4HCPB

Crystal structure of burkholderia pseudomallei effector protein chbp in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
AAMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Putative ATP/GTP binding protein
publication title Structural mechanism of ubiquitin and NEDD8 deamidation catalyzed by bacterial effectors that induce macrophage-specific apoptosis.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hcpB00
3A1QB 2KDFB 3KYDD 5G55A 3PLUA 4CO7A 3V60A 2FAZA 2J0KA 2QHOA 5LLIA 4B95A 2KLGA 2L76A 3L16A 4FJYA 4IWQA 2XK5B 4JL9A 5C23A 3VFKA 3VQIA 3N32A 1YD8U 4XZ4A 4JGHB 2Z59B 1QZEA 2FIFA 3C0RB 2JRHA 2LI5A 3T8MA 3H6NA 5IAAC 4GDKA 4KZCA 5E6OA 3ZTCA 4ANXA 3ZRFA 2KNBA 2JF5A 4WWOA 2PJHA 2FNJB 2JRIB 2D11A 4AJWA 4DDID 4M8NA 2KN5A 3NOBA 3MHSD 1MG8A 2KOXA 3PRZA 4E74A 1FXTB 2CHWA 2N7EA 4W9CA 1V81A 2KKCA 2JUOA 2HE7A 3R7QA 3V6EB 4FHKA 2ZZPB 4KSLC 4ANVA 3A1QA 1V9JA 3IFWB 2KVRA 1U4AA 3DVGX 2JZ3B 3LDZE 3ML8A 2KK8A 3X0WA 4HLEA 2Z0EB 4TQ0A 3TMPB 4EUTA 1YIWA 3QC8B 3QK0A 4GB9A 2XK5A 2DENB 1D3ZA 3PV1A 1PQSA 3L54A 3QJZA 2NR2A 1OTRB 2LXAA 1K8RB 2D3GA 3MTNB 3ZDTA 1KOTA 2MBQA 2ZCCA 1WJ6A 2KC1A 4WJPA 2GBNA 2IO1B 2NPTB 3DVGY 2MA9B 2C60A 1WFYA 3PLVA 2WDTB 5IA7A 4NY0A 4IC7B 4FJZA 2J7QB 1YQBA 2YVCA 2CU1A 2BKRB 1KJTA 4DWFA 1V5OA 2WX1A 3ENEA 4FN2A 2KO3A 2LGXA 4MELA 4NNJB 3KYCD 3PTFC 4HCNB 3ZNHB 2DZIA 2RD0A 3OJ4B 4XX5A 3ZDMC 4ZDVA 5JH5C 3M3JA 3MJWA 2AL6A 2DAFA 2KDIA 2LWPA 3KUDB 3WAOA 1YX5B 1IP9A 4ICUA 3RUIB 5E6PA 1WJUA 3UQAA 2IYDB 4FADA 4K1RB 3HM3A 1UBIA 1WY8A 4RMAA 4IWPA 3U30A 1WX9A 4EOYA 4ZYNA 2RGFA 2ZNVC 2ZCBA 2JZZA 5AZGA 3VTUA 3QX1A 1HE8A 3PSEB 1WXMA 3WAPA 2GBMA 2L05A 3JSVB 4ZRIA 5J18A 3AU5A 2MCNB 3QHTA 4IUMB 3CSTA 5GMVA 5CHWA 2KTRB 4DK5A 2NPTA 4TQ1A 3KUCB 5AZFA 3IHPC 1TTNA 4ICVA 3WAMA 2HD5B 4BKSD 5G2NA 2DYMA 4BOSC 2KLCA 3QA8A 3R66C 2A5UA 4HJKA 4BBNF 4G11A 3UIPB 2K6DB 2OOBB 3CSFA 1WGRA 3PT2B 3ZNGC 4A20A 3TL5A 3EHVA 5D7GA 2M17A 2ZNVB 4WJOA 3A33B 2MLBA 4AWJA 4MJSB 2V4LA 3UGBB 1WIAA 5CTRC 4DXAB 1UBQA 1Z2MA 2NBWB 2K6QA 3L08A 1UD7A 2IY1B 4YL8A 3JSVA 3APDA 4CYEA 4WWPA 4DBGA 4KDIC 2KJHB 1LQBA 1CMXB 4J6IA 2IBIB 2KDEB 2GBRA 4IM2A 1WX7A 3EECA 2KTRA 4N9F4 3PVLA 1Q5WB 1V86A 1GC6A 1WXSA 3GOEA 2BWFA 4RM9A 3B08A 4PS8A 4W9EA 4LDTB 1SGHA 2FCMA 5EDSA 3VH4B 2N9PC 3N3KB 4P7IA 2ZVOA 5JZEB 1E8XA 2D2QA 4WQOB 2V1YA 2B3AA 2EMTA 4IW0A 2MBHA 3DDCB 3JW0X 3M63B 4I6LB 2N1VA 2KDBA 1SIFA 2LVPA 3W1SC 2N1WA 4MJSA 2FCNA 2OJRA 3VTWA 2KTFA 2L00B 2C7MB 5L95C 3QCAA 4URKA 3VHTC 1XT9B 1YJ1A 2KXJA 2ZPYA 4BKGA 2PPHA 1TZ1A 2KX3A 2R2OA 2C9WB 2CS4A 1ISNA 3H7PB 3ALBA 4GOCA 5D94A 3UIOB 2PE6B 2AYOB 3PRPB 4G0NB 4AJYB 2J0JA 1WI0A 2NBUA 3VH3B 2I1JA 4MDKE 1P9DU 2K1FA 1F9JA 3NY5A 2DZJA 2JT4B 3VXWA 2KX0A 1S1QB 2KJRA 4NPNA 3TIXA 5C1ZA 4DHJB 5J17A 5KHQA 1C3TA 2N4FA 2FCQA 3TCAA 5E6NA 1E90A 1J0GA 3U7DA 2BYFA 2DZKA 1GNUA 3R3MA 4DHZB 1R4NI 2MBBB 4GSWA 5AZHA 4MGIE 3RZWC 1WGDA 2IY0B 2UWQA 3L10B 3A9KB 4E3CA 3NHEB 4II2B 4E71A 4KVGB 4NQLB 2L0FA 2KC2A 3OAWA 1WMHB 4W9IA 3VUXA 3PRMB 4IG7B 4AP4C 1TBEA 2CHXA 4HWIB 1OQYA 2LZ6A 4ZRJA 2G4SA 1WX8A 3BINA 4W9DA 3ZKJC 2ASQA 3A4SC 3ZLZA 4TUUA 4BVUC 2K39A 2WYQA 2ZVNA 2LRUA 3APFA 3DBLI 4PYZA 2Z0DB 3APCA 2FUHB 4MM3A 1I42A 1EO6A 2MWSB 3QWZB 2D10A 4EZKA 5JHBA 3OJ3A 1IYFA 5DPSA 5KHOA 1WGHA 2G45B 2JXXA 2K8CA 2WX0A 4ZRKA 3SU8X 3QQ8B 3W1SA 4W9JA 2IO3B 3KW5B 1KM7A 3HHMA 4K7UA 1VCBA 4TKNA 2C5LC 4LCDE 2XBBC 1WM2A 3PHWB 3HK0A 4DDGD 1WJNA 2R2QA 1UELA 4NAWB 4LJPB 2WWZA 3ONSA 4FLHA 3RZFA 5BO4B 4KDLB 2KWCA 2ZPNA 5HKHA 5AEKB 3CMMB 1S3SG 3ZO5B 2M4NA 3NZUA 4MSMB 1GC7A 4BOZB 1YX6B 2VRRB 1H8CA 2O2VB 2GMIC 2G4DB 4ANWA 3QAQA 5TR5A 3VDZA 1X1MA 1WYWB 3DBSA 1V5TA 3AI5A 3S2AA 4TV3A 2NVUI 3DVNU 3RD2A 4HPMB 3X23A 1V80A 1J8CA 2AL3A 3PZDA 1Z5SB 1WXAA 1ZW7A 5CX3A 2AWTA 3KUZA 4MGYE 1NI2A 2LD9A 2J0MA 4K81A 4GDLB 3W1YA 2D07B 3VUYA 1ZGUB 4BFRA 4NAWA 3RCZA 2LRWA 3A9JB 1XD3B 2NBVB 2LASA 3PS6A 4JQWC 3ZW3A 3K9OB 2A4ZA 1GJZA 3ZIMA 2L0TA 4HPLB 1H4RA 2DZMA 3WA0A 1UH6A 2O6VB 3NZSA 4JLCA 3DQVA 5DPRA 4EKUA 5JHAA 4EFOA 4PYUA 2KQ7A 3SDLC 2HJ8A 2O2VA 3GZNI 4FJVB 2MQJA 1IPGA 1V6EA 3DBHI 2ZJDA 1E8YA 4NJ7A 1WR1A 1LXDA 4WJQA 1EF5A 4M0WB 4OVUA 1P0RA 3SHQA 2KD0A 1EUVB 2BF8B 2LXCA 3Q3JA 2REXA 3UQBA 1WGGA 2KANA 5LXHA 2LUEA 3L0WB 1OGWA 4KIKB 1E5WA 1C1YB 1WE7A 1RRBA 4B6WA 1SE9A 4W9LA 4W9KA 5DCNA 3ML9A 2KMAA 2NS5A 2K25A 2DX5B 4HK2A 4HVBA 3A9JA 5DPWA 4PS3A 3L13A 2M1MA 2BGFA 4PS7A 3WALA 1WZ3A 2K8HA 3VVWB 3DCGA 2O6VA 3IBEA 4W9GA 4FA6A 1WGYA 4F8CB 4W9HA 3ZUNA 4M8MA 3LJ3A 3WIMA 2N9XA 4G3XB 2MW5A 3VAWA 2IO2B 4ANUA 1P3QU 3A4RA 4GIVA 1LM8B 3T9LA 2LGDA 2BYEA 4KV2A 1TGZB 1UGMA 1WJ4A 2HTHA 4I6NB 5CHFA 5D6JB 4GU2A 1T0YA 2EMSA 3D32A 4KIKA 3DPDA 3ZVVA 4MH0E 4DHZE 2DHZA 2KQSA 3PPAA 3QIJA 5FR6A 3V6CB 1Q0WB 3B1LX 3P2BA 1M94A 3TJPA 3H7PA 4HXDA 2L7RA 3SD5A 2Y5BB 2MBOA 2W9NA 1WF9A 3PREA 4DHJD 1E7VA 3V62A 3PHXB 3I3TB 1NBFC 3JYUA 4ASWC 2NCNA 2AEHA 2KJ6A 2LVQA 2MSED 3DBRI 4A3PA 1AARA 1RFAA 2K8BA 3NS8A 1R4MI 3VUWA 4F7ZA 1BT0A 3EFUA 4X57B 3DOWA 2UYZB 2N9EB 3N30A 1KLVA 2BYVE 1V2YA 3VTVA 2DYOA 2BPSA 2CR5A 5D2MB 2N7DA 1WRDB 2KFJA 4IM3A 4MEMA 4EZLA 3IG3A 3Q3FA 3KVFB 4HDQA 4EEWA 4B9KA 3CF6E 2V3SA 1WXVA 2GBKA 2KHWB 3JVZX 3M62B 4RM8A 3V61A 4CHKA 2KWUB 3A9KA 4GMVA 2KFKB 3AXCA 2BKFA 3ZNID 3HM6X 4IWOA 4BBNC 3RULA 2IZVB 1WMHA 1OEYJ 1OEYA 1VD2A 4I6PA 3H1UA 2L3ZA 3H7SA 3BY4B 1WH3A 1GUAB 4A3OA 2MP2B 5CHVC 2M0XA 2RR9A 4KSKC 1WM3A 3UINB 2GOWA 4FULA 3UF8A 5LXIB 3QARA 4HDOA 3M95A 3H9DA 1V49A 4IM0A 3ZTDA 1E8WA 4XC2A 3AU4A 2PE9A 4WAAA 2ZEQA 1J19A 4MGKE 1E8ZA 2BWES 5L83A 5J2RA 1G6JA 2LGYA 4MGZE 3DVNV 4JIOU 2JY6A 4W9FA 4BKTA 2EKEC 1Y8RC 1EF1A 2LJ5A 3AULA 3ZNZB 1P1AA 4G50A 2KFKA 2MRPA 1Q1OA 2C7HA 3EC8A 2RSUA 3L17A 4K7WA 3PGEA 2KWVB 1L7YA 1P98A 3O65B 4GXBA 2I1KA 4OVVA 2JVCA 1WR6E 3IVFA 2FCSA 4HCPB 3ECIA 1GG3A 2C7NB 2DYBA 1ZKHA 3K9PB 1L2NA 1WZ0A 1UZXB 2MP2A 3ZRCA 2KMCA 2YLMA 2GBJA 3RYTA 2XEWA 4NQKE 4FBJB 4BKSA 1I35A 2PEAA 4LJOB 2CKHB 2RPQA 5DPTA 2LVOA 4MSQB 1JRUA 2MX2A 4AOFA 2G3QB 4II3B 3TBLD 2L8JA 4GN1A 2DAJA 2FIDA 1NDDA 2CHZA 3B0AA 4NJ6A 1RLFA 1A5RA 1E7UA 2M8SA 2IO0B 3R7RA 3WANA 4K7SA 4FHJA 4GDKB 1RAXA 3U8ZA 4AUQC 3RT3B 1WE6A 3KH0A 4EZJA 1LFDA 2O6VD 4WJNA 3HIZA 3OLMD 1XQQA 4LDTD 2MBEA 4GGQA 2JWZA 2KZRA 4GDLA 4WWNA 4KZ0A 4F1SA 2JPHA
chains in the Genus database with same CATH superfamily
2KDFB 4NZLB 1WGKA 4CO7A 1J7BA 1T0RC 4CQNA 4B95A 2J52A 4IWQA 3ZGZA 1ZDXA 3T8MA 3H6NA 1NENB 1ZE3D 1YOVB 4GDKA 3ZTCA 3BVMA 4ANXA 2PJHA 2JRIB 2D11A 3NOBA 2CHWA 2N7EA 4OW0A 4KSLC 1FO4A 1F0ZA 4ARIA 3A1QA 5LNK1 2JZ3B 1DOXA 2KK8A 4WWMA 2K3UA 2QIEB 2XK5A 3PV1A 3V3XA 4RF0A 2BS3B 2J42A 2D3GA 3AE1B 1MI0A 3MC0B 1E0ZA 2MBQA 3PLVA 2J7QB 2WX1A 3ENEA 3KYCD 3ZNHB 3W2DA 2DZIA 5JH5C 3DBLB 2AL6A 2DAFA 3MJWA 4HPPA 4FXCA 4ICUA 1WJUA 3U52E 4YXDB 1HXYD 1WY8A 3KWVA 3U30A 4ZYNA 3BVZA 1XO3A 3AEBB 2M0AA 3WAPA 2BVCA 2L05A 3AU5A 2MCNB 1QOBA 4IUMB 4TSSA 5CHWA 2TSSA 4DK5A 3KUCB 3IHPC 1YQ3B 3SFEB 4BOSC 2A5UA 2JYEA 4BBNF 3UIPB 2LHDA 1DGJA 1UF0A 3TL5A 2INDC 3C8YA 5D7GA 1GOZA 2WXIA 1V8CA 1WIAA 3AEAB 1EU3A 4CYEA 3DWMA 4KDIC 3CWIA 4J6IA 4IM2A 3EECA 3PVLA 1GC6A 3B08A 2WXFA 2YEPB 2N9PC 4B0MA 4IW0A 2EMTA 4YTNB 3M63B 1T0SC 5D3DA 2N1VA 2KDBA 1SIFA 3VTWA 2C7MB 1QOGA 3QCAA 4URKA 4M00A 2WLBA 1YJ1A 3P4PB 3HVDA 2KX3A 2R2OA 2CS4A 2PE6B 2BYTA 4K3BA 3B9JA 4S17A 2AYOB 2N0SB 3Q8FA 4JWUC 2J0JA 1WI0A 1JWBD 2NBUA 4P16A 1FRDA 3BYYB 4KX6B 2K1FA 3VXWA 5C1ZA 2PIAA 1C9FA 2WXGA 1T5XD 1E90A 3U7DA 3MFGA 1PFDA 1GNUA 4MACA 5AZHA 1V97A 3RZWC 1FCLA 2QJLA 3Q3MC 4E3CA 1ZXHA 3OAWA 1I4RA 3VUXA 2CHXA 2LZ6A 4ZRJA 2G4SA 3AEGB 3BINA 4W9DA 2ASQA 2KQ4X 3A4SC 5H92C 4AS1A 2BQQA 2ZVNA 3APFA 4PYZA 2BT6A 2FUHB 1VJKA 4MM3A 3H8HA 1PGAA 2QILA 4EZKA 1IYFA 5KHOA 1WGHA 2WX0A 3QQ8B 5EE1A 3OG5A 1FEHA 3KWLA 4LNNA 4TKNA 2C5LC 2AX5A 3GB1A 4DDGD 3J9CA 1UELA 2WWZA 3RZFA 4KDLB 3CMMB 2MH7A 1STEA 5IKCM 3AE4B 1VR9A 2L52A 3QAQA 3NUHB 3RNFC 4D2KA 1WYWB 3S2AA 4B0EA 4XGAB 4P6VF 1IUEA 1MPEA 3PZDA 1Z5SB 1N6ZA 1WXAA 1ZW7A 2LD9A 2J0MA 3IAS1 4GDLB 2CU3A 1GB4A 3VUYA 1ZGUB 3RCZA 2ICIA 4RFBA 3EFCA 4HPLB 1H4RA 4XWTA 3BK2A 1D4BA 4JLCA 1I4GA 4EFOA 4A6QA 3GZNI 4MH8A 1V6EA 3BWUD 2FUG1 3GZNB 4NJ7A 1XEEA 1WR1A 2INPE 4M0WB 2XN9C 3Q3JA 2REXA 1SBBB 2LUEA 4DQOC 4KIKB 2DWQA 1WE7A 4W9LA 4N58A 2NS5A 2LEKA 4HVBA 3A9JA 3NZ3A 2QC8A 2GB1A 3WALA 4YSXB 1ZP0B 2NTTA 3DCGA 3IBEA 4FA6A 4W9HA 2WNMA 1I4PA 2MW5A 1TKEA 3T9LA 4KV2A 2BYEA 5CHFA 2MJDA 1T0YA 2EMSA 2MHJA 2WQYB 3D32A 1NEKB 4MH0E 2DHZA 4ZRPA 2KQSA 1TIFA 1Q0WB 3P2BA 1M94A 1ET6A 4DHJD 1FD6A 2H89B 4RGOS 3V62A 2HJ1A 3Q8BA 2W3SA 1NBFC 4ASWC 2K9XA 1I4XA 2NCNA 2LVQA 1AARA 3U2SC 1RFAA 1TS3A 2N9EB 1KLVA 2WXNA 2DYOA 1F77A 2BPSA 2KFJA 4LNKA 1HZ6A 4BZAA 3NVWA 4HDQA 2QDFA 3CF6E 1WXVA 4N59A 3IAM1 5C3JB 3SFDB 3NJTA 3V61A 2WU2B 3HM6X 5HHDG 4NJCA 1WMHA 1QT9A 4A90A 1RFKA 3Q6BA 2HTME 1SE3A 3H7SA 4A3OA 2MP2B 2M0XA 2I38A 1WXQA 3R2IA 4DXFA 3GE8C 5LXIB 3H9DA 1J7CA 1E8WA 4RNAA 1IBXA 4MGZE 3DVNV 2KN4A 3FKYA 1Y8RC 1P1AA 3SEBA 1ZXIA 3HUIA 2C7HA 3EC8A 4LK0M 4ZOHC 3PGEA 1L7YA 4GXBA 4OVVA 1HA5A 1C77A 4HCPB 1GG3A 1YN4A 2Q5WD 1UZXB 5IOIA 2J4XA 2PVGC 4JE3B 2XEWA 4NQKE 1FFVA 2PEAA 5H8YE 3TBLD 1L6VA 4GN1A 3B0AA 2IO0B 3WANA 3ZJUA 4K7SA 1JQ4A 4AUQC 1K51A 4WJNA 1XXGA 4LDTD 2MBEA 5D3IB 1YN3A 2JWZA 3AE6B 4KZ0A 2WP9B 4KGTA 1RWSA 3KYDD 5G55A 2QHOA 1FXAA 2J0KA 4LTUA 1NI3A 2KLGA 3AE5B 3URYA 2L76A 3VR8B 4FJYA 5C23A 3AEFB 3VFKA 1C76A 2KMMA 4JGHB 5IAAC 5E6OA 3ZRFA 2JF5A 4AJWA 3TEYA 4ZRQA 2D3AA 3PRZA 2KOXA 2LMCA 2WDVB 3T3NA 1V81A 2KKCA 2JUOA 2HE7A 3R7QA 3V6EB 2NTSA 2ZZPB 4USAA 3IFWB 1SJED 3DVGX 3AEDB 2M56B 4ZHPA 3LDZE 3X0WA 2Z0EB 3TMPB 1YIWA 3QC8B 4GB9A 3L54A 2NR2A 1OTRB 1K8RB 3MTNB 4HEA1 1JRPA 2KC1A 4WJPA 2GBNA 2IO1B 2NPTB 2MA9B 2C60A 1WFYA 5IA7A 2WDTB 4NY0A 4IC7B 1HTQA 4QAYA 1FNUA 1RYJA 3RMKC 2QMTA 4MELA 4NNJB 2LGXA 3PTFC 2RD0A 3ZDMC 4ZDVA 3WAOA 1IP9A 3BK1A 3UQAA 4FADA 4IWPA 2RGFA 2ZNVC 2ZCBA 3VTUA 1HE8A 3PSEB 5E6JA 1MHHE 3CSTA 2KTRB 1V1PB 4RH6A 1CQVA 3WAMA 2KVZA 2DYMA 4C4VB 5C2TB 2K6DB 4A20A 1SIJA 1HTOA 1PGBA 1EU4A 2V3PA 2ZNVB 4WJOA 2RDGA 2INNE 4MJSB 3NG0A 3UGBB 4DXAB 1UBQA 2NBWB 3MHZA 3L08A 1UD7A 3JSVA 3APDA 4DBGA 4PT5A 1SXTA 1CMXB 2KDEB 2GBRA 4N9F4 2ON8A 2BWFA 4RM9A 1YQ4B 4LDTB 1JW9D 1SGHA 2FCMA 3N3KB 4DXGA 1E8XA 2D2QA 4JWSC 2OJWA 2V1YA 2B3AA 2K22A 2MBHA 1N60A 4I6LB 2WHIA 3W1SC 2N1WA 2FCNA 2KTFA 3AM9A 5L95C 2KXJA 2PPHA 4GOCA 2C9WB 1ISNA 5D94A 1F2RC 4PK1A 2EKIA 4AJYB 3VH3B 3TEWA 2R61A 4WIPA 2I1JA 1ZDVA 2N9LA 1F9JA 3TUOA 2OHFA 2KX0A 3TIXA 5J17A 2N4FA 5E6NA 1UNSA 3CIRB 2LGIA 1R4NI 1R4NB 1BUIC 1WGDA 2UWQA 2WXKA 3NHEB 4KVGB 2L0FA 2KC2A 4OZBA 1WMHB 3PRMB 4OZCA 4HWIB 4TUUA 3I9V1 2KWDA 2RDHA 3DBLI 3DBRB 1R4MB 1QOAA 1EO6A 3EGRA 5JHBA 2PVOD 5DPSA 3SU8X 2JXXA 4JPSA 4W9JA 3KW5B 2PMVA 1JWUD 2XBBC 2X38A 4REZA 1WM2A 1WJNA 3ONSA 3ZXVA 1NVID 2KWCA 3AN1A 2ZPNA 5HKHA 3BIID 1KFYB 1S3SG 2V0GA 2M4NA 1GC7A 2LUMA 2VRRB 1H8CA 2O2VB 3T3OA 2L1AA 2GI9A 2KDMA 1ZUD2 4Q2JA 1V80A 1VRAB 5CX3A 2HDEA 1L6UA 1B1ZA 3KUZA 4MGYE 1NI2A 2VZKD 1F1HA 1JALA 4P1CC 1KF6B 4K81A 4BFRA 1OFFA 4NAWA 1IGDA 2NBVB 1LGRA 3SR6A 3AEEB 2L0TA 3WA0A 1UH6A 3Q14C 3NZSA 3SDLC 2WXMA 2ZJDA 1FNVA 1K50A 3AMZA 4UDUC 1LXDA 4WJQA 2KD0A 1I7HA 4TMAB 2KANA 1CK1A 2JSVX 1C1YB 1D5XC 1K52A 1SE9A 4XYCA 1JWMD 4W9KA 5DCNA 2KMAA 4YWGG 2K25A 4HK2A 1DOIA 5DPWA 3KQ4A 3WCQA 1WZ3A 2IJ0A 2K8HA 3VVWB 1ROEA 2O6VA 4F8CB 3ZUNA 1PDXA 4M8MA 3LJ3A 5MPOA 2MJ3A 2N9XA 2W3RA 2IO2B 4ANUA 1P3QU 1E7PB 4GIVA 2LGDA 1FXIA 1TGZB 1UGMA 4I6NB 3OWEB 2L83A 3DPDA 3B1LX 3H7PA 3O13A 4HXDA 3SD5A 1XLPA 2MBOA 1SB3C 3PHXB 1GPXA 3FILA 2MSED 4A3PA 5BYRA 3NS8A 1FFUA 3EFUA 3DOWA 2BYVE 3DHHC 5D2MB 2CR5A 5AUIA 3IG3A 2D3BA 4EEWA 5JXVA 1AWDA 2JX5A 3M62B 2KWUB 4GMVA 1MHXA 2BKFA 1ZOYB 3ZNID 4IWOA 4WQMA 1L0VB 4OVZA 3PZ8A 2L3ZA 4ACFA 1WH3A 1GUAB 2RR9A 4XWWA 1WM3A 1L5PA 1VLBA 4R3DA 4S0RA 5BYQA 4HDOA 4XC2A 4WAFA 1EM7A 1EWYC 2ZEQA 5L83A 2BWES 2LGYA 4JIOU 4W9FA 4BKTA 4C80A 2LJ5A 3AULA 5IN7A 2KFKA 3B2FA 3FC4A 2MRPA 4OZAA 3MJ5A 3MP9A 2VZKB 2JVCA 3AE7B 2C7NB 2DYBA 1ZKHA 3ZRCA 2YLMA 2GBJA 4WH4A 1L0YB 4BKSA 4LJOB 4MSQB 2MX2A 4L2YA 1NDDA 2CHZA 2M8SA 4GDKB 3U8ZA 3KH0A 4EZJA 1LFDA 2O6VD 1XQQA 2KZRA 4WWNA 1I4QA 1FRRA 4F1SA 2JPHA 3A1QB 1JWAD 3PLUA 2FAZA 5LLIA 2IGGA 3U7ZA 4JL9A 2XK5B 1YJJA 3VQIA 3N32A 1QZEA 2FIFA 3C0RB 2LI5A 4YTMB 4KZCA 1XLQA 2KNBA 1IGCA 2KN5A 1MG8A 1FXTB 3P4RB 2QCZA 4FHKA 1C4PA 2LFIA 4RGMA 2NMQA 1U4AA 2LHEA 3ML8A 1VZ7A 4HLEA 3EA6A 3QK0A 3RFZB 2DENB 1D3ZA 1PQSA 2QEJC 3QJZA 1N5XA 1HZ5A 2W55A 3DHIC 2ZCCA 3VR9B 2WXOA 3DVGY 1FNWA 1YQBA 2YVCA 2CU1A 2BKRB 1KJTA 2N9KA 5EE9A 4DWFA 1V5OA 4FN2A 2KO3A 3LB8C 4HCNB 3V05A 4XX5A 3OJ4B 3M3JA 1YX5B 3I57A 2I2YA 1TYGB 2IYDB 3HM3A 1N5WA 4EOYA 2ZW1A 2JZZA 3QX1A 3U4EG 1QQRA 5GMVA 4TQ1A 5FK9C 5AZFA 4ICVA 1TS5A 4BKSD 5G2NA 2KLCA 3R66C 3NS1A 2V9HA 4G11A 2OOBB 3PT2B 3EHVA 1MFWA 1V1OA 2WS3B 3A33B 2AQ3B 3AE8B 5CTRC 2AQ1B 1MVKA 2K6QA 4WWPA 3KLSX 2KJHB 1NYQA 1DOYA 1WX7A 1PYWD 2W54A 3N1XC 1Q5WB 1V86A 2X8XX 3GOEA 2N7JA 5EDSA 2ZVOA 2E3TA 1FIQA 1TKGA 2IGDA 2LVPA 3AH7A 4J3OD 3VHTC 1UUPA 1XT9B 4BKGA 1TZ1A 3H7PB 3MC8A 1SF0A 1SSNA 2GLSA 1FMAD 3PRPB 2BS2B 1YMHE 1KLUD 4MDKE 2JWUA 3NY5A 3FAHA 4MM3B 2DZJA 3R8BA 4GLSC 1N62A 4DHJB 4NAMA 2Y5CA 1C3TA 2CJOA 2BYFA 2DZKA 2MBBB 1P7FA 2ZW0A 4MGIE 1E6EB 2IY0B 3L10B 4E71A 4II2B 3Q69A 4W9IA 4IG7B 3ABVB 3AECB 3ZLZA 3DHGC 4BVUC 2WYQA 5I4DA 2Z0DB 1I42A 2MWSB 3QWZB 2D10A 5EE0A 2WXRA 4ZRKA 1N63A 4HJGE 2WDRB 2IO3B 4HKZE 3HHMA 4K7UA 2K5PA 3AE9B 2D3CA 3ZXRA 2QSDA 3ZYYX 1SJHD 1ZPSA 2BBCA 4XDDA 4C00A 3NZUA 3W9CB 4BOZB 1YX6B 1HEZE 2G4DB 1TY2A 4ANWA 1K53A 3DBSA 1V5TA 3AI5A 4TV3A 2NVUI 3DVNU 1J8CA 5HI1A 2AWTA 3W1YA 3EUB2 3DWGC 4P1BC 3A9JB 2LASA 3PS6A 3ZW3A 3K9OB 1JROA 2A4ZA 1GJZA 5G5GA 2DZMA 5BMGA 1XLOA 4EKUA 5JHAA 1F52A 4PYUA 2KQ7A 2DLBA 2MQJA 3IT4B 1QF6A 4OHJA 3DBHI 1ACCA 3IT6B 3DBHB 4YTPB 1EF5A 2LXCA 3UQBA 1WGGA 5LXHA 3L0WB 5BMIA 1E5WA 2OEDA 1T6BX 2Y5PA 2RMMA 4HROA 3RPFC 2M1MA 4PS7A 2Y3AA 4W9GA 5FR3A 4HRSA 1PUTA 3LXFA 3I5JC 4G3XB 1D5ZC 4M0WA 1LM8B 5D6JB 2JQRB 1R7SA 2ACZB 4KIKA 4DHZE 1AW7A 1F2RI 1Y56A 3PPAA 5FR6A 3V6CB 3TJPA 2IPKD 2L7RA 2D5GA 2Y5BB 1WF9A 3C19A 1NYRA 3JYUA 1L0XB 2AEHA 2KJ6A 5AUKA 3DBRI 2K8BA 1R4MI 4X57B 4YSYB 1AYFA 2UYZB 4C56C 1V2YA 2N7DA 4MEMA 1GAQB 1IBXB 3KVFB 4YT0B 1ET9A 2WDQB 3LYYA 2KHWB 4RM8A 3A9KA 1KH0A 4WURA 2BB6A 1OEYA 4I6PA 3H1UA 2M19A 4M02A 3BY4B 1D6EC 4KSKC 1QILA 3UF8A 4FULA 3QARA 1CZPA 3ZTDA 3AU4A 1C4AA 1J19A 2BW2A 1E8ZA 3RNGC 4IKGA 2JYTA 3P42A 3ZNZB 4G50A 4A55A 3L17A 2RSUA 3N1ZC 1AN8A 3O65B 4EE2A 2I1KA 4US8A 1WR6E 2FCSA 1P7EA 2K0PA 3K9PB 1L2NA 1C78A 1WZ0A 2KYWA 3GP7A 2MP2A 3P1MA 3E56A 4M01A 3I63C 1I35A 5DPTA 2LVOA 2SAKA 3P4SB 4AOFA 2L8JA 4RF1A 2DAJA 1JCKB 1RLFA 1A5RA 1TZOA 1RAXA 3RT3B 2WXLA 4H2AA 3OLMD 4MT5A 1PGXA 4GGQA 1A70A 1JWSD 3RNAC 1M4VA 3WIMA 2FBWB 3V60A 1E10A 3AE3B 3L16A 2L32A 5T8IA 1YD8U 3BZDB 3NVVA 4XZ4A 2Z59B 3ZQ4A 2JRHA 4A8XC 1XF5L 4WWOA 3N1YC 4DDID 2FNJB 5J2RA 1OQRA 4M8NA 2J53A 3MHSD 4E74A 4W9CA 2PKOA 1WRIA 4ANVA 3NVZA 1JMLA 3Q2AC 1V9JA 2KVRA 4XDCA 4TQ0A 4RGNA 1LO5D 4EUTA 1QKZA 1HQRD 2LXAA 3ZDTA 4YSZB 1KOTA 1UWMA 1WJ6A 1TT5B 3UI3A 1MJDA 4FJZA 2WXQA 1QOFA 2E6XA 2AQ2B 4XE0A 3AV8A 2KDIA 2LWPA 3KUDB 3PO0A 1TJEA 3RUIB 2KACA 5E6PA 1B9RA 2WXHA 3L4PA 4K1RB 1UBIA 4RMAA 3VRAB 1WX9A 1J7AA 4IDIA 5AZGA 1WXMA 3Q8EA 2GBMA 3TEXA 3JSVB 4ZRIA 3PZ7A 1SEBD 5J18A 3W5UB 1KLGD 3QHTA 4L23A 1OQQA 2NPTA 1TTNA 2HD5B 2SEBD 3QA8A 4HJKA 2H88B 3CSFA 1WGRA 3ZNGC 1DYQA 2V3NA 2M17A 1BMLC 3W5VB 4ZHOA 3IXSA 2MLBA 4AWJA 2V4LA 1Z2MA 1YJIA 2IY1B 3BYTB 2IDYA 4YL8A 4N6EB 1LQBA 2IBIB 2UU7A 2KTRA 1V1PA 3TEZA 1WXSA 4A9AA 4PS8A 4W9EA 4C4VA 3VH4B 4P7IA 5JZEB 1WSPA 4WQOB 3DDCB 3JW0X 2YEPF 1C79A 1FCCC 1L4ZB 4MJSA 1FM0D 2OJRA 2L00B 3TSSA 2ZPYA 1YNTE 2MEKA 1TS2A 3ALBA 3UIOB 1C4CA 2BTEA 4IOIE 4G0NB 4C7ZA 1SE2A 2DNFA 3HRDD 1P9DU 2WU5B 3AE2B 3RNBC 2WGSA 2JT4B 4NPNA 1S1QB 2KJRA 2LGSA 2BB5A 5KHQA 3ZJTA 2FCQA 2KAJA 3TCAA 5TSSA 4BAXA 1J0GA 3R3MA 4DHZB 4GSWA 2CJNA 3A9KB 4NQLB 1XLNA 4AP4C 1TBEA 4JX1C 1OQYA 1WX8A 2JZPA 3GE3C 3ZKJC 3Q8CA 1WYGA 2RPVA 2DBYA 2K39A 2LRUA 3RN9C 3APCA 4KKJA 1FPYA 4RCOA 4LNOA 3OJ3A 4AQ7A 2G45B 2K8CA 2WXJA 1YN5A 3VRBB 3W1SA 1ESFA 5BYSA 3N20C 2JXTA 1KM7A 1XCQL 1VCBA 4LCDE 3Q3NC 1VZ6A 1TKYA 3PHWB 3HK0A 2R2QA 4NAWB 4LJPB 4FLHA 1Q10A 5BO4B 5AEKB 2MJEA 3ZO5B 4MSMB 1QLBB 2GMIC 2LJIA 3NRZA 1D5MC 2GRIA 5TR5A 3VDZA 1X1MA 3RI7C 3RNEC 1UWXA 3X23A 3RD2A 4HPMB 2AL3A 3BVGA 3P4QB 2D07B 2LRWA 1XD3B 4JQWC 4C7YA 4K3CA 1KRHA 1L4DB 3ZIMA 1TY0A 2O6VB 4L1BA 5DPRA 3DQVA 2HJ8A 2O2VA 4FJVB 1IPGA 3ZJVA 2INCC 5HG2A 1E8YA 4O1NA 1TS4A 4OVUA 1P0RA 3SHQA 1EUVB 2BF8B 2BS4B 2RDBC 1KTKA 1N61A 1GB1A 1OGWA 2EELA 5GXGB 2B76B 1RRBA 4B6WA 3ML9A 2Z8LA 2DX5B 4PS3A 3L13A 1MG4A 3FILB 2PLPA 2BGFA 3B2GA 1VZ8A 3Q3OC 1WGYA 3Q8AA 1CJEA 2V4IB 1I4HA 3NVYA 3VAWA 2WXPA 3A4RA 2KT7A 2VH1A 2ONQA 2HTHA 1WJ4A 4GU2A 4ZYSA 3ZVVA 3QIJA 3E9SA 2W9NA 3PREA 1E7VA 3I3TB 3N9YC 1SE4A 1T0QC 3VUWA 4F7ZA 1BT0A 3N30A 3MC9A 3VTVA 1WRDB 4IM3A 4EZLA 5BMHA 3Q3FA 3ETRA 3GS2A 4B9KA 1VDVA 3P63A 2V3SA 5IO9A 4US9A 2GBKA 4KKIA 3JVZX 4ITKA 2G1EA 4CHKA 3RNCC 2KFKB 3AXCA 1E9MA 4BBNC 1T3QA 3RULA 2IZVB 4KGRA 4LLGM 1OEYJ 5FKAC 1VD2A 2VH2A 2W82A 1UGJA 2PW9A 4LNIA 5CHVC 5HFYA 3UINB 2IGHA 2GOWA 1BXTA 3M95A 4ARCA 1V49A 4IM0A 2PE9A 3HVZA 4WAAA 4MGKE 1G6JA 2JU6X 2JY6A 2EKEC 1EF1A 5G5HA 3AB5A 1Q1OA 4K7WA 2KWVB 3R2TA 1P98A 5EE3A 1WWTA 3IVFA 3ECIA 1ENFA 5IP4D 4LNFA 2XNAC 2G9HD 2KMCA 3RYTA 4FBJB 2CKHB 2RPQA 4HKQA 1EWCA 2PTLA 1JRUA 2G3QB 4II3B 2FIDA 4NJ6A 1E7UA 3R7RA 4FHJA 4RGTA 1WE6A 1RM6C 3HIZA 4GDLA 2FE8A 1XCTL 4KGSA
chains in the Genus database with same CATH topology
3A1QB 2KDFB 3KYDD 5G55A 3PLUA 4CO7A 3V60A 2FAZA 2J0KA 2QHOA 5LLIA 4B95A 2KLGA 2L76A 3L16A 4FJYA 4IWQA 2XK5B 4JL9A 5C23A 3VFKA 3VQIA 3N32A 1YD8U 4XZ4A 4JGHB 2Z59B 1QZEA 2FIFA 3C0RB 2JRHA 2LI5A 3T8MA 3H6NA 5IAAC 4GDKA 4KZCA 5E6OA 3ZTCA 4ANXA 3ZRFA 2KNBA 2JF5A 4WWOA 2PJHA 2FNJB 2JRIB 2D11A 4AJWA 4DDID 4M8NA 2KN5A 3NOBA 3MHSD 1MG8A 2KOXA 3PRZA 4E74A 1FXTB 2CHWA 2N7EA 4W9CA 1V81A 2KKCA 2JUOA 2HE7A 3R7QA 3V6EB 4FHKA 2ZZPB 4KSLC 4ANVA 3A1QA 1V9JA 3IFWB 2KVRA 1U4AA 3DVGX 2JZ3B 3LDZE 3ML8A 2KK8A 3X0WA 4HLEA 2Z0EB 4TQ0A 3TMPB 4EUTA 1YIWA 3QC8B 3QK0A 4GB9A 2XK5A 2DENB 1D3ZA 3PV1A 1PQSA 3L54A 3QJZA 2NR2A 1OTRB 2LXAA 1K8RB 2D3GA 3MTNB 3ZDTA 1KOTA 2MBQA 2ZCCA 1WJ6A 2KC1A 4WJPA 2GBNA 2IO1B 2NPTB 3DVGY 2MA9B 2C60A 1WFYA 3PLVA 2WDTB 5IA7A 4NY0A 4IC7B 4FJZA 2J7QB 1YQBA 2YVCA 2CU1A 2BKRB 1KJTA 4DWFA 1V5OA 2WX1A 3ENEA 4FN2A 2KO3A 2LGXA 4MELA 4NNJB 3KYCD 3PTFC 4HCNB 3ZNHB 2DZIA 2RD0A 3OJ4B 4XX5A 3ZDMC 4ZDVA 5JH5C 3M3JA 3MJWA 2AL6A 2DAFA 2KDIA 2LWPA 3KUDB 3WAOA 1YX5B 1IP9A 4ICUA 3RUIB 5E6PA 1WJUA 3UQAA 2IYDB 4FADA 4K1RB 3HM3A 1UBIA 1WY8A 4RMAA 4IWPA 3U30A 1WX9A 4EOYA 4ZYNA 2RGFA 2ZNVC 2ZCBA 2JZZA 5AZGA 3VTUA 3QX1A 1HE8A 3PSEB 1WXMA 3WAPA 2GBMA 2L05A 3JSVB 4ZRIA 5J18A 3AU5A 2MCNB 3QHTA 4IUMB 3CSTA 5GMVA 5CHWA 2KTRB 4DK5A 2NPTA 4TQ1A 3KUCB 5AZFA 3IHPC 1TTNA 4ICVA 3WAMA 2HD5B 4BKSD 5G2NA 2DYMA 4BOSC 2KLCA 3QA8A 3R66C 2A5UA 4HJKA 4BBNF 4G11A 3UIPB 2K6DB 2OOBB 3CSFA 1WGRA 3PT2B 3ZNGC 4A20A 3TL5A 3EHVA 5D7GA 2M17A 2ZNVB 4WJOA 3A33B 2MLBA 4AWJA 4MJSB 2V4LA 3UGBB 1WIAA 5CTRC 4DXAB 1UBQA 1Z2MA 2NBWB 2K6QA 3L08A 1UD7A 2IY1B 4YL8A 3JSVA 3APDA 4CYEA 4WWPA 4DBGA 4KDIC 2KJHB 1LQBA 1CMXB 4J6IA 2IBIB 2KDEB 2GBRA 4IM2A 1WX7A 3EECA 2KTRA 4N9F4 3PVLA 1Q5WB 1V86A 1GC6A 1WXSA 3GOEA 2BWFA 4RM9A 3B08A 4PS8A 4W9EA 4LDTB 1SGHA 2FCMA 5EDSA 3VH4B 2N9PC 3N3KB 4P7IA 2ZVOA 5JZEB 1E8XA 2D2QA 4WQOB 2V1YA 2B3AA 2EMTA 4IW0A 2MBHA 3DDCB 3JW0X 3M63B 4I6LB 2N1VA 2KDBA 1SIFA 2LVPA 3W1SC 2N1WA 4MJSA 2FCNA 2OJRA 3VTWA 2KTFA 2L00B 2C7MB 5L95C 3QCAA 4URKA 3VHTC 1XT9B 1YJ1A 2KXJA 2ZPYA 4BKGA 2PPHA 1TZ1A 2KX3A 2R2OA 2C9WB 2CS4A 1ISNA 3H7PB 3ALBA 4GOCA 5D94A 3UIOB 2PE6B 2AYOB 3PRPB 4G0NB 4AJYB 2J0JA 1WI0A 2NBUA 3VH3B 2I1JA 4MDKE 1P9DU 2K1FA 1F9JA 3NY5A 2DZJA 2JT4B 3VXWA 2KX0A 1S1QB 2KJRA 4NPNA 3TIXA 5C1ZA 4DHJB 5J17A 5KHQA 1C3TA 2N4FA 2FCQA 3TCAA 5E6NA 1E90A 1J0GA 3U7DA 2BYFA 2DZKA 1GNUA 3R3MA 4DHZB 1R4NI 2MBBB 4GSWA 5AZHA 4MGIE 3RZWC 1WGDA 2IY0B 2UWQA 3L10B 3A9KB 4E3CA 3NHEB 4II2B 4E71A 4KVGB 4NQLB 2L0FA 2KC2A 3OAWA 1WMHB 4W9IA 3VUXA 3PRMB 4IG7B 4AP4C 1TBEA 2CHXA 4HWIB 1OQYA 2LZ6A 4ZRJA 2G4SA 1WX8A 3BINA 4W9DA 3ZKJC 2ASQA 3A4SC 3ZLZA 4TUUA 4BVUC 2K39A 2WYQA 2ZVNA 2LRUA 3APFA 3DBLI 4PYZA 2Z0DB 3APCA 2FUHB 4MM3A 1I42A 1EO6A 2MWSB 3QWZB 2D10A 4EZKA 5JHBA 3OJ3A 1IYFA 5DPSA 5KHOA 1WGHA 2G45B 2JXXA 2K8CA 2WX0A 4ZRKA 3SU8X 3QQ8B 3W1SA 4W9JA 2IO3B 3KW5B 1KM7A 3HHMA 4K7UA 1VCBA 4TKNA 2C5LC 4LCDE 2XBBC 1WM2A 3PHWB 3HK0A 4DDGD 1WJNA 2R2QA 1UELA 4NAWB 4LJPB 2WWZA 3ONSA 4FLHA 3RZFA 5BO4B 4KDLB 2KWCA 2ZPNA 5HKHA 5AEKB 3CMMB 1S3SG 3ZO5B 2M4NA 3NZUA 4MSMB 1GC7A 4BOZB 1YX6B 2VRRB 1H8CA 2O2VB 2GMIC 2G4DB 4ANWA 3QAQA 5TR5A 3VDZA 1X1MA 1WYWB 3DBSA 1V5TA 3AI5A 3S2AA 4TV3A 2NVUI 3DVNU 3RD2A 4HPMB 3X23A 1V80A 1J8CA 2AL3A 3PZDA 1Z5SB 1WXAA 1ZW7A 5CX3A 2AWTA 3KUZA 4MGYE 1NI2A 2LD9A 2J0MA 4K81A 4GDLB 3W1YA 2D07B 3VUYA 1ZGUB 4BFRA 4NAWA 3RCZA 2LRWA 3A9JB 1XD3B 2NBVB 2LASA 3PS6A 4JQWC 3ZW3A 3K9OB 2A4ZA 1GJZA 3ZIMA 2L0TA 4HPLB 1H4RA 2DZMA 3WA0A 1UH6A 2O6VB 3NZSA 4JLCA 3DQVA 5DPRA 4EKUA 5JHAA 4EFOA 4PYUA 2KQ7A 3SDLC 2HJ8A 2O2VA 3GZNI 4FJVB 2MQJA 1IPGA 1V6EA 3DBHI 2ZJDA 1E8YA 4NJ7A 1WR1A 1LXDA 4WJQA 1EF5A 4M0WB 4OVUA 1P0RA 3SHQA 2KD0A 1EUVB 2BF8B 2LXCA 3Q3JA 2REXA 3UQBA 1WGGA 2KANA 5LXHA 2LUEA 3L0WB 1OGWA 4KIKB 1E5WA 1C1YB 1WE7A 1RRBA 4B6WA 1SE9A 4W9LA 4W9KA 5DCNA 3ML9A 2KMAA 2NS5A 2K25A 2DX5B 4HK2A 4HVBA 3A9JA 5DPWA 4PS3A 3L13A 2M1MA 2BGFA 4PS7A 3WALA 1WZ3A 2K8HA 3VVWB 3DCGA 2O6VA 3IBEA 4W9GA 4FA6A 1WGYA 4F8CB 4W9HA 3ZUNA 4M8MA 3LJ3A 3WIMA 2N9XA 4G3XB 2MW5A 3VAWA 2IO2B 4ANUA 1P3QU 3A4RA 4GIVA 1LM8B 3T9LA 2LGDA 2BYEA 4KV2A 1TGZB 1UGMA 1WJ4A 2HTHA 4I6NB 5CHFA 5D6JB 4GU2A 1T0YA 2EMSA 3D32A 4KIKA 3DPDA 3ZVVA 4MH0E 4DHZE 2DHZA 2KQSA 3PPAA 3QIJA 5FR6A 3V6CB 1Q0WB 3B1LX 3P2BA 1M94A 3TJPA 3H7PA 4HXDA 2L7RA 3SD5A 2Y5BB 2MBOA 2W9NA 1WF9A 3PREA 4DHJD 1E7VA 3V62A 3PHXB 3I3TB 1NBFC 3JYUA 4ASWC 2NCNA 2AEHA 2KJ6A 2LVQA 2MSED 3DBRI 4A3PA 1AARA 1RFAA 2K8BA 3NS8A 1R4MI 3VUWA 4F7ZA 1BT0A 3EFUA 4X57B 3DOWA 2UYZB 2N9EB 3N30A 1KLVA 2BYVE 1V2YA 3VTVA 2DYOA 2BPSA 2CR5A 5D2MB 2N7DA 1WRDB 2KFJA 4IM3A 4MEMA 4EZLA 3IG3A 3Q3FA 3KVFB 4HDQA 4EEWA 4B9KA 3CF6E 2V3SA 1WXVA 2GBKA 2KHWB 3JVZX 3M62B 4RM8A 3V61A 4CHKA 2KWUB 3A9KA 4GMVA 2KFKB 3AXCA 2BKFA 3ZNID 3HM6X 4IWOA 4BBNC 3RULA 2IZVB 1WMHA 1OEYJ 1OEYA 1VD2A 4I6PA 3H1UA 2L3ZA 3H7SA 3BY4B 1WH3A 1GUAB 4A3OA 2MP2B 5CHVC 2M0XA 2RR9A 4KSKC 1WM3A 3UINB 2GOWA 4FULA 3UF8A 5LXIB 3QARA 4HDOA 3M95A 3H9DA 1V49A 4IM0A 3ZTDA 1E8WA 4XC2A 3AU4A 2PE9A 4WAAA 2ZEQA 1J19A 4MGKE 1E8ZA 2BWES 5L83A 5J2RA 1G6JA 2LGYA 4MGZE 3DVNV 4JIOU 2JY6A 4W9FA 4BKTA 2EKEC 1Y8RC 1EF1A 2LJ5A 3AULA 3ZNZB 1P1AA 4G50A 2KFKA 2MRPA 1Q1OA 2C7HA 3EC8A 2RSUA 3L17A 4K7WA 3PGEA 2KWVB 1L7YA 1P98A 3O65B 4GXBA 2I1KA 4OVVA 2JVCA 1WR6E 3IVFA 2FCSA 4HCPB 3ECIA 1GG3A 2C7NB 2DYBA 1ZKHA 3K9PB 1L2NA 1WZ0A 1UZXB 2MP2A 3ZRCA 2KMCA 2YLMA 2GBJA 3RYTA 2XEWA 4NQKE 4FBJB 4BKSA 1I35A 2PEAA 4LJOB 2CKHB 2RPQA 5DPTA 2LVOA 4MSQB 1JRUA 2MX2A 4AOFA 2G3QB 4II3B 3TBLD 2L8JA 4GN1A 2DAJA 2FIDA 1NDDA 2CHZA 3B0AA 4NJ6A 1RLFA 1A5RA 1E7UA 2M8SA 2IO0B 3R7RA 3WANA 4K7SA 4FHJA 4GDKB 1RAXA 3U8ZA 4AUQC 3RT3B 1WE6A 3KH0A 4EZJA 1LFDA 2O6VD 4WJNA 3HIZA 3OLMD 1XQQA 4LDTD 2MBEA 4GGQA 2JWZA 2KZRA 4GDLA 4WWNA 4KZ0A 4F1SA 2JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Q B;  2KDF B;  3KYD D;  5G55 A;  3PLU A;  4CO7 A;  3V60 A;  2FAZ A;  2J0K A;  2QHO A;  5LLI A;  4B95 A;  2KLG A;  2L76 A;  3L16 A;  4FJY A;  4IWQ A;  2XK5 B;  4JL9 A;  5C23 A;  3VFK A;  3VQI A;  3N32 A;  1YD8 U;  4XZ4 A;  4JGH B;  2Z59 B;  1QZE A;  2FIF A;  3C0R B;  2JRH A;  2LI5 A;  3T8M A;  3H6N A;  5IAA C;  4GDK A;  4KZC A;  5E6O A;  3ZTC A;  4ANX A;  3ZRF A;  2KNB A;  2JF5 A;  4WWO A;  2PJH A;  2FNJ B;  2JRI B;  2D11 A;  4AJW A;  4DDI D;  4M8N A;  2KN5 A;  3NOB A;  3MHS D;  1MG8 A;  2KOX A;  3PRZ A;  4E74 A;  1FXT B;  2CHW A;  2N7E A;  4W9C A;  1V81 A;  2KKC A;  2JUO A;  2HE7 A;  3R7Q A;  3V6E B;  4FHK A;  2ZZP B;  4KSL C;  4ANV A;  3A1Q A;  1V9J A;  3IFW B;  2KVR A;  1U4A A;  3DVG X;  2JZ3 B;  3LDZ E;  3ML8 A;  2KK8 A;  3X0W A;  4HLE A;  2Z0E B;  4TQ0 A;  3TMP B;  4EUT A;  1YIW A;  3QC8 B;  3QK0 A;  4GB9 A;  2XK5 A;  2DEN B;  1D3Z A;  3PV1 A;  1PQS A;  3L54 A;  3QJZ A;  2NR2 A;  1OTR B;  2LXA A;  1K8R B;  2D3G A;  3MTN B;  3ZDT A;  1KOT A;  2MBQ A;  2ZCC A;  1WJ6 A;  2KC1 A;  4WJP A;  2GBN A;  2IO1 B;  2NPT B;  3DVG Y;  2MA9 B;  2C60 A;  1WFY A;  3PLV A;  2WDT B;  5IA7 A;  4NY0 A;  4IC7 B;  4FJZ A;  2J7Q B;  1YQB A;  2YVC A;  2CU1 A;  2BKR B;  1KJT A;  4DWF A;  1V5O A;  2WX1 A;  3ENE A;  4FN2 A;  2KO3 A;  2LGX A;  4MEL A;  4NNJ B;  3KYC D;  3PTF C;  4HCN B;  3ZNH B;  2DZI A;  2RD0 A;  3OJ4 B;  4XX5 A;  3ZDM C;  4ZDV A;  5JH5 C;  3M3J A;  3MJW A;  2AL6 A;  2DAF A;  2KDI A;  2LWP A;  3KUD B;  3WAO A;  1YX5 B;  1IP9 A;  4ICU A;  3RUI B;  5E6P A;  1WJU A;  3UQA A;  2IYD B;  4FAD A;  4K1R B;  3HM3 A;  1UBI A;  1WY8 A;  4RMA A;  4IWP A;  3U30 A;  1WX9 A;  4EOY A;  4ZYN A;  2RGF A;  2ZNV C;  2ZCB A;  2JZZ A;  5AZG A;  3VTU A;  3QX1 A;  1HE8 A;  3PSE B;  1WXM A;  3WAP A;  2GBM A;  2L05 A;  3JSV B;  4ZRI A;  5J18 A;  3AU5 A;  2MCN B;  3QHT A;  4IUM B;  3CST A;  5GMV A;  5CHW A;  2KTR B;  4DK5 A;  2NPT A;  4TQ1 A;  3KUC B;  5AZF A;  3IHP C;  1TTN A;  4ICV A;  3WAM A;  2HD5 B;  4BKS D;  5G2N A;  2DYM A;  4BOS C;  2KLC A;  3QA8 A;  3R66 C;  2A5U A;  4HJK A;  4BBN F;  4G11 A;  3UIP B;  2K6D B;  2OOB B;  3CSF A;  1WGR A;  3PT2 B;  3ZNG C;  4A20 A;  3TL5 A;  3EHV A;  5D7G A;  2M17 A;  2ZNV B;  4WJO A;  3A33 B;  2MLB A;  4AWJ A;  4MJS B;  2V4L A;  3UGB B;  1WIA A;  5CTR C;  4DXA B;  1UBQ A;  1Z2M A;  2NBW B;  2K6Q A;  3L08 A;  1UD7 A;  2IY1 B;  4YL8 A;  3JSV A;  3APD A;  4CYE A;  4WWP A;  4DBG A;  4KDI C;  2KJH B;  1LQB A;  1CMX B;  4J6I A;  2IBI B;  2KDE B;  2GBR A;  4IM2 A;  1WX7 A;  3EEC A;  2KTR A;  4N9F 4;  3PVL A;  1Q5W B;  1V86 A;  1GC6 A;  1WXS A;  3GOE A;  2BWF A;  4RM9 A;  3B08 A;  4PS8 A;  4W9E A;  4LDT B;  1SGH A;  2FCM A;  5EDS A;  3VH4 B;  2N9P C;  3N3K B;  4P7I A;  2ZVO A;  5JZE B;  1E8X A;  2D2Q A;  4WQO B;  2V1Y A;  2B3A A;  2EMT A;  4IW0 A;  2MBH A;  3DDC B;  3JW0 X;  3M63 B;  4I6L B;  2N1V A;  2KDB A;  1SIF A;  2LVP A;  3W1S C;  2N1W A;  4MJS A;  2FCN A;  2OJR A;  3VTW A;  2KTF A;  2L00 B;  2C7M B;  5L95 C;  3QCA A;  4URK A;  3VHT C;  1XT9 B;  1YJ1 A;  2KXJ A;  2ZPY A;  4BKG A;  2PPH A;  1TZ1 A;  2KX3 A;  2R2O A;  2C9W B;  2CS4 A;  1ISN A;  3H7P B;  3ALB A;  4GOC A;  5D94 A;  3UIO B;  2PE6 B;  2AYO B;  3PRP B;  4G0N B;  4AJY B;  2J0J A;  1WI0 A;  2NBU A;  3VH3 B;  2I1J A;  4MDK E;  1P9D U;  2K1F A;  1F9J A;  3NY5 A;  2DZJ A;  2JT4 B;  3VXW A;  2KX0 A;  1S1Q B;  2KJR A;  4NPN A;  3TIX A;  5C1Z A;  4DHJ B;  5J17 A;  5KHQ A;  1C3T A;  2N4F A;  2FCQ A;  3TCA A;  5E6N A;  1E90 A;  1J0G A;  3U7D A;  2BYF A;  2DZK A;  1GNU A;  3R3M A;  4DHZ B;  1R4N I;  2MBB B;  4GSW A;  5AZH A;  4MGI E;  3RZW C;  1WGD A;  2IY0 B;  2UWQ A;  3L10 B;  3A9K B;  4E3C A;  3NHE B;  4II2 B;  4E71 A;  4KVG B;  4NQL B;  2L0F A;  2KC2 A;  3OAW A;  1WMH B;  4W9I A;  3VUX A;  3PRM B;  4IG7 B;  4AP4 C;  1TBE A;  2CHX A;  4HWI B;  1OQY A;  2LZ6 A;  4ZRJ A;  2G4S A;  1WX8 A;  3BIN A;  4W9D A;  3ZKJ C;  2ASQ A;  3A4S C;  3ZLZ A;  4TUU A;  4BVU C;  2K39 A;  2WYQ A;  2ZVN A;  2LRU A;  3APF A;  3DBL I;  4PYZ A;  2Z0D B;  3APC A;  2FUH B;  4MM3 A;  1I42 A;  1EO6 A;  2MWS B;  3QWZ B;  2D10 A;  4EZK A;  5JHB A;  3OJ3 A;  1IYF A;  5DPS A;  5KHO A;  1WGH A;  2G45 B;  2JXX A;  2K8C A;  2WX0 A;  4ZRK A;  3SU8 X;  3QQ8 B;  3W1S A;  4W9J A;  2IO3 B;  3KW5 B;  1KM7 A;  3HHM A;  4K7U A;  1VCB A;  4TKN A;  2C5L C;  4LCD E;  2XBB C;  1WM2 A;  3PHW B;  3HK0 A;  4DDG D;  1WJN A;  2R2Q A;  1UEL A;  4NAW B;  4LJP B;  2WWZ A;  3ONS A;  4FLH A;  3RZF A;  5BO4 B;  4KDL B;  2KWC A;  2ZPN A;  5HKH A;  5AEK B;  3CMM B;  1S3S G;  3ZO5 B;  2M4N A;  3NZU A;  4MSM B;  1GC7 A;  4BOZ B;  1YX6 B;  2VRR B;  1H8C A;  2O2V B;  2GMI C;  2G4D B;  4ANW A;  3QAQ A;  5TR5 A;  3VDZ A;  1X1M A;  1WYW B;  3DBS A;  1V5T A;  3AI5 A;  3S2A A;  4TV3 A;  2NVU I;  3DVN U;  3RD2 A;  4HPM B;  3X23 A;  1V80 A;  1J8C A;  2AL3 A;  3PZD A;  1Z5S B;  1WXA A;  1ZW7 A;  5CX3 A;  2AWT A;  3KUZ A;  4MGY E;  1NI2 A;  2LD9 A;  2J0M A;  4K81 A;  4GDL B;  3W1Y A;  2D07 B;  3VUY A;  1ZGU B;  4BFR A;  4NAW A;  3RCZ A;  2LRW A;  3A9J B;  1XD3 B;  2NBV B;  2LAS A;  3PS6 A;  4JQW C;  3ZW3 A;  3K9O B;  2A4Z A;  1GJZ A;  3ZIM A;  2L0T A;  4HPL B;  1H4R A;  2DZM A;  3WA0 A;  1UH6 A;  2O6V B;  3NZS A;  4JLC A;  3DQV A;  5DPR A;  4EKU A;  5JHA A;  4EFO A;  4PYU A;  2KQ7 A;  3SDL C;  2HJ8 A;  2O2V A;  3GZN I;  4FJV B;  2MQJ A;  1IPG A;  1V6E A;  3DBH I;  2ZJD A;  1E8Y A;  4NJ7 A;  1WR1 A;  1LXD A;  4WJQ A;  1EF5 A;  4M0W B;  4OVU A;  1P0R A;  3SHQ A;  2KD0 A;  1EUV B;  2BF8 B;  2LXC A;  3Q3J A;  2REX A;  3UQB A;  1WGG A;  2KAN A;  5LXH A;  2LUE A;  3L0W B;  1OGW A;  4KIK B;  1E5W A;  1C1Y B;  1WE7 A;  1RRB A;  4B6W A;  1SE9 A;  4W9L A;  4W9K A;  5DCN A;  3ML9 A;  2KMA A;  2NS5 A;  2K25 A;  2DX5 B;  4HK2 A;  4HVB A;  3A9J A;  5DPW A;  4PS3 A;  3L13 A;  2M1M A;  2BGF A;  4PS7 A;  3WAL A;  1WZ3 A;  2K8H A;  3VVW B;  3DCG A;  2O6V A;  3IBE A;  4W9G A;  4FA6 A;  1WGY A;  4F8C B;  4W9H A;  3ZUN A;  4M8M A;  3LJ3 A;  3WIM A;  2N9X A;  4G3X B;  2MW5 A;  3VAW A;  2IO2 B;  4ANU A;  1P3Q U;  3A4R A;  4GIV A;  1LM8 B;  3T9L A;  2LGD A;  2BYE A;  4KV2 A;  1TGZ B;  1UGM A;  1WJ4 A;  2HTH A;  4I6N B;  5CHF A;  5D6J B;  4GU2 A;  1T0Y A;  2EMS A;  3D32 A;  4KIK A;  3DPD A;  3ZVV A;  4MH0 E;  4DHZ E;  2DHZ A;  2KQS A;  3PPA A;  3QIJ A;  5FR6 A;  3V6C B;  1Q0W B;  3B1L X;  3P2B A;  1M94 A;  3TJP A;  3H7P A;  4HXD A;  2L7R A;  3SD5 A;  2Y5B B;  2MBO A;  2W9N A;  1WF9 A;  3PRE A;  4DHJ D;  1E7V A;  3V62 A;  3PHX B;  3I3T B;  1NBF C;  3JYU A;  4ASW C;  2NCN A;  2AEH A;  2KJ6 A;  2LVQ A;  2MSE D;  3DBR I;  4A3P A;  1AAR A;  1RFA A;  2K8B A;  3NS8 A;  1R4M I;  3VUW A;  4F7Z A;  1BT0 A;  3EFU A;  4X57 B;  3DOW A;  2UYZ B;  2N9E B;  3N30 A;  1KLV A;  2BYV E;  1V2Y A;  3VTV A;  2DYO A;  2BPS A;  2CR5 A;  5D2M B;  2N7D A;  1WRD B;  2KFJ A;  4IM3 A;  4MEM A;  4EZL A;  3IG3 A;  3Q3F A;  3KVF B;  4HDQ A;  4EEW A;  4B9K A;  3CF6 E;  2V3S A;  1WXV A;  2GBK A;  2KHW B;  3JVZ X;  3M62 B;  4RM8 A;  3V61 A;  4CHK A;  2KWU B;  3A9K A;  4GMV A;  2KFK B;  3AXC A;  2BKF A;  3ZNI D;  3HM6 X;  4IWO A;  4BBN C;  3RUL A;  2IZV B;  1WMH A;  1OEY J;  1OEY A;  1VD2 A;  4I6P A;  3H1U A;  2L3Z A;  3H7S A;  3BY4 B;  1WH3 A;  1GUA B;  4A3O A;  2MP2 B;  5CHV C;  2M0X A;  2RR9 A;  4KSK C;  1WM3 A;  3UIN B;  2GOW A;  4FUL A;  3UF8 A;  5LXI B;  3QAR A;  4HDO A;  3M95 A;  3H9D A;  1V49 A;  4IM0 A;  3ZTD A;  1E8W A;  4XC2 A;  3AU4 A;  2PE9 A;  4WAA A;  2ZEQ A;  1J19 A;  4MGK E;  1E8Z A;  2BWE S;  5L83 A;  5J2R A;  1G6J A;  2LGY A;  4MGZ E;  3DVN V;  4JIO U;  2JY6 A;  4W9F A;  4BKT A;  2EKE C;  1Y8R C;  1EF1 A;  2LJ5 A;  3AUL A;  3ZNZ B;  1P1A A;  4G50 A;  2KFK A;  2MRP A;  1Q1O A;  2C7H A;  3EC8 A;  2RSU A;  3L17 A;  4K7W A;  3PGE A;  2KWV B;  1L7Y A;  1P98 A;  3O65 B;  4GXB A;  2I1K A;  4OVV A;  2JVC A;  1WR6 E;  3IVF A;  2FCS A;  4HCP B;  3ECI A;  1GG3 A;  2C7N B;  2DYB A;  1ZKH A;  3K9P B;  1L2N A;  1WZ0 A;  1UZX B;  2MP2 A;  3ZRC A;  2KMC A;  2YLM A;  2GBJ A;  3RYT A;  2XEW A;  4NQK E;  4FBJ B;  4BKS A;  1I35 A;  2PEA A;  4LJO B;  2CKH B;  2RPQ A;  5DPT A;  2LVO A;  4MSQ B;  1JRU A;  2MX2 A;  4AOF A;  2G3Q B;  4II3 B;  3TBL D;  2L8J A;  4GN1 A;  2DAJ A;  2FID A;  1NDD A;  2CHZ A;  3B0A A;  4NJ6 A;  1RLF A;  1A5R A;  1E7U A;  2M8S A;  2IO0 B;  3R7R A;  3WAN A;  4K7S A;  4FHJ A;  4GDK B;  1RAX A;  3U8Z A;  4AUQ C;  3RT3 B;  1WE6 A;  3KH0 A;  4EZJ A;  1LFD A;  2O6V D;  4WJN A;  3HIZ A;  3OLM D;  1XQQ A;  4LDT D;  2MBE A;  4GGQ A;  2JWZ A;  2KZR A;  4GDL A;  4WWN A;  4KZ0 A;  4F1S A;  2JPH A; 
#chains in the Genus database with same CATH topology
 2KDF B;  4NZL B;  1WGK A;  4CO7 A;  1J7B A;  1T0R C;  4CQN A;  4B95 A;  2J52 A;  4IWQ A;  3ZGZ A;  1ZDX A;  3T8M A;  3H6N A;  1NEN B;  1ZE3 D;  1YOV B;  4GDK A;  3ZTC A;  3BVM A;  4ANX A;  2PJH A;  2JRI B;  2D11 A;  3NOB A;  2CHW A;  2N7E A;  4OW0 A;  4KSL C;  1FO4 A;  1F0Z A;  4ARI A;  3A1Q A;  5LNK 1;  2JZ3 B;  1DOX A;  2KK8 A;  4WWM A;  2K3U A;  2QIE B;  2XK5 A;  3PV1 A;  3V3X A;  4RF0 A;  2BS3 B;  2J42 A;  2D3G A;  3AE1 B;  1MI0 A;  3MC0 B;  1E0Z A;  2MBQ A;  3PLV A;  2J7Q B;  2WX1 A;  3ENE A;  3KYC D;  3ZNH B;  3W2D A;  2DZI A;  5JH5 C;  3DBL B;  2AL6 A;  2DAF A;  3MJW A;  4HPP A;  4FXC A;  4ICU A;  1WJU A;  3U52 E;  4YXD B;  1HXY D;  1WY8 A;  3KWV A;  3U30 A;  4ZYN A;  3BVZ A;  1XO3 A;  3AEB B;  2M0A A;  3WAP A;  2BVC A;  2L05 A;  3AU5 A;  2MCN B;  1QOB A;  4IUM B;  4TSS A;  5CHW A;  2TSS A;  4DK5 A;  3KUC B;  3IHP C;  1YQ3 B;  3SFE B;  4BOS C;  2A5U A;  2JYE A;  4BBN F;  3UIP B;  2LHD A;  1DGJ A;  1UF0 A;  3TL5 A;  2IND C;  3C8Y A;  5D7G A;  1GOZ A;  2WXI A;  1V8C A;  1WIA A;  3AEA B;  1EU3 A;  4CYE A;  3DWM A;  4KDI C;  3CWI A;  4J6I A;  4IM2 A;  3EEC A;  3PVL A;  1GC6 A;  3B08 A;  2WXF A;  2YEP B;  2N9P C;  4B0M A;  4IW0 A;  2EMT A;  4YTN B;  3M63 B;  1T0S C;  5D3D A;  2N1V A;  2KDB A;  1SIF A;  3VTW A;  2C7M B;  1QOG A;  3QCA A;  4URK A;  4M00 A;  2WLB A;  1YJ1 A;  3P4P B;  3HVD A;  2KX3 A;  2R2O A;  2CS4 A;  2PE6 B;  2BYT A;  4K3B A;  3B9J A;  4S17 A;  2AYO B;  2N0S B;  3Q8F A;  4JWU C;  2J0J A;  1WI0 A;  1JWB D;  2NBU A;  4P16 A;  1FRD A;  3BYY B;  4KX6 B;  2K1F A;  3VXW A;  5C1Z A;  2PIA A;  1C9F A;  2WXG A;  1T5X D;  1E90 A;  3U7D A;  3MFG A;  1PFD A;  1GNU A;  4MAC A;  5AZH A;  1V97 A;  3RZW C;  1FCL A;  2QJL A;  3Q3M C;  4E3C A;  1ZXH A;  3OAW A;  1I4R A;  3VUX A;  2CHX A;  2LZ6 A;  4ZRJ A;  2G4S A;  3AEG B;  3BIN A;  4W9D A;  2ASQ A;  2KQ4 X;  3A4S C;  5H92 C;  4AS1 A;  2BQQ A;  2ZVN A;  3APF A;  4PYZ A;  2BT6 A;  2FUH B;  1VJK A;  4MM3 A;  3H8H A;  1PGA A;  2QIL A;  4EZK A;  1IYF A;  5KHO A;  1WGH A;  2WX0 A;  3QQ8 B;  5EE1 A;  3OG5 A;  1FEH A;  3KWL A;  4LNN A;  4TKN A;  2C5L C;  2AX5 A;  3GB1 A;  4DDG D;  3J9C A;  1UEL A;  2WWZ A;  3RZF A;  4KDL B;  3CMM B;  2MH7 A;  1STE A;  5IKC M;  3AE4 B;  1VR9 A;  2L52 A;  3QAQ A;  3NUH B;  3RNF C;  4D2K A;  1WYW B;  3S2A A;  4B0E A;  4XGA B;  4P6V F;  1IUE A;  1MPE A;  3PZD A;  1Z5S B;  1N6Z A;  1WXA A;  1ZW7 A;  2LD9 A;  2J0M A;  3IAS 1;  4GDL B;  2CU3 A;  1GB4 A;  3VUY A;  1ZGU B;  3RCZ A;  2ICI A;  4RFB A;  3EFC A;  4HPL B;  1H4R A;  4XWT A;  3BK2 A;  1D4B A;  4JLC A;  1I4G A;  4EFO A;  4A6Q A;  3GZN I;  4MH8 A;  1V6E A;  3BWU D;  2FUG 1;  3GZN B;  4NJ7 A;  1XEE A;  1WR1 A;  2INP E;  4M0W B;  2XN9 C;  3Q3J A;  2REX A;  1SBB B;  2LUE A;  4DQO C;  4KIK B;  2DWQ A;  1WE7 A;  4W9L A;  4N58 A;  2NS5 A;  2LEK A;  4HVB A;  3A9J A;  3NZ3 A;  2QC8 A;  2GB1 A;  3WAL A;  4YSX B;  1ZP0 B;  2NTT A;  3DCG A;  3IBE A;  4FA6 A;  4W9H A;  2WNM A;  1I4P A;  2MW5 A;  1TKE A;  3T9L A;  4KV2 A;  2BYE A;  5CHF A;  2MJD A;  1T0Y A;  2EMS A;  2MHJ A;  2WQY B;  3D32 A;  1NEK B;  4MH0 E;  2DHZ A;  4ZRP A;  2KQS A;  1TIF A;  1Q0W B;  3P2B A;  1M94 A;  1ET6 A;  4DHJ D;  1FD6 A;  2H89 B;  4RGO S;  3V62 A;  2HJ1 A;  3Q8B A;  2W3S A;  1NBF C;  4ASW C;  2K9X A;  1I4X A;  2NCN A;  2LVQ A;  1AAR A;  3U2S C;  1RFA A;  1TS3 A;  2N9E B;  1KLV A;  2WXN A;  2DYO A;  1F77 A;  2BPS A;  2KFJ A;  4LNK A;  1HZ6 A;  4BZA A;  3NVW A;  4HDQ A;  2QDF A;  3CF6 E;  1WXV A;  4N59 A;  3IAM 1;  5C3J B;  3SFD B;  3NJT A;  3V61 A;  2WU2 B;  3HM6 X;  5HHD G;  4NJC A;  1WMH A;  1QT9 A;  4A90 A;  1RFK A;  3Q6B A;  2HTM E;  1SE3 A;  3H7S A;  4A3O A;  2MP2 B;  2M0X A;  2I38 A;  1WXQ A;  3R2I A;  4DXF A;  3GE8 C;  5LXI B;  3H9D A;  1J7C A;  1E8W A;  4RNA A;  1IBX A;  4MGZ E;  3DVN V;  2KN4 A;  3FKY A;  1Y8R C;  1P1A A;  3SEB A;  1ZXI A;  3HUI A;  2C7H A;  3EC8 A;  4LK0 M;  4ZOH C;  3PGE A;  1L7Y A;  4GXB A;  4OVV A;  1HA5 A;  1C77 A;  4HCP B;  1GG3 A;  1YN4 A;  2Q5W D;  1UZX B;  5IOI A;  2J4X A;  2PVG C;  4JE3 B;  2XEW A;  4NQK E;  1FFV A;  2PEA A;  5H8Y E;  3TBL D;  1L6V A;  4GN1 A;  3B0A A;  2IO0 B;  3WAN A;  3ZJU A;  4K7S A;  1JQ4 A;  4AUQ C;  1K51 A;  4WJN A;  1XXG A;  4LDT D;  2MBE A;  5D3I B;  1YN3 A;  2JWZ A;  3AE6 B;  4KZ0 A;  2WP9 B;  4KGT A;  1RWS A;  3KYD D;  5G55 A;  2QHO A;  1FXA A;  2J0K A;  4LTU A;  1NI3 A;  2KLG A;  3AE5 B;  3URY A;  2L76 A;  3VR8 B;  4FJY A;  5C23 A;  3AEF B;  3VFK A;  1C76 A;  2KMM A;  4JGH B;  5IAA C;  5E6O A;  3ZRF A;  2JF5 A;  4AJW A;  3TEY A;  4ZRQ A;  2D3A A;  3PRZ A;  2KOX A;  2LMC A;  2WDV B;  3T3N A;  1V81 A;  2KKC A;  2JUO A;  2HE7 A;  3R7Q A;  3V6E B;  2NTS A;  2ZZP B;  4USA A;  3IFW B;  1SJE D;  3DVG X;  3AED B;  2M56 B;  4ZHP A;  3LDZ E;  3X0W A;  2Z0E B;  3TMP B;  1YIW A;  3QC8 B;  4GB9 A;  3L54 A;  2NR2 A;  1OTR B;  1K8R B;  3MTN B;  4HEA 1;  1JRP A;  2KC1 A;  4WJP A;  2GBN A;  2IO1 B;  2NPT B;  2MA9 B;  2C60 A;  1WFY A;  5IA7 A;  2WDT B;  4NY0 A;  4IC7 B;  1HTQ A;  4QAY A;  1FNU A;  1RYJ A;  3RMK C;  2QMT A;  4MEL A;  4NNJ B;  2LGX A;  3PTF C;  2RD0 A;  3ZDM C;  4ZDV A;  3WAO A;  1IP9 A;  3BK1 A;  3UQA A;  4FAD A;  4IWP A;  2RGF A;  2ZNV C;  2ZCB A;  3VTU A;  1HE8 A;  3PSE B;  5E6J A;  1MHH E;  3CST A;  2KTR B;  1V1P B;  4RH6 A;  1CQV A;  3WAM A;  2KVZ A;  2DYM A;  4C4V B;  5C2T B;  2K6D B;  4A20 A;  1SIJ A;  1HTO A;  1PGB A;  1EU4 A;  2V3P A;  2ZNV B;  4WJO A;  2RDG A;  2INN E;  4MJS B;  3NG0 A;  3UGB B;  4DXA B;  1UBQ A;  2NBW B;  3MHZ A;  3L08 A;  1UD7 A;  3JSV A;  3APD A;  4DBG A;  4PT5 A;  1SXT A;  1CMX B;  2KDE B;  2GBR A;  4N9F 4;  2ON8 A;  2BWF A;  4RM9 A;  1YQ4 B;  4LDT B;  1JW9 D;  1SGH A;  2FCM A;  3N3K B;  4DXG A;  1E8X A;  2D2Q A;  4JWS C;  2OJW A;  2V1Y A;  2B3A A;  2K22 A;  2MBH A;  1N60 A;  4I6L B;  2WHI A;  3W1S C;  2N1W A;  2FCN A;  2KTF A;  3AM9 A;  5L95 C;  2KXJ A;  2PPH A;  4GOC A;  2C9W B;  1ISN A;  5D94 A;  1F2R C;  4PK1 A;  2EKI A;  4AJY B;  3VH3 B;  3TEW A;  2R61 A;  4WIP A;  2I1J A;  1ZDV A;  2N9L A;  1F9J A;  3TUO A;  2OHF A;  2KX0 A;  3TIX A;  5J17 A;  2N4F A;  5E6N A;  1UNS A;  3CIR B;  2LGI A;  1R4N I;  1R4N B;  1BUI C;  1WGD A;  2UWQ A;  2WXK A;  3NHE B;  4KVG B;  2L0F A;  2KC2 A;  4OZB A;  1WMH B;  3PRM B;  4OZC A;  4HWI B;  4TUU A;  3I9V 1;  2KWD A;  2RDH A;  3DBL I;  3DBR B;  1R4M B;  1QOA A;  1EO6 A;  3EGR A;  5JHB A;  2PVO D;  5DPS A;  3SU8 X;  2JXX A;  4JPS A;  4W9J A;  3KW5 B;  2PMV A;  1JWU D;  2XBB C;  2X38 A;  4REZ A;  1WM2 A;  1WJN A;  3ONS A;  3ZXV A;  1NVI D;  2KWC A;  3AN1 A;  2ZPN A;  5HKH A;  3BII D;  1KFY B;  1S3S G;  2V0G A;  2M4N A;  1GC7 A;  2LUM A;  2VRR B;  1H8C A;  2O2V B;  3T3O A;  2L1A A;  2GI9 A;  2KDM A;  1ZUD 2;  4Q2J A;  1V80 A;  1VRA B;  5CX3 A;  2HDE A;  1L6U A;  1B1Z A;  3KUZ A;  4MGY E;  1NI2 A;  2VZK D;  1F1H A;  1JAL A;  4P1C C;  1KF6 B;  4K81 A;  4BFR A;  1OFF A;  4NAW A;  1IGD A;  2NBV B;  1LGR A;  3SR6 A;  3AEE B;  2L0T A;  3WA0 A;  1UH6 A;  3Q14 C;  3NZS A;  3SDL C;  2WXM A;  2ZJD A;  1FNV A;  1K50 A;  3AMZ A;  4UDU C;  1LXD A;  4WJQ A;  2KD0 A;  1I7H A;  4TMA B;  2KAN A;  1CK1 A;  2JSV X;  1C1Y B;  1D5X C;  1K52 A;  1SE9 A;  4XYC A;  1JWM D;  4W9K A;  5DCN A;  2KMA A;  4YWG G;  2K25 A;  4HK2 A;  1DOI A;  5DPW A;  3KQ4 A;  3WCQ A;  1WZ3 A;  2IJ0 A;  2K8H A;  3VVW B;  1ROE A;  2O6V A;  4F8C B;  3ZUN A;  1PDX A;  4M8M A;  3LJ3 A;  5MPO A;  2MJ3 A;  2N9X A;  2W3R A;  2IO2 B;  4ANU A;  1P3Q U;  1E7P B;  4GIV A;  2LGD A;  1FXI A;  1TGZ B;  1UGM A;  4I6N B;  3OWE B;  2L83 A;  3DPD A;  3B1L X;  3H7P A;  3O13 A;  4HXD A;  3SD5 A;  1XLP A;  2MBO A;  1SB3 C;  3PHX B;  1GPX A;  3FIL A;  2MSE D;  4A3P A;  5BYR A;  3NS8 A;  1FFU A;  3EFU A;  3DOW A;  2BYV E;  3DHH C;  5D2M B;  2CR5 A;  5AUI A;  3IG3 A;  2D3B A;  4EEW A;  5JXV A;  1AWD A;  2JX5 A;  3M62 B;  2KWU B;  4GMV A;  1MHX A;  2BKF A;  1ZOY B;  3ZNI D;  4IWO A;  4WQM A;  1L0V B;  4OVZ A;  3PZ8 A;  2L3Z A;  4ACF A;  1WH3 A;  1GUA B;  2RR9 A;  4XWW A;  1WM3 A;  1L5P A;  1VLB A;  4R3D A;  4S0R A;  5BYQ A;  4HDO A;  4XC2 A;  4WAF A;  1EM7 A;  1EWY C;  2ZEQ A;  5L83 A;  2BWE S;  2LGY A;  4JIO U;  4W9F A;  4BKT A;  4C80 A;  2LJ5 A;  3AUL A;  5IN7 A;  2KFK A;  3B2F A;  3FC4 A;  2MRP A;  4OZA A;  3MJ5 A;  3MP9 A;  2VZK B;  2JVC A;  3AE7 B;  2C7N B;  2DYB A;  1ZKH A;  3ZRC A;  2YLM A;  2GBJ A;  4WH4 A;  1L0Y B;  4BKS A;  4LJO B;  4MSQ B;  2MX2 A;  4L2Y A;  1NDD A;  2CHZ A;  2M8S A;  4GDK B;  3U8Z A;  3KH0 A;  4EZJ A;  1LFD A;  2O6V D;  1XQQ A;  2KZR A;  4WWN A;  1I4Q A;  1FRR A;  4F1S A;  2JPH A;  3A1Q B;  1JWA D;  3PLU A;  2FAZ A;  5LLI A;  2IGG A;  3U7Z A;  4JL9 A;  2XK5 B;  1YJJ A;  3VQI A;  3N32 A;  1QZE A;  2FIF A;  3C0R B;  2LI5 A;  4YTM B;  4KZC A;  1XLQ A;  2KNB A;  1IGC A;  2KN5 A;  1MG8 A;  1FXT B;  3P4R B;  2QCZ A;  4FHK A;  1C4P A;  2LFI A;  4RGM A;  2NMQ A;  1U4A A;  2LHE A;  3ML8 A;  1VZ7 A;  4HLE A;  3EA6 A;  3QK0 A;  3RFZ B;  2DEN B;  1D3Z A;  1PQS A;  2QEJ C;  3QJZ A;  1N5X A;  1HZ5 A;  2W55 A;  3DHI C;  2ZCC A;  3VR9 B;  2WXO A;  3DVG Y;  1FNW A;  1YQB A;  2YVC A;  2CU1 A;  2BKR B;  1KJT A;  2N9K A;  5EE9 A;  4DWF A;  1V5O A;  4FN2 A;  2KO3 A;  3LB8 C;  4HCN B;  3V05 A;  4XX5 A;  3OJ4 B;  3M3J A;  1YX5 B;  3I57 A;  2I2Y A;  1TYG B;  2IYD B;  3HM3 A;  1N5W A;  4EOY A;  2ZW1 A;  2JZZ A;  3QX1 A;  3U4E G;  1QQR A;  5GMV A;  4TQ1 A;  5FK9 C;  5AZF A;  4ICV A;  1TS5 A;  4BKS D;  5G2N A;  2KLC A;  3R66 C;  3NS1 A;  2V9H A;  4G11 A;  2OOB B;  3PT2 B;  3EHV A;  1MFW A;  1V1O A;  2WS3 B;  3A33 B;  2AQ3 B;  3AE8 B;  5CTR C;  2AQ1 B;  1MVK A;  2K6Q A;  4WWP A;  3KLS X;  2KJH B;  1NYQ A;  1DOY A;  1WX7 A;  1PYW D;  2W54 A;  3N1X C;  1Q5W B;  1V86 A;  2X8X X;  3GOE A;  2N7J A;  5EDS A;  2ZVO A;  2E3T A;  1FIQ A;  1TKG A;  2IGD A;  2LVP A;  3AH7 A;  4J3O D;  3VHT C;  1UUP A;  1XT9 B;  4BKG A;  1TZ1 A;  3H7P B;  3MC8 A;  1SF0 A;  1SSN A;  2GLS A;  1FMA D;  3PRP B;  2BS2 B;  1YMH E;  1KLU D;  4MDK E;  2JWU A;  3NY5 A;  3FAH A;  4MM3 B;  2DZJ A;  3R8B A;  4GLS C;  1N62 A;  4DHJ B;  4NAM A;  2Y5C A;  1C3T A;  2CJO A;  2BYF A;  2DZK A;  2MBB B;  1P7F A;  2ZW0 A;  4MGI E;  1E6E B;  2IY0 B;  3L10 B;  4E71 A;  4II2 B;  3Q69 A;  4W9I A;  4IG7 B;  3ABV B;  3AEC B;  3ZLZ A;  3DHG C;  4BVU C;  2WYQ A;  5I4D A;  2Z0D B;  1I42 A;  2MWS B;  3QWZ B;  2D10 A;  5EE0 A;  2WXR A;  4ZRK A;  1N63 A;  4HJG E;  2WDR B;  2IO3 B;  4HKZ E;  3HHM A;  4K7U A;  2K5P A;  3AE9 B;  2D3C A;  3ZXR A;  2QSD A;  3ZYY X;  1SJH D;  1ZPS A;  2BBC A;  4XDD A;  4C00 A;  3NZU A;  3W9C B;  4BOZ B;  1YX6 B;  1HEZ E;  2G4D B;  1TY2 A;  4ANW A;  1K53 A;  3DBS A;  1V5T A;  3AI5 A;  4TV3 A;  2NVU I;  3DVN U;  1J8C A;  5HI1 A;  2AWT A;  3W1Y A;  3EUB 2;  3DWG C;  4P1B C;  3A9J B;  2LAS A;  3PS6 A;  3ZW3 A;  3K9O B;  1JRO A;  2A4Z A;  1GJZ A;  5G5G A;  2DZM A;  5BMG A;  1XLO A;  4EKU A;  5JHA A;  1F52 A;  4PYU A;  2KQ7 A;  2DLB A;  2MQJ A;  3IT4 B;  1QF6 A;  4OHJ A;  3DBH I;  1ACC A;  3IT6 B;  3DBH B;  4YTP B;  1EF5 A;  2LXC A;  3UQB A;  1WGG A;  5LXH A;  3L0W B;  5BMI A;  1E5W A;  2OED A;  1T6B X;  2Y5P A;  2RMM A;  4HRO A;  3RPF C;  2M1M A;  4PS7 A;  2Y3A A;  4W9G A;  5FR3 A;  4HRS A;  1PUT A;  3LXF A;  3I5J C;  4G3X B;  1D5Z C;  4M0W A;  1LM8 B;  5D6J B;  2JQR B;  1R7S A;  2ACZ B;  4KIK A;  4DHZ E;  1AW7 A;  1F2R I;  1Y56 A;  3PPA A;  5FR6 A;  3V6C B;  3TJP A;  2IPK D;  2L7R A;  2D5G A;  2Y5B B;  1WF9 A;  3C19 A;  1NYR A;  3JYU A;  1L0X B;  2AEH A;  2KJ6 A;  5AUK A;  3DBR I;  2K8B A;  1R4M I;  4X57 B;  4YSY B;  1AYF A;  2UYZ B;  4C56 C;  1V2Y A;  2N7D A;  4MEM A;  1GAQ B;  1IBX B;  3KVF B;  4YT0 B;  1ET9 A;  2WDQ B;  3LYY A;  2KHW B;  4RM8 A;  3A9K A;  1KH0 A;  4WUR A;  2BB6 A;  1OEY A;  4I6P A;  3H1U A;  2M19 A;  4M02 A;  3BY4 B;  1D6E C;  4KSK C;  1QIL A;  3UF8 A;  4FUL A;  3QAR A;  1CZP A;  3ZTD A;  3AU4 A;  1C4A A;  1J19 A;  2BW2 A;  1E8Z A;  3RNG C;  4IKG A;  2JYT A;  3P42 A;  3ZNZ B;  4G50 A;  4A55 A;  3L17 A;  2RSU A;  3N1Z C;  1AN8 A;  3O65 B;  4EE2 A;  2I1K A;  4US8 A;  1WR6 E;  2FCS A;  1P7E A;  2K0P A;  3K9P B;  1L2N A;  1C78 A;  1WZ0 A;  2KYW A;  3GP7 A;  2MP2 A;  3P1M A;  3E56 A;  4M01 A;  3I63 C;  1I35 A;  5DPT A;  2LVO A;  2SAK A;  3P4S B;  4AOF A;  2L8J A;  4RF1 A;  2DAJ A;  1JCK B;  1RLF A;  1A5R A;  1TZO A;  1RAX A;  3RT3 B;  2WXL A;  4H2A A;  3OLM D;  4MT5 A;  1PGX A;  4GGQ A;  1A70 A;  1JWS D;  3RNA C;  1M4V A;  3WIM A;  2FBW B;  3V60 A;  1E10 A;  3AE3 B;  3L16 A;  2L32 A;  5T8I A;  1YD8 U;  3BZD B;  3NVV A;  4XZ4 A;  2Z59 B;  3ZQ4 A;  2JRH A;  4A8X C;  1XF5 L;  4WWO A;  3N1Y C;  4DDI D;  2FNJ B;  5J2R A;  1OQR A;  4M8N A;  2J53 A;  3MHS D;  4E74 A;  4W9C A;  2PKO A;  1WRI A;  4ANV A;  3NVZ A;  1JML A;  3Q2A C;  1V9J A;  2KVR A;  4XDC A;  4TQ0 A;  4RGN A;  1LO5 D;  4EUT A;  1QKZ A;  1HQR D;  2LXA A;  3ZDT A;  4YSZ B;  1KOT A;  1UWM A;  1WJ6 A;  1TT5 B;  3UI3 A;  1MJD A;  4FJZ A;  2WXQ A;  1QOF A;  2E6X A;  2AQ2 B;  4XE0 A;  3AV8 A;  2KDI A;  2LWP A;  3KUD B;  3PO0 A;  1TJE A;  3RUI B;  2KAC A;  5E6P A;  1B9R A;  2WXH A;  3L4P A;  4K1R B;  1UBI A;  4RMA A;  3VRA B;  1WX9 A;  1J7A A;  4IDI A;  5AZG A;  1WXM A;  3Q8E A;  2GBM A;  3TEX A;  3JSV B;  4ZRI A;  3PZ7 A;  1SEB D;  5J18 A;  3W5U B;  1KLG D;  3QHT A;  4L23 A;  1OQQ A;  2NPT A;  1TTN A;  2HD5 B;  2SEB D;  3QA8 A;  4HJK A;  2H88 B;  3CSF A;  1WGR A;  3ZNG C;  1DYQ A;  2V3N A;  2M17 A;  1BML C;  3W5V B;  4ZHO A;  3IXS A;  2MLB A;  4AWJ A;  2V4L A;  1Z2M A;  1YJI A;  2IY1 B;  3BYT B;  2IDY A;  4YL8 A;  4N6E B;  1LQB A;  2IBI B;  2UU7 A;  2KTR A;  1V1P A;  3TEZ A;  1WXS A;  4A9A A;  4PS8 A;  4W9E A;  4C4V A;  3VH4 B;  4P7I A;  5JZE B;  1WSP A;  4WQO B;  3DDC B;  3JW0 X;  2YEP F;  1C79 A;  1FCC C;  1L4Z B;  4MJS A;  1FM0 D;  2OJR A;  2L00 B;  3TSS A;  2ZPY A;  1YNT E;  2MEK A;  1TS2 A;  3ALB A;  3UIO B;  1C4C A;  2BTE A;  4IOI E;  4G0N B;  4C7Z A;  1SE2 A;  2DNF A;  3HRD D;  1P9D U;  2WU5 B;  3AE2 B;  3RNB C;  2WGS A;  2JT4 B;  4NPN A;  1S1Q B;  2KJR A;  2LGS A;  2BB5 A;  5KHQ A;  3ZJT A;  2FCQ A;  2KAJ A;  3TCA A;  5TSS A;  4BAX A;  1J0G A;  3R3M A;  4DHZ B;  4GSW A;  2CJN A;  3A9K B;  4NQL B;  1XLN A;  4AP4 C;  1TBE A;  4JX1 C;  1OQY A;  1WX8 A;  2JZP A;  3GE3 C;  3ZKJ C;  3Q8C A;  1WYG A;  2RPV A;  2DBY A;  2K39 A;  2LRU A;  3RN9 C;  3APC A;  4KKJ A;  1FPY A;  4RCO A;  4LNO A;  3OJ3 A;  4AQ7 A;  2G45 B;  2K8C A;  2WXJ A;  1YN5 A;  3VRB B;  3W1S A;  1ESF A;  5BYS A;  3N20 C;  2JXT A;  1KM7 A;  1XCQ L;  1VCB A;  4LCD E;  3Q3N C;  1VZ6 A;  1TKY A;  3PHW B;  3HK0 A;  2R2Q A;  4NAW B;  4LJP B;  4FLH A;  1Q10 A;  5BO4 B;  5AEK B;  2MJE A;  3ZO5 B;  4MSM B;  1QLB B;  2GMI C;  2LJI A;  3NRZ A;  1D5M C;  2GRI A;  5TR5 A;  3VDZ A;  1X1M A;  3RI7 C;  3RNE C;  1UWX A;  3X23 A;  3RD2 A;  4HPM B;  2AL3 A;  3BVG A;  3P4Q B;  2D07 B;  2LRW A;  1XD3 B;  4JQW C;  4C7Y A;  4K3C A;  1KRH A;  1L4D B;  3ZIM A;  1TY0 A;  2O6V B;  4L1B A;  5DPR A;  3DQV A;  2HJ8 A;  2O2V A;  4FJV B;  1IPG A;  3ZJV A;  2INC C;  5HG2 A;  1E8Y A;  4O1N A;  1TS4 A;  4OVU A;  1P0R A;  3SHQ A;  1EUV B;  2BF8 B;  2BS4 B;  2RDB C;  1KTK A;  1N61 A;  1GB1 A;  1OGW A;  2EEL A;  5GXG B;  2B76 B;  1RRB A;  4B6W A;  3ML9 A;  2Z8L A;  2DX5 B;  4PS3 A;  3L13 A;  1MG4 A;  3FIL B;  2PLP A;  2BGF A;  3B2G A;  1VZ8 A;  3Q3O C;  1WGY A;  3Q8A A;  1CJE A;  2V4I B;  1I4H A;  3NVY A;  3VAW A;  2WXP A;  3A4R A;  2KT7 A;  2VH1 A;  2ONQ A;  2HTH A;  1WJ4 A;  4GU2 A;  4ZYS A;  3ZVV A;  3QIJ A;  3E9S A;  2W9N A;  3PRE A;  1E7V A;  3I3T B;  3N9Y C;  1SE4 A;  1T0Q C;  3VUW A;  4F7Z A;  1BT0 A;  3N30 A;  3MC9 A;  3VTV A;  1WRD B;  4IM3 A;  4EZL A;  5BMH A;  3Q3F A;  3ETR A;  3GS2 A;  4B9K A;  1VDV A;  3P63 A;  2V3S A;  5IO9 A;  4US9 A;  2GBK A;  4KKI A;  3JVZ X;  4ITK A;  2G1E A;  4CHK A;  3RNC C;  2KFK B;  3AXC A;  1E9M A;  4BBN C;  1T3Q A;  3RUL A;  2IZV B;  4KGR A;  4LLG M;  1OEY J;  5FKA C;  1VD2 A;  2VH2 A;  2W82 A;  1UGJ A;  2PW9 A;  4LNI A;  5CHV C;  5HFY A;  3UIN B;  2IGH A;  2GOW A;  1BXT A;  3M95 A;  4ARC A;  1V49 A;  4IM0 A;  2PE9 A;  3HVZ A;  4WAA A;  4MGK E;  1G6J A;  2JU6 X;  2JY6 A;  2EKE C;  1EF1 A;  5G5H A;  3AB5 A;  1Q1O A;  4K7W A;  2KWV B;  3R2T A;  1P98 A;  5EE3 A;  1WWT A;  3IVF A;  3ECI A;  1ENF A;  5IP4 D;  4LNF A;  2XNA C;  2G9H D;  2KMC A;  3RYT A;  4FBJ B;  2CKH B;  2RPQ A;  4HKQ A;  1EWC A;  2PTL A;  1JRU A;  2G3Q B;  4II3 B;  2FID A;  4NJ6 A;  1E7U A;  3R7R A;  4FHJ A;  4RGT A;  1WE6 A;  1RM6 C;  3HIZ A;  4GDL A;  2FE8 A;  1XCT L;  4KGS A; 
#chains in the Genus database with same CATH homology
 3A1Q B;  2KDF B;  3KYD D;  5G55 A;  3PLU A;  4CO7 A;  3V60 A;  2FAZ A;  2J0K A;  2QHO A;  5LLI A;  4B95 A;  2KLG A;  2L76 A;  3L16 A;  4FJY A;  4IWQ A;  2XK5 B;  4JL9 A;  5C23 A;  3VFK A;  3VQI A;  3N32 A;  1YD8 U;  4XZ4 A;  4JGH B;  2Z59 B;  1QZE A;  2FIF A;  3C0R B;  2JRH A;  2LI5 A;  3T8M A;  3H6N A;  5IAA C;  4GDK A;  4KZC A;  5E6O A;  3ZTC A;  4ANX A;  3ZRF A;  2KNB A;  2JF5 A;  4WWO A;  2PJH A;  2FNJ B;  2JRI B;  2D11 A;  4AJW A;  4DDI D;  4M8N A;  2KN5 A;  3NOB A;  3MHS D;  1MG8 A;  2KOX A;  3PRZ A;  4E74 A;  1FXT B;  2CHW A;  2N7E A;  4W9C A;  1V81 A;  2KKC A;  2JUO A;  2HE7 A;  3R7Q A;  3V6E B;  4FHK A;  2ZZP B;  4KSL C;  4ANV A;  3A1Q A;  1V9J A;  3IFW B;  2KVR A;  1U4A A;  3DVG X;  2JZ3 B;  3LDZ E;  3ML8 A;  2KK8 A;  3X0W A;  4HLE A;  2Z0E B;  4TQ0 A;  3TMP B;  4EUT A;  1YIW A;  3QC8 B;  3QK0 A;  4GB9 A;  2XK5 A;  2DEN B;  1D3Z A;  3PV1 A;  1PQS A;  3L54 A;  3QJZ A;  2NR2 A;  1OTR B;  2LXA A;  1K8R B;  2D3G A;  3MTN B;  3ZDT A;  1KOT A;  2MBQ A;  2ZCC A;  1WJ6 A;  2KC1 A;  4WJP A;  2GBN A;  2IO1 B;  2NPT B;  3DVG Y;  2MA9 B;  2C60 A;  1WFY A;  3PLV A;  2WDT B;  5IA7 A;  4NY0 A;  4IC7 B;  4FJZ A;  2J7Q B;  1YQB A;  2YVC A;  2CU1 A;  2BKR B;  1KJT A;  4DWF A;  1V5O A;  2WX1 A;  3ENE A;  4FN2 A;  2KO3 A;  2LGX A;  4MEL A;  4NNJ B;  3KYC D;  3PTF C;  4HCN B;  3ZNH B;  2DZI A;  2RD0 A;  3OJ4 B;  4XX5 A;  3ZDM C;  4ZDV A;  5JH5 C;  3M3J A;  3MJW A;  2AL6 A;  2DAF A;  2KDI A;  2LWP A;  3KUD B;  3WAO A;  1YX5 B;  1IP9 A;  4ICU A;  3RUI B;  5E6P A;  1WJU A;  3UQA A;  2IYD B;  4FAD A;  4K1R B;  3HM3 A;  1UBI A;  1WY8 A;  4RMA A;  4IWP A;  3U30 A;  1WX9 A;  4EOY A;  4ZYN A;  2RGF A;  2ZNV C;  2ZCB A;  2JZZ A;  5AZG A;  3VTU A;  3QX1 A;  1HE8 A;  3PSE B;  1WXM A;  3WAP A;  2GBM A;  2L05 A;  3JSV B;  4ZRI A;  5J18 A;  3AU5 A;  2MCN B;  3QHT A;  4IUM B;  3CST A;  5GMV A;  5CHW A;  2KTR B;  4DK5 A;  2NPT A;  4TQ1 A;  3KUC B;  5AZF A;  3IHP C;  1TTN A;  4ICV A;  3WAM A;  2HD5 B;  4BKS D;  5G2N A;  2DYM A;  4BOS C;  2KLC A;  3QA8 A;  3R66 C;  2A5U A;  4HJK A;  4BBN F;  4G11 A;  3UIP B;  2K6D B;  2OOB B;  3CSF A;  1WGR A;  3PT2 B;  3ZNG C;  4A20 A;  3TL5 A;  3EHV A;  5D7G A;  2M17 A;  2ZNV B;  4WJO A;  3A33 B;  2MLB A;  4AWJ A;  4MJS B;  2V4L A;  3UGB B;  1WIA A;  5CTR C;  4DXA B;  1UBQ A;  1Z2M A;  2NBW B;  2K6Q A;  3L08 A;  1UD7 A;  2IY1 B;  4YL8 A;  3JSV A;  3APD A;  4CYE A;  4WWP A;  4DBG A;  4KDI C;  2KJH B;  1LQB A;  1CMX B;  4J6I A;  2IBI B;  2KDE B;  2GBR A;  4IM2 A;  1WX7 A;  3EEC A;  2KTR A;  4N9F 4;  3PVL A;  1Q5W B;  1V86 A;  1GC6 A;  1WXS A;  3GOE A;  2BWF A;  4RM9 A;  3B08 A;  4PS8 A;  4W9E A;  4LDT B;  1SGH A;  2FCM A;  5EDS A;  3VH4 B;  2N9P C;  3N3K B;  4P7I A;  2ZVO A;  5JZE B;  1E8X A;  2D2Q A;  4WQO B;  2V1Y A;  2B3A A;  2EMT A;  4IW0 A;  2MBH A;  3DDC B;  3JW0 X;  3M63 B;  4I6L B;  2N1V A;  2KDB A;  1SIF A;  2LVP A;  3W1S C;  2N1W A;  4MJS A;  2FCN A;  2OJR A;  3VTW A;  2KTF A;  2L00 B;  2C7M B;  5L95 C;  3QCA A;  4URK A;  3VHT C;  1XT9 B;  1YJ1 A;  2KXJ A;  2ZPY A;  4BKG A;  2PPH A;  1TZ1 A;  2KX3 A;  2R2O A;  2C9W B;  2CS4 A;  1ISN A;  3H7P B;  3ALB A;  4GOC A;  5D94 A;  3UIO B;  2PE6 B;  2AYO B;  3PRP B;  4G0N B;  4AJY B;  2J0J A;  1WI0 A;  2NBU A;  3VH3 B;  2I1J A;  4MDK E;  1P9D U;  2K1F A;  1F9J A;  3NY5 A;  2DZJ A;  2JT4 B;  3VXW A;  2KX0 A;  1S1Q B;  2KJR A;  4NPN A;  3TIX A;  5C1Z A;  4DHJ B;  5J17 A;  5KHQ A;  1C3T A;  2N4F A;  2FCQ A;  3TCA A;  5E6N A;  1E90 A;  1J0G A;  3U7D A;  2BYF A;  2DZK A;  1GNU A;  3R3M A;  4DHZ B;  1R4N I;  2MBB B;  4GSW A;  5AZH A;  4MGI E;  3RZW C;  1WGD A;  2IY0 B;  2UWQ A;  3L10 B;  3A9K B;  4E3C A;  3NHE B;  4II2 B;  4E71 A;  4KVG B;  4NQL B;  2L0F A;  2KC2 A;  3OAW A;  1WMH B;  4W9I A;  3VUX A;  3PRM B;  4IG7 B;  4AP4 C;  1TBE A;  2CHX A;  4HWI B;  1OQY A;  2LZ6 A;  4ZRJ A;  2G4S A;  1WX8 A;  3BIN A;  4W9D A;  3ZKJ C;  2ASQ A;  3A4S C;  3ZLZ A;  4TUU A;  4BVU C;  2K39 A;  2WYQ A;  2ZVN A;  2LRU A;  3APF A;  3DBL I;  4PYZ A;  2Z0D B;  3APC A;  2FUH B;  4MM3 A;  1I42 A;  1EO6 A;  2MWS B;  3QWZ B;  2D10 A;  4EZK A;  5JHB A;  3OJ3 A;  1IYF A;  5DPS A;  5KHO A;  1WGH A;  2G45 B;  2JXX A;  2K8C A;  2WX0 A;  4ZRK A;  3SU8 X;  3QQ8 B;  3W1S A;  4W9J A;  2IO3 B;  3KW5 B;  1KM7 A;  3HHM A;  4K7U A;  1VCB A;  4TKN A;  2C5L C;  4LCD E;  2XBB C;  1WM2 A;  3PHW B;  3HK0 A;  4DDG D;  1WJN A;  2R2Q A;  1UEL A;  4NAW B;  4LJP B;  2WWZ A;  3ONS A;  4FLH A;  3RZF A;  5BO4 B;  4KDL B;  2KWC A;  2ZPN A;  5HKH A;  5AEK B;  3CMM B;  1S3S G;  3ZO5 B;  2M4N A;  3NZU A;  4MSM B;  1GC7 A;  4BOZ B;  1YX6 B;  2VRR B;  1H8C A;  2O2V B;  2GMI C;  2G4D B;  4ANW A;  3QAQ A;  5TR5 A;  3VDZ A;  1X1M A;  1WYW B;  3DBS A;  1V5T A;  3AI5 A;  3S2A A;  4TV3 A;  2NVU I;  3DVN U;  3RD2 A;  4HPM B;  3X23 A;  1V80 A;  1J8C A;  2AL3 A;  3PZD A;  1Z5S B;  1WXA A;  1ZW7 A;  5CX3 A;  2AWT A;  3KUZ A;  4MGY E;  1NI2 A;  2LD9 A;  2J0M A;  4K81 A;  4GDL B;  3W1Y A;  2D07 B;  3VUY A;  1ZGU B;  4BFR A;  4NAW A;  3RCZ A;  2LRW A;  3A9J B;  1XD3 B;  2NBV B;  2LAS A;  3PS6 A;  4JQW C;  3ZW3 A;  3K9O B;  2A4Z A;  1GJZ A;  3ZIM A;  2L0T A;  4HPL B;  1H4R A;  2DZM A;  3WA0 A;  1UH6 A;  2O6V B;  3NZS A;  4JLC A;  3DQV A;  5DPR A;  4EKU A;  5JHA A;  4EFO A;  4PYU A;  2KQ7 A;  3SDL C;  2HJ8 A;  2O2V A;  3GZN I;  4FJV B;  2MQJ A;  1IPG A;  1V6E A;  3DBH I;  2ZJD A;  1E8Y A;  4NJ7 A;  1WR1 A;  1LXD A;  4WJQ A;  1EF5 A;  4M0W B;  4OVU A;  1P0R A;  3SHQ A;  2KD0 A;  1EUV B;  2BF8 B;  2LXC A;  3Q3J A;  2REX A;  3UQB A;  1WGG A;  2KAN A;  5LXH A;  2LUE A;  3L0W B;  1OGW A;  4KIK B;  1E5W A;  1C1Y B;  1WE7 A;  1RRB A;  4B6W A;  1SE9 A;  4W9L A;  4W9K A;  5DCN A;  3ML9 A;  2KMA A;  2NS5 A;  2K25 A;  2DX5 B;  4HK2 A;  4HVB A;  3A9J A;  5DPW A;  4PS3 A;  3L13 A;  2M1M A;  2BGF A;  4PS7 A;  3WAL A;  1WZ3 A;  2K8H A;  3VVW B;  3DCG A;  2O6V A;  3IBE A;  4W9G A;  4FA6 A;  1WGY A;  4F8C B;  4W9H A;  3ZUN A;  4M8M A;  3LJ3 A;  3WIM A;  2N9X A;  4G3X B;  2MW5 A;  3VAW A;  2IO2 B;  4ANU A;  1P3Q U;  3A4R A;  4GIV A;  1LM8 B;  3T9L A;  2LGD A;  2BYE A;  4KV2 A;  1TGZ B;  1UGM A;  1WJ4 A;  2HTH A;  4I6N B;  5CHF A;  5D6J B;  4GU2 A;  1T0Y A;  2EMS A;  3D32 A;  4KIK A;  3DPD A;  3ZVV A;  4MH0 E;  4DHZ E;  2DHZ A;  2KQS A;  3PPA A;  3QIJ A;  5FR6 A;  3V6C B;  1Q0W B;  3B1L X;  3P2B A;  1M94 A;  3TJP A;  3H7P A;  4HXD A;  2L7R A;  3SD5 A;  2Y5B B;  2MBO A;  2W9N A;  1WF9 A;  3PRE A;  4DHJ D;  1E7V A;  3V62 A;  3PHX B;  3I3T B;  1NBF C;  3JYU A;  4ASW C;  2NCN A;  2AEH A;  2KJ6 A;  2LVQ A;  2MSE D;  3DBR I;  4A3P A;  1AAR A;  1RFA A;  2K8B A;  3NS8 A;  1R4M I;  3VUW A;  4F7Z A;  1BT0 A;  3EFU A;  4X57 B;  3DOW A;  2UYZ B;  2N9E B;  3N30 A;  1KLV A;  2BYV E;  1V2Y A;  3VTV A;  2DYO A;  2BPS A;  2CR5 A;  5D2M B;  2N7D A;  1WRD B;  2KFJ A;  4IM3 A;  4MEM A;  4EZL A;  3IG3 A;  3Q3F A;  3KVF B;  4HDQ A;  4EEW A;  4B9K A;  3CF6 E;  2V3S A;  1WXV A;  2GBK A;  2KHW B;  3JVZ X;  3M62 B;  4RM8 A;  3V61 A;  4CHK A;  2KWU B;  3A9K A;  4GMV A;  2KFK B;  3AXC A;  2BKF A;  3ZNI D;  3HM6 X;  4IWO A;  4BBN C;  3RUL A;  2IZV B;  1WMH A;  1OEY J;  1OEY A;  1VD2 A;  4I6P A;  3H1U A;  2L3Z A;  3H7S A;  3BY4 B;  1WH3 A;  1GUA B;  4A3O A;  2MP2 B;  5CHV C;  2M0X A;  2RR9 A;  4KSK C;  1WM3 A;  3UIN B;  2GOW A;  4FUL A;  3UF8 A;  5LXI B;  3QAR A;  4HDO A;  3M95 A;  3H9D A;  1V49 A;  4IM0 A;  3ZTD A;  1E8W A;  4XC2 A;  3AU4 A;  2PE9 A;  4WAA A;  2ZEQ A;  1J19 A;  4MGK E;  1E8Z A;  2BWE S;  5L83 A;  5J2R A;  1G6J A;  2LGY A;  4MGZ E;  3DVN V;  4JIO U;  2JY6 A;  4W9F A;  4BKT A;  2EKE C;  1Y8R C;  1EF1 A;  2LJ5 A;  3AUL A;  3ZNZ B;  1P1A A;  4G50 A;  2KFK A;  2MRP A;  1Q1O A;  2C7H A;  3EC8 A;  2RSU A;  3L17 A;  4K7W A;  3PGE A;  2KWV B;  1L7Y A;  1P98 A;  3O65 B;  4GXB A;  2I1K A;  4OVV A;  2JVC A;  1WR6 E;  3IVF A;  2FCS A;  4HCP B;  3ECI A;  1GG3 A;  2C7N B;  2DYB A;  1ZKH A;  3K9P B;  1L2N A;  1WZ0 A;  1UZX B;  2MP2 A;  3ZRC A;  2KMC A;  2YLM A;  2GBJ A;  3RYT A;  2XEW A;  4NQK E;  4FBJ B;  4BKS A;  1I35 A;  2PEA A;  4LJO B;  2CKH B;  2RPQ A;  5DPT A;  2LVO A;  4MSQ B;  1JRU A;  2MX2 A;  4AOF A;  2G3Q B;  4II3 B;  3TBL D;  2L8J A;  4GN1 A;  2DAJ A;  2FID A;  1NDD A;  2CHZ A;  3B0A A;  4NJ6 A;  1RLF A;  1A5R A;  1E7U A;  2M8S A;  2IO0 B;  3R7R A;  3WAN A;  4K7S A;  4FHJ A;  4GDK B;  1RAX A;  3U8Z A;  4AUQ C;  3RT3 B;  1WE6 A;  3KH0 A;  4EZJ A;  1LFD A;  2O6V D;  4WJN A;  3HIZ A;  3OLM D;  1XQQ A;  4LDT D;  2MBE A;  4GGQ A;  2JWZ A;  2KZR A;  4GDL A;  4WWN A;  4KZ0 A;  4F1S A;  2JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...