1DOYA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN [2FE-2S]
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doyA00
4JX1C 1RWSA 3PO0A 4HRSA 2QIEB 1XO3A 3HUIA 1TKYA 1UWMA 3P63A 1N5WA 1JW9D 3HVZA 2K9XA 2W3RA 1E9MA 1NI3A 1PDXA 3P4QB 1J7AA 1N60A 4YSZB 4WWMA 3VR8B 1IUEA 2L52A 1OQRA 4C7ZA 2KMMA 2W55A 1JQ4A 3AB5A 1JWBD 3AE9B 4C80A 2W54A 4HROA 2BS3B 1T3QA 1VLBA 3DWGC 2PKOA 1OFFA 3EUB2 3BIID 3NVVA 1TKGA 2E3TA 3AE5B 5AUIA 1XLQA 1WXQA 1YQ3B 1ZUD2 3L4PA 4A9AA 2CJNA 1AWDA 3B9JA 5H8YE 1FM0D 1I7HA 1JRPA 4ZOHC 1QOFA 4N59A 4C7YA 2Q5WD 1TKEA 3AN1A 3P1MA 1QOAA 1L6VA 2K5PA 4ZHOA 3W5UB 1FFVA 1KF6B 3KWLA 1FRDA 3P4SB 4LTUA 5AUKA 1DOIA 1ROEA 4YT0B 3AE2B 1CZPA 1N61A 1E6EB 1FMAD 1L0VB 2BS4B 5H92C 1VJKA 1F0ZA 3AE1B 4YSXB 1TYGB 2K22A 2DWQA 4YXDB 3AEFB 5EE9A 1XLNA 2LEKA 3P4PB 3NVYA 4YTNB 1N5XA 2MJ3A 4P6VF 1V8CA 1QOBA 1N62A 1SB3C 5EE1A 4JWUC 5G5GA 5GXGB 3FAHA 2QJLA 4JWSC 1CJEA 2EKIA 1KFYB 2WLBA 3AEBB 1FRRA 3AE3B 1NENB 2ACZB 1E0ZA 2WDQB 3RPFC 2FBWB 2MJDA 4ITKA 1FFUA 3AE6B 4USAA 1E10A 1GPXA 3LB8C 1WGKA 3VRBB 1YJIA 1SIJA 4ZHPA 2H88B 2B76B 4US8A 1XLPA 2WDVB 2OHFA 1ZP0B 2WDRB 1AYFA 1WWTA 1ZXIA 5C2TB 3AEDB 1YQ4B 1A70A 2JQRB 2WP9B 3AV8A 2AX5A 2PVOD 3B2GA 1JALA 1QOGA 4N58A 3AECB 1TJEA 1FXIA 3AM9A 3AEEB 5EE3A 1J7BA 1SF0A 1J7CA 4US9A 3WCQA 3B2FA 4WQMA 3SR6A 1NYQA 5G5HA 3W9CB 5MPOA 2L83A 2M19A 4YTMB 3AH7A 3CWIA 1B9RA 3VRAB 1DOXA 1E7PB 1NYRA 2CJOA 1WYGA 3AEGB 4YTPB 1DGJA 1NEKB 3NVZA 2M56B 1EWYC 2BS2B 3NVWA 5EE0A 3CIRB 2G1EA 3SFEB 1YJJA 2WU5B 2PVGC 2WU2B 1L5PA 2HTME 3HRDD 4YSYB 1QF6A 1N63A 1GAQB 3NRZA 4N6EB 1FO4A 3SFDB 2WS3B 2MH7A 3AE8B 3FC4A 3ZYYX 3W5VB 3NS1A 2JX5A 4FXCA 4IDIA 2H89B 1DOYA 2PIAA 1FXAA 1JWAD 1NVID 3P4RB 1OQQA 1QLBB 2KAJA 3VR9B 1FIQA 1RM6C 5C3JB 4KX6B 1JROA 3AE4B 3AE7B 1KRHA 2MJEA 2Y5CA 1VDVA 1RFKA 1XLOA 1PFDA 1ZOYB 1WRIA 2BT6A 2CU3A 2WQYB 1QT9A 3ABVB 3AEAB 3AMZA 1L6UA 1R7SA 2N0SB 1PUTA 1RYJA 2DBYA 2W3SA 3DWMA 3LXFA 1V97A 3ETRA
chains in the Genus database with same CATH superfamily
5C23A 3DHHC 3ZJUA 3JW0X 2LVOA 3U52E 1TY2A 4BBNC 5TSSA 3TEXA 4MELA 1TY0A 1E8XA 4AJWA 1KTKA 1L7YA 3TMPB 4LJOB 4F7ZA 1ZUD2 3IXSA 2W82A 2CJNA 2DZMA 1QOFA 4IKGA 2R61A 3QJZA 3VXWA 3EC8A 5D7GA 1R4MI 3AE1B 3WA0A 1NDDA 4DDGD 3B1LX 3C8YA 4RGNA 2C60A 2RMMA 3IG3A 3ZDMC 1FNUA 2GBMA 3JSVB 1F77A 4WURA 3OWEB 4GN1A 1XD3B 2WXJA 2LUMA 1MJDA 2D3BA 3PV1A 2BVCA 2IZVB 3A33B 3CSFA 4A3OA 5DPTA 4GDKA 4DDID 4PS3A 1C76A 1J7CA 3B2FA 4YL8A 2C5LC 4J6IA 3WAMA 2FCNA 2BTEA 3QWZB 1ZXHA 5KHQA 4ZRQA 2C7HA 3VUXA 3FC4A 4BZAA 3AU5A 5KHOA 1JWAD 4M8NA 5L95C 1WSPA 5G2NA 4P16A 1V5OA 2LMCA 3ZDTA 1RM6C 2O6VA 3AE4B 2W9NA 4YTMB 2AQ1B 2KFKB 2HDEA 5TR5A 2DBYA 3R2IA 4XYCA 4JX1C 2BW2A 2L32A 4MM3A 4HEA1 1N5WA 5BMHA 3DHGC 2DYMA 2KMMA 4BVUC 2NBWB 4WJQA 3ONSA 2MW5A 3UQBA 3NY5A 1GOZA 2MEKA 2V9HA 3LYYA 3V62A 2K8HA 1GB4A 1ZE3D 1YNTE 2X38A 1TS5A 3UGBB 4W9IA 1AARA 4WWPA 4WQOB 3OJ4B 2O6VB 4X57B 1FFVA 4LTUA 3H7PB 1ROEA 4M0WA 1V6EA 2K25A 5BYQA 3VTWA 3MTNB 4WWNA 5EE9A 1I4HA 1L4DB 3IT6B 1SE9A 2AQ2B 2JT4B 3C19A 2PE6B 4FJYA 4DXAB 3VDZA 1SJED 4AWJA 1FNWA 2BYFA 3ZJTA 3UIOB 3WAPA 2GOWA 1E10A 1WE7A 4E74A 1Z2MA 3ZJVA 4ZHPA 2ONQA 2SAKA 4IWQA 2BPSA 2LGIA 4RNAA 2WP9B 3M95A 2HD5B 2JZPA 1TBEA 3B08A 5G5HA 4P1CC 1F2RC 1DOXA 4AJYB 3OJ3A 3D32A 1HXYD 1OGWA 3Q6BA 3VH3B 1BXTA 4GSWA 1N63A 2KX3A 4W9CA 1YN3A 3NRZA 2MH7A 5J18A 3BZDB 2JYTA 2ICIA 4C00A 3ZUNA 3PLVA 3PT2B 3KWVA 4OVZA 5AZGA 1WRIA 1BUIC 4MJSB 2V4LA 2KVRA 2EKEC 4JIOU 1JW9D 3ZW3A 1QILA 3QQ8B 2OJWA 3NUHB 2KTRA 1JWUD 2AL6A 2JZ3B 1D5ZC 3RNCC 2DHZA 1TKGA 5AUIA 2D5GA 2KDFB 3P2BA 3RMKC 1WX8A 3R66C 2PLPA 3KYCD 4HJKA 3AN1A 2M4NA 1ET9A 4PYZA 3P4SB 3A9KB 4WJOA 3AU4A 1T6BX 5H92C 2INCC 3V6CB 3V61A 2DZIA 3E56A 1KLGD 3NVYA 1EM7A 3RUIB 4P6VF 4TSSA 2IY0B 4K7WA 4GGQA 2LXCA 5EE1A 3OLMD 5GXGB 5E6NA 2EKIA 1KFYB 2RR9A 3ECIA 2FBWB 2NPTB 3L0WB 4DHZB 2R2OA 1IBXB 5FK9C 3L10B 3C0RB 3IT4B 3NZSA 1AYFA 1WM3A 2FUHB 2REXA 3M3JA 2AX5A 2ZW0A 3DVNV 4N58A 5DPRA 1TT5B 4WQMA 1NYQA 1AW7A 3AI5A 3KUZA 1QZEA 1NEKB 3BK1A 1G6JA 2KNBA 1E8YA 4KV2A 5BMGA 3VUYA 2BWFA 1GAQB 3ALBA 3DVGX 4ASWC 2ASQA 3T9LA 4R3DA 3GZNB 2JXXA 4KGRA 2KWVB 4OZBA 4KKJA 1XLOA 1FPYA 1ZOYB 2WQYB 2MP2A 3VTVA 2N7DA 4AP4C 1V97A 1IGDA 2YEPB 2IY1B 1VD2A 3L17A 4EKUA 5LLIA 4CQNA 4UDUC 1IUEA 4FULA 2V4IB 1XCTL 3PS6A 4MT5A 1MI0A 4M0WB 3NJTA 4A9AA 2XN9C 2QC8A 1FM0D 2GMIC 4KZCA 1DYQA 2FCSA 3P1MA 4NJ7A 4XX5A 3IVFA 2RDGA 2AQ3B 2WXLA 1E6EB 1L0VB 4IM2A 1VJKA 2DWQA 2HTHA 1WMHB 5IO9A 2NMQA 2BBCA 1ACCA 3DBSA 2BB5A 1N62A 2FCMA 2L00B 1V1PB 1H8CA 5LXHA 3MP9A 2KLCA 1XEEA 2N7EA 1GPXA 4RGMA 4IM3A 2JF5A 1HTQA 1LGRA 4IOIE 4AQ7A 1XF5L 4BFRA 3DVGY 1Q10A 1YQ4B 4E71A 2D2QA 1HZ5A 1WX9A 3ZNID 3AM9A 2QCZA 2K0PA 2KWCA 5I4DA 4PYUA 1V2YA 4PT5A 4IG7B 5IA7A 2MX2A 3N3KB 1AN8A 3VRAB 2EELA 2KMCA 2JYEA 4NAWA 2IO1B 3NVWA 3QARA 2HTME 1WGHA 1V1PA 2EMSA 3SFDB 3W5VB 4P1BC 1E5WA 3A4RA 4FXCA 4JQWC 2BKFA 3APFA 4W9DA 2N4FA 2DZKA 4DBGA 2O2VB 3EA6A 3QK0A 4WWOA 3AULA 4HXDA 1KRHA 3I63C 2ZPNA 1L6UA 1I4XA 4XC2A 4I6LB 4L1BA 1PUTA 3LXFA 3K9OB 4RCOA 3VVWB 1ZKHA 2G4SA 1K52A 3CSTA 2BS3B 3IAM1 4KIKB 1P1AA 4G11A 3DBLI 1HA5A 1WGRA 2DYOA 3B9JA 4AOFA 3TUOA 1WJ6A 4ZOHC 3PGEA 2CR5A 2O2VA 1I4QA 2K3UA 3T3OA 2GBNA 1M94A 2KFKA 5IP4D 1C78A 4CHKA 3DBRI 3P4PB 3N1XC 4EFOA 3L08A 5J17A 5D6JB 3TEZA 1FNVA 4JWUC 5G5GA 3I9V1 2KXJA 2WDQB 1GB1A 4OZAA 3ZXVA 3GP7A 4NPNA 4FA6A 1MHXA 1I4PA 5CHFA 2KVZA 3H7PA 3QAQA 2EMTA 4B95A 4C4VB 1D5MC 2KZRA 2WX0A 4LNIA 1OEYA 4XDCA 2C7NB 4YTPB 3RD2A 3JYUA 4WH4A 3CIRB 3NZ3A 4EZJA 2K39A 2D3CA 2LXAA 2MP2B 2WXKA 3U7DA 2KJRA 5HKHA 2JX5A 1EU4A 3H6NA 2KK8A 4A90A 3Q8AA 3RNBC 3ZKJC 4A20A 2L3ZA 2WHIA 3N9YC 2WXPA 2Y5CA 3W1SC 3ABVB 2WYQA 1QT9A 3QHTA 3RYTA 2BF8B 3L54A 3ML8A 2OOBB 4Q2JA 3ZLZA 1UGMA 1UGJA 2ZW1A 3RFZB 2FNJB 2KQSA 1MG4A 4A8XC 1WJUA 1OFFA 4RMAA 1ZDXA 3M62B 2N9PC 1GC7A 2JUOA 4URKA 3EFUA 1EF5A 2CU1A 1KF6B 1L4ZB 1DOIA 2VZKB 4XGAB 1C4PA 2N7JA 2ZZPB 5D2MB 4OVVA 3X23A 2IGHA 1EWCA 1D4BA 4AS1A 1TGZB 2MBHA 1E8ZA 3URYA 2L05A 1YD8U 2LRWA 2A4ZA 3JSVA 4S0RA 4ZRJA 2KWDA 1YJIA 1SIJA 2Z0DB 5BO4B 2WXHA 3SEBA 2WXQA 5C2TB 1GC6A 3AEDB 3MFGA 1JALA 2K8BA 4KZ0A 3WCQA 5MPOA 1WX7A 1LM8B 3CWIA 2NBVB 1E7PB 3GE3C 4DWFA 5AEKB 1T5XD 4GDLA 2UU7A 4ARIA 4IDIA 2WWZA 2KHWB 1YN5A 2BKRB 1SIFA 4F1SA 3TJPA 1MHHE 3ZNZB 2MJEA 2LVQA 3AEAB 3MHZA 2J4XA 2N0SB 5HFYA 3GS2A 4L23A 2BQQA 5DPWA 4ZRIA 3W2DA 5HHDG 4TV3A 2K9XA 2PE9A 3I5JC 4MSQB 1IGCA 4KDLB 3VR8B 4IW0A 5HI1A 4E3CA 4HROA 4ZYSA 2LJ5A 3L16A 2PKOA 2E3TA 4GDLB 3ZRFA 1RLFA 1V86A 4LNOA 4PK1A 4CYEA 3DOWA 4IWOA 3A9JB 4D2KA 2N1WA 4ANWA 1XQQA 5BMIA 1E7VA 3S2AA 3Q3JA 3ZTDA 2VRRB 3NG0A 4RH6A 3DCGA 4YSXB 2K22A 4TQ0A 3AEFB 1XLNA 1WM2A 2YLMA 2LJIA 5L83A 2ZEQA 2NVUI 2MJ3A 4HWIB 4IUMB 2OEDA 2SEBD 1CJEA 4ZYNA 4HDOA 3OG5A 1C1YB 3BVGA 2BGFA 4NZLB 4MGZE 3ZTCA 3A4SC 3VRBB 2WDVB 3KVFB 4KGSA 2XEWA 2DYBA 3DDCB 4XDDA 3DPDA 4XE0A 1SF0A 1ESFA 1V9JA 2FIFA 1C9FA 4KKIA 1WMHA 4G50A 2WGSA 5JHAA 1HQRD 2JWUA 3JVZX 3NS1A 1ENFA 5E6PA 3SHQA 3EGRA 2KQ7A 1KOTA 1PGXA 3NHEB 3B2GA 3EUB2 1TS2A 2QIEB 3R3MA 1VR9A 1E9MA 3PRPB 2LUEA 3W1SA 1K53A 2LGSA 2RD0A 1JQ4A 1JWBD 3UQAA 2KX0A 1WIAA 2G45B 1WE6A 5IKCM 3BIID 5D3IB 2CHZA 2L76A 3A1QB 4HK2A 1YQ3B 3TL5A 4M8MA 2IO3B 2KWUB 2M0AA 3BVZA 3HHMA 3K9PB 5H8YE 2G9HD 1MG8A 4HLEA 3HK0A 3R7RA 2GB1A 2K5PA 2MLBA 2KO3A 4M01A 4HCNB 1FMAD 2VH1A 3R8BA 3WIMA 3WAOA 3V05A 2PPHA 1TYGB 1L2NA 3Q3OC 2QEJC 3SU8X 2MWSB 3BK2A 1CK1A 3PRMB 2N9XA 4DHJB 1UNSA 1WGGA 3M63B 3H7SA 4GMVA 1IBXA 2MJDA 1TS4A 4NQKE 4ARCA 4DXFA 1YX5B 4DK5A 4EUTA 2HJ1A 1KLVA 1YQBA 4EOYA 1FXIA 2B3AA 2GRIA 1PYWD 2K1FA 3T3NA 2IYDB 2CJOA 4DHJD 2WNMA 3GZNI 4MACA 2WS3B 1I42A 3VQIA 4K81A 3N32A 3BY4B 3MHSD 4NJCA 4RF1A 3SD5A 1MVKA 1EU3A 2E6XA 2KMAA 2WXOA 2D11A 3TSSA 1CQVA 4XWTA 2WXIA 1C77A 3GB1A 2XK5A 3KLSX 4ICUA 1XO3A 1TKYA 2JU6X 3P63A 1T0YA 1GNUA 4W9KA 3HVDA 3APCA 2G3QB 4C7ZA 1FCCC 3DWGC 3VAWA 3ZVVA 2M0XA 2IDYA 4REZA 1Y56A 3J9CA 1FEHA 3PRZA 4IWPA 3UINB 1JRPA 3BWUD 2C7MB 3ZGZA 3OAWA 1SGHA 1VCBA 1CZPA 1N61A 1HE8A 2J42A 1BT0A 4A6QA 2ZVOA 1UWXA 1OEYJ 1TIFA 2FIDA 4EEWA 4MJSA 1LO5D 2PJHA 3ML9A 4JWSC 1ZW7A 3BYTB 4ITKA 2JRIB 4MGYE 1EF1A 2FCQA 4XZ4A 1S3SG 1F1HA 4ACFA 1MFWA 1ZXIA 2IO0B 2PVOD 5CHVC 1QQRA 4GDKB 3KW5B 2AWTA 2KT7A 3W9CB 1YX6B 3VFKA 2DNFA 3FILB 1L5PA 1WRDB 1WYWB 1K8RB 2TSSA 4GU2A 2KYWA 4EZLA 2H89B 5DPSA 3PHWB 4KX6B 1STEA 3AEBB 1IYFA 1XT9B 4II3B 3DWMA 3UF8A 3O65B 3KUCB 3A1QA 2KC1A 1B1ZA 2G4DB 3HVZA 4KDIC 4MM3B 1KLUD 3P4QB 2L1AA 3AXCA 1WZ0A 3MJ5A 1OQRA 2IBIB 3ZNHB 3RZWC 4C80A 1T3QA 3HM3A 2CHWA 4WJPA 2KOXA 2V1YA 2AEHA 3PHXB 3VH4B 2L8JA 4HKQA 4W9HA 3PREA 4ICVA 1R4NI 2Q5WD 1TKEA 1LXDA 2DAFA 2LGXA 1FXTB 2N9EB 3DBRB 1PQSA 2BS4B 4OVUA 5GMVA 2QILA 3T8MA 3DVNU 1K50A 1FCLA 5JZEB 4TQ1A 2ZJDA 1LFDA 1V8CA 2NBUA 1SB3C 3Q3MC 4YSZB 1ZGUB 2YEPF 4HPLB 1NENB 1RRBA 3IFWB 3N1YC 1J0GA 4LJPB 1UBQA 4ANUA 1WGKA 2RGFA 4MDKE 2H88B 2ZCBA 1XCQL 3A9JA 2OHFA 2K6DB 2LHDA 3W1YA 2KC2A 1A70A 3ZQ4A 5BYSA 2V0GA 1WF9A 4FJZA 1P7FA 1WXMA 2PW9A 5CTRC 4DHZE 2Z59B 3SFEB 1Q5WB 2PVGC 4JL9A 5HG2A 2ZVNA 2LASA 3ZRCA 1F52A 5JH5C 1QLBB 1H4RA 4FN2A 2GLSA 2K8CA 4WIPA 3ENEA 4MSMB 1K51A 5LXIB 2M56B 3ETRA 2Z0EB 4W9GA 2LWPA 3VUWA 1PDXA 1VZ8A 3RCZA 4A55A 4WWMA 2L52A 3HM6X 1WGYA 1UD7A 4TMAB 3PSEB 3L4PA 2NR2A 4FLHA 2WXNA 2BYVE 1QKZA 4S17A 3PVLA 3BVMA 4XWWA 4G3XB 1L6VA 2O6VD 4NAWB 1L0YB 2UYZB 5AUKA 5LNK1 3O13A 1IPGA 1N6ZA 2K6QA 3DBHB 4LDTD 2JY6A 3Q3NC 1V5TA 4TUUA 1CMXB 2J0JA 2INDC 4GB9A 1I4RA 2ON8A 2KKCA 4M02A 2INPE 3Q2AC 5CX3A 3EHVA 2DAJA 2LRUA 1SJHD 3RI7C 1FFUA 2D07B 3AE6B 4HJGE 4USAA 4FHJA 4US8A 3WANA 2ZCCA 2LZ6A 3DBLB 2MBQA 4RF0A 4LNKA 2JWZA 3BINA 2GBRA 2MQJA 3SR6A 2L83A 3SDLC 1E90A 4HVBA 1B9RA 4FADA 3KQ4A 2JXTA 1ISNA 3V6EB 1WYGA 3IHPC 2WU5B 3HRDD 2WXGA 4YSYB 3U4EG 3FKYA 1FO4A 1C79A 5AZHA 2UWQA 4PS7A 5G55A 1NVID 1P3QU 2HJ8A 1TZOA 4KSLC 1PFDA 4B0MA 4GLSC 1WXVA 2W3SA 3U7ZA 1P7EA 3Q69A 2W3RA 4EZKA 4NNJB 1WY8A 2HE7A 2M1MA 2D10A 3EFCA 3U30A 2ZPYA 5IAAC 1AWDA 3QX1A 1WXSA 2PTLA 3RNFC 3W5UB 2KACA 4A3PA 1MPEA 3H9DA 4BOSC 2I38A 2LGDA 1GG3A 2LHEA 1KH0A 3U8ZA 4BKSD 2LEKA 2QHOA 2J0KA 4YTNB 2IPKD 4I6PA 1TS3A 1E8WA 2N9LA 4BOZB 1EO6A 1JMLA 4GIVA 2WLBA 2ACZB 2JZZA 2LD9A 3Q8BA 1F9JA 3PZDA 1ZP0B 2VH2A 3L13A 1C4CA 2WXFA 4B6WA 4P7IA 4KGTA 2KDIA 3AEEB 1J7BA 4WAAA 1VZ6A 4KSKC 4RFBA 3NZUA 3AH7A 4IC7B 2KFJA 2MSED 1NYRA 2KDMA 5EE0A 4CO7A 1JRUA 1IP9A 4BKSA 3LDZE 3ZYYX 4PS8A 1YMHE 1DOYA 3A9KA 2IGDA 2KANA 3APDA 1OQQA 4IM0A 2KJHB 1S1QB 2KQ4X 2QDFA 3ZO5B 1UH6A 2BT6A 3PZ8A 2MHJA 3AMZA 3B0AA 4TKNA 4F8CB 3PO0A 4LCDE 2NPTA 1KJTA 2MBEA 3TCAA 1L0XB 1WXAA 4BBNF 3AB5A 3AE9B 2J7QB 1VLBA 2DLBA 3MJWA 1J8CA 4NY0A 1XLQA 1T0SC 2BWES 1T0QC 2GBJA 2MRPA 1UZXB 3WALA 3MC8A 4ANXA 3PTFC 4ZDVA 1JWSD 2KN5A 3TBLD 2VZKD 3TEWA 1HTOA 1V49A 2LFIA 1NBFC 5AZFA 1SSNA 3H8HA 1QOBA 1RFAA 2ZNVC 1WJNA 2QJLA 5FR6A 3Q8CA 1U4AA 1A5RA 3QA8A 1V80A 2RDBC 4HPPA 1QOGA 3NS8A 2AL3A 3PPAA 1WJ4A 2Y5PA 2BYTA 2M19A 4LLGM 3Q8EA 5FR3A 4EE2A 3Q3FA 1DGJA 3NVZA 5D3DA 1WGDA 2J53A 4KVGB 2DX5B 1NI2A 3AE8B 5DCNA 2NS5A 1FXAA 2C9WB 2QSDA 2M8SA 3RN9C 3CF6E 2INNE 4FJVB 5C3JB 3PLUA 1VDVA 4K3BA 1SBBB 1SE4A 1V81A 1RYJA 2NCNA 2KJ6A 4G0NB 4MGKE 2BYEA 4W9LA 3HUIA 1UWMA 1M4VA 1GJZA 3RULA 2MBOA 5C1ZA 1J7AA 1N60A 4FBJB 4WJNA 1C3TA 4JLCA 3AE5B 3KUDB 4LDTB 2J0MA 3DQVA 1GUAB 1I7HA 2KTRB 2WXMA 1P98A 4C7YA 1E7UA 2Z8LA 5CHWA 2OJRA 4MH0E 2XNAC 2J52A 3P42A 2CKHB 1UELA 2IGGA 2L0FA 1F0ZA 4YXDB 2KN4A 1X1MA 4M00A 4DQOC 3FAHA 3AE3B 1E0ZA 1P9DU 4RGTA 1ZDVA 2V3PA 3LB8C 3RT3B 1Y8RC 1D6EC 4LNFA 1HEZE 1PGBA 1WWTA 1WH3A 2RPQA 3RNEC 1TJEA 3HIZA 4KIKA 5EE3A 3DHIC 1UF0A 2RSUA 1ET6A 4C56C 3FILA 1C4AA 4JGHB 2I1KA 3AEGB 3KH0A 1EWYC 1WR6E 2DZJA 2WU2B 2JRHA 1FD6A 2I1JA 4LK0M 3RNGC 4NQLB 1VRAB 2L0TA 4MGIE 2MCNB 2KAJA 3VR9B 3AE7B 1I35A 3ZIMA 3IAS1 2V3NA 1R7SA 2D3AA 4RM8A 1RWSA 4HRSA 5T8IA 3N30A 4I6NB 1NI3A 4N9F4 1HZ6A 4LNNA 4OHJA 3E9SA 1D3ZA 3U2SC 4OW0A 2W54A 4II2B 3ZXRA 4HPMB 3Q8FA 4C4VA 1PGAA 3ZNGC 2LGYA 4J3OD 5IN7A 1WXQA 4N59A 4L2YA 2L7RA 3KWLA 1Q0WB 2KLGA 4W9EA 3QCAA 2A5UA 4MEMA 2LVPA 3AE2B 4K7SA 4YT0B 2JPHA 5E6OA 3H1UA 1Z5SB 4HKZE 3VTUA 4W9FA 2NTTA 2FAZA 3CMMB 4NAMA 5JHBA 3PZ7A 4DXGA 3NOBA 2IO2B 3QIJA 5E6JA 2XK5B 3IBEA 1SXTA 1FRRA 1YJ1A 1UUPA 3RPFC 4GOCA 1YOVB 1D5XC 2PMVA 4HDQA 2B76B 2MA9B 1XLPA 2V3SA 2WDRB 4JPSA 4WAFA 2JQRB 3AV8A 1OTRB 1ZPSA 3N20C 4GXBA 4QAYA 1WZ3A 2RPVA 4K1RB 3R2TA 3GE8C 2MBBB 2QMTA 2IJ0A 4H2AA 3RNAC 1QF6A 1OQYA 1R4MB 3TEYA 1SEBD 1TZ1A 2KDEB 2PIAA 2KDBA 1WFYA 3P4RB 3MC9A 2CHXA 2CS4A 4BKTA 1I4GA 1WI0A 2R2QA 1JROA 2N9KA 4O1NA 5J2RA 1V1OA 4YWGG 4BKGA 3BYYB 3I57A 4FHKA 1J19A 1XXGA 2BB6A 2ZNVB 2KD0A 3GOEA 4K3CA 4B0EA 4K7UA 4AUQC 1YN4A 2AYOB 2M17A 2W55A 2WDTB 4RGOS 1T0RC 4B9KA 2FUG1 1P0RA 3NVVA 3TIXA 2JVCA 4HCPB 3V3XA 1YIWA 2NTSA 5BYRA 4ZRPA 1F2RI 1JCKB 2GBKA 1RAXA 3DBHI 4JE3B 1QOAA 2Y5BB 2D3GA 2RDHA 4ZHOA 4ANVA 2WX1A 1FRDA 2XBBC 3LJ3A 1Q1OA 1KM7A 2X8XX 2LI5A 4OZCA 1WR1A 1N5XA 4W9JA 2I2YA 3VHTC 5FKAC 2Y3AA 5EDSA 3RZFA 1EUVB 4NJ6A 5JXVA 4BAXA 2JSVX 3UI3A 3V60A 3N1ZC 3AECB 3X0WA 1VZ7A 3KYDD 2YVCA 2GI9A 1BMLC 2N1VA 1R4NB 2PEAA 2KTFA 5D94A 2BS2B 4RM9A 1SE3A 2G1EA 2DENB 1LQBA 1YJJA 2WXRA 3MC0B 1SE2A 4N6EB 3I3TB 1TTNA 4ZRKA 1UBIA 3EECA 2FE8A 1FIQA 5IOIA 3R7QA 1RFKA 4US9A 3Q14C 2CU3A 4MH8A 1JWMD 3QC8B 3UIPB
chains in the Genus database with same CATH topology
4RCOA 3PO0A 3KLSX 1XO3A 1TKYA 2JU6X 3P63A 3ZJUA 3U52E 1TY2A 1K52A 1L0XB 3HVDA 5TSSA 3TEXA 4C7ZA 3AB5A 3AE9B 1TY0A 1FCCC 2BS3B 1VLBA 3DWGC 3IAM1 2DLBA 1KTKA 2IDYA 4REZA 1HA5A 1XLQA 1Y56A 3J9CA 1FEHA 1ZUD2 3IXSA 2W82A 2CJNA 2DYOA 3B9JA 3TUOA 4ZOHC 1JRPA 1QOFA 4IKGA 3BWUD 1I4QA 2R61A 1JWSD 2K3UA 3T3OA 3ZGZA 1CZPA 1N61A 1C78A 2VZKD 3TEWA 5D7GA 2LFIA 2J42A 3AE1B 4A6QA 1UWXA 3P4PB 1SSNA 3H8HA 3C8YA 1QOBA 3TEZA 4RGNA 1LO5D 2RMMA 1FNVA 4JWUC 5G5GA 2QJLA 4JWSC 3I9V1 2WDQB 1GB1A 3BYTB 4ITKA 4OZAA 3Q8CA 1FNUA 3GP7A 1F77A 4WURA 3OWEB 2WXJA 2LUMA 1MHXA 1I4PA 1ZXIA 2PVOD 1QOGA 1QQRA 1C76A 4GDKB 1J7CA 2Y5PA 1D5MC 3B2FA 2BYTA 3W9CB 2M19A 4LLGM 4XDCA 3Q8EA 5FR3A 4EE2A 4YTPB 2BTEA 1DGJA 3NVZA 4WH4A 1ZXHA 3FILB 5D3DA 3CIRB 3NZ3A 4ZRQA 2J53A 1L5PA 2WXKA 2TSSA 3AE8B 3FC4A 2JX5A 1EU4A 2H89B 4A90A 1FXAA 1JWAD 3Q8AA 2QSDA 1WSPA 4P16A 2LMCA 2INNE 1RM6C 5C3JB 3N9YC 2WXPA 1STEA 3AE4B 4KX6B 2Y5CA 1VDVA 3ABVB 3AEBB 4YTMB 2AQ1B 1SBBB 1QT9A 1SE4A 2HDEA 2DBYA 1RYJA 3DWMA 3R2IA 4JX1C 2BW2A 2L32A 3HUIA 1UWMA 4Q2JA 4HEA1 1N5WA 1M4VA 1B1ZA 5BMHA 3HVZA 4MM3B 1KLUD 1UGJA 2ZW1A 3P4QB 1J7AA 1N60A 2L1AA 3MJ5A 1OQRA 3RFZB 2DYMA 2KMMA 4C80A 1T3QA 4A8XC 1GOZA 1OFFA 2MEKA 3LYYA 3AE5B 1GB4A 1ZE3D 1YNTE 1ZDXA 2X38A 1TS5A 4HKQA 1I7HA 2WXMA 4C7YA 2Q5WD 1TKEA 2Z8LA 2XNAC 2J52A 1FFVA 1KF6B 4LTUA 1L4ZB 1DOIA 3P42A 2VZKB 1ROEA 4M0WA 1C4PA 2BS4B 2N7JA 2IGGA 5BYQA 1F0ZA 2IGHA 2QILA 1EWCA 4YXDB 1D4BA 5EE9A 1I4HA 1L4DB 2KN4A 4AS1A 1K50A 3IT6B 1FCLA 4TQ1A 2AQ2B 1V8CA 4DQOC 1SB3C 1SJED 3URYA 4YSZB 3FAHA 3AE3B 1E0ZA 2YEPF 1FNWA 4RGTA 1NENB 1ZDVA 3ZJTA 2V3PA 1E10A 2KWDA 3LB8C 3ZJVA 1WGKA 4ZHPA 1YJIA 1D6EC 1SIJA 2H88B 1XCQL 2WXHA 2ONQA 1HEZE 3SEBA 1PGBA 2OHFA 2SAKA 2WXQA 2LGIA 4RNAA 1WWTA 2LHDA 5C2TB 3AEDB 1A70A 2WP9B 3ZQ4A 5BYSA 2V0GA 3MFGA 1JALA 1TJEA 5EE3A 2JZPA 1P7FA 3WCQA 5G5HA 5MPOA 2PW9A 1F2RC 3CWIA 1ET6A 4C56C 3FILA 1DOXA 1E7PB 1C4AA 3AEGB 1HXYD 1EWYC 1T5XD 3SFEB 1BXTA 2PVGC 2WU2B 1FD6A 1N63A 1YN3A 3NRZA 5HG2A 2MH7A 3BZDB 4LK0M 4ARIA 2JYTA 1VRAB 4IDIA 2ICIA 1QLBB 1YN5A 2KAJA 3VR9B 1MHHE 3AE7B 3KWVA 2MJEA 3IAS1 4OVZA 1WRIA 2V3NA 3AEAB 3MHZA 2J4XA 4WIPA 1BUIC 1R7SA 2N0SB 1K51A 5HFYA 2M56B 3ETRA 3GS2A 4L23A 1RWSA 4HRSA 1JW9D 5T8IA 5HHDG 1QILA 3W2DA 2K9XA 1NI3A 1PDXA 1VZ8A 4A55A 3NUHB 1HZ6A 1IGCA 2L52A 4WWMA 3VR8B 5HI1A 1JWUD 4OHJA 3E9SA 1D5ZC 4OW0A 2W54A 4HROA 3U2SC 4ZYSA 2PKOA 3Q8FA 4TMAB 1PGAA 1TKGA 2E3TA 4GDLB 5AUIA 4J3OD 1WXQA 2D5GA 3L4PA 2PLPA 2WXNA 4D2KA 1QKZA 4N59A 4L2YA 3BVMA 3AN1A 4XWWA 1L6VA 1ET9A 4NAWB 1L0YB 3KWLA 5BMIA 3P4SB 5AUKA 5LNK1 3O13A 4YT0B 1T6BX 3AE2B 4RH6A 5H92C 4HKZE 2K22A 4YSXB 4TQ0A 3AEFB 1XLNA 1KLGD 3E56A 3NVYA 1EM7A 2NTTA 4NAMA 2LJIA 2MJ3A 4P6VF 4TSSA 3PZ7A 4DXGA 1I4RA 2ON8A 2OEDA 5EE1A 2INPE 5GXGB 5E6JA 2SEBD 1CJEA 2EKIA 1KFYB 1SXTA 1FRRA 1UUPA 3RPFC 2FBWB 1SJHD 3BVGA 1FFUA 4NZLB 3AE6B 4HJGE 4USAA 1IBXB 5FK9C 1D5XC 2PMVA 3VRBB 2B76B 4US8A 1XLPA 2WDVB 4KGSA 3IT4B 2WDRB 1AYFA 4JPSA 4WAFA 2JQRB 4XDDA 3AV8A 2AX5A 2ZW0A 4N58A 4RF0A 1ZPSA 4XE0A 1SF0A 2RPVA 4WQMA 3SR6A 1NYQA 2L83A 1ESFA 3R2TA 1B9RA 1C9FA 4KKIA 1AW7A 3KQ4A 2JXTA 2QMTA 1WYGA 1NEKB 3BK1A 2IJ0A 4H2AA 2WU5B 3HRDD 2WXGA 5BMGA 4YSYB 3U4EG 1HQRD 1QF6A 1GAQB 1FO4A 1C79A 2JWUA 3TEYA 1SEBD 3NS1A 2PIAA 1NVID 3P4RB 1ENFA 4R3DA 1TZOA 4KGRA 1I4GA 4OZBA 4KKJA 1JROA 1XLOA 2N9KA 1PFDA 1ZOYB 2WQYB 3EGRA 4O1NA 4B0MA 4GLSC 1PGXA 1V1OA 4YWGG 2W3SA 3B2GA 3EUB2 1V97A 1TS2A 1IGDA 2YEPB 3BYYB 3I57A 2QIEB 1XXGA 3U7ZA 1P7EA 2BB6A 1VR9A 2W3RA 3Q69A 4B0EA 1E9MA 3W1SA 4CQNA 1IUEA 1K53A 4UDUC 2V4IB 1YN4A 2W55A 1JQ4A 1JWBD 4RGOS 1XCTL 2FUG1 3BIID 3NVVA 5D3IB 4MT5A 1MI0A 1YQ3B 3V3XA 4A9AA 2M0AA 2NTSA 1AWDA 3BVZA 2XN9C 5H8YE 2G9HD 5BYRA 1FM0D 4ZRPA 1F2RI 1JCKB 2PTLA 1DYQA 4JE3B 3P1MA 1QOAA 2GB1A 2K5PA 2RDHA 4ZHOA 3W5UB 2KACA 1FRDA 1MPEA 2RDGA 2AQ3B 2WXLA 2I38A 1E6EB 1FMAD 1L0VB 3R8BA 3V05A 1VJKA 1TYGB 2LHEA 2DWQA 1KH0A 4OZCA 2LEKA 2NMQA 2BBCA 4YTNB 2IPKD 1N5XA 2QEJC 1ACCA 1TS3A 3BK2A 1CK1A 2BB5A 1N62A 2N9LA 2I2YA 1V1PB 1JMLA 1UNSA 5FKAC 2WLBA 2ACZB 2Y3AA 1IBXA 2MJDA 3MP9A 1TS4A 1XEEA 1GPXA 4RGMA 4ARCA 4DXFA 3Q8BA 4IOIE 4AQ7A 1XF5L 5JXVA 1ZP0B 2JSVX 1Q10A 3UI3A 1YQ4B 1C4CA 2WXFA 1HZ5A 3AECB 4KGTA 1FXIA 3AM9A 3AEEB 2K0PA 1J7BA 1VZ7A 5I4DA 1VZ6A 4PT5A 2GRIA 4RFBA 2GI9A 1PYWD 1BMLC 3AH7A 3T3NA 1AN8A 3VRAB 2EELA 2JYEA 1NYRA 2CJOA 2KDMA 2WNMA 2BS2B 3NVWA 5EE0A 1SE3A 2G1EA 1YJJA 2WXRA 2HTME 3MC0B 1V1PA 1SE2A 4N6EB 4MACA 3SFDB 2WS3B 3VQIA 3ZYYX 3W5VB 1YMHE 4FXCA 4NJCA 1DOYA 4RF1A 2IGDA 1MVKA 1OQQA 2FE8A 3EA6A 1FIQA 2KQ4X 1EU3A 1KRHA 2E6XA 1RFKA 4US9A 2CU3A 3TSSA 2BT6A 2WXOA 3AMZA 3PZ8A 1CQVA 1JWMD 4MH8A 4XWTA 1L6UA 1I4XA 2WXIA 4L1BA 1PUTA 3LXFA 1C77A 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX1 C;  1RWS A;  3PO0 A;  4HRS A;  2QIE B;  1XO3 A;  3HUI A;  1TKY A;  1UWM A;  3P63 A;  1N5W A;  1JW9 D;  3HVZ A;  2K9X A;  2W3R A;  1E9M A;  1NI3 A;  1PDX A;  3P4Q B;  1J7A A;  1N60 A;  4YSZ B;  4WWM A;  3VR8 B;  1IUE A;  2L52 A;  1OQR A;  4C7Z A;  2KMM A;  2W55 A;  1JQ4 A;  3AB5 A;  1JWB D;  3AE9 B;  4C80 A;  2W54 A;  4HRO A;  2BS3 B;  1T3Q A;  1VLB A;  3DWG C;  2PKO A;  1OFF A;  3EUB 2;  3BII D;  3NVV A;  1TKG A;  2E3T A;  3AE5 B;  5AUI A;  1XLQ A;  1WXQ A;  1YQ3 B;  1ZUD 2;  3L4P A;  4A9A A;  2CJN A;  1AWD A;  3B9J A;  5H8Y E;  1FM0 D;  1I7H A;  1JRP A;  4ZOH C;  1QOF A;  4N59 A;  4C7Y A;  2Q5W D;  1TKE A;  3AN1 A;  3P1M A;  1QOA A;  1L6V A;  2K5P A;  4ZHO A;  3W5U B;  1FFV A;  1KF6 B;  3KWL A;  1FRD A;  3P4S B;  4LTU A;  5AUK A;  1DOI A;  1ROE A;  4YT0 B;  3AE2 B;  1CZP A;  1N61 A;  1E6E B;  1FMA D;  1L0V B;  2BS4 B;  5H92 C;  1VJK A;  1F0Z A;  3AE1 B;  4YSX B;  1TYG B;  2K22 A;  2DWQ A;  4YXD B;  3AEF B;  5EE9 A;  1XLN A;  2LEK A;  3P4P B;  3NVY A;  4YTN B;  1N5X A;  2MJ3 A;  4P6V F;  1V8C A;  1QOB A;  1N62 A;  1SB3 C;  5EE1 A;  4JWU C;  5G5G A;  5GXG B;  3FAH A;  2QJL A;  4JWS C;  1CJE A;  2EKI A;  1KFY B;  2WLB A;  3AEB B;  1FRR A;  3AE3 B;  1NEN B;  2ACZ B;  1E0Z A;  2WDQ B;  3RPF C;  2FBW B;  2MJD A;  4ITK A;  1FFU A;  3AE6 B;  4USA A;  1E10 A;  1GPX A;  3LB8 C;  1WGK A;  3VRB B;  1YJI A;  1SIJ A;  4ZHP A;  2H88 B;  2B76 B;  4US8 A;  1XLP A;  2WDV B;  2OHF A;  1ZP0 B;  2WDR B;  1AYF A;  1WWT A;  1ZXI A;  5C2T B;  3AED B;  1YQ4 B;  1A70 A;  2JQR B;  2WP9 B;  3AV8 A;  2AX5 A;  2PVO D;  3B2G A;  1JAL A;  1QOG A;  4N58 A;  3AEC B;  1TJE A;  1FXI A;  3AM9 A;  3AEE B;  5EE3 A;  1J7B A;  1SF0 A;  1J7C A;  4US9 A;  3WCQ A;  3B2F A;  4WQM A;  3SR6 A;  1NYQ A;  5G5H A;  3W9C B;  5MPO A;  2L83 A;  2M19 A;  4YTM B;  3AH7 A;  3CWI A;  1B9R A;  3VRA B;  1DOX A;  1E7P B;  1NYR A;  2CJO A;  1WYG A;  3AEG B;  4YTP B;  1DGJ A;  1NEK B;  3NVZ A;  2M56 B;  1EWY C;  2BS2 B;  3NVW A;  5EE0 A;  3CIR B;  2G1E A;  3SFE B;  1YJJ A;  2WU5 B;  2PVG C;  2WU2 B;  1L5P A;  2HTM E;  3HRD D;  4YSY B;  1QF6 A;  1N63 A;  1GAQ B;  3NRZ A;  4N6E B;  1FO4 A;  3SFD B;  2WS3 B;  2MH7 A;  3AE8 B;  3FC4 A;  3ZYY X;  3W5V B;  3NS1 A;  2JX5 A;  4FXC A;  4IDI A;  2H89 B;  1DOY A;  2PIA A;  1FXA A;  1JWA D;  1NVI D;  3P4R B;  1OQQ A;  1QLB B;  2KAJ A;  3VR9 B;  1FIQ A;  1RM6 C;  5C3J B;  4KX6 B;  1JRO A;  3AE4 B;  3AE7 B;  1KRH A;  2MJE A;  2Y5C A;  1VDV A;  1RFK A;  1XLO A;  1PFD A;  1ZOY B;  1WRI A;  2BT6 A;  2CU3 A;  2WQY B;  1QT9 A;  3ABV B;  3AEA B;  3AMZ A;  1L6U A;  1R7S A;  2N0S B;  1PUT A;  1RYJ A;  2DBY A;  2W3S A;  3DWM A;  3LXF A;  1V97 A;  3ETR A; 
#chains in the Genus database with same CATH topology
 5C23 A;  3DHH C;  3ZJU A;  3JW0 X;  2LVO A;  3U52 E;  1TY2 A;  4BBN C;  5TSS A;  3TEX A;  4MEL A;  1TY0 A;  1E8X A;  4AJW A;  1KTK A;  1L7Y A;  3TMP B;  4LJO B;  4F7Z A;  1ZUD 2;  3IXS A;  2W82 A;  2CJN A;  2DZM A;  1QOF A;  4IKG A;  2R61 A;  3QJZ A;  3VXW A;  3EC8 A;  5D7G A;  1R4M I;  3AE1 B;  3WA0 A;  1NDD A;  4DDG D;  3B1L X;  3C8Y A;  4RGN A;  2C60 A;  2RMM A;  3IG3 A;  3ZDM C;  1FNU A;  2GBM A;  3JSV B;  1F77 A;  4WUR A;  3OWE B;  4GN1 A;  1XD3 B;  2WXJ A;  2LUM A;  1MJD A;  2D3B A;  3PV1 A;  2BVC A;  2IZV B;  3A33 B;  3CSF A;  4A3O A;  5DPT A;  4GDK A;  4DDI D;  4PS3 A;  1C76 A;  1J7C A;  3B2F A;  4YL8 A;  2C5L C;  4J6I A;  3WAM A;  2FCN A;  2BTE A;  3QWZ B;  1ZXH A;  5KHQ A;  4ZRQ A;  2C7H A;  3VUX A;  3FC4 A;  4BZA A;  3AU5 A;  5KHO A;  1JWA D;  4M8N A;  5L95 C;  1WSP A;  5G2N A;  4P16 A;  1V5O A;  2LMC A;  3ZDT A;  1RM6 C;  2O6V A;  3AE4 B;  2W9N A;  4YTM B;  2AQ1 B;  2KFK B;  2HDE A;  5TR5 A;  2DBY A;  3R2I A;  4XYC A;  4JX1 C;  2BW2 A;  2L32 A;  4MM3 A;  4HEA 1;  1N5W A;  5BMH A;  3DHG C;  2DYM A;  2KMM A;  4BVU C;  2NBW B;  4WJQ A;  3ONS A;  2MW5 A;  3UQB A;  3NY5 A;  1GOZ A;  2MEK A;  2V9H A;  3LYY A;  3V62 A;  2K8H A;  1GB4 A;  1ZE3 D;  1YNT E;  2X38 A;  1TS5 A;  3UGB B;  4W9I A;  1AAR A;  4WWP A;  4WQO B;  3OJ4 B;  2O6V B;  4X57 B;  1FFV A;  4LTU A;  3H7P B;  1ROE A;  4M0W A;  1V6E A;  2K25 A;  5BYQ A;  3VTW A;  3MTN B;  4WWN A;  5EE9 A;  1I4H A;  1L4D B;  3IT6 B;  1SE9 A;  2AQ2 B;  2JT4 B;  3C19 A;  2PE6 B;  4FJY A;  4DXA B;  3VDZ A;  1SJE D;  4AWJ A;  1FNW A;  2BYF A;  3ZJT A;  3UIO B;  3WAP A;  2GOW A;  1E10 A;  1WE7 A;  4E74 A;  1Z2M A;  3ZJV A;  4ZHP A;  2ONQ A;  2SAK A;  4IWQ A;  2BPS A;  2LGI A;  4RNA A;  2WP9 B;  3M95 A;  2HD5 B;  2JZP A;  1TBE A;  3B08 A;  5G5H A;  4P1C C;  1F2R C;  1DOX A;  4AJY B;  3OJ3 A;  3D32 A;  1HXY D;  1OGW A;  3Q6B A;  3VH3 B;  1BXT A;  4GSW A;  1N63 A;  2KX3 A;  4W9C A;  1YN3 A;  3NRZ A;  2MH7 A;  5J18 A;  3BZD B;  2JYT A;  2ICI A;  4C00 A;  3ZUN A;  3PLV A;  3PT2 B;  3KWV A;  4OVZ A;  5AZG A;  1WRI A;  1BUI C;  4MJS B;  2V4L A;  2KVR A;  2EKE C;  4JIO U;  1JW9 D;  3ZW3 A;  1QIL A;  3QQ8 B;  2OJW A;  3NUH B;  2KTR A;  1JWU D;  2AL6 A;  2JZ3 B;  1D5Z C;  3RNC C;  2DHZ A;  1TKG A;  5AUI A;  2D5G A;  2KDF B;  3P2B A;  3RMK C;  1WX8 A;  3R66 C;  2PLP A;  3KYC D;  4HJK A;  3AN1 A;  2M4N A;  1ET9 A;  4PYZ A;  3P4S B;  3A9K B;  4WJO A;  3AU4 A;  1T6B X;  5H92 C;  2INC C;  3V6C B;  3V61 A;  2DZI A;  3E56 A;  1KLG D;  3NVY A;  1EM7 A;  3RUI B;  4P6V F;  4TSS A;  2IY0 B;  4K7W A;  4GGQ A;  2LXC A;  5EE1 A;  3OLM D;  5GXG B;  5E6N A;  2EKI A;  1KFY B;  2RR9 A;  3ECI A;  2FBW B;  2NPT B;  3L0W B;  4DHZ B;  2R2O A;  1IBX B;  5FK9 C;  3L10 B;  3C0R B;  3IT4 B;  3NZS A;  1AYF A;  1WM3 A;  2FUH B;  2REX A;  3M3J A;  2AX5 A;  2ZW0 A;  3DVN V;  4N58 A;  5DPR A;  1TT5 B;  4WQM A;  1NYQ A;  1AW7 A;  3AI5 A;  3KUZ A;  1QZE A;  1NEK B;  3BK1 A;  1G6J A;  2KNB A;  1E8Y A;  4KV2 A;  5BMG A;  3VUY A;  2BWF A;  1GAQ B;  3ALB A;  3DVG X;  4ASW C;  2ASQ A;  3T9L A;  4R3D A;  3GZN B;  2JXX A;  4KGR A;  2KWV B;  4OZB A;  4KKJ A;  1XLO A;  1FPY A;  1ZOY B;  2WQY B;  2MP2 A;  3VTV A;  2N7D A;  4AP4 C;  1V97 A;  1IGD A;  2YEP B;  2IY1 B;  1VD2 A;  3L17 A;  4EKU A;  5LLI A;  4CQN A;  4UDU C;  1IUE A;  4FUL A;  2V4I B;  1XCT L;  3PS6 A;  4MT5 A;  1MI0 A;  4M0W B;  3NJT A;  4A9A A;  2XN9 C;  2QC8 A;  1FM0 D;  2GMI C;  4KZC A;  1DYQ A;  2FCS A;  3P1M A;  4NJ7 A;  4XX5 A;  3IVF A;  2RDG A;  2AQ3 B;  2WXL A;  1E6E B;  1L0V B;  4IM2 A;  1VJK A;  2DWQ A;  2HTH A;  1WMH B;  5IO9 A;  2NMQ A;  2BBC A;  1ACC A;  3DBS A;  2BB5 A;  1N62 A;  2FCM A;  2L00 B;  1V1P B;  1H8C A;  5LXH A;  3MP9 A;  2KLC A;  1XEE A;  2N7E A;  1GPX A;  4RGM A;  4IM3 A;  2JF5 A;  1HTQ A;  1LGR A;  4IOI E;  4AQ7 A;  1XF5 L;  4BFR A;  3DVG Y;  1Q10 A;  1YQ4 B;  4E71 A;  2D2Q A;  1HZ5 A;  1WX9 A;  3ZNI D;  3AM9 A;  2QCZ A;  2K0P A;  2KWC A;  5I4D A;  4PYU A;  1V2Y A;  4PT5 A;  4IG7 B;  5IA7 A;  2MX2 A;  3N3K B;  1AN8 A;  3VRA B;  2EEL A;  2KMC A;  2JYE A;  4NAW A;  2IO1 B;  3NVW A;  3QAR A;  2HTM E;  1WGH A;  1V1P A;  2EMS A;  3SFD B;  3W5V B;  4P1B C;  1E5W A;  3A4R A;  4FXC A;  4JQW C;  2BKF A;  3APF A;  4W9D A;  2N4F A;  2DZK A;  4DBG A;  2O2V B;  3EA6 A;  3QK0 A;  4WWO A;  3AUL A;  4HXD A;  1KRH A;  3I63 C;  2ZPN A;  1L6U A;  1I4X A;  4XC2 A;  4I6L B;  4L1B A;  1PUT A;  3LXF A;  3K9O B;  4RCO A;  3VVW B;  1ZKH A;  2G4S A;  1K52 A;  3CST A;  2BS3 B;  3IAM 1;  4KIK B;  1P1A A;  4G11 A;  3DBL I;  1HA5 A;  1WGR A;  2DYO A;  3B9J A;  4AOF A;  3TUO A;  1WJ6 A;  4ZOH C;  3PGE A;  2CR5 A;  2O2V A;  1I4Q A;  2K3U A;  3T3O A;  2GBN A;  1M94 A;  2KFK A;  5IP4 D;  1C78 A;  4CHK A;  3DBR I;  3P4P B;  3N1X C;  4EFO A;  3L08 A;  5J17 A;  5D6J B;  3TEZ A;  1FNV A;  4JWU C;  5G5G A;  3I9V 1;  2KXJ A;  2WDQ B;  1GB1 A;  4OZA A;  3ZXV A;  3GP7 A;  4NPN A;  4FA6 A;  1MHX A;  1I4P A;  5CHF A;  2KVZ A;  3H7P A;  3QAQ A;  2EMT A;  4B95 A;  4C4V B;  1D5M C;  2KZR A;  2WX0 A;  4LNI A;  1OEY A;  4XDC A;  2C7N B;  4YTP B;  3RD2 A;  3JYU A;  4WH4 A;  3CIR B;  3NZ3 A;  4EZJ A;  2K39 A;  2D3C A;  2LXA A;  2MP2 B;  2WXK A;  3U7D A;  2KJR A;  5HKH A;  2JX5 A;  1EU4 A;  3H6N A;  2KK8 A;  4A90 A;  3Q8A A;  3RNB C;  3ZKJ C;  4A20 A;  2L3Z A;  2WHI A;  3N9Y C;  2WXP A;  2Y5C A;  3W1S C;  3ABV B;  2WYQ A;  1QT9 A;  3QHT A;  3RYT A;  2BF8 B;  3L54 A;  3ML8 A;  2OOB B;  4Q2J A;  3ZLZ A;  1UGM A;  1UGJ A;  2ZW1 A;  3RFZ B;  2FNJ B;  2KQS A;  1MG4 A;  4A8X C;  1WJU A;  1OFF A;  4RMA A;  1ZDX A;  3M62 B;  2N9P C;  1GC7 A;  2JUO A;  4URK A;  3EFU A;  1EF5 A;  2CU1 A;  1KF6 B;  1L4Z B;  1DOI A;  2VZK B;  4XGA B;  1C4P A;  2N7J A;  2ZZP B;  5D2M B;  4OVV A;  3X23 A;  2IGH A;  1EWC A;  1D4B A;  4AS1 A;  1TGZ B;  2MBH A;  1E8Z A;  3URY A;  2L05 A;  1YD8 U;  2LRW A;  2A4Z A;  3JSV A;  4S0R A;  4ZRJ A;  2KWD A;  1YJI A;  1SIJ A;  2Z0D B;  5BO4 B;  2WXH A;  3SEB A;  2WXQ A;  5C2T B;  1GC6 A;  3AED B;  3MFG A;  1JAL A;  2K8B A;  4KZ0 A;  3WCQ A;  5MPO A;  1WX7 A;  1LM8 B;  3CWI A;  2NBV B;  1E7P B;  3GE3 C;  4DWF A;  5AEK B;  1T5X D;  4GDL A;  2UU7 A;  4ARI A;  4IDI A;  2WWZ A;  2KHW B;  1YN5 A;  2BKR B;  1SIF A;  4F1S A;  3TJP A;  1MHH E;  3ZNZ B;  2MJE A;  2LVQ A;  3AEA B;  3MHZ A;  2J4X A;  2N0S B;  5HFY A;  3GS2 A;  4L23 A;  2BQQ A;  5DPW A;  4ZRI A;  3W2D A;  5HHD G;  4TV3 A;  2K9X A;  2PE9 A;  3I5J C;  4MSQ B;  1IGC A;  4KDL B;  3VR8 B;  4IW0 A;  5HI1 A;  4E3C A;  4HRO A;  4ZYS A;  2LJ5 A;  3L16 A;  2PKO A;  2E3T A;  4GDL B;  3ZRF A;  1RLF A;  1V86 A;  4LNO A;  4PK1 A;  4CYE A;  3DOW A;  4IWO A;  3A9J B;  4D2K A;  2N1W A;  4ANW A;  1XQQ A;  5BMI A;  1E7V A;  3S2A A;  3Q3J A;  3ZTD A;  2VRR B;  3NG0 A;  4RH6 A;  3DCG A;  4YSX B;  2K22 A;  4TQ0 A;  3AEF B;  1XLN A;  1WM2 A;  2YLM A;  2LJI A;  5L83 A;  2ZEQ A;  2NVU I;  2MJ3 A;  4HWI B;  4IUM B;  2OED A;  2SEB D;  1CJE A;  4ZYN A;  4HDO A;  3OG5 A;  1C1Y B;  3BVG A;  2BGF A;  4NZL B;  4MGZ E;  3ZTC A;  3A4S C;  3VRB B;  2WDV B;  3KVF B;  4KGS A;  2XEW A;  2DYB A;  3DDC B;  4XDD A;  3DPD A;  4XE0 A;  1SF0 A;  1ESF A;  1V9J A;  2FIF A;  1C9F A;  4KKI A;  1WMH A;  4G50 A;  2WGS A;  5JHA A;  1HQR D;  2JWU A;  3JVZ X;  3NS1 A;  1ENF A;  5E6P A;  3SHQ A;  3EGR A;  2KQ7 A;  1KOT A;  1PGX A;  3NHE B;  3B2G A;  3EUB 2;  1TS2 A;  2QIE B;  3R3M A;  1VR9 A;  1E9M A;  3PRP B;  2LUE A;  3W1S A;  1K53 A;  2LGS A;  2RD0 A;  1JQ4 A;  1JWB D;  3UQA A;  2KX0 A;  1WIA A;  2G45 B;  1WE6 A;  5IKC M;  3BII D;  5D3I B;  2CHZ A;  2L76 A;  3A1Q B;  4HK2 A;  1YQ3 B;  3TL5 A;  4M8M A;  2IO3 B;  2KWU B;  2M0A A;  3BVZ A;  3HHM A;  3K9P B;  5H8Y E;  2G9H D;  1MG8 A;  4HLE A;  3HK0 A;  3R7R A;  2GB1 A;  2K5P A;  2MLB A;  2KO3 A;  4M01 A;  4HCN B;  1FMA D;  2VH1 A;  3R8B A;  3WIM A;  3WAO A;  3V05 A;  2PPH A;  1TYG B;  1L2N A;  3Q3O C;  2QEJ C;  3SU8 X;  2MWS B;  3BK2 A;  1CK1 A;  3PRM B;  2N9X A;  4DHJ B;  1UNS A;  1WGG A;  3M63 B;  3H7S A;  4GMV A;  1IBX A;  2MJD A;  1TS4 A;  4NQK E;  4ARC A;  4DXF A;  1YX5 B;  4DK5 A;  4EUT A;  2HJ1 A;  1KLV A;  1YQB A;  4EOY A;  1FXI A;  2B3A A;  2GRI A;  1PYW D;  2K1F A;  3T3N A;  2IYD B;  2CJO A;  4DHJ D;  2WNM A;  3GZN I;  4MAC A;  2WS3 B;  1I42 A;  3VQI A;  4K81 A;  3N32 A;  3BY4 B;  3MHS D;  4NJC A;  4RF1 A;  3SD5 A;  1MVK A;  1EU3 A;  2E6X A;  2KMA A;  2WXO A;  2D11 A;  3TSS A;  1CQV A;  4XWT A;  2WXI A;  1C77 A;  3GB1 A;  2XK5 A;  3KLS X;  4ICU A;  1XO3 A;  1TKY A;  2JU6 X;  3P63 A;  1T0Y A;  1GNU A;  4W9K A;  3HVD A;  3APC A;  2G3Q B;  4C7Z A;  1FCC C;  3DWG C;  3VAW A;  3ZVV A;  2M0X A;  2IDY A;  4REZ A;  1Y56 A;  3J9C A;  1FEH A;  3PRZ A;  4IWP A;  3UIN B;  1JRP A;  3BWU D;  2C7M B;  3ZGZ A;  3OAW A;  1SGH A;  1VCB A;  1CZP A;  1N61 A;  1HE8 A;  2J42 A;  1BT0 A;  4A6Q A;  2ZVO A;  1UWX A;  1OEY J;  1TIF A;  2FID A;  4EEW A;  4MJS A;  1LO5 D;  2PJH A;  3ML9 A;  4JWS C;  1ZW7 A;  3BYT B;  4ITK A;  2JRI B;  4MGY E;  1EF1 A;  2FCQ A;  4XZ4 A;  1S3S G;  1F1H A;  4ACF A;  1MFW A;  1ZXI A;  2IO0 B;  2PVO D;  5CHV C;  1QQR A;  4GDK B;  3KW5 B;  2AWT A;  2KT7 A;  3W9C B;  1YX6 B;  3VFK A;  2DNF A;  3FIL B;  1L5P A;  1WRD B;  1WYW B;  1K8R B;  2TSS A;  4GU2 A;  2KYW A;  4EZL A;  2H89 B;  5DPS A;  3PHW B;  4KX6 B;  1STE A;  3AEB B;  1IYF A;  1XT9 B;  4II3 B;  3DWM A;  3UF8 A;  3O65 B;  3KUC B;  3A1Q A;  2KC1 A;  1B1Z A;  2G4D B;  3HVZ A;  4KDI C;  4MM3 B;  1KLU D;  3P4Q B;  2L1A A;  3AXC A;  1WZ0 A;  3MJ5 A;  1OQR A;  2IBI B;  3ZNH B;  3RZW C;  4C80 A;  1T3Q A;  3HM3 A;  2CHW A;  4WJP A;  2KOX A;  2V1Y A;  2AEH A;  3PHX B;  3VH4 B;  2L8J A;  4HKQ A;  4W9H A;  3PRE A;  4ICV A;  1R4N I;  2Q5W D;  1TKE A;  1LXD A;  2DAF A;  2LGX A;  1FXT B;  2N9E B;  3DBR B;  1PQS A;  2BS4 B;  4OVU A;  5GMV A;  2QIL A;  3T8M A;  3DVN U;  1K50 A;  1FCL A;  5JZE B;  4TQ1 A;  2ZJD A;  1LFD A;  1V8C A;  2NBU A;  1SB3 C;  3Q3M C;  4YSZ B;  1ZGU B;  2YEP F;  4HPL B;  1NEN B;  1RRB A;  3IFW B;  3N1Y C;  1J0G A;  4LJP B;  1UBQ A;  4ANU A;  1WGK A;  2RGF A;  4MDK E;  2H88 B;  2ZCB A;  1XCQ L;  3A9J A;  2OHF A;  2K6D B;  2LHD A;  3W1Y A;  2KC2 A;  1A70 A;  3ZQ4 A;  5BYS A;  2V0G A;  1WF9 A;  4FJZ A;  1P7F A;  1WXM A;  2PW9 A;  5CTR C;  4DHZ E;  2Z59 B;  3SFE B;  1Q5W B;  2PVG C;  4JL9 A;  5HG2 A;  2ZVN A;  2LAS A;  3ZRC A;  1F52 A;  5JH5 C;  1QLB B;  1H4R A;  4FN2 A;  2GLS A;  2K8C A;  4WIP A;  3ENE A;  4MSM B;  1K51 A;  5LXI B;  2M56 B;  3ETR A;  2Z0E B;  4W9G A;  2LWP A;  3VUW A;  1PDX A;  1VZ8 A;  3RCZ A;  4A55 A;  4WWM A;  2L52 A;  3HM6 X;  1WGY A;  1UD7 A;  4TMA B;  3PSE B;  3L4P A;  2NR2 A;  4FLH A;  2WXN A;  2BYV E;  1QKZ A;  4S17 A;  3PVL A;  3BVM A;  4XWW A;  4G3X B;  1L6V A;  2O6V D;  4NAW B;  1L0Y B;  2UYZ B;  5AUK A;  5LNK 1;  3O13 A;  1IPG A;  1N6Z A;  2K6Q A;  3DBH B;  4LDT D;  2JY6 A;  3Q3N C;  1V5T A;  4TUU A;  1CMX B;  2J0J A;  2IND C;  4GB9 A;  1I4R A;  2ON8 A;  2KKC A;  4M02 A;  2INP E;  3Q2A C;  5CX3 A;  3EHV A;  2DAJ A;  2LRU A;  1SJH D;  3RI7 C;  1FFU A;  2D07 B;  3AE6 B;  4HJG E;  4USA A;  4FHJ A;  4US8 A;  3WAN A;  2ZCC A;  2LZ6 A;  3DBL B;  2MBQ A;  4RF0 A;  4LNK A;  2JWZ A;  3BIN A;  2GBR A;  2MQJ A;  3SR6 A;  2L83 A;  3SDL C;  1E90 A;  4HVB A;  1B9R A;  4FAD A;  3KQ4 A;  2JXT A;  1ISN A;  3V6E B;  1WYG A;  3IHP C;  2WU5 B;  3HRD D;  2WXG A;  4YSY B;  3U4E G;  3FKY A;  1FO4 A;  1C79 A;  5AZH A;  2UWQ A;  4PS7 A;  5G55 A;  1NVI D;  1P3Q U;  2HJ8 A;  1TZO A;  4KSL C;  1PFD A;  4B0M A;  4GLS C;  1WXV A;  2W3S A;  3U7Z A;  1P7E A;  3Q69 A;  2W3R A;  4EZK A;  4NNJ B;  1WY8 A;  2HE7 A;  2M1M A;  2D10 A;  3EFC A;  3U30 A;  2ZPY A;  5IAA C;  1AWD A;  3QX1 A;  1WXS A;  2PTL A;  3RNF C;  3W5U B;  2KAC A;  4A3P A;  1MPE A;  3H9D A;  4BOS C;  2I38 A;  2LGD A;  1GG3 A;  2LHE A;  1KH0 A;  3U8Z A;  4BKS D;  2LEK A;  2QHO A;  2J0K A;  4YTN B;  2IPK D;  4I6P A;  1TS3 A;  1E8W A;  2N9L A;  4BOZ B;  1EO6 A;  1JML A;  4GIV A;  2WLB A;  2ACZ B;  2JZZ A;  2LD9 A;  3Q8B A;  1F9J A;  3PZD A;  1ZP0 B;  2VH2 A;  3L13 A;  1C4C A;  2WXF A;  4B6W A;  4P7I A;  4KGT A;  2KDI A;  3AEE B;  1J7B A;  4WAA A;  1VZ6 A;  4KSK C;  4RFB A;  3NZU A;  3AH7 A;  4IC7 B;  2KFJ A;  2MSE D;  1NYR A;  2KDM A;  5EE0 A;  4CO7 A;  1JRU A;  1IP9 A;  4BKS A;  3LDZ E;  3ZYY X;  4PS8 A;  1YMH E;  1DOY A;  3A9K A;  2IGD A;  2KAN A;  3APD A;  1OQQ A;  4IM0 A;  2KJH B;  1S1Q B;  2KQ4 X;  2QDF A;  3ZO5 B;  1UH6 A;  2BT6 A;  3PZ8 A;  2MHJ A;  3AMZ A;  3B0A A;  4TKN A;  4F8C B;  3PO0 A;  4LCD E;  2NPT A;  1KJT A;  2MBE A;  3TCA A;  1L0X B;  1WXA A;  4BBN F;  3AB5 A;  3AE9 B;  2J7Q B;  1VLB A;  2DLB A;  3MJW A;  1J8C A;  4NY0 A;  1XLQ A;  1T0S C;  2BWE S;  1T0Q C;  2GBJ A;  2MRP A;  1UZX B;  3WAL A;  3MC8 A;  4ANX A;  3PTF C;  4ZDV A;  1JWS D;  2KN5 A;  3TBL D;  2VZK D;  3TEW A;  1HTO A;  1V49 A;  2LFI A;  1NBF C;  5AZF A;  1SSN A;  3H8H A;  1QOB A;  1RFA A;  2ZNV C;  1WJN A;  2QJL A;  5FR6 A;  3Q8C A;  1U4A A;  1A5R A;  3QA8 A;  1V80 A;  2RDB C;  4HPP A;  1QOG A;  3NS8 A;  2AL3 A;  3PPA A;  1WJ4 A;  2Y5P A;  2BYT A;  2M19 A;  4LLG M;  3Q8E A;  5FR3 A;  4EE2 A;  3Q3F A;  1DGJ A;  3NVZ A;  5D3D A;  1WGD A;  2J53 A;  4KVG B;  2DX5 B;  1NI2 A;  3AE8 B;  5DCN A;  2NS5 A;  1FXA A;  2C9W B;  2QSD A;  2M8S A;  3RN9 C;  3CF6 E;  2INN E;  4FJV B;  5C3J B;  3PLU A;  1VDV A;  4K3B A;  1SBB B;  1SE4 A;  1V81 A;  1RYJ A;  2NCN A;  2KJ6 A;  4G0N B;  4MGK E;  2BYE A;  4W9L A;  3HUI A;  1UWM A;  1M4V A;  1GJZ A;  3RUL A;  2MBO A;  5C1Z A;  1J7A A;  1N60 A;  4FBJ B;  4WJN A;  1C3T A;  4JLC A;  3AE5 B;  3KUD B;  4LDT B;  2J0M A;  3DQV A;  1GUA B;  1I7H A;  2KTR B;  2WXM A;  1P98 A;  4C7Y A;  1E7U A;  2Z8L A;  5CHW A;  2OJR A;  4MH0 E;  2XNA C;  2J52 A;  3P42 A;  2CKH B;  1UEL A;  2IGG A;  2L0F A;  1F0Z A;  4YXD B;  2KN4 A;  1X1M A;  4M00 A;  4DQO C;  3FAH A;  3AE3 B;  1E0Z A;  1P9D U;  4RGT A;  1ZDV A;  2V3P A;  3LB8 C;  3RT3 B;  1Y8R C;  1D6E C;  4LNF A;  1HEZ E;  1PGB A;  1WWT A;  1WH3 A;  2RPQ A;  3RNE C;  1TJE A;  3HIZ A;  4KIK A;  5EE3 A;  3DHI C;  1UF0 A;  2RSU A;  1ET6 A;  4C56 C;  3FIL A;  1C4A A;  4JGH B;  2I1K A;  3AEG B;  3KH0 A;  1EWY C;  1WR6 E;  2DZJ A;  2WU2 B;  2JRH A;  1FD6 A;  2I1J A;  4LK0 M;  3RNG C;  4NQL B;  1VRA B;  2L0T A;  4MGI E;  2MCN B;  2KAJ A;  3VR9 B;  3AE7 B;  1I35 A;  3ZIM A;  3IAS 1;  2V3N A;  1R7S A;  2D3A A;  4RM8 A;  1RWS A;  4HRS A;  5T8I A;  3N30 A;  4I6N B;  1NI3 A;  4N9F 4;  1HZ6 A;  4LNN A;  4OHJ A;  3E9S A;  1D3Z A;  3U2S C;  4OW0 A;  2W54 A;  4II2 B;  3ZXR A;  4HPM B;  3Q8F A;  4C4V A;  1PGA A;  3ZNG C;  2LGY A;  4J3O D;  5IN7 A;  1WXQ A;  4N59 A;  4L2Y A;  2L7R A;  3KWL A;  1Q0W B;  2KLG A;  4W9E A;  3QCA A;  2A5U A;  4MEM A;  2LVP A;  3AE2 B;  4K7S A;  4YT0 B;  2JPH A;  5E6O A;  3H1U A;  1Z5S B;  4HKZ E;  3VTU A;  4W9F A;  2NTT A;  2FAZ A;  3CMM B;  4NAM A;  5JHB A;  3PZ7 A;  4DXG A;  3NOB A;  2IO2 B;  3QIJ A;  5E6J A;  2XK5 B;  3IBE A;  1SXT A;  1FRR A;  1YJ1 A;  1UUP A;  3RPF C;  4GOC A;  1YOV B;  1D5X C;  2PMV A;  4HDQ A;  2B76 B;  2MA9 B;  1XLP A;  2V3S A;  2WDR B;  4JPS A;  4WAF A;  2JQR B;  3AV8 A;  1OTR B;  1ZPS A;  3N20 C;  4GXB A;  4QAY A;  1WZ3 A;  2RPV A;  4K1R B;  3R2T A;  3GE8 C;  2MBB B;  2QMT A;  2IJ0 A;  4H2A A;  3RNA C;  1QF6 A;  1OQY A;  1R4M B;  3TEY A;  1SEB D;  1TZ1 A;  2KDE B;  2PIA A;  2KDB A;  1WFY A;  3P4R B;  3MC9 A;  2CHX A;  2CS4 A;  4BKT A;  1I4G A;  1WI0 A;  2R2Q A;  1JRO A;  2N9K A;  4O1N A;  5J2R A;  1V1O A;  4YWG G;  4BKG A;  3BYY B;  3I57 A;  4FHK A;  1J19 A;  1XXG A;  2BB6 A;  2ZNV B;  2KD0 A;  3GOE A;  4K3C A;  4B0E A;  4K7U A;  4AUQ C;  1YN4 A;  2AYO B;  2M17 A;  2W55 A;  2WDT B;  4RGO S;  1T0R C;  4B9K A;  2FUG 1;  1P0R A;  3NVV A;  3TIX A;  2JVC A;  4HCP B;  3V3X A;  1YIW A;  2NTS A;  5BYR A;  4ZRP A;  1F2R I;  1JCK B;  2GBK A;  1RAX A;  3DBH I;  4JE3 B;  1QOA A;  2Y5B B;  2D3G A;  2RDH A;  4ZHO A;  4ANV A;  2WX1 A;  1FRD A;  2XBB C;  3LJ3 A;  1Q1O A;  1KM7 A;  2X8X X;  2LI5 A;  4OZC A;  1WR1 A;  1N5X A;  4W9J A;  2I2Y A;  3VHT C;  5FKA C;  2Y3A A;  5EDS A;  3RZF A;  1EUV B;  4NJ6 A;  5JXV A;  4BAX A;  2JSV X;  3UI3 A;  3V60 A;  3N1Z C;  3AEC B;  3X0W A;  1VZ7 A;  3KYD D;  2YVC A;  2GI9 A;  1BML C;  2N1V A;  1R4N B;  2PEA A;  2KTF A;  5D94 A;  2BS2 B;  4RM9 A;  1SE3 A;  2G1E A;  2DEN B;  1LQB A;  1YJJ A;  2WXR A;  3MC0 B;  1SE2 A;  4N6E B;  3I3T B;  1TTN A;  4ZRK A;  1UBI A;  3EEC A;  2FE8 A;  1FIQ A;  5IOI A;  3R7Q A;  1RFK A;  4US9 A;  3Q14 C;  2CU3 A;  4MH8 A;  1JWM D;  3QC8 B;  3UIP B; 
#chains in the Genus database with same CATH homology
 4RCO A;  3PO0 A;  3KLS X;  1XO3 A;  1TKY A;  2JU6 X;  3P63 A;  3ZJU A;  3U52 E;  1TY2 A;  1K52 A;  1L0X B;  3HVD A;  5TSS A;  3TEX A;  4C7Z A;  3AB5 A;  3AE9 B;  1TY0 A;  1FCC C;  2BS3 B;  1VLB A;  3DWG C;  3IAM 1;  2DLB A;  1KTK A;  2IDY A;  4REZ A;  1HA5 A;  1XLQ A;  1Y56 A;  3J9C A;  1FEH A;  1ZUD 2;  3IXS A;  2W82 A;  2CJN A;  2DYO A;  3B9J A;  3TUO A;  4ZOH C;  1JRP A;  1QOF A;  4IKG A;  3BWU D;  1I4Q A;  2R61 A;  1JWS D;  2K3U A;  3T3O A;  3ZGZ A;  1CZP A;  1N61 A;  1C78 A;  2VZK D;  3TEW A;  5D7G A;  2LFI A;  2J42 A;  3AE1 B;  4A6Q A;  1UWX A;  3P4P B;  1SSN A;  3H8H A;  3C8Y A;  1QOB A;  3TEZ A;  4RGN A;  1LO5 D;  2RMM A;  1FNV A;  4JWU C;  5G5G A;  2QJL A;  4JWS C;  3I9V 1;  2WDQ B;  1GB1 A;  3BYT B;  4ITK A;  4OZA A;  3Q8C A;  1FNU A;  3GP7 A;  1F77 A;  4WUR A;  3OWE B;  2WXJ A;  2LUM A;  1MHX A;  1I4P A;  1ZXI A;  2PVO D;  1QOG A;  1QQR A;  1C76 A;  4GDK B;  1J7C A;  2Y5P A;  1D5M C;  3B2F A;  2BYT A;  3W9C B;  2M19 A;  4LLG M;  4XDC A;  3Q8E A;  5FR3 A;  4EE2 A;  4YTP B;  2BTE A;  1DGJ A;  3NVZ A;  4WH4 A;  1ZXH A;  3FIL B;  5D3D A;  3CIR B;  3NZ3 A;  4ZRQ A;  2J53 A;  1L5P A;  2WXK A;  2TSS A;  3AE8 B;  3FC4 A;  2JX5 A;  1EU4 A;  2H89 B;  4A90 A;  1FXA A;  1JWA D;  3Q8A A;  2QSD A;  1WSP A;  4P16 A;  2LMC A;  2INN E;  1RM6 C;  5C3J B;  3N9Y C;  2WXP A;  1STE A;  3AE4 B;  4KX6 B;  2Y5C A;  1VDV A;  3ABV B;  3AEB B;  4YTM B;  2AQ1 B;  1SBB B;  1QT9 A;  1SE4 A;  2HDE A;  2DBY A;  1RYJ A;  3DWM A;  3R2I A;  4JX1 C;  2BW2 A;  2L32 A;  3HUI A;  1UWM A;  4Q2J A;  4HEA 1;  1N5W A;  1M4V A;  1B1Z A;  5BMH A;  3HVZ A;  4MM3 B;  1KLU D;  1UGJ A;  2ZW1 A;  3P4Q B;  1J7A A;  1N60 A;  2L1A A;  3MJ5 A;  1OQR A;  3RFZ B;  2DYM A;  2KMM A;  4C80 A;  1T3Q A;  4A8X C;  1GOZ A;  1OFF A;  2MEK A;  3LYY A;  3AE5 B;  1GB4 A;  1ZE3 D;  1YNT E;  1ZDX A;  2X38 A;  1TS5 A;  4HKQ A;  1I7H A;  2WXM A;  4C7Y A;  2Q5W D;  1TKE A;  2Z8L A;  2XNA C;  2J52 A;  1FFV A;  1KF6 B;  4LTU A;  1L4Z B;  1DOI A;  3P42 A;  2VZK B;  1ROE A;  4M0W A;  1C4P A;  2BS4 B;  2N7J A;  2IGG A;  5BYQ A;  1F0Z A;  2IGH A;  2QIL A;  1EWC A;  4YXD B;  1D4B A;  5EE9 A;  1I4H A;  1L4D B;  2KN4 A;  4AS1 A;  1K50 A;  3IT6 B;  1FCL A;  4TQ1 A;  2AQ2 B;  1V8C A;  4DQO C;  1SB3 C;  1SJE D;  3URY A;  4YSZ B;  3FAH A;  3AE3 B;  1E0Z A;  2YEP F;  1FNW A;  4RGT A;  1NEN B;  1ZDV A;  3ZJT A;  2V3P A;  1E10 A;  2KWD A;  3LB8 C;  3ZJV A;  1WGK A;  4ZHP A;  1YJI A;  1D6E C;  1SIJ A;  2H88 B;  1XCQ L;  2WXH A;  2ONQ A;  1HEZ E;  3SEB A;  1PGB A;  2OHF A;  2SAK A;  2WXQ A;  2LGI A;  4RNA A;  1WWT A;  2LHD A;  5C2T B;  3AED B;  1A70 A;  2WP9 B;  3ZQ4 A;  5BYS A;  2V0G A;  3MFG A;  1JAL A;  1TJE A;  5EE3 A;  2JZP A;  1P7F A;  3WCQ A;  5G5H A;  5MPO A;  2PW9 A;  1F2R C;  3CWI A;  1ET6 A;  4C56 C;  3FIL A;  1DOX A;  1E7P B;  1C4A A;  3AEG B;  1HXY D;  1EWY C;  1T5X D;  3SFE B;  1BXT A;  2PVG C;  2WU2 B;  1FD6 A;  1N63 A;  1YN3 A;  3NRZ A;  5HG2 A;  2MH7 A;  3BZD B;  4LK0 M;  4ARI A;  2JYT A;  1VRA B;  4IDI A;  2ICI A;  1QLB B;  1YN5 A;  2KAJ A;  3VR9 B;  1MHH E;  3AE7 B;  3KWV A;  2MJE A;  3IAS 1;  4OVZ A;  1WRI A;  2V3N A;  3AEA B;  3MHZ A;  2J4X A;  4WIP A;  1BUI C;  1R7S A;  2N0S B;  1K51 A;  5HFY A;  2M56 B;  3ETR A;  3GS2 A;  4L23 A;  1RWS A;  4HRS A;  1JW9 D;  5T8I A;  5HHD G;  1QIL A;  3W2D A;  2K9X A;  1NI3 A;  1PDX A;  1VZ8 A;  4A55 A;  3NUH B;  1HZ6 A;  1IGC A;  2L52 A;  4WWM A;  3VR8 B;  5HI1 A;  1JWU D;  4OHJ A;  3E9S A;  1D5Z C;  4OW0 A;  2W54 A;  4HRO A;  3U2S C;  4ZYS A;  2PKO A;  3Q8F A;  4TMA B;  1PGA A;  1TKG A;  2E3T A;  4GDL B;  5AUI A;  4J3O D;  1WXQ A;  2D5G A;  3L4P A;  2PLP A;  2WXN A;  4D2K A;  1QKZ A;  4N59 A;  4L2Y A;  3BVM A;  3AN1 A;  4XWW A;  1L6V A;  1ET9 A;  4NAW B;  1L0Y B;  3KWL A;  5BMI A;  3P4S B;  5AUK A;  5LNK 1;  3O13 A;  4YT0 B;  1T6B X;  3AE2 B;  4RH6 A;  5H92 C;  4HKZ E;  2K22 A;  4YSX B;  4TQ0 A;  3AEF B;  1XLN A;  1KLG D;  3E56 A;  3NVY A;  1EM7 A;  2NTT A;  4NAM A;  2LJI A;  2MJ3 A;  4P6V F;  4TSS A;  3PZ7 A;  4DXG A;  1I4R A;  2ON8 A;  2OED A;  5EE1 A;  2INP E;  5GXG B;  5E6J A;  2SEB D;  1CJE A;  2EKI A;  1KFY B;  1SXT A;  1FRR A;  1UUP A;  3RPF C;  2FBW B;  1SJH D;  3BVG A;  1FFU A;  4NZL B;  3AE6 B;  4HJG E;  4USA A;  1IBX B;  5FK9 C;  1D5X C;  2PMV A;  3VRB B;  2B76 B;  4US8 A;  1XLP A;  2WDV B;  4KGS A;  3IT4 B;  2WDR B;  1AYF A;  4JPS A;  4WAF A;  2JQR B;  4XDD A;  3AV8 A;  2AX5 A;  2ZW0 A;  4N58 A;  4RF0 A;  1ZPS A;  4XE0 A;  1SF0 A;  2RPV A;  4WQM A;  3SR6 A;  1NYQ A;  2L83 A;  1ESF A;  3R2T A;  1B9R A;  1C9F A;  4KKI A;  1AW7 A;  3KQ4 A;  2JXT A;  2QMT A;  1WYG A;  1NEK B;  3BK1 A;  2IJ0 A;  4H2A A;  2WU5 B;  3HRD D;  2WXG A;  5BMG A;  4YSY B;  3U4E G;  1HQR D;  1QF6 A;  1GAQ B;  1FO4 A;  1C79 A;  2JWU A;  3TEY A;  1SEB D;  3NS1 A;  2PIA A;  1NVI D;  3P4R B;  1ENF A;  4R3D A;  1TZO A;  4KGR A;  1I4G A;  4OZB A;  4KKJ A;  1JRO A;  1XLO A;  2N9K A;  1PFD A;  1ZOY B;  2WQY B;  3EGR A;  4O1N A;  4B0M A;  4GLS C;  1PGX A;  1V1O A;  4YWG G;  2W3S A;  3B2G A;  3EUB 2;  1V97 A;  1TS2 A;  1IGD A;  2YEP B;  3BYY B;  3I57 A;  2QIE B;  1XXG A;  3U7Z A;  1P7E A;  2BB6 A;  1VR9 A;  2W3R A;  3Q69 A;  4B0E A;  1E9M A;  3W1S A;  4CQN A;  1IUE A;  1K53 A;  4UDU C;  2V4I B;  1YN4 A;  2W55 A;  1JQ4 A;  1JWB D;  4RGO S;  1XCT L;  2FUG 1;  3BII D;  3NVV A;  5D3I B;  4MT5 A;  1MI0 A;  1YQ3 B;  3V3X A;  4A9A A;  2M0A A;  2NTS A;  1AWD A;  3BVZ A;  2XN9 C;  5H8Y E;  2G9H D;  5BYR A;  1FM0 D;  4ZRP A;  1F2R I;  1JCK B;  2PTL A;  1DYQ A;  4JE3 B;  3P1M A;  1QOA A;  2GB1 A;  2K5P A;  2RDH A;  4ZHO A;  3W5U B;  2KAC A;  1FRD A;  1MPE A;  2RDG A;  2AQ3 B;  2WXL A;  2I38 A;  1E6E B;  1FMA D;  1L0V B;  3R8B A;  3V05 A;  1VJK A;  1TYG B;  2LHE A;  2DWQ A;  1KH0 A;  4OZC A;  2LEK A;  2NMQ A;  2BBC A;  4YTN B;  2IPK D;  1N5X A;  2QEJ C;  1ACC A;  1TS3 A;  3BK2 A;  1CK1 A;  2BB5 A;  1N62 A;  2N9L A;  2I2Y A;  1V1P B;  1JML A;  1UNS A;  5FKA C;  2WLB A;  2ACZ B;  2Y3A A;  1IBX A;  2MJD A;  3MP9 A;  1TS4 A;  1XEE A;  1GPX A;  4RGM A;  4ARC A;  4DXF A;  3Q8B A;  4IOI E;  4AQ7 A;  1XF5 L;  5JXV A;  1ZP0 B;  2JSV X;  1Q10 A;  3UI3 A;  1YQ4 B;  1C4C A;  2WXF A;  1HZ5 A;  3AEC B;  4KGT A;  1FXI A;  3AM9 A;  3AEE B;  2K0P A;  1J7B A;  1VZ7 A;  5I4D A;  1VZ6 A;  4PT5 A;  2GRI A;  4RFB A;  2GI9 A;  1PYW D;  1BML C;  3AH7 A;  3T3N A;  1AN8 A;  3VRA B;  2EEL A;  2JYE A;  1NYR A;  2CJO A;  2KDM A;  2WNM A;  2BS2 B;  3NVW A;  5EE0 A;  1SE3 A;  2G1E A;  1YJJ A;  2WXR A;  2HTM E;  3MC0 B;  1V1P A;  1SE2 A;  4N6E B;  4MAC A;  3SFD B;  2WS3 B;  3VQI A;  3ZYY X;  3W5V B;  1YMH E;  4FXC A;  4NJC A;  1DOY A;  4RF1 A;  2IGD A;  1MVK A;  1OQQ A;  2FE8 A;  3EA6 A;  1FIQ A;  2KQ4 X;  1EU3 A;  1KRH A;  2E6X A;  1RFK A;  4US9 A;  2CU3 A;  3TSS A;  2BT6 A;  2WXO A;  3AMZ A;  3PZ8 A;  1CQV A;  1JWM D;  4MH8 A;  4XWT A;  1L6U A;  1I4X A;  2WXI A;  4L1B A;  1PUT A;  3LXF A;  1C77 A;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...