2LXAA

Solution structure of the get5 ubiquitin-like domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Ubiquitin-like protein MDY2
total genus 16
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxaA00
2M1MA 2EMSA 2K8BA 2XBBC 4A3PA 3DVGX 3MHSD 2R2OA 3ZTDA 5EDSA 1WJ4A 2KQ7A 2KDIA 4KZ0A 4HLEA 4KSKC 4GB9A 2NCNA 3QX1A 4K7SA 4E3CA 2J7QB 4PS7A 2N9PC 4FJZA 2MCNB 2B3AA 3TMPB 1E7UA 4ANWA 3QK0A 2C7NB 2K39A 2C60A 2LVPA 3PZDA 4AJWA 2FIFA 2C5LC 2K25A 2FCSA 2I1JA 3H6NA 3JW0X 4TV3A 4WJOA 2LWPA 2O2VB 4BKGA 4NQKE 1UBIA 1V6EA 3W1YA 3BY4B 1E8YA 4CHKA 2N1WA 4MGKE 1WM2A 1YD8U 3WANA 5D7GA 3ML9A 4ANUA 4F8CB 4AWJA 3DOWA 3ZRFA 5D6JB 4N9F4 2WYQA 4A20A 3DBLI 2MBBB 3A9KA 2KANA 2CHZA 4HCPB 2G3QB 1TTNA 4G11A 3ZNGC 2RR9A 4DWFA 3B1LX 4BKSA 2BPSA 5HKHA 2MWSB 3OJ3A 2CS4A 3UQBA 2EMTA 3PREA 4FN2A 3V62A 2PE6B 4NQLB 1S3SG 1RAXA 3VXWA 3TJPA 3ZDMC 3DVGY 4RM8A 4DHZB 1C1YB 3ZIMA 4BBNC 2GBKA 4HCNB 3EFUA 4LDTD 1E8ZA 4RMAA 2KNBA 2REXA 3DQVA 2GBNA 2NBWB 4IUMB 3UQAA 5DPWA 2MA9B 3JYUA 2C7MB 2IZVB 2KX0A 4GSWA 2J0JA 4BOZB 2DENB 5JHBA 4FULA 3OAWA 3ECIA 4MSQB 4I6PA 2JRIB 2KJ6A 2KX3A 4HVBA 1I42A 1WH3A 2L76A 3QARA 2NPTA 4W9IA 2DZMA 3UIOB 3VDZA 4YL8A 4K81A 2KFJA 3L17A 3QCAA 2D3GA 4HXDA 3A1QB 3RULA 2ZNVC 4URKA 4G0NB 5DPRA 1WRDB 2HJ8A 3AULA 3ZO5B 2KXJA 4J6IA 5BO4B 3OJ4B 2J0MA 4LDTB 3L08A 3H7PA 4II2B 5L95C 2FCQA 5LXIB 4W9CA 3SU8X 2WX0A 3A4RA 2UYZB 2RD0A 2BYEA 2KC2A 4NPNA 4W9KA 5LXHA 3VUWA 3R66C 4W9FA 4HDQA 3DPDA 1S1QB 1WGHA 2CHWA 2ZCCA 4P7IA 1WYWB 2K1FA 3A4SC 4JLCA 3DBSA 3L54A 4FJYA 4GDKA 3RZWC 2FAZA 2G4SA 4DDID 2Z59B 4DBGA 2N7EA 2J0KA 5DCNA 1PQSA 3PGEA 1V5TA 1WXVA 2N1VA 1KOTA 2KO3A 1EF1A 4RM9A 2LGXA 1J0GA 2FUHB 1EO6A 2EKEC 2GBMA 3L16A 2K6DB 3TCAA 3WIMA 4EUTA 2KOXA 1A5RA 3T9LA 3U7DA 3Q3JA 2L3ZA 3LJ3A 4G3XB 4GIVA 4W9HA 3M95A 1WMHB 2JRHA 2L7RA 2DX5B 1WY8A 2KDFB 5KHOA 3ZDTA 5C1ZA 3EHVA 3B0AA 2FIDA 4NAWA 2GBRA 3PS6A 2GBJA 2ZVNA 2KD0A 1WJ6A 3M63B 2FNJB 3PRPB 3ZNZB 4DDGD 2MX2A 4FJVB 2YVCA 3TIXA 3PRZA 3U8ZA 1XD3B 3DVNV 2KJRA 3PRMB 2BGFA 4GDLB 2IO1B 4F7ZA 2D2QA 3PV1A 1IPGA 1H8CA 3M3JA 2BKFA 3APCA 3K9OB 2KZRA 4IWPA 2IY0B 1WXSA 3ENEA 3S2AA 3U30A 3VH3B 4EZKA 3CSTA 1KJTA 1J8CA 2CU1A 4WJNA 2D11A 2O2VA 3EECA 4MM3A 1SIFA 3IFWB 4MJSB 1WE6A 1VCBA 2L8JA 3DBHI 5G55A 3VUYA 2BYVE 3BINA 3VVWB 2LI5A 4WJPA 3WAPA 3X0WA 3W1SC 3GOEA 4B6WA 4M0WB 3C0RB 2MBEA 3MJWA 4HWIB 4ZYNA 2GOWA 1UH6A 4FHKA 1LQBA 1WX9A 2WDTB 2K8CA 3GZNI 1WE7A 2N7DA 3PLUA 4PYZA 3T8MA 1Z5SB 3V60A 4A3OA 4HPLB 3W1SA 1EUVB 1E8WA 2IO0B 3PHXB 1WGGA 4DK5A 2NS5A 3O65B 3PSEB 2ZVOA 4ZRIA 3H9DA 3QQ8B 5J18A 3IHPC 4WWPA 1BT0A 1OTRB 2XEWA 3RZFA 1GG3A 2BYFA 2JF5A 4BBNF 2KWCA 3VTVA 1P1AA 3DCGA 4W9EA 3JSVA 3L10B 2K6QA 4EZJA 2G4DB 1WFYA 2L05A 5CHWA 2IY1B 3R7RA 1CMXB 5E6NA 1I35A 4MGYE 1YIWA 4NNJB 4ANXA 2NR2A 4BKSD 1RFAA 1Q5WB 4ICVA 1U4AA 2MP2A 4MGZE 2W9NA 1WGDA 1WF9A 2HD5B 2L00B 4MH0E 2M4NA 1C3TA 1WX8A 2HE7A 3N3KB 3V6CB 4DHZE 2CR5A 2M17A 3B08A 3WALA 3QHTA 5L83A 2VRRB 1E7VA 2LD9A 3NZUA 3DDCB 2D10A 2L0FA 2O6VA 4DHJD 2UWQA 5IAAC 3AU5A 1E90A 1RRBA 2ZPNA 4LCDE 4E71A 5E6PA 1V80A 2BWES 4MEMA 2QHOA 4KV2A 2BF8B 3VTWA 3PTFC 3HIZA 1YJ1A 4IWOA 1IYFA 4MDKE 4PS3A 4HPMB 4AUQC 5FR6A 1J19A 1UGMA 5AZHA 4CO7A 2KFKB 4II3B 2LGDA 3H7PB 1YQBA 3VFKA 4F1SA 4MJSA 3H7SA 2AWTA 3ML8A 2MQJA 3VH4B 3IVFA 4W9GA 2KC1A 3UF8A 1ZW7A 1OEYA 1NDDA 3KYCD 4MGIE 3N32A 2LVQA 4B95A 3RYTA 2NBVB 3R3MA 3TL5A 3ZLZA 3MTNB 5J2RA 2AL6A 2KTFA 3QC8B 3QAQA 4KZCA 2JPHA 3HHMA 3L0WB 2KDEB 2MW5A 1WXAA 2FCNA 2JT4B 4KVGB 2I1KA 2XK5B 3KW5B 1WI0A 2RPQA 2DAJA 2JWZA 2KMCA 1TGZB 4WJQA 4W9LA 1P98A 4OVVA 1GUAB 2KVRA 3ZNID 4E74A 4TUUA 2LASA 4M8MA 3ZNHB 2FCMA 5DPTA 1V86A 3ZKJC 2O6VD 5JHAA 4PS8A 3CMMB 1WGRA 1MG8A 3JSVB 4EEWA 4B9KA 3KYDD 1UZXB 2IO2B 3SHQA 2IBIB 2KTRB 3RUIB 2KKCA 2NVUI 4KIKB 2DZIA 1QZEA 1WZ3A 3PLVA 2ZNVB 2LRWA 1Q0WB 3A33B 2MBQA 4ZRKA 2LXAA 2KDBA 2NBUA 5LLIA 3SDLC 2DZJA 4I6NB 2XK5A 5D2MB 2CKHB 1YX5B 4X57B 3AI5A 4K1RB 4DXAB 5AZGA 2JVCA 4EKUA 1WIAA 3ZRCA 1WGYA 3V6EB 4GXBA 1GC6A 1FXTB 3RD2A 4EZLA 3A9KB 2MBHA 3R7QA 3A9JB 4IM3A 2KLGA 1R4NI 4WQOB 4AP4C 5CTRC 3I3TB 4JIOU 5CHVC 1XT9B 1KLVA 3WAMA 4GMVA 2BKRB 3EC8A 4KIKA 4M8NA 1H4RA 1T0YA 1WMHA 1RLFA 2JUOA 4KDLB 3AU4A 3PVLA 2KFKA 3V61A 1AARA 1WJNA 3NY5A 2C9WB 2DYBA 2MLBA 3M62B 4LJOB 5J17A 2AL3A 2PEAA 4NY0A 2PPHA 2ASQA 5DPSA 4KDIC 1V9JA 4MELA 5IA7A 3KUCB 1R4MI 3APFA 3HM6X 3L13A 3NS8A 1E8XA 3IBEA 4XX5A 4ICUA 4NJ7A 2JY6A 5AEKB 2YLMA 4WWOA 3NZSA 3WA0A 2NPTB 3NOBA 1NI2A 4XC2A 3VQIA 5CHFA 2KWUB 3APDA 1P3QU 4IM2A 3ZVVA 4LJPB 1WM3A 3NHEB 2ZCBA 3JVZX 4AOFA 2MRPA 1UD7A 1M94A 2AEHA 1TZ1A 2LUEA 2LVOA 2CHXA 2ZPYA 4K7UA 2KWVB 2GMIC 1WXMA 4FBJB 3PT2B 1OQYA 1SGHA 2KTRA 2N9EB 4WWNA 4HK2A 5JH5C 1X1MA 1GJZA 3PHWB 3KH0A 4JL9A 3WAOA 3ZUNA 2HTHA 1LXDA 3KUZA 1D3ZA 4GU2A 3ZW3A 2WX1A 1P9DU 3CF6E 2ZEQA 1V81A 2V1YA 1P0RA 4TQ1A 3VTUA 5E6OA 1WX7A 1Y8RC 2LZ6A 1HE8A 2DHZA 2LRUA 4ASWC 2R2QA 3VAWA 2JXXA 2KJHB 3H1UA 4OVUA 4XZ4A 4K7WA 1V5OA 1XQQA 4G50A 1SE9A 1NBFC 3VUXA 3RCZA 1KM7A 2IYDB 2D07B 2ZJDA 2LXCA 2V3SA 4WAAA 2DYOA 1K8RB 2DZKA 2Z0DB 2WWZA 4GN1A 5TR5A 2MBOA 3ZTCA 2MSED 1UELA 2A5UA 1UBQA 3P2BA 4ZDVA 3UINB 2RGFA 3HM3A 4GDLA 3KVFB 5JZEB 2C7HA 1LM8B 3SD5A 2N9XA 5D94A 2K8HA 1LFDA 4NAWB 2KK8A 2M0XA 1GC7A 3A9JA 5KHQA 3X23A 2PJHA 3HK0A 3N30A 1EF5A 4GGQA 4AJYB 1L7YA 1YX6B 2KQSA 1ZKHA 2V4LA 4FHJA 4IG7B 4JGHB 2PE9A 1Z2MA 2OOBB 2IO3B 3K9PB 3RT3B 1WR1A 2KLCA 2ZZPB 3ALBA 1WZ0A 3D32A 4ZRJA 2RSUA 1ISNA 2L0TA 3QJZA 2M8SA 2A4ZA 1L2NA 1GNUA 3QWZB 4IC7B 2KN5A 3TBLD 3KUDB 3DVNU 4IM0A 2KMAA 2O6VB 4HDOA 4BVUC 1Q1OA 4FADA 2LGYA 1ZGUB 2Z0EB 4W9JA 3DBRI 4BFRA 1TBEA 4ANVA 2DYMA 3LDZE 4GDKB 4NJ6A 1WR6E 2KHWB 4W9DA 3QA8A 2AYOB 2LJ5A 2Y5BB 2G45B 4KSLC 4TKNA 5G2NA 4MSMB 4CYEA 1OGWA 3CSFA 4HJKA 1VD2A 5CX3A 4IWQA 1IP9A 3UGBB 1V2YA 3PPAA 2OJRA 1G6JA 4PYUA 4BKTA 3IG3A 1JRUA 5C23A 3Q3FA 4EOYA 1OEYJ 1WJUA 3QIJA 4IW0A 3ONSA 4FLHA 2JZ3B 1E5WA 3UIPB 2N4FA 4JQWC 3A1QA 1V49A 3AXCA 5GMVA 4I6LB 2BWFA 2MP2B 3VHTC 1F9JA 4GOCA 5AZFA 2DAFA 4BOSC 4TQ0A 3OLMD 4FA6A 4DHJB 4EFOA 2JZZA
chains in the Genus database with same CATH superfamily
1TKGA 3DVGX 2R2OA 3ZTDA 2K0PA 2YEPB 4E3CA 4FJZA 3TMPB 1E7UA 2RDHA 4AJWA 1IGDA 3PZDA 2FIFA 2FCSA 4BKGA 2BB5A 2LWPA 1V6EA 3BY4B 1HZ6A 1GAQB 1HXYD 2N1WA 3WANA 1FNVA 1UNSA 2BS2B 2N9KA 3MFGA 3ML9A 1NYRA 3DOWA 4N9F4 4M00A 4LNKA 4S0RA 2G3QB 2IDYA 2RR9A 3B1LX 4KGRA 3MC8A 5MPOA 2PE6B 3TJPA 4DHZB 1PYWD 3N1YC 1E8ZA 2DLBA 2GBNA 2NBWB 3JYUA 2KX0A 1FO4A 2WDQB 1IUEA 4I6PA 3Q6BA 3VDZA 3E9SA 1WSPA 4RGOS 4WQMA 1T0RC 1QOAA 3NJTA 2KQ4X 4G0NB 1J7AA 1MI0A 2Y5CA 1QKZA 2MJ3A 3ZO5B 5AUKA 4ITKA 3L08A 5L95C 2QSDA 1JWBD 3CIRB 1F1HA 2WX0A 4OW0A 2BYEA 4NPNA 4W9FA 2LEKA 3V3XA 4HDQA 3DPDA 1S1QB 2CHWA 2K1FA 4DDID 3DBSA 4GDKA 4XE0A 2PLPA 5BYRA 1EF1A 3L16A 4EUTA 2KOXA 2WXOA 1A5RA 2CJOA 4GIVA 1WMHB 2JRHA 2L7RA 3ABVB 1WY8A 2KDFB 3ZDTA 3EHVA 2GBRA 2GBJA 3ZQ4A 2FNJB 3AE1B 4FJVB 3TIXA 3PRZA 3DVNV 3PRMB 2BGFA 4GDLB 3AE2B 1H8CA 1FXAA 4RCOA 3S2AA 3U30A 1N63A 2O2VA 4MM3A 1TIFA 3EFCA 3W5VB 3W1SC 3GOEA 2MJDA 3MJWA 1UH6A 1F52A 1LQBA 3KWVA 3NVYA 1E9MA 3I5JC 2ONQA 2NS5A 3O65B 3H9DA 3IHPC 4WWPA 2JF5A 1OQRA 1R4MB 1SB3C 3UI3A 3DCGA 3JSVA 3L10B 1CMXB 1L5PA 1YIWA 4NNJB 3VRBB 1Q5WB 4ICVA 4MGZE 2L00B 1I4GA 4H2AA 2L1AA 3N1ZC 3WALA 1TYGB 3NZUA 2V4IB 2L0FA 2UWQA 2AQ2B 1RRBA 4E71A 5E6PA 3IAS1 3VTWA 3PTFC 4RF1A 1J19A 1HZ5A 4II3B 2LGDA 3H7PB 1YQBA 1E6EB 3RNFC 3CWIA 2IJ0A 5C2TB 3IVFA 1ET6A 1ET9A 3R3MA 4US9A 1R4NB 5T8IA 1KLUD 3HHMA 3L0WB 2FCNA 4KVGB 3KW5B 1WI0A 3RFZB 1GUAB 2JSVX 4ACFA 1MPEA 2LASA 1V1PA 5JHAA 1FCLA 3JSVB 4RGNA 3KYDD 1E10A 5G5HA 2KWDA 2KTRB 4KIKB 1ZOYB 3A33B 2MBQA 4DQOC 2NBUA 3PO0A 2DZJA 2XK5A 2CKHB 4K1RB 1GPXA 2LGSA 3V6EB 4GXBA 3KQ4A 1GC6A 4P1BC 1L0XB 1SE4A 3A9KB 2AQ3B 4YT0B 2QIEB 4IM3A 1RM6C 1WGKA 2BKRB 4M8NA 4KDLB 2OEDA 2PTLA 2QMTA 1AARA 2DYBA 3M62B 1UWMA 4L2YA 2AL3A 2PPHA 1V9JA 4JPSA 2QILA 1E8XA 4ICUA 3FKYA 2JY6A 2YLMA 2VH2A 2NPTB 2W82A 3NOBA 1NI2A 4XC2A 3APDA 2FE8A 3ZVVA 3NHEB 1QLBB 2MRPA 1V1PB 2MH7A 2LUEA 2CHXA 3I9V1 1TS4A 2GMIC 4RNAA 1OQYA 2W54A 4USAA 3Q3NC 4JL9A 3W5UB 1AWDA 4C80A 5E6OA 3I63C 2R2QA 2JXXA 3H1UA 4XZ4A 4HJGE 4B0MA 1D6EC 1L0YB 1SE9A 3IXSA 4KKIA 2IYDB 2D07B 2V3SA 1AW7A 1TS2A 3AE8B 1QT9A 4N6EB 1UBQA 1TJEA 3HM3A 2WNMA 1SXTA 1LM8B 3SD5A 2N9XA 1QILA 4ARIA 1GC7A 1N61A 1YMHE 3RNAC 1JALA 4GGQA 1XF5L 4IG7B 4PK1A 2PE9A 2OOBB 2IO3B 2KMMA 3RT3B 1VZ7A 3RNBC 3D32A 2N9LA 2G1EA 1ISNA 1UGJA 3QJZA 1FIQA 4A55A 3QWZB 1SF0A 3DVNU 2KMAA 2O6VB 2QJLA 3NS1A 4HPPA 1ZGUB 2Z0EB 3HUIA 2D5GA 4W9JA 1WR6E 2WQYB 3QA8A 2AYOB 3AEBB 2G45B 3IT4B 4TKNA 3AEAB 3CSFA 1V2YA 4LLGM 4P1CC 4PYUA 3AEEB 4EOYA 1WJUA 4OZBA 3QIJA 1XCTL 4XDCA 2EELA 1NEKB 1N5XA 1JRPA 4B0EA 5GMVA 4I6LB 3VHTC 4BOSC 3P4PB 4BAXA 4FA6A 2GRIA 4DHJB 4EFOA 2JZZA 2JYTA 2MHJA 3MHSD 1WJ4A 2KQ7A 2KDIA 4HLEA 4KSKC 2DBYA 2N9PC 2MCNB 5G5GA 3AH7A 4MT5A 2K39A 1D5XC 2INDC 1YN3A 1FFUA 2O2VB 1IBXA 2N7JA 4NQKE 1KF6B 1UBIA 1E8YA 4MGKE 4YWGG 1JROA 1V8CA 1XLPA 1JQ4A 2L83A 2G9HD 4AWJA 3AV8A 2MBBB 3A9KA 2KANA 3DHGC 1TTNA 4BKSA 3OJ3A 1GB1A 1T6BX 3DVGY 3ZIMA 4LTUA 3EFUA 4RMAA 2KNBA 3DQVA 3UQAA 4GSWA 2J0JA 5JHBA 3Q14C 3TEWA 1CJEA 2WXLA 3E56A 4MSQB 2D3AA 2JRIB 2KJ6A 4HVBA 2L76A 2NPTA 4W9IA 2DZMA 3AEGB 3HRDD 4YTNB 4YL8A 2AX5A 1FCCC 3B2FA 2KFJA 3DBHB 1YJIA 3FAHA 1DYQA 4C56C 1TKEA 4HXDA 3RULA 3N9YC 2HJ8A 5BO4B 1SSNA 1SEBD 1Y56A 2IGHA 5EE0A 1FRRA 4II2B 3P4QB 3HVZA 3SU8X 2RD0A 3VUWA 3IT6B 1FMAD 1T0SC 2ZCCA 1WYWB 3A4SC 4JLCA 3L54A 3DHIC 4FJYA 3RPFC 2Z59B 4DBGA 2KT7A 1V5TA 3NG0A 4ZHPA 4HKQA 2KO3A 1AN8A 5HI1A 2FUHB 1EO6A 2ACZB 2JX5A 3WIMA 1K50A 3T9LA 3U7DA 1YN5A 1QQRA 3Q8BA 1E0ZA 1BXTA 3AEFB 2M56B 3BVMA 1WJ6A 3P1MA 3PRPB 2MX2A 2IO1B 4CQNA 3AE4B 3PV1A 2BB6A 3M3JA 2PKOA 2VH1A 1CK1A 1KJTA 4WJNA 2E3TA 5EE3A 2L52A 1QF6A 1L0VB 3IFWB 4MJSB 2NTSA 1VCBA 5G55A 3BINA 2LI5A 3WAPA 4ZYNA 2GOWA 1WX9A 1C78A 3ETRA 3GZNI 4HPLB 3H8HA 2W55A 1EUVB 1WGGA 3RMKC 4WURA 1F2RC 4ZRIA 1C76A 1OTRB 2XEWA 3MP9A 1GG3A 2BYFA 4JWSC 2KWCA 1P1AA 4W9EA 4EZJA 3U2SC 2L05A 2IY1B 3R2TA 2TSSA 1RFAA 2WXGA 3OG5A 1I4QA 2LUMA 1DOYA 1CQVA 1WX8A 3V6CB 3N3KB 4DHZE 2CR5A 2M17A 2XNAC 5L83A 2VRRB 2K22A 3DDCB 1IBXB 2O6VA 4LCDE 2BWES 4MEMA 3NVVA 2QHOA 5GXGB 2BF8B 3HIZA 1J7BA 4MDKE 1K52A 3Q3MC 4HPMB 5FR6A 2GLSA 1UGMA 3B2GA 4CO7A 1VDVA 4F1SA 3H7SA 3ZJUA 3SEBA 3VH4B 2INPE 3ZGZA 1MHHE 2KC1A 1OEYA 3HVDA 5HG2A 2V3NA 3N32A 2LVQA 1HQRD 3TL5A 3ZLZA 3MTNB 4JX1C 2IGDA 2AL6A 2KTFA 3QC8B 2ZW0A 3QAQA 1WRIA 2PVOD 2MW5A 1WXAA 4O1NA 4HRSA 2JWZA 2KMCA 4W9LA 4N59A 2KVRA 4WWMA 4M8MA 2JQRB 4YTPB 3ZNHB 1V86A 3ZKJC 2O6VD 1UWXA 1F2RI 3CMMB 1WGRA 4EEWA 4B9KA 2BW2A 3SR6A 4RF0A 2IO2B 1DOIA 1NYQA 4C7ZA 1Q0WB 1D5MC 2KDBA 4Q2JA 1YX5B 3AI5A 4MH8A 2JVCA 4EKUA 3ZRCA 4KX6B 4REZA 5HHDG 3R7QA 2KLGA 1R4NI 4AP4C 3ZJTA 4JIOU 5CHVC 3WAMA 4KIKA 5BMHA 3T3OA 3C19A 3AU4A 3PVLA 2KFKA 4LJOB 3MC0B 3R2IA 1ZDXA 3KUCB 3HM6X 1ZDVA 3IBEA 4YSZB 5AEKB 4WWOA 3MC9A 3BWUD 2I2YA 2BBCA 3ZXRA 4LJPB 1WM3A 4C4VB 1UD7A 2AEHA 2LVOA 2QC8A 4D2KA 3PT2B 4IOIE 2BTEA 2Y3AA 1VRAB 2KTRA 2N9EB 3WCQA 5JH5C 3PHWB 3VRAB 3ZW3A 2WX1A 3TUOA 1B9RA 1Y8RC 2VZKB 1FM0D 2DHZA 1UF0A 1V5OA 2WS3B 1KM7A 2WGSA 2ZJDA 2LXCA 1F0ZA 4M01A 2DYOA 4XYCA 1YOVB 2Z0DB 5BMGA 4GN1A 1EU3A 1AYFA 2RGFA 5JZEB 2C7HA 2YEPF 5D94A 1MFWA 1ENFA 2M0XA 5KHQA 1SE2A 3URYA 3X23A 4P16A 1EF5A 2KQSA 4FHJA 1I4RA 1ZKHA 4JGHB 1WR1A 2KLCA 3ALBA 2RSUA 1NVID 2M8SA 1GNUA 4K3CA 4IM0A 3AE7B 1P7FA 3BYTB 1OFFA 3ZYYX 4GDKB 4W9DA 2Y5BB 2PW9A 4KSLC 4MSMB 4CYEA 2ICIA 4RH6A 1IP9A 3P42A 4BKTA 2JXTA 2KYWA 5C23A 3Q3FA 1FNUA 2SEBD 2N4FA 2RMMA 1L4DB 3A1QA 1I4XA 1F9JA 5JXVA 4LNFA 5AZFA 2DAFA 4TQ0A 3GS2A 2EMSA 4EE2A 4US8A 1MG4A 2NCNA 3L4PA 3P4RB 4K7SA 4LNIA 5BMIA 1SBBB 4ANWA 2J53A 1P7EA 2C60A 2LVPA 5EE9A 2C5LC 2KDMA 3H6NA 4WJOA 4L1BA 1FFVA 1VZ8A 2WDVB 3W1YA 1YD8U 3BZDB 5BYQA 1XLQA 5FKAC 3DHHC 4F8CB 4IDIA 3ZRFA 1SJHD 2WYQA 2H89B 3DBLI 4HCPB 4DWFA 4G11A 1F77A 3NUHB 2BPSA 5HKHA 5H8YE 2CS4A 3UQBA 4XWTA 4C4VA 4FN2A 3V62A 2V0GA 1RAXA 1BMLC 4PT5A 3VXWA 2WXJA 2QCZA 1PGBA 4UDUC 4BBNC 2GBKA 2IGGA 2WXFA 3Q69A 4QAYA 4IUMB 2MA9B 2WXNA 3N20C 2IZVB 4BOZB 1TZOA 2DENB 3I57A 2LJIA 4ZYSA 1ZXIA 3DBLB 1DOXA 2WXPA 3UIOB 4M0WA 4ARCA 3QCAA 3A1QB 5DPRA 1WRDB 3AULA 2KXJA 5LNK1 2J0MA 1XLOA 3H7PA 2EKIA 2FCQA 5FK9C 2WXMA 5LXIB 3ZXVA 4W9KA 2UYZB 2KC2A 4OZCA 3R66C 4HROA 1L4ZB 1WGHA 1L6VA 4P7IA 4XWWA 2FAZA 4DXFA 4AQ7A 2N7EA 2J0KA 3PGEA 1J0GA 2LGXA 1ROEA 2EKEC 2GBMA 2K6DB 3LJ3A 4G3XB 4W9HA 1FNWA 1VR9A 2DX5B 2B76B 1HTQA 4DXGA 5C1ZA 4NAWA 3PS6A 1KLGD 4DDGD 3U8ZA 2KJRA 1FD6A 4F7ZA 1IPGA 1N5WA 1V1OA 1SJED 1FPYA 4IWPA 1RWSA 2HTME 3W9CB 2IY0B 2CU1A 1SIFA 1EWCA 3DBHI 3VUYA 3U4EG 3VVWB 4WJPA 2DWQA 4M0WB 3GP7A 2MBEA 4FHKA 2WDTB 2K8CA 1WE7A 2N7DA 3V60A 3PHXB 3FILA 2LFIA 3V05A 2OJWA 4DK5A 5IOIA 5IO9A 2ZVOA 3QQ8B 4YSYB 5J18A 1BT0A 4BBNF 3VTVA 2G4DB 5E6NA 4C00A 2WXRA 2NR2A 3DBRB 4BKSD 2MP2A 2W9NA 1WGDA 2HD5B 4MH0E 1C3TA 5AUIA 3QHTA 1E7VA 2LD9A 4DHJD 3VR9B 5IAAC 3AU5A 1PGXA 3MHZA 2ZPNA 4GLSC 4ZRPA 1ESFA 1GB4A 2WXIA 1YJ1A 4IWOA 3TEYA 1IYFA 5AZHA 1XCQL 2KFKB 1E7PB 3VFKA 2R61A 4MJSA 3FC4A 1HTOA 4WAFA 2AWTA 3ML8A 3AE9B 3UF8A 1NDDA 3KYCD 4B95A 3RYTA 2NBVB 5J2RA 1XEEA 1NENB 4KZCA 2JPHA 4BZAA 4AS1A 2XK5B 2RPQA 2DAJA 1P98A 4OVVA 4E74A 3R8BA 5DPTA 3FILB 4PS8A 1MG8A 1C4CA 1N62A 2IBIB 3AECB 3RUIB 1QZEA 3PLVA 3SFEB 2LXAA 3AEDB 5LLIA 3SDLC 1EWYC 2LHEA 3LYYA 1D4BA 1XXGA 4X57B 2WXKA 4HKZE 4DXAB 1WIAA 3RD2A 2BVCA 4EZLA 2MBHA 2H88B 3A9JB 1SE3A 2LGIA 4WQOB 5BYSA 5CTRC 3I3TB 4HEA1 1XT9B 4ZOHC 3EC8A 1JWUD 1H4RA 1TKYA 4XGAB 4KGSA 2GB1A 3NY5A 2C9WB 1T0QC 3ZJVA 5J17A 1ZUD2 2PEAA 2D3BA 4KDIC 5IA7A 4MELA 1R4MI 2K9XA 2D3CA 3NVWA 3NS8A 4XX5A 3NZSA 2E6XA 5CHFA 2KWUB 2WU5B 1P3QU 4IM2A 2ZCBA 1KTKA 4K7UA 4FBJB 2WP9B 4WWNA 1STEA 2J52A 4HK2A 3RN9C 3U7ZA 3ZUNA 1LXDA 3KUZA 1D3ZA 4GU2A 4J3OD 4R3DA 2K3UA 2W3SA 3CF6E 1YNTE 2ZEQA 1V81A 5IP4D 4TQ1A 1N60A 2LZ6A 1HE8A 3VAWA 2KJHB 4OVUA 4K7WA 1XQQA 4G50A 3VUXA 1NBFC 1WXQA 1VZ6A 5TSSA 2RDGA 2WWZA 1XO3A 5TR5A 2FUG1 1UELA 2KN4A 2BQQA 4GDLA 3KVFB 5IN7A 3Q2AC 2M0AA 4YTMB 5IKCM 4NAWB 3A9JA 4NZLB 1I4HA 3KLSX 4LNOA 5I4DA 3HK0A 4AJYB 2V4LA 2HJ1A 2DNFA 1Z2MA 1I7HA 1UUPA 1N6ZA 1XLNA 3BIID 1TY0A 1WZ0A 4ZRJA 1HEZE 2L0TA 4NAMA 2A4ZA 4IC7B 3TBLD 3KUDB 1ZP0B 4HDOA 1Q1OA 1WYGA 3AMZA 4ANVA 1KH0A 2DYMA 4WH4A 2KHWB 2Q5WD 1QOBA 2INCC 3U52E 2NMQA 5G2NA 1OGWA 1VD2A 3UGBB 4RGTA 3PPAA 3Q8FA 3J9CA 1JRUA 1LGRA 3BVZA 4FLHA 1C4AA 2JZ3B 3UIPB 1FXIA 1V49A 1JW9D 2OHFA 2BWFA 2MP2B 3NRZA 2MEKA 2M1MA 2K8BA 2XBBC 2K5PA 5EE1A 4A3PA 1T3QA 5EDSA 4KZ0A 4S17A 2MJEA 2JYEA 4GB9A 3QX1A 3RI7C 2J7QB 1L6UA 4PS7A 4KKJA 1KRHA 1JCKB 2B3AA 2I38A 3QK0A 4FXCA 5D3IB 2C7NB 4OVZA 1C4PA 1TS3A 2K25A 1PUTA 2I1JA 3JW0X 4TV3A 3Q3OC 1C79A 2VZKD 1TT5B 4CHKA 1WM2A 2V9HA 3O13A 5D7GA 4ANUA 3AE6B 1ZXHA 5D6JB 4A20A 2L32A 3W2DA 2CHZA 2SAKA 3ZNGC 4A9AA 2CU3A 4XDDA 2MWSB 3T3NA 2EMTA 3PREA 4NQLB 1S3SG 1Q10A 3ZDMC 4A8XC 2WU2B 4RM8A 1C1YB 4HCNB 4LDTD 2REXA 5DPWA 1C9FA 2C7MB 1R7SA 3RNEC 3P4SB 1BUIC 4FULA 3OAWA 3ECIA 2JWUA 2BS3B 1K53A 2KX3A 2KACA 1I42A 1WH3A 3QARA 2GI9A 4K81A 3L17A 4MM3B 2D3GA 2ZNVC 4URKA 4J6IA 3OJ4B 3KWLA 4LDTB 3LB8C 4W9CA 3A4RA 5LXHA 2Y5PA 4JE3B 3AM9A 2W3RA 3RZWC 2G4SA 2V3PA 5DCNA 1PQSA 1JWSD 3RNGC 1WXVA 2N1VA 1KOTA 4RM9A 1TS5A 3P63A 3TCAA 3EUB2 2QDFA 4WIPA 1YQ3B 3Q3JA 5HFYA 1ZPSA 2L3ZA 3M95A 5KHOA 2KVZA 3B0AA 2FIDA 2ZVNA 2KD0A 3M63B 3ZNZB 2YVCA 1K51A 1C77A 1XD3B 1M4VA 1YJJA 2D2QA 3NVZA 2QEJC 1A70A 2BKFA 3APCA 3K9OB 4N58A 4NJCA 2RPVA 2KZRA 1EM7A 1YQ4B 1WXSA 3ENEA 3VH3B 4EZKA 1J8CA 3CSTA 2D11A 3EECA 2ZW1A 1WE6A 2L8JA 2BYVE 3SFDB 1J7CA 2PVGC 3X0WA 4B6WA 4MACA 3C0RB 4HWIB 1JMLA 4PYZA 3PLUA 3T8MA 4A3OA 1Z5SB 3W1SA 1E8WA 2IO0B 2NTTA 3RNCC 3PSEB 2LHDA 4LK0M 1JWMD 2M19A 3RZFA 2FBWB 2K6QA 1WFYA 5CHWA 3R7RA 1I35A 1NI3A 4MGYE 2HDEA 4ANXA 2INNE 2X8XX 5C3JB 1U4AA 1WF9A 1ACCA 1I4PA 4ZHOA 4TSSA 4KGTA 2M4NA 3EGRA 2HE7A 4RFBA 5E6JA 3B08A 2D10A 1E90A 5H92C 1V80A 1QOGA 1MHXA 3PZ7A 2J4XA 4KV2A 1RYJA 1EU4A 3TEZA 1MJDA 4PS3A 1VLBA 4AUQC 2J42A 3AE3B 4LNNA 2JU6X 1ZE3D 2MQJA 1KFYB 1T5XD 4W9GA 1IGCA 2WXQA 1ZW7A 4MGIE 2PMVA 4ZRQA 4OHJA 3MJ5A 2JZPA 2WHIA 3DWGC 2KDEB 4A90A 2JT4B 2I1KA 4WJQA 1TGZB 3AN1A 3ZNID 4YSXB 4TUUA 2XN9C 2FCMA 1FEHA 1FRDA 1HA5A 2CJNA 1UZXB 3SHQA 2KKCA 2NVUI 2DZIA 4L23A 2KAJA 1WZ3A 2LMCA 1D5ZC 3B9JA 3GZNB 1QOFA 2LRWA 2ZNVB 4ZRKA 2IPKD 4I6NB 5D2MB 2RDBC 3PZ8A 3GE3C 5AZGA 1PFDA 1WGYA 3BYYB 1FXTB 2WLBA 3EA6A 3Q8EA 2Z8LA 4K3BA 1RFKA 4P6VF 1KLVA 2BYTA 1VJKA 4GMVA 2WXHA 3BK1A 1T0YA 1WMHA 1RLFA 2JUOA 4C7YA 3V61A 1WJNA 1PDXA 2MLBA 4NY0A 3TSSA 2ASQA 5DPSA 1GOZA 3APFA 3L13A 4NJ7A 4JWUC 3WA0A 3VQIA 3IAM1 3JVZX 3AE5B 4OZAA 4AOFA 2AQ1B 1M94A 3Q8AA 1TZ1A 2ZPYA 2KWVB 1WXMA 1SGHA 1X1MA 1MVKA 1GJZA 3KH0A 3WAOA 2HTHA 3BK2A 1P9DU 2V1YA 1P0RA 3VTUA 1WX7A 2X38A 2LRUA 4ASWC 1PGAA 1CZPA 3N1XC 1V97A 1OQQA 1JWAD 4A6QA 3RCZA 3GB1A 5D3DA 4WAAA 2DZKA 1K8RB 3TEXA 4RGMA 1SIJA 2MBOA 2MSED 3ZTCA 2A5UA 3P2BA 4ZDVA 3UINB 4TMAB 1TY2A 3C8YA 2K8HA 1LFDA 2KK8A 3BVGA 2PJHA 3N30A 1L7YA 1LO5D 1YX6B 2BS4B 1DGJA 3K9PB 2ZZPB 3VR8B 1L2NA 2KN5A 1YN4A 4BVUC 4FADA 2LGYA 2N0SB 3GE8C 3DBRI 4BFRA 5FR3A 1TBEA 3LDZE 4NJ6A 2UU7A 2LJ5A 4YXDB 3OWEB 4HJKA 5CX3A 4IWQA 4M02A 2OJRA 1G6JA 3IG3A 2WDRB 1OEYJ 1B1ZA 4IW0A 3Q8CA 3ONSA 1E5WA 2BT6A 4JQWC 2ON8A 3AXCA 2PIAA 3AB5A 3LXFA 3NZ3A 4GOCA 3OLMD 3DWMA 4IKGA 1WWTA
chains in the Genus database with same CATH topology
2M1MA 2EMSA 2K8BA 2XBBC 4A3PA 3DVGX 3MHSD 2R2OA 3ZTDA 5EDSA 1WJ4A 2KQ7A 2KDIA 4KZ0A 4HLEA 4KSKC 4GB9A 2NCNA 3QX1A 4K7SA 4E3CA 2J7QB 4PS7A 2N9PC 4FJZA 2MCNB 2B3AA 3TMPB 1E7UA 4ANWA 3QK0A 2C7NB 2K39A 2C60A 2LVPA 3PZDA 4AJWA 2FIFA 2C5LC 2K25A 2FCSA 2I1JA 3H6NA 3JW0X 4TV3A 4WJOA 2LWPA 2O2VB 4BKGA 4NQKE 1UBIA 1V6EA 3W1YA 3BY4B 1E8YA 4CHKA 2N1WA 4MGKE 1WM2A 1YD8U 3WANA 5D7GA 3ML9A 4ANUA 4F8CB 4AWJA 3DOWA 3ZRFA 5D6JB 4N9F4 2WYQA 4A20A 3DBLI 2MBBB 3A9KA 2KANA 2CHZA 4HCPB 2G3QB 1TTNA 4G11A 3ZNGC 2RR9A 4DWFA 3B1LX 4BKSA 2BPSA 5HKHA 2MWSB 3OJ3A 2CS4A 3UQBA 2EMTA 3PREA 4FN2A 3V62A 2PE6B 4NQLB 1S3SG 1RAXA 3VXWA 3TJPA 3ZDMC 3DVGY 4RM8A 4DHZB 1C1YB 3ZIMA 4BBNC 2GBKA 4HCNB 3EFUA 4LDTD 1E8ZA 4RMAA 2KNBA 2REXA 3DQVA 2GBNA 2NBWB 4IUMB 3UQAA 5DPWA 2MA9B 3JYUA 2C7MB 2IZVB 2KX0A 4GSWA 2J0JA 4BOZB 2DENB 5JHBA 4FULA 3OAWA 3ECIA 4MSQB 4I6PA 2JRIB 2KJ6A 2KX3A 4HVBA 1I42A 1WH3A 2L76A 3QARA 2NPTA 4W9IA 2DZMA 3UIOB 3VDZA 4YL8A 4K81A 2KFJA 3L17A 3QCAA 2D3GA 4HXDA 3A1QB 3RULA 2ZNVC 4URKA 4G0NB 5DPRA 1WRDB 2HJ8A 3AULA 3ZO5B 2KXJA 4J6IA 5BO4B 3OJ4B 2J0MA 4LDTB 3L08A 3H7PA 4II2B 5L95C 2FCQA 5LXIB 4W9CA 3SU8X 2WX0A 3A4RA 2UYZB 2RD0A 2BYEA 2KC2A 4NPNA 4W9KA 5LXHA 3VUWA 3R66C 4W9FA 4HDQA 3DPDA 1S1QB 1WGHA 2CHWA 2ZCCA 4P7IA 1WYWB 2K1FA 3A4SC 4JLCA 3DBSA 3L54A 4FJYA 4GDKA 3RZWC 2FAZA 2G4SA 4DDID 2Z59B 4DBGA 2N7EA 2J0KA 5DCNA 1PQSA 3PGEA 1V5TA 1WXVA 2N1VA 1KOTA 2KO3A 1EF1A 4RM9A 2LGXA 1J0GA 2FUHB 1EO6A 2EKEC 2GBMA 3L16A 2K6DB 3TCAA 3WIMA 4EUTA 2KOXA 1A5RA 3T9LA 3U7DA 3Q3JA 2L3ZA 3LJ3A 4G3XB 4GIVA 4W9HA 3M95A 1WMHB 2JRHA 2L7RA 2DX5B 1WY8A 2KDFB 5KHOA 3ZDTA 5C1ZA 3EHVA 3B0AA 2FIDA 4NAWA 2GBRA 3PS6A 2GBJA 2ZVNA 2KD0A 1WJ6A 3M63B 2FNJB 3PRPB 3ZNZB 4DDGD 2MX2A 4FJVB 2YVCA 3TIXA 3PRZA 3U8ZA 1XD3B 3DVNV 2KJRA 3PRMB 2BGFA 4GDLB 2IO1B 4F7ZA 2D2QA 3PV1A 1IPGA 1H8CA 3M3JA 2BKFA 3APCA 3K9OB 2KZRA 4IWPA 2IY0B 1WXSA 3ENEA 3S2AA 3U30A 3VH3B 4EZKA 3CSTA 1KJTA 1J8CA 2CU1A 4WJNA 2D11A 2O2VA 3EECA 4MM3A 1SIFA 3IFWB 4MJSB 1WE6A 1VCBA 2L8JA 3DBHI 5G55A 3VUYA 2BYVE 3BINA 3VVWB 2LI5A 4WJPA 3WAPA 3X0WA 3W1SC 3GOEA 4B6WA 4M0WB 3C0RB 2MBEA 3MJWA 4HWIB 4ZYNA 2GOWA 1UH6A 4FHKA 1LQBA 1WX9A 2WDTB 2K8CA 3GZNI 1WE7A 2N7DA 3PLUA 4PYZA 3T8MA 1Z5SB 3V60A 4A3OA 4HPLB 3W1SA 1EUVB 1E8WA 2IO0B 3PHXB 1WGGA 4DK5A 2NS5A 3O65B 3PSEB 2ZVOA 4ZRIA 3H9DA 3QQ8B 5J18A 3IHPC 4WWPA 1BT0A 1OTRB 2XEWA 3RZFA 1GG3A 2BYFA 2JF5A 4BBNF 2KWCA 3VTVA 1P1AA 3DCGA 4W9EA 3JSVA 3L10B 2K6QA 4EZJA 2G4DB 1WFYA 2L05A 5CHWA 2IY1B 3R7RA 1CMXB 5E6NA 1I35A 4MGYE 1YIWA 4NNJB 4ANXA 2NR2A 4BKSD 1RFAA 1Q5WB 4ICVA 1U4AA 2MP2A 4MGZE 2W9NA 1WGDA 1WF9A 2HD5B 2L00B 4MH0E 2M4NA 1C3TA 1WX8A 2HE7A 3N3KB 3V6CB 4DHZE 2CR5A 2M17A 3B08A 3WALA 3QHTA 5L83A 2VRRB 1E7VA 2LD9A 3NZUA 3DDCB 2D10A 2L0FA 2O6VA 4DHJD 2UWQA 5IAAC 3AU5A 1E90A 1RRBA 2ZPNA 4LCDE 4E71A 5E6PA 1V80A 2BWES 4MEMA 2QHOA 4KV2A 2BF8B 3VTWA 3PTFC 3HIZA 1YJ1A 4IWOA 1IYFA 4MDKE 4PS3A 4HPMB 4AUQC 5FR6A 1J19A 1UGMA 5AZHA 4CO7A 2KFKB 4II3B 2LGDA 3H7PB 1YQBA 3VFKA 4F1SA 4MJSA 3H7SA 2AWTA 3ML8A 2MQJA 3VH4B 3IVFA 4W9GA 2KC1A 3UF8A 1ZW7A 1OEYA 1NDDA 3KYCD 4MGIE 3N32A 2LVQA 4B95A 3RYTA 2NBVB 3R3MA 3TL5A 3ZLZA 3MTNB 5J2RA 2AL6A 2KTFA 3QC8B 3QAQA 4KZCA 2JPHA 3HHMA 3L0WB 2KDEB 2MW5A 1WXAA 2FCNA 2JT4B 4KVGB 2I1KA 2XK5B 3KW5B 1WI0A 2RPQA 2DAJA 2JWZA 2KMCA 1TGZB 4WJQA 4W9LA 1P98A 4OVVA 1GUAB 2KVRA 3ZNID 4E74A 4TUUA 2LASA 4M8MA 3ZNHB 2FCMA 5DPTA 1V86A 3ZKJC 2O6VD 5JHAA 4PS8A 3CMMB 1WGRA 1MG8A 3JSVB 4EEWA 4B9KA 3KYDD 1UZXB 2IO2B 3SHQA 2IBIB 2KTRB 3RUIB 2KKCA 2NVUI 4KIKB 2DZIA 1QZEA 1WZ3A 3PLVA 2ZNVB 2LRWA 1Q0WB 3A33B 2MBQA 4ZRKA 2LXAA 2KDBA 2NBUA 5LLIA 3SDLC 2DZJA 4I6NB 2XK5A 5D2MB 2CKHB 1YX5B 4X57B 3AI5A 4K1RB 4DXAB 5AZGA 2JVCA 4EKUA 1WIAA 3ZRCA 1WGYA 3V6EB 4GXBA 1GC6A 1FXTB 3RD2A 4EZLA 3A9KB 2MBHA 3R7QA 3A9JB 4IM3A 2KLGA 1R4NI 4WQOB 4AP4C 5CTRC 3I3TB 4JIOU 5CHVC 1XT9B 1KLVA 3WAMA 4GMVA 2BKRB 3EC8A 4KIKA 4M8NA 1H4RA 1T0YA 1WMHA 1RLFA 2JUOA 4KDLB 3AU4A 3PVLA 2KFKA 3V61A 1AARA 1WJNA 3NY5A 2C9WB 2DYBA 2MLBA 3M62B 4LJOB 5J17A 2AL3A 2PEAA 4NY0A 2PPHA 2ASQA 5DPSA 4KDIC 1V9JA 4MELA 5IA7A 3KUCB 1R4MI 3APFA 3HM6X 3L13A 3NS8A 1E8XA 3IBEA 4XX5A 4ICUA 4NJ7A 2JY6A 5AEKB 2YLMA 4WWOA 3NZSA 3WA0A 2NPTB 3NOBA 1NI2A 4XC2A 3VQIA 5CHFA 2KWUB 3APDA 1P3QU 4IM2A 3ZVVA 4LJPB 1WM3A 3NHEB 2ZCBA 3JVZX 4AOFA 2MRPA 1UD7A 1M94A 2AEHA 1TZ1A 2LUEA 2LVOA 2CHXA 2ZPYA 4K7UA 2KWVB 2GMIC 1WXMA 4FBJB 3PT2B 1OQYA 1SGHA 2KTRA 2N9EB 4WWNA 4HK2A 5JH5C 1X1MA 1GJZA 3PHWB 3KH0A 4JL9A 3WAOA 3ZUNA 2HTHA 1LXDA 3KUZA 1D3ZA 4GU2A 3ZW3A 2WX1A 1P9DU 3CF6E 2ZEQA 1V81A 2V1YA 1P0RA 4TQ1A 3VTUA 5E6OA 1WX7A 1Y8RC 2LZ6A 1HE8A 2DHZA 2LRUA 4ASWC 2R2QA 3VAWA 2JXXA 2KJHB 3H1UA 4OVUA 4XZ4A 4K7WA 1V5OA 1XQQA 4G50A 1SE9A 1NBFC 3VUXA 3RCZA 1KM7A 2IYDB 2D07B 2ZJDA 2LXCA 2V3SA 4WAAA 2DYOA 1K8RB 2DZKA 2Z0DB 2WWZA 4GN1A 5TR5A 2MBOA 3ZTCA 2MSED 1UELA 2A5UA 1UBQA 3P2BA 4ZDVA 3UINB 2RGFA 3HM3A 4GDLA 3KVFB 5JZEB 2C7HA 1LM8B 3SD5A 2N9XA 5D94A 2K8HA 1LFDA 4NAWB 2KK8A 2M0XA 1GC7A 3A9JA 5KHQA 3X23A 2PJHA 3HK0A 3N30A 1EF5A 4GGQA 4AJYB 1L7YA 1YX6B 2KQSA 1ZKHA 2V4LA 4FHJA 4IG7B 4JGHB 2PE9A 1Z2MA 2OOBB 2IO3B 3K9PB 3RT3B 1WR1A 2KLCA 2ZZPB 3ALBA 1WZ0A 3D32A 4ZRJA 2RSUA 1ISNA 2L0TA 3QJZA 2M8SA 2A4ZA 1L2NA 1GNUA 3QWZB 4IC7B 2KN5A 3TBLD 3KUDB 3DVNU 4IM0A 2KMAA 2O6VB 4HDOA 4BVUC 1Q1OA 4FADA 2LGYA 1ZGUB 2Z0EB 4W9JA 3DBRI 4BFRA 1TBEA 4ANVA 2DYMA 3LDZE 4GDKB 4NJ6A 1WR6E 2KHWB 4W9DA 3QA8A 2AYOB 2LJ5A 2Y5BB 2G45B 4KSLC 4TKNA 5G2NA 4MSMB 4CYEA 1OGWA 3CSFA 4HJKA 1VD2A 5CX3A 4IWQA 1IP9A 3UGBB 1V2YA 3PPAA 2OJRA 1G6JA 4PYUA 4BKTA 3IG3A 1JRUA 5C23A 3Q3FA 4EOYA 1OEYJ 1WJUA 3QIJA 4IW0A 3ONSA 4FLHA 2JZ3B 1E5WA 3UIPB 2N4FA 4JQWC 3A1QA 1V49A 3AXCA 5GMVA 4I6LB 2BWFA 2MP2B 3VHTC 1F9JA 4GOCA 5AZFA 2DAFA 4BOSC 4TQ0A 3OLMD 4FA6A 4DHJB 4EFOA 2JZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1M A;  2EMS A;  2K8B A;  2XBB C;  4A3P A;  3DVG X;  3MHS D;  2R2O A;  3ZTD A;  5EDS A;  1WJ4 A;  2KQ7 A;  2KDI A;  4KZ0 A;  4HLE A;  4KSK C;  4GB9 A;  2NCN A;  3QX1 A;  4K7S A;  4E3C A;  2J7Q B;  4PS7 A;  2N9P C;  4FJZ A;  2MCN B;  2B3A A;  3TMP B;  1E7U A;  4ANW A;  3QK0 A;  2C7N B;  2K39 A;  2C60 A;  2LVP A;  3PZD A;  4AJW A;  2FIF A;  2C5L C;  2K25 A;  2FCS A;  2I1J A;  3H6N A;  3JW0 X;  4TV3 A;  4WJO A;  2LWP A;  2O2V B;  4BKG A;  4NQK E;  1UBI A;  1V6E A;  3W1Y A;  3BY4 B;  1E8Y A;  4CHK A;  2N1W A;  4MGK E;  1WM2 A;  1YD8 U;  3WAN A;  5D7G A;  3ML9 A;  4ANU A;  4F8C B;  4AWJ A;  3DOW A;  3ZRF A;  5D6J B;  4N9F 4;  2WYQ A;  4A20 A;  3DBL I;  2MBB B;  3A9K A;  2KAN A;  2CHZ A;  4HCP B;  2G3Q B;  1TTN A;  4G11 A;  3ZNG C;  2RR9 A;  4DWF A;  3B1L X;  4BKS A;  2BPS A;  5HKH A;  2MWS B;  3OJ3 A;  2CS4 A;  3UQB A;  2EMT A;  3PRE A;  4FN2 A;  3V62 A;  2PE6 B;  4NQL B;  1S3S G;  1RAX A;  3VXW A;  3TJP A;  3ZDM C;  3DVG Y;  4RM8 A;  4DHZ B;  1C1Y B;  3ZIM A;  4BBN C;  2GBK A;  4HCN B;  3EFU A;  4LDT D;  1E8Z A;  4RMA A;  2KNB A;  2REX A;  3DQV A;  2GBN A;  2NBW B;  4IUM B;  3UQA A;  5DPW A;  2MA9 B;  3JYU A;  2C7M B;  2IZV B;  2KX0 A;  4GSW A;  2J0J A;  4BOZ B;  2DEN B;  5JHB A;  4FUL A;  3OAW A;  3ECI A;  4MSQ B;  4I6P A;  2JRI B;  2KJ6 A;  2KX3 A;  4HVB A;  1I42 A;  1WH3 A;  2L76 A;  3QAR A;  2NPT A;  4W9I A;  2DZM A;  3UIO B;  3VDZ A;  4YL8 A;  4K81 A;  2KFJ A;  3L17 A;  3QCA A;  2D3G A;  4HXD A;  3A1Q B;  3RUL A;  2ZNV C;  4URK A;  4G0N B;  5DPR A;  1WRD B;  2HJ8 A;  3AUL A;  3ZO5 B;  2KXJ A;  4J6I A;  5BO4 B;  3OJ4 B;  2J0M A;  4LDT B;  3L08 A;  3H7P A;  4II2 B;  5L95 C;  2FCQ A;  5LXI B;  4W9C A;  3SU8 X;  2WX0 A;  3A4R A;  2UYZ B;  2RD0 A;  2BYE A;  2KC2 A;  4NPN A;  4W9K A;  5LXH A;  3VUW A;  3R66 C;  4W9F A;  4HDQ A;  3DPD A;  1S1Q B;  1WGH A;  2CHW A;  2ZCC A;  4P7I A;  1WYW B;  2K1F A;  3A4S C;  4JLC A;  3DBS A;  3L54 A;  4FJY A;  4GDK A;  3RZW C;  2FAZ A;  2G4S A;  4DDI D;  2Z59 B;  4DBG A;  2N7E A;  2J0K A;  5DCN A;  1PQS A;  3PGE A;  1V5T A;  1WXV A;  2N1V A;  1KOT A;  2KO3 A;  1EF1 A;  4RM9 A;  2LGX A;  1J0G A;  2FUH B;  1EO6 A;  2EKE C;  2GBM A;  3L16 A;  2K6D B;  3TCA A;  3WIM A;  4EUT A;  2KOX A;  1A5R A;  3T9L A;  3U7D A;  3Q3J A;  2L3Z A;  3LJ3 A;  4G3X B;  4GIV A;  4W9H A;  3M95 A;  1WMH B;  2JRH A;  2L7R A;  2DX5 B;  1WY8 A;  2KDF B;  5KHO A;  3ZDT A;  5C1Z A;  3EHV A;  3B0A A;  2FID A;  4NAW A;  2GBR A;  3PS6 A;  2GBJ A;  2ZVN A;  2KD0 A;  1WJ6 A;  3M63 B;  2FNJ B;  3PRP B;  3ZNZ B;  4DDG D;  2MX2 A;  4FJV B;  2YVC A;  3TIX A;  3PRZ A;  3U8Z A;  1XD3 B;  3DVN V;  2KJR A;  3PRM B;  2BGF A;  4GDL B;  2IO1 B;  4F7Z A;  2D2Q A;  3PV1 A;  1IPG A;  1H8C A;  3M3J A;  2BKF A;  3APC A;  3K9O B;  2KZR A;  4IWP A;  2IY0 B;  1WXS A;  3ENE A;  3S2A A;  3U30 A;  3VH3 B;  4EZK A;  3CST A;  1KJT A;  1J8C A;  2CU1 A;  4WJN A;  2D11 A;  2O2V A;  3EEC A;  4MM3 A;  1SIF A;  3IFW B;  4MJS B;  1WE6 A;  1VCB A;  2L8J A;  3DBH I;  5G55 A;  3VUY A;  2BYV E;  3BIN A;  3VVW B;  2LI5 A;  4WJP A;  3WAP A;  3X0W A;  3W1S C;  3GOE A;  4B6W A;  4M0W B;  3C0R B;  2MBE A;  3MJW A;  4HWI B;  4ZYN A;  2GOW A;  1UH6 A;  4FHK A;  1LQB A;  1WX9 A;  2WDT B;  2K8C A;  3GZN I;  1WE7 A;  2N7D A;  3PLU A;  4PYZ A;  3T8M A;  1Z5S B;  3V60 A;  4A3O A;  4HPL B;  3W1S A;  1EUV B;  1E8W A;  2IO0 B;  3PHX B;  1WGG A;  4DK5 A;  2NS5 A;  3O65 B;  3PSE B;  2ZVO A;  4ZRI A;  3H9D A;  3QQ8 B;  5J18 A;  3IHP C;  4WWP A;  1BT0 A;  1OTR B;  2XEW A;  3RZF A;  1GG3 A;  2BYF A;  2JF5 A;  4BBN F;  2KWC A;  3VTV A;  1P1A A;  3DCG A;  4W9E A;  3JSV A;  3L10 B;  2K6Q A;  4EZJ A;  2G4D B;  1WFY A;  2L05 A;  5CHW A;  2IY1 B;  3R7R A;  1CMX B;  5E6N A;  1I35 A;  4MGY E;  1YIW A;  4NNJ B;  4ANX A;  2NR2 A;  4BKS D;  1RFA A;  1Q5W B;  4ICV A;  1U4A A;  2MP2 A;  4MGZ E;  2W9N A;  1WGD A;  1WF9 A;  2HD5 B;  2L00 B;  4MH0 E;  2M4N A;  1C3T A;  1WX8 A;  2HE7 A;  3N3K B;  3V6C B;  4DHZ E;  2CR5 A;  2M17 A;  3B08 A;  3WAL A;  3QHT A;  5L83 A;  2VRR B;  1E7V A;  2LD9 A;  3NZU A;  3DDC B;  2D10 A;  2L0F A;  2O6V A;  4DHJ D;  2UWQ A;  5IAA C;  3AU5 A;  1E90 A;  1RRB A;  2ZPN A;  4LCD E;  4E71 A;  5E6P A;  1V80 A;  2BWE S;  4MEM A;  2QHO A;  4KV2 A;  2BF8 B;  3VTW A;  3PTF C;  3HIZ A;  1YJ1 A;  4IWO A;  1IYF A;  4MDK E;  4PS3 A;  4HPM B;  4AUQ C;  5FR6 A;  1J19 A;  1UGM A;  5AZH A;  4CO7 A;  2KFK B;  4II3 B;  2LGD A;  3H7P B;  1YQB A;  3VFK A;  4F1S A;  4MJS A;  3H7S A;  2AWT A;  3ML8 A;  2MQJ A;  3VH4 B;  3IVF A;  4W9G A;  2KC1 A;  3UF8 A;  1ZW7 A;  1OEY A;  1NDD A;  3KYC D;  4MGI E;  3N32 A;  2LVQ A;  4B95 A;  3RYT A;  2NBV B;  3R3M A;  3TL5 A;  3ZLZ A;  3MTN B;  5J2R A;  2AL6 A;  2KTF A;  3QC8 B;  3QAQ A;  4KZC A;  2JPH A;  3HHM A;  3L0W B;  2KDE B;  2MW5 A;  1WXA A;  2FCN A;  2JT4 B;  4KVG B;  2I1K A;  2XK5 B;  3KW5 B;  1WI0 A;  2RPQ A;  2DAJ A;  2JWZ A;  2KMC A;  1TGZ B;  4WJQ A;  4W9L A;  1P98 A;  4OVV A;  1GUA B;  2KVR A;  3ZNI D;  4E74 A;  4TUU A;  2LAS A;  4M8M A;  3ZNH B;  2FCM A;  5DPT A;  1V86 A;  3ZKJ C;  2O6V D;  5JHA A;  4PS8 A;  3CMM B;  1WGR A;  1MG8 A;  3JSV B;  4EEW A;  4B9K A;  3KYD D;  1UZX B;  2IO2 B;  3SHQ A;  2IBI B;  2KTR B;  3RUI B;  2KKC A;  2NVU I;  4KIK B;  2DZI A;  1QZE A;  1WZ3 A;  3PLV A;  2ZNV B;  2LRW A;  1Q0W B;  3A33 B;  2MBQ A;  4ZRK A;  2LXA A;  2KDB A;  2NBU A;  5LLI A;  3SDL C;  2DZJ A;  4I6N B;  2XK5 A;  5D2M B;  2CKH B;  1YX5 B;  4X57 B;  3AI5 A;  4K1R B;  4DXA B;  5AZG A;  2JVC A;  4EKU A;  1WIA A;  3ZRC A;  1WGY A;  3V6E B;  4GXB A;  1GC6 A;  1FXT B;  3RD2 A;  4EZL A;  3A9K B;  2MBH A;  3R7Q A;  3A9J B;  4IM3 A;  2KLG A;  1R4N I;  4WQO B;  4AP4 C;  5CTR C;  3I3T B;  4JIO U;  5CHV C;  1XT9 B;  1KLV A;  3WAM A;  4GMV A;  2BKR B;  3EC8 A;  4KIK A;  4M8N A;  1H4R A;  1T0Y A;  1WMH A;  1RLF A;  2JUO A;  4KDL B;  3AU4 A;  3PVL A;  2KFK A;  3V61 A;  1AAR A;  1WJN A;  3NY5 A;  2C9W B;  2DYB A;  2MLB A;  3M62 B;  4LJO B;  5J17 A;  2AL3 A;  2PEA A;  4NY0 A;  2PPH A;  2ASQ A;  5DPS A;  4KDI C;  1V9J A;  4MEL A;  5IA7 A;  3KUC B;  1R4M I;  3APF A;  3HM6 X;  3L13 A;  3NS8 A;  1E8X A;  3IBE A;  4XX5 A;  4ICU A;  4NJ7 A;  2JY6 A;  5AEK B;  2YLM A;  4WWO A;  3NZS A;  3WA0 A;  2NPT B;  3NOB A;  1NI2 A;  4XC2 A;  3VQI A;  5CHF A;  2KWU B;  3APD A;  1P3Q U;  4IM2 A;  3ZVV A;  4LJP B;  1WM3 A;  3NHE B;  2ZCB A;  3JVZ X;  4AOF A;  2MRP A;  1UD7 A;  1M94 A;  2AEH A;  1TZ1 A;  2LUE A;  2LVO A;  2CHX A;  2ZPY A;  4K7U A;  2KWV B;  2GMI C;  1WXM A;  4FBJ B;  3PT2 B;  1OQY A;  1SGH A;  2KTR A;  2N9E B;  4WWN A;  4HK2 A;  5JH5 C;  1X1M A;  1GJZ A;  3PHW B;  3KH0 A;  4JL9 A;  3WAO A;  3ZUN A;  2HTH A;  1LXD A;  3KUZ A;  1D3Z A;  4GU2 A;  3ZW3 A;  2WX1 A;  1P9D U;  3CF6 E;  2ZEQ A;  1V81 A;  2V1Y A;  1P0R A;  4TQ1 A;  3VTU A;  5E6O A;  1WX7 A;  1Y8R C;  2LZ6 A;  1HE8 A;  2DHZ A;  2LRU A;  4ASW C;  2R2Q A;  3VAW A;  2JXX A;  2KJH B;  3H1U A;  4OVU A;  4XZ4 A;  4K7W A;  1V5O A;  1XQQ A;  4G50 A;  1SE9 A;  1NBF C;  3VUX A;  3RCZ A;  1KM7 A;  2IYD B;  2D07 B;  2ZJD A;  2LXC A;  2V3S A;  4WAA A;  2DYO A;  1K8R B;  2DZK A;  2Z0D B;  2WWZ A;  4GN1 A;  5TR5 A;  2MBO A;  3ZTC A;  2MSE D;  1UEL A;  2A5U A;  1UBQ A;  3P2B A;  4ZDV A;  3UIN B;  2RGF A;  3HM3 A;  4GDL A;  3KVF B;  5JZE B;  2C7H A;  1LM8 B;  3SD5 A;  2N9X A;  5D94 A;  2K8H A;  1LFD A;  4NAW B;  2KK8 A;  2M0X A;  1GC7 A;  3A9J A;  5KHQ A;  3X23 A;  2PJH A;  3HK0 A;  3N30 A;  1EF5 A;  4GGQ A;  4AJY B;  1L7Y A;  1YX6 B;  2KQS A;  1ZKH A;  2V4L A;  4FHJ A;  4IG7 B;  4JGH B;  2PE9 A;  1Z2M A;  2OOB B;  2IO3 B;  3K9P B;  3RT3 B;  1WR1 A;  2KLC A;  2ZZP B;  3ALB A;  1WZ0 A;  3D32 A;  4ZRJ A;  2RSU A;  1ISN A;  2L0T A;  3QJZ A;  2M8S A;  2A4Z A;  1L2N A;  1GNU A;  3QWZ B;  4IC7 B;  2KN5 A;  3TBL D;  3KUD B;  3DVN U;  4IM0 A;  2KMA A;  2O6V B;  4HDO A;  4BVU C;  1Q1O A;  4FAD A;  2LGY A;  1ZGU B;  2Z0E B;  4W9J A;  3DBR I;  4BFR A;  1TBE A;  4ANV A;  2DYM A;  3LDZ E;  4GDK B;  4NJ6 A;  1WR6 E;  2KHW B;  4W9D A;  3QA8 A;  2AYO B;  2LJ5 A;  2Y5B B;  2G45 B;  4KSL C;  4TKN A;  5G2N A;  4MSM B;  4CYE A;  1OGW A;  3CSF A;  4HJK A;  1VD2 A;  5CX3 A;  4IWQ A;  1IP9 A;  3UGB B;  1V2Y A;  3PPA A;  2OJR A;  1G6J A;  4PYU A;  4BKT A;  3IG3 A;  1JRU A;  5C23 A;  3Q3F A;  4EOY A;  1OEY J;  1WJU A;  3QIJ A;  4IW0 A;  3ONS A;  4FLH A;  2JZ3 B;  1E5W A;  3UIP B;  2N4F A;  4JQW C;  3A1Q A;  1V49 A;  3AXC A;  5GMV A;  4I6L B;  2BWF A;  2MP2 B;  3VHT C;  1F9J A;  4GOC A;  5AZF A;  2DAF A;  4BOS C;  4TQ0 A;  3OLM D;  4FA6 A;  4DHJ B;  4EFO A;  2JZZ A; 
#chains in the Genus database with same CATH topology
 1TKG A;  3DVG X;  2R2O A;  3ZTD A;  2K0P A;  2YEP B;  4E3C A;  4FJZ A;  3TMP B;  1E7U A;  2RDH A;  4AJW A;  1IGD A;  3PZD A;  2FIF A;  2FCS A;  4BKG A;  2BB5 A;  2LWP A;  1V6E A;  3BY4 B;  1HZ6 A;  1GAQ B;  1HXY D;  2N1W A;  3WAN A;  1FNV A;  1UNS A;  2BS2 B;  2N9K A;  3MFG A;  3ML9 A;  1NYR A;  3DOW A;  4N9F 4;  4M00 A;  4LNK A;  4S0R A;  2G3Q B;  2IDY A;  2RR9 A;  3B1L X;  4KGR A;  3MC8 A;  5MPO A;  2PE6 B;  3TJP A;  4DHZ B;  1PYW D;  3N1Y C;  1E8Z A;  2DLB A;  2GBN A;  2NBW B;  3JYU A;  2KX0 A;  1FO4 A;  2WDQ B;  1IUE A;  4I6P A;  3Q6B A;  3VDZ A;  3E9S A;  1WSP A;  4RGO S;  4WQM A;  1T0R C;  1QOA A;  3NJT A;  2KQ4 X;  4G0N B;  1J7A A;  1MI0 A;  2Y5C A;  1QKZ A;  2MJ3 A;  3ZO5 B;  5AUK A;  4ITK A;  3L08 A;  5L95 C;  2QSD A;  1JWB D;  3CIR B;  1F1H A;  2WX0 A;  4OW0 A;  2BYE A;  4NPN A;  4W9F A;  2LEK A;  3V3X A;  4HDQ A;  3DPD A;  1S1Q B;  2CHW A;  2K1F A;  4DDI D;  3DBS A;  4GDK A;  4XE0 A;  2PLP A;  5BYR A;  1EF1 A;  3L16 A;  4EUT A;  2KOX A;  2WXO A;  1A5R A;  2CJO A;  4GIV A;  1WMH B;  2JRH A;  2L7R A;  3ABV B;  1WY8 A;  2KDF B;  3ZDT A;  3EHV A;  2GBR A;  2GBJ A;  3ZQ4 A;  2FNJ B;  3AE1 B;  4FJV B;  3TIX A;  3PRZ A;  3DVN V;  3PRM B;  2BGF A;  4GDL B;  3AE2 B;  1H8C A;  1FXA A;  4RCO A;  3S2A A;  3U30 A;  1N63 A;  2O2V A;  4MM3 A;  1TIF A;  3EFC A;  3W5V B;  3W1S C;  3GOE A;  2MJD A;  3MJW A;  1UH6 A;  1F52 A;  1LQB A;  3KWV A;  3NVY A;  1E9M A;  3I5J C;  2ONQ A;  2NS5 A;  3O65 B;  3H9D A;  3IHP C;  4WWP A;  2JF5 A;  1OQR A;  1R4M B;  1SB3 C;  3UI3 A;  3DCG A;  3JSV A;  3L10 B;  1CMX B;  1L5P A;  1YIW A;  4NNJ B;  3VRB B;  1Q5W B;  4ICV A;  4MGZ E;  2L00 B;  1I4G A;  4H2A A;  2L1A A;  3N1Z C;  3WAL A;  1TYG B;  3NZU A;  2V4I B;  2L0F A;  2UWQ A;  2AQ2 B;  1RRB A;  4E71 A;  5E6P A;  3IAS 1;  3VTW A;  3PTF C;  4RF1 A;  1J19 A;  1HZ5 A;  4II3 B;  2LGD A;  3H7P B;  1YQB A;  1E6E B;  3RNF C;  3CWI A;  2IJ0 A;  5C2T B;  3IVF A;  1ET6 A;  1ET9 A;  3R3M A;  4US9 A;  1R4N B;  5T8I A;  1KLU D;  3HHM A;  3L0W B;  2FCN A;  4KVG B;  3KW5 B;  1WI0 A;  3RFZ B;  1GUA B;  2JSV X;  4ACF A;  1MPE A;  2LAS A;  1V1P A;  5JHA A;  1FCL A;  3JSV B;  4RGN A;  3KYD D;  1E10 A;  5G5H A;  2KWD A;  2KTR B;  4KIK B;  1ZOY B;  3A33 B;  2MBQ A;  4DQO C;  2NBU A;  3PO0 A;  2DZJ A;  2XK5 A;  2CKH B;  4K1R B;  1GPX A;  2LGS A;  3V6E B;  4GXB A;  3KQ4 A;  1GC6 A;  4P1B C;  1L0X B;  1SE4 A;  3A9K B;  2AQ3 B;  4YT0 B;  2QIE B;  4IM3 A;  1RM6 C;  1WGK A;  2BKR B;  4M8N A;  4KDL B;  2OED A;  2PTL A;  2QMT A;  1AAR A;  2DYB A;  3M62 B;  1UWM A;  4L2Y A;  2AL3 A;  2PPH A;  1V9J A;  4JPS A;  2QIL A;  1E8X A;  4ICU A;  3FKY A;  2JY6 A;  2YLM A;  2VH2 A;  2NPT B;  2W82 A;  3NOB A;  1NI2 A;  4XC2 A;  3APD A;  2FE8 A;  3ZVV A;  3NHE B;  1QLB B;  2MRP A;  1V1P B;  2MH7 A;  2LUE A;  2CHX A;  3I9V 1;  1TS4 A;  2GMI C;  4RNA A;  1OQY A;  2W54 A;  4USA A;  3Q3N C;  4JL9 A;  3W5U B;  1AWD A;  4C80 A;  5E6O A;  3I63 C;  2R2Q A;  2JXX A;  3H1U A;  4XZ4 A;  4HJG E;  4B0M A;  1D6E C;  1L0Y B;  1SE9 A;  3IXS A;  4KKI A;  2IYD B;  2D07 B;  2V3S A;  1AW7 A;  1TS2 A;  3AE8 B;  1QT9 A;  4N6E B;  1UBQ A;  1TJE A;  3HM3 A;  2WNM A;  1SXT A;  1LM8 B;  3SD5 A;  2N9X A;  1QIL A;  4ARI A;  1GC7 A;  1N61 A;  1YMH E;  3RNA C;  1JAL A;  4GGQ A;  1XF5 L;  4IG7 B;  4PK1 A;  2PE9 A;  2OOB B;  2IO3 B;  2KMM A;  3RT3 B;  1VZ7 A;  3RNB C;  3D32 A;  2N9L A;  2G1E A;  1ISN A;  1UGJ A;  3QJZ A;  1FIQ A;  4A55 A;  3QWZ B;  1SF0 A;  3DVN U;  2KMA A;  2O6V B;  2QJL A;  3NS1 A;  4HPP A;  1ZGU B;  2Z0E B;  3HUI A;  2D5G A;  4W9J A;  1WR6 E;  2WQY B;  3QA8 A;  2AYO B;  3AEB B;  2G45 B;  3IT4 B;  4TKN A;  3AEA B;  3CSF A;  1V2Y A;  4LLG M;  4P1C C;  4PYU A;  3AEE B;  4EOY A;  1WJU A;  4OZB A;  3QIJ A;  1XCT L;  4XDC A;  2EEL A;  1NEK B;  1N5X A;  1JRP A;  4B0E A;  5GMV A;  4I6L B;  3VHT C;  4BOS C;  3P4P B;  4BAX A;  4FA6 A;  2GRI A;  4DHJ B;  4EFO A;  2JZZ A;  2JYT A;  2MHJ A;  3MHS D;  1WJ4 A;  2KQ7 A;  2KDI A;  4HLE A;  4KSK C;  2DBY A;  2N9P C;  2MCN B;  5G5G A;  3AH7 A;  4MT5 A;  2K39 A;  1D5X C;  2IND C;  1YN3 A;  1FFU A;  2O2V B;  1IBX A;  2N7J A;  4NQK E;  1KF6 B;  1UBI A;  1E8Y A;  4MGK E;  4YWG G;  1JRO A;  1V8C A;  1XLP A;  1JQ4 A;  2L83 A;  2G9H D;  4AWJ A;  3AV8 A;  2MBB B;  3A9K A;  2KAN A;  3DHG C;  1TTN A;  4BKS A;  3OJ3 A;  1GB1 A;  1T6B X;  3DVG Y;  3ZIM A;  4LTU A;  3EFU A;  4RMA A;  2KNB A;  3DQV A;  3UQA A;  4GSW A;  2J0J A;  5JHB A;  3Q14 C;  3TEW A;  1CJE A;  2WXL A;  3E56 A;  4MSQ B;  2D3A A;  2JRI B;  2KJ6 A;  4HVB A;  2L76 A;  2NPT A;  4W9I A;  2DZM A;  3AEG B;  3HRD D;  4YTN B;  4YL8 A;  2AX5 A;  1FCC C;  3B2F A;  2KFJ A;  3DBH B;  1YJI A;  3FAH A;  1DYQ A;  4C56 C;  1TKE A;  4HXD A;  3RUL A;  3N9Y C;  2HJ8 A;  5BO4 B;  1SSN A;  1SEB D;  1Y56 A;  2IGH A;  5EE0 A;  1FRR A;  4II2 B;  3P4Q B;  3HVZ A;  3SU8 X;  2RD0 A;  3VUW A;  3IT6 B;  1FMA D;  1T0S C;  2ZCC A;  1WYW B;  3A4S C;  4JLC A;  3L54 A;  3DHI C;  4FJY A;  3RPF C;  2Z59 B;  4DBG A;  2KT7 A;  1V5T A;  3NG0 A;  4ZHP A;  4HKQ A;  2KO3 A;  1AN8 A;  5HI1 A;  2FUH B;  1EO6 A;  2ACZ B;  2JX5 A;  3WIM A;  1K50 A;  3T9L A;  3U7D A;  1YN5 A;  1QQR A;  3Q8B A;  1E0Z A;  1BXT A;  3AEF B;  2M56 B;  3BVM A;  1WJ6 A;  3P1M A;  3PRP B;  2MX2 A;  2IO1 B;  4CQN A;  3AE4 B;  3PV1 A;  2BB6 A;  3M3J A;  2PKO A;  2VH1 A;  1CK1 A;  1KJT A;  4WJN A;  2E3T A;  5EE3 A;  2L52 A;  1QF6 A;  1L0V B;  3IFW B;  4MJS B;  2NTS A;  1VCB A;  5G55 A;  3BIN A;  2LI5 A;  3WAP A;  4ZYN A;  2GOW A;  1WX9 A;  1C78 A;  3ETR A;  3GZN I;  4HPL B;  3H8H A;  2W55 A;  1EUV B;  1WGG A;  3RMK C;  4WUR A;  1F2R C;  4ZRI A;  1C76 A;  1OTR B;  2XEW A;  3MP9 A;  1GG3 A;  2BYF A;  4JWS C;  2KWC A;  1P1A A;  4W9E A;  4EZJ A;  3U2S C;  2L05 A;  2IY1 B;  3R2T A;  2TSS A;  1RFA A;  2WXG A;  3OG5 A;  1I4Q A;  2LUM A;  1DOY A;  1CQV A;  1WX8 A;  3V6C B;  3N3K B;  4DHZ E;  2CR5 A;  2M17 A;  2XNA C;  5L83 A;  2VRR B;  2K22 A;  3DDC B;  1IBX B;  2O6V A;  4LCD E;  2BWE S;  4MEM A;  3NVV A;  2QHO A;  5GXG B;  2BF8 B;  3HIZ A;  1J7B A;  4MDK E;  1K52 A;  3Q3M C;  4HPM B;  5FR6 A;  2GLS A;  1UGM A;  3B2G A;  4CO7 A;  1VDV A;  4F1S A;  3H7S A;  3ZJU A;  3SEB A;  3VH4 B;  2INP E;  3ZGZ A;  1MHH E;  2KC1 A;  1OEY A;  3HVD A;  5HG2 A;  2V3N A;  3N32 A;  2LVQ A;  1HQR D;  3TL5 A;  3ZLZ A;  3MTN B;  4JX1 C;  2IGD A;  2AL6 A;  2KTF A;  3QC8 B;  2ZW0 A;  3QAQ A;  1WRI A;  2PVO D;  2MW5 A;  1WXA A;  4O1N A;  4HRS A;  2JWZ A;  2KMC A;  4W9L A;  4N59 A;  2KVR A;  4WWM A;  4M8M A;  2JQR B;  4YTP B;  3ZNH B;  1V86 A;  3ZKJ C;  2O6V D;  1UWX A;  1F2R I;  3CMM B;  1WGR A;  4EEW A;  4B9K A;  2BW2 A;  3SR6 A;  4RF0 A;  2IO2 B;  1DOI A;  1NYQ A;  4C7Z A;  1Q0W B;  1D5M C;  2KDB A;  4Q2J A;  1YX5 B;  3AI5 A;  4MH8 A;  2JVC A;  4EKU A;  3ZRC A;  4KX6 B;  4REZ A;  5HHD G;  3R7Q A;  2KLG A;  1R4N I;  4AP4 C;  3ZJT A;  4JIO U;  5CHV C;  3WAM A;  4KIK A;  5BMH A;  3T3O A;  3C19 A;  3AU4 A;  3PVL A;  2KFK A;  4LJO B;  3MC0 B;  3R2I A;  1ZDX A;  3KUC B;  3HM6 X;  1ZDV A;  3IBE A;  4YSZ B;  5AEK B;  4WWO A;  3MC9 A;  3BWU D;  2I2Y A;  2BBC A;  3ZXR A;  4LJP B;  1WM3 A;  4C4V B;  1UD7 A;  2AEH A;  2LVO A;  2QC8 A;  4D2K A;  3PT2 B;  4IOI E;  2BTE A;  2Y3A A;  1VRA B;  2KTR A;  2N9E B;  3WCQ A;  5JH5 C;  3PHW B;  3VRA B;  3ZW3 A;  2WX1 A;  3TUO A;  1B9R A;  1Y8R C;  2VZK B;  1FM0 D;  2DHZ A;  1UF0 A;  1V5O A;  2WS3 B;  1KM7 A;  2WGS A;  2ZJD A;  2LXC A;  1F0Z A;  4M01 A;  2DYO A;  4XYC A;  1YOV B;  2Z0D B;  5BMG A;  4GN1 A;  1EU3 A;  1AYF A;  2RGF A;  5JZE B;  2C7H A;  2YEP F;  5D94 A;  1MFW A;  1ENF A;  2M0X A;  5KHQ A;  1SE2 A;  3URY A;  3X23 A;  4P16 A;  1EF5 A;  2KQS A;  4FHJ A;  1I4R A;  1ZKH A;  4JGH B;  1WR1 A;  2KLC A;  3ALB A;  2RSU A;  1NVI D;  2M8S A;  1GNU A;  4K3C A;  4IM0 A;  3AE7 B;  1P7F A;  3BYT B;  1OFF A;  3ZYY X;  4GDK B;  4W9D A;  2Y5B B;  2PW9 A;  4KSL C;  4MSM B;  4CYE A;  2ICI A;  4RH6 A;  1IP9 A;  3P42 A;  4BKT A;  2JXT A;  2KYW A;  5C23 A;  3Q3F A;  1FNU A;  2SEB D;  2N4F A;  2RMM A;  1L4D B;  3A1Q A;  1I4X A;  1F9J A;  5JXV A;  4LNF A;  5AZF A;  2DAF A;  4TQ0 A;  3GS2 A;  2EMS A;  4EE2 A;  4US8 A;  1MG4 A;  2NCN A;  3L4P A;  3P4R B;  4K7S A;  4LNI A;  5BMI A;  1SBB B;  4ANW A;  2J53 A;  1P7E A;  2C60 A;  2LVP A;  5EE9 A;  2C5L C;  2KDM A;  3H6N A;  4WJO A;  4L1B A;  1FFV A;  1VZ8 A;  2WDV B;  3W1Y A;  1YD8 U;  3BZD B;  5BYQ A;  1XLQ A;  5FKA C;  3DHH C;  4F8C B;  4IDI A;  3ZRF A;  1SJH D;  2WYQ A;  2H89 B;  3DBL I;  4HCP B;  4DWF A;  4G11 A;  1F77 A;  3NUH B;  2BPS A;  5HKH A;  5H8Y E;  2CS4 A;  3UQB A;  4XWT A;  4C4V A;  4FN2 A;  3V62 A;  2V0G A;  1RAX A;  1BML C;  4PT5 A;  3VXW A;  2WXJ A;  2QCZ A;  1PGB A;  4UDU C;  4BBN C;  2GBK A;  2IGG A;  2WXF A;  3Q69 A;  4QAY A;  4IUM B;  2MA9 B;  2WXN A;  3N20 C;  2IZV B;  4BOZ B;  1TZO A;  2DEN B;  3I57 A;  2LJI A;  4ZYS A;  1ZXI A;  3DBL B;  1DOX A;  2WXP A;  3UIO B;  4M0W A;  4ARC A;  3QCA A;  3A1Q B;  5DPR A;  1WRD B;  3AUL A;  2KXJ A;  5LNK 1;  2J0M A;  1XLO A;  3H7P A;  2EKI A;  2FCQ A;  5FK9 C;  2WXM A;  5LXI B;  3ZXV A;  4W9K A;  2UYZ B;  2KC2 A;  4OZC A;  3R66 C;  4HRO A;  1L4Z B;  1WGH A;  1L6V A;  4P7I A;  4XWW A;  2FAZ A;  4DXF A;  4AQ7 A;  2N7E A;  2J0K A;  3PGE A;  1J0G A;  2LGX A;  1ROE A;  2EKE C;  2GBM A;  2K6D B;  3LJ3 A;  4G3X B;  4W9H A;  1FNW A;  1VR9 A;  2DX5 B;  2B76 B;  1HTQ A;  4DXG A;  5C1Z A;  4NAW A;  3PS6 A;  1KLG D;  4DDG D;  3U8Z A;  2KJR A;  1FD6 A;  4F7Z A;  1IPG A;  1N5W A;  1V1O A;  1SJE D;  1FPY A;  4IWP A;  1RWS A;  2HTM E;  3W9C B;  2IY0 B;  2CU1 A;  1SIF A;  1EWC A;  3DBH I;  3VUY A;  3U4E G;  3VVW B;  4WJP A;  2DWQ A;  4M0W B;  3GP7 A;  2MBE A;  4FHK A;  2WDT B;  2K8C A;  1WE7 A;  2N7D A;  3V60 A;  3PHX B;  3FIL A;  2LFI A;  3V05 A;  2OJW A;  4DK5 A;  5IOI A;  5IO9 A;  2ZVO A;  3QQ8 B;  4YSY B;  5J18 A;  1BT0 A;  4BBN F;  3VTV A;  2G4D B;  5E6N A;  4C00 A;  2WXR A;  2NR2 A;  3DBR B;  4BKS D;  2MP2 A;  2W9N A;  1WGD A;  2HD5 B;  4MH0 E;  1C3T A;  5AUI A;  3QHT A;  1E7V A;  2LD9 A;  4DHJ D;  3VR9 B;  5IAA C;  3AU5 A;  1PGX A;  3MHZ A;  2ZPN A;  4GLS C;  4ZRP A;  1ESF A;  1GB4 A;  2WXI A;  1YJ1 A;  4IWO A;  3TEY A;  1IYF A;  5AZH A;  1XCQ L;  2KFK B;  1E7P B;  3VFK A;  2R61 A;  4MJS A;  3FC4 A;  1HTO A;  4WAF A;  2AWT A;  3ML8 A;  3AE9 B;  3UF8 A;  1NDD A;  3KYC D;  4B95 A;  3RYT A;  2NBV B;  5J2R A;  1XEE A;  1NEN B;  4KZC A;  2JPH A;  4BZA A;  4AS1 A;  2XK5 B;  2RPQ A;  2DAJ A;  1P98 A;  4OVV A;  4E74 A;  3R8B A;  5DPT A;  3FIL B;  4PS8 A;  1MG8 A;  1C4C A;  1N62 A;  2IBI B;  3AEC B;  3RUI B;  1QZE A;  3PLV A;  3SFE B;  2LXA A;  3AED B;  5LLI A;  3SDL C;  1EWY C;  2LHE A;  3LYY A;  1D4B A;  1XXG A;  4X57 B;  2WXK A;  4HKZ E;  4DXA B;  1WIA A;  3RD2 A;  2BVC A;  4EZL A;  2MBH A;  2H88 B;  3A9J B;  1SE3 A;  2LGI A;  4WQO B;  5BYS A;  5CTR C;  3I3T B;  4HEA 1;  1XT9 B;  4ZOH C;  3EC8 A;  1JWU D;  1H4R A;  1TKY A;  4XGA B;  4KGS A;  2GB1 A;  3NY5 A;  2C9W B;  1T0Q C;  3ZJV A;  5J17 A;  1ZUD 2;  2PEA A;  2D3B A;  4KDI C;  5IA7 A;  4MEL A;  1R4M I;  2K9X A;  2D3C A;  3NVW A;  3NS8 A;  4XX5 A;  3NZS A;  2E6X A;  5CHF A;  2KWU B;  2WU5 B;  1P3Q U;  4IM2 A;  2ZCB A;  1KTK A;  4K7U A;  4FBJ B;  2WP9 B;  4WWN A;  1STE A;  2J52 A;  4HK2 A;  3RN9 C;  3U7Z A;  3ZUN A;  1LXD A;  3KUZ A;  1D3Z A;  4GU2 A;  4J3O D;  4R3D A;  2K3U A;  2W3S A;  3CF6 E;  1YNT E;  2ZEQ A;  1V81 A;  5IP4 D;  4TQ1 A;  1N60 A;  2LZ6 A;  1HE8 A;  3VAW A;  2KJH B;  4OVU A;  4K7W A;  1XQQ A;  4G50 A;  3VUX A;  1NBF C;  1WXQ A;  1VZ6 A;  5TSS A;  2RDG A;  2WWZ A;  1XO3 A;  5TR5 A;  2FUG 1;  1UEL A;  2KN4 A;  2BQQ A;  4GDL A;  3KVF B;  5IN7 A;  3Q2A C;  2M0A A;  4YTM B;  5IKC M;  4NAW B;  3A9J A;  4NZL B;  1I4H A;  3KLS X;  4LNO A;  5I4D A;  3HK0 A;  4AJY B;  2V4L A;  2HJ1 A;  2DNF A;  1Z2M A;  1I7H A;  1UUP A;  1N6Z A;  1XLN A;  3BII D;  1TY0 A;  1WZ0 A;  4ZRJ A;  1HEZ E;  2L0T A;  4NAM A;  2A4Z A;  4IC7 B;  3TBL D;  3KUD B;  1ZP0 B;  4HDO A;  1Q1O A;  1WYG A;  3AMZ A;  4ANV A;  1KH0 A;  2DYM A;  4WH4 A;  2KHW B;  2Q5W D;  1QOB A;  2INC C;  3U52 E;  2NMQ A;  5G2N A;  1OGW A;  1VD2 A;  3UGB B;  4RGT A;  3PPA A;  3Q8F A;  3J9C A;  1JRU A;  1LGR A;  3BVZ A;  4FLH A;  1C4A A;  2JZ3 B;  3UIP B;  1FXI A;  1V49 A;  1JW9 D;  2OHF A;  2BWF A;  2MP2 B;  3NRZ A;  2MEK A;  2M1M A;  2K8B A;  2XBB C;  2K5P A;  5EE1 A;  4A3P A;  1T3Q A;  5EDS A;  4KZ0 A;  4S17 A;  2MJE A;  2JYE A;  4GB9 A;  3QX1 A;  3RI7 C;  2J7Q B;  1L6U A;  4PS7 A;  4KKJ A;  1KRH A;  1JCK B;  2B3A A;  2I38 A;  3QK0 A;  4FXC A;  5D3I B;  2C7N B;  4OVZ A;  1C4P A;  1TS3 A;  2K25 A;  1PUT A;  2I1J A;  3JW0 X;  4TV3 A;  3Q3O C;  1C79 A;  2VZK D;  1TT5 B;  4CHK A;  1WM2 A;  2V9H A;  3O13 A;  5D7G A;  4ANU A;  3AE6 B;  1ZXH A;  5D6J B;  4A20 A;  2L32 A;  3W2D A;  2CHZ A;  2SAK A;  3ZNG C;  4A9A A;  2CU3 A;  4XDD A;  2MWS B;  3T3N A;  2EMT A;  3PRE A;  4NQL B;  1S3S G;  1Q10 A;  3ZDM C;  4A8X C;  2WU2 B;  4RM8 A;  1C1Y B;  4HCN B;  4LDT D;  2REX A;  5DPW A;  1C9F A;  2C7M B;  1R7S A;  3RNE C;  3P4S B;  1BUI C;  4FUL A;  3OAW A;  3ECI A;  2JWU A;  2BS3 B;  1K53 A;  2KX3 A;  2KAC A;  1I42 A;  1WH3 A;  3QAR A;  2GI9 A;  4K81 A;  3L17 A;  4MM3 B;  2D3G A;  2ZNV C;  4URK A;  4J6I A;  3OJ4 B;  3KWL A;  4LDT B;  3LB8 C;  4W9C A;  3A4R A;  5LXH A;  2Y5P A;  4JE3 B;  3AM9 A;  2W3R A;  3RZW C;  2G4S A;  2V3P A;  5DCN A;  1PQS A;  1JWS D;  3RNG C;  1WXV A;  2N1V A;  1KOT A;  4RM9 A;  1TS5 A;  3P63 A;  3TCA A;  3EUB 2;  2QDF A;  4WIP A;  1YQ3 B;  3Q3J A;  5HFY A;  1ZPS A;  2L3Z A;  3M95 A;  5KHO A;  2KVZ A;  3B0A A;  2FID A;  2ZVN A;  2KD0 A;  3M63 B;  3ZNZ B;  2YVC A;  1K51 A;  1C77 A;  1XD3 B;  1M4V A;  1YJJ A;  2D2Q A;  3NVZ A;  2QEJ C;  1A70 A;  2BKF A;  3APC A;  3K9O B;  4N58 A;  4NJC A;  2RPV A;  2KZR A;  1EM7 A;  1YQ4 B;  1WXS A;  3ENE A;  3VH3 B;  4EZK A;  1J8C A;  3CST A;  2D11 A;  3EEC A;  2ZW1 A;  1WE6 A;  2L8J A;  2BYV E;  3SFD B;  1J7C A;  2PVG C;  3X0W A;  4B6W A;  4MAC A;  3C0R B;  4HWI B;  1JML A;  4PYZ A;  3PLU A;  3T8M A;  4A3O A;  1Z5S B;  3W1S A;  1E8W A;  2IO0 B;  2NTT A;  3RNC C;  3PSE B;  2LHD A;  4LK0 M;  1JWM D;  2M19 A;  3RZF A;  2FBW B;  2K6Q A;  1WFY A;  5CHW A;  3R7R A;  1I35 A;  1NI3 A;  4MGY E;  2HDE A;  4ANX A;  2INN E;  2X8X X;  5C3J B;  1U4A A;  1WF9 A;  1ACC A;  1I4P A;  4ZHO A;  4TSS A;  4KGT A;  2M4N A;  3EGR A;  2HE7 A;  4RFB A;  5E6J A;  3B08 A;  2D10 A;  1E90 A;  5H92 C;  1V80 A;  1QOG A;  1MHX A;  3PZ7 A;  2J4X A;  4KV2 A;  1RYJ A;  1EU4 A;  3TEZ A;  1MJD A;  4PS3 A;  1VLB A;  4AUQ C;  2J42 A;  3AE3 B;  4LNN A;  2JU6 X;  1ZE3 D;  2MQJ A;  1KFY B;  1T5X D;  4W9G A;  1IGC A;  2WXQ A;  1ZW7 A;  4MGI E;  2PMV A;  4ZRQ A;  4OHJ A;  3MJ5 A;  2JZP A;  2WHI A;  3DWG C;  2KDE B;  4A90 A;  2JT4 B;  2I1K A;  4WJQ A;  1TGZ B;  3AN1 A;  3ZNI D;  4YSX B;  4TUU A;  2XN9 C;  2FCM A;  1FEH A;  1FRD A;  1HA5 A;  2CJN A;  1UZX B;  3SHQ A;  2KKC A;  2NVU I;  2DZI A;  4L23 A;  2KAJ A;  1WZ3 A;  2LMC A;  1D5Z C;  3B9J A;  3GZN B;  1QOF A;  2LRW A;  2ZNV B;  4ZRK A;  2IPK D;  4I6N B;  5D2M B;  2RDB C;  3PZ8 A;  3GE3 C;  5AZG A;  1PFD A;  1WGY A;  3BYY B;  1FXT B;  2WLB A;  3EA6 A;  3Q8E A;  2Z8L A;  4K3B A;  1RFK A;  4P6V F;  1KLV A;  2BYT A;  1VJK A;  4GMV A;  2WXH A;  3BK1 A;  1T0Y A;  1WMH A;  1RLF A;  2JUO A;  4C7Y A;  3V61 A;  1WJN A;  1PDX A;  2MLB A;  4NY0 A;  3TSS A;  2ASQ A;  5DPS A;  1GOZ A;  3APF A;  3L13 A;  4NJ7 A;  4JWU C;  3WA0 A;  3VQI A;  3IAM 1;  3JVZ X;  3AE5 B;  4OZA A;  4AOF A;  2AQ1 B;  1M94 A;  3Q8A A;  1TZ1 A;  2ZPY A;  2KWV B;  1WXM A;  1SGH A;  1X1M A;  1MVK A;  1GJZ A;  3KH0 A;  3WAO A;  2HTH A;  3BK2 A;  1P9D U;  2V1Y A;  1P0R A;  3VTU A;  1WX7 A;  2X38 A;  2LRU A;  4ASW C;  1PGA A;  1CZP A;  3N1X C;  1V97 A;  1OQQ A;  1JWA D;  4A6Q A;  3RCZ A;  3GB1 A;  5D3D A;  4WAA A;  2DZK A;  1K8R B;  3TEX A;  4RGM A;  1SIJ A;  2MBO A;  2MSE D;  3ZTC A;  2A5U A;  3P2B A;  4ZDV A;  3UIN B;  4TMA B;  1TY2 A;  3C8Y A;  2K8H A;  1LFD A;  2KK8 A;  3BVG A;  2PJH A;  3N30 A;  1L7Y A;  1LO5 D;  1YX6 B;  2BS4 B;  1DGJ A;  3K9P B;  2ZZP B;  3VR8 B;  1L2N A;  2KN5 A;  1YN4 A;  4BVU C;  4FAD A;  2LGY A;  2N0S B;  3GE8 C;  3DBR I;  4BFR A;  5FR3 A;  1TBE A;  3LDZ E;  4NJ6 A;  2UU7 A;  2LJ5 A;  4YXD B;  3OWE B;  4HJK A;  5CX3 A;  4IWQ A;  4M02 A;  2OJR A;  1G6J A;  3IG3 A;  2WDR B;  1OEY J;  1B1Z A;  4IW0 A;  3Q8C A;  3ONS A;  1E5W A;  2BT6 A;  4JQW C;  2ON8 A;  3AXC A;  2PIA A;  3AB5 A;  3LXF A;  3NZ3 A;  4GOC A;  3OLM D;  3DWM A;  4IKG A;  1WWT A; 
#chains in the Genus database with same CATH homology
 2M1M A;  2EMS A;  2K8B A;  2XBB C;  4A3P A;  3DVG X;  3MHS D;  2R2O A;  3ZTD A;  5EDS A;  1WJ4 A;  2KQ7 A;  2KDI A;  4KZ0 A;  4HLE A;  4KSK C;  4GB9 A;  2NCN A;  3QX1 A;  4K7S A;  4E3C A;  2J7Q B;  4PS7 A;  2N9P C;  4FJZ A;  2MCN B;  2B3A A;  3TMP B;  1E7U A;  4ANW A;  3QK0 A;  2C7N B;  2K39 A;  2C60 A;  2LVP A;  3PZD A;  4AJW A;  2FIF A;  2C5L C;  2K25 A;  2FCS A;  2I1J A;  3H6N A;  3JW0 X;  4TV3 A;  4WJO A;  2LWP A;  2O2V B;  4BKG A;  4NQK E;  1UBI A;  1V6E A;  3W1Y A;  3BY4 B;  1E8Y A;  4CHK A;  2N1W A;  4MGK E;  1WM2 A;  1YD8 U;  3WAN A;  5D7G A;  3ML9 A;  4ANU A;  4F8C B;  4AWJ A;  3DOW A;  3ZRF A;  5D6J B;  4N9F 4;  2WYQ A;  4A20 A;  3DBL I;  2MBB B;  3A9K A;  2KAN A;  2CHZ A;  4HCP B;  2G3Q B;  1TTN A;  4G11 A;  3ZNG C;  2RR9 A;  4DWF A;  3B1L X;  4BKS A;  2BPS A;  5HKH A;  2MWS B;  3OJ3 A;  2CS4 A;  3UQB A;  2EMT A;  3PRE A;  4FN2 A;  3V62 A;  2PE6 B;  4NQL B;  1S3S G;  1RAX A;  3VXW A;  3TJP A;  3ZDM C;  3DVG Y;  4RM8 A;  4DHZ B;  1C1Y B;  3ZIM A;  4BBN C;  2GBK A;  4HCN B;  3EFU A;  4LDT D;  1E8Z A;  4RMA A;  2KNB A;  2REX A;  3DQV A;  2GBN A;  2NBW B;  4IUM B;  3UQA A;  5DPW A;  2MA9 B;  3JYU A;  2C7M B;  2IZV B;  2KX0 A;  4GSW A;  2J0J A;  4BOZ B;  2DEN B;  5JHB A;  4FUL A;  3OAW A;  3ECI A;  4MSQ B;  4I6P A;  2JRI B;  2KJ6 A;  2KX3 A;  4HVB A;  1I42 A;  1WH3 A;  2L76 A;  3QAR A;  2NPT A;  4W9I A;  2DZM A;  3UIO B;  3VDZ A;  4YL8 A;  4K81 A;  2KFJ A;  3L17 A;  3QCA A;  2D3G A;  4HXD A;  3A1Q B;  3RUL A;  2ZNV C;  4URK A;  4G0N B;  5DPR A;  1WRD B;  2HJ8 A;  3AUL A;  3ZO5 B;  2KXJ A;  4J6I A;  5BO4 B;  3OJ4 B;  2J0M A;  4LDT B;  3L08 A;  3H7P A;  4II2 B;  5L95 C;  2FCQ A;  5LXI B;  4W9C A;  3SU8 X;  2WX0 A;  3A4R A;  2UYZ B;  2RD0 A;  2BYE A;  2KC2 A;  4NPN A;  4W9K A;  5LXH A;  3VUW A;  3R66 C;  4W9F A;  4HDQ A;  3DPD A;  1S1Q B;  1WGH A;  2CHW A;  2ZCC A;  4P7I A;  1WYW B;  2K1F A;  3A4S C;  4JLC A;  3DBS A;  3L54 A;  4FJY A;  4GDK A;  3RZW C;  2FAZ A;  2G4S A;  4DDI D;  2Z59 B;  4DBG A;  2N7E A;  2J0K A;  5DCN A;  1PQS A;  3PGE A;  1V5T A;  1WXV A;  2N1V A;  1KOT A;  2KO3 A;  1EF1 A;  4RM9 A;  2LGX A;  1J0G A;  2FUH B;  1EO6 A;  2EKE C;  2GBM A;  3L16 A;  2K6D B;  3TCA A;  3WIM A;  4EUT A;  2KOX A;  1A5R A;  3T9L A;  3U7D A;  3Q3J A;  2L3Z A;  3LJ3 A;  4G3X B;  4GIV A;  4W9H A;  3M95 A;  1WMH B;  2JRH A;  2L7R A;  2DX5 B;  1WY8 A;  2KDF B;  5KHO A;  3ZDT A;  5C1Z A;  3EHV A;  3B0A A;  2FID A;  4NAW A;  2GBR A;  3PS6 A;  2GBJ A;  2ZVN A;  2KD0 A;  1WJ6 A;  3M63 B;  2FNJ B;  3PRP B;  3ZNZ B;  4DDG D;  2MX2 A;  4FJV B;  2YVC A;  3TIX A;  3PRZ A;  3U8Z A;  1XD3 B;  3DVN V;  2KJR A;  3PRM B;  2BGF A;  4GDL B;  2IO1 B;  4F7Z A;  2D2Q A;  3PV1 A;  1IPG A;  1H8C A;  3M3J A;  2BKF A;  3APC A;  3K9O B;  2KZR A;  4IWP A;  2IY0 B;  1WXS A;  3ENE A;  3S2A A;  3U30 A;  3VH3 B;  4EZK A;  3CST A;  1KJT A;  1J8C A;  2CU1 A;  4WJN A;  2D11 A;  2O2V A;  3EEC A;  4MM3 A;  1SIF A;  3IFW B;  4MJS B;  1WE6 A;  1VCB A;  2L8J A;  3DBH I;  5G55 A;  3VUY A;  2BYV E;  3BIN A;  3VVW B;  2LI5 A;  4WJP A;  3WAP A;  3X0W A;  3W1S C;  3GOE A;  4B6W A;  4M0W B;  3C0R B;  2MBE A;  3MJW A;  4HWI B;  4ZYN A;  2GOW A;  1UH6 A;  4FHK A;  1LQB A;  1WX9 A;  2WDT B;  2K8C A;  3GZN I;  1WE7 A;  2N7D A;  3PLU A;  4PYZ A;  3T8M A;  1Z5S B;  3V60 A;  4A3O A;  4HPL B;  3W1S A;  1EUV B;  1E8W A;  2IO0 B;  3PHX B;  1WGG A;  4DK5 A;  2NS5 A;  3O65 B;  3PSE B;  2ZVO A;  4ZRI A;  3H9D A;  3QQ8 B;  5J18 A;  3IHP C;  4WWP A;  1BT0 A;  1OTR B;  2XEW A;  3RZF A;  1GG3 A;  2BYF A;  2JF5 A;  4BBN F;  2KWC A;  3VTV A;  1P1A A;  3DCG A;  4W9E A;  3JSV A;  3L10 B;  2K6Q A;  4EZJ A;  2G4D B;  1WFY A;  2L05 A;  5CHW A;  2IY1 B;  3R7R A;  1CMX B;  5E6N A;  1I35 A;  4MGY E;  1YIW A;  4NNJ B;  4ANX A;  2NR2 A;  4BKS D;  1RFA A;  1Q5W B;  4ICV A;  1U4A A;  2MP2 A;  4MGZ E;  2W9N A;  1WGD A;  1WF9 A;  2HD5 B;  2L00 B;  4MH0 E;  2M4N A;  1C3T A;  1WX8 A;  2HE7 A;  3N3K B;  3V6C B;  4DHZ E;  2CR5 A;  2M17 A;  3B08 A;  3WAL A;  3QHT A;  5L83 A;  2VRR B;  1E7V A;  2LD9 A;  3NZU A;  3DDC B;  2D10 A;  2L0F A;  2O6V A;  4DHJ D;  2UWQ A;  5IAA C;  3AU5 A;  1E90 A;  1RRB A;  2ZPN A;  4LCD E;  4E71 A;  5E6P A;  1V80 A;  2BWE S;  4MEM A;  2QHO A;  4KV2 A;  2BF8 B;  3VTW A;  3PTF C;  3HIZ A;  1YJ1 A;  4IWO A;  1IYF A;  4MDK E;  4PS3 A;  4HPM B;  4AUQ C;  5FR6 A;  1J19 A;  1UGM A;  5AZH A;  4CO7 A;  2KFK B;  4II3 B;  2LGD A;  3H7P B;  1YQB A;  3VFK A;  4F1S A;  4MJS A;  3H7S A;  2AWT A;  3ML8 A;  2MQJ A;  3VH4 B;  3IVF A;  4W9G A;  2KC1 A;  3UF8 A;  1ZW7 A;  1OEY A;  1NDD A;  3KYC D;  4MGI E;  3N32 A;  2LVQ A;  4B95 A;  3RYT A;  2NBV B;  3R3M A;  3TL5 A;  3ZLZ A;  3MTN B;  5J2R A;  2AL6 A;  2KTF A;  3QC8 B;  3QAQ A;  4KZC A;  2JPH A;  3HHM A;  3L0W B;  2KDE B;  2MW5 A;  1WXA A;  2FCN A;  2JT4 B;  4KVG B;  2I1K A;  2XK5 B;  3KW5 B;  1WI0 A;  2RPQ A;  2DAJ A;  2JWZ A;  2KMC A;  1TGZ B;  4WJQ A;  4W9L A;  1P98 A;  4OVV A;  1GUA B;  2KVR A;  3ZNI D;  4E74 A;  4TUU A;  2LAS A;  4M8M A;  3ZNH B;  2FCM A;  5DPT A;  1V86 A;  3ZKJ C;  2O6V D;  5JHA A;  4PS8 A;  3CMM B;  1WGR A;  1MG8 A;  3JSV B;  4EEW A;  4B9K A;  3KYD D;  1UZX B;  2IO2 B;  3SHQ A;  2IBI B;  2KTR B;  3RUI B;  2KKC A;  2NVU I;  4KIK B;  2DZI A;  1QZE A;  1WZ3 A;  3PLV A;  2ZNV B;  2LRW A;  1Q0W B;  3A33 B;  2MBQ A;  4ZRK A;  2LXA A;  2KDB A;  2NBU A;  5LLI A;  3SDL C;  2DZJ A;  4I6N B;  2XK5 A;  5D2M B;  2CKH B;  1YX5 B;  4X57 B;  3AI5 A;  4K1R B;  4DXA B;  5AZG A;  2JVC A;  4EKU A;  1WIA A;  3ZRC A;  1WGY A;  3V6E B;  4GXB A;  1GC6 A;  1FXT B;  3RD2 A;  4EZL A;  3A9K B;  2MBH A;  3R7Q A;  3A9J B;  4IM3 A;  2KLG A;  1R4N I;  4WQO B;  4AP4 C;  5CTR C;  3I3T B;  4JIO U;  5CHV C;  1XT9 B;  1KLV A;  3WAM A;  4GMV A;  2BKR B;  3EC8 A;  4KIK A;  4M8N A;  1H4R A;  1T0Y A;  1WMH A;  1RLF A;  2JUO A;  4KDL B;  3AU4 A;  3PVL A;  2KFK A;  3V61 A;  1AAR A;  1WJN A;  3NY5 A;  2C9W B;  2DYB A;  2MLB A;  3M62 B;  4LJO B;  5J17 A;  2AL3 A;  2PEA A;  4NY0 A;  2PPH A;  2ASQ A;  5DPS A;  4KDI C;  1V9J A;  4MEL A;  5IA7 A;  3KUC B;  1R4M I;  3APF A;  3HM6 X;  3L13 A;  3NS8 A;  1E8X A;  3IBE A;  4XX5 A;  4ICU A;  4NJ7 A;  2JY6 A;  5AEK B;  2YLM A;  4WWO A;  3NZS A;  3WA0 A;  2NPT B;  3NOB A;  1NI2 A;  4XC2 A;  3VQI A;  5CHF A;  2KWU B;  3APD A;  1P3Q U;  4IM2 A;  3ZVV A;  4LJP B;  1WM3 A;  3NHE B;  2ZCB A;  3JVZ X;  4AOF A;  2MRP A;  1UD7 A;  1M94 A;  2AEH A;  1TZ1 A;  2LUE A;  2LVO A;  2CHX A;  2ZPY A;  4K7U A;  2KWV B;  2GMI C;  1WXM A;  4FBJ B;  3PT2 B;  1OQY A;  1SGH A;  2KTR A;  2N9E B;  4WWN A;  4HK2 A;  5JH5 C;  1X1M A;  1GJZ A;  3PHW B;  3KH0 A;  4JL9 A;  3WAO A;  3ZUN A;  2HTH A;  1LXD A;  3KUZ A;  1D3Z A;  4GU2 A;  3ZW3 A;  2WX1 A;  1P9D U;  3CF6 E;  2ZEQ A;  1V81 A;  2V1Y A;  1P0R A;  4TQ1 A;  3VTU A;  5E6O A;  1WX7 A;  1Y8R C;  2LZ6 A;  1HE8 A;  2DHZ A;  2LRU A;  4ASW C;  2R2Q A;  3VAW A;  2JXX A;  2KJH B;  3H1U A;  4OVU A;  4XZ4 A;  4K7W A;  1V5O A;  1XQQ A;  4G50 A;  1SE9 A;  1NBF C;  3VUX A;  3RCZ A;  1KM7 A;  2IYD B;  2D07 B;  2ZJD A;  2LXC A;  2V3S A;  4WAA A;  2DYO A;  1K8R B;  2DZK A;  2Z0D B;  2WWZ A;  4GN1 A;  5TR5 A;  2MBO A;  3ZTC A;  2MSE D;  1UEL A;  2A5U A;  1UBQ A;  3P2B A;  4ZDV A;  3UIN B;  2RGF A;  3HM3 A;  4GDL A;  3KVF B;  5JZE B;  2C7H A;  1LM8 B;  3SD5 A;  2N9X A;  5D94 A;  2K8H A;  1LFD A;  4NAW B;  2KK8 A;  2M0X A;  1GC7 A;  3A9J A;  5KHQ A;  3X23 A;  2PJH A;  3HK0 A;  3N30 A;  1EF5 A;  4GGQ A;  4AJY B;  1L7Y A;  1YX6 B;  2KQS A;  1ZKH A;  2V4L A;  4FHJ A;  4IG7 B;  4JGH B;  2PE9 A;  1Z2M A;  2OOB B;  2IO3 B;  3K9P B;  3RT3 B;  1WR1 A;  2KLC A;  2ZZP B;  3ALB A;  1WZ0 A;  3D32 A;  4ZRJ A;  2RSU A;  1ISN A;  2L0T A;  3QJZ A;  2M8S A;  2A4Z A;  1L2N A;  1GNU A;  3QWZ B;  4IC7 B;  2KN5 A;  3TBL D;  3KUD B;  3DVN U;  4IM0 A;  2KMA A;  2O6V B;  4HDO A;  4BVU C;  1Q1O A;  4FAD A;  2LGY A;  1ZGU B;  2Z0E B;  4W9J A;  3DBR I;  4BFR A;  1TBE A;  4ANV A;  2DYM A;  3LDZ E;  4GDK B;  4NJ6 A;  1WR6 E;  2KHW B;  4W9D A;  3QA8 A;  2AYO B;  2LJ5 A;  2Y5B B;  2G45 B;  4KSL C;  4TKN A;  5G2N A;  4MSM B;  4CYE A;  1OGW A;  3CSF A;  4HJK A;  1VD2 A;  5CX3 A;  4IWQ A;  1IP9 A;  3UGB B;  1V2Y A;  3PPA A;  2OJR A;  1G6J A;  4PYU A;  4BKT A;  3IG3 A;  1JRU A;  5C23 A;  3Q3F A;  4EOY A;  1OEY J;  1WJU A;  3QIJ A;  4IW0 A;  3ONS A;  4FLH A;  2JZ3 B;  1E5W A;  3UIP B;  2N4F A;  4JQW C;  3A1Q A;  1V49 A;  3AXC A;  5GMV A;  4I6L B;  2BWF A;  2MP2 B;  3VHT C;  1F9J A;  4GOC A;  5AZF A;  2DAF A;  4BOS C;  4TQ0 A;  3OLM D;  4FA6 A;  4DHJ B;  4EFO A;  2JZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...