3Q14C

Toluene 4 monooxygenase hd complex with p-cresol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAETHYLENE GLYCOL
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3q14C00
3RNGC 3RNEC 1T0QC 3DHIC 3Q14C 3DHHC 3DHGC 3N1XC 3Q2AC 3RNFC 3Q3MC 2RDBC 3RNCC 3N20C 2INCC 3GE3C 3GE8C 4P1BC 3I63C 1T0RC 4P1CC 3RNAC 1T0SC 3RN9C 3RNBC 3Q3OC 3N1YC 3RI7C 3RMKC 3I5JC 3N1ZC 3Q3NC 2INDC
chains in the Genus database with same CATH superfamily
2WXHA 3D32A 1AW7A 2C5LC 1K51A 4IM2A 1SJHD 1ZUD2 4LNFA 1PGAA 2CU1A 3VVWB 2Z59B 4RM9A 3CWIA 1E7UA 3DVGX 3IVFA 1WE6A 1TYGB 1D4BA 1ZDXA 2KQ4X 2AL6A 1ET6A 3Q6BA 4XDDA 2WDQB 4G50A 5J18A 2M0AA 4F7ZA 4R3DA 5J2RA 3PS6A 3AULA 4LDTB 4W9IA 2W55A 1N5WA 4MDKE 4M0WB 4IWOA 5LXIB 1T0SC 3H7PA 2QC8A 1C78A 1FCCC 3PHXB 4KGSA 2BS4B 1TIFA 4TKNA 2K39A 3NHEB 2ZEQA 2MW5A 1WXSA 2L76A 2WDVB 1EO6A 4I6PA 3EGRA 1GC7A 4ARIA 1K53A 3IG3A 2V1YA 1D6EC 1CMXB 1SGHA 4RGTA 1OQRA 1ACCA 2NTSA 2BW2A 3NG0A 3RNGC 3I9V1 2K22A 1V1OA 3EA6A 2JUOA 2J0KA 1MHHE 2JQRB 1LQBA 1OEYJ 1KM7A 4TSSA 2CHZA 5D94A 3MHSD 2G4SA 4P7IA 2WXPA 2KJHB 4DHJB 4K7SA 1WM3A 3Q69A 4W9LA 3JYUA 1FXAA 4TMAB 2LWPA 1SIFA 3L17A 4KKIA 1KOTA 2D5GA 4BZAA 2KJRA 2PE6B 2J0JA 5KHOA 3ML8A 5AZHA 2LHDA 1KTKA 2LVQA 1AYFA 2HTME 4KIKB 3LB8C 5D2MB 2INDC 1ENFA 1B1ZA 1LFDA 2Y5PA 3PSEB 1WX7A 2LXCA 3R7RA 3MJ5A 2KO3A 1UD7A 1V1PB 2N7JA 4W9KA 3LXFA 3PRPB 1V2YA 2OOBB 4W9EA 2NTTA 1I4QA 4FADA 5BMIA 2MBQA 3QK0A 1N5XA 3DBSA 4ZYNA 2PKOA 3LJ3A 1YQBA 4ZDVA 2JXTA 1WJ4A 3NVYA 3P4PB 4AP4C 2WXMA 2FCQA 5FKAC 1XLNA 3KWVA 1VRAB 2D2QA 1FMAD 2VRRB 2UYZB 2O6VB 3AE3B 5EE0A 2CR5A 1MJDA 2J7QB 4WH4A 1SB3C 1YX5B 1WH3A 4C4VB 2IO0B 2IBIB 3QHTA 2KDMA 1FPYA 2KACA 3WCQA 3ZKJC 4A6QA 1YQ3B 1X1MA 1FD6A 5HHDG 1PQSA 3SHQA 3OG5A 2M17A 1SE4A 4X57B 2WX0A 1SE3A 4KDLB 3R2IA 1ZOYB 4DHZB 2XBBC 2BWFA 1ISNA 1WGDA 3ZTCA 2EMSA 2BWES 2WU2B 1R7SA 1L4DB 3VHTC 5DPTA 1EF5A 5C1ZA 2INNE 4KVGB 5T8IA 3V62A 4CQNA 1F52A 2PW9A 1UZXB 1MPEA 2G4DB 1SIJA 2AQ1B 1HTOA 4I6LB 5D3IB 4TUUA 2NVUI 3PRMB 3ABVB 2VZKD 1A70A 4RCOA 4S0RA 3Q14C 3R8BA 3PHWB 4PS8A 3RNFC 1VJKA 2C9WB 2KJ6A 3M3JA 2MBOA 4XE0A 2KANA 1J7BA 1YOVB 1R4NI 5HFYA 4ZRIA 4H2AA 2D11A 2KDFB 1YN5A 2A5UA 3WAOA 3EFUA 2JXXA 3L0WB 5E6JA 3DVGY 2L7RA 2LHEA 2XN9C 1E8XA 2LGYA 1Q1OA 2NPTA 1LM8B 2H89B 4YL8A 5JHAA 2KTFA 3V6CB 2L0FA 3DVNV 3N9YC 3GE3C 2HJ8A 1EU3A 1U4AA 3OWEB 2D3CA 2REXA 3H9DA 4OVVA 4HWIB 2WDRB 2W3SA 4DDID 1Q0WB 1TY2A 2V3PA 2D3BA 2LGDA 3V6EB 1MI0A 3JSVB 3RZWC 4BBNF 4PYZA 1IP9A 2DHZA 4II3B 1TKEA 4BAXA 4HJGE 5IA7A 3HK0A 2FUHB 3WIMA 5FR6A 4UDUC 2IY1B 1CK1A 2MLBA 2QEJC 4MGIE 4RM8A 4OW0A 4WWOA 1VDVA 3PZ8A 2L8JA 2XNAC 4FJYA 1ROEA 4IUMB 2MP2A 2ICIA 1WSPA 2HD5B 1S1QB 5IO9A 1L5PA 1P0RA 2FNJB 3MHZA 3I57A 1I4XA 3PREA 3TEYA 3U2SC 2JRIB 3BINA 2DZKA 2Z0EB 3SEBA 5CTRC 3SFDB 3VRBB 3N1XC 2W3RA 1C4CA 4RGMA 3NZ3A 1JRUA 1WWTA 1I35A 3NZUA 3WA0A 3UF8A 5I4DA 3SD5A 3I63C 2N4FA 3BVZA 2BYTA 1JALA 1N63A 2FCSA 3ZQ4A 1C4PA 1NENB 1TS4A 2JT4B 4KV2A 1RWSA 5H8YE 2B3AA 5KHQA 1C9FA 3RCZA 1WJ6A 3A1QB 2DZJA 4HROA 5TR5A 5AUIA 3S2AA 1FO4A 3FILB 3TEZA 2N7DA 1I4RA 2W82A 4HKQA 4HDQA 1XF5L 2MCNB 2FCMA 4B95A 2AL3A 1PUTA 2WXKA 2GB1A 3JVZX 4BVUC 1IGCA 3QX1A 4ZHOA 4DXAB 4BBNC 3W1YA 2J52A 4MGKE 3ZRFA 5E6OA 1KLUD 1VLBA 4ACFA 1WE7A 2R2QA 5E6PA 3DWGC 2FUG1 2KX0A 2BS3B 1JWMD 1FEHA 1TS5A 3AE9B 1N61A 5JHBA 3CF6E 1WGRA 4D2KA 1XCQL 3VUYA 3PLVA 2D3AA 3ZYYX 3L13A 4NZLB 4AOFA 3ZO5B 1UNSA 1XD3B 4PK1A 2KYWA 4FN2A 1TBEA 4NPNA 4LDTD 4GGQA 4MH0E 1PGBA 2N9PC 4QAYA 2OHFA 2LUMA 2IZVB 1XLPA 4MGYE 3ZDTA 2FIFA 4HCPB 4KZ0A 3K9PB 2NBVB 4WJOA 3VUXA 4EZLA 3MC0B 2KDBA 2PVGC 4IM0A 2E3TA 4YTMB 3TIXA 1BT0A 3EC8A 5C23A 2KLGA 2IPKD 1JQ4A 3N1YC 3GP7A 3DPDA 3ZUNA 4YSZB 4NAWB 4IDIA 4OHJA 1WF9A 4AQ7A 2MBHA 4US9A 3V3XA 2YLMA 2RDGA 3NZSA 3N20C 1JWUD 3R66C 3VR8B 3RPFC 4JLCA 2KKCA 1JRPA 1ZGUB 2BYVE 1L0VB 4DHJD 1ZKHA 5E6NA 2O2VB 3P2BA 1UELA 1WGKA 4B0EA 3W1SA 1TKYA 2FBWB 5C2TB 2K0PA 3ZNZB 1TY0A 4HPLB 2MQJA 1UH6A 1Y8RC 3ML9A 5HG2A 3U30A 3UGBB 1H8CA 2NBUA 3AB5A 5BO4B 4GIVA 5GXGB 1AWDA 2WDTB 4G11A 2AEHA 2NS5A 1NI3A 1IUEA 3U7DA 4W9HA 1VZ6A 3DBRI 4IOIE 3RUIB 4DXGA 3I3TB 1EU4A 1FXIA 1LO5D 1YQ4B 2KMCA 4ANVA 2PTLA 1FNWA 2WS3B 1V5TA 2FIDA 1N60A 2WLBA 3B9JA 2HE7A 4US8A 2LGXA 5AZFA 4N58A 1F77A 2LRUA 1XEEA 3A33B 5DPWA 1YJ1A 4CYEA 2Y5CA 3UINB 2BGFA 3NS8A 4WWNA 2NBWB 1JWBD 4ASWC 2R61A 4MJSB 2W54A 3NJTA 2KTRA 1V5OA 4ZRPA 4MT5A 2O6VD 2LFIA 5IOIA 3A9JA 1B9RA 3HIZA 2UWQA 1MFWA 3BVGA 3SR6A 3W9CB 4RF1A 3AEFB 1JCKB 3IBEA 1WGHA 2AYOB 2N9KA 1G6JA 1V97A 4PYUA 5BYSA 2M1MA 3AM9A 3W5UB 2LD9A 3MFGA 1R4MI 2RGFA 1F2RC 5CX3A 2PE9A 3Q3MC 2KWDA 1WX8A 3OAWA 3R3MA 4P16A 3ZVVA 1QLBB 4MM3B 1E7VA 2O2VA 3BYYB 1D5MC 1L0XB 4TQ1A 3DCGA 3M95A 3V05A 5JZEB 4PS7A 2KVZA 4B6WA 4JIOU 4JGHB 1ZXHA 3A9KB 4F1SA 3HM6X 3RD2A 1JMLA 1WJUA 2BPSA 2K6QA 4EZJA 1I42A 1WIAA 2OJRA 4HPMB 2QJLA 2WXGA 4LCDE 1UUPA 4EZKA 2WXFA 3C8YA 4K7UA 3MC9A 3PGEA 1SE9A 4WIPA 5TSSA 2KFKB 2L00B 3DBHI 2WXRA 1EWCA 2DYOA 2J0MA 3VTVA 3V60A 1WRDB 2MJEA 1FFVA 2IDYA 3BYTB 4IWPA 2IJ0A 2LGSA 5DPSA 2PIAA 1J0GA 1L6UA 2GBRA 1R4NB 1V6EA 2KN4A 4M0WA 1MHXA 3KVFB 4JPSA 1DOIA 2ZNVC 1P1AA 1XO3A 1VR9A 2KFJA 3AV8A 4J3OD 5H92C 1SJED 4ARCA 1GOZA 2MA9B 3DBLI 4C7YA 1T6BX 2DYMA 1MG8A 2E6XA 3KH0A 3ZLZA 2SEBD 3PV1A 1ZW7A 4WJPA 4ZYSA 1TKGA 3L4PA 2KOXA 2JZZA 2LJ5A 1E5WA 2EKIA 3GZNI 2B76B 3KUDB 3QCAA 2DENB 4DHZE 3QA8A 2JZ3B 4M8NA 3E56A 4BOZB 1TS3A 1WMHB 3EHVA 3A9KA 2K3UA 2N1WA 3AH7A 4ZHPA 1JROA 2RSUA 2N9XA 5IP4D 1KJTA 4XWWA 1JW9D 1WGYA 4WWMA 2QILA 1QOFA 1P7FA 1D5ZC 2RPVA 1FCLA 5CHWA 1ZP0B 1GB1A 3VTUA 4ANUA 1IBXB 3BVMA 1V81A 4KIKA 1A5RA 3KQ4A 5CHFA 4ZOHC 1V9JA 4MELA 3APDA 4L23A 3NRZA 4HJKA 2LJIA 1ET9A 2INPE 1V1PA 3Q2AC 2LGIA 3KYCD 4LJPB 4C80A 2MWSB 2DZMA 2GBMA 1YNTE 4DQOC 1HQRD 2TSSA 4J6IA 4EE2A 3ETRA 1YMHE 2G45B 3Q8BA 2Z0DB 5EE1A 1YJJA 2KDIA 4WAFA 5MPOA 3ALBA 4JX1C 3P4QB 4EFOA 3ENEA 3IAS1 3M63B 2O6VA 2WHIA 3AE5B 3A4RA 1L4ZB 4FBJB 3KWLA 4A8XC 4URKA 4RNAA 2D10A 4C4VA 3P4SB 3ZJUA 2ZCBA 3L08A 1OGWA 4B9KA 1WFYA 1Z2MA 4KDIC 1P3QU 5L95C 2BYFA 2NR2A 2HJ1A 1VZ8A 1Y56A 2DYBA 4XZ4A 3GE8C 3GOEA 3ZNGC 1TT5B 3SU8X 3QAQA 1E8YA 2DBYA 4XGAB 2V3SA 2QHOA 4HK2A 3C19A 5G55A 2N1VA 1UGJA 1BMLC 4XWTA 4EEWA 4Q2JA 1GAQB 4FXCA 1L7YA 1IBXA 3LYYA 2LVOA 2IO2B 2IO1B 3IAM1 4KSLC 4NNJB 1FFUA 3VDZA 3Q8FA 1WZ0A 2X38A 1HTQA 2YEPF 2PMVA 3QARA 5D3DA 1P7EA 4C7ZA 2KQSA 2L0TA 3RN9C 1C4AA 3IT6B 3MTNB 3C0RB 5FR3A 3WAPA 3AECB 2C7MB 1XT9B 3EUB2 1DGJA 3EFCA 3H8HA 3OJ4B 5HI1A 3TL5A 2GBKA 1SXTA 3SDLC 1NYRA 2M19A 1WXMA 1WM2A 3T3OA 3BWUD 5G5GA 3H6NA 1J7AA 3N30A 3AXCA 3VQIA 1MG4A 3MC8A 5D6JB 3X23A 1BUIC 4YTPB 1N62A 1ZE3D 3JSVA 2GOWA 2M0XA 1E7PB 2KT7A 3RNCC 2WYQA 3CSFA 3PT2B 1XCTL 4REZA 4AJWA 4DWFA 3DQVA 2WXQA 4MGZE 1YN4A 3PTFC 3CIRB 3N3KB 1WXQA 1QF6A 4GXBA 5LNK1 4MSQB 1STEA 4LJOB 4WQOB 3VR9B 3RFZB 2JF5A 4W9JA 2BKFA 3DBRB 3QWZB 4I6NB 2BB6A 4EUTA 3OLMD 2BKRB 1EM7A 1C79A 2Q5WD 1V80A 1FIQA 2N9LA 2D3GA 1N6ZA 1XLOA 3DDCB 1WYWB 3DHIC 3AEAB 1GPXA 3X0WA 3KLSX 2AQ2B 2K25A 4JE3B 2IYDB 2LEKA 4HXDA 2IO3B 4K7WA 2C7NB 2XK5B 2RD0A 4MACA 4OVUA 2PVOD 2JYTA 5DPRA 3FAHA 2ON8A 3A1QA 2N9EB 2KDEB 4NJ6A 3ZJVA 2SAKA 3NVZA 3FILA 1TJEA 2QMTA 3VAWA 4HDOA 4PT5A 1T0RC 2N7EA 1K50A 1ESFA 1F9JA 2JWUA 4AS1A 3APCA 1XLQA 3ECIA 4MEMA 2Y5BB 3W2DA 1R4MB 3VFKA 2WP9B 1GG3A 1DYQA 4IC7B 4LK0M 2AWTA 2X8XX 4IWQA 1UWMA 3ZXVA 4ANXA 2AX5A 5LLIA 1KH0A 3IXSA 3PVLA 3MJWA 2KD0A 4P1CC 4FLHA 3KUZA 2IY0B 4PS3A 1FXTB 4GSWA 4HKZE 3E9SA 1QILA 2KC1A 3BIID 3ZJTA 1S3SG 3N1ZC 4E71A 1FRRA 2BTEA 3PZDA 1FRDA 2HTHA 1E10A 3U4EG 3PRZA 3DHGC 4K3CA 2WXIA 2I2YA 2QCZA 2BQQA 3HRDD 1ZXIA 2RDBC 3Q3JA 4XX5A 1WI0A 2ZNVB 3IHPC 4GDLB 3U8ZA 2OEDA 4LNNA 2CS4A 5IAAC 3RNBC 1C77A 2CHXA 3NVVA 3DWMA 1T3QA 2IGGA 4BFRA 2K1FA 4IW0A 3QJZA 2D07B 4DDGD 3DBHB 4A9AA 2L32A 2M8SA 1F0ZA 4A3PA 3AE8B 1YIWA 1K8RB 1F2RI 2LUEA 2L1AA 2GLSA 2BF8B 2DAFA 2XK5A 5IKCM 2G9HD 1I7HA 4NQKE 4A20A 3B0AA 1AN8A 2K8CA 3KYDD 4YWGG 1UF0A 4OZAA 2HDEA 3RYTA 2PPHA 4JWUC 1V49A 1AARA 3WANA 3VTWA 3AMZA 3WALA 2J42A 4FJVB 2K8HA 3PZ7A 2KC2A 3KW5B 3DBLB 1WRIA 2KK8A 3BK2A 2JX5A 3RT3B 4NAWA 1D5XC 2CJOA 3ZIMA 2ZPYA 3B08A 3W1SC 1XQQA 1FNVA 4A90A 4JL9A 1QQRA 2LI5A 1J7CA 4GMVA 1LXDA 3UQAA 2I38A 2KAJA 3GZNB 2L3ZA 2V4IB 4YXDB 3M62B 3RI7C 2DNFA 4DBGA 1QKZA 2JZPA 4DK5A 1T5XD 3L54A 2BT6A 3TCAA 1TZ1A 1E0ZA 1WR1A 1Q5WB 2G3QB 1QOAA 2JPHA 4LNIA 3AE2B 1IYFA 1D3ZA 4WJNA 2DAJA 1E8ZA 4GDLA 1JWAD 2V4LA 2PEAA 4FHKA 1IGDA 5EDSA 1L2NA 5AEKB 4JQWC 4WWPA 4YTNB 3ZRCA 4WJQA 3SFEB 2K8BA 5DCNA 2KX3A 4HEA1 2WU5B 2WX1A 3AU4A 1I4GA 1F1HA 2PLPA 1VCBA 1QT9A 2KLCA 2ZW1A 4RGNA 3AU5A 1YJIA 1WX9A 4II2B 1FM0D 4LNKA 3P1MA 2FAZA 3AE6B 2KWVB 2LVPA 2LRWA 3HHMA 3NY5A 4MJSA 2WXOA 5LXHA 1UBQA 4OZCA 2BYEA 1NDDA 5J17A 5IN7A 1WGGA 3U7ZA 3UQBA 2MRPA 2MJ3A 4G3XB 3RNAC 1UBIA 5JH5C 4FHJA 5CHVC 1CJEA 4KZCA 2JU6X 1K52A 3NVWA 4BKGA 2L52A 4YSYB 1YN3A 3P4RB 2K9XA 3PO0A 2WXLA 1H4RA 1PDXA 2GBNA 5AZGA 2EMTA 3DOWA 1Q10A 1UWXA 2GBJA 3Q3FA 4EOYA 1TTNA 2BB5A 1OQYA 2JSVX 2L05A 4NQLB 3AEEB 4MM3A 4K81A 4ITKA 2KQ7A 1VZ7A 4WAAA 3HUIA 4AWJA 1KFYB 4ICVA 4BOSC 5EE3A 3PPAA 2KNBA 2GI9A 2LMCA 3RZFA 3CSTA 3OJ3A 1YD8U 2ZPNA 1RFKA 4O1NA 5BMGA 2WXNA 3ZW3A 3VH4B 3ZGZA 2NPTB 3PLUA 2KN5A 4KSKC 2MJDA 2LZ6A 2KMMA 2MBEA 1HZ5A 2YVCA 3L10B 3TEXA 3NUHB 3AE4B 4FULA 2JVCA 3TUOA 4BKSA 1WJNA 3RULA 1BXTA 2EELA 4N9F4 3T9LA 3B1LX 1OFFA 3APFA 4M00A 4USAA 2Y3AA 1RYJA 1ZPSA 3T3NA 3Q8CA 2ZCCA 1GC6A 2WQYB 4ZRQA 4GOCA 2DWQA 2KFKA 2KHWB 1KLGD 3IFWB 4KGRA 2R2OA 1I4PA 3AEGB 2C60A 3Q3OC 2XEWA 1PFDA 3AE7B 4K1RB 2KWUB 4FJZA 1XXGA 4LNOA 3RNEC 1SEBD 4GB9A 4BKTA 2M4NA 4NJCA 1ZDVA 2MP2B 2FCNA 1FNUA 3AEBB 5GMVA 1E6EB 1KF6B 2GMIC 3B2FA 3Q8AA 3ONSA 2Z8LA 5BYRA 4E3CA 2ZW0A 4GU2A 3ZTDA 3O65B 2JY6A 3BY4B 2WWZA 1LGRA 1V8CA 3FKYA 2KVRA 3VRAB 2LASA 1WZ3A 3L16A 1GUAB 3ZXRA 4XC2A 4YSXB 1IPGA 4WURA 2CKHB 4LLGM 2OJWA 4NAMA 1DOXA 4K3BA 1YX6B 1HZ6A 4W9GA 2EKEC 1UGMA 1SE2A 3VUWA 3BZDB 2DZIA 4KGTA 4CHKA 4GLSC 1T0QC 1SSNA 5AUKA 1EUVB 1RRBA 1WMHA 2YEPB 2L83A 1NI2A 4C56C 2KXJA 4P1BC 1DOYA 4NJ7A 1NYQA 2RR9A 4LTUA 4NY0A 1TS2A 3W5VB 1NBFC 2IGHA 1PYWD 2ACZB 2M56B 2MH7A 3R2TA 3UIPB 4JWSC 2ZJDA 1WXAA 2GRIA 2MBBB 1QOBA 2ZVNA 2V3NA 3BK1A 1RM6C 1L0YB 4GDKB 4RH6A 3R7QA 2CU3A 3HVDA 2G1EA 1KRHA 2CHWA 5EE9A 3UIOB 2ZVOA 4G0NB 4S17A 3WAMA 2JYEA 4W9FA 1J8CA 4HCNB 3EECA 4B0MA 1E8WA 3HM3A 3P63A 1CZPA 1C1YB 1EF1A 1RFAA 3O13A 4DXFA 2MEKA 3UI3A 4M01A 4HVBA 3AE1B 3I5JC 4TQ0A 4A55A 1GNUA 2UU7A 2ONQA 3KUCB 1KLVA 5BMHA 2I1JA 3ZNID 4HPPA 4EKUA 3TEWA 1P98A 1RLFA 3VH3B 4AJYB 2V9HA 4TV3A 3ZDMC 2KWCA 2VZKB 3NOBA 1P9DU 3LDZE 4ZRKA 4IG7B 4MH8A 2QSDA 2K6DB 4OVZA 1M4VA 2RDHA 4L2YA 3GS2A 2LXAA 1M94A 1WXVA 2RMMA 1MVKA 2FE8A 1PGXA 1WR6E 3FC4A 2QIEB 1J19A 2NMQA 4IKGA 3Q8EA 3H1UA 3JW0X 4L1BA 1QOGA 5C3JB 3B2GA 4C00A 4ICUA 3TMPB 2VH2A 4RFBA 1VD2A 2KZRA 5BYQA 1L6VA 4P6VF 1C76A 1SF0A 4GDKA 3TSSA 1C3TA 3N32A 2N0SB 2H88B 3HVZA 2BBCA 2WGSA 2MHJA 2KMAA 1WY8A 2VH1A 1SBBB 1OQQA 3DHHC 5FK9C 1EWYC 4YT0B 3U52E 4KKJA 1HEZE 2ZZPB 2PJHA 2V0GA 4XYCA 1HE8A 2RPQA 1QZEA 4WQMA 4RMAA 3Q3NC 1GJZA 3DVNU 1HA5A 2JWZA 2QDFA 4F8CB 1RAXA 1WYGA 5G5HA 4N6EB 2I1KA 5HKHA 2CJNA 3URYA 4CO7A 1E90A 2W9NA 1TGZB 4KX6B 4N59A 3TBLD 2INCC 4GN1A 4MSMB 2A4ZA 2NCNA 4A3OA 4ANWA 3TJPA 2BS2B 3VXWA 2KTRB 3QIJA 4XDCA 2MSED 3J9CA 3A9JB 1GB4A 3CMMB 1HXYD 3H7PB 3H7SA 3NS1A 4BKSD 3RMKC 2K5PA 3MP9A 3V61A 3K9OB 1NEKB 2WNMA 4M8MA 3P42A 4AUQC 2IGDA 1E9MA 3QC8B 4M02A 2DX5B 4HRSA 5G2NA 1V86A 4ZRJA 3AEDB 4HLEA 2AQ3B 1OTRB 1T0YA 1JWSD 2J53A 2MX2A 1Z5SB 4W9DA 2BVCA 4W9CA 2C7HA 4RF0A 2DLBA 4OZBA 2ASQA 1TZOA 3AN1A 3QQ8B 2WXJA 5D7GA 5JXVA 2J4XA 4IM3A 1I4HA 3ZNHB 1OEYA 3A4SC 4E74A 4RGOS 3T8MA 2JRHA 5L83A 3GB1A 3IT4B 1NVID 1CQVA 4FA6A 3AI5A
chains in the Genus database with same CATH topology
3RNGC 3RNEC 1T0QC 3DHIC 3Q14C 3DHHC 3DHGC 3N1XC 3Q2AC 3RNFC 3Q3MC 2RDBC 3RNCC 3N20C 2INCC 3GE3C 3GE8C 4P1BC 3I63C 1T0RC 4P1CC 3RNAC 1T0SC 3RN9C 3RNBC 3Q3OC 3N1YC 3RI7C 3RMKC 3I5JC 3N1ZC 3Q3NC 2INDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNG C;  3RNE C;  1T0Q C;  3DHI C;  3Q14 C;  3DHH C;  3DHG C;  3N1X C;  3Q2A C;  3RNF C;  3Q3M C;  2RDB C;  3RNC C;  3N20 C;  2INC C;  3GE3 C;  3GE8 C;  4P1B C;  3I63 C;  1T0R C;  4P1C C;  3RNA C;  1T0S C;  3RN9 C;  3RNB C;  3Q3O C;  3N1Y C;  3RI7 C;  3RMK C;  3I5J C;  3N1Z C;  3Q3N C;  2IND C; 
#chains in the Genus database with same CATH topology
 2WXH A;  3D32 A;  1AW7 A;  2C5L C;  1K51 A;  4IM2 A;  1SJH D;  1ZUD 2;  4LNF A;  1PGA A;  2CU1 A;  3VVW B;  2Z59 B;  4RM9 A;  3CWI A;  1E7U A;  3DVG X;  3IVF A;  1WE6 A;  1TYG B;  1D4B A;  1ZDX A;  2KQ4 X;  2AL6 A;  1ET6 A;  3Q6B A;  4XDD A;  2WDQ B;  4G50 A;  5J18 A;  2M0A A;  4F7Z A;  4R3D A;  5J2R A;  3PS6 A;  3AUL A;  4LDT B;  4W9I A;  2W55 A;  1N5W A;  4MDK E;  4M0W B;  4IWO A;  5LXI B;  1T0S C;  3H7P A;  2QC8 A;  1C78 A;  1FCC C;  3PHX B;  4KGS A;  2BS4 B;  1TIF A;  4TKN A;  2K39 A;  3NHE B;  2ZEQ A;  2MW5 A;  1WXS A;  2L76 A;  2WDV B;  1EO6 A;  4I6P A;  3EGR A;  1GC7 A;  4ARI A;  1K53 A;  3IG3 A;  2V1Y A;  1D6E C;  1CMX B;  1SGH A;  4RGT A;  1OQR A;  1ACC A;  2NTS A;  2BW2 A;  3NG0 A;  3RNG C;  3I9V 1;  2K22 A;  1V1O A;  3EA6 A;  2JUO A;  2J0K A;  1MHH E;  2JQR B;  1LQB A;  1OEY J;  1KM7 A;  4TSS A;  2CHZ A;  5D94 A;  3MHS D;  2G4S A;  4P7I A;  2WXP A;  2KJH B;  4DHJ B;  4K7S A;  1WM3 A;  3Q69 A;  4W9L A;  3JYU A;  1FXA A;  4TMA B;  2LWP A;  1SIF A;  3L17 A;  4KKI A;  1KOT A;  2D5G A;  4BZA A;  2KJR A;  2PE6 B;  2J0J A;  5KHO A;  3ML8 A;  5AZH A;  2LHD A;  1KTK A;  2LVQ A;  1AYF A;  2HTM E;  4KIK B;  3LB8 C;  5D2M B;  2IND C;  1ENF A;  1B1Z A;  1LFD A;  2Y5P A;  3PSE B;  1WX7 A;  2LXC A;  3R7R A;  3MJ5 A;  2KO3 A;  1UD7 A;  1V1P B;  2N7J A;  4W9K A;  3LXF A;  3PRP B;  1V2Y A;  2OOB B;  4W9E A;  2NTT A;  1I4Q A;  4FAD A;  5BMI A;  2MBQ A;  3QK0 A;  1N5X A;  3DBS A;  4ZYN A;  2PKO A;  3LJ3 A;  1YQB A;  4ZDV A;  2JXT A;  1WJ4 A;  3NVY A;  3P4P B;  4AP4 C;  2WXM A;  2FCQ A;  5FKA C;  1XLN A;  3KWV A;  1VRA B;  2D2Q A;  1FMA D;  2VRR B;  2UYZ B;  2O6V B;  3AE3 B;  5EE0 A;  2CR5 A;  1MJD A;  2J7Q B;  4WH4 A;  1SB3 C;  1YX5 B;  1WH3 A;  4C4V B;  2IO0 B;  2IBI B;  3QHT A;  2KDM A;  1FPY A;  2KAC A;  3WCQ A;  3ZKJ C;  4A6Q A;  1YQ3 B;  1X1M A;  1FD6 A;  5HHD G;  1PQS A;  3SHQ A;  3OG5 A;  2M17 A;  1SE4 A;  4X57 B;  2WX0 A;  1SE3 A;  4KDL B;  3R2I A;  1ZOY B;  4DHZ B;  2XBB C;  2BWF A;  1ISN A;  1WGD A;  3ZTC A;  2EMS A;  2BWE S;  2WU2 B;  1R7S A;  1L4D B;  3VHT C;  5DPT A;  1EF5 A;  5C1Z A;  2INN E;  4KVG B;  5T8I A;  3V62 A;  4CQN A;  1F52 A;  2PW9 A;  1UZX B;  1MPE A;  2G4D B;  1SIJ A;  2AQ1 B;  1HTO A;  4I6L B;  5D3I B;  4TUU A;  2NVU I;  3PRM B;  3ABV B;  2VZK D;  1A70 A;  4RCO A;  4S0R A;  3Q14 C;  3R8B A;  3PHW B;  4PS8 A;  3RNF C;  1VJK A;  2C9W B;  2KJ6 A;  3M3J A;  2MBO A;  4XE0 A;  2KAN A;  1J7B A;  1YOV B;  1R4N I;  5HFY A;  4ZRI A;  4H2A A;  2D11 A;  2KDF B;  1YN5 A;  2A5U A;  3WAO A;  3EFU A;  2JXX A;  3L0W B;  5E6J A;  3DVG Y;  2L7R A;  2LHE A;  2XN9 C;  1E8X A;  2LGY A;  1Q1O A;  2NPT A;  1LM8 B;  2H89 B;  4YL8 A;  5JHA A;  2KTF A;  3V6C B;  2L0F A;  3DVN V;  3N9Y C;  3GE3 C;  2HJ8 A;  1EU3 A;  1U4A A;  3OWE B;  2D3C A;  2REX A;  3H9D A;  4OVV A;  4HWI B;  2WDR B;  2W3S A;  4DDI D;  1Q0W B;  1TY2 A;  2V3P A;  2D3B A;  2LGD A;  3V6E B;  1MI0 A;  3JSV B;  3RZW C;  4BBN F;  4PYZ A;  1IP9 A;  2DHZ A;  4II3 B;  1TKE A;  4BAX A;  4HJG E;  5IA7 A;  3HK0 A;  2FUH B;  3WIM A;  5FR6 A;  4UDU C;  2IY1 B;  1CK1 A;  2MLB A;  2QEJ C;  4MGI E;  4RM8 A;  4OW0 A;  4WWO A;  1VDV A;  3PZ8 A;  2L8J A;  2XNA C;  4FJY A;  1ROE A;  4IUM B;  2MP2 A;  2ICI A;  1WSP A;  2HD5 B;  1S1Q B;  5IO9 A;  1L5P A;  1P0R A;  2FNJ B;  3MHZ A;  3I57 A;  1I4X A;  3PRE A;  3TEY A;  3U2S C;  2JRI B;  3BIN A;  2DZK A;  2Z0E B;  3SEB A;  5CTR C;  3SFD B;  3VRB B;  3N1X C;  2W3R A;  1C4C A;  4RGM A;  3NZ3 A;  1JRU A;  1WWT A;  1I35 A;  3NZU A;  3WA0 A;  3UF8 A;  5I4D A;  3SD5 A;  3I63 C;  2N4F A;  3BVZ A;  2BYT A;  1JAL A;  1N63 A;  2FCS A;  3ZQ4 A;  1C4P A;  1NEN B;  1TS4 A;  2JT4 B;  4KV2 A;  1RWS A;  5H8Y E;  2B3A A;  5KHQ A;  1C9F A;  3RCZ A;  1WJ6 A;  3A1Q B;  2DZJ A;  4HRO A;  5TR5 A;  5AUI A;  3S2A A;  1FO4 A;  3FIL B;  3TEZ A;  2N7D A;  1I4R A;  2W82 A;  4HKQ A;  4HDQ A;  1XF5 L;  2MCN B;  2FCM A;  4B95 A;  2AL3 A;  1PUT A;  2WXK A;  2GB1 A;  3JVZ X;  4BVU C;  1IGC A;  3QX1 A;  4ZHO A;  4DXA B;  4BBN C;  3W1Y A;  2J52 A;  4MGK E;  3ZRF A;  5E6O A;  1KLU D;  1VLB A;  4ACF A;  1WE7 A;  2R2Q A;  5E6P A;  3DWG C;  2FUG 1;  2KX0 A;  2BS3 B;  1JWM D;  1FEH A;  1TS5 A;  3AE9 B;  1N61 A;  5JHB A;  3CF6 E;  1WGR A;  4D2K A;  1XCQ L;  3VUY A;  3PLV A;  2D3A A;  3ZYY X;  3L13 A;  4NZL B;  4AOF A;  3ZO5 B;  1UNS A;  1XD3 B;  4PK1 A;  2KYW A;  4FN2 A;  1TBE A;  4NPN A;  4LDT D;  4GGQ A;  4MH0 E;  1PGB A;  2N9P C;  4QAY A;  2OHF A;  2LUM A;  2IZV B;  1XLP A;  4MGY E;  3ZDT A;  2FIF A;  4HCP B;  4KZ0 A;  3K9P B;  2NBV B;  4WJO A;  3VUX A;  4EZL A;  3MC0 B;  2KDB A;  2PVG C;  4IM0 A;  2E3T A;  4YTM B;  3TIX A;  1BT0 A;  3EC8 A;  5C23 A;  2KLG A;  2IPK D;  1JQ4 A;  3N1Y C;  3GP7 A;  3DPD A;  3ZUN A;  4YSZ B;  4NAW B;  4IDI A;  4OHJ A;  1WF9 A;  4AQ7 A;  2MBH A;  4US9 A;  3V3X A;  2YLM A;  2RDG A;  3NZS A;  3N20 C;  1JWU D;  3R66 C;  3VR8 B;  3RPF C;  4JLC A;  2KKC A;  1JRP A;  1ZGU B;  2BYV E;  1L0V B;  4DHJ D;  1ZKH A;  5E6N A;  2O2V B;  3P2B A;  1UEL A;  1WGK A;  4B0E A;  3W1S A;  1TKY A;  2FBW B;  5C2T B;  2K0P A;  3ZNZ B;  1TY0 A;  4HPL B;  2MQJ A;  1UH6 A;  1Y8R C;  3ML9 A;  5HG2 A;  3U30 A;  3UGB B;  1H8C A;  2NBU A;  3AB5 A;  5BO4 B;  4GIV A;  5GXG B;  1AWD A;  2WDT B;  4G11 A;  2AEH A;  2NS5 A;  1NI3 A;  1IUE A;  3U7D A;  4W9H A;  1VZ6 A;  3DBR I;  4IOI E;  3RUI B;  4DXG A;  3I3T B;  1EU4 A;  1FXI A;  1LO5 D;  1YQ4 B;  2KMC A;  4ANV A;  2PTL A;  1FNW A;  2WS3 B;  1V5T A;  2FID A;  1N60 A;  2WLB A;  3B9J A;  2HE7 A;  4US8 A;  2LGX A;  5AZF A;  4N58 A;  1F77 A;  2LRU A;  1XEE A;  3A33 B;  5DPW A;  1YJ1 A;  4CYE A;  2Y5C A;  3UIN B;  2BGF A;  3NS8 A;  4WWN A;  2NBW B;  1JWB D;  4ASW C;  2R61 A;  4MJS B;  2W54 A;  3NJT A;  2KTR A;  1V5O A;  4ZRP A;  4MT5 A;  2O6V D;  2LFI A;  5IOI A;  3A9J A;  1B9R A;  3HIZ A;  2UWQ A;  1MFW A;  3BVG A;  3SR6 A;  3W9C B;  4RF1 A;  3AEF B;  1JCK B;  3IBE A;  1WGH A;  2AYO B;  2N9K A;  1G6J A;  1V97 A;  4PYU A;  5BYS A;  2M1M A;  3AM9 A;  3W5U B;  2LD9 A;  3MFG A;  1R4M I;  2RGF A;  1F2R C;  5CX3 A;  2PE9 A;  3Q3M C;  2KWD A;  1WX8 A;  3OAW A;  3R3M A;  4P16 A;  3ZVV A;  1QLB B;  4MM3 B;  1E7V A;  2O2V A;  3BYY B;  1D5M C;  1L0X B;  4TQ1 A;  3DCG A;  3M95 A;  3V05 A;  5JZE B;  4PS7 A;  2KVZ A;  4B6W A;  4JIO U;  4JGH B;  1ZXH A;  3A9K B;  4F1S A;  3HM6 X;  3RD2 A;  1JML A;  1WJU A;  2BPS A;  2K6Q A;  4EZJ A;  1I42 A;  1WIA A;  2OJR A;  4HPM B;  2QJL A;  2WXG A;  4LCD E;  1UUP A;  4EZK A;  2WXF A;  3C8Y A;  4K7U A;  3MC9 A;  3PGE A;  1SE9 A;  4WIP A;  5TSS A;  2KFK B;  2L00 B;  3DBH I;  2WXR A;  1EWC A;  2DYO A;  2J0M A;  3VTV A;  3V60 A;  1WRD B;  2MJE A;  1FFV A;  2IDY A;  3BYT B;  4IWP A;  2IJ0 A;  2LGS A;  5DPS A;  2PIA A;  1J0G A;  1L6U A;  2GBR A;  1R4N B;  1V6E A;  2KN4 A;  4M0W A;  1MHX A;  3KVF B;  4JPS A;  1DOI A;  2ZNV C;  1P1A A;  1XO3 A;  1VR9 A;  2KFJ A;  3AV8 A;  4J3O D;  5H92 C;  1SJE D;  4ARC A;  1GOZ A;  2MA9 B;  3DBL I;  4C7Y A;  1T6B X;  2DYM A;  1MG8 A;  2E6X A;  3KH0 A;  3ZLZ A;  2SEB D;  3PV1 A;  1ZW7 A;  4WJP A;  4ZYS A;  1TKG A;  3L4P A;  2KOX A;  2JZZ A;  2LJ5 A;  1E5W A;  2EKI A;  3GZN I;  2B76 B;  3KUD B;  3QCA A;  2DEN B;  4DHZ E;  3QA8 A;  2JZ3 B;  4M8N A;  3E56 A;  4BOZ B;  1TS3 A;  1WMH B;  3EHV A;  3A9K A;  2K3U A;  2N1W A;  3AH7 A;  4ZHP A;  1JRO A;  2RSU A;  2N9X A;  5IP4 D;  1KJT A;  4XWW A;  1JW9 D;  1WGY A;  4WWM A;  2QIL A;  1QOF A;  1P7F A;  1D5Z C;  2RPV A;  1FCL A;  5CHW A;  1ZP0 B;  1GB1 A;  3VTU A;  4ANU A;  1IBX B;  3BVM A;  1V81 A;  4KIK A;  1A5R A;  3KQ4 A;  5CHF A;  4ZOH C;  1V9J A;  4MEL A;  3APD A;  4L23 A;  3NRZ A;  4HJK A;  2LJI A;  1ET9 A;  2INP E;  1V1P A;  3Q2A C;  2LGI A;  3KYC D;  4LJP B;  4C80 A;  2MWS B;  2DZM A;  2GBM A;  1YNT E;  4DQO C;  1HQR D;  2TSS A;  4J6I A;  4EE2 A;  3ETR A;  1YMH E;  2G45 B;  3Q8B A;  2Z0D B;  5EE1 A;  1YJJ A;  2KDI A;  4WAF A;  5MPO A;  3ALB A;  4JX1 C;  3P4Q B;  4EFO A;  3ENE A;  3IAS 1;  3M63 B;  2O6V A;  2WHI A;  3AE5 B;  3A4R A;  1L4Z B;  4FBJ B;  3KWL A;  4A8X C;  4URK A;  4RNA A;  2D10 A;  4C4V A;  3P4S B;  3ZJU A;  2ZCB A;  3L08 A;  1OGW A;  4B9K A;  1WFY A;  1Z2M A;  4KDI C;  1P3Q U;  5L95 C;  2BYF A;  2NR2 A;  2HJ1 A;  1VZ8 A;  1Y56 A;  2DYB A;  4XZ4 A;  3GE8 C;  3GOE A;  3ZNG C;  1TT5 B;  3SU8 X;  3QAQ A;  1E8Y A;  2DBY A;  4XGA B;  2V3S A;  2QHO A;  4HK2 A;  3C19 A;  5G55 A;  2N1V A;  1UGJ A;  1BML C;  4XWT A;  4EEW A;  4Q2J A;  1GAQ B;  4FXC A;  1L7Y A;  1IBX A;  3LYY A;  2LVO A;  2IO2 B;  2IO1 B;  3IAM 1;  4KSL C;  4NNJ B;  1FFU A;  3VDZ A;  3Q8F A;  1WZ0 A;  2X38 A;  1HTQ A;  2YEP F;  2PMV A;  3QAR A;  5D3D A;  1P7E A;  4C7Z A;  2KQS A;  2L0T A;  3RN9 C;  1C4A A;  3IT6 B;  3MTN B;  3C0R B;  5FR3 A;  3WAP A;  3AEC B;  2C7M B;  1XT9 B;  3EUB 2;  1DGJ A;  3EFC A;  3H8H A;  3OJ4 B;  5HI1 A;  3TL5 A;  2GBK A;  1SXT A;  3SDL C;  1NYR A;  2M19 A;  1WXM A;  1WM2 A;  3T3O A;  3BWU D;  5G5G A;  3H6N A;  1J7A A;  3N30 A;  3AXC A;  3VQI A;  1MG4 A;  3MC8 A;  5D6J B;  3X23 A;  1BUI C;  4YTP B;  1N62 A;  1ZE3 D;  3JSV A;  2GOW A;  2M0X A;  1E7P B;  2KT7 A;  3RNC C;  2WYQ A;  3CSF A;  3PT2 B;  1XCT L;  4REZ A;  4AJW A;  4DWF A;  3DQV A;  2WXQ A;  4MGZ E;  1YN4 A;  3PTF C;  3CIR B;  3N3K B;  1WXQ A;  1QF6 A;  4GXB A;  5LNK 1;  4MSQ B;  1STE A;  4LJO B;  4WQO B;  3VR9 B;  3RFZ B;  2JF5 A;  4W9J A;  2BKF A;  3DBR B;  3QWZ B;  4I6N B;  2BB6 A;  4EUT A;  3OLM D;  2BKR B;  1EM7 A;  1C79 A;  2Q5W D;  1V80 A;  1FIQ A;  2N9L A;  2D3G A;  1N6Z A;  1XLO A;  3DDC B;  1WYW B;  3DHI C;  3AEA B;  1GPX A;  3X0W A;  3KLS X;  2AQ2 B;  2K25 A;  4JE3 B;  2IYD B;  2LEK A;  4HXD A;  2IO3 B;  4K7W A;  2C7N B;  2XK5 B;  2RD0 A;  4MAC A;  4OVU A;  2PVO D;  2JYT A;  5DPR A;  3FAH A;  2ON8 A;  3A1Q A;  2N9E B;  2KDE B;  4NJ6 A;  3ZJV A;  2SAK A;  3NVZ A;  3FIL A;  1TJE A;  2QMT A;  3VAW A;  4HDO A;  4PT5 A;  1T0R C;  2N7E A;  1K50 A;  1ESF A;  1F9J A;  2JWU A;  4AS1 A;  3APC A;  1XLQ A;  3ECI A;  4MEM A;  2Y5B B;  3W2D A;  1R4M B;  3VFK A;  2WP9 B;  1GG3 A;  1DYQ A;  4IC7 B;  4LK0 M;  2AWT A;  2X8X X;  4IWQ A;  1UWM A;  3ZXV A;  4ANX A;  2AX5 A;  5LLI A;  1KH0 A;  3IXS A;  3PVL A;  3MJW A;  2KD0 A;  4P1C C;  4FLH A;  3KUZ A;  2IY0 B;  4PS3 A;  1FXT B;  4GSW A;  4HKZ E;  3E9S A;  1QIL A;  2KC1 A;  3BII D;  3ZJT A;  1S3S G;  3N1Z C;  4E71 A;  1FRR A;  2BTE A;  3PZD A;  1FRD A;  2HTH A;  1E10 A;  3U4E G;  3PRZ A;  3DHG C;  4K3C A;  2WXI A;  2I2Y A;  2QCZ A;  2BQQ A;  3HRD D;  1ZXI A;  2RDB C;  3Q3J A;  4XX5 A;  1WI0 A;  2ZNV B;  3IHP C;  4GDL B;  3U8Z A;  2OED A;  4LNN A;  2CS4 A;  5IAA C;  3RNB C;  1C77 A;  2CHX A;  3NVV A;  3DWM A;  1T3Q A;  2IGG A;  4BFR A;  2K1F A;  4IW0 A;  3QJZ A;  2D07 B;  4DDG D;  3DBH B;  4A9A A;  2L32 A;  2M8S A;  1F0Z A;  4A3P A;  3AE8 B;  1YIW A;  1K8R B;  1F2R I;  2LUE A;  2L1A A;  2GLS A;  2BF8 B;  2DAF A;  2XK5 A;  5IKC M;  2G9H D;  1I7H A;  4NQK E;  4A20 A;  3B0A A;  1AN8 A;  2K8C A;  3KYD D;  4YWG G;  1UF0 A;  4OZA A;  2HDE A;  3RYT A;  2PPH A;  4JWU C;  1V49 A;  1AAR A;  3WAN A;  3VTW A;  3AMZ A;  3WAL A;  2J42 A;  4FJV B;  2K8H A;  3PZ7 A;  2KC2 A;  3KW5 B;  3DBL B;  1WRI A;  2KK8 A;  3BK2 A;  2JX5 A;  3RT3 B;  4NAW A;  1D5X C;  2CJO A;  3ZIM A;  2ZPY A;  3B08 A;  3W1S C;  1XQQ A;  1FNV A;  4A90 A;  4JL9 A;  1QQR A;  2LI5 A;  1J7C A;  4GMV A;  1LXD A;  3UQA A;  2I38 A;  2KAJ A;  3GZN B;  2L3Z A;  2V4I B;  4YXD B;  3M62 B;  3RI7 C;  2DNF A;  4DBG A;  1QKZ A;  2JZP A;  4DK5 A;  1T5X D;  3L54 A;  2BT6 A;  3TCA A;  1TZ1 A;  1E0Z A;  1WR1 A;  1Q5W B;  2G3Q B;  1QOA A;  2JPH A;  4LNI A;  3AE2 B;  1IYF A;  1D3Z A;  4WJN A;  2DAJ A;  1E8Z A;  4GDL A;  1JWA D;  2V4L A;  2PEA A;  4FHK A;  1IGD A;  5EDS A;  1L2N A;  5AEK B;  4JQW C;  4WWP A;  4YTN B;  3ZRC A;  4WJQ A;  3SFE B;  2K8B A;  5DCN A;  2KX3 A;  4HEA 1;  2WU5 B;  2WX1 A;  3AU4 A;  1I4G A;  1F1H A;  2PLP A;  1VCB A;  1QT9 A;  2KLC A;  2ZW1 A;  4RGN A;  3AU5 A;  1YJI A;  1WX9 A;  4II2 B;  1FM0 D;  4LNK A;  3P1M A;  2FAZ A;  3AE6 B;  2KWV B;  2LVP A;  2LRW A;  3HHM A;  3NY5 A;  4MJS A;  2WXO A;  5LXH A;  1UBQ A;  4OZC A;  2BYE A;  1NDD A;  5J17 A;  5IN7 A;  1WGG A;  3U7Z A;  3UQB A;  2MRP A;  2MJ3 A;  4G3X B;  3RNA C;  1UBI A;  5JH5 C;  4FHJ A;  5CHV C;  1CJE A;  4KZC A;  2JU6 X;  1K52 A;  3NVW A;  4BKG A;  2L52 A;  4YSY B;  1YN3 A;  3P4R B;  2K9X A;  3PO0 A;  2WXL A;  1H4R A;  1PDX A;  2GBN A;  5AZG A;  2EMT A;  3DOW A;  1Q10 A;  1UWX A;  2GBJ A;  3Q3F A;  4EOY A;  1TTN A;  2BB5 A;  1OQY A;  2JSV X;  2L05 A;  4NQL B;  3AEE B;  4MM3 A;  4K81 A;  4ITK A;  2KQ7 A;  1VZ7 A;  4WAA A;  3HUI A;  4AWJ A;  1KFY B;  4ICV A;  4BOS C;  5EE3 A;  3PPA A;  2KNB A;  2GI9 A;  2LMC A;  3RZF A;  3CST A;  3OJ3 A;  1YD8 U;  2ZPN A;  1RFK A;  4O1N A;  5BMG A;  2WXN A;  3ZW3 A;  3VH4 B;  3ZGZ A;  2NPT B;  3PLU A;  2KN5 A;  4KSK C;  2MJD A;  2LZ6 A;  2KMM A;  2MBE A;  1HZ5 A;  2YVC A;  3L10 B;  3TEX A;  3NUH B;  3AE4 B;  4FUL A;  2JVC A;  3TUO A;  4BKS A;  1WJN A;  3RUL A;  1BXT A;  2EEL A;  4N9F 4;  3T9L A;  3B1L X;  1OFF A;  3APF A;  4M00 A;  4USA A;  2Y3A A;  1RYJ A;  1ZPS A;  3T3N A;  3Q8C A;  2ZCC A;  1GC6 A;  2WQY B;  4ZRQ A;  4GOC A;  2DWQ A;  2KFK A;  2KHW B;  1KLG D;  3IFW B;  4KGR A;  2R2O A;  1I4P A;  3AEG B;  2C60 A;  3Q3O C;  2XEW A;  1PFD A;  3AE7 B;  4K1R B;  2KWU B;  4FJZ A;  1XXG A;  4LNO A;  3RNE C;  1SEB D;  4GB9 A;  4BKT A;  2M4N A;  4NJC A;  1ZDV A;  2MP2 B;  2FCN A;  1FNU A;  3AEB B;  5GMV A;  1E6E B;  1KF6 B;  2GMI C;  3B2F A;  3Q8A A;  3ONS A;  2Z8L A;  5BYR A;  4E3C A;  2ZW0 A;  4GU2 A;  3ZTD A;  3O65 B;  2JY6 A;  3BY4 B;  2WWZ A;  1LGR A;  1V8C A;  3FKY A;  2KVR A;  3VRA B;  2LAS A;  1WZ3 A;  3L16 A;  1GUA B;  3ZXR A;  4XC2 A;  4YSX B;  1IPG A;  4WUR A;  2CKH B;  4LLG M;  2OJW A;  4NAM A;  1DOX A;  4K3B A;  1YX6 B;  1HZ6 A;  4W9G A;  2EKE C;  1UGM A;  1SE2 A;  3VUW A;  3BZD B;  2DZI A;  4KGT A;  4CHK A;  4GLS C;  1T0Q C;  1SSN A;  5AUK A;  1EUV B;  1RRB A;  1WMH A;  2YEP B;  2L83 A;  1NI2 A;  4C56 C;  2KXJ A;  4P1B C;  1DOY A;  4NJ7 A;  1NYQ A;  2RR9 A;  4LTU A;  4NY0 A;  1TS2 A;  3W5V B;  1NBF C;  2IGH A;  1PYW D;  2ACZ B;  2M56 B;  2MH7 A;  3R2T A;  3UIP B;  4JWS C;  2ZJD A;  1WXA A;  2GRI A;  2MBB B;  1QOB A;  2ZVN A;  2V3N A;  3BK1 A;  1RM6 C;  1L0Y B;  4GDK B;  4RH6 A;  3R7Q A;  2CU3 A;  3HVD A;  2G1E A;  1KRH A;  2CHW A;  5EE9 A;  3UIO B;  2ZVO A;  4G0N B;  4S17 A;  3WAM A;  2JYE A;  4W9F A;  1J8C A;  4HCN B;  3EEC A;  4B0M A;  1E8W A;  3HM3 A;  3P63 A;  1CZP A;  1C1Y B;  1EF1 A;  1RFA A;  3O13 A;  4DXF A;  2MEK A;  3UI3 A;  4M01 A;  4HVB A;  3AE1 B;  3I5J C;  4TQ0 A;  4A55 A;  1GNU A;  2UU7 A;  2ONQ A;  3KUC B;  1KLV A;  5BMH A;  2I1J A;  3ZNI D;  4HPP A;  4EKU A;  3TEW A;  1P98 A;  1RLF A;  3VH3 B;  4AJY B;  2V9H A;  4TV3 A;  3ZDM C;  2KWC A;  2VZK B;  3NOB A;  1P9D U;  3LDZ E;  4ZRK A;  4IG7 B;  4MH8 A;  2QSD A;  2K6D B;  4OVZ A;  1M4V A;  2RDH A;  4L2Y A;  3GS2 A;  2LXA A;  1M94 A;  1WXV A;  2RMM A;  1MVK A;  2FE8 A;  1PGX A;  1WR6 E;  3FC4 A;  2QIE B;  1J19 A;  2NMQ A;  4IKG A;  3Q8E A;  3H1U A;  3JW0 X;  4L1B A;  1QOG A;  5C3J B;  3B2G A;  4C00 A;  4ICU A;  3TMP B;  2VH2 A;  4RFB A;  1VD2 A;  2KZR A;  5BYQ A;  1L6V A;  4P6V F;  1C76 A;  1SF0 A;  4GDK A;  3TSS A;  1C3T A;  3N32 A;  2N0S B;  2H88 B;  3HVZ A;  2BBC A;  2WGS A;  2MHJ A;  2KMA A;  1WY8 A;  2VH1 A;  1SBB B;  1OQQ A;  3DHH C;  5FK9 C;  1EWY C;  4YT0 B;  3U52 E;  4KKJ A;  1HEZ E;  2ZZP B;  2PJH A;  2V0G A;  4XYC A;  1HE8 A;  2RPQ A;  1QZE A;  4WQM A;  4RMA A;  3Q3N C;  1GJZ A;  3DVN U;  1HA5 A;  2JWZ A;  2QDF A;  4F8C B;  1RAX A;  1WYG A;  5G5H A;  4N6E B;  2I1K A;  5HKH A;  2CJN A;  3URY A;  4CO7 A;  1E90 A;  2W9N A;  1TGZ B;  4KX6 B;  4N59 A;  3TBL D;  2INC C;  4GN1 A;  4MSM B;  2A4Z A;  2NCN A;  4A3O A;  4ANW A;  3TJP A;  2BS2 B;  3VXW A;  2KTR B;  3QIJ A;  4XDC A;  2MSE D;  3J9C A;  3A9J B;  1GB4 A;  3CMM B;  1HXY D;  3H7P B;  3H7S A;  3NS1 A;  4BKS D;  3RMK C;  2K5P A;  3MP9 A;  3V61 A;  3K9O B;  1NEK B;  2WNM A;  4M8M A;  3P42 A;  4AUQ C;  2IGD A;  1E9M A;  3QC8 B;  4M02 A;  2DX5 B;  4HRS A;  5G2N A;  1V86 A;  4ZRJ A;  3AED B;  4HLE A;  2AQ3 B;  1OTR B;  1T0Y A;  1JWS D;  2J53 A;  2MX2 A;  1Z5S B;  4W9D A;  2BVC A;  4W9C A;  2C7H A;  4RF0 A;  2DLB A;  4OZB A;  2ASQ A;  1TZO A;  3AN1 A;  3QQ8 B;  2WXJ A;  5D7G A;  5JXV A;  2J4X A;  4IM3 A;  1I4H A;  3ZNH B;  1OEY A;  3A4S C;  4E74 A;  4RGO S;  3T8M A;  2JRH A;  5L83 A;  3GB1 A;  3IT4 B;  1NVI D;  1CQV A;  4FA6 A;  3AI5 A; 
#chains in the Genus database with same CATH homology
 3RNG C;  3RNE C;  1T0Q C;  3DHI C;  3Q14 C;  3DHH C;  3DHG C;  3N1X C;  3Q2A C;  3RNF C;  3Q3M C;  2RDB C;  3RNC C;  3N20 C;  2INC C;  3GE3 C;  3GE8 C;  4P1B C;  3I63 C;  1T0R C;  4P1C C;  3RNA C;  1T0S C;  3RN9 C;  3RNB C;  3Q3O C;  3N1Y C;  3RI7 C;  3RMK C;  3I5J C;  3N1Z C;  3Q3N C;  2IND C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...