2LXAA

Solution structure of the get5 ubiquitin-like domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
MVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein MDY2
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 16
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lxaA00
3DBSA 5E6NA 5E6PA 2M17A 2IO3B 3TCAA 3V60A 2G3QB 3C0RB 3RD2A 3VUXA 4AWJA 2ZZPB 3RUIB 4KVGB 4XX5A 2N1WA 1M94A 3M3JA 4JLCA 1IP9A 1YX6B 2M1MA 2WYQA 3O65B 4NY0A 2MBOA 4ZRJA 4JGHB 4MJSA 4CO7A 3M95A 1Q5WB 3CSTA 2V1YA 2KTFA 1GC7A 3DPDA 2MCNB 2QHOA 1E7VA 1LM8B 2IO0B 3ZNHB 4FN2A 2MBBB 4GIVA 4EOYA 1S1QB 4AP4C 2RSUA 4AJWA 4ZRKA 3U7DA 4ANVA 4K81A 4TQ1A 2FIFA 1RAXA 1WJ6A 2ZPNA 4NPNA 2HD5B 5LLIA 2N4FA 3MTNB 4BKTA 5IA7A 4MDKE 2MBHA 2NVUI 2ZVOA 3L08A 4WQOB 3VXWA 1WJ4A 4I6NB 1X1MA 3PVLA 2DHZA 3Q3JA 3ZIMA 3VUWA 3UQBA 3M63B 3ZLZA 4KZ0A 3EHVA 2LJ5A 3LDZE 3W1SC 3ZNGC 2CU1A 2IO1B 1JRUA 4FBJB 3T9LA 4N9F4 1OGWA 2IY0B 2HTHA 3UQAA 1WX9A 2KJ6A 2KJRA 4MGIE 3A1QA 4OVUA 4WJNA 4HLEA 5JHBA 2ZNVB 4G3XB 5KHQA 4IWQA 4XZ4A 2MSED 4MGKE 4BFRA 3PRZA 1TTNA 2WX1A 1Y8RC 1WIAA 2FCNA 5C23A 2KANA 1CMXB 3SHQA 3V61A 4B9KA 2MRPA 4HPMB 4X57B 3T8MA 4DK5A 4DDGD 3ECIA 1V6EA 4GOCA 2K8BA 2KWVB 3PRMB 4BKGA 3TJPA 2KLGA 4TKNA 5E6OA 2CHZA 3QA8A 4M8NA 2XK5A 3DCGA 3H1UA 3NHEB 3VH3B 3VH4B 3ZRFA 4IM2A 4KDIC 4W9DA 3PHWB 4DHJD 1UH6A 3R66C 5IAAC 2BWES 1UBQA 5AZHA 2AEHA 1VD2A 2KTRB 4GGQA 4W9JA 2GBJA 2FUHB 4FJVB 2KFKB 5J17A 2LWPA 3LJ3A 5D7GA 3HM3A 2G45B 2AWTA 3H7SA 2DX5B 2EMTA 3GZNI 3SD5A 2KDEB 4BKSD 2LVPA 3GOEA 1J0GA 2BKRB 3KUZA 2K8HA 4HPLB 4RM8A 4WWPA 5DPWA 1NDDA 5HKHA 1UELA 3AULA 4JL9A 3WA0A 4IM0A 1E5WA 2G4DB 2KC1A 1KJTA 4FJYA 5DCNA 2M8SA 3PT2B 3QARA 2KD0A 3VQIA 2K6QA 2IZVB 3IFWB 1WM3A 2KMAA 2KFKA 4GMVA 4M0WB 3BY4B 2CR5A 1NBFC 2DZMA 2FNJB 3QWZB 4GDLA 3V6EB 2ZJDA 1EO6A 2L0FA 1NI2A 1TBEA 2LVOA 2C5LC 1WI0A 2PE9A 3QHTA 3K9OB 2BYEA 3H7PA 4LCDE 4FADA 4ICVA 1L7YA 4KIKB 3X23A 1SE9A 3QIJA 4ZDVA 1I35A 3EECA 4EZLA 5KHOA 4GB9A 2KX3A 2M0XA 2LGXA 4GSWA 4ANUA 1OQYA 2JZ3B 2KWCA 3A4RA 1YJ1A 2KDBA 1WYWB 2LXAA 3OJ4B 4II3B 4PS8A 3QQ8B 3CSFA 3PLVA 3WAPA 3H6NA 2LRWA 4EZKA 2C7NB 1GC6A 4IWPA 3DOWA 3JVZX 4FLHA 3UGBB 1YD8U 2PE6B 2EKEC 2KVRA 3ML9A 4HCNB 3PTFC 3EFUA 5G2NA 3JYUA 4EUTA 3PLUA 4KIKA 4I6PA 1WXMA 3A33B 1WE7A 1WH3A 3I3TB 4URKA 4JIOU 1R4MI 2JF5A 4PS3A 3X0WA 2J7QB 2KC2A 3R3MA 2KOXA 2LGYA 4K7SA 4WJOA 4ASWC 5LXIB 2LI5A 4TQ0A 2IY1B 2PJHA 4DHJB 3JSVA 4GDKB 1QZEA 2NR2A 2O2VA 3QC8B 3VVWB 4IM3A 5L95C 5CHFA 1WR1A 4F8CB 1G6JA 4ICUA 4PYUA 4CHKA 1Z2MA 2BF8B 2JY6A 3DBRI 2I1KA 1H4RA 1XD3B 2AL6A 4J6IA 1MG8A 3ZUNA 1V49A 4KV2A 1RRBA 3NOBA 3VAWA 4IUMB 2NCNA 2DZJA 3DBHI 3WALA 3HK0A 2C9WB 5D6JB 3IBEA 3KYDD 5TR5A 5BO4B 4AJYB 1E8WA 1OEYA 4NAWB 3M62B 1V9JA 2UWQA 5AZFA 4LJOB 2ZNVC 2KFJA 4W9KA 4GDKA 1WGGA 3ZDMC 3ZTCA 5LXHA 1D3ZA 2BWFA 4I6LB 1V2YA 4II2B 1YIWA 5AEKB 2XBBC 2V3SA 4BVUC 3H9DA 4MH0E 5DPTA 3R7QA 4DHZE 4KSLC 4MM3A 1U4AA 1GNUA 3PREA 1H8CA 2O6VD 1EF1A 1SGHA 2LZ6A 3K9PB 1ZKHA 4GU2A 2V4LA 2BGFA 2L3ZA 2ZVNA 3WAMA 2UYZB 3ZDTA 3ZVVA 2KK8A 4NQLB 2DYMA 4XC2A 2LVQA 3KUCB 5CHWA 1V5OA 1WR6E 2A4ZA 2LUEA 1E8YA 2Z0EB 4W9IA 2L05A 2M4NA 3VTVA 1I42A 4TUUA 2W9NA 1KLVA 2N7DA 4DDID 3TBLD 1Z5SB 2MP2B 2HE7A 2AYOB 1EUVB 2DAFA 2XEWA 3NZUA 5CHVC 2ZCCA 3PV1A 3PSEB 4KSKC 3ZTDA 2VRRB 3A9JB 3KYCD 2Y5BB 3Q3FA 3SU8X 4A20A 2KN5A 4W9GA 1XT9B 1V5TA 4HDOA 3VHTC 3UIOB 2RPQA 1T0YA 1V81A 1ISNA 5JHAA 3VUYA 2BPSA 3PPAA 3OLMD 1WGDA 2GBKA 2L7RA 1WJNA 4MELA 3N30A 2DENB 1WXVA 3ZRCA 2KQ7A 2LRUA 2D07B 2RD0A 2I1JA 4M8MA 2JVCA 1UZXB 2AL3A 3AU5A 3CMMB 2MP2A 3AXCA 4PS7A 3ZNID 3P2BA 2DYBA 2KTRA 1GJZA 2BKFA 2BYFA 3A9JA 4GXBA 2OJRA 5J18A 3U30A 2K1FA 3HIZA 4KZCA 2R2QA 2ZPYA 3JW0X 3QAQA 2J0JA 1FXTB 2GBRA 5D2MB 3ZW3A 1J19A 3EC8A 4IG7B 3PHXB 4HJKA 4F7ZA 4G50A 3ZO5B 3APCA 4FHJA 4A3OA 4WAAA 2N7EA 3L16A 3ZKJC 2ZEQA 1WGYA 2J0MA 3U8ZA 5DPRA 2KXJA 1UD7A 3IG3A 2IO2B 1WF9A 1OTRB 2KX0A 2FAZA 3SDLC 3V6CB 5L83A 4K7WA 2LASA 2O6VB 4B95A 1LQBA 5AZGA 2J0KA 4GN1A 1P0RA 2PEAA 4LJPB 1P9DU 2NBWB 4NJ6A 4HWIB 2G4SA 3L17A 1P3QU 1Q0WB 1ZW7A 2NBUA 3KH0A 4MJSB 1IPGA 2ASQA 4RM9A 3L0WB 2FCMA 2MX2A 2MW5A 3B1LX 3DQVA 3PZDA 1WE6A 5D94A 4AOFA 2KHWB 1C1YB 1ZGUB 2JPHA 2JZZA 1C3TA 4WWNA 4A3PA 3V62A 4EZJA 1YQBA 3VTWA 2Z59B 3L13A 3RULA 5JZEB 3CF6E 4MEMA 4BOZB 3A4SC 2DAJA 4P7IA 3TMPB 4HVBA 2A5UA 2O6VA 1VCBA 3KVFB 2IBIB 2K25A 1A5RA 3PRPB 1J8CA 3APFA 3B08A 2D3GA 3UIPB 1GUAB 3WANA 5JH5C 2OOBB 4BBNF 4EEWA 2MWSB 2GOWA 2KKCA 2WX0A 3KW5B 3QJZA 4EKUA 3NZSA 3VTUA 2HJ8A 3MJWA 4CYEA 1WZ0A 2MQJA 4B6WA 2JXXA 2WDTB 3N32A 4HXDA 1WXSA 1RLFA 4MSMB 2N9PC 3HM6X 4BBNC 2KJHB 3D32A 4E71A 1WJUA 4FJZA 2GBMA 2DZIA 4W9CA 2LGDA 3DVNV 2JUOA 4IW0A 3A1QB 2KLCA 3B0AA 2L8JA 3RT3B 1WFYA 1UBIA 1BT0A 3N3KB 4LDTD 2K39A 3UF8A 2YVCA 3UINB 3DBLI 3KUDB 5EDSA 3RCZA 1WRDB 1S3SG 2EMSA 4W9EA 4ZYNA 2Z0DB 1WXAA 5G55A 4BKSA 4IC7B 5CX3A 1V80A 2K6DB 4MSQB 2CKHB 3PS6A 4AUQC 4NAWA 2KO3A 2LD9A 3ZNZB 3ALBA 5DPSA 1KOTA 2XK5B 2R2OA 3DVGX 3DDCB 2B3AA 4K7UA 5GMVA 4FULA 4E3CA 4OVVA 5J2RA 4ZRIA 2C7HA 3VDZA 3RZWC 1EF5A 1GG3A 2KZRA 2NBVB 4WWOA 3IVFA 1WY8A 4K1RB 4BOSC 1WX7A 2MA9B 4F1SA 1OEYJ 3AU4A 1V86A 3QCAA 2JWZA 3WAOA 4NNJB 1HE8A 1AARA 2GBNA 2YLMA 4ANWA 4DBGA 1WZ3A 4W9FA 2MLBA 3OJ3A 4FHKA 4W9LA 2IYDB 3HHMA 3A9KB 1UGMA 1WGRA 2N1VA 2KQSA 1WX8A 3MHSD 2ZCBA 4MGZE 1WGHA 2NS5A 1Q1OA 2NPTB 2L00B 4W9HA 2KDIA 3BINA 1WM2A 2N9XA 2PPHA 1WMHB 2KDFB 1K8RB 2RGFA 4IWOA 1L2NA 1SIFA 1TGZB 4TV3A 1R4NI 4GDLB 3W1SA 4RMAA 3NY5A 2L0TA 2LXCA 1YX5B 1P98A 2C7MB 4YL8A 3IHPC 3TL5A 4DXAB 2GMIC 3H7PB 3RZFA 5CTRC 2FCSA 1XQQA 5FR6A 3PGEA 2FCQA 3RYTA 3A9KA 1KM7A 2KNBA 3NS8A 4DWFA 2C60A 3DVGY 4EFOA 4NJ7A 5C1ZA 4HDQA 3APDA 4HCPB 2NPTA 1E90A 1LXDA 4WJQA 1F9JA 1P1AA 1WMHA 2CS4A 1E8XA 3WIMA 3DVNU 3W1YA 2N9EB 2DZKA 2CHWA 4G0NB 3L10B 4LDTB 3ML8A 4HK2A 4JQWC 2KWUB 2KMCA 1E8ZA 4PYZA 2D11A 4FA6A 2WWZA 4NQKE 2RR9A 1TZ1A 2CHXA 2L76A 4WJPA 3VFKA 2JRHA 2D10A 1IYFA 4E74A 3OAWA 2JRIB 4ANXA 3S2AA 2REXA 3ENEA 2D2QA 3TIXA 2BYVE 3JSVB 4KDLB 3QX1A 2O2VB 2FIDA 1RFAA 4DHZB 3QK0A 2K8CA 4G11A 1PQSA 3L54A 2JT4B 3ONSA 2MBEA 4MGYE 2MBQA 3R7RA 1E7UA 2DYOA 1LFDA 3AI5A
chains in the Genus database with same CATH superfamily
4TSSA 2M17A 3RD2A 4AWJA 4A9AA 4KVGB 3M3JA 2WYQA 3Q2AC 3O65B 4NY0A 4LNFA 4CO7A 3M95A 2IGGA 2V1YA 3AEDB 3DPDA 4KGTA 1FFUA 1T3QA 2MBBB 2XN9C 4AP4C 2RSUA 3P4SB 2CU3A 2X8XX 3AE6B 2ZPNA 3MTNB 5IA7A 4ZOHC 2PVOD 2G1EA 3Q3JA 4KZ0A 4LNKA 3LDZE 3RMKC 5C3JB 4N9F4 3PZ7A 3UQAA 1YJJA 2KJRA 1D5MC 3BVGA 2MSED 2DLBA 4LNNA 1I7HA 1Y8RC 4RFBA 3P4RB 3V61A 3SHQA 5BMIA 4HPMB 4X57B 3T8MA 3ZGZA 3Q8AA 4FXCA 2KACA 1V6EA 3U7ZA 4BKGA 2KLGA 2CHZA 3QA8A 3VH3B 4W9DA 3MJ5A 2KDMA 3R66C 1I4QA 5AZHA 4GGQA 4FJVB 2KFKB 1FCCC 2WP9B 2MH7A 1CQVA 2DX5B 3GZNI 2PVGC 2LVPA 1J0GA 2K8HA 1UUPA 4JL9A 2G4DB 2WXHA 1KFYB 2QDFA 3QARA 2KD0A 1ZP0B 3IFWB 2KMAA 3SFDB 4H2AA 4HROA 2CR5A 4GDLA 1IBXB 1TBEA 1WI0A 3QHTA 1T0RC 1AWDA 1L7YA 1V1PB 4HKQA 3AE5B 5KHOA 4MH8A 2KDBA 3W2DA 1D5ZC 4TMAB 3BZDB 4HPPA 1YD8U 3PTFC 5EE1A 1OQQA 3JYUA 5FR3A 1FNUA 3CWIA 3A33B 3FAHA 3P4QB 4JIOU 1R4MI 4XWTA 4JX1C 2KOXA 1SJED 3Q8FA 2PJHA 4C56C 4DHJB 3NS1A 1VDVA 3VVWB 2E6XA 4IM3A 4F8CB 1B9RA 4CHKA 1Z2MA 5TSSA 4J6IA 1MG8A 3Q69A 1EWYC 4KV2A 3C8YA 2DZJA 5HI1A 5TR5A 3M62B 1V9JA 3ZTCA 1D3ZA 1WGGA 3TEZA 4I6LB 4AQ7A 1V2YA 4II2B 5AEKB 5HG2A 2K3UA 4B0MA 2AQ3B 1JCKB 1KLUD 4LK0M 3DBRB 4KSLC 2QCZA 3LXFA 3PREA 1H8CA 1SIJA 3K9PB 2N9KA 1ZKHA 2SEBD 2UYZB 3ZDTA 3RNCC 1UGJA 2LVQA 1TKGA 2L05A 1F77A 3VTVA 4TUUA 1JMLA 2N7DA 3Q3OC 3TBLD 3I63C 4O1NA 1EUVB 2IPKD 4KSKC 3A9JB 1TS2A 1XT9B 3AM9A 1V5TA 3VHTC 2LUMA 3B9JA 3UIOB 1C77A 2RPQA 4LTUA 4A90A 1ISNA 2BPSA 3PPAA 4YSXB 1WGDA 2WDVB 2GBKA 1FEHA 2FE8A 3N30A 2KQ7A 3BIID 2RD0A 3ZNID 1C9FA 1Y56A 2VZKB 4GXBA 5J18A 3Q3NC 4OZCA 2JX5A 2R2QA 1FXTB 1JALA 2PW9A 1J19A 4M01A 4HJKA 3ZO5B 1T0SC 3APCA 4WAAA 3L16A 3BK2A 1N63A 3IG3A 2KX0A 3SDLC 5BYQA 1FPYA 3V6CB 4NJCA 1WSPA 2LASA 2JU6X 5AZGA 3ZJVA 1IBXA 1NVID 4GN1A 1I4HA 2NBWB 1SB3C 4HWIB 2G4SA 2J42A 4MJSB 4M02A 2WDRB 2YEPF 4DXFA 3DQVA 2X38A 4A3PA 3V62A 3RULA 3TMPB 1JQ4A 1RFKA 2IBIB 2WXGA 3UIPB 4RGMA 3WANA 3ABVB 3KW5B 3QJZA 4ZRQA 3TSSA 2HJ8A 4OZBA 2I2YA 4B6WA 2JXXA 1SSNA 5D3DA 1T0QC 4E71A 3Q14C 3BVMA 5FKAC 2BVCA 2JUOA 1J7BA 4LDTD 3UF8A 3BK1A 3KUDB 4LLGM 3RCZA 1JRPA 2EMSA 3IT4B 4W9EA 4ZYNA 1DOYA 5CX3A 1V80A 4MSQB 2G9HD 4AUQC 2LD9A 3ALBA 5DPSA 2BQQA 3WCQA 2XK5B 3DVGX 2H89B 5J2RA 4ZRIA 2KZRA 3IVFA 4XYCA 4F1SA 1OEYJ 3AU4A 4NNJB 4HKZE 3DBLB 2GBNA 3URYA 4W9FA 2MLBA 3OJ3A 4FHKA 2IYDB 3A9KB 1BUIC 1WGRA 2N1VA 2KQSA 1WX8A 1VZ6A 3AECB 1Q1OA 4IKGA 3TEWA 2N9XA 2KDFB 4IWOA 1SIFA 2HDEA 2WLBA 3W1SA 4RMAA 2WXLA 1ENFA 1P98A 3NVWA 4DXAB 3IHPC 3TL5A 3H7PB 1DOXA 3SEBA 4WH4A 5CTRC 5FR6A 3Q8EA 1KM7A 4DWFA 1C4PA 4EFOA 4OW0A 4HDQA 3APDA 4WJQA 3AE7B 4ZHPA 3FILB 3KWLA 3MHZA 3LB8C 3B2GA 1A70A 5JXVA 1RM6C 3ML8A 4JQWC 2V9HA 2KMCA 1C78A 1EU3A 2D11A 3H8HA 1TZ1A 2LHEA 2JRHA 1XXGA 2JRIB 2JYTA 2FUG1 2DNFA 2JQRB 4ANXA 3S2AA 2W82A 1XLNA 2BYVE 1ZDXA 2H88B 3JSVB 2BBCA 1WWTA 3ONSA 4A20A 3R7RA 1E7UA 2ACZB 3AI5A 2KN4A 5E6NA 1TZOA 1QF6A 2FBWB 4US9A 3V60A 1PFDA 3RUIB 3MP9A 2N1WA 2M1MA 4JGHB 4MJSA 1Q5WB 3I5JC 2KTFA 1GC7A 2QC8A 1YNTE 1LM8B 1FXAA 1OFFA 3DHIC 2JZPA 3NVYA 3ZNHB 1CJEA 4MM3B 4TQ1A 4YTMB 1RAXA 2HD5B 2N0SB 2N7JA 4C7YA 2NVUI 3L08A 4WQOB 2Q5WD 3R2IA 2PMVA 3PVLA 4XWWA 2WQYB 2WS3B 3M63B 3UQBA 3EHVA 1TT5B 1JRUA 3IAM1 1HZ5A 3T9LA 1ZE3D 2WXMA 5BMGA 1OGWA 1IGCA 1ZXHA 2OHFA 4MGIE 1FIQA 4OVUA 4HLEA 2ZNVB 4BFRA 3PRZA 1TTNA 1RWSA 1WIAA 2FCNA 2KANA 5EE3A 4DK5A 2VH1A 3TEXA 2KWVB 1JROA 3PRMB 3TJPA 1M4VA 5HFYA 3Q6BA 4M8NA 2XK5A 3DCGA 3H1UA 3NHEB 1VLBA 3KQ4A 3PHWB 5IAAC 3MC9A 2KTRB 2BS4B 2PKOA 3E9SA 3RNGC 1L0VB 5G5HA 2EMTA 1QLBB 1C79A 4BKSD 3VRAB 2L52A 2V0GA 5DPWA 1F2RC 5HKHA 4IM0A 3N1YC 4FJYA 1K51A 4ITKA 3VQIA 1TS5A 1WM3A 4GMVA 1FO4A 1K50A 3QWZB 3V6EB 1EO6A 1NI2A 1E7PB 5AUIA 1XLOA 2BYEA 2PLPA 3H7PA 4LCDE 2PTLA 1LO5D 1N6ZA 4ICVA 1I35A 1GB1A 3EECA 2KX3A 1P7EA 1OQYA 2BTEA 2KWCA 2BS3B 4II3B 1D5XC 3QQ8B 3CSFA 2LRWA 3FILA 1HTQA 2QIEB 1VR9A 3JVZX 4P1CC 1UF0A 3UGBB 2PE6B 3ML9A 4HCNB 1HTOA 2BT6A 3PLUA 2BB6A 2BW2A 2INCC 1WH3A 2JF5A 2J7QB 4ASWC 4WJOA 1YQ4B 2RDBC 3JSVA 4A55A 3OWEB 5L95C 5CHFA 1G6JA 2BF8B 2JY6A 1XD3B 3ZUNA 1V49A 4KX6B 3GB1A 2WU2B 2NCNA 1STEA 3IBEA 3KYDD 4IOIE 1E8WA 4EE2A 1OEYA 4NAWB 4RF0A 2BYTA 2GRIA 2ZNVC 3ZQ4A 4GDKA 3ZDMC 4C7ZA 2BWFA 3O13A 1YIWA 3H9DA 3R7QA 4MM3A 1GNUA 5IN7A 1SF0A 3AEGB 1SGHA 2LZ6A 3DBHB 1K52A 4GU2A 2ZVNA 4REZA 4QAYA 3WAMA 3ZVVA 1FMAD 2KK8A 4D2KA 2QMTA 4L1BA 2L1AA 1KF6B 1IUEA 1UNSA 1KLVA 4DDID 3V3XA 4RGOS 4PK1A 3NZUA 2WXIA 2ZCCA 3PSEB 3ETRA 2AQ2B 1EWCA 2IDYA 2KN5A 4XE0A 4HDOA 4PT5A 1SEBD 1V81A 4JWUC 1UWXA 2L7RA 1WJNA 1TIFA 1WXVA 3ZRCA 2LRUA 4M8MA 2JVCA 3CMMB 1F2RI 1PUTA 2KTRA 3P2BA 3V05A 1JWSD 1FRDA 2OJRA 3U30A 3HIZA 2DWQA 2QILA 4ZYSA 4HJGE 2GBRA 2D3AA 4IG7B 1E0ZA 2DBYA 4G50A 1YQ3B 4A3OA 1MG4A 3P42A 1TS3A 1WGYA 3U8ZA 5DPRA 2KXJA 2IO2B 2WXJA 3EGRA 4USAA 4IDIA 1LQBA 2J0KA 1P0RA 2PEAA 4LJPB 1P9DU 3EA6A 1V1OA 1ZW7A 2NBUA 3AE4B 3U52E 1IPGA 4M00A 1AYFA 2FCMA 2MX2A 3B1LX 5BYRA 1ZGUB 2JPHA 1YQBA 3L13A 4MEMA 4BOZB 4K3CA 3AE2B 2A5UA 3KVFB 1A5RA 4HRSA 2D3GA 2WXNA 3RPFC 3I57A 3R2TA 2QJLA 2OOBB 4BBNF 4EEWA 2GOWA 3AEBB 2WX0A 4EKUA 3HUIA 3MJWA 3N32A 4HXDA 3GE3C 4BBNC 3D32A 1WJUA 2GBMA 2DZIA 3GP7A 3B0AA 1UBIA 2K39A 2YVCA 1GOZA 5EDSA 1L5PA 3RNAC 1YJIA 1WXAA 2J52A 2EELA 2MEKA 2K6DB 2Y5CA 2CKHB 2KT7A 4KKIA 4C80A 1MI0A 4NAWA 4OVVA 2C7HA 3AH7A 1GG3A 1WY8A 4K1RB 2JYEA 4BOSC 4P16A 2INNE 1V86A 3QCAA 2JWZA 3WAOA 2JXTA 2YLMA 1WZ3A 1UGMA 1F0ZA 1QOBA 1WGHA 3NZ3A 3U4EG 2KYWA 1I4PA 1TS4A 1K8RB 4P1BC 1TGZB 3KWVA 2C7MB 1MFWA 4B0EA 1BMLC 2FCSA 1XQQA 4MT5A 3PGEA 3W9CB 2C60A 4ACFA 2VH2A 5C1ZA 2NPTA 1LXDA 3AMZA 1P1AA 3NVVA 1L4ZB 1WMHA 3WIMA 1QKZA 4HEA1 2N9EB 4RCOA 3L10B 4LDTB 4LNIA 3NVZA 3KLSX 4PYZA 4FA6A 1TY2A 2WWZA 2CHXA 2L76A 1NENB 1L0XB 3OAWA 2N9LA 3ENEA 2D2QA 1P7FA 3QX1A 2LGIA 1RFAA 4ZHOA 4G11A 3L54A 1WGKA 2LJIA 4RH6A 4MGYE 1LFDA 2W3RA 2IO3B 3TCAA 3VUXA 4XX5A 2UU7A 2AX5A 1IP9A 1N5WA 4K3BA 4KGSA 1QOFA 5G5GA 1DOIA 1GB4A 2IO0B 4FN2A 4GIVA 4KGRA 3NG0A 4AJWA 3U7DA 2NMQA 4K81A 2VZKD 1J7CA 4R3DA 2ZVOA 3NJTA 3HVZA 1V8CA 1ET9A 1X1MA 1I4XA 2DHZA 1HQRD 2RDGA 3ZIMA 3GE8C 3L4PA 3W1SC 3ZNGC 2CU1A 4FBJB 1RYJA 2IY0B 2M19A 2HTHA 2E3TA 4WJNA 5JHBA 4G3XB 4IWQA 4XZ4A 2WX1A 1CMXB 1SBBB 3IXSA 2MJDA 4DDGD 3ECIA 2K8BA 4TKNA 1AW7A 3VH4B 3ZRFA 4IM2A 4KDIC 1XF5L 1UH6A 3BYTB 1E10A 1WRIA 2BWES 2Y3AA 1UBQA 3VR8B 1VD2A 3W5VB 2FUHB 3LJ3A 2AWTA 2WXQA 3SD5A 5FK9C 1T6BX 1I4RA 3GOEA 2BKRB 4S17A 4WWPA 1NDDA 1UELA 3AULA 1KJTA 1PYWD 3PT2B 2KMMA 2K6QA 2IZVB 4Q2JA 4RGTA 3ZJUA 1YN4A 2WXKA 3BY4B 1NBFC 2DZMA 2FNJB 1R4NB 2L0FA 2LVOA 2C5LC 3J9CA 4S0RA 3GZNB 4NZLB 2LGSA 3X23A 1SE9A 1JWMD 4ZDVA 2ICIA 4EZLA 4GLSC 2WHIA 3A4RA 1YJ1A 2LXAA 2TSSA 3AV8A 3AEEB 4PS8A 3PLVA 3WAPA 1PGBA 2C7NB 1GC6A 1XLQA 4M0WA 5E6JA 1YN5A 2EKEC 2HTME 1E6EB 3AE3B 4YWGG 4EUTA 4KIKA 4I6PA 3RNEC 3I3TB 4URKA 4PS3A 3X0WA 2KC2A 3R3MA 5LXIB 2LEKA 4GDKB 2XNAC 1N60A 2R61A 4PYUA 2D3BA 3DBRI 1XO3A 2I1KA 1YN3A 1J7AA 3B2FA 5BYSA 4US8A 1RRBA 3WALA 2C9WB 1FNWA 2W54A 4YT0B 2ON8A 3AE8B 5BO4B 4AJYB 3DHHC 3AEFB 4A6QA 1HXYD 2UWQA 4LJOB 4W9KA 5LXHA 5T8IA 3Q8BA 2KVZA 2V3SA 4MH0E 4C4VA 4DHZE 2W3SA 2IGDA 1V97A 2O6VD 4CQNA 2WXOA 2WGSA 2V4LA 2L3ZA 4YTPB 2V3PA 4NQLB 2EKIA 4RF1A 1V5OA 2A4ZA 2LUEA 4W9IA 1E8YA 2K0PA 5IKCM 4WWMA 1I42A 2J53A 1FCLA 2L32A 2OJWA 4JWSC 1Z5SB 2HE7A 2AYOB 2XEWA 5CHVC 4JPSA 3PV1A 3KYCD 2HJ1A 2Y5BB 3Q3FA 3SU8X 4W9GA 5H92C 3N1ZC 1GPXA 5JHAA 3RNFC 1VZ7A 2DENB 5JH5C 3P4PB 3AU5A 2AL3A 2MP2A 1IGDA 2BYFA 1L0YB 2K1FA 2RPVA 4WQMA 2ZPYA 1ZXIA 4WAFA 5D2MB 3HRDD 4BZAA 3EC8A 2WXFA 3TEYA 3ZKJC 5EE0A 3MFGA 2J0MA 2M0AA 1C4AA 1UD7A 1WF9A 1OTRB 1AN8A 5L83A 1OQRA 2WNMA 3BYYB 4NJ6A 1Q0WB 3KH0A 2ASQA 4P6VF 5D94A 1CK1A 1WE6A 3DWMA 1C1YB 4XDCA 4WWNA 1XCQL 1YMHE 2Z59B 4P7IA 4HVBA 2O6VA 3APFA 1XCTL 1GUAB 4N58A 2D5GA 2MWSB 2KKCA 3BWUD 1JWUD 4CYEA 1RLFA 4MSMB 3HM6X 1L4DB 3DVNV 3A1QB 2L8JA 3RT3B 1BXTA 3N3KB 3DBLI 4BKSA 1WRDB 1S3SG 2WXPA 2Z0DB 5G55A 1L6UA 4DQOC 3OG5A 2NTTA 2KO3A 3FKYA 1UWMA 2KWDA 2INDC 2B3AA 4K7UA 5GMVA 4FULA 3RZWC 1EF5A 4OZAA 3PO0A 2NBVB 1FM0D 2MA9B 3ZJTA 2W55A 4MACA 1YOVB 1AARA 5HHDG 5BMHA 2INPE 2ZCBA 4MGZE 2WDQB 2NPTB 2L00B 4W9HA 2KDIA 1WM2A 1WMHB 3MC8A 3IT6B 1L2NA 1SJHD 1R4NI 2L0TA 2LXCA 1MJDA 1YX5B 1MHXA 4WURA 2GMIC 2K22A 5MPOA 2GI9A 1C4CA 3RYTA 2KNBA 2WU5B 1F1HA 3DVGY 3Q8CA 1R7SA 1JW9D 2CS4A 1E8XA 2V4IB 2JWUA 1ACCA 2CHWA 4HK2A 1ZDVA 2KWUB 2RR9A 3VFKA 4WJPA 2D10A 1IYFA 4E74A 1QQRA 3P1MA 4N6EB 3TIXA 1F52A 4KDLB 3N1XC 1EU4A 2O2VB 1PQSA 2K5PA 2JT4B 2MBQA 2DYOA 2J4XA 3DBSA 5E6PA 2RDHA 2G3QB 3C0RB 2ZZPB 3MC0B 1M94A 4JLCA 1DGJA 1YX6B 1ESFA 3DWGC 2MBOA 4YSZB 2ONQA 2RMMA 4ZRJA 3CSTA 1FNVA 2MCNB 2QHOA 1E7VA 4RNAA 1EM7A 2QEJC 4EOYA 1S1QB 4ZRKA 4ANVA 1HA5A 2FIFA 2Z8LA 1WJ6A 1NEKB 4NPNA 5LLIA 3EFCA 5IOIA 2N4FA 3W5UB 4BKTA 4MDKE 4C00A 1FRRA 2MBHA 3VXWA 5D3IB 1WJ4A 2YEPB 4I6NB 1DYQA 2D3CA 3VUWA 3ZLZA 3HVDA 5EE9A 2LJ5A 2IO1B 2ZW1A 4L2YA 1WX9A 2KJ6A 3I9V1 3AEAB 1WYGA 3A1QA 5KHQA 4MGKE 4ARIA 5C23A 4B9KA 2MRPA 4KKJA 4GOCA 2B76B 5E6OA 1SXTA 4DHJD 2AEHA 1TYGB 4W9JA 2GBJA 5J17A 1VZ8A 2LWPA 1XEEA 5D7GA 4RGNA 3HM3A 2G45B 3H7SA 3ZXRA 2KDEB 1VRAB 2CJNA 1N62A 3KUZA 4HPLB 4RM8A 4YXDB 3WA0A 2BS2B 1E5WA 5DCNA 2KC1A 2M8SA 4ZRPA 1HEZE 1KLGD 3NUHB 2IGHA 3LYYA 2KFKA 4M0WB 1WXQA 2ZJDA 1JWAD 2PE9A 3K9OB 4FADA 4KIKB 3QIJA 4GB9A 2M0XA 2LGXA 4GSWA 4ANUA 2JZ3B 3OJ4B 1TY0A 1WYWB 4OHJA 2M56B 3TUOA 3H6NA 4EZKA 5LNK1 1NI3A 4IWPA 3DOWA 4FLHA 2KVRA 3EFUA 5G2NA 1V1PA 1WXMA 2LMCA 1WE7A 1MPEA 2GB1A 4K7SA 2LGYA 4BAXA 3BVZA 2KAJA 2LI5A 4TQ0A 2IY1B 1QZEA 4YSYB 2NR2A 2O2VA 5IP4D 3QC8B 1WR1A 4JE3B 4ICUA 4C4VB 2I38A 1H4RA 2AL6A 3VRBB 1KH0A 3NOBA 3VAWA 4IUMB 3DBHI 3HK0A 5D6JB 3RNBC 1TKYA 4NAMA 5AZFA 1QT9A 2KFJA 2XBBC 4BVUC 5DPTA 1B1ZA 4WIPA 4ARCA 3PZ8A 5GXGB 1U4AA 3SR6A 1EF1A 2KQ4X 1CZPA 4L23A 2BGFA 3ZYYX 2DYMA 1L6VA 4XC2A 5CHWA 3KUCB 1WR6E 1FFVA 2Z0EB 3C19A 2CJOA 2M4NA 2W9NA 3AB5A 2MP2B 2DAFA 3ZTDA 3R8BA 2VRRB 4UDUC 3EUB2 4YTNB 3UI3A 3NRZA 3T3NA 1PDXA 3AN1A 2V3NA 1PGXA 1T0YA 1HZ6A 1PGAA 1ZPSA 3VUYA 3OLMD 4MELA 3P63A 3VR9B 2D07B 2I1JA 4DHZB 1UZXB 4PS7A 3AXCA 3Q3MC 2DYBA 1ROEA 1GJZA 2BKFA 1Q10A 3A9JA 3T3OA 4KZCA 3JW0X 3QAQA 2J0JA 3ZW3A 1N5XA 3PHXB 4F7ZA 4AS1A 4FHJA 2N7EA 2ZEQA 3CIRB 2Y5PA 2FAZA 3GS2A 1NYRA 2SAKA 4K7WA 2WXRA 2O6VB 4B95A 1C76A 4OVZA 2K9XA 1K53A 4DXGA 3AE1B 3L17A 1P3QU 4RM9A 3L0WB 2MW5A 3PZDA 4AOFA 2KHWB 2JZZA 1C3TA 4EZJA 3VTWA 5JZEB 1N61A 3CF6E 3A4SC 2DAJA 1VCBA 2NTSA 2K25A 3PRPB 1J8CA 3B08A 5C2TB 2MJEA 3NZSA 3VTUA 1FD6A 1SE3A 1WZ0A 2MQJA 1ET6A 1R4MB 2WDTB 1WXSA 1QOAA 2N9PC 2ZW0A 2KJHB 3U2SC 4FJZA 3DHGC 4W9CA 2LGDA 4IW0A 2KLCA 5I4DA 3SFEB 1WFYA 1JWBD 1BT0A 2LHDA 3UINB 2IJ0A 3N20C 2L83A 4IC7B 3PS6A 1GAQB 1KOTA 3ZNZB 2R2OA 3DDCB 4XDDA 3FC4A 1VJKA 1XLPA 4E3CA 3VDZA 4N59A 4A8XC 4WWOA 1TKEA 1WX7A 2MJ3A 1HE8A 2AQ1B 4ANWA 4DBGA 1SE2A 3RN9C 1T5XD 4W9LA 3HHMA 3MHSD 1QOGA 2LFIA 1D6EC 1NYQA 2NS5A 2QSDA 3BINA 3N9YC 2PPHA 2RGFA 1MHHE 5H8YE 4TV3A 4GDLB 3NY5A 5AUKA 4J3OD 2MHJA 3E56A 1E9MA 4YL8A 3RZFA 1KTKA 2FCQA 3A9KA 3NS8A 1MVKA 2OEDA 1I4GA 2PIAA 4NJ7A 4LNOA 4HCPB 1KRHA 1E90A 1F9JA 3DVNU 3W1YA 2DZKA 2GLSA 3IAS1 4G0NB 3AE9B 1E8ZA 1ZUD2 1FXIA 2BB5A 4NQKE 1TJEA 1QILA 1ZOYB 1SE4A 3RI7C 2JSVX 4XGAB 3ZXVA 2REXA 3RFZB 1D4BA 2FIDA 3QK0A 2K8CA 1LGRA 2MBEA 5IO9A
chains in the Genus database with same CATH topology
3DBSA 5E6NA 5E6PA 2M17A 2IO3B 3TCAA 3V60A 2G3QB 3C0RB 3RD2A 3VUXA 4AWJA 2ZZPB 3RUIB 4KVGB 4XX5A 2N1WA 1M94A 3M3JA 4JLCA 1IP9A 1YX6B 2M1MA 2WYQA 3O65B 4NY0A 2MBOA 4ZRJA 4JGHB 4MJSA 4CO7A 3M95A 1Q5WB 3CSTA 2V1YA 2KTFA 1GC7A 3DPDA 2MCNB 2QHOA 1E7VA 1LM8B 2IO0B 3ZNHB 4FN2A 2MBBB 4GIVA 4EOYA 1S1QB 4AP4C 2RSUA 4AJWA 4ZRKA 3U7DA 4ANVA 4K81A 4TQ1A 2FIFA 1RAXA 1WJ6A 2ZPNA 4NPNA 2HD5B 5LLIA 2N4FA 3MTNB 4BKTA 5IA7A 4MDKE 2MBHA 2NVUI 2ZVOA 3L08A 4WQOB 3VXWA 1WJ4A 4I6NB 1X1MA 3PVLA 2DHZA 3Q3JA 3ZIMA 3VUWA 3UQBA 3M63B 3ZLZA 4KZ0A 3EHVA 2LJ5A 3LDZE 3W1SC 3ZNGC 2CU1A 2IO1B 1JRUA 4FBJB 3T9LA 4N9F4 1OGWA 2IY0B 2HTHA 3UQAA 1WX9A 2KJ6A 2KJRA 4MGIE 3A1QA 4OVUA 4WJNA 4HLEA 5JHBA 2ZNVB 4G3XB 5KHQA 4IWQA 4XZ4A 2MSED 4MGKE 4BFRA 3PRZA 1TTNA 2WX1A 1Y8RC 1WIAA 2FCNA 5C23A 2KANA 1CMXB 3SHQA 3V61A 4B9KA 2MRPA 4HPMB 4X57B 3T8MA 4DK5A 4DDGD 3ECIA 1V6EA 4GOCA 2K8BA 2KWVB 3PRMB 4BKGA 3TJPA 2KLGA 4TKNA 5E6OA 2CHZA 3QA8A 4M8NA 2XK5A 3DCGA 3H1UA 3NHEB 3VH3B 3VH4B 3ZRFA 4IM2A 4KDIC 4W9DA 3PHWB 4DHJD 1UH6A 3R66C 5IAAC 2BWES 1UBQA 5AZHA 2AEHA 1VD2A 2KTRB 4GGQA 4W9JA 2GBJA 2FUHB 4FJVB 2KFKB 5J17A 2LWPA 3LJ3A 5D7GA 3HM3A 2G45B 2AWTA 3H7SA 2DX5B 2EMTA 3GZNI 3SD5A 2KDEB 4BKSD 2LVPA 3GOEA 1J0GA 2BKRB 3KUZA 2K8HA 4HPLB 4RM8A 4WWPA 5DPWA 1NDDA 5HKHA 1UELA 3AULA 4JL9A 3WA0A 4IM0A 1E5WA 2G4DB 2KC1A 1KJTA 4FJYA 5DCNA 2M8SA 3PT2B 3QARA 2KD0A 3VQIA 2K6QA 2IZVB 3IFWB 1WM3A 2KMAA 2KFKA 4GMVA 4M0WB 3BY4B 2CR5A 1NBFC 2DZMA 2FNJB 3QWZB 4GDLA 3V6EB 2ZJDA 1EO6A 2L0FA 1NI2A 1TBEA 2LVOA 2C5LC 1WI0A 2PE9A 3QHTA 3K9OB 2BYEA 3H7PA 4LCDE 4FADA 4ICVA 1L7YA 4KIKB 3X23A 1SE9A 3QIJA 4ZDVA 1I35A 3EECA 4EZLA 5KHOA 4GB9A 2KX3A 2M0XA 2LGXA 4GSWA 4ANUA 1OQYA 2JZ3B 2KWCA 3A4RA 1YJ1A 2KDBA 1WYWB 2LXAA 3OJ4B 4II3B 4PS8A 3QQ8B 3CSFA 3PLVA 3WAPA 3H6NA 2LRWA 4EZKA 2C7NB 1GC6A 4IWPA 3DOWA 3JVZX 4FLHA 3UGBB 1YD8U 2PE6B 2EKEC 2KVRA 3ML9A 4HCNB 3PTFC 3EFUA 5G2NA 3JYUA 4EUTA 3PLUA 4KIKA 4I6PA 1WXMA 3A33B 1WE7A 1WH3A 3I3TB 4URKA 4JIOU 1R4MI 2JF5A 4PS3A 3X0WA 2J7QB 2KC2A 3R3MA 2KOXA 2LGYA 4K7SA 4WJOA 4ASWC 5LXIB 2LI5A 4TQ0A 2IY1B 2PJHA 4DHJB 3JSVA 4GDKB 1QZEA 2NR2A 2O2VA 3QC8B 3VVWB 4IM3A 5L95C 5CHFA 1WR1A 4F8CB 1G6JA 4ICUA 4PYUA 4CHKA 1Z2MA 2BF8B 2JY6A 3DBRI 2I1KA 1H4RA 1XD3B 2AL6A 4J6IA 1MG8A 3ZUNA 1V49A 4KV2A 1RRBA 3NOBA 3VAWA 4IUMB 2NCNA 2DZJA 3DBHI 3WALA 3HK0A 2C9WB 5D6JB 3IBEA 3KYDD 5TR5A 5BO4B 4AJYB 1E8WA 1OEYA 4NAWB 3M62B 1V9JA 2UWQA 5AZFA 4LJOB 2ZNVC 2KFJA 4W9KA 4GDKA 1WGGA 3ZDMC 3ZTCA 5LXHA 1D3ZA 2BWFA 4I6LB 1V2YA 4II2B 1YIWA 5AEKB 2XBBC 2V3SA 4BVUC 3H9DA 4MH0E 5DPTA 3R7QA 4DHZE 4KSLC 4MM3A 1U4AA 1GNUA 3PREA 1H8CA 2O6VD 1EF1A 1SGHA 2LZ6A 3K9PB 1ZKHA 4GU2A 2V4LA 2BGFA 2L3ZA 2ZVNA 3WAMA 2UYZB 3ZDTA 3ZVVA 2KK8A 4NQLB 2DYMA 4XC2A 2LVQA 3KUCB 5CHWA 1V5OA 1WR6E 2A4ZA 2LUEA 1E8YA 2Z0EB 4W9IA 2L05A 2M4NA 3VTVA 1I42A 4TUUA 2W9NA 1KLVA 2N7DA 4DDID 3TBLD 1Z5SB 2MP2B 2HE7A 2AYOB 1EUVB 2DAFA 2XEWA 3NZUA 5CHVC 2ZCCA 3PV1A 3PSEB 4KSKC 3ZTDA 2VRRB 3A9JB 3KYCD 2Y5BB 3Q3FA 3SU8X 4A20A 2KN5A 4W9GA 1XT9B 1V5TA 4HDOA 3VHTC 3UIOB 2RPQA 1T0YA 1V81A 1ISNA 5JHAA 3VUYA 2BPSA 3PPAA 3OLMD 1WGDA 2GBKA 2L7RA 1WJNA 4MELA 3N30A 2DENB 1WXVA 3ZRCA 2KQ7A 2LRUA 2D07B 2RD0A 2I1JA 4M8MA 2JVCA 1UZXB 2AL3A 3AU5A 3CMMB 2MP2A 3AXCA 4PS7A 3ZNID 3P2BA 2DYBA 2KTRA 1GJZA 2BKFA 2BYFA 3A9JA 4GXBA 2OJRA 5J18A 3U30A 2K1FA 3HIZA 4KZCA 2R2QA 2ZPYA 3JW0X 3QAQA 2J0JA 1FXTB 2GBRA 5D2MB 3ZW3A 1J19A 3EC8A 4IG7B 3PHXB 4HJKA 4F7ZA 4G50A 3ZO5B 3APCA 4FHJA 4A3OA 4WAAA 2N7EA 3L16A 3ZKJC 2ZEQA 1WGYA 2J0MA 3U8ZA 5DPRA 2KXJA 1UD7A 3IG3A 2IO2B 1WF9A 1OTRB 2KX0A 2FAZA 3SDLC 3V6CB 5L83A 4K7WA 2LASA 2O6VB 4B95A 1LQBA 5AZGA 2J0KA 4GN1A 1P0RA 2PEAA 4LJPB 1P9DU 2NBWB 4NJ6A 4HWIB 2G4SA 3L17A 1P3QU 1Q0WB 1ZW7A 2NBUA 3KH0A 4MJSB 1IPGA 2ASQA 4RM9A 3L0WB 2FCMA 2MX2A 2MW5A 3B1LX 3DQVA 3PZDA 1WE6A 5D94A 4AOFA 2KHWB 1C1YB 1ZGUB 2JPHA 2JZZA 1C3TA 4WWNA 4A3PA 3V62A 4EZJA 1YQBA 3VTWA 2Z59B 3L13A 3RULA 5JZEB 3CF6E 4MEMA 4BOZB 3A4SC 2DAJA 4P7IA 3TMPB 4HVBA 2A5UA 2O6VA 1VCBA 3KVFB 2IBIB 2K25A 1A5RA 3PRPB 1J8CA 3APFA 3B08A 2D3GA 3UIPB 1GUAB 3WANA 5JH5C 2OOBB 4BBNF 4EEWA 2MWSB 2GOWA 2KKCA 2WX0A 3KW5B 3QJZA 4EKUA 3NZSA 3VTUA 2HJ8A 3MJWA 4CYEA 1WZ0A 2MQJA 4B6WA 2JXXA 2WDTB 3N32A 4HXDA 1WXSA 1RLFA 4MSMB 2N9PC 3HM6X 4BBNC 2KJHB 3D32A 4E71A 1WJUA 4FJZA 2GBMA 2DZIA 4W9CA 2LGDA 3DVNV 2JUOA 4IW0A 3A1QB 2KLCA 3B0AA 2L8JA 3RT3B 1WFYA 1UBIA 1BT0A 3N3KB 4LDTD 2K39A 3UF8A 2YVCA 3UINB 3DBLI 3KUDB 5EDSA 3RCZA 1WRDB 1S3SG 2EMSA 4W9EA 4ZYNA 2Z0DB 1WXAA 5G55A 4BKSA 4IC7B 5CX3A 1V80A 2K6DB 4MSQB 2CKHB 3PS6A 4AUQC 4NAWA 2KO3A 2LD9A 3ZNZB 3ALBA 5DPSA 1KOTA 2XK5B 2R2OA 3DVGX 3DDCB 2B3AA 4K7UA 5GMVA 4FULA 4E3CA 4OVVA 5J2RA 4ZRIA 2C7HA 3VDZA 3RZWC 1EF5A 1GG3A 2KZRA 2NBVB 4WWOA 3IVFA 1WY8A 4K1RB 4BOSC 1WX7A 2MA9B 4F1SA 1OEYJ 3AU4A 1V86A 3QCAA 2JWZA 3WAOA 4NNJB 1HE8A 1AARA 2GBNA 2YLMA 4ANWA 4DBGA 1WZ3A 4W9FA 2MLBA 3OJ3A 4FHKA 4W9LA 2IYDB 3HHMA 3A9KB 1UGMA 1WGRA 2N1VA 2KQSA 1WX8A 3MHSD 2ZCBA 4MGZE 1WGHA 2NS5A 1Q1OA 2NPTB 2L00B 4W9HA 2KDIA 3BINA 1WM2A 2N9XA 2PPHA 1WMHB 2KDFB 1K8RB 2RGFA 4IWOA 1L2NA 1SIFA 1TGZB 4TV3A 1R4NI 4GDLB 3W1SA 4RMAA 3NY5A 2L0TA 2LXCA 1YX5B 1P98A 2C7MB 4YL8A 3IHPC 3TL5A 4DXAB 2GMIC 3H7PB 3RZFA 5CTRC 2FCSA 1XQQA 5FR6A 3PGEA 2FCQA 3RYTA 3A9KA 1KM7A 2KNBA 3NS8A 4DWFA 2C60A 3DVGY 4EFOA 4NJ7A 5C1ZA 4HDQA 3APDA 4HCPB 2NPTA 1E90A 1LXDA 4WJQA 1F9JA 1P1AA 1WMHA 2CS4A 1E8XA 3WIMA 3DVNU 3W1YA 2N9EB 2DZKA 2CHWA 4G0NB 3L10B 4LDTB 3ML8A 4HK2A 4JQWC 2KWUB 2KMCA 1E8ZA 4PYZA 2D11A 4FA6A 2WWZA 4NQKE 2RR9A 1TZ1A 2CHXA 2L76A 4WJPA 3VFKA 2JRHA 2D10A 1IYFA 4E74A 3OAWA 2JRIB 4ANXA 3S2AA 2REXA 3ENEA 2D2QA 3TIXA 2BYVE 3JSVB 4KDLB 3QX1A 2O2VB 2FIDA 1RFAA 4DHZB 3QK0A 2K8CA 4G11A 1PQSA 3L54A 2JT4B 3ONSA 2MBEA 4MGYE 2MBQA 3R7RA 1E7UA 2DYOA 1LFDA 3AI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBS A;  5E6N A;  5E6P A;  2M17 A;  2IO3 B;  3TCA A;  3V60 A;  2G3Q B;  3C0R B;  3RD2 A;  3VUX A;  4AWJ A;  2ZZP B;  3RUI B;  4KVG B;  4XX5 A;  2N1W A;  1M94 A;  3M3J A;  4JLC A;  1IP9 A;  1YX6 B;  2M1M A;  2WYQ A;  3O65 B;  4NY0 A;  2MBO A;  4ZRJ A;  4JGH B;  4MJS A;  4CO7 A;  3M95 A;  1Q5W B;  3CST A;  2V1Y A;  2KTF A;  1GC7 A;  3DPD A;  2MCN B;  2QHO A;  1E7V A;  1LM8 B;  2IO0 B;  3ZNH B;  4FN2 A;  2MBB B;  4GIV A;  4EOY A;  1S1Q B;  4AP4 C;  2RSU A;  4AJW A;  4ZRK A;  3U7D A;  4ANV A;  4K81 A;  4TQ1 A;  2FIF A;  1RAX A;  1WJ6 A;  2ZPN A;  4NPN A;  2HD5 B;  5LLI A;  2N4F A;  3MTN B;  4BKT A;  5IA7 A;  4MDK E;  2MBH A;  2NVU I;  2ZVO A;  3L08 A;  4WQO B;  3VXW A;  1WJ4 A;  4I6N B;  1X1M A;  3PVL A;  2DHZ A;  3Q3J A;  3ZIM A;  3VUW A;  3UQB A;  3M63 B;  3ZLZ A;  4KZ0 A;  3EHV A;  2LJ5 A;  3LDZ E;  3W1S C;  3ZNG C;  2CU1 A;  2IO1 B;  1JRU A;  4FBJ B;  3T9L A;  4N9F 4;  1OGW A;  2IY0 B;  2HTH A;  3UQA A;  1WX9 A;  2KJ6 A;  2KJR A;  4MGI E;  3A1Q A;  4OVU A;  4WJN A;  4HLE A;  5JHB A;  2ZNV B;  4G3X B;  5KHQ A;  4IWQ A;  4XZ4 A;  2MSE D;  4MGK E;  4BFR A;  3PRZ A;  1TTN A;  2WX1 A;  1Y8R C;  1WIA A;  2FCN A;  5C23 A;  2KAN A;  1CMX B;  3SHQ A;  3V61 A;  4B9K A;  2MRP A;  4HPM B;  4X57 B;  3T8M A;  4DK5 A;  4DDG D;  3ECI A;  1V6E A;  4GOC A;  2K8B A;  2KWV B;  3PRM B;  4BKG A;  3TJP A;  2KLG A;  4TKN A;  5E6O A;  2CHZ A;  3QA8 A;  4M8N A;  2XK5 A;  3DCG A;  3H1U A;  3NHE B;  3VH3 B;  3VH4 B;  3ZRF A;  4IM2 A;  4KDI C;  4W9D A;  3PHW B;  4DHJ D;  1UH6 A;  3R66 C;  5IAA C;  2BWE S;  1UBQ A;  5AZH A;  2AEH A;  1VD2 A;  2KTR B;  4GGQ A;  4W9J A;  2GBJ A;  2FUH B;  4FJV B;  2KFK B;  5J17 A;  2LWP A;  3LJ3 A;  5D7G A;  3HM3 A;  2G45 B;  2AWT A;  3H7S A;  2DX5 B;  2EMT A;  3GZN I;  3SD5 A;  2KDE B;  4BKS D;  2LVP A;  3GOE A;  1J0G A;  2BKR B;  3KUZ A;  2K8H A;  4HPL B;  4RM8 A;  4WWP A;  5DPW A;  1NDD A;  5HKH A;  1UEL A;  3AUL A;  4JL9 A;  3WA0 A;  4IM0 A;  1E5W A;  2G4D B;  2KC1 A;  1KJT A;  4FJY A;  5DCN A;  2M8S A;  3PT2 B;  3QAR A;  2KD0 A;  3VQI A;  2K6Q A;  2IZV B;  3IFW B;  1WM3 A;  2KMA A;  2KFK A;  4GMV A;  4M0W B;  3BY4 B;  2CR5 A;  1NBF C;  2DZM A;  2FNJ B;  3QWZ B;  4GDL A;  3V6E B;  2ZJD A;  1EO6 A;  2L0F A;  1NI2 A;  1TBE A;  2LVO A;  2C5L C;  1WI0 A;  2PE9 A;  3QHT A;  3K9O B;  2BYE A;  3H7P A;  4LCD E;  4FAD A;  4ICV A;  1L7Y A;  4KIK B;  3X23 A;  1SE9 A;  3QIJ A;  4ZDV A;  1I35 A;  3EEC A;  4EZL A;  5KHO A;  4GB9 A;  2KX3 A;  2M0X A;  2LGX A;  4GSW A;  4ANU A;  1OQY A;  2JZ3 B;  2KWC A;  3A4R A;  1YJ1 A;  2KDB A;  1WYW B;  2LXA A;  3OJ4 B;  4II3 B;  4PS8 A;  3QQ8 B;  3CSF A;  3PLV A;  3WAP A;  3H6N A;  2LRW A;  4EZK A;  2C7N B;  1GC6 A;  4IWP A;  3DOW A;  3JVZ X;  4FLH A;  3UGB B;  1YD8 U;  2PE6 B;  2EKE C;  2KVR A;  3ML9 A;  4HCN B;  3PTF C;  3EFU A;  5G2N A;  3JYU A;  4EUT A;  3PLU A;  4KIK A;  4I6P A;  1WXM A;  3A33 B;  1WE7 A;  1WH3 A;  3I3T B;  4URK A;  4JIO U;  1R4M I;  2JF5 A;  4PS3 A;  3X0W A;  2J7Q B;  2KC2 A;  3R3M A;  2KOX A;  2LGY A;  4K7S A;  4WJO A;  4ASW C;  5LXI B;  2LI5 A;  4TQ0 A;  2IY1 B;  2PJH A;  4DHJ B;  3JSV A;  4GDK B;  1QZE A;  2NR2 A;  2O2V A;  3QC8 B;  3VVW B;  4IM3 A;  5L95 C;  5CHF A;  1WR1 A;  4F8C B;  1G6J A;  4ICU A;  4PYU A;  4CHK A;  1Z2M A;  2BF8 B;  2JY6 A;  3DBR I;  2I1K A;  1H4R A;  1XD3 B;  2AL6 A;  4J6I A;  1MG8 A;  3ZUN A;  1V49 A;  4KV2 A;  1RRB A;  3NOB A;  3VAW A;  4IUM B;  2NCN A;  2DZJ A;  3DBH I;  3WAL A;  3HK0 A;  2C9W B;  5D6J B;  3IBE A;  3KYD D;  5TR5 A;  5BO4 B;  4AJY B;  1E8W A;  1OEY A;  4NAW B;  3M62 B;  1V9J A;  2UWQ A;  5AZF A;  4LJO B;  2ZNV C;  2KFJ A;  4W9K A;  4GDK A;  1WGG A;  3ZDM C;  3ZTC A;  5LXH A;  1D3Z A;  2BWF A;  4I6L B;  1V2Y A;  4II2 B;  1YIW A;  5AEK B;  2XBB C;  2V3S A;  4BVU C;  3H9D A;  4MH0 E;  5DPT A;  3R7Q A;  4DHZ E;  4KSL C;  4MM3 A;  1U4A A;  1GNU A;  3PRE A;  1H8C A;  2O6V D;  1EF1 A;  1SGH A;  2LZ6 A;  3K9P B;  1ZKH A;  4GU2 A;  2V4L A;  2BGF A;  2L3Z A;  2ZVN A;  3WAM A;  2UYZ B;  3ZDT A;  3ZVV A;  2KK8 A;  4NQL B;  2DYM A;  4XC2 A;  2LVQ A;  3KUC B;  5CHW A;  1V5O A;  1WR6 E;  2A4Z A;  2LUE A;  1E8Y A;  2Z0E B;  4W9I A;  2L05 A;  2M4N A;  3VTV A;  1I42 A;  4TUU A;  2W9N A;  1KLV A;  2N7D A;  4DDI D;  3TBL D;  1Z5S B;  2MP2 B;  2HE7 A;  2AYO B;  1EUV B;  2DAF A;  2XEW A;  3NZU A;  5CHV C;  2ZCC A;  3PV1 A;  3PSE B;  4KSK C;  3ZTD A;  2VRR B;  3A9J B;  3KYC D;  2Y5B B;  3Q3F A;  3SU8 X;  4A20 A;  2KN5 A;  4W9G A;  1XT9 B;  1V5T A;  4HDO A;  3VHT C;  3UIO B;  2RPQ A;  1T0Y A;  1V81 A;  1ISN A;  5JHA A;  3VUY A;  2BPS A;  3PPA A;  3OLM D;  1WGD A;  2GBK A;  2L7R A;  1WJN A;  4MEL A;  3N30 A;  2DEN B;  1WXV A;  3ZRC A;  2KQ7 A;  2LRU A;  2D07 B;  2RD0 A;  2I1J A;  4M8M A;  2JVC A;  1UZX B;  2AL3 A;  3AU5 A;  3CMM B;  2MP2 A;  3AXC A;  4PS7 A;  3ZNI D;  3P2B A;  2DYB A;  2KTR A;  1GJZ A;  2BKF A;  2BYF A;  3A9J A;  4GXB A;  2OJR A;  5J18 A;  3U30 A;  2K1F A;  3HIZ A;  4KZC A;  2R2Q A;  2ZPY A;  3JW0 X;  3QAQ A;  2J0J A;  1FXT B;  2GBR A;  5D2M B;  3ZW3 A;  1J19 A;  3EC8 A;  4IG7 B;  3PHX B;  4HJK A;  4F7Z A;  4G50 A;  3ZO5 B;  3APC A;  4FHJ A;  4A3O A;  4WAA A;  2N7E A;  3L16 A;  3ZKJ C;  2ZEQ A;  1WGY A;  2J0M A;  3U8Z A;  5DPR A;  2KXJ A;  1UD7 A;  3IG3 A;  2IO2 B;  1WF9 A;  1OTR B;  2KX0 A;  2FAZ A;  3SDL C;  3V6C B;  5L83 A;  4K7W A;  2LAS A;  2O6V B;  4B95 A;  1LQB A;  5AZG A;  2J0K A;  4GN1 A;  1P0R A;  2PEA A;  4LJP B;  1P9D U;  2NBW B;  4NJ6 A;  4HWI B;  2G4S A;  3L17 A;  1P3Q U;  1Q0W B;  1ZW7 A;  2NBU A;  3KH0 A;  4MJS B;  1IPG A;  2ASQ A;  4RM9 A;  3L0W B;  2FCM A;  2MX2 A;  2MW5 A;  3B1L X;  3DQV A;  3PZD A;  1WE6 A;  5D94 A;  4AOF A;  2KHW B;  1C1Y B;  1ZGU B;  2JPH A;  2JZZ A;  1C3T A;  4WWN A;  4A3P A;  3V62 A;  4EZJ A;  1YQB A;  3VTW A;  2Z59 B;  3L13 A;  3RUL A;  5JZE B;  3CF6 E;  4MEM A;  4BOZ B;  3A4S C;  2DAJ A;  4P7I A;  3TMP B;  4HVB A;  2A5U A;  2O6V A;  1VCB A;  3KVF B;  2IBI B;  2K25 A;  1A5R A;  3PRP B;  1J8C A;  3APF A;  3B08 A;  2D3G A;  3UIP B;  1GUA B;  3WAN A;  5JH5 C;  2OOB B;  4BBN F;  4EEW A;  2MWS B;  2GOW A;  2KKC A;  2WX0 A;  3KW5 B;  3QJZ A;  4EKU A;  3NZS A;  3VTU A;  2HJ8 A;  3MJW A;  4CYE A;  1WZ0 A;  2MQJ A;  4B6W A;  2JXX A;  2WDT B;  3N32 A;  4HXD A;  1WXS A;  1RLF A;  4MSM B;  2N9P C;  3HM6 X;  4BBN C;  2KJH B;  3D32 A;  4E71 A;  1WJU A;  4FJZ A;  2GBM A;  2DZI A;  4W9C A;  2LGD A;  3DVN V;  2JUO A;  4IW0 A;  3A1Q B;  2KLC A;  3B0A A;  2L8J A;  3RT3 B;  1WFY A;  1UBI A;  1BT0 A;  3N3K B;  4LDT D;  2K39 A;  3UF8 A;  2YVC A;  3UIN B;  3DBL I;  3KUD B;  5EDS A;  3RCZ A;  1WRD B;  1S3S G;  2EMS A;  4W9E A;  4ZYN A;  2Z0D B;  1WXA A;  5G55 A;  4BKS A;  4IC7 B;  5CX3 A;  1V80 A;  2K6D B;  4MSQ B;  2CKH B;  3PS6 A;  4AUQ C;  4NAW A;  2KO3 A;  2LD9 A;  3ZNZ B;  3ALB A;  5DPS A;  1KOT A;  2XK5 B;  2R2O A;  3DVG X;  3DDC B;  2B3A A;  4K7U A;  5GMV A;  4FUL A;  4E3C A;  4OVV A;  5J2R A;  4ZRI A;  2C7H A;  3VDZ A;  3RZW C;  1EF5 A;  1GG3 A;  2KZR A;  2NBV B;  4WWO A;  3IVF A;  1WY8 A;  4K1R B;  4BOS C;  1WX7 A;  2MA9 B;  4F1S A;  1OEY J;  3AU4 A;  1V86 A;  3QCA A;  2JWZ A;  3WAO A;  4NNJ B;  1HE8 A;  1AAR A;  2GBN A;  2YLM A;  4ANW A;  4DBG A;  1WZ3 A;  4W9F A;  2MLB A;  3OJ3 A;  4FHK A;  4W9L A;  2IYD B;  3HHM A;  3A9K B;  1UGM A;  1WGR A;  2N1V A;  2KQS A;  1WX8 A;  3MHS D;  2ZCB A;  4MGZ E;  1WGH A;  2NS5 A;  1Q1O A;  2NPT B;  2L00 B;  4W9H A;  2KDI A;  3BIN A;  1WM2 A;  2N9X A;  2PPH A;  1WMH B;  2KDF B;  1K8R B;  2RGF A;  4IWO A;  1L2N A;  1SIF A;  1TGZ B;  4TV3 A;  1R4N I;  4GDL B;  3W1S A;  4RMA A;  3NY5 A;  2L0T A;  2LXC A;  1YX5 B;  1P98 A;  2C7M B;  4YL8 A;  3IHP C;  3TL5 A;  4DXA B;  2GMI C;  3H7P B;  3RZF A;  5CTR C;  2FCS A;  1XQQ A;  5FR6 A;  3PGE A;  2FCQ A;  3RYT A;  3A9K A;  1KM7 A;  2KNB A;  3NS8 A;  4DWF A;  2C60 A;  3DVG Y;  4EFO A;  4NJ7 A;  5C1Z A;  4HDQ A;  3APD A;  4HCP B;  2NPT A;  1E90 A;  1LXD A;  4WJQ A;  1F9J A;  1P1A A;  1WMH A;  2CS4 A;  1E8X A;  3WIM A;  3DVN U;  3W1Y A;  2N9E B;  2DZK A;  2CHW A;  4G0N B;  3L10 B;  4LDT B;  3ML8 A;  4HK2 A;  4JQW C;  2KWU B;  2KMC A;  1E8Z A;  4PYZ A;  2D11 A;  4FA6 A;  2WWZ A;  4NQK E;  2RR9 A;  1TZ1 A;  2CHX A;  2L76 A;  4WJP A;  3VFK A;  2JRH A;  2D10 A;  1IYF A;  4E74 A;  3OAW A;  2JRI B;  4ANX A;  3S2A A;  2REX A;  3ENE A;  2D2Q A;  3TIX A;  2BYV E;  3JSV B;  4KDL B;  3QX1 A;  2O2V B;  2FID A;  1RFA A;  4DHZ B;  3QK0 A;  2K8C A;  4G11 A;  1PQS A;  3L54 A;  2JT4 B;  3ONS A;  2MBE A;  4MGY E;  2MBQ A;  3R7R A;  1E7U A;  2DYO A;  1LFD A;  3AI5 A; 
#chains in the Genus database with same CATH topology
 4TSS A;  2M17 A;  3RD2 A;  4AWJ A;  4A9A A;  4KVG B;  3M3J A;  2WYQ A;  3Q2A C;  3O65 B;  4NY0 A;  4LNF A;  4CO7 A;  3M95 A;  2IGG A;  2V1Y A;  3AED B;  3DPD A;  4KGT A;  1FFU A;  1T3Q A;  2MBB B;  2XN9 C;  4AP4 C;  2RSU A;  3P4S B;  2CU3 A;  2X8X X;  3AE6 B;  2ZPN A;  3MTN B;  5IA7 A;  4ZOH C;  2PVO D;  2G1E A;  3Q3J A;  4KZ0 A;  4LNK A;  3LDZ E;  3RMK C;  5C3J B;  4N9F 4;  3PZ7 A;  3UQA A;  1YJJ A;  2KJR A;  1D5M C;  3BVG A;  2MSE D;  2DLB A;  4LNN A;  1I7H A;  1Y8R C;  4RFB A;  3P4R B;  3V61 A;  3SHQ A;  5BMI A;  4HPM B;  4X57 B;  3T8M A;  3ZGZ A;  3Q8A A;  4FXC A;  2KAC A;  1V6E A;  3U7Z A;  4BKG A;  2KLG A;  2CHZ A;  3QA8 A;  3VH3 B;  4W9D A;  3MJ5 A;  2KDM A;  3R66 C;  1I4Q A;  5AZH A;  4GGQ A;  4FJV B;  2KFK B;  1FCC C;  2WP9 B;  2MH7 A;  1CQV A;  2DX5 B;  3GZN I;  2PVG C;  2LVP A;  1J0G A;  2K8H A;  1UUP A;  4JL9 A;  2G4D B;  2WXH A;  1KFY B;  2QDF A;  3QAR A;  2KD0 A;  1ZP0 B;  3IFW B;  2KMA A;  3SFD B;  4H2A A;  4HRO A;  2CR5 A;  4GDL A;  1IBX B;  1TBE A;  1WI0 A;  3QHT A;  1T0R C;  1AWD A;  1L7Y A;  1V1P B;  4HKQ A;  3AE5 B;  5KHO A;  4MH8 A;  2KDB A;  3W2D A;  1D5Z C;  4TMA B;  3BZD B;  4HPP A;  1YD8 U;  3PTF C;  5EE1 A;  1OQQ A;  3JYU A;  5FR3 A;  1FNU A;  3CWI A;  3A33 B;  3FAH A;  3P4Q B;  4JIO U;  1R4M I;  4XWT A;  4JX1 C;  2KOX A;  1SJE D;  3Q8F A;  2PJH A;  4C56 C;  4DHJ B;  3NS1 A;  1VDV A;  3VVW B;  2E6X A;  4IM3 A;  4F8C B;  1B9R A;  4CHK A;  1Z2M A;  5TSS A;  4J6I A;  1MG8 A;  3Q69 A;  1EWY C;  4KV2 A;  3C8Y A;  2DZJ A;  5HI1 A;  5TR5 A;  3M62 B;  1V9J A;  3ZTC A;  1D3Z A;  1WGG A;  3TEZ A;  4I6L B;  4AQ7 A;  1V2Y A;  4II2 B;  5AEK B;  5HG2 A;  2K3U A;  4B0M A;  2AQ3 B;  1JCK B;  1KLU D;  4LK0 M;  3DBR B;  4KSL C;  2QCZ A;  3LXF A;  3PRE A;  1H8C A;  1SIJ A;  3K9P B;  2N9K A;  1ZKH A;  2SEB D;  2UYZ B;  3ZDT A;  3RNC C;  1UGJ A;  2LVQ A;  1TKG A;  2L05 A;  1F77 A;  3VTV A;  4TUU A;  1JML A;  2N7D A;  3Q3O C;  3TBL D;  3I63 C;  4O1N A;  1EUV B;  2IPK D;  4KSK C;  3A9J B;  1TS2 A;  1XT9 B;  3AM9 A;  1V5T A;  3VHT C;  2LUM A;  3B9J A;  3UIO B;  1C77 A;  2RPQ A;  4LTU A;  4A90 A;  1ISN A;  2BPS A;  3PPA A;  4YSX B;  1WGD A;  2WDV B;  2GBK A;  1FEH A;  2FE8 A;  3N30 A;  2KQ7 A;  3BII D;  2RD0 A;  3ZNI D;  1C9F A;  1Y56 A;  2VZK B;  4GXB A;  5J18 A;  3Q3N C;  4OZC A;  2JX5 A;  2R2Q A;  1FXT B;  1JAL A;  2PW9 A;  1J19 A;  4M01 A;  4HJK A;  3ZO5 B;  1T0S C;  3APC A;  4WAA A;  3L16 A;  3BK2 A;  1N63 A;  3IG3 A;  2KX0 A;  3SDL C;  5BYQ A;  1FPY A;  3V6C B;  4NJC A;  1WSP A;  2LAS A;  2JU6 X;  5AZG A;  3ZJV A;  1IBX A;  1NVI D;  4GN1 A;  1I4H A;  2NBW B;  1SB3 C;  4HWI B;  2G4S A;  2J42 A;  4MJS B;  4M02 A;  2WDR B;  2YEP F;  4DXF A;  3DQV A;  2X38 A;  4A3P A;  3V62 A;  3RUL A;  3TMP B;  1JQ4 A;  1RFK A;  2IBI B;  2WXG A;  3UIP B;  4RGM A;  3WAN A;  3ABV B;  3KW5 B;  3QJZ A;  4ZRQ A;  3TSS A;  2HJ8 A;  4OZB A;  2I2Y A;  4B6W A;  2JXX A;  1SSN A;  5D3D A;  1T0Q C;  4E71 A;  3Q14 C;  3BVM A;  5FKA C;  2BVC A;  2JUO A;  1J7B A;  4LDT D;  3UF8 A;  3BK1 A;  3KUD B;  4LLG M;  3RCZ A;  1JRP A;  2EMS A;  3IT4 B;  4W9E A;  4ZYN A;  1DOY A;  5CX3 A;  1V80 A;  4MSQ B;  2G9H D;  4AUQ C;  2LD9 A;  3ALB A;  5DPS A;  2BQQ A;  3WCQ A;  2XK5 B;  3DVG X;  2H89 B;  5J2R A;  4ZRI A;  2KZR A;  3IVF A;  4XYC A;  4F1S A;  1OEY J;  3AU4 A;  4NNJ B;  4HKZ E;  3DBL B;  2GBN A;  3URY A;  4W9F A;  2MLB A;  3OJ3 A;  4FHK A;  2IYD B;  3A9K B;  1BUI C;  1WGR A;  2N1V A;  2KQS A;  1WX8 A;  1VZ6 A;  3AEC B;  1Q1O A;  4IKG A;  3TEW A;  2N9X A;  2KDF B;  4IWO A;  1SIF A;  2HDE A;  2WLB A;  3W1S A;  4RMA A;  2WXL A;  1ENF A;  1P98 A;  3NVW A;  4DXA B;  3IHP C;  3TL5 A;  3H7P B;  1DOX A;  3SEB A;  4WH4 A;  5CTR C;  5FR6 A;  3Q8E A;  1KM7 A;  4DWF A;  1C4P A;  4EFO A;  4OW0 A;  4HDQ A;  3APD A;  4WJQ A;  3AE7 B;  4ZHP A;  3FIL B;  3KWL A;  3MHZ A;  3LB8 C;  3B2G A;  1A70 A;  5JXV A;  1RM6 C;  3ML8 A;  4JQW C;  2V9H A;  2KMC A;  1C78 A;  1EU3 A;  2D11 A;  3H8H A;  1TZ1 A;  2LHE A;  2JRH A;  1XXG A;  2JRI B;  2JYT A;  2FUG 1;  2DNF A;  2JQR B;  4ANX A;  3S2A A;  2W82 A;  1XLN A;  2BYV E;  1ZDX A;  2H88 B;  3JSV B;  2BBC A;  1WWT A;  3ONS A;  4A20 A;  3R7R A;  1E7U A;  2ACZ B;  3AI5 A;  2KN4 A;  5E6N A;  1TZO A;  1QF6 A;  2FBW B;  4US9 A;  3V60 A;  1PFD A;  3RUI B;  3MP9 A;  2N1W A;  2M1M A;  4JGH B;  4MJS A;  1Q5W B;  3I5J C;  2KTF A;  1GC7 A;  2QC8 A;  1YNT E;  1LM8 B;  1FXA A;  1OFF A;  3DHI C;  2JZP A;  3NVY A;  3ZNH B;  1CJE A;  4MM3 B;  4TQ1 A;  4YTM B;  1RAX A;  2HD5 B;  2N0S B;  2N7J A;  4C7Y A;  2NVU I;  3L08 A;  4WQO B;  2Q5W D;  3R2I A;  2PMV A;  3PVL A;  4XWW A;  2WQY B;  2WS3 B;  3M63 B;  3UQB A;  3EHV A;  1TT5 B;  1JRU A;  3IAM 1;  1HZ5 A;  3T9L A;  1ZE3 D;  2WXM A;  5BMG A;  1OGW A;  1IGC A;  1ZXH A;  2OHF A;  4MGI E;  1FIQ A;  4OVU A;  4HLE A;  2ZNV B;  4BFR A;  3PRZ A;  1TTN A;  1RWS A;  1WIA A;  2FCN A;  2KAN A;  5EE3 A;  4DK5 A;  2VH1 A;  3TEX A;  2KWV B;  1JRO A;  3PRM B;  3TJP A;  1M4V A;  5HFY A;  3Q6B A;  4M8N A;  2XK5 A;  3DCG A;  3H1U A;  3NHE B;  1VLB A;  3KQ4 A;  3PHW B;  5IAA C;  3MC9 A;  2KTR B;  2BS4 B;  2PKO A;  3E9S A;  3RNG C;  1L0V B;  5G5H A;  2EMT A;  1QLB B;  1C79 A;  4BKS D;  3VRA B;  2L52 A;  2V0G A;  5DPW A;  1F2R C;  5HKH A;  4IM0 A;  3N1Y C;  4FJY A;  1K51 A;  4ITK A;  3VQI A;  1TS5 A;  1WM3 A;  4GMV A;  1FO4 A;  1K50 A;  3QWZ B;  3V6E B;  1EO6 A;  1NI2 A;  1E7P B;  5AUI A;  1XLO A;  2BYE A;  2PLP A;  3H7P A;  4LCD E;  2PTL A;  1LO5 D;  1N6Z A;  4ICV A;  1I35 A;  1GB1 A;  3EEC A;  2KX3 A;  1P7E A;  1OQY A;  2BTE A;  2KWC A;  2BS3 B;  4II3 B;  1D5X C;  3QQ8 B;  3CSF A;  2LRW A;  3FIL A;  1HTQ A;  2QIE B;  1VR9 A;  3JVZ X;  4P1C C;  1UF0 A;  3UGB B;  2PE6 B;  3ML9 A;  4HCN B;  1HTO A;  2BT6 A;  3PLU A;  2BB6 A;  2BW2 A;  2INC C;  1WH3 A;  2JF5 A;  2J7Q B;  4ASW C;  4WJO A;  1YQ4 B;  2RDB C;  3JSV A;  4A55 A;  3OWE B;  5L95 C;  5CHF A;  1G6J A;  2BF8 B;  2JY6 A;  1XD3 B;  3ZUN A;  1V49 A;  4KX6 B;  3GB1 A;  2WU2 B;  2NCN A;  1STE A;  3IBE A;  3KYD D;  4IOI E;  1E8W A;  4EE2 A;  1OEY A;  4NAW B;  4RF0 A;  2BYT A;  2GRI A;  2ZNV C;  3ZQ4 A;  4GDK A;  3ZDM C;  4C7Z A;  2BWF A;  3O13 A;  1YIW A;  3H9D A;  3R7Q A;  4MM3 A;  1GNU A;  5IN7 A;  1SF0 A;  3AEG B;  1SGH A;  2LZ6 A;  3DBH B;  1K52 A;  4GU2 A;  2ZVN A;  4REZ A;  4QAY A;  3WAM A;  3ZVV A;  1FMA D;  2KK8 A;  4D2K A;  2QMT A;  4L1B A;  2L1A A;  1KF6 B;  1IUE A;  1UNS A;  1KLV A;  4DDI D;  3V3X A;  4RGO S;  4PK1 A;  3NZU A;  2WXI A;  2ZCC A;  3PSE B;  3ETR A;  2AQ2 B;  1EWC A;  2IDY A;  2KN5 A;  4XE0 A;  4HDO A;  4PT5 A;  1SEB D;  1V81 A;  4JWU C;  1UWX A;  2L7R A;  1WJN A;  1TIF A;  1WXV A;  3ZRC A;  2LRU A;  4M8M A;  2JVC A;  3CMM B;  1F2R I;  1PUT A;  2KTR A;  3P2B A;  3V05 A;  1JWS D;  1FRD A;  2OJR A;  3U30 A;  3HIZ A;  2DWQ A;  2QIL A;  4ZYS A;  4HJG E;  2GBR A;  2D3A A;  4IG7 B;  1E0Z A;  2DBY A;  4G50 A;  1YQ3 B;  4A3O A;  1MG4 A;  3P42 A;  1TS3 A;  1WGY A;  3U8Z A;  5DPR A;  2KXJ A;  2IO2 B;  2WXJ A;  3EGR A;  4USA A;  4IDI A;  1LQB A;  2J0K A;  1P0R A;  2PEA A;  4LJP B;  1P9D U;  3EA6 A;  1V1O A;  1ZW7 A;  2NBU A;  3AE4 B;  3U52 E;  1IPG A;  4M00 A;  1AYF A;  2FCM A;  2MX2 A;  3B1L X;  5BYR A;  1ZGU B;  2JPH A;  1YQB A;  3L13 A;  4MEM A;  4BOZ B;  4K3C A;  3AE2 B;  2A5U A;  3KVF B;  1A5R A;  4HRS A;  2D3G A;  2WXN A;  3RPF C;  3I57 A;  3R2T A;  2QJL A;  2OOB B;  4BBN F;  4EEW A;  2GOW A;  3AEB B;  2WX0 A;  4EKU A;  3HUI A;  3MJW A;  3N32 A;  4HXD A;  3GE3 C;  4BBN C;  3D32 A;  1WJU A;  2GBM A;  2DZI A;  3GP7 A;  3B0A A;  1UBI A;  2K39 A;  2YVC A;  1GOZ A;  5EDS A;  1L5P A;  3RNA C;  1YJI A;  1WXA A;  2J52 A;  2EEL A;  2MEK A;  2K6D B;  2Y5C A;  2CKH B;  2KT7 A;  4KKI A;  4C80 A;  1MI0 A;  4NAW A;  4OVV A;  2C7H A;  3AH7 A;  1GG3 A;  1WY8 A;  4K1R B;  2JYE A;  4BOS C;  4P16 A;  2INN E;  1V86 A;  3QCA A;  2JWZ A;  3WAO A;  2JXT A;  2YLM A;  1WZ3 A;  1UGM A;  1F0Z A;  1QOB A;  1WGH A;  3NZ3 A;  3U4E G;  2KYW A;  1I4P A;  1TS4 A;  1K8R B;  4P1B C;  1TGZ B;  3KWV A;  2C7M B;  1MFW A;  4B0E A;  1BML C;  2FCS A;  1XQQ A;  4MT5 A;  3PGE A;  3W9C B;  2C60 A;  4ACF A;  2VH2 A;  5C1Z A;  2NPT A;  1LXD A;  3AMZ A;  1P1A A;  3NVV A;  1L4Z B;  1WMH A;  3WIM A;  1QKZ A;  4HEA 1;  2N9E B;  4RCO A;  3L10 B;  4LDT B;  4LNI A;  3NVZ A;  3KLS X;  4PYZ A;  4FA6 A;  1TY2 A;  2WWZ A;  2CHX A;  2L76 A;  1NEN B;  1L0X B;  3OAW A;  2N9L A;  3ENE A;  2D2Q A;  1P7F A;  3QX1 A;  2LGI A;  1RFA A;  4ZHO A;  4G11 A;  3L54 A;  1WGK A;  2LJI A;  4RH6 A;  4MGY E;  1LFD A;  2W3R A;  2IO3 B;  3TCA A;  3VUX A;  4XX5 A;  2UU7 A;  2AX5 A;  1IP9 A;  1N5W A;  4K3B A;  4KGS A;  1QOF A;  5G5G A;  1DOI A;  1GB4 A;  2IO0 B;  4FN2 A;  4GIV A;  4KGR A;  3NG0 A;  4AJW A;  3U7D A;  2NMQ A;  4K81 A;  2VZK D;  1J7C A;  4R3D A;  2ZVO A;  3NJT A;  3HVZ A;  1V8C A;  1ET9 A;  1X1M A;  1I4X A;  2DHZ A;  1HQR D;  2RDG A;  3ZIM A;  3GE8 C;  3L4P A;  3W1S C;  3ZNG C;  2CU1 A;  4FBJ B;  1RYJ A;  2IY0 B;  2M19 A;  2HTH A;  2E3T A;  4WJN A;  5JHB A;  4G3X B;  4IWQ A;  4XZ4 A;  2WX1 A;  1CMX B;  1SBB B;  3IXS A;  2MJD A;  4DDG D;  3ECI A;  2K8B A;  4TKN A;  1AW7 A;  3VH4 B;  3ZRF A;  4IM2 A;  4KDI C;  1XF5 L;  1UH6 A;  3BYT B;  1E10 A;  1WRI A;  2BWE S;  2Y3A A;  1UBQ A;  3VR8 B;  1VD2 A;  3W5V B;  2FUH B;  3LJ3 A;  2AWT A;  2WXQ A;  3SD5 A;  5FK9 C;  1T6B X;  1I4R A;  3GOE A;  2BKR B;  4S17 A;  4WWP A;  1NDD A;  1UEL A;  3AUL A;  1KJT A;  1PYW D;  3PT2 B;  2KMM A;  2K6Q A;  2IZV B;  4Q2J A;  4RGT A;  3ZJU A;  1YN4 A;  2WXK A;  3BY4 B;  1NBF C;  2DZM A;  2FNJ B;  1R4N B;  2L0F A;  2LVO A;  2C5L C;  3J9C A;  4S0R A;  3GZN B;  4NZL B;  2LGS A;  3X23 A;  1SE9 A;  1JWM D;  4ZDV A;  2ICI A;  4EZL A;  4GLS C;  2WHI A;  3A4R A;  1YJ1 A;  2LXA A;  2TSS A;  3AV8 A;  3AEE B;  4PS8 A;  3PLV A;  3WAP A;  1PGB A;  2C7N B;  1GC6 A;  1XLQ A;  4M0W A;  5E6J A;  1YN5 A;  2EKE C;  2HTM E;  1E6E B;  3AE3 B;  4YWG G;  4EUT A;  4KIK A;  4I6P A;  3RNE C;  3I3T B;  4URK A;  4PS3 A;  3X0W A;  2KC2 A;  3R3M A;  5LXI B;  2LEK A;  4GDK B;  2XNA C;  1N60 A;  2R61 A;  4PYU A;  2D3B A;  3DBR I;  1XO3 A;  2I1K A;  1YN3 A;  1J7A A;  3B2F A;  5BYS A;  4US8 A;  1RRB A;  3WAL A;  2C9W B;  1FNW A;  2W54 A;  4YT0 B;  2ON8 A;  3AE8 B;  5BO4 B;  4AJY B;  3DHH C;  3AEF B;  4A6Q A;  1HXY D;  2UWQ A;  4LJO B;  4W9K A;  5LXH A;  5T8I A;  3Q8B A;  2KVZ A;  2V3S A;  4MH0 E;  4C4V A;  4DHZ E;  2W3S A;  2IGD A;  1V97 A;  2O6V D;  4CQN A;  2WXO A;  2WGS A;  2V4L A;  2L3Z A;  4YTP B;  2V3P A;  4NQL B;  2EKI A;  4RF1 A;  1V5O A;  2A4Z A;  2LUE A;  4W9I A;  1E8Y A;  2K0P A;  5IKC M;  4WWM A;  1I42 A;  2J53 A;  1FCL A;  2L32 A;  2OJW A;  4JWS C;  1Z5S B;  2HE7 A;  2AYO B;  2XEW A;  5CHV C;  4JPS A;  3PV1 A;  3KYC D;  2HJ1 A;  2Y5B B;  3Q3F A;  3SU8 X;  4W9G A;  5H92 C;  3N1Z C;  1GPX A;  5JHA A;  3RNF C;  1VZ7 A;  2DEN B;  5JH5 C;  3P4P B;  3AU5 A;  2AL3 A;  2MP2 A;  1IGD A;  2BYF A;  1L0Y B;  2K1F A;  2RPV A;  4WQM A;  2ZPY A;  1ZXI A;  4WAF A;  5D2M B;  3HRD D;  4BZA A;  3EC8 A;  2WXF A;  3TEY A;  3ZKJ C;  5EE0 A;  3MFG A;  2J0M A;  2M0A A;  1C4A A;  1UD7 A;  1WF9 A;  1OTR B;  1AN8 A;  5L83 A;  1OQR A;  2WNM A;  3BYY B;  4NJ6 A;  1Q0W B;  3KH0 A;  2ASQ A;  4P6V F;  5D94 A;  1CK1 A;  1WE6 A;  3DWM A;  1C1Y B;  4XDC A;  4WWN A;  1XCQ L;  1YMH E;  2Z59 B;  4P7I A;  4HVB A;  2O6V A;  3APF A;  1XCT L;  1GUA B;  4N58 A;  2D5G A;  2MWS B;  2KKC A;  3BWU D;  1JWU D;  4CYE A;  1RLF A;  4MSM B;  3HM6 X;  1L4D B;  3DVN V;  3A1Q B;  2L8J A;  3RT3 B;  1BXT A;  3N3K B;  3DBL I;  4BKS A;  1WRD B;  1S3S G;  2WXP A;  2Z0D B;  5G55 A;  1L6U A;  4DQO C;  3OG5 A;  2NTT A;  2KO3 A;  3FKY A;  1UWM A;  2KWD A;  2IND C;  2B3A A;  4K7U A;  5GMV A;  4FUL A;  3RZW C;  1EF5 A;  4OZA A;  3PO0 A;  2NBV B;  1FM0 D;  2MA9 B;  3ZJT A;  2W55 A;  4MAC A;  1YOV B;  1AAR A;  5HHD G;  5BMH A;  2INP E;  2ZCB A;  4MGZ E;  2WDQ B;  2NPT B;  2L00 B;  4W9H A;  2KDI A;  1WM2 A;  1WMH B;  3MC8 A;  3IT6 B;  1L2N A;  1SJH D;  1R4N I;  2L0T A;  2LXC A;  1MJD A;  1YX5 B;  1MHX A;  4WUR A;  2GMI C;  2K22 A;  5MPO A;  2GI9 A;  1C4C A;  3RYT A;  2KNB A;  2WU5 B;  1F1H A;  3DVG Y;  3Q8C A;  1R7S A;  1JW9 D;  2CS4 A;  1E8X A;  2V4I B;  2JWU A;  1ACC A;  2CHW A;  4HK2 A;  1ZDV A;  2KWU B;  2RR9 A;  3VFK A;  4WJP A;  2D10 A;  1IYF A;  4E74 A;  1QQR A;  3P1M A;  4N6E B;  3TIX A;  1F52 A;  4KDL B;  3N1X C;  1EU4 A;  2O2V B;  1PQS A;  2K5P A;  2JT4 B;  2MBQ A;  2DYO A;  2J4X A;  3DBS A;  5E6P A;  2RDH A;  2G3Q B;  3C0R B;  2ZZP B;  3MC0 B;  1M94 A;  4JLC A;  1DGJ A;  1YX6 B;  1ESF A;  3DWG C;  2MBO A;  4YSZ B;  2ONQ A;  2RMM A;  4ZRJ A;  3CST A;  1FNV A;  2MCN B;  2QHO A;  1E7V A;  4RNA A;  1EM7 A;  2QEJ C;  4EOY A;  1S1Q B;  4ZRK A;  4ANV A;  1HA5 A;  2FIF A;  2Z8L A;  1WJ6 A;  1NEK B;  4NPN A;  5LLI A;  3EFC A;  5IOI A;  2N4F A;  3W5U B;  4BKT A;  4MDK E;  4C00 A;  1FRR A;  2MBH A;  3VXW A;  5D3I B;  1WJ4 A;  2YEP B;  4I6N B;  1DYQ A;  2D3C A;  3VUW A;  3ZLZ A;  3HVD A;  5EE9 A;  2LJ5 A;  2IO1 B;  2ZW1 A;  4L2Y A;  1WX9 A;  2KJ6 A;  3I9V 1;  3AEA B;  1WYG A;  3A1Q A;  5KHQ A;  4MGK E;  4ARI A;  5C23 A;  4B9K A;  2MRP A;  4KKJ A;  4GOC A;  2B76 B;  5E6O A;  1SXT A;  4DHJ D;  2AEH A;  1TYG B;  4W9J A;  2GBJ A;  5J17 A;  1VZ8 A;  2LWP A;  1XEE A;  5D7G A;  4RGN A;  3HM3 A;  2G45 B;  3H7S A;  3ZXR A;  2KDE B;  1VRA B;  2CJN A;  1N62 A;  3KUZ A;  4HPL B;  4RM8 A;  4YXD B;  3WA0 A;  2BS2 B;  1E5W A;  5DCN A;  2KC1 A;  2M8S A;  4ZRP A;  1HEZ E;  1KLG D;  3NUH B;  2IGH A;  3LYY A;  2KFK A;  4M0W B;  1WXQ A;  2ZJD A;  1JWA D;  2PE9 A;  3K9O B;  4FAD A;  4KIK B;  3QIJ A;  4GB9 A;  2M0X A;  2LGX A;  4GSW A;  4ANU A;  2JZ3 B;  3OJ4 B;  1TY0 A;  1WYW B;  4OHJ A;  2M56 B;  3TUO A;  3H6N A;  4EZK A;  5LNK 1;  1NI3 A;  4IWP A;  3DOW A;  4FLH A;  2KVR A;  3EFU A;  5G2N A;  1V1P A;  1WXM A;  2LMC A;  1WE7 A;  1MPE A;  2GB1 A;  4K7S A;  2LGY A;  4BAX A;  3BVZ A;  2KAJ A;  2LI5 A;  4TQ0 A;  2IY1 B;  1QZE A;  4YSY B;  2NR2 A;  2O2V A;  5IP4 D;  3QC8 B;  1WR1 A;  4JE3 B;  4ICU A;  4C4V B;  2I38 A;  1H4R A;  2AL6 A;  3VRB B;  1KH0 A;  3NOB A;  3VAW A;  4IUM B;  3DBH I;  3HK0 A;  5D6J B;  3RNB C;  1TKY A;  4NAM A;  5AZF A;  1QT9 A;  2KFJ A;  2XBB C;  4BVU C;  5DPT A;  1B1Z A;  4WIP A;  4ARC A;  3PZ8 A;  5GXG B;  1U4A A;  3SR6 A;  1EF1 A;  2KQ4 X;  1CZP A;  4L23 A;  2BGF A;  3ZYY X;  2DYM A;  1L6V A;  4XC2 A;  5CHW A;  3KUC B;  1WR6 E;  1FFV A;  2Z0E B;  3C19 A;  2CJO A;  2M4N A;  2W9N A;  3AB5 A;  2MP2 B;  2DAF A;  3ZTD A;  3R8B A;  2VRR B;  4UDU C;  3EUB 2;  4YTN B;  3UI3 A;  3NRZ A;  3T3N A;  1PDX A;  3AN1 A;  2V3N A;  1PGX A;  1T0Y A;  1HZ6 A;  1PGA A;  1ZPS A;  3VUY A;  3OLM D;  4MEL A;  3P63 A;  3VR9 B;  2D07 B;  2I1J A;  4DHZ B;  1UZX B;  4PS7 A;  3AXC A;  3Q3M C;  2DYB A;  1ROE A;  1GJZ A;  2BKF A;  1Q10 A;  3A9J A;  3T3O A;  4KZC A;  3JW0 X;  3QAQ A;  2J0J A;  3ZW3 A;  1N5X A;  3PHX B;  4F7Z A;  4AS1 A;  4FHJ A;  2N7E A;  2ZEQ A;  3CIR B;  2Y5P A;  2FAZ A;  3GS2 A;  1NYR A;  2SAK A;  4K7W A;  2WXR A;  2O6V B;  4B95 A;  1C76 A;  4OVZ A;  2K9X A;  1K53 A;  4DXG A;  3AE1 B;  3L17 A;  1P3Q U;  4RM9 A;  3L0W B;  2MW5 A;  3PZD A;  4AOF A;  2KHW B;  2JZZ A;  1C3T A;  4EZJ A;  3VTW A;  5JZE B;  1N61 A;  3CF6 E;  3A4S C;  2DAJ A;  1VCB A;  2NTS A;  2K25 A;  3PRP B;  1J8C A;  3B08 A;  5C2T B;  2MJE A;  3NZS A;  3VTU A;  1FD6 A;  1SE3 A;  1WZ0 A;  2MQJ A;  1ET6 A;  1R4M B;  2WDT B;  1WXS A;  1QOA A;  2N9P C;  2ZW0 A;  2KJH B;  3U2S C;  4FJZ A;  3DHG C;  4W9C A;  2LGD A;  4IW0 A;  2KLC A;  5I4D A;  3SFE B;  1WFY A;  1JWB D;  1BT0 A;  2LHD A;  3UIN B;  2IJ0 A;  3N20 C;  2L83 A;  4IC7 B;  3PS6 A;  1GAQ B;  1KOT A;  3ZNZ B;  2R2O A;  3DDC B;  4XDD A;  3FC4 A;  1VJK A;  1XLP A;  4E3C A;  3VDZ A;  4N59 A;  4A8X C;  4WWO A;  1TKE A;  1WX7 A;  2MJ3 A;  1HE8 A;  2AQ1 B;  4ANW A;  4DBG A;  1SE2 A;  3RN9 C;  1T5X D;  4W9L A;  3HHM A;  3MHS D;  1QOG A;  2LFI A;  1D6E C;  1NYQ A;  2NS5 A;  2QSD A;  3BIN A;  3N9Y C;  2PPH A;  2RGF A;  1MHH E;  5H8Y E;  4TV3 A;  4GDL B;  3NY5 A;  5AUK A;  4J3O D;  2MHJ A;  3E56 A;  1E9M A;  4YL8 A;  3RZF A;  1KTK A;  2FCQ A;  3A9K A;  3NS8 A;  1MVK A;  2OED A;  1I4G A;  2PIA A;  4NJ7 A;  4LNO A;  4HCP B;  1KRH A;  1E90 A;  1F9J A;  3DVN U;  3W1Y A;  2DZK A;  2GLS A;  3IAS 1;  4G0N B;  3AE9 B;  1E8Z A;  1ZUD 2;  1FXI A;  2BB5 A;  4NQK E;  1TJE A;  1QIL A;  1ZOY B;  1SE4 A;  3RI7 C;  2JSV X;  4XGA B;  3ZXV A;  2REX A;  3RFZ B;  1D4B A;  2FID A;  3QK0 A;  2K8C A;  1LGR A;  2MBE A;  5IO9 A; 
#chains in the Genus database with same CATH homology
 3DBS A;  5E6N A;  5E6P A;  2M17 A;  2IO3 B;  3TCA A;  3V60 A;  2G3Q B;  3C0R B;  3RD2 A;  3VUX A;  4AWJ A;  2ZZP B;  3RUI B;  4KVG B;  4XX5 A;  2N1W A;  1M94 A;  3M3J A;  4JLC A;  1IP9 A;  1YX6 B;  2M1M A;  2WYQ A;  3O65 B;  4NY0 A;  2MBO A;  4ZRJ A;  4JGH B;  4MJS A;  4CO7 A;  3M95 A;  1Q5W B;  3CST A;  2V1Y A;  2KTF A;  1GC7 A;  3DPD A;  2MCN B;  2QHO A;  1E7V A;  1LM8 B;  2IO0 B;  3ZNH B;  4FN2 A;  2MBB B;  4GIV A;  4EOY A;  1S1Q B;  4AP4 C;  2RSU A;  4AJW A;  4ZRK A;  3U7D A;  4ANV A;  4K81 A;  4TQ1 A;  2FIF A;  1RAX A;  1WJ6 A;  2ZPN A;  4NPN A;  2HD5 B;  5LLI A;  2N4F A;  3MTN B;  4BKT A;  5IA7 A;  4MDK E;  2MBH A;  2NVU I;  2ZVO A;  3L08 A;  4WQO B;  3VXW A;  1WJ4 A;  4I6N B;  1X1M A;  3PVL A;  2DHZ A;  3Q3J A;  3ZIM A;  3VUW A;  3UQB A;  3M63 B;  3ZLZ A;  4KZ0 A;  3EHV A;  2LJ5 A;  3LDZ E;  3W1S C;  3ZNG C;  2CU1 A;  2IO1 B;  1JRU A;  4FBJ B;  3T9L A;  4N9F 4;  1OGW A;  2IY0 B;  2HTH A;  3UQA A;  1WX9 A;  2KJ6 A;  2KJR A;  4MGI E;  3A1Q A;  4OVU A;  4WJN A;  4HLE A;  5JHB A;  2ZNV B;  4G3X B;  5KHQ A;  4IWQ A;  4XZ4 A;  2MSE D;  4MGK E;  4BFR A;  3PRZ A;  1TTN A;  2WX1 A;  1Y8R C;  1WIA A;  2FCN A;  5C23 A;  2KAN A;  1CMX B;  3SHQ A;  3V61 A;  4B9K A;  2MRP A;  4HPM B;  4X57 B;  3T8M A;  4DK5 A;  4DDG D;  3ECI A;  1V6E A;  4GOC A;  2K8B A;  2KWV B;  3PRM B;  4BKG A;  3TJP A;  2KLG A;  4TKN A;  5E6O A;  2CHZ A;  3QA8 A;  4M8N A;  2XK5 A;  3DCG A;  3H1U A;  3NHE B;  3VH3 B;  3VH4 B;  3ZRF A;  4IM2 A;  4KDI C;  4W9D A;  3PHW B;  4DHJ D;  1UH6 A;  3R66 C;  5IAA C;  2BWE S;  1UBQ A;  5AZH A;  2AEH A;  1VD2 A;  2KTR B;  4GGQ A;  4W9J A;  2GBJ A;  2FUH B;  4FJV B;  2KFK B;  5J17 A;  2LWP A;  3LJ3 A;  5D7G A;  3HM3 A;  2G45 B;  2AWT A;  3H7S A;  2DX5 B;  2EMT A;  3GZN I;  3SD5 A;  2KDE B;  4BKS D;  2LVP A;  3GOE A;  1J0G A;  2BKR B;  3KUZ A;  2K8H A;  4HPL B;  4RM8 A;  4WWP A;  5DPW A;  1NDD A;  5HKH A;  1UEL A;  3AUL A;  4JL9 A;  3WA0 A;  4IM0 A;  1E5W A;  2G4D B;  2KC1 A;  1KJT A;  4FJY A;  5DCN A;  2M8S A;  3PT2 B;  3QAR A;  2KD0 A;  3VQI A;  2K6Q A;  2IZV B;  3IFW B;  1WM3 A;  2KMA A;  2KFK A;  4GMV A;  4M0W B;  3BY4 B;  2CR5 A;  1NBF C;  2DZM A;  2FNJ B;  3QWZ B;  4GDL A;  3V6E B;  2ZJD A;  1EO6 A;  2L0F A;  1NI2 A;  1TBE A;  2LVO A;  2C5L C;  1WI0 A;  2PE9 A;  3QHT A;  3K9O B;  2BYE A;  3H7P A;  4LCD E;  4FAD A;  4ICV A;  1L7Y A;  4KIK B;  3X23 A;  1SE9 A;  3QIJ A;  4ZDV A;  1I35 A;  3EEC A;  4EZL A;  5KHO A;  4GB9 A;  2KX3 A;  2M0X A;  2LGX A;  4GSW A;  4ANU A;  1OQY A;  2JZ3 B;  2KWC A;  3A4R A;  1YJ1 A;  2KDB A;  1WYW B;  2LXA A;  3OJ4 B;  4II3 B;  4PS8 A;  3QQ8 B;  3CSF A;  3PLV A;  3WAP A;  3H6N A;  2LRW A;  4EZK A;  2C7N B;  1GC6 A;  4IWP A;  3DOW A;  3JVZ X;  4FLH A;  3UGB B;  1YD8 U;  2PE6 B;  2EKE C;  2KVR A;  3ML9 A;  4HCN B;  3PTF C;  3EFU A;  5G2N A;  3JYU A;  4EUT A;  3PLU A;  4KIK A;  4I6P A;  1WXM A;  3A33 B;  1WE7 A;  1WH3 A;  3I3T B;  4URK A;  4JIO U;  1R4M I;  2JF5 A;  4PS3 A;  3X0W A;  2J7Q B;  2KC2 A;  3R3M A;  2KOX A;  2LGY A;  4K7S A;  4WJO A;  4ASW C;  5LXI B;  2LI5 A;  4TQ0 A;  2IY1 B;  2PJH A;  4DHJ B;  3JSV A;  4GDK B;  1QZE A;  2NR2 A;  2O2V A;  3QC8 B;  3VVW B;  4IM3 A;  5L95 C;  5CHF A;  1WR1 A;  4F8C B;  1G6J A;  4ICU A;  4PYU A;  4CHK A;  1Z2M A;  2BF8 B;  2JY6 A;  3DBR I;  2I1K A;  1H4R A;  1XD3 B;  2AL6 A;  4J6I A;  1MG8 A;  3ZUN A;  1V49 A;  4KV2 A;  1RRB A;  3NOB A;  3VAW A;  4IUM B;  2NCN A;  2DZJ A;  3DBH I;  3WAL A;  3HK0 A;  2C9W B;  5D6J B;  3IBE A;  3KYD D;  5TR5 A;  5BO4 B;  4AJY B;  1E8W A;  1OEY A;  4NAW B;  3M62 B;  1V9J A;  2UWQ A;  5AZF A;  4LJO B;  2ZNV C;  2KFJ A;  4W9K A;  4GDK A;  1WGG A;  3ZDM C;  3ZTC A;  5LXH A;  1D3Z A;  2BWF A;  4I6L B;  1V2Y A;  4II2 B;  1YIW A;  5AEK B;  2XBB C;  2V3S A;  4BVU C;  3H9D A;  4MH0 E;  5DPT A;  3R7Q A;  4DHZ E;  4KSL C;  4MM3 A;  1U4A A;  1GNU A;  3PRE A;  1H8C A;  2O6V D;  1EF1 A;  1SGH A;  2LZ6 A;  3K9P B;  1ZKH A;  4GU2 A;  2V4L A;  2BGF A;  2L3Z A;  2ZVN A;  3WAM A;  2UYZ B;  3ZDT A;  3ZVV A;  2KK8 A;  4NQL B;  2DYM A;  4XC2 A;  2LVQ A;  3KUC B;  5CHW A;  1V5O A;  1WR6 E;  2A4Z A;  2LUE A;  1E8Y A;  2Z0E B;  4W9I A;  2L05 A;  2M4N A;  3VTV A;  1I42 A;  4TUU A;  2W9N A;  1KLV A;  2N7D A;  4DDI D;  3TBL D;  1Z5S B;  2MP2 B;  2HE7 A;  2AYO B;  1EUV B;  2DAF A;  2XEW A;  3NZU A;  5CHV C;  2ZCC A;  3PV1 A;  3PSE B;  4KSK C;  3ZTD A;  2VRR B;  3A9J B;  3KYC D;  2Y5B B;  3Q3F A;  3SU8 X;  4A20 A;  2KN5 A;  4W9G A;  1XT9 B;  1V5T A;  4HDO A;  3VHT C;  3UIO B;  2RPQ A;  1T0Y A;  1V81 A;  1ISN A;  5JHA A;  3VUY A;  2BPS A;  3PPA A;  3OLM D;  1WGD A;  2GBK A;  2L7R A;  1WJN A;  4MEL A;  3N30 A;  2DEN B;  1WXV A;  3ZRC A;  2KQ7 A;  2LRU A;  2D07 B;  2RD0 A;  2I1J A;  4M8M A;  2JVC A;  1UZX B;  2AL3 A;  3AU5 A;  3CMM B;  2MP2 A;  3AXC A;  4PS7 A;  3ZNI D;  3P2B A;  2DYB A;  2KTR A;  1GJZ A;  2BKF A;  2BYF A;  3A9J A;  4GXB A;  2OJR A;  5J18 A;  3U30 A;  2K1F A;  3HIZ A;  4KZC A;  2R2Q A;  2ZPY A;  3JW0 X;  3QAQ A;  2J0J A;  1FXT B;  2GBR A;  5D2M B;  3ZW3 A;  1J19 A;  3EC8 A;  4IG7 B;  3PHX B;  4HJK A;  4F7Z A;  4G50 A;  3ZO5 B;  3APC A;  4FHJ A;  4A3O A;  4WAA A;  2N7E A;  3L16 A;  3ZKJ C;  2ZEQ A;  1WGY A;  2J0M A;  3U8Z A;  5DPR A;  2KXJ A;  1UD7 A;  3IG3 A;  2IO2 B;  1WF9 A;  1OTR B;  2KX0 A;  2FAZ A;  3SDL C;  3V6C B;  5L83 A;  4K7W A;  2LAS A;  2O6V B;  4B95 A;  1LQB A;  5AZG A;  2J0K A;  4GN1 A;  1P0R A;  2PEA A;  4LJP B;  1P9D U;  2NBW B;  4NJ6 A;  4HWI B;  2G4S A;  3L17 A;  1P3Q U;  1Q0W B;  1ZW7 A;  2NBU A;  3KH0 A;  4MJS B;  1IPG A;  2ASQ A;  4RM9 A;  3L0W B;  2FCM A;  2MX2 A;  2MW5 A;  3B1L X;  3DQV A;  3PZD A;  1WE6 A;  5D94 A;  4AOF A;  2KHW B;  1C1Y B;  1ZGU B;  2JPH A;  2JZZ A;  1C3T A;  4WWN A;  4A3P A;  3V62 A;  4EZJ A;  1YQB A;  3VTW A;  2Z59 B;  3L13 A;  3RUL A;  5JZE B;  3CF6 E;  4MEM A;  4BOZ B;  3A4S C;  2DAJ A;  4P7I A;  3TMP B;  4HVB A;  2A5U A;  2O6V A;  1VCB A;  3KVF B;  2IBI B;  2K25 A;  1A5R A;  3PRP B;  1J8C A;  3APF A;  3B08 A;  2D3G A;  3UIP B;  1GUA B;  3WAN A;  5JH5 C;  2OOB B;  4BBN F;  4EEW A;  2MWS B;  2GOW A;  2KKC A;  2WX0 A;  3KW5 B;  3QJZ A;  4EKU A;  3NZS A;  3VTU A;  2HJ8 A;  3MJW A;  4CYE A;  1WZ0 A;  2MQJ A;  4B6W A;  2JXX A;  2WDT B;  3N32 A;  4HXD A;  1WXS A;  1RLF A;  4MSM B;  2N9P C;  3HM6 X;  4BBN C;  2KJH B;  3D32 A;  4E71 A;  1WJU A;  4FJZ A;  2GBM A;  2DZI A;  4W9C A;  2LGD A;  3DVN V;  2JUO A;  4IW0 A;  3A1Q B;  2KLC A;  3B0A A;  2L8J A;  3RT3 B;  1WFY A;  1UBI A;  1BT0 A;  3N3K B;  4LDT D;  2K39 A;  3UF8 A;  2YVC A;  3UIN B;  3DBL I;  3KUD B;  5EDS A;  3RCZ A;  1WRD B;  1S3S G;  2EMS A;  4W9E A;  4ZYN A;  2Z0D B;  1WXA A;  5G55 A;  4BKS A;  4IC7 B;  5CX3 A;  1V80 A;  2K6D B;  4MSQ B;  2CKH B;  3PS6 A;  4AUQ C;  4NAW A;  2KO3 A;  2LD9 A;  3ZNZ B;  3ALB A;  5DPS A;  1KOT A;  2XK5 B;  2R2O A;  3DVG X;  3DDC B;  2B3A A;  4K7U A;  5GMV A;  4FUL A;  4E3C A;  4OVV A;  5J2R A;  4ZRI A;  2C7H A;  3VDZ A;  3RZW C;  1EF5 A;  1GG3 A;  2KZR A;  2NBV B;  4WWO A;  3IVF A;  1WY8 A;  4K1R B;  4BOS C;  1WX7 A;  2MA9 B;  4F1S A;  1OEY J;  3AU4 A;  1V86 A;  3QCA A;  2JWZ A;  3WAO A;  4NNJ B;  1HE8 A;  1AAR A;  2GBN A;  2YLM A;  4ANW A;  4DBG A;  1WZ3 A;  4W9F A;  2MLB A;  3OJ3 A;  4FHK A;  4W9L A;  2IYD B;  3HHM A;  3A9K B;  1UGM A;  1WGR A;  2N1V A;  2KQS A;  1WX8 A;  3MHS D;  2ZCB A;  4MGZ E;  1WGH A;  2NS5 A;  1Q1O A;  2NPT B;  2L00 B;  4W9H A;  2KDI A;  3BIN A;  1WM2 A;  2N9X A;  2PPH A;  1WMH B;  2KDF B;  1K8R B;  2RGF A;  4IWO A;  1L2N A;  1SIF A;  1TGZ B;  4TV3 A;  1R4N I;  4GDL B;  3W1S A;  4RMA A;  3NY5 A;  2L0T A;  2LXC A;  1YX5 B;  1P98 A;  2C7M B;  4YL8 A;  3IHP C;  3TL5 A;  4DXA B;  2GMI C;  3H7P B;  3RZF A;  5CTR C;  2FCS A;  1XQQ A;  5FR6 A;  3PGE A;  2FCQ A;  3RYT A;  3A9K A;  1KM7 A;  2KNB A;  3NS8 A;  4DWF A;  2C60 A;  3DVG Y;  4EFO A;  4NJ7 A;  5C1Z A;  4HDQ A;  3APD A;  4HCP B;  2NPT A;  1E90 A;  1LXD A;  4WJQ A;  1F9J A;  1P1A A;  1WMH A;  2CS4 A;  1E8X A;  3WIM A;  3DVN U;  3W1Y A;  2N9E B;  2DZK A;  2CHW A;  4G0N B;  3L10 B;  4LDT B;  3ML8 A;  4HK2 A;  4JQW C;  2KWU B;  2KMC A;  1E8Z A;  4PYZ A;  2D11 A;  4FA6 A;  2WWZ A;  4NQK E;  2RR9 A;  1TZ1 A;  2CHX A;  2L76 A;  4WJP A;  3VFK A;  2JRH A;  2D10 A;  1IYF A;  4E74 A;  3OAW A;  2JRI B;  4ANX A;  3S2A A;  2REX A;  3ENE A;  2D2Q A;  3TIX A;  2BYV E;  3JSV B;  4KDL B;  3QX1 A;  2O2V B;  2FID A;  1RFA A;  4DHZ B;  3QK0 A;  2K8C A;  4G11 A;  1PQS A;  3L54 A;  2JT4 B;  3ONS A;  2MBE A;  4MGY E;  2MBQ A;  3R7R A;  1E7U A;  2DYO A;  1LFD A;  3AI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...