3MFGA

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
total genus 52
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mfgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mfgA01
1V1OA 2IPKD 1SEBD 1RF2D 1FGBD 1L0YB 1S5ED 5ELCA 2SEBD 1LTBD 1I4RA 1PTOB 2XN9C 4UDUC 1BCPF 1RD9D 1TY2A 1UNSA 2RDGA 1S5FD 5ELDA 2O2LD 1PTOC 1ET6A 2XRSD 5D3DA 1EU4A 5FKAC 1EWCA 1TY0A 4DXGA 1EU3A 1CK1A 1BCPD 3DWQA 1FD7D 4OHJA 3URYA 1B44D 1FNUA 4RFBA 1SE3A 2CHBD 2Z8LA 1CHQD 4RGOS 1RDPD 1DJRD 1JWMD 1LLRD 3DWPA 4O1NA 1JR0D 4Z9CB 3O13A 1I4GA 3BVZA 1EEFD 1XXGA 1LO5D 1PRTB 1S5CD 1JWSD 3SEBA 1D5MC 1I4PA 1LTGD 2WV6D 1PRTC 1LTAD 1SJHD 2IJ0A 1PZJD 1MD2D 1KLUD 1QILA 5D3IB 1SE2A 1BXTA 1HQRD 1CT1D 1V1PA 1PZKD 4RHSA 4BWGB 1EFID 1BCPB 1SBBB 1TS3A 1D6EC 4RH6A 1TS2A 2QILA 4C56C 1BCPC 4RGNA 1EEID 1LTSD 2ICIA 4RCOA 3W2DA 1CHPD 4RGMA 2AQ1B 1YN3A 1D5ZC 1DYQA 3BYYB 4NZLB 3V05A 1HA5A 3R8BA 3BZDB 3BYTB 1YN4A 1ET9A 1I4XA 1PTOH 1YN5A 1HXYD 3MFGA 1S5BD 4TSSA 2R61A 2NTTA 2TSSA 1CQVA 1PZID 1L0XB 1SE4A 3GP7A 4L6TB 1ESFA 3R2IA 5ELBA 1KLGD 3EFXD 1LTRD 3EA6A 5TSSA 1LT6D 1PTOF 3TSSA 5ELFA 1XTCD 1GOZA 1I4QA 1LT5D 1LT3D 1I4HA 3BVMA 1V1PB 1KTKA 2RDHA 5ELEA 1STEA 2G9HD 3BVGA 1LTID 1PTOD 1UUPA 1TS5A 4ZYSA 3OWEB 1RCVD 2AQ3B 4L63B 4DXFA 1S5DD 1JQYD 2XRQD 4K6LA 5FK9C 1LT4D 1F77A 1HTLD 1T5XD 4RGTA 2XNAC 1AW7A 1G8ZD 3CHBD 1B1ZA 4RHRA 3MC0B 1M4VA 1PRTF 1SXTA 1FNVA 2QEJC 1ENFA 1D5XC 1JCKB 2NTSA 1TS4A 3R2TA 3DWAA 1SJED 1LTTD 5I4DA 2J4XA 1PYWD 1FNWA 1AN8A 2AQ2B 1JWUD 1PRTD 3KLSX
chains in the Genus database with same CATH superfamily
2IX3A 2OQKA 1XCTL 3B2GA 4HDQA 5LLIA 3PO0A 1GUTA 1ACCA 2ONQA 3MHZA 1RD9D 4UP9A 5ELDA 2ZCCA 3RD2A 4A3IB 2H89B 1WYDA 4E3CA 1PH4A 2JA6H 2RHSB 2WXOA 4KY5A 1NI2A 4BBNC 2RSOA 4NP5A 3QJYA 4HRSA 4L5SA 1NY4A 3ETRA 4WURA 4JW0A 1PXUA 5DEHA 2JZ3B 5J22A 2HIVA 4OHJA 2EELA 2J53A 3A4RA 5E6OA 2MJEA 4OZCA 3AEVA 1SDFA 4MGKE 1HR0L 1LLRD 1VCIA 2K22A 1I3QB 1FGUA 4ZHPA 4JVZA 3MXPA 2BYTA 3J7ZC 1L7YA 2IGHA 2WU5B 5C5LA 2A5UA 2JYTA 1T6BX 3SK5A 1PVOA 3CC4A 2L1BA 1Z5SB 4OWTB 3QA8A 5DPSA 1KIXA 3SVMA 3ZYYX 2BB5A 1WX7A 3KF8B 3NUCA 2CU1A 2CHWA 4JV5Q 4C3HG 1XPOA 5K36H 5EPKA 4A4IA 3EBEA 2LZ6A 5COYA 3N32A 2B63B 1H9RA 3HOWB 1B2TA 4JCVE 4LF6L 5CBAE 3S1RH 1SBBB 1SMXA 2M0AA 4G0NB 4P71A 1BOSA 2K5QA 3RD4A 3CF5A 3M7NA 4OO1G 4WAAA 3TREA 4UY8C 1I5FA 3D6CA 2I46A 1JW9D 2MP2B 2SAKA 4BKSD 2BQQA 4EVOA 4UP7A 3P4SB 3W5UB 3V05A 1XNQQ 4LFCL 3MFGA 5CGKA 4B95A 1EY9A 2W55A 5JJIA 2HJ1A 3HM6X 4W9KA 3N9YC 2JA6B 4DWFA 1MKHA 3H3VI 4YTNB 1YIWA 2KDIA 3HG9A 1F52A 3S2DH 4HROA 4ZRKA 3B6YA 4LAAA 4B08A 3NPPA 4RKLA 2B76B 3E9SA 4G11A 4KY7A 1C7YA 4B0MA 3W3AA 3DBLI 3NBHA 2ZJPA 4EKUA 4HLEA 2RCFA 4ZRZA 3ZO5B 3CCRA 1I4HA 3OSOA 1V1PB 4IOCA 1E8XA 1SN8A 4C4VB 3PO2G 1RFKA 1Q46A 1M94A 3FILB 2C35B 2F0MA 2KC2A 2R2QA 1BBXC 1UE5A 4R8NA 3IFWB 3AMUA 3I8ZA 2KCMA 3M4QA 1C9FA 5KEEA 2DY8A 4OEMB 3RN9C 4LDTD 1P0RA 1IYUA 4GU2A 3W1SA 1PRTF 2NWGA 4YXDB 1Z6HA 1IBXA 1I6VC 1STHA 1D7QA 3S1RB 4JV5L 2NTSA 2M4NA 2KO3A 4NJ6A 3V6EB 1V5OA 1HZ6A 4I7ZC 5C4ZA 3KDFB 4KZ0A 1CM9A 1D8LA 4JI8Q 2Q2UA 4J3OD 3E6ZX 3AH7A 4K1RB 4LUVA 5D2MB 2Z6BA 1S5ED 5JJLA 3ZW3A 1E7PB 4FXKC 2N9XA 1JMCA 2MO1A 2KCNA 2L11A 1UBQA 2IBIB 2DAFA 1VQAA 5D6JB 3RR5A 2EIFA 2O2LD 1XNQL 2NS5A 3Q8EA 5H92C 1HUMA 2B2YC 2G9DA 4G7OC 1XO3A 2N4FA 3UIOB 4BBRG 3X23A 4IUQA 4ARCA 3BK1A 4QB4A 1UD7A 4KDLB 5AZFA 2OXPA 2KENA 2GN5A 1EUJA 3CRKC 4DN4M 2YLMA 2CHBD 1VQFA 5IGEA 3M7GA 1CHQD 2MP1A 2F0HA 4RGOS 1WTQA 4PQXA 1GO3E 4CBVA 2LHEA 1IUEA 1GPXA 1LO5D 1IXRA 1TYGB 2KTRB 2JEAI 2M0XA 1N34Q 4GOPB 3A8IE 2BKFA 1Y8PB 2YU9H 2EOTA 5IAAC 4FP5D 4H0LC 1CFMA 4ZAIA 4DV0Q 1LABA 5JEAG 1HNZQ 3PUZA 4US9A 4R4IA 1KDBA 2WXPA 2G4SA 2K5PA 2KWVB 4XZ4A 1P7FA 1IHZA 1EF1A 3H91A 4WJ3M 1XMOQ 2KECA 4IKGA 3NUHB 1DGSA 2R92H 2NYZD 1X55A 5BYSA 5GAHC 5E7NA 4IUVA 3U50C 2F0IA 4KZCA 4S17A 5CYUA 3FKIH 1E7VA 2OOBB 5C1ZA 4IPCA 3C1FA 4B9XA 1PFSA 1WTRA 2PVOD 3IL8A 3OHXC 1YN3A 3HKZG 2LEKA 3AI5A 3Q6BA 2M1MA 1AARA 3RZOH 2NCNA 4P75A 4JI8L 3T3OA 4KHVA 3PHXB 2CCZA 1ZYRD 4W9DA 3Q3JA 4MHEA 4OZAA 4JBJA 3C3LA 1TKYA 4ME3A 4BFRA 2BS4B 1LYLA 2VW9A 2BTEA 4GNXB 2FHTA 1X3QA 2FXQA 2L52A 2B2WA 1R7SA 4DNRB 4TQ0A 1YNJD 3B0AA 3R3OA 2JU6X 4DR1Q 4PYZA 2A1AA 2ZXPA 3G71A 3HM3A 3G6EA 3VYTA 2PW7A 1LT5D 5GQOA 1Z7TA 5C0XJ 1K8GA 1QOBA 1EZ8A 2G45B 1H95A 2Z9HA 3IKJA 3VR4A 1K53A 3R7RA 1DM0B 2NPTA 3RYTA 4NPSA 1BUIC 1E8WA 4MGZE 4ZYSA 2LGIA 3G4SA 1WGHA 1PFNA 2YU9B 3HOZH 4II2B 1K3BC 1SLJA 2BDNA 4KLKA 1MSHA 3HRDD 1WR6E 1SR3A 1UELA 3OIQA 1EY5A 1Q5WB 4K7WA 3RNBC 3STBC 1HNZL 4DV0L 4FHKA 2EYHA 3MC0B 4S3SA 4AH6A 1HTOA 4KKIA 5J2RA 1PYSB 3ZXRA 2R92B 1B3QA 2HD3A 3F2DA 4N9PA 1BT0A 3R3MA 1VQ9A 2BA1A 1L4DB 1WM2A 4YWGG 4IJLA 3N1ZC 3I57A 1F2ZA 1MIUA 1TVXA 1YHAA 3FKIB 3LXFA 2GBKA 4XTCS 1I42A 2W54A 5C3EH 2K1FA 3AM9A 4DR4Q 1WGDA 1WE6A 1VQ8A 1L0YB 4NB3A 2F3WA 4ZRIA 3RZOB 2QCZA 5MPOA 2WHIA 2FCNA 4TUUA 1DZ1A 5BMHA 3LGJA 4ZK9B 1UH6A 4N6EB 3Q24A 1S5FD 1K8MA 1EZ6A 2KHIA 3GDEA 5ISRA 4JGHB 4MJSB 3HOXG 2JRIB 3CXCA 3OLMD 2R6GA 3PIP3 2D5GA 1ILPA 1V97A 2C7HA 1CK1A 4K8JA 4OZBA 1RTOA 4XQQA 5GXGB 3URYA 3EQLC 1AE2A 3M4OH 2QC8A 3Q8CA 5C0XH 3DHGC 1YJJA 2MX2A 3D4DA 3ZXVA 4A55A 4DGZA 2WINB 4BXXH 2EY2A 3KF8A 4KY6A 4FVMA 4DR1L 1X56A 1J7AA 2PE6B 1D4BA 2ATWA 5FO9B 4UAIA 1QJOA 5M5XH 1KDAA 3HOZB 2PPHA 4A3FH 1OTCA 4DR3Q 3KH0A 1R4MI 1CKNB 1HZBA 1DOMA 1GVPA 3DPDA 4W9LA 5IOCA 1QILA 4HDOA 3VA5A 2MP2A 2N9EB 3S24A 4HPPA 1CT1D 5EGTA 1VQJA 4IG7B 3RNFC 1GUNA 2PI2E 1Q1EA 3CCLA 3A5UA 1E0ZA 1NVID 2KJRA 1I6HH 1QG7A 5K5PA 1UEAB 5DPWA 3VVWB 3FAHA 4CDDC 3AQQA 3I72A 5C3EB 4NQLB 1C3TA 5CV4A 1SYFA 3R8BA 2AWTA 3E0EA 3BZDB 3C1EA 2QDLA 1XYIA 1I4XA 2K33A 2LGYA 4CGYB 1ZEQX 4CQNA 4GS3A 1FR3A 2XIWA 4A75A 4US8A 3DEOA 4N8X1 2JZZA 4AWJA 3H0GH 2QHOA 2G5DA 3SR6A 2BS3B 3GTGH 3K59A 1N8RC 1Y1WG 1B9MA 5FLMH 1NENB 1Q12A 1RM6C 2PNHA 4OVVA 2NZ1D 1F0ZA 4AYBB 1VQKA 3NENA 3M4OB 5HFYA 3ML9A 5ELFA 3NG0A 3VRBB 1WJ6A 3ZNZB 2FIFA 5IYCG 1ZP0B 2B2YA 3I4MH 4G50A 1WTVA 2PZTA 1PHJA 4KVGB 2UXBQ 4CDCC 4EQOA 2WXIA 2XK5B 3KLRA 1STEA 1UUPA 4A93G 5M5XB 1YBYA 1S5DD 4A3FB 3IFDA 4X3TA 1QKZA 1PH9A 2KFKB 3K9OB 2VUMH 3AECB 1K8RB 1DOLA 3A1QA 2VXWA 1A62A 1U4RA 1C1YB 2KACA 4ZYNA 1R4PB 1M4VA 4G4KA 5EPJA 4CDEC 4DR3L 4HVBA 5HGTA 2BKRB 4X57B 1JCKB 1EO6A 1UWVA 1N6ZA 3I70A 3W1BA 3FPUB 3DWAA 1I6HB 3C19A 1Y8RC 2ZTEA 3NEMA 5IIFA 2J4XA 5JPNC 2F0DA 4KV2A 1AN8A 3VH3B 3RNUA 4GLXA 2N88A 1UEBA 2JQRB 4BKTA 2Z0DB 1YX5B 3LWUA 5IP9H 2IPKD 1SEBD 4XYQA 1H4RA 2J0JA 1OXSC 4R4TA 3JSVB 2E5LQ 3H9DA 4IC7B 2JSVX 1UNSA 3K5MA 2W3RA 3VXWA 4IURA 1YHBA 4X66Q 2LXCA 4HEA1 3H0GB 4MELA 4AIMA 3GTGB 1WXQA 5IN7A 1A70A 1IL2A 2IT1A 1VQHA 2TMPA 4DNTB 2QCPX 4DAPA 1FD7D 3AE8B 4WRDA 1SE3A 2L8JA 4FJVB 5C4JH 3FHWA 1KOTA 3DWPA 4C3IH 4QJFA 3J9CA 3I4MB 2K50A 2NN6H 3GD7A 2ES2A 2ZVNA 4MGIE 4YSXB 1NAPA 2HCIA 1JALA 3VYRA 1A3TA 4NKLA 4A3CH 3I3TB 1LTAD 3CCSA 4C7YA 1WJUA 3TJPA 2F3VA 1QZEA 4DR2L 2UXBL 4WQMA 2LRUA 3W5OA 2ZZPB 3C8YA 1MD2D 1C77A 2VUMB 3LX0A 2F0LA 2QDFA 3H8HA 2E2IH 5AFWA 2F52A 3NZUA 4K7SA 2BPSA 4PMCA 2M17A 4IALA 3GZNI 3B2FA 4K5VA 1EFWA 4GXBA 1YIJA 4KIKA 1AFPA 5JVH3 5BR8Q 1NYQA 4C56C 5JVG3 3CCQA 2RGFA 4GKJL 3CCUA 2BBCA 2Z0EB 4ICUA 5AUKA 3T9LA 4B3RQ 1H9KA 1FFVA 2AYOB 5E6PA 2JSOA 2DGYA 2CH4A 1EQRA 1TKWB 1HQMC 2XSCA 1L0WA 4DPGA 1PH6A 4B3TQ 4ZDVA 3U2SC 3PSEB 3IHPC 4DDGD 3Q22A 3STBD 1GUWA 2MUYA 3UDXA 2QIEB 4PG3A 4YY3Q 4NXNQ 4IFDI 3MWYW 4IUPA 2E5LL 5M5YH 2AEHA 4BOZB 1FD6A 1L4ZB 3ALBA 3PREA 2L76A 4X66L 2KFJA 2OQ0A 5EDSA 1V8CA 3BDCA 4DV3Q 3V6CB 1LT6D 1SNDA 3MP9A 2WS3B 3VTVA 5C4JB 1GOZA 2BA0A 2CWPA 1I4QA 1QCBD 4C3IB 3HS0C 4DR6L 4GMVA 1TWGH 1DCZA 3OIPA 4KN4C 2A4ZA 1HH2P 4JYAQ 4OVUA 1PUTA 1WGKA 3TEXA 4GSWA 2KD0A 1GM5A 1PH2A 2GBNA 4HJAA 1WXAA 2ZNVC 4Y7NB 4HJ7A 3A9KA 2M8SA 2XVSA 1QOHA 2E76C 3ZRCA 1E24A 2KVMA 3OJ3A 1IBKQ 4LUZA 1RHPA 3SXHA 2NVXH 3LJ3A 4HCPB 1G2TA 4USAA 3Q3FA 4RGTA 2WNMA 4GDKA 3JAMi 3DBRI 1FPYA 4WWOA 2NVQH 1JJ2A 1HTPA 2E2IB 4X6AH 4FO2A 2HTHA 2I07B 4JWSC 1JC7A 3S1NH 4K6DA 5FR6A 1AH9A 1IP9A 2EE1A 4DK3C 1C4AA 4A3OA 2K52A 5CV8A 3I73A 1EL0A 1WIAA 2EY5A 1EY8A 3EJIA 3QX1A 2DY7A 5BR8L 4MJSA 5C3JB 2JA5H 1TKGA 2KA7A 2KTFA 4B3RL 1WZ0A 2D2CC 3ICEA 3DCGA 3NBHB 1SF0A 3VUYA 5DAUA 4FDBA 4HK2A 1KC8C 1C76A 2NVUI 4B3TL 5EPLA 3PVLA 1G2SA 2RVLA 4DR5Q 2JRHA 4TQUS 5EE3A 5M5YB 1G6JA 2EKIA 2MO0A 3MXUA 4LDTB 3KJPA 2KEDA 4DV7L 1WGYA 4BOSC 2JE6I 2VB3X 4NXNL 4YY3L 2Z8LA 5M5WH 3M85A 4QY7A 2H88B 5KNDA 2K0PA 1GD7A 5A35A 3QHTA 5EAYA 1VQPA 1R4NB 2FMMA 2D9UA 4DV3L 1YHQA 1TWGB 4V0BA 1I4GA 2F0QA 3BVZA 1BKBA 4RF0A 1FCCC 1IBXB 2WAQE 1C9OA 3WALA 5A2QE 3S1QB 1WD1A 2V3NA 5CBEE 4M02A 1M8AA 2RA4A 4JYAL 4JPSA 4ARIA 2MJ3A 1I7HA 3OG5A 1JE5A 2INCC 4XDXA 2NVXB 2KJHB 1VF5C 2Y3AA 4IWQA 4JBKA 2NVYB 1KLUD 3Q6SA 1B9NA 4ANVA 4GN5A 4YHHQ 1IBKL 3MHBA 5M3FH 2NVQB 3T3NA 3S1NB 2FBWB 1EFID 1Q7YC 1X3GA 3NVYA 2C7MB 1U9RA 1NMGA 3FRPB 3PQIA 1D6EC 1TS2A 1U4MA 3CWIA 4A3JH 2OT2A 2YTYA 3AE5B 3N1YC 3MZ5A 3DVGY 2K03A 4RCOA 1K50A 3DMUA 2EDGA 3AV8A 3TUOA 1D5ZC 1OQYA 2Z59B 3L0OA 2K6QA 2JA5B 4ZOHC 1HXYD 1K28A 4X3SA 5M3MH 1D3ZA 3WAOA 2Y5CA 3VR5A 5J1ZA 2NTTA 4K8IA 4A3IG 2JX5A 4BY7G 1E7UA 3X3MA 4GZYC 1C0AA 2BE5D 5IGDA 1J6QA 1ZXHA 2Y5PA 3WOFA 4DXAB 3ERSX 4IPDA 3IRBA 1KRSA 4LF7Q 1ROEA 2EXZA 4DR5L 3KFUA 5H1SE 1STAA 2HQEA 5M5WB 2CJOA 4LJPB 3VDZA 2KZRA 1YI2A 3ZNHB 4ITKA 3K80C 1A5RA 2VB2X 2N7DA 4G3XB 4BAXA 1NMFA 1VZ8A 3AE2B 2INNE 4OW0A 1LM0A 2R2OA 3A9JA 1WI5A 2E74C 4KTAA 4A3LG 3APDA 3L54A 2HHHQ 3H6NA 1ONLA 5ELNA 2BYFA 2DZKA 2CVRA 5G55A 3I4NG 3OTOQ 1SB3C 2IO2B 2QGQA 2PPBC 1G6ZA 5M3FB 3RZDH 3DEPA 1GJXA 4ZRPA 3P4QB 3Q2AC 1SYDA 3OYYA 1Q1OA 2F0EA 3JSVA 4R9WA 3PHWB 5C23A 1FNWA 4A3JB 3CSFA 3ZIMA 1WTOA 1YJ1A 4W9IA 2R93G 2WXKA 4KKSA 1V1OA 3AE7B 1FGBD 2UUBQ 4QQBX 2BT6A 4NJ7A 3AMZA 1N36L 4A3DH 3DM3A 5M3MB 3MXNA 3LWEA 1L0VB 1WXMA 1ET6A 2B3AA 2WWZA 1SSOA 1YNTE 4MSMB 1NBWA 3KK7A 3HOVH 1TY0A 5M9OA 1TU2B 2NPTB 1SROA 5I6WA 1JB7A 1VQMA 3NZ3A 4AQYL 1HZCA 2R7ZH 1SIFA 4B9KA 2LHDA 5BMIA 3QO2A 3MTSA 1EWHA 3EC8A 3PZDA 1WFYA 3K6OA 1YQ4B 1RDPD 4P74A 5IYDH 2A6HC 1D1IA 2ZXOA 4EGVA 4DF7A 3RN2A 4A90A 3G7LA 4LF7L 3GOEA 4IM2A 1PA6A 2LUMA 3OPOA 3RNGC 2I5HA 1Q3LA 1WTWA 3J80L 4HEDA 4CJ0B 2NVTH 1UGJA 1ICFB 3GTJH 4ILWA 1WZ3A 1D1KA 2IJ0A 1L1OC 2VS1A 1E8YA 3ZJTA 5G3LF 2WXRA 1VJKA 3OMCA 5G2NA 2EPBA 4ODGA 1WTPA 2N49A 2Z4IA 2L00B 2W3SA 2KHSA 3EROA 4ZUJA 4A3EG 2HHHL 1EY7A 4L5TA 1A0IA 3RZDB 3KWLA 1TT2A 4BWGB 4G7ZC 4JE3B 1GHKA 1TS3A 1HZ5A 1F2RC 4TRDA 1U0LA 3PF5A 3OTOL 1NEKB 1TQOA 4HAEA 3LYYA 3I4OA 1FYCA 4MH0E 2AQ1B 1F2MA 1HE8A 2WXJA 4TV3A 1WR1A 2BWFA 1LFDA 5FOBB 3AU4A 2UYZB 1VR9A 3UGBB 3HOUG 1J8IA 2JXXA 1WE7A 2FINB 1VQIA 1IKLA 4NXMQ 4A3DB 2PKOA 1MBYA 2HDMA 2WDRB 3RMKC 3ONAB 2UUBL 3D8GA 2EYLA 3PGEA 3TBIB 2MBBB 4WORA 3HOVB 1SE4A 2GA4B 4L6TB 4HIDA 1YJWA 4BKSA 2G3QB 4WJPA 5TSSA 2KMMA 3IVFA 1FCLA 1V9PA 3FVQA 5C44H 5IP4D 5G3LD 2JYOA 2VZAA 3CKIB 2KMCA 2PEAA 2OCEA 4KKUA 1VLBA 3EECA 3ZJUA 1CQFA 1V1QA 5LL6X 2WP9B 2E2JH 1YD8U 3BVMA 4J15A 4DHZB 3KUCB 2AUKA 4DKAC 2EKEC 2LXAA 2LKVA 4H44C 2DZJA 4MEMA 5FJ8G 4NJCA 3GE8C 1RCVD 3GTOH 3UF8A 3T53B 4LFBQ 3S14H 3N1XC 3GTJB 3V2TA 1ENCA 5FK9C 1JOOA 4H2AA 2R7FA 1TZ1A 3RI7C 1HTLD 1SYCA 2HT1A 4JI4Q 4GOCA 1T5EA 5CV5A 2KC1A 4HIKA 4E6IA 2GOWA 5AUIA 5C6AA 1P98A 3GV3A 3GTLH 3H15A 3B9JA 1ZPSA 2UXDQ 3L9AX 3M4PA 3Q8AA 2B2VC 1GUSA 2K25A 4M8NA 3SK4A 5C5MA 4HJ5A 3TRZA 2N7EA 3VR8B 2YV5A 4FJYA 1EWIA 2SEBD 2XWJB 4JBMA 5GMVA 3GS2A 1N63A 3ZQ4A 4GIVA 3ITPA 3TMPB 4UDUC 4K81A 1QVGA 5A2QL 2O6VD 2IYDB 2KAJA 4HJ8A 2XRSD 2BYEA 1NYRA 1VCBA 4HMIA 1SE8A 4NXML 1XLOA 1K83H 1HA6A 1BBUA 4HMJA 4WFN3 1VQEA 1EU3A 5E3FA 4OO1H 4NNJB 2JA9A 2A6EC 1V5TA 5C44B 1VQOA 4A3GG 4KD4A 3HOYG 3MFYA 4HWIB 2JY6A 3A1QB 1XTDA 3GTKH 1WFQA 1GC6A 2BH8A 3PRZA 3QIJA 3BK2A 1MI2A 4IFDG 1KNAA 3TZDA 1WCMG 1WRIA 2VY3A 2JZPA 4GLVB 3ENEA 2C5CA 2Z6KA 4IJHA 4JOIC 3Q0AA 4PS7A 1VQGA 3S14B 1E8ZA 1GAQB 1XEEA 1WYGA 4S0RA 3HHMA 4C7ZA 1N33Q 1WGRA 4TKOB 1V6EA 1GB4A 5ELOA 4HCEA 2A19A 5D3IB 4QMGA 1ISNA 1SNQA 1ZW7A 3S2DB 2N8NA 1GUOA 4RHSA 1UZXB 1DOKA 3AE4B 1I94Q 2B2TA 4BBSG 4IN3A 3GTLB 1X3PA 3NQTA 3PMFA 1KQSA 1JWBD 2VH1A 1PH5A 1EEID 1BNZA 3PO2H 3S17H 2D3AA 2MLBA 3S15H 3KUZA 2LFNA 2X69A 2CH4W 2OJRA 2BW2A 2UXDL 3BYTB 3KBGA 4HCSA 4LNKA 2F03A 3DQVA 1P16A 4ZKBB 1PLFA 5JEAJ 4IDIA 4JG2A 4LK0M 1FVIA 1NI3A 4TMAB 4WJOA 4H7BA 4ANXA 1J7CA 4F7ZA 4JPBW 1XWEA 3QOJA 3KYCD 1K83B 3UE1A 1ESFA 3F1ZA 2KWUB 5IT9L 1KLGD 5DPRA 4UHVA 2WB1E 2FCSA 4FXCA 3TSSA 3WAMA 4LMQD 1EM7A 1P1AA 4L5QA 2ICEC 3N6RA 5C4HA 2KJ6A 4BBNF 1V81A 2AKWB 3GTKB 2FUG1 1AE3A 2WXLA 1KTKA 2RDHA 4NAMA 2G9HD 3BVGA 4KIKB 5BN4A 3NS8A 2BOSA 1H9SA 1F2RI 4NDXA 4PZ7A 2ZPNA 4DV6Q 4MACA 3I4LA 2JT4B 3C0RB 3ZTDA 2JQOA 3P75A 2MBHA 3QWNA 3NQIA 1J5EQ 4XDDA 2EY1A 2A6HD 1C8CA 1WMHA 1ENFA 1HPCA 1KDCA 1M90C 5DCNA 2WAQG 3TEWA 1RYJA 3U4ZA 1LM8B 3AU5A 3VYUA 2I2YA 4KGRA 2IWHA 1BO0A 1PYWD 2DJFC 4A3BH 1G51A 2OEOA 1NTGA 1KJTA 3PIO3 3PO2B 1LTRD 1LTLA 2K01A 1CTMA 3BDLA 1UAPA 3ULPA 1I94L 3S15B 4F88A 1X1MA 3H7PA 3ML8A 3PLUA 4WWNA 2DN8A 2I38A 5JEAH 4A3MG 2AUJD 2F0VA 4GOPC 1F1HA 2RDGA 1S3OA 1YVCA 4U68A 5D14A 1ILQA 3I56A 3N3KB 1IGCA 1ML0D 3T8MA 1QOAA 2BF8B 4YCWA 1N34L 2DNEA 4DXGA 2YVCA 2BWES 3N30A 3A9KB 4OX9Q 3SU8X 4KJOA 4HJ9A 2PO4A 4LW1A 3E9HA 5DM63 4LNQA 2N9LA 4GDKB 1PYBA 1VQ4A 1JR0D 3MXGA 1XMOL 5I2YA 3AE6B 3AE1B 1TIFA 2F0GA 4CKEA 1YNNC 2UWQA 5IA7A 2RQXA 4NQKE 3SEBA 1VQNA 1D5MC 2V1CC 3NJTA 4N9TA 4V190 4TQ1A 3U58A 4LUOA 4H13C 1IBLQ 3PRPB 2E2HH 4YCVA 4A3FG 1IYVA 1LGRA 4XGAB 4MZ9A 1CKMA 1KNEA 1XPUA 2RF4A 4YTPB 2DJGC 4EZJA 5IKCM 1J0GA 2JVCA 2L55A 2EVBA 2EMTA 4IUMB 4ZHOA 5J18A 4WWPA 2DHZA 2LRWA 1QVCA 2ZPYA 1SYBA 4QUCA 3CIRB 2CQOA 4PS3A 2C60A 2WQYB 3V3XA 1TWHH 2LD9A 1GJZA 1WWTA 4BA1I 1BCPC 2XTIA 4RGNA 2MNAA 1J5EL 2CU3A 1FRDA 3UINB 3HZXA 4A3BB 1CHPD 1QNKA 4HCNB 2C9OA 4EQNA 4KKJA 2F0PA 4K7UA 1JB3A 4NZLB 3ZUNA 2WLBA 2VNUD 1S5BD 4Q2JA 2EQSA 2R61A 2IO1B 4MM3A 1TXYA 1QF6A 1UE1A 1H9JA 1H9MA 2INPE 5BMGA 1QZHA 2TSSA 3EIVA 3BJUA 1O80A 2Y0SB 4DBGA 1HUNA 3SFDB 2J7ZA 2J0MA 5ELBA 3U8ZA 3J81E 4IUNA 1EWYC 3A74A 1TBEA 4K0KQ 2KOXA 2QF7A 4BA2I 3VH4B 5LXIB 2LJ5A 1IPGA 1F9PA 2AMCB 2KWCA 3PUXA 2WX0A 1N32Q 2UU9Q 4AQ7A 3TQYA 3HKZB 2KDMA 1BBWA 4LF8Q 5I9OA 1STYA 1CSPA 2QW7A 1GHJA 1UWXA 2DZMA 4LNIA 3UQBA 1FXAA 2BDOA 1WGGA 3AB9A 1SMYC 3B1LX 2LS01 4RNAA 4WJ4A 1QLBB 4WQOB 4R1JA 1NUCA 2WP8J 3W1GA 3QQ8B 3P63A 1TR5A 3HOXH 1JQYD 1Q90A 2E2HB 4DR4L 2EMSA 2PTLA 4ULLA 4DAMA 1WVLA 2BGFA 1T5XD 3U7ZA 4K5WA 1A3VA 2X6LA 4DV2Q 2L0FA 2LVPA 2HTME 1SRUA 2A6ED 2F0WA 3CU7A 3HGBA 1IBLL 3RFZB 3EUB2 2QEJC 3L3OC 3LB8C 3ZTCA 3ND9A 2EJGC 3HVDA 3HIZA 1E9MA 3G48A 1AEXA 1KAWA 1C4QA 1TWHB 1JQ4A 3K5OA 5I4DA 2A68C 3D3RA 1AYFA 3NY5A 1PH7A 1E5WA 5HKHA 4YWKA 3L13A 1JROA 3AN1A 2VL6A 2WXFA 1LTBD 1RTNA 1I4RA 1V43A 3J81c 4NAWA 1JRPA 2JF5A 4ALPA 1PGBA 1ZXIA 5NUCA 1PTOC 1L2FA 1CMXB 5JJZA 1C78A 5D3DA 1EU4A 5FKAC 5LMUQ 2KDBA 1Z47A 4JI2Q 1XMQQ 5CMDA 5CHFA 3QB3A 4EX5A 4XC2A 1WXSA 3J7A5 2MW5A 2H5XA 3A9JB 1Q8IA 4PZ8A 3D31A 2ZJDA 3W1YA 3AEAB 4QIWB 4EFOA 4F7XA 1JOKA 1KM7A 2N9PC 4O1NA 1KD1C 1RRBA 3TZUA 3ZRFA 1W6JA 4K0KL 4AJYB 1XXGA 3NVZA 3MEHA 3A54A 1YOVB 2UU9L 2WV6D 3WCQA 1EY0A 4J6HA 4LF8L 1MFWA 4A3CG 1TT5B 4B3SQ 4DDID 2KCTA 4R3DA 4KHPQ 1Y1WH 1PFDA 4P1BC 5IGFA 1P7EA 4C3JG 2WKCA 1SE2A 1BXTA 5C4XG 2CHZA 2WKDA 3X0WA 1ZDXA 5IYCH 2MBOA 3MXNB 3RLFA 4DV2L 1CSQA 3Q3OC 1JE4A 1K0RA 4CHKA 5IYBG 2MQJA 3TEHB 5LMNQ 2KQ3A 4TVAB 1S3SG 1LTSD 2DNCA 2AL6A 1YZ6A 4H02A 4A93H 5KYLA 1X9NA 2ON8A 2V4DA 3NELA 3DBHB 2F0TA 2Z1CA 2VRRB 1L6VA 4L1BA 1CZGA 4IQZA 3UQAA 3PIOA 4KSLC 4DAYA 2NUCA 2EYFA 2D62A 2UXCQ 1V80A 4B9WA 2E3TA 3BWUD 3TEYA 1KFYB 4FHJA 1ESRA 1CZWA 2B2UC 3VFKA 2UUAQ 2LGXA 1VRAB 1J7BA 2KN5A 3ZLZA 3VA7A 3KYHC 1VQDA 1XMQL 1IZ6A 3N52A 4JI2L 2M9VA 5CR3A 1C4PA 3I9V1 3ND8A 1IW7C 1QB5D 1MJDA 3PZ8A 3RNAC 5L95C 1EQQA 4B6WA 3AE3B 3U9OA 5JHBA 2CHXA 2SDFA 3J80E 2ZNVB 3UDFA 2O5JC 3GO5A 1FO4A 2IO3B 1LTID 2JP1A 3RLNA 4C00A 1SYGA 2LVQA 4NY0A 4K6LA 4KK7A 4PT5A 1X65A 2P5ZX 4AOFA 3L08A 4A3KH 1Y1WB 2XNAC 3IAS1 3CHBD 1K51A 1JICA 1CZPA 1IBMQ 1T0YA 5JPMC 4B3SL 4JX1C 4D2KA 2EJMA 2K04A 1WX9A 1ASZA 4RM9A 1FNVA 2K5WA 4LFAQ 1Z9FA 3M4YA 1B53A 2DLBA 3HRZC 2KX0A 2M00A 4L5RC 2MSED 3MEFA 1MHXA 3H3VH 5JHAA 2IHEA 2MBEA 5HY6A 4FBJB 1RJTA 2BCOA 5ELCA 5KIXA 3QCAA 1QZGA 4BZAA 2LGSA 3ERQA 3IBEA 3FEWX 3NRZA 1GKHA 1N5WA 4MSQB 4LNOA 5IOIA 2UUCQ 3A7AB 4YT0B 4AUQC 3WDNA 4UP8A 1JWAD 2CKZB 2N7JA 2JA8G 1F2LA 4WJWA 2QA4A 3SHLA 3J80c 3DHHC 4IW0A 1HFGA 1VQ6A 3S17B 2UXCL 1XLPA 2IY1B 4MDKE 1BCPD 3FC4A 2K5HA 1FIQA 4KGTA 3ZJVA 4OWXB 1RODA 1UE7A 4ABNA 2ZJRA 1JWMD 2UUAL 1L2NA 3C2PA 3M62B 4M8MA 1XCQL 1Z2MA 2CQAA 4YWLA 2JA7H 3NBIA 2WXQA 1N61A 3AYHB 4TKNA 2I1JA 4DK6C 4OIJA 3WIMA 3AXCA 1HFNA 4NW2A 1B50A 1DXMA 1V2YA 1V49A 5AJ3Q 2WB1G 1SNCA 1LQBA 5C3XA 1PZJD 2O6VB 1WX8A 3NZSA 3E9IA 3HUIA 4A3KB 5BYQA 2KQ7A 1DGJA 1GB1A 1A63A 2Q5WD 3KVFB 5IE8A 3PO3G 2KWDA 3HVZA 3H1UA 3DDCB 5L83A 3GTMH 4W9FA 2K1BA 2DYOA 3UDGA 2FNJB 2F0KA 1NNXA 1IBML 1GUAB 3J81L 4P7IA 4IPGA 1SMYD 3W2DA 5IODA 2Y0SE 4ASWC 5G5HA 4LFAL 4A20A 4FADA 1A8VA 1BF4A 4J6IA 4IPHA 2X6GA 3TS2A 2MJDA 3ZNGC 4R4OA 1YN4A 4M1UB 4ICVA 1WY8A 3I5JC 4K14A 1AP0A 1PGXA 2HDEA 2N1WA 4FA6A 4HPMB 1J9OA 1YMHE 3DBLB 1OXVA 3V96A 5M3MG 3HKZE 3AFPA 3AFQA 2EJFC 3BDOA 4C1NI 3T1HQ 4BY1H 4PS8A 1O7LA 5KNBA 1K52A 3DBSA 3IAM1 2IY0B 2KDEB 2MWSB 2B8FA 5E6JA 3J7AV 4BVUC 4OGQC 1FM0D 2A68D 4KN7C 5KYIA 3PF4A 2Q8RE 2KNBA 4UPAA 3T13A 4C2MH 5IP7G 4HXDA 3RT3B 1MJEA 4CJ1B 3PV1A 3L7ZC 4EOYA 4P73A 1FFUA 1NDDA 1VQBA 1WJJA 2JA7B 2LUEA 4XWTA 2UU7A 1F9RA 4X3UA 1DOYA 4K2KA 1PTOD 2A73B 1JJCB 4I6LB 4AYBE 3ZVVA 3JVZX 1WTHA 4HN7A 1Q81C 3TS0A 1V8QA 5FO7B 3TP8A 5C0XI 5IY0A 2RDFA 3DHIC 4F8CB 3M63B 4DAVA 2K5NA 1B1ZA 2SNMA 1NSNS 4YSYB 2Q8IB 1YITA 1T0RC 5AJ3L 2D11A 1TTNA 2Z0SA 3VAWA 1D5XC 3GTMB 1KRHA 2HE7A 2PIAA 1TS4A 4RAUC 5IO9A 2FAZA 1SJED 4O0AA 2Q8TA 3CCVA 2AQ2B 2QKIC 1OEYA 2J7QB 1JWUD 4G57A 3WWVA 3RPFC 4URKA 1SNOA 1RF2D 3IXSA 2L05A 3W1SC 1UE6A 5E1FA 1V9JA 4OELB 4K3BA 3PLVA 2HUGA 1GC7A 1IGDA 3GB1A 3CMMB 1IYFA 3IAYA 1MG8A 3EGRA 4JI5Q 2G1EA 1N5XA 4BY1B 2D3CA 1HHVA 4MNOA 5CHVC 5IT9E 4P72A 4HTHA 3A56A 2I0QA 3PCOB 2D2QA 3ZDTA 3TEZA 2XWBB 3CD6A 1H9SB 3DWQA 2VQFQ 4QF4A 1WYWB 3EHVA 4L23A 1B44D 1KL9A 4XXEA 4RFBA 5LHY1 5F2DA 2B63G 3HOWG 1N60A 2AL3A 2AWOA 3ULLA 2GRIA 2I1KA 2RR9A 4C2MB 4C1NK 4FF3A 3BY4B 2MCNB 4YHHL 4I7AA 1JOQA 5DPTA 4R4QA 2NB0A 2GBRA 1IKMA 4HJKA 1EYCA 1SFOH 2B2UA 3D4WA 3U7DA 2L5TA 2WXNA 1N62A 1WMHB 4PMBA 1SIJA 3RN5A 2WU2B 1L1OB 5LMNW 1FXIA 1PRTC 1FRRA 2K3UA 1UWMA 2K28A 4A3IH 4BY7H 3KW5B 3DXJC 2SOBA 3EN2A 3S2AA 2BS2B 1GUGA 2L0CA 3NTHA 1PDXA 3MC8A 5E6NA 4YIJA 1C79A 1VS0A 3H7PB 2IZVB 2JA6G 1HQRD 5I9PA 1W6KA 5CC4A 1IW7D 3K0XA 1HZ9A 3SD5A 3KLWA 1VMPA 2VZKD 2K6AA 1VDZA 2BYVE 4HR7B 1B8AA 3IFTA 4L8JA 2AWNA 2K6DB 4GLSC 4WJQA 3BG3A 4FF4A 3Q69A 1XLQA 1VF7A 4YCUA 1K8OA 5IT9c 2CFMA 2IGGA 4RF1A 3A33B 5KHOA 5I2XA 4X62Q 5GROA 4A3LH 1ENAA 1TIID 3AULA 1K3RA 3A8JE 4RWSC 2D3GA 1YN5A 3KLSA 3U4VA 2LJIA 2IGDA 3IT6B 1Y56A 5HI1A 2OWOA 3I4NH 2PQAB 1EYAA 3L10B 1ZYRC 2LSSA 4CKBA 2A8VA 3TN2A 3K7AH 3SE0A 2N55A 4HSPA 2R3ZA 1CQVA 1A2UA 4F8MA 1J19A 4K3CA 4LLGM 1PGAA 2E6XA 3CPFA 4JI5L 1C4CA 2DYMA 4Y52H 4W9EA 2HDLA 5K36G 3EA6A 4DHJD 3R66C 3QC8B 1STNA 2K32A 1F9JA 4XE0A 3QK0A 2PZWA 4F87A 2R93H 3DOWA 1YNJC 3VR6A 3NE5B 1BR9A 1DD2A 3A8KE 3K57A 2VQFL 3H09A 2DX5B 3K8AA 2D3BA 1WI0A 2JWZA 1SFOB 1T0SC 2NBWB 3AE9B 2L32A 1KF6B 4PK1A 2B2WC 1EOTA 1KABA 3A5ZB 1Q1BA 4LNFA 3RZFA 4IOAA 1GG3A 1OGWA 1VZ7A 4MTNA 4MIUA 3BZCA 3EFCA 2XRQD 4BY7B 1XPRA 1NJIC 1TKEA 1GNUA 4ID6A 2YEPF 3W9CB 1XNRQ 2OHFA 1WRDB 2NN6I 2AX5A 4K2LA 2ZT9C 3CW2C 5TR5A 3F8TA 1V86A 1Y1VH 3MA2B 2KQ4X 1ICWA 4KGSA 1RKNA 3E0JA 2R7ZB 3NOBA 4MM3B 4N8FA 3R2TA 3CMAA 3TBLD 4GLAC 3P2BA 3NSWA 3WANA 3N20C 1G291 1MVKA 2FE8A 5C2TB 3FPPA 1XLNA 3JYUA 4EZKA 3J81i 1TWCH 1ZOYB 1WJ4A 2ZEQA 5D7GA 5J17A 2NVTB 3P4RB 2F4VQ 3VTUA 4X62L 3P42A 3I4NB 2MJ8A 4A3EH 2FJ2A 3K7AB 3TP5A 1F2YA 4EUTA 3GQBA 2MA9B 3ZGZA 1DONA 1LV9A 1VQ7A 2EYOA 2OF1A 1R4MB 2MRPA 3RCZA 4YTMB 2R93B 2Y5BB 3JAME 4Z9CB 2KVRA 1EQVA 5JJKA 4JQWC 2O6VA 2NBUA 2F0SA 3HFZB 3HOUH 1OTRB 1JWSD 4FXGC 3X3NA 5BN3A 3L0WB 3VUXA 1B70B 4NPNA 2PVGC 4I6PA 1H8CA 3A7LA 1CJEA 1EOVA 5J39A 1MSGA 2L0TA 4C3HH 2ENBA 1R4NI 2D5DA 1P3QU 2PNRC 2WFWA 4CHTB 1QT9A 1B3AA 3T4AC 5FLXL 4NAWB 1VDVA 1Y1VB 4XDCA 1WSPA 3UI3A 3CPWA 2KN4A 1XNRL 5I6YA 2JXMB 1RAXA 1U5KA 2O4XA 2H1EA 1X54A 4MH8A 3V62A 1ZKHA 4DUZQ 2A5HA 3CAMA 3RUIB 4EQPA 4IFDJ 5FJ8H 2E2JB 4DR7Q 2NBVB 3E3XA 2V3SA 3NHHA 3K0YA 1ET9A 3NK9A 4OIKA 2LXJA 1TWCB 3GTOB 2C9WB 1O7IA 3NTIA 4ZLTF 2ACZB 3JAMc 3I63C 1ZUD2 3L16A 3RZWC 4A3EB 1EIHA 1XQQA 4JI0Q 4LFBL 2KX3A 4M01A 1PFBA 4KKTA 2F4VL 3L17A 3EFXD 4A3PA 2KLGA 2KHJA 2NR2A 4JI4L 4IM3A 2R92G 2GVBA 3GTPH 1YQ3B 2E2DC 2L12A 3CC2A 2QDBA 2GBJA 3ZDMC 3RUZA 2A74C 3FKIG 5IGBA 3HOUB 3MTNB 1HNXQ 1SGHA 2L1AA 3OWEB 5LXHA 4JI6Q 5EBCA 3AEEB 4IUTA 2RCNA 3DM1A 1CA6A 3VDYA 1ZKOA 3RNCC 2OEDA 2O5IC 1LT4D 3K58A 4FLHA 2C7NB 4C3HB 4ZKCB 2MPMA 3DVNU 3AEBB 3MJWA 3FMCA 2ASQA 4A3GH 2O2VA 2V9HA 4DAYB 3HOYH 4FYDA 3H7SA 2DYBA 1VQLA 4PV1C 1QOGA 3D0FA 1LTTD 4GGQA 1BDOA 4IFDH 2DNFA 2X38A 1WCMH 2GLSA 1PRTD 4DXFA 2G4DB 4A3BG 3JC66 4J8QA 2ZW0A 2PZUA 1E2VA 3T51B 2KEEA 5BN5A 2L83A 4E71A 2LY7A 4DUZL 4NMZA 1PMRA 5EBDA 1SYEA 2LMCB 2VH2A 4ANUA 2GI9A 3PTFC 1G91A 4JI3Q 2K4KA 4II3B 3Q14C 1C48A 2ALYB 4DR7L 3I91A 3HOZG 2J0TD 1I50H 2A69C 2R7DA 4BBRH 5KGUA 1AZQA 1EWCA 1S1QB 1VD2A 2EYJA 3EVQA 1KLVA 1O78A 4DK5A 3J80i 2Y0SG 4BBSH 4QGUA 3KYDD 1N33L 1YEZA 1TZOA 2WXMA 4FN2A 2D10A 2WACA 3L4PA 1L1OA 1HR0W 4BS9A 4JI0L 4IUUA 1DJRD 3GTPB 2F1MA 4IM0A 1CUKA 2MHVA 2MGSA 2JPHA 3NHEB 3VR3A 1M1KC 1EUVB 2KLCA 2BH2A 1U4PA 1QUQA 2MFIA 2Q2IA 2PMZB 4CKCA 3DLLA 1VQ5A 1RIPA 1LTGD 3J81j 5C3EG 2J52A 3GE3C 3P1MA 3GZNB 3PPAA 4OWWB 1X6OA 4P6VF 3SDLC 1OQRA 4GDLA 1SJHD 2PW5A 5LL6S 4DA2A 2HQLA 3U4EG 4XT1B 1HNXL 2RPQA 1WD0A 3KF6A 1OEYJ 4JI6L 5AEKB 5JZEB 4LCDE 1PDQA 5T1IA 3IT4B 2QJLA 2IL8A 3K81C 1A6XA 4A3GB 1BCPB 3HOYB 1MGSA 1E10A 1KAAA 1PFMA 1EYGA 1Q10A 1YX6B 4AYBG 5EKLA 1K73C 1P8LA 2JXTA 5C0XG 2ZW1A 2K5DA 3PS6A 4LJOB 1WCMB 4RGMA 2PQAA 4L2YA 4WAFA 2F0FA 1IYJB 4DNIA 4Q5VA 4EEWA 1FXTB 1HA5A 1X3FA 2RHQB 4DU9A 4BXXG 2J0KA 1T9HA 1PTOH 2EYMA 4WIPA 3CQZH 1WH3A 1VMCA 1S72A 2XBBC 2VQEQ 4TSSA 4LF5Q 1DOIA 3U30A 2F0UA 4O2DA 1I50B 4HIOA 4BBRB 2WDVB 3OWFA 1Q8KA 1WM3A 3D6WA 2D0PA 2K75A 4JI3L 4M0WA 4MTKA 4GNXC 2BVCA 4BBSB 1OXXK 2I5LX 4R4CA 4DV6L 3A0JA 4FXDA 4RKBA 2W9NA 3K7UC 2DAJA 3E5SA 2ZJQA 1QWYA 3JW0X 3Q8DA 2KKCA 4JLCA 5G5GA 5AZHA 2FCMA 4XT3B 2KUMA 5HG2A 2F0JA 2V0GA 3DBRB 1A3UA 2RSNA 3TMEA 2JN4A 2PCFB 4A3MH 4QUFA 3PGZA 4DV4Q 3Q3NC 4HKZE 4LNNA 4ACFA 2F0OA 2JK8A 3TP7A 2ZTCA 1XJVA 4JI7Q 3V61A 1MHWC 1EF5A 3ABVB 4OL7A 1PH1A 4EZLA 1KRTA 5EJWA 4KHZA 2RPVA 3EFUA 2NZOA 3R7QA 1F77A 2B2VA 2Q2TA 1W3SA 1AW7A 3CCEA 3H0GG 4DHZE 5JXVA 1EY6A 4RHRA 1LUZA 1SXTA 2KCCA 2CWAA 3UE0A 2REXA 3P20A 5FLMG 1QVFA 5D94A 4YSZB 3VTWA 1ZGUB 1E1TA 3DUZA 5J3BA 4FF2A 1NE3A 2LFIA 1BQQT 1MG4A 1I35A 3CCMA 5IWAQ 1XT9B 1EIFA 4OONA 3JAML 4OX9L 3I4MG 3WA0A 1MJCA 1E3PA 3KQ4A 1Y14B 1KXLA 2NBFA 4PZ6A 4DFAA 5IGCA 4KV6A 1U4LA 1PTOB 3LNNA 2V3PA 3CQZB 3Q8FA 1TY2A 1CI3M 1FJGQ 1JORA 4QAYA 3P1HA 3PRMB 3QG1A 4HJGE 5EE1A 3VHTC 5GADC 3OMGA 1UBIA 2K8BA 1Q82C 1HTQA 5EE9A 2VQEL 2GMIC 4LF5L 2WAQB 2VUMG 2NMQA 2W82A 4LWCA 1ASYA 3S2HH 3HK0A 3S1MH 1STBA 4JOIA 3NS1A 2AHOB 3D32A 1A2TA 1UF0A 1SAPA 2PI2A 4P16A 2I5MX 4P2CB 3ONSA 2KHWB 2KDFB 3PZ7A 2V4IB 1QQRA 2L15A 4W9CA 5CORA 1EEFD 1QNUA 2IHFA 2K8HA 1W2BA 3AU7A 4A3MB 1L5PA 2GBMA 1S5CD 3B08A 4LF9Q 3TIXA 5E4WC 1WJNA 3ZKJC 3DWMA 4W9HA 2V4LA 5IP9G 4OVZA 1OQQA 4WH4A 3VRAB 3D4RA 4DV4L 4RMAA 3I2ZA 5DLQE 2FFKB 4JI7L 2PQEA 3VUWA 2GVAA 1T0QC 2D0OA 3M3YH 2ASBA 2N78A 5FO8B 3S9WA 1WTXA 1L6UA 1NR2A 1OXUA 1V1PA 4DK1A 1MI0A 2M56B 1P9DU 2EY6A 4C4VA 3VR9B 3FILA 1E90A 4IOIE 3UI2A 1YNXA 3ECIA 4CO7A 1O7YA 4CJ2C 2CW0C 1YJIA 1E22A 4DR2Q 3T56B 4C3IG 3P7JA 2K8CA 2WXGA 4GN1A 3BYYB 3P4PB 2NN6G 1NBFC 2IX0A 3OOCA 1OXTA 1N32L 1Q0WB 5IWAL 2RKSA 3MC9A 2QEXA 1SNPA 3HKSA 4GN4B 3M9BA 3HOXB 3KDFA 3DVGX 5DM73 2RDBC 2MHJA 3K9PB 4GKJQ 4REZA 1FJGL 3PUYA 4X65Q 1RWSA 1VZ6A 2QSDA 1EYDA 2IW3A 2XEWA 3S2HB 2BE5C 3S1MB 2KYWA 5BYRA 5C3WA 4IZ8A 1OFFA 2INDC 2K05A 3H6MA 2QMTA 2VZKB 4ZCKA 4IO9A 2PYKA 1S4ZA 1F9SA 3QAQA 3CC7A 4RA8A 1LT3D 4ZUIA 2WIIB 4YWMA 2FIDA 3MAQA 2F3IA 2MBQA 4RG1A 3F2CA 2LASA 1TS5A 4PNYA 3M95A 2A69D 2OTJA 4OO1I 2AQ3B 3R93A 1XF5L 4I65A 2N0SB 5HURA 3Q23A 2B8GA 4HKQA 4EE2A 2HD5B 1SE9A 4LF9L 1J8CA 3L2PA 1U4AA 3QWZB 1TGZB 2EXDA 3G6JB 2ZXRA 3W5VB 3KUPA 4A3KG 3F2UA 3M3YB 1HRJA 2L7RA 3KBXA 1G6PA 4DR6Q 1II3A 2KTRA 5GAGC 1FL0A 5JAVA 2IY5B 5LMUL 3AEGB 4GOPA 4DHJB 4A9AA 4JWUC 4JIOU 3PUVA 2FMCA 2ZM6Q 2LMCA 3QJZA 3FDTA 1BVSA 1KH0A 1BUVT 4DQOC 4LK1C 1JRUA 2JWUA 2H4OA 1TJEA 5JOBA 3KLSX 4J1MA 3I55A 2IO0B 1E0BA 4Y7NH 4APVA 1PH8A 1EIYB 3BS1A 3V60A 2L4NA 4DV1Q 2RBMA 5DNFA 4KDIC 3DHQA 5HHDG 1BCPF 1RL2A 1R4QB 2WYQA 2KQSA 4C3JH 4ZQ3A 4LJZC 2CJNA 1TWAH 5C4XH 2Q2HA 3SR1A 3TP6A 4POFA 2PMZE 4P1CC 4Q0FA 3U52E 1ZE3D 3NVWA 3I3CA 4KD3A 2K39A 4FJZA 2LVOA 1Y69U 1AZPA 3CMEA 4KHPL 3OAWA 5IYBH 1FNUA 3J7AF 3UIPB 5CV7A 3F2BA 3RMHA 1E6EB 1YNND 3TDQA 1R9TH 4X65L 3NTKA 4ZRJA 2RD0A 1Y8OB 3O13A 5CV6A 2ZTDA 2K5VA 1SSNA 5KHQA 2JA7G 4GNXA 5E4XA 1PV4A 4O42A 3SFEB 4A93B 1ZDVA 4JI1Q 1K9MC 5LMNL 5GAEC 4I6NB 2JA5G 3I90A 2PLPA 1QOFA 1E2ZA 2E75C 4DV7Q 2DBYA 3SK8A 4AJWA 2JJQA 2KK8A 4N59A 1QE6A 3RLOA 1TWFH 2IX1A 3AB5A 1X32A 3T16A 4DUYQ 1Q86C 3C46A 1EQTA 5JH5C 3H94A 2IDYA 3E56A 3Q3MC 4ANWA 3Q8BA 1S40A 3APCA 2EYPA 4GN3B 2WDQB 3CSTA 4RCNA 3PIPA 2WDTB 4A6QA 4XWWA 2QILA 4XQNA 4LF4Q 2FUHB 1YJ9A 1DOXA 3S16H 2ICIA 4A76A 1PH3A 2YEPB 2ZVOA 2X8XX 2OTLA 2LI5A 2ZM6L 1B9RA 3S1QH 3MHSD 1X3EA 2MEKA 1WOCA 2MQHA 2KOLA 5H8YE 3UDIA 4HSVA 4HIMA 1JJGA 2K14A 2LXKA 1STGA 4M8AA 1B4OA 1NR4A 3K5LA 1JT8A 4C3JB 1HCZA 2NVYH 2KXJA 1TWAB 5C4XB 2DUDA 4BY1G 1CKOA 4DV1L 1FMAD 5KRUA 2F4IA 1YQBA 1L0XB 2PMVA 1T3QA 3IG3A 2JUOA 5CHWA 4DV5Q 4G7HC 3HP3A 4JL9A 3TL5A 1VQCA 4DK0A 1BMLC 3QOLA 4OXPA 2PW9A 4KSKC 5M3FG 1PTOF 5IGGA 3SDZA 4M00A 2K9XA 1A15A 4XQJA 2HJ8A 2DZIA 3PUWA 2CS4A 1R9TB 2L9HA 2F0NA 4U673 4N58A 4JK1C 5L37A 4A3JG 2B39A 5ELEA 2JEBI 2D07B 4JC0A 2V1YA 4E74A 2LWPA 4XYOA 4CYEA 4ME5A 1Y8NB 3MJ5A 4L63B 3MVVA 4AS1A 2YTXA 2JYEA 1XD3B 2JA8H 3PT2B 2SNSA 2DENB 4JI1L 1TWFB 1G8ZD 3NWTA 5FLXE 3SHQA 1OO9B 3KJOA 4X64Q 4FF1A 3BZKA 1CA5A 2UUCL 2B29A 3AEDB 4DUYL 4X3KA 3SK6A 3BU2A 5T8IA 4JBWA 4LTUA 5FR3A 3DVNV 2K7VA 5EKIA 1RLFA 1CKNA 3S16B 4XYCA 4W9GA 4MGYE 3WAPA 4B3MQ 2KBNA 1UGMA 2J42A 4LF4L 4FULA 1E2WA 2XN9C 3VYSA 2FCQA 1WXVA 5HGQA 1D2BA 1K0SA 2RMMA 4GB9A 3APFA 1JMLA 1HNWQ 3PO3H 3PV0A 4CDFC 4WJNA 4C80A 2KVZA 2KMAA 3CRLC 3OW7A 3U9SA 2CW0D 2YYZA 2N3SA 3RULA 4K5XA 1PQSA 3SGIA 3T1YQ 2KJXA 2BB6A 2N9KA 4DV5L 1HJPA 4FNFA 3OW2A 1N36Q 3H3VC 3RNEC 2MH7A 4F1SA 5FLXc 3ZNID 1PRTB 4IWOA 4KMUC 2LGDA 1I4PA 5EQ0A 2O2VB 3KUDB 4WWMA 2N1VA 4QIWE 4AQYQ 1IL8A 3ER0A 4A3DG 2JA8B 1NCVA 2DWQA 1LACA 4RMFA 2Z4HA 1RFAA 2C5LC 1SNMA 4MT5A 4POGA 4RM8A 3FP9A 4GKKQ 3HOVG 2XK5A 2B3GA 1HZAA 1PZKD 3I7FA 5IP7H 1N9WA 2Z6KC 1MPEA 2YTVA 3T1HL 3CP0A 3LDZE 3GTQH 2R7ZG 4RH6A 1XX8A 3QIAA 4KI0A 3A55A 3ZJYC 1EIGA 4X64L 2KFKA 5IYDG 5CV9A 5KNCA 4R8IA 3BIID 4A8XC 1DYQA 4AP4C 3HEJA 3CCJA 2PE9A 3A4SC 5EKKA 4YL8A 2WB1B 2HIXA 4PMWA 2B2TC 2PJHA 4W9JA 4XX5A 5CX3A 3NVVA 4B3ML 5BO4B 4HPLB 3VR2A 1K8AC 3O65B 4B0EA 3KOJA 3GV6A 3WOEA 3PO3B 4KX6B 1QUQB 1KHIA 1PZID 1WF9A 2RSUA 3GP7A 1HR0Q 2L3ZA 2WX1A 3R2IA 3DBHI 1HNWL 4GDLB 2M2LA 4MN3A 2CR5A 3BINA 3FKYA 3CF6E 1XTCD 2WXHA 2M19A 1B7YB 3KF6B 2KANA 2KT7A 1I3QH 2CKHB 2EZVA 4EQ5A 2ZCBA 4IWPA 3KWVA 3NXWA 1FEHA 3T1YL 3PSIA 4KJNA 5LNK1 2HCCA 3AEFB 3NP8A 1AWDA 4N9F4 3ULJA 1GXDC 5CTRC 1EY4A 1LXDA 2GB1A 1O7ZA 4LF6Q 5D65A 1HEZE 4ZRQA 3TCAA 4BKGA 4XIGS 4PYUA 2B63H 1E7ZA 3J7YW 2WGSA 3HOWH 1MHHE 3QARA 3K5NA 5T1GA 2NZHA 3NWSA 1ZXTA 1Y1VG 2E8GA 4QCLA 1YJNA 3GTQB 3VQIA 3M3JA 2ID0A 1F9QA 4GKKL 2OJWA 3QR8A 5AZGA 5C44G 3OJ4B 2XGTA 4LFCQ 4M0WB 5EE0A 4QL5A 1E1OA 3DWGC
chains in the Genus database with same CATH topology
2IX3A 1XCTL 3B2GA 3PO0A 1GUTA 1ACCA 2ONQA 3MHZA 1RD9D 5ELDA 4A3IB 2H89B 2WXOA 4KY5A 2RSOA 4NP5A 3QJYA 4HRSA 3ETRA 4WURA 1PXUA 5DEHA 5J22A 4OHJA 2EELA 2J53A 2MJEA 4OZCA 1SDFA 1LLRD 1VCIA 2K22A 1I3QB 4ZHPA 3MXPA 2WU5B 2IGHA 5C5LA 2JYTA 1T6BX 3SK5A 2L1BA 3SVMA 3ZYYX 2BB5A 3NUCA 4C3HG 5K36H 5EPKA 5COYA 2B63B 1H9RA 3HOWB 1B2TA 5CBAE 2M0AA 1SBBB 3RD4A 1BOSA 2K5QA 3M7NA 4OO1G 3D6CA 2I46A 1JW9D 2SAKA 4EVOA 3P4SB 3W5UB 3V05A 3MFGA 5CGKA 1EY9A 2W55A 3N9YC 2JA6B 4YTNB 3HG9A 4HROA 4LAAA 4B08A 3NPPA 4RKLA 2B76B 3E9SA 4KY7A 4B0MA 3W3AA 3NBHA 4ZRZA 1I4HA 3OSOA 1V1PB 1RFKA 3FILB 2F0MA 1BBXC 4R8NA 3AMUA 3I8ZA 1C9FA 5KEEA 2DY8A 1IYUA 3W1SA 1PRTF 2NWGA 4YXDB 1Z6HA 1IBXA 1I6VC 1STHA 3S1RB 2NTSA 1HZ6A 4I7ZC 5C4ZA 1CM9A 4J3OD 3E6ZX 3AH7A 1S5ED 1E7PB 4FXKC 2KCNA 2L11A 2O2LD 3Q8EA 5H92C 1HUMA 2B2YC 2G9DA 4G7OC 1XO3A 4IUQA 4ARCA 3BK1A 4QB4A 2OXPA 3CRKC 4DN4M 2CHBD 5IGEA 3M7GA 1CHQD 2MP1A 2F0HA 4RGOS 1WTQA 4PQXA 4CBVA 2LHEA 1IUEA 1GPXA 1LO5D 1TYGB 2JEAI 3A8IE 1Y8PB 2EOTA 4FP5D 4H0LC 1CFMA 4ZAIA 1LABA 5JEAG 3PUZA 4US9A 1KDBA 2WXPA 2K5PA 1P7FA 1IHZA 3H91A 2KECA 4IKGA 3NUHB 2NYZD 5BYSA 4IUVA 2F0IA 5CYUA 3C1FA 4B9XA 1WTRA 2PVOD 3IL8A 3OHXC 1YN3A 2LEKA 3T3OA 4KHVA 1ZYRD 4MHEA 4OZAA 3C3LA 1TKYA 2BS4B 2BTEA 2FHTA 1X3QA 2L52A 2B2WA 1R7SA 4DNRB 4TQ0A 1YNJD 3R3OA 2JU6X 2ZXPA 3VYTA 2PW7A 1LT5D 5C0XJ 1Z7TA 1QOBA 1EZ8A 3IKJA 3VR4A 1K53A 1DM0B 1BUIC 4ZYSA 2LGIA 1PFNA 2YU9B 2BDNA 1MSHA 3HRDD 3OIQA 1EY5A 2EYHA 3MC0B 4S3SA 4KKIA 2R92B 4N9PA 2BA1A 1L4DB 4YWGG 3I57A 1F2ZA 1TVXA 3FKIB 3LXFA 4XTCS 2W54A 3AM9A 1L0YB 2F3WA 3RZOB 5MPOA 1DZ1A 5BMHA 4N6EB 4ZK9B 3Q24A 1S5FD 1K8MA 1EZ6A 5ISRA 2R6GA 3PIP3 2D5GA 1ILPA 1V97A 1CK1A 4K8JA 4OZBA 1RTOA 4XQQA 3URYA 3EQLC 3Q8CA 5C0XH 1YJJA 3D4DA 4A55A 4DGZA 2WINB 2EY2A 3KF8A 4KY6A 4FVMA 1J7AA 1D4BA 5FO9B 4UAIA 1QJOA 1KDAA 3HOZB 1DOMA 5IOCA 1QILA 3VA5A 1CT1D 5EGTA 1GUNA 1Q1EA 1E0ZA 1NVID 5K5PA 1QG7A 1UEAB 3FAHA 3I72A 5C3EB 5CV4A 1SYFA 3R8BA 3BZDB 3C1EA 1XYIA 1I4XA 2K33A 4CGYB 1ZEQX 4CQNA 1FR3A 2XIWA 4US8A 3DEOA 3SR6A 2BS3B 3K59A 1B9MA 1NENB 1Q12A 1RM6C 2NZ1D 1F0ZA 4AYBB 3M4OB 5HFYA 5ELFA 3VRBB 1ZP0B 2B2YA 1WTVA 2PZTA 4EQOA 2WXIA 3KLRA 1STEA 1UUPA 5M5XB 1S5DD 4A3FB 3IFDA 4X3TA 1QKZA 3AECB 1DOLA 2VXWA 1U4RA 2KACA 1R4PB 1M4VA 4G4KA 5EPJA 5HGTA 1JCKB 3I70A 3FPUB 3DWAA 1I6HB 5JPNC 5IIFA 2J4XA 2F0DA 1AN8A 2N88A 2JQRB 3LWUA 2IPKD 1SEBD 4XYQA 1OXSC 2JSVX 1UNSA 3K5MA 2W3RA 4IURA 4HEA1 3H0GB 3GTGB 1WXQA 1A70A 2IT1A 2TMPA 4DNTB 2QCPX 4DAPA 1FD7D 3AE8B 4WRDA 1SE3A 3DWPA 3J9CA 3I4MB 2NN6H 3GD7A 4YSXB 1NAPA 2HCIA 1JALA 3VYRA 1A3TA 4NKLA 1LTAD 4C7YA 2F3VA 4WQMA 3C8YA 1MD2D 1C77A 2VUMB 3LX0A 2F0LA 3H8HA 5AFWA 4PMCA 4IALA 3B2FA 4K5VA 1AFPA 5JVH3 1NYQA 4C56C 5JVG3 2BBCA 5AUKA 1H9KA 1FFVA 2JSOA 1TKWB 1HQMC 2XSCA 3U2SC 3Q22A 1GUWA 2MUYA 2QIEB 4IFDI 3MWYW 4IUPA 1FD6A 1L4ZB 1V8CA 3BDCA 1LT6D 1SNDA 3MP9A 2WS3B 5C4JB 1GOZA 2BA0A 1I4QA 1QCBD 4C3IB 3HS0C 1DCZA 3OIPA 4KN4C 3TEXA 1PUTA 1WGKA 4Y7NB 1QOHA 2E76C 2XVSA 2KVMA 4USAA 1RHPA 3SXHA 1G2TA 4RGTA 2WNMA 1HTPA 2E2IB 4JWSC 4FO2A 2I07B 1JC7A 4K6DA 2EE1A 1C4AA 5CV8A 3I73A 1EL0A 2EY5A 1EY8A 3EJIA 5C3JB 2DY7A 1TKGA 2KA7A 2D2CC 1SF0A 5DAUA 1C76A 5EPLA 1G2SA 2RVLA 4TQUS 5EE3A 5M5YB 2EKIA 3MXUA 2KEDA 2JE6I 2VB3X 2Z8LA 3M85A 2H88B 5KNDA 2K0PA 5A35A 2FMMA 2D9UA 1TWGB 4V0BA 1I4GA 2F0QA 3BVZA 4RF0A 1FCCC 1IBXB 5A2QE 3S1QB 1WD1A 2V3NA 5CBEE 1M8AA 2RA4A 4JPSA 4ARIA 2MJ3A 1I7HA 4XDXA 2NVXB 2Y3AA 1VF5C 2NVYB 1KLUD 3Q6SA 1B9NA 2NVQB 3MHBA 3T3NA 3S1NB 2FBWB 1EFID 3NVYA 1U9RA 3FRPB 1D6EC 1TS2A 1U4MA 3CWIA 2OT2A 3AE5B 3MZ5A 2K03A 4RCOA 1K50A 3DMUA 2EDGA 3AV8A 3TUOA 1D5ZC 2JA5B 4ZOHC 1HXYD 4X3SA 2Y5CA 3VR5A 5J1ZA 2NTTA 4K8IA 2JX5A 3X3MA 4GZYC 2BE5D 5IGDA 1ZXHA 2Y5PA 3WOFA 1ROEA 2EXZA 2CJOA 1STAA 2HQEA 5M5WB 4ITKA 2VB2X 1VZ8A 3AE2B 2INNE 4OW0A 2E74C 4KTAA 1ONLA 2CVRA 1SB3C 2PPBC 1G6ZA 5M3FB 3DEPA 1GJXA 4ZRPA 3P4QB 1SYDA 2F0EA 4R9WA 1FNWA 4A3JB 1WTOA 2WXKA 4KKSA 1V1OA 3AE7B 1FGBD 2BT6A 3AMZA 5M3MB 3MXNA 3LWEA 1L0VB 1ET6A 1SSOA 1YNTE 3KK7A 1TY0A 5M9OA 1TU2B 5I6WA 3NZ3A 2LHDA 5BMIA 3QO2A 3MTSA 1EWHA 3K6OA 1YQ4B 1RDPD 4EGVA 2A6HC 1D1IA 2ZXOA 4DF7A 4A90A 3G7LA 2LUMA 3OPOA 1Q3LA 1WTWA 3J80L 4HEDA 4CJ0B 1UGJA 4ILWA 1D1KA 2IJ0A 3ZJTA 5G3LF 2WXRA 1VJKA 3OMCA 2EPBA 4ODGA 1WTPA 2Z4IA 2W3SA 2KHSA 3EROA 4ZUJA 3KWLA 1EY7A 3RZDB 1TT2A 4BWGB 4G7ZC 4JE3B 1GHKA 1TS3A 1HZ5A 1F2RC 4TRDA 1NEKB 1TQOA 4HAEA 3LYYA 1FYCA 2AQ1B 1F2MA 2WXJA 5FOBB 1VR9A 1J8IA 2FINB 1IKLA 4A3DB 2PKOA 1MBYA 2HDMA 2WDRB 3ONAB 3D8GA 2EYLA 3TBIB 4WORA 3HOVB 1SE4A 2GA4B 4L6TB 5TSSA 2KMMA 3FVQA 5G3LD 2JYOA 3CKIB 4KKUA 1VLBA 3ZJUA 1CQFA 5LL6X 2WP9B 3BVMA 2AUKA 2LKVA 4H44C 4NJCA 1RCVD 3T53B 3GTJB 3V2TA 1ENCA 5FK9C 1JOOA 4H2AA 1HTLD 1SYCA 1T5EA 5CV5A 4E6IA 5AUIA 5C6AA 3GV3A 3B9JA 1ZPSA 3L9AX 3Q8AA 2B2VC 1GUSA 3SK4A 5C5MA 3VR8B 2SEBD 2XWJB 3ZQ4A 3GS2A 1N63A 3ITPA 4UDUC 5A2QL 2KAJA 2XRSD 1NYRA 4HMIA 1XLOA 1HA6A 4HMJA 4WFN3 1EU3A 5E3FA 4OO1H 2A6EC 5C44B 4KD4A 3MFYA 3BK2A 1MI2A 4IFDG 1KNAA 3TZDA 1WRIA 2JZPA 2C5CA 3Q0AA 3S14B 1GAQB 1XEEA 1WYGA 4C7ZA 1GB4A 4TKOB 4HCEA 5D3IB 4QMGA 1SNQA 3S2DB 1GUOA 4RHSA 1DOKA 3AE4B 2B2TA 4IN3A 3GTLB 1X3PA 3NQTA 3PMFA 1JWBD 1EEID 1BNZA 2LFNA 2X69A 2BW2A 3BYTB 3KBGA 4HCSA 2F03A 4ZKBB 1PLFA 5JEAJ 4IDIA 4LK0M 1NI3A 4TMAB 4H7BA 1J7CA 1XWEA 3QOJA 1K83B 1ESFA 5IT9L 1KLGD 4FXCA 3TSSA 4LMQD 1EM7A 2ICEC 3N6RA 5C4HA 2FUG1 3GTKB 2WXLA 1KTKA 2RDHA 4NAMA 2G9HD 3BVGA 5BN4A 2BOSA 1H9SA 1F2RI 4NDXA 4MACA 3I4LA 3P75A 3QWNA 3NQIA 4XDDA 2EY1A 2A6HD 1C8CA 1FCLA 1ENFA 1HPCA 1KDCA 3TEWA 1RYJA 2I2YA 3VYUA 4KGRA 2IWHA 1BO0A 1PYWD 2OEOA 3PIO3 3PO2B 1LTRD 3BDLA 2K01A 1CTMA 3S15B 1UAPA 3S17B 1RWSA 4F88A 2DN8A 2I38A 5JEAH 2AUJD 2F0VA 2RDGA 5D14A 4U68A 1ILQA 1IGCA 1ML0D 1QOAA 2DNEA 4DXGA 4KJOA 2PO4A 5DM63 2N9LA 4GDKB 1JR0D 3MXGA 5I2YA 3AE6B 3AE1B 2F0GA 4CKEA 1YNNC 2RQXA 3SEBA 1D5MC 4N9TA 4V190 4TQ1A 4H13C 1IYVA 1KNEA 4YTPB 4ZHOA 2L55A 2EVBA 3CIRB 1SYBA 4QUCA 2WQYB 3V3XA 1WWTA 4BA1I 1BCPC 4RGNA 2CU3A 1FRDA 3HZXA 4A3BB 1CHPD 1QNKA 2C9OA 4EQNA 4KKJA 2F0PA 1JB3A 4NZLB 2WLBA 2VNUD 1S5BD 4Q2JA 2R61A 1QF6A 1H9JA 1H9MA 2INPE 5BMGA 2TSSA 1O80A 2Y0SB 1HUNA 3SFDB 2J7ZA 5ELBA 3J81E 4IUNA 1EWYC 2QF7A 4BA2I 1F9PA 3PUXA 4AQ7A 3HKZB 2KDMA 5I9OA 1STYA 1GHJA 1UWXA 1FXAA 2BDOA 3AB9A 1SMYC 2LS01 4RNAA 1QLBB 1NUCA 2WP8J 3P63A 1TR5A 1JQYD 1Q90A 2E2HB 2PTLA 4ULLA 1WVLA 3U7ZA 1T5XD 4K5WA 1A3VA 2X6LA 2HTME 2F0WA 2A6ED 3HGBA 3CU7A 3RFZB 3EUB2 2QEJC 3L3OC 3LB8C 3ND9A 2EJGC 3HVDA 1E9MA 1AEXA 1C4QA 1TWHB 1JQ4A 3K5OA 5I4DA 2A68C 3D3RA 1AYFA 1JROA 3AN1A 2WXFA 1LTBD 1RTNA 1I4RA 1V43A 1JRPA 1PGBA 1ZXIA 5NUCA 1PTOC 5JJZA 1C78A 5D3DA 1EU4A 5FKAC 1Z47A 5CMDA 3QB3A 1Q8IA 3D31A 3AEAB 4QIWB 4F7XA 1JOKA 4O1NA 3TZUA 1W6JA 1XXGA 3NVZA 3MEHA 3A54A 2WV6D 3WCQA 1EY0A 4J6HA 4R3DA 1PFDA 5IGFA 1P7EA 4C3JG 2WKCA 1SE2A 1BXTA 2WKDA 1ZDXA 3RLFA 1JE4A 2KQ3A 1LTSD 2DNCA 5KYLA 2ON8A 2V4DA 2F0TA 2Z1CA 4L1BA 1L6VA 1CZGA 4IQZA 4DAYA 2NUCA 2EYFA 2D62A 4B9WA 2E3TA 3BWUD 3TEYA 1KFYB 1ESRA 1CZWA 2B2UC 1VRAB 1J7BA 3VA7A 3N52A 2M9VA 5CR3A 1C4PA 3I9V1 3ND8A 1IW7C 1QB5D 3PZ8A 3AE3B 3U9OA 2SDFA 3J80E 2O5JC 3GO5A 1FO4A 1LTID 2JP1A 1SYGA 4K6LA 4KK7A 4PT5A 1Y1WB 2XNAC 3IAS1 3CHBD 1K51A 1JICA 1CZPA 4JX1C 4D2KA 5JPMC 2EJMA 2K04A 1FNVA 2K5WA 3M4YA 1B53A 2DLBA 3HRZC 2M00A 1MHXA 1RJTA 2BCOA 5ELCA 5KIXA 3NRZA 3ERQA 3FEWX 1N5WA 3A7AB 4YT0B 3WDNA 1JWAD 2N7JA 1F2LA 4WJWA 3SHLA 1HFGA 1XLPA 1BCPD 3FC4A 1FIQA 4KGTA 3ZJVA 1RODA 4ABNA 1JWMD 3C2PA 1XCQL 2CQAA 2WXQA 3NBIA 1N61A 4OIJA 1HFNA 4NW2A 1B50A 1DXMA 1SNCA 5C3XA 1PZJD 3HUIA 4A3KB 5BYQA 1DGJA 1GB1A 2Q5WD 2KWDA 3HVZA 2K1BA 2DYOA 2F0KA 3J81L 1SMYD 3W2DA 5IODA 5G5HA 1BF4A 2X6GA 2MJDA 1YN4A 4M1UB 4K14A 1AP0A 1PGXA 2HDEA 1J9OA 1YMHE 1OXVA 3V96A 3BDOA 4C1NI 2EJFC 1O7LA 5KNBA 1K52A 3IAM1 2B8FA 5E6JA 3J7AV 4OGQC 1FM0D 2A68D 4KN7C 5KYIA 2Q8RE 3T13A 4CJ1B 3L7ZC 1FFUA 2JA7B 4XWTA 1F9RA 4X3UA 1DOYA 4K2KA 1PTOD 2A73B 4HN7A 1V8QA 5FO7B 3TP8A 5C0XI 2RDFA 4DAVA 1B1ZA 2SNMA 1NSNS 4YSYB 2Q8IB 1D5XC 3GTMB 1KRHA 2PIAA 1TS4A 4RAUC 1SJED 2Q8TA 2AQ2B 2QKIC 3RPFC 1JWUD 4G57A 1SNOA 1RF2D 3IXSA 5E1FA 2HUGA 1IGDA 3GB1A 3IAYA 3EGRA 2G1EA 1N5XA 4BY1B 1HHVA 5IT9E 4HTHA 3A56A 3TEZA 2XWBB 1H9SB 3DWQA 4QF4A 4L23A 1B44D 4XXEA 4RFBA 5LHY1 5F2DA 1N60A 2V0GA 2AWOA 2GRIA 4C2MB 4C1NK 4FF3A 1JOQA 2NB0A 1IKMA 1EYCA 2B2UA 3D4WA 2L5TA 2WXNA 1N62A 4PMBA 1SIJA 2WU2B 1FXIA 1PRTC 1FRRA 2K3UA 1UWMA 2K28A 3DXJC 2SOBA 2BS2B 1GUGA 2L0CA 3NTHA 1PDXA 4YIJA 1C79A 1HQRD 5I9PA 1W6KA 5CC4A 1IW7D 1VMPA 2VZKD 2K6AA 1VDZA 4HR7B 3IFTA 4GLSC 4L8JA 2AWNA 3BG3A 4FF4A 3Q69A 1XLQA 1VF7A 1K8OA 2IGGA 4RF1A 5I2XA 1ENAA 1TIID 3A8JE 4RWSC 1YN5A 3KLSA 2LJIA 2IGDA 3IT6B 1Y56A 5HI1A 1EYAA 1ZYRC 4CKBA 3TN2A 3SE0A 2N55A 4HSPA 2R3ZA 1CQVA 1A2UA 4F8MA 4LLGM 1PGAA 2E6XA 2DYMA 1C4CA 2HDLA 5K36G 3EA6A 1STNA 2K32A 4XE0A 2PZWA 4F87A 1YNJC 3VR6A 3NE5B 1BR9A 1DD2A 3A8KE 3K57A 3H09A 3AE9B 1SFOB 2L32A 1KF6B 2B2WC 1EOTA 1KABA 1Q1BA 1VZ7A 4MIUA 2XRQD 4BY7B 1TKEA 4ID6A 2YEPF 3W9CB 2OHFA 2NN6I 2AX5A 4K2LA 2ZT9C 3MA2B 2KQ4X 1ICWA 4KGSA 1RKNA 3E0JA 2R7ZB 4MM3B 3R2TA 3NSWA 1G291 1MVKA 2FE8A 5C2TB 3FPPA 1XLNA 1ZOYB 5D7GA 2NVTB 3P4RB 3P42A 3I4NB 2MJ8A 2FJ2A 3K7AB 3TP5A 1F2YA 3GQBA 3ZGZA 1DONA 1LV9A 2EYOA 2OF1A 4YTMB 2R93B 3JAME 4Z9CB 1EQVA 2F0SA 1JWSD 4FXGC 5BN3A 3X3NA 2PVGC 3A7LA 1CJEA 5J39A 1MSGA 2ENBA 2D5DA 2PNRC 1QT9A 4CHTB 1B3AA 3T4AC 5FLXL 4NAWB 1VDVA 1Y1VB 4XDCA 1WSPA 3UI3A 2KN4A 5I6YA 2JXMB 4MH8A 2O4XA 2H1EA 2A5HA 4EQPA 4IFDJ 2E2JB 3NHHA 3K0YA 1ET9A 3NK9A 4OIKA 1TWCB 3GTOB 3NTIA 4ZLTF 2ACZB 1ZUD2 4A3EB 1EIHA 1PFBA 4KKTA 3EFXD 1YQ3B 2E2DC 2L12A 2QDBA 3RUZA 2A74C 5IGBA 3HOUB 2L1AA 3OWEB 5EBCA 3AEEB 4IUTA 1CA6A 3DM1A 1ZKOA 2OEDA 2O5IC 1LT4D 3K58A 4C3HB 4ZKCB 2MPMA 3AEBB 3FMCA 4FYDA 4PV1C 1QOGA 1LTTD 1BDOA 4IFDH 2X38A 4DXFA 1PRTD 4J8QA 2ZW0A 2PZUA 1E2VA 3T51B 2KEEA 5BN5A 2L83A 2LY7A 4NMZA 1PMRA 5EBDA 1SYEA 2LMCB 2GI9A 1G91A 1C48A 2BYTA 3I91A 2J0TD 2A69C 5KGUA 1AZQA 1EWCA 2EYJA 3EVQA 1O78A 1TZOA 2WXMA 2WACA 3L4PA 4BS9A 4IUUA 1DJRD 3GTPB 2F1MA 2MHVA 2MGSA 3VR3A 1U4PA 2PMZB 5GXGB 4CKCA 2J52A 3P1MA 1LTGD 4P6VF 1OQRA 1SJHD 2PW5A 5LL6S 4DA2A 3U4EG 4XT1B 1WD0A 1PDQA 5T1IA 3IT4B 2QJLA 2IL8A 1A6XA 4A3GB 1BCPB 3HOYB 1MGSA 1E10A 1KAAA 1PFMA 1Q10A 5EKLA 2JXTA 5C0XG 2ZW1A 2K5DA 1WCMB 4RGMA 4L2YA 4WAFA 2F0FA 4Q5VA 1HA5A 4DU9A 1PTOH 2EYMA 4WIPA 1VMCA 4TSSA 1DOIA 2F0UA 1I50B 4BBRB 2WDVB 3OWFA 3D6WA 4M0WA 4BBSB 1OXXK 4FXDA 4RKBA 3E5SA 1QWYA 5G5GA 4XT3B 2KUMA 5HG2A 2F0JA 1A3UA 2RSNA 3TMEA 2PCFB 4QUFA 4HKZE 2F0OA 3TP7A 3ABVB 4OL7A 5EJWA 4KHZA 2RPVA 1F77A 2B2VA 1AW7A 5JXVA 1EY6A 4RHRA 1SXTA 2KCCA 3P20A 4YSZB 3DUZA 4FF2A 2LFIA 1BQQT 3JAML 3KQ4A 2NBFA 4DFAA 5IGCA 4KV6A 1U4LA 1PTOB 3LNNA 2V3PA 3CQZB 3Q8FA 1TY2A 1CI3M 1JORA 3P1HA 3QG1A 4HJGE 5EE1A 3OMGA 5EE9A 2WAQB 2NMQA 2W82A 3NS1A 1STBA 1A2TA 1SAPA 4P16A 4P2CB 3PZ7A 2V4IB 1QQRA 5CORA 1EEFD 1QNUA 3AU7A 4A3MB 1L5PA 1S5CD 5E4WC 3DWMA 4OVZA 1OQQA 4WH4A 3VRAB 3D4RA 2FFKB 2PQEA 3S9WA 5FO8B 1WTXA 1L6UA 1NR2A 1OXUA 1V1PA 4DK1A 1MI0A 2M56B 2EY6A 3VR9B 3FILA 4IOIE 3UI2A 1O7YA 4CJ2C 2CW0C 1YJIA 3T56B 4C3IG 3P7JA 2WXGA 3BYYB 3P4PB 2NN6G 2IX0A 3OOCA 1OXTA 2RKSA 1SNPA 3HOXB 5DM73 4REZA 1VZ6A 3PUYA 2QSDA 1EYDA 2IW3A 3S2HB 2BE5C 3S1MB 5BYRA 5C3WA 4IZ8A 1OFFA 2K05A 3H6MA 2QMTA 2VZKB 2PYKA 1S4ZA 1F9SA 4RA8A 1LT3D 4ZUIA 2WIIB 3MAQA 1TS5A 4PNYA 2A69D 4OO1I 2AQ3B 3R93A 1XF5L 4I65A 2N0SB 5HURA 3Q23A 2B8GA 4HKQA 4EE2A 3G6JB 2ZXRA 3W5VB 3KUPA 3M3YB 3F2UA 1HRJA 3KBXA 1II3A 5JAVA 3AEGB 4A9AA 4JWUC 3PUVA 2FMCA 2LMCA 3FDTA 1KH0A 1BUVT 4DQOC 4LK1C 2JWUA 2H4OA 1TJEA 5JOBA 3KLSX 4J1MA 1E0BA 3BS1A 2L4NA 5HHDG 2RBMA 5DNFA 3DHQA 1BCPF 1R4QB 4ZQ3A 4LJZC 2CJNA 3TP6A 3SR1A 4Q0FA 3U52E 1ZE3D 3NVWA 3I3CA 4KD3A 1Y69U 1AZPA 1FNUA 3J7AF 5CV7A 3RMHA 1E6EB 1YNND 3TDQA 3NTKA 1Y8OB 3O13A 5CV6A 1SSNA 5E4XA 4O42A 3SFEB 4A93B 1ZDVA 3I90A 2PLPA 1QOFA 1E2ZA 2E75C 2DBYA 3SK8A 4N59A 1QE6A 3AB5A 2IX1A 1X32A 3T16A 3C46A 1EQTA 3H94A 2IDYA 3E56A 3Q8BA 2EYPA 2WDQB 4RCNA 4XWWA 4A6QA 2QILA 4XQNA 1DOXA 2ICIA 2YEPB 1B9RA 2MEKA 5H8YE 2KOLA 4HSVA 1STGA 4M8AA 1B4OA 1NR4A 3K5LA 4C3JB 1HCZA 1TWAB 5C4XB 2PMVA 1FMAD 5KRUA 2F4IA 1L0XB 1T3QA 4G7HC 3HP3A 4DK0A 1BMLC 3QOLA 2PW9A 1PTOF 5IGGA 3SDZA 2K9XA 1A15A 4XQJA 3PUWA 1R9TB 2L9HA 2F0NA 4U673 4N58A 4JK1C 2B39A 5ELEA 2JEBI 4XYOA 4ME5A 1Y8NB 3MJ5A 4L63B 3MVVA 4AS1A 2JYEA 2SNSA 1TWFB 1G8ZD 3NWTA 5FLXE 1OO9B 4FF1A 1CA5A 3AEDB 4X3KA 3SK6A 5T8IA 4JBWA 4LTUA 5FR3A 2K7VA 5EKIA 3S16B 2J42A 1E2WA 2XN9C 3VYSA 1D2BA 2RMMA 1JMLA 3PV0A 4C80A 3CRLC 3OW7A 3U9SA 2CW0D 2YYZA 4K5XA 2KJXA 2BB6A 2N9KA 4FNFA 3H3VC 2MH7A 1PRTB 4KMUC 1I4PA 5EQ0A 4WWMA 1IL8A 2JA8B 1NCVA 2DWQA 1LACA 2Z4HA 1SNMA 4MT5A 1MPEA 1PZKD 4RH6A