1E10A

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAKHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Iron-sulfur protein
molecule keywords FERREDOXIN
total genus 21
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e10A00
1SF0A 2DWQA 1J7CA 1WXQA 3ZYYX 2KAJA 3W9CB 1JW9D 1XLPA 5MPOA 2BS2B 2PVOD 1FO4A 4ITKA 1NYQA 3AE9B 3AB5A 4ZHPA 2JX5A 3AE6B 1JQ4A 3AE3B 1JRPA 5AUKA 2WS3B 3HRDD 3B2FA 2WQYB 1YQ4B 2BS3B 3AEBB 4KX6B 1XO3A 2CJOA 1IUEA 5EE0A 1FM0D 3AE2B 4ZOHC 3AN1A 1JALA 4YSYB 1R7SA 4JWSC 2G1EA 3AE8B 3P63A 1OFFA 1QOBA 1GAQB 2PIAA 2WP9B 1FXAA 1N63A 1ZXIA 2Q5WD 4US9A 5GXGB 1A70A 3B2GA 3VR9B 1TKEA 3VRBB 3AEFB 1AYFA 1QT9A 3B9JA 1YJJA 4HROA 2MJ3A 1RM6C 1B9RA 2H88B 1J7AA 3W5VB 2Y5CA 2LEKA 4WWMA 3DWGC 2BT6A 2L83A 3P4RB 4YTNB 1UWMA 4P6VF 4N58A 1PDXA 3AE4B 1CZPA 1GPXA 1T3QA 1L5PA 1PFDA 1QOAA 2W55A 3AV8A 4C80A 2FBWB 5EE1A 2WU2B 2K5PA 2QJLA 3WCQA 3AECB 1N5WA 1QOGA 1PUTA 2N0SB 2WDRB 3AEEB 5H92C 1FXIA 1QOFA 3AE1B 3AEGB 2B76B 1WYGA 1AWDA 1ROEA 1DOXA 1NI3A 1FFUA 1WRIA 1YQ3B 2HTME 2MJEA 4ZHOA 4US8A 2KMMA 3LXFA 1JWBD 1KRHA 1ZP0B 1RWSA 1VDVA 1NYRA 2M56B 4A9AA 3PO0A 1OQRA 3EUB2 3NRZA 1N61A 1F0ZA 5AUIA 1JROA 2BS4B 3DWMA 1E7PB 1ZUD2 3BIID 3SFEB 1E6EB 2EKIA 2M19A 1EWYC 5G5GA 1TKYA 1FIQA 3P4PB 4YT0B 1XLOA 4USAA 2ACZB 3NVVA 4HRSA 4YTPB 1FMAD 3RPFC 3VR8B 3AE7B 1XLNA 4JWUC 2W3RA 2K22A 3FC4A 1QLBB 3CWIA 1FRDA 1CJEA 2E3TA 2MH7A 3AH7A 4YSZB 3NVYA 3P4SB 4N6EB 4C7ZA 1RYJA 3NVWA 3KWLA 4YTMB 5C3JB 2AX5A 1L0VB 3W5UB 1FRRA 1NEKB 1JWAD 1L6UA 1YJIA 1E9MA 2MJDA 3AE5B 3AMZA 3SFDB 2L52A 3SR6A 1N62A 3VRAB 1XLQA 4FXCA 1E0ZA 3CIRB 1OQQA 2CU3A 2W54A 3AM9A 1TKGA 5EE9A 5EE3A 3P4QB 1DOYA 1DGJA 2PVGC 2OHFA 4IDIA 1N60A 1VLBA 2WDQB 3NS1A 1J7BA 2DBYA 3HUIA 1ZOYB 2PKOA 5H8YE 2QIEB 1RFKA 4WQMA 5C2TB 1QF6A 1V97A 2CJNA 1N5XA 4YSXB 2WU5B 3ABVB 1KFYB 3P1MA 1TYGB 2WDVB 1SIJA 1WGKA 1TJEA 1VJKA 4C7YA 3FAHA 1L6VA 3L4PA 4JX1C 1KF6B 2H89B 5G5HA 1NVID 4YXDB 1E10A 1DOIA 1V8CA 1WWTA 3NVZA 1I7HA 3AEAB 1SB3C 2WLBA 2W3SA 2JQRB 3HVZA 2K9XA 3LB8C 4N59A 1NENB 1FFVA 3ETRA 3AEDB 4LTUA
chains in the Genus database with same CATH superfamily
1HA5A 1TBEA 1E90A 2IO1B 2K6QA 5MPOA 2GBJA 3FKYA 1EWCA 1WXSA 4FN2A 3K9PB 2KFKB 1MFWA 2I2YA 4KV2A 4RFBA 1SSNA 4JWSC 5D3DA 1QOBA 1RRBA 2NBUA 3PVLA 3UF8A 1IBXB 4WWNA 2JZ3B 2C7NB 2LVOA 2Z0DB 3C0RB 1KLVA 2RSUA 2VZKB 4RH6A 3DWGC 1T0RC 4IWOA 2KJ6A 3RNFC 4RM8A 2KZRA 3P4RB 1FCCC 1PDXA 4H2AA 3VTVA 1OEYJ 3MP9A 2KC2A 4KGRA 3PSEB 5EDSA 2O6VB 4LNNA 4HJGE 3BYTB 3N1XC 2UYZB 3LXFA 1VDVA 4GLSC 1ZP0B 2WXIA 4MJSB 1P9DU 3NRZA 2AEHA 4L2YA 1IBXA 2ZW1A 4NJCA 3O65B 1XLOA 4HXDA 3BYYB 1MHXA 4G11A 3AU4A 3AE7B 2OOBB 3Q3OC 4NZLB 4MGKE 4LCDE 1UD7A 4CQNA 1SJED 3W5UB 2EKEC 1JWAD 2IPKD 2FIDA 4IKGA 3Q8FA 3BY4B 1E0ZA 4MSQB 5CHVC 3IFWB 4MJSA 2LASA 4OZBA 3OAWA 4REZA 3NS1A 3N30A 3ZIMA 1IGCA 2INDC 3P1MA 2X38A 2FUG1 2HJ8A 2BWFA 1WWTA 1GOZA 4WIPA 1P98A 3L10B 4LTUA 5J2RA 1DYQA 2IGDA 5T8IA 2QEJC 4K7UA 3TEYA 4XE0A 3ZVVA 2KQSA 2O6VA 1PGXA 3B2FA 4ARCA 4XGAB 2AQ3B 5KHOA 2Y3AA 3QJZA 3EFCA 3TL5A 3B2GA 2XN9C 2GMIC 4J6IA 5HI1A 1YJJA 3M95A 3W1YA 3W5VB 3UQAA 2Z8LA 2NVUI 4K3CA 5L95C 1C4CA 3R7QA 2FBWB 3AE1B 2DX5B 2L00B 2JZPA 5GMVA 1F1HA 2DYBA 1EU4A 2IZVB 1J8CA 2CKHB 3KUCB 1Q1OA 4ANUA 4IM3A 3IVFA 3SFEB 2EKIA 1T0SC 4C4VB 4B95A 4RGNA 1L0XB 3Q3MC 3R2IA 3MFGA 2NTTA 3NG0A 3ZXVA 3KWLA 1SBBB 2AX5A 2RDHA 4PYUA 2J0MA 3H9DA 1WGGA 2N9XA 1V1PB 2BGFA 3UINB 5TR5A 3N1YC 4HCNB 3OG5A 2TSSA 1WMHA 1WXMA 1LQBA 3W1SA 1C4PA 1YX6B 2JY6A 3N32A 3ABVB 3MC0B 2KFKA 1KF6B 4YXDB 2G45B 1V8CA 3AEAB 2JQRB 3I57A 3RULA 4DHJB 4RNAA 3ZYYX 4P7IA 2MBBB 3GE8C 2RD0A 1C3TA 4C56C 3AB5A 3B1LX 1JWUD 1WMHB 2KDBA 4HKZE 4XWWA 1QZEA 1KTKA 1WFYA 3DBHI 1GB4A 3BWUD 2BS3B 3WALA 2L7RA 4MT5A 4FLHA 2FNJB 3NZSA 4JIOU 2PIAA 3U8ZA 2KC1A 2O2VA 1WE6A 3B9JA 4LNOA 4PS7A 2Y5CA 3A9JB 2NMQA 4KVGB 4XX5A 3WAPA 3B0AA 1R4MI 2MLBA 1WJ4A 2IJ0A 1BMLC 4IM0A 1DOXA 1EU3A 4KKJA 4MH0E 1JWBD 1RWSA 1AN8A 1MI0A 4XYCA 4FA6A 3ZNGC 1E8ZA 3N9YC 4WJNA 2ASQA 4RMAA 2KD0A 2LVPA 2M17A 4HRSA 2LHEA 2LRUA 3ZQ4A 2RDBC 4MEMA 1I4GA 2JWZA 1CJEA 5CX3A 3SU8X 4HJKA 4GDKA 4E74A 5BMGA 3AMZA 3KUDB 1YMHE 3E9SA 3RI7C 4ICVA 3TJPA 1F2RI 2CS4A 2WDQB 4LDTB 1JWSD 4WQMA 3H8HA 1U4AA 2BB6A 1WGDA 2HTHA 1LXDA 2WU5B 1I4PA 2LD9A 3ZRCA 3Q69A 2WDVB 1BT0A 2W3SA 1NENB 2M4NA 1WGHA 2K39A 3EHVA 3GZNI 3PZ8A 1V9JA 1JQ4A 1I4QA 2LGSA 3HRDD 1MJDA 4A8XC 2WNMA 2LWPA 2Z0EB 1JALA 4IWPA 1E8YA 4W9IA 4OVVA 4Q2JA 3L0WB 1I42A 5D3IB 1WIAA 4GXBA 2FCQA 3ZDTA 2IO0B 4FADA 2KLGA 2FCMA 2WX0A 5IOIA 3RD2A 3AEEB 3OLMD 3GP7A 4XWTA 1XQQA 4W9DA 2XNAC 3QARA 2N1VA 4HEA1 2M19A 2L0FA 2DAJA 3KVFB 2KWUB 3NVVA 4I6NB 1SGHA 1FNUA 1C77A 1UF0A 4BBNC 3ZXRA 3CWIA 4M8MA 3AH7A 2V3NA 2X8XX 3SFDB 2V3PA 2OEDA 2K3UA 3RNGC 2DLBA 4ZDVA 3P4QB 1DOYA 1DGJA 2BYVE 4IDIA 2DBYA 3HUIA 5LNK1 3DVGX 4CO7A 2WGSA 2G4DB 4WJQA 3NZ3A 4A90A 3SDLC 2R2QA 1WGKA 4WURA 3ZGZA 4II3B 3PRMB 5KHQA 2GBMA 4I6LB 1SF0A 1J7CA 2KAJA 2WXLA 3DBRI 2D3BA 1OGWA 1GNUA 4ITKA 4ZHPA 5HG2A 4C4VA 3LDZE 3Q3NC 4M0WB 2K8BA 1FM0D 1T6BX 4YSYB 1BUIC 4US9A 1A70A 5L83A 4ARIA 3ZTCA 2WXHA 1WRDB 2BVCA 3Q3FA 5JHAA 3AE4B 3KYCD 1SJHD 2JSVX 4TV3A 2KT7A 2M0AA 2QJLA 1QOGA 3RNCC 3BVZA 4DXGA 3JSVB 3MTNB 3PLUA 2KX3A 5TSSA 4US8A 2AWTA 2DYMA 3R8BA 4EZJA 2MBHA 1K52A 1ZGUB 2FCSA 3GB1A 3DWMA 4ZYNA 2KMAA 4W9GA 5G2NA 1WM2A 2LRWA 2AL3A 1I4RA 3RPFC 3ML8A 4JWUC 3T8MA 1L4DB 2J53A 2E6XA 4KIKB 1D4BA 3UI3A 4YSZB 3P4SB 1RYJA 1V80A 2UU7A 2MBEA 2PW9A 3U4EG 3VRAB 2KNBA 3CIRB 4RF1A 2HJ1A 3KUZA 3VAWA 3RYTA 3VTWA 1RFKA 1VZ8A 4HCPB 2I1JA 1HXYD 2QMTA 2LHDA 3RFZB 2XK5B 4NNJB 1TYGB 1SIJA 4KDLB 4ZRIA 3I5JC 1L6VA 1TY0A 2JZZA 2KHWB 3W2DA 3BVMA 1WE7A 2KDIA 1SB3C 2N9PC 1WF9A 1KM7A 4JQWC 1SEBD 3CF6E 3Q8EA 4HPMB 4BFRA 3L16A 1R4NB 5BYRA 3Q3JA 2CJOA 4DHJD 4TUUA 3AULA 2G1EA 3P63A 3TSSA 4HLEA 1E8XA 1E7VA 1YIWA 4OHJA 2PEAA 4GIVA 1R4NI 5AZGA 1WZ0A 5FR6A 4MH8A 4DDGD 4S0RA 2GLSA 2CU1A 2QILA 3RZWC 5EE1A 3DBSA 3OWEB 2LJ5A 3HIZA 3ZJVA 1PUTA 5FKAC 1EF5A 4R3DA 5H92C 1Z5SB 2JYTA 1D3ZA 3M3JA 5BYQA 1OEYA 2ONQA 1UBQA 3MC8A 3JVZX 2L32A 3ZO5B 3GS2A 3Q8BA 3WA0A 1WI0A 4URKA 4F7ZA 5E6NA 1JWMD 3APDA 4J3OD 1FNVA 2IBIB 1L0VB 1PGAA 3A1QB 2JT4B 2WX1A 4WH4A 2PVGC 1SXTA 4LDTD 2WDTB 1ZW7A 3DVNV 3HM6X 5LLIA 2Y5BB 1I4XA 4OVUA 2BW2A 3L4PA 4WAFA 5C23A 2KTRB 3RZFA 4L1BA 4ACFA 2D10A 2N7JA 4F1SA 1C76A 4EUTA 1VRAB 4EKUA 3GZNB 4JLCA 2K0PA 4G3XB 4WJPA 1XO3A 1P3QU 3DOWA 2BB5A 4FJZA 4ZOHC 3T3OA 4O1NA 3PHXB 1MG4A 2DAFA 2V4LA 2WXPA 1QQRA 2KFJA 3BK2A 3BK1A 1E5WA 4ZRQA 3VRBB 1QT9A 1STEA 3ZLZA 2RDGA 2C7HA 3TEXA 4W9HA 3CSFA 4WQOB 4BOZB 1L4ZB 1WR1A 2D2QA 1EO6A 1YD8U 4HVBA 3A4SC 4GOCA 3PREA 1K53A 4ZYSA 4E3CA 2O6VD 1ZKHA 3TUOA 3HM3A 2ZVOA 4E71A 1OQRA 1N61A 2VZKD 2DNFA 2WXMA 1SIFA 1HZ6A 1E7PB 1XD3B 3TCAA 1WH3A 2M0XA 1Z2MA 1C79A 4A20A 4YT0B 2KDFB 1Q10A 2KX0A 4USAA 5LXIB 1K8RB 3TEZA 3ZJTA 2G9HD 2YLMA 2MH7A 4FBJB 4N6EB 2PJHA 4K3BA 1ET6A 3L54A 1TKGA 1TS3A 3NHEB 4FULA 1ZE3D 1D5XC 4P1BC 3MJ5A 4AJWA 2WHIA 2MBQA 4RCOA 1PYWD 4IW0A 2N9KA 1DOIA 3LB8C 3HVZA 1FXTB 1D5ZC 3H7PB 1XF5L 2IY0B 1K51A 3PHWB 4S17A 5FK9C 4IUMB 4IC7B 4W9LA 1GC6A 4DWFA 1T0YA 2WYQA 5EE0A 1VCBA 2JU6X 2GBNA 2L0TA 1SE3A 4DHZE 2M1MA 4GDLB 2C9WB 4A3PA 2ON8A 2DYOA 1V2YA 2L3ZA 1WR6E 2MJ3A 4XC2A 3VXWA 3PPAA 3C8YA 2EELA 1P1AA 3SEBA 4RGTA 2DZIA 3ENEA 2NTSA 1GPXA 2YEPF 2LXCA 2KLCA 2KQ7A 3A9KB 4FJYA 3TIXA 1WRIA 1CK1A 3PRPB 3RNAC 2Y5PA 1FEHA 4TQ1A 2MWSB 4BKTA 3W1SC 4XZ4A 4KZ0A 3KQ4A 2KJHB 3RCZA 3AI5A 2BWES 3M62B 1FMAD 4KGTA 2LVQA 1SE4A 3H7PA 3V60A 4AWJA 2BPSA 3Q8AA 3VH4B 3NVYA 1TY2A 2KTRA 3IG3A 3LYYA 1TS2A 3HHMA 1E9MA 1C1YB 4K7SA 2FIFA 1J0GA 1TIFA 1I4HA 4KSLC 5E6JA 1GB1A 2O2VB 5EE9A 4MM3B 1VZ7A 3R2TA 1N60A 2LGIA 2IO3B 2PKOA 2AQ1B 4KKIA 2CJNA 1PQSA 1UZXB 3H7SA 3IBEA 1VJKA 3FAHA 4JX1C 2N4FA 4JE3B 4M01A 2K9XA 4BVUC 5CHFA 4PK1A 4G0NB 5AZFA 2J4XA 2B3AA 2BS2B 3AU5A 5JHBA 4MGZE 1HE8A 2ZCBA 1SE9A 3TEWA 2JX5A 2RGFA 3PLVA 1F77A 4LK0M 4W9KA 3VUXA 2LZ6A 2N9EB 2VH2A 3ML9A 1F9JA 1OFFA 4OVZA 3IXSA 2L05A 2KN5A 4TSSA 1AYFA 2RPVA 2ICIA 4M00A 1QILA 2WXOA 1MHHE 2JF5A 1B9RA 5D2MB 3DBHB 2VRRB 3APCA 4WWOA 2WXGA 2GOWA 1F52A 5JH5C 2LUEA 3AECB 4XDCA 2WWZA 1FCLA 3QHTA 1KLGD 1MG8A 5J18A 2N7DA 1FFUA 2WXRA 2K8HA 3QX1A 5AZHA 1YN4A 3ALBA 5BMIA 1KJTA 4P1CC 2KDEB 3ONSA 3J9CA 2KVRA 5CTRC 2D11A 2JVCA 2W3RA 4IWQA 2MBOA 4AOFA 4RM9A 3IHPC 2MRPA 2PE6B 2KO3A 3VHTC 2MEKA 3LJ3A 4AUQC 5C3JB 2V3SA 5E6OA 5AEKB 1YJIA 3AE5B 3DVGY 3A9JA 3PTFC 2OHFA 4QAYA 1I35A 4BKSA 5H8YE 3T9LA 5C2TB 1V97A 3WAOA 3V05A 1N5XA 1RFAA 1XEEA 3N20C 2D3AA 4C7YA 3A4RA 1WXAA 3SHQA 2IYDB 1Y8RC 4DHZB 3AEDB 3ZNID 1YQBA 2DWQA 2LJIA 3P42A 3IT4B 1TGZB 5LXHA 1LO5D 1A5RA 5IAAC 1JCKB 2WS3B 3AEBB 1UELA 1KH0A 1IPGA 4WAAA 3AE2B 2BKRB 4EZLA 5GXGB 1MVKA 3EA6A 3VR9B 3A1QA 2NPTA 2NR2A 4KZCA 4N9F4 2CHZA 2DHZA 2YEPB 3RNBC 2J42A 4B6WA 2KVZA 2PMVA 1CZPA 1UWXA 1L5PA 1V81A 4C80A 1HTOA 4WWPA 2K5PA 1N5WA 1WXVA 2UWQA 2B76B 2V1YA 2BTEA 2BYFA 1E7UA 2PTLA 2R2OA 2VH1A 2CHWA 3PGEA 4NY0A 1ISNA 1WM3A 4GU2A 4B0EA 5AUIA 2RMMA 4AQ7A 2JUOA 3UIPB 2L76A 3DHGC 3TBLD 2KK8A 3H6NA 1GUAB 2ACZB 3ECIA 4CYEA 3FC4A 2LI5A 2C60A 3U7DA 2D3GA 3A33B 2K6DB 1PGBA 1WGYA 3SR6A 1UNSA 2JRHA 2K8CA 2D5GA 4HDOA 1D6EC 2INPE 4M8NA 1L0YB 1VLBA 2BYTA 1HTQA 2YVCA 1ZOYB 3VDZA 4HPLB 3ZUNA 4HK2A 3URYA 1MPEA 4RGOS 1E10A 4DXFA 1FO4A 1I7HA 2I38A 4PS3A 4EFOA 5HKHA 3JSVA 3FILA 3VH3B 3TMPB 5HHDG 1ZDVA 2JPHA 2CHXA 4LNFA 2KQ4X 2BBCA 4NAMA 3WAMA 4NJ7A 2DZJA 3AE6B 3U7ZA 3NJTA 4BBNF 2MCNB 1JRUA 5BYSA 5D7GA 1K50A 4F8CB 3AN1A 3DCGA 1TZOA 1KLUD 1ZXIA 4ASWC 2XBBC 4EZKA 3ZJUA 4TQ0A 4FHKA 2H88B 3BVGA 2MP2B 4M02A 4P6VF 4N58A 3I3TB 2GRIA 3AV8A 3V6EB 3X23A 2XK5A 3Q14C 3QAQA 1ZXHA 4DK5A 3AEGB 1ROEA 3ZDMC 2HTME 3EECA 4A9AA 3EUB2 4YL8A 3CMMB 3NUHB 1JROA 4NAWA 3V6CB 1XXGA 3BIID 1E6EB 4MM3A 1FIQA 3QWZB 4MGYE 1OQYA 4LJOB 1HQRD 4X57B 4M0WA 1V49A 1XLNA 1QLBB 4GDKB 5J17A 4HKQA 2KN4A 2ZVNA 4YTMB 2C7MB 1C4AA 3V3XA 2A4ZA 3T3NA 2A5UA 5D6JB 1IYFA 2INCC 2JYEA 4MACA 2QHOA 3HVDA 3L08A 3MC9A 2H89B 2J7QB 2V9HA 3OJ4B 1XT9B 2W82A 1NYQA 1M94A 1T0QC 3R66C 1VD2A 3H1UA 1YX5B 4KX6B 2IY1B 1IUEA 2OJRA 4L23A 4YWGG 5IP4D 2LMCA 2Q5WD 3VVWB 3ZNHB 2MHJA 2FAZA 1WGRA 3Q8CA 2RPQA 2XEWA 1YN3A 1J7AA 4OZCA 5DCNA 5IA7A 4DQOC 2MP2A 2KMCA 3M63B 2HE7A 4IOIE 3BZDB 1PFDA 2ZCCA 4NPNA 1S1QB 1HEZE 3DBLI 2WU2B 3PRZA 1FXIA 2QSDA 4W9EA 2REXA 4GN1A 1WJ6A 1WZ3A 4BOSC 1NYRA 1ZDXA 2KANA 1IGDA 2FE8A 3VUWA 5DPTA 2BS4B 5G5GA 2KYWA 2MX2A 4IG7B 1V86A 2KKCA 2ZJDA 4JPSA 1FRDA 1SE2A 1YN5A 4TMAB 1QKZA 4HDQA 3QQ8B 1EM7A 2KWCA 1E8WA 1VZ6A 1V1OA 1XLQA 4AJYB 3PZ7A 2PLPA 1OQQA 3AM9A 2KOXA 4DXAB 2RR9A 5G55A 1J7BA 3DBRB 2G4SA 1FNWA 2W9NA 1KFYB 2JRIB 3UQBA 1H4RA 1TJEA 3PT2B 1YNTE 4AS1A 3B08A 4N59A 1EUVB 1UH6A 2V4IB 3W9CB 4UDUC 1YOVB 3GE3C 3RNEC 3PZDA 4BAXA 3RMKC 2WQYB 4KSKC 2Z59B 2PE9A 1WX9A 3R7RA 1GG3A 2D3CA 1FD6A 1ET9A 1FXAA 1WYWB 2ZNVB 5C1ZA 1RLFA 4ANVA 1F2RC 2JXXA 3L13A 2AYOB 2L83A 3QK0A 3APFA 3I63C 4KGSA 1JMLA 1T3QA 2LFIA 3EGRA 3WCQA 4GMVA 1WYGA 3MHZA 2KACA 3P2BA 1KRHA 1IP9A 2LUMA 3AXCA 3PO0A 3VQIA 1RAXA 1M4VA 3MHSD 4ANXA 3DDCB 1EWYC 3IAM1 3RN9C 4KIKA 3D32A 1XCQL 4CHKA 4FJVB 1EF1A 1OTRB 2EMSA 5DPWA 3KWVA 4W9FA 4HPPA 2GBKA 1AARA 2QCZA 2L52A 1N62A 4II2B 4PT5A 3KLSX 2EMTA 3WANA 2CR5A 2KTFA 1WX7A 4C00A 4OZAA 2QIEB 2M8SA 2L8JA 4NQKE 1L2NA 2I1KA 1WJNA 3QCAA 2L1AA 1S3SG 4MGIE 4ICUA 2JXTA 2IO2B 3SD5A 1JW9D 1XLPA 2DZMA 4ZRKA 3AE3B 3U2SC 3VFKA 2LGDA 2SEBD 2ZEQA 4EEWA 1TS5A 3AE8B 4IM2A 2N7EA 1TKEA 2PPHA 3AEFB 1P0RA 2ZPNA 1CMXB 4KDIC 3FILB 4WWMA 2BT6A 4ZRPA 5E6PA 1AW7A 3QIJA 4LLGM 2ZZPB 2N0SB 3IT6B 1QOFA 2KWDA 2KMMA 5IKCM 4NQLB 3ZNZB 1UUPA 3ZW3A 1HZ5A 4I6PA 4DDID 4K81A 4GB9A 4PYZA 2D07B 2KJRA 1Q0WB 2ZPYA 1H8CA 1TKYA 4D2KA 4EOYA 1C9FA 3GOEA 1Q5WB 3E56A 4WJOA 4DBGA 1NBFC 3HK0A 2R61A 2NCNA 3NVWA 3KYDD 4FHJA 1G6JA 1L6UA 3ZRFA 2HD5B 5DPRA 3PV1A 5IN7A 1UBIA 2KWVB 3ZKJC 1T5XD 1WJUA 1B1ZA 2NBVB 2K1FA 5IO9A 4A3OA 3VTUA 4P16A 2MA9B 4GGQA 5D94A 3A9KA 3Q2AC 2LGXA 2IGGA 1KOTA 3CSTA 4K7WA 3KW5B 1TZ1A 1P7FA 1WXQA 1TT5B 1X1MA 3MJWA 1WY8A 2PVOD 1JRPA 4LNIA 5AUKA 3JYUA 1YQ4B 4GSWA 1R7SA 2WXFA 4AP4C 1GAQB 1N63A 2GI9A 5BO4B 1UGJA 4NAWB 4ANWA 3N3KB 3NOBA 4RF0A 4HROA 1RM6C 3EC8A 2LGYA 2DENB 2LEKA 3Q6BA 2WXQA 2GB1A 1N6ZA 4JL9A 2W55A 1V6EA 2QC8A 5JXVA 2WXNA 1ACCA 1XCTL 4EE2A 1GC7A 1AWDA 2GBRA 2N9LA 3N1ZC 3R3MA 2V0GA 1YQ3B 1P7EA 2ZW0A 3EFUA 1ZPSA 2M56B 3BINA 1FPYA 3ZTDA 1L7YA 1WSPA 2QDFA 4W9CA 4A6QA 2BF8B 3P4PB 2KDMA 1LM8B 1TTNA 5DPSA 3O13A 4B9KA 2SAKA 2E3TA 2NS5A 4BKSD 2BYEA 5HFYA 4ZRJA 1TS4A 2NBWB 1V5TA 2NPTB 2HDEA 5FR3A 5EE3A 3RUIB 4MELA 2KXJA 2J52A 3WIMA 3C19A 1GJZA 3V61A 1QF6A 4G50A 1LGRA 3IAS1 2JWUA 2IDYA 5G5HA 1NDDA 1Y56A 1NVID 4OW0A 2WLBA 4JGHB 3ETRA 4ZHOA 1YJ1A 1LFDA 2C5LC 3S2AA 4BZAA 3DHIC 3RT3B 3AE9B 3I9V1 3KH0A 1UGMA 2IGHA 2G3QB 4XDDA 2ZNVC 3NZUA 1NI2A 3OJ3A 2WP9B 2J0KA 3U30A 4GDLA 2AQ2B 1J19A 1V1PA 2J0JA 4MDKE 3VUYA 1ENFA 4YTNB 1UWMA 2WXKA 1BXTA 2OJWA 4W9JA 1CQVA 1QOAA 3DHHC 1R4MB 4LNKA 3U52E 1VR9A 4B0MA 2WDRB 2FUHB 3JW0X 2WXJA 4A55A 2LXAA 1NI3A 1V5OA 3UGBB 2MJEA 1WX8A 4BKGA 2BQQA 3DQVA 1F0ZA 3QA8A 1ZUD2 2BKFA 5I4DA 4TKNA 2K25A 4YTPB 5CHWA 3VR8B 3V62A 2K22A 5JZEB 4NJ6A 2MQJA 4HWIB 3X0WA 4C7ZA 2MW5A 1FRRA 1NEKB 2MJDA 2FCNA 4RGMA 3QC8B 3UIOB 4FXCA 2DZKA 2CU3A 2W54A 3PS6A 1D5MC 4K1RB 3L17A 2AL6A 1ESFA 3DPDA 3DVNU 3K9OB 1C78A 4MSMB 4LJPB 3DBLB 4YSXB 5BMHA 3NY5A 2INNE 3NS8A 2N1WA 2MSED 3NVZA 1FFVA 4PS8A
chains in the Genus database with same CATH topology
1SF0A 1J7CA 1HA5A 2V4IB 2KAJA 2WXLA 3W9CB 5MPOA 2J4XA 4UDUC 1EWCA 2BS2B 4ITKA 4ZHPA 2JX5A 5HG2A 3TEWA 1F77A 4LK0M 2WQYB 2I2YA 1FM0D 1T6BX 4RFBA 4YSYB 1SSNA 4JWSC 5D3DA 1ET9A 1FD6A 1OFFA 1QOBA 1BUIC 4OVZA 4US9A 1FXAA 1A70A 3IXSA 1IBXB 4TSSA 1AYFA 2RPVA 2ICIA 1QILA 2WXOA 1MHHE 1B9RA 4ARIA 1F2RC 2VZKB 4RH6A 3DWGC 2L83A 2WXHA 3P4RB 2WXGA 4KGSA 1FCCC 1JMLA 1PDXA 3AE4B 4H2AA 1T3QA 2LFIA 3EGRA 3MP9A 1SJHD 2JSVX 4KGRA 2M0AA 2QJLA 3WCQA 3AECB 4XDCA 1QOGA 1FCLA 3BVZA 4DXGA 1KLGD 4HJGE 1WYGA 3BYTB 3MHZA 1FFUA 2KACA 2WXRA 5TSSA 4US8A 3LXFA 2DYMA 1VDVA 1KRHA 1ZP0B 2WXIA 1YN4A 4GLSC 3R8BA 1K52A 2LUMA 3NRZA 3PO0A 5BMIA 3GB1A 3VQIA 1M4VA 4L2YA 1IBXA 2ZW1A 3DWMA 4NJCA 1EWYC 3IAM1 1XLOA 3BYYB 3J9CA 1MHXA 1I4RA 1XCQL 3RPFC 3AE7B 4JWUC 2W3RA 1L4DB 4NZLB 2J53A 2E6XA 1D4BA 3UI3A 4YSZB 3KWVA 2MEKA 4CQNA 3P4SB 1RYJA 5C3JB 1SJED 3W5UB 1JWAD 1YJIA 2IPKD 2PW9A 3AE5B 3U4EG 2L52A 1N62A 4PT5A 3KLSX 3VRAB 4IKGA 3Q8FA 1E0ZA 3CIRB 4OZBA 4RF1A 2OHFA 4REZA 3NS1A 4OZAA 5H8YE 2QIEB 1RFKA 1VZ8A 1HXYD 2QMTA 5C2TB 1V97A 2LHDA 3RFZB 1IGCA 1N5XA 1XEEA 3V05A 3P1MA 2X38A 1TYGB 1SIJA 4C7YA 2FUG1 1L6VA 1TY0A 3W2DA 3BVMA 1WWTA 1GOZA 1SB3C 4WIPA 2L1AA 3AEDB 4LTUA 2JXTA 1DYQA 2DWQA 2IGDA 5T8IA 2LJIA 2QEJC 1SEBD 3P42A 1JW9D 1XLPA 3IT4B 3TEYA 4XE0A 1LO5D 3Q8EA 1JCKB 3AE3B 1PGXA 2WS3B 3B2FA 5BYRA 3U2SC 3AEBB 4ARCA 1KH0A 2CJOA 2SEBD 3AE2B 2AQ3B 2Y3AA 1TS5A 2G1EA 3AE8B 3P63A 3TSSA 5GXGB 1MVKA 3B2GA 3EA6A 3VR9B 1TKEA 2XN9C 3AEFB 5HI1A 1YJJA 4OHJA 3W5VB 2YEPB 3FILB 4WWMA 2BT6A 2Z8LA 2J42A 4ZRPA 1C4CA 2PMVA 4MH8A 1AW7A 1CZPA 1UWXA 1L5PA 4C80A 2QILA 2FBWB 5EE1A 4LLGM 2K5PA 3OWEB 1N5WA 2N0SB 1PUTA 3IT6B 5FKAC 3ZJVA 4R3DA 3AE1B 1QOFA 5H92C 2B76B 2BTEA 2JYTA 2KWDA 2JZPA 5BYQA 2KMMA 2PTLA 2ONQA 1EU4A 1UUPA 1HZ5A 4B0EA 5AUIA 2RMMA 4AQ7A 3SFEB 2EKIA 2L32A 1TKYA 4D2KA 3GS2A 3Q8BA 4RGNA 1C9FA 2ACZB 1L0XB 3E56A 3R2IA 3FC4A 3MFGA 2R61A 1JWMD 4J3OD 2NTTA 1FNVA 3NVWA 1PGBA 3KWLA 1SBBB 2AX5A 1L0VB 1PGAA 2RDHA 1L6UA 3SR6A 1UNSA 1V1PB 2D5GA 1D6EC 2INPE 4WH4A 2TSSA 2PVGC 1L0YB 1VLBA 1T5XD 1SXTA 1B1ZA 2BYTA 1ZOYB 3W1SA 1C4PA 3ABVB 4P16A 3MC0B 3URYA 1I4XA 1MPEA 2BW2A 3L4PA 4WAFA 4RGOS 1KF6B 4YXDB 1E10A 4L1BA 4DXFA 1V8CA 2IGGA 1FO4A 1I7HA 2I38A 3AEAB 2JQRB 3I57A 3FILA 5HHDG 1P7FA 1ZDVA 2N7JA 4RNAA 1C76A 1WXQA 3ZYYX 2KQ4X 2BBCA 4C56C 4NAMA 1VRAB 2PVOD 3AB5A 3AE6B 1JWUD 1JRPA 4HKZE 3U7ZA 4XWWA 2K0PA 5AUKA 1KTKA 5BYSA 1GB4A 3BWUD 1YQ4B 2BS3B 1XO3A 5D7GA 4MT5A 2BB5A 1K50A 3T3OA 4ZOHC 4O1NA 3AN1A 1TZOA 1KLUD 1R7SA 2WXFA 1GAQB 2PIAA 1ZXIA 1N63A 2WXPA 1QQRA 2GI9A 3BK2A 3BK1A 1UGJA 4NAWB 4ZRQA 3VRBB 3B9JA 1QT9A 3ZJUA 4RF0A 1STEA 4HROA 2RDGA 1RM6C 4TQ0A 2H88B 3BVGA 2Y5CA 3TEXA 2LEKA 2WXQA 2GB1A 1L4ZB 2NMQA 4P6VF 4N58A 2GRIA 2W55A 3AV8A 5JXVA 1K53A 1ZXHA 1ACCA 1XCTL 2WXNA 4EE2A 2IJ0A 1BMLC 3AEGB 4ZYSA 1AWDA 1ROEA 2N9LA 1DOXA 2V0GA 3TUOA 1YQ3B 1EU3A 1P7EA 2HTME 4KKJA 2ZW0A 1JWBD 1ZPSA 2M56B 1RWSA 1AN8A 1MI0A 4A9AA 1OQRA 3EUB2 1N61A 2VZKD 2WXMA 3NUHB 1JROA 1WSPA 3N9YC 1HZ6A 1E7PB 1XXGA 3BIID 1E6EB 4A6QA 1FIQA 3P4PB 1C79A 4YT0B 1HQRD 1Q10A 4HRSA 4USAA 4M0WA 2KDMA 2LHEA 3ZQ4A 1XLNA 3TEZA 3ZJTA 1I4GA 1QLBB 3O13A 4GDKB 1CJEA 2G9HD 2SAKA 4HKQA 2E3TA 2MH7A 2KN4A 4N6EB 4YTMB 5BMGA 1C4AA 5HFYA 3AMZA 1TS4A 1YMHE 3E9SA 1ET6A 3V3XA 5FR3A 2HDEA 1TKGA 1TS3A 5EE3A 3T3NA 1ZE3D 1F2RI 1D5XC 2WDQB 2JYEA 1JWSD 4MACA 2J52A 3MJ5A 4WQMA 3H8HA 1QF6A 2BB6A 2WU5B 1I4PA 3HVDA 4RCOA 3IAS1 3Q69A 1PYWD 2WDVB 2JWUA 2IDYA 2N9KA 5G5HA 2H89B 1Y56A 1NVID 4OW0A 1DOIA 3LB8C 3HVZA 2WLBA 2W3SA 1D5ZC 1NENB 3ETRA 1XF5L 4ZHOA 1K51A 5FK9C 2W82A 1NYQA 3AE9B 3I9V1 3PZ8A 2IGHA 1JQ4A 1I4QA 3HRDD 4KX6B 4XDDA 4A8XC 2WNMA 1IUEA 5EE0A 4L23A 2JU6X 1JALA 4YWGG 1SE3A 2LMCA 2WP9B 2Q5WD 4GDLB 2ON8A 2DYOA 4Q2JA 2AQ2B 3Q8CA 1V1PA 2MJ3A 5D3IB 1YN3A 1J7AA 1ENFA 4OZCA 4DQOC 3C8YA 2EELA 4YTNB 1UWMA 3SEBA 4RGTA 2WXKA 1BXTA 2NTSA 3BZDB 4IOIE 1GPXA 1CQVA 1PFDA 1QOAA 3U52E 2YEPF 1HEZE 2WU2B 1VR9A 4B0MA 2WDRB 3AEEB 1FXIA 2QSDA 2WXJA 3GP7A 4A55A 1NI3A 4XWTA 1WRIA 1CK1A 2MJEA 2XNAC 2Y5PA 1NYRA 1ZDXA 1FEHA 4TQ1A 1IGDA 1F0ZA 2FE8A 2BS4B 1ZUD2 4HEA1 2M19A 5G5GA 3KQ4A 5I4DA 4YTPB 3NVVA 1FNUA 1C77A 1FMAD 3VR8B 4JPSA 4KGTA 2K22A 1SE4A 3CWIA 1FRDA 1SE2A 1YN5A 4TMAB 3Q8AA 1QKZA 3AH7A 3NVYA 1TY2A 4C7ZA 3LYYA 1FRRA 2MJDA 1NEKB 1TS2A 2V3NA 1E9MA 1EM7A 2V3PA 4RGMA 3SFDB 1VZ6A 2OEDA 1V1OA 2K3UA 1XLQA 1I4HA 4FXCA 5E6JA 2DLBA 3PZ7A 1GB1A 2PLPA 1OQQA 2CU3A 2W54A 3AM9A 5EE9A 4MM3B 3P4QB 1VZ7A 1DOYA 1DGJA 4IDIA 1D5MC 1N60A 3R2TA 2LGIA 1J7BA 1ESFA 2DBYA 3HUIA 5LNK1 2PKOA 2AQ1B 4KKIA 1C78A 2CJNA 3NZ3A 4A90A 1FNWA 4YSXB 5BMHA 1KFYB 2INNE 1VJKA 1TJEA 1WGKA 4WURA 1YNTE 3ZGZA 3FAHA 4AS1A 4JX1C 3NVZA 4N59A 4JE3B 2K9XA 1FFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF0 A;  2DWQ A;  1J7C A;  1WXQ A;  3ZYY X;  2KAJ A;  3W9C B;  1JW9 D;  1XLP A;  5MPO A;  2BS2 B;  2PVO D;  1FO4 A;  4ITK A;  1NYQ A;  3AE9 B;  3AB5 A;  4ZHP A;  2JX5 A;  3AE6 B;  1JQ4 A;  3AE3 B;  1JRP A;  5AUK A;  2WS3 B;  3HRD D;  3B2F A;  2WQY B;  1YQ4 B;  2BS3 B;  3AEB B;  4KX6 B;  1XO3 A;  2CJO A;  1IUE A;  5EE0 A;  1FM0 D;  3AE2 B;  4ZOH C;  3AN1 A;  1JAL A;  4YSY B;  1R7S A;  4JWS C;  2G1E A;  3AE8 B;  3P63 A;  1OFF A;  1QOB A;  1GAQ B;  2PIA A;  2WP9 B;  1FXA A;  1N63 A;  1ZXI A;  2Q5W D;  4US9 A;  5GXG B;  1A70 A;  3B2G A;  3VR9 B;  1TKE A;  3VRB B;  3AEF B;  1AYF A;  1QT9 A;  3B9J A;  1YJJ A;  4HRO A;  2MJ3 A;  1RM6 C;  1B9R A;  2H88 B;  1J7A A;  3W5V B;  2Y5C A;  2LEK A;  4WWM A;  3DWG C;  2BT6 A;  2L83 A;  3P4R B;  4YTN B;  1UWM A;  4P6V F;  4N58 A;  1PDX A;  3AE4 B;  1CZP A;  1GPX A;  1T3Q A;  1L5P A;  1PFD A;  1QOA A;  2W55 A;  3AV8 A;  4C80 A;  2FBW B;  5EE1 A;  2WU2 B;  2K5P A;  2QJL A;  3WCQ A;  3AEC B;  1N5W A;  1QOG A;  1PUT A;  2N0S B;  2WDR B;  3AEE B;  5H92 C;  1FXI A;  1QOF A;  3AE1 B;  3AEG B;  2B76 B;  1WYG A;  1AWD A;  1ROE A;  1DOX A;  1NI3 A;  1FFU A;  1WRI A;  1YQ3 B;  2HTM E;  2MJE A;  4ZHO A;  4US8 A;  2KMM A;  3LXF A;  1JWB D;  1KRH A;  1ZP0 B;  1RWS A;  1VDV A;  1NYR A;  2M56 B;  4A9A A;  3PO0 A;  1OQR A;  3EUB 2;  3NRZ A;  1N61 A;  1F0Z A;  5AUI A;  1JRO A;  2BS4 B;  3DWM A;  1E7P B;  1ZUD 2;  3BII D;  3SFE B;  1E6E B;  2EKI A;  2M19 A;  1EWY C;  5G5G A;  1TKY A;  1FIQ A;  3P4P B;  4YT0 B;  1XLO A;  4USA A;  2ACZ B;  3NVV A;  4HRS A;  4YTP B;  1FMA D;  3RPF C;  3VR8 B;  3AE7 B;  1XLN A;  4JWU C;  2W3R A;  2K22 A;  3FC4 A;  1QLB B;  3CWI A;  1FRD A;  1CJE A;  2E3T A;  2MH7 A;  3AH7 A;  4YSZ B;  3NVY A;  3P4S B;  4N6E B;  4C7Z A;  1RYJ A;  3NVW A;  3KWL A;  4YTM B;  5C3J B;  2AX5 A;  1L0V B;  3W5U B;  1FRR A;  1NEK B;  1JWA D;  1L6U A;  1YJI A;  1E9M A;  2MJD A;  3AE5 B;  3AMZ A;  3SFD B;  2L52 A;  3SR6 A;  1N62 A;  3VRA B;  1XLQ A;  4FXC A;  1E0Z A;  3CIR B;  1OQQ A;  2CU3 A;  2W54 A;  3AM9 A;  1TKG A;  5EE9 A;  5EE3 A;  3P4Q B;  1DOY A;  1DGJ A;  2PVG C;  2OHF A;  4IDI A;  1N60 A;  1VLB A;  2WDQ B;  3NS1 A;  1J7B A;  2DBY A;  3HUI A;  1ZOY B;  2PKO A;  5H8Y E;  2QIE B;  1RFK A;  4WQM A;  5C2T B;  1QF6 A;  1V97 A;  2CJN A;  1N5X A;  4YSX B;  2WU5 B;  3ABV B;  1KFY B;  3P1M A;  1TYG B;  2WDV B;  1SIJ A;  1WGK A;  1TJE A;  1VJK A;  4C7Y A;  3FAH A;  1L6V A;  3L4P A;  4JX1 C;  1KF6 B;  2H89 B;  5G5H A;  1NVI D;  4YXD B;  1E10 A;  1DOI A;  1V8C A;  1WWT A;  3NVZ A;  1I7H A;  3AEA B;  1SB3 C;  2WLB A;  2W3S A;  2JQR B;  3HVZ A;  2K9X A;  3LB8 C;  4N59 A;  1NEN B;  1FFV A;  3ETR A;  3AED B;  4LTU A; 
#chains in the Genus database with same CATH topology
 1HA5 A;  1TBE A;  1E90 A;  2IO1 B;  2K6Q A;  5MPO A;  2GBJ A;  3FKY A;  1EWC A;  1WXS A;  4FN2 A;  3K9P B;  2KFK B;  1MFW A;  2I2Y A;  4KV2 A;  4RFB A;  1SSN A;  4JWS C;  5D3D A;  1QOB A;  1RRB A;  2NBU A;  3PVL A;  3UF8 A;  1IBX B;  4WWN A;  2JZ3 B;  2C7N B;  2LVO A;  2Z0D B;  3C0R B;  1KLV A;  2RSU A;  2VZK B;  4RH6 A;  3DWG C;  1T0R C;  4IWO A;  2KJ6 A;  3RNF C;  4RM8 A;  2KZR A;  3P4R B;  1FCC C;  1PDX A;  4H2A A;  3VTV A;  1OEY J;  3MP9 A;  2KC2 A;  4KGR A;  3PSE B;  5EDS A;  2O6V B;  4LNN A;  4HJG E;  3BYT B;  3N1X C;  2UYZ B;  3LXF A;  1VDV A;  4GLS C;  1ZP0 B;  2WXI A;  4MJS B;  1P9D U;  3NRZ A;  2AEH A;  4L2Y A;  1IBX A;  2ZW1 A;  4NJC A;  3O65 B;  1XLO A;  4HXD A;  3BYY B;  1MHX A;  4G11 A;  3AU4 A;  3AE7 B;  2OOB B;  3Q3O C;  4NZL B;  4MGK E;  4LCD E;  1UD7 A;  4CQN A;  1SJE D;  3W5U B;  2EKE C;  1JWA D;  2IPK D;  2FID A;  4IKG A;  3Q8F A;  3BY4 B;  1E0Z A;  4MSQ B;  5CHV C;  3IFW B;  4MJS A;  2LAS A;  4OZB A;  3OAW A;  4REZ A;  3NS1 A;  3N30 A;  3ZIM A;  1IGC A;  2IND C;  3P1M A;  2X38 A;  2FUG 1;  2HJ8 A;  2BWF A;  1WWT A;  1GOZ A;  4WIP A;  1P98 A;  3L10 B;  4LTU A;  5J2R A;  1DYQ A;  2IGD A;  5T8I A;  2QEJ C;  4K7U A;  3TEY A;  4XE0 A;  3ZVV A;  2KQS A;  2O6V A;  1PGX A;  3B2F A;  4ARC A;  4XGA B;  2AQ3 B;  5KHO A;  2Y3A A;  3QJZ A;  3EFC A;  3TL5 A;  3B2G A;  2XN9 C;  2GMI C;  4J6I A;  5HI1 A;  1YJJ A;  3M95 A;  3W1Y A;  3W5V B;  3UQA A;  2Z8L A;  2NVU I;  4K3C A;  5L95 C;  1C4C A;  3R7Q A;  2FBW B;  3AE1 B;  2DX5 B;  2L00 B;  2JZP A;  5GMV A;  1F1H A;  2DYB A;  1EU4 A;  2IZV B;  1J8C A;  2CKH B;  3KUC B;  1Q1O A;  4ANU A;  4IM3 A;  3IVF A;  3SFE B;  2EKI A;  1T0S C;  4C4V B;  4B95 A;  4RGN A;  1L0X B;  3Q3M C;  3R2I A;  3MFG A;  2NTT A;  3NG0 A;  3ZXV A;  3KWL A;  1SBB B;  2AX5 A;  2RDH A;  4PYU A;  2J0M A;  3H9D A;  1WGG A;  2N9X A;  1V1P B;  2BGF A;  3UIN B;  5TR5 A;  3N1Y C;  4HCN B;  3OG5 A;  2TSS A;  1WMH A;  1WXM A;  1LQB A;  3W1S A;  1C4P A;  1YX6 B;  2JY6 A;  3N32 A;  3ABV B;  3MC0 B;  2KFK A;  1KF6 B;  4YXD B;  2G45 B;  1V8C A;  3AEA B;  2JQR B;  3I57 A;  3RUL A;  4DHJ B;  4RNA A;  3ZYY X;  4P7I A;  2MBB B;  3GE8 C;  2RD0 A;  1C3T A;  4C56 C;  3AB5 A;  3B1L X;  1JWU D;  1WMH B;  2KDB A;  4HKZ E;  4XWW A;  1QZE A;  1KTK A;  1WFY A;  3DBH I;  1GB4 A;  3BWU D;  2BS3 B;  3WAL A;  2L7R A;  4MT5 A;  4FLH A;  2FNJ B;  3NZS A;  4JIO U;  2PIA A;  3U8Z A;  2KC1 A;  2O2V A;  1WE6 A;  3B9J A;  4LNO A;  4PS7 A;  2Y5C A;  3A9J B;  2NMQ A;  4KVG B;  4XX5 A;  3WAP A;  3B0A A;  1R4M I;  2MLB A;  1WJ4 A;  2IJ0 A;  1BML C;  4IM0 A;  1DOX A;  1EU3 A;  4KKJ A;  4MH0 E;  1JWB D;  1RWS A;  1AN8 A;  1MI0 A;  4XYC A;  4FA6 A;  3ZNG C;  1E8Z A;  3N9Y C;  4WJN A;  2ASQ A;  4RMA A;  2KD0 A;  2LVP A;  2M17 A;  4HRS A;  2LHE A;  2LRU A;  3ZQ4 A;  2RDB C;  4MEM A;  1I4G A;  2JWZ A;  1CJE A;  5CX3 A;  3SU8 X;  4HJK A;  4GDK A;  4E74 A;  5BMG A;  3AMZ A;  3KUD B;  1YMH E;  3E9S A;  3RI7 C;  4ICV A;  3TJP A;  1F2R I;  2CS4 A;  2WDQ B;  4LDT B;  1JWS D;  4WQM A;  3H8H A;  1U4A A;  2BB6 A;  1WGD A;  2HTH A;  1LXD A;  2WU5 B;  1I4P A;  2LD9 A;  3ZRC A;  3Q69 A;  2WDV B;  1BT0 A;  2W3S A;  1NEN B;  2M4N A;  1WGH A;  2K39 A;  3EHV A;  3GZN I;  3PZ8 A;  1V9J A;  1JQ4 A;  1I4Q A;  2LGS A;  3HRD D;  1MJD A;  4A8X C;  2WNM A;  2LWP A;  2Z0E B;  1JAL A;  4IWP A;  1E8Y A;  4W9I A;  4OVV A;  4Q2J A;  3L0W B;  1I42 A;  5D3I B;  1WIA A;  4GXB A;  2FCQ A;  3ZDT A;  2IO0 B;  4FAD A;  2KLG A;  2FCM A;  2WX0 A;  5IOI A;  3RD2 A;  3AEE B;  3OLM D;  3GP7 A;  4XWT A;  1XQQ A;  4W9D A;  2XNA C;  3QAR A;  2N1V A;  4HEA 1;  2M19 A;  2L0F A;  2DAJ A;  3KVF B;  2KWU B;  3NVV A;  4I6N B;  1SGH A;  1FNU A;  1C77 A;  1UF0 A;  4BBN C;  3ZXR A;  3CWI A;  4M8M A;  3AH7 A;  2V3N A;  2X8X X;  3SFD B;  2V3P A;  2OED A;  2K3U A;  3RNG C;  2DLB A;  4ZDV A;  3P4Q B;  1DOY A;  1DGJ A;  2BYV E;  4IDI A;  2DBY A;  3HUI A;  5LNK 1;  3DVG X;  4CO7 A;  2WGS A;  2G4D B;  4WJQ A;  3NZ3 A;  4A90 A;  3SDL C;  2R2Q A;  1WGK A;  4WUR A;  3ZGZ A;  4II3 B;  3PRM B;  5KHQ A;  2GBM A;  4I6L B;  1SF0 A;  1J7C A;  2KAJ A;  2WXL A;  3DBR I;  2D3B A;  1OGW A;  1GNU A;  4ITK A;  4ZHP A;  5HG2 A;  4C4V A;  3LDZ E;  3Q3N C;  4M0W B;  2K8B A;  1FM0 D;  1T6B X;  4YSY B;  1BUI C;  4US9 A;  1A70 A;  5L83 A;  4ARI A;  3ZTC A;  2WXH A;  1WRD B;  2BVC A;  3Q3F A;  5JHA A;  3AE4 B;  3KYC D;  1SJH D;  2JSV X;  4TV3 A;  2KT7 A;  2M0A A;  2QJL A;  1QOG A;  3RNC C;  3BVZ A;  4DXG A;  3JSV B;  3MTN B;  3PLU A;  2KX3 A;  5TSS A;  4US8 A;  2AWT A;  2DYM A;  3R8B A;  4EZJ A;  2MBH A;  1K52 A;  1ZGU B;  2FCS A;  3GB1 A;  3DWM A;  4ZYN A;  2KMA A;  4W9G A;  5G2N A;  1WM2 A;  2LRW A;  2AL3 A;  1I4R A;  3RPF C;  3ML8 A;  4JWU C;  3T8M A;  1L4D B;  2J53 A;  2E6X A;  4KIK B;  1D4B A;  3UI3 A;  4YSZ B;  3P4S B;  1RYJ A;  1V80 A;  2UU7 A;  2MBE A;  2PW9 A;  3U4E G;  3VRA B;  2KNB A;  3CIR B;  4RF1 A;  2HJ1 A;  3KUZ A;  3VAW A;  3RYT A;  3VTW A;  1RFK A;  1VZ8 A;  4HCP B;  2I1J A;  1HXY D;  2QMT A;  2LHD A;  3RFZ B;  2XK5 B;  4NNJ B;  1TYG B;  1SIJ A;  4KDL B;  4ZRI A;  3I5J C;  1L6V A;  1TY0 A;  2JZZ A;  2KHW B;  3W2D A;  3BVM A;  1WE7 A;  2KDI A;  1SB3 C;  2N9P C;  1WF9 A;  1KM7 A;  4JQW C;  1SEB D;  3CF6 E;  3Q8E A;  4HPM B;  4BFR A;  3L16 A;  1R4N B;  5BYR A;  3Q3J A;  2CJO A;  4DHJ D;  4TUU A;  3AUL A;  2G1E A;  3P63 A;  3TSS A;  4HLE A;  1E8X A;  1E7V A;  1YIW A;  4OHJ A;  2PEA A;  4GIV A;  1R4N I;  5AZG A;  1WZ0 A;  5FR6 A;  4MH8 A;  4DDG D;  4S0R A;  2GLS A;  2CU1 A;  2QIL A;  3RZW C;  5EE1 A;  3DBS A;  3OWE B;  2LJ5 A;  3HIZ A;  3ZJV A;  1PUT A;  5FKA C;  1EF5 A;  4R3D A;  5H92 C;  1Z5S B;  2JYT A;  1D3Z A;  3M3J A;  5BYQ A;  1OEY A;  2ONQ A;  1UBQ A;  3MC8 A;  3JVZ X;  2L32 A;  3ZO5 B;  3GS2 A;  3Q8B A;  3WA0 A;  1WI0 A;  4URK A;  4F7Z A;  5E6N A;  1JWM D;  3APD A;  4J3O D;  1FNV A;  2IBI B;  1L0V B;  1PGA A;  3A1Q B;  2JT4 B;  2WX1 A;  4WH4 A;  2PVG C;  1SXT A;  4LDT D;  2WDT B;  1ZW7 A;  3DVN V;  3HM6 X;  5LLI A;  2Y5B B;  1I4X A;  4OVU A;  2BW2 A;  3L4P A;  4WAF A;  5C23 A;  2KTR B;  3RZF A;  4L1B A;  4ACF A;  2D10 A;  2N7J A;  4F1S A;  1C76 A;  4EUT A;  1VRA B;  4EKU A;  3GZN B;  4JLC A;  2K0P A;  4G3X B;  4WJP A;  1XO3 A;  1P3Q U;  3DOW A;  2BB5 A;  4FJZ A;  4ZOH C;  3T3O A;  4O1N A;  3PHX B;  1MG4 A;  2DAF A;  2V4L A;  2WXP A;  1QQR A;  2KFJ A;  3BK2 A;  3BK1 A;  1E5W A;  4ZRQ A;  3VRB B;  1QT9 A;  1STE A;  3ZLZ A;  2RDG A;  2C7H A;  3TEX A;  4W9H A;  3CSF A;  4WQO B;  4BOZ B;  1L4Z B;  1WR1 A;  2D2Q A;  1EO6 A;  1YD8 U;  4HVB A;  3A4S C;  4GOC A;  3PRE A;  1K53 A;  4ZYS A;  4E3C A;  2O6V D;  1ZKH A;  3TUO A;  3HM3 A;  2ZVO A;  4E71 A;  1OQR A;  1N61 A;  2VZK D;  2DNF A;  2WXM A;  1SIF A;  1HZ6 A;  1E7P B;  1XD3 B;  3TCA A;  1WH3 A;  2M0X A;  1Z2M A;  1C79 A;  4A20 A;  4YT0 B;  2KDF B;  1Q10 A;  2KX0 A;  4USA A;  5LXI B;  1K8R B;  3TEZ A;  3ZJT A;  2G9H D;  2YLM A;  2MH7 A;  4FBJ B;  4N6E B;  2PJH A;  4K3B A;  1ET6 A;  3L54 A;  1TKG A;  1TS3 A;  3NHE B;  4FUL A;  1ZE3 D;  1D5X C;  4P1B C;  3MJ5 A;  4AJW A;  2WHI A;  2MBQ A;  4RCO A;  1PYW D;  4IW0 A;  2N9K A;  1DOI A;  3LB8 C;  3HVZ A;  1FXT B;  1D5Z C;  3H7P B;  1XF5 L;  2IY0 B;  1K51 A;  3PHW B;  4S17 A;  5FK9 C;  4IUM B;  4IC7 B;  4W9L A;  1GC6 A;  4DWF A;  1T0Y A;  2WYQ A;  5EE0 A;  1VCB A;  2JU6 X;  2GBN A;  2L0T A;  1SE3 A;  4DHZ E;  2M1M A;  4GDL B;  2C9W B;  4A3P A;  2ON8 A;  2DYO A;  1V2Y A;  2L3Z A;  1WR6 E;  2MJ3 A;  4XC2 A;  3VXW A;  3PPA A;  3C8Y A;  2EEL A;  1P1A A;  3SEB A;  4RGT A;  2DZI A;  3ENE A;  2NTS A;  1GPX A;  2YEP F;  2LXC A;  2KLC A;  2KQ7 A;  3A9K B;  4FJY A;  3TIX A;  1WRI A;  1CK1 A;  3PRP B;  3RNA C;  2Y5P A;  1FEH A;  4TQ1 A;  2MWS B;  4BKT A;  3W1S C;  4XZ4 A;  4KZ0 A;  3KQ4 A;  2KJH B;  3RCZ A;  3AI5 A;  2BWE S;  3M62 B;  1FMA D;  4KGT A;  2LVQ A;  1SE4 A;  3H7P A;  3V60 A;  4AWJ A;  2BPS A;  3Q8A A;  3VH4 B;  3NVY A;  1TY2 A;  2KTR A;  3IG3 A;  3LYY A;  1TS2 A;  3HHM A;  1E9M A;  1C1Y B;  4K7S A;  2FIF A;  1J0G A;  1TIF A;  1I4H A;  4KSL C;  5E6J A;  1GB1 A;  2O2V B;  5EE9 A;  4MM3 B;  1VZ7 A;  3R2T A;  1N60 A;  2LGI A;  2IO3 B;  2PKO A;  2AQ1 B;  4KKI A;  2CJN A;  1PQS A;  1UZX B;  3H7S A;  3IBE A;  1VJK A;  3FAH A;  4JX1 C;  2N4F A;  4JE3 B;  4M01 A;  2K9X A;  4BVU C;  5CHF A;  4PK1 A;  4G0N B;  5AZF A;  2J4X A;  2B3A A;  2BS2 B;  3AU5 A;  5JHB A;  4MGZ E;  1HE8 A;  2ZCB A;  1SE9 A;  3TEW A;  2JX5 A;  2RGF A;  3PLV A;  1F77 A;  4LK0 M;  4W9K A;  3VUX A;  2LZ6 A;  2N9E B;  2VH2 A;  3ML9 A;  1F9J A;  1OFF A;  4OVZ A;  3IXS A;  2L05 A;  2KN5 A;  4TSS A;  1AYF A;  2RPV A;  2ICI A;  4M00 A;  1QIL A;  2WXO A;  1MHH E;  2JF5 A;  1B9R A;  5D2M B;  3DBH B;  2VRR B;  3APC A;  4WWO A;  2WXG A;  2GOW A;  1F52 A;  5JH5 C;  2LUE A;  3AEC B;  4XDC A;  2WWZ A;  1FCL A;  3QHT A;  1KLG D;  1MG8 A;  5J18 A;  2N7D A;  1FFU A;  2WXR A;  2K8H A;  3QX1 A;  5AZH A;  1YN4 A;  3ALB A;  5BMI A;  1KJT A;  4P1C C;  2KDE B;  3ONS A;  3J9C A;  2KVR A;  5CTR C;  2D11 A;  2JVC A;  2W3R A;  4IWQ A;  2MBO A;  4AOF A;  4RM9 A;  3IHP C;  2MRP A;  2PE6 B;  2KO3 A;  3VHT C;  2MEK A;  3LJ3 A;  4AUQ C;  5C3J B;  2V3S A;  5E6O A;  5AEK B;  1YJI A;  3AE5 B;  3DVG Y;  3A9J A;  3PTF C;  2OHF A;  4QAY A;  1I35 A;  4BKS A;  5H8Y E;  3T9L A;  5C2T B;  1V97 A;  3WAO A;  3V05 A;  1N5X A;  1RFA A;  1XEE A;  3N20 C;  2D3A A;  4C7Y A;  3A4R A;  1WXA A;  3SHQ A;  2IYD B;  1Y8R C;  4DHZ B;  3AED B;  3ZNI D;  1YQB A;  2DWQ A;  2LJI A;  3P42 A;  3IT4 B;  1TGZ B;  5LXH A;  1LO5 D;  1A5R A;  5IAA C;  1JCK B;  2WS3 B;  3AEB B;  1UEL A;  1KH0 A;  1IPG A;  4WAA A;  3AE2 B;  2BKR B;  4EZL A;  5GXG B;  1MVK A;  3EA6 A;  3VR9 B;  3A1Q A;  2NPT A;  2NR2 A;  4KZC A;  4N9F 4;  2CHZ A;  2DHZ A;  2YEP B;  3RNB C;  2J42 A;  4B6W A;  2KVZ A;  2PMV A;  1CZP A;  1UWX A;  1L5P A;  1V81 A;  4C80 A;  1HTO A;  4WWP A;  2K5P A;  1N5W A;  1WXV A;  2UWQ A;  2B76 B;  2V1Y A;  2BTE A;  2BYF A;  1E7U A;  2PTL A;  2R2O A;  2VH1 A;  2CHW A;  3PGE A;  4NY0 A;  1ISN A;  1WM3 A;  4GU2 A;  4B0E A;  5AUI A;  2RMM A;  4AQ7 A;  2JUO A;  3UIP B;  2L76 A;  3DHG C;  3TBL D;  2KK8 A;  3H6N A;  1GUA B;  2ACZ B;  3ECI A;  4CYE A;  3FC4 A;  2LI5 A;  2C60 A;  3U7D A;  2D3G A;  3A33 B;  2K6D B;  1PGB A;  1WGY A;  3SR6 A;  1UNS A;  2JRH A;  2K8C A;  2D5G A;  4HDO A;  1D6E C;  2INP E;  4M8N A;  1L0Y B;  1VLB A;  2BYT A;  1HTQ A;  2YVC A;  1ZOY B;  3VDZ A;  4HPL B;  3ZUN A;  4HK2 A;  3URY A;  1MPE A;  4RGO S;  1E10 A;  4DXF A;  1FO4 A;  1I7H A;  2I38 A;  4PS3 A;  4EFO A;  5HKH A;  3JSV A;  3FIL A;  3VH3 B;  3TMP B;  5HHD G;  1ZDV A;  2JPH A;  2CHX A;  4LNF A;  2KQ4 X;  2BBC A;  4NAM A;  3WAM A;  4NJ7 A;  2DZJ A;  3AE6 B;  3U7Z A;  3NJT A;  4BBN F;  2MCN B;  1JRU A;  5BYS A;  5D7G A;  1K50 A;  4F8C B;  3AN1 A;  3DCG A;  1TZO A;  1KLU D;  1ZXI A;  4ASW C;  2XBB C;  4EZK A;  3ZJU A;  4TQ0 A;  4FHK A;  2H88 B;  3BVG A;  2MP2 B;  4M02 A;  4P6V F;  4N58 A;  3I3T B;  2GRI A;  3AV8 A;  3V6E B;  3X23 A;  2XK5 A;  3Q14 C;  3QAQ A;  1ZXH A;  4DK5 A;  3AEG B;  1ROE A;  3ZDM C;  2HTM E;  3EEC A;  4A9A A;  3EUB 2;  4YL8 A;  3CMM B;  3NUH B;  1JRO A;  4NAW A;  3V6C B;  1XXG A;  3BII D;  1E6E B;  4MM3 A;  1FIQ A;  3QWZ B;  4MGY E;  1OQY A;  4LJO B;  1HQR D;  4X57 B;  4M0W A;  1V49 A;  1XLN A;  1QLB B;  4GDK B;  5J17 A;  4HKQ A;  2KN4 A;  2ZVN A;  4YTM B;  2C7M B;  1C4A A;  3V3X A;  2A4Z A;  3T3N A;  2A5U A;  5D6J B;  1IYF A;  2INC C;  2JYE A;  4MAC A;  2QHO A;  3HVD A;  3L08 A;  3MC9 A;  2H89 B;  2J7Q B;  2V9H A;  3OJ4 B;  1XT9 B;  2W82 A;  1NYQ A;  1M94 A;  1T0Q C;  3R66 C;  1VD2 A;  3H1U A;  1YX5 B;  4KX6 B;  2IY1 B;  1IUE A;  2OJR A;  4L23 A;  4YWG G;  5IP4 D;  2LMC A;  2Q5W D;  3VVW B;  3ZNH B;  2MHJ A;  2FAZ A;  1WGR A;  3Q8C A;  2RPQ A;  2XEW A;  1YN3 A;  1J7A A;  4OZC A;  5DCN A;  5IA7 A;  4DQO C;  2MP2 A;  2KMC A;  3M63 B;  2HE7 A;  4IOI E;  3BZD B;  1PFD A;  2ZCC A;  4NPN A;  1S1Q B;  1HEZ E;  3DBL I;  2WU2 B;  3PRZ A;  1FXI A;  2QSD A;  4W9E A;  2REX A;  4GN1 A;  1WJ6 A;  1WZ3 A;  4BOS C;  1NYR A;  1ZDX A;  2KAN A;  1IGD A;  2FE8 A;  3VUW A;  5DPT A;  2BS4 B;  5G5G A;  2KYW A;  2MX2 A;  4IG7 B;  1V86 A;  2KKC A;  2ZJD A;  4JPS A;  1FRD A;  1SE2 A;  1YN5 A;  4TMA B;  1QKZ A;  4HDQ A;  3QQ8 B;  1EM7 A;  2KWC A;  1E8W A;  1VZ6 A;  1V1O A;  1XLQ A;  4AJY B;  3PZ7 A;  2PLP A;  1OQQ A;  3AM9 A;  2KOX A;  4DXA B;  2RR9 A;  5G55 A;  1J7B A;  3DBR B;  2G4S A;  1FNW A;  2W9N A;  1KFY B;  2JRI B;  3UQB A;  1H4R A;  1TJE A;  3PT2 B;  1YNT E;  4AS1 A;  3B08 A;  4N59 A;  1EUV B;  1UH6 A;  2V4I B;  3W9C B;  4UDU C;  1YOV B;  3GE3 C;  3RNE C;  3PZD A;  4BAX A;  3RMK C;  2WQY B;  4KSK C;  2Z59 B;  2PE9 A;  1WX9 A;  3R7R A;  1GG3 A;  2D3C A;  1FD6 A;  1ET9 A;  1FXA A;  1WYW B;  2ZNV B;  5C1Z A;  1RLF A;  4ANV A;  1F2R C;  2JXX A;  3L13 A;  2AYO B;  2L83 A;  3QK0 A;  3APF A;  3I63 C;  4KGS A;  1JML A;  1T3Q A;  2LFI A;  3EGR A;  3WCQ A;  4GMV A;  1WYG A;  3MHZ A;  2KAC A;  3P2B A;  1KRH A;  1IP9 A;  2LUM A;  3AXC A;  3PO0 A;  3VQI A;  1RAX A;  1M4V A;  3MHS D;  4ANX A;  3DDC B;  1EWY C;  3IAM 1;  3RN9 C;  4KIK A;  3D32 A;  1XCQ L;  4CHK A;  4FJV B;  1EF1 A;  1OTR B;  2EMS A;  5DPW A;  3KWV A;  4W9F A;  4HPP A;  2GBK A;  1AAR A;  2QCZ A;  2L52 A;  1N62 A;  4II2 B;  4PT5 A;  3KLS X;  2EMT A;  3WAN A;  2CR5 A;  2KTF A;  1WX7 A;  4C00 A;  4OZA A;  2QIE B;  2M8S A;  2L8J A;  4NQK E;  1L2N A;  2I1K A;  1WJN A;  3QCA A;  2L1A A;  1S3S G;  4MGI E;  4ICU A;  2JXT A;  2IO2 B;  3SD5 A;  1JW9 D;  1XLP A;  2DZM A;  4ZRK A;  3AE3 B;  3U2S C;  3VFK A;  2LGD A;  2SEB D;  2ZEQ A;  4EEW A;  1TS5 A;  3AE8 B;  4IM2 A;  2N7E A;  1TKE A;  2PPH A;  3AEF B;  1P0R A;  2ZPN A;  1CMX B;  4KDI C;  3FIL B;  4WWM A;  2BT6 A;  4ZRP A;  5E6P A;  1AW7 A;  3QIJ A;  4LLG M;  2ZZP B;  2N0S B;  3IT6 B;  1QOF A;  2KWD A;  2KMM A;  5IKC M;  4NQL B;  3ZNZ B;  1UUP A;  3ZW3 A;  1HZ5 A;  4I6P A;  4DDI D;  4K81 A;  4GB9 A;  4PYZ A;  2D07 B;  2KJR A;  1Q0W B;  2ZPY A;  1H8C A;  1TKY A;  4D2K A;  4EOY A;  1C9F A;  3GOE A;  1Q5W B;  3E56 A;  4WJO A;  4DBG A;  1NBF C;  3HK0 A;  2R61 A;  2NCN A;  3NVW A;  3KYD D;  4FHJ A;  1G6J A;  1L6U A;  3ZRF A;  2HD5 B;  5DPR A;  3PV1 A;  5IN7 A;  1UBI A;  2KWV B;  3ZKJ C;  1T5X D;  1WJU A;  1B1Z A;  2NBV B;  2K1F A;  5IO9 A;  4A3O A;  3VTU A;  4P16 A;  2MA9 B;  4GGQ A;  5D94 A;  3A9K A;  3Q2A C;  2LGX A;  2IGG A;  1KOT A;  3CST A;  4K7W A;  3KW5 B;  1TZ1 A;  1P7F A;  1WXQ A;  1TT5 B;  1X1M A;  3MJW A;  1WY8 A;  2PVO D;  1JRP A;  4LNI A;  5AUK A;  3JYU A;  1YQ4 B;  4GSW A;  1R7S A;  2WXF A;  4AP4 C;  1GAQ B;  1N63 A;  2GI9 A;  5BO4 B;  1UGJ A;  4NAW B;  4ANW A;  3N3K B;  3NOB A;  4RF0 A;  4HRO A;  1RM6 C;  3EC8 A;  2LGY A;  2DEN B;  2LEK A;  3Q6B A;  2WXQ A;  2GB1 A;  1N6Z A;  4JL9 A;  2W55 A;  1V6E A;  2QC8 A;  5JXV A;  2WXN A;  1ACC A;  1XCT L;  4EE2 A;  1GC7 A;  1AWD A;  2GBR A;  2N9L A;  3N1Z C;  3R3M A;  2V0G A;  1YQ3 B;  1P7E A;  2ZW0 A;  3EFU A;  1ZPS A;  2M56 B;  3BIN A;  1FPY A;  3ZTD A;  1L7Y A;  1WSP A;  2QDF A;  4W9C A;  4A6Q A;  2BF8 B;  3P4P B;  2KDM A;  1LM8 B;  1TTN A;  5DPS A;  3O13 A;  4B9K A;  2SAK A;  2E3T A;  2NS5 A;  4BKS D;  2BYE A;  5HFY A;  4ZRJ A;  1TS4 A;  2NBW B;  1V5T A;  2NPT B;  2HDE A;  5FR3 A;  5EE3 A;  3RUI B;  4MEL A;  2KXJ A;  2J52 A;  3WIM A;  3C19 A;  1GJZ A;  3V61 A;  1QF6 A;  4G50 A;  1LGR A;  3IAS 1;  2JWU A;  2IDY A;  5G5H A;  1NDD A;  1Y56 A;  1NVI D;  4OW0 A;  2WLB A;  4JGH B;  3ETR A;  4ZHO A;  1YJ1 A;  1LFD A;  2C5L C;  3S2A A;  4BZA A;  3DHI C;  3RT3 B;  3AE9 B;  3I9V 1;  3KH0 A;  1UGM A;  2IGH A;  2G3Q B;  4XDD A;  2ZNV C;  3NZU A;  1NI2 A;  3OJ3 A;  2WP9 B;  2J0K A;  3U30 A;  4GDL A;  2AQ2 B;  1J19 A;  1V1P A;  2J0J A;  4MDK E;  3VUY A;  1ENF A;  4YTN B;  1UWM A;  2WXK A;  1BXT A;  2OJW A;  4W9J A;  1CQV A;  1QOA A;  3DHH C;  1R4M B;  4LNK A;  3U52 E;  1VR9 A;  4B0M A;  2WDR B;  2FUH B;  3JW0 X;  2WXJ A;  4A55 A;  2LXA A;  1NI3 A;  1V5O A;  3UGB B;  2MJE A;  1WX8 A;  4BKG A;  2BQQ A;  3DQV A;  1F0Z A;  3QA8 A;  1ZUD 2;  2BKF A;  5I4D A;  4TKN A;  2K25 A;  4YTP B;  5CHW A;  3VR8 B;  3V62 A;  2K22 A;  5JZE B;  4NJ6 A;  2MQJ A;  4HWI B;  3X0W A;  4C7Z A;  2MW5 A;  1FRR A;  1NEK B;  2MJD A;  2FCN A;  4RGM A;  3QC8 B;  3UIO B;  4FXC A;  2DZK A;  2CU3 A;  2W54 A;  3PS6 A;  1D5M C;  4K1R B;  3L17 A;  2AL6 A;  1ESF A;  3DPD A;  3DVN U;  3K9O B;  1C78 A;  4MSM B;  4LJP B;  3DBL B;  4YSX B;  5BMH A;  3NY5 A;  2INN E;  3NS8 A;  2N1W A;  2MSE D;  3NVZ A;  1FFV A;  4PS8 A; 
#chains in the Genus database with same CATH homology
 1SF0 A;  1J7C A;  1HA5 A;  2V4I B;  2KAJ A;  2WXL A;  3W9C B;  5MPO A;  2J4X A;  4UDU C;  1EWC A;  2BS2 B;  4ITK A;  4ZHP A;  2JX5 A;  5HG2 A;  3TEW A;  1F77 A;  4LK0 M;  2WQY B;  2I2Y A;  1FM0 D;  1T6B X;  4RFB A;  4YSY B;  1SSN A;  4JWS C;  5D3D A;  1ET9 A;  1FD6 A;  1OFF A;  1QOB A;  1BUI C;  4OVZ A;  4US9 A;  1FXA A;  1A70 A;  3IXS A;  1IBX B;  4TSS A;  1AYF A;  2RPV A;  2ICI A;  1QIL A;  2WXO A;  1MHH E;  1B9R A;  4ARI A;  1F2R C;  2VZK B;  4RH6 A;  3DWG C;  2L83 A;  2WXH A;  3P4R B;  2WXG A;  4KGS A;  1FCC C;  1JML A;  1PDX A;  3AE4 B;  4H2A A;  1T3Q A;  2LFI A;  3EGR A;  3MP9 A;  1SJH D;  2JSV X;  4KGR A;  2M0A A;  2QJL A;  3WCQ A;  3AEC B;  4XDC A;  1QOG A;  1FCL A;  3BVZ A;  4DXG A;  1KLG D;  4HJG E;  1WYG A;  3BYT B;  3MHZ A;  1FFU A;  2KAC A;  2WXR A;  5TSS A;  4US8 A;  3LXF A;  2DYM A;  1VDV A;  1KRH A;  1ZP0 B;  2WXI A;  1YN4 A;  4GLS C;  3R8B A;  1K52 A;  2LUM A;  3NRZ A;  3PO0 A;  5BMI A;  3GB1 A;  3VQI A;  1M4V A;  4L2Y A;  1IBX A;  2ZW1 A;  3DWM A;  4NJC A;  1EWY C;  3IAM 1;  1XLO A;  3BYY B;  3J9C A;  1MHX A;  1I4R A;  1XCQ L;  3RPF C;  3AE7 B;  4JWU C;  2W3R A;  1L4D B;  4NZL B;  2J53 A;  2E6X A;  1D4B A;  3UI3 A;  4YSZ B;  3KWV A;  2MEK A;  4CQN A;  3P4S B;  1RYJ A;  5C3J B;  1SJE D;  3W5U B;  1JWA D;  1YJI A;  2IPK D;  2PW9 A;  3AE5 B;  3U4E G;  2L52 A;  1N62 A;  4PT5 A;  3KLS X;  3VRA B;  4IKG A;  3Q8F A;  1E0Z A;  3CIR B;  4OZB A;  4RF1 A;  2OHF A;  4REZ A;  3NS1 A;  4OZA A;  5H8Y E;  2QIE B;  1RFK A;  1VZ8 A;  1HXY D;  2QMT A;  5C2T B;  1V97 A;  2LHD A;  3RFZ B;  1IGC A;  1N5X A;  1XEE A;  3V05 A;  3P1M A;  2X38 A;  1TYG B;  1SIJ A;  4C7Y A;  2FUG 1;  1L6V A;  1TY0 A;  3W2D A;  3BVM A;  1WWT A;  1GOZ A;  1SB3 C;  4WIP A;  2L1A A;  3AED B;  4LTU A;  2JXT A;  1DYQ A;  2DWQ A;  2IGD A;  5T8I A;  2LJI A;  2QEJ C;  1SEB D;  3P42 A;  1JW9 D;  1XLP A;  3IT4 B;  3TEY A;  4XE0 A;  1LO5 D;  3Q8E A;  1JCK B;  3AE3 B;  1PGX A;  2WS3 B;  3B2F A;  5BYR A;  3U2S C;  3AEB B;  4ARC A;  1KH0 A;  2CJO A;  2SEB D;  3AE2 B;  2AQ3 B;  2Y3A A;  1TS5 A;  2G1E A;  3AE8 B;  3P63 A;  3TSS A;  5GXG B;  1MVK A;  3B2G A;  3EA6 A;  3VR9 B;  1TKE A;  2XN9 C;  3AEF B;  5HI1 A;  1YJJ A;  4OHJ A;  3W5V B;  2YEP B;  3FIL B;  4WWM A;  2BT6 A;  2Z8L A;  2J42 A;  4ZRP A;  1C4C A;  2PMV A;  4MH8 A;  1AW7 A;  1CZP A;  1UWX A;  1L5P A;  4C80 A;  2QIL A;  2FBW B;  5EE1 A;  4LLG M;  2K5P A;  3OWE B;  1N5W A;  2N0S B;  1PUT A;  3IT6 B;  5FKA C;  3ZJV A;  4R3D A;  3AE1 B;  1QOF A;  5H92 C;  2B76 B;  2BTE A;  2JYT A;  2KWD A;  2JZP A;  5BYQ A;  2KMM A;  2PTL A;  2ONQ A;  1EU4 A;  1UUP A;  1HZ5 A;  4B0E A;  5AUI A;  2RMM A;  4AQ7 A;  3SFE B;  2EKI A;  2L32 A;  1TKY A;  4D2K A;  3GS2 A;  3Q8B A;  4RGN A;  1C9F A;  2ACZ B;  1L0X B;  3E56 A;  3R2I A;  3FC4 A;  3MFG A;  2R61 A;  1JWM D;  4J3O D;  2NTT A;  1FNV A;  3NVW A;  1PGB A;  3KWL A;  1SBB B;  2AX5 A;  1L0V B;  1PGA A;  2RDH A;  1L6U A;  3SR6 A;  1UNS A;  1V1P B;  2D5G A;  1D6E C;  2INP E;  4WH4 A;  2TSS A;  2PVG C;  1L0Y B;  1VLB A;  1T5X D;  1SXT A;  1B1Z A;  2BYT A;  1ZOY B;  3W1S A;  1C4P A;  3ABV B;  4P16 A;  3MC0 B;  3URY A;  1I4X A;  1MPE A;  2BW2 A;  3L4P A;  4WAF A;  4RGO S;  1KF6 B;  4YXD B;  1E10 A;  4L1B A;  4DXF A;  1V8C A;  2IGG A;  1FO4 A;  1I7H A;  2I38 A;  3AEA B;  2JQR B;  3I57 A;  3FIL A;  5HHD G;  1P7F A;  1ZDV A;  2N7J A;  4RNA A;  1C76 A;  1WXQ A;  3ZYY X;  2KQ4 X;  2BBC A;  4C56 C;  4NAM A;  1VRA B;  2PVO D;  3AB5 A;  3AE6 B;  1JWU D;  1JRP A;  4HKZ E;  3U7Z A;  4XWW A;  2K0P A;  5AUK A;  1KTK A;  5BYS A;  1GB4 A;  3BWU D;  1YQ4 B;  2BS3 B;  1XO3 A;  5D7G A;  4MT5 A;  2BB5 A;  1K50 A;  3T3O A;  4ZOH C;  4O1N A;  3AN1 A;  1TZO A;  1KLU D;  1R7S A;  2WXF A;  1GAQ B;  2PIA A;  1ZXI A;  1N63 A;  2WXP A;  1QQR A;  2GI9 A;  3BK2 A;  3BK1 A;  1UGJ A;  4NAW B;  4ZRQ A;  3VRB B;  3B9J A;  1QT9 A;  3ZJU A;  4RF0 A;  1STE A;  4HRO A;  2RDG A;  1RM6 C;  4TQ0 A;  2H88 B;  3BVG A;  2Y5C A;  3TEX A;  2LEK A;  2WXQ A;  2GB1 A;  1L4Z B;  2NMQ A;  4P6V F;  4N58 A;  2GRI A;  2W55 A;  3AV8 A;  5JXV A;  1K53 A;  1ZXH A;  1ACC A;  1XCT L;  2WXN A;  4EE2 A;  2IJ0 A;  1BML C;  3AEG B;  4ZYS A;  1AWD A;  1ROE A;  2N9L A;  1DOX A;  2V0G A;  3TUO A;  1YQ3 B;  1EU3 A;  1P7E A;  2HTM E;  4KKJ A;  2ZW0 A;  1JWB D;  1ZPS A;  2M56 B;  1RWS A;  1AN8 A;  1MI0 A;  4A9A A;  1OQR A;  3EUB 2;  1N61 A;  2VZK D;  2WXM A;  3NUH B;  1JRO A;  1WSP A;  3N9Y C;  1HZ6 A;  1E7P B;  1XXG A;  3BII D;  1E6E B;  4A6Q A;  1FIQ A;  3P4P B;  1C79 A;  4YT0 B;  1HQR D;  1Q10 A;  4HRS A;  4USA A;  4M0W A;  2KDM A;  2LHE A;  3ZQ4 A;  1XLN A;  3TEZ A;  3ZJT A;  1I4G A;  1QLB B;  3O13 A;  4GDK B;  1CJE A;  2G9H D;  2SAK A;  4HKQ A;  2E3T A;  2MH7 A;  2KN4 A;  4N6E B;  4YTM B;  5BMG A;  1C4A A;  5HFY A;  3AMZ A;  1TS4 A;  1YMH E;  3E9S A;  1ET6 A;  3V3X A;  5FR3 A;  2HDE A;  1TKG A;  1TS3 A;  5EE3 A;  3T3N A;  1ZE3 D;  1F2R I;  1D5X C;  2WDQ B;  2JYE A;  1JWS D;  4MAC A;  2J52 A;  3MJ5 A;  4WQM A;  3H8H A;  1QF6 A;  2BB6 A;  2WU5 B;  1I4P A;  3HVD A;  4RCO A;  3IAS 1;  3Q69 A;  1PYW D;  2WDV B;  2JWU A;  2IDY A;  2N9K A;  5G5H A;  2H89 B;  1Y56 A;  1NVI D;  4OW0 A;  1DOI A;  3LB8 C;  3HVZ A;  2WLB A;  2W3S A;  1D5Z C;  1NEN B;  3ETR A;  1XF5 L;  4ZHO A;  1K51 A;  5FK9 C;  2W82 A;  1NYQ A;  3AE9 B;  3I9V 1;  3PZ8 A;  2IGH A;  1JQ4 A;  1I4Q A;  3HRD D;  4KX6 B;  4XDD A;  4A8X C;  2WNM A;  1IUE A;  5EE0 A;  4L23 A;  2JU6 X;  1JAL A;  4YWG G;  1SE3 A;  2LMC A;  2WP9 B;  2Q5W D;  4GDL B;  2ON8 A;  2DYO A;  4Q2J A;  2AQ2 B;  3Q8C A;  1V1P A;  2MJ3 A;  5D3I B;  1YN3 A;  1J7A A;  1ENF A;  4OZC A;  4DQO C;  3C8Y A;  2EEL A;  4YTN B;  1UWM A;  3SEB A;  4RGT A;  2WXK A;  1BXT A;  2NTS A;  3BZD B;  4IOI E;  1GPX A;  1CQV A;  1PFD A;  1QOA A;  3U52 E;  2YEP F;  1HEZ E;  2WU2 B;  1VR9 A;  4B0M A;  2WDR B;  3AEE B;  1FXI A;  2QSD A;  2WXJ A;  3GP7 A;  4A55 A;  1NI3 A;  4XWT A;  1WRI A;  1CK1 A;  2MJE A;  2XNA C;  2Y5P A;  1NYR A;  1ZDX A;  1FEH A;  4TQ1 A;  1IGD A;  1F0Z A;  2FE8 A;  2BS4 B;  1ZUD 2;  4HEA 1;  2M19 A;  5G5G A;  3KQ4 A;  5I4D A;  4YTP B;  3NVV A;  1FNU A;  1C77 A;  1FMA D;  3VR8 B;  4JPS A;  4KGT A;  2K22 A;  1SE4 A;  3CWI A;  1FRD A;  1SE2 A;  1YN5 A;  4TMA B;  3Q8A A;  1QKZ A;  3AH7 A;  3NVY A;  1TY2 A;  4C7Z A;  3LYY A;  1FRR A;  2MJD A;  1NEK B;  1TS2 A;  2V3N A;  1E9M A;  1EM7 A;  2V3P A;  4RGM A;  3SFD B;  1VZ6 A;  2OED A;  1V1O A;  2K3U A;  1XLQ A;  1I4H A;  4FXC A;  5E6J A;  2DLB A;  3PZ7 A;  1GB1 A;  2PLP A;  1OQQ A;  2CU3 A;  2W54 A;  3AM9 A;  5EE9 A;  4MM3 B;  3P4Q B;  1VZ7 A;  1DOY A;  1DGJ A;  4IDI A;  1D5M C;  1N60 A;  3R2T A;  2LGI A;  1J7B A;  1ESF A;  2DBY A;  3HUI A;  5LNK 1;  2PKO A;  2AQ1 B;  4KKI A;  1C78 A;  2CJN A;  3NZ3 A;  4A90 A;  1FNW A;  4YSX B;  5BMH A;  1KFY B;  2INN E;  1VJK A;  1TJE A;  1WGK A;  4WUR A;  1YNT E;  3ZGZ A;  3FAH A;  4AS1 A;  4JX1 C;  3NVZ A;  4N59 A;  4JE3 B;  2K9X A;  1FFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...