2AQ2B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR BETA CHAIN V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq2B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq2B01
1ET9A 2TSSA 1LTID 4L63B 1LLRD 1CHPD 2G9HD 2NTTA 1I4GA 3BYTB 1SBBB 1CK1A 1ET6A 1JWSD 2QILA 2WV6D 3BYYB 1AN8A 1I4XA 1PYWD 1S5BD 1G8ZD 1JWMD 1EEFD 1LT5D 1JR0D 1PTOC 1BXTA 3DWQA 3DWAA 3DWPA 1LT3D 1FNVA 2XRQD 4OHJA 1EFID 4DXFA 1YN4A 1TY0A 1S5FD 3MFGA 1BCPF 1HA5A 1PZID 4RGOS 1FNUA 1EU3A 5FKAC 2AQ1B 1I4RA 4RGTA 1FD7D 1PZJD 1DYQA 1SE4A 1BCPB 1XXGA 2XN9C 4O1NA 1CT1D 4BWGB 1SXTA 4K6LA 3V05A 1EU4A 1SE3A 1KTKA 2AQ3B 1ESFA 1EEID 2XRSD 5ELEA 1RDPD 1DJRD 1HTLD 1S5CD 1SE2A 2O2LD 1FNWA 1PRTF 1L0YB 1LTGD 4UDUC 1L0XB 1BCPD 3BVZA 4C56C 1ENFA 1KLGD 1JCKB 3CHBD 3W2DA 2Z8LA 1I4HA 1PRTB 3MC0B 4RHSA 5D3DA 3TSSA 1TS4A 2RDGA 1LTTD 2IJ0A 1CHQD 1PTOH 1TS3A 3BVMA 5ELFA 5I4DA 1D6EC 1YN5A 1T5XD 1TS5A 1M4VA 1BCPC 2XNAC 1B44D 2AQ2B 4RH6A 1D5ZC 1SJHD 2NTSA 4L6TB 1FGBD 1LO5D 1PRTD 1TS2A 4RGNA 4NZLB 3GP7A 1QILA 4RHRA 5D3IB 1JQYD 3URYA 2R61A 1B1ZA 1YN3A 1AW7A 5ELBA 4DXGA 1HQRD 1SJED 1KLUD 1MD2D 2SEBD 1PTOF 1V1PA 3R2TA 5ELDA 1EWCA 1LTSD 4Z9CB 1STEA 4RFBA 1XTCD 3EA6A 1SEBD 1RD9D 2J4XA 3R2IA 1LTAD 1LTBD 1PRTC 1PTOB 3OWEB 2ICIA 3EFXD 4TSSA 1LT6D 5TSSA 1S5ED 2QEJC 1S5DD 1RF2D 3BVGA 1CQVA 1I4QA 3KLSX 1I4PA 1LTRD 1PZKD 3R8BA 3BZDB 3SEBA 4ZYSA 1GOZA 4RGMA 1HXYD 1D5MC 1V1PB 2IPKD 1F77A 1JWUD 2CHBD 3O13A 1RCVD 1UUPA 1TY2A 1UNSA 2RDHA 1PTOD 5FK9C 1V1OA 4RCOA 1D5XC 5ELCA 1LT4D
chains in the Genus database with same CATH superfamily
5BN4A 2B63G 2TSSA 4EQOA 5C4JB 2BT6A 4ARIA 1E3PA 1HFNA 1TTNA 1OEYJ 1YNTE 1LFDA 1IBML 3UF8A 1TWAB 4HIKA 2LJ5A 3PUWA 4G7ZC 4GXBA 2DZKA 3ZQ4A 4A6QA 3I2ZA 1XMQQ 5CHVC 2H88B 5M3FG 4B08A 3C0RB 4ZUIA 3PTFC 1SNMA 2KQSA 4GS3A 1JE4A 3B08A 2F4IA 3G6JB 1X3GA 3GTGB 3N30A 4MGIE 1FNUA 4HCNB 3OIQA 1TXYA 3VYTA 3M62B 3K0YA 2KACA 3L4PA 1PVOA 2ZW1A 1EYDA 1VQ4A 3HOUH 2RDBC 1E0ZA 3PIO3 1V6EA 2BPSA 3BDLA 2JUOA 1SXTA 4DR5L 2CS4A 5M5YH 3AE4B 1L2NA 4UAIA 3DHHC 1EF5A 1NY4A 2D0PA 2ONQA 2BYTA 1N32Q 3CCQA 4C3IG 4K7WA 5J1ZA 1P0RA 2RHSB 4NAWA 1KNEA 4UDUC 2WS3B 1VQMA 1UF0A 4K8JA 1VS0A 2JX5A 2WB1E 5JH5C 2FIFA 1STAA 4C1NI 5CV5A 2M19A 4F88A 3SK4A 2FNJB 4II3B 4M8NA 5D3DA 3HS0C 2K03A 4CQNA 1EIGA 4ZOHC 5IGCA 1KAAA 1P8LA 2BB5A 2EKEC 3VRBB 1E7VA 3E9SA 2EELA 1L1OB 1A2UA 3TMEA 1HEZE 2L32A 2I46A 4A3GH 1L4ZB 1FCLA 5LMNQ 4LFBL 2D3AA 4L8JA 4RCNA 4QF4A 1J7CA 5G5GA 1UELA 3S17B 2WGSA 1VQDA 3AU7A 1WMHA 4KN7C 3Q8EA 4OVVA 3DBRB 2E2DC 4C3HB 4N9PA 3U7DA 4LDTB 2K5PA 2N3SA 5IGDA 2CH4A 2JP1A 3HKZG 3WOEA 1F2LA 4LJZC 2R92G 2WU5B 4HWIB 1E10A 2DZJA 1HQRD 3HKSA 3GQBA 3AE1B 1PTOF 2VB2X 3QHTA 1VDZA 3KYHC 2PPBC 2DJGC 3J9CA 1ROEA 3NHEB 5JXVA 2KZRA 1P3QU 1STEA 2DAJA 3Q3FA 1V97A 3CXCA 2PVOD 3PS6A 4ITKA 4AYBB 3W5UB 4U673 1KQSA 2KT7A 1N5XA 2NN6I 2E5LL 1IBKQ 4X62L 1WSPA 4K7UA 1A63A 4AWJA 1T0SC 1U4LA 4XWWA 2HD3A 5DM63 1IKMA 1YD8U 1FMAD 3MXPA 1PZKD 1ISNA 4ULLA 3NRZA 1XCQL 1B4OA 4AJYB 1C1YB 2IPKD 1N62A 1AH9A 2MP1A 4CKEA 3L7ZC 3V3XA 1HTQA 1K8MA 4JI4L 1UNSA 5M3FB 1VQBA 4GN4B 3VYSA 5FK9C 2OTJA 2K6DB 1WJ4A 1V8QA 1L6UA 1V5OA 4IALA 3DBRI 4DR4L 3T1HL 3PUXA 1NI2A 4FBJB 1HNWL 1XX8A 1FL0A 2A69C 2WX1A 4JI2L 1I4XA 5K36H 4CJ1B 2WDVB 1IYJB 1JOKA 3VR8B 4CJ0B 3H7SA 2KWDA 4M00A 4W9HA 3UQBA 2AWTA 3A9JA 4D2KA 2WDRB 1I94L 4WJNA 5M5XH 3AB9A 5FJ8G 4JI3Q 2GBNA 4OL7A 3ML8A 3U4VA 4P1BC 1S5FD 3RNAC 4C3IB 3I72A 3PRPB 5CR3A 4GOPA 1J5EQ 2ASQA 2LJIA 4KD3A 4LJPB 4DQOC 2F0TA 3D3RA 1Q8IA 1J19A 2FCMA 1WXMA 3Q24A 1VQKA 2WDTB 2BWFA 3AE6B 1FD7D 3RI7C 1SE4A 3MVVA 3QO2A 3GTMB 2JA5B 1JMLA 3PPAA 4QMGA 3QWZB 3EQLC 4DAVA 1C77A 3GTKH 2EPBA 1EU4A 2F0IA 3D6WA 3X3NA 1PH9A 4IWQA 3Q22A 2XWBB 4N9F4 3I9V1 2BDNA 2JA6G 2NMQA 4IUTA 3A5UA 1EWHA 4FLHA 3NVWA 2BH8A 3K59A 2B2YC 2ZTCA 1ZDVA 1A3UA 4B3RL 4KHPQ 3MA2B 5EKLA 4IFDG 4FJYA 1ZYRD 3ND9A 4ZRKA 3OTOQ 2AYOB 1WX8A 3RNEC 3UDFA 2AX5A 1R9TB 1JCKB 1EWIA 5JEAH 1S1QB 4G7OC 3A8KE 2R92B 4KKIA 4P71A 5D7GA 3T53B 3TREA 3ZNID 4HKZE 3MWYW 2B8FA 3CMMB 3ZW3A 1WX9A 2BF8B 4LDTD 3HK0A 1PXUA 3C1EA 3R7RA 5HG2A 2ATWA 1GHJA 5CYUA 1W3SA 2QGQA 3H3VC 3P42A 1A3TA 3TQYA 5J3BA 1MJEA 2QKIC 3OYYA 4R9WA 4DK1A 4A3KB 1Q3LA 1GM5A 4HEDA 1SF0A 3OPOA 4HSPA 2D5GA 2KUMA 2BW2A 5M3MG 1FVIA 4A3FG 2K4KA 3CCVA 1TIFA 3GE3C 4A3LH 3CC4A 1G291 3QK0A 2IO0B 4YY3L 4G0NB 4KY7A 3PO2H 5TR5A 2R7DA 4FDBA 2ASBA 1Y56A 1T0RC 5IGFA 5IWAL 5ELDA 5BR8L 1VQAA 3HOXB 2RHQB 1Q5WB 3JSVA 2MBQA 3RNCC 4IZ8A 4IOIE 1I50B 2ZXOA 1N34L 1FYCA 3N1YC 1YNNC 3A1QB 1GC6A 2ICIA 3EFXD 1PDQA 1C4CA 3EFUA 4AYBE 4LMQD 4A93G 1OXXK 3ZDMC 1QCBD 1KJTA 2PZWA 1L1OC 4GKKQ 3RLFA 1ML0D 2CCZA 4GU2A 1CSQA 3AE3B 1XWEA 1Y8NB 3B1LX 4WJ4A 1YNJC 1NENB 3GTPB 2W55A 5BMGA 1TWHH 4M8MA 2K32A 4GOCA 3PO3G 4X65Q 2OJWA 2JF5A 2G4SA 2HCIA 1VRAB 4LUVA 1TR5A 2L52A 4HJ5A 3A5ZB 4EE2A 2K39A 4DR6Q 2WV6D 2BS2B 2ZPNA 4WJOA 1HRJA 1UH6A 2AWOA 4BY1G 1AZPA 4O0AA 4FJVB 5FOBB 1LT5D 2IDYA 4XDDA 4LUOA 2KC2A 2VQEQ 4DR1L 2N4FA 4H02A 3AE9B 5C44H 2O6VB 2WHIA 4JIOU 4ARCA 2QHOA 2JA6B 3FKIH 4KY6A 4BBSH 2JN4A 4KJOA 2JXMB 3J81j 4FXDA 1PZID 3ZJVA 2ZTEA 1S3OA 2M0AA 1EYAA 5FKAC 3K5NA 1I4RA 3MHBA 3I4MG 1QJOA 4IO9A 4X57B 3PRZA 1H9SB 3T56B 4CHKA 5D14A 3VR3A 5HGQA 1VQNA 3HVDA 1CT1D 2JYOA 4DK5A 1S40A 1PH7A 1RYJA 4BY7G 2EVBA 5J18A 4A75A 3S2HB 3VA5A 1Q81C 1AE2A 3GTOH 1N36L 1E8WA 2VQFQ 1W6KA 1WCMG 1ENCA 3KUCB 3D8GA 2L15A 2C7NB 2MCNB 2AMCB 1XT9B 3PLUA 3P2BA 1H95A 1QOAA 2D5DA 3I5JC 5D6JB 2ZT9C 1H9JA 3EECA 4XYQA 5HY6A 3U4ZA 5M3MB 1WGDA 2BTEA 4A3FB 3V61A 5DNFA 1PRTB 2EYFA 2MQJA 4KN4C 1VR9A 2ACZB 5C4XG 1GUWA 1T0QC 3R3MA 4KGRA 1TS3A 3M85A 3HKZE 1IPGA 1XMOL 3IVFA 2EY1A 2LUEA 3NZUA 2FAZA 1JJCB 2F0LA 3QOJA 2GI9A 1CSPA 1YHAA 2E76C 1EQVA 3SHLA 1FGUA 3CMEA 1EWYC 2L7RA 3AU4A 3GTQB 1Q1EA 4EZKA 4AOFA 2MJDA 4A93B 3I8ZA 3GP7A 2RDFA 5KIXA 4U68A 2WKCA 1C4QA 1IW7D 3M3YB 1B53A 1Y1WB 4WWMA 2V9HA 3TEZA 4IFDH 3IXSA 1SJED 3MHSD 4V190 4UY8C 3K9PB 3KBXA 2INCC 3H1UA 3CF5A 2WFWA 1P16A 3F2UA 3PO3B 4NMZA 3HG9A 1N60A 2K3UA 1OGWA 4HAEA 3C46A 4B9KA 2X6LA 4I7AA 1TWFH 1HTPA 3CPWA 1YJIA 3NSWA 3KLRA 1HH2P 1DM0B 2N0SB 3KF8B 2IY1B 2GBRA 2CHWA 4NXML 1K52A 1X32A 4K5VA 3S16H 3Q8FA 2NVTH 3NHHA 1V81A 1WXVA 1G6PA 2DHZA 3I3TB 4BY1B 2E2HH 4RGMA 1WJ6A 5A35A 5C5LA 3M4OB 4X6AH 1ZXTA 1FIQA 2YV5A 1XO3A 2NVQB 1JOOA 4K6DA 3AV8A 3AE7B 1K0SA 4ZDVA 2K33A 2L00B 1J7AA 3IL8A 3DM1A 4H2AA 1SE8A 1Y1VH 3M4QA 1V1OA 3EJIA 4IUQA 1NVID 2BKFA 3GD7A 2MEKA 3I57A 3WANA 2M00A 1LTID 1EQRA 2M17A 3IAS1 1JALA 2JA8G 3Q6BA 1UBQA 3S1NH 3Q8AA 4HK2A 4I65A 3ZJTA 2SNSA 2KDBA 1QVFA 1BMLC 1LGRA 2WKDA 4KI0A 4HMIA 3I4MB 1ZEQX 5JOBA 4C2MH 2LXCA 3T51B 4HJAA 3ZVVA 3Q14C 1IXRA 1DZ1A 1T5EA 4XGAB 2O5JC 2ID0A 4GLXA 4BY7B 4DV2Q 1MHWC 3NZSA 3N52A 3ER0A 3H15A 4FF4A 2F4VQ 1ZXIA 5CV4A 4DXFA 3P1MA 5COYA 3OWFA 4ANVA 1WCMB 2KEEA 2NUCA 4EUTA 5M5WB 3DBLI 3A33B 3LB8C 3J80L 4C4VA 1YVCA 2F0PA 3ULJA 4RGTA 1TGZB 2Y5PA 4QQBX 2G5DA 3J7AF 3AEEB 1VQEA 3UI3A 3K8AA 3NTKA 1CKNA 2B2WC 2ZCBA 3A7LA 1VZ7A 3VHTC 1JRUA 4K6LA 5C4XB 3CSTA 4GN5A 2AQ3B 2E6XA 2QDFA 1MI0A 2A68C 3P4PB 2W54A 2R2QA 4WORA 4XQJA 3MXNA 3EGRA 3DMUA 4NQLB 4GDLA 2Q8TA 2LY7A 1GAQB 1EY6A 1SB3C 1YOVB 2X6GA 2C7MB 1RAXA 5ISRA 3TP5A 3HRZC 2B2VA 2J0KA 3A8JE 1UZXB 2DZMA 4MH0E 4XTCS 5GAHC 4RHSA 1WTOA 4OGQC 2B3GA 1NYRA 1HNZQ 4YWKA 3P63A 2CR5A 2YEPF 3NQTA 4BFRA 2KECA 4N8X1 1V9PA 3B2GA 4S17A 3DHIC 5EBCA 5IP7H 1XNQQ 1PFBA 2RPQA 4MZ9A 3VFKA 1NCVA 1F9RA 3FMCA 4HJKA 4DV3L 2R93B 2VXWA 4OELB 3RMHA 1M1KC 1F9PA 3X23A 2MA9B 3VR4A 4RH6A 1D4BA 4UHVA 2I5HA 3LNNA 1HZ5A 4HPLB 4P6VF 1QILA 2Z0SA 1CZWA 2WACA 1SYDA 2CQOA 4QIWB 1E7ZA 2GB1A 4DV4L 1NNXA 4N9TA 4UPAA 3E6ZX 3TBLD 3K80C 3GDEA 3U58A 3Q3OC 2EYMA 5ELNA 3FC4A 4ZLTF 3H8HA 1J8CA 3S1MB 5T1IA 2HDMA 1O7LA 1PYSB 1WGRA 2D10A 2PZTA 1PRTC 1B2TA 2FUHB 4P74A 2M4NA 3BZKA 5DLQE 4JI8Q 2M0XA 2JA8B 4JI5Q 1GPXA 2CW0C 3UI2A 1BNZA 1Q82C 1S5DD 1TQOA 2WB1G 5I9PA 1FJGL 1E7UA 2OF1A 4H13C 1M90C 4A76A 1WM2A 1K73C 3ONAB 3R8BA 5FO8B 4A3DH 2MBBB 2IO2B 4XDCA 4IUVA 1YI2A 3GTJB 3A55A 4NXNQ 3S14H 2VZKB 1RCVD 5EAYA 1VQPA 4NJ7A 4KIKB 4ZYNA 1K83B 4DAYB 3JAME 4JGHB 2BE5D 1X55A 4RMAA 4K2KA 3AI5A 4OX9Q 3I4NB 3GV6A 2B2TC 2D11A 3DUZA 5FLMH 1S72A 1LT4D 1O78A 3RZDB 4X64L 1A6XA 2MO0A 3HOZH 2BWES 5C2TB 3A4SC 4EQPA 1LLRD 1I6VC 3CC2A 3G71A 1SRUA 3K5MA 3TS0A 3IFTA 2E3TA 3ZUNA 1ET6A 1JW9D 2P5ZX 3PHWB 5H92C 2GOWA 1KL9A 3CRKC 1I3QH 2PW5A 4GDKB 2JSOA 1G8ZD 1JWMD 1FXAA 4JOIC 2OHFA 1BXTA 2MNAA 5CBAE 2ZJRA 2IY0B 2BYEA 3W1SA 1DD2A 2WIIB 4US9A 2CU1A 2EY6A 3VR5A 1WE7A 3Q2AC 3VXWA 4F8MA 1ZUD2 3H0GG 1QNKA 1UAPA 2NWGA 1HA5A 2JJQA 1VQ6A 2Y0SB 2QJLA 3C8YA 3WCQA 2IO1B 2F0MA 1B3QA 2A6HC 3UE1A 3TL5A 4A3CG 1HA6A 4NPNA 4X3TA 1BCPB 2A6EC 4HDQA 3U9SA 5LL6S 4ICUA 3JC66 1KIXA 2WYQA 1Y8OB 3GTLB 1XD3B 3S1RH 3J81E 3BJUA 4B3SQ 1ZGUB 3W5VB 1T6BX 1WIAA 3R66C 1S5CD 1SE2A 2KX0A 2QC8A 2AEHA 2EOTA 1MG4A 5FLXE 3UQAA 1GUSA 4HCEA 4DR3L 2D2QA 1WJNA 1FRRA 2LVOA 4KJNA 1JWAD 3NVZA 1ENFA 4OONA 2RD0A 3S2DB 1IP9A 3HFZB 5IP9G 1PA6A 1VQCA 1SYEA 5BN3A 1SROA 2TMPA 2MW5A 3QG1A 3CCEA 2BH2A 2WXIA 1KRSA 1LUZA 4S3SA 2UU9L 2Q2TA 1G2SA 4OO1G 4BKGA 1C7YA 1YX5B 3IFWB 1T3QA 4GGQA 3E9HA 3NEMA 1F52A 2L8JA 3Q69A 4JI1L 1MSGA 5KRUA 1AE3A 2LXKA 5CV9A 3GO5A 4PV1C 4X3KA 1K50A 3UINB 3ALBA 4AIMA 4F8CB 4YSZB 3H7PA 2N1WA 4JV5L 3NBHA 1PGBA 2R61A 4HJGE 2BOSA 2FCQA 2VY3A 3MHZA 4MJSA 3NELA 1TT5B 4BZAA 1MD2D 1V1PA 2RSOA 3QR8A 1MIUA 4QIWE 5GAGC 2JT4B 3ONSA 5CTRC 1YJ1A 2L5TA 1MKHA 5IY0A 3HIZA 2DNEA 2JSVX 1C9FA 1Z5SB 4HSVA 2RSNA 5C23A 4JI7Q 4LF7L 2V1CC 4Y7NH 1ASZA 1FFUA 2DENB 5EJWA 1EOTA 2QEJC 1PMRA 2VL6A 4A3JH 1RODA 1WTHA 4G11A 1FO4A 3MJ5A 1LTRD 2UUAQ 4WFN3 1DOIA 1B7YB 2CVRA 1L0WA 5HGTA 3O13A 4G57A 5EKKA 1P1AA 1PH8A 2BBCA 4DV0Q 5G2NA 4HXDA 2JU6X 5EBDA 1D5XC 4LFCQ 4L6TB 3TMPB 5HFYA 3L3OC 1EOVA 2LHDA 2HJ8A 3CMAA 2NBUA 3L0OA 3DVGX 4ANXA 4MN3A 2ZEQA 3NWTA 1RFKA 3A9JB 4UP8A 4AJWA 3ZNHB 1BR9A 5IT9E 1TKEA 4K3BA 2EKIA 1EZ6A 1UGMA 4DUYQ 2KC1A 3S1QB 4R4TA 5NUCA 4OZAA 3I91A 3AEFB 4KVGB 5F2DA 4GOPB 3CRLC 5T1GA 4C7ZA 3AYHB 3DWPA 5C0XI 1PUTA 2XRQD 1L0VB 4NJCA 4W9CA 3I3CA 3KDFA 3KQ4A 4MTNA 3UE0A 4DV7L 3N9YC 4RAUC 4DV5L 2HHHQ 4X3UA 4WQOB 4AS1A 3LX0A 3EUB2 3STBC 4AYBG 3LDZE 4AQYQ 3P7JA 3TEWA 1PH5A 2IHFA 2CWAA 4B9XA 3L16A 2V1YA 2H4OA 4IG7B 4LW1A 1V80A 2Y0SE 3VTWA 2PW7A 1XXGA 1JRPA 1DOMA 4GSWA 4II2B 4USAA 4BWGB 1EIHA 2NVYB 1FFVA 2KTFA 1VQLA 2KDIA 1ESFA 4EKUA 3LWUA 3A7AB 4ZKCB 1PH6A 1BBWA 2XK5B 2QF7A 4DU9A 4WJPA 2F0JA 4OEMB 2EZVA 1I6HH 3CQZH 4IW0A 3NENA 3I7FA 2LVQA 4IWOA 3UIOB 4JI6Q 2NCNA 2PI2A 1NR4A 2KWUB 2MUYA 5C3EB 5G3LD 1E6EB 3CD6A 1C4PA 1Q1OA 4B0MA 4UP9A 3S24A 4CDEC 1LQBA 1XMQL 4JBMA 2ZW0A 3PZDA 1NBWA 4MGZE 1SE9A 2RPVA 2RF4A 1V43A 1NR2A 1MJCA 1E2ZA 1X65A 4LNKA 3PLVA 4L1BA 1SFOB 3A9KA 3SHQA 2C60A 4QB4A 4A3GB 2J7QB 1V9JA 2LWPA 3NJTA 5LXHA 1BCPC 2DN8A 3F2CA 1EFWA 3EROA 1HUMA 1D5ZC 3DQVA 5E6OA 5EE1A 3VTVA 2EXDA 1PLFA 1LO5D 2F0VA 4L5TA 2GA4B 4RHRA 5D3IB 1JB7A 2WXHA 4TMAB 2UXBL 1IYVA 5I2YA 2YLMA 4A3EH 1VJKA 1D7QA 3QOLA 3T3OA 2Z6BA 4C3JG 4OO1I 3RULA 1KFYB 4A3BB 1EWCA 3AEGB 3GS2A 1N32L 2IBIB 2Z0DB 5C4JH 1XEEA 2F0UA 2JA5G 1YMHE 3ENEA 2BA0A 4MDKE 5IP9H 1FEHA 5IYCH 1TWGH 2WLBA 2V4IB 3JAMc 1QUQB 3CW2C 2NPTA 2N7DA 1TWAH 2KTRA 2WXMA 5G5HA 3AMUA 1SNQA 1WH3A 5IODA 1I4PA 1G51A 2NZ1D 2K14A 2YU9H 2A69D 1L5PA 1D1KA 2XIWA 3NK9A 3H94A 4GNXB 3H3VI 3MXGA 2N9PC 1FXIA 3AE8B 5T8IA 4IPDA 1XCTL 4FXGC 1XYIA 4F1SA 1JWUD 2DNCA 3K7AB 3BWUD 3FILB 2M56B 2R7ZG 3Q8BA 3GTGH 1EYCA 1IHZA 1E7PB 1XQQA 2JPHA 2L83A 4KSLC 2F52A 2GLSA 2PQAA 2KHIA 3BK1A 3TEHB 2LMCA 1G6JA 4ODGA 2G9HD 1K8RB 2N7JA 3HOVB 3OLMD 3H09A 2BQQA 3QQ8B 3PRMB 1VQFA 1SLJA 1WE6A 2OJRA 3LJ3A 3PZ8A 1VQ8A 3OJ4B 4A3KG 4YCWA 3QA8A 1JQ4A 4IFDJ 5IN7A 1A62A 1WM3A 2GN5A 1DOYA 5CBEE 4OVUA 3DWAA 1UE1A 3IG3A 1QNUA 4US8A 5A2QL 1GJXA 3AM9A 1FNVA 4OHJA 5CV8A 1EFID 2WAQB 4HIOA 3WA0A 5AJ3L 2KVMA 1IBKL 2E5LQ 3HOXG 2NN6H 4X62Q 3J81c 1EU3A 3AEVA 4FHJA 2UUCQ 1PYBA 1X56A 1IL8A 5FLXc 4ZRZA 4F87A 3GE8C 3IT4B 3JAMi 2WXFA 4APVA 1U5KA 3HOYG 4O1NA 1NDDA 1JJGA 4MSMB 1K8GA 4JI4Q 3AE2B 1ILQA 2K5VA 4JI0Q 1BVSA 5ELEA 1OQQA 5L37A 1M8AA 2ZZPB 4DR4Q 4B0EA 1SIJA 4YTMB 2Q2IA 1FNWA 1HNWQ 5C3WA 4C3HH 2PIAA 4FA6A 4HCSA 2VUMB 3E3XA 1ESRA 1YNXA 2NS5A 1CZGA 4GOPC 4CJ2C 3VDZA 3PIP3 2Y5CA 1IYFA 4KD4A 2V4LA 2R3ZA 1AARA 5CX3A 2DGYA 1HNXQ 3N1ZC 3ZIMA 1RL2A 2I1KA 1LYLA 3SK8A 2INPE 4A3MB 1XPRA 2WXNA 1GB1A 4C3JB 2BYVE 2LEKA 2EJMA 1I42A 2B63H 2F0SA 5I4DA 1D6EC 4HPPA 2O2VB 2AL6A 1WRIA 1VMCA 1Z6HA 3BZCA 3SD5A 2CH4W 2MGSA 3HP3A 4PZ6A 3KWLA 2V3SA 2I38A 4W9KA 4IKGA 5CORA 2PE6B 1CUKA 3K9OB 2Z6KA 2DX5B 1H8CA 1YNND 5DPWA 4DBGA 2PW9A 1FGBD 1YBYA 2K28A 1NI3A 2PLPA 1QQRA 1MI2A 3J81i 3NZ3A 1RHPA 5D65A 5ELBA 3W1BA 5M3FH 4GLVB 3EFCA 4W9LA 3SK5A 1VLBA 2OQKA 2BKRB 2D62A 1QWYA 3PGEA 3WAPA 2R7ZB 1DXMA 3K6OA 1CFMA 2L4NA 2UUBL 4OWWB 4BBNC 4H0LC 4KHPL 4R3DA 1YNJD 4B3RQ 4N59A 3OTOL 1QOBA 3E0EA 3I55A 3Q6SA 5AZGA 1NTGA 1KXLA 2LS01 3TS2A 4WQMA 2LFNA 3CIRB 5CC4A 5LMUQ 2VZAA 3KLSX 3VDYA 3S15B 4EGVA 2Y5BB 2M9VA 4LAAA 4DAMA 1PH2A 2ZNVB 3B0AA 3QIAA 4HIDA 5EE3A 3DWGC 3TIXA 5DPRA 2EJGC 5IT9c 1BF4A 2QIEB 3TEYA 2I2YA 4BA2I 2PEAA 2MFIA 3PVLA 4C3IH 4ZK9B 2AWNA 2F1MA 2BS4B 4TRDA 2WXOA 5J17A 2LUMA 5GAEC 3PUZA 1D8LA 4LFAQ 3MXUA 3VAWA 2VNUD 1C4AA 2JXTA 2HJ1A 2NTTA 4P72A 3APFA 4EZLA 5KHQA 3O65B 2JA5H 2CFMA 2DYMA 3AU5A 2XGTA 1AN8A 3T1YL 1QKZA 3RT3B 3CP0A 1UGJA 3N32A 3A8IE 2A5UA 4DUZQ 3MZ5A 1OQRA 3HOYB 5BR8Q 3AEAB 3RUIB 2K75A 4C00A 1TWCB 4FXCA 4G4KA 4H7BA 2GVAA 1NSNS 3VUYA 2N8NA 4EFOA 5C44B 4L5QA 1Y1WG 1LT3D 4HDOA 3L9AX 4L5SA 4BBSB 2L1AA 2MPMA 3RN5A 3IFDA 2I5LX 1STGA 4GNXC 3AE5B 2FFKB 1PH4A 3QB3A 2WAQE 4IN3A 4R8IA 2R92H 4GKKL 4GZYC 3KYCD 4WH4A 4LNFA 3TEXA 3ZKJC 5J2RA 2F0FA 3NTIA 3WOFA 3D6CA 2BDOA 4CGYB 2KDEB 1B9RA 4WJ3M 2XVSA 3PV0A 4JLCA 2NVXB 3MXNB 1SIFA 2ICEC 4LUZA 1XLQA 4R4IA 4X65L 4YT0B 4XQNA 1STNA 1UE7A 3HOWG 1GG3A 3AEDB 2YTYA 2O2LD 3AULA 3M4PA 4P75A 1LXDA 3N6RA 3PIOA 4DR6L 1PGAA 4Q0FA 2K6QA 2HD5B 1IBLL 1L0XB 2BB6A 3CCJA 1TVXA 4IOCA 1YX6B 3HOXH 4CKBA 4KMUC 3T13A 1CKOA 3TSSA 2VQEL 1KABA 5IYBG 1P7FA 2KQ7A 4YHHQ 1RTNA 2BGFA 1UWMA 4P2CB 1RTOA 3DVNU 4MT5A 1BBXC 4MM3B 3FDTA 1QZHA 3EVQA 3IRBA 4NQKE 1QLBB 5BYRA 2GBKA 1O80A 3WWVA 3FHWA 3X3MA 3KBGA 2Z9HA 1SNDA 2MJEA 4OVZA 1GB4A 5I6WA 3SDZA 4ZHPA 1HPCA 1WYDA 2FMCA 4KTAA 3HRDD 3RZOB 2EY2A 1JC7A 4BBRG 1SDFA 3GTPH 1AW7A 1MHXA 4E74A 1KLUD 5FJ8H 1B9NA 3IT6B 3NOBA 1GUTA 3R2TA 5IP4D 4QL5A 3J7A5 2VQFL 3U30A 5IKCM 2EYHA 2N78A 3NBIA 4RFBA 5HI1A 1OXVA 4EVOA 2IGGA 2I1JA 4LF5L 2MHJA 5IYDG 2K52A 3BS1A 1PTOB 3EBEA 4FNFA 3OWEB 4TSSA 1C3TA 3OW2A 4EZJA 4RNAA 5DPSA 2PNHA 2LHEA 1U4PA 5AZHA 2JE6I 2UU7A 4DK0A 4MNOA 2KVRA 4XWTA 2NBFA 2E2HB 4PZ8A 2AL3A 3Q0AA 4QCLA 4JYAL 1F9QA 2JA6H 2JWUA 2EQSA 3QX1A 2C5CA 2I5MX 1XMOQ 4IOAA 1SN8A 2L05A 1QE6A 5ELCA 3CCLA 3EN2A 2QMTA 4WWOA 1ET9A 1AYFA 1TZ1A 2HCCA 4LJOB 1R4MB 3JYUA 4FN2A 3B2FA 3V60A 2WXQA 1I4GA 5KEEA 2B2UA 3QJYA 4M0WB 1R7SA 3BYYB 5K5PA 4NDXA 4PMWA 4FYDA 2R93G 5FR6A 3B6YA 1U9RA 4C2MB 2WXPA 3KF6A 3S2HH 3DEPA 2CU3A 4PS8A 1EEFD 4DV6Q 3MC9A 1HCZA 2F03A 5KNDA 3Q23A 4J8QA 1QOGA 3I73A 2F3IA 2QSDA 3DBLB 2KXJA 2C9OA 2F0GA 3DHQA 4BS9A 1J8IA 1HQMC 2WWZA 3CF6E 4IUMB 3HOWB 4BA1I 1Q8KA 3SGIA 1C8CA 2MLBA 1Y14B 2HUGA 5JJZA 2ZNVC 1Q90A 1TJEA 2A68D 1HR0Q 4NXMQ 4OZCA 5G3LF 5IE8A 5M3MH 4A3FH 1X3EA 4MIUA 1PFDA 5DPTA 1TU2B 2QDBA 3RPFC 1A2TA 4BKTA 2KVZA 4JE3B 1V5TA 2K8CA 1HHVA 1Z7TA 1FRDA 3FPPA 2MRPA 4LK0M 4JVZA 3D4DA 3VR6A 1N33Q 2XN9C 1RWSA 2O6VD 5EPLA 2O5IC 1S4ZA 1YJNA 1OTCA 4ICVA 4TKNA 3NPPA 1LM8B 1HFGA 1R4MI 3VR9B 2KMCA 1ZKOA 1KRTA 2PMZB 3GTQH 4R4QA 4W9GA 1KLVA 4PQXA 4A93H 2FMMA 1WGYA 4E71A 4MELA 1L0YB 1EY7A 1LTGD 3M3YH 4LNNA 1J7BA 1IZ6A 3I4NG 4I6PA 2WINB 2X8XX 3RFZB 3BVZA 1A3VA 3RN2A 3K81C 1WVLA 1TKGA 4BXXG 1FR3A 1WJUA 1GKHA 2CQAA 4XDXA 4XT1B 5G55A 4BBRB 2Z8LA 4POFA 4DV2L 1YJ9A 4JC0A 1JROA 1ZW7A 4RA8A 3NVVA 3PO3H 2MH7A 2KOXA 2F4VL 3M7NA 1STBA 4YXDB 4DXAB 3IHPC 3VA7A 4YWGG 3ZJUA 3QWNA 1G91A 2PCFB 4OWXB 3U7ZA 3VVWB 3NBHB 4FHKA 4B3TQ 2OT2A 3IKJA 4BY1H 3K0XA 1ASYA 4NZLB 5EQ0A 1PRTD 3M4OH 3E9IA 2KANA 2NVQH 4HVBA 1IBXB 3U52E 1T0YA 3KLWA 2Y0SG 2J0TD 1K3BC 2CW0D 3E5SA 2JA7G 2WP9B 4ZRPA 2B2VC 1PH3A 4IJHA 2KK8A 4EQ5A 2E2IB 5JJKA 1YJJA 3N20C 2NZOA 1PHJA 1N5WA 3EA6A 2K25A 2KA7A 2IX0A 3M95A 3K57A 4JX1C 1WOCA 3A4RA 4PYZA 2B2WA 2PKOA 4Q2JA 2MBHA 2YTVA 3OMGA 3I4MH 2CHXA 4JPSA 2FE8A 4N6EB 4GN3B 1MPEA 5GXGB 3BVGA 4O42A 4BY7H 3NS8A 1WFQA 1NBFC 5BMIA 2D0OA 2LXAA 1SYFA 1F77A 1XNQL 1PDXA 2CKHB 2EJFC 4FVMA 1WCMH 4LF9L 1NAPA 5M5WH 2BVCA 4DV3Q 3KLSA 4J1MA 2JY6A 4CDCC 1K3RA 4KHVA 4A3IB 3D32A 3RR5A 4K0KQ 4WURA 1U4RA 3RUZA 1EO6A 4RMFA 4J6HA 1VDVA 3TRZA 4W9JA 3I70A 3RD2A 3ZNZB 3PQIA 1AEXA 2Q8RE 3I90A 1CKMA 4IM3A 4A9AA 2BCOA 1WF9A 2F0QA 4DV4Q 5C4XH 5IYDH 2A6HD 1I3QB 2PMVA 1H9SA 1E24A 2RBMA 3KDFB 2LXJA 4DV1L 1DOKA 1MBYA 1PTOC 1CA5A 3TZDA 2IYDB 1WTWA 2A6ED 2F0DA 4B3MQ 4HR7B 5AUIA 1V1QA 4DR2Q 1KDAA 3LGJA 1YN4A 2UXCQ 5E6NA 1N9WA 1C78A 4JI8L 1ZP0B 2FCNA 4JI5L 2RMMA 3LYYA 2LVPA 1DOLA 2A4ZA 4RGOS 4DPGA 3J80E 1WTPA 2F0OA 3P1HA 3MFYA 3L10B 5C0XG 1K8OA 2G1EA 1PZJD 2B29A 1SSNA 1X54A 4HJ9A 5C4ZA 3R3OA 3DHGC 4OX9L 3OIPA 2Y3AA 1ZDXA 2R93H 2I0QA 1LACA 1VQGA 4FULA 3R7QA 1QF6A 5EE0A 2EYLA 4YIJA 5FO9B 3S2AA 4POGA 3W1SC 4CHTB 2N88A 4WWNA 2KBNA 3FPUB 2DBYA 2F0HA 4YSYB 1FD6A 3AFPA 4IDIA 3D4WA 3CCSA 1A0IA 3D31A 2Z4IA 4A90A 3ZJYC 3GB1A 2AUJD 1E2WA 2PTLA 4J6IA 3PF5A 2B2TA 4IPCA 2EDGA 2KKCA 3A9KB 2JA7B 3MC0B 4BKSD 4ZHOA 1WYGA 2Q5WD 2PQEA 3IAM1 5DM73 2ZM6Q 1G2TA 1SAPA 1AZQA 1OO9B 3WAOA 1NJIC 5KGUA 1JMCA 3U2SC 2DLBA 4ANUA 2JA8H 1V2YA 2KFJA 4KZ0A 3VYRA 4NAWB 2FUG1 5AFWA 4GN1A 4JOIA 5KNCA 4DHJB 1B44D 1SMYC 4PZ7A 3KF8A 3GTJH 2LKVA 3DCGA 1PFMA 2KX3A 3UIPB 3UDIA 2MJ8A 1KM7A 1K83H 3CPFA 2HQLA 2RA4A 3ZXVA 1CMXB 4LF4L 3I4NH 4B3SL 2K8HA 2NBVB 1WTQA 1JORA 4NAMA 1B8AA 1EIFA 3P20A 3RZDH 4BXXH 4X66Q 1EY9A 2FHTA 3WALA 1CZPA 3M7GA 5LLIA 1Q1BA 2CWPA 1VQOA 3V62A 4O2DA 5FR3A 4ZRIA 1LT6D 3FEWX 1RJTA 1WMHB 1S5ED 3ZRFA 2EXZA 1Z47A 1RF2D 2E75C 1QOHA 2XWJB 1EY5A 1KAWA 4FF1A 4JW0A 3VR2A 5E4WC 4K1RB 4ACFA 4GB9A 2RQXA 1KH0A 1GUAB 4ME3A 3RLOA 2V3PA 2PQAB 5C3EG 3NQIA 3MP9A 1YIJA 2C7HA 4RG1A 3PO0A 2JYTA 5JVG3 1Y8PB 2KMAA 4K7SA 3ZYYX 4HMJA 1K53A 3R93A 2VS1A 3X0WA 4JCVE 5CGKA 2A74C 3K7UC 2KMMA 2G9DA 1XNRQ 4A3GG 1RM6C 2HE7A 3TDQA 1HTOA 3C19A 1YHQA 4MACA 5GADC 3CSFA 3L17A 4CYEA 3STBD 4IM0A 1F9SA 1KDBA 1PYWD 4IPGA 3GTLH 2F3VA 2ES2A 2VZKD 4LF6Q 3NUHB 4YWMA 2LASA 1QG7A 1JR0D 3HM3A 1VF7A 4C7YA 3DWQA 4C80A 4BAXA 3OW7A 4KKSA 2EYPA 2L12A 4JWSC 3RCZA 2REXA 1E22A 3U50C 1WTXA 4JI7L 4P7IA 5IIFA 4A3BG 4LF7Q 2K8BA 3NY5A 2PE9A 3S2DH 3HGBA 2KO3A 2PNRC 2AQ1B 3F8TA 1LV9A 4LNOA 4XZ4A 4S0RA 1O7IA 2KWCA 2ZXPA 3TUOA 1EY0A 4AP4C 1A70A 1II3A 2ZTDA 4DV0L 1IGDA 2M8SA 3Q8CA 5HKHA 3I56A 2WX0A 1EEID 3T4AC 4DR7L 1IUEA 4LF8L 4URKA 1YIWA 4GKJQ 2UXDQ 2CJOA 2KCTA 2DAFA 2D3CA 2F0NA 2EYJA 1ZKHA 3DBHB 5AZFA 3ERQA 3RYTA 2KCNA 5JPMC 3L0WB 1UBIA 3FKYA 2KENA 2E2JH 1WR6E 1OXTA 1BCPD 3SR1A 4E3CA 4C56C 1VQIA 4JBKA 2W3RA 3ZRCA 5MPOA 5C6AA 2LGDA 3H91A 3DLLA 3HOVG 1NUCA 1TYGB 3AMZA 4HKQA 3SDLC 2OEOA 1NYQA 2L1BA 2RDGA 2R6GA 3VUWA 1LTTD 5K36G 2JYEA 3HOUB 1CHQD 2VRRB 4CKCA 5KYLA 1T5XD 1W6JA 3BG3A 3DBSA 3TCAA 2B8GA 5M5YB 2YEPB 3DM3A 4J15A 4AQYL 2RCNA 3JW0X 3ZGZA 2WAQG 4NY0A 3GOEA 1MJDA 4KV2A 3PGZA 3G48A 1C9OA 3A74A 2V4DA 3CCRA 1XLOA 4KKUA 5HHDG 4OIJA 1YN3A 5C3XA 2OWOA 3F2BA 4A3EB 2GMIC 5EE9A 1X3PA 3AEBB 3RNBC 1IBMQ 3DXJC 4YL8A 1WD1A 4QGUA 2INNE 3H0GH 5AEKB 2MHVA 1QOFA 1N6ZA 4KIKA 4DAYA 1V49A 1UEAB 2BA1A 3DBHI 3QAQA 1TWGB 4LK1C 4GLSC 3DVNV 2N55A 4JI6L 3J7AV 5DAUA 4IQZA 4KKJA 1CI3M 4A3CH 3DDCB 4CO7A 5CV7A 3M3JA 4A20A 4HN7A 3S1QH 1OXUA 2J7ZA 1WY8A 2ZVOA 2GBMA 4XC2A 1HUNA 4YTNB 4M1UB 2YU9B 4WAAA 2VUMG 3MEFA 3J7YW 1VQ9A 5IOIA 4GDKA 1YQBA 3E0JA 5JEAG 5GMVA 3JSVB 1UUPA 1O7YA 3RNFC 3AB5A 1HZCA 4PK1A 3Q3NC 5JAVA 4DR5Q 2A73B 4A3MG 4JBJA 1XPOA 4HCPB 4WRDA 3SFEB 3SVMA 3KUDB 5JHAA 3DEOA 2WP8J 3KJPA 4XT3B 1PFSA 4JBWA 3BYTB 1SBBB 1JWSD 3DPDA 2UXBQ 4FJZA 1TIID 2NVYH 3ULLA 5M9OA 3JVZX 4PYUA 3UGBB 3J80c 2XSCA 4B9WA 2ZJPA 3KUPA 5AUKA 4OO1H 1C0AA 1WXAA 1UE6A 2B76B 4FF3A 4A3LG 4XYCA 2JA9A 3PO2G 2X38A 5DCNA 5C1ZA 4ZKBB 3MFGA 5C3EH 2OCEA 2IGHA 5LMNL 1MFWA 3ZO5B 4LFBQ 2KFKA 4RM8A 4I6LB 3QCAA 3SE0A 1ZPSA 5CV6A 2A1AA 4P1CC 3ZXRA 1YHBA 1ILPA 1GC7A 4L23A 3H3VH 3W5OA 4KGTA 5LXIB 1YITA 4K2LA 5I6YA 5DEHA 1SFOH 1GUGA 3V05A 1OFFA 2MBEA 1SMXA 2KWVB 2N9LA 1TKYA 4DWFA 3I63C 4PS7A 2GVBA 1DJRD 4PG3A 4YCVA 1VQHA 2PPHA 1HTLD 2R2OA 2W3SA 4MH8A 1FCCC 3SFDB 3AQQA 1PRTF 5M5XB 4XQQA 4CDDC 2INDC 1YQ4B 2WXRA 2NBWB 1QVCA 2W9NA 1KDCA 4A3BH 4IPHA 1ONLA 1UD7A 2EIFA 1IYUA 4TQ1A 1TS4A 4DF7A 1EIYB 5BYQA 3NE5B 3KK7A 2B63B 1GNUA 5AJ3Q 3TBIB 2ZVNA 3J80i 5BN5A 1EQQA 2E74C 1E90A 3KFUA 3GTKB 1WR1A 2MX2A 1B9MA 2K22A 3NTHA 5C44G 2UUCL 2L3ZA 3T9LA 3CU7A 5JPNC 3FKIG 1CQFA 4ME5A 1SJHD 3S17H 4BBSG 2JQRB 2ZJDA 1VF5C 1CM9A 1HZBA 2Z1CA 4RGNA 4HLEA 3W9CB 3T1HQ 3NVYA 1WWTA 4KY5A 3K7AH 2FBWB 4V0BA 4JQWC 4PT5A 1I7HA 3FRPB 4JI2Q 4DXGA 4JI0L 5IGEA 3N3KB 4LNIA 4PS3A 1K9MC 2VH1A 1LTSD 5C3JB 4MGYE 1V86A 1U4AA 1XTCD 1OTRB 3RMKC 2NB0A 1SEBD 1I94Q 2SNMA 1RD9D 3HOVH 5L83A 4LNQA 4JI3L 1SGHA 3KH0A 3VH4B 2K01A 1BUIC 1UWXA 2KHSA 5TSSA 3OAWA 1Y69U 1J5EL 3BIID 3RZWC 5BYSA 1HNXL 4OXPA 2Z6KC 1CQVA 1I4QA 2FXQA 2K5DA 3HZXA 1U4MA 4A3OA 1OQYA 3ML9A 1GUOA 2L0CA 1HXYD 4ZUJA 3U4EG 2VW9A 1L2FA 2KJRA 1TY2A 2JRIB 2MP2A 1RRBA 5I2XA 1X3QA 1YZ6A 3DOWA 3WDNA 2JQOA 3PO2B 2BYFA 4RCOA 4KV6A 1XTDA 4MGKE 5KHOA 4TVAB 3I4LA 3KF6B 3ECIA 1KHIA 1WYWB 3RN9C 2N9KA 4YSXB 1CHPD 3A54A 2MJ3A 4BOZB 1VQ7A 2QILA 3VH3B 4R4OA 4DA2A 2VH2A 3G6EA 3PT2B 1KOTA 1QB5D 1AP0A 1N61A 2KNBA 4ZRQA 1BBUA 4R4CA 3APCA 3ND8A 5LL6X 1DONA 2UUBQ 5A2QE 2B2YA 4I6NB 2VUMH 4CBVA 2VB3X 2XK5A 1A5RA 3TP8A 1TWHB 1BDOA 4UP7A 4KK7A 5LMUL 2N9XA 3OJ3A 2IW3A 3HKZB 3P4QB 5IA7A 4E6IA 4RF0A 3NP8A 4ZAIA 2CKZB 4A3MH 3CAMA 4XXEA 4C3JH 2HTHA 3L13A 4N58A 1F2RI 3GTMH 4JL9A 3E56A 4IURA 2DY8A 2HDEA 2X69A 3GV3A 1V8CA 1K8AC 2MQHA 4YY3Q 2WXKA 4GMVA 2JEBI 1RDPD 3AECB 2C9WB 5IWAQ 4LFAL 4IUPA 1JOQA 1L4DB 1JB3A 5I9OA 1N34Q 1K0RA 1NE3A 1Y1VG 4C4VB 1EY4A 3FKIB 1UEBA 3T1YQ 3OMCA 4DUZL 1O7ZA 1TT2A 1R9TH 3LWEA 1QT9A 4TKOB 2R7ZH 1CKNB 1ZXHA 1E1OA 3HVZA 3LXFA 5D2MB 4DNRB 1Q46A 2LD9A 4IUNA 1ICWA 4FO2A 1FPYA 5JJLA 2NZHA 5JZEB 2B3AA 1I5FA 5J39A 2D3BA 1U0LA 2DUDA 1HZAA 1ZYRC 4FP5D 1J6QA 4DK3C 4GDLB 5EDSA 2N49A 3S15H 4EEWA 1QUQA 5E7NA 3GTOB 4WAFA 2AQ2B 1HZ6A 2OEDA 4A3KH 1N8RC 1L1OA 4Q5VA 1EZ8A 3D0FA 1P9DU 1WTRA 4DAPA 3IBEA 2JRHA 3VRAB 3N1XC 5IOCA 3SXHA 1E1TA 1EQTA 1E8XA 4LLGM 4G50A 4A55A 4GNXA 1B50A 2K1FA 2OOBB 2LGSA 3FILA 1P7EA 4Z9CB 3P4SB 4YTPB 1GO3E 2EYOA 1MSHA 4DR1Q 1I50H 2WXJA 2J4XA 5IGBA 1H4RA 3VQIA 4G3XB 1KF6B 2LGIA 1IBLQ 2N1VA 1VCBA 3V2TA 4R8NA 2GRIA 3PUVA 1EUVB 3KYDD 1GUNA 1NMFA 4NJ6A 4QUCA 1MGSA 1Q7YC 2D3GA 3HOYH 2NYZD 4PMCA 3PZ7A 5LMNW 1TWCH 1PV4A 4KGSA 3QIJA 2LZ6A 3H6MA 4KHZA 4YHHL 1YJWA 1GOZA 2FJ2A 2KLGA 2LRUA 1D5MC 4TQ0A 3C2PA 3A0JA 2AHOB 4BOSC 3RZFA 1PFNA 3CCMA 1JT8A 2MSED 4KDLB 4OZBA 3RLNA 4NNJB 4ZCKA 5KYIA 4MTKA 1S3SG 5CMDA 1KC8C 3RNGC 3HHMA 2RKSA 3G7LA 2FCSA 5GROA 5IP7G 2Q2UA 1NEKB 1VZ6A 1N36Q 4AH6A 4DDID 3GZNB 1MVKA 2FIDA 1HZ9A 1BOSA 2NVXH 4DHZB 1TWFB 2EMTA 2MWSB 1S5BD 1KRHA 4YWLA 3EHVA 1F0ZA 3S16B 2RGFA 3M4YA 4GIVA 4TQUS 1HJPA 2MO1A 2NVTB 3ERSX 2FINB 1IKLA 2IX3A 2ZJQA 2KYWA 3HUIA 2RR9A 4HJ8A 2DYBA 4LCDE 4LF5Q 2CHZA 3TJPA 3HEJA 4IUUA 2OQ0A 4F7XA 5C4HA 3U8ZA 4JWUC 1BCPF 2RVLA 4ILWA 5E1FA 1Y1VB 4QJFA 1D3ZA 5E3FA 1VQ5A 1F2RC 1E8ZA 3ZLZA 5E4XA 4JYAQ 2B2UC 4NB3A 3T16A 4HRSA 3S1NB 3VTUA 1VMPA 3DWMA 1J0GA 1GXDC 4IFDI 3Q8DA 1XLPA 1WXSA 1C48A 1WGHA 2M1MA 2KHJA 4A3DG 1KTKA 2DY7A 2JVCA 1B3AA 1D1IA 3D4RA 4DN4M 2L55A 2O2VA 3GZNI 2HDLA 3H9DA 2KCMA 1SYGA 3RZOH 2K5WA 3ZDTA 4A3PA 1WI5A 5FLMG 4A3IG 4P73A 3HOZG 2WXGA 1UWVA 4DV6L 1SYBA 4H44C 5IGGA 3J7ZC 1I4HA 4W9FA 3IAYA 5E6PA 2KQ3A 2KJ6A 3KVFB 1H9KA 4HEA1 4P16A 1OXSC 2O4XA 3FVQA 1Q10A 2GBJA 1DCZA 2WDQB 4B95A 3V96A 3KOJA 2KDMA 4G7HC 1Y8RC 1GJZA 1PTOH 1RIPA 1CJEA 1WXQA 1M94A 3PIPA 2D07B 1HR0L 5EPKA 2JXXA 1D2BA 5GQOA 2KOLA 1IL2A 1M4VA 2XNAC 2ENBA 1K51A 3L2PA 1F2MA 1EYGA 3FP9A 3W1GA 1N33L 2D2CC 4K5WA 1C76A 4ABNA 4YCUA 3MTSA 1TBEA 3Q3JA 1JQYD 3VUXA 4ZRJA 3MTNB 2HIVA 3MEHA 1Y1WH 1WGKA 2SEBD 4OIKA 1X1MA 1OEYA 2KJXA 1ACCA 3EC8A 4DDGD 1IGCA 4QY7A 2K50A 4FADA 2KCCA 1G6ZA 1JJ2A 2J0MA 2F0WA 3R2IA 2Q8IB 1LTAD 3F2DA 4FF2A 2KDFB 1KD1C 4QAYA 2H5XA 4NPSA 3NG0A 1IW7C 5E6JA 3OOCA 5BO4B 1E5WA 3H7PB 1H9RA 1LTLA 3P4RB 4AQ7A 4R1JA 3K5OA 1WX7A 3A1QA 3OSOA 3RD4A 1MHHE 1TZOA 2SOBA 1ICFB 2ZCCA 4MJSB 4WWPA 2MBOA 4W9EA 2J53A 3NUCA 1V1PB 4IJLA 3HOWH 2CHBD 1RKNA 1C79A 1XPUA 1FXTB 2K0PA 3MC8A 2M2LA 5C0XJ 3QJZA 4EOYA 3JAML 4NW2A 1PTOD 1SYCA 4B3TL 4MHEA 1R4NB 1JE5A 2L11A 2BS3B 2K5HA 3ZNGC 2Z0EB 1K28A 2HQEA 3H6NA 3T8MA 1DOXA 1ENAA 4L63B 5CHWA 1BO0A 1YEZA 3ZTDA 3UDGA 2D9UA 1CK1A 3BINA 5IYBH 4KLKA 2UYZB 3BY4B 4LWCA 1X6OA 5H8YE 4L2YA 4RKLA 3AN1A 1F1HA 4DHZE 1HNZL 2DYOA 2I07B 4REZA 4A3DB 1WFYA 2KN4A 3NS1A 2F3WA 4OWTB 4XX5A 3S14B 3W3AA 2W82A 3OG5A 1R4PB 1J9OA 1EUJA 3RNUA 2H1EA 4BBRH 2O6VA 4J3OD 4M01A 4EQNA 2DJFC 2L0TA 2IHEA 1UE5A 2QCPX 3HOZB 2J42A 4JPBW 2ON8A 4MEMA 5BMHA 3SU8X 3BU2A 3K58A 2JZZA 3S9WA 4A3JG 3TP7A 4K3CA 2KEDA 1W2BA 2SAKA 3BDCA 1WZ3A 3TN2A 4LF9Q 2KN5A 3A56A 1R4NI 1SE3A 3F1ZA 2NR2A 3PV1A 2XRSD 2LGYA 1EF1A 3EIVA 3UDXA 2K1BA 2ALYB 3J81L 4K0KL 1MG8A 1P98A 3MJWA 4MM3A 4RF1A 4BBNF 1I35A 4GLAC 2ZXRA 1PQSA 3PCOB 3WAMA 4I7ZC 1EY8A 2IT1A 5FLXL 4HJ7A 2Z59B 3V6CB 1XLNA 3L08A 1HE8A 2IZVB 2LI5A 3CHBD 2E2IH 3B9JA 1SMYD 2B39A 1JICA 4HTHA 4DV1Q 1FJGQ 3PSIA 2KQ4X 4W9DA 4DKAC 4B3ML 4DFAA 4DR2L 2LFIA 4XYOA 2UXCL 5IAAC 5EGTA 2N7EA 4TV3A 5JVH3 2CJNA 4NXNL 3V6EB 2DNFA 3PSEB 3MAQA 3AH7A 2KHWB 3G4SA 1QZEA 1TS5A 2QW7A 2QEXA 3S1RB 3W1YA 1N63A 2UWQA 2EE1A 3ICEA 2K5QA 2YVCA 2NTSA 4X64Q 1WI0A 1GHKA 1WZ0A 5LHY1 1AFPA 1TKWB 1BUVT 1Q0WB 3U9OA 1LM0A 2KLCA 3URYA 2HT1A 1B1ZA 2JZPA 1E2VA 1SNPA 3C1FA 4IC7B 2PMZE 4ANWA 2WQYB 3P75A 3ABVB 4M02A 4A3IH 3KWVA 4KX6B 1Z2MA 1BKBA 3I4OA 3PF4A 4Y52H 4AUQC 4NKLA 3S1MH 2K6AA 1R4QB 2PVGC 3KW5B 2K04A 3SR6A 4ZQ3A 3TZUA 2K5NA 2QDLA 2IL8A 4NP5A 1FM0D 1VCIA 2LRWA 4QUFA 4F7ZA 5H1SE 4M0WA 2ZM6L 2XBBC 1STYA 3BZDB 3ETRA 4ZYSA 3M63B 1VZ8A 2PYKA 2QCZA 5KNBA 4WIPA 3DVGY 4HROA 4RWSC 2IY5B 2LGXA 1XJVA 3Q3MC 2JWZA 2RDHA 1RLFA 2YTXA 1EM7A 2N9EB 4FXKC 3SEBA 4B6WA 2NPTB 3ITPA 2A19A 1LABA 4K81A 3HOUG 2WNMA 3BK2A 2HTME 1AWDA 2KTRB 1F2ZA 2R7FA 1SR3A 2RSUA 5IT9L 4DR3Q 2K05A 2SDFA 4Y7NB 4LF4Q 1BQQT 5HURA 1RFAA 1XF5L 5J22A 3K5LA 4A3JB 1ZE3D 2AKWB 2G3QB 2BE5C 4X66L 3PREA 4LTUA 1Q12A 1QZGA 1L6VA 1YQ3B 1Z9FA 2K7VA 3PUYA 4A3EG 4MSQB 2KFKB 5LNK1 2EMSA 2IWHA 1F9JA 1TY0A 4RM9A 1EL0A 5L95C 2H89B 2UU9Q 2LMCB 2Q2HA 5D94A 5FO7B 1QVGA 1HR0W 2WXLA 4CDFC 1WD0A 3CKIB 1KNAA 4DK6C 5IYCG 4JI1Q 2JA7H 4JK1C 3CWIA 3FAHA 3M9BA 4L5RC 2NVUI 1F2YA 2OTLA 2A5HA 2G45B 3QC8B 4ALPA 1DYQA 2C35B 3PHXB 5JHBA 4XIGS 3L54A 1DGJA 1Q86C 2WU2B 4JV5Q 1E0BA 2IO3B 2C5LC 1A8VA 4C1NK 5C5MA 4W9IA 2KJHB 3AFQA 2JZ3B 1E9MA 2L9HA 3ZTCA 2Z4HA 3NXWA 4K5XA 2WB1B 1XNRL 4BKSA 5JJIA 1CTMA 3PMFA 4KKTA 1L7YA 2LSSA 3VYUA 5ELOA 4RKBA 1H9MA 3KJOA 4KZCA 2E2JB 2ZPYA 4K14A 4PNYA 1STHA 2PJHA 3BDOA 4ASWC 4LF6L 1KLGD 3APDA 1IBXA 1WJJA 4A8XC 3W2DA 2V3NA 2EY5A 2F0KA 2G4DB 5CHFA 2UUAL 3AXCA 2JK8A 5EKIA 4KSKC 3T3NA 1VD2A 2PZUA 4KDIC 2IJ0A 3TP6A 3WIMA 1GD7A 4M8AA 5ELFA 2F0EA 3BVMA 1YN5A 4TUUA 3C3LA 4K8IA 2DZIA 3QARA 1VQJA 3NWSA 4DNIA 4IWPA 2IGDA 4HPMB 5JEAJ 4XE0A 1NMGA 4WJWA 4LFCL 2QA4A 5IO9A 1SSOA 2JEAI 4X3SA 1B70B 4ID6A 1TS2A 1I6HB 2NN6G 3SK6A 3CQZB 2L0FA 4A4IA 4BVUC 1ZOYB 2A8VA 1WGGA 4N8FA 2PI2E 1WTVA 5EPJA 4DGZA 1PH1A 2K9XA 2KD0A 3ULPA 4DUYL 4HIMA 4DR7Q 1A15A 1T9HA 3H0GB 4LF8Q 4GKJL 2UXDL 3HM6X 2AUKA 4EX5A 4DHJD 1SNOA 2KAJA 2YYZA 4DNTB 3OHXC 5C0XH 1LTBD 1JWBD 4WJQA 4DV7Q 4JG2A 1SNCA 2HHHL 2XTIA 4PMBA 3CCUA 4DV5Q 1GVPA 2L76A 1CA6A 4C3HG 2MP2B 3KUZA 2V0GA 2E8GA 2IX1A 1E8YA 2OXPA 2DWQA 1X9NA 4OW0A 1X3FA 1BT0A 1DGSA 2J0JA 4IM2A 3CC7A 2PO4A 2RCFA 2J52A 2XEWA 2HIXA 1WRDB 1PGXA
chains in the Genus database with same CATH topology
5BN4A 2TSSA 4EQOA 5C4JB 2BT6A 4ARIA 1YNTE 1HFNA 1TWAB 3PUWA 4G7ZC 3ZQ4A 4A6QA 2H88B 4B08A 4ZUIA 1SNMA 1JE4A 2F4IA 3G6JB 3GTGB 1FNUA 3OIQA 3VYTA 3K0YA 2KACA 3L4PA 2ZW1A 1EYDA 1E0ZA 3PIO3 3BDLA 1SXTA 3AE4B 4UAIA 2ONQA 2BYTA 4C3IG 5J1ZA 1KNEA 4UDUC 2WS3B 4K8JA 2JX5A 1STAA 4C1NI 5CV5A 2M19A 4F88A 3SK4A 5D3DA 3HS0C 2K03A 4CQNA 1EIGA 4ZOHC 5IGCA 1KAAA 3VRBB 2BB5A 3E9SA 2EELA 1A2UA 3TMEA 1HEZE 2L32A 2I46A 1L4ZB 1FCLA 4L8JA 4RCNA 4QF4A 1J7CA 5G5GA 3S17B 3AU7A 4KN7C 3Q8EA 2E2DC 4C3HB 4N9PA 2K5PA 5IGDA 2WU5B 2JP1A 3WOEA 1E10A 1F2LA 4LJZC 1HQRD 3GQBA 3AE1B 1PTOF 2VB2X 1VDZA 2PPBC 3J9CA 1ROEA 5JXVA 1STEA 1V97A 2PVOD 4ITKA 4AYBB 3W5UB 4U673 1N5XA 2NN6I 1WSPA 1U4LA 4XWWA 1IKMA 5DM63 1FMAD 3MXPA 1PZKD 4ULLA 3NRZA 1XCQL 1B4OA 2IPKD 1N62A 2MP1A 4CKEA 3L7ZC 3V3XA 1K8MA 1UNSA 5M3FB 3VYSA 5FK9C 1V8QA 1L6UA 4IALA 3PUXA 1XX8A 2A69C 1I4XA 5K36H 4CJ1B 2WDVB 1JOKA 3VR8B 4CJ0B 2KWDA 4D2KA 2WDRB 3AB9A 4OL7A 1S5FD 4C3IB 3I72A 5CR3A 2LJIA 4KD3A 4DQOC 2F0TA 3D3RA 1Q8IA 3Q24A 3AE6B 1FD7D 1SE4A 3MVVA 3QO2A 3GTMB 2JA5B 1JMLA 4QMGA 3EQLC 4DAVA 1C77A 2EPBA 1EU4A 2F0IA 3D6WA 3X3NA 3Q22A 2XWBB 3I9V1 2BDNA 2NMQA 4IUTA 1EWHA 3NVWA 3K59A 2B2YC 1ZDVA 1A3UA 3MA2B 5EKLA 4IFDG 1ZYRD 3ND9A 2AX5A 1R9TB 1JCKB 5JEAH 4G7OC 3A8KE 2R92B 4KKIA 5D7GA 3T53B 4HKZE 3MWYW 2B8FA 1PXUA 3C1EA 5HG2A 1GHJA 5CYUA 3H3VC 3P42A 1A3TA 2QKIC 4R9WA 4DK1A 4A3KB 1SF0A 1Q3LA 2D5GA 4HEDA 3OPOA 4HSPA 2KUMA 2BW2A 1G291 4KY7A 1Y56A 5IGFA 5ELDA 3HOXB 4IZ8A 4IOIE 1I50B 2ZXOA 1FYCA 1YNNC 2ICIA 3EFXD 1PDQA 1C4CA 4LMQD 1OXXK 1QCBD 2PZWA 3RLFA 1ML0D 3AE3B 1XWEA 1Y8NB 1YNJC 1NENB 3GTPB 2W55A 5BMGA 2K32A 2HCIA 1VRAB 1TR5A 2L52A 4EE2A 2WV6D 2BS2B 1HRJA 2AWOA 1AZPA 5FOBB 1LT5D 2IDYA 4XDDA 3AE9B 4ARCA 2JA6B 4KY6A 4KJOA 2JXMB 4FXDA 1PZID 3ZJVA 2M0AA 1EYAA 5FKAC 3K5NA 1I4RA 3MHBA 1QJOA 1H9SB 3T56B 5D14A 3VR3A 3HVDA 1CT1D 2JYOA 1RYJA 2EVBA 3S2HB 3VA5A 1W6KA 1ENCA 3D8GA 1QOAA 2D5DA 2ZT9C 1H9JA 4XYQA 2BTEA 5M3MB 4A3FB 5DNFA 1PRTB 2EYFA 4KN4C 1VR9A 2ACZB 1GUWA 4KGRA 1TS3A 3M85A 2EY1A 2F0LA 3QOJA 2GI9A 2E76C 1EWYC 1EQVA 3SHLA 3GTQB 1Q1EA 2MJDA 4A93B 3I8ZA 3GP7A 5KIXA 2RDFA 4U68A 2WKCA 1C4QA 1IW7D 3M3YB 1B53A 1Y1WB 4WWMA 3TEZA 4IFDH 3IXSA 1SJED 4V190 3KBXA 3F2UA 3PO3B 4NMZA 3HG9A 1N60A 2K3UA 4HAEA 3C46A 2X6LA 1HTPA 1YJIA 3NSWA 3KLRA 2N0SB 1DM0B 1K52A 1X32A 4K5VA 3Q8FA 3NHHA 4BY1B 4RGMA 5A35A 5C5LA 3M4OB 1FIQA 1ZXTA 1XO3A 2NVQB 1JOOA 4K6DA 3AV8A 3AE7B 2K33A 1J7AA 3IL8A 3DM1A 4H2AA 1NVID 1V1OA 3EJIA 4IUQA 2MEKA 3GD7A 3I57A 2M00A 1LTID 3IAS1 1JALA 3Q8AA 4I65A 3ZJTA 2SNSA 1BMLC 2WKDA 4KI0A 4HMIA 3I4MB 1ZEQX 5JOBA 3T51B 1DZ1A 1T5EA 2O5JC 2ID0A 4BY7B 3N52A 4FF4A 1ZXIA 5CV4A 4DXFA 3P1MA 5COYA 3OWFA 1WCMB 2KEEA 2NUCA 5M5WB 3LB8C 3J80L 2F0PA 4RGTA 2Y5PA 3J7AF 3AEEB 3UI3A 3NTKA 2B2WC 3A7LA 1VZ7A 4K6LA 5C4XB 2AQ3B 2E6XA 1MI0A 2A68C 3P4PB 2W54A 4WORA 4XQJA 3MXNA 3EGRA 3DMUA 2Q8TA 2LY7A 1GAQB 1EY6A 1SB3C 2X6GA 5ISRA 3TP5A 3HRZC 2B2VA 3A8JE 4XTCS 4RHSA 1WTOA 4OGQC 1NYRA 3P63A 2YEPF 3NQTA 2KECA 3B2GA 5EBCA 1PFBA 1NCVA 1F9RA 3FMCA 2R93B 2VXWA 3RMHA 1F9PA 3VR4A 4RH6A 1D4BA 3LNNA 1HZ5A 4P6VF 1QILA 1CZWA 2WACA 1SYDA 4QIWB 2GB1A 4N9TA 3E6ZX 2EYMA 3H8HA 3FC4A 4ZLTF 3S1MB 5T1IA 2HDMA 1O7LA 2PZTA 1PRTC 1B2TA 2JA8B 1GPXA 2CW0C 3UI2A 1BNZA 1XLQA 1S5DD 1TQOA 5I9PA 1MHHE 4MH8A 2OF1A 4H13C 3ONAB 3R8BA 5FO8B 4XDCA 4IUVA 3GTJB 3A55A 2VZKB 1RCVD 1K83B 3JAME 2BE5D 4K2KA 3I4NB 3GV6A 2B2TC 3DUZA 1A6XA 1LT4D 1O78A 3RZDB 5C2TB 4EQPA 1LLRD 1I6VC 3K5MA 2E3TA 3IFTA 1ET6A 1JW9D 5H92C 3CRKC 2PW5A 4GDKB 2JSOA 1G8ZD 1JWMD 1FXAA 2OHFA 1BXTA 5CBAE 3W1SA 1DD2A 2WIIB 4US9A 2EY6A 3VR5A 4F8MA 1ZUD2 1QNKA 1UAPA 2NWGA 1HA5A 2Y0SB 2QJLA 3C8YA 3WCQA 2F0MA 2A6HC 1HA6A 4X3TA 1BCPB 2A6EC 3U9SA 5LL6S 1Y8OB 3GTLB 3J81E 3W5VB 1T6BX 1S5CD 1SE2A 2EOTA 5FLXE 1GUSA 4HCEA 1FRRA 4KJNA 1JWAD 3NVZA 1ENFA 3S2DB 1SYEA 5BN3A 2TMPA 3QG1A 2WXIA 4S3SA 1G2SA 4OO1G 1T3QA 3Q69A 1MSGA 5KRUA 5CV9A 3GO5A 4PV1C 4X3KA 1K50A 4YSZB 1PGBA 3NBHA 2R61A 4HJGE 2BOSA 3MHZA 1MD2D 1V1PA 2RSOA 2L5TA 2DNEA 2JSVX 1C9FA 4HSVA 2RSNA 1FFUA 5EJWA 1EOTA 2QEJC 1PMRA 1FO4A 1RODA 3MJ5A 1LTRD 4WFN3 1DOIA 2CVRA 5HGTA 3O13A 4G57A 5EKKA 2BBCA 2JU6X 5EBDA 1D5XC 4L6TB 5HFYA 3L3OC 2LHDA 4MN3A 3NWTA 1RFKA 1BR9A 5IT9E 1TKEA 2EKIA 1EZ6A 3S1QB 5NUCA 4OZAA 3I91A 3AEFB 5F2DA 4C7ZA 3CRLC 5T1GA 3DWPA 5C0XI 1PUTA 2XRQD 1L0VB 4NJCA 3I3CA 3KQ4A 3N9YC 4RAUC 4X3UA 4AS1A 3LX0A 3EUB2 3TEWA 3P7JA 4B9XA 2H4OA 2PW7A 1XXGA 1JRPA 1DOMA 4USAA 4BWGB 1EIHA 2NVYB 1FFVA 1ESFA 3LWUA 3A7AB 4ZKCB 2QF7A 4DU9A 2F0JA 2EZVA 1NR4A 2MUYA 5C3EB 5G3LD 1E6EB 1C4PA 4B0MA 2ZW0A 2RPVA 1V43A 1NR2A 1E2ZA 4L1BA 1SFOB 4QB4A 4A3GB 1BCPC 2DN8A 3EROA 1HUMA 1D5ZC 5EE1A 1PLFA 1LO5D 2F0VA 5D3IB 2GA4B 4RHRA 2WXHA 4TMAB 1IYVA 5I2YA 1VJKA 3QOLA 4C3JG 4OO1I 1KFYB 4A3BB 1EWCA 3AEGB 3GS2A 1XEEA 2F0UA 1YMHE 2BA0A 1FEHA 2WLBA 2V4IB 2WXMA 5G5HA 3AMUA 1SNQA 5IODA 1I4PA 2NZ1D 2A69D 1L5PA 1D1KA 2XIWA 3NK9A 3H94A 3AE8B 3MXGA 1FXIA 5T8IA 1XCTL 4FXGC 1XYIA 1JWUD 2DNCA 3K7AB 3BWUD 3FILB 2M56B 3Q8BA 1EYCA 1IHZA 1E7PB 2L83A 3BK1A 2LMCA 4ODGA 2G9HD 2N7JA 3HOVB 3H09A 3PZ8A 1JQ4A 4IFDJ 1DOYA 5CBEE 3DWAA 1QNUA 4US8A 5A2QL 1GJXA 3AM9A 1FNVA 4OHJA 5CV8A 1EFID 2WAQB 2KVMA 2NN6H 1EU3A 1IL8A 4ZRZA 4F87A 3IT4B 2WXFA 4O1NA 3AE2B 1ILQA 5ELEA 1OQQA 1M8AA 4B0EA 1SIJA 4YTMB 1FNWA 5C3WA 2PIAA 4HCSA 2VUMB 1ESRA 1CZGA 4CJ2C 3PIP3 2Y5CA 4KD4A 2R3ZA 2INPE 2WXNA 3SK8A 4A3MB 1GB1A 4C3JB 2LEKA 2EJMA 2F0SA 5I4DA 1D6EC 1WRIA 1VMCA 1Z6HA 2MGSA 3HP3A 3KWLA 3T3OA 2I38A 4IKGA 5CORA 1YNND 2PW9A 1FGBD 2K28A 1NI3A 2PLPA 1QQRA 1MI2A 3NZ3A 1RHPA 5D65A 5ELBA 3SK5A 1VLBA 2D62A 1QWYA 2R7ZB 1DXMA 3K6OA 1CFMA 2L4NA 4H0LC 4R3DA 1YNJD 4N59A 1QOBA 3Q6SA 2LS01 4WQMA 2LFNA 3CIRB 5CC4A 3KLSX 3S15B 4EGVA 5EE3A 2M9VA 4LAAA 3QIAA 3DWGC 2EJGC 1BF4A 2QIEB 3TEYA 2I2YA 4BA2I 4ZK9B 2AWNA 2F1MA 2BS4B 4TRDA 2WXOA 2LUMA 3PUZA 3MXUA 2VNUD 1C4AA 2JXTA 2NTTA 2DYMA 1AN8A 1QKZA 1UGJA 3A8IE 1OQRA 3MZ5A 3HOYB 3AEAB 1TWCB 4FXCA 4G4KA 4H7BA 1NSNS 5C44B 1LT3D 3L9AX 4BBSB 2L1AA 2MPMA 3IFDA 1STGA 3AE5B 2FFKB 3QB3A 4IN3A 4R8IA 4WH4A 4GZYC 3TEXA 2F0FA 3NTIA 3WOFA 3D6CA 2BDOA 4CGYB 1B9RA 2XVSA 3PV0A 2NVXB 2ICEC 4YT0B 4XQNA 1STNA 3AEDB 2O2LD 3N6RA 1PGAA 4Q0FA 2BB6A 1L0XB 1TVXA 4CKBA 4KMUC 3T13A 3TSSA 1KABA 1P7FA 1RTNA 1UWMA 4P2CB 1RTOA 4MT5A 1BBXC 4MM3B 3FDTA 3EVQA 1QLBB 5BYRA 1O80A 3X3MA 3KBGA 1SNDA 2MJEA 4OVZA 1GB4A 5I6WA 3SDZA 4ZHPA 1HPCA 2FMCA 4KTAA 3HRDD 3RZOB 2EY2A 1JC7A 1SDFA 1AW7A 1MHXA 1KLUD 3IT6B 1B9NA 1GUTA 3R2TA 2EYHA 4RFBA 3NBIA 5HI1A 1OXVA 4EVOA 2IGGA 3BS1A 1PTOB 4FNFA 3OWEB 4TSSA 4RNAA 2LHEA 1U4PA 2JE6I 4DK0A 4XWTA 2NBFA 2E2HB 3Q0AA 4QCLA 1F9QA 2JWUA 2C5CA 1QE6A 5ELCA 2QMTA 1ET9A 1AYFA 2HCCA 3B2FA 2WXQA 1I4GA 5KEEA 2B2UA 3QJYA 1R7SA 3BYYB 5K5PA 4NDXA 4PMWA 4FYDA 1U9RA 4C2MB 2WXPA 3DEPA 2CU3A 1EEFD 1HCZA 2F03A 5KNDA 3Q23A 4J8QA 1QOGA 3I73A 2QSDA 2C9OA 2F0GA 3DHQA 4BS9A 1J8IA 1HQMC 3HOWB 4BA1I 1C8CA 2HUGA 5JJZA 1Q90A 1TJEA 2A68D 4OZCA 5G3LF 4MIUA 1PFDA 1TU2B 2QDBA 3RPFC 1A2TA 4JE3B 4LK0M 1HHVA 1Z7TA 1FRDA 3FPPA 3D4DA 3VR6A 2XN9C 1RWSA 5EPLA 2O5IC 1S4ZA 3NPPA 1HFGA 3VR9B 1ZKOA 2PMZB 4PQXA 2FMMA 1L0YB 1EY7A 1LTGD 1J7BA 2WINB 3RFZB 3BVZA 1A3VA 1WVLA 1TKGA 1FR3A 2CQAA 4XDXA 4XT1B 4BBRB 2Z8LA 1JROA 4RA8A 3NVVA 2MH7A 3M7NA 1STBA 4YXDB 3VA7A 4YWGG 3ZJUA 3QWNA 1G91A 2PCFB 3U7ZA 2OT2A 3IKJA 4NZLB 5EQ0A 1PRTD 1IBXB 3U52E 3E5SA 2J0TD 2CW0D 2WP9B 4ZRPA 2B2VC 2E2IB 1YJJA 1N5WA 3EA6A 2KA7A 2IX0A 3K57A 4JX1C 2B2WA 2PKOA 4Q2JA 3OMGA 4JPSA 2FE8A 4N6EB 1MPEA 5GXGB 3BVGA 4O42A 5BMIA 1SYFA 1F77A 1PDXA 2EJFC 4FVMA 1NAPA 3KLSA 4J1MA 4A3IB 4KHVA 4WURA 1U4RA 3RUZA 4J6HA 1VDVA 3I70A 1AEXA 2Q8RE 3I90A 4A9AA 2BCOA 2F0QA 2A6HD 1I3QB 2PMVA 1H9SA 2RBMA 1DOKA 1MBYA 1PTOC 1CA5A 3TZDA 1WTWA 2A6ED 2F0DA 4HR7B 5AUIA 1KDAA 1YN4A 1C78A 1ZP0B 2RMMA 3LYYA 1DOLA 4RGOS 3J80E 1WTPA 2F0OA 3P1HA 3MFYA 5C0XG 1K8OA 2G1EA 1PZJD 1SSNA 5C4ZA 3R3OA 3OIPA 2Y3AA 1ZDXA 1LACA 1QF6A 5EE0A 2EYLA 4YIJA 5FO9B 4CHTB 2N88A 4YSYB 3FPUB 2DBYA 2F0HA 1FD6A 4IDIA 3D4WA 3D31A 2Z4IA 3GB1A 2AUJD 1E2WA 2PTLA 2B2TA 2EDGA 2JA7B 3MC0B 4ZHOA 1WYGA 2Q5WD 2PQEA 3IAM1 5DM73 1G2TA 1SAPA 1AZQA 1OO9B 5KGUA 3U2SC 2DLBA 3VYRA 4NAWB 2FUG1 5AFWA 5KNCA 1B44D 1SMYC 3KF8A 2LKVA 1PFMA 2MJ8A 2RA4A 1WTQA 1JORA 4NAMA 3P20A 1EY9A 2FHTA 1CZPA 3M7GA 1Q1BA 5FR3A 1LT6D 3FEWX 1RJTA 1S5ED 2EXZA 1Z47A 1RF2D 2E75C 1QOHA 2XWJB 1EY5A 4FF1A 3VR2A 5E4WC 2RQXA 1KH0A 2V3PA 3NQIA 3MP9A 3PO0A 2JYTA 5JVG3 1Y8PB 3ZYYX 4HMJA 1K53A 3R93A 5CGKA 2A74C 2KMMA 2G9DA 1RM6C 3TDQA 4MACA 1F9SA 1KDBA 1PYWD 2VZKD 2F3VA 3NUHB 1QG7A 1JR0D 4C80A 1VF7A 4C7YA 3DWQA 3OW7A 4KKSA 2EYPA 2L12A 4JWSC 1WTXA 5IIFA 3HGBA 2PNRC 2AQ1B 1LV9A 2ZXPA 3TUOA 1EY0A 1A70A 1II3A 1IGDA 3Q8CA 1EEID 3T4AC 1IUEA 2CJOA 2F0NA 2EYJA 3ERQA 2KCNA 5JPMC 1OXTA 1BCPD 3SR1A 4C56C 2W3RA 5MPOA 5C6AA 3H91A 1NUCA 1TYGB 3AMZA 4HKQA 2OEOA 1NYQA 2L1BA 2RDGA 2R6GA 1LTTD 5K36G 2JYEA 3HOUB 1CHQD 4CKCA 5KYLA 1T5XD 1W6JA 3BG3A 2B8GA 5M5YB 2YEPB 3ZGZA 2V4DA 1XLOA 4KKUA 5HHDG 4OIJA 1YN3A 5C3XA 5EE9A 4A3EB 1X3PA 3AEBB 3DXJC 1WD1A 2INNE 2MHVA 1QOFA 4DAYA 1UEAB 2BA1A 1TWGB 4LK1C 4GLSC 2N55A 3J7AV 5DAUA 4IQZA 4KKJA 1CI3M 5CV7A 4HN7A 1OXUA 2J7ZA 4YTNB 1HUNA 4M1UB 2YU9B 3J7YW 3E0JA 5JEAG 1UUPA 1O7YA 3AB5A 5JAVA 2A73B 4WRDA 3SFEB 3SVMA 3DEOA 2WP8J 4XT3B 4JBWA 3BYTB 1SBBB 1JWSD 1TIID 5M9OA 2XSCA 4B9WA 3KUPA 5AUKA 4OO1H 2B76B 4FF3A 2X38A 4ZKBB 3MFGA 2IGHA 3SE0A 1ZPSA 5CV6A 1ILPA 4L23A 4KGTA 4K2LA 5I6YA 5DEHA 1GUGA 3V05A 1OFFA 2N9LA 1TKYA 1DJRD 1HTLD 2W3SA 3SFDB 1FCCC 1PRTF 5M5XB 4XQQA 1YQ4B 2WXRA 1KDCA 1ONLA 1IYUA 4TQ1A 1TS4A 4DF7A 5BYQA 3NE5B 3KK7A 2B63B 3TBIB 5BN5A 2E74C 3GTKB 1B9MA 2K22A 3NTHA 3CU7A 5JPNC 1CQFA 4ME5A 1SJHD 2JQRB 1VF5C 1CM9A 2Z1CA 4RGNA 3W9CB 3NVYA 1WWTA 4KY5A 2FBWB 4V0BA 4PT5A 1I7HA 3FRPB 4DXGA 5IGEA 1LTSD 5C3JB 1XTCD 2NB0A 1SEBD 2SNMA 1RD9D 2K01A 1BUIC 1UWXA 2KHSA 5TSSA 1Y69U 3BIID 5BYSA 1CQVA 1I4QA 2K5DA 3HZXA 1U4MA 1GUOA 2L0CA 1HXYD 4ZUJA 3U4EG 1TY2A 5I2XA 1X3QA 3WDNA 3PO2B 4RCOA 4KV6A 3I4LA 4YSXB 2N9KA 1CHPD 3A54A 2MJ3A 2QILA 4DA2A 1QB5D 1AP0A 1N61A 4ZRQA 3ND8A 5LL6X 1DONA 5A2QE 2B2YA 4CBVA 2VB3X 3TP8A 1TWHB 1BDOA 4A90A 4KK7A 3P4QB 2IW3A 3HKZB 4E6IA 4RF0A 3NP8A 4ZAIA 4XXEA 4N58A 1F2RI 3E56A 4IURA 2DY8A 2HDEA 2X69A 3GV3A 1V8CA 2WXKA 2JEBI 1RDPD 3AECB 4IUPA 1JOQA 1L4DB 1JB3A 5I9OA 1EY4A 3FKIB 3OMCA 1O7ZA 1TT2A 3LWEA 1QT9A 4TKOB 3LXFA 1ZXHA 3HVZA 4DNRB 4IUNA 1ICWA 4FO2A 5J39A 1ZYRC 4FP5D 4GDLB 3GTOB 4WAFA 2AQ2B 1HZ6A 2OEDA 4Q5VA 1EZ8A 1WTRA 4DAPA 3VRAB 5IOCA 3SXHA 1EQTA 4LLGM 4A55A 1B50A 3FILA 1P7EA 4Z9CB 3P4SB 4YTPB 2EYOA 1MSHA 2WXJA 2J4XA 5IGBA 3VQIA 1KF6B 2LGIA 3V2TA 4R8NA 2GRIA 3PUVA 1GUNA 4QUCA 1MGSA 2NYZD 4PMCA 3PZ7A 4KGSA 3H6MA 4KHZA 1GOZA 2FJ2A 1D5MC 4TQ0A 3C2PA 1PFNA 4OZBA 5KYIA 5CMDA 2RKSA 3G7LA 1NEKB 1VZ6A 1MVKA 1BOSA 1TWFB 1S5BD 1KRHA 1F0ZA 3S16B 3M4YA 4TQUS 2NVTB 2IX3A 2FINB 1IKLA 3HUIA 3HEJA 4IUUA 4F7XA 5C4HA 4JWUC 1BCPF 2RVLA 4ILWA 5E1FA 1Y1VB 5E3FA 1F2RC 5E4XA 2B2UC 3T16A 4HRSA 3S1NB 1VMPA 3DWMA 1GXDC 4IFDI 1XLPA 1C48A 1KTKA 2DY7A 1B3AA 1D1IA 3D4RA 4DN4M 2L55A 2HDLA 1SYGA 2K5WA 2WXGA 1SYBA 4H44C 5IGGA 1I4HA 3IAYA 2KQ3A 1H9KA 4HEA1 4P16A 1OXSC 2O4XA 3FVQA 1Q10A 2WDQB 1DCZA 3V96A 2KDMA 4G7HC 1PTOH 1CJEA 1WXQA 5EPKA 1D2BA 2KOLA 1M4VA 2XNAC 2ENBA 1K51A 1F2MA 2D2CC 4K5WA 1C76A 4ABNA 3MTSA 1JQYD 3MEHA 1WGKA 2SEBD 4OIKA 2KJXA 1ACCA 1IGCA 2KCCA 1G6ZA 2F0WA 3R2IA 2Q8IB 1LTAD 4FF2A 5E6JA 1IW7C 3OOCA 1H9RA 3P4RB 4AQ7A 3K5OA 3OSOA 3RD4A 1TZOA 2SOBA 2J53A 3NUCA 1V1PB 2CHBD 1RKNA 1C79A 2K0PA 2M2LA 5C0XJ 3JAML 4NW2A 1PTOD 1SYCA 4MHEA 2L11A 2BS3B 2HQEA 1DOXA 1ENAA 4L63B 1BO0A 2D9UA 1CK1A 5H8YE 4L2YA 4RKLA 3AN1A 2DYOA 2I07B 4REZA 4A3DB 2KN4A 3NS1A 2F3WA 3S14B 3W3AA 2W82A 1R4PB 1J9OA 2H1EA 4J3OD 4EQNA 3HOZB 2QCPX 2J42A 5BMHA 2ON8A 3K58A 3S9WA 3TP7A 2KEDA 2SAKA 3BDCA 3TN2A 3A56A 1SE3A 2XRSD 3J81L 2K1BA 4RF1A 2ZXRA 4I7ZC 1EY8A 2IT1A 5FLXL 1XLNA 3CHBD 3B9JA 1SMYD 2B39A 1JICA 4HTHA 2KQ4X 4DFAA 2LFIA 4XYOA 5EGTA 5JVH3 2CJNA 3MAQA 3AH7A 1TS5A 3S1RB 1N63A 2EE1A 2K5QA 2NTSA 1GHKA 5LHY1 1AFPA 1TKWB 1BUVT 3U9OA 3URYA 1B1ZA 2JZPA 1E2VA 1SNPA 3C1FA 2WQYB 3P75A 3ABVB 3KWVA 4KX6B 4NKLA 2K6AA 1R4QB 2PVGC 2K04A 3SR6A 4ZQ3A 3TZUA 2IL8A 4NP5A 1FM0D 1VCIA 4QUFA 4M0WA 1STYA 3BZDB 3ETRA 4ZYSA 1VZ8A 2PYKA 5KNBA 4WIPA 4HROA 4RWSC 2RDHA 1EM7A 4FXKC 3SEBA 3ITPA 1LABA 2WNMA 3BK2A 2HTME 1AWDA 1F2ZA 5IT9L 2K05A 2SDFA 4Y7NB 1BQQT 5HURA 1XF5L 1ZE3D 5J22A 3K5LA 4A3JB 4LTUA 2BE5C 1Q12A 1L6VA 1YQ3B 2K7VA 3PUYA 5LNK1 2IWHA 1TY0A 1EL0A 2H89B 2LMCB 5FO7B 2WXLA 1WD0A 3CKIB 1KNAA 3CWIA 4JK1C 3FAHA 1F2YA 2A5HA 1DYQA 4XIGS 1DGJA 2WU2B 1E0BA 4C1NK 5C5MA 1E9MA 2L9HA 2Z4HA 3NXWA 4K5XA 2WB1B 1CTMA 3PMFA 4KKTA 3VYUA