1E10A

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAKHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron-sulfur protein
molecule keywords FERREDOXIN
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
total genus 21
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e10A00
1CJEA 1JWBD 2MH7A 2G1EA 2WDRB 2OHFA 3P4RB 5AUIA 3NVVA 1TKGA 3AE5B 3AE7B 4JWUC 2H88B 4YXDB 5EE9A 1GAQB 1YQ4B 2PVOD 1NENB 1ZP0B 3VRBB 1E9MA 3AE9B 3ZYYX 1J7CA 3AEDB 3L4PA 3AEFB 4JX1C 3WCQA 2CJNA 2QJLA 1JROA 1R7SA 5C2TB 2WP9B 4HROA 3CWIA 2WQYB 1NYQA 1J7BA 1VLBA 1DGJA 1YJIA 2W54A 4IDIA 4WQMA 3KWLA 4FXCA 1L6VA 2K22A 1E6EB 1AYFA 3FC4A 3NVWA 3AM9A 2EKIA 1FXAA 1KFYB 1KRHA 3AE4B 3P63A 3AECB 1AWDA 3P4QB 2LEKA 2E3TA 5MPOA 4LTUA 1L6UA 4C7ZA 2L83A 2W3RA 4YSYB 2B76B 1PUTA 3SFDB 3P4PB 4YSXB 2ACZB 1QOFA 1JWAD 1SF0A 1XO3A 1T3QA 1VDVA 2BS2B 1KF6B 1NEKB 1NVID 2KMMA 2PKOA 1SIJA 1RFKA 3AE1B 1IUEA 1YJJA 3DWMA 3AMZA 1WWTA 4YTPB 5GXGB 4US8A 5C3JB 4YSZB 1N62A 5G5HA 2Y5CA 1ZXIA 1ZUD2 2WDQB 3HUIA 2CJOA 4ZOHC 3EUB2 1N5WA 4C7YA 1EWYC 3AEGB 1DOXA 3W9CB 1B9RA 1L5PA 1E0ZA 3AN1A 3NVYA 1N60A 1A70A 2HTME 2BT6A 2K9XA 1GPXA 1JQ4A 5EE1A 1QOGA 4N6EB 2M56B 3NVZA 1NI3A 1WXQA 1QOAA 3AEBB 3BIID 1ROEA 1FMAD 1FIQA 1V8CA 1TKEA 1XLQA 4US9A 1V97A 3RPFC 3DWGC 1QOBA 1FO4A 1RYJA 4N59A 3HVZA 1N63A 2QIEB 4USAA 5AUKA 1WYGA 2K5PA 3NRZA 3VRAB 2DBYA 4ZHOA 1QF6A 1CZPA 5EE3A 3W5UB 1WGKA 4KX6B 1N61A 1F0ZA 4YTMB 3SFEB 1JW9D 1RM6C 2M19A 3CIRB 1J7AA 2MJDA 3AH7A 5G5GA 5H92C 2L52A 2WU2B 1QLBB 2BS4B 2PVGC 2W55A 2CU3A 1OQRA 3AE2B 1L0VB 1FFVA 5EE0A 3P1MA 3PO0A 4N58A 2MJ3A 3AE3B 1TYGB 3AV8A 2KAJA 2WS3B 3W5VB 1E10A 1UWMA 3NS1A 1FXIA 3B2FA 2WDVB 4ZHPA 4P6VF 1TJEA 4JWSC 3AEAB 4WWMA 1DOIA 3AE6B 2BS3B 2DWQA 3HRDD 1VJKA 3AEEB 3B9JA 3LXFA 1FRDA 2W3SA 3SR6A 3VR9B 1ZOYB 3ABVB 2AX5A 1XLNA 1FRRA 1XLPA 1PFDA 3FAHA 4ITKA 1XLOA 4YT0B 3AE8B 2PIAA 1JRPA 1YQ3B 2JX5A 2H89B 2WLBA 3LB8C 1TKYA 1NYRA 4YTNB 1E7PB 5H8YE 2N0SB 1PDXA 3AB5A 1QT9A 2MJEA 1N5XA 1RWSA 2FBWB 1JALA 3VR8B 1DOYA 1I7HA 4A9AA 1FFUA 3P4SB 3ETRA 4HRSA 1OQQA 3B2GA 2Q5WD 4C80A 1WRIA 1FM0D 1OFFA 2JQRB 2WU5B 1SB3C
chains in the Genus database with same CATH superfamily
3AULA 3R8BA 2WDRB 1FXTB 3M62B 5AZGA 4AP4C 3JSVA 5BYSA 2KZRA 5HHDG 3TJPA 2NPTA 2W54A 3KUZA 4KIKA 1T5XD 2ZW0A 1CK1A 3PREA 5D6JB 5HFYA 1V1PA 1V49A 1SBBB 3I5JC 1EF1A 2BQQA 2V4LA 4LTUA 2ON8A 2NR2A 1H4RA 2FIFA 3ZJTA 4DQOC 3ZVVA 1L4ZB 1VR9A 2IGHA 1RLFA 3HM3A 3U7DA 2MEKA 3Q8AA 4DXAB 3L17A 4EOYA 4K7UA 3U8ZA 5CHFA 1RYJA 4ASWC 3RI7C 4EUTA 4R3DA 3H7SA 2KDBA 4DWFA 1IPGA 4LJPB 4CO7A 4TSSA 1X1MA 4HKQA 3PTFC 2WXNA 4F1SA 2WNMA 4N58A 4W9IA 3UQAA 3DBRI 3NHEB 1I4XA 1E8WA 1WM2A 1WYWB 3QAQA 3HHMA 3BK2A 1PFDA 1YX6B 4L1BA 2BKRB 2J42A 4NZLB 2D07B 2MHJA 1SE4A 2GBMA 1Q5WB 2EMTA 2R2OA 2WX1A 4BOZB 1WMHA 1JWUD 1RWSA 1DOYA 5BMGA 2I38A 3ETRA 3OAWA 3EFUA 2JVCA 2MH7A 3EGRA 4GDLB 3VRBB 1K53A 3VFKA 4TQ1A 4IDIA 2N9PC 3KYCD 4W9JA 1AN8A 3FC4A 1J0GA 1NDDA 4IWOA 2D3CA 2GMIC 1KRHA 1WX8A 1LQBA 3H9DA 4KKJA 2DNFA 3TMPB 3P4PB 1JWAD 2KN5A 1NVID 5G5GA 1CQVA 5GXGB 1VZ7A 2IPKD 4B0EA 1MFWA 2IO3B 3KH0A 1B9RA 2IDYA 4B95A 3AN1A 1TS5A 2DZIA 1N60A 3DBRB 4HEA1 1QOGA 4MH8A 2PEAA 2J0KA 1F77A 2GBKA 5AEKB 1QOBA 2WXOA 5CX3A 3QQ8B 2KK8A 3PHXB 2DBYA 2XNAC 1AW7A 2G4SA 1EF5A 1S1QB 2VZKB 2K8CA 2PVGC 1P9DU 3WALA 1L0VB 3R2TA 1E7VA 2MQJA 2GB1A 5DPSA 4BVUC 3VAWA 5LLIA 4JE3B 1EUVB 3HM6X 1YNTE 3PZ8A 2LXAA 5BYQA 4A20A 2NS5A 3B9JA 4N9F4 1XLPA 5L95C 4RM9A 2PIAA 2DAJA 1TKYA 2WXLA 3FILA 1F9JA 2KLCA 3VR8B 4K7WA 1PYWD 3BK1A 1VZ6A 1WRIA 3DWGC 1J19A 1E90A 2AQ3B 3QWZB 1YQBA 2LGIA 3A33B 3ZNGC 3Q3MC 1NENB 2J0JA 3AEDB 3WCQA 3QC8B 4WJQA 3TBLD 3V60A 2G4DB 4RFBA 2K6QA 3RZFA 3N20C 2LASA 1GC7A 3RYTA 1L2NA 4FXCA 1L6VA 2UWQA 2WXJA 3BYTB 4LNNA 2D5GA 4HKZE 3N32A 1WRDB 4KSLC 3P63A 3QX1A 4YSYB 3SD5A 1WE6A 2EMSA 3RNAC 1KF6B 4XC2A 3RT3B 3D32A 1YJJA 3N3KB 3PV1A 4US8A 1VCBA 5J17A 3EUB2 3ZTCA 2CR5A 3R7RA 3KWVA 2BYVE 1FM0D 2K9XA 1L0XB 4TKNA 4WWPA 3V05A 3V61A 1P7EA 4DXGA 5DPRA 4IKGA 1MJDA 1I42A 4WWOA 4M8NA 4DHZB 2LHDA 2KTRB 2I1KA 4K1RB 4PK1A 4A6QA 3ZNHB 1WGKA 4AS1A 4RGNA 2M19A 4ZRKA 4BKGA 2DLBA 3Q3FA 2JYEA 1EU4A 2J52A 2JZ3B 4DHZE 2TSSA 2KAJA 4MM3A 3W5VB 4A8XC 3B2FA 4W9FA 1RAXA 5HKHA 3NZSA 4PS7A 5CHVC 4B6WA 1TBEA 3HRDD 2W3SA 4RCOA 3V3XA 3HK0A 1PGAA 1FPYA 1XLOA 1ENFA 1YQ3B 2H89B 2KFKA 2N4FA 5GMVA 1QT9A 4J3OD 4JX1C 1LGRA 3MC8A 1ZPSA 1UZXB 4OZAA 4PS3A 3W1YA 2RDGA 1UELA 2L7RA 4XDCA 2CU1A 4DBGA 2V3PA 5BO4B 4OZCA 1C77A 1J7BA 2JYTA 4W9EA 4LNFA 4NQLB 2K6DB 3PSEB 2X8XX 4GLSC 2EKIA 2KNBA 4XX5A 4HCNB 3CSFA 2DZKA 2KMAA 2E3TA 2MP2A 2YLMA 4BAXA 2OOBB 1SF0A 4OVVA 1C4PA 5AZHA 5EE0A 2PKOA 3T3NA 1RFKA 2L0FA 2HE7A 2N9LA 2XEWA 2K39A 2JPHA 2WXHA 1ZUD2 2UYZB 2MBOA 1WY8A 5FR3A 4BOSC 5DCNA 3BZDB 3ZIMA 2LMCA 1F2RC 1FMAD 4KZCA 4HLEA 2ZVOA 3ZO5B 4GSWA 2KJ6A 1TS4A 3IAS1 2RDBC 3B08A 2BYTA 2W55A 1UGJA 3PT2B 4RGMA 2KFJA 3P1MA 4JGHB 1I35A 3AV8A 1WX9A 5C23A 2KVZA 3Q8EA 2C5LC 3IG3A 3A9JB 3NS1A 2V3SA 4S0RA 3PVLA 3I3TB 4TQ0A 3UIPB 2JZPA 2LGYA 2BS3B 2JRHA 2ZPYA 2KX3A 4HPPA 3LYYA 5IN7A 2VZKD 2YEPF 1MVKA 3TEXA 3NZUA 3AI5A 3MTNB 2DENB 4PYZA 1HXYD 1ESFA 1WGRA 3VTVA 3Q8FA 4MJSB 2O6VA 1JRUA 2QC8A 2AQ1B 1YQ4B 1HE8A 3UQBA 1VD2A 2LRWA 1J7CA 1HA5A 1WJUA 1JWMD 1TZOA 1R7SA 2XK5A 2HJ8A 1LFDA 1EU3A 5C2TB 4HROA 2VRRB 4RGTA 2SEBD 2KDMA 3DVNU 4K3BA 3C0RB 3SHQA 3QA8A 3KQ4A 5MPOA 1L6UA 2EELA 3DBSA 4YSXB 1QOFA 2KWCA 2WXMA 3VXWA 4TUUA 3N1XC 2X38A 5C3JB 1RRBA 3PHWB 5G5HA 4C4VB 1L5PA 1XT9B 2AL3A 1A70A 3EFCA 4ZRJA 4YL8A 2WDTB 2BW2A 1C4CA 2PMVA 1NI2A 1ROEA 1V8CA 4G3XB 1TKEA 4B9KA 4PS8A 4Q2JA 2CKHB 4ZHOA 4L2YA 1WZ3A 2IGDA 4XWWA 3L10B 3APDA 2WXPA 4YTMB 4M0WB 2FE8A 2PE9A 4A3OA 2NBVB 2V0GA 2KXJA 3H6NA 4WWNA 3RUIB 1XD3B 1R4MB 2KHWB 1F1HA 2N7JA 1E10A 1SJHD 2OEDA 2KJRA 4HJKA 4ANXA 3DHGC 2YVCA 2LGSA 2KTFA 2FUG1 3JSVB 3MC0B 2JWZA 4A90A 4BBNF 3PRZA 3CMMB 2NPTB 1JRPA 4KIKB 4JPSA 2JY6A 1WM3A 5E6NA 3W1SC 3AB5A 1V1PB 1I7HA 2AWTA 4F7ZA 5AZFA 1C9FA 3PRMB 4LK0M 5KHOA 5FR6A 2OHFA 2LJIA 2BBCA 3KUDB 3AE9B 1JWSD 1SE9A 2WP9B 4JL9A 3WIMA 5G55A 3W2DA 2BB5A 3JW0X 2QCZA 2SAKA 2BB6A 1I4HA 1AARA 4E74A 4HPMB 3AE1B 4FN2A 4YSZB 2WXQA 3OWEB 4ZRIA 1R4NI 1EWYC 5J18A 2BYFA 4CQNA 2V1YA 4OZBA 2RPVA 3NVZA 2BKFA 3AEBB 5D3DA 3SEBA 4ANWA 2D3BA 4N59A 2O2VA 3QK0A 3OLMD 3KYDD 4GN1A 1CZPA 4KGRA 1HQRD 4FJZA 5I4DA 3A9KA 3BY4B 3E56A 2VH2A 2KDIA 3AH7A 3P42A 1B1ZA 2BS4B 4IM2A 1WMHB 4YWGG 1UBIA 1IP9A 2WDVB 2A4ZA 1C78A 3WANA 3RFZB 3APCA 4FLHA 1C76A 4WWMA 3DOWA 1WXSA 1K51A 3VR9B 4E3CA 1FD6A 1WJ4A 2AQ2B 2KVRA 3WAPA 1M94A 3N1ZC 2Z0EB 4KZ0A 4LLGM 2MBHA 4DDGD 3NS8A 3A1QA 1C79A 1YD8U 4NAMA 4W9GA 4G50A 2PLPA 3NVVA 4EZJA 2INPE 4YXDB 1XEEA 1PQSA 4OHJA 4WURA 3ML8A 5HG2A 1ISNA 1NYQA 4CHKA 1K8RB 2V4IB 3V6EB 2BGFA 4NY0A 3U30A 1UNSA 3VVWB 4EZKA 3TSSA 4XDDA 2KMMA 2N7EA 2KT7A 4ARCA 4X57B 2PJHA 3C19A 2JU6X 1N5WA 1UUPA 2GRIA 4IOIE 3BWUD 2MW5A 4RH6A 2M0AA 4KVGB 3TUOA 2KJHB 4K3CA 2JT4B 3DVGX 1NI3A 1WXQA 5EDSA 4L23A 3DBLI 2RMMA 4MELA 2RGFA 3NRZA 2V3NA 2LZ6A 5EE3A 3ZXRA 5C1ZA 3NG0A 3SFEB 4XGAB 4KV2A 2WU2B 2J4XA 1ET6A 5JH5C 1WJNA 2JSVX 3FILB 2MJ3A 2ZZPB 1Q10A 1MG4A 2MSED 5D2MB 2QDFA 3PZ7A 1G6JA 1T0YA 2M0XA 4BFRA 1L7YA 2V9HA 4MSQB 3AEEB 3LXFA 4NQKE 2R61A 3VTUA 1JMLA 2N0SB 2J7QB 4ZYNA 3FKYA 2KDFB 4A9AA 3N30A 2DYOA 4JIOU 4BKTA 2G45B 3GE8C 1V2YA 3AE5B 4FULA 1LXDA 3ZNZB 4BZAA 1KM7A 1P0RA 4WJOA 1DGJA 1YN5A 2ZCCA 4LNIA 2KANA 2PPHA 4IM3A 1C4AA 2WXIA 2Y5BB 3DBLB 2ZJDA 2N9EB 3K9PB 1AWDA 2L83A 1WGDA 1XO3A 4M8MA 2OJRA 3Q6BA 2BTEA 2J0MA 1V80A 1IUEA 2D10A 4HDQA 4G0NB 1DOXA 1FNUA 2FIDA 2BT6A 3ONSA 4MM3B 4ZRQA 2LVPA 2KC2A 2RSUA 4A3PA 1XXGA 1HTOA 2Y3AA 5LNK1 2NVUI 2LFIA 3JVZX 3ECIA 2L8JA 3T9LA 3B0AA 1JW9D 1D6EC 2G3QB 4MDKE 2KFKB 2JXXA 1I4GA 1UD7A 2GBNA 1OEYA 3AE3B 2LUMA 2M4NA 3EC8A 4OW0A 4P6VF 4P7IA 3DCGA 2INNE 3OJ4B 1TZ1A 1VJKA 4II3B 2XN9C 5IAAC 2KACA 1SGHA 3ZW3A 1FCCC 1YOVB 2AEHA 3AE8B 2BWFA 3VH3B 4YTNB 2HJ1A 2M8SA 1JALA 4WIPA 3P4SB 3B2GA 3DBHI 2WU5B 2MP2B 3Q3NC 4NJ6A 1Q0WB 4IWQA 1I4QA 4CYEA 1GAQB 1ZP0B 4FBJB 4P1CC 2I1JA 1E9MA 2QILA 2GI9A 2QJLA 5J2RA 3ZQ4A 4IUMB 4XE0A 1WGYA 4IW0A 3AU5A 2JZZA 4HXDA 2MCNB 3Q8CA 3SU8X 3U2SC 2L05A 2QHOA 4TV3A 2L1AA 3SFDB 1PGBA 2FAZA 4GU2A 5D94A 4YTPB 3GZNI 3ZNID 4NAWB 3VHTC 1GOZA 3R66C 3RNGC 3ZDTA 1WR1A 4BKSA 3J9CA 1L4DB 2L3ZA 3X0WA 3NVYA 5DPWA 2DX5B 4N6EB 2A5UA 1XLQA 4I6NB 3MHSD 1N63A 3P2BA 2KX0A 3VRAB 1WYGA 3UGBB 2BF8B 3W5UB 1WXVA 1WSPA 2KQ4X 1YIWA 3H8HA 3Q69A 3U4EG 2JRIB 1V81A 1ZXHA 3MJWA 4GIVA 3DBHB 3PO0A 1U4AA 1ZDXA 2B3AA 3PLVA 4HDOA 3SDLC 3ZJUA 3V6CB 2O6VB 1GG3A 4JWSC 2K8HA 3TEZA 1OEYJ 2DWQA 1TY2A 1IYFA 2BYEA 3U7ZA 3BVZA 3H1UA 3RMKC 1PGXA 2KMCA 3ZJVA 2XK5B 2QMTA 2YEPB 1EWCA 3DVGY 3RNEC 4MEMA 3EECA 1QZEA 5T8IA 1WH3A 1S3SG 2UU7A 3VQIA 1FFUA 2NBUA 3ZRFA 1SB3C 2KN4A 1JWBD 1ZE3D 4JWUC 2Z0DB 2PVOD 3QJZA 3LJ3A 2CJNA 1MG8A 2WX0A 3QIJA 2ZNVB 2ZEQA 3CWIA 3UI3A 3ZKJC 1VZ8A 1KJTA 3MFGA 2HD5B 4WQOB 4F8CB 2DZJA 2LI5A 4GMVA 1HZ6A 3AE4B 2C7HA 1WR6E 2LEKA 4C7ZA 3L16A 2W3RA 2JUOA 1T3QA 1UWXA 2BWES 2LVQA 1K50A 3O65B 1WWTA 2IO0B 4MACA 2MBQA 3L0WB 2HTME 1GPXA 2PE6B 3DPDA 1GB1A 2INCC 3GS2A 3DHHC 1T6BX 1SSNA 4WJPA 1V1OA 4EZLA 3MC9A 3ZLZA 3CIRB 5TR5A 2DYMA 5H92C 4EFOA 4RM8A 3VH4B 3GOEA 1K52A 1UWMA 2INDC 3IHPC 2Z8LA 4LCDE 1D3ZA 2Y5PA 4W9KA 3AEAB 1V5TA 3AE6B 1TIFA 4OVZA 1ZOYB 4HJGE 1XLNA 4HPLB 4WAFA 3PS6A 4H2AA 4KDLB 4KKIA 2MJEA 1KOTA 4NNJB 1ZGUB 1KTKA 1SJED 3IBEA 2G1EA 5EE9A 1YN3A 2AL6A 3M3JA 3L4PA 3IXSA 5G2NA 2WQYB 2KWUB 3RD2A 2MWSB 1WE7A 5JHBA 4AOFA 3NVWA 4WJNA 5IKCM 2VH1A 4S17A 1KFYB 2BPSA 3P4QB 3MP9A 1YN4A 3HIZA 2B76B 3IVFA 4G11A 3RNCC 3AMZA 1SIJA 2WYQA 3DWMA 2XBBC 4UDUC 3A9KB 2DHZA 2Y5CA 3Q3OC 1QQRA 3RNFC 1SE3A 4GDKA 2FCNA 3N9YC 1SIFA 3UIOB 2GOWA 5CHWA 3WAMA 3BIID 3IFWB 2LGDA 4IC7B 3LDZE 3JYUA 1D4BA 4FHKA 2HTHA 1C3TA 1GUAB 1I4RA 1QF6A 2L32A 3PZDA 2K0PA 1HEZE 2K1FA 1QLBB 3H7PA 4KGSA 2PTLA 3NUHB 3T3OA 3A1QB 3PRPB 1WIAA 1DYQA 1EM7A 3NZ3A 4MSMB 5D7GA 4O1NA 3FAHA 3A4RA 4LNKA 2QSDA 2WLBA 1SE2A 2FNJB 3MJ5A 1N5XA 2FBWB 2N1WA 4FHJA 3OG5A 3NJTA 2O6VD 4MGIE 1OQQA 1UGMA 4C80A 5D3IB 2WGSA 1KLVA 1YMHE 2REXA 4NJCA 1QKZA 1OTRB 2NCNA 1P1AA 1IBXA 1BUIC 4QAYA 2QEJC 1E6EB 4W9LA 4W9CA 3AM9A 1H8CA 2IY0B 1GC6A 2C60A 2ONQA 4I6LB 2K25A 1ZKHA 2DZMA 1TT5B 2KC1A 1VDVA 3NOBA 1XCTL 2ZVNA 1R4NB 2KQ7A 2D2QA 1QILA 1LO5D 4ZOHC 5LXIB 2CJOA 1WI0A 3VTWA 1Q1OA 4GOCA 1E8YA 1FIQA 3RNBC 4DHJD 4IWPA 3ZUNA 2QIEB 1MI0A 2ZCBA 1LM8B 2KO3A 1N61A 3KVFB 4OVUA 2RPQA 2L52A 2L76A 4RGOS 3IAM1 3L54A 1TGZB 4M00A 4K7SA 1TYGB 3APFA 3RN9C 1FXIA 1GJZA 3L13A 4MGYE 1TJEA 1VRAB 1E7UA 2WXKA 4W9HA 4P16A 2LJ5A 1GNUA 1FRRA 1MHHE 4YT0B 3KW5B 3QCAA 3Q8BA 4URKA 3AU4A 1RFAA 2H88B 3KLSX 2NTSA 3I63C 2E6XA 1ET9A 4LDTB 1V5OA 3BVGA 1STEA 4KGTA 2KDEB 2N9KA 1XQQA 1AYFA 1NBFC 3I9V1 3KUCB 4FJVB 2L0TA 2D11A 3BYYB 3S2AA 3W1SA 1BT0A 1KLGD 4EKUA 1TS2A 4GB9A 3T8MA 5IA7A 1V9JA 1E5WA 1NEKB 2D3AA 4GDLA 1OGWA 4J6IA 2FUHB 4ICUA 1N62A 3Q14C 1KH0A 3AEGB 3ZDMC 3B1LX 4DXFA 1WX7A 2IO2B 3R7QA 4IG7B 4JLCA 3RULA 2M56B 2LWPA 4US9A 1V97A 2G9HD 3EA6A 2DAFA 3UF8A 2ASQA 2JWUA 3DVNV 4ACFA 2K5PA 2LXCA 5KHQA 3QHTA 4KSKC 1F0ZA 4ARIA 1L0YB 3O13A 2BVCA 2KOXA 1D5XC 3VUXA 4JQWC 4XWTA 1BXTA 2Z59B 2LUEA 4FADA 4II2B 3RCZA 4EEWA 3VUYA 1FEHA 2IBIB 4RF0A 1FCLA 4HK2A 4RF1A 4B0MA 1PDXA 1WGHA 2Q5WD 3DHIC 3ABVB 2JQRB 2KYWA 3AXCA 2CS4A 2MX2A 3DQVA 3P4RB 2ZNVC 1UH6A 1TKGA 3X23A 3ZXVA 4C00A 2LD9A 3BVMA 4HVBA 1UF0A 4LJOB 2K3UA 3AEFB 3UINB 1EO6A 3TCAA 3TEWA 1WXAA 3Q2AC 2I2YA 4WQMA 4WH4A 1BMLC 3C8YA 2MRPA 1FXAA 2GBRA 2KWVB 4ZDVA 1HTQA 3ML9A 2N9XA 2ACZB 2MBBB 1FNWA 2BS2B 4MH0E 5LXHA 3Q3JA 1ZXIA 2WDQB 4FA6A 4W9DA 1E0ZA 3GP7A 2IO1B 2LRUA 3TIXA 4ZRPA 3TL5A 1QOAA 2WWZA 3GB1A 5L83A 3V62A 3K9OB 2RR9A 1FNVA 3HVDA 2MLBA 4M02A 1T0QC 2CHZA 1WZ0A 5HI1A 2NBWB 2D3GA 2CU3A 1OQRA 5BMIA 1C1YB 1T0SC 2MA9B 1WFYA 3RZWC 5E6PA 1M4VA 1UBQA 1KLUD 4AQ7A 4BBNC 2FCSA 2KTRA 3N1YC 5TSSA 2W82A 1Z2MA 2MBEA 3OJ3A 3MHZA 2GLSA 4ANUA 1A5RA 1IGCA 1WJ6A 1Y8RC 1CJEA 1ZDVA 2GBJA 5DPTA 2PW9A 3AE7B 1P98A 2K8BA 2W9NA 2WXRA 5E6JA 5JZEB 1JROA 2IY1B 2JXTA 1D5MC 1OQYA 4GXBA 1VLBA 1V86A 1WF9A 1MPEA 1YJIA 2IGGA 3NY5A 4ICVA 3R2IA 5BYRA 2K22A 5IO9A 2KQSA 3A4SC 1PUTA 3GZNB 5FKAC 1T0RC 4NJ7A 3IT4B 4LDTD 4C56C 4NAWA 3DDCB 4ZYSA 2LVOA 3EHVA 5FK9C 5EE1A 1SXTA 2CHXA 3VDZA 4TMAB 4HCPB 3RPFC 4K81A 1FO4A 2FCMA 2AYOB 3HVZA 4DHJB 1E8XA 3I57A 2C9WB 4DDID 4KX6B 2KD0A 1J7AA 2ICIA 3AE2B 3PLUA 4P1BC 2OJWA 1F52A 4HWIB 2HDEA 3M63B 4ANVA 1WGGA 1Y56A 2LHEA 1R4MI 5IOIA 1HZ5A 2RD0A 2IYDB 3WAOA 2KKCA 1DOIA 3CSTA 1FRDA 4DK5A 3WA0A 3E9SA 2N7DA 2ZPNA 2AX5A 2NTTA 4ITKA 1ACCA 1F2RI 2JX5A 1CMXB 4AUQC 1SEBD 3LB8C 4GGQA 5H8YE 3M95A 2CHWA 4AJWA 4HRSA 3A9JA 1OFFA 4PYUA 1D5ZC 5JXVA 3ZGZA 4MGZE 2IZVB 4FJYA 3ZYYX 3PPAA 3ALBA 4EE2A 1I4PA 1WXMA 3PGEA 4M01A 3KWLA 4GDKB 1IGDA 3U52E 2C7NB 2KWDA 4IM0A 1ZW7A 5E6OA 3URYA 3AECB 4NPNA 4D2KA 1TY0A 4MJSA 2FCQA 4RMAA 3IT6B 2M1MA 2N1VA 5AUIA 3CF6E 3ZTDA 2WXGA 4XYCA 3L08A 4BKSD 3VUWA 2WHIA 3HUIA 4C7YA 1MHXA 3H7PB 1E8ZA 4MGKE 2ZW1A 3W9CB 1TS3A 2IJ0A 1JQ4A 1GB4A 2NMQA 4I6PA 1XF5L 5IP4D 1YX5B 2O2VB 4LNOA 2L00B 1J8CA 4USAA 5AUKA 4XZ4A 2M17A 3ENEA 1N6ZA 1XCQL 4KDIC 1RM6C 2J53A 4WAAA 2MJDA 4C4VA 1FFVA 4A55A 5BMHA 4AWJA 3TEYA 1V6EA 2WS3B 3ZRCA 4ZHPA 5CTRC 2RDHA 2JF5A 3BINA 4PT5A 3SR6A 1YJ1A 2LGXA 4REZA 5JHAA 2DYBA 1TTNA 4MT5A 1IBXB 3R3MA 4M0WA 3GE3C 1P7FA 2KLGA 3QARA 1NYRA 2R2QA 2WXFA 1JCKB 1E7PB 4E71A 4RNAA 2C7MB 4AJYB 1P3QU 1Z5SB 2EKEC
chains in the Genus database with same CATH topology
3R8BA 2WDRB 1I4QA 2AQ1B 2H88B 3KLSX 1GAQB 1YQ4B 1ZP0B 1E9MA 1J7CA 2NTSA 1HA5A 2QILA 2E6XA 1ET9A 5BYSA 1JWMD 1TZOA 1R7SA 2GI9A 2QJLA 5C2TB 1EU3A 5HHDG 3ZQ4A 4HROA 3BVGA 4RGTA 4XE0A 2W54A 1T5XD 1STEA 2KDMA 2SEBD 2ZW0A 1CK1A 4KGTA 5HFYA 2N9KA 1AYFA 3I9V1 1V1PA 3Q8CA 3U2SC 1SBBB 3BYYB 3KQ4A 5MPOA 3W1SA 4LTUA 1L6UA 1KLGD 2EELA 1TS2A 2L1AA 3SFDB 1PGBA 4YSXB 2ON8A 1QOFA 2WXMA 1NEKB 4YTPB 2X38A 3ZJTA 4NAWB 4DQOC 5C3JB 1N62A 5G5HA 1GOZA 1KH0A 1L4ZB 1VR9A 3AEGB 4DXFA 1L5PA 3J9CA 1L4DB 2IGHA 3NVYA 1A70A 2MEKA 3Q8AA 4N6EB 2M56B 2BW2A 1C4CA 2PMVA 1ROEA 1XLQA 1V8CA 1TKEA 4US9A 1V97A 2G9HD 3EA6A 1RYJA 2JWUA 4Q2JA 1N63A 3VRAB 4ZHOA 1WYGA 2K5PA 4L2YA 4R3DA 2IGDA 3W5UB 4XWWA 2WXPA 4TSSA 4HKQA 1WSPA 2KQ4X 4YTMB 2WXNA 1F0ZA 2FE8A 3H8HA 3Q69A 3U4EG 2V0GA 1ZXHA 2WNMA 4ARIA 1L0YB 3O13A 3PO0A 4N58A 1ZDXA 2N7JA 1E10A 1SJHD 2OEDA 3ZJUA 1D5XC 1I4XA 4JWSC 4XWTA 3TEZA 2DWQA 1BXTA 1TY2A 3U7ZA 3BVZA 2FUG1 1PGXA 3MC0B 3ZJVA 3BK2A 2QMTA 1PFDA 2YEPB 4A90A 1EWCA 1FEHA 4L1BA 2J42A 4NZLB 4RF0A 1JRPA 4JPSA 1FCLA 4RF1A 1SE4A 4B0MA 5T8IA 1PDXA 3AB5A 1JWUD 1RWSA 1DOYA 1V1PB 5BMGA 1I7HA 2I38A 3VQIA 1FFUA 3ETRA 2Q5WD 1C9FA 3ABVB 4LK0M 2JQRB 1SB3C 2KN4A 1JWBD 2MH7A 1ZE3D 2OHFA 3P4RB 1TKGA 2LJIA 4JWUC 3EGRA 3BVMA 2BBCA 2PVOD 4GDLB 3VRBB 3AE9B 1JWSD 2K3UA 3AEFB 1K53A 2CJNA 2WP9B 4TQ1A 3CWIA 3UI3A 3TEWA 2I2YA 4IDIA 4WQMA 1VZ8A 4WH4A 1BMLC 3C8YA 3MFGA 3W2DA 2BB5A 1AN8A 3FC4A 1FXAA 2SAKA 1HZ6A 1KRHA 3AE4B 2BB6A 2LEKA 4KKJA 4C7ZA 2W3RA 1I4HA 3P4PB 2ACZB 1JWAD 1T3QA 1UWXA 1FNWA 2BS2B 1NVID 3AE1B 5G5GA 1K50A 1CQVA 1WWTA 5GXGB 1VZ7A 4YSZB 2IPKD 4B0EA 2WXQA 3OWEB 1ZXIA 2WDQB 4MACA 1EWYC 1B9RA 1E0ZA 2IDYA 3AN1A 3GP7A 4CQNA 1TS5A 1N60A 2HTME 4HEA1 1GPXA 1QOGA 4OZBA 2RPVA 4ZRPA 4MH8A 1GB1A 3NVZA 1QOAA 3AEBB 1F77A 5D3DA 3GB1A 3SEBA 3GS2A 1QOBA 4N59A 2WXOA 1T6BX 1SSNA 1FNVA 2DBYA 2XNAC 1AW7A 1CZPA 3HVDA 1V1OA 4KGRA 1HQRD 5I4DA 3CIRB 2DYMA 3E56A 3P42A 2VZKB 3AH7A 5H92C 1B1ZA 5HI1A 2BS4B 2PVGC 2CU3A 1OQRA 1L0VB 5BMIA 4YWGG 3R2TA 1K52A 2GB1A 1UWMA 2Z8LA 2WDVB 1M4VA 4JE3B 1C78A 2Y5PA 1KLUD 1YNTE 3PZ8A 5BYQA 3RFZB 4AQ7A 1C76A 3AEAB 4WWMA 3AE6B 4OVZA 3B9JA 5TSSA 1K51A 2W82A 3VR9B 1ZOYB 4HJGE 1FD6A 1XLNA 1XLPA 2AQ2B 4WAFA 2PIAA 4H2AA 3MHZA 1TKYA 4LLGM 4KKIA 2WXLA 3FILA 2MJEA 3VR8B 1PYWD 3BK1A 1VZ6A 1IGCA 1WRIA 3DWGC 1C79A 1CJEA 1KTKA 4NAMA 1SJED 2G1EA 1ZDVA 2AQ3B 2LGIA 2PLPA 2PW9A 3NVVA 2INPE 3AE7B 4YXDB 5EE9A 1YN3A 1XEEA 1NENB 2WXRA 4OHJA 3AEDB 3L4PA 3WCQA 4WURA 5E6JA 1JROA 3IXSA 5HG2A 2JXTA 1D5MC 4RFBA 2WQYB 1NYQA 1VLBA 1YJIA 1MPEA 2IGGA 3R2IA 4FXCA 5BYRA 1L6VA 2V4IB 2K22A 3NVWA 2WXJA 3BYTB 2D5GA 4HKZE 1UNSA 1KFYB 3P63A 3P4QB 3MP9A 1YN4A 4YSYB 2B76B 1PUTA 5FKAC 3TSSA 4XDDA 2KMMA 1KF6B 3IT4B 3AMZA 1SIJA 4C56C 1YJJA 3DWMA 4UDUC 4ARCA 4US8A 2Y5CA 2JU6X 3EUB2 1N5WA 1QQRA 1UUPA 2GRIA 1SE3A 4ZYSA 4IOIE 3BWUD 3KWVA 4RH6A 2M0AA 3TUOA 3N9YC 2K9XA 1L0XB 5FK9C 3V05A 5EE1A 1SXTA 1P7EA 4DXGA 1NI3A 1WXQA 4IKGA 4L23A 3BIID 4TMAB 3RPFC 1FO4A 1D4BA 2LHDA 3HVZA 2RMMA 3NRZA 2V3NA 1I4RA 3I57A 4A6QA 5EE3A 1QF6A 1WGKA 2L32A 2K0PA 4KX6B 4AS1A 4RGNA 2M19A 3SFEB 1J7AA 1HEZE 2ICIA 2WU2B 1QLBB 2DLBA 2J4XA 3AE2B 1ET6A 2JSVX 2JYEA 4KGSA 1EU4A 2J52A 2PTLA 3FILB 3NUHB 2HDEA 2MJ3A 1Q10A 2TSSA 2KAJA 3W5VB 4A8XC 1Y56A 2LHEA 3T3OA 3PZ7A 3B2FA 1HZ5A 1DOIA 3HRDD 3AEEB 3LXFA 1DYQA 1EM7A 1FRDA 2W3SA 4RCOA 3NZ3A 2R61A 3E9SA 5D7GA 2AX5A 3V3XA 4O1NA 3FAHA 1PGAA 1JMLA 2NTTA 4ITKA 1XLOA 1ACCA 1F2RI 1ENFA 2JX5A 1YQ3B 1SE2A 2H89B 2QSDA 2WLBA 1SEBD 3LB8C 5H8YE 2N0SB 3MJ5A 1QT9A 1N5XA 2FBWB 4A9AA 4J3OD 4HRSA 1OQQA 4C80A 1OFFA 5D3IB 4JX1C 2DYOA 1YMHE 1ZPSA 1D5ZC 4NJCA 5JXVA 1QKZA 3AE5B 4OZAA 3ZGZA 2RDGA 4XDCA 3ZYYX 2V3PA 4EE2A 1IBXA 1BUIC 4OZCA 1I4PA 1C77A 1J7BA 2JYTA 1DGJA 3KWLA 4GDKB 1IGDA 1YN5A 2QEJC 1E6EB 3U52E 2KWDA 4GLSC 3AM9A 2EKIA 1C4AA 2WXIA 3URYA 3AECB 2ONQA 1AWDA 4D2KA 1TY0A 2E3TA 2L83A 1XO3A 3IT6B 1SF0A 1C4PA 1VDVA 5AUIA 1XCTL 2PKOA 5EE0A 2BTEA 3T3NA 1RFKA 1IUEA 2WXGA 2N9LA 1QILA 1LO5D 2WXHA 4ZOHC 1ZUD2 3HUIA 2CJOA 4C7YA 1MHXA 1DOXA 2ZW1A 3W9CB 1FNUA 1TS3A 2IJ0A 5FR3A 2BT6A 4MM3B 3BZDB 1JQ4A 4ZRQA 1GB4A 2NMQA 2LMCA 1FMAD 1F2RC 1FIQA 1XF5L 1XXGA 2Y3AA 5LNK1 2QIEB 2LFIA 4USAA 5AUKA 1MI0A 1TS4A 1XCQL 3IAS1 1N61A 1JW9D 1D6EC 1RM6C 2J53A 2MJDA 2L52A 2BYTA 2W55A 4RGOS 1UGJA 3IAM1 1I4GA 1FFVA 4RGMA 4A55A 3P1MA 5BMHA 3AE3B 2LUMA 1TYGB 3AV8A 3TEYA 3Q8EA 4OW0A 2WS3B 3NS1A 1FXIA 4ZHPA 4P6VF 1TJEA 1VRAB 4TQ0A 2JZPA 2RDHA 2INNE 2WXKA 2BS3B 4PT5A 1VJKA 4P16A 3SR6A 2XN9C 4REZA 2KACA 3LYYA 4MT5A 1FRRA 2VZKD 2YEPF 1MHHE 1IBXB 1FCCC 1MVKA 4M0WA 4YT0B 3TEXA 3AE8B 1P7FA 1NYRA 4YTNB 1HXYD 2WXFA 1JCKB 1E7PB 1ESFA 4RNAA 3Q8FA 1JALA 4WIPA 3Q8BA 3P4SB 3B2GA 1FM0D 2WU5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJE A;  1JWB D;  2MH7 A;  2G1E A;  2WDR B;  2OHF A;  3P4R B;  5AUI A;  3NVV A;  1TKG A;  3AE5 B;  3AE7 B;  4JWU C;  2H88 B;  4YXD B;  5EE9 A;  1GAQ B;  1YQ4 B;  2PVO D;  1NEN B;  1ZP0 B;  3VRB B;  1E9M A;  3AE9 B;  3ZYY X;  1J7C A;  3AED B;  3L4P A;  3AEF B;  4JX1 C;  3WCQ A;  2CJN A;  2QJL A;  1JRO A;  1R7S A;  5C2T B;  2WP9 B;  4HRO A;  3CWI A;  2WQY B;  1NYQ A;  1J7B A;  1VLB A;  1DGJ A;  1YJI A;  2W54 A;  4IDI A;  4WQM A;  3KWL A;  4FXC A;  1L6V A;  2K22 A;  1E6E B;  1AYF A;  3FC4 A;  3NVW A;  3AM9 A;  2EKI A;  1FXA A;  1KFY B;  1KRH A;  3AE4 B;  3P63 A;  3AEC B;  1AWD A;  3P4Q B;  2LEK A;  2E3T A;  5MPO A;  4LTU A;  1L6U A;  4C7Z A;  2L83 A;  2W3R A;  4YSY B;  2B76 B;  1PUT A;  3SFD B;  3P4P B;  4YSX B;  2ACZ B;  1QOF A;  1JWA D;  1SF0 A;  1XO3 A;  1T3Q A;  1VDV A;  2BS2 B;  1KF6 B;  1NEK B;  1NVI D;  2KMM A;  2PKO A;  1SIJ A;  1RFK A;  3AE1 B;  1IUE A;  1YJJ A;  3DWM A;  3AMZ A;  1WWT A;  4YTP B;  5GXG B;  4US8 A;  5C3J B;  4YSZ B;  1N62 A;  5G5H A;  2Y5C A;  1ZXI A;  1ZUD 2;  2WDQ B;  3HUI A;  2CJO A;  4ZOH C;  3EUB 2;  1N5W A;  4C7Y A;  1EWY C;  3AEG B;  1DOX A;  3W9C B;  1B9R A;  1L5P A;  1E0Z A;  3AN1 A;  3NVY A;  1N60 A;  1A70 A;  2HTM E;  2BT6 A;  2K9X A;  1GPX A;  1JQ4 A;  5EE1 A;  1QOG A;  4N6E B;  2M56 B;  3NVZ A;  1NI3 A;  1WXQ A;  1QOA A;  3AEB B;  3BII D;  1ROE A;  1FMA D;  1FIQ A;  1V8C A;  1TKE A;  1XLQ A;  4US9 A;  1V97 A;  3RPF C;  3DWG C;  1QOB A;  1FO4 A;  1RYJ A;  4N59 A;  3HVZ A;  1N63 A;  2QIE B;  4USA A;  5AUK A;  1WYG A;  2K5P A;  3NRZ A;  3VRA B;  2DBY A;  4ZHO A;  1QF6 A;  1CZP A;  5EE3 A;  3W5U B;  1WGK A;  4KX6 B;  1N61 A;  1F0Z A;  4YTM B;  3SFE B;  1JW9 D;  1RM6 C;  2M19 A;  3CIR B;  1J7A A;  2MJD A;  3AH7 A;  5G5G A;  5H92 C;  2L52 A;  2WU2 B;  1QLB B;  2BS4 B;  2PVG C;  2W55 A;  2CU3 A;  1OQR A;  3AE2 B;  1L0V B;  1FFV A;  5EE0 A;  3P1M A;  3PO0 A;  4N58 A;  2MJ3 A;  3AE3 B;  1TYG B;  3AV8 A;  2KAJ A;  2WS3 B;  3W5V B;  1E10 A;  1UWM A;  3NS1 A;  1FXI A;  3B2F A;  2WDV B;  4ZHP A;  4P6V F;  1TJE A;  4JWS C;  3AEA B;  4WWM A;  1DOI A;  3AE6 B;  2BS3 B;  2DWQ A;  3HRD D;  1VJK A;  3AEE B;  3B9J A;  3LXF A;  1FRD A;  2W3S A;  3SR6 A;  3VR9 B;  1ZOY B;  3ABV B;  2AX5 A;  1XLN A;  1FRR A;  1XLP A;  1PFD A;  3FAH A;  4ITK A;  1XLO A;  4YT0 B;  3AE8 B;  2PIA A;  1JRP A;  1YQ3 B;  2JX5 A;  2H89 B;  2WLB A;  3LB8 C;  1TKY A;  1NYR A;  4YTN B;  1E7P B;  5H8Y E;  2N0S B;  1PDX A;  3AB5 A;  1QT9 A;  2MJE A;  1N5X A;  1RWS A;  2FBW B;  1JAL A;  3VR8 B;  1DOY A;  1I7H A;  4A9A A;  1FFU A;  3P4S B;  3ETR A;  4HRS A;  1OQQ A;  3B2G A;  2Q5W D;  4C80 A;  1WRI A;  1FM0 D;  1OFF A;  2JQR B;  2WU5 B;  1SB3 C; 
#chains in the Genus database with same CATH topology
 3AUL A;  3R8B A;  2WDR B;  1FXT B;  3M62 B;  5AZG A;  4AP4 C;  3JSV A;  5BYS A;  2KZR A;  5HHD G;  3TJP A;  2NPT A;  2W54 A;  3KUZ A;  4KIK A;  1T5X D;  2ZW0 A;  1CK1 A;  3PRE A;  5D6J B;  5HFY A;  1V1P A;  1V49 A;  1SBB B;  3I5J C;  1EF1 A;  2BQQ A;  2V4L A;  4LTU A;  2ON8 A;  2NR2 A;  1H4R A;  2FIF A;  3ZJT A;  4DQO C;  3ZVV A;  1L4Z B;  1VR9 A;  2IGH A;  1RLF A;  3HM3 A;  3U7D A;  2MEK A;  3Q8A A;  4DXA B;  3L17 A;  4EOY A;  4K7U A;  3U8Z A;  5CHF A;  1RYJ A;  4ASW C;  3RI7 C;  4EUT A;  4R3D A;  3H7S A;  2KDB A;  4DWF A;  1IPG A;  4LJP B;  4CO7 A;  4TSS A;  1X1M A;  4HKQ A;  3PTF C;  2WXN A;  4F1S A;  2WNM A;  4N58 A;  4W9I A;  3UQA A;  3DBR I;  3NHE B;  1I4X A;  1E8W A;  1WM2 A;  1WYW B;  3QAQ A;  3HHM A;  3BK2 A;  1PFD A;  1YX6 B;  4L1B A;  2BKR B;  2J42 A;  4NZL B;  2D07 B;  2MHJ A;  1SE4 A;  2GBM A;  1Q5W B;  2EMT A;  2R2O A;  2WX1 A;  4BOZ B;  1WMH A;  1JWU D;  1RWS A;  1DOY A;  5BMG A;  2I38 A;  3ETR A;  3OAW A;  3EFU A;  2JVC A;  2MH7 A;  3EGR A;  4GDL B;  3VRB B;  1K53 A;  3VFK A;  4TQ1 A;  4IDI A;  2N9P C;  3KYC D;  4W9J A;  1AN8 A;  3FC4 A;  1J0G A;  1NDD A;  4IWO A;  2D3C A;  2GMI C;  1KRH A;  1WX8 A;  1LQB A;  3H9D A;  4KKJ A;  2DNF A;  3TMP B;  3P4P B;  1JWA D;  2KN5 A;  1NVI D;  5G5G A;  1CQV A;  5GXG B;  1VZ7 A;  2IPK D;  4B0E A;  1MFW A;  2IO3 B;  3KH0 A;  1B9R A;  2IDY A;  4B95 A;  3AN1 A;  1TS5 A;  2DZI A;  1N60 A;  3DBR B;  4HEA 1;  1QOG A;  4MH8 A;  2PEA A;  2J0K A;  1F77 A;  2GBK A;  5AEK B;  1QOB A;  2WXO A;  5CX3 A;  3QQ8 B;  2KK8 A;  3PHX B;  2DBY A;  2XNA C;  1AW7 A;  2G4S A;  1EF5 A;  1S1Q B;  2VZK B;  2K8C A;  2PVG C;  1P9D U;  3WAL A;  1L0V B;  3R2T A;  1E7V A;  2MQJ A;  2GB1 A;  5DPS A;  4BVU C;  3VAW A;  5LLI A;  4JE3 B;  1EUV B;  3HM6 X;  1YNT E;  3PZ8 A;  2LXA A;  5BYQ A;  4A20 A;  2NS5 A;  3B9J A;  4N9F 4;  1XLP A;  5L95 C;  4RM9 A;  2PIA A;  2DAJ A;  1TKY A;  2WXL A;  3FIL A;  1F9J A;  2KLC A;  3VR8 B;  4K7W A;  1PYW D;  3BK1 A;  1VZ6 A;  1WRI A;  3DWG C;  1J19 A;  1E90 A;  2AQ3 B;  3QWZ B;  1YQB A;  2LGI A;  3A33 B;  3ZNG C;  3Q3M C;  1NEN B;  2J0J A;  3AED B;  3WCQ A;  3QC8 B;  4WJQ A;  3TBL D;  3V60 A;  2G4D B;  4RFB A;  2K6Q A;  3RZF A;  3N20 C;  2LAS A;  1GC7 A;  3RYT A;  1L2N A;  4FXC A;  1L6V A;  2UWQ A;  2WXJ A;  3BYT B;  4LNN A;  2D5G A;  4HKZ E;  3N32 A;  1WRD B;  4KSL C;  3P63 A;  3QX1 A;  4YSY B;  3SD5 A;  1WE6 A;  2EMS A;  3RNA C;  1KF6 B;  4XC2 A;  3RT3 B;  3D32 A;  1YJJ A;  3N3K B;  3PV1 A;  4US8 A;  1VCB A;  5J17 A;  3EUB 2;  3ZTC A;  2CR5 A;  3R7R A;  3KWV A;  2BYV E;  1FM0 D;  2K9X A;  1L0X B;  4TKN A;  4WWP A;  3V05 A;  3V61 A;  1P7E A;  4DXG A;  5DPR A;  4IKG A;  1MJD A;  1I42 A;  4WWO A;  4M8N A;  4DHZ B;  2LHD A;  2KTR B;  2I1K A;  4K1R B;  4PK1 A;  4A6Q A;  3ZNH B;  1WGK A;  4AS1 A;  4RGN A;  2M19 A;  4ZRK A;  4BKG A;  2DLB A;  3Q3F A;  2JYE A;  1EU4 A;  2J52 A;  2JZ3 B;  4DHZ E;  2TSS A;  2KAJ A;  4MM3 A;  3W5V B;  4A8X C;  3B2F A;  4W9F A;  1RAX A;  5HKH A;  3NZS A;  4PS7 A;  5CHV C;  4B6W A;  1TBE A;  3HRD D;  2W3S A;  4RCO A;  3V3X A;  3HK0 A;  1PGA A;  1FPY A;  1XLO A;  1ENF A;  1YQ3 B;  2H89 B;  2KFK A;  2N4F A;  5GMV A;  1QT9 A;  4J3O D;  4JX1 C;  1LGR A;  3MC8 A;  1ZPS A;  1UZX B;  4OZA A;  4PS3 A;  3W1Y A;  2RDG A;  1UEL A;  2L7R A;  4XDC A;  2CU1 A;  4DBG A;  2V3P A;  5BO4 B;  4OZC A;  1C77 A;  1J7B A;  2JYT A;  4W9E A;  4LNF A;  4NQL B;  2K6D B;  3PSE B;  2X8X X;  4GLS C;  2EKI A;  2KNB A;  4XX5 A;  4HCN B;  3CSF A;  2DZK A;  2KMA A;  2E3T A;  2MP2 A;  2YLM A;  4BAX A;  2OOB B;  1SF0 A;  4OVV A;  1C4P A;  5AZH A;  5EE0 A;  2PKO A;  3T3N A;  1RFK A;  2L0F A;  2HE7 A;  2N9L A;  2XEW A;  2K39 A;  2JPH A;  2WXH A;  1ZUD 2;  2UYZ B;  2MBO A;  1WY8 A;  5FR3 A;  4BOS C;  5DCN A;  3BZD B;  3ZIM A;  2LMC A;  1F2R C;  1FMA D;  4KZC A;  4HLE A;  2ZVO A;  3ZO5 B;  4GSW A;  2KJ6 A;  1TS4 A;  3IAS 1;  2RDB C;  3B08 A;  2BYT A;  2W55 A;  1UGJ A;  3PT2 B;  4RGM A;  2KFJ A;  3P1M A;  4JGH B;  1I35 A;  3AV8 A;  1WX9 A;  5C23 A;  2KVZ A;  3Q8E A;  2C5L C;  3IG3 A;  3A9J B;  3NS1 A;  2V3S A;  4S0R A;  3PVL A;  3I3T B;  4TQ0 A;  3UIP B;  2JZP A;  2LGY A;  2BS3 B;  2JRH A;  2ZPY A;  2KX3 A;  4HPP A;  3LYY A;  5IN7 A;  2VZK D;  2YEP F;  1MVK A;  3TEX A;  3NZU A;  3AI5 A;  3MTN B;  2DEN B;  4PYZ A;  1HXY D;  1ESF A;  1WGR A;  3VTV A;  3Q8F A;  4MJS B;  2O6V A;  1JRU A;  2QC8 A;  2AQ1 B;  1YQ4 B;  1HE8 A;  3UQB A;  1VD2 A;  2LRW A;  1J7C A;  1HA5 A;  1WJU A;  1JWM D;  1TZO A;  1R7S A;  2XK5 A;  2HJ8 A;  1LFD A;  1EU3 A;  5C2T B;  4HRO A;  2VRR B;  4RGT A;  2SEB D;  2KDM A;  3DVN U;  4K3B A;  3C0R B;  3SHQ A;  3QA8 A;  3KQ4 A;  5MPO A;  1L6U A;  2EEL A;  3DBS A;  4YSX B;  1QOF A;  2KWC A;  2WXM A;  3VXW A;  4TUU A;  3N1X C;  2X38 A;  5C3J B;  1RRB A;  3PHW B;  5G5H A;  4C4V B;  1L5P A;  1XT9 B;  2AL3 A;  1A70 A;  3EFC A;  4ZRJ A;  4YL8 A;  2WDT B;  2BW2 A;  1C4C A;  2PMV A;  1NI2 A;  1ROE A;  1V8C A;  4G3X B;  1TKE A;  4B9K A;  4PS8 A;  4Q2J A;  2CKH B;  4ZHO A;  4L2Y A;  1WZ3 A;  2IGD A;  4XWW A;  3L10 B;  3APD A;  2WXP A;  4YTM B;  4M0W B;  2FE8 A;  2PE9 A;  4A3O A;  2NBV B;  2V0G A;  2KXJ A;  3H6N A;  4WWN A;  3RUI B;  1XD3 B;  1R4M B;  2KHW B;  1F1H A;  2N7J A;  1E10 A;  1SJH D;  2OED A;  2KJR A;  4HJK A;  4ANX A;  3DHG C;  2YVC A;  2LGS A;  2KTF A;  2FUG 1;  3JSV B;  3MC0 B;  2JWZ A;  4A90 A;  4BBN F;  3PRZ A;  3CMM B;  2NPT B;  1JRP A;  4KIK B;  4JPS A;  2JY6 A;  1WM3 A;  5E6N A;  3W1S C;  3AB5 A;  1V1P B;  1I7H A;  2AWT A;  4F7Z A;  5AZF A;  1C9F A;  3PRM B;  4LK0 M;  5KHO A;  5FR6 A;  2OHF A;  2LJI A;  2BBC A;  3KUD B;  3AE9 B;  1JWS D;  1SE9 A;  2WP9 B;  4JL9 A;  3WIM A;  5G55 A;  3W2D A;  2BB5 A;  3JW0 X;  2QCZ A;  2SAK A;  2BB6 A;  1I4H A;  1AAR A;  4E74 A;  4HPM B;  3AE1 B;  4FN2 A;  4YSZ B;  2WXQ A;  3OWE B;  4ZRI A;  1R4N I;  1EWY C;  5J18 A;  2BYF A;  4CQN A;  2V1Y A;  4OZB A;  2RPV A;  3NVZ A;  2BKF A;  3AEB B;  5D3D A;  3SEB A;  4ANW A;  2D3B A;  4N59 A;  2O2V A;  3QK0 A;  3OLM D;  3KYD D;  4GN1 A;  1CZP A;  4KGR A;  1HQR D;  4FJZ A;  5I4D A;  3A9K A;  3BY4 B;  3E56 A;  2VH2 A;  2KDI A;  3AH7 A;  3P42 A;  1B1Z A;  2BS4 B;  4IM2 A;  1WMH B;  4YWG G;  1UBI A;  1IP9 A;  2WDV B;  2A4Z A;  1C78 A;  3WAN A;  3RFZ B;  3APC A;  4FLH A;  1C76 A;  4WWM A;  3DOW A;  1WXS A;  1K51 A;  3VR9 B;  4E3C A;  1FD6 A;  1WJ4 A;  2AQ2 B;  2KVR A;  3WAP A;  1M94 A;  3N1Z C;  2Z0E B;  4KZ0 A;  4LLG M;  2MBH A;  4DDG D;  3NS8 A;  3A1Q A;  1C79 A;  1YD8 U;  4NAM A;  4W9G A;  4G50 A;  2PLP A;  3NVV A;  4EZJ A;  2INP E;  4YXD B;  1XEE A;  1PQS A;  4OHJ A;  4WUR A;  3ML8 A;  5HG2 A;  1ISN A;  1NYQ A;  4CHK A;  1K8R B;  2V4I B;  3V6E B;  2BGF A;  4NY0 A;  3U30 A;  1UNS A;  3VVW B;  4EZK A;  3TSS A;  4XDD A;  2KMM A;  2N7E A;  2KT7 A;  4ARC A;  4X57 B;  2PJH A;  3C19 A;  2JU6 X;  1N5W A;  1UUP A;  2GRI A;  4IOI E;  3BWU D;  2MW5 A;  4RH6 A;  2M0A A;  4KVG B;  3TUO A;  2KJH B;  4K3C A;  2JT4 B;  3DVG X;  1NI3 A;  1WXQ A;  5EDS A;  4L23 A;  3DBL I;  2RMM A;  4MEL A;  2RGF A;  3NRZ A;  2V3N A;  2LZ6 A;  5EE3 A;  3ZXR A;  5C1Z A;  3NG0 A;  3SFE B;  4XGA B;  4KV2 A;  2WU2 B;  2J4X A;  1ET6 A;  5JH5 C;  1WJN A;  2JSV X;  3FIL B;  2MJ3 A;  2ZZP B;  1Q10 A;  1MG4 A;  2MSE D;  5D2M B;  2QDF A;  3PZ7 A;  1G6J A;  1T0Y A;  2M0X A;  4BFR A;  1L7Y A;  2V9H A;  4MSQ B;  3AEE B;  3LXF A;  4NQK E;  2R61 A;  3VTU A;  1JML A;  2N0S B;  2J7Q B;  4ZYN A;  3FKY A;  2KDF B;  4A9A A;  3N30 A;  2DYO A;  4JIO U;  4BKT A;  2G45 B;  3GE8 C;  1V2Y A;  3AE5 B;  4FUL A;  1LXD A;  3ZNZ B;  4BZA A;  1KM7 A;  1P0R A;  4WJO A;  1DGJ A;  1YN5 A;  2ZCC A;  4LNI A;  2KAN A;  2PPH A;  4IM3 A;  1C4A A;  2WXI A;  2Y5B B;  3DBL B;  2ZJD A;  2N9E B;  3K9P B;  1AWD A;  2L83 A;  1WGD A;  1XO3 A;  4M8M A;  2OJR A;  3Q6B A;  2BTE A;  2J0M A;  1V80 A;  1IUE A;  2D10 A;  4HDQ A;  4G0N B;  1DOX A;  1FNU A;  2FID A;  2BT6 A;  3ONS A;  4MM3 B;  4ZRQ A;  2LVP A;  2KC2 A;  2RSU A;  4A3P A;  1XXG A;  1HTO A;  2Y3A A;  5LNK 1;  2NVU I;  2LFI A;  3JVZ X;  3ECI A;  2L8J A;  3T9L A;  3B0A A;  1JW9 D;  1D6E C;  2G3Q B;  4MDK E;  2KFK B;  2JXX A;  1I4G A;  1UD7 A;  2GBN A;  1OEY A;  3AE3 B;  2LUM A;  2M4N A;  3EC8 A;  4OW0 A;  4P6V F;  4P7I A;  3DCG A;  2INN E;  3OJ4 B;  1TZ1 A;  1VJK A;  4II3 B;  2XN9 C;  5IAA C;  2KAC A;  1SGH A;  3ZW3 A;  1FCC C;  1YOV B;  2AEH A;  3AE8 B;  2BWF A;  3VH3 B;  4YTN B;  2HJ1 A;  2M8S A;  1JAL A;  4WIP A;  3P4S B;  3B2G A;  3DBH I;  2WU5 B;  2MP2 B;  3Q3N C;  4NJ6 A;  1Q0W B;  4IWQ A;  1I4Q A;  4CYE A;  1GAQ B;  1ZP0 B;  4FBJ B;  4P1C C;  2I1J A;  1E9M A;  2QIL A;  2GI9 A;  2QJL A;  5J2R A;  3ZQ4 A;  4IUM B;  4XE0 A;  1WGY A;  4IW0 A;  3AU5 A;  2JZZ A;  4HXD A;  2MCN B;  3Q8C A;  3SU8 X;  3U2S C;  2L05 A;  2QHO A;  4TV3 A;  2L1A A;  3SFD B;  1PGB A;  2FAZ A;  4GU2 A;  5D94 A;  4YTP B;  3GZN I;  3ZNI D;  4NAW B;  3VHT C;  1GOZ A;  3R66 C;  3RNG C;  3ZDT A;  1WR1 A;  4BKS A;  3J9C A;  1L4D B;  2L3Z A;  3X0W A;  3NVY A;  5DPW A;  2DX5 B;  4N6E B;  2A5U A;  1XLQ A;  4I6N B;  3MHS D;  1N63 A;  3P2B A;  2KX0 A;  3VRA B;  1WYG A;  3UGB B;  2BF8 B;  3W5U B;  1WXV A;  1WSP A;  2KQ4 X;  1YIW A;  3H8H A;  3Q69 A;  3U4E G;  2JRI B;  1V81 A;  1ZXH A;  3MJW A;  4GIV A;  3DBH B;  3PO0 A;  1U4A A;  1ZDX A;  2B3A A;  3PLV A;  4HDO A;  3SDL C;  3ZJU A;  3V6C B;  2O6V B;  1GG3 A;  4JWS C;  2K8H A;  3TEZ A;  1OEY J;  2DWQ A;  1TY2 A;  1IYF A;  2BYE A;  3U7Z A;  3BVZ A;  3H1U A;  3RMK C;  1PGX A;  2KMC A;  3ZJV A;  2XK5 B;  2QMT A;  2YEP B;  1EWC A;  3DVG Y;  3RNE C;  4MEM A;  3EEC A;  1QZE A;  5T8I A;  1WH3 A;  1S3S G;  2UU7 A;  3VQI A;  1FFU A;  2NBU A;  3ZRF A;  1SB3 C;  2KN4 A;  1JWB D;  1ZE3 D;  4JWU C;  2Z0D B;  2PVO D;  3QJZ A;  3LJ3 A;  2CJN A;  1MG8 A;  2WX0 A;  3QIJ A;  2ZNV B;  2ZEQ A;  3CWI A;  3UI3 A;  3ZKJ C;  1VZ8 A;  1KJT A;  3MFG A;  2HD5 B;  4WQO B;  4F8C B;  2DZJ A;  2LI5 A;  4GMV A;  1HZ6 A;  3AE4 B;  2C7H A;  1WR6 E;  2LEK A;  4C7Z A;  3L16 A;  2W3R A;  2JUO A;  1T3Q A;  1UWX A;  2BWE S;  2LVQ A;  1K50 A;  3O65 B;  1WWT A;  2IO0 B;  4MAC A;  2MBQ A;  3L0W B;  2HTM E;  1GPX A;  2PE6 B;  3DPD A;  1GB1 A;  2INC C;  3GS2 A;  3DHH C;  1T6B X;  1SSN A;  4WJP A;  1V1O A;  4EZL A;  3MC9 A;  3ZLZ A;  3CIR B;  5TR5 A;  2DYM A;  5H92 C;  4EFO A;  4RM8 A;  3VH4 B;  3GOE A;  1K52 A;  1UWM A;  2IND C;  3IHP C;  2Z8L A;  4LCD E;  1D3Z A;  2Y5P A;  4W9K A;  3AEA B;  1V5T A;  3AE6 B;  1TIF A;  4OVZ A;  1ZOY B;  4HJG E;  1XLN A;  4HPL B;  4WAF A;  3PS6 A;  4H2A A;  4KDL B;  4KKI A;  2MJE A;  1KOT A;  4NNJ B;  1ZGU B;  1KTK A;  1SJE D;  3IBE A;  2G1E A;  5EE9 A;  1YN3 A;  2AL6 A;  3M3J A;  3L4P A;  3IXS A;  5G2N A;  2WQY B;  2KWU B;  3RD2 A;  2MWS B;  1WE7 A;  5JHB A;  4AOF A;  3NVW A;  4WJN A;  5IKC M;  2VH1 A;  4S17 A;  1KFY B;  2BPS A;  3P4Q B;  3MP9 A;  1YN4 A;  3HIZ A;  2B76 B;  3IVF A;  4G11 A;  3RNC C;  3AMZ A;  1SIJ A;  2WYQ A;  3DWM A;  2XBB C;  4UDU C;  3A9K B;  2DHZ A;  2Y5C A;  3Q3O C;  1QQR A;  3RNF C;  1SE3 A;  4GDK A;  2FCN A;  3N9Y C;  1SIF A;  3UIO B;  2GOW A;  5CHW A;  3WAM A;  3BII D;  3IFW B;  2LGD A;  4IC7 B;  3LDZ E;  3JYU A;  1D4B A;  4FHK A;  2HTH A;  1C3T A;  1GUA B;  1I4R A;  1QF6 A;  2L32 A;  3PZD A;  2K0P A;  1HEZ E;  2K1F A;  1QLB B;  3H7P A;  4KGS A;  2PTL A;  3NUH B;  3T3O A;  3A1Q B;  3PRP B;  1WIA A;  1DYQ A;  1EM7 A;  3NZ3 A;  4MSM B;  5D7G A;  4O1N A;  3FAH A;  3A4R A;  4LNK A;  2QSD A;  2WLB A;  1SE2 A;  2FNJ B;  3MJ5 A;  1N5X A;  2FBW B;  2N1W A;  4FHJ A;  3OG5 A;  3NJT A;  2O6V D;  4MGI E;  1OQQ A;  1UGM A;  4C80 A;  5D3I B;  2WGS A;  1KLV A;  1YMH E;  2REX A;  4NJC A;  1QKZ A;  1OTR B;  2NCN A;  1P1A A;  1IBX A;  1BUI C;  4QAY A;  2QEJ C;  1E6E B;  4W9L A;  4W9C A;  3AM9 A;  1H8C A;  2IY0 B;  1GC6 A;  2C60 A;  2ONQ A;  4I6L B;  2K25 A;  1ZKH A;  2DZM A;  1TT5 B;  2KC1 A;  1VDV A;  3NOB A;  1XCT L;  2ZVN A;  1R4N B;  2KQ7 A;  2D2Q A;  1QIL A;  1LO5 D;  4ZOH C;  5LXI B;  2CJO A;  1WI0 A;  3VTW A;  1Q1O A;  4GOC A;  1E8Y A;  1FIQ A;  3RNB C;  4DHJ D;  4IWP A;  3ZUN A;  2QIE B;  1MI0 A;  2ZCB A;  1LM8 B;  2KO3 A;  1N61 A;  3KVF B;  4OVU A;  2RPQ A;  2L52 A;  2L76 A;  4RGO S;  3IAM 1;  3L54 A;  1TGZ B;  4M00 A;  4K7S A;  1TYG B;  3APF A;  3RN9 C;  1FXI A;  1GJZ A;  3L13 A;  4MGY E;  1TJE A;  1VRA B;  1E7U A;  2WXK A;  4W9H A;  4P16 A;  2LJ5 A;  1GNU A;  1FRR A;  1MHH E;  4YT0 B;  3KW5 B;  3QCA A;  3Q8B A;  4URK A;  3AU4 A;  1RFA A;  2H88 B;  3KLS X;  2NTS A;  3I63 C;  2E6X A;  1ET9 A;  4LDT B;  1V5O A;  3BVG A;  1STE A;  4KGT A;  2KDE B;  2N9K A;  1XQQ A;  1AYF A;  1NBF C;  3I9V 1;  3KUC B;  4FJV B;  2L0T A;  2D11 A;  3BYY B;  3S2A A;  3W1S A;  1BT0 A;  1KLG D;  4EKU A;  1TS2 A;  4GB9 A;  3T8M A;  5IA7 A;  1V9J A;  1E5W A;  1NEK B;  2D3A A;  4GDL A;  1OGW A;  4J6I A;  2FUH B;  4ICU A;  1N62 A;  3Q14 C;  1KH0 A;  3AEG B;  3ZDM C;  3B1L X;  4DXF A;  1WX7 A;  2IO2 B;  3R7Q A;  4IG7 B;  4JLC A;  3RUL A;  2M56 B;  2LWP A;  4US9 A;  1V97 A;  2G9H D;  3EA6 A;  2DAF A;  3UF8 A;  2ASQ A;  2JWU A;  3DVN V;  4ACF A;  2K5P A;  2LXC A;  5KHQ A;  3QHT A;  4KSK C;  1F0Z A;  4ARI A;  1L0Y B;  3O13 A;  2BVC A;  2KOX A;  1D5X C;  3VUX A;  4JQW C;  4XWT A;  1BXT A;  2Z59 B;  2LUE A;  4FAD A;  4II2 B;  3RCZ A;  4EEW A;  3VUY A;  1FEH A;  2IBI B;  4RF0 A;  1FCL A;  4HK2 A;  4RF1 A;  4B0M A;  1PDX A;  1WGH A;  2Q5W D;  3DHI C;  3ABV B;  2JQR B;  2KYW A;  3AXC A;  2CS4 A;  2MX2 A;  3DQV A;  3P4R B;  2ZNV C;  1UH6 A;  1TKG A;  3X23 A;  3ZXV A;  4C00 A;  2LD9 A;  3BVM A;  4HVB A;  1UF0 A;  4LJO B;  2K3U A;  3AEF B;  3UIN B;  1EO6 A;  3TCA A;  3TEW A;  1WXA A;  3Q2A C;  2I2Y A;  4WQM A;  4WH4 A;  1BML C;  3C8Y A;  2MRP A;  1FXA A;  2GBR A;  2KWV B;  4ZDV A;  1HTQ A;  3ML9 A;  2N9X A;  2ACZ B;  2MBB B;  1FNW A;  2BS2 B;  4MH0 E;  5LXH A;  3Q3J A;  1ZXI A;  2WDQ B;  4FA6 A;  4W9D A;  1E0Z A;  3GP7 A;  2IO1 B;  2LRU A;  3TIX A;  4ZRP A;  3TL5 A;  1QOA A;  2WWZ A;  3GB1 A;  5L83 A;  3V62 A;  3K9O B;  2RR9 A;  1FNV A;  3HVD A;  2MLB A;  4M02 A;  1T0Q C;  2CHZ A;  1WZ0 A;  5HI1 A;  2NBW B;  2D3G A;  2CU3 A;  1OQR A;  5BMI A;  1C1Y B;  1T0S C;  2MA9 B;  1WFY A;  3RZW C;  5E6P A;  1M4V A;  1UBQ A;  1KLU D;  4AQ7 A;  4BBN C;  2FCS A;  2KTR A;  3N1Y C;  5TSS A;  2W82 A;  1Z2M A;  2MBE A;  3OJ3 A;  3MHZ A;  2GLS A;  4ANU A;  1A5R A;  1IGC A;  1WJ6 A;  1Y8R C;  1CJE A;  1ZDV A;  2GBJ A;  5DPT A;  2PW9 A;  3AE7 B;  1P98 A;  2K8B A;  2W9N A;  2WXR A;  5E6J A;  5JZE B;  1JRO A;  2IY1 B;  2JXT A;  1D5M C;  1OQY A;  4GXB A;  1VLB A;  1V86 A;  1WF9 A;  1MPE A;  1YJI A;  2IGG A;  3NY5 A;  4ICV A;  3R2I A;  5BYR A;  2K22 A;  5IO9 A;  2KQS A;  3A4S C;  1PUT A;  3GZN B;  5FKA C;  1T0R C;  4NJ7 A;  3IT4 B;  4LDT D;  4C56 C;  4NAW A;  3DDC B;  4ZYS A;  2LVO A;  3EHV A;  5FK9 C;  5EE1 A;  1SXT A;  2CHX A;  3VDZ A;  4TMA B;  4HCP B;  3RPF C;  4K81 A;  1FO4 A;  2FCM A;  2AYO B;  3HVZ A;  4DHJ B;  1E8X A;  3I57 A;  2C9W B;  4DDI D;  4KX6 B;  2KD0 A;  1J7A A;  2ICI A;  3AE2 B;  3PLU A;  4P1B C;  2OJW A;  1F52 A;  4HWI B;  2HDE A;  3M63 B;  4ANV A;  1WGG A;  1Y56 A;  2LHE A;  1R4M I;  5IOI A;  1HZ5 A;  2RD0 A;  2IYD B;  3WAO A;  2KKC A;  1DOI A;  3CST A;  1FRD A;  4DK5 A;  3WA0 A;  3E9S A;  2N7D A;  2ZPN A;  2AX5 A;  2NTT A;  4ITK A;  1ACC A;  1F2R I;  2JX5 A;  1CMX B;  4AUQ C;  1SEB D;  3LB8 C;  4GGQ A;  5H8Y E;  3M95 A;  2CHW A;  4AJW A;  4HRS A;  3A9J A;  1OFF A;  4PYU A;  1D5Z C;  5JXV A;  3ZGZ A;  4MGZ E;  2IZV B;  4FJY A;  3ZYY X;  3PPA A;  3ALB A;  4EE2 A;  1I4P A;  1WXM A;  3PGE A;  4M01 A;  3KWL A;  4GDK B;  1IGD A;  3U52 E;  2C7N B;  2KWD A;  4IM0 A;  1ZW7 A;  5E6O A;  3URY A;  3AEC B;  4NPN A;  4D2K A;  1TY0 A;  4MJS A;  2FCQ A;  4RMA A;  3IT6 B;  2M1M A;  2N1V A;  5AUI A;  3CF6 E;  3ZTD A;  2WXG A;  4XYC A;  3L08 A;  4BKS D;  3VUW A;  2WHI A;  3HUI A;  4C7Y A;  1MHX A;  3H7P B;  1E8Z A;  4MGK E;  2ZW1 A;  3W9C B;  1TS3 A;  2IJ0 A;  1JQ4 A;  1GB4 A;  2NMQ A;  4I6P A;  1XF5 L;  5IP4 D;  1YX5 B;  2O2V B;  4LNO A;  2L00 B;  1J8C A;  4USA A;  5AUK A;  4XZ4 A;  2M17 A;  3ENE A;  1N6Z A;  1XCQ L;  4KDI C;  1RM6 C;  2J53 A;  4WAA A;  2MJD A;  4C4V A;  1FFV A;  4A55 A;  5BMH A;  4AWJ A;  3TEY A;  1V6E A;  2WS3 B;  3ZRC A;  4ZHP A;  5CTR C;  2RDH A;  2JF5 A;  3BIN A;  4PT5 A;  3SR6 A;  1YJ1 A;  2LGX A;  4REZ A;  5JHA A;  2DYB A;  1TTN A;  4MT5 A;  1IBX B;  3R3M A;  4M0W A;  3GE3 C;  1P7F A;  2KLG A;  3QAR A;  1NYR A;  2R2Q A;  2WXF A;  1JCK B;  1E7P B;  4E71 A;  4RNA A;  2C7M B;  4AJY B;  1P3Q U;  1Z5S B;  2EKE C; 
#chains in the Genus database with same CATH homology
 3R8B A;  2WDR B;  1I4Q A;  2AQ1 B;  2H88 B;  3KLS X;  1GAQ B;  1YQ4 B;  1ZP0 B;  1E9M A;  1J7C A;  2NTS A;  1HA5 A;  2QIL A;  2E6X A;  1ET9 A;  5BYS A;  1JWM D;  1TZO A;  1R7S A;  2GI9 A;  2QJL A;  5C2T B;  1EU3 A;  5HHD G;  3ZQ4 A;  4HRO A;  3BVG A;  4RGT A;  4XE0 A;  2W54 A;  1T5X D;  1STE A;  2KDM A;  2SEB D;  2ZW0 A;  1CK1 A;  4KGT A;  5HFY A;  2N9K A;  1AYF A;  3I9V 1;  1V1P A;  3Q8C A;  3U2S C;  1SBB B;  3BYY B;  3KQ4 A;  5MPO A;  3W1S A;  4LTU A;  1L6U A;  1KLG D;  2EEL A;  1TS2 A;  2L1A A;  3SFD B;  1PGB A;  4YSX B;  2ON8 A;  1QOF A;  2WXM A;  1NEK B;  4YTP B;  2X38 A;  3ZJT A;  4NAW B;  4DQO C;  5C3J B;  1N62 A;  5G5H A;  1GOZ A;  1KH0 A;  1L4Z B;  1VR9 A;  3AEG B;  4DXF A;  1L5P A;  3J9C A;  1L4D B;  2IGH A;  3NVY A;  1A70 A;  2MEK A;  3Q8A A;  4N6E B;  2M56 B;  2BW2 A;  1C4C A;  2PMV A;  1ROE A;  1XLQ A;  1V8C A;  1TKE A;  4US9 A;  1V97 A;  2G9H D;  3EA6 A;  1RYJ A;  2JWU A;  4Q2J A;  1N63 A;  3VRA B;  4ZHO A;  1WYG A;  2K5P A;  4L2Y A;  4R3D A;  2IGD A;  3W5U B;  4XWW A;  2WXP A;  4TSS A;  4HKQ A;  1WSP A;  2KQ4 X;  4YTM B;  2WXN A;  1F0Z A;  2FE8 A;  3H8H A;  3Q69 A;  3U4E G;  2V0G A;  1ZXH A;  2WNM A;  4ARI A;  1L0Y B;  3O13 A;  3PO0 A;  4N58 A;  1ZDX A;  2N7J A;  1E10 A;  1SJH D;  2OED A;  3ZJU A;  1D5X C;  1I4X A;  4JWS C;  4XWT A;  3TEZ A;  2DWQ A;  1BXT A;  1TY2 A;  3U7Z A;  3BVZ A;  2FUG 1;  1PGX A;  3MC0 B;  3ZJV A;  3BK2 A;  2QMT A;  1PFD A;  2YEP B;  4A90 A;  1EWC A;  1FEH A;  4L1B A;  2J42 A;  4NZL B;  4RF0 A;  1JRP A;  4JPS A;  1FCL A;  4RF1 A;  1SE4 A;  4B0M A;  5T8I A;  1PDX A;  3AB5 A;  1JWU D;  1RWS A;  1DOY A;  1V1P B;  5BMG A;  1I7H A;  2I38 A;  3VQI A;  1FFU A;  3ETR A;  2Q5W D;  1C9F A;  3ABV B;  4LK0 M;  2JQR B;  1SB3 C;  2KN4 A;  1JWB D;  2MH7 A;  1ZE3 D;  2OHF A;  3P4R B;  1TKG A;  2LJI A;  4JWU C;  3EGR A;  3BVM A;  2BBC A;  2PVO D;  4GDL B;  3VRB B;  3AE9 B;  1JWS D;  2K3U A;  3AEF B;  1K53 A;  2CJN A;  2WP9 B;  4TQ1 A;  3CWI A;  3UI3 A;  3TEW A;  2I2Y A;  4IDI A;  4WQM A;  1VZ8 A;  4WH4 A;  1BML C;  3C8Y A;  3MFG A;  3W2D A;  2BB5 A;  1AN8 A;  3FC4 A;  1FXA A;  2SAK A;  1HZ6 A;  1KRH A;  3AE4 B;  2BB6 A;  2LEK A;  4KKJ A;  4C7Z A;  2W3R A;  1I4H A;  3P4P B;  2ACZ B;  1JWA D;  1T3Q A;  1UWX A;  1FNW A;  2BS2 B;  1NVI D;  3AE1 B;  5G5G A;  1K50 A;  1CQV A;  1WWT A;  5GXG B;  1VZ7 A;  4YSZ B;  2IPK D;  4B0E A;  2WXQ A;  3OWE B;  1ZXI A;  2WDQ B;  4MAC A;  1EWY C;  1B9R A;  1E0Z A;  2IDY A;  3AN1 A;  3GP7 A;  4CQN A;  1TS5 A;  1N60 A;  2HTM E;  4HEA 1;  1GPX A;  1QOG A;  4OZB A;  2RPV A;  4ZRP A;  4MH8 A;  1GB1 A;  3NVZ A;  1QOA A;  3AEB B;  1F77 A;  5D3D A;  3GB1 A;  3SEB A;  3GS2 A;  1QOB A;  4N59 A;  2WXO A;  1T6B X;  1SSN A;  1FNV A;  2DBY A;  2XNA C;  1AW7 A;  1CZP A;  3HVD A;  1V1O A;  4KGR A;  1HQR D;  5I4D A;  3CIR B;  2DYM A;  3E56 A;  3P42 A;  2VZK B;  3AH7 A;  5H92 C;  1B1Z A;  5HI1 A;  2BS4 B;  2PVG C;  2CU3 A;  1OQR A;  1L0V B;  5BMI A;  4YWG G;  3R2T A;  1K52 A;  2GB1 A;  1UWM A;  2Z8L A;  2WDV B;  1M4V A;  4JE3 B;  1C78 A;  2Y5P A;  1KLU D;  1YNT E;  3PZ8 A;  5BYQ A;  3RFZ B;  4AQ7 A;  1C76 A;  3AEA B;  4WWM A;  3AE6 B;  4OVZ A;  3B9J A;  5TSS A;  1K51 A;  2W82 A;  3VR9 B;  1ZOY B;  4HJG E;  1FD6 A;  1XLN A;  1XLP A;  2AQ2 B;  4WAF A;  2PIA A;  4H2A A;  3MHZ A;  1TKY A;  4LLG M;  4KKI A;  2WXL A;  3FIL A;  2MJE A;  3VR8 B;  1PYW D;  3BK1 A;  1VZ6 A;  1IGC A;  1WRI A;  3DWG C;  1C79 A;  1CJE A;  1KTK A;  4NAM A;  1SJE D;  2G1E A;  1ZDV A;  2AQ3 B;  2LGI A;  2PLP A;  2PW9 A;  3NVV A;  2INP E;  3AE7 B;  4YXD B;  5EE9 A;  1YN3 A;  1XEE A;  1NEN B;  2WXR A;  4OHJ A;  3AED B;  3L4P A;  3WCQ A;  4WUR A;  5E6J A;  1JRO A;  3IXS A;  5HG2 A;  2JXT A;  1D5M C;  4RFB A;  2WQY B;  1NYQ A;  1VLB A;  1YJI A;  1MPE A;  2IGG A;  3R2I A;  4FXC A;  5BYR A;  1L6V A;  2V4I B;  2K22 A;  3NVW A;  2WXJ A;  3BYT B;  2D5G A;  4HKZ E;  1UNS A;  1KFY B;  3P63 A;  3P4Q B;  3MP9 A;  1YN4 A;  4YSY B;  2B76 B;  1PUT A;  5FKA C;  3TSS A;  4XDD A;  2KMM A;  1KF6 B;  3IT4 B;  3AMZ A;  1SIJ A;  4C56 C;  1YJJ A;  3DWM A;  4UDU C;  4ARC A;  4US8 A;  2Y5C A;  2JU6 X;  3EUB 2;  1N5W A;  1QQR A;  1UUP A;  2GRI A;  1SE3 A;  4ZYS A;  4IOI E;  3BWU D;  3KWV A;  4RH6 A;  2M0A A;  3TUO A;  3N9Y C;  2K9X A;  1L0X B;  5FK9 C;  3V05 A;  5EE1 A;  1SXT A;  1P7E A;  4DXG A;  1NI3 A;  1WXQ A;  4IKG A;  4L23 A;  3BII D;  4TMA B;  3RPF C;  1FO4 A;  1D4B A;  2LHD A;  3HVZ A;  2RMM A;  3NRZ A;  2V3N A;  1I4R A;  3I57 A;  4A6Q A;  5EE3 A;  1QF6 A;  1WGK A;  2L32 A;  2K0P A;  4KX6 B;  4AS1 A;  4RGN A;  2M19 A;  3SFE B;  1J7A A;  1HEZ E;  2ICI A;  2WU2 B;  1QLB B;  2DLB A;  2J4X A;  3AE2 B;  1ET6 A;  2JSV X;  2JYE A;  4KGS A;  1EU4 A;  2J52 A;  2PTL A;  3FIL B;  3NUH B;  2HDE A;  2MJ3 A;  1Q10 A;  2TSS A;  2KAJ A;  3W5V B;  4A8X C;  1Y56 A;  2LHE A;  3T3O A;  3PZ7 A;  3B2F A;  1HZ5 A;  1DOI A;  3HRD D;  3AEE B;  3LXF A;  1DYQ A;  1EM7 A;  1FRD A;  2W3S A;  4RCO A;  3NZ3 A;  2R61 A;  3E9S A;  5D7G A;  2AX5 A;  3V3X A;  4O1N A;  3FAH A;  1PGA A;  1JML A;  2NTT A;  4ITK A;  1XLO A;  1ACC A;  1F2R I;  1ENF A;  2JX5 A;  1YQ3 B;  1SE2 A;  2H89 B;  2QSD A;  2WLB A;  1SEB D;  3LB8 C;  5H8Y E;  2N0S B;  3MJ5 A;  1QT9 A;  1N5X A;  2FBW B;  4A9A A;  4J3O D;  4HRS A;  1OQQ A;  4C80 A;  1OFF A;  5D3I B;  4JX1 C;  2DYO A;  1YMH E;  1ZPS A;  1D5Z C;  4NJC A;  5JXV A;  1QKZ A;  3AE5 B;  4OZA A;  3ZGZ A;  2RDG A;  4XDC A;  3ZYY X;  2V3P A;  4EE2 A;  1IBX A;  1BUI C;  4OZC A;  1I4P A;  1C77 A;  1J7B A;  2JYT A;  1DGJ A;  3KWL A;  4GDK B;  1IGD A;  1YN5 A;  2QEJ C;  1E6E B;  3U52 E;  2KWD A;  4GLS C;  3AM9 A;  2EKI A;  1C4A A;  2WXI A;  3URY A;  3AEC B;  2ONQ A;  1AWD A;  4D2K A;  1TY0 A;  2E3T A;  2L83 A;  1XO3 A;  3IT6 B;  1SF0 A;  1C4P A;  1VDV A;  5AUI A;  1XCT L;  2PKO A;  5EE0 A;  2BTE A;  3T3N A;  1RFK A;  1IUE A;  2WXG A;  2N9L A;  1QIL A;  1LO5 D;  2WXH A;  4ZOH C;  1ZUD 2;  3HUI A;  2CJO A;  4C7Y A;  1MHX A;  1DOX A;  2ZW1 A;  3W9C B;  1FNU A;  1TS3 A;  2IJ0 A;  5FR3 A;  2BT6 A;  4MM3 B;  3BZD B;  1JQ4 A;  4ZRQ A;  1GB4 A;  2NMQ A;  2LMC A;  1FMA D;  1F2R C;  1FIQ A;  1XF5 L;  1XXG A;  2Y3A A;  5LNK 1;  2QIE B;  2LFI A;  4USA A;  5AUK A;  1MI0 A;  1TS4 A;  1XCQ L;  3IAS 1;  1N61 A;  1JW9 D;  1D6E C;  1RM6 C;  2J53 A;  2MJD A;  2L52 A;  2BYT A;  2W55 A;  4RGO S;  1UGJ A;  3IAM 1;  1I4G A;  1FFV A;  4RGM A;  4A55 A;  3P1M A;  5BMH A;  3AE3 B;  2LUM A;  1TYG B;  3AV8 A;  3TEY A;  3Q8E A;  4OW0 A;  2WS3 B;  3NS1 A;  1FXI A;  4ZHP A;  4P6V F;  1TJE A;  1VRA B;  4TQ0 A;  2JZP A;  2RDH A;  2INN E;  2WXK A;  2BS3 B;  4PT5 A;  1VJK A;  4P16 A;  3SR6 A;  2XN9 C;  4REZ A;  2KAC A;  3LYY A;  4MT5 A;  1FRR A;  2VZK D;  2YEP F;  1MHH E;  1IBX B;  1FCC C;  1MVK A;  4M0W A;  4YT0 B;  3TEX A;  3AE8 B;  1P7F A;  1NYR A;  4YTN B;  1HXY D;  2WXF A;  1JCK B;  1E7P B;  1ESF A;  4RNA A;  3Q8F A;  1JAL A;  4WIP A;  3Q8B A;  3P4S B;  3B2G A;  1FM0 D;  2WU5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...