3Q14C

Toluene 4 monooxygenase hd complex with p-cresol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords PENTAETHYLENE GLYCOL
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q14C00
1T0QC 3RI7C 3Q2AC 1T0RC 3N1XC 3N1YC 3Q14C 3RNFC 3I5JC 4P1CC 3DHGC 3RNGC 2INCC 2RDBC 3N20C 3RNBC 3GE8C 4P1BC 3RNCC 3Q3NC 3DHHC 3RNEC 3GE3C 3N1ZC 3Q3MC 2INDC 3RN9C 3DHIC 3Q3OC 1T0SC 3RMKC 3I63C 3RNAC
chains in the Genus database with same CATH superfamily
1WGHA 1ZKHA 4FHJA 2IGHA 2LHDA 4MM3A 1XLPA 2N1VA 4WJQA 2N7DA 1OQYA 2WS3B 4BVUC 3ZKJC 1N5XA 3QHTA 1K52A 4WQOB 2QJLA 1WE6A 4B6WA 4AOFA 5JHBA 3VR9B 2DX5B 3WANA 4DXFA 3ZO5B 2OJRA 2M8SA 3W1YA 3AEFB 2K5PA 1V97A 3W9CB 1KLUD 3T3OA 1CZPA 3APDA 4NAWB 3ZRFA 1VZ7A 3C19A 3NVVA 3LDZE 3L08A 1FFUA 4J3OD 2WX1A 3PZ8A 3KYCD 1L7YA 2N9EB 2EMSA 3OWEB 4I6LB 3EECA 3WA0A 5KHOA 4I6NB 5HHDG 1QOGA 2MBQA 3WIMA 1VR9A 2D3CA 4WWMA 4ICUA 3PGEA 1YQ3B 2NCNA 3Q8AA 3P4PB 2WXIA 2LMCA 2IZVB 4L23A 2M17A 4P7IA 3EGRA 4XWTA 2LVOA 3A9JB 1TYGB 4NY0A 2KNBA 2V1YA 3GOEA 1UZXB 5LXHA 4FADA 2V0GA 2V4LA 4W9CA 2L0FA 1ISNA 2KJ6A 3EA6A 1NENB 2JRHA 3VVWB 2ZPYA 5EE1A 4YTMB 2KVZA 4C80A 4BKTA 1FEHA 1VD2A 4LJOB 1WR6E 4PT5A 5D6JB 2BF8B 1KJTA 3VTWA 4LDTB 1OGWA 2LGYA 3DBHI 3Q8BA 4MSMB 1UGJA 3OG5A 2KFKA 2REXA 2IO0B 2HTME 1R4MI 4HWIB 3PHWB 4ACFA 3HRDD 2MJ3A 3QA8A 1NI3A 3P4SB 2G3QB 2J42A 5BMGA 1AARA 2MA9B 4KGSA 2FE8A 2D3GA 4A3PA 3OJ4B 1VZ6A 2WU2B 1WJUA 5E6NA 2J7QB 1MPEA 1KF6B 1ZGUB 2DZJA 4IWOA 3IBEA 2D2QA 1EWYC 3DCGA 4TV3A 1F2RI 3X23A 3VHTC 2FCSA 4IM3A 1DOYA 3ZUNA 3W5VB 3T3NA 2KAJA 4FBJB 4FLHA 3DVGY 3Q2AC 2RDGA 1JW9D 2WX0A 4JQWC 3MC0B 3NHEB 1K53A 4S0RA 3TEZA 5GXGB 1UUPA 4LLGM 1JALA 3CIRB 2NBUA 3URYA 2X38A 4JGHB 2YVCA 4MT5A 2LEKA 4MGZE 2WXHA 4YSYB 3R2IA 5BO4B 1V8CA 5DCNA 3I3TB 3DHGC 4XWWA 3W1SC 5IN7A 4ANXA 3B08A 3L16A 2OEDA 2V4IB 1WGRA 2N0SB 3T8MA 4FJVB 2MX2A 3N1ZC 4GSWA 1G6JA 2UWQA 5AEKB 3ETRA 4HKZE 2CHXA 3IAM1 1BXTA 2WNMA 3ZTCA 3SD5A 3WCQA 4YXDB 4OW0A 5CHWA 3A9JA 3EFUA 1KH0A 4KZ0A 3V61A 3I9V1 2I38A 4HLEA 3ZDTA 3P1MA 2AYOB 4K7UA 2C60A 1FMAD 3NJTA 4W9JA 3AE8B 5GMVA 2O2VB 4KSLC 3TMPB 2FUG1 3CSTA 1CQVA 4CHKA 3IXSA 5TSSA 2LUEA 1Z5SB 1NYQA 1PDXA 4HKQA 2QC8A 1XCQL 4KKIA 2DNFA 1XT9B 2J0MA 3M62B 4NQLB 1IP9A 3Q3NC 3BK1A 3MC8A 5IP4D 4EZKA 3OAWA 5I4DA 5D3DA 4K81A 2KLCA 2D11A 4YTPB 2BS2B 1FM0D 1FIQA 2G45B 1YIWA 3RNFC 4DHZE 4O1NA 4ZDVA 2X8XX 4PS7A 2DAJA 3ZNID 2NTTA 1YJ1A 2FNJB 4E3CA 2O2VA 3IAS1 4A9AA 4C7ZA 1L0VB 4LNFA 1IBXB 2NPTA 3BK2A 1VLBA 1R4NI 3AM9A 2W9NA 2O6VD 2G4DB 2PPHA 3EFCA 1JQ4A 1CK1A 3U7ZA 2HD5B 3AXCA 4GB9A 4RFBA 1V6EA 2WDTB 2WXQA 4JIOU 4EE2A 2VZKB 3FKYA 1IGCA 1PGBA 3AEGB 1IUEA 3VQIA 2KVRA 4W9DA 2MBBB 1UBQA 3LB8C 3BY4B 1E0ZA 1WIAA 3V3XA 1B9RA 2LJ5A 5DPTA 2Y3AA 2PTLA 2WXGA 4DHZB 5EE0A 5DPWA 1WZ0A 3QAQA 3ZNHB 2BYEA 2WDRB 3JSVB 3X0WA 1AN8A 2N4FA 1J7BA 2IGGA 2C9WB 2MJDA 3AN1A 5HI1A 3RT3B 2J52A 4B0EA 4ARCA 4N9F4 5T8IA 4BKGA 4K7WA 3PT2B 1FXTB 3NVYA 2PE9A 2ONQA 2KTRB 5D3IB 1E8ZA 5JHAA 2JVCA 1WJ6A 4WWNA 4BZAA 3AE4B 1J8CA 3B9JA 3PO0A 3V60A 1CJEA 3PLUA 1B1ZA 2NBVB 3DQVA 4Q2JA 3ZNZB 3JW0X 1PGAA 2NTSA 2LZ6A 2KMAA 2EELA 3H9DA 3Q6BA 4A6QA 3WAOA 3A9KA 2LWPA 2E6XA 4NJCA 2NMQA 4WWOA 4HROA 3PS6A 4II2B 2IY0B 2WQYB 3C0RB 2KQ7A 2EMTA 4BAXA 4K3BA 2WDQB 5C2TB 4EZLA 3I5JC 1YX6B 4EFOA 1L5PA 1NI2A 1E5WA 3J9CA 1E7VA 2IYDB 3RNBC 1RRBA 2HE7A 1PYWD 4TMAB 3PVLA 1KM7A 1L0XB 4HCNB 3NOBA 2CU3A 1HE8A 3IFWB 1Q1OA 3SHQA 3AMZA 2C5LC 4TSSA 2CJOA 3E9SA 1EWCA 3R2TA 3NUHB 1GOZA 2KZRA 3PRMB 4FN2A 1P3QU 2V3PA 2CKHB 3HVDA 2C7NB 3QK0A 4AP4C 2MCNB 3NG0A 4NPNA 1E7PB 4J6IA 3IT4B 3ZLZA 3BINA 1D5MC 2JRIB 4JWUC 3FC4A 1L0YB 1P0RA 3KWLA 3GS2A 4A3OA 4DQOC 1Y56A 1QKZA 1YD8U 3DBLB 2N7EA 5DPRA 3TBLD 2JWZA 3SR6A 4P1BC 3VXWA 1TS2A 2IY1B 2MBHA 3R7RA 2MH7A 1J7AA 5BMHA 3HHMA 2SAKA 3AI5A 4HVBA 2MRPA 3AU4A 4RM9A 2GBRA 3DVNV 4YWGG 4C4VA 3ZVVA 1QLBB 5CX3A 3RD2A 1P7EA 1F52A 3BVGA 1R7SA 1D5ZC 4WJOA 4ZRIA 1JWMD 2WLBA 2MLBA 4WURA 3NVZA 3JSVA 4K1RB 1V49A 2K0PA 3K9OB 2UU7A 2ZPNA 3VUXA 2GBNA 2WXOA 1T3QA 2GRIA 4LNKA 3H8HA 3EUB2 2JZPA 3LYYA 3PHXB 4F1SA 5DPSA 1ZP0B 1JMLA 4H2AA 1C1YB 4W9KA 4K3CA 2KX0A 3IHPC 3PZDA 2L05A 2ON8A 3V6EB 2YLMA 3AE6B 4KIKB 1SIFA 2MW5A 2WXFA 3W5UB 2KLGA 4ANUA 1ZW7A 2HTHA 3RUIB 2BVCA 1RYJA 2EKEC 2HDEA 2KO3A 3MHSD 1FO4A 4G0NB 2QMTA 2QCZA 2CJNA 3SDLC 2PEAA 4DDID 2G1EA 3H7PB 1JWUD 3ZTDA 2N7JA 1L2NA 1RFAA 2BB5A 4BOSC 2I1KA 1TT5B 1TJEA 2KDMA 1AWDA 4RM8A 2KDEB 2NR2A 5IOIA 2ZJDA 1J7CA 1NVID 2PMVA 4ARIA 4ZRQA 1AYFA 4IM0A 4RF0A 3TEYA 3LJ3A 4WH4A 4ASWC 5FR3A 1T0SC 1I4XA 2JU6X 4R3DA 3N1XC 5BYRA 3JVZX 1X1MA 1SB3C 2L1AA 4GU2A 4IW0A 4KZCA 1WXMA 1K50A 4A20A 3U52E 4YTNB 4FULA 1N60A 1ROEA 2KDFB 2ZW1A 3BVMA 3QC8B 3A33B 2BPSA 4IM2A 2QILA 1WH3A 3M3JA 3EC8A 4I6PA 5J2RA 1WJNA 4RGTA 2IO2B 1V81A 2C7MB 1C4CA 2V3SA 2K8BA 3R8BA 4URKA 2FIDA 4G3XB 1XF5L 5EDSA 1P9DU 2K9XA 1HXYD 3RULA 1V80A 1DYQA 3H1UA 1D4BA 2I1JA 4ZRPA 3N30A 3GZNB 3V6CB 3KLSX 2ACZB 4XDDA 2L7RA 1MFWA 4USAA 2XK5A 1TKEA 4GDKB 4DK5A 1MG4A 2WXRA 4AQ7A 4TKNA 2H89B 1OEYA 2JT4B 2LGDA 3QQ8B 3KUCB 4OZCA 1YJJA 2M4NA 2MSED 4WIPA 3B1LX 1N61A 5G2NA 3BIID 4XZ4A 4W9IA 1ZUD2 1MJDA 4HPPA 2FBWB 1FXIA 2JWUA 3H7PA 1MG8A 2D07B 4MEMA 4IWQA 2RDHA 3L13A 4NJ7A 5EE9A 4US8A 3WALA 3KWVA 4RMAA 3RNCC 2WHIA 4L1BA 3NS8A 4EZJA 1QZEA 4DXAB 2PJHA 4GLSC 3PV1A 4W9GA 2MP2B 2ZVOA 2MBOA 2K3UA 4P6VF 4B0MA 4W9FA 3APFA 2JQRB 3R66C 2JYEA 3IVFA 5CHFA 1VRAB 2IO1B 4GDLB 2L83A 4YSXB 2I2YA 2JZ3B 5D7GA 1XD3B 3MC9A 4HEA1 4B95A 1FD6A 3U8ZA 1WX9A 3BZDB 4MACA 2M1MA 3UIOB 2KKCA 1HEZE 5J18A 2KQSA 1M94A 3AV8A 1WM3A 5KHQA 2KN4A 2DYMA 2D5GA 2BWES 2CU1A 4KDIC 1C79A 1LFDA 1FRRA 1TZ1A 1YQ4B 4FXCA 1EM7A 4XC2A 4W9HA 2KOXA 2KACA 5D2MB 4JWSC 2IJ0A 4G50A 3VTVA 4HJGE 2R2QA 1YOVB 1WR1A 1I4QA 1D3ZA 3UQAA 1JWBD 3DPDA 1V2YA 3V62A 1KLVA 2BW2A 2AQ1B 5C3JB 4MELA 4IUMB 3AE3B 2LHEA 1F2RC 2L8JA 2RD0A 2K8HA 1J19A 4M00A 3AE5B 4B9KA 3IT6B 2AEHA 2WGSA 2HJ8A 3ML8A 4KSKC 3RZWC 1Y8RC 5MPOA 2L3ZA 4EEWA 3FILB 3AB5A 1GUAB 1SF0A 3VRAB 2KFKB 3N1YC 1WX7A 2KDIA 2OOBB 5H8YE 3GZNI 5L95C 4MGYE 3MJWA 2A5UA 1SJHD 3ZJUA 2DZMA 5E6OA 3P2BA 3TCAA 1FCCC 4S17A 2IGDA 2NS5A 2YEPF 4ANWA 3RPFC 1GPXA 2VH2A 2Z0EB 2QHOA 5IO9A 1FNVA 2D10A 4BBNC 2M19A 3N32A 3KYDD 1Q5WB 3DBRI 2LXCA 4JLCA 4EOYA 2KTFA 2LJIA 5C1ZA 2IO3B 5AZHA 1WXVA 4E71A 1V1PA 2KX3A 1V5TA 1TGZB 1YNTE 2BKRB 3TL5A 4YT0B 2PVOD 3BVZA 4WAFA 1PFDA 3HM6X 4QAYA 5BMIA 1WI0A 4OZBA 2O6VA 1L4DB 3Q3MC 2LI5A 1QOBA 3UIPB 3MHZA 4ZYSA 2CHZA 1E90A 2LGXA 5IAAC 2KC1A 1OQQA 3C8YA 2RSUA 1SE2A 1TS5A 2Q5WD 2L76A 2ZNVB 4IDIA 2JF5A 4OVVA 1ACCA 2K8CA 2GI9A 4GMVA 4N59A 3ZIMA 2M0AA 1SIJA 4LCDE 2JY6A 3OLMD 3NRZA 1C9FA 2KD0A 1E7UA 3DBHB 1C4AA 3GP7A 3A1QB 1WF9A 3TUOA 1T0RC 4FHKA 5FR6A 3ZXRA 3ZDMC 4WJPA 3DBSA 3U4EG 1TS3A 4MH8A 3A1QA 2INPE 4OVZA 2KWUB 4N58A 1QOFA 4IC7B 5E6JA 3AEEB 2QDFA 3AE1B 4CQNA 5H92C 4IWPA 2C7HA 2WYQA 2KTRA 2BTEA 4GIVA 3ZXVA 5BYQA 3H6NA 1TBEA 1YMHE 4C7YA 2RPQA 1WGKA 2JUOA 2JX5A 2GBKA 2WXPA 2Z0DB 1GC7A 4C4VB 4ZRKA 3IG3A 3ZGZA 1A5RA 3GB1A 2NBWB 5LXIB 2ZEQA 2ICIA 1EF1A 1OQRA 2WU5B 2J0JA 4ZYNA 1E8YA 2D3AA 4OZAA 1FFVA 1XLQA 3BWUD 3U7DA 1K8RB 3DDCB 5CTRC 1BMLC 1EO6A 3QX1A 1MHHE 3S2AA 4M0WB 2BGFA 1UH6A 4RNAA 3RNAC 1JROA 4IOIE 2ASQA 1E8WA 3TEXA 1XLOA 3VUYA 2KJRA 2WXJA 1C3TA 3CMMB 3TIXA 1YX5B 1WM2A 3WAPA 2RDBC 2KANA 2KC2A 4EKUA 4EUTA 1QF6A 1F1HA 4DHJD 1QT9A 1WWTA 1TKYA 4II3B 4HJKA 1T5XD 2OJWA 1WX8A 4ANVA 2DHZA 2KHWB 1ET6A 2LGSA 3VDZA 4P1CC 3RYTA 2MJEA 1QILA 2XN9C 1DGJA 2GB1A 1GC6A 2IDYA 4A8XC 3RN9C 4BBNF 2ZVNA 3DVNU 2LD9A 2VH1A 4OHJA 2XK5B 4ZHOA 1JWAD 2FCNA 2LRWA 1R4NB 2BT6A 2WXKA 3ABVB 1UGMA 3NZ3A 2LVPA 1NEKB 2LASA 4AS1A 2KWDA 2XEWA 3DVGX 3MJ5A 3MTNB 4D2KA 3RNEC 1P1AA 5E6PA 3DHIC 4K7SA 2LUMA 4FA6A 4LTUA 3Q8FA 4HXDA 2DZIA 2Y5PA 3O65B 2G9HD 1XO3A 3RFZB 4GOCA 1BT0A 3HK0A 1H4RA 4M0WA 3DHHC 1EU3A 3U2SC 2HJ1A 3V05A 3ZJTA 1GB1A 3RI7C 3W2DA 3QWZB 1E8XA 3A4RA 3O13A 4G11A 4DWFA 4WQMA 3NVWA 2N9PC 1V5OA 1GB4A 4AWJA 3Q69A 2IPKD 2ZCBA 2QIEB 3P63A 3A4SC 1DOXA 2W3SA 1E9MA 5HFYA 1HTOA 3SU8X 2J0KA 3KH0A 5LLIA 5JZEB 4PYZA 4NAMA 2N9XA 4MDKE 2M0XA 4ZOHC 2K25A 1MVKA 2VZKD 2RR9A 3FILA 3AH7A 4KVGB 4AUQC 1F77A 3CF6E 1KFYB 4HDQA 2MWSB 4BFRA 5AZGA 3AULA 4IKGA 4HCPB 2NPTB 4E74A 1GNUA 4M8MA 2W55A 4KGTA 2JXXA 2GOWA 4XDCA 3AE2B 4AJWA 3PSEB 1TTNA 1ZXHA 2INCC 1LM8B 1TZOA 1JRUA 1RM6C 4JX1C 2R2OA 3TJPA 1VDVA 2WDVB 2V3NA 2BYVE 3ENEA 4UDUC 1L6UA 2GMIC 2PVGC 3PREA 2K6DB 1F0ZA 4MGKE 3VAWA 1L6VA 3B2GA 3L54A 1HZ5A 2KXJA 1FCLA 1V9JA 4X57B 4LNOA 3B0AA 2JXTA 1K51A 1JCKB 3Q3OC 4GGQA 3DOWA 3B2FA 1RAXA 1WGDA 3LXFA 2AL6A 4P16A 2ZZPB 1I42A 3PPAA 1WXQA 1SSNA 2INDC 1LO5D 2Z59B 1HQRD 3L4PA 4M02A 1N5WA 5BYSA 3ECIA 4LDTD 2AWTA 1KTKA 3NS1A 1S1QB 2TSSA 2L00B 3ONSA 2AQ2B 3HM3A 1YJIA 4MH0E 2KT7A 1ENFA 1WSPA 1KLGD 2PLPA 3VR8B 1MI0A 1OFFA 1XLNA 3RCZA 1ZOYB 4ICVA 3VUWA 5IKCM 2CHWA 4WWPA 5CHVC 1P7FA 3VTUA 3I57A 1EUVB 4CYEA 1P98A 3HVZA 4ZHPA 3PZ7A 1WY8A 4KX6B 1HA5A 1TY0A 3DBLI 4GDKA 3HIZA 3N3KB 3QCAA 2ZNVC 3GE8C 1U4AA 3FAHA 1ET9A 2AQ3B 1WRIA 1T6BX 2OHFA 1YQBA 1RLFA 3K9PB 2DENB 1UD7A 2D3BA 4FJZA 3Q14C 2BB6A 1I35A 2CS4A 3AEAB 1D6EC 1PQSA 3UQBA 1LGRA 5AUIA 4RCOA 2FIFA 2J53A 1RFKA 3GE3C 2JPHA 2AL3A 5G5HA 4JL9A 4KDLB 1AW7A 1WGYA 1N62A 2KN5A 2MQJA 4KIKA 4FJYA 1T0QC 1C76A 2FCMA 3PLVA 2K6QA 2NVUI 2LFIA 4KV2A 1I4HA 2CR5A 3VH4B 5FKAC 1E10A 3RZFA 1S3SG 2INNE 1QOAA 1I4RA 3H7SA 3PRPB 2FUHB 4WAAA 3ALBA 2RPVA 3NZSA 5J17A 4MJSB 2B76B 1J0GA 4US9A 2KYWA 2PE6B 3A9KB 4NAWA 3KUZA 1ZXIA 1NDDA 2SEBD 5JXVA 2BQQA 4LNNA 1C4PA 2DZKA 3DWMA 4JPSA 4WJNA 2DYOA 3Q3FA 2K39A 5C23A 3CWIA 2JZZA 1UF0A 1VCBA 2H88B 1UBIA 2DYBA 4RGMA 1WMHB 3D32A 1KRHA 1N63A 1QQRA 3T9LA 3KVFB 2A4ZA 3UF8A 2KJHB 2EKIA 2LRUA 1V1OA 3R7QA 1VJKA 4YL8A 2B3AA 2WWZA 3L0WB 3UINB 1FXAA 4MGIE 4XGAB 1SEBD 4MSQB 1GJZA 2N9KA 3SFEB 2BBCA 2WXMA 1WFYA 2KWCA 4HPLB 2BS3B 2E3TA 1I7HA 1HTQA 2W54A 1BUIC 1SE4A 2KDBA 3VRBB 1I4GA 3DWGC 4KGRA 5AZFA 4M8NA 4BKSA 3TSSA 4BKSD 3UGBB 2XBBC 3AEBB 1WMHA 3NY5A 4L2YA 2WP9B 1N6ZA 4PS3A 3RNGC 1Q0WB 3N9YC 3KW5B 4C00A 2VRRB 2YEPB 2LVQA 2QSDA 4MM3B 2KFJA 4A90A 3ZW3A 4HPMB 3PTFC 4NQKE 2MP2A 4YSZB 2JYTA 3W1SA 2DWQA 2BS4B 2FCQA 1UNSA 2LXAA 1JWSD 1UWXA 1WRDB 1PUTA 4BOZB 1GG3A 1E6EB 1FNWA 5HG2A 2DAFA 2KMCA 3ZNGC 1ZPSA 4DHJB 4PS8A 3CSFA 2WXLA 1M4VA 4CO7A 1SE3A 3E56A 3HUIA 4RF1A 4ITKA 3VH3B 5G5GA 3DBRB 2M56B 5HKHA 4OVUA 3P4QB 4RH6A 1PGXA 3BYTB 1C77A 3I63C 1YN4A 1NYRA 2DBYA 3AEDB 4LNIA 3M95A 4GDLA 2KQ4X 3ZJVA 1TS4A 1OTRB 1TKGA 2KWVB 2BYTA 1R4MB 4F8CB 2G4SA 4XE0A 1ESFA 2K1FA 1VZ8A 2ZCCA 3ZQ4A 3OJ3A 2GBJA 4AJYB 3QIJA 2Y5CA 1DOIA 1WYGA 2BKFA 1H8CA 4PK1A 1Q10A 2L52A 1C78A 1WYWB 3AECB 3MP9A 1EF5A 1LQBA 3SFDB 4TQ1A 4LK0M 1IBXA 1EU4A 2DLBA 3TEWA 4RGNA 1FRDA 2V9HA 4F7ZA 4XX5A 3KUDB 3ML9A 5FK9C 2MBEA 3EHVA 3BYYB 2R61A 1Z2MA 1XCTL 1WE7A 4GXBA 1SE9A 4TUUA 2O6VB 2BWFA 3R3MA 2AX5A 3L17A 3U30A 2GBMA 3SEBA 3NZUA 1HZ6A 2KMMA 5IA7A 4N6EB 1I4PA 3UI3A 1YN5A 1UWMA 1WXAA 3AU5A 1OEYJ 1RWSA 5EE3A 4W9EA 1F9JA 4DXGA 3P4RB 1ZDVA 4MJSA 2PKOA 2GLSA 2W82A 1KOTA 1ZDXA 4C56C 3MFGA 3AE9B 1V86A 4GN1A 3N20C 1WJ4A 2MEKA 1MHXA 2Y5BB 4TQ0A 3Q3JA 2FAZA 4M01A 4PYUA 4LJPB 1WXSA 4HK2A 5JH5C 3AE7B 3Q8EA 1L4ZB 2PW9A 5AUKA 1T0YA 4RGOS 5D94A 4DBGA 4IG7B 5G55A 1LXDA 2ZW0A 1IGDA 3Q8CA 2MHJA 1D5XC 4NNJB 1NBFC 2PIAA 2XNAC 5L83A 2BYFA 2JSVX 4REZA 4KKJA 1FNUA 2LGIA 2W3RA 1XEEA 3ZYYX 4ZRJA 2N9LA 2QEJC 3P42A 4JE3B 2Z8LA 3ZRCA 3QARA 1IYFA 4A55A 1ZE3D 1TIFA 1IPGA 2RMMA 3PRZA 1STEA 2RGFA 4W9LA 2K22A 2L32A 1UELA 1TY2A 1A70A 2KK8A 4HRSA 3M63B 1SJED 1YN3A 5LNK1 1XXGA 4HDOA 1FPYA 3QJZA 3WAMA 4NZLB 3RMKC 1XQQA 1SGHA 3KQ4A 4NJ6A 2UYZB 3VFKA 5TR5A 1SXTA 2J4XA 1SBBB 1JRPA 1GAQB 2N1WA 1CMXB 3APCA 2WXNA 1WGGA 3JYUA 1WZ3A 2L0TA 3L10B 2IBIB 1V1PB 4XYCA 4DDGD
chains in the Genus database with same CATH topology
1T0QC 3RI7C 3Q2AC 1T0RC 3N1XC 3N1YC 3Q14C 3RNFC 3I5JC 4P1CC 3DHGC 3RNGC 2INCC 2RDBC 3N20C 3RNBC 3GE8C 4P1BC 3RNCC 3Q3NC 3DHHC 3RNEC 3GE3C 3N1ZC 3Q3MC 2INDC 3RN9C 3DHIC 3Q3OC 1T0SC 3RMKC 3I63C 3RNAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3RI7 C;  3Q2A C;  1T0R C;  3N1X C;  3N1Y C;  3Q14 C;  3RNF C;  3I5J C;  4P1C C;  3DHG C;  3RNG C;  2INC C;  2RDB C;  3N20 C;  3RNB C;  3GE8 C;  4P1B C;  3RNC C;  3Q3N C;  3DHH C;  3RNE C;  3GE3 C;  3N1Z C;  3Q3M C;  2IND C;  3RN9 C;  3DHI C;  3Q3O C;  1T0S C;  3RMK C;  3I63 C;  3RNA C; 
#chains in the Genus database with same CATH topology
 1WGH A;  1ZKH A;  4FHJ A;  2IGH A;  2LHD A;  4MM3 A;  1XLP A;  2N1V A;  4WJQ A;  2N7D A;  1OQY A;  2WS3 B;  4BVU C;  3ZKJ C;  1N5X A;  3QHT A;  1K52 A;  4WQO B;  2QJL A;  1WE6 A;  4B6W A;  4AOF A;  5JHB A;  3VR9 B;  2DX5 B;  3WAN A;  4DXF A;  3ZO5 B;  2OJR A;  2M8S A;  3W1Y A;  3AEF B;  2K5P A;  1V97 A;  3W9C B;  1KLU D;  3T3O A;  1CZP A;  3APD A;  4NAW B;  3ZRF A;  1VZ7 A;  3C19 A;  3NVV A;  3LDZ E;  3L08 A;  1FFU A;  4J3O D;  2WX1 A;  3PZ8 A;  3KYC D;  1L7Y A;  2N9E B;  2EMS A;  3OWE B;  4I6L B;  3EEC A;  3WA0 A;  5KHO A;  4I6N B;  5HHD G;  1QOG A;  2MBQ A;  3WIM A;  1VR9 A;  2D3C A;  4WWM A;  4ICU A;  3PGE A;  1YQ3 B;  2NCN A;  3Q8A A;  3P4P B;  2WXI A;  2LMC A;  2IZV B;  4L23 A;  2M17 A;  4P7I A;  3EGR A;  4XWT A;  2LVO A;  3A9J B;  1TYG B;  4NY0 A;  2KNB A;  2V1Y A;  3GOE A;  1UZX B;  5LXH A;  4FAD A;  2V0G A;  2V4L A;  4W9C A;  2L0F A;  1ISN A;  2KJ6 A;  3EA6 A;  1NEN B;  2JRH A;  3VVW B;  2ZPY A;  5EE1 A;  4YTM B;  2KVZ A;  4C80 A;  4BKT A;  1FEH A;  1VD2 A;  4LJO B;  1WR6 E;  4PT5 A;  5D6J B;  2BF8 B;  1KJT A;  3VTW A;  4LDT B;  1OGW A;  2LGY A;  3DBH I;  3Q8B A;  4MSM B;  1UGJ A;  3OG5 A;  2KFK A;  2REX A;  2IO0 B;  2HTM E;  1R4M I;  4HWI B;  3PHW B;  4ACF A;  3HRD D;  2MJ3 A;  3QA8 A;  1NI3 A;  3P4S B;  2G3Q B;  2J42 A;  5BMG A;  1AAR A;  2MA9 B;  4KGS A;  2FE8 A;  2D3G A;  4A3P A;  3OJ4 B;  1VZ6 A;  2WU2 B;  1WJU A;  5E6N A;  2J7Q B;  1MPE A;  1KF6 B;  1ZGU B;  2DZJ A;  4IWO A;  3IBE A;  2D2Q A;  1EWY C;  3DCG A;  4TV3 A;  1F2R I;  3X23 A;  3VHT C;  2FCS A;  4IM3 A;  1DOY A;  3ZUN A;  3W5V B;  3T3N A;  2KAJ A;  4FBJ B;  4FLH A;  3DVG Y;  3Q2A C;  2RDG A;  1JW9 D;  2WX0 A;  4JQW C;  3MC0 B;  3NHE B;  1K53 A;  4S0R A;  3TEZ A;  5GXG B;  1UUP A;  4LLG M;  1JAL A;  3CIR B;  2NBU A;  3URY A;  2X38 A;  4JGH B;  2YVC A;  4MT5 A;  2LEK A;  4MGZ E;  2WXH A;  4YSY B;  3R2I A;  5BO4 B;  1V8C A;  5DCN A;  3I3T B;  3DHG C;  4XWW A;  3W1S C;  5IN7 A;  4ANX A;  3B08 A;  3L16 A;  2OED A;  2V4I B;  1WGR A;  2N0S B;  3T8M A;  4FJV B;  2MX2 A;  3N1Z C;  4GSW A;  1G6J A;  2UWQ A;  5AEK B;  3ETR A;  4HKZ E;  2CHX A;  3IAM 1;  1BXT A;  2WNM A;  3ZTC A;  3SD5 A;  3WCQ A;  4YXD B;  4OW0 A;  5CHW A;  3A9J A;  3EFU A;  1KH0 A;  4KZ0 A;  3V61 A;  3I9V 1;  2I38 A;  4HLE A;  3ZDT A;  3P1M A;  2AYO B;  4K7U A;  2C60 A;  1FMA D;  3NJT A;  4W9J A;  3AE8 B;  5GMV A;  2O2V B;  4KSL C;  3TMP B;  2FUG 1;  3CST A;  1CQV A;  4CHK A;  3IXS A;  5TSS A;  2LUE A;  1Z5S B;  1NYQ A;  1PDX A;  4HKQ A;  2QC8 A;  1XCQ L;  4KKI A;  2DNF A;  1XT9 B;  2J0M A;  3M62 B;  4NQL B;  1IP9 A;  3Q3N C;  3BK1 A;  3MC8 A;  5IP4 D;  4EZK A;  3OAW A;  5I4D A;  5D3D A;  4K81 A;  2KLC A;  2D11 A;  4YTP B;  2BS2 B;  1FM0 D;  1FIQ A;  2G45 B;  1YIW A;  3RNF C;  4DHZ E;  4O1N A;  4ZDV A;  2X8X X;  4PS7 A;  2DAJ A;  3ZNI D;  2NTT A;  1YJ1 A;  2FNJ B;  4E3C A;  2O2V A;  3IAS 1;  4A9A A;  4C7Z A;  1L0V B;  4LNF A;  1IBX B;  2NPT A;  3BK2 A;  1VLB A;  1R4N I;  3AM9 A;  2W9N A;  2O6V D;  2G4D B;  2PPH A;  3EFC A;  1JQ4 A;  1CK1 A;  3U7Z A;  2HD5 B;  3AXC A;  4GB9 A;  4RFB A;  1V6E A;  2WDT B;  2WXQ A;  4JIO U;  4EE2 A;  2VZK B;  3FKY A;  1IGC A;  1PGB A;  3AEG B;  1IUE A;  3VQI A;  2KVR A;  4W9D A;  2MBB B;  1UBQ A;  3LB8 C;  3BY4 B;  1E0Z A;  1WIA A;  3V3X A;  1B9R A;  2LJ5 A;  5DPT A;  2Y3A A;  2PTL A;  2WXG A;  4DHZ B;  5EE0 A;  5DPW A;  1WZ0 A;  3QAQ A;  3ZNH B;  2BYE A;  2WDR B;  3JSV B;  3X0W A;  1AN8 A;  2N4F A;  1J7B A;  2IGG A;  2C9W B;  2MJD A;  3AN1 A;  5HI1 A;  3RT3 B;  2J52 A;  4B0E A;  4ARC A;  4N9F 4;  5T8I A;  4BKG A;  4K7W A;  3PT2 B;  1FXT B;  3NVY A;  2PE9 A;  2ONQ A;  2KTR B;  5D3I B;  1E8Z A;  5JHA A;  2JVC A;  1WJ6 A;  4WWN A;  4BZA A;  3AE4 B;  1J8C A;  3B9J A;  3PO0 A;  3V60 A;  1CJE A;  3PLU A;  1B1Z A;  2NBV B;  3DQV A;  4Q2J A;  3ZNZ B;  3JW0 X;  1PGA A;  2NTS A;  2LZ6 A;  2KMA A;  2EEL A;  3H9D A;  3Q6B A;  4A6Q A;  3WAO A;  3A9K A;  2LWP A;  2E6X A;  4NJC A;  2NMQ A;  4WWO A;  4HRO A;  3PS6 A;  4II2 B;  2IY0 B;  2WQY B;  3C0R B;  2KQ7 A;  2EMT A;  4BAX A;  4K3B A;  2WDQ B;  5C2T B;  4EZL A;  3I5J C;  1YX6 B;  4EFO A;  1L5P A;  1NI2 A;  1E5W A;  3J9C A;  1E7V A;  2IYD B;  3RNB C;  1RRB A;  2HE7 A;  1PYW D;  4TMA B;  3PVL A;  1KM7 A;  1L0X B;  4HCN B;  3NOB A;  2CU3 A;  1HE8 A;  3IFW B;  1Q1O A;  3SHQ A;  3AMZ A;  2C5L C;  4TSS A;  2CJO A;  3E9S A;  1EWC A;  3R2T A;  3NUH B;  1GOZ A;  2KZR A;  3PRM B;  4FN2 A;  1P3Q U;  2V3P A;  2CKH B;  3HVD A;  2C7N B;  3QK0 A;  4AP4 C;  2MCN B;  3NG0 A;  4NPN A;  1E7P B;  4J6I A;  3IT4 B;  3ZLZ A;  3BIN A;  1D5M C;  2JRI B;  4JWU C;  3FC4 A;  1L0Y B;  1P0R A;  3KWL A;  3GS2 A;  4A3O A;  4DQO C;  1Y56 A;  1QKZ A;  1YD8 U;  3DBL B;  2N7E A;  5DPR A;  3TBL D;  2JWZ A;  3SR6 A;  4P1B C;  3VXW A;  1TS2 A;  2IY1 B;  2MBH A;  3R7R A;  2MH7 A;  1J7A A;  5BMH A;  3HHM A;  2SAK A;  3AI5 A;  4HVB A;  2MRP A;  3AU4 A;  4RM9 A;  2GBR A;  3DVN V;  4YWG G;  4C4V A;  3ZVV A;  1QLB B;  5CX3 A;  3RD2 A;  1P7E A;  1F52 A;  3BVG A;  1R7S A;  1D5Z C;  4WJO A;  4ZRI A;  1JWM D;  2WLB A;  2MLB A;  4WUR A;  3NVZ A;  3JSV A;  4K1R B;  1V49 A;  2K0P A;  3K9O B;  2UU7 A;  2ZPN A;  3VUX A;  2GBN A;  2WXO A;  1T3Q A;  2GRI A;  4LNK A;  3H8H A;  3EUB 2;  2JZP A;  3LYY A;  3PHX B;  4F1S A;  5DPS A;  1ZP0 B;  1JML A;  4H2A A;  1C1Y B;  4W9K A;  4K3C A;  2KX0 A;  3IHP C;  3PZD A;  2L05 A;  2ON8 A;  3V6E B;  2YLM A;  3AE6 B;  4KIK B;  1SIF A;  2MW5 A;  2WXF A;  3W5U B;  2KLG A;  4ANU A;  1ZW7 A;  2HTH A;  3RUI B;  2BVC A;  1RYJ A;  2EKE C;  2HDE A;  2KO3 A;  3MHS D;  1FO4 A;  4G0N B;  2QMT A;  2QCZ A;  2CJN A;  3SDL C;  2PEA A;  4DDI D;  2G1E A;  3H7P B;  1JWU D;  3ZTD A;  2N7J A;  1L2N A;  1RFA A;  2BB5 A;  4BOS C;  2I1K A;  1TT5 B;  1TJE A;  2KDM A;  1AWD A;  4RM8 A;  2KDE B;  2NR2 A;  5IOI A;  2ZJD A;  1J7C A;  1NVI D;  2PMV A;  4ARI A;  4ZRQ A;  1AYF A;  4IM0 A;  4RF0 A;  3TEY A;  3LJ3 A;  4WH4 A;  4ASW C;  5FR3 A;  1T0S C;  1I4X A;  2JU6 X;  4R3D A;  3N1X C;  5BYR A;  3JVZ X;  1X1M A;  1SB3 C;  2L1A A;  4GU2 A;  4IW0 A;  4KZC A;  1WXM A;  1K50 A;  4A20 A;  3U52 E;  4YTN B;  4FUL A;  1N60 A;  1ROE A;  2KDF B;  2ZW1 A;  3BVM A;  3QC8 B;  3A33 B;  2BPS A;  4IM2 A;  2QIL A;  1WH3 A;  3M3J A;  3EC8 A;  4I6P A;  5J2R A;  1WJN A;  4RGT A;  2IO2 B;  1V81 A;  2C7M B;  1C4C A;  2V3S A;  2K8B A;  3R8B A;  4URK A;  2FID A;  4G3X B;  1XF5 L;  5EDS A;  1P9D U;  2K9X A;  1HXY D;  3RUL A;  1V80 A;  1DYQ A;  3H1U A;  1D4B A;  2I1J A;  4ZRP A;  3N30 A;  3GZN B;  3V6C B;  3KLS X;  2ACZ B;  4XDD A;  2L7R A;  1MFW A;  4USA A;  2XK5 A;  1TKE A;  4GDK B;  4DK5 A;  1MG4 A;  2WXR A;  4AQ7 A;  4TKN A;  2H89 B;  1OEY A;  2JT4 B;  2LGD A;  3QQ8 B;  3KUC B;  4OZC A;  1YJJ A;  2M4N A;  2MSE D;  4WIP A;  3B1L X;  1N61 A;  5G2N A;  3BII D;  4XZ4 A;  4W9I A;  1ZUD 2;  1MJD A;  4HPP A;  2FBW B;  1FXI A;  2JWU A;  3H7P A;  1MG8 A;  2D07 B;  4MEM A;  4IWQ A;  2RDH A;  3L13 A;  4NJ7 A;  5EE9 A;  4US8 A;  3WAL A;  3KWV A;  4RMA A;  3RNC C;  2WHI A;  4L1B A;  3NS8 A;  4EZJ A;  1QZE A;  4DXA B;  2PJH A;  4GLS C;  3PV1 A;  4W9G A;  2MP2 B;  2ZVO A;  2MBO A;  2K3U A;  4P6V F;  4B0M A;  4W9F A;  3APF A;  2JQR B;  3R66 C;  2JYE A;  3IVF A;  5CHF A;  1VRA B;  2IO1 B;  4GDL B;  2L83 A;  4YSX B;  2I2Y A;  2JZ3 B;  5D7G A;  1XD3 B;  3MC9 A;  4HEA 1;  4B95 A;  1FD6 A;  3U8Z A;  1WX9 A;  3BZD B;  4MAC A;  2M1M A;  3UIO B;  2KKC A;  1HEZ E;  5J18 A;  2KQS A;  1M94 A;  3AV8 A;  1WM3 A;  5KHQ A;  2KN4 A;  2DYM A;  2D5G A;  2BWE S;  2CU1 A;  4KDI C;  1C79 A;  1LFD A;  1FRR A;  1TZ1 A;  1YQ4 B;  4FXC A;  1EM7 A;  4XC2 A;  4W9H A;  2KOX A;  2KAC A;  5D2M B;  4JWS C;  2IJ0 A;  4G50 A;  3VTV A;  4HJG E;  2R2Q A;  1YOV B;  1WR1 A;  1I4Q A;  1D3Z A;  3UQA A;  1JWB D;  3DPD A;  1V2Y A;  3V62 A;  1KLV A;  2BW2 A;  2AQ1 B;  5C3J B;  4MEL A;  4IUM B;  3AE3 B;  2LHE A;  1F2R C;  2L8J A;  2RD0 A;  2K8H A;  1J19 A;  4M00 A;  3AE5 B;  4B9K A;  3IT6 B;  2AEH A;  2WGS A;  2HJ8 A;  3ML8 A;  4KSK C;  3RZW C;  1Y8R C;  5MPO A;  2L3Z A;  4EEW A;  3FIL B;  3AB5 A;  1GUA B;  1SF0 A;  3VRA B;  2KFK B;  3N1Y C;  1WX7 A;  2KDI A;  2OOB B;  5H8Y E;  3GZN I;  5L95 C;  4MGY E;  3MJW A;  2A5U A;  1SJH D;  3ZJU A;  2DZM A;  5E6O A;  3P2B A;  3TCA A;  1FCC C;  4S17 A;  2IGD A;  2NS5 A;  2YEP F;  4ANW A;  3RPF C;  1GPX A;  2VH2 A;  2Z0E B;  2QHO A;  5IO9 A;  1FNV A;  2D10 A;  4BBN C;  2M19 A;  3N32 A;  3KYD D;  1Q5W B;  3DBR I;  2LXC A;  4JLC A;  4EOY A;  2KTF A;  2LJI A;  5C1Z A;  2IO3 B;  5AZH A;  1WXV A;  4E71 A;  1V1P A;  2KX3 A;  1V5T A;  1TGZ B;  1YNT E;  2BKR B;  3TL5 A;  4YT0 B;  2PVO D;  3BVZ A;  4WAF A;  1PFD A;  3HM6 X;  4QAY A;  5BMI A;  1WI0 A;  4OZB A;  2O6V A;  1L4D B;  3Q3M C;  2LI5 A;  1QOB A;  3UIP B;  3MHZ A;  4ZYS A;  2CHZ A;  1E90 A;  2LGX A;  5IAA C;  2KC1 A;  1OQQ A;  3C8Y A;  2RSU A;  1SE2 A;  1TS5 A;  2Q5W D;  2L76 A;  2ZNV B;  4IDI A;  2JF5 A;  4OVV A;  1ACC A;  2K8C A;  2GI9 A;  4GMV A;  4N59 A;  3ZIM A;  2M0A A;  1SIJ A;  4LCD E;  2JY6 A;  3OLM D;  3NRZ A;  1C9F A;  2KD0 A;  1E7U A;  3DBH B;  1C4A A;  3GP7 A;  3A1Q B;  1WF9 A;  3TUO A;  1T0R C;  4FHK A;  5FR6 A;  3ZXR A;  3ZDM C;  4WJP A;  3DBS A;  3U4E G;  1TS3 A;  4MH8 A;  3A1Q A;  2INP E;  4OVZ A;  2KWU B;  4N58 A;  1QOF A;  4IC7 B;  5E6J A;  3AEE B;  2QDF A;  3AE1 B;  4CQN A;  5H92 C;  4IWP A;  2C7H A;  2WYQ A;  2KTR A;  2BTE A;  4GIV A;  3ZXV A;  5BYQ A;  3H6N A;  1TBE A;  1YMH E;  4C7Y A;  2RPQ A;  1WGK A;  2JUO A;  2JX5 A;  2GBK A;  2WXP A;  2Z0D B;  1GC7 A;  4C4V B;  4ZRK A;  3IG3 A;  3ZGZ A;  1A5R A;  3GB1 A;  2NBW B;  5LXI B;  2ZEQ A;  2ICI A;  1EF1 A;  1OQR A;  2WU5 B;  2J0J A;  4ZYN A;  1E8Y A;  2D3A A;  4OZA A;  1FFV A;  1XLQ A;  3BWU D;  3U7D A;  1K8R B;  3DDC B;  5CTR C;  1BML C;  1EO6 A;  3QX1 A;  1MHH E;  3S2A A;  4M0W B;  2BGF A;  1UH6 A;  4RNA A;  3RNA C;  1JRO A;  4IOI E;  2ASQ A;  1E8W A;  3TEX A;  1XLO A;  3VUY A;  2KJR A;  2WXJ A;  1C3T A;  3CMM B;  3TIX A;  1YX5 B;  1WM2 A;  3WAP A;  2RDB C;  2KAN A;  2KC2 A;  4EKU A;  4EUT A;  1QF6 A;  1F1H A;  4DHJ D;  1QT9 A;  1WWT A;  1TKY A;  4II3 B;  4HJK A;  1T5X D;  2OJW A;  1WX8 A;  4ANV A;  2DHZ A;  2KHW B;  1ET6 A;  2LGS A;  3VDZ A;  4P1C C;  3RYT A;  2MJE A;  1QIL A;  2XN9 C;  1DGJ A;  2GB1 A;  1GC6 A;  2IDY A;  4A8X C;  3RN9 C;  4BBN F;  2ZVN A;  3DVN U;  2LD9 A;  2VH1 A;  4OHJ A;  2XK5 B;  4ZHO A;  1JWA D;  2FCN A;  2LRW A;  1R4N B;  2BT6 A;  2WXK A;  3ABV B;  1UGM A;  3NZ3 A;  2LVP A;  1NEK B;  2LAS A;  4AS1 A;  2KWD A;  2XEW A;  3DVG X;  3MJ5 A;  3MTN B;  4D2K A;  3RNE C;  1P1A A;  5E6P A;  3DHI C;  4K7S A;  2LUM A;  4FA6 A;  4LTU A;  3Q8F A;  4HXD A;  2DZI A;  2Y5P A;  3O65 B;  2G9H D;  1XO3 A;  3RFZ B;  4GOC A;  1BT0 A;  3HK0 A;  1H4R A;  4M0W A;  3DHH C;  1EU3 A;  3U2S C;  2HJ1 A;  3V05 A;  3ZJT A;  1GB1 A;  3RI7 C;  3W2D A;  3QWZ B;  1E8X A;  3A4R A;  3O13 A;  4G11 A;  4DWF A;  4WQM A;  3NVW A;  2N9P C;  1V5O A;  1GB4 A;  4AWJ A;  3Q69 A;  2IPK D;  2ZCB A;  2QIE B;  3P63 A;  3A4S C;  1DOX A;  2W3S A;  1E9M A;  5HFY A;  1HTO A;  3SU8 X;  2J0K A;  3KH0 A;  5LLI A;  5JZE B;  4PYZ A;  4NAM A;  2N9X A;  4MDK E;  2M0X A;  4ZOH C;  2K25 A;  1MVK A;  2VZK D;  2RR9 A;  3FIL A;  3AH7 A;  4KVG B;  4AUQ C;  1F77 A;  3CF6 E;  1KFY B;  4HDQ A;  2MWS B;  4BFR A;  5AZG A;  3AUL A;  4IKG A;  4HCP B;  2NPT B;  4E74 A;  1GNU A;  4M8M A;  2W55 A;  4KGT A;  2JXX A;  2GOW A;  4XDC A;  3AE2 B;  4AJW A;  3PSE B;  1TTN A;  1ZXH A;  2INC C;  1LM8 B;  1TZO A;  1JRU A;  1RM6 C;  4JX1 C;  2R2O A;  3TJP A;  1VDV A;  2WDV B;  2V3N A;  2BYV E;  3ENE A;  4UDU C;  1L6U A;  2GMI C;  2PVG C;  3PRE A;  2K6D B;  1F0Z A;  4MGK E;  3VAW A;  1L6V A;  3B2G A;  3L54 A;  1HZ5 A;  2KXJ A;  1FCL A;  1V9J A;  4X57 B;  4LNO A;  3B0A A;  2JXT A;  1K51 A;  1JCK B;  3Q3O C;  4GGQ A;  3DOW A;  3B2F A;  1RAX A;  1WGD A;  3LXF A;  2AL6 A;  4P16 A;  2ZZP B;  1I42 A;  3PPA A;  1WXQ A;  1SSN A;  2IND C;  1LO5 D;  2Z59 B;  1HQR D;  3L4P A;  4M02 A;  1N5W A;  5BYS A;  3ECI A;  4LDT D;  2AWT A;  1KTK A;  3NS1 A;  1S1Q B;  2TSS A;  2L00 B;  3ONS A;  2AQ2 B;  3HM3 A;  1YJI A;  4MH0 E;  2KT7 A;  1ENF A;  1WSP A;  1KLG D;  2PLP A;  3VR8 B;  1MI0 A;  1OFF A;  1XLN A;  3RCZ A;  1ZOY B;  4ICV A;  3VUW A;  5IKC M;  2CHW A;  4WWP A;  5CHV C;  1P7F A;  3VTU A;  3I57 A;  1EUV B;  4CYE A;  1P98 A;  3HVZ A;  4ZHP A;  3PZ7 A;  1WY8 A;  4KX6 B;  1HA5 A;  1TY0 A;  3DBL I;  4GDK A;  3HIZ A;  3N3K B;  3QCA A;  2ZNV C;  3GE8 C;  1U4A A;  3FAH A;  1ET9 A;  2AQ3 B;  1WRI A;  1T6B X;  2OHF A;  1YQB A;  1RLF A;  3K9P B;  2DEN B;  1UD7 A;  2D3B A;  4FJZ A;  3Q14 C;  2BB6 A;  1I35 A;  2CS4 A;  3AEA B;  1D6E C;  1PQS A;  3UQB A;  1LGR A;  5AUI A;  4RCO A;  2FIF A;  2J53 A;  1RFK A;  3GE3 C;  2JPH A;  2AL3 A;  5G5H A;  4JL9 A;  4KDL B;  1AW7 A;  1WGY A;  1N62 A;  2KN5 A;  2MQJ A;  4KIK A;  4FJY A;  1T0Q C;  1C76 A;  2FCM A;  3PLV A;  2K6Q A;  2NVU I;  2LFI A;  4KV2 A;  1I4H A;  2CR5 A;  3VH4 B;  5FKA C;  1E10 A;  3RZF A;  1S3S G;  2INN E;  1QOA A;  1I4R A;  3H7S A;  3PRP B;  2FUH B;  4WAA A;  3ALB A;  2RPV A;  3NZS A;  5J17 A;  4MJS B;  2B76 B;  1J0G A;  4US9 A;  2KYW A;  2PE6 B;  3A9K B;  4NAW A;  3KUZ A;  1ZXI A;  1NDD A;  2SEB D;  5JXV A;  2BQQ A;  4LNN A;  1C4P A;  2DZK A;  3DWM A;  4JPS A;  4WJN A;  2DYO A;  3Q3F A;  2K39 A;  5C23 A;  3CWI A;  2JZZ A;  1UF0 A;  1VCB A;  2H88 B;  1UBI A;  2DYB A;  4RGM A;  1WMH B;  3D32 A;  1KRH A;  1N63 A;  1QQR A;  3T9L A;  3KVF B;  2A4Z A;  3UF8 A;  2KJH B;  2EKI A;  2LRU A;  1V1O A;  3R7Q A;  1VJK A;  4YL8 A;  2B3A A;  2WWZ A;  3L0W B;  3UIN B;  1FXA A;  4MGI E;  4XGA B;  1SEB D;  4MSQ B;  1GJZ A;  2N9K A;  3SFE B;  2BBC A;  2WXM A;  1WFY A;  2KWC A;  4HPL B;  2BS3 B;  2E3T A;  1I7H A;  1HTQ A;  2W54 A;  1BUI C;  1SE4 A;  2KDB A;  3VRB B;  1I4G A;  3DWG C;  4KGR A;  5AZF A;  4M8N A;  4BKS A;  3TSS A;  4BKS D;  3UGB B;  2XBB C;  3AEB B;  1WMH A;  3NY5 A;  4L2Y A;  2WP9 B;  1N6Z A;  4PS3 A;  3RNG C;  1Q0W B;  3N9Y C;  3KW5 B;  4C00 A;  2VRR B;  2YEP B;  2LVQ A;  2QSD A;  4MM3 B;  2KFJ A;  4A90 A;  3ZW3 A;  4HPM B;  3PTF C;  4NQK E;  2MP2 A;  4YSZ B;  2JYT A;  3W1S A;  2DWQ A;  2BS4 B;  2FCQ A;  1UNS A;  2LXA A;  1JWS D;  1UWX A;  1WRD B;  1PUT A;  4BOZ B;  1GG3 A;  1E6E B;  1FNW A;  5HG2 A;  2DAF A;  2KMC A;  3ZNG C;  1ZPS A;  4DHJ B;  4PS8 A;  3CSF A;  2WXL A;  1M4V A;  4CO7 A;  1SE3 A;  3E56 A;  3HUI A;  4RF1 A;  4ITK A;  3VH3 B;  5G5G A;  3DBR B;  2M56 B;  5HKH A;  4OVU A;  3P4Q B;  4RH6 A;  1PGX A;  3BYT B;  1C77 A;  3I63 C;  1YN4 A;  1NYR A;  2DBY A;  3AED B;  4LNI A;  3M95 A;  4GDL A;  2KQ4 X;  3ZJV A;  1TS4 A;  1OTR B;  1TKG A;  2KWV B;  2BYT A;  1R4M B;  4F8C B;  2G4S A;  4XE0 A;  1ESF A;  2K1F A;  1VZ8 A;  2ZCC A;  3ZQ4 A;  3OJ3 A;  2GBJ A;  4AJY B;  3QIJ A;  2Y5C A;  1DOI A;  1WYG A;  2BKF A;  1H8C A;  4PK1 A;  1Q10 A;  2L52 A;  1C78 A;  1WYW B;  3AEC B;  3MP9 A;  1EF5 A;  1LQB A;  3SFD B;  4TQ1 A;  4LK0 M;  1IBX A;  1EU4 A;  2DLB A;  3TEW A;  4RGN A;  1FRD A;  2V9H A;  4F7Z A;  4XX5 A;  3KUD B;  3ML9 A;  5FK9 C;  2MBE A;  3EHV A;  3BYY B;  2R61 A;  1Z2M A;  1XCT L;  1WE7 A;  4GXB A;  1SE9 A;  4TUU A;  2O6V B;  2BWF A;  3R3M A;  2AX5 A;  3L17 A;  3U30 A;  2GBM A;  3SEB A;  3NZU A;  1HZ6 A;  2KMM A;  5IA7 A;  4N6E B;  1I4P A;  3UI3 A;  1YN5 A;  1UWM A;  1WXA A;  3AU5 A;  1OEY J;  1RWS A;  5EE3 A;  4W9E A;  1F9J A;  4DXG A;  3P4R B;  1ZDV A;  4MJS A;  2PKO A;  2GLS A;  2W82 A;  1KOT A;  1ZDX A;  4C56 C;  3MFG A;  3AE9 B;  1V86 A;  4GN1 A;  3N20 C;  1WJ4 A;  2MEK A;  1MHX A;  2Y5B B;  4TQ0 A;  3Q3J A;  2FAZ A;  4M01 A;  4PYU A;  4LJP B;  1WXS A;  4HK2 A;  5JH5 C;  3AE7 B;  3Q8E A;  1L4Z B;  2PW9 A;  5AUK A;  1T0Y A;  4RGO S;  5D94 A;  4DBG A;  4IG7 B;  5G55 A;  1LXD A;  2ZW0 A;  1IGD A;  3Q8C A;  2MHJ A;  1D5X C;  4NNJ B;  1NBF C;  2PIA A;  2XNA C;  5L83 A;  2BYF A;  2JSV X;  4REZ A;  4KKJ A;  1FNU A;  2LGI A;  2W3R A;  1XEE A;  3ZYY X;  4ZRJ A;  2N9L A;  2QEJ C;  3P42 A;  4JE3 B;  2Z8L A;  3ZRC A;  3QAR A;  1IYF A;  4A55 A;  1ZE3 D;  1TIF A;  1IPG A;  2RMM A;  3PRZ A;  1STE A;  2RGF A;  4W9L A;  2K22 A;  2L32 A;  1UEL A;  1TY2 A;  1A70 A;  2KK8 A;  4HRS A;  3M63 B;  1SJE D;  1YN3 A;  5LNK 1;  1XXG A;  4HDO A;  1FPY A;  3QJZ A;  3WAM A;  4NZL B;  3RMK C;  1XQQ A;  1SGH A;  3KQ4 A;  4NJ6 A;  2UYZ B;  3VFK A;  5TR5 A;  1SXT A;  2J4X A;  1SBB B;  1JRP A;  1GAQ B;  2N1W A;  1CMX B;  3APC A;  2WXN A;  1WGG A;  3JYU A;  1WZ3 A;  2L0T A;  3L10 B;  2IBI B;  1V1P B;  4XYC A;  4DDG D; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3RI7 C;  3Q2A C;  1T0R C;  3N1X C;  3N1Y C;  3Q14 C;  3RNF C;  3I5J C;  4P1C C;  3DHG C;  3RNG C;  2INC C;  2RDB C;  3N20 C;  3RNB C;  3GE8 C;  4P1B C;  3RNC C;  3Q3N C;  3DHH C;  3RNE C;  3GE3 C;  3N1Z C;  3Q3M C;  2IND C;  3RN9 C;  3DHI C;  3Q3O C;  1T0S C;  3RMK C;  3I63 C;  3RNA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...