5D2MB

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase,protein binding
total genus 14
structure length 76
sequence length 76
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d2mB00
3MJWA 3HIZA 2RR9A 2DZJA 2CU1A 2V1YA 3R66C 3PRMB 4KZ0A 3C0RB 1UGMA 1WGYA 4GB9A 2MQJA 3ML9A 3RYTA 3NZSA 1GNUA 1XT9B 4FBJB 2CHXA 2GOWA 3VHTC 4EUTA 2AYOB 2M4NA 2K6QA 2JT4B 2WX1A 3VUXA 2GBNA 1J19A 4B9KA 5D6JB 5IAAC 2G4SA 3UGBB 1A5RA 1Q0WB 2D11A 2JPHA 3ZRFA 1XQQA 2KDIA 3EHVA 2D07B 4ANUA 4II3B 4ASWC 2BGFA 3HM3A 4MJSB 2ZVNA 3H7PA 1RFAA 4K7UA 1R4MI 1RLFA 1UH6A 3AI5A 2LUEA 4W9CA 1LQBA 3IVFA 3WAOA 3EFUA 3H1UA 2FCMA 2JUOA 4IM3A 4EZLA 5JZEB 2K1FA 5DCNA 3BINA 3M95A 2L7RA 3QC8B 4I6LB 4NJ7A 2DYOA 3UF8A 3Q3FA 1V6EA 2HTHA 2PJHA 4GDLB 4II2B 2RD0A 3JW0X 1F9JA 1WM3A 2YLMA 3R7RA 2LZ6A 1ZGUB 3ZLZA 1WJUA 4EOYA 4PS8A 4XX5A 3SU8X 1TGZB 2GMIC 4MGKE 4NAWA 4BVUC 5JHAA 1GJZA 3T9LA 2N9XA 3PLVA 1V86A 3AULA 3L17A 4TUUA 5J2RA 2AWTA 3IBEA 2FCQA 4BOSC 1YD8U 2V4LA 2DZMA 2N9PC 2B3AA 4FLHA 3RULA 3WANA 2NBUA 2NS5A 2XK5B 5JHBA 3OJ3A 1LFDA 3PS6A 3WAMA 3SDLC 4BKSA 1WR6E 4HJKA 5C1ZA 5CTRC 3P2BA 2WYQA 4JGHB 5GMVA 1E7VA 2OOBB 4WWPA 3KUZA 2KTRB 2KZRA 3L16A 4FHJA 2O2VA 2R2OA 4CYEA 4NJ6A 3DCGA 2O6VA 5DPWA 2MRPA 3A9KB 1Z5SB 2KDBA 3PVLA 3PRZA 2LVQA 3WIMA 1X1MA 3K9PB 2IYDB 3B08A 2KVRA 4FA6A 1NI2A 2N1VA 3APCA 3KH0A 3JVZX 2ZPNA 1V49A 1WZ3A 2G45B 3HM6X 2GBRA 2MP2B 1P9DU 4I6NB 2HJ8A 3ZO5B 3KYDD 4PYUA 3W1SA 3UINB 1R4NI 1WX9A 3CF6E 4TKNA 3L0WB 2MWSB 4LJPB 3ZNGC 3ZKJC 2NPTA 4M0WB 4W9HA 4GU2A 5DPTA 3VUWA 4RMAA 5FR6A 2IO0B 1ZW7A 4DHJD 3QK0A 3CSFA 4GDKB 2KX3A 5CHVC 2RPQA 4CHKA 3W1YA 1TZ1A 3PSEB 4KVGB 4LJOB 3LJ3A 2M8SA 3RZFA 2JZZA 3VAWA 5LXIB 2REXA 3PGEA 3PTFC 4HPLB 3AXCA 2M17A 4JL9A 2DENB 1SIFA 1H4RA 2JRIB 2Z0EB 4URKA 1YIWA 3EC8A 1WX7A 4DK5A 2MX2A 2PEAA 3VTUA 3KUCB 2FCSA 3T8MA 2UYZB 2IZVB 4FJVB 1GG3A 4WWNA 1WE6A 4IWQA 2KWUB 1UZXB 3NZUA 3A9JB 2G3QB 3NOBA 1E8XA 4F1SA 2N7DA 4WJPA 3V61A 1GC6A 1WGHA 3I3TB 2FAZA 3LDZE 1KM7A 2KX0A 1WMHB 4KIKB 1WXAA 4G11A 3KUDB 1TBEA 2AEHA 3X23A 3S2AA 1EUVB 3TJPA 3RT3B 1E8ZA 3PV1A 4HDOA 3QWZB 2KOXA 2JXXA 3RUIB 3VXWA 2KANA 3PLUA 4MSMB 5CHFA 2WX0A 3A1QB 5D2MB 4G0NB 2NVUI 1YX6B 3DBHI 4FHKA 3TIXA 1T0YA 4A3OA 2LWPA 3B1LX 4DXAB 1EF5A 3ZW3A 2BWES 4W9IA 2XEWA 3ZDTA 2AL6A 1E90A 5LLIA 4W9LA 1OQYA 2CKHB 2CR5A 2MA9B 2MBQA 3GOEA 3PRPB 4WJOA 5J17A 4DDGD 2DZKA 1V5OA 4LCDE 1QZEA 2BWFA 3A4RA 1I42A 3L08A 2KWVB 3IG3A 5TR5A 2WWZA 5E6NA 2BKFA 1WJ6A 1WX8A 1VD2A 2M0XA 5DPSA 2NR2A 4M8MA 2KC2A 3DDCB 2LRWA 2D10A 1PQSA 3UQBA 2NBWB 4TQ0A 2C7NB 2JF5A 2LI5A 3O65B 4HCNB 4XZ4A 1Y8RC 2MBBB 4DBGA 4MJSA 5L83A 4NPNA 4G3XB 1JRUA 3DBSA 3DVNU 1Q1OA 2ZVOA 5DPRA 4BBNF 1WM2A 2NCNA 3VQIA 3ZTDA 4W9DA 2LD9A 2DAFA 4BKSD 4ZRIA 2EKEC 1V81A 2KLCA 2ZZPB 3U8ZA 3VDZA 1WI0A 2L3ZA 4J6IA 4EFOA 1WJNA 4FADA 1IP9A 1WZ0A 3V6CB 2MSED 4GDLA 2IBIB 3ZIMA 4GXBA 2L0FA 5J18A 2O6VD 1S3SG 4GSWA 4E74A 3M63B 1K8RB 2ASQA 2MBEA 3RCZA 4I6PA 4TV3A 2L00B 3DQVA 4EZKA 2Y5BB 3U30A 3APFA 3L13A 3OJ4B 4DDID 4K7WA 1V80A 5KHQA 1OGWA 4AUQC 2ZPYA 3VFKA 3VH4B 4X57B 4F8CB 2FNJB 2BKRB 4NY0A 3ZNHB 4MEMA 4DHZB 2CHWA 2N4FA 2KJ6A 1P1AA 1E7UA 3DVGX 4MSQB 4BKGA 2XK5A 3QHTA 3CSTA 1XD3B 2A5UA 2PPHA 2KWCA 2LRUA 3N32A 1WE7A 4IUMB 2KFJA 3NS8A 1WYWB 2LVPA 1IYFA 1KLVA 1TTNA 2IY0B 3D32A 5IA7A 1NDDA 2KTRA 3JSVB 2HE7A 4HK2A 2GBJA 3WALA 3H6NA 4KDIC 1WIAA 1EO6A 2K8CA 2KC1A 2KLGA 3A9KA 4MH0E 1WF9A 3B0AA 3PT2B 4K81A 3QQ8B 5AZGA 3A4SC 4P7IA 2C60A 1U4AA 3NHEB 2N9EB 4NQKE 2KN5A 2LVOA 2I1KA 1VCBA 3APDA 1P0RA 4KZCA 2MP2A 2KK8A 2KQ7A 2LXAA 2MBOA 4BFRA 2VRRB 4HXDA 2KMAA 3H9DA 4MELA 4WWOA 4MGYE 3WAPA 4AJWA 4E71A 4ICUA 2KJHB 4N9F4 2IO3B 3VTVA 3X0WA 4IWPA 1LM8B 4TQ1A 3RD2A 3ZRCA 1HE8A 4JIOU 2KXJA 2G4DB 2EMSA 2FCNA 4GDKA 2AL3A 1OEYJ 4F7ZA 4DHZE 3OAWA 4LDTD 5EDSA 4IWOA 5AEKB 1I35A 2KFKB 4IG7B 1WRDB 2BPSA 4ANWA 3QARA 2FIFA 4M8NA 4W9FA 1RRBA 3ZDMC 2M1MA 1UBQA 2NBVB 4GGQA 4GIVA 4K1RB 2WDTB 5CX3A 5HKHA 1WY8A 4OVUA 2RSUA 2K8HA 4HPMB 4JLCA 3TCAA 2W9NA 3DBRI 1OTRB 4W9JA 2N7EA 3U7DA 2FIDA 4EEWA 4K7SA 2C9WB 3V6EB 4AOFA 5JH5C 1NBFC 1YX5B 2L8JA 3N3KB 4YL8A 4DWFA 2DYMA 2N1WA 3A9JA 4MDKE 3TBLD 4AP4C 5G2NA 2ZNVC 4ZDVA 3DVNV 3MHSD 5E6OA 3NY5A 3GZNI 4ZRKA 4ZYNA 2DAJA 2Z0DB 4MGZE 3UIOB 3EECA 2QHOA 1RAXA 1WMHA 2BYVE 2GBMA 2LGYA 3HHMA 3L10B 4KIKA 4RM8A 2MCNB 2K6DB 3SHQA 4NQLB 3H7PB 4AJYB 4B95A 4ICVA 4PS3A 3A33B 2K8BA 3DOWA 4ZRJA 2J7QB 2J0KA 2DZIA 1SGHA 3A1QA 3JYUA 1CMXB 4KSKC 3QIJA 3ALBA 4G50A 3PZDA 1GUAB 3ZNID 2KKCA 3MTNB 1BT0A 1UBIA 4IM0A 2OJRA 2ZNVB 3BY4B 2MBHA 2KJRA 1ISNA 2FUHB 5C23A 3VTWA 3ZVVA 3DPDA 4NAWB 4JQWC 1FXTB 2PE6B 4GN1A 3IHPC 1WGGA 4AWJA 4BKTA 4NNJB 1YQBA 1P3QU 1E8YA 5L95C 4IM2A 3CMMB 4HCPB 3W1SC 4MM3A 3ZTCA 4BOZB 1V2YA 2KMCA 3RZWC 2A4ZA 2BYEA 4IW0A 4KSLC 3DVGY 5E6PA 3HK0A 2KTFA 1AARA 2KNBA 1M94A 2Z59B 4FJZA 1G6JA 4FN2A 2O2VB 2KQSA 2ZJDA 3PHWB 1H8CA 2O6VB 2C5LC 1P98A 2ZEQA 1WXVA 2BF8B 3KYCD 3M3JA 4WJNA 4FULA 3PREA 4A3PA 2ZCCA 1LXDA 2RGFA 3V62A 3VVWB 1KOTA 1WH3A 1UD7A 3ZUNA 1L2NA 3AU5A 3AU4A 1WGDA 1IPGA 4WAAA 3R3MA 2PE9A 1GC7A 1WR1A 4W9GA 3WA0A 3QX1A 4EZJA 2EMTA 3H7SA 3ZNZB 2NPTB 2DX5B 4EKUA 2IY1B 2IO2B 3UQAA 3ONSA 1L7YA 2D3GA 2JRHA 1ZKHA 1WXMA 5BO4B 3L54A 4MGIE 5G55A 1YJ1A 3N30A 2BYFA 4OVVA 2L76A 2KDFB 2LGDA 2HD5B 3M62B 2JVCA 4HWIB 4RM9A 4WJQA 4B6WA 2D2QA 4KV2A 3VUYA 3KW5B 3SD5A 2YVCA 1V9JA 3ECIA 5KHOA 2R2QA 1Q5WB 4HLEA 1J0GA 3ENEA 1E8WA 3JSVA 1MG8A 2LXCA 4KDLB 5D94A 1Z2MA 4DHJB 3TL5A 2I1JA 4HDQA 2MW5A 3KVFB 3Q3JA 2KD0A 2LGXA 2MLBA 3PHXB 4A20A 1C1YB 1E5WA 1UELA 2C7MB 5D7GA 4GOCA 1WFYA 3QA8A 3VH3B 4E3CA 4HVBA 2UWQA 2ZCBA 4XC2A 2L0TA 2JZ3B 2KHWB 2L05A 3QAQA 5AZHA 3V60A 3ML8A 2V3SA 4W9EA 1EF1A 4ANXA 2JWZA 1OEYA 2K39A 1V5TA 2C7HA 2DHZA 1S1QB 2K25A 4WQOB 4FJYA 4PS7A 4LDTB 2KDEB 2GBKA 2J0MA 3QCAA 1WJ4A 2J0JA 2CHZA 3OLMD 5CHWA 4CO7A 5AZFA 1C3TA 1D3ZA 3QJZA 2LJ5A 1WXSA 3IFWB 1KJTA 2LASA 3DBLI 3K9OB 1J8CA 2KFKA 3TMPB 1WGRA 2CS4A 2IO1B 3UIPB 4GMVA 2JY6A 4IC7B 3PPAA 4BBNC 5LXHA 2KO3A 1SE9A 2DYBA 2XBBC 4ANVA 3R7QA 4PYZA 4W9KA
chains in the Genus database with same CATH superfamily
1OFFA 3PRMB 2TSSA 3C0RB 3RNEC 3RYTA 1UF0A 2GOWA 3Q14C 4M01A 1KF6B 2AYOB 1ESFA 2JT4B 2WX1A 5HHDG 4P1CC 1ROEA 1Q0WB 2D11A 3ZRFA 3EHVA 4ASWC 3HM3A 4MJSB 2J4XA 1LO5D 2WGSA 3EFUA 3L4PA 3SFEB 3BINA 3UF8A 3BVZA 3Q3FA 2HTHA 2D5GA 2RD0A 1TY2A 2LZ6A 1R4NB 1YN5A 2CJOA 4UDUC 2M19A 1K53A 4XX5A 1TGZB 2N9LA 2N9XA 5EE1A 1YD8U 2XK5B 1F0ZA 1D4BA 1MPEA 1N63A 3W2DA 4BKSA 3Q3OC 5C1ZA 3P2BA 1MG4A 2WYQA 1V1OA 1NYRA 1KTKA 2KTRB 3TUOA 3L16A 4KX6B 4NJ6A 3DCGA 3RNGC 5DPWA 2MRPA 2WP9B 3A9KB 3ZXVA 1Z5SB 2WNMA 4BZAA 2D3CA 2Q5WD 2MP2B 4BAXA 4C56C 1WX9A 3L0WB 3ZNGC 4W9HA 2UU7A 4YTNB 3UI3A 4GU2A 2BBCA 4WAFA 4DHJD 4GDKB 2RPQA 1D6EC 3NUHB 2W82A 3DBHB 3P4QB 1RYJA 1ET9A 3MJ5A 2M17A 2ONQA 3DHHC 2JRIB 2K3UA 1B9RA 1C77A 3OWEB 2KQ4X 4IWQA 3NZUA 3N20C 4F1SA 2N7DA 1WGHA 1ACCA 1XLOA 1WMHB 1PDXA 2AEHA 3X23A 3S2AA 1EUVB 4RGMA 3RT3B 1V1PA 3KQ4A 3RUIB 3U7ZA 5CHFA 1TJEA 3A1QB 2G9HD 3LXFA 1YX6B 5T8IA 1TT5B 1T0YA 1UGJA 1EF5A 2BWES 2XEWA 1E90A 1XLPA 4WJOA 2MHJA 3BK2A 1AWDA 3RNBC 3L08A 1UWXA 5TR5A 2BKFA 5DPSA 2NR2A 3DDCB 3R8BA 2LRWA 5FK9C 2NBWB 2LI5A 2PMVA 3KWLA 4DBGA 5L83A 4G3XB 1JRUA 3DBSA 2ZVOA 1T6BX 4BKSD 4ZRIA 1V81A 2KLCA 1WI0A 1N60A 1A70A 1WJNA 1WZ0A 2QDFA 2IBIB 4GDLA 2ON8A 5J18A 1E6EB 1S3SG 3M63B 1TZOA 2VH2A 4I6PA 1CJEA 2NMQA 3U30A 3L13A 1XF5L 4LTUA 2QIEB 4NY0A 3ZNHB 1WWTA 3BWUD 3DVGX 5D3IB 4AS1A 1NYQA 1XD3B 4B0EA 2PPHA 1LGRA 3EGRA 1FXIA 1TTNA 5IA7A 2L1AA 3WALA 4KDIC 3R2IA 3BIID 4MH0E 2KLGA 2XN9C 1WF9A 4K81A 2V4IB 2LVOA 1TKGA 1QKZA 2MBOA 2VRRB 1HQRD 4M02A 4LLGM 3GZNB 4YSXB 3NZ3A 4M0WA 1IBXB 1ZUD2 1LM8B 2KMMA 3ZRCA 1HE8A 2KXJA 2G4DB 2EMSA 4DHZE 4IWOA 1I35A 5C2TB 1TS4A 1WY8A 5HKHA 2JZPA 4HPMB 4JLCA 4J3OD 1ENFA 3TCAA 2PW9A 3DBRI 4W9JA 2N7EA 2FIDA 4RF0A 5JH5C 1YX5B 4YL8A 1F52A 4DWFA 3V05A 2N1WA 4AP4C 5G2NA 5E6OA 4ZYNA 5GXGB 2DAJA 1RAXA 2LGYA 2GBMA 3HHMA 2K6DB 1JALA 2QMTA 3H7PB 3AE4B 1AYFA 4ZRJA 2J0KA 1N62A 3GE3C 2DZIA 1I4GA 3IAM1 1D5MC 2WXQA 2MJDA 3NVZA 3KLSX 3PZ8A 2FUHB 3AEGB 4NAWB 2GB1A 1FXTB 4AWJA 1P3QU 1E8YA 2PKOA 3NRZA 3ZQ4A 2MEKA 2KMCA 3DVGY 4L23A 1AARA 2Z59B 2O2VB 2KQSA 4XDCA 1SE4A 1HXYD 2WXGA 1P98A 3AM9A 4HKZE 4WJNA 4N58A 4A3PA 1LXDA 2RGFA 3V62A 1UD7A 2D3BA 1WGDA 2PE9A 2M56B 3WA0A 4EZJA 3H7SA 2VZKB 4WIPA 4MH8A 2MJ3A 2DX5B 2IO2B 3UQAA 2AQ3B 1L7YA 3ONSA 1ZKHA 5EE0A 3NVWA 3N30A 4RCOA 1K51A 2JVCA 4RM9A 4WJQA 4B6WA 3ECIA 3P42A 1E8WA 2LXCA 4L1BA 3AE3B 2MW5A 3H8HA 3KVFB 1WRIA 2KD0A 2LGXA 2MLBA 4OZCA 3RMKC 1C1YB 3FKYA 4A20A 1F2RI 2BS3B 3VH3B 4E3CA 1D5XC 4XC2A 2E3TA 1JWSD 1EU4A 3ML8A 1OEYA 2DHZA 3C19A 1S1QB 3DWMA 2GBKA 2J0MA 1WJ4A 1C3TA 1D3ZA 1KJTA 2LASA 2WQYB 4IOIE 3RFZB 4S17A 4IC7B 3N1ZC 3NVVA 1PYWD 1SE9A 1Q10A 3MJWA 4RNAA 3R66C 4KZ0A 4GLSC 1UGMA 1WGYA 3ZXRA 2AX5A 2K5PA 3NZSA 1XT9B 2CHXA 4EUTA 2K6QA 5D6JB 2G4SA 4LNIA 1Y56A 2JQRB 3V3XA 4DXGA 1FFUA 2KDIA 4ANUA 4II3B 2BGFA 1RFAA 4K7UA 1RLFA 1UH6A 3AI5A 2LUEA 1SXTA 3ZYYX 3H1UA 3CWIA 2FCMA 3GP7A 5JZEB 2K1FA 5DCNA 3M95A 3QC8B 1DOXA 2DYOA 1VZ6A 1F9JA 1ZGUB 4N59A 3ZLZA 4EOYA 1GJZA 2I2YA 4BVUC 4NZLB 3T9LA 1V86A 3L17A 2Z8LA 3DHIC 3IBEA 2FCQA 2V4LA 2DZMA 2N9PC 3RULA 3WANA 3OJ3A 5IP4D 3PS6A 3SDLC 1WR6E 1YQ4B 5LNK1 4HKQA 4JGHB 5GMVA 2OOBB 3KUZA 4FHJA 2KZRA 1TKYA 3B2GA 4A8XC 3PRZA 1QOBA 2VZKD 3AE7B 1NI2A 3KH0A 2MH7A 2NTTA 1P9DU 2HJ8A 3ZO5B 1TS3A 3W1SA 3UINB 1ZOYB 2MWSB 3FAHA 1QOAA 5FR6A 2JSVX 3QK0A 3CSFA 4CHKA 2IGHA 3W1YA 3TEWA 3PSEB 4XE0A 2WXKA 2M8SA 2WDQB 3RZFA 4ZHPA 2REXA 4HPLB 3RNFC 1MHHE 4JL9A 1J7CA 1FCCC 2KVZA 2DENB 1SIFA 4YWGG 2AQ2B 1WX7A 4DK5A 4JPSA 2PEAA 2OJWA 2FCSA 3T8MA 4P1BC 2UYZB 2IZVB 1C9FA 4RFBA 4FJVB 1CZPA 2XNAC 2KWUB 1UZXB 1F1HA 4ZYSA 4B0MA 2KX0A 4G11A 4RH6A 4A55A 1FEHA 1FRDA 2KOXA 4NAMA 3N9YC 1GOZA 3MFGA 2JU6X 3ZDTA 5LLIA 4W9LA 1SJED 2CR5A 2W3RA 3AECB 4OVZA 4DDGD 2RDBC 2L32A 2KWVB 1TS5A 2WWZA 5E6NA 1GAQB 2M0XA 2D10A 2ICIA 1PQSA 2JF5A 4HCNB 4XZ4A 2DLBA 1SBBB 3AMZA 4MJSA 4O1NA 5DPRA 2DWQA 3VQIA 3GB1A 1FO4A 2DAFA 2KT7A 2ZZPB 3VDZA 2BW2A 2L3ZA 3P4RB 3ZIMA 3IXSA 4GXBA 4GSWA 2MBEA 3RCZA 3WCQA 5G5HA 1E0ZA 3DQVA 3EUB2 1L6UA 4K7WA 4XDDA 4AUQC 4OZBA 3VFKA 1YNTE 4HEA1 4C7YA 4MACA 2QEJC 5HFYA 2XK5A 3QHTA 2A5UA 3N32A 1MVKA 2IGDA 5H8YE 4US9A 1KLVA 2IY0B 1FPYA 2W55A 2KTRA 2QC8A 3IT6B 3JSVB 1FXAA 3AEAB 3BK1A 3A9KA 3B0AA 3PT2B 5AZGA 1DOYA 3IAS1 2KN5A 1VZ8A 1VCBA 2WXIA 1FIQA 1P0RA 3HVZA 2MP2A 2KQ7A 4KZCA 1ZPSA 1I4XA 2H89B 4HXDA 4WWOA 4AJWA 4E71A 4ICUA 4N9F4 1KFYB 3GE8C 1KRHA 2WDRB 3VTVA 4IWPA 1VR9A 3RD2A 3RN9C 4JIOU 3FC4A 4GDKA 2FCNA 4F7ZA 1OEYJ 4LDTD 4NJCA 2KFKB 1HZ5A 1WRDB 2BPSA 2BTEA 4ANWA 2FIFA 1T0RC 4W9FA 1RRBA 1L4DB 4K1RB 5CX3A 2NTSA 1XXGA 4ZOHC 1E9MA 4S0RA 2K8HA 4KKJA 1PGXA 3U7DA 2QJLA 2C9WB 2CJNA 2WLBA 2RPVA 2LHEA 5H92C 3NY5A 3UIOB 3EECA 2SEBD 1WMHA 3L10B 4RM8A 1NENB 4AJYB 2OHFA 4B95A 3PZ7A 2K8BA 4ZHOA 1STEA 3JYUA 3A1QA 1CMXB 3AEEB 3QIJA 3ALBA 1GUAB 3RPFC 2HJ1A 3MTNB 2B76B 1BT0A 1UBIA 4IM0A 2ZNVB 2PVGC 3BY4B 2MBHA 1JWMD 2YEPF 2V3NA 3ZVVA 1OQRA 4JQWC 1TYGB 2LEKA 4LNFA 1E7PB 5L95C 4NNJB 1YQBA 1VLBA 3Q8BA 4IM2A 3CMMB 4HCPB 3W1SC 3Q3MC 2WS3B 3RZWC 2BYEA 3ZJUA 4N6EB 2KTFA 2CU3A 2KNBA 4FJZA 3P63A 1M4VA 2ZJDA 3PHWB 2O6VB 2ZEQA 1BMLC 1WXVA 3PREA 1N5WA 3AU5A 1GPXA 4WAAA 3J9CA 1WR1A 1JMLA 2VH1A 3ZNZB 2NPTB 4EKUA 2KWDA 2D3GA 2JRHA 1WXMA 3L54A 3DBLB 2BYFA 2L76A 2KDFB 3M62B 4C00A 2D2QA 4KV2A 2YVCA 5KHOA 2R2QA 1Q5WB 1FM0D 1MFWA 3ENEA 4RGOS 1Z2MA 2PLPA 2KN4A 2QCZA 1C4CA 1SSNA 1JCKB 2WXFA 2ZCBA 1ZXIA 3O13A 2JZ3B 2LHDA 3QAQA 3V60A 1P7FA 3BVGA 2K39A 1IBXA 5BYRA 2K25A 4WQOB 4ZRPA 3BVMA 4HPPA 3QCAA 2CHZA 4CO7A 3K9OB 4P6VF 3U52E 3TMPB 4JWSC 2CS4A 2IO1B 3AE2B 2HTME 4BBNC 5LXHA 4ANVA 3R7QA 3Q8EA 3HIZA 2RR9A 2DZJA 2V1YA 1MJDA 1L0XB 4FXCA 4GB9A 2MQJA 1GNUA 1V8CA 4FBJB 2M4NA 3VUXA 4B9KA 5IAAC 3UGBB 2LGIA 2JPHA 3ABVB 1XQQA 1SF0A 2ZVNA 3H7PA 4W9CA 1R4MI 2WU5B 3IVFA 2WXMA 2JX5A 1F2RC 4IM3A 1JRPA 3VRAB 2L7RA 4NJ7A 1V6EA 2PJHA 1TIFA 3ZJVA 3JW0X 1CK1A 1PUTA 2YLMA 3R7RA 5D3DA 2X8XX 2OEDA 3W5UB 3SU8X 4MGKE 4NAWA 3PLVA 4R3DA 4LNNA 3AULA 4TUUA 3I9V1 5J2RA 4YTMB 2AWTA 1JW9D 4BOSC 1WSPA 4FLHA 2B3AA 2NBUA 2NS5A 3MHZA 3MP9A 1LFDA 3WAMA 4OW0A 4HJKA 1DOIA 3MC9A 5CTRC 4WWPA 2HDEA 3TEZA 2O2VA 1XCQL 3PVLA 2LVQA 5MPOA 3K9PB 2IYDB 3B08A 2KVRA 3VR8B 4FA6A 2N1VA 3APCA 1L4ZB 1V49A 2G45B 5BYSA 3SFDB 3HM6X 2GBRA 4OHJA 1JWBD 3KYDD 3FILB 3BYYB 1R4NI 4TKNA 4LJPB 2WU2B 2KACA 1SE2A 5DPTA 3VUWA 1ZW7A 1SIJA 2KX3A 5CHVC 1MI0A 5TSSA 4MT5A 1E10A 1TZ1A 4KVGB 1K52A 2JZZA 1L5PA 1SB3C 1EM7A 1YMHE 2BVCA 2Z0EB 4URKA 1YIWA 3EC8A 4JE3B 3VTUA 4RGNA 3KUCB 2E6XA 1GG3A 2QILA 3A9JB 2G3QB 3P1MA 2BQQA 1E8XA 4WJPA 2FAZA 2J52A 1FNUA 4KIKB 1WXAA 2QSDA 5HI1A 3DHGC 3Q8FA 3TJPA 3QWZB 1JWUD 4EE2A 2JXXA 3E9SA 2KANA 3PLUA 4MSMB 2BT6A 2INNE 4G0NB 3DBHI 3I5JC 4FHKA 4A3OA 2LWPA 4DXAB 1QOGA 3ZW3A 5FKAC 2AL6A 2RDGA 4JX1C 1VJKA 1OQYA 2MA9B 2MBQA 2H88B 4LCDE 2PIAA 1UNSA 4HJGE 1QZEA 4WURA 1QLBB 5HG2A 1WJ6A 1VD2A 4M8MA 3AEFB 2KC2A 4HRSA 3Q6BA 2C7NB 5IO9A 4C4VB 3SR6A 1TKEA 1Y8RC 2MBBB 4NPNA 1B1ZA 3DVNU 1Q1OA 4D2KA 3HVDA 4BBNF 1WM2A 2NCNA 3ZTDA 4W9DA 2EKEC 4IKGA 3AV8A 1EWCA 3U8ZA 4CQNA 4J6IA 1NI3A 4EFOA 1YN3A 1DGJA 4E74A 1EU3A 1K8RB 2ASQA 2WHIA 2DNFA 4TV3A 2X38A 2L00B 3SEBA 2Y5CA 2Y5BB 1FNVA 2JXTA 4DDID 1V80A 1HZ6A 4KGSA 4RF1A 1SE3A 2RMMA 4X57B 4F8CB 2FNJB 2BKRB 2KJ6A 2WXRA 1P1AA 4MSQB 1XLNA 4BKGA 3CSTA 1VRAB 2G1EA 2KWCA 4K3BA 2LJIA 1IGDA 3EA6A 5IKCM 1WYWB 4ARCA 3Q8CA 2HE7A 4HK2A 2GBJA 3H6NA 1WIAA 2K8CA 3DBRB 1YN4A 3N1YC 3A4SC 2C60A 1UWMA 2JWUA 4LNOA 1C79A 1U4AA 2N9EB 2MJEA 4NQKE 2JYEA 2KK8A 2W3SA 2LXAA 3MC8A 3LYYA 3H9DA 4MELA 4MGYE 1VDVA 5FR3A 2PTLA 1I4HA 4ACFA 3E56A 4LK0M 2LMCA 2KYWA 5EDSA 1PGBA 2FUG1 1UBQA 2NBVB 4GIVA 1HA5A 2WDTB 2RSUA 2FBWB 2W9NA 2M0AA 4EEWA 4K7SA 3T3OA 4AOFA 4H2AA 3N3KB 1T0SC 1ZXHA 2DYMA 1AW7A 2KDMA 3TBLD 2EKIA 3TEYA 2BS2B 3MHSD 3GS2A 3GZNI 4ZRKA 4MGZE 1F77A 2WXNA 2BYVE 3RNAC 4ICVA 1T3QA 1YOVB 3A33B 1DYQA 2J7QB 3VRBB 4KGRA 4KSKC 4G50A 2K9XA 2KKCA 4WQMA 2KJRA 1QQRA 4HROA 1D5ZC 4WH4A 3W5VB 4YSYB 5C23A 2ACZB 1V97A 3W9CB 3Q3NC 3IHPC 3CIRB 1WGGA 4BKTA 3AE6B 2GLSA 1NEKB 3NVYA 1I7HA 2IPKD 2N7JA 3NJTA 2LGSA 3ZTCA 4BOZB 2EELA 4KSLC 3AE8B 2L83A 5E6PA 2AQ1B 2BB6A 1RM6C 1H8CA 4RGTA 5BMGA 3M3JA 2BF8B 4FULA 4P16A 2PVOD 4ITKA 1J7BA 1ZE3D 3AN1A 3P4PB 2ZCCA 1N5XA 3VVWB 2IDYA 1WH3A 1ZDVA 1L2NA 4OZAA 1IPGA 3R3MA 1GC7A 4W9GA 2EMTA 1WGKA 3HRDD 2SAKA 2WDVB 5G55A 1YJ1A 1NVID 4OVVA 2LGDA 4HWIB 2HD5B 2GRIA 3KW5B 3SD5A 1V9JA 1T0QC 1XLQA 2V3PA 1QF6A 3JSVA 1EWYC 4KDLB 5D94A 3TL5A 2I1JA 4HDQA 3PHXB 1E5WA 1UELA 1FD6A 5D7GA 1WFYA 4HVBA 2UWQA 2L0TA 2KHWB 4W9EA 4ANXA 2JWZA 1XCTL 1V5TA 2C7HA 3AB5A 4YT0B 4Q2JA 4FJYA 4PS7A 1ET6A 2J0JA 5CHWA 1RFKA 2LJ5A 3IFWB 1ZP0B 1J8CA 2KFKA 1V1PB 1WGRA 1KLGD 3ZGZA 4ARIA 3PPAA 2KO3A 2DYBA 2CU1A 1XEEA 1L0VB 1OQQA 2DBYA 3ML9A 3HUIA 3VHTC 2J42A 2GBNA 1J19A 1A5RA 1FCLA 2D07B 4A6QA 1BUIC 2WXOA 3BZDB 5AUKA 1LQBA 4KGTA 3WAOA 2JUOA 4EZLA 4K3CA 4DQOC 4I6LB 2INPE 4GDLB 4II2B 1R7SA 2JYTA 1WM3A 4IDIA 1WJUA 4PS8A 2GMIC 5JHAA 5JHBA 1I4RA 1MHXA 2R61A 4L2YA 1E7VA 1L0YB 2R2OA 4CYEA 3P4SB 1FMAD 4YTPB 2O6VA 1P7EA 2KDBA 3WIMA 3U2SC 1X1MA 3N1XC 3JVZX 2ZPNA 1WZ3A 1HTQA 5IOIA 4I6NB 3RI7C 3ZJTA 4PYUA 2J53A 5BYQA 3CF6E 3ZKJC 2NPTA 4M0WB 2WXJA 4RMAA 2IO0B 4TSSA 1VZ7A 5JXVA 3RNCC 4LJOB 3LJ3A 3VAWA 5LXIB 3PGEA 1UUPA 2GI9A 3PTFC 2BYTA 3AXCA 3I63C 1N61A 1H4RA 2INCC 3TEXA 3AE5B 2MX2A 4WWNA 3B2FA 1WE6A 3U4EG 4WWMA 1C78A 3NOBA 1RWSA 3V61A 1GC6A 3I3TB 3LDZE 1KM7A 2ZW0A 3KUDB 1TBEA 1HTOA 2V0GA 1E8ZA 3PV1A 4HDOA 3BYTB 3VXWA 1JWAD 4PT5A 2WX0A 5D2MB 4DXFA 2NVUI 3TIXA 3B1LX 4XYCA 4W9IA 2CKHB 3GOEA 3PRPB 2YEPB 5J17A 3R2TA 2DZKA 1V5OA 4KKIA 2BWFA 3A4RA 1I42A 4XGAB 3IG3A 1WX8A 1PGAA 1BXTA 3UQBA 4TQ0A 1SJHD 3O65B 4REZA 4C80A 1J7AA 5AUIA 3IT4B 2LD9A 1FFVA 2K22A 3LB8C 1I4QA 2IGGA 4FADA 3NS1A 3T3NA 1IP9A 3V6CB 2MSED 2L0FA 2O6VD 3URYA 1IUEA 4EZKA 3APFA 2WXHA 3OJ4B 3Q8AA 1WXQA 5E6JA 5KHQA 1OGWA 2ZPYA 3VH4B 1WYGA 4YSZB 4MEMA 4DHZB 2CHWA 2N4FA 1KH0A 1E7UA 2WXLA 2LRUA 1WE7A 4IUMB 2KFJA 3NS8A 1IYFA 2LVPA 2IJ0A 5IN7A 3D32A 1NDDA 3TSSA 2W54A 1EO6A 2KC1A 3QQ8B 4P7IA 4QAYA 3NHEB 2I1KA 3APDA 4USAA 4PK1A 1T5XD 1YJIA 4BFRA 2KMAA 3FILA 3WAPA 2KJHB 3NG0A 2IO3B 3X0WA 4TQ1A 2K0PA 5BMHA 2AL3A 1SEBD 3OAWA 5AEKB 1GB1A 2BS4B 4IG7B 1C76A 3QARA 4M8NA 5EE9A 1PFDA 1K50A 1XO3A 3ZDMC 2M1MA 4GGQA 2FE8A 4A9AA 4OVUA 1GB4A 3AH7A 1JROA 2D3AA 1OTRB 2V9HA 3VR9B 5BMIA 3V6EB 3DWGC 1NBFC 2L8JA 3A9JA 4MDKE 2N0SB 2ZNVC 4ZDVA 3DVNV 3AE1B 5C3JB 2LFIA 2Z0DB 2QHOA 4C7ZA 4KIKA 3PO0A 2MCNB 3SHQA 4NQLB 2Y3AA 4PS3A 3DOWA 4XWTA 1QILA 1SGHA 2RDHA 3PZDA 1C4AA 3OG5A 3ZNID 2N9KA 2I38A 2OJRA 1I4PA 4MM3B 1TY0A 1N6ZA 1ISNA 1AN8A 1L6VA 3VTWA 1HEZE 3DPDA 3I57A 2PE6B 4GN1A 3Q69A 1YJJA 4C4VA 3AEBB 1FNWA 4MM3A 1V2YA 1CQVA 2A4ZA 4IW0A 3HK0A 1QT9A 4M00A 1M94A 1G6JA 4FN2A 1IGCA 2C5LC 2L52A 3AE9B 3KYCD 2BB5A 2WXPA 1FRRA 3AEDB 1TS2A 1KOTA 3ZUNA 3AU4A 1C4PA 3MC0B 4ZRQA 3QX1A 2IY1B 4US8A 2LUMA 4JWUC 4LNKA 5BO4B 4MGIE 2INDC 2KAJA 3VUYA 3KWVA 4XWWA 4HLEA 1J0GA 3Q2AC 1MG8A 3EFCA 4DHJB 1KLUD 2Y5PA 3B9JA 1ZDXA 3Q3JA 1YQ3B 2C7MB 4GOCA 3QA8A 1QOFA 5G5GA 4TMAB 2L05A 5AZHA 2V3SA 1EF1A 4YXDB 1R4MB 4LDTB 3C8YA 2KDEB 3OLMD 5AZFA 3QJZA 1WXSA 5I4DA 2ZW1A 3DBLI 3ETRA 4AQ7A 3UIPB 4GMVA 2JY6A 1JQ4A 4A90A 2XBBC 5EE3A 4PYZA 4W9KA
chains in the Genus database with same CATH topology
3MJWA 3HIZA 2RR9A 2DZJA 2CU1A 2V1YA 3R66C 3PRMB 4KZ0A 3C0RB 1UGMA 1WGYA 4GB9A 2MQJA 3ML9A 3RYTA 3NZSA 1GNUA 1XT9B 4FBJB 2CHXA 2GOWA 3VHTC 4EUTA 2AYOB 2M4NA 2K6QA 2JT4B 2WX1A 3VUXA 2GBNA 1J19A 4B9KA 5D6JB 5IAAC 2G4SA 3UGBB 1A5RA 1Q0WB 2D11A 2JPHA 3ZRFA 1XQQA 2KDIA 3EHVA 2D07B 4ANUA 4II3B 4ASWC 2BGFA 3HM3A 4MJSB 2ZVNA 3H7PA 1RFAA 4K7UA 1R4MI 1RLFA 1UH6A 3AI5A 2LUEA 4W9CA 1LQBA 3IVFA 3WAOA 3EFUA 3H1UA 2FCMA 2JUOA 4IM3A 4EZLA 5JZEB 2K1FA 5DCNA 3BINA 3M95A 2L7RA 3QC8B 4I6LB 4NJ7A 2DYOA 3UF8A 3Q3FA 1V6EA 2HTHA 2PJHA 4GDLB 4II2B 2RD0A 3JW0X 1F9JA 1WM3A 2YLMA 3R7RA 2LZ6A 1ZGUB 3ZLZA 1WJUA 4EOYA 4PS8A 4XX5A 3SU8X 1TGZB 2GMIC 4MGKE 4NAWA 4BVUC 5JHAA 1GJZA 3T9LA 2N9XA 3PLVA 1V86A 3AULA 3L17A 4TUUA 5J2RA 2AWTA 3IBEA 2FCQA 4BOSC 1YD8U 2V4LA 2DZMA 2N9PC 2B3AA 4FLHA 3RULA 3WANA 2NBUA 2NS5A 2XK5B 5JHBA 3OJ3A 1LFDA 3PS6A 3WAMA 3SDLC 4BKSA 1WR6E 4HJKA 5C1ZA 5CTRC 3P2BA 2WYQA 4JGHB 5GMVA 1E7VA 2OOBB 4WWPA 3KUZA 2KTRB 2KZRA 3L16A 4FHJA 2O2VA 2R2OA 4CYEA 4NJ6A 3DCGA 2O6VA 5DPWA 2MRPA 3A9KB 1Z5SB 2KDBA 3PVLA 3PRZA 2LVQA 3WIMA 1X1MA 3K9PB 2IYDB 3B08A 2KVRA 4FA6A 1NI2A 2N1VA 3APCA 3KH0A 3JVZX 2ZPNA 1V49A 1WZ3A 2G45B 3HM6X 2GBRA 2MP2B 1P9DU 4I6NB 2HJ8A 3ZO5B 3KYDD 4PYUA 3W1SA 3UINB 1R4NI 1WX9A 3CF6E 4TKNA 3L0WB 2MWSB 4LJPB 3ZNGC 3ZKJC 2NPTA 4M0WB 4W9HA 4GU2A 5DPTA 3VUWA 4RMAA 5FR6A 2IO0B 1ZW7A 4DHJD 3QK0A 3CSFA 4GDKB 2KX3A 5CHVC 2RPQA 4CHKA 3W1YA 1TZ1A 3PSEB 4KVGB 4LJOB 3LJ3A 2M8SA 3RZFA 2JZZA 3VAWA 5LXIB 2REXA 3PGEA 3PTFC 4HPLB 3AXCA 2M17A 4JL9A 2DENB 1SIFA 1H4RA 2JRIB 2Z0EB 4URKA 1YIWA 3EC8A 1WX7A 4DK5A 2MX2A 2PEAA 3VTUA 3KUCB 2FCSA 3T8MA 2UYZB 2IZVB 4FJVB 1GG3A 4WWNA 1WE6A 4IWQA 2KWUB 1UZXB 3NZUA 3A9JB 2G3QB 3NOBA 1E8XA 4F1SA 2N7DA 4WJPA 3V61A 1GC6A 1WGHA 3I3TB 2FAZA 3LDZE 1KM7A 2KX0A 1WMHB 4KIKB 1WXAA 4G11A 3KUDB 1TBEA 2AEHA 3X23A 3S2AA 1EUVB 3TJPA 3RT3B 1E8ZA 3PV1A 4HDOA 3QWZB 2KOXA 2JXXA 3RUIB 3VXWA 2KANA 3PLUA 4MSMB 5CHFA 2WX0A 3A1QB 5D2MB 4G0NB 2NVUI 1YX6B 3DBHI 4FHKA 3TIXA 1T0YA 4A3OA 2LWPA 3B1LX 4DXAB 1EF5A 3ZW3A 2BWES 4W9IA 2XEWA 3ZDTA 2AL6A 1E90A 5LLIA 4W9LA 1OQYA 2CKHB 2CR5A 2MA9B 2MBQA 3GOEA 3PRPB 4WJOA 5J17A 4DDGD 2DZKA 1V5OA 4LCDE 1QZEA 2BWFA 3A4RA 1I42A 3L08A 2KWVB 3IG3A 5TR5A 2WWZA 5E6NA 2BKFA 1WJ6A 1WX8A 1VD2A 2M0XA 5DPSA 2NR2A 4M8MA 2KC2A 3DDCB 2LRWA 2D10A 1PQSA 3UQBA 2NBWB 4TQ0A 2C7NB 2JF5A 2LI5A 3O65B 4HCNB 4XZ4A 1Y8RC 2MBBB 4DBGA 4MJSA 5L83A 4NPNA 4G3XB 1JRUA 3DBSA 3DVNU 1Q1OA 2ZVOA 5DPRA 4BBNF 1WM2A 2NCNA 3VQIA 3ZTDA 4W9DA 2LD9A 2DAFA 4BKSD 4ZRIA 2EKEC 1V81A 2KLCA 2ZZPB 3U8ZA 3VDZA 1WI0A 2L3ZA 4J6IA 4EFOA 1WJNA 4FADA 1IP9A 1WZ0A 3V6CB 2MSED 4GDLA 2IBIB 3ZIMA 4GXBA 2L0FA 5J18A 2O6VD 1S3SG 4GSWA 4E74A 3M63B 1K8RB 2ASQA 2MBEA 3RCZA 4I6PA 4TV3A 2L00B 3DQVA 4EZKA 2Y5BB 3U30A 3APFA 3L13A 3OJ4B 4DDID 4K7WA 1V80A 5KHQA 1OGWA 4AUQC 2ZPYA 3VFKA 3VH4B 4X57B 4F8CB 2FNJB 2BKRB 4NY0A 3ZNHB 4MEMA 4DHZB 2CHWA 2N4FA 2KJ6A 1P1AA 1E7UA 3DVGX 4MSQB 4BKGA 2XK5A 3QHTA 3CSTA 1XD3B 2A5UA 2PPHA 2KWCA 2LRUA 3N32A 1WE7A 4IUMB 2KFJA 3NS8A 1WYWB 2LVPA 1IYFA 1KLVA 1TTNA 2IY0B 3D32A 5IA7A 1NDDA 2KTRA 3JSVB 2HE7A 4HK2A 2GBJA 3WALA 3H6NA 4KDIC 1WIAA 1EO6A 2K8CA 2KC1A 2KLGA 3A9KA 4MH0E 1WF9A 3B0AA 3PT2B 4K81A 3QQ8B 5AZGA 3A4SC 4P7IA 2C60A 1U4AA 3NHEB 2N9EB 4NQKE 2KN5A 2LVOA 2I1KA 1VCBA 3APDA 1P0RA 4KZCA 2MP2A 2KK8A 2KQ7A 2LXAA 2MBOA 4BFRA 2VRRB 4HXDA 2KMAA 3H9DA 4MELA 4WWOA 4MGYE 3WAPA 4AJWA 4E71A 4ICUA 2KJHB 4N9F4 2IO3B 3VTVA 3X0WA 4IWPA 1LM8B 4TQ1A 3RD2A 3ZRCA 1HE8A 4JIOU 2KXJA 2G4DB 2EMSA 2FCNA 4GDKA 2AL3A 1OEYJ 4F7ZA 4DHZE 3OAWA 4LDTD 5EDSA 4IWOA 5AEKB 1I35A 2KFKB 4IG7B 1WRDB 2BPSA 4ANWA 3QARA 2FIFA 4M8NA 4W9FA 1RRBA 3ZDMC 2M1MA 1UBQA 2NBVB 4GGQA 4GIVA 4K1RB 2WDTB 5CX3A 5HKHA 1WY8A 4OVUA 2RSUA 2K8HA 4HPMB 4JLCA 3TCAA 2W9NA 3DBRI 1OTRB 4W9JA 2N7EA 3U7DA 2FIDA 4EEWA 4K7SA 2C9WB 3V6EB 4AOFA 5JH5C 1NBFC 1YX5B 2L8JA 3N3KB 4YL8A 4DWFA 2DYMA 2N1WA 3A9JA 4MDKE 3TBLD 4AP4C 5G2NA 2ZNVC 4ZDVA 3DVNV 3MHSD 5E6OA 3NY5A 3GZNI 4ZRKA 4ZYNA 2DAJA 2Z0DB 4MGZE 3UIOB 3EECA 2QHOA 1RAXA 1WMHA 2BYVE 2GBMA 2LGYA 3HHMA 3L10B 4KIKA 4RM8A 2MCNB 2K6DB 3SHQA 4NQLB 3H7PB 4AJYB 4B95A 4ICVA 4PS3A 3A33B 2K8BA 3DOWA 4ZRJA 2J7QB 2J0KA 2DZIA 1SGHA 3A1QA 3JYUA 1CMXB 4KSKC 3QIJA 3ALBA 4G50A 3PZDA 1GUAB 3ZNID 2KKCA 3MTNB 1BT0A 1UBIA 4IM0A 2OJRA 2ZNVB 3BY4B 2MBHA 2KJRA 1ISNA 2FUHB 5C23A 3VTWA 3ZVVA 3DPDA 4NAWB 4JQWC 1FXTB 2PE6B 4GN1A 3IHPC 1WGGA 4AWJA 4BKTA 4NNJB 1YQBA 1P3QU 1E8YA 5L95C 4IM2A 3CMMB 4HCPB 3W1SC 4MM3A 3ZTCA 4BOZB 1V2YA 2KMCA 3RZWC 2A4ZA 2BYEA 4IW0A 4KSLC 3DVGY 5E6PA 3HK0A 2KTFA 1AARA 2KNBA 1M94A 2Z59B 4FJZA 1G6JA 4FN2A 2O2VB 2KQSA 2ZJDA 3PHWB 1H8CA 2O6VB 2C5LC 1P98A 2ZEQA 1WXVA 2BF8B 3KYCD 3M3JA 4WJNA 4FULA 3PREA 4A3PA 2ZCCA 1LXDA 2RGFA 3V62A 3VVWB 1KOTA 1WH3A 1UD7A 3ZUNA 1L2NA 3AU5A 3AU4A 1WGDA 1IPGA 4WAAA 3R3MA 2PE9A 1GC7A 1WR1A 4W9GA 3WA0A 3QX1A 4EZJA 2EMTA 3H7SA 3ZNZB 2NPTB 2DX5B 4EKUA 2IY1B 2IO2B 3UQAA 3ONSA 1L7YA 2D3GA 2JRHA 1ZKHA 1WXMA 5BO4B 3L54A 4MGIE 5G55A 1YJ1A 3N30A 2BYFA 4OVVA 2L76A 2KDFB 2LGDA 2HD5B 3M62B 2JVCA 4HWIB 4RM9A 4WJQA 4B6WA 2D2QA 4KV2A 3VUYA 3KW5B 3SD5A 2YVCA 1V9JA 3ECIA 5KHOA 2R2QA 1Q5WB 4HLEA 1J0GA 3ENEA 1E8WA 3JSVA 1MG8A 2LXCA 4KDLB 5D94A 1Z2MA 4DHJB 3TL5A 2I1JA 4HDQA 2MW5A 3KVFB 3Q3JA 2KD0A 2LGXA 2MLBA 3PHXB 4A20A 1C1YB 1E5WA 1UELA 2C7MB 5D7GA 4GOCA 1WFYA 3QA8A 3VH3B 4E3CA 4HVBA 2UWQA 2ZCBA 4XC2A 2L0TA 2JZ3B 2KHWB 2L05A 3QAQA 5AZHA 3V60A 3ML8A 2V3SA 4W9EA 1EF1A 4ANXA 2JWZA 1OEYA 2K39A 1V5TA 2C7HA 2DHZA 1S1QB 2K25A 4WQOB 4FJYA 4PS7A 4LDTB 2KDEB 2GBKA 2J0MA 3QCAA 1WJ4A 2J0JA 2CHZA 3OLMD 5CHWA 4CO7A 5AZFA 1C3TA 1D3ZA 3QJZA 2LJ5A 1WXSA 3IFWB 1KJTA 2LASA 3DBLI 3K9OB 1J8CA 2KFKA 3TMPB 1WGRA 2CS4A 2IO1B 3UIPB 4GMVA 2JY6A 4IC7B 3PPAA 4BBNC 5LXHA 2KO3A 1SE9A 2DYBA 2XBBC 4ANVA 3R7QA 4PYZA 4W9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJW A;  3HIZ A;  2RR9 A;  2DZJ A;  2CU1 A;  2V1Y A;  3R66 C;  3PRM B;  4KZ0 A;  3C0R B;  1UGM A;  1WGY A;  4GB9 A;  2MQJ A;  3ML9 A;  3RYT A;  3NZS A;  1GNU A;  1XT9 B;  4FBJ B;  2CHX A;  2GOW A;  3VHT C;  4EUT A;  2AYO B;  2M4N A;  2K6Q A;  2JT4 B;  2WX1 A;  3VUX A;  2GBN A;  1J19 A;  4B9K A;  5D6J B;  5IAA C;  2G4S A;  3UGB B;  1A5R A;  1Q0W B;  2D11 A;  2JPH A;  3ZRF A;  1XQQ A;  2KDI A;  3EHV A;  2D07 B;  4ANU A;  4II3 B;  4ASW C;  2BGF A;  3HM3 A;  4MJS B;  2ZVN A;  3H7P A;  1RFA A;  4K7U A;  1R4M I;  1RLF A;  1UH6 A;  3AI5 A;  2LUE A;  4W9C A;  1LQB A;  3IVF A;  3WAO A;  3EFU A;  3H1U A;  2FCM A;  2JUO A;  4IM3 A;  4EZL A;  5JZE B;  2K1F A;  5DCN A;  3BIN A;  3M95 A;  2L7R A;  3QC8 B;  4I6L B;  4NJ7 A;  2DYO A;  3UF8 A;  3Q3F A;  1V6E A;  2HTH A;  2PJH A;  4GDL B;  4II2 B;  2RD0 A;  3JW0 X;  1F9J A;  1WM3 A;  2YLM A;  3R7R A;  2LZ6 A;  1ZGU B;  3ZLZ A;  1WJU A;  4EOY A;  4PS8 A;  4XX5 A;  3SU8 X;  1TGZ B;  2GMI C;  4MGK E;  4NAW A;  4BVU C;  5JHA A;  1GJZ A;  3T9L A;  2N9X A;  3PLV A;  1V86 A;  3AUL A;  3L17 A;  4TUU A;  5J2R A;  2AWT A;  3IBE A;  2FCQ A;  4BOS C;  1YD8 U;  2V4L A;  2DZM A;  2N9P C;  2B3A A;  4FLH A;  3RUL A;  3WAN A;  2NBU A;  2NS5 A;  2XK5 B;  5JHB A;  3OJ3 A;  1LFD A;  3PS6 A;  3WAM A;  3SDL C;  4BKS A;  1WR6 E;  4HJK A;  5C1Z A;  5CTR C;  3P2B A;  2WYQ A;  4JGH B;  5GMV A;  1E7V A;  2OOB B;  4WWP A;  3KUZ A;  2KTR B;  2KZR A;  3L16 A;  4FHJ A;  2O2V A;  2R2O A;  4CYE A;  4NJ6 A;  3DCG A;  2O6V A;  5DPW A;  2MRP A;  3A9K B;  1Z5S B;  2KDB A;  3PVL A;  3PRZ A;  2LVQ A;  3WIM A;  1X1M A;  3K9P B;  2IYD B;  3B08 A;  2KVR A;  4FA6 A;  1NI2 A;  2N1V A;  3APC A;  3KH0 A;  3JVZ X;  2ZPN A;  1V49 A;  1WZ3 A;  2G45 B;  3HM6 X;  2GBR A;  2MP2 B;  1P9D U;  4I6N B;  2HJ8 A;  3ZO5 B;  3KYD D;  4PYU A;  3W1S A;  3UIN B;  1R4N I;  1WX9 A;  3CF6 E;  4TKN A;  3L0W B;  2MWS B;  4LJP B;  3ZNG C;  3ZKJ C;  2NPT A;  4M0W B;  4W9H A;  4GU2 A;  5DPT A;  3VUW A;  4RMA A;  5FR6 A;  2IO0 B;  1ZW7 A;  4DHJ D;  3QK0 A;  3CSF A;  4GDK B;  2KX3 A;  5CHV C;  2RPQ A;  4CHK A;  3W1Y A;  1TZ1 A;  3PSE B;  4KVG B;  4LJO B;  3LJ3 A;  2M8S A;  3RZF A;  2JZZ A;  3VAW A;  5LXI B;  2REX A;  3PGE A;  3PTF C;  4HPL B;  3AXC A;  2M17 A;  4JL9 A;  2DEN B;  1SIF A;  1H4R A;  2JRI B;  2Z0E B;  4URK A;  1YIW A;  3EC8 A;  1WX7 A;  4DK5 A;  2MX2 A;  2PEA A;  3VTU A;  3KUC B;  2FCS A;  3T8M A;  2UYZ B;  2IZV B;  4FJV B;  1GG3 A;  4WWN A;  1WE6 A;  4IWQ A;  2KWU B;  1UZX B;  3NZU A;  3A9J B;  2G3Q B;  3NOB A;  1E8X A;  4F1S A;  2N7D A;  4WJP A;  3V61 A;  1GC6 A;  1WGH A;  3I3T B;  2FAZ A;  3LDZ E;  1KM7 A;  2KX0 A;  1WMH B;  4KIK B;  1WXA A;  4G11 A;  3KUD B;  1TBE A;  2AEH A;  3X23 A;  3S2A A;  1EUV B;  3TJP A;  3RT3 B;  1E8Z A;  3PV1 A;  4HDO A;  3QWZ B;  2KOX A;  2JXX A;  3RUI B;  3VXW A;  2KAN A;  3PLU A;  4MSM B;  5CHF A;  2WX0 A;  3A1Q B;  5D2M B;  4G0N B;  2NVU I;  1YX6 B;  3DBH I;  4FHK A;  3TIX A;  1T0Y A;  4A3O A;  2LWP A;  3B1L X;  4DXA B;  1EF5 A;  3ZW3 A;  2BWE S;  4W9I A;  2XEW A;  3ZDT A;  2AL6 A;  1E90 A;  5LLI A;  4W9L A;  1OQY A;  2CKH B;  2CR5 A;  2MA9 B;  2MBQ A;  3GOE A;  3PRP B;  4WJO A;  5J17 A;  4DDG D;  2DZK A;  1V5O A;  4LCD E;  1QZE A;  2BWF A;  3A4R A;  1I42 A;  3L08 A;  2KWV B;  3IG3 A;  5TR5 A;  2WWZ A;  5E6N A;  2BKF A;  1WJ6 A;  1WX8 A;  1VD2 A;  2M0X A;  5DPS A;  2NR2 A;  4M8M A;  2KC2 A;  3DDC B;  2LRW A;  2D10 A;  1PQS A;  3UQB A;  2NBW B;  4TQ0 A;  2C7N B;  2JF5 A;  2LI5 A;  3O65 B;  4HCN B;  4XZ4 A;  1Y8R C;  2MBB B;  4DBG A;  4MJS A;  5L83 A;  4NPN A;  4G3X B;  1JRU A;  3DBS A;  3DVN U;  1Q1O A;  2ZVO A;  5DPR A;  4BBN F;  1WM2 A;  2NCN A;  3VQI A;  3ZTD A;  4W9D A;  2LD9 A;  2DAF A;  4BKS D;  4ZRI A;  2EKE C;  1V81 A;  2KLC A;  2ZZP B;  3U8Z A;  3VDZ A;  1WI0 A;  2L3Z A;  4J6I A;  4EFO A;  1WJN A;  4FAD A;  1IP9 A;  1WZ0 A;  3V6C B;  2MSE D;  4GDL A;  2IBI B;  3ZIM A;  4GXB A;  2L0F A;  5J18 A;  2O6V D;  1S3S G;  4GSW A;  4E74 A;  3M63 B;  1K8R B;  2ASQ A;  2MBE A;  3RCZ A;  4I6P A;  4TV3 A;  2L00 B;  3DQV A;  4EZK A;  2Y5B B;  3U30 A;  3APF A;  3L13 A;  3OJ4 B;  4DDI D;  4K7W A;  1V80 A;  5KHQ A;  1OGW A;  4AUQ C;  2ZPY A;  3VFK A;  3VH4 B;  4X57 B;  4F8C B;  2FNJ B;  2BKR B;  4NY0 A;  3ZNH B;  4MEM A;  4DHZ B;  2CHW A;  2N4F A;  2KJ6 A;  1P1A A;  1E7U A;  3DVG X;  4MSQ B;  4BKG A;  2XK5 A;  3QHT A;  3CST A;  1XD3 B;  2A5U A;  2PPH A;  2KWC A;  2LRU A;  3N32 A;  1WE7 A;  4IUM B;  2KFJ A;  3NS8 A;  1WYW B;  2LVP A;  1IYF A;  1KLV A;  1TTN A;  2IY0 B;  3D32 A;  5IA7 A;  1NDD A;  2KTR A;  3JSV B;  2HE7 A;  4HK2 A;  2GBJ A;  3WAL A;  3H6N A;  4KDI C;  1WIA A;  1EO6 A;  2K8C A;  2KC1 A;  2KLG A;  3A9K A;  4MH0 E;  1WF9 A;  3B0A A;  3PT2 B;  4K81 A;  3QQ8 B;  5AZG A;  3A4S C;  4P7I A;  2C60 A;  1U4A A;  3NHE B;  2N9E B;  4NQK E;  2KN5 A;  2LVO A;  2I1K A;  1VCB A;  3APD A;  1P0R A;  4KZC A;  2MP2 A;  2KK8 A;  2KQ7 A;  2LXA A;  2MBO A;  4BFR A;  2VRR B;  4HXD A;  2KMA A;  3H9D A;  4MEL A;  4WWO A;  4MGY E;  3WAP A;  4AJW A;  4E71 A;  4ICU A;  2KJH B;  4N9F 4;  2IO3 B;  3VTV A;  3X0W A;  4IWP A;  1LM8 B;  4TQ1 A;  3RD2 A;  3ZRC A;  1HE8 A;  4JIO U;  2KXJ A;  2G4D B;  2EMS A;  2FCN A;  4GDK A;  2AL3 A;  1OEY J;  4F7Z A;  4DHZ E;  3OAW A;  4LDT D;  5EDS A;  4IWO A;  5AEK B;  1I35 A;  2KFK B;  4IG7 B;  1WRD B;  2BPS A;  4ANW A;  3QAR A;  2FIF A;  4M8N A;  4W9F A;  1RRB A;  3ZDM C;  2M1M A;  1UBQ A;  2NBV B;  4GGQ A;  4GIV A;  4K1R B;  2WDT B;  5CX3 A;  5HKH A;  1WY8 A;  4OVU A;  2RSU A;  2K8H A;  4HPM B;  4JLC A;  3TCA A;  2W9N A;  3DBR I;  1OTR B;  4W9J A;  2N7E A;  3U7D A;  2FID A;  4EEW A;  4K7S A;  2C9W B;  3V6E B;  4AOF A;  5JH5 C;  1NBF C;  1YX5 B;  2L8J A;  3N3K B;  4YL8 A;  4DWF A;  2DYM A;  2N1W A;  3A9J A;  4MDK E;  3TBL D;  4AP4 C;  5G2N A;  2ZNV C;  4ZDV A;  3DVN V;  3MHS D;  5E6O A;  3NY5 A;  3GZN I;  4ZRK A;  4ZYN A;  2DAJ A;  2Z0D B;  4MGZ E;  3UIO B;  3EEC A;  2QHO A;  1RAX A;  1WMH A;  2BYV E;  2GBM A;  2LGY A;  3HHM A;  3L10 B;  4KIK A;  4RM8 A;  2MCN B;  2K6D B;  3SHQ A;  4NQL B;  3H7P B;  4AJY B;  4B95 A;  4ICV A;  4PS3 A;  3A33 B;  2K8B A;  3DOW A;  4ZRJ A;  2J7Q B;  2J0K A;  2DZI A;  1SGH A;  3A1Q A;  3JYU A;  1CMX B;  4KSK C;  3QIJ A;  3ALB A;  4G50 A;  3PZD A;  1GUA B;  3ZNI D;  2KKC A;  3MTN B;  1BT0 A;  1UBI A;  4IM0 A;  2OJR A;  2ZNV B;  3BY4 B;  2MBH A;  2KJR A;  1ISN A;  2FUH B;  5C23 A;  3VTW A;  3ZVV A;  3DPD A;  4NAW B;  4JQW C;  1FXT B;  2PE6 B;  4GN1 A;  3IHP C;  1WGG A;  4AWJ A;  4BKT A;  4NNJ B;  1YQB A;  1P3Q U;  1E8Y A;  5L95 C;  4IM2 A;  3CMM B;  4HCP B;  3W1S C;  4MM3 A;  3ZTC A;  4BOZ B;  1V2Y A;  2KMC A;  3RZW C;  2A4Z A;  2BYE A;  4IW0 A;  4KSL C;  3DVG Y;  5E6P A;  3HK0 A;  2KTF A;  1AAR A;  2KNB A;  1M94 A;  2Z59 B;  4FJZ A;  1G6J A;  4FN2 A;  2O2V B;  2KQS A;  2ZJD A;  3PHW B;  1H8C A;  2O6V B;  2C5L C;  1P98 A;  2ZEQ A;  1WXV A;  2BF8 B;  3KYC D;  3M3J A;  4WJN A;  4FUL A;  3PRE A;  4A3P A;  2ZCC A;  1LXD A;  2RGF A;  3V62 A;  3VVW B;  1KOT A;  1WH3 A;  1UD7 A;  3ZUN A;  1L2N A;  3AU5 A;  3AU4 A;  1WGD A;  1IPG A;  4WAA A;  3R3M A;  2PE9 A;  1GC7 A;  1WR1 A;  4W9G A;  3WA0 A;  3QX1 A;  4EZJ A;  2EMT A;  3H7S A;  3ZNZ B;  2NPT B;  2DX5 B;  4EKU A;  2IY1 B;  2IO2 B;  3UQA A;  3ONS A;  1L7Y A;  2D3G A;  2JRH A;  1ZKH A;  1WXM A;  5BO4 B;  3L54 A;  4MGI E;  5G55 A;  1YJ1 A;  3N30 A;  2BYF A;  4OVV A;  2L76 A;  2KDF B;  2LGD A;  2HD5 B;  3M62 B;  2JVC A;  4HWI B;  4RM9 A;  4WJQ A;  4B6W A;  2D2Q A;  4KV2 A;  3VUY A;  3KW5 B;  3SD5 A;  2YVC A;  1V9J A;  3ECI A;  5KHO A;  2R2Q A;  1Q5W B;  4HLE A;  1J0G A;  3ENE A;  1E8W A;  3JSV A;  1MG8 A;  2LXC A;  4KDL B;  5D94 A;  1Z2M A;  4DHJ B;  3TL5 A;  2I1J A;  4HDQ A;  2MW5 A;  3KVF B;  3Q3J A;  2KD0 A;  2LGX A;  2MLB A;  3PHX B;  4A20 A;  1C1Y B;  1E5W A;  1UEL A;  2C7M B;  5D7G A;  4GOC A;  1WFY A;  3QA8 A;  3VH3 B;  4E3C A;  4HVB A;  2UWQ A;  2ZCB A;  4XC2 A;  2L0T A;  2JZ3 B;  2KHW B;  2L05 A;  3QAQ A;  5AZH A;  3V60 A;  3ML8 A;  2V3S A;  4W9E A;  1EF1 A;  4ANX A;  2JWZ A;  1OEY A;  2K39 A;  1V5T A;  2C7H A;  2DHZ A;  1S1Q B;  2K25 A;  4WQO B;  4FJY A;  4PS7 A;  4LDT B;  2KDE B;  2GBK A;  2J0M A;  3QCA A;  1WJ4 A;  2J0J A;  2CHZ A;  3OLM D;  5CHW A;  4CO7 A;  5AZF A;  1C3T A;  1D3Z A;  3QJZ A;  2LJ5 A;  1WXS A;  3IFW B;  1KJT A;  2LAS A;  3DBL I;  3K9O B;  1J8C A;  2KFK A;  3TMP B;  1WGR A;  2CS4 A;  2IO1 B;  3UIP B;  4GMV A;  2JY6 A;  4IC7 B;  3PPA A;  4BBN C;  5LXH A;  2KO3 A;  1SE9 A;  2DYB A;  2XBB C;  4ANV A;  3R7Q A;  4PYZ A;  4W9K A; 
#chains in the Genus database with same CATH topology
 1OFF A;  3PRM B;  2TSS A;  3C0R B;  3RNE C;  3RYT A;  1UF0 A;  2GOW A;  3Q14 C;  4M01 A;  1KF6 B;  2AYO B;  1ESF A;  2JT4 B;  2WX1 A;  5HHD G;  4P1C C;  1ROE A;  1Q0W B;  2D11 A;  3ZRF A;  3EHV A;  4ASW C;  3HM3 A;  4MJS B;  2J4X A;  1LO5 D;  2WGS A;  3EFU A;  3L4P A;  3SFE B;  3BIN A;  3UF8 A;  3BVZ A;  3Q3F A;  2HTH A;  2D5G A;  2RD0 A;  1TY2 A;  2LZ6 A;  1R4N B;  1YN5 A;  2CJO A;  4UDU C;  2M19 A;  1K53 A;  4XX5 A;  1TGZ B;  2N9L A;  2N9X A;  5EE1 A;  1YD8 U;  2XK5 B;  1F0Z A;  1D4B A;  1MPE A;  1N63 A;  3W2D A;  4BKS A;  3Q3O C;  5C1Z A;  3P2B A;  1MG4 A;  2WYQ A;  1V1O A;  1NYR A;  1KTK A;  2KTR B;  3TUO A;  3L16 A;  4KX6 B;  4NJ6 A;  3DCG A;  3RNG C;  5DPW A;  2MRP A;  2WP9 B;  3A9K B;  3ZXV A;  1Z5S B;  2WNM A;  4BZA A;  2D3C A;  2Q5W D;  2MP2 B;  4BAX A;  4C56 C;  1WX9 A;  3L0W B;  3ZNG C;  4W9H A;  2UU7 A;  4YTN B;  3UI3 A;  4GU2 A;  2BBC A;  4WAF A;  4DHJ D;  4GDK B;  2RPQ A;  1D6E C;  3NUH B;  2W82 A;  3DBH B;  3P4Q B;  1RYJ A;  1ET9 A;  3MJ5 A;  2M17 A;  2ONQ A;  3DHH C;  2JRI B;  2K3U A;  1B9R A;  1C77 A;  3OWE B;  2KQ4 X;  4IWQ A;  3NZU A;  3N20 C;  4F1S A;  2N7D A;  1WGH A;  1ACC A;  1XLO A;  1WMH B;  1PDX A;  2AEH A;  3X23 A;  3S2A A;  1EUV B;  4RGM A;  3RT3 B;  1V1P A;  3KQ4 A;  3RUI B;  3U7Z A;  5CHF A;  1TJE A;  3A1Q B;  2G9H D;  3LXF A;  1YX6 B;  5T8I A;  1TT5 B;  1T0Y A;  1UGJ A;  1EF5 A;  2BWE S;  2XEW A;  1E90 A;  1XLP A;  4WJO A;  2MHJ A;  3BK2 A;  1AWD A;  3RNB C;  3L08 A;  1UWX A;  5TR5 A;  2BKF A;  5DPS A;  2NR2 A;  3DDC B;  3R8B A;  2LRW A;  5FK9 C;  2NBW B;  2LI5 A;  2PMV A;  3KWL A;  4DBG A;  5L83 A;  4G3X B;  1JRU A;  3DBS A;  2ZVO A;  1T6B X;  4BKS D;  4ZRI A;  1V81 A;  2KLC A;  1WI0 A;  1N60 A;  1A70 A;  1WJN A;  1WZ0 A;  2QDF A;  2IBI B;  4GDL A;  2ON8 A;  5J18 A;  1E6E B;  1S3S G;  3M63 B;  1TZO A;  2VH2 A;  4I6P A;  1CJE A;  2NMQ A;  3U30 A;  3L13 A;  1XF5 L;  4LTU A;  2QIE B;  4NY0 A;  3ZNH B;  1WWT A;  3BWU D;  3DVG X;  5D3I B;  4AS1 A;  1NYQ A;  1XD3 B;  4B0E A;  2PPH A;  1LGR A;  3EGR A;  1FXI A;  1TTN A;  5IA7 A;  2L1A A;  3WAL A;  4KDI C;  3R2I A;  3BII D;  4MH0 E;  2KLG A;  2XN9 C;  1WF9 A;  4K81 A;  2V4I B;  2LVO A;  1TKG A;  1QKZ A;  2MBO A;  2VRR B;  1HQR D;  4M02 A;  4LLG M;  3GZN B;  4YSX B;  3NZ3 A;  4M0W A;  1IBX B;  1ZUD 2;  1LM8 B;  2KMM A;  3ZRC A;  1HE8 A;  2KXJ A;  2G4D B;  2EMS A;  4DHZ E;  4IWO A;  1I35 A;  5C2T B;  1TS4 A;  1WY8 A;  5HKH A;  2JZP A;  4HPM B;  4JLC A;  4J3O D;  1ENF A;  3TCA A;  2PW9 A;  3DBR I;  4W9J A;  2N7E A;  2FID A;  4RF0 A;  5JH5 C;  1YX5 B;  4YL8 A;  1F52 A;  4DWF A;  3V05 A;  2N1W A;  4AP4 C;  5G2N A;  5E6O A;  4ZYN A;  5GXG B;  2DAJ A;  1RAX A;  2LGY A;  2GBM A;  3HHM A;  2K6D B;  1JAL A;  2QMT A;  3H7P B;  3AE4 B;  1AYF A;  4ZRJ A;  2J0K A;  1N62 A;  3GE3 C;  2DZI A;  1I4G A;  3IAM 1;  1D5M C;  2WXQ A;  2MJD A;  3NVZ A;  3KLS X;  3PZ8 A;  2FUH B;  3AEG B;  4NAW B;  2GB1 A;  1FXT B;  4AWJ A;  1P3Q U;  1E8Y A;  2PKO A;  3NRZ A;  3ZQ4 A;  2MEK A;  2KMC A;  3DVG Y;  4L23 A;  1AAR A;  2Z59 B;  2O2V B;  2KQS A;  4XDC A;  1SE4 A;  1HXY D;  2WXG A;  1P98 A;  3AM9 A;  4HKZ E;  4WJN A;  4N58 A;  4A3P A;  1LXD A;  2RGF A;  3V62 A;  1UD7 A;  2D3B A;  1WGD A;  2PE9 A;  2M56 B;  3WA0 A;  4EZJ A;  3H7S A;  2VZK B;  4WIP A;  4MH8 A;  2MJ3 A;  2DX5 B;  2IO2 B;  3UQA A;  2AQ3 B;  1L7Y A;  3ONS A;  1ZKH A;  5EE0 A;  3NVW A;  3N30 A;  4RCO A;  1K51 A;  2JVC A;  4RM9 A;  4WJQ A;  4B6W A;  3ECI A;  3P42 A;  1E8W A;  2LXC A;  4L1B A;  3AE3 B;  2MW5 A;  3H8H A;  3KVF B;  1WRI A;  2KD0 A;  2LGX A;  2MLB A;  4OZC A;  3RMK C;  1C1Y B;  3FKY A;  4A20 A;  1F2R I;  2BS3 B;  3VH3 B;  4E3C A;  1D5X C;  4XC2 A;  2E3T A;  1JWS D;  1EU4 A;  3ML8 A;  1OEY A;  2DHZ A;  3C19 A;  1S1Q B;  3DWM A;  2GBK A;  2J0M A;  1WJ4 A;  1C3T A;  1D3Z A;  1KJT A;  2LAS A;  2WQY B;  4IOI E;  3RFZ B;  4S17 A;  4IC7 B;  3N1Z C;  3NVV A;  1PYW D;  1SE9 A;  1Q10 A;  3MJW A;  4RNA A;  3R66 C;  4KZ0 A;  4GLS C;  1UGM A;  1WGY A;  3ZXR A;  2AX5 A;  2K5P A;  3NZS A;  1XT9 B;  2CHX A;  4EUT A;  2K6Q A;  5D6J B;  2G4S A;  4LNI A;  1Y56 A;  2JQR B;  3V3X A;  4DXG A;  1FFU A;  2KDI A;  4ANU A;  4II3 B;  2BGF A;  1RFA A;  4K7U A;  1RLF A;  1UH6 A;  3AI5 A;  2LUE A;  1SXT A;  3ZYY X;  3H1U A;  3CWI A;  2FCM A;  3GP7 A;  5JZE B;  2K1F A;  5DCN A;  3M95 A;  3QC8 B;  1DOX A;  2DYO A;  1VZ6 A;  1F9J A;  1ZGU B;  4N59 A;  3ZLZ A;  4EOY A;  1GJZ A;  2I2Y A;  4BVU C;  4NZL B;  3T9L A;  1V86 A;  3L17 A;  2Z8L A;  3DHI C;  3IBE A;  2FCQ A;  2V4L A;  2DZM A;  2N9P C;  3RUL A;  3WAN A;  3OJ3 A;  5IP4 D;  3PS6 A;  3SDL C;  1WR6 E;  1YQ4 B;  5LNK 1;  4HKQ A;  4JGH B;  5GMV A;  2OOB B;  3KUZ A;  4FHJ A;  2KZR A;  1TKY A;  3B2G A;  4A8X C;  3PRZ A;  1QOB A;  2VZK D;  3AE7 B;  1NI2 A;  3KH0 A;  2MH7 A;  2NTT A;  1P9D U;  2HJ8 A;  3ZO5 B;  1TS3 A;  3W1S A;  3UIN B;  1ZOY B;  2MWS B;  3FAH A;  1QOA A;  5FR6 A;  2JSV X;  3QK0 A;  3CSF A;  4CHK A;  2IGH A;  3W1Y A;  3TEW A;  3PSE B;  4XE0 A;  2WXK A;  2M8S A;  2WDQ B;  3RZF A;  4ZHP A;  2REX A;  4HPL B;  3RNF C;  1MHH E;  4JL9 A;  1J7C A;  1FCC C;  2KVZ A;  2DEN B;  1SIF A;  4YWG G;  2AQ2 B;  1WX7 A;  4DK5 A;  4JPS A;  2PEA A;  2OJW A;  2FCS A;  3T8M A;  4P1B C;  2UYZ B;  2IZV B;  1C9F A;  4RFB A;  4FJV B;  1CZP A;  2XNA C;  2KWU B;  1UZX B;  1F1H A;  4ZYS A;  4B0M A;  2KX0 A;  4G11 A;  4RH6 A;  4A55 A;  1FEH A;  1FRD A;  2KOX A;  4NAM A;  3N9Y C;  1GOZ A;  3MFG A;  2JU6 X;  3ZDT A;  5LLI A;  4W9L A;  1SJE D;  2CR5 A;  2W3R A;  3AEC B;  4OVZ A;  4DDG D;  2RDB C;  2L32 A;  2KWV B;  1TS5 A;  2WWZ A;  5E6N A;  1GAQ B;  2M0X A;  2D10 A;  2ICI A;  1PQS A;  2JF5 A;  4HCN B;  4XZ4 A;  2DLB A;  1SBB B;  3AMZ A;  4MJS A;  4O1N A;  5DPR A;  2DWQ A;  3VQI A;  3GB1 A;  1FO4 A;  2DAF A;  2KT7 A;  2ZZP B;  3VDZ A;  2BW2 A;  2L3Z A;  3P4R B;  3ZIM A;  3IXS A;  4GXB A;  4GSW A;  2MBE A;  3RCZ A;  3WCQ A;  5G5H A;  1E0Z A;  3DQV A;  3EUB 2;  1L6U A;  4K7W A;  4XDD A;  4AUQ C;  4OZB A;  3VFK A;  1YNT E;  4HEA 1;  4C7Y A;  4MAC A;  2QEJ C;  5HFY A;  2XK5 A;  3QHT A;  2A5U A;  3N32 A;  1MVK A;  2IGD A;  5H8Y E;  4US9 A;  1KLV A;  2IY0 B;  1FPY A;  2W55 A;  2KTR A;  2QC8 A;  3IT6 B;  3JSV B;  1FXA A;  3AEA B;  3BK1 A;  3A9K A;  3B0A A;  3PT2 B;  5AZG A;  1DOY A;  3IAS 1;  2KN5 A;  1VZ8 A;  1VCB A;  2WXI A;  1FIQ A;  1P0R A;  3HVZ A;  2MP2 A;  2KQ7 A;  4KZC A;  1ZPS A;  1I4X A;  2H89 B;  4HXD A;  4WWO A;  4AJW A;  4E71 A;  4ICU A;  4N9F 4;  1KFY B;  3GE8 C;  1KRH A;  2WDR B;  3VTV A;  4IWP A;  1VR9 A;  3RD2 A;  3RN9 C;  4JIO U;  3FC4 A;  4GDK A;  2FCN A;  4F7Z A;  1OEY J;  4LDT D;  4NJC A;  2KFK B;  1HZ5 A;  1WRD B;  2BPS A;  2BTE A;  4ANW A;  2FIF A;  1T0R C;  4W9F A;  1RRB A;  1L4D B;  4K1R B;  5CX3 A;  2NTS A;  1XXG A;  4ZOH C;  1E9M A;  4S0R A;  2K8H A;  4KKJ A;  1PGX A;  3U7D A;  2QJL A;  2C9W B;  2CJN A;  2WLB A;  2RPV A;  2LHE A;  5H92 C;  3NY5 A;  3UIO B;  3EEC A;  2SEB D;  1WMH A;  3L10 B;  4RM8 A;  1NEN B;  4AJY B;  2OHF A;  4B95 A;  3PZ7 A;  2K8B A;  4ZHO A;  1STE A;  3JYU A;  3A1Q A;  1CMX B;  3AEE B;  3QIJ A;  3ALB A;  1GUA B;  3RPF C;  2HJ1 A;  3MTN B;  2B76 B;  1BT0 A;  1UBI A;  4IM0 A;  2ZNV B;  2PVG C;  3BY4 B;  2MBH A;  1JWM D;  2YEP F;  2V3N A;  3ZVV A;  1OQR A;  4JQW C;  1TYG B;  2LEK A;  4LNF A;  1E7P B;  5L95 C;  4NNJ B;  1YQB A;  1VLB A;  3Q8B A;  4IM2 A;  3CMM B;  4HCP B;  3W1S C;  3Q3M C;  2WS3 B;  3RZW C;  2BYE A;  3ZJU A;  4N6E B;  2KTF A;  2CU3 A;  2KNB A;  4FJZ A;  3P63 A;  1M4V A;  2ZJD A;  3PHW B;  2O6V B;  2ZEQ A;  1BML C;  1WXV A;  3PRE A;  1N5W A;  3AU5 A;  1GPX A;  4WAA A;  3J9C A;  1WR1 A;  1JML A;  2VH1 A;  3ZNZ B;  2NPT B;  4EKU A;  2KWD A;  2D3G A;  2JRH A;  1WXM A;  3L54 A;  3DBL B;  2BYF A;  2L76 A;  2KDF B;  3M62 B;  4C00 A;  2D2Q A;  4KV2 A;  2YVC A;  5KHO A;  2R2Q A;  1Q5W B;  1FM0 D;  1MFW A;  3ENE A;  4RGO S;  1Z2M A;  2PLP A;  2KN4 A;  2QCZ A;  1C4C A;  1SSN A;  1JCK B;  2WXF A;  2ZCB A;  1ZXI A;  3O13 A;  2JZ3 B;  2LHD A;  3QAQ A;  3V60 A;  1P7F A;  3BVG A;  2K39 A;  1IBX A;  5BYR A;  2K25 A;  4WQO B;  4ZRP A;  3BVM A;  4HPP A;  3QCA A;  2CHZ A;  4CO7 A;  3K9O B;  4P6V F;  3U52 E;  3TMP B;  4JWS C;  2CS4 A;  2IO1 B;  3AE2 B;  2HTM E;  4BBN C;  5LXH A;  4ANV A;  3R7Q A;  3Q8E A;  3HIZ A;  2RR9 A;  2DZJ A;  2V1Y A;  1MJD A;  1L0X B;  4FXC A;  4GB9 A;  2MQJ A;  1GNU A;  1V8C A;  4FBJ B;  2M4N A;  3VUX A;  4B9K A;  5IAA C;  3UGB B;  2LGI A;  2JPH A;  3ABV B;  1XQQ A;  1SF0 A;  2ZVN A;  3H7P A;  4W9C A;  1R4M I;  2WU5 B;  3IVF A;  2WXM A;  2JX5 A;  1F2R C;  4IM3 A;  1JRP A;  3VRA B;  2L7R A;  4NJ7 A;  1V6E A;  2PJH A;  1TIF A;  3ZJV A;  3JW0 X;  1CK1 A;  1PUT A;  2YLM A;  3R7R A;  5D3D A;  2X8X X;  2OED A;  3W5U B;  3SU8 X;  4MGK E;  4NAW A;  3PLV A;  4R3D A;  4LNN A;  3AUL A;  4TUU A;  3I9V 1;  5J2R A;  4YTM B;  2AWT A;  1JW9 D;  4BOS C;  1WSP A;  4FLH A;  2B3A A;  2NBU A;  2NS5 A;  3MHZ A;  3MP9 A;  1LFD A;  3WAM A;  4OW0 A;  4HJK A;  1DOI A;  3MC9 A;  5CTR C;  4WWP A;  2HDE A;  3TEZ A;  2O2V A;  1XCQ L;  3PVL A;  2LVQ A;  5MPO A;  3K9P B;  2IYD B;  3B08 A;  2KVR A;  3VR8 B;  4FA6 A;  2N1V A;  3APC A;  1L4Z B;  1V49 A;  2G45 B;  5BYS A;  3SFD B;  3HM6 X;  2GBR A;  4OHJ A;  1JWB D;  3KYD D;  3FIL B;  3BYY B;  1R4N I;  4TKN A;  4LJP B;  2WU2 B;  2KAC A;  1SE2 A;  5DPT A;  3VUW A;  1ZW7 A;  1SIJ A;  2KX3 A;  5CHV C;  1MI0 A;  5TSS A;  4MT5 A;  1E10 A;  1TZ1 A;  4KVG B;  1K52 A;  2JZZ A;  1L5P A;  1SB3 C;  1EM7 A;  1YMH E;  2BVC A;  2Z0E B;  4URK A;  1YIW A;  3EC8 A;  4JE3 B;  3VTU A;  4RGN A;  3KUC B;  2E6X A;  1GG3 A;  2QIL A;  3A9J B;  2G3Q B;  3P1M A;  2BQQ A;  1E8X A;  4WJP A;  2FAZ A;  2J52 A;  1FNU A;  4KIK B;  1WXA A;  2QSD A;  5HI1 A;  3DHG C;  3Q8F A;  3TJP A;  3QWZ B;  1JWU D;  4EE2 A;  2JXX A;  3E9S A;  2KAN A;  3PLU A;  4MSM B;  2BT6 A;  2INN E;  4G0N B;  3DBH I;  3I5J C;  4FHK A;  4A3O A;  2LWP A;  4DXA B;  1QOG A;  3ZW3 A;  5FKA C;  2AL6 A;  2RDG A;  4JX1 C;  1VJK A;  1OQY A;  2MA9 B;  2MBQ A;  2H88 B;  4LCD E;  2PIA A;  1UNS A;  4HJG E;  1QZE A;  4WUR A;  1QLB B;  5HG2 A;  1WJ6 A;  1VD2 A;  4M8M A;  3AEF B;  2KC2 A;  4HRS A;  3Q6B A;  2C7N B;  5IO9 A;  4C4V B;  3SR6 A;  1TKE A;  1Y8R C;  2MBB B;  4NPN A;  1B1Z A;  3DVN U;  1Q1O A;  4D2K A;  3HVD A;  4BBN F;  1WM2 A;  2NCN A;  3ZTD A;  4W9D A;  2EKE C;  4IKG A;  3AV8 A;  1EWC A;  3U8Z A;  4CQN A;  4J6I A;  1NI3 A;  4EFO A;  1YN3 A;  1DGJ A;  4E74 A;  1EU3 A;  1K8R B;  2ASQ A;  2WHI A;  2DNF A;  4TV3 A;  2X38 A;  2L00 B;  3SEB A;  2Y5C A;  2Y5B B;  1FNV A;  2JXT A;  4DDI D;  1V80 A;  1HZ6 A;  4KGS A;  4RF1 A;  1SE3 A;  2RMM A;  4X57 B;  4F8C B;  2FNJ B;  2BKR B;  2KJ6 A;  2WXR A;  1P1A A;  4MSQ B;  1XLN A;  4BKG A;  3CST A;  1VRA B;  2G1E A;  2KWC A;  4K3B A;  2LJI A;  1IGD A;  3EA6 A;  5IKC M;  1WYW B;  4ARC A;  3Q8C A;  2HE7 A;  4HK2 A;  2GBJ A;  3H6N A;  1WIA A;  2K8C A;  3DBR B;  1YN4 A;  3N1Y C;  3A4S C;  2C60 A;  1UWM A;  2JWU A;  4LNO A;  1C79 A;  1U4A A;  2N9E B;  2MJE A;  4NQK E;  2JYE A;  2KK8 A;  2W3S A;  2LXA A;  3MC8 A;  3LYY A;  3H9D A;  4MEL A;  4MGY E;  1VDV A;  5FR3 A;  2PTL A;  1I4H A;  4ACF A;  3E56 A;  4LK0 M;  2LMC A;  2KYW A;  5EDS A;  1PGB A;  2FUG 1;  1UBQ A;  2NBV B;  4GIV A;  1HA5 A;  2WDT B;  2RSU A;  2FBW B;  2W9N A;  2M0A A;  4EEW A;  4K7S A;  3T3O A;  4AOF A;  4H2A A;  3N3K B;  1T0S C;  1ZXH A;  2DYM A;  1AW7 A;  2KDM A;  3TBL D;  2EKI A;  3TEY A;  2BS2 B;  3MHS D;  3GS2 A;  3GZN I;  4ZRK A;  4MGZ E;  1F77 A;  2WXN A;  2BYV E;  3RNA C;  4ICV A;  1T3Q A;  1YOV B;  3A33 B;  1DYQ A;  2J7Q B;  3VRB B;  4KGR A;  4KSK C;  4G50 A;  2K9X A;  2KKC A;  4WQM A;  2KJR A;  1QQR A;  4HRO A;  1D5Z C;  4WH4 A;  3W5V B;  4YSY B;  5C23 A;  2ACZ B;  1V97 A;  3W9C B;  3Q3N C;  3IHP C;  3CIR B;  1WGG A;  4BKT A;  3AE6 B;  2GLS A;  1NEK B;  3NVY A;  1I7H A;  2IPK D;  2N7J A;  3NJT A;  2LGS A;  3ZTC A;  4BOZ B;  2EEL A;  4KSL C;  3AE8 B;  2L83 A;  5E6P A;  2AQ1 B;  2BB6 A;  1RM6 C;  1H8C A;  4RGT A;  5BMG A;  3M3J A;  2BF8 B;  4FUL A;  4P16 A;  2PVO D;  4ITK A;  1J7B A;  1ZE3 D;  3AN1 A;  3P4P B;  2ZCC A;  1N5X A;  3VVW B;  2IDY A;  1WH3 A;  1ZDV A;  1L2N A;  4OZA A;  1IPG A;  3R3M A;  1GC7 A;  4W9G A;  2EMT A;  1WGK A;  3HRD D;  2SAK A;  2WDV B;  5G55 A;  1YJ1 A;  1NVI D;  4OVV A;  2LGD A;  4HWI B;  2HD5 B;  2GRI A;  3KW5 B;  3SD5 A;  1V9J A;  1T0Q C;  1XLQ A;  2V3P A;  1QF6 A;  3JSV A;  1EWY C;  4KDL B;  5D94 A;  3TL5 A;  2I1J A;  4HDQ A;  3PHX B;  1E5W A;  1UEL A;  1FD6 A;  5D7G A;  1WFY A;  4HVB A;  2UWQ A;  2L0T A;  2KHW B;  4W9E A;  4ANX A;  2JWZ A;  1XCT L;  1V5T A;  2C7H A;  3AB5 A;  4YT0 B;  4Q2J A;  4FJY A;  4PS7 A;  1ET6 A;  2J0J A;  5CHW A;  1RFK A;  2LJ5 A;  3IFW B;  1ZP0 B;  1J8C A;  2KFK A;  1V1P B;  1WGR A;  1KLG D;  3ZGZ A;  4ARI A;  3PPA A;  2KO3 A;  2DYB A;  2CU1 A;  1XEE A;  1L0V B;  1OQQ A;  2DBY A;  3ML9 A;  3HUI A;  3VHT C;  2J42 A;  2GBN A;  1J19 A;  1A5R A;  1FCL A;  2D07 B;  4A6Q A;  1BUI C;  2WXO A;  3BZD B;  5AUK A;  1LQB A;  4KGT A;  3WAO A;  2JUO A;  4EZL A;  4K3C A;  4DQO C;  4I6L B;  2INP E;  4GDL B;  4II2 B;  1R7S A;  2JYT A;  1WM3 A;  4IDI A;  1WJU A;  4PS8 A;  2GMI C;  5JHA A;  5JHB A;  1I4R A;  1MHX A;  2R61 A;  4L2Y A;  1E7V A;  1L0Y B;  2R2O A;  4CYE A;  3P4S B;  1FMA D;  4YTP B;  2O6V A;  1P7E A;  2KDB A;  3WIM A;  3U2S C;  1X1M A;  3N1X C;  3JVZ X;  2ZPN A;  1WZ3 A;  1HTQ A;  5IOI A;  4I6N B;  3RI7 C;  3ZJT A;  4PYU A;  2J53 A;  5BYQ A;  3CF6 E;  3ZKJ C;  2NPT A;  4M0W B;  2WXJ A;  4RMA A;  2IO0 B;  4TSS A;  1VZ7 A;  5JXV A;  3RNC C;  4LJO B;  3LJ3 A;  3VAW A;  5LXI B;  3PGE A;  1UUP A;  2GI9 A;  3PTF C;  2BYT A;  3AXC A;  3I63 C;  1N61 A;  1H4R A;  2INC C;  3TEX A;  3AE5 B;  2MX2 A;  4WWN A;  3B2F A;  1WE6 A;  3U4E G;  4WWM A;  1C78 A;  3NOB A;  1RWS A;  3V61 A;  1GC6 A;  3I3T B;  3LDZ E;  1KM7 A;  2ZW0 A;  3KUD B;  1TBE A;  1HTO A;  2V0G A;  1E8Z A;  3PV1 A;  4HDO A;  3BYT B;  3VXW A;  1JWA D;  4PT5 A;  2WX0 A;  5D2M B;  4DXF A;  2NVU I;  3TIX A;  3B1L X;  4XYC A;  4W9I A;  2CKH B;  3GOE A;  3PRP B;  2YEP B;  5J17 A;  3R2T A;  2DZK A;  1V5O A;  4KKI A;  2BWF A;  3A4R A;  1I42 A;  4XGA B;  3IG3 A;  1WX8 A;  1PGA A;  1BXT A;  3UQB A;  4TQ0 A;  1SJH D;  3O65 B;  4REZ A;  4C80 A;  1J7A A;  5AUI A;  3IT4 B;  2LD9 A;  1FFV A;  2K22 A;  3LB8 C;  1I4Q A;  2IGG A;  4FAD A;  3NS1 A;  3T3N A;  1IP9 A;  3V6C B;  2MSE D;  2L0F A;  2O6V D;  3URY A;  1IUE A;  4EZK A;  3APF A;  2WXH A;  3OJ4 B;  3Q8A A;  1WXQ A;  5E6J A;  5KHQ A;  1OGW A;  2ZPY A;  3VH4 B;  1WYG A;  4YSZ B;  4MEM A;  4DHZ B;  2CHW A;  2N4F A;  1KH0 A;  1E7U A;  2WXL A;  2LRU A;  1WE7 A;  4IUM B;  2KFJ A;  3NS8 A;  1IYF A;  2LVP A;  2IJ0 A;  5IN7 A;  3D32 A;  1NDD A;  3TSS A;  2W54 A;  1EO6 A;  2KC1 A;  3QQ8 B;  4P7I A;  4QAY A;  3NHE B;  2I1K A;  3APD A;  4USA A;  4PK1 A;  1T5X D;  1YJI A;  4BFR A;  2KMA A;  3FIL A;  3WAP A;  2KJH B;  3NG0 A;  2IO3 B;  3X0W A;  4TQ1 A;  2K0P A;  5BMH A;  2AL3 A;  1SEB D;  3OAW A;  5AEK B;  1GB1 A;  2BS4 B;  4IG7 B;  1C76 A;  3QAR A;  4M8N A;  5EE9 A;  1PFD A;  1K50 A;  1XO3 A;  3ZDM C;  2M1M A;  4GGQ A;  2FE8 A;  4A9A A;  4OVU A;  1GB4 A;  3AH7 A;  1JRO A;  2D3A A;  1OTR B;  2V9H A;  3VR9 B;  5BMI A;  3V6E B;  3DWG C;  1NBF C;  2L8J A;  3A9J A;  4MDK E;  2N0S B;  2ZNV C;  4ZDV A;  3DVN V;  3AE1 B;  5C3J B;  2LFI A;  2Z0D B;  2QHO A;  4C7Z A;  4KIK A;  3PO0 A;  2MCN B;  3SHQ A;  4NQL B;  2Y3A A;  4PS3 A;  3DOW A;  4XWT A;  1QIL A;  1SGH A;  2RDH A;  3PZD A;  1C4A A;  3OG5 A;  3ZNI D;  2N9K A;  2I38 A;  2OJR A;  1I4P A;  4MM3 B;  1TY0 A;  1N6Z A;  1ISN A;  1AN8 A;  1L6V A;  3VTW A;  1HEZ E;  3DPD A;  3I57 A;  2PE6 B;  4GN1 A;  3Q69 A;  1YJJ A;  4C4V A;  3AEB B;  1FNW A;  4MM3 A;  1V2Y A;  1CQV A;  2A4Z A;  4IW0 A;  3HK0 A;  1QT9 A;  4M00 A;  1M94 A;  1G6J A;  4FN2 A;  1IGC A;  2C5L C;  2L52 A;  3AE9 B;  3KYC D;  2BB5 A;  2WXP A;  1FRR A;  3AED B;  1TS2 A;  1KOT A;  3ZUN A;  3AU4 A;  1C4P A;  3MC0 B;  4ZRQ A;  3QX1 A;  2IY1 B;  4US8 A;  2LUM A;  4JWU C;  4LNK A;  5BO4 B;  4MGI E;  2IND C;  2KAJ A;  3VUY A;  3KWV A;  4XWW A;  4HLE A;  1J0G A;  3Q2A C;  1MG8 A;  3EFC A;  4DHJ B;  1KLU D;  2Y5P A;  3B9J A;  1ZDX A;  3Q3J A;  1YQ3 B;  2C7M B;  4GOC A;  3QA8 A;  1QOF A;  5G5G A;  4TMA B;  2L05 A;  5AZH A;  2V3S A;  1EF1 A;  4YXD B;  1R4M B;  4LDT B;  3C8Y A;  2KDE B;  3OLM D;  5AZF A;  3QJZ A;  1WXS A;  5I4D A;  2ZW1 A;  3DBL I;  3ETR A;  4AQ7 A;  3UIP B;  4GMV A;  2JY6 A;  1JQ4 A;  4A90 A;  2XBB C;  5EE3 A;  4PYZ A;  4W9K A; 
#chains in the Genus database with same CATH homology
 3MJW A;  3HIZ A;  2RR9 A;  2DZJ A;  2CU1 A;  2V1Y A;  3R66 C;  3PRM B;  4KZ0 A;  3C0R B;  1UGM A;  1WGY A;  4GB9 A;  2MQJ A;  3ML9 A;  3RYT A;  3NZS A;  1GNU A;  1XT9 B;  4FBJ B;  2CHX A;  2GOW A;  3VHT C;  4EUT A;  2AYO B;  2M4N A;  2K6Q A;  2JT4 B;  2WX1 A;  3VUX A;  2GBN A;  1J19 A;  4B9K A;  5D6J B;  5IAA C;  2G4S A;  3UGB B;  1A5R A;  1Q0W B;  2D11 A;  2JPH A;  3ZRF A;  1XQQ A;  2KDI A;  3EHV A;  2D07 B;  4ANU A;  4II3 B;  4ASW C;  2BGF A;  3HM3 A;  4MJS B;  2ZVN A;  3H7P A;  1RFA A;  4K7U A;  1R4M I;  1RLF A;  1UH6 A;  3AI5 A;  2LUE A;  4W9C A;  1LQB A;  3IVF A;  3WAO A;  3EFU A;  3H1U A;  2FCM A;  2JUO A;  4IM3 A;  4EZL A;  5JZE B;  2K1F A;  5DCN A;  3BIN A;  3M95 A;  2L7R A;  3QC8 B;  4I6L B;  4NJ7 A;  2DYO A;  3UF8 A;  3Q3F A;  1V6E A;  2HTH A;  2PJH A;  4GDL B;  4II2 B;  2RD0 A;  3JW0 X;  1F9J A;  1WM3 A;  2YLM A;  3R7R A;  2LZ6 A;  1ZGU B;  3ZLZ A;  1WJU A;  4EOY A;  4PS8 A;  4XX5 A;  3SU8 X;  1TGZ B;  2GMI C;  4MGK E;  4NAW A;  4BVU C;  5JHA A;  1GJZ A;  3T9L A;  2N9X A;  3PLV A;  1V86 A;  3AUL A;  3L17 A;  4TUU A;  5J2R A;  2AWT A;  3IBE A;  2FCQ A;  4BOS C;  1YD8 U;  2V4L A;  2DZM A;  2N9P C;  2B3A A;  4FLH A;  3RUL A;  3WAN A;  2NBU A;  2NS5 A;  2XK5 B;  5JHB A;  3OJ3 A;  1LFD A;  3PS6 A;  3WAM A;  3SDL C;  4BKS A;  1WR6 E;  4HJK A;  5C1Z A;  5CTR C;  3P2B A;  2WYQ A;  4JGH B;  5GMV A;  1E7V A;  2OOB B;  4WWP A;  3KUZ A;  2KTR B;  2KZR A;  3L16 A;  4FHJ A;  2O2V A;  2R2O A;  4CYE A;  4NJ6 A;  3DCG A;  2O6V A;  5DPW A;  2MRP A;  3A9K B;  1Z5S B;  2KDB A;  3PVL A;  3PRZ A;  2LVQ A;  3WIM A;  1X1M A;  3K9P B;  2IYD B;  3B08 A;  2KVR A;  4FA6 A;  1NI2 A;  2N1V A;  3APC A;  3KH0 A;  3JVZ X;  2ZPN A;  1V49 A;  1WZ3 A;  2G45 B;  3HM6 X;  2GBR A;  2MP2 B;  1P9D U;  4I6N B;  2HJ8 A;  3ZO5 B;  3KYD D;  4PYU A;  3W1S A;  3UIN B;  1R4N I;  1WX9 A;  3CF6 E;  4TKN A;  3L0W B;  2MWS B;  4LJP B;  3ZNG C;  3ZKJ C;  2NPT A;  4M0W B;  4W9H A;  4GU2 A;  5DPT A;  3VUW A;  4RMA A;  5FR6 A;  2IO0 B;  1ZW7 A;  4DHJ D;  3QK0 A;  3CSF A;  4GDK B;  2KX3 A;  5CHV C;  2RPQ A;  4CHK A;  3W1Y A;  1TZ1 A;  3PSE B;  4KVG B;  4LJO B;  3LJ3 A;  2M8S A;  3RZF A;  2JZZ A;  3VAW A;  5LXI B;  2REX A;  3PGE A;  3PTF C;  4HPL B;  3AXC A;  2M17 A;  4JL9 A;  2DEN B;  1SIF A;  1H4R A;  2JRI B;  2Z0E B;  4URK A;  1YIW A;  3EC8 A;  1WX7 A;  4DK5 A;  2MX2 A;  2PEA A;  3VTU A;  3KUC B;  2FCS A;  3T8M A;  2UYZ B;  2IZV B;  4FJV B;  1GG3 A;  4WWN A;  1WE6 A;  4IWQ A;  2KWU B;  1UZX B;  3NZU A;  3A9J B;  2G3Q B;  3NOB A;  1E8X A;  4F1S A;  2N7D A;  4WJP A;  3V61 A;  1GC6 A;  1WGH A;  3I3T B;  2FAZ A;  3LDZ E;  1KM7 A;  2KX0 A;  1WMH B;  4KIK B;  1WXA A;  4G11 A;  3KUD B;  1TBE A;  2AEH A;  3X23 A;  3S2A A;  1EUV B;  3TJP A;  3RT3 B;  1E8Z A;  3PV1 A;  4HDO A;  3QWZ B;  2KOX A;  2JXX A;  3RUI B;  3VXW A;  2KAN A;  3PLU A;  4MSM B;  5CHF A;  2WX0 A;  3A1Q B;  5D2M B;  4G0N B;  2NVU I;  1YX6 B;  3DBH I;  4FHK A;  3TIX A;  1T0Y A;  4A3O A;  2LWP A;  3B1L X;  4DXA B;  1EF5 A;  3ZW3 A;  2BWE S;  4W9I A;  2XEW A;  3ZDT A;  2AL6 A;  1E90 A;  5LLI A;  4W9L A;  1OQY A;  2CKH B;  2CR5 A;  2MA9 B;  2MBQ A;  3GOE A;  3PRP B;  4WJO A;  5J17 A;  4DDG D;  2DZK A;  1V5O A;  4LCD E;  1QZE A;  2BWF A;  3A4R A;  1I42 A;  3L08 A;  2KWV B;  3IG3 A;  5TR5 A;  2WWZ A;  5E6N A;  2BKF A;  1WJ6 A;  1WX8 A;  1VD2 A;  2M0X A;  5DPS A;  2NR2 A;  4M8M A;  2KC2 A;  3DDC B;  2LRW A;  2D10 A;  1PQS A;  3UQB A;  2NBW B;  4TQ0 A;  2C7N B;  2JF5 A;  2LI5 A;  3O65 B;  4HCN B;  4XZ4 A;  1Y8R C;  2MBB B;  4DBG A;  4MJS A;  5L83 A;  4NPN A;  4G3X B;  1JRU A;  3DBS A;  3DVN U;  1Q1O A;  2ZVO A;  5DPR A;  4BBN F;  1WM2 A;  2NCN A;  3VQI A;  3ZTD A;  4W9D A;  2LD9 A;  2DAF A;  4BKS D;  4ZRI A;  2EKE C;  1V81 A;  2KLC A;  2ZZP B;  3U8Z A;  3VDZ A;  1WI0 A;  2L3Z A;  4J6I A;  4EFO A;  1WJN A;  4FAD A;  1IP9 A;  1WZ0 A;  3V6C B;  2MSE D;  4GDL A;  2IBI B;  3ZIM A;  4GXB A;  2L0F A;  5J18 A;  2O6V D;  1S3S G;  4GSW A;  4E74 A;  3M63 B;  1K8R B;  2ASQ A;  2MBE A;  3RCZ A;  4I6P A;  4TV3 A;  2L00 B;  3DQV A;  4EZK A;  2Y5B B;  3U30 A;  3APF A;  3L13 A;  3OJ4 B;  4DDI D;  4K7W A;  1V80 A;  5KHQ A;  1OGW A;  4AUQ C;  2ZPY A;  3VFK A;  3VH4 B;  4X57 B;  4F8C B;  2FNJ B;  2BKR B;  4NY0 A;  3ZNH B;  4MEM A;  4DHZ B;  2CHW A;  2N4F A;  2KJ6 A;  1P1A A;  1E7U A;  3DVG X;  4MSQ B;  4BKG A;  2XK5 A;  3QHT A;  3CST A;  1XD3 B;  2A5U A;  2PPH A;  2KWC A;  2LRU A;  3N32 A;  1WE7 A;  4IUM B;  2KFJ A;  3NS8 A;  1WYW B;  2LVP A;  1IYF A;  1KLV A;  1TTN A;  2IY0 B;  3D32 A;  5IA7 A;  1NDD A;  2KTR A;  3JSV B;  2HE7 A;  4HK2 A;  2GBJ A;  3WAL A;  3H6N A;  4KDI C;  1WIA A;  1EO6 A;  2K8C A;  2KC1 A;  2KLG A;  3A9K A;  4MH0 E;  1WF9 A;  3B0A A;  3PT2 B;  4K81 A;  3QQ8 B;  5AZG A;  3A4S C;  4P7I A;  2C60 A;  1U4A A;  3NHE B;  2N9E B;  4NQK E;  2KN5 A;  2LVO A;  2I1K A;  1VCB A;  3APD A;  1P0R A;  4KZC A;  2MP2 A;  2KK8 A;  2KQ7 A;  2LXA A;  2MBO A;  4BFR A;  2VRR B;  4HXD A;  2KMA A;  3H9D A;  4MEL A;  4WWO A;  4MGY E;  3WAP A;  4AJW A;  4E71 A;  4ICU A;  2KJH B;  4N9F 4;  2IO3 B;  3VTV A;  3X0W A;  4IWP A;  1LM8 B;  4TQ1 A;  3RD2 A;  3ZRC A;  1HE8 A;  4JIO U;  2KXJ A;  2G4D B;  2EMS A;  2FCN A;  4GDK A;  2AL3 A;  1OEY J;  4F7Z A;  4DHZ E;  3OAW A;  4LDT D;  5EDS A;  4IWO A;  5AEK B;  1I35 A;  2KFK B;  4IG7 B;  1WRD B;  2BPS A;  4ANW A;  3QAR A;  2FIF A;  4M8N A;  4W9F A;  1RRB A;  3ZDM C;  2M1M A;  1UBQ A;  2NBV B;  4GGQ A;  4GIV A;  4K1R B;  2WDT B;  5CX3 A;  5HKH A;  1WY8 A;  4OVU A;  2RSU A;  2K8H A;  4HPM B;  4JLC A;  3TCA A;  2W9N A;  3DBR I;  1OTR B;  4W9J A;  2N7E A;  3U7D A;  2FID A;  4EEW A;  4K7S A;  2C9W B;  3V6E B;  4AOF A;  5JH5 C;  1NBF C;  1YX5 B;  2L8J A;  3N3K B;  4YL8 A;  4DWF A;  2DYM A;  2N1W A;  3A9J A;  4MDK E;  3TBL D;  4AP4 C;  5G2N A;  2ZNV C;  4ZDV A;  3DVN V;  3MHS D;  5E6O A;  3NY5 A;  3GZN I;  4ZRK A;  4ZYN A;  2DAJ A;  2Z0D B;  4MGZ E;  3UIO B;  3EEC A;  2QHO A;  1RAX A;  1WMH A;  2BYV E;  2GBM A;  2LGY A;  3HHM A;  3L10 B;  4KIK A;  4RM8 A;  2MCN B;  2K6D B;  3SHQ A;  4NQL B;  3H7P B;  4AJY B;  4B95 A;  4ICV A;  4PS3 A;  3A33 B;  2K8B A;  3DOW A;  4ZRJ A;  2J7Q B;  2J0K A;  2DZI A;  1SGH A;  3A1Q A;  3JYU A;  1CMX B;  4KSK C;  3QIJ A;  3ALB A;  4G50 A;  3PZD A;  1GUA B;  3ZNI D;  2KKC A;  3MTN B;  1BT0 A;  1UBI A;  4IM0 A;  2OJR A;  2ZNV B;  3BY4 B;  2MBH A;  2KJR A;  1ISN A;  2FUH B;  5C23 A;  3VTW A;  3ZVV A;  3DPD A;  4NAW B;  4JQW C;  1FXT B;  2PE6 B;  4GN1 A;  3IHP C;  1WGG A;  4AWJ A;  4BKT A;  4NNJ B;  1YQB A;  1P3Q U;  1E8Y A;  5L95 C;  4IM2 A;  3CMM B;  4HCP B;  3W1S C;  4MM3 A;  3ZTC A;  4BOZ B;  1V2Y A;  2KMC A;  3RZW C;  2A4Z A;  2BYE A;  4IW0 A;  4KSL C;  3DVG Y;  5E6P A;  3HK0 A;  2KTF A;  1AAR A;  2KNB A;  1M94 A;  2Z59 B;  4FJZ A;  1G6J A;  4FN2 A;  2O2V B;  2KQS A;  2ZJD A;  3PHW B;  1H8C A;  2O6V B;  2C5L C;  1P98 A;  2ZEQ A;  1WXV A;  2BF8 B;  3KYC D;  3M3J A;  4WJN A;  4FUL A;  3PRE A;  4A3P A;  2ZCC A;  1LXD A;  2RGF A;  3V62 A;  3VVW B;  1KOT A;  1WH3 A;  1UD7 A;  3ZUN A;  1L2N A;  3AU5 A;  3AU4 A;  1WGD A;  1IPG A;  4WAA A;  3R3M A;  2PE9 A;  1GC7 A;  1WR1 A;  4W9G A;  3WA0 A;  3QX1 A;  4EZJ A;  2EMT A;  3H7S A;  3ZNZ B;  2NPT B;  2DX5 B;  4EKU A;  2IY1 B;  2IO2 B;  3UQA A;  3ONS A;  1L7Y A;  2D3G A;  2JRH A;  1ZKH A;  1WXM A;  5BO4 B;  3L54 A;  4MGI E;  5G55 A;  1YJ1 A;  3N30 A;  2BYF A;  4OVV A;  2L76 A;  2KDF B;  2LGD A;  2HD5 B;  3M62 B;  2JVC A;  4HWI B;  4RM9 A;  4WJQ A;  4B6W A;  2D2Q A;  4KV2 A;  3VUY A;  3KW5 B;  3SD5 A;  2YVC A;  1V9J A;  3ECI A;  5KHO A;  2R2Q A;  1Q5W B;  4HLE A;  1J0G A;  3ENE A;  1E8W A;  3JSV A;  1MG8 A;  2LXC A;  4KDL B;  5D94 A;  1Z2M A;  4DHJ B;  3TL5 A;  2I1J A;  4HDQ A;  2MW5 A;  3KVF B;  3Q3J A;  2KD0 A;  2LGX A;  2MLB A;  3PHX B;  4A20 A;  1C1Y B;  1E5W A;  1UEL A;  2C7M B;  5D7G A;  4GOC A;  1WFY A;  3QA8 A;  3VH3 B;  4E3C A;  4HVB A;  2UWQ A;  2ZCB A;  4XC2 A;  2L0T A;  2JZ3 B;  2KHW B;  2L05 A;  3QAQ A;  5AZH A;  3V60 A;  3ML8 A;  2V3S A;  4W9E A;  1EF1 A;  4ANX A;  2JWZ A;  1OEY A;  2K39 A;  1V5T A;  2C7H A;  2DHZ A;  1S1Q B;  2K25 A;  4WQO B;  4FJY A;  4PS7 A;  4LDT B;  2KDE B;  2GBK A;  2J0M A;  3QCA A;  1WJ4 A;  2J0J A;  2CHZ A;  3OLM D;  5CHW A;  4CO7 A;  5AZF A;  1C3T A;  1D3Z A;  3QJZ A;  2LJ5 A;  1WXS A;  3IFW B;  1KJT A;  2LAS A;  3DBL I;  3K9O B;  1J8C A;  2KFK A;  3TMP B;  1WGR A;  2CS4 A;  2IO1 B;  3UIP B;  4GMV A;  2JY6 A;  4IC7 B;  3PPA A;  4BBN C;  5LXH A;  2KO3 A;  1SE9 A;  2DYB A;  2XBB C;  4ANV A;  3R7Q A;  4PYZ A;  4W9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...