1PUTA

An nmr-derived model for the solution structure of oxidized putidaredoxin, a 2fe, 2-s ferredoxin from pseudomonas
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRQLDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PUTIDAREDOXIN
publication title An NMR-derived model for the solution structure of oxidized putidaredoxin, a 2-Fe, 2-S ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 10
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1putA00
1NENB 1JWBD 2JX5A 2PVGC 3AEGB 3AE9B 3NS1A 2CJNA 2QJLA 3AH7A 3RPFC 1TKEA 1ROEA 3AB5A 3B2GA 2MJ3A 1CJEA 3ABVB 4YSYB 1WYGA 1UWMA 2QIEB 3AE2B 5G5GA 4FXCA 2EKIA 2AX5A 3SFEB 1JALA 1XO3A 4JWSC 2PVOD 1JWAD 1V97A 2KMMA 5MPOA 1JROA 3AEFB 1QOAA 4YTPB 1YJJA 4US8A 2BS3B 3AE8B 3AMZA 1XLPA 1OQRA 3AV8A 4YSXB 5C3JB 1A70A 1L5PA 4N59A 2MH7A 3L4PA 3P4QB 4ITKA 2DWQA 3VR8B 1L6VA 3ZYYX 1NEKB 3FAHA 2WLBA 1QLBB 3NVYA 5GXGB 1NYQA 1XLOA 3AEBB 2G1EA 1FM0D 1FMAD 2BS2B 4P6VF 4C80A 1E0ZA 1QF6A 1F0ZA 3BIID 1T3QA 2WDQB 2MJDA 3P63A 5G5HA 1J7CA 5H8YE 4WQMA 3P4SB 1IUEA 1FXIA 2ACZB 2L83A 4A9AA 2LEKA 1FO4A 3DWMA 2E3TA 3AE4B 1EWYC 4YXDB 2H88B 1PFDA 1TKYA 2W3RA 3NVZA 2K5PA 1J7BA 3W5UB 1R7SA 3HRDD 5EE0A 1DOXA 1QT9A 2CU3A 1L6UA 2MJEA 1PDXA 1RYJA 1CZPA 3P4PB 3SFDB 4YT0B 2BT6A 1SF0A 1GAQB 2WU5B 3AEAB 2OHFA 4YTNB 1KRHA 2WU2B 1QOBA 4ZHOA 3NVVA 3DWGC 4KX6B 3AECB 5AUKA 1VJKA 1TJEA 5AUIA 5C2TB 2KAJA 1ZXIA 1VDVA 1E9MA 1RFKA 3PO0A 2M19A 2WS3B 3LXFA 4N58A 1OQQA 3NRZA 2WDRB 4C7ZA 4ZHPA 3P1MA 1DOYA 2WQYB 2N0SB 1NYRA 2M56B 2WP9B 1TKGA 1KF6B 1AYFA 1ZP0B 1QOGA 2Y5CA 1E10A 2L52A 1NI3A 1FRRA 2B76B 2K22A 1WGKA 1I7HA 3KWLA 4N6EB 4JWUC 2JQRB 3AEDB 1E7PB 2W55A 3VRAB 3W5VB 1N61A 1WXQA 3VR9B 1SIJA 1N60A 1ZUD2 1RWSA 1V8CA 1AWDA 2W3SA 3W9CB 1OFFA 4LTUA 1FRDA 1WWTA 2WDVB 5EE1A 5H92C 4YSZB 1DGJA 3ETRA 5EE9A 3AE5B 3AE6B 3NVWA 3VRBB 3B9JA 1J7AA 4USAA 3B2FA 3HVZA 3EUB2 1XLQA 2H89B 2PIAA 3FC4A 4C7YA 1FIQA 5EE3A 1DOIA 1QOFA 1YQ3B 2Q5WD 3AN1A 3P4RB 4HRSA 1GPXA 3LB8C 3SR6A 2DBYA 1ZOYB 1FFUA 3HUIA 4HROA 1JQ4A 1JW9D 1XLNA 3AM9A 3WCQA 2CJOA 1N5WA 1N62A 1YJIA 3AE1B 3CWIA 1TYGB 1E6EB 2HTME 2BS4B 2PKOA 4JX1C 1JRPA 1WRIA 3AE3B 1N63A 1NVID 1YQ4B 2K9XA 4ZOHC 1SB3C 1FFVA 4WWMA 2FBWB 2W54A 4US9A 1L0VB 4YTMB 1B9RA 1VLBA 1PUTA 1FXAA 1KFYB 3CIRB 1RM6C 3AE7B 1N5XA 3AEEB 4IDIA
chains in the Genus database with same CATH superfamily
2PVGC 3DBRB 4XWTA 3JSVA 4LNOA 2Y5BB 3PZ8A 4IWQA 1NI2A 1QOAA 1ISNA 4TMAB 2L76A 4RMAA 1WMHB 4BAXA 3QWZB 1WRDB 2ZNVC 5HKHA 1ENFA 4NNJB 1JWMD 1NYQA 4JIOU 2BS2B 4P6VF 3L0WB 1KM7A 3BIID 4XC2A 5DPRA 2V9HA 1V9JA 1WX9A 2ON8A 2BBCA 1C4PA 2KFKB 4C4VB 2K8CA 1RYJA 1VZ8A 1WGRA 4M0WA 4ARIA 2CHWA 2ZNVB 4S0RA 2OHFA 3KWVA 2EELA 5TSSA 2QCZA 2BB5A 1V1PB 1JWSD 4K3BA 3I5JC 4B6WA 1FNVA 4MGKE 1LQBA 3RNFC 2KWUB 3WAOA 1KLVA 3V61A 1V81A 1QOGA 2NR2A 1V86A 2MP2B 2PJHA 2JQRB 2LRUA 1YX5B 2M4NA 1SIJA 1TTNA 4ANXA 2HD5B 1F9JA 3QC8B 2LVPA 2IGHA 5C23A 3LYYA 4MGZE 4FHKA 1C4CA 1M94A 5DPTA 3R7RA 4W9GA 2Z59B 1JRUA 1E8WA 3O13A 3WCQA 4HPMB 4ICUA 2MSED 4JLCA 1FNWA 2K9XA 2FBWB 1VLBA 3RULA 3DOWA 1D5ZC 1GC6A 2ZCCA 3NOBA 2FIDA 4GDLB 2K25A 2L05A 3RZFA 1J8CA 3GZNB 4URKA 2KT7A 4B0MA 2EKIA 2AX5A 4DXAB 4DHJB 2MHJA 1SIFA 2PVOD 3VUYA 2FCQA 2GRIA 1Y8RC 4L2YA 1V1OA 5C3JB 5JHBA 2MH7A 4FADA 5BYRA 4KZ0A 4KGSA 1QKZA 2BWES 1Q0WB 4HJKA 1F0ZA 3PRPB 3B08A 5G55A 1BT0A 4BBNF 5J2RA 5DPSA 3BY4B 3T9LA 4NZLB 4XDCA 2CHXA 2N7EA 3RZWC 4ARCA 3PLUA 3AXCA 4A20A 4DHZB 2HTHA 3SEBA 4ZHOA 3NVVA 4KX6B 5AUIA 2LWPA 2N1VA 3LXFA 2YVCA 4W9IA 2RGFA 4C56C 2BW2A 2Y5CA 1WMHA 2RMMA 2J7QB 4IM3A 2N9PC 3N3KB 4BKTA 5L83A 5GMVA 4F7ZA 4EEWA 1PGBA 3W2DA 3FC4A 2QHOA 4HRSA 1IP9A 1SE2A 3SR6A 4C4VA 2OJRA 4NAWB 1FFUA 4MH0E 2C9WB 4P1BC 1FFVA 4WWMA 4G3XB 1LXDA 1FXAA 4MM3B 1AARA 1YIWA 3CMMB 3KUCB 3VH3B 3W1SC 3ZUNA 4NQKE 1UWMA 4HWIB 2MP2A 1R4NI 4MJSA 3CF6E 2W82A 3AMZA 5D94A 4RGOS 4EKUA 3H8HA 1JCKB 2BYTA 5AZGA 2GOWA 4NJCA 2KACA 2C60A 1EM7A 3Q3JA 3DQVA 2BGFA 2LD9A 2WDQB 3P63A 1BMLC 2QSDA 1VD2A 2DZMA 3KLSX 2ACZB 2FUHB 3ZQ4A 3JYUA 3IHPC 3OAWA 1PFDA 3U7ZA 3ZO5B 4WURA 2ZW1A 4J6IA 2WXIA 4PYZA 1P7EA 2INPE 2RR9A 4XE0A 4P1CC 2IO1B 4WWOA 3Q3FA 3ZNZB 1RFKA 3A4SC 4EFOA 4II3B 1ZGUB 4BBNC 3P1MA 2K8HA 2QMTA 1E10A 1NI3A 3KQ4A 4WJNA 2OOBB 5FK9C 4AJWA 2DZJA 2KVZA 2UU7A 5DPWA 1L2NA 3A9JA 1V8CA 4YSZB 2AEHA 1I42A 2LGYA 3NVWA 3IG3A 1DOIA 2FAZA 3UQBA 4L23A 5IO9A 2WYQA 2MRPA 3MC0B 3A9KB 3I63C 5G2NA 4RM8A 4ZYNA 2GBNA 3WAPA 3WALA 2J52A 4NJ6A 3MC8A 4WJPA 3Q8FA 2KN4A 3A1QA 4Q2JA 2KJHB 3ABVB 1XCTL 5FKAC 4JWSC 1HZ5A 4XZ4A 3QHTA 2WXJA 1L6VA 3N9YC 3NVYA 3DBLI 2K8BA 2QDFA 1E8YA 3N30A 3P42A 2XK5A 5BMHA 4NAWA 2MJDA 2L3ZA 1K52A 2JF5A 2BYVE 3I57A 5IN7A 1FXIA 3RN9C 4ACFA 2GBJA 2V3NA 4W9FA 4ICVA 5D2MB 1WR6E 3EECA 2WDTB 4DDID 3X0WA 4K7SA 1KRHA 1QOBA 2ZPNA 1C1YB 1UD7A 4C7ZA 3BVZA 1TKGA 3Q3NC 4G0NB 4XX5A 3W1SA 3AEDB 2W55A 2ZCBA 4A90A 3KUZA 3BZDB 2WNMA 2KZRA 1T5XD 3ETRA 4JL9A 3EUB2 2H89B 5C1ZA 3JW0X 5EE3A 2CS4A 3IVFA 4BOSC 2DLBA 3UINB 1GPXA 2ONQA 3BYTB 1HQRD 1VR9A 2EMSA 1C79A 3PRZA 3IAS1 1L0XB 1NVID 3DBHB 1WJUA 1L0VB 5I4DA 1B9RA 1SE9A 1DOYA 5E6NA 1XQQA 3AEGB 5FR6A 1TGZB 3N32A 2X38A 2MBOA 5FR3A 3RT3B 2QIEB 1ET9A 2IBIB 1FCCC 2WXLA 3ONSA 4FXCA 4OW0A 4R3DA 2D10A 2Z0EB 3BYYB 2CHZA 5CX3A 3HM6X 4DHJD 1WGYA 3DHHC 1T0YA 5J18A 1GB1A 4M8MA 2L8JA 4RF0A 4PK1A 2IO0B 3A9KA 4L1BA 1GJZA 2UWQA 1FD6A 4YXDB 1EWYC 2KJRA 2H88B 4B0EA 3QA8A 1H8CA 3U52E 2BYFA 1A5RA 3QX1A 4KKJA 4LJPB 2AL6A 1WGGA 1GG3A 2GMIC 1E5WA 3DVGY 3U2SC 2D5GA 1UH6A 1WF9A 3IBEA 3PS6A 3C0RB 4FA6A 1I4QA 2IO3B 2G4DB 3ZKJC 1E9MA 5D7GA 2KO3A 4GMVA 3VVWB 4IWOA 2N0SB 4I6PA 4K7WA 3NZ3A 4IOIE 2DENB 4EZJA 2BB6A 4YWGG 1LO5D 4AOFA 2JWUA 4KDLB 1UBIA 2JRHA 2LHEA 2L1AA 2KXJA 1YNTE 4MGYE 2YEPB 2W9NA 2FCNA 1V6EA 5EE9A 1UUPA 1EWCA 4PS8A 2FE8A 3D32A 1VRAB 2LI5A 4XDDA 1FIQA 2Q5WD 3R2TA 4HVBA 3RYTA 2ASQA 1FPYA 3M3JA 4AUQC 1QQRA 4QAYA 1J19A 1SB3C 3IFWB 4W9DA 4GLSC 4BOZB 3CIRB 1RM6C 4EZLA 3DBHI 2JXTA 2KDBA 3NUHB 4WIPA 4ZRKA 1YN5A 1TKEA 4BZAA 1GUAB 3VAWA 1V2YA 2N7JA 3AE2B 2FNJB 2MBQA 1GB4A 1OGWA 5E6PA 2DZKA 2AYOB 3LDZE 3AE8B 2JXXA 2LVQA 4WWNA 1FXTB 3V6CB 3PTFC 2V1YA 1NEKB 3EFUA 2XBBC 3RNBC 1C77A 4GB9A 3V60A 4ZDVA 4E3CA 2KLGA 1T3QA 2REXA 4AJYB 2LUMA 4OVUA 2C7NB 2DZIA 4WQOB 1UGMA 1UZXB 3NVZA 1CZPA 3VQIA 2FIFA 3Q3OC 2PTLA 4YTNB 5LNK1 1I4GA 1F1HA 3R3MA 3V62A 2RSUA 3AECB 3GE8C 4NJ7A 2KC1A 1UGJA 4JGHB 1PQSA 4DHZE 4O1NA 2SAKA 4TUUA 5BYSA 2EMTA 3HM3A 3J9CA 2KMCA 4OVVA 2W3SA 3Q2AC 3RFZB 4LTUA 4FLHA 1DGJA 4J3OD 2INNE 2PIAA 1VZ7A 1QOFA 2G45B 3LB8C 1KH0A 4LNIA 4OHJA 2WGSA 3KUDB 4CQNA 2HTME 4MJSB 2MWSB 2MLBA 3RMKC 1ZKHA 2J0MA 3AU4A 3BVGA 5AEKB 1M4VA 3RPFC 1ET6A 2R2OA 1ROEA 1TIFA 4ZRIA 2D11A 4CYEA 1WZ3A 4OZBA 3RCZA 4IM2A 3ZLZA 2M0XA 2HDEA 4KIKA 3P4QB 4KGRA 2UYZB 2INCC 5JHAA 4A3PA 3VR8B 2M8SA 4PT5A 4HEA1 2BPSA 2IDYA 2BKRB 2KFJA 3P2BA 1E7UA 2X8XX 3DBRI 1IUEA 2MA9B 2LEKA 1T0SC 3ZW3A 3N20C 1FEHA 2VH2A 5EE0A 1E90A 1WFYA 1MG4A 2MJEA 3L10B 4GXBA 2IJ0A 2QC8A 2GI9A 4NPNA 3ZNHB 1B1ZA 3AEAB 1TS3A 2A5UA 1VJKA 1TJEA 3A9JB 3Q8AA 4KV2A 3ZNGC 3Q8CA 1ESFA 4RGNA 1UNSA 4FBJB 3Q8EA 1SXTA 2IY0B 2V4IB 1Q5WB 3TJPA 2K3UA 3L08A 1FRDA 2A4ZA 1WWTA 2WDVB 3AE5B 1J7AA 1EU4A 4E74A 3A1QB 3CSFA 2D3BA 3PGEA 4RGMA 1Q10A 2D3AA 3ZVVA 2ZVNA 4CHKA 2IYDB 2NMQA 4ZOHC 4M00A 1WXMA 2JZ3B 2Z8LA 1KFYB 1QILA 3VRAB 2RPQA 2M0AA 3ZTCA 1CJEA 2XK5B 3SU8X 1JWUD 4PS3A 3UGBB 4YSXB 3R2IA 4K3CA 5AZHA 3FAHA 1G6JA 1C76A 3OG5A 3V05A 1E0ZA 3P4SB 3PZDA 3BK2A 2G4SA 4IKGA 4RFBA 3GZNI 2NPTB 3Q14C 1IGDA 1YOVB 1QT9A 2M17A 1HA5A 2LHDA 1UF0A 4MSQB 2L00B 2LUEA 3ZRCA 3EA6A 3ZGZA 3H6NA 2C7HA 3SD5A 2J42A 3TBLD 1T0QC 3RD2A 4I6LB 2DNFA 1WM2A 3ZDMC 2IGDA 3N1YC 4NY0A 1Z2MA 2IPKD 1L7YA 1ZP0B 1ZDXA 2JWZA 2EKEC 2JPHA 2BTEA 3MC9A 3TEXA 4IM0A 3ZJUA 3W9CB 1L4ZB 1OFFA 4HK2A 2KC2A 1X1MA 4OVZA 5EE1A 2BF8B 3VRBB 3B9JA 3HVZA 1XLQA 1I4RA 2VZKD 2CR5A 1MFWA 2GB1A 3AN1A 2WX1A 5KHOA 1JQ4A 2KWDA 4HXDA 1Y56A 2PKOA 2OEDA 1ACCA 4FN2A 2O2VB 3NS1A 3H9DA 5IOIA 2LGIA 2N9EB 3AH7A 2G9HD 2JYTA 1OEYA 2ZVOA 1KLUD 3MJ5A 1SGHA 4MGIE 3KYCD 4OZAA 1JWAD 5BO4B 1V97A 4DWFA 2J0JA 4DDGD 3OLMD 4ANUA 1N6ZA 1XLPA 5HHDG 1CQVA 3NJTA 3ZJVA 3U8ZA 1F2RC 3QCAA 1AW7A 3AEBB 4AP4C 1FM0D 3FILB 2BVCA 4EUTA 1PYWD 5H8YE 3ZXVA 3AE4B 3RUIB 4HPLB 2KOXA 3TEZA 5IAAC 2K6QA 2MBHA 2CU3A 1PDXA 2DAJA 2BT6A 1D5MC 3GB1A 3A4RA 2R2QA 1V49A 4FJZA 1XT9B 2VRRB 1MG8A 4DQOC 1C9FA 1WH3A 3UIOB 2N9LA 2VH1A 4M01A 3ZNID 3ZIMA 1AYFA 2KWCA 2LVOA 1WXSA 3KWLA 4KZCA 4GGQA 3PHXB 1YN3A 1D4BA 2JVCA 2KDEB 3PT2B 2KTFA 4DXGA 1SJED 5JZEB 3TEYA 2NPTA 1YQ3B 3R8BA 2JU6X 2NBVB 3KH0A 3V3XA 1R4MB 1YX6B 3DHGC 2CJOA 3Q6BA 1WJ4A 3EC8A 3Q8BA 1JRPA 3AE3B 4A6QA 4AQ7A 2L0FA 1HZ6A 4LCDE 2DYMA 3BVMA 4A55A 4F1SA 5CHVC 2JX5A 4XWWA 3TMPB 2IGGA 3B2GA 1P7FA 2MJ3A 3NG0A 1XO3A 3MFGA 3PLVA 2KMMA 3NHEB 1P1AA 1D6EC 1GOZA 3URYA 2KDMA 1K50A 3TIXA 3EGRA 1A70A 1L5PA 4XYCA 2BKFA 3BWUD 2JY6A 4G50A 3UF8A 4C80A 4HDOA 1RAXA 1WZ0A 1OTRB 2JZPA 4AWJA 2E3TA 1RFAA 2WXKA 3K9OB 1TKYA 4GSWA 2MEKA 4RCOA 3ZJTA 3I9V1 1J7BA 1P98A 3EHVA 3Q3MC 3P4PB 2O2VA 3S2AA 3TL5A 2INDC 1SF0A 3DCGA 3IAM1 2N1WA 1I4PA 1F2RI 4P16A 3Q69A 5TR5A 1VDVA 4OZCA 4TQ0A 1F77A 2L0TA 2I1JA 2KTRA 3SDLC 2WQYB 2JUOA 1YQBA 3N1XC 2Y3AA 3OWEB 2KK8A 3ECIA 2FCSA 4GU2A 5J17A 2G3QB 3VR9B 3V6EB 3FILA 4IW0A 2J0KA 5IP4D 3AE6B 4WAAA 1DYQA 4HROA 2NBWB 1N62A 5HG2A 5L95C 4BVUC 4US9A 1WJ6A 2QEJC 4UDUC 1E8ZA 2MBEA 4KIKB 2VZKB 1MVKA 1NENB 1WE7A 4DK5A 1Q1OA 1WE6A 2I38A 1WSPA 1SBBB 3R7QA 2MCNB 1JROA 3E9SA 2BQQA 4E71A 2KJ6A 4YL8A 1C3TA 2PW9A 3L4PA 1UBQA 1SEBD 2DWQA 4ITKA 4ZRQA 2RDHA 1K8RB 1V5OA 1XLOA 1T6BX 3DVNU 3B0AA 2BYEA 2JT4B 4S17A 4K81A 2YLMA 4RM9A 4WH4A 4LNFA 3PRMB 3HRDD 1DOXA 5BYQA 2FUG1 4LDTB 3FKYA 2NS5A 3MHZA 3DWGC 1EF1A 2D3CA 5AUKA 1SJHD 1K51A 1HTOA 1WM3A 3NRZA 4ZHPA 2KDIA 2IZVB 2AWTA 1XD3B 3ALBA 4GDKA 4LK0M 4HDQA 5D3IB 3C19A 1WGKA 1ZXHA 4N6EB 4JWUC 1LGRA 2KQ4X 3VDZA 1I35A 3DVGX 4HCNB 1HEZE 1WIAA 3ZXRA 1I4HA 2WXMA 3AE1B 1YJIA 3WIMA 4C00A 2AQ1B 1WGHA 1C4AA 2K0PA 4YTMB 1CK1A 1P9DU 4ZRJA 1J0GA 1AN8A 4GOCA 4H2AA 2LXAA 2KNBA 1LM8B 2AQ3B 5MPOA 3ML8A 4FULA 1YJJA 3DVNV 3ML9A 1KJTA 4XGAB 2ZZPB 4MT5A 2G1EA 1STEA 3U30A 4MEMA 5G5HA 4ZRPA 1L0YB 4MH8A 1Z5SB 2KQ7A 4WWPA 2L83A 1CMXB 2KVRA 1WX8A 3IXSA 5BMGA 5IKCM 5CTRC 3E56A 3W5UB 2KX0A 2WXNA 3CSTA 3PSEB 1GAQB 1V5TA 3U7DA 5CHFA 4GIVA 3R66C 2WXHA 4A3OA 2WS3B 1WGDA 3DBSA 2WXRA 2HJ1A 3HHMA 2IO2B 3EFCA 4AS1A 2N9KA 1TZOA 1I7HA 3KYDD 3U4EG 4TKNA 5T8IA 1WXQA 1WXVA 2LRWA 2PMVA 4RGTA 2KMAA 1E8XA 3DPDA 2IY1B 5H92C 2AQ2B 2XNAC 1R4NB 1TY0A 5D6JB 3L13A 3B2FA 4C7YA 3APFA 1FO4A 1XF5L 1IBXB 2KANA 2MQJA 5D3DA 2D3GA 3TUOA 2M1MA 4W9KA 5AZFA 1XLNA 1D3ZA 1TYGB 1E6EB 1L4DB 2KYWA 2LGSA 1N63A 4BKGA 4FJVB 2O6VB 2DYBA 1S1QB 4P7IA 4TV3A 3AE7B 1N5XA 1TS2A 3MJWA 1VCBA 2KQSA 3AE9B 3NZUA 4N9F4 4KGTA 1WYGA 5G5GA 1EF5A 2GBMA 3T3OA 3TCAA 1FNUA 1SSNA 2DAFA 4N59A 2LXCA 2NTTA 3ENEA 3M62B 2JSVX 2ZJDA 1SE4A 4CO7A 1FMAD 1QZEA 3H1UA 2SEBD 3DWMA 2KLCA 3L17A 2D07B 3ZDTA 2K5PA 2HJ8A 3DHIC 4FJYA 1L6UA 1LFDA 4KKIA 3L16A 2Z0DB 4KSKC 2WU5B 4HKQA 2B3AA 3KVFB 3QIJA 2DX5B 4IG7B 3PO0A 3BK1A 2M19A 4MACA 1JMLA 1ZE3D 2KFKA 1MHXA 4MDKE 1U4AA 2L52A 3BINA 2NBUA 4F8CB 2K22A 4LLGM 1KLGD 1MPEA 1V1PA 1T0RC 3W5VB 1N61A 1ZUD2 3IT4B 2MW5A 3PPAA 4G11A 2LASA 4II2B 1PGXA 3C8YA 1ZDVA 5JH5C 3P4RB 3RNGC 2BWFA 1ZOYB 3WANA 3HUIA 3RNCC 4A8XC 2D2QA 3CWIA 4HCPB 5CHWA 3AULA 3DBLB 4BFRA 2NVUI 2KD0A 1YD8U 4HJGE 2C7MB 2W54A 3OJ3A 3PHWB 5JXVA 3T3NA 3I3TB 4EE2A 4NQLB 2QJLA 4NAMA 3WA0A 2NCNA 2KWVB 3TSSA 3RNEC 3GS2A 4M02A 4US8A 4RH6A 3AV8A 1WI0A 2AL3A 3VTUA 4KVGB 4GDLA 3ZYYX 5BMIA 2WLBA 1QLBB 5IA7A 4GN1A 3QQ8B 1IBXA 1QF6A 2RPVA 2ZPYA 3AU5A 4FHJA 3VH4B 2MX2A 3QJZA 4I6NB 2DHZA 1WYWB 3KW5B 4MSMB 2W3RA 2LJIA 4JE3B 2O6VA 1R7SA 2KTRB 1HTQA 2KN5A 2LGDA 2GLSA 3ZTDA 4X57B 1XCQL 1WXAA 3VFKA 4W9HA 4K7UA 2WU2B 4WJOA 4ASWC 1D5XC 4BKSA 2KKCA 2E6XA 2KAJA 1TS5A 3QK0A 1ZXIA 4LDTD 4KSLC 3H7PB 2WDRB 1WX7A 1WY8A 1KF6B 4LNNA 4HPPA 1YMHE 3RI7C 5HI1A 1RLFA 3M95A 3X23A 2NTSA 2J53A 1P0RA 2KX3A 1OEYJ 3HVDA 2CKHB 3PZ7A 1XEEA 2XN9C 3AM9A 1N5WA 1TT5B 2BS4B 4JX1C 1WRIA 2WXOA 4ANVA 2YEPF 4HLEA 5LXIB 3UI3A 5E6OA 2GBRA 1SE3A 2CJNA 3PREA 3AB5A 2PPHA 4YSYB 5LLIA 3PVLA 3A33B 1WJNA 2K39A 3AEFB 4YTPB 2BS3B 1C78A 4MM3A 1OQRA 1TBEA 2WXGA 2CU1A 1FCLA 2LGXA 5E6JA 3IT6B 2GBKA 2RD0A 3N1ZC 5GXGB 2I2YA 2N7DA 2WXPA 1WR1A 1J7CA 1HE8A 3JVZX 4WQMA 3DDCB 3HK0A 3ZRFA 2V0GA 2N4FA 1EU3A 3GE3C 1V80A 2RDGA 5KHQA 1MJDA 4M8NA 4RNAA 5EDSA 3SFDB 2PE9A 4GDKB 3PV1A 2WHIA 2KHWB 1TY2A 1IYFA 1EO6A 3NS8A 2KDFB 3B1LX 4K1RB 2OJWA 4PYUA 5HFYA 4W9JA 3JSVB 2M56B 2WP9B 3H7SA 1E7VA 5LXHA 2WWZA 3VHTC 3APCA 1HXYD 2I1KA 2N9XA 3MTNB 1E7PB 4PS7A 4EOYA 1YN4A 1MI0A 3QARA 1RWSA 3APDA 3K9PB 2L32A 4JQWC 4W9LA 3VUWA 4W9EA 2WXQA 1OQYA 4REZA 1UWXA 4USAA 4HKZE 4IWPA 3VTWA 1GNUA 2QILA 2Y5PA 3M63B 4DXFA 1BUIC 2WX0A 1YQ4B 2K1FA 2RDBC 1I4XA 3VXWA 3OJ4B 1IPGA 3WAMA 2TSSA 4RF1A 4M0WB 3H7PA 1JWBD 3LJ3A 2V4LA 2O6VD 4WJQA 2LJ5A 1TS4A 1P3QU 3SFEB 1JALA 2MBBB 4W9CA 2LFIA 4LJOB 4JPSA 1MHHE 2V3SA 3O65B 4BKSD 1NBFC 3HIZA 3L54A 1R4MI 3VTVA 2HE7A 2JYEA 1KTKA 1YJ1A 1EUVB 4TSSA 2LZ6A 1UELA 2C5LC 3UQAA 4MELA 4ZYSA 1NDDA 3VUXA 5DCNA 2PE6B 4A9AA 2FCMA 4TQ1A 3AI5A 4B95A 3MP9A 3QAQA 2K6DB 2ZEQA 4IUMB 1VZ6A 2ZW0A 1K53A 2L7RA 1H4RA 4D2KA 1KOTA 2XEWA 4ANWA 1ZPSA 5C2TB 2V3PA 3MHSD 1GC7A 4N58A 1OQQA 2DYOA 1RRBA 2JZZA 1NYRA 3W1YA 1PGAA 3NZSA 2LMCA 1FRRA 2B76B 1ZW7A 4WAFA 1BXTA 1N60A 3TEWA 1AWDA 4IC7B 2PLPA 3SHQA 3RNAC 1F52A 4KDIC 3GOEA 3T8MA 4YT0B 3UIPB 1XXGA 4DBGA 2ICIA 2DBYA 1JW9D 2R61A 2J4XA 4LNKA 2JRIB 2WXFA 1S3SG 4B9KA 1IGCA 1PUTA 2PEAA 1TZ1A 3NY5A 4EZKA 3GP7A 3AEEB 4IDIA
chains in the Genus database with same CATH topology
2PVGC 4XWTA 3AEGB 3AE9B 3NS1A 2LGIA 2X38A 3AH7A 2G9HD 2JYTA 4KGTA 3PZ8A 5FR3A 1WYGA 1KLUD 2QIEB 3MJ5A 5G5GA 1ET9A 2WXLA 1FCCC 4FXCA 4OW0A 4OZAA 1JWAD 4R3DA 1V97A 3T3OA 3BYYB 1QOAA 1FNUA 1SSNA 1XLPA 4TMAB 4N59A 5HHDG 1CQVA 2NTTA 3ZJVA 2JSVX 1F2RC 1ENFA 1SE4A 1JWMD 1NYQA 1AW7A 3AEBB 1FM0D 1FMAD 2BS2B 4P6VF 3FILB 1GB1A 3BIID 4RF0A 1PYWD 2SEBD 4L1BA 5H8YE 1FD6A 3DWMA 4YXDB 3AE4B 1EWYC 2H88B 4B0EA 3TEZA 2K5PA 2ON8A 2BBCA 1C4PA 3U52E 2CU3A 1L6UA 1PDXA 1RYJA 1VZ8A 4KKIA 4M0WA 2BT6A 4KKJA 1D5MC 4ARIA 2WU5B 3GB1A 2OHFA 3KWVA 2EELA 5TSSA 4HKQA 2BB5A 1V1PB 3U2SC 1JWSD 2D5GA 1I4QA 1E9MA 3PO0A 5D7GA 3BK1A 2M19A 4DQOC 4MACA 1C9FA 1JMLA 1ZE3D 1FNVA 2N9LA 1DOYA 1MHXA 2N0SB 1AYFA 1QOGA 3NZ3A 2L52A 4IOIE 2BB6A 2K22A 4LLGM 4YWGG 3KWLA 1KLGD 1LO5D 1MPEA 1V1PA 2JQRB 3W5VB 2JWUA 1N61A 1SIJA 1ZUD2 1YN3A 2LHEA 3IT4B 1D4BA 2L1AA 1YNTE 2YEPB 2IGHA 3LYYA 4DXGA 1SJED 1C4CA 1UUPA 5EE9A 1EWCA 1PGXA 2FE8A 3AE7B 3C8YA 1VRAB 4XDDA 1ZDVA 3TEYA 1FIQA 1YQ3B 3P4RB 2Q5WD 3R2TA 3R8BA 2JU6X 1ZOYB 3HUIA 4A8XC 3V3XA 1QQRA 3O13A 3WCQA 2CJOA 3CWIA 3Q8BA 1JRPA 3AE3B 4A6QA 1FNWA 2K9XA 1SB3C 4AQ7A 4HJGE 2FBWB 2W54A 1VLBA 4GLSC 3CIRB 1RM6C 1HZ6A 5JXVA 2DYMA 2JXTA 3BVMA 3NUHB 4A55A 4XWWA 1D5ZC 2JX5A 3T3NA 4EE2A 2IGGA 4WIPA 1YN5A 2QJLA 4NAMA 1TKEA 4GDLB 3B2GA 1P7FA 2MJ3A 2N7JA 3AE2B 4B0MA 2EKIA 2AX5A 1XO3A 3TSSA 2PVOD 3MFGA 2KMMA 2GRIA 1GB4A 1D6EC 1GOZA 3GS2A 2KDMA 3URYA 1K50A 4US8A 3AE8B 4RH6A 4L2YA 3AV8A 1V1OA 3EGRA 5C3JB 1A70A 1L5PA 2MH7A 5BYRA 3BWUD 3ZYYX 5BMIA 1NEKB 2WLBA 1QLBB 1C77A 4KGSA 1IBXA 1QKZA 4C80A 1QF6A 1F0ZA 2RPVA 1T3QA 2LUMA 2JZPA 1FO4A 2E3TA 2WXKA 4NZLB 4XDCA 1TKYA 2W3RA 2MEKA 3NVZA 4RCOA 3ZJTA 2LJIA 1J7BA 3I9V1 4JE3B 4ARCA 1R7SA 1CZPA 3P4PB 3VQIA 1XCQL 1SF0A 3IAM1 2PTLA 4YTNB 5LNK1 1I4GA 2WU2B 1I4PA 3SEBA 4ZHOA 3NVVA 1F2RI 4P16A 1D5XC 4KX6B 3AECB 3Q69A 5AUIA 2E6XA 2KAJA 1TS5A 1ZXIA 1VDVA 4OZCA 1UGJA 3LXFA 4TQ0A 1F77A 2WDRB 2WQYB 4C56C 2BW2A 1KF6B 2Y3AA 3OWEB 2Y5CA 4O1NA 2SAKA 2RMMA 1YMHE 5BYSA 3J9CA 5HI1A 3VR9B 3FILA 2W3SA 3RFZB 1PGBA 4LTUA 3W2DA 2NTSA 1DGJA 2J53A 3AE6B 4J3OD 2INNE 3FC4A 2PIAA 1VZ7A 1QOFA 4HRSA 1DYQA 3LB8C 1KH0A 1SE2A 3HVDA 3SR6A 4OHJA 3PZ7A 4NAWB 1FFUA 4HROA 1XEEA 2XN9C 3AM9A 1N5WA 1N62A 5HG2A 4CQNA 2HTME 2BS4B 4JX1C 1WRIA 2WXOA 1FFVA 4WWMA 4US9A 1FXAA 2YEPF 2QEJC 4UDUC 4MM3B 2VZKB 1MVKA 3UI3A 1NENB 3BVGA 1SE3A 1M4VA 2CJNA 3RPFC 1ET6A 1ROEA 3AB5A 2I38A 4YSYB 1UWMA 1WSPA 4OZBA 1SBBB 1JROA 3AEFB 4YTPB 3E9SA 2BS3B 1C78A 2HDEA 2W82A 1OQRA 2WXGA 3AMZA 4RGOS 1FCLA 3P4QB 2PW9A 3L4PA 4KGRA 5E6JA 3H8HA 1JCKB 3IT6B 1SEBD 2DWQA 4ITKA 4ZRQA 2BYTA 3VR8B 2RDHA 4PT5A 4NJCA 5GXGB 2KACA 1XLOA 1T6BX 2I2YA 4HEA1 1EM7A 2IDYA 2WXPA 2WDQB 3P63A 1BMLC 2QSDA 1J7CA 4WQMA 1IUEA 3KLSX 2ACZB 2LEKA 3ZQ4A 2V0GA 1EU3A 3U7ZA 1PFDA 4WH4A 1FEHA 4WURA 2RDGA 2ZW1A 3HRDD 5EE0A 1DOXA 4RNAA 5BYQA 2MJEA 2WXIA 3SFDB 2IJ0A 2GI9A 4GDKB 1B1ZA 1P7EA 2FUG1 2INPE 1TS3A 3AEAB 1TY2A 4XE0A 3MHZA 3DWGC 5AUKA 1VJKA 1TJEA 1SJHD 1RFKA 1K51A 5HFYA 3NRZA 3Q8AA 4ZHPA 3P1MA 3Q8CA 2M56B 2WP9B 1ESFA 2QMTA 1UNSA 4RGNA 4LK0M 1E10A 5D3IB 1NI3A 3KQ4A 1WGKA 1ZXHA 4N6EB 1HXYD 4JWUC 5FK9C 1E7PB 3Q8EA 1YN4A 1MI0A 1SXTA 2KQ4X 2V4IB 1RWSA 2L32A 1V8CA 2K3UA 1FRDA 1WWTA 2WDVB 2WXQA 4YSZB 1HEZE 4REZA 1UWXA 3AE5B 3NVWA 1J7AA 1EU4A 4USAA 4HKZE 1DOIA 1I4HA 2WXMA 4L23A 2QILA 2Y5PA 3MC0B 4DXFA 1BUIC 3AE1B 1YJIA 4RGMA 1Q10A 2J52A 2NMQA 1YQ4B 2AQ1B 4ZOHC 1C4AA 2K0PA 1I4XA 4YTMB 2Z8LA 3Q8FA 1CK1A 1KFYB 2KN4A 1QILA 2TSSA 4RF1A 3VRAB 1JWBD 2M0AA 1AN8A 4Q2JA 4H2AA 1CJEA 3ABVB 1XCTL 1TS4A 5FKAC 3SFEB 1JALA 4JWSC 1JWUD 1HZ5A 2AQ3B 2LFIA 5MPOA 4JPSA 1YJJA 1MHHE 4YSXB 3R2IA 2WXJA 2JYEA 4MT5A 1L6VA 3N9YC 1KTKA 3FAHA 3NVYA 1C76A 2G1EA 3P42A 4TSSA 1STEA 3V05A 1E0ZA 5BMHA 2MJDA 5G5HA 4ZYSA 1K52A 4ZRPA 1L0YB 4MH8A 3I57A 3P4SB 1FXIA 2L83A 4A9AA 3BK2A 4TQ1A 4IKGA 3MP9A 4RFBA 2V3NA 3IXSA 5BMGA 3W5UB 3E56A 1IGDA 1QT9A 1HA5A 2LHDA 1VZ6A 2WXNA 2ZW0A 1K53A 4D2KA 1GAQB 3EA6A 1KRHA 1QOBA 3ZGZA 1ZPSA 2J42A 2WXHA 5C2TB 2V3PA 2WS3B 4N58A 1OQQA 4C7ZA 2DYOA 3BVZA 2IGDA 1NYRA 2WXRA 1TKGA 2IPKD 1PGAA 1ZP0B 1ZDXA 2LMCA 4AS1A 1FRRA 2N9KA 1TZOA 2B76B 1I7HA 3W1SA 3U4EG 3AEDB 4WAFA 2BTEA 2W55A 1BXTA 5T8IA 4A90A 1WXQA 3TEXA 1N60A 3TEWA 3ZJUA 2PMVA 1AWDA 1L4ZB 4RGTA 3W9CB 1OFFA 2PLPA 3BZDB 4OVZA 5EE1A 5H92C 2WNMA 1T5XD 2AQ2B 2XNAC 3ETRA 3VRBB 1TY0A 3B9JA 4YT0B 3B2FA 3HVZA 3EUB2 1XLQA 2H89B 1XF5L 4C7YA 1I4RA 1XXGA 2VZKD 5EE3A 1IBXB 2GB1A 3AN1A 1GPXA 2DLBA 5D3DA 2ONQA 2ICIA 3TUOA 2DBYA 3BYTB 1HQRD 1VR9A 1JQ4A 1JW9D 2R61A 1XLNA 1C79A 3IAS1 1L0XB 2KWDA 1TYGB 1Y56A 1E6EB 1L4DB 2J4XA 2PKOA 2OEDA 1N63A 1NVID 2WXFA 1L0VB 5I4DA 1B9RA 1IGCA 1PUTA 1ACCA 1N5XA 3GP7A 3AEEB 4IDIA 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN B;  1JWB D;  2JX5 A;  2PVG C;  3AEG B;  3AE9 B;  3NS1 A;  2CJN A;  2QJL A;  3AH7 A;  3RPF C;  1TKE A;  1ROE A;  3AB5 A;  3B2G A;  2MJ3 A;  1CJE A;  3ABV B;  4YSY B;  1WYG A;  1UWM A;  2QIE B;  3AE2 B;  5G5G A;  4FXC A;  2EKI A;  2AX5 A;  3SFE B;  1JAL A;  1XO3 A;  4JWS C;  2PVO D;  1JWA D;  1V97 A;  2KMM A;  5MPO A;  1JRO A;  3AEF B;  1QOA A;  4YTP B;  1YJJ A;  4US8 A;  2BS3 B;  3AE8 B;  3AMZ A;  1XLP A;  1OQR A;  3AV8 A;  4YSX B;  5C3J B;  1A70 A;  1L5P A;  4N59 A;  2MH7 A;  3L4P A;  3P4Q B;  4ITK A;  2DWQ A;  3VR8 B;  1L6V A;  3ZYY X;  1NEK B;  3FAH A;  2WLB A;  1QLB B;  3NVY A;  5GXG B;  1NYQ A;  1XLO A;  3AEB B;  2G1E A;  1FM0 D;  1FMA D;  2BS2 B;  4P6V F;  4C80 A;  1E0Z A;  1QF6 A;  1F0Z A;  3BII D;  1T3Q A;  2WDQ B;  2MJD A;  3P63 A;  5G5H A;  1J7C A;  5H8Y E;  4WQM A;  3P4S B;  1IUE A;  1FXI A;  2ACZ B;  2L83 A;  4A9A A;  2LEK A;  1FO4 A;  3DWM A;  2E3T A;  3AE4 B;  1EWY C;  4YXD B;  2H88 B;  1PFD A;  1TKY A;  2W3R A;  3NVZ A;  2K5P A;  1J7B A;  3W5U B;  1R7S A;  3HRD D;  5EE0 A;  1DOX A;  1QT9 A;  2CU3 A;  1L6U A;  2MJE A;  1PDX A;  1RYJ A;  1CZP A;  3P4P B;  3SFD B;  4YT0 B;  2BT6 A;  1SF0 A;  1GAQ B;  2WU5 B;  3AEA B;  2OHF A;  4YTN B;  1KRH A;  2WU2 B;  1QOB A;  4ZHO A;  3NVV A;  3DWG C;  4KX6 B;  3AEC B;  5AUK A;  1VJK A;  1TJE A;  5AUI A;  5C2T B;  2KAJ A;  1ZXI A;  1VDV A;  1E9M A;  1RFK A;  3PO0 A;  2M19 A;  2WS3 B;  3LXF A;  4N58 A;  1OQQ A;  3NRZ A;  2WDR B;  4C7Z A;  4ZHP A;  3P1M A;  1DOY A;  2WQY B;  2N0S B;  1NYR A;  2M56 B;  2WP9 B;  1TKG A;  1KF6 B;  1AYF A;  1ZP0 B;  1QOG A;  2Y5C A;  1E10 A;  2L52 A;  1NI3 A;  1FRR A;  2B76 B;  2K22 A;  1WGK A;  1I7H A;  3KWL A;  4N6E B;  4JWU C;  2JQR B;  3AED B;  1E7P B;  2W55 A;  3VRA B;  3W5V B;  1N61 A;  1WXQ A;  3VR9 B;  1SIJ A;  1N60 A;  1ZUD 2;  1RWS A;  1V8C A;  1AWD A;  2W3S A;  3W9C B;  1OFF A;  4LTU A;  1FRD A;  1WWT A;  2WDV B;  5EE1 A;  5H92 C;  4YSZ B;  1DGJ A;  3ETR A;  5EE9 A;  3AE5 B;  3AE6 B;  3NVW A;  3VRB B;  3B9J A;  1J7A A;  4USA A;  3B2F A;  3HVZ A;  3EUB 2;  1XLQ A;  2H89 B;  2PIA A;  3FC4 A;  4C7Y A;  1FIQ A;  5EE3 A;  1DOI A;  1QOF A;  1YQ3 B;  2Q5W D;  3AN1 A;  3P4R B;  4HRS A;  1GPX A;  3LB8 C;  3SR6 A;  2DBY A;  1ZOY B;  1FFU A;  3HUI A;  4HRO A;  1JQ4 A;  1JW9 D;  1XLN A;  3AM9 A;  3WCQ A;  2CJO A;  1N5W A;  1N62 A;  1YJI A;  3AE1 B;  3CWI A;  1TYG B;  1E6E B;  2HTM E;  2BS4 B;  2PKO A;  4JX1 C;  1JRP A;  1WRI A;  3AE3 B;  1N63 A;  1NVI D;  1YQ4 B;  2K9X A;  4ZOH C;  1SB3 C;  1FFV A;  4WWM A;  2FBW B;  2W54 A;  4US9 A;  1L0V B;  4YTM B;  1B9R A;  1VLB A;  1PUT A;  1FXA A;  1KFY B;  3CIR B;  1RM6 C;  3AE7 B;  1N5X A;  3AEE B;  4IDI A; 
#chains in the Genus database with same CATH topology
 2PVG C;  3DBR B;  4XWT A;  3JSV A;  4LNO A;  2Y5B B;  3PZ8 A;  4IWQ A;  1NI2 A;  1QOA A;  1ISN A;  4TMA B;  2L76 A;  4RMA A;  1WMH B;  4BAX A;  3QWZ B;  1WRD B;  2ZNV C;  5HKH A;  1ENF A;  4NNJ B;  1JWM D;  1NYQ A;  4JIO U;  2BS2 B;  4P6V F;  3L0W B;  1KM7 A;  3BII D;  4XC2 A;  5DPR A;  2V9H A;  1V9J A;  1WX9 A;  2ON8 A;  2BBC A;  1C4P A;  2KFK B;  4C4V B;  2K8C A;  1RYJ A;  1VZ8 A;  1WGR A;  4M0W A;  4ARI A;  2CHW A;  2ZNV B;  4S0R A;  2OHF A;  3KWV A;  2EEL A;  5TSS A;  2QCZ A;  2BB5 A;  1V1P B;  1JWS D;  4K3B A;  3I5J C;  4B6W A;  1FNV A;  4MGK E;  1LQB A;  3RNF C;  2KWU B;  3WAO A;  1KLV A;  3V61 A;  1V81 A;  1QOG A;  2NR2 A;  1V86 A;  2MP2 B;  2PJH A;  2JQR B;  2LRU A;  1YX5 B;  2M4N A;  1SIJ A;  1TTN A;  4ANX A;  2HD5 B;  1F9J A;  3QC8 B;  2LVP A;  2IGH A;  5C23 A;  3LYY A;  4MGZ E;  4FHK A;  1C4C A;  1M94 A;  5DPT A;  3R7R A;  4W9G A;  2Z59 B;  1JRU A;  1E8W A;  3O13 A;  3WCQ A;  4HPM B;  4ICU A;  2MSE D;  4JLC A;  1FNW A;  2K9X A;  2FBW B;  1VLB A;  3RUL A;  3DOW A;  1D5Z C;  1GC6 A;  2ZCC A;  3NOB A;  2FID A;  4GDL B;  2K25 A;  2L05 A;  3RZF A;  1J8C A;  3GZN B;  4URK A;  2KT7 A;  4B0M A;  2EKI A;  2AX5 A;  4DXA B;  4DHJ B;  2MHJ A;  1SIF A;  2PVO D;  3VUY A;  2FCQ A;  2GRI A;  1Y8R C;  4L2Y A;  1V1O A;  5C3J B;  5JHB A;  2MH7 A;  4FAD A;  5BYR A;  4KZ0 A;  4KGS A;  1QKZ A;  2BWE S;  1Q0W B;  4HJK A;  1F0Z A;  3PRP B;  3B08 A;  5G55 A;  1BT0 A;  4BBN F;  5J2R A;  5DPS A;  3BY4 B;  3T9L A;  4NZL B;  4XDC A;  2CHX A;  2N7E A;  3RZW C;  4ARC A;  3PLU A;  3AXC A;  4A20 A;  4DHZ B;  2HTH A;  3SEB A;  4ZHO A;  3NVV A;  4KX6 B;  5AUI A;  2LWP A;  2N1V A;  3LXF A;  2YVC A;  4W9I A;  2RGF A;  4C56 C;  2BW2 A;  2Y5C A;  1WMH A;  2RMM A;  2J7Q B;  4IM3 A;  2N9P C;  3N3K B;  4BKT A;  5L83 A;  5GMV A;  4F7Z A;  4EEW A;  1PGB A;  3W2D A;  3FC4 A;  2QHO A;  4HRS A;  1IP9 A;  1SE2 A;  3SR6 A;  4C4V A;  2OJR A;  4NAW B;  1FFU A;  4MH0 E;  2C9W B;  4P1B C;  1FFV A;  4WWM A;  4G3X B;  1LXD A;  1FXA A;  4MM3 B;  1AAR A;  1YIW A;  3CMM B;  3KUC B;  3VH3 B;  3W1S C;  3ZUN A;  4NQK E;  1UWM A;  4HWI B;  2MP2 A;  1R4N I;  4MJS A;  3CF6 E;  2W82 A;  3AMZ A;  5D94 A;  4RGO S;  4EKU A;  3H8H A;  1JCK B;  2BYT A;  5AZG A;  2GOW A;  4NJC A;  2KAC A;  2C60 A;  1EM7 A;  3Q3J A;  3DQV A;  2BGF A;  2LD9 A;  2WDQ B;  3P63 A;  1BML C;  2QSD A;  1VD2 A;  2DZM A;  3KLS X;  2ACZ B;  2FUH B;  3ZQ4 A;  3JYU A;  3IHP C;  3OAW A;  1PFD A;  3U7Z A;  3ZO5 B;  4WUR A;  2ZW1 A;  4J6I A;  2WXI A;  4PYZ A;  1P7E A;  2INP E;  2RR9 A;  4XE0 A;  4P1C C;  2IO1 B;  4WWO A;  3Q3F A;  3ZNZ B;  1RFK A;  3A4S C;  4EFO A;  4II3 B;  1ZGU B;  4BBN C;  3P1M A;  2K8H A;  2QMT A;  1E10 A;  1NI3 A;  3KQ4 A;  4WJN A;  2OOB B;  5FK9 C;  4AJW A;  2DZJ A;  2KVZ A;  2UU7 A;  5DPW A;  1L2N A;  3A9J A;  1V8C A;  4YSZ B;  2AEH A;  1I42 A;  2LGY A;  3NVW A;  3IG3 A;  1DOI A;  2FAZ A;  3UQB A;  4L23 A;  5IO9 A;  2WYQ A;  2MRP A;  3MC0 B;  3A9K B;  3I63 C;  5G2N A;  4RM8 A;  4ZYN A;  2GBN A;  3WAP A;  3WAL A;  2J52 A;  4NJ6 A;  3MC8 A;  4WJP A;  3Q8F A;  2KN4 A;  3A1Q A;  4Q2J A;  2KJH B;  3ABV B;  1XCT L;  5FKA C;  4JWS C;  1HZ5 A;  4XZ4 A;  3QHT A;  2WXJ A;  1L6V A;  3N9Y C;  3NVY A;  3DBL I;  2K8B A;  2QDF A;  1E8Y A;  3N30 A;  3P42 A;  2XK5 A;  5BMH A;  4NAW A;  2MJD A;  2L3Z A;  1K52 A;  2JF5 A;  2BYV E;  3I57 A;  5IN7 A;  1FXI A;  3RN9 C;  4ACF A;  2GBJ A;  2V3N A;  4W9F A;  4ICV A;  5D2M B;  1WR6 E;  3EEC A;  2WDT B;  4DDI D;  3X0W A;  4K7S A;  1KRH A;  1QOB A;  2ZPN A;  1C1Y B;  1UD7 A;  4C7Z A;  3BVZ A;  1TKG A;  3Q3N C;  4G0N B;  4XX5 A;  3W1S A;  3AED B;  2W55 A;  2ZCB A;  4A90 A;  3KUZ A;  3BZD B;  2WNM A;  2KZR A;  1T5X D;  3ETR A;  4JL9 A;  3EUB 2;  2H89 B;  5C1Z A;  3JW0 X;  5EE3 A;  2CS4 A;  3IVF A;  4BOS C;  2DLB A;  3UIN B;  1GPX A;  2ONQ A;  3BYT B;  1HQR D;  1VR9 A;  2EMS A;  1C79 A;  3PRZ A;  3IAS 1;  1L0X B;  1NVI D;  3DBH B;  1WJU A;  1L0V B;  5I4D A;  1B9R A;  1SE9 A;  1DOY A;  5E6N A;  1XQQ A;  3AEG B;  5FR6 A;  1TGZ B;  3N32 A;  2X38 A;  2MBO A;  5FR3 A;  3RT3 B;  2QIE B;  1ET9 A;  2IBI B;  1FCC C;  2WXL A;  3ONS A;  4FXC A;  4OW0 A;  4R3D A;  2D10 A;  2Z0E B;  3BYY B;  2CHZ A;  5CX3 A;  3HM6 X;  4DHJ D;  1WGY A;  3DHH C;  1T0Y A;  5J18 A;  1GB1 A;  4M8M A;  2L8J A;  4RF0 A;  4PK1 A;  2IO0 B;  3A9K A;  4L1B A;  1GJZ A;  2UWQ A;  1FD6 A;  4YXD B;  1EWY C;  2KJR A;  2H88 B;  4B0E A;  3QA8 A;  1H8C A;  3U52 E;  2BYF A;  1A5R A;  3QX1 A;  4KKJ A;  4LJP B;  2AL6 A;  1WGG A;  1GG3 A;  2GMI C;  1E5W A;  3DVG Y;  3U2S C;  2D5G A;  1UH6 A;  1WF9 A;  3IBE A;  3PS6 A;  3C0R B;  4FA6 A;  1I4Q A;  2IO3 B;  2G4D B;  3ZKJ C;  1E9M A;  5D7G A;  2KO3 A;  4GMV A;  3VVW B;  4IWO A;  2N0S B;  4I6P A;  4K7W A;  3NZ3 A;  4IOI E;  2DEN B;  4EZJ A;  2BB6 A;  4YWG G;  1LO5 D;  4AOF A;  2JWU A;  4KDL B;  1UBI A;  2JRH A;  2LHE A;  2L1A A;  2KXJ A;  1YNT E;  4MGY E;  2YEP B;  2W9N A;  2FCN A;  1V6E A;  5EE9 A;  1UUP A;  1EWC A;  4PS8 A;  2FE8 A;  3D32 A;  1VRA B;  2LI5 A;  4XDD A;  1FIQ A;  2Q5W D;  3R2T A;  4HVB A;  3RYT A;  2ASQ A;  1FPY A;  3M3J A;  4AUQ C;  1QQR A;  4QAY A;  1J19 A;  1SB3 C;  3IFW B;  4W9D A;  4GLS C;  4BOZ B;  3CIR B;  1RM6 C;  4EZL A;  3DBH I;  2JXT A;  2KDB A;  3NUH B;  4WIP A;  4ZRK A;  1YN5 A;  1TKE A;  4BZA A;  1GUA B;  3VAW A;  1V2Y A;  2N7J A;  3AE2 B;  2FNJ B;  2MBQ A;  1GB4 A;  1OGW A;  5E6P A;  2DZK A;  2AYO B;  3LDZ E;  3AE8 B;  2JXX A;  2LVQ A;  4WWN A;  1FXT B;  3V6C B;  3PTF C;  2V1Y A;  1NEK B;  3EFU A;  2XBB C;  3RNB C;  1C77 A;  4GB9 A;  3V60 A;  4ZDV A;  4E3C A;  2KLG A;  1T3Q A;  2REX A;  4AJY B;  2LUM A;  4OVU A;  2C7N B;  2DZI A;  4WQO B;  1UGM A;  1UZX B;  3NVZ A;  1CZP A;  3VQI A;  2FIF A;  3Q3O C;  2PTL A;  4YTN B;  5LNK 1;  1I4G A;  1F1H A;  3R3M A;  3V62 A;  2RSU A;  3AEC B;  3GE8 C;  4NJ7 A;  2KC1 A;  1UGJ A;  4JGH B;  1PQS A;  4DHZ E;  4O1N A;  2SAK A;  4TUU A;  5BYS A;  2EMT A;  3HM3 A;  3J9C A;  2KMC A;  4OVV A;  2W3S A;  3Q2A C;  3RFZ B;  4LTU A;  4FLH A;  1DGJ A;  4J3O D;  2INN E;  2PIA A;  1VZ7 A;  1QOF A;  2G45 B;  3LB8 C;  1KH0 A;  4LNI A;  4OHJ A;  2WGS A;  3KUD B;  4CQN A;  2HTM E;  4MJS B;  2MWS B;  2MLB A;  3RMK C;  1ZKH A;  2J0M A;  3AU4 A;  3BVG A;  5AEK B;  1M4V A;  3RPF C;  1ET6 A;  2R2O A;  1ROE A;  1TIF A;  4ZRI A;  2D11 A;  4CYE A;  1WZ3 A;  4OZB A;  3RCZ A;  4IM2 A;  3ZLZ A;  2M0X A;  2HDE A;  4KIK A;  3P4Q B;  4KGR A;  2UYZ B;  2INC C;  5JHA A;  4A3P A;  3VR8 B;  2M8S A;  4PT5 A;  4HEA 1;  2BPS A;  2IDY A;  2BKR B;  2KFJ A;  3P2B A;  1E7U A;  2X8X X;  3DBR I;  1IUE A;  2MA9 B;  2LEK A;  1T0S C;  3ZW3 A;  3N20 C;  1FEH A;  2VH2 A;  5EE0 A;  1E90 A;  1WFY A;  1MG4 A;  2MJE A;  3L10 B;  4GXB A;  2IJ0 A;  2QC8 A;  2GI9 A;  4NPN A;  3ZNH B;  1B1Z A;  3AEA B;  1TS3 A;  2A5U A;  1VJK A;  1TJE A;  3A9J B;  3Q8A A;  4KV2 A;  3ZNG C;  3Q8C A;  1ESF A;  4RGN A;  1UNS A;  4FBJ B;  3Q8E A;  1SXT A;  2IY0 B;  2V4I B;  1Q5W B;  3TJP A;  2K3U A;  3L08 A;  1FRD A;  2A4Z A;  1WWT A;  2WDV B;  3AE5 B;  1J7A A;  1EU4 A;  4E74 A;  3A1Q B;  3CSF A;  2D3B A;  3PGE A;  4RGM A;  1Q10 A;  2D3A A;  3ZVV A;  2ZVN A;  4CHK A;  2IYD B;  2NMQ A;  4ZOH C;  4M00 A;  1WXM A;  2JZ3 B;  2Z8L A;  1KFY B;  1QIL A;  3VRA B;  2RPQ A;  2M0A A;  3ZTC A;  1CJE A;  2XK5 B;  3SU8 X;  1JWU D;  4PS3 A;  3UGB B;  4YSX B;  3R2I A;  4K3C A;  5AZH A;  3FAH A;  1G6J A;  1C76 A;  3OG5 A;  3V05 A;  1E0Z A;  3P4S B;  3PZD A;  3BK2 A;  2G4S A;  4IKG A;  4RFB A;  3GZN I;  2NPT B;  3Q14 C;  1IGD A;  1YOV B;  1QT9 A;  2M17 A;  1HA5 A;  2LHD A;  1UF0 A;  4MSQ B;  2L00 B;  2LUE A;  3ZRC A;  3EA6 A;  3ZGZ A;  3H6N A;  2C7H A;  3SD5 A;  2J42 A;  3TBL D;  1T0Q C;  3RD2 A;  4I6L B;  2DNF A;  1WM2 A;  3ZDM C;  2IGD A;  3N1Y C;  4NY0 A;  1Z2M A;  2IPK D;  1L7Y A;  1ZP0 B;  1ZDX A;  2JWZ A;  2EKE C;  2JPH A;  2BTE A;  3MC9 A;  3TEX A;  4IM0 A;  3ZJU A;  3W9C B;  1L4Z B;  1OFF A;  4HK2 A;  2KC2 A;  1X1M A;  4OVZ A;  5EE1 A;  2BF8 B;  3VRB B;  3B9J A;  3HVZ A;  1XLQ A;  1I4R A;  2VZK D;  2CR5 A;  1MFW A;  2GB1 A;  3AN1 A;  2WX1 A;  5KHO A;  1JQ4 A;  2KWD A;  4HXD A;  1Y56 A;  2PKO A;  2OED A;  1ACC A;  4FN2 A;  2O2V B;  3NS1 A;  3H9D A;  5IOI A;  2LGI A;  2N9E B;  3AH7 A;  2G9H D;  2JYT A;  1OEY A;  2ZVO A;  1KLU D;  3MJ5 A;  1SGH A;  4MGI E;  3KYC D;  4OZA A;  1JWA D;  5BO4 B;  1V97 A;  4DWF A;  2J0J A;  4DDG D;  3OLM D;  4ANU A;  1N6Z A;  1XLP A;  5HHD G;  1CQV A;  3NJT A;  3ZJV A;  3U8Z A;  1F2R C;  3QCA A;  1AW7 A;  3AEB B;  4AP4 C;  1FM0 D;  3FIL B;  2BVC A;  4EUT A;  1PYW D;  5H8Y E;  3ZXV A;  3AE4 B;  3RUI B;  4HPL B;  2KOX A;  3TEZ A;  5IAA C;  2K6Q A;  2MBH A;  2CU3 A;  1PDX A;  2DAJ A;  2BT6 A;  1D5M C;  3GB1 A;  3A4R A;  2R2Q A;  1V49 A;  4FJZ A;  1XT9 B;  2VRR B;  1MG8 A;  4DQO C;  1C9F A;  1WH3 A;  3UIO B;  2N9L A;  2VH1 A;  4M01 A;  3ZNI D;  3ZIM A;  1AYF A;  2KWC A;  2LVO A;  1WXS A;  3KWL A;  4KZC A;  4GGQ A;  3PHX B;  1YN3 A;  1D4B A;  2JVC A;  2KDE B;  3PT2 B;  2KTF A;  4DXG A;  1SJE D;  5JZE B;  3TEY A;  2NPT A;  1YQ3 B;  3R8B A;  2JU6 X;  2NBV B;  3KH0 A;  3V3X A;  1R4M B;  1YX6 B;  3DHG C;  2CJO A;  3Q6B A;  1WJ4 A;  3EC8 A;  3Q8B A;  1JRP A;  3AE3 B;  4A6Q A;  4AQ7 A;  2L0F A;  1HZ6 A;  4LCD E;  2DYM A;  3BVM A;  4A55 A;  4F1S A;  5CHV C;  2JX5 A;  4XWW A;  3TMP B;  2IGG A;  3B2G A;  1P7F A;  2MJ3 A;  3NG0 A;  1XO3 A;  3MFG A;  3PLV A;  2KMM A;  3NHE B;  1P1A A;  1D6E C;  1GOZ A;  3URY A;  2KDM A;  1K50 A;  3TIX A;  3EGR A;  1A70 A;  1L5P A;  4XYC A;  2BKF A;  3BWU D;  2JY6 A;  4G50 A;  3UF8 A;  4C80 A;  4HDO A;  1RAX A;  1WZ0 A;  1OTR B;  2JZP A;  4AWJ A;  2E3T A;  1RFA A;  2WXK A;  3K9O B;  1TKY A;  4GSW A;  2MEK A;  4RCO A;  3ZJT A;  3I9V 1;  1J7B A;  1P98 A;  3EHV A;  3Q3M C;  3P4P B;  2O2V A;  3S2A A;  3TL5 A;  2IND C;  1SF0 A;  3DCG A;  3IAM 1;  2N1W A;  1I4P A;  1F2R I;  4P16 A;  3Q69 A;  5TR5 A;  1VDV A;  4OZC A;  4TQ0 A;  1F77 A;  2L0T A;  2I1J A;  2KTR A;  3SDL C;  2WQY B;  2JUO A;  1YQB A;  3N1X C;  2Y3A A;  3OWE B;  2KK8 A;  3ECI A;  2FCS A;  4GU2 A;  5J17 A;  2G3Q B;  3VR9 B;  3V6E B;  3FIL A;  4IW0 A;  2J0K A;  5IP4 D;  3AE6 B;  4WAA A;  1DYQ A;  4HRO A;  2NBW B;  1N62 A;  5HG2 A;  5L95 C;  4BVU C;  4US9 A;  1WJ6 A;  2QEJ C;  4UDU C;  1E8Z A;  2MBE A;  4KIK B;  2VZK B;  1MVK A;  1NEN B;  1WE7 A;  4DK5 A;  1Q1O A;  1WE6 A;  2I38 A;  1WSP A;  1SBB B;  3R7Q A;  2MCN B;  1JRO A;  3E9S A;  2BQQ A;  4E71 A;  2KJ6 A;  4YL8 A;  1C3T A;  2PW9 A;  3L4P A;  1UBQ A;  1SEB D;  2DWQ A;  4ITK A;  4ZRQ A;  2RDH A;  1K8R B;  1V5O A;  1XLO A;  1T6B X;  3DVN U;  3B0A A;  2BYE A;  2JT4 B;  4S17 A;  4K81 A;  2YLM A;  4RM9 A;  4WH4 A;  4LNF A;  3PRM B;  3HRD D;  1DOX A;  5BYQ A;  2FUG 1;  4LDT B;  3FKY A;  2NS5 A;  3MHZ A;  3DWG C;  1EF1 A;  2D3C A;  5AUK A;  1SJH D;  1K51 A;  1HTO A;  1WM3 A;  3NRZ A;  4ZHP A;  2KDI A;  2IZV B;  2AWT A;  1XD3 B;  3ALB A;  4GDK A;  4LK0 M;  4HDQ A;  5D3I B;  3C19 A;  1WGK A;  1ZXH A;  4N6E B;  4JWU C;  1LGR A;  2KQ4 X;  3VDZ A;  1I35 A;  3DVG X;  4HCN B;  1HEZ E;  1WIA A;  3ZXR A;  1I4H A;  2WXM A;  3AE1 B;  1YJI A;  3WIM A;  4C00 A;  2AQ1 B;  1WGH A;  1C4A A;  2K0P A;  4YTM B;  1CK1 A;  1P9D U;  4ZRJ A;  1J0G A;  1AN8 A;  4GOC A;  4H2A A;  2LXA A;  2KNB A;  1LM8 B;  2AQ3 B;  5MPO A;  3ML8 A;  4FUL A;  1YJJ A;  3DVN V;  3ML9 A;  1KJT A;  4XGA B;  2ZZP B;  4MT5 A;  2G1E A;  1STE A;  3U30 A;  4MEM A;  5G5H A;  4ZRP A;  1L0Y B;  4MH8 A;  1Z5S B;  2KQ7 A;  4WWP A;  2L83 A;  1CMX B;  2KVR A;  1WX8 A;  3IXS A;  5BMG A;  5IKC M;  5CTR C;  3E56 A;  3W5U B;  2KX0 A;  2WXN A;  3CST A;  3PSE B;  1GAQ B;  1V5T A;  3U7D A;  5CHF A;  4GIV A;  3R66 C;  2WXH A;  4A3O A;  2WS3 B;  1WGD A;  3DBS A;  2WXR A;  2HJ1 A;  3HHM A;  2IO2 B;  3EFC A;  4AS1 A;  2N9K A;  1TZO A;  1I7H A;  3KYD D;  3U4E G;  4TKN A;  5T8I A;  1WXQ A;  1WXV A;  2LRW A;  2PMV A;  4RGT A;  2KMA A;  1E8X A;  3DPD A;  2IY1 B;  5H92 C;  2AQ2 B;  2XNA C;  1R4N B;  1TY0 A;  5D6J B;  3L13 A;  3B2F A;  4C7Y A;  3APF A;  1FO4 A;  1XF5 L;  1IBX B;  2KAN A;  2MQJ A;  5D3D A;  2D3G A;  3TUO A;  2M1M A;  4W9K A;  5AZF A;  1XLN A;  1D3Z A;  1TYG B;  1E6E B;  1L4D B;  2KYW A;  2LGS A;  1N63 A;  4BKG A;  4FJV B;  2O6V B;  2DYB A;  1S1Q B;  4P7I A;  4TV3 A;  3AE7 B;  1N5X A;  1TS2 A;  3MJW A;  1VCB A;  2KQS A;  3AE9 B;  3NZU A;  4N9F 4;  4KGT A;  1WYG A;  5G5G A;  1EF5 A;  2GBM A;  3T3O A;  3TCA A;  1FNU A;  1SSN A;  2DAF A;  4N59 A;  2LXC A;  2NTT A;  3ENE A;  3M62 B;  2JSV X;  2ZJD A;  1SE4 A;  4CO7 A;  1FMA D;  1QZE A;  3H1U A;  2SEB D;  3DWM A;  2KLC A;  3L17 A;  2D07 B;  3ZDT A;  2K5P A;  2HJ8 A;  3DHI C;  4FJY A;  1L6U A;  1LFD A;  4KKI A;  3L16 A;  2Z0D B;  4KSK C;  2WU5 B;  4HKQ A;  2B3A A;  3KVF B;  3QIJ A;  2DX5 B;  4IG7 B;  3PO0 A;  3BK1 A;  2M19 A;  4MAC A;  1JML A;  1ZE3 D;  2KFK A;  1MHX A;  4MDK E;  1U4A A;  2L52 A;  3BIN A;  2NBU A;  4F8C B;  2K22 A;  4LLG M;  1KLG D;  1MPE A;  1V1P A;  1T0R C;  3W5V B;  1N61 A;  1ZUD 2;  3IT4 B;  2MW5 A;  3PPA A;  4G11 A;  2LAS A;  4II2 B;  1PGX A;  3C8Y A;  1ZDV A;  5JH5 C;  3P4R B;  3RNG C;  2BWF A;  1ZOY B;  3WAN A;  3HUI A;  3RNC C;  4A8X C;  2D2Q A;  3CWI A;  4HCP B;  5CHW A;  3AUL A;  3DBL B;  4BFR A;  2NVU I;  2KD0 A;  1YD8 U;  4HJG E;  2C7M B;  2W54 A;  3OJ3 A;  3PHW B;  5JXV A;  3T3N A;  3I3T B;  4EE2 A;  4NQL B;  2QJL A;  4NAM A;  3WA0 A;  2NCN A;  2KWV B;  3TSS A;  3RNE C;  3GS2 A;  4M02 A;  4US8 A;  4RH6 A;  3AV8 A;  1WI0 A;  2AL3 A;  3VTU A;  4KVG B;  4GDL A;  3ZYY X;  5BMI A;  2WLB A;  1QLB B;  5IA7 A;  4GN1 A;  3QQ8 B;  1IBX A;  1QF6 A;  2RPV A;  2ZPY A;  3AU5 A;  4FHJ A;  3VH4 B;  2MX2 A;  3QJZ A;  4I6N B;  2DHZ A;  1WYW B;  3KW5 B;  4MSM B;  2W3R A;  2LJI A;  4JE3 B;  2O6V A;  1R7S A;  2KTR B;  1HTQ A;  2KN5 A;  2LGD A;  2GLS A;  3ZTD A;  4X57 B;  1XCQ L;  1WXA A;  3VFK A;  4W9H A;  4K7U A;  2WU2 B;  4WJO A;  4ASW C;  1D5X C;  4BKS A;  2KKC A;  2E6X A;  2KAJ A;  1TS5 A;  3QK0 A;  1ZXI A;  4LDT D;  4KSL C;  3H7P B;  2WDR B;  1WX7 A;  1WY8 A;  1KF6 B;  4LNN A;  4HPP A;  1YMH E;  3RI7 C;  5HI1 A;  1RLF A;  3M95 A;  3X23 A;  2NTS A;  2J53 A;  1P0R A;  2KX3 A;  1OEY J;  3HVD A;  2CKH B;  3PZ7 A;  1XEE A;  2XN9 C;  3AM9 A;  1N5W A;  1TT5 B;  2BS4 B;  4JX1 C;  1WRI A;  2WXO A;  4ANV A;  2YEP F;  4HLE A;  5LXI B;  3UI3 A;  5E6O A;  2GBR A;  1SE3 A;  2CJN A;  3PRE A;  3AB5 A;  2PPH A;  4YSY B;  5LLI A;  3PVL A;  3A33 B;  1WJN A;  2K39 A;  3AEF B;  4YTP B;  2BS3 B;  1C78 A;  4MM3 A;  1OQR A;  1TBE A;  2WXG A;  2CU1 A;  1FCL A;  2LGX A;  5E6J A;  3IT6 B;  2GBK A;  2RD0 A;  3N1Z C;  5GXG B;  2I2Y A;  2N7D A;  2WXP A;  1WR1 A;  1J7C A;  1HE8 A;  3JVZ X;  4WQM A;  3DDC B;  3HK0 A;  3ZRF A;  2V0G A;  2N4F A;  1EU3 A;  3GE3 C;  1V80 A;  2RDG A;  5KHQ A;  1MJD A;  4M8N A;  4RNA A;  5EDS A;  3SFD B;  2PE9 A;  4GDK B;  3PV1 A;  2WHI A;  2KHW B;  1TY2 A;  1IYF A;  1EO6 A;  3NS8 A;  2KDF B;  3B1L X;  4K1R B;  2OJW A;  4PYU A;  5HFY A;  4W9J A;  3JSV B;  2M56 B;  2WP9 B;  3H7S A;  1E7V A;  5LXH A;  2WWZ A;  3VHT C;  3APC A;  1HXY D;  2I1K A;  2N9X A;  3MTN B;  1E7P B;  4PS7 A;  4EOY A;  1YN4 A;  1MI0 A;  3QAR A;  1RWS A;  3APD A;  3K9P B;  2L32 A;  4JQW C;  4W9L A;  3VUW A;  4W9E A;  2WXQ A;  1OQY A;  4REZ A;  1UWX A;  4USA A;  4HKZ E;  4IWP A;  3VTW A;  1GNU A;  2QIL A;  2Y5P A;  3M63 B;  4DXF A;  1BUI C;  2WX0 A;  1YQ4 B;  2K1F A;  2RDB C;  1I4X A;  3VXW A;  3OJ4 B;  1IPG A;  3WAM A;  2TSS A;  4RF1 A;  4M0W B;  3H7P A;  1JWB D;  3LJ3 A;  2V4L A;  2O6V D;  4WJQ A;  2LJ5 A;  1TS4 A;  1P3Q U;  3SFE B;  1JAL A;  2MBB B;  4W9C A;  2LFI A;  4LJO B;  4JPS A;  1MHH E;  2V3S A;  3O65 B;  4BKS D;  1NBF C;  3HIZ A;  3L54 A;  1R4M I;  3VTV A;  2HE7 A;  2JYE A;  1KTK A;  1YJ1 A;  1EUV B;  4TSS A;  2LZ6 A;  1UEL A;  2C5L C;  3UQA A;  4MEL A;  4ZYS A;  1NDD A;  3VUX A;  5DCN A;  2PE6 B;  4A9A A;  2FCM A;  4TQ1 A;  3AI5 A;  4B95 A;  3MP9 A;  3QAQ A;  2K6D B;  2ZEQ A;  4IUM B;  1VZ6 A;  2ZW0 A;  1K53 A;  2L7R A;  1H4R A;  4D2K A;  1KOT A;  2XEW A;  4ANW A;  1ZPS A;  5C2T B;  2V3P A;  3MHS D;  1GC7 A;  4N58 A;  1OQQ A;  2DYO A;  1RRB A;  2JZZ A;  1NYR A;  3W1Y A;  1PGA A;  3NZS A;  2LMC A;  1FRR A;  2B76 B;  1ZW7 A;  4WAF A;  1BXT A;  1N60 A;  3TEW A;  1AWD A;  4IC7 B;  2PLP A;  3SHQ A;  3RNA C;  1F52 A;  4KDI C;  3GOE A;  3T8M A;  4YT0 B;  3UIP B;  1XXG A;  4DBG A;  2ICI A;  2DBY A;  1JW9 D;  2R61 A;  2J4X A;  4LNK A;  2JRI B;  2WXF A;  1S3S G;  4B9K A;  1IGC A;  1PUT A;  2PEA A;  1TZ1 A;  3NY5 A;  4EZK A;  3GP7 A;  3AEE B;  4IDI A; 
#chains in the Genus database with same CATH homology
 2PVG C;  4XWT A;  3AEG B;  3AE9 B;  3NS1 A;  2LGI A;  2X38 A;  3AH7 A;  2G9H D;  2JYT A;  4KGT A;  3PZ8 A;  5FR3 A;  1WYG A;  1KLU D;  2QIE B;  3MJ5 A;  5G5G A;  1ET9 A;  2WXL A;  1FCC C;  4FXC A;  4OW0 A;  4OZA A;  1JWA D;  4R3D A;  1V97 A;  3T3O A;  3BYY B;  1QOA A;  1FNU A;  1SSN A;  1XLP A;  4TMA B;  4N59 A;  5HHD G;  1CQV A;  2NTT A;  3ZJV A;  2JSV X;  1F2R C;  1ENF A;  1SE4 A;  1JWM D;  1NYQ A;  1AW7 A;  3AEB B;  1FM0 D;  1FMA D;  2BS2 B;  4P6V F;  3FIL B;  1GB1 A;  3BII D;  4RF0 A;  1PYW D;  2SEB D;  4L1B A;  5H8Y E;  1FD6 A;  3DWM A;  4YXD B;  3AE4 B;  1EWY C;  2H88 B;  4B0E A;  3TEZ A;  2K5P A;  2ON8 A;  2BBC A;  1C4P A;  3U52 E;  2CU3 A;  1L6U A;  1PDX A;  1RYJ A;  1VZ8 A;  4KKI A;  4M0W A;  2BT6 A;  4KKJ A;  1D5M C;  4ARI A;  2WU5 B;  3GB1 A;  2OHF A;  3KWV A;  2EEL A;  5TSS A;  4HKQ A;  2BB5 A;  1V1P B;  3U2S C;  1JWS D;  2D5G A;  1I4Q A;  1E9M A;  3PO0 A;  5D7G A;  3BK1 A;  2M19 A;  4DQO C;  4MAC A;  1C9F A;  1JML A;  1ZE3 D;  1FNV A;  2N9L A;  1DOY A;  1MHX A;  2N0S B;  1AYF A;  1QOG A;  3NZ3 A;  2L52 A;  4IOI E;  2BB6 A;  2K22 A;  4LLG M;  4YWG G;  3KWL A;  1KLG D;  1LO5 D;  1MPE A;  1V1P A;  2JQR B;  3W5V B;  2JWU A;  1N61 A;  1SIJ A;  1ZUD 2;  1YN3 A;  2LHE A;  3IT4 B;  1D4B A;  2L1A A;  1YNT E;  2YEP B;  2IGH A;  3LYY A;  4DXG A;  1SJE D;  1C4C A;  1UUP A;  5EE9 A;  1EWC A;  1PGX A;  2FE8 A;  3AE7 B;  3C8Y A;  1VRA B;  4XDD A;  1ZDV A;  3TEY A;  1FIQ A;  1YQ3 B;  3P4R B;  2Q5W D;  3R2T A;  3R8B A;  2JU6 X;  1ZOY B;  3HUI A;  4A8X C;  3V3X A;  1QQR A;  3O13 A;  3WCQ A;  2CJO A;  3CWI A;  3Q8B A;  1JRP A;  3AE3 B;  4A6Q A;  1FNW A;  2K9X A;  1SB3 C;  4AQ7 A;  4HJG E;  2FBW B;  2W54 A;  1VLB A;  4GLS C;  3CIR B;  1RM6 C;  1HZ6 A;  5JXV A;  2DYM A;  2JXT A;  3BVM A;  3NUH B;  4A55 A;  4XWW A;  1D5Z C;  2JX5 A;  3T3N A;  4EE2 A;  2IGG A;  4WIP A;  1YN5 A;  2QJL A;  4NAM A;  1TKE A;  4GDL B;  3B2G A;  1P7F A;  2MJ3 A;  2N7J A;  3AE2 B;  4B0M A;  2EKI A;  2AX5 A;  1XO3 A;  3TSS A;  2PVO D;  3MFG A;  2KMM A;  2GRI A;  1GB4 A;  1D6E C;  1GOZ A;  3GS2 A;  2KDM A;  3URY A;  1K50 A;  4US8 A;  3AE8 B;  4RH6 A;  4L2Y A;  3AV8 A;  1V1O A;  3EGR A;  5C3J B;  1A70 A;  1L5P A;  2MH7 A;  5BYR A;  3BWU D;  3ZYY X;  5BMI A;  1NEK B;  2WLB A;  1QLB B;  1C77 A;  4KGS A;  1IBX A;  1QKZ A;  4C80 A;  1QF6 A;  1F0Z A;  2RPV A;  1T3Q A;  2LUM A;  2JZP A;  1FO4 A;  2E3T A;  2WXK A;  4NZL B;  4XDC A;  1TKY A;  2W3R A;  2MEK A;  3NVZ A;  4RCO A;  3ZJT A;  2LJI A;  1J7B A;  3I9V 1;  4JE3 B;  4ARC A;  1R7S A;  1CZP A;  3P4P B;  3VQI A;  1XCQ L;  1SF0 A;  3IAM 1;  2PTL A;  4YTN B;  5LNK 1;  1I4G A;  2WU2 B;  1I4P A;  3SEB A;  4ZHO A;  3NVV A;  1F2R I;  4P16 A;  1D5X C;  4KX6 B;  3AEC B;  3Q69 A;  5AUI A;  2E6X A;  2KAJ A;  1TS5 A;  1ZXI A;  1VDV A;  4OZC A;  1UGJ A;  3LXF A;  4TQ0 A;  1F77 A;  2WDR B;  2WQY B;  4C56 C;  2BW2 A;  1KF6 B;  2Y3A A;  3OWE B;  2Y5C A;  4O1N A;  2SAK A;  2RMM A;  1YMH E;  5BYS A;  3J9C A;  5HI1 A;  3VR9 B;  3FIL A;  2W3S A;  3RFZ B;  1PGB A;  4LTU A;  3W2D A;  2NTS A;  1DGJ A;  2J53 A;  3AE6 B;  4J3O D;  2INN E;  3FC4 A;  2PIA A;  1VZ7 A;  1QOF A;  4HRS A;  1DYQ A;  3LB8 C;  1KH0 A;  1SE2 A;  3HVD A;  3SR6 A;  4OHJ A;  3PZ7 A;  4NAW B;  1FFU A;  4HRO A;  1XEE A;  2XN9 C;  3AM9 A;  1N5W A;  1N62 A;  5HG2 A;  4CQN A;  2HTM E;  2BS4 B;  4JX1 C;  1WRI A;  2WXO A;  1FFV A;  4WWM A;  4US9 A;  1FXA A;  2YEP F;  2QEJ C;  4UDU C;  4MM3 B;  2VZK B;  1MVK A;  3UI3 A;  1NEN B;  3BVG A;  1SE3 A;  1M4V A;  2CJN A;  3RPF C;  1ET6 A;  1ROE A;  3AB5 A;  2I38 A;  4YSY B;  1UWM A;  1WSP A;  4OZB A;  1SBB B;  1JRO A;  3AEF B;  4YTP B;  3E9S A;  2BS3 B;  1C78 A;  2HDE A;  2W82 A;  1OQR A;  2WXG A;  3AMZ A;  4RGO S;  1FCL A;  3P4Q B;  2PW9 A;  3L4P A;  4KGR A;  5E6J A;  3H8H A;  1JCK B;  3IT6 B;  1SEB D;  2DWQ A;  4ITK A;  4ZRQ A;  2BYT A;  3VR8 B;  2RDH A;  4PT5 A;  4NJC A;  5GXG B;  2KAC A;  1XLO A;  1T6B X;  2I2Y A;  4HEA 1;  1EM7 A;  2IDY A;  2WXP A;  2WDQ B;  3P63 A;  1BML C;  2QSD A;  1J7C A;  4WQM A;  1IUE A;  3KLS X;  2ACZ B;  2LEK A;  3ZQ4 A;  2V0G A;  1EU3 A;  3U7Z A;  1PFD A;  4WH4 A;  1FEH A;  4WUR A;  2RDG A;  2ZW1 A;  3HRD D;  5EE0 A;  1DOX A;  4RNA A;  5BYQ A;  2MJE A;  2WXI A;  3SFD B;  2IJ0 A;  2GI9 A;  4GDK B;  1B1Z A;  1P7E A;  2FUG 1;  2INP E;  1TS3 A;  3AEA B;  1TY2 A;  4XE0 A;  3MHZ A;  3DWG C;  5AUK A;  1VJK A;  1TJE A;  1SJH D;  1RFK A;  1K51 A;  5HFY A;  3NRZ A;  3Q8A A;  4ZHP A;  3P1M A;  3Q8C A;  2M56 B;  2WP9 B;  1ESF A;  2QMT A;  1UNS A;  4RGN A;  4LK0 M;  1E10 A;  5D3I B;  1NI3 A;  3KQ4 A;  1WGK A;  1ZXH A;  4N6E B;  1HXY D;  4JWU C;  5FK9 C;  1E7P B;  3Q8E A;  1YN4 A;  1MI0 A;  1SXT A;  2KQ4 X;  2V4I B;  1RWS A;  2L32 A;  1V8C A;  2K3U A;  1FRD A;  1WWT A;  2WDV B;  2WXQ A;  4YSZ B;  1HEZ E;  4REZ A;  1UWX A;  3AE5 B;  3NVW A;  1J7A A;  1EU4 A;  4USA A;  4HKZ E;  1DOI A;  1I4H A;  2WXM A;  4L23 A;  2QIL A;  2Y5P A;  3MC0 B;  4DXF A;  1BUI C;  3AE1 B;  1YJI A;  4RGM A;  1Q10 A;  2J52 A;  2NMQ A;  1YQ4 B;  2AQ1 B;  4ZOH C;  1C4A A;  2K0P A;  1I4X A;  4YTM B;  2Z8L A;  3Q8F A;  1CK1 A;  1KFY B;  2KN4 A;  1QIL A;  2TSS A;  4RF1 A;  3VRA B;  1JWB D;  2M0A A;  1AN8 A;  4Q2J A;  4H2A A;  1CJE A;  3ABV B;  1XCT L;  1TS4 A;  5FKA C;  3SFE B;  1JAL A;  4JWS C;  1JWU D;  1HZ5 A;  2AQ3 B;  2LFI A;  5MPO A;  4JPS A;  1YJJ A;  1MHH E;  4YSX B;  3R2I A;  2WXJ A;  2JYE A;  4MT5 A;  1L6V A;  3N9Y C;  1KTK A;  3FAH A;  3NVY A;  1C76 A;  2G1E A;  3P42 A;  4TSS A;  1STE A;  3V05 A;  1E0Z A;  5BMH A;  2MJD A;  5G5H A;  4ZYS A;  1K52 A;  4ZRP A;  1L0Y B;  4MH8 A;  3I57 A;  3P4S B;  1FXI A;  2L83 A;  4A9A A;  3BK2 A;  4TQ1 A;  4IKG A;  3MP9 A;  4RFB A;  2V3N A;  3IXS A;  5BMG A;  3W5U B;  3E56 A;  1IGD A;  1QT9 A;  1HA5 A;  2LHD A;  1VZ6 A;  2WXN A;  2ZW0 A;  1K53 A;  4D2K A;  1GAQ B;  3EA6 A;  1KRH A;  1QOB A;  3ZGZ A;  1ZPS A;  2J42 A;  2WXH A;  5C2T B;  2V3P A;  2WS3 B;  4N58 A;  1OQQ A;  4C7Z A;  2DYO A;  3BVZ A;  2IGD A;  1NYR A;  2WXR A;  1TKG A;  2IPK D;  1PGA A;  1ZP0 B;  1ZDX A;  2LMC A;  4AS1 A;  1FRR A;  2N9K A;  1TZO A;  2B76 B;  1I7H A;  3W1S A;  3U4E G;  3AED B;  4WAF A;  2BTE A;  2W55 A;  1BXT A;  5T8I A;  4A90 A;  1WXQ A;  3TEX A;  1N60 A;  3TEW A;  3ZJU A;  2PMV A;  1AWD A;  1L4Z B;  4RGT A;  3W9C B;  1OFF A;  2PLP A;  3BZD B;  4OVZ A;  5EE1 A;  5H92 C;  2WNM A;  1T5X D;  2AQ2 B;  2XNA C;  3ETR A;  3VRB B;  1TY0 A;  3B9J A;  4YT0 B;  3B2F A;  3HVZ A;  3EUB 2;  1XLQ A;  2H89 B;  1XF5 L;  4C7Y A;  1I4R A;  1XXG A;  2VZK D;  5EE3 A;  1IBX B;  2GB1 A;  3AN1 A;  1GPX A;  2DLB A;  5D3D A;  2ONQ A;  2ICI A;  3TUO A;  2DBY A;  3BYT B;  1HQR D;  1VR9 A;  1JQ4 A;  1JW9 D;  2R61 A;  1XLN A;  1C79 A;  3IAS 1;  1L0X B;  2KWD A;  1TYG B;  1Y56 A;  1E6E B;  1L4D B;  2J4X A;  2PKO A;  2OED A;  1N63 A;  1NVI D;  2WXF A;  1L0V B;  5I4D A;  1B9R A;  1IGC A;  1PUT A;  1ACC A;  1N5X A;  3GP7 A;  3AEE B;  4IDI A;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...