2AQ2B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-CELL RECEPTOR BETA CHAIN V
total genus 71
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq2B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq2B01
1FNWA 1LT3D 1PTOB 1I4GA 4RCOA 3TSSA 2XRQD 1PZJD 1EU3A 1V1PA 1L0XB 1JWMD 1BXTA 1XTCD 1BCPC 1JWUD 1STEA 5FKAC 1M4VA 1LTSD 3SEBA 2O2LD 3DWAA 4ZYSA 4UDUC 3O13A 1EFID 3R2IA 1JCKB 1JQYD 3R2TA 1CK1A 1RD9D 3BVZA 4OHJA 1PTOH 1FNUA 1KLUD 2RDHA 1B44D 1FNVA 1YN5A 1BCPD 1V1OA 4RGNA 1FGBD 1SEBD 2AQ1B 1EU4A 1SJED 5ELEA 4RGMA 1SE2A 1MD2D 1TS2A 1DJRD 4RGOS 3GP7A 5ELDA 4NZLB 1XXGA 1GOZA 1PRTB 1JR0D 5TSSA 1PYWD 1PZID 5I4DA 5ELFA 1AW7A 2QEJC 2QILA 2XN9C 3MFGA 1ET6A 1PRTF 1I4PA 3V05A 2XNAC 1TY2A 2TSSA 1YN3A 1QILA 1T5XD 1CQVA 2IJ0A 1HXYD 1D5MC 2SEBD 1UNSA 1EEFD 1YN4A 1LTAD 3BZDB 1CHPD 1SE3A 3MC0B 4O1NA 1AN8A 4DXGA 1SBBB 1I4RA 1LTGD 2G9HD 2NTTA 3BVMA 2ICIA 3EFXD 4RGTA 4C56C 3BYTB 1LT4D 3DWPA 5D3DA 1I4QA 1PRTD 3BVGA 1D6EC 1LT5D 1B1ZA 1ET9A 1PTOD 2J4XA 3CHBD 1HA5A 1SE4A 1ESFA 1L0YB 5D3IB 3R8BA 1EEID 2NTSA 1CHQD 1S5ED 1FD7D 1UUPA 1RCVD 2IPKD 4L6TB 1CT1D 1LTBD 1LT6D 1JWSD 1TS5A 4L63B 1ENFA 2AQ3B 1SXTA 3KLSX 1PTOC 4Z9CB 1LTID 1HTLD 1I4HA 1RDPD 1TS3A 1SJHD 1TY0A 2CHBD 2WV6D 1S5DD 4RHRA 1HQRD 1PZKD 1RF2D 3W2DA 1TS4A 1DYQA 1S5BD 1BCPB 1LTTD 1S5FD 1S5CD 4TSSA 1V1PB 5ELBA 4BWGB 1I4XA 3URYA 1F77A 2XRSD 3BYYB 1KTKA 1EWCA 3EA6A 3OWEB 4RFBA 4DXFA 1PTOF 4K6LA 2Z8LA 2AQ2B 5ELCA 1BCPF 2RDGA 1D5ZC 1KLGD 5FK9C 1G8ZD 4RHSA 1D5XC 2R61A 1LO5D 4RH6A 1LTRD 1PRTC 1LLRD 3DWQA
chains in the Genus database with same CATH superfamily
3GTKB 3SGIA 3RCZA 4HMIA 1QUQB 1L6VA 3TSSA 1JB3A 1SAPA 4H7BA 2RMMA 1HCZA 4W9JA 1JE5A 4KHZA 5IP4D 3QG1A 2F3IA 3LNNA 1AZQA 2A8VA 2M4NA 3HVZA 2LGIA 1STNA 2JA7H 4BBSH 4UDUC 4IWOA 5LMNL 3EN2A 4WJQA 4NXMQ 4CJ2C 4OIKA 3CP0A 4B08A 1H9JA 5IP9G 3BVZA 2KHWB 3AQQA 2UXDQ 2IDYA 4RCNA 3AE9B 2RF4A 1YN5A 1VQHA 5D65A 3T1HQ 3QARA 4P1BC 1T0RC 4O0AA 1JWBD 1GUGA 3HS0C 5CX3A 1GUWA 3NPPA 3APCA 5IE8A 3KQ4A 4A3JH 3M4PA 3ZRCA 1WI5A 1X3GA 1UWXA 1WJ4A 4NJ7A 3D4RA 1HE8A 2XK5A 4AQYQ 5LMUQ 3H91A 1ZEQX 4C3HH 3NWTA 3PS6A 5EAYA 2F0HA 4XT1B 1K8AC 3S2DH 2X8XX 4BBNF 3UINB 5I2YA 2PCFB 3AB9A 4X3KA 2XGTA 2Y5CA 5IY0A 1WJ6A 4ZUIA 3L08A 3VR5A 5EGTA 3J7AV 1VMPA 3NE5B 3QJYA 1S4ZA 1TWAH 1N62A 5EE0A 3PV1A 1BT0A 1C79A 2JVCA 4GDKA 4JI1L 1OXVA 5IO9A 2BPSA 2N8NA 1UH6A 2BW2A 1C9FA 5IGDA 5GAEC 5JJLA 1XMQL 1G6ZA 2BF8B 3PSIA 2B8FA 1JJ2A 3PO2B 4JI7Q 1A63A 2WACA 4HTHA 4EVOA 1NENB 1JORA 1SYBA 3PCOB 1F9JA 5JEAG 5BR8Q 1Q82C 3DHIC 1VCIA 3GDEA 1WE7A 4PMBA 4ME3A 3Q3MC 4NAWB 5IA7A 2RKSA 1U4PA 4OWTB 1TJEA 5CV8A 5CC4A 2JA6H 2SAKA 5JZEB 4H13C 1MHXA 1SE4A 1FRDA 3PLVA 1LGRA 1GJXA 1Y1VB 1IYVA 3PIOA 1R4MI 3R3OA 4A3DB 1TS5A 2F3WA 4DPGA 4EX5A 3J80c 1A6XA 3ND9A 4IOAA 2AQ3B 3RLNA 1FO4A 1E24A 1B3AA 1G91A 1S3SG 3OTOQ 4DAYA 2K39A 2QC8A 4M01A 4DK1A 4HEA1 2OXPA 3CMAA 1R4MB 3HIZA 2CW0C 2V1YA 1H9SA 2K1BA 2CR5A 4CKBA 2EY2A 4CDDC 4KY5A 4ZKCB 4CJ0B 2JQOA 5A2QL 1EZ8A 4BY1B 3EA6A 1EQQA 1XX8A 2XWBB 4G7ZC 3Q0AA 3J7ZC 4KGSA 3AEDB 4FXCA 1B9MA 2A5UA 1SB3C 2Z4HA 4AQYL 4DV4L 1N5WA 4FXGC 1VQDA 3R66C 4A3DG 3X0WA 4PMWA 4NPNA 3F2DA 2XK5B 2QEXA 1U4AA 4WQOB 1I42A 3DQVA 3AEFB 1GNUA 2HUGA 5IYCG 1YITA 5M5YB 3Q8CA 4I6PA 4ITKA 1IL8A 4B3SQ 3OLMD 3R7RA 4P75A 4BS9A 4ANXA 2WKCA 4ZHPA 5FKAC 1WX7A 5M3FH 1LTSD 2Z0SA 4BY1H 1JROA 2EYHA 4GN3B 4QGUA 2MSED 1MHWC 3AV8A 2Z1CA 3ULJA 1GG3A 3MXPA 2KTRB 4FVMA 4FJZA 4ARIA 1R4NI 4OHJA 1YNJC 1Y8RC 1UWVA 1FJGQ 2JPHA 2L3ZA 2XEWA 3Q8BA 3QJZA 4O2DA 3V96A 2EJFC 4DNIA 3JSVB 1WD1A 4G57A 3CF6E 3Q14C 4M0WA 1HNZL 2WWZA 4JI6Q 2KANA 3RPFC 4BFRA 4HJGE 3LDZE 4X64Q 2FHTA 4EUTA 4R9WA 3PSEB 3GTLB 4W9LA 3RZFA 1B2TA 5C3JB 2F4VL 3QAQA 1HTPA 4XTCS 4W9HA 1STBA 2H4OA 5DPTA 1PRTB 2WP9B 2MW5A 4DUYL 1T0YA 5EPKA 1GKHA 2IL8A 2UUBQ 3K6OA 5ISRA 4POGA 4A3BB 1JOQA 3SR6A 1XMOQ 1OGWA 5FLMG 3FILA 3QQ8B 1FFVA 3PT2B 1NR2A 4LJOB 3MJ5A 1EIFA 3FEWX 4UHVA 1RYJA 3M3YH 1PDXA 3K58A 4KV2A 1EWYC 1C4AA 4CDFC 1IP9A 4EQOA 3KYCD 1YBYA 4TVAB 3C0RB 5IP7G 3IT6B 3EUB2 4DN4M 3GZNB 3I4LA 3MXGA 1R9TB 3CF5A 1AZPA 2MJ3A 3WIMA 4GKJQ 3WALA 4JBWA 1GHJA 4KIKA 4A20A 4FP5D 4OGQC 3NTHA 2RDBC 4YSYB 1SBBB 4AWJA 3FKIH 3LB8C 3RZDB 3BVMA 4RGTA 4FF1A 3VR9B 1IHZA 2C35B 1LT4D 5D3DA 4JV5L 1FRRA 4BOZB 3ECIA 4WAFA 4BXXG 1HA5A 4C1NK 2NN6I 1WY8A 3KBGA 3HKZB 3DVGY 2JUOA 4BKSA 3EBEA 2NTSA 1LYLA 1WTHA 3G48A 2A5HA 3I63C 2CVRA 3PO0A 1MI2A 2INDC 2V4IB 1X55A 2VZKB 4XWWA 1A3VA 1ZE3D 2D5GA 4M8NA 2MLBA 3H09A 2YLMA 1SJHD 2JWZA 4V190 1RF2D 3KUDB 2F0VA 1HR0L 5G55A 3U58A 1SYEA 1A3UA 2KD0A 3G71A 2N9XA 1BOSA 1VS0A 2NWGA 2NBFA 3I55A 1SE8A 4GN5A 4ZRPA 2HTME 1HFGA 2IHFA 4W9KA 3GD7A 1KRTA 1PH3A 5AZGA 2EY5A 2D10A 2OCEA 4K81A 4HIOA 1QOGA 3TBLD 4UP8A 5I2XA 1BBUA 1QVFA 4ANUA 2NVYB 4XQNA 4USAA 5ELCA 1NUCA 3A9JA 1BCPF 1KLGD 3NBIA 3J7A5 4A93G 2KDMA 1YNND 3NVVA 4A3IG 1V9PA 1ZKHA 2VS1A 4TV3A 3BK2A 4K6DA 2KHIA 1V80A 1TWHH 2UYZB 3JVZX 1FNWA 1N8RC 4I6LB 5T1IA 4DHJD 4DAPA 3HOYG 4IKGA 4CHKA 4CKCA 4YY3Q 3J81L 1NBWA 1TXYA 2QHOA 2B2WC 5FLXE 2CQAA 1A2TA 1P98A 3Q8AA 2EYPA 2B63B 4FA6A 1Q5WB 3M3YB 1B3QA 4IUNA 3D31A 5JJKA 2ZNVB 2I38A 1C48A 5DLQE 1PA6A 4HJ7A 2C5CA 4KJNA 1FM0D 2IO3B 4KSLC 1HA6A 2GLSA 1TBEA 2PO4A 4W9CA 4IWQA 3RMKC 4OO1H 4N6EB 2AL3A 2ZW0A 4WH4A 2QDFA 4RGMA 2LFIA 4NNJB 5CGKA 1VLBA 4NQLB 4MN3A 1DJRD 1WGRA 2ZTCA 3NTIA 4JBJA 4P71A 2WINB 3L3OC 1NJIC 1WYWB 1J5EL 2D07B 4LF6L 3K81C 4DV7Q 5TSSA 4LDTB 1KIXA 2MO1A 4P16A 3A1QB 1ISNA 1UF0A 2V0GA 5T1GA 4JI0L 4L8JA 1EYDA 3GZNI 4G50A 3BZCA 3R93A 1XCQL 4YTPB 3J81j 2HIVA 2GBJA 3BDLA 2Q2UA 1X3FA 2DNCA 2L1BA 2PZTA 3MVVA 3GTKH 1EL0A 2IZVB 2JWUA 3N32A 4MM3A 5D6JB 4BY7H 1Q8KA 4HCNB 3P4QB 1IPGA 1QUQA 1Q8IA 1C4PA 1SYCA 2SOBA 1X6OA 5DM73 5LMNW 1YN4A 2MUYA 1X54A 1DXMA 3QK0A 1ICWA 4JWSC 3TEHB 1V86A 4DXGA 1NYQA 2VQFL 2WXJA 2JA5G 1QZEA 5E6JA 1TGZB 4BKSD 3HKSA 5J18A 1Y8PB 4A55A 3RYTA 2DY8A 4A3GH 4C3JB 1VR9A 4CKEA 5COYA 3VTUA 1YNNC 2NUCA 2A68C 4HAEA 3AEVA 2PEAA 4FJYA 4OO1G 1T0QC 4A8XC 2VH1A 4YCWA 3EFUA 4MSQB 2VY3A 3VYTA 2K22A 2BCOA 2OWOA 5LXIB 2YEPB 4J6HA 4DK0A 3RUZA 1I4HA 1TY0A 3M63B 4P6VF 2GVBA 5IGFA 3JAMc 3CWIA 3TL5A 2BE5C 1YZ6A 3NZ3A 2FUHB 3WDNA 1QF6A 3U9OA 3I2ZA 4OIJA 4X62Q 2N7EA 1YEZA 1E8XA 5LL6S 1EWCA 2YU9B 4WIPA 2M56B 4J15A 1PTOF 4DFAA 1IBKL 3EFCA 3K7AH 4X66L 2Z0EB 1EY9A 3ONAB 2BH2A 2R92G 5E4XA 1VMCA 3AEEB 1MJEA 1KQSA 2BWES 4YXDB 1U9RA 3ERQA 3V60A 1GUOA 2VXWA 2XIWA 4LNQA 3P1HA 5C0XJ 1EF1A 4OELB 1HUNA 3DWQA 4MGKE 4Y52H 5NUCA 1F2RI 2ZW1A 2RA4A 2L05A 5LLIA 1TWGB 1X3PA 2JZPA 3F2BA 4ZAIA 4KSKC 4ZYNA 4YHHQ 1STEA 1WRIA 3PRPB 2D0OA 4FHKA 2ON8A 1BBWA 2NN6H 2O2LD 5E4WC 4DUZL 4DV3Q 4R1JA 1VZ8A 2QDLA 4NW2A 3W9CB 2F0WA 4TUUA 1R4PB 4B3SL 2L0CA 3HOXB 1H4RA 2Z4IA 2PNHA 2PZWA 4K5WA 4RGNA 1YX6B 1EWHA 2I5LX 5GAHC 3B08A 4B95A 4IUPA 4JBKA 3DBHB 2PI2E 3K80C 5JHBA 1M1KC 2SNMA 2C60A 3NS1A 4LAAA 4WJPA 4DV4Q 2MEKA 3VXWA 3GP7A 3PZDA 1WTXA 4NZLB 1STHA 3BDOA 2JA8B 4KD4A 3J81E 3ZLZA 1M90C 5IGCA 3T1YL 4MZ9A 5I4DA 3KF6A 1TWCH 3P7JA 1GUTA 1AH9A 4JVZA 3ERSX 1K8RB 2OHFA 3K9OB 3P42A 3TEYA 2DX5B 3B6YA 1KHIA 4A3DH 3P2BA 4QB4A 1EY6A 1PFSA 1HQMC 2KQ7A 2LXKA 2WXLA 4FDBA 1XMOL 1TY2A 2NR2A 4JL9A 4ASWC 3W1GA 5GAGC 1XF5L 4QCLA 4B3RL 3MZ5A 2YTVA 2GBRA 3UF8A 3TBIB 4A3MG 2R7ZB 3DVNU 5BYRA 3I4MB 5A35A 1EYCA 3E9IA 3A9KB 3OAWA 1UNSA 4JK1C 1PV4A 4BY7G 2BT6A 1L6UA 3I70A 3J7AF 1E9MA 4E74A 1LQBA 2Y5BB 2R93G 4ICVA 3GS2A 3VR6A 2JA6G 1VCBA 2Y3AA 1ONLA 1OXUA 5C3WA 1ZYRC 4GZYC 1FJGL 2PVGC 4CBVA 3KWLA 2K5PA 1FXTB 2ES2A 2JA7G 5IAAC 2N55A 2HDLA 2RSUA 4HJ8A 5LNK1 3NELA 2J0MA 1WVLA 2J7QB 3HOVB 2PYKA 3EQLC 4POFA 3C8YA 3HOXG 1WYDA 3LYYA 3K9PB 2JSOA 3S1MB 5L37A 4HXDA 1HTLD 2WV6D 1K8GA 4AS1A 1YJIA 1P7EA 2OTLA 1CFMA 2WDQB 1YQBA 1WZ3A 1DYQA 3A74A 3S9WA 2BQQA 1E10A 1YQ4B 3Q22A 5C6AA 4CQNA 5F2DA 1LFDA 3MC9A 3PLUA 2WFWA 2E74C 4R8IA 1TZ1A 2WDVB 5BMHA 4F1SA 2EDGA 4ACFA 2BGFA 2H89B 2PQAA 4C3JG 1N34Q 1A0IA 4WWMA 3D6CA 3HOUG 2B2TC 4IFDG 1T3QA 3G4SA 4GLAC 2CH4A 2IYDB 3IFDA 1N63A 5FK9C 4C3JH 3CW2C 1Q81C 1SN8A 2BA0A 4B9WA 4DR4L 1GXDC 3NQIA 3LJ3A 5FR3A 3FKIB 1OQQA 4W9GA 3RNAC 4HROA 2GN5A 5EQ0A 1K52A 3KW5B 1KABA 3NUCA 3S2HH 1CJEA 3E56A 1LUZA 1WCMB 1J6QA 2GMIC 4GLSC 1O7YA 5LMNQ 2L15A 1I6VC 5IIFA 2MO0A 3SEBA 1YNTE 2L1AA 3DWGC 1SRUA 2DGYA 1JCKB 1RD9D 2AMCB 2KHJA 3CCSA 3M85A 4XC2A 1H9RA 2RDHA 2PW5A 1VQAA 4ICUA 1F9SA 3OMCA 1UGJA 4LFCL 3J7YW 4DV2L 5CMDA 5FLXL 2NBVB 1NI3A 4MJSA 3ZIMA 3ALBA 4OVZA 1XNRQ 3D32A 5C4XG 4K7SA 1SJED 1QOFA 3P75A 4NAMA 1EIYB 4KVGB 3T13A 1C78A 2LJ5A 2V3PA 4QUFA 2L83A 3RNCC 1C8CA 1VQPA 4YY3L 1PH1A 2FBWB 3OJ4B 4KIKB 4IJLA 5E1FA 2VRRB 1VQJA 2IY1B 2K3UA 2K8HA 5ELFA 4HJAA 1AW7A 2RSNA 3AEAB 4KGRA 1MKHA 3MFGA 2M2LA 2AWNA 4IUUA 4H44C 3TP5A 2N9KA 5CBAE 1U5KA 1ESRA 1AARA 3D3RA 3FPPA 3CQZH 1U4LA 1E2VA 4FLHA 2KVMA 2MA9B 1PFDA 3HOWH 1PFMA 4EZJA 4DHZE 2B2VC 2EPBA 2N78A 5BN4A 2MHVA 2QCPX 1VQKA 3S1NH 4YIJA 4LF4L 4C00A 2F4VQ 2ASQA 1N32L 4CGYB 3WAOA 2G4SA 1SE3A 1E90A 3KJPA 4UAIA 2JU6X 1BNZA 3H9DA 3I90A 2Q5WD 3KDFA 2W82A 4WWPA 4EQNA 1TT5B 1E7VA 2LWPA 3ONSA 4C56C 4N59A 1Y1WG 3U8ZA 2PIAA 5KEEA 4XE0A 3BVGA 1XT9B 4EQ5A 1DOLA 1EIGA 1QKZA 1WOCA 3K7AB 4F8MA 1B50A 2CFMA 2E2IB 5J39A 2XWJB 2IPKD 4L6TB 4K8JA 3HM6X 4L63B 2EYOA 4ZRKA 2O2VB 4Q0FA 1VQOA 3MEHA 1V6EA 1OFFA 4IUMB 2LASA 1PTOC 1Y8OB 4II2B 2AHOB 5J2RA 1J7BA 4X3TA 2E5LL 4DWFA 1GAQB 2K6DB 2KBNA 4L5RC 2ZNVC 1ML0D 5JH5C 2KENA 2J0TD 2R92B 4RF0A 4I7ZC 5AJ3L 3N20C 2F0GA 4KDIC 3BYYB 3SDZA 1IBLQ 4GOPA 3S1MH 2WDRB 5G5HA 2IT1A 4A3CH 3M7NA 3I72A 3A8IE 2JYEA 1I50B 1P0RA 3BIID 3VFKA 4LMQD 1T5EA 3RLOA 1XTDA 1PH9A 1AFPA 2HDEA 2LGXA 1WGYA 5HI1A 4B3TL 3IFWB 3DXJC 2WB1E 4I7AA 2AEHA 2Y0SB 2R61A 1JB7A 3GE3C 3E3XA 4A3FH 4B9XA 1WM2A 3HEJA 4AJYB 2Y0SE 3HOVH 2VB3X 4K8IA 1AEXA 3OTOL 2J42A 2XRQD 1V1PA 4DR1L 1J5EQ 3KUPA 3CSTA 4WJ4A 2KVRA 2F0IA 3ZDTA 1PXUA 2UUCL 3J81i 1TVXA 3O13A 1XLPA 2L0TA 5EDSA 4PT5A 2Z9HA 4KK7A 1UE1A 3DBRI 1TKEA 4YSXB 1Q46A 2KCTA 4JOIC 2JXXA 3KF6B 1WCMH 1EF5A 1EO6A 1QQRA 3CRLC 2K5WA 3TRZA 2V1CC 4JI3Q 3C2PA 2WXHA 1G6JA 2W9NA 4JIOU 4R4CA 5M5XB 1GC6A 1E7ZA 4FULA 2XTIA 1WCMG 2EXDA 1DOYA 1P16A 4X65L 2HT1A 2BVCA 4ZUJA 3NG0A 5ELEA 3NZSA 4U673 5FJ8H 2WGSA 1EUVB 2HQLA 1A70A 2VNUD 4HIMA 2D2QA 3RZOB 4IFDI 3TP7A 1WH3A 3PPAA 4FNFA 4DR2L 2MBOA 3NWSA 4MDKE 2B2UC 1D1IA 3LX0A 3RT3B 3VR2A 2VW9A 2ZPYA 3AEGB 4LUVA 4KMUC 1YJJA 1CKMA 2R7ZG 1YX5B 3S14B 1X1MA 3UDGA 3I4MG 2K5DA 2QJLA 4KKSA 1Q3LA 4AYBG 1QILA 1OEYJ 1VQMA 2K9XA 2REXA 3VQIA 4EZLA 1CKNB 3UDXA 2CHWA 2NPTB 2NZ1D 2HCCA 2IJ0A 3OPOA 3H7SA 1II3A 5M3MG 5LMUL 5CHVC 3SFEB 3TIXA 1N34L 3T53B 4CJ1B 5HHDG 4F7XA 3J80L 1KDBA 4KN4C 2E75C 3F1ZA 3DHHC 3GTQH 1L7YA 3I9V1 1F2LA 3D4DA 1TQOA 3JAML 2PE9A 2L8JA 4A3OA 2PMZB 2NZOA 2BYTA 3KWVA 2J7ZA 2NVQB 4OWWB 3WA0A 1LT5D 4GLVB 5M9OA 2FXQA 4ANVA 2K4KA 1YHQA 2BKRB 1EEID 5CV4A 3CC2A 4A3FB 1UUPA 4IURA 5IOCA 1RCVD 3PTFC 2MWSB 1L1OA 4M02A 2B2UA 5L95C 4JOIA 3ABVB 2KEDA 5D7GA 1QJOA 3L9AX 5JPNC 3ZNHB 1XJVA 2JXTA 3SD5A 2BS4B 3V6EB 2WXRA 1NDDA 3NBHA 2PE6B 2D2CC 1SNPA 3FDTA 1V5OA 1F1HA 1XLNA 5J22A 5C5MA 1D3ZA 1KNAA 1SNOA 4HJKA 2L11A 1BDOA 1Y1VG 2ZT9C 3RLFA 3MTSA 1I4XA 5BN3A 2GBKA 2XRSD 3LGJA 4DV6L 4KI0A 4X57B 3VYSA 1VQNA 2RCFA 1G2SA 2ID0A 2N9EB 2DAJA 4RG1A 1NYRA 3AECB 1GO3E 2KECA 3RI7C 4DR1Q 1O7IA 2ZTDA 4W9FA 1F2MA 2KQSA 3FPUB 1PQSA 2WXIA 1XPOA 5BMGA 4LF7L 1E7UA 2I1JA 4WAAA 1RL2A 2EE1A 4DHZB 1H9MA 3PUVA 2FCSA 3QIAA 3L0OA 1BUVT 2ALYB 2IGDA 3PF4A 1SSOA 3A4RA 3S1RH 1VQGA 5C3EG 1SIJA 4ZLTF 3T16A 3J81c 4HWIB 1TTNA 1WIAA 3T1YQ 1YD8U 3GTJH 1N33Q 2LMCA 3S2DB 4DV1Q 4RMAA 3FMCA 5DCNA 1A2UA 2EVBA 1OXXK 2EY6A 1IUEA 5AJ3Q 3M4OB 1M94A 2B29A 4ODGA 1B70B 5D14A 1LTLA 3T1HL 1BCPD 1F2RC 4WWOA 1MGSA 4YWLA 1WF9A 1X3QA 3I73A 3M4YA 3I3TB 3GTOB 1J0GA 1VZ6A 3J80i 1J7CA 2KACA 4IW0A 2Z6KA 1PUTA 5BYQA 2EJMA 2HD3A 5G2NA 4HKZE 4IUVA 4RGOS 3E9SA 2PNRC 2D0PA 5C44G 4YCUA 3VTWA 1AE3A 2KFKA 2M17A 4DUZQ 4DV3L 1F9QA 3NSWA 3U4ZA 1ZDVA 2BWFA 4JYAL 2EOTA 3E9HA 4C3HG 1BUIC 2UXCL 5IOIA 3ZTDA 1PRTF 4GDLA 2DHZA 2FINB 3FRPB 3PO3B 4R4IA 1N5XA 4C4VB 5JAVA 5CYUA 2CS4A 4FF3A 1Q1OA 1HZ9A 3KLRA 3CCRA 3GTOH 2KMAA 1Q0WB 1XQQA 2IBIB 2YVCA 1WR6E 4TKNA 2N3SA 4DR5Q 3HOYH 2SEBD 5DPSA 2BH8A 3SK5A 1N33L 2EELA 3Q3FA 4YTMB 4X66Q 2KX0A 4JI8Q 1E5WA 3CPFA 3BZDB 3RNUA 2NVTH 3CCQA 2UU9L 1S3OA 3M4OH 2A69D 2E2JH 3NHEB 3A55A 3U7ZA 2K5VA 2KFKB 2N1VA 2B8GA 2G9HD 1JJGA 3QIJA 2ICIA 2I07B 2OT2A 3S16B 1DONA 3V2TA 3MAQA 1Z5SB 1B1ZA 3HM3A 3J9CA 3HRZC 3VR4A 2FAZA 4MEMA 4KGTA 1XYIA 4G7HC 3SK8A 3GB1A 3ML9A 2YEPF 1FD7D 1TWHB 2K32A 4AYBB 2DZMA 2E8GA 2F0NA 1H95A 4YWMA 4EZKA 4RKBA 5JVG3 5EKKA 5A2QE 3EECA 3UQBA 4FJVB 2YYZA 1Y14B 2N7DA 1P8LA 3P4RB 2KQ4X 4DBGA 1AP0A 3I57A 1IBXB 2L76A 1FCCC 2KCCA 1ZKOA 2DJGC 3VRAB 1QOHA 1SR3A 2R6GA 2RVLA 1VQLA 2MPMA 1PVOA 1G51A 4OEMB 1O7ZA 2VB2X 3PGZA 4MGZE 4IWPA 5FOBB 2IY0B 5IGGA 1OQRA 3Q3JA 4HPLB 1E1OA 4K6LA 1Z2MA 3PUXA 1ZXHA 3MP9A 1X65A 3W5OA 2JZ3B 4R4OA 2WS3B 1SNDA 3LXFA 4IUQA 4X64L 4YCVA 1HUMA 5K5PA 3ULPA 3T8MA 1D5ZC 2F0PA 3W1SA 1EWIA 4IFDH 1HNWQ 1VRAB 2MRPA 1HNZQ 5TR5A 1D5XC 1VDVA 4RH6A 2O6VB 1KLVA 1SMYD 4ABNA 1JJCB 2KAJA 3GO5A 2KDBA 3DBHI 3B2GA 1ZDXA 2K5NA 3DBLI 1XTCD 1MI0A 3I4OA 4WORA 2WXPA 1STYA 3OHXC 2TMPA 5E7NA 3R2IA 3C1FA 2KQ3A 3MXNB 2QF7A 1IBLL 1VQCA 2RPQA 3TCAA 4GB9A 2BKFA 2LKVA 3F2CA 1QNUA 4BBSG 3V61A 2V9HA 4CHTB 4G3XB 2WP8J 1B44D 4KTAA 1HJPA 3O65B 1WI0A 2F0JA 4I65A 5C4JH 2EJGC 4IALA 4DV0L 1QVGA 3ENEA 1FGBD 1SEBD 2CH4W 1A3TA 2KJRA 4PS8A 3H94A 3Q8DA 1MIUA 4II3B 5GMVA 2MJ8A 4KJOA 3T56B 3KK7A 2RDFA 3CMEA 2Q2TA 2WDTB 3PZ8A 4KLKA 2YTYA 3I4NG 4LLGM 4JG2A 4C3IG 1PYWD 3QHTA 3GTPH 4X65Q 4NP5A 3M9BA 5DNFA 3GTGH 1WGDA 1ET6A 3BY4B 1WJNA 3ZJTA 3PV0A 1E22A 2JZZA 3ZGZA 2E2HB 2HJ8A 2DYBA 3H7PA 4IFDJ 3BZKA 3OSOA 1YN3A 3CKIB 3WCQA 2INCC 3B9JA 3S2AA 1DOMA 3NXWA 1T9HA 2LY7A 4ZQ3A 2MFIA 4KKIA 1CZWA 1PGXA 5C3EH 2BA1A 1ILQA 5M3FB 2HHHL 2CU1A 1SMXA 3AH7A 1ENAA 3FP9A 1QCBD 5JXVA 2D3AA 4PYZA 4C3IB 2JA8G 3N3KB 2ZZPB 2K01A 4MT5A 4WJWA 1I4RA 3HG9A 1NE3A 5IYDG 1C7YA 3L4PA 3TMPB 1O7LA 3BDCA 3N30A 3BYTB 1WWTA 1TIFA 3KF8A 3RN5A 1PLFA 4LNIA 3S1RB 1KOTA 2IWHA 3TDQA 2PQEA 3FKIG 4KHVA 2UXCQ 4NAWA 3SK6A 1Y1WH 2DLBA 4FXKC 2JYTA 1F52A 1LTID 3HFZB 3TEZA 3A9KA 3J80E 4HRSA 3CCVA 1BKBA 3QR8A 3MJWA 4DR7L 4MGIE 2UXDL 1V1PB 1P1AA 4A3CG 5C44H 2LVOA 2F0OA 1UELA 1NAPA 1PH7A 2KWCA 4JI2Q 2LD9A 1GB1A 2KJXA 1IBMQ 1B9NA 4CO7A 4DR6L 4BVUC 2KXJA 2I0QA 1BO0A 3T3NA 4HPPA 2DENB 1MHHE 3HOVG 2DZJA 5G3LD 1G8ZD 3NY5A 4XX5A 3RMHA 2R92H 1SFOH 4GU2A 1X3EA 1Q90A 4N58A 5KRUA 2WLBA 2ZEQA 2LHDA 4DV5Q 2A4ZA 4URKA 2E2IH 1R7SA 2N1WA 4FHJA 3DM3A 4XQJA 1VQ4A 1BMLC 4RCOA 1WTWA 1K73C 2ZCCA 3V3XA 4UY8C 1G291 5M3MH 4LF6Q 1HNWL 5CV7A 2MJDA 3L54A 4C2MB 1D1KA 4GDKB 2UU7A 3ZTCA 1KDCA 3DLLA 4EFOA 4G4KA 4ZYSA 1N6ZA 2DBYA 4LF4Q 2ACZB 5CHFA 3E6ZX 5G5GA 2M0XA 1IBKQ 3ZJUA 5M3FG 4A3IB 4DHJB 4JI4L 2K8BA 5M5YH 1FNUA 3H6NA 1P7FA 4IM0A 1WMHB 1N60A 1NY4A 1S72A 1FXAA 1EYAA 2DY7A 4KHPL 2ONQA 1HTOA 1KH0A 2K28A 1QOAA 1EYGA 1QG7A 3CXCA 2L00B 1EFWA 3KF8B 1F2YA 2L9HA 1YQ3B 2CJOA 2AUJD 2EYLA 1KC8C 2GRIA 4L23A 2F0EA 1LM8B 1XXGA 4WRDA 1XNQL 1WGHA 5HG2A 1I35A 2X69A 2MP1A 3IKJA 5FLMH 2JRHA 4JI1Q 4ULLA 1SNCA 3FC4A 2FUG1 4XWTA 2MQHA 3PIP3 4W9IA 3BG3A 1IGCA 2GA4B 1K50A 1I4PA 3RNBC 2XNAC 2PPBC 4M00A 5C4ZA 2KC1A 2O2VA 3UIPB 4A3PA 4KKJA 4XYCA 3ZNZB 1E3PA 1RODA 4DNTB 3LWEA 2W54A 1UBQA 3NRZA 1LABA 4V0BA 4A3FG 2B2WA 2K33A 1JE4A 3CC7A 1HXYD 5AZFA 1WYGA 4DR5L 2QDBA 4LF9Q 4F8CB 2QSDA 5T8IA 3Q24A 5IODA 4U68A 2F03A 4BOSC 2LGYA 5JEAH 2D9UA 2EKEC 3UGBB 3HP3A 3C19A 1VDZA 1W3SA 1CKOA 3D6WA 4A3EH 2NVXH 1GC7A 2OEDA 2UUAL 2BS2B 2LI5A 5JJIA 3EGRA 2F0KA 2INPE 4UPAA 1HR0Q 1PTOD 3QB3A 3I91A 1STAA 1WTRA 4HJ5A 1ESFA 1KM7A 2PVOD 2ZCBA 4ZRIA 3S1QB 2K6AA 4LK0M 4DR6Q 4A9AA 1K0RA 1TKGA 5CR3A 4ZK9B 3PRMB 4QL5A 1RLFA 1LTBD 3AE5B 4IPCA 4FF2A 4DXAB 3DBSA 2PTLA 2MBQA 4HPMB 2A6EC 4C2MH 4JV5Q 1JW9D 4KN7C 3TEWA 1O78A 3RULA 3W2DA 5GQOA 2ZJRA 3N9YC 1VQ9A 3Q2AC 4JC0A 5C3EB 5EPLA 5HY6A 1HR0W 5ELBA 3JC66 1CA6A 4OW0A 1WZ0A 4DAVA 1F77A 1IYJB 4IG7B 1KTKA 4K1RB 3HOZG 1YNXA 3OWEB 3P4SB 3NVWA 4BBRG 3HOWG 1PH2A 3TP8A 1UD7A 1EOTA 3NHHA 1L0WA 3EJIA 4L5SA 2M19A 1PFBA 3PIPA 3B1LX 1XLQA 2AWTA 3JSVA 4J3OD 3U2SC 3SVMA 1WXAA 3GTGB 4HSVA 2DAFA 5C2TB 3VVWB 4BBSB 3L10B 4E71A 3TP6A 3DOWA 4GNXA 2W3RA 5C44B 4ZOHC 1ZYRD 1MJDA 4LFBQ 1EIHA 2N0SB 1LT3D 4DUYQ 3SFDB 1Q1EA 3NQTA 3ZO5B 4GOCA 3A5ZB 2KJ6A 4A3GG 2IY5B 1BCPC 1JWUD 1O80A 1S1QB 1A15A 3AE6B 2ZJPA 4H0LC 1SSNA 1ZGUB 4OVVA 1K9MC 3CD6A 3TQYA 5FO8B 1GHKA 3OJ3A 2KHSA 1WM3A 3P20A 5EE1A 1TKWB 5FO9B 2EMSA 5I9OA 1HZ5A 4AYBE 1FNVA 2K7VA 2FE8A 5FR6A 4DR4Q 2F3VA 4APVA 2VQEQ 2UUAQ 1JICA 2WAQE 1GPXA 4G0NB 4US8A 2ZXOA 4XIGS 3AE2B 2KUMA 3JW0X 3ZUNA 2E2JB 4A3EB 2NVXB 2OQKA 1F2ZA 1SE2A 2F0TA 3I4NH 1MPEA 2G4DB 2M1MA 4ZRZA 2KKCA 2DJFC 4LNNA 3VR8B 2WHIA 5ELDA 1HZAA 2KDEB 1GOZA 1AE2A 4Q5VA 2ZVOA 1JMCA 3K5MA 1GUAB 2BB6A 2WXKA 2BYFA 1YHAA 5AFWA 3S1NB 4TMAB 4DAYB 2QEJC 2QILA 2XN9C 3VRBB 1ASYA 1OEYA 1JRPA 3RN9C 4A3LH 4QAYA 3V05A 4GOPB 2WNMA 3ZKJC 5H1SE 2NVTB 2MCNB 3SHQA 4CYEA 2FCQA 5EBDA 2TSSA 5K36G 3A4SC 1J8IA 3AFQA 1IYUA 1T5XD 3P1MA 5MPOA 4N9F4 3A33B 4GKKQ 2LS01 3Q8EA 4QIWE 4PS3A 1EEFD 3RZOH 1SDFA 5E6OA 2Q8IB 4N9TA 2CU3A 3AE1B 1DM0B 1AN8A 3HGBA 4KKTA 3WWVA 3M7GA 4F87A 3AULA 4LTUA 1X56A 5J3BA 2G5DA 5KYIA 2KOLA 3OIPA 2FJ2A 3RFZB 2UU9Q 3ND8A 1TR5A 4RKLA 5IWAL 4ZCKA 4DQOC 3TS2A 2B3AA 4B3ML 2RPVA 3UQAA 4M8AA 4KZCA 1NMGA 3PQIA 1F0ZA 4IQZA 3ZQ4A 2BDOA 1WTOA 1EY8A 4B0MA 2WXNA 3X3NA 1HHVA 1WXVA 2NB0A 1TS3A 3PGEA 3FHWA 1SMYC 1HTQA 3R3MA 2R3ZA 2K03A 3EVQA 1SYGA 1S5CD 4O42A 1SYFA 1YHBA 3S2HB 5KNBA 4JPSA 4J8QA 1YIJA 1YJNA 3NVZA 4EEWA 2AYOB 4CDCC 1HH2P 5M5WB 4LF5L 2IX1A 3R7QA 1FFUA 1PGAA 3H7PB 4OZBA 3UE0A 3GTJB 4L1BA 4WJOA 4ZKBB 2UUCQ 1HZ6A 4ZDVA 4ZRJA 5E6NA 1IW7C 3GV6A 1L0VB 2E2DC 2N49A 2VUMG 1HFNA 3ZRFA 1XCTL 3B0AA 4W9EA 3ML8A 3IHPC 1MVKA 2UWQA 5KNDA 1Q86C 2ASBA 4RHSA 4NY0A 1E2WA 1IW7D 3KOJA 1QOBA 4OONA 1W6KA 1HZCA 2EMTA 1PRTC 4R8NA 2PKOA 1EY0A 1FPYA 2CJNA 3U50C 2AL6A 1I50H 4LNFA 2NPTA 4ARCA 1PYSB 2FMCA 1WSPA 2IO2B 1WGGA 5IYCH 2BTEA 2RBMA 4PZ8A 3SHLA 1I7HA 3KFUA 2KNBA 3GQBA 3KUCB 1DOIA 3U4EG 4KY7A 2F1MA 1TWFH 3SE0A 4ANWA 3MXNA 3HK0A 1VQ6A 3RNFC 1E8ZA 3EC8A 3QWZB 2JP1A 4OX9L 4TQ1A 1GJZA 2A6HC 2PMVA 5BMIA 3AMUA 1J8CA 1OTCA 3F8TA 1VQ8A 4BY7B 1QB5D 1NI2A 3VUXA 1K83B 2A1AA 5KNCA 1P3QU 1KF6B 3APFA 4GS3A 2NYZD 3H0GB 5LL6X 4A6QA 4DK3C 1WXSA 3CRKC 4DK6C 3IRBA 3RNEC 3A8KE 1JQ4A 5CV5A 1DCZA 1FYCA 4K14A 5C23A 3N1YC 1WTPA 1FGUA 3VA5A 4JI3L 1WGKA 1IXRA 2QW7A 2PW9A 5GXGB 1CKNA 3A7LA 5IGEA 4M8MA 3ZNGC 3MEFA 5J17A 2EZVA 2L12A 1ZW7A 4H2AA 1V5TA 1N32Q 1IBXA 1Q7YC 4HDOA 3NK9A 3M95A 3DVGX 5JJZA 3MC8A 1LACA 4TQUS 1J9OA 1C76A 2PLPA 3CCLA 3KYDD 3MC0B 1K3BC 3TREA 1VF7A 5E6PA 2VUMB 2INNE 3IFTA 1Z6HA 5LXHA 3KLWA 2LGDA 4MGYE 1ENCA 1OXSC 4HEDA 2O4XA 2JEAI 1PRTD 1I4QA 2IGHA 2JJQA 3NUHB 5IT9c 2PPHA 4K5XA 4GSWA 1QZHA 2WXFA 4E6IA 1EQRA 1FXIA 1B4OA 1PHJA 2AX5A 2J0JA 3OW7A 5CV9A 2LUMA 3AE8B 3DVNV 3FKYA 4JQWC 1WJUA 3DWMA 1YOVB 5LHY1 4XYQA 2K04A 1ZXIA 2BS3B 3SDLC 1UEAB 2MBHA 4HCEA 2D5DA 1YI2A 1WJJA 2IX0A 2WAQB 3V62A 1G2TA 3ETRA 1QLBB 4RNAA 3U52E 2NVYH 4BA1I 1N36L 1BCPB 4MELA 1S5FD 4IOCA 3CMMB 3A8JE 5KHOA 3UIOB 4QUCA 1BF4A 4NPSA 3W1BA 4A3KB 4LFAL 4JE3B 3W1YA 4R4TA 4JYAQ 4EOYA 1X32A 4P2CB 3ULLA 2F0MA 2ZXRA 2MJEA 4RF1A 3I3CA 4DR2Q 2SDFA 4DA2A 4HLEA 3HHMA 1C0AA 1Q12A 1MSGA 1C3TA 2AUKA 2JQRB 5C3XA 5L83A 4A3LG 2FNJB 2P5ZX 1TWCB 1I3QH 4YTNB 4YHHL 2A69C 1HPCA 3M4QA 4TRDA 2HE7A 4PV1C 2MHJA 1OTRB 3DCGA 2VUMH 1E1TA 2OF1A 1FR3A 1LTRD 1VQFA 4A93H 3AE4B 1CQFA 1FL0A 1YMHE 2NN6G 2ZM6Q 1EU3A 2KVZA 2CW0D 1XNQQ 1L4DB 4AIMA 2OTJA 4FXDA 4ILWA 2CQOA 2AWOA 3PF5A 3U9SA 5IT9E 2QMTA 1LM0A 1MSHA 1OXTA 1TYGB 3H0GH 1SROA 1Q1BA 4RM9A 4A76A 3C3LA 2A6HD 4X62L 4MTNA 3AB5A 1SYDA 4WWNA 2RSOA 4NB3A 3CCEA 1EZ6A 2JRIB 4E3CA 1RAXA 1Z9FA 3HKZG 4A3KH 2AQ1B 1XO3A 1XPUA 2WQYB 2K5HA 1MD2D 4JCVE 1TS2A 2D62A 3Q3NC 3W5UB 2OJWA 1TWAB 4J6IA 3EIVA 3ER0A 1C4QA 1NBFC 1VJKA 5KYLA 3NVYA 2NBUA 3SXHA 1EY5A 2RCNA 3K5NA 1DGJA 5H92C 4LJZC 1SF0A 4MSMB 1H8CA 4I6NB 3ZW3A 2BE5D 3KYHC 4JBMA 4JI6L 4TKOB 3NEMA 2L7RA 5K36H 3FVQA 5M3MB 3AYHB 2WAQG 2GBNA 5HGQA 4MHEA 4LF8Q 4YL8A 3I8ZA 2DYMA 5C0XH 4FADA 2IW3A 2LUEA 2I2YA 2D3BA 4MACA 2EYJA 1NR4A 4BBRH 2KCMA 2VQFQ 1UAPA 4BKTA 2A68D 5AEKB 1C9OA 2JE6I 3G6JB 3W1SC 1ZPSA 3NS8A 4XGAB 4NJ6A 4F88A 1LTAD 4TQ0A 1B7YB 1CHPD 1JRUA 3CQZB 1SIFA 1NSNS 1PH6A 2KZRA 4HSPA 1MBYA 2VL6A 4N9PA 4O1NA 4J1MA 1U0LA 5EPJA 1L1OB 1Z47A 1BVSA 2JYOA 4LW1A 1I94L 2E3TA 3L13A 1PYBA 1E0BA 4LFAQ 4DDGD 1FD6A 1X9NA 4EE2A 5M5WH 2L52A 2J0KA 2PQAB 1N36Q 2XVSA 1I3QB 1ZUD2 1XLOA 2WX1A 4GKJL 4BY1G 3AXCA 2JA9A 4FN2A 1BR9A 3VUWA 4M0WB 1F9PA 1CSPA 3TJPA 5IN7A 3PUYA 4EGVA 4BXXH 1FMAD 3GOEA 3M3JA 2Z6KC 4LF9L 1N61A 3HVDA 3HZXA 3K0YA 4IPHA 1I6HH 2K5QA 4OL7A 4Z9CB 1JOKA 4YWKA 1HQRD 4XT3B 2IX3A 3A56A 1KXLA 1V49A 1XWEA 1S5BD 2HTHA 3DPDA 1A8VA 5FJ8G 1LXDA 2HJ1A 3IAS1 2Q8TA 2V3SA 3S15B 3H3VI 2DZKA 2ZJQA 3VYUA 2GVAA 4NXML 3CCMA 1MG4A 4MTKA 3T51B 5C4HA 3I5JC 3H3VH 1K53A 1N9WA 1KRHA 4DU9A 3TS0A 1LV9A 1UWMA 1CZGA 2AQ2B 3STBD 3HOZH 4Q2JA 2MP2A 2N7JA 3C1EA 4RAUC 2DYOA 4LF5Q 2WXQA 3OG5A 4P72A 1I6HB 3BWUD 2I5MX 3Q8FA 2C9WB 4QQBX 1LO5D 2JT4B 4ME5A 1MG8A 1VF5C 4G7OC 3A5UA 5IYDH 5AUKA 1L0XB 5IP7H 1C1YB 4OZAA 5CTRC 4OO1I 4XQQA 5EE9A 2OQ0A 1JC7A 5M5XH 1V9JA 4NQKE 1EOVA 3ZDMC 1Y8NB 3ZJVA 2M0AA 2JA5H 1CUKA 2F0FA 2KK8A 4GDLB 3VH4B 4C7YA 2OOBB 1PTOH 1BBXC 3DUZA 2PW7A 2ICEC 2QGQA 2R93B 5EKLA 4OX9Q 2G3QB 3X3MA 5G3LF 3H0GG 2BYVE 3L7ZC 3NP8A 1C77A 2X38A 5CHWA 2D3CA 3T3OA 2ZVNA 1EUJA 1EU4A 1QWYA 3S15H 2BB5A 3UDFA 4ZRQA 2B39A 1WE6A 3DEPA 4GXBA 5KIXA 2CHXA 3QX1A 1WTQA 1UBIA 4LK1C 4PZ6A 1JWAD 2R7FA 3RD2A 3SU8X 3WOFA 3PZ7A 1PH8A 1D8LA 2KEEA 3PUZA 4LWCA 3I4MH 3N6RA 1XNRL 2J53A 2NBWB 5BYSA 4WJ3M 3DBRB 2LGSA 1E7PB 2B2YC 5DPWA 4AP4C 1DD2A 3VAWA 4NDXA 4LUZA 1YIWA 2IHEA 4A3MH 3T4AC 2WKDA 4GNXC 5JPMC 3QOJA 3NTKA 2YU9H 1TIID 4HK2A 1CQVA 2PJHA 3E5SA 5JVH3 1TZOA 3TEXA 1D5MC 4C4VA 1E8WA 4ZHOA 3OWFA 4C1NI 1UGMA 1RJTA 1SNQA 2A73B 2BOSA 1RRBA 1F9RA 2F4IA 3QA8A 1UZXB 4C3HB 1C4CA 1K51A 4OZCA 4PYUA 1CTMA 3L0WB 2KLCA 4PMCA 2C7NB 1KAWA 2WXGA 1L4ZB 1JMLA 3DDCB 1LTGD 1ZP0B 3PIO3 1K3RA 5J1ZA 3EFXD 1B9RA 3ZYYX 1J7AA 4HDQA 2KN4A 3M62B 2QKIC 1S40A 4US9A 2L4NA 1PMRA 1ET9A 3CHBD 2K52A 3QOLA 4X3UA 4A3MB 4JI4Q 3UI3A 2Y0SG 4DV7L 1CZPA 3R8BA 1QZGA 4FYDA 2WU2B 4S17A 1E0ZA 2R2OA 1GD7A 4HN7A 3H8HA 3K7UC 3D8GA 4H02A 2RHSB 4A3JG 4P74A 1TT2A 1ENFA 3K5OA 5FO7B 4AH6A 3SK4A 5IWAQ 3A54A 4B3RQ 1R4NB 4JWUC 3KLSX 2LXAA 2VZAA 2CKHB 2KN5A 2CHBD 2W3SA 3IL8A 2LEKA 4MNOA 3PO2H 2DNEA 1RFKA 4C7ZA 1LTTD 4IPDA 4XXEA 2KWUB 3AN1A 4WURA 4OXPA 2JN4A 1GM5A 3DBLB 1G6PA 1QVCA 3CCUA 5C0XI 3HOWB 1PH5A 2PZUA 2ZTEA 1DOKA 3H15A 4DXFA 3GTQB 2KMMA 4C3IH 1VQ7A 3S1QH 3AMZA 4K7WA 2CCZA 3KH0A 4GIVA 4DK5A 2Z8LA 2MX2A 1NNXA 3ZNID 2E76C 1CSQA 2MGSA 2RDGA 4A3JB 2KJHB 2HDMA 3KLSA 4IM3A 4EQPA 2RHQB 3Q69A 2C9OA 4BA2I 1LLRD 2LXCA 1PTOB 1CMXB 4JPBW 4MH0E 3U7DA 2KCNA 3GTLH 1XEEA 1JWMD 1GUNA 2K14A 4ID6A 2K6QA 2WX0A 1MFWA 2Z0DB 1EQTA 5CBEE 5IGBA 3N1XC 3DWAA 4HIDA 2IO1B 1EFID 2VZKD 3GTPB 3PHWB 3R2TA 1KFYB 3W3AA 3N1ZC 2O6VA 5E3FA 1JT8A 2LSSA 2WU5B 4KX6B 1Q10A 2RQXA 2M8SA 3Q3OC 2ZM6L 3EROA 4K2LA 3K5LA 4FF4A 1FIQA 2HD5B 1V1OA 1WD0A 5IP9H 1FCLA 2K05A 1L2NA 5GROA 2O5JC 2QIEB 5IKCM 2JA7B 5DEHA 4JI0Q 1NVID 1B53A 2WB1G 4XDCA 3HOZB 1E2ZA 3JAMi 4DV1L 2F0SA 1TWGH 1W2BA 2N4FA 5BO4B 4NJCA 3AE3B 1EM7A 3RR5A 3V6CB 1R9TH 4A3KG 3GTMB 1A62A 2CHZA 4DF7A 1RWSA 1JR0D 4X6AH 3HRDD 1WMHA 1J19A 4N8X1 4UP7A 5CORA 3VH3B 2ZXPA 3RZDH 2PI2A 3H3VC 2E6XA 3DM1A 5EBCA 1RHPA 4LF8L 5HURA 2ATWA 2K75A 3IXSA 1K8MA 2IGGA 1IZ6A 4N8FA 3WANA 2VH2A 1ICFB 2JK8A 3PRZA 1TKYA 3VDZA 4S3SA 1T0SC 2KDFB 3ITPA 5IT9L 2FCMA 4IZ8A 2R93H 2FIDA 2V4DA 3DHGC 4YSZB 4QF4A 3PHXB 2OJRA 2D3GA 4LNKA 2JF5A 1SGHA 4LFCQ 1RIPA 2H1EA 3QWNA 2I1KA 1B8AA 1BQQT 1TU2B 3K57A 4A3BH 1V8CA 1SE9A 3BJUA 3CSFA 3A7AB 3AI5A 1SNMA 3DWPA 2FMMA 2UUBL 2PMZE 4A3EG 3PREA 1D6EC 3X23A 3BS1A 3QCAA 4LCDE 5KGUA 4P73A 3UE1A 1NMFA 2F0DA 5D3IB 2FCNA 4FBJB 1U4MA 2M9VA 1CHQD 1NTGA 4A4IA 3HKZE 3KVFB 4D2KA 4A93B 1WXQA 1CT1D 1LT6D 1JWSD 4B3MQ 3PO3H 3P63A 2BDNA 1WX9A 1GB4A 4REZA 2D11A 4DV6Q 1PH4A 1KNEA 1RM6C 4G11A 5BN5A 2G9DA 1RDPD 2LVQA 2SNSA 4RHRA 4B0EA 4AQ7A 4P7IA 4OWXB 3VR3A 2OEOA 4GGQA 2RR9A 3AU5A 2FIFA 2ENBA 3G7LA 1V81A 3IBEA 4JX1C 4BZAA 3U4VA 4JW0A 2W55A 1K83H 1GVPA 4GN1A 4KDLB 4HJ9A 4XDDA 2B2YA 2NVQH 2KT7A 3HOUH 4BKGA 2KWDA 1JOOA 1I5FA 3VHTC 3OMGA 4RFBA 1Y1WB 4JLCA 1IBML 5D94A 2C7MB 4GLXA 3PMFA 2JA5B 4A3IH 1V97A 4YWGG 3H1UA 4QJFA 1PFNA 2X6GA 3A9JB 4JI5L 5JOBA 4F7ZA 3JYUA 3TUOA 2KX3A 2HCIA 1Y69U 4PK1A 1MJCA 2V4LA 4LJPB 2V3NA 3PUWA 5HGTA 3QO2A 1WFQA 1OQYA 5I6WA 1NEKB 4WJNA 3K0XA 4K7UA 1I4GA 2LMCB 1PZJD 3CU7A 2JXMB 1V2YA 1E8YA 1FVIA 3HOYB 3MTNB 2MBBB 3BK1A 3IG3A 4DNRB 2JEBI 1DGSA 2R7DA 3I7FA 4IO9A 1PGBA 3TMEA 4EKUA 2G45B 1AYFA 1JQYD 5EJWA 4K0KL 3UI2A 2UXBQ 2LRUA 2JY6A 4CDEC 4GNXB 3C46A 2GBMA 3PVLA 5C1ZA 1ASZA 2CKZB 4K5VA 1KLUD 3APDA 3LWUA 2LVPA 4BBNC 4IDIA 2F0LA 2MP2B 3RN2A 3IAM1 2N9LA 5IYBH 4KHPQ 1KD1C 4A3GB 3AM9A 3MXUA 4XDXA 1WRDB 2BBCA 2NZHA 4XYOA 1L1OC 2YV5A 1D2BA 4AJWA 2C5LC 2K0PA 1ZOYB 4KZ0A 4DR3Q 1K8OA 1Y1VH 5DM63 2KTFA 5AZHA 2LHEA 3I56A 2M00A 5JHAA 1IKMA 4HCPB 3S17B 3KDFB 1WX8A 2MH7A 3PO2G 4DGZA 1VD2A 4DDID 1PZID 5C4JB 2B63H 2R7ZH 2NS5A 2LXJA 3IT4B 3NBHB 3P4PB 4FO2A 5ELOA 3U30A 2F0UA 3B2FA 2KTRA 3AFPA 3EHVA 3DMUA 3VUYA 3ZXRA 1ILPA 3E0EA 2Z59B 5H8YE 4L2YA 2B63G 3KBXA 1EY4A 1V1QA 3K8AA 4DV5L 2QCZA 1U4RA 4JI7L 1HZBA 3GV3A 4IN3A 4RMFA 2N9PC 5EKIA 2UXBL 3A0JA 3VDYA 5HKHA 5I9PA 2NMQA 3K59A 2F0QA 4X3SA 2WB1B 4HIKA 1XMQQ 2MBEA 3MHZA 4IM2A 4JI2L 2DZIA 1DZ1A 2DN8A 3S14H 3OOCA 1YVCA 2H5XA 4B6WA 3MHSD 1KDAA 2KWVB 4DV0Q 2GOWA 2MQJA 5AUIA 2AKWB 2NTTA 5HFYA 1WFYA 3VTVA 2O6VD 2WYQA 3T9LA 1RKNA 4L5TA 1AWDA 2KLGA 2JA8H 3L2PA 2GB1A 2WXOA 2B3GA 1YJ9A 2DNFA 2L5TA 4K2KA 1S5ED 4GKKL 1P9DU 1RTNA 2GI9A 2L32A 3H6MA 1SXTA 1VQBA 4AUQC 2YTXA 3NJTA 4LNOA 3HOXH 4BBRB 3F2UA 3CIRB 3WAPA 2A74C 4A75A 1PZKD 3S24A 1TS4A 2WXMA 1D4BA 2X6LA 5C4XH 2E5LQ 4PS7A 3AU4A 4LF7Q 1CM9A 4MM3B 4AOFA 4P1CC 1CA5A 4Y7NH 4HKQA 4ALPA 3TZDA 3URYA 1I94Q 1YNJD 2MNAA 1D7QA 3AE7B 2HHHQ 4IPGA 2JSVX 2HIXA 5DPRA 3GTMH 1Z7TA 2G1EA 2LFNA 3BINA 2F52A 3DEOA 1KJTA 4M1UB 2ZPNA 2CWPA 3VYRA 4HCSA 4L5QA 1V43A 1M8AA 3E0JA 3A1QA 3SR1A 2EY1A 3UDIA 3DHQA 4LFBL 4DAMA 3MFYA 3HOUB 1RFAA 3S17H 1L5PA 1UE6A 2B2VA 5BR8L 1HNXL 1HNXQ 3L16A 5C4XB 1T6BX 2K50A 5GADC 5FLXc 4MH8A 4GMVA 2K25A 1UE7A 2KC2A 3NOBA 1H9SB 5EE3A 1IKLA 1BXTA 4WFN3 3NZUA 4KKUA 1XD3B 1M4VA 2WIIB 3QC8B 5ELNA 4DR7Q 2EYFA 2EIFA 4PZ7A 2KYWA 1VQIA 2NVUI 3Q23A 2A19A 4IOIE 1V8QA 1WTVA 4KV6A 1CK1A 2EQSA 5IYBG 1EQVA 4IJHA 4DR3L 1QT9A 4A3BG 1PDQA 3MA2B 4RA8A 4JGHB 1YJ1A 4OVUA 4QY7A 2E2HH 1L2FA 2L0FA 1OO9B 3CC4A 2C7HA 3OW2A 4YT0B 2QA4A 2L55A 4GOPC 2EXZA 4B3TQ 1IGDA 4PQXA 4JI5Q 2I5HA 3RZWC 4NMZA 2HQEA 3PO3G 2A6ED 1FEHA 2XBBC 3NENA 4K0KQ 4W9DA 5CV6A 3KUZA 2KO3A 3RNGC 2JA6B 3AU7A 1YJWA 1CI3M 4NXNQ 4RM8A 4R3DA 4XZ4A 2O5IC 1VZ7A 1IL2A 3WOEA 3CAMA 2IO0B 2K1FA 4B9KA 1UE5A 3TZUA 3G6EA 4QMGA 4MIUA 2RD0A 3OIQA 4PNYA 1K0SA 1QNKA 2EKIA 3S16H 4RWSC 5C0XG 2R2QA 3MWYW 3GE8C 2FFKB 4Y7NB 2Q2IA 1Y56A 2CWAA 1VQ5A 4WQMA 4R4QA 3RD4A 3BU2A 2LJIA 2B2TA 1XPRA 1E6EB 2DWQA 3TN2A 2JX5A 3KJOA 2VQEL 2BYEA 1W6JA 2LZ6A 4KY6A 1EY7A 3WAMA 1STGA 1K28A 2DUDA 1ACCA 1NCVA 1HEZE 3L17A 1GUSA 4LDTD 1R4QB 4S0RA 2J4XA 1VQEA 3CPWA 4C80A 1H9KA 1IYFA 1L0YB 5D2MB 4GN4B 4LUOA 1ROEA 4NXNL 3HUIA 3RUIB 3IVFA 2NCNA 4KD3A 3JAME 3ZXVA 5JEAJ 1KAAA 5C5LA 2Y5PA 3ZVVA 3W5VB 3FAHA 1SFOB 4K3CA 1A5RA 4A90A 4PG3A 1RTOA 1S5DD 4HR7B 2B76B 3AEBB 2KA7A 1QE6A 3N52A 5I6YA 4NKLA 4TSSA 1JALA 2KOXA 2N88A 2LRWA 1SLJA 4BWGB 2RGFA 1DOXA 2XSCA 2Q8RE 4UP9A 2Q2HA 3IAYA 5KHQA 2KDIA 4IUTA 3FILB 4JI8L 4K3BA 1WR1A 3MHBA 3ZJYC 3OYYA 5DAUA 2J52A 2KFJA 1TWFB 2Z6BA 3CCJA 2ZJDA 3ICEA 4MJSB 1KL9A 4DKAC 4HVBA 1WXMA 1HRJA 4HMJA 1ZXTA 3STBC 3I4NB 3VA7A 2K8CA 1KRSA 2I46A 4DV2Q 2KMCA 3Q6BA 2EYMA 3Q6SA 4IC7B 4QIWB 3D4WA 4BAXA 3D0FA 1UEBA 2H88B
chains in the Genus database with same CATH topology
3GTKB 4HMIA 1L6VA 3TSSA 1JB3A 1SAPA 4H7BA 2RMMA 1HCZA 4KHZA 3QG1A 3LNNA 1AZQA 3HVZA 2LGIA 1STNA 4UDUC 4CJ2C 4OIKA 4B08A 1H9JA 3BVZA 2IDYA 4RCNA 3AE9B 1YN5A 5D65A 1JWBD 1GUGA 3HS0C 1GUWA 3NPPA 3KQ4A 1UWXA 3D4RA 3H91A 1ZEQX 3NWTA 2F0HA 4XT1B 5I2YA 2PCFB 3AB9A 4X3KA 2Y5CA 4ZUIA 3VR5A 5EGTA 3J7AV 1VMPA 3NE5B 3QJYA 1S4ZA 1N62A 5EE0A 1C79A 1OXVA 2BW2A 1C9FA 5IGDA 1G6ZA 2B8FA 3PO2B 2WACA 4HTHA 4EVOA 1NENB 1JORA 1SYBA 5JEAG 1VCIA 4PMBA 4NAWB 2RKSA 1U4PA 1TJEA 5CV8A 5CC4A 2SAKA 4H13C 1MHXA 1SE4A 1FRDA 1GJXA 1Y1VB 1IYVA 3R3OA 4A3DB 1TS5A 2F3WA 1A6XA 3ND9A 2AQ3B 1FO4A 1B3AA 1G91A 4DAYA 4DK1A 4HEA1 2OXPA 2CW0C 1H9SA 2K1BA 4CKBA 2EY2A 4KY5A 4ZKCB 4CJ0B 5A2QL 1EZ8A 4BY1B 3EA6A 1XX8A 2XWBB 4G7ZC 3Q0AA 4KGSA 3AEDB 4FXCA 1B9MA 1SB3C 2Z4HA 1N5WA 4FXGC 4PMWA 3AEFB 2HUGA 5M5YB 3Q8CA 4ITKA 1IL8A 4BS9A 2WKCA 4ZHPA 5FKAC 1LTSD 1JROA 2EYHA 3AV8A 2Z1CA 3MXPA 4FVMA 4ARIA 4OHJA 1YNJC 3Q8BA 3V96A 2EJFC 1WD1A 4G57A 4M0WA 3RPFC 4HJGE 2FHTA 5C3JB 4R9WA 3GTLB 1B2TA 1HTPA 4XTCS 1STBA 2H4OA 1PRTB 2WP9B 5EPKA 2IL8A 1JOQA 3K6OA 5ISRA 4A3BB 3SR6A 3FILA 1FFVA 1NR2A 3MJ5A 3FEWX 1RYJA 1PDXA 3K58A 1EWYC 1C4AA 4EQOA 3IT6B 3EUB2 4DN4M 3I4LA 3MXGA 1R9TB 1AZPA 2MJ3A 4JBWA 1GHJA 4FP5D 4OGQC 3NTHA 4YSYB 1SBBB 3LB8C 3RZDB 3BVMA 4RGTA 4FF1A 3VR9B 1IHZA 1LT4D 5D3DA 1FRRA 4WAFA 1HA5A 4C1NK 2NN6I 3KBGA 3HKZB 2NTSA 2A5HA 2CVRA 3PO0A 1MI2A 2V4IB 2VZKB 4XWWA 1A3VA 1ZE3D 2D5GA 3H09A 1SJHD 4V190 1RF2D 2F0VA 1SYEA 1A3UA 1BOSA 2NWGA 2NBFA 4ZRPA 2HTME 1HFGA 3GD7A 2EY5A 1QOGA 5I2XA 2NVYB 4XQNA 4USAA 5ELCA 1NUCA 1BCPF 1KLGD 3NBIA 2KDMA 1YNND 3NVVA 3BK2A 4K6DA 1FNWA 5T1IA 4DAPA 4IKGA 4CKCA 3J81L 2B2WC 5FLXE 2CQAA 1A2TA 3Q8AA 2EYPA 2B63B 3M3YB 4IUNA 3D31A 2I38A 1C48A 2C5CA 4KJNA 1FM0D 1HA6A 2PO4A 4OO1H 4N6EB 2ZW0A 4WH4A 4RGMA 2LFIA 5CGKA 1VLBA 1DJRD 4MN3A 3NTIA 2WINB 3L3OC 5TSSA 4P16A 2V0GA 5T1GA 4L8JA 1EYDA 3R93A 1XCQL 4YTPB 3BDLA 2DNCA 2L1BA 2PZTA 3MVVA 1EL0A 2JWUA 3P4QB 1Q8IA 1C4PA 1SYCA 2SOBA 5DM73 1YN4A 2MUYA 1DXMA 1ICWA 4JWSC 4DXGA 1NYQA 2WXJA 5E6JA 1Y8PB 4A55A 2DY8A 4C3JB 1VR9A 4CKEA 5COYA 1YNNC 2NUCA 2A68C 4HAEA 4A8XC 4OO1G 3VYTA 2K22A 2BCOA 2YEPB 4J6HA 4DK0A 3RUZA 1I4HA 1TY0A 4P6VF 5IGFA 3CWIA 2BE5C 3NZ3A 3WDNA 1QF6A 3U9OA 4OIJA 4WIPA 5LL6S 1EWCA 2YU9B 2M56B 4DFAA 1PTOF 1EY9A 3ONAB 5E4XA 1VMCA 3AEEB 4YXDB 1U9RA 3ERQA 1GUOA 2VXWA 2XIWA 3P1HA 5C0XJ 1HUNA 3DWQA 5NUCA 1F2RI 2ZW1A 2RA4A 1TWGB 1X3PA 2JZPA 4ZAIA 1STEA 1WRIA 2ON8A 2NN6H 2O2LD 5E4WC 1VZ8A 4NW2A 3W9CB 2F0WA 1R4PB 2L0CA 3HOXB 2Z4IA 2PZWA 4K5WA 4RGNA 1EWHA 4IUPA 2SNMA 3NS1A 4LAAA 2MEKA 3GP7A 1WTXA 4NZLB 1STHA 3BDOA 2JA8B 4KD4A 3J81E 5IGCA 5I4DA 2OHFA 3P7JA 1GUTA 3P42A 3TEYA 4QB4A 1EY6A 1HQMC 2WXLA 1TY2A 1XF5L 4QCLA 3MZ5A 3TBIB 2R7ZB 5BYRA 3I4MB 5A35A 1EYCA 1UNSA 4JK1C 2BT6A 1L6UA 3I70A 3J7AF 1E9MA 3GS2A 3VR6A 2Y3AA 1ONLA 1OXUA 5C3WA 1ZYRC 4GZYC 2PVGC 4CBVA 3KWLA 2K5PA 2N55A 2HDLA 5LNK1 1WVLA 3C8YA 3HOVB 2PYKA 3EQLC 3LYYA 2JSOA 3S1MB 1HTLD 2WV6D 4AS1A 1YJIA 1P7EA 1CFMA 2WDQB 1E10A 1DYQA 3S9WA 1YQ4B 3Q22A 5C6AA 4CQNA 5F2DA 5BMHA 2E74C 4R8IA 2WDVB 2EDGA 2H89B 4C3JG 4WWMA 3D6CA 2B2TC 4IFDG 1T3QA 3IFDA 1N63A 5FK9C 2BA0A 4B9WA 1GXDC 3NQIA 5FR3A 3FKIB 1OQQA 4HROA 5EQ0A 1K52A 1KABA 3NUCA 1CJEA 3E56A 1WCMB 4GLSC 1O7YA 1I6VC 5IIFA 3DWGC 3SEBA 1YNTE 2L1AA 1JCKB 1RD9D 3M85A 1H9RA 2RDHA 2PW5A 1F9SA 3OMCA 1UGJA 3J7YW 5CMDA 5FLXL 1NI3A 4OVZA 1SJED 1QOFA 3P75A 4NAMA 3T13A 1C78A 2V3PA 4QUFA 2L83A 1C8CA 2FBWB 5E1FA 2K3UA 5ELFA 1AW7A 2RSNA 3AEAB 4KGRA 3MFGA 2M2LA 2AWNA 4IUUA 4H44C 3TP5A 2N9KA 5CBAE 1ESRA 3D3RA 3FPPA 1U4LA 1E2VA 2KVMA 1PFDA 1PFMA 2B2VC 2EPBA 5BN4A 2MHVA 2QCPX 4YIJA 4CGYB 1SE3A 4UAIA 2JU6X 1BNZA 3I90A 2Q5WD 2W82A 4EQNA 4C56C 4N59A 2PIAA 5KEEA 4XE0A 3BVGA 1DOLA 1EIGA 1QKZA 3K7AB 4F8MA 1B50A 2E2IB 5J39A 2XWJB 2IPKD 4K8JA 4L6TB 4L63B 2EYOA 4Q0FA 3MEHA 1OFFA 1PTOC 1Y8OB 1J7BA 4X3TA 1GAQB 1ML0D 2R92B 2J0TD 4RF0A 4I7ZC 2F0GA 3BYYB 3SDZA 2WDRB 5G5HA 2IT1A 3M7NA 3I72A 3A8IE 2JYEA 1I50B 3BIID 4LMQD 1T5EA 1AFPA 2HDEA 5HI1A 3DXJC 2Y0SB 2R61A 4B9XA 3HEJA 2VB3X 4K8IA 1AEXA 2J42A 2XRQD 1V1PA 3KUPA 2F0IA 1PXUA 1TVXA 3O13A 1XLPA 4PT5A 4KK7A 1TKEA 4YSXB 1QQRA 3CRLC 2K5WA 2WXHA 3C2PA 5M5XB 1DOYA 4ZUJA 5ELEA 4U673 1A70A 2VNUD 3RZOB 4IFDI 3TP7A 4FNFA 3NWSA 2B2UC 1D1IA 3LX0A 3VR2A 3AEGB 4KMUC 1YJJA 3S14B 2K5DA 2QJLA 4KKSA 1Q3LA 1QILA 2K9XA 3VQIA 2NZ1D 2HCCA 2IJ0A 3OPOA 1II3A 3SFEB 3T53B 4CJ1B 5HHDG 4F7XA 3J80L 1KDBA 4KN4C 2E75C 3I9V1 1F2LA 3D4DA 1TQOA 3JAML 2PMZB 2BYTA 3KWVA 2J7ZA 2NVQB 1LT5D 5M9OA 1EEID 5CV4A 4A3FB 1UUPA 4IURA 5IOCA 1RCVD 2B2UA 3ABVB 2KEDA 5D7GA 1QJOA 3L9AX 5JPNC 2JXTA 2BS4B 2WXRA 3NBHA 2D2CC 1SNPA 3FDTA 1XLNA 5J22A 5C5MA 1KNAA 1SNOA 2L11A 1BDOA 2ZT9C 3RLFA 3MTSA 1I4XA 5BN3A 2XRSD 4KI0A 3VYSA 1G2SA 2ID0A 1NYRA 3AECB 2KECA 1F2MA 3FPUB 2WXIA 5BMGA 2EE1A 1H9MA 3PUVA 3QIAA 1BUVT 2IGDA 1SSOA 1SIJA 4ZLTF 3T16A 2LMCA 3S2DB 3FMCA 1A2UA 2EVBA 1OXXK 2EY6A 1IUEA 3M4OB 4ODGA 5D14A 1BCPD 1F2RC 1MGSA 1X3QA 3I73A 3M4YA 3GTOB 1VZ6A 1J7CA 2KACA 1PUTA 5BYQA 2EJMA 4HKZE 4IUVA 4RGOS 3E9SA 2PNRC 1F9QA 3NSWA 1ZDVA 2EOTA 4C3HG 1BUIC 1PRTF 2FINB 3FRPB 3PO3B 1N5XA 5JAVA 5CYUA 4FF3A 3KLRA 2SEBD 3SK5A 2EELA 3BZDB 2A69D 3A55A 3U7ZA 2B8GA 2G9HD 2ICIA 2I07B 2OT2A 3S16B 1DONA 3V2TA 3MAQA 1B1ZA 3J9CA 3HRZC 3VR4A 4KGTA 1XYIA 4G7HC 3SK8A 3GB1A 2YEPF 1FD7D 1TWHB 2K32A 4AYBB 2F0NA 4RKBA 5JVG3 5EKKA 5A2QE 2YYZA 3P4RB 2KQ4X 1AP0A 3I57A 1IBXB 1FCCC 2KCCA 1ZKOA 3VRAB 1QOHA 2R6GA 2RVLA 2MPMA 1O7ZA 2VB2X 5FOBB 5IGGA 1OQRA 4K6LA 3PUXA 1ZXHA 3MP9A 2WS3B 1SNDA 3LXFA 4IUQA 1HUMA 5K5PA 3W1SA 1D5ZC 2F0PA 4IFDH 1VRAB 1D5XC 1VDVA 4RH6A 1SMYD 4ABNA 2KAJA 3GO5A 3B2GA 1ZDXA 1XTCD 1MI0A 4WORA 2WXPA 1STYA 3OHXC 2TMPA 3R2IA 3C1FA 2KQ3A 2QF7A 2LKVA 1QNUA 4CHTB 2WP8J 1B44D 4KTAA 2F0JA 4I65A 2EJGC 4IALA 1FGBD 1SEBD 1A3TA 3H94A 2MJ8A 4KJOA 3T56B 3KK7A 2RDFA 3PZ8A 4LLGM 4C3IG 1PYWD 4NP5A 5DNFA 1ET6A 3ZJTA 3PV0A 3ZGZA 2E2HB 4IFDJ 3OSOA 1YN3A 3CKIB 3WCQA 3B9JA 1DOMA 3NXWA 2LY7A 4ZQ3A 4KKIA 1CZWA 1PGXA 2BA1A 1ILQA 5M3FB 3AH7A 1ENAA 1QCBD 5JXVA 4C3IB 2K01A 4MT5A 4WJWA 1I4RA 3HG9A 3L4PA 1O7LA 3BDCA 3BYTB 1WWTA 3KF8A 1PLFA 3S1RB 2IWHA 3TDQA 2PQEA 4KHVA 3SK6A 2DLBA 4FXKC 2JYTA 1LTID 3TEZA 3J80E 4HRSA 1V1PB 2F0OA 1NAPA 1GB1A 2KJXA 1B9NA 3T3NA 1BO0A 1MHHE 5G3LD 1G8ZD 3RMHA 1Q90A 4N58A 5KRUA 2WLBA 2LHDA 1R7SA 4XQJA 1BMLC 4RCOA 1WTWA 3V3XA 1G291 5CV7A 2MJDA 4GDKB 4C2MB 1D1KA 1KDCA 4G4KA 4ZYSA 2DBYA 2ACZB 3E6ZX 5G5GA 3ZJUA 4A3IB 1FNUA 1P7FA 1N60A 1FXAA 1EYAA 2DY7A 2ONQA 1QOAA 1KH0A 2K28A 1QG7A 1F2YA 2L9HA 1YQ3B 2CJOA 2AUJD 2EYLA 2GRIA 4L23A 2F0EA 1XXGA 4WRDA 5HG2A 2X69A 2MP1A 3IKJA 4ULLA 1SNCA 3FC4A 2FUG1 4XWTA 3PIP3 3BG3A 1IGCA 2GA4B 1K50A 1I4PA 2XNAC 2PPBC 5C4ZA 4KKJA 1RODA 4DNTB 3LWEA 2W54A 3NRZA 1LABA 4V0BA 2B2WA 2K33A 1JE4A 1HXYD 1WYGA 2QDBA 2QSDA 5T8IA 3Q24A 5IODA 4U68A 2F03A 5JEAH 2D9UA 3HP3A 1VDZA 3D6WA 2OEDA 2BS2B 3EGRA 2F0KA 2INPE 1PTOD 3QB3A 3I91A 1STAA 1WTRA 1ESFA 2PVOD 3S1QB 2K6AA 4LK0M 4A9AA 1TKGA 5CR3A 4ZK9B 1LTBD 3AE5B 4FF2A 2PTLA 2A6EC 3TEWA 1JW9D 4KN7C 1O78A 3W2DA 3N9YC 5C3EB 5EPLA 5ELBA 1CA6A 4OW0A 4DAVA 1F77A 1KTKA 3OWEB 3P4SB 3NVWA 3TP8A 1EOTA 3NHHA 3EJIA 2M19A 1PFBA 4J3OD 1XLQA 3U2SC 3SVMA 3GTGB 4HSVA 5C2TB 4BBSB 3TP6A 2W3RA 5C44B 4ZOHC 1ZYRD 1EIHA 2N0SB 1LT3D 3SFDB 1Q1EA 3NQTA 1BCPC 1JWUD 1O80A 1A15A 3AE6B 4H0LC 1SSNA 1GHKA 5FO8B 2KHSA 3P20A 5EE1A 1TKWB 5FO9B 5I9OA 1HZ5A 1FNVA 2K7VA 2FE8A 2F3VA 1JICA 1GPXA 4US8A 2ZXOA 4XIGS 3AE2B 2KUMA 2E2JB 4A3EB 2NVXB 1F2ZA 1SE2A 2F0TA 1MPEA 4ZRZA 3VR8B 5ELDA 1GOZA 4Q5VA 3K5MA 2BB6A 2WXKA 3S1NB 5AFWA 4TMAB 2QEJC 2QILA 2XN9C 3VRBB 1JRPA 3V05A 2WNMA 2NVTB 5EBDA 2TSSA 5K36G 1J8IA 1IYUA 1T5XD 3P1MA 5MPOA 2LS01 3Q8EA 1EEFD 1SDFA 2Q8IB 4N9TA 2CU3A 3AE1B 1DM0B 1AN8A 3HGBA 4KKTA 4F87A 3M7GA 4LTUA 5KYIA 2KOLA 3OIPA 2FJ2A 3RFZB 3ND8A 1TR5A 4RKLA 4DQOC 2RPVA 4M8AA 1F0ZA 4IQZA 3ZQ4A 2BDOA 1WTOA 1EY8A 4B0MA 2WXNA 3X3NA 1HHVA 2NB0A 1TS3A 1SMYC 2R3ZA 2K03A 3EVQA 1SYGA 1S5CD 4O42A 1SYFA 3S2HB 4JPSA 5KNBA 4J8QA 3NVZA 5M5WB 2IX1A 1FFUA 1PGAA 4OZBA 3GTJB 4L1BA 4ZKBB 1HZ6A 1IW7C 3GV6A 1L0VB 2E2DC 1HFNA 1XCTL 1MVKA 2BTEA 5KNDA 4RHSA 1E2WA 1IW7D 1QOBA 1W6KA 1PRTC 4R8NA 2PKOA 1EY0A 2CJNA 4ARCA 2FMCA 1WSPA 2RBMA 1I7HA 3SHLA 3GQBA 1DOIA 3U4EG 4KY7A 2F1MA 3SE0A 3MXNA 2JP1A 4TQ1A 2A6HC 2PMVA 5BMIA 3AMUA 4BY7B 1QB5D 1K83B 5KNCA 1KF6B 2NYZD 3H0GB 5LL6X 4A6QA 3CRKC 3A8KE 1JQ4A 5CV5A 1DCZA 1FYCA 4K14A 1WTPA 3VA5A 1WGKA 2PW9A 5GXGB 3A7LA 5IGEA 2EZVA 2L12A 4H2AA 1IBXA 3NK9A 5JJZA 1LACA 4TQUS 1J9OA 1C76A 2PLPA 3MC0B 1VF7A 2VUMB 2INNE 3IFTA 1Z6HA 1ENCA 1OXSC 4HEDA 2O4XA 2JEAI 1I4QA 1PRTD 2IGHA 3NUHB 4K5XA 2WXFA 4E6IA 2AX5A 1FXIA 1B4OA 2LUMA 3AE8B 3OW7A 5CV9A 3DWMA 5LHY1 4XYQA 2K04A 1ZXIA 2BS3B 1UEAB 4HCEA 2D5DA 2IX0A 2WAQB 1G2TA 3ETRA 1QLBB 4RNAA 3U52E 4BA1I 1BCPB 1S5FD 3A8JE 4QUCA 1BF4A 4A3KB 4JE3B 1X32A 4P2CB 2MJEA 2F0MA 2ZXRA 4RF1A 3I3CA 2SDFA 4DA2A 1Q12A 1MSGA 2AUKA 2JQRB 5C3XA 1TWCB 4YTNB 2A69C 1HPCA 4TRDA 4PV1C 2OF1A 1FR3A 1LTRD 3AE4B 1CQFA 1YMHE 2NN6G 1EU3A 2CW0D 1L4DB 4FXDA 4ILWA 2AWOA 3U9SA 5IT9E 2QMTA 1OXTA 1MSHA 1TYGB 1Q1BA 3C3LA 2A6HD 3AB5A 1SYDA 2RSOA 1EZ6A 2AQ1B 1XO3A 2WQYB 1MD2D 1TS2A 2D62A 3W5UB 1TWAB 1VJKA 1C4QA 5KYLA 3NVYA 3SXHA 1EY5A 3K5NA 1DGJA 5H92C 4LJZC 1SF0A 2BE5D 4TKOB 5K36H 3FVQA 5M3MB 4MHEA 3I8ZA 2DYMA 5C0XH 2IW3A 2I2YA 4MACA 2EYJA 1NR4A 1UAPA 2A68D 2JE6I 3G6JB 1ZPSA 4F88A 1LTAD 4TQ0A 1CHPD 3CQZB 1NSNS 4HSPA 1MBYA 4O1NA 4N9PA 5EPJA 4J1MA 1Z47A 2E3TA 2JYOA 1E0BA 1FD6A 4EE2A 2L52A 1ZUD2 2XVSA 1I3QB 1XLOA 1BR9A 1F9PA 3PUYA 4EGVA 1FMAD 1N61A 3HVDA 3HZXA 3K0YA 2K5QA 4OL7A 4Z9CB 1JOKA 1HQRD 4XT3B 2IX3A 3A56A 1XWEA 1S5BD 3IAS1 2Q8TA 3S15B 3VYUA 3T51B 5C4HA 1KRHA 1K53A 4DU9A 1LV9A 1UWMA 1CZGA 2AQ2B 4Q2JA 2N7JA 3C1EA 4RAUC 2DYOA 2WXQA 3Q8FA 1I6HB 3BWUD 1LO5D 4ME5A 1VF5C 4G7OC 5AUKA 1L0XB 4OZAA 4OO1I 4XQQA 5EE9A 1JC7A 1Y8NB 3ZJVA 2M0AA 4GDLB 4C7YA 2F0FA 1PTOH 1BBXC 3DUZA 2PW7A 2ICEC 2R93B 5EKLA 3X3MA 5G3LF 3L7ZC 3NP8A 1C77A 2X38A 3T3OA 1EU4A 1QWYA 4ZRQA 2BB5A 2B39A 3DEPA 5KIXA 1WTQA 4LK1C 1JWAD 3WOFA 3PZ7A 3PUZA 2KEEA 3N6RA 2J53A 5BYSA 1E7PB 2B2YC 1DD2A 4NDXA 3T4AC 2WKDA 5JPMC 3QOJA 3NTKA 1TIID 1CQVA 3E5SA 5JVH3 1TZOA 3TEXA 1D5MC 4ZHOA 3OWFA 4C1NI 1RJTA 1SNQA 2A73B 2BOSA 1F9RA 2F4IA 4C3HB 1C4CA 1K51A 4OZCA 1CTMA 4PMCA 2WXGA 1L4ZB 1JMLA 1LTGD 1ZP0B 3PIO3 5J1ZA 1B9RA 3EFXD 3ZYYX 1J7AA 2KN4A 2QKIC 4US9A 2L4NA 1PMRA 1ET9A 3CHBD 3QOLA 4X3UA 4A3MB 3UI3A 1CZPA 3R8BA 4FYDA 2WU2B 1E0ZA 4HN7A 3H8HA 3D8GA 1TT2A 1ENFA 3K5OA 5FO7B 3SK4A 3A54A 4JWUC 3KLSX 2CHBD 2W3SA 3IL8A 2LEKA 2DNEA 1RFKA 4C7ZA 1LTTD 4XXEA 4WURA 3AN1A 5C0XI 3HOWB 2PZUA 1DOKA 4DXFA 3GTQB 2KMMA 3AMZA 2Z8LA 2E76C 2MGSA 2RDGA 4A3JB 2HDMA 3KLSA 4EQPA 3Q69A 2C9OA 4BA2I 1LLRD 1PTOB 2KCNA 1XEEA 1JWMD 1GUNA 4ID6A 1EQTA 5CBEE 5IGBA 3DWAA 1EFID 2VZKD 3GTPB 3R2TA 1KFYB 3W3AA 5E3FA 2WU5B 4KX6B 1Q10A 2RQXA 3EROA 4K2LA 3K5LA 4FF4A 1FIQA 1V1OA 1WD0A 1FCLA 2K05A 2O5JC 2QIEB 2JA7B 5DEHA 1NVID 1B53A 4XDCA 3HOZB 1E2ZA 2F0SA 4NJCA 3AE3B 1EM7A 3GTMB 4DF7A 1RWSA 1JR0D 3HRDD 5CORA 2ZXPA 3H3VC 2E6XA 3DM1A 5EBCA 1RHPA 3IXSA 5HURA 1K8MA 2IGGA 1TKYA 4S3SA 3ITPA 5IT9L 4IZ8A 2V4DA 4YSZB 4QF4A 2H1EA 3QWNA 1BQQT 1TU2B 3K57A 1V8CA 3A7AB 1SNMA 3DWPA 2FMMA 1D6EC 3BS1A 5KGUA 2F0DA 5D3IB 1U4MA 2M9VA 1CHQD 4D2KA 4A93B 1WXQA 1CT1D 1LT6D 1JWSD 3P63A 2BDNA 1GB4A 4REZA 1KNEA 1RM6C 5BN5A 2G9DA 1RDPD 2SNSA 4RHRA 4B0EA 4AQ7A 3VR3A 2OEOA 2ENBA 3G7LA 4JX1C 2W55A 4XDDA 2B2YA 2KWDA 1JOOA 3OMGA 4RFBA 1Y1WB 3PMFA 2JA5B 1V97A 4YWGG 1PFNA 2X6GA 5JOBA 3TUOA 2HCIA 1Y69U 2V3NA 3PUWA 5HGTA 3QO2A 5I6WA 1NEKB 1I4GA 2LMCB 1PZJD 3CU7A 2JXMB 3HOYB 3BK1A 4DNRB 2JEBI 1PGBA 3TMEA 1AYFA 1JQYD 5EJWA 3UI2A 3C46A 4K5VA 1KLUD 3LWUA 4IDIA 2F0LA 3IAM1 2N9LA 4A3GB 3AM9A 3MXUA 4XDXA 2BBCA 4XYOA 1D2BA 2K0PA 1ZOYB 1K8OA 5DM63 2LHEA 2M00A 1IKMA 3S17B 2MH7A 4DGZA 1PZID 5C4JB 3IT4B 3P4PB 4FO2A 2F0UA 3B2FA 3DMUA 1ILPA 5H8YE 4L2YA 3KBXA 1EY4A 1U4RA 3GV3A 4IN3A 5EKIA 5I9PA 2NMQA 3K59A 2F0QA 4X3SA 2WB1B 3MHZA 1DZ1A 2DN8A 3OOCA 1KDAA 5AUIA 2NTTA 5HFYA 1RKNA 1AWDA 2WXOA 2GB1A 2L5TA 4K2KA 1S5ED 1RTNA 2GI9A 2L32A 3H6MA 1SXTA 4BBRB 3F2UA 3CIRB 2A74C 1PZKD 1TS4A 2WXMA 1D4BA 2X6LA 1CM9A 4MM3B 1CA5A 4HKQA 3TZDA 3URYA 1YNJD 3AE7B 2JSVX 1Z7TA 2G1EA 2LFNA 3DEOA 4M1UB 3VYRA 4HCSA 1V43A 1M8AA 3E0JA 3SR1A 2EY1A 3DHQA 3MFYA 3HOUB 1L5PA 2B2VA 5C4XB 1T6BX 4MH8A 1H9SB 5EE3A 1IKLA 1BXTA 4WFN3 4KKUA 1M4VA 2WIIB 2EYFA 3Q23A 4IOIE 1V8QA 1WTVA 1CK1A 4KV6A 1QT9A 1EQVA 1PDQA 3MA2B 4RA8A 1OO9B 4YT0B 1IGDA 2L55A 2EXZA 4PQXA 4NMZA 2HQEA 1FEHA 2A6ED 5CV6A 2JA6B 3AU7A 1CI3M 4R3DA 2O5IC 1VZ7A 3WOEA 3TZUA 4QMGA 4MIUA 3OIQA 4PNYA 1QNKA 2EKIA 4RWSC 5C0XG 3MWYW 2FFKB 4Y7NB 1Y56A 4WQMA