2AQ2B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWPGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-CELL RECEPTOR BETA CHAIN V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq2B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq2B01
1XTCD 1RCVD 4ZYSA 2O2LD 2XN9C 1UNSA 5D3IB 1LTBD 1I4GA 1JR0D 1YN3A 1D6EC 4L6TB 2AQ3B 1ET9A 1V1PA 3TSSA 1EWCA 1G8ZD 1PZKD 3DWAA 1TS5A 1LO5D 4RGNA 3BVZA 1M4VA 1LTTD 1DJRD 1JWMD 3DWPA 1HXYD 1BCPF 1I4PA 1TY0A 1I4XA 5FK9C 1EU3A 1PTOH 3BYTB 1TY2A 1AW7A 1HQRD 1V1OA 2IJ0A 1D5XC 1PTOC 1XXGA 3DWQA 1SBBB 1LTAD 2NTTA 1CT1D 3R8BA 3V05A 1SXTA 1BCPD 1D5MC 3R2TA 1HTLD 4RCOA 1LT6D 1PZJD 1I4HA 1CHQD 2RDHA 2AQ2B 4RHSA 1CQVA 1SE3A 1PRTC 4DXGA 1KTKA 1FNUA 1I4QA 1V1PB 3O13A 5I4DA 1LTRD 2J4XA 1S5CD 1SE4A 2IPKD 4RGOS 5TSSA 1LTID 4RHRA 4RH6A 1BCPB 3SEBA 4UDUC 3URYA 2NTSA 1MD2D 1PYWD 4RFBA 1SJHD 1L0XB 2AQ1B 2XNAC 1QILA 1LTGD 2QILA 1EEFD 1LT4D 1FNVA 4OHJA 1PTOF 1CK1A 2WV6D 3BVGA 3EFXD 3OWEB 1EEID 4O1NA 1YN5A 1FD7D 1SEBD 2QEJC 4RGTA 1T5XD 1RDPD 1TS3A 1EU4A 2R61A 1GOZA 3MFGA 4Z9CB 1SJED 1S5ED 4TSSA 1LT5D 1SE2A 4C56C 4NZLB 4L63B 1D5ZC 1PRTF 3BZDB 1KLUD 3GP7A 1B1ZA 1S5FD 3W2DA 1PTOD 1AN8A 5ELCA 2Z8LA 1TS4A 2XRSD 2TSSA 4DXFA 1TS2A 3MC0B 5D3DA 4K6LA 5FKAC 5ELBA 3BVMA 4BWGB 1L0YB 5ELDA 3CHBD 1LTSD 1F77A 1YN4A 1BXTA 1JQYD 1DYQA 1JWSD 1FGBD 1EFID 1LLRD 3KLSX 1KLGD 1PRTD 1RF2D 1S5DD 1I4RA 1PTOB 1CHPD 1FNWA 1STEA 1BCPC 2G9HD 3R2IA 1B44D 1JWUD 1ET6A 2CHBD 3EA6A 1UUPA 2RDGA 2XRQD 5ELFA 1PZID 1S5BD 3BYYB 1RD9D 1ENFA 1JCKB 1HA5A 2SEBD 1LT3D 5ELEA 1ESFA 2ICIA 1PRTB 4RGMA
chains in the Genus database with same CATH superfamily
1EY9A 1L1OA 3ZYYX 4CDDC 1SYGA 2B63H 4W9CA 2L83A 4QUFA 2ZVNA 1DZ1A 1HTPA 4B3TQ 2LMCA 1Q7YC 3A1QA 1JT8A 1EQRA 1UE5A 1VDZA 3LWUA 1GC6A 1V8CA 1HZCA 5E4XA 1G6ZA 1XTDA 3OLMD 4GU2A 4ARIA 4PNYA 3K80C 3TS2A 5CV5A 4DHJB 4FADA 2RF4A 4DHZB 3DWPA 4N9PA 1HRJA 2KN4A 2W3RA 3ZNGC 1PFBA 4A3JG 4POFA 3DHGC 1I4PA 1RODA 3ERSX 3H3VH 1M94A 3ZJTA 1ICWA 3SK8A 1IBLQ 1EU3A 4BZAA 2MHVA 2WIIB 4FDBA 4RKLA 2CQAA 2JA6B 4JPBW 1V1OA 2WXRA 2HQLA 2UU9L 4XQQA 4D2KA 2D0PA 3H6NA 2IJ0A 3IVFA 1O7ZA 5E6JA 5T1IA 4C00A 4A3DH 5J2RA 3CRKC 2I5MX 4DV7L 3H8HA 1CUKA 1ONLA 3NBIA 1XWEA 3Q8FA 4M02A 5AZFA 4K5WA 1V1QA 2DZIA 3A8IE 2G45B 4HRSA 2ZT9C 2RGFA 1XX8A 4FN2A 4R1JA 3PREA 1E1OA 3MAQA 2LS01 1XT9B 3PZ8A 1X3QA 1AZQA 2NBWB 2WXQA 5H92C 2G3QB 1KTKA 1H9SA 4A3CG 1KABA 3MEHA 3O13A 4PQXA 1TWFH 1WCMG 4OO1H 1UGMA 2LEKA 2IWHA 3AI5A 2E76C 4EUTA 2BB5A 3GTKB 1BBWA 1OQQA 2KC1A 4TUUA 3GOEA 4P6VF 2EYHA 4RFBA 2XSCA 1C4CA 2OCEA 3FKIG 3P7JA 3BZKA 2AQ1B 3MA2B 4FXGC 2DJFC 1WTPA 2K28A 2KTRB 1OXTA 2K33A 3PO0A 2D62A 4UP9A 1OQYA 1WYWB 3D4WA 1B9MA 2UXDQ 4NP5A 3JAMi 3FVQA 4M8AA 2F0MA 4A3FG 1RL2A 2LXAA 3A9KB 2V4IB 3ENEA 4LJPB 3VR5A 2Z6KA 3J7ZC 1TT5B 1EY0A 1YNTE 2L8JA 2YEPB 3HOUH 4J1MA 3PO2G 4RAUC 5IN7A 4HJ7A 2LWPA 3NOBA 1H8CA 2BOSA 5BYQA 4A3JH 1P8LA 3EECA 2IGHA 2EYFA 5CMDA 5C0XH 3C19A 4US8A 2Z8LA 5ELNA 1KNAA 4MH0E 4TKOB 3AEDB 3LGJA 4NQKE 2W3SA 2RDFA 1C78A 1X3FA 2LHDA 3HM6X 1E2ZA 2F0FA 2L0TA 1KAAA 2WACA 1P7FA 1WGGA 2NZOA 1WTXA 2QDLA 1B9RA 3JC66 3DHHC 2KCTA 1SMXA 2L12A 4BBRH 1HHVA 3S2AA 3Q22A 1YJJA 1JWSD 3RR5A 4JL9A 1R9TB 1FJGL 1I4RA 2B2VA 3IRBA 1N34Q 1AYFA 3MEFA 1WIAA 3V61A 3U7ZA 4DK5A 3AN1A 1E7ZA 4ULLA 4WJOA 1ZUD2 2GN5A 3OTOL 1EIGA 1XLNA 2GBKA 3I4NG 4IWQA 2XRQD 2LGSA 4A3CH 1JWBD 1TJEA 5BO4B 1SLJA 1WCMH 4WWOA 3S17H 3KQ4A 1LABA 1KC8C 2INNE 2XWBB 2VQEQ 4JI1L 1ESFA 1B2TA 2HDEA 1P0RA 2QDBA 2M17A 3FKIH 2OEOA 3H6MA 3GTOB 2KHIA 3PGEA 4GSWA 1DCZA 1MBYA 5D3IB 2EE1A 3M7GA 3MVVA 1T6BX 5CYUA 2G4SA 4HCPB 4P7IA 4EX5A 3RULA 1RAXA 3G4SA 2C5LC 2INDC 5JAVA 3IAYA 2JQRB 2VZKD 4AJWA 2QEXA 4A3FH 1E9MA 1YQ4B 1BUIC 4I6LB 4BVUC 2MW5A 4A9AA 3HIZA 1B3QA 3R3OA 1HR0W 1X65A 3ER0A 3KF6B 2AMCB 1WTWA 2JA8G 4ICUA 4DBGA 4JI5L 2JYTA 3KK7A 1ESRA 4IALA 3NZSA 3HGBA 3L0OA 2KTRA 3HOVG 4DFAA 3PO2H 5CC4A 4MTNA 1I4XA 3DLLA 5T1GA 4C3HG 2DNCA 2F0NA 4KTAA 4LMQD 4DGZA 4ZRIA 1LQBA 3S1QH 1YD8U 2I07B 4A3MB 1Q5WB 3B08A 4LF4L 1E6EB 2LXJA 1FJGQ 3A9KA 3H94A 1QCBD 5FOBB 3CD6A 1I3QB 3UF8A 1SBBB 5EPLA 1L6VA 1WGRA 1ZXIA 3SFEB 1FYCA 2NTTA 4JC0A 3VAWA 1NYQA 2R7ZG 2PEAA 3S14B 3PSEB 1JJ2A 3DBRI 2FE8A 4AS1A 2ZVOA 4IZ8A 2SNSA 4LW1A 1BT0A 3MP9A 3QA8A 4FHJA 1ML0D 1X9NA 4C4VB 4JI2L 3A9JB 2DENB 4IOIE 4DXGA 1BVSA 1A3VA 2OEDA 4YWLA 5A35A 1VQ7A 3CMMB 4OWWB 3I4NH 4DNTB 1NE3A 2N49A 1H9RA 4DK3C 2EELA 2V3SA 3OHXC 3SVMA 4CKEA 4HJ5A 1VQJA 4CJ2C 1VQKA 4HXDA 1K8MA 4JI7Q 5DPWA 3DEOA 4MEMA 2EYMA 3NVYA 5BMIA 4RF0A 2QILA 2LRUA 4GDLB 2B2YA 3VTVA 5C4JH 4L5RC 3I4LA 5JVG3 1I6HH 3MJ5A 2BYTA 5DLQE 4K7UA 2K52A 2KLGA 3PUWA 1ZXTA 5IP9H 4ZHOA 2WXOA 1IBKL 1DOLA 2RSNA 1SRUA 2A73B 1YX6B 2GRIA 1SNCA 3VRAB 3AEAB 1JORA 3V3XA 4LDTB 3MZ5A 3TL5A 3ZXVA 2CU3A 3KJPA 1OFFA 1RHPA 1LACA 1HEZE 4WJPA 2JA8H 1GUGA 4C56C 3W1SA 4ME5A 3GP7A 1B1ZA 3N52A 4IPHA 1N33L 2IO3B 1YITA 4HKZE 3SGIA 3HOVH 2L32A 1Y8OB 4C3HH 1I50B 2CVRA 3GTPH 3OIQA 5M3MG 2R92B 1WMHB 3IT6B 4EZKA 5M5XB 4HJ8A 4NDXA 3ERQA 4QJFA 1FXIA 3ZDTA 5HI1A 4JI2Q 5AEKB 1F9SA 3KWLA 4FULA 3NUCA 2BBCA 1D8LA 2J52A 4BBSB 2NVTB 1LTSD 3I5JC 4XWTA 2WXJA 3IFTA 5IAAC 3RD2A 2D3GA 5JJIA 3QHTA 3SXHA 1QG7A 1LLRD 3A4SC 1IP9A 1XYIA 3O65B 3WA0A 5AJ3L 3CQZB 1E8ZA 3UGBB 2WAQB 2N7JA 3VUYA 2ZJRA 2NN6I 3SFDB 3UDGA 1JWUD 1E3PA 3EA6A 4H02A 1Q86C 1WRIA 2R2QA 1X3GA 4KIKB 4WJNA 4IFDI 4DR1Q 3S2HH 2JWUA 4A75A 2KJ6A 4A3BG 4WQMA 1KRTA 1MGSA 3DMUA 1IBKQ 3SK4A 3FHWA 3B1LX 1GNUA 2NBUA 3UI2A 4RMAA 4CYEA 4IDIA 2BCOA 1F9JA 2XN9C 1Q12A 1AE2A 4KN7C 5CR3A 1SNOA 1CZPA 2L05A 3S9WA 1E90A 1YN3A 2DYMA 1PZKD 2MBQA 2WKDA 1LO5D 1N33Q 1QJOA 4XDXA 1BR9A 1CMXB 1WZ3A 3DEPA 4IUNA 1TTNA 2E74C 1T3QA 3CCEA 1J7CA 1XMOL 2E8GA 2GB1A 4K2KA 3PV0A 4PZ6A 3GTLH 3E9HA 4IOAA 2LD9A 4GDLA 4BBNF 4I65A 1WGHA 3PV1A 1QOHA 3HOZB 3P4SB 4LDTD 2Q2HA 2L52A 5C3WA 2BH8A 4S17A 5IYDG 1IYVA 4X62L 3M4PA 2LASA 5AZGA 4FLHA 4JOIA 2V4LA 3NZUA 1XEEA 2JYEA 2Z59B 4IQZA 5M3MH 5FLMH 1NMGA 3BZCA 1DD2A 1JB7A 3PRMB 1WXAA 3IFDA 5CBAE 4L23A 1YQ3B 4JIOU 4DR6L 1HZAA 1XLQA 4DAVA 2F0GA 3AEBB 5GAEC 3H7PB 1QVFA 4F1SA 4ZHPA 3C2PA 1LT6D 1S3OA 1XCQL 2AL6A 3K5NA 2DWQA 4TQ0A 4EE2A 3NWTA 1WMHA 5G3LF 3T1HQ 2BS3B 3SK6A 1VF7A 2BYEA 3IHPC 3VUXA 3I3TB 1U4AA 2IW3A 1VQ8A 2F3IA 3L08A 4JX1C 2HDLA 3URYA 4W9JA 3RI7C 2NN6G 4IM3A 4UP7A 1C7YA 3DDCB 1IW7D 2DAFA 4JI4Q 4YTPB 3ZQ4A 3ZVVA 2EOTA 1V86A 3EQLC 2NB0A 3CAMA 1XMOQ 2JA6H 1MJDA 4N58A 1STBA 1SF0A 2K1FA 1H95A 1GUAB 1TZ1A 2PE9A 4A20A 2LGDA 4LNKA 2QEJC 1X32A 3M7NA 3T3OA 3QX1A 2MFIA 3A8KE 3OPOA 2L7RA 2IT1A 4FXKC 2KQ4X 4RKBA 1KRHA 2EY2A 1Y1WB 1RIPA 3HM3A 1PRTF 1WE6A 2N7DA 1YVCA 1E2VA 1KAWA 3F8TA 3RZDB 2WINB 4DR6Q 3OIPA 3PHXB 1TS4A 4BOSC 2RHSB 2CU1A 2XVSA 4DR5L 4CHTB 4C3IB 2W55A 2N7EA 1EY8A 2W54A 4YCWA 3VXWA 1I7HA 2IBIB 4K8IA 3GTKH 1EZ8A 1TWHB 3A0JA 1S40A 3AMUA 1ZW7A 1K53A 2KA7A 4ZK9B 2KNBA 2IZVB 2V3PA 2X6LA 2KWDA 3CSTA 1FGBD 1Q8IA 1KDBA 4HJ9A 3H7SA 2X6GA 3OG5A 3H1UA 1W2BA 1TYGB 1FCLA 1CFMA 1TU2B 4HEDA 5AUKA 3P4PB 2K0PA 4OWXB 2IHEA 1XD3B 3PRPB 4NJ7A 2ZM6L 2ES2A 1L4DB 2O5IC 4R3DA 2PVOD 3TZDA 1OEYA 2MPMA 4IOCA 2MQHA 1C9FA 3FP9A 5ELEA 1X1MA 3AEFB 1PGBA 3H7PA 4ZCKA 3CMEA 1VCBA 4ITKA 4HDOA 4DAMA 3NVZA 4WIPA 4YTMB 1I42A 1WJNA 4R4OA 4W9FA 4A3MG 3V62A 3ZO5B 1EF1A 4WURA 5K36G 3OYYA 1G8ZD 4ABNA 4DU9A 1EO6A 4IPCA 1OXVA 2A4ZA 5IYCG 1GG3A 4IJHA 1JE5A 1KD1C 2MX2A 2GBMA 3PZ7A 4ZLTF 4DA2A 1IHZA 2AWOA 4DR5Q 2ALYB 4B3RL 4A93B 3ML9A 4XYCA 1HXYD 2BDOA 1HNWL 1J8CA 2PMZE 3PUYA 2MBHA 1R9TH 1GO3E 2KANA 4USAA 3LJ3A 3LWEA 3CPWA 2VNUD 3PIO3 4R8IA 4DV3L 1YJIA 2EZVA 2KFKB 2Y5CA 1TBEA 1XCTL 2F0SA 3AM9A 1ACCA 1TKGA 4ANUA 4DDGD 2YTYA 2FXQA 1J6QA 2ZM6Q 2P5ZX 1X56A 1X3EA 2NVYB 3PS6A 2WDTB 2DZKA 2FJ2A 1YOVB 3SK5A 2B2WC 3AEGB 3GTOH 1GHJA 4P2CB 4RHSA 4URKA 1CSQA 3MXGA 1DGJA 1P9DU 2EY6A 2JSOA 3VTWA 1ZDXA 3MWYW 1EOVA 2Z0DB 3EIVA 3NP8A 5I6WA 3UQAA 1EL0A 2EXZA 1MSGA 3SEBA 2K32A 2ZTEA 2CWAA 3DBLI 1WGDA 3E9SA 3NHEB 3HOYB 2PPHA 5C2TB 1CJEA 2XNAC 4A76A 3Q2AC 1VQ9A 1R4MI 3Q6BA 4BXXH 3OW2A 4QQBX 2WB1B 5GADC 4B3RQ 1NENB 1CSPA 1KRSA 1HNWQ 1EFWA 1CKMA 3L2PA 2R92G 5G3LD 4R8NA 4A3MH 2F03A 2OXPA 1LFDA 1CZGA 4G7ZC 5K36H 1Y1VG 3P1MA 1I3QH 1PUTA 4DV3Q 2F4VQ 4BBSG 2Y5BB 4O2DA 2K22A 3NY5A 4XX5A 5IP4D 3VR4A 2JJQA 5IYCH 4MIUA 4XT1B 4LJOB 2WDQB 5TR5A 3S14H 3DBHB 3UIPB 4BY7G 4ME3A 5KNDA 3MXPA 3VR9B 1ZYRD 1F2ZA 2L00B 5EJWA 3E0EA 2M19A 1A62A 1SYCA 2KTFA 4DF7A 3ICEA 2Z1CA 3A74A 2DN8A 3NSWA 2QA4A 3PQIA 1WX7A 1N62A 1YZ6A 2CFMA 1HFGA 1TWGB 4KD4A 1PH2A 4WORA 4FF1A 2C60A 2E3TA 4MM3B 1SNMA 3I55A 2KQ3A 2KO3A 4IUMB 4YWGG 1PRTD 5D2MB 4HK2A 4X3SA 2K05A 4AUQC 2OF1A 5LNK1 3I4MB 3TEWA 2JUOA 2K01A 5FLXc 2ASBA 4C1NI 1EWHA 3HFZB 2N55A 2KFKA 1HE8A 2DZJA 1B44D 1JICA 2RBMA 5D14A 1J5EL 3PHWB 1UUPA 3NHHA 2KDIA 4AYBG 3D32A 4IUTA 5KRUA 5LMNQ 1VMCA 2K8BA 3CF5A 3AE8B 2B2TC 2YU9B 2ICIA 4NXNL 1IUEA 3ND8A 4HAEA 3STBC 4LNNA 2I5HA 1UE1A 4LFBL 2DHZA 2FCNA 3BDOA 4XYQA 4IM2A 1V5OA 4OZAA 3AMZA 3C46A 1I50H 5MPOA 2KJXA 4PZ8A 2R92H 1IPGA 1V5TA 1U9RA 2WXMA 4UP8A 3S1MB 2FFKB 2AWTA 1L6UA 3DUZA 2ZXRA 4J8QA 1SB3C 2NVTH 4BBSH 3ZXRA 1V8QA 4LLGM 3WAMA 4A3KB 3H0GB 4OELB 4ZUIA 3CCSA 1P7EA 2KVRA 1IYFA 1X3PA 1PMRA 5BN3A 2KOLA 3CQZH 3APFA 1EOTA 2OHFA 2W9NA 2KWUB 2Y0SB 3OOCA 2Q2TA 4JWSC 1VJKA 1Y8RC 3W9CB 1PTOC 3DWQA 1QLBB 4KKSA 3M85A 1PH8A 3PLVA 3L4PA 5DPRA 3NS8A 5J17A 4NMZA 4JYAL 4LF7L 5IYBG 2UWQA 4K5VA 2QHOA 2D10A 2JPHA 1CA6A 2A8VA 3W1BA 1NDDA 3PF4A 1YNJC 4NXNQ 1WY8A 3UDFA 5EE1A 1RTNA 4WJ3M 1HNZQ 1SE4A 4LFBQ 2WU5B 2Y3AA 1UE7A 2E5LL 3CWIA 1KL9A 2KDMA 1IBXB 5FJ8G 5EKLA 2UUAL 3QWNA 3OMCA 1UWMA 4TVAB 1LTGD 4FO2A 2MRPA 2F0WA 5IGCA 3WAOA 3HOZH 4OO1I 4C3IG 5EDSA 1I94Q 4A3IG 2WDRB 2OJRA 1MJEA 1LM0A 1W3SA 4ZYNA 5KGUA 4NB3A 4KMUC 1HZ6A 5IKCM 2XGTA 1S1QB 3NG0A 2JRIB 3KUDB 4B3ML 2GI9A 3QARA 4JWUC 2AKWB 2JWZA 1STYA 2N8NA 4U68A 4L2YA 4K81A 1YI2A 2DJGC 4QCLA 3B2FA 1XPUA 1CTMA 2D0OA 3UQBA 4S3SA 4JYAQ 1JRUA 4LF7Q 4EEWA 2K03A 3V2TA 4BKSD 5JEAG 5E4WC 2TSSA 3UI3A 3MC0B 1HPCA 4ZRKA 1FO4A 4JBMA 5NUCA 2N9KA 1X55A 3EBEA 2GBRA 2INPE 4BKSA 2R7FA 2HJ8A 1K51A 2MHJA 2BS2B 1A2TA 3K6OA 3Q8DA 3SHQA 3CCQA 1B4OA 5CV8A 3RNCC 5C0XI 1FIQA 1PFSA 5IYBH 3EROA 2E5LQ 4DR7L 1OEYJ 2H1EA 1BCPC 1F2RI 1NI2A 2CHWA 4AP4C 5C3JB 3CP0A 3HOWB 2INCC 2D2QA 3AB9A 5HGQA 1K73C 3AE3B 1WD1A 4OWTB 5ELFA 2KJHB 4YY3L 4FVMA 4JI6L 4A93G 2K8CA 5IE8A 1RD9D 1P98A 2WNMA 3AFPA 1T5XD 1EY5A 3FMCA 3AE7B 1Y1WH 1B7YB 1NY4A 4QIWE 4R4QA 4W9LA 4X3TA 4PS3A 5LHY1 3WIMA 4EKUA 4KSKC 5KHQA 2ACZB 1VQAA 2WP9B 1N36L 3RZDH 2KFJA 2X8XX 3HK0A 4N8FA 1CKNA 2AQ3B 3MXNA 3U52E 4KKTA 3ULPA 2N9PC 4LUZA 3RLOA 4C3IH 1SYFA 4P75A 2D3AA 5JVH3 2C35B 4MDKE 3D8GA 5DM73 1TWHH 2J42A 1IBXA 2EXDA 3V6EB 2MP1A 1TIID 3DVNV 2VB2X 1O7LA 4X3UA 2DX5B 3VYUA 5LMUL 2OWOA 4YTNB 2CW0D 4NPNA 1QOBA 4DAYB 2OQKA 4HPLB 4BKGA 4DR7Q 3TP8A 3DBSA 3RNAC 1CT1D 2EIFA 1O7IA 4JLCA 3HOYG 3VDYA 3L10B 1CA5A 1MSHA 3PIP3 4G7HC 2YEPF 2MBEA 1VQIA 4M00A 2WB1G 5G2NA 3P4QB 1LUZA 3GDEA 4V190 4ZRQA 5IT9E 2AQ2B 3HOUG 1NAPA 3BDCA 4P16A 2K5NA 1ILPA 1O78A 1VDVA 3CSFA 1N36Q 5C0XG 1STAA 2HQEA 3DHQA 2M0AA 3IXSA 1K8GA 4A93H 2KOXA 4UDUC 5JEAJ 5AUIA 1ZDVA 2LGXA 1D3ZA 3CCJA 1QZEA 1YEZA 3DQVA 4HKQA 3FEWX 3T13A 2IY0B 5IA7A 4MTKA 3LDZE 3RZFA 2XWJB 4F87A 3J9CA 1G6PA 1R4QB 2K1BA 3SR6A 4BBRG 4X65L 4G57A 4N6EB 4DNIA 1WI5A 2F0EA 3FDTA 2KX3A 1E0BA 2PZWA 4O1NA 2KHJA 1Y69U 5D94A 4H0LC 4RGTA 5JPNC 2LSSA 5LMUQ 1NR2A 4JI0L 1EIHA 1HCZA 1VQBA 2HUGA 2PW5A 2XIWA 3B6YA 4DK1A 4WJ4A 5CX3A 3A8JE 4M1UB 4B0EA 5FO7B 5E6PA 3RYTA 2F0QA 3NWSA 3I4MG 1D5ZC 3BZDB 2NVYH 5EKKA 4B6WA 1JALA 2I1KA 1AN8A 4LNQA 2IL8A 4XYOA 2VH1A 5JOBA 3U4EG 2L11A 1CZWA 1H9KA 1TXYA 3HKZG 2LXCA 5ELBA 1VQMA 5J39A 4KKJA 1K83B 5LMNW 4GDKB 2RVLA 3GV3A 4RA8A 2H89B 3C1EA 1WOCA 2M4NA 1G291 1PGXA 1SE9A 3HOYH 2F0UA 4GIVA 5IOCA 2L3ZA 1WX9A 1PTOB 2YTXA 2A69D 1U0LA 4JG2A 1FR3A 3JW0X 2F0DA 2IO2B 5DNFA 2UU9Q 3CCLA 4ASWC 4DAYA 4DV7Q 3DCGA 2M8SA 2QJLA 2D07B 1BKBA 3ZW3A 4X65Q 2K04A 1FM0D 5M5WB 4DHJD 2EQSA 3NQIA 2KUMA 1SN8A 1PH1A 2B8FA 5JPMC 1KFYB 4HMJA 4KY5A 4A3KG 1LGRA 2K8HA 2KX0A 2L76A 1RM6C 2R93B 3RUIB 4FF4A 4ARCA 4KHPL 2BWFA 4P1CC 2Y0SG 2UUBL 3PVLA 3RCZA 2EVBA 5JH5C 2DAJA 4I6NB 3HG9A 2J0KA 2PO4A 4HMIA 3WALA 4QF4A 4KX6B 3F2BA 3WOEA 1UBIA 4AIMA 1VQEA 1WTVA 5D6JB 4B0MA 1TWGH 1U5KA 4KV2A 4JK1C 4O0AA 5J22A 2MBOA 4OIJA 3QK0A 4AQYL 1J7BA 1P1AA 1BBUA 5C0XJ 2QCPX 1MHHE 2XK5B 3AE6B 5FK9C 5IT9L 4GN5A 3I4MH 1HQRD 3HEJA 3IAS1 4GNXC 4K3CA 3Q8AA 3TDQA 3JAMc 2N88A 2B2TA 3J80E 4L5TA 3K5MA 1T0RC 3ZJYC 3VDZA 4XQJA 2CR5A 3JSVB 3PZDA 2EY1A 1WXSA 1XNRL 5LXIB 3SD5A 4WAFA 3N1XC 5IP9G 2WFWA 1YNNC 3TEHB 1L0VB 2KLCA 1D1KA 1STNA 2YU9H 2SOBA 1T5EA 1C4QA 1DONA 1SYDA 3Q23A 5CV6A 1FNUA 2VZKB 4KKIA 4LK0M 1NBFC 5EE9A 3U7DA 5HGTA 3W5UB 1OO9B 2K7VA 1HTQA 2UUBQ 3VYTA 4GDKA 3TP6A 2CCZA 3S1MH 1WI0A 3N30A 4RHRA 3KLSA 1BCPB 2PYKA 2VL6A 1XMQL 2NTSA 2DNEA 3BK2A 4M0WB 4EFOA 1VQOA 1RYJA 1A0IA 3X3NA 4A3KH 1OXXK 3H0GH 3SR1A 4FJYA 4WAAA 4JBJA 3TIXA 3N1YC 3A7LA 1ZXHA 2CJNA 2EJGC 3OTOQ 4AQYQ 3KWVA 1YBYA 1SROA 2JE6I 1LXDA 3HRDD 2F3VA 1BQQT 3G48A 2X69A 1EUJA 2JXMB 2QIEB 3CMAA 2DZMA 1SYBA 3R93A 4JI1Q 1RFAA 1QNKA 2BW2A 2JK8A 3Q8CA 3ALBA 5M5YB 2K9XA 1KQSA 2RA4A 3K7AB 5ELCA 3HOWG 2JSVX 2JA5B 5EPJA 4YSXB 4OW0A 1KOTA 5EAYA 2M56B 2N9LA 1C79A 4AWJA 1SIFA 2R7DA 1O7YA 2L5TA 1GJZA 2DGYA 4WFN3 3BVMA 5CBEE 4M01A 4OVZA 1L0YB 3IKJA 2KBNA 3RFZB 3RMHA 3QC8B 4KZCA 4JI5Q 3VR6A 1JROA 1YN4A 2LVPA 4A8XC 3KLSX 2NZHA 4EQOA 5IO9A 3QWZB 1NYRA 2QGQA 2ID0A 1SDFA 5C23A 3KLRA 4FNFA 3M63B 3KYDD 1FD6A 1XMQQ 1QOAA 4WWNA 2G9HD 2BQQA 4LF4Q 5G5GA 1PDQA 2KVMA 1VQLA 4RWSC 3U58A 2L1AA 3JSVA 3BY4B 4DV0L 2X38A 1QB5D 2WYQA 3AE4B 1Y56A 3JYUA 2HTME 5BN5A 3WANA 3I63C 4A3LH 2O5JC 5FLMG 3A54A 3T16A 5I9PA 1VMPA 1XTCD 3NTHA 1T0QC 4XQNA 4ZYSA 1JOOA 2G4DB 3KF6A 4BOZB 1ET9A 1KF6B 2F0PA 2Z4HA 1TQOA 3KFUA 4GLVB 3AXCA 4B9KA 3TJPA 4EQPA 2RSUA 5JJZA 4Y52H 2PJHA 2A6EC 4M0WA 1DJRD 3PRZA 1QE6A 3PIPA 2FAZA 2K3UA 1WTQA 4AYBE 1QT9A 1EIYB 2ZJQA 2BA1A 1J19A 2IX1A 3FILB 2I2YA 3BYTB 4DPGA 1WVLA 5IP7H 3ZGZA 1VQHA 1K0SA 3MJWA 3HOWH 1EYCA 4WRDA 1SE8A 2PPBC 4C3JB 3B0AA 4HVBA 4CDEC 3TMPB 3W5VB 1VQ4A 5C4HA 5COYA 5M3FB 1VQ6A 3WOFA 3DM3A 2CJOA 2LRWA 2JA6G 3QQ8B 4C4VA 2HE7A 2FCMA 3R2TA 3HVDA 2PI2A 4DV0Q 5JJLA 3MTNB 2MNAA 1Q81C 2JZPA 5C6AA 4B3SL 1DOYA 4C7YA 5LL6X 4KGTA 2GLSA 3AV8A 3AU5A 4R4IA 2K5QA 5I4DA 1I6VC 1IKLA 1YHBA 4RGOS 3MC8A 5C3XA 2MP2B 5BYSA 4X66L 3AU7A 2WX0A 1E8YA 1MD2D 2EYJA 3DOWA 5ELOA 3I91A 4NJ6A 3F2DA 3MC9A 5AJ3Q 4OONA 1II3A 2HDMA 1WH3A 3K9PB 4MSMB 3ZNID 3PT2B 2WV6D 1WD0A 4GKJL 4W9KA 1GUSA 1N60A 4YT0B 1WYGA 3HOXB 2KDEB 2NMQA 3X3MA 3GTGB 1MHXA 1VRAB 5CTRC 3W1GA 5CV7A 5I9OA 1PH9A 4HCNB 3NVVA 3Q24A 3GO5A 1YJWA 2E2JB 3Q69A 5LXHA 4AJYB 4KY7A 3D4DA 3ZTDA 2N9XA 4MZ9A 5EBCA 2BYFA 1ZKHA 2BTEA 4LUOA 1UZXB 3DBLB 3V6CB 2MO0A 4KD3A 1PYBA 4B3SQ 4DXFA 5GMVA 1IYUA 1E1TA 3VR2A 4JW0A 2WU2B 2ZPYA 3EUB2 4KDLB 3Q3OC 1ISNA 2Q5WD 1WTOA 4S0RA 1EIFA 5KYLA 2RHQB 3ETRA 2R93G 1DYQA 4GNXB 1SIJA 4E71A 4KIKA 4N9F4 5C4ZA 4GOPC 4DR4L 2VB3X 5C5MA 3FILA 3NE5B 3RLNA 3BK1A 5F2DA 4DK0A 1QKZA 2KMCA 1YJNA 4R9WA 4X62Q 3P2BA 4IUPA 4K2LA 4V0BA 3NPPA 3ZDMC 1UEAB 1FXTB 2KT7A 2LVOA 4GS3A 3KJOA 3I90A 2F0HA 3KYCD 1S5BD 3EHVA 2V1YA 4C7ZA 1ENFA 4DKAC 4EVOA 5DPTA 3T8MA 2AEHA 1WSPA 1MJCA 3D31A 3R66C 1KXLA 3U4VA 1QF6A 1R4NB 4CQNA 1IBML 1E8XA 1U4MA 4BAXA 1C76A 1N5WA 1I5FA 2MP2A 1RFKA 1K83H 2FMCA 4FP5D 1KIXA 3AE1B 4N8X1 5BR8L 1PHJA 2D11A 1XNQL 1QOFA 4DWFA 1PTOH 4HSVA 1IYJB 2XTIA 4A4IA 2D3CA 3NUHB 3CXCA 1GUNA 4DR4Q 2N4FA 2ASQA 2PQAB 2K5HA 4IPDA 4BXXG 3MHZA 2N78A 1LM8B 1FGUA 2PTLA 1VR9A 3R8BA 5M5WH 1V9PA 3V05A 4A3OA 2JT4B 3T51B 4JVZA 1EQQA 2R93H 3KYHC 4GGQA 1AARA 4NQLB 2RSOA 4DV2L 2IY5B 1ZE3D 3ABVB 3BIID 3HHMA 2FINB 1PH7A 1C48A 4WQOB 4AH6A 4E74A 3KLWA 3J81E 2PLPA 1GUOA 5I2YA 4PS7A 3Q3MC 5IODA 2IPKD 2QSDA 1TKYA 2G9DA 1IBMQ 4LNFA 2GVAA 1PYWD 1TGZB 1UWVA 1MI2A 3TP5A 1EY4A 4DUZL 2OTJA 1JMLA 1MFWA 1MG8A 4PMBA 1Y8NB 3DVNU 5CHFA 3E56A 4A3EB 3RMKC 2YVCA 4PG3A 2NVXB 4PK1A 4CKBA 1CK1A 4XTCS 5DAUA 1PYSB 5BR8Q 2F3WA 4XT3B 1PH4A 2WB1E 3DWMA 3BDLA 1YN5A 1XNQQ 2NPTB 2V4DA 5IWAL 2PNRC 1HUNA 2IO1B 1VQCA 3F2UA 4OZCA 4KN4C 4FF3A 2WWZA 1WRDB 2VRRB 2IX0A 1FFVA 2WX1A 3U9SA 3W2DA 4IWOA 3C1FA 5C3EB 2CS4A 2L15A 3OAWA 3IL8A 3C3LA 3M3YB 4DV6L 4M8MA 3OW7A 2UU7A 4DV2Q 1E22A 5D3DA 3W5OA 4TMAB 4W9GA 5FKAC 4AQ7A 3GZNI 5GQOA 5EBDA 4IUUA 5H8YE 4TKNA 2AX5A 3UDXA 4FYDA 2FUHB 3H15A 3J7A5 1FCCC 1OQRA 3UE1A 1E24A 1K0RA 1HA6A 1FRRA 2PMZB 4ANVA 3M4OB 3AFQA 5C4XB 1STEA 4CJ0B 4DUZQ 3SHLA 1FPYA 3PCOB 1WJJA 4L1BA 2PQAA 2CHBD 2BH2A 2MA9B 1QVGA 2YTVA 4CJ1B 3I7FA 2KAJA 2M1MA 2MEKA 3HUIA 3ZNZB 3T1YL 2NVQB 1IKMA 1QOGA 2WAQG 4P72A 1Q1OA 3T4AC 2LUEA 1WJ4A 4DAPA 1JRPA 1Q3LA 1LTLA 3HKZE 5GAHC 1IGDA 2MWSB 4CDFC 3RNGC 4W9HA 4OVVA 3S2DB 5FO9B 1QVCA 1BF4A 5M5YH 4IJLA 3SE0A 1MG4A 2KZRA 1I4GA 1JR0D 3K7AH 2YV5A 4YWKA 2JA5H 1IXRA 4OZBA 4LF6L 4PMWA 3K9OB 5IOIA 3EJIA 3K5LA 1UAPA 1YJ9A 3DXJC 2N0SB 3MXUA 1YHAA 1XO3A 1Q0WB 4HJGE 1GD7A 4KJOA 1J0GA 4HPMB 4BFRA 4FXDA 3J81L 3RN2A 1NI3A 1WTRA 2NPTA 1VQDA 1EQVA 3LNNA 5I2XA 4LF9L 2ZW0A 4IURA 2Y0SE 2H5XA 4DR2L 4RM9A 1A15A 4GB9A 1F2YA 3HOZG 2JX5A 2M00A 1G51A 5BYRA 2EYOA 1D5MC 2ICEC 2B2VC 2M2LA 3KF8B 3T1YQ 3Q6SA 4GKKL 3TBLD 2Z0SA 1TWCB 1YX5B 3BG3A 2CKZB 4MH8A 1F0ZA 4OX9L 1K8AC 3K58A 2WLBA 3VH4B 4YSYB 3HOXG 3N9YC 1EYAA 4IN3A 2J4XA 2Q8RE 2MJ3A 4L5SA 1N32L 2AWNA 5E6NA 1Q8KA 5JHAA 3ZJUA 2UXCL 2O6VB 4BS9A 1N63A 4BA1I 2HD5B 4LF6Q 4XWWA 2J0JA 4A90A 1JQ4A 1EEFD 1C1YB 2C7NB 4OHJA 2JZ3B 1TKWB 4NPSA 4RNAA 3OWEB 1BMLC 2EYLA 1R7SA 3D3RA 2KKCA 1J5EQ 1OTRB 3Q3NC 4PYZA 5CHWA 1B8AA 3GB1A 3H3VI 4BA2I 4C3JH 1RRBA 2ZNVC 1RDPD 5M3FH 1K9MC 3CC7A 4LF8L 4XC2A 5L83A 1RLFA 4G0NB 2RCFA 1SJED 1HR0L 4MN3A 3Q8EA 3D6WA 4LF9Q 2I38A 5KIXA 4HLEA 4DR2Q 4MNOA 4G7OC 2AYOB 3PTFC 3VTUA 3ULJA 1LYLA 3PUVA 1XJVA 4UY8C 4EOYA 3ZLZA 2FIDA 4MM3A 3TS0A 4GKKQ 4JCVE 1Y1WG 2C7HA 4J3OD 4REZA 2BF8B 1GB1A 4P1BC 5IGDA 1JMCA 4BWGB 3K7UC 1XPRA 4OX9Q 1HJPA 5ELDA 2KCMA 3TUOA 1F9PA 1N32Q 2KVZA 2B8GA 2ZXPA 1W6JA 2KC2A 1L2NA 2IDYA 3S24A 1D1IA 2F0OA 1E0ZA 4K14A 2WXHA 2HIXA 4OIKA 3U9OA 2L55A 3GTMB 1Y14B 5JXVA 4ZAIA 3TREA 1WE7A 4NAMA 4NNJB 1S4ZA 2F0JA 3HOXH 4IM0A 4YL8A 4DDID 4F7ZA 3GTGH 1YNXA 2E6XA 1JE4A 1BDOA 1H4RA 1MPEA 2DBYA 3VQIA 2PW7A 1K50A 3KF8A 4HJAA 2JQOA 3DVGX 2KDBA 3FC4A 2E2JH 3MHSD 4LF8Q 3DVGY 4JBKA 2A19A 3AE5B 2O2LD 3DM1A 4XXEA 4HTHA 4L6TB 4ILWA 1EZ6A 2K39A 3ITPA 3P4RB 3SDZA 1V2YA 2O6VA 3CPFA 4LTUA 4I7AA 3A1QB 1T0YA 3Q3FA 3K8AA 4L5QA 2UUAQ 3DBHI 3VUWA 3ML8A 4O42A 4Q2JA 1TY0A 4MELA 4TV3A 4DV4L 3TRZA 1IL8A 4MGYE 1PH5A 4MT5A 1ENAA 2R7ZB 4II3B 1YQBA 2K6DB 4NJCA 4CDCC 2M0XA 4CHKA 2KK8A 4B3MQ 2M9VA 4YWMA 1SXTA 2KENA 1HZ5A 4LF5L 4WWMA 1WXQA 1J7AA 1AE3A 3I3CA 2KDFB 1GM5A 4B3TL 1E8WA 2F52A 1GC7A 2KQSA 2SAKA 1LTRD 3K0YA 2HTHA 3BWUD 3T3NA 3KW5B 5TSSA 4DHZE 2BB6A 4HR7B 1QZHA 1FRDA 4IUVA 1CQFA 2BYVE 1KNEA 3FAHA 2IYDB 3N6RA 4IPGA 3U2SC 1SJHD 3NVWA 3QOJA 3T53B 2KECA 4A3PA 2B3GA 3CCUA 1DGSA 3AU4A 5LLIA 3U50C 1QNUA 3T56B 4KVGB 1IZ6A 4E3CA 1X6OA 1K28A 2EJMA 1PTOF 1J8IA 3L54A 1F2LA 2EPBA 2LZ6A 5BN4A 2BKRB 2BT6A 3E3XA 1TR5A 2KXJA 1FD7D 2JA7B 4AOFA 3VHTC 4DV4Q 3LXFA 4YY3Q 4JI6Q 4XE0A 3V96A 1GOZA 4YIJA 3MFGA 3CIRB 4LAAA 2WDVB 4OGQC 3I4OA 1NMFA 3QG1A 4HCSA 3RNUA 5C4XG 3H9DA 3W1YA 1XQQA 4QIWB 1K8OA 1HFNA 2WQYB 3TN2A 1DOIA 1UH6A 4LF5Q 4P71A 2QMTA 3J7AV 4JOIC 3A9JA 4NAWB 2CQOA 4WJQA 2HT1A 3GD7A 3TEXA 1TIFA 2LGYA 2ZTCA 5AFWA 2IX3A 1Q1BA 1XPOA 4ZOHC 4C2MB 5C1ZA 3ZKJC 2GBNA 3VH3B 5CHVC 1SNDA 2B39A 1EFID 1KM7A 3DBRB 1VS0A 3UE0A 4P73A 2LI5A 3RN9C 4A3EH 2W82A 1Z7TA 2B2WA 4QUCA 1YJ1A 4KI0A 2NVXH 2E2HB 4A3BB 1AEXA 1DOXA 2QF7A 2UXDL 4DK6C 2F0LA 1QWYA 3VYSA 3D6CA 1V80A 1DM0B 3E5SA 3TCAA 1FFUA 1XF5L 4A6QA 1HA5A 2J7QB 3OMGA 2DY8A 1ZOYB 1MKHA 2E75C 2RD0A 4Q5VA 3I57A 1YHQA 1WF9A 2E2IB 3JVZX 1EY7A 3T9LA 4L8JA 2N3SA 5C3EH 2MJ8A 3RNFC 1IW7C 1D6EC 3VYRA 1A63A 5KYIA 3BINA 2L4NA 4ZUJA 3M3YH 3DWGC 3DWAA 5L37A 1TS5A 2GVBA 2Z6BA 1AZPA 4PS8A 3QJZA 1OXSC 5GROA 4PZ7A 3J81j 2O2VB 2V3NA 3EC8A 1JWMD 1YMHE 3UIOB 3HP3A 4YSZB 2R2OA 1BCPF 3QAQA 4KSLC 2GMIC 4LJZC 3S1NB 2UUCL 3P63A 1N34L 3J7AF 3KVFB 4RM8A 2ZNVB 3M4OH 5C4XH 1AW7A 3R7RA 3KUZA 3ZJVA 3S1RB 2QDFA 2EKEC 3GTQB 4A3GB 2HIVA 1PDXA 1M8AA 1D5XC 2VZAA 3H0GG 1G91A 4JI0Q 3NZ3A 3SDLC 4GOCA 4OEMB 4POGA 3U8ZA 2NVQH 2NYZD 2BE5C 4RF1A 3P20A 4HN7A 2GA4B 1AH9A 1A5RA 1Q90A 1WGKA 4MGZE 2VQEL 3WWVA 1A8VA 4RCOA 4K0KL 3PGZA 3L3OC 5T8IA 2KCCA 3OJ4B 3KUPA 2RDHA 2DY7A 3S2DH 4IKGA 1W6KA 2JF5A 1KH0A 2L0FA 2XEWA 3PMFA 4NAWA 1E2WA 3KUCB 1KLVA 4RCNA 1PGAA 3AB5A 1P3QU 3NS1A 3QR8A 5CORA 1PLFA 4G3XB 3STBD 1BOSA 3NQTA 3BU2A 1GXDC 1ASYA 2WXIA 3L16A 2ZW1A 1ZKOA 4KK7A 2BVCA 3TMEA 1B70B 3RD4A 4II2B 2MJEA 4CO7A 3D4RA 2ZJDA 4QL5A 1Z5SB 5ISRA 4GN3B 5G5HA 1TWAB 1UE6A 2KEEA 1SMYC 2UUCQ 1STHA 3CCVA 1ENCA 4XIGS 4GLAC 1UGJA 3S15B 1HQMC 3CF6E 5KNCA 1Q10A 2TMPA 4TSSA 4DV5L 2OOBB 3ZUNA 4GN4B 1NBWA 1SE2A 4KHPQ 2K6QA 2EMSA 2A6HC 4ZKCB 2MH7A 4JPSA 5D7GA 1S5FD 1M90C 2BA0A 1PTOD 1TWCH 2PI2E 1C0AA 4G4KA 3N1ZC 4Y7NB 4A3LG 1Q82C 4K0KQ 2HCCA 3IT4B 4LUVA 3RZOB 5J18A 2CH4W 2JEBI 2LY7A 1WM2A 2O2VA 3GS2A 4K7SA 2D9UA 4JV5L 3GTJB 1GVPA 1UELA 3IG3A 1FL0A 3RLFA 4JI7L 1YNJD 4HIDA 2A5UA 2JVCA 5H1SE 3M4YA 4NXML 2AL3A 5HFYA 1CHPD 4JQWC 2HHHL 1L5PA 2KYWA 3QO2A 3AE2B 3C8YA 4PYUA 4BBNC 1XLPA 1NCVA 3ND9A 4EQ5A 2KHWB 3OJ3A 1PZID 3NJTA 1XNRQ 3AULA 5IP7G 3RPFC 1G6JA 1PVOA 4IG7B 2SEBD 2XBBC 1MI0A 2KN5A 1WYDA 3G6EA 4RGMA 5G55A 2O4XA 2K5DA 1V9JA 4FJVB 4G11A 1RCVD 4LNIA 4DV5Q 1UNSA 1STGA 5C5LA 4XZ4A 1WFQA 3M3JA 2N9EB 3L17A 1VZ7A 3PPAA 1AWDA 2XK5A 3BVZA 4BY1B 3RT3B 1M4VA 4QY7A 1HH2P 1EUVB 5EE0A 4PT5A 3EFUA 3BJUA 3X0WA 1RJTA 4HEA1 2EY5A 2PIAA 2WAQE 4N9TA 4JV5Q 1VF5C 3H09A 2FMMA 2MSED 3QJYA 2KEDA 2A68C 1GUTA 3H3VC 4NXMQ 2BKFA 4EQNA 5EQ0A 2SNMA 4KHZA 3GTMH 1EM7A 1K3RA 5M9OA 1V6EA 1ZYRC 1IL2A 2HHHQ 1PFMA 2ZXOA 1F52A 2KMMA 3SU8X 2K4KA 4GLSC 4DR1L 3TEZA 3AEEB 2Q8TA 1EQTA 2VUMB 2PCFB 1F1HA 1MVKA 1T9HA 1BCPD 1KDCA 1TT2A 1FMAD 3VR8B 3J80L 2LVQA 2AHOB 1I4HA 5K5PA 2Z9HA 3HS0C 2QW7A 3N3KB 1I35A 1CHQD 1E10A 3TEYA 2JY6A 3VVWB 4TQ1A 1WX8A 1PRTC 4R4TA 2JA7G 1V1PB 2KWVB 1B53A 2K75A 1V97A 1F9RA 2E2DC 4H7BA 1Q1EA 1R4PB 2JEAI 5HKHA 3KOJA 4HIKA 2J53A 2ZCCA 2GBJA 1RWSA 2NCNA 1C4AA 4K7WA 1Y1VB 1FNVA 4U673 5FLXE 2WXLA 5FR6A 3MTSA 5CV4A 2JP1A 1MHWC 3L9AX 2R7ZH 2AUJD 1SEBD 4HSPA 2ZJPA 2F0VA 4BY7B 3V60A 3Q14C 1WFYA 1PV4A 2DYBA 3P1HA 1YIJA 1LT5D 4J15A 3PO3B 4YCVA 4KGRA 1A3TA 2KQ7A 3CKIB 3AH7A 2HCIA 4L63B 4UPAA 2K6AA 1PH6A 1ROEA 2ENBA 2WXFA 2Z0EB 2B2UC 3K81C 2WKCA 1BUVT 5IT9c 2RPQA 2CHXA 4C80A 4N59A 2JRHA 2XRSD 1SR3A 2IHFA 1QUQB 3T1HL 4QB4A 2H4OA 4Q0FA 2EJFC 5AZHA 3IBEA 2L1BA 2MJDA 1F2RC 3CHBD 1KDAA 3EVQA 4GLXA 1F77A 2A5HA 1DOKA 1RTOA 1JQYD 2FBWB 4X57B 5DM63 4CKCA 4JI4L 1S5DD 5IGGA 4AYBB 2WHIA 1D7QA 3R2IA 4JE3B 2WGSA 4LWCA 1T0SC 2B3AA 4RMFA 1EWYC 2JA7H 4HPPA 4MGIE 1HZBA 5E1FA 4ZQ3A 1Z9FA 1JJGA 1NTGA 1TZOA 2LJIA 2DLBA 4K3BA 2WXNA 1C77A 4FA6A 4MSQB 5C44B 1PH3A 5JZEB 3GZNB 4F8MA 1R4MB 1OTCA 4UAIA 1UEBA 1QQRA 4EZJA 1LTBD 4I7ZC 4A3GG 1V1PA 5IGEA 2HJ1A 1EWCA 4B9XA 4HWIB 2LUMA 3I73A 4H2AA 4OL7A 4NY0A 2R6GA 1HNXL 1BBXC 4DUYL 1SNPA 2VQFL 3LB8C 2LJ5A 4X66Q 1LTTD 4C2MH 2F4IA 3L0WB 3KBXA 2BWES 5L95C 5D65A 2Y5PA 3J80i 4JI8L 1VQPA 1N61A 1H9JA 3PUXA 1AFPA 2VY3A 1D4BA 4IW0A 5A2QE 4GKJQ 2E2HH 4A3BH 2WXPA 3DPDA 3NXWA 1EYDA 4W9EA 1UF0A 1WR1A 4IFDG 1V81A 1ZP0B 2DYOA 2VS1A 1SFOB 5HURA 4KJNA 2K25A 1NSNS 1HTLD 2J7ZA 2MBBB 4GXBA 5HHDG 4ZDVA 2RMMA 1N5XA 5FLXL 2HD3A 1D2BA 1WZ0A 1ZGUB 2ZPNA 2E2IH 3PLUA 3KDFB 2Q2UA 2IY1B 4WWPA 3A33B 1VQ5A 4KDIC 3E6ZX 1QUQA 3S16B 2ZCBA 1Z6HA 1ASZA 2N1WA 1S5CD 2PMVA 3NRZA 4C1NK 3EN2A 4K1RB 1JW9D 4RH6A 2BE5D 4LK1C 1JOKA 1JJCB 4DNRB 4WH4A 3LX0A 3ONAB 4A3IB 2GOWA 5IYDH 1HNXQ 3B9JA 2FHTA 1DXMA 4DUYQ 1L4ZB 4IO9A 4TQUS 2VQFQ 1VD2A 4J6HA 4RG1A 2MQJA 2RDBC 2PE6B 3S1NH 4ZRZA 1OXUA 3CC4A 2KJRA 1LV9A 3KBGA 2NR2A 3AECB 2IGGA 2F0TA 4B9WA 1EEID 3S1RH 1B3AA 3A5ZB 4JI8Q 3GTQH 3J80c 4A3GH 4K6DA 5EPKA 1TS3A 1PFNA 2ZTDA 5JJKA 4X6AH 1OGWA 2V1CC 1HUMA 1S5ED 3AQQA 3Q8BA 2B29A 1EY6A 4HDQA 4NZLB 2B63B 1N9WA 5KHOA 3APDA 1NVID 1WJUA 3ONSA 4LFAL 3X23A 4TRDA 4MGKE 4QAYA 4QGUA 2LGIA 1ZPSA 3MFYA 4GNXA 3HZXA 4OXPA 2NN6H 1TS2A 1L1OC 1YNND 3TBIB 1P16A 1SMYD 2KCNA 1NEKB 2NBVB 1A3UA 3D0FA 3GE3C 1WGYA 2CW0C 4IFDH 5HG2A 4H44C 3GE8C 4APVA 2JA5G 4M8NA 2CHZA 2N1VA 2KD0A 1SSOA 3Q0AA 1RKNA 4GZYC 1H9MA 2K5PA 3E9IA 5CV9A 3VFKA 2A6HD 1FNWA 1S72A 3CCRA 4HJKA 2EDGA 3FPPA 1EYGA 3P75A 1N6ZA 3ECIA 4A3DB 1ET6A 5JHBA 1TWAH 2RDGA 1M1KC 4BY1G 2D5GA 5DCNA 1N8RC 1L2FA 3BYYB 2F4VL 3S15H 1JWAD 3NENA 1JCKB 2C7MB 1HZ9A 3H91A 1PRTB 4IFDJ 1GJXA 3TQYA 2MGSA 3G7LA 3KDFA 2D2CC 5IGBA 1C4PA 1X54A 1B9NA 1KHIA 5A2QL 3P42A 3I72A 4DQOC 1TWFB 4E6IA 4Y7NH 4W9IA 2DNFA 3FRPB 1VZ6A 4LFAQ 4WJWA 4RGNA 2BDNA 1NJIC 2ATWA 3RZOH 2BPSA 2VUMG 1U4LA 2NWGA 3UDIA 3GTJH 2FCQA 3R3MA 2EMTA 3K57A 1VZ8A 3MHBA 3ZRCA 2EYPA 3A55A 4B08A 2V9HA 3ZTCA 3I9V1 2V0GA 2RR9A 2PZTA 3A7AB 5DEHA 2UXBL 3NBHB 3G71A 2R3ZA 5IWAQ 3RN5A 2NS5A 2QKIC 4MHEA 2K5WA 4P74A 1LTAD 3RNBC 3A5UA 2YYZA 3VA7A 1YIWA 3NTKA 5BMGA 2F0IA 4HCEA 5LMNL 3AEVA 3HOUB 2PKOA 4C3JG 3QIJA 4KV6A 4UHVA 2FUG1 1E7PB 3EGRA 4A3JB 5M3FG 4HROA 2Z6KC 2JXXA 1U4RA 4QMGA 4ICVA 1JC7A 4OVUA 1CQVA 1SNQA 3K5OA 4H13C 4DV6Q 1SSNA 2LHEA 4XDCA 2A68D 3W3AA 2BGFA 2MCNB 2A69C 1GB4A 5FO8B 2VXWA 3LYYA 4X3KA 1GAQB 4IUQA 2ON8A 1J9OA 4BY1H 3PO3G 1LTID 4BBRB 3QCAA 4MJSB 3R7QA 2RKSA 1BNZA 2C9WB 1FEHA 1QILA 2C9OA 2IGDA 2K5VA 3ZNHB 1LT4D 3M95A 5CGKA 1R4NI 1Y8PB 4XGAB 3CC2A 3BVGA 1Q46A 3U4ZA 3F2CA 1PQSA 4G50A 2A6ED 2PZUA 3UINB 1A6XA 4J6IA 2OTLA 2NBFA 4EGVA 4LCDE 4X64L 1EWIA 1V49A 4A55A 1WCMB 2K50A 3S17B 1IGCA 3HRZC 1GKHA 2UXBQ 4JI3L 5GXGB 2LFNA 3G6JB 2VUMH 2LFIA 1A2UA 3QOLA 2MLBA 4JGHB 4ZRPA 3FKIB 3FKYA 1KLUD 3HKZB 1L0WA 3NELA 1TVXA 4GOPB 2DUDA 1AP0A 1XLOA 3M62B 4ANXA 3Q3JA 2G5DA 3FPUB 2KACA 3CU7A 1ZEQX 3E0JA 2I5LX 1K3BC 2PQEA 4KKUA 1V43A 4A3FB 4K6LA 1PXUA 1HNZL 2VW9A 2L0CA 1FXAA 4FXCA 3RZWC 3HKSA 5KEEA 3CCMA 2ONQA 5BMHA 3PSIA 4ZRJA 3I70A 1BXTA 4XDDA 1S3SG 5C44G 4MACA 5M5XH 2QCZA 3PO2B 5IIFA 1UWXA 1GHKA 1Y1VH 2I46A 3S1QB 3APCA 1EF5A 1GPXA 2K14A 4ODGA 2MO1A 2Q2IA 3JAME 3NBHA 2QC8A 4FJZA 1I94L 2F1MA 1SYEA 4R4CA 5E7NA 4I6PA 4PMCA 1WM3A 1G2SA 3OSOA 4KY6A 2D3BA 2B2UA 4BY7H 3J7YW 4F88A 3BS1A 4IC7B 1LT3D 1F9QA 2PNHA 3PO3H 2A74C 3GQBA 4X64Q 2L9HA 1KJTA 4BKTA 4F8CB 5E6OA 4K8JA 4GMVA 4JI3Q 2A1AA 2SDFA 2IO0B 4DR3L 1MIUA 2J0TD 3QIAA 3ULLA 3TSSA 1PFDA 3N32A 3A56A 1QZGA 2CH4A 1DOMA 2Z4IA 1NNXA 3I8ZA 1JOQA 1VQFA 5GAGC 4DV1L 3I4NB 3IAM1 2UXCQ 4LFCL 3TP7A 4ALPA 2NUCA 5KNBA 4MJSA 1CKNB 3MXNB 1FVIA 2RPVA 5LL6S 1VLBA 3VA5A 2I1JA 4KLKA 4CBVA 1ICFB 1K52A 4NW2A 2B76B 5C4JB 1I6HB 2FCSA 1CKOA 1WJ6A 2REXA 5J3BA 1TY2A 5E3FA 2JN4A 1CM9A 2JXTA 2PVGC 4DXAB 1WWTA 4FF2A 2JU6X 2JZZA 3GV6A 1XXGA 2RCNA 3I2ZA 1L7YA 4LNOA 2B2YC 4FHKA 1HR0Q 1WTHA 4YHHL 2O6VD 2CKHB 2VH2A 3WAPA 3I56A 1VCIA 2JA8B 2KHSA 3IFWB 5J1ZA 2OQ0A 3J81i 3KH0A 4IWPA 4JBWA 1PZJD 5C44H 1L1OB 1TKEA 4GOPA 1NUCA 3HOVB 4DN4M 1G2TA 1WXVA 2FIFA 4C3HB 3NTIA 2LXKA 3M9BA 3GTPB 3A4RA 1SE3A 4F7XA 3M4QA 2LMCB 5I6YA 1WR6E 3ZRFA 3CRLC 1I4QA 4B95A 4ANWA 2OJWA 1E7VA 3W1SC 4GN1A 5HY6A 4PV1C 1HTOA 4DR3Q 3AE9B 2CWPA 5EE3A 1UD7A 4HIMA 2RQXA 4DV1Q 2B63G 2KWCA 2Q8IB 2PW9A 1L0XB 1BO0A 3HVZA 3WCQA 2J0MA 4LFCQ 2JA9A 2JYOA 3TZUA 1E5WA 2WXGA 1Z2MA 4YXDB 3EFXD 4KHVA 1SGHA 1Z47A 2H88B 4EZLA 3VRBB 3PUZA 4CGYB 1CI3M 1PA6A 1C9OA 4A3EG 3S2HB 2NVUI 2YLMA 2WS3B 1EU4A 2R61A 1F2MA 3N20C 1B50A 4FBJB 4KZ0A 4Z9CB 2I0QA 4HIOA 1SFOH 5FR3A 3QB3A 1GUWA 5EKIA 1C3TA 3K0XA 1K8RB 3L13A 4YHHQ 3NK9A 1A70A 4ZKBB 2BS4B 1NR4A 2LKVA 1JB3A 4ACFA 3K59A 3JAML 2ZZPB 3OWFA 4A3DG 2WP8J 3ZIMA 2C5CA 3EFCA 3J81c 4NKLA 1WXMA 1H9SB 2D5DA 5FJ8H 1VQNA 3S16H 1C8CA 3RNEC 1U4PA 3DHIC 3F1ZA 5C3EG 4K5XA 3PIOA 3RUZA 4US9A 3NEMA 3PF5A 1IBLL 2NZ1D 2F0KA 2UYZB 1ILQA 3GTLB 2OT2A 4A3IH 1E7UA 3B2GA 1KLGD 1RF2D 2KMAA 2ZEQA 2AUKA 1O80A 2MUYA 1SAPA 5DPSA 4OO1G 4YCUA 4W9DA 3WDNA 1UBQA 1VQGA 5IY0A 5M3MB 2EKIA 4KGSA 2WXKA 3VR3A 5EGTA 2FNJB 4ID6A 3CW2C 2G1EA 3U30A 3AYHB 3C0RB 3L7ZC 5IGFA 5JEAH
chains in the Genus database with same CATH topology
1EY9A 3ZYYX 1SYGA 2L83A 4QUFA 1DZ1A 1HTPA 2LMCA 1VDZA 3LWUA 1V8CA 4ARIA 5E4XA 1G6ZA 4PNYA 5CV5A 3DWPA 4N9PA 1HRJA 2KN4A 2W3RA 1PFBA 1I4PA 1RODA 3ZJTA 1ICWA 3SK8A 1EU3A 2MHVA 2WIIB 2JA6B 4RKLA 2CQAA 1V1OA 2WXRA 4XQQA 4D2KA 2IJ0A 5E6JA 1O7ZA 5T1IA 3CRKC 3H8HA 1ONLA 3NBIA 1XWEA 3Q8FA 4K5WA 3A8IE 4HRSA 2ZT9C 1XX8A 3MAQA 2LS01 3PZ8A 1X3QA 1AZQA 2WXQA 5H92C 1KTKA 1H9SA 4RF0A 1KABA 3MEHA 3O13A 4PQXA 4OO1H 2LEKA 2IWHA 2E76C 2BB5A 3GTKB 1OQQA 4P6VF 2EYHA 4RFBA 2XSCA 1C4CA 3P7JA 3MA2B 2AQ1B 4FXGC 1WTPA 2K28A 1OXTA 2K33A 3PO0A 2D62A 3D4WA 1B9MA 4NP5A 3FVQA 4M8AA 2F0MA 2V4IB 3VR5A 1EY0A 1YNTE 2YEPB 4J1MA 4RAUC 2BOSA 5BYQA 4US8A 2IGHA 2EYFA 5CMDA 5C0XH 2Z8LA 1KNAA 4TKOB 3AEDB 2W3SA 2RDFA 1C78A 2LHDA 1E2ZA 2F0FA 1KAAA 2WACA 1P7FA 1WTXA 1B9RA 1HHVA 2L12A 3Q22A 1YJJA 1JWSD 1R9TB 1AYFA 1I4RA 2B2VA 3U7ZA 3AN1A 4ULLA 1ZUD2 1EIGA 1XLNA 2XRQD 1JWBD 1TJEA 3KQ4A 1LABA 2INNE 2XWBB 1ESFA 1B2TA 2HDEA 2QDBA 3H6MA 2OEOA 3GTOB 1DCZA 1MBYA 5D3IB 2EE1A 3M7GA 3MVVA 1T6BX 5CYUA 5JAVA 3IAYA 2JQRB 1E9MA 1YQ4B 1BUIC 4A9AA 3R3OA 1WTWA 2JYTA 3KK7A 1ESRA 4IALA 3HGBA 4DFAA 5CC4A 3RPFC 1I4XA 5T1GA 4C3HG 2DNCA 2F0NA 4KTAA 4LMQD 4DGZA 2I07B 4A3MB 1E6EB 3H94A 1QCBD 5FOBB 1I3QB 1SBBB 5EPLA 1L6VA 1ZXIA 3SFEB 1FYCA 2NTTA 1NYQA 3S14B 4AS1A 2FE8A 4IZ8A 2SNSA 3MP9A 1ML0D 4IOIE 4DXGA 1A3VA 2OEDA 5A35A 4DNTB 1H9RA 2EELA 3OHXC 3SVMA 4CKEA 4CJ2C 1K8MA 3DEOA 2EYMA 3NVYA 5BMIA 2QILA 4GDLB 2B2YA 3I4LA 5JVG3 3MJ5A 2BYTA 3PUWA 1ZXTA 4ZHOA 2WXOA 1DOLA 2RSNA 2A73B 2GRIA 1SNCA 3VRAB 3AEAB 1JORA 3V3XA 3MZ5A 2CU3A 1OFFA 1RHPA 1LACA 1HEZE 1GUGA 4C56C 3W1SA 4ME5A 3GP7A 1B1ZA 3N52A 4HKZE 2L32A 1Y8OB 1I50B 2CVRA 3OIQA 2R92B 3IT6B 5M5XB 4NDXA 3ERQA 1FXIA 5HI1A 1F9SA 3KWLA 3NUCA 2BBCA 2J52A 4XWTA 4BBSB 2NVTB 1LTSD 2WXJA 3IFTA 3SXHA 1QG7A 1LLRD 1XYIA 3CQZB 2WAQB 2N7JA 2NN6I 3SFDB 1WRIA 1JWUD 3EA6A 4IFDI 2JWUA 4WQMA 1MGSA 3DMUA 3SK4A 3UI2A 4IDIA 2BCOA 2XN9C 1Q12A 4KN7C 1CZPA 5CR3A 1SNOA 3S9WA 1YN3A 2DYMA 1PZKD 2WKDA 1LO5D 1QJOA 4XDXA 1BR9A 3DEPA 4IUNA 2E74C 1T3QA 1J7CA 2GB1A 4K2KA 3PV0A 4I65A 1QOHA 3HOZB 3P4SB 2L52A 5C3WA 1IYVA 1XEEA 2JYEA 4IQZA 1DD2A 3IFDA 5CBAE 4L23A 1YQ3B 1XLQA 4DAVA 2F0GA 3AEBB 4ZHPA 3C2PA 1LT6D 1XCQL 3K5NA 2DWQA 4TQ0A 4EE2A 3NWTA 5G3LF 2BS3B 3SK6A 1VF7A 2IW3A 4JX1C 2HDLA 3URYA 2NN6G 4YTPB 1IW7D 3ZQ4A 2EOTA 3EQLC 2NB0A 4N58A 1STBA 1SF0A 2QEJC 1X32A 3M7NA 3T3OA 3A8KE 3OPOA 2IT1A 4FXKC 2KQ4X 4RKBA 1KRHA 2EY2A 1Y1WB 1PRTF 1E2VA 3RZDB 2WINB 3OIPA 1TS4A 2XVSA 4CHTB 4C3IB 2W55A 2W54A 1EY8A 1I7HA 4K8IA 1EZ8A 1TWHB 3AMUA 1K53A 2KA7A 4ZK9B 2V3PA 2X6LA 2KWDA 1FGBD 1Q8IA 1KDBA 2X6GA 1TYGB 1FCLA 1CFMA 1TU2B 4HEDA 5AUKA 3P4PB 2K0PA 1L4DB 4R3DA 2O5IC 2PVOD 3TZDA 2MPMA 1C9FA 5ELEA 3AEFB 1PGBA 4ITKA 3NVZA 4WIPA 4YTMB 4WURA 5K36G 4DU9A 1G8ZD 4ABNA 1OXVA 3PZ7A 4ZLTF 4DA2A 1IHZA 2AWOA 4A93B 1HXYD 2BDOA 3PUYA 4USAA 3LWEA 2VNUD 3PIO3 4R8IA 1YJIA 2EZVA 2Y5CA 1XCTL 2F0SA 3AM9A 1ACCA 1TKGA 2NVYB 2FJ2A 3AEGB 3SK5A 2B2WC 1GHJA 4P2CB 4RHSA 3MXGA 1DGJA 2EY6A 2JSOA 1ZDXA 3MWYW 3NP8A 5I6WA 1EL0A 2EXZA 1MSGA 3SEBA 2K32A 3E9SA 3HOYB 5C2TB 1CJEA 2XNAC 2WB1B 1NENB 5G3LD 4R8NA 2F03A 2OXPA 1CZGA 4G7ZC 5K36H 3P1MA 1PUTA 2K22A 3VR4A 4MIUA 4XT1B 2WDQB 5KNDA 3MXPA 3VR9B 1ZYRD 1F2ZA 5EJWA 2M19A 1SYCA 4DF7A 2Z1CA 3NSWA 2DN8A 3AE8B 5AUIA 1N62A 1HFGA 1TWGB 4KD4A 4WORA 4FF1A 2E3TA 4MM3B 1SNMA 2KQ3A 4YWGG 1PRTD 4X3SA 2K05A 2OF1A 5LNK1 3I4MB 3TEWA 2K01A 4C1NI 1EWHA 2N55A 1B44D 1JICA 2RBMA 5D14A 1UUPA 3NHHA 4IUTA 5KRUA 1VMCA 2B2TC 2YU9B 2ICIA 1IUEA 3ND8A 4HAEA 3BDOA 4XYQA 4OZAA 3AMZA 3C46A 5MPOA 2KJXA 1U9RA 2WXMA 3S1MB 2FFKB 1L6UA 3DUZA 2ZXRA 4J8QA 1SB3C 1V8QA 4LLGM 4A3KB 3H0GB 1P7EA 4ZUIA 1X3PA 1PMRA 5BN3A 2KOLA 1EOTA 2OHFA 4JWSC 2Y0SB 3OOCA 1VJKA 3W9CB 1PTOC 3DWQA 1QLBB 4KKSA 3M85A 3L4PA 4NMZA 4K5VA 1CA6A 1YNJC 5EE1A 1RTNA 1SE4A 2WU5B 2Y3AA 3CWIA 2KDMA 1IBXB 5EKLA 3QWNA 3OMCA 1UWMA 1LTGD 4FO2A 2F0WA 5IGCA 4OO1I 4C3IG 2WDRB 5KGUA 1HZ6A 4KMUC 2GI9A 4JWUC 1STYA 4U68A 4L2YA 4QCLA 3B2FA 1CTMA 4S3SA 2K03A 3V2TA 5JEAG 5E4WC 2TSSA 3UI3A 3MC0B 1HPCA 1FO4A 5NUCA 2N9KA 2INPE 1K51A 2BS2B 1A2TA 3K6OA 1B4OA 5CV8A 5C0XI 1FIQA 3EROA 2H1EA 1BCPC 1F2RI 5C3JB 3HOWB 3AB9A 3AE3B 1WD1A 5ELFA 4FVMA 1RD9D 2WNMA 1T5XD 1EY5A 3FMCA 3AE7B 4X3TA 5LHY1 2ACZB 2WP9B 3U52E 2AQ3B 3MXNA 4KKTA 1SYFA 5JVH3 3D8GA 5DM73 2J42A 1IBXA 2MP1A 1TIID 2VB2X 1O7LA 4X3UA 3VYUA 4YTNB 2CW0D 1QOBA 3TP8A 1CT1D 1CA5A 1MSHA 3PIP3 4G7HC 2YEPF 3P4QB 4V190 4ZRQA 5IT9E 2AQ2B 1NAPA 3BDCA 4P16A 1ILPA 1O78A 1VDVA 5C0XG 1STAA 2HQEA 3DHQA 2M0AA 3IXSA 4UDUC 5JEAJ 1ZDVA 4HKQA 3FEWX 3T13A 3SR6A 2XWJB 4F87A 3J9CA 1R4QB 2K1BA 4G57A 4N6EB 2F0EA 3FDTA 1E0BA 2PZWA 4O1NA 1Y69U 4H0LC 4RGTA 5JPNC 1EIHA 1NR2A 1HCZA 2HUGA 2PW5A 2XIWA 4DK1A 4B0EA 3A8JE 4M1UB 5FO7B 2F0QA 3NWSA 1D5ZC 3BZDB 5EKKA 1JALA 1AN8A 2IL8A 4XYOA 5JOBA 3U4EG 2L11A 1CZWA 1H9KA 5ELBA 5J39A 4KKJA 1K83B 4GDKB 2RVLA 3GV3A 4RA8A 2H89B 3C1EA 1G291 1PGXA 2F0UA 5IOCA 1PTOB 2A69D 1FR3A 2F0DA 5DNFA 4DAYA 2QJLA 2K04A 1FM0D 5M5WB 2KUMA 3NQIA 2B8FA 5JPMC 1KFYB 4HMJA 4KY5A 1RM6C 2R93B 4ARCA 4FF4A 2EVBA 3HG9A 2PO4A 4HMIA 4QF4A 4KX6B 3WOEA 1WTVA 4B0MA 4JK1C 5J22A 4OIJA 1J7BA 5C0XJ 2QCPX 1MHHE 3AE6B 5FK9C 5IT9L 1HQRD 3HEJA 3IAS1 3Q8AA 3TDQA 2N88A 2B2TA 3J80E 3K5MA 4XQJA 2EY1A 4WAFA 1YNNC 1L0VB 1D1KA 1STNA 2SOBA 1T5EA 1C4QA 1DONA 1SYDA 3Q23A 5CV6A 1FNUA 2VZKB 4KKIA 4LK0M 5EE9A 3W5UB 5HGTA 1OO9B 2K7VA 3VYTA 3TP6A 4RHRA 3KLSA 1BCPB 2PYKA 2NTSA 2DNEA 3BK2A 1RYJA 3X3NA 1OXXK 3SR1A 3A7LA 1ZXHA 2CJNA 2EJGC 3KWVA 2JE6I 3HRDD 2F3VA 1BQQT 2X69A 2JXMB 2QIEB 1SYBA 3R93A 1QNKA 2BW2A 3Q8CA 5M5YB 2K9XA 2RA4A 3K7AB 5ELCA 2JSVX 4YSXB 2JA5B 5EPJA 4OW0A 2M56B 2N9LA 1C79A 1O7YA 2L5TA 4WFN3 3BVMA 5CBEE 4OVZA 1L0YB 3IKJA 3RFZB 3RMHA 3VR6A 1JROA 1YN4A 4A8XC 3KLSX 4EQOA 1NYRA 2ID0A 1SDFA 3KLRA 4FNFA 1FD6A 1QOAA 2G9HD 5G5GA 1PDQA 2KVMA 4RWSC 2L1AA 2X38A 1QB5D 3AE4B 1Y56A 2HTME 5BN5A 2O5JC 3A54A 3T16A 5I9PA 1VMPA 1XTCD 3NTHA 4XQNA 4ZYSA 1JOOA 1ET9A 1KF6B 2F0PA 2Z4HA 1TQOA 4EQPA 5JJZA 2A6EC 4M0WA 1DJRD 1QE6A 2K3UA 1WTQA 1QT9A 2BA1A 3FILB 2IX1A 2I2YA 3BYTB 1WVLA 3ZGZA 1EYCA 4WRDA 2PPBC 4C3JB 3W5VB 5C4HA 5COYA 5M3FB 3WOFA 2CJOA 3R2TA 3HVDA 2JZPA 5C6AA 1DOYA 4C7YA 5LL6X 4KGTA 3AV8A 2K5QA 5I4DA 1I6VC 1IKLA 4RGOS 5C3XA 5BYSA 3AU7A 1MD2D 2EYJA 3I91A 1II3A 2HDMA 2WV6D 1WD0A 1GUSA 1N60A 4YT0B 1WYGA 3HOXB 2NMQA 3X3MA 3GTGB 1MHXA 1VRAB 5CV7A 5I9OA 3NVVA 3Q24A 3GO5A 3Q69A 2E2JB 4KY7A 3D4DA 5EBCA 2BTEA 4KD3A 4DXFA 1IYUA 3VR2A 2WU2B 3EUB2 2Q5WD 1WTOA 5KYLA 3ETRA 1DYQA 1SIJA 5C4ZA 3FILA 5C5MA 2VB3X 3NE5B 3BK1A 5F2DA 4DK0A 1QKZA 4R9WA 4IUPA 4K2LA 4V0BA 3NPPA 1UEAB 3I90A 2F0HA 1S5BD 4C7ZA 1ENFA 4EVOA 1WSPA 3D31A 1QF6A 4CQNA 1U4MA 1C76A 1N5WA 1RFKA 2FMCA 4FP5D 3AE1B 1QOFA 1PTOH 4HSVA 3NUHB 1GUNA 3MHZA 2PTLA 1VR9A 3R8BA 3V05A 3T51B 2RSOA 1ZE3D 3ABVB 3BIID 2FINB 1C48A 3J81E 2PLPA 1GUOA 5I2YA 5IODA 2IPKD 2QSDA 1TKYA 2G9DA 1PYWD 1MI2A 3TP5A 1EY4A 1JMLA 4PMBA 1Y8NB 3E56A 4A3EB 2NVXB 4CKBA 1CK1A 4XTCS 5DAUA 3DWMA 2F3WA 4XT3B 3BDLA 1YN5A 2V4DA 2PNRC 1HUNA 3F2UA 4OZCA 4KN4C 4FF3A 2IX0A 1FFVA 3U9SA 3W2DA 3C1FA 5C3EB 3IL8A 3C3LA 3M3YB 3OW7A 5D3DA 4TMAB 4AQ7A 5FKAC 5EBDA 4IUUA 5H8YE 2AX5A 4FYDA 1FCCC 1OQRA 1HA6A 1FRRA 2PMZB 3M4OB 5C4XB 1STEA 4CJ0B 3SHLA 4L1BA 2CHBD 2MEKA 2KAJA 4CJ1B 3TEYA 3HUIA 2NVQB 1IKMA 1QOGA 3T4AC 4DAPA 1JRPA 1Q3LA 1IGDA 3S2DB 5FO9B 1BF4A 3SE0A 1I4GA 1JR0D 4OZBA 4PMWA 3EJIA 3K5LA 1UAPA 3DXJC 2N0SB 3MXUA 1XO3A 4HJGE 4KJOA 4FXDA 3J81L 1NI3A 1WTRA 1EQVA 3LNNA 5I2XA 2ZW0A 4IURA 1A15A 1F2YA 2JX5A 2M00A 5BYRA 2EYOA 1D5MC 2ICEC 2B2VC 2M2LA 3Q6SA 1TWCB 3BG3A 4MH8A 1F0ZA 3K58A 2WLBA 4YSYB 3N9YC 1EYAA 4IN3A 2J4XA 2Q8RE 2MJ3A 2AWNA 3ZJUA 4BS9A 1N63A 4BA1I 4XWWA 4A90A 1JQ4A 1EEFD 4RNAA 4OHJA 1TKWB 3OWEB 1BMLC 2EYLA 1R7SA 3D3RA 3GB1A 4BA2I 1RDPD 1SJED 4MN3A 3Q8EA 3D6WA 2I38A 5KIXA 4G7OC 3PUVA 4J3OD 4REZA 1GB1A 5IGDA 4BWGB 5ELDA 3TUOA 1F9PA 2B8GA 2ZXPA 1W6JA 2IDYA 1D1IA 2F0OA 1E0ZA 4K14A 2WXHA 4OIKA 3U9OA 2L55A 3GTMB 5JXVA 4ZAIA 4NAMA 1S4ZA 2F0JA 2E6XA 1JE4A 1BDOA 1MPEA 3VQIA 2DBYA 2PW7A 1K50A 3KF8A 3FC4A 3AE5B 2O2LD 3DM1A 4XXEA 4HTHA 4L6TB 4ILWA 1EZ6A 3ITPA 3P4RB 3SDZA 4LTUA 4O42A 4Q2JA 1TY0A 1IL8A 4MT5A 1ENAA 2R7ZB 4NJCA 2M9VA 1SXTA 1HZ5A 4WWMA 1WXQA 1J7AA 3I3CA 2SAKA 1LTRD 3K0YA 3BWUD 3T3NA 5TSSA 2BB6A 4HR7B 1FRDA 4IUVA 1CQFA 3FAHA 1KNEA 3N6RA 3U2SC 1SJHD 3NVWA 3QOJA 3T53B 2KECA 1QNUA 3T56B 2EJMA 1J8IA 1PTOF 1F2LA 2EPBA 5BN4A 2BT6A 1TR5A 1FD7D 2JA7B 3LXFA 4XE0A 3V96A 1GOZA 4YIJA 3MFGA 3CIRB 4LAAA 2WDVB 4OGQC 4HCSA 3QG1A 4QIWB 1K8OA 1HFNA 2WQYB 3TN2A 1DOIA 2QMTA 3J7AV 4NAWB 3GD7A 3TEXA 5AFWA 2IX3A 1Q1BA 4ZOHC 4C2MB 1SNDA 2B39A 1EFID 2W82A 1Z7TA 2B2WA 4QUCA 4KI0A 2E2HB 4A3BB 1AEXA 1DOXA 2QF7A 2F0LA 1QWYA 3VYSA 3D6CA 1DM0B 3E5SA 1FFUA 1XF5L 4A6QA 1HA5A 3OMGA 2DY8A 1ZOYB 2E75C 4Q5VA 3I57A 2E2IB 1EY7A 4L8JA 2MJ8A 1IW7C 1D6EC 3VYRA 5KYIA 2L4NA 4ZUJA 3DWGC 3DWAA 1TS5A 1AZPA 1OXSC 2V3NA 1JWMD 1YMHE 3HP3A 4YSZB 1BCPF 4LJZC 3S1NB 3P63A 3J7AF 1AW7A 3ZJVA 3S1RB 3GTQB 4A3GB 1PDXA 1M8AA 1D5XC 1G91A 3NZ3A 2NYZD 2BE5C 4RF1A 3P20A 4HN7A 2GA4B 1Q90A 1WGKA 4RCOA 5T8IA 3L3OC 2KCCA 3KUPA 2RDHA 2DY7A 4IKGA 1W6KA 1KH0A 3PMFA 1E2WA 4RCNA 1PGAA 3AB5A 3NS1A 5CORA 1PLFA 1BOSA 3NQTA 1GXDC 2WXIA 2ZW1A 1ZKOA 4KK7A 3TMEA 3RD4A 2MJEA 3D4RA 5ISRA 5G5HA 1TWAB 2KEEA 1SMYC 1STHA 1UGJA 1ENCA 4XIGS 3S15B 1HQMC 5KNCA 1Q10A 2TMPA 4TSSA 1SE2A 2A6HC 4ZKCB 2MH7A 4JPSA 5D7GA 1S5FD 2BA0A 1PTOD 4G4KA 4Y7NB 2HCCA 3IT4B 3RZOB 2JEBI 2LY7A 3GS2A 2D9UA 3GTJB 3RLFA 1YNJD 3M4YA 5HFYA 1CHPD 1L5PA 3AE2B 3QO2A 3C8YA 1XLPA 1NCVA 3ND9A 1PZID 2SEBD 1MI0A 4RGMA 2O4XA 2K5DA 1RCVD 1UNSA 1STGA 5C5LA 1VZ7A 1AWDA 3BVZA 4BY1B 1M4VA 5EE0A 4PT5A 1RJTA 4HEA1 2EY5A 2PIAA 4N9TA 1VF5C 3H09A 2FMMA 3QJYA 2KEDA 2A68C 1GUTA 3H3VC 4EQNA 5EQ0A 2SNMA 4KHZA 1EM7A 2VZKD 5M9OA 1ZYRC 1PFMA 2ZXOA 2KMMA 4GLSC 3TEZA 3AEEB 2Q8TA 1EQTA 2VUMB 2PCFB 1MVKA 1BCPD 1KDCA 1TT2A 1FMAD 3VR8B 3J80L 1I4HA 5K5PA 3HS0C 1CHQD 1E10A 4TQ1A 1PRTC 1V1PB 1B53A 1V97A 1F9RA 2E2DC 4H7BA 1Q1EA 1R4PB 2JEAI 2J53A 1RWSA 1C4AA 1Y1VB 1FNVA 4U673 5FLXE 2WXLA 3MTSA 5CV4A 2JP1A 3L9AX 2AUJD 1SEBD 4HSPA 2F0VA 4BY7B 3P1HA 1LT5D 3PO3B 4KGRA 1A3TA 3CKIB 3AH7A 2HCIA 4L63B 2K6AA 1ROEA 2WXFA 2ENBA 2B2UC 2WKCA 1BUVT 4C80A 4N59A 2XRSD 4QB4A 2H4OA 4Q0FA 2EJFC 2L1BA 2MJDA 1F2RC 3CHBD 1KDAA 3EVQA 1F77A 2A5HA 1RTOA 1DOKA 1JQYD 2FBWB 5DM63 4CKCA 1S5DD 5IGGA 4AYBB 3R2IA 4JE3B 1EWYC 5E1FA 4ZQ3A 2LJIA 1TZOA 2DLBA 2WXNA 1C77A 5C44B 4F8MA 4UAIA 1QQRA 1LTBD 4I7ZC 1V1PA 5IGEA 1EWCA 4B9XA 2LUMA 3I73A 4H2AA 4OL7A 2R6GA 1BBXC 1SNPA 3LB8C 1LTTD 2F4IA 3KBXA 5D65A 2Y5PA 1N61A 1H9JA 3PUXA 1AFPA 1D4BA 5A2QE 2WXPA 3NXWA 1EYDA 4IFDG 1ZP0B 2DYOA 1SFOB 5HURA 4KJNA 1NSNS 1HTLD 2J7ZA 5HHDG 2RMMA 1N5XA 5FLXL 1D2BA 3E6ZX 3S16B 1Z6HA 1S5CD 2PMVA 3NRZA 4C1NK 1JW9D 4RH6A 2BE5D 4LK1C 1JOKA 4DNRB 4WH4A 3LX0A 3ONAB 4A3IB 3B9JA 2FHTA 1DXMA 1L4ZB 4TQUS 4J6HA 4ZRZA 1OXUA 3AECB 1LV9A 3KBGA 2IGGA 2F0TA 4B9WA 1EEID 1B3AA 4K6DA 5EPKA 1TS3A 1PFNA 3Q8BA 1HUMA 1S5ED 1EY6A 4NZLB 2B63B 1NVID 4TRDA 2LGIA 1ZPSA 3MFYA 3HZXA 1NEKB 2NN6H 1TS2A 3TBIB 1YNND 1SMYD 2KCNA 1A3UA 2CW0C 4IFDH 5HG2A 4H44C 1SSOA 3Q0AA 1RKNA 4GZYC 1H9MA 2K5PA 5CV9A 2A6HD 1FNWA 2EDGA 3FPPA 3P75A 4A3DB 1ET6A 2RDGA 2D5GA 3BYYB 1JWAD 1JCKB 3H91A 1PRTB 4IFDJ 1GJXA 2MGSA 3G7LA 2D2CC 5IGBA 1C4PA 1B9NA 5A2QL 3P42A 3I72A 4DQOC 1TWFB 4E6IA 3FRPB 1VZ6A 4WJWA 4RGNA 2BDNA 1U4LA 2NWGA 3K57A 1VZ8A 3MHBA 2EYPA 3A55A 4B08A 3I9V1 2V0GA 2PZTA 3A7AB 5DEHA 2R3ZA 2QKIC 4MHEA 2K5WA 1LTAD 2YYZA 3VA7A 5BMGA 3NTKA 2F0IA 4HCEA 3HOUB 2PKOA 4C3JG 4KV6A 2FUG1 3EGRA 1E7PB 4A3JB 4HROA 1U4RA 4QMGA 1JC7A 1CQVA 1SNQA 3K5OA 4H13C 2LHEA 1SSNA 4XDCA 2A68D 3W3AA 2A69C 1GB4A 5FO8B 2VXWA 3LYYA 4X3KA 1GAQB 4IUQA 2ON8A 1J9OA 1LTID 4BBRB 2RKSA 1BNZA 1FEHA 1QILA 2C9OA 2IGDA 1LT4D 5CGKA 1Y8PB 3BVGA 2A6ED 2PZUA 1A6XA 2NBFA 4EGVA 4A55A 1WCMB 3S17B 1IGCA 3HRZC 5GXGB 2LFNA 3G6JB 2LFIA 1A2UA 3QOLA 4ZRPA 3FKIB 1KLUD 3HKZB 1TVXA 1AP0A 1XLOA 3FPUB 2KACA 3CU7A 1ZEQX 3E0JA 2PQEA 4KKUA 4A3FB 1FXAA 1V43A 2JU6X 4K6LA 1PXUA 2L0CA 4FXCA 5KEEA 2ONQA 5BMHA 3I70A 1BXTA 4XDDA 4MACA 3PO2B 5IIFA 1UWXA 1GHKA 2I46A 3S1QB 1GPXA 4ODGA 3JAME 3NBHA 2F1MA 1SYEA 4PMCA 1G2SA 3OSOA 4KY6A 2B2UA 3J7YW 4F88A 3BS1A 1LT3D 1F9QA 2A74C 3GQBA 2L9HA 4K8JA 2SDFA 3QIAA 2J0TD 3TSSA 1PFDA 3A56A 1DOMA 2Z4IA 3I8ZA 1JOQA 3I4NB 3IAM1 3TP7A 2NUCA 5KNBA 2RPVA 5LL6S 1VLBA 3VA5A 4CBVA 1K52A 4NW2A 2B76B 5C4JB 1I6HB 1TY2A 5E3FA 1CM9A 2JXTA 2PVGC 1WWTA 4FF2A 3GV6A 1XXGA 2B2YC 1VCIA 2JA8B 2KHSA 5J1ZA 4JBWA 1PZJD 1TKEA 1NUCA 3HOVB 4DN4M 1G2TA 4C3HB 3NTIA 3GTPB 1SE3A 4F7XA 5I6YA 2LMCB 3CRLC 1I4QA 4PV1C 3AE9B 5EE3A 3HVZA 2RQXA 2Q8IB 2PW9A 1L0XB 1BO0A 3WCQA