1DOYA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN [2FE-2S]
molecule tags Electron transport
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doyA00
1QF6A 1DOXA 1OFFA 4YSZB 2MJDA 3NRZA 3HVZA 2BS2B 3AEAB 3AM9A 1N63A 2WU5B 2WU2B 3B2GA 5G5GA 5C2TB 3RPFC 1A70A 3HRDD 2LEKA 1FFUA 1OQRA 1FM0D 2JQRB 2DBYA 1CZPA 2K9XA 3ETRA 1AWDA 1NYQA 4C7YA 1WGKA 2BT6A 1L6VA 1NVID 1J7BA 2Q5WD 3P1MA 3FC4A 2N0SB 3NVYA 3P63A 1L0VB 4YTMB 3LXFA 5AUIA 3SFEB 3CIRB 3AEBB 5EE0A 1JRPA 4ZHOA 4YXDB 3AE1B 1J7CA 4IDIA 1QLBB 1YJIA 3VR8B 2CJOA 3DWGC 3WCQA 1JQ4A 1NEKB 1KFYB 1PDXA 2CJNA 2PVOD 3VR9B 1AYFA 1XLQA 2DWQA 2K5PA 1FXAA 1J7AA 1XO3A 1FFVA 1KRHA 1N60A 1NYRA 1TKEA 2MJEA 3AN1A 1E9MA 3AECB 5EE1A 3W5VB 1ZP0B 2WDRB 2WP9B 4N58A 1QOFA 2L83A 2KAJA 2AX5A 5EE3A 5G5HA 3P4QB 1QT9A 1R7SA 5H92C 3AEDB 3AE9B 1SIJA 2CU3A 2PKOA 2BS4B 1RM6C 1QOBA 2MJ3A 1WRIA 4P6VF 1L5PA 2MH7A 3BIID 3AEGB 3EUB2 3SFDB 4C80A 1TYGB 3AE2B 2WDVB 1RFKA 2WS3B 2W54A 5MPOA 3NVWA 5GXGB 2KMMA 2PIAA 3B2FA 1JROA 3NS1A 1QOGA 4YT0B 3VRAB 1FXIA 1E6EB 1WWTA 2QJLA 2Y5CA 4JWUC 4N59A 3AE4B 3B9JA 1N5WA 4YSXB 1E0ZA 2G1EA 4FXCA 3P4RB 1ROEA 1XLNA 2E3TA 1N5XA 4A9AA 3AH7A 1QOAA 2OHFA 1FRRA 3AB5A 3AV8A 1FMAD 3HUIA 2L52A 4YSYB 1DOYA 1N61A 2ACZB 2WQYB 3W5UB 1EWYC 2M56B 2WLBA 4HROA 1TJEA 2BS3B 4US8A 3FAHA 1F0ZA 1FRDA 4WQMA 4USAA 3W9CB 5EE9A 4HRSA 3LB8C 3ZYYX 1NENB 1YQ3B 2H88B 2FBWB 2PVGC 2W3SA 3AE8B 2WDQB 5C3JB 1WYGA 1FIQA 1KF6B 1XLPA 1FO4A 1CJEA 1JALA 1UWMA 2JX5A 3NVVA 1RWSA 2EKIA 4ITKA 1PFDA 1DOIA 1VLBA 1SF0A 1OQQA 2W3RA 4LTUA 3AE7B 1JW9D 2QIEB 4US9A 3L4PA 2M19A 1IUEA 1RYJA 2K22A 3KWLA 1GPXA 4KX6B 1WXQA 1JWBD 2H89B 1V8CA 1XLOA 1GAQB 1ZXIA 3VRBB 4JWSC 4WWMA 1I7HA 1ZOYB 3AEEB 3P4PB 4N6EB 1E10A 3ABVB 1VJKA 5H8YE 2HTME 3CWIA 1L6UA 1V97A 1TKYA 1YQ4B 3NVZA 3AMZA 1TKGA 1E7PB 2B76B 3AE6B 4JX1C 2W55A 1YJJA 1ZUD2 1PUTA 1VDVA 4YTPB 3PO0A 1T3QA 3AE5B 1B9RA 1JWAD 3P4SB 5AUKA 3AEFB 4YTNB 1N62A 4C7ZA 1DGJA 4ZHPA 1NI3A 3SR6A 3AE3B 3DWMA 4ZOHC 1SB3C
chains in the Genus database with same CATH superfamily
4N9F4 4B6WA 1OFFA 1ZDXA 3NRZA 2BWFA 2V3NA 3Q2AC 1N63A 2L0FA 3SDLC 3VH4B 2I1JA 2XK5A 4G3XB 2N7DA 4PS7A 2K39A 2DBYA 2MP2A 2W9NA 2D10A 2OJRA 1T0SC 1STEA 4DDGD 3SFEB 3CIRB 2WDTB 3T3OA 1UBQA 4HJKA 4RM8A 4HCNB 1YN3A 3GZNI 2QDFA 3UGBB 4N58A 1I4HA 1C1YB 2JZPA 2G45B 4I6PA 1QOBA 4FULA 2CHXA 3D32A 4EFOA 1MHXA 3AEGB 3UF8A 2WDVB 1L7YA 1FNWA 5LXHA 2DZIA 3ZTCA 1Y8RC 3Q6BA 1RRBA 3RFZB 1FMAD 2BW2A 4FJZA 2D3BA 2YLMA 5CHWA 1UGJA 3LB8C 1FNVA 2IO1B 5E6JA 4HEA1 2W3SA 3RUIB 2NBVB 3ZXRA 3TJPA 3W1SC 1WYGA 1C79A 1JALA 1D5MC 1D3ZA 4OVZA 5IKCM 2ZW0A 1VD2A 3NHEB 4KX6B 3O65B 1TIFA 1MG4A 2DAFA 3E9SA 3RNGC 1OEYJ 5CTRC 4D2KA 4C7ZA 3QAQA 3HVDA 4F8CB 3ONSA 1WJ6A 4WWOA 4TMAB 4QAYA 3ECIA 1DOXA 1Q10A 2WXFA 1DYQA 3B2GA 1X1MA 2WXGA 4HDOA 1WMHA 3RYTA 1I4RA 2K8BA 3ZLZA 1FPYA 3LXFA 2RD0A 1KLVA 4EZJA 2M1MA 1I4QA 2J53A 2AL3A 1JCKB 2GB1A 1PDXA 3MHSD 1T5XD 2K6QA 3I9V1 4LNIA 4HPPA 2BYEA 4KVGB 1KH0A 2TSSA 4AQ7A 1SEBD 2J7QB 4P1CC 1WRIA 1F52A 4OVVA 2Y3AA 4FBJB 3DVNV 1R4MB 3FILA 2KMMA 2OEDA 3QIJA 4XDCA 4KIKA 1XQQA 4WAFA 5KHOA 2Y5CA 1KLUD 3R8BA 4ANWA 1E0ZA 5DCNA 1PGAA 3WALA 2L52A 3MHZA 2ACZB 2NTTA 2N9XA 4UDUC 1F0ZA 4USAA 1QZEA 1NENB 4W9GA 1D5ZC 3PS6A 4WURA 4GSWA 3V60A 2DX5B 3VFKA 2IYDB 4AP4C 3T9LA 1CJEA 3TEYA 2WXLA 1BMLC 2BYVE 1YN5A 2N9PC 2EMTA 4OHJA 1L4ZB 2DHZA 2XK5B 2QIEB 1JWUD 3KLSX 2M19A 3J9CA 2L00B 1SJHD 3CSFA 2FUHB 1FNUA 3ABVB 5LLIA 1S3SG 2HJ1A 2PE6B 5J17A 3ZW3A 1T3QA 1K51A 1WZ3A 2CKHB 1WGGA 4JPSA 5FR6A 1PYWD 4IKGA 1SSNA 5DPTA 4ANUA 1WM3A 2ZW1A 3BVZA 2NBUA 3MC9A 3AEAB 5IAAC 1FM0D 1TS3A 2WXIA 3NVYA 2N0SB 4YTMB 5HKHA 2M4NA 2G9HD 4YXDB 2CR5A 3UIPB 4WWPA 2L7RA 5D7GA 3ZUNA 4ZRIA 2QMTA 1MFWA 4FHKA 3T8MA 2NPTA 4KSKC 3BIID 1GB1A 3AE2B 4JQWC 3U4EG 3B2FA 3IFWB 4GDKA 4GGQA 4X57B 1E6EB 1WWTA 3M62B 3Q3MC 1VRAB 2MBQA 4A9AA 1PGXA 1FRRA 3H7PA 2V4LA 2DZMA 3QK0A 2K0PA 3BZDB 2IZVB 1Z5SB 1WJUA 2BS3B 4MEMA 4NAMA 4PYUA 4MSQB 1C3TA 2KN4A 3ZVVA 1OEYA 3NZSA 4ITKA 4DXGA 4LTUA 2Z8LA 2LVQA 3EC8A 3L4PA 4E74A 4TV3A 2K22A 1JWMD 5CX3A 1I4PA 3ZTDA 5HI1A 3R66C 1Q0WB 4YTPB 2MBHA 1ACCA 1IYFA 3FKYA 1ET9A 3DWMA 4NJ7A 1SB3C 1YD8U 3DBHB 4YSZB 3N30A 3ZRFA 3CMMB 1WE6A 3QARA 2GI9A 5C2TB 3RPFC 4RFBA 2LMCA 4DK5A 1AWDA 1NYQA 4AUQC 4HLEA 1E8XA 5BYRA 1L0VB 2L8JA 3X0WA 1EF5A 3TL5A 1T6BX 4W9DA 3AU4A 2PVOD 1AYFA 4M00A 1NYRA 1UELA 3NOBA 1MJDA 1QOFA 2C9WB 4ZYNA 1JRUA 4J6IA 3C19A 2V4IB 1JMLA 4ARCA 2KJHB 2KD0A 4P6VF 3WIMA 1L5PA 2LZ6A 3HM3A 4L23A 3PREA 4MJSB 2ZZPB 4CHKA 2MSED 3AE4B 2A4ZA 1C4CA 3EFUA 1VCBA 4YSYB 1DOYA 4IM0A 4MGZE 4AS1A 1WJ4A 1YNTE 3DQVA 4TQ1A 5C3JB 4KGRA 3ML8A 1ISNA 2CU1A 1L4DB 2HD5B 2MBOA 4WJQA 4ASWC 3B08A 2D07B 3M95A 4EEWA 2KTRA 5JZEB 4CYEA 2VZKB 2KX3A 2LRWA 2AWTA 3DPDA 2VH2A 1E10A 4LNNA 3SU8X 1VDVA 3AE5B 4A3PA 1JWAD 1UUPA 3TIXA 2WXJA 2AQ2B 2LWPA 2LXAA 1NI3A 5C1ZA 3AE3B 1P7EA 2KFKB 4BFRA 2WU5B 2VH1A 4W9KA 3A4SC 2LHDA 1YX5B 2K9XA 1UZXB 3EHVA 4II3B 3MC0B 4Q2JA 3U7DA 4ZYSA 3I3TB 5JXVA 1KFYB 1C78A 1FXAA 1J7AA 4A3OA 3L08A 3WAOA 4HKQA 3UQBA 4ZRKA 4HPMB 3S2AA 3TEWA 2LJIA 2BPSA 1WJNA 2KLCA 2JZZA 4BKTA 1WXSA 1LXDA 3P2BA 5BMIA 1CQVA 2DENB 4N59A 4HCPB 4F7ZA 4FXCA 2KC1A 2JRIB 4J3OD 3M63B 1XLNA 1N5XA 2ASQA 3A1QB 1TS4A 2KDMA 1WRDB 4IUMB 2Z0EB 5I4DA 1WR1A 3RNBC 2WLBA 4JIOU 1F2RC 3RNCC 3W9CB 4XYCA 3UIOB 5FKAC 4BOZB 1YQ3B 2H88B 2PVGC 2INNE 2K6DB 3ZXVA 1QQRA 3GB1A 1GOZA 2LD9A 1WXMA 4K3BA 1RAXA 1YIWA 3NZ3A 3ZGZA 1NBFC 1T0QC 2W3RA 3KW5B 3SHQA 3AE7B 3SD5A 4AWJA 3DVNU 1V8CA 1GAQB 2INPE 1HXYD 2G4DB 1ZOYB 3A9JB 3EA6A 4P16A 4MGIE 4NQKE 3RMKC 4OW0A 5TR5A 4JX1C 3B0AA 1IP9A 1F1HA 2N4FA 2Y5PA 1UF0A 1BUIC 4WAAA 3N1XC 4BBNC 2PW9A 1TBEA 3K9PB 1XXGA 1WY8A 4II2B 3KVFB 4KIKB 3AM9A 2XBBC 2L05A 2DLBA 2BT6A 1J7BA 3P42A 3IXSA 1JRPA 4DWFA 2KYWA 2QEJC 1E7UA 1JQ4A 2LHEA 2INCC 3VR9B 3NVWA 1KRHA 2IPKD 4PK1A 2WP9B 3EECA 2BWES 2FCNA 3P4QB 4JGHB 3Q3NC 4LNFA 3RNEC 1WR6E 3Q8CA 4NAWA 5DPWA 2KDBA 4FLHA 4KDIC 3DHHC 2KLGA 5D94A 2KKCA 2RSUA 2O2VB 2IBIB 3B9JA 3RT3B 1QKZA 1M94A 4FA6A 2V0GA 1SIFA 4HROA 3Q3FA 4W9LA 2INDC 2ZVNA 1SE3A 2O6VD 3TEXA 4XE0A 2HTHA 3BK1A 1SXTA 2JUOA 2JX5A 2Z0DB 3ZQ4A 3PLUA 4MM3B 2LASA 2ZNVB 3OAWA 3CF6E 2JSVX 3DHGC 1E8YA 4I6NB 1P1AA 2H89B 1TZOA 1I42A 2KMCA 2V9HA 1V97A 3H6NA 3NVZA 1TKGA 1K8RB 1M4VA 2WXRA 3ALBA 3PO0A 2LGSA 3NZUA 2JXTA 2JZ3B 2KFJA 3U30A 2PMVA 1E8ZA 1JWSD 2SEBD 2WXMA 4W9EA 3HRDD 5LNK1 1WGYA 2AL6A 1TS2A 3BINA 3VTVA 1NVID 4KV2A 5EE0A 4S0RA 4ZHOA 5TSSA 3TBLD 5IP4D 2CJOA 3VUXA 3ENEA 1E90A 1XO3A 4IWPA 2I38A 5D3IB 3PT2B 1ZP0B 3TMPB 3N3KB 2KAJA 1SE4A 3BVGA 2UU7A 5J2RA 1C4AA 3R2IA 1H4RA 3BYYB 2MJ3A 1NDDA 3DVGX 2OOBB 2RDBC 1Y56A 3ZNGC 1PQSA 2KC2A 3PRPB 2W54A 4B0MA 4M8NA 4RH6A 2KMAA 2IGHA 4KKJA 2C5LC 4MGKE 4B95A 3QX1A 1IBXB 1C76A 2Z59B 2WXKA 2K3UA 1TJEA 4TUUA 1I4XA 1EM7A 3IBEA 5L83A 1LGRA 5JHAA 3HK0A 3PVLA 1TZ1A 1C9FA 4HWIB 4OZCA 1WZ0A 2MX2A 2HDEA 3MC8A 1IUEA 1SE2A 1WXQA 1R4NI 3VXWA 3ZJTA 3UINB 4MH8A 2N9LA 2C7NB 3CWIA 2MLBA 3BK2A 1E7PB 4MACA 3R7QA 3T3NA 3U8ZA 2W82A 4AJYB 3KYDD 1GNUA 3EGRA 1AARA 4DQOC 4TKNA 4XWTA 4XWWA 2L1AA 1HTQA 2JY6A 3DBRB 1V1OA 2LGDA 2WXQA 2EELA 2KT7A 4ICVA 2GBJA 2NMQA 3OWEB 3VHTC 3RD2A 4G11A 2FIFA 1P9DU 2KFKA 5IOIA 1C77A 3QC8B 4G50A 3X23A 1WE7A 1F2RI 2MCNB 1ZDVA 4YWGG 1KJTA 4IG7B 3V05A 3AEDB 3RI7C 2E6XA 1SIJA 5GMVA 4W9HA 3N9YC 1WXVA 3PTFC 3ZDMC 2FE8A 1LFDA 4MM3A 4C80A 1RFKA 2FCQA 2C7HA 5GXGB 3KQ4A 2OJWA 4NJCA 1H8CA 1MHHE 4LJPB 4JLCA 2QJLA 2BKFA 3N20C 2O6VA 1N5WA 2JT4B 3SEBA 5DPSA 3IT4B 5D3DA 2PPHA 4RF0A 2FCMA 3HM6X 3WAPA 2KANA 2I1KA 2WDQB 2ZPYA 2JXXA 1KF6B 1XLPA 1GC6A 3RN9C 2LI5A 3A1QA 1E7VA 2KK8A 2UYZB 1WGRA 2KNBA 1Q5WB 3RZWC 4LNKA 1JWBD 3JW0X 2QC8A 4MGYE 4E71A 2KOXA 3URYA 5BYQA 1R4NB 1B9RA 2WGSA 1A5RA 5AUKA 2KQ7A 4RMAA 2FIDA 2HJ8A 4ZHPA 1P7FA 1V49A 5L95C 3MP9A 1HE8A 1YX6B 2PE9A 3BWUD 4IW0A 3QA8A 3HHMA 4REZA 1ENFA 3AXCA 1I4GA 2JQRB 4O1NA 2WX1A 1D4BA 2J42A 3U2SC 3NUHB 3UI3A 3AE1B 1IBXA 2ZEQA 2LGXA 1ZKHA 2JU6X 4XGAB 1V1PA 4HKZE 3DDCB 2A5UA 5EE1A 3W5VB 2WDRB 1AN8A 3TEZA 2FAZA 5EE3A 4GDLA 3L13A 4IOIE 5H92C 3HIZA 1WMHB 3WANA 3U7ZA 4KKIA 2IGGA 3VAWA 1SJED 1ESFA 4R3DA 2ICIA 2LVPA 2CHWA 2M17A 2RR9A 1EWCA 1PGBA 4ICUA 3A33B 4KGTA 4WJOA 3R7RA 3VRAB 2L32A 4YSXB 2DZKA 3RULA 2KN5A 2KDFB 4RGOS 2C7MB 2DAJA 3QWZB 1SE9A 4HPLB 1TTNA 5D6JB 1FO4A 4IC7B 2WNMA 1QILA 5FR3A 2V1YA 4DXAB 1CMXB 3GZNB 4A90A 5HHDG 2MBBB 4GDKB 1OQYA 3JSVB 4WJPA 1K52A 2HTME 2KO3A 2KTRB 2IO3B 1ZGUB 1KOTA 3Q8AA 2W55A 3JVZX 2I2YA 4LDTB 4LLGM 2YVCA 3V6EB 2QHOA 3BVMA 3MJ5A 3ZNID 4XX5A 1WI0A 3U52E 3GS2A 2MJDA 2PLPA 3IAM1 1TS5A 2REXA 3P63A 3FC4A 2RDHA 2C60A 2KACA 4KGSA 1F77A 4IDIA 1WYWB 4NNJB 1EUVB 3LJ3A 3GE8C 5G2NA 4L1BA 2L83A 3GP7A 2LGYA 1HA5A 3OG5A 4A20A 2GBRA 1GUAB 3QQ8B 2M0XA 3OLMD 2MH7A 4IM2A 2BKRB 1BT0A 3VQIA 1P98A 4M0WA 4WH4A 3NS1A 4CQNA 5E6NA 4LCDE 4DHJD 2XNAC 3AH7A 4IWOA 3AV8A 3NG0A 3HUIA 3VUYA 4MSMB 2WYQA 4S17A 2D2QA 4FJYA 3DCGA 3ZYYX 2R2QA 2LFIA 2QSDA 1T0RC 3PGEA 4K81A 2PEAA 2ZVOA 2GOWA 5AZGA 2N9EB 5CHFA 4US9A 1I35A 1IGCA 3MFGA 3BY4B 4W9JA 5C23A 4JWSC 3ZKJC 2GBKA 4N6EB 5H8YE 3DBLI 4RGTA 2G3QB 3Q3OC 4CO7A 1WF9A 2AEHA 2ZCBA 3ZIMA 3H9DA 2D11A 3LYYA 2KTFA 3VH3B 1UGMA 4ZOHC 3DBRI 2BGFA 1XF5L 1F9JA 1HTOA 4RCOA 3IVFA 1YQBA 1WIAA 4BKSA 4FN2A 1YJ1A 1N6ZA 1WGKA 3PRMB 3PZ7A 4URKA 1EO6A 1WX9A 1BXTA 2N1VA 3DVGY 3K9OB 3V61A 4NQLB 2WHIA 2IY0B 3L17A 4ZRQA 1RFAA 2KQ4X 4OVUA 3DWGC 1HZ6A 3APCA 3PLVA 1IPGA 2KZRA 2NBWB 4K7WA 1ZE3D 2NCNA 1GG3A 3A9KA 2GMIC 4XZ4A 4HXDA 3ZDTA 2KXJA 4RGNA 1P0RA 1JROA 2WX0A 1QOGA 4YT0B 3N32A 5CHVC 2JYTA 2G1EA 1V5OA 3P4RB 2N7JA 3R3MA 4IWQA 1QOAA 4P1BC 1IGDA 3IAS1 3IT6B 3VVWB 2ZNVC 4KDLB 1K50A 1FCLA 2KX0A 3AI5A 4KZCA 4C4VB 5HFYA 4AOFA 2J0JA 1RWSA 2JRHA 2K8CA 1V86A 2VRRB 4IM3A 3VTUA 4BBNF 4ANVA 3KWLA 2WWZA 4ZRPA 1XLOA 1ZXIA 4BVUC 3AEEB 4ACFA 3DBHI 4PS8A 1VJKA 3APDA 2LVOA 1L6UA 3AMZA 1GB4A 4TSSA 2X38A 1YJJA 1PUTA 1L2NA 3KUZA 5KHQA 4OZBA 4RF1A 1HQRD 4M01A 3ZJVA 4A55A 3ZRCA 4DDID 3Q14C 2BS2B 2KQSA 4I6LB 5BMGA 3A9KB 5BYSA 1WGHA 1A70A 2LEKA 4W9FA 2MRPA 1Z2MA 2GBNA 2NPTB 2K25A 4RGMA 4C7YA 1L6VA 1MG8A 4K1RB 1UNSA 3KWVA 4EOYA 3H1UA 4W9CA 3KUCB 3WCQA 3H7PB 2K5PA 1E8WA 4FHJA 1N60A 3AECB 2MP2B 4B0EA 2GRIA 2JVCA 2AX5A 4XC2A 3L0WB 2AYOB 1WGDA 4C4VA 2VZKD 3LDZE 2CU3A 3NJTA 3TUOA 2J0KA 3A4RA 2KJRA 3V3XA 2YEPF 3ZNHB 2MEKA 2E3TA 3I5JC 2KHWB 3PRZA 2LUEA 3M3JA 1N61A 3W5UB 2DYMA 3FAHA 1FRDA 2NTSA 2WXOA 4WQMA 2WXPA 3OJ4B 1UH6A 2FBWB 2M8SA 3NY5A 1TT5B 1YN4A 1B1ZA 3C8YA 4GB9A 2BB5A 4KSLC 4ARIA 1UBIA 4WJNA 4BKGA 4FJVB 4MT5A 1GPXA 3BYTB 1G6JA 2O2VA 2CHZA 4RNAA 3VRBB 4F1SA 1I7HA 1XEEA 2EMSA 3UQAA 2LUMA 4NY0A 4NPNA 1ZUD2 3ML9A 3VDZA 1V80A 1ZW7A 4EUTA 4GN1A 4BKSD 4K7SA 2FUG1 3N1YC 4GMVA 1L0XB 3V62A 2JYEA 5G5GA 5BMHA 2MWSB 3RNFC 1C4PA 1FFUA 2LRUA 3ETRA 2XN9C 2PTLA 3DBLB 3JYUA 2BVCA 1VZ8A 1FCCC 1K53A 2Q5WD 4PYZA 1J0GA 4PT5A 1YJIA 3APFA 4GU2A 1WXAA 3I57A 1TKEA 1V6EA 2QILA 3AN1A 3IHPC 2N1WA 1GJZA 5T8IA 3KYCD 5LXIB 4HDQA 3MJWA 3ZO5B 1WFYA 1TGZB 3JSVA 3SFDB 2N7EA 5BO4B 5MPOA 2WXNA 2Y5BB 2KDEB 3C0RB 3V6CB 1TY2A 2DYBA 2KWVB 2OHFA 2V3SA 4EKUA 2MA9B 2BF8B 3FILB 5EE9A 3IG3A 1EU4A 1FEHA 2MBEA 1L0YB 2BTEA 1FXTB 1YOVB 1PFDA 4BZAA 3PZDA 3VTWA 1XCTL 1JW9D 4A6QA 2KJ6A 2JPHA 2WXHA 1RYJA 3QCAA 3RNAC 1LM8B 1V2YA 2ON8A 3AULA 1WX8A 2L0TA 5J18A 1YQ4B 5IA7A 3AE6B 3TSSA 3L16A 2IJ0A 3P4SB 3AEFB 4FADA 1DGJA 3Q69A 4KZ0A 3DOWA 3Q8BA 2AQ3B 1V9JA 3QJZA 3PZ8A 4JL9A 3KH0A 1J19A 1KTKA 2JF5A 3O13A 4MELA 3Q8EA 1V5TA 1D6EC 2L3ZA 4MJSA 3P1MA 2LXCA 2BYFA 5D2MB 3AEBB 3W1SA 3E56A 1J7CA 1QLBB 2NS5A 4M8MA 2RPQA 2CJNA 4HJGE 2JWUA 2N9KA 2V3PA 1XLQA 3R2TA 1KM7A 2KVZA 1QT9A 2FNJB 2IO2B 3AE9B 2ZCCA 2PKOA 2HE7A 4LDTD 2IDYA 1GC7A 3EUB2 1EU3A 2PIAA 4XDDA 2NVUI 1P3QU 3PHXB 1FXIA 4C00A 1SGHA 1EF1A 2IGDA 4YL8A 2AQ1B 4E3CA 2O6VB 5E6PA 3A9JA 4BOSC 2M56B 3GOEA 3W2DA 5AZHA 3ZJUA 3WAMA 2MW5A 1NI2A 4WWNA 5HG2A 5JH5C 4GIVA 2EKIA 1VLBA 1SF0A 2PJHA 4H2AA 4M02A 2D3GA 4WWMA 3P4PB 4M0WB 1UD7A 1LQBA 1TKYA 4K3CA 4ZDVA 1WX7A 4EZKA 1N62A 3PHWB 3SR6A 1WSPA 1VZ7A 3VUWA 1OGWA 5E6OA 4LNOA 4NAWB 1OQRA 2IO0B 1CZPA 1CK1A 1U4AA 2KVRA 3TCAA 4HVBA 5G55A 2ZJDA 5DPRA 3VR8B 2BQQA 4LJOB 1NEKB 2EKEC 1WH3A 2RDGA 2MJEA 1SBBB 1E9MA 2R2OA 1UWXA 5G5HA 4B9KA 1R7SA 5AEKB 3H8HA 1RM6C 1J8CA 3RCZA 1T0YA 2JWZA 4C56C 4W9IA 1TYGB 4ANXA 2NR2A 2WS3B 1ZPSA 4MH0E 2GBMA 2RGFA 3PPAA 2G4SA 2SAKA 3AB5A 4BAXA 3N1ZC 1D5XC 1V1PB 3PSEB 1EWYC 1RLFA 4NJ6A 5EDSA 4GDLB 3AE8B 4EZLA 4ZRJA 5FK9C 1HZ5A 3W1YA 1FIQA 3H7SA 4NZLB 1UWMA 2IY1B 2ZPNA 4DBGA 1DOIA 2X8XX 3EFCA 1MI0A 1MVKA 1R4MI 1S1QB 3DHIC 2D3AA 2LGIA 2GLSA 2QCZA 1KLGD 3ZNZB 3B1LX 2LJ5A 1E5WA 1LO5D 4GOCA 4P7IA 3PV1A 1AW7A 3KUDB 2FCSA 2BBCA 4DHJB 2D3CA 1QF6A 4DXFA 3L54A 3HVZA 3AU5A 4DHZE 2R61A 2WU2B 4PS3A 2M0AA 4L2YA 4WQOB 1HEZE 4HK2A 1ZXHA 4G0NB 5IO9A 5AUIA 3QHTA 2D5GA 4GLSC 4AJWA 1OTRB 3NS8A 1Q1OA 3Q3JA 2YEPB 3Q8FA 2MQJA 2DWQA 4MDKE 2MHJA 1FFVA 3MTNB 1MPEA 2KDIA 4DHZB 5JHBA 2K1FA 3CSTA 1V81A 1XCQL 2BS4B 3L10B 2BYTA 2DYOA 2UWQA 2RPVA 2L76A 4OZAA 2DZJA 2KWUB 4GXBA 1ET6A 4JWUC 1VR9A 2XEWA 3WA0A 3GE3C 2BB6A 1ROEA 2CS4A 4LK0M 2J52A 2WQYB 1WM2A 4US8A 4HRSA 2B3AA 2J0MA 2RMMA 1FD6A 4A8XC 5IN7A 1YMHE 2J4XA 5AZFA 1VZ6A 3NVVA 4K7UA 2KWDA 2KWCA 4WIPA 1TY0A 1OQQA 4RM9A 2ONQA 3OJ3A 4EE2A 2DNFA 3DBSA 1XT9B 4JE3B 1XD3B 2B76B 4YTNB 3RZFA 4TQ0A 3I63C 2K8HA
chains in the Genus database with same CATH topology
1OFFA 1ZDXA 3BWUD 3NRZA 1L0XB 2V3NA 2JYEA 5G5GA 1N63A 2WU5B 4REZA 5BMHA 2LHDA 1C4PA 1ENFA 1FFUA 1I4GA 2JQRB 2DBYA 2K9XA 3ETRA 2XN9C 4O1NA 2PTLA 1VZ8A 1FCCC 1K53A 2Q5WD 1D4BA 2J42A 1STEA 3SFEB 3CIRB 3U2SC 3NUHB 3UI3A 3T3OA 3AE1B 3MC0B 4Q2JA 1IBXA 4ZYSA 4PT5A 1YJIA 2JU6X 5JXVA 1V1PA 1KFYB 1C78A 1YN3A 1FXAA 1J7AA 4HKZE 3I57A 1TKEA 2QILA 3AN1A 5EE1A 3W5VB 2WDRB 1AN8A 4N58A 5EE3A 3TEZA 4HKQA 4IOIE 1I4HA 2JZPA 5H92C 5T8IA 3U7ZA 4KKIA 1QOBA 2IGGA 3TEWA 1SJED 1ESFA 1MHXA 2LJIA 4R3DA 2ICIA 3AEGB 3SFDB 1EWCA 2WDVB 5MPOA 1PGBA 1FNWA 2WXNA 4KGTA 5BMIA 1CQVA 3VRAB 4N59A 2L32A 4YSXB 4FXCA 4J3OD 3RFZB 1XLNA 1N5XA 1TY2A 1TS4A 2KDMA 2OHFA 5I4DA 1FMAD 2BW2A 4RGOS 2WLBA 1F2RC 1UGJA 3FILB 5EE9A 3LB8C 3W9CB 5FKAC 1FNVA 1YQ3B 2H88B 4HEA1 1EU4A 2PVGC 2W3SA 2INNE 5E6JA 1FEHA 1QQRA 1WYGA 1FO4A 1C79A 1JALA 1D5MC 1GOZA 3GB1A 4OVZA 1L0YB 1QILA 2WNMA 2BTEA 5FR3A 1PFDA 3NZ3A 4A90A 5HHDG 3ZGZA 2W3RA 3AE7B 1XCTL 1JW9D 2ZW0A 4GDKB 4A6QA 2WXHA 1RYJA 4KX6B 1V8CA 1GAQB 1K52A 2INPE 2ON8A 1HXYD 1ZOYB 3EA6A 4P16A 2HTME 1YQ4B 4OW0A 3AE6B 3E9SA 4JX1C 3Q8AA 2W55A 2I2YA 4LLGM 4D2KA 3TSSA 2IJ0A 3P4SB 3BVMA 3MJ5A 3AEFB 2Y5PA 4C7ZA 3HVDA 1DGJA 1BUIC 3Q69A 3U52E 2PW9A 3Q8BA 3GS2A 4TMAB 2AQ3B 1DOXA 1XXGA 2MJDA 1Q10A 2PLPA 3PZ8A 2WXFA 1DYQA 3AM9A 3B2GA 1KTKA 2WXGA 3IAM1 3O13A 1TS5A 3Q8EA 2DLBA 1D6EC 1I4RA 2BT6A 1J7BA 3P63A 3P1MA 3FC4A 3LXFA 3P42A 2RDHA 2KACA 3IXSA 3AEBB 1JRPA 1I4QA 4KGSA 3W1SA 2QEJC 2J53A 1F77A 3E56A 1J7CA 4IDIA 1QLBB 1JCKB 2GB1A 1JQ4A 2LHEA 2CJNA 1PDXA 2JWUA 4HJGE 2N9KA 2V3PA 1XLQA 3NVWA 3VR9B 3R2TA 1KRHA 1T5XD 2IPKD 3I9V1 4L1BA 2WP9B 2L83A 3GP7A 1HA5A 3P4QB 1QT9A 1KH0A 2TSSA 3AE9B 2PKOA 4AQ7A 1SEBD 2IDYA 3Q8CA 1WRIA 2MH7A 3EUB2 2Y3AA 1EU3A 3FILA 2KMMA 2OEDA 2PIAA 4XDDA 3VQIA 4XDCA 4M0WA 4WH4A 3NS1A 4WAFA 1FXIA 2Y5CA 1KLUD 3R8BA 4CQNA 3B9JA 1E0ZA 2IGDA 2XNAC 1PGAA 2AQ1B 1QKZA 3AH7A 3AV8A 2V0GA 3HUIA 2L52A 3MHZA 2ACZB 2M56B 2NTTA 4HROA 4UDUC 3W2DA 1F0ZA 4USAA 1SE3A 3ZYYX 3ZJUA 1NENB 1D5ZC 2LFIA 2QSDA 4WURA 3TEXA 4XE0A 5HG2A 3BK1A 1CJEA 3TEYA 1SXTA 2WXLA 1BMLC 2JX5A 3ZQ4A 1YN5A 2EKIA 4MM3B 1VLBA 1SF0A 4OHJA 1L4ZB 4H2AA 2JSVX 2QIEB 1JWUD 4US9A 3KLSX 2M19A 1IGCA 3J9CA 3MFGA 1SJHD 2H89B 1TZOA 4JWSC 4WWMA 1FNUA 3P4PB 4N6EB 3ABVB 5H8YE 4RGTA 1V97A 1TKYA 3NVZA 1TKGA 1M4VA 2WXRA 3PO0A 1T3QA 1K51A 1N62A 2JXTA 3LYYA 4JPSA 3SR6A 1WSPA 1VZ7A 4ZOHC 1PYWD 4IKGA 1SSNA 2ZW1A 3BVZA 1XF5L 2PMVA 3AEAB 4RCOA 1JWSD 2SEBD 2WXMA 3HRDD 4NAWB 1OQRA 1FM0D 5LNK1 1TS3A 1CZPA 1CK1A 1TS2A 1WGKA 1NVID 2WXIA 3NVYA 2N0SB 3PZ7A 4YTMB 1BXTA 5EE0A 2G9HD 5TSSA 4ZHOA 4YXDB 4ZRQA 2KQ4X 3VR8B 2CJOA 3DWGC 1HZ6A 1NEKB 5D7GA 1XO3A 2RDGA 2I38A 5D3IB 2MJEA 1SBBB 1E9MA 1ZP0B 1ZE3D 2KAJA 1UWXA 2QMTA 1SE4A 3BVGA 5G5HA 1R7SA 1C4AA 3H8HA 1RM6C 3R2IA 3BYYB 2MJ3A 4C56C 3BIID 1Y56A 1GB1A 1TYGB 3AE2B 3U4EG 2WS3B 2W54A 1ZPSA 4B0MA 4RH6A 3B2FA 2IGHA 4RGNA 1JROA 4KKJA 1QOGA 4YT0B 1E6EB 1WWTA 2JYTA 2G1EA 1VRAB 3P4RB 4A9AA 2N7JA 1PGXA 1QOAA 2SAKA 1FRRA 1IGDA 1C76A 3AB5A 1IBXB 3IAS1 2K0PA 3IT6B 1D5XC 3BZDB 1V1PB 2WXKA 2K3UA 1EWYC 1K50A 1TJEA 2BS3B 4NAMA 1FCLA 1I4XA 1EM7A 4GDLB 3AE8B 5FK9C 1HZ5A 5HFYA 2KN4A 1FIQA 4NZLB 1UWMA 1C9FA 4OZCA 1RWSA 4ITKA 1DOIA 4DXGA 2HDEA 4LTUA 2Z8LA 1MI0A 3L4PA 1IUEA 2K22A 1SE2A 1MVKA 3KWLA 1WXQA 4ZRPA 2LGIA 1JWMD 1XLOA 1ZXIA 1I4PA 3AEEB 5HI1A 3ZJTA 1KLGD 1VJKA 2N9LA 4MH8A 3CWIA 1L6UA 3BK2A 3AMZA 1E7PB 4MACA 4TSSA 2X38A 1GB4A 1LO5D 1YJJA 3T3NA 1PUTA 2W82A 4YTPB 1AW7A 3EGRA 4OZBA 4RF1A 1ACCA 1HQRD 2BBCA 1ET9A 3ZJVA 3DWMA 1SB3C 4DQOC 1QF6A 4A55A 4DXFA 4YSZB 4XWTA 3HVZA 2BS2B 3AE3B 2L1AA 4XWWA 5BMGA 2R61A 2WU2B 5BYSA 5C2TB 2GI9A 3RPFC 1A70A 4RFBA 2LMCA 2M0AA 2LEKA 4L2YA 1V1OA 1HEZE 4RGMA 2WXQA 1ZXHA 1AWDA 1NYQA 4C7YA 1L6VA 2EELA 5BYRA 1L0VB 2NMQA 3OWEB 5AUIA 1UNSA 2D5GA 3KWVA 4GLSC 1T6BX 1C77A 2YEPB 3WCQA 3Q8FA 2PVOD 1AYFA 2DWQA 2K5PA 1FFVA 1N60A 1NYRA 1MPEA 3AECB 1F2RI 4B0EA 1ZDVA 2GRIA 1QOFA 4YWGG 2AX5A 3V05A 2VZKD 3AEDB 2E6XA 1SIJA 1JMLA 2CU3A 1XCQL 2BS4B 2V4IB 4ARCA 3TUOA 3N9YC 2BYTA 4P6VF 2DYOA 1L5PA 2FE8A 4C80A 4L23A 1RFKA 2RPVA 5GXGB 3KQ4A 4OZAA 4NJCA 1MHHE 3V3XA 1ET6A 2QJLA 2YEPF 4JWUC 1VR9A 3AE4B 1N5WA 2MEKA 2BB6A 1ROEA 2E3TA 3SEBA 1C4CA 3IT4B 5D3DA 4LK0M 4YSYB 2J52A 1DOYA 1N61A 2WQYB 3W5UB 2DYMA 4US8A 3FAHA 4RF0A 1FRDA 2NTSA 2WXOA 4WQMA 2WXPA 4HRSA 4AS1A 2FBWB 2RMMA 1FD6A 4A8XC 1YNTE 2WDQB 4TQ1A 5C3JB 4KGRA 1YMHE 1KF6B 1XLPA 1YN4A 2J4XA 1VZ6A 1B1ZA 1L4DB 3NVVA 3C8YA 2BB5A 2KWDA 4ARIA 4WIPA 1TY0A 1OQQA 2ONQA 4EE2A 4MT5A 2VZKB 1GPXA 3BYTB 1JWBD 3VRBB 4RNAA 1I7HA 1E10A 1XEEA 4JE3B 2B76B 2LUMA 3URYA 1ZUD2 1VDVA 5BYQA 3AE5B 1B9RA 1JWAD 1UUPA 5AUKA 2WXJA 4YTNB 4TQ0A 2AQ2B 4ZHPA 1P7FA 1NI3A 2FUG1 1P7EA 3MP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QF6 A;  1DOX A;  1OFF A;  4YSZ B;  2MJD A;  3NRZ A;  3HVZ A;  2BS2 B;  3AEA B;  3AM9 A;  1N63 A;  2WU5 B;  2WU2 B;  3B2G A;  5G5G A;  5C2T B;  3RPF C;  1A70 A;  3HRD D;  2LEK A;  1FFU A;  1OQR A;  1FM0 D;  2JQR B;  2DBY A;  1CZP A;  2K9X A;  3ETR A;  1AWD A;  1NYQ A;  4C7Y A;  1WGK A;  2BT6 A;  1L6V A;  1NVI D;  1J7B A;  2Q5W D;  3P1M A;  3FC4 A;  2N0S B;  3NVY A;  3P63 A;  1L0V B;  4YTM B;  3LXF A;  5AUI A;  3SFE B;  3CIR B;  3AEB B;  5EE0 A;  1JRP A;  4ZHO A;  4YXD B;  3AE1 B;  1J7C A;  4IDI A;  1QLB B;  1YJI A;  3VR8 B;  2CJO A;  3DWG C;  3WCQ A;  1JQ4 A;  1NEK B;  1KFY B;  1PDX A;  2CJN A;  2PVO D;  3VR9 B;  1AYF A;  1XLQ A;  2DWQ A;  2K5P A;  1FXA A;  1J7A A;  1XO3 A;  1FFV A;  1KRH A;  1N60 A;  1NYR A;  1TKE A;  2MJE A;  3AN1 A;  1E9M A;  3AEC B;  5EE1 A;  3W5V B;  1ZP0 B;  2WDR B;  2WP9 B;  4N58 A;  1QOF A;  2L83 A;  2KAJ A;  2AX5 A;  5EE3 A;  5G5H A;  3P4Q B;  1QT9 A;  1R7S A;  5H92 C;  3AED B;  3AE9 B;  1SIJ A;  2CU3 A;  2PKO A;  2BS4 B;  1RM6 C;  1QOB A;  2MJ3 A;  1WRI A;  4P6V F;  1L5P A;  2MH7 A;  3BII D;  3AEG B;  3EUB 2;  3SFD B;  4C80 A;  1TYG B;  3AE2 B;  2WDV B;  1RFK A;  2WS3 B;  2W54 A;  5MPO A;  3NVW A;  5GXG B;  2KMM A;  2PIA A;  3B2F A;  1JRO A;  3NS1 A;  1QOG A;  4YT0 B;  3VRA B;  1FXI A;  1E6E B;  1WWT A;  2QJL A;  2Y5C A;  4JWU C;  4N59 A;  3AE4 B;  3B9J A;  1N5W A;  4YSX B;  1E0Z A;  2G1E A;  4FXC A;  3P4R B;  1ROE A;  1XLN A;  2E3T A;  1N5X A;  4A9A A;  3AH7 A;  1QOA A;  2OHF A;  1FRR A;  3AB5 A;  3AV8 A;  1FMA D;  3HUI A;  2L52 A;  4YSY B;  1DOY A;  1N61 A;  2ACZ B;  2WQY B;  3W5U B;  1EWY C;  2M56 B;  2WLB A;  4HRO A;  1TJE A;  2BS3 B;  4US8 A;  3FAH A;  1F0Z A;  1FRD A;  4WQM A;  4USA A;  3W9C B;  5EE9 A;  4HRS A;  3LB8 C;  3ZYY X;  1NEN B;  1YQ3 B;  2H88 B;  2FBW B;  2PVG C;  2W3S A;  3AE8 B;  2WDQ B;  5C3J B;  1WYG A;  1FIQ A;  1KF6 B;  1XLP A;  1FO4 A;  1CJE A;  1JAL A;  1UWM A;  2JX5 A;  3NVV A;  1RWS A;  2EKI A;  4ITK A;  1PFD A;  1DOI A;  1VLB A;  1SF0 A;  1OQQ A;  2W3R A;  4LTU A;  3AE7 B;  1JW9 D;  2QIE B;  4US9 A;  3L4P A;  2M19 A;  1IUE A;  1RYJ A;  2K22 A;  3KWL A;  1GPX A;  4KX6 B;  1WXQ A;  1JWB D;  2H89 B;  1V8C A;  1XLO A;  1GAQ B;  1ZXI A;  3VRB B;  4JWS C;  4WWM A;  1I7H A;  1ZOY B;  3AEE B;  3P4P B;  4N6E B;  1E10 A;  3ABV B;  1VJK A;  5H8Y E;  2HTM E;  3CWI A;  1L6U A;  1V97 A;  1TKY A;  1YQ4 B;  3NVZ A;  3AMZ A;  1TKG A;  1E7P B;  2B76 B;  3AE6 B;  4JX1 C;  2W55 A;  1YJJ A;  1ZUD 2;  1PUT A;  1VDV A;  4YTP B;  3PO0 A;  1T3Q A;  3AE5 B;  1B9R A;  1JWA D;  3P4S B;  5AUK A;  3AEF B;  4YTN B;  1N62 A;  4C7Z A;  1DGJ A;  4ZHP A;  1NI3 A;  3SR6 A;  3AE3 B;  3DWM A;  4ZOH C;  1SB3 C; 
#chains in the Genus database with same CATH topology
 4N9F 4;  4B6W A;  1OFF A;  1ZDX A;  3NRZ A;  2BWF A;  2V3N A;  3Q2A C;  1N63 A;  2L0F A;  3SDL C;  3VH4 B;  2I1J A;  2XK5 A;  4G3X B;  2N7D A;  4PS7 A;  2K39 A;  2DBY A;  2MP2 A;  2W9N A;  2D10 A;  2OJR A;  1T0S C;  1STE A;  4DDG D;  3SFE B;  3CIR B;  2WDT B;  3T3O A;  1UBQ A;  4HJK A;  4RM8 A;  4HCN B;  1YN3 A;  3GZN I;  2QDF A;  3UGB B;  4N58 A;  1I4H A;  1C1Y B;  2JZP A;  2G45 B;  4I6P A;  1QOB A;  4FUL A;  2CHX A;  3D32 A;  4EFO A;  1MHX A;  3AEG B;  3UF8 A;  2WDV B;  1L7Y A;  1FNW A;  5LXH A;  2DZI A;  3ZTC A;  1Y8R C;  3Q6B A;  1RRB A;  3RFZ B;  1FMA D;  2BW2 A;  4FJZ A;  2D3B A;  2YLM A;  5CHW A;  1UGJ A;  3LB8 C;  1FNV A;  2IO1 B;  5E6J A;  4HEA 1;  2W3S A;  3RUI B;  2NBV B;  3ZXR A;  3TJP A;  3W1S C;  1WYG A;  1C79 A;  1JAL A;  1D5M C;  1D3Z A;  4OVZ A;  5IKC M;  2ZW0 A;  1VD2 A;  3NHE B;  4KX6 B;  3O65 B;  1TIF A;  1MG4 A;  2DAF A;  3E9S A;  3RNG C;  1OEY J;  5CTR C;  4D2K A;  4C7Z A;  3QAQ A;  3HVD A;  4F8C B;  3ONS A;  1WJ6 A;  4WWO A;  4TMA B;  4QAY A;  3ECI A;  1DOX A;  1Q10 A;  2WXF A;  1DYQ A;  3B2G A;  1X1M A;  2WXG A;  4HDO A;  1WMH A;  3RYT A;  1I4R A;  2K8B A;  3ZLZ A;  1FPY A;  3LXF A;  2RD0 A;  1KLV A;  4EZJ A;  2M1M A;  1I4Q A;  2J53 A;  2AL3 A;  1JCK B;  2GB1 A;  1PDX A;  3MHS D;  1T5X D;  2K6Q A;  3I9V 1;  4LNI A;  4HPP A;  2BYE A;  4KVG B;  1KH0 A;  2TSS A;  4AQ7 A;  1SEB D;  2J7Q B;  4P1C C;  1WRI A;  1F52 A;  4OVV A;  2Y3A A;  4FBJ B;  3DVN V;  1R4M B;  3FIL A;  2KMM A;  2OED A;  3QIJ A;  4XDC A;  4KIK A;  1XQQ A;  4WAF A;  5KHO A;  2Y5C A;  1KLU D;  3R8B A;  4ANW A;  1E0Z A;  5DCN A;  1PGA A;  3WAL A;  2L52 A;  3MHZ A;  2ACZ B;  2NTT A;  2N9X A;  4UDU C;  1F0Z A;  4USA A;  1QZE A;  1NEN B;  4W9G A;  1D5Z C;  3PS6 A;  4WUR A;  4GSW A;  3V60 A;  2DX5 B;  3VFK A;  2IYD B;  4AP4 C;  3T9L A;  1CJE A;  3TEY A;  2WXL A;  1BML C;  2BYV E;  1YN5 A;  2N9P C;  2EMT A;  4OHJ A;  1L4Z B;  2DHZ A;  2XK5 B;  2QIE B;  1JWU D;  3KLS X;  2M19 A;  3J9C A;  2L00 B;  1SJH D;  3CSF A;  2FUH B;  1FNU A;  3ABV B;  5LLI A;  1S3S G;  2HJ1 A;  2PE6 B;  5J17 A;  3ZW3 A;  1T3Q A;  1K51 A;  1WZ3 A;  2CKH B;  1WGG A;  4JPS A;  5FR6 A;  1PYW D;  4IKG A;  1SSN A;  5DPT A;  4ANU A;  1WM3 A;  2ZW1 A;  3BVZ A;  2NBU A;  3MC9 A;  3AEA B;  5IAA C;  1FM0 D;  1TS3 A;  2WXI A;  3NVY A;  2N0S B;  4YTM B;  5HKH A;  2M4N A;  2G9H D;  4YXD B;  2CR5 A;  3UIP B;  4WWP A;  2L7R A;  5D7G A;  3ZUN A;  4ZRI A;  2QMT A;  1MFW A;  4FHK A;  3T8M A;  2NPT A;  4KSK C;  3BII D;  1GB1 A;  3AE2 B;  4JQW C;  3U4E G;  3B2F A;  3IFW B;  4GDK A;  4GGQ A;  4X57 B;  1E6E B;  1WWT A;  3M62 B;  3Q3M C;  1VRA B;  2MBQ A;  4A9A A;  1PGX A;  1FRR A;  3H7P A;  2V4L A;  2DZM A;  3QK0 A;  2K0P A;  3BZD B;  2IZV B;  1Z5S B;  1WJU A;  2BS3 B;  4MEM A;  4NAM A;  4PYU A;  4MSQ B;  1C3T A;  2KN4 A;  3ZVV A;  1OEY A;  3NZS A;  4ITK A;  4DXG A;  4LTU A;  2Z8L A;  2LVQ A;  3EC8 A;  3L4P A;  4E74 A;  4TV3 A;  2K22 A;  1JWM D;  5CX3 A;  1I4P A;  3ZTD A;  5HI1 A;  3R66 C;  1Q0W B;  4YTP B;  2MBH A;  1ACC A;  1IYF A;  3FKY A;  1ET9 A;  3DWM A;  4NJ7 A;  1SB3 C;  1YD8 U;  3DBH B;  4YSZ B;  3N30 A;  3ZRF A;  3CMM B;  1WE6 A;  3QAR A;  2GI9 A;  5C2T B;  3RPF C;  4RFB A;  2LMC A;  4DK5 A;  1AWD A;  1NYQ A;  4AUQ C;  4HLE A;  1E8X A;  5BYR A;  1L0V B;  2L8J A;  3X0W A;  1EF5 A;  3TL5 A;  1T6B X;  4W9D A;  3AU4 A;  2PVO D;  1AYF A;  4M00 A;  1NYR A;  1UEL A;  3NOB A;  1MJD A;  1QOF A;  2C9W B;  4ZYN A;  1JRU A;  4J6I A;  3C19 A;  2V4I B;  1JML A;  4ARC A;  2KJH B;  2KD0 A;  4P6V F;  3WIM A;  1L5P A;  2LZ6 A;  3HM3 A;  4L23 A;  3PRE A;  4MJS B;  2ZZP B;  4CHK A;  2MSE D;  3AE4 B;  2A4Z A;  1C4C A;  3EFU A;  1VCB A;  4YSY B;  1DOY A;  4IM0 A;  4MGZ E;  4AS1 A;  1WJ4 A;  1YNT E;  3DQV A;  4TQ1 A;  5C3J B;  4KGR A;  3ML8 A;  1ISN A;  2CU1 A;  1L4D B;  2HD5 B;  2MBO A;  4WJQ A;  4ASW C;  3B08 A;  2D07 B;  3M95 A;  4EEW A;  2KTR A;  5JZE B;  4CYE A;  2VZK B;  2KX3 A;  2LRW A;  2AWT A;  3DPD A;  2VH2 A;  1E10 A;  4LNN A;  3SU8 X;  1VDV A;  3AE5 B;  4A3P A;  1JWA D;  1UUP A;  3TIX A;  2WXJ A;  2AQ2 B;  2LWP A;  2LXA A;  1NI3 A;  5C1Z A;  3AE3 B;  1P7E A;  2KFK B;  4BFR A;  2WU5 B;  2VH1 A;  4W9K A;  3A4S C;  2LHD A;  1YX5 B;  2K9X A;  1UZX B;  3EHV A;  4II3 B;  3MC0 B;  4Q2J A;  3U7D A;  4ZYS A;  3I3T B;  5JXV A;  1KFY B;  1C78 A;  1FXA A;  1J7A A;  4A3O A;  3L08 A;  3WAO A;  4HKQ A;  3UQB A;  4ZRK A;  4HPM B;  3S2A A;  3TEW A;  2LJI A;  2BPS A;  1WJN A;  2KLC A;  2JZZ A;  4BKT A;  1WXS A;  1LXD A;  3P2B A;  5BMI A;  1CQV A;  2DEN B;  4N59 A;  4HCP B;  4F7Z A;  4FXC A;  2KC1 A;  2JRI B;  4J3O D;  3M63 B;  1XLN A;  1N5X A;  2ASQ A;  3A1Q B;  1TS4 A;  2KDM A;  1WRD B;  4IUM B;  2Z0E B;  5I4D A;  1WR1 A;  3RNB C;  2WLB A;  4JIO U;  1F2R C;  3RNC C;  3W9C B;  4XYC A;  3UIO B;  5FKA C;  4BOZ B;  1YQ3 B;  2H88 B;  2PVG C;  2INN E;  2K6D B;  3ZXV A;  1QQR A;  3GB1 A;  1GOZ A;  2LD9 A;  1WXM A;  4K3B A;  1RAX A;  1YIW A;  3NZ3 A;  3ZGZ A;  1NBF C;  1T0Q C;  2W3R A;  3KW5 B;  3SHQ A;  3AE7 B;  3SD5 A;  4AWJ A;  3DVN U;  1V8C A;  1GAQ B;  2INP E;  1HXY D;  2G4D B;  1ZOY B;  3A9J B;  3EA6 A;  4P16 A;  4MGI E;  4NQK E;  3RMK C;  4OW0 A;  5TR5 A;  4JX1 C;  3B0A A;  1IP9 A;  1F1H A;  2N4F A;  2Y5P A;  1UF0 A;  1BUI C;  4WAA A;  3N1X C;  4BBN C;  2PW9 A;  1TBE A;  3K9P B;  1XXG A;  1WY8 A;  4II2 B;  3KVF B;  4KIK B;  3AM9 A;  2XBB C;  2L05 A;  2DLB A;  2BT6 A;  1J7B A;  3P42 A;  3IXS A;  1JRP A;  4DWF A;  2KYW A;  2QEJ C;  1E7U A;  1JQ4 A;  2LHE A;  2INC C;  3VR9 B;  3NVW A;  1KRH A;  2IPK D;  4PK1 A;  2WP9 B;  3EEC A;  2BWE S;  2FCN A;  3P4Q B;  4JGH B;  3Q3N C;  4LNF A;  3RNE C;  1WR6 E;  3Q8C A;  4NAW A;  5DPW A;  2KDB A;  4FLH A;  4KDI C;  3DHH C;  2KLG A;  5D94 A;  2KKC A;  2RSU A;  2O2V B;  2IBI B;  3B9J A;  3RT3 B;  1QKZ A;  1M94 A;  4FA6 A;  2V0G A;  1SIF A;  4HRO A;  3Q3F A;  4W9L A;  2IND C;  2ZVN A;  1SE3 A;  2O6V D;  3TEX A;  4XE0 A;  2HTH A;  3BK1 A;  1SXT A;  2JUO A;  2JX5 A;  2Z0D B;  3ZQ4 A;  3PLU A;  4MM3 B;  2LAS A;  2ZNV B;  3OAW A;  3CF6 E;  2JSV X;  3DHG C;  1E8Y A;  4I6N B;  1P1A A;  2H89 B;  1TZO A;  1I42 A;  2KMC A;  2V9H A;  1V97 A;  3H6N A;  3NVZ A;  1TKG A;  1K8R B;  1M4V A;  2WXR A;  3ALB A;  3PO0 A;  2LGS A;  3NZU A;  2JXT A;  2JZ3 B;  2KFJ A;  3U30 A;  2PMV A;  1E8Z A;  1JWS D;  2SEB D;  2WXM A;  4W9E A;  3HRD D;  5LNK 1;  1WGY A;  2AL6 A;  1TS2 A;  3BIN A;  3VTV A;  1NVI D;  4KV2 A;  5EE0 A;  4S0R A;  4ZHO A;  5TSS A;  3TBL D;  5IP4 D;  2CJO A;  3VUX A;  3ENE A;  1E90 A;  1XO3 A;  4IWP A;  2I38 A;  5D3I B;  3PT2 B;  1ZP0 B;  3TMP B;  3N3K B;  2KAJ A;  1SE4 A;  3BVG A;  2UU7 A;  5J2R A;  1C4A A;  3R2I A;  1H4R A;  3BYY B;  2MJ3 A;  1NDD A;  3DVG X;  2OOB B;  2RDB C;  1Y56 A;  3ZNG C;  1PQS A;  2KC2 A;  3PRP B;  2W54 A;  4B0M A;  4M8N A;  4RH6 A;  2KMA A;  2IGH A;  4KKJ A;  2C5L C;  4MGK E;  4B95 A;  3QX1 A;  1IBX B;  1C76 A;  2Z59 B;  2WXK A;  2K3U A;  1TJE A;  4TUU A;  1I4X A;  1EM7 A;  3IBE A;  5L83 A;  1LGR A;  5JHA A;  3HK0 A;  3PVL A;  1TZ1 A;  1C9F A;  4HWI B;  4OZC A;  1WZ0 A;  2MX2 A;  2HDE A;  3MC8 A;  1IUE A;  1SE2 A;  1WXQ A;  1R4N I;  3VXW A;  3ZJT A;  3UIN B;  4MH8 A;  2N9L A;  2C7N B;  3CWI A;  2MLB A;  3BK2 A;  1E7P B;  4MAC A;  3R7Q A;  3T3N A;  3U8Z A;  2W82 A;  4AJY B;  3KYD D;  1GNU A;  3EGR A;  1AAR A;  4DQO C;  4TKN A;  4XWT A;  4XWW A;  2L1A A;  1HTQ A;  2JY6 A;  3DBR B;  1V1O A;  2LGD A;  2WXQ A;  2EEL A;  2KT7 A;  4ICV A;  2GBJ A;  2NMQ A;  3OWE B;  3VHT C;  3RD2 A;  4G11 A;  2FIF A;  1P9D U;  2KFK A;  5IOI A;  1C77 A;  3QC8 B;  4G50 A;  3X23 A;  1WE7 A;  1F2R I;  2MCN B;  1ZDV A;  4YWG G;  1KJT A;  4IG7 B;  3V05 A;  3AED B;  3RI7 C;  2E6X A;  1SIJ A;  5GMV A;  4W9H A;  3N9Y C;  1WXV A;  3PTF C;  3ZDM C;  2FE8 A;  1LFD A;  4MM3 A;  4C80 A;  1RFK A;  2FCQ A;  2C7H A;  5GXG B;  3KQ4 A;  2OJW A;  4NJC A;  1H8C A;  1MHH E;  4LJP B;  4JLC A;  2QJL A;  2BKF A;  3N20 C;  2O6V A;  1N5W A;  2JT4 B;  3SEB A;  5DPS A;  3IT4 B;  5D3D A;  2PPH A;  4RF0 A;  2FCM A;  3HM6 X;  3WAP A;  2KAN A;  2I1K A;  2WDQ B;  2ZPY A;  2JXX A;  1KF6 B;  1XLP A;  1GC6 A;  3RN9 C;  2LI5 A;  3A1Q A;  1E7V A;  2KK8 A;  2UYZ B;  1WGR A;  2KNB A;  1Q5W B;  3RZW C;  4LNK A;  1JWB D;  3JW0 X;  2QC8 A;  4MGY E;  4E71 A;  2KOX A;  3URY A;  5BYQ A;  1R4N B;  1B9R A;  2WGS A;  1A5R A;  5AUK A;  2KQ7 A;  4RMA A;  2FID A;  2HJ8 A;  4ZHP A;  1P7F A;  1V49 A;  5L95 C;  3MP9 A;  1HE8 A;  1YX6 B;  2PE9 A;  3BWU D;  4IW0 A;  3QA8 A;  3HHM A;  4REZ A;  1ENF A;  3AXC A;  1I4G A;  2JQR B;  4O1N A;  2WX1 A;  1D4B A;  2J42 A;  3U2S C;  3NUH B;  3UI3 A;  3AE1 B;  1IBX A;  2ZEQ A;  2LGX A;  1ZKH A;  2JU6 X;  4XGA B;  1V1P A;  4HKZ E;  3DDC B;  2A5U A;  5EE1 A;  3W5V B;  2WDR B;  1AN8 A;  3TEZ A;  2FAZ A;  5EE3 A;  4GDL A;  3L13 A;  4IOI E;  5H92 C;  3HIZ A;  1WMH B;  3WAN A;  3U7Z A;  4KKI A;  2IGG A;  3VAW A;  1SJE D;  1ESF A;  4R3D A;  2ICI A;  2LVP A;  2CHW A;  2M17 A;  2RR9 A;  1EWC A;  1PGB A;  4ICU A;  3A33 B;  4KGT A;  4WJO A;  3R7R A;  3VRA B;  2L32 A;  4YSX B;  2DZK A;  3RUL A;  2KN5 A;  2KDF B;  4RGO S;  2C7M B;  2DAJ A;  3QWZ B;  1SE9 A;  4HPL B;  1TTN A;  5D6J B;  1FO4 A;  4IC7 B;  2WNM A;  1QIL A;  5FR3 A;  2V1Y A;  4DXA B;  1CMX B;  3GZN B;  4A90 A;  5HHD G;  2MBB B;  4GDK B;  1OQY A;  3JSV B;  4WJP A;  1K52 A;  2HTM E;  2KO3 A;  2KTR B;  2IO3 B;  1ZGU B;  1KOT A;  3Q8A A;  2W55 A;  3JVZ X;  2I2Y A;  4LDT B;  4LLG M;  2YVC A;  3V6E B;  2QHO A;  3BVM A;  3MJ5 A;  3ZNI D;  4XX5 A;  1WI0 A;  3U52 E;  3GS2 A;  2MJD A;  2PLP A;  3IAM 1;  1TS5 A;  2REX A;  3P63 A;  3FC4 A;  2RDH A;  2C60 A;  2KAC A;  4KGS A;  1F77 A;  4IDI A;  1WYW B;  4NNJ B;  1EUV B;  3LJ3 A;  3GE8 C;  5G2N A;  4L1B A;  2L83 A;  3GP7 A;  2LGY A;  1HA5 A;  3OG5 A;  4A20 A;  2GBR A;  1GUA B;  3QQ8 B;  2M0X A;  3OLM D;  2MH7 A;  4IM2 A;  2BKR B;  1BT0 A;  3VQI A;  1P98 A;  4M0W A;  4WH4 A;  3NS1 A;  4CQN A;  5E6N A;  4LCD E;  4DHJ D;  2XNA C;  3AH7 A;  4IWO A;  3AV8 A;  3NG0 A;  3HUI A;  3VUY A;  4MSM B;  2WYQ A;  4S17 A;  2D2Q A;  4FJY A;  3DCG A;  3ZYY X;  2R2Q A;  2LFI A;  2QSD A;  1T0R C;  3PGE A;  4K81 A;  2PEA A;  2ZVO A;  2GOW A;  5AZG A;  2N9E B;  5CHF A;  4US9 A;  1I35 A;  1IGC A;  3MFG A;  3BY4 B;  4W9J A;  5C23 A;  4JWS C;  3ZKJ C;  2GBK A;  4N6E B;  5H8Y E;  3DBL I;  4RGT A;  2G3Q B;  3Q3O C;  4CO7 A;  1WF9 A;  2AEH A;  2ZCB A;  3ZIM A;  3H9D A;  2D11 A;  3LYY A;  2KTF A;  3VH3 B;  1UGM A;  4ZOH C;  3DBR I;  2BGF A;  1XF5 L;  1F9J A;  1HTO A;  4RCO A;  3IVF A;  1YQB A;  1WIA A;  4BKS A;  4FN2 A;  1YJ1 A;  1N6Z A;  1WGK A;  3PRM B;  3PZ7 A;  4URK A;  1EO6 A;  1WX9 A;  1BXT A;  2N1V A;  3DVG Y;  3K9O B;  3V61 A;  4NQL B;  2WHI A;  2IY0 B;  3L17 A;  4ZRQ A;  1RFA A;  2KQ4 X;  4OVU A;  3DWG C;  1HZ6 A;  3APC A;  3PLV A;  1IPG A;  2KZR A;  2NBW B;  4K7W A;  1ZE3 D;  2NCN A;  1GG3 A;  3A9K A;  2GMI C;  4XZ4 A;  4HXD A;  3ZDT A;  2KXJ A;  4RGN A;  1P0R A;  1JRO A;  2WX0 A;  1QOG A;  4YT0 B;  3N32 A;  5CHV C;  2JYT A;  2G1E A;  1V5O A;  3P4R B;  2N7J A;  3R3M A;  4IWQ A;  1QOA A;  4P1B C;  1IGD A;  3IAS 1;  3IT6 B;  3VVW B;  2ZNV C;  4KDL B;  1K50 A;  1FCL A;  2KX0 A;  3AI5 A;  4KZC A;  4C4V B;  5HFY A;  4AOF A;  2J0J A;  1RWS A;  2JRH A;  2K8C A;  1V86 A;  2VRR B;  4IM3 A;  3VTU A;  4BBN F;  4ANV A;  3KWL A;  2WWZ A;  4ZRP A;  1XLO A;  1ZXI A;  4BVU C;  3AEE B;  4ACF A;  3DBH I;  4PS8 A;  1VJK A;  3APD A;  2LVO A;  1L6U A;  3AMZ A;  1GB4 A;  4TSS A;  2X38 A;  1YJJ A;  1PUT A;  1L2N A;  3KUZ A;  5KHQ A;  4OZB A;  4RF1 A;  1HQR D;  4M01 A;  3ZJV A;  4A55 A;  3ZRC A;  4DDI D;  3Q14 C;  2BS2 B;  2KQS A;  4I6L B;  5BMG A;  3A9K B;  5BYS A;  1WGH A;  1A70 A;  2LEK A;  4W9F A;  2MRP A;  1Z2M A;  2GBN A;  2NPT B;  2K25 A;  4RGM A;  4C7Y A;  1L6V A;  1MG8 A;  4K1R B;  1UNS A;  3KWV A;  4EOY A;  3H1U A;  4W9C A;  3KUC B;  3WCQ A;  3H7P B;  2K5P A;  1E8W A;  4FHJ A;  1N60 A;  3AEC B;  2MP2 B;  4B0E A;  2GRI A;  2JVC A;  2AX5 A;  4XC2 A;  3L0W B;  2AYO B;  1WGD A;  4C4V A;  2VZK D;  3LDZ E;  2CU3 A;  3NJT A;  3TUO A;  2J0K A;  3A4R A;  2KJR A;  3V3X A;  2YEP F;  3ZNH B;  2MEK A;  2E3T A;  3I5J C;  2KHW B;  3PRZ A;  2LUE A;  3M3J A;  1N61 A;  3W5U B;  2DYM A;  3FAH A;  1FRD A;  2NTS A;  2WXO A;  4WQM A;  2WXP A;  3OJ4 B;  1UH6 A;  2FBW B;  2M8S A;  3NY5 A;  1TT5 B;  1YN4 A;  1B1Z A;  3C8Y A;  4GB9 A;  2BB5 A;  4KSL C;  4ARI A;  1UBI A;  4WJN A;  4BKG A;  4FJV B;  4MT5 A;  1GPX A;  3BYT B;  1G6J A;  2O2V A;  2CHZ A;  4RNA A;  3VRB B;  4F1S A;  1I7H A;  1XEE A;  2EMS A;  3UQA A;  2LUM A;  4NY0 A;  4NPN A;  1ZUD 2;  3ML9 A;  3VDZ A;  1V80 A;  1ZW7 A;  4EUT A;  4GN1 A;  4BKS D;  4K7S A;  2FUG 1;  3N1Y C;  4GMV A;  1L0X B;  3V62 A;  2JYE A;  5G5G A;  5BMH A;  2MWS B;  3RNF C;  1C4P A;  1FFU A;  2LRU A;  3ETR A;  2XN9 C;  2PTL A;  3DBL B;  3JYU A;  2BVC A;  1VZ8 A;  1FCC C;  1K53 A;  2Q5W D;  4PYZ A;  1J0G A;  4PT5 A;  1YJI A;  3APF A;  4GU2 A;  1WXA A;  3I57 A;  1TKE A;  1V6E A;  2QIL A;  3AN1 A;  3IHP C;  2N1W A;  1GJZ A;  5T8I A;  3KYC D;  5LXI B;  4HDQ A;  3MJW A;  3ZO5 B;  1WFY A;  1TGZ B;  3JSV A;  3SFD B;  2N7E A;  5BO4 B;  5MPO A;  2WXN A;  2Y5B B;  2KDE B;  3C0R B;  3V6C B;  1TY2 A;  2DYB A;  2KWV B;  2OHF A;  2V3S A;  4EKU A;  2MA9 B;  2BF8 B;  3FIL B;  5EE9 A;  3IG3 A;  1EU4 A;  1FEH A;  2MBE A;  1L0Y B;  2BTE A;  1FXT B;  1YOV B;  1PFD A;  4BZA A;  3PZD A;  3VTW A;  1XCT L;  1JW9 D;  4A6Q A;  2KJ6 A;  2JPH A;  2WXH A;  1RYJ A;  3QCA A;  3RNA C;  1LM8 B;  1V2Y A;  2ON8 A;  3AUL A;  1WX8 A;  2L0T A;  5J18 A;  1YQ4 B;  5IA7 A;  3AE6 B;  3TSS A;  3L16 A;  2IJ0 A;  3P4S B;  3AEF B;  4FAD A;  1DGJ A;  3Q69 A;  4KZ0 A;  3DOW A;  3Q8B A;  2AQ3 B;  1V9J A;  3QJZ A;  3PZ8 A;  4JL9 A;  3KH0 A;  1J19 A;  1KTK A;  2JF5 A;  3O13 A;  4MEL A;  3Q8E A;  1V5T A;  1D6E C;  2L3Z A;  4MJS A;  3P1M A;  2LXC A;  2BYF A;  5D2M B;  3AEB B;  3W1S A;  3E56 A;  1J7C A;  1QLB B;  2NS5 A;  4M8M A;  2RPQ A;  2CJN A;  4HJG E;  2JWU A;  2N9K A;  2V3P A;  1XLQ A;  3R2T A;  1KM7 A;  2KVZ A;  1QT9 A;  2FNJ B;  2IO2 B;  3AE9 B;  2ZCC A;  2PKO A;  2HE7 A;  4LDT D;  2IDY A;  1GC7 A;  3EUB 2;  1EU3 A;  2PIA A;  4XDD A;  2NVU I;  1P3Q U;  3PHX B;  1FXI A;  4C00 A;  1SGH A;  1EF1 A;  2IGD A;  4YL8 A;  2AQ1 B;  4E3C A;  2O6V B;  5E6P A;  3A9J A;  4BOS C;  2M56 B;  3GOE A;  3W2D A;  5AZH A;  3ZJU A;  3WAM A;  2MW5 A;  1NI2 A;  4WWN A;  5HG2 A;  5JH5 C;  4GIV A;  2EKI A;  1VLB A;  1SF0 A;  2PJH A;  4H2A A;  4M02 A;  2D3G A;  4WWM A;  3P4P B;  4M0W B;  1UD7 A;  1LQB A;  1TKY A;  4K3C A;  4ZDV A;  1WX7 A;  4EZK A;  1N62 A;  3PHW B;  3SR6 A;  1WSP A;  1VZ7 A;  3VUW A;  1OGW A;  5E6O A;  4LNO A;  4NAW B;  1OQR A;  2IO0 B;  1CZP A;  1CK1 A;  1U4A A;  2KVR A;  3TCA A;  4HVB A;  5G55 A;  2ZJD A;  5DPR A;  3VR8 B;  2BQQ A;  4LJO B;  1NEK B;  2EKE C;  1WH3 A;  2RDG A;  2MJE A;  1SBB B;  1E9M A;  2R2O A;  1UWX A;  5G5H A;  4B9K A;  1R7S A;  5AEK B;  3H8H A;  1RM6 C;  1J8C A;  3RCZ A;  1T0Y A;  2JWZ A;  4C56 C;  4W9I A;  1TYG B;  4ANX A;  2NR2 A;  2WS3 B;  1ZPS A;  4MH0 E;  2GBM A;  2RGF A;  3PPA A;  2G4S A;  2SAK A;  3AB5 A;  4BAX A;  3N1Z C;  1D5X C;  1V1P B;  3PSE B;  1EWY C;  1RLF A;  4NJ6 A;  5EDS A;  4GDL B;  3AE8 B;  4EZL A;  4ZRJ A;  5FK9 C;  1HZ5 A;  3W1Y A;  1FIQ A;  3H7S A;  4NZL B;  1UWM A;  2IY1 B;  2ZPN A;  4DBG A;  1DOI A;  2X8X X;  3EFC A;  1MI0 A;  1MVK A;  1R4M I;  1S1Q B;  3DHI C;  2D3A A;  2LGI A;  2GLS A;  2QCZ A;  1KLG D;  3ZNZ B;  3B1L X;  2LJ5 A;  1E5W A;  1LO5 D;  4GOC A;  4P7I A;  3PV1 A;  1AW7 A;  3KUD B;  2FCS A;  2BBC A;  4DHJ B;  2D3C A;  1QF6 A;  4DXF A;  3L54 A;  3HVZ A;  3AU5 A;  4DHZ E;  2R61 A;  2WU2 B;  4PS3 A;  2M0A A;  4L2Y A;  4WQO B;  1HEZ E;  4HK2 A;  1ZXH A;  4G0N B;  5IO9 A;  5AUI A;  3QHT A;  2D5G A;  4GLS C;  4AJW A;  1OTR B;  3NS8 A;  1Q1O A;  3Q3J A;  2YEP B;  3Q8F A;  2MQJ A;  2DWQ A;  4MDK E;  2MHJ A;  1FFV A;  3MTN B;  1MPE A;  2KDI A;  4DHZ B;  5JHB A;  2K1F A;  3CST A;  1V81 A;  1XCQ L;  2BS4 B;  3L10 B;  2BYT A;  2DYO A;  2UWQ A;  2RPV A;  2L76 A;  4OZA A;  2DZJ A;  2KWU B;  4GXB A;  1ET6 A;  4JWU C;  1VR9 A;  2XEW A;  3WA0 A;  3GE3 C;  2BB6 A;  1ROE A;  2CS4 A;  4LK0 M;  2J52 A;  2WQY B;  1WM2 A;  4US8 A;  4HRS A;  2B3A A;  2J0M A;  2RMM A;  1FD6 A;  4A8X C;  5IN7 A;  1YMH E;  2J4X A;  5AZF A;  1VZ6 A;  3NVV A;  4K7U A;  2KWD A;  2KWC A;  4WIP A;  1TY0 A;  1OQQ A;  4RM9 A;  2ONQ A;  3OJ3 A;  4EE2 A;  2DNF A;  3DBS A;  1XT9 B;  4JE3 B;  1XD3 B;  2B76 B;  4YTN B;  3RZF A;  4TQ0 A;  3I63 C;  2K8H A; 
#chains in the Genus database with same CATH homology
 1OFF A;  1ZDX A;  3BWU D;  3NRZ A;  1L0X B;  2V3N A;  2JYE A;  5G5G A;  1N63 A;  2WU5 B;  4REZ A;  5BMH A;  2LHD A;  1C4P A;  1ENF A;  1FFU A;  1I4G A;  2JQR B;  2DBY A;  2K9X A;  3ETR A;  2XN9 C;  4O1N A;  2PTL A;  1VZ8 A;  1FCC C;  1K53 A;  2Q5W D;  1D4B A;  2J42 A;  1STE A;  3SFE B;  3CIR B;  3U2S C;  3NUH B;  3UI3 A;  3T3O A;  3AE1 B;  3MC0 B;  4Q2J A;  1IBX A;  4ZYS A;  4PT5 A;  1YJI A;  2JU6 X;  5JXV A;  1V1P A;  1KFY B;  1C78 A;  1YN3 A;  1FXA A;  1J7A A;  4HKZ E;  3I57 A;  1TKE A;  2QIL A;  3AN1 A;  5EE1 A;  3W5V B;  2WDR B;  1AN8 A;  4N58 A;  5EE3 A;  3TEZ A;  4HKQ A;  4IOI E;  1I4H A;  2JZP A;  5H92 C;  5T8I A;  3U7Z A;  4KKI A;  1QOB A;  2IGG A;  3TEW A;  1SJE D;  1ESF A;  1MHX A;  2LJI A;  4R3D A;  2ICI A;  3AEG B;  3SFD B;  1EWC A;  2WDV B;  5MPO A;  1PGB A;  1FNW A;  2WXN A;  4KGT A;  5BMI A;  1CQV A;  3VRA B;  4N59 A;  2L32 A;  4YSX B;  4FXC A;  4J3O D;  3RFZ B;  1XLN A;  1N5X A;  1TY2 A;  1TS4 A;  2KDM A;  2OHF A;  5I4D A;  1FMA D;  2BW2 A;  4RGO S;  2WLB A;  1F2R C;  1UGJ A;  3FIL B;  5EE9 A;  3LB8 C;  3W9C B;  5FKA C;  1FNV A;  1YQ3 B;  2H88 B;  4HEA 1;  1EU4 A;  2PVG C;  2W3S A;  2INN E;  5E6J A;  1FEH A;  1QQR A;  1WYG A;  1FO4 A;  1C79 A;  1JAL A;  1D5M C;  1GOZ A;  3GB1 A;  4OVZ A;  1L0Y B;  1QIL A;  2WNM A;  2BTE A;  5FR3 A;  1PFD A;  3NZ3 A;  4A90 A;  5HHD G;  3ZGZ A;  2W3R A;  3AE7 B;  1XCT L;  1JW9 D;  2ZW0 A;  4GDK B;  4A6Q A;  2WXH A;  1RYJ A;  4KX6 B;  1V8C A;  1GAQ B;  1K52 A;  2INP E;  2ON8 A;  1HXY D;  1ZOY B;  3EA6 A;  4P16 A;  2HTM E;  1YQ4 B;  4OW0 A;  3AE6 B;  3E9S A;  4JX1 C;  3Q8A A;  2W55 A;  2I2Y A;  4LLG M;  4D2K A;  3TSS A;  2IJ0 A;  3P4S B;  3BVM A;  3MJ5 A;  3AEF B;  2Y5P A;  4C7Z A;  3HVD A;  1DGJ A;  1BUI C;  3Q69 A;  3U52 E;  2PW9 A;  3Q8B A;  3GS2 A;  4TMA B;  2AQ3 B;  1DOX A;  1XXG A;  2MJD A;  1Q10 A;  2PLP A;  3PZ8 A;  2WXF A;  1DYQ A;  3AM9 A;  3B2G A;  1KTK A;  2WXG A;  3IAM 1;  3O13 A;  1TS5 A;  3Q8E A;  2DLB A;  1D6E C;  1I4R A;  2BT6 A;  1J7B A;  3P63 A;  3P1M A;  3FC4 A;  3LXF A;  3P42 A;  2RDH A;  2KAC A;  3IXS A;  3AEB B;  1JRP A;  1I4Q A;  4KGS A;  3W1S A;  2QEJ C;  2J53 A;  1F77 A;  3E56 A;  1J7C A;  4IDI A;  1QLB B;  1JCK B;  2GB1 A;  1JQ4 A;  2LHE A;  2CJN A;  1PDX A;  2JWU A;  4HJG E;  2N9K A;  2V3P A;  1XLQ A;  3NVW A;  3VR9 B;  3R2T A;  1KRH A;  1T5X D;  2IPK D;  3I9V 1;  4L1B A;  2WP9 B;  2L83 A;  3GP7 A;  1HA5 A;  3P4Q B;  1QT9 A;  1KH0 A;  2TSS A;  3AE9 B;  2PKO A;  4AQ7 A;  1SEB D;  2IDY A;  3Q8C A;  1WRI A;  2MH7 A;  3EUB 2;  2Y3A A;  1EU3 A;  3FIL A;  2KMM A;  2OED A;  2PIA A;  4XDD A;  3VQI A;  4XDC A;  4M0W A;  4WH4 A;  3NS1 A;  4WAF A;  1FXI A;  2Y5C A;  1KLU D;  3R8B A;  4CQN A;  3B9J A;  1E0Z A;  2IGD A;  2XNA C;  1PGA A;  2AQ1 B;  1QKZ A;  3AH7 A;  3AV8 A;  2V0G A;  3HUI A;  2L52 A;  3MHZ A;  2ACZ B;  2M56 B;  2NTT A;  4HRO A;  4UDU C;  3W2D A;  1F0Z A;  4USA A;  1SE3 A;  3ZYY X;  3ZJU A;  1NEN B;  1D5Z C;  2LFI A;  2QSD A;  4WUR A;  3TEX A;  4XE0 A;  5HG2 A;  3BK1 A;  1CJE A;  3TEY A;  1SXT A;  2WXL A;  1BML C;  2JX5 A;  3ZQ4 A;  1YN5 A;  2EKI A;  4MM3 B;  1VLB A;  1SF0 A;  4OHJ A;  1L4Z B;  4H2A A;  2JSV X;  2QIE B;  1JWU D;  4US9 A;  3KLS X;  2M19 A;  1IGC A;  3J9C A;  3MFG A;  1SJH D;  2H89 B;  1TZO A;  4JWS C;  4WWM A;  1FNU A;  3P4P B;  4N6E B;  3ABV B;  5H8Y E;  4RGT A;  1V97 A;  1TKY A;  3NVZ A;  1TKG A;  1M4V A;  2WXR A;  3PO0 A;  1T3Q A;  1K51 A;  1N62 A;  2JXT A;  3LYY A;  4JPS A;  3SR6 A;  1WSP A;  1VZ7 A;  4ZOH C;  1PYW D;  4IKG A;  1SSN A;  2ZW1 A;  3BVZ A;  1XF5 L;  2PMV A;  3AEA B;  4RCO A;  1JWS D;  2SEB D;  2WXM A;  3HRD D;  4NAW B;  1OQR A;  1FM0 D;  5LNK 1;  1TS3 A;  1CZP A;  1CK1 A;  1TS2 A;  1WGK A;  1NVI D;  2WXI A;  3NVY A;  2N0S B;  3PZ7 A;  4YTM B;  1BXT A;  5EE0 A;  2G9H D;  5TSS A;  4ZHO A;  4YXD B;  4ZRQ A;  2KQ4 X;  3VR8 B;  2CJO A;  3DWG C;  1HZ6 A;  1NEK B;  5D7G A;  1XO3 A;  2RDG A;  2I38 A;  5D3I B;  2MJE A;  1SBB B;  1E9M A;  1ZP0 B;  1ZE3 D;  2KAJ A;  1UWX A;  2QMT A;  1SE4 A;  3BVG A;  5G5H A;  1R7S A;  1C4A A;  3H8H A;  1RM6 C;  3R2I A;  3BYY B;  2MJ3 A;  4C56 C;  3BII D;  1Y56 A;  1GB1 A;  1TYG B;  3AE2 B;  3U4E G;  2WS3 B;  2W54 A;  1ZPS A;  4B0M A;  4RH6 A;  3B2F A;  2IGH A;  4RGN A;  1JRO A;  4KKJ A;  1QOG A;  4YT0 B;  1E6E B;  1WWT A;  2JYT A;  2G1E A;  1VRA B;  3P4R B;  4A9A A;  2N7J A;  1PGX A;  1QOA A;  2SAK A;  1FRR A;  1IGD A;  1C76 A;  3AB5 A;  1IBX B;  3IAS 1;  2K0P A;  3IT6 B;  1D5X C;  3BZD B;  1V1P B;  2WXK A;  2K3U A;  1EWY C;  1K50 A;  1TJE A;  2BS3 B;  4NAM A;  1FCL A;  1I4X A;  1EM7 A;  4GDL B;  3AE8 B;  5FK9 C;  1HZ5 A;  5HFY A;  2KN4 A;  1FIQ A;  4NZL B;  1UWM A;  1C9F A;  4OZC A;  1RWS A;  4ITK A;  1DOI A;  4DXG A;  2HDE A;  4LTU A;  2Z8L A;  1MI0 A;  3L4P A;  1IUE A;  2K22 A;  1SE2 A;  1MVK A;  3KWL A;  1WXQ A;  4ZRP A;  2LGI A;  1JWM D;  1XLO A;  1ZXI A;  1I4P A;  3AEE B;  5HI1 A;  3ZJT A;  1KLG D;  1VJK A;  2N9L A;  4MH8 A;  3CWI A;  1L6U A;  3BK2 A;  3AMZ A;  1E7P B;  4MAC A;  4TSS A;  2X38 A;  1GB4 A;  1LO5 D;  1YJJ A;  3T3N A;  1PUT A;  2W82 A;  4YTP B;  1AW7 A;  3EGR A;  4OZB A;  4RF1 A;  1ACC A;  1HQR D;  2BBC A;  1ET9 A;  3ZJV A;  3DWM A;  1SB3 C;  4DQO C;  1QF6 A;  4A55 A;  4DXF A;  4YSZ B;  4XWT A;  3HVZ A;  2BS2 B;  3AE3 B;  2L1A A;  4XWW A;  5BMG A;  2R61 A;  2WU2 B;  5BYS A;  5C2T B;  2GI9 A;  3RPF C;  1A70 A;  4RFB A;  2LMC A;  2M0A A;  2LEK A;  4L2Y A;  1V1O A;  1HEZ E;  4RGM A;  2WXQ A;  1ZXH A;  1AWD A;  1NYQ A;  4C7Y A;  1L6V A;  2EEL A;  5BYR A;  1L0V B;  2NMQ A;  3OWE B;  5AUI A;  1UNS A;  2D5G A;  3KWV A;  4GLS C;  1T6B X;  1C77 A;  2YEP B;  3WCQ A;  3Q8F A;  2PVO D;  1AYF A;  2DWQ A;  2K5P A;  1FFV A;  1N60 A;  1NYR A;  1MPE A;  3AEC B;  1F2R I;  4B0E A;  1ZDV A;  2GRI A;  1QOF A;  4YWG G;  2AX5 A;  3V05 A;  2VZK D;  3AED B;  2E6X A;  1SIJ A;  1JML A;  2CU3 A;  1XCQ L;  2BS4 B;  2V4I B;  4ARC A;  3TUO A;  3N9Y C;  2BYT A;  4P6V F;  2DYO A;  1L5P A;  2FE8 A;  4C80 A;  4L23 A;  1RFK A;  2RPV A;  5GXG B;  3KQ4 A;  4OZA A;  4NJC A;  1MHH E;  3V3X A;  1ET6 A;  2QJL A;  2YEP F;  4JWU C;  1VR9 A;  3AE4 B;  1N5W A;  2MEK A;  2BB6 A;  1ROE A;  2E3T A;  3SEB A;  1C4C A;  3IT4 B;  5D3D A;  4LK0 M;  4YSY B;  2J52 A;  1DOY A;  1N61 A;  2WQY B;  3W5U B;  2DYM A;  4US8 A;  3FAH A;  4RF0 A;  1FRD A;  2NTS A;  2WXO A;  4WQM A;  2WXP A;  4HRS A;  4AS1 A;  2FBW B;  2RMM A;  1FD6 A;  4A8X C;  1YNT E;  2WDQ B;  4TQ1 A;  5C3J B;  4KGR A;  1YMH E;  1KF6 B;  1XLP A;  1YN4 A;  2J4X A;  1VZ6 A;  1B1Z A;  1L4D B;  3NVV A;  3C8Y A;  2BB5 A;  2KWD A;  4ARI A;  4WIP A;  1TY0 A;  1OQQ A;  2ONQ A;  4EE2 A;  4MT5 A;  2VZK B;  1GPX A;  3BYT B;  1JWB D;  3VRB B;  4RNA A;  1I7H A;  1E10 A;  1XEE A;  4JE3 B;  2B76 B;  2LUM A;  3URY A;  1ZUD 2;  1VDV A;  5BYQ A;  3AE5 B;  1B9R A;  1JWA D;  1UUP A;  5AUK A;  2WXJ A;  4YTN B;  4TQ0 A;  2AQ2 B;  4ZHP A;  1P7F A;  1NI3 A;  2FUG 1;  1P7E A;  3MP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...