3MFGA

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
molecule keywords Toxic shock syndrome toxin-1
total genus 52
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mfgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mfgA01
1RDPD 1TS3A 1S5DD 1TY2A 1I4PA 1LT4D 1EFID 2RDGA 1RCVD 5ELBA 1BCPB 2NTTA 2Z8LA 1LT3D 1TS5A 1XXGA 3O13A 1EU3A 1JWSD 1FNUA 1CQVA 1SJED 1D5XC 1DYQA 1BCPC 1CHPD 1ESFA 1HA5A 1SEBD 3URYA 1HQRD 2AQ2B 1D5ZC 1PRTB 3DWAA 5FK9C 1LLRD 1PTOC 1PTOF 1B1ZA 2XRSD 3TSSA 1EEID 4UDUC 1B44D 1PRTC 1RF2D 1I4XA 1TS4A 1ET6A 1ENFA 1V1PA 1S5FD 1L0XB 4RHRA 3MC0B 5I4DA 1LT5D 3R2TA 1RD9D 2XRQD 1EU4A 1L0YB 1LO5D 3V05A 3R8BA 1LTSD 1FGBD 1PTOH 5D3IB 2R61A 4RFBA 4ZYSA 1I4HA 1BXTA 3BYYB 1V1PB 1I4GA 4L6TB 2SEBD 1FD7D 1TY0A 1S5CD 1XTCD 1LTBD 3R2IA 1PZKD 1AN8A 1YN3A 1LT6D 2WV6D 1T5XD 1JQYD 1FNWA 1UNSA 3EA6A 1UUPA 1M4VA 2QEJC 1G8ZD 2TSSA 1PTOD 3KLSX 4RGOS 1S5ED 2AQ3B 3CHBD 1LTAD 1PRTD 1F77A 4DXGA 4K6LA 1SE4A 1JCKB 2XN9C 1PZJD 1FNVA 1ET9A 1KLUD 2J4XA 1LTRD 4RGMA 1BCPD 1PZID 2QILA 3GP7A 4NZLB 1JWMD 3BVMA 2RDHA 1SJHD 1AW7A 1PTOB 3BYTB 1CHQD 1LTID 1PRTF 1CK1A 3BZDB 4TSSA 1EEFD 4RH6A 1QILA 1S5BD 3MFGA 1SBBB 3BVGA 2G9HD 1PYWD 1BCPF 2AQ1B 5ELDA 1TS2A 5ELCA 5FKAC 1I4RA 1JWUD 4Z9CB 3OWEB 1HTLD 2IJ0A 1HXYD 5ELEA 3EFXD 3SEBA 4RGNA 4RHSA 1KLGD 2CHBD 1D6EC 1JR0D 2ICIA 3DWPA 2O2LD 1YN4A 2IPKD 1EWCA 5ELFA 5TSSA 1DJRD 3DWQA 5D3DA 4C56C 1D5MC 1LTTD 1SE3A 4RCOA 1I4QA 1SXTA 3BVZA 1CT1D 4BWGB 1YN5A 1V1OA 1SE2A 3W2DA 1LTGD 2XNAC 1STEA 2NTSA 1GOZA 4RGTA 1MD2D 4L63B 4O1NA 4OHJA 4DXFA 1KTKA
chains in the Genus database with same CATH superfamily
2WB1G 4XXEA 4CDFC 5GAEC 2OCEA 3VR3A 2HJ8A 3M95A 4YCUA 3H7SA 1JICA 3FP9A 4JBMA 3U52E 3S1NH 3ZKJC 3W9CB 1UF0A 4ZOHC 2NTTA 2ZT9C 1I50B 5CC4A 1TQOA 1UWXA 4QY7A 1Q1EA 4LF9Q 1GKHA 2ZTEA 1N36L 4KKIA 4OWWB 4MTNA 4JYAQ 3AI5A 4EQPA 3GDEA 3I73A 4B3TL 4DR4L 1E1OA 4IUVA 2PQAB 4GKJL 3PUYA 4DAVA 4GS3A 2LHEA 3PIPA 2E75C 2JPHA 4NB3A 3B1LX 4YY3L 3J7AV 1F2RC 4ZQ3A 5HFYA 1YQ4B 1D7QA 3QARA 3IL8A 5EPLA 2UUCL 2N1WA 4OX9Q 4RF0A 5IP7G 4A3CH 4DV2Q 3EUB2 3EHVA 3W1BA 5K36H 1EU4A 1H8CA 3V05A 1GUSA 4RMFA 1WXQA 4OL7A 5HKHA 1H9SB 3KF8A 2NVQB 2V3SA 4P1CC 4YSYB 4DR3Q 1I4HA 4L6TB 1T5EA 2JY6A 2K22A 5AUKA 3D4RA 1LM8B 3AECB 4OVVA 3HVDA 2ASQA 4AYBE 2JX5A 1C4CA 1ZOYB 1FL0A 1OXXK 3JAMc 1PLFA 2PNHA 4LFAL 5IWAQ 1QF6A 1WD0A 1SNQA 1TT5B 3K7AH 3W5OA 2BH2A 1VZ7A 3L17A 1FNWA 4Q0FA 1UZXB 2LUMA 3QK0A 1FVIA 2F0DA 1UNSA 3EA6A 2M2LA 3AEAB 3R7RA 1L6UA 1QCBD 1NMGA 2DJGC 2V3PA 3OIPA 1PRTD 4K2LA 4GKKL 1SYEA 1B4OA 2KKCA 3ITPA 4ZHPA 4J6HA 3HOXB 1FJGL 1WX8A 3U2SC 1ET9A 4G7HC 4YWLA 4L2YA 1C9FA 5LMUQ 2QILA 5GROA 4K81A 2Q2HA 1YJNA 1E2ZA 3ER0A 4KJNA 4DPGA 3B2GA 3MXNB 3E9IA 3KBXA 2X6GA 4LNIA 1PRTF 2L1BA 2RDFA 4LMQD 4OELB 2W3RA 1SSNA 3H09A 3A4SC 3MEHA 1TXYA 4A3EG 2OT2A 4HJGE 1GUWA 2WQYB 4P7IA 2B29A 3CAMA 4HSVA 3VH4B 2MW5A 2EKIA 1TBEA 2LD9A 4H2AA 1H4RA 3WAMA 2ZNVC 5LLIA 1KQSA 4ZRQA 3D6WA 2R2QA 5CX3A 1MG4A 2OOBB 1J9OA 1WVLA 2K28A 2EYOA 2WU5B 5E6JA 1YMHE 4LJOB 2N88A 3FILA 5C6AA 1VQLA 3TP7A 1PH8A 2JA6B 2ZJRA 2IBIB 2ZJPA 3N32A 2EJMA 2CWPA 2F0IA 3N3KB 4NPNA 4PS7A 1QNKA 3PRPB 1YN5A 3BS1A 4L8JA 3KJOA 4MH8A 2JN4A 1PH3A 4IURA 2QSDA 4KZ0A 1B53A 4IUQA 4KGRA 3PS6A 4A76A 4LF5Q 3ECIA 2LHDA 4J1MA 1DXMA 4ULLA 2C5CA 4DU9A 3I4MG 5C44B 1RFKA 1S5DD 3ND8A 1VCIA 5IODA 1YVCA 2LMCB 3S2DB 1VDZA 5C3EH 2WX0A 3HZXA 2PYKA 3CPFA 2RCNA 2D3CA 3OLMD 2YV5A 4HVBA 4PS8A 2INCC 3BWUD 2JVCA 1VQPA 3NS8A 2KT7A 2SAKA 3T16A 3Q0AA 1IL2A 4XDXA 1FIQA 1P7EA 2F0PA 2P5ZX 3N6RA 3S17B 2V4IB 3DCGA 3I57A 4WJ4A 1A6XA 4Y7NH 1XO3A 3E9HA 1PRTC 4JI5Q 4YHHQ 1ICWA 1IYJB 1YHQA 2QEXA 2ID0A 4QIWB 5GAHC 2KFJA 3KW5B 1XNQL 3F2CA 1GUAB 1FEHA 2M19A 3AN1A 1K3RA 5L95C 3NXWA 1YNND 1DD2A 1L1OC 1EYDA 1VQ6A 2MBHA 2NUCA 3MJWA 3I4NG 1QQRA 1EF5A 1T0SC 2I5MX 2WWZA 2ZVNA 4MIUA 1MI2A 2KJXA 1ML0D 4LUOA 3Q6SA 4L5QA 4G7ZC 3S1MB 1V1PB 1L4ZB 2F52A 1OTRB 1HZ6A 4XX5A 4GLVB 1XTCD 3L16A 4WQOB 1JOOA 1PZKD 1ZXTA 5IN7A 4C3IH 4KN4C 3MC9A 1LTLA 4WJNA 4LUZA 4AH6A 4BAXA 2WXKA 3ZNID 4YTPB 5MPOA 4K8JA 1P98A 2F0FA 3A4RA 3KUCB 2EXZA 4N8FA 4FNFA 5FO9B 5FO7B 1FYCA 3I5JC 2N49A 4DV6L 1B9MA 1S5ED 3HKZE 1KRTA 2DZIA 2PMVA 4B0MA 1FCLA 4JI8Q 4DN4M 4NPSA 3DLLA 4LF4Q 4OONA 4PQXA 1U5KA 4R4QA 2KDMA 2NVTB 2ZCBA 3RLOA 2GI9A 4IUPA 4GNXC 1F9SA 4JG2A 3PPAA 1GPXA 2ONQA 2XWJB 4WJWA 1JWMD 4DV5Q 4JWSC 1WYWB 3M7NA 4KGTA 4MEMA 2F0OA 1XPRA 4HIOA 4W9FA 3GTQH 4DF7A 4J6IA 1E10A 2UXBL 5E7NA 5BMHA 2N3SA 1QE6A 1JRPA 2MA9B 4JWUC 1EO6A 3RN2A 1STNA 2YVCA 4JI3Q 3J81c 3F2BA 2VUMB 4C00A 3LYYA 3JYUA 3OMCA 4C3HH 4OXPA 3E6ZX 4H7BA 2INPE 2JZZA 5AJ3Q 1J6QA 1J5EL 5CV7A 2E5LQ 3APFA 2IO1B 3EECA 3V61A 4FF4A 2BH8A 2HQLA 1WTWA 2N4FA 3VYUA 4CHTB 1SIJA 2VS1A 5C0XG 1QG7A 2NMQA 2ZXOA 1IBKQ 3CD6A 4CKCA 1JWAD 4BKSA 1RHPA 3HRZC 2L15A 4ZUIA 1V2YA 4B3RL 1K0RA 1F9PA 4XC2A 1J7BA 3LXFA 1SRUA 4DR3L 1XNRL 4GDKB 4GXBA 2WX1A 4WURA 4P2CB 2G9DA 1EIGA 2BBCA 3V6CB 2J7ZA 4B0EA 4BKSD 3EIVA 4EGVA 4EEWA 3U7ZA 1GD7A 4KY7A 4AWJA 2L9HA 3I70A 1V86A 1QZGA 2A69C 1STGA 3K6OA 3GTJH 1DOXA 5D6JB 5IYCH 1STBA 1J8IA 2CWAA 4D2KA 2XK5B 5M3FH 2A6HC 2B3AA 1SYBA 3PUZA 2KBNA 3RNUA 2KJHB 1WIAA 3PO2G 3PO0A 4C3IB 1YJ9A 1WXAA 3J81j 2B2UC 1VCBA 2AQ2B 3HOUH 2I5HA 4NXML 1E9MA 4MHEA 4F88A 1PH6A 3S16H 2N7JA 4EZJA 3C0RB 1EUJA 3TEYA 2SNMA 3G4SA 2Z59B 4DDID 4QF4A 2FUG1 5LXHA 1W3SA 3CC7A 3A1QB 2MNAA 3RT3B 4PZ6A 2K5PA 5I6YA 1PFNA 1WGYA 2J0MA 3KF6A 2RDBC 1A5RA 4IZ8A 5L83A 5E4XA 3E9SA 5CR3A 2Q2TA 4EZKA 1A15A 5EBDA 4HIDA 3T1HL 2V0GA 3V96A 4A3GG 1BXTA 5A2QE 2X69A 3S17H 2IL8A 4IOCA 2Q2UA 1TY0A 4EFOA 5EE3A 1LTBD 4RCNA 3HOVG 1YNNC 4ZK9B 2OXPA 4IKGA 2MQJA 1QWYA 3R93A 2A6EC 1J5EQ 3T4AC 3M4PA 1N33Q 5JPNC 3PGZA 4LK1C 3H0GH 2D2QA 3AE7B 4R4OA 4BBSH 4PZ7A 2KJRA 5IGCA 1K0SA 4GNXB 1W2BA 4S17A 4OVZA 2BTEA 4PMBA 2QJLA 1QOBA 2KVMA 4XIGS 1VQBA 5IYCG 4C3HB 3DBLB 3ZJUA 4IPGA 3U4ZA 2LGYA 3PLVA 4N58A 4XYCA 2KLCA 1IXRA 4DR6Q 5C5MA 2F0NA 3WALA 3BVMA 4N9PA 5IYDG 4QCLA 1AW7A 1R7SA 1RLFA 2K6DB 1OFFA 3SK6A 3F2UA 4JBJA 4KK7A 4GN3B 5DM73 1KF6B 3APCA 4Y7NB 3VTVA 4ABNA 1N5XA 2V3NA 2EXDA 4A55A 3J80E 1S5BD 2DYBA 2B2VC 4J15A 1VDVA 1QVFA 3DBHI 4OW0A 1Y8NB 2C9OA 4IUTA 1M90C 2IJ0A 5I9OA 1N9WA 3RNFC 2XGTA 1UD7A 2MBOA 4NXMQ 2PEAA 2N1VA 2CHBD 2M9VA 3VHTC 1R4QB 2DNCA 4IUNA 4GN1A 1WOCA 4YTNB 5IT9c 2KNBA 1V9JA 3N1ZC 3SHLA 1U4MA 4NP5A 1LYLA 3G71A 2RGFA 4LFBQ 3VR5A 5IP4D 2UUAL 3K8AA 1EY7A 2I38A 3X0WA 1RL2A 2LXCA 2WXPA 2KJ6A 3J7YW 1ZE3D 2GA4B 4HEDA 1UELA 4YSZB 5HY6A 2QCZA 3AB9A 4ZDVA 3AE8B 4DKAC 5JXVA 3IRBA 2OQ0A 1N8RC 2WINB 4LNOA 1JALA 3VH3B 3SDZA 3AE1B 1JRUA 1VF7A 3S1MH 3CQZH 1RDPD 3P1HA 3ZLZA 1IKLA 1A3VA 2JA8H 1J7AA 2N0SB 1TY2A 3OTOQ 2E2HB 4ZCKA 1WFQA 3V2TA 3CP0A 2KMAA 4DUYL 5FOBB 2XBBC 3E56A 5FLXE 1TS5A 1X32A 2R7FA 4V0BA 2E2JH 5JEAG 4MELA 5IP9G 3V6EB 1WGHA 1H9SA 2PI2A 3KF8B 3VR2A 2DUDA 3HKSA 2C5LC 2NR2A 1D5XC 1MJCA 4C4VB 1A62A 2RPVA 2WXFA 3N1XC 4JI8L 1VZ6A 2HUGA 2KD0A 2Z0DB 4AOFA 4X66L 1Q90A 3E0JA 4MTKA 1WTVA 1KIXA 4K0KL 1WI0A 3WA0A 1PTOF 1AWDA 2B63H 2AHOB 2HE7A 2EYJA 1WYDA 2NCNA 4DV0L 1YI2A 1VQNA 1V43A 3JAME 1N36Q 3MAQA 5GAGC 3S1RH 1D2BA 1ISNA 3OYYA 1IBLL 3IAM1 5IGGA 1MPEA 2H88B 3K5LA 4TQ0A 2HHHQ 1FMAD 3MZ5A 2CHZA 3BZCA 3UDIA 1TR5A 2IGGA 5E6OA 1E0BA 4URKA 2IX0A 2K03A 3OPOA 2IGDA 2H5XA 2MBEA 4IFDG 2Y3AA 5IKCM 2Z1CA 3HK0A 3UF8A 3A7AB 1K3BC 1PH1A 1ASYA 1YJJA 3ZXVA 2UUBQ 3DBSA 1KLVA 1PDQA 1R9TH 1WM3A 1K8RB 5KHQA 3GTOB 2KDEB 2WXLA 2J52A 4DFAA 4POFA 1K8GA 2F0QA 4ZAIA 2B2UA 5E3FA 5KEEA 5D94A 4A6QA 2LWPA 1EF1A 2AL6A 4KN7C 4B3TQ 4DR4Q 1PGBA 2BA1A 2NVUI 2K6AA 2CHWA 3SD5A 2VQEL 3AU4A 2MP1A 1WCMH 2IWHA 4NJCA 3WOEA 1DONA 3PO2B 2WNMA 4WH4A 2K75A 3TREA 5BN4A 2J4XA 3OW2A 1XNRQ 4A9AA 3J81L 1PZID 3K57A 2WXRA 3I4MH 2LFIA 5TR5A 2B39A 1X9NA 1OO9B 4CHKA 1NENB 2JE6I 4W9LA 4IFDJ 4U673 2DAFA 4HEA1 4K7SA 4B08A 2VZKD 1V97A 1VQHA 4OIKA 2YU9H 3RUIB 3D0FA 4W9CA 5G2NA 2RSOA 2A6HD 4JBKA 3M3YH 1LQBA 1L1OB 1UAPA 3I72A 5C0XJ 5CHFA 2WB1E 1GB4A 1A8VA 2LXJA 2FNJB 5EE1A 1IHZA 2DY8A 4A3MG 1WYGA 1Y1VH 2JA7B 2IY0B 1HR0Q 2KCCA 1P7FA 4NKLA 3BY4B 1QT9A 2JQOA 4ZKBB 4ME5A 3QOJA 1RRBA 1JR0D 4RWSC 5EGTA 1CMXB 2KHSA 4OGQC 4YWGG 4DR7Q 3G48A 2WGSA 1KJTA 1HZBA 1V9PA 3CCLA 2I1JA 1HNXQ 5KHOA 5DNFA 4MM3A 3RN9C 3I56A 1MG8A 3EJIA 3T3OA 4X62L 1WTHA 1R4PB 3BVZA 4I7ZC 3UDGA 3AMUA 2C7NB 3SDLC 4ANVA 5I2XA 5J18A 2MUYA 1XPUA 4A3MB 5DAUA 1H9MA 3H0GB 4JK1C 3TZUA 3KYDD 2PZUA 2L8JA 1Q8IA 2B63G 3HOZB 2FCQA 4FBJB 5BN5A 3CCJA 3FKYA 4GLXA 1ILPA 2O6VD 1F2RI 5IA7A 1QOFA 1NR4A 1SGHA 1IBXB 2RBMA 1WSPA 3SE0A 4E6IA 4KHPQ 4AJYB 1CJEA 3VR9B 3EN2A 4ARIA 3VR8B 4GNXA 1S4ZA 2ZW1A 2HIXA 2F0UA 5D14A 2VW9A 2ZM6L 2NZHA 2M0AA 2M8SA 1LT3D 1XXGA 4WFN3 4GMVA 3HOUB 2O5IC 1A3TA 2BPSA 2JQRB 5GADC 3SXHA 5K36G 4AQYL 2BW2A 4FF2A 1HA5A 2EDGA 1LGRA 1CSQA 3QOLA 1D5ZC 2CKZB 3L7ZC 3DWAA 3NPPA 4WWPA 2JK8A 2VQFL 1WJJA 1A63A 1JWBD 3CMAA 3RD2A 1ZDVA 2F1MA 1XCQL 2BKRB 2F0VA 4A3BG 1VD2A 1NE3A 1P16A 4YCVA 1V1PA 1EZ8A 3SU8X 4Y52H 4YSXB 1GAQB 3FKIG 2R93G 4A3JH 4HJ9A 1J8CA 2LXKA 4CDCC 3KF6B 4JI6L 2AUJD 1LXDA 4HJ7A 1NEKB 2IW3A 3D32A 2HT1A 1B8AA 1JB7A 1JMLA 2M4NA 3A1QA 4KV2A 3KUPA 5NUCA 1GO3E 1OQQA 1YX6B 4IPDA 2IGHA 4JI5L 2WDTB 3ZJTA 1I4GA 2SEBD 1VMCA 2E2IH 3AE3B 1I3QB 3PIOA 1V80A 2NVTH 4YIJA 3ENEA 3QHTA 1V5TA 1Y14B 1BBXC 2F03A 2PPBC 3F2DA 1I5FA 5IT9E 4W9GA 3QCAA 5C3JB 3AMZA 1X1MA 4LF6Q 2ZTDA 2R7ZB 2TSSA 2HQEA 4FP5D 1TWFB 4JC0A 2JA8B 2GB1A 1TWGB 3S15H 1A2UA 2VNUD 1PDXA 3UINB 2V4LA 3ZQ4A 3NY5A 3C1FA 5IWAL 2JA6H 2XN9C 3FDTA 4WAFA 1FNVA 3SK4A 1QOGA 2UU7A 4MH0E 2Q8RE 5J39A 4S3SA 2H4OA 3T51B 4HXDA 4GDKA 1A3UA 1HEZE 1F9QA 3MHBA 1PTOB 4M02A 2B3GA 1J19A 2WU2B 4US9A 4TSSA 2BYEA 1C79A 1PH9A 2KFKB 4XTCS 4HCEA 4JI2Q 4A20A 2FHTA 3MFGA 4CDEC 3H3VH 3BVGA 1WX7A 3IHPC 3HOYG 1WF9A 1I4RA 1SYGA 1GUGA 4A93H 3C3LA 3LB8C 3W1YA 3TJPA 1KLGD 1E7ZA 3MWYW 1HNWL 3KLWA 4BBNC 4DHZB 1BBWA 2JA5G 3AEEB 4QUCA 1E6EB 1HNZL 5EPKA 3ZDMC 2EQSA 4GIVA 2LKVA 3TP8A 3R66C 1PMRA 1LM0A 1YHBA 3SK5A 2CCZA 1ROEA 1WJNA 2ACZB 1E7PB 2JWZA 2KOXA 5FJ8H 3LDZE 4POGA 3HG9A 4N9TA 2HD5B 4AIMA 1C9OA 1NI3A 4DXFA 3ZW3A 2AWNA 2E2DC 3EFUA 4R1JA 1RIPA 4X3TA 1TKEA 1ZYRD 1LT4D 1VS0A 5AZHA 4ZUJA 4ZRKA 5ELBA 5CTRC 3AE6B 1SDFA 2QGQA 2BT6A 1EU3A 2E76C 1VQFA 2QC8A 1JWSD 2DNEA 1FNUA 2EY2A 1XF5L 1EWIA 5M5WB 2QF7A 3QJYA 1PRTB 1BF4A 1X3GA 3I7FA 4KMUC 1O7YA 2DZMA 2K52A 1DGSA 2RF4A 1ILQA 1II3A 5JJKA 3VUYA 3K7UC 1YNXA 2B8FA 3BK2A 1TS4A 3OOCA 3G7LA 5M3MG 2BQQA 3RNAC 2MQHA 5LXIB 2X6LA 4RHRA 3RD4A 2AMCB 2IX1A 1X3EA 1V6EA 3KQ4A 1LT5D 4X64Q 1FFUA 3JVZX 2XRQD 2MBBB 2KWVB 3R8BA 1MI0A 1XLQA 4JI7L 4C1NK 3AYHB 2WXJA 4IW0A 4DBGA 5JHBA 2F0KA 2F3IA 1CA5A 3FC4A 4GOCA 3Q8CA 4EZLA 5C4XB 3NTKA 1A0IA 5E4WC 1Z47A 4B3SL 5IOIA 2A73B 3CCQA 4IFDI 2BYVE 2KHWB 3K59A 3S2DH 1B50A 2L7RA 3GB1A 1XYIA 3R3OA 3KWLA 4QMGA 5M3MB 2VZAA 1A2TA 3PO3B 5J2RA 1O80A 3B9JA 4JX1C 3FKIB 2WDQB 3O65B 2DHZA 3LNNA 3BDOA 1JROA 2PVGC 2ZVOA 2R7DA 2G1EA 3STBC 4YCWA 1TWHH 1IYUA 1PTOD 1YNJC 1BUVT 5DLQE 1X65A 4MSQB 1YQ3B 3AU5A 3K7AB 5G55A 4RNAA 3ZJVA 3QIJA 4BVUC 3TCAA 3J80L 2PKOA 4C3IG 4DHJB 1SN8A 3PZ7A 2NN6I 1QOAA 3WIMA 5HGQA 2JYOA 2FIFA 2K3UA 3DVGY 3GP7A 3DXJC 4JPBW 4X65L 2MSED 3BYTB 3Q14C 4DAYB 3ZNGC 1WTRA 5AJ3L 3I4NH 4QL5A 4G3XB 1XLOA 3HOXH 5EE0A 4REZA 2F4VL 4DR6L 3KFUA 3FHWA 3TP6A 1L7YA 3HUIA 3ONAB 3T1YQ 1NBWA 2WXGA 4IOIE 3H0GG 3PF5A 5CV5A 4CGYB 2NVXB 2WXQA 3ZYYX 2Z0SA 1TJEA 1TWCB 1HXYD 3RYTA 4IOAA 4GN4B 1E7UA 1EWYC 3J7A5 2JXXA 5IIFA 1L6VA 3NE5B 1EZ6A 1G6JA 3QB3A 3BDLA 2WYQA 3OIQA 3DBHB 4MGYE 5CBEE 1B9RA 1XD3B 5AUIA 3K81C 2KCMA 2RKSA 3MHZA 1XLNA 3H15A 1EIHA 3P20A 3A9JB 1IYFA 4IM2A 3MXNA 1C8CA 1STEA 1G6PA 2KDIA 5CV4A 4K2KA 2PZWA 1KL9A 1X54A 3DVNV 4FO2A 1MVKA 1YJWA 1KTKA 4HLEA 3TS0A 3PHWB 1SNCA 2EOTA 5I2YA 5F2DA 4EKUA 1I4PA 4CKBA 2OF1A 3SK8A 1I94Q 2LVQA 2W82A 1HR0W 3VVWB 4BXXG 2WP9B 5C5LA 2L0FA 3VA7A 3CCVA 2TMPA 1PGXA 4JGHB 3J80c 2PMZE 3AEDB 3RPFC 1N32L 2REXA 3GTJB 1AZQA 2KQ3A 1SJED 2BS3B 4LDTB 1DYQA 2QKIC 3DUZA 3D4DA 1Z7TA 4IG7B 1X3FA 1XX8A 3IFTA 4NAWB 2DY7A 2HTME 2VY3A 3NZUA 4ANWA 5C44G 5H8YE 1B1ZA 3EC8A 3IAYA 2OTJA 2LI5A 3OG5A 5C4JH 2E2HH 1I4XA 2L1AA 5HG2A 1N32Q 4F1SA 4C3JH 2JA7G 4W9JA 3V3XA 3AFQA 4CDDC 2ZEQA 3RMHA 2DWQA 4WJQA 4ZRPA 1MHWC 4BBRB 4R4CA 1WR6E 2VH2A 1LO5D 3IXSA 5LMNQ 4N9F4 1NJIC 2QHOA 4MM3B 3H94A 4RFBA 2PJHA 3TEHB 2KEDA 3PZ8A 1Q82C 5EKIA 1XCTL 1ZPSA 4EQOA 3ERSX 4UY8C 3S1NB 5IYBH 2VB3X 3D4WA 1MFWA 4M01A 2ICEC 1UGJA 3T8MA 2GVAA 3A8KE 2QMTA 2CJOA 2WS3B 3HVZA 5BYSA 2ASBA 2KUMA 4KSLC 1MKHA 4XYOA 2PQEA 2MJ8A 3U30A 3D3RA 2RCFA 2K1BA 5EPJA 2LRUA 3L13A 1L1OA 3LWEA 2KFKA 1EY0A 3RNEC 2JUOA 3DBLI 5EJWA 1K9MC 5C4XG 2R93H 1SE4A 2N7DA 1SR3A 4F7XA 2KQ4X 3NQTA 1JE5A 4A3BH 2KTFA 3KVFB 3EROA 4ME3A 1D3ZA 3TUOA 1K50A 2MJDA 3UDXA 1GC6A 1BCPD 2PZTA 3NBHA 3Q8DA 2MGSA 3MEFA 1L5PA 2KHIA 3KBGA 3U50C 1QUQA 4OX9L 2LVPA 4K1RB 3AE2B 3SFDB 3A55A 4RG1A 3GTGB 3VYRA 1UBIA 3W1SC 3HKZB 1ZYRC 4S0RA 1QILA 2WAQE 2K39A 3NK9A 2RMMA 2EE1A 1WI5A 2D3AA 1N6ZA 1BCPF 4BA1I 1EFWA 3P4QB 1NCVA 1TIID 1HPCA 3RLNA 3K9PB 3OWEB 3K58A 4KDLB 3KDFA 5CHWA 2XEWA 3SEBA 3EFXD 5IYBG 2K8CA 3DHGC 3QX1A 4PYUA 3WANA 4HCNB 1FM0D 1Y1WG 5M5WH 3PTFC 4H02A 4HCPB 1DZ1A 4JVZA 2SDFA 4IWQA 4FN2A 1S3OA 5G3LF 3HOZH 3C8YA 2MWSB 3ULLA 4GKKQ 2BYFA 3JC66 2Z6KA 1YJIA 5E1FA 5EKKA 3OTOL 1Y8PB 1E2WA 2JSVX 4FJZA 3B2FA 3ZTDA 1CQFA 1VMPA 4JV5Q 2WLBA 2A19A 5BO4B 4EQNA 3I2ZA 4FVMA 3PIP3 2GBMA 5C3XA 1C4QA 2NWGA 4GB9A 1TS3A 5G3LD 5IOCA 1GUOA 2QA4A 1KDBA 1PYSB 3GTKH 1Y56A 1MIUA 4C1NI 1Z9FA 2K04A 2RA4A 1NYRA 3S1QH 2HDEA 3I90A 2G3QB 4GU2A 3NELA 2K8HA 2RHSB 1WJ4A 1Z2MA 3OSOA 1WXSA 2H89B 4HK2A 3OWFA 1IBLQ 2OWOA 1ZKHA 4KVGB 1E0ZA 1F52A 3H7PB 5JHAA 4JI1Q 4JI0L 4JLCA 4HJ5A 4K5VA 1HNWQ 3RI7C 4WWOA 2JP1A 3LX0A 1ET6A 4DUZQ 2L76A 3T3NA 1O7LA 1UEBA 4O42A 5M5XB 3U9SA 4LFCQ 3HOWH 2KX3A 4G57A 2JYTA 3I63C 5I4DA 1V49A 3A54A 4KSKC 1JOQA 1IPGA 2FFKB 5ELNA 4IUUA 3GE8C 4IJHA 4XQQA 2JA5B 1F9RA 2UUBL 4GKJQ 1X3QA 3VYTA 2PMZB 1PTOH 4ZYSA 2UXCL 4IC7B 3P42A 4DR1Q 2A74C 1Z5SB 3G6EA 3T1YL 3I4NB 1YJ1A 4OVUA 4NXNL 3AE5B 1JJGA 3GTGH 3P63A 4HIKA 1CKNA 4NJ6A 3D8GA 4MGZE 3GOEA 1SMXA 2K9XA 4PV1C 3Q3FA 4L1BA 4PG3A 1N63A 3OHXC 1KOTA 2ZM6Q 1M1KC 3GZNI 4USAA 3HOXG 4IN3A 2PO4A 5A2QL 3K5MA 1M4VA 3GTKB 3KLSX 2HDLA 5IP9H 3TRZA 1K73C 4DR2L 1LTAD 2D07B 1BDOA 4LK0M 4N6EB 3G6JB 4OWXB 1DCZA 1SAPA 3OMGA 1YD8U 4R9WA 4B9XA 2C7HA 4KIKA 2AKWB 3NHHA 1E2VA 2ZXPA 4DV4Q 4JQWC 4F8CB 1BNZA 2KANA 3I4OA 3QWNA 3PV1A 1GC7A 4QB4A 1XMOQ 5G5GA 1LTID 4XZ4A 2L55A 3VDZA 3DHQA 4NMZA 1NY4A 1HR0L 2NPTA 4LNKA 3IFDA 3M4YA 4BFRA 1L4DB 2EJFC 3FVQA 1VZ8A 1VQIA 2DLBA 4NQKE 1GHJA 4LLGM 4G50A 1OXUA 2Y0SE 4JI4Q 2OHFA 3J7AF 3HM6X 3W5UB 3AB5A 3MA2B 4AQ7A 1E90A 3HP3A 3A9KA 1NVID 2D62A 5ELDA 2PW5A 1JC7A 1P1AA 4BBRH 1HTLD 4P16A 5EAYA 4LFAQ 3QA8A 1K83H 4ILWA 2X38A 2K5WA 3DHIC 4ICUA 3VRAB 4A3IH 4U68A 2D11A 1ONLA 5BMIA 1FFVA 3VYSA 4DUZL 2LRWA 1HE8A 2ZNVB 2IDYA 1SROA 1DOLA 2F0SA 1M8AA 2F0MA 4W9DA 2KA7A 3CIRB 2LVOA 3CF5A 5H1SE 4KD4A 1FXAA 1SNOA 1TWAH 2KOLA 2BDNA 1KRHA 3FAHA 3PHXB 1F9JA 1OQYA 4ZYNA 1YNTE 3C2PA 4IM0A 3WCQA 4UAIA 4HJAA 1OXVA 2DGYA 2VQFQ 5JJLA 4LF7L 2X8XX 5CHVC 2C35B 4MJSB 2RDGA 4R8IA 1F2ZA 1RCVD 4JI1L 3RN5A 4JI0Q 4J8QA 2F4VQ 1TKWB 2BB6A 3M9BA 2Y5PA 1MHHE 3K9OB 2NBFA 1HHVA 5M3MH 2GBNA 3J9CA 2G4DB 4A3GB 2XK5A 3FRPB 1SEBD 3Q8AA 1IUEA 4DR2Q 3TN2A 4R4IA 5DEHA 4OEMB 3B0AA 2CU1A 2LXAA 2JA7H 4DNIA 3AEVA 4TKNA 2EVBA 2M0XA 1CKMA 1V8CA 4KHVA 3P7JA 3AEBB 3LWUA 4NW2A 5C44H 1Q12A 4JIOU 3UI2A 1SE8A 2SNSA 1E22A 2K4KA 4K5WA 1PV4A 3KLRA 3RFZB 1JMCA 2EYMA 2GBRA 1L0YB 1BBUA 1YBYA 2Z9HA 4LWCA 2CR5A 1VQ9A 1KXLA 4TUUA 3ZVVA 4BBNF 5IO9A 2WXMA 1GNUA 4BXXH 5IGFA 1V8QA 2RQXA 1QB5D 4UP9A 1F0ZA 3NZSA 1K8MA 2JF5A 3SHQA 2LJIA 4KKTA 2B2YA 1HA6A 4K5XA 5LHY1 3JAML 4II2B 4XGAB 4X64L 4CQNA 4A3KH 2Y0SG 2NB0A 1I6HB 2J53A 1I94L 4DAPA 4GOPC 5EE9A 2WFWA 2I46A 3M85A 4R8NA 1H9RA 1PA6A 3IFWB 1R4MB 3MJ5A 5ISRA 2JEBI 2RSUA 4GDLB 4BY7G 4HCSA 1XMOL 2AQ3B 1CI3M 2Z6BA 3AXCA 4KX6B 3ND9A 4TKOB 1ICFB 1PQSA 4HAEA 4P1BC 1RWSA 5M9OA 2VL6A 1ZP0B 3NS1A 4I6NB 1WGRA 4A93G 2VUMH 3N9YC 3J81i 2FMCA 4RGMA 2NVXH 5C1ZA 1XMQL 5BMGA 1XNQQ 1ZXIA 2G45B 1YITA 2E3TA 3C46A 5GXGB 1EOVA 4NAWA 1YQBA 4NY0A 3P75A 3KWVA 1HQMC 3PO2H 4V190 3B6YA 3T1HQ 2F0TA 2QCPX 3HOWB 1PFMA 1V81A 3Q3OC 5C0XH 1EYCA 1HNZQ 1E8ZA 1QZEA 3CMEA 1TS2A 1GUNA 1C4PA 2KN4A 1JWUD 3ZRCA 3T53B 3RZOB 2FCSA 2B63B 2YU9B 5AEKB 1NAPA 3TEXA 4FHJA 4RGNA 1XQQA 1JJCB 2CVRA 4QUFA 1IKMA 3DWPA 4DK1A 4FXDA 5ELFA 3S24A 5AZGA 1TWFH 4YY3Q 4W9KA 3DWQA 4MDKE 1I50H 1MSHA 4HTHA 5D3DA 2O2VA 2LS01 1U4LA 1VJKA 3VA5A 4YL8A 3CCSA 1IYVA 1G2TA 1UWMA 2M00A 1W6JA 3K80C 2V4DA 3RLFA 4HROA 1CT1D 3A56A 1IW7D 1U9RA 2N8NA 4LF4L 4C7ZA 3M63B 4TQ1A 3DHHC 5JJIA 3UQBA 3S14B 1HTOA 3JSVA 4KY5A 4JPSA 5IAAC 1W6KA 1Q86C 2Y5BB 5BR8L 4AS1A 2BS4B 1Q8KA 5D7GA 3MVVA 2MX2A 2KMCA 2PNRC 5I9PA 5IE8A 1CM9A 3CRLC 2JT4B 3X3NA 2Q2IA 3AQQA 2A5HA 5FR6A 2MHVA 1EY6A 1SFOH 4ZRIA 2PI2E 3FKIH 2INDC 4MN3A 1SF0A 2MH7A 4LF8Q 2W55A 1X55A 4NNJB 2MP2A 3L2PA 2UWQA 1IW7C 2ES2A 2N9EB 2NS5A 4B3ML 1MSGA 4YXDB 2BKFA 1NBFC 3ML9A 1S3SG 3PSEB 2KWUB 1F1HA 1EQTA 1B44D 4L5RC 2K8BA 4KKJA 2D3GA 5FLMG 2DZJA 4PMWA 1HRJA 3STBD 1RTOA 1AP0A 5D2MB 3HS0C 1S72A 1JB3A 2DAJA 4P6VF 3WAOA 3L3OC 3KLSA 3CCUA 1FXTB 2R61A 2K0PA 3FILB 2D2CC 3BYYB 1WE7A 2KDFB 4PYZA 1Y8OB 1TWCH 4A3LH 4QGUA 1O7ZA 4A3DB 1AH9A 3JAMi 4OZAA 1TWAB 4Q2JA 3A8JE 4LW1A 2HCIA 1LT6D 2R93B 1UGMA 1GB1A 3QG1A 3RNCC 5FJ8G 2YTVA 1C78A 2JZPA 2O6VA 4ACFA 4LNQA 5DPWA 1GVPA 2QEJC 1B9NA 2K5VA 3HOYH 5IGBA 1OEYA 2C7MB 3ALBA 3ETRA 3CPWA 1U0LA 2IT1A 2FIDA 1QVGA 4TMAB 4P75A 1T6BX 1KABA 1HZCA 4LDTD 1EQVA 1RAXA 3IT4B 3AE4B 4K3CA 2KTRA 2L00B 2R3ZA 3PRMB 3KYCD 1OQRA 2YTXA 3OW7A 2BDOA 2KQSA 3GE3C 4DWFA 3S2AA 4FYDA 3GTLH 3P4PB 3Q22A 3K0XA 2LUEA 5M5YB 3UIOB 1DM0B 3NP8A 3ZGZA 5T1IA 1EEFD 1F2LA 2I1KA 4MGIE 1WMHA 2L4NA 3PUXA 4C2MB 2E5LL 3JW0X 1H9KA 3AU7A 3A74A 3AULA 4ALPA 1QVCA 4G11A 1E5WA 2BCOA 1HTPA 1PYWD 5FKAC 3GS2A 5C23A 4HPLB 2Z4IA 1Q1BA 1U4PA 4CO7A 4A3EB 1CTMA 4HDOA 1BR9A 3S1RB 3DMUA 1PH5A 4W9HA 1G51A 4B3RQ 2N9PC 2ICIA 1D6EC 4WRDA 4OO1H 3E5SA 3DWGC 2KYWA 2IPKD 4NJ7A 2KEEA 2IY5B 2KN5A 1XWEA 2PPHA 5G5HA 2KTRB 3DEPA 4C56C 3GTMB 1HH2P 4EUTA 4PS3A 3UI3A 2KC1A 1S40A 3I4MB 3CCMA 2NZ1D 4JI7Q 2EKEC 1JT8A 4DK6C 2JA9A 1ZXHA 1I3QH 3I3TB 4RGTA 2ZCCA 3IKJA 4OHJA 5EQ0A 1Y1WH 1LABA 4UP7A 1AZPA 5E6PA 4XWWA 5C4HA 2R92B 1PFBA 1GG3A 2CHXA 4M00A 4XDDA 3U4VA 4DXAB 1FD6A 2FMMA 1E8YA 2G4SA 1BVSA 4IDIA 1WGDA 1CUKA 4CBVA 5M3FB 3NRZA 3VXWA 3HGBA 2ATWA 1TKGA 1LV9A 1HZ5A 3BZKA 1Y1VB 3NWSA 4ZRZA 2UU9Q 3SVMA 2VXWA 1SNMA 4RAUC 5JAVA 1CFMA 2LMCA 4WAAA 2RSNA 1GJZA 4EE2A 2I5LX 2BVCA 4B9WA 2K5QA 2JRHA 3BIID 3ZTCA 4IALA 1LLRD 1PTOC 1TU2B 2N78A 4UHVA 3VTWA 2XIWA 1O78A 1EIFA 1YNJD 2BWES 4HKZE 2K33A 5LL6S 1GM5A 2UXDQ 2O5JC 2WDVB 3CWIA 3EGRA 2MHJA 3CCRA 4AUQC 2W9NA 1J7CA 4X6AH 4ARCA 1SYDA 2BE5C 2IO0B 3BJUA 2V1YA 3B08A 2MP2B 3FMCA 4CKEA 5A35A 5D3IB 1R4MI 1E7VA 1KRSA 2M17A 4A93B 2K50A 2LZ6A 4HRSA 3QIAA 1V1QA 1NTGA 1WZ0A 3CF6E 1UE6A 3AEFB 2BB5A 1T5XD 4JL9A 2ZJDA 4GLAC 4BBSB 4I65A 3JSVB 4DR1L 3MC8A 1UH6A 1G8ZD 2E8GA 4RGOS 5T1GA 1C77A 1JJ2A 2F0HA 2Y0SB 1WTOA 5IP7H 1IBKL 4A3CG 4K7UA 1D4BA 3GO5A 2E74C 4DXGA 5HURA 1QLBB 3M62B 1RTNA 2A1AA 2R6GA 4YWMA 1X3PA 2D10A 2O2VB 2WXHA 1VQEA 4A3DG 1YX5B 1BQQT 5IGDA 4OO1G 2JU6X 4NZLB 5HI1A 3S2HH 4K3BA 1BT0A 1Y1VG 4A8XC 4JOIA 4DV2L 3GTMH 4HPMB 5IGEA 5E6NA 4CYEA 4EX5A 3DWMA 3L54A 1PH2A 1SYCA 1G91A 1C3TA 3Q3MC 2G9HD 2JZ3B 3I8ZA 1NI2A 4C3JG 5JJZA 5ELCA 3TMPB 1ZKOA 4Z9CB 3A0JA 4OWTB 2NBVB 2LFNA 1EM7A 2EMSA 1WCMB 2YEPF 2ZZPB 2YEPB 3HOWG 2NN6H 2AX5A 5IT9L 1BUIC 1ENCA 4A3GH 1IGCA 4A3KB 1KAWA 4LNFA 1YEZA 4BY7H 3IBEA 2RD0A 4X57B 3QC8B 4IM3A 2WHIA 2DJFC 4DQOC 2E2IB 2FCMA 5M5XH 3CRKC 1F2YA 1YIWA 1I4QA 5KRUA 2F3WA 4DK0A 1HUMA 2VQEQ 2CW0D 1SE2A 2A8VA 4GDLA 3QO2A 4WQMA 3A8IE 1GOZA 1SLJA 4DR5Q 4L63B 5JVG3 1V5OA 4B3SQ 3I3CA 3PSIA 4M0WB 3E0EA 3PT2B 1C76A 1FRDA 3H6MA 2UUAQ 3A5UA 4IFDH 3ZXRA 1IZ6A 4ASWC 3VUXA 2PVOD 3GV6A 3CQZB 4KD3A 3NBIA 4A3LG 1QZHA 3H6NA 3RNBC 1TWHB 3W5VB 2J42A 1HUNA 4II3B 4K8IA 3L9AX 5J3BA 2GLSA 1N60A 3O13A 2XVSA 2HCCA 4DNTB 3C19A 1F2MA 1KHIA 2ZXRA 1ZEQX 2RHQB 5CV8A 1BCPC 4ITKA 3VQIA 2WACA 1T9HA 1HQRD 1S1QB 4DK3C 3PIO3 2KWDA 2WKDA 1XLPA 3U4EG 3PUWA 3NZ3A 4LTUA 2R92G 4OO1I 1OXSC 3CSFA 2JA8G 4DV3L 5CV6A 4OZBA 4A3FG 1ASZA 2FXQA 2WB1B 3DQVA 1TTNA 4R4TA 3AV8A 3R7QA 2Z4HA 3CXCA 3M3YB 5FO8B 2ON8A 1X6OA 1TGZB 4I6LB 2FUHB 1WJ6A 1VQAA 1M94A 1FR3A 5JEAH 1JQ4A 3K0YA 3UE0A 3S9WA 1D1KA 2F0JA 4BKGA 1RFAA 1VQ5A 4FA6A 1K8OA 2YLMA 2FCNA 3X23A 5K5PA 4G0NB 3K5OA 3R2IA 1Q10A 2J0TD 3I55A 2KXJA 2W3SA 3I4LA 3NENA 2ZTCA 1LACA 3FPPA 1WX9A 2HDMA 2BWFA 3L10B 2IHEA 3PQIA 1NMFA 3ZJYC 3AM9A 1C1YB 2A68D 3HKZG 4KI0A 1FXIA 2KO3A 3VAWA 2QIEB 5KIXA 3U7DA 4QAYA 4M1UB 1WD1A 1KC8C 1UE5A 1JOKA 2FAZA 1HZ9A 5T8IA 1HCZA 4ODGA 4GN5A 3WDNA 2E6XA 3CW2C 1K53A 1KDCA 1T0RC 2VH1A 3DVNU 4JI4L 3QQ8B 3U8ZA 4YHHL 4BBRG 3MTNB 4BOZB 1U4RA 4NQLB 4CJ2C 2VRRB 2A4ZA 3OAWA 3KK7A 4XDCA 1WY8A 3ZDTA 4JI6Q 1CK1A 2BA0A 3H3VI 4F8MA 1AE3A 3NUCA 1SYFA 3PGEA 3A9KB 4P72A 4DUYQ 2AYOB 1JW9D 4WWMA 4MSMB 1ZW7A 3LGJA 2QW7A 3T13A 1PFSA 3UQAA 4DAMA 2HIVA 3S15B 1ESRA 2ZW0A 2B2YC 1NUCA 4FLHA 1EY5A 3GV3A 4FXCA 4F87A 2NPTB 4JE3B 1FGUA 2EZVA 3N52A 2XWBB 5ELEA 1SFOB 3RZWC 4DHJD 4M8NA 4X66Q 4K0KQ 1FPYA 1ZUD2 3H91A 3S2HB 1P3QU 3HOVH 3Q8FA 4DV0Q 5TSSA 3KUDB 3SFEB 5ELOA 1I42A 3S16B 1VRAB 4KIKB 3EVQA 5KNCA 1D5MC 1PH7A 3WAPA 2N9KA 3Q69A 5J17A 4TV3A 3N30A 4KHPL 2Q8TA 4LF7Q 1DOIA 4PT5A 1V1OA 2V9HA 3DEOA 3W2DA 2BE5D 1XT9B 2GRIA 5JEAJ 4LJPB 2DYMA 2KAJA 3ZNZB 5KYIA 3NHEB 3EBEA 2QDLA 5KGUA 4DV5L 1CZGA 1QKZA 4YT0B 1EQQA 2L83A 3UIPB 5AZFA 3EQLC 3MHSD 2D0PA 3T56B 2KWCA 1PYBA 1Y8RC 2QDBA 3HFZB 1GXDC 1Y69U 1TKYA 2PIAA 3SR6A 2EY1A 5BN3A 3KJPA 1N33L 2EELA 3IG3A 2CH4W 1E3PA 1EY8A 1LFDA 4B9KA 2LGDA 1BOSA 2O6VB 1CQVA 1EYGA 3HEJA 1E8XA 2JA5H 2LJ5A 3U9OA 5M3FG 1VQCA 3MP9A 2INNE 3RZFA 1VQDA 3RZDB 1VQ7A 2LASA 2WAQG 2GVBA 3DDCB 1WFYA 1N34Q 4M8AA 3PV0A 3RZDH 3H3VC 4ZLTF 3TDQA 2EYPA 5CORA 4UDUC 3RCZA 3VDYA 4FULA 3P4RB 1C7YA 1SE9A 4ANXA 1XJVA 5BYRA 1GUTA 1KAAA 2XTIA 4FHKA 2L0TA 2WIIB 1TIFA 1VR9A 5C0XI 2EYHA 4MNOA 1Q81C 3H7PA 2K5NA 1DOMA 2KHJA 2GBJA 1DGJA 4EVOA 1MGSA 4PZ8A 1N34L 1LTSD 1FGBD 3ZIMA 3GTLB 4OZCA 1UE7A 4XWTA 3BDCA 1EOTA 4NDXA 3CC2A 4LF6L 3S1QB 1HZAA 3FPUB 1PHJA 3ULJA 1FRRA 2M1MA 3M3JA 5HGTA 2B2VA 2F4IA 4HKQA 4L23A 1WR1A 3L4PA 2WV6D 2KVZA 1IP9A 2IO2B 2BF8B 4A3EH 5L37A 3MFYA 1X56A 4GOPB 5M5YH 2JYEA 4BKTA 3NTHA 4MGKE 1HJPA 2NBWB 2O4XA 3HIZA 2PW9A 1K28A 4QQBX 2D0OA 2LGIA 1CSPA 4I7AA 4IQZA 2JEAI 1T3QA 2KQ7A 3TL5A 4A75A 4A3IG 2J0JA 2UXDL 3DPDA 2KX0A 3GD7A 2MO0A 2OJWA 2KMMA 2B2WC 2B2WA 4C3HG 4P71A 2C9WB 2Q8IB 4DNRB 2DNFA 1IBML 3UE1A 3BZDB 1TVXA 4XT3B 2G5DA 1WTXA 4JCVE 2W54A 4GLSC 1EUVB 2K7VA 4A3JG 3NSWA 2NVQH 2L11A 2L0CA 4TQUS 1K51A 2CU3A 1WTQA 2MBQA 1RKNA 3NWTA 4JYAL 1E24A 1UBQA 4R3DA 1R4NI 4TRDA 2ZJQA 2MFIA 2K25A 5CV9A 3RUZA 1TZOA 1MHXA 1FO4A 4A3FH 1YN4A 1SNPA 1EWCA 4KHZA 2R92H 1A70A 4P73A 3PLUA 4DV6Q 3BINA 3VUWA 1Y1WB 1WMHB 3UGBB 2D5GA 4P74A 5LL6X 1IL8A 2KCTA 3GTPH 1O7IA 2AWTA 1KFYB 2PTLA 1LTGD 3RR5A 1VQKA 1L0VB 1STYA 1I6VC 1RM6C 4HWIB 1STHA 4IO9A 4RM9A 3ZUNA 1YIJA 5C3EB 3AEGB 3PZDA 4ZRJA 4AQYQ 1MJEA 4B6WA 2IHFA 1ENAA 2D5DA 4PK1A 2KDBA 3PRZA 3A7LA 3Q2AC 4Q5VA 3HRDD 3J7ZC 2JWUA 5KYLA 4MACA 4DK5A 4HIMA 4HJKA 2IY1B 2OQKA 5KNDA 2F3VA 2Z8LA 4APVA 2C60A 2LGSA 2ALYB 5EDSA 2EY5A 1EL0A 4E74A 4JOIC 3KOJA 5EBCA 2UUCQ 2NVYB 4IJLA 3GQBA 5C3EG 5FK9C 2B8GA 1KD1C 3OJ3A 3CKIB 2ZPYA 1HTQA 3L0WB 3VR6A 3X3MA 2CS4A 5LMUL 2K14A 3HM3A 4UPAA 1WCMG 3Q3JA 1XMQQ 5LMNW 1S5FD 5J1ZA 5DPRA 1B3QA 2I07B 5J22A 1RD9D 1IBMQ 2V1CC 1G6ZA 3KYHC 1DOKA 5COYA 3HOVB 1NDDA 4JV5L 4DR5L 1SIFA 1G2SA 2GN5A 3NQIA 4C2MH 4L5TA 1AEXA 1K52A 3NVVA 3OJ4B 1WH3A 2MLBA 4KGSA 3NEMA 4DV1L 4BY1H 1YN3A 2NN6G 1FJGQ 2OEDA 1AE2A 1QJOA 4BY1B 1AYFA 4X3UA 3ML8A 4ICVA 3W1SA 1EYAA 4RKBA 4HDQA 4EOYA 5FLXc 1EQRA 1OTCA 4A3DH 1WRDB 1UUPA 2UU9L 4K14A 1RJTA 4KKUA 1GHKA 4RKLA 3NUHB 3HOZG 3CU7A 2KACA 1JCKB 4GGQA 1C4AA 4FXKC 3Q3NC 4PNYA 1I35A 3TIXA 1OGWA 1KLUD 4DV3Q 1CZPA 2HJ1A 2MO1A 4JI2L 1PGAA 4LF5L 1XEEA 4KLKA 2I0QA 3WOFA 4DHZE 1K8AC 2JXMB 2RVLA 1EIYB 4ZHOA 3K5NA 1C48A 4EQ5A 1L2NA 4XT1B 3M4OH 1BMLC 3L08A 3T9LA 1T0YA 1NNXA 3R3MA 2EMTA 2HD3A 1I7HA 3BK1A 2WAQB 2XSCA 3WWVA 3CCEA 4LF8L 2F0EA 2K5HA 1I6HH 1VQMA 1MJDA 3M7GA 2RPQA 2AQ1B 5LNK1 1FCCC 3GTQB 1PVOA 1SNDA 4B3MQ 2KLGA 2MEKA 3KH0A 1STAA 2WKCA 4A3BB 2K5DA 1B7YB 4GSWA 4IPHA 4HSPA 4DGZA 4C7YA 3NVZA 3SR1A 2UXBQ 2M56B 3RNGC 1TT2A 3MXPA 5AFWA 4HJ8A 1D8LA 3BU2A 5BR8Q 1N61A 3KUZA 4WJOA 3RULA 2A68C 4LUVA 1B2TA 3TBLD 2ZPNA 3GTOH 1ZDXA 4JI3L 1Q5WB 3DBRB 2L12A 1SE3A 4FJVB 5JPMC 1SXTA 4QJFA 1ZGUB 1KNAA 1HFGA 3U58A 5C4ZA 5FLMH 1AFPA 4RM8A 3CC4A 1SB3C 2R7ZH 4LAAA 4W9EA 1MD2D 2WXIA 4O1NA 2L32A 2D3BA 3EFCA 1EY4A 1Q1OA 1SSOA 2OTLA 1U4AA 4IUMB 2FJ2A 4F7ZA 2I2YA 3H1UA 1JORA 4A3FB 1WRIA 3IAS1 5GQOA 4KV6A 1Q7YC 3V60A 4JBWA 4E71A 5C4XH 2KENA 3IVFA 2CQAA 3NTIA 2OJRA 4HN7A 4AYBG 4WIPA 1N62A 4FXGC 3URYA 5DM63 2MCNB 1ESFA 3Q24A 3Q8BA 2EYLA 4A3IB 5BYQA 4XE0A 1OEYJ 2NYZD 1VQOA 3APDA 1TZ1A 5IYDH 3TEWA 3CSTA 1CKNB 3TSSA 1EEID 4XQJA 3VR4A 4AP4C 2B2TA 3ZNHB 1D1IA 2F0WA 3QAQA 2CQOA 1JE4A 4JW0A 4X65Q 4LFBL 1L0XB 2DYOA 3R2TA 2B76B 2KCNA 1B3AA 1YHAA 3ZO5B 4ANUA 2LY7A 2L05A 2PE9A 2WDRB 4FADA 3QR8A 1HFNA 4HMIA 1FD7D 2N7EA 1QOHA 3VRBB 2K1FA 4IWOA 2WXOA 4X3SA 3NOBA 3NG0A 2GOWA 2KVRA 4DV7Q 2Q5WD 4E3CA 4WJPA 1VF5C 1B70B 3TP5A 3DM1A 1PFDA 5C2TB 4QIWE 5LMNL 5CBAE 1JQYD 1CA6A 2H1EA 2JJQA 2VZKB 4KJOA 3AH7A 3VFKA 1NR2A 1DOYA 2PW7A 1E8WA 4RF1A 4DV7L 4MJSA 3DVGX 1EY9A 3Q6BA 2K05A 2YYZA 3L0OA 1EWHA 2L52A 2PCFB 1PZJD 1VLBA 3TEZA 4O2DA 2EIFA 3ICEA 3N20C 1CZWA 1PUTA 4K6DA 4FF1A 3N1YC 5I6WA 3AE9B 2RDHA 1SJHD 1BKBA 3PO3H 1WZ3A 2PQAA 2FBWB 3HOUG 2AWOA 1RODA 3HOYB 3I9V1 3W3AA 2A6ED 3PVLA 3TZDA 4FJYA 1KH0A 3TS2A 4DA2A 4KZCA 2HHHL 4G7OC 4GOPA 1PH4A 2UXCQ 1XPOA 1SBBB 4RA8A 3PO3G 1H95A 1WM2A 5FR3A 4GZYC 3D31A 4KDIC 5CGKA 2MJEA 2CKHB 4IWPA 5JVH3 1WXVA 2RR9A 1UEAB 5JH5C 4PMCA 3A5ZB 2NBUA 4DDGD 2WXNA 3C1EA 4FF3A 4RHSA 2JA6G 2AEHA 2MPMA 1OXTA 2NVYH 3FEWX 4TVAB 3UDFA 4ZKCB 2KZRA 3PF4A 4C4VA 2O2LD 1Z6HA 3DBRI 2BYTA 1DJRD 1GJXA 2N9XA 1WGKA 2BOSA 3F8TA 3Q23A 1LTTD 2J0KA 2MRPA 2N55A 3LJ3A 3QJZA 4RCOA 1WTPA 4MZ9A 1C0AA 1Q3LA 4ID6A 4I6PA 2D9UA 1TWGH 5C4JB 2PLPA 1KM7A 2KK8A 4A3OA 1WJUA 2NTSA 3MTSA 4H13C 4DR7L 2MJ3A 5JZEB 2IO3B 2A5UA 1WXMA 1P8LA 4CJ0B 2QDFA 3NBHB 2JSOA 4M8MA 4BA2I 4WJ3M 2VB2X 3HHMA 2DBYA 1EFID 3H9DA 2EJGC 3TMEA 1K83B 1UE1A 1BCPB 4KKSA 5H92C 3V62A 3PCOB 4KTAA 4X3KA 4XQNA 4WWNA 1CHPD 4H0LC 1NSNS 4NAMA 1G291 1VQJA 2A69D 4IPCA 3PREA 2OEOA 2E2JB 3DM3A 4A3JB 3CMMB 1SMYD 2XRSD 1WGGA 4BY7B 4AJWA 4M0WA 3P1MA 1RF2D 3MXGA 1BO0A 1RYJA 3E3XA 2AUKA 1ENFA 2K01A 4YWKA 5KNBA 1HNXL 2DZKA 4LF9L 4NXNQ 2GBKA 2GMIC 2LGXA 4XYQA 3ZRFA 5C3WA 3MC0B 2WP8J 4AYBB 2AL3A 4LNNA 5DPSA 3RZOH 3F1ZA 2LEKA 4N8X1 3RMKC 2EPBA 1P0RA 4N59A 1IGDA 4OIJA 3SGIA 3GTPB 1YOVB 5JOBA 2Z6KC 2ENBA 2CJNA 2L3ZA 4A3PA 3PUVA 1S5CD 4FDBA 5EKLA 2IX3A 2N9LA 1AN8A 2R7ZG 5IY0A 1IBXA 3TQYA 2B2TC 2BS2B 3AFPA 2HTHA 4K7WA 2Z0EB 4J3OD 4BOSC 4DV4L 3NJTA 3A33B 2DN8A 1KNEA 2KECA 3P2BA 4RMAA 1H9JA 2VUMG 3S14H 2F0GA 1YZ6A 2K32A 5DPTA 4BZAA 4H44C 3GZNB 3ERQA 3BG3A 4CJ1B 3CHBD 1QNUA 1TYGB 2KC2A 1F77A 1WE6A 4K6LA 2CH4A 1UWVA 3ULPA 1SMYC 4BBSG 1AARA 2Y5CA 5DCNA 2YTYA 4LJZC 2FINB 3MXUA 4G4KA 1LTRD 4A3MH 1L0WA 3Q8EA 3M4OB 4HPPA 2PE6B 1KDAA 3P4SB 3DOWA 1E1TA 2CW0C 2JXTA 4YTMB 4A3KG 1CHQD 2DX5B 5D65A 3VTUA 1ACCA 1R4NB 4WORA 3A9JA 4L5SA 4BS9A 4RH6A 5CYUA 3ONSA 4HR7B 2R2OA 1NYQA 4C80A 3NVYA 1P9DU 4US8A 4LCDE 3H8HA 4B95A 1T0QC 3TBIB 4BY1G 2FE8A 2J7QB 4X62Q 3M4QA 3ABVB 4UP8A 4DV1Q 2UYZB 2LSSA 1R9TB 3KDFB 3W1GA 4MT5A 2IYDB 1LUZA 1VQGA 4A90A 5HHDG 5GMVA 4HMJA 5CMDA 2DENB 4O0AA 3D6CA 2CFMA 1Q0WB 3NVWA 2EYFA 4LFCL 4KY6A 1VQ8A 2NZOA 2IZVB 1J0GA 1VQ4A 2BGFA 4C3JB 2SOBA 4BWGB 2L5TA 4DAYA 1MBYA 1QUQB 2F0LA 1N5WA 2JRIB 2XNAC 1Q46A 4A4IA 3J80i 5FLXL 3J81E 1L2FA 3IT6B 3QWZB 1PXUA 3I91A 2EY6A 3PMFA 2K6QA 1CKOA 4W9IA 1XTDA 1WWTA
chains in the Genus database with same CATH topology
4XXEA 3VR3A 1JICA 3U52E 3W9CB 4ZOHC 2NTTA 2ZT9C 1I50B 5CC4A 1TQOA 1UWXA 1Q1EA 4KKIA 4EQPA 3I73A 4IUVA 3PUYA 4DAVA 2LHEA 2E75C 3J7AV 1F2RC 4ZQ3A 5HFYA 1YQ4B 3IL8A 5EPLA 4RF0A 3EUB2 5K36H 1EU4A 3V05A 1GUSA 1WXQA 4OL7A 1H9SB 3KF8A 2NVQB 4YSYB 1I4HA 4L6TB 1T5EA 2K22A 5AUKA 3D4RA 3AECB 3HVDA 2JX5A 1C4CA 1ZOYB 1OXXK 1PLFA 1QF6A 1WD0A 1SNQA 1VZ7A 1FNWA 4Q0FA 2LUMA 2F0DA 1UNSA 3EA6A 2M2LA 3AEAB 1L6UA 1QCBD 2V3PA 3OIPA 1PRTD 4K2LA 1SYEA 1B4OA 3ITPA 4ZHPA 4J6HA 3HOXB 3U2SC 1ET9A 4G7HC 4L2YA 1C9FA 2QILA 1E2ZA 4KJNA 3B2GA 3KBXA 2X6GA 1PRTF 2L1BA 2RDFA 4LMQD 2W3RA 1SSNA 3H09A 3MEHA 2OT2A 4HJGE 1GUWA 2WQYB 4HSVA 2EKIA 4H2AA 4ZRQA 3D6WA 1J9OA 1WVLA 2K28A 2EYOA 2WU5B 5E6JA 1YMHE 2N88A 3FILA 5C6AA 3TP7A 2JA6B 2EJMA 2F0IA 1QNKA 1YN5A 3BS1A 4L8JA 4MH8A 4IURA 2QSDA 1B53A 4IUQA 4KGRA 2LHDA 4J1MA 1DXMA 4ULLA 2C5CA 4DU9A 5C44B 1RFKA 1S5DD 3ND8A 1VCIA 5IODA 2LMCB 3S2DB 1VDZA 3HZXA 2PYKA 3BWUD 2SAKA 3T16A 3Q0AA 4XDXA 1FIQA 1P7EA 2F0PA 3N6RA 3S17B 2V4IB 3I57A 1A6XA 1XO3A 1PRTC 1ICWA 2ID0A 4QIWB 3AN1A 1FEHA 2M19A 3NXWA 1YNND 1DD2A 1EYDA 2NUCA 1QQRA 4MIUA 1MI2A 2KJXA 1ML0D 3Q6SA 4G7ZC 3S1MB 1V1PB 1L4ZB 1HZ6A 1XTCD 1JOOA 1PZKD 1ZXTA 4KN4C 2WXKA 5MPOA 4YTPB 4K8JA 2F0FA 2EXZA 4FNFA 5FO9B 5FO7B 1FYCA 1B9MA 1S5ED 2PMVA 4B0MA 1FCLA 4DN4M 4PQXA 2KDMA 2NVTB 2GI9A 4IUPA 1F9SA 1GPXA 2ONQA 2XWJB 4WJWA 1JWMD 4JWSC 3M7NA 4KGTA 2F0OA 4DF7A 1E10A 5BMHA 1JRPA 1QE6A 4JWUC 1STNA 2VUMB 3LYYA 3OMCA 3E6ZX 4H7BA 2INPE 5CV7A 4FF4A 1WTWA 3VYUA 4CHTB 1SIJA 5C0XG 1QG7A 2NMQA 2ZXOA 4CKCA 1JWAD 1RHPA 3HRZC 4ZUIA 1F9PA 1J7BA 3LXFA 4GDKB 4WURA 4P2CB 2G9DA 1EIGA 2BBCA 4B0EA 2J7ZA 4EGVA 3U7ZA 4KY7A 2L9HA 3I70A 2A69C 1STGA 3K6OA 1DOXA 1STBA 1J8IA 4D2KA 2A6HC 1SYBA 3PUZA 3PO0A 4C3IB 2B2UC 2AQ2B 1E9MA 4MHEA 4F88A 2N7JA 3TEYA 2SNMA 4QF4A 2FUG1 2K5PA 5I6YA 1PFNA 4IZ8A 5E4XA 3E9SA 5CR3A 1A15A 5EBDA 2V0GA 3V96A 1BXTA 5A2QE 2X69A 2IL8A 1TY0A 5EE3A 1LTBD 4RCNA 1YNNC 4ZK9B 2OXPA 4IKGA 1QWYA 3R93A 2A6EC 3T4AC 5JPNC 4LK1C 3AE7B 5IGCA 4OVZA 2BTEA 4PMBA 2QJLA 1QOBA 2KVMA 4XIGS 4C3HB 3ZJUA 4N58A 5C5MA 2F0NA 3BVMA 4N9PA 4QCLA 1AW7A 1R7SA 1OFFA 3SK6A 3F2UA 4KK7A 5DM73 1KF6B 4Y7NB 4ABNA 1N5XA 2V3NA 4A55A 3J80E 1S5BD 2B2VC 1VDVA 4OW0A 1Y8NB 2C9OA 4IUTA 2IJ0A 5I9OA 2CHBD 2M9VA 1R4QB 2DNCA 4IUNA 4YTNB 3SHLA 1U4MA 4NP5A 3VR5A 1EY7A 2I38A 2WXPA 3J7YW 1ZE3D 2GA4B 4HEDA 4YSZB 3AB9A 3AE8B 5JXVA 2WINB 1JALA 3SDZA 3AE1B 1VF7A 3P1HA 1RDPD 1IKLA 1A3VA 1J7AA 2N0SB 1TY2A 2E2HB 3V2TA 3E56A 5FOBB 5FLXE 1TS5A 1X32A 4V0BA 5JEAG 1H9SA 3VR2A 1D5XC 2RPVA 2WXFA 1VZ6A 2HUGA 1Q90A 3E0JA 1WTVA 1PTOF 1AWDA 2EYJA 1V43A 3JAME 1D2BA 3MAQA 3IAM1 5IGGA 1MPEA 2H88B 3K5LA 4TQ0A 1FMAD 3MZ5A 1TR5A 2IGGA 1E0BA 2IX0A 2K03A 3OPOA 2IGDA 4IFDG 2Y3AA 2Z1CA 3A7AB 1YJJA 1PDQA 3GTOB 2WXLA 2J52A 4DFAA 2F0QA 4ZAIA 2B2UA 5E3FA 5KEEA 4A6QA 4KN7C 1PGBA 2BA1A 2K6AA 2MP1A 2IWHA 4NJCA 3WOEA 1DONA 3PO2B 2WNMA 4WH4A 4A9AA 5BN4A 2J4XA 3J81L 1PZID 3K57A 2WXRA 2LFIA 2B39A 1OO9B 1NENB 2JE6I 4IFDJ 4U673 4HEA1 4B08A 2VZKD 1V97A 4OIKA 2RSOA 2A6HD 1UAPA 3I72A 5C0XJ 1GB4A 5EE1A 1IHZA 2DY8A 1WYGA 2JA7B 2KCCA 1P7FA 4NKLA 1QT9A 4ZKBB 4ME5A 3QOJA 1JR0D 4RWSC 5EGTA 2KHSA 4OGQC 4YWGG 5DNFA 3EJIA 3T3OA 1R4PB 3BVZA 3AMUA 4I7ZC 5I2XA 2MUYA 4A3MB 5DAUA 1H9MA 3H0GB 4JK1C 3TZUA 2PZUA 1Q8IA 3HOZB 5BN5A 1ILPA 1F2RI 1QOFA 1NR4A 1IBXB 2RBMA 1WSPA 3SE0A 4E6IA 1CJEA 3VR9B 4ARIA 3VR8B 2ZW1A 1S4ZA 2F0UA 5D14A 2M0AA 1LT3D 1XXGA 4WFN3 3HOUB 2O5IC 1A3TA 2JQRB 3SXHA 5K36G 2BW2A 4FF2A 1HA5A 2EDGA 3QOLA 1D5ZC 3L7ZC 3DWAA 3NPPA 1JWBD 1ZDVA 2F1MA 1XCQL 2F0VA 1V1PA 1EZ8A 4YSXB 1GAQB 2AUJD 1NEKB 2IW3A 1JMLA 3KUPA 5NUCA 1OQQA 2IGHA 3ZJTA 1I4GA 2SEBD 1VMCA 3AE3B 1I3QB 4YIJA 1BBXC 2F03A 2PPBC 5IT9E 5C3JB 3AMZA 2R7ZB 2TSSA 2HQEA 4FP5D 1TWFB 2JA8B 2GB1A 1TWGB 1A2UA 2VNUD 1PDXA 3ZQ4A 3C1FA 2XN9C 3FDTA 4WAFA 1FNVA 3SK4A 1QOGA 2Q8RE 5J39A 4S3SA 2H4OA 3T51B 1A3UA 1HEZE 1F9QA 3MHBA 1PTOB 2WU2B 4US9A 4TSSA 1C79A 4XTCS 4HCEA 2FHTA 3MFGA 3BVGA 1I4RA 1SYGA 1GUGA 3C3LA 3LB8C 1KLGD 3MWYW 3AEEB 4QUCA 1E6EB 5EPKA 2LKVA 3TP8A 1PMRA 3SK5A 1ROEA 2ACZB 1E7PB 3HG9A 4N9TA 1NI3A 4DXFA 2AWNA 2E2DC 1TKEA 4X3TA 1ZYRD 1LT4D 4ZUJA 5ELBA 3AE6B 1SDFA 2BT6A 1EU3A 2E76C 1JWSD 2DNEA 1FNUA 2EY2A 1XF5L 5M5WB 2QF7A 3QJYA 1PRTB 1BF4A 4KMUC 1O7YA 1ILQA 1II3A 2B8FA 3BK2A 1TS4A 3OOCA 3G7LA 2X6LA 4RHRA 3RD4A 2IX1A 3KQ4A 1LT5D 1FFUA 2XRQD 3R8BA 1MI0A 1XLQA 4C1NK 2WXJA 2F0KA 3FC4A 1CA5A 3Q8CA 5C4XB 3NTKA 5E4WC 1Z47A 2A73B 4IFDI 3K59A 1B50A 3GB1A 1XYIA 3R3OA 3KWLA 4QMGA 5M3MB 1A2TA 3PO3B 1O80A 3B9JA 4JX1C 3FKIB 2WDQB 3LNNA 3BDOA 1JROA 2PVGC 2G1EA 1IYUA 1PTOD 1YNJC 1BUVT 1YQ3B 3K7AB 4RNAA 3ZJVA 3J80L 2PKOA 4C3IG 3PZ7A 2NN6I 1QOAA 2JYOA 2K3UA 3GP7A 3DXJC 3BYTB 1WTRA 5EE0A 1XLOA 4REZA 3TP6A 3HUIA 3ONAB 2WXGA 4IOIE 2NVXB 5CV5A 4CGYB 2WXQA 3ZYYX 1TJEA 1TWCB 1HXYD 1EWYC 5IIFA 1L6VA 3NE5B 1EZ6A 3QB3A 3BDLA 3OIQA 5CBEE 1B9RA 5AUIA 2RKSA 3MHZA 1XLNA 1EIHA 3P20A 3MXNA 1C8CA 1STEA 5CV4A 4K2KA 2PZWA 4FO2A 1MVKA 1KTKA 1SNCA 2EOTA 5I2YA 5F2DA 1I4PA 4CKBA 2OF1A 3SK8A 2W82A 2WP9B 5C5LA 3VA7A 2TMPA 1PGXA 3AEDB 3RPFC 3GTJB 1AZQA 2KQ3A 1SJED 2BS3B 1DYQA 2QKIC 3DUZA 3D4DA 1Z7TA 1XX8A 3IFTA 4NAWB 2DY7A 2HTME 5H8YE 1B1ZA 3IAYA 2L1AA 1I4XA 5HG2A 3V3XA 3RMHA 2DWQA 4ZRPA 4BBRB 1LO5D 3IXSA 4MM3B 3H94A 4RFBA 2KEDA 3PZ8A 5EKIA 1XCTL 1ZPSA 4EQOA 3S1NB 2VB3X 3D4WA 2ICEC 1UGJA 3A8KE 2QMTA 2CJOA 2WS3B 3HVZA 5BYSA 2KUMA 4XYOA 2PQEA 2MJ8A 3D3RA 2K1BA 5EPJA 3LWEA 1EY0A 5EJWA 1SE4A 4F7XA 2KQ4X 3NQTA 3EROA 3TUOA 1K50A 2MJDA 1BCPD 2PZTA 3NBHA 2MGSA 1L5PA 3KBGA 3AE2B 3SFDB 3A55A 3GTGB 3VYRA 3HKZB 1ZYRC 1QILA 3NK9A 2RMMA 2EE1A 3P4QB 1BCPF 4BA1I 1NCVA 1TIID 1HPCA 3OWEB 3K58A 3SEBA 3EFXD 1FM0D 1DZ1A 2SDFA 5G3LF 3C8YA 1YJIA 5E1FA 5EKKA 1Y8PB 1E2WA 2JSVX 3B2FA 1CQFA 1VMPA 2WLBA 4EQNA 4FVMA 3PIP3 5C3XA 1C4QA 2NWGA 1TS3A 5G3LD 5IOCA 1GUOA 1KDBA 1Y56A 4C1NI 2K04A 2RA4A 1NYRA 2HDEA 3I90A 3OSOA 2H89B 3OWFA 1E0ZA 4K5VA 2JP1A 3LX0A 1ET6A 3T3NA 1O7LA 4O42A 5M5XB 3U9SA 4G57A 2JYTA 5I4DA 3A54A 1JOQA 2FFKB 4IUUA 4XQQA 2JA5B 1F9RA 1X3QA 3VYTA 2PMZB 1PTOH 4ZYSA 3P42A 2A74C 3I4NB 3AE5B 3P63A 3D8GA 2K9XA 4PV1C 4L1BA 1N63A 3OHXC 4USAA 4IN3A 2PO4A 5A2QL 3K5MA 1M4VA 3GTKB 3KLSX 2HDLA 1LTAD 4LK0M 1BDOA 4N6EB 3G6JB 1DCZA 1SAPA 3OMGA 4R9WA 4B9XA 3NHHA 1E2VA 2ZXPA 1BNZA 3QWNA 4QB4A 5G5GA 1LTID 2L55A 3DHQA 4NMZA 3IFDA 3M4YA 1L4DB 2EJFC 3FVQA 1VZ8A 2DLBA 1GHJA 4LLGM 1OXUA 2OHFA 3J7AF 4AQ7A 3W5UB 3AB5A 3MA2B 3HP3A 1NVID 2D62A 5ELDA 2PW5A 1JC7A 1HTLD 4P16A 4ILWA 2X38A 2K5WA 3VRAB 4U68A 1ONLA 5BMIA 1FFVA 3VYSA 2IDYA 1DOLA 2F0SA 1M8AA 2F0MA 2KA7A 3CIRB 1FXAA 4KD4A 1SNOA 2KOLA 3FAHA 2BDNA 1KRHA 1YNTE 3C2PA 3WCQA 4UAIA 1OXVA 2RDGA 4R8IA 1F2ZA 1RCVD 4J8QA 1TKWB 2BB6A 2Y5PA 1MHHE 2NBFA 1HHVA 3J9CA 4A3GB 3FRPB 1SEBD 3Q8AA 1IUEA 3TN2A 5DEHA 2EVBA 1V8CA 4KHVA 3P7JA 3AEBB 3LWUA 4NW2A 1Q12A 3UI2A 2SNSA 4K5WA 3RFZB 3KLRA 2EYMA 1L0YB 2WXMA 5IGFA 1V8QA 2RQXA 1QB5D 1F0ZA 1K8MA 2LJIA 4KKTA 2B2YA 1HA6A 4K5XA 5LHY1 3JAML 4CQNA 1I6HB 2NB0A 2J53A 5EE9A 4DAPA 2I46A 3M85A 4R8NA 1H9RA 3MJ5A 5ISRA 2JEBI 4GDLB 4HCSA 4KX6B 2AQ3B 1CI3M 3ND9A 4TKOB 4HAEA 1RWSA 5M9OA 1ZP0B 3NS1A 3N9YC 2FMCA 4RGMA 5BMGA 1ZXIA 2E3TA 3C46A 5GXGB 3P75A 3KWVA 1HQMC 4V190 2F0TA 2QCPX 3HOWB 1PFMA 5C0XH 1EYCA 1TS2A 1GUNA 1C4PA 2KN4A 1JWUD 3T53B 3RZOB 2B63B 2YU9B 1NAPA 3TEXA 4RGNA 2CVRA 4QUFA 1IKMA 3DWPA 4DK1A 4FXDA 5ELFA 3DWQA 1MSHA 4HTHA 5D3DA 2LS01 1U4LA 1VJKA 3VA5A 1G2TA 1IYVA 1UWMA 2M00A 1W6JA 2V4DA 3RLFA 4HROA 1CT1D 3A56A 1U9RA 1IW7D 4C7ZA 4TQ1A 3S14B 4KY5A 4JPSA 1W6KA 4AS1A 2BS4B 5D7GA 3MVVA 2PNRC 5I9PA 1CM9A 3CRLC 3X3NA 2A5HA 2MHVA 1EY6A 2MH7A 4MN3A 1SF0A 2W55A 1IW7C 1MSGA 4YXDB 1EQTA 1B44D 4KKJA 4PMWA 1HRJA 1RTOA 1AP0A 3HS0C 1JB3A 4P6VF 3L3OC 3KLSA 2R61A 2K0PA 3FILB 2D2CC 3BYYB 1Y8OB 1O7ZA 4A3DB 4OZAA 1TWAB 4Q2JA 3A8JE 2HCIA 1LT6D 2R93B 1GB1A 3QG1A 1C78A 2JZPA 2QEJC 1B9NA 3ETRA 5IGBA 2IT1A 4TMAB 1T6BX 1KABA 1EQVA 3IT4B 3AE4B 2R3ZA 1OQRA 3OW7A 2BDOA 4FYDA 3P4PB 3Q22A 5M5YB 1DM0B 3NP8A 3ZGZA 5T1IA 1EEFD 1F2LA 2L4NA 3PUXA 4C2MB 1H9KA 3AU7A 2BCOA 1HTPA 1PYWD 5FKAC 3GS2A 2Z4IA 1Q1BA 1U4PA 4A3EB 1CTMA 1BR9A 3S1RB 3DMUA 2ICIA 1D6EC 4WRDA 4OO1H 3E5SA 3DWGC 2IPKD 2KEEA 1XWEA 5G5HA 3DEPA 4C56C 3GTMB 3UI3A 3I4MB 2NZ1D 1ZXHA 4RGTA 3IKJA 4OHJA 5EQ0A 1LABA 1AZPA 4XWWA 5C4HA 2R92B 1PFBA 4XDDA 1FD6A 2FMMA 4IDIA 4CBVA 5M3FB 3NRZA 3HGBA 1TKGA 1LV9A 1HZ5A 1Y1VB 3NWSA 4ZRZA 3SVMA 2VXWA 1SNMA 4RAUC 5JAVA 1CFMA 2LMCA 2RSNA 4EE2A 3BIID 4B9WA 2K5QA 4IALA 1LLRD 1PTOC 1TU2B 2XIWA 1O78A 1YNJD 4HKZE 2K33A 5LL6S 2O5JC 2WDVB 3CWIA 3EGRA 1J7CA 4ARCA 1SYDA 2BE5C 3FMCA 4CKEA 5A35A 5D3IB 4A93B 4HRSA 3QIAA 3AEFB 2BB5A 1T5XD 4BBSB 4I65A 1G8ZD 5T1GA 4RGOS 1C77A 2F0HA 2Y0SB 1WTOA 1D4BA 3GO5A 2E74C 4DXGA 5HURA 1QLBB 1RTNA 2R6GA 1X3PA 2WXHA 1BQQT 5IGDA 4OO1G 2JU6X 4NZLB 5HI1A 4A8XC 5IGEA 3DWMA 1G91A 1SYCA 2G9HD 3I8ZA 4C3JG 5JJZA 5ELCA 1ZKOA 4Z9CB 2LFNA 1EM7A 1WCMB 2YEPF 2YEPB 2NN6H 2AX5A 5IT9L 1BUIC 1ENCA 1IGCA 4A3KB 4DQOC 2E2IB 3CRKC 1F2YA 1I4QA 5KRUA 2F3WA 4DK0A 1HUMA 2CW0D 1SE2A 3QO2A 4WQMA 3A8IE 1GOZA 4L63B 5JVG3 3I3CA 1C76A 1FRDA 3H6MA 4IFDH 2PVOD 3GV6A 3CQZB 4KD3A 3NBIA 3W5VB 1TWHB 2J42A 1HUNA 4K8IA 3L9AX 1N60A 3O13A 2XVSA 2HCCA 4DNTB 1F2MA 2ZXRA 1ZEQX 5CV8A 1BCPC 4ITKA 3VQIA 2WACA 1HQRD 3PIO3 2KWDA 2WKDA 1XLPA 3U4EG 3PUWA 3NZ3A 4LTUA 4OO1I 1OXSC 5CV6A 4OZBA 2WB1B 3AV8A 2Z4HA 3M3YB 5FO8B 2ON8A 1FR3A 5JEAH 1JQ4A 3K0YA 3S9WA 1D1KA 2F0JA 1K8OA 5K5PA 3K5OA 3R2IA 1Q10A 2J0TD 2W3SA 3I4LA 1LACA 3FPPA 2HDMA 3AM9A 2A68D 4KI0A 1FXIA 2QIEB 5KIXA 4M1UB 1WD1A 1JOKA 5T8IA 1HCZA 4ODGA 3WDNA 2E6XA 1K53A 1KDCA 1U4RA 4CJ2C 3KK7A 4XDCA 1CK1A 2BA0A 4F8MA 3NUCA 1SYFA 1JW9D 4WWMA 3T13A 3S15B 1ESRA 2ZW0A 2B2YC 1NUCA 1EY5A 3GV3A 4FXCA 4F87A 4JE3B 2EZVA 3N52A 2XWBB 5ELEA 1SFOB 1ZUD2 3H91A 3S2HB 3Q8FA 5TSSA 3SFEB 3S16B 1VRAB 3EVQA 5KNCA 1D5MC 2N9KA 3Q69A 2Q8TA 1DOIA 4PT5A 1V1OA 3DEOA 3W2DA 2BE5D 2GRIA 5JEAJ 2DYMA 2KAJA 5KYIA 5KGUA 1CZGA 1QKZA 4YT0B 2L83A 3EQLC 3T56B 2QDBA 1GXDC 1Y69U 1TKYA 2PIAA 3SR6A 2EY1A 5BN3A 2EELA 1EY8A 1BOSA 1CQVA 3HEJA 3U9OA 3MP9A 2INNE 3RZDB 4M8AA 3PV0A 3H3VC 4ZLTF 3TDQA 2EYPA 5CORA 4UDUC 3P4RB 5BYRA 1GUTA 1KAAA 2WIIB 1VR9A 5C0XI 2EYHA 1DOMA 1DGJA 4EVOA 1MGSA 1LTSD 1FGBD 3GTLB 4OZCA 4XWTA 3BDCA 1EOTA 4NDXA 3S1QB 3FPUB 1FRRA 5HGTA 2B2VA 2F4IA 4HKQA 4L23A 3L4PA 2WV6D 3MFYA 2JYEA 3NTHA 2O4XA 2PW9A 2LGIA 4IQZA 2JEAI 1T3QA 3GD7A 2KMMA 2B2WC 2B2WA 4C3HG 2Q8IB 4DNRB 3BZDB 1TVXA 4XT3B 1WTXA 2W54A 4GLSC 2K7VA 3NSWA 2L11A 2L0CA 4TQUS 1K51A 2CU3A 1WTQA 1RKNA 3NWTA 4R3DA 4TRDA 5CV9A 3RUZA 1TZOA 1MHXA 1FO4A 1YN4A 1SNPA 1EWCA 4KHZA 1A70A 1Y1WB 2D5GA 5LL6X 1IL8A 1KFYB 2PTLA 1LTGD 1L0VB 1STYA 1I6VC 1RM6C 1STHA 3AEGB 5C3EB 1ENAA 2D5DA 3A7LA 4Q5VA 3HRDD 2JWUA 5KYLA 4MACA 5KNDA 2F3VA 2Z8LA 2EY5A 1EL0A 5EBCA 2NVYB 3GQBA 5FK9C 2B8GA 3CKIB 3VR6A 3X3MA 1S5FD 5J1ZA 2I07B 5J22A 1RD9D 1G6ZA 1DOKA 5COYA 3HOVB 1G2SA 3NQIA 1K52A 1AEXA 3NVVA 4KGSA 1YN3A 2NN6G 2OEDA 1QJOA 4BY1B 1AYFA 4X3UA 3W1SA 1EYAA 4RKBA 1UUPA 4K14A 1RJTA 4KKUA 1GHKA 4RKLA 3NUHB 3CU7A 2KACA 1JCKB 1C4AA 4FXKC 4PNYA 1KLUD 1CZPA 1PGAA 1XEEA 3WOFA 2JXMB 2RVLA 4ZHOA 3K5NA 1C48A 4XT1B 1BMLC 1I7HA 3BK1A 2WAQB 2XSCA 2F0EA 3M7GA 5LNK1 2AQ1B 1FCCC 3GTQB 1SNDA 2MEKA 1STAA 2WKCA 4A3BB 2K5DA 4HSPA 4DGZA 4C7YA 3NVZA 3SR1A 2M56B 1TT2A 3MXPA 5AFWA 1N61A 2A68C 1B2TA 1ZDXA 2L12A 1SE3A 5JPMC 1SXTA 1KNAA 1HFGA 5C4ZA 1AFPA 1SB3C 4LAAA 1MD2D 2WXIA 4O1NA 2L32A 1EY4A 2I2YA 1SSOA 2FJ2A 1JORA 4A3FB 1WRIA 3IAS1 4KV6A 4JBWA 2CQAA 3NTIA 4HN7A 4WIPA 1N62A 4FXGC 5DM63 3URYA 3Q24A 1ESFA 3Q8BA 4A3IB 2EYLA 5BYQA 4XE0A 2NYZD 3TEWA 3TSSA 1EEID 4XQJA 3VR4A 2B2TA 1D1IA 2F0WA 1JE4A 1L0XB 2DYOA 3R2TA 2B76B 2KCNA 1B3AA 2LY7A 2WDRB 1HFNA 4HMIA 1FD7D 1QOHA 3VRBB 2WXOA 4X3SA 2Q5WD 1VF5C 3TP5A 3DM1A 1PFDA 5C2TB 5CBAE 1JQYD 1CA6A 2H1EA 2VZKB 4KJOA 3AH7A 1NR2A 1DOYA 2PW7A 4RF1A 1EY9A 2K05A 2YYZA 1EWHA 2L52A 2PCFB 1PZJD 1VLBA 3TEZA 1CZWA 1PUTA 4K6DA 4FF1A 5I6WA 3AE9B 2RDHA 1SJHD 2FBWB 2AWOA 1RODA 3HOYB 3I9V1 3W3AA 2A6ED 3TZDA 1KH0A 4DA2A 4G7OC 1SBBB 4RA8A 5FR3A 4GZYC 3D31A 5CGKA 2MJEA 5JVH3 1UEAB 4PMCA 2WXNA 3C1EA 4FF3A 4RHSA 2MPMA 1OXTA 3FEWX 4ZKCB 2O2LD 1Z6HA 2BYTA 1DJRD 1GJXA 1WGKA 2BOSA 3Q23A 1LTTD 2N55A 4RCOA 1WTPA 1Q3LA 4ID6A 2D9UA 5C4JB 2PLPA 2NTSA 3MTSA 4H13C 2MJ3A 4CJ0B 2JSOA 4BA2I 2VB2X 2DBYA 1EFID 2EJGC 3TMEA 1K83B 4KKSA 1BCPB 5H92C 4KTAA 4X3KA 4XQNA 1CHPD 4H0LC 1NSNS 4NAMA 1G291 2A69D 2OEOA 2E2JB 4A3JB 1SMYD 2XRSD 4BY7B 4M0WA 3P1MA 1RF2D 3MXGA 1BO0A 1RYJA 2AUKA 1ENFA 2K01A 5KNBA 4XYQA 5C3WA 3MC0B 2WP8J 4AYBB 2LEKA 2EPBA 4N59A 1IGDA 4OIJA 3GTPB 5JOBA 2ENBA 2CJNA 3PUVA 1S5CD 5EKLA 2IX3A 2N9LA 1AN8A 1IBXA 2B2TC 2BS2B 4J3OD 2DN8A 1KNEA 2KECA 1H9JA 2F0GA 2K32A 4H44C 3ERQA 3BG3A