3Q14C

Toluene 4 monooxygenase hd complex with p-cresol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PENTAETHYLENE GLYCOL
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q14C00
3N1YC 3RMKC 2RDBC 3RNFC 3RI7C 3RNBC 3N1ZC 3Q3OC 3I63C 3RNAC 3RNGC 1T0RC 3DHHC 3RNEC 3Q14C 3GE3C 3DHIC 3Q3MC 3Q2AC 1T0SC 3GE8C 3RNCC 3N1XC 3DHGC 2INCC 3I5JC 3RN9C 1T0QC 3Q3NC 4P1BC 2INDC 3N20C 4P1CC
chains in the Genus database with same CATH superfamily
2KVRA 2N9LA 3GS2A 1OEYJ 4KKJA 2C7NB 1D3ZA 1I4PA 3V61A 3WAMA 4WIPA 5T8IA 4W9KA 3T9LA 4ZHPA 2JVCA 2MX2A 3AE9B 2D5GA 4ANVA 2LI5A 4M8NA 4MT5A 4C7YA 3Q8CA 1AYFA 1FEHA 1A70A 2RDGA 1D4BA 1E9MA 2W82A 4W9HA 2FIFA 4TQ1A 4ZRPA 4YXDB 1J0GA 4NY0A 1WX8A 4IUMB 3BIID 1C78A 4W9IA 3AH7A 2KN5A 1CK1A 2MJEA 3UF8A 2LGIA 1PGXA 3BYTB 1E7VA 3SD5A 1GC7A 3IT4B 3OLMD 4HCPB 3U52E 2BPSA 3ENEA 2WXRA 2RDHA 5H8YE 4S17A 2Y3AA 2KMCA 2BB6A 1UD7A 1E6EB 4N58A 4LLGM 2IPKD 2DENB 1N6ZA 2IO0B 4FN2A 4LJOB 1ZE3D 3SDLC 3VUYA 2C60A 1FNVA 4E3CA 4WJOA 1WGGA 1JWSD 1YOVB 3DPDA 3Q3JA 2N9PC 2WXMA 4FHKA 2HTME 2QEJC 2IY0B 2NS5A 1GB4A 3GE3C 1NENB 3AMZA 2WXFA 1DOXA 2KNBA 4JLCA 3MHSD 2NPTB 2QMTA 1EWCA 5D2MB 3UIOB 2D2QA 4W9CA 4MM3B 2JPHA 4ANUA 2MJDA 3KYDD 5LNK1 2M0AA 2WXJA 2YLMA 5AEKB 2ASQA 2MWSB 2PKOA 3PV1A 3BK2A 2QSDA 5EDSA 2FUG1 1UZXB 2BYVE 1L4ZB 5AZGA 2WXPA 3V60A 2CU3A 2H88B 4IDIA 2WYQA 1NBFC 1WRDB 4ICVA 4XWTA 1YX5B 3NOBA 4NQKE 4NAWB 2LJ5A 1MG4A 1LXDA 1SE2A 5DPSA 2K5PA 1L7YA 1FXIA 4PYZA 4IM0A 1ZW7A 3WCQA 2KACA 1UGJA 3H7PB 3DWMA 3Q8FA 3BINA 1TS2A 1L0XB 2LVPA 3NVVA 3HM3A 4LDTD 2MBHA 4HLEA 3DHGC 3HHMA 2Z8LA 4XDDA 1T0QC 3PREA 4LNKA 3QARA 4JWSC 1WJ6A 4PS3A 5TSSA 4PS7A 3SHQA 1SXTA 2N7DA 1JW9D 3R8BA 2KX0A 4II3B 1WH3A 4OHJA 3IT6B 3ZW3A 3ZTCA 2BS3B 2PPHA 2V3PA 2AEHA 1GUAB 1VCBA 1WM2A 2MP2A 2J42A 4XE0A 2N9EB 4R3DA 4L23A 2MJ3A 2IO3B 1WM3A 1Q5WB 3IAM1 2GBMA 1AWDA 2XN9C 2GRIA 3BYYB 4OVZA 3AB5A 4URKA 2MRPA 5LXIB 1VJKA 4ZYNA 3ML8A 2MW5A 1T6BX 2BTEA 3R3MA 3R7QA 3EC8A 3N1XC 2MEKA 1V8CA 1OTRB 5DCNA 4B0EA 3TEWA 4TUUA 2WU5B 2DHZA 3BVGA 3KVFB 4E71A 1IPGA 3DBHB 4AS1A 3I63C 2DX5B 2ZW0A 5LLIA 4I6PA 3TJPA 4A20A 2LVQA 1FCCC 3DHIC 3W2DA 4MGYE 2CR5A 1IGDA 1VLBA 4KSKC 3PLVA 1EO6A 1QF6A 3B2FA 2LEKA 5JXVA 2IDYA 4BKGA 2KQ7A 1C76A 3Q8EA 5L83A 1I4XA 4FJZA 2KDFB 4BBNC 1SIFA 5HI1A 2K8BA 1YQBA 1T3QA 3MC9A 1V1OA 5BYSA 1OQYA 4OW0A 3ALBA 4MSQB 4WAAA 3AE2B 1QT9A 3HM6X 3RMKC 3ZJUA 2MSED 1L6UA 3CMMB 1SE4A 1S3SG 3FILA 2IBIB 1JWUD 5EE0A 3Q3OC 3DBRB 4DWFA 1AN8A 5D94A 2IO1B 3UI3A 5D3IB 3Q3MC 4HJKA 1XT9B 2BYEA 1I4RA 4NZLB 3NZSA 3I9V1 2W9NA 1JMLA 4BAXA 2BF8B 4DHJB 2V1YA 1FMAD 1WR1A 1E10A 4F8CB 3UQBA 2B3AA 4GN1A 3H1UA 1FXAA 2DZJA 5CX3A 1C3TA 3O13A 1E7PB 2M0XA 3I3TB 1B9RA 3DBLB 1U4AA 3AE1B 4JIOU 3AE6B 5C2TB 1TYGB 1WGRA 1D5XC 2K3UA 2KDBA 4BOZB 1K51A 3BZDB 1V1PA 5CHFA 2ZCBA 5KHQA 3HVZA 3AU4A 5BMGA 2VH2A 1FXTB 2WXIA 5JHBA 1I4QA 3P4SB 2FCMA 4HKQA 4RCOA 3QK0A 4G0NB 3DWGC 1WX9A 3ABVB 4JGHB 2MA9B 1RAXA 2R2QA 1JWMD 1UWXA 1TY2A 2ZW1A 4F7ZA 1Y56A 2M4NA 4MDKE 4HK2A 1LO5D 3LYYA 3M62B 2V3SA 3HVDA 4US9A 1WXMA 2IY1B 1MG8A 1RLFA 1L2NA 1JALA 1KLUD 4GLSC 3VXWA 2D10A 2WDRB 5KHOA 3NHEB 4K3BA 1VD2A 4WJPA 3KH0A 4H2AA 3OJ3A 1I35A 2FBWB 4CHKA 3PZ7A 3EFUA 3A9KA 3AI5A 2WXLA 2KKCA 1ENFA 4XGAB 2ZJDA 2HDEA 3PS6A 1TJEA 4I6LB 1I4HA 3P4PB 4WQMA 4MGIE 2D3CA 3IBEA 3DBLI 5CHVC 1WE6A 3B0AA 4WH4A 1NI2A 2MQJA 2KAJA 1J7CA 3BVMA 1HZ6A 2BKFA 2LASA 5AZFA 2KQ4X 2LD9A 3QJZA 1WXSA 1V5OA 2DBYA 3NVWA 2WX1A 1XCTL 1N5XA 1OQRA 2IGGA 4A90A 4LNFA 3SEBA 3PHXB 1FO4A 4D2KA 1BUIC 4IM3A 1FPYA 3ZVVA 3KUDB 2BWFA 4P7IA 2PMVA 4IC7B 4HJGE 1CMXB 1YNTE 1J8CA 4A9AA 4XYCA 3VQIA 1L4DB 3A9JA 5I4DA 2QIEB 3APDA 3LDZE 4HCNB 5D7GA 3L4PA 5DPTA 1WZ3A 4W9LA 2WX0A 1QOGA 2W3RA 4DHJD 1UWMA 2G4DB 3VH3B 3CIRB 1HTOA 4RGMA 4WWOA 3PZDA 1P98A 3ZDMC 3UGBB 5BYQA 3NZ3A 1HA5A 2KT7A 1WGDA 3J9CA 2KFKA 1Z5SB 1C9FA 4P6VF 4S0RA 2M17A 1NEKB 2JXXA 1WXQA 1SEBD 2LRWA 5JHAA 1V97A 3AN1A 1FNUA 4LTUA 4TQ0A 2PVGC 4A6QA 5EE1A 1C4CA 3ML9A 2BKRB 1ACCA 5IAAC 2E6XA 4MSMB 2OHFA 1V9JA 4G3XB 4XC2A 1VZ8A 1FFUA 2RMMA 4B95A 2BYFA 2KXJA 2XK5B 2ICIA 2FNJB 1XLNA 3RNFC 4G11A 1KFYB 3PHWB 4CYEA 3ZNZB 5GXGB 2VRRB 1M4VA 3H7SA 3W9CB 2V0GA 1TIFA 3WAOA 4A8XC 4BKTA 4OZCA 1KLVA 3E9SA 4JX1C 4DDID 2D3AA 2KTFA 4RNAA 3OG5A 2OEDA 1UH6A 3I5JC 1C4AA 1VZ6A 4IM2A 1GOZA 4NAMA 4EKUA 1L0YB 3EGRA 1QZEA 2V9HA 2KLGA 2BS4B 3P4RB 2SEBD 3ETRA 4ASWC 2PIAA 3IG3A 4L2YA 1SGHA 4ANXA 2WLBA 1SBBB 4M0WA 1EF1A 2DAFA 3ONSA 2EELA 2NBWB 4FHJA 5E6NA 1WY8A 3QA8A 4ZRKA 1V6EA 2J52A 1WGKA 4A3PA 1LGRA 2BGFA 4WJNA 3X23A 4A3OA 1WXAA 4ZDVA 1PYWD 1HEZE 2V3NA 1V5TA 1CZPA 2C9WB 4MELA 3QIJA 3RULA 2MLBA 4KKIA 4M02A 2WHIA 5BMIA 4XWWA 1R4NI 3VDZA 5IKCM 4IKGA 1TT5B 3KW5B 3M3JA 4RM8A 1PGBA 2PE9A 2PLPA 2WNMA 3GOEA 4ACFA 1TTNA 4B9KA 1L6VA 4N59A 2PVOD 1KF6B 3Q3FA 2LUEA 1WFYA 1V2YA 4MJSB 3U7ZA 4KIKB 4CQNA 2LVOA 2OJRA 4ANWA 1FRDA 4IG7B 4MGZE 4RF0A 2L52A 2INDC 4RFBA 1RWSA 2A4ZA 3SR6A 3VTWA 4FJVB 4ZYSA 4WWNA 1UGMA 5CTRC 2KFJA 1LM8B 4J3OD 4OZAA 3ZGZA 1NI3A 3TEYA 3V6CB 2JZZA 2W3SA 3URYA 3P2BA 1EWYC 4NJ6A 4GB9A 1KOTA 3AEFB 1HXYD 2WU2B 4MACA 3U30A 3R2TA 3LB8C 2RD0A 1ZXIA 4LNOA 1IGCA 5HHDG 1QKZA 1DGJA 1PGAA 1WXVA 3NG0A 2JRIB 5MPOA 2X8XX 2YEPB 3JSVB 3ZKJC 2I1KA 4USAA 3M95A 3P4QB 1MI0A 2QILA 3HK0A 2JX5A 3KLSX 1T5XD 2JZ3B 3AV8A 1N63A 2LGSA 4PYUA 3PRPB 1YIWA 1UUPA 1WWTA 2REXA 3Q14C 4XDCA 2QCZA 5C1ZA 5H92C 3LJ3A 4II2B 3A33B 2BBCA 1J19A 2LRUA 1QOFA 2AL3A 3AEEB 4AP4C 2WXGA 2RDBC 1OFFA 1WGYA 5AUIA 4J6IA 3ZQ4A 2KTRB 5G5GA 2AL6A 1NVID 1UELA 3B2GA 5J2RA 1MVKA 1JWAD 2KVZA 2L05A 2N4FA 1GG3A 4HKZE 1EUVB 3NVYA 1NDDA 2AQ3B 1KRHA 4AJWA 2K0PA 1XQQA 3WANA 4ZRIA 1IYFA 4ZRQA 4GDKB 1KLGD 1C1YB 2NPTA 1JQ4A 1XEEA 3R2IA 4A55A 3VVWB 2PE6B 1YN5A 4MM3A 3NY5A 3O65B 2NBVB 2Y5CA 3D32A 4NJCA 4AUQC 4NNJB 2M56B 2NBUA 3A1QB 5BO4B 2FCNA 3Q8AA 1GC6A 3RCZA 2UU7A 3FAHA 2OOBB 4EFOA 2GI9A 3L0WB 1IBXB 4RGTA 1P7FA 4WWPA 1JWBD 3V3XA 4Q2JA 1A5RA 4NJ7A 3V6EB 4LNIA 3N30A 2XNAC 1K8RB 4ICUA 3PTFC 2L8JA 2N1VA 1D5ZC 1F2RI 1QQRA 5FKAC 3W5UB 3VHTC 3RNGC 4B6WA 4NAWA 4ZOHC 5C23A 4GGQA 1TZOA 3IVFA 2LUMA 3UQAA 2AQ1B 5HFYA 2AX5A 3FC4A 2KMMA 3EA6A 5FK9C 4BKSD 2LGYA 3AE5B 1JRUA 4ZRJA 4LCDE 2JY6A 3RN9C 1B1ZA 4OVVA 3NS8A 1V86A 2CJNA 2I38A 2Y5PA 2O6VB 1UF0A 3H7PA 2ZEQA 2ON8A 1WMHA 4JWUC 1BXTA 3ZUNA 4FLHA 1E7UA 2O2VB 4C4VB 5J17A 2D3BA 1YX6B 4K7UA 2K8CA 1E8WA 3JVZX 3ZNGC 4TKNA 5EE3A 3TSSA 2EMSA 1YQ3B 1EU4A 4KGSA 3W1SA 3AU5A 4P1CC 2R61A 3DBSA 4TSSA 2J7QB 3FKYA 4DQOC 2DYOA 1K50A 3U2SC 1E8YA 4I6NB 2MCNB 4K7SA 2K6DB 4HPMB 1RYJA 4M00A 2W55A 2J0KA 4HWIB 1MJDA 1VZ7A 2NR2A 4GDLB 1ZGUB 1J7BA 1TY0A 3DVGY 1ISNA 1N61A 3SFDB 3TL5A 1XLQA 3KUZA 2DWQA 1Z2MA 4GOCA 4EZKA 3AXCA 1ET9A 2KYWA 3VTUA 3QCAA 4DXFA 2D07B 3GB1A 3N32A 1DYQA 2JZPA 4GXBA 2KO3A 2KFKB 1GAQB 3C19A 3P1MA 3OJ4B 4YTPB 3DCGA 5E6JA 1F9JA 2N9XA 1K52A 1R7SA 1YJIA 1K53A 1RRBA 2L0TA 5BYRA 1ET6A 2KJ6A 3R66C 1F2RC 2K6QA 4DK5A 2KLCA 4C80A 1UBIA 1N60A 1WJ4A 4W9DA 4C56C 3IFWB 4W9FA 2JWUA 3ZJTA 4YWGG 2FCQA 2J53A 2CHZA 3Q2AC 1P3QU 1AARA 3PSEB 1HE8A 1WYGA 3HUIA 3W1SC 1MHHE 1R4MI 1SJHD 4DXGA 1WI0A 4MH0E 1I4GA 2DZMA 2HD5B 1SE3A 1D5MC 3ZLZA 3OAWA 4RMAA 4W9GA 4HDQA 3X0WA 3L17A 3CSFA 1QLBB 3R7RA 4ITKA 1DOYA 2KWDA 5D3DA 2L76A 2MBBB 2FAZA 2L7RA 3M63B 5BMHA 4FA6A 2HJ8A 1TKEA 1V49A 4YSYB 1OGWA 3RNAC 2IZVB 4FADA 2LHEA 1ZKHA 2L3ZA 2L83A 3VFKA 2LHDA 1QILA 2QHOA 1M94A 4YL8A 3A4SC 3Q8BA 2JQRB 3WA0A 2GBKA 1TBEA 3VUXA 1FNWA 2O6VD 4K3CA 1PDXA 1PFDA 1FFVA 3ZO5B 2WP9B 3ZIMA 1C79A 2LXCA 4IWPA 4IWQA 2FCSA 2BVCA 1ROEA 2DLBA 3KWLA 3WIMA 1E0ZA 1QOBA 1F0ZA 4HROA 2Y5BB 2INNE 4KX6B 2ZZPB 2KDMA 2RSUA 2Z59B 4C00A 5IN7A 1PUTA 2SAKA 3RZWC 1Q0WB 1RFAA 2FE8A 3ZTDA 2EKIA 1WF9A 4EEWA 2WXKA 2DYMA 1C4PA 4GU2A 2K39A 4KDLB 3ZNID 1NYQA 4OZBA 2QJLA 1T0YA 2AQ2B 2JU6X 1R4NB 4ARCA 3N1ZC 1YN4A 5IO9A 3C8YA 4O1NA 2WS3B 4XX5A 4GMVA 2KC2A 3S2AA 2BB5A 2BWES 5HG2A 4PT5A 4HPPA 4YTMB 2IO2B 2WWZA 3BWUD 1OQQA 4WWMA 1F77A 5GMVA 3AULA 3H8HA 2LZ6A 2A5UA 3ZXRA 4MGKE 1ZP0B 2KD0A 2JXTA 3VH4B 2TSSA 2W54A 2GBJA 2I2YA 3HRDD 4FXCA 2MHJA 3B08A 4JL9A 3RNEC 3PT2B 5DPRA 1YJJA 2N1WA 1T0SC 2WQYB 3K9OB 4DXAB 5IA7A 3TIXA 1VRAB 3ZJVA 3GP7A 4CO7A 1YJ1A 1LQBA 1ZUD2 1TS5A 3QWZB 3IHPC 1KM7A 4RGOS 3QHTA 1SB3C 3NJTA 2KQSA 3PLUA 1UBQA 3NS1A 4BZAA 4BVUC 3Q6BA 3W5VB 3CWIA 4YT0B 4US8A 1FM0D 4FJYA 3T3OA 4KGRA 1X1MA 3VRBB 1SIJA 1H4RA 2RR9A 2BT6A 2JWZA 4HVBA 1AW7A 2N9KA 4DBGA 1TS3A 4G50A 1MHXA 2GMIC 2MP2B 2KDIA 3EECA 3VR9B 1VDVA 5JH5C 3DVNU 3B1LX 4LK0M 3T8MA 2GBNA 3EHVA 3QX1A 3QQ8B 3L10B 3APCA 1PQSA 1UNSA 2YEPF 3RUIB 2FUHB 2X38A 1HZ5A 4KZ0A 2R2OA 4KZCA 5FR6A 2EMTA 3U7DA 3RPFC 3N3KB 2AYOB 1EF5A 2ZNVC 3AE3B 1MPEA 2KX3A 4RM9A 3SU8X 3ZYYX 2C7MB 2ZVOA 2BYTA 1Q1OA 1YQ4B 4BFRA 1VR9A 3PO0A 3MC0B 2LFIA 3QC8B 2EKEC 1WIAA 3VR8B 1N5WA 1WRIA 2RPVA 1WSPA 2WXQA 3DHHC 4RF1A 2BQQA 4K81A 3K9PB 3RZFA 1G6JA 1WJNA 4FULA 4EZJA 2WDQB 2INPE 1FD6A 2Z0EB 3AE8B 2QC8A 2PEAA 2Q5WD 2D3GA 5E6PA 2PW9A 2ZPYA 3TMPB 1ESFA 2KK8A 5G55A 1SSNA 2XK5A 3W1YA 3FILB 1QOAA 4GSWA 1WX7A 3GZNB 2RPQA 4QAYA 5LXHA 1F1HA 2LGXA 1WZ0A 3Q69A 1SE9A 1GNUA 3QAQA 4AWJA 2GOWA 2JT4B 2NMQA 1XCQL 3TEZA 2MBEA 3L13A 3KYCD 2LMCA 2N7JA 1EM7A 2NCNA 4IW0A 1WMHB 3VTVA 3U8ZA 1SJED 4DHZB 1TGZB 1HTQA 3EFCA 2L0FA 1YD8U 1YN3A 4N9F4 3IXSA 3AE4B 3AM9A 2G3QB 4LJPB 2H89B 2G1EA 2GB1A 4KV2A 2V4IB 1BMLC 1TZ1A 1TKGA 4PS8A 1V1PB 2IGDA 3LXFA 2WGSA 2VH1A 1ZDXA 2KHWB 4AOFA 4EZLA 3ZNHB 3BK1A 2WDTB 2K1FA 1J7AA 2N7EA 2CS4A 2JYTA 3KQ4A 3ZRFA 3PZ8A 2KOXA 1STEA 2NTSA 4KDIC 2GBRA 2PTLA 1F52A 2ZPNA 4KGTA 3DQVA 2K8HA 2KANA 2ONQA 2JUOA 1IUEA 3UINB 1WR6E 3NUHB 1XO3A 4KSLC 4BKSA 3IAS1 1H8CA 1JCKB 3PGEA 4EUTA 2L32A 2E3TA 4MJSA 4KIKA 4M8MA 2B76B 1MFWA 3E56A 2FIDA 4EE2A 3GZNI 4NQLB 4JPSA 1WJUA 1P9DU 3DOWA 2M8SA 5EE9A 3T3NA 3H6NA 4LNNA 3Q3NC 1ZXHA 2CKHB 4E74A 4WAFA 3V05A 5L95C 3RD2A 1CQVA 3A9KB 1JRPA 1T0RC 2KZRA 2Z0DB 1C77A 4HXDA 2KJHB 2C5LC 2HE7A 3AE7B 4NPNA 3RNCC 1FCLA 1GB1A 2LXAA 3L08A 4ZHOA 3MP9A 1XXGA 4YTNB 2M19A 5AUKA 1GJZA 1Q10A 3ZXVA 2C7HA 1WE7A 2JSVX 1E5WA 1SF0A 3SFEB 2K9XA 1BT0A 1N62A 3DVNV 3MTNB 3JSVA 1P0RA 4JE3B 2HJ1A 1V80A 4REZA 1HQRD 3H9DA 1R4MB 3C0RB 2UWQA 4IWOA 1V81A 4GIVA 2G4SA 4K7WA 2KN4A 1YMHE 2MBQA 2VZKB 5IP4D 4WURA 4MEMA 2QDFA 2WXHA 4KVGB 5FR3A 2D11A 2I1JA 1P7EA 2G45B 1XF5L 2JRHA 2YVCA 2INCC 1L5PA 3TUOA 4P1BC 3ZDTA 2KTRA 3A9JB 2WDVB 4HRSA 4AJYB 3DBHI 3MC8A 2IGHA 3RI7C 3RNBC 2ACZB 4K1RB 2XEWA 3KWVA 3AEGB 2N0SB 3WALA 4B0MA 3ZRCA 2J0MA 2IJ0A 5AZHA 1E90A 2PJHA 5IOIA 3BY4B 2CHXA 4HEA1 4MH8A 4BOSC 4C7ZA 3RFZB 3N1YC 3I57A 1L0VB 4W9EA 1E8ZA 3L54A 4GDKA 5JZEB 4P16A 2LWPA 4IOIE 2UYZB 2CJOA 2KWUB 1KH0A 1WYWB 5G2NA 2OJWA 2CU1A 4RH6A 3A1QA 1TKYA 2MH7A 1WGHA 4RGNA 3TEXA 3DBRI 1P1AA 1IBXA 1ZPSA 3APFA 5D6JB 3N9YC 2K22A 5CHWA 4YSXB 3AECB 5TR5A 2LGDA 2WXOA 3DDCB 1S1QB 3PPAA 1FRRA 2KWCA 3V62A 1GPXA 4AQ7A 4X57B 3NVZA 3P63A 1XLPA 3RT3B 4ARIA 2ZVNA 3A4RA 2IYDB 2DNFA 2ZNVB 3L16A 3PRZA 4PK1A 1KTKA 3JW0X 3AEBB 3VRAB 4W9JA 1RFKA 4XZ4A 4M01A 4TV3A 2BW2A 2O6VA 2LJIA 3TBLD 2J0JA 2RGFA 5HKHA 1Y8RC 3MJ5A 4WQOB 3VUWA 1IP9A 1KJTA 2O2VA 3N20C 4C4VA 2KJRA 3VAWA 4HPLB 3KUCB 2JYEA 1I42A 3HIZA 3NRZA 1XD3B 4TMAB 1TS4A 3TCAA 3MHZA 3WAPA 4M0WB 5J18A 2DAJA 2DZKA 3PVLA 3AEAB 4UDUC 3MFGA 1E8XA 3ECIA 3DVGX 2L1AA 2KC1A 5E6OA 4FBJB 2HTHA 3PRMB 2WXNA 3MJWA 1DOIA 1RM6C 2XBBC 4GDLA 4L1BA 1ZDVA 2GLSA 4DHZE 4F1SA 3GE8C 4HDOA 1JROA 1I7HA 1XLOA 3U4EG 3BVZA 4BBNF 3AEDB 3B9JA 1OEYA 4YSZB 1LFDA 2ZCCA 1FIQA 2DZIA 2KWVB 5G5HA 4WJQA 3NZUA 2VZKD 2K25A 2V4LA 3CSTA 3EUB2 2KDEB 2BS2B 2NVUI 1ZOYB 2CHWA 2L00B 3UIPB 2JF5A 2AWTA 3P42A 3JYUA 4OVUA 2J4XA 2NTTA 4JQWC 4LDTB 1D6EC 1NYRA 4EOYA 2M1MA 4DDGD 3OWEB 1CJEA 4N6EB 1EU3A 2DYBA 3CF6E 2G9HD 5C3JB 2MBOA 2KMAA 5DPWA 3RYTA
chains in the Genus database with same CATH topology
3N1YC 3RMKC 2RDBC 3RNFC 3RI7C 3RNBC 3N1ZC 3Q3OC 3I63C 3RNAC 3RNGC 1T0RC 3DHHC 3RNEC 3Q14C 3GE3C 3DHIC 3Q3MC 3Q2AC 1T0SC 3GE8C 3RNCC 3N1XC 3DHGC 2INCC 3I5JC 3RN9C 1T0QC 3Q3NC 4P1BC 2INDC 3N20C 4P1CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Y C;  3RMK C;  2RDB C;  3RNF C;  3RI7 C;  3RNB C;  3N1Z C;  3Q3O C;  3I63 C;  3RNA C;  3RNG C;  1T0R C;  3DHH C;  3RNE C;  3Q14 C;  3GE3 C;  3DHI C;  3Q3M C;  3Q2A C;  1T0S C;  3GE8 C;  3RNC C;  3N1X C;  3DHG C;  2INC C;  3I5J C;  3RN9 C;  1T0Q C;  3Q3N C;  4P1B C;  2IND C;  3N20 C;  4P1C C; 
#chains in the Genus database with same CATH topology
 2KVR A;  2N9L A;  3GS2 A;  1OEY J;  4KKJ A;  2C7N B;  1D3Z A;  1I4P A;  3V61 A;  3WAM A;  4WIP A;  5T8I A;  4W9K A;  3T9L A;  4ZHP A;  2JVC A;  2MX2 A;  3AE9 B;  2D5G A;  4ANV A;  2LI5 A;  4M8N A;  4MT5 A;  4C7Y A;  3Q8C A;  1AYF A;  1FEH A;  1A70 A;  2RDG A;  1D4B A;  1E9M A;  2W82 A;  4W9H A;  2FIF A;  4TQ1 A;  4ZRP A;  4YXD B;  1J0G A;  4NY0 A;  1WX8 A;  4IUM B;  3BII D;  1C78 A;  4W9I A;  3AH7 A;  2KN5 A;  1CK1 A;  2MJE A;  3UF8 A;  2LGI A;  1PGX A;  3BYT B;  1E7V A;  3SD5 A;  1GC7 A;  3IT4 B;  3OLM D;  4HCP B;  3U52 E;  2BPS A;  3ENE A;  2WXR A;  2RDH A;  5H8Y E;  4S17 A;  2Y3A A;  2KMC A;  2BB6 A;  1UD7 A;  1E6E B;  4N58 A;  4LLG M;  2IPK D;  2DEN B;  1N6Z A;  2IO0 B;  4FN2 A;  4LJO B;  1ZE3 D;  3SDL C;  3VUY A;  2C60 A;  1FNV A;  4E3C A;  4WJO A;  1WGG A;  1JWS D;  1YOV B;  3DPD A;  3Q3J A;  2N9P C;  2WXM A;  4FHK A;  2HTM E;  2QEJ C;  2IY0 B;  2NS5 A;  1GB4 A;  3GE3 C;  1NEN B;  3AMZ A;  2WXF A;  1DOX A;  2KNB A;  4JLC A;  3MHS D;  2NPT B;  2QMT A;  1EWC A;  5D2M B;  3UIO B;  2D2Q A;  4W9C A;  4MM3 B;  2JPH A;  4ANU A;  2MJD A;  3KYD D;  5LNK 1;  2M0A A;  2WXJ A;  2YLM A;  5AEK B;  2ASQ A;  2MWS B;  2PKO A;  3PV1 A;  3BK2 A;  2QSD A;  5EDS A;  2FUG 1;  1UZX B;  2BYV E;  1L4Z B;  5AZG A;  2WXP A;  3V60 A;  2CU3 A;  2H88 B;  4IDI A;  2WYQ A;  1NBF C;  1WRD B;  4ICV A;  4XWT A;  1YX5 B;  3NOB A;  4NQK E;  4NAW B;  2LJ5 A;  1MG4 A;  1LXD A;  1SE2 A;  5DPS A;  2K5P A;  1L7Y A;  1FXI A;  4PYZ A;  4IM0 A;  1ZW7 A;  3WCQ A;  2KAC A;  1UGJ A;  3H7P B;  3DWM A;  3Q8F A;  3BIN A;  1TS2 A;  1L0X B;  2LVP A;  3NVV A;  3HM3 A;  4LDT D;  2MBH A;  4HLE A;  3DHG C;  3HHM A;  2Z8L A;  4XDD A;  1T0Q C;  3PRE A;  4LNK A;  3QAR A;  4JWS C;  1WJ6 A;  4PS3 A;  5TSS A;  4PS7 A;  3SHQ A;  1SXT A;  2N7D A;  1JW9 D;  3R8B A;  2KX0 A;  4II3 B;  1WH3 A;  4OHJ A;  3IT6 B;  3ZW3 A;  3ZTC A;  2BS3 B;  2PPH A;  2V3P A;  2AEH A;  1GUA B;  1VCB A;  1WM2 A;  2MP2 A;  2J42 A;  4XE0 A;  2N9E B;  4R3D A;  4L23 A;  2MJ3 A;  2IO3 B;  1WM3 A;  1Q5W B;  3IAM 1;  2GBM A;  1AWD A;  2XN9 C;  2GRI A;  3BYY B;  4OVZ A;  3AB5 A;  4URK A;  2MRP A;  5LXI B;  1VJK A;  4ZYN A;  3ML8 A;  2MW5 A;  1T6B X;  2BTE A;  3R3M A;  3R7Q A;  3EC8 A;  3N1X C;  2MEK A;  1V8C A;  1OTR B;  5DCN A;  4B0E A;  3TEW A;  4TUU A;  2WU5 B;  2DHZ A;  3BVG A;  3KVF B;  4E71 A;  1IPG A;  3DBH B;  4AS1 A;  3I63 C;  2DX5 B;  2ZW0 A;  5LLI A;  4I6P A;  3TJP A;  4A20 A;  2LVQ A;  1FCC C;  3DHI C;  3W2D A;  4MGY E;  2CR5 A;  1IGD A;  1VLB A;  4KSK C;  3PLV A;  1EO6 A;  1QF6 A;  3B2F A;  2LEK A;  5JXV A;  2IDY A;  4BKG A;  2KQ7 A;  1C76 A;  3Q8E A;  5L83 A;  1I4X A;  4FJZ A;  2KDF B;  4BBN C;  1SIF A;  5HI1 A;  2K8B A;  1YQB A;  1T3Q A;  3MC9 A;  1V1O A;  5BYS A;  1OQY A;  4OW0 A;  3ALB A;  4MSQ B;  4WAA A;  3AE2 B;  1QT9 A;  3HM6 X;  3RMK C;  3ZJU A;  2MSE D;  1L6U A;  3CMM B;  1SE4 A;  1S3S G;  3FIL A;  2IBI B;  1JWU D;  5EE0 A;  3Q3O C;  3DBR B;  4DWF A;  1AN8 A;  5D94 A;  2IO1 B;  3UI3 A;  5D3I B;  3Q3M C;  4HJK A;  1XT9 B;  2BYE A;  1I4R A;  4NZL B;  3NZS A;  3I9V 1;  2W9N A;  1JML A;  4BAX A;  2BF8 B;  4DHJ B;  2V1Y A;  1FMA D;  1WR1 A;  1E10 A;  4F8C B;  3UQB A;  2B3A A;  4GN1 A;  3H1U A;  1FXA A;  2DZJ A;  5CX3 A;  1C3T A;  3O13 A;  1E7P B;  2M0X A;  3I3T B;  1B9R A;  3DBL B;  1U4A A;  3AE1 B;  4JIO U;  3AE6 B;  5C2T B;  1TYG B;  1WGR A;  1D5X C;  2K3U A;  2KDB A;  4BOZ B;  1K51 A;  3BZD B;  1V1P A;  5CHF A;  2ZCB A;  5KHQ A;  3HVZ A;  3AU4 A;  5BMG A;  2VH2 A;  1FXT B;  2WXI A;  5JHB A;  1I4Q A;  3P4S B;  2FCM A;  4HKQ A;  4RCO A;  3QK0 A;  4G0N B;  3DWG C;  1WX9 A;  3ABV B;  4JGH B;  2MA9 B;  1RAX A;  2R2Q A;  1JWM D;  1UWX A;  1TY2 A;  2ZW1 A;  4F7Z A;  1Y56 A;  2M4N A;  4MDK E;  4HK2 A;  1LO5 D;  3LYY A;  3M62 B;  2V3S A;  3HVD A;  4US9 A;  1WXM A;  2IY1 B;  1MG8 A;  1RLF A;  1L2N A;  1JAL A;  1KLU D;  4GLS C;  3VXW A;  2D10 A;  2WDR B;  5KHO A;  3NHE B;  4K3B A;  1VD2 A;  4WJP A;  3KH0 A;  4H2A A;  3OJ3 A;  1I35 A;  2FBW B;  4CHK A;  3PZ7 A;  3EFU A;  3A9K A;  3AI5 A;  2WXL A;  2KKC A;  1ENF A;  4XGA B;  2ZJD A;  2HDE A;  3PS6 A;  1TJE A;  4I6L B;  1I4H A;  3P4P B;  4WQM A;  4MGI E;  2D3C A;  3IBE A;  3DBL I;  5CHV C;  1WE6 A;  3B0A A;  4WH4 A;  1NI2 A;  2MQJ A;  2KAJ A;  1J7C A;  3BVM A;  1HZ6 A;  2BKF A;  2LAS A;  5AZF A;  2KQ4 X;  2LD9 A;  3QJZ A;  1WXS A;  1V5O A;  2DBY A;  3NVW A;  2WX1 A;  1XCT L;  1N5X A;  1OQR A;  2IGG A;  4A90 A;  4LNF A;  3SEB A;  3PHX B;  1FO4 A;  4D2K A;  1BUI C;  4IM3 A;  1FPY A;  3ZVV A;  3KUD B;  2BWF A;  4P7I A;  2PMV A;  4IC7 B;  4HJG E;  1CMX B;  1YNT E;  1J8C A;  4A9A A;  4XYC A;  3VQI A;  1L4D B;  3A9J A;  5I4D A;  2QIE B;  3APD A;  3LDZ E;  4HCN B;  5D7G A;  3L4P A;  5DPT A;  1WZ3 A;  4W9L A;  2WX0 A;  1QOG A;  2W3R A;  4DHJ D;  1UWM A;  2G4D B;  3VH3 B;  3CIR B;  1HTO A;  4RGM A;  4WWO A;  3PZD A;  1P98 A;  3ZDM C;  3UGB B;  5BYQ A;  3NZ3 A;  1HA5 A;  2KT7 A;  1WGD A;  3J9C A;  2KFK A;  1Z5S B;  1C9F A;  4P6V F;  4S0R A;  2M17 A;  1NEK B;  2JXX A;  1WXQ A;  1SEB D;  2LRW A;  5JHA A;  1V97 A;  3AN1 A;  1FNU A;  4LTU A;  4TQ0 A;  2PVG C;  4A6Q A;  5EE1 A;  1C4C A;  3ML9 A;  2BKR B;  1ACC A;  5IAA C;  2E6X A;  4MSM B;  2OHF A;  1V9J A;  4G3X B;  4XC2 A;  1VZ8 A;  1FFU A;  2RMM A;  4B95 A;  2BYF A;  2KXJ A;  2XK5 B;  2ICI A;  2FNJ B;  1XLN A;  3RNF C;  4G11 A;  1KFY B;  3PHW B;  4CYE A;  3ZNZ B;  5GXG B;  2VRR B;  1M4V A;  3H7S A;  3W9C B;  2V0G A;  1TIF A;  3WAO A;  4A8X C;  4BKT A;  4OZC A;  1KLV A;  3E9S A;  4JX1 C;  4DDI D;  2D3A A;  2KTF A;  4RNA A;  3OG5 A;  2OED A;  1UH6 A;  3I5J C;  1C4A A;  1VZ6 A;  4IM2 A;  1GOZ A;  4NAM A;  4EKU A;  1L0Y B;  3EGR A;  1QZE A;  2V9H A;  2KLG A;  2BS4 B;  3P4R B;  2SEB D;  3ETR A;  4ASW C;  2PIA A;  3IG3 A;  4L2Y A;  1SGH A;  4ANX A;  2WLB A;  1SBB B;  4M0W A;  1EF1 A;  2DAF A;  3ONS A;  2EEL A;  2NBW B;  4FHJ A;  5E6N A;  1WY8 A;  3QA8 A;  4ZRK A;  1V6E A;  2J52 A;  1WGK A;  4A3P A;  1LGR A;  2BGF A;  4WJN A;  3X23 A;  4A3O A;  1WXA A;  4ZDV A;  1PYW D;  1HEZ E;  2V3N A;  1V5T A;  1CZP A;  2C9W B;  4MEL A;  3QIJ A;  3RUL A;  2MLB A;  4KKI A;  4M02 A;  2WHI A;  5BMI A;  4XWW A;  1R4N I;  3VDZ A;  5IKC M;  4IKG A;  1TT5 B;  3KW5 B;  3M3J A;  4RM8 A;  1PGB A;  2PE9 A;  2PLP A;  2WNM A;  3GOE A;  4ACF A;  1TTN A;  4B9K A;  1L6V A;  4N59 A;  2PVO D;  1KF6 B;  3Q3F A;  2LUE A;  1WFY A;  1V2Y A;  4MJS B;  3U7Z A;  4KIK B;  4CQN A;  2LVO A;  2OJR A;  4ANW A;  1FRD A;  4IG7 B;  4MGZ E;  4RF0 A;  2L52 A;  2IND C;  4RFB A;  1RWS A;  2A4Z A;  3SR6 A;  3VTW A;  4FJV B;  4ZYS A;  4WWN A;  1UGM A;  5CTR C;  2KFJ A;  1LM8 B;  4J3O D;  4OZA A;  3ZGZ A;  1NI3 A;  3TEY A;  3V6C B;  2JZZ A;  2W3S A;  3URY A;  3P2B A;  1EWY C;  4NJ6 A;  4GB9 A;  1KOT A;  3AEF B;  1HXY D;  2WU2 B;  4MAC A;  3U30 A;  3R2T A;  3LB8 C;  2RD0 A;  1ZXI A;  4LNO A;  1IGC A;  5HHD G;  1QKZ A;  1DGJ A;  1PGA A;  1WXV A;  3NG0 A;  2JRI B;  5MPO A;  2X8X X;  2YEP B;  3JSV B;  3ZKJ C;  2I1K A;  4USA A;  3M95 A;  3P4Q B;  1MI0 A;  2QIL A;  3HK0 A;  2JX5 A;  3KLS X;  1T5X D;  2JZ3 B;  3AV8 A;  1N63 A;  2LGS A;  4PYU A;  3PRP B;  1YIW A;  1UUP A;  1WWT A;  2REX A;  3Q14 C;  4XDC A;  2QCZ A;  5C1Z A;  5H92 C;  3LJ3 A;  4II2 B;  3A33 B;  2BBC A;  1J19 A;  2LRU A;  1QOF A;  2AL3 A;  3AEE B;  4AP4 C;  2WXG A;  2RDB C;  1OFF A;  1WGY A;  5AUI A;  4J6I A;  3ZQ4 A;  2KTR B;  5G5G A;  2AL6 A;  1NVI D;  1UEL A;  3B2G A;  5J2R A;  1MVK A;  1JWA D;  2KVZ A;  2L05 A;  2N4F A;  1GG3 A;  4HKZ E;  1EUV B;  3NVY A;  1NDD A;  2AQ3 B;  1KRH A;  4AJW A;  2K0P A;  1XQQ A;  3WAN A;  4ZRI A;  1IYF A;  4ZRQ A;  4GDK B;  1KLG D;  1C1Y B;  2NPT A;  1JQ4 A;  1XEE A;  3R2I A;  4A55 A;  3VVW B;  2PE6 B;  1YN5 A;  4MM3 A;  3NY5 A;  3O65 B;  2NBV B;  2Y5C A;  3D32 A;  4NJC A;  4AUQ C;  4NNJ B;  2M56 B;  2NBU A;  3A1Q B;  5BO4 B;  2FCN A;  3Q8A A;  1GC6 A;  3RCZ A;  2UU7 A;  3FAH A;  2OOB B;  4EFO A;  2GI9 A;  3L0W B;  1IBX B;  4RGT A;  1P7F A;  4WWP A;  1JWB D;  3V3X A;  4Q2J A;  1A5R A;  4NJ7 A;  3V6E B;  4LNI A;  3N30 A;  2XNA C;  1K8R B;  4ICU A;  3PTF C;  2L8J A;  2N1V A;  1D5Z C;  1F2R I;  1QQR A;  5FKA C;  3W5U B;  3VHT C;  3RNG C;  4B6W A;  4NAW A;  4ZOH C;  5C23 A;  4GGQ A;  1TZO A;  3IVF A;  2LUM A;  3UQA A;  2AQ1 B;  5HFY A;  2AX5 A;  3FC4 A;  2KMM A;  3EA6 A;  5FK9 C;  4BKS D;  2LGY A;  3AE5 B;  1JRU A;  4ZRJ A;  4LCD E;  2JY6 A;  3RN9 C;  1B1Z A;  4OVV A;  3NS8 A;  1V86 A;  2CJN A;  2I38 A;  2Y5P A;  2O6V B;  1UF0 A;  3H7P A;  2ZEQ A;  2ON8 A;  1WMH A;  4JWU C;  1BXT A;  3ZUN A;  4FLH A;  1E7U A;  2O2V B;  4C4V B;  5J17 A;  2D3B A;  1YX6 B;  4K7U A;  2K8C A;  1E8W A;  3JVZ X;  3ZNG C;  4TKN A;  5EE3 A;  3TSS A;  2EMS A;  1YQ3 B;  1EU4 A;  4KGS A;  3W1S A;  3AU5 A;  4P1C C;  2R61 A;  3DBS A;  4TSS A;  2J7Q B;  3FKY A;  4DQO C;  2DYO A;  1K50 A;  3U2S C;  1E8Y A;  4I6N B;  2MCN B;  4K7S A;  2K6D B;  4HPM B;  1RYJ A;  4M00 A;  2W55 A;  2J0K A;  4HWI B;  1MJD A;  1VZ7 A;  2NR2 A;  4GDL B;  1ZGU B;  1J7B A;  1TY0 A;  3DVG Y;  1ISN A;  1N61 A;  3SFD B;  3TL5 A;  1XLQ A;  3KUZ A;  2DWQ A;  1Z2M A;  4GOC A;  4EZK A;  3AXC A;  1ET9 A;  2KYW A;  3VTU A;  3QCA A;  4DXF A;  2D07 B;  3GB1 A;  3N32 A;  1DYQ A;  2JZP A;  4GXB A;  2KO3 A;  2KFK B;  1GAQ B;  3C19 A;  3P1M A;  3OJ4 B;  4YTP B;  3DCG A;  5E6J A;  1F9J A;  2N9X A;  1K52 A;  1R7S A;  1YJI A;  1K53 A;  1RRB A;  2L0T A;  5BYR A;  1ET6 A;  2KJ6 A;  3R66 C;  1F2R C;  2K6Q A;  4DK5 A;  2KLC A;  4C80 A;  1UBI A;  1N60 A;  1WJ4 A;  4W9D A;  4C56 C;  3IFW B;  4W9F A;  2JWU A;  3ZJT A;  4YWG G;  2FCQ A;  2J53 A;  2CHZ A;  3Q2A C;  1P3Q U;  1AAR A;  3PSE B;  1HE8 A;  1WYG A;  3HUI A;  3W1S C;  1MHH E;  1R4M I;  1SJH D;  4DXG A;  1WI0 A;  4MH0 E;  1I4G A;  2DZM A;  2HD5 B;  1SE3 A;  1D5M C;  3ZLZ A;  3OAW A;  4RMA A;  4W9G A;  4HDQ A;  3X0W A;  3L17 A;  3CSF A;  1QLB B;  3R7R A;  4ITK A;  1DOY A;  2KWD A;  5D3D A;  2L76 A;  2MBB B;  2FAZ A;  2L7R A;  3M63 B;  5BMH A;  4FA6 A;  2HJ8 A;  1TKE A;  1V49 A;  4YSY B;  1OGW A;  3RNA C;  2IZV B;  4FAD A;  2LHE A;  1ZKH A;  2L3Z A;  2L83 A;  3VFK A;  2LHD A;  1QIL A;  2QHO A;  1M94 A;  4YL8 A;  3A4S C;  3Q8B A;  2JQR B;  3WA0 A;  2GBK A;  1TBE A;  3VUX A;  1FNW A;  2O6V D;  4K3C A;  1PDX A;  1PFD A;  1FFV A;  3ZO5 B;  2WP9 B;  3ZIM A;  1C79 A;  2LXC A;  4IWP A;  4IWQ A;  2FCS A;  2BVC A;  1ROE A;  2DLB A;  3KWL A;  3WIM A;  1E0Z A;  1QOB A;  1F0Z A;  4HRO A;  2Y5B B;  2INN E;  4KX6 B;  2ZZP B;  2KDM A;  2RSU A;  2Z59 B;  4C00 A;  5IN7 A;  1PUT A;  2SAK A;  3RZW C;  1Q0W B;  1RFA A;  2FE8 A;  3ZTD A;  2EKI A;  1WF9 A;  4EEW A;  2WXK A;  2DYM A;  1C4P A;  4GU2 A;  2K39 A;  4KDL B;  3ZNI D;  1NYQ A;  4OZB A;  2QJL A;  1T0Y A;  2AQ2 B;  2JU6 X;  1R4N B;  4ARC A;  3N1Z C;  1YN4 A;  5IO9 A;  3C8Y A;  4O1N A;  2WS3 B;  4XX5 A;  4GMV A;  2KC2 A;  3S2A A;  2BB5 A;  2BWE S;  5HG2 A;  4PT5 A;  4HPP A;  4YTM B;  2IO2 B;  2WWZ A;  3BWU D;  1OQQ A;  4WWM A;  1F77 A;  5GMV A;  3AUL A;  3H8H A;  2LZ6 A;  2A5U A;  3ZXR A;  4MGK E;  1ZP0 B;  2KD0 A;  2JXT A;  3VH4 B;  2TSS A;  2W54 A;  2GBJ A;  2I2Y A;  3HRD D;  4FXC A;  2MHJ A;  3B08 A;  4JL9 A;  3RNE C;  3PT2 B;  5DPR A;  1YJJ A;  2N1W A;  1T0S C;  2WQY B;  3K9O B;  4DXA B;  5IA7 A;  3TIX A;  1VRA B;  3ZJV A;  3GP7 A;  4CO7 A;  1YJ1 A;  1LQB A;  1ZUD 2;  1TS5 A;  3QWZ B;  3IHP C;  1KM7 A;  4RGO S;  3QHT A;  1SB3 C;  3NJT A;  2KQS A;  3PLU A;  1UBQ A;  3NS1 A;  4BZA A;  4BVU C;  3Q6B A;  3W5V B;  3CWI A;  4YT0 B;  4US8 A;  1FM0 D;  4FJY A;  3T3O A;  4KGR A;  1X1M A;  3VRB B;  1SIJ A;  1H4R A;  2RR9 A;  2BT6 A;  2JWZ A;  4HVB A;  1AW7 A;  2N9K A;  4DBG A;  1TS3 A;  4G50 A;  1MHX A;  2GMI C;  2MP2 B;  2KDI A;  3EEC A;  3VR9 B;  1VDV A;  5JH5 C;  3DVN U;  3B1L X;  4LK0 M;  3T8M A;  2GBN A;  3EHV A;  3QX1 A;  3QQ8 B;  3L10 B;  3APC A;  1PQS A;  1UNS A;  2YEP F;  3RUI B;  2FUH B;  2X38 A;  1HZ5 A;  4KZ0 A;  2R2O A;  4KZC A;  5FR6 A;  2EMT A;  3U7D A;  3RPF C;  3N3K B;  2AYO B;  1EF5 A;  2ZNV C;  3AE3 B;  1MPE A;  2KX3 A;  4RM9 A;  3SU8 X;  3ZYY X;  2C7M B;  2ZVO A;  2BYT A;  1Q1O A;  1YQ4 B;  4BFR A;  1VR9 A;  3PO0 A;  3MC0 B;  2LFI A;  3QC8 B;  2EKE C;  1WIA A;  3VR8 B;  1N5W A;  1WRI A;  2RPV A;  1WSP A;  2WXQ A;  3DHH C;  4RF1 A;  2BQQ A;  4K81 A;  3K9P B;  3RZF A;  1G6J A;  1WJN A;  4FUL A;  4EZJ A;  2WDQ B;  2INP E;  1FD6 A;  2Z0E B;  3AE8 B;  2QC8 A;  2PEA A;  2Q5W D;  2D3G A;  5E6P A;  2PW9 A;  2ZPY A;  3TMP B;  1ESF A;  2KK8 A;  5G55 A;  1SSN A;  2XK5 A;  3W1Y A;  3FIL B;  1QOA A;  4GSW A;  1WX7 A;  3GZN B;  2RPQ A;  4QAY A;  5LXH A;  1F1H A;  2LGX A;  1WZ0 A;  3Q69 A;  1SE9 A;  1GNU A;  3QAQ A;  4AWJ A;  2GOW A;  2JT4 B;  2NMQ A;  1XCQ L;  3TEZ A;  2MBE A;  3L13 A;  3KYC D;  2LMC A;  2N7J A;  1EM7 A;  2NCN A;  4IW0 A;  1WMH B;  3VTV A;  3U8Z A;  1SJE D;  4DHZ B;  1TGZ B;  1HTQ A;  3EFC A;  2L0F A;  1YD8 U;  1YN3 A;  4N9F 4;  3IXS A;  3AE4 B;  3AM9 A;  2G3Q B;  4LJP B;  2H89 B;  2G1E A;  2GB1 A;  4KV2 A;  2V4I B;  1BML C;  1TZ1 A;  1TKG A;  4PS8 A;  1V1P B;  2IGD A;  3LXF A;  2WGS A;  2VH1 A;  1ZDX A;  2KHW B;  4AOF A;  4EZL A;  3ZNH B;  3BK1 A;  2WDT B;  2K1F A;  1J7A A;  2N7E A;  2CS4 A;  2JYT A;  3KQ4 A;  3ZRF A;  3PZ8 A;  2KOX A;  1STE A;  2NTS A;  4KDI C;  2GBR A;  2PTL A;  1F52 A;  2ZPN A;  4KGT A;  3DQV A;  2K8H A;  2KAN A;  2ONQ A;  2JUO A;  1IUE A;  3UIN B;  1WR6 E;  3NUH B;  1XO3 A;  4KSL C;  4BKS A;  3IAS 1;  1H8C A;  1JCK B;  3PGE A;  4EUT A;  2L32 A;  2E3T A;  4MJS A;  4KIK A;  4M8M A;  2B76 B;  1MFW A;  3E56 A;  2FID A;  4EE2 A;  3GZN I;  4NQL B;  4JPS A;  1WJU A;  1P9D U;  3DOW A;  2M8S A;  5EE9 A;  3T3N A;  3H6N A;  4LNN A;  3Q3N C;  1ZXH A;  2CKH B;  4E74 A;  4WAF A;  3V05 A;  5L95 C;  3RD2 A;  1CQV A;  3A9K B;  1JRP A;  1T0R C;  2KZR A;  2Z0D B;  1C77 A;  4HXD A;  2KJH B;  2C5L C;  2HE7 A;  3AE7 B;  4NPN A;  3RNC C;  1FCL A;  1GB1 A;  2LXA A;  3L08 A;  4ZHO A;  3MP9 A;  1XXG A;  4YTN B;  2M19 A;  5AUK A;  1GJZ A;  1Q10 A;  3ZXV A;  2C7H A;  1WE7 A;  2JSV X;  1E5W A;  1SF0 A;  3SFE B;  2K9X A;  1BT0 A;  1N62 A;  3DVN V;  3MTN B;  3JSV A;  1P0R A;  4JE3 B;  2HJ1 A;  1V80 A;  4REZ A;  1HQR D;  3H9D A;  1R4M B;  3C0R B;  2UWQ A;  4IWO A;  1V81 A;  4GIV A;  2G4S A;  4K7W A;  2KN4 A;  1YMH E;  2MBQ A;  2VZK B;  5IP4 D;  4WUR A;  4MEM A;  2QDF A;  2WXH A;  4KVG B;  5FR3 A;  2D11 A;  2I1J A;  1P7E A;  2G45 B;  1XF5 L;  2JRH A;  2YVC A;  2INC C;  1L5P A;  3TUO A;  4P1B C;  3ZDT A;  2KTR A;  3A9J B;  2WDV B;  4HRS A;  4AJY B;  3DBH I;  3MC8 A;  2IGH A;  3RI7 C;  3RNB C;  2ACZ B;  4K1R B;  2XEW A;  3KWV A;  3AEG B;  2N0S B;  3WAL A;  4B0M A;  3ZRC A;  2J0M A;  2IJ0 A;  5AZH A;  1E90 A;  2PJH A;  5IOI A;  3BY4 B;  2CHX A;  4HEA 1;  4MH8 A;  4BOS C;  4C7Z A;  3RFZ B;  3N1Y C;  3I57 A;  1L0V B;  4W9E A;  1E8Z A;  3L54 A;  4GDK A;  5JZE B;  4P16 A;  2LWP A;  4IOI E;  2UYZ B;  2CJO A;  2KWU B;  1KH0 A;  1WYW B;  5G2N A;  2OJW A;  2CU1 A;  4RH6 A;  3A1Q A;  1TKY A;  2MH7 A;  1WGH A;  4RGN A;  3TEX A;  3DBR I;  1P1A A;  1IBX A;  1ZPS A;  3APF A;  5D6J B;  3N9Y C;  2K22 A;  5CHW A;  4YSX B;  3AEC B;  5TR5 A;  2LGD A;  2WXO A;  3DDC B;  1S1Q B;  3PPA A;  1FRR A;  2KWC A;  3V62 A;  1GPX A;  4AQ7 A;  4X57 B;  3NVZ A;  3P63 A;  1XLP A;  3RT3 B;  4ARI A;  2ZVN A;  3A4R A;  2IYD B;  2DNF A;  2ZNV B;  3L16 A;  3PRZ A;  4PK1 A;  1KTK A;  3JW0 X;  3AEB B;  3VRA B;  4W9J A;  1RFK A;  4XZ4 A;  4M01 A;  4TV3 A;  2BW2 A;  2O6V A;  2LJI A;  3TBL D;  2J0J A;  2RGF A;  5HKH A;  1Y8R C;  3MJ5 A;  4WQO B;  3VUW A;  1IP9 A;  1KJT A;  2O2V A;  3N20 C;  4C4V A;  2KJR A;  3VAW A;  4HPL B;  3KUC B;  2JYE A;  1I42 A;  3HIZ A;  3NRZ A;  1XD3 B;  4TMA B;  1TS4 A;  3TCA A;  3MHZ A;  3WAP A;  4M0W B;  5J18 A;  2DAJ A;  2DZK A;  3PVL A;  3AEA B;  4UDU C;  3MFG A;  1E8X A;  3ECI A;  3DVG X;  2L1A A;  2KC1 A;  5E6O A;  4FBJ B;  2HTH A;  3PRM B;  2WXN A;  3MJW A;  1DOI A;  1RM6 C;  2XBB C;  4GDL A;  4L1B A;  1ZDV A;  2GLS A;  4DHZ E;  4F1S A;  3GE8 C;  4HDO A;  1JRO A;  1I7H A;  1XLO A;  3U4E G;  3BVZ A;  4BBN F;  3AED B;  3B9J A;  1OEY A;  4YSZ B;  1LFD A;  2ZCC A;  1FIQ A;  2DZI A;  2KWV B;  5G5H A;  4WJQ A;  3NZU A;  2VZK D;  2K25 A;  2V4L A;  3CST A;  3EUB 2;  2KDE B;  2BS2 B;  2NVU I;  1ZOY B;  2CHW A;  2L00 B;  3UIP B;  2JF5 A;  2AWT A;  3P42 A;  3JYU A;  4OVU A;  2J4X A;  2NTT A;  4JQW C;  4LDT B;  1D6E C;  1NYR A;  4EOY A;  2M1M A;  4DDG D;  3OWE B;  1CJE A;  4N6E B;  1EU3 A;  2DYB A;  3CF6 E;  2G9H D;  5C3J B;  2MBO A;  2KMA A;  5DPW A;  3RYT A; 
#chains in the Genus database with same CATH homology
 3N1Y C;  3RMK C;  2RDB C;  3RNF C;  3RI7 C;  3RNB C;  3N1Z C;  3Q3O C;  3I63 C;  3RNA C;  3RNG C;  1T0R C;  3DHH C;  3RNE C;  3Q14 C;  3GE3 C;  3DHI C;  3Q3M C;  3Q2A C;  1T0S C;  3GE8 C;  3RNC C;  3N1X C;  3DHG C;  2INC C;  3I5J C;  3RN9 C;  1T0Q C;  3Q3N C;  4P1B C;  2IND C;  3N20 C;  4P1C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...