4HCPB

Crystal structure of burkholderia pseudomallei effector protein chbp in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
b'AAMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP/GTP binding protein
publication title Structural mechanism of ubiquitin and NEDD8 deamidation catalyzed by bacterial effectors that induce macrophage-specific apoptosis.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Protein binding
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hcpB00
1WMHB 3L08A 2N7EA 4LJPB 3RZWC 5D2MB 4KIKB 3VVWB 4EUTA 3DCGA 4MH0E 3H7PB 3MJWA 2M0XA 3QJZA 3GOEA 4FJYA 4E74A 4ZRKA 1V2YA 3VUXA 4NAWA 3QQ8B 2ZCCA 2ZVOA 3N30A 1WX9A 3VHTC 4W9CA 1V5TA 2FNJB 2NBWB 4W9FA 1YX6B 2BPSA 4A3PA 1YD8U 4HLEA 3KVFB 4AOFA 1OQYA 2K25A 2JY6A 2MSED 3A4SC 1GNUA 2GBKA 5D6JB 1RLFA 1P3QU 3UINB 4AJWA 2N9XA 2LWPA 5C1ZA 1Q0WB 4WWOA 5CTRC 2O6VD 3C0RB 3H1UA 1E8ZA 2G4SA 2N1VA 3Q3JA 3ALBA 3UQBA 4II3B 3QARA 2KNBA 2KJ6A 2BKFA 3BY4B 4KSLC 2L8JA 2Y5BB 2K1FA 3JSVB 3LJ3A 4JL9A 3ZTDA 2BYEA 3A9JA 1WGDA 1X1MA 4GU2A 3VTWA 4JIOU 3IBEA 4WJOA 2J0KA 2CHWA 2DZKA 4M0WB 3B0AA 2L00B 4PYUA 5DCNA 4HPMB 4IWOA 2FAZA 3CMMB 2KX0A 1WJ4A 3M62B 2KWUB 2MCNB 1WXVA 1WY8A 1C1YB 1HE8A 3OLMD 4HK2A 4J6IA 3DVGX 1YIWA 2C7MB 5JHAA 2KJRA 2KLGA 1QZEA 4N9F4 2L3ZA 1LQBA 2KC2A 1EF1A 5CHWA 1MG8A 4A3OA 3IG3A 3WALA 2KOXA 2MBEA 4EZJA 2Z0EB 1P9DU 3PS6A 3SHQA 3T9LA 1Q1OA 3KYCD 2MWSB 2OOBB 2LRWA 2BKRB 3EECA 3QCAA 3NZSA 4I6PA 2L76A 2BYVE 2LJ5A 1YJ1A 4JGHB 2AEHA 2PPHA 1WM2A 4NY0A 3HM6X 1A5RA 1UBIA 5E6OA 4BBNF 1UBQA 1Z5SB 5L95C 1UELA 4W9KA 3X0WA 1V5OA 3NZUA 3O65B 4K81A 5D94A 4KDLB 3MTNB 3JVZX 1UD7A 4DK5A 2IY0B 1F9JA 2BF8B 4FHKA 4F8CB 1WE6A 2L0TA 4IWPA 3DPDA 1LFDA 4WWNA 2KN5A 3APDA 4W9JA 3ML8A 3KUZA 4W9EA 5AZHA 5TR5A 4XC2A 1PQSA 2KANA 3IHPC 2C60A 5AZFA 2G45B 1H8CA 2IY1B 3PRZA 3WAPA 2LD9A 4HDQA 3A9KB 3R3MA 4IC7B 4OVVA 4ICUA 2DZMA 4FJVB 1SIFA 2LVOA 4RMAA 1S1QB 3H7SA 2J7QB 1K8RB 2A4ZA 3APCA 3L0WB 3L54A 4DBGA 3PRMB 3TIXA 2PJHA 2C5LC 2DZIA 3CSFA 4AJYB 4KV2A 4KIKA 1EF5A 1WI0A 4WQOB 1ZKHA 2MP2B 1ZGUB 2M8SA 4K1RB 4PS7A 4DHJB 3L16A 3V62A 5FR6A 4PS8A 2LGXA 3DBLI 3VUWA 3TMPB 4AWJA 2KTRB 3W1SC 4URKA 4PYZA 1V49A 1SGHA 5GMVA 2K6DB 4EEWA 2RD0A 2KDIA 1E7UA 3DVNU 4GDKB 4KZ0A 3UIOB 4M8NA 4NJ7A 5KHOA 1V80A 2D07B 2RPQA 3DVNV 2LUEA 4X57B 2BGFA 3W1YA 3WAOA 2LRUA 1JRUA 1T0YA 2LVQA 3PVLA 3SDLC 2OJRA 4B6WA 4CHKA 3OAWA 2NCNA 1E8XA 2CR5A 3L10B 1WXSA 3JW0X 1WYWB 2FUHB 2VRRB 4F1SA 4BVUC 4EZLA 1P0RA 4WWPA 4BBNC 1GG3A 2GOWA 3QK0A 5DPSA 2C7NB 3HK0A 2HTHA 4MGKE 3QAQA 3A1QA 4G0NB 3L13A 2V4LA 4NQLB 2NPTB 4ANWA 4FJZA 1OGWA 3WA0A 4GSWA 4HJKA 2DHZA 3DVGY 4ANVA 3M95A 3UIPB 4BOZB 1E90A 4EFOA 1LXDA 1WH3A 3CF6E 2N4FA 2KTFA 3QIJA 5J18A 3APFA 3RUIB 4E71A 5DPTA 3A4RA 2EMTA 2LGDA 3RD2A 2C9WB 3JYUA 2ZVNA 4ZRIA 1U4AA 4A20A 4IM0A 2EKEC 2R2OA 2JRIB 2O6VB 2HD5B 4BOSC 1WGRA 3B08A 4ICVA 2I1KA 1J0GA 3ZRFA 4GB9A 4ANXA 3EFUA 4ANUA 4FA6A 2RR9A 5CHVC 4DHZE 4G11A 3ZNGC 1KJTA 2Z59B 4HWIB 2GBJA 4XZ4A 1WGGA 2WX1A 1RAXA 2IO2B 3ENEA 2KK8A 5C23A 2N7DA 4I6LB 5LXHA 3PRPB 3NY5A 1WJUA 1WX8A 2MBHA 2O2VB 3ZVVA 4DHZB 3AU4A 2MLBA 2KVRA 4B9KA 3OJ3A 2LZ6A 4NAWB 3M63B 3QX1A 2W9NA 3R7QA 2KFJA 4HCPB 3ZKJC 2DAFA 5J2RA 3WAMA 2GBMA 2LI5A 1VD2A 4AUQC 2I1JA 4BFRA 3T8MA 1VCBA 2ZNVC 3MHSD 4II2B 3KYDD 3NOBA 4FLHA 4GMVA 4ZYNA 2N9PC 2D3GA 4MJSA 1E8YA 1H4RA 1RFAA 2XBBC 3AULA 5EDSA 2ZNVB 3U30A 3KUDB 4GDLB 1NI2A 4KDIC 2K6QA 1WGHA 3A9JB 4JLCA 1XQQA 3V60A 2ZJDA 4GIVA 2JPHA 2M4NA 2MBQA 2GBRA 5G55A 1XT9B 2JT4B 2YVCA 4RM9A 2LGYA 5E6PA 1GUAB 1RRBA 2QHOA 2XEWA 3EHVA 3SU8X 2ZPYA 1ZW7A 4GDKA 5KHQA 3K9OB 4NNJB 1YQBA 2FIFA 2K39A 1XD3B 2K8CA 2KC1A 4IG7B 4K7SA 2XK5A 4YL8A 2KLCA 4RM8A 4FBJB 2JWZA 3ZIMA 3M3JA 2AL6A 1WMHA 1NBFC 5AZGA 1KOTA 2G4DB 4MGIE 2LVPA 3OJ4B 2GMIC 1J8CA 2MX2A 3ML9A 3H7PA 3X23A 4TV3A 3S2AA 3TJPA 4IW0A 4IUMB 4LDTD 4IM3A 3K9PB 3ZDMC 4TKNA 4BKTA 5JHBA 3PV1A 3V6CB 3KUCB 2ZPNA 2DENB 3PLVA 4ZRJA 1WFYA 1WJNA 2D10A 1UH6A 2G3QB 4W9DA 4DDID 3WANA 2AWTA 2DAJA 2N9EB 3UF8A 4B95A 4DHJD 1WRDB 2JF5A 4GGQA 1V6EA 2CKHB 3ZRCA 2ZCBA 3ZDTA 1Y8RC 2AL3A 2LXCA 5G2NA 3Q3FA 1Q5WB 3ZNID 1WX7A 3ZW3A 4BKGA 1OTRB 2KHWB 3N32A 4DXAB 4W9IA 5DPWA 3H9DA 4I6NB 2DX5B 4LJOB 3JSVA 2NBVB 4FADA 4HVBA 1WXAA 2BWES 3RULA 4BKSA 1FXTB 2FCSA 4MEMA 3TBLD 1ISNA 2DYBA 2KXJA 2K8BA 2YLMA 2IYDB 2KKCA 3PHWB 3ZUNA 1TTNA 2L0FA 3HHMA 4IWQA 2ZZPB 3LDZE 3U8ZA 2NS5A 5DPRA 3PZDA 2KQ7A 5L83A 1LM8B 3ONSA 4HDOA 4GXBA 2KD0A 4P7IA 1EUVB 3VUYA 2J0JA 2C7HA 3U7DA 2O2VA 4E3CA 4W9HA 3AI5A 3VAWA 1V9JA 2KDEB 2KFKB 1GJZA 1WZ3A 3P2BA 3A33B 4KSKC 3PREA 2UWQA 3QHTA 3SD5A 1WXMA 4ZDVA 2WX0A 3PGEA 3V61A 4PS3A 1WJ6A 4MGYE 3QA8A 3RCZA 3DBSA 4WJQA 1G6JA 2V3SA 1YX5B 4WAAA 2KO3A 1S3SG 5E6NA 2UYZB 4MGZE 2IBIB 4TQ1A 4LCDE 1D3ZA 3H6NA 2K8HA 2PE9A 3VTUA 4BKSD 2N1WA 3VTVA 2L05A 4KVGB 4K7UA 1WGYA 3RT3B 1GC6A 2AYOB 2JVCA 1V86A 1E7VA 3NS8A 2HE7A 4GDLA 1EO6A 2MRPA 4CYEA 3PSEB 2CU1A 2KMCA 3QC8B 3IVFA 1TGZB 4NJ6A 2JXXA 3A1QB 1IPGA 2PE6B 4K7WA 3ZO5B 1UGMA 1OEYJ 2GBNA 2BYFA 1P1AA 2KQSA 3QWZB 3UGBB 2HJ8A 4AP4C 2KWVB 3UQAA 2M17A 3GZNI 3A9KA 3HIZA 2JZZA 2MW5A 2IO1B 4FULA 3DOWA 2EMSA 1E5WA 1IP9A 4MSQB 2NR2A 4FHJA 3HM3A 3I3TB 1OEYA 2FIDA 3KW5B 2WWZA 1WR1A 4KZCA 1WR6E 4MELA 4JQWC 1NDDA 4NPNA 2MP2A 5CX3A 2MA9B 2Z0DB 4CO7A 2FCQA 4HCNB 2FCNA 3AU5A 1V81A 3PPAA 5JZEB 1AARA 4XX5A 1M94A 4TUUA 2A5UA 2KTRA 4WJNA 4WJPA 5D7GA 3L17A 3PT2B 3PLUA 1CMXB 1SE9A 3V6EB 1I42A 2KDBA 1C3TA 1WIAA 4GOCA 4HPLB 3TL5A 2M1MA 3ZNZB 5HKHA 2B3AA 3KH0A 3R7RA 3VXWA 3W1SA 3NHEB 3R66C 2IZVB 4FN2A 3ZNHB 4EKUA 4EOYA 5AEKB 4GN1A 2MBBB 1L2NA 3VH3B 2CHXA 3VH4B 1WZ0A 2FCMA 3DDCB 5IA7A 1TBEA 2JUOA 4MM3A 5J17A 1WF9A 5JH5C 4EZKA 1WM3A 2IO3B 1GC7A 2KDFB 4HXDA 2D11A 1R4NI 2WDTB 2KZRA 2DYMA 4TQ0A 2ZEQA 3BINA 4DWFA 4LDTB 4MJSB 1KM7A 2BWFA 1L7YA 4G50A 2NPTA 2CS4A 4MSMB 2R2QA 4OVUA 4W9GA 2KMAA 5IAAC 2RGFA 1UZXB 3RZFA 2WYQA 3ZTCA 3PHXB 4MDKE 2MQJA 1IYFA 2KX3A 2REXA 4M8MA 3PTFC 3VFKA 3D32A 4DDGD 1WE7A 3DQVA 3ECIA 3IFWB 4NQKE 3TCAA 4G3XB 2KFKA 5LLIA 2JRHA 2DYOA 2L7RA 1TZ1A 3RYTA 3VDZA 1J19A 1Z2MA 2ASQA 2KWCA 2LXAA 2V1YA 3ZLZA 4ASWC 1BT0A 1P98A 1R4MI 5BO4B 2JZ3B 2NVUI 2CHZA 2KJHB 2O6VA 3N3KB 3WIMA 3DBRI 2DZJA 2D2QA 3EC8A 1I35A 3AXCA 1E8WA 2NBUA 3DBHI 4IM2A 3VQIA 2IO0B 3B1LX 2MBOA 4W9LA 5LXIB 2J0MA 2PEAA 2XK5B 5CHFA 1KLVA 2RSUA 4F7ZA 2LASA 3CSTA
chains in the Genus database with same CATH superfamily
1AYFA 2BVCA 1YN4A 4MH0E 1T0SC 2M0XA 3GOEA 4ZRPA 2XNAC 3QQ8B 3N30A 2WXKA 4W9FA 3AE1B 4A3PA 2D3BA 4AOFA 1OQYA 1L5PA 1GNUA 2UU7A 3FKYA 1I4HA 4AJWA 3W5VB 2N9XA 4A8XC 1Q0WB 2TSSA 3H1UA 1YJIA 3QARA 2J4XA 3BY4B 3JSVB 4GU2A 4KX6B 3IBEA 2CHWA 3Q3NC 3B0AA 2W54A 2L00B 4HPMB 2FBWB 3Q8EA 1WJ4A 4US8A 2KWUB 1C1YB 3R2IA 4J6IA 1YIWA 5JHAA 2L3ZA 1EF1A 1I4XA 2D5GA 2MBEA 4ITKA 2J53A 1CZPA 3TEWA 3SHQA 4PT5A 4I6PA 2LJ5A 1FD6A 2AEHA 1WM2A 3HM6X 1UBIA 5E6OA 4TSSA 1EWYC 2CU3A 3I9V1 3NVZA 1J7AA 4K81A 4KDLB 4NZLB 1UD7A 4F8CB 1MFWA 1D5XC 4W9EA 1F1HA 5AZHA 5TR5A 2V9HA 1AN8A 3IHPC 2C60A 4N6EB 1H8CA 4ARIA 1C9FA 3PRZA 3WAPA 3DWMA 4HDQA 4OVVA 3AE6B 4ICUA 2KDMA 2OEDA 4RMAA 3H7SA 2J7QB 3APCA 4S17A 2C5LC 3NG0A 2DZIA 4IDIA 1EF5A 3RFZB 4WQOB 1RFKA 3L16A 5FR6A 4PS8A 2LGXA 2QJLA 3WCQA 3TMPB 1STEA 3GE3C 4GDKB 3MC0B 3UIOB 2HJ1A 1PGXA 4NJ7A 5D3DA 1I4RA 5BMIA 1V80A 3DVNV 4HKZE 1IUEA 1QOAA 3E56A 3SDLC 1DGJA 4B6WA 4GLSC 2NCNA 2CR5A 4C4VB 3JW0X 3SFEB 3QAQA 1IBXB 4G0NB 3L13A 3I57A 2G9HD 1E6EB 3BVGA 4AS1A 2WXQA 1L6VA 1L4ZB 1SE4A 2DHZA 1XLNA 4ANVA 3UIPB 3ZYYX 3CF6E 5T8IA 3L4PA 4DXGA 2IGDA 1U4AA 2R2OA 2JRIB 2HD5B 1T5XD 4BOSC 3RNAC 4ICVA 2LGIA 1L0VB 4IOIE 2RR9A 4FA6A 4DHZE 3ZNGC 4XZ4A 2KK8A 5LXHA 1WX8A 2MBHA 2MLBA 4RGNA 5H92C 1F52A 3R7QA 2KFJA 1XLOA 1ZPSA 3I63C 3TUOA 2GBMA 1XCTL 2LI5A 3FILB 3FAHA 1VD2A 1YQ3B 4BFRA 2ZNVC 2MJDA 4FLHA 5C3JB 2N9PC 1UNSA 3P4PB 3VR8B 4KKIA 3A9JB 4JLCA 3V60A 2ZJDA 1GUAB 3SU8X 1JWMD 2ZPYA 5KHQA 2FIFA 1XD3B 2WXFA 2K8CA 1E7PB 2XK5A 2KLCA 4FBJB 2JWZA 3M3JA 3OG5A 4MGIE 3U2SC 2LVPA 4ACFA 1PGAA 1J8CA 3ML9A 1TKGA 4TV3A 4IW0A 4IUMB 3K9PB 1DOIA 4JE3B 3KUCB 2ZPNA 2D3CA 4ZRJA 1FFVA 1QLBB 3Q69A 1WWTA 3SEBA 4L2YA 2CKHB 2K3UA 3ZRCA 1Y8RC 5D3IB 5BYQA 2WHIA 1KFYB 1WX7A 1R4MB 4DXAB 1YNTE 1HXYD 3H9DA 1D4BA 2DX5B 2K22A 4MM3B 3JSVA 3RULA 3TBLD 1RWSA 2YLMA 2K8BA 2KKCA 1TTNA 2L0FA 1MG4A 3LDZE 2LUMA 1D5MC 2KD0A 1FMAD 2J0JA 4NAMA 3U7DA 4W9HA 2W3SA 2KDEB 4WH4A 4DXFA 2WX0A 1MHHE 1YQ4B 1HTQA 1BUIC 1NI3A 3DBSA 4WJQA 3AEFB 1S3SG 2X38A 5E6NA 2UYZB 4MGZE 2IBIB 3P63A 4LCDE 1D3ZA 3AH7A 1FCLA 1V1PB 4USAA 4OZCA 3PSEB 3FC4A 3Q3MC 1J7BA 1TGZB 5C2TB 3A1QB 2LHDA 1OEYJ 4HKQA 4JWUC 3QWZB 4AP4C 1QOBA 2KWVB 2V0GA 2JZZA 1IP9A 4FHJA 3HM3A 3AN1A 1OEYA 2FIDA 3MFGA 4WWMA 3HVDA 2INCC 2MA9B 3KQ4A 2FCQA 3PPAA 2IJ0A 1V81A 1QF6A 3PLUA 3TEXA 3V6EB 2KDBA 1SE2A 3TL5A 2M1MA 5HKHA 4EOYA 4YTMB 5GXGB 1VRAB 1L2NA 3ETRA 2FCMA 1WF9A 5JH5C 2CJNA 2IO3B 1GC7A 1MHXA 4HRSA 2ZEQA 1IBXA 2GB1A 4MJSB 1KM7A 4OVUA 1L7YA 1GJZA 2CS4A 2KMAA 3ZTCA 3RZFA 3Q8CA 3AM9A 2MQJA 2INDC 3AE5B 4NQKE 3C19A 1Z2MA 4ASWC 1BT0A 1R4MI 3ZJUA 3EC8A 1KTKA 2NBUA 3DBHI 3VQIA 4W9LA 1PFDA 2WXNA 2ZW1A 2RSUA 3CSTA 3L08A 4LJPB 3VVWB 2EELA 1K51A 4RCOA 4IKGA 4FJYA 1V2YA 3EFCA 4WURA 2ZCCA 1WX9A 4W9CA 1V5TA 3RI7C 4HLEA 3FILA 2GBKA 1FNWA 4P6VF 3UINB 5C1ZA 2LWPA 2Y5PA 5CTRC 3TEYA 1WXQA 1E8ZA 3UQBA 3RNCC 2KJ6A 2IPKD 1YMHE 2BKFA 2KN4A 4KSLC 2L8JA 2K1FA 2W82A 3NRZA 3A9JA 3R8BA 4JIOU 4PYUA 4M01A 2V4IB 4M00A 1HE8A 4HJGE 1WGKA 2G1EA 2GI9A 1P7EA 4YSZB 2B76B 2E6XA 1QZEA 2KC2A 3CIRB 5BMGA 1SJHD 3IG3A 3WALA 4EZJA 1P9DU 1EWCA 2GRIA 3T9LA 2QIEB 2BKRB 4L23A 1YJ1A 2BS3B 4A6QA 1A5RA 1YN3A 5L95C 1UELA 3NZUA 1F2RC 3MTNB 3JVZX 2QSDA 1TYGB 1Q10A 3DPDA 3B2GA 4MACA 4WWNA 1L6UA 4W9JA 4XE0A 3ML8A 5BMHA 1QOFA 3KUZA 4P1CC 1PQSA 2HTME 2ON8A 5AZFA 2G45B 1KRHA 1I4GA 4NJCA 3R3MA 5E6JA 4XDCA 1S1QB 3L0WB 3L54A 3LB8C 3PRMB 3TIXA 1UF0A 3P1MA 1C4PA 2LJIA 3P4RB 4KIKA 1ZKHA 1GOZA 2WNMA 3B2FA 3VUWA 3GE8C 1IGDA 4AWJA 1Y56A 4PYZA 4N58A 4KGSA 2GLSA 4EEWA 2RD0A 3DVNU 3W9CB 3AB5A 5KHOA 2RPQA 1EM7A 2RDBC 4X57B 2LRUA 1V1PA 1XF5L 2LVQA 3PVLA 1FFUA 3OAWA 4H2AA 5BYSA 2FUHB 4KGTA 4XYCA 4BVUC 4WWPA 4A90A 1GG3A 1K53A 1HZ5A 3A1QA 4M0WA 1BXTA 1FRDA 2V4LA 4FJZA 3WA0A 4GSWA 4C00A 1E90A 4P16A 3U7ZA 2K0PA 2N4FA 3QIJA 5J18A 4WIPA 5DPTA 1AW7A 2EMTA 1PUTA 2LGDA 5BYRA 1GAQB 3I5JC 1WGRA 1J0GA 2RDGA 3ZRFA 4ANXA 3EFUA 2WP9B 5I4DA 4G11A 1KJTA 2Z59B 4HWIB 3Q14C 1WGGA 2BB6A 1RAXA 2IO2B 2WX1A 3ENEA 5C23A 4YTPB 2ZW0A 2KVRA 3ZXVA 4YSXB 3OJ3A 4NAWB 2PLPA 3M63B 3ZKJC 4A9AA 3N1ZC 1XLPA 1KF6B 1D5ZC 3WAMA 3AE4B 1QKZA 3T8MA 1VCBA 3AE9B 3NOBA 1NENB 4ZYNA 2I2YA 4MJSA 5EDSA 1E8YA 2XBBC 3AULA 1FM0D 2ZNVB 1NI2A 4O1NA 1WGHA 4US9A 4GIVA 2MBQA 1XT9B 2FE8A 2QHOA 3BZDB 1ZW7A 1SF0A 2Y5CA 2KQ4X 1YQBA 2JWUA 5AUIA 3ZIMA 5AZGA 3URYA 1TS5A 5LNK1 3RMKC 1N60A 1DOYA 3S2AA 4LDTD 4IM3A 2NMQA 3ZDMC 4TKNA 1WSPA 4KGRA 2LHEA 3V3XA 2D10A 2G3QB 1F0ZA 4DDID 4B95A 4BAXA 4DHJD 2JF5A 4GGQA 2ZCBA 3DHHC 4C7ZA 2LXCA 1Q5WB 1QT9A 1TZOA 4BKGA 1CQVA 1ZDVA 2KHWB 3N32A 4W9IA 4QAYA 4I6NB 4LJOB 1OFFA 2BWES 3RNFC 1FXTB 1ISNA 3PHWB 2LFIA 2ZZPB 3U8ZA 1JWSD 1SB3C 1N5XA 2NS5A 5DPRA 3PZDA 2KQ7A 3T3NA 4P7IA 4A55A 2WXGA 2O2VA 3VRAB 3AE7B 4LNOA 1WZ3A 1OQRA 1WXMA 1N61A 3GP7A 1WJ6A 2VZKD 4MGYE 3UI3A 1C79A 2V3SA 4WAAA 2KO3A 4RGTA 4TQ1A 1ZXIA 2JSVX 2WU5B 1PGBA 4KKJA 4BKSD 2N1WA 2L05A 2BT6A 1GC6A 2N0SB 4N59A 3NS8A 4GDLA 1EO6A 2MRPA 2RPVA 1QILA 3IVFA 4NJ6A 4TMAB 1UGMA 1YN5A 3VRBB 2BYFA 2HJ8A 2MW5A 2IO1B 4FULA 3DOWA 3KWVA 4K3CA 2NR2A 2V3NA 3KW5B 3Q8BA 2WXOA 1NDDA 1TY2A 2WXHA 5CX3A 2Z0DB 1AARA 4XX5A 3RNBC 2L32A 3L17A 4RF1A 2IDYA 3AV8A 1SE9A 4AQ7A 1WIAA 1D6EC 4GOCA 4HPLB 4MH8A 1XEEA 3VXWA 5AUKA 2DBYA 3R66C 3ZNHB 5AEKB 1PYWD 2CHXA 3VH4B 1WZ0A 3DDCB 1ZDXA 5H8YE 5IA7A 1N6ZA 3DHIC 1WM3A 2IGHA 2KDFB 4HXDA 2D11A 2PW9A 4DWFA 4LDTB 4MSMB 2RGFA 1UZXB 1IYFA 4RNAA 1ZE3D 3DBLB 3ECIA 1MJDA 3TCAA 2DYOA 2W55A 3U4EG 3RYTA 2LXAA 3RN9C 3W2DA 3ZLZA 5BO4B 3DBHB 3N3KB 3IXSA 1FCCC 3AE3B 3K9OB 3C8YA 2QILA 2N7EA 4YXDB 3RZWC 5D2MB 4KIKB 1ENFA 4HROA 1TIFA 3H7PB 3QJZA 3NJTA 1EU4A 2V3PA 4NAWA 4REZA 2FNJB 2NBWB 3GB1A 2K25A 2JY6A 4RF0A 2MSED 1SEBD 1RLFA 1P3QU 2VZKB 2LMCA 4WWOA 2O6VD 3C0RB 2G4SA 3MP9A 2N1VA 3ALBA 1F77A 2DLBA 1V1OA 2KNBA 1ZP0B 2Y5BB 3ZTDA 2BYEA 1TS2A 4LTUA 1WGDA 1X1MA 3VTWA 1T0RC 3NVWA 4WJOA 2J0KA 4ZYSA 2H88B 4M0WB 5DCNA 4IWOA 2FAZA 2KX0A 1WXVA 1WY8A 2C7MB 4LNKA 2KJRA 2KLGA 4N9F4 5CHWA 1MG8A 2Z0EB 1Q1OA 2WDQB 3KYCD 2MWSB 1JMLA 3NZSA 2L76A 5TSSA 4NY0A 4WQMA 1UBQA 3DHGC 3X0WA 1V5OA 1KH0A 2AQ1B 1HTOA 3ZQ4A 4FHKA 2L0TA 1LFDA 2KN5A 3IAS1 3O13A 4XC2A 1C77A 2KANA 2IY1B 2LD9A 3A9KB 4IC7B 1SIFA 1K8RB 3N1XC 2PJHA 4Q2JA 3CSFA 4AJYB 4KV2A 2EKIA 2MP2B 1ZGUB 2WLBA 2M8SA 4PS7A 3DBLI 2WXJA 3W1SC 1XXGA 2WXPA 5GMVA 4YT0B 1AWDA 2KDIA 1E7UA 2KAJA 4D2KA 2WDRB 2D07B 3WAOA 1JRUA 1JALA 1N62A 1FXIA 1E10A 3LXFA 1XCQL 2WGSA 2PVOD 1WXSA 1WYWB 3BVZA 1L4DB 4EZLA 2GOWA 3QK0A 5DPSA 2C7NB 2ONQA 1FXAA 2JU6X 1JCKB 3R2TA 2NPTB 4ANWA 4HJKA 3DVGY 1LXDA 1WH3A 1T0QC 3APFA 3N1YC 4E71A 2JYEA 3A4RA 3E9SA 4A20A 4IM0A 2EKEC 4DQOC 4ARCA 2O6VB 1KLGD 1SSNA 4OVZA 4GB9A 5IKCM 1OQQA 1I4QA 2GBJA 3AECB 1QQRA 3PRPB 1WJUA 2O2VB 1B9RA 3BVMA 3U52E 2JYTA 3QX1A 3PZ7A 4HCPB 2DAFA 4CQNA 3AEBB 4OW0A 1E9MA 4AUQC 2AQ3B 1DYQA 2BBCA 2J52A 3KYDD 1LO5D 1H4RA 1RFAA 2YEPB 1TT5B 3U30A 1L0YB 2BTEA 4K3BA 3KUDB 4GDLB 2PVGC 4RGOS 1QOGA 1XQQA 2M4NA 2GBRA 5G55A 2JT4B 3AMZA 4XDDA 2YVCA 1F2RI 2ACZB 2LGYA 3BK1A 2XEWA 4B0EA 3BK2A 2JXTA 3CWIA 4ZHPA 3ZJTA 4LNIA 3MHZA 3RPFC 1KOTA 1NBFC 2G4DB 2GMIC 2MX2A 3H7PA 4YSYB 3X23A 3TJPA 2PIAA 5G5HA 5JHBA 2X8XX 3PV1A 3V6CB 3AEDB 2DENB 4WAFA 3PLVA 1BMLC 1WFYA 1WJNA 5EE0A 3EGRA 3NVYA 2AWTA 2DAJA 4ZHOA 2QMTA 1V6EA 5G5GA 2AL3A 2YEPF 1XLQA 3Q3FA 1KLUD 3EA6A 4XWWA 1V8CA 3ZNID 5HFYA 2L1AA 2WQYB 3AEAB 2J42A 2NBVB 1VR9A 5JXVA 4BKSA 1K50A 3ZUNA 5FR3A 2INPE 1TKEA 1TS4A 1LM8B 3BYTB 3ONSA 4GXBA 2KVZA 5L83A 1GB1A 2OHFA 1EUVB 3VUYA 2C7HA 4E3CA 3LYYA 1ROEA 1YOVB 1V9JA 3GS2A 1NEKB 1VDVA 4KSKC 2UWQA 3QHTA 2OJWA 3PGEA 1EU3A 3MC9A 3ZXRA 3EUB2 1UGJA 2VH1A 2Z8LA 1FRRA 2WS3B 3H6NA 2K8HA 3VTVA 4KVGB 4K7UA 3RT3B 1SIJA 2JVCA 1E7VA 1YJJA 2K5PA 4CYEA 3QC8B 2DNFA 1ZXHA 3MC8A 2JXXA 1K52A 4K7WA 2GBNA 2M19A 3UGBB 1FIQA 1NYQA 5EE3A 1B1ZA 2M17A 3A9KA 3HIZA 1E5WA 4JWSC 4RH6A 1WR1A 2MP2A 4UDUC 1VZ8A 4CO7A 4HCNB 3AU5A 3HRDD 1T3QA 3IAM1 4TUUA 2A5UA 3PT2B 3Q8FA 5HG2A 1FEHA 1I42A 5EE9A 5HHDG 4YWGG 4EKUA 4GN1A 2MBBB 2VH2A 2M0AA 4EZKA 1ET9A 5IP4D 4TQ0A 3BINA 3SR6A 1JWUD 1CK1A 4G50A 2NPTA 2L52A 5IAAC 3AEGB 2WYQA 3PHXB 3IT6B 2KX3A 2REXA 4M8MA 1GB4A 1JRPA 4DDGD 4RFBA 1WE7A 3IFWB 4G3XB 2KFKA 5LLIA 2L7RA 4M02A 1TZ1A 4RGMA 1J19A 2KMMA 1P98A 2NVUI 2O6VA 2DZJA 2D2QA 1VLBA 1I35A 3AXCA 1E8WA 4IM2A 1FPYA 2IO0B 1XO3A 2XN9C 4BZAA 2J0MA 2QCZA 2MJEA 5LXIB 4F7ZA 2MHJA 1WMHB 4HEA1 4EUTA 3DCGA 3MJWA 2JX5A 2QEJC 2E3TA 4E74A 4ZRKA 3VUXA 1JQ4A 2WXIA 2ZVOA 4LK0M 3VHTC 4OHJA 1YX6B 2BPSA 1YD8U 2PKOA 1HA5A 3KVFB 1M4VA 3A4SC 5D6JB 3TEZA 2AX5A 3TSSA 3Q3JA 4II3B 4JL9A 3ZJVA 3LJ3A 2HDEA 3Q6BA 2DZKA 2KWDA 3AE2B 3CMMB 3M62B 1E0ZA 2MCNB 3OLMD 4HK2A 4JX1C 3DVGX 3ZGZA 1LQBA 4A3OA 5MPOA 2CJOA 1V97A 2KOXA 3PS6A 2LGSA 3HUIA 3KLSX 2OOBB 2LRWA 3EECA 3QCAA 4MT5A 3NUHB 2BYVE 4JGHB 2PPHA 2BQQA 1C78A 4BBNF 1Z5SB 4W9KA 3O65B 5D94A 4DK5A 2IY0B 1F9JA 2BF8B 1WE6A 4IWPA 4XGAB 3APDA 1VZ6A 3J9CA 3NZ3A 4L1BA 2FUG1 1I4PA 1IGCA 3KWLA 2DZMA 4FJVB 2LVOA 4DBGA 2A4ZA 4JPSA 3PZ8A 1WI0A 4ZRQA 1TS3A 4K1RB 4DHJB 3V62A 2KTRB 4URKA 1V49A 1SGHA 2NTSA 2K6DB 4KZ0A 1WRIA 4M8NA 1WYGA 2LUEA 2BGFA 3W1YA 4YTNB 3BWUD 1T0YA 4OZBA 1HEZE 1TJEA 2WXMA 2W3RA 2BYTA 2OJRA 4CHKA 3P4QB 1E8XA 3L10B 1JWAD 2VRRB 4LNFA 4F1SA 4J3OD 1P0RA 4BBNC 3HK0A 1GPXA 2HTHA 3OWEB 4MGKE 2AQ2B 1T6BX 2SEBD 4NQLB 1OGWA 3M95A 4BOZB 4EFOA 2MJ3A 2KTFA 1FNUA 3RUIB 2QDFA 3RD2A 2C9WB 3JYUA 2ZVNA 4ZRIA 1ESFA 3NS1A 2WXLA 1NVID 2BW2A 3B08A 1VZ7A 3Q8AA 2I1KA 4ANUA 2BB5A 5CHVC 4LLGM 4FXCA 2N7DA 4I6LB 2LEKA 3NY5A 3ZVVA 3VR9B 4DHZB 3AU4A 4B9KA 2NTTA 5IN7A 2LZ6A 3RNEC 2W9NA 1C4AA 2RMMA 3Q2AC 2N7JA 5J2RA 2PMVA 2I1JA 3RNGC 1RYJA 3GZNB 2BS2B 2KT7A 3MHSD 2N9LA 3HVZA 4II2B 4GMVA 1ET6A 1R7SA 3N9YC 2D3GA 1NYRA 1MI0A 4KDIC 2K6QA 2I38A 2JPHA 2PTLA 1JWBD 2IGGA 4RM9A 2MEKA 5E6PA 1RRBA 3EHVA 4GDKA 2KYWA 1TY0A 4NNJB 1UUPA 2K39A 1ZUD2 2KC1A 4IG7B 4K7SA 4YL8A 4RM8A 3Q3OC 2AL6A 1WMHA 3OJ4B 2R61A 1SXTA 4C4VA 1SE3A 1R4NB 4BKTA 3B9JA 3NVVA 3IT4B 1HQRD 3ABVB 1UH6A 4W9DA 3WANA 2WXRA 3UF8A 1WRDB 2INNE 3ZDTA 5G2NA 4R3DA 5EE1A 1TKYA 5FKAC 1CJEA 3ZW3A 1OTRB 4LNNA 1J7CA 5DPWA 2WDVB 3DBRB 2K9XA 1PDXA 4FADA 4HVBA 1WXAA 1L0XB 4XWTA 1A70A 2SAKA 2FCSA 4MEMA 1HZ6A 3N20C 2DYBA 2KXJA 2IYDB 3HHMA 4IWQA 3V05A 3BIID 4HDOA 2ICIA 1N63A 3AI5A 3VAWA 2KFKB 1VJKA 3PO0A 3P2BA 1FNVA 3A33B 3PREA 3SD5A 4ZDVA 2Y3AA 3V61A 4PS3A 3RCZA 3QA8A 1G6JA 1YX5B 4B0MA 2N9KA 1ZOYB 4C7YA 2JQRB 1JROA 2PE9A 1ACCA 2D3AA 3VTUA 2M56B 1WGYA 1I7HA 4P1BC 5HI1A 2AYOB 3T3OA 1V86A 2HE7A 1MPEA 1RM6C 2CU1A 2KMCA 4EE2A 4OZAA 1IPGA 2PE6B 3AEEB 1N5WA 3SFDB 3ZO5B 2H89B 1P1AA 2KQSA 3UQAA 3GZNI 4HPPA 2EMSA 4MSQB 3I3TB 2L83A 2JZPA 2WWZA 4KZCA 1WR6E 4MELA 4JQWC 4NPNA 4C56C 2FCNA 5JZEB 1M94A 1SJED 4WJNA 2KTRA 4WJPA 5D7GA 3AE8B 5IOIA 1SBBB 2LASA 2BS4B 3H8HA 1CMXB 1JW9D 1C3TA 3MJ5A 2WU2B 3ZNZB 2B3AA 3KH0A 3R7RA 3W1SA 3NHEB 2IZVB 4FN2A 1UWXA 3VH3B 1C76A 1TBEA 3BYYB 2JUOA 4MM3A 5J17A 2MH7A 1FO4A 1R4NI 2WDTB 2KZRA 2DYMA 4ZOHC 2BWFA 4W9GA 2R2QA 1DOXA 3W5UB 4S0RA 4MDKE 3DWGC 3PTFC 3VFKA 3D32A 3P42A 3DQVA 1C4CA 1MVKA 2KACA 2JRHA 1LGRA 3P4SB 3VDZA 2ASQA 2KWCA 1UWMA 1P7FA 2V1YA 5IO9A 2JZ3B 2CHZA 5FK9C 2KJHB 3WIMA 3DBRI 2Q5WD 3B1LX 2RDHA 2MBOA 2DWQA 2PEAA 4PK1A 2QC8A 2XK5B 5CHFA 1KLVA 4C80A 2N9EB
chains in the Genus database with same CATH topology
1WMHB 3L08A 2N7EA 4LJPB 3RZWC 5D2MB 4KIKB 3VVWB 4EUTA 3DCGA 4MH0E 3H7PB 3MJWA 2M0XA 3QJZA 3GOEA 4FJYA 4E74A 4ZRKA 1V2YA 3VUXA 4NAWA 3QQ8B 2ZCCA 2ZVOA 3N30A 1WX9A 3VHTC 4W9CA 1V5TA 2FNJB 2NBWB 4W9FA 1YX6B 2BPSA 4A3PA 1YD8U 4HLEA 3KVFB 4AOFA 1OQYA 2K25A 2JY6A 2MSED 3A4SC 1GNUA 2GBKA 5D6JB 1RLFA 1P3QU 3UINB 4AJWA 2N9XA 2LWPA 5C1ZA 1Q0WB 4WWOA 5CTRC 2O6VD 3C0RB 3H1UA 1E8ZA 2G4SA 2N1VA 3Q3JA 3ALBA 3UQBA 4II3B 3QARA 2KNBA 2KJ6A 2BKFA 3BY4B 4KSLC 2L8JA 2Y5BB 2K1FA 3JSVB 3LJ3A 4JL9A 3ZTDA 2BYEA 3A9JA 1WGDA 1X1MA 4GU2A 3VTWA 4JIOU 3IBEA 4WJOA 2J0KA 2CHWA 2DZKA 4M0WB 3B0AA 2L00B 4PYUA 5DCNA 4HPMB 4IWOA 2FAZA 3CMMB 2KX0A 1WJ4A 3M62B 2KWUB 2MCNB 1WXVA 1WY8A 1C1YB 1HE8A 3OLMD 4HK2A 4J6IA 3DVGX 1YIWA 2C7MB 5JHAA 2KJRA 2KLGA 1QZEA 4N9F4 2L3ZA 1LQBA 2KC2A 1EF1A 5CHWA 1MG8A 4A3OA 3IG3A 3WALA 2KOXA 2MBEA 4EZJA 2Z0EB 1P9DU 3PS6A 3SHQA 3T9LA 1Q1OA 3KYCD 2MWSB 2OOBB 2LRWA 2BKRB 3EECA 3QCAA 3NZSA 4I6PA 2L76A 2BYVE 2LJ5A 1YJ1A 4JGHB 2AEHA 2PPHA 1WM2A 4NY0A 3HM6X 1A5RA 1UBIA 5E6OA 4BBNF 1UBQA 1Z5SB 5L95C 1UELA 4W9KA 3X0WA 1V5OA 3NZUA 3O65B 4K81A 5D94A 4KDLB 3MTNB 3JVZX 1UD7A 4DK5A 2IY0B 1F9JA 2BF8B 4FHKA 4F8CB 1WE6A 2L0TA 4IWPA 3DPDA 1LFDA 4WWNA 2KN5A 3APDA 4W9JA 3ML8A 3KUZA 4W9EA 5AZHA 5TR5A 4XC2A 1PQSA 2KANA 3IHPC 2C60A 5AZFA 2G45B 1H8CA 2IY1B 3PRZA 3WAPA 2LD9A 4HDQA 3A9KB 3R3MA 4IC7B 4OVVA 4ICUA 2DZMA 4FJVB 1SIFA 2LVOA 4RMAA 1S1QB 3H7SA 2J7QB 1K8RB 2A4ZA 3APCA 3L0WB 3L54A 4DBGA 3PRMB 3TIXA 2PJHA 2C5LC 2DZIA 3CSFA 4AJYB 4KV2A 4KIKA 1EF5A 1WI0A 4WQOB 1ZKHA 2MP2B 1ZGUB 2M8SA 4K1RB 4PS7A 4DHJB 3L16A 3V62A 5FR6A 4PS8A 2LGXA 3DBLI 3VUWA 3TMPB 4AWJA 2KTRB 3W1SC 4URKA 4PYZA 1V49A 1SGHA 5GMVA 2K6DB 4EEWA 2RD0A 2KDIA 1E7UA 3DVNU 4GDKB 4KZ0A 3UIOB 4M8NA 4NJ7A 5KHOA 1V80A 2D07B 2RPQA 3DVNV 2LUEA 4X57B 2BGFA 3W1YA 3WAOA 2LRUA 1JRUA 1T0YA 2LVQA 3PVLA 3SDLC 2OJRA 4B6WA 4CHKA 3OAWA 2NCNA 1E8XA 2CR5A 3L10B 1WXSA 3JW0X 1WYWB 2FUHB 2VRRB 4F1SA 4BVUC 4EZLA 1P0RA 4WWPA 4BBNC 1GG3A 2GOWA 3QK0A 5DPSA 2C7NB 3HK0A 2HTHA 4MGKE 3QAQA 3A1QA 4G0NB 3L13A 2V4LA 4NQLB 2NPTB 4ANWA 4FJZA 1OGWA 3WA0A 4GSWA 4HJKA 2DHZA 3DVGY 4ANVA 3M95A 3UIPB 4BOZB 1E90A 4EFOA 1LXDA 1WH3A 3CF6E 2N4FA 2KTFA 3QIJA 5J18A 3APFA 3RUIB 4E71A 5DPTA 3A4RA 2EMTA 2LGDA 3RD2A 2C9WB 3JYUA 2ZVNA 4ZRIA 1U4AA 4A20A 4IM0A 2EKEC 2R2OA 2JRIB 2O6VB 2HD5B 4BOSC 1WGRA 3B08A 4ICVA 2I1KA 1J0GA 3ZRFA 4GB9A 4ANXA 3EFUA 4ANUA 4FA6A 2RR9A 5CHVC 4DHZE 4G11A 3ZNGC 1KJTA 2Z59B 4HWIB 2GBJA 4XZ4A 1WGGA 2WX1A 1RAXA 2IO2B 3ENEA 2KK8A 5C23A 2N7DA 4I6LB 5LXHA 3PRPB 3NY5A 1WJUA 1WX8A 2MBHA 2O2VB 3ZVVA 4DHZB 3AU4A 2MLBA 2KVRA 4B9KA 3OJ3A 2LZ6A 4NAWB 3M63B 3QX1A 2W9NA 3R7QA 2KFJA 4HCPB 3ZKJC 2DAFA 5J2RA 3WAMA 2GBMA 2LI5A 1VD2A 4AUQC 2I1JA 4BFRA 3T8MA 1VCBA 2ZNVC 3MHSD 4II2B 3KYDD 3NOBA 4FLHA 4GMVA 4ZYNA 2N9PC 2D3GA 4MJSA 1E8YA 1H4RA 1RFAA 2XBBC 3AULA 5EDSA 2ZNVB 3U30A 3KUDB 4GDLB 1NI2A 4KDIC 2K6QA 1WGHA 3A9JB 4JLCA 1XQQA 3V60A 2ZJDA 4GIVA 2JPHA 2M4NA 2MBQA 2GBRA 5G55A 1XT9B 2JT4B 2YVCA 4RM9A 2LGYA 5E6PA 1GUAB 1RRBA 2QHOA 2XEWA 3EHVA 3SU8X 2ZPYA 1ZW7A 4GDKA 5KHQA 3K9OB 4NNJB 1YQBA 2FIFA 2K39A 1XD3B 2K8CA 2KC1A 4IG7B 4K7SA 2XK5A 4YL8A 2KLCA 4RM8A 4FBJB 2JWZA 3ZIMA 3M3JA 2AL6A 1WMHA 1NBFC 5AZGA 1KOTA 2G4DB 4MGIE 2LVPA 3OJ4B 2GMIC 1J8CA 2MX2A 3ML9A 3H7PA 3X23A 4TV3A 3S2AA 3TJPA 4IW0A 4IUMB 4LDTD 4IM3A 3K9PB 3ZDMC 4TKNA 4BKTA 5JHBA 3PV1A 3V6CB 3KUCB 2ZPNA 2DENB 3PLVA 4ZRJA 1WFYA 1WJNA 2D10A 1UH6A 2G3QB 4W9DA 4DDID 3WANA 2AWTA 2DAJA 2N9EB 3UF8A 4B95A 4DHJD 1WRDB 2JF5A 4GGQA 1V6EA 2CKHB 3ZRCA 2ZCBA 3ZDTA 1Y8RC 2AL3A 2LXCA 5G2NA 3Q3FA 1Q5WB 3ZNID 1WX7A 3ZW3A 4BKGA 1OTRB 2KHWB 3N32A 4DXAB 4W9IA 5DPWA 3H9DA 4I6NB 2DX5B 4LJOB 3JSVA 2NBVB 4FADA 4HVBA 1WXAA 2BWES 3RULA 4BKSA 1FXTB 2FCSA 4MEMA 3TBLD 1ISNA 2DYBA 2KXJA 2K8BA 2YLMA 2IYDB 2KKCA 3PHWB 3ZUNA 1TTNA 2L0FA 3HHMA 4IWQA 2ZZPB 3LDZE 3U8ZA 2NS5A 5DPRA 3PZDA 2KQ7A 5L83A 1LM8B 3ONSA 4HDOA 4GXBA 2KD0A 4P7IA 1EUVB 3VUYA 2J0JA 2C7HA 3U7DA 2O2VA 4E3CA 4W9HA 3AI5A 3VAWA 1V9JA 2KDEB 2KFKB 1GJZA 1WZ3A 3P2BA 3A33B 4KSKC 3PREA 2UWQA 3QHTA 3SD5A 1WXMA 4ZDVA 2WX0A 3PGEA 3V61A 4PS3A 1WJ6A 4MGYE 3QA8A 3RCZA 3DBSA 4WJQA 1G6JA 2V3SA 1YX5B 4WAAA 2KO3A 1S3SG 5E6NA 2UYZB 4MGZE 2IBIB 4TQ1A 4LCDE 1D3ZA 3H6NA 2K8HA 2PE9A 3VTUA 4BKSD 2N1WA 3VTVA 2L05A 4KVGB 4K7UA 1WGYA 3RT3B 1GC6A 2AYOB 2JVCA 1V86A 1E7VA 3NS8A 2HE7A 4GDLA 1EO6A 2MRPA 4CYEA 3PSEB 2CU1A 2KMCA 3QC8B 3IVFA 1TGZB 4NJ6A 2JXXA 3A1QB 1IPGA 2PE6B 4K7WA 3ZO5B 1UGMA 1OEYJ 2GBNA 2BYFA 1P1AA 2KQSA 3QWZB 3UGBB 2HJ8A 4AP4C 2KWVB 3UQAA 2M17A 3GZNI 3A9KA 3HIZA 2JZZA 2MW5A 2IO1B 4FULA 3DOWA 2EMSA 1E5WA 1IP9A 4MSQB 2NR2A 4FHJA 3HM3A 3I3TB 1OEYA 2FIDA 3KW5B 2WWZA 1WR1A 4KZCA 1WR6E 4MELA 4JQWC 1NDDA 4NPNA 2MP2A 5CX3A 2MA9B 2Z0DB 4CO7A 2FCQA 4HCNB 2FCNA 3AU5A 1V81A 3PPAA 5JZEB 1AARA 4XX5A 1M94A 4TUUA 2A5UA 2KTRA 4WJNA 4WJPA 5D7GA 3L17A 3PT2B 3PLUA 1CMXB 1SE9A 3V6EB 1I42A 2KDBA 1C3TA 1WIAA 4GOCA 4HPLB 3TL5A 2M1MA 3ZNZB 5HKHA 2B3AA 3KH0A 3R7RA 3VXWA 3W1SA 3NHEB 3R66C 2IZVB 4FN2A 3ZNHB 4EKUA 4EOYA 5AEKB 4GN1A 2MBBB 1L2NA 3VH3B 2CHXA 3VH4B 1WZ0A 2FCMA 3DDCB 5IA7A 1TBEA 2JUOA 4MM3A 5J17A 1WF9A 5JH5C 4EZKA 1WM3A 2IO3B 1GC7A 2KDFB 4HXDA 2D11A 1R4NI 2WDTB 2KZRA 2DYMA 4TQ0A 2ZEQA 3BINA 4DWFA 4LDTB 4MJSB 1KM7A 2BWFA 1L7YA 4G50A 2NPTA 2CS4A 4MSMB 2R2QA 4OVUA 4W9GA 2KMAA 5IAAC 2RGFA 1UZXB 3RZFA 2WYQA 3ZTCA 3PHXB 4MDKE 2MQJA 1IYFA 2KX3A 2REXA 4M8MA 3PTFC 3VFKA 3D32A 4DDGD 1WE7A 3DQVA 3ECIA 3IFWB 4NQKE 3TCAA 4G3XB 2KFKA 5LLIA 2JRHA 2DYOA 2L7RA 1TZ1A 3RYTA 3VDZA 1J19A 1Z2MA 2ASQA 2KWCA 2LXAA 2V1YA 3ZLZA 4ASWC 1BT0A 1P98A 1R4MI 5BO4B 2JZ3B 2NVUI 2CHZA 2KJHB 2O6VA 3N3KB 3WIMA 3DBRI 2DZJA 2D2QA 3EC8A 1I35A 3AXCA 1E8WA 2NBUA 3DBHI 4IM2A 3VQIA 2IO0B 3B1LX 2MBOA 4W9LA 5LXIB 2J0MA 2PEAA 2XK5B 5CHFA 1KLVA 2RSUA 4F7ZA 2LASA 3CSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMH B;  3L08 A;  2N7E A;  4LJP B;  3RZW C;  5D2M B;  4KIK B;  3VVW B;  4EUT A;  3DCG A;  4MH0 E;  3H7P B;  3MJW A;  2M0X A;  3QJZ A;  3GOE A;  4FJY A;  4E74 A;  4ZRK A;  1V2Y A;  3VUX A;  4NAW A;  3QQ8 B;  2ZCC A;  2ZVO A;  3N30 A;  1WX9 A;  3VHT C;  4W9C A;  1V5T A;  2FNJ B;  2NBW B;  4W9F A;  1YX6 B;  2BPS A;  4A3P A;  1YD8 U;  4HLE A;  3KVF B;  4AOF A;  1OQY A;  2K25 A;  2JY6 A;  2MSE D;  3A4S C;  1GNU A;  2GBK A;  5D6J B;  1RLF A;  1P3Q U;  3UIN B;  4AJW A;  2N9X A;  2LWP A;  5C1Z A;  1Q0W B;  4WWO A;  5CTR C;  2O6V D;  3C0R B;  3H1U A;  1E8Z A;  2G4S A;  2N1V A;  3Q3J A;  3ALB A;  3UQB A;  4II3 B;  3QAR A;  2KNB A;  2KJ6 A;  2BKF A;  3BY4 B;  4KSL C;  2L8J A;  2Y5B B;  2K1F A;  3JSV B;  3LJ3 A;  4JL9 A;  3ZTD A;  2BYE A;  3A9J A;  1WGD A;  1X1M A;  4GU2 A;  3VTW A;  4JIO U;  3IBE A;  4WJO A;  2J0K A;  2CHW A;  2DZK A;  4M0W B;  3B0A A;  2L00 B;  4PYU A;  5DCN A;  4HPM B;  4IWO A;  2FAZ A;  3CMM B;  2KX0 A;  1WJ4 A;  3M62 B;  2KWU B;  2MCN B;  1WXV A;  1WY8 A;  1C1Y B;  1HE8 A;  3OLM D;  4HK2 A;  4J6I A;  3DVG X;  1YIW A;  2C7M B;  5JHA A;  2KJR A;  2KLG A;  1QZE A;  4N9F 4;  2L3Z A;  1LQB A;  2KC2 A;  1EF1 A;  5CHW A;  1MG8 A;  4A3O A;  3IG3 A;  3WAL A;  2KOX A;  2MBE A;  4EZJ A;  2Z0E B;  1P9D U;  3PS6 A;  3SHQ A;  3T9L A;  1Q1O A;  3KYC D;  2MWS B;  2OOB B;  2LRW A;  2BKR B;  3EEC A;  3QCA A;  3NZS A;  4I6P A;  2L76 A;  2BYV E;  2LJ5 A;  1YJ1 A;  4JGH B;  2AEH A;  2PPH A;  1WM2 A;  4NY0 A;  3HM6 X;  1A5R A;  1UBI A;  5E6O A;  4BBN F;  1UBQ A;  1Z5S B;  5L95 C;  1UEL A;  4W9K A;  3X0W A;  1V5O A;  3NZU A;  3O65 B;  4K81 A;  5D94 A;  4KDL B;  3MTN B;  3JVZ X;  1UD7 A;  4DK5 A;  2IY0 B;  1F9J A;  2BF8 B;  4FHK A;  4F8C B;  1WE6 A;  2L0T A;  4IWP A;  3DPD A;  1LFD A;  4WWN A;  2KN5 A;  3APD A;  4W9J A;  3ML8 A;  3KUZ A;  4W9E A;  5AZH A;  5TR5 A;  4XC2 A;  1PQS A;  2KAN A;  3IHP C;  2C60 A;  5AZF A;  2G45 B;  1H8C A;  2IY1 B;  3PRZ A;  3WAP A;  2LD9 A;  4HDQ A;  3A9K B;  3R3M A;  4IC7 B;  4OVV A;  4ICU A;  2DZM A;  4FJV B;  1SIF A;  2LVO A;  4RMA A;  1S1Q B;  3H7S A;  2J7Q B;  1K8R B;  2A4Z A;  3APC A;  3L0W B;  3L54 A;  4DBG A;  3PRM B;  3TIX A;  2PJH A;  2C5L C;  2DZI A;  3CSF A;  4AJY B;  4KV2 A;  4KIK A;  1EF5 A;  1WI0 A;  4WQO B;  1ZKH A;  2MP2 B;  1ZGU B;  2M8S A;  4K1R B;  4PS7 A;  4DHJ B;  3L16 A;  3V62 A;  5FR6 A;  4PS8 A;  2LGX A;  3DBL I;  3VUW A;  3TMP B;  4AWJ A;  2KTR B;  3W1S C;  4URK A;  4PYZ A;  1V49 A;  1SGH A;  5GMV A;  2K6D B;  4EEW A;  2RD0 A;  2KDI A;  1E7U A;  3DVN U;  4GDK B;  4KZ0 A;  3UIO B;  4M8N A;  4NJ7 A;  5KHO A;  1V80 A;  2D07 B;  2RPQ A;  3DVN V;  2LUE A;  4X57 B;  2BGF A;  3W1Y A;  3WAO A;  2LRU A;  1JRU A;  1T0Y A;  2LVQ A;  3PVL A;  3SDL C;  2OJR A;  4B6W A;  4CHK A;  3OAW A;  2NCN A;  1E8X A;  2CR5 A;  3L10 B;  1WXS A;  3JW0 X;  1WYW B;  2FUH B;  2VRR B;  4F1S A;  4BVU C;  4EZL A;  1P0R A;  4WWP A;  4BBN C;  1GG3 A;  2GOW A;  3QK0 A;  5DPS A;  2C7N B;  3HK0 A;  2HTH A;  4MGK E;  3QAQ A;  3A1Q A;  4G0N B;  3L13 A;  2V4L A;  4NQL B;  2NPT B;  4ANW A;  4FJZ A;  1OGW A;  3WA0 A;  4GSW A;  4HJK A;  2DHZ A;  3DVG Y;  4ANV A;  3M95 A;  3UIP B;  4BOZ B;  1E90 A;  4EFO A;  1LXD A;  1WH3 A;  3CF6 E;  2N4F A;  2KTF A;  3QIJ A;  5J18 A;  3APF A;  3RUI B;  4E71 A;  5DPT A;  3A4R A;  2EMT A;  2LGD A;  3RD2 A;  2C9W B;  3JYU A;  2ZVN A;  4ZRI A;  1U4A A;  4A20 A;  4IM0 A;  2EKE C;  2R2O A;  2JRI B;  2O6V B;  2HD5 B;  4BOS C;  1WGR A;  3B08 A;  4ICV A;  2I1K A;  1J0G A;  3ZRF A;  4GB9 A;  4ANX A;  3EFU A;  4ANU A;  4FA6 A;  2RR9 A;  5CHV C;  4DHZ E;  4G11 A;  3ZNG C;  1KJT A;  2Z59 B;  4HWI B;  2GBJ A;  4XZ4 A;  1WGG A;  2WX1 A;  1RAX A;  2IO2 B;  3ENE A;  2KK8 A;  5C23 A;  2N7D A;  4I6L B;  5LXH A;  3PRP B;  3NY5 A;  1WJU A;  1WX8 A;  2MBH A;  2O2V B;  3ZVV A;  4DHZ B;  3AU4 A;  2MLB A;  2KVR A;  4B9K A;  3OJ3 A;  2LZ6 A;  4NAW B;  3M63 B;  3QX1 A;  2W9N A;  3R7Q A;  2KFJ A;  4HCP B;  3ZKJ C;  2DAF A;  5J2R A;  3WAM A;  2GBM A;  2LI5 A;  1VD2 A;  4AUQ C;  2I1J A;  4BFR A;  3T8M A;  1VCB A;  2ZNV C;  3MHS D;  4II2 B;  3KYD D;  3NOB A;  4FLH A;  4GMV A;  4ZYN A;  2N9P C;  2D3G A;  4MJS A;  1E8Y A;  1H4R A;  1RFA A;  2XBB C;  3AUL A;  5EDS A;  2ZNV B;  3U30 A;  3KUD B;  4GDL B;  1NI2 A;  4KDI C;  2K6Q A;  1WGH A;  3A9J B;  4JLC A;  1XQQ A;  3V60 A;  2ZJD A;  4GIV A;  2JPH A;  2M4N A;  2MBQ A;  2GBR A;  5G55 A;  1XT9 B;  2JT4 B;  2YVC A;  4RM9 A;  2LGY A;  5E6P A;  1GUA B;  1RRB A;  2QHO A;  2XEW A;  3EHV A;  3SU8 X;  2ZPY A;  1ZW7 A;  4GDK A;  5KHQ A;  3K9O B;  4NNJ B;  1YQB A;  2FIF A;  2K39 A;  1XD3 B;  2K8C A;  2KC1 A;  4IG7 B;  4K7S A;  2XK5 A;  4YL8 A;  2KLC A;  4RM8 A;  4FBJ B;  2JWZ A;  3ZIM A;  3M3J A;  2AL6 A;  1WMH A;  1NBF C;  5AZG A;  1KOT A;  2G4D B;  4MGI E;  2LVP A;  3OJ4 B;  2GMI C;  1J8C A;  2MX2 A;  3ML9 A;  3H7P A;  3X23 A;  4TV3 A;  3S2A A;  3TJP A;  4IW0 A;  4IUM B;  4LDT D;  4IM3 A;  3K9P B;  3ZDM C;  4TKN A;  4BKT A;  5JHB A;  3PV1 A;  3V6C B;  3KUC B;  2ZPN A;  2DEN B;  3PLV A;  4ZRJ A;  1WFY A;  1WJN A;  2D10 A;  1UH6 A;  2G3Q B;  4W9D A;  4DDI D;  3WAN A;  2AWT A;  2DAJ A;  2N9E B;  3UF8 A;  4B95 A;  4DHJ D;  1WRD B;  2JF5 A;  4GGQ A;  1V6E A;  2CKH B;  3ZRC A;  2ZCB A;  3ZDT A;  1Y8R C;  2AL3 A;  2LXC A;  5G2N A;  3Q3F A;  1Q5W B;  3ZNI D;  1WX7 A;  3ZW3 A;  4BKG A;  1OTR B;  2KHW B;  3N32 A;  4DXA B;  4W9I A;  5DPW A;  3H9D A;  4I6N B;  2DX5 B;  4LJO B;  3JSV A;  2NBV B;  4FAD A;  4HVB A;  1WXA A;  2BWE S;  3RUL A;  4BKS A;  1FXT B;  2FCS A;  4MEM A;  3TBL D;  1ISN A;  2DYB A;  2KXJ A;  2K8B A;  2YLM A;  2IYD B;  2KKC A;  3PHW B;  3ZUN A;  1TTN A;  2L0F A;  3HHM A;  4IWQ A;  2ZZP B;  3LDZ E;  3U8Z A;  2NS5 A;  5DPR A;  3PZD A;  2KQ7 A;  5L83 A;  1LM8 B;  3ONS A;  4HDO A;  4GXB A;  2KD0 A;  4P7I A;  1EUV B;  3VUY A;  2J0J A;  2C7H A;  3U7D A;  2O2V A;  4E3C A;  4W9H A;  3AI5 A;  3VAW A;  1V9J A;  2KDE B;  2KFK B;  1GJZ A;  1WZ3 A;  3P2B A;  3A33 B;  4KSK C;  3PRE A;  2UWQ A;  3QHT A;  3SD5 A;  1WXM A;  4ZDV A;  2WX0 A;  3PGE A;  3V61 A;  4PS3 A;  1WJ6 A;  4MGY E;  3QA8 A;  3RCZ A;  3DBS A;  4WJQ A;  1G6J A;  2V3S A;  1YX5 B;  4WAA A;  2KO3 A;  1S3S G;  5E6N A;  2UYZ B;  4MGZ E;  2IBI B;  4TQ1 A;  4LCD E;  1D3Z A;  3H6N A;  2K8H A;  2PE9 A;  3VTU A;  4BKS D;  2N1W A;  3VTV A;  2L05 A;  4KVG B;  4K7U A;  1WGY A;  3RT3 B;  1GC6 A;  2AYO B;  2JVC A;  1V86 A;  1E7V A;  3NS8 A;  2HE7 A;  4GDL A;  1EO6 A;  2MRP A;  4CYE A;  3PSE B;  2CU1 A;  2KMC A;  3QC8 B;  3IVF A;  1TGZ B;  4NJ6 A;  2JXX A;  3A1Q B;  1IPG A;  2PE6 B;  4K7W A;  3ZO5 B;  1UGM A;  1OEY J;  2GBN A;  2BYF A;  1P1A A;  2KQS A;  3QWZ B;  3UGB B;  2HJ8 A;  4AP4 C;  2KWV B;  3UQA A;  2M17 A;  3GZN I;  3A9K A;  3HIZ A;  2JZZ A;  2MW5 A;  2IO1 B;  4FUL A;  3DOW A;  2EMS A;  1E5W A;  1IP9 A;  4MSQ B;  2NR2 A;  4FHJ A;  3HM3 A;  3I3T B;  1OEY A;  2FID A;  3KW5 B;  2WWZ A;  1WR1 A;  4KZC A;  1WR6 E;  4MEL A;  4JQW C;  1NDD A;  4NPN A;  2MP2 A;  5CX3 A;  2MA9 B;  2Z0D B;  4CO7 A;  2FCQ A;  4HCN B;  2FCN A;  3AU5 A;  1V81 A;  3PPA A;  5JZE B;  1AAR A;  4XX5 A;  1M94 A;  4TUU A;  2A5U A;  2KTR A;  4WJN A;  4WJP A;  5D7G A;  3L17 A;  3PT2 B;  3PLU A;  1CMX B;  1SE9 A;  3V6E B;  1I42 A;  2KDB A;  1C3T A;  1WIA A;  4GOC A;  4HPL B;  3TL5 A;  2M1M A;  3ZNZ B;  5HKH A;  2B3A A;  3KH0 A;  3R7R A;  3VXW A;  3W1S A;  3NHE B;  3R66 C;  2IZV B;  4FN2 A;  3ZNH B;  4EKU A;  4EOY A;  5AEK B;  4GN1 A;  2MBB B;  1L2N A;  3VH3 B;  2CHX A;  3VH4 B;  1WZ0 A;  2FCM A;  3DDC B;  5IA7 A;  1TBE A;  2JUO A;  4MM3 A;  5J17 A;  1WF9 A;  5JH5 C;  4EZK A;  1WM3 A;  2IO3 B;  1GC7 A;  2KDF B;  4HXD A;  2D11 A;  1R4N I;  2WDT B;  2KZR A;  2DYM A;  4TQ0 A;  2ZEQ A;  3BIN A;  4DWF A;  4LDT B;  4MJS B;  1KM7 A;  2BWF A;  1L7Y A;  4G50 A;  2NPT A;  2CS4 A;  4MSM B;  2R2Q A;  4OVU A;  4W9G A;  2KMA A;  5IAA C;  2RGF A;  1UZX B;  3RZF A;  2WYQ A;  3ZTC A;  3PHX B;  4MDK E;  2MQJ A;  1IYF A;  2KX3 A;  2REX A;  4M8M A;  3PTF C;  3VFK A;  3D32 A;  4DDG D;  1WE7 A;  3DQV A;  3ECI A;  3IFW B;  4NQK E;  3TCA A;  4G3X B;  2KFK A;  5LLI A;  2JRH A;  2DYO A;  2L7R A;  1TZ1 A;  3RYT A;  3VDZ A;  1J19 A;  1Z2M A;  2ASQ A;  2KWC A;  2LXA A;  2V1Y A;  3ZLZ A;  4ASW C;  1BT0 A;  1P98 A;  1R4M I;  5BO4 B;  2JZ3 B;  2NVU I;  2CHZ A;  2KJH B;  2O6V A;  3N3K B;  3WIM A;  3DBR I;  2DZJ A;  2D2Q A;  3EC8 A;  1I35 A;  3AXC A;  1E8W A;  2NBU A;  3DBH I;  4IM2 A;  3VQI A;  2IO0 B;  3B1L X;  2MBO A;  4W9L A;  5LXI B;  2J0M A;  2PEA A;  2XK5 B;  5CHF A;  1KLV A;  2RSU A;  4F7Z A;  2LAS A;  3CST A; 
#chains in the Genus database with same CATH topology
 1AYF A;  2BVC A;  1YN4 A;  4MH0 E;  1T0S C;  2M0X A;  3GOE A;  4ZRP A;  2XNA C;  3QQ8 B;  3N30 A;  2WXK A;  4W9F A;  3AE1 B;  4A3P A;  2D3B A;  4AOF A;  1OQY A;  1L5P A;  1GNU A;  2UU7 A;  3FKY A;  1I4H A;  4AJW A;  3W5V B;  2N9X A;  4A8X C;  1Q0W B;  2TSS A;  3H1U A;  1YJI A;  3QAR A;  2J4X A;  3BY4 B;  3JSV B;  4GU2 A;  4KX6 B;  3IBE A;  2CHW A;  3Q3N C;  3B0A A;  2W54 A;  2L00 B;  4HPM B;  2FBW B;  3Q8E A;  1WJ4 A;  4US8 A;  2KWU B;  1C1Y B;  3R2I A;  4J6I A;  1YIW A;  5JHA A;  2L3Z A;  1EF1 A;  1I4X A;  2D5G A;  2MBE A;  4ITK A;  2J53 A;  1CZP A;  3TEW A;  3SHQ A;  4PT5 A;  4I6P A;  2LJ5 A;  1FD6 A;  2AEH A;  1WM2 A;  3HM6 X;  1UBI A;  5E6O A;  4TSS A;  1EWY C;  2CU3 A;  3I9V 1;  3NVZ A;  1J7A A;  4K81 A;  4KDL B;  4NZL B;  1UD7 A;  4F8C B;  1MFW A;  1D5X C;  4W9E A;  1F1H A;  5AZH A;  5TR5 A;  2V9H A;  1AN8 A;  3IHP C;  2C60 A;  4N6E B;  1H8C A;  4ARI A;  1C9F A;  3PRZ A;  3WAP A;  3DWM A;  4HDQ A;  4OVV A;  3AE6 B;  4ICU A;  2KDM A;  2OED A;  4RMA A;  3H7S A;  2J7Q B;  3APC A;  4S17 A;  2C5L C;  3NG0 A;  2DZI A;  4IDI A;  1EF5 A;  3RFZ B;  4WQO B;  1RFK A;  3L16 A;  5FR6 A;  4PS8 A;  2LGX A;  2QJL A;  3WCQ A;  3TMP B;  1STE A;  3GE3 C;  4GDK B;  3MC0 B;  3UIO B;  2HJ1 A;  1PGX A;  4NJ7 A;  5D3D A;  1I4R A;  5BMI A;  1V80 A;  3DVN V;  4HKZ E;  1IUE A;  1QOA A;  3E56 A;  3SDL C;  1DGJ A;  4B6W A;  4GLS C;  2NCN A;  2CR5 A;  4C4V B;  3JW0 X;  3SFE B;  3QAQ A;  1IBX B;  4G0N B;  3L13 A;  3I57 A;  2G9H D;  1E6E B;  3BVG A;  4AS1 A;  2WXQ A;  1L6V A;  1L4Z B;  1SE4 A;  2DHZ A;  1XLN A;  4ANV A;  3UIP B;  3ZYY X;  3CF6 E;  5T8I A;  3L4P A;  4DXG A;  2IGD A;  1U4A A;  2R2O A;  2JRI B;  2HD5 B;  1T5X D;  4BOS C;  3RNA C;  4ICV A;  2LGI A;  1L0V B;  4IOI E;  2RR9 A;  4FA6 A;  4DHZ E;  3ZNG C;  4XZ4 A;  2KK8 A;  5LXH A;  1WX8 A;  2MBH A;  2MLB A;  4RGN A;  5H92 C;  1F52 A;  3R7Q A;  2KFJ A;  1XLO A;  1ZPS A;  3I63 C;  3TUO A;  2GBM A;  1XCT L;  2LI5 A;  3FIL B;  3FAH A;  1VD2 A;  1YQ3 B;  4BFR A;  2ZNV C;  2MJD A;  4FLH A;  5C3J B;  2N9P C;  1UNS A;  3P4P B;  3VR8 B;  4KKI A;  3A9J B;  4JLC A;  3V60 A;  2ZJD A;  1GUA B;  3SU8 X;  1JWM D;  2ZPY A;  5KHQ A;  2FIF A;  1XD3 B;  2WXF A;  2K8C A;  1E7P B;  2XK5 A;  2KLC A;  4FBJ B;  2JWZ A;  3M3J A;  3OG5 A;  4MGI E;  3U2S C;  2LVP A;  4ACF A;  1PGA A;  1J8C A;  3ML9 A;  1TKG A;  4TV3 A;  4IW0 A;  4IUM B;  3K9P B;  1DOI A;  4JE3 B;  3KUC B;  2ZPN A;  2D3C A;  4ZRJ A;  1FFV A;  1QLB B;  3Q69 A;  1WWT A;  3SEB A;  4L2Y A;  2CKH B;  2K3U A;  3ZRC A;  1Y8R C;  5D3I B;  5BYQ A;  2WHI A;  1KFY B;  1WX7 A;  1R4M B;  4DXA B;  1YNT E;  1HXY D;  3H9D A;  1D4B A;  2DX5 B;  2K22 A;  4MM3 B;  3JSV A;  3RUL A;  3TBL D;  1RWS A;  2YLM A;  2K8B A;  2KKC A;  1TTN A;  2L0F A;  1MG4 A;  3LDZ E;  2LUM A;  1D5M C;  2KD0 A;  1FMA D;  2J0J A;  4NAM A;  3U7D A;  4W9H A;  2W3S A;  2KDE B;  4WH4 A;  4DXF A;  2WX0 A;  1MHH E;  1YQ4 B;  1HTQ A;  1BUI C;  1NI3 A;  3DBS A;  4WJQ A;  3AEF B;  1S3S G;  2X38 A;  5E6N A;  2UYZ B;  4MGZ E;  2IBI B;  3P63 A;  4LCD E;  1D3Z A;  3AH7 A;  1FCL A;  1V1P B;  4USA A;  4OZC A;  3PSE B;  3FC4 A;  3Q3M C;  1J7B A;  1TGZ B;  5C2T B;  3A1Q B;  2LHD A;  1OEY J;  4HKQ A;  4JWU C;  3QWZ B;  4AP4 C;  1QOB A;  2KWV B;  2V0G A;  2JZZ A;  1IP9 A;  4FHJ A;  3HM3 A;  3AN1 A;  1OEY A;  2FID A;  3MFG A;  4WWM A;  3HVD A;  2INC C;  2MA9 B;  3KQ4 A;  2FCQ A;  3PPA A;  2IJ0 A;  1V81 A;  1QF6 A;  3PLU A;  3TEX A;  3V6E B;  2KDB A;  1SE2 A;  3TL5 A;  2M1M A;  5HKH A;  4EOY A;  4YTM B;  5GXG B;  1VRA B;  1L2N A;  3ETR A;  2FCM A;  1WF9 A;  5JH5 C;  2CJN A;  2IO3 B;  1GC7 A;  1MHX A;  4HRS A;  2ZEQ A;  1IBX A;  2GB1 A;  4MJS B;  1KM7 A;  4OVU A;  1L7Y A;  1GJZ A;  2CS4 A;  2KMA A;  3ZTC A;  3RZF A;  3Q8C A;  3AM9 A;  2MQJ A;  2IND C;  3AE5 B;  4NQK E;  3C19 A;  1Z2M A;  4ASW C;  1BT0 A;  1R4M I;  3ZJU A;  3EC8 A;  1KTK A;  2NBU A;  3DBH I;  3VQI A;  4W9L A;  1PFD A;  2WXN A;  2ZW1 A;  2RSU A;  3CST A;  3L08 A;  4LJP B;  3VVW B;  2EEL A;  1K51 A;  4RCO A;  4IKG A;  4FJY A;  1V2Y A;  3EFC A;  4WUR A;  2ZCC A;  1WX9 A;  4W9C A;  1V5T A;  3RI7 C;  4HLE A;  3FIL A;  2GBK A;  1FNW A;  4P6V F;  3UIN B;  5C1Z A;  2LWP A;  2Y5P A;  5CTR C;  3TEY A;  1WXQ A;  1E8Z A;  3UQB A;  3RNC C;  2KJ6 A;  2IPK D;  1YMH E;  2BKF A;  2KN4 A;  4KSL C;  2L8J A;  2K1F A;  2W82 A;  3NRZ A;  3A9J A;  3R8B A;  4JIO U;  4PYU A;  4M01 A;  2V4I B;  4M00 A;  1HE8 A;  4HJG E;  1WGK A;  2G1E A;  2GI9 A;  1P7E A;  4YSZ B;  2B76 B;  2E6X A;  1QZE A;  2KC2 A;  3CIR B;  5BMG A;  1SJH D;  3IG3 A;  3WAL A;  4EZJ A;  1P9D U;  1EWC A;  2GRI A;  3T9L A;  2QIE B;  2BKR B;  4L23 A;  1YJ1 A;  2BS3 B;  4A6Q A;  1A5R A;  1YN3 A;  5L95 C;  1UEL A;  3NZU A;  1F2R C;  3MTN B;  3JVZ X;  2QSD A;  1TYG B;  1Q10 A;  3DPD A;  3B2G A;  4MAC A;  4WWN A;  1L6U A;  4W9J A;  4XE0 A;  3ML8 A;  5BMH A;  1QOF A;  3KUZ A;  4P1C C;  1PQS A;  2HTM E;  2ON8 A;  5AZF A;  2G45 B;  1KRH A;  1I4G A;  4NJC A;  3R3M A;  5E6J A;  4XDC A;  1S1Q B;  3L0W B;  3L54 A;  3LB8 C;  3PRM B;  3TIX A;  1UF0 A;  3P1M A;  1C4P A;  2LJI A;  3P4R B;  4KIK A;  1ZKH A;  1GOZ A;  2WNM A;  3B2F A;  3VUW A;  3GE8 C;  1IGD A;  4AWJ A;  1Y56 A;  4PYZ A;  4N58 A;  4KGS A;  2GLS A;  4EEW A;  2RD0 A;  3DVN U;  3W9C B;  3AB5 A;  5KHO A;  2RPQ A;  1EM7 A;  2RDB C;  4X57 B;  2LRU A;  1V1P A;  1XF5 L;  2LVQ A;  3PVL A;  1FFU A;  3OAW A;  4H2A A;  5BYS A;  2FUH B;  4KGT A;  4XYC A;  4BVU C;  4WWP A;  4A90 A;  1GG3 A;  1K53 A;  1HZ5 A;  3A1Q A;  4M0W A;  1BXT A;  1FRD A;  2V4L A;  4FJZ A;  3WA0 A;  4GSW A;  4C00 A;  1E90 A;  4P16 A;  3U7Z A;  2K0P A;  2N4F A;  3QIJ A;  5J18 A;  4WIP A;  5DPT A;  1AW7 A;  2EMT A;  1PUT A;  2LGD A;  5BYR A;  1GAQ B;  3I5J C;  1WGR A;  1J0G A;  2RDG A;  3ZRF A;  4ANX A;  3EFU A;  2WP9 B;  5I4D A;  4G11 A;  1KJT A;  2Z59 B;  4HWI B;  3Q14 C;  1WGG A;  2BB6 A;  1RAX A;  2IO2 B;  2WX1 A;  3ENE A;  5C23 A;  4YTP B;  2ZW0 A;  2KVR A;  3ZXV A;  4YSX B;  3OJ3 A;  4NAW B;  2PLP A;  3M63 B;  3ZKJ C;  4A9A A;  3N1Z C;  1XLP A;  1KF6 B;  1D5Z C;  3WAM A;  3AE4 B;  1QKZ A;  3T8M A;  1VCB A;  3AE9 B;  3NOB A;  1NEN B;  4ZYN A;  2I2Y A;  4MJS A;  5EDS A;  1E8Y A;  2XBB C;  3AUL A;  1FM0 D;  2ZNV B;  1NI2 A;  4O1N A;  1WGH A;  4US9 A;  4GIV A;  2MBQ A;  1XT9 B;  2FE8 A;  2QHO A;  3BZD B;  1ZW7 A;  1SF0 A;  2Y5C A;  2KQ4 X;  1YQB A;  2JWU A;  5AUI A;  3ZIM A;  5AZG A;  3URY A;  1TS5 A;  5LNK 1;  3RMK C;  1N60 A;  1DOY A;  3S2A A;  4LDT D;  4IM3 A;  2NMQ A;  3ZDM C;  4TKN A;  1WSP A;  4KGR A;  2LHE A;  3V3X A;  2D10 A;  2G3Q B;  1F0Z A;  4DDI D;  4B95 A;  4BAX A;  4DHJ D;  2JF5 A;  4GGQ A;  2ZCB A;  3DHH C;  4C7Z A;  2LXC A;  1Q5W B;  1QT9 A;  1TZO A;  4BKG A;  1CQV A;  1ZDV A;  2KHW B;  3N32 A;  4W9I A;  4QAY A;  4I6N B;  4LJO B;  1OFF A;  2BWE S;  3RNF C;  1FXT B;  1ISN A;  3PHW B;  2LFI A;  2ZZP B;  3U8Z A;  1JWS D;  1SB3 C;  1N5X A;  2NS5 A;  5DPR A;  3PZD A;  2KQ7 A;  3T3N A;  4P7I A;  4A55 A;  2WXG A;  2O2V A;  3VRA B;  3AE7 B;  4LNO A;  1WZ3 A;  1OQR A;  1WXM A;  1N61 A;  3GP7 A;  1WJ6 A;  2VZK D;  4MGY E;  3UI3 A;  1C79 A;  2V3S A;  4WAA A;  2KO3 A;  4RGT A;  4TQ1 A;  1ZXI A;  2JSV X;  2WU5 B;  1PGB A;  4KKJ A;  4BKS D;  2N1W A;  2L05 A;  2BT6 A;  1GC6 A;  2N0S B;  4N59 A;  3NS8 A;  4GDL A;  1EO6 A;  2MRP A;  2RPV A;  1QIL A;  3IVF A;  4NJ6 A;  4TMA B;  1UGM A;  1YN5 A;  3VRB B;  2BYF A;  2HJ8 A;  2MW5 A;  2IO1 B;  4FUL A;  3DOW A;  3KWV A;  4K3C A;  2NR2 A;  2V3N A;  3KW5 B;  3Q8B A;  2WXO A;  1NDD A;  1TY2 A;  2WXH A;  5CX3 A;  2Z0D B;  1AAR A;  4XX5 A;  3RNB C;  2L32 A;  3L17 A;  4RF1 A;  2IDY A;  3AV8 A;  1SE9 A;  4AQ7 A;  1WIA A;  1D6E C;  4GOC A;  4HPL B;  4MH8 A;  1XEE A;  3VXW A;  5AUK A;  2DBY A;  3R66 C;  3ZNH B;  5AEK B;  1PYW D;  2CHX A;  3VH4 B;  1WZ0 A;  3DDC B;  1ZDX A;  5H8Y E;  5IA7 A;  1N6Z A;  3DHI C;  1WM3 A;  2IGH A;  2KDF B;  4HXD A;  2D11 A;  2PW9 A;  4DWF A;  4LDT B;  4MSM B;  2RGF A;  1UZX B;  1IYF A;  4RNA A;  1ZE3 D;  3DBL B;  3ECI A;  1MJD A;  3TCA A;  2DYO A;  2W55 A;  3U4E G;  3RYT A;  2LXA A;  3RN9 C;  3W2D A;  3ZLZ A;  5BO4 B;  3DBH B;  3N3K B;  3IXS A;  1FCC C;  3AE3 B;  3K9O B;  3C8Y A;  2QIL A;  2N7E A;  4YXD B;  3RZW C;  5D2M B;  4KIK B;  1ENF A;  4HRO A;  1TIF A;  3H7P B;  3QJZ A;  3NJT A;  1EU4 A;  2V3P A;  4NAW A;  4REZ A;  2FNJ B;  2NBW B;  3GB1 A;  2K25 A;  2JY6 A;  4RF0 A;  2MSE D;  1SEB D;  1RLF A;  1P3Q U;  2VZK B;  2LMC A;  4WWO A;  2O6V D;  3C0R B;  2G4S A;  3MP9 A;  2N1V A;  3ALB A;  1F77 A;  2DLB A;  1V1O A;  2KNB A;  1ZP0 B;  2Y5B B;  3ZTD A;  2BYE A;  1TS2 A;  4LTU A;  1WGD A;  1X1M A;  3VTW A;  1T0R C;  3NVW A;  4WJO A;  2J0K A;  4ZYS A;  2H88 B;  4M0W B;  5DCN A;  4IWO A;  2FAZ A;  2KX0 A;  1WXV A;  1WY8 A;  2C7M B;  4LNK A;  2KJR A;  2KLG A;  4N9F 4;  5CHW A;  1MG8 A;  2Z0E B;  1Q1O A;  2WDQ B;  3KYC D;  2MWS B;  1JML A;  3NZS A;  2L76 A;  5TSS A;  4NY0 A;  4WQM A;  1UBQ A;  3DHG C;  3X0W A;  1V5O A;  1KH0 A;  2AQ1 B;  1HTO A;  3ZQ4 A;  4FHK A;  2L0T A;  1LFD A;  2KN5 A;  3IAS 1;  3O13 A;  4XC2 A;  1C77 A;  2KAN A;  2IY1 B;  2LD9 A;  3A9K B;  4IC7 B;  1SIF A;  1K8R B;  3N1X C;  2PJH A;  4Q2J A;  3CSF A;  4AJY B;  4KV2 A;  2EKI A;  2MP2 B;  1ZGU B;  2WLB A;  2M8S A;  4PS7 A;  3DBL I;  2WXJ A;  3W1S C;  1XXG A;  2WXP A;  5GMV A;  4YT0 B;  1AWD A;  2KDI A;  1E7U A;  2KAJ A;  4D2K A;  2WDR B;  2D07 B;  3WAO A;  1JRU A;  1JAL A;  1N62 A;  1FXI A;  1E10 A;  3LXF A;  1XCQ L;  2WGS A;  2PVO D;  1WXS A;  1WYW B;  3BVZ A;  1L4D B;  4EZL A;  2GOW A;  3QK0 A;  5DPS A;  2C7N B;  2ONQ A;  1FXA A;  2JU6 X;  1JCK B;  3R2T A;  2NPT B;  4ANW A;  4HJK A;  3DVG Y;  1LXD A;  1WH3 A;  1T0Q C;  3APF A;  3N1Y C;  4E71 A;  2JYE A;  3A4R A;  3E9S A;  4A20 A;  4IM0 A;  2EKE C;  4DQO C;  4ARC A;  2O6V B;  1KLG D;  1SSN A;  4OVZ A;  4GB9 A;  5IKC M;  1OQQ A;  1I4Q A;  2GBJ A;  3AEC B;  1QQR A;  3PRP B;  1WJU A;  2O2V B;  1B9R A;  3BVM A;  3U52 E;  2JYT A;  3QX1 A;  3PZ7 A;  4HCP B;  2DAF A;  4CQN A;  3AEB B;  4OW0 A;  1E9M A;  4AUQ C;  2AQ3 B;  1DYQ A;  2BBC A;  2J52 A;  3KYD D;  1LO5 D;  1H4R A;  1RFA A;  2YEP B;  1TT5 B;  3U30 A;  1L0Y B;  2BTE A;  4K3B A;  3KUD B;  4GDL B;  2PVG C;  4RGO S;  1QOG A;  1XQQ A;  2M4N A;  2GBR A;  5G55 A;  2JT4 B;  3AMZ A;  4XDD A;  2YVC A;  1F2R I;  2ACZ B;  2LGY A;  3BK1 A;  2XEW A;  4B0E A;  3BK2 A;  2JXT A;  3CWI A;  4ZHP A;  3ZJT A;  4LNI A;  3MHZ A;  3RPF C;  1KOT A;  1NBF C;  2G4D B;  2GMI C;  2MX2 A;  3H7P A;  4YSY B;  3X23 A;  3TJP A;  2PIA A;  5G5H A;  5JHB A;  2X8X X;  3PV1 A;  3V6C B;  3AED B;  2DEN B;  4WAF A;  3PLV A;  1BML C;  1WFY A;  1WJN A;  5EE0 A;  3EGR A;  3NVY A;  2AWT A;  2DAJ A;  4ZHO A;  2QMT A;  1V6E A;  5G5G A;  2AL3 A;  2YEP F;  1XLQ A;  3Q3F A;  1KLU D;  3EA6 A;  4XWW A;  1V8C A;  3ZNI D;  5HFY A;  2L1A A;  2WQY B;  3AEA B;  2J42 A;  2NBV B;  1VR9 A;  5JXV A;  4BKS A;  1K50 A;  3ZUN A;  5FR3 A;  2INP E;  1TKE A;  1TS4 A;  1LM8 B;  3BYT B;  3ONS A;  4GXB A;  2KVZ A;  5L83 A;  1GB1 A;  2OHF A;  1EUV B;  3VUY A;  2C7H A;  4E3C A;  3LYY A;  1ROE A;  1YOV B;  1V9J A;  3GS2 A;  1NEK B;  1VDV A;  4KSK C;  2UWQ A;  3QHT A;  2OJW A;  3PGE A;  1EU3 A;  3MC9 A;  3ZXR A;  3EUB 2;  1UGJ A;  2VH1 A;  2Z8L A;  1FRR A;  2WS3 B;  3H6N A;  2K8H A;  3VTV A;  4KVG B;  4K7U A;  3RT3 B;  1SIJ A;  2JVC A;  1E7V A;  1YJJ A;  2K5P A;  4CYE A;  3QC8 B;  2DNF A;  1ZXH A;  3MC8 A;  2JXX A;  1K52 A;  4K7W A;  2GBN A;  2M19 A;  3UGB B;  1FIQ A;  1NYQ A;  5EE3 A;  1B1Z A;  2M17 A;  3A9K A;  3HIZ A;  1E5W A;  4JWS C;  4RH6 A;  1WR1 A;  2MP2 A;  4UDU C;  1VZ8 A;  4CO7 A;  4HCN B;  3AU5 A;  3HRD D;  1T3Q A;  3IAM 1;  4TUU A;  2A5U A;  3PT2 B;  3Q8F A;  5HG2 A;  1FEH A;  1I42 A;  5EE9 A;  5HHD G;  4YWG G;  4EKU A;  4GN1 A;  2MBB B;  2VH2 A;  2M0A A;  4EZK A;  1ET9 A;  5IP4 D;  4TQ0 A;  3BIN A;  3SR6 A;  1JWU D;  1CK1 A;  4G50 A;  2NPT A;  2L52 A;  5IAA C;  3AEG B;  2WYQ A;  3PHX B;  3IT6 B;  2KX3 A;  2REX A;  4M8M A;  1GB4 A;  1JRP A;  4DDG D;  4RFB A;  1WE7 A;  3IFW B;  4G3X B;  2KFK A;  5LLI A;  2L7R A;  4M02 A;  1TZ1 A;  4RGM A;  1J19 A;  2KMM A;  1P98 A;  2NVU I;  2O6V A;  2DZJ A;  2D2Q A;  1VLB A;  1I35 A;  3AXC A;  1E8W A;  4IM2 A;  1FPY A;  2IO0 B;  1XO3 A;  2XN9 C;  4BZA A;  2J0M A;  2QCZ A;  2MJE A;  5LXI B;  4F7Z A;  2MHJ A;  1WMH B;  4HEA 1;  4EUT A;  3DCG A;  3MJW A;  2JX5 A;  2QEJ C;  2E3T A;  4E74 A;  4ZRK A;  3VUX A;  1JQ4 A;  2WXI A;  2ZVO A;  4LK0 M;  3VHT C;  4OHJ A;  1YX6 B;  2BPS A;  1YD8 U;  2PKO A;  1HA5 A;  3KVF B;  1M4V A;  3A4S C;  5D6J B;  3TEZ A;  2AX5 A;  3TSS A;  3Q3J A;  4II3 B;  4JL9 A;  3ZJV A;  3LJ3 A;  2HDE A;  3Q6B A;  2DZK A;  2KWD A;  3AE2 B;  3CMM B;  3M62 B;  1E0Z A;  2MCN B;  3OLM D;  4HK2 A;  4JX1 C;  3DVG X;  3ZGZ A;  1LQB A;  4A3O A;  5MPO A;  2CJO A;  1V97 A;  2KOX A;  3PS6 A;  2LGS A;  3HUI A;  3KLS X;  2OOB B;  2LRW A;  3EEC A;  3QCA A;  4MT5 A;  3NUH B;  2BYV E;  4JGH B;  2PPH A;  2BQQ A;  1C78 A;  4BBN F;  1Z5S B;  4W9K A;  3O65 B;  5D94 A;  4DK5 A;  2IY0 B;  1F9J A;  2BF8 B;  1WE6 A;  4IWP A;  4XGA B;  3APD A;  1VZ6 A;  3J9C A;  3NZ3 A;  4L1B A;  2FUG 1;  1I4P A;  1IGC A;  3KWL A;  2DZM A;  4FJV B;  2LVO A;  4DBG A;  2A4Z A;  4JPS A;  3PZ8 A;  1WI0 A;  4ZRQ A;  1TS3 A;  4K1R B;  4DHJ B;  3V62 A;  2KTR B;  4URK A;  1V49 A;  1SGH A;  2NTS A;  2K6D B;  4KZ0 A;  1WRI A;  4M8N A;  1WYG A;  2LUE A;  2BGF A;  3W1Y A;  4YTN B;  3BWU D;  1T0Y A;  4OZB A;  1HEZ E;  1TJE A;  2WXM A;  2W3R A;  2BYT A;  2OJR A;  4CHK A;  3P4Q B;  1E8X A;  3L10 B;  1JWA D;  2VRR B;  4LNF A;  4F1S A;  4J3O D;  1P0R A;  4BBN C;  3HK0 A;  1GPX A;  2HTH A;  3OWE B;  4MGK E;  2AQ2 B;  1T6B X;  2SEB D;  4NQL B;  1OGW A;  3M95 A;  4BOZ B;  4EFO A;  2MJ3 A;  2KTF A;  1FNU A;  3RUI B;  2QDF A;  3RD2 A;  2C9W B;  3JYU A;  2ZVN A;  4ZRI A;  1ESF A;  3NS1 A;  2WXL A;  1NVI D;  2BW2 A;  3B08 A;  1VZ7 A;  3Q8A A;  2I1K A;  4ANU A;  2BB5 A;  5CHV C;  4LLG M;  4FXC A;  2N7D A;  4I6L B;  2LEK A;  3NY5 A;  3ZVV A;  3VR9 B;  4DHZ B;  3AU4 A;  4B9K A;  2NTT A;  5IN7 A;  2LZ6 A;  3RNE C;  2W9N A;  1C4A A;  2RMM A;  3Q2A C;  2N7J A;  5J2R A;  2PMV A;  2I1J A;  3RNG C;  1RYJ A;  3GZN B;  2BS2 B;  2KT7 A;  3MHS D;  2N9L A;  3HVZ A;  4II2 B;  4GMV A;  1ET6 A;  1R7S A;  3N9Y C;  2D3G A;  1NYR A;  1MI0 A;  4KDI C;  2K6Q A;  2I38 A;  2JPH A;  2PTL A;  1JWB D;  2IGG A;  4RM9 A;  2MEK A;  5E6P A;  1RRB A;  3EHV A;  4GDK A;  2KYW A;  1TY0 A;  4NNJ B;  1UUP A;  2K39 A;  1ZUD 2;  2KC1 A;  4IG7 B;  4K7S A;  4YL8 A;  4RM8 A;  3Q3O C;  2AL6 A;  1WMH A;  3OJ4 B;  2R61 A;  1SXT A;  4C4V A;  1SE3 A;  1R4N B;  4BKT A;  3B9J A;  3NVV A;  3IT4 B;  1HQR D;  3ABV B;  1UH6 A;  4W9D A;  3WAN A;  2WXR A;  3UF8 A;  1WRD B;  2INN E;  3ZDT A;  5G2N A;  4R3D A;  5EE1 A;  1TKY A;  5FKA C;  1CJE A;  3ZW3 A;  1OTR B;  4LNN A;  1J7C A;  5DPW A;  2WDV B;  3DBR B;  2K9X A;  1PDX A;  4FAD A;  4HVB A;  1WXA A;  1L0X B;  4XWT A;  1A70 A;  2SAK A;  2FCS A;  4MEM A;  1HZ6 A;  3N20 C;  2DYB A;  2KXJ A;  2IYD B;  3HHM A;  4IWQ A;  3V05 A;  3BII D;  4HDO A;  2ICI A;  1N63 A;  3AI5 A;  3VAW A;  2KFK B;  1VJK A;  3PO0 A;  3P2B A;  1FNV A;  3A33 B;  3PRE A;  3SD5 A;  4ZDV A;  2Y3A A;  3V61 A;  4PS3 A;  3RCZ A;  3QA8 A;  1G6J A;  1YX5 B;  4B0M A;  2N9K A;  1ZOY B;  4C7Y A;  2JQR B;  1JRO A;  2PE9 A;  1ACC A;  2D3A A;  3VTU A;  2M56 B;  1WGY A;  1I7H A;  4P1B C;  5HI1 A;  2AYO B;  3T3O A;  1V86 A;  2HE7 A;  1MPE A;  1RM6 C;  2CU1 A;  2KMC A;  4EE2 A;  4OZA A;  1IPG A;  2PE6 B;  3AEE B;  1N5W A;  3SFD B;  3ZO5 B;  2H89 B;  1P1A A;  2KQS A;  3UQA A;  3GZN I;  4HPP A;  2EMS A;  4MSQ B;  3I3T B;  2L83 A;  2JZP A;  2WWZ A;  4KZC A;  1WR6 E;  4MEL A;  4JQW C;  4NPN A;  4C56 C;  2FCN A;  5JZE B;  1M94 A;  1SJE D;  4WJN A;  2KTR A;  4WJP A;  5D7G A;  3AE8 B;  5IOI A;  1SBB B;  2LAS A;  2BS4 B;  3H8H A;  1CMX B;  1JW9 D;  1C3T A;  3MJ5 A;  2WU2 B;  3ZNZ B;  2B3A A;  3KH0 A;  3R7R A;  3W1S A;  3NHE B;  2IZV B;  4FN2 A;  1UWX A;  3VH3 B;  1C76 A;  1TBE A;  3BYY B;  2JUO A;  4MM3 A;  5J17 A;  2MH7 A;  1FO4 A;  1R4N I;  2WDT B;  2KZR A;  2DYM A;  4ZOH C;  2BWF A;  4W9G A;  2R2Q A;  1DOX A;  3W5U B;  4S0R A;  4MDK E;  3DWG C;  3PTF C;  3VFK A;  3D32 A;  3P42 A;  3DQV A;  1C4C A;  1MVK A;  2KAC A;  2JRH A;  1LGR A;  3P4S B;  3VDZ A;  2ASQ A;  2KWC A;  1UWM A;  1P7F A;  2V1Y A;  5IO9 A;  2JZ3 B;  2CHZ A;  5FK9 C;  2KJH B;  3WIM A;  3DBR I;  2Q5W D;  3B1L X;  2RDH A;  2MBO A;  2DWQ A;  2PEA A;  4PK1 A;  2QC8 A;  2XK5 B;  5CHF A;  1KLV A;  4C80 A;  2N9E B; 
#chains in the Genus database with same CATH homology
 1WMH B;  3L08 A;  2N7E A;  4LJP B;  3RZW C;  5D2M B;  4KIK B;  3VVW B;  4EUT A;  3DCG A;  4MH0 E;  3H7P B;  3MJW A;  2M0X A;  3QJZ A;  3GOE A;  4FJY A;  4E74 A;  4ZRK A;  1V2Y A;  3VUX A;  4NAW A;  3QQ8 B;  2ZCC A;  2ZVO A;  3N30 A;  1WX9 A;  3VHT C;  4W9C A;  1V5T A;  2FNJ B;  2NBW B;  4W9F A;  1YX6 B;  2BPS A;  4A3P A;  1YD8 U;  4HLE A;  3KVF B;  4AOF A;  1OQY A;  2K25 A;  2JY6 A;  2MSE D;  3A4S C;  1GNU A;  2GBK A;  5D6J B;  1RLF A;  1P3Q U;  3UIN B;  4AJW A;  2N9X A;  2LWP A;  5C1Z A;  1Q0W B;  4WWO A;  5CTR C;  2O6V D;  3C0R B;  3H1U A;  1E8Z A;  2G4S A;  2N1V A;  3Q3J A;  3ALB A;  3UQB A;  4II3 B;  3QAR A;  2KNB A;  2KJ6 A;  2BKF A;  3BY4 B;  4KSL C;  2L8J A;  2Y5B B;  2K1F A;  3JSV B;  3LJ3 A;  4JL9 A;  3ZTD A;  2BYE A;  3A9J A;  1WGD A;  1X1M A;  4GU2 A;  3VTW A;  4JIO U;  3IBE A;  4WJO A;  2J0K A;  2CHW A;  2DZK A;  4M0W B;  3B0A A;  2L00 B;  4PYU A;  5DCN A;  4HPM B;  4IWO A;  2FAZ A;  3CMM B;  2KX0 A;  1WJ4 A;  3M62 B;  2KWU B;  2MCN B;  1WXV A;  1WY8 A;  1C1Y B;  1HE8 A;  3OLM D;  4HK2 A;  4J6I A;  3DVG X;  1YIW A;  2C7M B;  5JHA A;  2KJR A;  2KLG A;  1QZE A;  4N9F 4;  2L3Z A;  1LQB A;  2KC2 A;  1EF1 A;  5CHW A;  1MG8 A;  4A3O A;  3IG3 A;  3WAL A;  2KOX A;  2MBE A;  4EZJ A;  2Z0E B;  1P9D U;  3PS6 A;  3SHQ A;  3T9L A;  1Q1O A;  3KYC D;  2MWS B;  2OOB B;  2LRW A;  2BKR B;  3EEC A;  3QCA A;  3NZS A;  4I6P A;  2L76 A;  2BYV E;  2LJ5 A;  1YJ1 A;  4JGH B;  2AEH A;  2PPH A;  1WM2 A;  4NY0 A;  3HM6 X;  1A5R A;  1UBI A;  5E6O A;  4BBN F;  1UBQ A;  1Z5S B;  5L95 C;  1UEL A;  4W9K A;  3X0W A;  1V5O A;  3NZU A;  3O65 B;  4K81 A;  5D94 A;  4KDL B;  3MTN B;  3JVZ X;  1UD7 A;  4DK5 A;  2IY0 B;  1F9J A;  2BF8 B;  4FHK A;  4F8C B;  1WE6 A;  2L0T A;  4IWP A;  3DPD A;  1LFD A;  4WWN A;  2KN5 A;  3APD A;  4W9J A;  3ML8 A;  3KUZ A;  4W9E A;  5AZH A;  5TR5 A;  4XC2 A;  1PQS A;  2KAN A;  3IHP C;  2C60 A;  5AZF A;  2G45 B;  1H8C A;  2IY1 B;  3PRZ A;  3WAP A;  2LD9 A;  4HDQ A;  3A9K B;  3R3M A;  4IC7 B;  4OVV A;  4ICU A;  2DZM A;  4FJV B;  1SIF A;  2LVO A;  4RMA A;  1S1Q B;  3H7S A;  2J7Q B;  1K8R B;  2A4Z A;  3APC A;  3L0W B;  3L54 A;  4DBG A;  3PRM B;  3TIX A;  2PJH A;  2C5L C;  2DZI A;  3CSF A;  4AJY B;  4KV2 A;  4KIK A;  1EF5 A;  1WI0 A;  4WQO B;  1ZKH A;  2MP2 B;  1ZGU B;  2M8S A;  4K1R B;  4PS7 A;  4DHJ B;  3L16 A;  3V62 A;  5FR6 A;  4PS8 A;  2LGX A;  3DBL I;  3VUW A;  3TMP B;  4AWJ A;  2KTR B;  3W1S C;  4URK A;  4PYZ A;  1V49 A;  1SGH A;  5GMV A;  2K6D B;  4EEW A;  2RD0 A;  2KDI A;  1E7U A;  3DVN U;  4GDK B;  4KZ0 A;  3UIO B;  4M8N A;  4NJ7 A;  5KHO A;  1V80 A;  2D07 B;  2RPQ A;  3DVN V;  2LUE A;  4X57 B;  2BGF A;  3W1Y A;  3WAO A;  2LRU A;  1JRU A;  1T0Y A;  2LVQ A;  3PVL A;  3SDL C;  2OJR A;  4B6W A;  4CHK A;  3OAW A;  2NCN A;  1E8X A;  2CR5 A;  3L10 B;  1WXS A;  3JW0 X;  1WYW B;  2FUH B;  2VRR B;  4F1S A;  4BVU C;  4EZL A;  1P0R A;  4WWP A;  4BBN C;  1GG3 A;  2GOW A;  3QK0 A;  5DPS A;  2C7N B;  3HK0 A;  2HTH A;  4MGK E;  3QAQ A;  3A1Q A;  4G0N B;  3L13 A;  2V4L A;  4NQL B;  2NPT B;  4ANW A;  4FJZ A;  1OGW A;  3WA0 A;  4GSW A;  4HJK A;  2DHZ A;  3DVG Y;  4ANV A;  3M95 A;  3UIP B;  4BOZ B;  1E90 A;  4EFO A;  1LXD A;  1WH3 A;  3CF6 E;  2N4F A;  2KTF A;  3QIJ A;  5J18 A;  3APF A;  3RUI B;  4E71 A;  5DPT A;  3A4R A;  2EMT A;  2LGD A;  3RD2 A;  2C9W B;  3JYU A;  2ZVN A;  4ZRI A;  1U4A A;  4A20 A;  4IM0 A;  2EKE C;  2R2O A;  2JRI B;  2O6V B;  2HD5 B;  4BOS C;  1WGR A;  3B08 A;  4ICV A;  2I1K A;  1J0G A;  3ZRF A;  4GB9 A;  4ANX A;  3EFU A;  4ANU A;  4FA6 A;  2RR9 A;  5CHV C;  4DHZ E;  4G11 A;  3ZNG C;  1KJT A;  2Z59 B;  4HWI B;  2GBJ A;  4XZ4 A;  1WGG A;  2WX1 A;  1RAX A;  2IO2 B;  3ENE A;  2KK8 A;  5C23 A;  2N7D A;  4I6L B;  5LXH A;  3PRP B;  3NY5 A;  1WJU A;  1WX8 A;  2MBH A;  2O2V B;  3ZVV A;  4DHZ B;  3AU4 A;  2MLB A;  2KVR A;  4B9K A;  3OJ3 A;  2LZ6 A;  4NAW B;  3M63 B;  3QX1 A;  2W9N A;  3R7Q A;  2KFJ A;  4HCP B;  3ZKJ C;  2DAF A;  5J2R A;  3WAM A;  2GBM A;  2LI5 A;  1VD2 A;  4AUQ C;  2I1J A;  4BFR A;  3T8M A;  1VCB A;  2ZNV C;  3MHS D;  4II2 B;  3KYD D;  3NOB A;  4FLH A;  4GMV A;  4ZYN A;  2N9P C;  2D3G A;  4MJS A;  1E8Y A;  1H4R A;  1RFA A;  2XBB C;  3AUL A;  5EDS A;  2ZNV B;  3U30 A;  3KUD B;  4GDL B;  1NI2 A;  4KDI C;  2K6Q A;  1WGH A;  3A9J B;  4JLC A;  1XQQ A;  3V60 A;  2ZJD A;  4GIV A;  2JPH A;  2M4N A;  2MBQ A;  2GBR A;  5G55 A;  1XT9 B;  2JT4 B;  2YVC A;  4RM9 A;  2LGY A;  5E6P A;  1GUA B;  1RRB A;  2QHO A;  2XEW A;  3EHV A;  3SU8 X;  2ZPY A;  1ZW7 A;  4GDK A;  5KHQ A;  3K9O B;  4NNJ B;  1YQB A;  2FIF A;  2K39 A;  1XD3 B;  2K8C A;  2KC1 A;  4IG7 B;  4K7S A;  2XK5 A;  4YL8 A;  2KLC A;  4RM8 A;  4FBJ B;  2JWZ A;  3ZIM A;  3M3J A;  2AL6 A;  1WMH A;  1NBF C;  5AZG A;  1KOT A;  2G4D B;  4MGI E;  2LVP A;  3OJ4 B;  2GMI C;  1J8C A;  2MX2 A;  3ML9 A;  3H7P A;  3X23 A;  4TV3 A;  3S2A A;  3TJP A;  4IW0 A;  4IUM B;  4LDT D;  4IM3 A;  3K9P B;  3ZDM C;  4TKN A;  4BKT A;  5JHB A;  3PV1 A;  3V6C B;  3KUC B;  2ZPN A;  2DEN B;  3PLV A;  4ZRJ A;  1WFY A;  1WJN A;  2D10 A;  1UH6 A;  2G3Q B;  4W9D A;  4DDI D;  3WAN A;  2AWT A;  2DAJ A;  2N9E B;  3UF8 A;  4B95 A;  4DHJ D;  1WRD B;  2JF5 A;  4GGQ A;  1V6E A;  2CKH B;  3ZRC A;  2ZCB A;  3ZDT A;  1Y8R C;  2AL3 A;  2LXC A;  5G2N A;  3Q3F A;  1Q5W B;  3ZNI D;  1WX7 A;  3ZW3 A;  4BKG A;  1OTR B;  2KHW B;  3N32 A;  4DXA B;  4W9I A;  5DPW A;  3H9D A;  4I6N B;  2DX5 B;  4LJO B;  3JSV A;  2NBV B;  4FAD A;  4HVB A;  1WXA A;  2BWE S;  3RUL A;  4BKS A;  1FXT B;  2FCS A;  4MEM A;  3TBL D;  1ISN A;  2DYB A;  2KXJ A;  2K8B A;  2YLM A;  2IYD B;  2KKC A;  3PHW B;  3ZUN A;  1TTN A;  2L0F A;  3HHM A;  4IWQ A;  2ZZP B;  3LDZ E;  3U8Z A;  2NS5 A;  5DPR A;  3PZD A;  2KQ7 A;  5L83 A;  1LM8 B;  3ONS A;  4HDO A;  4GXB A;  2KD0 A;  4P7I A;  1EUV B;  3VUY A;  2J0J A;  2C7H A;  3U7D A;  2O2V A;  4E3C A;  4W9H A;  3AI5 A;  3VAW A;  1V9J A;  2KDE B;  2KFK B;  1GJZ A;  1WZ3 A;  3P2B A;  3A33 B;  4KSK C;  3PRE A;  2UWQ A;  3QHT A;  3SD5 A;  1WXM A;  4ZDV A;  2WX0 A;  3PGE A;  3V61 A;  4PS3 A;  1WJ6 A;  4MGY E;  3QA8 A;  3RCZ A;  3DBS A;  4WJQ A;  1G6J A;  2V3S A;  1YX5 B;  4WAA A;  2KO3 A;  1S3S G;  5E6N A;  2UYZ B;  4MGZ E;  2IBI B;  4TQ1 A;  4LCD E;  1D3Z A;  3H6N A;  2K8H A;  2PE9 A;  3VTU A;  4BKS D;  2N1W A;  3VTV A;  2L05 A;  4KVG B;  4K7U A;  1WGY A;  3RT3 B;  1GC6 A;  2AYO B;  2JVC A;  1V86 A;  1E7V A;  3NS8 A;  2HE7 A;  4GDL A;  1EO6 A;  2MRP A;  4CYE A;  3PSE B;  2CU1 A;  2KMC A;  3QC8 B;  3IVF A;  1TGZ B;  4NJ6 A;  2JXX A;  3A1Q B;  1IPG A;  2PE6 B;  4K7W A;  3ZO5 B;  1UGM A;  1OEY J;  2GBN A;  2BYF A;  1P1A A;  2KQS A;  3QWZ B;  3UGB B;  2HJ8 A;  4AP4 C;  2KWV B;  3UQA A;  2M17 A;  3GZN I;  3A9K A;  3HIZ A;  2JZZ A;  2MW5 A;  2IO1 B;  4FUL A;  3DOW A;  2EMS A;  1E5W A;  1IP9 A;  4MSQ B;  2NR2 A;  4FHJ A;  3HM3 A;  3I3T B;  1OEY A;  2FID A;  3KW5 B;  2WWZ A;  1WR1 A;  4KZC A;  1WR6 E;  4MEL A;  4JQW C;  1NDD A;  4NPN A;  2MP2 A;  5CX3 A;  2MA9 B;  2Z0D B;  4CO7 A;  2FCQ A;  4HCN B;  2FCN A;  3AU5 A;  1V81 A;  3PPA A;  5JZE B;  1AAR A;  4XX5 A;  1M94 A;  4TUU A;  2A5U A;  2KTR A;  4WJN A;  4WJP A;  5D7G A;  3L17 A;  3PT2 B;  3PLU A;  1CMX B;  1SE9 A;  3V6E B;  1I42 A;  2KDB A;  1C3T A;  1WIA A;  4GOC A;  4HPL B;  3TL5 A;  2M1M A;  3ZNZ B;  5HKH A;  2B3A A;  3KH0 A;  3R7R A;  3VXW A;  3W1S A;  3NHE B;  3R66 C;  2IZV B;  4FN2 A;  3ZNH B;  4EKU A;  4EOY A;  5AEK B;  4GN1 A;  2MBB B;  1L2N A;  3VH3 B;  2CHX A;  3VH4 B;  1WZ0 A;  2FCM A;  3DDC B;  5IA7 A;  1TBE A;  2JUO A;  4MM3 A;  5J17 A;  1WF9 A;  5JH5 C;  4EZK A;  1WM3 A;  2IO3 B;  1GC7 A;  2KDF B;  4HXD A;  2D11 A;  1R4N I;  2WDT B;  2KZR A;  2DYM A;  4TQ0 A;  2ZEQ A;  3BIN A;  4DWF A;  4LDT B;  4MJS B;  1KM7 A;  2BWF A;  1L7Y A;  4G50 A;  2NPT A;  2CS4 A;  4MSM B;  2R2Q A;  4OVU A;  4W9G A;  2KMA A;  5IAA C;  2RGF A;  1UZX B;  3RZF A;  2WYQ A;  3ZTC A;  3PHX B;  4MDK E;  2MQJ A;  1IYF A;  2KX3 A;  2REX A;  4M8M A;  3PTF C;  3VFK A;  3D32 A;  4DDG D;  1WE7 A;  3DQV A;  3ECI A;  3IFW B;  4NQK E;  3TCA A;  4G3X B;  2KFK A;  5LLI A;  2JRH A;  2DYO A;  2L7R A;  1TZ1 A;  3RYT A;  3VDZ A;  1J19 A;  1Z2M A;  2ASQ A;  2KWC A;  2LXA A;  2V1Y A;  3ZLZ A;  4ASW C;  1BT0 A;  1P98 A;  1R4M I;  5BO4 B;  2JZ3 B;  2NVU I;  2CHZ A;  2KJH B;  2O6V A;  3N3K B;  3WIM A;  3DBR I;  2DZJ A;  2D2Q A;  3EC8 A;  1I35 A;  3AXC A;  1E8W A;  2NBU A;  3DBH I;  4IM2 A;  3VQI A;  2IO0 B;  3B1L X;  2MBO A;  4W9L A;  5LXI B;  2J0M A;  2PEA A;  2XK5 B;  5CHF A;  1KLV A;  2RSU A;  4F7Z A;  2LAS A;  3CST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...