2AQ2B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
b'SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR BETA CHAIN V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq2B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq2B01
4RGMA 1ET9A 2IPKD 1PTOF 1ET6A 1JWUD 1S5CD 2RDGA 1EWCA 4UDUC 1EFID 1EEID 1SJED 3O13A 1HTLD 1LT5D 1T5XD 4TSSA 3BVZA 5ELEA 1PRTD 1AW7A 2AQ2B 2Z8LA 1QILA 4NZLB 1TS2A 1JR0D 1SE3A 1EU4A 1I4RA 1EU3A 1V1OA 1FD7D 1F77A 1PRTF 3GP7A 1SEBD 1I4HA 1SBBB 1PZKD 4L6TB 1BCPC 2XRSD 1B44D 4L63B 1S5FD 3DWQA 4DXFA 2QEJC 1JCKB 2XNAC 4OHJA 5FK9C 1XTCD 2R61A 4RHSA 1LT6D 2G9HD 1LTBD 2J4XA 1CQVA 1YN3A 1CK1A 1RCVD 1ESFA 1YN5A 1CHPD 3TSSA 1LT4D 2WV6D 3BVMA 1RF2D 1I4XA 1TY2A 1KTKA 3SEBA 3URYA 1B1ZA 1DJRD 1RD9D 4RGTA 1TY0A 3BZDB 1GOZA 4ZYSA 1SJHD 1CT1D 1JWSD 1STEA 1XXGA 1D5XC 1FGBD 1I4GA 1TS5A 1UUPA 4RCOA 1S5DD 3BVGA 1CHQD 2NTSA 5ELCA 2O2LD 1FNWA 5I4DA 1TS4A 1S5ED 3W2DA 1HXYD 4RGOS 1PTOH 1LLRD 1SE4A 1BCPD 1MD2D 2TSSA 5ELFA 5ELDA 1D5MC 1V1PA 1FNVA 1PTOB 5D3IB 1BCPF 4BWGB 5TSSA 3V05A 1AN8A 1V1PB 2IJ0A 1LO5D 1PTOC 2ICIA 4Z9CB 3R2TA 1HA5A 2AQ1B 1LTID 1G8ZD 4K6LA 1D5ZC 1ENFA 3R8BA 1LTAD 1YN4A 4DXGA 2SEBD 3R2IA 2AQ3B 1PRTB 1JQYD 3OWEB 1PRTC 5ELBA 1I4QA 1S5BD 3CHBD 4RGNA 1TS3A 1HQRD 2QILA 3DWAA 3EFXD 1LTRD 1M4VA 5D3DA 1SE2A 5FKAC 1PZJD 1KLUD 2RDHA 4RHRA 1SXTA 3EA6A 1I4PA 1BXTA 2NTTA 1BCPB 1LTSD 3BYYB 3MFGA 4C56C 3DWPA 2CHBD 1RDPD 1FNUA 1LTGD 1UNSA 3KLSX 1PYWD 4O1NA 3MC0B 1PZID 1LT3D 1JWMD 4RH6A 1DYQA 2XRQD 1EEFD 4RFBA 1PTOD 2XN9C 3BYTB 1L0YB 1L0XB 1D6EC 1KLGD 1LTTD
chains in the Genus database with same CATH superfamily
5J1ZA 3NZUA 4GKKL 1WD0A 2LZ6A 2BQQA 4CDFC 4IJLA 2YLMA 1SRUA 1PTOF 4XGAB 1TT2A 1YBYA 1PGBA 2K6AA 1JALA 1HNZL 3VR5A 4LUOA 2O6VA 2E2JB 5LXHA 4GDLB 4N9F4 4TSSA 1LXDA 2ZPNA 1AW7A 1WGYA 3HOYH 3W5VB 2R6GA 1EU4A 1WTOA 4NQLB 3J80i 3GTLB 2KFKA 4GDKA 4W9KA 3WALA 4YT0B 2G4SA 2Q8IB 4H2AA 1VJKA 4W9GA 2BDNA 1BCPC 2AL6A 1WMHA 2BPSA 5IYCG 4KLKA 3L13A 4TKOB 2QEJC 3DM1A 3I4OA 5E4XA 1WX7A 2WB1G 2WXMA 4WWOA 1LT6D 3BG3A 4XWTA 4IUPA 2PE9A 3JAMc 2RCNA 1E10A 2X6LA 2JA7G 2K5NA 1U4AA 1CHPD 4LK1C 1EY7A 2WDVB 1LT4D 4J1MA 3STBD 4ME3A 4M00A 4L2YA 3H91A 1RF2D 2CWPA 2A6HC 2DYMA 2N9PC 2JWZA 3L16A 2N7JA 1M90C 2DN8A 3APDA 1SYGA 1SJHD 2A19A 2V4LA 2MBOA 3CCQA 1E2WA 4AQYQ 2L7RA 1D5XC 2EYOA 1HNXQ 3ZJTA 2EYPA 2SOBA 5BN4A 2LUEA 3IT6B 4ZRIA 4NP5A 1AFPA 1ML0D 1VQGA 3CQZB 4A3PA 1TWAB 3CD6A 1GUWA 2RCFA 1XF5L 2IGGA 2WDRB 4UPAA 4JI3Q 2VQFL 1H9SB 1ZKOA 3TZDA 1J19A 3DBRI 3OAWA 4JL9A 3AI5A 3KVFB 3UIPB 4XDDA 3M3YB 2RDFA 3QB3A 3U4VA 3FILA 5M9OA 4EZKA 1MD2D 1Q46A 1YX5B 4C00A 3WIMA 2TMPA 1ZP0B 1BUIC 4RKBA 1WZ3A 2ZTCA 2JEBI 2HQEA 3VQIA 2WU5B 3I70A 2BS2B 4X62L 2UXBQ 3S2HH 4A3IH 2BH2A 4N9TA 2VW9A 2I1KA 3PUXA 3NTKA 1GUOA 2VY3A 3HKZB 4C2MB 1PRTB 2UU7A 4LF8L 2C7MB 4Q0FA 2PNRC 2YEPF 2J0KA 3H7SA 1L0VB 3TIXA 1QUQB 1G91A 2QILA 3HRDD 4ZQ3A 2FFKB 5HG2A 4ANUA 1V5TA 3V2TA 1SE9A 4IFDJ 1P9DU 2NTTA 4LF9Q 1MGSA 2YTXA 4XDXA 4U673 2ZJQA 4LF6Q 4AIMA 2M2LA 3RMKC 4A3MG 2CHBD 2AWNA 1LTGD 3M4OB 2LVPA 2B63H 1HZ6A 1PYWD 1L2NA 2K5WA 3Q8CA 1S4ZA 1KQSA 1YX6B 2B2VA 4M8AA 1L0WA 3K59A 3M62B 1E8ZA 3MXNB 1IBLL 1X1MA 1E0ZA 2F0KA 2NN6H 3RN2A 4ANWA 1RODA 4YCWA 2GB1A 4LNFA 4POFA 1ZYRC 2Q2UA 2RGFA 2JA6H 3U7DA 2EQSA 4YXDB 1PFNA 4DR4Q 1NYQA 4DR6L 3BK1A 3DVNV 1EIHA 3GZNB 1HPCA 4BOSC 2RDGA 2QW7A 4BA2I 3DOWA 3U2SC 3I4MG 1PDXA 4TUUA 4EZLA 2K5QA 2PQAB 4CDDC 2WWZA 2IO2B 3HEJA 1L6VA 1Z5SB 1FRRA 3PTFC 5IWAQ 4C1NK 2E6XA 4NY0A 3J9CA 4DDGD 1EU3A 4F88A 3J81c 1F77A 1FCCC 3NZSA 2BH8A 2FINB 1E9MA 1PZKD 4A3JH 3QAQA 1G6PA 4JPSA 2IYDB 5CYUA 1ENAA 1Z47A 3VH4B 1ICFB 2Y3AA 3R66C 3E9HA 2EMSA 2J4XA 2PCFB 5C5LA 4J6HA 2MEKA 1QNKA 1YN5A 4CKEA 3CW2C 2D07B 4KGRA 4H02A 2LEKA 5NUCA 3MWYW 4GKKQ 1HHVA 1SNOA 1R9TB 2JXXA 3HHMA 1WYGA 4KHPL 4P71A 4L5TA 2EKEC 4OZBA 4A3DB 2YU9H 4FNFA 1JW9D 3CCUA 4LMQD 3NXWA 1GC6A 2K22A 4FHKA 5KRUA 2KCCA 3TREA 1E1OA 2KTFA 1F2LA 5KHQA 3H3VH 3RN5A 4LF4L 4GOCA 4GKJQ 1F2RC 4DR3L 4R4QA 1AZPA 2PW9A 3ZLZA 3DWMA 1FNWA 2C5LC 3CRKC 4KY5A 2D2QA 4R4TA 1ZDXA 1F2YA 5AJ3L 1PYBA 1BUVT 2TSSA 1G291 4IPDA 2HTHA 1LUZA 1A63A 3C19A 1TGZB 2ON8A 2K33A 5C44H 1I94L 3SR6A 4F8CB 3AN1A 3KQ4A 1AN8A 2JYOA 2OOBB 4DBGA 2OT2A 1EIGA 3LGJA 1PFSA 4DF7A 4RWSC 2GBNA 1VQ8A 4I65A 4A3GH 5CORA 3D4DA 3UDXA 3KLSA 1WTRA 2KHIA 3GTMH 2FCSA 4IC7B 2MPMA 3AEEB 5J3BA 1QZHA 3AYHB 3R2IA 3NS8A 1X3QA 2AQ3B 4FXCA 1JQ4A 2K50A 1QLBB 2EJFC 2MHJA 4K5WA 3NUCA 4IFDI 1F9JA 3ALBA 3EVQA 1PMRA 1EF5A 3N1YC 4FHJA 3CPFA 3N30A 3M7GA 5H1SE 2FCQA 1EZ6A 3W5OA 3ZVVA 3ZW3A 3GQBA 1NTGA 1VQEA 4P2CB 5KIXA 5M3MB 4IPGA 4DDID 1QT9A 4E6IA 2R7DA 3A7LA 3T1HL 1DCZA 5FO8B 3I63C 1BXTA 3GZNI 4FULA 2WXRA 3LNNA 5AZGA 5BO4B 2Y0SB 2ATWA 4GIVA 4X62Q 3I4NB 1Q1OA 1HTPA 2DNCA 2GVAA 1DYQA 3I72A 3MHBA 2JA5G 2GI9A 4GN1A 3QARA 2Z4HA 5JOBA 3S1RH 1CQFA 4HEA1 1VQAA 2IPKD 1SE4A 5IT9L 3CCJA 3IFWB 2IW3A 1YZ6A 4KD4A 4CJ2C 4LF8Q 4O2DA 4J15A 5KNDA 2M0XA 4DAPA 1AE2A 1IGDA 1EWCA 1KRHA 1A3TA 5I9OA 4CQNA 2L83A 3AB9A 4K14A 1HTLD 1PVOA 2EELA 4LFBQ 3VFKA 3FEWX 3MJWA 2UUCQ 4N9PA 2BWFA 4IUTA 4EUTA 3NHEB 2DHZA 1OQQA 3U52E 1BQQT 1M94A 1WTQA 4B9WA 3MHZA 4K5XA 3VR8B 1XLOA 1S5FD 4XDCA 5T1GA 5M3FH 2IX1A 2BKRB 2F0VA 3VYTA 3UINB 2GOWA 4M02A 3ERQA 4XYQA 1IL2A 1WSPA 3I73A 4KSLC 2MO0A 5HURA 1IBLQ 3SGIA 1XQQA 5GXGB 1C4PA 4KIKB 1KIXA 3Q3FA 1UBIA 2MX2A 2N9XA 4ANXA 4C80A 3HOXG 2RKSA 2JZPA 3VUYA 2Q2IA 3F2BA 1XT9B 2A69C 5C4ZA 1AZQA 4DR6Q 2JPHA 4EKUA 4NPSA 4GNXA 1W6KA 4GU2A 4ZYSA 2MRPA 3PLVA 3MFYA 3VA5A 1N36L 3TS0A 2E2HH 3Q0AA 4FA6A 4MIUA 1ZGUB 2W3RA 2LXAA 4F7ZA 5FR3A 4K5VA 2EY1A 3NHHA 1NBFC 3RNBC 1UZXB 1U5KA 1V80A 2M19A 3IHPC 3H1UA 1GVPA 4KKTA 2VS1A 3TN2A 2JA9A 4W9CA 3TEHB 2PKOA 2WDQB 1BCPD 1KDCA 1BR9A 4JI5L 1SIJA 2KDFB 2CVRA 5J17A 4LF5L 3E9IA 3AEAB 4KKJA 2GMIC 5CTRC 2Y0SE 5DPWA 2N7DA 2F0SA 1PTOB 5C4HA 2VQEL 3PO2G 2KWDA 5L37A 2K75A 2F0DA 1WX9A 2AEHA 2KX3A 1FCLA 3R2TA 4UY8C 1XMOL 4KHPQ 4MTKA 1O80A 1G8ZD 4BBRH 2XWBB 1ZPSA 2OQ0A 4GN4B 3ML8A 2A6HD 2DNEA 2F0PA 1XNQL 3ABVB 2NBWB 1P7EA 2JRIB 1A0IA 2B2TA 1C4QA 3OMGA 1C0AA 5JJIA 2INNE 1O7LA 4P1CC 2MNAA 4HIKA 2KQSA 1QVGA 4LNIA 2LJ5A 1E7ZA 2YTYA 1E5WA 1BOSA 1SYFA 2PPBC 2PE6B 3CHBD 5JJZA 5ISRA 4DHZB 3AH7A 4NDXA 4JBJA 1V9PA 4ULLA 1DGSA 2GBMA 2WB1E 2KD0A 3A33B 5L95C 2G45B 5FKAC 2AX5A 4MSMB 4B9KA 3ZGZA 2Z6BA 4BVUC 3VUWA 1N5WA 4A3BB 2LY7A 3WWVA 1TWGH 5J22A 2R7ZG 4C2MH 2RHQB 4IOIE 1ZE3D 2MQJA 1I94Q 4AOFA 2EYMA 2F0FA 1IP9A 3H7PA 2VZAA 2M9VA 2Q2HA 3EN2A 4DAYA 3J80E 5C4JB 3MC0B 2KWCA 3JAML 1FVIA 4Y7NH 1VQ5A 2MQHA 2OWOA 4WJ3M 4HDQA 4KHZA 2EE1A 2HHHQ 2A6EC 2Z59B 3H9DA 4LTUA 1E6EB 4QY7A 1EYDA 3ENEA 1V2YA 2KACA 1TZOA 3EFCA 2L52A 3K5NA 2DGYA 1T6BX 2KNBA 3M4QA 1KF6B 2MO1A 5IYBG 4L23A 3OJ4B 4R4OA 1L1OC 4IFDH 2C60A 1QE6A 3Q3JA 1PH4A 3Q8AA 2KHSA 3DVNU 2KQ3A 2WXOA 5IOIA 4EQPA 1XYIA 4Q2JA 1I4RA 3T1HQ 1D1KA 2VH2A 2JYTA 1SEBD 3BY4B 3TEWA 1F1HA 1XCTL 2K8BA 3FKYA 5DPSA 5BR8Q 4NAWB 1ISNA 3RD2A 1SB3C 1JCKB 5JAVA 3V96A 2QF7A 3EFUA 1Y69U 3G6JB 2MJ8A 4DN4M 4C3HB 3HM3A 4LFCL 2BB6A 5D65A 3AQQA 4HK2A 2X69A 4NJ7A 3GTKH 4BY7B 2WX0A 4OONA 2YEPB 1QOHA 1MI0A 4W9LA 4JBKA 3BVMA 5BYRA 4DR7L 1D7QA 3KUZA 4PMCA 1ZYRD 3PSIA 4OVVA 4DNRB 1FFVA 4HPLB 1XWEA 1GOZA 2K6QA 4B3SQ 3T8MA 3KW5B 1RTNA 2GN5A 1WXVA 1STEA 1TWCB 3K6OA 2IY0B 1ENCA 3M63B 4K2LA 4UAIA 4AYBG 4HCSA 3NS1A 1BDOA 2PLPA 1FJGQ 2CU1A 3QC8B 5E6PA 3BDOA 4V190 4B3ML 3I9V1 2H89B 4KV2A 2OJRA 4DK1A 4HDOA 5AUIA 1P7FA 1E0BA 5J39A 2DZIA 1WR6E 4X3SA 4E74A 1QJOA 3OIPA 3VDYA 5KGUA 1FFUA 1MPEA 1JJCB 1B2TA 2K0PA 3LDZE 1XTDA 3M3JA 3KUPA 1N9WA 4P72A 3A5UA 1FL0A 2ICEC 1VCBA 4GOPB 2EPBA 2LMCA 2ZJDA 4ACFA 2KVMA 3C46A 4K1RB 2MGSA 1RM6C 1X3GA 3L08A 5E6JA 1MVKA 3VR6A 1STYA 1E22A 1KNEA 4N6EB 1FXTB 1N36Q 3TS2A 2BKFA 4R3DA 4DHJD 3GOEA 4A3KG 4KVGB 4DR5L 3Q6SA 1PRTC 1W6JA 5ELOA 2KC1A 3DUZA 3PIOA 4X66L 3MC8A 2B2WC 1TS3A 2A1AA 2V4IB 3VTVA 2V3NA 3PCOB 1R4PB 1FXIA 4GB9A 1F0ZA 1HQRD 4G50A 4HLEA 1KAWA 1RKNA 2BS4B 2LGSA 1K28A 2LXCA 1V9JA 2CU3A 2XEWA 3P63A 4JE3B 4ZRQA 2MFIA 4JI5Q 2NMQA 1K3BC 3FP9A 4OO1G 1DZ1A 2NVYB 1XD3B 4MGKE 2HIXA 4FF2A 1Y8RC 2ES2A 4W9EA 2RSNA 3FVQA 4MZ9A 5LMNW 2PIAA 1YNNC 3D3RA 3SHQA 4CO7A 3S24A 3BS1A 4ZRZA 2QCZA 4BY1G 3Q6BA 1RHPA 2IO3B 2CKHB 3RZFA 2K14A 2GBRA 2JK8A 3JYUA 5CBAE 1XMOQ 2LGDA 5C3EG 2XRQD 3NSWA 1EEFD 2D3AA 3NG0A 2E75C 3RLOA 5EE3A 2XN9C 5IP7H 1XNQQ 3Q3MC 1L0YB 1FEHA 3I56A 3HOVG 1CFMA 2D2CC 4JI0L 2L32A 1WR1A 3ZTDA 2K39A 2FCNA 4HJAA 4OXPA 5FJ8H 4MNOA 2BBCA 5E7NA 3S1MH 3P1HA 1GHKA 2MJDA 3VR2A 2RD0A 2BYEA 2BF8B 3I4NH 2Z6KC 3NPPA 4A3FG 2O6VB 4EE2A 3ZQ4A 2AKWB 2Z0SA 3KYHC 2KLCA 5EAYA 2BB5A 2KA7A 1YVCA 4HVBA 1Q8IA 5I2XA 4JI7Q 1X32A 2JXTA 3PHWB 2I2YA 2CFMA 2KFKB 4GDKB 1HR0L 4DK3C 1U4MA 3A55A 3JVZX 2AHOB 2PO4A 4R9WA 1AP0A 1Y8OB 4XQNA 1WMHB 2F4VL 2KC2A 2FBWB 3HKZG 4NXMQ 4WFN3 1TTNA 4A3JB 2K1BA 4IOAA 1F2ZA 1C76A 2ZM6L 5IYCH 4B0EA 2WAQG 3HZXA 3I90A 2CJNA 2ENBA 4IOCA 1TKYA 1UE5A 3Q2AC 1C48A 1TY2A 1KTKA 4KMUC 3U9SA 4NAMA 4AQYL 1RD9D 4A3LH 2VZKB 1EWYC 3E6ZX 4HJ5A 2I5MX 2JA7H 3VR9B 4MH8A 1J7CA 1ZOYB 5FLMG 3IVFA 2HDMA 5IO9A 4NAWA 3AE9B 2N0SB 2IWHA 1PGAA 1K73C 2YU9B 3Q8FA 1JJGA 4MM3A 1CTMA 3D32A 5H8YE 1YQ4B 5G2NA 2ID0A 1TBEA 3K9OB 1MBYA 2MH7A 3MXPA 3VYRA 1RFAA 1Y56A 4KGSA 3NJTA 1X54A 3I91A 4CBVA 1C1YB 4R4IA 4HROA 1ONLA 3KOJA 4QGUA 4LFCQ 4MSQB 1FNVA 2E76C 4JI4Q 1CA6A 1EYAA 1LO5D 3QOLA 2VL6A 2LRWA 4PMWA 1KABA 3VYSA 2AQ1B 3M95A 3I5JC 1MHHE 1D5ZC 5C44B 1T5EA 2LVQA 3PRZA 2OCEA 5HGTA 2FNJB 3OG5A 2DY8A 1FGUA 1SYEA 4L8JA 5FLXE 1ROEA 1NNXA 2K4KA 4A3GB 4TMAB 3OMCA 3R3MA 4B08A 2FUHB 1MJEA 4HJKA 4EVOA 1VQHA 3RPFC 1K0SA 1HJPA 1NUCA 3KFUA 4IUVA 2IX3A 2IX0A 1Q10A 1WJ4A 1XO3A 2N9LA 1HEZE 1K8AC 4IWPA 4R8NA 2EY2A 2WLBA 3BU2A 3A0JA 2L5TA 2ZXPA 1HUMA 4OIJA 2KQ4X 2CKZB 2KDIA 3BYYB 1KD1C 2REXA 3AFPA 4IUUA 3LB8C 3A9KA 4AUQC 2PPHA 3L9AX 3PIO3 4FF1A 2KDMA 3DPDA 5C0XG 1G2SA 4QQBX 2JU6X 1A6XA 3J7YW 1AYFA 4YCUA 3GTJH 1TIFA 3NVYA 1ICWA 2V1CC 3F2CA 3WAMA 2HTME 1T0QC 1SYDA 1OEYJ 5EKLA 1MJDA 3DHGC 1MKHA 1C79A 3QR8A 3BIID 3ZXVA 4DR5Q 1D8LA 1EUVB 2L76A 4G4KA 3HOZH 1HFNA 3U7ZA 4PYUA 2F0NA 2F0UA 5IWAL 1SF0A 2MP2A 2Z8LA 1B4OA 1LM0A 4NZLB 4HR7B 3DHIC 1K52A 2H88B 4N8FA 2K3UA 3ULJA 3RN9C 2NR2A 4BOZB 3GP7A 3W1SC 2PMZB 3I4LA 1Y1VB 2RF4A 4EOYA 4JOIC 3DWQA 4B3RQ 1IYFA 1J0GA 4HJ7A 2K52A 4GN3B 4LFAL 4NB3A 1IBMQ 5JPNC 5EGTA 2CHXA 5KNBA 3OOCA 2F0IA 1SMXA 1BO0A 5G3LF 3GTPH 3DBLB 1UWMA 3ICEA 1A15A 4XQJA 1NMFA 5M3FB 1VQOA 3S1NB 3CC7A 4FF4A 4A3CG 2J0MA 3I3TB 4K7SA 3RD4A 5A35A 2IHEA 2A6ED 2E8GA 4PMBA 3OW2A 4JI0Q 3H3VI 4BXXG 1A70A 2LGYA 1B1ZA 1DJRD 1A5RA 2ONQA 3BZDB 4CJ1B 1MJCA 4PS8A 1H9MA 2PI2E 3PUVA 4GKJL 5K36H 2IDYA 5JPMC 2KMAA 1IZ6A 1N6ZA 4C3HH 3QIAA 4C3JH 1D4BA 1I42A 1UWXA 1P8LA 3KWLA 1XLPA 4BY7H 3PV1A 2O2LD 4A93G 1HR0Q 4DUZL 2E2HB 2M0AA 4OVUA 2MP1A 2WXPA 4K8IA 2OEOA 2DUDA 1BF4A 1HRJA 1UGMA 2F4VQ 1HCZA 3L54A 4K7UA 1T9HA 5ELFA 2VUMG 4II3B 4LK0M 1EIYB 3J80L 1TWCH 1EY5A 2M17A 4BBNC 1PH5A 5LXIB 2IHFA 4DV7L 4YTNB 4NPNA 4YWLA 2ZM6Q 2J42A 2NBUA 3UIOB 1BVSA 4IJHA 3QJZA 3P75A 4WWMA 1J8CA 2C5CA 4RMFA 4KTAA 1PTOC 2CWAA 2QEXA 3HP3A 3A5ZB 2J7QB 4DV3Q 1TKGA 2Z0DB 3GE3C 3B6YA 4RNAA 1Q86C 4A76A 2BT6A 2BS3B 2E74C 1T0YA 4BBSG 3PVLA 4KSKC 1Q90A 1F9PA 5IOCA 1K50A 4BA1I 3NVVA 3PRPB 3P20A 1YJ9A 4B3TQ 3L4PA 1UBQA 1G2TA 2ZT9C 3MHSD 4BBRB 3K7AH 3QO2A 2LS01 2JSVX 2KJHB 2B2YC 2E5LL 3QCAA 2BA1A 1LQBA 1SIFA 3WDNA 5GAHC 3NRZA 1NAPA 3T13A 3CMAA 3JW0X 1M4VA 2PMZE 3AFQA 2VXWA 4LWCA 1Y1WG 1L2FA 2PYKA 1V6EA 4L5SA 3A1QA 1WTWA 3WANA 1VZ8A 4BAXA 3I55A 5DPRA 4HWIB 3UF8A 1I35A 3SHLA 1LT3D 4PT5A 1WFQA 2KJXA 1TWGB 2PI2A 4DK0A 1GHJA 1NY4A 3H0GH 3WAOA 4KY6A 4DV6L 2EYHA 1CJEA 2A4ZA 4P73A 4AYBE 2F0EA 1D6EC 2K32A 1LTTD 4A4IA 1WJJA 3PUYA 3L2PA 3EUB2 4N59A 3G71A 5C4XG 1FYCA 2I46A 4Y7NB 3MZ5A 1M8AA 2NVYH 3S1QB 1IPGA 1DONA 3QX1A 4LFBL 1GC7A 1NEKB 4DQOC 3R7QA 1EFID 1JE4A 2GVBA 1Q7YC 2JA5H 2UUCL 2G3QB 3K57A 1RTOA 2JZZA 2L8JA 3CCEA 1B9RA 3DBLI 3TMPB 3FKIB 3PGEA 1PRTD 4NJCA 4ALPA 3TP7A 4UP9A 3D4RA 3IT4B 2B2UC 5C2TB 2J0JA 5CC4A 1AWDA 2F0LA 1V1OA 2L00B 1WOCA 3UQAA 2CJOA 4FJVB 1SLJA 2XBBC 3APFA 3AE1B 5IGEA 2JT4B 2PVGC 5AZHA 3SD5A 1YNND 3T1YL 4M1UB 4DV5Q 4FO2A 3PIP3 1OEYA 4IUMB 4HCPB 1YJ1A 5E3FA 3A9JA 1Q5WB 3T51B 3S14B 1E2ZA 1JWBD 2DAFA 3JSVA 3P4QB 3W1YA 1QZEA 1VQIA 3GTKB 4XT3B 4DU9A 2K1FA 3X3NA 3DDCB 1EM7A 3SVMA 1N63A 4GNXB 3CP0A 1AH9A 2WGSA 4FN2A 4F1SA 1E7PB 3W1BA 4YY3L 2LGXA 2O2VA 3WOFA 1TVXA 1V86A 3SU8X 4PZ6A 1XEEA 1J7BA 1SNPA 3FPPA 1TS4A 3FPUB 1YQ3B 2R2OA 5EPKA 2F0MA 1JROA 2AMCB 4J3OD 1WGRA 4ABNA 1WX8A 4JC0A 3K0YA 4LFAQ 1WRIA 2INPE 2KJRA 4YWGG 2YYZA 2KOLA 3H6NA 1PDQA 1FD6A 1QCBD 4YTPB 1BT0A 1QOBA 1V1PA 1KM7A 1F9SA 2ZJRA 4II2B 3P1MA 3V05A 5EJWA 3PO3G 3J7AF 3L3OC 1A2TA 4DGZA 2V9HA 3N32A 1CKNA 1PFBA 3S9WA 2ZPYA 4GLVB 2AWTA 5GADC 3ZDMC 3E3XA 2H5XA 1JRUA 1ZXIA 1LGRA 1JQYD 5EBDA 4HXDA 2SDFA 3A54A 3D31A 3NTHA 2JN4A 4WRDA 3OWEB 3HOYG 4IUNA 1R4NB 3KYDD 2WNMA 3RR5A 4CHKA 3Q22A 4DUZQ 2KEDA 2KO3A 2INDC 1LTRD 5BYQA 5D3DA 3ZIMA 2F0GA 1EY0A 5I6YA 1VQPA 1FRDA 4QIWB 1XX8A 1MHXA 4K2KA 3I57A 5D2MB 2W82A 5HKHA 4RAUC 2WAQE 2WINB 4FXDA 4DV7Q 3N1XC 1W2BA 4W9FA 2H1EA 5LLIA 5HGQA 3HOWG 1YJWA 1A3VA 3B9JA 4MGIE 3RNEC 3L0WB 2HHHL 5T8IA 1JB7A 3H7PB 1P16A 4LJOB 4DAYB 3UQBA 3CC4A 2R7ZH 2HJ8A 1ESRA 1B70B 2JUOA 5M5YH 2UUAL 4ZUIA 5FO7B 2FAZA 2KCNA 3ZJYC 4BZAA 1VDVA 3F2DA 1ZUD2 1SJED 1K83H 4UP7A 3J7AV 2E5LQ 1WM3A 2WXHA 4HIOA 4J6IA 5BR8L 1MIUA 5IYBH 1WTXA 1UEAB 3HOUG 3S1MB 2N9KA 3HK0A 5BMGA 3ECIA 1SBBB 5CV7A 4MEMA 4P6VF 2XRSD 3FRPB 4RMAA 5BN5A 1ILPA 4WJOA 1SDFA 3PUWA 3WCQA 3IAYA 1WE7A 3DVGX 4RHSA 3C0RB 4NNJB 1EY4A 3IFTA 4QUFA 3DEOA 4H13C 3MEHA 4A3IG 1CK1A 4CKBA 1UD7A 2K8CA 4PNYA 4DV6Q 3OW7A 1RFKA 3TCAA 4I6LB 4DV4L 3MJ5A 2A5HA 2HDLA 1YJJA 5LMUQ 3SDLC 4B3SL 3H09A 3RMHA 4WWPA 2NB0A 1B53A 2HD3A 2KENA 2L0TA 1QWYA 1Y1VH 2OXPA 3S2AA 1P0RA 2I5LX 1MHWC 1FJGL 5IGFA 4IM0A 1PFMA 1OQYA 2KBNA 1PA6A 1GM5A 1WI0A 2WB1B 3Q14C 2DZKA 2JSOA 5GAEC 4TQ0A 3BZCA 5EPLA 4IQZA 2A5UA 4XZ4A 1WCMG 3U58A 4IUQA 2L1BA 3W1GA 4EGVA 3S1NH 4FYDA 1VQJA 2JA7B 2KCMA 2XIWA 4RCNA 4BS9A 5CGKA 2LASA 1LLRD 4QIWE 3RZOH 2QJLA 1XLQA 3CCSA 4G7ZC 1QQRA 3EHVA 3KUDB 1WYDA 4MTNA 3D6WA 2B63G 3T1YQ 4GLSC 5JJKA 4PQXA 2YV5A 1JWAD 3ITPA 4KJNA 1R4NI 1FO4A 2NN6G 1NMGA 1P1AA 3TBLD 2HE7A 3SFDB 2JA6G 1HE8A 3U8ZA 2ICIA 4HEDA 2WFWA 4XXEA 3X0WA 2LMCB 4I6NB 4K6LA 4TQ1A 3L17A 2IY1B 2JF5A 1KFYB 3QQ8B 3NQIA 3GV6A 3PV0A 1QZGA 3KDFB 2SEBD 2ZCCA 3E0JA 1U0LA 3TJPA 3VVWB 2N1WA 3GV3A 1M1KC 4WJNA 4YY3Q 2R92G 2C7HA 3BDLA 1I4QA 1WF9A 1SE8A 3V60A 2D5DA 1OO9B 5I2YA 1VQBA 1KXLA 3AMZA 3HRZC 5EE9A 5BN3A 2PMVA 4JGHB 4A3KH 2LXKA 5LHY1 2PNHA 2RDHA 1MFWA 4FLHA 1N61A 1G6ZA 4S0RA 5IAAC 1BCPB 2I0QA 5JEAG 4JI6Q 1JMCA 4N8X1 2KHJA 4NXNQ 1QNUA 2N55A 1PV4A 3CMMB 4MGZE 1PZID 1H8CA 3AEDB 5JHAA 4OO1H 3ZNGC 1PTOD 1YOVB 2AUJD 4IPHA 4PZ7A 1Q12A 1XPUA 2B2VC 4A3EG 4BY1H 3NVZA 4M8NA 1IBXA 4LNKA 2N9EB 4I7ZC 4BKTA 2Q8RE 3GTJB 2B3AA 5EPJA 2G9DA 5C3EH 4DUYQ 4KDIC 1E90A 3ER0A 1QG7A 1QB5D 2CW0C 5ELEA 3SK6A 2DY7A 2F3WA 3AULA 1GUAB 4IKGA 2QKIC 3K80C 4JI7L 3F2UA 1SE3A 3RT3B 3MXGA 1H9JA 3J80c 3KK7A 4IZ8A 1ZXTA 3CF5A 3HOZB 4QCLA 4DNTB 1YNTE 2KN4A 3TBIB 4PS3A 4C3IH 3M9BA 3ZKJC 5CMDA 2KANA 4ICUA 4NXML 3S1QH 4A3FH 3ONSA 4WH4A 4OHJA 4IW0A 4FADA 1KHIA 2ZW1A 2G9HD 1CKOA 3JAMi 3I4MB 2LHEA 3CPWA 4C7YA 4H44C 5EDSA 3FKIH 3B1LX 4MACA 4DV1L 1EL0A 2KDBA 3Q8BA 3TSSA 1F9QA 5I6WA 2UUAQ 2B29A 1K3RA 4M0WA 2KZRA 1C9OA 1L6UA 2KTRA 2LI5A 4QL5A 3URYA 3GTPB 3AM9A 1KC8C 2LJIA 4K0KL 2M00A 3J81j 1QVCA 4AH6A 4DAMA 3S15B 1STAA 3NBHA 1WGGA 1IYUA 3R3OA 1E2VA 2EJGC 5FOBB 2R93G 2D3CA 5C3JB 1OQRA 1HTQA 1L5PA 5CHVC 3ZNZB 1HXYD 4MM3B 1A2UA 3S14H 5DPTA 3KH0A 5E6NA 2MJ3A 2DNFA 4C3JB 1S1QB 3GTQH 2F0OA 4JI4L 1PGXA 5IGDA 4AQ7A 1GB4A 4EQNA 1J9OA 3BINA 3ZRFA 3KWVA 5CBEE 4XIGS 4DV4Q 1H95A 4DXAB 1STBA 1PH9A 3DM3A 2JA8G 4CDEC 1WTVA 1Z2MA 4GMVA 1SNQA 3FDTA 1HA5A 1I6HH 1YEZA 1S3SG 3RI7C 1EZ8A 1CSQA 2F03A 4IG7B 1XNRQ 4LW1A 3D6CA 1VMPA 2QMTA 3CF6E 3R7RA 1UWVA 3X23A 1VF5C 1OFFA 2KVRA 2DBYA 2KKCA 4DAVA 2C35B 4ODGA 2WDTB 3ZDTA 4G0NB 4BFRA 1LACA 3PREA 3KJPA 3K5OA 2ALYB 2KWVB 4JV5Q 3M4YA 3QIJA 1W3SA 3DHQA 3FAHA 4ME5A 1VQDA 2D9UA 3HFZB 2W54A 2GRIA 1U4RA 3K7AB 4EZJA 1WGDA 4JOIA 2D5GA 2KK8A 3V62A 3TEZA 1KL9A 2F1MA 3Q24A 5EBCA 4POGA 1C9FA 1UNSA 1FNUA 3E5SA 1YD8U 3KLSX 4TRDA 4WQOB 2A68C 3KDFA 3A9KB 4MGYE 2R2QA 5FO9B 4RH6A 1SYCA 1X9NA 1LYLA 2W55A 5JXVA 3OLMD 5L83A 1HNWQ 2A73B 2KQ7A 3PZDA 2CQAA 2KAJA 1K8GA 3H8HA 2IBIB 5HY6A 2Z0EB 2RVLA 5D14A 1O7IA 2RQXA 1K0RA 4CKCA 5C0XH 4XYOA 4K6DA 2NVTH 1WXQA 4X57B 4DHJB 3H0GB 1LTLA 2JQOA 3APCA 2I07B 5E4WC 3B2FA 3C8YA 1T5XD 4J8QA 3BVZA 1CUKA 4YIJA 5IIFA 2LVOA 1TS2A 2EYJA 2R3ZA 5CV5A 2QDBA 1XPOA 3KJOA 4DR1L 1OGWA 2MP2B 2QCPX 4ZAIA 1E8YA 3J81i 1RYJA 2JA5B 1TKEA 1K53A 4B3RL 2ZCBA 2HT1A 3RZWC 3G7LA 4EEWA 1IBML 3TMEA 5IYDH 4JX1C 4OW0A 4RF1A 4IALA 3SR1A 1NE3A 3TL5A 1S40A 2K6DB 3OTOQ 3DEPA 5IP9H 2L0FA 1CQVA 2JVCA 3DWGC 3VR3A 2ACZB 4AP4C 1QOGA 4GGQA 4N58A 1C4AA 3N20C 5BMHA 2KLGA 3H6MA 2DX5B 3D4WA 3QWZB 1TY0A 1AARA 3UI2A 3N3KB 2SNMA 1V8QA 4E71A 1H9KA 2CH4W 1Q8KA 2ZXOA 2HIVA 4HMIA 4A3CH 1IYVA 2WKCA 2EXZA 4BXXH 1VQ7A 5IA7A 4XX5A 3P4PB 4BKSD 3CIRB 2MBBB 3EQLC 3CCVA 3KF8A 3T56B 4US8A 2D3BA 3W2DA 1FR3A 2JXMB 4X6AH 3HOXB 4JBMA 5J18A 1Y8NB 2IGHA 4JBWA 4ITKA 1EQRA 2NBVB 3B08A 3I2ZA 1STNA 4R1JA 3W3AA 3H94A 5ELDA 5HFYA 1KDAA 1NSNS 2HCCA 2RSOA 4A93H 1ILQA 2UXDQ 4DV1Q 3AXCA 3DXJC 4M01A 5TSSA 4KN7C 4DV3L 4JG2A 2MBQA 4XE0A 1HH2P 4A90A 1WTPA 3NEMA 2VUMH 4L5RC 5G5HA 2EXDA 1J6QA 2JY6A 3C2PA 5LMNL 2VH1A 2W3SA 1E1TA 4JPBW 1KRSA 3SDZA 2QGQA 4DXGA 4B3TL 4K0KQ 4LDTB 4IFDG 1N32L 1ZDVA 3PHXB 1KH0A 2DZJA 1TU2B 3UE0A 1V43A 3ULLA 5ELBA 1I5FA 5EKIA 1N60A 2XGTA 1P98A 4URKA 4RGNA 4YSZB 3PO2B 2B2UA 1FMAD 4C1NI 2RR9A 3A7AB 3GTOH 2Y5PA 2UYZB 2L4NA 1SE2A 5J2RA 1WJUA 3HS0C 4IPCA 3H15A 1E7VA 1YNJC 1OXVA 1L4DB 1WYWB 4AJWA 1SN8A 1SXTA 3EA6A 4GS3A 1X56A 3AE2B 3A1QB 1C3TA 4YWMA 3QG1A 3IBEA 2NVXH 2MUYA 3LX0A 1G6JA 2NZHA 1NI2A 3SXHA 5JVH3 4IM3A 3AE7B 2OQKA 1Y1WH 1F2RI 3NWTA 5FLXc 3QWNA 4HSVA 2MCNB 1DOKA 5GAGC 1GD7A 3AU7A 2N78A 4KZ0A 1N34L 1CZGA 5KNCA 2NYZD 2KECA 1NR2A 2R7ZB 5JH5C 4OIKA 1T0SC 1YJNA 3O13A 5IT9E 2QA4A 5M5YB 2F0WA 2JQRB 2FUG1 2KWUB 1QILA 4ZHOA 1OXUA 4X64L 3RZDH 2IT1A 2M8SA 2XTIA 1V49A 2FIFA 5EQ0A 4NJ6A 3K58A 4OVZA 4YHHL 1GPXA 4A3DG 2DJGC 4ZDVA 1B9MA 4PYZA 1I4HA 1K83B 1FM0D 3DLLA 3M85A 1D1IA 4JVZA 1CSPA 2NUCA 2LRUA 1QVFA 3AEVA 3G4SA 2HUGA 1HA6A 3PPAA 2XNAC 2LKVA 4DV5L 4W9IA 1WRDB 2M4NA 4QF4A 4TVAB 3HVDA 3C1EA 2XWJB 3LWUA 4A3MH 1H4RA 4W9JA 1J8IA 1GUGA 1CA5A 2K9XA 2LHDA 1GXDC 5CV8A 1IHZA 1TKWB 2NVQB 3HM6X 2K28A 3A9JB 4NMZA 2Y5CA 2L15A 5ELNA 3JSVB 3MTNB 4AS1A 1ZW7A 2J0TD 4G57A 4WJ4A 2GBKA 1JWSD 1JB3A 1XXGA 4ZUJA 3PIPA 3AE4B 3ZJVA 1FGBD 1JOKA 3I4MH 3I3CA 4DR1Q 1S5DD 2N8NA 4HTHA 2FHTA 2CW0D 3NTIA 4WJWA 2HCIA 2BWES 2DYOA 2RDBC 2O2VB 2XK5A 5M5WH 3ZJUA 1Q0WB 2QHOA 2WX1A 3N52A 1E8WA 4K81A 2LFIA 1QOFA 2KUMA 2WHIA 4GLXA 4FBJB 1B3QA 2Z9HA 4KZCA 3T53B 5D6JB 3TP8A 2D0OA 3P7JA 3OWFA 1PH8A 4DNIA 1YITA 1D5MC 5LL6X 1EY9A 2PW7A 3S15H 3A56A 4F8MA 1BCPF 3RZOB 3S17H 1JORA 3PZ7A 4AYBB 1V1PB 2MBEA 2KX0A 4KD3A 2Q8TA 1NBWA 1CZPA 2PQEA 2XSCA 1VQ4A 1JMLA 4ARIA 5M3MG 2WKDA 1I7HA 1X3EA 1CKNB 5FJ8G 3K7UC 2KDEB 3KUCB 4MJSA 5IN7A 2L9HA 4PZ8A 2JEAI 3PO3H 2Y0SG 3I4NG 1PH6A 1WE6A 3VR4A 4BKSA 1WY8A 3IXSA 1L1OB 4TKNA 3GE8C 1A62A 3DMUA 4MELA 3MA2B 5BMIA 1N62A 4C4VA 2N7EA 3A4SC 4UP8A 3S2DB 3K5MA 3NBIA 3Q23A 2D11A 1J7AA 2BDOA 3L7ZC 2Q5WD 3T16A 2HD5B 1WJNA 3ML9A 3V3XA 3RUIB 4I7AA 1WXAA 2MBHA 5C6AA 4KX6B 2JJQA 3E0EA 1OTCA 4K3CA 4OZCA 3DWPA 3D8GA 3EC8A 1RDPD 1EIFA 4A3KB 1LV9A 3K9PB 4YSYB 3RCZA 2J7ZA 3B2GA 2M1MA 3UI3A 3ETRA 5GROA 1JWMD 1JC7A 5A2QE 2MLBA 1TXYA 5FR6A 3B0AA 1SAPA 2BW2A 2INCC 1Q1BA 2X38A 4WJQA 1WH3A 5LMNQ 2V4DA 4A3LG 1PFDA 1MSGA 3MC9A 3QK0A 1SYBA 3HOWH 1FIQA 5AZFA 4DK6C 1N32Q 2WU2B 4EQ5A 3JAME 2NZOA 1PH1A 3ZTCA 3SK8A 3TRZA 2OTJA 2IGDA 5M5XH 2X8XX 1SMYC 3CSTA 3P4SB 4XC2A 3W5UB 4X65L 1EEID 5IP4D 2F4IA 2AQ2B 1V5OA 4F7XA 3EBEA 3TDQA 2EY6A 4BY1B 1VLBA 5AFWA 2G5DA 5C3EB 3LWEA 3ERSX 1C78A 2C7NB 2UU9L 1K8OA 3OPOA 1FPYA 2JE6I 1VQ6A 3CAMA 1JOQA 2BGFA 3HOVB 2UUBQ 1MI2A 5FK9C 1EOTA 4H7BA 4DV0L 2NPTA 1T0RC 1XJVA 1X6OA 1LTBD 2EOTA 3HOUH 1GAQB 1YN3A 1VQNA 1VR9A 4C3IB 2A68D 3QHTA 5LMUL 4B0MA 3AE8B 1EFWA 4O0AA 4A3FB 4LF7L 3GB1A 1EO6A 2PZTA 4JI1Q 1N34Q 2N1VA 3PZ8A 3ONAB 3C1FA 1O7YA 1NYRA 4DA2A 2F0HA 3NOBA 4WAFA 3K0XA 3NQTA 3PF4A 2WXIA 1AEXA 4S3SA 2M56B 4HCEA 5COYA 1E24A 1TS5A 1UUPA 4X64Q 1C7YA 4Y52H 3Q3OC 1VQMA 1RJTA 3BVGA 2K8HA 3GTGH 1F2MA 4YHHQ 1ASYA 5HI1A 2MJEA 1S5ED 3PGZA 2WAQB 4RM8A 4A20A 1F9RA 1YHBA 4AJYB 1TR5A 1CM9A 3CCMA 5K5PA 1PH2A 1WCMH 1OTRB 4LCDE 1DXMA 1EWIA 2KCTA 3VRBB 3MAQA 2E2IH 4BWGB 3DCGA 5G5GA 2I38A 2PEAA 4KDLB 3NZ3A 3GTQB 1UGJA 3UGBB 2EMTA 2CR5A 4JYAL 4I6PA 3PT2B 3PQIA 1ZXHA 3N6RA 2ZVNA 4A3BG 2MA9B 2Q2TA 3HOXH 3PS6A 2K5PA 3HOZG 3LJ3A 1DOMA 2BE5C 4APVA 3E9SA 3KF6A 3TP6A 3PF5A 1X3FA 1I6HB 1S5BD 2VB3X 2F52A 2E3TA 2PW5A 4LAAA 1BBUA 4EFOA 3EIVA 3J7ZC 3L10B 2NCNA 2ZEQA 4HRSA 1N33Q 2R92H 2PVOD 4JI6L 1STHA 1I4PA 4NXNL 4K8JA 3CRLC 4KV6A 4UHVA 1LTSD 5DEHA 1RRBA 4OO1I 2K25A 2LWPA 4QJFA 3SK5A 3AEFB 1YI2A 1A3UA 2C9OA 4A75A 4EX5A 4DV2Q 1HZ5A 2G4DB 2WXJA 1GJXA 3J81E 4GOPC 4R8IA 1WGHA 1HZBA 4HCNB 3PO2H 3Q3NC 1WD1A 2V0GA 4JW0A 1F52A 5JEAH 1EYGA 2BTEA 1L1OA 1QKZA 4JI2L 5CV6A 4FXKC 4IM2A 2UXCL 5K36G 4DUYL 1I3QH 1II3A 5EKKA 2BOSA 1CI3M 3G48A 4G7OC 3GO5A 4C3HG 4GDLA 4QMGA 4C3JG 4HKZE 4WWNA 5C23A 1IBXB 3HKZE 1LT5D 4BY7G 1Q1EA 5C0XJ 1HZCA 1KRTA 3CXCA 2SNSA 2Z1CA 2DWQA 2KVZA 3Q8DA 1HNZQ 1K51A 1WM2A 1EY8A 4A3EH 2NVTB 5C3WA 3EROA 2EIFA 2J53A 2D10A 4WQMA 2OF1A 3V6EB 1Z6HA 2FXQA 4L6TB 3SFEB 2MHVA 1VQKA 1YNJD 2MWSB 4MT5A 3VDZA 3T3NA 4TV3A 2KOXA 1J5EL 2R61A 1SNDA 2E2DC 4CJ0B 2SAKA 4B95A 1TQOA 4P75A 4NQKE 2VRRB 4XYCA 1C4CA 1TIID 1RCVD 2ZVOA 2I5HA 3MP9A 4LNOA 1TJEA 1ESFA 4HJ9A 1H9RA 3S16H 1E7UA 1KOTA 2PZUA 3WAPA 1RIPA 3VA7A 4MDKE 2IL8A 1TT5B 1NVID 2RMMA 2EZVA 5KEEA 1HFGA 4M0WB 4RGTA 2WXLA 1YIWA 2KTRB 2FMCA 3NK9A 4X65Q 1PYSB 2HJ1A 3IG3A 5TR5A 1YHQA 5MPOA 3PLUA 4LJPB 4U68A 4G11A 4HPMB 4JWUC 3NBHB 1MG8A 4A6QA 1H9SA 2KFJA 5I4DA 3NENA 3QA8A 2UU9Q 1WFYA 1O7ZA 4KY7A 1IL8A 1Z9FA 1BNZA 2NVQH 1P3QU 5JJLA 3P4RB 4PS7A 3BWUD 2QC8A 3HUIA 2R93H 4P1BC 2VQFQ 3P42A 4DV0Q 4JWSC 4YCVA 3V61A 4KJOA 2B8FA 1ASZA 1IW7D 5DCNA 1EQTA 1L7YA 3CU7A 1N5XA 4ICVA 4OL7A 3KBGA 3H0GG 4LF7Q 2AUKA 3RULA 4L5QA 4CDCC 4DR2L 4HSPA 2KJ6A 3OHXC 5H92C 5FLXL 1KLVA 1XNRL 4A93B 3BZKA 3RYTA 4ZHPA 2B76B 1YN4A 2WP9B 1CKMA 2B2WA 1JE5A 2HQLA 1RLFA 2DAJA 2N3SA 5E1FA 4OWXB 5DAUA 2JA8H 1I50B 2KT7A 4ZRJA 1KNAA 2VUMB 2PJHA 1QUQA 4JV5L 2P5ZX 1ACCA 4JI8L 3H3VC 3MTSA 3RNCC 2BYFA 5CR3A 1GUTA 3I7FA 2V3PA 1JRPA 1L4ZB 3UDGA 3W9CB 3M7NA 4XQQA 4RHRA 4FP5D 4YL8A 4W9HA 1R7SA 5BYSA 1EYCA 4ZOHC 2L3ZA 4NW2A 1BBXC 4FJYA 4BBSB 4KK7A 3GTOB 1SFOH 3IKJA 5GQOA 2LGIA 1V81A 1SR3A 3U9OA 2MW5A 1JJ2A 2V1YA 2ZNVB 2B39A 3AE3B 3MXNA 4O1NA 4FF3A 1HNWL 3LXFA 1NR4A 2NS5A 4JYAQ 3MVVA 5C0XI 1TWHB 4X3TA 1STGA 1QOAA 4WORA 3A8JE 3S2DH 2NVXB 2E2JH 1CMXB 1DOIA 4HAEA 1YMHE 4DWFA 4PG3A 2K7VA 4IN3A 2Z6KA 3Q69A 3AE5B 4ZRPA 1B50A 1Y1WB 1BBWA 2L0CA 2L11A 2J52A 2QIEB 1LM8B 2QDFA 1EOVA 3GTLH 2PQAA 4P7IA 1WI5A 1HTOA 4A3JG 3U30A 1JICA 2CH4A 3BDCA 3L0OA 5IE8A 3PMFA 4Q5VA 5D94A 4HIMA 1JR0D 2LXJA 4F87A 1PUTA 1DOXA 3OSOA 4ASWC 3SK4A 1FD7D 4P74A 5JVG3 2MSED 4JCVE 1DOYA 2OJWA 4A3OA 1T3QA 4X3KA 2DJFC 3OTOL 5G3LD 4R4CA 4ZLTF 3RZDB 4DXFA 1LFDA 2HDEA 2FMMA 5C4XB 1XTCD 4P16A 3AMUA 3AB5A 5CHWA 1E3PA 4GSWA 3VHTC 4LUZA 1GUSA 1BMLC 1EY6A 1GNUA 2DZMA 2PTLA 2WV6D 5D7GA 4HMJA 1LABA 4JI2Q 1DM0B 2UXCQ 3N9YC 4RG1A 2WYQA 2CCZA 1NI3A 2K5VA 4S17A 4A3MB 1G51A 1GG3A 1WGKA 2C9WB 3CQZH 3V6CB 1TWAH 4FDBA 4ARCA 3HOVH 3CKIB 3JC66 3EECA 4HJ8A 1CT1D 2QSDA 3RNGC 1SMYD 3RNUA 4OZAA 4D2KA 4DFAA 1X3PA 4ZKCB 3M3YH 2N4FA 1TWFB 2IY5B 4EQOA 5LNK1 4HKQA 1U4LA 4LF4Q 2N49A 5C44G 3T9LA 2RPVA 2K5DA 3KF8B 2WS3B 4RGOS 4DR3Q 5IKCM 2L05A 3DVGY 1PH3A 1SNMA 1B7YB 1J5EQ 1IBKL 3WA0A 3TP5A 1YIJA 2UXDL 4O42A 2RHSB 5AJ3Q 4A3GG 2ZZPB 5KYIA 5JZEB 5M5WB 3ZUNA 2GLSA 4GZYC 2KEEA 3RLFA 5A2QL 4IWQA 4CHTB 4CGYB 2N88A 4Z9CB 2VNUD 5AEKB 1SNCA 2ZXRA 1WZ0A 1LTID 4OX9L 1YQBA 3OJ3A 3ZRCA 2EDGA 3PO0A 3S17B 1ZEQX 3KBXA 3CC2A 3BK2A 1GUNA 2JWUA 4OWTB 1VQCA 2F0QA 2LFNA 5FLMH 4WAAA 4TQUS 4K7WA 3RLNA 5IGGA 1D3ZA 3PO3B 3DWAA 2RSUA 1JOOA 1HZ9A 1WXSA 2JZ3B 5C3XA 1U9RA 1PLFA 1X65A 2Z4IA 3M4OH 1QF6A 4YSXB 3TZUA 1KLUD 1KDBA 3VTUA 3SE0A 2BVCA 3K81C 3MFGA 4C56C 4L1BA 3TQYA 1R4MB 3OYYA 2WXGA 4X3UA 4DR2Q 1IXRA 2H4OA 3K5LA 3HOYB 3IL8A 3STBC 2GBJA 5C1ZA 5AUKA 1RWSA 3GD7A 1R4QB 1L0XB 1Y1VG 1VS0A 2K03A 4H0LC 3U50C 1EUJA 3ULPA 1ET9A 1VQ9A 2NVUI 5IY0A 3X3MA 1V97A 4US9A 2A8VA 5HHDG 4UDUC 3FC4A 2GA4B 5DNFA 2BE5D 2F3IA 3G6EA 5IGCA 4OEMB 2EYLA 3HOWB 3W1SA 4JI8Q 4IURA 4DKAC 5M3FG 3CCLA 3KLWA 2RBMA 3AEBB 1VMCA 1IKLA 2EJMA 4QB4A 5M5XB 3CWIA 2V3SA 2UWQA 1PRTF 1VF7A 4NKLA 3EJIA 3AU5A 3NUHB 4ZYNA 1WXMA 2ZW0A 3Q8EA 3ZNHB 4DHZE 4V0BA 1B44D 4XT1B 1OXXK 2EYFA 1EF1A 4ZRKA 4YWKA 1CZWA 3NWSA 1R9TH 3O65B 2AWOA 4KIKA 1IGCA 1NENB 1N8RC 4A3DH 2BYVE 3AECB 4ID6A 3CCRA 3VRAB 2K01A 2OHFA 3I8ZA 3ZO5B 4WURA 4FXGC 3T4AC 1V8CA 1I4XA 5T1IA 3D0FA 2B3GA 3VTWA 4A8XC 5CV4A 4KKIA 3GDEA 3GS2A 3HOUB 3F1ZA 3VYUA 5JHBA 1VD2A 2A74C 1EQVA 4RKLA 3WOEA 1HR0W 3R93A 1GJZA 5IODA 1PXUA 4G7HC 2D3GA 2CQOA 1V1QA 4RCOA 3UDIA 2YTVA 4LNQA 2WXNA 1CHQD 2NTSA 3S2HB 1IKMA 4A3IB 1IYJB 1TZ1A 3DQVA 1VZ6A 5DM63 4KGTA 1Q82C 1KAAA 2AYOB 2XK5B 1NJIC 3HGBA 2D62A 3J7A5 2EKIA 1UELA 1DD2A 2WP8J 1Q3LA 3NP8A 3GTGB 3VH3B 4GLAC 4ZK9B 4XWWA 4BBRG 3HVZA 3NE5B 1Q81C 1DOLA 3J81L 2K04A 4OELB 5DM73 1K9MC 2YVCA 4LF5Q 2O5JC 1HUNA 4LLGM 2WQYB 1BKBA 3KLRA 2O4XA 1UAPA 3A4RA 4QUCA 2VQEQ 1XMQL 1PQSA 1SSOA 1WCMB 3IAM1 1I6VC 2K05A 1D2BA 1PHJA 2RPQA 1ENFA 3F8TA 4RF0A 3R8BA 1LTAD 2E2IB 1UF0A 1K8RB 2JRHA 1UEBA 4HJGE 1XCQL 3NY5A 4GNXC 3HIZA 4USAA 2B2YA 3ZXRA 1HQMC 2WIIB 1C77A 2ZTDA 2BA0A 2FE8A 1S72A 1R4MI 3M4PA 5M3MH 4MJSB 1E8XA 2B63B 2X6GA 4A55A 2O6VD 2ZTEA 4LJZC 2DYBA 2LUMA 1HZAA 1VCIA 1OXSC 4DK5A 3PRMB 4JQWC 4E3CA 4C3IG 2JA6B 3CSFA 1IBKQ 3NVWA 1PZJD 4C4VB 1SROA 1IUEA 2W9NA 2FIDA 2Y5BB 1FXAA 2JP1A 3TEXA 1YJIA 1I50H 3FKIG 3EGRA 4FVMA 4FJZA 3IAS1 2R92B 1UH6A 1NDDA 2B8GA 4RFBA 3VAWA 4OX9Q 5LL6S 1VDZA 3BYTB 2JYEA 2KMCA 1B3AA 4WJPA 1KLGD 3HKSA 5CV9A 4RGMA 2VZKD 4HPPA 2RA4A 2IO0B 4LUVA 5JEAJ 3DBHB 5EE1A 3RFZB 1ET6A 4AWJA 1JWUD 1S5CD 2B2TC 3VXWA 3IRBA 1B8AA 3UDFA 4BBSH 5C5MA 3AV8A 3MXUA 2NZ1D 4LDTD 4HIDA 1HNXL 4JK1C 4PV1C 2NWGA 5DLQE 2D0PA 1I3QB 2DENB 4YTMB 2WXKA 1EWHA 1VQFA 1TWHH 3QJYA 1Z7TA 4IO9A 3E56A 3DBSA 1WTHA 4GXBA 3IFDA 3ZYYX 2UUBL 2KYWA 2WXFA 4B6WA 2KN5A 4JI3L 3A8KE 4L63B 3RNFC 1SSNA 2FCMA 1JT8A 5E6OA 3A8IE 4A3EB 2G1EA 3LYYA 4WIPA 2IZVB 5F2DA 1GO3E 1KJTA 2L12A 2NPTB 4W9DA 1VQLA 2EY5A 2XVSA 2WACA 4JI1L 3C3LA 1TYGB 3FILB 3AEGB 1Y8PB 1NCVA 2PZWA 1O78A 1S3OA 2UXBL 5IT9c 3MEFA 3AE6B 5GMVA 2BYTA 1Y14B 4QAYA 1ZKHA 3SEBA 2L55A 4CYEA 3TUOA 2ASQA 1MSHA 2ZJPA 4OWWB 4DR7Q 2R7FA 1VRAB 5CX3A 3TEYA 3S16B 1UE7A 1B9NA 5C4XH 4C7ZA 1YNXA 3CMEA 1WWTA 4DPGA 5G55A 3K8AA 1I4GA 2A69D 3U4EG 1U4PA 5I9PA 1RAXA 4JIOU 1SGHA 1WJ6A 3AU4A 4MN3A 5ELCA 2O5IC 3ND9A 2AL3A 4RM9A 2F0TA 2VB2X 2CHZA 1IW7C 1PH7A 2I1JA 3RNAC 3GTMB 1PTOH 4B3MQ 2JX5A 3OIQA 4B9XA 2ASBA 4G3XB 3T3OA 2CS4A 5KYLA 2IO1B 1K8MA 4MH0E 3HG9A 3ND8A 5EE0A 4LF9L 4LF6L 4PK1A 1UE1A 1YHAA 4MHEA 5IGBA 5D3IB 4GOPA 1C8CA 1XPRA 2WXQA 1GKHA 4KKUA 1AE3A 2IJ0A 1TWFH 2R93B 1EQQA 3P2BA 2NN6I 1WIAA 3PUZA 3DHHC 3DBRB 4K3BA 2K5HA 2KHWB 3FMCA 1X55A 3VUXA 4KHVA 4ILWA 4DR4L 4ANVA 1A8VA 2F3VA 1VZ7A 4LNNA 2OTLA 4JLCA 4HN7A 2LD9A 2CHWA 4KI0A 1WVLA 3NELA 3KF6B 4A3BH 2L1AA 2OEDA 4M8MA 4BKGA 1RL2A 3N1ZC 1N33L 1GB1A 3EFXD 3S1RB 2JA8B 3KYCD 4X66Q 5IYDG 5C4JH 1XLNA 2EVBA 2QDLA 3U4ZA 1DGJA 2KXJA 3FHWA 3RUZA 3DBHI 1MG4A 4DV2L 5IP9G 5IP7G 1OXTA 3PSEB 4IDIA 4KKSA 2KMMA 5CHFA 4KN4C 1UE6A 4RA8A 2DLBA 4REZA 4ZKBB 1XMQQ 4GN5A 5KHOA 2BCOA 2ZNVC 4XTCS 4ZCKA 3QOJA 3ZNID 3A74A 4IWOA 2F0JA 2FJ2A 2LSSA 3UE1A 1SFOB 4BBNF 3BJUA 4A9AA 2NBFA 4OGQC
chains in the Genus database with same CATH topology
5J1ZA 1WD0A 1PTOF 1TT2A 1PGBA 2K6AA 1JALA 3VR5A 2E2JB 4GDLB 4TSSA 1AW7A 3W5VB 2R6GA 1EU4A 1WTOA 3GTLB 4YT0B 2Q8IB 4H2AA 1VJKA 2BDNA 1BCPC 4TKOB 2QEJC 3DM1A 5E4XA 2WXMA 1LT6D 3BG3A 4XWTA 4IUPA 1E10A 2X6LA 1CHPD 4LK1C 1EY7A 2WDVB 1LT4D 4J1MA 4L2YA 3H91A 1RF2D 2A6HC 2DYMA 2N7JA 2DN8A 1SYGA 1SJHD 1E2WA 1D5XC 2EYOA 3ZJTA 2EYPA 2SOBA 5BN4A 3IT6B 4NP5A 1AFPA 1ML0D 3CQZB 1TWAB 1GUWA 1XF5L 2IGGA 2WDRB 1H9SB 1ZKOA 3TZDA 4XDDA 3M3YB 2RDFA 3QB3A 3FILA 5M9OA 1MD2D 2TMPA 1ZP0B 1BUIC 4RKBA 2JEBI 2HQEA 3VQIA 2WU5B 3I70A 2BS2B 4N9TA 3PUXA 3NTKA 1GUOA 3HKZB 4C2MB 1PRTB 4Q0FA 2PNRC 2YEPF 1L0VB 1G91A 2QILA 3HRDD 4ZQ3A 2FFKB 5HG2A 3V2TA 4IFDJ 2NTTA 1MGSA 4XDXA 4U673 2M2LA 2CHBD 2AWNA 1LTGD 3M4OB 1HZ6A 1PYWD 2K5WA 3Q8CA 1S4ZA 2B2VA 4M8AA 3K59A 1E0ZA 2F0KA 2NN6H 1RODA 2GB1A 1ZYRC 4YXDB 1PFNA 1NYQA 3BK1A 1EIHA 1HPCA 2RDGA 4BA2I 3U2SC 1PDXA 2K5QA 3HEJA 1L6VA 1FRRA 4C1NK 2E6XA 3J9CA 1EU3A 4F88A 1F77A 1FCCC 2FINB 1E9MA 1PZKD 4JPSA 5CYUA 1ENAA 1Z47A 2Y3AA 2J4XA 2PCFB 5C5LA 4J6HA 2MEKA 1QNKA 1YN5A 4CKEA 4KGRA 2LEKA 5NUCA 3MWYW 1HHVA 1SNOA 1R9TB 4OZBA 1WYGA 4A3DB 1JW9D 4FNFA 4LMQD 3NXWA 2K22A 5KRUA 2KCCA 1F2LA 1F2RC 2PW9A 1AZPA 3DWMA 1FNWA 3CRKC 4KY5A 1ZDXA 1F2YA 1BUVT 2TSSA 1G291 2ON8A 2K33A 3SR6A 3AN1A 3KQ4A 1AN8A 2JYOA 2OT2A 1EIGA 4DF7A 4RWSC 4I65A 5CORA 3D4DA 3KLSA 1WTRA 2MPMA 3AEEB 4FXCA 3R2IA 1X3QA 2AQ3B 1JQ4A 1QLBB 2EJFC 4K5WA 3NUCA 4IFDI 3EVQA 1PMRA 3M7GA 1EZ6A 3GQBA 5KIXA 4P2CB 5M3MB 1QT9A 4E6IA 3A7LA 1DCZA 5FO8B 1BXTA 2WXRA 3LNNA 2Y0SB 3I4NB 1HTPA 2DNCA 3I72A 1DYQA 3MHBA 2GI9A 2Z4HA 5JOBA 1CQFA 4HEA1 5IT9L 2IPKD 1SE4A 2IW3A 4KD4A 4CJ2C 5KNDA 4DAPA 1KRHA 1IGDA 1EWCA 1A3TA 5I9OA 4CQNA 2L83A 3AB9A 4K14A 1HTLD 2EELA 3FEWX 4N9PA 4IUTA 1OQQA 3U52E 1BQQT 1WTQA 4B9WA 3MHZA 4K5XA 3VR8B 1XLOA 1S5FD 4XDCA 5T1GA 2IX1A 2F0VA 3VYTA 3ERQA 4XYQA 1WSPA 3I73A 5HURA 5GXGB 1C4PA 4C80A 2RKSA 2JZPA 2A69C 5C4ZA 1AZQA 1W6KA 4ZYSA 3MFYA 3VA5A 3Q0AA 4MIUA 2W3RA 5FR3A 4K5VA 2EY1A 3NHHA 2M19A 4KKTA 3TN2A 2PKOA 2WDQB 1BCPD 1KDCA 1BR9A 1SIJA 2CVRA 4KKJA 3AEAB 2F0SA 1PTOB 5C4HA 2KWDA 2F0DA 1FCLA 3R2TA 1O80A 1G8ZD 1ZPSA 2XWBB 2A6HD 2DNEA 2F0PA 3ABVB 1P7EA 2B2TA 1C4QA 3OMGA 2INNE 1O7LA 1BOSA 1SYFA 2PPBC 3CHBD 5JJZA 5ISRA 3AH7A 4NDXA 4ULLA 5FKAC 2AX5A 3ZGZA 1N5WA 4A3BB 2LY7A 5J22A 4IOIE 1ZE3D 2EYMA 2F0FA 2M9VA 3J80E 4DAYA 5C4JB 3MC0B 3JAML 4KHZA 2EE1A 2A6EC 4LTUA 1E6EB 1EYDA 2KACA 1TZOA 2L52A 3K5NA 1T6BX 1KF6B 4L23A 4IFDH 1QE6A 3Q8AA 2KHSA 2KQ3A 2WXOA 4EQPA 1XYIA 4Q2JA 1I4RA 1D1KA 2JYTA 1SEBD 3TEWA 1XCTL 4NAWB 1SB3C 1JCKB 5JAVA 3V96A 2QF7A 1Y69U 3G6JB 2MJ8A 4DN4M 4C3HB 2BB6A 5D65A 2X69A 4BY7B 2YEPB 1QOHA 1MI0A 3BVMA 5BYRA 4PMCA 1ZYRD 4DNRB 1FFVA 1XWEA 1GOZA 1RTNA 1STEA 1TWCB 3K6OA 1ENCA 4K2LA 4UAIA 3NS1A 4HCSA 1BDOA 2PLPA 3BDOA 4V190 3I9V1 2H89B 4DK1A 5AUIA 1P7FA 1E0BA 5J39A 4X3SA 1QJOA 3OIPA 5KGUA 1FFUA 1MPEA 1B2TA 2K0PA 3KUPA 2ICEC 2EPBA 2LMCA 2KVMA 3C46A 2MGSA 1RM6C 5E6JA 1MVKA 3VR6A 1STYA 1KNEA 4N6EB 4R3DA 3Q6SA 1PRTC 1W6JA 3DUZA 2B2WC 1TS3A 2V4IB 2V3NA 1R4PB 1FXIA 1F0ZA 1HQRD 1RKNA 2BS4B 4JE3B 4ZRQA 3P63A 2CU3A 2NMQA 4OO1G 1DZ1A 2NVYB 4FF2A 2RSNA 3FVQA 2PIAA 1YNNC 3D3RA 3BS1A 4ZRZA 1RHPA 5CBAE 2XRQD 3NSWA 1EEFD 2E75C 5EE3A 2XN9C 1L0YB 1FEHA 1CFMA 2D2CC 2L32A 2BBCA 3P1HA 1GHKA 2MJDA 3VR2A 3NPPA 4EE2A 3ZQ4A 2BB5A 2KA7A 1Q8IA 5I2XA 2JXTA 1X32A 2I2YA 4GDKB 1U4MA 3A55A 2PO4A 4R9WA 1AP0A 1Y8OB 4XQNA 2FBWB 4WFN3 4A3JB 2K1BA 1F2ZA 1C76A 4B0EA 3HZXA 3I90A 2CJNA 2ENBA 1TKYA 1C48A 1TY2A 1KTKA 4KMUC 3U9SA 4NAMA 1RD9D 2VZKB 1EWYC 3E6ZX 3VR9B 4MH8A 1J7CA 1ZOYB 2HDMA 3AE9B 2N0SB 2IWHA 1PGAA 2YU9B 3Q8FA 1CTMA 5H8YE 1YQ4B 2ID0A 1MBYA 2MH7A 3MXPA 3VYRA 1Y56A 4KGSA 3I91A 4CBVA 4HROA 1ONLA 1FNVA 2E76C 1CA6A 1EYAA 1LO5D 3QOLA 4PMWA 1KABA 3VYSA 2AQ1B 1MHHE 1D5ZC 5C44B 1T5EA 5HGTA 2DY8A 1SYEA 4L8JA 5FLXE 1ROEA 4A3GB 4TMAB 3OMCA 4B08A 4EVOA 3RPFC 1NUCA 4IUVA 2IX3A 2IX0A 1Q10A 1XO3A 2N9LA 1HEZE 4R8NA 2EY2A 2WLBA 2ZXPA 2L5TA 1HUMA 4OIJA 2KQ4X 3BYYB 4IUUA 3LB8C 3L9AX 3PIO3 4FF1A 2KDMA 5C0XG 1G2SA 2JU6X 1A6XA 3J7YW 1AYFA 3NVYA 1ICWA 2HTME 1SYDA 5EKLA 1C79A 3BIID 4G4KA 1HFNA 3U7ZA 2F0NA 2F0UA 1SF0A 2Z8LA 1B4OA 4NZLB 4HR7B 1K52A 2H88B 2K3UA 3GP7A 2PMZB 3I4LA 1Y1VB 3DWQA 5JPNC 5EGTA 5KNBA 3OOCA 2F0IA 1BO0A 5G3LF 1UWMA 1A15A 4XQJA 5M3FB 3S1NB 4FF4A 3RD4A 5A35A 2A6ED 4PMBA 1A70A 1B1ZA 1DJRD 2ONQA 3BZDB 4CJ1B 1H9MA 3PUVA 5K36H 2IDYA 5JPMC 3QIAA 1D4BA 1UWXA 3KWLA 1XLPA 2O2LD 2E2HB 2M0AA 2MP1A 2WXPA 4K8IA 2OEOA 1BF4A 1HRJA 1HCZA 5ELFA 4LK0M 3J80L 1EY5A 4YTNB 2J42A 4WWMA 3P75A 2C5CA 4KTAA 1PTOC 3HP3A 1TKGA 4RNAA 2BT6A 2BS3B 2E74C 1Q90A 1F9PA 5IOCA 1K50A 4BA1I 3NVVA 3P20A 3L4PA 1G2TA 2ZT9C 4BBRB 3QO2A 2LS01 2JSVX 2B2YC 2BA1A 3WDNA 3NRZA 1NAPA 3T13A 1M4VA 2VXWA 2PYKA 1WTWA 1VZ8A 3SHLA 1LT3D 4PT5A 2KJXA 1TWGB 4DK0A 1GHJA 4KY6A 2EYHA 1CJEA 2F0EA 1D6EC 2K32A 1LTTD 3EUB2 3PUYA 4N59A 1FYCA 2I46A 4Y7NB 3MZ5A 1M8AA 3S1QB 4DQOC 1DONA 1NEKB 1EFID 1JE4A 3K57A 1RTOA 1B9RA 3FKIB 1PRTD 4NJCA 3TP7A 3D4RA 3IT4B 2B2UC 5C2TB 5CC4A 1AWDA 2F0LA 1V1OA 2CJOA 3AE1B 5IGEA 2PVGC 1YNND 4M1UB 4FO2A 3PIP3 5E3FA 3T51B 3S14B 1E2ZA 1JWBD 3P4QB 3GTKB 4XT3B 4DU9A 4YTPB 3X3NA 1EM7A 3SVMA 1N63A 1E7PB 3WOFA 1TVXA 1XEEA 1J7BA 1SNPA 3FPPA 1TS4A 3FPUB 1YQ3B 5EPKA 2F0MA 1JROA 4J3OD 4ABNA 1WRIA 3K0YA 2INPE 4YWGG 2YYZA 2KOLA 1PDQA 1FD6A 1QCBD 1QOBA 1V1PA 1F9SA 3P1MA 3V05A 5EJWA 3J7AF 3L3OC 1A2TA 4DGZA 1PFBA 3S9WA 1ZXIA 1JQYD 5EBDA 2SDFA 3A54A 3D31A 3NTHA 4WRDA 3OWEB 4IUNA 2WNMA 3Q22A 2KEDA 1LTRD 5BYQA 5D3DA 2F0GA 1EY0A 5I6YA 1FRDA 4QIWB 1XX8A 1MHXA 4K2KA 3I57A 2W82A 4RAUC 2WINB 4FXDA 2H1EA 1A3VA 3B9JA 5T8IA 1ESRA 4ZUIA 5FO7B 2KCNA 1VDVA 1ZUD2 1SJED 3J7AV 2WXHA 1WTXA 3S1MB 1UEAB 2N9KA 5BMGA 1SBBB 5CV7A 4P6VF 2XRSD 3FRPB 5BN5A 1ILPA 3WCQA 1SDFA 3PUWA 3IAYA 4RHSA 1EY4A 3IFTA 4QUFA 3DEOA 4H13C 3MEHA 1CK1A 4CKBA 4PNYA 1RFKA 3OW7A 3MJ5A 2A5HA 2HDLA 1YJJA 3H09A 3RMHA 2NB0A 1B53A 1QWYA 2OXPA 5IGFA 1PFMA 2WB1B 2JSOA 4TQ0A 5EPLA 4IQZA 4IUQA 2L1BA 4EGVA 4FYDA 2JA7B 2XIWA 4RCNA 4BS9A 5CGKA 2QJLA 1LLRD 1XLQA 4G7ZC 1QQRA 3D6WA 4GLSC 4PQXA 1JWAD 3ITPA 4KJNA 1FO4A 2NN6G 3SFDB 2ICIA 4HEDA 4XXEA 2LMCB 4TQ1A 4K6LA 1KFYB 3NQIA 3GV6A 3PV0A 2SEBD 3E0JA 3GV3A 3BDLA 1I4QA 2D5DA 1OO9B 5I2YA 3AMZA 3HRZC 5EE9A 5BN3A 2PMVA 5LHY1 2RDHA 1N61A 1G6ZA 1BCPB 5JEAG 1QNUA 2N55A 1PZID 3AEDB 4OO1H 1PTOD 2AUJD 1Q12A 2B2VC 3NVZA 1IBXA 4I7ZC 2Q8RE 3GTJB 5EPJA 2G9DA 1QG7A 1QB5D 2CW0C 5ELEA 3SK6A 2DY7A 2F3WA 4IKGA 2QKIC 3F2UA 1SE3A 3MXGA 1H9JA 3KK7A 4IZ8A 1ZXTA 3HOZB 4QCLA 4DNTB 1YNTE 2KN4A 3TBIB 5CMDA 4WH4A 4OHJA 2ZW1A 2G9HD 3I4MB 2LHEA 4C7YA 4H44C 4MACA 1EL0A 3Q8BA 3TSSA 1F9QA 5I6WA 4M0WA 1L6UA 3URYA 3GTPB 3AM9A 2LJIA 2M00A 3S15B 1STAA 3NBHA 1IYUA 3R3OA 1E2VA 2EJGC 5FOBB 5C3JB 1OQRA 1L5PA 1HXYD 4MM3B 1A2UA 2MJ3A 4C3JB 2F0OA 1PGXA 5IGDA 4AQ7A 1GB4A 4EQNA 1J9OA 3KWVA 5CBEE 4XIGS 1STBA 1WTVA 1SNQA 3FDTA 1HA5A 1EZ8A 2F03A 3D6CA 1VMPA 2QMTA 1VF5C 1OFFA 2DBYA 4DAVA 4ODGA 1LACA 3K5OA 3M4YA 3DHQA 3FAHA 4ME5A 2D9UA 2W54A 2GRIA 1U4RA 3K7AB 2D5GA 3TEZA 2F1MA 3Q24A 5EBCA 1C9FA 1UNSA 1FNUA 3E5SA 3KLSX 4TRDA 2A68C 5FO9B 4RH6A 1SYCA 2W55A 5JXVA 2A73B 2CQAA 2KAJA 3H8HA 2RVLA 5D14A 2RQXA 4CKCA 5C0XH 4XYOA 4K6DA 1WXQA 3H0GB 2I07B 5E4WC 3B2FA 3C8YA 1T5XD 4J8QA 3BVZA 4YIJA 5IIFA 1TS2A 2EYJA 2R3ZA 5CV5A 2QDBA 2QCPX 4ZAIA 1RYJA 1TKEA 2JA5B 1K53A 3G7LA 3TMEA 4OW0A 4JX1C 4RF1A 4IALA 3SR1A 3DEPA 1CQVA 3DWGC 3VR3A 2ACZB 1QOGA 4N58A 1C4AA 5BMHA 3H6MA 3D4WA 1TY0A 3UI2A 2SNMA 1V8QA 1H9KA 2ZXOA 4HMIA 1IYVA 2WKCA 2EXZA 3P4PB 3CIRB 3EQLC 3KF8A 3T56B 4US8A 3W2DA 1FR3A 2JXMB 3HOXB 1Y8NB 2IGHA 4JBWA 4ITKA 1STNA 3W3AA 3H94A 5ELDA 5HFYA 1KDAA 1NSNS 2HCCA 2RSOA 1ILQA 3DXJC 5TSSA 4KN7C 4XE0A 4A90A 1WTPA 5G5HA 3C2PA 2W3SA 3SDZA 4DXGA 4IFDG 1ZDVA 1KH0A 1TU2B 1N60A 1V43A 5ELBA 5EKIA 4RGNA 4YSZB 3PO2B 2B2UA 1FMAD 4C1NI 3A7AB 2Y5PA 2L4NA 1SE2A 3HS0C 1L4DB 1YNJC 1OXVA 1SXTA 3EA6A 3AE2B 3QG1A 2MUYA 3LX0A 3SXHA 5JVH3 3AE7B 1F2RI 3NWTA 3QWNA 4HSVA 1DOKA 3AU7A 1CZGA 5KNCA 2NYZD 2KECA 1NR2A 2R7ZB 4OIKA 2JQRB 3O13A 5IT9E 5M5YB 2F0WA 2FUG1 1QILA 4ZHOA 1OXUA 2IT1A 5EQ0A 3K58A 4OVZA 1GPXA 1B9MA 1I4HA 1K83B 1FM0D 3M85A 1D1IA 2NUCA 2HUGA 1HA6A 2XNAC 2LKVA 4QF4A 3HVDA 3C1EA 2XWJB 3LWUA 1J8IA 1GUGA 1CA5A 2K9XA 2LHDA 1GXDC 5CV8A 1IHZA 1TKWB 2NVQB 2K28A 4NMZA 2Y5CA 4AS1A 2J0TD 4G57A 1JWSD 1JB3A 1XXGA 4ZUJA 3AE4B 3ZJVA 1FGBD 1JOKA 3I3CA 1S5DD 4HTHA 2FHTA 2CW0D 3NTIA 4WJWA 2HCIA 2DYOA 3ZJUA 3N52A 2LFIA 1QOFA 2KUMA 3T53B 3TP8A 3P7JA 3OWFA 1D5MC 5LL6X 1EY9A 2PW7A 3A56A 4F8MA 1BCPF 3RZOB 1JORA 3PZ7A 4AYBB 1V1PB 4KD3A 2Q8TA 1CZPA 2PQEA 2XSCA 1JMLA 4ARIA 2WKDA 1I7HA 2L9HA 2JEAI 3VR4A 3IXSA 3DMUA 3MA2B 5BMIA 1N62A 3S2DB 3K5MA 3NBIA 3Q23A 1J7AA 2BDOA 3L7ZC 2Q5WD 3T16A 3V3XA 5C6AA 4KX6B 4OZCA 3DWPA 3D8GA 1RDPD 4A3KB 1LV9A 4YSYB 2J7ZA 3B2GA 3UI3A 3ETRA 1JWMD 1JC7A 5A2QE 1SAPA 2BW2A 2X38A 1Q1BA 1PFDA 2V4DA 1MSGA 1SYBA 1FIQA 2WU2B 3JAME 3SK8A 2IGDA 3W5UB 3P4SB 1SMYC 1EEID 2F4IA 2AQ2B 4F7XA 3TDQA 2EY6A 4BY1B 1VLBA 5AFWA 5C3EB 3LWEA 1C78A 1K8OA 3OPOA 2JE6I 1JOQA 3HOVB 1MI2A 5FK9C 1EOTA 4H7BA 1LTBD 2EOTA 1GAQB 1YN3A 1VR9A 4C3IB 2A68D 4B0MA 3AE8B 4A3FB 3GB1A 2PZTA 3PZ8A 3ONAB 3C1FA 1O7YA 1NYRA 4DA2A 2F0HA 4WAFA 3NQTA 2WXIA 1AEXA 4S3SA 2M56B 4HCEA 5COYA 1TS5A 1UUPA 1RJTA 3BVGA 1F2MA 5HI1A 2MJEA 1S5ED 2WAQB 1F9RA 1TR5A 1CM9A 5K5PA 1DXMA 3VRBB 3MAQA 5G5GA 4BWGB 2I38A 3NZ3A 3GTQB 1UGJA 1ZXHA 3N6RA 2K5PA 1DOMA 2BE5C 3E9SA 3TP6A 1I6HB 1S5BD 2VB3X 2E3TA 2PW5A 4LAAA 4HRSA 2PVOD 1STHA 1I4PA 4K8JA 3CRLC 4KV6A 5DEHA 1LTSD 4OO1I 3SK5A 3AEFB 1A3UA 2C9OA 2WXJA 1HZ5A 1GJXA 3J81E 4R8IA 1WD1A 2V0GA 5JEAH 2BTEA 1QKZA 5CV6A 4FXKC 5K36G 5EKKA 1II3A 2BOSA 1CI3M 4G7OC 3GO5A 4C3HG 4QMGA 4C3JG 4HKZE 1IBXB 1LT5D 2DWQA 1Q1EA 5C0XJ 2SNSA 2Z1CA 1K51A 1EY8A 2NVTB 5C3WA 3EROA 2J53A 4WQMA 2OF1A 1Z6HA 4L6TB 3SFEB 2MHVA 3T3NA 1YNJD 4MT5A 2R61A 1SNDA 2E2DC 4CJ0B 2SAKA 1TQOA 1C4CA 1TIID 1RCVD 3MP9A 1TJEA 1ESFA 1H9RA 2PZUA 3VA7A 2IL8A 1NVID 2RMMA 2EZVA 5KEEA 1HFGA 4RGTA 2WXLA 2FMCA 3NK9A 5MPOA 4U68A 4JWUC 4A6QA 1H9SA 5I4DA 1O7ZA 4KY7A 1IL8A 1BNZA 3P4RB 3BWUD 3HUIA 3P42A 4JWSC 4KJOA 2B8FA 1IW7D 1EQTA 3CU7A 1N5XA 4OL7A 3KBGA 2AUKA 4HSPA 3OHXC 5H92C 5FLXL 4A93B 4ZHPA 2B76B 1YN4A 2WP9B 2B2WA 5E1FA 5DAUA 1I50B 1KNAA 2VUMB 1ACCA 3H3VC 3MTSA 5CR3A 1GUTA 2V3PA 1JRPA 1L4ZB 3W9CB 3M7NA 4XQQA 4RHRA 4FP5D 5BYSA 1R7SA 1EYCA 4ZOHC 4NW2A 1BBXC 4BBSB 4KK7A 3GTOB 3IKJA 2LGIA 3U9OA 2B39A 3AE3B 3MXNA 4O1NA 4FF3A 3LXFA 1NR4A 3MVVA 5C0XI 1TWHB 4X3TA 1STGA 1QOAA 4WORA 3A8JE 2NVXB 1DOIA 1YMHE 4HAEA 2K7VA 4IN3A 3Q69A 3AE5B 4ZRPA 1B50A 1Y1WB 2L0CA 2L11A 2J52A 2QIEB 1JICA 3BDCA 3PMFA 4Q5VA 1JR0D 4F87A 1PUTA 1DOXA 3OSOA 3SK4A 1FD7D 5JVG3 1DOYA 1T3QA 4X3KA 5G3LD 4ZLTF 3RZDB 4DXFA 2HDEA 2FMMA 5C4XB 1XTCD 4P16A 3AMUA 3AB5A 1GUSA 1BMLC 1EY6A 2PTLA 2WV6D 5D7GA 4HMJA 1LABA 1DM0B 3N9YC 1NI3A 4A3MB 4ARCA 1WGKA 3CKIB 1CT1D 2QSDA 1SMYD 4OZAA 4D2KA 4DFAA 1X3PA 4ZKCB 1TWFB 5LNK1 4EQOA 4HKQA 1U4LA 2RPVA 2K5DA 2WS3B 4RGOS 1SNMA 3TP5A 4O42A 5KYIA 5M5WB 4GZYC 2KEEA 3RLFA 5A2QL 4CHTB 4CGYB 2N88A 4Z9CB 2VNUD 1SNCA 2ZXRA 1LTID 2EDGA 3PO0A 3S17B 1ZEQX 3KBXA 3BK2A 1GUNA 2JWUA 2F0QA 2LFNA 4TQUS 5IGGA 3PO3B 3DWAA 1JOOA 1QF6A 5C3XA 1U9RA 1PLFA 2Z4IA 4YSXB 3TZUA 1KLUD 1KDBA 3SE0A 4C56C 3MFGA 4L1BA 2WXGA 4X3UA 2H4OA 3K5LA 3HOYB 3IL8A 5AUKA 1RWSA 3GD7A 1R4QB 1L0XB 2K03A 4H0LC 1ET9A 3X3MA 1V97A 4US9A 5HHDG 4UDUC 3FC4A 2GA4B 5DNFA 2BE5D 5IGCA 2EYLA 3HOWB 3W1SA 4IURA 2RBMA 3AEBB 1VMCA 1IKLA 2EJMA 4QB4A 5M5XB 3CWIA 1PRTF 1VF7A 4NKLA 3EJIA 3NUHB 2ZW0A 3Q8EA 4V0BA 1B44D 4XT1B 1OXXK 2EYFA 1CZWA 3NWSA 2AWOA 1IGCA 1NENB 3AECB 4ID6A 3VRAB 2K01A 2OHFA 3I8ZA 4WURA 4FXGC 3T4AC 1V8CA 1I4XA 5T1IA 4A8XC 5CV4A 4KKIA 3GS2A 3HOUB 3VYUA 2A74C 1EQVA 4RKLA 3WOEA 3R93A 5IODA 1PXUA 4G7HC 4RCOA 2WXNA 1CHQD 2NTSA 3S2HB 1IKMA 4A3IB 1VZ6A 5DM63 4KGTA 1KAAA 3HGBA 2D62A 2EKIA 1DD2A 2WP8J 1Q3LA 3NP8A 3GTGB 4ZK9B 4XWWA 3HVZA 3NE5B 1DOLA 3J81L 2K04A 5DM73 2O5JC 1HUNA 4LLGM 2WQYB 3KLRA 2O4XA 1UAPA 4QUCA 3IAM1 1SSOA 1WCMB 1I6VC 2K05A 1D2BA 1ENFA 4RF0A 3R8BA 1LTAD 2E2IB 4HJGE 1XCQL 4USAA 2B2YA 1HQMC 2WIIB 1C77A 2FE8A 2BA0A 2B63B 2X6GA 4A55A 4LJZC 2LUMA 1VCIA 1OXSC 4C3IG 2JA6B 3NVWA 1PZJD 1IUEA 1FXAA 2JP1A 3TEXA 1YJIA 3EGRA 4FVMA 3IAS1 2R92B 2B8GA 4RFBA 5LL6S 1VDZA 3BYTB 2JYEA 1B3AA 1KLGD 5CV9A 4RGMA 2VZKD 2RA4A 5EE1A 3RFZB 5JEAJ 1ET6A 1JWUD 1S5CD 2B2TC 5C5MA 3AV8A 3MXUA 2NZ1D 4JK1C 4PV1C 2NWGA 1I3QB 4YTMB 2WXKA 1EWHA 3QJYA 3E56A 1Z7TA 3IFDA 3ZYYX 2WXFA 3A8KE 4L63B 1SSNA 3A8IE 4A3EB 2G1EA 3LYYA 4WIPA 5F2DA 2L12A 2EY5A 2XVSA 2WACA 3C3LA 1TYGB 3FILB 3AEGB 1Y8PB 1NCVA 2PZWA 1O78A 3AE6B 2BYTA 3SEBA 2L55A 3TUOA 1MSHA 1VRAB 3TEYA 3S16B 1B9NA 4C7ZA 1WWTA 1I4GA