2GRIA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2griA01
2GRIA 2M0AA 2IDYA
chains in the Genus database with same CATH superfamily
3JVZX 3AE1B 3EFCA 3W1SA 4HDOA 2M17A 3AEGB 5MPOA 3AU4A 4B0MA 1N60A 2PJHA 3AEEB 4QAYA 4MELA 1VJKA 1LO5D 1E8XA 2LZ6A 3W5VB 3SFDB 1BT0A 1V86A 4A3PA 2Y5PA 2E3TA 2OOBB 4NQKE 2V4IB 4HROA 2XBBC 4WURA 1FFUA 3UIPB 2WDQB 4NY0A 3BVMA 3QAQA 2D3AA 5AZHA 2V3NA 4GLSC 3LYYA 2K8CA 4E74A 2N9LA 2R2OA 5DPWA 2CJNA 3SU8X 2CJOA 4KDLB 4XDDA 1C9FA 3GB1A 3OLMD 1L6UA 3VH4B 4CHKA 5IA7A 1L4ZB 2C7HA 4IM2A 1WZ0A 3B2FA 1MI0A 4KGTA 4C4VB 1JW9D 4MSMB 4S0RA 2FNJB 1R4MB 2WX0A 3AH7A 4NJCA 4CO7A 3PV1A 2ZNVC 1FIQA 2DHZA 2JU6X 3UIOB 2KWDA 4ZRQA 3JW0X 3P4SB 3HVZA 3RI7C 2WXPA 4JIOU 4FJVB 1TBEA 2K8BA 4BOZB 5JHAA 2BKFA 2QHOA 3T3NA 1QT9A 3A9JB 2RD0A 2NCNA 1TS5A 3UF8A 2FUHB 4KSLC 1L0VB 2QC8A 2JUOA 4PT5A 1WGYA 4BBNC 4HCPB 4L1BA 1J7AA 1LGRA 1GG3A 4DDID 3WAOA 2AQ3B 2QSDA 2LRUA 3CWIA 4A6QA 2M56B 1UD7A 1I42A 1TKYA 3ZRFA 1ROEA 3APDA 4EKUA 1FNWA 2X8XX 4CQNA 3ENEA 4IKGA 4ZRJA 2CKHB 4C7ZA 1OQRA 3A1QB 1YOVB 1DYQA 3MJWA 4MDKE 5CHFA 3L13A 2N7EA 3Q8BA 1F2RC 3PHWB 1YNTE 2CU1A 4IWPA 2WU2B 2LASA 2ONQA 4RGTA 1K53A 1QF6A 3V62A 1S1QB 2MJ3A 2KLCA 2KC1A 2PTLA 1WZ3A 4F1SA 1KH0A 1SEBD 3CSTA 3NZSA 2N1WA 1YQ3B 1B1ZA 4GU2A 3KWVA 1EWCA 2K6QA 4XZ4A 3B9JA 4M0WA 4RNAA 1SE4A 1JCKB 1E10A 4L23A 2WDVB 2HJ1A 4FULA 1ZUD2 4D2KA 1Q1OA 3JSVA 2ZW0A 3MC9A 2XNAC 5CTRC 2EKEC 4P6VF 2KLGA 2I38A 4NJ7A 1I4RA 3EUB2 4B6WA 2NTTA 2LFIA 5IOIA 5BMIA 3L08A 3QWZB 3C19A 2QILA 3U4EG 2WXRA 4BKSA 1TT5B 2BGFA 2L52A 1OQYA 4M00A 1BXTA 3DOWA 3SD5A 1EWYC 4BOSC 1TJEA 2J42A 2LGXA 1T0RC 2YEPB 2KFJA 2LI5A 2MRPA 4LNKA 3PRZA 1L6VA 3PPAA 2ZJDA 4O1NA 1CQVA 3IXSA 1XLQA 2KMCA 3Q69A 4JGHB 4F8CB 1NENB 3H7PB 1F0ZA 1UELA 1J7CA 1NI2A 2BYTA 2X38A 3O65B 1V1PA 1WJNA 2J0KA 2JZPA 2IO1B 4LNOA 2IY0B 1KRHA 2KACA 2NR2A 3ZNGC 2GBMA 1L2NA 4YXDB 5KHQA 1WXAA 3AN1A 4GB9A 4WIPA 1VD2A 3IG3A 4RGOS 2N0SB 3EA6A 2MH7A 3RNFC 2N4FA 3AE9B 2FAZA 4HXDA 4ZOHC 3KUZA 2I2YA 1N62A 3NUHB 1J7BA 4RFBA 2K3UA 2EMTA 3ZUNA 2O6VB 4RCOA 3SR6A 3M95A 3AEFB 4C00A 3RYTA 1KF6B 4WJQA 1WJ4A 2IO2B 1KLUD 4WWMA 1OEYA 2KVRA 4LNNA 3WIMA 4JL9A 3DPDA 5AZFA 2GBRA 3DQVA 1YN3A 1WH3A 4GIVA 2BBCA 2KD0A 1ACCA 5G2NA 3SDLC 4ZYSA 3Q3NC 4K1RB 2A5UA 2D3CA 3D32A 1EUVB 2FCMA 2I1KA 2BYVE 1J8CA 2J0JA 1C78A 2QIEB 5J17A 4YSZB 2WDTB 1TZOA 3T8MA 4ZRPA 3V61A 1M4VA 3T3OA 4JQWC 1MPEA 4G11A 1Y56A 2OEDA 1AWDA 4HK2A 4REZA 1YJ1A 4BKGA 1WMHB 1T5XD 4GDLB 2REXA 1Z5SB 1RAXA 2QCZA 1WX8A 1OQQA 2NBUA 2V3PA 3TBLD 1QOAA 5BYRA 1WIAA 4I6NB 2MBQA 3FILA 4AJYB 3VR8B 2IDYA 1WGHA 4ZRKA 4TQ0A 5AUKA 1QLBB 4LJOB 2INNE 3ZNHB 4HPPA 1QOGA 2W54A 1QZEA 3AE5B 3WAPA 1UWXA 3M63B 2XK5A 4IWQA 2JZ3B 1YX6B 2IZVB 2LWPA 4ASWC 2RDHA 1QILA 1Q10A 4YL8A 4HVBA 3ECIA 4LLGM 1KOTA 5D94A 3I5JC 1UUPA 3NRZA 2ACZB 4GDKB 2AL3A 4LNFA 2D2QA 1V81A 1C4CA 4K7SA 5E6OA 5LXIB 2IGHA 3GE3C 1CJEA 1V80A 1OGWA 2YEPF 3A33B 4KX6B 5GMVA 4FA6A 1GUAB 1P0RA 2MBOA 4LTUA 4A55A 3TL5A 2J0MA 2C60A 1UBQA 4EOYA 4MM3A 1GAQB 3ML8A 4II2B 1HZ6A 4MSQB 3RUIB 1GPXA 3U30A 4ARIA 4JWSC 5G55A 5T8IA 1TTNA 3IAS1 2KKCA 2WXGA 3MFGA 4EUTA 5CHWA 2KMAA 1SBBB 3ZW3A 1EF5A 1I4HA 1LFDA 1QOFA 2K39A 4XWWA 3ZJVA 2LHDA 3NY5A 1C1YB 4MACA 2DENB 3AE7B 3OJ3A 2KTRA 2BF8B 2Y5CA 2LJIA 3TEZA 4EEWA 2KANA 2KYWA 4MEMA 1E5WA 2KDBA 3N1XC 5D6JB 2PIAA 1WF9A 1FEHA 3U7DA 3P4QB 2C7NB 4JWUC 2QJLA 1XD3B 1V8CA 3I63C 2G3QB 1ESFA 3EC8A 1HXYD 4FBJB 5G5GA 1FO4A 2DBYA 2SEBD 3N1YC 3HK0A 2N9KA 1F9JA 3ZTCA 3EGRA 3CIRB 3AM9A 3NZ3A 3W2DA 1D5XC 4ZYNA 1EU4A 3T9LA 1N61A 1D5ZC 4DHZE 3BK2A 2RDBC 2KX3A 2L8JA 3KH0A 1HTQA 1E7UA 1DOXA 1MHXA 3DCGA 2INCC 3CF6E 4YSXB 2BQQA 1NEKB 1TS2A 5EE9A 4KIKA 2PE6B 1P7EA 3DVGY 4MJSA 2LGIA 4W9LA 4YTPB 1I35A 3HHMA 2LD9A 3KYCD 1HZ5A 4AS1A 2W9NA 1V6EA 2WDRB 4WH4A 2RPVA 1V97A 4OVUA 1R4MI 1VZ6A 4ANWA 3PZ7A 4PS7A 5AZGA 3PS6A 1ET9A 1ET6A 3RPFC 2Q5WD 1KFYB 2K1FA 3N32A 4KDIC 4NAWA 1WGDA 3ZJUA 2DYBA 3A4RA 4IUMB 1T0SC 3PHXB 5C23A 3ZNID 3WAMA 1DGJA 1KLGD 3P63A 5IO9A 1Q0WB 3IT4B 3AE3B 4MGKE 1D3ZA 4FADA 2OJWA 5IP4D 3ZYYX 3L16A 2CHWA 4N6EB 3Q3JA 4PYZA 4YSYB 1IGCA 3MHZA 2TSSA 1K52A 2JF5A 2KVZA 1C77A 2HJ8A 3AE8B 1WYWB 2ZVOA 3HIZA 2M0AA 3RD2A 3ZJTA 5FR3A 3PVLA 5E6NA 2KHWB 2BB5A 2KWUB 3RNBC 2KZRA 1ISNA 3RNAC 1VDVA 4XDCA 3L54A 5DPRA 2MJDA 2DYMA 5BO4B 1IBXB 3O13A 1HQRD 5CX3A 2C5LC 4AP4C 1AW7A 1SE3A 4K3CA 4J6IA 2NPTB 1ZXHA 1P1AA 4IDIA 3P1MA 4BKSD 4DWFA 2K0PA 1YJJA 1TKGA 2WXJA 2G4DB 2WXLA 1TGZB 2HE7A 5FK9C 3PRMB 4A3OA 3RULA 2MWSB 2XN9C 2VZKB 1I4QA 2D3GA 1SJHD 1ZXIA 3QARA 2WQYB 2KJRA 3NVVA 1ZPSA 2JXTA 4A90A 5GXGB 3DWMA 5H92C 2MHJA 1XLNA 4FHKA 1J19A 3E9SA 2OHFA 2BKRB 3QQ8B 2L83A 2IPKD 4W9JA 2YVCA 1ZOYB 3I57A 1WJUA 3GOEA 4MT5A 1WGGA 3UQBA 2RGFA 4PYUA 1AARA 2LGDA 3WALA 1VR9A 4KZ0A 4KKIA 1VRAB 1TIFA 1JWMD 2ASQA 3N30A 2JSVX 3FC4A 1H4RA 1WRIA 2BPSA 3VAWA 3W9CB 3TJPA 4HEA1 4C80A 4US8A 2MA9B 1YN4A 3IAM1 4NZLB 1V2YA 3PT2B 3QCAA 3AV8A 4USAA 3P4PB 1H8CA 3BYYB 3QC8B 3VVWB 2MEKA 1P9DU 3ABVB 2WWZA 2G45B 1Z2MA 3UQAA 2N9PC 2MBBB 4XGAB 4IW0A 4WQMA 3W1YA 1NYQA 4GXBA 2D3BA 2IJ0A 1V9JA 1R4NI 2NS5A 2AYOB 3V6CB 1GNUA 1WXMA 3H6NA 2MCNB 2WLBA 2HTME 3N1ZC 3AEAB 3DWGC 1IYFA 2H88B 2MP2A 1FRDA 5D2MB 3ZKJC 3TSSA 3ETRA 3Q8AA 3KUDB 2G9HD 1PFDA 2LGYA 5C1ZA 1PUTA 2IBIB 2QDFA 5DPSA 3EFUA 1SGHA 2LGSA 4PS8A 1S3SG 3H1UA 5KHOA 3V60A 2PVGC 1EM7A 1L0YB 2RSUA 3AEBB 1TS3A 1PGXA 4HCNB 3ZGZA 3IFWB 2AL6A 4EE2A 1RFKA 1D5MC 4MH0E 2WXNA 1WJ6A 5AEKB 4E3CA 4HPLB 1ZW7A 2MBHA 3KVFB 4HLEA 5IN7A 3DVGX 4WJNA 4ITKA 4OHJA 1R4NB 1GB4A 2W82A 4JPSA 3MC8A 2PW9A 2ZW1A 3U8ZA 1JRPA 3R2TA 3Q3OC 3SFEB 4BBNF 2KFKA 2DLBA 3LDZE 3PREA 2BT6A 1SF0A 3DBHB 3BVZA 4RF1A 3AXCA 1N6ZA 2WYQA 4FXCA 4HKZE 3GZNI 2PKOA 4HJKA 2L7RA 4WAFA 2G4SA 3RZWC 2RPQA 1JWAD 3VTWA 2C7MB 1V49A 4W9GA 3OJ4B 1QKZA 3Q3FA 2FIFA 3UINB 5L83A 3ZRCA 1CMXB 3TCAA 3WA0A 2B76B 2KNBA 2KWCA 2J4XA 4KKJA 3TUOA 2N7JA 5BMHA 4S17A 3X0WA 3NG0A 1FM0D 4A20A 4EZLA 3DBRI 2ON8A 3NJTA 3RCZA 3U7ZA 4BZAA 2NMQA 1UBIA 1YD8U 3GS2A 2MQJA 1L4DB 2K8HA 2PEAA 4IC7B 5IAAC 4BFRA 2CU3A 4NNJB 1DOIA 2AQ2B 2M0XA 3P42A 4II3B 1UGMA 4BKTA 2QMTA 3KWLA 3RT3B 3GZNB 2LHEA 2AQ1B 4ZHOA 2PLPA 1YMHE 3IHPC 4M0WB 3A9KA 5LLIA 3M62B 1HEZE 1I4PA 4KV2A 3JSVB 4ANUA 2AEHA 3DVNV 5TSSA 2CHXA 2WNMA 1NI3A 4NAMA 2KOXA 1MHHE 5BYQA 2FUG1 2FCQA 5HI1A 4M8NA 5LNK1 2VZKD 2KK8A 4W9DA 3PO0A 3VH3B 4LDTB 1FPYA 1Y8RC 3DBRB 2V1YA 3DHGC 1QOBA 2LUEA 3QHTA 1I4XA 3QK0A 1FXIA 1WSPA 2IO0B 3PZDA 4KZCA 3URYA 4B0EA 1FXTB 3VQIA 2FCSA 2UU7A 2KDMA 3B2GA 2UWQA 4W9FA 3ZLZA 2NBWB 1JWUD 2GBKA 1E90A 1STEA 4HKQA 3AMZA 2O2VA 4BAXA 2MX2A 2GI9A 1TZ1A 1FD6A 2JXXA 2AX5A 3LXFA 2M8SA 2RMMA 2R61A 1V1PB 2BVCA 3TIXA 1SE2A 5JXVA 4A9AA 3PZ8A 3QA8A 3ZNZB 2VH1A 3NS8A 1XXGA 4NQLB 3DDCB 4H2AA 3VRBB 2EMSA 5D3DA 2KQSA 1B9RA 1V1OA 4I6LB 4E71A 3TEXA 2DAFA 1SE9A 4DXAB 1WXSA 3V6EB 5HFYA 1XT9B 3PLUA 1C79A 1E8ZA 4ICVA 3ONSA 1TY2A 1RYJA 3L4PA 3WANA 1FRRA 3NOBA 3L17A 4W9HA 3PSEB 4OVVA 2JQRB 3NVYA 3ZIMA 2PVOD 4HPMB 1ZKHA 1XLOA 4URKA 2M19A 2LMCA 3AE2B 4P1CC 2BYEA 3TEYA 3OWEB 3GE8C 4FHJA 2OJRA 2Z0DB 1RFAA 1HTOA 1BMLC 3AE6B 2PPHA 5E6JA 1BUIC 2WX1A 2GBNA 3V05A 2HDEA 4MGYE 3EHVA 4M01A 2GOWA 1XQQA 1WYGA 1D4BA 3KYDD 1UGJA 3AULA 4CYEA 4UDUC 1SIJA 3BWUD 3B1LX 3PLVA 1AYFA 1QQRA 3DBSA 3RZFA 1CK1A 1JQ4A 4C4VA 3DHIC 2W3RA 2N9EB 4W9CA 3I3TB 4LCDE 4TKNA 2KJ6A 1XCQL 3KW5B 3ZO5B 4IM3A 5HHDG 3FILB 2WXOA 4DXGA 4IWOA 1IUEA 2KDFB 2D11A 4RH6A 1A70A 2CR5A 3A9JA 4MGIE 4TQ1A 1V5TA 4FJZA 3DHHC 4AOFA 1XCTL 2XK5B 2FIDA 2L00B 2SAKA 3VR9B 4HJGE 3ZDTA 1JMLA 5FR6A 2WXIA 4N58A 4ANVA 1P7FA 3UI3A 2HD5B 4RMAA 3VDZA 2XEWA 5C3JB 2GLSA 3HM3A 1T0YA 1UZXB 2KMMA 1L7YA 1RLFA 1HA5A 4FJYA 4HDQA 3NZUA 2BB6A 2LEKA 4ZRIA 3VFKA 2C9WB 3MC0B 4IOIE 2K25A 1YQBA 3A1QA 3DBLI 1RRBA 2NBVB 1MG8A 2KTFA 3OAWA 4LJPB 2WXMA 4EFOA 3IBEA 3HUIA 3KLSX 4MM3B 2H89B 3ZTDA 3CMMB 3U2SC 1OTRB 4DBGA 2KDIA 2BW2A 1IGDA 4TUUA 4MGZE 1F52A 2ZNVB 1XO3A 1SXTA 4DK5A 2DZJA 3CSFA 1F2RI 3R7RA 1VZ7A 1SB3C 2Z0EB 1SIFA 4AQ7A 3WCQA 1YJIA 3A4SC 4JLCA 1E8WA 3B08A 4HWIB 1ZDVA 2KTRB 3RNCC 1SSNA 1OFFA 2D10A 1PGBA 1IPGA 4ICUA 4K7WA 2L32A 2VRRB 3VUWA 1VLBA 5EE0A 4LDTD 3DBLB 3I9V1 1WR1A 1C3TA 4OZAA 1YN5A 3KQ4A 1EU3A 4ACFA 1JWSD 1JROA 4TMAB 3SHQA 1U4AA 3Q3MC 3C8YA 3W5UB 1JWBD 3MJ5A 2JYTA 4OZCA 1WXQA 1LM8B 1M94A 2ZPYA 1PDXA 5BYSA 2IYDB 2JT4B 3ZQ4A 3Q14C 2J53A 1V5OA 4RGMA 1GC6A 4PS3A 2KDEB 2WS3B 3VTUA 3H7PA 4P7IA 2WXKA 4DHJD 4C7YA 1WGKA 1NDDA 1WX7A 2I1JA 2WP9B 4GOCA 2N9XA 5JHBA 3C0RB 2FCNA 4TV3A 3NS1A 5TR5A 2LVPA 1C4AA 4RGNA 2RDGA 3MTNB 4NPNA 2GB1A 1FMAD 3Q8CA 4US9A 4YT0B 3JYUA 4W9EA 4TSSA 1MJDA 4KIKB 2M4NA 3PTFC 4OW0A 1AN8A 3AECB 2LVQA 3RNEC 3NVWA 3E56A 1WRDB 1MFWA 3MP9A 4K3BA 4MJSB 1I4GA 2O6VA 3Q6BA 1KLVA 1RM6C 4OVZA 1WWTA 4FN2A 1T6BX 1UWMA 2IGDA 2UYZB 2V0GA 4P16A 3LB8C 3TMPB 4MH8A 5EE3A 1E6EB 2KAJA 4NAWB 4WJPA 3Q2AC 3KUCB 4JX1C 3GP7A 3UGBB 3ZDMC 2G1EA 1D6EC 1FNVA 2DX5B 4I6PA 2D07B 3DBHI 1XLPA 1PQSA 1P98A 1FFVA 2BS2B 3U52E 2KQ7A 1VCBA 1YIWA 2GBJA 1PYWD 2INPE 4XC2A 3K9PB 1WE7A 2LRWA 4ZDVA 2MSED 4GMVA 3R8BA 4KGSA 4EZJA 2EKIA 1WMHA 3ALBA 2KWVB 4GDLA 5H8YE 4NJ6A 3VTVA 5LXHA 3W1SC 1WM3A 2L05A 3L10B 4JE3B 1TKEA 3VRAB 4OZBA 3AU5A 2LUMA 4EZKA 3APFA 3FKYA 4RF0A 3NVZA 2Y5BB 2JWZA 1A5RA 1LQBA 2WXHA 5D7GA 2JZZA 1JALA 5FKAC 3BK1A 3IVFA 2DZKA 1K8RB 2W55A 1WFYA 2Z8LA 1UNSA 2JWUA 4WWNA 3BINA 4ARCA 2J52A 1J0GA 1WM2A 2PMVA 4L2YA 3BVGA 2D5GA 1WR6E 2V3SA 3LJ3A 4GDKA 3M3JA 2BTEA 1YQ4B 2KT7A 3PRPB 2J7QB 4ANXA 5E6PA 2L3ZA 3Q8FA 5DCNA 3RNGC 1WE6A 3ZVVA 3R2IA 4RM8A 2ICIA 3P2BA 2Y3AA 3N20C 2DNFA 2MW5A 3R3MA 4GSWA 1XF5L 1KM7A 2LXAA 4BVUC 3EECA 2E6XA 2L76A 2LVOA 3QIJA 1ZE3D 4DHZB 1Q5WB 1GOZA 5C2TB 2NVUI 3VXWA 3SEBA 3V3XA 2WXFA 1G6JA 2ZZPB 4B95A 1WGRA 5D3IB 1E0ZA 4WQOB 4N59A 3H8HA 4K81A 4KSKC 2WU5B 2MLBA 2K22A 2MP2B 1DOYA 1WXVA 2JRIB 5EE1A 1UF0A 4GGQA 4R3DA 1E8YA 3OG5A 4IG7B 3L0WB 1E9MA 1R7SA 1ZGUB 4M8MA 4WWOA 1NYRA 3H7SA 1FCLA 4YTMB 4WWPA 3QX1A 2DZIA 2W3SA 3MHSD 1F77A 1MVKA 2A4ZA 2MBEA 2KC2A 1SJED 3BYTB 4N9F4 3ML9A 1C4PA 4FLHA 1GJZA 2KN5A 4XE0A 4X57B 4XYCA 3N3KB 3R7QA 2L1AA 4DDGD 1I7HA 5J18A 1VZ8A 2ZCCA 2WGSA 2RR9A 5J2RA 4LNIA 3VHTC 2B3AA 4KGRA 2N1VA 3BY4B 2FE8A 3DVNU 3RN9C 4B9KA 2KFKB 5IKCM 1X1MA 1TYGB 5L95C 2V9HA 2QEJC 3AE4B 1T3QA 5JH5C 4LK0M 2JRHA 2JYEA 1K50A 4F7ZA 4DHJB 1F1HA 2WXQA 1JRUA 3VUYA 4XWTA 3ZXRA 1XEEA 4WJOA 3HVDA 5HG2A 3HM6X 2MJEA 5CHVC 2INDC 1N63A 2LJ5A 1ENFA 2ZVNA 2BWFA 5BMGA 1WX9A 4G50A 1UH6A 2KJHB 1ZP0B 3S2AA 2IGGA 5AUIA 2JX5A 3RMKC 2ZPNA 2YLMA 2R2QA 2KX0A 4WAAA 1ZDXA 4AUQC 1PGAA 2KN4A 4AWJA 3PGEA 1C76A 2LXCA 4ZHPA 2KXJA 2FBWB 4KVGB 3B0AA 2BWES 2JPHA 3AEDB 3AI5A 1N5XA 4A8XC 4W9IA 3H9DA 3VUXA 1CZPA 4GN1A 2WHIA 1YX5B 2ZCBA 4IM0A 1KTKA 2JVCA 3A9KB 2L0FA 3HRDD 3Q8EA 1TY0A 1KJTA 4P1BC 4HRSA 2BYFA 1IBXA 4PK1A 5G5HA 1FCCC 1FNUA 1NVID 1L5PA 2NPTA 2K6DB 4Q2JA 4G0NB 1EF1A 4RM9A 3TEWA 4M02A 1GB1A 2CS4A 3K9OB 2ZEQA 3BZDB 1E7PB 2DWQA 1OEYJ 2JY6A 4C56C 1E7VA 2IO3B 5I4DA 2DAJA 3APCA 1LXDA 5HKHA 3J9CA 3X23A 2BS4B 5DPTA 3RFZB 2GMIC 5JZEB 4XX5A 1T0QC 1WY8A 3IT6B 4DXFA 2L0TA 2NTSA 4DQOC 2AWTA 2Z59B 1L0XB 2HTHA 2DZMA 1WI0A 1TS4A 1N5WA 3P4RB 1P3QU 4K7UA 2CHZA 2V4LA 2PE9A 3ZXVA 2VH2A 2O2VB 2K5PA 1MG4A 2IY1B 1NBFC 5EDSA 1RWSA 4W9KA 1FXAA 2EELA 2M1MA 4AJWA 3AB5A 3FAHA 2N7DA 3BIID 3QJZA 1GC7A 4J3OD 2K9XA 2KQ4X 2DYOA 1EO6A 3N9YC 1IP9A 4YTNB 3R66C 1HE8A 2BS3B 2KO3A 2O6VD 3NHEB 4G3XB 1K51A 4YWGG 2GRIA
chains in the Genus database with same CATH topology
3AE1B 2B76B 3W1SA 1RM6C 2J4XA 4OVZA 1GAQB 1WWTA 1HZ6A 4KKJA 1T6BX 3TUOA 2N7JA 3AEGB 5BMHA 1UWMA 1GPXA 2IGDA 5MPOA 4ARIA 4JWSC 4B0MA 4P16A 2V0GA 5T8IA 1N60A 3LB8C 3AEEB 1FM0D 3IAS1 4MH8A 2ON8A 5EE3A 2WXGA 3MFGA 1VJKA 3U7ZA 1LO5D 2NMQA 1E6EB 2KAJA 4NAWB 3W5VB 3SFDB 1SBBB 4JX1C 3GS2A 3GP7A 2G1EA 2Y5PA 1L4DB 1D6EC 1FNVA 1I4HA 2E3TA 1QOFA 2CU3A 2V4IB 4HROA 4XWWA 1DOIA 3ZJVA 1XLPA 4WURA 2LHDA 1FFVA 2AQ2B 1FFUA 3P42A 2BS2B 2QMTA 4MACA 2WDQB 3KWLA 3U52E 2LHEA 2AQ1B 3AE7B 3BVMA 4ZHOA 2PLPA 1YMHE 1PYWD 2Y5CA 2INPE 2LJIA 2V3NA 4GLSC 3TEZA 3LYYA 1HEZE 1I4PA 2N9LA 3R8BA 2CJNA 4KGSA 2CJOA 5TSSA 4XDDA 1C9FA 3GB1A 1L6UA 2PIAA 2EKIA 1L4ZB 2WNMA 1FEHA 1NI3A 4NAMA 3P4QB 5H8YE 1MHHE 4JE3B 3B2FA 5BYQA 4JWUC 1MI0A 1TKEA 3VRAB 2FUG1 2QJLA 4KGTA 5HI1A 5LNK1 1V8CA 1JW9D 2VZKD 4OZBA 2LUMA 3PO0A 1ESFA 1HXYD 3AH7A 4RF0A 5G5GA 1FO4A 4NJCA 2DBYA 3NVZA 2SEBD 1QOBA 2N9KA 1FIQA 2JU6X 2KWDA 4ZRQA 2WXHA 3EGRA 3CIRB 3HVZA 3P4SB 3AM9A 5D7GA 2WXPA 3NZ3A 1JALA 3W2DA 1D5XC 3BK1A 5FKAC 1I4XA 1EU4A 1FXIA 1WSPA 2W55A 4B0EA 3URYA 2Z8LA 3VQIA 1N61A 1UNSA 1D5ZC 2JWUA 3BK2A 3T3NA 2KDMA 3B2GA 4ARCA 1QT9A 1TS5A 1JWUD 2J52A 1DOXA 4L2YA 2PMVA 3BVGA 1STEA 2D5GA 4HKQA 3AMZA 1L0VB 1MHXA 2GI9A 1FD6A 4PT5A 2BTEA 2AX5A 1YQ4B 4L1BA 1J7AA 3LXFA 2RMMA 2R61A 1V1PB 1SE2A 5JXVA 4YSXB 4A9AA 3PZ8A 3Q8FA 2AQ3B 1NEKB 1TS2A 2QSDA 1XXGA 5EE9A 4H2AA 3CWIA 3VRBB 4A6QA 3R2IA 1P7EA 2M56B 5D3DA 1TKYA 2LGIA 2ICIA 1B9RA 1V1OA 4YTPB 1ROEA 3TEXA 2Y3AA 4AS1A 1FNWA 1HZ5A 4CQNA 4IKGA 5HFYA 4C7ZA 1C79A 1OQRA 2WDRB 1DYQA 2RPVA 4WH4A 1V97A 1TY2A 1RYJA 3L4PA 1VZ6A 1FRRA 1XF5L 3PZ7A 2JQRB 3Q8BA 1ET9A 1ET6A 3NVYA 1F2RC 2Q5WD 3RPFC 1YNTE 2E6XA 1KFYB 2PVOD 1XLOA 2WU2B 2ONQA 1ZE3D 3ZJUA 4RGTA 2M19A 1K53A 2LMCA 3AE2B 1QF6A 1GOZA 5C2TB 3SEBA 3V3XA 2WXFA 2MJ3A 1DGJA 1KLGD 3P63A 2PTLA 3TEYA 1KH0A 3OWEB 1SEBD 3IT4B 3AE3B 5D3IB 1E0ZA 3ZYYX 1YQ3B 4N59A 1B1ZA 3H8HA 1BMLC 3KWVA 1EWCA 3AE6B 4N6EB 2WU5B 2K22A 3B9JA 4YSYB 1DOYA 4M0WA 1IGCA 2TSSA 3MHZA 1K52A 1SE4A 1BUIC 4RNAA 1JCKB 5E6JA 5EE1A 1E10A 1C77A 4L23A 2WDVB 3AE8B 3V05A 2HDEA 2M0AA 1ZUD2 4D2KA 4R3DA 3ZJTA 1WYGA 5FR3A 1D4BA 2BB5A 2ZW0A 2XNAC 1UGJA 1E9MA 4P6VF 1R7SA 4UDUC 1VDVA 1SIJA 4XDCA 2I38A 1I4RA 3EUB2 1NYRA 2NTTA 2MJDA 3BWUD 2DYMA 2LFIA 1FCLA 1AYFA 1QQRA 4YTMB 3O13A 1IBXB 1CK1A 1JQ4A 1HQRD 5BMIA 2W3SA 1F77A 1MVKA 2W3RA 1AW7A 1SE3A 1ZXHA 2QILA 4IDIA 1SJED 3P1MA 3BYTB 3U4EG 2WXRA 1C4PA 2K0PA 1YJJA 1TKGA 1XCQL 2WXJA 2WXLA 4XE0A 5HHDG 2L52A 3FILB 2WXOA 5FK9C 4DXGA 1BXTA 2XN9C 2VZKB 1I4QA 1EWYC 2L1AA 1IUEA 1SJHD 1I7HA 1TJEA 1ZXIA 4RH6A 1VZ8A 2J42A 1A70A 2WQYB 3NVVA 1ZPSA 2JXTA 4A90A 2YEPB 5GXGB 3DWMA 4TQ1A 1L6VA 4KGRA 5H92C 1XLNA 4O1NA 1CQVA 2FE8A 3IXSA 1XCTL 3E9SA 1XLQA 2OHFA 3Q69A 2SAKA 3VR9B 1NENB 2L83A 2IPKD 1JMLA 4HJGE 1F0ZA 1TYGB 2WXIA 1J7CA 4N58A 2BYTA 2X38A 2QEJC 3AE4B 1V1PA 1T3QA 2JZPA 4LK0M 1P7FA 3UI3A 2JYEA 1K50A 1KRHA 1ZOYB 2KACA 3I57A 5C3JB 4YXDB 2WXQA 4XWTA 4MT5A 1XEEA 1VR9A 2KMMA 3HVDA 4KKIA 1VRAB 5HG2A 3AN1A 1JWMD 1HA5A 2BB6A 4WIPA 2LEKA 2MJEA 4RGOS 2JSVX 2N0SB 3EA6A 3FC4A 2MH7A 1WRIA 3MC0B 4IOIE 3AE9B 4ZOHC 3W9CB 2I2YA 4HEA1 1N62A 4C80A 4US8A 3NUHB 1J7BA 1YN4A 4RFBA 1N63A 3IAM1 4NZLB 2WXMA 2K3UA 4RCOA 1ENFA 5BMGA 3AV8A 4USAA 3P4PB 3SR6A 3BYYB 2MEKA 3AEFB 1KF6B 3ABVB 3KLSX 3HUIA 1ZP0B 4MM3B 2H89B 2IGGA 5AUIA 1KLUD 2JX5A 4WWMA 3U2SC 4WQMA 1ZDXA 2KN4A 1PGAA 1NYQA 2IJ0A 1C76A 2BW2A 1IGDA 1YN3A 2BBCA 4ZHPA 1XO3A 1SXTA 1ACCA 2FBWB 2WLBA 1F2RI 1VZ7A 4ZYSA 1SB3C 2HTME 3AEAB 3DWGC 3AEDB 2H88B 1FRDA 4AQ7A 1N5XA 3WCQA 4A8XC 3TSSA 1YJIA 1CZPA 3ETRA 3Q8AA 1C78A 2QIEB 2G9HD 1PFDA 1KTKA 4YSZB 1ZDVA 1TZOA 1PUTA 1SSNA 4ZRPA 1OFFA 1M4VA 1PGBA 3T3OA 3HRDD 2L32A 3Q8EA 1MPEA 1TY0A 2PVGC 1EM7A 1Y56A 2OEDA 1L0YB 1VLBA 4HRSA 1AWDA 5EE0A 1IBXA 3AEBB 1TS3A 5G5HA 1FCCC 1PGXA 3ZGZA 3I9V1 4REZA 1FNUA 1NVID 1L5PA 4EE2A 1T5XD 1RFKA 4GDLB 4OZAA 1YN5A 3KQ4A 4Q2JA 3TEWA 1D5MC 1EU3A 1GB1A 1OQQA 1JWSD 2V3PA 1QOAA 1JROA 3BZDB 4TMAB 5BYRA 1E7PB 2WXNA 3C8YA 3W5UB 1JWBD 3MJ5A 3FILA 3VR8B 2IDYA 2DWQA 4C56C 2JYTA 5AUKA 4TQ0A 1QLBB 4OZCA 1WXQA 5I4DA 1PDXA 5BYSA 2INNE 1QOGA 3J9CA 4ITKA 2W54A 2BS4B 3ZQ4A 4OHJA 2J53A 1GB4A 2W82A 3RFZB 4JPSA 4RGMA 3AE5B 2PW9A 2ZW1A 1JRPA 1UWXA 3IT6B 4DXFA 3R2TA 2WS3B 3SFEB 2NTSA 4DQOC 2DLBA 1L0XB 2BT6A 2RDHA 1SF0A 1QILA 1N5WA 1TS4A 3BVZA 1Q10A 3P4RB 2WXKA 4RF1A 4C7YA 4LLGM 1WGKA 2WP9B 4FXCA 1UUPA 4HKZE 3NRZA 2ACZB 2K5PA 2PKOA 4GDKB 4WAFA 1RWSA 3NS1A 1FXAA 1JWAD 1C4AA 2EELA 4RGNA 1C4CA 2RDGA 3AB5A 3FAHA 2GB1A 1FMAD 3BIID 4J3OD 3Q8CA 2IGHA 4US9A 4YT0B 1CJEA 4TSSA 2K9XA 2KQ4X 2DYOA 2YEPF 3N9YC 4KX6B 4OW0A 1AN8A 4YTNB 3AECB 2BS3B 3NVWA 3E56A 3MP9A 4LTUA 1QKZA 4A55A 1I4GA 1K51A 4YWGG 2GRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRI A;  2M0A A;  2IDY A; 
#chains in the Genus database with same CATH topology
 3JVZ X;  3AE1 B;  3EFC A;  3W1S A;  4HDO A;  2M17 A;  3AEG B;  5MPO A;  3AU4 A;  4B0M A;  1N60 A;  2PJH A;  3AEE B;  4QAY A;  4MEL A;  1VJK A;  1LO5 D;  1E8X A;  2LZ6 A;  3W5V B;  3SFD B;  1BT0 A;  1V86 A;  4A3P A;  2Y5P A;  2E3T A;  2OOB B;  4NQK E;  2V4I B;  4HRO A;  2XBB C;  4WUR A;  1FFU A;  3UIP B;  2WDQ B;  4NY0 A;  3BVM A;  3QAQ A;  2D3A A;  5AZH A;  2V3N A;  4GLS C;  3LYY A;  2K8C A;  4E74 A;  2N9L A;  2R2O A;  5DPW A;  2CJN A;  3SU8 X;  2CJO A;  4KDL B;  4XDD A;  1C9F A;  3GB1 A;  3OLM D;  1L6U A;  3VH4 B;  4CHK A;  5IA7 A;  1L4Z B;  2C7H A;  4IM2 A;  1WZ0 A;  3B2F A;  1MI0 A;  4KGT A;  4C4V B;  1JW9 D;  4MSM B;  4S0R A;  2FNJ B;  1R4M B;  2WX0 A;  3AH7 A;  4NJC A;  4CO7 A;  3PV1 A;  2ZNV C;  1FIQ A;  2DHZ A;  2JU6 X;  3UIO B;  2KWD A;  4ZRQ A;  3JW0 X;  3P4S B;  3HVZ A;  3RI7 C;  2WXP A;  4JIO U;  4FJV B;  1TBE A;  2K8B A;  4BOZ B;  5JHA A;  2BKF A;  2QHO A;  3T3N A;  1QT9 A;  3A9J B;  2RD0 A;  2NCN A;  1TS5 A;  3UF8 A;  2FUH B;  4KSL C;  1L0V B;  2QC8 A;  2JUO A;  4PT5 A;  1WGY A;  4BBN C;  4HCP B;  4L1B A;  1J7A A;  1LGR A;  1GG3 A;  4DDI D;  3WAO A;  2AQ3 B;  2QSD A;  2LRU A;  3CWI A;  4A6Q A;  2M56 B;  1UD7 A;  1I42 A;  1TKY A;  3ZRF A;  1ROE A;  3APD A;  4EKU A;  1FNW A;  2X8X X;  4CQN A;  3ENE A;  4IKG A;  4ZRJ A;  2CKH B;  4C7Z A;  1OQR A;  3A1Q B;  1YOV B;  1DYQ A;  3MJW A;  4MDK E;  5CHF A;  3L13 A;  2N7E A;  3Q8B A;  1F2R C;  3PHW B;  1YNT E;  2CU1 A;  4IWP A;  2WU2 B;  2LAS A;  2ONQ A;  4RGT A;  1K53 A;  1QF6 A;  3V62 A;  1S1Q B;  2MJ3 A;  2KLC A;  2KC1 A;  2PTL A;  1WZ3 A;  4F1S A;  1KH0 A;  1SEB D;  3CST A;  3NZS A;  2N1W A;  1YQ3 B;  1B1Z A;  4GU2 A;  3KWV A;  1EWC A;  2K6Q A;  4XZ4 A;  3B9J A;  4M0W A;  4RNA A;  1SE4 A;  1JCK B;  1E10 A;  4L23 A;  2WDV B;  2HJ1 A;  4FUL A;  1ZUD 2;  4D2K A;  1Q1O A;  3JSV A;  2ZW0 A;  3MC9 A;  2XNA C;  5CTR C;  2EKE C;  4P6V F;  2KLG A;  2I38 A;  4NJ7 A;  1I4R A;  3EUB 2;  4B6W A;  2NTT A;  2LFI A;  5IOI A;  5BMI A;  3L08 A;  3QWZ B;  3C19 A;  2QIL A;  3U4E G;  2WXR A;  4BKS A;  1TT5 B;  2BGF A;  2L52 A;  1OQY A;  4M00 A;  1BXT A;  3DOW A;  3SD5 A;  1EWY C;  4BOS C;  1TJE A;  2J42 A;  2LGX A;  1T0R C;  2YEP B;  2KFJ A;  2LI5 A;  2MRP A;  4LNK A;  3PRZ A;  1L6V A;  3PPA A;  2ZJD A;  4O1N A;  1CQV A;  3IXS A;  1XLQ A;  2KMC A;  3Q69 A;  4JGH B;  4F8C B;  1NEN B;  3H7P B;  1F0Z A;  1UEL A;  1J7C A;  1NI2 A;  2BYT A;  2X38 A;  3O65 B;  1V1P A;  1WJN A;  2J0K A;  2JZP A;  2IO1 B;  4LNO A;  2IY0 B;  1KRH A;  2KAC A;  2NR2 A;  3ZNG C;  2GBM A;  1L2N A;  4YXD B;  5KHQ A;  1WXA A;  3AN1 A;  4GB9 A;  4WIP A;  1VD2 A;  3IG3 A;  4RGO S;  2N0S B;  3EA6 A;  2MH7 A;  3RNF C;  2N4F A;  3AE9 B;  2FAZ A;  4HXD A;  4ZOH C;  3KUZ A;  2I2Y A;  1N62 A;  3NUH B;  1J7B A;  4RFB A;  2K3U A;  2EMT A;  3ZUN A;  2O6V B;  4RCO A;  3SR6 A;  3M95 A;  3AEF B;  4C00 A;  3RYT A;  1KF6 B;  4WJQ A;  1WJ4 A;  2IO2 B;  1KLU D;  4WWM A;  1OEY A;  2KVR A;  4LNN A;  3WIM A;  4JL9 A;  3DPD A;  5AZF A;  2GBR A;  3DQV A;  1YN3 A;  1WH3 A;  4GIV A;  2BBC A;  2KD0 A;  1ACC A;  5G2N A;  3SDL C;  4ZYS A;  3Q3N C;  4K1R B;  2A5U A;  2D3C A;  3D32 A;  1EUV B;  2FCM A;  2I1K A;  2BYV E;  1J8C A;  2J0J A;  1C78 A;  2QIE B;  5J17 A;  4YSZ B;  2WDT B;  1TZO A;  3T8M A;  4ZRP A;  3V61 A;  1M4V A;  3T3O A;  4JQW C;  1MPE A;  4G11 A;  1Y56 A;  2OED A;  1AWD A;  4HK2 A;  4REZ A;  1YJ1 A;  4BKG A;  1WMH B;  1T5X D;  4GDL B;  2REX A;  1Z5S B;  1RAX A;  2QCZ A;  1WX8 A;  1OQQ A;  2NBU A;  2V3P A;  3TBL D;  1QOA A;  5BYR A;  1WIA A;  4I6N B;  2MBQ A;  3FIL A;  4AJY B;  3VR8 B;  2IDY A;  1WGH A;  4ZRK A;  4TQ0 A;  5AUK A;  1QLB B;  4LJO B;  2INN E;  3ZNH B;  4HPP A;  1QOG A;  2W54 A;  1QZE A;  3AE5 B;  3WAP A;  1UWX A;  3M63 B;  2XK5 A;  4IWQ A;  2JZ3 B;  1YX6 B;  2IZV B;  2LWP A;  4ASW C;  2RDH A;  1QIL A;  1Q10 A;  4YL8 A;  4HVB A;  3ECI A;  4LLG M;  1KOT A;  5D94 A;  3I5J C;  1UUP A;  3NRZ A;  2ACZ B;  4GDK B;  2AL3 A;  4LNF A;  2D2Q A;  1V81 A;  1C4C A;  4K7S A;  5E6O A;  5LXI B;  2IGH A;  3GE3 C;  1CJE A;  1V80 A;  1OGW A;  2YEP F;  3A33 B;  4KX6 B;  5GMV A;  4FA6 A;  1GUA B;  1P0R A;  2MBO A;  4LTU A;  4A55 A;  3TL5 A;  2J0M A;  2C60 A;  1UBQ A;  4EOY A;  4MM3 A;  1GAQ B;  3ML8 A;  4II2 B;  1HZ6 A;  4MSQ B;  3RUI B;  1GPX A;  3U30 A;  4ARI A;  4JWS C;  5G55 A;  5T8I A;  1TTN A;  3IAS 1;  2KKC A;  2WXG A;  3MFG A;  4EUT A;  5CHW A;  2KMA A;  1SBB B;  3ZW3 A;  1EF5 A;  1I4H A;  1LFD A;  1QOF A;  2K39 A;  4XWW A;  3ZJV A;  2LHD A;  3NY5 A;  1C1Y B;  4MAC A;  2DEN B;  3AE7 B;  3OJ3 A;  2KTR A;  2BF8 B;  2Y5C A;  2LJI A;  3TEZ A;  4EEW A;  2KAN A;  2KYW A;  4MEM A;  1E5W A;  2KDB A;  3N1X C;  5D6J B;  2PIA A;  1WF9 A;  1FEH A;  3U7D A;  3P4Q B;  2C7N B;  4JWU C;  2QJL A;  1XD3 B;  1V8C A;  3I63 C;  2G3Q B;  1ESF A;  3EC8 A;  1HXY D;  4FBJ B;  5G5G A;  1FO4 A;  2DBY A;  2SEB D;  3N1Y C;  3HK0 A;  2N9K A;  1F9J A;  3ZTC A;  3EGR A;  3CIR B;  3AM9 A;  3NZ3 A;  3W2D A;  1D5X C;  4ZYN A;  1EU4 A;  3T9L A;  1N61 A;  1D5Z C;  4DHZ E;  3BK2 A;  2RDB C;  2KX3 A;  2L8J A;  3KH0 A;  1HTQ A;  1E7U A;  1DOX A;  1MHX A;  3DCG A;  2INC C;  3CF6 E;  4YSX B;  2BQQ A;  1NEK B;  1TS2 A;  5EE9 A;  4KIK A;  2PE6 B;  1P7E A;  3DVG Y;  4MJS A;  2LGI A;  4W9L A;  4YTP B;  1I35 A;  3HHM A;  2LD9 A;  3KYC D;  1HZ5 A;  4AS1 A;  2W9N A;  1V6E A;  2WDR B;  4WH4 A;  2RPV A;  1V97 A;  4OVU A;  1R4M I;  1VZ6 A;  4ANW A;  3PZ7 A;  4PS7 A;  5AZG A;  3PS6 A;  1ET9 A;  1ET6 A;  3RPF C;  2Q5W D;  1KFY B;  2K1F A;  3N32 A;  4KDI C;  4NAW A;  1WGD A;  3ZJU A;  2DYB A;  3A4R A;  4IUM B;  1T0S C;  3PHX B;  5C23 A;  3ZNI D;  3WAM A;  1DGJ A;  1KLG D;  3P63 A;  5IO9 A;  1Q0W B;  3IT4 B;  3AE3 B;  4MGK E;  1D3Z A;  4FAD A;  2OJW A;  5IP4 D;  3ZYY X;  3L16 A;  2CHW A;  4N6E B;  3Q3J A;  4PYZ A;  4YSY B;  1IGC A;  3MHZ A;  2TSS A;  1K52 A;  2JF5 A;  2KVZ A;  1C77 A;  2HJ8 A;  3AE8 B;  1WYW B;  2ZVO A;  3HIZ A;  2M0A A;  3RD2 A;  3ZJT A;  5FR3 A;  3PVL A;  5E6N A;  2KHW B;  2BB5 A;  2KWU B;  3RNB C;  2KZR A;  1ISN A;  3RNA C;  1VDV A;  4XDC A;  3L54 A;  5DPR A;  2MJD A;  2DYM A;  5BO4 B;  1IBX B;  3O13 A;  1HQR D;  5CX3 A;  2C5L C;  4AP4 C;  1AW7 A;  1SE3 A;  4K3C A;  4J6I A;  2NPT B;  1ZXH A;  1P1A A;  4IDI A;  3P1M A;  4BKS D;  4DWF A;  2K0P A;  1YJJ A;  1TKG A;  2WXJ A;  2G4D B;  2WXL A;  1TGZ B;  2HE7 A;  5FK9 C;  3PRM B;  4A3O A;  3RUL A;  2MWS B;  2XN9 C;  2VZK B;  1I4Q A;  2D3G A;  1SJH D;  1ZXI A;  3QAR A;  2WQY B;  2KJR A;  3NVV A;  1ZPS A;  2JXT A;  4A90 A;  5GXG B;  3DWM A;  5H92 C;  2MHJ A;  1XLN A;  4FHK A;  1J19 A;  3E9S A;  2OHF A;  2BKR B;  3QQ8 B;  2L83 A;  2IPK D;  4W9J A;  2YVC A;  1ZOY B;  3I57 A;  1WJU A;  3GOE A;  4MT5 A;  1WGG A;  3UQB A;  2RGF A;  4PYU A;  1AAR A;  2LGD A;  3WAL A;  1VR9 A;  4KZ0 A;  4KKI A;  1VRA B;  1TIF A;  1JWM D;  2ASQ A;  3N30 A;  2JSV X;  3FC4 A;  1H4R A;  1WRI A;  2BPS A;  3VAW A;  3W9C B;  3TJP A;  4HEA 1;  4C80 A;  4US8 A;  2MA9 B;  1YN4 A;  3IAM 1;  4NZL B;  1V2Y A;  3PT2 B;  3QCA A;  3AV8 A;  4USA A;  3P4P B;  1H8C A;  3BYY B;  3QC8 B;  3VVW B;  2MEK A;  1P9D U;  3ABV B;  2WWZ A;  2G45 B;  1Z2M A;  3UQA A;  2N9P C;  2MBB B;  4XGA B;  4IW0 A;  4WQM A;  3W1Y A;  1NYQ A;  4GXB A;  2D3B A;  2IJ0 A;  1V9J A;  1R4N I;  2NS5 A;  2AYO B;  3V6C B;  1GNU A;  1WXM A;  3H6N A;  2MCN B;  2WLB A;  2HTM E;  3N1Z C;  3AEA B;  3DWG C;  1IYF A;  2H88 B;  2MP2 A;  1FRD A;  5D2M B;  3ZKJ C;  3TSS A;  3ETR A;  3Q8A A;  3KUD B;  2G9H D;  1PFD A;  2LGY A;  5C1Z A;  1PUT A;  2IBI B;  2QDF A;  5DPS A;  3EFU A;  1SGH A;  2LGS A;  4PS8 A;  1S3S G;  3H1U A;  5KHO A;  3V60 A;  2PVG C;  1EM7 A;  1L0Y B;  2RSU A;  3AEB B;  1TS3 A;  1PGX A;  4HCN B;  3ZGZ A;  3IFW B;  2AL6 A;  4EE2 A;  1RFK A;  1D5M C;  4MH0 E;  2WXN A;  1WJ6 A;  5AEK B;  4E3C A;  4HPL B;  1ZW7 A;  2MBH A;  3KVF B;  4HLE A;  5IN7 A;  3DVG X;  4WJN A;  4ITK A;  4OHJ A;  1R4N B;  1GB4 A;  2W82 A;  4JPS A;  3MC8 A;  2PW9 A;  2ZW1 A;  3U8Z A;  1JRP A;  3R2T A;  3Q3O C;  3SFE B;  4BBN F;  2KFK A;  2DLB A;  3LDZ E;  3PRE A;  2BT6 A;  1SF0 A;  3DBH B;  3BVZ A;  4RF1 A;  3AXC A;  1N6Z A;  2WYQ A;  4FXC A;  4HKZ E;  3GZN I;  2PKO A;  4HJK A;  2L7R A;  4WAF A;  2G4S A;  3RZW C;  2RPQ A;  1JWA D;  3VTW A;  2C7M B;  1V49 A;  4W9G A;  3OJ4 B;  1QKZ A;  3Q3F A;  2FIF A;  3UIN B;  5L83 A;  3ZRC A;  1CMX B;  3TCA A;  3WA0 A;  2B76 B;  2KNB A;  2KWC A;  2J4X A;  4KKJ A;  3TUO A;  2N7J A;  5BMH A;  4S17 A;  3X0W A;  3NG0 A;  1FM0 D;  4A20 A;  4EZL A;  3DBR I;  2ON8 A;  3NJT A;  3RCZ A;  3U7Z A;  4BZA A;  2NMQ A;  1UBI A;  1YD8 U;  3GS2 A;  2MQJ A;  1L4D B;  2K8H A;  2PEA A;  4IC7 B;  5IAA C;  4BFR A;  2CU3 A;  4NNJ B;  1DOI A;  2AQ2 B;  2M0X A;  3P42 A;  4II3 B;  1UGM A;  4BKT A;  2QMT A;  3KWL A;  3RT3 B;  3GZN B;  2LHE A;  2AQ1 B;  4ZHO A;  2PLP A;  1YMH E;  3IHP C;  4M0W B;  3A9K A;  5LLI A;  3M62 B;  1HEZ E;  1I4P A;  4KV2 A;  3JSV B;  4ANU A;  2AEH A;  3DVN V;  5TSS A;  2CHX A;  2WNM A;  1NI3 A;  4NAM A;  2KOX A;  1MHH E;  5BYQ A;  2FUG 1;  2FCQ A;  5HI1 A;  4M8N A;  5LNK 1;  2VZK D;  2KK8 A;  4W9D A;  3PO0 A;  3VH3 B;  4LDT B;  1FPY A;  1Y8R C;  3DBR B;  2V1Y A;  3DHG C;  1QOB A;  2LUE A;  3QHT A;  1I4X A;  3QK0 A;  1FXI A;  1WSP A;  2IO0 B;  3PZD A;  4KZC A;  3URY A;  4B0E A;  1FXT B;  3VQI A;  2FCS A;  2UU7 A;  2KDM A;  3B2G A;  2UWQ A;  4W9F A;  3ZLZ A;  2NBW B;  1JWU D;  2GBK A;  1E90 A;  1STE A;  4HKQ A;  3AMZ A;  2O2V A;  4BAX A;  2MX2 A;  2GI9 A;  1TZ1 A;  1FD6 A;  2JXX A;  2AX5 A;  3LXF A;  2M8S A;  2RMM A;  2R61 A;  1V1P B;  2BVC A;  3TIX A;  1SE2 A;  5JXV A;  4A9A A;  3PZ8 A;  3QA8 A;  3ZNZ B;  2VH1 A;  3NS8 A;  1XXG A;  4NQL B;  3DDC B;  4H2A A;  3VRB B;  2EMS A;  5D3D A;  2KQS A;  1B9R A;  1V1O A;  4I6L B;  4E71 A;  3TEX A;  2DAF A;  1SE9 A;  4DXA B;  1WXS A;  3V6E B;  5HFY A;  1XT9 B;  3PLU A;  1C79 A;  1E8Z A;  4ICV A;  3ONS A;  1TY2 A;  1RYJ A;  3L4P A;  3WAN A;  1FRR A;  3NOB A;  3L17 A;  4W9H A;  3PSE B;  4OVV A;  2JQR B;  3NVY A;  3ZIM A;  2PVO D;  4HPM B;  1ZKH A;  1XLO A;  4URK A;  2M19 A;  2LMC A;  3AE2 B;  4P1C C;  2BYE A;  3TEY A;  3OWE B;  3GE8 C;  4FHJ A;  2OJR A;  2Z0D B;  1RFA A;  1HTO A;  1BML C;  3AE6 B;  2PPH A;  5E6J A;  1BUI C;  2WX1 A;  2GBN A;  3V05 A;  2HDE A;  4MGY E;  3EHV A;  4M01 A;  2GOW A;  1XQQ A;  1WYG A;  1D4B A;  3KYD D;  1UGJ A;  3AUL A;  4CYE A;  4UDU C;  1SIJ A;  3BWU D;  3B1L X;  3PLV A;  1AYF A;  1QQR A;  3DBS A;  3RZF A;  1CK1 A;  1JQ4 A;  4C4V A;  3DHI C;  2W3R A;  2N9E B;  4W9C A;  3I3T B;  4LCD E;  4TKN A;  2KJ6 A;  1XCQ L;  3KW5 B;  3ZO5 B;  4IM3 A;  5HHD G;  3FIL B;  2WXO A;  4DXG A;  4IWO A;  1IUE A;  2KDF B;  2D11 A;  4RH6 A;  1A70 A;  2CR5 A;  3A9J A;  4MGI E;  4TQ1 A;  1V5T A;  4FJZ A;  3DHH C;  4AOF A;  1XCT L;  2XK5 B;  2FID A;  2L00 B;  2SAK A;  3VR9 B;  4HJG E;  3ZDT A;  1JML A;  5FR6 A;  2WXI A;  4N58 A;  4ANV A;  1P7F A;  3UI3 A;  2HD5 B;  4RMA A;  3VDZ A;  2XEW A;  5C3J B;  2GLS A;  3HM3 A;  1T0Y A;  1UZX B;  2KMM A;  1L7Y A;  1RLF A;  1HA5 A;  4FJY A;  4HDQ A;  3NZU A;  2BB6 A;  2LEK A;  4ZRI A;  3VFK A;  2C9W B;  3MC0 B;  4IOI E;  2K25 A;  1YQB A;  3A1Q A;  3DBL I;  1RRB A;  2NBV B;  1MG8 A;  2KTF A;  3OAW A;  4LJP B;  2WXM A;  4EFO A;  3IBE A;  3HUI A;  3KLS X;  4MM3 B;  2H89 B;  3ZTD A;  3CMM B;  3U2S C;  1OTR B;  4DBG A;  2KDI A;  2BW2 A;  1IGD A;  4TUU A;  4MGZ E;  1F52 A;  2ZNV B;  1XO3 A;  1SXT A;  4DK5 A;  2DZJ A;  3CSF A;  1F2R I;  3R7R A;  1VZ7 A;  1SB3 C;  2Z0E B;  1SIF A;  4AQ7 A;  3WCQ A;  1YJI A;  3A4S C;  4JLC A;  1E8W A;  3B08 A;  4HWI B;  1ZDV A;  2KTR B;  3RNC C;  1SSN A;  1OFF A;  2D10 A;  1PGB A;  1IPG A;  4ICU A;  4K7W A;  2L32 A;  2VRR B;  3VUW A;  1VLB A;  5EE0 A;  4LDT D;  3DBL B;  3I9V 1;  1WR1 A;  1C3T A;  4OZA A;  1YN5 A;  3KQ4 A;  1EU3 A;  4ACF A;  1JWS D;  1JRO A;  4TMA B;  3SHQ A;  1U4A A;  3Q3M C;  3C8Y A;  3W5U B;  1JWB D;  3MJ5 A;  2JYT A;  4OZC A;  1WXQ A;  1LM8 B;  1M94 A;  2ZPY A;  1PDX A;  5BYS A;  2IYD B;  2JT4 B;  3ZQ4 A;  3Q14 C;  2J53 A;  1V5O A;  4RGM A;  1GC6 A;  4PS3 A;  2KDE B;  2WS3 B;  3VTU A;  3H7P A;  4P7I A;  2WXK A;  4DHJ D;  4C7Y A;  1WGK A;  1NDD A;  1WX7 A;  2I1J A;  2WP9 B;  4GOC A;  2N9X A;  5JHB A;  3C0R B;  2FCN A;  4TV3 A;  3NS1 A;  5TR5 A;  2LVP A;  1C4A A;  4RGN A;  2RDG A;  3MTN B;  4NPN A;  2GB1 A;  1FMA D;  3Q8C A;  4US9 A;  4YT0 B;  3JYU A;  4W9E A;  4TSS A;  1MJD A;  4KIK B;  2M4N A;  3PTF C;  4OW0 A;  1AN8 A;  3AEC B;  2LVQ A;  3RNE C;  3NVW A;  3E56 A;  1WRD B;  1MFW A;  3MP9 A;  4K3B A;  4MJS B;  1I4G A;  2O6V A;  3Q6B A;  1KLV A;  1RM6 C;  4OVZ A;  1WWT A;  4FN2 A;  1T6B X;  1UWM A;  2IGD A;  2UYZ B;  2V0G A;  4P16 A;  3LB8 C;  3TMP B;  4MH8 A;  5EE3 A;  1E6E B;  2KAJ A;  4NAW B;  4WJP A;  3Q2A C;  3KUC B;  4JX1 C;  3GP7 A;  3UGB B;  3ZDM C;  2G1E A;  1D6E C;  1FNV A;  2DX5 B;  4I6P A;  2D07 B;  3DBH I;  1XLP A;  1PQS A;  1P98 A;  1FFV A;  2BS2 B;  3U52 E;  2KQ7 A;  1VCB A;  1YIW A;  2GBJ A;  1PYW D;  2INP E;  4XC2 A;  3K9P B;  1WE7 A;  2LRW A;  4ZDV A;  2MSE D;  4GMV A;  3R8B A;  4KGS A;  4EZJ A;  2EKI A;  1WMH A;  3ALB A;  2KWV B;  4GDL A;  5H8Y E;  4NJ6 A;  3VTV A;  5LXH A;  3W1S C;  1WM3 A;  2L05 A;  3L10 B;  4JE3 B;  1TKE A;  3VRA B;  4OZB A;  3AU5 A;  2LUM A;  4EZK A;  3APF A;  3FKY A;  4RF0 A;  3NVZ A;  2Y5B B;  2JWZ A;  1A5R A;  1LQB A;  2WXH A;  5D7G A;  2JZZ A;  1JAL A;  5FKA C;  3BK1 A;  3IVF A;  2DZK A;  1K8R B;  2W55 A;  1WFY A;  2Z8L A;  1UNS A;  2JWU A;  4WWN A;  3BIN A;  4ARC A;  2J52 A;  1J0G A;  1WM2 A;  2PMV A;  4L2Y A;  3BVG A;  2D5G A;  1WR6 E;  2V3S A;  3LJ3 A;  4GDK A;  3M3J A;  2BTE A;  1YQ4 B;  2KT7 A;  3PRP B;  2J7Q B;  4ANX A;  5E6P A;  2L3Z A;  3Q8F A;  5DCN A;  3RNG C;  1WE6 A;  3ZVV A;  3R2I A;  4RM8 A;  2ICI A;  3P2B A;  2Y3A A;  3N20 C;  2DNF A;  2MW5 A;  3R3M A;  4GSW A;  1XF5 L;  1KM7 A;  2LXA A;  4BVU C;  3EEC A;  2E6X A;  2L76 A;  2LVO A;  3QIJ A;  1ZE3 D;  4DHZ B;  1Q5W B;  1GOZ A;  5C2T B;  2NVU I;  3VXW A;  3SEB A;  3V3X A;  2WXF A;  1G6J A;  2ZZP B;  4B95 A;  1WGR A;  5D3I B;  1E0Z A;  4WQO B;  4N59 A;  3H8H A;  4K81 A;  4KSK C;  2WU5 B;  2MLB A;  2K22 A;  2MP2 B;  1DOY A;  1WXV A;  2JRI B;  5EE1 A;  1UF0 A;  4GGQ A;  4R3D A;  1E8Y A;  3OG5 A;  4IG7 B;  3L0W B;  1E9M A;  1R7S A;  1ZGU B;  4M8M A;  4WWO A;  1NYR A;  3H7S A;  1FCL A;  4YTM B;  4WWP A;  3QX1 A;  2DZI A;  2W3S A;  3MHS D;  1F77 A;  1MVK A;  2A4Z A;  2MBE A;  2KC2 A;  1SJE D;  3BYT B;  4N9F 4;  3ML9 A;  1C4P A;  4FLH A;  1GJZ A;  2KN5 A;  4XE0 A;  4X57 B;  4XYC A;  3N3K B;  3R7Q A;  2L1A A;  4DDG D;  1I7H A;  5J18 A;  1VZ8 A;  2ZCC A;  2WGS A;  2RR9 A;  5J2R A;  4LNI A;  3VHT C;  2B3A A;  4KGR A;  2N1V A;  3BY4 B;  2FE8 A;  3DVN U;  3RN9 C;  4B9K A;  2KFK B;  5IKC M;  1X1M A;  1TYG B;  5L95 C;  2V9H A;  2QEJ C;  3AE4 B;  1T3Q A;  5JH5 C;  4LK0 M;  2JRH A;  2JYE A;  1K50 A;  4F7Z A;  4DHJ B;  1F1H A;  2WXQ A;  1JRU A;  3VUY A;  4XWT A;  3ZXR A;  1XEE A;  4WJO A;  3HVD A;  5HG2 A;  3HM6 X;  2MJE A;  5CHV C;  2IND C;  1N63 A;  2LJ5 A;  1ENF A;  2ZVN A;  2BWF A;  5BMG A;  1WX9 A;  4G50 A;  1UH6 A;  2KJH B;  1ZP0 B;  3S2A A;  2IGG A;  5AUI A;  2JX5 A;  3RMK C;  2ZPN A;  2YLM A;  2R2Q A;  2KX0 A;  4WAA A;  1ZDX A;  4AUQ C;  1PGA A;  2KN4 A;  4AWJ A;  3PGE A;  1C76 A;  2LXC A;  4ZHP A;  2KXJ A;  2FBW B;  4KVG B;  3B0A A;  2BWE S;  2JPH A;  3AED B;  3AI5 A;  1N5X A;  4A8X C;  4W9I A;  3H9D A;  3VUX A;  1CZP A;  4GN1 A;  2WHI A;  1YX5 B;  2ZCB A;  4IM0 A;  1KTK A;  2JVC A;  3A9K B;  2L0F A;  3HRD D;  3Q8E A;  1TY0 A;  1KJT A;  4P1B C;  4HRS A;  2BYF A;  1IBX A;  4PK1 A;  5G5H A;  1FCC C;  1FNU A;  1NVI D;  1L5P A;  2NPT A;  2K6D B;  4Q2J A;  4G0N B;  1EF1 A;  4RM9 A;  3TEW A;  4M02 A;  1GB1 A;  2CS4 A;  3K9O B;  2ZEQ A;  3BZD B;  1E7P B;  2DWQ A;  1OEY J;  2JY6 A;  4C56 C;  1E7V A;  2IO3 B;  5I4D A;  2DAJ A;  3APC A;  1LXD A;  5HKH A;  3J9C A;  3X23 A;  2BS4 B;  5DPT A;  3RFZ B;  2GMI C;  5JZE B;  4XX5 A;  1T0Q C;  1WY8 A;  3IT6 B;  4DXF A;  2L0T A;  2NTS A;  4DQO C;  2AWT A;  2Z59 B;  1L0X B;  2HTH A;  2DZM A;  1WI0 A;  1TS4 A;  1N5W A;  3P4R B;  1P3Q U;  4K7U A;  2CHZ A;  2V4L A;  2PE9 A;  3ZXV A;  2VH2 A;  2O2V B;  2K5P A;  1MG4 A;  2IY1 B;  1NBF C;  5EDS A;  1RWS A;  4W9K A;  1FXA A;  2EEL A;  2M1M A;  4AJW A;  3AB5 A;  3FAH A;  2N7D A;  3BII D;  3QJZ A;  1GC7 A;  4J3O D;  2K9X A;  2KQ4 X;  2DYO A;  1EO6 A;  3N9Y C;  1IP9 A;  4YTN B;  3R66 C;  1HE8 A;  2BS3 B;  2KO3 A;  2O6V D;  3NHE B;  4G3X B;  1K51 A;  4YWG G;  2GRI A; 
#chains in the Genus database with same CATH homology
 3AE1 B;  2B76 B;  3W1S A;  1RM6 C;  2J4X A;  4OVZ A;  1GAQ B;  1WWT A;  1HZ6 A;  4KKJ A;  1T6B X;  3TUO A;  2N7J A;  3AEG B;  5BMH A;  1UWM A;  1GPX A;  2IGD A;  5MPO A;  4ARI A;  4JWS C;  4B0M A;  4P16 A;  2V0G A;  5T8I A;  1N60 A;  3LB8 C;  3AEE B;  1FM0 D;  3IAS 1;  4MH8 A;  2ON8 A;  5EE3 A;  2WXG A;  3MFG A;  1VJK A;  3U7Z A;  1LO5 D;  2NMQ A;  1E6E B;  2KAJ A;  4NAW B;  3W5V B;  3SFD B;  1SBB B;  4JX1 C;  3GS2 A;  3GP7 A;  2G1E A;  2Y5P A;  1L4D B;  1D6E C;  1FNV A;  1I4H A;  2E3T A;  1QOF A;  2CU3 A;  2V4I B;  4HRO A;  4XWW A;  1DOI A;  3ZJV A;  1XLP A;  4WUR A;  2LHD A;  1FFV A;  2AQ2 B;  1FFU A;  3P42 A;  2BS2 B;  2QMT A;  4MAC A;  2WDQ B;  3KWL A;  3U52 E;  2LHE A;  2AQ1 B;  3AE7 B;  3BVM A;  4ZHO A;  2PLP A;  1YMH E;  1PYW D;  2Y5C A;  2INP E;  2LJI A;  2V3N A;  4GLS C;  3TEZ A;  3LYY A;  1HEZ E;  1I4P A;  2N9L A;  3R8B A;  2CJN A;  4KGS A;  2CJO A;  5TSS A;  4XDD A;  1C9F A;  3GB1 A;  1L6U A;  2PIA A;  2EKI A;  1L4Z B;  2WNM A;  1FEH A;  1NI3 A;  4NAM A;  3P4Q B;  5H8Y E;  1MHH E;  4JE3 B;  3B2F A;  5BYQ A;  4JWU C;  1MI0 A;  1TKE A;  3VRA B;  2FUG 1;  2QJL A;  4KGT A;  5HI1 A;  5LNK 1;  1V8C A;  1JW9 D;  2VZK D;  4OZB A;  2LUM A;  3PO0 A;  1ESF A;  1HXY D;  3AH7 A;  4RF0 A;  5G5G A;  1FO4 A;  4NJC A;  2DBY A;  3NVZ A;  2SEB D;  1QOB A;  2N9K A;  1FIQ A;  2JU6 X;  2KWD A;  4ZRQ A;  2WXH A;  3EGR A;  3CIR B;  3HVZ A;  3P4S B;  3AM9 A;  5D7G A;  2WXP A;  3NZ3 A;  1JAL A;  3W2D A;  1D5X C;  3BK1 A;  5FKA C;  1I4X A;  1EU4 A;  1FXI A;  1WSP A;  2W55 A;  4B0E A;  3URY A;  2Z8L A;  3VQI A;  1N61 A;  1UNS A;  1D5Z C;  2JWU A;  3BK2 A;  3T3N A;  2KDM A;  3B2G A;  4ARC A;  1QT9 A;  1TS5 A;  1JWU D;  2J52 A;  1DOX A;  4L2Y A;  2PMV A;  3BVG A;  1STE A;  2D5G A;  4HKQ A;  3AMZ A;  1L0V B;  1MHX A;  2GI9 A;  1FD6 A;  4PT5 A;  2BTE A;  2AX5 A;  1YQ4 B;  4L1B A;  1J7A A;  3LXF A;  2RMM A;  2R61 A;  1V1P B;  1SE2 A;  5JXV A;  4YSX B;  4A9A A;  3PZ8 A;  3Q8F A;  2AQ3 B;  1NEK B;  1TS2 A;  2QSD A;  1XXG A;  5EE9 A;  4H2A A;  3CWI A;  3VRB B;  4A6Q A;  3R2I A;  1P7E A;  2M56 B;  5D3D A;  1TKY A;  2LGI A;  2ICI A;  1B9R A;  1V1O A;  4YTP B;  1ROE A;  3TEX A;  2Y3A A;  4AS1 A;  1FNW A;  1HZ5 A;  4CQN A;  4IKG A;  5HFY A;  4C7Z A;  1C79 A;  1OQR A;  2WDR B;  1DYQ A;  2RPV A;  4WH4 A;  1V97 A;  1TY2 A;  1RYJ A;  3L4P A;  1VZ6 A;  1FRR A;  1XF5 L;  3PZ7 A;  2JQR B;  3Q8B A;  1ET9 A;  1ET6 A;  3NVY A;  1F2R C;  2Q5W D;  3RPF C;  1YNT E;  2E6X A;  1KFY B;  2PVO D;  1XLO A;  2WU2 B;  2ONQ A;  1ZE3 D;  3ZJU A;  4RGT A;  2M19 A;  1K53 A;  2LMC A;  3AE2 B;  1QF6 A;  1GOZ A;  5C2T B;  3SEB A;  3V3X A;  2WXF A;  2MJ3 A;  1DGJ A;  1KLG D;  3P63 A;  2PTL A;  3TEY A;  1KH0 A;  3OWE B;  1SEB D;  3IT4 B;  3AE3 B;  5D3I B;  1E0Z A;  3ZYY X;  1YQ3 B;  4N59 A;  1B1Z A;  3H8H A;  1BML C;  3KWV A;  1EWC A;  3AE6 B;  4N6E B;  2WU5 B;  2K22 A;  3B9J A;  4YSY B;  1DOY A;  4M0W A;  1IGC A;  2TSS A;  3MHZ A;  1K52 A;  1SE4 A;  1BUI C;  4RNA A;  1JCK B;  5E6J A;  5EE1 A;  1E10 A;  1C77 A;  4L23 A;  2WDV B;  3AE8 B;  3V05 A;  2HDE A;  2M0A A;  1ZUD 2;  4D2K A;  4R3D A;  3ZJT A;  1WYG A;  5FR3 A;  1D4B A;  2BB5 A;  2ZW0 A;  2XNA C;  1UGJ A;  1E9M A;  4P6V F;  1R7S A;  4UDU C;  1VDV A;  1SIJ A;  4XDC A;  2I38 A;  1I4R A;  3EUB 2;  1NYR A;  2NTT A;  2MJD A;  3BWU D;  2DYM A;  2LFI A;  1FCL A;  1AYF A;  1QQR A;  4YTM B;  3O13 A;  1IBX B;  1CK1 A;  1JQ4 A;  1HQR D;  5BMI A;  2W3S A;  1F77 A;  1MVK A;  2W3R A;  1AW7 A;  1SE3 A;  1ZXH A;  2QIL A;  4IDI A;  1SJE D;  3P1M A;  3BYT B;  3U4E G;  2WXR A;  1C4P A;  2K0P A;  1YJJ A;  1TKG A;  1XCQ L;  2WXJ A;  2WXL A;  4XE0 A;  5HHD G;  2L52 A;  3FIL B;  2WXO A;  5FK9 C;  4DXG A;  1BXT A;  2XN9 C;  2VZK B;  1I4Q A;  1EWY C;  2L1A A;  1IUE A;  1SJH D;  1I7H A;  1TJE A;  1ZXI A;  4RH6 A;  1VZ8 A;  2J42 A;  1A70 A;  2WQY B;  3NVV A;  1ZPS A;  2JXT A;  4A90 A;  2YEP B;  5GXG B;  3DWM A;  4TQ1 A;  1L6V A;  4KGR A;  5H92 C;  1XLN A;  4O1N A;  1CQV A;  2FE8 A;  3IXS A;  1XCT L;  3E9S A;  1XLQ A;  2OHF A;  3Q69 A;  2SAK A;  3VR9 B;  1NEN B;  2L83 A;  2IPK D;  1JML A;  4HJG E;  1F0Z A;  1TYG B;  2WXI A;  1J7C A;  4N58 A;  2BYT A;  2X38 A;  2QEJ C;  3AE4 B;  1V1P A;  1T3Q A;  2JZP A;  4LK0 M;  1P7F A;  3UI3 A;  2JYE A;  1K50 A;  1KRH A;  1ZOY B;  2KAC A;  3I57 A;  5C3J B;  4YXD B;  2WXQ A;  4XWT A;  4MT5 A;  1XEE A;  1VR9 A;  2KMM A;  3HVD A;  4KKI A;  1VRA B;  5HG2 A;  3AN1 A;  1JWM D;  1HA5 A;  2BB6 A;  4WIP A;  2LEK A;  2MJE A;  4RGO S;  2JSV X;  2N0S B;  3EA6 A;  3FC4 A;  2MH7 A;  1WRI A;  3MC0 B;  4IOI E;  3AE9 B;  4ZOH C;  3W9C B;  2I2Y A;  4HEA 1;  1N62 A;  4C80 A;  4US8 A;  3NUH B;  1J7B A;  1YN4 A;  4RFB A;  1N63 A;  3IAM 1;  4NZL B;  2WXM A;  2K3U A;  4RCO A;  1ENF A;  5BMG A;  3AV8 A;  4USA A;  3P4P B;  3SR6 A;  3BYY B;  2MEK A;  3AEF B;  1KF6 B;  3ABV B;  3KLS X;  3HUI A;  1ZP0 B;  4MM3 B;  2H89 B;  2IGG A;  5AUI A;  1KLU D;  2JX5 A;  4WWM A;  3U2S C;  4WQM A;  1ZDX A;  2KN4 A;  1PGA A;  1NYQ A;  2IJ0 A;  1C76 A;  2BW2 A;  1IGD A;  1YN3 A;  2BBC A;  4ZHP A;  1XO3 A;  1SXT A;  1ACC A;  2FBW B;  2WLB A;  1F2R I;  1VZ7 A;  4ZYS A;  1SB3 C;  2HTM E;  3AEA B;  3DWG C;  3AED B;  2H88 B;  1FRD A;  4AQ7 A;  1N5X A;  3WCQ A;  4A8X C;  3TSS A;  1YJI A;  1CZP A;  3ETR A;  3Q8A A;  1C78 A;  2QIE B;  2G9H D;  1PFD A;  1KTK A;  4YSZ B;  1ZDV A;  1TZO A;  1PUT A;  1SSN A;  4ZRP A;  1OFF A;  1M4V A;  1PGB A;  3T3O A;  3HRD D;  2L32 A;  3Q8E A;  1MPE A;  1TY0 A;  2PVG C;  1EM7 A;  1Y56 A;  2OED A;  1L0Y B;  1VLB A;  4HRS A;  1AWD A;  5EE0 A;  1IBX A;  3AEB B;  1TS3 A;  5G5H A;  1FCC C;  1PGX A;  3ZGZ A;  3I9V 1;  4REZ A;  1FNU A;  1NVI D;  1L5P A;  4EE2 A;  1T5X D;  1RFK A;  4GDL B;  4OZA A;  1YN5 A;  3KQ4 A;  4Q2J A;  3TEW A;  1D5M C;  1EU3 A;  1GB1 A;  1OQQ A;  1JWS D;  2V3P A;  1QOA A;  1JRO A;  3BZD B;  4TMA B;  5BYR A;  1E7P B;  2WXN A;  3C8Y A;  3W5U B;  1JWB D;  3MJ5 A;  3FIL A;  3VR8 B;  2IDY A;  2DWQ A;  4C56 C;  2JYT A;  5AUK A;  4TQ0 A;  1QLB B;  4OZC A;  1WXQ A;  5I4D A;  1PDX A;  5BYS A;  2INN E;  1QOG A;  3J9C A;  4ITK A;  2W54 A;  2BS4 B;  3ZQ4 A;  4OHJ A;  2J53 A;  1GB4 A;  2W82 A;  3RFZ B;  4JPS A;  4RGM A;  3AE5 B;  2PW9 A;  2ZW1 A;  1JRP A;  1UWX A;  3IT6 B;  4DXF A;  3R2T A;  2WS3 B;  3SFE B;  2NTS A;  4DQO C;  2DLB A;  1L0X B;  2BT6 A;  2RDH A;  1SF0 A;  1QIL A;  1N5W A;  1TS4 A;  3BVZ A;  1Q10 A;  3P4R B;  2WXK A;  4RF1 A;  4C7Y A;  4LLG M;  1WGK A;  2WP9 B;  4FXC A;  1UUP A;  4HKZ E;  3NRZ A;  2ACZ B;  2K5P A;  2PKO A;  4GDK B;  4WAF A;  1RWS A;  3NS1 A;  1FXA A;  1JWA D;  1C4A A;  2EEL A;  4RGN A;  1C4C A;  2RDG A;  3AB5 A;  3FAH A;  2GB1 A;  1FMA D;  3BII D;  4J3O D;  3Q8C A;  2IGH A;  4US9 A;  4YT0 B;  1CJE A;  4TSS A;  2K9X A;  2KQ4 X;  2DYO A;  2YEP F;  3N9Y C;  4KX6 B;  4OW0 A;  1AN8 A;  4YTN B;  3AEC B;  2BS3 B;  3NVW A;  3E56 A;  3MP9 A;  4LTU A;  1QKZ A;  4A55 A;  1I4G A;  1K51 A;  4YWG G;  2GRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...