3Q14C

Toluene 4 monooxygenase hd complex with p-cresol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAETHYLENE GLYCOL
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q14C00
3GE8C 3RNEC 1T0QC 3RNGC 3DHIC 3Q3MC 3N20C 3RN9C 3Q14C 3N1XC 3RNAC 3DHGC 3I5JC 3GE3C 3Q2AC 2INDC 3N1YC 3N1ZC 3DHHC 3Q3NC 4P1CC 1T0RC 3RMKC 3RNCC 3RI7C 2RDBC 3RNFC 3I63C 3Q3OC 1T0SC 3RNBC 2INCC 4P1BC
chains in the Genus database with same CATH superfamily
4DHJB 3TMPB 4QAYA 2O2VA 4A8XC 2UWQA 4HVBA 2IGHA 1DOIA 3R7QA 4GLSC 1WR1A 4KVGB 3TEZA 1C4AA 1NYRA 4XZ4A 1IGDA 2BTEA 1FRRA 3ZQ4A 5J18A 4DHJD 2KLCA 5BMHA 3ZDMC 1Q10A 5DPWA 4NPNA 3SEBA 1D5MC 1I35A 3DVNU 2ZNVB 3K9OB 2MBOA 3VUYA 5EE9A 1CJEA 3RD2A 3Q8BA 1NI3A 3V62A 2K22A 1R4NB 2JUOA 2PJHA 2M0AA 5TR5A 2O2VB 4BKTA 3CSTA 3ZXVA 1MI0A 4NJ6A 5LXIB 1WH3A 2QSDA 1NI2A 5J2RA 2NS5A 2A5UA 1KFYB 4GIVA 3UGBB 5HFYA 1LO5D 3FC4A 4IM2A 4KGTA 3PPAA 2K39A 2K5PA 5IOIA 2HTME 4OZAA 4KZCA 1R4MB 1VLBA 3U52E 1K52A 2MHJA 1GUAB 5CTRC 4A90A 1G6JA 1OQYA 3V6EB 2FCSA 2KX3A 2J4XA 2UU7A 2J52A 4HJGE 3H8HA 2Y3AA 3Q3NC 4P1CC 2HTHA 4HPPA 3X23A 2R61A 3KWVA 4YSYB 3ZGZA 1C4PA 3ONSA 2KMAA 2V9HA 1WGHA 1MPEA 1OQRA 4LJOB 1CQVA 2WDTB 2HDEA 2LZ6A 1E5WA 1FRDA 1QF6A 2V3SA 5D3IB 1WXQA 4DK5A 2G45B 4P7IA 5HG2A 1F0ZA 2IO0B 4YXDB 4HKQA 1WYWB 1SIJA 1MFWA 4K81A 1N6ZA 1QKZA 2BW2A 4WJPA 1P9DU 2DX5B 3VXWA 3RN9C 1LXDA 2DBYA 1ZP0B 5D7GA 1I4PA 1JRUA 1FFUA 1ET6A 1Y56A 5AZFA 3ZVVA 2HD5B 2KDEB 4A55A 1ZDXA 1UZXB 4II2B 4IWQA 3I63C 3TIXA 1PYWD 1QOFA 4MSMB 2KVRA 3ZNZB 1YMHE 4IOIE 1N60A 3QIJA 2KTFA 2EKEC 2KT7A 2KQ4X 2WXLA 4FLHA 1WGKA 3RUIB 2JT4B 1V2YA 3RT3B 3P4SB 4HRSA 2MEKA 5C2TB 3HVZA 1JROA 1WX7A 1OEYJ 3RULA 3DCGA 2LXAA 2KJRA 3J9CA 2WXJA 2QMTA 1HEZE 4ANUA 5IP4D 2JZPA 4BBNF 1XQQA 4TUUA 1I4HA 4W9DA 1TKGA 2GB1A 4DXGA 1K50A 3L16A 4F8CB 2J53A 2MA9B 1WX9A 3RNEC 4HCNB 3N20C 3LDZE 1WGGA 3DBRI 1EF1A 3KQ4A 4LNIA 3NVYA 3SFDB 3EC8A 1F52A 4FJYA 2L8JA 3DHHC 3MJWA 2DLBA 3M95A 4C80A 2FBWB 3DBLI 4MGIE 3T3OA 2B3AA 5AEKB 2MBBB 4FHKA 3R66C 5DPRA 1FNWA 1SE9A 1CMXB 5BMIA 2LGDA 1V5TA 4OHJA 4DQOC 2DZMA 4E71A 4MT5A 5JXVA 2ONQA 3HUIA 2WDRB 3IT4B 3UI3A 3B0AA 3T9LA 3MHSD 1WF9A 3C19A 3HHMA 1XLPA 2K8CA 3C8YA 4FXCA 1E7PB 2W54A 1JWMD 3S2AA 3TEWA 5LNK1 3BINA 4K7WA 4HPLB 4C7ZA 3P1MA 1B1ZA 4YSXB 3LXFA 1D4BA 3VH3B 3HM6X 3N1ZC 5CHFA 1SEBD 2IO2B 2ZNVC 3T3NA 2LUMA 2CHZA 5LXHA 1VD2A 1VJKA 2FIFA 1RWSA 1WX8A 2N7EA 1PUTA 1TIFA 1UBQA 1RFAA 3QCAA 2FNJB 3AEBB 4DWFA 4TMAB 1SE2A 1YJJA 4WAAA 1C76A 4C00A 3GS2A 1P98A 1C9FA 1TS5A 3ZJTA 1JWBD 3SD5A 2RPVA 2FE8A 3AE8B 4W9FA 2DNFA 2X38A 3AB5A 4S0RA 4N58A 2I38A 4WH4A 4JE3B 3ZLZA 3ZIMA 4OZBA 3RNBC 3VR9B 4AUQC 3AH7A 2H89B 2JWUA 3TSSA 2RPQA 1J7AA 3VUXA 2WQYB 1NYQA 2LJ5A 4GN1A 4XE0A 3ZO5B 2AL6A 1EU3A 2ICIA 1S3SG 4GDKA 3WA0A 2BPSA 2LGYA 3AE9B 3NRZA 3AEAB 3BY4B 2BWES 4HCPB 4XX5A 4I6NB 1I4XA 2M56B 2KTRA 1CZPA 2AEHA 4IKGA 3MP9A 3T8MA 1J19A 2MJ3A 3LYYA 3R8BA 3BK2A 3EECA 1GC7A 1RFKA 3WANA 3QHTA 4ZRJA 1GB1A 1TKYA 2WU5B 3RNGC 3SHQA 2IY0B 4XDCA 1VRAB 2X8XX 1E7VA 2V4LA 2OOBB 1TS3A 2NTTA 3RYTA 4MGKE 2RMMA 3EGRA 4TV3A 3NVZA 4GDKB 4I6PA 2MRPA 2QC8A 5CX3A 4RFBA 4S17A 4BKSA 2WS3B 4XWWA 3W1SC 3ZNGC 3R7RA 1DOXA 1GPXA 1V6EA 1RM6C 4RF0A 2IPKD 2KTRB 3L17A 1C77A 2BYEA 3AE5B 4RGNA 2QIEB 3N9YC 5E6NA 4IG7B 3M3JA 4ZHOA 1TKEA 2JYTA 1UF0A 3L08A 2QDFA 1SSNA 2NCNA 4K7SA 1VZ6A 2N9LA 5IA7A 1T5XD 2JXTA 2CU1A 1QZEA 1DYQA 3R3MA 3RCZA 1J7CA 1ZE3D 2LGSA 3AN1A 1N62A 2LASA 4TSSA 1TZ1A 4MJSA 1FFVA 4JWUC 3DWMA 4G0NB 2XBBC 4WQMA 4GXBA 3DBRB 1FNUA 2KD0A 3ZW3A 1WJ6A 4PS3A 3DOWA 1T6BX 1V81A 3L13A 3I5JC 4H2AA 4FN2A 1D6EC 2Y5PA 3AM9A 1D5ZC 3DBLB 2GMIC 2WXQA 1UELA 4MH8A 4BKSD 1WM3A 2RDHA 4IWOA 3EHVA 4ZRKA 3OWEB 2KYWA 2CHXA 2MX2A 1IUEA 1I4RA 4OVVA 2LUEA 2JVCA 4GDLA 4BBNC 2LGIA 1T3QA 4MJSB 1ROEA 4JL9A 2L1AA 3CMMB 1I42A 3AE1B 5CHWA 3GB1A 1A5RA 3ZJVA 3KYDD 4B6WA 1L4DB 4P1BC 2G4SA 4URKA 3ALBA 4ZYSA 2ZEQA 3DBHI 3TUOA 1XLOA 2ZPNA 4J3OD 2JWZA 1N63A 3IXSA 2FCQA 2K25A 2JY6A 1HTQA 4ANXA 1SXTA 1QOAA 3R2TA 2TSSA 2IGDA 2V4IB 4N59A 5JHAA 2JX5A 2JZZA 2L7RA 4W9JA 4PYUA 4AP4C 1YQ4B 2RDGA 5G2NA 1J7BA 3ZTDA 2DZJA 1P1AA 3NJTA 3AU4A 4GOCA 1ZW7A 1HQRD 2C7NB 5GXGB 4GDLB 3Q3JA 4TKNA 2LRWA 4KKIA 1QOGA 2DYOA 2W3RA 3ZRFA 3SDLC 2OHFA 4L1BA 3I9V1 1YX6B 4ZDVA 3VAWA 2LVPA 1L6UA 2JZ3B 4DBGA 3TBLD 1U4AA 1FEHA 3N3KB 4B9KA 2IYDB 4II3B 4ANVA 5AZHA 3DVNV 4AJWA 3L4PA 1V1PA 1E9MA 4IUMB 1FO4A 3W5UB 1K51A 4IC7B 1XF5L 2ZVOA 4BFRA 4FBJB 1Q1OA 2BWFA 1M94A 3ML9A 4NJ7A 2ZJDA 3DHIC 3VH4B 2VH1A 4BZAA 1JMLA 2K8HA 4ZHPA 3HK0A 3ZTCA 3QARA 4XWTA 4KKJA 2KK8A 3WAOA 2DZKA 2JYEA 4WQOB 2WHIA 2GRIA 2BBCA 2G9HD 2J0MA 4LK0M 2WXOA 2D10A 1AARA 4KDLB 2OJWA 1IYFA 2EMTA 1XXGA 2PVGC 2KKCA 1WXVA 1DOYA 4WJQA 3V61A 2KWVB 5H8YE 1WZ3A 4P16A 1FIQA 5EE0A 1V1PB 2PPHA 4M0WA 4HROA 1AN8A 1WGYA 1WM2A 3B9JA 1SF0A 4K1RB 3BYTB 3AMZA 4W9KA 3QQ8B 3AE2B 3AE6B 2BS4B 2VZKB 3ZNID 2WWZA 2GI9A 1QOBA 4KGRA 4B0MA 3ZKJC 2KC2A 1EUVB 3WAMA 3W1SA 4ICUA 1L4ZB 4FHJA 2Z59B 3VTUA 2WLBA 4YTPB 2VZKD 4NAWA 4AWJA 4JGHB 2KDBA 1ESFA 3AEDB 3V05A 2IDYA 3OJ4B 4BOZB 2NPTA 4EUTA 4M0WB 1HZ6A 4JIOU 1SBBB 2IO1B 2WXGA 3VRAB 5KHOA 3NG0A 1P7EA 2CKHB 2M0XA 1OEYA 3JSVA 1V86A 2GLSA 1P3QU 1T0YA 3PRMB 3RNAC 3ENEA 3GZNI 3URYA 2BVCA 2QCZA 1LGRA 2B76B 4KX6B 3APDA 1WR6E 1ZOYB 3MTNB 2AQ2B 2E3TA 4OZCA 2CJNA 2BB5A 3SFEB 1V80A 1WE6A 3KUDB 4FJZA 1PGAA 3PZ7A 2WXRA 4RCOA 1ZPSA 1GJZA 4NAWB 3M63B 3NVWA 2W55A 3L10B 3WIMA 2SAKA 2NPTB 2ZPYA 4ACFA 5IO9A 4EZKA 1IBXA 2Z0EB 2IZVB 3DVGX 1JW9D 2BKRB 4KGSA 3JSVB 4B0EA 2QEJC 1KRHA 2CU3A 4BAXA 4CO7A 3WAPA 1M4VA 1H8CA 4CYEA 2V3NA 3RNCC 3W1YA 1R7SA 1BUIC 1NVID 2L0TA 1BXTA 2N4FA 2KX0A 4MGZE 4HK2A 2N1WA 3VQIA 4E74A 1F2RI 2L0FA 3IAS1 2LJIA 2MBQA 2CS4A 1MVKA 3B2GA 5E6PA 3PHXB 4TQ1A 2W3SA 1EWYC 3ZUNA 1IBXB 3QWZB 1FCLA 1ISNA 1HTOA 2KWDA 3Q8FA 4IDIA 1TY0A 2D2QA 1YJ1A 2KN4A 1HE8A 3HRDD 3H6NA 3VTWA 2JPHA 4MSQB 1J0GA 3BVZA 1FM0D 3PTFC 2RGFA 2XN9C 2QILA 1TZOA 1GG3A 3CIRB 2YEPF 3GE8C 4LCDE 4HDQA 1KJTA 1VCBA 2LVQA 4FA6A 3DHGC 1VZ7A 1RRBA 4F1SA 4DHZB 4GU2A 2LHDA 3VR8B 1YOVB 4K3CA 4EE2A 2KFJA 2WP9B 1RLFA 2JRIB 2N1VA 4ITKA 3ZDTA 3Q3MC 2MW5A 2MH7A 1E90A 3BZDB 2LVOA 3AULA 2MWSB 2M17A 4NQLB 2KMMA 2KMCA 2BT6A 3RPFC 1SIFA 2DWQA 1DGJA 2M19A 1TS4A 2EMSA 1D3ZA 2H88B 4HKZE 5JH5C 3E56A 2IY1B 2KWUB 2ZVNA 3Q2AC 2PEAA 4MACA 3IG3A 2C7MB 1C1YB 2LD9A 1L2NA 5CHVC 2AWTA 5I4DA 4M02A 3AE7B 1X1MA 2BS3B 4O1NA 3DQVA 3A4RA 2HJ1A 3CWIA 5D6JB 1WMHA 3EFCA 5GMVA 1HZ5A 4ZRQA 3L0WB 2PMVA 2IBIB 1J8CA 1SJED 1L0YB 4YTNB 1C3TA 3NY5A 2FAZA 4EOYA 2L05A 4ZRPA 4RM8A 1C79A 2INNE 4USAA 5IAAC 1JCKB 2IJ0A 1PGBA 2KDMA 2PE6B 3P42A 2PKOA 1LM8B 4KZ0A 3KLSX 3GZNB 1FNVA 4MDKE 4BOSC 4YT0B 1EF5A 5EDSA 1FPYA 3OJ3A 2N0SB 2JRHA 2KDFB 2KAJA 4MEMA 1TTNA 1T0QC 1VZ8A 4N6EB 4M8NA 2WX0A 3IFWB 3NS1A 1WMHB 1TJEA 2RD0A 5KHQA 1E10A 1IGCA 4DXAB 4WAFA 2ACZB 2WXKA 5FK9C 2WX1A 3NZUA 1YQBA 3OAWA 3LB8C 2G3QB 2D11A 4WJNA 2INCC 2NR2A 1UNSA 3KW5B 2I1KA 5BO4B 1ZXHA 4MELA 3BIID 1YN4A 1KM7A 1S1QB 3NZ3A 2KJHB 5D3DA 1N5XA 2HE7A 4CHKA 2D3GA 1WJNA 5EE3A 4A3OA 2KQ7A 4REZA 1ZGUB 4ZOHC 1JQ4A 2KDIA 2QHOA 1KLGD 3I57A 3ML8A 3PVLA 3AXCA 1XO3A 5H92C 1WXMA 4GGQA 2N9EB 2INDC 3EA6A 4NY0A 1FXIA 3FKYA 4YSZB 4HJKA 2J7QB 1UD7A 4RMAA 3HVDA 3AV8A 1XCQL 4AS1A 4B95A 3BYYB 2REXA 2W82A 1WJUA 3FAHA 2WXPA 4P6VF 3Q8CA 1OQQA 3QX1A 3U7DA 3B2FA 4GMVA 1WE7A 5HHDG 2ASQA 3PSEB 3AE3B 1WXAA 3RMKC 5E6JA 2BF8B 2BS2B 4EZJA 1TBEA 1YJIA 2W9NA 4G11A 3UF8A 2JSVX 3W5VB 2L3ZA 3A9KA 4ARCA 3DVGY 4C56C 2JQRB 3Q69A 1E0ZA 3ZJUA 2FCNA 3GOEA 4UDUC 1STEA 2KO3A 2D07B 1SE4A 2NVUI 2KOXA 4ARIA 1WGRA 4IM3A 4XGAB 3VVWB 4RH6A 2YVCA 1VR9A 1TY2A 4KDIC 3L54A 2BYVE 3ZNHB 1GB4A 2L32A 2KACA 4PK1A 3IHPC 4AJYB 2PTLA 2O6VD 1MHHE 2ZW0A 4K7UA 4XDDA 4EEWA 3P4RB 2PIAA 3AECB 5BYRA 4RM9A 1JALA 3NVVA 3U7ZA 1LQBA 3ZYYX 2MBEA 4NNJB 1CK1A 1ACCA 3TCAA 3AI5A 4M00A 3P63A 1WIAA 2I2YA 1EWCA 3B1LX 4XYCA 2DENB 1L5PA 3A9KB 2V1YA 1PDXA 4MH0E 1WFYA 3ETRA 1WY8A 2MLBA 3Q8EA 3KVFB 3UINB 1ZUD2 2V0GA 2R2QA 3SU8X 3V6CB 3BK1A 2DHZA 3X0WA 2KN5A 1Z2MA 2QJLA 3Q3OC 1YQ3B 1V8CA 1IP9A 3PREA 1UWMA 1L7YA 1WGDA 1EO6A 3Q14C 1K8RB 4DXFA 4ASWC 1EU4A 4E3CA 2KJ6A 3AU5A 3C0RB 2D3BA 2MBHA 3RNFC 2L52A 1GNUA 2V3PA 2KVZA 1P0RA 1FMAD 3U30A 4KSKC 2WXNA 4WURA 3KUCB 2MCNB 2J0JA 1UH6A 4RNAA 1XLQA 2EKIA 3O13A 3VTVA 1YNTE 3A1QA 4ICVA 3IVFA 3QK0A 2LGXA 4DDID 2LI5A 5EE1A 2PLPA 5L83A 1E6EB 1A70A 3QC8B 4MGYE 1MJDA 1WXSA 3NHEB 5FKAC 4IWPA 1WJ4A 1KLUD 2C5LC 2K9XA 4CQNA 5L95C 2DYBA 1I4GA 4LNNA 4Q2JA 4PS7A 2KQSA 4HEA1 3NUHB 3NOBA 2AYOB 2WGSA 3A9JA 4HWIB 1L6VA 3R2IA 1NBFC 2K6QA 4C7YA 1TGZB 3K9PB 4KSLC 2NMQA 4PS8A 3UQAA 3W2DA 2BKFA 2C60A 1MG8A 1NDDA 4YL8A 4LNOA 3MC8A 1YX5B 3A1QB 3IBEA 3PS6A 3H7PA 2G4DB 1XLNA 3MJ5A 1MHXA 2CJOA 2WNMA 4DHZE 1V97A 2LMCA 2XK5A 2NBWB 4JX1C 2AQ1B 1F2RC 2ON8A 4BVUC 2KWCA 2BB6A 1QILA 2K1FA 4KIKA 4A9AA 2ZCCA 4A3PA 2NTSA 1UGMA 2J0KA 1F1HA 3A9JB 4WWOA 4PYZA 4L23A 1UBIA 4JWSC 5JZEB 4TQ0A 2AQ3B 2MP2A 3W9CB 3SR6A 1V1OA 2L83A 4EFOA 3PRPB 3V3XA 4W9LA 1UGJA 2N9PC 1PGXA 3H7PB 2KZRA 4PT5A 1H4RA 2KC1A 4G50A 5J17A 5HKHA 3AEEB 3DBHB 3PZDA 4LDTB 3WCQA 1F9JA 1B9RA 2XK5B 4A20A 2KLGA 2AL3A 3BWUD 5DPSA 4L2YA 4KIKB 3GE3C 1KTKA 1GOZA 1EM7A 4BKGA 4DDGD 3AEGB 1XCTL 2BYTA 2RDBC 4LDTD 1QT9A 2VH2A 1SB3C 3JYUA 2AX5A 2INPE 4GB9A 3TEXA 1Z5SB 2MP2B 5AZGA 2GBNA 1ET9A 3HM3A 2ZCBA 1HA5A 3PZ8A 1AYFA 4F7ZA 2K8BA 2WXMA 4EZLA 1ZXIA 2CHWA 1OGWA 3O65B 1TT5B 1C4CA 3JVZX 5BMGA 4D2KA 1ZDVA 2GBRA 3I3TB 5MPOA 1E8WA 2M8SA 2K0PA 3OG5A 5G5GA 1E8YA 2D3CA 2G1EA 3AE4B 3VDZA 4W9IA 4C4VA 3DWGC 4JLCA 4JQWC 5LLIA 2GBMA 2JF5A 3U2SC 4W9CA 1WWTA 2J42A 4GSWA 4I6LB 1XT9B 4WWMA 5DPTA 1JWSD 1ZKHA 3TL5A 3MHZA 3ZRCA 2RR9A 2Q5WD 3FILA 3MFGA 4LNFA 5BYQA 1T0RC 3N32A 1V5OA 1AW7A 5AUKA 1UUPA 2K3UA 3APFA 2GOWA 1SJHD 5D94A 2MSED 3P2BA 4G3XB 4ANWA 2DYMA 3KWLA 3RZFA 3Q3FA 2N7JA 5HI1A 4WIPA 1UWXA 1WRDB 4AQ7A 2OJRA 4FJVB 2GBKA 5TSSA 3BVGA 4C4VB 4R3DA 3APCA 1GC6A 5IKCM 2JXXA 2YLMA 3EFUA 1WRIA 2LEKA 2EELA 4NQKE 3V60A 2YEPB 5FR6A 2FUG1 2LHEA 3KUZA 1FD6A 3ZXRA 3PLUA 2C7HA 3N1XC 3N30A 2BQQA 2C9WB 4LLGM 3LJ3A 4US8A 3FILB 3IT6B 2RSUA 1KH0A 2N7DA 3A4SC 2MJDA 1XD3B 2E6XA 4W9GA 1L0XB 3Q6BA 3QAQA 2KANA 1T0SC 1JRPA 2LFIA 1QLBB 3P4PB 3UQBA 5C3JB 3NS8A 1WYGA 2MJEA 1XEEA 1LFDA 3DPDA 1FXAA 3UIPB 2LRUA 2GBJA 2UYZB 3VFKA 1NENB 3IAM1 3CF6E 5T8IA 2XNAC 5D2MB 2FCMA 2L76A 1E8ZA 1HXYD 3A33B 5DCNA 1OTRB 2Z0DB 2IGGA 3PO0A 5JHBA 2ZW1A 5AUIA 2D3AA 2FUHB 2PE9A 4JPSA 4HPMB 3PT2B 2BYFA 2KHWB 3KYCD 4HXDA 4ZRIA 2Y5BB 2WU2B 4M01A 4M8MA 4RGTA 1WI0A 1FCCC 3VHTC 5IN7A 1WZ0A 1SGHA 3DDCB 1L0VB 1R4NI 3KH0A 3CSFA 3AEFB 1YN5A 2CR5A 3UIOB 3EUB2 5BYSA 2KXJA 1TYGB 2KNBA 4IM0A 2SEBD 1VDVA 4NZLB 2D5GA 1I7HA 2M4NA 1KLVA 1PQSA 3GP7A 2Z8LA 4WWNA 2FIDA 3RZWC 1K53A 2A4ZA 1SE3A 1YD8U 1R4MI 4LJPB 1E7UA 4WWPA 5C23A 2OEDA 4EKUA 2WYQA 2DAJA 4KV2A 4LNKA 4XC2A 3TJPA 3RFZB 3QA8A 1BT0A 1YN3A 3ABVB 4OVZA 4K3BA 1RAXA 2R2OA 1D5XC 3ECIA 2L00B 4HDOA 4ZYNA 2I1JA 1N5WA 2O6VA 3NZSA 1ENFA 4J6IA 3RI7C 3U4EG 1TS2A 4WJOA 2K6DB 1JWUD 2KFKA 1QQRA 3WALA 5FR3A 4NAMA 2WDVB 1WSPA 4LTUA 2N9KA 4MM3A 4RGOS 1C78A 2HJ8A 2LXCA 2PVOD 1NEKB 3E9SA 2JU6X 1YIWA 4OVUA 3PLVA 1Q5WB 4RGMA 4N9F4 4W9EA 3PV1A 2WXHA 4YTMB 3PGEA 4A6QA 3H1UA 4FULA 4OW0A 2M1MA 5E6OA 4IW0A 3QJZA 2WXIA 1JWAD 2VRRB 1V49A 3N1YC 1OFFA 1Q0WB 2O6VB 3D32A 2N9XA 4NJCA 3VRBB 1P7FA 2IO3B 3PHWB 2KFKB 2DZIA 3TEYA 4HLEA 3OLMD 4MM3B 2ZZPB 1FXTB 3M62B 3VUWA 1KOTA 5C1ZA 1I4QA 1V9JA 1N61A 1E8XA 3U8ZA 3MC0B 5G55A 1AWDA 5G5HA 4US9A 3HIZA 3P4QB 4X57B 3Q8AA 4YWGG 2LWPA 3DBSA 3MC9A 1PFDA 1MG4A 4FADA 1GAQB 2NBUA 3H7SA 1F77A 2PW9A 3PRZA 2WDQB 3H9DA 2XEWA 1RYJA 1KF6B 3B08A 1BMLC 2NBVB 3BVMA 1IPGA 3JW0X 4AOFA 2DAFA 2Y5CA 2BGFA 2WXFA 4RF1A 2MQJA 1Y8RC 4W9HA
chains in the Genus database with same CATH topology
3GE8C 3RNEC 1T0QC 3RNGC 3DHIC 3Q3MC 3N20C 3RN9C 3Q14C 3N1XC 3RNAC 3DHGC 3I5JC 3GE3C 3Q2AC 2INDC 3N1YC 3N1ZC 3DHHC 3Q3NC 4P1CC 1T0RC 3RMKC 3RNCC 3RI7C 2RDBC 3RNFC 3I63C 3Q3OC 1T0SC 3RNBC 2INCC 4P1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE8 C;  3RNE C;  1T0Q C;  3RNG C;  3DHI C;  3Q3M C;  3N20 C;  3RN9 C;  3Q14 C;  3N1X C;  3RNA C;  3DHG C;  3I5J C;  3GE3 C;  3Q2A C;  2IND C;  3N1Y C;  3N1Z C;  3DHH C;  3Q3N C;  4P1C C;  1T0R C;  3RMK C;  3RNC C;  3RI7 C;  2RDB C;  3RNF C;  3I63 C;  3Q3O C;  1T0S C;  3RNB C;  2INC C;  4P1B C; 
#chains in the Genus database with same CATH topology
 4DHJ B;  3TMP B;  4QAY A;  2O2V A;  4A8X C;  2UWQ A;  4HVB A;  2IGH A;  1DOI A;  3R7Q A;  4GLS C;  1WR1 A;  4KVG B;  3TEZ A;  1C4A A;  1NYR A;  4XZ4 A;  1IGD A;  2BTE A;  1FRR A;  3ZQ4 A;  5J18 A;  4DHJ D;  2KLC A;  5BMH A;  3ZDM C;  1Q10 A;  5DPW A;  4NPN A;  3SEB A;  1D5M C;  1I35 A;  3DVN U;  2ZNV B;  3K9O B;  2MBO A;  3VUY A;  5EE9 A;  1CJE A;  3RD2 A;  3Q8B A;  1NI3 A;  3V62 A;  2K22 A;  1R4N B;  2JUO A;  2PJH A;  2M0A A;  5TR5 A;  2O2V B;  4BKT A;  3CST A;  3ZXV A;  1MI0 A;  4NJ6 A;  5LXI B;  1WH3 A;  2QSD A;  1NI2 A;  5J2R A;  2NS5 A;  2A5U A;  1KFY B;  4GIV A;  3UGB B;  5HFY A;  1LO5 D;  3FC4 A;  4IM2 A;  4KGT A;  3PPA A;  2K39 A;  2K5P A;  5IOI A;  2HTM E;  4OZA A;  4KZC A;  1R4M B;  1VLB A;  3U52 E;  1K52 A;  2MHJ A;  1GUA B;  5CTR C;  4A90 A;  1G6J A;  1OQY A;  3V6E B;  2FCS A;  2KX3 A;  2J4X A;  2UU7 A;  2J52 A;  4HJG E;  3H8H A;  2Y3A A;  3Q3N C;  4P1C C;  2HTH A;  4HPP A;  3X23 A;  2R61 A;  3KWV A;  4YSY B;  3ZGZ A;  1C4P A;  3ONS A;  2KMA A;  2V9H A;  1WGH A;  1MPE A;  1OQR A;  4LJO B;  1CQV A;  2WDT B;  2HDE A;  2LZ6 A;  1E5W A;  1FRD A;  1QF6 A;  2V3S A;  5D3I B;  1WXQ A;  4DK5 A;  2G45 B;  4P7I A;  5HG2 A;  1F0Z A;  2IO0 B;  4YXD B;  4HKQ A;  1WYW B;  1SIJ A;  1MFW A;  4K81 A;  1N6Z A;  1QKZ A;  2BW2 A;  4WJP A;  1P9D U;  2DX5 B;  3VXW A;  3RN9 C;  1LXD A;  2DBY A;  1ZP0 B;  5D7G A;  1I4P A;  1JRU A;  1FFU A;  1ET6 A;  1Y56 A;  5AZF A;  3ZVV A;  2HD5 B;  2KDE B;  4A55 A;  1ZDX A;  1UZX B;  4II2 B;  4IWQ A;  3I63 C;  3TIX A;  1PYW D;  1QOF A;  4MSM B;  2KVR A;  3ZNZ B;  1YMH E;  4IOI E;  1N60 A;  3QIJ A;  2KTF A;  2EKE C;  2KT7 A;  2KQ4 X;  2WXL A;  4FLH A;  1WGK A;  3RUI B;  2JT4 B;  1V2Y A;  3RT3 B;  3P4S B;  4HRS A;  2MEK A;  5C2T B;  3HVZ A;  1JRO A;  1WX7 A;  1OEY J;  3RUL A;  3DCG A;  2LXA A;  2KJR A;  3J9C A;  2WXJ A;  2QMT A;  1HEZ E;  4ANU A;  5IP4 D;  2JZP A;  4BBN F;  1XQQ A;  4TUU A;  1I4H A;  4W9D A;  1TKG A;  2GB1 A;  4DXG A;  1K50 A;  3L16 A;  4F8C B;  2J53 A;  2MA9 B;  1WX9 A;  3RNE C;  4HCN B;  3N20 C;  3LDZ E;  1WGG A;  3DBR I;  1EF1 A;  3KQ4 A;  4LNI A;  3NVY A;  3SFD B;  3EC8 A;  1F52 A;  4FJY A;  2L8J A;  3DHH C;  3MJW A;  2DLB A;  3M95 A;  4C80 A;  2FBW B;  3DBL I;  4MGI E;  3T3O A;  2B3A A;  5AEK B;  2MBB B;  4FHK A;  3R66 C;  5DPR A;  1FNW A;  1SE9 A;  1CMX B;  5BMI A;  2LGD A;  1V5T A;  4OHJ A;  4DQO C;  2DZM A;  4E71 A;  4MT5 A;  5JXV A;  2ONQ A;  3HUI A;  2WDR B;  3IT4 B;  3UI3 A;  3B0A A;  3T9L A;  3MHS D;  1WF9 A;  3C19 A;  3HHM A;  1XLP A;  2K8C A;  3C8Y A;  4FXC A;  1E7P B;  2W54 A;  1JWM D;  3S2A A;  3TEW A;  5LNK 1;  3BIN A;  4K7W A;  4HPL B;  4C7Z A;  3P1M A;  1B1Z A;  4YSX B;  3LXF A;  1D4B A;  3VH3 B;  3HM6 X;  3N1Z C;  5CHF A;  1SEB D;  2IO2 B;  2ZNV C;  3T3N A;  2LUM A;  2CHZ A;  5LXH A;  1VD2 A;  1VJK A;  2FIF A;  1RWS A;  1WX8 A;  2N7E A;  1PUT A;  1TIF A;  1UBQ A;  1RFA A;  3QCA A;  2FNJ B;  3AEB B;  4DWF A;  4TMA B;  1SE2 A;  1YJJ A;  4WAA A;  1C76 A;  4C00 A;  3GS2 A;  1P98 A;  1C9F A;  1TS5 A;  3ZJT A;  1JWB D;  3SD5 A;  2RPV A;  2FE8 A;  3AE8 B;  4W9F A;  2DNF A;  2X38 A;  3AB5 A;  4S0R A;  4N58 A;  2I38 A;  4WH4 A;  4JE3 B;  3ZLZ A;  3ZIM A;  4OZB A;  3RNB C;  3VR9 B;  4AUQ C;  3AH7 A;  2H89 B;  2JWU A;  3TSS A;  2RPQ A;  1J7A A;  3VUX A;  2WQY B;  1NYQ A;  2LJ5 A;  4GN1 A;  4XE0 A;  3ZO5 B;  2AL6 A;  1EU3 A;  2ICI A;  1S3S G;  4GDK A;  3WA0 A;  2BPS A;  2LGY A;  3AE9 B;  3NRZ A;  3AEA B;  3BY4 B;  2BWE S;  4HCP B;  4XX5 A;  4I6N B;  1I4X A;  2M56 B;  2KTR A;  1CZP A;  2AEH A;  4IKG A;  3MP9 A;  3T8M A;  1J19 A;  2MJ3 A;  3LYY A;  3R8B A;  3BK2 A;  3EEC A;  1GC7 A;  1RFK A;  3WAN A;  3QHT A;  4ZRJ A;  1GB1 A;  1TKY A;  2WU5 B;  3RNG C;  3SHQ A;  2IY0 B;  4XDC A;  1VRA B;  2X8X X;  1E7V A;  2V4L A;  2OOB B;  1TS3 A;  2NTT A;  3RYT A;  4MGK E;  2RMM A;  3EGR A;  4TV3 A;  3NVZ A;  4GDK B;  4I6P A;  2MRP A;  2QC8 A;  5CX3 A;  4RFB A;  4S17 A;  4BKS A;  2WS3 B;  4XWW A;  3W1S C;  3ZNG C;  3R7R A;  1DOX A;  1GPX A;  1V6E A;  1RM6 C;  4RF0 A;  2IPK D;  2KTR B;  3L17 A;  1C77 A;  2BYE A;  3AE5 B;  4RGN A;  2QIE B;  3N9Y C;  5E6N A;  4IG7 B;  3M3J A;  4ZHO A;  1TKE A;  2JYT A;  1UF0 A;  3L08 A;  2QDF A;  1SSN A;  2NCN A;  4K7S A;  1VZ6 A;  2N9L A;  5IA7 A;  1T5X D;  2JXT A;  2CU1 A;  1QZE A;  1DYQ A;  3R3M A;  3RCZ A;  1J7C A;  1ZE3 D;  2LGS A;  3AN1 A;  1N62 A;  2LAS A;  4TSS A;  1TZ1 A;  4MJS A;  1FFV A;  4JWU C;  3DWM A;  4G0N B;  2XBB C;  4WQM A;  4GXB A;  3DBR B;  1FNU A;  2KD0 A;  3ZW3 A;  1WJ6 A;  4PS3 A;  3DOW A;  1T6B X;  1V81 A;  3L13 A;  3I5J C;  4H2A A;  4FN2 A;  1D6E C;  2Y5P A;  3AM9 A;  1D5Z C;  3DBL B;  2GMI C;  2WXQ A;  1UEL A;  4MH8 A;  4BKS D;  1WM3 A;  2RDH A;  4IWO A;  3EHV A;  4ZRK A;  3OWE B;  2KYW A;  2CHX A;  2MX2 A;  1IUE A;  1I4R A;  4OVV A;  2LUE A;  2JVC A;  4GDL A;  4BBN C;  2LGI A;  1T3Q A;  4MJS B;  1ROE A;  4JL9 A;  2L1A A;  3CMM B;  1I42 A;  3AE1 B;  5CHW A;  3GB1 A;  1A5R A;  3ZJV A;  3KYD D;  4B6W A;  1L4D B;  4P1B C;  2G4S A;  4URK A;  3ALB A;  4ZYS A;  2ZEQ A;  3DBH I;  3TUO A;  1XLO A;  2ZPN A;  4J3O D;  2JWZ A;  1N63 A;  3IXS A;  2FCQ A;  2K25 A;  2JY6 A;  1HTQ A;  4ANX A;  1SXT A;  1QOA A;  3R2T A;  2TSS A;  2IGD A;  2V4I B;  4N59 A;  5JHA A;  2JX5 A;  2JZZ A;  2L7R A;  4W9J A;  4PYU A;  4AP4 C;  1YQ4 B;  2RDG A;  5G2N A;  1J7B A;  3ZTD A;  2DZJ A;  1P1A A;  3NJT A;  3AU4 A;  4GOC A;  1ZW7 A;  1HQR D;  2C7N B;  5GXG B;  4GDL B;  3Q3J A;  4TKN A;  2LRW A;  4KKI A;  1QOG A;  2DYO A;  2W3R A;  3ZRF A;  3SDL C;  2OHF A;  4L1B A;  3I9V 1;  1YX6 B;  4ZDV A;  3VAW A;  2LVP A;  1L6U A;  2JZ3 B;  4DBG A;  3TBL D;  1U4A A;  1FEH A;  3N3K B;  4B9K A;  2IYD B;  4II3 B;  4ANV A;  5AZH A;  3DVN V;  4AJW A;  3L4P A;  1V1P A;  1E9M A;  4IUM B;  1FO4 A;  3W5U B;  1K51 A;  4IC7 B;  1XF5 L;  2ZVO A;  4BFR A;  4FBJ B;  1Q1O A;  2BWF A;  1M94 A;  3ML9 A;  4NJ7 A;  2ZJD A;  3DHI C;  3VH4 B;  2VH1 A;  4BZA A;  1JML A;  2K8H A;  4ZHP A;  3HK0 A;  3ZTC A;  3QAR A;  4XWT A;  4KKJ A;  2KK8 A;  3WAO A;  2DZK A;  2JYE A;  4WQO B;  2WHI A;  2GRI A;  2BBC A;  2G9H D;  2J0M A;  4LK0 M;  2WXO A;  2D10 A;  1AAR A;  4KDL B;  2OJW A;  1IYF A;  2EMT A;  1XXG A;  2PVG C;  2KKC A;  1WXV A;  1DOY A;  4WJQ A;  3V61 A;  2KWV B;  5H8Y E;  1WZ3 A;  4P16 A;  1FIQ A;  5EE0 A;  1V1P B;  2PPH A;  4M0W A;  4HRO A;  1AN8 A;  1WGY A;  1WM2 A;  3B9J A;  1SF0 A;  4K1R B;  3BYT B;  3AMZ A;  4W9K A;  3QQ8 B;  3AE2 B;  3AE6 B;  2BS4 B;  2VZK B;  3ZNI D;  2WWZ A;  2GI9 A;  1QOB A;  4KGR A;  4B0M A;  3ZKJ C;  2KC2 A;  1EUV B;  3WAM A;  3W1S A;  4ICU A;  1L4Z B;  4FHJ A;  2Z59 B;  3VTU A;  2WLB A;  4YTP B;  2VZK D;  4NAW A;  4AWJ A;  4JGH B;  2KDB A;  1ESF A;  3AED B;  3V05 A;  2IDY A;  3OJ4 B;  4BOZ B;  2NPT A;  4EUT A;  4M0W B;  1HZ6 A;  4JIO U;  1SBB B;  2IO1 B;  2WXG A;  3VRA B;  5KHO A;  3NG0 A;  1P7E A;  2CKH B;  2M0X A;  1OEY A;  3JSV A;  1V86 A;  2GLS A;  1P3Q U;  1T0Y A;  3PRM B;  3RNA C;  3ENE A;  3GZN I;  3URY A;  2BVC A;  2QCZ A;  1LGR A;  2B76 B;  4KX6 B;  3APD A;  1WR6 E;  1ZOY B;  3MTN B;  2AQ2 B;  2E3T A;  4OZC A;  2CJN A;  2BB5 A;  3SFE B;  1V80 A;  1WE6 A;  3KUD B;  4FJZ A;  1PGA A;  3PZ7 A;  2WXR A;  4RCO A;  1ZPS A;  1GJZ A;  4NAW B;  3M63 B;  3NVW A;  2W55 A;  3L10 B;  3WIM A;  2SAK A;  2NPT B;  2ZPY A;  4ACF A;  5IO9 A;  4EZK A;  1IBX A;  2Z0E B;  2IZV B;  3DVG X;  1JW9 D;  2BKR B;  4KGS A;  3JSV B;  4B0E A;  2QEJ C;  1KRH A;  2CU3 A;  4BAX A;  4CO7 A;  3WAP A;  1M4V A;  1H8C A;  4CYE A;  2V3N A;  3RNC C;  3W1Y A;  1R7S A;  1BUI C;  1NVI D;  2L0T A;  1BXT A;  2N4F A;  2KX0 A;  4MGZ E;  4HK2 A;  2N1W A;  3VQI A;  4E74 A;  1F2R I;  2L0F A;  3IAS 1;  2LJI A;  2MBQ A;  2CS4 A;  1MVK A;  3B2G A;  5E6P A;  3PHX B;  4TQ1 A;  2W3S A;  1EWY C;  3ZUN A;  1IBX B;  3QWZ B;  1FCL A;  1ISN A;  1HTO A;  2KWD A;  3Q8F A;  4IDI A;  1TY0 A;  2D2Q A;  1YJ1 A;  2KN4 A;  1HE8 A;  3HRD D;  3H6N A;  3VTW A;  2JPH A;  4MSQ B;  1J0G A;  3BVZ A;  1FM0 D;  3PTF C;  2RGF A;  2XN9 C;  2QIL A;  1TZO A;  1GG3 A;  3CIR B;  2YEP F;  3GE8 C;  4LCD E;  4HDQ A;  1KJT A;  1VCB A;  2LVQ A;  4FA6 A;  3DHG C;  1VZ7 A;  1RRB A;  4F1S A;  4DHZ B;  4GU2 A;  2LHD A;  3VR8 B;  1YOV B;  4K3C A;  4EE2 A;  2KFJ A;  2WP9 B;  1RLF A;  2JRI B;  2N1V A;  4ITK A;  3ZDT A;  3Q3M C;  2MW5 A;  2MH7 A;  1E90 A;  3BZD B;  2LVO A;  3AUL A;  2MWS B;  2M17 A;  4NQL B;  2KMM A;  2KMC A;  2BT6 A;  3RPF C;  1SIF A;  2DWQ A;  1DGJ A;  2M19 A;  1TS4 A;  2EMS A;  1D3Z A;  2H88 B;  4HKZ E;  5JH5 C;  3E56 A;  2IY1 B;  2KWU B;  2ZVN A;  3Q2A C;  2PEA A;  4MAC A;  3IG3 A;  2C7M B;  1C1Y B;  2LD9 A;  1L2N A;  5CHV C;  2AWT A;  5I4D A;  4M02 A;  3AE7 B;  1X1M A;  2BS3 B;  4O1N A;  3DQV A;  3A4R A;  2HJ1 A;  3CWI A;  5D6J B;  1WMH A;  3EFC A;  5GMV A;  1HZ5 A;  4ZRQ A;  3L0W B;  2PMV A;  2IBI B;  1J8C A;  1SJE D;  1L0Y B;  4YTN B;  1C3T A;  3NY5 A;  2FAZ A;  4EOY A;  2L05 A;  4ZRP A;  4RM8 A;  1C79 A;  2INN E;  4USA A;  5IAA C;  1JCK B;  2IJ0 A;  1PGB A;  2KDM A;  2PE6 B;  3P42 A;  2PKO A;  1LM8 B;  4KZ0 A;  3KLS X;  3GZN B;  1FNV A;  4MDK E;  4BOS C;  4YT0 B;  1EF5 A;  5EDS A;  1FPY A;  3OJ3 A;  2N0S B;  2JRH A;  2KDF B;  2KAJ A;  4MEM A;  1TTN A;  1T0Q C;  1VZ8 A;  4N6E B;  4M8N A;  2WX0 A;  3IFW B;  3NS1 A;  1WMH B;  1TJE A;  2RD0 A;  5KHQ A;  1E10 A;  1IGC A;  4DXA B;  4WAF A;  2ACZ B;  2WXK A;  5FK9 C;  2WX1 A;  3NZU A;  1YQB A;  3OAW A;  3LB8 C;  2G3Q B;  2D11 A;  4WJN A;  2INC C;  2NR2 A;  1UNS A;  3KW5 B;  2I1K A;  5BO4 B;  1ZXH A;  4MEL A;  3BII D;  1YN4 A;  1KM7 A;  1S1Q B;  3NZ3 A;  2KJH B;  5D3D A;  1N5X A;  2HE7 A;  4CHK A;  2D3G A;  1WJN A;  5EE3 A;  4A3O A;  2KQ7 A;  4REZ A;  1ZGU B;  4ZOH C;  1JQ4 A;  2KDI A;  2QHO A;  1KLG D;  3I57 A;  3ML8 A;  3PVL A;  3AXC A;  1XO3 A;  5H92 C;  1WXM A;  4GGQ A;  2N9E B;  2IND C;  3EA6 A;  4NY0 A;  1FXI A;  3FKY A;  4YSZ B;  4HJK A;  2J7Q B;  1UD7 A;  4RMA A;  3HVD A;  3AV8 A;  1XCQ L;  4AS1 A;  4B95 A;  3BYY B;  2REX A;  2W82 A;  1WJU A;  3FAH A;  2WXP A;  4P6V F;  3Q8C A;  1OQQ A;  3QX1 A;  3U7D A;  3B2F A;  4GMV A;  1WE7 A;  5HHD G;  2ASQ A;  3PSE B;  3AE3 B;  1WXA A;  3RMK C;  5E6J A;  2BF8 B;  2BS2 B;  4EZJ A;  1TBE A;  1YJI A;  2W9N A;  4G11 A;  3UF8 A;  2JSV X;  3W5V B;  2L3Z A;  3A9K A;  4ARC A;  3DVG Y;  4C56 C;  2JQR B;  3Q69 A;  1E0Z A;  3ZJU A;  2FCN A;  3GOE A;  4UDU C;  1STE A;  2KO3 A;  2D07 B;  1SE4 A;  2NVU I;  2KOX A;  4ARI A;  1WGR A;  4IM3 A;  4XGA B;  3VVW B;  4RH6 A;  2YVC A;  1VR9 A;  1TY2 A;  4KDI C;  3L54 A;  2BYV E;  3ZNH B;  1GB4 A;  2L32 A;  2KAC A;  4PK1 A;  3IHP C;  4AJY B;  2PTL A;  2O6V D;  1MHH E;  2ZW0 A;  4K7U A;  4XDD A;  4EEW A;  3P4R B;  2PIA A;  3AEC B;  5BYR A;  4RM9 A;  1JAL A;  3NVV A;  3U7Z A;  1LQB A;  3ZYY X;  2MBE A;  4NNJ B;  1CK1 A;  1ACC A;  3TCA A;  3AI5 A;  4M00 A;  3P63 A;  1WIA A;  2I2Y A;  1EWC A;  3B1L X;  4XYC A;  2DEN B;  1L5P A;  3A9K B;  2V1Y A;  1PDX A;  4MH0 E;  1WFY A;  3ETR A;  1WY8 A;  2MLB A;  3Q8E A;  3KVF B;  3UIN B;  1ZUD 2;  2V0G A;  2R2Q A;  3SU8 X;  3V6C B;  3BK1 A;  2DHZ A;  3X0W A;  2KN5 A;  1Z2M A;  2QJL A;  3Q3O C;  1YQ3 B;  1V8C A;  1IP9 A;  3PRE A;  1UWM A;  1L7Y A;  1WGD A;  1EO6 A;  3Q14 C;  1K8R B;  4DXF A;  4ASW C;  1EU4 A;  4E3C A;  2KJ6 A;  3AU5 A;  3C0R B;  2D3B A;  2MBH A;  3RNF C;  2L52 A;  1GNU A;  2V3P A;  2KVZ A;  1P0R A;  1FMA D;  3U30 A;  4KSK C;  2WXN A;  4WUR A;  3KUC B;  2MCN B;  2J0J A;  1UH6 A;  4RNA A;  1XLQ A;  2EKI A;  3O13 A;  3VTV A;  1YNT E;  3A1Q A;  4ICV A;  3IVF A;  3QK0 A;  2LGX A;  4DDI D;  2LI5 A;  5EE1 A;  2PLP A;  5L83 A;  1E6E B;  1A70 A;  3QC8 B;  4MGY E;  1MJD A;  1WXS A;  3NHE B;  5FKA C;  4IWP A;  1WJ4 A;  1KLU D;  2C5L C;  2K9X A;  4CQN A;  5L95 C;  2DYB A;  1I4G A;  4LNN A;  4Q2J A;  4PS7 A;  2KQS A;  4HEA 1;  3NUH B;  3NOB A;  2AYO B;  2WGS A;  3A9J A;  4HWI B;  1L6V A;  3R2I A;  1NBF C;  2K6Q A;  4C7Y A;  1TGZ B;  3K9P B;  4KSL C;  2NMQ A;  4PS8 A;  3UQA A;  3W2D A;  2BKF A;  2C60 A;  1MG8 A;  1NDD A;  4YL8 A;  4LNO A;  3MC8 A;  1YX5 B;  3A1Q B;  3IBE A;  3PS6 A;  3H7P A;  2G4D B;  1XLN A;  3MJ5 A;  1MHX A;  2CJO A;  2WNM A;  4DHZ E;  1V97 A;  2LMC A;  2XK5 A;  2NBW B;  4JX1 C;  2AQ1 B;  1F2R C;  2ON8 A;  4BVU C;  2KWC A;  2BB6 A;  1QIL A;  2K1F A;  4KIK A;  4A9A A;  2ZCC A;  4A3P A;  2NTS A;  1UGM A;  2J0K A;  1F1H A;  3A9J B;  4WWO A;  4PYZ A;  4L23 A;  1UBI A;  4JWS C;  5JZE B;  4TQ0 A;  2AQ3 B;  2MP2 A;  3W9C B;  3SR6 A;  1V1O A;  2L83 A;  4EFO A;  3PRP B;  3V3X A;  4W9L A;  1UGJ A;  2N9P C;  1PGX A;  3H7P B;  2KZR A;  4PT5 A;  1H4R A;  2KC1 A;  4G50 A;  5J17 A;  5HKH A;  3AEE B;  3DBH B;  3PZD A;  4LDT B;  3WCQ A;  1F9J A;  1B9R A;  2XK5 B;  4A20 A;  2KLG A;  2AL3 A;  3BWU D;  5DPS A;  4L2Y A;  4KIK B;  3GE3 C;  1KTK A;  1GOZ A;  1EM7 A;  4BKG A;  4DDG D;  3AEG B;  1XCT L;  2BYT A;  2RDB C;  4LDT D;  1QT9 A;  2VH2 A;  1SB3 C;  3JYU A;  2AX5 A;  2INP E;  4GB9 A;  3TEX A;  1Z5S B;  2MP2 B;  5AZG A;  2GBN A;  1ET9 A;  3HM3 A;  2ZCB A;  1HA5 A;  3PZ8 A;  1AYF A;  4F7Z A;  2K8B A;  2WXM A;  4EZL A;  1ZXI A;  2CHW A;  1OGW A;  3O65 B;  1TT5 B;  1C4C A;  3JVZ X;  5BMG A;  4D2K A;  1ZDV A;  2GBR A;  3I3T B;  5MPO A;  1E8W A;  2M8S A;  2K0P A;  3OG5 A;  5G5G A;  1E8Y A;  2D3C A;  2G1E A;  3AE4 B;  3VDZ A;  4W9I A;  4C4V A;  3DWG C;  4JLC A;  4JQW C;  5LLI A;  2GBM A;  2JF5 A;  3U2S C;  4W9C A;  1WWT A;  2J42 A;  4GSW A;  4I6L B;  1XT9 B;  4WWM A;  5DPT A;  1JWS D;  1ZKH A;  3TL5 A;  3MHZ A;  3ZRC A;  2RR9 A;  2Q5W D;  3FIL A;  3MFG A;  4LNF A;  5BYQ A;  1T0R C;  3N32 A;  1V5O A;  1AW7 A;  5AUK A;  1UUP A;  2K3U A;  3APF A;  2GOW A;  1SJH D;  5D94 A;  2MSE D;  3P2B A;  4G3X B;  4ANW A;  2DYM A;  3KWL A;  3RZF A;  3Q3F A;  2N7J A;  5HI1 A;  4WIP A;  1UWX A;  1WRD B;  4AQ7 A;  2OJR A;  4FJV B;  2GBK A;  5TSS A;  3BVG A;  4C4V B;  4R3D A;  3APC A;  1GC6 A;  5IKC M;  2JXX A;  2YLM A;  3EFU A;  1WRI A;  2LEK A;  2EEL A;  4NQK E;  3V60 A;  2YEP B;  5FR6 A;  2FUG 1;  2LHE A;  3KUZ A;  1FD6 A;  3ZXR A;  3PLU A;  2C7H A;  3N1X C;  3N30 A;  2BQQ A;  2C9W B;  4LLG M;  3LJ3 A;  4US8 A;  3FIL B;  3IT6 B;  2RSU A;  1KH0 A;  2N7D A;  3A4S C;  2MJD A;  1XD3 B;  2E6X A;  4W9G A;  1L0X B;  3Q6B A;  3QAQ A;  2KAN A;  1T0S C;  1JRP A;  2LFI A;  1QLB B;  3P4P B;  3UQB A;  5C3J B;  3NS8 A;  1WYG A;  2MJE A;  1XEE A;  1LFD A;  3DPD A;  1FXA A;  3UIP B;  2LRU A;  2GBJ A;  2UYZ B;  3VFK A;  1NEN B;  3IAM 1;  3CF6 E;  5T8I A;  2XNA C;  5D2M B;  2FCM A;  2L76 A;  1E8Z A;  1HXY D;  3A33 B;  5DCN A;  1OTR B;  2Z0D B;  2IGG A;  3PO0 A;  5JHB A;  2ZW1 A;  5AUI A;  2D3A A;  2FUH B;  2PE9 A;  4JPS A;  4HPM B;  3PT2 B;  2BYF A;  2KHW B;  3KYC D;  4HXD A;  4ZRI A;  2Y5B B;  2WU2 B;  4M01 A;  4M8M A;  4RGT A;  1WI0 A;  1FCC C;  3VHT C;  5IN7 A;  1WZ0 A;  1SGH A;  3DDC B;  1L0V B;  1R4N I;  3KH0 A;  3CSF A;  3AEF B;  1YN5 A;  2CR5 A;  3UIO B;  3EUB 2;  5BYS A;  2KXJ A;  1TYG B;  2KNB A;  4IM0 A;  2SEB D;  1VDV A;  4NZL B;  2D5G A;  1I7H A;  2M4N A;  1KLV A;  1PQS A;  3GP7 A;  2Z8L A;  4WWN A;  2FID A;  3RZW C;  1K53 A;  2A4Z A;  1SE3 A;  1YD8 U;  1R4M I;  4LJP B;  1E7U A;  4WWP A;  5C23 A;  2OED A;  4EKU A;  2WYQ A;  2DAJ A;  4KV2 A;  4LNK A;  4XC2 A;  3TJP A;  3RFZ B;  3QA8 A;  1BT0 A;  1YN3 A;  3ABV B;  4OVZ A;  4K3B A;  1RAX A;  2R2O A;  1D5X C;  3ECI A;  2L00 B;  4HDO A;  4ZYN A;  2I1J A;  1N5W A;  2O6V A;  3NZS A;  1ENF A;  4J6I A;  3RI7 C;  3U4E G;  1TS2 A;  4WJO A;  2K6D B;  1JWU D;  2KFK A;  1QQR A;  3WAL A;  5FR3 A;  4NAM A;  2WDV B;  1WSP A;  4LTU A;  2N9K A;  4MM3 A;  4RGO S;  1C78 A;  2HJ8 A;  2LXC A;  2PVO D;  1NEK B;  3E9S A;  2JU6 X;  1YIW A;  4OVU A;  3PLV A;  1Q5W B;  4RGM A;  4N9F 4;  4W9E A;  3PV1 A;  2WXH A;  4YTM B;  3PGE A;  4A6Q A;  3H1U A;  4FUL A;  4OW0 A;  2M1M A;  5E6O A;  4IW0 A;  3QJZ A;  2WXI A;  1JWA D;  2VRR B;  1V49 A;  3N1Y C;  1OFF A;  1Q0W B;  2O6V B;  3D32 A;  2N9X A;  4NJC A;  3VRB B;  1P7F A;  2IO3 B;  3PHW B;  2KFK B;  2DZI A;  3TEY A;  4HLE A;  3OLM D;  4MM3 B;  2ZZP B;  1FXT B;  3M62 B;  3VUW A;  1KOT A;  5C1Z A;  1I4Q A;  1V9J A;  1N61 A;  1E8X A;  3U8Z A;  3MC0 B;  5G55 A;  1AWD A;  5G5H A;  4US9 A;  3HIZ A;  3P4Q B;  4X57 B;  3Q8A A;  4YWG G;  2LWP A;  3DBS A;  3MC9 A;  1PFD A;  1MG4 A;  4FAD A;  1GAQ B;  2NBU A;  3H7S A;  1F77 A;  2PW9 A;  3PRZ A;  2WDQ B;  3H9D A;  2XEW A;  1RYJ A;  1KF6 B;  3B08 A;  1BML C;  2NBV B;  3BVM A;  1IPG A;  3JW0 X;  4AOF A;  2DAF A;  2Y5C A;  2BGF A;  2WXF A;  4RF1 A;  2MQJ A;  1Y8R C;  4W9H A; 
#chains in the Genus database with same CATH homology
 3GE8 C;  3RNE C;  1T0Q C;  3RNG C;  3DHI C;  3Q3M C;  3N20 C;  3RN9 C;  3Q14 C;  3N1X C;  3RNA C;  3DHG C;  3I5J C;  3GE3 C;  3Q2A C;  2IND C;  3N1Y C;  3N1Z C;  3DHH C;  3Q3N C;  4P1C C;  1T0R C;  3RMK C;  3RNC C;  3RI7 C;  2RDB C;  3RNF C;  3I63 C;  3Q3O C;  1T0S C;  3RNB C;  2INC C;  4P1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...