3MFGA

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
total genus 52
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mfgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mfgA01
1BCPB 3BZDB 1JWMD 1PYWD 1LT5D 4RH6A 1LTID 4ZYSA 1S5DD 2O2LD 1PTOC 1V1PB 1I4QA 1D5MC 4TSSA 2RDGA 1PRTB 3BVGA 3DWQA 4RGTA 2XRSD 4DXFA 4UDUC 1UNSA 3MFGA 5TSSA 1PZJD 2NTSA 1LT4D 1SEBD 5FKAC 1FGBD 1KLUD 2ICIA 1SJED 1TS5A 3O13A 4BWGB 1KLGD 1UUPA 1SE2A 1CHQD 1TS2A 1V1OA 1FNUA 1TY0A 1DYQA 1JWSD 2Z8LA 1F77A 2RDHA 2AQ3B 4L63B 3R2TA 1XTCD 1I4XA 1M4VA 2WV6D 5ELCA 1PZKD 1D5ZC 4RGNA 1ESFA 2G9HD 1PTOD 1RCVD 2AQ1B 1YN3A 1LTGD 1I4PA 1LTTD 1AW7A 1LTSD 4RFBA 5ELBA 1FD7D 1EU3A 2TSSA 4C56C 1LO5D 2AQ2B 3BVZA 1BCPF 1PTOB 5I4DA 1S5FD 1STEA 1SXTA 3R2IA 1EWCA 4DXGA 3URYA 1HA5A 1SE4A 1SBBB 1LT3D 3GP7A 2R61A 1PZID 1PRTF 1D6EC 2QEJC 3BYYB 1JCKB 3EFXD 1D5XC 1I4HA 4Z9CB 1S5CD 4RGMA 1YN5A 1KTKA 1LTBD 3EA6A 1JQYD 4K6LA 4RHRA 1LLRD 1EFID 5ELFA 1I4GA 2QILA 1ENFA 1TS4A 1CQVA 1HXYD 1S5BD 3SEBA 1ET6A 3BYTB 1RDPD 1DJRD 2J4XA 3R8BA 1EU4A 1YN4A 1RD9D 1RF2D 1LTRD 1BXTA 1T5XD 1L0XB 3W2DA 5D3DA 2XN9C 1AN8A 1EEFD 2CHBD 2NTTA 1ET9A 1CT1D 1XXGA 1JWUD 5ELDA 1TS3A 1LTAD 3TSSA 3DWAA 1PTOH 3KLSX 1SJHD 4O1NA 3BVMA 4L6TB 1FNVA 1LT6D 3OWEB 3DWPA 4RGOS 3V05A 1I4RA 1BCPC 2IJ0A 3CHBD 1BCPD 1CHPD 1PTOF 5D3IB 1FNWA 1TY2A 2XRQD 1MD2D 2IPKD 1V1PA 1EEID 3MC0B 4NZLB 1G8ZD 1HTLD 1B1ZA 1L0YB 2XNAC 1S5ED 1GOZA 5FK9C 1HQRD 4RCOA 5ELEA 1PRTC 1B44D 1PRTD 1SE3A 4RHSA 4OHJA 1JR0D 1CK1A 1QILA 2SEBD
chains in the Genus database with same CATH superfamily
2A6HD 5IYCG 3ZVVA 2RHSB 2L12A 2YTYA 1BT0A 2G45B 4ZYSA 5JEAH 2ZM6L 1V49A 2WAQB 4V190 4OWTB 2NN6H 5EKLA 3PIOA 3H15A 4A3EH 4K0KL 1E9MA 3DM1A 1K73C 4ACFA 4IUVA 4LUZA 2SAKA 2INNE 4LF7Q 1XYIA 3GTQH 4FXGC 1UBQA 3SXHA 4DR3L 1HNWL 1MVKA 1WGRA 1DOMA 3M85A 1C4CA 1WX8A 2LJIA 1P16A 2N7EA 3O13A 4DU9A 4BWGB 4HIOA 4ALPA 4DR4L 2NS5A 1OXXK 3UDXA 4C3IH 2CHXA 3A1QB 1UGJA 5H92C 5CV4A 2PTLA 4XWTA 2K0PA 2INCC 3U8ZA 2CQAA 4A93G 3S1QB 2M56B 4JBJA 4B3SL 2WNMA 4JI1L 5C4ZA 3X3MA 3CPWA 3I4NH 1E8ZA 1WMHA 3K5OA 2K25A 3GE8C 1V6EA 5DPWA 3CF5A 1JWAD 1VF5C 3TIXA 1ESFA 4JE3B 2L00B 1PTOD 1SNPA 3CW2C 4R4TA 3A0JA 1YJ1A 3PO3G 1SE8A 3RMKC 2CWPA 3HKZB 1AW7A 3HRZC 3LWEA 3AE2B 3M3YB 3RNEC 3NEMA 2N9LA 2VUMH 1F52A 5HHDG 4B95A 1A62A 1GPXA 1ESRA 1ZDVA 5BR8Q 2A68C 2LGDA 3QA8A 2K14A 2WB1E 4PG3A 1WRDB 2L1AA 3A5UA 2ZJRA 2QC8A 2C9OA 1SXTA 3KQ4A 3MHBA 3JC66 4GXBA 1K8OA 1EWCA 4A3LH 4JI2L 1Q81C 4WFN3 2VNUD 1STHA 4NMZA 2O6VB 3TREA 1PRTF 1Q1EA 4N8X1 2WDVB 3K8AA 4D2KA 1AWDA 2K39A 2ZW0A 3H8HA 4WJPA 1JCKB 5EJWA 2M9VA 3J80i 1F9JA 2QEXA 4FJYA 3W5VB 2HD5B 4NJ6A 4Q0FA 1CZWA 2UUCL 5IKCM 3A9JA 5ELFA 4HEDA 3S1QH 2DZMA 1D7QA 1S5BD 2FHTA 5CHFA 4A3BG 2K03A 5CORA 3R8BA 2KDIA 1QVFA 1PLFA 2EY1A 4MHEA 4A3MG 2B3GA 4R4QA 4IC7B 1E6EB 1T5XD 4LF7L 1F1HA 1WXMA 5C5MA 4GKJQ 3TQYA 3PHXB 3ECIA 1VR9A 1VQ6A 3G48A 2HHHQ 3EIVA 2EMTA 1ILQA 1BO0A 1EEFD 2ALYB 2K5DA 1A70A 1JW9D 3OIPA 2FBWB 3KLSA 4FVMA 3KWLA 4BY7H 4MJSA 4XDDA 2JEBI 5AJ3Q 2M8SA 2KECA 1WX9A 2VW9A 4K5WA 4G4KA 5IP9H 3DWPA 4JYAQ 2CW0C 4GDKB 4ODGA 2JZZA 1MD2D 2L5TA 1QUQB 3A5ZB 3H0GH 1GUWA 4ZUJA 4ANXA 4H0LC 3DVNU 2I46A 1L0YB 5FK9C 3GE3C 4FJVB 2KBNA 2WX1A 3VYRA 3D8GA 2WDTB 1R4PB 2NZOA 1CFMA 2E2HB 1WCMB 1XLOA 2ZPYA 5FLXc 2YVCA 4EQOA 2KTRA 4EQNA 1ICFB 4P74A 5C5LA 5C3WA 2PZUA 3FILA 2F0PA 3W1GA 5BR8L 2Y0SG 4L5TA 4W9LA 1XTDA 4NW2A 1DOIA 4HJAA 2V3NA 1EUJA 4K8IA 3I57A 4OELB 4L5SA 2VZKB 3TDQA 3VRBB 2ZW1A 1PA6A 4IFDI 2QHOA 5M5WH 2LFIA 3RD2A 3RNGC 2D07B 3S14H 2IZVB 4GS3A 1LTLA 5FKAC 1SJED 5IWAQ 4MIUA 2GOWA 2JQRB 4E71A 3PO0A 2F0IA 3DHQA 3E56A 3CQZB 2YLMA 1FMAD 3PRZA 4DK5A 1FPYA 4LNOA 2WS3B 1UELA 4O0AA 5LNK1 3DBHI 3KF6B 3G6EA 3H7PB 3CC4A 1C7YA 3AN1A 3ITPA 1HNXL 4LTUA 3P4PB 3QIJA 3T13A 4ABNA 3VQIA 4C00A 3VYTA 4ASWC 5BMIA 4FXKC 2DYBA 1D5ZC 3RNBC 4Y7NH 3KLWA 1LYLA 1W6JA 4P75A 4A4IA 1WJ6A 1H9JA 3CAMA 4K5VA 2KWCA 3BDCA 4CKEA 1WXAA 3BG3A 4GKJL 3ULPA 3KYHC 1XO3A 2I38A 2KDFB 1SNQA 4X3UA 4C56C 2HHHL 4CDDC 2E74C 1FIQA 1RLFA 4MM3A 4FP5D 2FMMA 1PTOB 3AE5B 4TQ1A 4LMQD 4QGUA 4MACA 2HDMA 5AJ3L 2JA6H 2B2UA 2LKVA 2Y5CA 1FYCA 4XE0A 4JYAL 2D9UA 2JRHA 4PYUA 5EE1A 2KWUB 1M8AA 1Q7YC 4WQMA 3I63C 3R7RA 4ICUA 1STYA 4FF2A 1XF5L 4LDTD 3EFCA 1Q86C 1YNJC 5KEEA 4BBSG 2YEPB 1TVXA 2LRUA 3CQZH 1YX5B 2N7DA 4N9F4 4IQZA 2BB5A 3J81E 1XEEA 1PH4A 2UUBQ 3CC2A 3PF4A 3AB9A 3RLNA 2JA5G 1E90A 1IYVA 2C7HA 4C3JG 4C7ZA 3ND8A 2L4NA 4AYBB 4G11A 1KHIA 5ELNA 2FE8A 4DXAB 4RF1A 1LM0A 3EVQA 3HFZB 3PUWA 1RF2D 4HK2A 4KKSA 3OYYA 1SIJA 1KNAA 2PZWA 4CHTB 4EX5A 2MNAA 4JPSA 5GADC 2JP1A 5DEHA 4CDEC 1K52A 1EY5A 1ZPSA 2JE6I 5IWAL 1MJEA 3X0WA 2ASQA 2KCMA 1PTOH 5M3MB 2IX3A 1HZ5A 1L0VB 3VR4A 4IJLA 3V05A 1XPRA 1HCZA 1VDZA 5JHAA 3UF8A 3CMEA 5GXGB 2WKCA 1NNXA 2H4OA 5E6NA 1HJPA 5C4JB 4B3TQ 2WB1B 1I50B 1R4NI 5LL6S 1K53A 4CJ0B 4GGQA 3QO2A 2A69C 4KLKA 2XVSA 2ZTEA 1PDQA 4X3TA 1B44D 4DV0Q 3STBC 3NJTA 1JR0D 1X1MA 1JQ4A 2WP8J 2NBVB 1E0BA 3QB3A 2K50A 5ISRA 1B9RA 5G3LF 3J80c 3NOBA 1T6BX 2F3WA 2NN6G 2SDFA 4A3EG 4R4IA 1P3QU 1Z5SB 1NI3A 4IPGA 4W9KA 3ALBA 4UHVA 3GS2A 5CHVC 2GA4B 2BBCA 1JE4A 3KYDD 4LCDE 3P63A 1SYDA 1C4QA 3K7AB 1GUNA 1S3SG 1YHQA 4FF4A 3TMEA 3IKJA 4DV2Q 3VA7A 1TIFA 2C9WB 4C3IG 3ICEA 2MHJA 2ZJQA 1QZHA 3Q3MC 4F87A 1C9FA 3I72A 1QZEA 4ZOHC 1NENB 3ZNHB 2KJ6A 4EGVA 1L4ZB 5I2YA 1KAAA 4AUQC 3I4NG 4DHJB 1FRRA 2UUBL 1HTQA 4MNOA 1O78A 3L0OA 5JPNC 3Q14C 1I50H 3BINA 1A63A 5G55A 1NR2A 4LFCQ 4GN4B 1BDOA 2JWUA 3GV6A 3CCRA 3A33B 1MFWA 3BK2A 4AIMA 1EY7A 2Q5WD 2O6VA 4OIKA 3NPPA 2G4SA 2VUMG 2KN5A 5CC4A 3PVLA 4DR1Q 2E2IB 4XGAB 3HOYH 2Z0SA 4BA2I 1M1KC 4HJ7A 2WAQG 1AZPA 2KENA 4BBRB 2LXJA 3KWVA 4J15A 2BYEA 4PV1C 3W9CB 4A3LG 2R93B 5AZFA 3VA5A 4KKJA 1Y69U 4W9CA 5EGTA 4DDID 3MXGA 4NQLB 4X57B 2PNHA 1B9MA 1WRIA 3L13A 2OEDA 1CI3M 1KM7A 3AE8B 2I07B 1D2BA 5JJZA 5H1SE 4B3TL 2K8CA 1JT8A 2NVXB 4X62Q 1MSGA 2BE5D 2JA8B 1Z7TA 4KKTA 1EIYB 1A15A 3QJYA 3DEPA 4DV0L 3W5UB 1QNKA 4A3OA 3GTJB 3GTPH 4BZAA 4KMUC 2OOBB 2QGQA 4HJGE 4LJOB 1ENFA 2R7ZB 3C19A 4MSQB 2H5XA 4DV7Q 1V43A 4LDTB 4EUTA 3K5MA 5EKKA 3V62A 1P7EA 1EY8A 2A4ZA 2EMSA 4GDKA 3AE4B 1VQFA 1QUQA 1TT2A 2B2WC 4RAUC 2ZZPB 3BK1A 1QNUA 1Z9FA 1U5KA 1JMCA 3KBGA 3NVYA 3TUOA 4JX1C 2RQXA 2K33A 4BBRH 1C3TA 1IKLA 1NCVA 5IGCA 3K7UC 1E1OA 1E3PA 1FNVA 1YNNC 5IP9G 4ARIA 2L1BA 3RZFA 3S2HH 4HSVA 4QIWE 2CU1A 3UINB 2WFWA 1X3FA 3H0GG 2HJ1A 3K9OB 4MELA 4XYCA 4LJPB 1G8ZD 1WTPA 5C0XJ 2Z6BA 5ELOA 3NZUA 4KX6B 1I6HH 1SYGA 3F2UA 3KDFB 4OZCA 2NVXH 1JJCB 4DGZA 3NHEB 1VQGA 2JA8H 3MTSA 1PH5A 1EO6A 2PMVA 4P16A 4LFCL 1K8AC 2KZRA 5LHY1 1PQSA 2L76A 4IWOA 2KDMA 5K5PA 4DR1L 2FMCA 3PZ8A 3IHPC 3X3NA 3KYCD 1HTPA 1C78A 2JA9A 3SDLC 3E9HA 2I5LX 3KF6A 1RTOA 1KQSA 2WXOA 1DONA 3H7PA 1ZDXA 3B2GA 1PFSA 2K8HA 3CCVA 1NBWA 2Z59B 3SK4A 1IPGA 3RNFC 1ZYRC 4IM2A 2K01A 2KMCA 4PK1A 1IYJB 3UQAA 2V9HA 5EPKA 1TQOA 4XT3B 4OEMB 4X62L 3MXPA 1HH2P 4IJHA 4LF6L 2WXGA 5EAYA 4ICVA 4Q2JA 4DUZL 3F2DA 3NE5B 5C3EH 2RPQA 2DY8A 2Z9HA 4ZRIA 4YCUA 1BUIC 3L2PA 2WINB 3D4RA 2DN8A 5DM63 1YMHE 1J19A 2EJMA 1EQQA 2EIFA 4KHPQ 3SFEB 2MQJA 1SROA 1VQIA 4NPSA 4DV7L 1TIID 4JOIA 1RCVD 5A2QL 1IBKQ 3I5JC 3QOLA 1ZE3D 4WAFA 3NP8A 4AS1A 3DLLA 1E2WA 3PIO3 4KGRA 4JI7L 1JOQA 1MBYA 3QJZA 1XPUA 2JX5A 4FF1A 2B2VA 2KCCA 1O7LA 3SR1A 5CV8A 2LXAA 2CJOA 2JA6G 1STGA 1KF6B 2HQLA 1SDFA 3RYTA 3WAPA 1G91A 1YJWA 3UE1A 4ZDVA 1K8MA 2B8FA 2L0CA 3FP9A 1QJOA 1D6EC 3I7FA 3OWFA 4N58A 5KYLA 3BYYB 2ZNVC 3J7AV 5FR6A 5FO8B 3NS1A 1WJUA 2WXRA 4N6EB 3BJUA 2UUAL 2DYMA 3CCMA 2LXCA 1MSHA 4FHKA 2K5QA 4O42A 4EQPA 2MW5A 2ZXPA 1BOSA 4EOYA 1CQVA 4AJWA 2V4DA 3BYTB 1IW7C 1IYFA 4J3OD 3J81i 1KFYB 1MG4A 2O4XA 1GG3A 1TWGB 1KNEA 4A3JB 3RN9C 2HTHA 3A8KE 2WU5B 1H9SA 2P5ZX 1CZGA 3ZXVA 3DBRI 3DWAA 2MEKA 4P1BC 3QWZB 1U9RA 3GTGB 3NELA 3ZJVA 1BCPC 4XC2A 5FJ8G 2BS2B 5EDSA 2PIAA 4XDCA 4KHPL 1B1ZA 3PRMB 4GMVA 1HPCA 1BVSA 2QDLA 3VR9B 2M19A 4A3GB 4GLSC 2NVYH 4DUYQ 5CV7A 3MAQA 1IBKL 4L5RC 1V5OA 2L32A 2ZVNA 4WJQA 5HURA 2PVOD 4TRDA 4A9AA 3ER0A 4HJKA 3ZXRA 1W6KA 2RF4A 2F0DA 5GROA 4JWUC 2UWQA 3NVVA 4G50A 4JI0Q 3ZDMC 4AYBG 1V1PB 1HR0W 4TSSA 3HKSA 2EYFA 1C4AA 4FXDA 3IG3A 3IFTA 2JEAI 4USAA 4H02A 3GTMB 2YTVA 2NTSA 1SIFA 3ZRFA 2V3SA 1EY4A 3RNAC 1T0YA 3NS8A 5EBCA 1YQ3B 3A9KB 4N9PA 4JI6Q 1NUCA 2KHSA 1WTRA 4HIMA 3FKIB 2F0HA 1SNCA 1TKYA 5M3MG 2D2CC 4IUPA 4K5XA 4HXDA 5D65A 5IYDH 1I6VC 3DBHB 1HZAA 1X3EA 2B2UC 4JBMA 1G6PA 3EUB2 4LNQA 2J0TD 3W5OA 2RSOA 2HIXA 3CP0A 1ACCA 1KAWA 1S40A 1X6OA 3I3TB 1Q8KA 4OL7A 2KWDA 5K36H 1PDXA 2X6LA 1F2MA 2J7QB 1B50A 4A3IB 3PV1A 4KTAA 2LVPA 2L9HA 3GOEA 1NR4A 2INPE 1Y14B 1B53A 1LTTD 4M02A 3VR2A 1JB3A 2Z6KA 1F2ZA 1KDAA 3HOYG 2BVCA 2KOXA 2KX0A 4XTCS 2VY3A 4F8CB 4IFDJ 3WAMA 4CKBA 4RM8A 3ZKJC 2XWJB 1GD7A 2KDBA 3KFUA 1VCIA 2AEHA 3S16H 4A3KH 4FBJB 2K5PA 3ZLZA 4KV6A 4HJ5A 1WVLA 2DNFA 2Q2UA 3NG0A 5E1FA 4IOCA 2KC2A 1YHBA 4KV2A 2J52A 3E9IA 1PZID 1NY4A 2XBBC 4A3FB 3RZDB 1VQNA 1VQCA 3T4AC 1QVCA 1YJJA 4LF4Q 2QEJC 3OAWA 4I6PA 1JICA 1C0AA 1ASZA 3CSFA 4FF3A 3KK7A 1R9TH 2V1CC 2W3SA 2F3IA 1WSPA 2K75A 2FUG1 1JE5A 5J18A 1ZW7A 1BNZA 2N9XA 5AUKA 2ZJPA 4NJCA 3QG1A 2EXDA 4N9TA 2ZM6Q 3TBIB 4JI0L 4JI4Q 5IGEA 1EU4A 1U4MA 2NCNA 2F0EA 3P4QB 2JXTA 1U4LA 4OVUA 3DMUA 2WKDA 4UP8A 4C80A 2JF5A 3MEFA 4DPGA 1HE8A 2QDFA 4NJ7A 1JMLA 2GI9A 2V0GA 4BKTA 4GOCA 2FINB 3AFPA 3KDFA 4O2DA 4RA8A 1TTNA 2CU3A 2KEDA 1MPEA 5ELDA 2FCSA 4BBRG 2K1FA 3TMPB 5IT9L 4JI6L 2RHQB 1TJEA 1WJ4A 3PPAA 3BVMA 4IOAA 3EHVA 2BH8A 1WR1A 1J8IA 2JA7H 1XLNA 1PH8A 4OWWB 2KFKB 1PTOF 1WXVA 3I4OA 2IPKD 2KUMA 1HTLD 1R4NB 1AEXA 3TP6A 4A3FH 3RZDH 2D3AA 5C23A 1OQRA 4ITKA 2JA8G 5KNBA 4C3JH 4RCOA 2KCTA 3AMUA 4B6WA 1ISNA 2CH4W 1EWIA 2IGHA 1YJNA 3NTKA 1YBYA 2BKFA 3KJOA 4EKUA 3WA0A 2W55A 3MHZA 3FPUB 1IKMA 2YEPF 1ZXTA 3PS6A 3GO5A 5JPMC 1I4QA 3E3XA 4B0EA 1NTGA 4AQ7A 1WYDA 2F0NA 1DOLA 4LNKA 2VQEL 5E6JA 3L08A 4JI2Q 3OTOQ 1A5RA 4H2AA 4NXNQ 4QJFA 4G7OC 3QR8A 2KQSA 1YQ4B 3J81c 4HJ9A 1JROA 2OQKA 4GNXC 3HHMA 3TCAA 4N8FA 4LF4L 2E2DC 3AH7A 4EZJA 2DJGC 1N60A 5C3EG 2LS01 3HGBA 5IY0A 1N8RC 3UIOB 5CMDA 1TY0A 3H09A 4HMJA 2D3BA 2RDHA 5EKIA 1GAQB 4B3ML 1TWCB 3CSTA 1EY0A 4MDKE 1PH3A 1UE7A 4CDCC 1PZKD 2K5VA 2K5HA 1TWHH 4ME5A 1TR5A 4JI4L 2F0OA 3K59A 2G3QB 2KT7A 1XMOQ 3NUCA 4DAYB 2BQQA 1LGRA 1YN3A 2A5UA 1I4PA 1F9PA 3HOUH 2EZVA 2KJRA 1Q90A 4RNAA 1WR6E 3U4EG 3B6YA 3D0FA 5KNDA 3MTNB 3VXWA 4MZ9A 5FOBB 4FA6A 3S2DH 3VR5A 2A68D 2AQ2B 5JEAJ 2PPBC 1MHXA 1TKGA 3HUIA 3HOWB 1L0WA 2VQFL 4DV3Q 4CDFC 2WYQA 5I9OA 2DHZA 1WTXA 1PVOA 5D7GA 1X55A 4C7YA 1KLVA 1G2SA 4US9A 4R8IA 2QW7A 4W9DA 3CCLA 4N59A 3VUXA 3MJWA 2MLBA 5KHQA 1X3PA 3HOVH 2ZT9C 5M9OA 1MI0A 1D5XC 5C4HA 3CMMB 3R7QA 4CKCA 5LXIB 1KTKA 4M0WA 3DEOA 5JH5C 4DKAC 4JPBW 2C7MB 1LLRD 1MKHA 4KHVA 2QILA 5EPJA 4K14A 2JVCA 3LXFA 1SGHA 1K0SA 3DHIC 5IYBH 3PT2B 4NXMQ 2VL6A 2WHIA 5G5HA 2QCZA 5BN4A 2F0QA 3QAQA 4KDIC 3QOJA 3P75A 3DWGC 1FFUA 3F2CA 4ZK9B 1EYAA 4HRSA 4EQ5A 2RBMA 3ZTCA 3OTOL 3N9YC 4NXNL 5I6YA 1TT5B 5CV6A 3W3AA 1A3UA 4B9XA 2MBHA 4F1SA 5DPTA 1GVPA 3PF5A 4NQKE 2PLPA 3FRPB 4CO7A 1VCBA 1VZ7A 4L6TB 3MA2B 3P42A 4I65A 4IM0A 2AX5A 1WD1A 3K5NA 1HNXQ 4OX9Q 1TZOA 1T3QA 4KGSA 1V1PA 4A3DB 2PI2E 2DX5B 1Y1WB 4HCPB 3AEFB 4LNIA 2D11A 1UWMA 4GDLB 4A75A 4TVAB 2D0OA 3SK6A 1XMOL 2LGXA 4JQWC 4ZRJA 5TR5A 3LYYA 3PCOB 2SEBD 5E3FA 3RN5A 3A9KA 4S17A 4YWGG 4ZAIA 3MP9A 3QX1A 3M3YH 2LHDA 4WWOA 3MC8A 1PTOC 3V2TA 1VQ8A 3CPFA 4MGZE 2QDBA 2FCQA 3BIID 1MJCA 3DWQA 3CKIB 4JOIC 5HY6A 1WTWA 4DDGD 2MP2B 4DV3L 2N49A 2XK5B 1RJTA 1AP0A 3HOZB 1WX7A 4GB9A 2V4IB 3PUVA 2F0SA 3OOCA 1CKMA 5AZGA 3QK0A 3W1SA 1TS5A 2ZCBA 1IXRA 5KYIA 3LB8C 2B2VC 2BWFA 3H7SA 5DPSA 5IYDG 4ZQ3A 1UUPA 2CFMA 2IL8A 3AEVA 2L83A 1SSNA 4RCNA 3S2AA 3DM3A 1EIFA 1TS2A 2L11A 3JAML 3ZO5B 3M4OB 3SVMA 1RIPA 1LUZA 4L63B 5K36G 4DHZE 1WD0A 2Q2HA 5LMNQ 4TUUA 3SK8A 2XGTA 5CBAE 1Y1WH 3J9CA 4ULLA 4NXML 2KK8A 1R7SA 1RFKA 1E2VA 3VR3A 3TN2A 1UE1A 4PZ8A 3BS1A 1VQJA 1CKOA 5I6WA 1WY8A 2ZEQA 2WXIA 2K9XA 1LTSD 4JI8Q 3Q8BA 3CCSA 1CA6A 2J0KA 3PV0A 1SMYC 1FD7D 4H13C 2IWHA 4A76A 5D14A 1C1YB 2GB1A 2N7JA 4BFRA 3H94A 3DXJC 1XNRQ 3VUYA 2H1EA 3EJIA 4A3KG 3VTVA 1STEA 1MHWC 3DVGY 1VMCA 4HIDA 5G5GA 1PGBA 5I2XA 3GB1A 4IG7B 3H1UA 3HOZH 3F1ZA 4OX9L 2BA1A 3GTKB 5HKHA 1GXDC 3M9BA 1OXTA 4NKLA 2F0UA 3FKIG 5DAUA 4C4VB 1QVGA 2K04A 1FXTB 3C46A 3TBLD 4II3B 1LTBD 4XQJA 2BWES 3EA6A 2C5LC 1X54A 1AZQA 3HK0A 2E2HH 1WCMH 1N36Q 1STNA 2F0VA 3M4OH 4KD4A 4KN4C 1KH0A 3NZSA 3EFUA 2K05A 3D6CA 5L83A 1X3GA 4XXEA 3P1HA 4IPHA 1SSOA 2KFKA 2RR9A 1H9RA 1E8WA 1PH7A 1V9PA 1VZ6A 2G9DA 2LFNA 5CR3A 4LW1A 1JALA 1L7YA 2XEWA 3DBRB 3M3JA 4FJZA 2UXDQ 1K51A 2NTTA 2IDYA 4HMIA 2Z1CA 1V97A 1PFNA 1Q3LA 1LTAD 3TSSA 1NI2A 3G71A 2MWSB 2JA7G 4W9GA 2GLSA 3OWEB 2WP9B 1E8YA 2VB2X 3H3VC 3N52A 3VVWB 1BBWA 2A5HA 4JG2A 4HJ8A 3NSWA 1R4MI 2KLCA 3U52E 1EEID 3SHLA 4A3FG 1CJEA 3PUZA 1QOBA 2LASA 2ID0A 5LMNL 3GTKH 1VQLA 2Q2IA 4LAAA 2OEOA 2WXLA 5KIXA 1ML0D 4R9WA 1PRTC 1TZ1A 1D4BA 4EEWA 4PQXA 4WJ4A 5IP4D 3QIAA 2KHWB 1YHAA 1PH1A 3ZUNA 2L3ZA 1BQQT 1FCCC 2SOBA 2NB0A 4JI8L 1JWBD 2RVLA 1PV4A 1P7FA 2EY5A 2G1EA 1WJJA 1A2UA 1K0RA 1XNRL 1DZ1A 2KN4A 2OTJA 2KAJA 4AP4C 3DDCB 2PZTA 2ZXRA 1D3ZA 5T1IA 1EQTA 2Z6KC 2UU9Q 1J7CA 1YX6B 2DAJA 5AUIA 1KLUD 2R3ZA 5FJ8H 1P9DU 3ZYYX 2WIIB 1LQBA 2LI5A 5D6JB 2EJFC 3PZDA 3RPFC 4JL9A 1PFDA 2WX0A 3T3OA 3IVFA 1RKNA 1V1OA 3KBXA 1F77A 2KANA 2EYJA 1N36L 3HM3A 4HCSA 2EKIA 3CRLC 3PLUA 5A2QE 2F4VQ 3KUPA 2WV6D 2RCFA 1OEYJ 1ZKHA 3A1QA 3T1YQ 3L54A 1OGWA 3ZNZB 3GTLB 3I73A 4TQUS 1QOHA 3HOUG 2IHEA 4E3CA 3FKYA 1GUTA 4FO2A 2HE7A 2J42A 5BO4B 2B2YA 3VH4B 5M3FB 1V81A 2TSSA 2VZAA 2X38A 2GVBA 3HM6X 1PUTA 2NN6I 2J0JA 2UXDL 1E5WA 1EF1A 5AFWA 2MBBB 3O65B 4RMAA 2R7DA 1ZEQX 2PMZE 2L55A 2X69A 1L1OB 5M3MH 1T0RC 2I5HA 4HPPA 4YWKA 2W9NA 4XZ4A 3X23A 3AU7A 4K2LA 3J7ZC 1H8CA 2PCFB 3HOVG 1GJXA 2CS4A 4C1NK 5C4XB 1MG8A 2JSOA 2NBFA 4X65Q 1JJ2A 5C4JH 3FVQA 2A6ED 2I1KA 1I4HA 1FXIA 2VXWA 4HCEA 4V0BA 1YN5A 1PYSB 4E6IA 2ZJDA 1F9QA 4OONA 1A3VA 1V2YA 2JZPA 3MC9A 3TP8A 1GUSA 2REXA 4CQNA 1I42A 1OXVA 5IYBG 3N3KB 1KABA 1RDPD 4KD3A 1XWEA 1LV9A 5E4WC 5HGTA 4DR5Q 2H88B 2NZ1D 2LJ5A 3RMHA 3SDZA 3NBIA 1G6ZA 2GBKA 3D6WA 1LTRD 2LY7A 1VD2A 1EQVA 4MEMA 5HFYA 5E4XA 1WH3A 3RNCC 3HIZA 4Q5VA 3K7AH 5J22A 1WTVA 2GRIA 2UU9L 4B9KA 5M3FH 2IX1A 4GDLA 1U4RA 4LF6Q 2AUJD 2BA0A 4P1CC 4ZKCB 3G4SA 4DUZQ 1C8CA 1Q82C 4R8NA 3FEWX 1GC7A 4WQOB 1SN8A 3WAOA 4S3SA 2FNJB 1FNWA 1VQ5A 3KOJA 3V61A 2RCNA 5EE9A 5LLIA 3H3VH 2Y0SE 1S5ED 2F4VL 1PXUA 2IT1A 3T1YL 2OHFA 3J7AF 2XK5A 4KGTA 1N62A 1X3QA 1VQDA 4QB4A 4X64Q 2FJ2A 4QMGA 3Q69A 1FEHA 1SYCA 1QWYA 5BN5A 2G5DA 1MIUA 1BR9A 2BW2A 3HKZG 4MGKE 2F0KA 1HFGA 4AJYB 1LT5D 4IUTA 2R2OA 4JI7Q 3SU8X 2LMCB 2E2IH 2O2LD 1IGCA 4J8QA 2Q2TA 5J17A 2JXMB 3E6ZX 1VQBA 1Z2MA 5CV5A 3KVFB 4UDUC 2R93H 1F9RA 1UNSA 2HD3A 3MZ5A 4GLXA 1LT4D 3DQVA 3M63B 1UH6A 1T0SC 2AHOB 5A35A 2ACZB 1B7YB 2N88A 4H7BA 2K22A 4X65L 1SYBA 3RLOA 3A4SC 4ZKBB 1MHHE 2UUAQ 1A0IA 2K5WA 2HDLA 1FNUA 3ULLA 2NVQB 3PRPB 1GC6A 4ZHPA 3ZQ4A 2AQ3B 3GTJH 5C0XH 3P4RB 4JVZA 2HUGA 4KK7A 1WGKA 2BE5C 1Y1WG 2R7ZH 2WXKA 2MUYA 4DR5L 1RTNA 4LUOA 1GB4A 3IL8A 4NB3A 2V4LA 4AWJA 1IHZA 1NMFA 1CA5A 2SNSA 2MGSA 1XLQA 1VDVA 3NVZA 2MJ8A 3Q8EA 4ILWA 2KWVB 1OFFA 2OXPA 2E76C 1EL0A 4L5QA 3K0XA 4KY5A 4OO1H 1X65A 4K7WA 4C4VA 1YJIA 4RWSC 1WXQA 2PYKA 1GUGA 4I7ZC 3DBSA 4FLHA 2J53A 1J7AA 4F8MA 4MGIE 1MJDA 1HA5A 2NPTB 3HOZG 2JWZA 3SE0A 2WDQB 3HRDD 2VB3X 1R4QB 2R61A 2WXJA 3C3LA 2B29A 4DR2Q 3M95A 2D0PA 1YITA 4HLEA 3C1FA 3MFYA 3VAWA 3RUZA 2JT4B 3HP3A 3ZW3A 4RGMA 1AARA 4A55A 2K6QA 4CBVA 4X64L 1WCMG 4R4CA 3MJ5A 4K6LA 3ZRCA 3FDTA 3RLFA 3E0EA 5JVG3 1TS4A 2PQEA 4IUQA 2EY6A 1WTOA 3APFA 1FFVA 2UU7A 3Q6SA 1WXSA 2C35B 3SGIA 3RFZB 2EYPA 1DD2A 2K5NA 1YN4A 4HIKA 1CM9A 1YVCA 1YZ6A 2XTIA 3K0YA 5KRUA 1CZPA 3M62B 3IBEA 2AWNA 3RCZA 3N6RA 4M1UB 5IT9E 2YV5A 5CYUA 2CHBD 2JQOA 1W3SA 3ONSA 1RHPA 1Y8NB 4A3PA 4EZKA 3NQTA 1N61A 4K7SA 2D5DA 4O1NA 4HROA 4OVZA 1NBFC 1SAPA 2JSVX 1HZ6A 1BCPD 1N5XA 3RUIB 1XJVA 1H4RA 3NXWA 2FFKB 4DR7Q 4HVBA 3W1SC 1HUNA 1JOKA 2F0WA 3DPDA 4EE2A 4QL5A 1ZOYB 4AH6A 3U58A 2F0LA 2INDC 3TEXA 2N55A 3NWTA 1XLPA 4AOFA 4OWXB 1GB1A 2VH2A 3VTUA 1GO3E 5E6PA 3NRZA 5M5XB 3TRZA 2N9PC 2Z4IA 3CC7A 4A3BB 1K8RB 3RI7C 4ANUA 3UDIA 4KVGB 3Q24A 2N1WA 2DUDA 4A3MB 4GZYC 5JVH3 1A6XA 1EYDA 3E0JA 3D4WA 4KKUA 2EELA 4IM3A 2JUOA 4X66Q 1XPOA 2R6GA 5LL6X 3MFGA 2IW3A 2RDFA 2NUCA 2AYOB 4R1JA 2Y3AA 1FGBD 2LVOA 4US8A 4OVVA 4DR2L 1E0ZA 4RG1A 5HGQA 4QQBX 4DAPA 1QOAA 4K2KA 4QY7A 4II2B 2E5LQ 1JRUA 3OPOA 1YOVB 1SE2A 2MO1A 3PGZA 2G4DB 4LF8Q 3RULA 4HPLB 5J1ZA 3EGRA 1YEZA 2D62A 2WQYB 1V1QA 1YJ9A 4WJOA 4C2MB 3BU2A 4B9WA 2E75C 2WAQE 1G2TA 1KJTA 5JJIA 1O7YA 4LF5Q 4KSKC 1L1OA 3ZJUA 1CTMA 3PUXA 1VQMA 2KJXA 3UI2A 3S1MB 1TKEA 2UXBQ 5CBEE 2MBOA 2QJLA 5DLQE 1TWGH 1EM7A 4A3JH 2KYWA 3R3MA 3AECB 3K57A 1E7PB 2AKWB 2KACA 4JC0A 3NK9A 1WJNA 5GAGC 3NVWA 4HKQA 3AU5A 3EQLC 1RWSA 1EY6A 1SNOA 1IBLQ 5FLXL 1VQPA 1JRPA 1WIAA 2LZ6A 2CWAA 1NMGA 2EYMA 3HOXB 2EPBA 3LX0A 3GTGH 4PS8A 1CSPA 1N5WA 5DPRA 4NPNA 2F0TA 1E10A 3M7GA 2WB1G 4QUCA 4WJNA 1E7VA 2SNMA 1G291 3VDYA 3EFXD 4DR7L 1TBEA 4PS7A 2BYFA 4MH8A 4A3GH 3ERQA 4WAAA 1C9OA 2EOTA 2IO1B 5IO9A 4LF9Q 4QIWB 1LABA 3SHQA 2V1YA 2TMPA 1WM2A 2IY5B 2MBEA 3SEBA 1S72A 3OIQA 4FULA 5H8YE 1FVIA 2ZNVB 3NWSA 3TEWA 3J81j 2KQ3A 4GLVB 3I2ZA 2C5CA 2VQEQ 2AL6A 4IURA 1K83B 3L0WB 2LVQA 2WWZA 4BOZB 2WLBA 4IFDH 4FDBA 4X66L 4REZA 1QT9A 5M3FG 3GTMH 4K3CA 1WI0A 4R3DA 4BKSD 2PW7A 4GKKQ 1KD1C 2BPSA 1OXSC 3M4PA 2O5IC 1L4DB 5EE3A 3FKIH 3I55A 2E5LL 2D5GA 4B08A 1A8VA 5G2NA 2IJ0A 4P71A 1R4MB 3HOXH 3K81C 4K6DA 5EBDA 3I56A 2XRQD 4B3MQ 4LF8L 1WFYA 3KUCB 5C4XG 2K1BA 2OCEA 2YTXA 2GBJA 2J7ZA 4M01A 5JJKA 2KKCA 1XCQL 3AFQA 1EOTA 4BBSB 3JW0X 4W9JA 4BXXH 4X3SA 4A3IH 4LF5L 2IO3B 2F52A 2UXBL 1IGDA 4JCVE 4BA1I 3AI5A 1BCPB 2PNRC 2JA5B 2CJNA 2HCIA 3R93A 4ZHOA 3H91A 2KVZA 4HAEA 3PO2B 3CCQA 3T1HQ 3SR6A 3KH0A 3U9OA 2B2TA 4MTKA 2MA9B 2O5JC 3WALA 3T8MA 1O7ZA 1YQBA 2IGDA 2VQFQ 5T1GA 4L1BA 2MBQA 1BKBA 4EZLA 2XRSD 1IBLL 2R93G 4KIKB 3AEDB 1H9KA 1ENAA 1K83H 2YYZA 3AM9A 5IN7A 1VRAB 4G57A 3RR5A 3EROA 2B2YC 2ICIA 2BB6A 5AEKB 2PJHA 4XX5A 1G6JA 4DK1A 2DAFA 1KLGD 2AWOA 3PSIA 3JAME 1V8QA 2LMCA 1JB7A 4A3CH 1DOXA 1CHQD 2EYHA 3M7NA 5BMHA 2DZJA 4CGYB 5C0XG 4LF9L 4NDXA 4POGA 4DV4Q 2JZ3B 2XSCA 3R2TA 4X6AH 2R7ZG 1QF6A 5IA7A 3D3RA 2IYDB 2K4KA 1J8CA 4YIJA 2G9HD 2OT2A 4J6HA 1QCBD 1PYBA 3LNNA 3OG5A 4DR6L 5IGFA 4KY6A 2BOSA 3T51B 2NPTA 3ML8A 2KMMA 3NUHB 3TEZA 3ZNID 3RD4A 2QA4A 1V5TA 4RFBA 3E5SA 3HG9A 1OTCA 4DQOC 3ERSX 4OO1G 5EQ0A 2GBRA 4TV3A 1WYWB 3JVZX 4A3EB 3PO2H 4IPDA 2BKRB 3AMZA 4GKKL 2DBYA 4LNNA 1S5FD 1B8AA 1SYEA 3TP7A 2BH2A 3L4PA 1E7UA 4TMAB 5KHOA 3T9LA 3VUWA 4CHKA 3RNUA 2RKSA 1IBXB 3OMGA 2M1MA 3MXUA 4DNIA 3J80L 4BY1B 2X8XX 1UWVA 4DV6Q 3VYUA 4C3IB 3U9SA 2NBWB 3OJ3A 2KMAA 2VH1A 2WXMA 4HCNB 1C77A 1Q1OA 1KRHA 3GZNI 4IUMB 4ZRQA 1K8GA 2K32A 1STBA 5E7NA 2ZPNA 3PIP3 4CYEA 1JQYD 1VF7A 3Q0AA 3UGBB 4FNFA 4RKBA 1HXYD 4YWLA 3K80C 2KJHB 1SF0A 2R92B 1J5EQ 2KVRA 3T1HL 4MN3A 2KLGA 3DVGX 4HN7A 5HI1A 4J6IA 3BDLA 3AE6B 1OO9B 2W54A 2VUMB 1L0XB 5D3DA 2M2LA 2K52A 1N33Q 4IKGA 1I94Q 2OJRA 4P73A 3J7YW 2VRRB 4B3RQ 1W2BA 2KXJA 3TS2A 2OJWA 4C1NI 1HRJA 1XXGA 1CT1D 1U4PA 1JWUD 1L6UA 1NVID 1AFPA 2E6XA 2RA4A 2KTFA 3S1NB 3KLSX 4RM9A 4K81A 4W9EA 2I1JA 5CTRC 2NMQA 1I4RA 4YSYB 3CHBD 1VQKA 3N32A 3GQBA 3R66C 1YI2A 3DBLI 3MC0B 2A73B 4DV4L 4BY1H 1C48A 1M90C 4AYBE 1TWCH 4DK0A 4WJWA 4OW0A 2MCNB 4JBKA 2ZXOA 2EVBA 4XDXA 5ELEA 4DV5Q 2XIWA 1LFDA 1WZ3A 3TL5A 2L0TA 2PVGC 2JY6A 3QQ8B 3I4MB 1V80A 2JU6X 1QILA 2A6HC 2NR2A 1JWMD 1PYWD 1P98A 1KRTA 1NSNS 3LGJA 3IAS1 3W1YA 4G7ZC 4JK1C 1I35A 1KXLA 2WXNA 1GM5A 2R92H 3N30A 3Q22A 2RDGA 2L7RA 3DCGA 3CWIA 5IP7H 2H89B 1F9SA 3ML9A 3HOWH 1VQAA 1B2TA 2N78A 1D1IA 5TSSA 4GOPB 1RYJA 2CW0D 1PZJD 3Q2AC 1C79A 3S24A 3BDOA 4KDLB 1EY9A 4BY7B 4RMFA 5C6AA 4ZRZA 4DV6L 2ATWA 2EKEC 2F3VA 4P72A 3SD5A 1IZ6A 3S1NH 1E8XA 2WXHA 3CIRB 5C3JB 2EQSA 3AV8A 4W9IA 3H0GB 1EF5A 2MJ3A 3FAHA 1JOOA 2KEEA 2Y5BB 3QCAA 3A54A 4DAVA 1WF9A 1XTCD 4PS3A 1N32Q 2BTEA 2D3CA 4GNXB 2I5MX 1B3QA 1L2FA 2K6DB 1PFMA 1J5EL 2ZCCA 3C0RB 3IXSA 1V86A 1K9MC 2FCNA 5C2TB 2M4NA 5BYRA 2PEAA 4A3JG 1F2YA 4P7IA 2F03A 1RRBA 3I4MH 5ELBA 4WWNA 1VQ9A 4X3KA 4JV5Q 1N33L 2C7NB 3SFDB 3VH3B 2KVMA 1SMYD 1I94L 1K50A 3F8TA 1I7HA 1LO5D 4B3RL 1DCZA 2F0FA 2MRPA 2DY7A 4TKNA 1HFNA 3EBEA 2UXCQ 1UD7A 1E24A 2WXPA 1WGHA 4KKIA 1QB5D 1AH9A 5C1ZA 5M5WB 1TWAB 3AYHB 1UEAB 4LJZC 5C44B 5CGKA 2JN4A 3OHXC 3S14B 1EIHA 1TYGB 2JYOA 1OQYA 4KZCA 4W9HA 2M0XA 3ZIMA 1RAXA 2BYTA 1BF4A 1FM0D 5JJLA 2EY2A 4A3DH 1NJIC 1WE7A 1K28A 1IBMQ 3IFWB 1N34Q 4A3GG 4OIJA 4ANWA 2WACA 4DV5L 3WANA 4ID6A 2QCPX 4APVA 3AEBB 3VYSA 3RT3B 2F0GA 2LSSA 5DNFA 4XYOA 1S4ZA 2MH7A 2QF7A 4Y7NB 4M00A 5BYQA 5NUCA 2J4XA 4BBNF 3PQIA 1Y8PB 1RD9D 4JI5Q 3VDZA 2RGFA 4A8XC 4PNYA 1DXMA 1BXTA 1L6VA 2I0QA 4IFDG 2CHZA 4H44C 1YIWA 1G51A 1B70B 4TKOB 2QIEB 2F1MA 3Q3NC 4PMCA 1ZP0B 1XNQQ 1UWXA 2DNCA 4KZ0A 5FR3A 1X9NA 1TS3A 3S1RB 2JA6B 3ZTDA 2D10A 1SJHD 2AUKA 1YNJD 1OTRB 3UI3A 5FLMH 1LT6D 5GAHC 2BF8B 3BY4B 3HOXG 4KI0A 2JYTA 1TWAH 2B3AA 4DHJD 4ZCKA 1HZ9A 1CHPD 4M8AA 4YCVA 1CKNB 5C44H 2BCOA 2PKOA 1FGUA 2LD9A 2F0JA 1SYFA 4BAXA 1TGZB 1DM0B 1SR3A 3DUZA 1GOZA 1N32L 3AE9B 3Q8CA 4BXXG 2BDOA 3M4YA 4A3IG 4DWFA 1Q12A 1VQ4A 4KIKA 1F0ZA 1PRTD 3I8ZA 1BMLC 4OHJA 1UGMA 3PZ7A 1CK1A 4Y52H 2DYOA 3NENA 3ABVB 2B8GA 4JV5L 4MSMB 1LACA 4OGQC 3AU4A 1KOTA 2HTME 4F88A 1QOGA 3AE3B 2KQ4X 2N3SA 5EE0A 1II3A 3V6CB 2UXCL 1WI5A 2CH4A 1L1OC 3A4RA 2JPHA 1Y1VB 3A8IE 1KRSA 1O80A 4DXFA 1QKZA 4K8JA 3ZGZA 1OQQA 3IT6B 4UAIA 2IO2B 2ZVOA 5JHBA 3TS0A 2PE6B 2KNBA 4JWSC 1ICWA 3DHGC 3ZDTA 3AE1B 5J39A 4DF7A 3S1RH 1IBML 4YY3Q 1N34L 3TP5A 2A69D 4A3CG 3RN2A 2JRIB 3STBD 3TJPA 4JBWA 2Z8LA 1EWYC 3WWVA 2FIDA 4URKA 4BVUC 1I4XA 3JAMi 1WTHA 4LFBQ 1Y8OB 2B63B 2X6GA 5IT9c 2WGSA 2AQ1B 3N20C 1IBXA 2QSDA 5JAVA 4JI5L 5LMNW 4MT5A 4E74A 2MQHA 3VR6A 2EE1A 1Q0WB 2C60A 5MPOA 4FXCA 4K1RB 4R4OA 4I7AA 4DV1Q 3PO2G 1STAA 4DA2A 1PHJA 1XNQL 2MFIA 3T16A 3KW5B 2E8GA 4F7ZA 4DAYA 1MI2A 1F2RC 4A90A 1SMXA 4K7UA 2D2QA 2W82A 1Y1VH 4P2CB 3V3XA 1AE2A 3GP7A 1LT3D 1JJGA 3L10B 1TKWB 2JK8A 3WIMA 2ASBA 2ENBA 3PIPA 1CMXB 1TWFB 3EN2A 1UZXB 4MGYE 3MXNB 2LUEA 2JJQA 2BS3B 3J7A5 1WE6A 3GD7A 4GLAC 2RDBC 1WM3A 4RHRA 1EFID 4L8JA 1PGAA 2LWPA 3UIPB 1H9SB 3AQQA 5IGDA 1ASYA 3NZ3A 2W3RA 2F4IA 1SLJA 4ZUIA 4DAMA 2PQAB 1FRDA 2B63H 5GAEC 2IHFA 4HTHA 4XQQA 2L0FA 4MTNA 4XT1B 1WTQA 4YXDB 4JI3Q 2IX0A 3HOYB 1LM8B 4BKSA 4C3HB 2MO0A 3MEHA 5JEAG 2FIFA 5GMVA 4I6NB 4XYQA 1GUAB 2K3UA 2E3TA 5CX3A 4IPCA 3UDFA 2CR5A 2WU2B 2B2TC 2CCZA 1ZKOA 2DJFC 4YY3L 3HEJA 1VJKA 4GN5A 4BBNC 1HNZQ 2KCNA 3S15B 3DHHC 1TY2A 4BY1G 3A55A 4NZLB 1CUKA 2Y5PA 1UF0A 2A74C 1TXYA 2IY1B 2V3PA 4LFBL 4ME3A 1HQRD 1TWFH 2DLBA 3U7DA 3ZNGC 2M17A 1IL2A 3VHTC 1UE6A 3KLRA 2ON8A 4CJ1B 3GTPB 1XD3B 5IE8A 1YD8U 4YTPB 4GOPA 4GN3B 3GTLH 2ICEC 4ANVA 3IAM1 3BZDB 3Q8FA 1EOVA 3JSVB 3NY5A 3FHWA 3AEGB 4XQNA 4DV1L 3Q3OC 4DHZB 2R92G 3KUDB 2IGGA 3P4SB 4HSPA 1RFAA 1A2TA 1D5MC 4OXPA 5IP7G 3CCJA 2K8BA 4NNJB 1PRTB 3HOWG 1BBXC 1YNTE 1YNND 4KN7C 3UE0A 2ONQA 4GNXA 4C3HH 1XMQQ 2PO4A 5JZEB 2BGFA 1UBIA 3D32A 2N1VA 1T5EA 4JLCA 4YSZB 5C4XH 1WZ0A 2HCCA 1S1QB 2KD0A 2QKIC 2HJ8A 2MP2A 4YTMB 3S2HB 3C2PA 2N9EB 2N0SB 1M94A 3LWUA 5HG2A 1EZ8A 1HTOA 1PH2A 3S15H 1WGYA 5LMUQ 1I6HB 1Q5WB 2AWTA 2A6EC 3TEYA 3I3CA 5ELCA 2R2QA 2MP1A 4WWPA 4RGNA 2KO3A 1SRUA 2KOLA 1JORA 3TZDA 3LDZE 4GSWA 2Q8RE 1N6ZA 4S0RA 3Q8DA 1PMRA 3I4MG 4UPAA 3APDA 2KHIA 5FO7B 1FXAA 2WDRB 4JI3L 2NZHA 4NAWB 2DZKA 3AXCA 3WOFA 3D4DA 2QMTA 1VZ8A 2KC1A 4L23A 1ZYRD 4QCLA 4NY0A 5FLXE 4BOSC 3BVZA 1BCPF 5I4DA 5LXHA 5G3LD 4YCWA 1V8CA 2O2VB 2AL3A 2JYEA 4RF0A 3B08A 5J2RA 1CSQA 4KJNA 2GVAA 3L9AX 3U50C 1SBBB 3H6MA 3CF6E 3UQBA 3T3NA 1HNZL 4AQYQ 4G7HC 1P8LA 2CVRA 4BY7G 1VQHA 4DV2L 4A3DG 4YL8A 3GZNB 3H6NA 3U30A 3EECA 5C3EB 1SB3C 1PH9A 2K6AA 1WFQA 1ROEA 4HWIB 1EQRA 3I70A 4IOIE 3RZWC 1I4GA 2RSNA 3J81L 4JGHB 3BWUD 1AYFA 3N1YC 1ET6A 1DJRD 3KF8B 5F2DA 3CCEA 2HDEA 3ZJTA 2LXKA 5IOCA 1J9OA 2B39A 3EC8A 4KSLC 2KFJA 3Q8AA 2L05A 4IO9A 1J0GA 5D94A 2LGYA 1CKNA 2IO0B 1EZ6A 3VFKA 1A3TA 1VS0A 5IIFA 3JAMc 1GHKA 2KHJA 2XN9C 5IGBA 1XMQL 4A20A 1L2NA 5CV9A 3C1EA 3AB5A 2R7FA 3U4VA 5I9PA 5FLMG 3K5LA 1IUEA 3LJ3A 4IWPA 3A7LA 5C44G 4A93B 3L16A 4J1MA 3DBLB 2NBUA 3ND9A 5GQOA 2DZIA 3NTIA 2NVQH 1KDCA 3QHTA 3V6EB 4LNFA 5LMUL 1E2ZA 1S3OA 3L17A 2EDGA 2XNAC 3P20A 3P1MA 1OXUA 3ONAB 4OZBA 1IW7D 1EYCA 1H9MA 2L8JA 4KY7A 2EYLA 2GMIC 2N9KA 4GIVA 1ENCA 3B9JA 3PO3B 2PW5A 1EYGA 1HR0Q 3R3OA 3KJPA 2K28A 3MHSD 1N9WA 1VQ7A 3I91A 3L7ZC 2LUMA 4M8MA 5IYCH 1HA6A 1J6QA 1LTID 3NBHB 3WOEA 2BT6A 4ZRPA 4ARCA 3G7LA 4RKLA 3HS0C 3AE7B 3ENEA 1Y8RC 1L5PA 3UDGA 5DCNA 3MVVA 2CHWA 4U673 1OEYA 5JOBA 1ZXIA 1D8LA 2OTLA 1P1AA 4UP7A 2D3GA 4WWMA 2FCMA 1ILPA 1SEBD 2GN5A 2MJDA 4FADA 4AQYL 1KDBA 2NVTB 1B4OA 1D1KA 2L15A 1WWTA 4ZYNA 4IALA 4WH4A 2PMZB 1XT9B 4YWMA 4YHHQ 1RL2A 4LFAQ 2F0MA 3SK5A 4YT0B 1DYQA 1Q8IA 4A93H 1XCTL 1QOFA 3B2FA 2JXXA 3BZKA 2GBMA 1ONLA 2OF1A 3V60A 1FR3A 3FMCA 2E2JB 3FC4A 4HDOA 5J3BA 1V9JA 2LGIA 2NVYB 2A1AA 1CQFA 3A56A 3GDEA 1T0QC 2MJEA 3FPPA 1PGXA 5BN3A 3OMCA 4QAYA 3K6OA 1LTGD 1SFOB 1KL9A 4LWCA 3PO3H 1LXDA 5BMGA 1IL8A 3CD6A 4LK0M 1EU3A 4YTNB 5DM73 2Q8TA 3NTHA 4UY8C 3F2BA 2I2YA 2DGYA 3MXNA 3A74A 1AE3A 1VQEA 4WRDA 1EWHA 3ULJA 4DNRB 3GTOB 1WMHB 4PYZA 1FO4A 2YU9B 1HEZE 3CMAA 4QF4A 1Y1VG 4LLGM 4MH0E 4DK6C 1MGSA 3URYA 3J80E 2Z0EB 3P2BA 3HZXA 4YSXB 1SE4A 2ZTDA 1FL0A 4M0WB 2PI2A 3PTFC 1N63A 3MWYW 3Q23A 2IBIB 5C3XA 2PQAA 1X56A 2LRWA 2MSED 2N8NA 5FO9B 1NE3A 1ZGUB 4Z9CB 2NVTH 5M5YB 4GN1A 3AEEB 1WYGA 1JC7A 1HR0L 3OJ4B 1P0RA 4F7XA 3TZUA 1QE6A 1GUOA 3S17B 1ZUD2 5M5XH 2E2JH 5D2MB 3IAYA 2B63G 4A3BH 2Y0SB 2KX3A 1BBUA 4TQ0A 3QWNA 3B1LX 4BS9A 4HEA1 4A6QA 3M4QA 4A3MH 4P6VF 3RZOB 1E1TA 3CU7A 1SFOH 2RSUA 1U4AA 4IUUA 3Q6BA 1NYQA 4KJOA 4UP9A 5CHWA 3NQIA 2HT1A 3A9JB 3OLMD 2NVUI 4PZ7A 3S16B 4A3KB 2ZTCA 1Q10A 1HZCA 4JW0A 3GTOH 1WGDA 2BDNA 2YU9H 5L37A 4HPMB 3T53B 1U0LA 2WXFA 3JSVA 1UAPA 3U7ZA 3HKZE 4XIGS 4YHHL 4LFAL 3PHWB 1RODA 3A7AB 4WORA 1KC8C 4G0NB 2LGSA 4NAMA 3D31A 3IT4B 3PGEA 2CKHB 3BZCA 4C2MH 1Q1BA 1R9TB 5COYA 1HUMA 1KIXA 4PZ6A 2FXQA 5M5YH 1UE5A 4DR6Q 1I5FA 4MJSB 1I3QB 3S1MH 5KGUA 4XWWA 4K3BA 4EFOA 1DOYA 1C76A 2RD0A 5KNCA 1EUVB 4WJ3M 4RH6A 3CCUA 3K9PB 3U4ZA 3PUYA 4M8NA 1TU2B 1S5DD 4LK1C 3S17H 3DWMA 4ZRKA 3N1ZC 3W1BA 3CXCA 2MPMA 1GNUA 4IUNA 3CRKC 5IOIA 2N4FA 3BVGA 4RGTA 3V96A 1WGGA 2PPHA 3VTWA 2XWBB 4B0MA 1HZBA 4IDIA 3RZOH 1DGJA 2CQOA 5E6OA 4C3HG 1SNMA 1HHVA 3GV3A 3Q3JA 2K7VA 3I4LA 2KQ7A 2EXZA 5IODA 2KTRB 1IP9A 1J7BA 4DK3C 1B9NA 1QG7A 4BKGA 1GJZA 2IY0B 3FILB 1EFWA 2Z4HA 1UEBA 2JA7B 3QARA 3OSOA 4NAWA 1Y56A 3PREA 1DOKA 1XX8A 1JWSD 1FJGQ 4JIOU 3QC8B 1NDDA 3AEAB 4L2YA 4FYDA 3H3VI 1M4VA 1X32A 4QUFA 4PMBA 4C3JB 4FN2A 4FHJA 3PSEB 2O2VA 1NYRA 1Z47A 4POFA 3L3OC 3I90A 4DUYL 4I6LB 2ES2A 4EVOA 1I3QH 3NHHA 2FUHB 4NP5A 3ZJYC 1YIJA 3OW2A 5IGGA 1DGSA 2EJGC 4ZLTF 1RM6C 2O6VD 4DBGA 1XQQA 3HVZA 2NYZD 5JXVA 3C8YA 1HQMC 4K0KQ 2RMMA 1F2LA 1O7IA 3R2IA 1VLBA 3APCA 4W9FA 2KDEB 3ETRA 1VMPA 1K3BC 4DXGA 4PT5A 5L95C 1QQRA 4GU2A 4HDQA 4DR3Q 1HNWQ 1WOCA 2UYZB 1YNXA 3U2SC 3N1XC 3P7JA 3K58A 4WIPA 3KF8A 2DWQA 4DR4Q 3G6JB 3B0AA 3OW7A 4OZAA 4CJ2C 4WURA 4MM3B 4DN4M 2PW9A 3VR8B 2KA7A 1VQOA 1Z6HA 1QLBB 1S5CD 4BBSH 2MX2A 2MHVA 2HQEA 1F2RI 3I9V1 4LUVA 4U68A 1H95A 2LEKA 1SNDA 1BUVT 4IZ8A 3WDNA 2FAZA 4B3SQ 5IAAC 5C0XI 4JI1Q 1NEKB 1E7ZA 3H9DA 3HVDA 2AMCB 1TWHB 2JA5H 2DNEA 2NWGA 3DVNV 3S9WA 2OWOA 3WCQA 1PFBA 2A8VA 1FCLA 4HR7B 3Q3FA 2OQ0A 3HOUB 1C4PA 3DOWA 2RPVA 3GTQB 3W2DA 4GOPC 2Z0DB 2BYVE 3PLVA 2HIVA 3S2DB 1NAPA 4OO1I 2BS4B 2J0MA 1SE9A 1AN8A 3IRBA 4PMWA 4DFAA 3E9SA 1ET9A 3KUZA 1FD6A 4KHZA 1Q46A 2B76B 2L52A 5BYSA 2CKZB 3A8JE 2GBNA 4HKZE 3PMFA 2DENB 2LHEA 1K3RA 4RGOS 1ZXHA 5EPLA 2PE9A 3VRAB 3NBHA 5D3IB 3I4NB 3HOVB 4IN3A 3T56B 1FJGL 2WXQA 3JYUA 5T8IA 5AZHA 4DNTB 1GHJA 1EIGA 4IW0A 1E22A 1IYUA 2EYOA 1B3AA 2M0AA 4IWQA 3IFDA 1PH6A 4G3XB 1T9HA 2A19A 1SE3A 2M00A 2VS1A 4RHSA 2Q8IB 2UUCQ 2VZKD 3TEHB 1QZGA 2B2WA 3AULA 1GKHA
chains in the Genus database with same CATH topology
2A6HD 2L12A 4ZYSA 5JEAH 2WAQB 4V190 5EKLA 2NN6H 1E9MA 3DM1A 4IUVA 2SAKA 2INNE 1XYIA 4FXGC 3SXHA 1MVKA 1DOMA 3M85A 1C4CA 2LJIA 3O13A 4DU9A 4BWGB 5EE9A 1OXXK 1UGJA 5H92C 5CV4A 2PTLA 4XWTA 2K0PA 2CQAA 3S1QB 2M56B 2WNMA 5C4ZA 3X3MA 3K5OA 1JWAD 1VF5C 1ESFA 4JE3B 1PTOD 1SNPA 3HKZB 3LWEA 1AW7A 3HRZC 3AE2B 3M3YB 2N9LA 5HHDG 1GPXA 1ESRA 1ZDVA 2A68C 2L1AA 2C9OA 1SXTA 3KQ4A 3MHBA 1K8OA 1EWCA 4WFN3 2VNUD 1STHA 4NMZA 1PRTF 1Q1EA 2WDVB 4D2KA 1AWDA 2ZW0A 3H8HA 1JCKB 5EJWA 2M9VA 3W5VB 4Q0FA 1CZWA 5ELFA 4HEDA 1S5BD 2FHTA 2K03A 5CORA 3R8BA 1PLFA 2EY1A 4MHEA 1E6EB 1T5XD 5C5MA 1VR9A 1ILQA 1BO0A 1EEFD 2K5DA 1A70A 1JW9D 3OIPA 2FBWB 3KLSA 4FVMA 3KWLA 4XDDA 2JEBI 2KECA 4K5WA 4G4KA 3DWPA 2CW0C 4GDKB 4ODGA 1MD2D 2L5TA 1GUWA 4ZUJA 4H0LC 2I46A 1L0YB 5FK9C 3VYRA 3D8GA 1R4PB 1CFMA 2E2HB 1WCMB 1XLOA 4EQOA 4EQNA 5C5LA 5C3WA 2PZUA 3FILA 2F0PA 4NW2A 1DOIA 2V3NA 4K8IA 3I57A 2VZKB 3VRBB 3TDQA 2ZW1A 4IFDI 2LFIA 5FKAC 1SJED 4MIUA 2JQRB 3PO0A 2F0IA 3DHQA 3E56A 3CQZB 1FMAD 2WS3B 5LNK1 3AN1A 3ITPA 4LTUA 3P4PB 3T13A 4ABNA 3VQIA 3VYTA 5BMIA 4FXKC 1D5ZC 1W6JA 1H9JA 4K5VA 3BDCA 4CKEA 3BG3A 1XO3A 2I38A 1SNQA 4X3UA 4C56C 1FIQA 2E74C 4FP5D 2FMMA 1PTOB 3AE5B 4TQ1A 4LMQD 4MACA 2HDMA 2B2UA 2LKVA 2Y5CA 1FYCA 4XE0A 2D9UA 5EE1A 1M8AA 4WQMA 1STYA 4FF2A 1XF5L 1YNJC 5KEEA 2YEPB 1TVXA 4IQZA 2BB5A 3J81E 1XEEA 3AB9A 1IYVA 4C3JG 4C7ZA 3ND8A 2L4NA 4AYBB 2FE8A 4RF1A 3EVQA 3PUWA 1RF2D 4KKSA 1SIJA 1KNAA 2PZWA 4CHTB 4JPSA 2JP1A 5DEHA 1K52A 1EY5A 1ZPSA 2JE6I 1PTOH 5M3MB 2IX3A 1HZ5A 1L0VB 3VR4A 3V05A 1HCZA 1VDZA 5GXGB 2WKCA 2H4OA 5C4JB 2WB1B 1I50B 5LL6S 1K53A 4CJ0B 3QO2A 2A69C 2XVSA 1PDQA 4X3TA 1B44D 1JR0D 1JQ4A 2WP8J 1E0BA 3QB3A 5ISRA 1B9RA 5G3LF 1T6BX 2F3WA 2NN6G 2SDFA 1NI3A 3GS2A 2GA4B 2BBCA 1JE4A 3P63A 1SYDA 1C4QA 3K7AB 1GUNA 4FF4A 3TMEA 3IKJA 3VA7A 4C3IG 4F87A 1C9FA 3I72A 4ZOHC 1NENB 4EGVA 1L4ZB 5I2YA 1KAAA 1FRRA 1O78A 5JPNC 1NR2A 1BDOA 2JWUA 3GV6A 3BK2A 2Q5WD 1EY7A 4OIKA 3NPPA 5CC4A 2E2IB 4BA2I 1AZPA 4BBRB 3KWVA 3W9CB 4PV1C 2R93B 3VA5A 4KKJA 1Y69U 5EGTA 3MXGA 1B9MA 1WRIA 2OEDA 1CI3M 3AE8B 2I07B 1D2BA 5JJZA 2NVXB 1MSGA 2BE5D 2JA8B 1Z7TA 4KKTA 1A15A 3QJYA 3DEPA 3W5UB 1QNKA 3GTJB 4KMUC 4HJGE 1ENFA 2R7ZB 1V43A 3K5MA 5EKKA 1P7EA 1EY8A 3AE4B 1TT2A 2B2WC 4RAUC 3BK1A 1QNUA 3KBGA 3NVYA 3TUOA 4JX1C 2RQXA 2K33A 1IKLA 1NCVA 5IGCA 1YNNC 1FNVA 4ARIA 2L1BA 4HSVA 1G8ZD 1WTPA 5C0XJ 4KX6B 1SYGA 3F2UA 4OZCA 4DGZA 3MTSA 2PMVA 4P16A 5LHY1 2KDMA 5K5PA 2FMCA 3PZ8A 3X3NA 1HTPA 1C78A 2WXOA 1RTOA 1DONA 1ZDXA 3B2GA 3SK4A 1ZYRC 2K01A 5EPKA 1TQOA 4XT3B 2WXGA 4Q2JA 3MXPA 3NE5B 2DY8A 1BUIC 2WINB 3D4RA 2DN8A 5DM63 1YMHE 2EJMA 3SFEB 1TIID 1RCVD 5A2QL 3QOLA 1ZE3D 4WAFA 3NP8A 4AS1A 1E2WA 3PIO3 4KGRA 1JOQA 1MBYA 2JX5A 4FF1A 2B2VA 2KCCA 1O7LA 3SR1A 5CV8A 2CJOA 1STGA 1KF6B 1SDFA 1G91A 1K8MA 2B8FA 2L0CA 3OWFA 1QJOA 1D6EC 4N58A 5KYLA 3BYYB 3J7AV 5FO8B 3NS1A 2WXRA 4N6EB 2DYMA 1MSHA 2K5QA 4O42A 4EQPA 2ZXPA 1BOSA 1CQVA 2V4DA 3BYTB 1IW7C 4J3OD 1KFYB 2O4XA 1TWGB 1KNEA 4A3JB 3A8KE 2WU5B 1H9SA 1CZGA 3DWAA 2MEKA 1U9RA 3GTGB 3ZJVA 1BCPC 2BS2B 2PIAA 4XDCA 1B1ZA 1HPCA 3VR9B 2M19A 4A3GB 4GLSC 2L32A 5CV7A 3MAQA 5HURA 2PVOD 4TRDA 4A9AA 1W6KA 2F0DA 4JWUC 3NVVA 1V1PB 4TSSA 2EYFA 1C4AA 4FXDA 3IFTA 2JEAI 4USAA 3GTMB 2NTSA 1EY4A 5EBCA 1YQ3B 4N9PA 1NUCA 2KHSA 1WTRA 3FKIB 2F0HA 1SNCA 1TKYA 2D2CC 4IUPA 4K5XA 5D65A 1I6VC 2B2UC 3EUB2 2J0TD 2RSOA 1ACCA 4OL7A 2KWDA 5K36H 1PDXA 2X6LA 1F2MA 1B50A 4A3IB 4KTAA 2L9HA 1NR4A 2INPE 1B53A 1LTTD 3VR2A 1JB3A 1F2ZA 1KDAA 4XTCS 4IFDJ 4CKBA 2XWJB 1VCIA 2K5PA 4KV6A 1WVLA 5E1FA 2J52A 1PZID 4A3FB 3RZDB 3T4AC 1YJJA 2QEJC 1JICA 4FF3A 3KK7A 2W3SA 1WSPA 2FUG1 5AUKA 1BNZA 4NJCA 3QG1A 4N9TA 3TBIB 5IGEA 1EU4A 1U4MA 3P4QB 2F0EA 2JXTA 1U4LA 4C80A 3DMUA 2WKDA 1JMLA 2GI9A 2V0GA 2FINB 4RA8A 2CU3A 2KEDA 1MPEA 5ELDA 5IT9L 1TJEA 3BVMA 1J8IA 1XLNA 1PTOF 2IPKD 2KUMA 1HTLD 1AEXA 3TP6A 1OQRA 4ITKA 5KNBA 3AMUA 4RCOA 2IGHA 3NTKA 2W55A 3MHZA 3FPUB 1IKMA 2YEPF 1ZXTA 3GO5A 5JPMC 1I4QA 4B0EA 4AQ7A 2F0NA 1DOLA 5E6JA 4H2AA 4G7OC 1YQ4B 1JROA 2E2DC 3AH7A 1N60A 2LS01 3HGBA 5CMDA 1TY0A 3H09A 4HMJA 2RDHA 5EKIA 1GAQB 1TWCB 1EY0A 1PZKD 4ME5A 1TR5A 2F0OA 3K59A 3NUCA 1YN3A 1I4PA 1F9PA 2EZVA 4RNAA 1Q90A 3U4EG 5KNDA 5FOBB 3VR5A 2A68D 2AQ2B 5JEAJ 2PPBC 1MHXA 1TKGA 3HUIA 3HOWB 5I9OA 1WTXA 5D7GA 4C7YA 1G2SA 4US9A 4R8IA 4N59A 1X3PA 2ZT9C 5M9OA 1MI0A 1D5XC 5C4HA 4CKCA 1KTKA 4M0WA 3DEOA 1LLRD 4KHVA 5EPJA 2QILA 3LXFA 4K14A 5G5HA 5BN4A 2F0QA 3QOJA 3P75A 3DWGC 1FFUA 4ZK9B 1EYAA 4HRSA 2RBMA 3N9YC 5I6YA 5CV6A 3W3AA 1A3UA 4B9XA 2PLPA 3FRPB 1VZ7A 4L6TB 3MA2B 3P42A 4I65A 2AX5A 1WD1A 3K5NA 1TZOA 1T3QA 4KGSA 1V1PA 4A3DB 1Y1WB 3AEFB 1UWMA 4GDLB 3SK6A 3LYYA 2SEBD 5E3FA 4YWGG 4ZAIA 3MP9A 2LHDA 1PTOC 3V2TA 2QDBA 3BIID 3DWQA 3CKIB 1WTWA 1RJTA 1AP0A 3HOZB 2V4IB 3PUVA 2F0SA 3OOCA 3W1SA 1TS5A 3LB8C 5KYIA 2B2VC 4ZQ3A 1UUPA 2IL8A 2L83A 1SSNA 4RCNA 1TS2A 2L11A 3JAML 3M4OB 3SVMA 4L63B 5K36G 1WD0A 3SK8A 5CBAE 3J9CA 4ULLA 1R7SA 1RFKA 1E2VA 3VR3A 3TN2A 3BS1A 5I6WA 2WXIA 2K9XA 1LTSD 3Q8BA 1CA6A 3PV0A 1SMYC 1FD7D 4H13C 2IWHA 5D14A 2GB1A 2N7JA 3H94A 3DXJC 2H1EA 3EJIA 1STEA 1VMCA 5G5GA 1PGBA 5I2XA 3GB1A 2BA1A 3GTKB 1GXDC 1OXTA 4NKLA 2F0UA 5DAUA 2K04A 3C46A 1LTBD 4XQJA 3EA6A 1AZQA 1STNA 2F0VA 4KD4A 4KN4C 1KH0A 2K05A 3D6CA 4XXEA 3P1HA 1SSOA 1H9RA 1VZ6A 2G9DA 2LFNA 5CR3A 1JALA 1K51A 2NTTA 2IDYA 4HMIA 2Z1CA 1V97A 1PFNA 1Q3LA 1LTAD 3TSSA 3OWEB 2WP9B 2VB2X 3H3VC 3N52A 2A5HA 3NSWA 3U52E 1EEID 3SHLA 1QOBA 1CJEA 3PUZA 2ID0A 4LAAA 2OEOA 2WXLA 5KIXA 1ML0D 4R9WA 1PRTC 1D4BA 4PQXA 3QIAA 1BQQT 1FCCC 2SOBA 2NB0A 1JWBD 2RVLA 1P7FA 2EY5A 2G1EA 1A2UA 1DZ1A 2KN4A 2KAJA 2PZTA 2ZXRA 5T1IA 1EQTA 1J7CA 5AUIA 1KLUD 2R3ZA 3ZYYX 2WIIB 2EJFC 3RPFC 1PFDA 3T3OA 1RKNA 1V1OA 3KBXA 1F77A 2EYJA 4HCSA 2EKIA 3CRLC 5A2QE 3KUPA 2WV6D 3GTLB 3I73A 4TQUS 1QOHA 1GUTA 4FO2A 2J42A 2B2YA 5M3FB 2X38A 2TSSA 1PUTA 2NN6I 5AFWA 1ZEQX 2L55A 2X69A 3AU7A 4K2LA 2PCFB 1GJXA 4C1NK 5C4XB 2JSOA 2NBFA 3FVQA 2A6ED 1I4HA 1FXIA 2VXWA 4HCEA 4V0BA 1YN5A 4E6IA 1F9QA 1A3VA 2JZPA 3TP8A 1GUSA 4CQNA 1OXVA 1KABA 1RDPD 5HGTA 1XWEA 1LV9A 4KD3A 5E4WC 2H88B 2NZ1D 3RMHA 3SDZA 3NBIA 1G6ZA 3D6WA 1LTRD 2LY7A 1EQVA 5HFYA 5E4XA 4Q5VA 5J22A 1WTVA 2GRIA 2IX1A 1U4RA 2AUJD 2BA0A 4ZKCB 1C8CA 4R8NA 3FEWX 4S3SA 1FNWA 1S5ED 1PXUA 2IT1A 2OHFA 3J7AF 4KGTA 1N62A 1X3QA 4QB4A 2FJ2A 4QMGA 3Q69A 1FEHA 1SYCA 5BN5A 1QWYA 1BR9A 2BW2A 2F0KA 1HFGA 1LT5D 4IUTA 2LMCB 2O2LD 1IGCA 4J8QA 2JXMB 3E6ZX 5CV5A 4UDUC 1F9RA 1UNSA 3MZ5A 1LT4D 5A35A 2ACZB 4H7BA 2N88A 2K22A 1SYBA 4ZKBB 1MHHE 2K5WA 2NVQB 2HDLA 1FNUA 4ZHPA 3ZQ4A 2AQ3B 5C0XH 3P4RB 2HUGA 4KK7A 1WGKA 2BE5C 2WXKA 2MUYA 1RTNA 1GB4A 3IL8A 1IHZA 1XLQA 1CA5A 2SNSA 2MGSA 1VDVA 3NVZA 3Q8EA 2MJ8A 4ILWA 1OFFA 2OXPA 2E76C 1EL0A 4KY5A 4OO1H 1YJIA 4RWSC 1WXQA 2PYKA 1GUGA 4I7ZC 2J53A 1J7AA 4F8MA 1HA5A 2WDQB 3SE0A 3HRDD 2VB3X 1R4QB 2R61A 2WXJA 3C3LA 3C1FA 3MFYA 3RUZA 3HP3A 4RGMA 4A55A 4CBVA 3MJ5A 4K6LA 3FDTA 3RLFA 5JVG3 1TS4A 2PQEA 4IUQA 2EY6A 1WTOA 1FFVA 3Q6SA 3RFZB 2EYPA 1DD2A 1YN4A 1CM9A 3K0YA 1CZPA 5KRUA 2AWNA 3N6RA 4M1UB 5IT9E 5CYUA 2CHBD 1RHPA 1Y8NB 3NQTA 1N61A 2D5DA 4O1NA 4HROA 4OVZA 1SAPA 2JSVX 1HZ6A 1BCPD 1N5XA 3NXWA 2FFKB 1HUNA 1JOKA 2F0WA 4EE2A 1ZOYB 2F0LA 3TEXA 2N55A 3NWTA 1XLPA 1GB1A 3NRZA 5M5XB 2Z4IA 4A3BB 3Q24A 4A3MB 4GZYC 5JVH3 1A6XA 1EYDA 3E0JA 3D4WA 4KKUA 2EELA 2R6GA 5LL6X 3MFGA 2IW3A 2RDFA 2NUCA 2Y3AA 1FGBD 4US8A 1E0ZA 1QOAA 4DAPA 4K2KA 3OPOA 1SE2A 5J1ZA 3EGRA 2D62A 2WQYB 4C2MB 4B9WA 2E75C 1G2TA 1O7YA 3ZJUA 1CTMA 3PUXA 3S1MB 2KJXA 3UI2A 1TKEA 2QJLA 5CBEE 1EM7A 3AECB 3K57A 1E7PB 2KACA 3NK9A 3NVWA 4HKQA 3EQLC 1RWSA 1EY6A 1SNOA 5FLXL 1JRPA 2EYMA 3HOXB 2EPBA 3LX0A 1N5WA 2F0TA 1E10A 3M7GA 4QUCA 2SNMA 1G291 3EFXD 4MH8A 3ERQA 2EOTA 4QIWB 1LABA 2TMPA 3SEBA 3OIQA 5H8YE 3NWSA 3TEWA 2KQ3A 2C5CA 4IURA 1K83B 2WLBA 4IFDH 4REZA 1QT9A 4R3DA 2PW7A 1OXSC 2O5IC 1L4DB 5EE3A 2D5GA 4B08A 2IJ0A 2LMCA 4K6DA 5EBDA 2XRQD 2K1BA 2J7ZA 1XCQL 1EOTA 4BBSB 4X3SA 1IGDA 4BA1I 1BCPB 2PNRC 2JA5B 2CJNA 2HCIA 3R93A 4ZHOA 3H91A 4HAEA 3PO2B 3SR6A 3U9OA 2B2TA 2O5JC 1O7ZA 2IGDA 5T1GA 4L1BA 2XRSD 3AEDB 1H9KA 1ENAA 3AM9A 2YYZA 1VRAB 4G57A 3EROA 2B2YC 2ICIA 2BB6A 4DK1A 1KLGD 2AWOA 3JAME 1V8QA 1DOXA 1CHQD 2EYHA 3M7NA 5BMHA 4CGYB 5C0XG 4NDXA 1QF6A 2XSCA 3R2TA 3D3RA 4YIJA 2G9HD 2OT2A 4J6HA 1QCBD 3LNNA 5IGFA 4KY6A 2BOSA 3T51B 3NUHB 2KMMA 3TEZA 3RD4A 4RFBA 3E5SA 3HG9A 4DQOC 4OO1G 5EQ0A 4A3EB 3AMZA 2DBYA 1S5FD 1SYEA 3TP7A 3L4PA 4TMAB 2RKSA 1IBXB 3OMGA 3MXUA 3J80L 4BY1B 3VYUA 4C3IB 3U9SA 2WXMA 1C77A 1KRHA 4ZRQA 2K32A 1STBA 3PIP3 1JQYD 1VF7A 3Q0AA 4FNFA 4RKBA 1HXYD 1SF0A 2R92B 4MN3A 4HN7A 5HI1A 3BDLA 3AE6B 1OO9B 2W54A 2VUMB 1L0XB 5D3DA 2M2LA 4IKGA 3J7YW 4C1NI 1HRJA 1XXGA 1CT1D 1U4PA 1JWUD 1L6UA 1NVID 1AFPA 2E6XA 2RA4A 3S1NB 3KLSX 2NMQA 1I4RA 4YSYB 3CHBD 3GQBA 3MC0B 2A73B 1C48A 4DK0A 4WJWA 4OW0A 2ZXOA 2EVBA 4XDXA 5ELEA 2XIWA 2PVGC 3I4MB 2JU6X 1QILA 2A6HC 1JWMD 1PYWD 1NSNS 3IAS1 4G7ZC 4JK1C 2WXNA 3Q22A 2RDGA 3CWIA 2H89B 1F9SA 1B2TA 1RYJA 1D1IA 5TSSA 2CW0D 1PZJD 1C79A 3BDOA 1EY9A 4BY7B 5C6AA 4ZRZA 2F3VA 3CIRB 2WXHA 5C3JB 3AV8A 3H0GB 3FAHA 2MJ3A 1JOOA 2KEEA 3A54A 4DAVA 1XTCD 2BTEA 1PFMA 3IXSA 5C2TB 5BYRA 1F2YA 2F03A 5ELBA 3SFDB 4X3KA 2KVMA 1SMYD 1K50A 1I7HA 1LO5D 1DCZA 2F0FA 2DY7A 1HFNA 2WXPA 4KKIA 1QB5D 5M5WB 1TWAB 3S14B 1UEAB 4LJZC 5C44B 5CGKA 1EIHA 3OHXC 1TYGB 2JYOA 2BYTA 1BF4A 1FM0D 2EY2A 4OIJA 2WACA 4ID6A 2QCPX 3AEBB 3VYSA 2F0GA 5DNFA 4XYOA 1S4ZA 2MH7A 2QF7A 4Y7NB 5BYQA 5NUCA 2J4XA 1Y8PB 1RD9D 4A8XC 4PNYA 1DXMA 1BXTA 1L6VA 4IFDG 4H44C 4TKOB 2QIEB 2F1MA 4PMCA 1ZP0B 1UWXA 2DNCA 5FR3A 1TS3A 3S1RB 2JA6B 1SJHD 2AUKA 1YNJD 3UI3A 1LT6D 4KI0A 2JYTA 1CHPD 4M8AA 2PKOA 2BCOA 2F0JA 1SYFA 1DM0B 3DUZA 1GOZA 3AE9B 3Q8CA 2BDOA 3M4YA 1Q12A 1F0ZA 1PRTD 3I8ZA 1BMLC 4OHJA 3PZ7A 1CK1A 2DYOA 3ABVB 2B8GA 1LACA 4OGQC 2HTME 4F88A 1QOGA 3AE3B 2KQ4X 5EE0A 1II3A 1Y1VB 3A8IE 1O80A 4DXFA 1QKZA 4K8JA 3ZGZA 1OQQA 3IT6B 4UAIA 4JWSC 1ICWA 3AE1B 5J39A 4DF7A 3TP5A 2A69D 4JBWA 2Z8LA 1EWYC 1I4XA 1Y8OB 2B63B 2X6GA 2AQ1B 1IBXA 2QSDA 5JAVA 4MT5A 3VR6A 2EE1A 5MPOA 4FXCA 1STAA 4DA2A 3T16A 4DAYA 1MI2A 1F2RC 4A90A 2W82A 4P2CB 3V3XA 3GP7A 1LT3D 1TKWB 2ENBA 1TWFB 2BS3B 3GD7A 4RHRA 1EFID 4L8JA 1PGAA 1H9SB 5IGDA 3NZ3A 2W3RA 2F4IA 4ZUIA 1FRDA 4HTHA 4XQQA 4XT1B 1WTQA 4YXDB 2IX0A 3HOYB 4C3HB 5JEAG 3MEHA 4XYQA 2K3UA 2E3TA 2WU2B 2B2TC 1ZKOA 3HEJA 1VJKA 2KCNA 3S15B 1TY2A 3A55A 4NZLB 2Y5PA 2A74C 2V3PA 1HQRD 2DLBA 3KLRA 2ON8A 4CJ1B 3GTPB 4YTPB 2ICEC 3IAM1 3BZDB 3Q8FA 3AEGB 4XQNA 2IGGA 3P4SB 4HSPA 1A2TA 1D5MC 1PRTB 1BBXC 1YNTE 1YNND 4KN7C 2ONQA 2PO4A 1T5EA 4YSZB 2HCCA 2QKIC 4YTMB 3S2HB 3C2PA 2N0SB 3LWUA 5HG2A 1EZ8A 1I6HB 3TEYA 2A6EC 3I3CA 5ELCA 2MP1A 4RGNA 2KOLA 1JORA 3TZDA 2Q8RE 1PMRA 5FO7B 1FXAA 2WDRB 4NAWB 3WOFA 3D4DA 2QMTA 1VZ8A 4L23A 1ZYRD 4QCLA 5FLXE 3BVZA 1BCPF 5I4DA 5G3LD 1V8CA 2JYEA 4RF0A 4KJNA 3L9AX 3T3NA 1SBBB 3H6MA 4G7HC 2CVRA 5C3EB 1SB3C 2K6AA 1ROEA 3I70A 4IOIE 1I4GA 2RSNA 3J81L 3BWUD 1AYFA 1ET6A 1DJRD 3ZJTA 5F2DA 2HDEA 5IOCA 1J9OA 2B39A 3Q8AA 1EZ6A 1A3TA 5IIFA 1GHKA 2XN9C 5IGBA 5CV9A 3C1EA 3AB5A 5I9PA 3K5LA 1IUEA 3A7LA 4A93B 4J1MA 3ND9A 3NTIA 1KDCA 1E2ZA 2EDGA 2XNAC 3P20A 3P1MA 1OXUA 3ONAB 4OZBA 1IW7D 1EYCA 1H9MA 2N9KA 4KY7A 2EYLA 1ENCA 3B9JA 3PO3B 2PW5A 3R3OA 2K28A 3I91A 3L7ZC 2LUMA 1HA6A 3WOEA 1LTID 2BT6A 4ZRPA 4ARCA 3G7LA 4RKLA 3HS0C 3AE7B 1L5PA 3MVVA 4U673 5JOBA 1ZXIA 4WWMA 1ILPA 1SEBD 2MJDA 1KDBA 2NVTB 1B4OA 1D1KA 1WWTA 4IALA 4WH4A 2PMZB 3SK5A 2F0MA 4YT0B 1DYQA 1Q8IA 1XCTL 3B2FA 1QOFA 1ONLA 2OF1A 1FR3A 3FMCA 2E2JB 3FC4A 2LGIA 2NVYB 1CQFA 3A56A 2MJEA 3FPPA 1PGXA 5BN3A 3OMCA 3K6OA 1LTGD 1SFOB 5BMGA 1IL8A 4YTNB 4LK0M 1EU3A 2I2YA 5DM73 2Q8TA 3NTHA 3MXNA 4WRDA 1EWHA 4DNRB 3GTOB 1FO4A 2YU9B 1HEZE 4QF4A 4LLGM 1MGSA 3URYA 3J80E 3HZXA 4YSXB 1SE4A 1N63A 3MWYW 3Q23A 5C3XA 5FO9B 4Z9CB 5M5YB 3AEEB 1WYGA 1JC7A 4F7XA 3TZUA 1QE6A 1GUOA 3S17B 1ZUD2 3IAYA 4TQ0A 2Y0SB 3QWNA 4BS9A 4HEA1 4A6QA 4P6VF 3RZOB 3CU7A 4IUUA 1NYQA 4KJOA 3NQIA 3S16B 4A3KB 1Q10A 2BDNA 3T53B 2WXFA 1UAPA 3U7ZA 4XIGS 1RODA 3A7AB 4WORA 4NAMA 3D31A 3IT4B 1Q1BA 1R9TB 5COYA 1HUMA 1I3QB 4XWWA 5KGUA 1DOYA 1C76A 5KNCA 4RH6A 3PUYA 1TU2B 1S5DD 4LK1C 3DWMA 2MPMA 4IUNA 3CRKC 3BVGA 4RGTA 3V96A 2XWBB 4B0MA 4IDIA 1DGJA 4C3HG 1SNMA 1HHVA 3GV3A 2K7VA 3I4LA 2EXZA 5IODA 1J7BA 1B9NA 1QG7A 3FILB 2Z4HA 2JA7B 3OSOA 1Y56A 1DOKA 1XX8A 1JWSD 3AEAB 4L2YA 4FYDA 1M4VA 1X32A 4QUFA 4PMBA 4C3JB 1NYRA 1Z47A 3L3OC 3I90A 4EVOA 3NHHA 4NP5A 5IGGA 2EJGC 4ZLTF 1RM6C 3HVZA 2NYZD 5JXVA 3C8YA 1HQMC 2RMMA 1F2LA 3R2IA 1VLBA 3ETRA 1VMPA 4DXGA 4PT5A 1QQRA 3U2SC 3P7JA 3K58A 4WIPA 3KF8A 2DWQA 3G6JB 3OW7A 4OZAA 4CJ2C 4WURA 4MM3B 4DN4M 2PW9A 3VR8B 2KA7A 1QLBB 1Z6HA 1S5CD 3I9V1 2MHVA 2HQEA 1F2RI 4U68A 2LEKA 1SNDA