1DOYA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN [2FE-2S]
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doyA00
3AEEB 2K9XA 2BS4B 1WYGA 4JWSC 4P6VF 1V8CA 1WWTA 2Y5CA 3KWLA 1OQRA 3VR8B 3NS1A 1JW9D 5C3JB 3P4SB 2FBWB 2MJ3A 1DOYA 3DWMA 1TKYA 2PIAA 1SB3C 2WLBA 1N63A 1J7BA 1A70A 1SF0A 1ZOYB 1ZUD2 2E3TA 1AYFA 1FXAA 1VJKA 4C7YA 3AEGB 3NVVA 3CWIA 1J7CA 1ZXIA 3AE2B 4YT0B 4US8A 2W3RA 4N58A 1L5PA 1VDVA 1L6UA 2MJDA 1QLBB 1JWBD 3AE6B 4JX1C 1FFUA 2QIEB 1FXIA 1JRPA 1WXQA 5AUIA 1FM0D 1WGKA 1DOIA 3B2FA 1E6EB 3AV8A 1FRDA 3AH7A 1E9MA 4ZOHC 1XO3A 2JX5A 4YXDB 2W3SA 3AE3B 1VLBA 2H88B 5EE0A 1TKGA 1GAQB 1N61A 2WS3B 3W9CB 3AE4B 3VRBB 3NVWA 2WQYB 1CZPA 1WRIA 1JROA 5GXGB 2M19A 1J7AA 1QOAA 1QOBA 1KFYB 1L6VA 1N60A 1RWSA 3EUB2 3NVZA 3P4QB 4C7ZA 3VRAB 2CU3A 1KF6B 2EKIA 2W54A 2WDRB 1OQQA 1E0ZA 2MH7A 1I7HA 2MJEA 2QJLA 1QOGA 2WP9B 3AE5B 3AN1A 4HRSA 1F0ZA 1T3QA 1TKEA 2HTME 2DBYA 4KX6B 4US9A 1JWAD 1ROEA 1L0VB 1V97A 3HRDD 3P63A 5EE9A 5H92C 1R7SA 1XLOA 3FAHA 3DWGC 2WU5B 4JWUC 4A9AA 3AEDB 1RYJA 3ZYYX 3HVZA 3ABVB 3AE1B 3NRZA 1EWYC 1QOFA 1JALA 1NVID 2CJOA 1NI3A 1RM6C 2WDQB 1E10A 2CJNA 3P4RB 2OHFA 1FO4A 1TJEA 2AX5A 1OFFA 5AUKA 3SR6A 2K22A 1CJEA 2KMMA 2K5PA 3W5UB 4YSZB 1DOXA 4FXCA 5G5GA 3SFDB 1NYQA 1UWMA 2N0SB 1IUEA 3BIID 2L52A 1QF6A 3AE8B 3P1MA 1FMAD 1RFKA 2PVOD 3HUIA 3W5VB 2KAJA 4YTNB 1NYRA 2LEKA 1KRHA 2DWQA 1YJJA 1QT9A 3AEAB 4YTPB 4IDIA 3AEBB 2PKOA 2G1EA 4WQMA 1E7PB 4USAA 1TYGB 3WCQA 3RPFC 1YJIA 3NVYA 3VR9B 1YQ4B 3AE9B 4HROA 2L83A 1FFVA 1N5XA 2Q5WD 4N59A 1XLQA 3B9JA 1XLNA 4WWMA 3CIRB 2M56B 1XLPA 1GPXA 1SIJA 1FIQA 1NENB 4ZHOA 1AWDA 1N62A 3AE7B 3P4PB 1NEKB 3PO0A 4YSYB 2B76B 3AM9A 4ZHPA 1FRRA 2BT6A 3AMZA 1B9RA 3ETRA 5H8YE 2W55A 3B2GA 3AEFB 1PDXA 3LXFA 1N5WA 5G5HA 3AB5A 3FC4A 2ACZB 5C2TB 2PVGC 1PUTA 3L4PA 2BS3B 4C80A 2H89B 2BS2B 2WDVB 4YTMB 1DGJA 4YSXB 5EE1A 4N6EB 3AECB 2WU2B 3SFEB 1YQ3B 2JQRB 1ZP0B 3LB8C 1PFDA 4ITKA 4LTUA 1JQ4A 5EE3A 5MPOA
chains in the Genus database with same CATH superfamily
1FXTB 3M3JA 1C4AA 2FBWB 1HXYD 3ALBA 2J7QB 3HK0A 2D10A 3MHZA 2PEAA 5DPWA 1VJKA 2WXKA 1E90A 1F9JA 2GRIA 4N58A 1VDVA 4JX1C 1DYQA 2ZVNA 4RM8A 4HXDA 3Q14C 4DK5A 4ANVA 5IO9A 2V3PA 1JWSD 5DPSA 3DHGC 1QZEA 1KF6B 4NY0A 4RF1A 2QJLA 2KFJA 2FCMA 4TMAB 3NY5A 2D3BA 2GOWA 3DHIC 4FLHA 4P7IA 3W1SA 2GMIC 3HVZA 2JT4B 3CSTA 2WDQB 3WIMA 3P4RB 4HDOA 4WWNA 2IO2B 2KX0A 2AWTA 2IYDB 4ASWC 4KZ0A 4MH0E 3HUIA 4WWPA 3VTUA 2J42A 4RCOA 1KRHA 3TL5A 1WI0A 4CHKA 2ZVOA 1FFVA 1TY2A 4N59A 2NVUI 1V86A 4BBNC 3P4PB 1EF1A 2A5UA 4NPNA 4PT5A 3RNEC 3U52E 3L08A 3SD5A 1B9RA 3A9JA 2C60A 2LFIA 3I5JC 1R4NB 3M95A 2WGSA 4XDDA 4N9F4 2BF8B 2IDYA 2CHZA 3UQBA 3NS1A 5LNK1 4ARIA 4C56C 4HJKA 1FD6A 2FUG1 1K50A 3JSVA 1R4NI 1UWXA 5IOIA 1CQVA 1IBXB 3CWIA 1ET9A 1WMHA 3BVGA 2Z0DB 2C7HA 4ZOHC 1VLBA 1JMLA 1UZXB 5C23A 1J7AA 1B1ZA 2LUEA 3EUB2 1FCLA 2LVQA 2GBNA 2KTRB 4IW0A 2MH7A 3SDLC 4K1RB 4JWUC 4GIVA 2MW5A 3BK1A 1KOTA 3NHEB 2CJOA 4RGOS 5E6NA 5IKCM 4D2KA 5KHOA 2LMCA 2DYBA 3OJ3A 2JRIB 5BYRA 2O2VA 2KX3A 4OVZA 4IWOA 5FR3A 4ZDVA 2IY1B 3N1ZC 3QC8B 4ICVA 4KDIC 3H1UA 1WJNA 1AWDA 3K9OB 4YSYB 3N20C 3VVWB 1C79A 4I6PA 3C0RB 1JWUD 2KJRA 5G55A 4DDGD 4J6IA 4OW0A 1WWTA 4FHJA 5I4DA 1SE2A 2D3CA 1N63A 1RRBA 4XE0A 2IY0B 3MC8A 1FXAA 3FILA 2NS5A 2LVOA 4IC7B 2BTEA 1L6UA 3HVDA 3TBLD 1JRPA 4EEWA 3MC0B 1HA5A 1M94A 2PLPA 1S1QB 1E9MA 2KWVB 3AE3B 4Q2JA 3VXWA 4OHJA 2KN5A 4DQOC 2WS3B 4C4VB 3ENEA 1S3SG 2IPKD 1AN8A 2IJ0A 2HD5B 2KYWA 2RD0A 4NJCA 2L1AA 3HM6X 4KKJA 1RLFA 4HK2A 5EE9A 3IG3A 2ZNVB 3FAHA 2KQ4X 3KLSX 3GOEA 2LRUA 2IGHA 1I4QA 2L3ZA 2AYOB 4DHJB 3MJ5A 2EKEC 2DAJA 3BVMA 1IPGA 2Z0EB 3QHTA 2DX5B 5G5GA 1NYQA 2NTTA 3L16A 3MFGA 1LFDA 2WDTB 2L00B 4FULA 2LRWA 3ZRFA 4OZAA 3AEBB 4C00A 4TV3A 2WX1A 4ZRIA 3IXSA 2BQQA 2D07B 3EA6A 3Q3FA 1R4MB 4W9EA 4IKGA 3QJZA 4NNJB 3GS2A 4MGKE 2N9KA 2WXOA 5EE1A 3JVZX 2C5LC 1SJED 3Q3NC 1HTQA 4EKUA 5CTRC 2G4SA 4REZA 1OQRA 4MM3B 2MRPA 2DZIA 1YNTE 1R4MI 2WXPA 4EOYA 1IGDA 1XD3B 2N7JA 1JRUA 2BB5A 1TTNA 3QX1A 4TSSA 3U7ZA 2QEJC 2K6DB 4JL9A 4C7YA 2MQJA 2R61A 3ZNZB 5JHBA 4HEA1 2UWQA 2OJWA 3ZXVA 3AE6B 1WR1A 2NBUA 2ZJDA 4XX5A 2JX5A 1FNUA 3PZ8A 3TEWA 3T3NA 4WIPA 1E5WA 1J0GA 4M0WB 4HPPA 1H8CA 3KW5B 3B08A 1V80A 3BVZA 1OQQA 2BYVE 4LNKA 4WQOB 1L7YA 1SJHD 2M8SA 2JU6X 1LQBA 3DWGC 1SE4A 1WFYA 4A9AA 2WX0A 4JQWC 4B6WA 4WJNA 3TIXA 1RM6C 1E10A 1IGCA 2QSDA 3PZ7A 2R2OA 2MBBB 1GC6A 4LJPB 2ZCBA 4GGQA 3PREA 1IUEA 2C7MB 2INNE 3DVNU 4EZLA 4W9IA 1P98A 3KUCB 2LEKA 1SEBD 2YLMA 4KIKB 1ZE3D 1WJ6A 2NR2A 3PSEB 5AZFA 4FHKA 1EU4A 2KWCA 2IBIB 1C4PA 2WXNA 4ARCA 3ZKJC 4ZHPA 2NPTA 1WE7A 2XK5B 2Y5PA 2LXCA 3AXCA 1C76A 1TZ1A 1WGRA 2I1JA 2IGGA 2ONQA 2PVGC 1DGJA 3KYCD 1ZXHA 3A33B 2IO0B 1I35A 3N3KB 1WXMA 1Z5SB 4IUMB 2Y5BB 4J3OD 2K9XA 1SE9A 2BVCA 3ZQ4A 2LGIA 3NUHB 1ET6A 1CK1A 1F77A 2EMSA 4G3XB 1QKZA 1WGGA 3QAQA 2CR5A 2K0PA 3AEGB 5CHFA 1UUPA 1ZXIA 2KN4A 1QLBB 1FFUA 2PW9A 2G4DB 2G45B 4MACA 1V1OA 1E6EB 1PGXA 1T5XD 4ZYNA 3LDZE 2KXJA 2MHJA 3NVWA 3VH3B 1WXVA 1KFYB 1F2RI 1RWSA 3JYUA 4GXBA 3P4QB 3PHXB 4E71A 4GDLA 4EE2A 1T3QA 4US9A 2KVZA 1JWAD 2M17A 3CF6E 4KSKC 2WU5B 1UBIA 4M8MA 4PS3A 2N1WA 2X8XX 1C9FA 3ZLZA 2K22A 1LM8B 4II3B 4WJOA 3NZ3A 4GOCA 2KQSA 2Z8LA 3K9PB 4OZCA 1NI2A 1E8YA 5T8IA 4URKA 5JZEB 3N1XC 5E6PA 5KHQA 1YJIA 2KKCA 2L83A 3VDZA 1I4XA 1T6BX 3V61A 3EFCA 4ZRJA 3PO0A 1NEKB 1J8CA 3AMZA 4LDTD 2W55A 4LNNA 2WXIA 2WDVB 4N6EB 2L0FA 2WU2B 2M0XA 3PTFC 5JH5C 2N4FA 1WZ0A 2KJHB 4CO7A 2V1YA 2GBKA 2NMQA 1OTRB 5C3JB 2MJ3A 2BKRB 1V1PB 2WWZA 1WZ3A 1UBQA 1Y8RC 4JLCA 3R7QA 3KUZA 5J17A 3NZSA 4S17A 1EO6A 3AV8A 3PPAA 2XN9C 5E6OA 2V4IB 3VRBB 3V6EB 4C7ZA 1YX5B 3VFKA 2ZZPB 4KDLB 3AE5B 3PS6A 4MGZE 1ZDXA 3HRDD 5H92C 2ZPYA 4HKQA 2GLSA 1QQRA 2WYQA 4W9DA 4KGRA 4B0MA 1D5XC 2KFKA 3ZVVA 2WHIA 2AX5A 2JVCA 4BKTA 3A4RA 2WXLA 3B1LX 4R3DA 2N0SB 4GU2A 2KAJA 5J2RA 4YTNB 3WAMA 1GG3A 1QT9A 1V5OA 1WJUA 2J52A 4IDIA 5CHVC 1G6JA 3ZO5B 1N5XA 3ZDTA 3U8ZA 2LUMA 1SIJA 1KJTA 2K3UA 4MGYE 1FCCC 1LGRA 1WIAA 3AEFB 3W5VB 5C2TB 3UQAA 3CSFA 2KHWB 3ZTDA 4YSXB 3VUYA 3Q3MC 5LXIB 4EZKA 4W9LA 4FADA 4P1CC 3VR8B 1JW9D 3PZDA 4FN2A 3W2DA 4ANXA 1MG4A 1J7BA 1D6EC 3RN9C 1WR6E 1XEEA 2NBVB 4LK0M 2BGFA 1ZKHA 4W9HA 3UF8A 3M62B 1WGKA 1ENFA 2DHZA 3B2FA 4XYCA 2K25A 1I4RA 5LLIA 1JWMD 4HPLB 2QCZA 4MJSA 1MVKA 4H2AA 1D3ZA 1C77A 1L6VA 1N60A 5HHDG 3LJ3A 2PPHA 1P9DU 2D3GA 2WP9B 1HE8A 4G0NB 3AN1A 1TKEA 3AULA 5D6JB 5CX3A 5D3DA 1L0VB 2JRHA 4AWJA 1XLOA 3I3TB 4B9KA 2IZVB 2QHOA 1NVID 2RDGA 2BBCA 4A6QA 4QAYA 1WGYA 4K7UA 3VTVA 2YEPB 3TEXA 3X0WA 3DBHB 2LWPA 2WXMA 2J53A 3P42A 2L52A 4HWIB 3AE8B 2PVOD 3KH0A 1OGWA 1YN3A 3HIZA 3I57A 2KC1A 4LLGM 4P16A 1GOZA 1XCQL 2LXAA 3ONSA 1TS3A 3T8MA 2MWSB 3DBHI 4NAWB 1NENB 2D2QA 3QQ8B 3AE7B 1WM2A 3AB5A 5IP4D 2JPHA 2BS3B 1BXTA 5HI1A 4OZBA 1C4CA 3T3OA 1MG8A 3TSSA 2BPSA 1IP9A 4L23A 4P6VF 1E8ZA 1GB4A 1MFWA 4ZRPA 3DWMA 3H7PA 5HG2A 2HTHA 1L0YB 4PK1A 2MSED 4FJZA 1RAXA 1ZW7A 3IBEA 2VZKB 4KSLC 1D5MC 2KC2A 3DOWA 1J7CA 4US8A 3RNGC 2MJDA 4YWGG 1HTOA 1FXIA 3LYYA 1OEYA 2OJRA 1JCKB 2YEPF 2VH1A 2CHWA 1AARA 2CU1A 2AL3A 3ZJVA 2ICIA 4BVUC 3KWVA 1I4GA 3BZDB 2EKIA 2QILA 2QMTA 4BZAA 2O6VB 1E7VA 2D5GA 2WXHA 3L54A 2DZKA 1YQBA 4WAAA 1I4HA 4LJOB 3A1QB 4KVGB 3VTWA 4LNOA 4IM3A 3BINA 2OHFA 2OOBB 2R2QA 1Q5WB 5BYQA 3RFZB 1V81A 1F1HA 4PYUA 2RDBC 3OWEB 3V60A 4KZCA 3N32A 4AOFA 5BO4B 4USAA 4AS1A 2PE9A 3Q3JA 4BAXA 4BBNF 4WWMA 1WXSA 2L32A 3QK0A 4B95A 1VZ6A 2FCNA 1QILA 1XCTL 2JWZA 3LXFA 2LGDA 1I4PA 4DWFA 1BUIC 4RGNA 4WAFA 2BS2B 2NBWB 3DHHC 3VUWA 3ZTCA 3DDCB 3SFEB 4ITKA 1ISNA 2K1FA 2BS4B 1TT5B 2MBQA 3RNCC 2RGFA 3KWLA 3ZRCA 3MTNB 1EWCA 2EELA 1IBXA 1E7UA 2D11A 4TQ0A 2E3TA 3L0WB 2Y3AA 5CHWA 3E56A 3APDA 4GDKA 3UIPB 2FAZA 4JPSA 1E8WA 4FJYA 2L76A 2WNMA 1FRDA 2L0TA 2J0KA 4A90A 1L2NA 1YIWA 5EE0A 1TKGA 2RPVA 2WQYB 5GXGB 2V3SA 2KTRA 4LNIA 2MBEA 2N9EB 3UGBB 4DXGA 2W54A 2C9WB 2MJEA 4HRSA 5IAAC 5JHAA 3A9KB 3IAS1 3RZWC 1BT0A 5D7GA 4XWWA 3EC8A 3AE1B 2WXFA 1EWYC 4TUUA 1OFFA 2MEKA 4K81A 1DOXA 1F2RC 3PLUA 2IO3B 1UELA 1FMAD 4GB9A 2MX2A 4ANUA 2V4LA 1YQ4B 4NZLB 3B9JA 1XLNA 4BFRA 2BKFA 5D3IB 4XDCA 1GPXA 1ZDVA 3SEBA 2JZPA 1HEZE 2B76B 2KVRA 3AM9A 4HDQA 4DXFA 4NQLB 1L4DB 1V49A 5FK9C 3L4PA 2KWUB 1X1MA 1OQYA 3M63B 4RH6A 4GMVA 4RNAA 3AEEB 1V8CA 2Y5CA 2CKHB 3Q3OC 1TKYA 2WLBA 1P7FA 1AYFA 1TGZB 4BKSA 3ZW3A 3L13A 2AQ1B 1UGJA 2W3RA 1GUAB 3UI3A 3IVFA 3RNAC 1JWBD 1EUVB 2XBBC 3AI5A 4HCNB 1FM0D 2JXXA 1FNWA 1XO3A 3Q2AC 4C4VA 5DPTA 4WH4A 2M19A 1SE3A 1QOBA 3VRAB 2CU3A 1LXDA 2BWFA 2WDRB 5HKHA 3QCAA 1I7HA 4G11A 4ACFA 2JF5A 3Q8FA 3U30A 3BWUD 2J4XA 2HJ1A 3V6CB 3OG5A 3V05A 3NZUA 1QOFA 2K8BA 4II2B 2JYEA 3T9LA 2IGDA 3V62A 1ZGUB 1Y56A 3SFDB 1UWMA 1C3TA 5AEKB 1SIFA 1VD2A 2PTLA 3KUDB 3Q6BA 3U7DA 5AZGA 1VR9A 2G1EA 3NOBA 5TSSA 3VR9B 2HE7A 2KT7A 1XLQA 2Q5WD 1WM3A 2HDEA 3BYYB 5BMGA 5LXHA 2BYFA 3UINB 1FRRA 3TMPB 1PDXA 2DYMA 5G5HA 3RT3B 2LD9A 3A9JB 4GLSC 4WWOA 2XNAC 2OEDA 1RFAA 1ZP0B 2GI9A 3PLVA 1MJDA 4MM3A 1YJ1A 1P7EA 1PGBA 4BKGA 1WRDB 4X57B 1HZ6A 1DOYA 3RI7C 2PIAA 2LGYA 2QDFA 1NBFC 2LGXA 3Q69A 3JSVB 2BYTA 2HJ8A 3U2SC 4AP4C 2AL6A 4JIOU 1L4ZB 2MP2A 1WMHB 1EM7A 3AH7A 3WAPA 1H4RA 4M0WA 4W9KA 1GAQB 2A4ZA 1F52A 1WRIA 3DVGY 3H9DA 2E6XA 1YX6B 1MHHE 4BKSD 1WXAA 3RULA 5IN7A 1UGMA 2C7NB 2K8HA 1ROEA 2KJ6A 3N9YC 2CS4A 3Q8CA 3L17A 1N6ZA 4EUTA 4GN1A 3NRZA 1NI3A 1MHXA 2CJNA 4A55A 1SXTA 3VUXA 2MA9B 3Q8AA 3L10B 2INPE 1XQQA 2INDC 4EFOA 4K7WA 1NYRA 2JWUA 3I63C 2I1KA 2DWQA 4YTPB 2M1MA 4DHJD 4M8NA 2O2VB 3RNBC 2QC8A 2M56B 2XK5A 3ML8A 3RMKC 3RNFC 1FIQA 2FCSA 3IT4B 1ZPSA 3H7PB 2KANA 3VH4B 2LJ5A 2ACZB 2H89B 3J9CA 4K3CA 4PYZA 1VCBA 3R2IA 4HKZE 1YQ3B 4JE3B 3RPFC 2MLBA 4JWSC 4DDID 4YL8A 2SEBD 4CYEA 1A70A 5J18A 1ZOYB 2V3NA 3R66C 4CQNA 3S2AA 2L8JA 5D2MB 2LI5A 2KLCA 4IWPA 4YT0B 3FILB 1Z2MA 2WXJA 3NG0A 3QIJA 3V3XA 2B3AA 4LCDE 3B0AA 1PGAA 1K51A 3W9CB 4ICUA 2LVPA 1CZPA 2UU7A 1QOAA 4RGTA 1KLGD 2V0GA 2KNBA 2HTME 2RPQA 4MSQB 3GP7A 3Q8BA 3PRZA 3DCGA 2KO3A 1YMHE 1RYJA 1YD8U 1T0YA 3PV1A 3GZNB 4DHZB 1WX8A 5GMVA 2ZW0A 1TJEA 2KMMA 3ZIMA 1YN4A 1QF6A 1V9JA 2W9NA 4EZJA 3GZNI 5BMHA 3QA8A 4BOZB 2ZW1A 3NVYA 2L7RA 2KQ7A 3MP9A 4HROA 4KKIA 2VRRB 3JW0X 2RSUA 2DZMA 3CIRB 1BMLC 1XLPA 4MEMA 1FO4A 1KLUD 3C8YA 4G50A 3OLMD 2WXRA 3IHPC 3EECA 4IOIE 4GDKB 3ZDMC 1XF5L 2K6QA 1UH6A 2DYOA 1KTKA 4ANWA 5L83A 1JQ4A 4PS7A 5EE3A 5HFYA 4MSMB 1V1PA 3VHTC 3IFWB 4FJVB 3GE8C 4B0EA 1WYWB 1WY8A 3EGRA 1WE6A 2JZZA 1YOVB 1OEYJ 1Q1OA 3TEYA 2ZNVC 1TS4A 1WJ4A 2BWES 4A20A 2DLBA 2KD0A 4RF0A 4FA6A 3TJPA 4AJWA 3RZFA 1N61A 1UF0A 3AE4B 3NJTA 4HLEA 1GJZA 2G3QB 1JROA 4M02A 1LO5D 2FNJB 1K52A 2KMAA 4XZ4A 2G9HD 1E0ZA 1WX9A 2ZPNA 2XEWA 2WXQA 4KX6B 3D32A 2N7EA 1R7SA 2KZRA 2KDBA 3RD2A 2GBMA 4AUQC 3ZYYX 2AEHA 4NAMA 4K7SA 3HM3A 4I6NB 2JY6A 3Q8EA 2FIDA 1CJEA 4YSZB 2K5PA 4L2YA 3MC9A 4LDTB 1L0XB 4FBJB 3IT6B 4WQMA 3DBRB 4HJGE 1TYGB 2KK8A 2BYEA 3RYTA 3WANA 3AU4A 1TIFA 3ZJTA 1KLVA 3E9SA 4NQKE 1CMXB 4DHZE 1K8RB 1V2YA 4A3OA 2DAFA 2NPTB 2NTSA 5L95C 4C80A 3QARA 3DBRI 2DZJA 4IG7B 4GSWA 2JQRB 3LB8C 4HCPB 3TUOA 1SSNA 2RR9A 1FPYA 1TY0A 1WYGA 2N9PC 3P4SB 3UIOB 2KACA 1ZUD2 3BY4B 4S0RA 3C19A 1UD7A 1WF9A 1WSPA 1WX7A 4UDUC 4MELA 4WJPA 2N7DA 3KQ4A 2JXTA 1C1YB 3X23A 3AU5A 4W9CA 2D3AA 3DVGX 4TKNA 2H88B 2BW2A 5G2NA 1NDDA 3MJWA 3O65B 3W1YA 2RDHA 3NVZA 2N9XA 2PE6B 1V6EA 4KV2A 1F0ZA 2N1VA 4GDLB 4RGMA 2I2YA 2LJIA 3WALA 3AEDB 4HPMB 5DPRA 4WURA 3PGEA 3APCA 5AZHA 2MBOA 2BB6A 3SR6A 3OJ4B 1HQRD 4MT5A 4KGSA 4F8CB 2KDEB 4A3PA 3P2BA 4IM2A 1T0SC 1RFKA 2YVCA 4I6LB 1KM7A 3AEAB 2DENB 2PKOA 4OVUA 3R8BA 2N9LA 1KH0A 3WCQA 3PT2B 3HHMA 4NAWA 2L05A 3R7RA 1J19A 1P0RA 2JZ3B 4W9JA 1I42A 1TBEA 3ZGZA 2LASA 3RCZA 2M0AA 4HVBA 2JUOA 2KDFB 5H8YE 3B2GA 3A4SC 4XGAB 1VRAB 2FUHB 2W82A 2J0MA 4XC2A 4YTMB 5C1ZA 1D5ZC 3AECB 1WH3A 1K53A 2I38A 5FKAC 4LTUA 2REXA 3GE3C 4MDKE 2MP2B 3W1SC 3ZNID 5D94A 1P1AA 4L1BA 2MBHA 2TSSA 1SF0A 4OVVA 1SBBB 2KMCA 3CMMB 4BOSC 5IA7A 1WGHA 3I9V1 4O1NA 5BMIA 3H7SA 3TCAA 1EU3A 3PRMB 2EMTA 2FCQA 2W3SA 4KGTA 3ZNGC 3FKYA 2AQ2B 3R3MA 2IO1B 2JYTA 4RM9A 3WA0A 3DBSA 3SHQA 1D4BA 2O6VA 3ZNHB 4ZYSA 3PRPB 1QOGA 2AQ3B 2J0JA 3A1QA 2LHDA 3P63A 1YN5A 4E3CA 3BYTB 2ON8A 2JSVX 1PQSA 2KDIA 3NS8A 4K3BA 2ASQA 1TS5A 1TZOA 2V9HA 5AUKA 1MI0A 2KFKB 4IM0A 1M4VA 4FXCA 3BIID 4RMAA 5DCNA 3ZJUA 4AQ7A 1HZ5A 3QWZB 2KWDA 1T0RC 3WAOA 1XXGA 2DNFA 3ECIA 1Q10A 1YJJA 2LHEA 3ZUNA 1U4AA 2KLGA 3APFA 2FE8A 2PMVA 3DQVA 3BK2A 4MH8A 1C78A 2LGSA 4ZHOA 1N62A 4PS8A 2NCNA 2BT6A 1E8XA 4F7ZA 4TQ1A 1N5WA 2VH2A 1PUTA 3H8HA 4M00A 1GC7A 3KVFB 1EF5A 2X38A 1TS2A 1GB1A 2INCC 4XWTA 5MPOA 1IYFA 4DBGA 3EFUA 1PYWD 1Q0WB 1STEA 3DBLB 3KYDD 3O13A 4RFBA 2PJHA 1SB3C 4ZRQA 3DPDA 2GBJA 3OAWA 3NVVA 1AW7A 3AE2B 2GBRA 1L5PA 2FIFA 2RMMA 4ZRKA 4NJ7A 4LNFA 2QIEB 1ACCA 1T0QC 1WXQA 5AUIA 5FR6A 1DOIA 3DBLI 4P1BC 3VAWA 4YXDB 1VZ7A 3PVLA 2K39A 2MCNB 3H6NA 4WJQA 4DXAB 2VZKD 1SGHA 1ESFA 4JGHB 4MJSB 5TR5A 3GB1A 4W9FA 4A8XC 3A9KA 3TEZA 2DBYA 1V97A 4E74A 2WXGA 1GNUA 2KTFA 1UNSA 3ABVB 2M4NA 2Z59B 1JALA 4AJYB 4W9GA 4MGIE 3RUIB 4IWQA 3EHVA 3W5UB 5JXVA 2O6VD 1WGDA 3SU8X 3URYA 3P1MA 1P3QU 2CHXA 1FNVA 3U4EG 3N30A 1XT9B 2KDMA 1VZ8A 1FEHA 2GB1A 2LZ6A 2KOXA 2UYZB 3IAM1 1E7PB 1MPEA 3AE9B 5BYSA 2ZEQA 5E6JA 3ZXRA 1A5RA 1V5TA 3R2TA 3DVNV 4M01A 2K8CA 4NJ6A 3ETRA 3ML9A 4F1SA 3VQIA 2SAKA 3FC4A 4KIKA 5EDSA 3MHSD 3PHWB 2ZCCA 1PFDA 3N1YC
chains in the Genus database with same CATH topology
2K9XA 2BS4B 3ZQ4A 3KWLA 2LGIA 1V1PA 1C4AA 3NUHB 2FBWB 1EWCA 1ET6A 1HXYD 2EELA 1CK1A 1IBXA 1F77A 4B0EA 3MHZA 4TQ0A 2E3TA 1QKZA 3EGRA 2Y3AA 3E56A 1VJKA 2WXKA 2GRIA 2K0PA 3AEGB 1UUPA 1ZXIA 4JPSA 2KN4A 4N58A 1VDVA 3TEYA 1QLBB 1TS4A 4JX1C 2DLBA 1FFUA 1DYQA 2PW9A 4MACA 1V1OA 2WNMA 4RF0A 1E6EB 1PGXA 1FRDA 1T5XD 4A90A 5EE0A 1TKGA 1N61A 3AE4B 2RPVA 3NVWA 2V3PA 2WQYB 1JROA 5GXGB 1JWSD 1LO5D 1K52A 1KFYB 1F2RI 1RWSA 3P4QB 1KF6B 4DXGA 2W54A 2G9HD 4RF1A 1E0ZA 2QJLA 2MJEA 4HRSA 4EE2A 2WXQA 1T3QA 4KX6B 4TMAB 4US9A 1JWAD 3IAS1 1R7SA 2WU5B 5D7GA 3W1SA 4XWWA 3ZYYX 3HVZA 3AE1B 2WXFA 4NAMA 1EWYC 2WDQB 1C9FA 3P4RB 3Q8EA 1OFFA 2K22A 1CJEA 2MEKA 2K5PA 4YSZB 1DOXA 1F2RC 3NZ3A 2Z8LA 1FMAD 4L2YA 3HUIA 1L0XB 2J42A 4RCOA 4OZCA 1KRHA 3IT6B 5T8IA 4WQMA 4HJGE 1TYGB 1YJIA 1YQ4B 4NZLB 2L83A 1FFVA 1TY2A 4N59A 3B9JA 1XLNA 1I4XA 1T6BX 5D3IB 4XDCA 1GPXA 1ZDVA 3SEBA 3ZJTA 3E9SA 2JZPA 3P4PB 1NEKB 3PO0A 1HEZE 2B76B 3AM9A 4PT5A 3U52E 3AMZA 4DXFA 1B9RA 2LFIA 2W55A 1L4DB 5FK9C 2NTSA 2WXIA 3L4PA 4C80A 2WDVB 4XDDA 4N6EB 2WU2B 2JQRB 3LB8C 3TUOA 2IDYA 1SSNA 4RH6A 4RNAA 1TY0A 3AEEB 1WYGA 1V8CA 2Y5CA 3NS1A 2NMQA 5C3JB 3P4SB 4C56C 2MJ3A 2FUG1 5LNK1 4ARIA 1FD6A 1TKYA 1K50A 1V1PB 2WLBA 2KACA 1P7FA 1ZUD2 1AYFA 1UWXA 1CQVA 1IBXB 1WSPA 3CWIA 2AQ1B 1UGJA 2W3RA 1ET9A 3UI3A 4UDUC 3BVGA 1JWBD 3KQ4A 2JXTA 1FM0D 3AV8A 4ZOHC 1FNWA 1XO3A 2XN9C 2V4IB 1VLBA 2H88B 1JMLA 2BW2A 3VRBB 2RDHA 4WH4A 2M19A 1J7AA 1SE3A 1B1ZA 1QOBA 3EUB2 3NVZA 4C7ZA 1FCLA 3VRAB 2CU3A 2WDRB 2MH7A 1I7HA 3AE5B 1F0ZA 1ZDXA 4GDLB 3HRDD 4RGMA 3Q8FA 5H92C 2I2YA 2LJIA 3BWUD 2J4XA 4JWUC 4HKQA 1QQRA 3AEDB 3V05A 4KGRA 3BK1A 1QOFA 2CJOA 4WURA 4RGOS 4B0MA 1D5XC 2JYEA 2IGDA 2BB6A 2AX5A 3SR6A 4D2KA 2LMCA 1HQRD 4MT5A 1Y56A 2WXLA 4KGSA 4R3DA 3SFDB 1UWMA 2N0SB 5BYRA 1RFKA 2KAJA 4YTNB 2PTLA 4OVZA 1QT9A 3AEAB 2J52A 4IDIA 2PKOA 1VR9A 2G1EA 5FR3A 3R8BA 2N9LA 1KH0A 5TSSA 3WCQA 3VR9B 1N5XA 2Q5WD 1XLQA 2HDEA 3BYYB 2LUMA 5BMGA 1SIJA 1AWDA 4YSYB 3ZGZA 1FRRA 2M0AA 2K3UA 1FCCC 5H8YE 3B2GA 3AEFB 1PDXA 2DYMA 5G5HA 5C2TB 3W5VB 1VRAB 2W82A 1C79A 4GLSC 4YTMB 4YSXB 1D5ZC 3AECB 2XNAC 1K53A 2OEDA 1JWUD 1ZP0B 2GI9A 2I38A 4LTUA 5FKAC 1P7EA 1PGBA 4OW0A 1WWTA 5I4DA 1HZ6A 3VR8B 1SE2A 1JW9D 3W2DA 1DOYA 4L1BA 2PIAA 2TSSA 1N63A 1J7BA 1SF0A 1D6EC 4XE0A 1FXAA 3FILA 1SBBB 1XEEA 3Q69A 4LK0M 2BYTA 3U2SC 3I9V1 4O1NA 2BTEA 1L6UA 5BMIA 1L4ZB 3HVDA 1EU3A 1JRPA 3MC0B 1HA5A 1WGKA 2PLPA 1ENFA 3B2FA 1EM7A 3AH7A 1E9MA 1I4RA 1JWMD 2W3SA 3AE3B 4KGTA 4M0WA 4Q2JA 1GAQB 4OHJA 4DQOC 2AQ2B 2WS3B 2JYTA 1MVKA 1WRIA 4H2AA 1C77A 2IPKD 2E6XA 1L6VA 1AN8A 1N60A 5HHDG 2IJ0A 1D4BA 4NJCA 2L1AA 4ZYSA 1MHHE 2WP9B 1QOGA 3AN1A 4KKJA 1TKEA 2AQ3B 1ROEA 5D3DA 1L0VB 2LHDA 3N9YC 3P63A 1YN5A 5EE9A 3FAHA 1XLOA 3Q8CA 2KQ4X 3BYTB 3KLSX 2IGHA 2ON8A 1I4QA 2JSVX 3NRZA 3MJ5A 1NVID 1NI3A 1MHXA 1TS5A 2CJNA 1SXTA 4A55A 2RDGA 1TZOA 2BBCA 4A6QA 3BVMA 2YEPB 5AUKA 1MI0A 3TEXA 3Q8AA 2INPE 2WXMA 1M4VA 2J53A 4FXCA 1NYQA 3P42A 5G5GA 3BIID 2L52A 2NTTA 3AE8B 3MFGA 3ZJUA 2PVOD 4AQ7A 1HZ5A 1NYRA 2JWUA 2KWDA 1YN3A 1XXGA 2DWQA 4OZAA 1Q10A 1YJJA 2LHEA 4YTPB 3AEBB 3I57A 4LLGM 4P16A 1GOZA 1XCQL 2FE8A 2PMVA 3BK2A 4MH8A 1C78A 1TS3A 2M56B 3IXSA 4NAWB 1FIQA 1NENB 4ZHOA 3AE7B 1N62A 3EA6A 2BT6A 3IT4B 1ZPSA 4IKGA 4TQ1A 1N5WA 3GS2A 3AB5A 2ACZB 2N9KA 1PUTA 3H8HA 2WXOA 2BS3B 2H89B 3J9CA 1BXTA 5HI1A 5EE1A 4OZBA 1C4CA 2X38A 3R2IA 1TS2A 1YQ3B 4HKZE 3T3OA 1GB1A 4JE3B 3RPFC 3TSSA 1SJED 4XWTA 5MPOA 4L23A 4JWSC 4P6VF 1PYWD 1GB4A 4REZA 1OQRA 4MM3B 1STEA 1YNTE 2WXPA 3O13A 4ZRPA 4RFBA 2SEBD 3DWMA 1IGDA 2N7JA 2BB5A 1SB3C 5HG2A 1A70A 1ZOYB 1L0YB 4TSSA 4ZRQA 2QEJC 3U7ZA 2V3NA 4CQNA 2VZKB 1D5MC 4C7YA 3NVVA 2R61A 1AW7A 1J7CA 4US8A 3AE2B 4HEA1 4YT0B 3FILB 1L5PA 2RMMA 2MJDA 2WXJA 3AE6B 4YWGG 2QIEB 1ACCA 1FXIA 3V3XA 1WXQA 5AUIA 1DOIA 1PGAA 2JX5A 3LYYA 4YXDB 1VZ7A 1JCKB 1FNUA 1K51A 2YEPF 3PZ8A 3W9CB 3TEWA 1CZPA 3ZJVA 3T3NA 2ICIA 4WIPA 1QOAA 4RGTA 2VZKD 1ESFA 1KLGD 3KWVA 1I4GA 3BZDB 2V0GA 2EKIA 3GB1A 3BVZA 1OQQA 4A8XC 3TEZA 2QILA 2QMTA 2HTME 2DBYA 2D5GA 2WXHA 1SJHD 1V97A 3GP7A 2JU6X 3Q8BA 2WXGA 3DWGC 1SE4A 1I4HA 4A9AA 1YMHE 1UNSA 1RYJA 3ABVB 1JALA 1RM6C 1E10A 2ZW0A 1IGCA 2OHFA 1TJEA 2QSDA 3PZ7A 2KMMA 3W5UB 5JXVA 5BYQA 1YN4A 1IUEA 3URYA 3RFZB 1QF6A 2INNE 3P1MA 1FNVA 2LEKA 3U4EG 1SEBD 3OWEB 1ZE3D 2KDMA 1VZ8A 1FEHA 2GB1A 5BMHA 3IAM1 1E7PB 4USAA 1EU4A 2ZW1A 1C4PA 2WXNA 3MP9A 3NVYA 1MPEA 3AE9B 4HROA 4KKIA 4AS1A 5BYSA 5E6JA 3R2TA 4WWMA 3CIRB 2L32A 4ARCA 1BMLC 1XLPA 1VZ6A 4ZHPA 1FO4A 1KLUD 3C8YA 2Y5PA 1QILA 3ETRA 3VQIA 1XCTL 1C76A 2SAKA 2WXRA 3LXFA 2IGGA 1I4PA 3FC4A 2ONQA 2PVGC 1BUIC 4IOIE 4RGNA 4GDKB 4WAFA 2BS2B 1DGJA 1XF5L 1ZXHA 2DYOA 3SFEB 1KTKA 4ITKA 1PFDA 1JQ4A 4J3OD 5EE3A 5HFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE B;  2K9X A;  2BS4 B;  1WYG A;  4JWS C;  4P6V F;  1V8C A;  1WWT A;  2Y5C A;  3KWL A;  1OQR A;  3VR8 B;  3NS1 A;  1JW9 D;  5C3J B;  3P4S B;  2FBW B;  2MJ3 A;  1DOY A;  3DWM A;  1TKY A;  2PIA A;  1SB3 C;  2WLB A;  1N63 A;  1J7B A;  1A70 A;  1SF0 A;  1ZOY B;  1ZUD 2;  2E3T A;  1AYF A;  1FXA A;  1VJK A;  4C7Y A;  3AEG B;  3NVV A;  3CWI A;  1J7C A;  1ZXI A;  3AE2 B;  4YT0 B;  4US8 A;  2W3R A;  4N58 A;  1L5P A;  1VDV A;  1L6U A;  2MJD A;  1QLB B;  1JWB D;  3AE6 B;  4JX1 C;  1FFU A;  2QIE B;  1FXI A;  1JRP A;  1WXQ A;  5AUI A;  1FM0 D;  1WGK A;  1DOI A;  3B2F A;  1E6E B;  3AV8 A;  1FRD A;  3AH7 A;  1E9M A;  4ZOH C;  1XO3 A;  2JX5 A;  4YXD B;  2W3S A;  3AE3 B;  1VLB A;  2H88 B;  5EE0 A;  1TKG A;  1GAQ B;  1N61 A;  2WS3 B;  3W9C B;  3AE4 B;  3VRB B;  3NVW A;  2WQY B;  1CZP A;  1WRI A;  1JRO A;  5GXG B;  2M19 A;  1J7A A;  1QOA A;  1QOB A;  1KFY B;  1L6V A;  1N60 A;  1RWS A;  3EUB 2;  3NVZ A;  3P4Q B;  4C7Z A;  3VRA B;  2CU3 A;  1KF6 B;  2EKI A;  2W54 A;  2WDR B;  1OQQ A;  1E0Z A;  2MH7 A;  1I7H A;  2MJE A;  2QJL A;  1QOG A;  2WP9 B;  3AE5 B;  3AN1 A;  4HRS A;  1F0Z A;  1T3Q A;  1TKE A;  2HTM E;  2DBY A;  4KX6 B;  4US9 A;  1JWA D;  1ROE A;  1L0V B;  1V97 A;  3HRD D;  3P63 A;  5EE9 A;  5H92 C;  1R7S A;  1XLO A;  3FAH A;  3DWG C;  2WU5 B;  4JWU C;  4A9A A;  3AED B;  1RYJ A;  3ZYY X;  3HVZ A;  3ABV B;  3AE1 B;  3NRZ A;  1EWY C;  1QOF A;  1JAL A;  1NVI D;  2CJO A;  1NI3 A;  1RM6 C;  2WDQ B;  1E10 A;  2CJN A;  3P4R B;  2OHF A;  1FO4 A;  1TJE A;  2AX5 A;  1OFF A;  5AUK A;  3SR6 A;  2K22 A;  1CJE A;  2KMM A;  2K5P A;  3W5U B;  4YSZ B;  1DOX A;  4FXC A;  5G5G A;  3SFD B;  1NYQ A;  1UWM A;  2N0S B;  1IUE A;  3BII D;  2L52 A;  1QF6 A;  3AE8 B;  3P1M A;  1FMA D;  1RFK A;  2PVO D;  3HUI A;  3W5V B;  2KAJ A;  4YTN B;  1NYR A;  2LEK A;  1KRH A;  2DWQ A;  1YJJ A;  1QT9 A;  3AEA B;  4YTP B;  4IDI A;  3AEB B;  2PKO A;  2G1E A;  4WQM A;  1E7P B;  4USA A;  1TYG B;  3WCQ A;  3RPF C;  1YJI A;  3NVY A;  3VR9 B;  1YQ4 B;  3AE9 B;  4HRO A;  2L83 A;  1FFV A;  1N5X A;  2Q5W D;  4N59 A;  1XLQ A;  3B9J A;  1XLN A;  4WWM A;  3CIR B;  2M56 B;  1XLP A;  1GPX A;  1SIJ A;  1FIQ A;  1NEN B;  4ZHO A;  1AWD A;  1N62 A;  3AE7 B;  3P4P B;  1NEK B;  3PO0 A;  4YSY B;  2B76 B;  3AM9 A;  4ZHP A;  1FRR A;  2BT6 A;  3AMZ A;  1B9R A;  3ETR A;  5H8Y E;  2W55 A;  3B2G A;  3AEF B;  1PDX A;  3LXF A;  1N5W A;  5G5H A;  3AB5 A;  3FC4 A;  2ACZ B;  5C2T B;  2PVG C;  1PUT A;  3L4P A;  2BS3 B;  4C80 A;  2H89 B;  2BS2 B;  2WDV B;  4YTM B;  1DGJ A;  4YSX B;  5EE1 A;  4N6E B;  3AEC B;  2WU2 B;  3SFE B;  1YQ3 B;  2JQR B;  1ZP0 B;  3LB8 C;  1PFD A;  4ITK A;  4LTU A;  1JQ4 A;  5EE3 A;  5MPO A; 
#chains in the Genus database with same CATH topology
 1FXT B;  3M3J A;  1C4A A;  2FBW B;  1HXY D;  3ALB A;  2J7Q B;  3HK0 A;  2D10 A;  3MHZ A;  2PEA A;  5DPW A;  1VJK A;  2WXK A;  1E90 A;  1F9J A;  2GRI A;  4N58 A;  1VDV A;  4JX1 C;  1DYQ A;  2ZVN A;  4RM8 A;  4HXD A;  3Q14 C;  4DK5 A;  4ANV A;  5IO9 A;  2V3P A;  1JWS D;  5DPS A;  3DHG C;  1QZE A;  1KF6 B;  4NY0 A;  4RF1 A;  2QJL A;  2KFJ A;  2FCM A;  4TMA B;  3NY5 A;  2D3B A;  2GOW A;  3DHI C;  4FLH A;  4P7I A;  3W1S A;  2GMI C;  3HVZ A;  2JT4 B;  3CST A;  2WDQ B;  3WIM A;  3P4R B;  4HDO A;  4WWN A;  2IO2 B;  2KX0 A;  2AWT A;  2IYD B;  4ASW C;  4KZ0 A;  4MH0 E;  3HUI A;  4WWP A;  3VTU A;  2J42 A;  4RCO A;  1KRH A;  3TL5 A;  1WI0 A;  4CHK A;  2ZVO A;  1FFV A;  1TY2 A;  4N59 A;  2NVU I;  1V86 A;  4BBN C;  3P4P B;  1EF1 A;  2A5U A;  4NPN A;  4PT5 A;  3RNE C;  3U52 E;  3L08 A;  3SD5 A;  1B9R A;  3A9J A;  2C60 A;  2LFI A;  3I5J C;  1R4N B;  3M95 A;  2WGS A;  4XDD A;  4N9F 4;  2BF8 B;  2IDY A;  2CHZ A;  3UQB A;  3NS1 A;  5LNK 1;  4ARI A;  4C56 C;  4HJK A;  1FD6 A;  2FUG 1;  1K50 A;  3JSV A;  1R4N I;  1UWX A;  5IOI A;  1CQV A;  1IBX B;  3CWI A;  1ET9 A;  1WMH A;  3BVG A;  2Z0D B;  2C7H A;  4ZOH C;  1VLB A;  1JML A;  1UZX B;  5C23 A;  1J7A A;  1B1Z A;  2LUE A;  3EUB 2;  1FCL A;  2LVQ A;  2GBN A;  2KTR B;  4IW0 A;  2MH7 A;  3SDL C;  4K1R B;  4JWU C;  4GIV A;  2MW5 A;  3BK1 A;  1KOT A;  3NHE B;  2CJO A;  4RGO S;  5E6N A;  5IKC M;  4D2K A;  5KHO A;  2LMC A;  2DYB A;  3OJ3 A;  2JRI B;  5BYR A;  2O2V A;  2KX3 A;  4OVZ A;  4IWO A;  5FR3 A;  4ZDV A;  2IY1 B;  3N1Z C;  3QC8 B;  4ICV A;  4KDI C;  3H1U A;  1WJN A;  1AWD A;  3K9O B;  4YSY B;  3N20 C;  3VVW B;  1C79 A;  4I6P A;  3C0R B;  1JWU D;  2KJR A;  5G55 A;  4DDG D;  4J6I A;  4OW0 A;  1WWT A;  4FHJ A;  5I4D A;  1SE2 A;  2D3C A;  1N63 A;  1RRB A;  4XE0 A;  2IY0 B;  3MC8 A;  1FXA A;  3FIL A;  2NS5 A;  2LVO A;  4IC7 B;  2BTE A;  1L6U A;  3HVD A;  3TBL D;  1JRP A;  4EEW A;  3MC0 B;  1HA5 A;  1M94 A;  2PLP A;  1S1Q B;  1E9M A;  2KWV B;  3AE3 B;  4Q2J A;  3VXW A;  4OHJ A;  2KN5 A;  4DQO C;  2WS3 B;  4C4V B;  3ENE A;  1S3S G;  2IPK D;  1AN8 A;  2IJ0 A;  2HD5 B;  2KYW A;  2RD0 A;  4NJC A;  2L1A A;  3HM6 X;  4KKJ A;  1RLF A;  4HK2 A;  5EE9 A;  3IG3 A;  2ZNV B;  3FAH A;  2KQ4 X;  3KLS X;  3GOE A;  2LRU A;  2IGH A;  1I4Q A;  2L3Z A;  2AYO B;  4DHJ B;  3MJ5 A;  2EKE C;  2DAJ A;  3BVM A;  1IPG A;  2Z0E B;  3QHT A;  2DX5 B;  5G5G A;  1NYQ A;  2NTT A;  3L16 A;  3MFG A;  1LFD A;  2WDT B;  2L00 B;  4FUL A;  2LRW A;  3ZRF A;  4OZA A;  3AEB B;  4C00 A;  4TV3 A;  2WX1 A;  4ZRI A;  3IXS A;  2BQQ A;  2D07 B;  3EA6 A;  3Q3F A;  1R4M B;  4W9E A;  4IKG A;  3QJZ A;  4NNJ B;  3GS2 A;  4MGK E;  2N9K A;  2WXO A;  5EE1 A;  3JVZ X;  2C5L C;  1SJE D;  3Q3N C;  1HTQ A;  4EKU A;  5CTR C;  2G4S A;  4REZ A;  1OQR A;  4MM3 B;  2MRP A;  2DZI A;  1YNT E;  1R4M I;  2WXP A;  4EOY A;  1IGD A;  1XD3 B;  2N7J A;  1JRU A;  2BB5 A;  1TTN A;  3QX1 A;  4TSS A;  3U7Z A;  2QEJ C;  2K6D B;  4JL9 A;  4C7Y A;  2MQJ A;  2R61 A;  3ZNZ B;  5JHB A;  4HEA 1;  2UWQ A;  2OJW A;  3ZXV A;  3AE6 B;  1WR1 A;  2NBU A;  2ZJD A;  4XX5 A;  2JX5 A;  1FNU A;  3PZ8 A;  3TEW A;  3T3N A;  4WIP A;  1E5W A;  1J0G A;  4M0W B;  4HPP A;  1H8C A;  3KW5 B;  3B08 A;  1V80 A;  3BVZ A;  1OQQ A;  2BYV E;  4LNK A;  4WQO B;  1L7Y A;  1SJH D;  2M8S A;  2JU6 X;  1LQB A;  3DWG C;  1SE4 A;  1WFY A;  4A9A A;  2WX0 A;  4JQW C;  4B6W A;  4WJN A;  3TIX A;  1RM6 C;  1E10 A;  1IGC A;  2QSD A;  3PZ7 A;  2R2O A;  2MBB B;  1GC6 A;  4LJP B;  2ZCB A;  4GGQ A;  3PRE A;  1IUE A;  2C7M B;  2INN E;  3DVN U;  4EZL A;  4W9I A;  1P98 A;  3KUC B;  2LEK A;  1SEB D;  2YLM A;  4KIK B;  1ZE3 D;  1WJ6 A;  2NR2 A;  3PSE B;  5AZF A;  4FHK A;  1EU4 A;  2KWC A;  2IBI B;  1C4P A;  2WXN A;  4ARC A;  3ZKJ C;  4ZHP A;  2NPT A;  1WE7 A;  2XK5 B;  2Y5P A;  2LXC A;  3AXC A;  1C76 A;  1TZ1 A;  1WGR A;  2I1J A;  2IGG A;  2ONQ A;  2PVG C;  1DGJ A;  3KYC D;  1ZXH A;  3A33 B;  2IO0 B;  1I35 A;  3N3K B;  1WXM A;  1Z5S B;  4IUM B;  2Y5B B;  4J3O D;  2K9X A;  1SE9 A;  2BVC A;  3ZQ4 A;  2LGI A;  3NUH B;  1ET6 A;  1CK1 A;  1F77 A;  2EMS A;  4G3X B;  1QKZ A;  1WGG A;  3QAQ A;  2CR5 A;  2K0P A;  3AEG B;  5CHF A;  1UUP A;  1ZXI A;  2KN4 A;  1QLB B;  1FFU A;  2PW9 A;  2G4D B;  2G45 B;  4MAC A;  1V1O A;  1E6E B;  1PGX A;  1T5X D;  4ZYN A;  3LDZ E;  2KXJ A;  2MHJ A;  3NVW A;  3VH3 B;  1WXV A;  1KFY B;  1F2R I;  1RWS A;  3JYU A;  4GXB A;  3P4Q B;  3PHX B;  4E71 A;  4GDL A;  4EE2 A;  1T3Q A;  4US9 A;  2KVZ A;  1JWA D;  2M17 A;  3CF6 E;  4KSK C;  2WU5 B;  1UBI A;  4M8M A;  4PS3 A;  2N1W A;  2X8X X;  1C9F A;  3ZLZ A;  2K22 A;  1LM8 B;  4II3 B;  4WJO A;  3NZ3 A;  4GOC A;  2KQS A;  2Z8L A;  3K9P B;  4OZC A;  1NI2 A;  1E8Y A;  5T8I A;  4URK A;  5JZE B;  3N1X C;  5E6P A;  5KHQ A;  1YJI A;  2KKC A;  2L83 A;  3VDZ A;  1I4X A;  1T6B X;  3V61 A;  3EFC A;  4ZRJ A;  3PO0 A;  1NEK B;  1J8C A;  3AMZ A;  4LDT D;  2W55 A;  4LNN A;  2WXI A;  2WDV B;  4N6E B;  2L0F A;  2WU2 B;  2M0X A;  3PTF C;  5JH5 C;  2N4F A;  1WZ0 A;  2KJH B;  4CO7 A;  2V1Y A;  2GBK A;  2NMQ A;  1OTR B;  5C3J B;  2MJ3 A;  2BKR B;  1V1P B;  2WWZ A;  1WZ3 A;  1UBQ A;  1Y8R C;  4JLC A;  3R7Q A;  3KUZ A;  5J17 A;  3NZS A;  4S17 A;  1EO6 A;  3AV8 A;  3PPA A;  2XN9 C;  5E6O A;  2V4I B;  3VRB B;  3V6E B;  4C7Z A;  1YX5 B;  3VFK A;  2ZZP B;  4KDL B;  3AE5 B;  3PS6 A;  4MGZ E;  1ZDX A;  3HRD D;  5H92 C;  2ZPY A;  4HKQ A;  2GLS A;  1QQR A;  2WYQ A;  4W9D A;  4KGR A;  4B0M A;  1D5X C;  2KFK A;  3ZVV A;  2WHI A;  2AX5 A;  2JVC A;  4BKT A;  3A4R A;  2WXL A;  3B1L X;  4R3D A;  2N0S B;  4GU2 A;  2KAJ A;  5J2R A;  4YTN B;  3WAM A;  1GG3 A;  1QT9 A;  1V5O A;  1WJU A;  2J52 A;  4IDI A;  5CHV C;  1G6J A;  3ZO5 B;  1N5X A;  3ZDT A;  3U8Z A;  2LUM A;  1SIJ A;  1KJT A;  2K3U A;  4MGY E;  1FCC C;  1LGR A;  1WIA A;  3AEF B;  3W5V B;  5C2T B;  3UQA A;  3CSF A;  2KHW B;  3ZTD A;  4YSX B;  3VUY A;  3Q3M C;  5LXI B;  4EZK A;  4W9L A;  4FAD A;  4P1C C;  3VR8 B;  1JW9 D;  3PZD A;  4FN2 A;  3W2D A;  4ANX A;  1MG4 A;  1J7B A;  1D6E C;  3RN9 C;  1WR6 E;  1XEE A;  2NBV B;  4LK0 M;  2BGF A;  1ZKH A;  4W9H A;  3UF8 A;  3M62 B;  1WGK A;  1ENF A;  2DHZ A;  3B2F A;  4XYC A;  2K25 A;  1I4R A;  5LLI A;  1JWM D;  4HPL B;  2QCZ A;  4MJS A;  1MVK A;  4H2A A;  1D3Z A;  1C77 A;  1L6V A;  1N60 A;  5HHD G;  3LJ3 A;  2PPH A;  1P9D U;  2D3G A;  2WP9 B;  1HE8 A;  4G0N B;  3AN1 A;  1TKE A;  3AUL A;  5D6J B;  5CX3 A;  5D3D A;  1L0V B;  2JRH A;  4AWJ A;  1XLO A;  3I3T B;  4B9K A;  2IZV B;  2QHO A;  1NVI D;  2RDG A;  2BBC A;  4A6Q A;  4QAY A;  1WGY A;  4K7U A;  3VTV A;  2YEP B;  3TEX A;  3X0W A;  3DBH B;  2LWP A;  2WXM A;  2J53 A;  3P42 A;  2L52 A;  4HWI B;  3AE8 B;  2PVO D;  3KH0 A;  1OGW A;  1YN3 A;  3HIZ A;  3I57 A;  2KC1 A;  4LLG M;  4P16 A;  1GOZ A;  1XCQ L;  2LXA A;  3ONS A;  1TS3 A;  3T8M A;  2MWS B;  3DBH I;  4NAW B;  1NEN B;  2D2Q A;  3QQ8 B;  3AE7 B;  1WM2 A;  3AB5 A;  5IP4 D;  2JPH A;  2BS3 B;  1BXT A;  5HI1 A;  4OZB A;  1C4C A;  3T3O A;  1MG8 A;  3TSS A;  2BPS A;  1IP9 A;  4L23 A;  4P6V F;  1E8Z A;  1GB4 A;  1MFW A;  4ZRP A;  3DWM A;  3H7P A;  5HG2 A;  2HTH A;  1L0Y B;  4PK1 A;  2MSE D;  4FJZ A;  1RAX A;  1ZW7 A;  3IBE A;  2VZK B;  4KSL C;  1D5M C;  2KC2 A;  3DOW A;  1J7C A;  4US8 A;  3RNG C;  2MJD A;  4YWG G;  1HTO A;  1FXI A;  3LYY A;  1OEY A;  2OJR A;  1JCK B;  2YEP F;  2VH1 A;  2CHW A;  1AAR A;  2CU1 A;  2AL3 A;  3ZJV A;  2ICI A;  4BVU C;  3KWV A;  1I4G A;  3BZD B;  2EKI A;  2QIL A;  2QMT A;  4BZA A;  2O6V B;  1E7V A;  2D5G A;  2WXH A;  3L54 A;  2DZK A;  1YQB A;  4WAA A;  1I4H A;  4LJO B;  3A1Q B;  4KVG B;  3VTW A;  4LNO A;  4IM3 A;  3BIN A;  2OHF A;  2OOB B;  2R2Q A;  1Q5W B;  5BYQ A;  3RFZ B;  1V81 A;  1F1H A;  4PYU A;  2RDB C;  3OWE B;  3V60 A;  4KZC A;  3N32 A;  4AOF A;  5BO4 B;  4USA A;  4AS1 A;  2PE9 A;  3Q3J A;  4BAX A;  4BBN F;  4WWM A;  1WXS A;  2L32 A;  3QK0 A;  4B95 A;  1VZ6 A;  2FCN A;  1QIL A;  1XCT L;  2JWZ A;  3LXF A;  2LGD A;  1I4P A;  4DWF A;  1BUI C;  4RGN A;  4WAF A;  2BS2 B;  2NBW B;  3DHH C;  3VUW A;  3ZTC A;  3DDC B;  3SFE B;  4ITK A;  1ISN A;  2K1F A;  2BS4 B;  1TT5 B;  2MBQ A;  3RNC C;  2RGF A;  3KWL A;  3ZRC A;  3MTN B;  1EWC A;  2EEL A;  1IBX A;  1E7U A;  2D11 A;  4TQ0 A;  2E3T A;  3L0W B;  2Y3A A;  5CHW A;  3E56 A;  3APD A;  4GDK A;  3UIP B;  2FAZ A;  4JPS A;  1E8W A;  4FJY A;  2L76 A;  2WNM A;  1FRD A;  2L0T A;  2J0K A;  4A90 A;  1L2N A;  1YIW A;  5EE0 A;  1TKG A;  2RPV A;  2WQY B;  5GXG B;  2V3S A;  2KTR A;  4LNI A;  2MBE A;  2N9E B;  3UGB B;  4DXG A;  2W54 A;  2C9W B;  2MJE A;  4HRS A;  5IAA C;  5JHA A;  3A9K B;  3IAS 1;  3RZW C;  1BT0 A;  5D7G A;  4XWW A;  3EC8 A;  3AE1 B;  2WXF A;  1EWY C;  4TUU A;  1OFF A;  2MEK A;  4K81 A;  1DOX A;  1F2R C;  3PLU A;  2IO3 B;  1UEL A;  1FMA D;  4GB9 A;  2MX2 A;  4ANU A;  2V4L A;  1YQ4 B;  4NZL B;  3B9J A;  1XLN A;  4BFR A;  2BKF A;  5D3I B;  4XDC A;  1GPX A;  1ZDV A;  3SEB A;  2JZP A;  1HEZ E;  2B76 B;  2KVR A;  3AM9 A;  4HDQ A;  4DXF A;  4NQL B;  1L4D B;  1V49 A;  5FK9 C;  3L4P A;  2KWU B;  1X1M A;  1OQY A;  3M63 B;  4RH6 A;  4GMV A;  4RNA A;  3AEE B;  1V8C A;  2Y5C A;  2CKH B;  3Q3O C;  1TKY A;  2WLB A;  1P7F A;  1AYF A;  1TGZ B;  4BKS A;  3ZW3 A;  3L13 A;  2AQ1 B;  1UGJ A;  2W3R A;  1GUA B;  3UI3 A;  3IVF A;  3RNA C;  1JWB D;  1EUV B;  2XBB C;  3AI5 A;  4HCN B;  1FM0 D;  2JXX A;  1FNW A;  1XO3 A;  3Q2A C;  4C4V A;  5DPT A;  4WH4 A;  2M19 A;  1SE3 A;  1QOB A;  3VRA B;  2CU3 A;  1LXD A;  2BWF A;  2WDR B;  5HKH A;  3QCA A;  1I7H A;  4G11 A;  4ACF A;  2JF5 A;  3Q8F A;  3U30 A;  3BWU D;  2J4X A;  2HJ1 A;  3V6C B;  3OG5 A;  3V05 A;  3NZU A;  1QOF A;  2K8B A;  4II2 B;  2JYE A;  3T9L A;  2IGD A;  3V62 A;  1ZGU B;  1Y56 A;  3SFD B;  1UWM A;  1C3T A;  5AEK B;  1SIF A;  1VD2 A;  2PTL A;  3KUD B;  3Q6B A;  3U7D A;  5AZG A;  1VR9 A;  2G1E A;  3NOB A;  5TSS A;  3VR9 B;  2HE7 A;  2KT7 A;  1XLQ A;  2Q5W D;  1WM3 A;  2HDE A;  3BYY B;  5BMG A;  5LXH A;  2BYF A;  3UIN B;  1FRR A;  3TMP B;  1PDX A;  2DYM A;  5G5H A;  3RT3 B;  2LD9 A;  3A9J B;  4GLS C;  4WWO A;  2XNA C;  2OED A;  1RFA A;  1ZP0 B;  2GI9 A;  3PLV A;  1MJD A;  4MM3 A;  1YJ1 A;  1P7E A;  1PGB A;  4BKG A;  1WRD B;  4X57 B;  1HZ6 A;  1DOY A;  3RI7 C;  2PIA A;  2LGY A;  2QDF A;  1NBF C;  2LGX A;  3Q69 A;  3JSV B;  2BYT A;  2HJ8 A;  3U2S C;  4AP4 C;  2AL6 A;  4JIO U;  1L4Z B;  2MP2 A;  1WMH B;  1EM7 A;  3AH7 A;  3WAP A;  1H4R A;  4M0W A;  4W9K A;  1GAQ B;  2A4Z A;  1F52 A;  1WRI A;  3DVG Y;  3H9D A;  2E6X A;  1YX6 B;  1MHH E;  4BKS D;  1WXA A;  3RUL A;  5IN7 A;  1UGM A;  2C7N B;  2K8H A;  1ROE A;  2KJ6 A;  3N9Y C;  2CS4 A;  3Q8C A;  3L17 A;  1N6Z A;  4EUT A;  4GN1 A;  3NRZ A;  1NI3 A;  1MHX A;  2CJN A;  4A55 A;  1SXT A;  3VUX A;  2MA9 B;  3Q8A A;  3L10 B;  2INP E;  1XQQ A;  2IND C;  4EFO A;  4K7W A;  1NYR A;  2JWU A;  3I63 C;  2I1K A;  2DWQ A;  4YTP B;  2M1M A;  4DHJ D;  4M8N A;  2O2V B;  3RNB C;  2QC8 A;  2M56 B;  2XK5 A;  3ML8 A;  3RMK C;  3RNF C;  1FIQ A;  2FCS A;  3IT4 B;  1ZPS A;  3H7P B;  2KAN A;  3VH4 B;  2LJ5 A;  2ACZ B;  2H89 B;  3J9C A;  4K3C A;  4PYZ A;  1VCB A;  3R2I A;  4HKZ E;  1YQ3 B;  4JE3 B;  3RPF C;  2MLB A;  4JWS C;  4DDI D;  4YL8 A;  2SEB D;  4CYE A;  1A70 A;  5J18 A;  1ZOY B;  2V3N A;  3R66 C;  4CQN A;  3S2A A;  2L8J A;  5D2M B;  2LI5 A;  2KLC A;  4IWP A;  4YT0 B;  3FIL B;  1Z2M A;  2WXJ A;  3NG0 A;  3QIJ A;  3V3X A;  2B3A A;  4LCD E;  3B0A A;  1PGA A;  1K51 A;  3W9C B;  4ICU A;  2LVP A;  1CZP A;  2UU7 A;  1QOA A;  4RGT A;  1KLG D;  2V0G A;  2KNB A;  2HTM E;  2RPQ A;  4MSQ B;  3GP7 A;  3Q8B A;  3PRZ A;  3DCG A;  2KO3 A;  1YMH E;  1RYJ A;  1YD8 U;  1T0Y A;  3PV1 A;  3GZN B;  4DHZ B;  1WX8 A;  5GMV A;  2ZW0 A;  1TJE A;  2KMM A;  3ZIM A;  1YN4 A;  1QF6 A;  1V9J A;  2W9N A;  4EZJ A;  3GZN I;  5BMH A;  3QA8 A;  4BOZ B;  2ZW1 A;  3NVY A;  2L7R A;  2KQ7 A;  3MP9 A;  4HRO A;  4KKI A;  2VRR B;  3JW0 X;  2RSU A;  2DZM A;  3CIR B;  1BML C;  1XLP A;  4MEM A;  1FO4 A;  1KLU D;  3C8Y A;  4G50 A;  3OLM D;  2WXR A;  3IHP C;  3EEC A;  4IOI E;  4GDK B;  3ZDM C;  1XF5 L;  2K6Q A;  1UH6 A;  2DYO A;  1KTK A;  4ANW A;  5L83 A;  1JQ4 A;  4PS7 A;  5EE3 A;  5HFY A;  4MSM B;  1V1P A;  3VHT C;  3IFW B;  4FJV B;  3GE8 C;  4B0E A;  1WYW B;  1WY8 A;  3EGR A;  1WE6 A;  2JZZ A;  1YOV B;  1OEY J;  1Q1O A;  3TEY A;  2ZNV C;  1TS4 A;  1WJ4 A;  2BWE S;  4A20 A;  2DLB A;  2KD0 A;  4RF0 A;  4FA6 A;  3TJP A;  4AJW A;  3RZF A;  1N61 A;  1UF0 A;  3AE4 B;  3NJT A;  4HLE A;  1GJZ A;  2G3Q B;  1JRO A;  4M02 A;  1LO5 D;  2FNJ B;  1K52 A;  2KMA A;  4XZ4 A;  2G9H D;  1E0Z A;  1WX9 A;  2ZPN A;  2XEW A;  2WXQ A;  4KX6 B;  3D32 A;  2N7E A;  1R7S A;  2KZR A;  2KDB A;  3RD2 A;  2GBM A;  4AUQ C;  3ZYY X;  2AEH A;  4NAM A;  4K7S A;  3HM3 A;  4I6N B;  2JY6 A;  3Q8E A;  2FID A;  1CJE A;  4YSZ B;  2K5P A;  4L2Y A;  3MC9 A;  4LDT B;  1L0X B;  4FBJ B;  3IT6 B;  4WQM A;  3DBR B;  4HJG E;  1TYG B;  2KK8 A;  2BYE A;  3RYT A;  3WAN A;  3AU4 A;  1TIF A;  3ZJT A;  1KLV A;  3E9S A;  4NQK E;  1CMX B;  4DHZ E;  1K8R B;  1V2Y A;  4A3O A;  2DAF A;  2NPT B;  2NTS A;  5L95 C;  4C80 A;  3QAR A;  3DBR I;  2DZJ A;  4IG7 B;  4GSW A;  2JQR B;  3LB8 C;  4HCP B;  3TUO A;  1SSN A;  2RR9 A;  1FPY A;  1TY0 A;  1WYG A;  2N9P C;  3P4S B;  3UIO B;  2KAC A;  1ZUD 2;  3BY4 B;  4S0R A;  3C19 A;  1UD7 A;  1WF9 A;  1WSP A;  1WX7 A;  4UDU C;  4MEL A;  4WJP A;  2N7D A;  3KQ4 A;  2JXT A;  1C1Y B;  3X23 A;  3AU5 A;  4W9C A;  2D3A A;  3DVG X;  4TKN A;  2H88 B;  2BW2 A;  5G2N A;  1NDD A;  3MJW A;  3O65 B;  3W1Y A;  2RDH A;  3NVZ A;  2N9X A;  2PE6 B;  1V6E A;  4KV2 A;  1F0Z A;  2N1V A;  4GDL B;  4RGM A;  2I2Y A;  2LJI A;  3WAL A;  3AED B;  4HPM B;  5DPR A;  4WUR A;  3PGE A;  3APC A;  5AZH A;  2MBO A;  2BB6 A;  3SR6 A;  3OJ4 B;  1HQR D;  4MT5 A;  4KGS A;  4F8C B;  2KDE B;  4A3P A;  3P2B A;  4IM2 A;  1T0S C;  1RFK A;  2YVC A;  4I6L B;  1KM7 A;  3AEA B;  2DEN B;  2PKO A;  4OVU A;  3R8B A;  2N9L A;  1KH0 A;  3WCQ A;  3PT2 B;  3HHM A;  4NAW A;  2L05 A;  3R7R A;  1J19 A;  1P0R A;  2JZ3 B;  4W9J A;  1I42 A;  1TBE A;  3ZGZ A;  2LAS A;  3RCZ A;  2M0A A;  4HVB A;  2JUO A;  2KDF B;  5H8Y E;  3B2G A;  3A4S C;  4XGA B;  1VRA B;  2FUH B;  2W82 A;  2J0M A;  4XC2 A;  4YTM B;  5C1Z A;  1D5Z C;  3AEC B;  1WH3 A;  1K53 A;  2I38 A;  5FKA C;  4LTU A;  2REX A;  3GE3 C;  4MDK E;  2MP2 B;  3W1S C;  3ZNI D;  5D94 A;  1P1A A;  4L1B A;  2MBH A;  2TSS A;  1SF0 A;  4OVV A;  1SBB B;  2KMC A;  3CMM B;  4BOS C;  5IA7 A;  1WGH A;  3I9V 1;  4O1N A;  5BMI A;  3H7S A;  3TCA A;  1EU3 A;  3PRM B;  2EMT A;  2FCQ A;  2W3S A;  4KGT A;  3ZNG C;  3FKY A;  2AQ2 B;  3R3M A;  2IO1 B;  2JYT A;  4RM9 A;  3WA0 A;  3DBS A;  3SHQ A;  1D4B A;  2O6V A;  3ZNH B;  4ZYS A;  3PRP B;  1QOG A;  2AQ3 B;  2J0J A;  3A1Q A;  2LHD A;  3P63 A;  1YN5 A;  4E3C A;  3BYT B;  2ON8 A;  2JSV X;  1PQS A;  2KDI A;  3NS8 A;  4K3B A;  2ASQ A;  1TS5 A;  1TZO A;  2V9H A;  5AUK A;  1MI0 A;  2KFK B;  4IM0 A;  1M4V A;  4FXC A;  3BII D;  4RMA A;  5DCN A;  3ZJU A;  4AQ7 A;  1HZ5 A;  3QWZ B;  2KWD A;  1T0R C;  3WAO A;  1XXG A;  2DNF A;  3ECI A;  1Q10 A;  1YJJ A;  2LHE A;  3ZUN A;  1U4A A;  2KLG A;  3APF A;  2FE8 A;  2PMV A;  3DQV A;  3BK2 A;  4MH8 A;  1C78 A;  2LGS A;  4ZHO A;  1N62 A;  4PS8 A;  2NCN A;  2BT6 A;  1E8X A;  4F7Z A;  4TQ1 A;  1N5W A;  2VH2 A;  1PUT A;  3H8H A;  4M00 A;  1GC7 A;  3KVF B;  1EF5 A;  2X38 A;  1TS2 A;  1GB1 A;  2INC C;  4XWT A;  5MPO A;  1IYF A;  4DBG A;  3EFU A;  1PYW D;  1Q0W B;  1STE A;  3DBL B;  3KYD D;  3O13 A;  4RFB A;  2PJH A;  1SB3 C;  4ZRQ A;  3DPD A;  2GBJ A;  3OAW A;  3NVV A;  1AW7 A;  3AE2 B;  2GBR A;  1L5P A;  2FIF A;  2RMM A;  4ZRK A;  4NJ7 A;  4LNF A;  2QIE B;  1ACC A;  1T0Q C;  1WXQ A;  5AUI A;  5FR6 A;  1DOI A;  3DBL I;  4P1B C;  3VAW A;  4YXD B;  1VZ7 A;  3PVL A;  2K39 A;  2MCN B;  3H6N A;  4WJQ A;  4DXA B;  2VZK D;  1SGH A;  1ESF A;  4JGH B;  4MJS B;  5TR5 A;  3GB1 A;  4W9F A;  4A8X C;  3A9K A;  3TEZ A;  2DBY A;  1V97 A;  4E74 A;  2WXG A;  1GNU A;  2KTF A;  1UNS A;  3ABV B;  2M4N A;  2Z59 B;  1JAL A;  4AJY B;  4W9G A;  4MGI E;  3RUI B;  4IWQ A;  3EHV A;  3W5U B;  5JXV A;  2O6V D;  1WGD A;  3SU8 X;  3URY A;  3P1M A;  1P3Q U;  2CHX A;  1FNV A;  3U4E G;  3N30 A;  1XT9 B;  2KDM A;  1VZ8 A;  1FEH A;  2GB1 A;  2LZ6 A;  2KOX A;  2UYZ B;  3IAM 1;  1E7P B;  1MPE A;  3AE9 B;  5BYS A;  2ZEQ A;  5E6J A;  3ZXR A;  1A5R A;  1V5T A;  3R2T A;  3DVN V;  4M01 A;  2K8C A;  4NJ6 A;  3ETR A;  3ML9 A;  4F1S A;  3VQI A;  2SAK A;  3FC4 A;  4KIK A;  5EDS A;  3MHS D;  3PHW B;  2ZCC A;  1PFD A;  3N1Y C; 
#chains in the Genus database with same CATH homology
 2K9X A;  2BS4 B;  3ZQ4 A;  3KWL A;  2LGI A;  1V1P A;  1C4A A;  3NUH B;  2FBW B;  1EWC A;  1ET6 A;  1HXY D;  2EEL A;  1CK1 A;  1IBX A;  1F77 A;  4B0E A;  3MHZ A;  4TQ0 A;  2E3T A;  1QKZ A;  3EGR A;  2Y3A A;  3E56 A;  1VJK A;  2WXK A;  2GRI A;  2K0P A;  3AEG B;  1UUP A;  1ZXI A;  4JPS A;  2KN4 A;  4N58 A;  1VDV A;  3TEY A;  1QLB B;  1TS4 A;  4JX1 C;  2DLB A;  1FFU A;  1DYQ A;  2PW9 A;  4MAC A;  1V1O A;  2WNM A;  4RF0 A;  1E6E B;  1PGX A;  1FRD A;  1T5X D;  4A90 A;  5EE0 A;  1TKG A;  1N61 A;  3AE4 B;  2RPV A;  3NVW A;  2V3P A;  2WQY B;  1JRO A;  5GXG B;  1JWS D;  1LO5 D;  1K52 A;  1KFY B;  1F2R I;  1RWS A;  3P4Q B;  1KF6 B;  4DXG A;  2W54 A;  2G9H D;  4RF1 A;  1E0Z A;  2QJL A;  2MJE A;  4HRS A;  4EE2 A;  2WXQ A;  1T3Q A;  4KX6 B;  4TMA B;  4US9 A;  1JWA D;  3IAS 1;  1R7S A;  2WU5 B;  5D7G A;  3W1S A;  4XWW A;  3ZYY X;  3HVZ A;  3AE1 B;  2WXF A;  4NAM A;  1EWY C;  2WDQ B;  1C9F A;  3P4R B;  3Q8E A;  1OFF A;  2K22 A;  1CJE A;  2MEK A;  2K5P A;  4YSZ B;  1DOX A;  1F2R C;  3NZ3 A;  2Z8L A;  1FMA D;  4L2Y A;  3HUI A;  1L0X B;  2J42 A;  4RCO A;  4OZC A;  1KRH A;  3IT6 B;  5T8I A;  4WQM A;  4HJG E;  1TYG B;  1YJI A;  1YQ4 B;  4NZL B;  2L83 A;  1FFV A;  1TY2 A;  4N59 A;  3B9J A;  1XLN A;  1I4X A;  1T6B X;  5D3I B;  4XDC A;  1GPX A;  1ZDV A;  3SEB A;  3ZJT A;  3E9S A;  2JZP A;  3P4P B;  1NEK B;  3PO0 A;  1HEZ E;  2B76 B;  3AM9 A;  4PT5 A;  3U52 E;  3AMZ A;  4DXF A;  1B9R A;  2LFI A;  2W55 A;  1L4D B;  5FK9 C;  2NTS A;  2WXI A;  3L4P A;  4C80 A;  2WDV B;  4XDD A;  4N6E B;  2WU2 B;  2JQR B;  3LB8 C;  3TUO A;  2IDY A;  1SSN A;  4RH6 A;  4RNA A;  1TY0 A;  3AEE B;  1WYG A;  1V8C A;  2Y5C A;  3NS1 A;  2NMQ A;  5C3J B;  3P4S B;  4C56 C;  2MJ3 A;  2FUG 1;  5LNK 1;  4ARI A;  1FD6 A;  1TKY A;  1K50 A;  1V1P B;  2WLB A;  2KAC A;  1P7F A;  1ZUD 2;  1AYF A;  1UWX A;  1CQV A;  1IBX B;  1WSP A;  3CWI A;  2AQ1 B;  1UGJ A;  2W3R A;  1ET9 A;  3UI3 A;  4UDU C;  3BVG A;  1JWB D;  3KQ4 A;  2JXT A;  1FM0 D;  3AV8 A;  4ZOH C;  1FNW A;  1XO3 A;  2XN9 C;  2V4I B;  1VLB A;  2H88 B;  1JML A;  2BW2 A;  3VRB B;  2RDH A;  4WH4 A;  2M19 A;  1J7A A;  1SE3 A;  1B1Z A;  1QOB A;  3EUB 2;  3NVZ A;  4C7Z A;  1FCL A;  3VRA B;  2CU3 A;  2WDR B;  2MH7 A;  1I7H A;  3AE5 B;  1F0Z A;  1ZDX A;  4GDL B;  3HRD D;  4RGM A;  3Q8F A;  5H92 C;  2I2Y A;  2LJI A;  3BWU D;  2J4X A;  4JWU C;  4HKQ A;  1QQR A;  3AED B;  3V05 A;  4KGR A;  3BK1 A;  1QOF A;  2CJO A;  4WUR A;  4RGO S;  4B0M A;  1D5X C;  2JYE A;  2IGD A;  2BB6 A;  2AX5 A;  3SR6 A;  4D2K A;  2LMC A;  1HQR D;  4MT5 A;  1Y56 A;  2WXL A;  4KGS A;  4R3D A;  3SFD B;  1UWM A;  2N0S B;  5BYR A;  1RFK A;  2KAJ A;  4YTN B;  2PTL A;  4OVZ A;  1QT9 A;  3AEA B;  2J52 A;  4IDI A;  2PKO A;  1VR9 A;  2G1E A;  5FR3 A;  3R8B A;  2N9L A;  1KH0 A;  5TSS A;  3WCQ A;  3VR9 B;  1N5X A;  2Q5W D;  1XLQ A;  2HDE A;  3BYY B;  2LUM A;  5BMG A;  1SIJ A;  1AWD A;  4YSY B;  3ZGZ A;  1FRR A;  2M0A A;  2K3U A;  1FCC C;  5H8Y E;  3B2G A;  3AEF B;  1PDX A;  2DYM A;  5G5H A;  5C2T B;  3W5V B;  1VRA B;  2W82 A;  1C79 A;  4GLS C;  4YTM B;  4YSX B;  1D5Z C;  3AEC B;  2XNA C;  1K53 A;  2OED A;  1JWU D;  1ZP0 B;  2GI9 A;  2I38 A;  4LTU A;  5FKA C;  1P7E A;  1PGB A;  4OW0 A;  1WWT A;  5I4D A;  1HZ6 A;  3VR8 B;  1SE2 A;  1JW9 D;  3W2D A;  1DOY A;  4L1B A;  2PIA A;  2TSS A;  1N63 A;  1J7B A;  1SF0 A;  1D6E C;  4XE0 A;  1FXA A;  3FIL A;  1SBB B;  1XEE A;  3Q69 A;  4LK0 M;  2BYT A;  3U2S C;  3I9V 1;  4O1N A;  2BTE A;  1L6U A;  5BMI A;  1L4Z B;  3HVD A;  1EU3 A;  1JRP A;  3MC0 B;  1HA5 A;  1WGK A;  2PLP A;  1ENF A;  3B2F A;  1EM7 A;  3AH7 A;  1E9M A;  1I4R A;  1JWM D;  2W3S A;  3AE3 B;  4KGT A;  4M0W A;  4Q2J A;  1GAQ B;  4OHJ A;  4DQO C;  2AQ2 B;  2WS3 B;  2JYT A;  1MVK A;  1WRI A;  4H2A A;  1C77 A;  2IPK D;  2E6X A;  1L6V A;  1AN8 A;  1N60 A;  5HHD G;  2IJ0 A;  1D4B A;  4NJC A;  2L1A A;  4ZYS A;  1MHH E;  2WP9 B;  1QOG A;  3AN1 A;  4KKJ A;  1TKE A;  2AQ3 B;  1ROE A;  5D3D A;  1L0V B;  2LHD A;  3N9Y C;  3P63 A;  1YN5 A;  5EE9 A;  3FAH A;  1XLO A;  3Q8C A;  2KQ4 X;  3BYT B;  3KLS X;  2IGH A;  2ON8 A;  1I4Q A;  2JSV X;  3NRZ A;  3MJ5 A;  1NVI D;  1NI3 A;  1MHX A;  1TS5 A;  2CJN A;  1SXT A;  4A55 A;  2RDG A;  1TZO A;  2BBC A;  4A6Q A;  3BVM A;  2YEP B;  5AUK A;  1MI0 A;  3TEX A;  3Q8A A;  2INP E;  2WXM A;  1M4V A;  2J53 A;  4FXC A;  1NYQ A;  3P42 A;  5G5G A;  3BII D;  2L52 A;  2NTT A;  3AE8 B;  3MFG A;  3ZJU A;  2PVO D;  4AQ7 A;  1HZ5 A;  1NYR A;  2JWU A;  2KWD A;  1YN3 A;  1XXG A;  2DWQ A;  4OZA A;  1Q10 A;  1YJJ A;  2LHE A;  4YTP B;  3AEB B;  3I57 A;  4LLG M;  4P16 A;  1GOZ A;  1XCQ L;  2FE8 A;  2PMV A;  3BK2 A;  4MH8 A;  1C78 A;  1TS3 A;  2M56 B;  3IXS A;  4NAW B;  1FIQ A;  1NEN B;  4ZHO A;  3AE7 B;  1N62 A;  3EA6 A;  2BT6 A;  3IT4 B;  1ZPS A;  4IKG A;  4TQ1 A;  1N5W A;  3GS2 A;  3AB5 A;  2ACZ B;  2N9K A;  1PUT A;  3H8H A;  2WXO A;  2BS3 B;  2H89 B;  3J9C A;  1BXT A;  5HI1 A;  5EE1 A;  4OZB A;  1C4C A;  2X38 A;  3R2I A;  1TS2 A;  1YQ3 B;  4HKZ E;  3T3O A;  1GB1 A;  4JE3 B;  3RPF C;  3TSS A;  1SJE D;  4XWT A;  5MPO A;  4L23 A;  4JWS C;  4P6V F;  1PYW D;  1GB4 A;  4REZ A;  1OQR A;  4MM3 B;  1STE A;  1YNT E;  2WXP A;  3O13 A;  4ZRP A;  4RFB A;  2SEB D;  3DWM A;  1IGD A;  2N7J A;  2BB5 A;  1SB3 C;  5HG2 A;  1A70 A;  1ZOY B;  1L0Y B;  4TSS A;  4ZRQ A;  2QEJ C;  3U7Z A;  2V3N A;  4CQN A;  2VZK B;  1D5M C;  4C7Y A;  3NVV A;  2R61 A;  1AW7 A;  1J7C A;  4US8 A;  3AE2 B;  4HEA 1;  4YT0 B;  3FIL B;  1L5P A;  2RMM A;  2MJD A;  2WXJ A;  3AE6 B;  4YWG G;  2QIE B;  1ACC A;  1FXI A;  3V3X A;  1WXQ A;  5AUI A;  1DOI A;  1PGA A;  2JX5 A;  3LYY A;  4YXD B;  1VZ7 A;  1JCK B;  1FNU A;  1K51 A;  2YEP F;  3PZ8 A;  3W9C B;  3TEW A;  1CZP A;  3ZJV A;  3T3N A;  2ICI A;  4WIP A;  1QOA A;  4RGT A;  2VZK D;  1ESF A;  1KLG D;  3KWV A;  1I4G A;  3BZD B;  2V0G A;  2EKI A;  3GB1 A;  3BVZ A;  1OQQ A;  4A8X C;  3TEZ A;  2QIL A;  2QMT A;  2HTM E;  2DBY A;  2D5G A;  2WXH A;  1SJH D;  1V97 A;  3GP7 A;  2JU6 X;  3Q8B A;  2WXG A;  3DWG C;  1SE4 A;  1I4H A;  4A9A A;  1YMH E;  1UNS A;  1RYJ A;  3ABV B;  1JAL A;  1RM6 C;  1E10 A;  2ZW0 A;  1IGC A;  2OHF A;  1TJE A;  2QSD A;  3PZ7 A;  2KMM A;  3W5U B;  5JXV A;  5BYQ A;  1YN4 A;  1IUE A;  3URY A;  3RFZ B;  1QF6 A;  2INN E;  3P1M A;  1FNV A;  2LEK A;  3U4E G;  1SEB D;  3OWE B;  1ZE3 D;  2KDM A;  1VZ8 A;  1FEH A;  2GB1 A;  5BMH A;  3IAM 1;  1E7P B;  4USA A;  1EU4 A;  2ZW1 A;  1C4P A;  2WXN A;  3MP9 A;  3NVY A;  1MPE A;  3AE9 B;  4HRO A;  4KKI A;  4AS1 A;  5BYS A;  5E6J A;  3R2T A;  4WWM A;  3CIR B;  2L32 A;  4ARC A;  1BML C;  1XLP A;  1VZ6 A;  4ZHP A;  1FO4 A;  1KLU D;  3C8Y A;  2Y5P A;  1QIL A;  3ETR A;  3VQI A;  1XCT L;  1C76 A;  2SAK A;  2WXR A;  3LXF A;  2IGG A;  1I4P A;  3FC4 A;  2ONQ A;  2PVG C;  1BUI C;  4IOI E;  4RGN A;  4GDK B;  4WAF A;  2BS2 B;  1DGJ A;  1XF5 L;  1ZXH A;  2DYO A;  3SFE B;  1KTK A;  4ITK A;  1PFD A;  1JQ4 A;  4J3O D;  5EE3 A;  5HFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...