2GRIA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2griA01
2M0AA 2IDYA 2GRIA
chains in the Genus database with same CATH superfamily
2R2OA 4TQ1A 1J19A 2HD5B 2AQ1B 4EUTA 2KT7A 2LHEA 4HJKA 3QWZB 1WGDA 2LZ6A 2E6XA 4ZRKA 2LHDA 1T3QA 2XNAC 2CU3A 2BWFA 1UH6A 2ZPYA 3PVLA 1HE8A 2KLCA 2LXCA 1C78A 3TEYA 3RZWC 3NVVA 3AM9A 3SD5A 3L08A 1TT5B 1MFWA 4HROA 3H8HA 3DHIC 4EFOA 3C0RB 4JQWC 2N9LA 3PGEA 5IO9A 1FM0D 2JWZA 1WX8A 2WX1A 3AULA 2K6DB 4FJVB 4YXDB 4IWPA 5AUKA 3NHEB 4C7ZA 1R7SA 1KF6B 4C80A 2MA9B 1FNWA 4RM9A 4XDCA 3ABVB 1TBEA 5LNK1 1AN8A 1D6EC 2QSDA 2KJ6A 2MEKA 2RMMA 4W9FA 1WXMA 2HJ1A 2XN9C 5IOIA 4MJSA 2TSSA 3APDA 4NQKE 2LUMA 1VJKA 2N7EA 3TMPB 2DZMA 2K22A 4XYCA 1EO6A 3AEFB 1OQRA 1EF1A 1NVID 1RYJA 1RAXA 4M8NA 3HM3A 4MT5A 1YJ1A 1WX9A 2KANA 5D3DA 3BK2A 2LVPA 1WF9A 5LLIA 1C77A 3U30A 3ZO5B 3KWVA 5T8IA 2RDBC 5TSSA 5AUIA 1KLGD 2W55A 4YL8A 2HDEA 3QJZA 1PGXA 3ONSA 2BYEA 2RD0A 4FJZA 2Z0EB 2DNFA 1TY0A 1LM8B 4GOCA 1GB4A 4DXGA 1V5OA 4ANXA 1TGZB 2L05A 3QX1A 3ZDTA 2PVGC 1J7BA 1Y8RC 3BWUD 4N58A 4EZJA 2ACZB 1KFYB 4CO7A 4US8A 4A20A 1YD8U 2J42A 4W9IA 2V3NA 4HRSA 2G4SA 3PV1A 3RNAC 1BT0A 3P4QB 1P1AA 2K8HA 3JW0X 3AE4B 1V80A 2WXGA 4B6WA 2NBVB 2RR9A 4WAAA 3EFCA 4URKA 3BZDB 1E0ZA 1CZPA 4LNOA 5IKCM 3BYTB 4I6LB 2Z59B 2QJLA 3M3JA 1GJZA 3UINB 1OQQA 3RNCC 4A9AA 2D10A 1PQSA 3H7PA 4J3OD 1WY8A 2LI5A 2WDQB 1UWMA 5H92C 1WSPA 1V6EA 3VUYA 3W1YA 1VRAB 3MC0B 2FNJB 2V3PA 1FCLA 3OAWA 2J0JA 2NBUA 2UYZB 3U7ZA 4RF1A 1TIFA 1CJEA 1R4MB 2R61A 2FIDA 1HA5A 1XLPA 1YQ4B 4KZCA 1NDDA 1VCBA 3LB8C 2ONQA 4P1BC 1V97A 2WXNA 2GMIC 4RGNA 3DBLI 3A4SC 4RFBA 5IP4D 4JWUC 2CU1A 4PS7A 3IVFA 1FXTB 2L1AA 3IT6B 3ZJUA 1L4ZB 2BTEA 2OJRA 4WJPA 1I4RA 4O1NA 5DPSA 3DVGX 4YTPB 1E8WA 1GPXA 4EOYA 1I42A 1HQRD 2KMCA 1I4QA 5GMVA 2CHXA 2X8XX 3MFGA 1L6UA 2KDMA 1G6JA 1ZUD2 1AYFA 4Q2JA 4C4VA 3PSEB 1MHXA 5JHBA 4CYEA 2KDBA 3UQAA 3V6CB 3RNFC 1TTNA 1F77A 1MJDA 3P4PB 2IO0B 2QHOA 2QCZA 4MGZE 3T8MA 3EHVA 4N9F4 2YEPF 3TIXA 1ROEA 2DAJA 1JALA 3WAPA 4N6EB 1QF6A 1WJNA 1IUEA 2BYFA 2O6VB 1EWYC 1RFAA 1FEHA 4L1BA 1I4PA 5EDSA 2VH2A 1V1OA 4A55A 3NZUA 4JGHB 2KZRA 2MP2B 1E6EB 1SE2A 1Q0WB 1QT9A 2K8BA 3CIRB 4USAA 3B2FA 3VH4B 1M94A 4IM0A 4G3XB 1F1HA 2GLSA 1JWAD 1BUIC 1MVKA 2H89B 2N9KA 3A9KA 1IP9A 5JHAA 2W82A 4HJGE 3VDZA 4RGTA 1C3TA 1ZDVA 2BS3B 2D3BA 4A8XC 3ZKJC 2YEPB 2N1WA 3AE2B 2L00B 4NAWB 1FNUA 1D5ZC 4P6VF 5IAAC 4KGTA 3AN1A 2KMAA 4ANVA 4II3B 1SEBD 4NJ7A 2DAFA 1MG4A 1PFDA 2AYOB 3JSVA 1PYWD 4MM3B 1EUVB 4LJOB 2WGSA 1NBFC 3ZXRA 1TS3A 4WQOB 4FJYA 3L13A 1GUAB 1WYWB 2KVRA 1C4AA 1JMLA 4AJWA 4OHJA 2I38A 1WMHB 1TKEA 4IWOA 4US9A 3OJ3A 2JWUA 4FN2A 3DBHB 2JQRB 3AEDB 2LMCA 2N9EB 2Q5WD 2SAKA 2MRPA 3RD2A 3L10B 1FPYA 2PJHA 4HDQA 4K3CA 2IBIB 2PLPA 2V1YA 5FK9C 3FILA 1E8YA 2CJNA 3DQVA 3B0AA 1B9RA 1P7FA 2MW5A 1WI0A 2DZJA 2AL3A 3RMKC 1JWSD 3L0WB 1XQQA 1C9FA 1V86A 3IBEA 1SF0A 2G9HD 5H8YE 2ZW0A 2WXFA 1LO5D 3TL5A 4DHJB 2INDC 2JT4B 3PRMB 2QMTA 1FFVA 2BT6A 4WQMA 1D3ZA 4RCOA 1VZ8A 2PVOD 2WXRA 2V4IB 4H2AA 4HVBA 2WXHA 4LK0M 2BYTA 2GI9A 1D4BA 5EE3A 2DENB 2JXTA 2PE6B 2LVQA 2UWQA 2DLBA 4WJQA 2FCSA 4KV2A 3AE3B 2KQ7A 4FULA 4KIKB 3P4RB 4PT5A 3Q8AA 3UIOB 5CX3A 1J7CA 2KFKB 2IO1B 4HPLB 3UIPB 1YN5A 3Q3JA 3FC4A 3ML9A 5E6NA 5E6PA 1ZW7A 1FMAD 4ZRJA 1NI2A 3Q14C 3PZDA 5LXHA 2C7HA 3UQBA 3IAM1 5BYQA 2DYOA 1GG3A 1WGYA 2V3SA 3KQ4A 3Q3FA 1KTKA 3TEXA 1ACCA 1PUTA 4XC2A 1WGGA 3I57A 4NAMA 4KGSA 1WGHA 2N7DA 1S1QB 3RN9C 3OG5A 4DXFA 2L76A 2QDFA 2KK8A 4MACA 4LNFA 3V61A 2WS3B 2NMQA 2WXKA 3ZLZA 1V1PB 4AUQC 2ZVNA 3ZJVA 4D2KA 2V0GA 4JX1C 4L23A 2A4ZA 4ARIA 2VZKD 1FRRA 1KLUD 2Y5CA 2KTRA 3A4RA 1BXTA 1E90A 1L0YB 4PS8A 3WIMA 3EGRA 1MHHE 2LGXA 1V8CA 4ZRIA 3E9SA 4TQ0A 4JL9A 4G50A 3A9JB 3I5JC 4RGMA 1TS5A 3DHHC 1P3QU 3UF8A 1YQ3B 3FAHA 3KUZA 4AJYB 2K8CA 2IO2B 2IJ0A 1QZEA 2WXMA 5BO4B 2V9HA 4MH0E 1HXYD 2N7JA 4OVVA 3PRZA 2GBKA 1VZ7A 2K3UA 1WWTA 3VQIA 1HZ6A 4W9EA 1ZP0B 2V4LA 2KQSA 3VR8B 3PLVA 5E6JA 2HTME 1K8RB 4IM3A 1WM2A 2EKEC 4PK1A 3RI7C 4ZHPA 3SFDB 1XXGA 2ON8A 3U8ZA 4G0NB 4ZYSA 1A70A 5AEKB 1RLFA 2G3QB 1OEYA 4XWWA 1NYRA 4I6PA 4XZ4A 3QA8A 1FFUA 3M95A 1SSNA 1FXIA 2EMTA 2BB6A 1OFFA 1LGRA 3VFKA 2LJIA 1AW7A 4ANWA 2Y5BB 4CQNA 3ZNZB 1VLBA 2LWPA 4GB9A 1E5WA 2J0MA 2O2VB 2M4NA 3DBLB 4ICVA 3ZNID 1L4DB 4BBNC 2NCNA 3MP9A 1WXSA 2PKOA 4EKUA 1QOGA 4A90A 5C1ZA 1WJUA 1Z5SB 2EMSA 1K51A 4OW0A 1RWSA 1J0GA 3A1QA 1SJED 3A33B 2CHZA 1QKZA 4X57B 3N32A 4WH4A 3EC8A 3U4EG 1L5PA 2NBWB 1N5WA 2ZJDA 3NZ3A 4GDLA 3X0WA 2L7RA 3V3XA 4TSSA 2JRIB 4W9HA 2FAZA 1P7EA 2M17A 2M19A 2IGDA 3OJ4B 4J6IA 2MJ3A 1SJHD 4W9KA 1Q1OA 3AV8A 4HKZE 4M0WB 1L2NA 5JXVA 1I4HA 3AE5B 4MEMA 2JYTA 1HTOA 5CHFA 4RH6A 3EECA 3VUWA 4IC7B 3KUDB 2NPTA 4B0MA 2X38A 4F8CB 3JVZX 5G55A 1WR1A 2MSED 3H7SA 3T3OA 2KO3A 1K53A 3AEAB 2DYMA 2LGSA 2OHFA 1UBIA 1TJEA 4GIVA 1Q10A 4MDKE 1NI3A 2JPHA 2FCQA 4C00A 3W9CB 5HKHA 1L6VA 1GAQB 3VAWA 1YMHE 1T0QC 5TR5A 4DHZB 4ARCA 1WM3A 1ZGUB 2GBMA 1EF5A 2WHIA 5BYRA 4OZBA 1PGAA 4ZOHC 1QLBB 4HEA1 3TBLD 4GN1A 3M62B 3CSFA 2RPQA 1PDXA 2KQ4X 4FA6A 2DHZA 4HPMB 5FR3A 2NTSA 1TZ1A 4A6QA 1ET6A 3B2GA 1V5TA 2N1VA 2FIFA 3RPFC 4WIPA 3QQ8B 2JX5A 3URYA 4GU2A 2JXXA 4K1RB 1UGJA 1TKGA 4QAYA 2BF8B 4GDKA 2ZVOA 2L0FA 3SDLC 2LEKA 1WXQA 4B0EA 4W9LA 5C23A 4LDTD 1MG8A 1WRIA 1Q5WB 3PO0A 4WAFA 2JF5A 3C19A 1IBXB 2PE9A 3ZIMA 2KN4A 4OZCA 2LJ5A 1MPEA 2CR5A 3PS6A 2JRHA 2KDFB 3I63C 1IYFA 1E7PB 1V49A 1XEEA 3LJ3A 3WAOA 1XLOA 1WH3A 1RRBA 1I7HA 4FHJA 2G4DB 2JUOA 3HHMA 3BVZA 3CSTA 4M8MA 4NJ6A 1UUPA 2KMMA 3AMZA 1JRPA 4HCPB 2L52A 2WX0A 2ZNVB 2XK5A 4C7YA 2KVZA 1JWUD 2CJOA 4B9KA 1KM7A 2BVCA 1WXAA 3ENEA 3DOWA 3PT2B 2Z8LA 1EM7A 2WXQA 2R2QA 2MBHA 1C1YB 4EZLA 4EEWA 4II2B 3FKYA 4W9JA 2MBQA 2HTHA 2KXJA 2GBJA 1ZOYB 3Q8EA 1WX7A 3AEEB 4ASWC 3I3TB 2DBYA 2BQQA 3ZRCA 4PS3A 2JZ3B 4MSQB 3IG3A 1ZPSA 2NS5A 2LRWA 3DVNV 3PLUA 4FADA 3AEGB 4XDDA 3TSSA 2ZZPB 3QK0A 1IGDA 4B95A 1VD2A 1XLQA 4ICUA 2WNMA 2K1FA 3PHXB 4W9DA 2IZVB 3MTNB 3H6NA 1FO4A 1AWDA 1P98A 4WWNA 3MHSD 4LCDE 2N0SB 2XEWA 3PTFC 2W3SA 2LD9A 3VRAB 5CHWA 1FCCC 4JE3B 4AP4C 4KDIC 1ZDXA 4KKJA 2J0KA 2MBEA 2KJRA 3BINA 3UGBB 1ESFA 3BY4B 2C7MB 4A3OA 3ZTDA 4IWQA 3DWMA 4W9GA 1F52A 1WIAA 4KZ0A 1QILA 2BB5A 3T3NA 3VH3B 5I4DA 2C5LC 4C56C 4ITKA 4XGAB 2CS4A 2IY0B 5J18A 4IM2A 3NG0A 2PIAA 3AE1B 2OEDA 2WXPA 3VTWA 4KKIA 3W1SA 2VZKB 1A5RA 1R4NI 2EELA 4A3PA 2FCMA 4HXDA 4GLSC 1DGJA 4OVZA 1GC7A 2WXOA 4MJSB 5E6OA 1X1MA 1GB1A 4MGIE 3WALA 4P16A 3ZQ4A 2K39A 3VHTC 1I35A 1RM6C 2KTFA 2Z0DB 5BMGA 4DHZE 3B1LX 1UWXA 2K6QA 2FCNA 4JWSC 3APCA 1EWCA 2AWTA 3B08A 4TUUA 1C4CA 2G1EA 2M56B 1T6BX 4K81A 4YTMB 2HE7A 3RFZB 5MPOA 3QIJA 1SGHA 2JVCA 2M1MA 3R66C 1ENFA 2WXLA 1LXDA 3Q3OC 2BKRB 2KWUB 1L7YA 3V60A 2KKCA 3ZDMC 1YJIA 3U7DA 1KRHA 3ZXVA 4TV3A 2CKHB 4FHKA 4G11A 2IGGA 2WU2B 4BKSA 3IAS1 2AX5A 1WZ0A 3AB5A 3MHZA 2A5UA 1TY2A 4FBJB 2KX0A 1K50A 4FXCA 4R3DA 4XWTA 1T0RC 4ACFA 3R7RA 3SEBA 3GB1A 4BKTA 3SHQA 3WA0A 5LXIB 5EE0A 4JPSA 5DPRA 5J17A 4YSXB 5BMHA 3HRDD 1IGCA 4AS1A 4W9CA 5G5GA 2N4FA 2C7NB 3NRZA 2RPVA 3U52E 1KJTA 2ASQA 3APFA 1CMXB 1F2RI 1F2RC 2VH1A 1VR9A 3HK0A 5D6JB 2FUG1 4GXBA 3ALBA 3HUIA 3ZGZA 3H7PB 4OVUA 2KFJA 2AQ2B 5KHOA 4GMVA 4K7UA 4AQ7A 2IGHA 1SE3A 2MX2A 3RUIB 2N9PC 2KD0A 1GC6A 2LXAA 2KHWB 4HWIB 3ZW3A 2WXIA 2RGFA 1JW9D 3LDZE 2MLBA 3IHPC 3AEBB 4YTNB 2YLMA 1YIWA 1TZOA 4KX6B 4HK2A 1ZKHA 1XF5L 1XCQL 3R2IA 1SIFA 4LLGM 1N63A 3VVWB 3NVWA 3QAQA 4NZLB 2B76B 1NENB 1H8CA 1F9JA 2MHJA 2KC2A 3VTVA 2INNE 1YN3A 1UNSA 3VXWA 3DPDA 3TJPA 3NUHB 2KDEB 2L3ZA 1SE9A 3AXCA 2O6VA 3ETRA 4YSYB 4KVGB 1U4AA 3W2DA 3TEWA 1UF0A 3OWEB 3KLSX 4EZKA 2FBWB 2MBOA 4WURA 3H1UA 4C4VB 2MP2A 5AZGA 1ZXHA 2INCC 4NJCA 3LYYA 2KOXA 1UGMA 1N62A 3RULA 1N61A 3ZNGC 5HI1A 4IDIA 3Q69A 3ZRFA 3KYDD 2AEHA 1Y56A 3L4PA 1XLNA 2J4XA 2EKIA 3L17A 2MJEA 1SB3C 2GRIA 1OEYJ 1E10A 4XE0A 1FRDA 3CWIA 3V6EB 1F0ZA 4MGKE 1E8XA 2KLGA 4NQLB 2DZKA 1M4VA 2K9XA 1E9MA 1FIQA 4HCNB 2OJWA 4L2YA 4K7WA 4WWMA 1E8ZA 3BK1A 3O65B 1WJ6A 4NAWA 4E71A 1YQBA 2LUEA 1L0VB 4DQOC 2ZW1A 3GE8C 2IPKD 4M00A 3VUXA 2JZPA 2REXA 5JH5C 5L83A 3A9KB 2KAJA 4MM3A 4WJNA 2IY1B 4IG7B 2JY6A 3AI5A 3WAMA 3N1XC 4LDTB 4RGOS 3Q3MC 4HDOA 5HFYA 4IUMB 3X23A 3GE3C 4ANUA 1J8CA 3N20C 3N3KB 4DDID 2PW9A 1WMHA 3Q8FA 1WXVA 1UELA 1UZXB 1MI0A 1V2YA 5KHQA 3CF6E 1KLVA 3DHGC 5D94A 5D7GA 4TKNA 1STEA 2KACA 2W9NA 3DBRI 2UU7A 3JSVB 3ZNHB 1YJJA 4N59A 2IYDB 2QC8A 1SE4A 2GB1A 2J53A 3ML8A 1WE6A 4PYUA 2J7QB 1E7UA 4LTUA 3EUB2 3OLMD 1TYGB 2JSVX 1DOYA 3Q8CA 1B1ZA 2KYWA 3RCZA 2D3AA 2WWZA 4LNIA 3VRBB 1HEZE 2M8SA 4NNJB 1JQ4A 3D32A 2I1KA 1JROA 4YWGG 3HVZA 2LRUA 2KC1A 1UBQA 4KIKA 3H9DA 3NOBA 5CHVC 3FILB 2IO3B 2K0PA 3SFEB 2KFKA 1CK1A 3AE8B 3QC8B 1SIJA 3GOEA 3GZNI 4IOIE 5FKAC 3PREA 1ZE3D 2KNBA 1P9DU 3CMMB 2INPE 4MGYE 3NZSA 4GGQA 3KVFB 4ZRQA 2BBCA 1K52A 3TUOA 3B9JA 3JYUA 4DDGD 2KN5A 1YNTE 4F1SA 3P42A 3DDCB 2C60A 3NY5A 5GXGB 3ZVVA 3MC8A 1UD7A 1CQVA 3Q6BA 2J52A 4NY0A 2ZPNA 4M02A 3PZ7A 4CHKA 1XCTL 1BMLC 3L54A 1R4NB 1D5MC 1V1PA 2NR2A 1H4RA 2WQYB 1IPGA 4IW0A 3AU5A 4ZDVA 3DVNU 2AQ3B 1VZ6A 4MSMB 3DBSA 5HHDG 4WJOA 3DWGC 2K5PA 4DXAB 1VDVA 4KSLC 2FUHB 2WDRB 3A9JA 2MH7A 4BKGA 5C3JB 3P63A 2ZEQA 1T0SC 5C2TB 3GS2A 3AE7B 5AZFA 2NTTA 3C8YA 4P1CC 2G45B 1JWBD 2KWCA 2RDHA 2KWDA 2MJDA 4E74A 2LGIA 4YT0B 4REZA 2PTLA 2GBNA 2KTRB 2L83A 4BFRA 3T9LA 2OOBB 4HKQA 3SU8X 3HIZA 1QOFA 5CTRC 2JU6X 1V81A 3SR6A 3RT3B 1I4XA 3NVZA 5D3IB 3TEZA 1GOZA 5HG2A 3W5UB 1N6ZA 3PPAA 4WWOA 3NVYA 1XT9B 2AL6A 3TCAA 2RDGA 3UI3A 1ISNA 5AZHA 2WDTB 2N9XA 2W54A 4K7SA 3RYTA 3W1SC 3WCQA 1P0RA 1ZXIA 1N5XA 1JRUA 1XO3A 2DX5B 2WLBA 4AOFA 4DWFA 2I1JA 3N1YC 3AU4A 3ECIA 1DYQA 1JWMD 1NEKB 3PHWB 2O2VA 4AWJA 1YN4A 1YX5B 4DK5A 4GSWA 3S2AA 2D07B 4JIOU 1SBBB 3Q8BA 5EE1A 3V05A 2ZCCA 5J2RA 4BKSD 1QOAA 1QOBA 4LJPB 2KJHB 2BW2A 1WRDB 1T0YA 1YOVB 3RNGC 2BGFA 1V9JA 2D2QA 3RNEC 5DCNA 1DOIA 4KDLB 3O13A 3K9OB 3IXSA 4ZYNA 2BPSA 2IDYA 4IKGA 1OGWA 4RF0A 2BYVE 1LFDA 3N1ZC 2M0AA 4UDUC 2LFIA 4P7IA 2E3TA 4S17A 2JYEA 4ZHOA 4JLCA 4BAXA 4LNKA 4EE2A 5JZEB 2LASA 2PEAA 2BS2B 4XX5A 3N30A 2RSUA 3BVMA 3QCAA 4M0WA 4LNNA 2I2YA 4BBNF 1C79A 3Q3NC 4OZAA 4MH8A 4HLEA 4NPNA 3A1QB 3PZ8A 3QHTA 4ZRPA 3L16A 1XD3B 1R4MI 1Z2MA 1GNUA 2CHWA 2ZCBA 2D3CA 4GDLB 2D3GA 3HM6X 1N60A 2PMVA 2FE8A 1WR6E 1HTQA 1FNVA 4TMAB 2YVCA 2Y5PA 4S0RA 2M0XA 4KSKC 3EA6A 3PRPB 1RFKA 3EFUA 4YSZB 1WFYA 1AARA 1NYQA 1JCKB 3IT4B 3HVDA 3RNBC 2BKFA 1I4GA 2C9WB 5G5HA 4RMAA 4MELA 3AE9B 2NPTB 4KGRA 2O6VD 4I6NB 3N9YC 3I9V1 2K25A 2QEJC 1C76A 1TKYA 1DOXA 2MCNB 2DYBA 3R8BA 1E7VA 1C4PA 2L32A 5DPWA 2ZNVC 2ICIA 3K9PB 2D5GA 1EU4A 3ZUNA 2DWQA 4M01A 3LXFA 3M63B 1FXAA 2NVUI 1L0XB 3DVGY 5IA7A 2L0TA 3MC9A 1OQYA 3R3MA 2WP9B 3KWLA 5EE9A 2D11A 2HJ8A 3KUCB 2LGDA 5L95C 4BOSC 1TS2A 1YX6B 4K3BA 1KH0A 2XBBC 1SXTA 2SEBD 4BVUC 3GP7A 3E56A 3DCGA 1WGRA 1IBXA 2QIEB 2B3AA 3P2BA 5G2NA 3R2TA 2WDVB 3BYYB 3NJTA 4PYZA 4DBGA 3MJWA 2PPHA 2Y3AA 3BIID 3DBRB 4E3CA 2BWES 1WYGA 2LGYA 3P1MA 1QQRA 2GBRA 3AECB 2KDIA 3W5VB 3MJ5A 1HZ5A 4GDKB 5BYSA 2MBBB 1WGKA 1T5XD 3AH7A 3NS1A 3RZFA 3IFWB 2DZIA 5DPTA 3Q2AC 1LQBA 3BVGA 2BS4B 4RNAA 1FD6A 2JZZA 3KYCD 1ET9A 2H88B 4HPPA 3KH0A 5FR6A 2KWVB 2WU5B 2MQJA 2QILA 4BOZB 4F7ZA 4FLHA 4WWPA 3KW5B 1D5XC 3ZTCA 1TS4A 3AE6B 3VTUA 3NS8A 3QARA 1WZ3A 4RM8A 1WE7A 3GZNB 2MWSB 3ZJTA 1OTRB 2L8JA 4BZAA 2LVOA 2KX3A 3U2SC 2WXJA 5BMIA 3J9CA 1EU3A 3ZYYX 2WYQA 1J7AA 2XK5B 2VRRB 2W3RA 3R7QA 3WANA 1WJ4A 2GOWA 3P4SB 5D2MB 5IN7A 4DHJD 1KOTA 3V62A 1PGBA 3DBHI 1S3SG 3VR9B
chains in the Genus database with same CATH topology
1ZPSA 4RCOA 4TQ1A 1VZ8A 1CK1A 2PVOD 2WXRA 2V4IB 3AE8B 4H2AA 1SIJA 2WXHA 4LK0M 2BYTA 2AQ1B 2GI9A 1D4BA 4IOIE 3AEGB 4XDDA 5FKAC 2LHEA 5EE3A 3TSSA 2JXTA 2DLBA 1IGDA 1ZE3D 3AE3B 1XLQA 2E6XA 2WNMA 2LHDA 2INPE 3P4RB 1T3QA 4PT5A 4ZRQA 2XNAC 2BBCA 1K52A 2CU3A 3Q8AA 1J7CA 1FO4A 3TUOA 1AWDA 1YN5A 3B9JA 1YNTE 3FC4A 3P42A 2N0SB 1C78A 3TEYA 5GXGB 2W3SA 3NVVA 3AM9A 1FMAD 1CQVA 3VRAB 2J52A 1FCCC 4JE3B 3PZ7A 4HROA 3H8HA 1XCTL 3IAM1 2N9LA 5BYQA 2DYOA 1FM0D 1ZDXA 4KKJA 1BMLC 3KQ4A 1D5MC 1V1PA 1KTKA 3TEXA 1ACCA 4YXDB 1PUTA 5AUKA 4C7ZA 1R7SA 1KF6B 2WQYB 4C80A 1FNWA 3I57A 4XDCA 1ESFA 4KGSA 4NAMA 3ABVB 2AQ3B 1VZ6A 4DXFA 5LNK1 3DWMA 5HHDG 1AN8A 1D6EC 2QSDA 2MEKA 4MACA 1QILA 2RMMA 2WS3B 2BB5A 3T3NA 2NMQA 2WXKA 3DWGC 2K5PA 5I4DA 1VDVA 1V1PB 3ZJVA 2XN9C 4C56C 4ITKA 2TSSA 2WDRB 4D2KA 4JX1C 4L23A 2V0GA 2MH7A 4ARIA 2LUMA 1VJKA 2VZKD 1FRRA 3P63A 5C3JB 2PIAA 1KLUD 2Y5CA 3AE1B 2OEDA 2WXPA 5C2TB 3GS2A 3AE7B 2K22A 4KKIA 2VZKB 3W1SA 1BXTA 2NTTA 3C8YA 3AEFB 1OQRA 1L0YB 2EELA 1NVID 1JWBD 1RYJA 2RDHA 2KWDA 3EGRA 1MHHE 4GLSC 1V8CA 1DGJA 2MJDA 3E9SA 4MT5A 4OVZA 4TQ0A 2WXOA 2LGIA 4YT0B 4REZA 2PTLA 5D3DA 3BK2A 1GB1A 4RGMA 1TS5A 1C77A 2L83A 3KWVA 5T8IA 4P16A 5TSSA 3ZQ4A 4HKQA 5AUIA 1YQ3B 1QOFA 3FAHA 1KLGD 1RM6C 5BMGA 2W55A 2IJ0A 2HDEA 2JU6X 2WXMA 1UWXA 3SR6A 1PGXA 4JWSC 1HXYD 1I4XA 3NVZA 5D3IB 2N7JA 3TEZA 1GOZA 1VZ7A 1TY0A 2K3UA 5HG2A 1WWTA 3W5UB 1EWCA 3VQIA 1GB4A 1HZ6A 4DXGA 3NVYA 1C4CA 2G1EA 2M56B 1T6BX 1ZP0B 2RDGA 3VR8B 4YTMB 2PVGC 1J7BA 5MPOA 3RFZB 3BWUD 5E6JA 1ENFA 2HTME 4N58A 2WXLA 3UI3A 2ACZB 1KFYB 2W54A 4US8A 4ZHPA 2J42A 2V3NA 4HRSA 3SFDB 1XXGA 2ON8A 3WCQA 1YJIA 1KRHA 1ZXIA 4ZYSA 1N5XA 1XO3A 2WLBA 1A70A 2IGGA 3P4QB 2WU2B 3IAS1 2AX5A 3AB5A 3AE4B 3MHZA 4XWWA 1TY2A 1DYQA 1JWMD 1NEKB 1NYRA 2WXGA 1K50A 4FXCA 4R3DA 4XWTA 1YN4A 3SEBA 3BZDB 1FFUA 3GB1A 1CZPA 1SSNA 1FXIA 1SBBB 2BB6A 1OFFA 3Q8BA 1E0ZA 2LJIA 5EE1A 1AW7A 3V05A 4CQNA 1QOAA 1VLBA 1QOBA 5EE0A 4JPSA 3BYTB 4YSXB 2QJLA 5BMHA 2BW2A 3HRDD 1OQQA 1IGCA 4A9AA 4AS1A 5G5GA 4J3OD 2WDQB 1UWMA 5H92C 1DOIA 1WSPA 3NRZA 1L4DB 2RPVA 3U52E 3O13A 3IXSA 3MP9A 2IDYA 4IKGA 1VRAB 2PKOA 1F2RI 1F2RC 3MC0B 1VR9A 2V3PA 1FCLA 1QOGA 4RF0A 4A90A 2FUG1 3U7ZA 2M0AA 4UDUC 2LFIA 2E3TA 4RF1A 3HUIA 3ZGZA 1CJEA 2R61A 1K51A 4OW0A 1RWSA 1HA5A 2JYEA 1XLPA 1YQ4B 4ZHOA 2AQ2B 4EE2A 3LB8C 1SJED 2ONQA 4AQ7A 2IGHA 1V97A 2WXNA 1SE3A 1QKZA 4RGNA 2BS2B 4WH4A 4RFBA 3U4EG 1L5PA 2WXIA 4M0WA 3BVMA 4JWUC 1N5WA 1JW9D 3NZ3A 2I2YA 4WQMA 1C79A 3AEBB 2L1AA 4YTNB 3V3XA 4TSSA 4OZAA 4MH8A 3IT6B 3ZJUA 1L4ZB 2BTEA 1TZOA 3PZ8A 4ZRPA 1P7EA 2M19A 1I4RA 2IGDA 4KX6B 2MJ3A 4O1NA 1XF5L 1XCQL 1SJHD 3R2IA 4LLGM 3AV8A 1N63A 4YTPB 4HKZE 3NVWA 4NZLB 1GPXA 2B76B 4GDLB 1NENB 5JXVA 1I4HA 1HQRD 1I4QA 3AE5B 1N60A 2JYTA 3MFGA 2PMVA 4RH6A 2FE8A 1L6UA 2KDMA 1FNVA 4TMAB 1ZUD2 1AYFA 2INNE 2Y5PA 4Q2JA 1YN3A 1UNSA 1MHXA 3NUHB 4B0MA 2X38A 3EA6A 3ETRA 1RFKA 3T3OA 1F77A 4YSYB 3P4PB 4YSZB 1K53A 3AEAB 3W2DA 1NYQA 3TEWA 2DYMA 2OHFA 1JCKB 3IT4B 3HVDA 3OWEB 3KLSX 1I4GA 2FBWB 2YEPF 1ROEA 4WURA 5G5HA 1TJEA 3AE9B 4KGRA 1ZXHA 1Q10A 1JALA 4NJCA 4N6EB 1QF6A 1NI3A 3N9YC 3LYYA 1IUEA 3I9V1 1N62A 3W9CB 1EWYC 2QEJC 1C76A 1TKYA 1DOXA 1FEHA 1N61A 4L1BA 1I4PA 3R8BA 1C4PA 1L6VA 2L32A 5HI1A 4IDIA 1GAQB 3Q69A 1YMHE 2ICIA 1V1OA 1Y56A 1EU4A 2D5GA 4A55A 4ARCA 3L4PA 1XLNA 2DWQA 2J4XA 3LXFA 1E6EB 2EKIA 1SE2A 1FXAA 2MJEA 3CIRB 1QT9A 1SB3C 2GRIA 5BYRA 1L0XB 4OZBA 1PGAA 4ZOHC 1E10A 4XE0A 1FRDA 4USAA 3CWIA 3B2FA 1F0ZA 1QLBB 4HEA1 1M4VA 1JWAD 1PDXA 2KQ4X 1BUIC 2WP9B 3KWLA 2K9XA 1E9MA 1FIQA 5EE9A 1MVKA 5FR3A 2H89B 2NTSA 2N9KA 4A6QA 4L2YA 2W82A 1ET6A 3B2GA 4WWMA 1TS2A 3BK1A 3RPFC 1KH0A 1SXTA 2SEBD 1L0VB 4HJGE 3GP7A 4WIPA 3E56A 4DQOC 2JX5A 2ZW1A 3URYA 4RGTA 1IBXA 2QIEB 1ZDVA 2BS3B 1UGJA 2IPKD 1TKGA 4A8XC 3R2TA 2YEPB 2JZPA 2WDVB 2LEKA 1WXQA 3BYYB 4B0EA 3AE2B 2KAJA 2Y3AA 3BIID 4NAWB 1FNUA 1WYGA 3P1MA 1D5ZC 4P6VF 4KGTA 1WRIA 3AN1A 1QQRA 4RGOS 3AECB 3PO0A 4WAFA 5HFYA 1SEBD 1IBXB 3W5VB 3MJ5A 1HZ5A 1PFDA 4GDKB 5BYSA 2KN4A 4OZCA 2PW9A 3Q8FA 1PYWD 1WGKA 4MM3B 1T5XD 3AH7A 1MPEA 3NS1A 1TS3A 1MI0A 3BVGA 2BS4B 1E7PB 4RNAA 1C4AA 1JMLA 1XEEA 1FD6A 5D7GA 1ET9A 2H88B 1STEA 1XLOA 2KACA 1I7HA 4OHJA 2I38A 2BT6A 3BVZA 1YJJA 4N59A 1UUPA 1TKEA 2WU5B 2KMMA 3AMZA 1SE4A 1JRPA 2GB1A 2J53A 2JWUA 2QILA 4US9A 2L52A 2JQRB 4C7YA 1D5XC 4LTUA 3AEDB 1JWUD 2CJOA 2LMCA 2Q5WD 1TS4A 1TYGB 3AE6B 3EUB2 2SAKA 2JSVX 1DOYA 3Q8CA 2Z8LA 1B1ZA 1EM7A 2WXQA 2PLPA 5FK9C 3ZJTA 3FILA 2CJNA 3VRBB 3U2SC 1B9RA 1HEZE 1P7FA 2WXJA 5BMIA 1ZOYB 1EU3A 3J9CA 3ZYYX 3Q8EA 1JQ4A 1J7AA 2W3RA 3AEEB 1JWSD 1C9FA 1JROA 3P4SB 4YWGG 3HVZA 1SF0A 2G9HD 2DBYA 5H8YE 1PGBA 2WXFA 2ZW0A 1LO5D 2QMTA 1FFVA 3FILB 2K0PA 3SFEB 3VR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0A A;  2IDY A;  2GRI A; 
#chains in the Genus database with same CATH topology
 2R2O A;  4TQ1 A;  1J19 A;  2HD5 B;  2AQ1 B;  4EUT A;  2KT7 A;  2LHE A;  4HJK A;  3QWZ B;  1WGD A;  2LZ6 A;  2E6X A;  4ZRK A;  2LHD A;  1T3Q A;  2XNA C;  2CU3 A;  2BWF A;  1UH6 A;  2ZPY A;  3PVL A;  1HE8 A;  2KLC A;  2LXC A;  1C78 A;  3TEY A;  3RZW C;  3NVV A;  3AM9 A;  3SD5 A;  3L08 A;  1TT5 B;  1MFW A;  4HRO A;  3H8H A;  3DHI C;  4EFO A;  3C0R B;  4JQW C;  2N9L A;  3PGE A;  5IO9 A;  1FM0 D;  2JWZ A;  1WX8 A;  2WX1 A;  3AUL A;  2K6D B;  4FJV B;  4YXD B;  4IWP A;  5AUK A;  3NHE B;  4C7Z A;  1R7S A;  1KF6 B;  4C80 A;  2MA9 B;  1FNW A;  4RM9 A;  4XDC A;  3ABV B;  1TBE A;  5LNK 1;  1AN8 A;  1D6E C;  2QSD A;  2KJ6 A;  2MEK A;  2RMM A;  4W9F A;  1WXM A;  2HJ1 A;  2XN9 C;  5IOI A;  4MJS A;  2TSS A;  3APD A;  4NQK E;  2LUM A;  1VJK A;  2N7E A;  3TMP B;  2DZM A;  2K22 A;  4XYC A;  1EO6 A;  3AEF B;  1OQR A;  1EF1 A;  1NVI D;  1RYJ A;  1RAX A;  4M8N A;  3HM3 A;  4MT5 A;  1YJ1 A;  1WX9 A;  2KAN A;  5D3D A;  3BK2 A;  2LVP A;  1WF9 A;  5LLI A;  1C77 A;  3U30 A;  3ZO5 B;  3KWV A;  5T8I A;  2RDB C;  5TSS A;  5AUI A;  1KLG D;  2W55 A;  4YL8 A;  2HDE A;  3QJZ A;  1PGX A;  3ONS A;  2BYE A;  2RD0 A;  4FJZ A;  2Z0E B;  2DNF A;  1TY0 A;  1LM8 B;  4GOC A;  1GB4 A;  4DXG A;  1V5O A;  4ANX A;  1TGZ B;  2L05 A;  3QX1 A;  3ZDT A;  2PVG C;  1J7B A;  1Y8R C;  3BWU D;  4N58 A;  4EZJ A;  2ACZ B;  1KFY B;  4CO7 A;  4US8 A;  4A20 A;  1YD8 U;  2J42 A;  4W9I A;  2V3N A;  4HRS A;  2G4S A;  3PV1 A;  3RNA C;  1BT0 A;  3P4Q B;  1P1A A;  2K8H A;  3JW0 X;  3AE4 B;  1V80 A;  2WXG A;  4B6W A;  2NBV B;  2RR9 A;  4WAA A;  3EFC A;  4URK A;  3BZD B;  1E0Z A;  1CZP A;  4LNO A;  5IKC M;  3BYT B;  4I6L B;  2Z59 B;  2QJL A;  3M3J A;  1GJZ A;  3UIN B;  1OQQ A;  3RNC C;  4A9A A;  2D10 A;  1PQS A;  3H7P A;  4J3O D;  1WY8 A;  2LI5 A;  2WDQ B;  1UWM A;  5H92 C;  1WSP A;  1V6E A;  3VUY A;  3W1Y A;  1VRA B;  3MC0 B;  2FNJ B;  2V3P A;  1FCL A;  3OAW A;  2J0J A;  2NBU A;  2UYZ B;  3U7Z A;  4RF1 A;  1TIF A;  1CJE A;  1R4M B;  2R61 A;  2FID A;  1HA5 A;  1XLP A;  1YQ4 B;  4KZC A;  1NDD A;  1VCB A;  3LB8 C;  2ONQ A;  4P1B C;  1V97 A;  2WXN A;  2GMI C;  4RGN A;  3DBL I;  3A4S C;  4RFB A;  5IP4 D;  4JWU C;  2CU1 A;  4PS7 A;  3IVF A;  1FXT B;  2L1A A;  3IT6 B;  3ZJU A;  1L4Z B;  2BTE A;  2OJR A;  4WJP A;  1I4R A;  4O1N A;  5DPS A;  3DVG X;  4YTP B;  1E8W A;  1GPX A;  4EOY A;  1I42 A;  1HQR D;  2KMC A;  1I4Q A;  5GMV A;  2CHX A;  2X8X X;  3MFG A;  1L6U A;  2KDM A;  1G6J A;  1ZUD 2;  1AYF A;  4Q2J A;  4C4V A;  3PSE B;  1MHX A;  5JHB A;  4CYE A;  2KDB A;  3UQA A;  3V6C B;  3RNF C;  1TTN A;  1F77 A;  1MJD A;  3P4P B;  2IO0 B;  2QHO A;  2QCZ A;  4MGZ E;  3T8M A;  3EHV A;  4N9F 4;  2YEP F;  3TIX A;  1ROE A;  2DAJ A;  1JAL A;  3WAP A;  4N6E B;  1QF6 A;  1WJN A;  1IUE A;  2BYF A;  2O6V B;  1EWY C;  1RFA A;  1FEH A;  4L1B A;  1I4P A;  5EDS A;  2VH2 A;  1V1O A;  4A55 A;  3NZU A;  4JGH B;  2KZR A;  2MP2 B;  1E6E B;  1SE2 A;  1Q0W B;  1QT9 A;  2K8B A;  3CIR B;  4USA A;  3B2F A;  3VH4 B;  1M94 A;  4IM0 A;  4G3X B;  1F1H A;  2GLS A;  1JWA D;  1BUI C;  1MVK A;  2H89 B;  2N9K A;  3A9K A;  1IP9 A;  5JHA A;  2W82 A;  4HJG E;  3VDZ A;  4RGT A;  1C3T A;  1ZDV A;  2BS3 B;  2D3B A;  4A8X C;  3ZKJ C;  2YEP B;  2N1W A;  3AE2 B;  2L00 B;  4NAW B;  1FNU A;  1D5Z C;  4P6V F;  5IAA C;  4KGT A;  3AN1 A;  2KMA A;  4ANV A;  4II3 B;  1SEB D;  4NJ7 A;  2DAF A;  1MG4 A;  1PFD A;  2AYO B;  3JSV A;  1PYW D;  4MM3 B;  1EUV B;  4LJO B;  2WGS A;  1NBF C;  3ZXR A;  1TS3 A;  4WQO B;  4FJY A;  3L13 A;  1GUA B;  1WYW B;  2KVR A;  1C4A A;  1JML A;  4AJW A;  4OHJ A;  2I38 A;  1WMH B;  1TKE A;  4IWO A;  4US9 A;  3OJ3 A;  2JWU A;  4FN2 A;  3DBH B;  2JQR B;  3AED B;  2LMC A;  2N9E B;  2Q5W D;  2SAK A;  2MRP A;  3RD2 A;  3L10 B;  1FPY A;  2PJH A;  4HDQ A;  4K3C A;  2IBI B;  2PLP A;  2V1Y A;  5FK9 C;  3FIL A;  1E8Y A;  2CJN A;  3DQV A;  3B0A A;  1B9R A;  1P7F A;  2MW5 A;  1WI0 A;  2DZJ A;  2AL3 A;  3RMK C;  1JWS D;  3L0W B;  1XQQ A;  1C9F A;  1V86 A;  3IBE A;  1SF0 A;  2G9H D;  5H8Y E;  2ZW0 A;  2WXF A;  1LO5 D;  3TL5 A;  4DHJ B;  2IND C;  2JT4 B;  3PRM B;  2QMT A;  1FFV A;  2BT6 A;  4WQM A;  1D3Z A;  4RCO A;  1VZ8 A;  2PVO D;  2WXR A;  2V4I B;  4H2A A;  4HVB A;  2WXH A;  4LK0 M;  2BYT A;  2GI9 A;  1D4B A;  5EE3 A;  2DEN B;  2JXT A;  2PE6 B;  2LVQ A;  2UWQ A;  2DLB A;  4WJQ A;  2FCS A;  4KV2 A;  3AE3 B;  2KQ7 A;  4FUL A;  4KIK B;  3P4R B;  4PT5 A;  3Q8A A;  3UIO B;  5CX3 A;  1J7C A;  2KFK B;  2IO1 B;  4HPL B;  3UIP B;  1YN5 A;  3Q3J A;  3FC4 A;  3ML9 A;  5E6N A;  5E6P A;  1ZW7 A;  1FMA D;  4ZRJ A;  1NI2 A;  3Q14 C;  3PZD A;  5LXH A;  2C7H A;  3UQB A;  3IAM 1;  5BYQ A;  2DYO A;  1GG3 A;  1WGY A;  2V3S A;  3KQ4 A;  3Q3F A;  1KTK A;  3TEX A;  1ACC A;  1PUT A;  4XC2 A;  1WGG A;  3I57 A;  4NAM A;  4KGS A;  1WGH A;  2N7D A;  1S1Q B;  3RN9 C;  3OG5 A;  4DXF A;  2L76 A;  2QDF A;  2KK8 A;  4MAC A;  4LNF A;  3V61 A;  2WS3 B;  2NMQ A;  2WXK A;  3ZLZ A;  1V1P B;  4AUQ C;  2ZVN A;  3ZJV A;  4D2K A;  2V0G A;  4JX1 C;  4L23 A;  2A4Z A;  4ARI A;  2VZK D;  1FRR A;  1KLU D;  2Y5C A;  2KTR A;  3A4R A;  1BXT A;  1E90 A;  1L0Y B;  4PS8 A;  3WIM A;  3EGR A;  1MHH E;  2LGX A;  1V8C A;  4ZRI A;  3E9S A;  4TQ0 A;  4JL9 A;  4G50 A;  3A9J B;  3I5J C;  4RGM A;  1TS5 A;  3DHH C;  1P3Q U;  3UF8 A;  1YQ3 B;  3FAH A;  3KUZ A;  4AJY B;  2K8C A;  2IO2 B;  2IJ0 A;  1QZE A;  2WXM A;  5BO4 B;  2V9H A;  4MH0 E;  1HXY D;  2N7J A;  4OVV A;  3PRZ A;  2GBK A;  1VZ7 A;  2K3U A;  1WWT A;  3VQI A;  1HZ6 A;  4W9E A;  1ZP0 B;  2V4L A;  2KQS A;  3VR8 B;  3PLV A;  5E6J A;  2HTM E;  1K8R B;  4IM3 A;  1WM2 A;  2EKE C;  4PK1 A;  3RI7 C;  4ZHP A;  3SFD B;  1XXG A;  2ON8 A;  3U8Z A;  4G0N B;  4ZYS A;  1A70 A;  5AEK B;  1RLF A;  2G3Q B;  1OEY A;  4XWW A;  1NYR A;  4I6P A;  4XZ4 A;  3QA8 A;  1FFU A;  3M95 A;  1SSN A;  1FXI A;  2EMT A;  2BB6 A;  1OFF A;  1LGR A;  3VFK A;  2LJI A;  1AW7 A;  4ANW A;  2Y5B B;  4CQN A;  3ZNZ B;  1VLB A;  2LWP A;  4GB9 A;  1E5W A;  2J0M A;  2O2V B;  2M4N A;  3DBL B;  4ICV A;  3ZNI D;  1L4D B;  4BBN C;  2NCN A;  3MP9 A;  1WXS A;  2PKO A;  4EKU A;  1QOG A;  4A90 A;  5C1Z A;  1WJU A;  1Z5S B;  2EMS A;  1K51 A;  4OW0 A;  1RWS A;  1J0G A;  3A1Q A;  1SJE D;  3A33 B;  2CHZ A;  1QKZ A;  4X57 B;  3N32 A;  4WH4 A;  3EC8 A;  3U4E G;  1L5P A;  2NBW B;  1N5W A;  2ZJD A;  3NZ3 A;  4GDL A;  3X0W A;  2L7R A;  3V3X A;  4TSS A;  2JRI B;  4W9H A;  2FAZ A;  1P7E A;  2M17 A;  2M19 A;  2IGD A;  3OJ4 B;  4J6I A;  2MJ3 A;  1SJH D;  4W9K A;  1Q1O A;  3AV8 A;  4HKZ E;  4M0W B;  1L2N A;  5JXV A;  1I4H A;  3AE5 B;  4MEM A;  2JYT A;  1HTO A;  5CHF A;  4RH6 A;  3EEC A;  3VUW A;  4IC7 B;  3KUD B;  2NPT A;  4B0M A;  2X38 A;  4F8C B;  3JVZ X;  5G55 A;  1WR1 A;  2MSE D;  3H7S A;  3T3O A;  2KO3 A;  1K53 A;  3AEA B;  2DYM A;  2LGS A;  2OHF A;  1UBI A;  1TJE A;  4GIV A;  1Q10 A;  4MDK E;  1NI3 A;  2JPH A;  2FCQ A;  4C00 A;  3W9C B;  5HKH A;  1L6V A;  1GAQ B;  3VAW A;  1YMH E;  1T0Q C;  5TR5 A;  4DHZ B;  4ARC A;  1WM3 A;  1ZGU B;  2GBM A;  1EF5 A;  2WHI A;  5BYR A;  4OZB A;  1PGA A;  4ZOH C;  1QLB B;  4HEA 1;  3TBL D;  4GN1 A;  3M62 B;  3CSF A;  2RPQ A;  1PDX A;  2KQ4 X;  4FA6 A;  2DHZ A;  4HPM B;  5FR3 A;  2NTS A;  1TZ1 A;  4A6Q A;  1ET6 A;  3B2G A;  1V5T A;  2N1V A;  2FIF A;  3RPF C;  4WIP A;  3QQ8 B;  2JX5 A;  3URY A;  4GU2 A;  2JXX A;  4K1R B;  1UGJ A;  1TKG A;  4QAY A;  2BF8 B;  4GDK A;  2ZVO A;  2L0F A;  3SDL C;  2LEK A;  1WXQ A;  4B0E A;  4W9L A;  5C23 A;  4LDT D;  1MG8 A;  1WRI A;  1Q5W B;  3PO0 A;  4WAF A;  2JF5 A;  3C19 A;  1IBX B;  2PE9 A;  3ZIM A;  2KN4 A;  4OZC A;  2LJ5 A;  1MPE A;  2CR5 A;  3PS6 A;  2JRH A;  2KDF B;  3I63 C;  1IYF A;  1E7P B;  1V49 A;  1XEE A;  3LJ3 A;  3WAO A;  1XLO A;  1WH3 A;  1RRB A;  1I7H A;  4FHJ A;  2G4D B;  2JUO A;  3HHM A;  3BVZ A;  3CST A;  4M8M A;  4NJ6 A;  1UUP A;  2KMM A;  3AMZ A;  1JRP A;  4HCP B;  2L52 A;  2WX0 A;  2ZNV B;  2XK5 A;  4C7Y A;  2KVZ A;  1JWU D;  2CJO A;  4B9K A;  1KM7 A;  2BVC A;  1WXA A;  3ENE A;  3DOW A;  3PT2 B;  2Z8L A;  1EM7 A;  2WXQ A;  2R2Q A;  2MBH A;  1C1Y B;  4EZL A;  4EEW A;  4II2 B;  3FKY A;  4W9J A;  2MBQ A;  2HTH A;  2KXJ A;  2GBJ A;  1ZOY B;  3Q8E A;  1WX7 A;  3AEE B;  4ASW C;  3I3T B;  2DBY A;  2BQQ A;  3ZRC A;  4PS3 A;  2JZ3 B;  4MSQ B;  3IG3 A;  1ZPS A;  2NS5 A;  2LRW A;  3DVN V;  3PLU A;  4FAD A;  3AEG B;  4XDD A;  3TSS A;  2ZZP B;  3QK0 A;  1IGD A;  4B95 A;  1VD2 A;  1XLQ A;  4ICU A;  2WNM A;  2K1F A;  3PHX B;  4W9D A;  2IZV B;  3MTN B;  3H6N A;  1FO4 A;  1AWD A;  1P98 A;  4WWN A;  3MHS D;  4LCD E;  2N0S B;  2XEW A;  3PTF C;  2W3S A;  2LD9 A;  3VRA B;  5CHW A;  1FCC C;  4JE3 B;  4AP4 C;  4KDI C;  1ZDX A;  4KKJ A;  2J0K A;  2MBE A;  2KJR A;  3BIN A;  3UGB B;  1ESF A;  3BY4 B;  2C7M B;  4A3O A;  3ZTD A;  4IWQ A;  3DWM A;  4W9G A;  1F52 A;  1WIA A;  4KZ0 A;  1QIL A;  2BB5 A;  3T3N A;  3VH3 B;  5I4D A;  2C5L C;  4C56 C;  4ITK A;  4XGA B;  2CS4 A;  2IY0 B;  5J18 A;  4IM2 A;  3NG0 A;  2PIA A;  3AE1 B;  2OED A;  2WXP A;  3VTW A;  4KKI A;  3W1S A;  2VZK B;  1A5R A;  1R4N I;  2EEL A;  4A3P A;  2FCM A;  4HXD A;  4GLS C;  1DGJ A;  4OVZ A;  1GC7 A;  2WXO A;  4MJS B;  5E6O A;  1X1M A;  1GB1 A;  4MGI E;  3WAL A;  4P16 A;  3ZQ4 A;  2K39 A;  3VHT C;  1I35 A;  1RM6 C;  2KTF A;  2Z0D B;  5BMG A;  4DHZ E;  3B1L X;  1UWX A;  2K6Q A;  2FCN A;  4JWS C;  3APC A;  1EWC A;  2AWT A;  3B08 A;  4TUU A;  1C4C A;  2G1E A;  2M56 B;  1T6B X;  4K81 A;  4YTM B;  2HE7 A;  3RFZ B;  5MPO A;  3QIJ A;  1SGH A;  2JVC A;  2M1M A;  3R66 C;  1ENF A;  2WXL A;  1LXD A;  3Q3O C;  2BKR B;  2KWU B;  1L7Y A;  3V60 A;  2KKC A;  3ZDM C;  1YJI A;  3U7D A;  1KRH A;  3ZXV A;  4TV3 A;  2CKH B;  4FHK A;  4G11 A;  2IGG A;  2WU2 B;  4BKS A;  3IAS 1;  2AX5 A;  1WZ0 A;  3AB5 A;  3MHZ A;  2A5U A;  1TY2 A;  4FBJ B;  2KX0 A;  1K50 A;  4FXC A;  4R3D A;  4XWT A;  1T0R C;  4ACF A;  3R7R A;  3SEB A;  3GB1 A;  4BKT A;  3SHQ A;  3WA0 A;  5LXI B;  5EE0 A;  4JPS A;  5DPR A;  5J17 A;  4YSX B;  5BMH A;  3HRD D;  1IGC A;  4AS1 A;  4W9C A;  5G5G A;  2N4F A;  2C7N B;  3NRZ A;  2RPV A;  3U52 E;  1KJT A;  2ASQ A;  3APF A;  1CMX B;  1F2R I;  1F2R C;  2VH1 A;  1VR9 A;  3HK0 A;  5D6J B;  2FUG 1;  4GXB A;  3ALB A;  3HUI A;  3ZGZ A;  3H7P B;  4OVU A;  2KFJ A;  2AQ2 B;  5KHO A;  4GMV A;  4K7U A;  4AQ7 A;  2IGH A;  1SE3 A;  2MX2 A;  3RUI B;  2N9P C;  2KD0 A;  1GC6 A;  2LXA A;  2KHW B;  4HWI B;  3ZW3 A;  2WXI A;  2RGF A;  1JW9 D;  3LDZ E;  2MLB A;  3IHP C;  3AEB B;  4YTN B;  2YLM A;  1YIW A;  1TZO A;  4KX6 B;  4HK2 A;  1ZKH A;  1XF5 L;  1XCQ L;  3R2I A;  1SIF A;  4LLG M;  1N63 A;  3VVW B;  3NVW A;  3QAQ A;  4NZL B;  2B76 B;  1NEN B;  1H8C A;  1F9J A;  2MHJ A;  2KC2 A;  3VTV A;  2INN E;  1YN3 A;  1UNS A;  3VXW A;  3DPD A;  3TJP A;  3NUH B;  2KDE B;  2L3Z A;  1SE9 A;  3AXC A;  2O6V A;  3ETR A;  4YSY B;  4KVG B;  1U4A A;  3W2D A;  3TEW A;  1UF0 A;  3OWE B;  3KLS X;  4EZK A;  2FBW B;  2MBO A;  4WUR A;  3H1U A;  4C4V B;  2MP2 A;  5AZG A;  1ZXH A;  2INC C;  4NJC A;  3LYY A;  2KOX A;  1UGM A;  1N62 A;  3RUL A;  1N61 A;  3ZNG C;  5HI1 A;  4IDI A;  3Q69 A;  3ZRF A;  3KYD D;  2AEH A;  1Y56 A;  3L4P A;  1XLN A;  2J4X A;  2EKI A;  3L17 A;  2MJE A;  1SB3 C;  2GRI A;  1OEY J;  1E10 A;  4XE0 A;  1FRD A;  3CWI A;  3V6E B;  1F0Z A;  4MGK E;  1E8X A;  2KLG A;  4NQL B;  2DZK A;  1M4V A;  2K9X A;  1E9M A;  1FIQ A;  4HCN B;  2OJW A;  4L2Y A;  4K7W A;  4WWM A;  1E8Z A;  3BK1 A;  3O65 B;  1WJ6 A;  4NAW A;  4E71 A;  1YQB A;  2LUE A;  1L0V B;  4DQO C;  2ZW1 A;  3GE8 C;  2IPK D;  4M00 A;  3VUX A;  2JZP A;  2REX A;  5JH5 C;  5L83 A;  3A9K B;  2KAJ A;  4MM3 A;  4WJN A;  2IY1 B;  4IG7 B;  2JY6 A;  3AI5 A;  3WAM A;  3N1X C;  4LDT B;  4RGO S;  3Q3M C;  4HDO A;  5HFY A;  4IUM B;  3X23 A;  3GE3 C;  4ANU A;  1J8C A;  3N20 C;  3N3K B;  4DDI D;  2PW9 A;  1WMH A;  3Q8F A;  1WXV A;  1UEL A;  1UZX B;  1MI0 A;  1V2Y A;  5KHQ A;  3CF6 E;  1KLV A;  3DHG C;  5D94 A;  5D7G A;  4TKN A;  1STE A;  2KAC A;  2W9N A;  3DBR I;  2UU7 A;  3JSV B;  3ZNH B;  1YJJ A;  4N59 A;  2IYD B;  2QC8 A;  1SE4 A;  2GB1 A;  2J53 A;  3ML8 A;  1WE6 A;  4PYU A;  2J7Q B;  1E7U A;  4LTU A;  3EUB 2;  3OLM D;  1TYG B;  2JSV X;  1DOY A;  3Q8C A;  1B1Z A;  2KYW A;  3RCZ A;  2D3A A;  2WWZ A;  4LNI A;  3VRB B;  1HEZ E;  2M8S A;  4NNJ B;  1JQ4 A;  3D32 A;  2I1K A;  1JRO A;  4YWG G;  3HVZ A;  2LRU A;  2KC1 A;  1UBQ A;  4KIK A;  3H9D A;  3NOB A;  5CHV C;  3FIL B;  2IO3 B;  2K0P A;  3SFE B;  2KFK A;  1CK1 A;  3AE8 B;  3QC8 B;  1SIJ A;  3GOE A;  3GZN I;  4IOI E;  5FKA C;  3PRE A;  1ZE3 D;  2KNB A;  1P9D U;  3CMM B;  2INP E;  4MGY E;  3NZS A;  4GGQ A;  3KVF B;  4ZRQ A;  2BBC A;  1K52 A;  3TUO A;  3B9J A;  3JYU A;  4DDG D;  2KN5 A;  1YNT E;  4F1S A;  3P42 A;  3DDC B;  2C60 A;  3NY5 A;  5GXG B;  3ZVV A;  3MC8 A;  1UD7 A;  1CQV A;  3Q6B A;  2J52 A;  4NY0 A;  2ZPN A;  4M02 A;  3PZ7 A;  4CHK A;  1XCT L;  1BML C;  3L54 A;  1R4N B;  1D5M C;  1V1P A;  2NR2 A;  1H4R A;  2WQY B;  1IPG A;  4IW0 A;  3AU5 A;  4ZDV A;  3DVN U;  2AQ3 B;  1VZ6 A;  4MSM B;  3DBS A;  5HHD G;  4WJO A;  3DWG C;  2K5P A;  4DXA B;  1VDV A;  4KSL C;  2FUH B;  2WDR B;  3A9J A;  2MH7 A;  4BKG A;  5C3J B;  3P63 A;  2ZEQ A;  1T0S C;  5C2T B;  3GS2 A;  3AE7 B;  5AZF A;  2NTT A;  3C8Y A;  4P1C C;  2G45 B;  1JWB D;  2KWC A;  2RDH A;  2KWD A;  2MJD A;  4E74 A;  2LGI A;  4YT0 B;  4REZ A;  2PTL A;  2GBN A;  2KTR B;  2L83 A;  4BFR A;  3T9L A;  2OOB B;  4HKQ A;  3SU8 X;  3HIZ A;  1QOF A;  5CTR C;  2JU6 X;  1V81 A;  3SR6 A;  3RT3 B;  1I4X A;  3NVZ A;  5D3I B;  3TEZ A;  1GOZ A;  5HG2 A;  3W5U B;  1N6Z A;  3PPA A;  4WWO A;  3NVY A;  1XT9 B;  2AL6 A;  3TCA A;  2RDG A;  3UI3 A;  1ISN A;  5AZH A;  2WDT B;  2N9X A;  2W54 A;  4K7S A;  3RYT A;  3W1S C;  3WCQ A;  1P0R A;  1ZXI A;  1N5X A;  1JRU A;  1XO3 A;  2DX5 B;  2WLB A;  4AOF A;  4DWF A;  2I1J A;  3N1Y C;  3AU4 A;  3ECI A;  1DYQ A;  1JWM D;  1NEK B;  3PHW B;  2O2V A;  4AWJ A;  1YN4 A;  1YX5 B;  4DK5 A;  4GSW A;  3S2A A;  2D07 B;  4JIO U;  1SBB B;  3Q8B A;  5EE1 A;  3V05 A;  2ZCC A;  5J2R A;  4BKS D;  1QOA A;  1QOB A;  4LJP B;  2KJH B;  2BW2 A;  1WRD B;  1T0Y A;  1YOV B;  3RNG C;  2BGF A;  1V9J A;  2D2Q A;  3RNE C;  5DCN A;  1DOI A;  4KDL B;  3O13 A;  3K9O B;  3IXS A;  4ZYN A;  2BPS A;  2IDY A;  4IKG A;  1OGW A;  4RF0 A;  2BYV E;  1LFD A;  3N1Z C;  2M0A A;  4UDU C;  2LFI A;  4P7I A;  2E3T A;  4S17 A;  2JYE A;  4ZHO A;  4JLC A;  4BAX A;  4LNK A;  4EE2 A;  5JZE B;  2LAS A;  2PEA A;  2BS2 B;  4XX5 A;  3N30 A;  2RSU A;  3BVM A;  3QCA A;  4M0W A;  4LNN A;  2I2Y A;  4BBN F;  1C79 A;  3Q3N C;  4OZA A;  4MH8 A;  4HLE A;  4NPN A;  3A1Q B;  3PZ8 A;  3QHT A;  4ZRP A;  3L16 A;  1XD3 B;  1R4M I;  1Z2M A;  1GNU A;  2CHW A;  2ZCB A;  2D3C A;  4GDL B;  2D3G A;  3HM6 X;  1N60 A;  2PMV A;  2FE8 A;  1WR6 E;  1HTQ A;  1FNV A;  4TMA B;  2YVC A;  2Y5P A;  4S0R A;  2M0X A;  4KSK C;  3EA6 A;  3PRP B;  1RFK A;  3EFU A;  4YSZ B;  1WFY A;  1AAR A;  1NYQ A;  1JCK B;  3IT4 B;  3HVD A;  3RNB C;  2BKF A;  1I4G A;  2C9W B;  5G5H A;  4RMA A;  4MEL A;  3AE9 B;  2NPT B;  4KGR A;  2O6V D;  4I6N B;  3N9Y C;  3I9V 1;  2K25 A;  2QEJ C;  1C76 A;  1TKY A;  1DOX A;  2MCN B;  2DYB A;  3R8B A;  1E7V A;  1C4P A;  2L32 A;  5DPW A;  2ZNV C;  2ICI A;  3K9P B;  2D5G A;  1EU4 A;  3ZUN A;  2DWQ A;  4M01 A;  3LXF A;  3M63 B;  1FXA A;  2NVU I;  1L0X B;  3DVG Y;  5IA7 A;  2L0T A;  3MC9 A;  1OQY A;  3R3M A;  2WP9 B;  3KWL A;  5EE9 A;  2D11 A;  2HJ8 A;  3KUC B;  2LGD A;  5L95 C;  4BOS C;  1TS2 A;  1YX6 B;  4K3B A;  1KH0 A;  2XBB C;  1SXT A;  2SEB D;  4BVU C;  3GP7 A;  3E56 A;  3DCG A;  1WGR A;  1IBX A;  2QIE B;  2B3A A;  3P2B A;  5G2N A;  3R2T A;  2WDV B;  3BYY B;  3NJT A;  4PYZ A;  4DBG A;  3MJW A;  2PPH A;  2Y3A A;  3BII D;  3DBR B;  4E3C A;  2BWE S;  1WYG A;  2LGY A;  3P1M A;  1QQR A;  2GBR A;  3AEC B;  2KDI A;  3W5V B;  3MJ5 A;  1HZ5 A;  4GDK B;  5BYS A;  2MBB B;  1WGK A;  1T5X D;  3AH7 A;  3NS1 A;  3RZF A;  3IFW B;  2DZI A;  5DPT A;  3Q2A C;  1LQB A;  3BVG A;  2BS4 B;  4RNA A;  1FD6 A;  2JZZ A;  3KYC D;  1ET9 A;  2H88 B;  4HPP A;  3KH0 A;  5FR6 A;  2KWV B;  2WU5 B;  2MQJ A;  2QIL A;  4BOZ B;  4F7Z A;  4FLH A;  4WWP A;  3KW5 B;  1D5X C;  3ZTC A;  1TS4 A;  3AE6 B;  3VTU A;  3NS8 A;  3QAR A;  1WZ3 A;  4RM8 A;  1WE7 A;  3GZN B;  2MWS B;  3ZJT A;  1OTR B;  2L8J A;  4BZA A;  2LVO A;  2KX3 A;  3U2S C;  2WXJ A;  5BMI A;  3J9C A;  1EU3 A;  3ZYY X;  2WYQ A;  1J7A A;  2XK5 B;  2VRR B;  2W3R A;  3R7Q A;  3WAN A;  1WJ4 A;  2GOW A;  3P4S B;  5D2M B;  5IN7 A;  4DHJ D;  1KOT A;  3V62 A;  1PGB A;  3DBH I;  1S3S G;  3VR9 B; 
#chains in the Genus database with same CATH homology
 1ZPS A;  4RCO A;  4TQ1 A;  1VZ8 A;  1CK1 A;  2PVO D;  2WXR A;  2V4I B;  3AE8 B;  4H2A A;  1SIJ A;  2WXH A;  4LK0 M;  2BYT A;  2AQ1 B;  2GI9 A;  1D4B A;  4IOI E;  3AEG B;  4XDD A;  5FKA C;  2LHE A;  5EE3 A;  3TSS A;  2JXT A;  2DLB A;  1IGD A;  1ZE3 D;  3AE3 B;  1XLQ A;  2E6X A;  2WNM A;  2LHD A;  2INP E;  3P4R B;  1T3Q A;  4PT5 A;  4ZRQ A;  2XNA C;  2BBC A;  1K52 A;  2CU3 A;  3Q8A A;  1J7C A;  1FO4 A;  3TUO A;  1AWD A;  1YN5 A;  3B9J A;  1YNT E;  3FC4 A;  3P42 A;  2N0S B;  1C78 A;  3TEY A;  5GXG B;  2W3S A;  3NVV A;  3AM9 A;  1FMA D;  1CQV A;  3VRA B;  2J52 A;  1FCC C;  4JE3 B;  3PZ7 A;  4HRO A;  3H8H A;  1XCT L;  3IAM 1;  2N9L A;  5BYQ A;  2DYO A;  1FM0 D;  1ZDX A;  4KKJ A;  1BML C;  3KQ4 A;  1D5M C;  1V1P A;  1KTK A;  3TEX A;  1ACC A;  4YXD B;  1PUT A;  5AUK A;  4C7Z A;  1R7S A;  1KF6 B;  2WQY B;  4C80 A;  1FNW A;  3I57 A;  4XDC A;  1ESF A;  4KGS A;  4NAM A;  3ABV B;  2AQ3 B;  1VZ6 A;  4DXF A;  5LNK 1;  3DWM A;  5HHD G;  1AN8 A;  1D6E C;  2QSD A;  2MEK A;  4MAC A;  1QIL A;  2RMM A;  2WS3 B;  2BB5 A;  3T3N A;  2NMQ A;  2WXK A;  3DWG C;  2K5P A;  5I4D A;  1VDV A;  1V1P B;  3ZJV A;  2XN9 C;  4C56 C;  4ITK A;  2TSS A;  2WDR B;  4D2K A;  4JX1 C;  4L23 A;  2V0G A;  2MH7 A;  4ARI A;  2LUM A;  1VJK A;  2VZK D;  1FRR A;  3P63 A;  5C3J B;  2PIA A;  1KLU D;  2Y5C A;  3AE1 B;  2OED A;  2WXP A;  5C2T B;  3GS2 A;  3AE7 B;  2K22 A;  4KKI A;  2VZK B;  3W1S A;  1BXT A;  2NTT A;  3C8Y A;  3AEF B;  1OQR A;  1L0Y B;  2EEL A;  1NVI D;  1JWB D;  1RYJ A;  2RDH A;  2KWD A;  3EGR A;  1MHH E;  4GLS C;  1V8C A;  1DGJ A;  2MJD A;  3E9S A;  4MT5 A;  4OVZ A;  4TQ0 A;  2WXO A;  2LGI A;  4YT0 B;  4REZ A;  2PTL A;  5D3D A;  3BK2 A;  1GB1 A;  4RGM A;  1TS5 A;  1C77 A;  2L83 A;  3KWV A;  5T8I A;  4P16 A;  5TSS A;  3ZQ4 A;  4HKQ A;  5AUI A;  1YQ3 B;  1QOF A;  3FAH A;  1KLG D;  1RM6 C;  5BMG A;  2W55 A;  2IJ0 A;  2HDE A;  2JU6 X;  2WXM A;  1UWX A;  3SR6 A;  1PGX A;  4JWS C;  1HXY D;  1I4X A;  3NVZ A;  5D3I B;  2N7J A;  3TEZ A;  1GOZ A;  1VZ7 A;  1TY0 A;  2K3U A;  5HG2 A;  1WWT A;  3W5U B;  1EWC A;  3VQI A;  1GB4 A;  1HZ6 A;  4DXG A;  3NVY A;  1C4C A;  2G1E A;  2M56 B;  1T6B X;  1ZP0 B;  2RDG A;  3VR8 B;  4YTM B;  2PVG C;  1J7B A;  5MPO A;  3RFZ B;  3BWU D;  5E6J A;  1ENF A;  2HTM E;  4N58 A;  2WXL A;  3UI3 A;  2ACZ B;  1KFY B;  2W54 A;  4US8 A;  4ZHP A;  2J42 A;  2V3N A;  4HRS A;  3SFD B;  1XXG A;  2ON8 A;  3WCQ A;  1YJI A;  1KRH A;  1ZXI A;  4ZYS A;  1N5X A;  1XO3 A;  2WLB A;  1A70 A;  2IGG A;  3P4Q B;  2WU2 B;  3IAS 1;  2AX5 A;  3AB5 A;  3AE4 B;  3MHZ A;  4XWW A;  1TY2 A;  1DYQ A;  1JWM D;  1NEK B;  1NYR A;  2WXG A;  1K50 A;  4FXC A;  4R3D A;  4XWT A;  1YN4 A;  3SEB A;  3BZD B;  1FFU A;  3GB1 A;  1CZP A;  1SSN A;  1FXI A;  1SBB B;  2BB6 A;  1OFF A;  3Q8B A;  1E0Z A;  2LJI A;  5EE1 A;  1AW7 A;  3V05 A;  4CQN A;  1QOA A;  1VLB A;  1QOB A;  5EE0 A;  4JPS A;  3BYT B;  4YSX B;  2QJL A;  5BMH A;  2BW2 A;  3HRD D;  1OQQ A;  1IGC A;  4A9A A;  4AS1 A;  5G5G A;  4J3O D;  2WDQ B;  1UWM A;  5H92 C;  1DOI A;  1WSP A;  3NRZ A;  1L4D B;  2RPV A;  3U52 E;  3O13 A;  3IXS A;  3MP9 A;  2IDY A;  4IKG A;  1VRA B;  2PKO A;  1F2R I;  1F2R C;  3MC0 B;  1VR9 A;  2V3P A;  1FCL A;  1QOG A;  4RF0 A;  4A90 A;  2FUG 1;  3U7Z A;  2M0A A;  4UDU C;  2LFI A;  2E3T A;  4RF1 A;  3HUI A;  3ZGZ A;  1CJE A;  2R61 A;  1K51 A;  4OW0 A;  1RWS A;  1HA5 A;  2JYE A;  1XLP A;  1YQ4 B;  4ZHO A;  2AQ2 B;  4EE2 A;  3LB8 C;  1SJE D;  2ONQ A;  4AQ7 A;  2IGH A;  1V97 A;  2WXN A;  1SE3 A;  1QKZ A;  4RGN A;  2BS2 B;  4WH4 A;  4RFB A;  3U4E G;  1L5P A;  2WXI A;  4M0W A;  3BVM A;  4JWU C;  1N5W A;  1JW9 D;  3NZ3 A;  2I2Y A;  4WQM A;  1C79 A;  3AEB B;  2L1A A;  4YTN B;  3V3X A;  4TSS A;  4OZA A;  4MH8 A;  3IT6 B;  3ZJU A;  1L4Z B;  2BTE A;  1TZO A;  3PZ8 A;  4ZRP A;  1P7E A;  2M19 A;  1I4R A;  2IGD A;  4KX6 B;  2MJ3 A;  4O1N A;  1XF5 L;  1XCQ L;  1SJH D;  3R2I A;  4LLG M;  3AV8 A;  1N63 A;  4YTP B;  4HKZ E;  3NVW A;  4NZL B;  1GPX A;  2B76 B;  4GDL B;  1NEN B;  5JXV A;  1I4H A;  1HQR D;  1I4Q A;  3AE5 B;  1N60 A;  2JYT A;  3MFG A;  2PMV A;  4RH6 A;  2FE8 A;  1L6U A;  2KDM A;  1FNV A;  4TMA B;  1ZUD 2;  1AYF A;  2INN E;  2Y5P A;  4Q2J A;  1YN3 A;  1UNS A;  1MHX A;  3NUH B;  4B0M A;  2X38 A;  3EA6 A;  3ETR A;  1RFK A;  3T3O A;  1F77 A;  4YSY B;  3P4P B;  4YSZ B;  1K53 A;  3AEA B;  3W2D A;  1NYQ A;  3TEW A;  2DYM A;  2OHF A;  1JCK B;  3IT4 B;  3HVD A;  3OWE B;  3KLS X;  1I4G A;  2FBW B;  2YEP F;  1ROE A;  4WUR A;  5G5H A;  1TJE A;  3AE9 B;  4KGR A;  1ZXH A;  1Q10 A;  1JAL A;  4NJC A;  4N6E B;  1QF6 A;  1NI3 A;  3N9Y C;  3LYY A;  1IUE A;  3I9V 1;  1N62 A;  3W9C B;  1EWY C;  2QEJ C;  1C76 A;  1TKY A;  1DOX A;  1FEH A;  1N61 A;  4L1B A;  1I4P A;  3R8B A;  1C4P A;  1L6V A;  2L32 A;  5HI1 A;  4IDI A;  1GAQ B;  3Q69 A;  1YMH E;  2ICI A;  1V1O A;  1Y56 A;  1EU4 A;  2D5G A;  4A55 A;  4ARC A;  3L4P A;  1XLN A;  2DWQ A;  2J4X A;  3LXF A;  1E6E B;  2EKI A;  1SE2 A;  1FXA A;  2MJE A;  3CIR B;  1QT9 A;  1SB3 C;  2GRI A;  5BYR A;  1L0X B;  4OZB A;  1PGA A;  4ZOH C;  1E10 A;  4XE0 A;  1FRD A;  4USA A;  3CWI A;  3B2F A;  1F0Z A;  1QLB B;  4HEA 1;  1M4V A;  1JWA D;  1PDX A;  2KQ4 X;  1BUI C;  2WP9 B;  3KWL A;  2K9X A;  1E9M A;  1FIQ A;  5EE9 A;  1MVK A;  5FR3 A;  2H89 B;  2NTS A;  2N9K A;  4A6Q A;  4L2Y A;  2W82 A;  1ET6 A;  3B2G A;  4WWM A;  1TS2 A;  3BK1 A;  3RPF C;  1KH0 A;  1SXT A;  2SEB D;  1L0V B;  4HJG E;  3GP7 A;  4WIP A;  3E56 A;  4DQO C;  2JX5 A;  2ZW1 A;  3URY A;  4RGT A;  1IBX A;  2QIE B;  1ZDV A;  2BS3 B;  1UGJ A;  2IPK D;  1TKG A;  4A8X C;  3R2T A;  2YEP B;  2JZP A;  2WDV B;  2LEK A;  1WXQ A;  3BYY B;  4B0E A;  3AE2 B;  2KAJ A;  2Y3A A;  3BII D;  4NAW B;  1FNU A;  1WYG A;  3P1M A;  1D5Z C;  4P6V F;  4KGT A;  1WRI A;  3AN1 A;  1QQR A;  4RGO S;  3AEC B;  3PO0 A;  4WAF A;  5HFY A;  1SEB D;  1IBX B;  3W5V B;  3MJ5 A;  1HZ5 A;  1PFD A;  4GDK B;  5BYS A;  2KN4 A;  4OZC A;  2PW9 A;  3Q8F A;  1PYW D;  1WGK A;  4MM3 B;  1T5X D;  3AH7 A;  1MPE A;  3NS1 A;  1TS3 A;  1MI0 A;  3BVG A;  2BS4 B;  1E7P B;  4RNA A;  1C4A A;  1JML A;  1XEE A;  1FD6 A;  5D7G A;  1ET9 A;  2H88 B;  1STE A;  1XLO A;  2KAC A;  1I7H A;  4OHJ A;  2I38 A;  2BT6 A;  3BVZ A;  1YJJ A;  4N59 A;  1UUP A;  1TKE A;  2WU5 B;  2KMM A;  3AMZ A;  1SE4 A;  1JRP A;  2GB1 A;  2J53 A;  2JWU A;  2QIL A;  4US9 A;  2L52 A;  2JQR B;  4C7Y A;  1D5X C;  4LTU A;  3AED B;  1JWU D;  2CJO A;  2LMC A;  2Q5W D;  1TS4 A;  1TYG B;  3AE6 B;  3EUB 2;  2SAK A;  2JSV X;  1DOY A;  3Q8C A;  2Z8L A;  1B1Z A;  1EM7 A;  2WXQ A;  2PLP A;  5FK9 C;  3ZJT A;  3FIL A;  2CJN A;  3VRB B;  3U2S C;  1B9R A;  1HEZ E;  1P7F A;  2WXJ A;  5BMI A;  1ZOY B;  1EU3 A;  3J9C A;  3ZYY X;  3Q8E A;  1JQ4 A;  1J7A A;  2W3R A;  3AEE B;  1JWS D;  1C9F A;  1JRO A;  3P4S B;  4YWG G;  3HVZ A;  1SF0 A;  2G9H D;  2DBY A;  5H8Y E;  1PGB A;  2WXF A;  2ZW0 A;  1LO5 D;  2QMT A;  1FFV A;  3FIL B;  2K0P A;  3SFE B;  3VR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...