3MFGA

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 52
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mfgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mfgA01
1PTOB 3R8BA 5ELDA 1SEBD 4RGNA 1SJED 1I4XA 1BCPB 1LLRD 2RDHA 1XXGA 3BVMA 1EEID 1PTOC 1TS4A 2QEJC 3BZDB 2CHBD 1LTRD 4OHJA 1EU3A 5FKAC 1BCPC 3SEBA 1CT1D 1PZKD 3V05A 1S5BD 3GP7A 1PZJD 1S5FD 1S5DD 3MC0B 3URYA 1CQVA 1AN8A 5I4DA 3BYYB 4DXGA 1D5XC 3DWPA 1EFID 1ESFA 1G8ZD 1RDPD 1LT3D 1FGBD 1PYWD 1YN4A 1PZID 1PTOD 1LT5D 1CK1A 1LTGD 1I4GA 1S5ED 2AQ1B 3R2IA 1V1OA 1JWSD 1ET9A 1BCPD 1LT4D 1L0YB 1TS3A 2XRQD 4RGMA 4RFBA 1B1ZA 5ELBA 1TS2A 2J4XA 1CHQD 2RDGA 1M4VA 2NTTA 1V1PA 4O1NA 1TS5A 1YN3A 1LTSD 1HTLD 4RGTA 4L6TB 1JR0D 2XRSD 5TSSA 4RCOA 1MD2D 1V1PB 1LO5D 1GOZA 1LTAD 1DYQA 1B44D 2AQ3B 2WV6D 3DWQA 3W2DA 2IJ0A 1KLGD 2G9HD 2AQ2B 1S5CD 3TSSA 3R2TA 3DWAA 5D3IB 1STEA 2XN9C 3O13A 3KLSX 1FNWA 1UNSA 4C56C 1I4PA 1I4RA 4L63B 1TY0A 1L0XB 2ICIA 4NZLB 4RHRA 4Z9CB 1PTOF 3BYTB 4UDUC 1RCVD 1JWMD 1HXYD 1SE2A 4BWGB 1ET6A 1BCPF 1EU4A 1SE3A 4RH6A 1DJRD 1QILA 1PRTB 1F77A 3MFGA 1EEFD 1I4HA 1SJHD 1PRTC 1JQYD 1LTTD 3CHBD 1FNUA 1XTCD 3EA6A 1KTKA 1RD9D 3BVZA 1ENFA 1HA5A 1JWUD 1PTOH 3BVGA 1T5XD 1FNVA 1HQRD 1TY2A 2XNAC 5D3DA 4ZYSA 4K6LA 4TSSA 1LT6D 4DXFA 5ELCA 3OWEB 5ELEA 1D6EC 1JCKB 2TSSA 1YN5A 2Z8LA 1PRTD 1RF2D 4RHSA 5ELFA 1EWCA 1AW7A 2QILA 2IPKD 1LTBD 1D5MC 1D5ZC 1CHPD 1BXTA 2O2LD 2R61A 1I4QA 1SXTA 2NTSA 1UUPA 1FD7D 4RGOS 1KLUD 1SBBB 1SE4A 5FK9C 2SEBD 1LTID 3EFXD 1PRTF
chains in the Genus database with same CATH superfamily
2UUAQ 2KDFB 4DK6C 1OGWA 4IW0A 3TEWA 3NQIA 3Q8DA 2EVBA 1WTQA 4II3B 1D7QA 4C3HG 4X64Q 3J7AF 2RCNA 4KHPL 1VQJA 1JT8A 1QZEA 4HR7B 3AEAB 3I63C 2DZIA 4MIUA 1ZEQX 1ZPSA 2VL6A 1WGYA 1CT1D 2WGSA 5EE0A 1MHHE 3QWZB 1RFKA 2K3UA 1WXAA 1EOTA 1JB3A 1WGGA 2LFIA 4A93G 2BKFA 4JWSC 1VRAB 4I6LB 4DR6L 1E7UA 3HOZB 4L2YA 2J42A 5HHDG 1PH7A 4NXML 1UAPA 1VQ7A 2Z1CA 2A8VA 2FCNA 1UBIA 4A3KG 4JI2L 2LD9A 4EE2A 2RSNA 4ZKBB 4LJOB 1B1ZA 4OX9Q 2EOTA 2M00A 5M5WH 3GTPH 2C60A 4EQPA 3Q6BA 1A2UA 5IO9A 4MH0E 1HZ6A 5E6PA 2G4DB 2JRHA 1SNDA 2B2UC 3KF6A 2N9PC 3GTJH 3J81E 2KWCA 1JR0D 3T51B 1L1OC 4YY3L 3HOXB 2KZRA 2C7HA 5CHVC 2N7JA 3TREA 4WORA 4LUZA 1EQRA 3H6MA 1Y14B 2V4IB 5FO9B 3KF6B 1XMOL 3Q22A 3UINB 1I5FA 3S14B 1G6PA 3C1EA 3PGZA 2LWPA 4MJSA 2WAQE 3M7GA 1PFBA 2NBVB 3FMCA 3QG1A 3RNFC 3V2TA 4JVZA 1EY6A 3TP6A 5IYCH 2BGFA 2A5UA 2X6GA 2MCNB 2KVMA 5IYDH 2G4SA 3TEHB 4MJSB 4MM3A 3KBXA 4EEWA 1ICFB 5FLXL 5CMDA 1RODA 5FJ8G 3CCUA 3GB1A 1H9RA 2IGDA 4XWWA 1WTRA 1PRTB 5M3FG 5IP7H 1IYFA 1EQTA 3AI5A 4IWOA 4K5VA 4BA1I 2MO0A 3GTLH 5IGDA 1MJEA 3MTNB 2RR9A 4DV0L 4NQKE 2KLGA 2EKEC 2RSUA 2W55A 4DDGD 2PMZB 1G2TA 1BUIC 3SDZA 2D0PA 1WTHA 1KC8C 1K73C 4PMWA 4IUTA 4B3MQ 4A3BB 2CU3A 4ODGA 2B2VA 3NTKA 4K6LA 4GIVA 4PG3A 5M3MG 4NJ6A 3TIXA 3ZW3A 3DBSA 3U58A 3PIPA 4DK3C 2J0TD 3SK8A 1C3TA 1F0ZA 1MKHA 3RNGC 4AJWA 1STGA 4ANVA 1R4QB 4LF5L 3RNAC 2CJNA 4RM9A 1JE5A 1ZXIA 3M4PA 4DF7A 5BR8Q 1I4QA 2HD3A 1KF6B 3GOEA 1GM5A 3IAYA 3H0GG 4MTKA 1UZXB 3MHSD 5KHQA 1LTID 3EFXD 1PRTF 3VR6A 2NCNA 4M01A 2GBNA 4DR5L 1N8RC 1U4RA 2KQ7A 2YTXA 4K5XA 2LXKA 2NBFA 1VQ9A 4FNFA 2VH1A 5M5YB 2LVQA 2M0AA 1HTOA 2KN5A 3HK0A 1EQQA 1ICWA 1I94L 2LEKA 3A33B 1IGDA 5C0XJ 2LJ5A 3VAWA 2FHTA 1PFMA 3W3AA 3A9KA 3PO0A 3UIPB 1PFSA 2JQOA 3ZNHB 1D5XC 1XTDA 4P2CB 2WNMA 3U30A 4CJ1B 3Q14C 2DENB 1GC7A 1W2BA 5L83A 4R4TA 1Z7TA 1PZID 5C44B 3J81i 1G91A 4ZK9B 3A9KB 2V0GA 2BKRB 5LLIA 3CXCA 2B2WA 2EYJA 2ICEC 3A1QA 3K5MA 1EZ6A 1PGBA 3GE8C 4DNRB 1WOCA 2NB0A 1OEYJ 1KD1C 3IXSA 4C80A 1UE7A 3KLRA 1DOKA 4DK0A 2VZKD 2F0LA 4DV1Q 3A1QB 2L12A 4GKKQ 1JJ2A 4PZ6A 2UUCQ 1ZP0B 1X1MA 5FO8B 1IGCA 4G11A 5BMGA 3ZRCA 1EY0A 1M90C 1IYVA 1WRIA 2K9XA 3F1ZA 4MSMB 5LMUQ 2M4NA 1E2WA 2REXA 1WCMB 2O2VA 3C3LA 2IY5B 2AQ3B 3BZKA 1B70B 1SFOH 1HNXL 2JX5A 2K6AA 1R9TH 1ZDVA 2ASQA 1TR5A 2AQ2B 2EJFC 1TWHH 4K8IA 5EBCA 3TSSA 3TZUA 2O5IC 2NZ1D 2QC8A 3HP3A 4WIPA 2IY0B 2QIEB 4XQNA 2O2VB 2EQSA 2WXJA 2WXKA 3S16H 5DEHA 2ES2A 2V1CC 4WWMA 3KUZA 1F9QA 2Z0EB 4OO1I 1SLJA 2JEBI 1WMHA 1LGRA 1GPXA 3VRAB 1SE3A 2AKWB 2RCFA 1WFQA 2F0NA 3PQIA 2KHJA 4L8JA 3FVQA 1N36L 2YU9B 2VUMB 4A3FG 3HVDA 4WAAA 4NKLA 4FVMA 3KW5B 4QAYA 1WMHB 4HPMB 2LZ6A 1XTCD 4IJLA 2RSOA 1XWEA 2L00B 5F2DA 1XCQL 2E2HB 1PTOH 3S2DB 1QJOA 4K8JA 5E1FA 4K0KL 4PS8A 3RULA 1WTXA 2BE5C 4PZ7A 2CW0D 2O6VA 4DGZA 1DOLA 3K7AH 4WRDA 1X3GA 4DNTB 4EKUA 4DV6L 1XPOA 1N61A 1B9MA 1VDZA 1LYLA 3FP9A 3DXJC 2KVZA 3I4LA 5DPTA 4XDCA 2KVRA 1SDFA 3I72A 1NCVA 1WJ4A 4DV2L 1NYRA 4OL7A 1PQSA 2JYTA 2O6VB 4KZ0A 1G291 3DHGC 4IPHA 4EVOA 3W5UB 3ZO5B 5K5PA 2HDMA 2V1YA 3GV3A 4XYCA 4DR2Q 1SIJA 3BDOA 2KUMA 1XLQA 3L0WB 4C2MH 4M8NA 3IFWB 1XEEA 4OVZA 3W9CB 4CO7A 4DUYQ 4W9EA 5AZGA 4UP9A 4AP4C 1WRDB 2HCCA 1MSHA 1V86A 3I4OA 1E8XA 1CSPA 1QOAA 3NE5B 2MEKA 4AYBE 1HNZL 2RPQA 3PUWA 3ZRFA 2MP1A 4BA2I 3NUCA 4MN3A 4J3OD 1ML0D 3WDNA 2VNUD 3ZJUA 1X56A 3I56A 2DZKA 4BOZB 1PZJD 2MPMA 3H91A 4G57A 2IGGA 1MIUA 1S3OA 3BYYB 1HJPA 1MJDA 1Y8RC 1IBLL 1HZCA 1SNOA 3G6EA 3DBHB 2B63H 4JI7Q 3VTVA 3WOFA 1FYCA 1PHJA 4BY7G 4AQ7A 1PTOD 1JMCA 4BY1B 4A3GB 1U0LA 4OWTB 4ASWC 1D4BA 1D2BA 4KTAA 5GADC 3RI7C 2DYOA 4EQNA 1KDAA 2LJIA 3TL5A 3CIRB 4XT1B 1QB5D 2EDGA 1WY8A 3G6JB 2D3AA 2WXMA 4KVGB 2F03A 2KN4A 1O7YA 1TS2A 4C3IG 2YV5A 3F2BA 4AJYB 1UF0A 3OAWA 2FCMA 2EE1A 3M9BA 3OW7A 5CHFA 3VFKA 5EKKA 3R66C 5LL6S 1FXAA 4E74A 1A2TA 4LF7L 1I50H 4N59A 3RNEC 1S40A 2BYTA 1B9NA 1SN8A 2JWZA 2KDBA 3GTKB 3ZXVA 4P1CC 4JV5L 1IL2A 5H92C 1RJTA 1SNMA 1DOIA 2LHEA 4JI1Q 3SR1A 4JBMA 2WFWA 3K8AA 2ZPNA 3UQBA 2GRIA 1JROA 4GDLA 2ZJQA 1RWSA 1B3AA 4IALA 3STBC 3FKYA 4MGKE 2OTJA 2F0EA 2OJRA 1GHJA 1P9DU 4A3MH 2QDFA 2PI2E 2L8JA 1QG7A 3HRDD 4FDBA 3RMKC 3V6CB 2WWZA 3ZUNA 1N9WA 2PEAA 3PSIA 4P6VF 2UUBQ 1FFUA 4DUZL 4BBRH 1Y1WH 4MHEA 2B3GA 1K53A 2B2YC 1HNWL 2NWGA 1TT2A 1RFAA 2Q2UA 3K0XA 3NP8A 2MBHA 4B9WA 4X3SA 1SYEA 3CCVA 2IZVB 1DOYA 1W6KA 1SJHD 2INCC 4DA2A 3TRZA 5CV7A 1O7LA 3CHBD 5C0XG 3NELA 3CCMA 4HPPA 4AS1A 4YSXB 1F1HA 2XIWA 1YHAA 4Q0FA 1FNVA 3VR8B 3KJPA 4BBNF 2HJ8A 4CKEA 2J0KA 1JQ4A 2QKIC 4JI4L 1HTPA 3OJ3A 4TKOB 2Z0DB 2XBBC 3QX1A 4YHHQ 1BDOA 4JOIA 2K1BA 3TS0A 2RF4A 4LF8Q 3HOYG 3BINA 4DV5Q 1AW7A 2JA5G 2UXDL 2L3ZA 1CHPD 4JI5L 2PZUA 4KY7A 4DV3L 2HHHQ 1YQ4B 5JXVA 2BA0A 1YQ3B 3HOZH 4J6IA 3D31A 5KYIA 2F4IA 3LWUA 4BBSB 3WIMA 1V8QA 3J81j 4XZ4A 3MJ5A 5IYBH 4K14A 1PH9A 3PIP3 1I4XA 4DBGA 1YZ6A 2MWSB 3CSFA 1MFWA 1EF1A 3MHZA 2WB1E 3L0OA 3KYDD 3GTQB 1E6EB 3PREA 3NS8A 1N32L 2WDVB 1QKZA 1RHPA 5D14A 4WFN3 2MBEA 1GO3E 2AWNA 2K28A 1FRRA 4M8AA 1Z2MA 3RUIB 2WP9B 4B08A 1XT9B 2LVOA 3HOXH 1EFID 1GXDC 4DR4L 2O5JC 1GJXA 2WX1A 4KJNA 3PHWB 3RNBC 2D2QA 2WDTB 3UQAA 1QOBA 4JI6Q 1WE6A 2KJRA 4NXNL 2WAQB 4Y52H 5AUKA 2OQKA 2EYHA 3S14H 2WINB 3RUZA 4OIKA 2KYWA 1XMQL 2PPBC 4BXXG 3EROA 3T3OA 2Y0SG 5JOBA 2CVRA 1SYCA 1PFNA 4POGA 1STHA 2UXCL 2ZNVC 4KIKA 2NTTA 4X66L 1UE6A 5KNBA 5JEAH 1YJNA 2BWES 2ZVNA 4ZUIA 2UU9Q 4YSYB 2JA8B 1RKNA 5A2QL 3PGEA 2KCTA 4DHZB 2WQYB 3HG9A 1OXTA 2XRSD 4GN4B 1MG4A 3ZLZA 1VZ8A 1VQCA 2JSOA 4RCOA 2GA4B 1YNJD 3I55A 4KIKB 5T1GA 4L5SA 4B3RQ 2D11A 4DXAB 3VUYA 2KJHB 4AOFA 3OMCA 2WV6D 3D0FA 4C1NI 4LF6Q 3C0RB 3N9YC 2ATWA 2JJQA 5MPOA 3SK4A 2O4XA 2J7QB 3PZDA 5E3FA 1UBQA 4GB9A 4P73A 4R4IA 3K59A 3HOVB 1UNSA 3ZXRA 4MGIE 4GNXA 2RGFA 3AE6B 4A3BH 2OF1A 4HWIB 3R93A 2WKDA 4BS9A 3GD7A 3M3YB 2DAJA 1WVLA 4JQWC 4NZLB 4IPGA 2F0QA 2WP8J 4J6HA 4HN7A 2R93G 3GZNI 1K83B 4GNXB 4E3CA 5IGCA 1ET6A 3HKZG 4FA6A 4HSVA 1STBA 3S17B 3APCA 2FIDA 2N8NA 2N1VA 4DU9A 1CUKA 2ZXRA 1K3RA 5FLMH 4EZKA 1I4HA 2F0IA 4APVA 3CCJA 3I57A 1C8CA 1LTTD 3K9PB 4REZA 2K25A 2K5NA 3NVWA 5EKIA 2GOWA 4A76A 4LCDE 2ZM6Q 2FCQA 2BT6A 4LF4L 1I3QB 3PVLA 1NTGA 3G4SA 2LUEA 1GUNA 2F0WA 1K51A 5M5YH 4FLHA 3K58A 2Q8TA 3MEFA 1IPGA 4ITKA 3IFTA 5IE8A 2EMSA 4A3PA 4B6WA 5EBDA 1PRTD 2A68C 1BBUA 3H3VI 3FILA 3A55A 4H02A 2UUAL 2J0MA 5JJKA 1X3EA 4M1UB 3ULLA 3EECA 2QILA 2IPKD 4CGYB 4X64L 1UWMA 1NENB 3WAOA 4ZDVA 1VZ6A 2KHWB 3KYHC 2WU2B 4YL8A 3K5NA 5CV9A 3CCQA 4DR1Q 5C44H 3FILB 4DWFA 4W9HA 3VA5A 4JI3Q 1FCLA 2Z6KC 1P3QU 3G48A 1NAPA 3R8BA 4DR7Q 2PVGC 4RGNA 1BKBA 1SJED 4MDKE 1N63A 2EJGC 1JW9D 2I5HA 3W1YA 1XXGA 3RYTA 4KMUC 1SE9A 4CDCC 1LTRD 1Y8PB 3NTIA 4GLSC 3AV8A 4DR3Q 3N52A 3V05A 4PZ8A 1HRJA 1TJEA 2D10A 2PVOD 2FMMA 4HSPA 4RG1A 4W9LA 1AN8A 1VQIA 3MVVA 1Z5SB 1DXMA 5IYCG 1T5EA 2JWUA 2KTFA 4OX9L 4IN3A 1WCMH 5IYDG 3G7LA 4A3DB 4OWWB 2ZJDA 1FGBD 3AU5A 3KWLA 2AWTA 1O78A 1WX7A 5BYQA 1U9RA 2K33A 3R2IA 2B2UA 2Y5CA 1ET9A 1H9SA 3PIOA 1K8OA 3WANA 1L0YB 4CDDC 1L1OA 4QQBX 1TS3A 2XRQD 1TQOA 4XXEA 3QWNA 5JVG3 4JYAQ 3OMGA 5IP7G 3L54A 5K36H 2GB1A 4GGQA 3WALA 4IUPA 2RDGA 4XYQA 4F87A 3EFUA 3VVWB 4H13C 4ANXA 2JA6B 3AECB 2NVTB 3UF8A 1MJCA 1L1OB 4O1NA 1VQMA 2L1AA 3AXCA 1ISNA 2D5DA 1HTLD 1C77A 2GVBA 4RGTA 3TP8A 3OTOQ 3SFEB 1LACA 2SNMA 1QOHA 2YU9H 3KBGA 1MD2D 2VUMH 5G5HA 2AL3A 2WXGA 3JAMc 2F0MA 4XE0A 2BF8B 4ABNA 2K5QA 1B44D 4PMBA 3DOWA 1NBWA 3I90A 2KA7A 1GUSA 4KZCA 4LJZC 3ZNID 2EY2A 4OO1H 1F9JA 2E2HH 4LNOA 1FEHA 4GN1A 3S2DH 5IT9c 4KY5A 1JE4A 1A15A 1KL9A 5JH5C 2FE8A 2H88B 1TY0A 5AUIA 1ZXTA 4JBKA 5JJIA 5EE3A 2JY6A 1WI5A 4HKZE 1JRUA 3X3MA 4KDIC 1KLVA 2CU1A 1PTOF 2LXAA 4P16A 4FXDA 2M19A 3AU4A 5LXIB 2WDQB 2ZZPB 1H9MA 1EU4A 2QW7A 4FP5D 1DJRD 1NMGA 3T1HQ 1E3PA 2QMTA 2Z6BA 2D0OA 1E5WA 4B3ML 4KN7C 1UEBA 2E6XA 2JF5A 3ICEA 3MFGA 2BVCA 5E4XA 1EEFD 4HROA 2VZAA 3ABVB 3Q8CA 3V62A 2KX3A 4F8MA 3CP0A 4S0RA 2MUYA 2RMMA 4R9WA 1F2YA 4PMCA 4QGUA 2HIXA 3N1XC 3HS0C 1N33Q 1EYDA 2BS4B 1EM7A 3NSWA 2WXOA 2HDEA 4FJZA 4NW2A 1LT6D 4DXFA 5BR8L 4GLXA 1OQYA 3M95A 2WXLA 3JSVB 3HM6X 1FVIA 4HDQA 2W3SA 1XPUA 4HCPB 2JXXA 2LXCA 1LTLA 1T0SC 4G7HC 2PLPA 3OSOA 2BQQA 2KJ6A 5CORA 1E8WA 3C2PA 2DYBA 3MP9A 3HZXA 2FMCA 4BY1H 4A3GH 3NZ3A 3L08A 1X3PA 3TCAA 1YEZA 2IHEA 4LNKA 2K5WA 3VYRA 4LUVA 4URKA 2H5XA 1ESRA 2CHBD 4N9TA 4HJGE 2CCZA 5KHOA 4OHJA 1EWYC 1YNXA 1Q1EA 3WCQA 1AEXA 1ZYRD 4EZLA 2O6VD 3VH3B 4AUQC 1YNNC 1C4PA 5KGUA 2NMQA 3AEFB 4MSQB 4DK5A 4W9FA 2M17A 3ZJYC 3GTKH 1QLBB 2W3RA 2CWPA 3D4RA 5M3MB 2DBYA 4FULA 1D3ZA 4ANUA 3S1MB 2VQFQ 1RDPD 3JVZX 2FCSA 2PW7A 2W9NA 2AX5A 3M3JA 3Q3OC 3SK6A 3FKIB 1R4NB 1LTGD 2MX2A 3DEOA 2F0PA 1FRDA 3U9SA 1V1OA 2K50A 4LWCA 4IFDH 1T9HA 4HJAA 1WM2A 2H1EA 4GOPC 4BOSC 4DV1L 4GKKL 2MGSA 4U68A 2UUCL 2N9EB 2NVUI 2E5LQ 1PUTA 4X3TA 1LM8B 2KK8A 3J7AV 5LMUL 4F7XA 4DN4M 2K4KA 3ZIMA 1N34Q 1HPCA 3E9IA 1L4ZB 2EYFA 1O7ZA 2EKIA 4IM0A 2NN6H 2DUDA 5JEAJ 4G7ZC 4F88A 3VRBB 3MXNA 2JZ3B 3OOCA 5GQOA 1YNTE 1XNRQ 1GHKA 2B39A 2KMCA 2N78A 1HA6A 3PLVA 2FUG1 2WXQA 1OTCA 3PPAA 1A3VA 3IRBA 2LFNA 2K39A 3MXNB 2IJ0A 2INDC 1JWAD 2PNRC 4FF2A 1WTVA 1VQ8A 2M8SA 1SGHA 3NZSA 2EY6A 3A5ZB 4Q5VA 4OVVA 2I1JA 2AMCB 5G3LF 2IX1A 1ZOYB 3A5UA 1L7YA 4OW0A 4NPNA 1PV4A 1Y1VB 3ML8A 4BKSA 4ZLTF 4C3JB 3PTFC 2EELA 2GBMA 1SE2A 5CC4A 3AB9A 2MBBB 4WAFA 4TMAB 2B29A 2KJXA 2OWOA 2A6HD 2Q8IB 3MEHA 4A3EB 1TTNA 2VB2X 2JZZA 1PLFA 1YVCA 4EX5A 5BN5A 3B1LX 4HRSA 4HPLB 2K5HA 3H94A 1NY4A 1E7PB 5IA7A 1UE1A 1P98A 3NRZA 1MSGA 4QUFA 2D9UA 4C00A 1TWFB 4DV4Q 2Q2TA 4BBSH 1VQDA 1YHQA 4IURA 1GUWA 3ND9A 1P0RA 2K6QA 1Q3LA 1XQQA 2DHZA 3OHXC 2QCZA 2CQAA 5D3DA 2C5CA 2WB1B 4JG2A 3I9V1 1VMPA 4C4VA 2B63G 3MJWA 3GTQH 3KUCB 3S15B 1C4AA 3HIZA 4DR2L 4HCNB 2A1AA 3CAMA 1ONLA 3LB8C 4DUYL 5LXHA 3HOWB 4HJ8A 3GV6A 4HXDA 4DHZE 3VYSA 3LDZE 1DOXA 3J81L 4C7YA 5H1SE 3S9WA 4MM3B 4HEA1 4N9PA 4WJQA 2SEBD 1WTOA 1EIYB 3S1QB 1PDXA 2EPBA 1H9JA 3N3KB 2I07B 1FXIA 1JOOA 4HMJA 1WR6E 2FBWB 2ZTCA 1ENAA 5C3EB 4A3IG 2KDEB 3C19A 4V0BA 3D3RA 4FJVB 1K8GA 3SHQA 2RDHA 1J7AA 3E56A 1TS4A 4DV7Q 3DMUA 3D4DA 4JI7L 1RTOA 3CSTA 1BCPC 3OJ4B 2JA9A 1MG8A 4LTUA 1TT5B 5C4XB 2MO1A 3T13A 5GAEC 2JA8H 2V3SA 3CMMB 4KKJA 3U7DA 3MC0B 1HR0W 1HTQA 5CBAE 5CHWA 5I6WA 2L76A 1CZWA 2WU5B 4MT5A 1WJNA 1E1OA 3CRLC 3F2UA 1W3SA 2MSED 2CHZA 1TKWB 2Q5WD 2L5TA 4A3MG 2I38A 3FEWX 3DBLI 1QE6A 2P5ZX 2PPHA 2ZCBA 3W1SC 3AEDB 4B3SQ 1F2ZA 4BBRG 1Y1WG 1Y8NB 3PO2B 5ELOA 3HKSA 2KQSA 3AYHB 3HOVH 1G51A 5ELBA 5GMVA 1VQNA 2JZPA 3R7QA 1CHQD 3M3YH 4R8NA 4JI1L 3BK1A 2OEDA 2A69D 2K7VA 3DBLB 4YCVA 4AQYQ 1L6UA 4P72A 3DCGA 1K83H 2DNEA 1FJGQ 1FFVA 1VQ6A 1CFMA 2EYOA 4JI0Q 2K14A 1BMLC 3S17H 1P7EA 2OQ0A 2N7EA 5L37A 4POFA 2MHJA 2YLMA 1SMYD 4PYUA 1BT0A 5HFYA 2BWFA 2HCIA 1KDBA 2DZMA 3ECIA 4KSLC 3NVYA 3ENEA 2N88A 1YX5B 2UUBL 5KNCA 1X54A 1CKNA 2B2YA 2ALYB 1WD1A 4TQUS 1JB7A 3RNCC 3O13A 4ULLA 4PS7A 1CKOA 2DWQA 1I3QH 2KXJA 3DQVA 1IW7C 5DM73 2IYDB 1CJEA 3QR8A 1CKNB 1R7SA 4IJHA 2KDMA 3U8ZA 3N20C 5FLXc 1RCVD 1EF5A 1HXYD 3U52E 4BWGB 2NVXB 4HIKA 2F0UA 2N0SB 3AM9A 3EN2A 3NEMA 2BYVE 2V9HA 1HQMC 2EY5A 4LLGM 1QILA 4OZCA 1WYDA 1I6VC 4C3IB 1C78A 1F9SA 3MAQA 2Z4IA 1WD0A 3Q8AA 2I2YA 2VXWA 1VR9A 2L0CA 1YD8U 1TBEA 3H8HA 2IX0A 1X3QA 2Z59B 1N5XA 4LDTB 4YHHL 3DEPA 4R4CA 4LF9Q 1JALA 2PYKA 1SYDA 3F2CA 3G71A 4LF8L 1WXQA 2LRWA 2ZT9C 3KVFB 4DV5L 4FBJB 3DVGY 3Q8EA 4M0WA 4IOIE 4IUVA 4S3SA 3HOXG 5LMNQ 2A5HA 2KTRA 3OPOA 3LWEA 4KKSA 1SSOA 4QUCA 2HHHL 3OWEB 4ZRQA 3S2AA 1JCKB 4A3LH 3V3XA 2DYMA 4K3BA 4M0WB 4K81A 3ZJTA 3BU2A 3WWVA 4HIDA 1J7BA 2M56B 4KHPQ 2KTRB 3PF5A 2WLBA 3M63B 4OVUA 3PT2B 1D5MC 3S1RB 4ZRKA 1OQQA 1A6XA 3CF5A 1OXUA 1J5EQ 1SSNA 4A3DH 2KWVB 1BR9A 3K0YA 2L1BA 3NQTA 5JEAG 1A5RA 4AIMA 2KLCA 4A3CH 1SEBD 4YSZB 5J18A 3TS2A 1QCBD 1UWVA 1EU3A 3LX0A 3RD4A 2PW9A 2RD0A 3B0AA 2RVLA 3I4MB 3BWUD 2NVTH 4JI6L 1Q1OA 2VS1A 2K52A 2LGIA 2CQOA 1S5FD 3PHXB 4DXGA 1P7FA 4CJ0B 4OEMB 1ZW7A 1VS0A 4A3BG 2AL6A 4CYEA 1PYWD 1YN4A 1EIFA 3VUXA 5IP9H 4GN5A 1LT5D 1D1IA 4ZKCB 2AQ1B 3J80E 1I35A 4F7ZA 2QEXA 2UU9L 3DPDA 3IVFA 2JK8A 1FXTB 2HIVA 1K8RB 3ONSA 2ZNVB 4JLCA 4KV2A 4L5TA 3HVZA 4B9KA 2J4XA 4B3RL 2LGSA 3DBHI 2XWBB 3CQZB 2ZTDA 5FLMG 1TGZB 4LNNA 3U4ZA 4LF6L 4UAIA 1YQBA 2QDLA 3KH0A 4DQOC 2KBNA 2BCOA 1GB4A 3ML9A 4FADA 4DPGA 2EXDA 3HOUG 1CMXB 2LGDA 1FR3A 2MQHA 5TSSA 4NAWA 5BN4A 2B3AA 1VQAA 2LVPA 3SDLC 3T53B 3PCOB 2N7DA 4KV6A 5I6YA 2IO2B 4NDXA 1JMLA 2KFKA 4YTNB 4DKAC 1SIFA 1KLGD 4NAWB 2R7ZG 5C3JB 1CA5A 3J80L 3I2ZA 3X0WA 3AH7A 1YBYA 1FNWA 4OELB 1Y69U 2R92G 3VR4A 5I2XA 1P8LA 2F52A 3CC4A 3ETRA 1C9OA 2HQEA 3ZQ4A 4QCLA 3QK0A 2NYZD 4G0NB 4NPSA 3KLSA 3RZOH 3U9OA 2J53A 1JOKA 3JYUA 4MH8A 1GNUA 4IFDI 1F2RI 5C2TB 4KSKC 2ZM6L 2FAZA 2MW5A 2Y0SB 2JQRB 3KF8A 1IUEA 5EJWA 4KD4A 2V3NA 2MP2A 3GTMB 3W5OA 1XX8A 2KEEA 1QZHA 4CDFC 2YEPB 4K1RB 4A20A 1MI2A 3P4SB 3EA6A 3ZGZA 4WJ3M 5LHY1 1WR1A 4NP5A 1QNKA 2NN6I 1Q46A 3KF8B 4YWKA 2PCFB 1Q90A 2MP2B 4RMFA 2JE6I 1B8AA 2Z4HA 2X8XX 3QJYA 3AN1A 1WCMG 4HJ9A 4KGSA 1XYIA 4HJKA 4GDLB 4DR1L 2Z6KA 3LGJA 4X65Q 2VQEL 4HJ5A 1M94A 4JI3L 4XGAB 2Z8LA 1UGMA 1CTMA 1KRTA 2RHSB 2X38A 1BO0A 1WXMA 4DR7L 1WZ3A 1H8CA 3J7ZC 3H6NA 1U4MA 3F8TA 2O2LD 5M3MH 3RZDB 4WJPA 3I70A 3TQYA 3S1MH 3E3XA 5K36G 1J9OA 5E7NA 1FD7D 4RGOS 3KUDB 3PUVA 3FKIH 2OHFA 2GN5A 3PSEB 3RCZA 4DR3L 2MA9B 1PA6A 3KLWA 2F0SA 4LMQD 4JIOU 4K2LA 5IGGA 2X6LA 4IQZA 4A3JB 1G6JA 1SYGA 3J80i 5GAGC 2E2IB 2JSVX 2KEDA 2VUMG 2YEPF 4P1BC 1XCTL 4UHVA 1GUOA 5FKAC 3Q8FA 1X55A 4ZRPA 1A8VA 1PZKD 1LUZA 1ASZA 1GUTA 2QHOA 2KX0A 5AZFA 4ACFA 3PO3B 1BQQT 1IHZA 2OT2A 2TMPA 4OO1G 2JVCA 5GXGB 4DDID 4LAAA 1WFYA 5AJ3Q 4WWNA 1ILPA 4JYAL 2MH7A 2E74C 1SAPA 4RKBA 5IOCA 4EOYA 2LI5A 1KAAA 1YIWA 1LT3D 3AQQA 1S5ED 1NDDA 2K8CA 3VYTA 1SNCA 2KWUB 1V5TA 1C4QA 4UPAA 1Z47A 2BH2A 4EQOA 3QIJA 3OTOL 1QT9A 1VQ5A 2BA1A 4ZCKA 1EYCA 4BAXA 2MJDA 3A4RA 4KK7A 3IHPC 4A55A 1UH6A 1Y1VH 3FRPB 1H95A 1AH9A 5AZHA 5IY0A 4C3JH 1EY9A 4RF1A 4ZRIA 4KKUA 3VR5A 5DNFA 4LFBL 2MLBA 2W54A 1VF5C 2Q8RE 4DK1A 4LFCQ 4EFOA 1KNEA 2ZTEA 3TBIB 2HE7A 2K01A 2K05A 4A3EH 4TQ0A 4RCNA 2ENBA 1YIJA 5G3LD 1QQRA 2NZOA 2H4OA 5E4WC 3RLOA 2NVYB 4CJ2C 3AEBB 3EC8A 2HDLA 1FL0A 1TWFH 2D62A 2KENA 5IODA 3T1HL 2Q2HA 3ZJVA 3CF6E 2DX5B 3APDA 1J0GA 5FR3A 3A9JA 1T0QC 2KCMA 1I7HA 4FXKC 3P75A 3S15H 3E5SA 1JJGA 2PZWA 3PLUA 2KQ4X 3KDFA 1NJIC 2VW9A 1ZXHA 5C4HA 1Y56A 1XPRA 3PRPB 2R2OA 3QJZA 2K75A 3HOWH 3A9JB 4PS3A 2LKVA 1WF9A 1N33L 1LQBA 3ZNGC 4DAMA 2AEHA 4OZBA 3KDFB 1X9NA 4Y7NB 3Q69A 4ZRZA 4TQ1A 4FF1A 4OWXB 5BYRA 3U4EG 4TVAB 3APFA 2M9VA 3AFPA 1RD9D 3W5VB 3S1QH 2CS4A 4YIJA 3ZDMC 1OQRA 1HH2P 5C3EH 4MZ9A 2OEOA 1Q10A 1K3BC 3HUIA 3M4OB 2HUGA 2KHIA 1WX9A 1E1TA 2A73B 5CGKA 2TSSA 3B08A 2PQAA 3ND8A 4QIWE 1YN5A 2ZXPA 5C4XH 5FOBB 1FM0D 4IUMB 3JAME 3PUXA 3AEVA 4X62Q 3MFYA 1PXUA 3K7UC 4BKSD 1D8LA 1CI3M 1ZUD2 1NI3A 3MHBA 1SXTA 2PQAB 1UUPA 2BE5D 1YJ9A 3CMEA 4L23A 2L9HA 4HKQA 5IT9E 3P7JA 1GJZA 4OIJA 3SHLA 4FYDA 3PO2H 1Y8OB 2NN6G 4PYZA 1Q7YC 2KOLA 4J8QA 4Q2JA 4J15A 4A4IA 1EWIA 3ITPA 5CBEE 1PH8A 3SE0A 4RAUC 1B4OA 3PV0A 3GO5A 2VQFL 1ZDXA 1C1YB 3NY5A 2UXBQ 2IO1B 1B2TA 2LMCA 1UWXA 3MXPA 4GOPA 1O7IA 2CR5A 3SR6A 5I9OA 2F3IA 4F1SA 3URYA 2A6ED 3Q3FA 4JGHB 2XWJB 5J1ZA 3TDQA 1IBMQ 3KQ4A 2E5LL 5CTRC 4GZYC 1DCZA 1NR2A 2LMCB 4QL5A 4GOPB 1N34L 3C46A 3PRMB 1SYFA 4KGRA 1LM0A 4H7BA 4RM8A 1J8IA 4ARIA 3MA2B 1KABA 2A6HC 2C7MB 2IL8A 1LT4D 3EBEA 4DAYA 1K9MC 5I2YA 3QIAA 3NXWA 1XNRL 4ZQ3A 3LXFA 3I4NB 2B2TC 1V8CA 3U7ZA 2LGXA 3MTSA 1UELA 1VCIA 4LK0M 4F8CB 1KRHA 1K8AC 4O42A 3Q3MC 5CYUA 1Q8KA 3J7YW 4CQNA 3ZDTA 3NBIA 2RQXA 2NVXH 4L6TB 3NWSA 2N4FA 5IGEA 2ZW1A 4C3IH 1OTRB 1ILQA 3M7NA 3DBRB 1GD7A 4X3UA 4KHZA 1LO5D 5KEEA 2WHIA 1DYQA 2K8HA 4NJ7A 2PQEA 3DHQA 4JC0A 3DVNU 3BK2A 5KRUA 4PQXA 2KFJA 4KKIA 1EYAA 2B76B 4IM3A 2XN9C 1K52A 1HR0Q 1DONA 4M00A 2Y5PA 4L63B 3CW2C 3HGBA 2Z9HA 1A3UA 3BS1A 4HIMA 2KC2A 4W9JA 1MHWC 2V4LA 2JA7B 5E6OA 4S17A 1H9SB 2RBMA 2JN4A 2DNCA 3NWTA 5HURA 1HZ9A 2WAQG 3A8KE 1M1KC 1YJIA 4GLAC 4DV4L 1NBFC 3AB5A 4C3HB 2KT7A 2N9LA 4JBJA 1EO6A 3ALBA 1V5OA 3BDCA 3AE1B 4NJCA 1N6ZA 3P20A 3S1RH 1TZOA 1PYBA 2R2QA 3STBD 2LGYA 5C4JB 3FC4A 4IWQA 1WJJA 5DAUA 5IWAQ 4FF4A 2KC1A 2ZCCA 1KTKA 1MVKA 1XJVA 2JA8G 4I7ZC 4A93B 3ONAB 2XEWA 2NUCA 3DWGC 1HQRD 1TY2A 1NYQA 3L3OC 2KANA 3UI3A 5D7GA 4KKTA 4QJFA 5JHAA 1SYBA 1X6OA 4HIOA 3TBLD 3I4MH 3QARA 4GU2A 1OFFA 2N49A 5CR3A 3UDXA 3OWFA 4A3KB 1L0WA 3AULA 3K80C 1JC7A 1R4MB 1XLPA 1WZ0A 3HOVG 3LNNA 4JX1C 3V61A 2ZXOA 4R8IA 4LDTD 4DV7L 5T8IA 4QMGA 2ID0A 4N8X1 1N62A 3BIID 2AWOA 1KNAA 4DNIA 2GBKA 4B3TQ 2GVAA 2CFMA 5C3XA 3GTGB 1VZ7A 1BCPB 1LLRD 4AWJA 4TV3A 4UP8A 5BMHA 2XVSA 1N5WA 3UDGA 2NBUA 3NJTA 4YWLA 3CQZH 3T4AC 4DFAA 1V80A 3NVZA 3W1SA 5DLQE 2MJEA 1HZBA 4B3SL 1G2SA 5IIFA 4RMAA 2L4NA 2F0HA 3RFZB 2CKHB 3A8IE 2K8BA 1PVOA 3LYYA 1XNQQ 1G8ZD 2Y0SE 4OXPA 1WX8A 3PRZA 4GSWA 2SDFA 2HT1A 1GAQB 1SB3C 1PYSB 1J8CA 3E6ZX 1WI0A 1SE8A 3M4QA 1JWSD 2MJ8A 4AQYL 2H89B 4ZRJA 5EKLA 1Q1BA 5M3FB 1FJGL 4DAPA 2KO3A 4JI0L 1NEKB 4II2B 5TR5A 1LV9A 3CWIA 2D3BA 3WAPA 1T0YA 1NSNS 2YVCA 1RTNA 1Q82C 1PH2A 2FXQA 3JW0X 5HG2A 4ZHOA 2F0FA 5EQ0A 3PMFA 1R4NI 2A4ZA 4HTHA 4A3IB 2DAFA 3M62B 1EY4A 5KIXA 2F0KA 4FXGC 1E0ZA 1YHBA 1TWGB 3CD6A 1IBKQ 4XT3B 2K5PA 2CH4W 2K04A 3ZTCA 1A70A 3QC8B 4HMIA 4ME3A 3U50C 3GTMH 1KRSA 2M2LA 4IDIA 3GDEA 3H7PA 4A3LG 1AARA 2DN8A 2I46A 2IX3A 2EYLA 3LJ3A 3RT3B 2BDOA 2M0XA 2A74C 3HFZB 4B0MA 2BDNA 1K0SA 1UE5A 4PV1C 5C3WA 2RDBC 1GUAB 4ICUA 3CKIB 3FHWA 3GTOB 4WWOA 4G7OC 1Z9FA 2UWQA 3I7FA 2PO4A 4IUUA 4IOAA 2VRRB 3H7PB 4M8MA 3H0GB 4A3DG 3UE1A 4LNFA 2E76C 1F52A 4IM2A 3UI2A 4UDUC 2PW5A 1C76A 2KCCA 4LF9L 4ALPA 1V6EA 4A3CG 4L5QA 3PF4A 2BS2B 2CW0C 1V1QA 4V190 1J6QA 3RR5A 2PTLA 3Q8BA 3RZDH 2IY1B 5LMNL 2E3TA 2GI9A 1A0IA 3VUWA 1DGSA 4R4QA 1T6BX 3FDTA 3EQLC 2FIFA 4NMZA 1AZQA 4L5RC 2JPHA 1SF0A 3IAS1 1QZGA 4A3JH 1K8MA 1TWAB 5HGTA 1T5XD 1ZKHA 3SD5A 3OIPA 3H3VC 1OXSC 2E2IH 1EFWA 3PUZA 2KKCA 1WXVA 3W1BA 1RLFA 1J5EL 4WJWA 3OG5A 5IP9G 3CMAA 3I73A 1WYGA 5C23A 5BO4B 1E9MA 1RF2D 4W9DA 2PIAA 3JC66 3PO3H 3TEYA 4MNOA 1SMXA 2ZEQA 3KWVA 1IP9A 4JI8Q 2NVQB 3T1YQ 1HFNA 1NMFA 4JWUC 5C1ZA 1YITA 3EHVA 2CHWA 5NUCA 1VQ4A 2J7ZA 1H9KA 1GG3A 2L83A 4A75A 1KDCA 1KLUD 1SE4A 2L11A 4AH6A 2EZVA 2JUOA 1R4PB 4WJOA 1DOMA 4KI0A 3D4WA 4L1BA 1FD6A 3R3OA 3AE8B 4EQ5A 4YT0B 3SVMA 1YX6B 2A68D 1KAWA 1X32A 3TN2A 3T56B 4EGVA 3SXHA 3D8GA 2IO0B 3H7SA 1GVPA 4HK2A 4X57B 4BZAA 1PTOC 1HEZE 1V81A 5FLXE 1WIAA 2KWDA 5EGTA 2JRIB 3AE4B 2GBJA 1X65A 1H4RA 3L9AX 2FJ2A 2L55A 3RZFA 4EUTA 1FMAD 1NR4A 4DHJB 1OXVA 2DJFC 3IKJA 2SAKA 3TP7A 4C4VB 1IXRA 3B9JA 5FO7B 2WDRB 4AYBG 1V2YA 4I6NB 1BUVT 5C4ZA 2RHQB 3EJIA 4XWTA 1I42A 2NVYH 4YTPB 5D6JB 1CKMA 3L13A 1XF5L 1BBWA 2MFIA 5C6AA 1DZ1A 1KJTA 2SOBA 2LUMA 4A3FB 3NVVA 4C7ZA 3VQIA 4XQJA 3VR2A 1FIQA 1M4VA 4E6IA 1C79A 1KFYB 2N3SA 2R3ZA 1V1PA 1TVXA 1T3QA 4N6EB 5J2RA 3RN2A 2L52A 4LFAQ 3AE7B 1B7YB 2LSSA 4LNIA 3A74A 3I8ZA 3UDFA 1JWBD 5EE9A 2HQLA 3ZVVA 2IDYA 2QCPX 1V1PB 1WGKA 2IHFA 4JPSA 1GOZA 2A19A 2JYOA 1EQVA 3FPPA 3HRZC 4HCSA 2W82A 2WXHA 3MC9A 4Y7NH 4GXBA 1QVGA 5D2MB 3SK5A 2XSCA 4LJPB 2DLBA 5J22A 3KLSX 1Q81C 4JBWA 3J9CA 1STAA 3RZWC 1I4RA 3I5JC 1WJ6A 4CHKA 1K28A 4OZAA 1VF7A 3M4OH 5M5XB 1WXSA 2C9WB 1VDVA 3VXWA 2BTEA 4QIWB 1YJ1A 4IUNA 1YJWA 4RA8A 3FKIG 3AMUA 3QAQA 4FO2A 4LNQA 3OLMD 4KX6B 4OGQC 1JRPA 1TIFA 4I65A 5J39A 3OYYA 3K6OA 2UU7A 3A4SC 1AE3A 2QSDA 4IPCA 3AU7A 3FAHA 1VJKA 4ZOHC 4GKJQ 2E8GA 2QGQA 3PIO3 2JYEA 3OW2A 3PUYA 3UGBB 1JICA 1I6HB 4ZAIA 1VQKA 1U4AA 3E0EA 1KIXA 3VDZA 4X65L 3E0JA 3VR3A 3HOUB 2YTVA 3VTUA 4TRDA 1WGHA 4B0EA 2FUHB 3RPFC 3NENA 1K0RA 4TSSA 3RLFA 2K1FA 3E9HA 4BY7B 1D6EC 2V4DA 3L7ZC 1VD2A 2ZVOA 2R7ZB 1KHIA 4QB4A 3HOZG 2IBIB 3DDCB 5ELFA 3P1MA 1IZ6A 1SNPA 3FPUB 2F4VQ 2R92B 2WS3B 3VR9B 2AHOB 4HCEA 4WJNA 4RKLA 2C5LC 2QF7A 2F0JA 1TWCB 4JE3B 3KFUA 5IGFA 4ID6A 5IYBG 4KN4C 3D6WA 4K7UA 3J81c 4NNJB 2JXMB 2Y3AA 2BYEA 1Q8IA 1A62A 1Y1VG 5G55A 1VQGA 4ARCA 4KHVA 4C3JG 5JJLA 2WKCA 4XYOA 2F0GA 5ELDA 3ZKJC 1WSPA 3DWMA 1E8ZA 1ENCA 5EAYA 3I4NH 3ULJA 3W1GA 5AJ3L 1KQSA 4A3EG 3BVMA 2LHDA 4WQMA 4BKTA 2QEJC 1Z6HA 2F0DA 3VYUA 3EUB2 4W9CA 2IW3A 2DNFA 1SROA 3TJPA 2EIFA 1MGSA 1VLBA 3GP7A 3CCRA 4PT5A 4K5WA 3U4VA 3K57A 1A3TA 3IBEA 1YJJA 5E6JA 4LK1C 4A3OA 3DWPA 3L10B 3J7A5 1EZ8A 1V9JA 4R3DA 3KOJA 3KUPA 2K03A 2WB1G 2BPSA 3L17A 3RN5A 3NHHA 1IBXA 1XLNA 3BZCA 3S1NB 5C0XI 3H9DA 4KDLB 2JU6X 2NPTA 3P4PB 4XTCS 2KOXA 3P2BA 1XO3A 4YCUA 3MC8A 1YNJC 2BB6A 1VQOA 3HOWG 4LFCL 3TZDA 1IBXB 1YNND 4CKCA 4N58A 2Y5BB 2Q2IA 3DM3A 2OTLA 3QOJA 4DR6Q 2NPTB 4YWGG 5IKCM 2AUJD 3VH4B 2G45B 4NXMQ 3DHHC 2MQJA 2JA7H 3A8JE 1TS5A 2JA6H 1PH5A 1LTSD 5KNDA 4LW1A 4JI2Q 4XX5A 2WXIA 2ZW0A 3MXUA 4IC7B 2C7NB 4TUUA 1EY8A 1TKYA 4KLKA 4C3HH 1T0RC 5JHBA 4FHJA 5C3EG 3K9OB 2K5VA 3N30A 4BKGA 3P42A 3EFCA 3A54A 5C4JH 2N1WA 1OEYA 1TKGA 4WJ4A 3QHTA 1A63A 5DPSA 4JPBW 5EPKA 3HOYB 2F3WA 2UYZB 3KYCD 2WIIB 3R2TA 5C4XG 1OXXK 2MNAA 4A93H 2JA5B 2G1EA 3NOBA 4IFDJ 4YY3Q 4C56C 5G2NA 1I4PA 4WH4A 2VH2A 5BYSA 2JXTA 1LABA 3PZ7A 2BOSA 1FGUA 4TKNA 1HUMA 2F3VA 4IZ8A 1XMOQ 2NBWB 4Z9CB 4HJ7A 2OJWA 2IT1A 1Q0WB 3WAMA 1ASYA 4WURA 1JWMD 4A3KH 2E2JB 1YMHE 3SFDB 3PO2G 1W6JA 3QB3A 1QVCA 3Q6SA 3A56A 3L2PA 3H1UA 2RKSA 1WYWB 1BNZA 5GAHC 1EYGA 5H8YE 2I1KA 1PRTC 1JQYD 2A6EC 2N9XA 3AE2B 3QO2A 4KGTA 1HA5A 3QA8A 3GTGH 4X62L 2XNAC 1RL2A 2KFKB 5T1IA 4ME5A 3Q23A 2HTME 4UP7A 3EGRA 4DV0Q 3T8MA 5IOIA 1N60A 1UEAB 1VQHA 5IN7A 1E7ZA 2G9DA 5C44G 2XTIA 5I9PA 2XK5A 4GMVA 1OO9B 3IAM1 2D07B 2M1MA 4HEDA 1EY7A 1V9PA 1D5ZC 4B9XA 1RYJA 1IYUA 4MGYE 2B2VC 4GN3B 3TMPB 4MACA 1M8AA 2UXBL 2XK5B 3AEEB 1U4PA 5FJ8H 1U4LA 3H3VH 5G5GA 2LY7A 1CZGA 2MRPA 4ZHPA 4ICVA 3I3TB 4LF5Q 3N1ZC 4MEMA 2ON8A 5M3FH 1PH6A 2HTHA 1F2LA 2SNSA 3VA7A 1IBML 4PK1A 1JORA 1AP0A 1E10A 3BZDB 4LUOA 1KH0A 3X3NA 2MJ3A 3MZ5A 1HUNA 5J17A 1L4DB 3D32A 3L16A 2NZHA 2OXPA 3CC7A 2Z0SA 4DR5Q 4A3IH 4WQOB 1WE7A 3ZTDA 3V96A 2B2TA 1MI0A 1TWGH 2WXNA 1YOVB 4K7WA 2VY3A 1NE3A 5CV6A 3DM1A 5IGBA 1I94Q 3S2HB 4EZJA 2EYPA 1E0BA 1J19A 2R93B 1CK1A 4UY8C 1I4GA 4I7AA 2MBOA 3AE9B 1BCPD 3HKZB 4CDEC 1PFDA 1JJCB 1Q12A 5LL6X 1PGXA 2F0TA 5JPNC 1AYFA 2EJMA 1V49A 3B2FA 2QDBA 2DZJA 3ULPA 4IKGA 3GTOH 1STYA 1Q86C 4XQQA 1KM7A 2IWHA 1MHXA 1NVID 1P1AA 4MGZE 2PZTA 3NUHB 5AFWA 3H0GH 2DJGC 2F0OA 2WXFA 2RDFA 4W9IA 3AEGB 1HZAA 3CCSA 2L15A 2L05A 4US9A 4G3XB 4M02A 2KD0A 1HR0L 1HCZA 2B2WC 4X3KA 1L2NA 5D65A 5KYLA 4A90A 1PH3A 3PZ8A 3DWQA 2GMIC 1ACCA 1B9RA 3I4MG 4P7IA 3V6EB 3DWAA 5D3IB 3J80c 2D3CA 3GE3C 5E6NA 1TWAH 1PMRA 2J52A 4K2KA 2PJHA 3A7LA 3K81C 1IKLA 3NZUA 1CSQA 5M5WB 3SGIA 1XD3B 1FO4A 1L0XB 3ERSX 4RHRA 3GTPB 1HNXQ 4A8XC 1GB1A 4NB3A 3TEZA 1F9PA 5IWAL 1FCCC 3CC2A 3AE5B 5CV4A 4JCVE 4RWSC 3PS6A 1P16A 5EPJA 3TP5A 3GTJB 5CV5A 2NVQH 3IT4B 1SNQA 1F77A 3NHEB 2FINB 3CU7A 1IKMA 1IW7D 2G3QB 2KMMA 4FXCA 4P71A 1EUVB 3Q3JA 5ELNA 1E24A 3Q2AC 1FNUA 3R3MA 5DM63 5IP4D 4KJOA 1CA6A 3BVZA 3TUOA 2B8GA 4CHTB 3P1HA 3H09A 1N36Q 2L0TA 1V43A 1WM3A 2C35B 3V60A 3GS2A 4RF0A 3RNUA 5ELEA 2R6GA 5A2QE 3X23A 1DM0B 4USAA 1AFPA 1MBYA 3EIVA 2V3PA 4RHSA 1G6ZA 4MELA 4BY1G 4A3GG 2ASBA 1EWCA 1L2FA 3ER0A 3NTHA 4B3TL 4K0KQ 2ONQA 2VB3X 1BXTA 2CHXA 2WXRA 3QCAA 3GTLB 2EMTA 1ZYRC 1D1KA 1U5KA 4O0AA 5FK9C 4DV6Q 1HZ5A 3R7RA 1PGAA 3MXGA 1AZPA 3IFDA 2PMZE 1Q5WB 2HJ1A 1E2ZA 4DV2Q 4A9AA 4FF3A 2PE9A 1BVSA 4A3FH 1AE2A 3K5LA 2ZPYA 2ZJRA 1EEID 1O80A 1XNQL 1X3FA 5M9OA 1E2VA 1PDQA 3TEXA 3Q3NC 4HDOA 1S5BD 5JVH3 1S5DD 3K5OA 4X6AH 1L0VB 1QOGA 4HAEA 3M4YA 1CQVA 4KY6A 2R7FA 4IFDG 5LMNW 2FNJB 2FFKB 2L32A 2VZKB 3P63A 1CZPA 2YTYA 1ZE3D 2KDIA 1ESFA 2BW2A 3CCLA 1HNZQ 1GKHA 5C5MA 3VDYA 2R7DA 5BN3A 3DVGX 2DY8A 3ERQA 1WJUA 1TKEA 1WGDA 3BJUA 4J1MA 3AFQA 3VHTC 4US8A 1S3SG 4ZYNA 3KJOA 3GQBA 4RGMA 4IUQA 4RFBA 1IBLQ 1IBKL 4RNAA 2RPVA 1IYJB 1ZGUB 2KACA 5M5XH 5JZEB 2DY7A 3L4PA 3CCEA 2IO3B 1L5PA 1TZ1A 4DHJD 4ILWA 2KAJA 4CBVA 1WGRA 1S4ZA 1MPEA 4A3JG 1VMCA 1VCBA 4P74A 4I6PA 2D2CC 3IL8A 1VQLA 3CPFA 1C4CA 2NS5A 3T9LA 1TU2B 3JAML 3O65B 1QF6A 1HHVA 1LTAD 1YI2A 2EY1A 1I6HH 1EUJA 3W2DA 2JEAI 2NR2A 3GZNB 2G9HD 4LF7Q 3HOUH 1S5CD 5DPWA 2PNHA 4BBNC 3UE0A 1EWHA 3D6CA 5IT9L 4JW0A 3PO3G 5HKHA 1BF4A 2F1MA 4JV5Q 1F2RC 1WWTA 2LRUA 3F2DA 1EIHA 1F9RA 3DBRI 2CKZB 2ICIA 3NG0A 1V97A 1WTWA 4BY7H 1VQEA 4N9F4 1S1QB 2BBCA 3B6YA 2R7ZH 4DAYB 3BYTB 4K3CA 1WH3A 2AUKA 2R92H 2KECA 3RD2A 4RH6A 1BBXC 1PH1A 4BBSG 1TWCH 4H2AA 4K6DA 4QF4A 1QUQA 4GS3A 2I5MX 2BH8A 3E9SA 2VQEQ 1J7CA 1UD7A 3RMHA 1S72A 1SFOB 4DUZQ 1QVFA 2LS01 1C48A 1R9TB 1QOFA 2BB5A 1E90A 3BY4B 1TWHB 4W9KA 3ZNZB 4XIGS 3Q24A 3WOEA 2EYMA 1HNWQ 1QUQB 3QQ8B 2I5LX 3NK9A 4JI8L 3T1YL 4NY0A 5HI1A 2LXJA 2KNBA 2CH4A 2N55A 1DD2A 3P4RB 5ELCA 1WTPA 4BFRA 3S16B 3DLLA 5JPMC 1STNA 2BS3B 2DGYA 3NPPA 4DAVA 3TMEA 4IG7B 1LTBD 1II3A 4KD3A 4JI4Q 1VQPA 1VQFA 3AMZA 1K50A 2KMAA 3S1NH 1JOQA 3C8YA 3JAMi 1LFDA 5DCNA 1PTOB 2WACA 4JOIC 4ANWA 4IO9A 3HM3A 1XLOA 1EIGA 3A7AB 2UXDQ 2INPE 5IAAC 2JT4B 2KHSA 1R4MI 2JP1A 4JI5Q 2ACZB 5EE1A 4DV3Q 4NAMA 1NI2A 3DHIC 5CV8A 4GOCA 3A0JA 1F2MA 3K7AB 4WWPA 1NUCA 5JAVA 3SEBA 2E75C 5GROA 5C0XH 1B50A 2AYOB 1FPYA 1VQBA 2K6DB 4OONA 2WYQA 2IGHA 4K7SA 2GBRA 3MWYW 2L7RA 3CPWA 4U673 4XC2A 5I4DA 2K32A 1AWDA 2I0QA 4H44C 1L6VA 1GUGA 5HGQA 2OCEA 2A69C 2BYFA 2G5DA 2YYZA 2RA4A 1E7VA 1N32Q 1BOSA 2KQ3A 4C2MB 5EDSA 3BDLA 4LFBQ 3HOYH 4O2DA 2INNE 3CRKC 1SRUA 5BMIA 1EL0A 2HD5B 4LFAL 1CQFA 5C5LA 2LASA 3IG3A 3NS1A 3BG3A 1E8YA 1RIPA 2JA5H 4BVUC 1SMYC 5J3BA 2MHVA 1KOTA 2KCNA 4DR4Q 2L0FA 4XDDA 5COYA 4GDKA 1C0AA 5FR6A 2XGTA 4P75A 3QOLA 3RN9C 3C1FA 4QY7A 3IT6B 1EY5A 3I3CA 3T16A 4NXNQ 2CWAA 1RRBA 2K5DA 1YN3A 2F0VA 1CM9A 1PH4A 1QNUA 3S24A 2E2JH 2B8FA 4N8FA 2ZJPA 1XMQQ 1GC6A 3AE3B 4GDKB 1UGJA 3EVQA 4XDXA 2X69A 3I91A 4PNYA 2D5GA 4FJYA 2B63B 2UXCQ 4X66Q 4E71A 2CJOA 2PE6B 1TIID 3JSVA 3NBHA 3N6RA 4D2KA 3ZYYX 5A35A 1E22A 1HFGA 2GLSA 1STEA 5JJZA 2E2DC 3SU8X 5L95C 4MTNA 4ZUJA 4YCWA 4AYBB 4YXDB 2J0JA 4JL9A 5DPRA 3VTWA 4YWMA 4GKJL 4FN2A 1QWYA 3NBHB 1TXYA 1SR3A 3WA0A 1ZKOA 3DVNV 3RZOB 1DGJA 4B95A 3N1YC 4JK1C 2K0PA 2PKOA 2MBQA 4HLEA 1I50B 2PMVA 1BCPF 5AEKB 4BXXH 1RM6C 1KXLA 3KK7A 1RAXA 2WX0A 3I4NG 4YTMB 4GNXC 4A6QA 5EPLA 1TYGB 4IOCA 2OOBB 2EXZA 4IPDA 4R4OA 1IL8A 1B53A 3HEJA 3M85A 3UIOB 3H15A 4NQLB 1ENFA 2F4VL 1JWUD 2K22A 3BVGA 3N32A 3U2SC 3HKZE 4R1JA 4GLVB 4ZYSA 2QA4A 4C1NK 1B3QA 1EOVA 4A3MB 5HY6A 3B2GA 3T3NA 1NNXA 1ROEA 1C7YA 5LNK1 3Q0AA 2N9KA 3RLNA 4BBRB 1Y1WB 1LXDA 1HE8A 4LF4Q 5ISRA 2WXPA 3PV1A 4FHKA 2C9OA 4G50A 5CX3A 2R61A 4CKBA 2QJLA 4W9GA 3HHMA 4HVBA 4G4KA 2NTSA 2D3GA 3P4QB 5D94A 2PI2A 3S2HH 4H0LC 1SBBB 3DUZA 1C9FA 4IWPA 2R93H 3OIQA 2JA7G 2JA6G 3UDIA
chains in the Genus database with same CATH topology
3TEWA 3NQIA 2EVBA 1WTQA 4C3HG 3J7AF 4HR7B 3AEAB 4MIUA 1ZEQX 1ZPSA 1CT1D 5EE0A 1MHHE 1RFKA 2K3UA 1EOTA 1JB3A 2LFIA 4JWSC 1VRAB 3HOZB 4L2YA 2J42A 5HHDG 1UAPA 2Z1CA 4EE2A 2RSNA 4ZKBB 1B1ZA 2EOTA 2M00A 4EQPA 1A2UA 1HZ6A 1SNDA 2B2UC 3J81E 1JR0D 3T51B 3HOXB 2N7JA 4WORA 3H6MA 2V4IB 5FO9B 3Q22A 3S14B 3C1EA 3M7GA 1PFBA 3FMCA 3QG1A 3V2TA 1EY6A 3TP6A 2X6GA 2KVMA 3KBXA 5FLXL 5CMDA 1RODA 3GB1A 1H9RA 2IGDA 4XWWA 1WTRA 1PRTB 1EQTA 4K5VA 4BA1I 5IGDA 2W55A 2PMZB 1G2TA 1BUIC 3SDZA 4PMWA 4IUTA 2CU3A 4A3BB 4ODGA 2B2VA 3NTKA 4K6LA 2J0TD 3SK8A 1F0ZA 1STGA 1R4QB 2CJNA 1ZXIA 4DF7A 1I4QA 1KF6B 3IAYA 1LTID 3EFXD 1PRTF 3VR6A 1U4RA 4K5XA 2NBFA 4FNFA 5M5YB 2M0AA 1ICWA 2LEKA 1IGDA 5C0XJ 2FHTA 1PFMA 3W3AA 3PO0A 1D5XC 4P2CB 2WNMA 4CJ1B 1Z7TA 1PZID 5C44B 1G91A 4ZK9B 2V0GA 2B2WA 2EYJA 2ICEC 3K5MA 1EZ6A 1PGBA 4DNRB 2NB0A 3IXSA 4C80A 3KLRA 1DOKA 4DK0A 2VZKD 2F0LA 2L12A 1ZP0B 5FO8B 1IGCA 5BMGA 1EY0A 1IYVA 1WRIA 2K9XA 1E2WA 1WCMB 3C3LA 2AQ3B 2JX5A 2K6AA 1ZDVA 3TZUA 1TR5A 2AQ2B 2EJFC 4K8IA 5EBCA 3TSSA 2O5IC 4D2KA 2NZ1D 3HP3A 4WIPA 2QIEB 4XQNA 2WXJA 2WXKA 5DEHA 4WWMA 1F9QA 4OO1I 2JEBI 1GPXA 3VRAB 1SE3A 2F0NA 4L8JA 2YU9B 3FVQA 2VUMB 3HVDA 4NKLA 4FVMA 1XTCD 2RSOA 1XWEA 5F2DA 1XCQL 2E2HB 1PTOH 3S2DB 4K8JA 1QJOA 5E1FA 1WTXA 2BE5C 2CW0D 4DGZA 1DOLA 4WRDA 4DNTB 1N61A 1B9MA 1VDZA 3DXJC 3I4LA 4XDCA 1SDFA 3I72A 1NCVA 1NYRA 4OL7A 2JYTA 1G291 4EVOA 3W5UB 5K5PA 2HDMA 3GV3A 1SIJA 3BDOA 2KUMA 1XLQA 1XEEA 4OVZA 3W9CB 2HCCA 1MSHA 1QOAA 3NE5B 2MEKA 3PUWA 2MP1A 4BA2I 3NUCA 4MN3A 4J3OD 1ML0D 3WDNA 2VNUD 3ZJUA 1PZJD 2MPMA 3H91A 4G57A 2IGGA 3BYYB 1SNOA 3WOFA 1FYCA 4AQ7A 1PTOD 4BY1B 4A3GB 1D4BA 1D2BA 4KTAA 2DYOA 4EQNA 1KDAA 2LJIA 3CIRB 4XT1B 1QB5D 2EDGA 2WXMA 3G6JB 2F03A 2KN4A 1O7YA 1TS2A 4C3IG 2EE1A 3OW7A 5EKKA 5LL6S 1FXAA 1A2TA 2BYTA 4N59A 1B9NA 3GTKB 5H92C 1RJTA 1SNMA 1DOIA 2LHEA 3SR1A 2GRIA 1JROA 1RWSA 1B3AA 4IALA 2F0EA 1GHJA 1QG7A 3HRDD 4P6VF 1FFUA 4MHEA 1K53A 2B2YC 2NWGA 1TT2A 3NP8A 4B9WA 4X3SA 1SYEA 1DOYA 1W6KA 1SJHD 4DA2A 5CV7A 1O7LA 3CHBD 5C0XG 4AS1A 4YSXB 2XIWA 4Q0FA 1FNVA 3VR8B 4CKEA 1JQ4A 2QKIC 1HTPA 4TKOB 1BDOA 2K1BA 1AW7A 1CHPD 2PZUA 4KY7A 1YQ4B 5JXVA 2BA0A 1YQ3B 3D31A 5KYIA 2F4IA 3LWUA 4BBSB 1V8QA 3MJ5A 4K14A 3PIP3 1I4XA 3MHZA 3GTQB 1E6EB 2WDVB 1QKZA 1RHPA 5D14A 4WFN3 2AWNA 2K28A 1FRRA 4M8AA 2WP9B 4B08A 1EFID 1GXDC 2O5JC 1GJXA 4KJNA 1QOBA 2WAQB 5AUKA 2EYHA 2WINB 3RUZA 4OIKA 2PPBC 3EROA 3T3OA 5JOBA 2CVRA 1SYCA 1PFNA 1STHA 2NTTA 5KNBA 5JEAH 4YSYB 4ZUIA 2JA8B 1RKNA 5A2QL 2WQYB 3HG9A 1OXTA 2XRSD 1VZ8A 2JSOA 4RCOA 2GA4B 1YNJD 5T1GA 3OMCA 2WV6D 4C1NI 3N9YC 5MPOA 3SK4A 2O4XA 5E3FA 3K59A 3HOVB 1UNSA 3AE6B 2OF1A 3R93A 2WKDA 4BS9A 3GD7A 3M3YB 4NZLB 1WVLA 2F0QA 2WP8J 4J6HA 4HN7A 1K83B 5IGCA 1ET6A 4HSVA 1STBA 3S17B 4DU9A 2ZXRA 1I4HA 2F0IA 3I57A 1C8CA 1LTTD 4REZA 3NVWA 5EKIA 2BT6A 1I3QB 1GUNA 2F0WA 1K51A 3K58A 2Q8TA 4ITKA 3IFTA 5EBDA 1PRTD 2A68C 3FILA 3A55A 4M1UB 2QILA 2IPKD 4CGYB 1UWMA 1NENB 1VZ6A 2WU2B 3K5NA 5CV9A 3FILB 3VA5A 1FCLA 1NAPA 3R8BA 2PVGC 4RGNA 1SJED 1N63A 2EJGC 1JW9D 1XXGA 4KMUC 1LTRD 1Y8PB 3NTIA 4GLSC 3AV8A 3N52A 3V05A 1HRJA 1TJEA 2PVOD 2FMMA 4HSPA 1AN8A 3MVVA 1DXMA 1T5EA 2JWUA 4IN3A 3G7LA 4A3DB 3KWLA 1FGBD 1O78A 5BYQA 1U9RA 2K33A 3R2IA 2B2UA 2Y5CA 1ET9A 1H9SA 1K8OA 1L0YB 1TS3A 2XRQD 1TQOA 4XXEA 3QWNA 5JVG3 3OMGA 5K36H 2GB1A 4IUPA 2RDGA 4XYQA 4F87A 4H13C 2JA6B 3AECB 2NVTB 4O1NA 2L1AA 2D5DA 1HTLD 1C77A 4RGTA 3TP8A 3SFEB 1LACA 2SNMA 1QOHA 3KBGA 1MD2D 5G5HA 2WXGA 2F0MA 4XE0A 4ABNA 2K5QA 1B44D 4PMBA 3I90A 2KA7A 1GUSA 4LJZC 2EY2A 4OO1H 1FEHA 4KY5A 1JE4A 1A15A 2FE8A 2H88B 1TY0A 5AUIA 1ZXTA 5EE3A 4HKZE 3X3MA 1PTOF 4P16A 4FXDA 2M19A 2WDQB 1H9MA 1EU4A 4FP5D 1DJRD 2QMTA 4KN7C 2E6XA 3MFGA 5E4XA 1EEFD 4HROA 3ABVB 3Q8CA 4F8MA 2MUYA 2RMMA 4R9WA 1F2YA 4PMCA 3HS0C 2BS4B 1EYDA 1EM7A 3NSWA 2WXOA 2HDEA 4NW2A 1LT6D 4DXFA 2WXLA 2W3SA 4G7HC 2PLPA 3OSOA 5CORA 3C2PA 3MP9A 3HZXA 2FMCA 3NZ3A 1X3PA 2K5WA 3VYRA 1ESRA 2CHBD 4N9TA 4HJGE 4OHJA 1EWYC 1Q1EA 3WCQA 1AEXA 1ZYRD 1YNNC 1C4PA 5KGUA 2NMQA 3AEFB 2W3RA 1QLBB 5M3MB 3D4RA 2DBYA 3S1MB 1RDPD 2PW7A 2AX5A 3SK6A 3FKIB 1LTGD 3DEOA 2F0PA 1FRDA 3U9SA 1V1OA 4IFDH 2H1EA 2MGSA 4U68A 1PUTA 4X3TA 3J7AV 4F7XA 4DN4M 1HPCA 1L4ZB 2EYFA 1O7ZA 2EKIA 2NN6H 5JEAJ 4G7ZC 4F88A 3VRBB 3MXNA 3OOCA 1YNTE 1GHKA 2B39A 1HA6A 2FUG1 2WXQA 1A3VA 2LFNA 2IJ0A 1JWAD 2PNRC 4FF2A 1WTVA 2EY6A 4Q5VA 5G3LF 2IX1A 1ZOYB 4OW0A 1Y1VB 4ZLTF 4C3JB 2EELA 1SE2A 5CC4A 3AB9A 4TMAB 2KJXA 2A6HD 2Q8IB 3MEHA 4A3EB 2VB2X 1PLFA 5BN5A 4HRSA 3H94A 1E7PB 3NRZA 1MSGA 4QUFA 2D9UA 1TWFB 4IURA 1GUWA 3ND9A 1Q3LA 3OHXC 2CQAA 5D3DA 2C5CA 2WB1B 3I9V1 1VMPA 3S15B 1C4AA 1ONLA 3LB8C 3HOWB 3GV6A 3VYSA 1DOXA 3J81L 4C7YA 3S9WA 4MM3B 4HEA1 4N9PA 2SEBD 1WTOA 3S1QB 1PDXA 2EPBA 1H9JA 2I07B 1FXIA 1JOOA 4HMJA 2FBWB 5C3EB 1ENAA 4V0BA 3D3RA 2RDHA 1J7AA 3E56A 1TS4A 3DMUA 3D4DA 1RTOA 1BCPC 4LTUA 5C4XB 3T13A 4KKJA 3MC0B 5CBAE 5I6WA 1CZWA 2WU5B 4MT5A 3CRLC 3F2UA 1TKWB 2Q5WD 2L5TA 2I38A 3FEWX 1QE6A 3AEDB 1F2ZA 3PO2B 1Y8NB 5ELBA 2JZPA 1CHQD 4R8NA 3BK1A 2OEDA 2A69D 2K7VA 1L6UA 2DNEA 1FFVA 1CFMA 2EYOA 1BMLC 1P7EA 1SMYD 5HFYA 2HCIA 1KDBA 3NVYA 2N88A 5KNCA 1WD1A 2B2YA 4TQUS 3O13A 4ULLA 2DWQA 1IW7C 5DM73 1CJEA 1R7SA 2KDMA 1RCVD 3U52E 1HXYD 4BWGB 2NVXB 2N0SB 2F0UA 3AM9A 4LLGM 1HQMC 2EY5A 1QILA 4OZCA 1I6VC 4C3IB 1C78A 1F9SA 3MAQA 2Z4IA 1WD0A 3Q8AA 2I2YA 2VXWA 1VR9A 2L0CA 3H8HA 2IX0A 1X3QA 1N5XA 3DEPA 1JALA 2PYKA 1SYDA 1WXQA 2ZT9C 3Q8EA 4M0WA 4IOIE 4IUVA 4S3SA 2A5HA 3OPOA 3LWEA 4KKSA 1SSOA 4QUCA 3OWEB 4ZRQA 1JCKB 3V3XA 2DYMA 3ZJTA 1J7BA 4WAFA 2M56B 2WLBA 1D5MC 3S1RB 1OQQA 1A6XA 1OXUA 1SSNA 1BR9A 3K0YA 2L1BA 3NQTA 5JEAG 1SEBD 4YSZB 1QCBD 3LX0A 1EU3A 3RD4A 3BWUD 2PW9A 2RVLA 3I4MB 2LGIA 1S5FD 4DXGA 1P7FA 4CJ0B 1PYWD 1YN4A 1LT5D 1D1IA 4ZKCB 2AQ1B 3J80E 3HVZA 2J4XA 2XWBB 3CQZB 4UAIA 4DQOC 2BCOA 1GB4A 1FR3A 5TSSA 5BN4A 3T53B 4KV6A 5I6YA 4NDXA 1JMLA 4YTNB 1KLGD 4NAWB 5C3JB 1CA5A 3J80L 3AH7A 1FNWA 1Y69U 3VR4A 5I2XA 3ETRA 3ZQ4A 2HQEA 4QCLA 2NYZD 2J53A 3KLSA 5C2TB 3U9OA 4MH8A 1JOKA 4IFDI 1F2RI 2Y0SB 2JQRB 3KF8A 1IUEA 5EJWA 4KD4A 2V3NA 3GTMB 1XX8A 2KEEA 2YEPB 1MI2A 3P4SB 3EA6A 3ZGZA 5LHY1 4NP5A 1QNKA 2NN6I 2PCFB 1Q90A 2JE6I 2Z4HA 3QJYA 3AN1A 4KGSA 1XYIA 4GDLB 2Z8LA 1CTMA 2X38A 1BO0A 1U4MA 2O2LD 3RZDB 3I70A 5K36G 1J9OA 1FD7D 4RGOS 3PUVA 2OHFA 2F0SA 4LMQD 4K2LA 5IGGA 2X6LA 4IQZA 4A3JB 1SYGA 2JSVX 2E2IB 2KEDA 2YEPF 1XCTL 1GUOA 5FKAC 3Q8FA 4ZRPA 1PZKD 1GUTA 3PO3B 1BQQT 1IHZA 2OT2A 2TMPA 4OO1G 5GXGB 4LAAA 1ILPA 2MH7A 2E74C 1SAPA 4RKBA 5IOCA 1KAAA 1LT3D 1S5ED 3VYTA 1SNCA 1C4QA 1Z47A 4EQOA 1QT9A 2BA1A 1EYCA 2MJDA 4KK7A 4A55A 3FRPB 1EY9A 4RF1A 4KKUA 3VR5A 5DNFA 2W54A 1VF5C 2Q8RE 4DK1A 1KNEA 3TBIB 2K01A 2K05A 4TQ0A 4RCNA 2ENBA 1QQRA 5G3LD 2H4OA 5E4WC 2NVYB 4CJ2C 3AEBB 2HDLA 2D62A 5IODA 3ZJVA 5FR3A 1I7HA 4FXKC 3P75A 3E5SA 2PZWA 2KQ4X 1ZXHA 5C4HA 1Y56A 2LKVA 4OZBA 4Y7NB 3Q69A 4ZRZA 4TQ1A 4FF1A 5BYRA 3U4EG 2M9VA 1RD9D 3W5VB 4YIJA 1OQRA 2OEOA 1Q10A 3HUIA 3M4OB 2HUGA 2A73B 5CGKA 2TSSA 3ND8A 1YN5A 2ZXPA 5FOBB 1FM0D 3JAME 3PUXA 3MFYA 1PXUA 1CI3M 1ZUD2 1NI3A 3MHBA 1SXTA 1UUPA 2BE5D 4L23A 2L9HA 4HKQA 5IT9E 3P7JA 4OIJA 3SHLA 4FYDA 1Y8OB 2NN6G 2KOLA 4J8QA 4Q2JA 5CBEE 3ITPA 3SE0A 4RAUC 1B4OA 3PV0A 3GO5A 1ZDXA 1B2TA 2LMCA 1UWXA 3MXPA 3SR6A 5I9OA 3URYA 2A6ED 2XWJB 5J1ZA 3TDQA 3KQ4A 4GZYC 1DCZA 1NR2A 2LMCB 3C46A 1SYFA 4KGRA 4H7BA 1J8IA 4ARIA 3MA2B 1KABA 2A6HC 2IL8A 1LT4D 4DAYA 5I2YA 3QIAA 3NXWA 3LXFA 4ZQ3A 3I4NB 2B2TC 1V8CA 3U7ZA 3MTSA 1VCIA 4LK0M 1KRHA 4O42A 5CYUA 3J7YW 4CQNA 3NBIA 2RQXA 4L6TB 3NWSA 5IGEA 2ZW1A 1ILQA 3M7NA 4X3UA 4KHZA 1LO5D 5KEEA 1DYQA 2PQEA 3DHQA 3BK2A 5KRUA 4PQXA 4KKIA 1EYAA 2B76B 2XN9C 1K52A 1DONA 2Y5PA 4L63B 3HGBA 1A3UA 3BS1A 2JA7B 1H9SB 2RBMA 2DNCA 3NWTA 5HURA 3A8KE 1YJIA 3AB5A 4C3HB 2N9LA 3AE1B 3BDCA 4NJCA 3P20A 1TZOA 5C4JB 3FC4A 5DAUA 4FF4A 1KTKA 1MVKA 4I7ZC 4A93B 3ONAB 2NUCA 3DWGC 1HQRD 1TY2A 1NYQA 3L3OC 3UI3A 5D7GA 4KKTA 1SYBA 1OFFA 5CR3A 4A3KB 3OWFA 1JC7A 1XLPA 3LNNA 4JX1C 2ZXOA 4R8IA 5T8IA 4QMGA 2ID0A 1N62A 3BIID 2AWOA 1KNAA 5C3XA 3GTGB 1VZ7A 1BCPB 1LLRD 5BMHA 2XVSA 1N5WA 4DFAA 3T4AC 3NVZA 3W1SA 2MJEA 5IIFA 1G2SA 2L4NA 2F0HA 3RFZB 3A8IE 3LYYA 1G8ZD 2SDFA 1GAQB 1SB3C 3E6ZX 1JWSD 2MJ8A 2H89B 5EKLA 1Q1BA 5M3FB 4DAPA 1NEKB 1LV9A 3CWIA 1NSNS 1RTNA 5HG2A 4ZHOA 2F0FA 5EQ0A 3PMFA 4HTHA 4A3IB 1E0ZA 1EY4A 5KIXA 2F0KA 4FXGC 1TWGB 4XT3B 2K5PA 2K04A 1A70A 4HMIA 2M2LA 4IDIA 2DN8A 2I46A 2IX3A 2EYLA 2BDOA 2A74C 4B0MA 2BDNA 4PV1C 5C3WA 3CKIB 3GTOB 4G7OC 2PO4A 4IUUA 3H0GB 2E76C 3UI2A 4UDUC 2PW5A 1C76A 2KCCA 2BS2B 2CW0C 4V190 2PTLA 3Q8BA 2E3TA 2GI9A 1T6BX 3FDTA 3EQLC 4NMZA 1AZQA 1SF0A 3IAS1 1K8MA 1TWAB 5HGTA 1T5XD 3OIPA 3H3VC 1OXSC 3PUZA 4WJWA 3I73A 1WYGA 1E9MA 1RF2D 2PIAA 3TEYA 3KWVA 2NVQB 1HFNA 4JWUC 5NUCA 2J7ZA 1H9KA 2L83A 1KDCA 1KLUD 1SE4A 2L11A 2EZVA 1R4PB 1DOMA 4KI0A 3D4WA 4L1BA 1FD6A 3R3OA 3AE8B 4YT0B 3SVMA 2A68D 1X32A 3TN2A 3T56B 4EGVA 3SXHA 3D8GA 1PTOC 1HEZE 5FLXE 2KWDA 3AE4B 5EGTA 3L9AX 2FJ2A 2L55A 1FMAD 1NR4A 1OXVA 3IKJA 2SAKA 3TP7A 3B9JA 5FO7B 2WDRB 1BUVT 5C4ZA 3EJIA 4XWTA 4YTPB 1XF5L 5C6AA 1DZ1A 2SOBA 2LUMA 4A3FB 3NVVA 4C7ZA 3VQIA 4XQJA 3VR2A 1FIQA 4E6IA 1M4VA 1C79A 1KFYB 2R3ZA 1V1PA 1TVXA 1T3QA 4N6EB 2L52A 3AE7B 3I8ZA 1JWBD 5EE9A 2IDYA 2QCPX 1V1PB 1WGKA 4JPSA 1GOZA 2WXHA 2JYOA 1EQVA 3FPPA 3HRZC 4HCSA 2W82A 3SK5A 2XSCA 2DLBA 5J22A 3KLSX 4JBWA 3J9CA 1STAA 1I4RA 4OZAA 1VF7A 5M5XB 1VDVA 2BTEA 4QIWB 4IUNA 4RA8A 4KX6B 3AMUA 4FO2A 4OGQC 1JRPA 4I65A 5J39A 3K6OA 2QSDA 3AU7A 3FAHA 1VJKA 4ZOHC 3PIO3 2JYEA 3PUYA 1JICA 1I6HB 4ZAIA 3E0JA 3VR3A 3HOUB 4TRDA 4B0EA 3RPFC 4TSSA 3RLFA 4BY7B 1D6EC 2V4DA 3L7ZC 2R7ZB 4QB4A 3P1MA 5ELFA 3VR9B 1SNPA 3FPUB 2R92B 2WS3B 4HCEA 4RKLA 2QF7A 2F0JA 1TWCB 4JE3B 5IGFA 4ID6A 4KN4C 3D6WA 2JXMB 2Y3AA 1Q8IA 4ARCA 4KHVA 4C3JG 2WKCA 4XYOA 2F0GA 5ELDA 1WSPA 3DWMA 1ENCA 2LHDA 4WQMA 3BVMA 2QEJC 1Z6HA 2F0DA 3VYUA 3EUB2 2IW3A 1MGSA 1VLBA 3GP7A 4PT5A 4K5WA 3K57A 1A3TA 1YJJA 5E6JA 4LK1C 3DWPA 1EZ8A 4R3DA 3KUPA 2K03A 1IBXA 3NHHA 1XLNA 3S1NB 5C0XI 2JU6X 3P4PB 4XTCS 1XO3A 1YNJC 2BB6A 1IBXB 3TZDA 1YNND 4CKCA 4N58A 3QOJA 4YWGG 2AUJD 3A8JE 1TS5A 1LTSD 5KNDA 2WXIA 2ZW0A 3MXUA 1EY8A 1TKYA 3P42A 3A54A 1TKGA 5EPKA 3HOYB 2F3WA 2WIIB 3R2TA 1OXXK 2JA5B 2G1EA 4IFDJ 5BYSA 4C56C 1I4PA 4WH4A 2JXTA 1LABA 3PZ7A 2BOSA 1HUMA 2F3VA 4IZ8A 4Z9CB 2IT1A 4WURA 1JWMD 2E2JB 1YMHE 3SFDB 1W6JA 3QB3A 3Q6SA 3A56A 2RKSA 1BNZA 5H8YE 1PRTC 1JQYD 2A6EC 3AE2B 3QO2A 4KGTA 1HA5A 2XNAC 5T1IA 4ME5A 3Q23A 2HTME 3EGRA 1N60A 1UEAB 2G9DA 5I9PA 1OO9B 3IAM1 4HEDA 1EY7A 1D5ZC 4B9XA 1RYJA 1IYUA 2B2VC 4MACA 1M8AA 3AEEB 1U4PA 1U4LA 5G5GA 4ZHPA 2LY7A 1CZGA 2ON8A 1F2LA 2SNSA 3VA7A 1JORA 1AP0A 1E10A 3BZDB 1KH0A 3X3NA 2MJ3A 3MZ5A 1HUNA 1L4DB 2OXPA 3V96A 2B2TA 1MI0A 2WXNA 5CV6A 3DM1A 5IGBA 3S2HB 2EYPA 1E0BA 2R93B 1CK1A 3AE9B 1I4GA 1BCPD 3HKZB 1PGXA 1PFDA 1Q12A 5LL6X 2F0TA 5JPNC 1AYFA 2EJMA 3B2FA 2QDBA 4IKGA 1NVID 1STYA 4XQQA 1MHXA 2IWHA 2PZTA 3NUHB 5AFWA 2F0OA 2WXFA 2RDFA 3AEGB 4US9A 1HCZA 2B2WC 4X3KA 5D65A 5KYLA 4A90A 3PZ8A 3DWQA 1ACCA 1B9RA 3DWAA 5D3IB 1PMRA 2J52A 4K2KA 3A7LA 1IKLA 5M5WB 1FO4A 1L0XB 4RHRA 3GTPB 4A8XC 1GB1A 3TEZA 1F9PA 1FCCC 3AE5B 5CV4A 4RWSC 5EPJA 3TP5A 3GTJB 5CV5A 3IT4B 1SNQA 1F77A 2FINB 3CU7A 1IKMA 1IW7D 2KMMA 4FXCA 1FNUA 5DM63 4KJOA 1CA6A 3BVZA 3TUOA 2B8GA 4CHTB 3P1HA 3H09A 1V43A 3GS2A 4RF0A 5ELEA 2R6GA 5A2QE 1DM0B 4USAA 1AFPA 1MBYA 2V3PA 4RHSA 1G6ZA 1EWCA 2ONQA 3NTHA 2VB3X 1BXTA 2WXRA 3GTLB 1ZYRC 1D1KA 1HZ5A 5FK9C 1PGAA 3MXGA 1AZPA 3IFDA 1E2ZA 4A9AA 4FF3A 3K5LA 1EEID 1O80A 5M9OA 1E2VA 1PDQA 3TEXA 1S5BD 5JVH3 1S5DD 3K5OA 1QOGA 1L0VB 4KY6A 3M4YA 1CQVA 4HAEA 4IFDG 2L32A 3P63A 2FFKB 2VZKB 1CZPA 1ZE3D 1ESFA 2BW2A 5C5MA 5BN3A 2DY8A 3ERQA 1TKEA 4J1MA 4US8A 3GQBA 4RGMA 4IUQA 4RFBA 4RNAA 2RPVA 2KACA 2DY7A 3L4PA 1L5PA 4ILWA 2KAJA 4CBVA 1S4ZA 1MPEA 1VMCA 2D2CC 3IL8A 1C4CA 1TU2B 3JAML 1QF6A 1HHVA 1LTAD 2EY1A 3W2DA 2JEAI 2G9HD 1S5CD 1EWHA 3D6CA 5IT9L 1BF4A 2F1MA 1WWTA 1F2RC 1EIHA 1F9RA 2ICIA 1V97A 1WTWA 2BBCA 3BYTB 2AUKA 2KECA 4RH6A 1BBXC 4H2AA 4K6DA 4QF4A 3E9SA 1J7CA 3RMHA 1SFOB 2LS01 1C48A 1R9TB 1QOFA 2BB5A 1TWHB 4XIGS 3Q24A 3WOEA 2EYMA 3NK9A 5HI1A 2N55A 1DD2A 3P4RB 5ELCA 1WTPA 3S16B 5JPMC 1STNA 2BS3B 3NPPA 4DAVA 3TMEA 1LTBD 1II3A 4KD3A 3AMZA 1K50A 1JOQA 3C8YA 1PTOB 2WACA 1XLOA 1EIGA 3A7AB 2INPE 2KHSA 2JP1A 2ACZB 5EE1A 4NAMA 5CV8A 1F2MA 3K7AB 1NUCA 5JAVA 3SEBA 2E75C 5C0XH 1B50A 2IGHA 3MWYW 4U673 5I4DA 2K32A 1AWDA 4H44C 1L6VA 1GUGA 2A69C 2YYZA 2RA4A 1BOSA 2KQ3A 4C2MB 3BDLA 2INNE 3CRKC 5BMIA 1EL0A 3NS1A 1CQFA 5C5LA 3BG3A 1SMYC 2MHVA 2KCNA 4XDDA 5COYA 3QOLA 3C1FA 3IT6B 1EY5A 3I3CA 3T16A 2K5DA 1YN3A 2F0VA 1CM9A 1QNUA 2B8FA 3AE3B 4GDKB 1UGJA 3EVQA 4XDXA 2X69A 3I91A 4PNYA 2D5GA 2B63B 2CJOA