2GRIA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2griA01
2GRIA 2M0AA 2IDYA
chains in the Genus database with same CATH superfamily
2WX0A 3KUDB 2O6VA 1XLPA 4NJCA 4MT5A 1FRRA 3ZQ4A 1BUIC 1SE2A 4W9FA 4GN1A 2UWQA 4BKSD 1Q0WB 4C4VB 3H8HA 2BYEA 4FBJB 1E90A 3UF8A 4BBNC 4HJKA 2OOBB 1DYQA 1ZUD2 2G9HD 2NS5A 5L83A 4H2AA 2W54A 1NBFC 3N32A 3TL5A 5LLIA 3ZXRA 2BVCA 1JWAD 2J0KA 1KLGD 3DHHC 2E6XA 3RFZB 2D3CA 1JWMD 1WY8A 3VDZA 3U30A 5E6NA 1GC6A 2EELA 1OQRA 4KGTA 3ZJUA 1Y8RC 2LJIA 5CHFA 3Q3OC 5KHOA 2LXAA 1HTOA 1N60A 1UGMA 2WXPA 3B2FA 1IBXB 2N9LA 2NPTB 1LFDA 2WDTB 3M62B 3URYA 2N4FA 1WXAA 5EE1A 3GS2A 2O6VB 2YEPF 5MPOA 3T3OA 1SB3C 4FN2A 2OJRA 2W55A 1AN8A 2GBJA 2Y5BB 3B08A 1IGCA 3NVWA 2KFJA 4G11A 4KKIA 1FXTB 4B0MA 1WGKA 1HA5A 3VR8B 1NI2A 1E8ZA 4HKQA 5DPTA 1J7BA 4LK0M 4DHJD 1V6EA 1XXGA 3EUB2 4UDUC 1YIWA 4ZYSA 3R2IA 3TEWA 2YVCA 1HQRD 2AWTA 2IBIB 5HKHA 2FBWB 4WWOA 2WXQA 3ENEA 2KACA 4YTNB 2BKFA 1QQRA 1WJ4A 3VR9B 5BYSA 2NTTA 4RGMA 4A20A 4YXDB 2KTFA 3DWMA 1SEBD 3NHEB 4HK2A 3N1YC 5IAAC 4LDTB 2DX5B 1YJ1A 4EE2A 3SDLC 3N1ZC 4M8NA 5AZFA 2KMAA 4FHKA 2K22A 1CJEA 1QF6A 4AS1A 4FLHA 2JPHA 3RULA 4KSLC 3D32A 2K8HA 4W9EA 2CU1A 2PVOD 3Q2AC 5IO9A 1N6ZA 2KHWB 3MC0B 4GU2A 3AB5A 3EECA 2K1FA 1WX9A 5J18A 3TJPA 3LYYA 1J19A 2XBBC 2L76A 1WH3A 2BPSA 4WJOA 2INCC 3W9CB 4BKTA 1L0VB 4NY0A 4J6IA 1FIQA 1K52A 4HVBA 1ISNA 1T3QA 4J3OD 4D2KA 4QAYA 3R2TA 2KAJA 1VCBA 3TUOA 3LDZE 4CQNA 2WQYB 4TV3A 4ZHPA 2V4LA 4W9HA 2N9PC 4P1CC 4L1BA 1GAQB 1SXTA 2V3NA 1EWCA 4ZRJA 5BMHA 2C5LC 3QX1A 2G1EA 3SR6A 2KK8A 3KVFB 1WSPA 2KKCA 4JPSA 4ACFA 2MP2A 3MFGA 2LI5A 1WXVA 1LM8B 2JY6A 3AEDB 1VZ6A 2N1VA 4ARIA 2QSDA 3IFWB 2HE7A 2KLGA 4AUQC 4HCPB 1RYJA 2MJ3A 3Q6BA 4S0RA 1E7UA 4M0WB 1NYQA 2CHXA 4HXDA 3HM6X 5KHQA 3HHMA 4C7YA 1FXIA 1PQSA 3NY5A 1D6EC 4JQWC 1YX5B 3VQIA 4WAFA 1GC7A 3DBHB 2JYTA 4KVGB 2LZ6A 2KQSA 2L00B 3TCAA 2EMTA 4XWTA 1WI0A 4XYCA 1CK1A 4G3XB 2L3ZA 3PGEA 5HFYA 3BIID 3AULA 3EGRA 2HD5B 3C8YA 4DBGA 1V9JA 4EZKA 4WURA 3CWIA 2QHOA 1V5OA 4HEA1 5D3IB 3TMPB 1QLBB 1L2NA 2MP2B 3U4EG 3DHGC 1Q5WB 4M02A 4B0EA 4MEMA 1AYFA 1B9RA 3I57A 3PVLA 5D6JB 5DPSA 3RYTA 1SJHD 1I4PA 4JE3B 3AN1A 1C9FA 2Z8LA 3MP9A 1GOZA 2KN4A 4IM2A 1EF1A 1TJEA 2DNFA 1M94A 4DDID 1P0RA 3Q8EA 3IVFA 1V80A 3CIRB 2KZRA 1C78A 1OGWA 3DVNU 3LJ3A 3KQ4A 2JWZA 2D3GA 4AJWA 2R2OA 4DXGA 4MSMB 3WIMA 2BB5A 3UIPB 5FR3A 3N1XC 4HROA 1ESFA 2L8JA 1QKZA 1VLBA 2XN9C 3ECIA 4EUTA 1WMHA 2MSED 4I6PA 3ZTDA 2FUHB 3T3NA 2J4XA 2KJHB 2C60A 3QARA 3CSFA 1L0YB 1FMAD 4OVUA 1OEYA 4RNAA 2INDC 3BY4B 1YN4A 1MI0A 2W82A 2QDFA 4A3PA 5E6OA 5EE9A 3RZWC 4K7SA 2M0XA 3W1SC 1C4PA 1FFUA 4AOFA 4K7UA 1V81A 2JXTA 4WIPA 2WGSA 4P6VF 1OQQA 1KFYB 1LGRA 1T0QC 2G3QB 4HPLB 4I6NB 1I4HA 4R3DA 4RGNA 3SD5A 1L7YA 4JLCA 2KVRA 3FC4A 1SIJA 2MCNB 4NQLB 1XLQA 3APCA 4AWJA 2LUEA 3WALA 4OVZA 3BVGA 2J53A 1QZEA 1RAXA 1H4RA 1D4BA 2MHJA 3AM9A 1WM2A 1V97A 1WMHB 1FNUA 5JHBA 2AL3A 3L4PA 2MBBB 4OW0A 1E8XA 3KWLA 3AE6B 2L52A 4BKGA 3ZDTA 4E3CA 1YQBA 1SSNA 2KN5A 2WXMA 3KUZA 3SFDB 3ZXVA 2D5GA 1JRUA 1WR1A 1UNSA 3ZUNA 2LGIA 1V1PA 3RNBC 2HTME 3TEZA 1I4QA 4HLEA 2IO0B 2EKEC 1E10A 3Q69A 3BZDB 1UH6A 2WXNA 1S3SG 1HZ5A 4HJGE 3PLUA 4CHKA 4IKGA 2LJ5A 1YJIA 2R2QA 1YD8U 2FIDA 4KX6B 2IJ0A 1KF6B 4IWQA 2L0TA 3IAS1 5BMGA 2QIEB 3MJWA 3DBRB 3HIZA 4BKSA 1WZ0A 3E56A 3DHIC 2FIFA 5CTRC 3PO0A 4ZRQA 2YLMA 2LGSA 2L7RA 5G5GA 2ZVNA 3K9PB 2KDFB 4DXFA 5DPWA 5H8YE 2WDQB 2NTSA 1D5XC 2J7QB 5CHVC 3RMKC 2Z0EB 2ZJDA 1K53A 1E7VA 4LNNA 3IT4B 4M8MA 2DYOA 3TBLD 3L0WB 2EMSA 2V1YA 3PV1A 3BK2A 4N6EB 5C23A 2J42A 2KWCA 3ZW3A 2JUOA 2IDYA 2G45B 1OEYJ 4MH0E 3T8MA 1R4MB 4ITKA 2ICIA 3DPDA 4MELA 4NNJB 2XEWA 3CSTA 3BVMA 3RNGC 3W1YA 1BT0A 3KH0A 2DENB 1UF0A 1T6BX 1T5XD 5CHWA 3OJ3A 1U4AA 2K8CA 2BF8B 1MVKA 1T0SC 1PFDA 5GMVA 4W9CA 5D7GA 3ONSA 1TIFA 2K6DB 2GBNA 3FILA 1LO5D 1P9DU 4IUMB 3NJTA 1OQYA 4GMVA 3EHVA 2AYOB 3U8ZA 2J0JA 1WJ6A 3Q8FA 1KJTA 3W5UB 4II3B 1F2RI 4P16A 2LEKA 3BYYB 4GDLA 4ARCA 2INPE 2HTHA 2G4DB 1KRHA 4US8A 3HM3A 2MW5A 3WANA 2NVUI 1AARA 3L54A 3DVGY 3KYDD 2KC1A 3NVZA 3AMZA 1V49A 2LMCA 4W9JA 3ZTCA 2AQ2B 4A55A 1AW7A 1WGGA 2DYMA 1KM7A 3DVNV 1WIAA 4OZAA 1XQQA 1KOTA 1XCQL 3MHZA 1JWUD 4KIKA 1X1MA 1WGHA 2J0MA 1B1ZA 2RPVA 4WWNA 2MH7A 4W9IA 1ZP0B 3FILB 3S2AA 4RGTA 5TR5A 2KOXA 1D5ZC 2K39A 1UELA 4DHJB 1WGDA 3BVZA 5JXVA 2FUG1 2NBWB 1I4XA 2JT4B 3HUIA 1XF5L 2YEPB 4K3BA 2D11A 1E0ZA 5BYQA 2MBOA 2JZPA 4GDLB 3SFEB 2KLCA 3NZSA 1NDDA 2H89B 4YTPB 5T8IA 1QOBA 3SHQA 2L32A 4MDKE 3C0RB 1GJZA 1EUVB 1MG8A 1KLUD 2AQ1B 4WH4A 3UIOB 4XX5A 2C9WB 3WAPA 4NAWA 1J7CA 1FEHA 3L16A 2RDHA 2VZKD 4GOCA 4KIKB 1WJNA 2PE9A 1M4VA 2LXCA 3AE8B 1YOVB 2KC2A 4FXCA 4MGZE 1R4NB 2QEJC 3P63A 3C19A 3DBRI 3U52E 2MJDA 2WU5B 2N9KA 5JHAA 4DDGD 4LJOB 1YMHE 4KDIC 3KW5B 1V8CA 2W9NA 3ZRCA 4AQ7A 1FD6A 2AQ3B 3R7RA 2D3AA 1UZXB 3RZFA 4KGRA 1VRAB 2K3UA 2LVOA 2D2QA 4GB9A 3L08A 1WFYA 3ZIMA 4JGHB 4XDDA 1YN3A 5G5HA 3UI3A 3ZKJC 2AX5A 3OAWA 4OZCA 1ZXIA 1CZPA 5HG2A 3RCZA 3GE8C 4PK1A 3A4SC 2NBVB 3ALBA 3QQ8B 1IP9A 4NAWB 4USAA 3ZNHB 2EKIA 2KTRA 4M01A 4A9AA 4LDTD 1PUTA 4ICUA 2LRUA 2N0SB 1Q10A 3PT2B 4MACA 1SE3A 2KWVB 2V3SA 4XGAB 4WAAA 1R4MI 4A8XC 3NOBA 2C7NB 2INNE 1R7SA 1TKYA 1TS4A 3OG5A 4MGKE 2M8SA 1PDXA 3X23A 1F2RC 2LVPA 1TT5B 2CJNA 2Z59B 1I42A 2C7HA 1RLFA 2JU6X 4RM8A 5IA7A 1L6VA 4HDQA 3O65B 4N59A 2DHZA 1KH0A 3DDCB 3GB1A 3U7ZA 2IGGA 2LGXA 1K8RB 5L95C 2LASA 1XO3A 2WXFA 3N3KB 2M0AA 2KTRB 1HEZE 3V61A 5AEKB 1L4DB 5DPRA 4F1SA 2N1WA 4F7ZA 1TKEA 4PYUA 1VD2A 4NJ7A 1A70A 1ZXHA 4X57B 4S17A 3FKYA 1YQ4B 2FE8A 4KZ0A 2ZPYA 2UU7A 2FAZA 2PKOA 4OVVA 2JQRB 2GB1A 4CO7A 2DYBA 1HE8A 2LFIA 1TZ1A 2IO1B 4LNKA 2JF5A 3MHSD 5C2TB 1TS5A 3P1MA 4TSSA 2HDEA 2M17A 1C4AA 3ABVB 1MJDA 3WCQA 1FPYA 1TZOA 3Q3FA 2ZCCA 4E71A 5CX3A 4W9DA 2L05A 4LLGM 1XD3B 2MEKA 5JH5C 2KX3A 2JX5A 1CQVA 2IY0B 1GPXA 4HPMB 5G2NA 1EU3A 1OTRB 3LXFA 1WYGA 1NYRA 1JALA 2G4SA 1V2YA 3ZNID 5AUIA 3APDA 2CR5A 2FCQA 2GRIA 2TSSA 1R4NI 2IYDB 2KNBA 5AUKA 1BXTA 4FULA 1Y56A 1YN5A 2JRHA 3MC9A 4YSZB 2RGFA 3AU4A 2JWUA 2O2VA 3H7PA 3L10B 3QC8B 4TQ0A 1IGDA 5H92C 2LHEA 1VDVA 3AECB 2N7JA 2GBKA 1E5WA 2LGYA 1JWBD 1H8CA 3AU5A 3AI5A 4ZYNA 3P42A 2NCNA 2XK5A 4C56C 3PSEB 4GIVA 4IW0A 2V0GA 1ACCA 4B9KA 2WHIA 1RWSA 1TS3A 3EC8A 2M19A 4K1RB 4LCDE 4NJ6A 2KDEB 4HWIB 2MBEA 2Z0DB 3NZ3A 2K8BA 2ZEQA 1NI3A 1NVID 1UGJA 2LUMA 1FCCC 2BS2B 4B6WA 4ZHOA 3B2GA 4ZRPA 4XE0A 3L13A 3VUXA 2A4ZA 3VFKA 1WYWB 1SBBB 1KLVA 5E6JA 1QOAA 2O2VB 4BAXA 3DBSA 3DVGX 2JZ3B 2MBQA 3IXSA 3APFA 3H7PB 3RD2A 3NG0A 2HJ8A 1UBIA 1FCLA 3PTFC 3B9JA 2CHZA 4MJSA 4LNFA 3A4RA 4ZDVA 2MJEA 2I1KA 1FNWA 4YSXB 1ET6A 2LRWA 2MWSB 2WYQA 4WQMA 2RPQA 2WXLA 1WGRA 4MGYE 1XT9B 4HDOA 1LXDA 1PYWD 3ZLZA 4KKJA 2IPKD 2PTLA 2MQJA 4P1BC 3PHXB 2DAFA 1EO6A 1F52A 3QA8A 5G55A 3NS8A 1C76A 2QCZA 1SF0A 1JMLA 1JCKB 2CHWA 1I4GA 4JIOU 1Q1OA 1UBQA 4IWOA 4K81A 3VH4B 2KDIA 5IOIA 2VRRB 1WZ3A 3VUWA 5C1ZA 1N5WA 1BMLC 1WRIA 1ZKHA 3JYUA 4A90A 3UGBB 2BYVE 1ZDVA 1QOFA 3MTNB 5AZHA 1MHHE 3PRMB 1AWDA 4MJSB 3TIXA 1YX6B 3VRAB 5D3DA 1JRPA 1F9JA 3RNFC 2PJHA 5GXGB 4FHJA 5LXHA 1DOIA 3HRDD 4E74A 1V1PB 4WWMA 3DBLI 2VH2A 3A9KA 2KVZA 3M63B 4JWSC 2VH1A 1QILA 2GOWA 1QT9A 2NR2A 4A6QA 3OLMD 2ZZPB 2DAJA 2BS4B 3W5VB 1UWXA 3A1QA 3U7DA 1WX8A 4M00A 3PPAA 3KLSX 3BYTB 4C4VA 3IBEA 2SEBD 2D07B 1ZDXA 4BOZB 2BYFA 3NRZA 4REZA 1JROA 2WLBA 1L5PA 1TGZB 3AE9B 1D5MC 3AEBB 4F8CB 3K9OB 3P4PB 3M95A 1WXQA 4DK5A 3HVDA 5DCNA 3IAM1 3BWUD 2PLPA 4K7WA 2LD9A 1CMXB 2KD0A 1P7EA 2QJLA 4XWWA 2BTEA 1ZGUB 2ACZB 2NPTA 3HVZA 2FCSA 4C00A 3A9KB 2JVCA 3IG3A 2KWDA 3J9CA 4JX1C 2WXHA 4PT5A 5EE3A 3ZDMC 1KTKA 3JSVA 1GB1A 2JXXA 2OHFA 3LB8C 2X8XX 1RFKA 3A1QB 3R7QA 1FO4A 4II2B 2GMIC 3RNCC 2DLBA 3V3XA 3AE4B 2QMTA 4PS8A 4YTMB 2L83A 3DCGA 3IT6B 5BYRA 3WAOA 3AEEB 4NPNA 4GLSC 2ON8A 3R3MA 1FXAA 2FCNA 2R61A 2BGFA 2WXIA 3VH3B 4NQKE 3ZO5B 3QAQA 2W3RA 1OFFA 3VUYA 1VZ8A 4WQOB 2CJOA 4MGIE 2X38A 4AJYB 3L17A 2N9XA 3MJ5A 4WJPA 2N9EB 4HRSA 4DHZE 3JSVB 1WXMA 4L23A 2KQ4X 1TY2A 1VR9A 4YL8A 2M1MA 4PS3A 3ML9A 2PE6B 1RM6C 2VZKB 2Y5PA 2MX2A 1GNUA 2DZIA 2Y5CA 1N63A 3PZDA 2O6VD 3V62A 1V5TA 1ZOYB 3JW0X 4N9F4 2KMMA 1C1YB 1IPGA 3VVWB 4TQ1A 3DWGC 3H6NA 1SJED 2CS4A 3KYCD 4ZRKA 2DWQA 2WXKA 3GZNB 1XLNA 5FKAC 4GDKA 1K50A 2D3BA 4RMAA 1IUEA 4B95A 1FRDA 2J52A 4C80A 2MLBA 4O1NA 1JQ4A 1S1QB 1C3TA 3N9YC 4IOIE 2KO3A 3RT3B 3VTWA 2V4IB 2WU2B 4US9A 4YT0B 4KDLB 1DOXA 2Y3AA 1SE4A 3P4QB 2IGDA 3PRPB 3O13A 4ANWA 4OHJA 2B3AA 5LNK1 2BWFA 2XNAC 4XZ4A 4FA6A 2WXGA 3ZJTA 4YWGG 3ETRA 1EU4A 1TS2A 2ZCBA 3V60A 2KJRA 2RMMA 3RNAC 2K5PA 2NMQA 4RH6A 4FJVB 2MA9B 4GDKB 3B1LX 2WP9B 4BBNF 1I35A 1WXSA 3WA0A 4EOYA 4L2YA 3VTUA 2BYTA 4M0WA 3AEFB 3RPFC 4DWFA 1MFWA 3VRBB 1HZ6A 2DZKA 3KWVA 2IO2B 1GUAB 3E9SA 1FNVA 1XLOA 3R8BA 4G0NB 2ASQA 3AE2B 1J7AA 3AXCA 2C7MB 4EKUA 2AEHA 3AV8A 3UINB 4W9LA 1N5XA 1TBEA 1WRDB 3NS1A 1N61A 3I3TB 3PS6A 3CMMB 4ZRIA 2WDRB 4BZAA 2HJ1A 2NBUA 2WXRA 3QJZA 4HKZE 2AL6A 3R66C 3RNEC 2W3SA 5TSSA 5JZEB 2KDBA 4WWPA 4EEWA 1PGXA 2RDGA 4AP4C 1T0YA 4LTUA 2CU3A 4I6LB 3X0WA 3PRZA 1WE7A 3Q8CA 4ANVA 1DOYA 4RF0A 3GOEA 5BMIA 3TSSA 2H88B 4G50A 2OEDA 2GI9A 4JL9A 4IM3A 3W2DA 3SEBA 5J17A 3VAWA 1P98A 3AEAB 3H9DA 2WXJA 2FCMA 1UWMA 1UD7A 2BT6A 2JSVX 2A5UA 4NZLB 3BK1A 1WGYA 4P7IA 5HI1A 1STEA 4BVUC 3PREA 5FR6A 3KUCB 3N30A 1WM3A 1WX7A 1YJJA 3AH7A 2RD0A 4GXBA 3AE3B 4KSKC 1HXYD 1L6UA 2BBCA 1N62A 1V1OA 2KXJA 2SAKA 4YSYB 3TEYA 2QILA 3IHPC 4TUUA 2DBYA 3AE7B 4MH8A 3NVVA 2JYEA 2BW2A 2M56B 3DBLB 5D2MB 2ZNVC 3Q3NC 3OJ4B 2PW9A 3V6EB 3ZNZB 2WX1A 3VHTC 4JWUC 5D94A 3NVYA 3Q3MC 1ET9A 3ZGZA 3QHTA 4HPPA 4NAMA 3NZUA 2REXA 1SIFA 2RSUA 1HTQA 3N20C 4BOSC 1ROEA 4EFOA 1TTNA 3WAMA 3QWZB 2LVQA 2KDMA 2K6QA 3PLVA 3Q8AA 2FNJB 1Z5SB 2KYWA 3GZNI 5C3JB 2ZVOA 1NENB 3VXWA 3PZ8A 2DZJA 1G6JA 1A5RA 1P7FA 4RM9A 2BWES 2I1JA 4KZCA 1J8CA 2KWUB 1EWYC 2JZZA 1C79A 1MG4A 2IGHA 3VTVA 1MPEA 4GGQA 4ZOHC 2I38A 2GBRA 1VJKA 3Q3JA 1NEKB 4A3OA 2QC8A 1JW9D 3A9JA 5EE0A 4GSWA 2K25A 2KANA 2ZW1A 3H1UA 1DGJA 2E3TA 1P1AA 4RCOA 2BQQA 3GP7A 4DQOC 2WXOA 3NUHB 3JVZX 2M4NA 5J2RA 3RI7C 1FM0D 2RR9A 4W9KA 1QOGA 1XEEA 3I5JC 2L1AA 1TY0A 1ZPSA 4IDIA 3I63C 1I7HA 4MM3A 4FJYA 3ZJVA 1XCTL 1WR6E 2PVGC 4CYEA 1EM7A 4C7ZA 4OZBA 4N58A 2GLSA 2PMVA 2N7EA 3AE5B 5BO4B 4XC2A 3OWEB 2K9XA 3RUIB 1E6EB 1WWTA 1T0RC 3TEXA 3A9JB 1J0GA 3QK0A 4HCNB 1LQBA 3AE1B 4Q2JA 3BINA 3GE3C 3SU8X 2OJWA 3PZ7A 2XK5B 4IG7B 2KFKA 1RFAA 2WDVB 2N7DA 2PPHA 5IN7A 1GB4A 1C77A 1JWSD 2KQ7A 1C4CA 4EZLA 2WNMA 4RFBA 3ZRFA 1L0XB 4MM3B 4EZJA 4RF1A 4KGSA 3H7SA 4XDCA 5IKCM 4KV2A 4DHZB 2MRPA 3V05A 1E7PB 2ONQA 5FK9C 1PGAA 3V6CB 2ZNVB 1I4RA 1SE9A 1E8YA 2IO3B 1L4ZB 3DQVA 2IZVB 2BS3B 4MSQB 2BB6A 1Z2MA 4TKNA 3B0AA 4BFRA 1TKGA 3ML8A 5I4DA 3FAHA 3CF6E 4IC7B 3ZNGC 2ZW0A 4ICVA 3QIJA 3UQAA 3DBHI 3A33B 2L0FA 2D10A 5AZGA 3P4RB 1P3QU 2KFKB 3EA6A 3UQBA 4ANXA 3PHWB 4FJZA 2ZPNA 4ASWC 4IM0A 4LJPB 2DZMA 3ZYYX 3ZVVA 2KT7A 2BKRB 1ZW7A 4URKA 4W9GA 3W1SA 4ANUA 2JRIB 3QCAA 3M3JA 3I9V1 2IY1B 4PS7A 2V9HA 3U2SC 3AEGB 1PGBA 1E9MA 1IYFA 4PYZA 1WJUA 2GBMA 1ZE3D 5HHDG 3T9LA 2V3PA 5EDSA 1K51A 2Q5WD 3Q14C 1VZ7A 3EFUA 1E8WA 1EF5A 1RRBA 3MC8A 2WWZA 5E6PA 1SGHA 1FFVA 4LNOA 1ENFA 2CKHB 4DXAB 1F0ZA 1YQ3B 2WS3B 3Q8BA 4IWPA 5IP4D 3RN9C 1WE6A 3HK0A 3P2BA 1F1HA 1F77A 2PEAA 5LXIB 2KMCA 1WF9A 2LWPA 1MHXA 2MBHA 4LNIA 4RGOS 1YNTE 3P4SB 1TYGB 3EFCA 2KJ6A 1V86A 1GG3A 4WJQA 2I2YA 2LHDA 3DOWA 1UUPA 1IBXA 2B76B 2LGDA 2K0PA 2KX0A 2UYZB 4TMAB 2RDBC 4K3CA 2PIAA 4FADA 4WJNA 1D3ZA
chains in the Genus database with same CATH topology
2HDEA 2V4IB 4NJCA 1XLPA 2WU2B 4US9A 4YT0B 1SSNA 2WXMA 4MT5A 1FRRA 3ZQ4A 1C4AA 3SFDB 1BUIC 1SE2A 2D5GA 3ABVB 3WCQA 2Y3AA 1SE4A 1DOXA 3P4QB 1UNSA 2IGDA 2LGIA 3H8HA 1TZOA 3O13A 4OHJA 1DYQA 1V1PA 1ZUD2 4LLGM 5LNK1 2G9HD 2XNAC 2MEKA 4H2AA 2HTME 2W54A 2JX5A 3TEZA 1CQVA 1I4QA 2WXGA 3ZJTA 4YWGG 1GPXA 1JWAD 1E10A 3ETRA 1EU3A 1KLGD 1EU4A 1TS2A 3Q69A 2E6XA 3BZDB 3LXFA 1WYGA 1NYRA 2RMMA 3RFZB 2K5PA 1JALA 2NMQA 1JWMD 2WXNA 4RH6A 1HZ5A 4HJGE 5AUIA 4GDKB 2EELA 2WP9B 4IKGA 1OQRA 4KGTA 3ZJUA 1YJIA 4L2YA 2LJIA 2GRIA 2TSSA 5AUKA 4KX6B 2BYTA 1N60A 1BXTA 2IJ0A 3AEFB 4M0WA 3RPFC 2WXPA 1Y56A 3B2FA 1KF6B 1YN5A 1IBXB 2N9LA 3VRBB 3IAS1 1HZ6A 4YSZB 5BMGA 2QIEB 3KWVA 3E9SA 1FNVA 2JWUA 1XLOA 3R8BA 3URYA 5EE1A 3E56A 3AE2B 1J7AA 3GS2A 4TQ0A 1IGDA 3AV8A 1N5XA 3PO0A 4ZRQA 5H92C 2LHEA 2YEPF 3NS1A 1N61A 1VDVA 5G5GA 3AECB 5MPOA 2N7JA 3T3OA 1JWBD 1SB3C 4DXFA 2W55A 2WDRB 1AN8A 5H8YE 2WXRA 2WDQB 3P42A 4HKZE 4C56C 2NTSA 1IGCA 3NVWA 1D5XC 2V0GA 2W3SA 1ACCA 5TSSA 4KKIA 1RWSA 4B0MA 1TS3A 1WGKA 1HA5A 3VR8B 2M19A 1K53A 1PGXA 2RDGA 4HKQA 3IT4B 2DYOA 1J7BA 4LK0M 4LTUA 2CU3A 3NZ3A 1XXGA 3EUB2 1NI3A 1NVID 1UGJA 4UDUC 2LUMA 4ZYSA 3R2IA 1FCCC 3TEWA 2BS2B 3Q8CA 1DOYA 4RF0A 3BK2A 4N6EB 2J42A 4ZHOA 1HQRD 5BMIA 3B2GA 3TSSA 2FBWB 2WXQA 2H88B 2OEDA 4ZRPA 2GI9A 4XE0A 2IDYA 2KACA 4YTNB 3W2DA 3SEBA 1QQRA 3AEAB 4ITKA 2WXJA 3VR9B 1SBBB 2ICIA 5BYSA 1UWMA 2NTTA 4RGMA 2BT6A 2JSVX 1QOAA 5E6JA 4NZLB 3BK1A 5HI1A 1STEA 4YXDB 3BVMA 3IXSA 3DWMA 1FCLA 1YJJA 3AH7A 1SEBD 1T6BX 1T5XD 3B9JA 1MVKA 3AE3B 1PFDA 5D7GA 2MJEA 4EE2A 1HXYD 1L6UA 2BBCA 1N62A 1V1OA 2SAKA 4YSYB 1FNWA 3TEYA 2QILA 4YSXB 2DBYA 1ET6A 3FILA 1LO5D 3AE7B 4MH8A 3NVVA 2JYEA 2K22A 2BW2A 2M56B 1CJEA 4WQMA 1QF6A 2WXLA 2PW9A 4AS1A 3Q8FA 3W5UB 1PYWD 4JWUC 1F2RI 4KKJA 3NVYA 2IPKD 1ET9A 2LEKA 2PTLA 3BYYB 4P16A 3ZGZA 4NAMA 2INPE 4ARCA 1KRHA 4US8A 1C76A 2PVOD 1SF0A 1JMLA 1ROEA 1JCKB 1I4GA 3MC0B 2KDMA 3AB5A 3Q8AA 3NVZA 3AMZA 3LYYA 5C3JB 2LMCA 1NENB 2AQ2B 4A55A 1AW7A 3PZ8A 2DYMA 1P7FA 1N5WA 3W9CB 1BMLC 1WRIA 4OZAA 1XCQL 3MHZA 1EWYC 1JWUD 4A90A 1C79A 2IGHA 1MPEA 1L0VB 1ZDVA 1QOFA 4ZOHC 1MHHE 2I38A 1VJKA 1FIQA 1K52A 1AWDA 1B1ZA 1NEKB 3VRAB 1T3QA 2RPVA 5D3DA 2MH7A 1JRPA 1JW9D 5EE0A 4J3OD 1ZP0B 4D2KA 3FILB 5GXGB 3R2TA 4RGTA 2KAJA 3TUOA 1D5ZC 2ZW1A 4CQNA 1DOIA 2WQYB 3HRDD 1DGJA 3BVZA 4ZHPA 2E3TA 2FUG1 5JXVA 3HUIA 1I4XA 1V1PB 1XF5L 4WWMA 2YEPB 4L1BA 1E0ZA 1GAQB 3GP7A 1SXTA 2V3NA 4RCOA 1EWCA 5BYQA 2JZPA 5BMHA 4DQOC 4JWSC 4GDLB 3SFEB 2G1EA 1QILA 3SR6A 1QT9A 2WXOA 3NUHB 1WSPA 2H89B 4JPSA 4YTPB 4A6QA 5T8IA 3MFGA 1QOBA 2BS4B 3W5VB 1FM0D 1UWXA 2L32A 1QOGA 1XEEA 3AEDB 1VZ6A 4TSSA 2L1AA 1TY0A 1ZPSA 3KLSX 3BYTB 4IDIA 4ARIA 1I7HA 2QSDA 2SEBD 1ZDXA 1KLUD 1RYJA 2MJ3A 2AQ1B 3ZJVA 4WH4A 1NYQA 1XCTL 3NRZA 2PVGC 4REZA 1J7CA 1EM7A 1FEHA 1JROA 2WLBA 4N58A 4OZBA 4C7ZA 4C7YA 1L5PA 3AE9B 2RDHA 1D5MC 2VZKD 2PMVA 3AEBB 3AE5B 3OWEB 1FXIA 1D6EC 1M4VA 3P4PB 3AE8B 3VQIA 2K9XA 4FXCA 1E6EB 1WWTA 4WAFA 2JYTA 1WXQA 2QEJC 3TEXA 3HVDA 3P63A 3IAM1 4XWTA 1CK1A 3BWUD 3U52E 2MJDA 2WU5B 2PLPA 2N9KA 3AE1B 4Q2JA 1YMHE 5HFYA 3BIID 1V8CA 3PZ7A 4AQ7A 1P7EA 2QJLA 3EGRA 4XWWA 2AQ3B 2WDVB 2BTEA 1FD6A 3C8YA 3HVZA 2ACZB 1GB4A 4WURA 3J9CA 2KWDA 4JX1C 3CWIA 1C77A 4KGRA 1VRAB 2WXHA 4PT5A 2K3UA 4HEA1 1JWSD 5EE3A 5D3IB 1QLBB 1KTKA 1C4CA 1GB1A 3U4EG 2OHFA 4XDDA 3LB8C 1YN3A 2WNMA 5G5HA 1RFKA 4RFBA 3UI3A 4B0EA 1AYFA 1B9RA 2AX5A 3I57A 1L0XB 1FO4A 4OZCA 1ZXIA 4MM3B 2DLBA 3V3XA 1CZPA 4RF1A 4KGSA 3AE4B 4XDCA 5HG2A 2QMTA 4YTMB 3V05A 1E7PB 2L83A 3IT6B 5BYRA 2ONQA 1SJHD 4NAWB 1PGAA 5FK9C 1I4PA 3AEEB 4USAA 2EKIA 4JE3B 4A9AA 3AN1A 1C9FA 2Z8LA 3MP9A 1GOZA 2KN4A 1PUTA 4GLSC 1I4RA 1L4ZB 2ON8A 1TJEA 2BS3B 2N0SB 2BB6A 1FXAA 1Q10A 4MACA 1SE3A 1TKGA 2R61A 5I4DA 2WXIA 3FAHA 4A8XC 3Q8EA 3CIRB 1C78A 2ZW0A 2INNE 2W3RA 1R7SA 1TKYA 1TS4A 3KQ4A 1PDXA 3P4RB 1OFFA 1VZ8A 1F2RC 2CJOA 4DXGA 2CJNA 2X38A 2BB5A 3EA6A 5FR3A 4HROA 1ESFA 2JU6X 3MJ5A 1QKZA 1VLBA 3ZYYX 2XN9C 4HRSA 1L6VA 4L23A 3W1SA 2KQ4X 1TY2A 1VR9A 3T3NA 2J4XA 4N59A 3I9V1 1KH0A 3GB1A 3U7ZA 2IGGA 1RM6C 3U2SC 1XO3A 2VZKB 2WXFA 1PGBA 2Y5PA 1E9MA 3AEGB 1L0YB 2Y5CA 1FMAD 4RNAA 1ZE3D 5HHDG 2M0AA 1YN4A 2V3PA 1MI0A 1K51A 1N63A 2Q5WD 1HEZE 2W82A 1VZ7A 5EE9A 1ZOYB 1L4DB 2KMMA 1TKEA 1C4PA 4TQ1A 1FFVA 3DWGC 1FFUA 1ENFA 2JXTA 4WIPA 1A70A 1SJED 1ZXHA 1F0ZA 2DWQA 1YQ3B 2WS3B 1OQQA 2WXKA 4P6VF 1KFYB 3Q8BA 4RGNA 1I4HA 4R3DA 1F77A 1XLNA 5FKAC 3FC4A 1YQ4B 1SIJA 1MHXA 2FE8A 4RGOS 1XLQA 1K50A 1YNTE 3P4SB 1TYGB 1IUEA 2PKOA 2JQRB 1FRDA 2GB1A 2J52A 4OVZA 3BVGA 2I2YA 2LHDA 2J53A 1UUPA 1IBXA 2LFIA 4C80A 2B76B 4O1NA 1D4BA 2K0PA 3AM9A 1V97A 4TMAB 1JQ4A 1FNUA 3L4PA 4OW0A 5C2TB 3N9YC 2PIAA 3KWLA 3AE6B 2L52A 4IOIE 1TS5A 3P1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRI A;  2M0A A;  2IDY A; 
#chains in the Genus database with same CATH topology
 2WX0 A;  3KUD B;  2O6V A;  1XLP A;  4NJC A;  4MT5 A;  1FRR A;  3ZQ4 A;  1BUI C;  1SE2 A;  4W9F A;  4GN1 A;  2UWQ A;  4BKS D;  1Q0W B;  4C4V B;  3H8H A;  2BYE A;  4FBJ B;  1E90 A;  3UF8 A;  4BBN C;  4HJK A;  2OOB B;  1DYQ A;  1ZUD 2;  2G9H D;  2NS5 A;  5L83 A;  4H2A A;  2W54 A;  1NBF C;  3N32 A;  3TL5 A;  5LLI A;  3ZXR A;  2BVC A;  1JWA D;  2J0K A;  1KLG D;  3DHH C;  2E6X A;  3RFZ B;  2D3C A;  1JWM D;  1WY8 A;  3VDZ A;  3U30 A;  5E6N A;  1GC6 A;  2EEL A;  1OQR A;  4KGT A;  3ZJU A;  1Y8R C;  2LJI A;  5CHF A;  3Q3O C;  5KHO A;  2LXA A;  1HTO A;  1N60 A;  1UGM A;  2WXP A;  3B2F A;  1IBX B;  2N9L A;  2NPT B;  1LFD A;  2WDT B;  3M62 B;  3URY A;  2N4F A;  1WXA A;  5EE1 A;  3GS2 A;  2O6V B;  2YEP F;  5MPO A;  3T3O A;  1SB3 C;  4FN2 A;  2OJR A;  2W55 A;  1AN8 A;  2GBJ A;  2Y5B B;  3B08 A;  1IGC A;  3NVW A;  2KFJ A;  4G11 A;  4KKI A;  1FXT B;  4B0M A;  1WGK A;  1HA5 A;  3VR8 B;  1NI2 A;  1E8Z A;  4HKQ A;  5DPT A;  1J7B A;  4LK0 M;  4DHJ D;  1V6E A;  1XXG A;  3EUB 2;  4UDU C;  1YIW A;  4ZYS A;  3R2I A;  3TEW A;  2YVC A;  1HQR D;  2AWT A;  2IBI B;  5HKH A;  2FBW B;  4WWO A;  2WXQ A;  3ENE A;  2KAC A;  4YTN B;  2BKF A;  1QQR A;  1WJ4 A;  3VR9 B;  5BYS A;  2NTT A;  4RGM A;  4A20 A;  4YXD B;  2KTF A;  3DWM A;  1SEB D;  3NHE B;  4HK2 A;  3N1Y C;  5IAA C;  4LDT B;  2DX5 B;  1YJ1 A;  4EE2 A;  3SDL C;  3N1Z C;  4M8N A;  5AZF A;  2KMA A;  4FHK A;  2K22 A;  1CJE A;  1QF6 A;  4AS1 A;  4FLH A;  2JPH A;  3RUL A;  4KSL C;  3D32 A;  2K8H A;  4W9E A;  2CU1 A;  2PVO D;  3Q2A C;  5IO9 A;  1N6Z A;  2KHW B;  3MC0 B;  4GU2 A;  3AB5 A;  3EEC A;  2K1F A;  1WX9 A;  5J18 A;  3TJP A;  3LYY A;  1J19 A;  2XBB C;  2L76 A;  1WH3 A;  2BPS A;  4WJO A;  2INC C;  3W9C B;  4BKT A;  1L0V B;  4NY0 A;  4J6I A;  1FIQ A;  1K52 A;  4HVB A;  1ISN A;  1T3Q A;  4J3O D;  4D2K A;  4QAY A;  3R2T A;  2KAJ A;  1VCB A;  3TUO A;  3LDZ E;  4CQN A;  2WQY B;  4TV3 A;  4ZHP A;  2V4L A;  4W9H A;  2N9P C;  4P1C C;  4L1B A;  1GAQ B;  1SXT A;  2V3N A;  1EWC A;  4ZRJ A;  5BMH A;  2C5L C;  3QX1 A;  2G1E A;  3SR6 A;  2KK8 A;  3KVF B;  1WSP A;  2KKC A;  4JPS A;  4ACF A;  2MP2 A;  3MFG A;  2LI5 A;  1WXV A;  1LM8 B;  2JY6 A;  3AED B;  1VZ6 A;  2N1V A;  4ARI A;  2QSD A;  3IFW B;  2HE7 A;  2KLG A;  4AUQ C;  4HCP B;  1RYJ A;  2MJ3 A;  3Q6B A;  4S0R A;  1E7U A;  4M0W B;  1NYQ A;  2CHX A;  4HXD A;  3HM6 X;  5KHQ A;  3HHM A;  4C7Y A;  1FXI A;  1PQS A;  3NY5 A;  1D6E C;  4JQW C;  1YX5 B;  3VQI A;  4WAF A;  1GC7 A;  3DBH B;  2JYT A;  4KVG B;  2LZ6 A;  2KQS A;  2L00 B;  3TCA A;  2EMT A;  4XWT A;  1WI0 A;  4XYC A;  1CK1 A;  4G3X B;  2L3Z A;  3PGE A;  5HFY A;  3BII D;  3AUL A;  3EGR A;  2HD5 B;  3C8Y A;  4DBG A;  1V9J A;  4EZK A;  4WUR A;  3CWI A;  2QHO A;  1V5O A;  4HEA 1;  5D3I B;  3TMP B;  1QLB B;  1L2N A;  2MP2 B;  3U4E G;  3DHG C;  1Q5W B;  4M02 A;  4B0E A;  4MEM A;  1AYF A;  1B9R A;  3I57 A;  3PVL A;  5D6J B;  5DPS A;  3RYT A;  1SJH D;  1I4P A;  4JE3 B;  3AN1 A;  1C9F A;  2Z8L A;  3MP9 A;  1GOZ A;  2KN4 A;  4IM2 A;  1EF1 A;  1TJE A;  2DNF A;  1M94 A;  4DDI D;  1P0R A;  3Q8E A;  3IVF A;  1V80 A;  3CIR B;  2KZR A;  1C78 A;  1OGW A;  3DVN U;  3LJ3 A;  3KQ4 A;  2JWZ A;  2D3G A;  4AJW A;  2R2O A;  4DXG A;  4MSM B;  3WIM A;  2BB5 A;  3UIP B;  5FR3 A;  3N1X C;  4HRO A;  1ESF A;  2L8J A;  1QKZ A;  1VLB A;  2XN9 C;  3ECI A;  4EUT A;  1WMH A;  2MSE D;  4I6P A;  3ZTD A;  2FUH B;  3T3N A;  2J4X A;  2KJH B;  2C60 A;  3QAR A;  3CSF A;  1L0Y B;  1FMA D;  4OVU A;  1OEY A;  4RNA A;  2IND C;  3BY4 B;  1YN4 A;  1MI0 A;  2W82 A;  2QDF A;  4A3P A;  5E6O A;  5EE9 A;  3RZW C;  4K7S A;  2M0X A;  3W1S C;  1C4P A;  1FFU A;  4AOF A;  4K7U A;  1V81 A;  2JXT A;  4WIP A;  2WGS A;  4P6V F;  1OQQ A;  1KFY B;  1LGR A;  1T0Q C;  2G3Q B;  4HPL B;  4I6N B;  1I4H A;  4R3D A;  4RGN A;  3SD5 A;  1L7Y A;  4JLC A;  2KVR A;  3FC4 A;  1SIJ A;  2MCN B;  4NQL B;  1XLQ A;  3APC A;  4AWJ A;  2LUE A;  3WAL A;  4OVZ A;  3BVG A;  2J53 A;  1QZE A;  1RAX A;  1H4R A;  1D4B A;  2MHJ A;  3AM9 A;  1WM2 A;  1V97 A;  1WMH B;  1FNU A;  5JHB A;  2AL3 A;  3L4P A;  2MBB B;  4OW0 A;  1E8X A;  3KWL A;  3AE6 B;  2L52 A;  4BKG A;  3ZDT A;  4E3C A;  1YQB A;  1SSN A;  2KN5 A;  2WXM A;  3KUZ A;  3SFD B;  3ZXV A;  2D5G A;  1JRU A;  1WR1 A;  1UNS A;  3ZUN A;  2LGI A;  1V1P A;  3RNB C;  2HTM E;  3TEZ A;  1I4Q A;  4HLE A;  2IO0 B;  2EKE C;  1E10 A;  3Q69 A;  3BZD B;  1UH6 A;  2WXN A;  1S3S G;  1HZ5 A;  4HJG E;  3PLU A;  4CHK A;  4IKG A;  2LJ5 A;  1YJI A;  2R2Q A;  1YD8 U;  2FID A;  4KX6 B;  2IJ0 A;  1KF6 B;  4IWQ A;  2L0T A;  3IAS 1;  5BMG A;  2QIE B;  3MJW A;  3DBR B;  3HIZ A;  4BKS A;  1WZ0 A;  3E56 A;  3DHI C;  2FIF A;  5CTR C;  3PO0 A;  4ZRQ A;  2YLM A;  2LGS A;  2L7R A;  5G5G A;  2ZVN A;  3K9P B;  2KDF B;  4DXF A;  5DPW A;  5H8Y E;  2WDQ B;  2NTS A;  1D5X C;  2J7Q B;  5CHV C;  3RMK C;  2Z0E B;  2ZJD A;  1K53 A;  1E7V A;  4LNN A;  3IT4 B;  4M8M A;  2DYO A;  3TBL D;  3L0W B;  2EMS A;  2V1Y A;  3PV1 A;  3BK2 A;  4N6E B;  5C23 A;  2J42 A;  2KWC A;  3ZW3 A;  2JUO A;  2IDY A;  2G45 B;  1OEY J;  4MH0 E;  3T8M A;  1R4M B;  4ITK A;  2ICI A;  3DPD A;  4MEL A;  4NNJ B;  2XEW A;  3CST A;  3BVM A;  3RNG C;  3W1Y A;  1BT0 A;  3KH0 A;  2DEN B;  1UF0 A;  1T6B X;  1T5X D;  5CHW A;  3OJ3 A;  1U4A A;  2K8C A;  2BF8 B;  1MVK A;  1T0S C;  1PFD A;  5GMV A;  4W9C A;  5D7G A;  3ONS A;  1TIF A;  2K6D B;  2GBN A;  3FIL A;  1LO5 D;  1P9D U;  4IUM B;  3NJT A;  1OQY A;  4GMV A;  3EHV A;  2AYO B;  3U8Z A;  2J0J A;  1WJ6 A;  3Q8F A;  1KJT A;  3W5U B;  4II3 B;  1F2R I;  4P16 A;  2LEK A;  3BYY B;  4GDL A;  4ARC A;  2INP E;  2HTH A;  2G4D B;  1KRH A;  4US8 A;  3HM3 A;  2MW5 A;  3WAN A;  2NVU I;  1AAR A;  3L54 A;  3DVG Y;  3KYD D;  2KC1 A;  3NVZ A;  3AMZ A;  1V49 A;  2LMC A;  4W9J A;  3ZTC A;  2AQ2 B;  4A55 A;  1AW7 A;  1WGG A;  2DYM A;  1KM7 A;  3DVN V;  1WIA A;  4OZA A;  1XQQ A;  1KOT A;  1XCQ L;  3MHZ A;  1JWU D;  4KIK A;  1X1M A;  1WGH A;  2J0M A;  1B1Z A;  2RPV A;  4WWN A;  2MH7 A;  4W9I A;  1ZP0 B;  3FIL B;  3S2A A;  4RGT A;  5TR5 A;  2KOX A;  1D5Z C;  2K39 A;  1UEL A;  4DHJ B;  1WGD A;  3BVZ A;  5JXV A;  2FUG 1;  2NBW B;  1I4X A;  2JT4 B;  3HUI A;  1XF5 L;  2YEP B;  4K3B A;  2D11 A;  1E0Z A;  5BYQ A;  2MBO A;  2JZP A;  4GDL B;  3SFE B;  2KLC A;  3NZS A;  1NDD A;  2H89 B;  4YTP B;  5T8I A;  1QOB A;  3SHQ A;  2L32 A;  4MDK E;  3C0R B;  1GJZ A;  1EUV B;  1MG8 A;  1KLU D;  2AQ1 B;  4WH4 A;  3UIO B;  4XX5 A;  2C9W B;  3WAP A;  4NAW A;  1J7C A;  1FEH A;  3L16 A;  2RDH A;  2VZK D;  4GOC A;  4KIK B;  1WJN A;  2PE9 A;  1M4V A;  2LXC A;  3AE8 B;  1YOV B;  2KC2 A;  4FXC A;  4MGZ E;  1R4N B;  2QEJ C;  3P63 A;  3C19 A;  3DBR I;  3U52 E;  2MJD A;  2WU5 B;  2N9K A;  5JHA A;  4DDG D;  4LJO B;  1YMH E;  4KDI C;  3KW5 B;  1V8C A;  2W9N A;  3ZRC A;  4AQ7 A;  1FD6 A;  2AQ3 B;  3R7R A;  2D3A A;  1UZX B;  3RZF A;  4KGR A;  1VRA B;  2K3U A;  2LVO A;  2D2Q A;  4GB9 A;  3L08 A;  1WFY A;  3ZIM A;  4JGH B;  4XDD A;  1YN3 A;  5G5H A;  3UI3 A;  3ZKJ C;  2AX5 A;  3OAW A;  4OZC A;  1ZXI A;  1CZP A;  5HG2 A;  3RCZ A;  3GE8 C;  4PK1 A;  3A4S C;  2NBV B;  3ALB A;  3QQ8 B;  1IP9 A;  4NAW B;  4USA A;  3ZNH B;  2EKI A;  2KTR A;  4M01 A;  4A9A A;  4LDT D;  1PUT A;  4ICU A;  2LRU A;  2N0S B;  1Q10 A;  3PT2 B;  4MAC A;  1SE3 A;  2KWV B;  2V3S A;  4XGA B;  4WAA A;  1R4M I;  4A8X C;  3NOB A;  2C7N B;  2INN E;  1R7S A;  1TKY A;  1TS4 A;  3OG5 A;  4MGK E;  2M8S A;  1PDX A;  3X23 A;  1F2R C;  2LVP A;  1TT5 B;  2CJN A;  2Z59 B;  1I42 A;  2C7H A;  1RLF A;  2JU6 X;  4RM8 A;  5IA7 A;  1L6V A;  4HDQ A;  3O65 B;  4N59 A;  2DHZ A;  1KH0 A;  3DDC B;  3GB1 A;  3U7Z A;  2IGG A;  2LGX A;  1K8R B;  5L95 C;  2LAS A;  1XO3 A;  2WXF A;  3N3K B;  2M0A A;  2KTR B;  1HEZ E;  3V61 A;  5AEK B;  1L4D B;  5DPR A;  4F1S A;  2N1W A;  4F7Z A;  1TKE A;  4PYU A;  1VD2 A;  4NJ7 A;  1A70 A;  1ZXH A;  4X57 B;  4S17 A;  3FKY A;  1YQ4 B;  2FE8 A;  4KZ0 A;  2ZPY A;  2UU7 A;  2FAZ A;  2PKO A;  4OVV A;  2JQR B;  2GB1 A;  4CO7 A;  2DYB A;  1HE8 A;  2LFI A;  1TZ1 A;  2IO1 B;  4LNK A;  2JF5 A;  3MHS D;  5C2T B;  1TS5 A;  3P1M A;  4TSS A;  2HDE A;  2M17 A;  1C4A A;  3ABV B;  1MJD A;  3WCQ A;  1FPY A;  1TZO A;  3Q3F A;  2ZCC A;  4E71 A;  5CX3 A;  4W9D A;  2L05 A;  4LLG M;  1XD3 B;  2MEK A;  5JH5 C;  2KX3 A;  2JX5 A;  1CQV A;  2IY0 B;  1GPX A;  4HPM B;  5G2N A;  1EU3 A;  1OTR B;  3LXF A;  1WYG A;  1NYR A;  1JAL A;  2G4S A;  1V2Y A;  3ZNI D;  5AUI A;  3APD A;  2CR5 A;  2FCQ A;  2GRI A;  2TSS A;  1R4N I;  2IYD B;  2KNB A;  5AUK A;  1BXT A;  4FUL A;  1Y56 A;  1YN5 A;  2JRH A;  3MC9 A;  4YSZ B;  2RGF A;  3AU4 A;  2JWU A;  2O2V A;  3H7P A;  3L10 B;  3QC8 B;  4TQ0 A;  1IGD A;  5H92 C;  2LHE A;  1VDV A;  3AEC B;  2N7J A;  2GBK A;  1E5W A;  2LGY A;  1JWB D;  1H8C A;  3AU5 A;  3AI5 A;  4ZYN A;  3P42 A;  2NCN A;  2XK5 A;  4C56 C;  3PSE B;  4GIV A;  4IW0 A;  2V0G A;  1ACC A;  4B9K A;  2WHI A;  1RWS A;  1TS3 A;  3EC8 A;  2M19 A;  4K1R B;  4LCD E;  4NJ6 A;  2KDE B;  4HWI B;  2MBE A;  2Z0D B;  3NZ3 A;  2K8B A;  2ZEQ A;  1NI3 A;  1NVI D;  1UGJ A;  2LUM A;  1FCC C;  2BS2 B;  4B6W A;  4ZHO A;  3B2G A;  4ZRP A;  4XE0 A;  3L13 A;  3VUX A;  2A4Z A;  3VFK A;  1WYW B;  1SBB B;  1KLV A;  5E6J A;  1QOA A;  2O2V B;  4BAX A;  3DBS A;  3DVG X;  2JZ3 B;  2MBQ A;  3IXS A;  3APF A;  3H7P B;  3RD2 A;  3NG0 A;  2HJ8 A;  1UBI A;  1FCL A;  3PTF C;  3B9J A;  2CHZ A;  4MJS A;  4LNF A;  3A4R A;  4ZDV A;  2MJE A;  2I1K A;  1FNW A;  4YSX B;  1ET6 A;  2LRW A;  2MWS B;  2WYQ A;  4WQM A;  2RPQ A;  2WXL A;  1WGR A;  4MGY E;  1XT9 B;  4HDO A;  1LXD A;  1PYW D;  3ZLZ A;  4KKJ A;  2IPK D;  2PTL A;  2MQJ A;  4P1B C;  3PHX B;  2DAF A;  1EO6 A;  1F52 A;  3QA8 A;  5G55 A;  3NS8 A;  1C76 A;  2QCZ A;  1SF0 A;  1JML A;  1JCK B;  2CHW A;  1I4G A;  4JIO U;  1Q1O A;  1UBQ A;  4IWO A;  4K81 A;  3VH4 B;  2KDI A;  5IOI A;  2VRR B;  1WZ3 A;  3VUW A;  5C1Z A;  1N5W A;  1BML C;  1WRI A;  1ZKH A;  3JYU A;  4A90 A;  3UGB B;  2BYV E;  1ZDV A;  1QOF A;  3MTN B;  5AZH A;  1MHH E;  3PRM B;  1AWD A;  4MJS B;  3TIX A;  1YX6 B;  3VRA B;  5D3D A;  1JRP A;  1F9J A;  3RNF C;  2PJH A;  5GXG B;  4FHJ A;  5LXH A;  1DOI A;  3HRD D;  4E74 A;  1V1P B;  4WWM A;  3DBL I;  2VH2 A;  3A9K A;  2KVZ A;  3M63 B;  4JWS C;  2VH1 A;  1QIL A;  2GOW A;  1QT9 A;  2NR2 A;  4A6Q A;  3OLM D;  2ZZP B;  2DAJ A;  2BS4 B;  3W5V B;  1UWX A;  3A1Q A;  3U7D A;  1WX8 A;  4M00 A;  3PPA A;  3KLS X;  3BYT B;  4C4V A;  3IBE A;  2SEB D;  2D07 B;  1ZDX A;  4BOZ B;  2BYF A;  3NRZ A;  4REZ A;  1JRO A;  2WLB A;  1L5P A;  1TGZ B;  3AE9 B;  1D5M C;  3AEB B;  4F8C B;  3K9O B;  3P4P B;  3M95 A;  1WXQ A;  4DK5 A;  3HVD A;  5DCN A;  3IAM 1;  3BWU D;  2PLP A;  4K7W A;  2LD9 A;  1CMX B;  2KD0 A;  1P7E A;  2QJL A;  4XWW A;  2BTE A;  1ZGU B;  2ACZ B;  2NPT A;  3HVZ A;  2FCS A;  4C00 A;  3A9K B;  2JVC A;  3IG3 A;  2KWD A;  3J9C A;  4JX1 C;  2WXH A;  4PT5 A;  5EE3 A;  3ZDM C;  1KTK A;  3JSV A;  1GB1 A;  2JXX A;  2OHF A;  3LB8 C;  2X8X X;  1RFK A;  3A1Q B;  3R7Q A;  1FO4 A;  4II2 B;  2GMI C;  3RNC C;  2DLB A;  3V3X A;  3AE4 B;  2QMT A;  4PS8 A;  4YTM B;  2L83 A;  3DCG A;  3IT6 B;  5BYR A;  3WAO A;  3AEE B;  4NPN A;  4GLS C;  2ON8 A;  3R3M A;  1FXA A;  2FCN A;  2R61 A;  2BGF A;  2WXI A;  3VH3 B;  4NQK E;  3ZO5 B;  3QAQ A;  2W3R A;  1OFF A;  3VUY A;  1VZ8 A;  4WQO B;  2CJO A;  4MGI E;  2X38 A;  4AJY B;  3L17 A;  2N9X A;  3MJ5 A;  4WJP A;  2N9E B;  4HRS A;  4DHZ E;  3JSV B;  1WXM A;  4L23 A;  2KQ4 X;  1TY2 A;  1VR9 A;  4YL8 A;  2M1M A;  4PS3 A;  3ML9 A;  2PE6 B;  1RM6 C;  2VZK B;  2Y5P A;  2MX2 A;  1GNU A;  2DZI A;  2Y5C A;  1N63 A;  3PZD A;  2O6V D;  3V62 A;  1V5T A;  1ZOY B;  3JW0 X;  4N9F 4;  2KMM A;  1C1Y B;  1IPG A;  3VVW B;  4TQ1 A;  3DWG C;  3H6N A;  1SJE D;  2CS4 A;  3KYC D;  4ZRK A;  2DWQ A;  2WXK A;  3GZN B;  1XLN A;  5FKA C;  4GDK A;  1K50 A;  2D3B A;  4RMA A;  1IUE A;  4B95 A;  1FRD A;  2J52 A;  4C80 A;  2MLB A;  4O1N A;  1JQ4 A;  1S1Q B;  1C3T A;  3N9Y C;  4IOI E;  2KO3 A;  3RT3 B;  3VTW A;  2V4I B;  2WU2 B;  4US9 A;  4YT0 B;  4KDL B;  1DOX A;  2Y3A A;  1SE4 A;  3P4Q B;  2IGD A;  3PRP B;  3O13 A;  4ANW A;  4OHJ A;  2B3A A;  5LNK 1;  2BWF A;  2XNA C;  4XZ4 A;  4FA6 A;  2WXG A;  3ZJT A;  4YWG G;  3ETR A;  1EU4 A;  1TS2 A;  2ZCB A;  3V60 A;  2KJR A;  2RMM A;  3RNA C;  2K5P A;  2NMQ A;  4RH6 A;  4FJV B;  2MA9 B;  4GDK B;  3B1L X;  2WP9 B;  4BBN F;  1I35 A;  1WXS A;  3WA0 A;  4EOY A;  4L2Y A;  3VTU A;  2BYT A;  4M0W A;  3AEF B;  3RPF C;  4DWF A;  1MFW A;  3VRB B;  1HZ6 A;  2DZK A;  3KWV A;  2IO2 B;  1GUA B;  3E9S A;  1FNV A;  1XLO A;  3R8B A;  4G0N B;  2ASQ A;  3AE2 B;  1J7A A;  3AXC A;  2C7M B;  4EKU A;  2AEH A;  3AV8 A;  3UIN B;  4W9L A;  1N5X A;  1TBE A;  1WRD B;  3NS1 A;  1N61 A;  3I3T B;  3PS6 A;  3CMM B;  4ZRI A;  2WDR B;  4BZA A;  2HJ1 A;  2NBU A;  2WXR A;  3QJZ A;  4HKZ E;  2AL6 A;  3R66 C;  3RNE C;  2W3S A;  5TSS A;  5JZE B;  2KDB A;  4WWP A;  4EEW A;  1PGX A;  2RDG A;  4AP4 C;  1T0Y A;  4LTU A;  2CU3 A;  4I6L B;  3X0W A;  3PRZ A;  1WE7 A;  3Q8C A;  4ANV A;  1DOY A;  4RF0 A;  3GOE A;  5BMI A;  3TSS A;  2H88 B;  4G50 A;  2OED A;  2GI9 A;  4JL9 A;  4IM3 A;  3W2D A;  3SEB A;  5J17 A;  3VAW A;  1P98 A;  3AEA B;  3H9D A;  2WXJ A;  2FCM A;  1UWM A;  1UD7 A;  2BT6 A;  2JSV X;  2A5U A;  4NZL B;  3BK1 A;  1WGY A;  4P7I A;  5HI1 A;  1STE A;  4BVU C;  3PRE A;  5FR6 A;  3KUC B;  3N30 A;  1WM3 A;  1WX7 A;  1YJJ A;  3AH7 A;  2RD0 A;  4GXB A;  3AE3 B;  4KSK C;  1HXY D;  1L6U A;  2BBC A;  1N62 A;  1V1O A;  2KXJ A;  2SAK A;  4YSY B;  3TEY A;  2QIL A;  3IHP C;  4TUU A;  2DBY A;  3AE7 B;  4MH8 A;  3NVV A;  2JYE A;  2BW2 A;  2M56 B;  3DBL B;  5D2M B;  2ZNV C;  3Q3N C;  3OJ4 B;  2PW9 A;  3V6E B;  3ZNZ B;  2WX1 A;  3VHT C;  4JWU C;  5D94 A;  3NVY A;  3Q3M C;  1ET9 A;  3ZGZ A;  3QHT A;  4HPP A;  4NAM A;  3NZU A;  2REX A;  1SIF A;  2RSU A;  1HTQ A;  3N20 C;  4BOS C;  1ROE A;  4EFO A;  1TTN A;  3WAM A;  3QWZ B;  2LVQ A;  2KDM A;  2K6Q A;  3PLV A;  3Q8A A;  2FNJ B;  1Z5S B;  2KYW A;  3GZN I;  5C3J B;  2ZVO A;  1NEN B;  3VXW A;  3PZ8 A;  2DZJ A;  1G6J A;  1A5R A;  1P7F A;  4RM9 A;  2BWE S;  2I1J A;  4KZC A;  1J8C A;  2KWU B;  1EWY C;  2JZZ A;  1C79 A;  1MG4 A;  2IGH A;  3VTV A;  1MPE A;  4GGQ A;  4ZOH C;  2I38 A;  2GBR A;  1VJK A;  3Q3J A;  1NEK B;  4A3O A;  2QC8 A;  1JW9 D;  3A9J A;  5EE0 A;  4GSW A;  2K25 A;  2KAN A;  2ZW1 A;  3H1U A;  1DGJ A;  2E3T A;  1P1A A;  4RCO A;  2BQQ A;  3GP7 A;  4DQO C;  2WXO A;  3NUH B;  3JVZ X;  2M4N A;  5J2R A;  3RI7 C;  1FM0 D;  2RR9 A;  4W9K A;  1QOG A;  1XEE A;  3I5J C;  2L1A A;  1TY0 A;  1ZPS A;  4IDI A;  3I63 C;  1I7H A;  4MM3 A;  4FJY A;  3ZJV A;  1XCT L;  1WR6 E;  2PVG C;  4CYE A;  1EM7 A;  4C7Z A;  4OZB A;  4N58 A;  2GLS A;  2PMV A;  2N7E A;  3AE5 B;  5BO4 B;  4XC2 A;  3OWE B;  2K9X A;  3RUI B;  1E6E B;  1WWT A;  1T0R C;  3TEX A;  3A9J B;  1J0G A;  3QK0 A;  4HCN B;  1LQB A;  3AE1 B;  4Q2J A;  3BIN A;  3GE3 C;  3SU8 X;  2OJW A;  3PZ7 A;  2XK5 B;  4IG7 B;  2KFK A;  1RFA A;  2WDV B;  2N7D A;  2PPH A;  5IN7 A;  1GB4 A;  1C77 A;  1JWS D;  2KQ7 A;  1C4C A;  4EZL A;  2WNM A;  4RFB A;  3ZRF A;  1L0X B;  4MM3 B;  4EZJ A;  4RF1 A;  4KGS A;  3H7S A;  4XDC A;  5IKC M;  4KV2 A;  4DHZ B;  2MRP A;  3V05 A;  1E7P B;  2ONQ A;  5FK9 C;  1PGA A;  3V6C B;  2ZNV B;  1I4R A;  1SE9 A;  1E8Y A;  2IO3 B;  1L4Z B;  3DQV A;  2IZV B;  2BS3 B;  4MSQ B;  2BB6 A;  1Z2M A;  4TKN A;  3B0A A;  4BFR A;  1TKG A;  3ML8 A;  5I4D A;  3FAH A;  3CF6 E;  4IC7 B;  3ZNG C;  2ZW0 A;  4ICV A;  3QIJ A;  3UQA A;  3DBH I;  3A33 B;  2L0F A;  2D10 A;  5AZG A;  3P4R B;  1P3Q U;  2KFK B;  3EA6 A;  3UQB A;  4ANX A;  3PHW B;  4FJZ A;  2ZPN A;  4ASW C;  4IM0 A;  4LJP B;  2DZM A;  3ZYY X;  3ZVV A;  2KT7 A;  2BKR B;  1ZW7 A;  4URK A;  4W9G A;  3W1S A;  4ANU A;  2JRI B;  3QCA A;  3M3J A;  3I9V 1;  2IY1 B;  4PS7 A;  2V9H A;  3U2S C;  3AEG B;  1PGB A;  1E9M A;  1IYF A;  4PYZ A;  1WJU A;  2GBM A;  1ZE3 D;  5HHD G;  3T9L A;  2V3P A;  5EDS A;  1K51 A;  2Q5W D;  3Q14 C;  1VZ7 A;  3EFU A;  1E8W A;  1EF5 A;  1RRB A;  3MC8 A;  2WWZ A;  5E6P A;  1SGH A;  1FFV A;  4LNO A;  1ENF A;  2CKH B;  4DXA B;  1F0Z A;  1YQ3 B;  2WS3 B;  3Q8B A;  4IWP A;  5IP4 D;  3RN9 C;  1WE6 A;  3HK0 A;  3P2B A;  1F1H A;  1F77 A;  2PEA A;  5LXI B;  2KMC A;  1WF9 A;  2LWP A;  1MHX A;  2MBH A;  4LNI A;  4RGO S;  1YNT E;  3P4S B;  1TYG B;  3EFC A;  2KJ6 A;  1V86 A;  1GG3 A;  4WJQ A;  2I2Y A;  2LHD A;  3DOW A;  1UUP A;  1IBX A;  2B76 B;  2LGD A;  2K0P A;  2KX0 A;  2UYZ B;  4TMA B;  2RDB C;  4K3C A;  2PIA A;  4FAD A;  4WJN A;  1D3Z A; 
#chains in the Genus database with same CATH homology
 2HDE A;  2V4I B;  4NJC A;  1XLP A;  2WU2 B;  4US9 A;  4YT0 B;  1SSN A;  2WXM A;  4MT5 A;  1FRR A;  3ZQ4 A;  1C4A A;  3SFD B;  1BUI C;  1SE2 A;  2D5G A;  3ABV B;  3WCQ A;  2Y3A A;  1SE4 A;  1DOX A;  3P4Q B;  1UNS A;  2IGD A;  2LGI A;  3H8H A;  1TZO A;  3O13 A;  4OHJ A;  1DYQ A;  1V1P A;  1ZUD 2;  4LLG M;  5LNK 1;  2G9H D;  2XNA C;  2MEK A;  4H2A A;  2HTM E;  2W54 A;  2JX5 A;  3TEZ A;  1CQV A;  1I4Q A;  2WXG A;  3ZJT A;  4YWG G;  1GPX A;  1JWA D;  1E10 A;  3ETR A;  1EU3 A;  1KLG D;  1EU4 A;  1TS2 A;  3Q69 A;  2E6X A;  3BZD B;  3LXF A;  1WYG A;  1NYR A;  2RMM A;  3RFZ B;  2K5P A;  1JAL A;  2NMQ A;  1JWM D;  2WXN A;  4RH6 A;  1HZ5 A;  4HJG E;  5AUI A;  4GDK B;  2EEL A;  2WP9 B;  4IKG A;  1OQR A;  4KGT A;  3ZJU A;  1YJI A;  4L2Y A;  2LJI A;  2GRI A;  2TSS A;  5AUK A;  4KX6 B;  2BYT A;  1N60 A;  1BXT A;  2IJ0 A;  3AEF B;  4M0W A;  3RPF C;  2WXP A;  1Y56 A;  3B2F A;  1KF6 B;  1YN5 A;  1IBX B;  2N9L A;  3VRB B;  3IAS 1;  1HZ6 A;  4YSZ B;  5BMG A;  2QIE B;  3KWV A;  3E9S A;  1FNV A;  2JWU A;  1XLO A;  3R8B A;  3URY A;  5EE1 A;  3E56 A;  3AE2 B;  1J7A A;  3GS2 A;  4TQ0 A;  1IGD A;  3AV8 A;  1N5X A;  3PO0 A;  4ZRQ A;  5H92 C;  2LHE A;  2YEP F;  3NS1 A;  1N61 A;  1VDV A;  5G5G A;  3AEC B;  5MPO A;  2N7J A;  3T3O A;  1JWB D;  1SB3 C;  4DXF A;  2W55 A;  2WDR B;  1AN8 A;  5H8Y E;  2WXR A;  2WDQ B;  3P42 A;  4HKZ E;  4C56 C;  2NTS A;  1IGC A;  3NVW A;  1D5X C;  2V0G A;  2W3S A;  1ACC A;  5TSS A;  4KKI A;  1RWS A;  4B0M A;  1TS3 A;  1WGK A;  1HA5 A;  3VR8 B;  2M19 A;  1K53 A;  1PGX A;  2RDG A;  4HKQ A;  3IT4 B;  2DYO A;  1J7B A;  4LK0 M;  4LTU A;  2CU3 A;  3NZ3 A;  1XXG A;  3EUB 2;  1NI3 A;  1NVI D;  1UGJ A;  4UDU C;  2LUM A;  4ZYS A;  3R2I A;  1FCC C;  3TEW A;  2BS2 B;  3Q8C A;  1DOY A;  4RF0 A;  3BK2 A;  4N6E B;  2J42 A;  4ZHO A;  1HQR D;  5BMI A;  3B2G A;  3TSS A;  2FBW B;  2WXQ A;  2H88 B;  2OED A;  4ZRP A;  2GI9 A;  4XE0 A;  2IDY A;  2KAC A;  4YTN B;  3W2D A;  3SEB A;  1QQR A;  3AEA B;  4ITK A;  2WXJ A;  3VR9 B;  1SBB B;  2ICI A;  5BYS A;  1UWM A;  2NTT A;  4RGM A;  2BT6 A;  2JSV X;  1QOA A;  5E6J A;  4NZL B;  3BK1 A;  5HI1 A;  1STE A;  4YXD B;  3BVM A;  3IXS A;  3DWM A;  1FCL A;  1YJJ A;  3AH7 A;  1SEB D;  1T6B X;  1T5X D;  3B9J A;  1MVK A;  3AE3 B;  1PFD A;  5D7G A;  2MJE A;  4EE2 A;  1HXY D;  1L6U A;  2BBC A;  1N62 A;  1V1O A;  2SAK A;  4YSY B;  1FNW A;  3TEY A;  2QIL A;  4YSX B;  2DBY A;  1ET6 A;  3FIL A;  1LO5 D;  3AE7 B;  4MH8 A;  3NVV A;  2JYE A;  2K22 A;  2BW2 A;  2M56 B;  1CJE A;  4WQM A;  1QF6 A;  2WXL A;  2PW9 A;  4AS1 A;  3Q8F A;  3W5U B;  1PYW D;  4JWU C;  1F2R I;  4KKJ A;  3NVY A;  2IPK D;  1ET9 A;  2LEK A;  2PTL A;  3BYY B;  4P16 A;  3ZGZ A;  4NAM A;  2INP E;  4ARC A;  1KRH A;  4US8 A;  1C76 A;  2PVO D;  1SF0 A;  1JML A;  1ROE A;  1JCK B;  1I4G A;  3MC0 B;  2KDM A;  3AB5 A;  3Q8A A;  3NVZ A;  3AMZ A;  3LYY A;  5C3J B;  2LMC A;  1NEN B;  2AQ2 B;  4A55 A;  1AW7 A;  3PZ8 A;  2DYM A;  1P7F A;  1N5W A;  3W9C B;  1BML C;  1WRI A;  4OZA A;  1XCQ L;  3MHZ A;  1EWY C;  1JWU D;  4A90 A;  1C79 A;  2IGH A;  1MPE A;  1L0V B;  1ZDV A;  1QOF A;  4ZOH C;  1MHH E;  2I38 A;  1VJK A;  1FIQ A;  1K52 A;  1AWD A;  1B1Z A;  1NEK B;  3VRA B;  1T3Q A;  2RPV A;  5D3D A;  2MH7 A;  1JRP A;  1JW9 D;  5EE0 A;  4J3O D;  1ZP0 B;  4D2K A;  3FIL B;  5GXG B;  3R2T A;  4RGT A;  2KAJ A;  3TUO A;  1D5Z C;  2ZW1 A;  4CQN A;  1DOI A;  2WQY B;  3HRD D;  1DGJ A;  3BVZ A;  4ZHP A;  2E3T A;  2FUG 1;  5JXV A;  3HUI A;  1I4X A;  1V1P B;  1XF5 L;  4WWM A;  2YEP B;  4L1B A;  1E0Z A;  1GAQ B;  3GP7 A;  1SXT A;  2V3N A;  4RCO A;  1EWC A;  5BYQ A;  2JZP A;  5BMH A;  4DQO C;  4JWS C;  4GDL B;  3SFE B;  2G1E A;  1QIL A;  3SR6 A;  1QT9 A;  2WXO A;  3NUH B;  1WSP A;  2H89 B;  4JPS A;  4YTP B;  4A6Q A;  5T8I A;  3MFG A;  1QOB A;  2BS4 B;  3W5V B;  1FM0 D;  1UWX A;  2L32 A;  1QOG A;  1XEE A;  3AED B;  1VZ6 A;  4TSS A;  2L1A A;  1TY0 A;  1ZPS A;  3KLS X;  3BYT B;  4IDI A;  4ARI A;  1I7H A;  2QSD A;  2SEB D;  1ZDX A;  1KLU D;  1RYJ A;  2MJ3 A;  2AQ1 B;  3ZJV A;  4WH4 A;  1NYQ A;  1XCT L;  3NRZ A;  2PVG C;  4REZ A;  1J7C A;  1EM7 A;  1FEH A;  1JRO A;  2WLB A;  4N58 A;  4OZB A;  4C7Z A;  4C7Y A;  1L5P A;  3AE9 B;  2RDH A;  1D5M C;  2VZK D;  2PMV A;  3AEB B;  3AE5 B;  3OWE B;  1FXI A;  1D6E C;  1M4V A;  3P4P B;  3AE8 B;  3VQI A;  2K9X A;  4FXC A;  1E6E B;  1WWT A;  4WAF A;  2JYT A;  1WXQ A;  2QEJ C;  3TEX A;  3HVD A;  3P63 A;  3IAM 1;  4XWT A;  1CK1 A;  3BWU D;  3U52 E;  2MJD A;  2WU5 B;  2PLP A;  2N9K A;  3AE1 B;  4Q2J A;  1YMH E;  5HFY A;  3BII D;  1V8C A;  3PZ7 A;  4AQ7 A;  1P7E A;  2QJL A;  3EGR A;  4XWW A;  2AQ3 B;  2WDV B;  2BTE A;  1FD6 A;  3C8Y A;  3HVZ A;  2ACZ B;  1GB4 A;  4WUR A;  3J9C A;  2KWD A;  4JX1 C;  3CWI A;  1C77 A;  4KGR A;  1VRA B;  2WXH A;  4PT5 A;  2K3U A;  4HEA 1;  1JWS D;  5EE3 A;  5D3I B;  1QLB B;  1KTK A;  1C4C A;  1GB1 A;  3U4E G;  2OHF A;  4XDD A;  3LB8 C;  1YN3 A;  2WNM A;  5G5H A;  1RFK A;  4RFB A;  3UI3 A;  4B0E A;  1AYF A;  1B9R A;  2AX5 A;  3I57 A;  1L0X B;  1FO4 A;  4OZC A;  1ZXI A;  4MM3 B;  2DLB A;  3V3X A;  1CZP A;  4RF1 A;  4KGS A;  3AE4 B;  4XDC A;  5HG2 A;  2QMT A;  4YTM B;  3V05 A;  1E7P B;  2L83 A;  3IT6 B;  5BYR A;  2ONQ A;  1SJH D;  4NAW B;  1PGA A;  5FK9 C;  1I4P A;  3AEE B;  4USA A;  2EKI A;  4JE3 B;  4A9A A;  3AN1 A;  1C9F A;  2Z8L A;  3MP9 A;  1GOZ A;  2KN4 A;  1PUT A;  4GLS C;  1I4R A;  1L4Z B;  2ON8 A;  1TJE A;  2BS3 B;  2N0S B;  2BB6 A;  1FXA A;  1Q10 A;  4MAC A;  1SE3 A;  1TKG A;  2R61 A;  5I4D A;  2WXI A;  3FAH A;  4A8X C;  3Q8E A;  3CIR B;  1C78 A;  2ZW0 A;  2INN E;  2W3R A;  1R7S A;  1TKY A;  1TS4 A;  3KQ4 A;  1PDX A;  3P4R B;  1OFF A;  1VZ8 A;  1F2R C;  2CJO A;  4DXG A;  2CJN A;  2X38 A;  2BB5 A;  3EA6 A;  5FR3 A;  4HRO A;  1ESF A;  2JU6 X;  3MJ5 A;  1QKZ A;  1VLB A;  3ZYY X;  2XN9 C;  4HRS A;  1L6V A;  4L23 A;  3W1S A;  2KQ4 X;  1TY2 A;  1VR9 A;  3T3N A;  2J4X A;  4N59 A;  3I9V 1;  1KH0 A;  3GB1 A;  3U7Z A;  2IGG A;  1RM6 C;  3U2S C;  1XO3 A;  2VZK B;  2WXF A;  1PGB A;  2Y5P A;  1E9M A;  3AEG B;  1L0Y B;  2Y5C A;  1FMA D;  4RNA A;  1ZE3 D;  5HHD G;  2M0A A;  1YN4 A;  2V3P A;  1MI0 A;  1K51 A;  1N63 A;  2Q5W D;  1HEZ E;  2W82 A;  1VZ7 A;  5EE9 A;  1ZOY B;  1L4D B;  2KMM A;  1TKE A;  1C4P A;  4TQ1 A;  1FFV A;  3DWG C;  1FFU A;  1ENF A;  2JXT A;  4WIP A;  1A70 A;  1SJE D;  1ZXH A;  1F0Z A;  2DWQ A;  1YQ3 B;  2WS3 B;  1OQQ A;  2WXK A;  4P6V F;  1KFY B;  3Q8B A;  4RGN A;  1I4H A;  4R3D A;  1F77 A;  1XLN A;  5FKA C;  3FC4 A;  1YQ4 B;  1SIJ A;  1MHX A;  2FE8 A;  4RGO S;  1XLQ A;  1K50 A;  1YNT E;  3P4S B;  1TYG B;  1IUE A;  2PKO A;  2JQR B;  1FRD A;  2GB1 A;  2J52 A;  4OVZ A;  3BVG A;  2I2Y A;  2LHD A;  2J53 A;  1UUP A;  1IBX A;  2LFI A;  4C80 A;  2B76 B;  4O1N A;  1D4B A;  2K0P A;  3AM9 A;  1V97 A;  4TMA B;  1JQ4 A;  1FNU A;  3L4P A;  4OW0 A;  5C2T B;  3N9Y C;  2PIA A;  3KWL A;  3AE6 B;  2L52 A;  4IOI E;  1TS5 A;  3P1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...