1ESFA

Staphylococcal enterotoxin a
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
229
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A
publication title Crystal structure of the superantigen staphylococcal enterotoxin type A.
pubmed rcsb
source organism Staphylococcus aureus
total genus 71
structure length 229
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1esfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1esfA02
1LTSD 1S5ED 1JCKB 2ICIA 2TSSA 1XXGA 1HXYD 4NZLB 3EA6A 1STEA 1ET9A 1FNWA 1T5XD 3R8BA 1FNVA 4Z9CB 1TS3A 1PZID 1CHQD 1S5BD 1PTOD 1FNUA 1V1PA 3GP7A 1JR0D 4TSSA 1EU4A 1S5CD 3BVZA 1BCPF 1SE2A 2AQ3B 1RDPD 1SJED 2QILA 4UDUC 1CT1D 5ELFA 2SEBD 1I4PA 4RFBA 1CK1A 1SE4A 2NTTA 2R61A 4O1NA 1TS5A 3BVGA 1PTOF 1PZKD 1UNSA 5FK9C 4DXFA 4C56C 1HA5A 1V1OA 4L63B 4RHRA 1M4VA 1SE3A 1D5XC 1LTAD 2RDHA 5ELCA 1LTTD 1SXTA 2Z8LA 1TY0A 1FGBD 1MD2D 1PRTD 1BCPB 1L0YB 1V1PB 1L0XB 1RCVD 1ENFA 4RGMA 1AW7A 2J4XA 4DXGA 1JWSD 4RGOS 5I4DA 1TS2A 1EEID 3CHBD 2AQ2B 4L6TB 4ZYSA 2XRQD 4RGTA 1TY2A 5D3DA 1LT4D 2NTSA 1B1ZA 1D5ZC 1DYQA 5ELEA 3OWEB 1PRTF 1PTOH 4RHSA 3DWAA 5D3IB 1EFID 3DWQA 1I4RA 1LTRD 4BWGB 1LT5D 2RDGA 1QILA 1G8ZD 1YN3A 1HQRD 3R2IA 4K6LA 2XN9C 4RCOA 1LT3D 1BCPC 3DWPA 3SEBA 3BVMA 5FKAC 1LLRD 1JWUD 1RD9D 2XRSD 1SBBB 1EEFD 1AN8A 1HTLD 1CQVA 1ESFA 1CHPD 1I4HA 1PTOC 3EFXD 1F77A 2O2LD 1BXTA 1YN5A 1KLUD 1PTOB 1I4QA 1TS4A 3URYA 4OHJA 1I4XA 1RF2D 1JQYD 3BYYB 1S5DD 4RH6A 1BCPD 1D5MC 3KLSX 1EWCA 3MC0B 1S5FD 1KTKA 5ELDA 5TSSA 3BZDB 2IJ0A 1D6EC 3R2TA 1PYWD 2XNAC 1XTCD 1LT6D 1I4GA 1LTID 2WV6D 3O13A 2CHBD 3BYTB 2IPKD 1LTBD 5ELBA 2AQ1B 1EU3A 1JWMD 1FD7D 3TSSA 1LO5D 3V05A 1YN4A 3W2DA 1LTGD 1SEBD 1GOZA 3MFGA 1PRTC 4RGNA 1B44D 1KLGD 2G9HD 2QEJC 1DJRD 1PRTB 1SJHD 1ET6A 1PZJD 1UUPA
chains in the Genus database with same CATH superfamily
1GVPA 1BUIC 3GTPH 1E8ZA 3M4OH 4LUOA 1SGHA 3WOEA 4C3JH 3RNGC 3GTMH 1AZPA 1WGDA 4KKUA 3DBHB 4LF6L 2JZPA 4B9WA 3OG5A 4DV5Q 4LFBL 4A93B 3CRKC 1P1AA 1JB7A 2PJHA 3VH3B 3EA6A 2NMQA 2KTRB 4A3IB 2ZCBA 3BZKA 4OVUA 3Q3JA 2E5LL 1EF1A 2QSDA 4WWPA 4A3EG 4ARIA 2MLBA 3S2AA 3DVGX 4M1UB 1IL2A 3RZOB 2L1AA 5D94A 3K0YA 2K6DB 3D6CA 2PQAA 3Q14C 3ZNGC 4KKTA 4OVVA 1WTOA 2HE7A 5M5XH 2R93H 1WF9A 1XCTL 3PGEA 2BS4B 2VH2A 2QDBA 2KEDA 5IE8A 3HOVB 2LY7A 1HNWL 2WXQA 3HUIA 4A93G 2WKCA 2XWBB 2KN4A 2FBWB 1D8LA 4A3IG 5IT9c 5KYIA 1Q5WB 4HROA 3MAQA 4EUTA 3ZJTA 2FHTA 3L0WB 4BY1H 2MJDA 3W5VB 1BCPB 3CW2C 1RODA 2W55A 2GBRA 2PZTA 4U673 4B0EA 3QHTA 3VA5A 4P1CC 4KY7A 4DXGA 3E6ZX 5L37A 2UUCL 4AJYB 2M0XA 3L17A 1UE7A 3ZXVA 5EE3A 3Q6SA 4AYBB 4IM0A 1U9RA 1MJCA 2BB5A 3JVZX 3HOVG 1IP9A 5ELEA 5C0XI 1LTLA 1YVCA 3ER0A 1XCQL 1FMAD 2GOWA 2M4NA 1R4QB 4LNNA 5D3IB 1FPYA 2FFKB 3GB1A 4LNFA 1YI2A 2WXFA 2K22A 4WAAA 2N88A 3JSVB 1U4PA 4RCOA 1CMXB 2R7ZG 4ZQ3A 2UXBQ 2C60A 4BA1I 4A3DB 3PUVA 3H0GB 4QGUA 1LLRD 3QG1A 3QWNA 1GHKA 5K5PA 4PYZA 2LXKA 5C4JH 3P42A 5BMIA 2WYQA 1C4AA 2K5DA 3R7RA 1J5EQ 2EY6A 5IP7H 1KFYB 3EFXD 1L1OC 1SSOA 5BN5A 4R1JA 2KFKB 1D1IA 3K59A 1I4QA 2UU7A 3FRPB 4JI8Q 3KLSX 3GE8C 2WIIB 2INNE 3AB5A 2NYZD 3ULJA 2C5CA 5TSSA 3CCMA 4FXCA 2N7JA 1UBIA 2IX1A 4CYEA 4A3DG 4A3JB 2LVPA 1PYWD 2XNAC 1XTCD 3H0GG 1FM0D 1N34Q 4JI6L 4KHPQ 3GO5A 1ICWA 4RM8A 1HUMA 2E2IH 1FXAA 1NI3A 4HJ7A 1JC7A 1XO3A 4OZBA 4OO1G 4YWMA 1EYAA 1JW9D 3HZXA 3KBXA 1ISNA 1TWAH 4ZUJA 4LFAQ 1FRRA 2KQSA 3PV1A 1VQKA 1IBXA 1WH3A 2HHHQ 3DHIC 4F8CB 5BMGA 1VQEA 2KK8A 4KN4C 1B44D 1KLGD 2M8SA 5AZGA 3ZW3A 4LNOA 2BWES 2B2VA 3VYRA 4CO7A 1ZGUB 2B8FA 1PZJD 2EJFC 3I90A 1R4MI 1CQFA 5FR6A 1XXGA 1CZPA 1TT2A 5IWAL 1XMOQ 1HR0Q 2UU9Q 1F9JA 3D8GA 3KYHC 1K83B 1WYWB 1TKYA 4CKCA 1TS3A 1CHQD 1S5BD 4ANXA 1FNUA 2CCZA 3W9CB 1H9SB 3W3AA 3IBEA 2BE5D 2KO3A 3NENA 3APFA 2IL8A 3RNFC 4G7ZC 4EQ5A 4H44C 4MSQB 5IKCM 4YTPB 2OTLA 1B3QA 1MIUA 1TWFB 2SEBD 1EY6A 1EO6A 3RI7C 3RNAC 3P7JA 1YZ6A 5E7NA 5C44H 4DR2Q 4NQKE 4C4VA 3ZGZA 2JEAI 2KT7A 5JVH3 4KN7C 3KYDD 5FK9C 4DXFA 4PMBA 3ND9A 5M5YH 1ILPA 1QVFA 1N5XA 1J7AA 1TKWB 3C1EA 1SXTA 3B0AA 3UI3A 2QHOA 3HOYB 1V80A 1OXSC 4WQOB 2C7HA 1T3QA 5IA7A 2EIFA 2ZT9C 2ZVOA 1EY9A 2FCSA 1VQOA 2PQAB 1DXMA 1I6HB 1KJTA 2KQ7A 3R3OA 1TS2A 4LF9L 4DAYA 4J15A 5CC4A 3Q22A 4KHVA 5G2NA 1O7ZA 4XTCS 1RRBA 4C1NK 3M63B 1I50B 1YNTE 2GBJA 3W5UB 1VQ9A 3UQBA 1PH6A 1M1KC 4NXNL 1GNUA 2KECA 2Y0SE 3H09A 3PSEB 1PHJA 1GUWA 4NMZA 2R6GA 1E3PA 3RZDB 4EQPA 3PZ8A 4N59A 3RNEC 4BWGB 1YJNA 4MGYE 3HOYG 1J19A 3LYYA 3F8TA 3TREA 1NJIC 2D10A 4LF4L 1Y8NB 2X69A 2A6HC 4DNIA 2RDBC 4MEMA 4NKLA 3K9PB 1A62A 2K5PA 1KL9A 1ZYRD 1NYRA 1QQRA 3BINA 1EEFD 2DUDA 3NWTA 1A6XA 2B3AA 3PT2B 3GTKB 3IXSA 3L16A 3X3MA 1WE6A 3N20C 4DA2A 4X64Q 4W9IA 2J0TD 5IGEA 5MPOA 4BBNF 4A3CH 2RSOA 2KXJA 4P2CB 1GC7A 5T8IA 3WAOA 1Z5SB 3RUIB 3X0WA 4A3KG 4W9LA 1A3VA 1KTKA 4GN1A 3S2HH 3DMUA 4LNIA 2I2YA 2JA5B 2N7EA 3RUZA 3CCQA 4NY0A 1H9RA 1JE5A 2NVQH 2JY6A 3H7SA 2F0OA 1S3OA 2K8HA 1E7ZA 2EE1A 5IYDG 3BG3A 4ZLTF 5JOBA 1WGHA 4CDFC 2XBBC 3PS6A 4EZKA 2AWNA 4WRDA 4GDLB 3ZRCA 1RWSA 3KUPA 5EQ0A 5EJWA 1VDVA 3F2CA 3PVLA 1XWEA 2SAKA 4ZKCB 4J6HA 4QIWE 5FLXc 4XX5A 1S1QB 2ZVNA 2G9HD 4I7ZC 3Q3MC 4I6NB 3K5LA 3VUYA 1F2YA 3I4MG 2B2UC 2E75C 2QA4A 3PO2B 4UPAA 2KTFA 1WTRA 3CIRB 3RYTA 3PRZA 1C9FA 1H8CA 3TN2A 2I07B 3H1UA 1ZW7A 2WXIA 1WGGA 4K7SA 4A3FB 2C7MB 2JQRB 3AEEB 1WD0A 2A6EC 2K50A 2PQEA 5I6YA 2Z6BA 4BY7H 2N9EB 3EJIA 4KIKA 2V1YA 4BBRH 2GB1A 1BQQT 4LTUA 1TVXA 4IFDH 2R2OA 3D32A 4DV5L 1SNPA 2NBVB 4IM2A 1RLFA 5C3XA 2GRIA 1CUKA 1N32Q 3VYUA 3E56A 2EYFA 1QWYA 2PPHA 1SE2A 3FAHA 4R4OA 3MC9A 2JA6H 4GKKQ 4DBGA 5AUKA 3PO2G 4UDUC 3UDIA 5KIXA 3U50C 2N3SA 1PH7A 1P98A 2EXDA 2NTTA 3T56B 1TKGA 3STBD 2RQXA 3D4DA 1MI0A 2CQAA 2G1EA 3VTVA 4A3FG 1JQ4A 2PPBC 4C00A 5KRUA 1HA5A 4C2MB 1Z47A 1WTQA 4KKJA 1NBFC 2RDHA 5ELCA 3J80i 4DR6Q 3HHMA 4PK1A 3MVVA 2IX3A 1FO4A 1MD2D 4EQOA 5CYUA 3S14H 3OHXC 2KHJA 3Q24A 3UF8A 2VL6A 1LV9A 4K14A 5DPTA 2HIXA 2NBFA 3C3LA 1MI2A 5ELNA 1UH6A 3LWEA 1WVLA 1KH0A 5AZHA 1YBYA 1J0GA 2LXAA 2Z6KC 4JI0Q 1VS0A 3KBGA 3Q8BA 4C3HB 5IP9H 4L5RC 4LFCQ 4GNXC 3AEVA 3WALA 4DKAC 2MRPA 3DWQA 1I4RA 4R4IA 3DEPA 3SD5A 5JJIA 4F7ZA 4Y7NH 3P1MA 4UP9A 4JI1Q 1R4MB 4US9A 2JP1A 1BCPC 1DGJA 2BYVE 3NY5A 4CQNA 3VYTA 1CSQA 2MBEA 3PRPB 1CA5A 1JWUD 4GN3B 3CC4A 1HZAA 1V1QA 1FFUA 2WAQE 1VLBA 5LMNQ 2UXBL 1T9HA 3TZUA 4DAYB 1EZ8A 1I4HA 3U9OA 1ZDXA 4XE0A 1KLUD 1MJDA 1TS4A 4BA2I 1PH9A 2HTHA 1J5EL 1EYGA 3NUCA 1E5WA 2DY8A 3MC0B 4R9WA 2L05A 1SB3C 2ZM6Q 2ZPYA 4EEWA 2NVXB 2RCFA 1S3SG 1E0ZA 3PUZA 2Q2HA 3BJUA 2LHDA 3R2TA 1MHWC 4JI8L 1MHHE 4CJ2C 3ONAB 2DHZA 3I2ZA 1LTID 2B63H 1T0RC 1B70B 3Q2AC 3MXNA 1F9RA 4XYOA 1E8XA 4H7BA 1EU3A 1AARA 1N34L 1F1HA 4KHPL 2H5XA 2LRWA 2D3AA 3KUZA 4V0BA 1A2TA 1WFQA 2WB1E 3B2FA 4MH8A 2EYJA 5LNK1 1FL0A 1PRTC 3MFGA 4OELB 5G3LD 1EQQA 1KD1C 1MJEA 3PZ7A 1CTMA 4MELA 2MWSB 4GN4B 1JWBD 4LFAL 3AM9A 2YTVA 4ZDVA 2HHHL 3J81j 4W9FA 1XPUA 2N49A 3GOEA 1S5ED 2HD3A 3E9SA 2K8CA 2CH4A 1FJGQ 1SNQA 3RN5A 1CA6A 1V43A 2BQQA 4ZK9B 2WGSA 1D1KA 5C5MA 1KXLA 3TL5A 3BDCA 2CWPA 4YWGG 2N0SB 1YHAA 1N5WA 3J9CA 1PFBA 4N6EB 4DV1Q 1XX8A 3H3VC 2JWUA 3P2BA 4HCEA 1XMOL 1HR0L 2INDC 1G51A 3PHWB 1S5CD 2B2WC 3BU2A 4QJFA 4IALA 4FF2A 2QIEB 5L95C 5AJ3Q 3ULLA 2EKEC 3VR6A 1SE4A 4JOIC 2KJHB 4RKBA 3NZ3A 1CZWA 1LM0A 3ND8A 3K8AA 3S1QH 5AUIA 2D2CC 4L5TA 4RCNA 2HJ1A 1FR3A 2N4FA 4DV0Q 4W9EA 1V1OA 1WD1A 4RMFA 1ML0D 3K7AH 3AU7A 5GADC 1CKOA 3E3XA 4DR2L 2OCEA 2NVYH 2G4SA 4AP4C 1LTTD 2Z8LA 2RBMA 3PF5A 3MFYA 4ALPA 3DVGY 2ZJRA 4A3BH 3KYCD 1L0YB 2LFIA 3DXJC 1Y1WH 1WCMG 2XTIA 4LJOB 4MDKE 3U9SA 2RR9A 3Q8DA 2BH8A 5GMVA 2IO2B 3T13A 4FXDA 1T6BX 3UI2A 3NE5B 1S40A 3Q8AA 1II3A 1HNWQ 4P1BC 1Y1VB 2L0CA 5HHDG 4EE2A 1IBMQ 3A5ZB 4YY3Q 3N6RA 4IO9A 3S16B 2HCIA 3GTQH 1U0LA 1OGWA 2WXMA 4AUQC 2FXQA 4L23A 1EFID 1ASYA 3PUYA 2ACZB 3I5JC 1NMGA 2Z59B 4MSMB 2LASA 2DWQA 2V0GA 3DEOA 4GKJQ 4ODGA 1YX5B 4KV6A 1YJIA 2A74C 5HGQA 4Y52H 5GQOA 3ZUNA 3SEBA 2G5DA 4KI0A 1L6UA 2EYMA 2J0MA 4LJZC 4WORA 4BBSG 1D7QA 4PZ6A 3LJ3A 3PIO3 2KYWA 2F0UA 2MHJA 1CQVA 4ZRIA 1RM6C 4IJLA 1CHPD 5C4ZA 2VY3A 1ZOYB 5D7GA 2VQEQ 2MA9B 2NVTH 2WXOA 1C4QA 3T4AC 1VQNA 1GM5A 2YU9H 2L1BA 2NZOA 3BZCA 1N36Q 2BBCA 4L2YA 3TMPB 2F0KA 4RH6A 3GTLB 2NPTA 4X64L 4A3GH 1SMYC 2VQFQ 2V3NA 2LI5A 4KD4A 2WU5B 4QL5A 5KEEA 5J22A 1JOKA 2BCOA 1MPEA 4GB9A 3GTOB 4OL7A 4J1MA 3N32A 2B2TA 3EN2A 4C80A 2UUBQ 4ID6A 2ID0A 2IPKD 3U7DA 3RLNA 3AE6B 3P4RB 1U4LA 4RA8A 2UXDQ 2KX0A 4I6LB 1A63A 4HJAA 1DOMA 5C23A 2D3GA 4PMWA 3D0FA 1Y8PB 3N1XC 3HKSA 5D65A 3LWUA 1C9OA 1F52A 2QDFA 2FINB 2VZKD 4HSPA 3NBHA 1WI5A 1SRUA 2SDFA 2ICIA 3J7ZC 4ME5A 3M62B 4KGSA 1YMHE 3KVFB 4II2B 4QB4A 1GO3E 2FIFA 4C7ZA 4M8AA 5G3LF 4PZ7A 3R8BA 2GMIC 1PZID 1P8LA 2RPVA 4HJ8A 3IHPC 3MXNB 4AH6A 1XLQA 5IGGA 2K25A 1PGAA 4NPNA 3AE4B 3HK0A 5IN7A 4DDGD 2OQKA 1QG7A 2K5NA 2WINB 3SR1A 2JXTA 2KJRA 2KMCA 3QARA 5EE1A 1EWYC 3ETRA 4RFBA 1N32L 3M4YA 4EX5A 4GKKL 3VYSA 2A8VA 5EKKA 2IGHA 3DVNV 1TR5A 1YNJC 3ZNHB 3DHHC 2IT1A 4GLXA 2CW0C 3PO3H 4HJKA 2JA8B 1PMRA 2G3QB 1SYFA 1C4PA 4YWLA 5EPJA 3UGBB 1FXTB 1AWDA 1JICA 3DHQA 1X56A 4QUCA 3H7PA 4JW0A 3MP9A 4XC2A 2NN6H 2PMZB 3CQZH 4DR6L 1Z9FA 2CJNA 3Q3OC 3EQLC 3CHBD 2N7DA 3FHWA 4B3RL 3IFTA 4QQBX 1N62A 5LXHA 4ZUIA 3U52E 3DBRI 2B2VC 4HKQA 1TY2A 2MJ8A 1A3UA 1Q46A 4I65A 4FO2A 4H13C 5D3DA 1LT4D 2K05A 1OFFA 2JT4B 2F0EA 2RDFA 4LJPB 3HOWH 2SOBA 3HOZB 1SE9A 1V2YA 4JC0A 3B6YA 5C0XJ 2Q2IA 1C8CA 1TWCH 1BF4A 4FJVB 4JI0L 2K4KA 2DGYA 4CKEA 2VB2X 4M8NA 3H8HA 4LFCL 1JALA 3HEJA 4G4KA 2VS1A 4OWTB 1N8RC 3TEZA 1Q0WB 3I63C 3GQBA 3H91A 2KDIA 2E74C 4ZYNA 2K01A 2CHXA 2FUG1 1R9TH 1QUQA 3T1HQ 2M19A 4JI1L 3I9V1 5AZFA 4DK3C 1F2MA 4LAAA 3LGJA 1N33Q 1E24A 2ZCCA 4C3IB 4UY8C 4P71A 1PV4A 4KSKC 1PTOC 1KRHA 1WX9A 3NPPA 2KZRA 3UINB 3AEFB 5E6PA 5LMNL 4N9F4 3NSWA 4WJWA 1GUAB 1JQYD 3AU4A 5HURA 2AX5A 2HDMA 2PYKA 1UWMA 5FLMH 2K3UA 5HKHA 3CKIB 1S5FD 1AP0A 3U7ZA 3DUZA 3VR3A 1GPXA 3N3KB 2KACA 2DJGC 2QCPX 3G48A 4V190 5J18A 2CFMA 4PV1C 4MT5A 1A3TA 2ZM6L 2F0JA 1H9JA 2EYPA 3VR8B 4GLVB 3GD7A 4C3IG 3CXCA 2E2DC 3KUCB 1PFSA 5C4XB 1TBEA 4JE3B 2KWDA 2AL6A 3O65B 1GAQB 2UWQA 5T1GA 1DONA 5C3EB 1VQGA 2QEXA 1EOTA 1EWIA 4LF8Q 3M4OB 2CKHB 4C3JB 1BBWA 1QJOA 4HCSA 3GTMB 4CHKA 1VQ7A 1DOIA 5EGTA 2PTLA 1FXIA 5D14A 4AJWA 2PNHA 1VQDA 5IYCH 2Q8TA 2DLBA 1VQIA 1Y56A 4M0WB 3EUB2 1MHXA 1O7YA 5HY6A 2AWOA 1W2BA 3ABVB 1FJGL 3DQVA 4RWSC 1W6KA 3GP7A 1XT9B 3VVWB 4K2LA 1IGDA 2F0SA 3IVFA 1VQAA 5M5XB 3FP9A 2R93B 3VFKA 5C3EG 4DV1L 5CGKA 3Q0AA 2DAJA 3L4PA 4C3JG 1O7IA 4DN4M 1JOQA 3HG9A 3PIOA 1H95A 3EGRA 2K75A 2R61A 4O1NA 2LVQA 1IW7C 1EY5A 5M3FH 1PA6A 4DR1Q 3C1FA 3NBHB 3DVNU 1BR9A 2IHFA 4K5VA 5AJ3L 4BY1B 1V6EA 4P74A 4E6IA 4L63B 3M4PA 1PYBA 3PHXB 5CV5A 1V86A 2MGSA 4A9AA 4H2AA 4PYUA 4JI3Q 5C6AA 4S3SA 4QAYA 3QOJA 5E3FA 4DV0L 2K5QA 3S17H 1Q10A 1WSPA 4IWPA 4ANWA 3ZTDA 5JXVA 1XEEA 2IDYA 1MSHA 2J4XA 2OEOA 5JEAJ 2WP8J 5I4DA 3KF6A 2LGXA 1GC6A 3ZVVA 4OONA 3MZ5A 4ZYSA 1FGUA 2HIVA 4M00A 3JAMc 4HIOA 4BXXH 2NZHA 3F2DA 3D31A 3VA7A 3S1RH 4IFDI 1OXTA 1K53A 5G55A 1X65A 1VR9A 3Q6BA 2PW7A 1V8QA 3D4WA 1UD7A 1SYBA 2VUMH 3JAME 3QA8A 3UIOB 2NZ1D 4XYCA 3AE2B 5M3MH 4G50A 1IBML 2L83A 1Q8KA 3WOFA 4YY3L 1XMQQ 1QT9A 5IYBH 4GNXB 1VQ4A 1C48A 2K7VA 1QILA 1G6ZA 3AE7B 3TP7A 1LT3D 4BZAA 5FKAC 3H7PB 5IT9E 5EE0A 1Q90A 3PSIA 3WCQA 3PCOB 4DF7A 4GKJL 1G6JA 3U2SC 5CX3A 1VJKA 2F0PA 1UWVA 1VZ8A 1NAPA 5IGCA 2FIDA 3KQ4A 2GVAA 1KM7A 4YT0B 1HZBA 5LMNW 3VDYA 5BYRA 1X32A 2ZPNA 4F8MA 4A3EH 4ASWC 2O2LD 2WX1A 4DAPA 3MHSD 2L52A 1X3PA 1JJ2A 3I70A 2F03A 1C76A 2J52A 2WXRA 2VH1A 3AFPA 2L32A 1AE3A 2EDGA 2VQEL 3UDXA 2LMCA 4MGZE 2LSSA 1DOXA 2E3TA 3L7ZC 2E2IB 2K6AA 1N36L 2WXLA 2WP9B 2OF1A 4RG1A 4WIPA 4G57A 3T16A 5J1ZA 2VQFL 2ALYB 4A93H 2JQOA 1SF0A 1TWAB 3KDFA 3CCSA 3MJ5A 5C3JB 5J2RA 4A3IH 2PKOA 2CHBD 2PCFB 2PE9A 2EMSA 4PG3A 2IY5B 1VRAB 3W2DA 4AYBG 3VR2A 4BKGA 4YIJA 2UUBL 2G4DB 2Z0DB 1FD6A 1G6PA 2KHIA 2LVOA 4XT1B 3PMFA 3TZDA 5DAUA 1PRTB 3R3MA 4OWXB 2CS4A 1VMPA 2UXDL 2DBYA 3MXGA 5LMUQ 2ZZPB 1ZXHA 2KAJA 1I5FA 3QOLA 2M0AA 3RLFA 2K5HA 2O5JC 1ZUD2 2MBBB 1ENAA 4WJ4A 2B76B 1E2ZA 3EBEA 1FNWA 1X55A 5KGUA 4IUVA 3WWVA 3T1YQ 4A3MH 1JT8A 3DBLB 4J6IA 4H0LC 4TKNA 1EQRA 1V1PA 4R3DA 1TXYA 2JA7B 3B9JA 3GE3C 4HMIA 2R7ZH 5LL6S 4HVBA 2RMMA 1STAA 5C44B 2AUJD 2KVMA 2DZKA 4IWQA 2QKIC 2FCQA 2MNAA 3JW0X 2A6ED 4DR3Q 4FHKA 2MQHA 5M5YB 2AYOB 3GTJH 3IL8A 1HTQA 5DLQE 3J7AV 1WOCA 4A3JG 1WJNA 3UIPB 2F4IA 1ROEA 3TEXA 5BYSA 3CMEA 3J7AF 3ZTCA 1BOSA 4WWNA 2EJMA 2B2YA 2JA7G 2J0KA 3PIPA 3OW2A 5JH5C 1M8AA 3DWGC 2F0DA 5C44G 4LCDE 1I3QB 2IWHA 3FVQA 2DAFA 1LFDA 3RNCC 5JHBA 3DM1A 2MUYA 4OO1H 1E2WA 2MFIA 2YYZA 4XQQA 1T0SC 5ELOA 3RNUA 1B7YB 1F2RI 3OMGA 2LGYA 2Q5WD 1KNEA 3NTKA 2NTSA 1O80A 2MP2A 2K1BA 4IPHA 1PH2A 2OWOA 4OW0A 3OWEB 3M85A 2BF8B 1PVOA 3QAQA 4ICVA 3SDLC 1U4MA 2QDLA 1F0ZA 3OIQA 2IO3B 4B0MA 4GMVA 1OQYA 1GG3A 4KY6A 3AEAB 1OXXK 1LACA 4GXBA 2RDGA 1TZOA 5BN4A 1NSNS 3AE1B 4JPSA 1GJZA 4QF4A 5JVG3 1R7SA 1QOGA 1A70A 3Q23A 3HM3A 1AYFA 3A55A 1VQFA 4A3OA 1O78A 5C4HA 1TKEA 2H89B 1HTLD 2KHWB 4ZRKA 3V6CB 1YJ1A 4POGA 2LRUA 5IO9A 2K03A 5GXGB 3T1HL 1YQBA 3IAM1 2CHWA 3URYA 2WXPA 2YVCA 2KVZA 3WIMA 3ZNZB 1N33L 2C5LC 3S2HB 1T0QC 1QZGA 4DAMA 3JAML 1BCPD 2VRRB 3ML8A 4NJCA 2N1WA 1DOKA 2NVQB 4FA6A 2JU6X 4HIKA 1BKBA 1YJWA 2WDVB 2Q8RE 1KHIA 2F3IA 4JWSC 3PLVA 3H6NA 3S2DH 3G4SA 2D07B 3OMCA 3O13A 5IT9L 1SAPA 1FIQA 4OZCA 4FXGC 1DGSA 1K83H 4IOAA 3M9BA 1LTBD 3IT6B 4FN2A 4O2DA 3V96A 4B95A 1E7VA 1GXDC 1P0RA 1SR3A 3KJOA 1Q82C 4JI7Q 4NPSA 2SNSA 3UQAA 1EM7A 1E10A 2LEKA 4X65Q 1GUOA 4JGHB 3QB3A 4XQJA 1PH8A 5K36G 4TMAB 2LMCB 4N8FA 4BY7B 1EL0A 1DOLA 3OPOA 4LF8L 4BBRB 1TIFA 2DNEA 4QCLA 1PH1A 4B6WA 2LUMA 4DHJD 2F0VA 1X9NA 1PFDA 2JYTA 1STEA 2N9XA 2GLSA 2Y5BB 3KWLA 4TQ1A 1E1TA 3RCZA 3KDFB 1FCLA 4FLHA 4P7IA 4BKSA 2JA6B 2EOTA 4DK6C 1X6OA 3HOYH 1JR0D 1EU4A 2EY1A 4BBNC 3ENEA 1RDPD 1YD8U 3M7NA 2M00A 4CJ1B 2N8NA 4BAXA 3P4PB 4XZ4A 4FNFA 2ICEC 3C0RB 1CK1A 1IZ6A 1JJCB 3NVWA 1PH5A 3TIXA 3BVGA 5HFYA 1TT5B 5FLXE 2DY7A 4DQOC 3M3YB 2JA5G 2RPQA 1F2LA 3HOUH 5IOCA 1N9WA 3AECB 2AKWB 3P1HA 4RHRA 4MHEA 3HOXH 1E7PB 2KOLA 1A8VA 2DNCA 3S14B 3FDTA 1Y14B 4DR1L 2B2TC 2LWPA 2K14A 2KUMA 4A3KH 4Q0FA 1P7EA 1KF6B 1V1PB 3MJWA 4HR7B 2A69D 5DPWA 2DENB 1XYIA 3GTGH 2K1FA 1AW7A 4PZ8A 4JI3L 3S1NH 1V49A 1YX6B 1E8YA 3ULPA 4DR5Q 4IM3A 1IBXB 3I4OA 3N1ZC 4AQ7A 2R92H 5IYDH 2KMAA 2PMVA 5CTRC 4LLGM 3RN2A 2EKIA 1SYDA 2F0FA 2W9NA 2DNFA 2MQJA 4B08A 3X23A 1NE3A 2RF4A 3VR4A 2M1MA 4I6PA 1MFWA 3V3XA 4Y7NB 1PDXA 2ASQA 4HDQA 5C0XG 3I4MH 1GUSA 1UE1A 4KY5A 1YN3A 1P7FA 4B3MQ 4IOIE 4A3PA 3NOBA 1RHPA 3ZDMC 1TU2B 4O42A 5I6WA 1XMQL 2WNMA 2D2QA 4GDKA 3CCRA 4FF4A 4B3RQ 2RCNA 2L12A 1CJEA 2IHEA 3ECIA 3KLRA 3VXWA 2ZJPA 1YHQA 4JX1C 3MWYW 1VCIA 4PS7A 4CHTB 3B2GA 1C77A 4ACFA 4EGVA 2WACA 5FJ8G 1PH3A 3E9HA 1JRUA 2IZVB 1PTOB 1UE6A 3J80c 2BE5C 2MP2B 3SFDB 4C7YA 1I4XA 2O2VA 1TGZB 3U4EG 4C4VB 2JZ3B 1F9SA 2NN6I 4RF0A 3J80E 3PO2H 1JJGA 1L4DB 1X3FA 1BBUA 2XWJB 4HPPA 3BZDB 2B63B 2E2JB 2A68D 1D6EC 4A3FH 2PVOD 3F2BA 1LT6D 4UP8A 5BO4B 3NQIA 3KFUA 1WJ6A 2LGSA 4A3LG 1WGKA 2X38A 1L0WA 4REZA 1C78A 2AQ1B 5CMDA 5M5WB 4MNOA 1SIJA 4ULLA 4ME3A 1UZXB 1WX7A 2JF5A 1SE8A 2NVUI 3HVDA 3KK7A 1MGSA 2EXZA 1KLVA 2I46A 4YL8A 2QEJC 4KTAA 1IGCA 3A9KA 1DJRD 4XQNA 2MO1A 1ZXIA 5C1ZA 1SJHD 4GLAC 2EY2A 3BK2A 4JV5Q 1Z2MA 3N9YC 4C3HG 4KGRA 3L10B 3SDZA 4RKLA 2BDOA 3PGZA 3TS2A 4NQLB 2J7QB 1C1YB 3K81C 4X57B 3WAPA 1IL8A 1EF5A 2I1KA 2KD0A 2K5VA 2L55A 5GAEC 1QNUA 5LMUL 4HCPB 2LHEA 4NZLB 3ZIMA 4F1SA 2RKSA 3HVZA 3BDLA 3TP6A 2WFWA 3MTSA 3CMAA 4L5SA 2WU2B 1RYJA 5I2YA 2KQ4X 3T1YL 2BB6A 1L2NA 1FEHA 3NHEB 2YEPF 2BTEA 3S1QB 4GU2A 1AZQA 1L0VB 5ELFA 3ZNID 3KW5B 1ZYRC 3NTIA 5JAVA 4K2KA 1NCVA 4XIGS 5EAYA 4A4IA 1WE7A 1Q12A 4KDLB 1L4ZB 2PIAA 4DR3L 4O0AA 4WWOA 4E71A 1TWHB 3NVZA 1GKHA 3KLSA 1W3SA 3DM3A 3N52A 1Y1WB 2OT2A 1IUEA 2L0FA 3DCGA 1TY0A 4HEDA 4FYDA 1B8AA 3VR9B 4BS9A 1RL2A 1EY7A 1WM3A 5I2XA 1K51A 4RGMA 1J7CA 4JCVE 4POFA 1JWSD 3PZDA 1MVKA 2K32A 3QO2A 1QLBB 2WXNA 5JEAG 4HK2A 2CW0D 3CC7A 1KNAA 1NEKB 3NXWA 3JYUA 1QNKA 2OXPA 1N61A 1EIFA 3D3RA 3ERSX 3FKIB 1SYEA 3CD6A 4ZCKA 3SR6A 5E6OA 4XDDA 4B9KA 5FLXL 1B9MA 4JBWA 4FP5D 4OEMB 3AE3B 5IAAC 2MBQA 1LTRD 3H15A 1AFPA 1YNND 5D2MB 5CV8A 4KIKB 3Q3NC 2XN9C 3F2UA 2NVXH 1GUGA 1YQ4B 2BW2A 3OTOQ 1N63A 1Q7YC 4URKA 1EY4A 2A19A 3BIID 4PS8A 2XRSD 3EFUA 1IYJB 2NVTB 4NAWA 1JB3A 2YU9B 3CCLA 1N6ZA 3FKIG 2UXCQ 1SFOB 4A3GB 2KJ6A 2EELA 4L8JA 2XGTA 4MACA 1RF2D 2PMZE 4GS3A 3HM6X 1HJPA 5GAGC 2KNBA 4LDTB 3MA2B 3NVVA 1VQPA 3IFDA 1Q81C 1BNZA 2BS2B 3STBC 5BR8Q 3CPWA 3I4NB 2C35B 2K9XA 3VRAB 4XYQA 5HI1A 2I38A 3G6JB 4HJGE 4IJHA 4WFN3 4ZRQA 1SLJA 2EJGC 1UWXA 4GDKB 1PH4A 4IG7B 1IYFA 4WJPA 3DBLI 2ZJDA 2LXCA 5BN3A 4Q5VA 1OTCA 3TSSA 4A90A 1NMFA 1TWGH 2R7FA 1LTGD 1LGRA 1Y1VG 5M9OA 3EFCA 3FILA 2PO4A 2DZMA 2INPE 1WCMH 3V62A 1CI3M 4LF5Q 1K28A 4NP5A 2O2VB 4JLCA 2F3WA 2D62A 4JI7L 1QE6A 4HMJA 4EFOA 4FBJB 2KLGA 4LW1A 2YTXA 4PMCA 3J81i 2V4LA 3FPPA 3TS0A 3J80L 2L7RA 3I4NG 4XXEA 2DZIA 2KOXA 2WAQB 2BYTA 4EZJA 5FO7B 4X65L 1WXAA 2OQ0A 1HXYD 3DHGC 2PE6B 1KIXA 3ZJUA 1STHA 1GUTA 3A74A 1A2UA 1FNVA 3CAMA 2EVBA 4EVOA 1EYCA 3A1QA 2CWAA 1J7BA 4TV3A 5KHQA 1XNRQ 5I9OA 1VQJA 1WTHA 3ITPA 3G6EA 2LD9A 3NZSA 1GJXA 4KX6B 1HZ9A 4OX9Q 1ZE3D 1EIYB 3A9KB 4ILWA 4MN3A 4MTKA 4BBSH 3CCVA 2Q2TA 1XLOA 3KH0A 4IUTA 4IC7B 1JMCA 4KK7A 4FF3A 3IRBA 3PQIA 4WQMA 3NTHA 3D6WA 2L9HA 1M4VA 3CP0A 1DD2A 1LTAD 2W3RA 1V9PA 3A0JA 3U4VA 1K3RA 3CQZB 4PS3A 1VDZA 3TJPA 1HR0W 3CPFA 5EDSA 5EBCA 2CQOA 4RAUC 1PFMA 2H88B 1OXVA 4NW2A 4G0NB 5JJKA 4DUZQ 1QOFA 5H92C 1WJUA 5TR5A 2MBHA 4W9GA 2XIWA 3TEHB 3HOWB 2FCNA 2OHFA 2CU3A 4HCNB 1CKMA 5LLIA 2KDFB 1TWCB 1B1ZA 1D5ZC 4DR5L 2K8BA 4DHZB 1WGRA 2D11A 1IHZA 4IFDJ 3E9IA 1UGJA 2GBKA 1DOYA 2XK5A 1Q86C 2DYOA 3X3NA 3B1LX 1ZEQX 3K6OA 2F1MA 3E0EA 4LUVA 5H1SE 5FO8B 3NK9A 4HIDA 5JJLA 1WM2A 2ZTDA 1V8CA 3OLMD 3NJTA 1GB4A 3UE1A 3GS2A 1EFWA 1X54A 2ES2A 2N9PC 3TQYA 4B3ML 2GBNA 1D4BA 1SBBB 1IKLA 3PUXA 2PI2E 4LNQA 4M02A 4LWCA 4MJSA 2BVCA 1XJVA 3R7QA 1G291 2AHOB 3OW7A 3AI5A 4FXKC 4GLSC 3P75A 3RMKC 2KWUB 1OO9B 2PZUA 2O6VD 4ZOHC 2A5HA 4FADA 1S5DD 1QF6A 2JA8G 2F0WA 3L08A 4CDCC 3AYHB 2BKFA 4OO1I 3RZFA 5LHY1 2HDLA 2B2YC 3OWFA 5T1IA 4ANUA 3A8IE 3JC66 4EQNA 3QC8B 3WAMA 4IUPA 2F0NA 3CC2A 1HZ5A 4HDOA 4NAWB 3M7GA 2IW3A 3V05A 1YN4A 2WDQB 3OJ3A 5FLMG 2LKVA 2RA4A 1G2TA 3ZQ4A 3KOJA 3I73A 2AMCB 2GN5A 4BFRA 3S1MH 4HAEA 1IBKQ 1TIID 4JK1C 1K52A 3OOCA 3EIVA 3HOZG 4IDIA 5GROA 3U4ZA 2V9HA 1XLPA 2N1VA 4WJOA 3T8MA 1LM8B 1Z7TA 4JV5L 1J9OA 4G7HC 3RPFC 2L15A 5IGFA 3DBSA 4AYBE 1QZHA 3TP5A 4IN3A 5FR3A 3KLWA 2KBNA 4DV7Q 1HTOA 2IY1B 2IX0A 1AH9A 2LZ6A 1QOHA 4DNTB 4K8JA 1E8WA 1TJEA 3Q69A 4OGQC 3MHBA 3I56A 1XF5L 4HKZE 1HTPA 1HNZQ 2F52A 3BVZA 4NJ6A 5IY0A 3QCAA 1RTNA 3FILB 5KNCA 2KDBA 4PNYA 1TQOA 5A35A 1ILQA 4CBVA 4K0KQ 1VF7A 3P4SB 3QX1A 4IPDA 4J8QA 3GTPB 4IW0A 2VZAA 4NXMQ 1L6VA 1WY8A 3DLLA 3HKZB 1HZ6A 4HIMA 1RIPA 2SNMA 2NPTB 1UNSA 3GV3A 1F2RC 4C56C 4ITKA 1WYDA 3S17B 1M94A 1U4RA 1PFNA 3A1QB 1KRSA 3T51B 1IKMA 2KN5A 3PLUA 1Q3LA 1RKNA 1MG4A 4YWKA 1WXVA 3HIZA 3U30A 3QQ8B 5C4XG 4DV4Q 1MG8A 3SFEB 4K81A 4ZRPA 5EE9A 3A7AB 5BYQA 4M01A 2CKZB 3S1RB 1ZDVA 1V81A 1ZKHA 2HD5B 2MCNB 2VUMB 1HPCA 2H1EA 2KJXA 4RGTA 3SXHA 3BS1A 2BT6A 1EUJA 2J42A 3HKZG 3PV0A 4C3IH 4K5XA 1E22A 4CDDC 4XWTA 4FVMA 3ZKJC 1DYQA 3T3OA 4NNJB 4RF1A 3KJPA 1EIHA 3LB8C 2KANA 1N60A 4YSZB 2EY5A 4XDXA 1WTPA 3I57A 4JI5Q 1NI2A 4K6LA 5DM73 2JXMB 1SNOA 3DOWA 3NEMA 3SK5A 2VNUD 3CU7A 2WXKA 4GOCA 3RD4A 3C46A 3I3TB 4A3EB 1QOAA 2RHQB 2R93G 2X6LA 3S24A 2QGQA 2VUMG 2I5MX 3OTOL 4RNAA 1ONLA 1EUVB 1Y8OB 1ZKOA 1C4CA 4W9KA 1F77A 3AULA 2L8JA 5KYLA 2F0HA 3BYYB 4BY1G 1J6QA 4F87A 5C3EH 1VQMA 2FMMA 4K8IA 3P4QB 2XK5B 2UXCL 4KGTA 4HSVA 1WI0A 2FE8A 2EMTA 2Y5PA 4L5QA 3JAMi 4DR4Q 1WZ3A 3PRMB 3M4QA 3ZJVA 2V3SA 2F0TA 1YJJA 2CH4W 3MXUA 2KENA 3T9LA 5C4JB 4DUYQ 1YOVB 2CHZA 1I4GA 4B3TQ 2BYFA 3WANA 5BR8L 5ELBA 2PW5A 3QIAA 3Q8FA 3FMCA 4MJSB 3IAYA 3S15H 1GD7A 1A15A 1GUNA 4RGNA 4DU9A 1CKNA 3BWUD 1W6JA 1JWAD 2PEAA 1HE8A 3TBLD 1L2FA 2FCMA 5KHOA 4X62Q 3N30A 1DCZA 1LTSD 3ZLZA 1S72A 1VZ6A 4LF5L 1SYCA 2A6HD 2E2HH 2JJQA 3NRZA 1M90C 2WS3B 4A3MB 4OZAA 5KNDA 1RFAA 2GI9A 3AMZA 4RMAA 2MJEA 4DWFA 2D3CA 2AEHA 1A0IA 1MKHA 1SMXA 5E6JA 3GV6A 4Z9CB 3Q8CA 5IP7G 3NS8A 2R7ZB 3VQIA 1E6EB 5E4WC 4A6QA 5DM63 4TSSA 1QUQB 3NG0A 4ZHOA 1RFKA 4W9HA 1JRPA 3S9WA 1XPRA 3TEYA 2M56B 1SROA 1SJED 1LYLA 1XNRL 3BY4B 2D5DA 1B4OA 3RZOH 1K8RB 2IO0B 2UUAQ 2RGFA 1K9MC 3GTJB 1I4PA 4YTMB 3MC8A 2I0QA 4B3SQ 3P63A 2JYOA 3ZDTA 4OX9L 2BS3B 3SK8A 4A3MG 1SIFA 3TEWA 2FMCA 2N55A 4DV2Q 1XQQA 4BVUC 3DBRB 2NWGA 3HOVH 2JK8A 5E4XA 1K8OA 4JWUC 2XEWA 3A8JE 2BWFA 4P6VF 4ZRZA 1STYA 1FGBD 2WXHA 4GOPA 1J8IA 2QJLA 1XTDA 2YEPB 4AQYQ 1E0BA 2M2LA 2Z9HA 3ICEA 3TRZA 3AE8B 4DHJB 4GDLA 4KZ0A 2MO0A 4BKTA 4RGOS 4AS1A 1PGXA 4U68A 1EEID 4IURA 1OEYA 3A4SC 3RN9C 3WDNA 4HJ5A 4F88A 2JSVX 1QOBA 1CFMA 5A2QE 3A33B 3L54A 1NYQA 3CSFA 4DUZL 1IBLQ 1PUTA 1VQ5A 5EBDA 1C79A 1NBWA 1E1OA 2A73B 3CSTA 2V4DA 3GDEA 2F0GA 2HUGA 2EYOA 3K80C 2W54A 4WJNA 1HNXQ 4KLKA 3R2IA 3ZXRA 2RSNA 1E2VA 2YTYA 1EOVA 3I91A 3CMMB 1YHBA 1V5TA 4WURA 5C3WA 2Q2UA 4YSXB 3AMUA 2X6GA 1PGBA 1KDCA 4A3DH 3FPUB 3H0GH 3OSOA 4YCUA 2OTJA 4YHHQ 3AXCA 1WRDB 1IYVA 1JMLA 2H4OA 1Y8RC 1VZ7A 2I5LX 2LGIA 4DV6Q 1IYUA 4MGIE 3APDA 3QJYA 1X3EA 3W1GA 3S2DB 2Q8IB 2AL3A 4JYAQ 2IJ0A 4GIVA 5E6NA 2HTME 2F0IA 3R93A 4A75A 3AN1A 3NZUA 3U8ZA 2LJ5A 1BDOA 3I3CA 3AE9B 5DEHA 2JZZA 1KAAA 4A3JH 4K7WA 4HPLB 2D9UA 2QCZA 2FUHB 4MIUA 1I7HA 1V5OA 4JI4Q 1C3TA 3KF6B 3HGBA 1UELA 2IBIB 3APCA 1SEBD 3H3VH 2K33A 4ABNA 3F1ZA 4IQZA 2JA7H 4IUUA 2QMTA 4N58A 3EHVA 1ESRA 1NR4A 2QF7A 1GHJA 1HEZE 3R66C 4IUQA 5EKLA 4IKGA 1R4NI 1ICFB 3L0OA 1IBKL 3NP8A 1Z6HA 2TSSA 5JPNC 3L9AX 3BDOA 5DCNA 4RM9A 1SDFA 2DN8A 1YITA 2LGDA 4GSWA 3IFWB 1NUCA 3FC4A 2F4VQ 2GBMA 4IWOA 4S17A 2WHIA 3UDFA 1BUVT 3HRDD 4DV7L 5CORA 4A3CG 1U5KA 1STBA 1QZEA 4A8XC 1CKNB 1H4RA 2KC2A 3OJ4B 4DPGA 2KDEB 1I3QH 2NS5A 1HNZL 1K50A 3ML9A 4K5WA 4UP7A 2O5IC 3HOUB 3W1SA 5F2DA 3IG3A 3HOXB 3ZO5B 2P5ZX 4OIJA 1LQBA 2DYMA 1TWFH 4K0KL 2Y3AA 4R8NA 3KUDB 3I8ZA 2KHSA 1KRTA 2ZXPA 1YIJA 3C8YA 4A3KB 4NXML 4LF7Q 3HRZC 1U4AA 3A9JA 1ASZA 1UEAB 4DGZA 1WWTA 3C2PA 3GTGB 1YQ3B 3MHZA 3S1NB 3TCAA 2IY0B 1PRTD 2F0MA 4P16A 3VTUA 4P73A 4LMQD 1KDBA 1RCVD 1WTWA 4FULA 3A7LA 2R92B 2WDTB 3C19A 1LUZA 3CF5A 1I94Q 4JIOU 1PLFA 2PLPA 5EPKA 2KFJA 4FJYA 2X8XX 3M3JA 1B53A 2JE6I 2Z4IA 3K5OA 2ATWA 3HOUG 4DV4L 4TKOB 3HOXG 1I6HH 3W5OA 2RVLA 4KV2A 4EOYA 3FEWX 4KD3A 2F3VA 4BY7G 4NB3A 3I4MB 2BGFA 4BBRG 1I50H 3A5UA 1TYGB 3PUWA 3CCUA 3DWAA 4IFDG 3CF6E 4ZRJA 4N8X1 4GN5A 2MHVA 1HQRD 5K36H 4OXPA 3RZDH 4GOPB 2KDMA 4I7AA 4W9CA 2R2QA 3IT4B 3DWPA 2JA6G 2R92G 1K8MA 2ZTEA 4WWMA 3V61A 4MGKE 5CV7A 4IPCA 4JBKA 2B29A 2F0QA 4JI5L 5DNFA 2V4IB 3QIJA 4UAIA 3Q8EA 2WX0A 3PTFC 2KCNA 3UDGA 4DFAA 2FAZA 1YJ9A 1UBQA 4E74A 1BXTA 1YN5A 5A2QL 4KKIA 4X66Q 4GGQA 4BOSC 2K04A 4OHJA 4A55A 1O7LA 3SGIA 3GTKH 1V97A 2MX2A 2KA7A 1WFYA 1RAXA 5ELDA 2WLBA 1GB1A 1STNA 4C1NI 5LXIB 1H9MA 3IKJA 1T5EA 4JPBW 1VQ8A 1UGMA 1IPGA 2O6VA 3AE5B 3A4RA 3ONSA 1EIGA 4QUFA 5CBEE 1ENCA 1EY0A 3L2PA 2JA5H 4DR4L 3AH7A 5JZEB 1B9RA 1QB5D 3BYTB 3HS0C 2OJRA 4QY7A 1B50A 2Z0EB 5D6JB 4YCVA 2KCMA 4DNRB 2E8GA 4DUYL 2BKRB 3ZYYX 4JI2Q 4B3TL 1GOZA 2LFNA 5IP9G 1SSNA 2K39A 4X6AH 4FF1A 3TBIB 2R3ZA 2NUCA 3DDCB 1PXUA 3NELA 3SU8X 3RR5A 2O4XA 4KVGB 3RZWC 3RULA 1UUPA 3L13A 1HCZA 2W82A 3AB9A 2ASBA 1JCKB 2BH2A 4JG2A 2ZXOA 4ARCA 3QJZA 2KEEA 4XDCA 4WJ3M 5G5HA 1K0RA 4OVZA 4X62L 1XD3B 1I6VC 3K9OB 5DPSA 4DDID 3M3YH 1TZ1A 4G11A 1WR6E 2KWVB 1F9PA 3K5NA 3SVMA 1XNQQ 4HLEA 4HEA1 2HQEA 3VDZA 1EWHA 5C0XH 2D5GA 4QMGA 4FJZA 3W1YA 5LL6X 2EZVA 4KDIC 2LXJA 2JVCA 2Y0SB 5I9PA 1BCPF 5J17A 2J0JA 3NBIA 2QILA 3AEGB 4TUUA 1SMYD 5CHVC 2B3GA 2KLCA 4DK1A 1KQSA 2MBOA 2NBWB 1VCBA 4G3XB 2L4NA 1L1OA 1UEBA 1WX8A 4HTHA 2ZNVB 1I42A 5L83A 3K58A 5FJ8H 2UUAL 2G9DA 2B63G 4B3SL 2MEKA 4JVZA 3SHQA 2ZJQA 1VF5C 1Q1OA 2BYEA 3CCEA 3PO0A 2GVBA 2IO1B 1NENB 1X1MA 4C2MH 3AQQA 1BO0A 1SNMA 4DV2L 1RTOA 2D3BA 2CJOA 4XT3B 2Y0SG 1JROA 2NR2A 4PQXA 2WQYB 3VRBB 3N1YC 2FJ2A 3KF8A 4OIKA 2EQSA 5CR3A 2E6XA 3I4LA 1FCCC 2ZXRA 4DV3Q 2AQ2B 5CV6A 1K3BC 4A3LH 3AEBB 4DR7Q 3QR8A 4AOFA 4YXDB 4AQYL 2XRQD 3U58A 1G91A 4KZCA 4D2KA 2GA4B 1VD2A 2OJWA 1A5RA 2V1CC 1FYCA 1RJTA 2ZTCA 1PRTF 4JBJA 1PTOH 3NWSA 5AEKB 3K7AB 3HFZB 2XVSA 3LX0A 3H94A 2NVYB 2KWCA 4NAMA 4P75A 4DAVA 5H8YE 5BMHA 4E3CA 3A8KE 2R7DA 1LT5D 4C3HH 1IBLL 4H02A 4A3BB 3A9JB 4Q2JA 1WGYA 3TUOA 4ZKBB 4QIWB 3RD2A 1YNXA 5FOBB 4KJNA 2Z0SA 3K57A 2E2JH 1KABA 1R4NB 3VUWA 4YCWA 2VZKB 1HNXL 4HPMB 2JEBI 2WWZA 5IOIA 2K5WA 4X3TA 4GZYC 3AV8A 2IGGA 4K1RB 2A4ZA 4EKUA 5M5WH 1YNJD 4J3OD 2N78A 5JPMC 1Y69U 4JBMA 3GTQB 2WKDA 4YHHL 5CHFA 4B9XA 1P16A 4A3BG 1BBXC 1WXQA 2HJ8A 4L1BA 2F0LA 1Y1WG 1YEZA 2TMPA 4KHZA 2PW9A 2G45B 2N9KA 1KAWA 4DK5A 3V60A 4DHZE 4DV6L 1WR1A 2L76A 1VQLA 4CKBA 3T3NA 1TWGB 2DZJA 3V6EB 1ZXTA 3RMHA 2UU9L 4JYAL 1YIWA 2LS01 2OEDA 3Q3FA 1FD7D 1WCMB 5FO9B 2MP1A 4DXAB 2AWTA 2KCCA 3EROA 1H9KA 2NB0A 1UF0A 4N9PA 2A69C 1FFVA 1DM0B 2JRHA 1WYGA 4PT5A 4JI4L 3DPDA 3TP8A 4R4TA 2KX3A 4LF6Q 3D4RA 5COYA 1VQ6A 4LFBQ 2L00B 2L11A 5JEAH 3RT3B 2ZW1A 1TTNA 1WMHA 2IGDA 3MTNB 3K0XA 3SK4A 2E5LQ 1T0YA 2KC1A 3ZJYC 4JL9A 2BOSA 1SN8A 1L7YA 2KQ3A 2MSED 2O6VB 4R8IA 1E9MA 1L5PA 2HCCA 4YTNB 1ET9A 3GZNI 2KMMA 1TWHH 2JRIB 3NS1A 4LNKA 4US8A 1PDQA 1EQTA 1PTOD 4HXDA 3BK1A 1NTGA 4F7XA 4BBSB 2JYEA 4W9JA 2AQ3B 5CV9A 4II3B 2REXA 2F4VL 4G7OC 4A3GG 4A76A 4FHJA 2D0PA 5IIFA 3PPAA 1OXUA 2BA0A 2M17A 1HFGA 1TS5A 2K6QA 2K52A 5HGTA 3FKIH 1HZCA 2ON8A 1KDAA 2QW7A 1SE3A 2J53A 2N9LA 3G7LA 1E90A 1JOOA 3E5SA 4YSYB 3QWZB 2UUCQ 1B2TA 3VR5A 2LJIA 2WDRB 4XWWA 2MPMA 4LF7L 1HQMC 1NR2A 1L0XB 4APVA 5IGDA 1NDDA 3PF4A 3EC8A 5C2TB 2K0PA 4IOCA 2L0TA 2A68C 4CJ0B 3J81c 1K73C 1CM9A 3K5MA 2INCC 4L6TB 3MXPA 3I7FA 4AWJA 2DJFC 3CCJA 2B39A 1L1OB 1SNCA 3W1BA 3J81E 2CR5A 2IYDB 3DBHI 4P72A 3V2TA 1I94L 2Z4HA 3PO3B 4S0RA 2B2UA 1SFOH 1Y1VH 2WAQG 3I72A 4RHSA 3A54A 3NVYA 1BMLC 4USAA 1FRDA 1D3ZA 3H6MA 1ACCA 3S16H 1R4PB 1P3QU 1VQBA 1B9NA 3AU5A 3M95A 4M0WA 4BOZB 3ERQA 2WB1B 1PYSB 2JN4A 2MH7A 4R4CA 4HRSA 4K3CA 4MM3A 1WZ0A 4W9DA 3J7A5 1EYDA 1WRIA 3HKZE 3I4NH 2PVGC 3CWIA 1BT0A 3KF8B 1RD9D 1HH2P 1IW7D 3IAS1 1AN8A 2KKCA 2BPSA 2A1AA 1FVIA 1SNDA 4HN7A 1B3AA 3PO3G 4CDEC 1ZP0B 1UE5A 3B08A 2Y5CA 2YLMA 5E1FA 3QK0A 2E76C 1C7YA 4BKSD 1D5MC 2VW9A 5IP4D 3NHHA 1EWCA 1NVID 2A5UA 4JI6Q 1IXRA 2C7NB 1LXDA 2WB1G 4X66L 2UYZB 1VMCA 2JSOA 2PI2A 3LDZE 2NN6G 3GTLH 1EQVA 4GOPC 2RHSB 5G5GA 3VHTC 3VH4B 3G71A 2JUOA 2KTRA 5NUCA 1XPOA 1R9TB 1QKZA 2WV6D 2VXWA 5J39A 4LK1C 3GTOH 1LABA 2JA9A 1JWMD 1S4ZA 5CHWA 3S1MB 4R4QA 5IGBA 2B8GA 2M9VA 1Q1BA 3HOWG 3PREA 2D0OA 4NDXA 3AEDB 3NUHB 4HJ9A 4NJ7A 4IUNA 3KWVA 1QVGA 1OTRB 2PZWA 5J3BA 2WXJA 1JORA 4JI2L 3K7UC 5IWAQ 2Z6KA 3LXFA 4JQWC 1NY4A 4KSLC 4WH4A 2EPBA 3I55A 1SYGA 1E7UA 2JX5A 4GNXA 1NNXA 1MBYA 5EPLA 1X3GA 2DX5B 2RD0A 1T5XD 1HRJA 3H9DA 4X3SA 4N9TA 3VAWA 2W3SA 4TVAB 1OEYJ 1VQHA 3VTWA 1YNNC 2KVRA 1WJJA 4KKSA 1XNQL 1D2BA 1WTVA 2MW5A 2JXXA 2YV5A 4XGAB 5JHAA 4WAFA 2EYLA 1HFNA 4LDTD 3CRLC 2L5TA 3SE0A 1WXSA 2ZEQA 4IPGA 4AIMA 1KC8C 4A20A 4ICUA 1CT1D 1HUNA 5ISRA 1PQSA 1V9JA 1WMHB 1PTOF 3VUXA 1PZKD 3A56A 3HP3A 1ZPSA 1WXMA 2K28A 1AE2A 2PNRC 3EECA 4UHVA 3H3VI 1D5XC 2NBUA 2HQLA 4MZ9A 3JSVA 2JA8H 2I1JA 1K8AC 4KMUC 4LF9Q 4ANVA 3ZRFA 4TRDA 1ENFA 3T53B 5JJZA 2FNJB 1EZ6A 4LUZA 3FKYA 4NXNQ 3SHLA 2HDEA 1G2SA 5M3FB 2KFKA 1QCBD 5IYCG 3WA0A 4ZAIA 3EVQA 4DV3L 1X3QA 2L3ZA 3UE0A 1WIAA 2ZNVC 1DZ1A 2KCTA 4MH0E 4DR7L 4FDBA 2C9OA 1VQCA 2C9WB 4OWWB 1JE4A 4TQUS 3PIP3 1UAPA 3LNNA 4CGYB 1Q8IA 4LF4Q 4IZ8A 2ONQA 4ZHPA 4IUMB 1G8ZD 3HOZH 4TQ0A 2QC8A 2EYHA 1WTXA 1C0AA 3J7YW 1QVCA 2BDNA 3OIPA 4KJOA 1HHVA 5CV4A 2JPHA 4HWIB 3BVMA 5C5LA 2WXGA 3MEFA 4X3UA 5DPRA 3TDQA 1BVSA 2CU1A 2ENBA 4WJQA 1F2ZA 1OQQA 3RFZB 3NQTA 2Z1CA 2OOBB 5M3FG 3GZNB 3P20A 1CSPA 2B2WA 1P9DU 1ESFA 2I5HA 3E0JA 4M8MA 3OYYA 1EY8A 2V3PA 3SK6A 3L3OC 3J81L 3W1SC 1XLNA 2CVRA 1J8CA 1Q1EA 3MEHA 5M3MB 4LK0M 2DYBA 4JOIA 3OAWA 4EZLA 2MJ3A 3AFQA 4K7UA 2AUKA 4K6DA 5IODA 4MTNA 2VB3X 2J7ZA 3RNBC 4MM3B 1I35A 1KOTA 1STGA 2HT1A 1MSGA 1HA6A 1AEXA 3DWMA 2XSCA 1OQRA 2NCNA 1F9QA 5CBAE 5GAHC 3S15B 2JWZA 4X3KA 1H9SA 4BXXG 2ZW0A 3TMEA 1LO5D 3RLOA 1K8GA 2BA1A 5EKIA 5KNBA 4DK0A 2LUEA 1WJ4A 4K3BA 1K0SA 3ALBA 5M3MG 2RSUA 5HG2A 5C4XH 5AFWA 1ET6A 5IYBG 2E2HB 1CZGA
chains in the Genus database with same CATH topology
1BUIC 3WOEA 1AZPA 4KX6B 4KKUA 2JZPA 4B9WA 4A93B 3CRKC 3EA6A 2NMQA 4A3IB 2QSDA 4ARIA 4M1UB 3RZOB 2L1AA 3K0YA 3D6CA 4KKTA 1WTOA 1XCTL 2BS4B 2QDBA 2KEDA 3HOVB 2LY7A 2WXQA 3HUIA 2WKCA 2XWBB 2KN4A 2FBWB 5KYIA 4HROA 3MAQA 3ZJTA 2FHTA 2MJDA 3W5VB 1BCPB 1RODA 2W55A 2PZTA 4U673 4B0EA 3VA5A 4KY7A 4DXGA 3E6ZX 5EE3A 3Q6SA 4AYBB 1U9RA 2BB5A 5ELEA 5C0XI 1XCQL 1FMAD 1R4QB 5D3IB 2FFKB 3GB1A 2WXFA 2K22A 2N88A 1U4PA 4RCOA 4ZQ3A 4BA1I 4A3DB 3PUVA 3H0GB 1GHKA 1LLRD 3QG1A 3QWNA 5K5PA 3P42A 5BMIA 1C4AA 2K5DA 2EY6A 1KFYB 3EFXD 1SSOA 5BN5A 1D1IA 3K59A 1I4QA 3FRPB 3KLSX 2WIIB 2INNE 3AB5A 2NYZD 2C5CA 5TSSA 4FXCA 2N7JA 2IX1A 4A3JB 1PYWD 2XNAC 1XTCD 1FM0D 3GO5A 1ICWA 1HUMA 1NI3A 1FXAA 1XO3A 4OZBA 1JC7A 4OO1G 1EYAA 1JW9D 3HZXA 3KBXA 4ZUJA 1FRRA 1IBXA 5BMGA 4KN4C 1B44D 1KLGD 2B2VA 3VYRA 2B8FA 1PZJD 2EJFC 3I90A 1CQFA 1XXGA 1CZPA 1TT2A 3D8GA 1K83B 1TKYA 4CKCA 1TS3A 1CHQD 1S5BD 1FNUA 3W9CB 1H9SB 3W3AA 2BE5D 2IL8A 4G7ZC 4H44C 4YTPB 1TWFB 2SEBD 1EY6A 3P7JA 3ZGZA 2JEAI 5JVH3 4KN7C 5FK9C 4DXFA 4PMBA 3ND9A 1ILPA 1N5XA 1J7AA 1TKWB 3C1EA 1SXTA 3UI3A 3HOYB 1OXSC 1T3QA 2ZT9C 1EY9A 1DXMA 1I6HB 3R3OA 1TS2A 4DAYA 5CC4A 3Q22A 4KHVA 1O7ZA 4XTCS 4C1NK 1I50B 1YNTE 3W5UB 2KECA 3H09A 1GUWA 4NMZA 2R6GA 3RZDB 3PZ8A 4EQPA 4N59A 4BWGB 3LYYA 1Y8NB 2X69A 2A6HC 4NKLA 2K5PA 1ZYRD 1NYRA 1QQRA 1EEFD 3NWTA 1A6XA 3GTKB 3IXSA 3X3MA 4DA2A 2J0TD 5IGEA 5MPOA 2RSOA 4P2CB 5T8IA 1A3VA 1KTKA 3DMUA 2I2YA 2JA5B 3RUZA 1H9RA 2F0OA 2EE1A 3BG3A 4ZLTF 5JOBA 2AWNA 4WRDA 4GDLB 1RWSA 3KUPA 5EQ0A 5EJWA 1VDVA 1XWEA 2SAKA 4ZKCB 4J6HA 2G9HD 4I7ZC 3K5LA 1F2YA 3CIRB 2B2UC 2E75C 3PO2B 1C9FA 1WTRA 3TN2A 2I07B 2WXIA 4A3FB 2JQRB 3AEEB 1WD0A 2A6EC 2PQEA 5I6YA 3EJIA 4LTUA 2GB1A 1BQQT 1TVXA 4IFDH 1SNPA 5C3XA 2GRIA 3VYUA 3E56A 2EYFA 1QWYA 3FAHA 1SE2A 5AUKA 4UDUC 5KIXA 1TKGA 2NTTA 3T56B 2G1EA 2RQXA 3D4DA 1MI0A 2CQAA 1JQ4A 2PPBC 5KRUA 1HA5A 4C2MB 1Z47A 1WTQA 4KKJA 2RDHA 5ELCA 3MVVA 2IX3A 1FO4A 1MD2D 4EQOA 5CYUA 3OHXC 3Q24A 1LV9A 4K14A 2NBFA 3C3LA 1MI2A 3LWEA 1WVLA 1KH0A 3KBGA 3Q8BA 4C3HB 3DWQA 1I4RA 3DEPA 3P1MA 4US9A 2JP1A 1BCPC 1DGJA 4CQNA 3VYTA 1CA5A 1JWUD 1FFUA 1VLBA 3TZUA 1EZ8A 1I4HA 3U9OA 1ZDXA 4XE0A 1KLUD 1TS4A 4BA2I 3NUCA 2DY8A 3MC0B 4R9WA 1SB3C 2NVXB 1E0ZA 3PUZA 2LHDA 3R2TA 1MHHE 4CJ2C 3ONAB 1LTID 3MXNA 1F9RA 4XYOA 4H7BA 1EU3A 4V0BA 1A2TA 3B2FA 4MH8A 2EYJA 5LNK1 3MFGA 1PRTC 5G3LD 3PZ7A 1CTMA 1JWBD 3AM9A 1S5ED 3E9SA 1SNQA 1CA6A 1V43A 4ZK9B 1D1KA 5C5MA 3BDCA 1N5WA 3J9CA 1PFBA 4N6EB 1XX8A 3H3VC 2JWUA 4HCEA 1S5CD 2B2WC 4IALA 4FF2A 2QIEB 3VR6A 1SE4A 5AUIA 3NZ3A 4RKBA 1CZWA 3ND8A 2D2CC 4RCNA 1FR3A 1V1OA 1WD1A 1ML0D 3AU7A 1LTTD 2Z8LA 2RBMA 3MFYA 1L0YB 2LFIA 3DXJC 3U9SA 3T13A 4FXDA 1T6BX 3UI2A 3NE5B 3Q8AA 1II3A 1Y1VB 2L0CA 5HHDG 4EE2A 3N6RA 3S16B 2HCIA 2WXMA 4L23A 1EFID 3PUYA 2ACZB 2DWQA 2V0GA 3DEOA 4ODGA 4KV6A 1YJIA 2A74C 3SEBA 4KI0A 1L6UA 2EYMA 4LJZC 4WORA 3PIO3 2F0UA 1CQVA 1RM6C 1CHPD 5C4ZA 1ZOYB 5D7GA 2WXOA 1C4QA 3T4AC 2L1BA 2BBCA 4L2YA 2F0KA 4RH6A 3GTLB 1SMYC 2V3NA 4KD4A 2WU5B 5KEEA 5J22A 1JOKA 2BCOA 1MPEA 3GTOB 4OL7A 4J1MA 2B2TA 4C80A 4ID6A 2ID0A 2IPKD 3AE6B 3P4RB 1U4LA 4RA8A 1DOMA 4PMWA 1Y8PB 5D65A 3LWUA 2FINB 2VZKD 4HSPA 3NBHA 2SDFA 2ICIA 4KGSA 4ME5A 1YMHE 4QB4A 4C7ZA 4M8AA 5G3LF 3R8BA 1PZID 2RPVA 1XLQA 5IGGA 1PGAA 3AE4B 1QG7A 2WINB 3SR1A 2JXTA 5EE1A 1EWYC 3ETRA 4RFBA 3M4YA 3VYSA 5EKKA 2IGHA 1TR5A 1YNJC 2IT1A 2CW0C 2JA8B 1PMRA 1SYFA 1C4PA 5EPJA 1AWDA 1JICA 3DHQA 4QUCA 3MP9A 2NN6H 2PMZB 2CJNA 3EQLC 3CHBD 3IFTA 1N62A 4ZUIA 3U52E 4HKQA 2B2VC 1TY2A 2MJ8A 1A3UA 4I65A 4FO2A 4H13C 5D3DA 1LT4D 2K05A 1OFFA 2F0EA 2RDFA 2SOBA 3HOZB 5C0XJ 1C8CA 1BF4A 4CKEA 2VB2X 3H8HA 1JALA 3HEJA 4G4KA 3TEZA 3GQBA 3H91A 2E74C 2K01A 2FUG1 2M19A 3I9V1 1F2MA 4LAAA 4C3IB 1PTOC 1KRHA 3NPPA 3AEFB 3NSWA 4WJWA 1JQYD 5HURA 2AX5A 2HDMA 2PYKA 1UWMA 2K3UA 3CKIB 1S5FD 1AP0A 3U7ZA 3DUZA 3VR3A 1GPXA 2KACA 2QCPX 4V190 4PV1C 4MT5A 1A3TA 2F0JA 1H9JA 2EYPA 3VR8B 3GD7A 4C3IG 2E2DC 5C4XB 4JE3B 2KWDA 1GAQB 5T1GA 1DONA 5C3EB 3M4OB 1EOTA 4C3JB 1QJOA 4HCSA 3GTMB 1DOIA 5EGTA 2PTLA 1FXIA 5D14A 2DLBA 2Q8TA 1Y56A 3EUB2 1MHXA 1O7YA 2AWOA 3ABVB 4RWSC 1W6KA 3GP7A 4K2LA 1IGDA 2F0SA 5M5XB 2R93B 5CGKA 3Q0AA 3L4PA 4C3JG 4DN4M 1JOQA 3HG9A 3EGRA 2R61A 4O1NA 1IW7C 1EY5A 3C1FA 1BR9A 4K5VA 4BY1B 4E6IA 4L63B 5CV5A 2MGSA 4A9AA 4H2AA 5C6AA 4S3SA 3QOJA 5E3FA 1Q10A 2K5QA 1WSPA 5JXVA 1XEEA 1MSHA 2J4XA 2OEOA 5JEAJ 2WP8J 5I4DA 3MZ5A 4ZYSA 3D31A 3VA7A 4IFDI 1OXTA 1K53A 1VR9A 2PW7A 1V8QA 3D4WA 1SYBA 3JAME 2NZ1D 3AE2B 2L83A 3WOFA 1QT9A 2IDYA 1C48A 2K7VA 1QILA 1G6ZA 3AE7B 3TP7A 1LT3D 5FKAC 5IT9E 5EE0A 1Q90A 3WCQA 4DF7A 3U2SC 1VJKA 2F0PA 1VZ8A 1NAPA 5IGCA 3KQ4A 4YT0B 5BYRA 1X32A 4F8MA 2O2LD 4DAPA 2L52A 1X3PA 3I70A 2F03A 1C76A 2J52A 2WXRA 2L32A 2EDGA 2LMCA 1DOXA 2E3TA 3L7ZC 2E2IB 2K6AA 2WXLA 2WP9B 2OF1A 4WIPA 4G57A 3T16A 5J1ZA 1SF0A 5C3JB 3MJ5A 1TWAB 2PKOA 2CHBD 2PCFB 1VRAB 3W2DA 3VR2A 1FD6A 4YIJA 4XT1B 3PMFA 3TZDA 5DAUA 1PRTB 1VMPA 2DBYA 3MXGA 1ZXHA 2KAJA 3QOLA 2M0AA 3RLFA 2O5JC 1ZUD2 1ENAA 2B76B 1E2ZA 1FNWA 5KGUA 4IUVA 4H0LC 1V1PA 4R3DA 2JA7B 3B9JA 4HMIA 5LL6S 2RMMA 1STAA 5C44B 2AUJD 2KVMA 2QKIC 2A6ED 5M5YB 3IL8A 3J7AV 2F4IA 1ROEA 3TEXA 5BYSA 3J7AF 1BOSA 2EJMA 2B2YA 1M8AA 3DWGC 2F0DA 1I3QB 2IWHA 3FVQA 3DM1A 2MUYA 4OO1H 1E2WA 4XQQA 2YYZA 2Q5WD 1F2RI 3OMGA 1KNEA 3NTKA 2NTSA 1O80A 4YWGG 2K1BA 4OW0A 3OWEB 3M85A 1F0ZA 1U4MA 3OIQA 4B0MA 4KY6A 3AEAB 1OXXK 1LACA 2RDGA 1TZOA 5BN4A 1NSNS 3AE1B 4JPSA 4QF4A 5JVG3 1R7SA 1QOGA 1A70A 3Q23A 1AYFA 3A55A 1O78A 5C4HA 1TKEA 2H89B 1HTLD 2K03A 5GXGB 3IAM1 3URYA 2WXPA 3S2HB 3JAML 1BCPD 4NJCA 1DOKA 2NVQB 2JU6X 2WDVB 2Q8RE 4JWSC 3OMCA 3O13A 5IT9L 1SAPA 1FIQA 4OZCA 4FXGC 1LTBD 3IT6B 3V96A 1GXDC 2SNSA 1EM7A 1E10A 2LEKA 1GUOA 3QB3A 4XQJA 5K36G 4TMAB 2LMCB 4BY7B 1EL0A 1DOLA 3OPOA 4BBRB 2DNEA 4QCLA 2LUMA 2F0VA 1PFDA 2JYTA 1STEA 3KWLA 4TQ1A 1FCLA 2JA6B 2EOTA 1JR0D 1EU4A 2EY1A 1RDPD 3M7NA 2M00A 4CJ1B 3P4PB 4FNFA 2ICEC 1CK1A 3NVWA 5HFYA 3BVGA 5FLXE 2DY7A 4DQOC 3M3YB 1F2LA 5IOCA 3AECB 3P1HA 4RHRA 4MHEA 1E7PB 2KOLA 2DNCA 3S14B 3FDTA 2B2TC 2KUMA 4Q0FA 1P7EA 1KF6B 1V1PB 4HR7B 2A69D 1XYIA 1AW7A 1IBXB 4AQ7A 2PMVA 4LLGM 2EKIA 1SYDA 2F0FA 4B08A 3VR4A 3V3XA 4Y7NB 1PDXA 5C0XG 1GUSA 4KY5A 1YN3A 1P7FA 4IOIE 1RHPA 1TU2B 4O42A 5I6WA 2WNMA 4FF4A 2L12A 1CJEA 3KLRA 4JX1C 3MWYW 1VCIA 4CHTB 3B2GA 1C77A 4EGVA 2WACA 1PTOB 2BE5C 3SFDB 4C7YA 1I4XA 3U4EG 1F9SA 2NN6I 4RF0A 3J80E 1L4DB 2XWJB 3BZDB 2B63B 2E2JB 2A68D 1D6EC 2PVOD 1LT6D 3NQIA 1WGKA 2X38A 4REZA 1C78A 2AQ1B 5CMDA 5M5WB 1SIJA 4ULLA 3HVDA 3KK7A 1MGSA 2EXZA 2I46A 2QEJC 4KTAA 1IGCA 1DJRD 4XQNA 1ZXIA 1SJHD 2EY2A 3BK2A 3N9YC 4C3HG 4KGRA 3SDZA 4RKLA 2BDOA 1IL8A 2L55A 4NZLB 1QNUA 2LHEA 2RKSA 3HVZA 3BDLA 3TP6A 2WU2B 3MTSA 1RYJA 5I2YA 2KQ4X 2BB6A 1FEHA 2YEPF 2BTEA 3S1QB 1AZQA 1L0VB 5ELFA 1ZYRC 3NTIA 5JAVA 4K2KA 1NCVA 4XIGS 1Q12A 1L4ZB 2PIAA 1TWHB 3NVZA 3KLSA 1IUEA 3N52A 1Y1WB 2OT2A 1TY0A 4HEDA 4FYDA 3VR9B 4BS9A 1EY7A 5I2XA 1K51A 4RGMA 1J7CA 1JWSD 1MVKA 2K32A 3QO2A 1QLBB 2WXNA 5JEAG 2CW0D 1KNAA 1NEKB 3NXWA 1QNKA 2OXPA 1N61A 3D3RA 3FKIB 1SYEA 3SR6A 4XDDA 5FLXL 1B9MA 4JBWA 4FP5D 3AE3B 1LTRD 1AFPA 1YNND 5CV8A 2XN9C 3F2UA 1GUGA 1YQ4B 2BW2A 1N63A 1EY4A 3BIID 2XRSD 2NVTB 1JB3A 2YU9B 1SFOB 4A3GB 2EELA 4L8JA 4MACA 1RF2D 3MA2B 3NVVA 3IFDA 1BNZA 2BS2B 3I4NB 2K9XA 3VRAB 4XYQA 5HI1A 2I38A 3G6JB 4HJGE 4WFN3 4ZRQA 2EJGC 1UWXA 4GDKB 5BN3A 4Q5VA 4A90A 3TSSA 1LTGD 5M9OA 3FILA 2PO4A 2INPE 1CI3M 4NP5A 2F3WA 2D62A 1QE6A 4HMJA 4PMCA 3FPPA 3J80L 4XXEA 2BYTA 2WAQB 5FO7B 1HXYD 3ZJUA 1STHA 1GUTA 4EVOA 1A2UA 1FNVA 2EVBA 1EYCA 1J7BA 5I9OA 3ITPA 1GJXA 1ZE3D 4ILWA 4MN3A 1XLOA 4IUTA 4FF3A 4KK7A 4WQMA 3NTHA 3D6WA 2L9HA 1M4VA 1DD2A 1LTAD 2W3RA 3CQZB 1VDZA 5EBCA 4RAUC 2H88B 1PFMA 1OXVA 4NW2A 1QOFA 5H92C 2XIWA 3HOWB 2OHFA 2CU3A 1TWCB 1B1ZA 1D5ZC 1IHZA 4IFDJ 1UGJA 1DOYA 2DYOA 3X3NA 1ZEQX 3K6OA 2F1MA 5FO8B 3NK9A 1V8CA 1GB4A 3GS2A 1D4BA 1SBBB 1IKLA 3PUXA 1G291 3OW7A 4FXKC 4GLSC 3P75A 1OO9B 2PZUA 4ZOHC 2A5HA 1S5DD 1QF6A 2F0WA 4OO1I 5LHY1 2HDLA 2B2YC 3OWFA 5T1IA 3A8IE 4EQNA 4IUPA 2F0NA 1HZ5A 4NAWB 3M7GA 2IW3A 3V05A 1YN4A 2WDQB 2LKVA 2RA4A 1G2TA 3ZQ4A 3I73A 4HAEA 1TIID 4JK1C 1K52A 3OOCA 4IDIA 1XLPA 1Z7TA 1J9OA 4G7HC 3RPFC 5IGFA 3TP5A 4IN3A 5FR3A 2IX0A 1QOHA 4DNTB 4K8JA 1TJEA 3Q69A 4OGQC 3MHBA 1XF5L 4HKZE 1HTPA 3BVZA 1RTNA 3FILB 5KNCA 4PNYA 1TQOA 5A35A 1ILQA 4CBVA 3P4SB 1VF7A 3GTPB 4J8QA 1L6VA 3HKZB 1HZ6A 2SNMA 1UNSA 3GV3A 1F2RC 4C56C 4ITKA 3S17B 1U4RA 1PFNA 3T51B 1IKMA 1RKNA 1Q3LA 3SFEB 4ZRPA 5EE9A 3A7AB 5BYQA 3S1RB 1ZDVA 2VUMB 1HPCA 2H1EA 2KJXA 3SXHA 4RGTA 3BS1A 2BT6A 2J42A 3PV0A 4XWTA 4K5XA 4FVMA 1DYQA 3T3OA 4RF1A 1EIHA 3LB8C 1N60A 4YSZB 2EY5A 4XDXA 1WTPA 3I57A 4K6LA 5DM73 2JXMB 1SNOA 3SK5A 2VNUD 3CU7A 2WXKA 3RD4A 3C46A 4A3EB 1QOAA 2X6LA 4RNAA 1ONLA 1Y8OB 1ZKOA 1C4CA 1F77A 5KYLA 2F0HA 3BYYB 4F87A 2FMMA 4K8IA 3P4QB 4KGTA 4HSVA 2FE8A 2Y5PA 3ZJVA 2F0TA 1YJJA 3MXUA 5C4JB 1I4GA 5ELBA 2PW5A 3QIAA 3Q8FA 3FMCA 3IAYA 1A15A 1GUNA 4RGNA 4DU9A 3BWUD 1W6JA 1JWAD 1DCZA 1LTSD 1VZ6A 1SYCA 2A6HD 3NRZA 4OZAA 2WS3B 4A3MB 5KNDA 2GI9A 3AMZA 2MJEA 5E6JA 3GV6A 4Z9CB 3Q8CA 2R7ZB 3VQIA 1E6EB 5E4WC 4A6QA 5DM63 4TSSA 4ZHOA 1RFKA 1JRPA 3S9WA 3TEYA 2M56B 1SJED 2D5DA 1B4OA 3GTJB 1I4PA 4YTMB 3P63A 2JYOA 2BS3B 3SK8A 3TEWA 2FMCA 2N55A 2NWGA 1K8OA 5E4XA 4JWUC 3A8JE 4P6VF 4ZRZA 1STYA 1FGBD 2WXHA 1J8IA 2QJLA 2YEPB 1E0BA 2M2LA 3AE8B 4RGOS 4AS1A 1PGXA 4U68A 1EEID 4IURA 3WDNA 4F88A 2JSVX 1QOBA 1CFMA 5A2QE 1NYQA 1PUTA 5EBDA 1C79A 2A73B 2V4DA 2F0GA 2HUGA 2EYOA 2W54A 3R2IA 2RSNA 1E2VA 3I91A 4WURA 5C3WA 4YSXB 3AMUA 2X6GA 1PGBA 1KDCA 3FPUB 3OSOA 1IYVA 1JMLA 2H4OA 1VZ7A 2LGIA 1IYUA 3QJYA 3S2DB 2Q8IB 2IJ0A 2HTME 2F0IA 3R93A 3AN1A 1BDOA 3I3CA 3AE9B 5DEHA 1KAAA 2D9UA 4MIUA 1I7HA 3HGBA 1SEBD 2K33A 4ABNA 4IQZA 2QMTA 4IUUA 4N58A 1ESRA 1NR4A 2QF7A 1GHJA 1HEZE 4IUQA 5EKLA 4IKGA 3NP8A 1Z6HA 2TSSA 5JPNC 3L9AX 3BDOA 1SDFA 2DN8A 1NUCA 3FC4A 1BUVT 3HRDD 5CORA 1STBA 4A8XC 1K50A 4K5WA 2O5IC 3HOUB 3W1SA 5F2DA 3HOXB 4OIJA 2DYMA 2Y3AA 4R8NA 3I8ZA 2KHSA 2ZXPA 3C8YA 4A3KB 3HRZC 1UEAB 4DGZA 1WWTA 3C2PA 3GTGB 1YQ3B 3MHZA 3S1NB 1PRTD 2F0MA 4P16A 4LMQD 1KDBA 1RCVD 1WTWA 3A7LA 2R92B 1PLFA 2PLPA 5EPKA 1B53A 2JE6I 2Z4IA 3K5OA 2N0SB 4TKOB 2RVLA 3FEWX 4KD3A 2F3VA 3I4MB 1TYGB 3PUWA 3DWAA 4IFDG 2MHVA 1HQRD 5K36H 2KDMA 3IT4B 3DWPA 1K8MA 4WWMA 5CV7A 2F0QA 5DNFA 2V4IB 4UAIA 3Q8EA 2KCNA 4DFAA 1BXTA 1YN5A 5A2QL 4KKIA 2K04A 4OHJA 4A55A 1O7LA 1V97A 2KA7A 5ELDA 2WLBA 1GB1A 1STNA 4C1NI 1H9MA 3IKJA 1T5EA 3AE5B 1EIGA 4QUFA 5CBEE 1ENCA 1EY0A 3AH7A 1B9RA 1QB5D 3BYTB 3HS0C 1B50A 4DNRB 3ZYYX 1GOZA 2LFNA 1SSNA 4FF1A 3TBIB 2R3ZA 2NUCA 1PXUA 2O4XA 1UUPA 1HCZA 2W82A 3AB9A 1JCKB 4ARCA 2ZXOA 4XDCA 2KEEA 5G5HA 4OVZA 1I6VC 1F9PA 3K5NA 3SVMA 4HEA1 2HQEA 1EWHA 5C0XH 2D5GA 4QMGA 5LL6X 2EZVA 2Y0SB 5I9PA 1BCPF 3NBIA 2QILA 3AEGB 1SMYD 4DK1A 2L4NA 4HTHA 3K58A 2G9DA 2MEKA 1VF5C 3PO0A 1NENB 1BO0A 1SNMA 1RTOA 2CJOA 4XT3B 1JROA 4PQXA 2WQYB 3VRBB 2FJ2A 3KF8A 5CR3A 4OIKA 2E6XA 3I4LA 1FCCC 2ZXRA 2AQ2B 5CV6A 3AEBB 4YXDB 2XRQD 1G91A 4D2KA 2GA4B 1FYCA 1RJTA 1PRTF 1PTOH 3NWSA 3K7AB 2XVSA 3LX0A 3H94A 2NVYB 4NAMA 4DAVA 5H8YE 5BMHA 3A8KE 1LT5D 4A3BB 4Q2JA 3TUOA 4ZKBB 4QIWB 5FOBB 4KJNA 3K57A 1KABA 2VZKB 2JEBI 2K5WA 4X3TA 4GZYC 3AV8A 2IGGA 4J3OD 1YNJD 5JPMC 1Y69U 3GTQB 2WKDA 4B9XA 1BBXC 1WXQA 4L1BA 2F0LA 2TMPA 4KHZA 2PW9A 2N9KA 4CKBA 3T3NA 1TWGB 1ZXTA 3RMHA 2LS01 2OEDA 1FD7D 1WCMB 5FO9B 2MP1A 2KCCA 3EROA 1H9KA 2NB0A 4N9PA 2A69C 1FFVA 1DM0B 1WYGA 4PT5A 3TP8A 3D4RA 5COYA 2L11A 5JEAH 2ZW1A 2IGDA 3SK4A 2BOSA 2KQ3A 4R8IA 1E9MA 1L5PA 2HCCA 4YTNB 1ET9A 2KMMA 3NS1A 4US8A 1PDQA 1EQTA 1PTOD 3BK1A 4F7XA 4BBSB 2JYEA 2AQ3B 5CV9A 4G7OC 5IIFA 1OXUA 2BA0A 1HFGA 1TS5A 5HGTA 2ON8A 1KDAA 1SE3A 2J53A 2N9LA 3G7LA 1JOOA 3E5SA 4YSYB 1B2TA 3VR5A 2LJIA 2WDRB 4XWWA 2MPMA 1HQMC 1NR2A 1L0XB 5IGDA 5C2TB 2K0PA 2A68C 4CJ0B 1CM9A 3K5MA 4L6TB 3MXPA 2B39A 1SNCA 3J81E 3V2TA 2Z4HA 3PO3B 2B2UA 3I72A 4RHSA 3A54A 3NVYA 1BMLC 4USAA 1FRDA 3H6MA 1ACCA 1R4PB 1B9NA 4M0WA 3ERQA 2WB1B 2MH7A 4HRSA 5G5GA 1EYDA 1WRIA 2PVGC 3CWIA 1RD9D 1IW7D 3IAS1 1AN8A 1SNDA 4HN7A 1B3AA 1ZP0B 2Y5CA 5E1FA 2E76C 1D5MC 3NHHA 1EWCA 1NVID 1VMCA 2JSOA 2NN6G 1EQVA 5NUCA 1R9TB 1QKZA 2WV6D 2VXWA 5J39A 4LK1C 1LABA 1JWMD 1S4ZA 3S1MB 5IGBA 2B8GA 2M9VA 1Q1BA 4NDXA 3AEDB 3NUHB 4IUNA 3KWVA 2PZWA 2WXJA 1JORA 3LXFA 4WH4A 2EPBA 1SYGA 2JX5A 1MBYA 5EPLA 1T5XD 1HRJA 4X3SA 4N9TA 2W3SA 1YNNC 1D2BA 4KKSA 1WTVA 4WAFA 2EYLA 1HFNA 3CRLC 2L5TA 3SE0A 1CT1D 1HUNA 5ISRA 1PTOF 1PZKD 3A56A 3HP3A 1ZPSA 2K28A 2PNRC 1D5XC 4KMUC 4TRDA 1ENFA 3T53B 5JJZA 1EZ6A 3SHLA 2HDEA 1G2SA 5M3FB 1QCBD 4ZAIA 3EVQA 1X3QA 1DZ1A 2C9OA 1JE4A 4TQUS 3PIP3 1UAPA 3LNNA 4CGYB 1Q8IA 2ONQA