G 2EZVA 4F8CB 3CRKC 3NSWA 4R8NA 2MCNB 4IO9A 3O13A 1EY8A 3TP8A 1YNTE 2M56B 1Q81C 4OO1I 3AH7A 1N9WA 1SNOA 1E0ZA 2MBEA 3NWTA 2UYZB 2DENB 3L0OA 3DBRB 3PRMB 3AEGB 3GTLB 5FO7B 2JRIB 3HM3A 1UBIA 4IM0A 2J52A 1TYGB 5C4JH 4IJLA 3Q8EA 2RKSA 4QUFA 5K36G 1L6UA 2QJLA 3VTWA 2Z0DB 3NTHA 4BKSA 5LMNL 2DHZA 5E1FA 1WJ6A 2FCNA 3JAMi 4AS1A 1FNUA 1YN5A 4S0RA 5KGUA 2ASBA 2A68C 1UGMA 2E2HB 2WX0A 1KLVA 1IXRA 5JJLA 3ZNID 2WU2B 4AYBE 1CM9A 1DJRD 3C2PA 3CW2C 2AYOB 1V1QA 2CW0D 1F52A 1IPGA 4HJ8A 1JCKB 4M0WA 4P6VF 2M9VA 2K25A 1EY5A 1K3RA 4XYOA 1DD2A 4DXGA 4J15A 4R4CA 2PW5A 1H9KA 1Q1BA 3KF6A 1EYAA 1QZGA 2LXAA 2V3NA 2BWFA 2KJHB 3L2PA 4IWPA 1WR1A 1EWIA 3I4LA 2RSOA 1UE6A 4BS9A 1WI5A 5I2XA 3UDIA 1K8AC 1QVFA 2JA5B 2EY1A 2ZTCA 3D3RA 2UUBQ 4AIMA 1Y8PB 4DF7A 2Z9HA 2I1KA 2MQJA 2Y5BB 2JWZA 3GTKB 2LXKA 4JI1Q 1TBEA 4X3SA 5EBDA 3I72A 2PE9A 2WDTB 4LJZC 4X64L 1FGBD 3D4WA 3CMMB 2MH7A 3ZRCA 1LT5D 2QDLA 2JN4A 4A3KH 4X65L 4PQXA 2BYTA 5HURA 5BMGA 3S2DH 3Q3FA 4E6IA 5G5HA 4GKJL 1C4CA 2FIDA 4C3HB 2O4XA 3DHIC 2NUCA 4RGNA 2E2IH 1N36Q 1HA6A 5LXIB 4B3TL 1IYVA 5IGBA 2BYFA 1TGZB 5JPMC 3ULLA 2SDFA 4R4OA 1YIWA 2I07B 1U0LA 1STYA 3G71A 4P1BC 5FLXL 3DHQA 2FFKB 3DUZA 3TS0A 2R7DA 1EWYC 3OW2A 1OQYA 3AEEB 3ML9A 1NEKB 4DR4Q 1OEYA 1YJJA 4N59A 3X0WA 4NJ6A 4IG7B 2M17A 1EU3A 3P4RB 3R66C 4C2MB 1D1KA 2N1WA 3A56A 3KYDD 5KHOA 5A35A 3W1SC 4WAAA 3B6YA 1I7HA 3ZJYC 2HIVA 1SFOH 4L1BA 4GGQA 3MAQA 4K14A 3T1YL 4RGTA 2PZWA 1TWCH 3AU4A 4ZRIA 2SEBD 1SE4A 3MC0B 1FJGQ 2MEKA 2EQSA 3IAYA 1ZXTA 3KLSX 1A3UA 3ZLZA 2NWGA 4YWKA 4QJFA 1NJIC 3NUHB 2PI2E 3DHHC 5J2RA 1AP0A 5AUKA 1MD2D 1ET9A 1W6JA 2E2IB 3GS2A 3BDOA 3NXWA 4LF8L 1N36L 2D07B 3MTNB 4A3DB 1BDOA 1WWTA 2XBBC 1GUTA 3S2DB 5E6PA 1RTOA 2H88B 3BVMA 1SNQA 2QCZA 2JA9A 1KAWA 2V4IB 2HQEA 1J7BA 3T1HL 3PIPA 1ET6A 1NMGA 3UIOB 3U52E 3U4VA 1P9DU 3DVGX 3A8KE 1RCVD 2WB1E 4DV0Q 3K5NA 4FO2A 2KX0A 1JWAD 3NJTA 4LJOB 3L10B 2K1FA 1IYUA 5IN7A 3H94A 3NEMA 1V9JA 3RFZB 2H1EA 4HIMA 3FILA 5C23A 2KHIA 2VZKD 4NAWA 5FR6A 3GZNI 1QZEA 4IM3A 5LL6S 4CBVA 4DNTB 4CJ2C 1D1IA 1XQQA 4PT5A 3H7PA 4CJ1B 2IY5B 1MJCA 3S15H 2W55A 2R93H 1SNPA 2PNRC 5BN5A 2PCFB 5C3WA 1IBLQ 1NMFA 1JICA 2JU6X 4W9JA 4MTNA 1IP9A 2GBRA 2G5DA 5J18A 4DAPA 3IRBA 4GOCA 2LGYA 1TWGH 4WIPA 1EFID 1UF0A 4ITKA 2D2CC 4A3EG 2UXCL 4GKJQ 1UWMA 3J81L 1Y1WB 2HT1A 3NUCA 3QR8A 1P1AA 4XE0A 3N32A 5M3FB 1SIFA 2K28A 4I6PA 1RHPA 2K39A 4RAUC 3H91A 3BINA 3LYYA 4KVGB 1LTBD 3HG9A 2GVBA 1R9TB 1JB3A 3K0XA 4C3JB 4IOCA 2NVTB 1I94Q 3B08A 3J81i 4GOPB 3PUYA 2KFKB 2UWQA 3LX0A 1HH2P 4LFCQ 4MGZE 1QZHA 1J7CA 4AOFA 1XD3B 4MEMA 1ZP0B 1C0AA 5LHY1 4Z9CB 4OIJA 2AUKA 3A0JA 2Q8TA 1EYGA 2R7ZB 1VQLA 5JJKA 2JYOA 1FM0D 2O6VA 2RD0A 1SMYC 2G45B 2KVRA 2B63G 1XNQQ 2R7ZH 2OOBB 2QDBA 3TREA 4IM2A 4B9KA 4BOSC 3AE4B 1VZ6A 3RLNA 4Y52H 2MJ3A 4WJ3M 3BG3A 3RMKC 1K53A 1A8VA 1D5ZC 1JMLA 3AFQA 3CMAA 1HNWL 3PV0A 4NPNA 5T1IA 2N78A 4BAXA 2ZM6L 4LF6Q 1Q90A 5I6YA 2AWOA 1LABA 3CD6A 4GNXA 1LGRA 1B70B 5D6JB 2RSUA 4I7AA 1N6ZA 2HTME 1L7YA 1NAPA 3W3AA 5COYA 1JRPA 1E1OA 3H3VC 4DR7L 3D32A 2KTRB 2I5MX 1SE9A 4OVVA 4BKTA 1SYDA 3JC66 2GOWA 5JVG3 3U50C 2WXOA 1XTDA 3BK1A 3CCJA 2BWES 5C4XG 2N1VA 2IBIB 5AZHA 1XLPA 1FFVA 3I57A 3M7GA 2KK8A 1KNAA 2B29A 2K3UA 3VA5A 4JV5Q 2F3VA 1TWAH 3S1NB 1VZ8A 4V190 2A74C 4I6NB 1TKGA 3LDZE 3N20C 2M4NA 4OZCA 3JSVB 1TR5A 2KACA 3OG5A 1A62A 3PO3B 1YBYA 4PK1A 3JSVA 2RBMA 5BO4B 2BBCA 4EUTA 4ZRKA 4RHRA 3AE8B 5DCNA 3RPFC 1S5CD 1PGXA 2WB1B 4I7ZC 1SYCA 1MHXA 2ID0A 3R3OA 2KDIA 4C7YA 2DZJA 4AQYL 4IN3A 2BF8B 2DNFA 2QGQA 3PUXA 2UXCQ 3WDNA 1HJPA 1R4NI 1TS4A 5C44G 1EF5A 2MX2A 3AXCA 2N88A 2JJQA 2A5HA 4Y7NH 2IO1B 3WWVA 1C76A 4C3IH 5CMDA 5FLMG 5KNCA 4L6TB 1FR3A 3IFWB 3SDLC 3PO2B 3ZJVA 3SD5A 3A4SC 1K3BC 4EZKA 1R4PB 3E9IA 4L2YA 2L4NA 3IVFA 2K5HA 1IHZA 3KUCB 3NE5B 1TWAB 4JV5L 4S17A 1HPCA 3I7FA 1IGCA 1X3FA 3EVQA 5I9PA 1WTPA 5E6JA 4A3BH 2PLPA 1NCVA 2EYHA 5IP9H 4KHPL 3N3KB 3K7UC 4WWOA 1H4RA 3RNFC 4CKCA 4A3CG 1MSHA 1SB3C 2KANA 2NB0A 1CZWA 3EROA 2O6VB 3F2CA 1AE2A 1YJIA 1E5WA 2MHJA 4EOYA 3ML8A 4XC2A 1M4VA 2WB1G 3DPDA 1KTKA 2CQOA 4HR7B 4N9TA 2F0QA 1T0SC 3PHWB 3VR9B 1PTOF 3H7SA 3PO2H 2KFKA 3J80L 3GP7A 2E8GA 3TEXA 4GOPA 3PO3G 2EMSA 1A2TA 3AYHB 5IO9A 4GZYC 4M8NA 1TWFH 3AU7A 3B9JA 4A3IB 1SE3A 2JE6I 2YVCA 2KX3A 4EQNA 1WTWA 1EWHA 1TS2A 2XVSA 4MNOA 3OSOA 2KHSA 5KIXA 4H2AA 2K4KA 4JLCA 3I63C 1WXMA 2FMCA 1V6EA 2N9KA 4DHZE 2WXKA 3SR6A 2A4ZA 2JA5H 2OXPA 2QSDA 1RFAA 4LF9L 1HTLD 2JY6A 3IAM1 3KUZA 4W9CA 4E71A 1L2NA 1GJZA 4BFRA 2XK5A 3KYCD 4YWLA 2KLGA 4OO1G 4LUZA 3A4RA 3HOUB 1UEBA 3M63B 3Q8CA 4O0AA 2XRSD 2RGFA 3J81j 1E7ZA 3U4EG 2VZAA 1WGKA 1ILQA 1XMOL 2LEKA 1CA5A 4A3DG 2KBNA 1FNVA 4NAMA 4HMIA 3PZ7A 4RMFA 1GB1A 4JL9A 1UUPA 2F0IA 2F0DA 3T56B 5C1ZA 1KM7A 2KECA 4RA8A 1CJEA 4WJNA 2VB2X 1VQ8A 4AQ7A 3PQIA 1PFNA 1LM0A 3S1MB 2ZT9C 4LF7L 2R93B 4XWWA 3TP5A 2EYOA 4A90A 1LT4D 4LDTD 1SN8A 3MP9A 4BBSG 2DNEA 1BXTA 4JI4L 1OFFA 2JRHA 4P71A 1WYWB 1B9MA 4I65A 2ZNVC 1EIGA 3EBEA 5C4JB 2EMTA 1P0RA 2JXMB 3CQZB 1A6XA 2BS4B 3PO0A 5CX3A 1Y1VH 2LSSA 3LWUA 5EKLA 1EQQA 4N8X1 4WORA 3DDCB 3EFCA 2WP8J 4I6LB 1CK1A 2QHOA 1STAA 3JW0X 2W3RA 3PIP3 3MEFA 5D3IB 2NZHA 3GTPB 4JI3Q 4P72A 3BU2A 1WD1A 1XNRL 4ARIA 2KTRA 2K6AA 2N4FA 3PSEB 4A3DH 3ZNGC 3J9CA 3P1HA 2EY5A 4GLVB 3CC4A 1VQBA 1KF6B 3G48A 2LASA 4RKBA 4GNXB 3MXGA 4KKSA 5G3LF 1HNZQ 2N9PC 2OHFA 4A9AA 4MHEA 2YV5A 5FOBB 1Y8RC 1WIAA 3U2SC 3BYYB 1SR3A 3T3NA 5LMUQ 5BYQA 4CHKA 5IA7A 3S9WA 4X3TA 4PS8A 2KOLA 1VZ7A 1ESFA 3P4PB 1SFOB 1L0VB 3Q0AA 2V4LA 4A6QA 2K5PA 5EPJA 1KRHA 1TY2A 2WAQG 3ONSA 1E10A 3TBIB 1N62A 2C7NB 2ZVNA 4DAMA 1C4QA 4RGMA 2D3GA 4JI7L 4FBJB 3GB1A 1WZ3A 3AI5A 2ZTEA 3T4AC 1V1OA 1VQDA 4GN1A 2XRQD 4X57B 1STEA 3PSIA 2AHOB 2R7ZG 5C5LA 3BIID 4B3MQ 2WXGA 2E3TA 1WJNA 3B2FA 1QUQA 3QG1A 4JGHB 3F2DA 5BYRA 3RZFA 4OWTB 4LTUA 3HP3A 5IODA 4DR5L 2A6ED 1WE7A 2G4DB 2JWUA 1RJTA 3VAWA 4NXNL 2Z8LA 3JAML 1GHKA 2KO3A 1IBKQ 3ERSX 1JRUA 2Q2HA 1V8CA 1TU2B 1L0XB 1Q1OA 3PMFA 1VQJA 4PZ6A 5AUIA 4DK6C 3BZDB 2L11A 5LNK1 2Q5WD 2NN6H 1K8OA 3RNBC 1WY8A 5C3EH 1HNWQ 3CCLA 3I56A 3HOZG 3Q8FA 4K6DA 2ZM6Q 4LF6L 1XT9B 4OONA 1XJVA 1D5MC 1FVIA 2RCNA 4GN5A 2PTLA 4ICVA 4OVZA 3L9AX 4A3MH 4W9IA 2K8BA 2IHEA 1QT9A 2NBWB 4PS3A 3KQ4A 3ZW3A 5J17A 1JWBD 4QB4A 2ZXPA 1V1PA 2LKVA 1BR9A 4HTHA 2M0XA 2MRPA 3APDA 2VQEQ 3X23A 1QE6A 2VUMG 2CU1A 2KMAA 1B9RA 4ID6A 4LNOA 2QILA 1TWHB 1XNRQ 4B3SQ 5I4DA 1X6OA 4KKUA 3ETRA 3NPPA 1B9NA 2JA7H 1B3AA 1H9SA 4DR4L 2ZVOA 4UP7A 2QEXA 5E4XA 4DV7Q 4K5WA 4IPCA 3GTJB 1BCPC 1J5EL 3RNEC 1QNUA 4AJYB 5CC4A 2R2OA 3GD7A 4HROA 2FCSA 1C1YB 4N9PA 1V80A 5BN4A 2IX1A 4URKA 5CHVC 1DOLA 4JI2Q 2KJXA 2AL3A 1YI2A 5IGDA 1B50A 3TMPB 2TMPA 1SEBD 1IBML 4DK5A 4M00A 1OXSC 4DUYL 2WXMA 2L15A 4U673 2JXTA 2WP9B 3AULA 5L83A 1ZYRD 1L1OB 1P3QU 3A9JB 1M1KC 4ZAIA 2ES2A 2KDMA 3RULA 2AMCB 5C3JB 2G9HD 3KJPA 4WQOB 2VH2A 3MZ5A 5IYDH 1WRIA 2PYKA 2WACA 5J3BA 2BS2B 2ACZB 3M95A 2WLBA 4YSYB 5BMHA 2FNJB 5D7GA 2K01A 3SK6A 3UDFA 1R4MB 1HR0Q 3HHMA 4HJGE 5CGKA 1R9TH 1VDVA 3P1MA 3TIXA 2RF4A 3GTJH 4HIOA 3UDGA 1STGA 4DV4Q 1BBXC 3K7AB 1P7FA 1V8QA 2L9HA 1Q82C 4KHPQ 4G7OC 3CCEA 2GLSA 2W82A 1JROA 3OIQA 1TWGB 4DA2A 1WH3A 3AQQA 2HHHQ 4HXDA 2HCIA 4JK1C 2I1JA 2XIWA 3N1YC 1MGSA 3G7LA 3G6JB 4ZUIA 1FNWA 1K9MC 3A9KA 1G6PA 3I5JC 3Q69A 2JEBI 1ZKOA 2EYMA 2B8FA 5CV9A 1F2RC 1T0QC 1ZKHA 3QHTA 4A3LH 2BDOA 3A9JA 4CO7A 1P7EA 1N60A 2G9DA 1KHIA 4ILWA 3H15A 5J1ZA 4YSZB 3VR3A 3EIVA 4KSLC 3GTLH 4EZLA 1C4AA 1WXAA 4LF7Q 4F1SA 1JJCB 1KDBA 1PVOA 4JBKA 3KOJA 1MPEA 3VR4A 1Q86C 2F0UA 2LRUA 2W9NA 3TEZA 1V81A 1HFGA 3Q6BA 3V05A 4IPDA 3MJ5A 1ICWA 2GMIC 1L2FA 1PFMA 3WOFA 1DOIA 3AE2B 2HQLA 1CQVA 1T6BX 4KJOA 4B9XA 1C4PA 4OVUA 4QIWE 3DBRI 3RYTA 4DQOC 2MJEA 2DJGC 2Y0SG 2EE1A 2YU9B 4LNIA 5KRUA 2A69D 4LFCL 1IW7D 1N63A 5TR5A 4JI5L 2AWNA 5IOCA 3QIJA 3OW7A 3T53B 4GOPC 3MFYA 4TQUS 4ZRPA 1HEZE 1V1PB 4XIGS 4G3XB 1YHBA 2ZNVB 5BMIA 1BBWA 2K5QA 2IWHA 4HEA1 4QMGA 4F7ZA 2IGDA 5KEEA 2EXDA 2FJ2A 4YY3L 2L76A 1Q12A 3OOCA 4HN7A 1T3QA 2KCNA 4A3BB 1K51A 4AWJA 3NVWA 4DV6L 1YZ6A 1K8GA 3ZDMC 2KT7A 1EIYB 2LMCA 5T1GA 2MP1A 4XT3B 3N30A 2PVGC 1JQ4A 1WMHB 2D62A 4IUMB 4US9A 1U9RA 2NVQB 3NZ3A 5C3XA 2FINB 1HZ5A 1SJHD 1H9RA 2NN6I 5IYBH 4DXAB 4RMAA 4FXKC 3CRLC 2HJ1A 4C3HH 3U7ZA 2UUCQ 3T8MA 5EE1A 4EQ5A 4ZHPA 2E6XA 3K9OB 4ZYSA 1YNXA 2OCEA 3S1RB 3N6RA 3RN2A 1PMRA 5BR8L 5C0XJ 5HGTA 1N61A 1WXSA 4BBRB 1XMQQ 2KWVB 1NI2A 1XPOA 2WFWA 2NBUA 4HRSA 2UUAQ 2BTEA 3MJWA 4QCLA 3DBHI 3QJZA 1MHHE 3L08A 3NTIA 3CCVA 4NXML 3WAPA 1VCIA 1LO5D 4OHJA 4K8IA 2ZJRA 2KHWB 2VNUD 1D4BA 5EBCA 1F2LA 1Y14B 3EECA 1PRTB 4A3FG 3AE5B 2FBWB 2KCCA 3DM3A 3B1LX 1WYDA 2K50A 4ABNA 2XEWA 2PW7A 2CWPA 2LXCA 2V9HA 3AU5A 4B9WA 3RZOH 3RZDB 1FJGL 4LNKA 1PV4A 3ITPA 2WGSA 2NVXB 4WJPA 4XQJA 1N5XA 3H0GH 1CA6A 2N8NA 1MI0A 2RDGA 4OZAA 5H8YE 1D6EC 1D2BA 4P75A 3A74A 3C1EA 4X62L 4A3EH 5J39A 2DAJA 4EVOA 3HOXG 1F9JA 1AW7A 1I94L 4BY7G 1KLGD 3KBXA 2WDQB 3DBLI 2GB1A 2R92B 4ANVA 5M5YB 3CSTA 4GLSC 3P20A 1SNDA 2E5LL 1VQ6A 4HSPA 2YEPB 4YTPB 2L0FA 3DBLB 5JZEB 1RTNA 3BWUD 4QUCA 1MFWA 2C9WB 3S1QB 3V61A 1FCCC 3NVZA 1JB7A 5HG2A 4GN3B 4MGIE 2IY0B 2FXQA 2NN6G 3KFUA 1XTCD 2D3CA 3PGZA 5I6WA 1G2SA 1N34Q 1QG7A 1SSOA 3HOXB 3OPOA 1I42A 2JA8G 4JBMA 5JEAJ 4XGAB 1S4ZA 5ELBA 1GUNA 2WIIB 2VH1A 4M8MA 3TBLD 1WZ0A 1X32A 4DR6L 4FYDA 1PYBA 1FPYA 3VUXA 1WXQA 2Z59B 2LZ6A 3M62B 4GMVA 3VYTA 3RNAC 3T51B 4PG3A 1EM7A 2L1AA 3Q3JA 1GC6A 1F2ZA 3U4ZA 3SK5A 4LFAQ 3TZDA 3SFEB 4DR7Q 3ZDTA 5M3FH 1DYQA 1S5FD 4A3FB 1ZOYB 3UINB 1SNMA 1I50B 1MIUA 4JI6L 2JT4B 2N9XA 3P63A 4BY7B 2F0MA 3HKSA 4KLKA 4DFAA 3C3LA 4L5RC 2BPSA 3ZRFA 1V2YA 1GVPA 2LGIA 2EJMA 4FLHA 4DHJB 1DONA 4FJZA 2NBVB 1PZJD 1WJJA 2YEPF 4K0KL 1Q46A 2K7VA 4ICUA 1NR2A 4LNNA 4W9EA 1V9PA 1ASYA 2JEAI 1P8LA 2WKDA 2K75A 2KAJA 4JX1C 4J6IA 5GMVA 1N34L 2NBFA 3FPUB 2XN9C 3T13A 1YN4A 2KJRA 3D6WA 3K6OA 3ENEA 1VQCA 4DN4M 2WINB 1F9RA 1BQQT 4KTAA 3PCOB 1T0RC 3VXWA 1XLOA 1DOYA 1M90C 5ELNA 4IFDG 2QA4A 3ZVVA 4RM8A 2WHIA 4BBRG 2RPQA 1XPRA 2C9OA 5I2YA 1WI0A 3RZWC 3TL5A 1HCZA 1FXTB 4R9WA 1WSPA 3C19A 2AQ3B 1FIQA 1PDXA 4QL5A 5C4XB 4KKJA 2B39A 4JI3L 4GDLA 2PMZB 2GA4B 3I2ZA 3VRBB 1VRAB 3VTVA 1CZGA 4X65Q 1TWCB 3E6ZX 3QAQA 2HE7A 3M9BA 1LUZA 5ELEA 1TTNA 3F2BA 1JT8A 2JA5G 2GBKA 3AE1B 1ENAA 3S24A 2O2VB 3OJ3A 4BOZB 4M8AA 2Q2IA 1B2TA 4BZAA 2Z4IA 2MP2A 4S3SA 1EZ6A 1HE8A 1XLNA 2KC1A 3T1HQ 1KDCA 2L52A 1TY0A 4O2DA 1KLUD 2X6GA 1HTQA 4P2CB 4DV0L 5JJIA 2ZEQA 1S72A 3DWGC 4DR5Q 3QWNA 2VXWA 2L00B 1N8RC 5HHDG 4D2KA 4XDDA 2F4VL 3MEHA 2Z6BA 4YWMA 4GDKA 3KLSA 1UD7A 3TCAA 2WXHA 1SGHA 2ENBA 4BY1H 4KX6B 2NPTB 2L0TA 4DV2Q 2R3ZA 4JI0Q 1K8MA 2Y3AA 4OIKA 2L55A 4V0BA 4DBGA 2H5XA 1LTSD 2WNMA 2XWJB 1G6JA 5LMNW 3HOYG 2RCFA 3RUZA 3E0EA 1VQGA 4PZ8A 4BWGB 4C3JG 3GTPH 2C7MB 3P4SB 4HPLB 1MI2A 1IYJB 2C35B 1FRRA 2K52A 2WXIA 3GTKH 5D3DA 3OWFA 2RPVA 3GTQH 3T16A 4BBNC 1GO3E 2EYLA 2VUMB 5HY6A 4XQNA 1Q8IA 5IP4D 2FCMA 5IE8A 2B2TC 3HVDA 4MTKA 2CKZB 3CXCA 1YJ9A 4ZQ3A 2R92H 3NQIA 1LT6D 3BVGA 1VLBA 2WXFA 4NJ7A 2J0TD 2MWSB 4B3ML 4P7IA 4GSWA 1GJXA 3U7DA 1HUMA 4YHHL 2IPKD 1H9JA 3CU7A 3PF5A 1S3OA 1LQBA 3QWZB 5GADC 1OXXK 2BA1A 4GS3A 2J42A 4YL8A 1HHVA 4HJAA 5CR3A 3FKIB 3ND8A 4P73A 1K73C 1N32Q 5CORA 2KCMA 2ON8A 2ZJDA 4K8JA 1X3EA 3D4RA 5EKIA 4ULLA 4PMWA 1EF1A 5GXGB 3VYUA 2VQFL 4MDKE 1K83B 2ZXOA 1WX7A 2DY8A 1HR0W 3HZXA 1QNKA 3C0RB 3JYUA 1GD7A 3AEVA 4DAVA 2LVQA 2EYJA 1DCZA 5EKKA 4TRDA 1IKLA 2JQRB 3Q14C 4U68A 2YLMA 2ZCCA 3N1ZC 4AYBG 5DEHA 2CHXA 2KOXA 3NTKA 1PH6A 3TJPA 4MJSB 1TIID 4OELB 3A54A 4UAIA 1T5XD 4GLXA 1CTMA 2ZTDA 1AWDA 3I3TB 3R7QA 3V6CB 2R6GA 5IGGA 1YJWA 3OJ4B 3S1RH 1RYJA 1I4QA 1YVCA 3RMHA 1ZW7A 4YCVA 3I4OA 4OGQC 3DOWA 2CJOA 4CHTB 3M4QA 2BCOA 3WAOA 1NR4A 1T9HA 4FULA 2J4XA 5FKAC 3L0WB 2IT1A 4MT5A 2GVAA 4A93B 3J80i 3J7ZC 3UIPB 4BXXH 1KQSA 5M5YH 2VY3A 5A2QE 1J5EQ 1KAAA 1GUAB 3C46A 3MC8A 3FMCA 1WX9A 3DEOA 1Z5SB 1GG3A 1I4RA 3NRZA 3IG3A 3ZKJC 3GZNB 2JA7B 3EA6A 4NW2A 1C77A 4OX9Q 1B3QA 1PGAA 3UE1A 3H7PB 1KOTA 3DCGA 3FPPA 1SYFA 4NDXA 1I3QB 4ODGA 3VR2A 5IP7H 5KYLA 1GUGA 4KZCA 1PZID 4NAWB 4L8JA 4LCDE 3FILB 2M8SA 2NYZD 3SGIA 1PHJA 1Z6HA 4LUVA 3M4OH 2K03A 2BS3B 2J0KA 3W9CB 2INPE 2QEJC 3S15B 4KSKC 4IPHA 3QOJA 2K6DB 3A55A 3K9PB 4TQ1A 3BYTB 1EOVA 1KNEA 3GTMB 1SNCA 1AEXA 1SMYD 1P98A 3V3XA 1JJGA 1IL2A 1MG4A 3P2BA 1RF2D 2D0OA 4HCSA 1LTAD 1QVGA 5FJ8H 2DN8A 3GO5A 5K5PA 4MM3B 4Y7NB 3J81c 3UGBB 3CAMA 2DBYA 4HLEA 3KBGA 3SEBA 2C60A 2UXDQ 3L4PA 4QAYA 4P16A 1PH5A 2JYTA 4IALA 4A76A 2JXXA 2R61A 5JJZA 2RSNA 3KUPA 2RMMA 1J19A 4IUQA 1E90A 1NTGA 4J6HA 2B2VA 2M1MA 1V43A 1UELA 4J3OD 2HD3A 4PV1C 4KIKB 2HDLA 1F9PA 2ZJPA 4A3MG 2JVCA 1O7YA 3CWIA 3V60A 2V3PA 3PIOA 3E9HA 2O5JC 3OIPA 4NB3A 4R4QA 4JCVE 3SK8A 1VF5C 2AL6A 5L95C 1IBXB 4DR2L 3WALA 3BVZA 3RD4A 4LF8Q 1FO4A 2UU9L 2PW9A 4XX5A 5C5MA 3A33B 2EVBA 3FKYA 2ZW0A 1EEFD 3DWPA 3UI3A 2ZPNA 5LLIA 4HCPB 1GXDC 3UQAA 5IWAL 1MG8A 4EQPA 2PE6B 3QK0A 4K2LA 4UP9A 1TJEA 3Q3MC 1EY4A 1YOVB 2MBHA 4BY7H 4KMUC 2KDEB 3AN1A 2Z4HA 3W5VB 1KFYB 4DR1Q 1FL0A 3VR6A 5C3EG 2WX1A 4EZJA 2L1BA 1VQ5A 1VQAA 2PI2A 4KD3A 3HVZA 2MBQA 2QKIC 1AZQA 2K9XA 2E76C 4KHVA 5M9OA 2KQ3A 1L4DB 4NNJB 3OYYA 1PGBA 3BS1A 1FXAA 3PTFC 3RN5A 4A93H 4Q2JA 3CKIB 4IC7B 2MW5A 1XF5L 3QIAA 1Z2MA 2IO3B 2NZ1D 3T9LA 2MO0A 1JOOA 1YD8U 2YTXA 4YTNB 2L05A 1X54A 5DPTA 3RN9C 3STBD 1SYEA 4W9FA 2XWBB 3HOWG 4HPMB 5E4WC 2F4VQ 1ZXIA 2V3SA 3WAMA 2O6VD 3S1QH 3EN2A 4B3RL 3RI7C 3E56A 3KF8B 1KJTA 1X3PA 3H6NA 1X55A 2N49A 2XGTA 2MUYA 4K1RB 1HR0L 2NTSA 4FXGC 4RFBA 2EDGA 4HKQA 4LK0M 4FVMA 4KGTA 4B0EA 2K33A 3RLFA 2N7EA 1HNXL 2NMQA 3A1QA 3IXSA 4A55A 3EC8A 1UE1A 1EFWA 5AFWA 1Y1WH 1C9OA 4USAA 1UGJA 3EUB2 1NE3A 2UUCL 5IT9L 1LYLA 4AH6A 3HOVG 4M01A 3PUZA 5EDSA 1VQ4A 1Q8KA 4IPGA 4WQMA 4B6WA 3TN2A 3QOLA 1F77A 3RZOB 2KN4A 3NHEB 4XYCA 3P42A 1ESRA 3VDZA 4DHZB 2KA7A 1PTOD 3PUWA 4PZ7A 3IKJA 1PA6A 4NXMQ 1LLRD 2KZRA 5ELDA 2G3QB 1WGDA 4WRDA 2XTIA 4GKKQ 4KHZA 1TKEA 1YNJD 2IX0A 2NS5A 4DDGD 4W9KA 2MNAA 1PRTC 3GTQB 1S5ED 3TS2A 4B08A 1BT0A 3GE8C 2AKWB 2J53A 4IKGA 4FJVB 3APFA 2BGFA 1PTOH 2BW2A 1MKHA 1X3QA 4H13C 3M7NA 2LGDA 2WXNA 4LNFA 1ZE3D 1CKNB 5E7NA 2AWTA 1FD6A 4HAEA 3F1ZA 4NY0A 4KIKA 1F9QA 4KN4C 4HDOA 1XXGA 2PIAA 3SR1A 2QC8A 2RDHA 3AFPA 3RLOA 4F7XA 5CV5A 2RA4A 5IP9G 3E5SA 4BBSH 5CV7A 1KRTA 3MXNA 3RCZA 3AEAB 1SE2A 1VMCA 2AQ1B 4L5QA 4A75A 1A3VA 4MM3A 1STHA 4DR6Q 1EQRA 4DR3L 1ISNA 3V2TA 1J6QA 3NHHA 4C2MH 1IBKL 3I3CA 1TKYA 5GAGC 1V49A 2EELA
chains in the Genus database with same CATH topology
3OWEB 3NWSA 2EYFA 5M3MB 4F8MA 5IIFA 5FLXE 5CBEE 1J7AA 4TMAB 4NZLB 3R8BA 4H7BA 4A3MB 3C1FA 2B8GA 2F0LA 2J7ZA 2O5IC 1XO3A 4A8XC 1CHPD 3IT6B 3HUIA 2PPBC 2Y0SB 2KMMA 1TQOA 1KH0A 4ZUJA 4G4KA 1YNND 4US8A 1K52A 3VA7A 3AB5A 1Y1VB 1W6KA 5M5WB 3WOEA 3J81E 1R4QB 2JP1A 2F0PA 4H0LC 2EJFC 3DM1A 1S5DD 2QMTA 1II3A 1K50A 2WU5B 2A73B 4CQNA 3VR8B 1JWSD 2HUGA 1IKMA 3ABVB 2GI9A 5JAVA 2FMMA 4BA1I 2CQAA 1SAPA 5IT9E 1QCBD 2EYPA 3GQBA 1NI3A 1OXTA 1GUSA 3KWLA 4PMBA 1BUVT 3IL8A 3K0YA 5KNBA 1JWUD 3T3OA 1OXVA 2ICIA 2SAKA 2A69C 3S17B 1SJED 1Y8OB 3Q22A 1C9FA 4O1NA 4YXDB 5FR3A 3DWMA 1LV9A 1GAQB 2M0AA 1WTXA 4FXDA 5KYIA 2MGSA 4J8QA 3VRAB 2M00A 3J7AV 3HS0C 4K6LA 1I6HB 1QOBA 4M1UB 1UWXA 2F0EA 1GUOA 3HRZC 4AYBB 3NBHA 4FF3A 1JC7A 2XSCA 2WQYB 2E74C 4KY6A 1HFNA 3Q8AA 2K05A 2G1EA 1C48A 4UDUC 1QOFA 3AMZA 1DOXA 1ZDXA 3UI2A 2K0PA 1Q3LA 4TQ0A 4KN7C 4GDKB 1IW7C 3SVMA 4RGOS 1BO0A 4KJNA 4YSXB 1LTTD 4X3UA 2IDYA 1DOMA 2WDRB 3QO2A 5EE9A 3B2GA 1AFPA 1STBA 4C3IB 2BE5C 1PLFA 2Q8IB 3ZQ4A 2DY7A 2V0GA 1DGJA 1SF0A 1LACA 1YNNC 1QQRA 1QLBB 3SHLA 4C1NI 1XYIA 3GTOB 4CGYB 3MHBA 4TKOB 3DXJC 4GDLB 4ARCA 5EQ0A 5C4HA 4L23A 1BCPF 3FAHA 4Q0FA 1NYQA 1PTOC 4MH8A 5C0XI 3LNNA 1ZYRC 3I73A 2RQXA 2SOBA 4IUVA 1WYGA 3K58A 2L32A 4LLGM 2LHEA 3KLRA 1E6EB 3SDZA 4EQOA 2PZTA 1HA5A 3M4YA 1DOKA 4YWGG 1CT1D 3AECB 3I9V1 2Y5PA 4G7HC 3FC4A 1RKNA 2F0SA 1EOTA 3M3YB 2IJ0A 4J1MA 4G57A 4FP5D 3NP8A 5C0XH 3EJIA 1PYWD 4B0MA 2AQ2B 1DM0B 1E0BA 5JEAH 4YIJA 2HCCA 1QF6A 2L83A 4LK1C 3MVVA 4RF1A 4RF0A 4C3HG 1EQTA 3MFGA 4LAAA 3MA2B 3K5OA 5DAUA 1EZ8A 3Q8BA 2A6EC 3NK9A 1WTRA 3HRDD 3S16B 1AYFA 2F0HA 1QKZA 1H9MA 1I4GA 2WXRA 4KKIA 1OO9B 4DAYA 4WH4A 2RVLA 5EPLA 5I9OA 1EYDA 3W2DA 2WKCA 4LMQD 2VZKB 3HOYB 1STNA 3I8ZA 4IFDJ 1PUTA 2EJGC 2F0WA 4ZOHC 5DNFA 2EPBA 3ERQA 2RDFA 3AE3B 2SNSA 2B2TA 1A3TA 2PVOD 1CI3M 1MBYA 3ZGZA 2F0GA 5BN3A 2WXLA 2IL8A 1EQVA 2PMVA 4MIUA 4C80A 3A7AB 5H92C 5CBAE 1WVLA 1LT3D 1RD9D 2EOTA 5CV8A 5F2DA 4OO1H 1C78A 3TEYA 2OEDA 1HTPA 4F88A 1OXUA 4BY1B 3AM9A 4RCNA 2X69A 3M85A 1JR0D 1RFKA 1SYGA 1Y56A 4HMJA 4JBWA 1IL8A 3DEPA 1EWCA 1QJOA 1WTVA 3OHXC 2MJDA 2K04A 1ENCA 3LWEA 2VB3X 2KEEA 3SE0A 3PIO3 2Z1CA 4PNYA 2F4IA 4NMZA 4O42A 1EY7A 3QJYA 5C44B 2O2LD 3NVYA 3SK4A 1BNZA 1JOQA 5C2TB 1HUNA 4A3JB 5C4ZA 2PZUA 4MACA 4HSVA 2JSOA 3TZUA 1WTQA 1WD0A 2LJIA 1XCQL 4DGZA 5T8IA 1MSGA 1C8CA 1WTOA 1D5XC 1YNJC 1I4PA 3AE9B 4FXCA 4ZLTF 3ND9A 3OMCA 1J8IA 4HKZE 2LS01 5JOBA 4ZRZA 3VYRA 3NS1A 2Y5CA 3AB9A 3FRPB 3HOWB 1U4RA 1ZPSA 1EY9A 3MWYW 1DXMA 1E7PB 1EY6A 3KF8A 2I38A 5FK9C 3BK2A 3J80E 4N58A 2CVRA 4EGVA 2IW3A 3C8YA 1BCPD 1U4MA 2D5DA 3VQIA 2F3WA 2Q8RE 1ROEA 1TZOA 3A8JE 1GPXA 3A8IE 5ELFA 3H8HA 2W3SA 1Q10A 3URYA 2MPMA 1OQRA 4ZK9B 1SXTA 1VDZA 1O78A 1BOSA 5HFYA 2BOSA 2HDEA 4RH6A 1GUWA 2KWDA 1NUCA 1SSNA 1A15A 1ZUD2 2GRIA 2BB5A 1YQ4B 3WCQA 1VJKA 1N5WA 1VR9A 2F0TA 3W1SA 1R7SA 2IGGA 3EQLC 5TSSA 5DM73 1ACCA 3K59A 2FE8A 1IBXA 2L0CA 5CV6A 4JPSA 4WURA 1F2MA 2F0KA 1A2UA 1FRDA 3ONAB 4L63B 5KNDA 5JEAG 1E2WA 1UAPA 4RHSA 1I6VC 4IUUA 3PZ8A 4QIWB 1AZPA 1F2RI 5D65A 5C0XG 2A6HD 1JE4A 1TKWB 1HZ6A 2LHDA 3HEJA 4IUTA 2DYOA 3AMUA 2DNCA 3AEDB 3K5LA 1H9SB 1PXUA 2K5WA 2B2WC 4X3KA 3DWAA 3IFDA 2WDVB 2M19A 3U9SA 4KK7A 1PRTD 1CQFA 1I4XA 4IOIE 4KGSA 3A7LA 5JVH3 4IQZA 1CZPA 1QB5D 4OL7A 2SNMA 4KD4A 2EY6A 2JZPA 1ML0D 3QB3A 1TWFB 3BDCA 4DXFA 3ZYYX 1HXYD 1FEHA 4NJCA 2F0NA 3HOVB 1YQ3B 3Q6SA 2X38A 3S14B 1JALA 2AUJD 3E9SA 3OMGA 2LY7A 3N52A 5ELCA 4R8IA 3TSSA 3D8GA 5NUCA 2NTTA 3IT4B 2I2YA 3Q24A 3MHZA 5FO8B 4DNRB 1ZEQX 5G5GA 2HDMA 4JE3B 3TUOA 2W54A 1PFDA 2A6HC 1BCPB 3W5UB 5JPNC 2CHBD 2OT2A 3P75A 3UI3A 3VYSA 2K5DA 2N0SB 4R3DA 2F0VA 1Y8NB 4KV6A 5C6AA 3VR5A 3FVQA 5M5XB 3K57A 2LFIA 1L0YB 1SBBB 4H44C 1BF4A 4F87A 1E2ZA 2E2JB 2FHTA 4IUNA 3I4NB 2INNE 2WAQB 5FO9B 3R93A 1LTRD 3K5MA 2WS3B 1M8AA 4FF1A 1QOHA 1NYRA 1C79A 1PZKD 4CKBA 3V96A 2IX3A 1F9SA 3SXHA 1GB4A 3TP6A 2A68D 2M2LA 4DK0A 1XLQA 2F0JA 1JW9D 1B4OA 4C3IG 5EJWA 1KDAA 1ONLA 1SYBA 3TMEA 2EXZA 2N9LA 1OQQA 1O7LA 5E3FA 3F2UA 3AE7B 1G6ZA 1NVID 1LTID 2MJ8A 1G8ZD 3DMUA 4C56C 2L5TA 2WXJA 1PFBA 1YN3A 4XYQA 3AV8A 4IURA 1B53A 2WXPA 1EY0A 2F03A 2E75C 1B1ZA 3HOZB 1O80A 1XEEA 2F0OA 1I4HA 4C1NK 5HI1A 2D9UA 2XNAC 1XX8A 4XTCS 3IAS1 4IFDI 3EGRA 1DZ1A 3N9YC 4YT0B 3CIRB 1IGDA 1L5PA 2KEDA 2EY2A 4ME5A 1GOZA 4CJ0B 3MXUA 4IZ8A 2NVYB 4JWSC 3FDTA 1FYCA 4WAFA 3I4MB 2LUMA 1SDFA 3X3MA 4XT1B 3CHBD 2H4OA 5CYUA 1JOKA 4YTMB 4RKLA 3L7ZC 3KK7A 3AE6B 2DWQA 1FD7D 3AEBB 2DYMA 1L6VA 3NVVA 3H6MA 1HQRD 3L3OC 1RDPD 1RODA 3U9OA 1J9OA 4XXEA 2CU3A 2B2VC 2PQEA 1KABA 1BMLC 4FF2A 4TSSA 2K22A 2JA8B 3TEWA 3MXPA 3I90A 4ZKBB 2FUG1 1ZDVA 1F2YA 5IGFA 3EFXD 5EGTA 1MVKA 4JWUC 4ZHOA 4EE2A 2LFNA 4XDXA 3D4DA 1HQMC 1BUIC 4WJWA 1PRTF 2WXQA 4NKLA 5MPOA 4DK1A 2WV6D 3LB8C 4WWMA 2K1BA 5IGEA 4DU9A 4IFDH 1JORA 4BBSB 3D6CA 4KY7A 2L12A 2YYZA 3NBIA 4G7ZC 4ZKCB 3S2HB 4XWTA 1ZXHA 2ZXRA 1JQYD 4Q5VA 1L4ZB 4N6EB 1A70A 4A3KB 2QIEB 1NENB 2BDNA 5EE3A 2PKOA 4IDIA 2IGHA 1ILPA 2B76B 1TS5A 1TS3A 4XDCA 2KQ4X 4IUPA 3JAME 1QILA 3J7YW 4KY5A 2H89B 1O7ZA 1Z47A 4KI0A 1YMHE 3BDLA 1Q1EA 1UEAB 1UNSA 1S5BD 1EYCA 5EPKA 2AX5A 3NQTA 1PDQA 1JWMD 2EKIA 2F0FA 1EL0A 4C7ZA 3P7JA 3E0JA 5EE0A 5BYSA 1CHQD 3Q23A 2JX5A 2K32A 4LK0M 2B2UC 3PUVA 2ONQA 5JXVA 2N7JA 3J7AF 4K5VA 4HEDA 3GTGB 1U4LA 3P4QB 1NSNS 3HGBA 1FMAD 3I70A 3X3NA 2X6LA 2B2YA 5IGCA 3DWQA 2CJNA 2QF7A 5LL6X 1QOGA 1XWEA 4RWSC 3ZJTA 2PO4A 2BE5D 5A2QL 4ZRQA 1IUEA 1HRJA 3AEFB 1QWYA 3FEWX 3TDQA 1ENFA 2TSSA 3R2TA 3H09A 4RCOA 4CKEA 2JYEA 2MHVA 1LTGD 2ICEC 1SIJA 4K2KA 4REZA 1AN8A 2KVMA 3MTSA 4PMCA 4A3EB 3HKZB 1XCTL 4HCEA 3H0GB 1EEID 1B44D 1VMPA 2CW0C 2BB6A 2B2WA 3GV3A 2KUMA 3D31A 2D5GA 1FFUA 1E2VA 2QCPX 3TP7A 1GHJA 2BA0A 1FCLA 4FNFA 2B2YC 1RWSA 4A3GB 5C3EB 1Z7TA 1FXIA 4QF4A 4RNAA 1TVXA 1G291 3LXFA 5CV4A 2B2UA 4NP5A 1PTOB 1WCMB 1CFMA 4XQQA 3GV6A 1Y69U 2E2DC 2B63B 4K5XA 2C5CA 1T5EA 4KKTA 5G3LD 2DLBA 4BA2I 2F1MA 3SFDB 1G2TA 1QOAA 1EIHA 4KGRA 3IFTA 4OZBA 1E9MA 2V4DA 4OW0A 2I46A 3M4OB 2ZW1A 4FF4A 1RM6C 3R2IA 5DM63 2JA6B 1TT2A 4MN3A 2JSVX 1VF7A 4WFN3 1EU4A 1U4PA 1F0ZA 3I91A 1G91A 2BT6A 5K36H 5ISRA 2OEOA 2LMCB 5D14A 3KWVA 5J22A 2OF1A 2N55A 2EZVA 3CRKC 3NSWA 4R8NA 3O13A 1EY8A 3TP8A 1YNTE 2M56B 4OO1I 3AH7A 1SNOA 1E0ZA 3NWTA 3AEGB 3GTLB 5FO7B 2J52A 1TYGB 3Q8EA 2RKSA 4QUFA 5K36G 1L6UA 2QJLA 3NTHA 5E1FA 4AS1A 1FNUA 1YN5A 5KGUA 2A68C 2E2HB 2WU2B 1CM9A 1DJRD 3C2PA 2CW0D 1JCKB 4M0WA 4P6VF 2M9VA 1EY5A 4XYOA 1DD2A 4DXGA 2PW5A 1H9KA 1Q1BA 1EYAA 2V3NA 3I4LA 2RSOA 4BS9A 5I2XA 2JA5B 2EY1A 3D3RA 3ZJUA 4DF7A 1Y8PB 3GTKB 4X3SA 5EBDA 3I72A 4LJZC 1FGBD 3D4WA 2MH7A 1LT5D 4PQXA 2BYTA 5HURA 5G5HA 4E6IA 1C4CA 4C3HB 2O4XA 2NUCA 4RGNA 1HA6A 1IYVA 5IGBA 5JPMC 2SDFA 2I07B 1STYA 5FLXL 3DHQA 2FFKB 3DUZA 3AEEB 1EWYC 1NEKB 1YJJA 4N59A 3P4RB 1EU3A 4C2MB 1D1KA 3A56A 5A35A 1I7HA 4L1BA 3MAQA 4K14A 4RGTA 2PZWA 2SEBD 1SE4A 3MC0B 2MEKA 3IAYA 1ZXTA 3KLSX 1A3UA 2NWGA 3NUHB 1AP0A 5AUKA 1MD2D 1ET9A 1W6JA 2E2IB 3GS2A 3BDOA 3NXWA 4A3DB 1BDOA 1WWTA 1GUTA 3S2DB 1RTOA 2H88B 3BVMA 1SNQA 2V4IB 2HQEA 1J7BA 1ET6A 3U52E 3A8KE 1RCVD 3K5NA 4FO2A 1JWAD 1IYUA 3H94A 3RFZB 2H1EA 3FILA 2VZKD 5LL6S 4CBVA 4DNTB 4CJ2C 1D1IA 4PT5A 4CJ1B 2W55A 5BMGA 1SNPA 2PNRC 5BN5A 2PCFB 5C3WA 2JU6X 1JICA 4DAPA 4WIPA 1EFID 4ITKA 2D2CC 1UWMA 3J81L 1Y1WB 4XE0A 3NUCA 5M3FB 2K28A 1RHPA 3LYYA 4RAUC 3H91A 1LTBD 3HG9A 1R9TB 1JB3A 4C3JB 2NVTB 3PUYA 3LX0A 1J7CA 1ZP0B 5LHY1 4Z9CB 4OIJA 2AUKA 2Q8TA 2R7ZB 2JYOA 1FM0D 1SMYC 2QDBA 3AE4B 1VZ6A 2MJ3A 3BG3A 1K53A 1D5ZC 1JMLA 3PV0A 5T1IA 1Q90A 5I6YA 2AWOA 1LABA 2HTME 1NAPA 3W3AA 5COYA 1JRPA 3H3VC 1SYDA 2WXOA 5JVG3 3BK1A 1XLPA 1FFVA 3I57A 3M7GA 1KNAA 2K3UA 3VA5A 2F3VA 3S1NB 1VZ8A 4V190 2A74C 1TKGA 4OZCA 1TR5A 2KACA 3PO3B 2RBMA 2BBCA 4RHRA 3AE8B 3RPFC 1S5CD 1PGXA 2WB1B 4I7ZC 1SYCA 1MHXA 2ID0A 3R3OA 4C7YA 4IN3A 3PUXA 3WDNA 1TS4A 2N88A 2A5HA 1C76A 5CMDA 5KNCA 4L6TB 1FR3A 3PO2B 3ZJVA 1R4PB 4L2YA 2L4NA 1IHZA 3NE5B 1TWAB 1HPCA 1IGCA 3EVQA 5I9PA 1WTPA 5E6JA 2PLPA 1NCVA 2EYHA 4CKCA 1MSHA 1SB3C 2NB0A 1CZWA 3EROA 1YJIA 1M4VA 1KTKA 4HR7B 4N9TA 2F0QA 3VR9B 1PTOF 3J80L 3GP7A 3TEXA 1A2TA 4GZYC 3AU7A 3B9JA 4A3IB 1SE3A 2JE6I 4EQNA 1WTWA 1EWHA 1TS2A 2XVSA 3OSOA 2KHSA 5KIXA 4H2AA 2N9KA 2FMCA 2WXKA 3SR6A 2OXPA 2QSDA 1HTLD 3IAM1 4OO1G 3HOUB 3Q8CA 2XRSD 3U4EG 1WGKA 1ILQA 2LEKA 1CA5A 1FNVA 4NAMA 4HMIA 3PZ7A 1GB1A 1UUPA 2F0IA 2F0DA 3T56B 2KECA 4RA8A 1CJEA 2VB2X 4AQ7A 1PFNA 3S1MB 2ZT9C 2R93B 4XWWA 3TP5A 2EYOA 4A90A 1LT4D 3MP9A 2DNEA 1BXTA 1OFFA 1B9MA 4I65A 1EIGA 5C4JB 2JXMB 3CQZB 1A6XA 2BS4B 3PO0A 5EKLA 3LWUA 4WORA 2WP8J 1CK1A 1STAA 2W3RA 3PIP3 5D3IB 3GTPB 1WD1A 4ARIA 2K6AA 3J9CA 3P1HA 2EY5A 1KF6B 4RKBA 3MXGA 4KKSA 5G3LF 2OHFA 4A9AA 4MHEA 5FOBB 3U2SC 3BYYB 3T3NA 5BYQA 3S9WA 4X3TA 2KOLA 1VZ7A 1ESFA 3P4PB 1SFOB 1L0VB 3Q0AA 4A6QA 2K5PA 5EPJA 1KRHA 1TY2A 1E10A 3TBIB 1N62A 1C4QA 4RGMA 3GB1A 3T4AC 1V1OA 2XRQD 1STEA 5C5LA 3BIID 2WXGA 2E3TA 3B2FA 3QG1A 5BYRA 4LTUA 3HP3A 5IODA 2JWUA 2A6ED 1RJTA 2Z8LA 3JAML 1GHKA 1V8CA 1TU2B 1L0XB 3PMFA 5AUIA 3BZDB 2L11A 5LNK1 2Q5WD 2NN6H 1K8OA 3Q8FA 4K6DA 1V97A 4OVZA 1D5MC 2PTLA 3L9AX 1QT9A 3KQ4A 1JWBD 4QB4A 2ZXPA 1V1PA 2LKVA 1BR9A 4HTHA 1QE6A 1B9RA 4ID6A 2QILA 1TWHB 5I4DA 4KKUA 3ETRA 3NPPA 1B9NA 1B3AA 1H9SA 5E4XA 3GTJB 4K5WA 1BCPC 1QNUA 5CC4A 3GD7A 4HROA 4N9PA 5BN4A 2IX1A 1DOLA 2KJXA 5IGDA 1B50A 2TMPA 1SEBD 1OXSC 2WXMA 4U673 2JXTA 2WP9B 1ZYRD 4ZAIA 2KDMA 5C3JB 2G9HD 3MZ5A 1WRIA 2PYKA 2WACA 2BS2B 2ACZB 4YSYB 2WLBA 5BMHA 5D7GA 2K01A 3SK6A 4HJGE 5CGKA 1VDVA 3P1MA 1STGA 1BBXC 3K7AB 1P7FA 1V8QA 2L9HA 4G7OC 2W82A 1JROA 3OIQA 1TWGB 4DA2A 2HCIA 4JK1C 2XIWA 1MGSA 3G7LA 3G6JB 4ZUIA 1FNWA 3Q69A 2JEBI 1ZKOA 5CV9A 2EYMA 2B8FA 1F2RC 2BDOA 1P7EA 1N60A 2G9DA 4ILWA 5J1ZA 4YSZB 3VR3A 1C4AA 1KDBA 1MPEA 3VR4A 2F0UA 3TEZA 1HFGA 3V05A 3MJ5A 1ICWA 1PFMA 3WOFA 1DOIA 3AE2B 1CQVA 1T6BX 4KJOA 4B9XA 1C4PA 4DQOC 2MJEA 2YU9B 2EE1A 5KRUA 2A69D 1IW7D 1N63A 2AWNA 5IOCA 3OW7A 3T53B 3MFYA 4TQUS 4ZRPA 1HEZE 1V1PB 4XIGS 5BMIA 2K5QA 2IWHA 4HEA1 4QMGA 2IGDA 5KEEA 2FJ2A 1Q12A 3OOCA 4HN7A 1T3QA 2KCNA 4A3BB 1K51A 3NVWA 2LMCA 5T1GA 2MP1A 4XT3B 1JQ4A 2PVGC 2D62A 4US9A 1U9RA 2NVQB 3NZ3A 5C3XA 2FINB 1HZ5A 1SJHD 1H9RA 2NN6I 4FXKC 3CRLC 3U7ZA 5EE1A 4ZHPA 2E6XA 4ZYSA 1N61A 3S1RB 3N6RA 1PMRA 5C0XJ 5HGTA 4BBRB 4HRSA 2BTEA 4QCLA 1MHHE 3NTIA 1VCIA 1LO5D 4OHJA 4K8IA 2VNUD 1D4BA 5EBCA 1F2LA 1PRTB 3AE5B 2FBWB 2KCCA 4ABNA 2PW7A 4B9WA 3RZDB 3ITPA 2NVXB 4XQJA 1N5XA 1CA6A 1MI0A 2RDGA 4OZAA 5H8YE 1D6EC 1D2BA 3C1EA 5J39A 4EVOA 1AW7A 1KLGD 3KBXA 2WDQB 2GB1A 2R92B 5M5YB 4GLSC 3P20A 1SNDA 2YEPB 4HSPA 4YTPB 1RTNA 3BWUD 4QUCA 3S1QB 1FCCC 3NVZA 5HG2A 2NN6G 1XTCD 5I6WA 1G2SA 1QG7A 1SSOA 3HOXB 3OPOA 5JEAJ 1S4ZA 5ELBA 1GUNA 2WIIB 1X32A 4FYDA 1WXQA 3VYTA 3T51B 1EM7A 2L1AA 1F2ZA 3SFEB 3SK5A 3TZDA 1DYQA 1S5FD 4A3FB 1ZOYB 1SNMA 1I50B 3P63A 4BY7B 2F0MA 3C3LA 4DFAA 2LGIA 2EJMA 1DONA 1PZJD 2YEPF 2K7VA 1NR2A 2JEAI 4JX1C 2WKDA 2KAJA 2NBFA 3FPUB 2XN9C 3T13A 1YN4A 3D6WA 3K6OA 4DN4M 2WINB 1F9RA 1BQQT 4KTAA 1XLOA 1DOYA 4IFDG 2C9OA 5I2YA 1HCZA 4R9WA 1WSPA 2AQ3B 1FIQA 1PDXA 5C4XB 4KKJA 2B39A 2PMZB 2GA4B 3VRBB 1VRAB 1CZGA 1TWCB 3E6ZX 5ELEA 3AE1B 1ENAA 4M8AA 1B2TA 2Z4IA 4S3SA 1EZ6A 1XLNA 2L52A 1KDCA 1TY0A 1KLUD 2X6GA 4P2CB 3DWGC 3QWNA 2VXWA 5HHDG 4D2KA 4XDDA 3MEHA 3KLSA 2WXHA 2ENBA 4KX6B 2R3ZA 1K8MA 2Y3AA 4OIKA 2L55A 4V0BA 2WNMA 1LTSD 2XWJB 3RUZA 4BWGB 4C3JG 3P4SB 1MI2A 2WXIA 1FRRA 5D3DA 3OWFA 2RPVA 3T16A 2EYLA 2VUMB 4XQNA 1Q8IA 2B2TC 3HVDA 4ZQ3A 3NQIA 1LT6D 3BVGA 1VLBA 2WXFA 2J0TD 1GJXA 1HUMA 1H9JA 2IPKD 3CU7A 1OXXK 2BA1A 2J42A 1HHVA 5CR3A 3FKIB 3ND8A 5CORA 2ON8A 4K8JA 3D4RA 5GXGB 5EKIA 4ULLA 4PMWA 3VYUA 1K83B 2ZXOA 2DY8A 3HZXA 1QNKA 4DAVA 2EYJA 1DCZA 5EKKA 4TRDA 1IKLA 2JQRB 4U68A 5DEHA 3NTKA 1TIID 3A54A 4UAIA 1T5XD 1CTMA 1AWDA 2R6GA 5IGGA 1RYJA 1I4QA 3RMHA 4OGQC 2CJOA 4CHTB 2BCOA 1NR4A 2J4XA 5FKAC 2IT1A 4MT5A 4A93B 5A2QE 1KAAA 3C46A 3FMCA 3DEOA 1I4RA 3NRZA 2JA7B 3EA6A 4NW2A 1C77A 1PGAA 3FPPA 1SYFA 4NDXA 1I3QB 4ODGA 3VR2A 5KYLA 4NAWB 1GUGA 1PZID 4L8JA 3FILB 2NYZD 1Z6HA 2K03A 2BS3B 3W9CB 2INPE 2QEJC 3S15B 3QOJA 4TQ1A 3A55A 1KNEA 3BYTB 3GTMB 1SNCA 1AEXA 1SMYD 3V3XA 1RF2D 4HCSA 1LTAD 2DN8A 3GO5A 5K5PA 4MM3B 4Y7NB 2DBYA 3KBGA 3SEBA 3L4PA 4P16A 2JYTA 4IALA 2R61A 5JJZA 2RSNA 3KUPA 2RMMA 4IUQA 4J6HA 2B2VA 4J3OD 1V43A 4PV1C 2HDLA 1F9PA 1O7YA 3CWIA 2V3PA 2O5JC 3OIPA 3SK8A 1VF5C 1IBXB 3BVZA 3RD4A 1FO4A 2PW9A 5C5MA 2EVBA 2ZW0A 1EEFD 3DWPA 1GXDC 4EQPA 4K2LA 1TJEA 1EY4A 4KMUC 3AN1A 2Z4HA 3W5VB 1KFYB 3VR6A 2L1BA 4KD3A 3HVZA 2QKIC 1AZQA 2K9XA 2E76C 4KHVA 5M9OA 2KQ3A 1L4DB 1PGBA 3BS1A 1FXAA 4Q2JA 3CKIB 1XF5L 3QIAA 2NZ1D 1JOOA 4YTNB 1SYEA 2XWBB 5E4WC 1ZXIA 3E56A 1X3PA 2MUYA 2NTSA 4FXGC 4RFBA 2EDGA 4HKQA 4FVMA 4KGTA