2AQ2B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR BETA CHAIN V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq2B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq2B01
2QILA 2XRQD 1CT1D 1TS3A 2XRSD 3BVGA 4RGOS 1CHPD 3BVZA 3BZDB 5D3DA 1YN3A 2TSSA 1FNUA 1KTKA 1CHQD 1T5XD 4RFBA 5TSSA 1RCVD 3SEBA 4L63B 1D5XC 1LTBD 1DYQA 1S5DD 4K6LA 1XXGA 1KLGD 1TY0A 4O1NA 1CK1A 2AQ3B 1SXTA 1SE2A 1LTGD 1LTSD 1PTOH 1PRTB 1D5MC 2O2LD 5ELCA 1FGBD 1TS2A 2J4XA 1V1PB 1TS4A 4RGTA 3BYYB 2NTTA 1M4VA 1SEBD 1PTOF 3R2TA 5FK9C 1I4HA 1S5BD 1LT3D 2IJ0A 1ENFA 1LTRD 1PZKD 1S5ED 2NTSA 5ELFA 1F77A 1FNWA 1BCPD 1I4GA 1D6EC 1EFID 2Z8LA 4Z9CB 1JR0D 1S5FD 1LTAD 2RDGA 4C56C 4UDUC 1I4RA 1BXTA 4RGNA 1PTOD 1EU3A 1L0YB 3MC0B 1PRTC 1B44D 1HTLD 4RHSA 1SBBB 1SE4A 3URYA 1XTCD 4RGMA 3DWQA 3O13A 4RHRA 1EEID 1I4QA 1LTTD 1RD9D 1BCPF 1L0XB 4BWGB 1SE3A 3CHBD 1JWMD 4NZLB 1RF2D 4DXGA 1UUPA 3BYTB 1KLUD 1B1ZA 2QEJC 1STEA 1SJED 4OHJA 2AQ1B 3DWPA 2R61A 2XNAC 1PTOB 1TY2A 1G8ZD 3R8BA 1LLRD 2WV6D 1SJHD 1AW7A 2ICIA 3V05A 1PZID 1V1OA 3TSSA 1UNSA 5ELBA 2G9HD 1JCKB 1ESFA 4ZYSA 1GOZA 5ELDA 3GP7A 3OWEB 1CQVA 2XN9C 5I4DA 1QILA 2RDHA 1PRTD 3DWAA 1YN5A 1DJRD 2CHBD 1PTOC 4RCOA 1AN8A 1EU4A 1FNVA 1LO5D 1BCPB 2AQ2B 1I4PA 4L6TB 1ET6A 1EWCA 1RDPD 1LT5D 5FKAC 4RH6A 1ET9A 1MD2D 1JWSD 2IPKD 2SEBD 3BVMA 3R2IA 1JQYD 4DXFA 1LT6D 5D3IB 3MFGA 3EFXD 1FD7D 1HXYD 1PRTF 3EA6A 1JWUD 1LT4D 1LTID 3KLSX 1PYWD 1S5CD 1HA5A 1TS5A 1YN4A 1D5ZC 1I4XA 3W2DA 1BCPC 5ELEA 1V1PA 1EEFD 1PZJD 4TSSA 1HQRD
chains in the Genus database with same CATH superfamily
2CW0C 4MACA 4K7UA 4DV7L 5IYDG 3HG9A 3LWEA 4POFA 4DR4L 2XRSD 2I5LX 1SAPA 3Q3OC 1U4LA 1NTGA 2JE6I 2MP2B 4BA1I 2OQ0A 5C4XH 4HTHA 1Q12A 1T5XD 4X64L 4A3GB 1RCVD 3S2HB 1J8IA 1VD2A 1D5XC 2KWDA 2L83A 2M4NA 4LMQD 4N6EB 4Q2JA 4WQMA 3NUHB 1KLGD 1LUZA 2CS4A 2A68D 3LX0A 4F8MA 3FKIG 3H3VI 4KSLC 1MBYA 1FD6A 3K6OA 1V43A 3Q0AA 2E2HB 3L08A 4I6LB 2MCNB 1K3RA 1YHBA 4JI0Q 3S1RB 3H3VC 2YYZA 2F3WA 5ELCA 2O2LD 4HN7A 4AJYB 2FE8A 5HKHA 3HKZE 1X6OA 3EJIA 4GLVB 1C9OA 2NCNA 2BH8A 3KBXA 4FNFA 4FLHA 2YVCA 3E0JA 1XX8A 1ENFA 1XPOA 1WCMB 4N9TA 3S2DB 1BOSA 4GOPA 3KW5B 1FNWA 4ODGA 1I4GA 1NNXA 4LF6Q 2PMVA 1JR0D 1V80A 2M00A 3UGBB 3ML9A 3M4OH 1BNZA 3T51B 3C1FA 3F2UA 1D7QA 2E6XA 4ZRJA 3MXUA 4RHSA 2AWTA 3M9BA 3NTKA 2IO1B 3JAMi 5C44G 4AH6A 3HS0C 4RHRA 1LTTD 3DWMA 1G51A 3K5LA 3SK4A 1A2UA 4HIDA 3TP7A 3U58A 2K5DA 4DV2Q 4KHPQ 4N9F4 1EYCA 1MFWA 1IBXA 1Q46A 1UE6A 3MJWA 5C1ZA 3RNAC 4YHHL 5LMUL 1U4PA 2KJHB 5DNFA 3DVGY 4ZQ3A 1YITA 3GE3C 4YTPB 2VB3X 1UEAB 1IGCA 1GUTA 1GNUA 4HCNB 1Y1WG 1SFOB 2EE1A 1MIUA 3PS6A 3ZXRA 1GC6A 4YSYB 4QJFA 4JV5L 3PO2G 3F1ZA 3APFA 2JY6A 1H9SB 3TSSA 4LDTB 3P63A 2G9HD 3NENA 1VQGA 4BOSC 4DNIA 3PF5A 2BT6A 1C4AA 2GBJA 1NBFC 5ELDA 4IOAA 1XNRL 2R7ZG 4KX6B 2KTRB 2DUDA 4LFCQ 4XXEA 3NZ3A 4LNNA 5FR3A 4FF2A 2JXMB 1SIJA 2DBYA 2MBBB 1ILQA 1V81A 3WDNA 2L1AA 2RQXA 1YZ6A 3DLLA 1F2LA 3ZNHB 2JRHA 1EY8A 1TKGA 2ZXRA 4IJLA 4L6TB 2Q8TA 1ONLA 2F4VQ 4A93G 2MWSB 3V3XA 4NY0A 2HCIA 2JA8H 4XYQA 1WYDA 2PIAA 1KD1C 3ALBA 4KN7C 4HCSA 2K5NA 1LFDA 2K01A 4OW0A 2N49A 3ZTDA 2Z4HA 1PH1A 1YNTE 1FD7D 1LABA 1PRTF 2JRIB 2PE6B 3X3NA 1JB7A 3HP3A 2L55A 3SHLA 2QA4A 3GTKH 3K57A 4DK5A 3PMFA 4NP5A 2IDYA 2WIIB 1EIGA 4A76A 1PZJD 1WGDA 4BBSG 1KAWA 1HQRD 4HCEA 2W3RA 4UAIA 3U4VA 4FXKC 5BN4A 2PQEA 3NHHA 1KF6B 2MHJA 4F1SA 4G7HC 3QB3A 3GD7A 1O78A 2BYFA 2E74C 4TRDA 1E10A 2FMMA 3F2CA 2VH1A 4KVGB 5KNCA 4ZOHC 1OXXK 4LUOA 4RA8A 4BXXG 3V61A 1EYGA 3Q3MC 4BKTA 3J80E 2W3SA 2EYFA 1C4CA 1NVID 1WGRA 4UP7A 3GTJB 1SYDA 4CDFC 5EKIA 2KHWB 2RPVA 4A3CH 3CCLA 4KJNA 2PZTA 1K8OA 1PGBA 1WYWB 2QC8A 4CBVA 4ITKA 2F0IA 2KQSA 5IYDH 4KSKC 1B3QA 3H1UA 3T1YL 2PJHA 3LYYA 2MRPA 5JJIA 4C2MB 1PFBA 2B8GA 3KUCB 5FK9C 2IJ0A 1LT3D 2BVCA 1R4MB 2PMZB 3EGRA 1EY9A 3AULA 4IKGA 2AL3A 3DBSA 4FULA 1H9KA 2DAJA 3NK9A 4JPBW 3PIO3 3VRAB 3FKIH 4MIUA 3ZLZA 3QG1A 1RRBA 2LMCA 4DV5Q 3WAOA 2CW0D 1E7ZA 1WH3A 1HZ5A 1A0IA 1I4RA 3S1QH 4RGNA 3A9JA 4O0AA 1DONA 3DXJC 2Q2HA 2IO0B 2VNUD 1QE6A 1D4BA 2KWUB 5DPRA 3EVQA 4A3OA 1V9PA 1P0RA 3U9OA 5LMNQ 1K53A 4P1CC 2MA9B 1F0ZA 1RODA 3HOZG 4B3RL 3VTUA 3I4LA 1Q5WB 1UEBA 4LF5L 1VQ8A 4D2KA 4FJVB 1TY2A 2JU6X 3ZNID 3S15H 2N8NA 5EE1A 4JX1C 1LM8B 4HKQA 5C44H 1X3EA 5FR6A 2VQFL 4OVUA 1LV9A 1VF7A 2DX5B 1YNJC 4B6WA 4ZCKA 2KC1A 2O6VD 3SFDB 2CCZA 1M1KC 2I07B 3I91A 3EUB2 2NZ1D 3TL5A 4A3IG 2N0SB 1ZXHA 3DWGC 2F0HA 3R3OA 1B70B 5AJ3Q 2GRIA 2RHSB 1FXTB 2RDHA 3DWAA 2JA6G 4OXPA 1J6QA 1Y1WH 3W5OA 3A33B 3AU5A 4I7AA 2LFIA 2CFMA 4B9XA 2LGYA 3VXWA 1ET6A 3PO2H 1L0VB 1UGMA 4PNYA 1V6EA 4FVMA 2UWQA 4DR1L 3P4SB 1ET9A 4K2KA 4QUFA 5M3MB 1P1AA 2KWCA 3CCVA 2YU9H 1NMGA 2O6VA 5IP7G 2CKZB 1CQFA 1HXYD 2R7ZH 3DBHB 3I2ZA 2NPTB 1JWBD 2LS01 2QIEB 4CKEA 4MH0E 4DDID 2VUMB 3VR6A 1SYBA 3OMGA 1D5ZC 4DV0Q 2BBCA 2WWZA 1GPXA 4ID6A 2RGFA 1ML0D 4DV6L 3TQYA 4A93H 2WXHA 5HHDG 1R4QB 1WY8A 1EEFD 2MQJA 4LF4Q 4GKKQ 2WXKA 3AN1A 3MHZA 3LWUA 3NP8A 4K7SA 3I73A 3JAMc 1PH3A 4JLCA 2JEBI 3KH0A 2EXDA 4EE2A 2DNCA 2K22A 3B1LX 1YVCA 1HTPA 3DHQA 4P72A 4AIMA 4DU9A 2BS4B 4KK7A 1PH5A 3ABVB 4AS1A 4WJQA 1TWCH 3Q24A 4O42A 3M3YB 2C7NB 1B9NA 1PDXA 1S5DD 1EIYB 2B29A 1JE4A 1ISNA 4YCVA 3J81j 4DV5L 4IM0A 4BBSH 3K5NA 3C3LA 1K83H 2KMMA 4LTUA 1TS2A 4BBRB 1SYGA 3PT2B 1HZBA 3QO2A 1GUOA 2KEEA 4IPDA 2RA4A 3C2PA 2EY6A 3DHIC 1J0GA 1E2ZA 4BXXH 2NBVB 3RI7C 3M4QA 1AARA 2FUG1 5ELOA 2E2JH 2EOTA 5JOBA 2PEAA 2NVQH 4II2B 2ES2A 1HRJA 2K8HA 3NE5B 4A3EG 3RZDH 4MGKE 2LXAA 2V4LA 4RKBA 3IKJA 3K7UC 4CJ2C 4F8CB 3R93A 1UGJA 3HUIA 5AZHA 5H92C 2JPHA 3AM9A 1I35A 1EUJA 3MC0B 2WB1B 3BDLA 1T9HA 2NVXB 4B9KA 1ESRA 2FIDA 4K2LA 2RMMA 1WFQA 4ME5A 4USAA 4DR6L 1J7BA 2CKHB 2DHZA 4JI7L 1R4MI 2VRRB 5JEAJ 1QOBA 1EEID 1SYEA 3MAQA 2WDRB 2AL6A 4X3SA 1TIFA 4IFDJ 2IGGA 2YU9B 3A74A 1A3TA 1ACCA 1TZOA 3DVNV 3OTOL 4B3SL 4FADA 2K1FA 2F0EA 1XWEA 3HOUH 3KBGA 1L2NA 1D1KA 1KLUD 4LW1A 4ICVA 4DR5Q 2EY2A 2AQ1B 2CVRA 1LACA 2XNAC 3PREA 3H09A 3M4YA 3R8BA 1V49A 4DNRB 4LUZA 3B2FA 2SNMA 4TMAB 1N34L 4AQYQ 1B9RA 4K6DA 4K0KQ 1TWAH 3V05A 1X1MA 2CWPA 2EJGC 4KTAA 5A35A 3AEVA 4R4QA 2KC2A 2HUGA 1N60A 4C80A 1QB5D 2WXOA 2WAQB 4DAPA 1UH6A 4CYEA 3QJYA 1YHAA 1SYCA 3Q8DA 3HOZH 1C77A 1ENAA 4JBJA 2KK8A 2V3NA 4A3FG 1LXDA 4ZHPA 4XDDA 2PO4A 1MVKA 1BDOA 4HR7B 1I94Q 1DJRD 3T13A 1JT8A 1GD7A 3J9CA 1SYFA 2FHTA 5C5MA 1LO5D 2E76C 2PI2A 4WJ4A 5G3LF 2F0LA 3G4SA 1TWGB 2MP2A 1TQOA 3NG0A 2Z6BA 3FPUB 4NXML 1T0SC 2RDBC 3NEMA 3N9YC 3VQIA 3M3JA 3DPDA 1Q90A 2A69C 3A9KA 2AHOB 4A3IH 3GTMH 1WFYA 1WVLA 3CF6E 3Q2AC 1IKMA 2BYEA 4HPMB 4ZRQA 2BDOA 1VQNA 2OJRA 3JYUA 1X32A 2JA6H 5KNBA 1AH9A 2K1BA 3HOXB 3PZ7A 3RZOH 3MHBA 1XQQA 4C4VA 3FILB 3RMKC 5ELEA 3OWFA 1S1QB 3I70A 1E22A 4A3JG 2LGDA 4RNAA 3BDOA 5J17A 1YNJD 3Q6SA 2UUAL 3PGZA 3HOYB 1B8AA 2KVRA 3BVGA 1E2WA 1T3QA 3DBHI 1KRHA 5IP7H 3NZSA 2Z0EB 4JYAL 2YLMA 4IDIA 3A5UA 3DHHC 4US8A 3ZJUA 4N58A 3ZGZA 4M01A 5JHAA 3CCEA 1SMXA 1ICWA 4GOCA 2EYMA 3IAYA 4LFBQ 4ZK9B 4IUVA 4OO1I 2NUCA 3HOUB 1SE2A 3S17B 3AEEB 4R4IA 4IWPA 1VQAA 4JI2L 3CP0A 1VQ9A 3R7RA 1QOAA 4KJOA 1PRTB 4CKCA 4HPPA 4A3DB 1SN8A 2EYPA 1NAPA 1H9MA 2YV5A 1IBML 3AMUA 2UXDL 4LFAL 2E2IB 1NEKB 5LNK1 4G7OC 1SNPA 4IUQA 2WQYB 3UINB 1TYGB 1L5PA 3NSWA 3JSVB 4WJOA 2I1KA 3ZJTA 4MN3A 2M56B 4NPNA 5IP4D 1F77A 1B53A 3I3TB 2MNAA 3EQLC 4KKIA 4IWOA 4BKGA 4IG7B 3PUWA 2Y0SG 3V60A 1EY4A 1N36L 2HIXA 4DUZL 1H9SA 2DLBA 3VDYA 1V86A 4KKJA 2D0OA 2E2DC 2VZAA 4RG1A 1HUNA 3QR8A 4DAYB 1K0RA 2AWOA 3AEBB 2ZNVB 5CV4A 1X55A 3PO3B 1QOGA 1SNOA 3KUZA 1FGUA 3N3KB 4PYUA 3NELA 2X38A 3A56A 3M4PA 4YXDB 4TV3A 1HZCA 2KTRA 2AKWB 1NE3A 2JQOA 1UBIA 3TEWA 5EQ0A 4A3EH 4A3IB 1R9TH 2K28A 2O2VB 1VJKA 2LUMA 2OWOA 2V9HA 3K59A 2LJ5A 4IM3A 4A3GG 3AYHB 2BQQA 5DM63 2J7ZA 2G1EA 3UQBA 2N88A 3K0XA 3T9LA 1UWVA 2V3PA 2JX5A 2E5LL 4LNOA 2N7JA 3OLMD 1GKHA 1PVOA 3KLWA 1MPEA 4JBMA 4E71A 3H3VH 2UU9Q 4MH8A 2WDVB 2KDEB 4NKLA 4RMAA 3ONAB 1I3QH 4MGYE 4JI6L 1FPYA 4HMIA 3HK0A 3VUWA 1OXUA 1YIWA 5CX3A 3GTPB 1HPCA 4KKTA 2B3GA 4P2CB 5IGDA 1ASZA 1HNWL 3RLNA 4JI3Q 2LGIA 3OWEB 2N78A 3HEJA 5EBDA 1WCMG 2LKVA 3JW0X 3N20C 3RR5A 5MPOA 3KUPA 5LXIB 5ISRA 2CHXA 3PUVA 1NI3A 2AQ2B 5KYIA 3HFZB 4PT5A 3DOWA 3VA5A 3S14H 1HQMC 4DPGA 2C5CA 2B76B 4YWGG 5IIFA 3CMMB 4ILWA 3PIP3 3ZKJC 5J3BA 5I9OA 2FNJB 2Z9HA 4QIWE 4EQNA 4HJAA 1G6JA 2L7RA 4PQXA 2ON8A 4A3FH 3AECB 2GI9A 1NSNS 1HJPA 1LT4D 4PMWA 1PYWD 3Q8CA 1VQ4A 1CA5A 2C35B 1EIFA 1HR0L 2I38A 2CWAA 2NBWB 3SU8X 1SSOA 4L8JA 3U7ZA 2Q8RE 3M63B 1N62A 3WCQA 4P7IA 2QILA 2J42A 4JL9A 3CKIB 1VQEA 3S16B 5L95C 2FCMA 4RGOS 4QMGA 5L83A 3HKZB 4MEMA 2C7MB 2N7DA 2K4KA 4RFBA 4GS3A 1UE7A 2JWZA 4Y7NB 4O1NA 2F3IA 3DCGA 1R9TB 2N9LA 4A3JH 4O2DA 4XGAB 1VDZA 2Q8IB 2HDMA 4LNIA 2WYQA 2KCNA 1FCCC 1OQRA 1PQSA 3PHWB 2L8JA 1CKNB 2FCQA 1KDAA 2A69D 3AE6B 1NR2A 4X62Q 2YTVA 1PTOF 5FLXE 2G9DA 1C79A 1J7AA 1E8ZA 4JWSC 4FXDA 3VDZA 4KHVA 4EZKA 1AZQA 3OOCA 4OX9L 1IKLA 1OQYA 4LWCA 5IA7A 5KRUA 1FM0D 3GTGH 1VLBA 2L4NA 1B50A 2L15A 4MTKA 4BY1G 1LTAD 2RDGA 1VRAB 5M9OA 3GV6A 3J7A5 3UIOB 2CQOA 2VQEQ 1SNQA 2KKCA 3E9HA 1L0YB 1PRTC 2F1MA 4MHEA 5EPKA 2N9XA 4NJ7A 3RULA 3KVFB 2CR5A 1ZGUB 2DYMA 1XTCD 4R8NA 2WGSA 3A54A 1ZYRD 3GO5A 1BQQT 3STBC 3DWQA 1IBKL 3O13A 2UU9L 3S14B 1WE7A 1O7YA 4DHJB 4H13C 3B9JA 4Y52H 1WJNA 4FP5D 1JROA 3FDTA 4X3KA 4ZRZA 2NYZD 1Q3LA 2NVYH 2PPHA 3T4AC 4OZBA 3GQBA 1KL9A 4IPHA 3F2BA 1MJEA 5AFWA 3U7DA 2IO2B 2XEWA 3V6CB 4HXDA 2DY7A 1D3ZA 1Z5SB 4C3IB 1WXVA 1P7FA 3CCSA 4ZRPA 3ZJVA 3KYCD 2K5QA 4JI1L 5E3FA 3U4ZA 1N8RC 2KENA 3RT3B 1YJNA 1O7IA 2ZNVC 3PIOA 3L7ZC 1V1OA 2EJFC 4A3LG 4DKAC 2OEOA 2H1EA 2HQEA 2A73B 2WKDA 2OEDA 1OEYJ 3HHMA 4IJHA 2NPTA 5JPMC 1WTVA 2CJNA 3A0JA 2BKRB 4HCPB 2F0PA 4POGA 1MHXA 1G2SA 3IFTA 3NHEB 3VYTA 3Q69A 2PYKA 3NPPA 4DGZA 4I65A 2MEKA 4KDIC 5BYQA 4A3GH 2KZRA 4UHVA 3S2HH 1JC7A 4AYBE 1XLPA 3B0AA 5I4DA 2NBFA 2WXFA 1D2BA 1JORA 2ZW1A 3R7QA 4ASWC 4B95A 3RN5A 5IY0A 4GB9A 4NW2A 3KJOA 3W1YA 1HNXQ 4YWLA 1EWCA 2F0NA 5EPJA 5J39A 4HJ5A 4AUQC 2D2QA 3S1RH 4DF7A 1X56A 2RD0A 1MD2D 2R3ZA 4RM9A 3TZDA 1WTHA 2KMCA 2BDNA 1RTOA 1UD7A 4IUMB 2BW2A 1P98A 4LF8Q 2ATWA 4X66Q 1LTID 1WCMH 3TMEA 2K03A 2A6HC 3V62A 1YN4A 1X65A 1XPUA 1KQSA 1UWXA 3NS8A 3TUOA 3AMZA 4MJSB 3AI5A 2FIFA 3MXNB 2WX0A 4DK6C 4DAVA 5BYRA 1QJOA 1S72A 1CT1D 3WANA 4HDOA 4XE0A 4BBNF 4G4KA 3H15A 3T8MA 4P16A 2A1AA 2AWNA 3BZDB 4KV2A 4MSQB 3C19A 1WRIA 2WXPA 1XT9B 1CHQD 2IX0A 1LM0A 4EQPA 4K3CA 2HD5B 4JPSA 1DOXA 2KO3A 3K9OB 3Q3JA 1CUKA 4NXNL 4FJYA 4IOIE 3RCZA 1SXTA 4JC0A 1CA6A 3OW7A 2CU1A 3BWUD 4FN2A 3AE3B 2J0MA 4JE3B 4A55A 2M8SA 1LTGD 4A3MB 3ZVVA 4G57A 4K14A 3P75A 2ZTDA 1CFMA 2MPMA 4ANWA 3RNCC 2MQHA 1STNA 2PW9A 3HVZA 3U52E 4BKSD 3I4NG 1M4VA 2GA4B 2L0TA 1AP0A 1S5BD 4DR7Q 1VQBA 3A4RA 3H94A 3NXWA 1QVCA 1HCZA 2NZOA 5M3MG 3RN2A 2B2UC 4OIJA 2X69A 2L76A 3ND8A 2J53A 2OHFA 3E5SA 4WWOA 2WXNA 1JICA 1VQ5A 2VUMG 2Q2UA 2JK8A 2W55A 3E9IA 1B44D 3UE1A 4R1JA 2YEPB 1ILPA 1SBBB 3Q8AA 1VF5C 3EIVA 3VAWA 3OSOA 3CCUA 2R6GA 4OO1G 2DENB 1TWFB 4YTNB 5E6JA 1L1OB 2ZZPB 3IHPC 3ZDMC 4BKSA 2M17A 5IODA 1K50A 1FFUA 3FP9A 1SMYC 3L54A 1YQBA 2IGDA 3P2BA 4HROA 4BY1H 2HJ8A 1VQIA 1PHJA 3MC9A 2KOXA 4XX5A 1JOOA 3UDGA 2EY1A 1ZE3D 1Y8OB 1SJED 2C60A 3ETRA 1DCZA 3CRLC 2NBUA 4M0WB 2MP1A 4C00A 2BYTA 1R4NB 1WTXA 1HNXL 4KY7A 1YHQA 3OG5A 2OXPA 4YCUA 4ZAIA 2LHDA 1EOVA 3LJ3A 4H7BA 3H9DA 3L4PA 1F9QA 5IWAL 1IBLQ 3RUZA 1BVSA 2ZJQA 4BBRG 1J7CA 3N52A 5DPSA 1Q1EA 4JI4Q 2MUYA 3HOWB 1QOFA 3TDQA 3GZNB 3FILA 2K5PA 4DHZE 4JWUC 4KZCA 2XWJB 3LXFA 2BE5D 3IT4B 3NVWA 4QGUA 1YN5A 2DNEA 3AU7A 4A3BG 1PRTD 3GTJH 2KWVB 1C76A 4EZJA 1IHZA 1J9OA 4LF7L 2JT4B 1Y8RC 2WLBA 1VZ7A 1XNQQ 3CMEA 1WX9A 3STBD 1JB3A 1WWTA 3IRBA 4A3LH 1E7UA 3DM1A 3L0OA 1WSPA 3GS2A 5IO9A 1HR0W 1XLQA 5JJZA 1GHKA 1NMFA 1XMQQ 3SDLC 4K1RB 2WB1G 4G3XB 3K80C 1QNUA 1N32L 4C2MH 1XPRA 5CTRC 1E7VA 1WM3A 1YJWA 2A74C 3WALA 1U4RA 1I5FA 2KAJA 2C5LC 3H91A 2PNRC 1UBQA 2K39A 1WI0A 2Q5WD 2ZM6L 4IZ8A 4JQWC 3SK6A 1U4MA 2C7HA 3ULPA 4WJWA 3ZJYC 4RF1A 2HHHL 3FPPA 3RZFA 3RNUA 2PQAB 2WFWA 4KZ0A 5A2QE 5T1IA 2I1JA 5EGTA 1RFKA 3JSVA 1FNUA 4XYOA 1YNXA 1L7YA 4P73A 1KTKA 4CDCC 1N33Q 1VQ6A 2NVTB 1QQRA 1LYLA 1RHPA 3GTLB 3PRMB 2HQLA 2KHJA 4CJ0B 2KJ6A 1BO0A 1BBUA 4LUVA 4BY1B 2WXRA 2WAQG 3CSTA 5IGGA 1CZWA 4KI0A 2AX5A 2NB0A 5CR3A 2MW5A 1JJGA 3W1BA 4DAYA 1DOYA 2KQ7A 1VQ7A 1QWYA 4XQQA 1YJIA 3G7LA 1CZGA 3I57A 2XBBC 1DOLA 1NUCA 4GU2A 4JI0L 2ZEQA 4W9CA 4W9IA 5CV5A 2OCEA 3TJPA 5FJ8G 2O2VA 3WWVA 5C4JH 1JRPA 2H5XA 3Q23A 2K5HA 1XO3A 3KQ4A 2JQRB 1WTOA 2K8CA 2Z8LA 1WGKA 3AE1B 5BMHA 4PMBA 3TZUA 3PGEA 1BUIC 1BXTA 1E9MA 4LF6L 1A3UA 3HOXG 5G5GA 1FRRA 5EJWA 1GC7A 4IM2A 1HTLD 2LXJA 4IALA 1BKBA 2UUCQ 4OZCA 3I4NH 2N3SA 1HH2P 2VS1A 5C0XH 2PVOD 2K50A 2DY8A 4YSZB 2XVSA 2GVBA 4JI8Q 5M3MH 2F0VA 3CHBD 3HOYG 1L6VA 4KIKA 3P20A 4QAYA 2QKIC 1BBWA 1EY5A 3WIMA 2RCNA 4KHPL 1KDCA 4DV2L 3BYTB 4KLKA 3AB5A 3AEDB 2VUMH 4LK0M 1PTOB 1F9PA 1GM5A 1CI3M 1JE5A 1PYBA 2F3VA 3D4WA 1KNEA 2JA9A 2V1YA 3SR6A 4K8JA 2JA7B 2QJLA 3K8AA 3HOUG 2D5DA 4HSVA 4OO1H 3H7PB 3OJ3A 4W9LA 3J7AV 3TEXA 1L1OC 3T3NA 1D8LA 1XCQL 1JCKB 4PZ8A 2HTHA 3EECA 1ZOYB 4BVUC 4A3DG 4EQOA 2KDBA 2DZJA 3CXCA 2XGTA 4G0NB 4IUNA 5C3EB 3QC8B 4BOZB 1QZEA 3M3YH 1YBYA 3D6CA 1R4NI 4KKUA 3VTWA 2XSCA 2F0OA 4E6IA 2WXMA 4ANVA 1C4PA 2PE9A 2EZVA 5CYUA 4LFCL 1I4PA 4GMVA 1DZ1A 2RDFA 4C7ZA 2D11A 4B0EA 2BWES 1SMYD 2L00B 2MJ8A 1E8XA 2F0MA 1RWSA 4QUCA 3P4PB 4BBRH 1SGHA 2F4VL 3GZNI 1ZKOA 2KMAA 2B2UA 1N33L 1O80A 2FMCA 3NTIA 1N61A 3RZWC 4X3UA 3PO3G 4AQ7A 1J5EQ 5C4JB 3SR1A 4A3BH 4GZYC 3I7FA 1HE8A 2WNMA 2PI2E 2BOSA 5IOIA 1WXSA 1QLBB 3K0YA 2B39A 3U9SA 4GN3B 1FIQA 3NWTA 2N1WA 3QWZB 4OELB 3TP5A 2F0JA 3J7ZC 1Y8NB 2NVXH 1TS3A 4XQNA 4LK1C 3SFEB 2EIFA 2FFKB 1QNKA 3GTOH 3I4NB 3KF6B 1XJVA 1SF0A 2EY5A 3RLOA 2Y5BB 2NMQA 1K8RB 2ZVNA 3U4EG 1DM0B 4WAFA 2QEXA 3ECIA 1STAA 3MA2B 4I6NB 3RN9C 4A6QA 4EZLA 3MVVA 2AQ3B 2LI5A 5HGTA 5M5XB 3AEGB 1VQPA 2KCMA 1KH0A 4RAUC 5IOCA 2AUJD 1EY7A 4MGZE 1KRSA 1H9RA 4H0LC 3I56A 1X3GA 1D5MC 1Z6HA 1E90A 4JIOU 3E6ZX 4EQ5A 2IT1A 2K6QA 3A5ZB 3N1XC 1V9JA 2LGXA 1PXUA 1I6HB 2FXQA 4EGVA 3J81i 3DUZA 4DV1Q 4DR3Q 5K36G 4JI8L 3P1HA 4ZUIA 4S17A 4WH4A 1ENCA 4KGTA 2N55A 3PO0A 1VQJA 2W9NA 2WHIA 1I7HA 1K8AC 4QCLA 2GBKA 2VZKD 4PS7A 1VQFA 1XD3B 3NTHA 2J0TD 3ZNZB 2KJXA 1YQ4B 3W1SC 1TZ1A 3B6YA 4XT1B 3FHWA 1T0RC 3P4RB 3NBHB 5D65A 1SE4A 5EAYA 3M95A 3MEHA 3DVGX 5FJ8H 1TWGH 3DBRB 1PDQA 1BCPF 3UIPB 3CU7A 5KHQA 4DK3C 1L0WA 3DDCB 4WWMA 3HKZG 3NBIA 2EMSA 5GMVA 2WKCA 4B08A 4B3TQ 3CCMA 1PH2A 5LMNL 4WWPA 3NVVA 3AE7B 3CW2C 4A3BB 5IGBA 3HOXH 1KFYB 2LSSA 5JXVA 1PYSB 3AE9B 1YJ9A 2R93B 1KJTA 1E24A 1SJHD 1AW7A 1R7SA 2KFKB 2LVOA 2Z59B 1TT5B 2EQSA 4LAAA 4IPCA 4A9AA 5ELNA 5ELBA 2QCZA 3HOYH 2VY3A 1GOZA 5G3LD 2MJEA 2LVQA 3GTOB 2KDMA 2D3BA 3CSFA 4FXCA 1SE9A 1CQVA 2XN9C 3MXNA 2F0KA 2YTYA 1KIXA 4K7WA 5I6WA 4GNXB 4N9PA 1PTOC 2FCNA 4WJPA 1F9RA 4TKOB 1QKZA 2NWGA 5AJ3L 3GTQB 2HCCA 3S17H 3NRZA 1T0YA 2ZTCA 4GSWA 4L5QA 1MKHA 2YTXA 1C3TA 1L6UA 4A3DH 2ZW0A 3FC4A 2XTIA 3KYHC 4DXFA 4G50A 2E2IH 3MFGA 1E5WA 2WX1A 3VVWB 5I9PA 2BS2B 4IPGA 4HK2A 4MM3B 2Q2TA 4HSPA 1TS5A 1GB4A 3M85A 4PZ7A 2JYTA 1OXSC 4CHTB 1UE5A 3CCQA 1UE1A 1XMOQ 4KDLB 3K58A 4US9A 2KBNA 1U0LA 1AE2A 2E3TA 3TRZA 4TQ1A 4DV0L 3VR8B 4EX5A 3N30A 4C3IG 2FJ2A 4ZRIA 1RJTA 4W9FA 5DPTA 1W2BA 3RFZB 2I5HA 2L05A 2OT2A 1CHPD 4LF4L 4GKKL 3X0WA 5DEHA 1YNNC 4APVA 2HE7A 2D9UA 1WTWA 3PO3H 1WRDB 2NVUI 3CMAA 4HJGE 5TSSA 4L63B 1QZHA 1LTBD 3KWLA 1LGRA 2EMTA 3NQTA 5KHOA 3MP9A 2BF8B 4F7XA 2JF5A 3IAM1 3S9WA 2VB2X 5C4HA 5EE9A 4IURA 1SIFA 1YEZA 1YMHE 2W82A 2PMZE 4RWSC 3CCJA 1L1OA 3S24A 3L10B 4FBJB 2MHVA 4XWTA 5C0XI 5BO4B 3A7AB 1TS4A 2DGYA 4HJ7A 1RTNA 3AV8A 2EJMA 1I4HA 1SE8A 1KOTA 4M00A 2X8XX 2B2WC 1S5ED 5LHY1 4ANUA 4F7ZA 3G6JB 1MG4A 4NQKE 4M0WA 3MFYA 3GTPH 1WZ3A 4F87A 1Z7TA 3Q8FA 2YEPF 3QIJA 4K3BA 3AXCA 3OYYA 2HIVA 1JJ2A 1V97A 1WIAA 1IGDA 3URYA 3I90A 1K73C 3W3AA 3LNNA 1PH6A 5K36H 1BMLC 2INNE 3OW2A 3K81C 2Z4IA 1K0SA 1I4QA 3D0FA 4LDTD 1IBXB 4IC7B 2LUEA 4GN4B 1M90C 1K28A 2KLCA 3DEOA 2N7EA 3PSEB 3Q3NC 1GVPA 4C3JB 3HIZA 4TVAB 1G2TA 5H8YE 1EZ6A 1RF2D 4BBNC 5C3WA 1U5KA 4ZKCB 1WXQA 4L5RC 5CHVC 3ZNGC 2LD9A 3KUDB 2LASA 4MSMB 1WTQA 2INPE 1ZW7A 2WV6D 4DR5L 3DBRI 1IP9A 3NY5A 1QVFA 3QX1A 5FO7B 1UNSA 4A3MG 3S16H 5IN7A 5E4XA 3QK0A 5J22A 4AQYL 3BIID 3JAME 4K0KL 2K7VA 2UUBQ 3RUIB 1K52A 1STYA 5C2TB 3M7GA 5CHFA 3TEZA 1BR9A 1PH9A 4NMZA 4Y7NH 4RCOA 1XCTL 2F4IA 2GN5A 1TJEA 3VUXA 1A2TA 4JCVE 2FAZA 5G55A 1I94L 1FJGQ 1LT5D 1D1IA 1Q8KA 5FKAC 4JI5Q 4A3KB 5LL6X 1ZPSA 4RH6A 2LWPA 3I5JC 1JWSD 3J81c 1V5OA 2SEBD 3J80i 1EUVB 3ZW3A 4JW0A 3AQQA 3R2IA 2IY1B 3QWNA 4L23A 2L0CA 3OHXC 4PZ6A 1WR1A 4ZRKA 2KT7A 2O4XA 1S5CD 1Q0WB 4KY6A 3W1SA 4GNXC 1I4XA 4S3SA 2XWBB 2EYJA 3W2DA 2WXJA 3LB8C 4J6HA 1B3AA 4TSSA 2XRQD 4NQLB 1XLOA 3CQZB 2LY7A 1HZ9A 5DM73 4WORA 4CDEC 2KLGA 4ZYNA 5D3DA 4LJZC 1CMXB 5BMGA 2O5JC 4YT0B 2I5MX 3AFPA 3MWYW 1RM6C 4LF9Q 1TY0A 2LRWA 5GAEC 1SNMA 3HOWG 4EEWA 1ZDXA 2N9PC 4AP4C 5IT9E 3CC2A 4ALPA 3H8HA 5D7GA 3N1YC 4JVZA 1VDVA 3PVLA 4LFBL 4C3IH 4KMUC 3HRDD 2KUMA 3T1HQ 2J4XA 1XYIA 2OF1A 4IWQA 2JN4A 5G2NA 4DUYQ 4RGTA 2UXBQ 3BYYB 2IHFA 1WD1A 2WDTB 2NTTA 4HIOA 1HNZQ 3RNFC 1FYCA 5E6PA 3KFUA 2ASQA 4GLAC 3EC8A 4NAWB 3J7AF 5FLXL 2L32A 1AEXA 1LTRD 2NTSA 3PZDA 1C7YA 4OWWB 3RD2A 3NZUA 1HFGA 5HGQA 1E8WA 1PFNA 2AYOB 3ND9A 1SROA 3BDCA 3A8JE 4TUUA 3RYTA 1H8CA 4EUTA 1WXAA 1R4PB 3G6EA 3H7PA 2Y5PA 3VYSA 1U4AA 1II3A 4KHZA 5BN3A 5LMNW 1B4OA 4ACFA 1YNND 1VCBA 1S3OA 4RGMA 1N6ZA 3ULLA 3R3MA 2HDEA 2KDIA 1WGGA 3AE2B 4TQ0A 3K7AB 1KNAA 1MHWC 4CKBA 3AB9A 3FVQA 3SHQA 1YD8U 1Y14B 2IGHA 1EF1A 4DV4Q 4J6IA 4IOCA 1P7EA 2OQKA 5IE8A 4E74A 3LGJA 2JA5B 1MI2A 3NVYA 2R61A 2ZTEA 3T56B 1MSHA 1JALA 1BBXC 1DXMA 1NR4A 5BR8Q 2PW5A 3VR2A 1DGJA 2N1VA 4FO2A 2ICIA 5D6JB 1PZID 4ZKBB 3PQIA 2SAKA 5IYBG 2UXCQ 1TT2A 3BK2A 3TS0A 3L3OC 5CC4A 2RHQB 3KLRA 1VQHA 4ZYSA 3K5MA 1EQQA 1KM7A 5C5LA 2B2YC 1J8CA 1NYRA 3S1NB 1B9MA 4OGQC 2D3AA 1OFFA 3JVZX 4FHKA 4C3HB 1WX7A 3WAMA 1CZPA 2F0SA 1V8QA 2WU2B 3IAS1 2AUKA 2VH2A 3W5UB 1IYJB 2K5VA 1A8VA 2V1CC 1BCPB 3KOJA 5JAVA 3A8KE 4JI3L 4II3B 1T5EA 3VYUA 1RFAA 3J81L 3AFQA 4J1MA 4WAAA 3AEFB 2XK5B 1N63A 1M94A 4A3MH 4NJCA 2M9VA 4YY3Q 2KX0A 2PW7A 1Y69U 3KK7A 4LJOB 3CPFA 5KIXA 2O6VB 2W54A 1GB1A 2B2WA 1VQLA 3DQVA 4PG3A 3PV0A 2D3GA 2BWFA 1I50B 4ULLA 3H0GB 1NBWA 4DV3Q 3M7NA 3UDXA 2BA0A 1E0ZA 2WP9B 1L2FA 5EE3A 1U9RA 1NYQA 3D8GA 4GN1A 4DR4Q 2REXA 3W5VB 5FO8B 4ABNA 3EN2A 5I2YA 2A5UA 1DOKA 4IQZA 4X64Q 1CJEA 3CF5A 1WF9A 4NB3A 1HNZL 3HKSA 2JA7G 1STBA 4W9KA 1Y1VB 1TWFH 1VZ6A 4I7ZC 5TR5A 1JMCA 5JVG3 4MTNA 4MDKE 2B8FA 2BPSA 2Y3AA 1PFSA 2F0GA 5BMIA 3NOBA 2R92G 3C46A 2K8BA 2RPQA 1F1HA 1CK1A 3TBLD 3BY4B 1Q1BA 2C9WB 1NY4A 3RNBC 3QCAA 5C3EG 3PUXA 1P8LA 3I8ZA 3KF8B 5HURA 3MC8A 1TKWB 4JBKA 2FBWB 3I4OA 1FXIA 4URKA 3K9PB 3KDFB 5IGEA 1TR5A 3RMHA 3T53B 5M3FB 1TGZB 2ZJRA 4J3OD 5J18A 4PK1A 4IUTA 3OIQA 3ULJA 4HIMA 5JJKA 1F52A 3QA8A 4RKLA 3GOEA 5IP9G 3IBEA 1HUMA 4FA6A 4X62L 3PF4A 2P5ZX 1O7LA 2LGSA 3HOWH 1E2VA 5CV9A 2EDGA 1VR9A 3ZQ4A 4EKUA 3ERSX 2KFKA 2K75A 1VQOA 1RL2A 3A55A 5BR8L 3CPWA 1UZXB 4OZAA 1PLFA 4XTCS 1IXRA 4H2AA 1OTRB 3E0EA 3WA0A 2VQEL 1PFDA 2UXCL 3J80c 4YHHQ 2E8GA 5LMUQ 2DZMA 4BY7B 2FUHB 3FAHA 1FO4A 1S3SG 1P16A 1LTLA 2OOBB 2XIWA 4GNXA 1FEHA 1W6KA 3UI2A 5C0XG 5CGKA 1L4ZB 2EELA 2IBIB 1UUPA 1TKEA 4A3PA 2KYWA 4DWFA 2VL6A 4JV5Q 3DWPA 3APCA 1AFPA 2BYVE 4KGRA 4C7YA 3I4MB 4W9EA 1Q1OA 1EYAA 1LLRD 3GB1A 1C48A 5IGCA 4PYZA 3VTVA 5AZFA 1OGWA 5M5YB 5EKKA 3SGIA 3TREA 2F0UA 4R8IA 3CCRA 2ASBA 1XNRQ 5C23A 1GJZA 3D32A 1ESFA 4MM3A 1WMHB 1S4ZA 1G291 2AEHA 3S2AA 1AE3A 4DK0A 5AZGA 2NVTH 3L0WB 2R7DA 3GTLH 5EE0A 5FLMG 1EL0A 4OONA 4REZA 4S0RA 4CJ1B 2LEKA 3BK1A 2PNHA 4A90A 4K5XA 1YOVB 4ZDVA 2IZVB 2NN6H 3J7YW 4DDGD 5KGUA 5IYBH 2B63B 1O7ZA 3H7SA 4RCNA 3DBLB 1MGSA 3UDIA 2N4FA 3VFKA 4QQBX 3F2DA 2HT1A 3A9KB 1JQYD 5E6NA 4IFDI 3VH4B 5IAAC 4WWNA 2NZHA 1JJCB 3Q8EA 4L1BA 3ZIMA 2D07B 4C4VB 2TMPA 1IYFA 2RKSA 2PZUA 1SSNA 4LF8L 2GVAA 2KOLA 1BCPC 4X66L 4XQJA 1EM7A 4QF4A 3APDA 1ASYA 2VW9A 3S1MB 2QMTA 4BZAA 2PLPA 1VCIA 1L4DB 3D4RA 4JGHB 1TWHB 4KV6A 4MELA 1SNCA 2MBOA 1UWMA 1IYVA 3HM3A 2R93G 3MXPA 2TSSA 4XT3B 5A2QL 1RAXA 3RLFA 1C8CA 2GB1A 3AE5B 3MZ5A 2D10A 1G91A 1IW7C 2JEAI 3I63C 4RM8A 2KECA 5EPLA 1BF4A 5DAUA 1SDFA 4KD4A 1X9NA 1NDDA 4YIJA 3T1YQ 3VR3A 2QDFA 1G6PA 5CHWA 1KLVA 1F9JA 2JUOA 3CC4A 1V1QA 2QGQA 2M0AA 4X65Q 2KJRA 2DNFA 3OAWA 1PTOH 4QY7A 2V0GA 1X3PA 1V1PB 4YTMB 2LXKA 4LNFA 2JA7H 4GGQA 2JXTA 2B2YA 4WFN3 4DR2Q 5JHBA 1PH4A 4BA2I 1F2MA 1Z9FA 5KYLA 3U2SC 1HTOA 2A8VA 4RF0A 1SRUA 2R92H 5M5WB 5C3XA 1OQQA 1V5TA 4DR7L 4Z9CB 3A7LA 1WZ0A 1WOCA 5C3EH 2KACA 3SD5A 3DM3A 2WXLA 4E3CA 4EVOA 2ICEC 5JVH3 1EU3A 3J80L 1QUQB 3NS1A 2NR2A 1WJ6A 2L52A 2F03A 1C4QA 1TBEA 1QOHA 2A5HA 5C4XB 4XYCA 1RD9D 4BS9A 1JRUA 3QOJA 5IP9H 4B3RQ 4N8FA 4LF5Q 4YL8A 5H1SE 3IVFA 2WU5B 3BS1A 1F2RI 1AYFA 2DYOA 3QIAA 2L3ZA 2QEJC 4R4CA 3V96A 4OHJA 2A6HD 1F2RC 1FRDA 1V2YA 3MJ5A 2F0WA 3GV3A 2VQFQ 2H89B 2BTEA 1G8ZD 2JZZA 3C8YA 2L0FA 1SLJA 2F0DA 5CBEE 1EQRA 4OVZA 2INCC 2X6GA 1JWAD 4U673 4MNOA 3ER0A 1F9SA 2K14A 2M2LA 4EOYA 1ZUD2 1GJXA 3MTSA 1TU2B 1KDBA 3RNEC 4YSXB 1IBLL 3PPAA 2B2TC 4GDKB 3OIPA 1EWYC 3M4OB 2CU3A 3IG3A 3WOEA 4JI4L 1VMCA 3P4QB 2L1BA 4DR1Q 3CRKC 5KNDA 3TIXA 1AN8A 1E3PA 4N8X1 2MBHA 5M5XH 1GG3A 4UP9A 2DZKA 2MJDA 1A70A 1RKNA 1OXVA 1XNQL 3QJZA 4K5WA 4DK1A 3NUCA 1YJJA 1ZXTA 4R4TA 4GKJQ 1I6HH 2BB5A 2ZCBA 3PV1A 3BZCA 4DV6Q 1XMQL 4B3MQ 4A4IA 1NENB 4M02A 4OWTB 4L5TA 5FLMH 1QT9A 1WD0A 2R92B 5LLIA 3VHTC 1F2ZA 1MJDA 4DAMA 4HAEA 2WXIA 4C3JG 2D3CA 1KXLA 4X65L 1TTNA 3RPFC 3DBLI 1W6JA 1A63A 5L37A 4AYBG 3OJ4B 2EKIA 4M8MA 2IO3B 3NQIA 4NAWA 1B2TA 4X57B 4DR2L 4C1NI 1HZAA 2KHSA 2NS5A 4NDXA 1QF6A 4LCDE 1WTRA 2Y0SE 1YJ1A 3M62B 3ITPA 3BZKA 3ZRFA 4LLGM 2FINB 5D14A 1DYQA 4XZ4A 4K6LA 1XXGA 1FCLA 3TS2A 1SB3C 1S40A 5F2DA 1M8AA 2G3QB 5I2XA 3O65B 1I42A 3HOVG 3G48A 2ZPNA 2JA8B 4V0BA 1IPGA 2BH2A 1WJUA 1CTMA 1WXMA 1CKNA 2R93H 4HIKA 1K9MC 4GDLB 1IL8A 5GAHC 1CKOA 1IL2A 2UYZB 3PRZA 1TIID 3PLUA 4DHJD 4A3KG 3MXGA 2RSUA 5D2MB 4FDBA 4IO9A 3GTKB 1VZ8A 4I6PA 2PKOA 4MT5A 2BB6A 2IL8A 1BCPD 1EZ8A 1EFID 2RSNA 2JVCA 2KX3A 3CIRB 1F2YA 3N1ZC 2BKFA 4R9WA 1HTQA 4J15A 1P9DU 1WJJA 4UDUC 4DR6Q 2L12A 4JI7Q 4HWIB 1EWHA 2J0KA 3UI3A 4R4OA 2PVGC 1V8CA 2QSDA 3TEHB 1CKMA 3PIPA 1EWIA 3GTQH 4KD3A 5JJLA 5AUKA 3MHSD 4GN5A 1HHVA 2CHZA 3GE8C 4MGIE 3BG3A 3OTOQ 4B3SQ 1WJ4A 1IW7D 3Q6BA 1YI2A 5AEKB 2UUCL 3ONSA 1L0XB 2MLBA 3Q8BA 4XDCA 4A8XC 2WXQA 2OTJA 2UU7A 1CSQA 3KJPA 4NZLB 3A4SC 2L11A 1B1ZA 2B2VC 1N34Q 4CHKA 1KC8C 2JZ3B 3UE0A 1EQTA 3MEFA 4OEMB 2XK5A 2NN6I 1EO6A 4ME3A 1G6ZA 1J19A 4GLXA 2R2QA 2BA1A 1MSGA 2KNBA 4WJNA 4YCWA 5K5PA 3E3XA 4Q5VA 2L9HA 4ARIA 5T1GA 4P75A 1OTCA 1IUEA 1WX8A 4K5VA 4GKJL 2O5IC 3FKIB 2M0XA 5HG2A 4B3ML 2M1MA 2QF7A 2H88B 3RD4A 4PS3A 3VR9B 1JQ4A 3S1QB 2MBQA 2LRUA 1ZP0B 4JBWA 2RR9A 4TKNA 4KKSA 1GUGA 2G4SA 4QL5A 4PS8A 4NXMQ 2A4ZA 2RF4A 3DEPA 3ERQA 3JC66 4ZHOA 3TCAA 1SNDA 3SE0A 2MSED 5AUIA 1P3QU 3OPOA 2KCCA 2KEDA 2GBNA 1GUAB 1QVGA 3HRZC 3QHTA 5D3IB 1E1OA 2JYOA 1NI2A 4HLEA 1K8GA 1VQMA 1ICFB 5GQOA 2DN8A 3KLSX 4MZ9A 3C1EA 1VQDA 1PH8A 2GBMA 3P1MA 4HPLB 3KF8A 4LJPB 1AZPA 2UUAQ 4QIWB 1RIPA 3S15B 2MJ3A 3RNGC 2IY5B 3KDFA 1Z47A 5NUCA 4EFOA 2ZT9C 4FXGC 4CQNA 5C44B 1J5EL 4MJSA 2JA5G 4JYAQ 2LHEA 1K8MA 2F0QA 1H4RA 2ZVOA 5CBAE 1CM9A 3F8TA 1CSPA 5C3JB 2WINB 2K6AA 1T6BX 4LNQA 2CHWA 2DAFA 2WS3B 1IZ6A 3AE4B 2I46A 2QCPX 4OIKA 3W1GA 3V2TA 2K6DB 1Y1WB 4JI2Q 1HZ6A 4Q0FA 2QDLA 4C3JH 3VA7A 2JP1A 5JEAG 1A3VA 1GUSA 3PO2B 3ENEA 4A75A 4P1BC 1IBMQ 2K5WA 4C3HG 3SVMA 4IFDG 2UXDQ 2CH4A 1JOQA 2AMCB 4LFAQ 2HTME 4N59A 3WAPA 3VR4A 3Q3FA 1FGBD 3KLSA 3A1QB 1FR3A 4YWKA 5IT9c 3E56A 2OJWA 1SEBD 2R7ZB 5EBCA 2B2TA 3P42A 4G7ZC 3H6MA 2IWHA 3T16A 1N36Q 1X54A 3L9AX 4DV1L 4DR3L 4DUZQ 3BINA 1D6EC 4A93B 3AE8B 1S5FD 3H0GG 2QW7A 4C56C 1GAQB 2ZXPA 2D5GA 3HOVH 2QHOA 4ANXA 1GHJA 2Z6KC 4L5SA 2CJOA 2KANA 4W9GA 3AH7A 3BJUA 4IUPA 3VR5A 2ZXOA 1MG8A 3QQ8B 1E6EB 4P6VF 1WMHA 3VUYA 5HY6A 4DA2A 4P74A 3ICEA 1TWCB 2DYBA 4A3KH 1A15A 1TVXA 5GROA 1SE3A 4X6AH 2J0JA 2KN5A 5GXGB 3DHGC 4WQOB 2CH4W 5COYA 4ICUA 3U30A 2G45B 1Y1VG 2K52A 4DXGA 2E5LQ 4BBSB 1FXAA 2K3UA 4A20A 4AOFA 1K83B 3TEYA 4GOPB 5JZEB 1YQ3B 3QAQA 3PTFC 3L16A 1MJCA 1OXTA 2WACA 1EY6A 1ZDVA 3Q14C 2HD3A 2Z1CA 4IUUA 5FLXc 4B3TL 1VQCA 2JYEA 3N6RA 4V190 1SR3A 2HDLA 2ZJDA 4JI6Q 4CO7A 5LXHA 3IL8A 4KY5A 3CQZH 2E2JB 1HNWQ 3W9CB 2NVQB 2Z0DB 1KHIA 3G71A 2F52A 1ZXIA 2V4IB 2EVBA 5M3FG 2LFNA 1PUTA 4FJZA 2RCFA 3PCOB 3PSIA 3RZDB 1N9WA 3JAML 4P71A 2QDBA 2SOBA 1Q81C 2PCFB 4NPSA 3FRPB 1QILA 1C1YB 1VMPA 3TP8A 3HM6X 1JOKA 2CHBD 2K05A 1FNVA 2KHIA 2MGSA 5I6YA 1Q7YC 2BS3B 2KA7A 1H95A 2RBMA 2RSOA 1RDPD 1GUWA 1HA6A 1ZYRC 4AYBB 3P7JA 2ENBA 1GUNA 3L13A 4ARCA 4FF4A 1Q86C 3BVMA 2OTLA 1FVIA 3ZXVA 1HR0Q 1FMAD 3B08A 1GO3E 4BY7G 3CAMA 4FHJA 4W9JA 1A6XA 4JK1C 4CDDC 2K0PA 1BUVT 1GXDC 1V1PA 1TWAB 2WDQB 3HOVB 5IGFA 4WJ3M 1EIHA 1XMOL 2LXCA 3HZXA 2DJGC 2V4DA 3I4MG 2D2CC 1PH7A 3BVZA 2PQAA 1YN3A 1X3QA 2N9KA 2ZPYA 3SXHA 3HOZB 4JOIC 1MHHE 1UF0A 2MO0A 3WOFA 4DQOC 2WXGA 3PZ8A 3K7AH 4M1UB 1PGXA 2B2VA 4NAMA 1KAAA 1WI5A 2WP8J 3D3RA 2A6EC 4OWXB 3OMCA 1QUQA 1MI0A 3UDFA 3SK5A 2PPBC 2JA5H 5IT9L 4L2YA 1C9FA 4LNKA 3N32A 3K5OA 4OX9Q 4HJ8A 2JSVX 2INDC 5J2RA 3GTMB 1A5RA 3R2TA 3C0RB 2B63G 5IKCM 1PZKD 2JA6B 1FFVA 3RZOB 1C78A 1STHA 2G4DB 3MTNB 4NNJB 3S1NH 3ZDTA 5JEAH 4HRSA 1B7YB 3UQAA 4C3HH 4IFDH 4HJ9A 3R66C 3IT6B 4AJWA 5GAGC 1NCVA 2DJFC 2VXWA 1PTOD 1QCBD 1TXYA 3TP6A 5IYCG 1IBKQ 1HFNA 5HI1A 2JJQA 2JWUA 2EYLA 1YX6B 1EOTA 1DD2A 4PV1C 2IW3A 4W9DA 1PMRA 3CC7A 2R7FA 4BWGB 3EFUA 4GDKA 4KIKB 5G5HA 1WTPA 1E7PB 3EROA 4YWMA 2MBEA 1RLFA 4GIVA 5CV8A 1JWMD 4H44C 3E9SA 2KQ4X 1I50H 3H0GH 3LDZE 2HJ1A 4JI1Q 5FO9B 1DOIA 1RYJA 2I0QA 3D6WA 1STEA 4HVBA 1T0QC 3DVNU 3T3OA 2WB1E 2RVLA 2LMCB 1LQBA 3ZTCA 4OL7A 3CWIA 2IHEA 1W3SA 3FMCA 1DOMA 1YIJA 2EKEC 2K33A 2K32A 2KQ3A 1N5XA 5T8IA 3A9JB 3TN2A 3HVDA 4HJKA 2PTLA 4PMCA 2FCSA 3X23A 3PUYA 3ZO5B 4IW0A 1OEYA 2GOWA 4DNTB 1WM2A 3PRPB 1Y1VH 2ID0A 3D31A 3I72A 5FOBB 2IX1A 1C0AA 1PGAA 3PUZA 3AEAB 3ZRCA 2SDFA 1KABA 3BU2A 4FYDA 4FF3A 3D4DA 4GOPC 3QOLA 2BCOA 2UUBL 1YX5B 4HKZE 1DGSA 2F0FA 5EKLA 3FEWX 1EU4A 4XC2A 4WIPA 2A68C 5JH5C 2ACZB 4CGYB 4DHZB 5LL6S 2MH7A 2GBRA 5D94A 2MO1A 2ZCCA 4BFRA 1EYDA 4WRDA 3X3MA 3I55A 2IPKD 5BYSA 2WAQE 5M3FH 5CORA 5DLQE 2IYDB 1LT6D 1PFMA 4A3EB 2D0PA 2EXZA 2NN6G 4JI5L 1FJGL 1EF5A 4KGSA 3I9V1 2GLSA 3EA6A 2KFJA 5C4XG 2V3SA 4G11A 4RMFA 1JWUD 2EYOA 4UPAA 3VYRA 5E6OA 2EYHA 1WGHA 2KVZA 1HA5A 3IFWB 4XWWA 2Z6KA 2ALYB 2H4OA 5DPWA 1Z2MA 2MX2A 4B0MA 3NWSA 5J1ZA 3KWVA 4GDLA 1Y8PB 5E4WC 3QARA 3VH3B 2B3AA 3UF8A 2KXJA 1E8YA 3U8ZA 3A8IE 5C6AA 4HEDA 1I3QB 2BGFA 2JZPA 4DBGA 3FKYA 1TKYA 3H6NA 2L5TA 5CMDA 4DXAB 4NXNQ 2DWQA 2JXXA 1Q8IA 3KF6A 4BY7H 1K51A 3SEBA 2GMIC 2K25A 2IX3A 1EFWA 2BE5C 3L2PA 3VRBB 2KTFA 2R2OA 2K9XA 3I3CA 4DN4M 2PZWA 2KN4A 2LJIA 2E75C 1XEEA 5KEEA 3Q22A 4LF9L 3SDZA 3KYDD 1LTSD 2I2YA 5E1FA 4DV7Q 4TQUS 1ZEQX 4IN3A 3I4MH 3ZUNA 2IY0B 3TBIB 4FF1A 5GADC 1WR6E 5M5YH 4M8AA 4A3FB 1A62A 2J7QB 3T1HL 2N9EB 4GLSC 2EPBA 5CV6A 1VS0A 3ML8A 1XLNA 5ELFA 4J8QA 4DUYL 2UXBL 4K81A 4WURA 1E1TA 4K8IA 4ZLTF 4C1NK 3EBEA 1STGA 1PV4A 3AU4A 5JPNC 4HEA1 1K3BC 1H9JA 5EDSA 3HGBA 2KDFB 4B9WA 1JMLA 1WE6A 1JW9D 1VQKA 2SNSA 3CD6A 2LZ6A 2DZIA 4UP8A 3NBHA 1E0BA 2Y5CA 2X6LA 3EHVA 2B63H 2Z0SA 1Q10A 1IYUA 4H02A 4U68A 5C4ZA 1BT0A 1UELA 1NJIC 4BAXA 4JG2A 1UAPA 2A6ED 3J81E 2JSOA 3PLVA 2D62A 4A3JB 1HEZE 2CQAA 2VZKB 1AWDA 2E2HH 4M8NA 5IYCH 5IWAQ 1XF5L 4DV4L 2A19A 2G5DA 2KD0A 3PHXB 1EY0A 2J52A 4JOIA 4F88A 3S1MH 1FL0A 1OO9B 4KN4C 5CV7A 2JA8G 1ROEA 2F0TA 1EQVA 3EFCA 1QG7A 1TWHH 3S2DH 4W9HA 1XTDA 3GTGB 4HDQA 2M19A 4OVVA 4LF7Q 3GP7A 3GDEA 3U50C 1I6VC 1Q82C 2MFIA 5BN5A 5E7NA 4R3DA 4DFAA 2KCTA 5HFYA 3SK8A 3DMUA 1PA6A 4UY8C 1N32Q 2ZJPA 3L17A 5C0XJ 2K04A 3B2GA 4GXBA 1Y56A 3ZYYX 5DCNA 1WGYA 3TMPB 4HMJA 2Q2IA 4XIGS 3NVZA 2C9OA 2NVYB 2ZM6Q 2LVPA 1X3FA 1WYGA 4NJ6A 3IFDA 3IXSA 3EFXD 4YY3L 1QZGA 2Y0SB 3V6EB 2KVMA 4QB4A 1KRTA 2HHHQ 4AWJA 5M5WH 1N5WA 1SFOH 4XDXA 3NJTA 4DV3L 4X3TA 2ONQA 4ZUJA 3A1QA 4A3CG 1ZKHA
chains in the Genus database with same CATH topology
2CW0C 4MACA 3HG9A 3LWEA 2XRSD 1SAPA 1U4LA 2JE6I 4BA1I 4HTHA 1Q12A 1T5XD 4A3GB 1RCVD 3S2HB 1J8IA 2L83A 1D5XC 2KWDA 4N6EB 4Q2JA 4LMQD 4WQMA 3NUHB 1KLGD 2A68D 3LX0A 4F8MA 1MBYA 1FD6A 3K6OA 1V43A 3Q0AA 2E2HB 3H3VC 3S1RB 2YYZA 2F3WA 5ELCA 2O2LD 4HN7A 2FE8A 3EJIA 3KBXA 4FNFA 3E0JA 1XX8A 1ENFA 1WCMB 4N9TA 3S2DB 1BOSA 1FNWA 4ODGA 1I4GA 2PMVA 1JR0D 2M00A 1BNZA 3T51B 3C1FA 3F2UA 2E6XA 3MXUA 4RHSA 3NTKA 3HS0C 4RHRA 1LTTD 3DWMA 3K5LA 3SK4A 1A2UA 3TP7A 2K5DA 1IBXA 1EYCA 1U4PA 5DNFA 4ZQ3A 4YTPB 2VB3X 1UEAB 1IGCA 1GUTA 1SFOB 2EE1A 4YSYB 1H9SB 3TSSA 3P63A 2G9HD 2BT6A 1C4AA 5ELDA 4KX6B 4XXEA 3NZ3A 5FR3A 4FF2A 2JXMB 1SIJA 2DBYA 1ILQA 3WDNA 2L1AA 2RQXA 1F2LA 5HHDG 1EY8A 1TKGA 2ZXRA 2Q8TA 4L6TB 1ONLA 3V3XA 2HCIA 4XYQA 2PIAA 4KN7C 4HCSA 2K01A 4OW0A 2Z4HA 1YNTE 1FD7D 1LABA 1PRTF 3X3NA 3SHLA 2L55A 3HP3A 3K57A 3PMFA 4NP5A 2IDYA 2WIIB 1EIGA 1PZJD 2W3RA 1HQRD 4HCEA 4UAIA 4FXKC 5BN4A 2PQEA 3NHHA 1KF6B 4G7HC 3QB3A 3GD7A 1O78A 2E74C 4TRDA 1E10A 2FMMA 5KNCA 4ZOHC 1OXXK 4RA8A 3J80E 2W3SA 2EYFA 1C4CA 1NVID 3GTJB 1SYDA 5EKIA 2RPVA 4KJNA 2PZTA 1K8OA 1PGBA 4ITKA 4CBVA 2F0IA 3LYYA 4C2MB 1PFBA 2B8GA 5FK9C 2IJ0A 1LT3D 2PMZB 3EGRA 1EY9A 4IKGA 1H9KA 3NK9A 3PIO3 3VRAB 4MIUA 3QG1A 2LMCA 2CW0D 1HZ5A 1I4RA 4RGNA 1DONA 3DXJC 2VNUD 1QE6A 1D4BA 3EVQA 3U9OA 1K53A 1F0ZA 1RODA 3I4LA 4D2KA 1TY2A 2JU6X 5EE1A 4JX1C 4HKQA 1LV9A 1VF7A 1YNJC 3SFDB 2I07B 3I91A 3EUB2 2NZ1D 2N0SB 1ZXHA 3DWGC 2F0HA 3R3OA 2GRIA 2RDHA 3DWAA 2LFIA 4B9XA 1ET6A 1L0VB 4PNYA 4FVMA 3P4SB 1ET9A 4K2KA 4QUFA 5M3MB 1CQFA 1HXYD 1JWBD 2LS01 2QIEB 4CKEA 2VUMB 3VR6A 1SYBA 3OMGA 1D5ZC 2BBCA 1GPXA 4ID6A 1ML0D 2WXHA 1R4QB 1EEFD 2WXKA 3AN1A 3MHZA 3LWUA 3NP8A 3I73A 2JEBI 4EE2A 2DNCA 2K22A 1HTPA 3DHQA 4DU9A 2BS4B 4KK7A 3ABVB 4AS1A 3Q24A 4O42A 3M3YB 1B9NA 1PDXA 1S5DD 1JE4A 3K5NA 3C3LA 2KMMA 4LTUA 1TS2A 4BBRB 1SYGA 3QO2A 1GUOA 2KEEA 2RA4A 3C2PA 2EY6A 1E2ZA 2FUG1 2EOTA 5JOBA 1HRJA 3NE5B 4RKBA 3IKJA 4CJ2C 3R93A 1UGJA 3HUIA 5H92C 3AM9A 2NVXB 3MC0B 2WB1B 3BDLA 1ESRA 4K2LA 2RMMA 4USAA 4ME5A 1J7BA 5JEAJ 1QOBA 1SYEA 1EEID 3MAQA 2WDRB 4X3SA 4IFDJ 2IGGA 2YU9B 1A3TA 1ACCA 1TZOA 2F0EA 1XWEA 3KBGA 1D1KA 1KLUD 2EY2A 2AQ1B 2CVRA 1LACA 2XNAC 3H09A 3M4YA 3R8BA 1B9RA 4DNRB 3B2FA 2SNMA 4TMAB 4K6DA 3V05A 4KTAA 2EJGC 5A35A 2HUGA 1N60A 4C80A 1QB5D 2WXOA 2WAQB 4DAPA 3QJYA 1SYCA 1C77A 1ENAA 2V3NA 4ZHPA 4XDDA 2PO4A 1MVKA 1BDOA 4HR7B 3J9CA 1DJRD 3T13A 1SYFA 2FHTA 5C5MA 1LO5D 2E76C 5G3LF 2F0LA 1TWGB 1TQOA 3N9YC 3FPUB 3VQIA 1Q90A 2A69C 1WVLA 1IKMA 4ZRQA 2BDOA 1X32A 5KNBA 2K1BA 3HOXB 3PZ7A 3MHBA 3FILB 5ELEA 3OWFA 3I70A 4RNAA 3BDOA 1YNJD 3Q6SA 3HOYB 3BVGA 1E2WA 1T3QA 1KRHA 4IDIA 4US8A 3ZJUA 4N58A 3ZGZA 1ICWA 2EYMA 3IAYA 4ZK9B 4IUVA 4OO1I 2NUCA 3HOUB 1SE2A 3S17B 3AEEB 1QOAA 4KJOA 1PRTB 4CKCA 4A3DB 2EYPA 1NAPA 1H9MA 3AMUA 2E2IB 1NEKB 5LNK1 4G7OC 1SNPA 4IUQA 2WQYB 1TYGB 1L5PA 3NSWA 3ZJTA 4MN3A 2M56B 1F77A 1B53A 3EQLC 4KKIA 3PUWA 1EY4A 2DLBA 1H9SA 4KKJA 2E2DC 1HUNA 2AWOA 3AEBB 5CV4A 3PO3B 1QOGA 1SNOA 2X38A 3A56A 4YXDB 3TEWA 5EQ0A 4A3IB 2K28A 1VJKA 2LUMA 3K59A 5DM63 2J7ZA 2G1EA 2N88A 2V3PA 2JX5A 2N7JA 1MPEA 4MH8A 2WDVB 4NKLA 3ONAB 4HMIA 1OXUA 3GTPB 1HPCA 4KKTA 5IGDA 4P2CB 2LGIA 3OWEB 3HEJA 5EBDA 2LKVA 5MPOA 3KUPA 5ISRA 3PUVA 1NI3A 2AQ2B 5KYIA 4PT5A 3VA5A 1HQMC 2C5CA 2B76B 4YWGG 5IIFA 4ILWA 3PIP3 5I9OA 4EQNA 4PQXA 2ON8A 3AECB 2GI9A 1NSNS 1LT4D 4PMWA 1PYWD 3Q8CA 1CA5A 2I38A 4L8JA 1SSOA 3U7ZA 2Q8RE 3WCQA 1N62A 2QILA 2J42A 3CKIB 3S16B 4RGOS 4QMGA 3HKZB 4RFBA 4Y7NB 4O1NA 1R9TB 2N9LA 1VDZA 2Q8IB 2HDMA 2KCNA 1FCCC 1OQRA 1KDAA 2A69D 3AE6B 1NR2A 5FLXE 1PTOF 1C79A 2G9DA 4JWSC 1J7AA 4FXDA 4KHVA 1AZQA 3OOCA 1IKLA 5KRUA 1FM0D 1VLBA 2L4NA 1B50A 1LTAD 2RDGA 1VRAB 5M9OA 3GV6A 1SNQA 1L0YB 1PRTC 2F1MA 4MHEA 5EPKA 2DYMA 1XTCD 4R8NA 3A54A 1ZYRD 3GO5A 1BQQT 3S14B 3DWQA 2W54A 3O13A 1O7YA 4H13C 3B9JA 4FP5D 1JROA 3FDTA 4X3KA 4ZRZA 2NYZD 1Q3LA 4OZBA 3T4AC 3GQBA 5AFWA 2DY7A 4C3IB 1P7FA 4ZRPA 3ZJVA 2K5QA 5E3FA 3L7ZC 1V1OA 2EJFC 2OEOA 2H1EA 2HQEA 2A73B 2WKDA 2OEDA 5JPMC 1WTVA 2CJNA 2F0PA 1MHXA 1G2SA 3IFTA 3VYTA 3Q69A 2PYKA 3NPPA 4DGZA 4I65A 2MEKA 5BYQA 1JC7A 1XLPA 5I4DA 2NBFA 2WXFA 1D2BA 1JORA 2ZW1A 4NW2A 1EWCA 2F0NA 5EPJA 5J39A 4DF7A 1MD2D 2R3ZA 3TZDA 2BDNA 1RTOA 2BW2A 1LTID 3TMEA 2K03A 2A6HC 1YN4A 1UWXA 3TUOA 3AMZA 4DAVA 5BYRA 1QJOA 1CT1D 4XE0A 4G4KA 4P16A 2AWNA 3BZDB 1WRIA 2WXPA 1CHQD 2IX0A 4EQPA 4JPSA 1DOXA 4IOIE 1SXTA 1CA6A 3BWUD 3OW7A 3AE3B 4JE3B 4A55A 1LTGD 4A3MB 4G57A 4K14A 3P75A 1CFMA 2MPMA 1STNA 2PW9A 3HVZA 3U52E 1M4VA 2GA4B 1AP0A 1S5BD 3H94A 3NXWA 1HCZA 2B2UC 4OIJA 2X69A 2OHFA 3ND8A 2J53A 3E5SA 2WXNA 1JICA 2W55A 1B44D 2YEPB 1ILPA 1SBBB 3Q8AA 1VF5C 3OSOA 2R6GA 4OO1G 1TWFB 4YTNB 5E6JA 5IODA 1K50A 1FFUA 1SMYC 2IGDA 4HROA 1JOOA 2EY1A 1ZE3D 1Y8OB 1SJED 3ETRA 1DCZA 3CRLC 2MP1A 2BYTA 1WTXA 4KY7A 2OXPA 4ZAIA 2LHDA 4H7BA 3L4PA 1F9QA 3RUZA 1J7CA 3N52A 1Q1EA 3HOWB 2MUYA 1QOFA 3TDQA 3FILA 2K5PA 4JWUC 2XWJB 3LXFA 2BE5D 3IT4B 3NVWA 1YN5A 2DNEA 3AU7A 1PRTD 1C76A 1IHZA 1J9OA 2WLBA 1VZ7A 1JB3A 1WWTA 3GS2A 3DM1A 1WSPA 1XLQA 5JJZA 1GHKA 1QNUA 2A74C 1U4RA 2KAJA 3H91A 2PNRC 2Q5WD 4IZ8A 3SK6A 1U4MA 4WJWA 4RF1A 3FPPA 5A2QE 5T1IA 5EGTA 1RFKA 1FNUA 4XYOA 1QQRA 1KTKA 2NVTB 1RHPA 3GTLB 4CJ0B 1BO0A 4BY1B 2WXRA 5IGGA 1CZWA 4KI0A 2AX5A 2NB0A 5CR3A 4DAYA 1DOYA 1QWYA 4XQQA 1YJIA 3G7LA 1CZGA 3I57A 1DOLA 1NUCA 5CV5A 1JRPA 3Q23A 1XO3A 3KQ4A 2JQRB 1WTOA 3AE1B 2Z8LA 1WGKA 5BMHA 4PMBA 3TZUA 1BUIC 1BXTA 1E9MA 1A3UA 5G5GA 1FRRA 5EJWA 1HTLD 4IALA 4OZCA 5C0XH 2PVOD 2DY8A 4YSZB 2XVSA 2F0VA 3CHBD 1L6VA 3P20A 2QKIC 1EY5A 1KDCA 3BYTB 3AEDB 3AB5A 4LK0M 1PTOB 1F9PA 1CI3M 2F3VA 3D4WA 3SR6A 1KNEA 4K8JA 2JA7B 2QJLA 2D5DA 4HSVA 4OO1H 3J7AV 3TEXA 3T3NA 1XCQL 1JCKB 1ZOYB 4EQOA 4IUNA 5C3EB 3D6CA 4KKUA 2XSCA 2F0OA 4E6IA 2WXMA 1C4PA 2EZVA 5CYUA 1I4PA 1DZ1A 2RDFA 4C7ZA 4B0EA 1SMYD 3P4PB 2MJ8A 2F0MA 1RWSA 4QUCA 1ZKOA 2B2UA 1O80A 2FMCA 3NTIA 1N61A 4X3UA 4AQ7A 5C4JB 3SR1A 4GZYC 2WNMA 2BOSA 1QLBB 3K0YA 2B39A 3U9SA 1FIQA 3NWTA 3TP5A 2F0JA 1Y8NB 3SFEB 1TS3A 4XQNA 4LK1C 2FFKB 1QNKA 3I4NB 1SF0A 2EY5A 2NMQA 3U4EG 1DM0B 4WAFA 1STAA 3MA2B 3MVVA 2AQ3B 5HGTA 5M5XB 3AEGB 1KH0A 4RAUC 5IOCA 2AUJD 1EY7A 1H9RA 4H0LC 1D5MC 1Z6HA 3E6ZX 2IT1A 1PXUA 1I6HB 5K36G 4EGVA 3DUZA 3P1HA 4ZUIA 4WH4A 1ENCA 4KGTA 2N55A 3PO0A 1I7HA 4QCLA 2VZKD 3NTHA 2J0TD 2KJXA 1YQ4B 4XT1B 3P4RB 5D65A 1SE4A 3MEHA 1PDQA 1BCPF 3CU7A 4WWMA 3NBIA 2WKCA 4B08A 3NVVA 3AE7B 4A3BB 5IGBA 1KFYB 5JXVA 3AE9B 2R93B 1R7SA 1SJHD 1AW7A 4LAAA 4A9AA 5ELBA 1GOZA 5G3LD 2MJEA 3GTOB 2KDMA 4FXCA 1CQVA 2XN9C 3MXNA 2F0KA 5I6WA 4N9PA 1PTOC 1F9RA 4TKOB 1QKZA 2NWGA 3GTQB 2HCCA 3NRZA 1L6UA 2ZW0A 3FC4A 4DXFA 3MFGA 5I9PA 2BS2B 4MM3B 4HSPA 1TS5A 1GB4A 3M85A 2JYTA 1OXSC 4CHTB 3K58A 4US9A 2E3TA 4TQ1A 3VR8B 4C3IG 2FJ2A 1RJTA 3RFZB 2OT2A 1CHPD 5DEHA 1YNNC 2D9UA 1WTWA 4HJGE 5TSSA 4L63B 1LTBD 3KWLA 3NQTA 3MP9A 4F7XA 3IAM1 3S9WA 2VB2X 5C4HA 5EE9A 4IURA 1YMHE 2W82A 4RWSC 2MHVA 4XWTA 5C0XI 3A7AB 1TS4A 1RTNA 3AV8A 2EJMA 1I4HA 2B2WC 1S5ED 5LHY1 3G6JB 4M0WA 3MFYA 4F87A 1Z7TA 3Q8FA 2YEPF 1V97A 1IGDA 3URYA 3I90A 2INNE 3W3AA 3LNNA 5K36H 1BMLC 2Z4IA 1I4QA 1IBXB 3DEOA 4C3JB 1G2TA 5H8YE 1EZ6A 1RF2D 5C3WA 4ZKCB 1WXQA 1WTQA 2INPE 2WV6D 5FO7B 1UNSA 5E4XA 5J22A 3BIID 3JAME 2K7VA 1K52A 1STYA 5C2TB 3M7GA 3TEZA 1BR9A 4NMZA 4RCOA 1XCTL 2F4IA 1TJEA 1A2TA 1LT5D 1D1IA 5FKAC 4A3KB 5LL6X 1ZPSA 4RH6A 1JWSD 2SEBD 3R2IA 3QWNA 4L23A 2L0CA 3OHXC 2O4XA 1S5CD 4KY6A 3W1SA 1I4XA 4S3SA 2XWBB 2EYJA 3W2DA 2WXJA 3LB8C 4J6HA 1B3AA 4TSSA 2XRQD 1XLOA 3CQZB 2LY7A 5DM73 4WORA 5D3DA 4LJZC 5BMGA 2O5JC 4YT0B 3MWYW 1RM6C 1TY0A 1SNMA 1ZDXA 5IT9E 5D7GA 3H8HA 1VDVA 4KMUC 3HRDD 2KUMA 1XYIA 2J4XA 2OF1A 4RGTA 3BYYB 1WD1A 2NTTA 1FYCA 4NAWB 3J7AF 5FLXL 2L32A 1AEXA 1LTRD 2NTSA 1HFGA 1PFNA 3ND9A 3BDCA 3A8JE 1R4PB 2Y5PA 3VYSA 1II3A 4KHZA 5BN3A 1B4OA 1YNND 4RGMA 2HDEA 3AE2B 4TQ0A 3K7AB 1KNAA 4CKBA 3AB9A 3FVQA 2IGHA 1P7EA 2JA5B 1MI2A 3NVYA 2R61A 3T56B 1JALA 1MSHA 1BBXC 1DXMA 1NR4A 2PW5A 3VR2A 1DGJA 4FO2A 2ICIA 1PZID 4ZKBB 2SAKA 1TT2A 3BK2A 3L3OC 5CC4A 3KLRA 4ZYSA 3K5MA 5C5LA 2B2YC 1NYRA 3S1NB 1B9MA 4OGQC 1OFFA 4C3HB 1CZPA 2F0SA 1V8QA 2WU2B 3IAS1 2AUKA 3W5UB 5JAVA 1BCPB 3A8KE 1T5EA 3VYUA 3J81L 4J1MA 3AEFB 1N63A 4NJCA 2M9VA 2PW7A 1Y69U 3KK7A 1GB1A 5KIXA 2B2WA 3PV0A 1I50B 4ULLA 3H0GB 3M7NA 1E0ZA 2BA0A 2WP9B 5EE3A 1U9RA 1NYQA 3D8GA 3W5VB 5FO8B 4ABNA 5I2YA 1DOKA 4IQZA 1CJEA 1STBA 1Y1VB 1VZ6A 4I7ZC 5JVG3 2B8FA 2Y3AA 2F0GA 5BMIA 3C46A 1CK1A 1Q1BA 3PUXA 3I8ZA 5HURA 1TKWB 2FBWB 1FXIA 5IGEA 1TR5A 3RMHA 3T53B 5M3FB 4J3OD 4IUTA 3OIQA 4RKLA 1HUMA 1O7LA 1E2VA 5CV9A 2EDGA 1VR9A 3ZQ4A 3A55A 4OZAA 1PLFA 4XTCS 4H2AA 1PFDA 4BY7B 3FAHA 1FO4A 2XIWA 1FEHA 1W6KA 3UI2A 5C0XG 5CGKA 1L4ZB 2EELA 1UUPA 1TKEA 3DWPA 4C7YA 1AFPA 4KGRA 3I4MB 1EYAA 1LLRD 3GB1A 1C48A 5IGCA 5M5YB 5EKKA 2F0UA 4R8IA 1ESFA 1S4ZA 1G291 4DK0A 5EE0A 1EL0A 4REZA 4CJ1B 2LEKA 3BK1A 4A90A 4K5XA 2NN6H 3J7YW 5KGUA 2B63B 1O7ZA 4RCNA 1MGSA 1JQYD 4IFDI 3Q8EA 4L1BA 2TMPA 2RKSA 2PZUA 1SSNA 2KOLA 1BCPC 4XQJA 1EM7A 4QF4A 3S1MB 2QMTA 2PLPA 1VCIA 1L4DB 3D4RA 1TWHB 4KV6A 1SNCA 4A6QA 1UWMA 1IYVA 2GB1A 3MXPA 2TSSA 4XT3B 5A2QL 3AE5B 3RLFA 1C8CA 3MZ5A 1G91A 1IW7C 2JEAI 2KECA 5EPLA 1BF4A 5DAUA 1SDFA 4KD4A 4YIJA 3VR3A 2M0AA 1PTOH 2V0GA 1X3PA 1V1PB 4YTMB 2JXTA 2B2YA 4WFN3 4BA2I 1F2MA 5KYLA 3U2SC 4RF0A 5M5WB 5C3XA 1OQQA 4Z9CB 3A7LA 2KACA 2WXLA 4EVOA 2ICEC 5JVH3 1EU3A 3J80L 3NS1A 2L52A 2F03A 1C4QA 1QOHA 2A5HA 5C4XB 1RD9D 4BS9A 3QOJA 2WU5B 3BS1A 1F2RI 1AYFA 2DYOA 3QIAA 2QEJC 3V96A 4OHJA 2A6HD 1F2RC 1FRDA 3MJ5A 2F0WA 3GV3A 2H89B 2BTEA 1G8ZD 3C8YA 2F0DA 5CBEE 4OVZA 2X6GA 1JWAD 4U673 1F9SA 2M2LA 1ZUD2 1GJXA 3MTSA 1TU2B 1KDBA 4YSXB 2B2TC 4GDKB 3OIPA 1EWYC 3M4OB 2CU3A 3WOEA 1VMCA 3P4QB 2L1BA 3CRKC 5KNDA 1AN8A 2MJDA 1A70A 1RKNA 1OXVA 4K5WA 4DK1A 3NUCA 1YJJA 1ZXTA 2BB5A 1NENB 1QT9A 1WD0A 2R92B 1F2ZA 4HAEA 2WXIA 4C3JG 3RPFC 1W6JA 2EKIA 3NQIA 1B2TA 4C1NI 2KHSA 4NDXA 1QF6A 1WTRA 3ITPA 4LLGM 2FINB 5D14A 1DYQA 4K6LA 1XXGA 1FCLA 1SB3C 5F2DA 1M8AA 5I2XA 2JA8B 4V0BA 1CTMA 4GDLB 1IL8A 1TIID 3MXGA 3GTKB 1VZ8A 2PKOA 4MT5A 2BB6A 2IL8A 1BCPD 1EZ8A 1EFID 2RSNA 3CIRB 1F2YA 4R9WA 4UDUC 2L12A 1EWHA 3UI3A 2PVGC 1V8CA 2QSDA 4KD3A 5AUKA 1HHVA 3BG3A 1IW7D 4A8XC 1L0XB 3Q8BA 4XDCA 2WXQA 4NZLB 2L11A 1B1ZA 2B2VC 1EQTA 2NN6I 1G6ZA 2BA1A 1MSGA 5K5PA 4Q5VA 2L9HA 4ARIA 5T1GA 1IUEA 4K5VA 2O5IC 3FKIB 5HG2A 2QF7A 2H88B 3RD4A 3VR9B 1JQ4A 3S1QB 1ZP0B 4JBWA 4KKSA 1GUGA 3DEPA 3ERQA 4ZHOA 1SNDA 3SE0A 5AUIA 3OPOA 2KCCA 2KEDA 3HRZC 5D3IB 2JYOA 2DN8A 3KLSX 3C1EA 3P1MA 3KF8A 1AZPA 4QIWB 3S15B 2MJ3A 4CQNA 1Z47A 5NUCA 2ZT9C 4FXGC 5C44B 2LHEA 1K8MA 2F0QA 5CBAE 1CM9A 5C3JB 2WINB 2K6AA 1T6BX 2WS3B 3AE4B 2I46A 2QCPX 4OIKA 3V2TA 1Y1WB 1HZ6A 4Q0FA 3VA7A 2JP1A 5JEAG 1A3VA 1GUSA 3PO2B 2K5WA 4C3HG 3SVMA 4IFDG 1JOQA 2HTME 4N59A 3VR4A 1FGBD 3KLSA 1FR3A 3E56A 1SEBD 2R7ZB 5EBCA 2B2TA 3P42A 4G7ZC 3H6MA 2IWHA 3T16A 3L9AX 1D6EC 4A93B 3AE8B 1S5FD 4C56C 1GAQB 2D5GA 2ZXPA 1GHJA 2CJOA 3AH7A 4IUPA 3VR5A 2ZXOA 1E6EB 4P6VF 4DA2A 1TWCB 1A15A 1TVXA 1SE3A 5GXGB 5COYA 2K3UA 4DXGA 4BBSB 1FXAA 1K83B 3TEYA 1YQ3B 1ZDVA 1OXTA 2WACA 1EY6A 2Z1CA 4IUUA 2JYEA 3N6RA 4V190 2HDLA 3IL8A 4KY5A 2E2JB 3W9CB 2NVQB 1ZXIA 2V4IB 2EVBA 2LFNA 1PUTA 3RZDB 3JAML 2QDBA 2SOBA 2PCFB 3FRPB 1QILA 1VMPA 3TP8A 1JOKA 2CHBD 2K05A 1FNVA 2MGSA 5I6YA 2BS3B 2KA7A 2RBMA 2RSOA 1RDPD 1GUWA 1HA6A 1ZYRC 4AYBB 3P7JA 2ENBA 1GUNA 4ARCA 4FF4A 3BVMA 1FMAD 1A6XA 4JK1C 2K0PA 1BUVT 1GXDC 1V1PA 1TWAB 2WDQB 3HOVB 5IGFA 1EIHA 3HZXA 2V4DA 2D2CC 3BVZA 1YN3A 1X3QA 2N9KA 3SXHA 3HOZB 1MHHE 3WOFA 4DQOC 2WXGA 3PZ8A 4M1UB 1PGXA 2B2VA 4NAMA 1KAAA 2WP8J 3D3RA 2A6EC 3OMCA 1MI0A 3SK5A 2PPBC 5IT9L 4L2YA 1C9FA 3K5OA 2JSVX 3GTMB 3R2TA 1PZKD 2JA6B 1FFVA 3RZOB 1C78A 1STHA 5JEAH 4HRSA 4IFDH 3IT6B 1NCVA 2VXWA 1PTOD 1QCBD 3TP6A 1HFNA 5HI1A 2JWUA 2EYLA 1EOTA 1DD2A 4PV1C 2IW3A 1PMRA 4BWGB 5G5HA 1WTPA 1E7PB 3EROA 5CV8A 1JWMD 4H44C 3E9SA 2KQ4X 5FO9B 1DOIA 1RYJA 3D6WA 1STEA 3T3OA 2RVLA 2LMCB 4OL7A 3CWIA 3FMCA 1DOMA 2K33A 2K32A 2KQ3A 1N5XA 5T8IA 3TN2A 3HVDA 2PTLA 4PMCA 3PUYA 4DNTB 3D31A 2ID0A 3I72A 5FOBB 2IX1A 1PGAA 3AEAB 3PUZA 2SDFA 1KABA 4FYDA 4FF3A 3D4DA 3QOLA 2BCOA 4HKZE 2F0FA 5EKLA 3FEWX 1EU4A 4WIPA 2A68C 2ACZB 4CGYB 5LL6S 2MH7A 1EYDA 4WRDA 3X3MA 2IPKD 5BYSA 5CORA 1LT6D 1PFMA 4A3EB 2EXZA 2NN6G 4KGSA 3I9V1 3EA6A 1JWUD 2EYOA 3VYRA 2EYHA 1HA5A 4XWWA 2H4OA 4B0MA 3NWSA 5J1ZA 3KWVA 1Y8PB 5E4WC 3A8IE 5C6AA 4HEDA 1I3QB 2JZPA 1TKYA 2L5TA 5CMDA 2DWQA 1Q8IA 1K51A 3SEBA 2IX3A 2BE5C 3VRBB 2K9XA 3I3CA 4DN4M 2PZWA 2KN4A 2LJIA 2E75C 1XEEA 5KEEA 3Q22A 3SDZA 1LTSD 2I2YA 5E1FA 4TQUS 1ZEQX 4IN3A 3TBIB 4FF1A 4M8AA 4A3FB 4GLSC 2EPBA 5CV6A 1XLNA 5ELFA 4J8QA 4WURA 4K8IA 4ZLTF 4C1NK 1STGA 5JPNC