4HCPB

Crystal structure of burkholderia pseudomallei effector protein chbp in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
AAMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP/GTP binding protein
publication title Structural mechanism of ubiquitin and NEDD8 deamidation catalyzed by bacterial effectors that induce macrophage-specific apoptosis.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Protein binding
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hcpB00
1WY8A 2LGDA 1S1QB 1C1YB 2FIFA 2EKEC 3NHEB 4FN2A 5CHVC 4FJZA 4ICUA 3PLVA 4ASWC 3HM3A 1UBQA 3WAMA 1UZXB 2JF5A 3IHPC 4GDKB 2GBKA 1C3TA 2ZVNA 2KTFA 3N3KB 2KX0A 4B9KA 2MP2A 4LJOB 3U7DA 5IAAC 1WH3A 2WX0A 5J2RA 2DZJA 3DVNU 4IC7B 3O65B 3TIXA 3H6NA 4MGYE 2RSUA 4KZCA 5BO4B 4FA6A 4A20A 2KC2A 3WA0A 2KJ6A 4FBJB 3VUXA 4HDOA 1Q0WB 1WR1A 3A33B 3A9KA 4IWOA 2KO3A 1UH6A 3L10B 2PPHA 4DDGD 2RD0A 3RZWC 4HPLB 4MSMB 1WI0A 3I3TB 1J0GA 2KDBA 2A4ZA 4FHKA 3TL5A 3A9KB 4MDKE 4PS8A 4GN1A 4HDQA 2J0JA 2FCQA 2LRUA 3IVFA 3NY5A 4KDIC 3VQIA 3JW0X 4GSWA 4BOZB 1H8CA 1ZW7A 4TQ0A 2IYDB 5AEKB 3S2AA 2KJRA 3RCZA 4ANWA 1RAXA 3EFUA 5AZHA 2WWZA 2CR5A 2ZZPB 3WAOA 4IWPA 2BGFA 3ZKJC 5G55A 2CHWA 2ZEQA 4NNJB 3WANA 4KIKB 3M62B 4I6LB 1WZ0A 1YX6B 4PS3A 3NOBA 3KVFB 3HHMA 3KYDD 2FCNA 3CF6E 4M0WB 2A5UA 4WAAA 1VD2A 4EFOA 4PS7A 4NQKE 2MX2A 2L0TA 1TTNA 3V6EB 2G4DB 4GXBA 4IWQA 3U30A 3EC8A 2ZNVC 3JSVA 3UIPB 2HD5B 1KM7A 5FR6A 4BKTA 3IFWB 2XEWA 1E7UA 3L13A 3U8ZA 4W9EA 1WGGA 4MELA 4BFRA 5JHBA 2MSED 2LUEA 5JHAA 2KFKB 2J0KA 3VTWA 3RUIB 1P0RA 4EKUA 4FLHA 1Q5WB 3HM6X 1J19A 3QCAA 4WQOB 2MLBA 3ZDMC 3PT2B 5L95C 3H9DA 3CSFA 1NDDA 2O6VB 1LM8B 1ZKHA 2LVQA 2LZ6A 3EHVA 2I1JA 3X23A 4WJQA 1D3ZA 1XD3B 4G11A 4N9F4 3L54A 3TJPA 2M17A 2GBNA 2BF8B 1V81A 3QC8B 3QARA 1P9DU 4XZ4A 5JZEB 1OGWA 2KHWB 4MGZE 2KDFB 1IYFA 3DCGA 4W9CA 1GC6A 2QHOA 2FCSA 4BKSD 2IY1B 2ZPYA 3A4SC 1Z2MA 1GJZA 1TGZB 1M94A 2LVOA 3PHWB 1WMHB 3KH0A 1U4AA 3WIMA 2IO2B 4FHJA 3DVNV 3H1UA 3QJZA 1OEYA 4WJNA 3ZRCA 4G0NB 1QZEA 2LRWA 2C7MB 3QIJA 1WF9A 1SIFA 2AYOB 2YLMA 3ZO5B 1KJTA 2IO3B 2NS5A 3R7QA 3AULA 1YX5B 2FUHB 5CHWA 2PEAA 2V1YA 3Q3FA 2JWZA 1YJ1A 2KC1A 3ALBA 3ZNGC 2KWCA 4DK5A 2OOBB 3VTUA 5IA7A 2ZCCA 2JRIB 3LJ3A 3RZFA 2L7RA 4GOCA 4ZYNA 4BVUC 2ZVOA 5HKHA 2Z0DB 4TV3A 2JRHA 3QQ8B 3UGBB 1L7YA 3QHTA 1KOTA 3L0WB 4GGQA 2AWTA 4F1SA 1NBFC 4GDLA 2FIDA 2GOWA 3V62A 3AXCA 1WM3A 3RD2A 4FJYA 2L3ZA 2O6VD 4RM9A 4XX5A 2C9WB 1VCBA 2KN5A 2CHXA 4XC2A 1FXTB 3ZNID 2KWUB 1E8ZA 3TMPB 1GUAB 1R4MI 3JYUA 4GDKA 2MBEA 4EZJA 3H7PB 3W1SC 4LCDE 3B08A 2K25A 1P98A 2LXAA 2Z0EB 4NJ7A 2LGXA 2GBRA 4MSQB 2MQJA 1WXVA 3SDLC 3TCAA 2K6QA 1V6EA 2MWSB 2K6DB 5AZGA 4ANUA 4W9GA 4K7WA 2KDEB 1WJ4A 1V80A 4WWPA 5DPRA 4TUUA 1V86A 1A5RA 3PLUA 4KZ0A 2DX5B 4MJSB 2V3SA 2XBBC 2ZCBA 4GB9A 4CYEA 5D2MB 3ZLZA 2IO1B 2NBVB 4BBNF 5TR5A 1V2YA 3HIZA 3K9PB 2NPTB 4E3CA 4JL9A 3RYTA 4DHJB 3QK0A 3N32A 3QA8A 5CTRC 4K7UA 4WWOA 4WJPA 4FJVB 2FCMA 4AWJA 4BKSA 1HE8A 2D11A 1LFDA 4BBNC 5LXIB 3HK0A 1WXSA 2MBBB 4KIKA 3SU8X 3VDZA 2KOXA 2L0FA 4W9KA 2K39A 5DCNA 2KVRA 2L8JA 2KQSA 3WALA 3PS6A 1R4NI 2RGFA 3RULA 3MJWA 3L08A 2JT4B 4K1RB 3VAWA 1T0YA 2J0MA 4E74A 5D7GA 3ZRFA 4JIOU 3Q3JA 3R3MA 2RPQA 4DBGA 3ZNHB 4MH0E 1E7VA 3H7SA 2NVUI 4II2B 3RT3B 2DHZA 4X57B 2PE6B 2KFKA 1X1MA 3NS8A 2K1FA 2MBOA 3DOWA 3GZNI 1AARA 1YQBA 1SGHA 4KSKC 3SD5A 1NI2A 2O6VA 4RMAA 4F8CB 2D2QA 5J18A 2KD0A 2KANA 2DAJA 1IPGA 1WIAA 2IZVB 1UGMA 2C5LC 2LVPA 3B1LX 3DDCB 4WWNA 4G50A 4NAWB 3DBHI 3APCA 2CS4A 4W9IA 4DHJD 4E71A 3KYCD 3PTFC 2GMIC 5C23A 4TKNA 3K9OB 1OTRB 3VHTC 2REXA 2BYEA 1I42A 4M8NA 3MHSD 1WMHA 2WX1A 4F7ZA 3D32A 3ZW3A 3X0WA 3DBRI 2MW5A 5E6PA 3ZNZB 4KDLB 2KXJA 2D10A 3QAQA 5DPTA 1WE6A 2WYQA 3M95A 4KV2A 3VUYA 3UQAA 2NBWB 2CHZA 1TBEA 5KHOA 3OAWA 1WXMA 3VVWB 2XK5B 3ML9A 2AL6A 1WJNA 2K8BA 3PZDA 3T8MA 1E8WA 2J7QB 4IM3A 2IO0B 4I6PA 3BY4B 3PGEA 4W9FA 3UINB 5J17A 1WR6E 3LDZE 4CHKA 2AEHA 2D3GA 2BKFA 2KTRB 2JZZA 4IM2A 2ZJDA 4EUTA 1Y8RC 3KW5B 2I1KA 5KHQA 2C60A 1GC7A 4DDID 2L76A 4EOYA 2N7DA 2HJ8A 2BKRB 3VFKA 1IP9A 3A9JB 2M4NA 2G4SA 2IY0B 3DQVA 5LXHA 5E6OA 1V49A 3PSEB 4PYZA 2N9XA 1EF5A 3ZUNA 3B0AA 4KVGB 3H7PA 4BOSC 3AI5A 2KMAA 3P2BA 2BWES 4ZDVA 4WJOA 2JVCA 2DZMA 4IG7B 4AUQC 4AJWA 4JQWC 3V60A 1E90A 2MA9B 3CMMB 1JRUA 1RLFA 2L05A 2V4LA 2N1WA 4NPNA 4LJPB 2N7EA 2AL3A 2G45B 5GMVA 4CO7A 2PJHA 2O2VA 3M63B 4MJSA 3C0RB 2GBMA 2CU1A 4HWIB 3A1QB 1WM2A 5G2NA 3BINA 2GBJA 4HJKA 2HTHA 3EECA 5E6NA 1EUVB 2NPTA 2O2VB 3ZTDA 1OQYA 3KUDB 4LDTB 2FNJB 3QWZB 2LJ5A 3ENEA 4NJ6A 3V61A 4DHZB 2Y5BB 2YVCA 1WX9A 1SE9A 3KUZA 3TBLD 4OVUA 4I6NB 2KK8A 1GNUA 4BKGA 1OEYJ 4W9LA 3VH4B 2CKHB 2LGYA 3ZDTA 1YIWA 1RRBA 1I35A 5D6JB 1WX8A 4ZRKA 1PQSA 2PE9A 3A4RA 3PREA 2C7HA 1WJUA 3APFA 2KLGA 1WGHA 4MEMA 4B6WA 4AP4C 4W9HA 3IG3A 3PVLA 1UELA 3VH3B 4ICVA 2MP2B 2L00B 2OJRA 4II3B 2KKCA 2M0XA 1WZ3A 3ZIMA 1RFAA 1P1AA 3UQBA 1ZGUB 4DXAB 3UF8A 1L2NA 1WE7A 3ONSA 4MM3A 3VXWA 2BYVE 3PRZA 4HCPB 4JGHB 3CSTA 2KWVB 1GG3A 1TZ1A 2KDIA 1KLVA 1Q1OA 2UWQA 4G3XB 2N1VA 2ZNVB 4NQLB 2R2OA 2MRPA 1V5TA 4A3OA 2MCNB 1YD8U 4RM8A 3SHQA 3MTNB 2LD9A 4HVBA 3DBLI 4LDTD 3ZVVA 3PRMB 1LQBA 4NAWA 1XT9B 1V9JA 4W9DA 2KX3A 1WXAA 5C1ZA 2EMTA 2ZPNA 4HXDA 5LLIA 2BYFA 2VRRB 5DPWA 1F9JA 1G6JA 2LXCA 2DZKA 4IUMB 2KQ7A 2R2QA 1WX7A 4IM0A 4JLCA 3DPDA 2G3QB 2LASA 3AU4A 3JVZX 3OJ4B 3NZSA 3PV1A 3VUWA 2DYOA 1WRDB 2MBQA 3N30A 1EF1A 2DYMA 4IW0A 3GOEA 5CHFA 4ANXA 2NR2A 2XK5A 2DYBA 4DHZE 1WGDA 4MGKE 3PRPB 4URKA 1E5WA 2N9PC 2D07B 4ANVA 2JXXA 3JSVB 2BPSA 2M8SA 3R7RA 3ZTCA 1E8XA 2B3AA 1WGRA 2JZ3B 2LI5A 3W1YA 5DPSA 4HLEA 2BWFA 2JPHA 1V5OA 2JUOA 2KTRA 3NZUA 5EDSA 2LWPA 5JH5C 1P3QU 1WFYA 3L16A 2W9NA 3DVGY 2M1MA 2N4FA 4GU2A 3ECIA 4ZRIA 1K8RB 2KNBA 4HCNB 3A9JA 4TQ1A 3KUCB 1E8YA 3UIOB 4YL8A 2RR9A 1ISNA 1Z5SB 3DVGX 4M8MA 3AU5A 4P7IA 4NY0A 4GMVA 1WGYA 3OJ3A 1H4RA 4FULA 4A3PA 4EEWA 1EO6A 2K8HA 2KMCA 1UD7A 2IBIB 2DZIA 2K8CA 2Z59B 1WYWB 4GIVA 4K7SA 1S3SG 5L83A 3W1SA 2KZRA 3IBEA 3QX1A 3PPAA 4HPMB 2KJHB 4J6IA 4AOFA 2FAZA 2KFJA 2HE7A 2MBHA 3L17A 4DWFA 4K81A 3M3JA 3DBSA 4OVVA 1WJ6A 5AZFA 2DENB 2KLCA 5CX3A 4B95A 2JY6A 4EZKA 3ML8A 3T9LA 2NBUA 4AJYB 2NCNA 2WDTB 4W9JA 3VTVA 1BT0A 2EMSA 3A1QA 3PHXB 3WAPA 4KSLC 1J8CA 3R66C 4PYUA 1LXDA 2ASQA 2UYZB 3OLMD 2N9EB 3APDA 4FADA 1CMXB 1XQQA 4ZRJA 2C7NB 2DAFA 1MG8A 5D94A 4MGIE 3V6CB 1UBIA 4HK2A 4EZLA 4GDLB
chains in the Genus database with same CATH superfamily
1JWUD 1L0YB 5CHVC 4FN2A 2K9XA 4K3BA 3FILA 3HM3A 4D2KA 1UBQA 1L6VA 1HZ6A 1C3TA 3N3KB 2E6XA 3U7DA 1WH3A 1EWYC 3H6NA 4MGYE 4ZRPA 5BO4B 3VUXA 4IWOA 2RD0A 4HPLB 1STEA 3P4QB 4MT5A 1XLPA 4LNFA 4HDQA 3VQIA 2FCQA 1H8CA 1ZW7A 2IYDB 4L2YA 3ZJTA 4XWTA 3P4RB 2WWZA 2BGFA 2NTTA 3NVYA 4M0WA 2ZEQA 1FCLA 2V9HA 4REZA 1D5MC 1YX6B 3HHMA 2FCNA 2A5UA 1VD2A 3AEDB 4JPSA 1GB1A 3U30A 2M19A 3JSVA 1T6BX 3VRAB 1IGCA 1E7UA 3U8ZA 4W9EA 1FEHA 4BFRA 4OVZA 4JE3B 2AX5A 1YJIA 3ZDMC 3H9DA 1LM8B 1ZKHA 2LZ6A 3X23A 1XD3B 4N9F4 3L54A 2GBNA 4WAFA 3QC8B 3QARA 1P9DU 5JZEB 3DCGA 4W9CA 2QHOA 5BMHA 1Z2MA 1C77A 1TGZB 3BYYB 3PHWB 3HVZA 4HKQA 3ZRCA 2LRWA 1DOXA 3TEZA 1SIFA 3ZO5B 2IO3B 2NS5A 5H92C 1YX5B 2FUHB 2V1YA 2JWZA 2KC1A 2CJNA 2KWCA 2JRIB 1L7YA 4F1SA 2H89B 2WXPA 1TKGA 1ACCA 2J4XA 3BWUD 5D3DA 3ZNID 1E8ZA 1TS4A 1JWSD 3JYUA 1P7FA 3B08A 1P98A 2Z0EB 1JWAD 2IGGA 3Q8BA 4LNOA 3FKYA 4YXDB 5AZGA 2WXRA 1V80A 3N1ZC 1I4QA 1XCQL 4NJCA 3B9JA 5TR5A 2WXIA 4XDDA 3ZYYX 4YSXB 2M56B 3K9PB 3LB8C 3SEBA 3SFDB 4A8XC 4JL9A 3RYTA 3QK0A 3N32A 5HG2A 1QILA 1T0RC 3P1MA 4BBNC 1TKYA 3HK0A 1VR9A 4UDUC 5C3JB 2DWQA 2KQSA 1R4NI 1D5ZC 3BYTB 1RYJA 4E74A 2QILA 3PO0A 3ZNHB 1N63A 2NVUI 4X57B 4MM3B 3W5UB 3NS8A 2MBOA 3Q3MC 2QMTA 1AARA 1SIJA 2V0GA 4RMAA 2MHJA 1EM7A 4OZAA 5IO9A 1XLQA 3DDCB 1UGMA 4WWNA 3MC9A 4W9IA 4NZLB 3KYCD 5C23A 1QQRA 1JWBD 3VHTC 3GE3C 4YTNB 2V3PA 4HEA1 4RH6A 2RDGA 3DHIC 3X0WA 5E6PA 3EFCA 3ZNZB 3ZQ4A 2KVZA 1GPXA 4YT0B 3UQAA 3M95A 3VUYA 2NBWB 1FXIA 3WCQA 2XK5B 3ML9A 2L32A 3NZ3A 2QCZA 2IO0B 4P1BC 1T3QA 4CHKA 2D3GA 4IM2A 4EUTA 2W82A 2X38A 4QAYA 2HJ8A 3VFKA 3DQVA 2EELA 1V49A 4PYZA 1EF5A 2WXQA 4KVGB 1JRPA 2BWES 1ZOYB 3NVVA 2JVCA 4J3OD 4IG7B 1FM0D 3RI7C 1ENFA 3CMMB 1PFDA 1RLFA 2L05A 2N1WA 4RCOA 4YTPB 4LJPB 2G45B 1I4RA 5G5GA 3HVDA 1T0SC 3N20C 3J9CA 5G2NA 2GBJA 2HTHA 3I5JC 3V61A 3VRBB 5E6JA 1KFYB 2YVCA 1UNSA 1WX9A 1SE9A 2PLPA 5EE1A 4I6NB 2KK8A 2IDYA 1JCKB 3VH4B 1VZ6A 3ZDTA 2VH1A 2WLBA 1I35A 1FNUA 1XXGA 2C7HA 1QT9A 1J7CA 2KLGA 4MEMA 3RNGC 3IG3A 1UELA 3VH3B 1E10A 2K0PA 2M0XA 1CZPA 4DXAB 1L2NA 3UF8A 3ONSA 4MM3A 1SE3A 1YN5A 2BYVE 4C7ZA 2Y5CA 3AB5A 2GI9A 2GB1A 2MRPA 4O1NA 2WXMA 4A3OA 4S0RA 1QKZA 5HHDG 4W9DA 2KX3A 1WXAA 3FC4A 1BMLC 1TJEA 3AE8B 1G6JA 3Q8AA 2R2QA 3TEXA 3JVZX 1R7SA 4N58A 3VUWA 4PK1A 4RF1A 3U52E 1EF1A 4HKZE 2EKIA 2XK5A 4DHZE 4URKA 2OEDA 2DLBA 4P16A 4ANVA 3ZTCA 1WGRA 2JZ3B 2LI5A 3W1YA 2BWFA 4CQNA 1V5OA 1SB3C 1FXAA 5JH5C 2QC8A 3L16A 3DVGY 2M1MA 1K8RB 4HCNB 1E8YA 2IGDA 1ZP0B 3Q69A 3AU5A 1H4RA 4FULA 4C56C 1EO6A 2K8HA 4GIVA 1UD7A 2K8CA 2Z59B 1DYQA 3QX1A 3PPAA 4HPMB 4AOFA 2MBHA 1IUEA 4DWFA 1HTQA 1R4NB 2DENB 2NBUA 4AJYB 1NEKB 4W9JA 2EMSA 1ZXIA 1OQRA 1J8CA 3R66C 4PYUA 1LXDA 2ASQA 4US9A 3KWLA 2N9EB 4FADA 3RNBC 1XQQA 4ZRJA 2C7NB 2BVCA 3Q3OC 1UBIA 4HK2A 4EZLA 1AW7A 1E7PB 2EKEC 2LGSA 3DWMA 4ICUA 1FRRA 2D3BA 4S17A 3WAMA 1UZXB 3V05A 3IHPC 2LFIA 2KTFA 2KX0A 2D3CA 5IAAC 2DZJA 3DVNU 1SSNA 3O65B 3WA0A 4FBJB 1WR1A 3A9KA 3ZXRA 2KO3A 1UH6A 4DDGD 3RZWC 1C78A 4MSMB 2KDBA 1C4PA 3TL5A 2N7JA 3NY5A 3IVFA 4KDIC 3JW0X 1QOBA 2KJRA 3RCZA 3L4PA 4ANWA 5AZHA 2CR5A 3AEFB 2N0SB 3ZKJC 2CHWA 2HDEA 2IGHA 3M62B 4I6LB 1WZ0A 3NOBA 3KVFB 3KYDD 4M0WB 4WAAA 2WQYB 1SE2A 4NQKE 4RGMA 3V6EB 1TTNA 2G4DB 4XE0A 3EC8A 1E0ZA 3UIPB 5FR6A 3IFWB 2WGSA 2XEWA 3E56A 1LO5D 1YQ3B 1I4XA 5JHAA 3KWVA 1Q5WB 4WQOB 2UU7A 2MLBA 1E9MA 1FMAD 3CSFA 3ZGZA 5EE3A 3P4PB 3URYA 2O6VB 1L4DB 1TS5A 2I1JA 1TYGB 5G5HA 3BVMA 1GC6A 4BKSD 1CK1A 1M94A 2KN4A 3SFEB 3DHHC 1FO4A 1ZE3D 1PDXA 1ZUD2 2BW2A 1UWXA 3QJZA 4G0NB 1QZEA 4A55A 2J52A 3AULA 4LNKA 3HUIA 3ALBA 4DK5A 2ZCCA 3LJ3A 3RZFA 4GOCA 4BVUC 5HKHA 3QQ8B 1B1ZA 3QHTA 3GP7A 4GGQA 2AWTA 3V62A 1WM3A 3RD2A 3B2FA 1AYFA 2O6VD 4RM9A 2CHXA 3N1XC 1ZPSA 2PVOD 1NYRA 2MBEA 3BVZA 4NJ7A 3VR8B 4MSQB 2MQJA 3TCAA 1C79A 1V6EA 2MWSB 2K6DB 4ANUA 1IGDA 3BK2A 5EE9A 1N5XA 4TMAB 4WWPA 5DPRA 2V3SA 2XBBC 4GB9A 3ZLZA 2IO1B 1V2YA 3AMZA 1WXQA 4E3CA 4M02A 4WWOA 4FXCA 2FCMA 4BKSA 1HE8A 2D11A 1YJJA 2WHIA 2ON8A 3MC0B 4W9KA 1DGJA 5JXVA 2KVRA 2XNAC 2L8JA 3WALA 3W5VB 4PT5A 3MJWA 3RULA 3ZRFA 2NTSA 4C7YA 2WXHA 2RPQA 1E7VA 3OWEB 3H7SA 1WGKA 2DHZA 1KH0A 2KAJA 4RGOS 1YQBA 1V97A 1NI2A 2O6VA 2KD0A 1C9FA 2DAJA 1WIAA 2IZVB 4TSSA 3APCA 1P7EA 3Q8FA 2REXA 2BYEA 1QOAA 2WX1A 3DBRI 4XGAB 3QAQA 4KV2A 2CHZA 1TY0A 1HTOA 4OZCA 1WJNA 2K8BA 3T8MA 1E8WA 3O13A 3PGEA 2WU2B 4W9FA 5BMIA 1Y8RC 5KHQA 1RWSA 1GC7A 2L76A 4EOYA 2J53A 3R8BA 1TZOA 4JX1C 2BKRB 2M4NA 2G4SA 5LXHA 5E6OA 4R3DA 4HPPA 3PSEB 4WH4A 2N9XA 3W2DA 3B0AA 4WJOA 4M00A 3RNEC 1TS2A 2MA9B 2MJEA 5AUKA 2HJ1A 3Q14C 2NMQA 4N59A 1GB4A 4P6VF 3C0RB 1FFUA 2BB6A 5E6NA 3ZTDA 1EUVB 3KUDB 4NJ6A 2FNJB 3QWZB 2GLSA 2LJ5A 4DHZB 1SJED 1J7BA 3KUZA 4OVUA 4BKGA 1GNUA 1OFFA 2CKHB 2LGYA 2Q5WD 2I38A 5D6JB 1JW9D 2BQQA 1PQSA 1OQQA 3PREA 2WS3B 4W9HA 2PTLA 2MP2B 4II3B 2KKCA 1WZ3A 2QEJC 1FD6A 2PVGC 3UQBA 1VZ7A 4RF0A 4H2AA 3IAS1 3VXWA 3PRZA 4JWSC 4HCPB 2IPKD 1TZ1A 2K3UA 1Q1OA 1KLVA 3CIRB 2R2OA 2MCNB 2ACZB 1F77A 1L0VB 3SHQA 4HROA 3MTNB 2LGIA 4HVBA 1T0QC 3MHZA 5IKCM 3PRMB 1LQBA 3R2IA 3NJTA 4LNIA 5C1ZA 1C76A 4HXDA 1Q10A 2RPVA 2BYFA 1F9JA 2DZKA 1D4BA 3T3NA 3DPDA 1BXTA 3LYYA 3AU4A 3ZJUA 2MJDA 2KDMA 3DHGC 4MH8A 3CWIA 3N30A 2WXNA 2INPE 5FKAC 2DYBA 5T8IA 1E5WA 2N9PC 2D07B 3GS2A 2FE8A 3R7RA 2ZW0A 3IT4B 2JPHA 2YEPB 2QJLA 2W9NA 5BYSA 2N4FA 3UIOB 4ZRQA 2OHFA 5TSSA 2N9LA 3Q8EA 4NY0A 2QIEB 3BK1A 2KMCA 2IBIB 2DZIA 2PKOA 5IP4D 3EA6A 4XDCA 1FFVA 2KZRA 3IXSA 2KFJA 2HE7A 2DNFA 3L17A 3M3JA 2KLCA 1SJHD 3IAM1 3T9LA 2VZKD 3VTVA 1BT0A 3WAPA 4KSLC 2JZPA 3OLMD 3ZJVA 2SAKA 2ONQA 5D94A 2J42A 1MJDA 2PW9A 4B0MA 2LGDA 1S1QB 1C1YB 2FIFA 4XYCA 3NHEB 4ASWC 2INCC 4KX6B 3ZXVA 4GDKB 4ZOHC 4B9KA 2MP2A 4LJOB 2MEKA 1ZDVA 3DBRB 4FA6A 4A20A 4WIPA 2KC2A 1XO3A 2KJ6A 4HDOA 3A33B 1T5XD 3L10B 2PPHA 1TS3A 1WI0A 3I3TB 1J0GA 1YOVB 2A4ZA 4FHKA 3A9KB 2LJIA 4PS8A 3I57A 2J0JA 2LRUA 4GSWA 4TQ0A 5AEKB 3S2AA 1Y56A 4IKGA 3BIID 3WAOA 4IWPA 5G55A 1SXTA 3WANA 4AQ7A 4JWUC 3AEAB 4US8A 2AQ3B 4PS3A 3CF6E 2INNE 1V8CA 1ROEA 4EFOA 4PS7A 2MX2A 2L0TA 3TEWA 2ZNVC 3TEYA 2VH2A 3L13A 1WGGA 4MELA 5MPOA 1SEBD 2MSED 2R61A 2KFKB 3VTWA 3RUIB 1P0RA 4FLHA 2WXOA 4USAA 1J19A 5I4DA 1NDDA 2LVQA 3EHVA 1EU3A 1KF6B 4WJQA 1JALA 3U2SC 1NVID 4RFBA 4XZ4A 2KHWB 2DBYA 2YEPF 2ZPYA 3A4SC 1GJZA 3P42A 1QOFA 3WIMA 2IO2B 1MFWA 4K3CA 3DVNV 3H1UA 3AV8A 1OEYA 3NRZA 2C7MB 2LMCA 1WF9A 1VRAB 5CHWA 3ZNGC 5IA7A 3AE1B 2L7RA 2ZVOA 3W9CB 2Z0DB 2IJ0A 1NENB 4TV3A 3UGBB 3Q8CA 1LGRA 3L0WB 1NBFC 2GOWA 3AXCA 4FJYA 1YN3A 3AEBB 3U7ZA 1VCBA 2KN5A 4LLGM 1FXTB 1FNWA 5BMGA 3Q3NC 3B2GA 1PUTA 4GDKA 4EZJA 3H7PB 1EU4A 3W1SC 4LCDE 2K25A 3FAHA 1XLNA 2K6QA 4ZHPA 2KACA 4K7WA 1WJ4A 1DOIA 2JYTA 4DXFA 1V86A 3PLUA 4KZ0A 4C4VB 2DX5B 4MJSB 4EE2A 2ZCBA 4CYEA 5D2MB 3EGRA 4BBNF 2L1AA 3C19A 2NPTB 1MHHE 4DHJB 2CU3A 5CTRC 4ARIA 4IDIA 4WJPA 4AWJA 5LXIB 1WXSA 1XCTL 2MBBB 4GLSC 2CJOA 3VDZA 2ZW1A 1AWDA 2L0FA 2K39A 5DCNA 3AM9A 4RNAA 3L08A 4BAXA 2RMMA 4K1RB 4KGRA 1T0YA 2J0MA 1JMLA 5D7GA 4JIOU 4KGTA 3R3MA 3U4EG 4MH0E 2E3TA 4II2B 3RT3B 5IN7A 3UI3A 1RFKA 1E6EB 1SE4A 2KFKA 5C2TB 2K1FA 2Z8LA 1JWMD 3I63C 2JYEA 1I4HA 3SD5A 4F8CB 5J18A 2D2QA 4ITKA 3NG0A 2C5LC 4G50A 4NAWB 3DBHI 4DHJD 2CS4A 3K9OB 1WWTA 1R4MB 1I42A 2PMVA 4XWWA 1VZ8A 4F7ZA 3D32A 3AE9B 1UUPA 1L4ZB 1WE6A 2WYQA 2BTEA 2BYTA 5KHOA 3OAWA 1WXMA 2XN9C 3VVWB 2BT6A 4KKIA 2AL6A 3PZDA 2KYWA 2J7QB 3MP9A 4I6PA 3BY4B 3UINB 1WR6E 2D5GA 3LDZE 2AEHA 2WDVB 2JZZA 4LK0M 3KW5B 4L1BA 5FR3A 1N60A 4DDID 1M4VA 3NVWA 2IY0B 2GRIA 3ZUNA 2WNMA 3H7PA 4BOSC 3P2BA 3AE7B 1MVKA 2DZMA 4AUQC 2KWDA 1SBBB 4JQWC 4NPNA 2N7EA 1AN8A 2AL3A 4OZBA 2O2VA 4C4VA 4MJSA 3V3XA 2CU1A 4HWIB 1WM2A 3BINA 4HJKA 3EECA 2NPTA 3ENEA 2Y5BB 2AQ2B 1TIFA 4OW0A 4W9LA 2BBCA 2WDQB 4ZRKA 2PE9A 3A4RA 3DWGC 3APFA 4B6WA 4AP4C 3PVLA 4ICVA 2L00B 4B0EA 2M0AA 1ZGUB 3N1YC 1WE7A 3RMKC 1N5WA 4JGHB 2KWVB 1GG3A 2KDIA 2UWQA 2N1VA 2BS3B 2WXKA 2WU5B 3DBLI 4A90A 3ZVVA 4NAWA 3P63A 4WWMA 2G9HD 2ZPNA 1HQRD 2VRRB 5DPWA 2KQ7A 4IM0A 3OJ4B 1L0XB 3PV1A 2JU6X 1N6ZA 2DYMA 2KQ4X 4IW0A 3GOEA 2JSVX 5CHFA 2NR2A 4YWGG 1L6UA 4MGKE 3ABVB 2JXXA 2BPSA 3AE4B 1E8XA 3AE5B 1VJKA 5DPSA 2K22A 1MPEA 1P3QU 3TUOA 1A70A 1WFYA 1I4PA 4ZRIA 1KLGD 2KNBA 3KLSX 4TQ1A 1K53A 1N62A 1ESFA 2RR9A 1ISNA 3DVGX 4YL8A 3RNFC 4C80A 2WP9B 3OJ3A 4EEWA 4K7SA 5L83A 4KGSA 3W1SA 2SEBD 4J6IA 2FAZA 4HJGE 3RN9C 4K81A 1J7AA 3DBSA 4OVVA 5AZFA 4L23A 5CX3A 3SR6A 4EZKA 3ML8A 2WDTB 3MJ5A 3PHXB 1SF0A 5H8YE 2L52A 1F52A 2UYZB 4KKJA 4MGIE 2WXLA 4GDLB 1L5PA 1WY8A 4FJZA 3PLVA 3DBHB 1KLUD 1EWCA 3AN1A 2JF5A 2GBKA 1F0ZA 2ZVNA 2MH7A 5J2RA 2WX0A 4IC7B 3TIXA 2RSUA 4KZCA 2BS4B 1Q0WB 1BUIC 4YTMB 2V4IB 1XF5L 2K5PA 2WXJA 3KQ4A 4MDKE 4GN1A 1TKEA 4BOZB 1RAXA 3EFUA 2ZZPB 2FBWB 3NUHB 4WURA 3RFZB 4WQMA 3AE3B 4KIKB 1FRDA 3T3OA 4YSZB 4Q2JA 3EUB2 1K50A 4GXBA 4IWQA 2HD5B 1KM7A 4BKTA 2VZKB 5JHBA 2LUEA 2J0KA 4EKUA 3AEEB 3HM6X 3QCAA 5L95C 1F1HA 3PT2B 2KT7A 1D3ZA 4G11A 2RDBC 3TJPA 2M17A 1C4CA 2BF8B 1V81A 2LEKA 2W55A 1C4AA 1OGWA 4MGZE 2KDFB 1IYFA 1WYGA 2FCSA 1GOZA 2IY1B 5HFYA 3Q6BA 1MHXA 1I7HA 2LVOA 3KH0A 1WMHB 1U4AA 4FHJA 1V1PB 4WJNA 4A6QA 4P1CC 1MI0A 2WDRB 4ZYSA 3QIJA 2AYOB 2YLMA 1KJTA 3R7QA 4A9AA 2PEAA 2G1EA 3Q3FA 1YJ1A 2OOBB 3VTUA 4ZYNA 1HZ5A 2JXTA 2JRHA 1KOTA 4GDLA 2FIDA 1VLBA 1MG4A 2L3ZA 4XX5A 3DBLB 2C9WB 2D3AA 4XC2A 2KWUB 3TMPB 1GUAB 1R4MI 1RM6C 3H8HA 2LXAA 2LGXA 2GBRA 1FIQA 2KMMA 1WXVA 3SDLC 2W54A 4W9GA 1B9RA 2KDEB 1WRIA 5BYRA 1GAQB 1QLBB 4TUUA 4N6EB 1A5RA 1K52A 3MFGA 2NBVB 1UF0A 3HIZA 3BVGA 2OJWA 3QA8A 4K7UA 5LNK1 4FJVB 4RGTA 1LFDA 3VR9B 4DQOC 4KIKA 3SU8X 2KOXA 1QF6A 2H88B 3PS6A 2RGFA 2JT4B 3VAWA 4M01A 5BYQA 3Q3JA 1JQ4A 1ET9A 4DBGA 4HRSA 2JX5A 1IBXB 2W3RA 4MACA 2PE6B 1X1MA 5EE0A 3DOWA 2RDHA 1VDVA 3GZNI 5HI1A 1SGHA 4KSKC 2KANA 3NVZA 2HTME 2X8XX 1IPGA 3B1LX 2LVPA 2LHDA 3IT6B 1YMHE 3PTFC 2GMIC 4TKNA 1OTRB 3PZ7A 4M8NA 3MHSD 1WMHA 1QOGA 3ZW3A 2MW5A 2INDC 4ACFA 4KDLB 1V1PA 2KXJA 2D10A 5DPTA 4RGNA 4LTUA 3BZDB 1TBEA 1HA5A 3Q2AC 1JROA 4IOIE 1TY2A 3RPFC 4IM3A 2LUMA 5J17A 1FPYA 2MJ3A 2BKFA 2KTRB 1UWMA 2ZJDA 1F2RI 2I1KA 2C60A 1WSPA 3I9V1 1V1OA 3MC8A 3E9SA 2LHEA 3OG5A 2N7DA 1D6EC 1IP9A 3A9JB 3AE6B 1FNVA 3AI5A 2KMAA 4ZDVA 1XLOA 1N61A 4AJWA 3V60A 1E90A 3GE8C 1JRUA 2V4LA 1ET6A 2Y5PA 4CO7A 5GMVA 2PJHA 3M63B 1XEEA 2GBMA 2W3SA 3A1QB 2O2VB 1YN4A 4E71A 1OQYA 4LDTB 2V3NA 1NYQA 3R2TA 3TBLD 3HRDD 1OEYJ 1PGAA 5D3IB 1KTKA 1YIWA 1RRBA 5FK9C 1WX8A 1K51A 1WJUA 3FILB 1WGHA 1UGJA 1D5XC 2JQRB 4NAMA 5IOIA 2OJRA 3AH7A 1ZDXA 3ZIMA 1RFAA 1P1AA 1IBXA 1CQVA 3AE2B 3AECB 3CSTA 4ZHOA 4G3XB 2ZNVB 2B76B 4NQLB 2QDFA 1V5TA 1YD8U 4RM8A 1KRHA 2LD9A 4DXGA 1F2RC 4LDTD 3C8YA 1PGBA 1PGXA 5AUIA 1XT9B 1V9JA 2EMTA 3N9YC 5LLIA 1FCCC 2LXCA 4IUMB 1WX7A 4JLCA 2QSDA 4OHJA 2G3QB 2LASA 3NZSA 1HXYD 2DYOA 1WRDB 2MBQA 4ANXA 1CJEA 4BZAA 1WGDA 3PRPB 3RNCC 3JSVB 4ARCA 2M8SA 2B3AA 4LNNA 1I4GA 1YQ4B 3GB1A 4HLEA 2KTRA 2JUOA 3NZUA 5EDSA 2LWPA 3P4SB 2ICIA 3LXFA 1PYWD 4GU2A 3ECIA 3A9JA 2BB5A 1DOYA 2WXGA 3KUCB 2WXFA 5GXGB 2BS2B 3PZ8A 1HEZE 1Z5SB 4M8MA 4P7IA 4GMVA 1WGYA 2Y3AA 4A3PA 2I2YA 3NS1A 4AS1A 1ZXHA 1WYWB 1S3SG 3ETRA 3IBEA 2N9KA 2KJHB 1YNTE 1WJ6A 4B95A 1NI3A 2JY6A 2JWUA 2L83A 4YSYB 2FUG1 2NCNA 1TT5B 3A1QA 3AEGB 2PIAA 3APDA 2TSSA 1CMXB 3GZNB 2DAFA 2AQ1B 1MG8A 3RNAC 3V6CB 3TSSA 4NNJB 4C00A
chains in the Genus database with same CATH topology
1WY8A 2LGDA 1S1QB 1C1YB 2FIFA 2EKEC 3NHEB 4FN2A 5CHVC 4FJZA 4ICUA 3PLVA 4ASWC 3HM3A 1UBQA 3WAMA 1UZXB 2JF5A 3IHPC 4GDKB 2GBKA 1C3TA 2ZVNA 2KTFA 3N3KB 2KX0A 4B9KA 2MP2A 4LJOB 3U7DA 5IAAC 1WH3A 2WX0A 5J2RA 2DZJA 3DVNU 4IC7B 3O65B 3TIXA 3H6NA 4MGYE 2RSUA 4KZCA 5BO4B 4FA6A 4A20A 2KC2A 3WA0A 2KJ6A 4FBJB 3VUXA 4HDOA 1Q0WB 1WR1A 3A33B 3A9KA 4IWOA 2KO3A 1UH6A 3L10B 2PPHA 4DDGD 2RD0A 3RZWC 4HPLB 4MSMB 1WI0A 3I3TB 1J0GA 2KDBA 2A4ZA 4FHKA 3TL5A 3A9KB 4MDKE 4PS8A 4GN1A 4HDQA 2J0JA 2FCQA 2LRUA 3IVFA 3NY5A 4KDIC 3VQIA 3JW0X 4GSWA 4BOZB 1H8CA 1ZW7A 4TQ0A 2IYDB 5AEKB 3S2AA 2KJRA 3RCZA 4ANWA 1RAXA 3EFUA 5AZHA 2WWZA 2CR5A 2ZZPB 3WAOA 4IWPA 2BGFA 3ZKJC 5G55A 2CHWA 2ZEQA 4NNJB 3WANA 4KIKB 3M62B 4I6LB 1WZ0A 1YX6B 4PS3A 3NOBA 3KVFB 3HHMA 3KYDD 2FCNA 3CF6E 4M0WB 2A5UA 4WAAA 1VD2A 4EFOA 4PS7A 4NQKE 2MX2A 2L0TA 1TTNA 3V6EB 2G4DB 4GXBA 4IWQA 3U30A 3EC8A 2ZNVC 3JSVA 3UIPB 2HD5B 1KM7A 5FR6A 4BKTA 3IFWB 2XEWA 1E7UA 3L13A 3U8ZA 4W9EA 1WGGA 4MELA 4BFRA 5JHBA 2MSED 2LUEA 5JHAA 2KFKB 2J0KA 3VTWA 3RUIB 1P0RA 4EKUA 4FLHA 1Q5WB 3HM6X 1J19A 3QCAA 4WQOB 2MLBA 3ZDMC 3PT2B 5L95C 3H9DA 3CSFA 1NDDA 2O6VB 1LM8B 1ZKHA 2LVQA 2LZ6A 3EHVA 2I1JA 3X23A 4WJQA 1D3ZA 1XD3B 4G11A 4N9F4 3L54A 3TJPA 2M17A 2GBNA 2BF8B 1V81A 3QC8B 3QARA 1P9DU 4XZ4A 5JZEB 1OGWA 2KHWB 4MGZE 2KDFB 1IYFA 3DCGA 4W9CA 1GC6A 2QHOA 2FCSA 4BKSD 2IY1B 2ZPYA 3A4SC 1Z2MA 1GJZA 1TGZB 1M94A 2LVOA 3PHWB 1WMHB 3KH0A 1U4AA 3WIMA 2IO2B 4FHJA 3DVNV 3H1UA 3QJZA 1OEYA 4WJNA 3ZRCA 4G0NB 1QZEA 2LRWA 2C7MB 3QIJA 1WF9A 1SIFA 2AYOB 2YLMA 3ZO5B 1KJTA 2IO3B 2NS5A 3R7QA 3AULA 1YX5B 2FUHB 5CHWA 2PEAA 2V1YA 3Q3FA 2JWZA 1YJ1A 2KC1A 3ALBA 3ZNGC 2KWCA 4DK5A 2OOBB 3VTUA 5IA7A 2ZCCA 2JRIB 3LJ3A 3RZFA 2L7RA 4GOCA 4ZYNA 4BVUC 2ZVOA 5HKHA 2Z0DB 4TV3A 2JRHA 3QQ8B 3UGBB 1L7YA 3QHTA 1KOTA 3L0WB 4GGQA 2AWTA 4F1SA 1NBFC 4GDLA 2FIDA 2GOWA 3V62A 3AXCA 1WM3A 3RD2A 4FJYA 2L3ZA 2O6VD 4RM9A 4XX5A 2C9WB 1VCBA 2KN5A 2CHXA 4XC2A 1FXTB 3ZNID 2KWUB 1E8ZA 3TMPB 1GUAB 1R4MI 3JYUA 4GDKA 2MBEA 4EZJA 3H7PB 3W1SC 4LCDE 3B08A 2K25A 1P98A 2LXAA 2Z0EB 4NJ7A 2LGXA 2GBRA 4MSQB 2MQJA 1WXVA 3SDLC 3TCAA 2K6QA 1V6EA 2MWSB 2K6DB 5AZGA 4ANUA 4W9GA 4K7WA 2KDEB 1WJ4A 1V80A 4WWPA 5DPRA 4TUUA 1V86A 1A5RA 3PLUA 4KZ0A 2DX5B 4MJSB 2V3SA 2XBBC 2ZCBA 4GB9A 4CYEA 5D2MB 3ZLZA 2IO1B 2NBVB 4BBNF 5TR5A 1V2YA 3HIZA 3K9PB 2NPTB 4E3CA 4JL9A 3RYTA 4DHJB 3QK0A 3N32A 3QA8A 5CTRC 4K7UA 4WWOA 4WJPA 4FJVB 2FCMA 4AWJA 4BKSA 1HE8A 2D11A 1LFDA 4BBNC 5LXIB 3HK0A 1WXSA 2MBBB 4KIKA 3SU8X 3VDZA 2KOXA 2L0FA 4W9KA 2K39A 5DCNA 2KVRA 2L8JA 2KQSA 3WALA 3PS6A 1R4NI 2RGFA 3RULA 3MJWA 3L08A 2JT4B 4K1RB 3VAWA 1T0YA 2J0MA 4E74A 5D7GA 3ZRFA 4JIOU 3Q3JA 3R3MA 2RPQA 4DBGA 3ZNHB 4MH0E 1E7VA 3H7SA 2NVUI 4II2B 3RT3B 2DHZA 4X57B 2PE6B 2KFKA 1X1MA 3NS8A 2K1FA 2MBOA 3DOWA 3GZNI 1AARA 1YQBA 1SGHA 4KSKC 3SD5A 1NI2A 2O6VA 4RMAA 4F8CB 2D2QA 5J18A 2KD0A 2KANA 2DAJA 1IPGA 1WIAA 2IZVB 1UGMA 2C5LC 2LVPA 3B1LX 3DDCB 4WWNA 4G50A 4NAWB 3DBHI 3APCA 2CS4A 4W9IA 4DHJD 4E71A 3KYCD 3PTFC 2GMIC 5C23A 4TKNA 3K9OB 1OTRB 3VHTC 2REXA 2BYEA 1I42A 4M8NA 3MHSD 1WMHA 2WX1A 4F7ZA 3D32A 3ZW3A 3X0WA 3DBRI 2MW5A 5E6PA 3ZNZB 4KDLB 2KXJA 2D10A 3QAQA 5DPTA 1WE6A 2WYQA 3M95A 4KV2A 3VUYA 3UQAA 2NBWB 2CHZA 1TBEA 5KHOA 3OAWA 1WXMA 3VVWB 2XK5B 3ML9A 2AL6A 1WJNA 2K8BA 3PZDA 3T8MA 1E8WA 2J7QB 4IM3A 2IO0B 4I6PA 3BY4B 3PGEA 4W9FA 3UINB 5J17A 1WR6E 3LDZE 4CHKA 2AEHA 2D3GA 2BKFA 2KTRB 2JZZA 4IM2A 2ZJDA 4EUTA 1Y8RC 3KW5B 2I1KA 5KHQA 2C60A 1GC7A 4DDID 2L76A 4EOYA 2N7DA 2HJ8A 2BKRB 3VFKA 1IP9A 3A9JB 2M4NA 2G4SA 2IY0B 3DQVA 5LXHA 5E6OA 1V49A 3PSEB 4PYZA 2N9XA 1EF5A 3ZUNA 3B0AA 4KVGB 3H7PA 4BOSC 3AI5A 2KMAA 3P2BA 2BWES 4ZDVA 4WJOA 2JVCA 2DZMA 4IG7B 4AUQC 4AJWA 4JQWC 3V60A 1E90A 2MA9B 3CMMB 1JRUA 1RLFA 2L05A 2V4LA 2N1WA 4NPNA 4LJPB 2N7EA 2AL3A 2G45B 5GMVA 4CO7A 2PJHA 2O2VA 3M63B 4MJSA 3C0RB 2GBMA 2CU1A 4HWIB 3A1QB 1WM2A 5G2NA 3BINA 2GBJA 4HJKA 2HTHA 3EECA 5E6NA 1EUVB 2NPTA 2O2VB 3ZTDA 1OQYA 3KUDB 4LDTB 2FNJB 3QWZB 2LJ5A 3ENEA 4NJ6A 3V61A 4DHZB 2Y5BB 2YVCA 1WX9A 1SE9A 3KUZA 3TBLD 4OVUA 4I6NB 2KK8A 1GNUA 4BKGA 1OEYJ 4W9LA 3VH4B 2CKHB 2LGYA 3ZDTA 1YIWA 1RRBA 1I35A 5D6JB 1WX8A 4ZRKA 1PQSA 2PE9A 3A4RA 3PREA 2C7HA 1WJUA 3APFA 2KLGA 1WGHA 4MEMA 4B6WA 4AP4C 4W9HA 3IG3A 3PVLA 1UELA 3VH3B 4ICVA 2MP2B 2L00B 2OJRA 4II3B 2KKCA 2M0XA 1WZ3A 3ZIMA 1RFAA 1P1AA 3UQBA 1ZGUB 4DXAB 3UF8A 1L2NA 1WE7A 3ONSA 4MM3A 3VXWA 2BYVE 3PRZA 4HCPB 4JGHB 3CSTA 2KWVB 1GG3A 1TZ1A 2KDIA 1KLVA 1Q1OA 2UWQA 4G3XB 2N1VA 2ZNVB 4NQLB 2R2OA 2MRPA 1V5TA 4A3OA 2MCNB 1YD8U 4RM8A 3SHQA 3MTNB 2LD9A 4HVBA 3DBLI 4LDTD 3ZVVA 3PRMB 1LQBA 4NAWA 1XT9B 1V9JA 4W9DA 2KX3A 1WXAA 5C1ZA 2EMTA 2ZPNA 4HXDA 5LLIA 2BYFA 2VRRB 5DPWA 1F9JA 1G6JA 2LXCA 2DZKA 4IUMB 2KQ7A 2R2QA 1WX7A 4IM0A 4JLCA 3DPDA 2G3QB 2LASA 3AU4A 3JVZX 3OJ4B 3NZSA 3PV1A 3VUWA 2DYOA 1WRDB 2MBQA 3N30A 1EF1A 2DYMA 4IW0A 3GOEA 5CHFA 4ANXA 2NR2A 2XK5A 2DYBA 4DHZE 1WGDA 4MGKE 3PRPB 4URKA 1E5WA 2N9PC 2D07B 4ANVA 2JXXA 3JSVB 2BPSA 2M8SA 3R7RA 3ZTCA 1E8XA 2B3AA 1WGRA 2JZ3B 2LI5A 3W1YA 5DPSA 4HLEA 2BWFA 2JPHA 1V5OA 2JUOA 2KTRA 3NZUA 5EDSA 2LWPA 5JH5C 1P3QU 1WFYA 3L16A 2W9NA 3DVGY 2M1MA 2N4FA 4GU2A 3ECIA 4ZRIA 1K8RB 2KNBA 4HCNB 3A9JA 4TQ1A 3KUCB 1E8YA 3UIOB 4YL8A 2RR9A 1ISNA 1Z5SB 3DVGX 4M8MA 3AU5A 4P7IA 4NY0A 4GMVA 1WGYA 3OJ3A 1H4RA 4FULA 4A3PA 4EEWA 1EO6A 2K8HA 2KMCA 1UD7A 2IBIB 2DZIA 2K8CA 2Z59B 1WYWB 4GIVA 4K7SA 1S3SG 5L83A 3W1SA 2KZRA 3IBEA 3QX1A 3PPAA 4HPMB 2KJHB 4J6IA 4AOFA 2FAZA 2KFJA 2HE7A 2MBHA 3L17A 4DWFA 4K81A 3M3JA 3DBSA 4OVVA 1WJ6A 5AZFA 2DENB 2KLCA 5CX3A 4B95A 2JY6A 4EZKA 3ML8A 3T9LA 2NBUA 4AJYB 2NCNA 2WDTB 4W9JA 3VTVA 1BT0A 2EMSA 3A1QA 3PHXB 3WAPA 4KSLC 1J8CA 3R66C 4PYUA 1LXDA 2ASQA 2UYZB 3OLMD 2N9EB 3APDA 4FADA 1CMXB 1XQQA 4ZRJA 2C7NB 2DAFA 1MG8A 5D94A 4MGIE 3V6CB 1UBIA 4HK2A 4EZLA 4GDLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY8 A;  2LGD A;  1S1Q B;  1C1Y B;  2FIF A;  2EKE C;  3NHE B;  4FN2 A;  5CHV C;  4FJZ A;  4ICU A;  3PLV A;  4ASW C;  3HM3 A;  1UBQ A;  3WAM A;  1UZX B;  2JF5 A;  3IHP C;  4GDK B;  2GBK A;  1C3T A;  2ZVN A;  2KTF A;  3N3K B;  2KX0 A;  4B9K A;  2MP2 A;  4LJO B;  3U7D A;  5IAA C;  1WH3 A;  2WX0 A;  5J2R A;  2DZJ A;  3DVN U;  4IC7 B;  3O65 B;  3TIX A;  3H6N A;  4MGY E;  2RSU A;  4KZC A;  5BO4 B;  4FA6 A;  4A20 A;  2KC2 A;  3WA0 A;  2KJ6 A;  4FBJ B;  3VUX A;  4HDO A;  1Q0W B;  1WR1 A;  3A33 B;  3A9K A;  4IWO A;  2KO3 A;  1UH6 A;  3L10 B;  2PPH A;  4DDG D;  2RD0 A;  3RZW C;  4HPL B;  4MSM B;  1WI0 A;  3I3T B;  1J0G A;  2KDB A;  2A4Z A;  4FHK A;  3TL5 A;  3A9K B;  4MDK E;  4PS8 A;  4GN1 A;  4HDQ A;  2J0J A;  2FCQ A;  2LRU A;  3IVF A;  3NY5 A;  4KDI C;  3VQI A;  3JW0 X;  4GSW A;  4BOZ B;  1H8C A;  1ZW7 A;  4TQ0 A;  2IYD B;  5AEK B;  3S2A A;  2KJR A;  3RCZ A;  4ANW A;  1RAX A;  3EFU A;  5AZH A;  2WWZ A;  2CR5 A;  2ZZP B;  3WAO A;  4IWP A;  2BGF A;  3ZKJ C;  5G55 A;  2CHW A;  2ZEQ A;  4NNJ B;  3WAN A;  4KIK B;  3M62 B;  4I6L B;  1WZ0 A;  1YX6 B;  4PS3 A;  3NOB A;  3KVF B;  3HHM A;  3KYD D;  2FCN A;  3CF6 E;  4M0W B;  2A5U A;  4WAA A;  1VD2 A;  4EFO A;  4PS7 A;  4NQK E;  2MX2 A;  2L0T A;  1TTN A;  3V6E B;  2G4D B;  4GXB A;  4IWQ A;  3U30 A;  3EC8 A;  2ZNV C;  3JSV A;  3UIP B;  2HD5 B;  1KM7 A;  5FR6 A;  4BKT A;  3IFW B;  2XEW A;  1E7U A;  3L13 A;  3U8Z A;  4W9E A;  1WGG A;  4MEL A;  4BFR A;  5JHB A;  2MSE D;  2LUE A;  5JHA A;  2KFK B;  2J0K A;  3VTW A;  3RUI B;  1P0R A;  4EKU A;  4FLH A;  1Q5W B;  3HM6 X;  1J19 A;  3QCA A;  4WQO B;  2MLB A;  3ZDM C;  3PT2 B;  5L95 C;  3H9D A;  3CSF A;  1NDD A;  2O6V B;  1LM8 B;  1ZKH A;  2LVQ A;  2LZ6 A;  3EHV A;  2I1J A;  3X23 A;  4WJQ A;  1D3Z A;  1XD3 B;  4G11 A;  4N9F 4;  3L54 A;  3TJP A;  2M17 A;  2GBN A;  2BF8 B;  1V81 A;  3QC8 B;  3QAR A;  1P9D U;  4XZ4 A;  5JZE B;  1OGW A;  2KHW B;  4MGZ E;  2KDF B;  1IYF A;  3DCG A;  4W9C A;  1GC6 A;  2QHO A;  2FCS A;  4BKS D;  2IY1 B;  2ZPY A;  3A4S C;  1Z2M A;  1GJZ A;  1TGZ B;  1M94 A;  2LVO A;  3PHW B;  1WMH B;  3KH0 A;  1U4A A;  3WIM A;  2IO2 B;  4FHJ A;  3DVN V;  3H1U A;  3QJZ A;  1OEY A;  4WJN A;  3ZRC A;  4G0N B;  1QZE A;  2LRW A;  2C7M B;  3QIJ A;  1WF9 A;  1SIF A;  2AYO B;  2YLM A;  3ZO5 B;  1KJT A;  2IO3 B;  2NS5 A;  3R7Q A;  3AUL A;  1YX5 B;  2FUH B;  5CHW A;  2PEA A;  2V1Y A;  3Q3F A;  2JWZ A;  1YJ1 A;  2KC1 A;  3ALB A;  3ZNG C;  2KWC A;  4DK5 A;  2OOB B;  3VTU A;  5IA7 A;  2ZCC A;  2JRI B;  3LJ3 A;  3RZF A;  2L7R A;  4GOC A;  4ZYN A;  4BVU C;  2ZVO A;  5HKH A;  2Z0D B;  4TV3 A;  2JRH A;  3QQ8 B;  3UGB B;  1L7Y A;  3QHT A;  1KOT A;  3L0W B;  4GGQ A;  2AWT A;  4F1S A;  1NBF C;  4GDL A;  2FID A;  2GOW A;  3V62 A;  3AXC A;  1WM3 A;  3RD2 A;  4FJY A;  2L3Z A;  2O6V D;  4RM9 A;  4XX5 A;  2C9W B;  1VCB A;  2KN5 A;  2CHX A;  4XC2 A;  1FXT B;  3ZNI D;  2KWU B;  1E8Z A;  3TMP B;  1GUA B;  1R4M I;  3JYU A;  4GDK A;  2MBE A;  4EZJ A;  3H7P B;  3W1S C;  4LCD E;  3B08 A;  2K25 A;  1P98 A;  2LXA A;  2Z0E B;  4NJ7 A;  2LGX A;  2GBR A;  4MSQ B;  2MQJ A;  1WXV A;  3SDL C;  3TCA A;  2K6Q A;  1V6E A;  2MWS B;  2K6D B;  5AZG A;  4ANU A;  4W9G A;  4K7W A;  2KDE B;  1WJ4 A;  1V80 A;  4WWP A;  5DPR A;  4TUU A;  1V86 A;  1A5R A;  3PLU A;  4KZ0 A;  2DX5 B;  4MJS B;  2V3S A;  2XBB C;  2ZCB A;  4GB9 A;  4CYE A;  5D2M B;  3ZLZ A;  2IO1 B;  2NBV B;  4BBN F;  5TR5 A;  1V2Y A;  3HIZ A;  3K9P B;  2NPT B;  4E3C A;  4JL9 A;  3RYT A;  4DHJ B;  3QK0 A;  3N32 A;  3QA8 A;  5CTR C;  4K7U A;  4WWO A;  4WJP A;  4FJV B;  2FCM A;  4AWJ A;  4BKS A;  1HE8 A;  2D11 A;  1LFD A;  4BBN C;  5LXI B;  3HK0 A;  1WXS A;  2MBB B;  4KIK A;  3SU8 X;  3VDZ A;  2KOX A;  2L0F A;  4W9K A;  2K39 A;  5DCN A;  2KVR A;  2L8J A;  2KQS A;  3WAL A;  3PS6 A;  1R4N I;  2RGF A;  3RUL A;  3MJW A;  3L08 A;  2JT4 B;  4K1R B;  3VAW A;  1T0Y A;  2J0M A;  4E74 A;  5D7G A;  3ZRF A;  4JIO U;  3Q3J A;  3R3M A;  2RPQ A;  4DBG A;  3ZNH B;  4MH0 E;  1E7V A;  3H7S A;  2NVU I;  4II2 B;  3RT3 B;  2DHZ A;  4X57 B;  2PE6 B;  2KFK A;  1X1M A;  3NS8 A;  2K1F A;  2MBO A;  3DOW A;  3GZN I;  1AAR A;  1YQB A;  1SGH A;  4KSK C;  3SD5 A;  1NI2 A;  2O6V A;  4RMA A;  4F8C B;  2D2Q A;  5J18 A;  2KD0 A;  2KAN A;  2DAJ A;  1IPG A;  1WIA A;  2IZV B;  1UGM A;  2C5L C;  2LVP A;  3B1L X;  3DDC B;  4WWN A;  4G50 A;  4NAW B;  3DBH I;  3APC A;  2CS4 A;  4W9I A;  4DHJ D;  4E71 A;  3KYC D;  3PTF C;  2GMI C;  5C23 A;  4TKN A;  3K9O B;  1OTR B;  3VHT C;  2REX A;  2BYE A;  1I42 A;  4M8N A;  3MHS D;  1WMH A;  2WX1 A;  4F7Z A;  3D32 A;  3ZW3 A;  3X0W A;  3DBR I;  2MW5 A;  5E6P A;  3ZNZ B;  4KDL B;  2KXJ A;  2D10 A;  3QAQ A;  5DPT A;  1WE6 A;  2WYQ A;  3M95 A;  4KV2 A;  3VUY A;  3UQA A;  2NBW B;  2CHZ A;  1TBE A;  5KHO A;  3OAW A;  1WXM A;  3VVW B;  2XK5 B;  3ML9 A;  2AL6 A;  1WJN A;  2K8B A;  3PZD A;  3T8M A;  1E8W A;  2J7Q B;  4IM3 A;  2IO0 B;  4I6P A;  3BY4 B;  3PGE A;  4W9F A;  3UIN B;  5J17 A;  1WR6 E;  3LDZ E;  4CHK A;  2AEH A;  2D3G A;  2BKF A;  2KTR B;  2JZZ A;  4IM2 A;  2ZJD A;  4EUT A;  1Y8R C;  3KW5 B;  2I1K A;  5KHQ A;  2C60 A;  1GC7 A;  4DDI D;  2L76 A;  4EOY A;  2N7D A;  2HJ8 A;  2BKR B;  3VFK A;  1IP9 A;  3A9J B;  2M4N A;  2G4S A;  2IY0 B;  3DQV A;  5LXH A;  5E6O A;  1V49 A;  3PSE B;  4PYZ A;  2N9X A;  1EF5 A;  3ZUN A;  3B0A A;  4KVG B;  3H7P A;  4BOS C;  3AI5 A;  2KMA A;  3P2B A;  2BWE S;  4ZDV A;  4WJO A;  2JVC A;  2DZM A;  4IG7 B;  4AUQ C;  4AJW A;  4JQW C;  3V60 A;  1E90 A;  2MA9 B;  3CMM B;  1JRU A;  1RLF A;  2L05 A;  2V4L A;  2N1W A;  4NPN A;  4LJP B;  2N7E A;  2AL3 A;  2G45 B;  5GMV A;  4CO7 A;  2PJH A;  2O2V A;  3M63 B;  4MJS A;  3C0R B;  2GBM A;  2CU1 A;  4HWI B;  3A1Q B;  1WM2 A;  5G2N A;  3BIN A;  2GBJ A;  4HJK A;  2HTH A;  3EEC A;  5E6N A;  1EUV B;  2NPT A;  2O2V B;  3ZTD A;  1OQY A;  3KUD B;  4LDT B;  2FNJ B;  3QWZ B;  2LJ5 A;  3ENE A;  4NJ6 A;  3V61 A;  4DHZ B;  2Y5B B;  2YVC A;  1WX9 A;  1SE9 A;  3KUZ A;  3TBL D;  4OVU A;  4I6N B;  2KK8 A;  1GNU A;  4BKG A;  1OEY J;  4W9L A;  3VH4 B;  2CKH B;  2LGY A;  3ZDT A;  1YIW A;  1RRB A;  1I35 A;  5D6J B;  1WX8 A;  4ZRK A;  1PQS A;  2PE9 A;  3A4R A;  3PRE A;  2C7H A;  1WJU A;  3APF A;  2KLG A;  1WGH A;  4MEM A;  4B6W A;  4AP4 C;  4W9H A;  3IG3 A;  3PVL A;  1UEL A;  3VH3 B;  4ICV A;  2MP2 B;  2L00 B;  2OJR A;  4II3 B;  2KKC A;  2M0X A;  1WZ3 A;  3ZIM A;  1RFA A;  1P1A A;  3UQB A;  1ZGU B;  4DXA B;  3UF8 A;  1L2N A;  1WE7 A;  3ONS A;  4MM3 A;  3VXW A;  2BYV E;  3PRZ A;  4HCP B;  4JGH B;  3CST A;  2KWV B;  1GG3 A;  1TZ1 A;  2KDI A;  1KLV A;  1Q1O A;  2UWQ A;  4G3X B;  2N1V A;  2ZNV B;  4NQL B;  2R2O A;  2MRP A;  1V5T A;  4A3O A;  2MCN B;  1YD8 U;  4RM8 A;  3SHQ A;  3MTN B;  2LD9 A;  4HVB A;  3DBL I;  4LDT D;  3ZVV A;  3PRM B;  1LQB A;  4NAW A;  1XT9 B;  1V9J A;  4W9D A;  2KX3 A;  1WXA A;  5C1Z A;  2EMT A;  2ZPN A;  4HXD A;  5LLI A;  2BYF A;  2VRR B;  5DPW A;  1F9J A;  1G6J A;  2LXC A;  2DZK A;  4IUM B;  2KQ7 A;  2R2Q A;  1WX7 A;  4IM0 A;  4JLC A;  3DPD A;  2G3Q B;  2LAS A;  3AU4 A;  3JVZ X;  3OJ4 B;  3NZS A;  3PV1 A;  3VUW A;  2DYO A;  1WRD B;  2MBQ A;  3N30 A;  1EF1 A;  2DYM A;  4IW0 A;  3GOE A;  5CHF A;  4ANX A;  2NR2 A;  2XK5 A;  2DYB A;  4DHZ E;  1WGD A;  4MGK E;  3PRP B;  4URK A;  1E5W A;  2N9P C;  2D07 B;  4ANV A;  2JXX A;  3JSV B;  2BPS A;  2M8S A;  3R7R A;  3ZTC A;  1E8X A;  2B3A A;  1WGR A;  2JZ3 B;  2LI5 A;  3W1Y A;  5DPS A;  4HLE A;  2BWF A;  2JPH A;  1V5O A;  2JUO A;  2KTR A;  3NZU A;  5EDS A;  2LWP A;  5JH5 C;  1P3Q U;  1WFY A;  3L16 A;  2W9N A;  3DVG Y;  2M1M A;  2N4F A;  4GU2 A;  3ECI A;  4ZRI A;  1K8R B;  2KNB A;  4HCN B;  3A9J A;  4TQ1 A;  3KUC B;  1E8Y A;  3UIO B;  4YL8 A;  2RR9 A;  1ISN A;  1Z5S B;  3DVG X;  4M8M A;  3AU5 A;  4P7I A;  4NY0 A;  4GMV A;  1WGY A;  3OJ3 A;  1H4R A;  4FUL A;  4A3P A;  4EEW A;  1EO6 A;  2K8H A;  2KMC A;  1UD7 A;  2IBI B;  2DZI A;  2K8C A;  2Z59 B;  1WYW B;  4GIV A;  4K7S A;  1S3S G;  5L83 A;  3W1S A;  2KZR A;  3IBE A;  3QX1 A;  3PPA A;  4HPM B;  2KJH B;  4J6I A;  4AOF A;  2FAZ A;  2KFJ A;  2HE7 A;  2MBH A;  3L17 A;  4DWF A;  4K81 A;  3M3J A;  3DBS A;  4OVV A;  1WJ6 A;  5AZF A;  2DEN B;  2KLC A;  5CX3 A;  4B95 A;  2JY6 A;  4EZK A;  3ML8 A;  3T9L A;  2NBU A;  4AJY B;  2NCN A;  2WDT B;  4W9J A;  3VTV A;  1BT0 A;  2EMS A;  3A1Q A;  3PHX B;  3WAP A;  4KSL C;  1J8C A;  3R66 C;  4PYU A;  1LXD A;  2ASQ A;  2UYZ B;  3OLM D;  2N9E B;  3APD A;  4FAD A;  1CMX B;  1XQQ A;  4ZRJ A;  2C7N B;  2DAF A;  1MG8 A;  5D94 A;  4MGI E;  3V6C B;  1UBI A;  4HK2 A;  4EZL A;  4GDL B; 
#chains in the Genus database with same CATH topology
 1JWU D;  1L0Y B;  5CHV C;  4FN2 A;  2K9X A;  4K3B A;  3FIL A;  3HM3 A;  4D2K A;  1UBQ A;  1L6V A;  1HZ6 A;  1C3T A;  3N3K B;  2E6X A;  3U7D A;  1WH3 A;  1EWY C;  3H6N A;  4MGY E;  4ZRP A;  5BO4 B;  3VUX A;  4IWO A;  2RD0 A;  4HPL B;  1STE A;  3P4Q B;  4MT5 A;  1XLP A;  4LNF A;  4HDQ A;  3VQI A;  2FCQ A;  1H8C A;  1ZW7 A;  2IYD B;  4L2Y A;  3ZJT A;  4XWT A;  3P4R B;  2WWZ A;  2BGF A;  2NTT A;  3NVY A;  4M0W A;  2ZEQ A;  1FCL A;  2V9H A;  4REZ A;  1D5M C;  1YX6 B;  3HHM A;  2FCN A;  2A5U A;  1VD2 A;  3AED B;  4JPS A;  1GB1 A;  3U30 A;  2M19 A;  3JSV A;  1T6B X;  3VRA B;  1IGC A;  1E7U A;  3U8Z A;  4W9E A;  1FEH A;  4BFR A;  4OVZ A;  4JE3 B;  2AX5 A;  1YJI A;  3ZDM C;  3H9D A;  1LM8 B;  1ZKH A;  2LZ6 A;  3X23 A;  1XD3 B;  4N9F 4;  3L54 A;  2GBN A;  4WAF A;  3QC8 B;  3QAR A;  1P9D U;  5JZE B;  3DCG A;  4W9C A;  2QHO A;  5BMH A;  1Z2M A;  1C77 A;  1TGZ B;  3BYY B;  3PHW B;  3HVZ A;  4HKQ A;  3ZRC A;  2LRW A;  1DOX A;  3TEZ A;  1SIF A;  3ZO5 B;  2IO3 B;  2NS5 A;  5H92 C;  1YX5 B;  2FUH B;  2V1Y A;  2JWZ A;  2KC1 A;  2CJN A;  2KWC A;  2JRI B;  1L7Y A;  4F1S A;  2H89 B;  2WXP A;  1TKG A;  1ACC A;  2J4X A;  3BWU D;  5D3D A;  3ZNI D;  1E8Z A;  1TS4 A;  1JWS D;  3JYU A;  1P7F A;  3B08 A;  1P98 A;  2Z0E B;  1JWA D;  2IGG A;  3Q8B A;  4LNO A;  3FKY A;  4YXD B;  5AZG A;  2WXR A;  1V80 A;  3N1Z C;  1I4Q A;  1XCQ L;  4NJC A;  3B9J A;  5TR5 A;  2WXI A;  4XDD A;  3ZYY X;  4YSX B;  2M56 B;  3K9P B;  3LB8 C;  3SEB A;  3SFD B;  4A8X C;  4JL9 A;  3RYT A;  3QK0 A;  3N32 A;  5HG2 A;  1QIL A;  1T0R C;  3P1M A;  4BBN C;  1TKY A;  3HK0 A;  1VR9 A;  4UDU C;  5C3J B;  2DWQ A;  2KQS A;  1R4N I;  1D5Z C;  3BYT B;  1RYJ A;  4E74 A;  2QIL A;  3PO0 A;  3ZNH B;  1N63 A;  2NVU I;  4X57 B;  4MM3 B;  3W5U B;  3NS8 A;  2MBO A;  3Q3M C;  2QMT A;  1AAR A;  1SIJ A;  2V0G A;  4RMA A;  2MHJ A;  1EM7 A;  4OZA A;  5IO9 A;  1XLQ A;  3DDC B;  1UGM A;  4WWN A;  3MC9 A;  4W9I A;  4NZL B;  3KYC D;  5C23 A;  1QQR A;  1JWB D;  3VHT C;  3GE3 C;  4YTN B;  2V3P A;  4HEA 1;  4RH6 A;  2RDG A;  3DHI C;  3X0W A;  5E6P A;  3EFC A;  3ZNZ B;  3ZQ4 A;  2KVZ A;  1GPX A;  4YT0 B;  3UQA A;  3M95 A;  3VUY A;  2NBW B;  1FXI A;  3WCQ A;  2XK5 B;  3ML9 A;  2L32 A;  3NZ3 A;  2QCZ A;  2IO0 B;  4P1B C;  1T3Q A;  4CHK A;  2D3G A;  4IM2 A;  4EUT A;  2W82 A;  2X38 A;  4QAY A;  2HJ8 A;  3VFK A;  3DQV A;  2EEL A;  1V49 A;  4PYZ A;  1EF5 A;  2WXQ A;  4KVG B;  1JRP A;  2BWE S;  1ZOY B;  3NVV A;  2JVC A;  4J3O D;  4IG7 B;  1FM0 D;  3RI7 C;  1ENF A;  3CMM B;  1PFD A;  1RLF A;  2L05 A;  2N1W A;  4RCO A;  4YTP B;  4LJP B;  2G45 B;  1I4R A;  5G5G A;  3HVD A;  1T0S C;  3N20 C;  3J9C A;  5G2N A;  2GBJ A;  2HTH A;  3I5J C;  3V61 A;  3VRB B;  5E6J A;  1KFY B;  2YVC A;  1UNS A;  1WX9 A;  1SE9 A;  2PLP A;  5EE1 A;  4I6N B;  2KK8 A;  2IDY A;  1JCK B;  3VH4 B;  1VZ6 A;  3ZDT A;  2VH1 A;  2WLB A;  1I35 A;  1FNU A;  1XXG A;  2C7H A;  1QT9 A;  1J7C A;  2KLG A;  4MEM A;  3RNG C;  3IG3 A;  1UEL A;  3VH3 B;  1E10 A;  2K0P A;  2M0X A;  1CZP A;  4DXA B;  1L2N A;  3UF8 A;  3ONS A;  4MM3 A;  1SE3 A;  1YN5 A;  2BYV E;  4C7Z A;  2Y5C A;  3AB5 A;  2GI9 A;  2GB1 A;  2MRP A;  4O1N A;  2WXM A;  4A3O A;  4S0R A;  1QKZ A;  5HHD G;  4W9D A;  2KX3 A;  1WXA A;  3FC4 A;  1BML C;  1TJE A;  3AE8 B;  1G6J A;  3Q8A A;  2R2Q A;  3TEX A;  3JVZ X;  1R7S A;  4N58 A;  3VUW A;  4PK1 A;  4RF1 A;  3U52 E;  1EF1 A;  4HKZ E;  2EKI A;  2XK5 A;  4DHZ E;  4URK A;  2OED A;  2DLB A;  4P16 A;  4ANV A;  3ZTC A;  1WGR A;  2JZ3 B;  2LI5 A;  3W1Y A;  2BWF A;  4CQN A;  1V5O A;  1SB3 C;  1FXA A;  5JH5 C;  2QC8 A;  3L16 A;  3DVG Y;  2M1M A;  1K8R B;  4HCN B;  1E8Y A;  2IGD A;  1ZP0 B;  3Q69 A;  3AU5 A;  1H4R A;  4FUL A;  4C56 C;  1EO6 A;  2K8H A;  4GIV A;  1UD7 A;  2K8C A;  2Z59 B;  1DYQ A;  3QX1 A;  3PPA A;  4HPM B;  4AOF A;  2MBH A;  1IUE A;  4DWF A;  1HTQ A;  1R4N B;  2DEN B;  2NBU A;  4AJY B;  1NEK B;  4W9J A;  2EMS A;  1ZXI A;  1OQR A;  1J8C A;  3R66 C;  4PYU A;  1LXD A;  2ASQ A;  4US9 A;  3KWL A;  2N9E B;  4FAD A;  3RNB C;  1XQQ A;  4ZRJ A;  2C7N B;  2BVC A;  3Q3O C;  1UBI A;  4HK2 A;  4EZL A;  1AW7 A;  1E7P B;  2EKE C;  2LGS A;  3DWM A;  4ICU A;  1FRR A;  2D3B A;  4S17 A;  3WAM A;  1UZX B;  3V05 A;  3IHP C;  2LFI A;  2KTF A;  2KX0 A;  2D3C A;  5IAA C;  2DZJ A;  3DVN U;  1SSN A;  3O65 B;  3WA0 A;  4FBJ B;  1WR1 A;  3A9K A;  3ZXR A;  2KO3 A;  1UH6 A;  4DDG D;  3RZW C;  1C78 A;  4MSM B;  2KDB A;  1C4P A;  3TL5 A;  2N7J A;  3NY5 A;  3IVF A;  4KDI C;  3JW0 X;  1QOB A;  2KJR A;  3RCZ A;  3L4P A;  4ANW A;  5AZH A;  2CR5 A;  3AEF B;  2N0S B;  3ZKJ C;  2CHW A;  2HDE A;  2IGH A;  3M62 B;  4I6L B;  1WZ0 A;  3NOB A;  3KVF B;  3KYD D;  4M0W B;  4WAA A;  2WQY B;  1SE2 A;  4NQK E;  4RGM A;  3V6E B;  1TTN A;  2G4D B;  4XE0 A;  3EC8 A;  1E0Z A;  3UIP B;  5FR6 A;  3IFW B;  2WGS A;  2XEW A;  3E56 A;  1LO5 D;  1YQ3 B;  1I4X A;  5JHA A;  3KWV A;  1Q5W B;  4WQO B;  2UU7 A;  2MLB A;  1E9M A;  1FMA D;  3CSF A;  3ZGZ A;  5EE3 A;  3P4P B;  3URY A;  2O6V B;  1L4D B;  1TS5 A;  2I1J A;  1TYG B;  5G5H A;  3BVM A;  1GC6 A;  4BKS D;  1CK1 A;  1M94 A;  2KN4 A;  3SFE B;  3DHH C;  1FO4 A;  1ZE3 D;  1PDX A;  1ZUD 2;  2BW2 A;  1UWX A;  3QJZ A;  4G0N B;  1QZE A;  4A55 A;  2J52 A;  3AUL A;  4LNK A;  3HUI A;  3ALB A;  4DK5 A;  2ZCC A;  3LJ3 A;  3RZF A;  4GOC A;  4BVU C;  5HKH A;  3QQ8 B;  1B1Z A;  3QHT A;  3GP7 A;  4GGQ A;  2AWT A;  3V62 A;  1WM3 A;  3RD2 A;  3B2F A;  1AYF A;  2O6V D;  4RM9 A;  2CHX A;  3N1X C;  1ZPS A;  2PVO D;  1NYR A;  2MBE A;  3BVZ A;  4NJ7 A;  3VR8 B;  4MSQ B;  2MQJ A;  3TCA A;  1C79 A;  1V6E A;  2MWS B;  2K6D B;  4ANU A;  1IGD A;  3BK2 A;  5EE9 A;  1N5X A;  4TMA B;  4WWP A;  5DPR A;  2V3S A;  2XBB C;  4GB9 A;  3ZLZ A;  2IO1 B;  1V2Y A;  3AMZ A;  1WXQ A;  4E3C A;  4M02 A;  4WWO A;  4FXC A;  2FCM A;  4BKS A;  1HE8 A;  2D11 A;  1YJJ A;  2WHI A;  2ON8 A;  3MC0 B;  4W9K A;  1DGJ A;  5JXV A;  2KVR A;  2XNA C;  2L8J A;  3WAL A;  3W5V B;  4PT5 A;  3MJW A;  3RUL A;  3ZRF A;  2NTS A;  4C7Y A;  2WXH A;  2RPQ A;  1E7V A;  3OWE B;  3H7S A;  1WGK A;  2DHZ A;  1KH0 A;  2KAJ A;  4RGO S;  1YQB A;  1V97 A;  1NI2 A;  2O6V A;  2KD0 A;  1C9F A;  2DAJ A;  1WIA A;  2IZV B;  4TSS A;  3APC A;  1P7E A;  3Q8F A;  2REX A;  2BYE A;  1QOA A;  2WX1 A;  3DBR I;  4XGA B;  3QAQ A;  4KV2 A;  2CHZ A;  1TY0 A;  1HTO A;  4OZC A;  1WJN A;  2K8B A;  3T8M A;  1E8W A;  3O13 A;  3PGE A;  2WU2 B;  4W9F A;  5BMI A;  1Y8R C;  5KHQ A;  1RWS A;  1GC7 A;  2L76 A;  4EOY A;  2J53 A;  3R8B A;  1TZO A;  4JX1 C;  2BKR B;  2M4N A;  2G4S A;  5LXH A;  5E6O A;  4R3D A;  4HPP A;  3PSE B;  4WH4 A;  2N9X A;  3W2D A;  3B0A A;  4WJO A;  4M00 A;  3RNE C;  1TS2 A;  2MA9 B;  2MJE A;  5AUK A;  2HJ1 A;  3Q14 C;  2NMQ A;  4N59 A;  1GB4 A;  4P6V F;  3C0R B;  1FFU A;  2BB6 A;  5E6N A;  3ZTD A;  1EUV B;  3KUD B;  4NJ6 A;  2FNJ B;  3QWZ B;  2GLS A;  2LJ5 A;  4DHZ B;  1SJE D;  1J7B A;  3KUZ A;  4OVU A;  4BKG A;  1GNU A;  1OFF A;  2CKH B;  2LGY A;  2Q5W D;  2I38 A;  5D6J B;  1JW9 D;  2BQQ A;  1PQS A;  1OQQ A;  3PRE A;  2WS3 B;  4W9H A;  2PTL A;  2MP2 B;  4II3 B;  2KKC A;  1WZ3 A;  2QEJ C;  1FD6 A;  2PVG C;  3UQB A;  1VZ7 A;  4RF0 A;  4H2A A;  3IAS 1;  3VXW A;  3PRZ A;  4JWS C;  4HCP B;  2IPK D;  1TZ1 A;  2K3U A;  1Q1O A;  1KLV A;  3CIR B;  2R2O A;  2MCN B;  2ACZ B;  1F77 A;  1L0V B;  3SHQ A;  4HRO A;  3MTN B;  2LGI A;  4HVB A;  1T0Q C;  3MHZ A;  5IKC M;  3PRM B;  1LQB A;  3R2I A;  3NJT A;  4LNI A;  5C1Z A;  1C76 A;  4HXD A;  1Q10 A;  2RPV A;  2BYF A;  1F9J A;  2DZK A;  1D4B A;  3T3N A;  3DPD A;  1BXT A;  3LYY A;  3AU4 A;  3ZJU A;  2MJD A;  2KDM A;  3DHG C;  4MH8 A;  3CWI A;  3N30 A;  2WXN A;  2INP E;  5FKA C;  2DYB A;  5T8I A;  1E5W A;  2N9P C;  2D07 B;  3GS2 A;  2FE8 A;  3R7R A;  2ZW0 A;  3IT4 B;  2JPH A;  2YEP B;  2QJL A;  2W9N A;  5BYS A;  2N4F A;  3UIO B;  4ZRQ A;  2OHF A;  5TSS A;  2N9L A;  3Q8E A;  4NY0 A;  2QIE B;  3BK1 A;  2KMC A;  2IBI B;  2DZI A;  2PKO A;  5IP4 D;  3EA6 A;  4XDC A;  1FFV A;  2KZR A;  3IXS A;  2KFJ A;  2HE7 A;  2DNF A;  3L17 A;  3M3J A;  2KLC A;  1SJH D;  3IAM 1;  3T9L A;  2VZK D;  3VTV A;  1BT0 A;  3WAP A;  4KSL C;  2JZP A;  3OLM D;  3ZJV A;  2SAK A;  2ONQ A;  5D94 A;  2J42 A;  1MJD A;  2PW9 A;  4B0M A;  2LGD A;  1S1Q B;  1C1Y B;  2FIF A;  4XYC A;  3NHE B;  4ASW C;  2INC C;  4KX6 B;  3ZXV A;  4GDK B;  4ZOH C;  4B9K A;  2MP2 A;  4LJO B;  2MEK A;  1ZDV A;  3DBR B;  4FA6 A;  4A20 A;  4WIP A;  2KC2 A;  1XO3 A;  2KJ6 A;  4HDO A;  3A33 B;  1T5X D;  3L10 B;  2PPH A;  1TS3 A;  1WI0 A;  3I3T B;  1J0G A;  1YOV B;  2A4Z A;  4FHK A;  3A9K B;  2LJI A;  4PS8 A;  3I57 A;  2J0J A;  2LRU A;  4GSW A;  4TQ0 A;  5AEK B;  3S2A A;  1Y56 A;  4IKG A;  3BII D;  3WAO A;  4IWP A;  5G55 A;  1SXT A;  3WAN A;  4AQ7 A;  4JWU C;  3AEA B;  4US8 A;  2AQ3 B;  4PS3 A;  3CF6 E;  2INN E;  1V8C A;  1ROE A;  4EFO A;  4PS7 A;  2MX2 A;  2L0T A;  3TEW A;  2ZNV C;  3TEY A;  2VH2 A;  3L13 A;  1WGG A;  4MEL A;  5MPO A;  1SEB D;  2MSE D;  2R61 A;  2KFK B;  3VTW A;  3RUI B;  1P0R A;  4FLH A;  2WXO A;  4USA A;  1J19 A;  5I4D A;  1NDD A;  2LVQ A;  3EHV A;  1EU3 A;  1KF6 B;  4WJQ A;  1JAL A;  3U2S C;  1NVI D;  4RFB A;  4XZ4 A;  2KHW B;  2DBY A;  2YEP F;  2ZPY A;  3A4S C;  1GJZ A;  3P42 A;  1QOF A;  3WIM A;  2IO2 B;  1MFW A;  4K3C A;  3DVN V;  3H1U A;  3AV8 A;  1OEY A;  3NRZ A;  2C7M B;  2LMC A;  1WF9 A;  1VRA B;  5CHW A;  3ZNG C;  5IA7 A;  3AE1 B;  2L7R A;  2ZVO A;  3W9C B;  2Z0D B;  2IJ0 A;  1NEN B;  4TV3 A;  3UGB B;  3Q8C A;  1LGR A;  3L0W B;  1NBF C;  2GOW A;  3AXC A;  4FJY A;  1YN3 A;  3AEB B;  3U7Z A;  1VCB A;  2KN5 A;  4LLG M;  1FXT B;  1FNW A;  5BMG A;  3Q3N C;  3B2G A;  1PUT A;  4GDK A;  4EZJ A;  3H7P B;  1EU4 A;  3W1S C;  4LCD E;  2K25 A;  3FAH A;  1XLN A;  2K6Q A;  4ZHP A;  2KAC A;  4K7W A;  1WJ4 A;  1DOI A;  2JYT A;  4DXF A;  1V86 A;  3PLU A;  4KZ0 A;  4C4V B;  2DX5 B;  4MJS B;  4EE2 A;  2ZCB A;  4CYE A;  5D2M B;  3EGR A;  4BBN F;  2L1A A;  3C19 A;  2NPT B;  1MHH E;  4DHJ B;  2CU3 A;  5CTR C;  4ARI A;  4IDI A;  4WJP A;  4AWJ A;  5LXI B;  1WXS A;  1XCT L;  2MBB B;  4GLS C;  2CJO A;  3VDZ A;  2ZW1 A;  1AWD A;  2L0F A;  2K39 A;  5DCN A;  3AM9 A;  4RNA A;  3L08 A;  4BAX A;  2RMM A;  4K1R B;  4KGR A;  1T0Y A;  2J0M A;  1JML A;  5D7G A;  4JIO U;  4KGT A;  3R3M A;  3U4E G;  4MH0 E;  2E3T A;  4II2 B;  3RT3 B;  5IN7 A;  3UI3 A;  1RFK A;  1E6E B;  1SE4 A;  2KFK A;  5C2T B;  2K1F A;  2Z8L A;  1JWM D;  3I63 C;  2JYE A;  1I4H A;  3SD5 A;  4F8C B;  5J18 A;  2D2Q A;  4ITK A;  3NG0 A;  2C5L C;  4G50 A;  4NAW B;  3DBH I;  4DHJ D;  2CS4 A;  3K9O B;  1WWT A;  1R4M B;  1I42 A;  2PMV A;  4XWW A;  1VZ8 A;  4F7Z A;  3D32 A;  3AE9 B;  1UUP A;  1L4Z B;  1WE6 A;  2WYQ A;  2BTE A;  2BYT A;  5KHO A;  3OAW A;  1WXM A;  2XN9 C;  3VVW B;  2BT6 A;  4KKI A;  2AL6 A;  3PZD A;  2KYW A;  2J7Q B;  3MP9 A;  4I6P A;  3BY4 B;  3UIN B;  1WR6 E;  2D5G A;  3LDZ E;  2AEH A;  2WDV B;  2JZZ A;  4LK0 M;  3KW5 B;  4L1B A;  5FR3 A;  1N60 A;  4DDI D;  1M4V A;  3NVW A;  2IY0 B;  2GRI A;  3ZUN A;  2WNM A;  3H7P A;  4BOS C;  3P2B A;  3AE7 B;  1MVK A;  2DZM A;  4AUQ C;  2KWD A;  1SBB B;  4JQW C;  4NPN A;  2N7E A;  1AN8 A;  2AL3 A;  4OZB A;  2O2V A;  4C4V A;  4MJS A;  3V3X A;  2CU1 A;  4HWI B;  1WM2 A;  3BIN A;  4HJK A;  3EEC A;  2NPT A;  3ENE A;  2Y5B B;  2AQ2 B;  1TIF A;  4OW0 A;  4W9L A;  2BBC A;  2WDQ B;  4ZRK A;  2PE9 A;  3A4R A;  3DWG C;  3APF A;  4B6W A;  4AP4 C;  3PVL A;  4ICV A;  2L00 B;  4B0E A;  2M0A A;  1ZGU B;  3N1Y C;  1WE7 A;  3RMK C;  1N5W A;  4JGH B;  2KWV B;  1GG3 A;  2KDI A;  2UWQ A;  2N1V A;  2BS3 B;  2WXK A;  2WU5 B;  3DBL I;  4A90 A;  3ZVV A;  4NAW A;  3P63 A;  4WWM A;  2G9H D;  2ZPN A;  1HQR D;  2VRR B;  5DPW A;  2KQ7 A;  4IM0 A;  3OJ4 B;  1L0X B;  3PV1 A;  2JU6 X;  1N6Z A;  2DYM A;  2KQ4 X;  4IW0 A;  3GOE A;  2JSV X;  5CHF A;  2NR2 A;  4YWG G;  1L6U A;  4MGK E;  3ABV B;  2JXX A;  2BPS A;  3AE4 B;  1E8X A;  3AE5 B;  1VJK A;  5DPS A;  2K22 A;  1MPE A;  1P3Q U;  3TUO A;  1A70 A;  1WFY A;  1I4P A;  4ZRI A;  1KLG D;  2KNB A;  3KLS X;  4TQ1 A;  1K53 A;  1N62 A;  1ESF A;  2RR9 A;  1ISN A;  3DVG X;  4YL8 A;  3RNF C;  4C80 A;  2WP9 B;  3OJ3 A;  4EEW A;  4K7S A;  5L83 A;  4KGS A;  3W1S A;  2SEB D;  4J6I A;  2FAZ A;  4HJG E;  3RN9 C;  4K81 A;  1J7A A;  3DBS A;  4OVV A;  5AZF A;  4L23 A;  5CX3 A;  3SR6 A;  4EZK A;  3ML8 A;  2WDT B;  3MJ5 A;  3PHX B;  1SF0 A;  5H8Y E;  2L52 A;  1F52 A;  2UYZ B;  4KKJ A;  4MGI E;  2WXL A;  4GDL B;  1L5P A;  1WY8 A;  4FJZ A;  3PLV A;  3DBH B;  1KLU D;  1EWC A;  3AN1 A;  2JF5 A;  2GBK A;  1F0Z A;  2ZVN A;  2MH7 A;  5J2R A;  2WX0 A;  4IC7 B;  3TIX A;  2RSU A;  4KZC A;  2BS4 B;  1Q0W B;  1BUI C;  4YTM B;  2V4I B;  1XF5 L;  2K5P A;  2WXJ A;  3KQ4 A;  4MDK E;  4GN1 A;  1TKE A;  4BOZ B;  1RAX A;  3EFU A;  2ZZP B;  2FBW B;  3NUH B;  4WUR A;  3RFZ B;  4WQM A;  3AE3 B;  4KIK B;  1FRD A;  3T3O A;  4YSZ B;  4Q2J A;  3EUB 2;  1K50 A;  4GXB A;  4IWQ A;  2HD5 B;  1KM7 A;  4BKT A;  2VZK B;  5JHB A;  2LUE A;  2J0K A;  4EKU A;  3AEE B;  3HM6 X;  3QCA A;  5L95 C;  1F1H A;  3PT2 B;  2KT7 A;  1D3Z A;  4G11 A;  2RDB C;  3TJP A;  2M17 A;  1C4C A;  2BF8 B;  1V81 A;  2LEK A;  2W55 A;  1C4A A;  1OGW A;  4MGZ E;  2KDF B;  1IYF A;  1WYG A;  2FCS A;  1GOZ A;  2IY1 B;  5HFY A;  3Q6B A;  1MHX A;  1I7H A;  2LVO A;  3KH0 A;  1WMH B;  1U4A A;  4FHJ A;  1V1P B;  4WJN A;  4A6Q A;  4P1C C;  1MI0 A;  2WDR B;  4ZYS A;  3QIJ A;  2AYO B;  2YLM A;  1KJT A;  3R7Q A;  4A9A A;  2PEA A;  2G1E A;  3Q3F A;  1YJ1 A;  2OOB B;  3VTU A;  4ZYN A;  1HZ5 A;  2JXT A;  2JRH A;  1KOT A;  4GDL A;  2FID A;  1VLB A;  1MG4 A;  2L3Z A;  4XX5 A;  3DBL B;  2C9W B;  2D3A A;  4XC2 A;  2KWU B;  3TMP B;  1GUA B;  1R4M I;  1RM6 C;  3H8H A;  2LXA A;  2LGX A;  2GBR A;  1FIQ A;  2KMM A;  1WXV A;  3SDL C;  2W54 A;  4W9G A;  1B9R A;  2KDE B;  1WRI A;  5BYR A;  1GAQ B;  1QLB B;  4TUU A;  4N6E B;  1A5R A;  1K52 A;  3MFG A;  2NBV B;  1UF0 A;  3HIZ A;  3BVG A;  2OJW A;  3QA8 A;  4K7U A;  5LNK 1;  4FJV B;  4RGT A;  1LFD A;  3VR9 B;  4DQO C;  4KIK A;  3SU8 X;  2KOX A;  1QF6 A;  2H88 B;  3PS6 A;  2RGF A;  2JT4 B;  3VAW A;  4M01 A;  5BYQ A;  3Q3J A;  1JQ4 A;  1ET9 A;  4DBG A;  4HRS A;  2JX5 A;  1IBX B;  2W3R A;  4MAC A;  2PE6 B;  1X1M A;  5EE0 A;  3DOW A;  2RDH A;  1VDV A;  3GZN I;  5HI1 A;  1SGH A;  4KSK C;  2KAN A;  3NVZ A;  2HTM E;  2X8X X;  1IPG A;  3B1L X;  2LVP A;  2LHD A;  3IT6 B;  1YMH E;  3PTF C;  2GMI C;  4TKN A;  1OTR B;  3PZ7 A;  4M8N A;  3MHS D;  1WMH A;  1QOG A;  3ZW3 A;  2MW5 A;  2IND C;  4ACF A;  4KDL B;  1V1P A;  2KXJ A;  2D10 A;  5DPT A;  4RGN A;  4LTU A;  3BZD B;  1TBE A;  1HA5 A;  3Q2A C;  1JRO A;  4IOI E;  1TY2 A;  3RPF C;  4IM3 A;  2LUM A;  5J17 A;  1FPY A;  2MJ3 A;  2BKF A;  2KTR B;  1UWM A;  2ZJD A;  1F2R I;  2I1K A;  2C60 A;  1WSP A;  3I9V 1;  1V1O A;  3MC8 A;  3E9S A;  2LHE A;  3OG5 A;  2N7D A;  1D6E C;  1IP9 A;  3A9J B;  3AE6 B;  1FNV A;  3AI5 A;  2KMA A;  4ZDV A;  1XLO A;  1N61 A;  4AJW A;  3V60 A;  1E90 A;  3GE8 C;  1JRU A;  2V4L A;  1ET6 A;  2Y5P A;  4CO7 A;  5GMV A;  2PJH A;  3M63 B;  1XEE A;  2GBM A;  2W3S A;  3A1Q B;  2O2V B;  1YN4 A;  4E71 A;  1OQY A;  4LDT B;  2V3N A;  1NYQ A;  3R2T A;  3TBL D;  3HRD D;  1OEY J;  1PGA A;  5D3I B;  1KTK A;  1YIW A;  1RRB A;  5FK9 C;  1WX8 A;  1K51 A;  1WJU A;  3FIL B;  1WGH A;  1UGJ A;  1D5X C;  2JQR B;  4NAM A;  5IOI A;  2OJR A;  3AH7 A;  1ZDX A;  3ZIM A;  1RFA A;  1P1A A;  1IBX A;  1CQV A;  3AE2 B;  3AEC B;  3CST A;  4ZHO A;  4G3X B;  2ZNV B;  2B76 B;  4NQL B;  2QDF A;  1V5T A;  1YD8 U;  4RM8 A;  1KRH A;  2LD9 A;  4DXG A;  1F2R C;  4LDT D;  3C8Y A;  1PGB A;  1PGX A;  5AUI A;  1XT9 B;  1V9J A;  2EMT A;  3N9Y C;  5LLI A;  1FCC C;  2LXC A;  4IUM B;  1WX7 A;  4JLC A;  2QSD A;  4OHJ A;  2G3Q B;  2LAS A;  3NZS A;  1HXY D;  2DYO A;  1WRD B;  2MBQ A;  4ANX A;  1CJE A;  4BZA A;  1WGD A;  3PRP B;  3RNC C;  3JSV B;  4ARC A;  2M8S A;  2B3A A;  4LNN A;  1I4G A;  1YQ4 B;  3GB1 A;  4HLE A;  2KTR A;  2JUO A;  3NZU A;  5EDS A;  2LWP A;  3P4S B;  2ICI A;  3LXF A;  1PYW D;  4GU2 A;  3ECI A;  3A9J A;  2BB5 A;  1DOY A;  2WXG A;  3KUC B;  2WXF A;  5GXG B;  2BS2 B;  3PZ8 A;  1HEZ E;  1Z5S B;  4M8M A;  4P7I A;  4GMV A;  1WGY A;  2Y3A A;  4A3P A;  2I2Y A;  3NS1 A;  4AS1 A;  1ZXH A;  1WYW B;  1S3S G;  3ETR A;  3IBE A;  2N9K A;  2KJH B;  1YNT E;  1WJ6 A;  4B95 A;  1NI3 A;  2JY6 A;  2JWU A;  2L83 A;  4YSY B;  2FUG 1;  2NCN A;  1TT5 B;  3A1Q A;  3AEG B;  2PIA A;  3APD A;  2TSS A;  1CMX B;  3GZN B;  2DAF A;  2AQ1 B;  1MG8 A;  3RNA C;  3V6C B;  3TSS A;  4NNJ B;  4C00 A; 
#chains in the Genus database with same CATH homology
 1WY8 A;  2LGD A;  1S1Q B;  1C1Y B;  2FIF A;  2EKE C;  3NHE B;  4FN2 A;  5CHV C;  4FJZ A;  4ICU A;  3PLV A;  4ASW C;  3HM3 A;  1UBQ A;  3WAM A;  1UZX B;  2JF5 A;  3IHP C;  4GDK B;  2GBK A;  1C3T A;  2ZVN A;  2KTF A;  3N3K B;  2KX0 A;  4B9K A;  2MP2 A;  4LJO B;  3U7D A;  5IAA C;  1WH3 A;  2WX0 A;  5J2R A;  2DZJ A;  3DVN U;  4IC7 B;  3O65 B;  3TIX A;  3H6N A;  4MGY E;  2RSU A;  4KZC A;  5BO4 B;  4FA6 A;  4A20 A;  2KC2 A;  3WA0 A;  2KJ6 A;  4FBJ B;  3VUX A;  4HDO A;  1Q0W B;  1WR1 A;  3A33 B;  3A9K A;  4IWO A;  2KO3 A;  1UH6 A;  3L10 B;  2PPH A;  4DDG D;  2RD0 A;  3RZW C;  4HPL B;  4MSM B;  1WI0 A;  3I3T B;  1J0G A;  2KDB A;  2A4Z A;  4FHK A;  3TL5 A;  3A9K B;  4MDK E;  4PS8 A;  4GN1 A;  4HDQ A;  2J0J A;  2FCQ A;  2LRU A;  3IVF A;  3NY5 A;  4KDI C;  3VQI A;  3JW0 X;  4GSW A;  4BOZ B;  1H8C A;  1ZW7 A;  4TQ0 A;  2IYD B;  5AEK B;  3S2A A;  2KJR A;  3RCZ A;  4ANW A;  1RAX A;  3EFU A;  5AZH A;  2WWZ A;  2CR5 A;  2ZZP B;  3WAO A;  4IWP A;  2BGF A;  3ZKJ C;  5G55 A;  2CHW A;  2ZEQ A;  4NNJ B;  3WAN A;  4KIK B;  3M62 B;  4I6L B;  1WZ0 A;  1YX6 B;  4PS3 A;  3NOB A;  3KVF B;  3HHM A;  3KYD D;  2FCN A;  3CF6 E;  4M0W B;  2A5U A;  4WAA A;  1VD2 A;  4EFO A;  4PS7 A;  4NQK E;  2MX2 A;  2L0T A;  1TTN A;  3V6E B;  2G4D B;  4GXB A;  4IWQ A;  3U30 A;  3EC8 A;  2ZNV C;  3JSV A;  3UIP B;  2HD5 B;  1KM7 A;  5FR6 A;  4BKT A;  3IFW B;  2XEW A;  1E7U A;  3L13 A;  3U8Z A;  4W9E A;  1WGG A;  4MEL A;  4BFR A;  5JHB A;  2MSE D;  2LUE A;  5JHA A;  2KFK B;  2J0K A;  3VTW A;  3RUI B;  1P0R A;  4EKU A;  4FLH A;  1Q5W B;  3HM6 X;  1J19 A;  3QCA A;  4WQO B;  2MLB A;  3ZDM C;  3PT2 B;  5L95 C;  3H9D A;  3CSF A;  1NDD A;  2O6V B;  1LM8 B;  1ZKH A;  2LVQ A;  2LZ6 A;  3EHV A;  2I1J A;  3X23 A;  4WJQ A;  1D3Z A;  1XD3 B;  4G11 A;  4N9F 4;  3L54 A;  3TJP A;  2M17 A;  2GBN A;  2BF8 B;  1V81 A;  3QC8 B;  3QAR A;  1P9D U;  4XZ4 A;  5JZE B;  1OGW A;  2KHW B;  4MGZ E;  2KDF B;  1IYF A;  3DCG A;  4W9C A;  1GC6 A;  2QHO A;  2FCS A;  4BKS D;  2IY1 B;  2ZPY A;  3A4S C;  1Z2M A;  1GJZ A;  1TGZ B;  1M94 A;  2LVO A;  3PHW B;  1WMH B;  3KH0 A;  1U4A A;  3WIM A;  2IO2 B;  4FHJ A;  3DVN V;  3H1U A;  3QJZ A;  1OEY A;  4WJN A;  3ZRC A;  4G0N B;  1QZE A;  2LRW A;  2C7M B;  3QIJ A;  1WF9 A;  1SIF A;  2AYO B;  2YLM A;  3ZO5 B;  1KJT A;  2IO3 B;  2NS5 A;  3R7Q A;  3AUL A;  1YX5 B;  2FUH B;  5CHW A;  2PEA A;  2V1Y A;  3Q3F A;  2JWZ A;  1YJ1 A;  2KC1 A;  3ALB A;  3ZNG C;  2KWC A;  4DK5 A;  2OOB B;  3VTU A;  5IA7 A;  2ZCC A;  2JRI B;  3LJ3 A;  3RZF A;  2L7R A;  4GOC A;  4ZYN A;  4BVU C;  2ZVO A;  5HKH A;  2Z0D B;  4TV3 A;  2JRH A;  3QQ8 B;  3UGB B;  1L7Y A;  3QHT A;  1KOT A;  3L0W B;  4GGQ A;  2AWT A;  4F1S A;  1NBF C;  4GDL A;  2FID A;  2GOW A;  3V62 A;  3AXC A;  1WM3 A;  3RD2 A;  4FJY A;  2L3Z A;  2O6V D;  4RM9 A;  4XX5 A;  2C9W B;  1VCB A;  2KN5 A;  2CHX A;  4XC2 A;  1FXT B;  3ZNI D;  2KWU B;  1E8Z A;  3TMP B;  1GUA B;  1R4M I;  3JYU A;  4GDK A;  2MBE A;  4EZJ A;  3H7P B;  3W1S C;  4LCD E;  3B08 A;  2K25 A;  1P98 A;  2LXA A;  2Z0E B;  4NJ7 A;  2LGX A;  2GBR A;  4MSQ B;  2MQJ A;  1WXV A;  3SDL C;  3TCA A;  2K6Q A;  1V6E A;  2MWS B;  2K6D B;  5AZG A;  4ANU A;  4W9G A;  4K7W A;  2KDE B;  1WJ4 A;  1V80 A;  4WWP A;  5DPR A;  4TUU A;  1V86 A;  1A5R A;  3PLU A;  4KZ0 A;  2DX5 B;  4MJS B;  2V3S A;  2XBB C;  2ZCB A;  4GB9 A;  4CYE A;  5D2M B;  3ZLZ A;  2IO1 B;  2NBV B;  4BBN F;  5TR5 A;  1V2Y A;  3HIZ A;  3K9P B;  2NPT B;  4E3C A;  4JL9 A;  3RYT A;  4DHJ B;  3QK0 A;  3N32 A;  3QA8 A;  5CTR C;  4K7U A;  4WWO A;  4WJP A;  4FJV B;  2FCM A;  4AWJ A;  4BKS A;  1HE8 A;  2D11 A;  1LFD A;  4BBN C;  5LXI B;  3HK0 A;  1WXS A;  2MBB B;  4KIK A;  3SU8 X;  3VDZ A;  2KOX A;  2L0F A;  4W9K A;  2K39 A;  5DCN A;  2KVR A;  2L8J A;  2KQS A;  3WAL A;  3PS6 A;  1R4N I;  2RGF A;  3RUL A;  3MJW A;  3L08 A;  2JT4 B;  4K1R B;  3VAW A;  1T0Y A;  2J0M A;  4E74 A;  5D7G A;  3ZRF A;  4JIO U;  3Q3J A;  3R3M A;  2RPQ A;  4DBG A;  3ZNH B;  4MH0 E;  1E7V A;  3H7S A;  2NVU I;  4II2 B;  3RT3 B;  2DHZ A;  4X57 B;  2PE6 B;  2KFK A;  1X1M A;  3NS8 A;  2K1F A;  2MBO A;  3DOW A;  3GZN I;  1AAR A;  1YQB A;  1SGH A;  4KSK C;  3SD5 A;  1NI2 A;  2O6V A;  4RMA A;  4F8C B;  2D2Q A;  5J18 A;  2KD0 A;  2KAN A;  2DAJ A;  1IPG A;  1WIA A;  2IZV B;  1UGM A;  2C5L C;  2LVP A;  3B1L X;  3DDC B;  4WWN A;  4G50 A;  4NAW B;  3DBH I;  3APC A;  2CS4 A;  4W9I A;  4DHJ D;  4E71 A;  3KYC D;  3PTF C;  2GMI C;  5C23 A;  4TKN A;  3K9O B;  1OTR B;  3VHT C;  2REX A;  2BYE A;  1I42 A;  4M8N A;  3MHS D;  1WMH A;  2WX1 A;  4F7Z A;  3D32 A;  3ZW3 A;  3X0W A;  3DBR I;  2MW5 A;  5E6P A;  3ZNZ B;  4KDL B;  2KXJ A;  2D10 A;  3QAQ A;  5DPT A;  1WE6 A;  2WYQ A;  3M95 A;  4KV2 A;  3VUY A;  3UQA A;  2NBW B;  2CHZ A;  1TBE A;  5KHO A;  3OAW A;  1WXM A;  3VVW B;  2XK5 B;  3ML9 A;  2AL6 A;  1WJN A;  2K8B A;  3PZD A;  3T8M A;  1E8W A;  2J7Q B;  4IM3 A;  2IO0 B;  4I6P A;  3BY4 B;  3PGE A;  4W9F A;  3UIN B;  5J17 A;  1WR6 E;  3LDZ E;  4CHK A;  2AEH A;  2D3G A;  2BKF A;  2KTR B;  2JZZ A;  4IM2 A;  2ZJD A;  4EUT A;  1Y8R C;  3KW5 B;  2I1K A;  5KHQ A;  2C60 A;  1GC7 A;  4DDI D;  2L76 A;  4EOY A;  2N7D A;  2HJ8 A;  2BKR B;  3VFK A;  1IP9 A;  3A9J B;  2M4N A;  2G4S A;  2IY0 B;  3DQV A;  5LXH A;  5E6O A;  1V49 A;  3PSE B;  4PYZ A;  2N9X A;  1EF5 A;  3ZUN A;  3B0A A;  4KVG B;  3H7P A;  4BOS C;  3AI5 A;  2KMA A;  3P2B A;  2BWE S;  4ZDV A;  4WJO A;  2JVC A;  2DZM A;  4IG7 B;  4AUQ C;  4AJW A;  4JQW C;  3V60 A;  1E90 A;  2MA9 B;  3CMM B;  1JRU A;  1RLF A;  2L05 A;  2V4L A;  2N1W A;  4NPN A;  4LJP B;  2N7E A;  2AL3 A;  2G45 B;  5GMV A;  4CO7 A;  2PJH A;  2O2V A;  3M63 B;  4MJS A;  3C0R B;  2GBM A;  2CU1 A;  4HWI B;  3A1Q B;  1WM2 A;  5G2N A;  3BIN A;  2GBJ A;  4HJK A;  2HTH A;  3EEC A;  5E6N A;  1EUV B;  2NPT A;  2O2V B;  3ZTD A;  1OQY A;  3KUD B;  4LDT B;  2FNJ B;  3QWZ B;  2LJ5 A;  3ENE A;  4NJ6 A;  3V61 A;  4DHZ B;  2Y5B B;  2YVC A;  1WX9 A;  1SE9 A;  3KUZ A;  3TBL D;  4OVU A;  4I6N B;  2KK8 A;  1GNU A;  4BKG A;  1OEY J;  4W9L A;  3VH4 B;  2CKH B;  2LGY A;  3ZDT A;  1YIW A;  1RRB A;  1I35 A;  5D6J B;  1WX8 A;  4ZRK A;  1PQS A;  2PE9 A;  3A4R A;  3PRE A;  2C7H A;  1WJU A;  3APF A;  2KLG A;  1WGH A;  4MEM A;  4B6W A;  4AP4 C;  4W9H A;  3IG3 A;  3PVL A;  1UEL A;  3VH3 B;  4ICV A;  2MP2 B;  2L00 B;  2OJR A;  4II3 B;  2KKC A;  2M0X A;  1WZ3 A;  3ZIM A;  1RFA A;  1P1A A;  3UQB A;  1ZGU B;  4DXA B;  3UF8 A;  1L2N A;  1WE7 A;  3ONS A;  4MM3 A;  3VXW A;  2BYV E;  3PRZ A;  4HCP B;  4JGH B;  3CST A;  2KWV B;  1GG3 A;  1TZ1 A;  2KDI A;  1KLV A;  1Q1O A;  2UWQ A;  4G3X B;  2N1V A;  2ZNV B;  4NQL B;  2R2O A;  2MRP A;  1V5T A;  4A3O A;  2MCN B;  1YD8 U;  4RM8 A;  3SHQ A;  3MTN B;  2LD9 A;  4HVB A;  3DBL I;  4LDT D;  3ZVV A;  3PRM B;  1LQB A;  4NAW A;  1XT9 B;  1V9J A;  4W9D A;  2KX3 A;  1WXA A;  5C1Z A;  2EMT A;  2ZPN A;  4HXD A;  5LLI A;  2BYF A;  2VRR B;  5DPW A;  1F9J A;  1G6J A;  2LXC A;  2DZK A;  4IUM B;  2KQ7 A;  2R2Q A;  1WX7 A;  4IM0 A;  4JLC A;  3DPD A;  2G3Q B;  2LAS A;  3AU4 A;  3JVZ X;  3OJ4 B;  3NZS A;  3PV1 A;  3VUW A;  2DYO A;  1WRD B;  2MBQ A;  3N30 A;  1EF1 A;  2DYM A;  4IW0 A;  3GOE A;  5CHF A;  4ANX A;  2NR2 A;  2XK5 A;  2DYB A;  4DHZ E;  1WGD A;  4MGK E;  3PRP B;  4URK A;  1E5W A;  2N9P C;  2D07 B;  4ANV A;  2JXX A;  3JSV B;  2BPS A;  2M8S A;  3R7R A;  3ZTC A;  1E8X A;  2B3A A;  1WGR A;  2JZ3 B;  2LI5 A;  3W1Y A;  5DPS A;  4HLE A;  2BWF A;  2JPH A;  1V5O A;  2JUO A;  2KTR A;  3NZU A;  5EDS A;  2LWP A;  5JH5 C;  1P3Q U;  1WFY A;  3L16 A;  2W9N A;  3DVG Y;  2M1M A;  2N4F A;  4GU2 A;  3ECI A;  4ZRI A;  1K8R B;  2KNB A;  4HCN B;  3A9J A;  4TQ1 A;  3KUC B;  1E8Y A;  3UIO B;  4YL8 A;  2RR9 A;  1ISN A;  1Z5S B;  3DVG X;  4M8M A;  3AU5 A;  4P7I A;  4NY0 A;  4GMV A;  1WGY A;  3OJ3 A;  1H4R A;  4FUL A;  4A3P A;  4EEW A;  1EO6 A;  2K8H A;  2KMC A;  1UD7 A;  2IBI B;  2DZI A;  2K8C A;  2Z59 B;  1WYW B;  4GIV A;  4K7S A;  1S3S G;  5L83 A;  3W1S A;  2KZR A;  3IBE A;  3QX1 A;  3PPA A;  4HPM B;  2KJH B;  4J6I A;  4AOF A;  2FAZ A;  2KFJ A;  2HE7 A;  2MBH A;  3L17 A;  4DWF A;  4K81 A;  3M3J A;  3DBS A;  4OVV A;  1WJ6 A;  5AZF A;  2DEN B;  2KLC A;  5CX3 A;  4B95 A;  2JY6 A;  4EZK A;  3ML8 A;  3T9L A;  2NBU A;  4AJY B;  2NCN A;  2WDT B;  4W9J A;  3VTV A;  1BT0 A;  2EMS A;  3A1Q A;  3PHX B;  3WAP A;  4KSL C;  1J8C A;  3R66 C;  4PYU A;  1LXD A;  2ASQ A;  2UYZ B;  3OLM D;  2N9E B;  3APD A;  4FAD A;  1CMX B;  1XQQ A;  4ZRJ A;  2C7N B;  2DAF A;  1MG8 A;  5D94 A;  4MGI E;  3V6C B;  1UBI A;  4HK2 A;  4EZL A;  4GDL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...