3MFGA

Crystal structure of toxic shock syndrome toxin 1 (tsst-1) in complex with the human t cell receptor beta chain vbeta2.1 (ep-8)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin/immune system
molecule keywords Toxic shock syndrome toxin-1
total genus 52
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mfgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mfgA01
5ELEA 1FNUA 1YN4A 1HTLD 1PYWD 3BVGA 3BYTB 4ZYSA 4UDUC 3BVZA 1PZID 1EEFD 3OWEB 1EFID 4OHJA 1AW7A 1F77A 1RDPD 2O2LD 2RDHA 4RFBA 1LO5D 1FNWA 2IJ0A 1D6EC 1CQVA 1BXTA 1KLUD 1PRTD 2XRSD 4TSSA 1ET6A 1D5MC 1S5BD 2TSSA 2AQ1B 1PZKD 1HXYD 1LTSD 2CHBD 1LTBD 2G9HD 1I4XA 1L0XB 1LTAD 1TS2A 4BWGB 1DJRD 1EEID 1I4QA 1JWUD 1CHPD 1KTKA 4NZLB 1UUPA 3BZDB 1EWCA 1LT3D 4RH6A 1LT6D 1V1PB 2Z8LA 1M4VA 3DWPA 5ELFA 5FK9C 1JCKB 4RGOS 1S5FD 1ESFA 1JR0D 3KLSX 1TS3A 1YN5A 1L0YB 5ELCA 1KLGD 1LT4D 1JWMD 3SEBA 1MD2D 1XXGA 3BYYB 1V1OA 4RGNA 1TS5A 2AQ3B 1ENFA 2NTTA 1CT1D 1SE3A 1I4RA 1LTID 4L6TB 1ET9A 1B1ZA 1SBBB 1HA5A 1S5DD 1D5XC 1TS4A 4RHRA 2J4XA 1GOZA 1LT5D 3R2IA 1EU3A 1G8ZD 1UNSA 2RDGA 3W2DA 4K6LA 1BCPD 3GP7A 3BVMA 1EU4A 1S5CD 1SEBD 2XNAC 4DXGA 2ICIA 1B44D 1SE2A 2R61A 1SXTA 5ELDA 1HQRD 1BCPF 4RCOA 1I4PA 3URYA 3MFGA 3R2TA 1PTOB 4L63B 1JWSD 1QILA 1RD9D 2XRQD 1D5ZC 1T5XD 4C56C 2AQ2B 3V05A 1TY2A 4DXFA 1CHQD 1PTOF 1BCPC 1XTCD 1SJHD 2WV6D 1LTGD 3EFXD 1FNVA 1I4GA 1PRTC 1STEA 5I4DA 2IPKD 3DWAA 1V1PA 1CK1A 1LTTD 5D3DA 1PTOH 3CHBD 2QEJC 1BCPB 3EA6A 4Z9CB 1SJED 3DWQA 5ELBA 1RF2D 1PRTF 1LTRD 1I4HA 1YN3A 1RCVD 2NTSA 1SE4A 3R8BA 2QILA 2SEBD 4O1NA 5TSSA 1DYQA 1PRTB 1AN8A 1FGBD 1PTOD 5D3IB 1LLRD 2XN9C 4RGTA 4RGMA 1FD7D 1JQYD 5FKAC 1PZJD 3TSSA 3MC0B 3O13A 4RHSA 1PTOC 1S5ED 1TY0A
chains in the Genus database with same CATH superfamily
3D4WA 4ANWA 4HMJA 3PHXB 4II3B 3KWVA 4IUQA 3RNEC 2DJGC 1O7YA 4ZRQA 2N9EB 2F52A 2J0KA 4H2AA 2JA5H 5FO7B 5F2DA 3TN2A 2RA4A 1CA6A 1S1QB 2XSCA 1RDPD 1MKHA 3B6YA 4LK0M 3I56A 2CQOA 4MH8A 1TWAH 5D65A 2GLSA 1R4QB 4ZRIA 2E8GA 2K33A 2WXIA 3V6EB 3AE3B 1KLUD 1Y1VH 3AB9A 1HQMC 1HTOA 1ET6A 1U4LA 1Y69U 4IW0A 5BO4B 1Z7TA 3ULJA 4H0LC 4P16A 4AWJA 4P73A 4YTMB 2ZT9C 4YCVA 3I4NH 4GKKQ 2UU9Q 4FXDA 4IUVA 2LXCA 3RCZA 3G4SA 1E2ZA 1MSGA 1HTPA 3R3OA 2CU3A 4GDKA 3F2UA 2CHBD 1I6HH 4KHZA 1Q3LA 2OEOA 2MHJA 1WRDB 3AECB 4XDXA 3B08A 1FGUA 3JSVB 4ASWC 2KLCA 3UQAA 1C9OA 1Q81C 4MIUA 5M3MB 2NVXH 1EY8A 4KD4A 4EOYA 4H44C 2VY3A 1LT3D 3S2HH 3DVGX 4QJFA 2NZ1D 4G7OC 2CCZA 3DWMA 4TQ1A 1VQPA 3DPDA 1VDZA 2W54A 3A9KB 1TS3A 4ZLTF 1N33Q 3EIVA 3M3YB 2SAKA 4MHEA 1KLGD 4DK5A 4C3HH 1OXVA 2ES2A 3SEBA 1V49A 3FDTA 4B9XA 3RPFC 1AEXA 3ND8A 4B0EA 5K36H 1WOCA 1L6VA 3EQLC 4DDGD 2WAQE 4LWCA 1ICFB 5AFWA 1I4RA 5BYRA 3Q8BA 2ZM6L 1QVCA 1ET9A 3CRKC 4L6TB 1HCZA 1AP0A 4KLKA 1GG3A 2UYZB 1NENB 2SNSA 1XNRQ 2FUHB 1GOZA 5BYSA 1EU3A 1UNSA 4HJ8A 4YCWA 2VL6A 4BBSH 2F0DA 5JVH3 1LM8B 1J0GA 1DOYA 2WKCA 4X62Q 2Q2UA 2K04A 1E6EB 3J9CA 3L10B 1QNKA 2B2YC 2KQ3A 1C78A 1I7HA 4YWLA 2KQSA 2K5NA 4YY3L 5LLIA 3EECA 1T6BX 4C56C 1UD7A 4C3JB 2ONQA 3NY5A 4MH0E 4N6EB 4HAEA 2N8NA 1WD1A 4C3IH 1V80A 4JI4Q 2VQEQ 4W9KA 1AWDA 5IGCA 5FLXc 5EAYA 1J7CA 1GNUA 2F0QA 1WYDA 2H88B 1JB3A 1VZ8A 1WGYA 2V1YA 3DQVA 4K81A 3K7UC 3HKZE 3AYHB 1UE5A 4AJWA 1EF5A 2L0CA 4HIMA 4LJOB 3V6CB 2K01A 4ZRZA 4TUUA 4GU2A 2DJFC 4C2MB 2JYEA 4B3SQ 2HHHL 1JWAD 1UE6A 4ICUA 4ID6A 2AWNA 4UAIA 3RN5A 4KJNA 4FNFA 3I55A 2ZNVC 3HKZG 3FC4A 2G3QB 3KQ4A 2D2CC 1A3TA 1XT9B 4K7SA 1FGBD 1LGRA 1GPXA 4ODGA 1KAAA 4E3CA 1E8YA 4KHPQ 3TZUA 2NB0A 3QQ8B 2EY6A 1UBQA 4BZAA 4A3FH 2N7JA 5C2TB 3FILA 3EFCA 3TS0A 3MC0B 4PMWA 4EQOA 4LNQA 1O7IA 1YQ4B 2PKOA 5ELNA 4WWPA 1KOTA 1HTLD 1H9KA 1U4PA 1ZXIA 4DV4Q 2JU6X 2N1VA 2KCCA 3GTMB 4A76A 3NTIA 1X56A 1F77A 2RDHA 4DV6Q 2F4VL 2DZMA 3S2AA 4MJSB 1KDBA 4C7ZA 3NWTA 4R4IA 1X65A 1AZQA 1C0AA 2E2HH 1H9MA 2L15A 4MTKA 1EIYB 1SE8A 2A68C 2KENA 4J8QA 4WJ3M 1FEHA 3ETRA 3B1LX 4IFDJ 3QAQA 1JJ2A 2PTLA 4G57A 3BU2A 2YV5A 5HGQA 1GD7A 4KD3A 2KC2A 1CHPD 4LFBL 1W6JA 4IG7B 1B4OA 2UUAL 3SD5A 1VQCA 1RTNA 2F0UA 3NUHB 2LI5A 2RMMA 3JAME 2WAQB 3NG0A 1B53A 2NBFA 1JR0D 2K5DA 2RSNA 1Q12A 3AI5A 3TEXA 4GZYC 2IT1A 4BXXG 3PRZA 1X54A 4FO2A 2N78A 3A5ZB 3VR4A 3U30A 1CKNA 1ENFA 4HCSA 4FF2A 3PO2H 3S9WA 4IWQA 3RFZB 1KJTA 4GKJQ 3NTHA 3GO5A 3I4MH 2QW7A 3QK0A 2VQFQ 1WTXA 2I0QA 3GV6A 4XIGS 2R7DA 3OG5A 4X6AH 5GMVA 1G8ZD 5C4ZA 1EOTA 4A3MB 4IALA 3GTOB 1P9DU 4NB3A 1TWFH 1SRUA 4A8XC 2AMCB 3I9V1 3W3AA 3ND9A 4R4TA 4DR6Q 4A3CG 3PUYA 1B44D 4GOPC 1OTCA 2MSED 2L5TA 1B70B 4O0AA 2UXBQ 4MGZE 3RNFC 5JEAG 1VQMA 1ZDVA 2FBWB 1EYCA 3R2TA 4KKJA 2MUYA 1I3QH 4N58A 4HDQA 2K05A 2BYEA 1RFAA 1Z6HA 1WSPA 2B2VA 2UUBQ 5J18A 1N5XA 2EYPA 1YIWA 1BCPC 3ONAB 1SJHD 1HA6A 5HY6A 4CJ0B 1V5OA 2HDMA 5EKIA 2EE1A 2EJMA 1VQIA 4J3OD 4DWFA 1V1PA 4DR2Q 1PQSA 3KOJA 1EIFA 3OLMD 5BMGA 1T3QA 4OWTB 5D3DA 4OZCA 2PE9A 1D8LA 1IBLQ 5IO9A 3NSWA 1RRBA 2AUKA 4GN3B 4DA2A 5C3EG 3BDCA 2EY2A 1NMGA 1ENAA 2EXDA 3HOZH 4OO1G 1LTRD 4JIOU 1ZXHA 3OIQA 2WXKA 4MSMB 1F1HA 5DNFA 3SFDB 2JYOA 2V1CC 4QQBX 2L1AA 2KN4A 3I63C 4YSYB 4JBJA 2Y0SE 1KABA 3MXPA 4CQNA 2RHSB 1Z47A 1FXAA 3RN9C 4I65A 1EYDA 3L54A 4WJQA 1LQBA 4WJWA 1FFVA 1RYJA 4RHSA 2Z6KA 5T1IA 1I50H 5ELEA 4OX9Q 2Y5BB 5H1SE 3OWFA 1Y14B 3MA2B 4JX1C 3OTOL 2PW5A 4KHVA 1J7AA 4USAA 2MLBA 3BDOA 1KAWA 1TT5B 3GTQH 5T8IA 4ME3A 2FAZA 2JA5G 2IX1A 4KKSA 2K28A 3UDXA 2JA6B 1N32L 1WYGA 4A3CH 2F0VA 3BJUA 3Q69A 4L8JA 5E4XA 4YWMA 4KGTA 4HJ7A 1G6ZA 3N20C 4HPPA 4DV3Q 2AKWB 3W1YA 4K5XA 4ZHOA 3S1RH 4LF5L 1V8QA 1EQRA 4B9WA 2F03A 5J1ZA 3NS1A 1PH9A 1PZKD 2E2HB 5D94A 4GN4B 4A9AA 4BKSA 2JPHA 2YLMA 2V4DA 3PIP3 3IT6B 3J7AF 1VQ5A 4A3OA 2EXZA 1JJGA 2JA7G 1UEAB 3S1QB 1I50B 2WXFA 2Y5CA 1K50A 2O2VB 2W3SA 3I3CA 2R93G 2IYDB 4CJ1B 3ALBA 2JQOA 4A3PA 1IBLL 2Y5PA 5C4XG 1Q0WB 2MQJA 1W3SA 2ALYB 5EBCA 2UU7A 3T3NA 4NPNA 3L08A 3PTFC 2Y3AA 3D3RA 2KANA 2F0HA 3AB5A 3C3LA 1MGSA 3W5OA 3I90A 1YNTE 4GIVA 1UF0A 3HKZB 3HIZA 3NOBA 3OJ3A 1K0RA 2HCIA 2Q5WD 4K6DA 2YU9B 1IBXA 3D6WA 1HA5A 4AYBB 1TZOA 3KK7A 2WDRB 4JI0L 1QVFA 3HZXA 1JOKA 4JWSC 1WE7A 4DV2L 2KDFB 1K52A 3ZNHB 1AZPA 5LXIB 3S17H 1E9MA 3FPPA 4A3KH 3L0WB 2ICIA 1SNQA 3KF6A 1N34L 1RLFA 5M5XB 1QOAA 2L00B 2WXQA 2XEWA 1VQJA 1T0QC 4EZKA 2QDBA 3LNNA 1ZYRC 3A54A 1OEYJ 3GTGH 1VQ7A 3C19A 4HRSA 2DN8A 4KDIC 1X3FA 1N36L 1QILA 2IO1B 2MH7A 5C44G 4OVVA 4IUPA 4A3IB 1JW9D 3WIMA 1DGSA 2M0XA 2R92G 4FA6A 4X3TA 4I7ZC 2IPKD 5FLXE 3H91A 3RNBC 1YX5B 1LTTD 1PDQA 4XXEA 1R9TB 3OMGA 2H89B 4K3CA 1BCPB 3QO2A 3FEWX 1KLVA 1BF4A 2DNFA 1PRTF 2MP2A 4GDLB 1IBXB 2OQKA 1YN3A 4GLVB 1UGMA 4IURA 1PYBA 3DBLB 1B7YB 5BR8L 1HNXL 3EC8A 1KRSA 4NPSA 1SYFA 3M85A 1WY8A 2MGSA 2KXJA 1AN8A 1N9WA 1BT0A 3I3TB 1IYFA 2XN9C 3UI2A 3UI3A 3VDZA 5AJ3L 2LHDA 3T4AC 3ZRCA 3HS0C 3TSSA 5C0XH 2FJ2A 1SYDA 5E7NA 3APDA 4XQNA 1WYWB 3KVFB 3U7ZA 2I38A 3HGBA 3A9KA 2BA1A 3Q24A 5C44B 4KGRA 1VLBA 1UGJA 1HZ9A 1A6XA 3R3MA 5JOBA 2NVQH 1BR9A 3AMZA 4WWOA 3ZGZA 4ANXA 1OQYA 1KM7A 1J6QA 4BY1G 4LUVA 1SB3C 4HEDA 4GSWA 2D07B 1TVXA 2NVTB 1BOSA 2VS1A 4JYAQ 1T0RC 3Q3MC 1LO5D 3X23A 4X64Q 4ILWA 2IJ0A 1TR5A 4DUZQ 3P75A 4ITKA 3GTKH 2WXNA 4ZRPA 1I35A 2INNE 2Z4HA 3RR5A 3HM6X 4Q0FA 2FXQA 4K5WA 4OX9L 2C7NB 4RG1A 3CPWA 3T1YL 2DZIA 4A3DH 2KX0A 1SAPA 1RIPA 4C3IG 1W2BA 1IBML 2DNCA 1QOHA 3TEZA 1Q1BA 3B2FA 4DV5L 4IQZA 1HNZQ 5JPNC 3DBRI 4NAMA 3SR6A 4YT0B 4TKNA 1QJOA 3BZCA 5M5YB 2HTME 1STGA 3OOCA 1HR0L 2BE5D 4NQKE 1XTDA 2L83A 1SN8A 4DR6L 4IJLA 4P71A 1VMPA 4GLXA 2GA4B 1B3QA 4BAXA 3C1FA 1XMOQ 1EM7A 2OJRA 3ZNGC 5FOBB 1EOVA 3S24A 1ZDXA 2OEDA 5C4HA 3UDGA 4DK6C 4ZRKA 1JOOA 4A3BB 2WHIA 2RF4A 4HKZE 4JCVE 1WTOA 3R7RA 2HD5B 2L05A 1RTOA 4K8JA 3BYYB 1V1OA 3NEMA 5E1FA 5C4XB 1SYEA 2K5VA 2RQXA 1WVLA 1O78A 5LNK1 3M62B 4FXGC 2PLPA 3TMEA 2I2YA 3EHVA 3PPAA 1SGHA 3QX1A 3VUWA 2B2WA 2KTFA 3SE0A 2HUGA 3PIO3 3I4MG 3PUZA 1P7EA 4FXKC 2MNAA 1H9JA 5IOIA 1NTGA 4WJOA 1WI5A 2QIEB 4K6LA 2JA6H 3HOYG 3ECIA 2FMCA 1U5KA 3BVMA 5G2NA 2KDMA 1E7VA 1JB7A 2HIXA 1N6ZA 4RF0A 2NN6G 3PGEA 1U4RA 2A4ZA 4JYAL 4S17A 2OF1A 2C5CA 3QIAA 3NENA 4CHKA 3VA5A 2IX3A 4WJ4A 1G6PA 2KJHB 2YEPF 2QEXA 2A6HC 1J5EQ 4DR7L 5TR5A 3L7ZC 4JWUC 1Q10A 2JVCA 3S1NH 2L11A 1X3QA 1SMYD 4WQMA 2MBBB 4EQNA 3QG1A 4A3IH 2NR2A 4BBRH 1L2NA 1PTOH 4EX5A 3MFYA 1HNWQ 4ZKCB 2LHEA 2MX2A 3ZQ4A 4RAUC 5CMDA 4LF8L 5EJWA 3J81E 2WP8J 3HOVB 2MBEA 2A69C 1E8WA 1ICWA 3SHLA 5TSSA 3STBC 1WJ4A 3E56A 3Q8EA 3K5OA 4HKQA 1PRTB 3VR9B 1PTOD 3EGRA 2IGGA 3ZTCA 1C9FA 3K59A 2QGQA 2ZTCA 2PI2E 2F0EA 1PFDA 2J7ZA 2BPSA 2KCTA 1CJEA 2R93B 5C0XG 4MEMA 1GUSA 3PSEB 1ZUD2 1AARA 3PRMB 1CSPA 1PHJA 2LJIA 1L1OA 2JQRB 4IPHA 2N88A 1DM0B 2DYBA 3AU5A 2LKVA 2E2DC 2Q2IA 4JI3L 3HK0A 3BVZA 2RKSA 1R4MI 1EFID 2L9HA 3ZXVA 1E0ZA 4CDDC 2LGXA 4YXDB 1UELA 4CKEA 1VR9A 4HPMB 3LWEA 1IBKL 4A93B 2AWOA 5LMNL 1VQGA 2NN6H 2BS2B 1GC6A 1WFQA 4CHTB 5HGTA 1PH1A 1ZW7A 4WAAA 4R4CA 3RNGC 2DX5B 4ALPA 3H7SA 3DOWA 1HNXQ 2BDNA 4TKOB 1VMCA 3H0GG 3Q8DA 2GVAA 3SR1A 3RZFA 4BOZB 3S1MB 2ZVNA 2RVLA 3AEVA 1PDXA 2IGDA 2R7ZB 2Z4IA 4IM0A 4Y7NH 1YJNA 3CAMA 1L0XB 4LF4L 2XIWA 2F4IA 1KHIA 4OO1I 2YVCA 3M63B 3BZDB 4FF3A 3NE5B 4IDIA 3MXNB 3PUXA 4AIMA 2JA7B 4C3HB 1EWYC 3Q8CA 3QARA 5L95C 2HD3A 3GTLH 1TKGA 3NVZA 2K50A 1DXMA 3I4MB 3ZRFA 2PQAB 2MO1A 1N36Q 1TTNA 5AUKA 4JLCA 2MP2B 1TU2B 1LT4D 3RYTA 3N32A 4LF7L 4JI1L 3RLFA 4A93G 1XPOA 3W9CB 1F9RA 1DOMA 5JZEB 3DBLI 1E22A 1F0ZA 4X65Q 4UPAA 3M9BA 3UDIA 1S5DD 4YY3Q 1NEKB 1YJ1A 2NBWB 2A5HA 1OXSC 2KDIA 5E6PA 4B0MA 5JAVA 2JA5B 3TBLD 5EGTA 2JA6G 1J9OA 1XMQQ 3HOYH 1L6UA 3QA8A 1L4DB 4C80A 2R7ZG 3GP7A 4BKGA 2H5XA 2REXA 3PQIA 1HH2P 1RJTA 1SNCA 3OYYA 4ZQ3A 3ERQA 2RHQB 4HJ9A 5FLMG 2R2QA 4NY0A 4ANVA 4IOAA 2BKFA 1RHPA 4BBSB 4BBRB 2K14A 1YQ3B 1F2YA 3AU7A 3OHXC 3HRDD 2VXWA 2M56B 1XPUA 4A55A 1OEYA 4RMAA 3QWNA 4CDCC 2BE5C 3NZ3A 3Q6SA 2NCNA 3A1QB 3VYRA 5I9PA 2FCQA 3PGZA 2LMCA 2YTVA 3RT3B 1KC8C 1VD2A 4C7YA 1B8AA 1CK1A 4H13C 4JI6Q 2D11A 2B63G 3BS1A 1HHVA 4WWMA 5DPRA 1I42A 3VUYA 4X64L 5IT9c 1SYBA 2MHVA 2KN5A 1E2WA 1TIID 1WXVA 1F2MA 1SE4A 4LW1A 5GAEC 2CVRA 4LUZA 4ZK9B 2L3ZA 4MGIE 5GAGC 1CM9A 5I9OA 3Q8FA 3WAPA 3ZLZA 3HOWH 2C5LC 4IPGA 4A93H 2NPTB 4OVZA 3A56A 1HJPA 4DK1A 3KH0A 1AE2A 5FKAC 1FL0A 5JVG3 1P98A 1SE9A 3W5UB 3PIOA 2PMZB 5M5WB 4KY6A 5ELOA 3LJ3A 5KHOA 1STNA 1OXTA 2R3ZA 2OQ0A 1FNUA 3GTMH 2F0IA 3PO3B 1J8IA 3STBD 1BMLC 1GJXA 3D8GA 3BK2A 4AQ7A 3BVGA 1WTHA 2Q2TA 2RDBC 3DXJC 4ZYSA 2LUEA 4UDUC 3IAS1 2FE8A 3VR8B 1IW7D 1VQ8A 4TMAB 3P63A 5A2QE 2D10A 2O2LD 3FP9A 1NJIC 4BBNC 1YEZA 2N55A 2LSSA 2WDVB 4LFAQ 3K5MA 4NDXA 3SDZA 4JI5Q 1C76A 2D3CA 2JN4A 4NJ7A 5DPWA 4TSSA 3DMUA 5JEAJ 1F2RI 2GOWA 4C3HG 1TT2A 3H6NA 1IGDA 3CQZB 4HCEA 5EKLA 3RZDB 1FJGL 3AE5B 3KJOA 5FO9B 2O6VA 1QZHA 3MTNB 1G51A 5JHAA 3NBHB 4IO9A 1I4XA 4CBVA 2EMSA 2D9UA 5G3LD 4CO7A 2Z0EB 1S72A 2WDQB 4BY7B 4POFA 1E7ZA 2L0TA 1MSHA 3GTKB 5IT9L 3CCRA 3S2DH 5EE1A 3WA0A 4YL8A 3M3JA 3T8MA 2A5UA 1XCQL 4JI3Q 4DNTB 1Q46A 5KIXA 2I1JA 4GKJL 1RKNA 3H7PA 1CSQA 5CGKA 5H8YE 3ZJTA 3H8HA 1KDAA 2L12A 5IT9E 4RNAA 1WGGA 1L0YB 5ELCA 4QIWB 1JWMD 1JQ4A 2PNRC 4YHHL 4OZAA 1GUGA 3CRLC 4LNIA 4LNOA 1TS5A 4P6VF 1EY6A 3AEAB 1Z2MA 3HOXG 2D62A 2D3GA 4K0KL 3V2TA 4PMBA 1B1ZA 2EYHA 5IODA 1X3GA 1WXSA 1HZBA 1JICA 2RCFA 1GO3E 1G291 4NXML 2LS01 2J4XA 2HQEA 2RBMA 4DPGA 1L4ZB 1HE8A 3MC9A 1LV9A 2HJ8A 1WZ3A 3G7LA 2CJOA 1EZ8A 3V3XA 2KMAA 4FULA 3T3OA 1YHQA 3EVQA 3TP6A 4LJPB 3Q2AC 3ZKJC 2LXKA 1J5EL 4FN2A 3SK6A 1B50A 4APVA 5IOCA 4L63B 1MJDA 1ZKHA 3UIPB 1KRTA 1B3AA 5EE0A 2M8SA 5BN5A 4AQYL 3I70A 2LXAA 1QB5D 5IGBA 2AYOB 4WURA 4M01A 5J17A 1EUJA 1MFWA 2LEKA 2KA7A 4UP9A 2JJQA 1ILQA 4GGQA 3GE8C 4BA1I 1MJEA 1STEA 1E1TA 3K8AA 5I4DA 3T51B 2BKRB 4M0WA 5CHWA 4YWGG 2EYJA 2K6AA 1S4ZA 1GAQB 3E9SA 4A3IG 4RM9A 4X66L 3EUB2 2ZW1A 2B39A 2JRIB 1MIUA 3S15H 4EUTA 1PH3A 2W55A 2UUCQ 2C9WB 4NMZA 1XX8A 2PMZE 2QILA 3J81c 1DYQA 1DOXA 2LD9A 3CMAA 2HQLA 2K8HA 4ZCKA 4DR1Q 5BMIA 2I1KA 1E24A 3QJYA 3IXSA 1PMRA 2F0KA 2NVTH 4RGMA 1QZEA 1CQFA 1NMFA 2AEHA 2F3IA 2DYOA 4HK2A 3ML9A 2A6EC 4OL7A 1GUWA 1K73C 4V0BA 5CV6A 4MSQB 5KYLA 1VF5C 1D4BA 1N8RC 4RM8A 2D0PA 3IAYA 2DYMA 2KHWB 3AQQA 5D2MB 1B9NA 2NN6I 1JALA 5KNBA 1QOGA 1D2BA 2V0GA 4YTPB 4P1BC 3I72A 4RFBA 4IWPA 2KVRA 1HPCA 3VH3B 4MJSA 3APFA 1EY0A 4UP7A 5GXGB 1F2LA 1QUQB 3H94A 3N9YC 3D4RA 2L32A 2CHZA 4FJZA 2UWQA 2DZJA 5E4WC 3K6OA 4LF4Q 4POGA 2M0AA 1UEBA 2K5WA 3H0GH 2VW9A 4KY7A 3PO2G 1HXYD 2G9HD 2YEPB 5COYA 1JRUA 3NVVA 3D31A 2KMMA 1SROA 2OHFA 1KL9A 1HFGA 1IYUA 4PV1C 1XPRA 3W1SC 4N9PA 4OXPA 2JX5A 1VQOA 2KAJA 3A7AB 4IUMB 4KZ0A 4XGAB 4EKUA 2X69A 2JEAI 4HCNB 3HKSA 2A6HD 1FJGQ 1NAPA 1WGKA 3L2PA 4B3SL 5CV4A 4DAVA 2WXMA 3A9JB 4LF9Q 1C3TA 4X65L 1PH7A 3CWIA 1Y1WH 5GADC 4O2DA 2QSDA 1G2SA 3AEEB 3F2CA 4LDTB 2LVQA 4XC2A 2MEKA 2WQYB 2CH4A 1TKWB 1SMXA 4M8NA 4LK1C 2ZTEA 3KF8B 1JC7A 1V2YA 3A9JA 1QF6A 1P8LA 2BTEA 1Y8RC 3LDZE 1C8CA 4NQLB 1LXDA 1XQQA 1VZ7A 2RDGA 2J0TD 3TUOA 2CHWA 2ZM6Q 2N4FA 4KN7C 1UZXB 1S5CD 4XZ4A 2BCOA 4F7ZA 1YNNC 4R8NA 3IAM1 1I4PA 3NZSA 2F0TA 2NZHA 2EQSA 5C23A 3LYYA 4DR3Q 2N7DA 1PVOA 3U58A 2AQ2B 4PT5A 3MXUA 4NW2A 1YX6B 4DXFA 4QMGA 2V3SA 3H15A 3Q14C 3GTOH 5I2XA 2CQAA 1Z5SB 2K32A 4OIKA 3RMKC 2SOBA 3HG9A 5M3FG 1E7PB 3E5SA 2EPBA 2F0GA 1D7QA 2X8XX 2IO0B 3RN2A 1TIFA 2JRHA 2W82A 1PH4A 1NSNS 3P20A 3W5VB 1RFKA 3I91A 2FMMA 1GUOA 2UUAQ 4JI5L 3NK9A 3HOYB 1J19A 5AZFA 3I5JC 3BZKA 5BN3A 3VHTC 4EFOA 2B2YA 3WALA 3H3VH 4DV1L 3VDYA 5E6OA 1K83H 2HCCA 3VR2A 1K3BC 2WKDA 4HTHA 2IO2B 4OW0A 3WAMA 1STBA 2BYVE 1HR0W 2K75A 1P1AA 4DK0A 3JYUA 1BBWA 3MP9A 3O13A 5C4JH 1SIFA 3HRZC 1WWTA 1PFMA 1TY0A 3W1BA 3DCGA 2PPBC 3P1MA 2KVMA 4GN5A 4NAWA 1FMAD 4DFAA 1FPYA 2RGFA 4ACFA 1NCVA 2K8BA 1SNMA 1TWHB 3BYTB 4B3ML 3GTLB 1H4RA 3UDFA 1V8CA 4A3KB 2VQFL 1PZID 1EEFD 1K8RB 3HOVG 2HJ1A 2NZOA 4F8MA 2KWVB 5FR3A 2M1MA 3IG3A 1O7ZA 4A3GH 3RUIB 1FNWA 1I94Q 2HHHQ 3U4ZA 2M00A 1GM5A 1H9SA 1BBXC 1SSNA 1C4QA 5D7GA 1WCMG 1BXTA 2K7VA 5BN4A 3L3OC 4YWKA 2EOTA 1E90A 2QC8A 2XWBB 4DV6L 5EDSA 2N1WA 1WTRA 1K8MA 4PZ6A 3OSOA 4U673 3H7PB 4TVAB 3I4LA 4F88A 3NRZA 4P2CB 2FIDA 5M3FH 5DM63 3DLLA 1P7FA 1CKNB 2MJ3A 3AULA 4FF4A 2K9XA 3AEGB 3U9SA 1LUZA 4US9A 4F8CB 2Z8LA 4A3JB 5FK9C 1P3QU 5CV7A 2CFMA 1MHXA 1U4AA 2D2QA 3SDLC 3GDEA 4O42A 3CXCA 2OCEA 4JBWA 1PH5A 4JE3B 4OONA 4IJHA 4KI0A 1Q82C 3O65B 1HNZL 1X6OA 1IGCA 1E8ZA 1U9RA 1GUNA 2IBIB 1JROA 2K1BA 4GLAC 2F1MA 2AQ3B 4A3BH 1UBIA 2IDYA 1CT1D 3OMCA 4DV7L 4A3MH 2PE6B 4GNXC 5DAUA 2IY0B 4JPSA 5BMHA 4JI1Q 1HFNA 1TYGB 2QCZA 3LB8C 4BY1B 1NI3A 2VQEL 4MT5A 1Y8OB 4AS1A 2ZXOA 1SE2A 4AYBE 4GOPA 2WGSA 5ELDA 1MI2A 1HQRD 2CW0C 2JA8H 2HDLA 1Y8NB 2A1AA 2GBKA 1PH8A 2QMTA 4BVUC 3EJIA 1EFWA 1B9MA 2XRQD 4K5VA 4REZA 5IP7H 2KEDA 1VDVA 3ZUNA 3QJZA 4R1JA 1TY2A 1QZGA 1XTCD 2F3WA 2UXCL 3TZDA 1ACCA 3H1UA 3PMFA 3KLRA 1A2TA 1VJKA 5C3JB 4KHPL 2BYTA 4Q5VA 4G11A 2F0MA 5A35A 4PZ8A 2Z1CA 1Q86C 1NR4A 2BF8B 3NZUA 3EA6A 3QB3A 2DLBA 2OTJA 3DWQA 1ASZA 3U4VA 4BY1H 4JV5L 4IOCA 3U50C 1ESRA 2WDTB 3OAWA 2ZCBA 2JSVX 2DZKA 2MBHA 3I57A 3K9OB 3TIXA 4HSVA 1YVCA 4IPDA 3VXWA 1Y56A 3RI7C 4C00A 2EIFA 2EYMA 3TREA 2J53A 4NXNQ 5J2RA 2BS3B 3NELA 2K5QA 4JQWC 3NPPA 1S5ED 3FHWA 2PNHA 1YITA 5G5GA 1F9QA 2IX0A 1N63A 1P0RA 3TQYA 2A73B 2HE7A 4BBNF 3N6RA 2EKIA 3FKIH 4AUQC 2CJNA 1S3OA 4JI0Q 3F1ZA 3OPOA 3BWUD 4LF6L 3N1XC 1FXIA 1AW7A 4G4KA 3NS8A 1YQBA 4M8AA 1STHA 3WDNA 1QKZA 2O6VB 3VTVA 2ACZB 4DV5Q 2K22A 5M3MH 2NVXB 2VH2A 5JPMC 2SNMA 2GB1A 4ZRJA 1FCCC 1XLQA 1OXUA 1STYA 5IP7G 2JXXA 5KRUA 2TSSA 3VRAB 2AQ1B 4V190 2N0SB 3M4OH 1QVGA 2XGTA 4DQOC 3Q3JA 3AV8A 4ZUIA 4DF7A 2WXLA 2FIFA 1IUEA 1JWUD 3PV0A 2GI9A 4A20A 2NWGA 4DHJB 2QKIC 3LX0A 4NKLA 2E76C 2INPE 2NS5A 5CV9A 3X3NA 3CMMB 3GZNB 3UIOB 4XDDA 3GTJH 3SK5A 5ELFA 2BYFA 3OJ4B 4IM2A 1DD2A 1EQQA 3P4SB 2E74C 3UQBA 3DHIC 4DR1L 3KW5B 3T56B 1X1MA 5M9OA 2J7QB 2I5HA 1TGZB 1NNXA 1ILPA 2O2VA 1VQAA 3LWUA 2VZKB 2Q8RE 3K0YA 2KACA 2E2JB 1F2RC 3N52A 2DWQA 2J42A 3U2SC 5G5HA 4YSZB 4B3TQ 4DR2L 2X6GA 2B76B 2JZ3B 2AX5A 1YNXA 1F9SA 1D5XC 1YNJD 1C4PA 3C2PA 1NVID 2BVCA 2A68D 2B29A 3BG3A 1Q5WB 4LNFA 3V96A 3FKIG 2UXDL 1ROEA 4PMCA 1BCPD 2B2TA 3DVGY 2IL8A 4K14A 1CFMA 1QNUA 3FAHA 1A15A 4LUOA 2QA4A 4DXGA 4A4IA 1ASYA 5DPTA 1VZ6A 1II3A 1NYQA 1TJEA 3P4QB 2B2TC 1NR2A 1WJJA 1V6EA 3VQIA 3PCOB 1V9PA 1X3EA 2INCC 1D5ZC 1PH2A 4LDTD 2JA8B 3PUVA 3L17A 1E8XA 4KSKC 1K8AC 2KHJA 1SNDA 1LTGD 4A3FG 3B0AA 2WXGA 3V60A 1WZ0A 3OTOQ 2M4NA 1IBMQ 2E2JH 3N1YC 1E2VA 4L5SA 2CW0D 3CD6A 3TRZA 4HJKA 1EY7A 3KF6B 5CV8A 2VUMB 1N32Q 2KX3A 4J6HA 2G1EA 1OFFA 1V1QA 1GC7A 1WX9A 3DDCB 3VAWA 1WX8A 2CKZB 3J80E 1RF2D 3BIID 1GB1A 2NYZD 1Y8PB 1MVKA 1IKMA 3AE8B 4R4OA 4X66Q 3QHTA 1W6KA 2KHIA 1NYRA 4XTCS 2D3BA 4P7IA 2LVOA 1VQ6A 1A70A 4Y7NB 5DPSA 1PGXA 5C44H 1A63A 4HPLB 4ZAIA 4ZUJA 3VTWA 3X0WA 2MBQA 3MHBA 1C79A 4JV5Q 1MHWC 2CR5A 1HZCA 1E1OA 4XYOA 2JA7H 3MZ5A 5KHQA 1A8VA 3OW7A 3MXNA 1BDOA 1I94L 3J7A5 2PVGC 1OXXK 2V4LA 3A8KE 2R93H 1QCBD 2XK5A 3CCEA 4MN3A 1LYLA 1RM6C 1PXUA 2KQ7A 2K52A 4DR3L 4ZYNA 4B9KA 4MM3A 5IY0A 3AE9B 3KWLA 2BT6A 2UUBL 3J7AV 2AUJD 1L5PA 2LGYA 3AN1A 3UF8A 1GUAB 4KY5A 3NQIA 1WMHA 1PFNA 1S5BD 1UE7A 1C4AA 1J8CA 1DONA 1KD1C 1LTSD 1YJIA 3FPUB 4G3XB 2F0FA 3CC7A 3PF5A 2F0OA 4KVGB 1EEID 3UE1A 4YHHQ 4DAMA 1TWFB 1V86A 1XJVA 1ONLA 1N61A 1V9JA 4DV0L 5IN7A 4XT1B 5DM73 2MPMA 1QOFA 4AYBG 3PLVA 3TEYA 1GUTA 3T53B 2VB2X 1VQLA 2KO3A 2KWDA 3KBXA 1HR0Q 1SYCA 4PS7A 3R7QA 1WJ6A 3G6JB 4DUYQ 1VQHA 1YN5A 1FRRA 1UWVA 1BNZA 1YOVB 3K7AH 1XMOL 1VQBA 4JOIA 4DNRB 1VF7A 4W9DA 3S1NB 1D1KA 4YCUA 2IY1B 5EPJA 4BFRA 4G7HC 4JGHB 1IKLA 4LF9L 1KXLA 4JL9A 1R4PB 4WWNA 5DCNA 4OGQC 2CHXA 4WJPA 1SBBB 3TMPB 3E0EA 3D32A 3P1HA 4W9LA 1IHZA 2TMPA 1E3PA 4RHRA 3T1HL 1SFOB 5IAAC 4DHZE 5AEKB 2XK5B 2ZXRA 1LT5D 3PO3H 4DR5L 2ZEQA 3B2GA 2M17A 2ZJQA 4DBGA 4XDCA 4WJNA 5C3EH 3HOZG 2O5JC 2RDFA 1H9SB 5IWAQ 1DGJA 4LNNA 4OO1H 1Q8KA 4DKAC 2WU5B 2WXRA 2Q2HA 2Z0SA 1PV4A 5IYDH 2YU9H 1C1YB 4X3SA 3DBRB 4GN1A 4KJOA 4AOFA 2JK8A 3RZDH 1N5WA 3AMUA 3M7GA 3PF4A 5M5XH 1DOKA 2PW9A 3ZJVA 4GMVA 5FLXL 5IYBG 4BA2I 4A3DB 1Y1WB 2GMIC 5E6NA 2C7MB 1YBYA 2FFKB 4C1NI 2L8JA 1I4GA 3A5UA 2ZNVB 1GKHA 5JJKA 3AEFB 3MJWA 4N9F4 2K6DB 4M02A 3DHGC 5C6AA 1ZYRD 2KFJA 3CW2C 2WXHA 4HR7B 4HDOA 2ZW0A 1SLJA 4L5QA 2QJLA 5K5PA 1S3SG 2AL6A 4BS9A 2Z0DB 1SIJA 1VCIA 2EYLA 2M19A 2WXPA 3CP0A 4R3DA 4A3FB 4K3BA 1XNQL 3EN2A 3GZNI 3J81L 2HIVA 3D0FA 5JJIA 4PYUA 3Q3OC 5FR6A 3HUIA 1K8OA 3Q8AA 4A3MG 3CSTA 4II2B 2LWPA 4K7UA 1SR3A 4CJ2C 4GNXA 4GDLA 1A2UA 1PYWD 4RKBA 2R2OA 3ML8A 1TWGB 1AYFA 3WWVA 3K9PB 2JT4B 3QCAA 4JI8Q 1PGBA 4BKTA 1A0IA 2B2UA 3J80i 3WOEA 2DAFA 2LASA 4FHJA 2KECA 2PO4A 2JP1A 2MP1A 4LF8Q 2NVQB 1DOLA 2LGDA 3Q3NC 1E7UA 4ABNA 4IOIE 5GROA 1D5MC 2PW7A 3AFPA 1WGRA 1TWCB 1HZ5A 1WMHB 2WAQG 1IBKQ 2O4XA 2WXOA 4A3EG 5HI1A 5IYBH 3K58A 1WF9A 2WX0A 2W9NA 3A8JE 1GVPA 2F4VQ 4IFDI 3E0JA 2FNJB 1I4QA 5DLQE 5LL6S 1KTKA 4ULLA 1O7LA 1MHHE 4UHVA 1FM0D 2KDBA 2KKCA 4FDBA 1EWCA 2ZXPA 2E2IH 1MPEA 2EZVA 1IL8A 2E75C 4MELA 2KZRA 1WM3A 4IUNA 2MCNB 1JCKB 1QG7A 4AP4C 4A3KG 5ISRA 4LFCQ 1S5FD 2QDLA 2NMQA 5CORA 1FIQA 2WWZA 1TXYA 3S2HB 1EIHA 2WP9B 4GDKB 4PQXA 2C60A 2DENB 3FRPB 4BY7H 1MD2D 1TWAB 1ZPSA 4WQOB 4M8MA 3R66C 4RGNA 2WB1G 4GLSC 4R8IA 3M3YH 3KUZA 1EO6A 3LXFA 3IRBA 3TS2A 1IPGA 4A90A 4B6WA 3PUWA 1AFPA 1EY9A 2F0PA 2NVYB 3Q22A 2MJEA 3IVFA 3MJ5A 3JAMi 3MEHA 5C5LA 2RPVA 3VVWB 1HUNA 3BY4B 4N9TA 4GNXB 2XNAC 4KKTA 5C0XJ 3C0RB 4M00A 1PYSB 4AQYQ 2F0LA 2LXJA 4L1BA 1YMHE 4LNKA 4LJZC 5JJLA 3DEPA 2JY6A 3UE0A 1BO0A 2DUDA 3A33B 5M3MG 3MXGA 3JAMc 4JI4L 1IYVA 3X3MA 2JA9A 3MEFA 4CKBA 3APCA 4A6QA 4ARCA 3KYHC 2UU9L 2VZKD 3F2BA 4LFAL 3ZDTA 4X3UA 2V3NA 3CCVA 2NVUI 4M0WB 1BUIC 4DR4Q 4B95A 2ICEC 1QE6A 2IHFA 3NBIA 4YIJA 4A3EH 1WXQA 4S0RA 5AZHA 1SNOA 4CDEC 1KDCA 4QY7A 3NHEB 5JXVA 1H8CA 3VR5A 4N59A 4KGSA 2ON8A 1VCBA 2IWHA 2GBJA 2IZVB 4PK1A 4HVBA 3PV1A 3CKIB 5G3LF 1M90C 5EKKA 1OTRB 3P2BA 2OJWA 4ICVA 5E3FA 2JWZA 2ASQA 2PCFB 3CF6E 3JVZX 4PYZA 4F87A 2QCPX 3T9LA 2I5MX 1LTLA 4C2MH 3FILB 3PS6A 4LFCL 3JAML 1YHAA 1WJUA 1LLRD 1L0VB 3IHPC 1XLNA 3M7NA 3PSIA 4NNJB 1PZJD 3AE6B 1TWGH 3UGBB 3GTQB 2G45B 3DWPA 1NI2A 2GBRA 2JXTA 2ZVOA 1WJNA 3RUZA 4JC0A 3HOUG 2DBYA 4IUUA 2AWTA 3S16H 1R7SA 2NPTA 5CV5A 1HZAA 4NXMQ 2SDFA 2IY5B 4BOSC 5BYQA 3PZ7A 3ULLA 4JI6L 1PFSA 4OHJA 5EBDA 1XWEA 3F8TA 3JW0X 2KK8A 3U4EG 2DY7A 2IGHA 1A3VA 5L37A 4WORA 2ZPNA 2KFKB 2LFNA 3IT4B 3U7DA 4BXXH 5IE8A 4GB9A 3C46A 1F9PA 1QLBB 4KTAA 1WXAA 5IP4D 4DHZB 3HOWG 2WYQA 4XYQA 3CU7A 1XYIA 4LCDE 1ZXTA 1R4MB 2V4IB 4X57B 3VR3A 2HDEA 4HXDA 4QL5A 4RWSC 3J81j 3RNUA 2F3VA 3A4RA 3ZXRA 1LTAD 4BWGB 2XTIA 2V9HA 1DJRD 4GKKL 3KUCB 4NZLB 4L5RC 2YTYA 2DAJA 4L5TA 2R7ZH 1V5TA 3RNAC 3SVMA 1LT6D 4J15A 3G6EA 2FCNA 4A75A 3FKIB 1YIJA 1BKBA 2FINB 2OXPA 1U0LA 4RGOS 4DAYA 4E6IA 3KJPA 3CCQA 3ONSA 3KLSX 1B2TA 2K8CA 4HIDA 3SU8X 4FADA 2F0JA 2QDFA 1UE1A 4RCNA 2HTHA 2EMTA 5EPLA 5BR8Q 3ZW3A 2ZPYA 3KLWA 4IUTA 2WINB 1TKEA 3KF8A 5EE3A 2LFIA 2G9DA 4HIOA 3I4OA 2KNBA 1TS4A 3A4SC 4ZKBB 5C0XI 1MG8A 3A0JA 3HOUH 3R2IA 3WAOA 4N8X1 4AH6A 1D1IA 4DN4M 1SEBD 3I7FA 2FUG1 4CKCA 4KK7A 2IO3B 1K3RA 2HT1A 3WCQA 2LJ5A 2BH2A 2VNUD 3J7ZC 2KCNA 1VRAB 2WLBA 3EBEA 4QUCA 5IIFA 1PTOB 5HHDG 1XLPA 2KTRB 1JE4A 1T0SC 2BH8A 1EIGA 1ENCA 1Q90A 3CQZH 4KN4C 3H9DA 3DEOA 3IL8A 3MC8A 2B8FA 2WX1A 3A1QA 3SHQA 1EY4A 3G71A 3BINA 3GB1A 2K5HA 2XWJB 4DNIA 4P1CC 3N1ZC 4US8A 2ZZPB 2MBOA 3NTKA 3ZJYC 1WFYA 5AZGA 2EDGA 3J81i 4BBSG 3PLUA 1K51A 5CYUA 2YTXA 3ZTDA 3FVQA 1WGDA 3C1EA 4WAFA 4ZDVA 4NJCA 2NTSA 4DR4L 5CTRC 3ITPA 4EEWA 3TCAA 1FD6A 5M5WH 1OGWA 1R4NI 3Q3FA 4WRDA 1F2ZA 3TDQA 1VQKA 1SF0A 2MQHA 3NUCA 3H3VI 2F0NA 5M3FB 2NVYH 1PLFA 1PTOC 3VH4B 2DGYA 2KUMA 3S14H 1F52A 3DBSA 4W9GA 4DR5Q 2R92H 4I6LB 3P7JA 1XMQL 2PYKA 5C5MA 4XE0A 3SK8A 2BWES 2EJFC 4QGUA 3S17B 2E6XA 2JWUA 5LXHA 3OWEB 4OEMB 1BQQT 4JI7Q 3DWGC 3MTSA 1CZGA 2E3TA 1DCZA 4IPCA 4R4QA 4PS8A 5CX3A 1VQFA 1PUTA 4DK3C 2B2WC 5IYDG 1GHKA 1XEEA 4ME5A 2A19A 4DV4L 4R9WA 1QOBA 2EKEC 1C48A 4MZ9A 2AL3A 4FXCA 4TQ0A 2ASBA 1EL0A 1K53A 4QB4A 1TWHH 2RSOA 3ZJUA 1WX7A 4KKUA 3C8YA 3HOXH 4C3JH 4EE2A 1M94A 1WTPA 4A3BG 2KLGA 3EROA 3ZYYX 5AJ3Q 4G50A 2QHOA 1PFBA 2RD0A 1EYAA 4A3GB 4W9IA 1G91A 4JI2Q 5C3EB 3QR8A 3S14B 2PMVA 5GAHC 4KIKB 3PVLA 1BBUA 1V1PB 4EQPA 2FCMA 2D5GA 3VUXA 2L76A 3JSVA 5LMUL 1FCLA 2GVBA 3UINB 1SFOH 1FO4A 3D4DA 4DV0Q 2O6VD 3HEJA 3M4QA 5IA7A 4QCLA 1OO9B 1X9NA 1TKYA 5IGGA 2KWCA 4DUZL 1EF1A 1Q7YC 2C35B 3CCLA 2KCMA 4BY7G 1XCTL 2G4DB 2K5PA 2NUCA 1NE3A 4TQUS 2N9PC 2BWFA 3RULA 4XWWA 2E2IB 1HUMA 2ZCCA 3ABVB 1C77A 4E74A 1A3UA 4RA8A 3ZIMA 4OIJA 4GOPB 4KDLB 1G6JA 1XLOA 3KDFA 3ZNID 4JI8L 2JF5A 2WNMA 4KMUC 3W2DA 2R6GA 1WTQA 4J6IA 1H9RA 2VRRB 4P72A 1WH3A 3P4RB 3SK4A 3MWYW 1SMYC 3SGIA 4HEA1 2KJ6A 3HOUB 1BCPF 4RCOA 3DBHB 2K03A 4JW0A 3URYA 4HJGE 3TEWA 1CZWA 2BA0A 3PRPB 4D2KA 4DU9A 2CH4W 1RD9D 4X3KA 1XNRL 1T5XD 2BOSA 3M4PA 4RMFA 4L23A 4C4VA 1LFDA 4P75A 1PTOF 3BDLA 5IYCH 3A7LA 4IFDG 2INDC 1F9JA 3MHSD 4FJVB 4K7WA 4C3JG 2N49A 3KUDB 3L9AX 3QIJA 3GTPB 2K25A 4WH4A 4OZBA 3G48A 1R4NB 3P4PB 3E6ZX 2MJ8A 3I73A 2KTRA 4KX6B 3TP5A 1RWSA 3GD7A 1KQSA 3A55A 2QEJC 4DDID 2Y0SB 4NJ6A 1SJED 4L2YA 2PQAA 5ELBA 1I6VC 3L0OA 2KQ4X 4XT3B 3TEHB 1I4HA 4N8FA 1WIAA 5FLMH 2KFKA 3R8BA 3PT2B 1R9TH 3KUPA 1C7YA 1NBFC 1T0YA 3GTPH 2KHSA 3NQTA 5D3IB 3KLSA 1UWXA 1WR6E 3VTUA 4A3DG 1K9MC 3WANA 1KIXA 3RD4A 3QWZB 1VQDA 1ZOYB 4HJ5A 4Z9CB 1SNPA 3KYCD 4JVZA 4LF6Q 2ID0A 4DV2Q 5G55A 3T13A 1FR3A 3F2DA 5MPOA 4DAPA 4MTNA 2D5DA 3NHHA 2JEBI 1EQVA 1Q8IA 4OWXB 4BBRG 2BQQA 1G2TA 3NJTA 3B9JA 1EZ6A 2Q8TA 3IKJA 3T1YQ 2VH1A 3NVWA 1NDDA 2KOXA 2B2UC 4NAWB 3GE3C 1ML0D 3S16B 2J52A 5LL6X 1WI0A 3ZDMC 2L4NA 1CI3M 3HOXB 3TJPA 1FRDA 4I6NB 2XRSD 2C7HA 1WRIA 1EY5A 4XQQA 5IGDA 2X38A 2GN5A 1EQTA 3VFKA 4KV6A 2A8VA 4FP5D 3Q6BA 2I07B 3IBEA 3D6CA 1LTBD 4DV3L 5CHVC 3NWSA 4C3IB 1SSOA 3ER0A 3FKYA 1L2FA 2QF7A 4EVOA 1TBEA 3A8IE 4NP5A 4A3LH 2K0PA 4Q2JA 1MI0A 4HCPB 4RH6A 5KNCA 2LRUA 1FVIA 1UAPA 1M4VA 2UUCL 3HOVH 4JBKA 3AH7A 3BK1A 4PZ7A 4CGYB 2W3RA 3MHZA 4EZJA 3TP7A 2IHEA 5HKHA 4FYDA 2KBNA 1JOQA 2Z6BA 3PO2B 2L1BA 2WXJA 1WCMH 4J1MA 4A3EB 1XXGA 1WR1A 3K5NA 2PZWA 4GS3A 5IWAL 1RAXA 4QAYA 4JG2A 5C4JB 2JXMB 4W9JA 4LLGM 1L1OB 3GS2A 3GTJB 1KH0A 3DBHI 3S1RB 5EE9A 3P42A 4NXNL 2JE6I 3DVNV 4I6PA 3TP8A 4MGYE 1C4CA 2KOLA 3E9IA 4OWWB 4FHKA 1JJCB 3CCJA 2OOBB 3MVVA 1VQ4A 2LY7A 1EYGA 3GQBA 4C1NK 5CHFA 1FXTB 2LZ6A 4DV7Q 3NVYA 1EU4A 4DXAB 2ZJRA 3PREA 5C4XH 4DV1Q 1XO3A 4UY8C 1JT8A 1VQEA 4IN3A 3KFUA 3H09A 3ENEA 3SFEB 3AE7B 3KYDD 4OVUA 5LMUQ 2Z6KC 4DR7Q 2CS4A 2KD0A 2XBBC 3HP3A 5KYIA 2MFIA 1JE5A 3IFDA 1EWHA 1QUQA 5IYCG 1JORA 1KRHA 2MA9B 1D3ZA 3Q23A 4RKLA 2F0WA 4LF7Q 1E5WA 2O5IC 3DVNU 2CKHB 1HNWL 4JK1C 2H4OA 1I3QB 4JPBW 3S1MH 1XNQQ 4Y52H 2CWPA 1PRTC 4LMQD 4KV2A 4FF1A 5T1GA 2CU1A 2UXBL 3DWAA 3KBGA 1L7YA 4LAAA 1CTMA 4U68A 3VRBB 4ANUA 1L1OC 5FJ8G 1B9RA 3CHBD 4IC7B 1HTQA 5JJZA 3DM3A 1BUVT 1NUCA 3S1QH 1K28A 1QWYA 3HFZB 5LMNQ 2K3UA 2EYFA 4W9CA 4HIKA 4A3GG 2LMCB 4LTUA 2EJGC 4DGZA 3FMCA 1YHBA 4O1NA 1GHJA 3H3VC 4QUFA 1V43A 1IW7C 2I46A 1IZ6A 4WIPA 2R7FA 1K0SA 2J0JA 3EFUA 2N7EA 2JZPA 5HFYA 1PA6A 2VUMH 2KWUB 2K6QA 3TBIB 3GTGB 1FD7D 5K36G 1KNEA 2KJRA 3W1GA 1EUVB 5LMNW 4BKSD 4XQJA 3ZO5B 2A74C 4ZHPA 2DY8A 2L52A 4MACA 5KEEA 1YN4A 1JWBD 4MGKE 5CR3A 4E71A 1YJ9A 1DOIA 4DHJD 1QQRA 1Z9FA 2B3GA 2B63H 2L7RA 2KVZA 4TRDA 3TL5A 1WD0A 3KDFB 3CIRB 1GXDC 3CCUA 2UXDQ 3PZDA 3RZOB 2Y0SG 5J39A 1JMCA 3NBHA 3CMEA 1VQNA 1Y1VG 5CC4A 1PRTD 1TQOA 4K2LA 2GBNA 1NBWA 2K1FA 1Y1WG 3I4NG 4KKIA 2G4SA 2GRIA 4LFBQ 4XX5A 1ZP0B 1IP9A 4K8IA 5CBEE 4H7BA 4MDKE 4W9FA 4PNYA 3S2DB 2MRPA 1QT9A 2MJDA 2LGIA 3GOEA 1TWCH 1TS2A 3VYSA 1FFUA 2XVSA 1TZ1A 3DHHC 4K1RB 4A3LG 2NBUA 4F1SA 1GJZA 1UUPA 3PO3G 3HOZB 1HRJA 2EELA 4W9EA 2ZJDA 2NBVB 4WFN3 4QIWE 4KIKA 4ZOHC 4B3RQ 2RCNA 5CBAE 3CC2A 3M4YA 2PVOD 2X6LA 4F7XA 3L13A 5C1ZA 1WXMA 1ESFA 2A6ED 5FO8B 3MAQA 4JBMA 2BS4B 3HVZA 3M95A 3N30A 3ZNZB 2N9LA 3I8ZA 5I2YA 1M1KC 5HG2A 3AFQA 4CYEA 2Z9HA 2VUMG 5L83A 3CSFA 1X55A 2I5LX 2KMCA 1SE3A 2MO0A 4I7AA 4UP8A 3ERSX 4A3JH 1N62A 3VA7A 1N60A 4IZ8A 4CDFC 5DEHA 3AEDB 2C9OA 2A69D 1V97A 3HM3A 4YSXB 3V61A 4EQ5A 2OT2A 3N3KB 2RSUA 3QOJA 2N3SA 3H6MA 2UXCQ 2M2LA 2AHOB 3NP8A 3K7AB 1E0BA 5LHY1 3CCMA 2WB1E 3E3XA 1CUKA 1Q1EA 2G5DA 5C3XA 2FHTA 2M9VA 2VZAA 2Q8IB 4KZCA 2IW3A 3MFGA 1GB4A 2JSOA 3JC66 1HEZE 4URKA 1CA5A 4X62L 1V81A 4HLEA 1YNND 4KSLC 4P74A 3V05A 3U8ZA 3I2ZA 2D3AA 3DHQA 5GQOA 2R92B 1WE6A 2PIAA 4FJYA 2WV6D 4IFDH 4IKGA 4AJYB 3EFXD 3K57A 3J80L 1FNVA 2OTLA 1T5EA 2BBCA 1MJCA 2FCSA 1A5RA 1HZ6A 3AE2B 1N34Q 2BGFA 2YYZA 3QOLA 1IYJB 4M1UB 5FJ8H 3VYUA 1X32A 2OWOA 2JZZA 3Q0AA 1ZE3D 2ZTDA 3HHMA 2B8GA 4XYCA 3K5LA 1JMLA 4TV3A 2MW5A 1RCVD 5J3BA 4B3RL 1UWMA 3T16A 1O80A 5IP9H 1PGAA 1YZ6A 3OIPA 1H95A 3S15B 2V3PA 3AE1B 1OQRA 3U52E 2ZJPA 3W1SA 4RGTA 1SDFA 3DM1A 4HMIA 5KNDA 3RZOH 1DZ1A 1JQYD 1L0WA 1NY4A 1ISNA 2KEEA 3OW2A 2RR9A 1LACA 1J7BA 4A3JG 2JUOA 2KC1A 2WU2B 1ZKOA 3RZWC 4IM3A 2ENBA 1K83B 5IKCM 4OELB 1YJJA 2EY1A 3T1HQ 5EQ0A 3L16A 1CKOA 3J7YW 1N33L 1YNJC 2L0FA 3AXCA 2PQEA 2ATWA 2LVPA 1STAA 1XD3B 2PEAA 2B63B 4G7ZC 1ZEQX 5JEAH 1D6EC 1CQVA 1T9HA 4HN7A 5C3WA 3M4OB 4W9HA 4C4VB 5A2QL 3ZVVA 1WTVA 2N9XA 1AE3A 3GV3A 3WOFA 4B3TL 1AH9A 2LRWA 2N9KA 5IGFA 5J22A 1K8GA 5NUCA 3HOWB 2DHZA 3RNCC 3VYTA 3QC8B 2KT7A 3AEBB 1RODA 3I4NB 4HWIB 2KJXA 1CKMA 2F0SA 3AE4B 3K0XA 1I6HB 1Y1VB 2GBMA 2B2VC 1CMXB 2B3AA 1U4MA 1LABA 3R93A 3K80C 2KYWA 2DNEA 2EYOA 4DAYB 3CC4A 3CCSA 2WS3B 5KGUA 4JI2L 1P16A 1IL2A 5JHBA 4K0KQ 1KFYB 1I5FA 2PZUA 4RF1A 2K39A 2E5LL 3IFWB 1YD8U 3PZ8A 2BB5A 3ULPA 2NTTA 5D6JB 3ICEA 3RLOA 1LTID 2J0MA 1LM0A 1WCMB 4GOCA 3PHWB 4HROA 2JYTA 1MBYA 5E6JA 1VQ9A 1EWIA 3J80c 5D14A 3SXHA 2H1EA 1SYGA 4EGVA 3HVDA 1BVSA 4JOIC 4EZLA 4B3MQ 5I6WA 4MM3B 3RD2A 3K81C 2R61A 1SXTA 1KNAA 3AM9A 4B08A 5JH5C 2EY5A 2BW2A 4K2KA 1X3PA 1OQQA 1IXRA 2VB3X 1CZPA 2WB1B 1JWSD 4DUYL 4S3SA 1JRPA 1CHQD 3PIPA 2BDOA 5IGEA 2KDEB 3V62A 2WACA 4ARIA 3LGJA 3NXWA 2RPQA 4HJAA 3H0GB 2LUMA 5H92C 1YI2A 5AUIA 4LF5Q 1ZGUB 2MWSB 1YJWA 1UH6A 4PG3A 1XF5L 4YTNB 2PI2A 1MG4A 4GXBA 1M8AA 4HSPA 3IFTA 3RLNA 2PZTA 2WFWA 3VR6A 1E10A 3DUZA 1WGHA 4H02A 3E9HA 3RMHA 1KF6B 2WIIB 3L4PA 3A74A 3CF5A 1A62A 2CWAA 5HURA 2JA8G 3PO0A 5IP9G 1WM2A 4PS3A 4IWOA 2SEBD 3U9OA 2BB6A 1Q1OA 4QF4A 4FLHA 2K4KA 2PPHA 4FVMA 1RL2A 2D0OA 2P5ZX 4JI7L 2PJHA 2L55A 4XWTA 2Z59B 3AU4A 1S40A 4MNOA 1FYCA 3CPFA 2LGSA 2E5LQ 2EVBA 5M5YH 4G0NB 4FBJB 1WTWA 1VS0A 1PH6A 5EPKA 5I6YA
chains in the Genus database with same CATH topology
3D4WA 4HMJA 3KWVA 4IUQA 4ZRQA 1O7YA 4H2AA 5FO7B 5F2DA 3TN2A 2RA4A 1CA6A 2XSCA 1RDPD 4LK0M 4MH8A 5D65A 1R4QB 2K33A 2WXIA 3AE3B 1KLUD 3AB9A 1HQMC 1ET6A 1U4LA 1Y69U 1Z7TA 4H0LC 4P16A 4YTMB 2ZT9C 4FXDA 4IUVA 1E2ZA 1MSGA 1HTPA 3R3OA 2CU3A 3F2UA 2CHBD 4KHZA 1Q3LA 2OEOA 3AECB 4XDXA 4MIUA 5M3MB 1EY8A 4KD4A 4H44C 1LT3D 2NZ1D 4G7OC 3DWMA 4TQ1A 1VDZA 2W54A 1TS3A 4ZLTF 2SAKA 3M3YB 4MHEA 1KLGD 1OXVA 3SEBA 3FDTA 4B9XA 3RPFC 1AEXA 3ND8A 4B0EA 5K36H 1L6VA 3EQLC 5AFWA 1I4RA 5BYRA 3CRKC 1ET9A 4L6TB 1HCZA 1AP0A 1NENB 2SNSA 1GOZA 5BYSA 1EU3A 1UNSA 2F0DA 5JVH3 1DOYA 2WKCA 2K04A 1E6EB 3J9CA 1QNKA 2B2YC 2KQ3A 1C78A 1I7HA 1T6BX 4C56C 4C3JB 2ONQA 4N6EB 4HAEA 1WD1A 1AWDA 5IGCA 1J7CA 2F0QA 2H88B 1JB3A 1VZ8A 2L0CA 2K01A 4ZRZA 4C2MB 2JYEA 1JWAD 4ID6A 2AWNA 4UAIA 3KQ4A 4KJNA 4FNFA 3FC4A 2D2CC 1A3TA 1FGBD 1GPXA 4ODGA 1KAAA 3TZUA 2NB0A 2EY6A 5C2TB 2N7JA 3FILA 3MC0B 4PMWA 4EQOA 1YQ4B 2PKOA 1HTLD 1H9KA 1U4PA 1ZXIA 2JU6X 2KCCA 3GTMB 3NTIA 1F77A 2RDHA 1KDBA 4C7ZA 3NWTA 1AZQA 1H9MA 2A68C 4J8QA 1FEHA 3ETRA 4IFDJ 2PTLA 4G57A 4KD3A 1CHPD 1W6JA 1B4OA 1RTNA 2F0UA 3NUHB 2RMMA 3JAME 2WAQB 1B53A 2NBFA 1JR0D 2K5DA 2RSNA 1Q12A 3TEXA 4GZYC 2IT1A 4FO2A 3VR4A 1ENFA 4HCSA 4FF2A 3S9WA 3RFZB 3NTHA 3GO5A 1WTXA 3GV6A 4XIGS 1G8ZD 5C4ZA 1EOTA 4A3MB 4IALA 3GTOB 4A8XC 3I9V1 3W3AA 3ND9A 3PUYA 1B44D 2L5TA 5JEAG 2FBWB 1ZDVA 1EYCA 3R2TA 4KKJA 2MUYA 2K05A 1Z6HA 1WSPA 2B2VA 1N5XA 2EYPA 1BCPC 3ONAB 1SJHD 1HA6A 4CJ0B 2HDMA 5EKIA 2EE1A 2EJMA 4J3OD 1V1PA 5BMGA 1T3QA 5D3DA 4OZCA 3NSWA 2AUKA 4DA2A 3BDCA 2EY2A 1ENAA 4OO1G 1LTRD 1ZXHA 3OIQA 2WXKA 5DNFA 3SFDB 2JYOA 2L1AA 2KN4A 4YSYB 1KABA 3MXPA 4CQNA 1Z47A 1FXAA 4I65A 1EYDA 1RYJA 4WJWA 1FFVA 4RHSA 5T1IA 5ELEA 3OWFA 4JX1C 3MA2B 1J7AA 2PW5A 4KHVA 4USAA 3BDOA 5T8IA 2IX1A 4KKSA 2K28A 2JA6B 1WYGA 2F0VA 3Q69A 4L8JA 5E4XA 4KGTA 1G6ZA 4K5XA 4ZHOA 1V8QA 4B9WA 2F03A 5J1ZA 3NS1A 1PZKD 2E2HB 4A9AA 2V4DA 3PIP3 3IT6B 3J7AF 2EXZA 1UEAB 3S1QB 1I50B 2WXFA 2Y5CA 1K50A 2W3SA 3I3CA 4CJ1B 2Y5PA 5EBCA 3T3NA 2Y3AA 3D3RA 2F0HA 3AB5A 3C3LA 1MGSA 3I90A 1YNTE 3HKZB 2HCIA 2Q5WD 4K6DA 2YU9B 1IBXA 3D6WA 1HA5A 4AYBB 1TZOA 3KK7A 2WDRB 3HZXA 1JOKA 4JWSC 1K52A 1AZPA 1E9MA 3FPPA 2ICIA 1SNQA 5M5XB 1QOAA 2WXQA 2QDBA 3LNNA 1ZYRC 3A54A 4HRSA 2DN8A 1QILA 2MH7A 4IUPA 4A3IB 1JW9D 4X3TA 4I7ZC 2IPKD 5FLXE 3H91A 1LTTD 1PDQA 4XXEA 1R9TB 3OMGA 2H89B 1BCPB 3QO2A 3FEWX 1BF4A 1PRTF 4GDLB 1IBXB 1YN3A 4IURA 3M85A 1SYFA 2MGSA 1AN8A 2XN9C 3UI2A 3UI3A 2LHDA 3T4AC 3HS0C 3TSSA 5C0XH 2FJ2A 1SYDA 4XQNA 3U7ZA 2I38A 3HGBA 2BA1A 3Q24A 5C44B 4KGRA 1VLBA 1UGJA 1A6XA 5JOBA 3AMZA 1BR9A 3ZGZA 1SB3C 4HEDA 1TVXA 2NVTB 1BOSA 1LO5D 4ILWA 2IJ0A 1TR5A 3P75A 4ITKA 2WXNA 4ZRPA 2INNE 2Z4HA 4Q0FA 4K5WA 1SAPA 4C3IG 2DNCA 1QOHA 3TEZA 1Q1BA 3B2FA 4IQZA 5JPNC 4NAMA 3SR6A 4YT0B 1QJOA 5M5YB 2HTME 1STGA 3OOCA 2BE5D 2L83A 1VMPA 2GA4B 3C1FA 1EM7A 5FOBB 1ZDXA 2OEDA 5C4HA 1JOOA 4A3BB 4HKZE 1WTOA 1RTOA 4K8JA 3BYYB 1V1OA 5E1FA 5C4XB 1SYEA 2RQXA 5LNK1 1WVLA 1O78A 4FXGC 2PLPA 3TMEA 2I2YA 2B2WA 3SE0A 2HUGA 3PIO3 1P7EA 3PUZA 4FXKC 1H9JA 2QIEB 4K6LA 2FMCA 3BVMA 2KDMA 4RF0A 2NN6G 1U4RA 2OF1A 2C5CA 3QIAA 3VA5A 2IX3A 2YEPF 2A6HC 3L7ZC 4JWUC 1Q10A 2L11A 1X3QA 1SMYD 4WQMA 4EQNA 3QG1A 1PTOH 3MFYA 4ZKCB 2LHEA 3ZQ4A 4RAUC 5CMDA 5EJWA 3J81E 2WP8J 3HOVB 2A69C 1ICWA 3SHLA 5TSSA 3E56A 3Q8EA 4HKQA 3K5OA 1PRTB 3VR9B 1PTOD 3EGRA 2IGGA 1C9FA 3K59A 2F0EA 1PFDA 2J7ZA 1CJEA 2R93B 5C0XG 1GUSA 1ZUD2 2LJIA 2JQRB 2N88A 1DM0B 2LKVA 2E2DC 3BVZA 2RKSA 1EFID 2L9HA 1E0ZA 4YXDB 1VR9A 4CKEA 3LWEA 4A93B 2AWOA 2NN6H 2BS2B 4CHTB 5HGTA 2BDNA 4TKOB 1VMCA 3SR1A 3S1MB 2RVLA 1PDXA 2IGDA 2R7ZB 2Z4IA 1L0XB 2XIWA 2F4IA 4OO1I 3BZDB 4FF3A 3NE5B 4IDIA 3PUXA 2JA7B 4C3HB 1EWYC 3Q8CA 1TKGA 3NVZA 1DXMA 3I4MB 5AUKA 1TU2B 1LT4D 3RLFA 3W9CB 1F9RA 1DOMA 1F0ZA 1S5DD 1NEKB 2A5HA 1OXSC 4B0MA 5JAVA 2JA5B 5EGTA 1J9OA 1L6UA 1L4DB 4C80A 3GP7A 1RJTA 1SNCA 4ZQ3A 3ERQA 1RHPA 4BBSB 4BBRB 1YQ3B 3HRDD 1F2YA 3AU7A 3OHXC 2VXWA 2M56B 4A55A 3QWNA 2BE5C 3NZ3A 3Q6SA 3VYRA 5I9PA 2LMCA 4C7YA 1CK1A 4H13C 3BS1A 1HHVA 4WWMA 1SYBA 2MHVA 1E2WA 1TIID 1F2MA 1SE4A 2CVRA 4ZK9B 1CM9A 5I9OA 3Q8FA 4OVZA 3A56A 4DK1A 5FKAC 5JVG3 3W5UB 2PMZB 5M5WB 4KY6A 1STNA 1OXTA 2R3ZA 1J8IA 1FNUA 3PO3B 2F0IA 2N0SB 3BK2A 1BMLC 4EE2A 1GJXA 3D8GA 4AQ7A 3BVGA 3IAS1 3DXJC 4ZYSA 3VR8B 4UDUC 2FE8A 1IW7D 4TMAB 3P63A 5A2QE 2O2LD 2N55A 2WDVB 3K5MA 4NDXA 3SDZA 1C76A 4TSSA 3DMUA 5JEAJ 1F2RI 4C3HG 1TT2A 1IGDA 3CQZB 4HCEA 5EKLA 3RZDB 3AE5B 5FO9B 1I4XA 4CBVA 2D9UA 5G3LD 2WDQB 4BY7B 1MSHA 3GTKB 5IT9L 5EE1A 1XCQL 4DNTB 5KIXA 1RKNA 5CGKA 5H8YE 3ZJTA 3H8HA 1KDAA 2L12A 5IT9E 4RNAA 1L0YB 5ELCA 4QIWB 1JWMD 1JQ4A 2PNRC 4OZAA 1GUGA 3CRLC 4P6VF 1TS5A 1EY6A 3AEAB 2D62A 3V2TA 4PMBA 1B1ZA 2EYHA 5IODA 2YEPB 4DQOC 1JICA 4N59A 1G291 2LS01 2J4XA 2HQEA 2RBMA 1L4ZB 1LV9A 3G7LA 2CJOA 1EZ8A 3V3XA 3T3OA 3EVQA 3TP6A 3SK6A 1B50A 5IOCA 4L63B 1B3AA 5EE0A 5BN5A 3I70A 1QB5D 5IGBA 4WURA 2LEKA 2KA7A 1ILQA 4BA1I 1STEA 5I4DA 3T51B 4M0WA 4YWGG 2EYJA 2K6AA 1S4ZA 1GAQB 3E9SA 3EUB2 2ZW1A 2B39A 2W55A 4NMZA 1XX8A 2QILA 1DYQA 1DOXA 5BMIA 3QJYA 3IXSA 1PMRA 2F0KA 4RGMA 1CQFA 2DYOA 2A6EC 4OL7A 1GUWA 4V0BA 5CV6A 5KYLA 1VF5C 1D4BA 3IAYA 2DYMA 1B9NA 2NN6I 1JALA 5KNBA 1QOGA 1D2BA 2V0GA 4YTPB 3I72A 4RFBA 1HPCA 1EY0A 5GXGB 1F2LA 3H94A 3N9YC 3D4RA 2L32A 5E4WC 3K6OA 2M0AA 2K5WA 4KY7A 1HXYD 2G9HD 5COYA 3NVVA 3D31A 2KMMA 2OHFA 1HFGA 4PV1C 1IYUA 4N9PA 2JX5A 2KAJA 3A7AB 2X69A 2JEAI 2A6HD 1NAPA 1WGKA 5CV4A 4DAVA 2WXMA 3CWIA 2QSDA 1G2SA 3AEEB 2MEKA 2WQYB 1TKWB 4LK1C 1JC7A 1QF6A 2BTEA 1C8CA 1VZ7A 2RDGA 2J0TD 3TUOA 4KN7C 1S5CD 2BCOA 1YNNC 4R8NA 3IAM1 1I4PA 2F0TA 3LYYA 2AQ2B 4PT5A 3MXUA 4NW2A 4DXFA 4QMGA 5I2XA 2CQAA 2K32A 4OIKA 2SOBA 3HG9A 1E7PB 3E5SA 2EPBA 2F0GA 2W82A 1NSNS 3P20A 3W5VB 1RFKA 3I91A 2FMMA 1GUOA 3NK9A 3HOYB 5BN3A 2B2YA 2HCCA 3VR2A 2WKDA 4HTHA 1STBA 4DK0A 3MP9A 3O13A 3HRZC 1WWTA 1PFMA 1TY0A 2PPBC 3P1MA 2KVMA 1FMAD 4DFAA 1NCVA 1SNMA 1TWHB 3BYTB 3GTLB 1V8CA 3AEDB 4A3KB 1PZID 1EEFD 4F8MA 5FR3A 1O7ZA 1FNWA 2M00A 1H9SA 1BBXC 1SSNA 1C4QA 5D7GA 2K7VA 1BXTA 5BN4A 3L3OC 2EOTA 2XWBB 1WTRA 1K8MA 3OSOA 4U673 4F88A 3I4LA 3NRZA 4P2CB 5DM63 1P7FA 2MJ3A 4FF4A 2K9XA 3AEGB 3U9SA 4US9A 2Z8LA 4A3JB 5FK9C 5CV7A 1MHXA 4O42A 4JBWA 4JE3B 4KI0A 1IGCA 1U9RA 1GUNA 1JROA 2K1BA 2F1MA 2AQ3B 2IDYA 1CT1D 3OMCA 5DAUA 4JPSA 5BMHA 1HFNA 1TYGB 3LB8C 4BY1B 1NI3A 4MT5A 1Y8OB 4AS1A 2ZXOA 1SE2A 5ELDA 1MI2A 1HQRD 2CW0C 2HDLA 1Y8NB 2QMTA 3EJIA 1B9MA 2XRQD 4K5VA 4REZA 2KEDA 1VDVA 1TY2A 1XTCD 2F3WA 3TZDA 1ACCA 3PMFA 3KLRA 1A2TA 1VJKA 5C3JB 2BYTA 4Q5VA 2F0MA 5A35A 2Z1CA 1NR4A 3EA6A 3QB3A 2DLBA 3DWQA 1ESRA 2JSVX 3I57A 4HSVA 1Y56A 2EYMA 2J53A 2BS3B 2K5QA 3NPPA 1S5ED 5G5GA 1F9QA 2IX0A 1N63A 2A73B 3N6RA 2EKIA 2CJNA 3OPOA 3BWUD 1FXIA 1AW7A 4G4KA 4M8AA 1STHA 3WDNA 1QKZA 2ACZB 2K22A 2NVXB 5JPMC 2SNMA 2GB1A 1FCCC 1XLQA 1OXUA 1STYA 5KRUA 2TSSA 3VRAB 2AQ1B 4V190 3AV8A 4ZUIA 4DF7A 2WXLA 1IUEA 1JWUD 3PV0A 2GI9A 2NWGA 2QKIC 3LX0A 4NKLA 2E76C 2INPE 5CV9A 3X3NA 4XDDA 3SK5A 5ELFA 1DD2A 3P4SB 2E74C 3T56B 5M9OA 1ILPA 3LWUA 2VZKB 2Q8RE 3K0YA 2KACA 2E2JB 1F2RC 3N52A 2DWQA 2J42A 3U2SC 5G5HA 4YSZB 2X6GA 2B76B 2AX5A 1F9SA 1D5XC 1YNJD 1C4PA 3C2PA 1NVID 2A68D 3BG3A 3V96A 1ROEA 4PMCA 1BCPD 2B2TA 2IL8A 4K14A 1CFMA 1QNUA 3FAHA 1A15A 4DXGA 1VZ6A 1II3A 1NYQA 1TJEA 3P4QB 2B2TC 1NR2A 3VQIA 1D5ZC 2JA8B 3PUVA 1SNDA 1LTGD 2WXGA 1E2VA 2CW0D 1EY7A 5CV8A 2VUMB 4J6HA 2G1EA 1OFFA 3J80E 1RF2D 3BIID 1GB1A 2NYZD 1Y8PB 1MVKA 1IKMA 3AE8B 1W6KA 1NYRA 4XTCS 1A70A 4Y7NB 1PGXA 4ZAIA 4ZUJA 3MHBA 1C79A 4XYOA 3MZ5A 3OW7A 3MXNA 1BDOA 2PVGC 1OXXK 3A8KE 1QCBD 4MN3A 1RM6C 1PXUA 3AE9B 3KWLA 2BT6A 3J7AV 2AUJD 1L5PA 3AN1A 4KY5A 3NQIA 1PFNA 1S5BD 1C4AA 1DONA 1YJIA 1LTSD 3FPUB 2F0FA 2F0OA 1EEID 1TWFB 1ONLA 1N61A 4XT1B 5DM73 2MPMA 1QOFA 3TEYA 1GUTA 3T53B 2VB2X 2KWDA 3KBXA 1SYCA 3G6JB 1YN5A 1FRRA 1BNZA 4DNRB 1VF7A 3S1NB 1D1KA 5EPJA 4G7HC 1IKLA 1R4PB 4OGQC 1SBBB 3P1HA 1SFOB 1IHZA 2TMPA 4RHRA 3B2GA 2ZXRA 1LT5D 4XDCA 2O5JC 2RDFA 1H9SB 1DGJA 4OO1H 2WU5B 2WXRA 4X3SA 4KJOA 1N5WA 3AMUA 3M7GA 2PW9A 1DOKA 3ZJVA 5FLXL 4BA2I 4A3DB 1Y1WB 2FFKB 4C1NI 1I4GA 3AEFB 5C6AA 1ZYRD 2WXHA 4HR7B 2ZW0A 2QJLA 5K5PA 4BS9A 1SIJA 1VCIA 2EYLA 2M19A 2WXPA 4R3DA 4A3FB 3J81L 3HUIA 1K8OA 3Q8AA 4CJ2C 1A2UA 1PYWD 4RKBA 1TWGB 1AYFA 1PGBA 2B2UA 3WOEA 2KECA 2PO4A 2JP1A 2MP1A 2NVQB 1DOLA 4ABNA 4IOIE 1D5MC 2PW7A 1TWCB 1HZ5A 2O4XA 2WXOA 5HI1A 3K58A 3A8JE 4IFDI 3E0JA 1I4QA 5LL6S 1KTKA 4ULLA 1O7LA 1MHHE 1FM0D 1EWCA 2ZXPA 1MPEA 2EZVA 1IL8A 2E75C 4IUNA 1JCKB 1QG7A 5ISRA 1S5FD 2NMQA 5CORA 1FIQA 1EIHA 3S2HB 2WP9B 4GDKB 4PQXA 3FRPB 1MD2D 1TWAB 1ZPSA 4RGNA 4GLSC 3LXFA 4A90A 3PUWA 1AFPA 1EY9A 2F0PA 2NVYB 3Q22A 2MJEA 3MJ5A 3MEHA 5C5LA 2RPVA 1HUNA 4N9TA 2XNAC 4KKTA 5C0XJ 2F0LA 4L1BA 1YMHE 4LJZC 3DEPA 1BO0A 3Q8BA 1IYVA 3MXGA 4A6QA 3X3MA 4CKBA 4ARCA 2VZKD 4X3UA 2V3NA 1BUIC 2ICEC 1QE6A 3NBIA 4YIJA 1WXQA 1SNOA 1KDCA 5JXVA 3VR5A 4KGSA 2ON8A 2IWHA 3CKIB 5G3LF 5EKKA 5E3FA 2PCFB 4F87A 2QCPX 3FILB 3JAML 1LLRD 1L0VB 1XLNA 3M7NA 1PZJD 3AE6B 3GTQB 3DWPA 2JXTA 3RUZA 2DBYA 4IUUA 1R7SA 5CV5A 2SDFA 5BYQA 3PZ7A 4OHJA 5EBDA 1XWEA 3U4EG 2DY7A 2IGHA 1A3VA 4WORA 2LFNA 3IT4B 3C46A 1F9PA 1QLBB 4KTAA 4XYQA 3CU7A 1XYIA 1ZXTA 2V4IB 3VR3A 2HDEA 4RWSC 2F3VA 1LTAD 4BWGB 1DJRD 4NZLB 3SVMA 1LT6D 3FKIB 2FINB 2OXPA 4RGOS 4DAYA 4E6IA 3KLSX 1B2TA 2F0JA 4RCNA 5EPLA 4IUTA 2WINB 1TKEA 3KF8A 5EE3A 2LFIA 2G9DA 1TS4A 4ZKBB 5C0XI 3R2IA 1D1IA 4DN4M 1SEBD 2FUG1 4CKCA 4KK7A 3WCQA 2VNUD 2KCNA 1VRAB 2WLBA 4QUCA 5IIFA 1PTOB 5HHDG 1XLPA 1JE4A 1EIGA 1ENCA 1Q90A 4KN4C 3DEOA 3IL8A 2B8FA 1EY4A 3GB1A 2XWJB 4US8A 3NTKA 2EDGA 1K51A 5CYUA 3FVQA 3C1EA 4WAFA 4NJCA 2NTSA 3ITPA 1FD6A 4WRDA 1F2ZA 3TDQA 1SF0A 3NUCA 2F0NA 5M3FB 1PLFA 1PTOC 2KUMA 3P7JA 2PYKA 5C5MA 4XE0A 3SK8A 2EJFC 3S17B 2E6XA 2JWUA 3OWEB 1BQQT 3DWGC 3MTSA 1CZGA 2E3TA 1DCZA 1PUTA 2B2WC 1XEEA 1GHKA 4ME5A 4R9WA 1QOBA 1C48A 4TQ0A 4FXCA 1EL0A 1K53A 4QB4A 2RSOA 3ZJUA 4KKUA 3C8YA 1WTPA 3EROA 3ZYYX 1PFBA 1EYAA 4A3GB 1G91A 5C3EB 3S14B 2PMVA 4EQPA 1V1PB 2D5GA 1FCLA 1FO4A 3D4DA 3HEJA 4QCLA 1OO9B 1TKYA 5IGGA 1XCTL 2K5PA 2NUCA 4XWWA 4TQUS 2E2IB 1HUMA 3ABVB 1C77A 1A3UA 4RA8A 4OIJA 1XLOA 2WNMA 4N58A 4KMUC 3W2DA 2R6GA 1WTQA 1H9RA 3P4RB 3SK4A 3MWYW 1SMYC 4HEA1 3HOUB 1BCPF 4RCOA 2K03A 3URYA 4HJGE 3TEWA 1CZWA 2BA0A 4D2KA 4DU9A 1RD9D 4X3KA 1T5XD 2BOSA 4L23A 4IFDG 1PTOF 3BDLA 4OW0A 3A7LA 4C3JG 3L9AX 3GTPB 4WH4A 4OZBA 3P4PB 3E6ZX 2MJ8A 3I73A 4KX6B 3TP5A 1RWSA 3GD7A 3A55A 2QEJC 2Y0SB 1SJED 4L2YA 5ELBA 1I6VC 2KQ4X 4XT3B 1I4HA 3R8BA 3KUPA 2KHSA 3NQTA 5D3IB 3KLSA 1UWXA 3RD4A 1ZOYB 4Z9CB 1SNPA 2ID0A 3T13A 1FR3A 5MPOA 4DAPA 2D5DA 3NHHA 2JEBI 1EQVA 1Q8IA 1G2TA 3B9JA 1EZ6A 2Q8TA 3IKJA 3NVWA 2B2UC 4NAWB 1ML0D 3S16B 2J52A 5LL6X 2L4NA 1CI3M 3HOXB 1FRDA 2XRSD 1WRIA 1EY5A 4XQQA 5IGDA 2X38A 1EQTA 4KV6A 4FP5D 2I07B 3D6CA 1LTBD 3NWSA 4C3IB 1SSOA 2QF7A 4EVOA 3A8IE 4NP5A 2K0PA 4Q2JA 1MI0A 4RH6A 5KNCA 1UAPA 1M4VA 3BK1A 3AH7A 3MHZA 2W3RA 4CGYB 3TP7A 4FYDA 1JOQA 3PO2B 2L1BA 2WXJA 4J1MA 4A3EB 1XXGA 3K5NA 2PZWA 5C4JB 2JXMB 4LLGM 3GS2A 3GTJB 1KH0A 3S1RB 5EE9A 3P42A 2JE6I 3TP8A 1C4CA 2KOLA 3MVVA 2LY7A 3GQBA 4C1NK 3NVYA 1EU4A 1XO3A 4IN3A 3H09A 3SFEB 3AE7B 3HP3A 5KYIA 3IFDA 1EWHA 1JORA 1KRHA 3Q23A 4RKLA 2F0WA 2O5IC 4JK1C 2H4OA 1I3QB 1PRTC 4LMQD 4FF1A 5T1GA 3DWAA 3KBGA 4LAAA 1CTMA 4U68A 3VRBB 1B9RA 3CHBD 5JJZA 1BUVT 1NUCA 1QWYA 2K3UA 2EYFA 4LTUA 2LMCB 2EJGC 4DGZA 3FMCA 4O1NA 1GHJA 3H3VC 4QUFA 1V43A 1IW7C 2I46A 4WIPA 2JZPA 5HFYA 3TBIB 3GTGB 1FD7D 5K36G 1KNEA 4XQJA 2A74C 4ZHPA 2DY8A 2L52A 4MACA 5KEEA 1YN4A 1JWBD 5CR3A 1DOIA 1QQRA 4TRDA 1WD0A 3CIRB 1GXDC 3RZOB 5J39A 3NBHA 5CC4A 1PRTD 1TQOA 4K2LA 4KKIA 2GRIA 1ZP0B 4K8IA 5CBEE 4H7BA 4PNYA 3S2DB 1QT9A 2MJDA 2LGIA 1TS2A 3VYSA 1FFUA 2XVSA 1UUPA 3HOZB 1HRJA 2EELA 4ZOHC 4WFN3 5CBAE 3M4YA 2PVOD 2X6LA 4F7XA 1ESFA 2A6ED 5FO8B 3MAQA 2BS4B 3HVZA 2N9LA 3I8ZA 5I2YA 5HG2A 1SE3A 1N62A 3VA7A 1N60A 4IZ8A 5DEHA 2C9OA 2A69D 1V97A 4YSXB 2OT2A 3QOJA 3H6MA 2M2LA 5LHY1 3NP8A 3K7AB 1E0BA 1Q1EA 5C3XA 2FHTA 2M9VA 2Q8IB 2IW3A 3MFGA 1GB4A 2JSOA 1HEZE 1CA5A 1YNND 3V05A 3DHQA 2R92B 2PIAA 4IKGA 2WV6D 4IFDH 3EFXD 3K57A 3J80L 1FNVA 1T5EA 2BBCA 1HZ6A 3AE2B 2YYZA 3QOLA 4M1UB 3VYUA 1X32A 3Q0AA 1ZE3D 2B8GA 3K5LA 1JMLA 1RCVD 1UWMA 3T16A 1O80A 1PGAA 3OIPA 3S15B 2V3PA 3AE1B 1OQRA 3U52E 3W1SA 4RGTA 1SDFA 3DM1A 4HMIA 5KNDA 1DZ1A 1JQYD 2KEEA 1LACA 1J7BA 2WU2B 1ZKOA 2ENBA 1K83B 1YJJA 2EY1A 5EQ0A 3J7YW 1YNJC 2PQEA 1STAA 2B63B 4G7ZC 1ZEQX 5JEAH 1D6EC 1CQVA 4HN7A 5C3WA 3M4OB 5A2QL 1WTVA 3GV3A 3WOFA 2N9KA 5IGFA 5J22A 5NUCA 3HOWB 3VYTA 3AEBB 1RODA 3I4NB 2KJXA 3AE4B 2F0SA 1I6HB 1Y1VB 2B2VC 1U4MA 1LABA 3R93A 2DNEA 2EYOA 2WS3B 5KGUA 1KFYB 2PZUA 4RF1A 3PZ8A 2BB5A 2NTTA 1LTID 1WCMB 4HROA 2JYTA 1MBYA