1PUTA

An nmr-derived model for the solution structure of oxidized putidaredoxin, a 2fe, 2-s ferredoxin from pseudomonas
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRQLDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTIDAREDOXIN
publication title An NMR-derived model for the solution structure of oxidized putidaredoxin, a 2-Fe, 2-S ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 10
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1putA00
1L5PA 1QOFA 3AEAB 3NVVA 3AE3B 3P1MA 1TKGA 3L4PA 2MH7A 3RPFC 1AWDA 4WWMA 3W5VB 1OQRA 2M19A 2W54A 3ABVB 1WXQA 3P4PB 2OHFA 5EE1A 1E7PB 1XLPA 3SR6A 1ZOYB 2H89B 3B2FA 5MPOA 4YSZB 1ZXIA 1T3QA 1XLOA 1AYFA 3AN1A 2MJ3A 1SIJA 1TYGB 1YJIA 1EWYC 2MJEA 2WDVB 1RFKA 1DGJA 1KF6B 3AMZA 1E0ZA 2WQYB 1JQ4A 1WWTA 5EE9A 3CIRB 3W5UB 5GXGB 1FMAD 3AEDB 3NVYA 2CU3A 1QT9A 1NYQA 3AE4B 3W9CB 3P4QB 3VRAB 1FXIA 1FIQA 1YQ4B 1WYGA 3AE7B 3SFEB 3HRDD 3ZYYX 2ACZB 1JWAD 1KFYB 2K22A 3AEBB 2BS4B 2DBYA 2E3TA 1GPXA 1FRDA 1NENB 5EE0A 3DWGC 1J7AA 4P6VF 1CZPA 3ETRA 3AEEB 1JALA 3B2GA 3NVWA 2W55A 1XLQA 1WGKA 1FO4A 3KWLA 2PVGC 4ITKA 1N5WA 2WP9B 3NVZA 1DOIA 2EKIA 4KX6B 4ZHPA 1YJJA 2DWQA 2WU5B 1E9MA 1N5XA 1DOXA 1TJEA 3NRZA 4JWSC 4IDIA 1XLNA 1RWSA 2G1EA 1TKEA 1NVID 1J7CA 2LEKA 1FRRA 4HROA 1ZUD2 1E6EB 3P4RB 4LTUA 1FM0D 1OQQA 3VR9B 5H92C 2BS3B 1PFDA 1NEKB 3AEFB 3NS1A 5AUKA 1E10A 2JX5A 4HRSA 3CWIA 3AECB 2QIEB 4C7ZA 5G5GA 1GAQB 2PIAA 4YXDB 2L83A 3FC4A 2H88B 4C7YA 4C80A 4YTMB 3BIID 1J7BA 3AV8A 2PVOD 3AE9B 1DOYA 1L0VB 1YQ3B 4ZOHC 4N6EB 4YTPB 2K9XA 3AE5B 4A9AA 3AH7A 1L6VA 2MJDA 3AE6B 3AE1B 3LXFA 4N58A 1PDXA 1SB3C 2CJOA 2W3SA 3DWMA 4USAA 1RYJA 1N62A 3SFDB 4YSXB 2PKOA 2HTME 2WLBA 3B9JA 1FXAA 2N0SB 1VLBA 1PUTA 5G5HA 1NI3A 1ZP0B 1B9RA 2WDRB 4YSYB 3P4SB 1JRPA 2KAJA 4WQMA 2KMMA 4FXCA 1A70A 2CJNA 2JQRB 3WCQA 2B76B 1I7HA 1OFFA 1ROEA 5EE3A 4ZHOA 3VR8B 4JX1C 1L6UA 1V8CA 3AM9A 3VRBB 2BT6A 3LB8C 3EUB2 4YT0B 1QF6A 1F0ZA 1N60A 1R7SA 1TKYA 3AEGB 3AE2B 1JW9D 1VDVA 2AX5A 1CJEA 2QJLA 1JROA 1WRIA 1JWBD 1N61A 5AUIA 3PO0A 5H8YE 4N59A 1QOBA 4YTNB 3FAHA 5C2TB 2Y5CA 3P63A 1KRHA 1FFUA 1VJKA 2K5PA 1N63A 2WDQB 2W3RA 2WU2B 3AB5A 4US9A 1RM6C 1IUEA 1FFVA 1V97A 2Q5WD 3HUIA 1QOGA 2FBWB 2L52A 1UWMA 2WS3B 1NYRA 2BS2B 3HVZA 1QOAA 1QLBB 4JWUC 3AE8B 2M56B 5C3JB 1SF0A 4US8A 1XO3A
chains in the Genus database with same CATH superfamily
1WH3A 4G3XB 4HPPA 4N9F4 5FKAC 3PLVA 4HCNB 3VH4B 2O2VB 4GN1A 2CU1A 5EE9A 1WX7A 2PE9A 4ANUA 4EKUA 5HKHA 2ZZPB 3QJZA 3Q3FA 4B95A 4C4VB 1UF0A 4IUMB 4WURA 3DHHC 4NAMA 1MI0A 4AUQC 4S0RA 2KANA 3ZTDA 1JMLA 1DOIA 4URKA 1WGDA 1ZGUB 1TZOA 1XT9B 3RN9C 2RPQA 2LJ5A 1S3SG 2MP2B 4GSWA 4PS8A 1XD3B 4XX5A 4XWWA 3NZ3A 2RPVA 2MQJA 3OLMD 4CO7A 4CHKA 1SB3C 1YQBA 4YSXB 4IWQA 2NBUA 3KQ4A 4JPSA 4OVVA 1WGHA 1WSPA 2WDRB 3N30A 1JRPA 5IO9A 3R7RA 2IO1B 2R61A 2O2VA 2KWUB 2ZNVB 2LHDA 4ICUA 1UGJA 4I6NB 3AM9A 4LCDE 4LNKA 5IA7A 3PZ8A 1EF1A 4C4VA 3AEGB 1ACCA 4K7WA 4LNFA 2BPSA 3A4SC 4IM0A 3UINB 2N9EB 2JPHA 3PZDA 2FBWB 3PZ7A 3ZRFA 1XCTL 2V3SA 2KWDA 3RNBC 2NMQA 4HK2A 2DLBA 2LGXA 4MGYE 2D5GA 2K1FA 3VDZA 2N1WA 2MP2A 2KTFA 2PTLA 4ANVA 4W9IA 2PEAA 3KYCD 1RAXA 1FMAD 3KW5B 2WHIA 4RM9A 3PLUA 3IT6B 3ZJUA 5L83A 2SEBD 4GLSC 2N7EA 3PV1A 1D5ZC 1XLQA 3Q14C 1FO4A 2HD5B 2WP9B 1SXTA 4KX6B 3KLSX 3BYYB 3HK0A 4LDTB 4DDID 3P4RB 1NEKB 5AUKA 3L54A 1IGDA 3EGRA 2JYEA 1C76A 3R8BA 4YTMB 1V81A 2KN4A 2K9XA 2K6QA 4HWIB 1ESFA 2GBMA 2W3SA 2JXTA 2N0SB 3UIOB 1PUTA 4LNOA 2J42A 3EC8A 1KLUD 2IYDB 4BKTA 2MBHA 1C1YB 1BUIC 4KGRA 4RFBA 1WI0A 2LHEA 4OZBA 4E3CA 3B1LX 2N1VA 4Q2JA 3ZNZB 1E8WA 2JU6X 3DBRB 1T5XD 4R3DA 1SE9A 1Q0WB 1C9FA 2WXLA 1TS3A 5CHWA 3L0WB 2MCNB 2ON8A 2AL3A 2UYZB 3AU4A 2ZVNA 3A9KB 2MJ3A 2WDVB 3AMZA 3IG3A 3W5UB 2Z0DB 1GB1A 3FILA 4BKSD 1JWSD 2WX1A 2LVQA 4AQ7A 1TTNA 2MBQA 3DWGC 4GXBA 1EU3A 3ONSA 2BF8B 4WJQA 5E6JA 4CQNA 3B2GA 3NVWA 3LJ3A 3E56A 4DDGD 2D3BA 1NI2A 2BVCA 3QIJA 1TKEA 1P98A 2IY1B 2DHZA 4F7ZA 3A9JB 1E10A 1LQBA 4M01A 1V86A 4RF1A 2JSVX 1FXTB 4KIKB 3AE9B 4OVZA 4ASWC 4A9AA 1F9JA 4P7IA 2JXXA 2BTEA 4KSLC 1B9RA 2GRIA 4JE3B 5BYSA 1WJ6A 1ZE3D 2WXPA 3A9KA 4IWPA 3P42A 2KZRA 2IDYA 1SIFA 4FJYA 3GOEA 3O65B 4LJOB 4ZDVA 3GE8C 4KGTA 1TGZB 1D4BA 4W9CA 1KOTA 2ZW1A 3FKYA 2WXNA 2VZKD 1ZW7A 1WGRA 1KH0A 1N63A 4ZRIA 2J0KA 3IHPC 1Q5WB 3A4RA 1QOAA 3E9SA 3M3JA 2LUMA 3U7ZA 3AEAB 2YEPB 1KLGD 2IO0B 1L0YB 1AWDA 2FE8A 3A9JA 1UNSA 3SR6A 2MHJA 2H89B 1T3QA 4AJYB 2L00B 2WQYB 4KIKA 1WGYA 3CSFA 2KYWA 4FA6A 3V60A 4QAYA 2NPTB 3HRDD 4D2KA 2IGGA 4XYCA 4YWGG 2INNE 2INDC 4GDLB 1L2NA 2KK8A 2FIDA 2BYTA 3CSTA 2RDBC 4ITKA 4ZHPA 2WU5B 4IKGA 1F52A 3MTNB 1I4RA 1D5XC 3RYTA 2KD0A 1J7CA 2I1JA 1FRRA 1PGAA 5H92C 1SBBB 1MHHE 3Q3OC 4FADA 3ALBA 4HRSA 1Q10A 4EFOA 2H88B 3DBSA 5D7GA 1WYWB 2JZ3B 4ZRJA 2YLMA 1Y56A 5JZEB 2J52A 3RNEC 2RR9A 1LO5D 3PPAA 2PKOA 4MGIE 2AL6A 3DBLB 2HTME 2IO2B 4FJZA 2I2YA 3BK1A 5GMVA 2MA9B 1FNVA 3L16A 4PS7A 1IBXB 4M0WB 1WY8A 4JX1C 1C77A 3LB8C 1QF6A 2BWES 1R7SA 4HEA1 1JWUD 1D3ZA 1JROA 2NPTA 5IP4D 2N9LA 3U2SC 1JRUA 4YTNB 1E7UA 4GDLA 1V1PB 2PPHA 4TMAB 1FEHA 3H9DA 2QEJC 2K8BA 2LGIA 3ZVVA 1WM3A 1VCBA 3JSVB 4DBGA 4X57B 2JF5A 3DOWA 2MBBB 1SSNA 3DBRI 4IM2A 4WWMA 2CS4A 5HFYA 4MM3B 2KJRA 2K6DB 2VH1A 4KZCA 1WWTA 1D5MC 3IFWB 5KHQA 2VH2A 4E74A 5EDSA 1ZPSA 2DYBA 2HJ8A 1FIQA 5DPRA 2LMCA 2ACZB 3I57A 3Q2AC 2FUHB 2W55A 1IBXA 2BGFA 4M0WA 4NNJB 3R2TA 1FD6A 3X23A 3A1QB 4BBNC 4JIOU 3ML8A 1HTOA 4WAFA 3VFKA 1ZDVA 1E90A 1V1PA 3CWIA 5G5GA 5LLIA 4IG7B 3KUZA 1WE7A 3KUDB 3UGBB 3AE5B 3JSVA 4M8MA 3R66C 1WRDB 2LZ6A 2RGFA 5G5HA 4MM3A 2KMMA 1PQSA 4FXCA 1WJ4A 1A70A 1ZDXA 2JQRB 3J9CA 2G45B 4WWOA 1V8CA 3T3OA 3TBLD 2NTSA 3PO0A 1WXSA 1QOBA 3V3XA 2O6VD 2KVRA 1DOYA 1X1MA 3HHMA 3GZNI 4RMAA 1HXYD 3U8ZA 1M4VA 3R2IA 3TJPA 2KACA 4K3CA 1L5PA 3NVVA 3A1QA 3P1MA 4DXFA 1J19A 2X8XX 1WXQA 2LXCA 2W9NA 3N3KB 1WM2A 2FCSA 1TYGB 1E5WA 2GBNA 4YL8A 3VUYA 3AEDB 2GI9A 2RDHA 1QT9A 4FHJA 5BYQA 1UELA 4M02A 3AE7B 2NTTA 2K22A 3AEBB 2XBBC 3MP9A 3Q8AA 3NOBA 4DHJD 1SE4A 3SHQA 3I3TB 3ZUNA 3BYTB 4GDKA 3KWLA 2R2OA 1XQQA 3N1YC 1OQQA 2AQ3B 4KGSA 4GMVA 2WXMA 3EHVA 1GAQB 2HDEA 2PIAA 1ET9A 4MH0E 2PVOD 2G4DB 1L0VB 2WXHA 3MHZA 1GG3A 1L6VA 3AH7A 2OJRA 2QDFA 4USAA 1PDXA 3ZXRA 1H4RA 2PLPA 2L32A 2BBCA 3B9JA 4BBNF 1VLBA 1PYWD 4HLEA 4WQMA 3RZFA 4OZAA 2L3ZA 2M0XA 2B76B 1OFFA 3UI3A 5AZFA 3DVNV 2NVUI 1TBEA 2N7DA 2OEDA 2ZCCA 4MT5A 2LGYA 3ZTCA 4JLCA 5DPSA 1T0RC 5E6OA 3N32A 2WXJA 2L52A 2DX5B 5DPWA 2UWQA 3APFA 5E6PA 1BXTA 3PHXB 3VUWA 5CX3A 5IAAC 5L95C 3TUOA 5DPTA 3L4PA 3RPFC 1UBIA 1Z2MA 2XN9C 3PRMB 1WMHB 2C7HA 2IBIB 3DDCB 3RFZB 4TQ1A 2VRRB 1GC6A 4KKIA 2KHWB 4A55A 1EO6A 1VR9A 1JQ4A 4FN2A 1C4AA 3VHTC 3NY5A 3EECA 3AE4B 3P4QB 3V6EB 3PT2B 3ZYYX 1KFYB 2N9PC 4XGAB 2BQQA 2PJHA 3ETRA 3PHWB 1J8CA 4WAAA 1N5WA 3NVZA 1YJJA 1FNUA 2DWQA 3GP7A 3APCA 5CHVC 4IDIA 3ZNGC 2KWVB 3Q8BA 3NJTA 1E6EB 4MGKE 2DYOA 1LGRA 4EZJA 1TZ1A 2C5LC 2D3AA 1YNTE 5BMGA 1K52A 4TKNA 2N9KA 4KV2A 2KX0A 1VRAB 4RF0A 1MG4A 1WE6A 3V61A 1YN5A 1YN3A 3AE6B 4A6QA 2MLBA 3CMMB 3IT4B 1WMHA 3NS8A 3MC9A 2Y5PA 4FBJB 1P7EA 1T6BX 4EOYA 3NHEB 2D2QA 3EFCA 3ECIA 3VR8B 5IN7A 4P16A 3H7PB 3RNCC 4A20A 1WR1A 1HEZE 2D07B 3TL5A 1VDVA 1K51A 3JVZX 3FILB 4IOIE 2G9HD 2OOBB 2W3RA 1C4CA 3RNAC 1VZ6A 2WGSA 3B08A 3EFUA 2M56B 1AW7A 5C3JB 4W9JA 3RD2A 4MEMA 3H6NA 2J53A 3N9YC 2OHFA 3BZDB 3I5JC 4BOSC 2NBWB 1KF6B 3N20C 3VQIA 2ZNVC 1F2RI 3U7DA 3M95A 1R4NB 4BOZB 3RI7C 1HE8A 2BB6A 1EWCA 1WYGA 1XXGA 5C23A 5BMIA 2BS4B 3I9V1 4RM8A 3WALA 4PT5A 1WGKA 3RT3B 3H7PA 2JYTA 1E9MA 2RSUA 4KSKC 1NVID 3I63C 1YX6B 1PFDA 4M00A 5BMHA 4HKZE 3PSEB 2JZZA 3ZIMA 2IGHA 2L83A 2GMIC 2GBKA 1I4XA 1GB4A 2CHZA 1MFWA 3KWVA 4N58A 3T3NA 2J0MA 5BYRA 3N1ZC 2KVZA 3W1SA 3U4EG 1FXAA 4A8XC 3NG0A 4HPLB 4J3OD 1YOVB 2PMVA 2J7QB 4FULA 2KAJA 1C3TA 1V49A 3JW0X 1P0RA 2M1MA 2N7JA 3Q8EA 2XNAC 2L1AA 2I1KA 1FNWA 3GB1A 2KDMA 3MJWA 1E8ZA 2KJ6A 3QC8B 1OEYJ 1I42A 4YT0B 3OJ4B 2L7RA 1JW9D 1WRIA 4TUUA 1XF5L 1UD7A 2N9XA 1FFUA 2K5PA 2C7NB 2KDBA 4J6IA 4JL9A 3RMKC 4W9KA 4GOCA 2GLSA 4LLGM 4HDQA 2KFJA 1UWXA 2KO3A 5G55A 4P1CC 4BVUC 3UIPB 1V1OA 3ABVB 1E7PB 5BO4B 1I4GA 4BFRA 4KZ0A 2QILA 1PGXA 5GXGB 4FHKA 4NJ7A 3V05A 1YJ1A 2LVPA 5D6JB 2AQ2B 4W9HA 1TT5B 2K39A 2RMMA 2E3TA 2L8JA 1R4MB 5EE0A 3UQBA 4FJVB 3Q8CA 2K25A 1CZPA 2KFKB 3AEEB 4W9LA 4BKSA 4A3PA 4XC2A 4GB9A 3K9OB 5AZHA 2C60A 2VZKB 2V0GA 2DZKA 4HROA 4LTUA 3JYUA 1RRBA 3QA8A 1GUAB 1XEEA 2CKHB 3Q69A 4RGOS 3ZO5B 1YMHE 2M8SA 4DHZE 1J7BA 3OJ3A 3OAWA 3DQVA 4YTPB 5D3IB 1N6ZA 3AE1B 1CK1A 2LGSA 1SE3A 2DZIA 4DXGA 2V9HA 2WXOA 4I6PA 1G6JA 4DXAB 1BT0A 1I4PA 5HG2A 2V4IB 3H8HA 3ZRCA 1GOZA 4DHZB 2KKCA 2QC8A 5LXIB 3C19A 2Z8LA 1EU4A 5CTRC 2LXAA 2QJLA 4H2AA 4KVGB 2K0PA 3IBEA 1WX9A 4OHJA 1SGHA 4US9A 3NUHB 3WANA 1V97A 2KFKA 4EZLA 2BWFA 1PGBA 3NZUA 2GOWA 4RGTA 4PYZA 2MH7A 4JQWC 1S1QB 2WYQA 1F1HA 2NBVB 5EE1A 1WXMA 1XLPA 2MW5A 2HE7A 2FCMA 1YX5B 2MJEA 1A5RA 1DGJA 4ZRPA 1TS5A 2M17A 1WXVA 2W82A 5FR3A 3BWUD 5IOIA 1GJZA 4II2B 2DAFA 5TR5A 2WXFA 1XCQL 1J7AA 3IAM1 2PVGC 3DBHB 4NAWB 4HJGE 2FNJB 2DAJA 4ZRKA 3MFGA 3O13A 4WIPA 4NQKE 4A90A 1QILA 2G1EA 2V4LA 3TSSA 3DVNU 1ZUD2 2L76A 2R2QA 4TQ0A 4K7UA 2MRPA 4IM3A 3AI5A 3V6CB 2QIEB 3ML9A 3BIID 1H8CA 4G11A 2LRWA 2MJDA 4ZHOA 2FCQA 3DWMA 3ZGZA 2KQ7A 4ZYNA 3PTFC 1ZP0B 4YSYB 3H1UA 2J0JA 2LI5A 2K8CA 3W1YA 3PVLA 1WR6E 1UBQA 3EUB2 4ICVA 2FCNA 4MH8A 3EA6A 3BVMA 1QZEA 3DVGY 2Y5CA 1VJKA 2A5UA 1MVKA 2WU2B 2LFIA 3RUIB 2MEKA 1E7VA 2ZJDA 1NYRA 5AEKB 4NAWA 1YN4A 4MSQB 2KX3A 2HJ1A 2BB5A 4GDKB 4XE0A 3BVGA 1HA5A 2EELA 2KDEB 3C8YA 1V9JA 2M19A 4GIVA 2ZEQA 1ISNA 1VD2A 1NBFC 1AYFA 2GBJA 1P7FA 1SIJA 1P9DU 4K3BA 1AN8A 1E8YA 1BMLC 2INCC 3QX1A 4I6LB 3ZNID 1WGGA 3RNFC 3DPDA 1LFDA 2NR2A 2KTRA 2D10A 1STEA 5JHBA 1WJNA 2QMTA 2QHOA 1JCKB 4WJNA 1TJEA 2EMTA 2JUOA 3X0WA 1SEBD 3ZNHB 5D94A 4MELA 2XK5B 2O6VB 1FM0D 4WQOB 1JWMD 2E6XA 4AJWA 1P3QU 3DHIC 4C7ZA 4PS3A 3VTUA 4TSSA 5JXVA 3RNGC 3H7SA 3M62B 1UH6A 4ZOHC 1V5TA 4BAXA 3PRZA 1YIWA 2MX2A 3QARA 3UQAA 2KLCA 2YEPF 1TY0A 1ENFA 5J2RA 1L0XB 2WX0A 4PYUA 3PRPB 3OWEB 2TSSA 1MG8A 2KDFB 1TIFA 1K53A 3RZWC 3VRBB 2AQ1B 4KDIC 3AE2B 1CJEA 5H8YE 4DHJB 3NZSA 3TCAA 3M63B 1FFVA 1WZ3A 3L13A 3DBLI 3HVZA 1J0GA 4B0EA 4EE2A 4OZCA 1P1AA 3TIXA 4K81A 4XZ4A 2BKRB 2XK5A 2O6VA 1OQRA 2BYFA 2UU7A 4BKGA 2AWTA 2N4FA 2DENB 1YJIA 1EWYC 1WZ0A 4E71A 3LYYA 3KH0A 2FAZA 1C4PA 3UF8A 5E6NA 2CHXA 2L0FA 5JH5C 3QCAA 2FUG1 4S17A 1YQ4B 2KMAA 3HVDA 2D11A 1OEYA 1FCLA 2KDIA 1FPYA 4F8CB 2PW9A 3QWZB 4ZRQA 4FLHA 2MBOA 2CR5A 3KUCB 2YVCA 1VZ8A 3L10B 1MJDA 2EKIA 4NQLB 3R7QA 3DBHI 2LWPA 1RWSA 4HXDA 4MACA 1T0YA 2ZPNA 1DYQA 3HM6X 1TS4A 3WAMA 2JWUA 2LJIA 1OQYA 2KXJA 4ARIA 3ENEA 3APDA 2ONQA 1F2RC 1Q1OA 2Y5BB 4ACFA 1KM7A 4RH6A 2Z0EB 1SJHD 4WJPA 1NI3A 4HJKA 5FR6A 3VVWB 3T8MA 2WDTB 3QK0A 1I7HA 5J17A 4W9DA 4IC7B 1F0ZA 3ZQ4A 3BK2A 3GS2A 3SU8X 2AEHA 2HTHA 4LDTD 3IAS1 5HI1A 3PGEA 4ANXA 3TEWA 1OTRB 1KRHA 2WDQB 1E8XA 3AB5A 4UDUC 2K8HA 1QOGA 3WIMA 2JRHA 4JWUC 1QLBB 1FCCC 3W2DA 1XO3A 3AE3B 2V1YA 1TKGA 4MGZE 1Y8RC 5MPOA 1B1ZA 4AS1A 4MSMB 2Z59B 2FIFA 1RFKA 1E0ZA 1IPGA 2GBRA 4G0NB 1I4QA 3NVYA 4C56C 4P1BC 3DHGC 4M8NA 2IZVB 3SFEB 2M0AA 4ANWA 1CMXB 3P2BA 3WA0A 2IGDA 1HZ5A 2PE6B 2IO3B 1TS2A 1C78A 5TSSA 2OJWA 1DOXA 4L23A 2WWZA 1RLFA 1QQRA 2LEKA 3Q6BA 2WXGA 4PK1A 1ZXHA 2BS3B 5C1ZA 5AZGA 1WJUA 4NPNA 3N1XC 4OW0A 4KDLB 3AU5A 4G50A 3AV8A 1WFYA 3Q3MC 4XWTA 4L2YA 1N62A 2WXRA 1ET6A 3TEXA 3P4SB 3R3MA 4W9EA 4MJSB 1ZKHA 3L17A 1ROEA 5EE3A 4ARCA 3ZJVA 2AYOB 3HM3A 5G2NA 2J4XA 1KTKA 1CQVA 1WXAA 2QSDA 2LRUA 1SE2A 3VH3B 1L4ZB 5C2TB 1T0SC 2DYMA 3BY4B 3MC0B 2ZCBA 4DWFA 3P63A 4LNIA 1RM6C 2JRIB 2NCNA 2BW2A 4MDKE 4F1SA 2WXQA 3AE8B 1SF0A 1T0QC 2M4NA 3BINA 3HIZA 2DZMA 1C79A 4W9FA 4GU2A 1M94A 3SDLC 3W5VB 4ZYSA 3P4PB 1ZOYB 3B2FA 1I4HA 3KYDD 2KWCA 4II3B 3CIRB 3A33B 2D3GA 1OGWA 3U52E 1NDDA 2CU3A 3W9CB 2L05A 4NZLB 2KT7A 1GNUA 4TV3A 3ZDTA 3T9LA 2A4ZA 2WNMA 5I4DA 5IKCM 2KLGA 2BYEA 1NENB 4MJSA 1I35A 1JALA 1HQRD 1IGCA 2KC1A 2ZW0A 1XLNA 2BKFA 3VR9B 3U30A 1WF9A 3AULA 3NS1A 3W1SC 4EUTA 2JX5A 3B0AA 2KC2A 3AECB 1L7YA 3K9PB 4YXDB 5LXHA 3FC4A 4EEWA 3QQ8B 2KN5A 4N6EB 1LXDA 4O1NA 1HTQA 3ZXVA 2CJOA 2KQ4X 4GGQA 3S2AA 3GZNB 2C7MB 2RD0A 3ZDMC 1IP9A 1EM7A 2K3UA 1L6UA 2BT6A 1LM8B 3KVFB 4LK0M 4WWPA 1N60A 4HKQA 4IWOA 1N61A 3FAHA 1IYFA 4XDDA 3TMPB 2SAKA 4NY0A 3TEYA 2REXA 3PS6A 2BYVE 2G4SA 1AARA 2NS5A 3MC8A 2MWSB 4HVBA 2KNBA 1QOFA 3RCZA 4REZA 2W54A 3SEBA 1ZXIA 3AN1A 1XLOA 2DNFA 3DCGA 1WX8A 2I38A 2C9WB 3IVFA 1KLVA 1V6EA 3C0RB 1NYQA 4LNNA 3VTVA 1FXIA 1L4DB 2ASQA 2IJ0A 2JWZA 3WAOA 1VZ7A 1D6EC 2DBYA 1V2YA 1GPXA 4IW0A 4P6VF 2MSED 5JHAA 1RFAA 2JY6A 1K50A 1N5XA 4LJPB 3NRZA 1UUPA 5DCNA 5LNK1 3AEFB 1UZXB 3SD5A 4NJ6A 1R4NI 5T8IA 1V80A 4C7YA 4C80A 3WAPA 2KJHB 3V62A 2GB1A 1EUVB 3SFDB 3Q3JA 4WJOA 1QKZA 2D3CA 4CYEA 2WLBA 3TEZA 2V3PA 3WCQA 2CJNA 3CF6E 3URYA 2Y3AA 5HHDG 5KHOA 4RGNA 3D32A 4AOFA 2LGDA 4HPMB 2AX5A 3GE3C 5AUIA 2EMSA 5J18A 4HDOA 1Z5SB 4A3OA 1IUEA 2Q5WD 2KMCA 2LASA 4B6WA 1UWMA 2JT4B 4RGMA 3VUXA 3VTWA 1V5OA 2KTRB 2XEWA 5FK9C 1UGMA 2LVOA 5D3DA 3MJ5A 3ZJTA 3RULA 1TY2A 4B0MA 4WH4A 2MBEA 4YSZB 1SJED 1YD8U 2ZPYA 2LUEA 4XDCA 1MPEA 1U4AA 2INPE 4RCOA 4W9GA 2KOXA 3AXCA 3VRAB 1KJTA 4AP4C 3LDZE 1JWAD 4OVUA 2QCZA 1HZ6A 1FRDA 3IXSA 3QHTA 2X38A 5D2MB 4L1BA 1GC7A 2IPKD 2ZVOA 2ICIA 3ZW3A 4JWSC 3ZKJC 1MHXA 4RNAA 1WIAA 1K8RB 3Q3NC 1EF5A 3ZLZA 4K7SA 4K1RB 2KQSA 4WWNA 4AWJA 2WXIA 2LD9A 2G3QB 1F77A 1YQ3B 3OG5A 3VXWA 2EKEC 4BZAA 2RDGA 3LXFA 1R4MI 1RYJA 3Q8FA 2JVCA 2JZPA 2WXKA 3VAWA 3PREA 4DQOC 4C00A 4NJCA 4KKJA 2L0TA 4HCPB 4DK5A 4EZKA 3MHSD 2B3AA 4JGHB 2IY0B 5CHFA 1TKYA 4B9KA 2DZJA 1JWBD 4N59A 2V3NA 3HUIA 3BVZA 3DVGX 2WS3B 2BS2B 3L08A 3QAQA 4US8A 2CHWA
chains in the Genus database with same CATH topology
3AE3B 1SSNA 1TKGA 4WWMA 1V1OA 3ABVB 1E7PB 5FKAC 5HFYA 5MPOA 4MM3B 1B1ZA 1I4GA 4AS1A 1RFKA 2QILA 1E0ZA 1WWTA 5EE9A 1PGXA 1D5MC 5GXGB 1I4QA 3NVYA 3V05A 4C56C 1ZPSA 2AQ2B 1FIQA 2LMCA 3SFEB 2M0AA 2ACZB 4WURA 2RMMA 3I57A 2IGDA 2E3TA 1HZ5A 5EE0A 4NAMA 3Q8CA 1CZPA 1MI0A 3AEEB 1TS2A 2W55A 1IBXA 1JMLA 4M0WA 3R2TA 1DOIA 1C78A 5TSSA 1DOXA 4L23A 1FD6A 2VZKB 1QQRA 2LEKA 1TZOA 4HROA 4LTUA 2WXGA 2V0GA 4WAFA 1ZXHA 2BS3B 1ZDVA 4OW0A 1V1PA 3CWIA 5G5GA 1XEEA 4RGOS 3Q69A 1YMHE 1J7BA 3AV8A 4YTPB 5D3IB 4XWWA 3NZ3A 3AE5B 2RPVA 4XWTA 3AE1B 1CK1A 4L2YA 1SB3C 1SE3A 4YSXB 1N62A 2WXRA 3KQ4A 1ET6A 4JPSA 4DXGA 5G5HA 3TEXA 1WSPA 2WXOA 2WDRB 3P4SB 1JRPA 1I4PA 2R61A 2KMMA 4FXCA 1A70A 1ZDXA 2JQRB 3J9CA 5HG2A 1ROEA 5EE3A 2LHDA 2V4IB 4ARCA 3ZJVA 1UGJA 3H8HA 1V8CA 3AM9A 3T3OA 1GOZA 2J4XA 1KTKA 3PZ8A 2Z8LA 1CQVA 1EU4A 2QSDA 1ACCA 2NTSA 2QJLA 3AEGB 4H2AA 1SE2A 3PO0A 2K0PA 4OHJA 1QOBA 1L4ZB 5C2TB 3MC0B 2DYMA 3V3XA 3P63A 4US9A 1DOYA 3NUHB 1RM6C 1V97A 2FBWB 3PZ7A 1XCTL 2BW2A 1HXYD 2WXQA 1M4VA 2KWDA 1PGBA 3AE8B 3R2IA 1SF0A 2NMQA 2KACA 4RGTA 1L5PA 2DLBA 3NVVA 3P1MA 4DXFA 1C79A 2MH7A 2D5GA 3W5VB 1WXQA 3P4PB 4ZYSA 5EE1A 1XLPA 1ZOYB 3B2FA 1I4HA 1TYGB 2PTLA 2MJEA 1DGJA 4ZRPA 1TS5A 3CIRB 1FMAD 3AEDB 2GI9A 3U52E 2RDHA 2CU3A 1QT9A 2W82A 3ZJUA 3IT6B 5FR3A 3W9CB 4NZLB 5BYQA 3BWUD 3AE7B 2SEBD 2NTTA 2WNMA 2K22A 4GLSC 5I4DA 3AEBB 3MP9A 3Q8AA 1NENB 1D5ZC 2WXFA 1XCQL 1J7AA 1SE4A 3IAM1 1JALA 1HQRD 1XLQA 3BYTB 1FO4A 3KWLA 2PVGC 1IGCA 2WP9B 4NAWB 1SXTA 4KX6B 3KLSX 4HJGE 2ZW0A 3BYYB 3MFGA 3O13A 4WIPA 4A90A 1XLNA 1QILA 2G1EA 3TSSA 1ZUD2 3VR9B 3P4RB 1OQQA 2AQ3B 4KGSA 4TQ0A 1NEKB 3NS1A 5AUKA 2WXMA 2JX5A 3AECB 2QIEB 1IGDA 3EGRA 1GAQB 2HDEA 2JYEA 1C76A 2PIAA 3FC4A 1ET9A 3R8BA 4YXDB 4YTMB 3BIID 2PVOD 1L0VB 2KN4A 4N6EB 2WXHA 2K9XA 3MHZA 4O1NA 3AH7A 1L6VA 2MJDA 1ESFA 4USAA 4ZHOA 1PDXA 2CJOA 2W3SA 2KQ4X 3DWMA 2JXTA 3ZGZA 2PLPA 2L32A 2BBCA 3B9JA 2N0SB 1VLBA 1PUTA 2J42A 1ZP0B 1KLUD 4YSYB 1PYWD 4WQMA 4OZAA 1EM7A 1BUIC 4KGRA 2B76B 4RFBA 2K3UA 1OFFA 3UI3A 1L6UA 2LHEA 2BT6A 3EUB2 2OEDA 4LK0M 4MH8A 4OZBA 1N60A 4HKQA 4MT5A 3EA6A 1N61A 3BVMA 3FAHA 4XDDA 2Y5CA 1VJKA 2SAKA 1MVKA 2WU2B 2WXJA 2LFIA 4Q2JA 3TEYA 2L52A 2MEKA 2JU6X 1NYRA 1YN4A 1BXTA 1T5XD 4R3DA 2BB5A 4GDKB 1QOFA 3TUOA 2WXLA 4XE0A 3BVGA 1HA5A 1C9FA 2EELA 3L4PA 4REZA 1TS3A 3RPFC 2XN9C 3C8YA 2M19A 2W54A 3SEBA 3RFZB 4TQ1A 2ON8A 4KKIA 1ZXIA 1XLOA 1AYFA 3AN1A 1P7FA 1SIJA 2MJ3A 4A55A 1VR9A 2WDVB 3AMZA 2I38A 1JQ4A 1C4AA 3W5UB 1AN8A 1BMLC 1GB1A 1NYQA 3AE4B 3FILA 1JWSD 3P4QB 1FXIA 1L4DB 2IJ0A 3ZYYX 1KFYB 1VZ7A 1D6EC 2DBYA 4AQ7A 1GPXA 3DWGC 1EU3A 4P6VF 3ETRA 5E6JA 4CQNA 1STEA 3B2GA 3NVWA 3E56A 1K50A 1N5WA 2QMTA 3NVZA 1YJJA 1FNUA 1JCKB 2DWQA 1N5XA 3GP7A 1TJEA 1UUPA 3NRZA 4IDIA 1SEBD 1TKEA 3Q8BA 1E6EB 1FM0D 2DYOA 5LNK1 3AEFB 1JWMD 2E6XA 1E10A 4C7ZA 1YNTE 5BMGA 5T8IA 4RF1A 1K52A 4TSSA 4C7YA 4C80A 5JXVA 2JSVX 2N9KA 1VRAB 4RF0A 3AE9B 4OVZA 4ZOHC 4A9AA 2GB1A 1YN5A 1YN3A 3AE6B 4A6QA 3SFDB 1QKZA 2BTEA 2WLBA 3IT4B 1B9RA 2GRIA 2YEPF 2Y5PA 4JE3B 1TY0A 5BYSA 1ENFA 1P7EA 1ZE3D 2V3PA 1T6BX 3TEZA 1L0XB 2WXPA 3P42A 2IDYA 2CJNA 3OWEB 3WCQA 2TSSA 3URYA 1K53A 2Y3AA 3VR8B 5HHDG 4P16A 4RGNA 3VRBB 2AQ1B 4KGTA 1HEZE 3AE2B 1VDVA 1D4BA 1K51A 1CJEA 2AX5A 5AUIA 2ZW1A 2WXNA 2VZKD 5H8YE 3FILB 4IOIE 1KH0A 2G9HD 1N63A 2W3RA 1C4CA 1IUEA 1FFVA 1VZ6A 2Q5WD 1UWMA 3HVZA 1QOAA 3E9SA 4RGMA 2M56B 1AW7A 5C3JB 4B0EA 4EE2A 4OZCA 2LUMA 5FK9C 3U7ZA 3AEAB 5D3DA 2YEPB 1KLGD 2J53A 3MJ5A 3ZJTA 1L0YB 1AWDA 3N9YC 1OQRA 1TY2A 2FE8A 4B0MA 4WH4A 2OHFA 1UNSA 3SR6A 3BZDB 2H89B 4YSZB 1T3QA 1SJED 1YJIA 1EWYC 3LYYA 1KF6B 2WQYB 4XDCA 1MPEA 3VQIA 4RCOA 2INPE 1F2RI 1C4PA 3VRAB 2BB6A 2FUG1 1EWCA 1YQ4B 1WYGA 1XXGA 3HVDA 3HRDD 5BMIA 4D2KA 1FCLA 1JWAD 2IGGA 2BS4B 4YWGG 2INNE 3I9V1 1HZ6A 4GDLB 1FRDA 3IXSA 2PW9A 4ZRQA 2X38A 2BYTA 4PT5A 4L1BA 1WGKA 1VZ8A 4ITKA 2EKIA 2IPKD 4ZHPA 2JYTA 2ICIA 2WU5B 4IKGA 1E9MA 1I4RA 4JWSC 1D5XC 1RWSA 1MHXA 4RNAA 1NVID 1J7CA 1FRRA 1PGAA 5H92C 4MACA 1PFDA 1SBBB 1DYQA 1MHHE 1TS4A 5BMHA 4HRSA 4HKZE 2JWUA 1Q10A 2IGHA 2LJIA 2L83A 2H88B 5D7GA 2WXIA 4ARIA 1F77A 1I4XA 2ONQA 1F2RC 1YQ3B 1GB4A 1Y56A 3KWVA 4RH6A 2RDGA 3LXFA 4N58A 3T3NA 2J52A 1RYJA 5BYRA 1LO5D 1SJHD 3Q8FA 2PKOA 2HTME 2JZPA 3U4EG 1FXAA 3W1SA 4A8XC 1NI3A 4J3OD 2PMVA 2WXKA 2I2YA 4DQOC 3BK1A 4NJCA 2KAJA 4KKJA 3Q8EA 2N7JA 2XNAC 2L1AA 1FNVA 1FNWA 3GB1A 2KDMA 1I7HA 1IBXB 4JX1C 1C77A 3LB8C 1QF6A 4YT0B 1F0ZA 3ZQ4A 3BK2A 3GS2A 1R7SA 1TKYA 1JW9D 4HEA1 1JWUD 1JROA 1WRIA 1JWBD 3IAS1 2N9LA 4N59A 5HI1A 3U2SC 4YTNB 1XF5L 3TEWA 2V3NA 1KRHA 1FFUA 2WDQB 2K5PA 1V1PB 3AB5A 4UDUC 4TMAB 3HUIA 1QOGA 1FEHA 3BVZA 2QEJC 2WS3B 4LLGM 2BS2B 2LGIA 1QLBB 4JWUC 1FCCC 3W2DA 1UWXA 4US8A 1XO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5P A;  1QOF A;  3AEA B;  3NVV A;  3AE3 B;  3P1M A;  1TKG A;  3L4P A;  2MH7 A;  3RPF C;  1AWD A;  4WWM A;  3W5V B;  1OQR A;  2M19 A;  2W54 A;  3ABV B;  1WXQ A;  3P4P B;  2OHF A;  5EE1 A;  1E7P B;  1XLP A;  3SR6 A;  1ZOY B;  2H89 B;  3B2F A;  5MPO A;  4YSZ B;  1ZXI A;  1T3Q A;  1XLO A;  1AYF A;  3AN1 A;  2MJ3 A;  1SIJ A;  1TYG B;  1YJI A;  1EWY C;  2MJE A;  2WDV B;  1RFK A;  1DGJ A;  1KF6 B;  3AMZ A;  1E0Z A;  2WQY B;  1JQ4 A;  1WWT A;  5EE9 A;  3CIR B;  3W5U B;  5GXG B;  1FMA D;  3AED B;  3NVY A;  2CU3 A;  1QT9 A;  1NYQ A;  3AE4 B;  3W9C B;  3P4Q B;  3VRA B;  1FXI A;  1FIQ A;  1YQ4 B;  1WYG A;  3AE7 B;  3SFE B;  3HRD D;  3ZYY X;  2ACZ B;  1JWA D;  1KFY B;  2K22 A;  3AEB B;  2BS4 B;  2DBY A;  2E3T A;  1GPX A;  1FRD A;  1NEN B;  5EE0 A;  3DWG C;  1J7A A;  4P6V F;  1CZP A;  3ETR A;  3AEE B;  1JAL A;  3B2G A;  3NVW A;  2W55 A;  1XLQ A;  1WGK A;  1FO4 A;  3KWL A;  2PVG C;  4ITK A;  1N5W A;  2WP9 B;  3NVZ A;  1DOI A;  2EKI A;  4KX6 B;  4ZHP A;  1YJJ A;  2DWQ A;  2WU5 B;  1E9M A;  1N5X A;  1DOX A;  1TJE A;  3NRZ A;  4JWS C;  4IDI A;  1XLN A;  1RWS A;  2G1E A;  1TKE A;  1NVI D;  1J7C A;  2LEK A;  1FRR A;  4HRO A;  1ZUD 2;  1E6E B;  3P4R B;  4LTU A;  1FM0 D;  1OQQ A;  3VR9 B;  5H92 C;  2BS3 B;  1PFD A;  1NEK B;  3AEF B;  3NS1 A;  5AUK A;  1E10 A;  2JX5 A;  4HRS A;  3CWI A;  3AEC B;  2QIE B;  4C7Z A;  5G5G A;  1GAQ B;  2PIA A;  4YXD B;  2L83 A;  3FC4 A;  2H88 B;  4C7Y A;  4C80 A;  4YTM B;  3BII D;  1J7B A;  3AV8 A;  2PVO D;  3AE9 B;  1DOY A;  1L0V B;  1YQ3 B;  4ZOH C;  4N6E B;  4YTP B;  2K9X A;  3AE5 B;  4A9A A;  3AH7 A;  1L6V A;  2MJD A;  3AE6 B;  3AE1 B;  3LXF A;  4N58 A;  1PDX A;  1SB3 C;  2CJO A;  2W3S A;  3DWM A;  4USA A;  1RYJ A;  1N62 A;  3SFD B;  4YSX B;  2PKO A;  2HTM E;  2WLB A;  3B9J A;  1FXA A;  2N0S B;  1VLB A;  1PUT A;  5G5H A;  1NI3 A;  1ZP0 B;  1B9R A;  2WDR B;  4YSY B;  3P4S B;  1JRP A;  2KAJ A;  4WQM A;  2KMM A;  4FXC A;  1A70 A;  2CJN A;  2JQR B;  3WCQ A;  2B76 B;  1I7H A;  1OFF A;  1ROE A;  5EE3 A;  4ZHO A;  3VR8 B;  4JX1 C;  1L6U A;  1V8C A;  3AM9 A;  3VRB B;  2BT6 A;  3LB8 C;  3EUB 2;  4YT0 B;  1QF6 A;  1F0Z A;  1N60 A;  1R7S A;  1TKY A;  3AEG B;  3AE2 B;  1JW9 D;  1VDV A;  2AX5 A;  1CJE A;  2QJL A;  1JRO A;  1WRI A;  1JWB D;  1N61 A;  5AUI A;  3PO0 A;  5H8Y E;  4N59 A;  1QOB A;  4YTN B;  3FAH A;  5C2T B;  2Y5C A;  3P63 A;  1KRH A;  1FFU A;  1VJK A;  2K5P A;  1N63 A;  2WDQ B;  2W3R A;  2WU2 B;  3AB5 A;  4US9 A;  1RM6 C;  1IUE A;  1FFV A;  1V97 A;  2Q5W D;  3HUI A;  1QOG A;  2FBW B;  2L52 A;  1UWM A;  2WS3 B;  1NYR A;  2BS2 B;  3HVZ A;  1QOA A;  1QLB B;  4JWU C;  3AE8 B;  2M56 B;  5C3J B;  1SF0 A;  4US8 A;  1XO3 A; 
#chains in the Genus database with same CATH topology
 1WH3 A;  4G3X B;  4HPP A;  4N9F 4;  5FKA C;  3PLV A;  4HCN B;  3VH4 B;  2O2V B;  4GN1 A;  2CU1 A;  5EE9 A;  1WX7 A;  2PE9 A;  4ANU A;  4EKU A;  5HKH A;  2ZZP B;  3QJZ A;  3Q3F A;  4B95 A;  4C4V B;  1UF0 A;  4IUM B;  4WUR A;  3DHH C;  4NAM A;  1MI0 A;  4AUQ C;  4S0R A;  2KAN A;  3ZTD A;  1JML A;  1DOI A;  4URK A;  1WGD A;  1ZGU B;  1TZO A;  1XT9 B;  3RN9 C;  2RPQ A;  2LJ5 A;  1S3S G;  2MP2 B;  4GSW A;  4PS8 A;  1XD3 B;  4XX5 A;  4XWW A;  3NZ3 A;  2RPV A;  2MQJ A;  3OLM D;  4CO7 A;  4CHK A;  1SB3 C;  1YQB A;  4YSX B;  4IWQ A;  2NBU A;  3KQ4 A;  4JPS A;  4OVV A;  1WGH A;  1WSP A;  2WDR B;  3N30 A;  1JRP A;  5IO9 A;  3R7R A;  2IO1 B;  2R61 A;  2O2V A;  2KWU B;  2ZNV B;  2LHD A;  4ICU A;  1UGJ A;  4I6N B;  3AM9 A;  4LCD E;  4LNK A;  5IA7 A;  3PZ8 A;  1EF1 A;  4C4V A;  3AEG B;  1ACC A;  4K7W A;  4LNF A;  2BPS A;  3A4S C;  4IM0 A;  3UIN B;  2N9E B;  2JPH A;  3PZD A;  2FBW B;  3PZ7 A;  3ZRF A;  1XCT L;  2V3S A;  2KWD A;  3RNB C;  2NMQ A;  4HK2 A;  2DLB A;  2LGX A;  4MGY E;  2D5G A;  2K1F A;  3VDZ A;  2N1W A;  2MP2 A;  2KTF A;  2PTL A;  4ANV A;  4W9I A;  2PEA A;  3KYC D;  1RAX A;  1FMA D;  3KW5 B;  2WHI A;  4RM9 A;  3PLU A;  3IT6 B;  3ZJU A;  5L83 A;  2SEB D;  4GLS C;  2N7E A;  3PV1 A;  1D5Z C;  1XLQ A;  3Q14 C;  1FO4 A;  2HD5 B;  2WP9 B;  1SXT A;  4KX6 B;  3KLS X;  3BYY B;  3HK0 A;  4LDT B;  4DDI D;  3P4R B;  1NEK B;  5AUK A;  3L54 A;  1IGD A;  3EGR A;  2JYE A;  1C76 A;  3R8B A;  4YTM B;  1V81 A;  2KN4 A;  2K9X A;  2K6Q A;  4HWI B;  1ESF A;  2GBM A;  2W3S A;  2JXT A;  2N0S B;  3UIO B;  1PUT A;  4LNO A;  2J42 A;  3EC8 A;  1KLU D;  2IYD B;  4BKT A;  2MBH A;  1C1Y B;  1BUI C;  4KGR A;  4RFB A;  1WI0 A;  2LHE A;  4OZB A;  4E3C A;  3B1L X;  2N1V A;  4Q2J A;  3ZNZ B;  1E8W A;  2JU6 X;  3DBR B;  1T5X D;  4R3D A;  1SE9 A;  1Q0W B;  1C9F A;  2WXL A;  1TS3 A;  5CHW A;  3L0W B;  2MCN B;  2ON8 A;  2AL3 A;  2UYZ B;  3AU4 A;  2ZVN A;  3A9K B;  2MJ3 A;  2WDV B;  3AMZ A;  3IG3 A;  3W5U B;  2Z0D B;  1GB1 A;  3FIL A;  4BKS D;  1JWS D;  2WX1 A;  2LVQ A;  4AQ7 A;  1TTN A;  2MBQ A;  3DWG C;  4GXB A;  1EU3 A;  3ONS A;  2BF8 B;  4WJQ A;  5E6J A;  4CQN A;  3B2G A;  3NVW A;  3LJ3 A;  3E56 A;  4DDG D;  2D3B A;  1NI2 A;  2BVC A;  3QIJ A;  1TKE A;  1P98 A;  2IY1 B;  2DHZ A;  4F7Z A;  3A9J B;  1E10 A;  1LQB A;  4M01 A;  1V86 A;  4RF1 A;  2JSV X;  1FXT B;  4KIK B;  3AE9 B;  4OVZ A;  4ASW C;  4A9A A;  1F9J A;  4P7I A;  2JXX A;  2BTE A;  4KSL C;  1B9R A;  2GRI A;  4JE3 B;  5BYS A;  1WJ6 A;  1ZE3 D;  2WXP A;  3A9K A;  4IWP A;  3P42 A;  2KZR A;  2IDY A;  1SIF A;  4FJY A;  3GOE A;  3O65 B;  4LJO B;  4ZDV A;  3GE8 C;  4KGT A;  1TGZ B;  1D4B A;  4W9C A;  1KOT A;  2ZW1 A;  3FKY A;  2WXN A;  2VZK D;  1ZW7 A;  1WGR A;  1KH0 A;  1N63 A;  4ZRI A;  2J0K A;  3IHP C;  1Q5W B;  3A4R A;  1QOA A;  3E9S A;  3M3J A;  2LUM A;  3U7Z A;  3AEA B;  2YEP B;  1KLG D;  2IO0 B;  1L0Y B;  1AWD A;  2FE8 A;  3A9J A;  1UNS A;  3SR6 A;  2MHJ A;  2H89 B;  1T3Q A;  4AJY B;  2L00 B;  2WQY B;  4KIK A;  1WGY A;  3CSF A;  2KYW A;  4FA6 A;  3V60 A;  4QAY A;  2NPT B;  3HRD D;  4D2K A;  2IGG A;  4XYC A;  4YWG G;  2INN E;  2IND C;  4GDL B;  1L2N A;  2KK8 A;  2FID A;  2BYT A;  3CST A;  2RDB C;  4ITK A;  4ZHP A;  2WU5 B;  4IKG A;  1F52 A;  3MTN B;  1I4R A;  1D5X C;  3RYT A;  2KD0 A;  1J7C A;  2I1J A;  1FRR A;  1PGA A;  5H92 C;  1SBB B;  1MHH E;  3Q3O C;  4FAD A;  3ALB A;  4HRS A;  1Q10 A;  4EFO A;  2H88 B;  3DBS A;  5D7G A;  1WYW B;  2JZ3 B;  4ZRJ A;  2YLM A;  1Y56 A;  5JZE B;  2J52 A;  3RNE C;  2RR9 A;  1LO5 D;  3PPA A;  2PKO A;  4MGI E;  2AL6 A;  3DBL B;  2HTM E;  2IO2 B;  4FJZ A;  2I2Y A;  3BK1 A;  5GMV A;  2MA9 B;  1FNV A;  3L16 A;  4PS7 A;  1IBX B;  4M0W B;  1WY8 A;  4JX1 C;  1C77 A;  3LB8 C;  1QF6 A;  2BWE S;  1R7S A;  4HEA 1;  1JWU D;  1D3Z A;  1JRO A;  2NPT A;  5IP4 D;  2N9L A;  3U2S C;  1JRU A;  4YTN B;  1E7U A;  4GDL A;  1V1P B;  2PPH A;  4TMA B;  1FEH A;  3H9D A;  2QEJ C;  2K8B A;  2LGI A;  3ZVV A;  1WM3 A;  1VCB A;  3JSV B;  4DBG A;  4X57 B;  2JF5 A;  3DOW A;  2MBB B;  1SSN A;  3DBR I;  4IM2 A;  4WWM A;  2CS4 A;  5HFY A;  4MM3 B;  2KJR A;  2K6D B;  2VH1 A;  4KZC A;  1WWT A;  1D5M C;  3IFW B;  5KHQ A;  2VH2 A;  4E74 A;  5EDS A;  1ZPS A;  2DYB A;  2HJ8 A;  1FIQ A;  5DPR A;  2LMC A;  2ACZ B;  3I57 A;  3Q2A C;  2FUH B;  2W55 A;  1IBX A;  2BGF A;  4M0W A;  4NNJ B;  3R2T A;  1FD6 A;  3X23 A;  3A1Q B;  4BBN C;  4JIO U;  3ML8 A;  1HTO A;  4WAF A;  3VFK A;  1ZDV A;  1E90 A;  1V1P A;  3CWI A;  5G5G A;  5LLI A;  4IG7 B;  3KUZ A;  1WE7 A;  3KUD B;  3UGB B;  3AE5 B;  3JSV A;  4M8M A;  3R66 C;  1WRD B;  2LZ6 A;  2RGF A;  5G5H A;  4MM3 A;  2KMM A;  1PQS A;  4FXC A;  1WJ4 A;  1A70 A;  1ZDX A;  2JQR B;  3J9C A;  2G45 B;  4WWO A;  1V8C A;  3T3O A;  3TBL D;  2NTS A;  3PO0 A;  1WXS A;  1QOB A;  3V3X A;  2O6V D;  2KVR A;  1DOY A;  1X1M A;  3HHM A;  3GZN I;  4RMA A;  1HXY D;  3U8Z A;  1M4V A;  3R2I A;  3TJP A;  2KAC A;  4K3C A;  1L5P A;  3NVV A;  3A1Q A;  3P1M A;  4DXF A;  1J19 A;  2X8X X;  1WXQ A;  2LXC A;  2W9N A;  3N3K B;  1WM2 A;  2FCS A;  1TYG B;  1E5W A;  2GBN A;  4YL8 A;  3VUY A;  3AED B;  2GI9 A;  2RDH A;  1QT9 A;  4FHJ A;  5BYQ A;  1UEL A;  4M02 A;  3AE7 B;  2NTT A;  2K22 A;  3AEB B;  2XBB C;  3MP9 A;  3Q8A A;  3NOB A;  4DHJ D;  1SE4 A;  3SHQ A;  3I3T B;  3ZUN A;  3BYT B;  4GDK A;  3KWL A;  2R2O A;  1XQQ A;  3N1Y C;  1OQQ A;  2AQ3 B;  4KGS A;  4GMV A;  2WXM A;  3EHV A;  1GAQ B;  2HDE A;  2PIA A;  1ET9 A;  4MH0 E;  2PVO D;  2G4D B;  1L0V B;  2WXH A;  3MHZ A;  1GG3 A;  1L6V A;  3AH7 A;  2OJR A;  2QDF A;  4USA A;  1PDX A;  3ZXR A;  1H4R A;  2PLP A;  2L32 A;  2BBC A;  3B9J A;  4BBN F;  1VLB A;  1PYW D;  4HLE A;  4WQM A;  3RZF A;  4OZA A;  2L3Z A;  2M0X A;  2B76 B;  1OFF A;  3UI3 A;  5AZF A;  3DVN V;  2NVU I;  1TBE A;  2N7D A;  2OED A;  2ZCC A;  4MT5 A;  2LGY A;  3ZTC A;  4JLC A;  5DPS A;  1T0R C;  5E6O A;  3N32 A;  2WXJ A;  2L52 A;  2DX5 B;  5DPW A;  2UWQ A;  3APF A;  5E6P A;  1BXT A;  3PHX B;  3VUW A;  5CX3 A;  5IAA C;  5L95 C;  3TUO A;  5DPT A;  3L4P A;  3RPF C;  1UBI A;  1Z2M A;  2XN9 C;  3PRM B;  1WMH B;  2C7H A;  2IBI B;  3DDC B;  3RFZ B;  4TQ1 A;  2VRR B;  1GC6 A;  4KKI A;  2KHW B;  4A55 A;  1EO6 A;  1VR9 A;  1JQ4 A;  4FN2 A;  1C4A A;  3VHT C;  3NY5 A;  3EEC A;  3AE4 B;  3P4Q B;  3V6E B;  3PT2 B;  3ZYY X;  1KFY B;  2N9P C;  4XGA B;  2BQQ A;  2PJH A;  3ETR A;  3PHW B;  1J8C A;  4WAA A;  1N5W A;  3NVZ A;  1YJJ A;  1FNU A;  2DWQ A;  3GP7 A;  3APC A;  5CHV C;  4IDI A;  3ZNG C;  2KWV B;  3Q8B A;  3NJT A;  1E6E B;  4MGK E;  2DYO A;  1LGR A;  4EZJ A;  1TZ1 A;  2C5L C;  2D3A A;  1YNT E;  5BMG A;  1K52 A;  4TKN A;  2N9K A;  4KV2 A;  2KX0 A;  1VRA B;  4RF0 A;  1MG4 A;  1WE6 A;  3V61 A;  1YN5 A;  1YN3 A;  3AE6 B;  4A6Q A;  2MLB A;  3CMM B;  3IT4 B;  1WMH A;  3NS8 A;  3MC9 A;  2Y5P A;  4FBJ B;  1P7E A;  1T6B X;  4EOY A;  3NHE B;  2D2Q A;  3EFC A;  3ECI A;  3VR8 B;  5IN7 A;  4P16 A;  3H7P B;  3RNC C;  4A20 A;  1WR1 A;  1HEZ E;  2D07 B;  3TL5 A;  1VDV A;  1K51 A;  3JVZ X;  3FIL B;  4IOI E;  2G9H D;  2OOB B;  2W3R A;  1C4C A;  3RNA C;  1VZ6 A;  2WGS A;  3B08 A;  3EFU A;  2M56 B;  1AW7 A;  5C3J B;  4W9J A;  3RD2 A;  4MEM A;  3H6N A;  2J53 A;  3N9Y C;  2OHF A;  3BZD B;  3I5J C;  4BOS C;  2NBW B;  1KF6 B;  3N20 C;  3VQI A;  2ZNV C;  1F2R I;  3U7D A;  3M95 A;  1R4N B;  4BOZ B;  3RI7 C;  1HE8 A;  2BB6 A;  1EWC A;  1WYG A;  1XXG A;  5C23 A;  5BMI A;  2BS4 B;  3I9V 1;  4RM8 A;  3WAL A;  4PT5 A;  1WGK A;  3RT3 B;  3H7P A;  2JYT A;  1E9M A;  2RSU A;  4KSK C;  1NVI D;  3I63 C;  1YX6 B;  1PFD A;  4M00 A;  5BMH A;  4HKZ E;  3PSE B;  2JZZ A;  3ZIM A;  2IGH A;  2L83 A;  2GMI C;  2GBK A;  1I4X A;  1GB4 A;  2CHZ A;  1MFW A;  3KWV A;  4N58 A;  3T3N A;  2J0M A;  5BYR A;  3N1Z C;  2KVZ A;  3W1S A;  3U4E G;  1FXA A;  4A8X C;  3NG0 A;  4HPL B;  4J3O D;  1YOV B;  2PMV A;  2J7Q B;  4FUL A;  2KAJ A;  1C3T A;  1V49 A;  3JW0 X;  1P0R A;  2M1M A;  2N7J A;  3Q8E A;  2XNA C;  2L1A A;  2I1K A;  1FNW A;  3GB1 A;  2KDM A;  3MJW A;  1E8Z A;  2KJ6 A;  3QC8 B;  1OEY J;  1I42 A;  4YT0 B;  3OJ4 B;  2L7R A;  1JW9 D;  1WRI A;  4TUU A;  1XF5 L;  1UD7 A;  2N9X A;  1FFU A;  2K5P A;  2C7N B;  2KDB A;  4J6I A;  4JL9 A;  3RMK C;  4W9K A;  4GOC A;  2GLS A;  4LLG M;  4HDQ A;  2KFJ A;  1UWX A;  2KO3 A;  5G55 A;  4P1C C;  4BVU C;  3UIP B;  1V1O A;  3ABV B;  1E7P B;  5BO4 B;  1I4G A;  4BFR A;  4KZ0 A;  2QIL A;  1PGX A;  5GXG B;  4FHK A;  4NJ7 A;  3V05 A;  1YJ1 A;  2LVP A;  5D6J B;  2AQ2 B;  4W9H A;  1TT5 B;  2K39 A;  2RMM A;  2E3T A;  2L8J A;  1R4M B;  5EE0 A;  3UQB A;  4FJV B;  3Q8C A;  2K25 A;  1CZP A;  2KFK B;  3AEE B;  4W9L A;  4BKS A;  4A3P A;  4XC2 A;  4GB9 A;  3K9O B;  5AZH A;  2C60 A;  2VZK B;  2V0G A;  2DZK A;  4HRO A;  4LTU A;  3JYU A;  1RRB A;  3QA8 A;  1GUA B;  1XEE A;  2CKH B;  3Q69 A;  4RGO S;  3ZO5 B;  1YMH E;  2M8S A;  4DHZ E;  1J7B A;  3OJ3 A;  3OAW A;  3DQV A;  4YTP B;  5D3I B;  1N6Z A;  3AE1 B;  1CK1 A;  2LGS A;  1SE3 A;  2DZI A;  4DXG A;  2V9H A;  2WXO A;  4I6P A;  1G6J A;  4DXA B;  1BT0 A;  1I4P A;  5HG2 A;  2V4I B;  3H8H A;  3ZRC A;  1GOZ A;  4DHZ B;  2KKC A;  2QC8 A;  5LXI B;  3C19 A;  2Z8L A;  1EU4 A;  5CTR C;  2LXA A;  2QJL A;  4H2A A;  4KVG B;  2K0P A;  3IBE A;  1WX9 A;  4OHJ A;  1SGH A;  4US9 A;  3NUH B;  3WAN A;  1V97 A;  2KFK A;  4EZL A;  2BWF A;  1PGB A;  3NZU A;  2GOW A;  4RGT A;  4PYZ A;  2MH7 A;  4JQW C;  1S1Q B;  2WYQ A;  1F1H A;  2NBV B;  5EE1 A;  1WXM A;  1XLP A;  2MW5 A;  2HE7 A;  2FCM A;  1YX5 B;  2MJE A;  1A5R A;  1DGJ A;  4ZRP A;  1TS5 A;  2M17 A;  1WXV A;  2W82 A;  5FR3 A;  3BWU D;  5IOI A;  1GJZ A;  4II2 B;  2DAF A;  5TR5 A;  2WXF A;  1XCQ L;  1J7A A;  3IAM 1;  2PVG C;  3DBH B;  4NAW B;  4HJG E;  2FNJ B;  2DAJ A;  4ZRK A;  3MFG A;  3O13 A;  4WIP A;  4NQK E;  4A90 A;  1QIL A;  2G1E A;  2V4L A;  3TSS A;  3DVN U;  1ZUD 2;  2L76 A;  2R2Q A;  4TQ0 A;  4K7U A;  2MRP A;  4IM3 A;  3AI5 A;  3V6C B;  2QIE B;  3ML9 A;  3BII D;  1H8C A;  4G11 A;  2LRW A;  2MJD A;  4ZHO A;  2FCQ A;  3DWM A;  3ZGZ A;  2KQ7 A;  4ZYN A;  3PTF C;  1ZP0 B;  4YSY B;  3H1U A;  2J0J A;  2LI5 A;  2K8C A;  3W1Y A;  3PVL A;  1WR6 E;  1UBQ A;  3EUB 2;  4ICV A;  2FCN A;  4MH8 A;  3EA6 A;  3BVM A;  1QZE A;  3DVG Y;  2Y5C A;  1VJK A;  2A5U A;  1MVK A;  2WU2 B;  2LFI A;  3RUI B;  2MEK A;  1E7V A;  2ZJD A;  1NYR A;  5AEK B;  4NAW A;  1YN4 A;  4MSQ B;  2KX3 A;  2HJ1 A;  2BB5 A;  4GDK B;  4XE0 A;  3BVG A;  1HA5 A;  2EEL A;  2KDE B;  3C8Y A;  1V9J A;  2M19 A;  4GIV A;  2ZEQ A;  1ISN A;  1VD2 A;  1NBF C;  1AYF A;  2GBJ A;  1P7F A;  1SIJ A;  1P9D U;  4K3B A;  1AN8 A;  1E8Y A;  1BML C;  2INC C;  3QX1 A;  4I6L B;  3ZNI D;  1WGG A;  3RNF C;  3DPD A;  1LFD A;  2NR2 A;  2KTR A;  2D10 A;  1STE A;  5JHB A;  1WJN A;  2QMT A;  2QHO A;  1JCK B;  4WJN A;  1TJE A;  2EMT A;  2JUO A;  3X0W A;  1SEB D;  3ZNH B;  5D94 A;  4MEL A;  2XK5 B;  2O6V B;  1FM0 D;  4WQO B;  1JWM D;  2E6X A;  4AJW A;  1P3Q U;  3DHI C;  4C7Z A;  4PS3 A;  3VTU A;  4TSS A;  5JXV A;  3RNG C;  3H7S A;  3M62 B;  1UH6 A;  4ZOH C;  1V5T A;  4BAX A;  3PRZ A;  1YIW A;  2MX2 A;  3QAR A;  3UQA A;  2KLC A;  2YEP F;  1TY0 A;  1ENF A;  5J2R A;  1L0X B;  2WX0 A;  4PYU A;  3PRP B;  3OWE B;  2TSS A;  1MG8 A;  2KDF B;  1TIF A;  1K53 A;  3RZW C;  3VRB B;  2AQ1 B;  4KDI C;  3AE2 B;  1CJE A;  5H8Y E;  4DHJ B;  3NZS A;  3TCA A;  3M63 B;  1FFV A;  1WZ3 A;  3L13 A;  3DBL I;  3HVZ A;  1J0G A;  4B0E A;  4EE2 A;  4OZC A;  1P1A A;  3TIX A;  4K81 A;  4XZ4 A;  2BKR B;  2XK5 A;  2O6V A;  1OQR A;  2BYF A;  2UU7 A;  4BKG A;  2AWT A;  2N4F A;  2DEN B;  1YJI A;  1EWY C;  1WZ0 A;  4E71 A;  3LYY A;  3KH0 A;  2FAZ A;  1C4P A;  3UF8 A;  5E6N A;  2CHX A;  2L0F A;  5JH5 C;  3QCA A;  2FUG 1;  4S17 A;  1YQ4 B;  2KMA A;  3HVD A;  2D11 A;  1OEY A;  1FCL A;  2KDI A;  1FPY A;  4F8C B;  2PW9 A;  3QWZ B;  4ZRQ A;  4FLH A;  2MBO A;  2CR5 A;  3KUC B;  2YVC A;  1VZ8 A;  3L10 B;  1MJD A;  2EKI A;  4NQL B;  3R7Q A;  3DBH I;  2LWP A;  1RWS A;  4HXD A;  4MAC A;  1T0Y A;  2ZPN A;  1DYQ A;  3HM6 X;  1TS4 A;  3WAM A;  2JWU A;  2LJI A;  1OQY A;  2KXJ A;  4ARI A;  3ENE A;  3APD A;  2ONQ A;  1F2R C;  1Q1O A;  2Y5B B;  4ACF A;  1KM7 A;  4RH6 A;  2Z0E B;  1SJH D;  4WJP A;  1NI3 A;  4HJK A;  5FR6 A;  3VVW B;  3T8M A;  2WDT B;  3QK0 A;  1I7H A;  5J17 A;  4W9D A;  4IC7 B;  1F0Z A;  3ZQ4 A;  3BK2 A;  3GS2 A;  3SU8 X;  2AEH A;  2HTH A;  4LDT D;  3IAS 1;  5HI1 A;  3PGE A;  4ANX A;  3TEW A;  1OTR B;  1KRH A;  2WDQ B;  1E8X A;  3AB5 A;  4UDU C;  2K8H A;  1QOG A;  3WIM A;  2JRH A;  4JWU C;  1QLB B;  1FCC C;  3W2D A;  1XO3 A;  3AE3 B;  2V1Y A;  1TKG A;  4MGZ E;  1Y8R C;  5MPO A;  1B1Z A;  4AS1 A;  4MSM B;  2Z59 B;  2FIF A;  1RFK A;  1E0Z A;  1IPG A;  2GBR A;  4G0N B;  1I4Q A;  3NVY A;  4C56 C;  4P1B C;  3DHG C;  4M8N A;  2IZV B;  3SFE B;  2M0A A;  4ANW A;  1CMX B;  3P2B A;  3WA0 A;  2IGD A;  1HZ5 A;  2PE6 B;  2IO3 B;  1TS2 A;  1C78 A;  5TSS A;  2OJW A;  1DOX A;  4L23 A;  2WWZ A;  1RLF A;  1QQR A;  2LEK A;  3Q6B A;  2WXG A;  4PK1 A;  1ZXH A;  2BS3 B;  5C1Z A;  5AZG A;  1WJU A;  4NPN A;  3N1X C;  4OW0 A;  4KDL B;  3AU5 A;  4G50 A;  3AV8 A;  1WFY A;  3Q3M C;  4XWT A;  4L2Y A;  1N62 A;  2WXR A;  1ET6 A;  3TEX A;  3P4S B;  3R3M A;  4W9E A;  4MJS B;  1ZKH A;  3L17 A;  1ROE A;  5EE3 A;  4ARC A;  3ZJV A;  2AYO B;  3HM3 A;  5G2N A;  2J4X A;  1KTK A;  1CQV A;  1WXA A;  2QSD A;  2LRU A;  1SE2 A;  3VH3 B;  1L4Z B;  5C2T B;  1T0S C;  2DYM A;  3BY4 B;  3MC0 B;  2ZCB A;  4DWF A;  3P63 A;  4LNI A;  1RM6 C;  2JRI B;  2NCN A;  2BW2 A;  4MDK E;  4F1S A;  2WXQ A;  3AE8 B;  1SF0 A;  1T0Q C;  2M4N A;  3BIN A;  3HIZ A;  2DZM A;  1C79 A;  4W9F A;  4GU2 A;  1M94 A;  3SDL C;  3W5V B;  4ZYS A;  3P4P B;  1ZOY B;  3B2F A;  1I4H A;  3KYD D;  2KWC A;  4II3 B;  3CIR B;  3A33 B;  2D3G A;  1OGW A;  3U52 E;  1NDD A;  2CU3 A;  3W9C B;  2L05 A;  4NZL B;  2KT7 A;  1GNU A;  4TV3 A;  3ZDT A;  3T9L A;  2A4Z A;  2WNM A;  5I4D A;  5IKC M;  2KLG A;  2BYE A;  1NEN B;  4MJS A;  1I35 A;  1JAL A;  1HQR D;  1IGC A;  2KC1 A;  2ZW0 A;  1XLN A;  2BKF A;  3VR9 B;  3U30 A;  1WF9 A;  3AUL A;  3NS1 A;  3W1S C;  4EUT A;  2JX5 A;  3B0A A;  2KC2 A;  3AEC B;  1L7Y A;  3K9P B;  4YXD B;  5LXH A;  3FC4 A;  4EEW A;  3QQ8 B;  2KN5 A;  4N6E B;  1LXD A;  4O1N A;  1HTQ A;  3ZXV A;  2CJO A;  2KQ4 X;  4GGQ A;  3S2A A;  3GZN B;  2C7M B;  2RD0 A;  3ZDM C;  1IP9 A;  1EM7 A;  2K3U A;  1L6U A;  2BT6 A;  1LM8 B;  3KVF B;  4LK0 M;  4WWP A;  1N60 A;  4HKQ A;  4IWO A;  1N61 A;  3FAH A;  1IYF A;  4XDD A;  3TMP B;  2SAK A;  4NY0 A;  3TEY A;  2REX A;  3PS6 A;  2BYV E;  2G4S A;  1AAR A;  2NS5 A;  3MC8 A;  2MWS B;  4HVB A;  2KNB A;  1QOF A;  3RCZ A;  4REZ A;  2W54 A;  3SEB A;  1ZXI A;  3AN1 A;  1XLO A;  2DNF A;  3DCG A;  1WX8 A;  2I38 A;  2C9W B;  3IVF A;  1KLV A;  1V6E A;  3C0R B;  1NYQ A;  4LNN A;  3VTV A;  1FXI A;  1L4D B;  2ASQ A;  2IJ0 A;  2JWZ A;  3WAO A;  1VZ7 A;  1D6E C;  2DBY A;  1V2Y A;  1GPX A;  4IW0 A;  4P6V F;  2MSE D;  5JHA A;  1RFA A;  2JY6 A;  1K50 A;  1N5X A;  4LJP B;  3NRZ A;  1UUP A;  5DCN A;  5LNK 1;  3AEF B;  1UZX B;  3SD5 A;  4NJ6 A;  1R4N I;  5T8I A;  1V80 A;  4C7Y A;  4C80 A;  3WAP A;  2KJH B;  3V62 A;  2GB1 A;  1EUV B;  3SFD B;  3Q3J A;  4WJO A;  1QKZ A;  2D3C A;  4CYE A;  2WLB A;  3TEZ A;  2V3P A;  3WCQ A;  2CJN A;  3CF6 E;  3URY A;  2Y3A A;  5HHD G;  5KHO A;  4RGN A;  3D32 A;  4AOF A;  2LGD A;  4HPM B;  2AX5 A;  3GE3 C;  5AUI A;  2EMS A;  5J18 A;  4HDO A;  1Z5S B;  4A3O A;  1IUE A;  2Q5W D;  2KMC A;  2LAS A;  4B6W A;  1UWM A;  2JT4 B;  4RGM A;  3VUX A;  3VTW A;  1V5O A;  2KTR B;  2XEW A;  5FK9 C;  1UGM A;  2LVO A;  5D3D A;  3MJ5 A;  3ZJT A;  3RUL A;  1TY2 A;  4B0M A;  4WH4 A;  2MBE A;  4YSZ B;  1SJE D;  1YD8 U;  2ZPY A;  2LUE A;  4XDC A;  1MPE A;  1U4A A;  2INP E;  4RCO A;  4W9G A;  2KOX A;  3AXC A;  3VRA B;  1KJT A;  4AP4 C;  3LDZ E;  1JWA D;  4OVU A;  2QCZ A;  1HZ6 A;  1FRD A;  3IXS A;  3QHT A;  2X38 A;  5D2M B;  4L1B A;  1GC7 A;  2IPK D;  2ZVO A;  2ICI A;  3ZW3 A;  4JWS C;  3ZKJ C;  1MHX A;  4RNA A;  1WIA A;  1K8R B;  3Q3N C;  1EF5 A;  3ZLZ A;  4K7S A;  4K1R B;  2KQS A;  4WWN A;  4AWJ A;  2WXI A;  2LD9 A;  2G3Q B;  1F77 A;  1YQ3 B;  3OG5 A;  3VXW A;  2EKE C;  4BZA A;  2RDG A;  3LXF A;  1R4M I;  1RYJ A;  3Q8F A;  2JVC A;  2JZP A;  2WXK A;  3VAW A;  3PRE A;  4DQO C;  4C00 A;  4NJC A;  4KKJ A;  2L0T A;  4HCP B;  4DK5 A;  4EZK A;  3MHS D;  2B3A A;  4JGH B;  2IY0 B;  5CHF A;  1TKY A;  4B9K A;  2DZJ A;  1JWB D;  4N59 A;  2V3N A;  3HUI A;  3BVZ A;  3DVG X;  2WS3 B;  2BS2 B;  3L08 A;  3QAQ A;  4US8 A;  2CHW A; 
#chains in the Genus database with same CATH homology
 3AE3 B;  1SSN A;  1TKG A;  4WWM A;  1V1O A;  3ABV B;  1E7P B;  5FKA C;  5HFY A;  5MPO A;  4MM3 B;  1B1Z A;  1I4G A;  4AS1 A;  1RFK A;  2QIL A;  1E0Z A;  1WWT A;  5EE9 A;  1PGX A;  1D5M C;  5GXG B;  1I4Q A;  3NVY A;  3V05 A;  4C56 C;  1ZPS A;  2AQ2 B;  1FIQ A;  2LMC A;  3SFE B;  2M0A A;  2ACZ B;  4WUR A;  2RMM A;  3I57 A;  2IGD A;  2E3T A;  1HZ5 A;  5EE0 A;  4NAM A;  3Q8C A;  1CZP A;  1MI0 A;  3AEE B;  1TS2 A;  2W55 A;  1IBX A;  1JML A;  4M0W A;  3R2T A;  1DOI A;  1C78 A;  5TSS A;  1DOX A;  4L23 A;  1FD6 A;  2VZK B;  1QQR A;  2LEK A;  1TZO A;  4HRO A;  4LTU A;  2WXG A;  2V0G A;  4WAF A;  1ZXH A;  2BS3 B;  1ZDV A;  4OW0 A;  1V1P A;  3CWI A;  5G5G A;  1XEE A;  4RGO S;  3Q69 A;  1YMH E;  1J7B A;  3AV8 A;  4YTP B;  5D3I B;  4XWW A;  3NZ3 A;  3AE5 B;  2RPV A;  4XWT A;  3AE1 B;  1CK1 A;  4L2Y A;  1SB3 C;  1SE3 A;  4YSX B;  1N62 A;  2WXR A;  3KQ4 A;  1ET6 A;  4JPS A;  4DXG A;  5G5H A;  3TEX A;  1WSP A;  2WXO A;  2WDR B;  3P4S B;  1JRP A;  1I4P A;  2R61 A;  2KMM A;  4FXC A;  1A70 A;  1ZDX A;  2JQR B;  3J9C A;  5HG2 A;  1ROE A;  5EE3 A;  2LHD A;  2V4I B;  4ARC A;  3ZJV A;  1UGJ A;  3H8H A;  1V8C A;  3AM9 A;  3T3O A;  1GOZ A;  2J4X A;  1KTK A;  3PZ8 A;  2Z8L A;  1CQV A;  1EU4 A;  2QSD A;  1ACC A;  2NTS A;  2QJL A;  3AEG B;  4H2A A;  1SE2 A;  3PO0 A;  2K0P A;  4OHJ A;  1QOB A;  1L4Z B;  5C2T B;  3MC0 B;  2DYM A;  3V3X A;  3P63 A;  4US9 A;  1DOY A;  3NUH B;  1RM6 C;  1V97 A;  2FBW B;  3PZ7 A;  1XCT L;  2BW2 A;  1HXY D;  2WXQ A;  1M4V A;  2KWD A;  1PGB A;  3AE8 B;  3R2I A;  1SF0 A;  2NMQ A;  2KAC A;  4RGT A;  1L5P A;  2DLB A;  3NVV A;  3P1M A;  4DXF A;  1C79 A;  2MH7 A;  2D5G A;  3W5V B;  1WXQ A;  3P4P B;  4ZYS A;  5EE1 A;  1XLP A;  1ZOY B;  3B2F A;  1I4H A;  1TYG B;  2PTL A;  2MJE A;  1DGJ A;  4ZRP A;  1TS5 A;  3CIR B;  1FMA D;  3AED B;  2GI9 A;  3U52 E;  2RDH A;  2CU3 A;  1QT9 A;  2W82 A;  3ZJU A;  3IT6 B;  5FR3 A;  3W9C B;  4NZL B;  5BYQ A;  3BWU D;  3AE7 B;  2SEB D;  2NTT A;  2WNM A;  2K22 A;  4GLS C;  5I4D A;  3AEB B;  3MP9 A;  3Q8A A;  1NEN B;  1D5Z C;  2WXF A;  1XCQ L;  1J7A A;  1SE4 A;  3IAM 1;  1JAL A;  1HQR D;  1XLQ A;  3BYT B;  1FO4 A;  3KWL A;  2PVG C;  1IGC A;  2WP9 B;  4NAW B;  1SXT A;  4KX6 B;  3KLS X;  4HJG E;  2ZW0 A;  3BYY B;  3MFG A;  3O13 A;  4WIP A;  4A90 A;  1XLN A;  1QIL A;  2G1E A;  3TSS A;  1ZUD 2;  3VR9 B;  3P4R B;  1OQQ A;  2AQ3 B;  4KGS A;  4TQ0 A;  1NEK B;  3NS1 A;  5AUK A;  2WXM A;  2JX5 A;  3AEC B;  2QIE B;  1IGD A;  3EGR A;  1GAQ B;  2HDE A;  2JYE A;  1C76 A;  2PIA A;  3FC4 A;  1ET9 A;  3R8B A;  4YXD B;  4YTM B;  3BII D;  2PVO D;  1L0V B;  2KN4 A;  4N6E B;  2WXH A;  2K9X A;  3MHZ A;  4O1N A;  3AH7 A;  1L6V A;  2MJD A;  1ESF A;  4USA A;  4ZHO A;  1PDX A;  2CJO A;  2W3S A;  2KQ4 X;  3DWM A;  2JXT A;  3ZGZ A;  2PLP A;  2L32 A;  2BBC A;  3B9J A;  2N0S B;  1VLB A;  1PUT A;  2J42 A;  1ZP0 B;  1KLU D;  4YSY B;  1PYW D;  4WQM A;  4OZA A;  1EM7 A;  1BUI C;  4KGR A;  2B76 B;  4RFB A;  2K3U A;  1OFF A;  3UI3 A;  1L6U A;  2LHE A;  2BT6 A;  3EUB 2;  2OED A;  4LK0 M;  4MH8 A;  4OZB A;  1N60 A;  4HKQ A;  4MT5 A;  3EA6 A;  1N61 A;  3BVM A;  3FAH A;  4XDD A;  2Y5C A;  1VJK A;  2SAK A;  1MVK A;  2WU2 B;  2WXJ A;  2LFI A;  4Q2J A;  3TEY A;  2L52 A;  2MEK A;  2JU6 X;  1NYR A;  1YN4 A;  1BXT A;  1T5X D;  4R3D A;  2BB5 A;  4GDK B;  1QOF A;  3TUO A;  2WXL A;  4XE0 A;  3BVG A;  1HA5 A;  1C9F A;  2EEL A;  3L4P A;  4REZ A;  1TS3 A;  3RPF C;  2XN9 C;  3C8Y A;  2M19 A;  2W54 A;  3SEB A;  3RFZ B;  4TQ1 A;  2ON8 A;  4KKI A;  1ZXI A;  1XLO A;  1AYF A;  3AN1 A;  1P7F A;  1SIJ A;  2MJ3 A;  4A55 A;  1VR9 A;  2WDV B;  3AMZ A;  2I38 A;  1JQ4 A;  1C4A A;  3W5U B;  1AN8 A;  1BML C;  1GB1 A;  1NYQ A;  3AE4 B;  3FIL A;  1JWS D;  3P4Q B;  1FXI A;  1L4D B;  2IJ0 A;  3ZYY X;  1KFY B;  1VZ7 A;  1D6E C;  2DBY A;  4AQ7 A;  1GPX A;  3DWG C;  1EU3 A;  4P6V F;  3ETR A;  5E6J A;  4CQN A;  1STE A;  3B2G A;  3NVW A;  3E56 A;  1K50 A;  1N5W A;  2QMT A;  3NVZ A;  1YJJ A;  1FNU A;  1JCK B;  2DWQ A;  1N5X A;  3GP7 A;  1TJE A;  1UUP A;  3NRZ A;  4IDI A;  1SEB D;  1TKE A;  3Q8B A;  1E6E B;  1FM0 D;  2DYO A;  5LNK 1;  3AEF B;  1JWM D;  2E6X A;  1E10 A;  4C7Z A;  1YNT E;  5BMG A;  5T8I A;  4RF1 A;  1K52 A;  4TSS A;  4C7Y A;  4C80 A;  5JXV A;  2JSV X;  2N9K A;  1VRA B;  4RF0 A;  3AE9 B;  4OVZ A;  4ZOH C;  4A9A A;  2GB1 A;  1YN5 A;  1YN3 A;  3AE6 B;  4A6Q A;  3SFD B;  1QKZ A;  2BTE A;  2WLB A;  3IT4 B;  1B9R A;  2GRI A;  2YEP F;  2Y5P A;  4JE3 B;  1TY0 A;  5BYS A;  1ENF A;  1P7E A;  1ZE3 D;  2V3P A;  1T6B X;  3TEZ A;  1L0X B;  2WXP A;  3P42 A;  2IDY A;  2CJN A;  3OWE B;  3WCQ A;  2TSS A;  3URY A;  1K53 A;  2Y3A A;  3VR8 B;  5HHD G;  4P16 A;  4RGN A;  3VRB B;  2AQ1 B;  4KGT A;  1HEZ E;  3AE2 B;  1VDV A;  1D4B A;  1K51 A;  1CJE A;  2AX5 A;  5AUI A;  2ZW1 A;  2WXN A;  2VZK D;  5H8Y E;  3FIL B;  4IOI E;  1KH0 A;  2G9H D;  1N63 A;  2W3R A;  1C4C A;  1IUE A;  1FFV A;  1VZ6 A;  2Q5W D;  1UWM A;  3HVZ A;  1QOA A;  3E9S A;  4RGM A;  2M56 B;  1AW7 A;  5C3J B;  4B0E A;  4EE2 A;  4OZC A;  2LUM A;  5FK9 C;  3U7Z A;  3AEA B;  5D3D A;  2YEP B;  1KLG D;  2J53 A;  3MJ5 A;  3ZJT A;  1L0Y B;  1AWD A;  3N9Y C;  1OQR A;  1TY2 A;  2FE8 A;  4B0M A;  4WH4 A;  2OHF A;  1UNS A;  3SR6 A;  3BZD B;  2H89 B;  4YSZ B;  1T3Q A;  1SJE D;  1YJI A;  1EWY C;  3LYY A;  1KF6 B;  2WQY B;  4XDC A;  1MPE A;  3VQI A;  4RCO A;  2INP E;  1F2R I;  1C4P A;  3VRA B;  2BB6 A;  2FUG 1;  1EWC A;  1YQ4 B;  1WYG A;  1XXG A;  3HVD A;  3HRD D;  5BMI A;  4D2K A;  1FCL A;  1JWA D;  2IGG A;  2BS4 B;  4YWG G;  2INN E;  3I9V 1;  1HZ6 A;  4GDL B;  1FRD A;  3IXS A;  2PW9 A;  4ZRQ A;  2X38 A;  2BYT A;  4PT5 A;  4L1B A;  1WGK A;  1VZ8 A;  4ITK A;  2EKI A;  2IPK D;  4ZHP A;  2JYT A;  2ICI A;  2WU5 B;  4IKG A;  1E9M A;  1I4R A;  4JWS C;  1D5X C;  1RWS A;  1MHX A;  4RNA A;  1NVI D;  1J7C A;  1FRR A;  1PGA A;  5H92 C;  4MAC A;  1PFD A;  1SBB B;  1DYQ A;  1MHH E;  1TS4 A;  5BMH A;  4HRS A;  4HKZ E;  2JWU A;  1Q10 A;  2IGH A;  2LJI A;  2L83 A;  2H88 B;  5D7G A;  2WXI A;  4ARI A;  1F77 A;  1I4X A;  2ONQ A;  1F2R C;  1YQ3 B;  1GB4 A;  1Y56 A;  3KWV A;  4RH6 A;  2RDG A;  3LXF A;  4N58 A;  3T3N A;  2J52 A;  1RYJ A;  5BYR A;  1LO5 D;  1SJH D;  3Q8F A;  2PKO A;  2HTM E;  2JZP A;  3U4E G;  1FXA A;  3W1S A;  4A8X C;  1NI3 A;  4J3O D;  2PMV A;  2WXK A;  2I2Y A;  4DQO C;  3BK1 A;  4NJC A;  2KAJ A;  4KKJ A;  3Q8E A;  2N7J A;  2XNA C;  2L1A A;  1FNV A;  1FNW A;  3GB1 A;  2KDM A;  1I7H A;  1IBX B;  4JX1 C;  1C77 A;  3LB8 C;  1QF6 A;  4YT0 B;  1F0Z A;  3ZQ4 A;  3BK2 A;  3GS2 A;  1R7S A;  1TKY A;  1JW9 D;  4HEA 1;  1JWU D;  1JRO A;  1WRI A;  1JWB D;  3IAS 1;  2N9L A;  4N59 A;  5HI1 A;  3U2S C;  4YTN B;  1XF5 L;  3TEW A;  2V3N A;  1KRH A;  1FFU A;  2WDQ B;  2K5P A;  1V1P B;  3AB5 A;  4UDU C;  4TMA B;  3HUI A;  1QOG A;  1FEH A;  3BVZ A;  2QEJ C;  2WS3 B;  4LLG M;  2BS2 B;  2LGI A;  1QLB B;  4JWU C;  1FCC C;  3W2D A;  1UWX A;  4US8 A;  1XO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...