5D2MB

Complex between human sumo2-rangap1, ubc9 and znf451
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase,protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 76
sequence length 76
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5d2mB00
4J6IA 3VTWA 2YVCA 4TQ0A 5L95C 2ZVNA 2NR2A 2KJRA 1UBQA 2GBNA 1WE6A 3B08A 2PE9A 3X0WA 1A5RA 2FIFA 4JQWC 4BOSC 1I42A 5CHWA 4DHZE 3SD5A 3L13A 3P2BA 1UGMA 2MP2B 2NBVB 3ZLZA 1WX9A 3A33B 4MSQB 2G4DB 1T0YA 3R7RA 2K39A 2J7QB 2LRUA 2L8JA 3QJZA 2FCQA 4PS3A 1CMXB 3VTUA 3IVFA 1R4NI 4KDLB 2K1FA 4EZJA 3H7PA 1E7VA 1V2YA 1GUAB 1ZKHA 3JVZX 3PLUA 3PT2B 4HPLB 4MM3A 2AL6A 1UELA 2LXAA 4DHJD 4GDKA 3SDLC 2MA9B 4FJZA 2Z0DB 2ASQA 3UF8A 3AULA 4M8NA 4EUTA 1GNUA 2O6VD 3TMPB 2PE6B 2KDEB 1WR6E 2DAJA 4LJOB 4G11A 1ISNA 2J0KA 2XK5B 2FNJB 4BKTA 1NDDA 4BKGA 4OVVA 2K6QA 2DENB 2ZNVB 1E8YA 1Y8RC 3OLMD 1YIWA 2BWFA 4FULA 5E6NA 2MWSB 2EMSA 4KSLC 4LCDE 4HCNB 2D10A 2AEHA 2NPTA 3QQ8B 5GMVA 3RD2A 1UBIA 4IWPA 1WJUA 2IYDB 2KMAA 1IPGA 4HLEA 1QZEA 4XZ4A 5E6OA 2KN5A 3AU4A 2LZ6A 1E8WA 3KVFB 3VH3B 1KOTA 4W9HA 2MBEA 1YJ1A 3X23A 4DHJB 2MQJA 4W9IA 2RSUA 2EMTA 3ONSA 5CHVC 2CU1A 4TUUA 3QHTA 2LWPA 3B1LX 3CF6E 4WWOA 2O6VB 4ICVA 3N30A 3T9LA 3U7DA 4JLCA 4LJPB 1WR1A 1YD8U 2HE7A 4MSMB 1J8CA 1TGZB 4FHKA 1VCBA 2HD5B 2PJHA 1J19A 2B3AA 2JVCA 4K7UA 5G55A 3T8MA 2MP2A 1D3ZA 4K7WA 3HK0A 3ZW3A 2L00B 4FHJA 3GOEA 3V6CB 4IW0A 2JZ3B 1EF5A 4IUMB 2KQ7A 1IYFA 1IP9A 2WX1A 5J17A 1V6EA 3DOWA 3N3KB 2L0TA 4F7ZA 2LRWA 4II3B 3ENEA 1C1YB 4IM2A 2KWCA 4RM8A 4GU2A 2MBBB 4TQ1A 5AZFA 3SHQA 3VUWA 3ZRFA 4BKSD 5DPRA 3ZRCA 1H4RA 2KLGA 2XK5A 3ZNID 4EEWA 2ZZPB 2MBQA 4FN2A 3M95A 2K6DB 4MGZE 2AL3A 3AI5A 4PYZA 1YX6B 2LI5A 2UYZB 4GN1A 3TIXA 2LVPA 2N9EB 3HM6X 1LFDA 1WFYA 4KDIC 2BPSA 4M8MA 4HVBA 1G6JA 5DPTA 2DAFA 3NY5A 2Z59B 1WM3A 3H1UA 1YQBA 2MW5A 3TCAA 2BKFA 2KX0A 5D2MB 2KJHB 2IY0B 2KXJA 2G4SA 4IWQA 5HKHA 2D07B 2JT4B 1WX7A 5LXHA 4GMVA 1WI0A 4F8CB 4DXAB 2WWZA 3BY4B 2C60A 3SU8X 2K25A 1WZ3A 2L3ZA 3D32A 4KIKB 3ZVVA 4EFOA 4EOYA 1WH3A 3L16A 2O6VA 1U4AA 2ZPNA 1GJZA 4BVUC 4W9LA 1JRUA 2FIDA 4ICUA 3B0AA 4A20A 5JZEB 2JF5A 3ZDTA 3OJ3A 3U30A 2C5LC 4FADA 2DZIA 2KDFB 3A4SC 2ZEQA 4HDOA 1SE9A 4PS7A 2KOXA 2G3QB 3PV1A 2IO3B 3ZNHB 2BWES 2JRHA 4K7SA 4PYUA 2ZCCA 1XT9B 2D2QA 4GOCA 2CHXA 1TBEA 2JZZA 1ZGUB 2EKEC 3ZTCA 3ZUNA 2KDBA 2AWTA 4FLHA 2GBRA 3VDZA 3A9KB 3JSVB 1OEYJ 3CSFA 3VXWA 4IM0A 2C7MB 5FR6A 3UQAA 1WXSA 4WAAA 2FCMA 3L10B 3L08A 4NNJB 3A4RA 4GB9A 1HE8A 2C7HA 5CTRC 3WANA 5JH5C 1EO6A 3I3TB 3KH0A 5C1ZA 2LGDA 3L17A 1X1MA 3R66C 3QA8A 3Q3FA 4W9DA 2C9WB 4HK2A 3L0WB 4JGHB 2N1WA 4G0NB 1FXTB 4M0WB 3QC8B 4EZKA 2CKHB 2IO0B 1WE7A 4B6WA 2LVOA 4IWOA 2JY6A 3H7SA 1BT0A 4NJ7A 1E90A 3RYTA 2M8SA 5JHBA 3V61A 1OEYA 2Y5BB 3DVGY 2PEAA 1ZW7A 2MBHA 2K8BA 3K9OB 4KIKA 2CHZA 1LM8B 3V60A 2RR9A 2L05A 4KV2A 3ZIMA 4DHZB 5BO4B 4BKSA 2KC2A 2N1VA 3PVLA 4ANUA 1VD2A 1R4MI 2KHWB 2ZNVC 2HTHA 2JUOA 3PRPB 5E6PA 4NQLB 4BBNC 4E74A 4W9GA 1TZ1A 1WXMA 3DVGX 4I6PA 4AWJA 5J18A 1WGYA 4I6LB 3PGEA 1LXDA 3ZNGC 4ZRJA 3VFKA 4DBGA 3NS8A 1WY8A 4K81A 3DVNU 2GBMA 2KC1A 3PHXB 2KLCA 3ML9A 3PRMB 4ANVA 1RLFA 3LJ3A 4FJVB 2XBBC 3JYUA 2DHZA 2ZVOA 3H9DA 3QARA 4GXBA 4DDGD 2FCNA 3A9KA 2J0JA 3JSVA 3WAPA 5D6JB 3EFUA 4AJWA 5KHQA 1V80A 4IM3A 3QIJA 4NPNA 4WJPA 1OTRB 1V86A 3WIMA 2LVQA 2N7DA 1SGHA 1WJ6A 2JXXA 3APCA 1WF9A 1EUVB 3KUZA 3WALA 4ZDVA 1RAXA 4XC2A 3DBSA 3QX1A 4W9FA 1NI2A 2KTRB 2LXCA 1S1QB 2KTFA 4N9F4 2MCNB 2KMCA 4NQKE 1WMHB 3ECIA 4NJ6A 2WDTB 2G45B 3A9JB 2KFKB 2L7RA 2LD9A 2KKCA 2M4NA 4F1SA 2GBKA 4IC7B 3O65B 2CHWA 2QHOA 4JL9A 2JRIB 2DZJA 3ZNZB 1K8RB 4DK5A 2KO3A 2M1MA 2N9XA 4BBNF 2IY1B 4G3XB 1WIAA 4DDID 1RRBA 1GG3A 1UZXB 1KM7A 3AXCA 3DCGA 2KZRA 3QK0A 2BYVE 3KYDD 2AYOB 3ALBA 1XD3B 2K8HA 1MG8A 1Z2MA 2NVUI 3ZO5B 3UIOB 1S3SG 5JHAA 3W1YA 3APFA 2R2OA 2R2QA 3APDA 4II2B 3DBLI 3NHEB 5J2RA 4XX5A 1PQSA 3IHPC 2RGFA 1J0GA 3PPAA 4IG7B 3VHTC 3MJWA 1L7YA 2CR5A 2HJ8A 1E5WA 2VRRB 3HM3A 4W9CA 2O2VB 3PZDA 4EKUA 2KWUB 3UIPB 2MLBA 1V49A 1I35A 4ZRIA 2GBJA 2IZVB 1V9JA 2N7EA 5CHFA 2WX0A 2BF8B 1YX5B 2A4ZA 5AZGA 5G2NA 3ZKJC 1GC7A 4B9KA 4FA6A 1WXAA 1Q1OA 3TL5A 4TV3A 3VUYA 5LLIA 3S2AA 3V6EB 1NBFC 4NAWB 2KTRA 2ZJDA 1M94A 3VUXA 3GZNI 3A1QB 2BYFA 1UH6A 3JW0X 2PPHA 1V5OA 3RCZA 1WMHA 4GDLB 1SIFA 3C0RB 3ML8A 2FUHB 3W1SC 3A9JA 2KFKA 2D11A 4KZ0A 3VAWA 4AJYB 4OVUA 3QAQA 3M62B 3U8ZA 3QWZB 4GSWA 4DWFA 4FBJB 2JPHA 4MGKE 2DYOA 2K8CA 2NBUA 3V62A 2DZKA 2KQSA 2L76A 3DBHI 2MRPA 2DYBA 4A3OA 4NY0A 1V5TA 3MHSD 2I1KA 4MELA 1WGRA 3DVNV 1WM2A 1GC6A 2C7NB 3IFWB 1F9JA 1RFAA 2LUEA 4ANWA 1P0RA 4B95A 4RM9A 3TJPA 3EECA 3KUCB 2XEWA 2J0MA 3TBLD 2GOWA 4KSKC 1P98A 3L54A 2BKRB 4HPMB 4BOZB 3EHVA 3HHMA 2KX3A 4CO7A 1AARA 2KNBA 2OOBB 3HIZA 2DZMA 3DDCB 3PTFC 4HCPB 3UQBA 1Q0WB 5D7GA 2DYMA 3ZTDA 4TKNA 4LDTD 4HWIB 3BINA 3PSEB 2REXA 2LASA 3W1SA 2W9NA 2ZPYA 1H8CA 1Z5SB 2V1YA 2O2VA 3NOBA 2KVRA 3R7QA 1WGDA 3AU5A 5IA7A 4HDQA 2CS4A 4P7IA 1WJ4A 1L2NA 3PS6A 4X57B 3RUIB 4E71A 4WJQA 1C3TA 4WWNA 2A5UA 1WRDB 4MJSB 4CYEA 4GIVA 2FAZA 4NAWA 4WJOA 3CMMB 2LJ5A 5DPWA 3MTNB 3A1QA 2OJRA 2LGYA 4CHKA 5L83A 2JWZA 4HXDA 2ZCBA 4BFRA 1XQQA 3DPDA 3PRZA 5LXIB 4GDLA 4EZLA 2MBOA 4MDKE 3OJ4B 4A3PA 2MSED 5AZHA 5CX3A 4GGQA 4LDTB 1P1AA 2IO1B 4WQOB 1E8XA 2FCSA 2NBWB 4ANXA 3VQIA 1WGHA 1P3QU 2KK8A 3NZUA 4YL8A 4PS8A 2NS5A 2LGXA 1WGGA 3RT3B 2KWVB 2M0XA 2Z0EB 3EC8A 2D3GA 3PREA 3CSTA 3Q3JA 3K9PB 4WJNA 3RZWC 3N32A 3DQVA 2MX2A 3LDZE 2YLMA 1WXVA 3H7PB 4I6NB 4MGIE 1LQBA 3RULA 3IBEA 3NZSA 5TR5A 3VH4B 1UD7A 3M63B 3ZDMC 2RD0A 4E3CA 4GDKB 2KD0A 4AOFA 2RPQA 2L0FA 2NCNA 3KUDB 5KHOA 3KW5B 3M3JA 2IO2B 2KDIA 4W9KA 1TTNA 4MH0E 2V4LA 3DBRI 4KVGB 1OGWA 5EDSA 4RMAA 2IBIB 1WZ0A 2KANA 1WX8A 3WAMA 4AUQC 1E7UA 2V3SA 4FJYA 3UINB 3VTVA 2I1JA 2DX5B 2N4FA 3UGBB 5DCNA 1OQYA 2UWQA 4ZYNA 4MEMA 2NPTB 1WYWB 1WJNA 3IG3A 5DPSA 5C23A 1KLVA 4HJKA 4W9EA 5D94A 4ASWC 3R3MA 2KJ6A 4URKA 1KJTA 4JIOU 2BGFA 2GMIC 3H6NA 3PLVA 4MJSA 4G50A 4KZCA 4ZRKA 2N9PC 4WWPA 2WYQA 3PHWB 5AEKB 1EF1A 2M17A 3VVWB 4MGYE 3OAWA 1P9DU 1V81A 1E8ZA 4W9JA 3RZFA 4AP4C 2BYEA 3WA0A 4K1RB 3KYCD 2KFJA 3WAOA 5IAAC 3QCAA 1Q5WB
chains in the Genus database with same CATH superfamily
1R4MB 2NR2A 1UBQA 2GBNA 2W3RA 3URYA 4DHZE 3L13A 3P2BA 1NEKB 2NBVB 2K0PA 1T0YA 2L8JA 2FCQA 1R4NI 2K1FA 1E7VA 1TS4A 3NVVA 1UUPA 2LXAA 4JX1C 3AEEB 3IAS1 1P7FA 1TS3A 4M8NA 3W5VB 1WR6E 1ISNA 1K50A 1SE4A 1L0YB 4TMAB 3Q8EA 1FEHA 1YIWA 5E6NA 3VRBB 5FR3A 5EE0A 4LCDE 3U2SC 2D10A 3NZ3A 3RD2A 1J7BA 2IYDB 1IPGA 1QZEA 2W3SA 4US8A 5FK9C 3BYTB 3MC9A 2MQJA 2RSUA 2LUMA 4ICVA 1HXYD 4KGSA 1J8CA 1VCBA 1SE2A 1XEEA 1KLUD 2B3AA 2JVCA 4K7UA 3WCQA 1D3ZA 3C19A 4K7WA 2BS2B 3AH7A 1F2RC 3GOEA 3L4PA 4ARCA 3AE4B 4KGTA 5MPOA 2WXOA 3TEZA 1IP9A 1V6EA 4WWMA 3MC8A 3AE2B 3N3KB 4RM8A 3ENEA 1C1YB 1VDVA 2KWCA 2JYEA 3TEXA 3AE5B 2MBBB 3ZRFA 4BKSD 2WQYB 2KLGA 2MBQA 3GB1A 3M95A 4RGMA 1YX6B 1XF5L 2UYZB 2LVPA 3HM6X 1LFDA 1G6JA 4M01A 3TCAA 5D2MB 3TEWA 2XN9C 3DBHB 2D07B 2WDQB 1WX7A 2DLBA 1WI0A 2WWZA 1WZ3A 4KIKB 1FFVA 4BVUC 4HJGE 3OJ3A 2V9HA 1FIQA 1L6UA 3OG5A 4N6EB 3PV1A 3ZNHB 2BT6A 4K7SA 4PYUA 2KN4A 1SJHD 4YWGG 3N9YC 1ZGUB 3ZTCA 3E9SA 3ZUNA 2KDBA 2GBRA 2WGSA 3EFCA 1B9RA 2INCC 4IM0A 3UI3A 3UQAA 1WXSA 3DWGC 4WAAA 1T0RC 3L08A 1E0ZA 3Q3OC 5JH5C 5C1ZA 3P4PB 2LGDA 3L17A 4W9DA 3BIID 1LO5D 1XLPA 4HK2A 1FXTB 3QC8B 1SSNA 1YJJA 2IO0B 2L32A 5C2TB 2LVOA 2JY6A 1BT0A 2BS3B 2ICIA 2J52A 2PEAA 3AE6B 2LHEA 2CHZA 1LM8B 2L05A 5BMGA 4BKSA 2R61A 2KHWB 1R4MI 5E6PA 3TEYA 2JUOA 3PRPB 4ZOHC 4E74A 4LNOA 4W9GA 4HKZE 2MH7A 2LHDA 3RNGC 5D3IB 5D3DA 3N1XC 1FXIA 2GBMA 4C7YA 2BYTA 2XBBC 3QARA 1UNSA 4AJWA 2BW2A 1V80A 3WIMA 1ZP0B 3APCA 1ZUD2 1RAXA 3DBSA 4W9FA 2LXCA 2D5GA 2W54A 2KMCA 4NJ6A 2G45B 1IBXB 2GBKA 4M0WA 2QHOA 2WDRB 4DK5A 3ABVB 2BB5A 1OFFA 1TKYA 1RRBA 4OZAA 4MACA 3EA6A 2KZRA 3QK0A 1QOGA 3NS1A 3C8YA 2BTEA 1YN3A 1NYRA 3UIOB 3W1YA 4II2B 2D3CA 4XWWA 4LNKA 1TS5A 2K9XA 1JWBD 1RM6C 3CWIA 3NVYA 1MI0A 2VRRB 3RFZB 4EKUA 2KWUB 1V49A 2GBJA 2N7EA 1SE3A 2BF8B 5AZGA 1KFYB 1PUTA 3V6EB 2KTRA 2HJ1A 4BZAA 1T0QC 2KVZA 2W55A 1WMHA 3VAWA 1E7PB 1VRAB 2WXMA 3U8ZA 3QWZB 4DWFA 3BYYB 2JPHA 3V62A 2KQSA 3DBHI 5G5HA 3ZJUA 2YEPB 4RGTA 3MHSD 4MELA 1WM2A 3IFWB 3RNCC 1V1PB 3B2GA 2LUEA 3TJPA 1DOIA 2XEWA 1P98A 1GB1A 3NVWA 2BKRB 1YNTE 3VRAB 2QJLA 5D7GA 1STEA 2QDFA 3BINA 1Z5SB 3NOBA 2KVRA 3MC0B 4C80A 1MFWA 5IA7A 4YTNB 2CS4A 1WJ4A 1QOBA 5FKAC 4WJQA 1WRDB 4HPPA 4NAWA 5DPWA 3MTNB 2VZKD 2NMQA 2WXIA 4BFRA 1XQQA 5LXIB 4ACFA 4MDKE 2WU2B 4A3PA 1XCQL 4OW0A 2MSED 5CX3A 3KQ4A 2IO1B 3GS2A 1QOAA 2I2YA 1P3QU 2NS5A 2LGXA 2CU3A 3ZQ4A 2QC8A 2KWVB 3RT3B 1ZXHA 2Z0EB 2D3GA 3RZWC 2MX2A 3LDZE 2YLMA 1YJIA 4PK1A 4AS1A 3KUDB 2NCNA 5KHOA 4RF1A 3M3JA 1JALA 4GLSC 3RMKC 2IBIB 2JU6X 1WX8A 3WAMA 3UINB 4KX6B 3J9CA 3LXFA 1K51A 2I1JA 1FCCC 2DX5B 2N4FA 3UGBB 1OQYA 1L0VB 1WYWB 4A9AA 3MP9A 5C23A 4ARIA 4HJKA 1P7EA 1SJED 3Q3NC 5HG2A 2PIAA 2VH2A 4MJSA 4ZRKA 3PHWB 3RI7C 2M17A 3U7ZA 1A70A 4MGYE 2L83A 2N9KA 1ZDXA 3OAWA 5BYQA 4LLGM 4AP4C 2KFJA 1PFDA 1Q5WB 4TQ0A 5L95C 3W9CB 2PMVA 2N0SB 2PE9A 1A5RA 4JQWC 4ZRQA 1VZ8A 1UGMA 1WX9A 5EE3A 4MSQB 2G4DB 2J7QB 3IVFA 4P16A 4EZJA 3H7PA 3PLUA 1GUAB 3PT2B 4HPLB 2PLPA 3Q2AC 1C9FA 1NI3A 4B0MA 1RFKA 2ASQA 2Z8LA 4EUTA 1D4BA 1GNUA 3TMPB 4RF0A 2DAJA 4LJOB 4G11A 1FRRA 4BKTA 4YSXB 2ZNVB 1E8YA 1Y8RC 2SEBD 1QLBB 2BWFA 2MWSB 1RWSA 2NPTA 5GMVA 3AE1B 1UBIA 1D5ZC 4KKJA 4XZ4A 5E6OA 2KN5A 4W9HA 2MBEA 3RNFC 3X23A 2KT7A 4W9IA 2EMTA 4HKQA 2JZPA 1AN8A 1B1ZA 4JLCA 4LJPB 1WR1A 2HE7A 2JQRB 1QOFA 2PJHA 2DNFA 4A90A 3T8MA 3FAHA 3MJ5A 3ZW3A 1GPXA 2KDMA 1EF5A 4IUMB 2KQ7A 5TSSA 2WX1A 1QF6A 1BXTA 3DOWA 4F7ZA 2KYWA 4II3B 1SF0A 5AZFA 3VUWA 1PGBA 1H4RA 2EKIA 3GZNB 3GE3C 2K6DB 4MGZE 1GAQB 1SIJA 4GN1A 3TIXA 1WFYA 2BPSA 5DPTA 1JWMD 3ZGZA 3NY5A 2CJOA 3Q14C 2MW5A 1ET6A 2KJHB 2KXJA 2JT4B 1JWUD 4GMVA 3BVZA 4DXAB 1Q10A 2C60A 2K25A 4EFOA 1WH3A 1OQRA 1TZOA 4R3DA 2OJWA 1ESFA 1FMAD 1JRUA 1N60A 2JF5A 2DZIA 4YXDB 2BS4B 3I9V1 1AYFA 2K22A 2ZCCA 4GOCA 2CHXA 2X8XX 4FLHA 1T5XD 4RCOA 1IUEA 3VDZA 3CSFA 4NNJB 4M00A 3A4RA 1KH0A 2D3BA 3R66C 3Q3FA 1FNVA 5BMHA 1L0XB 4A55A 4C4VA 4JGHB 4M0WB 1FCLA 4ITKA 1WE7A 2H88B 4B6WA 4IWOA 3H7SA 3NUHB 1M4VA 4O1NA 1ZOYB 2MBHA 3K9OB 2K8BA 3V60A 4KV2A 5IO9A 1VD2A 4M02A 1YQ4B 2CJNA 2GI9A 1WXQA 1TZ1A 3DBRB 3GE8C 3PGEA 4ZRJA 4DBGA 1T3QA 1DOYA 1WY8A 3DVNU 3PHXB 3PRMB 3LJ3A 3R2TA 3JYUA 1JMLA 3A9KA 2J0JA 3JSVA 5KHQA 3P4QB 4IM3A 1OTRB 1V86A 2JXXA 3WALA 1WF9A 1EUVB 2PTLA 2KTRB 1S1QB 4XYCA 3SEBA 1WMHB 3ECIA 1T6BX 2M4NA 4F1SA 4N58A 1HZ6A 2M1MA 1WRIA 4BBNF 1FD6A 1YN4A 4QAYA 1KM7A 2MJ3A 4KKIA 4P1CC 3V3XA 2QMTA 2K8HA 1Z2MA 2NVUI 1C78A 2D3AA 1S3SG 5GXGB 5JHAA 3APDA 4XX5A 1PQSA 2RPVA 2N7JA 3I63C 4IG7B 3VHTC 2L1AA 1L7YA 2CR5A 3PZDA 2MLBA 4ZRIA 1V9JA 2Y3AA 3ZKJC 2A4ZA 4B9KA 1GC7A 4XWTA 3VUYA 5LLIA 4D2KA 1NBFC 4NAWB 2WDVB 3GZNI 1UH6A 3R8BA 4BAXA 3RCZA 2FUHB 3W1SC 1SEBD 2KFKA 3ZJVA 4AJYB 4OVUA 3Q6BA 1VR9A 3QAQA 1I4QA 4MGKE 1C79A 2DYOA 3AEDB 2MRPA 2DYBA 4A3OA 2KAJA 1V8CA 4A6QA 2I1KA 4WH4A 3DVNV 4XGAB 5HHDG 1F9JA 1RFAA 1ACCA 4ANWA 4K3BA 1C76A 3EECA 3ZXVA 1CQVA 2J0MA 4KSKC 4ZHPA 1IGDA 4BOZB 1IGCA 1TJEA 2KX3A 3HIZA 5AUKA 2KMMA 2DYMA 1Y56A 4LDTD 4HWIB 3RPFC 4YSYB 2O2VA 4B0EA 4L23A 3R7QA 4MH8A 1WGDA 3NG0A 3P4RB 1FNWA 3AU5A 1D5MC 4P7IA 4E71A 1C3TA 4WWNA 2LGSA 4MJSB 4CYEA 2FAZA 2OJRA 1D6EC 2LGYA 3DPDA 3PRZA 4GDLA 3SFEB 2RDHA 3OJ4B 1N62A 3P63A 4GGQA 1P1AA 1T0SC 1E8XA 2QCZA 1L4DB 1J7CA 3VQIA 1WGHA 1L4ZB 4YL8A 1XLOA 2J42A 5I4DA 2M0XA 3EC8A 2LMCA 1ZDVA 1C77A 2RMMA 3H7PB 3ETRA 3RULA 3IBEA 3BK2A 3NZSA 4OVZA 3VH4B 2WXPA 2INPE 2RD0A 1XCTL 2MJDA 3KW5B 2IO2B 2VZKB 4USAA 1XO3A 2V4LA 3DBRI 1OGWA 5EDSA 1WZ0A 2FBWB 1E7UA 1C4AA 2V3SA 4RFBA 1YMHE 4WAFA 3N20C 4ZYNA 2NPTB 1WJNA 1KLVA 4N59A 2KJ6A 4URKA 1KJTA 2BGFA 2GMIC 3H6NA 4G50A 4KZCA 3BVMA 4WWPA 5AEKB 3VVWB 2K3UA 1AWDA 1V81A 1E8ZA 4US9A 2BYEA 3WA0A 4K1RB 3QCAA 3VR8B 3VTWA 2ZVNA 2KJRA 1TY0A 1WE6A 3Q8CA 2FUG1 3AECB 2FIFA 4BOSC 1I42A 3SD5A 3ZLZA 3A33B 1WWTA 2M19A 3R7RA 4PS3A 3BK1A 1CMXB 1HTOA 1PGXA 4KDLB 1V2YA 1ZKHA 4MM3A 4DHJD 1UF0A 1VZ6A 2PW9A 3SDLC 2MA9B 2KQ4X 2Z0DB 3UF8A 2WHIA 2IGGA 3AULA 3EUB2 2O6VD 2PE6B 3HUIA 1E9MA 2J0KA 1MHXA 1NDDA 4BKGA 2K6QA 2DENB 2JXTA 4FULA 4DXGA 3TSSA 2EMSA 2AEHA 4IWPA 1JW9D 2LJIA 4HLEA 2MEKA 3LB8C 3KVFB 2LEKA 1HQRD 5IKCM 5CHVC 2CU1A 4L1BA 3QHTA 2LWPA 4JWUC 1UGJA 3CF6E 3IT4B 4MSMB 4RH6A 4FHKA 5LNK1 2HD5B 1J19A 3HRDD 4Q2JA 5G55A 3SFDB 2MP2A 2JYTA 3HK0A 2I38A 2INDC 2IGDA 2JZ3B 2E3TA 3P4SB 2YEPF 2L0TA 2LRWA 4GU2A 1BMLC 5DPRA 1F77A 2IGHA 2XK5A 3ZNID 4C00A 3PZ8A 3AE7B 4EEWA 2ZZPB 4FN2A 2AL3A 5BMIA 1PYWD 4C4VB 1CJEA 4M8MA 2KACA 1WM3A 3FILA 3I57A 3V05A 2QIEB 4NZLB 4IDIA 2WXRA 1VZ7A 5LXHA 1C4PA 4F8CB 1ROEA 2L3ZA 3D32A 4EOYA 4WQMA 3L16A 2O6VA 1U4AA 2ZPNA 2FIDA 4A20A 4J3OD 2C5LC 4FADA 4REZA 2ZEQA 4HDOA 5C3JB 1SE9A 4PS7A 2IO3B 2V3PA 2BWES 1XT9B 2JZZA 1HA5A 1N6ZA 2TSSA 3A9KB 3JSVB 3AE3B 2FCMA 3L10B 1JROA 3BZDB 4WIPA 1HE8A 5CTRC 3WANA 3I3TB 1YOVB 3L0WB 3NJTA 4G0NB 1DYQA 4LTUA 2LGIA 3KWLA 1L5PA 2QILA 1E90A 3RYTA 3T3OA 2M8SA 3B9JA 5JHBA 3V61A 2Y5BB 2V0GA 5EE1A 4OHJA 4P1BC 4TSSA 5BO4B 3ZYYX 4RNAA 4BBNC 2HTHA 4NQLB 4AWJA 1WXMA 3DVGX 2INNE 1MVKA 1WGYA 1PDXA 4I6LB 4ZHOA 1TKGA 3VFKA 2B76B 2KC1A 2FE8A 2DBYA 3ML9A 4ANVA 1RLFA 4FJVB 3PO0A 4GXBA 2DHZA 1JRPA 2FCNA 3WAPA 4P6VF 3QIJA 4WJPA 3U4EG 2LVQA 2N7DA 1WJ6A 3KUZA 4IKGA 1FXAA 2L52A 2GLSA 1NI2A 5H8YE 3AEBB 1MJDA 4N9F4 3Q69A 2WXKA 4C7ZA 3RNAC 2KFKB 2LD9A 1SBBB 4IC7B 1D5XC 1R7SA 2CHWA 1QQRA 3RNBC 2DZJA 3ZNZB 1K8RB 1K53A 1WGKA 1BUIC 2WU5B 2WXHA 2BYVE 3P42A 3CIRB 2ONQA 1XD3B 3APFA 2R2OA 2R2QA 4EE2A 2WLBA 3NHEB 5J2RA 3IHPC 2RGFA 4LNFA 4YT0B 4YTMB 2HJ8A 3HM3A 4W9CA 2O2VB 2JX5A 3LYYA 1I35A 1KLGD 1CK1A 2WX0A 2X38A 3AEAB 1YX5B 5G2NA 4FA6A 1WXAA 2EELA 4TV3A 3TL5A 2UU7A 3S2AA 2ZJDA 3NRZA 3JW0X 2PPHA 1V5OA 2AX5A 4GDLB 3ML8A 3C0RB 1K52A 1FM0D 3A9JA 2D11A 4KZ0A 2WNMA 1N63A 4GSWA 3W5UB 2K8CA 2L76A 1EU4A 1WGRA 4C56C 3EGRA 2C7NB 1I7HA 2RDGA 1ZPSA 4RM9A 4PT5A 3KUCB 3N1YC 2WXGA 2GOWA 1N5XA 1AW7A 2SAKA 4HPMB 4RGNA 3EHVA 2MHJA 3HHMA 4CO7A 2KNBA 3ZTDA 2V1YA 3T3NA 4ZYSA 3Q3MC 2IJ0A 3Q8BA 1L2NA 4X57B 3RUIB 2A5UA 2G1EA 4WJOA 2M0AA 3A1QA 4CHKA 5L83A 3N1ZC 2JWZA 2ZCBA 4H2AA 2OEDA 3E56A 4EZLA 4LNIA 4CQNA 5AZHA 4LDTB 3AN1A 1F52A 4WQOB 2BQQA 1NENB 1TT5B 2KK8A 3NZUA 4PS8A 1WGGA 3K9PB 1TKEA 2G9HD 4A8XC 4MGIE 4MM3B 2VH1A 5TR5A 3M63B 1UD7A 3ZDMC 1FRDA 4E3CA 4AOFA 2KD0A 5IN7A 2RPQA 2L0FA 3DHIC 4JE3B 2KDIA 1TY2A 3Q8AA 4NJCA 4W9KA 4MH0E 1TS2A 4KVGB 4FXCA 2KANA 2WXNA 5AUIA 4AUQC 1WYGA 2BB6A 3KWVA 5DCNA 1E6EB 3IG3A 5DPSA 3O13A 5D94A 4ASWC 1KTKA 2V3NA 4JIOU 3AV8A 1ET9A 1SXTA 2N9PC 2WYQA 1MHHE 1ZE3D 1P9DU 4W9JA 3RZFA 2N9LA 3KYCD 3WAOA 5IAAC 4J6IA 2YVCA 4LK0M 2Q5WD 3B08A 3X0WA 2QEJC 5CHWA 1TIFA 5HI1A 2MP2B 2K39A 3AE8B 2HDEA 2LRUA 3QJZA 3VTUA 3MFGA 4DXFA 3JVZX 3TUOA 2J4XA 1F1HA 2AL6A 1UELA 4GDKA 4FJZA 3FC4A 4OZCA 2JSVX 4S0RA 2KDEB 3B2FA 2XK5B 2GRIA 2FNJB 4OVVA 2Y5CA 3OLMD 2PVGC 1YN5A 1N61A 4KSLC 4HCNB 2WS3B 3QQ8B 4AQ7A 5IP4D 1WJUA 2KMAA 3FILB 3AU4A 2LZ6A 1E8WA 5EE9A 3AEGB 5H92C 3VH3B 1KOTA 2XNAC 1YJ1A 4DHJB 3ONSA 4TUUA 2MJEA 1L6VA 1I4GA 3B1LX 4WWOA 2O6VB 3T9LA 3N30A 3U7DA 2AQ2B 1YD8U 3BWUD 1TGZB 1KRHA 3DBLB 1MG4A 1JWAD 2L00B 4FHJA 3V6CB 4IW0A 1I4HA 1IYFA 1YQ3B 3AE9B 5J17A 1XLQA 2JWUA 1EM7A 4ZRPA 1DOXA 4IM2A 1QILA 3SHQA 4TQ1A 1TYGB 3ZRCA 5IOIA 3PZ7A 4OZBA 4PYZA 3AI5A 2LI5A 2N9EB 2GB1A 2WXLA 4KDIC 4HVBA 2DAFA 3AMZA 2Z59B 3H1UA 1YQBA 2BKFA 2KX0A 4WURA 2IY0B 4HEA1 3GP7A 2G4SA 4IWQA 5HKHA 3W2DA 1HEZE 3BY4B 3SU8X 4MT5A 3ZVVA 5G5GA 3P1MA 4JPSA 1GJZA 4W9LA 1I4RA 5JZEB 4ICUA 3B0AA 1NVID 3H8HA 3ZDTA 1HZ5A 3U30A 2KDFB 3A4SC 2KOXA 2G3QB 2JRHA 2KWDA 2D2QA 1QKZA 1TBEA 2EKEC 2AWTA 2RDBC 3ZXRA 3VXWA 1OEYJ 2C7MB 2NTSA 2IPKD 5FR6A 4S17A 1DGJA 1CZPA 4GB9A 2C7HA 1EO6A 3KH0A 1HTQA 1XXGA 1X1MA 3QA8A 3I5JC 2ON8A 2WXJA 2PKOA 2C9WB 4L2YA 2N1WA 4EZKA 2CKHB 4RGOS 3RNEC 2WXFA 4NJ7A 2QSDA 2OHFA 1OEYA 3DVGY 1ZW7A 3NVZA 4KIKA 2RR9A 3ZIMA 4DHZB 3ZJTA 3DHHC 2KC2A 2N1VA 1LGRA 3PVLA 4ANUA 2ZNVC 1JWSD 4I6PA 3IAM1 1E10A 4XE0A 5J18A 3BVGA 1LXDA 3ZNGC 1J7AA 3FKYA 1UWMA 3NS8A 4K81A 5JXVA 1EWCA 2KLCA 4IOIE 2ZVOA 3H9DA 4DDGD 5D6JB 3EFUA 4NPNA 1SGHA 4ZDVA 4XC2A 3QX1A 3U52E 2KTFA 1ZXIA 1V97A 2MCNB 4NQKE 2WDTB 3A9JB 2L7RA 3MHZA 2KKCA 3O65B 2ACZB 2AQ1B 2ZW1A 4JL9A 2JRIB 1VLBA 2KO3A 4DQOC 2N9XA 1V1OA 2PVOD 4K3CA 2J53A 2IY1B 4G3XB 1WIAA 4DDID 1F2RI 2NTTA 1GG3A 1UZXB 3AXCA 1FFUA 3DCGA 1R4NB 3KYDD 2AYOB 3ALBA 1MG8A 3ZO5B 5HFYA 3DBLI 1PGAA 5BYSA 3HVDA 1J0GA 3PPAA 1VJKA 5E6JA 3MJWA 1E5WA 2BBCA 3VR9B 3UIPB 1N5WA 2LFIA 3DWMA 2Y5PA 1JCKB 2IZVB 2WP9B 5CHFA 3AEFB 1F0ZA 1Q1OA 2H89B 3VUXA 1M94A 3A1QB 2BYFA 3Q8FA 1EU3A 1FO4A 1SIFA 2AQ3B 1IBXA 1I4XA 3M62B 1JQ4A 4FBJB 2BVCA 2NBUA 3AM9A 2DZKA 4NY0A 1V5TA 4JWSC 1RYJA 1GC6A 4HRSA 4KGRA 1P0RA 4B95A 1EWYC 3TBLD 3AB5A 3L54A 1AARA 4HCPB 2OOBB 3KLSX 2DZMA 3DDCB 3PTFC 5BYRA 3UQBA 1Q0WB 1NYQA 4YTPB 4TKNA 3PSEB 2REXA 2LASA 2ZW0A 3W1SA 2W9NA 2ZPYA 3DHGC 1H8CA 4LNNA 2WXQA 4XDDA 4HDQA 3PS6A 3R2IA 2K5PA 1WSPA 2W82A 4GIVA 3HVZA 1GOZA 2LJ5A 3CMMB 1I4PA 4HXDA 2HTME 2MBOA 4YSZB 1MPEA 1UWXA 2FCSA 2NBWB 1OQQA 4HROA 4UDUC 4ANXA 1XLNA 3RN9C 3PREA 3CSTA 3Q3JA 4WJNA 3N32A 1V1PA 3DQVA 1WXVA 2IDYA 4I6NB 1LQBA 1C4CA 4GDKB 1TTNA 4RMAA 4FJYA 3VTVA 5T8IA 3IT6B 4NAMA 2UWQA 3IXSA 1QT9A 4MEMA 4XDCA 2DWQA 2E6XA 3SR6A 4W9EA 2M56B 3R3MA 3PLVA 1FPYA 1FNUA 1KF6B 3OWEB 1GB4A 1EF1A 1ENFA 1SB3C 2V4IB
chains in the Genus database with same CATH topology
4J6IA 3VTWA 2YVCA 4TQ0A 5L95C 2ZVNA 2NR2A 2KJRA 1UBQA 2GBNA 1WE6A 3B08A 2PE9A 3X0WA 1A5RA 2FIFA 4JQWC 4BOSC 1I42A 5CHWA 4DHZE 3SD5A 3L13A 3P2BA 1UGMA 2MP2B 2NBVB 3ZLZA 1WX9A 3A33B 4MSQB 2G4DB 1T0YA 3R7RA 2K39A 2J7QB 2LRUA 2L8JA 3QJZA 2FCQA 4PS3A 1CMXB 3VTUA 3IVFA 1R4NI 4KDLB 2K1FA 4EZJA 3H7PA 1E7VA 1V2YA 1GUAB 1ZKHA 3JVZX 3PLUA 3PT2B 4HPLB 4MM3A 2AL6A 1UELA 2LXAA 4DHJD 4GDKA 3SDLC 2MA9B 4FJZA 2Z0DB 2ASQA 3UF8A 3AULA 4M8NA 4EUTA 1GNUA 2O6VD 3TMPB 2PE6B 2KDEB 1WR6E 2DAJA 4LJOB 4G11A 1ISNA 2J0KA 2XK5B 2FNJB 4BKTA 1NDDA 4BKGA 4OVVA 2K6QA 2DENB 2ZNVB 1E8YA 1Y8RC 3OLMD 1YIWA 2BWFA 4FULA 5E6NA 2MWSB 2EMSA 4KSLC 4LCDE 4HCNB 2D10A 2AEHA 2NPTA 3QQ8B 5GMVA 3RD2A 1UBIA 4IWPA 1WJUA 2IYDB 2KMAA 1IPGA 4HLEA 1QZEA 4XZ4A 5E6OA 2KN5A 3AU4A 2LZ6A 1E8WA 3KVFB 3VH3B 1KOTA 4W9HA 2MBEA 1YJ1A 3X23A 4DHJB 2MQJA 4W9IA 2RSUA 2EMTA 3ONSA 5CHVC 2CU1A 4TUUA 3QHTA 2LWPA 3B1LX 3CF6E 4WWOA 2O6VB 4ICVA 3N30A 3T9LA 3U7DA 4JLCA 4LJPB 1WR1A 1YD8U 2HE7A 4MSMB 1J8CA 1TGZB 4FHKA 1VCBA 2HD5B 2PJHA 1J19A 2B3AA 2JVCA 4K7UA 5G55A 3T8MA 2MP2A 1D3ZA 4K7WA 3HK0A 3ZW3A 2L00B 4FHJA 3GOEA 3V6CB 4IW0A 2JZ3B 1EF5A 4IUMB 2KQ7A 1IYFA 1IP9A 2WX1A 5J17A 1V6EA 3DOWA 3N3KB 2L0TA 4F7ZA 2LRWA 4II3B 3ENEA 1C1YB 4IM2A 2KWCA 4RM8A 4GU2A 2MBBB 4TQ1A 5AZFA 3SHQA 3VUWA 3ZRFA 4BKSD 5DPRA 3ZRCA 1H4RA 2KLGA 2XK5A 3ZNID 4EEWA 2ZZPB 2MBQA 4FN2A 3M95A 2K6DB 4MGZE 2AL3A 3AI5A 4PYZA 1YX6B 2LI5A 2UYZB 4GN1A 3TIXA 2LVPA 2N9EB 3HM6X 1LFDA 1WFYA 4KDIC 2BPSA 4M8MA 4HVBA 1G6JA 5DPTA 2DAFA 3NY5A 2Z59B 1WM3A 3H1UA 1YQBA 2MW5A 3TCAA 2BKFA 2KX0A 5D2MB 2KJHB 2IY0B 2KXJA 2G4SA 4IWQA 5HKHA 2D07B 2JT4B 1WX7A 5LXHA 4GMVA 1WI0A 4F8CB 4DXAB 2WWZA 3BY4B 2C60A 3SU8X 2K25A 1WZ3A 2L3ZA 3D32A 4KIKB 3ZVVA 4EFOA 4EOYA 1WH3A 3L16A 2O6VA 1U4AA 2ZPNA 1GJZA 4BVUC 4W9LA 1JRUA 2FIDA 4ICUA 3B0AA 4A20A 5JZEB 2JF5A 3ZDTA 3OJ3A 3U30A 2C5LC 4FADA 2DZIA 2KDFB 3A4SC 2ZEQA 4HDOA 1SE9A 4PS7A 2KOXA 2G3QB 3PV1A 2IO3B 3ZNHB 2BWES 2JRHA 4K7SA 4PYUA 2ZCCA 1XT9B 2D2QA 4GOCA 2CHXA 1TBEA 2JZZA 1ZGUB 2EKEC 3ZTCA 3ZUNA 2KDBA 2AWTA 4FLHA 2GBRA 3VDZA 3A9KB 3JSVB 1OEYJ 3CSFA 3VXWA 4IM0A 2C7MB 5FR6A 3UQAA 1WXSA 4WAAA 2FCMA 3L10B 3L08A 4NNJB 3A4RA 4GB9A 1HE8A 2C7HA 5CTRC 3WANA 5JH5C 1EO6A 3I3TB 3KH0A 5C1ZA 2LGDA 3L17A 1X1MA 3R66C 3QA8A 3Q3FA 4W9DA 2C9WB 4HK2A 3L0WB 4JGHB 2N1WA 4G0NB 1FXTB 4M0WB 3QC8B 4EZKA 2CKHB 2IO0B 1WE7A 4B6WA 2LVOA 4IWOA 2JY6A 3H7SA 1BT0A 4NJ7A 1E90A 3RYTA 2M8SA 5JHBA 3V61A 1OEYA 2Y5BB 3DVGY 2PEAA 1ZW7A 2MBHA 2K8BA 3K9OB 4KIKA 2CHZA 1LM8B 3V60A 2RR9A 2L05A 4KV2A 3ZIMA 4DHZB 5BO4B 4BKSA 2KC2A 2N1VA 3PVLA 4ANUA 1VD2A 1R4MI 2KHWB 2ZNVC 2HTHA 2JUOA 3PRPB 5E6PA 4NQLB 4BBNC 4E74A 4W9GA 1TZ1A 1WXMA 3DVGX 4I6PA 4AWJA 5J18A 1WGYA 4I6LB 3PGEA 1LXDA 3ZNGC 4ZRJA 3VFKA 4DBGA 3NS8A 1WY8A 4K81A 3DVNU 2GBMA 2KC1A 3PHXB 2KLCA 3ML9A 3PRMB 4ANVA 1RLFA 3LJ3A 4FJVB 2XBBC 3JYUA 2DHZA 2ZVOA 3H9DA 3QARA 4GXBA 4DDGD 2FCNA 3A9KA 2J0JA 3JSVA 3WAPA 5D6JB 3EFUA 4AJWA 5KHQA 1V80A 4IM3A 3QIJA 4NPNA 4WJPA 1OTRB 1V86A 3WIMA 2LVQA 2N7DA 1SGHA 1WJ6A 2JXXA 3APCA 1WF9A 1EUVB 3KUZA 3WALA 4ZDVA 1RAXA 4XC2A 3DBSA 3QX1A 4W9FA 1NI2A 2KTRB 2LXCA 1S1QB 2KTFA 4N9F4 2MCNB 2KMCA 4NQKE 1WMHB 3ECIA 4NJ6A 2WDTB 2G45B 3A9JB 2KFKB 2L7RA 2LD9A 2KKCA 2M4NA 4F1SA 2GBKA 4IC7B 3O65B 2CHWA 2QHOA 4JL9A 2JRIB 2DZJA 3ZNZB 1K8RB 4DK5A 2KO3A 2M1MA 2N9XA 4BBNF 2IY1B 4G3XB 1WIAA 4DDID 1RRBA 1GG3A 1UZXB 1KM7A 3AXCA 3DCGA 2KZRA 3QK0A 2BYVE 3KYDD 2AYOB 3ALBA 1XD3B 2K8HA 1MG8A 1Z2MA 2NVUI 3ZO5B 3UIOB 1S3SG 5JHAA 3W1YA 3APFA 2R2OA 2R2QA 3APDA 4II2B 3DBLI 3NHEB 5J2RA 4XX5A 1PQSA 3IHPC 2RGFA 1J0GA 3PPAA 4IG7B 3VHTC 3MJWA 1L7YA 2CR5A 2HJ8A 1E5WA 2VRRB 3HM3A 4W9CA 2O2VB 3PZDA 4EKUA 2KWUB 3UIPB 2MLBA 1V49A 1I35A 4ZRIA 2GBJA 2IZVB 1V9JA 2N7EA 5CHFA 2WX0A 2BF8B 1YX5B 2A4ZA 5AZGA 5G2NA 3ZKJC 1GC7A 4B9KA 4FA6A 1WXAA 1Q1OA 3TL5A 4TV3A 3VUYA 5LLIA 3S2AA 3V6EB 1NBFC 4NAWB 2KTRA 2ZJDA 1M94A 3VUXA 3GZNI 3A1QB 2BYFA 1UH6A 3JW0X 2PPHA 1V5OA 3RCZA 1WMHA 4GDLB 1SIFA 3C0RB 3ML8A 2FUHB 3W1SC 3A9JA 2KFKA 2D11A 4KZ0A 3VAWA 4AJYB 4OVUA 3QAQA 3M62B 3U8ZA 3QWZB 4GSWA 4DWFA 4FBJB 2JPHA 4MGKE 2DYOA 2K8CA 2NBUA 3V62A 2DZKA 2KQSA 2L76A 3DBHI 2MRPA 2DYBA 4A3OA 4NY0A 1V5TA 3MHSD 2I1KA 4MELA 1WGRA 3DVNV 1WM2A 1GC6A 2C7NB 3IFWB 1F9JA 1RFAA 2LUEA 4ANWA 1P0RA 4B95A 4RM9A 3TJPA 3EECA 3KUCB 2XEWA 2J0MA 3TBLD 2GOWA 4KSKC 1P98A 3L54A 2BKRB 4HPMB 4BOZB 3EHVA 3HHMA 2KX3A 4CO7A 1AARA 2KNBA 2OOBB 3HIZA 2DZMA 3DDCB 3PTFC 4HCPB 3UQBA 1Q0WB 5D7GA 2DYMA 3ZTDA 4TKNA 4LDTD 4HWIB 3BINA 3PSEB 2REXA 2LASA 3W1SA 2W9NA 2ZPYA 1H8CA 1Z5SB 2V1YA 2O2VA 3NOBA 2KVRA 3R7QA 1WGDA 3AU5A 5IA7A 4HDQA 2CS4A 4P7IA 1WJ4A 1L2NA 3PS6A 4X57B 3RUIB 4E71A 4WJQA 1C3TA 4WWNA 2A5UA 1WRDB 4MJSB 4CYEA 4GIVA 2FAZA 4NAWA 4WJOA 3CMMB 2LJ5A 5DPWA 3MTNB 3A1QA 2OJRA 2LGYA 4CHKA 5L83A 2JWZA 4HXDA 2ZCBA 4BFRA 1XQQA 3DPDA 3PRZA 5LXIB 4GDLA 4EZLA 2MBOA 4MDKE 3OJ4B 4A3PA 2MSED 5AZHA 5CX3A 4GGQA 4LDTB 1P1AA 2IO1B 4WQOB 1E8XA 2FCSA 2NBWB 4ANXA 3VQIA 1WGHA 1P3QU 2KK8A 3NZUA 4YL8A 4PS8A 2NS5A 2LGXA 1WGGA 3RT3B 2KWVB 2M0XA 2Z0EB 3EC8A 2D3GA 3PREA 3CSTA 3Q3JA 3K9PB 4WJNA 3RZWC 3N32A 3DQVA 2MX2A 3LDZE 2YLMA 1WXVA 3H7PB 4I6NB 4MGIE 1LQBA 3RULA 3IBEA 3NZSA 5TR5A 3VH4B 1UD7A 3M63B 3ZDMC 2RD0A 4E3CA 4GDKB 2KD0A 4AOFA 2RPQA 2L0FA 2NCNA 3KUDB 5KHOA 3KW5B 3M3JA 2IO2B 2KDIA 4W9KA 1TTNA 4MH0E 2V4LA 3DBRI 4KVGB 1OGWA 5EDSA 4RMAA 2IBIB 1WZ0A 2KANA 1WX8A 3WAMA 4AUQC 1E7UA 2V3SA 4FJYA 3UINB 3VTVA 2I1JA 2DX5B 2N4FA 3UGBB 5DCNA 1OQYA 2UWQA 4ZYNA 4MEMA 2NPTB 1WYWB 1WJNA 3IG3A 5DPSA 5C23A 1KLVA 4HJKA 4W9EA 5D94A 4ASWC 3R3MA 2KJ6A 4URKA 1KJTA 4JIOU 2BGFA 2GMIC 3H6NA 3PLVA 4MJSA 4G50A 4KZCA 4ZRKA 2N9PC 4WWPA 2WYQA 3PHWB 5AEKB 1EF1A 2M17A 3VVWB 4MGYE 3OAWA 1P9DU 1V81A 1E8ZA 4W9JA 3RZFA 4AP4C 2BYEA 3WA0A 4K1RB 3KYCD 2KFJA 3WAOA 5IAAC 3QCAA 1Q5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6I A;  3VTW A;  2YVC A;  4TQ0 A;  5L95 C;  2ZVN A;  2NR2 A;  2KJR A;  1UBQ A;  2GBN A;  1WE6 A;  3B08 A;  2PE9 A;  3X0W A;  1A5R A;  2FIF A;  4JQW C;  4BOS C;  1I42 A;  5CHW A;  4DHZ E;  3SD5 A;  3L13 A;  3P2B A;  1UGM A;  2MP2 B;  2NBV B;  3ZLZ A;  1WX9 A;  3A33 B;  4MSQ B;  2G4D B;  1T0Y A;  3R7R A;  2K39 A;  2J7Q B;  2LRU A;  2L8J A;  3QJZ A;  2FCQ A;  4PS3 A;  1CMX B;  3VTU A;  3IVF A;  1R4N I;  4KDL B;  2K1F A;  4EZJ A;  3H7P A;  1E7V A;  1V2Y A;  1GUA B;  1ZKH A;  3JVZ X;  3PLU A;  3PT2 B;  4HPL B;  4MM3 A;  2AL6 A;  1UEL A;  2LXA A;  4DHJ D;  4GDK A;  3SDL C;  2MA9 B;  4FJZ A;  2Z0D B;  2ASQ A;  3UF8 A;  3AUL A;  4M8N A;  4EUT A;  1GNU A;  2O6V D;  3TMP B;  2PE6 B;  2KDE B;  1WR6 E;  2DAJ A;  4LJO B;  4G11 A;  1ISN A;  2J0K A;  2XK5 B;  2FNJ B;  4BKT A;  1NDD A;  4BKG A;  4OVV A;  2K6Q A;  2DEN B;  2ZNV B;  1E8Y A;  1Y8R C;  3OLM D;  1YIW A;  2BWF A;  4FUL A;  5E6N A;  2MWS B;  2EMS A;  4KSL C;  4LCD E;  4HCN B;  2D10 A;  2AEH A;  2NPT A;  3QQ8 B;  5GMV A;  3RD2 A;  1UBI A;  4IWP A;  1WJU A;  2IYD B;  2KMA A;  1IPG A;  4HLE A;  1QZE A;  4XZ4 A;  5E6O A;  2KN5 A;  3AU4 A;  2LZ6 A;  1E8W A;  3KVF B;  3VH3 B;  1KOT A;  4W9H A;  2MBE A;  1YJ1 A;  3X23 A;  4DHJ B;  2MQJ A;  4W9I A;  2RSU A;  2EMT A;  3ONS A;  5CHV C;  2CU1 A;  4TUU A;  3QHT A;  2LWP A;  3B1L X;  3CF6 E;  4WWO A;  2O6V B;  4ICV A;  3N30 A;  3T9L A;  3U7D A;  4JLC A;  4LJP B;  1WR1 A;  1YD8 U;  2HE7 A;  4MSM B;  1J8C A;  1TGZ B;  4FHK A;  1VCB A;  2HD5 B;  2PJH A;  1J19 A;  2B3A A;  2JVC A;  4K7U A;  5G55 A;  3T8M A;  2MP2 A;  1D3Z A;  4K7W A;  3HK0 A;  3ZW3 A;  2L00 B;  4FHJ A;  3GOE A;  3V6C B;  4IW0 A;  2JZ3 B;  1EF5 A;  4IUM B;  2KQ7 A;  1IYF A;  1IP9 A;  2WX1 A;  5J17 A;  1V6E A;  3DOW A;  3N3K B;  2L0T A;  4F7Z A;  2LRW A;  4II3 B;  3ENE A;  1C1Y B;  4IM2 A;  2KWC A;  4RM8 A;  4GU2 A;  2MBB B;  4TQ1 A;  5AZF A;  3SHQ A;  3VUW A;  3ZRF A;  4BKS D;  5DPR A;  3ZRC A;  1H4R A;  2KLG A;  2XK5 A;  3ZNI D;  4EEW A;  2ZZP B;  2MBQ A;  4FN2 A;  3M95 A;  2K6D B;  4MGZ E;  2AL3 A;  3AI5 A;  4PYZ A;  1YX6 B;  2LI5 A;  2UYZ B;  4GN1 A;  3TIX A;  2LVP A;  2N9E B;  3HM6 X;  1LFD A;  1WFY A;  4KDI C;  2BPS A;  4M8M A;  4HVB A;  1G6J A;  5DPT A;  2DAF A;  3NY5 A;  2Z59 B;  1WM3 A;  3H1U A;  1YQB A;  2MW5 A;  3TCA A;  2BKF A;  2KX0 A;  5D2M B;  2KJH B;  2IY0 B;  2KXJ A;  2G4S A;  4IWQ A;  5HKH A;  2D07 B;  2JT4 B;  1WX7 A;  5LXH A;  4GMV A;  1WI0 A;  4F8C B;  4DXA B;  2WWZ A;  3BY4 B;  2C60 A;  3SU8 X;  2K25 A;  1WZ3 A;  2L3Z A;  3D32 A;  4KIK B;  3ZVV A;  4EFO A;  4EOY A;  1WH3 A;  3L16 A;  2O6V A;  1U4A A;  2ZPN A;  1GJZ A;  4BVU C;  4W9L A;  1JRU A;  2FID A;  4ICU A;  3B0A A;  4A20 A;  5JZE B;  2JF5 A;  3ZDT A;  3OJ3 A;  3U30 A;  2C5L C;  4FAD A;  2DZI A;  2KDF B;  3A4S C;  2ZEQ A;  4HDO A;  1SE9 A;  4PS7 A;  2KOX A;  2G3Q B;  3PV1 A;  2IO3 B;  3ZNH B;  2BWE S;  2JRH A;  4K7S A;  4PYU A;  2ZCC A;  1XT9 B;  2D2Q A;  4GOC A;  2CHX A;  1TBE A;  2JZZ A;  1ZGU B;  2EKE C;  3ZTC A;  3ZUN A;  2KDB A;  2AWT A;  4FLH A;  2GBR A;  3VDZ A;  3A9K B;  3JSV B;  1OEY J;  3CSF A;  3VXW A;  4IM0 A;  2C7M B;  5FR6 A;  3UQA A;  1WXS A;  4WAA A;  2FCM A;  3L10 B;  3L08 A;  4NNJ B;  3A4R A;  4GB9 A;  1HE8 A;  2C7H A;  5CTR C;  3WAN A;  5JH5 C;  1EO6 A;  3I3T B;  3KH0 A;  5C1Z A;  2LGD A;  3L17 A;  1X1M A;  3R66 C;  3QA8 A;  3Q3F A;  4W9D A;  2C9W B;  4HK2 A;  3L0W B;  4JGH B;  2N1W A;  4G0N B;  1FXT B;  4M0W B;  3QC8 B;  4EZK A;  2CKH B;  2IO0 B;  1WE7 A;  4B6W A;  2LVO A;  4IWO A;  2JY6 A;  3H7S A;  1BT0 A;  4NJ7 A;  1E90 A;  3RYT A;  2M8S A;  5JHB A;  3V61 A;  1OEY A;  2Y5B B;  3DVG Y;  2PEA A;  1ZW7 A;  2MBH A;  2K8B A;  3K9O B;  4KIK A;  2CHZ A;  1LM8 B;  3V60 A;  2RR9 A;  2L05 A;  4KV2 A;  3ZIM A;  4DHZ B;  5BO4 B;  4BKS A;  2KC2 A;  2N1V A;  3PVL A;  4ANU A;  1VD2 A;  1R4M I;  2KHW B;  2ZNV C;  2HTH A;  2JUO A;  3PRP B;  5E6P A;  4NQL B;  4BBN C;  4E74 A;  4W9G A;  1TZ1 A;  1WXM A;  3DVG X;  4I6P A;  4AWJ A;  5J18 A;  1WGY A;  4I6L B;  3PGE A;  1LXD A;  3ZNG C;  4ZRJ A;  3VFK A;  4DBG A;  3NS8 A;  1WY8 A;  4K81 A;  3DVN U;  2GBM A;  2KC1 A;  3PHX B;  2KLC A;  3ML9 A;  3PRM B;  4ANV A;  1RLF A;  3LJ3 A;  4FJV B;  2XBB C;  3JYU A;  2DHZ A;  2ZVO A;  3H9D A;  3QAR A;  4GXB A;  4DDG D;  2FCN A;  3A9K A;  2J0J A;  3JSV A;  3WAP A;  5D6J B;  3EFU A;  4AJW A;  5KHQ A;  1V80 A;  4IM3 A;  3QIJ A;  4NPN A;  4WJP A;  1OTR B;  1V86 A;  3WIM A;  2LVQ A;  2N7D A;  1SGH A;  1WJ6 A;  2JXX A;  3APC A;  1WF9 A;  1EUV B;  3KUZ A;  3WAL A;  4ZDV A;  1RAX A;  4XC2 A;  3DBS A;  3QX1 A;  4W9F A;  1NI2 A;  2KTR B;  2LXC A;  1S1Q B;  2KTF A;  4N9F 4;  2MCN B;  2KMC A;  4NQK E;  1WMH B;  3ECI A;  4NJ6 A;  2WDT B;  2G45 B;  3A9J B;  2KFK B;  2L7R A;  2LD9 A;  2KKC A;  2M4N A;  4F1S A;  2GBK A;  4IC7 B;  3O65 B;  2CHW A;  2QHO A;  4JL9 A;  2JRI B;  2DZJ A;  3ZNZ B;  1K8R B;  4DK5 A;  2KO3 A;  2M1M A;  2N9X A;  4BBN F;  2IY1 B;  4G3X B;  1WIA A;  4DDI D;  1RRB A;  1GG3 A;  1UZX B;  1KM7 A;  3AXC A;  3DCG A;  2KZR A;  3QK0 A;  2BYV E;  3KYD D;  2AYO B;  3ALB A;  1XD3 B;  2K8H A;  1MG8 A;  1Z2M A;  2NVU I;  3ZO5 B;  3UIO B;  1S3S G;  5JHA A;  3W1Y A;  3APF A;  2R2O A;  2R2Q A;  3APD A;  4II2 B;  3DBL I;  3NHE B;  5J2R A;  4XX5 A;  1PQS A;  3IHP C;  2RGF A;  1J0G A;  3PPA A;  4IG7 B;  3VHT C;  3MJW A;  1L7Y A;  2CR5 A;  2HJ8 A;  1E5W A;  2VRR B;  3HM3 A;  4W9C A;  2O2V B;  3PZD A;  4EKU A;  2KWU B;  3UIP B;  2MLB A;  1V49 A;  1I35 A;  4ZRI A;  2GBJ A;  2IZV B;  1V9J A;  2N7E A;  5CHF A;  2WX0 A;  2BF8 B;  1YX5 B;  2A4Z A;  5AZG A;  5G2N A;  3ZKJ C;  1GC7 A;  4B9K A;  4FA6 A;  1WXA A;  1Q1O A;  3TL5 A;  4TV3 A;  3VUY A;  5LLI A;  3S2A A;  3V6E B;  1NBF C;  4NAW B;  2KTR A;  2ZJD A;  1M94 A;  3VUX A;  3GZN I;  3A1Q B;  2BYF A;  1UH6 A;  3JW0 X;  2PPH A;  1V5O A;  3RCZ A;  1WMH A;  4GDL B;  1SIF A;  3C0R B;  3ML8 A;  2FUH B;  3W1S C;  3A9J A;  2KFK A;  2D11 A;  4KZ0 A;  3VAW A;  4AJY B;  4OVU A;  3QAQ A;  3M62 B;  3U8Z A;  3QWZ B;  4GSW A;  4DWF A;  4FBJ B;  2JPH A;  4MGK E;  2DYO A;  2K8C A;  2NBU A;  3V62 A;  2DZK A;  2KQS A;  2L76 A;  3DBH I;  2MRP A;  2DYB A;  4A3O A;  4NY0 A;  1V5T A;  3MHS D;  2I1K A;  4MEL A;  1WGR A;  3DVN V;  1WM2 A;  1GC6 A;  2C7N B;  3IFW B;  1F9J A;  1RFA A;  2LUE A;  4ANW A;  1P0R A;  4B95 A;  4RM9 A;  3TJP A;  3EEC A;  3KUC B;  2XEW A;  2J0M A;  3TBL D;  2GOW A;  4KSK C;  1P98 A;  3L54 A;  2BKR B;  4HPM B;  4BOZ B;  3EHV A;  3HHM A;  2KX3 A;  4CO7 A;  1AAR A;  2KNB A;  2OOB B;  3HIZ A;  2DZM A;  3DDC B;  3PTF C;  4HCP B;  3UQB A;  1Q0W B;  5D7G A;  2DYM A;  3ZTD A;  4TKN A;  4LDT D;  4HWI B;  3BIN A;  3PSE B;  2REX A;  2LAS A;  3W1S A;  2W9N A;  2ZPY A;  1H8C A;  1Z5S B;  2V1Y A;  2O2V A;  3NOB A;  2KVR A;  3R7Q A;  1WGD A;  3AU5 A;  5IA7 A;  4HDQ A;  2CS4 A;  4P7I A;  1WJ4 A;  1L2N A;  3PS6 A;  4X57 B;  3RUI B;  4E71 A;  4WJQ A;  1C3T A;  4WWN A;  2A5U A;  1WRD B;  4MJS B;  4CYE A;  4GIV A;  2FAZ A;  4NAW A;  4WJO A;  3CMM B;  2LJ5 A;  5DPW A;  3MTN B;  3A1Q A;  2OJR A;  2LGY A;  4CHK A;  5L83 A;  2JWZ A;  4HXD A;  2ZCB A;  4BFR A;  1XQQ A;  3DPD A;  3PRZ A;  5LXI B;  4GDL A;  4EZL A;  2MBO A;  4MDK E;  3OJ4 B;  4A3P A;  2MSE D;  5AZH A;  5CX3 A;  4GGQ A;  4LDT B;  1P1A A;  2IO1 B;  4WQO B;  1E8X A;  2FCS A;  2NBW B;  4ANX A;  3VQI A;  1WGH A;  1P3Q U;  2KK8 A;  3NZU A;  4YL8 A;  4PS8 A;  2NS5 A;  2LGX A;  1WGG A;  3RT3 B;  2KWV B;  2M0X A;  2Z0E B;  3EC8 A;  2D3G A;  3PRE A;  3CST A;  3Q3J A;  3K9P B;  4WJN A;  3RZW C;  3N32 A;  3DQV A;  2MX2 A;  3LDZ E;  2YLM A;  1WXV A;  3H7P B;  4I6N B;  4MGI E;  1LQB A;  3RUL A;  3IBE A;  3NZS A;  5TR5 A;  3VH4 B;  1UD7 A;  3M63 B;  3ZDM C;  2RD0 A;  4E3C A;  4GDK B;  2KD0 A;  4AOF A;  2RPQ A;  2L0F A;  2NCN A;  3KUD B;  5KHO A;  3KW5 B;  3M3J A;  2IO2 B;  2KDI A;  4W9K A;  1TTN A;  4MH0 E;  2V4L A;  3DBR I;  4KVG B;  1OGW A;  5EDS A;  4RMA A;  2IBI B;  1WZ0 A;  2KAN A;  1WX8 A;  3WAM A;  4AUQ C;  1E7U A;  2V3S A;  4FJY A;  3UIN B;  3VTV A;  2I1J A;  2DX5 B;  2N4F A;  3UGB B;  5DCN A;  1OQY A;  2UWQ A;  4ZYN A;  4MEM A;  2NPT B;  1WYW B;  1WJN A;  3IG3 A;  5DPS A;  5C23 A;  1KLV A;  4HJK A;  4W9E A;  5D94 A;  4ASW C;  3R3M A;  2KJ6 A;  4URK A;  1KJT A;  4JIO U;  2BGF A;  2GMI C;  3H6N A;  3PLV A;  4MJS A;  4G50 A;  4KZC A;  4ZRK A;  2N9P C;  4WWP A;  2WYQ A;  3PHW B;  5AEK B;  1EF1 A;  2M17 A;  3VVW B;  4MGY E;  3OAW A;  1P9D U;  1V81 A;  1E8Z A;  4W9J A;  3RZF A;  4AP4 C;  2BYE A;  3WA0 A;  4K1R B;  3KYC D;  2KFJ A;  3WAO A;  5IAA C;  3QCA A;  1Q5W B; 
#chains in the Genus database with same CATH topology
 1R4M B;  2NR2 A;  1UBQ A;  2GBN A;  2W3R A;  3URY A;  4DHZ E;  3L13 A;  3P2B A;  1NEK B;  2NBV B;  2K0P A;  1T0Y A;  2L8J A;  2FCQ A;  1R4N I;  2K1F A;  1E7V A;  1TS4 A;  3NVV A;  1UUP A;  2LXA A;  4JX1 C;  3AEE B;  3IAS 1;  1P7F A;  1TS3 A;  4M8N A;  3W5V B;  1WR6 E;  1ISN A;  1K50 A;  1SE4 A;  1L0Y B;  4TMA B;  3Q8E A;  1FEH A;  1YIW A;  5E6N A;  3VRB B;  5FR3 A;  5EE0 A;  4LCD E;  3U2S C;  2D10 A;  3NZ3 A;  3RD2 A;  1J7B A;  2IYD B;  1IPG A;  1QZE A;  2W3S A;  4US8 A;  5FK9 C;  3BYT B;  3MC9 A;  2MQJ A;  2RSU A;  2LUM A;  4ICV A;  1HXY D;  4KGS A;  1J8C A;  1VCB A;  1SE2 A;  1XEE A;  1KLU D;  2B3A A;  2JVC A;  4K7U A;  3WCQ A;  1D3Z A;  3C19 A;  4K7W A;  2BS2 B;  3AH7 A;  1F2R C;  3GOE A;  3L4P A;  4ARC A;  3AE4 B;  4KGT A;  5MPO A;  2WXO A;  3TEZ A;  1IP9 A;  1V6E A;  4WWM A;  3MC8 A;  3AE2 B;  3N3K B;  4RM8 A;  3ENE A;  1C1Y B;  1VDV A;  2KWC A;  2JYE A;  3TEX A;  3AE5 B;  2MBB B;  3ZRF A;  4BKS D;  2WQY B;  2KLG A;  2MBQ A;  3GB1 A;  3M95 A;  4RGM A;  1YX6 B;  1XF5 L;  2UYZ B;  2LVP A;  3HM6 X;  1LFD A;  1G6J A;  4M01 A;  3TCA A;  5D2M B;  3TEW A;  2XN9 C;  3DBH B;  2D07 B;  2WDQ B;  1WX7 A;  2DLB A;  1WI0 A;  2WWZ A;  1WZ3 A;  4KIK B;  1FFV A;  4BVU C;  4HJG E;  3OJ3 A;  2V9H A;  1FIQ A;  1L6U A;  3OG5 A;  4N6E B;  3PV1 A;  3ZNH B;  2BT6 A;  4K7S A;  4PYU A;  2KN4 A;  1SJH D;  4YWG G;  3N9Y C;  1ZGU B;  3ZTC A;  3E9S A;  3ZUN A;  2KDB A;  2GBR A;  2WGS A;  3EFC A;  1B9R A;  2INC C;  4IM0 A;  3UI3 A;  3UQA A;  1WXS A;  3DWG C;  4WAA A;  1T0R C;  3L08 A;  1E0Z A;  3Q3O C;  5JH5 C;  5C1Z A;  3P4P B;  2LGD A;  3L17 A;  4W9D A;  3BII D;  1LO5 D;  1XLP A;  4HK2 A;  1FXT B;  3QC8 B;  1SSN A;  1YJJ A;  2IO0 B;  2L32 A;  5C2T B;  2LVO A;  2JY6 A;  1BT0 A;  2BS3 B;  2ICI A;  2J52 A;  2PEA A;  3AE6 B;  2LHE A;  2CHZ A;  1LM8 B;  2L05 A;  5BMG A;  4BKS A;  2R61 A;  2KHW B;  1R4M I;  5E6P A;  3TEY A;  2JUO A;  3PRP B;  4ZOH C;  4E74 A;  4LNO A;  4W9G A;  4HKZ E;  2MH7 A;  2LHD A;  3RNG C;  5D3I B;  5D3D A;  3N1X C;  1FXI A;  2GBM A;  4C7Y A;  2BYT A;  2XBB C;  3QAR A;  1UNS A;  4AJW A;  2BW2 A;  1V80 A;  3WIM A;  1ZP0 B;  3APC A;  1ZUD 2;  1RAX A;  3DBS A;  4W9F A;  2LXC A;  2D5G A;  2W54 A;  2KMC A;  4NJ6 A;  2G45 B;  1IBX B;  2GBK A;  4M0W A;  2QHO A;  2WDR B;  4DK5 A;  3ABV B;  2BB5 A;  1OFF A;  1TKY A;  1RRB A;  4OZA A;  4MAC A;  3EA6 A;  2KZR A;  3QK0 A;  1QOG A;  3NS1 A;  3C8Y A;  2BTE A;  1YN3 A;  1NYR A;  3UIO B;  3W1Y A;  4II2 B;  2D3C A;  4XWW A;  4LNK A;  1TS5 A;  2K9X A;  1JWB D;  1RM6 C;  3CWI A;  3NVY A;  1MI0 A;  2VRR B;  3RFZ B;  4EKU A;  2KWU B;  1V49 A;  2GBJ A;  2N7E A;  1SE3 A;  2BF8 B;  5AZG A;  1KFY B;  1PUT A;  3V6E B;  2KTR A;  2HJ1 A;  4BZA A;  1T0Q C;  2KVZ A;  2W55 A;  1WMH A;  3VAW A;  1E7P B;  1VRA B;  2WXM A;  3U8Z A;  3QWZ B;  4DWF A;  3BYY B;  2JPH A;  3V62 A;  2KQS A;  3DBH I;  5G5H A;  3ZJU A;  2YEP B;  4RGT A;  3MHS D;  4MEL A;  1WM2 A;  3IFW B;  3RNC C;  1V1P B;  3B2G A;  2LUE A;  3TJP A;  1DOI A;  2XEW A;  1P98 A;  1GB1 A;  3NVW A;  2BKR B;  1YNT E;  3VRA B;  2QJL A;  5D7G A;  1STE A;  2QDF A;  3BIN A;  1Z5S B;  3NOB A;  2KVR A;  3MC0 B;  4C80 A;  1MFW A;  5IA7 A;  4YTN B;  2CS4 A;  1WJ4 A;  1QOB A;  5FKA C;  4WJQ A;  1WRD B;  4HPP A;  4NAW A;  5DPW A;  3MTN B;  2VZK D;  2NMQ A;  2WXI A;  4BFR A;  1XQQ A;  5LXI B;  4ACF A;  4MDK E;  2WU2 B;  4A3P A;  1XCQ L;  4OW0 A;  2MSE D;  5CX3 A;  3KQ4 A;  2IO1 B;  3GS2 A;  1QOA A;  2I2Y A;  1P3Q U;  2NS5 A;  2LGX A;  2CU3 A;  3ZQ4 A;  2QC8 A;  2KWV B;  3RT3 B;  1ZXH A;  2Z0E B;  2D3G A;  3RZW C;  2MX2 A;  3LDZ E;  2YLM A;  1YJI A;  4PK1 A;  4AS1 A;  3KUD B;  2NCN A;  5KHO A;  4RF1 A;  3M3J A;  1JAL A;  4GLS C;  3RMK C;  2IBI B;  2JU6 X;  1WX8 A;  3WAM A;  3UIN B;  4KX6 B;  3J9C A;  3LXF A;  1K51 A;  2I1J A;  1FCC C;  2DX5 B;  2N4F A;  3UGB B;  1OQY A;  1L0V B;  1WYW B;  4A9A A;  3MP9 A;  5C23 A;  4ARI A;  4HJK A;  1P7E A;  1SJE D;  3Q3N C;  5HG2 A;  2PIA A;  2VH2 A;  4MJS A;  4ZRK A;  3PHW B;  3RI7 C;  2M17 A;  3U7Z A;  1A70 A;  4MGY E;  2L83 A;  2N9K A;  1ZDX A;  3OAW A;  5BYQ A;  4LLG M;  4AP4 C;  2KFJ A;  1PFD A;  1Q5W B;  4TQ0 A;  5L95 C;  3W9C B;  2PMV A;  2N0S B;  2PE9 A;  1A5R A;  4JQW C;  4ZRQ A;  1VZ8 A;  1UGM A;  1WX9 A;  5EE3 A;  4MSQ B;  2G4D B;  2J7Q B;  3IVF A;  4P16 A;  4EZJ A;  3H7P A;  3PLU A;  1GUA B;  3PT2 B;  4HPL B;  2PLP A;  3Q2A C;  1C9F A;  1NI3 A;  4B0M A;  1RFK A;  2ASQ A;  2Z8L A;  4EUT A;  1D4B A;  1GNU A;  3TMP B;  4RF0 A;  2DAJ A;  4LJO B;  4G11 A;  1FRR A;  4BKT A;  4YSX B;  2ZNV B;  1E8Y A;  1Y8R C;  2SEB D;  1QLB B;  2BWF A;  2MWS B;  1RWS A;  2NPT A;  5GMV A;  3AE1 B;  1UBI A;  1D5Z C;  4KKJ A;  4XZ4 A;  5E6O A;  2KN5 A;  4W9H A;  2MBE A;  3RNF C;  3X23 A;  2KT7 A;  4W9I A;  2EMT A;  4HKQ A;  2JZP A;  1AN8 A;  1B1Z A;  4JLC A;  4LJP B;  1WR1 A;  2HE7 A;  2JQR B;  1QOF A;  2PJH A;  2DNF A;  4A90 A;  3T8M A;  3FAH A;  3MJ5 A;  3ZW3 A;  1GPX A;  2KDM A;  1EF5 A;  4IUM B;  2KQ7 A;  5TSS A;  2WX1 A;  1QF6 A;  1BXT A;  3DOW A;  4F7Z A;  2KYW A;  4II3 B;  1SF0 A;  5AZF A;  3VUW A;  1PGB A;  1H4R A;  2EKI A;  3GZN B;  3GE3 C;  2K6D B;  4MGZ E;  1GAQ B;  1SIJ A;  4GN1 A;  3TIX A;  1WFY A;  2BPS A;  5DPT A;  1JWM D;  3ZGZ A;  3NY5 A;  2CJO A;  3Q14 C;  2MW5 A;  1ET6 A;  2KJH B;  2KXJ A;  2JT4 B;  1JWU D;  4GMV A;  3BVZ A;  4DXA B;  1Q10 A;  2C60 A;  2K25 A;  4EFO A;  1WH3 A;  1OQR A;  1TZO A;  4R3D A;  2OJW A;  1ESF A;  1FMA D;  1JRU A;  1N60 A;  2JF5 A;  2DZI A;  4YXD B;  2BS4 B;  3I9V 1;  1AYF A;  2K22 A;  2ZCC A;  4GOC A;  2CHX A;  2X8X X;  4FLH A;  1T5X D;  4RCO A;  1IUE A;  3VDZ A;  3CSF A;  4NNJ B;  4M00 A;  3A4R A;  1KH0 A;  2D3B A;  3R66 C;  3Q3F A;  1FNV A;  5BMH A;  1L0X B;  4A55 A;  4C4V A;  4JGH B;  4M0W B;  1FCL A;  4ITK A;  1WE7 A;  2H88 B;  4B6W A;  4IWO A;  3H7S A;  3NUH B;  1M4V A;  4O1N A;  1ZOY B;  2MBH A;  3K9O B;  2K8B A;  3V60 A;  4KV2 A;  5IO9 A;  1VD2 A;  4M02 A;  1YQ4 B;  2CJN A;  2GI9 A;  1WXQ A;  1TZ1 A;  3DBR B;  3GE8 C;  3PGE A;  4ZRJ A;  4DBG A;  1T3Q A;  1DOY A;  1WY8 A;  3DVN U;  3PHX B;  3PRM B;  3LJ3 A;  3R2T A;  3JYU A;  1JML A;  3A9K A;  2J0J A;  3JSV A;  5KHQ A;  3P4Q B;  4IM3 A;  1OTR B;  1V86 A;  2JXX A;  3WAL A;  1WF9 A;  1EUV B;  2PTL A;  2KTR B;  1S1Q B;  4XYC A;  3SEB A;  1WMH B;  3ECI A;  1T6B X;  2M4N A;  4F1S A;  4N58 A;  1HZ6 A;  2M1M A;  1WRI A;  4BBN F;  1FD6 A;  1YN4 A;  4QAY A;  1KM7 A;  2MJ3 A;  4KKI A;  4P1C C;  3V3X A;  2QMT A;  2K8H A;  1Z2M A;  2NVU I;  1C78 A;  2D3A A;  1S3S G;  5GXG B;  5JHA A;  3APD A;  4XX5 A;  1PQS A;  2RPV A;  2N7J A;  3I63 C;  4IG7 B;  3VHT C;  2L1A A;  1L7Y A;  2CR5 A;  3PZD A;  2MLB A;  4ZRI A;  1V9J A;  2Y3A A;  3ZKJ C;  2A4Z A;  4B9K A;  1GC7 A;  4XWT A;  3VUY A;  5LLI A;  4D2K A;  1NBF C;  4NAW B;  2WDV B;  3GZN I;  1UH6 A;  3R8B A;  4BAX A;  3RCZ A;  2FUH B;  3W1S C;  1SEB D;  2KFK A;  3ZJV A;  4AJY B;  4OVU A;  3Q6B A;  1VR9 A;  3QAQ A;  1I4Q A;  4MGK E;  1C79 A;  2DYO A;  3AED B;  2MRP A;  2DYB A;  4A3O A;  2KAJ A;  1V8C A;  4A6Q A;  2I1K A;  4WH4 A;  3DVN V;  4XGA B;  5HHD G;  1F9J A;  1RFA A;  1ACC A;  4ANW A;  4K3B A;  1C76 A;  3EEC A;  3ZXV A;  1CQV A;  2J0M A;  4KSK C;  4ZHP A;  1IGD A;  4BOZ B;  1IGC A;  1TJE A;  2KX3 A;  3HIZ A;  5AUK A;  2KMM A;  2DYM A;  1Y56 A;  4LDT D;  4HWI B;  3RPF C;  4YSY B;  2O2V A;  4B0E A;  4L23 A;  3R7Q A;  4MH8 A;  1WGD A;  3NG0 A;  3P4R B;  1FNW A;  3AU5 A;  1D5M C;  4P7I A;  4E71 A;  1C3T A;  4WWN A;  2LGS A;  4MJS B;  4CYE A;  2FAZ A;  2OJR A;  1D6E C;  2LGY A;  3DPD A;  3PRZ A;  4GDL A;  3SFE B;  2RDH A;  3OJ4 B;  1N62 A;  3P63 A;  4GGQ A;  1P1A A;  1T0S C;  1E8X A;  2QCZ A;  1L4D B;  1J7C A;  3VQI A;  1WGH A;  1L4Z B;  4YL8 A;  1XLO A;  2J42 A;  5I4D A;  2M0X A;  3EC8 A;  2LMC A;  1ZDV A;  1C77 A;  2RMM A;  3H7P B;  3ETR A;  3RUL A;  3IBE A;  3BK2 A;  3NZS A;  4OVZ A;  3VH4 B;  2WXP A;  2INP E;  2RD0 A;  1XCT L;  2MJD A;  3KW5 B;  2IO2 B;  2VZK B;  4USA A;  1XO3 A;  2V4L A;  3DBR I;  1OGW A;  5EDS A;  1WZ0 A;  2FBW B;  1E7U A;  1C4A A;  2V3S A;  4RFB A;  1YMH E;  4WAF A;  3N20 C;  4ZYN A;  2NPT B;  1WJN A;  1KLV A;  4N59 A;  2KJ6 A;  4URK A;  1KJT A;  2BGF A;  2GMI C;  3H6N A;  4G50 A;  4KZC A;  3BVM A;  4WWP A;  5AEK B;  3VVW B;  2K3U A;  1AWD A;  1V81 A;  1E8Z A;  4US9 A;  2BYE A;  3WA0 A;  4K1R B;  3QCA A;  3VR8 B;  3VTW A;  2ZVN A;  2KJR A;  1TY0 A;  1WE6 A;  3Q8C A;  2FUG 1;  3AEC B;  2FIF A;  4BOS C;  1I42 A;  3SD5 A;  3ZLZ A;  3A33 B;  1WWT A;  2M19 A;  3R7R A;  4PS3 A;  3BK1 A;  1CMX B;  1HTO A;  1PGX A;  4KDL B;  1V2Y A;  1ZKH A;  4MM3 A;  4DHJ D;  1UF0 A;  1VZ6 A;  2PW9 A;  3SDL C;  2MA9 B;  2KQ4 X;  2Z0D B;  3UF8 A;  2WHI A;  2IGG A;  3AUL A;  3EUB 2;  2O6V D;  2PE6 B;  3HUI A;  1E9M A;  2J0K A;  1MHX A;  1NDD A;  4BKG A;  2K6Q A;  2DEN B;  2JXT A;  4FUL A;  4DXG A;  3TSS A;  2EMS A;  2AEH A;  4IWP A;  1JW9 D;  2LJI A;  4HLE A;  2MEK A;  3LB8 C;  3KVF B;  2LEK A;  1HQR D;  5IKC M;  5CHV C;  2CU1 A;  4L1B A;  3QHT A;  2LWP A;  4JWU C;  1UGJ A;  3CF6 E;  3IT4 B;  4MSM B;  4RH6 A;  4FHK A;  5LNK 1;  2HD5 B;  1J19 A;  3HRD D;  4Q2J A;  5G55 A;  3SFD B;  2MP2 A;  2JYT A;  3HK0 A;  2I38 A;  2IND C;  2IGD A;  2JZ3 B;  2E3T A;  3P4S B;  2YEP F;  2L0T A;  2LRW A;  4GU2 A;  1BML C;  5DPR A;  1F77 A;  2IGH A;  2XK5 A;  3ZNI D;  4C00 A;  3PZ8 A;  3AE7 B;  4EEW A;  2ZZP B;  4FN2 A;  2AL3 A;  5BMI A;  1PYW D;  4C4V B;  1CJE A;  4M8M A;  2KAC A;  1WM3 A;  3FIL A;  3I57 A;  3V05 A;  2QIE B;  4NZL B;  4IDI A;  2WXR A;  1VZ7 A;  5LXH A;  1C4P A;  4F8C B;  1ROE A;  2L3Z A;  3D32 A;  4EOY A;  4WQM A;  3L16 A;  2O6V A;  1U4A A;  2ZPN A;  2FID A;  4A20 A;  4J3O D;  2C5L C;  4FAD A;  4REZ A;  2ZEQ A;  4HDO A;  5C3J B;  1SE9 A;  4PS7 A;  2IO3 B;  2V3P A;  2BWE S;  1XT9 B;  2JZZ A;  1HA5 A;  1N6Z A;  2TSS A;  3A9K B;  3JSV B;  3AE3 B;  2FCM A;  3L10 B;  1JRO A;  3BZD B;  4WIP A;  1HE8 A;  5CTR C;  3WAN A;  3I3T B;  1YOV B;  3L0W B;  3NJT A;  4G0N B;  1DYQ A;  4LTU A;  2LGI A;  3KWL A;  1L5P A;  2QIL A;  1E90 A;  3RYT A;  3T3O A;  2M8S A;  3B9J A;  5JHB A;  3V61 A;  2Y5B B;  2V0G A;  5EE1 A;  4OHJ A;  4P1B C;  4TSS A;  5BO4 B;  3ZYY X;  4RNA A;  4BBN C;  2HTH A;  4NQL B;  4AWJ A;  1WXM A;  3DVG X;  2INN E;  1MVK A;  1WGY A;  1PDX A;  4I6L B;  4ZHO A;  1TKG A;  3VFK A;  2B76 B;  2KC1 A;  2FE8 A;  2DBY A;  3ML9 A;  4ANV A;  1RLF A;  4FJV B;  3PO0 A;  4GXB A;  2DHZ A;  1JRP A;  2FCN A;  3WAP A;  4P6V F;  3QIJ A;  4WJP A;  3U4E G;  2LVQ A;  2N7D A;  1WJ6 A;  3KUZ A;  4IKG A;  1FXA A;  2L52 A;  2GLS A;  1NI2 A;  5H8Y E;  3AEB B;  1MJD A;  4N9F 4;  3Q69 A;  2WXK A;  4C7Z A;  3RNA C;  2KFK B;  2LD9 A;  1SBB B;  4IC7 B;  1D5X C;  1R7S A;  2CHW A;  1QQR A;  3RNB C;  2DZJ A;  3ZNZ B;  1K8R B;  1K53 A;  1WGK A;  1BUI C;  2WU5 B;  2WXH A;  2BYV E;  3P42 A;  3CIR B;  2ONQ A;  1XD3 B;  3APF A;  2R2O A;  2R2Q A;  4EE2 A;  2WLB A;  3NHE B;  5J2R A;  3IHP C;  2RGF A;  4LNF A;  4YT0 B;  4YTM B;  2HJ8 A;  3HM3 A;  4W9C A;  2O2V B;  2JX5 A;  3LYY A;  1I35 A;  1KLG D;  1CK1 A;  2WX0 A;  2X38 A;  3AEA B;  1YX5 B;  5G2N A;  4FA6 A;  1WXA A;  2EEL A;  4TV3 A;  3TL5 A;  2UU7 A;  3S2A A;  2ZJD A;  3NRZ A;  3JW0 X;  2PPH A;  1V5O A;  2AX5 A;  4GDL B;  3ML8 A;  3C0R B;  1K52 A;  1FM0 D;  3A9J A;  2D11 A;  4KZ0 A;  2WNM A;  1N63 A;  4GSW A;  3W5U B;  2K8C A;  2L76 A;  1EU4 A;  1WGR A;  4C56 C;  3EGR A;  2C7N B;  1I7H A;  2RDG A;  1ZPS A;  4RM9 A;  4PT5 A;  3KUC B;  3N1Y C;  2WXG A;  2GOW A;  1N5X A;  1AW7 A;  2SAK A;  4HPM B;  4RGN A;  3EHV A;  2MHJ A;  3HHM A;  4CO7 A;  2KNB A;  3ZTD A;  2V1Y A;  3T3N A;  4ZYS A;  3Q3M C;  2IJ0 A;  3Q8B A;  1L2N A;  4X57 B;  3RUI B;  2A5U A;  2G1E A;  4WJO A;  2M0A A;  3A1Q A;  4CHK A;  5L83 A;  3N1Z C;  2JWZ A;  2ZCB A;  4H2A A;  2OED A;  3E56 A;  4EZL A;  4LNI A;  4CQN A;  5AZH A;  4LDT B;  3AN1 A;  1F52 A;  4WQO B;  2BQQ A;  1NEN B;  1TT5 B;  2KK8 A;  3NZU A;  4PS8 A;  1WGG A;  3K9P B;  1TKE A;  2G9H D;  4A8X C;  4MGI E;  4MM3 B;  2VH1 A;  5TR5 A;  3M63 B;  1UD7 A;  3ZDM C;  1FRD A;  4E3C A;  4AOF A;  2KD0 A;  5IN7 A;  2RPQ A;  2L0F A;  3DHI C;  4JE3 B;  2KDI A;  1TY2 A;  3Q8A A;  4NJC A;  4W9K A;  4MH0 E;  1TS2 A;  4KVG B;  4FXC A;  2KAN A;  2WXN A;  5AUI A;  4AUQ C;  1WYG A;  2BB6 A;  3KWV A;  5DCN A;  1E6E B;  3IG3 A;  5DPS A;  3O13 A;  5D94 A;  4ASW C;  1KTK A;  2V3N A;  4JIO U;  3AV8 A;  1ET9 A;  1SXT A;  2N9P C;  2WYQ A;  1MHH E;  1ZE3 D;  1P9D U;  4W9J A;  3RZF A;  2N9L A;  3KYC D;  3WAO A;  5IAA C;  4J6I A;  2YVC A;  4LK0 M;  2Q5W D;  3B08 A;  3X0W A;  2QEJ C;  5CHW A;  1TIF A;  5HI1 A;  2MP2 B;  2K39 A;  3AE8 B;  2HDE A;  2LRU A;  3QJZ A;  3VTU A;  3MFG A;  4DXF A;  3JVZ X;  3TUO A;  2J4X A;  1F1H A;  2AL6 A;  1UEL A;  4GDK A;  4FJZ A;  3FC4 A;  4OZC A;  2JSV X;  4S0R A;  2KDE B;  3B2F A;  2XK5 B;  2GRI A;  2FNJ B;  4OVV A;  2Y5C A;  3OLM D;  2PVG C;  1YN5 A;  1N61 A;  4KSL C;  4HCN B;  2WS3 B;  3QQ8 B;  4AQ7 A;  5IP4 D;  1WJU A;  2KMA A;  3FIL B;  3AU4 A;  2LZ6 A;  1E8W A;  5EE9 A;  3AEG B;  5H92 C;  3VH3 B;  1KOT A;  2XNA C;  1YJ1 A;  4DHJ B;  3ONS A;  4TUU A;  2MJE A;  1L6V A;  1I4G A;  3B1L X;  4WWO A;  2O6V B;  3T9L A;  3N30 A;  3U7D A;  2AQ2 B;  1YD8 U;  3BWU D;  1TGZ B;  1KRH A;  3DBL B;  1MG4 A;  1JWA D;  2L00 B;  4FHJ A;  3V6C B;  4IW0 A;  1I4H A;  1IYF A;  1YQ3 B;  3AE9 B;  5J17 A;  1XLQ A;  2JWU A;  1EM7 A;  4ZRP A;  1DOX A;  4IM2 A;  1QIL A;  3SHQ A;  4TQ1 A;  1TYG B;  3ZRC A;  5IOI A;  3PZ7 A;  4OZB A;  4PYZ A;  3AI5 A;  2LI5 A;  2N9E B;  2GB1 A;  2WXL A;  4KDI C;  4HVB A;  2DAF A;  3AMZ A;  2Z59 B;  3H1U A;  1YQB A;  2BKF A;  2KX0 A;  4WUR A;  2IY0 B;  4HEA 1;  3GP7 A;  2G4S A;  4IWQ A;  5HKH A;  3W2D A;  1HEZ E;  3BY4 B;  3SU8 X;  4MT5 A;  3ZVV A;  5G5G A;  3P1M A;  4JPS A;  1GJZ A;  4W9L A;  1I4R A;  5JZE B;  4ICU A;  3B0A A;  1NVI D;  3H8H A;  3ZDT A;  1HZ5 A;  3U30 A;  2KDF B;  3A4S C;  2KOX A;  2G3Q B;  2JRH A;  2KWD A;  2D2Q A;  1QKZ A;  1TBE A;  2EKE C;  2AWT A;  2RDB C;  3ZXR A;  3VXW A;  1OEY J;  2C7M B;  2NTS A;  2IPK D;  5FR6 A;  4S17 A;  1DGJ A;  1CZP A;  4GB9 A;  2C7H A;  1EO6 A;  3KH0 A;  1HTQ A;  1XXG A;  1X1M A;  3QA8 A;  3I5J C;  2ON8 A;  2WXJ A;  2PKO A;  2C9W B;  4L2Y A;  2N1W A;  4EZK A;  2CKH B;  4RGO S;  3RNE C;  2WXF A;  4NJ7 A;  2QSD A;  2OHF A;  1OEY A;  3DVG Y;  1ZW7 A;  3NVZ A;  4KIK A;  2RR9 A;  3ZIM A;  4DHZ B;  3ZJT A;  3DHH C;  2KC2 A;  2N1V A;  1LGR A;  3PVL A;  4ANU A;  2ZNV C;  1JWS D;  4I6P A;  3IAM 1;  1E10 A;  4XE0 A;  5J18 A;  3BVG A;  1LXD A;  3ZNG C;  1J7A A;  3FKY A;  1UWM A;  3NS8 A;  4K81 A;  5JXV A;  1EWC A;  2KLC A;  4IOI E;  2ZVO A;  3H9D A;  4DDG D;  5D6J B;  3EFU A;  4NPN A;  1SGH A;  4ZDV A;  4XC2 A;  3QX1 A;  3U52 E;  2KTF A;  1ZXI A;  1V97 A;  2MCN B;  4NQK E;  2WDT B;  3A9J B;  2L7R A;  3MHZ A;  2KKC A;  3O65 B;  2ACZ B;  2AQ1 B;  2ZW1 A;  4JL9 A;  2JRI B;  1VLB A;  2KO3 A;  4DQO C;  2N9X A;  1V1O A;  2PVO D;  4K3C A;  2J53 A;  2IY1 B;  4G3X B;  1WIA A;  4DDI D;  1F2R I;  2NTT A;  1GG3 A;  1UZX B;  3AXC A;  1FFU A;  3DCG A;  1R4N B;  3KYD D;  2AYO B;  3ALB A;  1MG8 A;  3ZO5 B;  5HFY A;  3DBL I;  1PGA A;  5BYS A;  3HVD A;  1J0G A;  3PPA A;  1VJK A;  5E6J A;  3MJW A;  1E5W A;  2BBC A;  3VR9 B;  3UIP B;  1N5W A;  2LFI A;  3DWM A;  2Y5P A;  1JCK B;  2IZV B;  2WP9 B;  5CHF A;  3AEF B;  1F0Z A;  1Q1O A;  2H89 B;  3VUX A;  1M94 A;  3A1Q B;  2BYF A;  3Q8F A;  1EU3 A;  1FO4 A;  1SIF A;  2AQ3 B;  1IBX A;  1I4X A;  3M62 B;  1JQ4 A;  4FBJ B;  2BVC A;  2NBU A;  3AM9 A;  2DZK A;  4NY0 A;  1V5T A;  4JWS C;  1RYJ A;  1GC6 A;  4HRS A;  4KGR A;  1P0R A;  4B95 A;  1EWY C;  3TBL D;  3AB5 A;  3L54 A;  1AAR A;  4HCP B;  2OOB B;  3KLS X;  2DZM A;  3DDC B;  3PTF C;  5BYR A;  3UQB A;  1Q0W B;  1NYQ A;  4YTP B;  4TKN A;  3PSE B;  2REX A;  2LAS A;  2ZW0 A;  3W1S A;  2W9N A;  2ZPY A;  3DHG C;  1H8C A;  4LNN A;  2WXQ A;  4XDD A;  4HDQ A;  3PS6 A;  3R2I A;  2K5P A;  1WSP A;  2W82 A;  4GIV A;  3HVZ A;  1GOZ A;  2LJ5 A;  3CMM B;  1I4P A;  4HXD A;  2HTM E;  2MBO A;  4YSZ B;  1MPE A;  1UWX A;  2FCS A;  2NBW B;  1OQQ A;  4HRO A;  4UDU C;  4ANX A;  1XLN A;  3RN9 C;  3PRE A;  3CST A;  3Q3J A;  4WJN A;  3N32 A;  1V1P A;  3DQV A;  1WXV A;  2IDY A;  4I6N B;  1LQB A;  1C4C A;  4GDK B;  1TTN A;  4RMA A;  4FJY A;  3VTV A;  5T8I A;  3IT6 B;  4NAM A;  2UWQ A;  3IXS A;  1QT9 A;  4MEM A;  4XDC A;  2DWQ A;  2E6X A;  3SR6 A;  4W9E A;  2M56 B;  3R3M A;  3PLV A;  1FPY A;  1FNU A;  1KF6 B;  3OWE B;  1GB4 A;  1EF1 A;  1ENF A;  1SB3 C;  2V4I B; 
#chains in the Genus database with same CATH homology
 4J6I A;  3VTW A;  2YVC A;  4TQ0 A;  5L95 C;  2ZVN A;  2NR2 A;  2KJR A;  1UBQ A;  2GBN A;  1WE6 A;  3B08 A;  2PE9 A;  3X0W A;  1A5R A;  2FIF A;  4JQW C;  4BOS C;  1I42 A;  5CHW A;  4DHZ E;  3SD5 A;  3L13 A;  3P2B A;  1UGM A;  2MP2 B;  2NBV B;  3ZLZ A;  1WX9 A;  3A33 B;  4MSQ B;  2G4D B;  1T0Y A;  3R7R A;  2K39 A;  2J7Q B;  2LRU A;  2L8J A;  3QJZ A;  2FCQ A;  4PS3 A;  1CMX B;  3VTU A;  3IVF A;  1R4N I;  4KDL B;  2K1F A;  4EZJ A;  3H7P A;  1E7V A;  1V2Y A;  1GUA B;  1ZKH A;  3JVZ X;  3PLU A;  3PT2 B;  4HPL B;  4MM3 A;  2AL6 A;  1UEL A;  2LXA A;  4DHJ D;  4GDK A;  3SDL C;  2MA9 B;  4FJZ A;  2Z0D B;  2ASQ A;  3UF8 A;  3AUL A;  4M8N A;  4EUT A;  1GNU A;  2O6V D;  3TMP B;  2PE6 B;  2KDE B;  1WR6 E;  2DAJ A;  4LJO B;  4G11 A;  1ISN A;  2J0K A;  2XK5 B;  2FNJ B;  4BKT A;  1NDD A;  4BKG A;  4OVV A;  2K6Q A;  2DEN B;  2ZNV B;  1E8Y A;  1Y8R C;  3OLM D;  1YIW A;  2BWF A;  4FUL A;  5E6N A;  2MWS B;  2EMS A;  4KSL C;  4LCD E;  4HCN B;  2D10 A;  2AEH A;  2NPT A;  3QQ8 B;  5GMV A;  3RD2 A;  1UBI A;  4IWP A;  1WJU A;  2IYD B;  2KMA A;  1IPG A;  4HLE A;  1QZE A;  4XZ4 A;  5E6O A;  2KN5 A;  3AU4 A;  2LZ6 A;  1E8W A;  3KVF B;  3VH3 B;  1KOT A;  4W9H A;  2MBE A;  1YJ1 A;  3X23 A;  4DHJ B;  2MQJ A;  4W9I A;  2RSU A;  2EMT A;  3ONS A;  5CHV C;  2CU1 A;  4TUU A;  3QHT A;  2LWP A;  3B1L X;  3CF6 E;  4WWO A;  2O6V B;  4ICV A;  3N30 A;  3T9L A;  3U7D A;  4JLC A;  4LJP B;  1WR1 A;  1YD8 U;  2HE7 A;  4MSM B;  1J8C A;  1TGZ B;  4FHK A;  1VCB A;  2HD5 B;  2PJH A;  1J19 A;  2B3A A;  2JVC A;  4K7U A;  5G55 A;  3T8M A;  2MP2 A;  1D3Z A;  4K7W A;  3HK0 A;  3ZW3 A;  2L00 B;  4FHJ A;  3GOE A;  3V6C B;  4IW0 A;  2JZ3 B;  1EF5 A;  4IUM B;  2KQ7 A;  1IYF A;  1IP9 A;  2WX1 A;  5J17 A;  1V6E A;  3DOW A;  3N3K B;  2L0T A;  4F7Z A;  2LRW A;  4II3 B;  3ENE A;  1C1Y B;  4IM2 A;  2KWC A;  4RM8 A;  4GU2 A;  2MBB B;  4TQ1 A;  5AZF A;  3SHQ A;  3VUW A;  3ZRF A;  4BKS D;  5DPR A;  3ZRC A;  1H4R A;  2KLG A;  2XK5 A;  3ZNI D;  4EEW A;  2ZZP B;  2MBQ A;  4FN2 A;  3M95 A;  2K6D B;  4MGZ E;  2AL3 A;  3AI5 A;  4PYZ A;  1YX6 B;  2LI5 A;  2UYZ B;  4GN1 A;  3TIX A;  2LVP A;  2N9E B;  3HM6 X;  1LFD A;  1WFY A;  4KDI C;  2BPS A;  4M8M A;  4HVB A;  1G6J A;  5DPT A;  2DAF A;  3NY5 A;  2Z59 B;  1WM3 A;  3H1U A;  1YQB A;  2MW5 A;  3TCA A;  2BKF A;  2KX0 A;  5D2M B;  2KJH B;  2IY0 B;  2KXJ A;  2G4S A;  4IWQ A;  5HKH A;  2D07 B;  2JT4 B;  1WX7 A;  5LXH A;  4GMV A;  1WI0 A;  4F8C B;  4DXA B;  2WWZ A;  3BY4 B;  2C60 A;  3SU8 X;  2K25 A;  1WZ3 A;  2L3Z A;  3D32 A;  4KIK B;  3ZVV A;  4EFO A;  4EOY A;  1WH3 A;  3L16 A;  2O6V A;  1U4A A;  2ZPN A;  1GJZ A;  4BVU C;  4W9L A;  1JRU A;  2FID A;  4ICU A;  3B0A A;  4A20 A;  5JZE B;  2JF5 A;  3ZDT A;  3OJ3 A;  3U30 A;  2C5L C;  4FAD A;  2DZI A;  2KDF B;  3A4S C;  2ZEQ A;  4HDO A;  1SE9 A;  4PS7 A;  2KOX A;  2G3Q B;  3PV1 A;  2IO3 B;  3ZNH B;  2BWE S;  2JRH A;  4K7S A;  4PYU A;  2ZCC A;  1XT9 B;  2D2Q A;  4GOC A;  2CHX A;  1TBE A;  2JZZ A;  1ZGU B;  2EKE C;  3ZTC A;  3ZUN A;  2KDB A;  2AWT A;  4FLH A;  2GBR A;  3VDZ A;  3A9K B;  3JSV B;  1OEY J;  3CSF A;  3VXW A;  4IM0 A;  2C7M B;  5FR6 A;  3UQA A;  1WXS A;  4WAA A;  2FCM A;  3L10 B;  3L08 A;  4NNJ B;  3A4R A;  4GB9 A;  1HE8 A;  2C7H A;  5CTR C;  3WAN A;  5JH5 C;  1EO6 A;  3I3T B;  3KH0 A;  5C1Z A;  2LGD A;  3L17 A;  1X1M A;  3R66 C;  3QA8 A;  3Q3F A;  4W9D A;  2C9W B;  4HK2 A;  3L0W B;  4JGH B;  2N1W A;  4G0N B;  1FXT B;  4M0W B;  3QC8 B;  4EZK A;  2CKH B;  2IO0 B;  1WE7 A;  4B6W A;  2LVO A;  4IWO A;  2JY6 A;  3H7S A;  1BT0 A;  4NJ7 A;  1E90 A;  3RYT A;  2M8S A;  5JHB A;  3V61 A;  1OEY A;  2Y5B B;  3DVG Y;  2PEA A;  1ZW7 A;  2MBH A;  2K8B A;  3K9O B;  4KIK A;  2CHZ A;  1LM8 B;  3V60 A;  2RR9 A;  2L05 A;  4KV2 A;  3ZIM A;  4DHZ B;  5BO4 B;  4BKS A;  2KC2 A;  2N1V A;  3PVL A;  4ANU A;  1VD2 A;  1R4M I;  2KHW B;  2ZNV C;  2HTH A;  2JUO A;  3PRP B;  5E6P A;  4NQL B;  4BBN C;  4E74 A;  4W9G A;  1TZ1 A;  1WXM A;  3DVG X;  4I6P A;  4AWJ A;  5J18 A;  1WGY A;  4I6L B;  3PGE A;  1LXD A;  3ZNG C;  4ZRJ A;  3VFK A;  4DBG A;  3NS8 A;  1WY8 A;  4K81 A;  3DVN U;  2GBM A;  2KC1 A;  3PHX B;  2KLC A;  3ML9 A;  3PRM B;  4ANV A;  1RLF A;  3LJ3 A;  4FJV B;  2XBB C;  3JYU A;  2DHZ A;  2ZVO A;  3H9D A;  3QAR A;  4GXB A;  4DDG D;  2FCN A;  3A9K A;  2J0J A;  3JSV A;  3WAP A;  5D6J B;  3EFU A;  4AJW A;  5KHQ A;  1V80 A;  4IM3 A;  3QIJ A;  4NPN A;  4WJP A;  1OTR B;  1V86 A;  3WIM A;  2LVQ A;  2N7D A;  1SGH A;  1WJ6 A;  2JXX A;  3APC A;  1WF9 A;  1EUV B;  3KUZ A;  3WAL A;  4ZDV A;  1RAX A;  4XC2 A;  3DBS A;  3QX1 A;  4W9F A;  1NI2 A;  2KTR B;  2LXC A;  1S1Q B;  2KTF A;  4N9F 4;  2MCN B;  2KMC A;  4NQK E;  1WMH B;  3ECI A;  4NJ6 A;  2WDT B;  2G45 B;  3A9J B;  2KFK B;  2L7R A;  2LD9 A;  2KKC A;  2M4N A;  4F1S A;  2GBK A;  4IC7 B;  3O65 B;  2CHW A;  2QHO A;  4JL9 A;  2JRI B;  2DZJ A;  3ZNZ B;  1K8R B;  4DK5 A;  2KO3 A;  2M1M A;  2N9X A;  4BBN F;  2IY1 B;  4G3X B;  1WIA A;  4DDI D;  1RRB A;  1GG3 A;  1UZX B;  1KM7 A;  3AXC A;  3DCG A;  2KZR A;  3QK0 A;  2BYV E;  3KYD D;  2AYO B;  3ALB A;  1XD3 B;  2K8H A;  1MG8 A;  1Z2M A;  2NVU I;  3ZO5 B;  3UIO B;  1S3S G;  5JHA A;  3W1Y A;  3APF A;  2R2O A;  2R2Q A;  3APD A;  4II2 B;  3DBL I;  3NHE B;  5J2R A;  4XX5 A;  1PQS A;  3IHP C;  2RGF A;  1J0G A;  3PPA A;  4IG7 B;  3VHT C;  3MJW A;  1L7Y A;  2CR5 A;  2HJ8 A;  1E5W A;  2VRR B;  3HM3 A;  4W9C A;  2O2V B;  3PZD A;  4EKU A;  2KWU B;  3UIP B;  2MLB A;  1V49 A;  1I35 A;  4ZRI A;  2GBJ A;  2IZV B;  1V9J A;  2N7E A;  5CHF A;  2WX0 A;  2BF8 B;  1YX5 B;  2A4Z A;  5AZG A;  5G2N A;  3ZKJ C;  1GC7 A;  4B9K A;  4FA6 A;  1WXA A;  1Q1O A;  3TL5 A;  4TV3 A;  3VUY A;  5LLI A;  3S2A A;  3V6E B;  1NBF C;  4NAW B;  2KTR A;  2ZJD A;  1M94 A;  3VUX A;  3GZN I;  3A1Q B;  2BYF A;  1UH6 A;  3JW0 X;  2PPH A;  1V5O A;  3RCZ A;  1WMH A;  4GDL B;  1SIF A;  3C0R B;  3ML8 A;  2FUH B;  3W1S C;  3A9J A;  2KFK A;  2D11 A;  4KZ0 A;  3VAW A;  4AJY B;  4OVU A;  3QAQ A;  3M62 B;  3U8Z A;  3QWZ B;  4GSW A;  4DWF A;  4FBJ B;  2JPH A;  4MGK E;  2DYO A;  2K8C A;  2NBU A;  3V62 A;  2DZK A;  2KQS A;  2L76 A;  3DBH I;  2MRP A;  2DYB A;  4A3O A;  4NY0 A;  1V5T A;  3MHS D;  2I1K A;  4MEL A;  1WGR A;  3DVN V;  1WM2 A;  1GC6 A;  2C7N B;  3IFW B;  1F9J A;  1RFA A;  2LUE A;  4ANW A;  1P0R A;  4B95 A;  4RM9 A;  3TJP A;  3EEC A;  3KUC B;  2XEW A;  2J0M A;  3TBL D;  2GOW A;  4KSK C;  1P98 A;  3L54 A;  2BKR B;  4HPM B;  4BOZ B;  3EHV A;  3HHM A;  2KX3 A;  4CO7 A;  1AAR A;  2KNB A;  2OOB B;  3HIZ A;  2DZM A;  3DDC B;  3PTF C;  4HCP B;  3UQB A;  1Q0W B;  5D7G A;  2DYM A;  3ZTD A;  4TKN A;  4LDT D;  4HWI B;  3BIN A;  3PSE B;  2REX A;  2LAS A;  3W1S A;  2W9N A;  2ZPY A;  1H8C A;  1Z5S B;  2V1Y A;  2O2V A;  3NOB A;  2KVR A;  3R7Q A;  1WGD A;  3AU5 A;  5IA7 A;  4HDQ A;  2CS4 A;  4P7I A;  1WJ4 A;  1L2N A;  3PS6 A;  4X57 B;  3RUI B;  4E71 A;  4WJQ A;  1C3T A;  4WWN A;  2A5U A;  1WRD B;  4MJS B;  4CYE A;  4GIV A;  2FAZ A;  4NAW A;  4WJO A;  3CMM B;  2LJ5 A;  5DPW A;  3MTN B;  3A1Q A;  2OJR A;  2LGY A;  4CHK A;  5L83 A;  2JWZ A;  4HXD A;  2ZCB A;  4BFR A;  1XQQ A;  3DPD A;  3PRZ A;  5LXI B;  4GDL A;  4EZL A;  2MBO A;  4MDK E;  3OJ4 B;  4A3P A;  2MSE D;  5AZH A;  5CX3 A;  4GGQ A;  4LDT B;  1P1A A;  2IO1 B;  4WQO B;  1E8X A;  2FCS A;  2NBW B;  4ANX A;  3VQI A;  1WGH A;  1P3Q U;  2KK8 A;  3NZU A;  4YL8 A;  4PS8 A;  2NS5 A;  2LGX A;  1WGG A;  3RT3 B;  2KWV B;  2M0X A;  2Z0E B;  3EC8 A;  2D3G A;  3PRE A;  3CST A;  3Q3J A;  3K9P B;  4WJN A;  3RZW C;  3N32 A;  3DQV A;  2MX2 A;  3LDZ E;  2YLM A;  1WXV A;  3H7P B;  4I6N B;  4MGI E;  1LQB A;  3RUL A;  3IBE A;  3NZS A;  5TR5 A;  3VH4 B;  1UD7 A;  3M63 B;  3ZDM C;  2RD0 A;  4E3C A;  4GDK B;  2KD0 A;  4AOF A;  2RPQ A;  2L0F A;  2NCN A;  3KUD B;  5KHO A;  3KW5 B;  3M3J A;  2IO2 B;  2KDI A;  4W9K A;  1TTN A;  4MH0 E;  2V4L A;  3DBR I;  4KVG B;  1OGW A;  5EDS A;  4RMA A;  2IBI B;  1WZ0 A;  2KAN A;  1WX8 A;  3WAM A;  4AUQ C;  1E7U A;  2V3S A;  4FJY A;  3UIN B;  3VTV A;  2I1J A;  2DX5 B;  2N4F A;  3UGB B;  5DCN A;  1OQY A;  2UWQ A;  4ZYN A;  4MEM A;  2NPT B;  1WYW B;  1WJN A;  3IG3 A;  5DPS A;  5C23 A;  1KLV A;  4HJK A;  4W9E A;  5D94 A;  4ASW C;  3R3M A;  2KJ6 A;  4URK A;  1KJT A;  4JIO U;  2BGF A;  2GMI C;  3H6N A;  3PLV A;  4MJS A;  4G50 A;  4KZC A;  4ZRK A;  2N9P C;  4WWP A;  2WYQ A;  3PHW B;  5AEK B;  1EF1 A;  2M17 A;  3VVW B;  4MGY E;  3OAW A;  1P9D U;  1V81 A;  1E8Z A;  4W9J A;  3RZF A;  4AP4 C;  2BYE A;  3WA0 A;  4K1R B;  3KYC D;  2KFJ A;  3WAO A;  5IAA C;  3QCA A;  1Q5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...