3Q14C

Toluene 4 monooxygenase hd complex with p-cresol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords PENTAETHYLENE GLYCOL
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q14C00
3Q2AC 3N1XC 3Q14C 3Q3MC 3Q3NC 3Q3OC 3N20C 3I63C 3DHGC 4P1BC 3DHIC 3GE3C 3RNCC 3RMKC 3RNEC 3DHHC 3RNAC 2INCC 3GE8C 3RN9C 4P1CC 2RDBC 1T0RC 1T0QC 1T0SC 2INDC 3RNBC 3N1YC 3RNFC 3N1ZC 3RI7C 3I5JC 3RNGC
chains in the Genus database with same CATH superfamily
2KACA 2NBWB 5HFYA 4US9A 4HVBA 3A4SC 3T3NA 2FBWB 4MGYE 3A9KB 3ENEA 3ZRCA 1C1YB 3HK0A 3N3KB 2KYWA 1ZUD2 2L05A 1L5PA 1IBXA 1K53A 4OZAA 4XC2A 4WWMA 1NEKB 2NTTA 3PV1A 2OEDA 2BYEA 5IOIA 4BKSD 1C4PA 3JVZX 5D3DA 1L4DB 2LUEA 4TV3A 2MJ3A 1JWUD 2KDMA 4P6VF 3HIZA 1M4VA 3MHSD 1AARA 2LASA 2REXA 5FKAC 2WXIA 3KW5B 4HK2A 3VVWB 3O65B 5LNK1 1VCBA 3IXSA 2KFKA 4NQLB 1YD8U 2LZ6A 5IAAC 2CU1A 4EUTA 1YOVB 2MBQA 5E6JA 4URKA 5CHVC 4AUQC 3DBLI 3VAWA 2JWUA 2MWSB 4MDKE 3DVGX 2WXLA 2N9XA 3RFZB 3PZ7A 3QX1A 4BKTA 4FBJB 2ZVNA 1Y8RC 3OAWA 1I7HA 5G5HA 2WU2B 3ML8A 2AYOB 3ECIA 1V81A 2PKOA 4G11A 4ZRKA 4ARCA 2N9EB 3DBHI 2KWCA 4K7UA 1XF5L 1TKYA 1UGMA 4A9AA 1T0RC 1QOBA 2K1FA 4JX1C 2CS4A 4C7YA 1DOYA 4F8CB 1FNUA 4L23A 1ZDVA 1J7AA 2M19A 5LXHA 3E56A 4N6EB 3VH3B 1MI0A 4W9KA 4P1BC 1TKEA 2JX5A 2RMMA 2L76A 2WWZA 3FILB 2M56B 1GAQB 2J0JA 2WDTB 1C4CA 1PGAA 4WJQA 1JRUA 2PVGC 1WZ3A 3BVGA 4WAFA 2MW5A 3JSVA 2PJHA 1XEEA 4BOZB 1EF5A 2WLBA 2ICIA 1E7UA 2WXKA 3APCA 3I63C 2MBEA 2GBRA 2KZRA 1I4HA 3SR6A 1D5MC 4NJCA 1Z5SB 2WXRA 2WX1A 2KDBA 5HI1A 3AU5A 2H88B 2MBHA 1F77A 3EUB2 2LVPA 2KWUB 5E6PA 2QCZA 2J0MA 5LLIA 4GSWA 1NI3A 3N30A 2AQ1B 4BBNC 1KJTA 1TZOA 2JZZA 2K5PA 3VR8B 2ZZPB 2KX0A 3I9V1 4K1RB 2MH7A 3QAQA 3DOWA 1FFVA 3N1ZC 1UD7A 3GB1A 2C60A 3L16A 2KX3A 1P7EA 3NOBA 2DYBA 1DYQA 4W9GA 1L7YA 3M95A 1Z2MA 2MP2B 3EHVA 1PQSA 2KANA 4I6PA 1NYQA 2HJ1A 1L6UA 4IOIE 4BZAA 2MJDA 1TY2A 3L0WB 4ARIA 4KIKA 2D5GA 3RPFC 2W3SA 3MC8A 3SU8X 1ZXIA 3R2IA 4NAWA 4XZ4A 4BAXA 2O6VD 4IKGA 1FRDA 4JQWC 4OVZA 1UWMA 1Q0WB 1NI2A 1RLFA 3U4EG 2VRRB 3DBLB 4LJPB 2JRIB 1T0YA 2NR2A 4B95A 1NYRA 1WZ0A 3KUDB 1L0XB 2CHWA 2DENB 4BVUC 1S1QB 4M0WA 4ASWC 4N9F4 1VDVA 2AEHA 3UIPB 1TGZB 4KVGB 3PPAA 2WXQA 2MLBA 1SJED 5BYQA 5CTRC 1AYFA 1RRBA 1VR9A 5GXGB 5DPTA 2KTFA 3N1XC 2L00B 4LCDE 2OOBB 1HQRD 3ZJTA 1J8CA 1WYGA 2WXMA 4RGTA 2W9NA 1VZ7A 4XYCA 1JCKB 4AJWA 4CYEA 2LJIA 1Q1OA 3KWVA 1JWBD 3ZKJC 2CR5A 1WJUA 4EZLA 1XQQA 1D3ZA 3U7DA 4G0NB 3LXFA 3V3XA 2VH1A 3DHGC 1F9JA 1YJJA 4GLSC 2JSVX 3MHZA 2INCC 4EZJA 1IUEA 2KDIA 4WJNA 2IGDA 1T0QC 5D6JB 1EWYC 2KJRA 2FCQA 4PYUA 3RUIB 4A90A 1J0GA 3AU4A 4XDCA 3PRMB 1CZPA 2JF5A 3QJZA 2D3AA 2LVQA 3T8MA 1KLVA 2KVZA 3O13A 4IG7B 4K3CA 4PS7A 1QQRA 4YSXB 2RPQA 3ZYYX 4PS8A 2WXOA 1D5ZC 3DWGC 2C9WB 2WQYB 2AWTA 2LMCA 1TYGB 3VH4B 2YVCA 2K3UA 2E6XA 1NENB 1RYJA 1A70A 5TR5A 3R7RA 3SD5A 2G1EA 1FPYA 2BVCA 3RNAC 2KOXA 1R7SA 4NNJB 2J52A 1GB4A 4KZCA 3KYDD 3ZVVA 1RAXA 4LNFA 3ML9A 3PS6A 4RGMA 3AN1A 4KDIC 3VTUA 5JZEB 2KQ4X 1E90A 4ZHOA 1GUAB 3V6EB 2M17A 3RMKC 1DGJA 4FADA 1S3SG 2KXJA 1V86A 3TBLD 5MPOA 3BK1A 4W9JA 1NDDA 2OHFA 2WS3B 1V49A 2G4DB 4BBNF 3AE2B 3X23A 4G50A 4C4VA 2PPHA 4WIPA 1FCLA 5FK9C 2BBCA 1D4BA 3CWIA 1GNUA 2NTSA 3VFKA 1FO4A 2VH2A 2KHWB 2J42A 2MX2A 2I1JA 4RFBA 4GDKA 4LLGM 2LRWA 3R8BA 1WIAA 4MSMB 5CHFA 5IA7A 1EO6A 2INNE 1XCTL 2I38A 3PHWB 4KKIA 1FXIA 2K0PA 1E7PB 1PGBA 3OJ3A 2NCNA 4B6WA 5KHQA 2D3CA 1V1OA 4ZRQA 3URYA 3RNCC 2RGFA 2KTRA 3MP9A 1JRPA 2IO0B 1VRAB 1XCQL 4IDIA 3PLUA 2RD0A 5BO4B 1FNWA 2IGHA 1Y56A 1B9RA 4IWOA 2W82A 3CIRB 4LDTD 1H4RA 3T9LA 3R7QA 3AE5B 3NJTA 3HM6X 5KHOA 4ICUA 5BMIA 2KK8A 2WXHA 3HVDA 4E74A 3BYTB 3RN9C 2WXGA 2RR9A 3AEBB 3SFEB 1RFKA 1OEYJ 2M8SA 2AX5A 4M02A 5D7GA 1P1AA 3WAMA 3RNFC 3Q69A 1YQBA 2NPTB 3RD2A 4J3OD 4W9EA 2X38A 1FXTB 3GE3C 3DVNV 3L54A 2MRPA 2BW2A 3AI5A 4WH4A 3AE6B 1P98A 3MJ5A 3ZJVA 1QZEA 2QMTA 2NPTA 2L7RA 2V1YA 2N9PC 2WXPA 2V4IB 2LXAA 4A6QA 4DXFA 3IAM1 4PYZA 4GU2A 4DQOC 1XLPA 3CSFA 4MM3B 1KOTA 1N63A 2V3SA 2M1MA 2NBVB 4G3XB 1HA5A 1WXMA 3AB5A 3BINA 1SE9A 1ZW7A 1AWDA 1IGDA 4W9FA 2LVOA 4LJOB 1YN4A 4WQOB 2IYDB 1XLQA 3R3MA 4KSKC 4TKNA 2MBOA 3RNGC 2MJEA 4US8A 3WAOA 2LFIA 5BMHA 2BB6A 2D07B 1FMAD 2AQ2B 2FE8A 2KTRB 2IGGA 4ITKA 3V6CB 3TUOA 1WGHA 1WWTA 2V3PA 2HTME 3RZFA 1UH6A 1AN8A 2YLMA 5AZHA 2GB1A 3IT6B 3UQBA 3TMPB 3Q3JA 3BK2A 5HG2A 3DBRI 4DHZE 1FNVA 3AEDB 1X1MA 3DHHC 1F52A 3UGBB 4AWJA 3L08A 3WALA 2Z59B 3EGRA 3MFGA 4B0MA 1XT9B 5C2TB 3WCQA 3LYYA 4C4VB 1T3QA 4WWOA 2INDC 1L6VA 5G55A 3C19A 2LGIA 1WRDB 2D10A 1OQYA 3VR9B 3AEEB 3QARA 2KDFB 4ZDVA 4CO7A 4WJOA 1KFYB 2XK5A 5HKHA 2LUMA 4M00A 3ZIMA 4IWPA 2Z8LA 4C00A 1ESFA 3BYYB 3AE9B 4AS1A 2D3GA 4FN2A 2FIFA 4AOFA 2K8CA 5G5GA 1F2RC 3MC9A 2LI5A 1MPEA 3ZJUA 2KLCA 3PGEA 1ROEA 3SEBA 3MTNB 3VXWA 2N0SB 1MHHE 3AEGB 5AUKA 3X0WA 2YEPF 1V8CA 2KN5A 1R4MI 2KVRA 3GS2A 4LNKA 1PGXA 4GMVA 4ICVA 3EC8A 3Q6BA 2OJWA 1YN5A 4FHJA 3ZLZA 2B3AA 3FKYA 1QOGA 2XNAC 2WXNA 3PHXB 2LHDA 1UNSA 2GBMA 3B1LX 2L3ZA 2QJLA 2DHZA 3I3TB 2ZNVB 3HRDD 1V9JA 5C1ZA 2HDEA 3FAHA 4OZBA 4MH8A 2BYFA 4GOCA 4YT0B 5E6NA 3DWMA 2IY0B 2ON8A 2XEWA 1F0ZA 2L0FA 3NVZA 1SE2A 1N61A 3IVFA 3TEZA 4HPMB 3N20C 5EE3A 2GBJA 2KFJA 4A3PA 5AZFA 2DLBA 3VRAB 4WQMA 4B9KA 3GE8C 1IYFA 1YJ1A 2JYEA 2QILA 2DZJA 1ISNA 3NRZA 2LWPA 1PUTA 3IAS1 2INPE 3C8YA 2C7MB 4BFRA 4E71A 4KZ0A 5G2NA 5C23A 1WR6E 4GIVA 1TKGA 2XK5B 2A4ZA 1TBEA 1GJZA 3HM3A 2KN4A 4Q2JA 1QOAA 4JGHB 1DOXA 1C4AA 5IP4D 2KC2A 5H8YE 1YQ3B 3NVVA 3I57A 5EE9A 5JXVA 4YTMB 3Q8FA 3V61A 4MELA 4PT5A 1ZXHA 3Q8BA 2QHOA 4LK0M 3L13A 3DVNU 1L0VB 2JUOA 1WGKA 1WR1A 1T6BX 1SJHD 2M0AA 3DPDA 2L8JA 5LXIB 1STEA 2JU6X 1HTQA 4OHJA 2M0XA 3VUYA 3NVWA 1LXDA 2RDGA 5D3IB 1BXTA 2DZKA 2LJ5A 1PDXA 4HDQA 5BMGA 3AE3B 3M3JA 2KC1A 2X8XX 1ET9A 1ZDXA 4XX5A 3HVZA 4ZYNA 1P7FA 3W2DA 4DDGD 3H8HA 3LB8C 4M01A 4KIKB 4KV2A 2K9XA 4WWNA 5FR3A 2Y3AA 1L4ZB 2J7QB 2WHIA 3AEAB 3L17A 2L0TA 3PTFC 1C76A 4ANUA 2JY6A 2MP2A 4GN1A 3BY4B 2QIEB 3NZSA 3NZUA 3B08A 3EFCA 2XBBC 3N9YC 4N58A 3NHEB 1YX6B 4MM3A 1I4GA 2RDBC 1WJ6A 1I4QA 3W1SC 4DHJD 1MVKA 3UF8A 3RYTA 1FD6A 3VTVA 1GB1A 4W9IA 2WYQA 4MGKE 3UI3A 1NVID 2CJOA 2HE7A 2K6QA 2PLPA 3L4PA 1TS3A 4GGQA 4RMAA 3B9JA 4MT5A 3H6NA 4A8XC 2J53A 4FJZA 2EMSA 1BT0A 4NY0A 1P0RA 4FULA 1JMLA 1EM7A 1JALA 2DAJA 3AE7B 1QF6A 4X57B 2FAZA 4M8MA 4S17A 3TJPA 1XLOA 3P4RB 5DPRA 2GOWA 1D5XC 2QEJC 4XGAB 4P7IA 3GP7A 3VRBB 1E5WA 4LNIA 3W1YA 3JSVB 4HEA1 2B76B 4K81A 2KJHB 2BS4B 2Y5CA 5J2RA 2BS2B 2M4NA 3Q8EA 2HTHA 1P9DU 4DDID 2NMQA 2N7JA 2L1AA 3K9OB 1N60A 1I42A 1UF0A 2V4LA 3H1UA 3M62B 1TJEA 2ONQA 3N1YC 4KSLC 4JPSA 3NS8A 4II2B 4AJYB 4GDKB 3ZNHB 4D2KA 2I1KA 3P4PB 1Q5WB 4HKZE 2G45B 3DDCB 3AEFB 3RNEC 2MHJA 1H8CA 4TSSA 3GZNB 1RM6C 2GBNA 2LXCA 4IUMB 3PLVA 1YMHE 5CHWA 3ZNGC 2E3TA 4ZHPA 1SE3A 4JWSC 1SGHA 2IZVB 3RCZA 1C77A 3QWZB 1WGRA 3ZNZB 1QKZA 2N9LA 4O1NA 4XDDA 2KO3A 1U4AA 1WGYA 2IY1B 1E8ZA 3SFDB 4FLHA 4NJ6A 1JWMD 1E6EB 1OEYA 2PE6B 2R61A 4HRSA 4XE0A 4ANXA 3ZXRA 1KH0A 2AL6A 2Y5BB 3AULA 4TQ0A 3BVZA 2KKCA 2GMIC 5E6OA 1IBXB 1WJNA 2QSDA 4ZRPA 4A55A 2CJNA 2SAKA 4FA6A 4YL8A 2BGFA 3B0AA 2IJ0A 3CMMB 3NZ3A 1ACCA 4C80A 2Q5WD 2V0GA 2EKIA 1RFAA 1I4XA 2JZPA 1F1HA 3RULA 4ZOHC 3H7PA 2A5UA 4RGNA 1JWAD 2JWZA 5GMVA 4B0EA 3CSTA 1J7CA 3Q14C 3B2FA 3TEWA 2WXJA 4W9HA 1WGDA 1HTOA 4NAMA 3Q8CA 1TZ1A 2D2QA 2FIDA 1FXAA 2LGXA 2QC8A 4JLCA 1BUIC 2KLGA 1P3QU 2BWFA 1FCCC 1F2RI 4YSYB 3H9DA 4YTNB 3PZDA 2G9HD 3FC4A 2BPSA 4E3CA 1EU3A 3NG0A 4USAA 1ZKHA 2SEBD 2PVOD 2JPHA 1SIFA 3IG3A 4ANWA 3VHTC 1CQVA 2CKHB 2UU7A 1UBIA 5T8IA 4NQKE 2LGYA 2JRHA 4LDTB 4M0WB 2LHEA 3JW0X 3TL5A 2BQQA 3WAPA 1OFFA 4OZCA 5IKCM 3S2AA 1E0ZA 3Q3FA 2AL3A 2W54A 4CQNA 2JVCA 5IN7A 4TUUA 2KQSA 3A33B 2BKRB 3Q3NC 4KGRA 3AMZA 2BF8B 1T5XD 4MJSA 1TS5A 4XWTA 4BOSC 3MJWA 3ZUNA 4NAWB 2FCSA 3ZW3A 2DAFA 3QQ8B 1ZGUB 2TSSA 5AUIA 1UWXA 2Y5PA 2ZCCA 2GBKA 3A4RA 1MJDA 1WMHB 3TEXA 3UQAA 4REZA 1VJKA 1OQRA 3ZGZA 2IO2B 3WIMA 3V05A 2PTLA 4MACA 4TMAB 3OG5A 4K7SA 3SDLC 4AP4C 5IO9A 2DZIA 1E10A 1QT9A 3APFA 2K8BA 2WDQB 3NVYA 1JW9D 3AXCA 1B1ZA 5HHDG 3U30A 3TSSA 2W3RA 2N7EA 1TY0A 4RH6A 4YTPB 1HZ5A 3P2BA 3Q2AC 2R2QA 2PW9A 3M63B 3W9CB 2C5LC 3A9JB 2W55A 4DWFA 1SEBD 5EE1A 2D3BA 3BZDB 3H7SA 4F7ZA 3P63A 3IFWB 2ZPNA 3PZ8A 2MSED 4RF0A 2N1VA 4H2AA 1T0SC 4IC7B 1XO3A 4OW0A 4KDLB 3RI7C 1FFUA 2DYMA 1IGCA 2KDEB 4IM2A 1YX5B 3KQ4A 4RM8A 1VZ6A 1Q10A 2DWQA 1WM3A 4WJPA 1K52A 1SB3C 4DXAB 2G4SA 2Z0EB 2RDHA 2WX0A 5I4DA 3EFUA 1BMLC 2ACZB 1HE8A 4NZLB 2V3NA 3IBEA 1KTKA 3FILA 2AQ3B 4DXGA 4PK1A 3OLMD 3QHTA 4DBGA 2O6VA 1E8YA 3EA6A 3K9PB 2J4XA 2L52A 2K39A 1WYWB 2JZ3B 2KNBA 1NBFC 4RM9A 1WX7A 2DYOA 1N62A 1C3TA 4JE3B 2L83A 3PSEB 1EF1A 4IWQA 4MSQB 3KUZA 4HLEA 2BTEA 4HKQA 3ZDMC 2VZKD 2WGSA 3LJ3A 3CF6E 1FEHA 3RNBC 1TT5B 2ZW1A 4C7ZA 1K50A 2ZPYA 2KMCA 5DCNA 4RF1A 4NPNA 1YN3A 3WA0A 1KF6B 4L1BA 3APDA 3AE8B 2JQRB 1SE4A 4KGSA 2KFKB 4FHKA 1UGJA 4ACFA 3W1SA 1V1PA 4P16A 4BKGA 3QA8A 1ET6A 3PT2B 5D2MB 5AZGA 3E9SA 4MEMA 1V5OA 2LGDA 3QCAA 1HXYD 2ASQA 3B2GA 2C7NB 5L83A 2ZCBA 2J0KA 4IM0A 4BKSA 1WRIA 1XXGA 4W9CA 1N6ZA 4S0RA 4IW0A 2N1WA 1G6JA 3Q3OC 1LO5D 4EKUA 3A9KA 3P4QB 1SF0A 3ALBA 2KQ7A 1KM7A 4DHZB 1EUVB 4LNNA 3V62A 4N59A 1C78A 5DPSA 1WY8A 1FIQA 1QLBB 1OTRB 2HJ8A 5JH5C 1I4RA 2OJRA 1UZXB 3NY5A 4F1SA 2JXTA 1GOZA 2K8HA 2CHXA 1XD3B 4ZRJA 1V80A 3DCGA 4FJYA 3NUHB 3ONSA 2MEKA 1ZE3D 1OGWA 5FR6A 3RT3B 1IPGA 4IM3A 2N4FA 4RGOS 3ZTDA 2IDYA 3L10B 1MFWA 2DNFA 4GXBA 4K7WA 1GPXA 3ETRA 4MGIE 1I4PA 1QILA 4TQ1A 3A1QB 3A1QA 4GDLA 2BYTA 1UBQA 5EDSA 1YJIA 3VUXA 2IO1B 2BYVE 4JL9A 3ZXVA 3D32A 3P4SB 5J18A 1R4MB 1AW7A 2ZJDA 3GOEA 4FXCA 2WNMA 1WJ4A 3N32A 4YWGG 1A5RA 4PS3A 2KWVB 1HZ6A 2IBIB 2VZKB 2KWDA 1E7VA 4R3DA 5AEKB 3ZNID 4II3B 3VQIA 2XN9C 4KKJA 3ZDTA 1JROA 2ZNVC 4DHJB 1YIWA 2JYTA 4JIOU 3R2TA 4HJKA 4ANVA 4RNAA 2HD5B 1VZ8A 4RCOA 1GG3A 2L32A 2ZW0A 2WDRB 1PFDA 2KMAA 2V9HA 4HJGE 1WH3A 3AECB 1E8XA 3J9CA 3V60A 3KH0A 3NS1A 2H89B 3T3OA 3DBRB 3DBHB 5JHAA 2LRUA 3BIID 1K51A 3DHIC 2O2VB 1LQBA 4AQ7A 1TS2A 2LEKA 1CMXB 1EWCA 4WAAA 4L2YA 1FRRA 1R4NB 3U52E 4UDUC 3VTWA 1VD2A 1V1PB 3PVLA 3EECA 2BB5A 5L95C 1LGRA 1WE7A 1LM8B 2K25A 4W9LA 3ZQ4A 1WF9A 5DPWA 2DX5B 1TIFA 2FUG1 3QK0A 2PIAA 2KD0A 1EU4A 2K6DB 2BS3B 1SXTA 2IO3B 1C79A 4P1CC 4A20A 2RPVA 4EEWA 2PE9A 1WXAA 1SSNA 4ZYSA 5TSSA 4LNOA 1ZPSA 3Q3MC 4EFOA 4NJ7A 1KLGD 4EZKA 1V5TA 4WWPA 1MHXA 4XWWA 1N5XA 2WXFA 3ZRFA 3KLSX 2DZMA 3JYUA 1SIJA 3IHPC 1L0YB 3QC8B 1E8WA 2CHZA 2GLSA 2BWES 5H92C 2MBBB 3PRPB 2O6VB 1UUPA 2NVUI 3TIXA 2LD9A 2FUHB 2EKEC 2UYZB 2N7DA 1ZP0B 2RSUA 1YNTE 3UINB 2BT6A 5J17A 3BWUD 4M8NA 4EOYA 1WXSA 1ZOYB 4KX6B 2KJ6A 1WFYA 3VUWA 4C56C 1OQQA 4HWIB 3W5VB 1M94A 4DK5A 1JQ4A 3ZTCA 1RWSA 3AM9A 4CHKA 4KGTA 2K22A 1ENFA 1WE6A 4QAYA 1FM0D 2JT4B 2C7HA 2UWQA 1N5WA 3LDZE 2NS5A 1SBBB 2WDVB 3MC0B 3QIJA 1GC6A 3P42A 4OVUA 1IP9A 1WSPA 1VLBA 2MCNB 2MQJA 1WI0A 3DBSA 3KUCB 2KMMA 3A9JA 4GB9A 1UELA 2PMVA 5C3JB 3U8ZA 2CU3A 2KAJA 3W5UB 1YQ4B 3R66C 3AE1B 2Z0DB 4A3OA 1CJEA 3Q8AA 3HHMA 1L2NA 3PREA 1WXQA 4ZRIA 1LFDA 2BKFA 4HCNB 1C9FA 3OJ4B 2WP9B 2O2VA 1KLUD 3BVMA 4HXDA 2ZEQA 4LTUA 4W9DA 3C0RB 3ZO5B 1XLNA 2LGSA 1WGGA 1WMHA 2IPKD 4HROA 3TEYA 1DOIA 2I2YA 4MJSB 3U2SC 2MA9B 2JXXA 4FJVB 5BYSA 1CK1A 2D11A 1KRHA 2NBUA 1D6EC 3UIOB 5D94A 5JHBA 1MG4A 1WX9A 1JWSD 4OVVA 4JWUC 1TTNA 4HPLB 3KWLA 5BYRA 1WM2A 1V97A 2FCNA 1I35A 3PRZA 1K8RB 3U7ZA 3PO0A 2R2OA 3P1MA 4YSZB 1MG8A 4MH0E 3KYCD 4WURA 4HCPB 2GI9A 1GC7A 2GRIA 2G3QB 1E9MA 1WXVA 2YEPB 2PEAA 3AE4B 4GDLB 3OWEB 3TCAA 5CX3A 4I6LB 3IT4B 3RZWC 1PYWD 1J19A 2EELA 3ABVB 2DBYA 2KT7A 2ZVOA 3GZNI 4HPPA 3AV8A 2EMTA 1J7BA 1TS4A 3VDZA 1HEZE 1R4NI 1WX8A 2FCMA 2N9KA 3DVGY 1V6EA 5EE0A 3AH7A 2FNJB 4I6NB 4YXDB 4HDOA 4J6IA 4EE2A 1V2YA 2WU5B 4MGZE 4K3BA 3KVFB 3WANA 3SHQA 3DQVA 3HUIA 1QOFA 2QDFA 3H7PB 3I5JC
chains in the Genus database with same CATH topology
3Q2AC 3N1XC 3Q14C 3Q3MC 3Q3NC 3Q3OC 3N20C 3I63C 3DHGC 4P1BC 3DHIC 3GE3C 3RNCC 3RMKC 3RNEC 3DHHC 3RNAC 2INCC 3GE8C 3RN9C 4P1CC 2RDBC 1T0RC 1T0QC 1T0SC 2INDC 3RNBC 3N1YC 3RNFC 3N1ZC 3RI7C 3I5JC 3RNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2A C;  3N1X C;  3Q14 C;  3Q3M C;  3Q3N C;  3Q3O C;  3N20 C;  3I63 C;  3DHG C;  4P1B C;  3DHI C;  3GE3 C;  3RNC C;  3RMK C;  3RNE C;  3DHH C;  3RNA C;  2INC C;  3GE8 C;  3RN9 C;  4P1C C;  2RDB C;  1T0R C;  1T0Q C;  1T0S C;  2IND C;  3RNB C;  3N1Y C;  3RNF C;  3N1Z C;  3RI7 C;  3I5J C;  3RNG C; 
#chains in the Genus database with same CATH topology
 2KAC A;  2NBW B;  5HFY A;  4US9 A;  4HVB A;  3A4S C;  3T3N A;  2FBW B;  4MGY E;  3A9K B;  3ENE A;  3ZRC A;  1C1Y B;  3HK0 A;  3N3K B;  2KYW A;  1ZUD 2;  2L05 A;  1L5P A;  1IBX A;  1K53 A;  4OZA A;  4XC2 A;  4WWM A;  1NEK B;  2NTT A;  3PV1 A;  2OED A;  2BYE A;  5IOI A;  4BKS D;  1C4P A;  3JVZ X;  5D3D A;  1L4D B;  2LUE A;  4TV3 A;  2MJ3 A;  1JWU D;  2KDM A;  4P6V F;  3HIZ A;  1M4V A;  3MHS D;  1AAR A;  2LAS A;  2REX A;  5FKA C;  2WXI A;  3KW5 B;  4HK2 A;  3VVW B;  3O65 B;  5LNK 1;  1VCB A;  3IXS A;  2KFK A;  4NQL B;  1YD8 U;  2LZ6 A;  5IAA C;  2CU1 A;  4EUT A;  1YOV B;  2MBQ A;  5E6J A;  4URK A;  5CHV C;  4AUQ C;  3DBL I;  3VAW A;  2JWU A;  2MWS B;  4MDK E;  3DVG X;  2WXL A;  2N9X A;  3RFZ B;  3PZ7 A;  3QX1 A;  4BKT A;  4FBJ B;  2ZVN A;  1Y8R C;  3OAW A;  1I7H A;  5G5H A;  2WU2 B;  3ML8 A;  2AYO B;  3ECI A;  1V81 A;  2PKO A;  4G11 A;  4ZRK A;  4ARC A;  2N9E B;  3DBH I;  2KWC A;  4K7U A;  1XF5 L;  1TKY A;  1UGM A;  4A9A A;  1T0R C;  1QOB A;  2K1F A;  4JX1 C;  2CS4 A;  4C7Y A;  1DOY A;  4F8C B;  1FNU A;  4L23 A;  1ZDV A;  1J7A A;  2M19 A;  5LXH A;  3E56 A;  4N6E B;  3VH3 B;  1MI0 A;  4W9K A;  4P1B C;  1TKE A;  2JX5 A;  2RMM A;  2L76 A;  2WWZ A;  3FIL B;  2M56 B;  1GAQ B;  2J0J A;  2WDT B;  1C4C A;  1PGA A;  4WJQ A;  1JRU A;  2PVG C;  1WZ3 A;  3BVG A;  4WAF A;  2MW5 A;  3JSV A;  2PJH A;  1XEE A;  4BOZ B;  1EF5 A;  2WLB A;  2ICI A;  1E7U A;  2WXK A;  3APC A;  3I63 C;  2MBE A;  2GBR A;  2KZR A;  1I4H A;  3SR6 A;  1D5M C;  4NJC A;  1Z5S B;  2WXR A;  2WX1 A;  2KDB A;  5HI1 A;  3AU5 A;  2H88 B;  2MBH A;  1F77 A;  3EUB 2;  2LVP A;  2KWU B;  5E6P A;  2QCZ A;  2J0M A;  5LLI A;  4GSW A;  1NI3 A;  3N30 A;  2AQ1 B;  4BBN C;  1KJT A;  1TZO A;  2JZZ A;  2K5P A;  3VR8 B;  2ZZP B;  2KX0 A;  3I9V 1;  4K1R B;  2MH7 A;  3QAQ A;  3DOW A;  1FFV A;  3N1Z C;  1UD7 A;  3GB1 A;  2C60 A;  3L16 A;  2KX3 A;  1P7E A;  3NOB A;  2DYB A;  1DYQ A;  4W9G A;  1L7Y A;  3M95 A;  1Z2M A;  2MP2 B;  3EHV A;  1PQS A;  2KAN A;  4I6P A;  1NYQ A;  2HJ1 A;  1L6U A;  4IOI E;  4BZA A;  2MJD A;  1TY2 A;  3L0W B;  4ARI A;  4KIK A;  2D5G A;  3RPF C;  2W3S A;  3MC8 A;  3SU8 X;  1ZXI A;  3R2I A;  4NAW A;  4XZ4 A;  4BAX A;  2O6V D;  4IKG A;  1FRD A;  4JQW C;  4OVZ A;  1UWM A;  1Q0W B;  1NI2 A;  1RLF A;  3U4E G;  2VRR B;  3DBL B;  4LJP B;  2JRI B;  1T0Y A;  2NR2 A;  4B95 A;  1NYR A;  1WZ0 A;  3KUD B;  1L0X B;  2CHW A;  2DEN B;  4BVU C;  1S1Q B;  4M0W A;  4ASW C;  4N9F 4;  1VDV A;  2AEH A;  3UIP B;  1TGZ B;  4KVG B;  3PPA A;  2WXQ A;  2MLB A;  1SJE D;  5BYQ A;  5CTR C;  1AYF A;  1RRB A;  1VR9 A;  5GXG B;  5DPT A;  2KTF A;  3N1X C;  2L00 B;  4LCD E;  2OOB B;  1HQR D;  3ZJT A;  1J8C A;  1WYG A;  2WXM A;  4RGT A;  2W9N A;  1VZ7 A;  4XYC A;  1JCK B;  4AJW A;  4CYE A;  2LJI A;  1Q1O A;  3KWV A;  1JWB D;  3ZKJ C;  2CR5 A;  1WJU A;  4EZL A;  1XQQ A;  1D3Z A;  3U7D A;  4G0N B;  3LXF A;  3V3X A;  2VH1 A;  3DHG C;  1F9J A;  1YJJ A;  4GLS C;  2JSV X;  3MHZ A;  2INC C;  4EZJ A;  1IUE A;  2KDI A;  4WJN A;  2IGD A;  1T0Q C;  5D6J B;  1EWY C;  2KJR A;  2FCQ A;  4PYU A;  3RUI B;  4A90 A;  1J0G A;  3AU4 A;  4XDC A;  3PRM B;  1CZP A;  2JF5 A;  3QJZ A;  2D3A A;  2LVQ A;  3T8M A;  1KLV A;  2KVZ A;  3O13 A;  4IG7 B;  4K3C A;  4PS7 A;  1QQR A;  4YSX B;  2RPQ A;  3ZYY X;  4PS8 A;  2WXO A;  1D5Z C;  3DWG C;  2C9W B;  2WQY B;  2AWT A;  2LMC A;  1TYG B;  3VH4 B;  2YVC A;  2K3U A;  2E6X A;  1NEN B;  1RYJ A;  1A70 A;  5TR5 A;  3R7R A;  3SD5 A;  2G1E A;  1FPY A;  2BVC A;  3RNA C;  2KOX A;  1R7S A;  4NNJ B;  2J52 A;  1GB4 A;  4KZC A;  3KYD D;  3ZVV A;  1RAX A;  4LNF A;  3ML9 A;  3PS6 A;  4RGM A;  3AN1 A;  4KDI C;  3VTU A;  5JZE B;  2KQ4 X;  1E90 A;  4ZHO A;  1GUA B;  3V6E B;  2M17 A;  3RMK C;  1DGJ A;  4FAD A;  1S3S G;  2KXJ A;  1V86 A;  3TBL D;  5MPO A;  3BK1 A;  4W9J A;  1NDD A;  2OHF A;  2WS3 B;  1V49 A;  2G4D B;  4BBN F;  3AE2 B;  3X23 A;  4G50 A;  4C4V A;  2PPH A;  4WIP A;  1FCL A;  5FK9 C;  2BBC A;  1D4B A;  3CWI A;  1GNU A;  2NTS A;  3VFK A;  1FO4 A;  2VH2 A;  2KHW B;  2J42 A;  2MX2 A;  2I1J A;  4RFB A;  4GDK A;  4LLG M;  2LRW A;  3R8B A;  1WIA A;  4MSM B;  5CHF A;  5IA7 A;  1EO6 A;  2INN E;  1XCT L;  2I38 A;  3PHW B;  4KKI A;  1FXI A;  2K0P A;  1E7P B;  1PGB A;  3OJ3 A;  2NCN A;  4B6W A;  5KHQ A;  2D3C A;  1V1O A;  4ZRQ A;  3URY A;  3RNC C;  2RGF A;  2KTR A;  3MP9 A;  1JRP A;  2IO0 B;  1VRA B;  1XCQ L;  4IDI A;  3PLU A;  2RD0 A;  5BO4 B;  1FNW A;  2IGH A;  1Y56 A;  1B9R A;  4IWO A;  2W82 A;  3CIR B;  4LDT D;  1H4R A;  3T9L A;  3R7Q A;  3AE5 B;  3NJT A;  3HM6 X;  5KHO A;  4ICU A;  5BMI A;  2KK8 A;  2WXH A;  3HVD A;  4E74 A;  3BYT B;  3RN9 C;  2WXG A;  2RR9 A;  3AEB B;  3SFE B;  1RFK A;  1OEY J;  2M8S A;  2AX5 A;  4M02 A;  5D7G A;  1P1A A;  3WAM A;  3RNF C;  3Q69 A;  1YQB A;  2NPT B;  3RD2 A;  4J3O D;  4W9E A;  2X38 A;  1FXT B;  3GE3 C;  3DVN V;  3L54 A;  2MRP A;  2BW2 A;  3AI5 A;  4WH4 A;  3AE6 B;  1P98 A;  3MJ5 A;  3ZJV A;  1QZE A;  2QMT A;  2NPT A;  2L7R A;  2V1Y A;  2N9P C;  2WXP A;  2V4I B;  2LXA A;  4A6Q A;  4DXF A;  3IAM 1;  4PYZ A;  4GU2 A;  4DQO C;  1XLP A;  3CSF A;  4MM3 B;  1KOT A;  1N63 A;  2V3S A;  2M1M A;  2NBV B;  4G3X B;  1HA5 A;  1WXM A;  3AB5 A;  3BIN A;  1SE9 A;  1ZW7 A;  1AWD A;  1IGD A;  4W9F A;  2LVO A;  4LJO B;  1YN4 A;  4WQO B;  2IYD B;  1XLQ A;  3R3M A;  4KSK C;  4TKN A;  2MBO A;  3RNG C;  2MJE A;  4US8 A;  3WAO A;  2LFI A;  5BMH A;  2BB6 A;  2D07 B;  1FMA D;  2AQ2 B;  2FE8 A;  2KTR B;  2IGG A;  4ITK A;  3V6C B;  3TUO A;  1WGH A;  1WWT A;  2V3P A;  2HTM E;  3RZF A;  1UH6 A;  1AN8 A;  2YLM A;  5AZH A;  2GB1 A;  3IT6 B;  3UQB A;  3TMP B;  3Q3J A;  3BK2 A;  5HG2 A;  3DBR I;  4DHZ E;  1FNV A;  3AED B;  1X1M A;  3DHH C;  1F52 A;  3UGB B;  4AWJ A;  3L08 A;  3WAL A;  2Z59 B;  3EGR A;  3MFG A;  4B0M A;  1XT9 B;  5C2T B;  3WCQ A;  3LYY A;  4C4V B;  1T3Q A;  4WWO A;  2IND C;  1L6V A;  5G55 A;  3C19 A;  2LGI A;  1WRD B;  2D10 A;  1OQY A;  3VR9 B;  3AEE B;  3QAR A;  2KDF B;  4ZDV A;  4CO7 A;  4WJO A;  1KFY B;  2XK5 A;  5HKH A;  2LUM A;  4M00 A;  3ZIM A;  4IWP A;  2Z8L A;  4C00 A;  1ESF A;  3BYY B;  3AE9 B;  4AS1 A;  2D3G A;  4FN2 A;  2FIF A;  4AOF A;  2K8C A;  5G5G A;  1F2R C;  3MC9 A;  2LI5 A;  1MPE A;  3ZJU A;  2KLC A;  3PGE A;  1ROE A;  3SEB A;  3MTN B;  3VXW A;  2N0S B;  1MHH E;  3AEG B;  5AUK A;  3X0W A;  2YEP F;  1V8C A;  2KN5 A;  1R4M I;  2KVR A;  3GS2 A;  4LNK A;  1PGX A;  4GMV A;  4ICV A;  3EC8 A;  3Q6B A;  2OJW A;  1YN5 A;  4FHJ A;  3ZLZ A;  2B3A A;  3FKY A;  1QOG A;  2XNA C;  2WXN A;  3PHX B;  2LHD A;  1UNS A;  2GBM A;  3B1L X;  2L3Z A;  2QJL A;  2DHZ A;  3I3T B;  2ZNV B;  3HRD D;  1V9J A;  5C1Z A;  2HDE A;  3FAH A;  4OZB A;  4MH8 A;  2BYF A;  4GOC A;  4YT0 B;  5E6N A;  3DWM A;  2IY0 B;  2ON8 A;  2XEW A;  1F0Z A;  2L0F A;  3NVZ A;  1SE2 A;  1N61 A;  3IVF A;  3TEZ A;  4HPM B;  3N20 C;  5EE3 A;  2GBJ A;  2KFJ A;  4A3P A;  5AZF A;  2DLB A;  3VRA B;  4WQM A;  4B9K A;  3GE8 C;  1IYF A;  1YJ1 A;  2JYE A;  2QIL A;  2DZJ A;  1ISN A;  3NRZ A;  2LWP A;  1PUT A;  3IAS 1;  2INP E;  3C8Y A;  2C7M B;  4BFR A;  4E71 A;  4KZ0 A;  5G2N A;  5C23 A;  1WR6 E;  4GIV A;  1TKG A;  2XK5 B;  2A4Z A;  1TBE A;  1GJZ A;  3HM3 A;  2KN4 A;  4Q2J A;  1QOA A;  4JGH B;  1DOX A;  1C4A A;  5IP4 D;  2KC2 A;  5H8Y E;  1YQ3 B;  3NVV A;  3I57 A;  5EE9 A;  5JXV A;  4YTM B;  3Q8F A;  3V61 A;  4MEL A;  4PT5 A;  1ZXH A;  3Q8B A;  2QHO A;  4LK0 M;  3L13 A;  3DVN U;  1L0V B;  2JUO A;  1WGK A;  1WR1 A;  1T6B X;  1SJH D;  2M0A A;  3DPD A;  2L8J A;  5LXI B;  1STE A;  2JU6 X;  1HTQ A;  4OHJ A;  2M0X A;  3VUY A;  3NVW A;  1LXD A;  2RDG A;  5D3I B;  1BXT A;  2DZK A;  2LJ5 A;  1PDX A;  4HDQ A;  5BMG A;  3AE3 B;  3M3J A;  2KC1 A;  2X8X X;  1ET9 A;  1ZDX A;  4XX5 A;  3HVZ A;  4ZYN A;  1P7F A;  3W2D A;  4DDG D;  3H8H A;  3LB8 C;  4M01 A;  4KIK B;  4KV2 A;  2K9X A;  4WWN A;  5FR3 A;  2Y3A A;  1L4Z B;  2J7Q B;  2WHI A;  3AEA B;  3L17 A;  2L0T A;  3PTF C;  1C76 A;  4ANU A;  2JY6 A;  2MP2 A;  4GN1 A;  3BY4 B;  2QIE B;  3NZS A;  3NZU A;  3B08 A;  3EFC A;  2XBB C;  3N9Y C;  4N58 A;  3NHE B;  1YX6 B;  4MM3 A;  1I4G A;  2RDB C;  1WJ6 A;  1I4Q A;  3W1S C;  4DHJ D;  1MVK A;  3UF8 A;  3RYT A;  1FD6 A;  3VTV A;  1GB1 A;  4W9I A;  2WYQ A;  4MGK E;  3UI3 A;  1NVI D;  2CJO A;  2HE7 A;  2K6Q A;  2PLP A;  3L4P A;  1TS3 A;  4GGQ A;  4RMA A;  3B9J A;  4MT5 A;  3H6N A;  4A8X C;  2J53 A;  4FJZ A;  2EMS A;  1BT0 A;  4NY0 A;  1P0R A;  4FUL A;  1JML A;  1EM7 A;  1JAL A;  2DAJ A;  3AE7 B;  1QF6 A;  4X57 B;  2FAZ A;  4M8M A;  4S17 A;  3TJP A;  1XLO A;  3P4R B;  5DPR A;  2GOW A;  1D5X C;  2QEJ C;  4XGA B;  4P7I A;  3GP7 A;  3VRB B;  1E5W A;  4LNI A;  3W1Y A;  3JSV B;  4HEA 1;  2B76 B;  4K81 A;  2KJH B;  2BS4 B;  2Y5C A;  5J2R A;  2BS2 B;  2M4N A;  3Q8E A;  2HTH A;  1P9D U;  4DDI D;  2NMQ A;  2N7J A;  2L1A A;  3K9O B;  1N60 A;  1I42 A;  1UF0 A;  2V4L A;  3H1U A;  3M62 B;  1TJE A;  2ONQ A;  3N1Y C;  4KSL C;  4JPS A;  3NS8 A;  4II2 B;  4AJY B;  4GDK B;  3ZNH B;  4D2K A;  2I1K A;  3P4P B;  1Q5W B;  4HKZ E;  2G45 B;  3DDC B;  3AEF B;  3RNE C;  2MHJ A;  1H8C A;  4TSS A;  3GZN B;  1RM6 C;  2GBN A;  2LXC A;  4IUM B;  3PLV A;  1YMH E;  5CHW A;  3ZNG C;  2E3T A;  4ZHP A;  1SE3 A;  4JWS C;  1SGH A;  2IZV B;  3RCZ A;  1C77 A;  3QWZ B;  1WGR A;  3ZNZ B;  1QKZ A;  2N9L A;  4O1N A;  4XDD A;  2KO3 A;  1U4A A;  1WGY A;  2IY1 B;  1E8Z A;  3SFD B;  4FLH A;  4NJ6 A;  1JWM D;  1E6E B;  1OEY A;  2PE6 B;  2R61 A;  4HRS A;  4XE0 A;  4ANX A;  3ZXR A;  1KH0 A;  2AL6 A;  2Y5B B;  3AUL A;  4TQ0 A;  3BVZ A;  2KKC A;  2GMI C;  5E6O A;  1IBX B;  1WJN A;  2QSD A;  4ZRP A;  4A55 A;  2CJN A;  2SAK A;  4FA6 A;  4YL8 A;  2BGF A;  3B0A A;  2IJ0 A;  3CMM B;  3NZ3 A;  1ACC A;  4C80 A;  2Q5W D;  2V0G A;  2EKI A;  1RFA A;  1I4X A;  2JZP A;  1F1H A;  3RUL A;  4ZOH C;  3H7P A;  2A5U A;  4RGN A;  1JWA D;  2JWZ A;  5GMV A;  4B0E A;  3CST A;  1J7C A;  3Q14 C;  3B2F A;  3TEW A;  2WXJ A;  4W9H A;  1WGD A;  1HTO A;  4NAM A;  3Q8C A;  1TZ1 A;  2D2Q A;  2FID A;  1FXA A;  2LGX A;  2QC8 A;  4JLC A;  1BUI C;  2KLG A;  1P3Q U;  2BWF A;  1FCC C;  1F2R I;  4YSY B;  3H9D A;  4YTN B;  3PZD A;  2G9H D;  3FC4 A;  2BPS A;  4E3C A;  1EU3 A;  3NG0 A;  4USA A;  1ZKH A;  2SEB D;  2PVO D;  2JPH A;  1SIF A;  3IG3 A;  4ANW A;  3VHT C;  1CQV A;  2CKH B;  2UU7 A;  1UBI A;  5T8I A;  4NQK E;  2LGY A;  2JRH A;  4LDT B;  4M0W B;  2LHE A;  3JW0 X;  3TL5 A;  2BQQ A;  3WAP A;  1OFF A;  4OZC A;  5IKC M;  3S2A A;  1E0Z A;  3Q3F A;  2AL3 A;  2W54 A;  4CQN A;  2JVC A;  5IN7 A;  4TUU A;  2KQS A;  3A33 B;  2BKR B;  3Q3N C;  4KGR A;  3AMZ A;  2BF8 B;  1T5X D;  4MJS A;  1TS5 A;  4XWT A;  4BOS C;  3MJW A;  3ZUN A;  4NAW B;  2FCS A;  3ZW3 A;  2DAF A;  3QQ8 B;  1ZGU B;  2TSS A;  5AUI A;  1UWX A;  2Y5P A;  2ZCC A;  2GBK A;  3A4R A;  1MJD A;  1WMH B;  3TEX A;  3UQA A;  4REZ A;  1VJK A;  1OQR A;  3ZGZ A;  2IO2 B;  3WIM A;  3V05 A;  2PTL A;  4MAC A;  4TMA B;  3OG5 A;  4K7S A;  3SDL C;  4AP4 C;  5IO9 A;  2DZI A;  1E10 A;  1QT9 A;  3APF A;  2K8B A;  2WDQ B;  3NVY A;  1JW9 D;  3AXC A;  1B1Z A;  5HHD G;  3U30 A;  3TSS A;  2W3R A;  2N7E A;  1TY0 A;  4RH6 A;  4YTP B;  1HZ5 A;  3P2B A;  3Q2A C;  2R2Q A;  2PW9 A;  3M63 B;  3W9C B;  2C5L C;  3A9J B;  2W55 A;  4DWF A;  1SEB D;  5EE1 A;  2D3B A;  3BZD B;  3H7S A;  4F7Z A;  3P63 A;  3IFW B;  2ZPN A;  3PZ8 A;  2MSE D;  4RF0 A;  2N1V A;  4H2A A;  1T0S C;  4IC7 B;  1XO3 A;  4OW0 A;  4KDL B;  3RI7 C;  1FFU A;  2DYM A;  1IGC A;  2KDE B;  4IM2 A;  1YX5 B;  3KQ4 A;  4RM8 A;  1VZ6 A;  1Q10 A;  2DWQ A;  1WM3 A;  4WJP A;  1K52 A;  1SB3 C;  4DXA B;  2G4S A;  2Z0E B;  2RDH A;  2WX0 A;  5I4D A;  3EFU A;  1BML C;  2ACZ B;  1HE8 A;  4NZL B;  2V3N A;  3IBE A;  1KTK A;  3FIL A;  2AQ3 B;  4DXG A;  4PK1 A;  3OLM D;  3QHT A;  4DBG A;  2O6V A;  1E8Y A;  3EA6 A;  3K9P B;  2J4X A;  2L52 A;  2K39 A;  1WYW B;  2JZ3 B;  2KNB A;  1NBF C;  4RM9 A;  1WX7 A;  2DYO A;  1N62 A;  1C3T A;  4JE3 B;  2L83 A;  3PSE B;  1EF1 A;  4IWQ A;  4MSQ B;  3KUZ A;  4HLE A;  2BTE A;  4HKQ A;  3ZDM C;  2VZK D;  2WGS A;  3LJ3 A;  3CF6 E;  1FEH A;  3RNB C;  1TT5 B;  2ZW1 A;  4C7Z A;  1K50 A;  2ZPY A;  2KMC A;  5DCN A;  4RF1 A;  4NPN A;  1YN3 A;  3WA0 A;  1KF6 B;  4L1B A;  3APD A;  3AE8 B;  2JQR B;  1SE4 A;  4KGS A;  2KFK B;  4FHK A;  1UGJ A;  4ACF A;  3W1S A;  1V1P A;  4P16 A;  4BKG A;  3QA8 A;  1ET6 A;  3PT2 B;  5D2M B;  5AZG A;  3E9S A;  4MEM A;  1V5O A;  2LGD A;  3QCA A;  1HXY D;  2ASQ A;  3B2G A;  2C7N B;  5L83 A;  2ZCB A;  2J0K A;  4IM0 A;  4BKS A;  1WRI A;  1XXG A;  4W9C A;  1N6Z A;  4S0R A;  4IW0 A;  2N1W A;  1G6J A;  3Q3O C;  1LO5 D;  4EKU A;  3A9K A;  3P4Q B;  1SF0 A;  3ALB A;  2KQ7 A;  1KM7 A;  4DHZ B;  1EUV B;  4LNN A;  3V62 A;  4N59 A;  1C78 A;  5DPS A;  1WY8 A;  1FIQ A;  1QLB B;  1OTR B;  2HJ8 A;  5JH5 C;  1I4R A;  2OJR A;  1UZX B;  3NY5 A;  4F1S A;  2JXT A;  1GOZ A;  2K8H A;  2CHX A;  1XD3 B;  4ZRJ A;  1V80 A;  3DCG A;  4FJY A;  3NUH B;  3ONS A;  2MEK A;  1ZE3 D;  1OGW A;  5FR6 A;  3RT3 B;  1IPG A;  4IM3 A;  2N4F A;  4RGO S;  3ZTD A;  2IDY A;  3L10 B;  1MFW A;  2DNF A;  4GXB A;  4K7W A;  1GPX A;  3ETR A;  4MGI E;  1I4P A;  1QIL A;  4TQ1 A;  3A1Q B;  3A1Q A;  4GDL A;  2BYT A;  1UBQ A;  5EDS A;  1YJI A;  3VUX A;  2IO1 B;  2BYV E;  4JL9 A;  3ZXV A;  3D32 A;  3P4S B;  5J18 A;  1R4M B;  1AW7 A;  2ZJD A;  3GOE A;  4FXC A;  2WNM A;  1WJ4 A;  3N32 A;  4YWG G;  1A5R A;  4PS3 A;  2KWV B;  1HZ6 A;  2IBI B;  2VZK B;  2KWD A;  1E7V A;  4R3D A;  5AEK B;  3ZNI D;  4II3 B;  3VQI A;  2XN9 C;  4KKJ A;  3ZDT A;  1JRO A;  2ZNV C;  4DHJ B;  1YIW A;  2JYT A;  4JIO U;  3R2T A;  4HJK A;  4ANV A;  4RNA A;  2HD5 B;  1VZ8 A;  4RCO A;  1GG3 A;  2L32 A;  2ZW0 A;  2WDR B;  1PFD A;  2KMA A;  2V9H A;  4HJG E;  1WH3 A;  3AEC B;  1E8X A;  3J9C A;  3V60 A;  3KH0 A;  3NS1 A;  2H89 B;  3T3O A;  3DBR B;  3DBH B;  5JHA A;  2LRU A;  3BII D;  1K51 A;  3DHI C;  2O2V B;  1LQB A;  4AQ7 A;  1TS2 A;  2LEK A;  1CMX B;  1EWC A;  4WAA A;  4L2Y A;  1FRR A;  1R4N B;  3U52 E;  4UDU C;  3VTW A;  1VD2 A;  1V1P B;  3PVL A;  3EEC A;  2BB5 A;  5L95 C;  1LGR A;  1WE7 A;  1LM8 B;  2K25 A;  4W9L A;  3ZQ4 A;  1WF9 A;  5DPW A;  2DX5 B;  1TIF A;  2FUG 1;  3QK0 A;  2PIA A;  2KD0 A;  1EU4 A;  2K6D B;  2BS3 B;  1SXT A;  2IO3 B;  1C79 A;  4P1C C;  4A20 A;  2RPV A;  4EEW A;  2PE9 A;  1WXA A;  1SSN A;  4ZYS A;  5TSS A;  4LNO A;  1ZPS A;  3Q3M C;  4EFO A;  4NJ7 A;  1KLG D;  4EZK A;  1V5T A;  4WWP A;  1MHX A;  4XWW A;  1N5X A;  2WXF A;  3ZRF A;  3KLS X;  2DZM A;  3JYU A;  1SIJ A;  3IHP C;  1L0Y B;  3QC8 B;  1E8W A;  2CHZ A;  2GLS A;  2BWE S;  5H92 C;  2MBB B;  3PRP B;  2O6V B;  1UUP A;  2NVU I;  3TIX A;  2LD9 A;  2FUH B;  2EKE C;  2UYZ B;  2N7D A;  1ZP0 B;  2RSU A;  1YNT E;  3UIN B;  2BT6 A;  5J17 A;  3BWU D;  4M8N A;  4EOY A;  1WXS A;  1ZOY B;  4KX6 B;  2KJ6 A;  1WFY A;  3VUW A;  4C56 C;  1OQQ A;  4HWI B;  3W5V B;  1M94 A;  4DK5 A;  1JQ4 A;  3ZTC A;  1RWS A;  3AM9 A;  4CHK A;  4KGT A;  2K22 A;  1ENF A;  1WE6 A;  4QAY A;  1FM0 D;  2JT4 B;  2C7H A;  2UWQ A;  1N5W A;  3LDZ E;  2NS5 A;  1SBB B;  2WDV B;  3MC0 B;  3QIJ A;  1GC6 A;  3P42 A;  4OVU A;  1IP9 A;  1WSP A;  1VLB A;  2MCN B;  2MQJ A;  1WI0 A;  3DBS A;  3KUC B;  2KMM A;  3A9J A;  4GB9 A;  1UEL A;  2PMV A;  5C3J B;  3U8Z A;  2CU3 A;  2KAJ A;  3W5U B;  1YQ4 B;  3R66 C;  3AE1 B;  2Z0D B;  4A3O A;  1CJE A;  3Q8A A;  3HHM A;  1L2N A;  3PRE A;  1WXQ A;  4ZRI A;  1LFD A;  2BKF A;  4HCN B;  1C9F A;  3OJ4 B;  2WP9 B;  2O2V A;  1KLU D;  3BVM A;  4HXD A;  2ZEQ A;  4LTU A;  4W9D A;  3C0R B;  3ZO5 B;  1XLN A;  2LGS A;  1WGG A;  1WMH A;  2IPK D;  4HRO A;  3TEY A;  1DOI A;  2I2Y A;  4MJS B;  3U2S C;  2MA9 B;  2JXX A;  4FJV B;  5BYS A;  1CK1 A;  2D11 A;  1KRH A;  2NBU A;  1D6E C;  3UIO B;  5D94 A;  5JHB A;  1MG4 A;  1WX9 A;  1JWS D;  4OVV A;  4JWU C;  1TTN A;  4HPL B;  3KWL A;  5BYR A;  1WM2 A;  1V97 A;  2FCN A;  1I35 A;  3PRZ A;  1K8R B;  3U7Z A;  3PO0 A;  2R2O A;  3P1M A;  4YSZ B;  1MG8 A;  4MH0 E;  3KYC D;  4WUR A;  4HCP B;  2GI9 A;  1GC7 A;  2GRI A;  2G3Q B;  1E9M A;  1WXV A;  2YEP B;  2PEA A;  3AE4 B;  4GDL B;  3OWE B;  3TCA A;  5CX3 A;  4I6L B;  3IT4 B;  3RZW C;  1PYW D;  1J19 A;  2EEL A;  3ABV B;  2DBY A;  2KT7 A;  2ZVO A;  3GZN I;  4HPP A;  3AV8 A;  2EMT A;  1J7B A;  1TS4 A;  3VDZ A;  1HEZ E;  1R4N I;  1WX8 A;  2FCM A;  2N9K A;  3DVG Y;  1V6E A;  5EE0 A;  3AH7 A;  2FNJ B;  4I6N B;  4YXD B;  4HDO A;  4J6I A;  4EE2 A;  1V2Y A;  2WU5 B;  4MGZ E;  4K3B A;  3KVF B;  3WAN A;  3SHQ A;  3DQV A;  3HUI A;  1QOF A;  2QDF A;  3H7P B;  3I5J C; 
#chains in the Genus database with same CATH homology
 3Q2A C;  3N1X C;  3Q14 C;  3Q3M C;  3Q3N C;  3Q3O C;  3N20 C;  3I63 C;  3DHG C;  4P1B C;  3DHI C;  3GE3 C;  3RNC C;  3RMK C;  3RNE C;  3DHH C;  3RNA C;  2INC C;  3GE8 C;  3RN9 C;  4P1C C;  2RDB C;  1T0R C;  1T0Q C;  1T0S C;  2IND C;  3RNB C;  3N1Y C;  3RNF C;  3N1Z C;  3RI7 C;  3I5J C;  3RNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...