1WX8A

Solution structure of the n-terminal ubiquitin-like domain in the 4931431f19rik protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSSGSSGVSGREPSSRIIRVSVKTPQDCHEFFLAENSNVRRFKKQISKYLHCNADRLVLIFTGKILRDQDILSQRGILDGSTVHVVVRSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx8A00
2DHZA 3CMMB 2BYFA 2CHWA 4DK5A 3V6EB 2GBMA 2N9PC 5JH5C 3MHSD 2L0FA 1E5WA 2FNJB 3EFUA 1WGRA 4EUTA 1E8WA 1E7VA 4FULA 2ZVOA 3T9LA 4G50A 1WGDA 4A3OA 3DOWA 3KVFB 3IFWB 2IO1B 4BBNC 2FCQA 1ZW7A 3ZLZA 5IA7A 3PZDA 1EF1A 4NNJB 4NAWA 3VUWA 1CMXB 4NPNA 4W9FA 4NJ6A 4XZ4A 2AYOB 4DXAB 3S2AA 2DZJA 2Y5BB 2BKFA 2IZVB 4MDKE 4DHZB 5J17A 4KDIC 1V81A 2M4NA 2K6QA 2KWCA 1ZKHA 3QARA 5CHFA 4NJ7A 4DHJB 3M95A 3ZDTA 2HD5B 5AEKB 1Q0WB 3M63B 3PSEB 4E71A 3ECIA 4ANWA 3RYTA 2REXA 4G3XB 2G45B 4CYEA 2PJHA 2RSUA 2N4FA 4GDKA 3QK0A 2IY0B 1WJNA 4II2B 2N1VA 4ZYNA 2CHXA 4BOZB 1UGMA 2N7EA 3QCAA 4FJVB 4FJYA 4HK2A 4FHKA 3ZNZB 2LGYA 3PS6A 2KDFB 2G3QB 2L8JA 2JVCA 2C60A 2O6VD 2Z59B 3A4RA 3IHPC 1E7UA 4FHJA 4TQ1A 5DPTA 4FBJB 1WI0A 3UGBB 4E74A 4K7WA 2ZNVB 1E90A 1AARA 3L17A 2DX5B 2KDBA 3X23A 2M0XA 4MSQB 5JZEB 2G4SA 3PREA 4DDGD 4RMAA 1WM3A 4GDKB 2RGFA 4MEMA 3DDCB 4PS3A 2DYOA 2YVCA 3DBRI 1EO6A 1XT9B 3PLVA 5E6OA 1I35A 2K1FA 2MWSB 4WJNA 3JW0X 5E6NA 2L76A 1L7YA 2PE9A 5CTRC 5LXHA 2DENB 4NY0A 5D94A 1TGZB 3QQ8B 2Z0EB 4DDID 2KWUB 5D2MB 2KX0A 1LM8B 3ZIMA 4B6WA 1Z2MA 1UD7A 1WH3A 1GG3A 4BKSD 4EZKA 2IO2B 3W1YA 1YJ1A 3ZTDA 2M1MA 3VUYA 4NQLB 1KLVA 2KK8A 2FCSA 5DCNA 2AEHA 3IBEA 1SGHA 3WAOA 5JHBA 2MRPA 2ZCBA 2LRWA 2LXCA 2KANA 1WGHA 3PLUA 3Q3JA 2KFKB 1F9JA 4NQKE 2A5UA 2BGFA 2PEAA 2XK5A 1WXAA 1I42A 1P3QU 2EMTA 2LI5A 3UQBA 4W9LA 3VH4B 2D10A 2IBIB 2JF5A 3NOBA 4GB9A 4AWJA 4HDOA 1PQSA 2FUHB 1V6EA 3N32A 4MSMB 3UINB 3P2BA 2L0TA 1V86A 2Z0DB 2XK5B 4KDLB 2KTRA 1T0YA 1OEYJ 1TBEA 1WX7A 2KQ7A 3K9OB 3L16A 2JZ3B 3B08A 3QJZA 4LDTB 3V60A 3UIPB 1TTNA 2KZRA 4OVVA 4GN1A 2FIFA 2XEWA 2KJRA 3EECA 4FA6A 4HXDA 2KTFA 2KTRB 1XD3B 2ZVNA 2AWTA 4WWNA 4AP4C 4JLCA 1D3ZA 3VDZA 3L13A 4JQWC 2O2VA 5E6PA 2DAFA 5EDSA 2RR9A 2LVOA 5JHAA 4FLHA 5GMVA 1XQQA 2K8BA 4TV3A 2LD9A 4BOSC 3Q3FA 3PVLA 2RPQA 3TCAA 2O2VB 3APDA 3JVZX 4XX5A 4B95A 3IVFA 3APFA 4MJSA 4BKGA 1TZ1A 2LGDA 2O6VA 4IM0A 4W9KA 1E8XA 2GBJA 2QHOA 3A1QB 3EC8A 3H7PA 2MLBA 3K9PB 5C23A 3R7RA 1WE7A 1KM7A 4BKTA 5AZGA 2MCNB 3PV1A 2KO3A 4MJSB 2O6VB 1FXTB 3QA8A 4PYUA 2K25A 4WWOA 3PTFC 3SHQA 3H7PB 5LXIB 2WWZA 3T8MA 2AL6A 3PHXB 2J7QB 2IO3B 2YLMA 4HCPB 3HK0A 3U30A 2JXXA 3A4SC 3WALA 5CX3A 1S1QB 1K8RB 1MG8A 2B3AA 1YX5B 4MH0E 2C7HA 3HIZA 4IWQA 2MBOA 3OLMD 3B1LX 4PS7A 4GSWA 3OAWA 3BINA 1V9JA 1ZGUB 5L83A 4ZRIA 3QAQA 2NVUI 4ICVA 4WWPA 4F7ZA 3RULA 2C9WB 3NZUA 2N1WA 1EF5A 2KLCA 3RD2A 5CHWA 4KVGB 4IW0A 2PE6B 1G6JA 2NBUA 3VUXA 2KHWB 2ZZPB 2ZCCA 2IO0B 3ZO5B 1YX6B 1EUVB 1P98A 4LCDE 3QC8B 4HPMB 4M8MA 4W9GA 1VCBA 3ML9A 3VXWA 1WXMA 1WFYA 4II3B 4XC2A 3H7SA 2ASQA 3DVGX 4A20A 2FIDA 3TL5A 3SU8X 4HJKA 2KC2A 1KJTA 4DBGA 4K7UA 2WX1A 2JT4B 4IWOA 5G55A 1J8CA 1LFDA 1RAXA 1J0GA 4IWPA 1P1AA 3DBLI 4HWIB 3ZVVA 4HCNB 3PGEA 2D3GA 2MBBB 3N30A 2C7MB 4TUUA 2ZEQA 2LVPA 4F1SA 1NI2A 2CHZA 2D2QA 1GJZA 2N9XA 3DVGY 2KOXA 3A9JB 1U4AA 1WXSA 4GIVA 1H8CA 3DCGA 1E8ZA 3H9DA 4CO7A 3ALBA 3GZNI 3V6CB 2JRHA 4P7IA 3RCZA 3WAMA 1KOTA 1WX9A 2KX3A 3MTNB 2BWES 4JIOU 3M3JA 4AUQC 3UQAA 2IY1B 3ENEA 3O65B 4X57B 3NY5A 3VTUA 1IP9A 2L00B 2KFKA 3PRZA 2R2QA 2KMCA 2KWVB 3PRPB 4A3PA 1V49A 3SD5A 2R2OA 3KYCD 1WMHA 2RD0A 2CS4A 4ANUA 1IPGA 2I1JA 3TMPB 4ANVA 1V80A 2JY6A 1GNUA 3WIMA 2UWQA 3DVNV 3DBSA 2L3ZA 2MX2A 2KLGA 3KYDD 4I6NB 3ZNHB 2V4LA 3QHTA 5DPSA 2BKRB 2CKHB 3QX1A 1WMHB 4K1RB 1JRUA 5AZFA 4MELA 4WJOA 2K6DB 1WJ4A 5J18A 3W1SC 3UF8A 2KDEB 4EOYA 4K81A 1RLFA 1S3SG 1SIFA 4EFOA 4AOFA 2N7DA 3R3MA 1QZEA 2NS5A 3HM3A 4KV2A 4W9EA 4URKA 1SE9A 3BY4B 4M0WB 3ZNID 1YQBA 2DZIA 2KQSA 2NBVB 3X0WA 4N9F4 1A5RA 5D6JB 3WANA 3LJ3A 4EKUA 4CHKA 3ML8A 4W9CA 1GC6A 2DYBA 4TKNA 2NPTA 5DPRA 2GOWA 2EMSA 2I1KA 4HDQA 3A1QA 4BFRA 3A33B 2W9NA 5KHOA 3KUDB 1ISNA 1NBFC 3C0RB 2LWPA 4GGQA 4IC7B 2JRIB 2KNBA 2NPTB 2D11A 4IM2A 3ZTCA 2ZPYA 2BYEA 5IAAC 2MBEA 3N3KB 3TBLD 3DQVA 4RM8A 4W9JA 2KN5A 2MSED 1P9DU 2MW5A 1RRBA 1BT0A 1WF9A 3L0WB 3EHVA 2CR5A 3AU4A 2M8SA 4WAAA 4EZLA 1HE8A 2V3SA 2LGXA 2J0KA 1RFAA 3AXCA 3JSVA 4HPLB 2K8CA 4ZDVA 2UYZB 5BO4B 3CSTA 3DPDA 1Q1OA 1V5TA 3HHMA 1R4NI 1UBQA 3U8ZA 4W9HA 4MGYE 4KZCA 3PHWB 2MBHA 2KC1A 3VVWB 3JSVB 2JPHA 3A9KB 3DBHI 2LASA 4PYZA 2BWFA 4BKSA 5CHVC 1WGGA 4DHZE 1P0RA 3R7QA 3TIXA 1UBIA 2KJ6A 2MA9B 2LRUA 4IUMB 4K7SA 2JWZA 3U7DA 2CU1A 2FAZA 4J6IA 1WY8A 2D07B 3VQIA 2BF8B 3NS8A 1WXVA 4KZ0A 2DYMA 2K39A 3PT2B 2WYQA 3QWZB 4LDTD 4E3CA 2N9EB 1UELA 4GDLA 2LXAA 1X1MA 1GUAB 2MBQA 3KUCB 3CF6E 3OJ4B 1UH6A 1WR6E 4JGHB 5TR5A 2LUEA 4HLEA 4NAWB 5D7GA 3ZNGC 3ZUNA 4GDLB 4GU2A 2DAJA 3B0AA 1H4RA 2ZJDA 1IYFA 3L08A 3GOEA 3I3TB 5DPWA 3A9JA 4BVUC 4ASWC 5FR6A 3MJWA 1R4MI 1Z5SB 3OJ3A 2WX0A 3RZFA 2PPHA 1LXDA 2LZ6A 3JYUA 1YIWA 4G0NB 1E8YA 4G11A 2G4DB 1C1YB 2KKCA 1OTRB 4FJZA 4MGIE 3ZW3A 3RUIB 5L95C 2ZNVC 3AI5A 4WQOB 4W9IA 1WZ0A 4W9DA 2KMAA 2KFJA 4EZJA 3NHEB 1WYWB 4PS8A 4AJYB 3M62B 3IG3A 1V2YA 2J0MA 1Q5WB 2MP2A 1WJUA 3HM6X 4KIKA 3KH0A 4MGKE 3DVNU 2ZPNA 4F8CB 3L10B 4AJWA 2GBRA 2K8HA 4ZRJA 1WIAA 2VRRB 3APCA 4IG7B 2J0JA 2OJRA 4YL8A 2C7NB 1L2NA 4RM9A 4WJQA 2HTHA 2IYDB 2MP2B 4KIKB 2JZZA 3ZRCA 1Y8RC 2C5LC 4KSKC 3QIJA 2FCMA 3D32A 3L54A 4DWFA 1OEYA 3VTVA 1NDDA 2WDTB 4ANXA 4DHJD 3H1UA 3RZWC 3VHTC 1YD8U 1M94A 4GMVA 2KVRA 1WJ6A 2A4ZA 3VTWA 3W1SA 1OGWA 3VFKA 4HVBA 2AL3A 2LVQA 2FCNA 3ONSA 3RT3B 4BBNF 3PPAA 3ZRFA 5C1ZA 3V62A 2BYVE 3NZSA 1V5OA 4FN2A 2V1YA 2JUOA 4GOCA 2HJ8A 5KHQA 4I6PA 1WGYA 2BPSA 3H6NA 3ZKJC 3LDZE 3WA0A 3CSFA 4TQ0A 2L7RA 4ZRKA 1UZXB 1LQBA 2HE7A 4LJOB 2KXJA 4M8NA 3VAWA 5AZHA 5HKHA 3KW5B 2GMIC 3KUZA 4I6LB 1WE6A 1WRDB 2DZMA 1GC7A 4WJPA 3PRMB 1VD2A 3SDLC 2GBNA 4KSLC 4GXBA 2NR2A 4JL9A 4B9KA 2NBWB 4ICUA 2XBBC 4LJPB 5G2NA 3V61A 1WM2A 2NCNA 2LJ5A 4OVUA 2KDIA 2MQJA 3AU5A 2DZKA 5J2RA 3WAPA 2KJHB 4IM3A 3VH3B 1C3TA 4MM3A 2EKEC 2M17A 1OQYA 4MGZE 1WZ3A 2L05A 1WR1A 2OOBB 3A9KA 5LLIA 3ZDMC 4FADA 3R66C 1WX8A 4EEWA 3TJPA 3UIOB 1J19A 2GBKA 3AULA 2KD0A
chains in the Genus database with same CATH superfamily
1T5XD 2PVGC 2GBMA 5JH5C 1DOIA 2ZVOA 2W82A 2TSSA 3IAM1 2FCQA 1ZW7A 4S17A 1EF1A 1YJIA 3VUWA 4W9FA 1ZOYB 4WQMA 4KDIC 1V81A 3FILB 4RF0A 2KWCA 3QARA 1FNWA 3AMZA 5CHFA 4DHJB 3M95A 2HD5B 1Q0WB 3PSEB 1YJJA 1RM6C 4ANWA 3RYTA 4MT5A 1A70A 4DXFA 4CYEA 2RSUA 1SF0A 2N7EA 1E10A 1SE3A 4FHKA 2KDFB 2L8JA 4GDKB 1TKEA 2C60A 2O6VD 2Z59B 3EGRA 2WXQA 4E74A 1E90A 2KDBA 1ZDVA 4MSQB 2J52A 1WM3A 3P63A 2KVZA 4EE2A 1LGRA 4A90A 4PS3A 2YVCA 1XT9B 5FK9C 2JQRB 5CTRC 1FFUA 2DENB 3O13A 3QQ8B 2Z0EB 4K3CA 2KX0A 2RDGA 4LNIA 2QSDA 1E7PB 1UD7A 5IOIA 2Y3AA 2LGSA 2FCSA 2QJLA 4ACFA 1SGHA 2WXHA 2LRWA 5IKCM 4N59A 4NQKE 2A5UA 2PEAA 5GXGB 1SXTA 3DHHC 1KF6B 1PQSA 2GRIA 1V6EA 3UINB 4KDLB 2WXIA 2KTRA 5E6JA 2KQ7A 3V05A 1GOZA 2JX5A 1TTNA 2FIFA 1QQRA 2KJRA 3EECA 4A55A 2DWQA 4XWTA 2AWTA 1RWSA 3L13A 2DAFA 5EDSA 3NUHB 4FLHA 1CJEA 2K8BA 1I4XA 2LD9A 4BOSC 1FRDA 3Q3FA 3GE8C 3PVLA 1RFKA 4B95A 3AE1B 3MC0B 2WDRB 3A1QB 3K9PB 3KWVA 4JWUC 1OFFA 1PDXA 5AZGA 2MCNB 2O6VB 3SHQA 2WWZA 3T8MA 2AL6A 1K52A 4HCPB 1JQ4A 3HK0A 3U30A 3W2DA 1S1QB 3AECB 5D3IB 1VR9A 5EE0A 3HIZA 2MBOA 3OLMD 5TSSA 4P1BC 3OAWA 4RF1A 4ZRIA 2OEDA 2UU7A 1Q10A 4XGAB 3Q8CA 2KLCA 3CIRB 3SR6A 4IW0A 1G6JA 2NBUA 2ZCCA 1YX6B 3BVZA 1P98A 2QCZA 2QC8A 2AQ2B 4HPMB 4W9GA 3VXWA 1WXMA 4M02A 1SB3C 1WFYA 3C19A 2ASQA 4B0EA 4A20A 4HJKA 4LK0M 4K7UA 2HJ1A 1J0GA 4LNKA 1P1AA 3PGEA 2MBBB 1WSPA 2V3PA 3A9JB 1E8ZA 4M00A 3R8BA 1PFDA 2JRHA 3TEYA 1YN3A 1VRAB 3MTNB 2KX3A 5EE9A 4AUQC 3M3JA 4OHJA 2IY1B 3ENEA 4WAFA 2KMCA 3PRPB 1V49A 2R2OA 3ZQ4A 3TMPB 1V80A 3KYDD 1FNUA 3QHTA 1WMHB 1IGDA 1PGBA 4N58A 3W1SC 3UF8A 2KDEB 4EOYA 1SE2A 4K81A 1V8CA 3BY4B 2H88B 2NBVB 4N9F4 3LJ3A 2DYBA 4YTMB 1D6EC 2EMSA 4HDQA 1AW7A 2WQYB 1ISNA 1FD6A 3C0RB 2R61A 4IC7B 2JRIB 2KNBA 2ZPYA 1YNTE 4YSZB 1I4PA 3TBLD 3I57A 3DQVA 3WCQA 4W9JA 2MW5A 3AU4A 3AE3B 4WAAA 2V3SA 3AXCA 5BYSA 5BO4B 1Q1OA 3HHMA 1D5XC 2QILA 3U8ZA 4KX6B 2JWUA 2MBHA 2KC1A 3VVWB 3A9KB 3DBHI 5CHVC 4YT0B 2MHJA 1UGJA 1P0RA 3Q69A 3R7QA 2KJ6A 2MA9B 3AEBB 1GB4A 5IO9A 2CU1A 2WP9B 2MH7A 1WY8A 2D07B 2RPVA 3VQIA 2BF8B 2CJNA 3LYYA 3PT2B 2Z8LA 2LXAA 1GUAB 4S0RA 3CF6E 1ZXIA 1UH6A 1L6UA 1M4VA 1WR6E 2L52A 4JGHB 1I4QA 1FPYA 4HLEA 3ZNGC 1AYFA 3B0AA 1BUIC 4JPSA 1E9MA 4BVUC 1LO5D 3IXSA 3DBRB 3OJ3A 1C79A 3RZFA 2PPHA 3JYUA 4G0NB 1YIWA 4IOIE 2G4DB 1V97A 2YEPF 3RUIB 1C77A 2KMAA 1MJDA 3AE7B 1N6ZA 3PZ7A 4PS8A 3IG3A 1V2YA 1Q5WB 2AQ1B 2ZPNA 4XE0A 3L10B 2GBRA 1N63A 4ZRJA 1NVID 3APCA 2J0JA 3R2TA 5T8IA 2MP2B 4KIKB 3W5VB 2JZZA 3Q3NC 2WHIA 2KWDA 3L54A 2LUMA 1AWDA 4GMVA 4M0WA 3VR9B 2KVRA 1WJ6A 2A4ZA 4HVBA 1TS3A 4BBNF 3ZRFA 1QILA 1JWBD 2WU5B 3NZSA 1QOGA 1D4BA 2HJ8A 3GP7A 2BPSA 3ZKJC 1HTQA 1SJED 3LDZE 4TQ0A 1UZXB 4NZLB 1LQBA 2HE7A 3P4PB 1FM0D 3Q8BA 3VAWA 5HKHA 3KW5B 3UI3A 3PO0A 3PRMB 3SDLC 2BS3B 3MC8A 3BVGA 2XBBC 2SEBD 3NVWA 2KDIA 2MJEA 2DZKA 3EUB2 1P7EA 3VH3B 4RNAA 2Q5WD 3T3OA 2KQ4X 2PLPA 3ZDMC 3R66C 2INDC 3ZXRA 3TJPA 2KD0A 2DHZA 2WXJA 2CHWA 4DK5A 4MM3B 3MHSD 1E5WA 1SBBB 2FNJB 1WGRA 1JWUD 4REZA 3T9LA 1JALA 4G50A 5IP4D 4A3OA 3DOWA 3KVFB 2IO1B 1TKYA 3PZDA 4NNJB 4NPNA 3AE4B 3S2AA 5C3JB 2Y5BB 1I7HA 4JWSC 2ONQA 2W3SA 1K53A 1XEEA 2XNAC 2V3NA 5EE3A 1MI0A 1YMHE 1T0SC 2N4FA 1V1PB 2IY0B 2N9LA 2PTLA 4II2B 2N1VA 2LMCA 2WDQB 4FJVB 4HK2A 3RNEC 2LGYA 2JVCA 1E7UA 3ABVB 2PIAA 1HZ6A 2RGFA 4WJNA 5LXHA 1LM8B 4B6WA 3TSSA 1K51A 4MH8A 1YJ1A 2M1MA 3VUYA 4NQLB 5BYRA 2KK8A 5DCNA 3WAOA 2AEHA 1KLVA 1TYGB 4A8XC 2ZCBA 3Q6BA 3W5UB 3PLUA 2EELA 1F9JA 1D5ZC 2BGFA 1NYRA 1AN8A 1WXAA 1FO4A 1HQRD 1P3QU 2EMTA 4USAA 3VH4B 2JF5A 3NOBA 3B2GA 4AWJA 3Q2AC 3N32A 3P2BA 2L0TA 1V86A 2XK5B 2I2YA 4LNNA 1T0YA 1OEYJ 3L16A 3TUOA 3QJZA 5EE1A 3NVZA 1ESFA 4FA6A 3TEXA 4AP4C 4JLCA 3VDZA 2O2VA 3GB1A 2LVOA 1DOYA 2RPQA 4PT5A 4XX5A 3APDA 3JVZX 3TCAA 3IVFA 3APFA 4MJSA 1TZ1A 2LGDA 1E8XA 2QHOA 2WGSA 3EC8A 2MLBA 1UWXA 1T3QA 3R7RA 1VZ7A 1CZPA 2WXOA 1KM7A 3BZDB 3H7PB 1F52A 4H2AA 2YLMA 1YQ3B 3A4SC 1IBXA 5CX3A 1K8RB 1ZUD2 2WXPA 2C7HA 1XCTL 3DWMA 1N61A 3BINA 1V9JA 3L4PA 1ZGUB 2INCC 5C2TB 4L1BA 2NVUI 4F7ZA 3RULA 2C9WB 3AEFB 4CQNA 3GZNB 4JX1C 3BYYB 2E3TA 4II3B 3P4RB 1HEZE 2FIDA 3TL5A 3SU8X 4IWPA 3ZVVA 1UWMA 2D3GA 2C7MB 4TUUA 2LVPA 2CHZA 2D2QA 1FXIA 3ZJVA 1WXSA 2PMVA 4GIVA 3RN9C 2ZW0A 3OWEB 3AE5B 1ZDXA 3GZNI 3V6CB 4BZAA 4P7IA 3RCZA 1KOTA 2I38A 4J3OD 3UQAA 4X57B 3IAS1 4ZRQA 2KFKA 2R2QA 3IT4B 4C7ZA 4A3PA 3KYCD 3Q8AA 4ANVA 3WIMA 4I6NB 4DHZE 2MX2A 4AQ7A 2V4LA 4WJOA 1WJ4A 1RLFA 1S3SG 1SIFA 1F1HA 1TY0A 3R3MA 2NS5A 3HM3A 4M0WB 4OW0A 3X0WA 1D5MC 2D3CA 3ML8A 4W9CA 1C4AA 4TKNA 2GOWA 3RNFC 2MJ3A 2K22A 1V1OA 1C4PA 4BFRA 3BVMA 5KHOA 1IGCA 1NBFC 5I4DA 2NPTB 2D11A 4IM2A 3KQ4A 3ZTCA 2MBEA 2WXLA 2MSED 3LXFA 4OVZA 1HE8A 2J0KA 3EA6A 1EM7A 1C4CA 4HPLB 2D3AA 3DPDA 3N1YC 4XDDA 3PHWB 3JSVB 1WGGA 1GPXA 3Q8FA 4K7SA 1XLQA 4LNOA 1I4HA 2VH1A 2BVCA 2K39A 4YSYB 2WYQA 4LDTD 1FRRA 1DYQA 2MBQA 1TIFA 1NENB 2FUG1 2BTEA 1I4RA 4C00A 5D7GA 4GDLB 2DAJA 1QOBA 1FFVA 1IYFA 3L08A 3GOEA 4ASWC 5FR6A 3MJWA 2CJOA 1LXDA 3DHGC 4G11A 1TS2A 3ZW3A 3VR8B 5L95C 4OZBA 4WQOB 1WZ0A 4L2YA 3T3NA 3I9V1 4AJYB 3HM6X 5HI1A 3KH0A 3BIID 1XLNA 3I5JC 2Y5PA 4RM9A 2IYDB 3ZRCA 2WLBA 2FCMA 3D32A 2WDTB 3FKYA 3H1UA 3VHTC 1YD8U 1M94A 4C7YA 3VTWA 3W1SA 4ARIA 2FE8A 4KGSA 4D2KA 4GOCA 3WA0A 4YTNB 3BK2A 1ZXHA 1XLPA 4ZRKA 1ZPSA 2VZKD 2KXJA 5LNK1 5AZHA 4RH6A 3P1MA 1GC7A 4A9AA 4KSLC 1EWYC 3V60A 4LJPB 4KGTA 1WM2A 2MEKA 5J2RA 4IM3A 1J7AA 2DBYA 1WR1A 2FBWB 1J19A 1QT9A 2GBKA 3AULA 2BYFA 2N9PC 2L0FA 4EUTA 4FULA 3NVVA 2WXMA 4WURA 2DLBA 3IFWB 3AEAB 1RYJA 3ZLZA 3FILA 4NAWA 4NJ6A 4XZ4A 2AYOB 3ZYYX 2IZVB 3GE3C 4MDKE 2JZPA 2M4NA 3AE8B 1ZKHA 4RGMA 2BBCA 2WDVB 3ZDTA 1TY2A 5AEKB 3M63B 4TSSA 3ECIA 1YN5A 4RFBA 1JWSD 2G45B 4C80A 4GDKA 4ZYSA 3QK0A 2JYTA 4LLGM 4ZYNA 4BOZB 1UGMA 4FJYA 3PS6A 2G3QB 4EKUA 3IHPC 4FHJA 2GI9A 3A4RA 1HZ5A 1C3TA 1NI3A 4FBJB 2IJ0A 3UGBB 4K7WA 1AARA 3L17A 2ICIA 3X23A 3NS1A 5JZEB 2G4SA 4HEA1 4DDGD 3DBRI 4L23A 1EO6A 1I35A 2K1FA 2JSVX 2XN9C 5E6NA 2L76A 2PE9A 5D94A 2KWUB 5H8YE 1Z2MA 1GG3A 2INPE 2M19A 3IBEA 2LXCA 2KANA 1WGHA 3Q3JA 2KFKB 3V3XA 1MHXA 1I42A 2BQQA 2LI5A 2IBIB 1C78A 4GB9A 2VH2A 4HDOA 2FUHB 1VZ6A 4MSMB 4QAYA 2D5GA 2WU2B 1QLBB 2Y5CA 5FKAC 2K5PA 1TBEA 3K9OB 1WXQA 1P7FA 3UIPB 4OVVA 2V9HA 2YEPB 1XLOA 2KTFA 2KTRB 2ZVNA 3OG5A 4WWNA 1D3ZA 4JQWC 5E6PA 1R4NB 2RR9A 1F77A 1WYGA 3BYTB 3CWIA 4BKGA 2O6VA 4IM0A 2ACZB 2GBJA 3MHZA 3RNBC 2PVOD 1SEBD 5G5HA 2M56B 4BKTA 2L83A 3PV1A 2KO3A 3QA8A 1FXTB 3PTFC 4C4VA 3PHXB 1JCKB 1N60A 2IGDA 1L4ZB 4MH0E 3NG0A 4IWQA 4P6VF 4GSWA 4RGNA 2HTME 2D3BA 4WWPA 3NZUA 2N1WA 5CHWA 4JE3B 4KVGB 3N9YC 2V0GA 2OHFA 3ZO5B 4LCDE 1PGAA 3ZGZA 5BMHA 3LB8C 4XC2A 4MACA 1SE4A 1N5WA 1PYWD 3ZJUA 2KC2A 1KJTA 4P16A 4DBGA 5AUKA 4IWOA 1J8CA 1LFDA 1RAXA 3ZJTA 4HWIB 3DWGC 1L6VA 3NJTA 2ZEQA 1GJZA 3DVGY 2KOXA 3IT6B 1WWTA 3AM9A 1H8CA 3H9DA 4CO7A 3ALBA 3DHIC 1J7BA 3RNCC 1WX9A 3B9JA 4JIOU 5BMIA 4ZOHC 3O65B 3NY5A 3VTUA 2KWVB 3SD5A 1WMHA 1QKZA 1IPGA 2I1JA 1MG4A 2JY6A 1GNUA 2UWQA 3DVNV 3DBSA 4PK1A 2KLGA 2CKHB 4Q2JA 2L32A 1MPEA 2QDFA 3AH7A 2AQ3B 1JRUA 4P1CC 3KWLA 3ZXVA 4EFOA 4AOFA 3U52E 1EWCA 1JWAD 2N7DA 1QZEA 4W9EA 1SE9A 2J42A 4DXGA 2DZIA 2KQSA 1A5RA 5D6JB 3RPFC 4CHKA 2MJDA 1GC6A 4YSXB 1I4GA 1ZP0B 1L4DB 3A33B 2W9NA 4WWMA 3KUDB 2RDBC 2LWPA 3FC4A 1PUTA 2W3RA 3N3KB 3AB5A 2E6XA 1P9DU 1F0ZA 1BT0A 3L0WB 3EHVA 2CR5A 3AE2B 2M8SA 4EZLA 3RNAC 1RFAA 1TT5B 2K8CA 4ZDVA 2UYZB 1JWMD 4AS1A 3MFGA 3CSTA 1JW9D 4W9HA 4HPPA 4MGYE 4KZCA 2LASA 2BWFA 4BKSA 3AE6B 1PGXA 2GB1A 3TIXA 1VDVA 4IUMB 2FAZA 3NS8A 1WXVA 1UNSA 2DYMA 4KZ0A 4E3CA 3QWZB 2WXFA 3N20C 1UELA 3KUCB 3NZ3A 2KAJA 3AN1A 2RDHA 3KLSX 1IUEA 2J53A 3AV8A 4NAWB 3ZUNA 4GU2A 1GB1A 5HHDG 2WX0A 2LZ6A 3EFCA 1E8YA 3AI5A 2IGHA 1BMLC 4W9DA 3PZ8A 4EZJA 2EKIA 1SSNA 4IDIA 3M62B 4ZHOA 2G9HD 2MP2A 4KIKA 3DVNU 4F8CB 4AJWA 1WIAA 2VRRB 4IG7B 2OJRA 1C9FA 3SFEB 4HKQA 3TEWA 3U2SC 2HTHA 2QEJC 1XF5L 1Y8RC 1TZOA 1ROEA 3MC9A 3VTVA 2BS4B 1NDDA 4ANXA 3RZWC 1YN4A 2KACA 1STEA 1MFWA 2AL3A 2N7JA 2LVQA 3Q3MC 2FCNA 3ONSA 3RT3B 1L5PA 3PPAA 1MVKA 1QOFA 2WS3B 5C1ZA 4FN2A 1R7SA 3HVDA 4HKZE 2V1YA 4ARCA 5KHQA 1WGYA 4XYCA 3CSFA 5HFYA 2LGIA 2GMIC 2L1AA 1WRDB 2DZMA 4K3BA 2KDMA 1VD2A 1EU3A 4BAXA 2GBNA 2IGGA 4GXBA 2NR2A 4ICUA 5G2NA 1QF6A 2NCNA 2LJ5A 3AU5A 3WAPA 1GAQB 4XWWA 3R2IA 2H89B 4MM3A 1OQYA 3P42A 1WZ3A 4MGZE 1SIJA 3NRZA 4FADA 2WXKA 1T6BX 1WX8A 3UIOB 5JXVA 2ZW1A 3CMMB 3V6EB 3RMKC 2LFIA 3EFUA 1E8WA 1E7VA 2QMTA 4WH4A 1WGDA 2PKOA 1YQ4B 2LHDA 4BBNC 2X38A 5IA7A 4R3DA 1CMXB 5BMGA 4DXAB 2DZJA 2BKFA 4C4VB 4DHZB 3AE9B 5J17A 3FAHA 2K6QA 4HJGE 3I63C 4NJ7A 1NYQA 1V1PA 4E71A 2REXA 4G3XB 1XCQL 1EU4A 2PJHA 2JYEA 2WXNA 1WJNA 2BB6A 2KMMA 2CHXA 3QCAA 3ZNZB 1ZE3D 5DPTA 4TQ1A 1OQRA 1WI0A 2ZNVB 3AEGB 2DX5B 2M0XA 3W9CB 4RGTA 3PREA 4RMAA 1ET6A 4MEMA 3DDCB 2INNE 2DYOA 1E0ZA 5E6OA 3PLVA 2MWSB 3JW0X 2WNMA 1L7YA 4NY0A 1JROA 1TGZB 4DDID 3RI7C 5D2MB 1CQVA 1BXTA 3ZIMA 1WH3A 3NVYA 4BKSD 4EZKA 2IO2B 3W1YA 3ZTDA 4ITKA 5JHBA 2MRPA 4ZRPA 3URYA 3E56A 3Q14C 2XK5A 2V4IB 3RFZB 5MPOA 3UQBA 4TMAB 4W9LA 2D10A 1ACCA 4HRSA 1Y56A 2Z0DB 3TEZA 4KKJA 1WX7A 2JZ3B 2ON8A 3B08A 4LDTB 2KZRA 4GN1A 2XEWA 4HXDA 1VZ8A 1XD3B 4NJCA 2KYWA 2B76B 5JHAA 4WIPA 1DGJA 5GMVA 1XQQA 4FXCA 2KN4A 4TV3A 2G1EA 3ETRA 3DBHB 2O2VB 1KRHA 3MP9A 4W9KA 3H7PA 2SAKA 2KT7A 5C23A 3SFDB 1WE7A 1ET9A 1HA5A 4ZHPA 4HROA 3HVZA 4MJSB 4WWOA 2N0SB 4PYUA 2K25A 5LXIB 2J7QB 2IO3B 3H8HA 2JXXA 2GLSA 3WALA 3N1ZC 1FNVA 5HG2A 3B2FA 1MG8A 2B3AA 1YX5B 2BYTA 3DBLB 4PS7A 3B1LX 4RCOA 5L83A 1J7CA 1IBXB 3QAQA 4ICVA 3E9SA 1KLGD 1EF5A 3RD2A 3BK1A 2PE6B 3VUXA 2BW2A 2KHWB 2ZZPB 2IO0B 1KFYB 1EUVB 1F2RI 3QC8B 4M8MA 1L0VB 1VCBA 1NEKB 3ML9A 3H7SA 1QOAA 3DVGX 1TS5A 1B1ZA 1JMLA 5G5GA 1HXYD 2WX1A 2JT4B 5G55A 3DBLI 2VZKB 4HCNB 3N30A 2CU3A 4F1SA 1NI2A 2N9XA 1U4AA 3DCGA 4OZAA 3P4SB 1KLUD 2BT6A 5AUIA 3WAMA 1T0RC 2BWES 2PW9A 4M01A 1FIQA 1IP9A 2L00B 3PRZA 2K0PA 3U4EG 2NTSA 1DOXA 2RD0A 2CS4A 4ANUA 2WXRA 2L3ZA 3ZNHB 2LHEA 5DPSA 2BKRB 3QX1A 1HTOA 1WGKA 4UDUC 4K1RB 1KTKA 5AZFA 4MELA 2K6DB 3SEBA 5J18A 3RNGC 5BYQA 4KV2A 3P4QB 4URKA 3ZNID 1YQBA 1FCCC 1FEHA 4DQOC 3WANA 1TS4A 2J4XA 2NPTA 5DPRA 5IN7A 3U7ZA 1TJEA 2I1KA 3A1QA 1OQQA 4GGQA 2BYEA 5IAAC 4O1NA 1KH0A 4RM8A 2KN5A 1RRBA 1WF9A 2M0AA 3Q8EA 2LGXA 4US9A 3JSVA 2X8XX 2AX5A 3BWUD 1N62A 1V5TA 3VRBB 1R4NI 1K50A 1UBQA 4B0MA 4KKIA 4LNFA 2W54A 4GLSC 3AEEB 2JPHA 1MHHE 1R4MB 4PYZA 3GS2A 4YWGG 1UBIA 2LRUA 2JWZA 1FXAA 3U7DA 4J6IA 2N9KA 2RMMA 4A6QA 1SJHD 4RGOS 2N9EB 4GDLA 1X1MA 2NTTA 1B9RA 3HUIA 3OJ4B 2OJWA 1UUPA 5TR5A 2LUEA 1T0QC 1H4RA 2ZJDA 4OZCA 3I3TB 2W55A 5DPWA 4XDCA 3A9JA 1R4MI 1Z5SB 2JXTA 1YOVB 1L0YB 1XO3A 1C1YB 2KKCA 1OTRB 4FJZA 4MGIE 2QIEB 2ZNVC 4C56C 3Q3OC 4W9IA 2BS2B 1N5XA 2KFJA 3NHEB 2IDYA 1WYWB 2J0MA 5H92C 1WJUA 4MGKE 4YTPB 3N1XC 2K8HA 4NAMA 4YL8A 2C7NB 4KGRA 1L2NA 4WJQA 1XXGA 2NMQA 2HDEA 2C5LC 4KSKC 4DWFA 3QIJA 1OEYA 4N6EB 4DHJD 3VRAB 3HRDD 1WRIA 2DNFA 1OGWA 3VFKA 2K3UA 1E6EB 1JRPA 1UF0A 3V62A 2BYVE 1V5OA 2IPKD 1VLBA 2JUOA 4I6PA 1ENFA 3H6NA 1L0XB 1FCLA 2K9XA 2LEKA 2L7RA 4YXDB 4LJOB 4M8NA 2BB5A 4US8A 3C8YA 3KUZA 2LJIA 4I6LB 1WE6A 1TKGA 4WJPA 2JU6X 4JL9A 4B9KA 4IKGA 2NBWB 3V61A 1FMAD 4OVUA 2MQJA 2WXGA 3AEDB 5FR3A 2KJHB 1CK1A 2EKEC 2M17A 4LTUA 1VJKA 2L05A 1C76A 2OOBB 3J9CA 3A9KA 5D3DA 5LLIA 3MJ5A 4EEWA 1F2RC
chains in the Genus database with same CATH topology
2DHZA 3CMMB 2BYFA 2CHWA 4DK5A 3V6EB 2GBMA 2N9PC 5JH5C 3MHSD 2L0FA 1E5WA 2FNJB 3EFUA 1WGRA 4EUTA 1E8WA 1E7VA 4FULA 2ZVOA 3T9LA 4G50A 1WGDA 4A3OA 3DOWA 3KVFB 3IFWB 2IO1B 4BBNC 2FCQA 1ZW7A 3ZLZA 5IA7A 3PZDA 1EF1A 4NNJB 4NAWA 3VUWA 1CMXB 4NPNA 4W9FA 4NJ6A 4XZ4A 2AYOB 4DXAB 3S2AA 2DZJA 2Y5BB 2BKFA 2IZVB 4MDKE 4DHZB 5J17A 4KDIC 1V81A 2M4NA 2K6QA 2KWCA 1ZKHA 3QARA 5CHFA 4NJ7A 4DHJB 3M95A 3ZDTA 2HD5B 5AEKB 1Q0WB 3M63B 3PSEB 4E71A 3ECIA 4ANWA 3RYTA 2REXA 4G3XB 2G45B 4CYEA 2PJHA 2RSUA 2N4FA 4GDKA 3QK0A 2IY0B 1WJNA 4II2B 2N1VA 4ZYNA 2CHXA 4BOZB 1UGMA 2N7EA 3QCAA 4FJVB 4FJYA 4HK2A 4FHKA 3ZNZB 2LGYA 3PS6A 2KDFB 2G3QB 2L8JA 2JVCA 2C60A 2O6VD 2Z59B 3A4RA 3IHPC 1E7UA 4FHJA 4TQ1A 5DPTA 4FBJB 1WI0A 3UGBB 4E74A 4K7WA 2ZNVB 1E90A 1AARA 3L17A 2DX5B 2KDBA 3X23A 2M0XA 4MSQB 5JZEB 2G4SA 3PREA 4DDGD 4RMAA 1WM3A 4GDKB 2RGFA 4MEMA 3DDCB 4PS3A 2DYOA 2YVCA 3DBRI 1EO6A 1XT9B 3PLVA 5E6OA 1I35A 2K1FA 2MWSB 4WJNA 3JW0X 5E6NA 2L76A 1L7YA 2PE9A 5CTRC 5LXHA 2DENB 4NY0A 5D94A 1TGZB 3QQ8B 2Z0EB 4DDID 2KWUB 5D2MB 2KX0A 1LM8B 3ZIMA 4B6WA 1Z2MA 1UD7A 1WH3A 1GG3A 4BKSD 4EZKA 2IO2B 3W1YA 1YJ1A 3ZTDA 2M1MA 3VUYA 4NQLB 1KLVA 2KK8A 2FCSA 5DCNA 2AEHA 3IBEA 1SGHA 3WAOA 5JHBA 2MRPA 2ZCBA 2LRWA 2LXCA 2KANA 1WGHA 3PLUA 3Q3JA 2KFKB 1F9JA 4NQKE 2A5UA 2BGFA 2PEAA 2XK5A 1WXAA 1I42A 1P3QU 2EMTA 2LI5A 3UQBA 4W9LA 3VH4B 2D10A 2IBIB 2JF5A 3NOBA 4GB9A 4AWJA 4HDOA 1PQSA 2FUHB 1V6EA 3N32A 4MSMB 3UINB 3P2BA 2L0TA 1V86A 2Z0DB 2XK5B 4KDLB 2KTRA 1T0YA 1OEYJ 1TBEA 1WX7A 2KQ7A 3K9OB 3L16A 2JZ3B 3B08A 3QJZA 4LDTB 3V60A 3UIPB 1TTNA 2KZRA 4OVVA 4GN1A 2FIFA 2XEWA 2KJRA 3EECA 4FA6A 4HXDA 2KTFA 2KTRB 1XD3B 2ZVNA 2AWTA 4WWNA 4AP4C 4JLCA 1D3ZA 3VDZA 3L13A 4JQWC 2O2VA 5E6PA 2DAFA 5EDSA 2RR9A 2LVOA 5JHAA 4FLHA 5GMVA 1XQQA 2K8BA 4TV3A 2LD9A 4BOSC 3Q3FA 3PVLA 2RPQA 3TCAA 2O2VB 3APDA 3JVZX 4XX5A 4B95A 3IVFA 3APFA 4MJSA 4BKGA 1TZ1A 2LGDA 2O6VA 4IM0A 4W9KA 1E8XA 2GBJA 2QHOA 3A1QB 3EC8A 3H7PA 2MLBA 3K9PB 5C23A 3R7RA 1WE7A 1KM7A 4BKTA 5AZGA 2MCNB 3PV1A 2KO3A 4MJSB 2O6VB 1FXTB 3QA8A 4PYUA 2K25A 4WWOA 3PTFC 3SHQA 3H7PB 5LXIB 2WWZA 3T8MA 2AL6A 3PHXB 2J7QB 2IO3B 2YLMA 4HCPB 3HK0A 3U30A 2JXXA 3A4SC 3WALA 5CX3A 1S1QB 1K8RB 1MG8A 2B3AA 1YX5B 4MH0E 2C7HA 3HIZA 4IWQA 2MBOA 3OLMD 3B1LX 4PS7A 4GSWA 3OAWA 3BINA 1V9JA 1ZGUB 5L83A 4ZRIA 3QAQA 2NVUI 4ICVA 4WWPA 4F7ZA 3RULA 2C9WB 3NZUA 2N1WA 1EF5A 2KLCA 3RD2A 5CHWA 4KVGB 4IW0A 2PE6B 1G6JA 2NBUA 3VUXA 2KHWB 2ZZPB 2ZCCA 2IO0B 3ZO5B 1YX6B 1EUVB 1P98A 4LCDE 3QC8B 4HPMB 4M8MA 4W9GA 1VCBA 3ML9A 3VXWA 1WXMA 1WFYA 4II3B 4XC2A 3H7SA 2ASQA 3DVGX 4A20A 2FIDA 3TL5A 3SU8X 4HJKA 2KC2A 1KJTA 4DBGA 4K7UA 2WX1A 2JT4B 4IWOA 5G55A 1J8CA 1LFDA 1RAXA 1J0GA 4IWPA 1P1AA 3DBLI 4HWIB 3ZVVA 4HCNB 3PGEA 2D3GA 2MBBB 3N30A 2C7MB 4TUUA 2ZEQA 2LVPA 4F1SA 1NI2A 2CHZA 2D2QA 1GJZA 2N9XA 3DVGY 2KOXA 3A9JB 1U4AA 1WXSA 4GIVA 1H8CA 3DCGA 1E8ZA 3H9DA 4CO7A 3ALBA 3GZNI 3V6CB 2JRHA 4P7IA 3RCZA 3WAMA 1KOTA 1WX9A 2KX3A 3MTNB 2BWES 4JIOU 3M3JA 4AUQC 3UQAA 2IY1B 3ENEA 3O65B 4X57B 3NY5A 3VTUA 1IP9A 2L00B 2KFKA 3PRZA 2R2QA 2KMCA 2KWVB 3PRPB 4A3PA 1V49A 3SD5A 2R2OA 3KYCD 1WMHA 2RD0A 2CS4A 4ANUA 1IPGA 2I1JA 3TMPB 4ANVA 1V80A 2JY6A 1GNUA 3WIMA 2UWQA 3DVNV 3DBSA 2L3ZA 2MX2A 2KLGA 3KYDD 4I6NB 3ZNHB 2V4LA 3QHTA 5DPSA 2BKRB 2CKHB 3QX1A 1WMHB 4K1RB 1JRUA 5AZFA 4MELA 4WJOA 2K6DB 1WJ4A 5J18A 3W1SC 3UF8A 2KDEB 4EOYA 4K81A 1RLFA 1S3SG 1SIFA 4EFOA 4AOFA 2N7DA 3R3MA 1QZEA 2NS5A 3HM3A 4KV2A 4W9EA 4URKA 1SE9A 3BY4B 4M0WB 3ZNID 1YQBA 2DZIA 2KQSA 2NBVB 3X0WA 4N9F4 1A5RA 5D6JB 3WANA 3LJ3A 4EKUA 4CHKA 3ML8A 4W9CA 1GC6A 2DYBA 4TKNA 2NPTA 5DPRA 2GOWA 2EMSA 2I1KA 4HDQA 3A1QA 4BFRA 3A33B 2W9NA 5KHOA 3KUDB 1ISNA 1NBFC 3C0RB 2LWPA 4GGQA 4IC7B 2JRIB 2KNBA 2NPTB 2D11A 4IM2A 3ZTCA 2ZPYA 2BYEA 5IAAC 2MBEA 3N3KB 3TBLD 3DQVA 4RM8A 4W9JA 2KN5A 2MSED 1P9DU 2MW5A 1RRBA 1BT0A 1WF9A 3L0WB 3EHVA 2CR5A 3AU4A 2M8SA 4WAAA 4EZLA 1HE8A 2V3SA 2LGXA 2J0KA 1RFAA 3AXCA 3JSVA 4HPLB 2K8CA 4ZDVA 2UYZB 5BO4B 3CSTA 3DPDA 1Q1OA 1V5TA 3HHMA 1R4NI 1UBQA 3U8ZA 4W9HA 4MGYE 4KZCA 3PHWB 2MBHA 2KC1A 3VVWB 3JSVB 2JPHA 3A9KB 3DBHI 2LASA 4PYZA 2BWFA 4BKSA 5CHVC 1WGGA 4DHZE 1P0RA 3R7QA 3TIXA 1UBIA 2KJ6A 2MA9B 2LRUA 4IUMB 4K7SA 2JWZA 3U7DA 2CU1A 2FAZA 4J6IA 1WY8A 2D07B 3VQIA 2BF8B 3NS8A 1WXVA 4KZ0A 2DYMA 2K39A 3PT2B 2WYQA 3QWZB 4LDTD 4E3CA 2N9EB 1UELA 4GDLA 2LXAA 1X1MA 1GUAB 2MBQA 3KUCB 3CF6E 3OJ4B 1UH6A 1WR6E 4JGHB 5TR5A 2LUEA 4HLEA 4NAWB 5D7GA 3ZNGC 3ZUNA 4GDLB 4GU2A 2DAJA 3B0AA 1H4RA 2ZJDA 1IYFA 3L08A 3GOEA 3I3TB 5DPWA 3A9JA 4BVUC 4ASWC 5FR6A 3MJWA 1R4MI 1Z5SB 3OJ3A 2WX0A 3RZFA 2PPHA 1LXDA 2LZ6A 3JYUA 1YIWA 4G0NB 1E8YA 4G11A 2G4DB 1C1YB 2KKCA 1OTRB 4FJZA 4MGIE 3ZW3A 3RUIB 5L95C 2ZNVC 3AI5A 4WQOB 4W9IA 1WZ0A 4W9DA 2KMAA 2KFJA 4EZJA 3NHEB 1WYWB 4PS8A 4AJYB 3M62B 3IG3A 1V2YA 2J0MA 1Q5WB 2MP2A 1WJUA 3HM6X 4KIKA 3KH0A 4MGKE 3DVNU 2ZPNA 4F8CB 3L10B 4AJWA 2GBRA 2K8HA 4ZRJA 1WIAA 2VRRB 3APCA 4IG7B 2J0JA 2OJRA 4YL8A 2C7NB 1L2NA 4RM9A 4WJQA 2HTHA 2IYDB 2MP2B 4KIKB 2JZZA 3ZRCA 1Y8RC 2C5LC 4KSKC 3QIJA 2FCMA 3D32A 3L54A 4DWFA 1OEYA 3VTVA 1NDDA 2WDTB 4ANXA 4DHJD 3H1UA 3RZWC 3VHTC 1YD8U 1M94A 4GMVA 2KVRA 1WJ6A 2A4ZA 3VTWA 3W1SA 1OGWA 3VFKA 4HVBA 2AL3A 2LVQA 2FCNA 3ONSA 3RT3B 4BBNF 3PPAA 3ZRFA 5C1ZA 3V62A 2BYVE 3NZSA 1V5OA 4FN2A 2V1YA 2JUOA 4GOCA 2HJ8A 5KHQA 4I6PA 1WGYA 2BPSA 3H6NA 3ZKJC 3LDZE 3WA0A 3CSFA 4TQ0A 2L7RA 4ZRKA 1UZXB 1LQBA 2HE7A 4LJOB 2KXJA 4M8NA 3VAWA 5AZHA 5HKHA 3KW5B 2GMIC 3KUZA 4I6LB 1WE6A 1WRDB 2DZMA 1GC7A 4WJPA 3PRMB 1VD2A 3SDLC 2GBNA 4KSLC 4GXBA 2NR2A 4JL9A 4B9KA 2NBWB 4ICUA 2XBBC 4LJPB 5G2NA 3V61A 1WM2A 2NCNA 2LJ5A 4OVUA 2KDIA 2MQJA 3AU5A 2DZKA 5J2RA 3WAPA 2KJHB 4IM3A 3VH3B 1C3TA 4MM3A 2EKEC 2M17A 1OQYA 4MGZE 1WZ3A 2L05A 1WR1A 2OOBB 3A9KA 5LLIA 3ZDMC 4FADA 3R66C 1WX8A 4EEWA 3TJPA 3UIOB 1J19A 2GBKA 3AULA 2KD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHZ A;  3CMM B;  2BYF A;  2CHW A;  4DK5 A;  3V6E B;  2GBM A;  2N9P C;  5JH5 C;  3MHS D;  2L0F A;  1E5W A;  2FNJ B;  3EFU A;  1WGR A;  4EUT A;  1E8W A;  1E7V A;  4FUL A;  2ZVO A;  3T9L A;  4G50 A;  1WGD A;  4A3O A;  3DOW A;  3KVF B;  3IFW B;  2IO1 B;  4BBN C;  2FCQ A;  1ZW7 A;  3ZLZ A;  5IA7 A;  3PZD A;  1EF1 A;  4NNJ B;  4NAW A;  3VUW A;  1CMX B;  4NPN A;  4W9F A;  4NJ6 A;  4XZ4 A;  2AYO B;  4DXA B;  3S2A A;  2DZJ A;  2Y5B B;  2BKF A;  2IZV B;  4MDK E;  4DHZ B;  5J17 A;  4KDI C;  1V81 A;  2M4N A;  2K6Q A;  2KWC A;  1ZKH A;  3QAR A;  5CHF A;  4NJ7 A;  4DHJ B;  3M95 A;  3ZDT A;  2HD5 B;  5AEK B;  1Q0W B;  3M63 B;  3PSE B;  4E71 A;  3ECI A;  4ANW A;  3RYT A;  2REX A;  4G3X B;  2G45 B;  4CYE A;  2PJH A;  2RSU A;  2N4F A;  4GDK A;  3QK0 A;  2IY0 B;  1WJN A;  4II2 B;  2N1V A;  4ZYN A;  2CHX A;  4BOZ B;  1UGM A;  2N7E A;  3QCA A;  4FJV B;  4FJY A;  4HK2 A;  4FHK A;  3ZNZ B;  2LGY A;  3PS6 A;  2KDF B;  2G3Q B;  2L8J A;  2JVC A;  2C60 A;  2O6V D;  2Z59 B;  3A4R A;  3IHP C;  1E7U A;  4FHJ A;  4TQ1 A;  5DPT A;  4FBJ B;  1WI0 A;  3UGB B;  4E74 A;  4K7W A;  2ZNV B;  1E90 A;  1AAR A;  3L17 A;  2DX5 B;  2KDB A;  3X23 A;  2M0X A;  4MSQ B;  5JZE B;  2G4S A;  3PRE A;  4DDG D;  4RMA A;  1WM3 A;  4GDK B;  2RGF A;  4MEM A;  3DDC B;  4PS3 A;  2DYO A;  2YVC A;  3DBR I;  1EO6 A;  1XT9 B;  3PLV A;  5E6O A;  1I35 A;  2K1F A;  2MWS B;  4WJN A;  3JW0 X;  5E6N A;  2L76 A;  1L7Y A;  2PE9 A;  5CTR C;  5LXH A;  2DEN B;  4NY0 A;  5D94 A;  1TGZ B;  3QQ8 B;  2Z0E B;  4DDI D;  2KWU B;  5D2M B;  2KX0 A;  1LM8 B;  3ZIM A;  4B6W A;  1Z2M A;  1UD7 A;  1WH3 A;  1GG3 A;  4BKS D;  4EZK A;  2IO2 B;  3W1Y A;  1YJ1 A;  3ZTD A;  2M1M A;  3VUY A;  4NQL B;  1KLV A;  2KK8 A;  2FCS A;  5DCN A;  2AEH A;  3IBE A;  1SGH A;  3WAO A;  5JHB A;  2MRP A;  2ZCB A;  2LRW A;  2LXC A;  2KAN A;  1WGH A;  3PLU A;  3Q3J A;  2KFK B;  1F9J A;  4NQK E;  2A5U A;  2BGF A;  2PEA A;  2XK5 A;  1WXA A;  1I42 A;  1P3Q U;  2EMT A;  2LI5 A;  3UQB A;  4W9L A;  3VH4 B;  2D10 A;  2IBI B;  2JF5 A;  3NOB A;  4GB9 A;  4AWJ A;  4HDO A;  1PQS A;  2FUH B;  1V6E A;  3N32 A;  4MSM B;  3UIN B;  3P2B A;  2L0T A;  1V86 A;  2Z0D B;  2XK5 B;  4KDL B;  2KTR A;  1T0Y A;  1OEY J;  1TBE A;  1WX7 A;  2KQ7 A;  3K9O B;  3L16 A;  2JZ3 B;  3B08 A;  3QJZ A;  4LDT B;  3V60 A;  3UIP B;  1TTN A;  2KZR A;  4OVV A;  4GN1 A;  2FIF A;  2XEW A;  2KJR A;  3EEC A;  4FA6 A;  4HXD A;  2KTF A;  2KTR B;  1XD3 B;  2ZVN A;  2AWT A;  4WWN A;  4AP4 C;  4JLC A;  1D3Z A;  3VDZ A;  3L13 A;  4JQW C;  2O2V A;  5E6P A;  2DAF A;  5EDS A;  2RR9 A;  2LVO A;  5JHA A;  4FLH A;  5GMV A;  1XQQ A;  2K8B A;  4TV3 A;  2LD9 A;  4BOS C;  3Q3F A;  3PVL A;  2RPQ A;  3TCA A;  2O2V B;  3APD A;  3JVZ X;  4XX5 A;  4B95 A;  3IVF A;  3APF A;  4MJS A;  4BKG A;  1TZ1 A;  2LGD A;  2O6V A;  4IM0 A;  4W9K A;  1E8X A;  2GBJ A;  2QHO A;  3A1Q B;  3EC8 A;  3H7P A;  2MLB A;  3K9P B;  5C23 A;  3R7R A;  1WE7 A;  1KM7 A;  4BKT A;  5AZG A;  2MCN B;  3PV1 A;  2KO3 A;  4MJS B;  2O6V B;  1FXT B;  3QA8 A;  4PYU A;  2K25 A;  4WWO A;  3PTF C;  3SHQ A;  3H7P B;  5LXI B;  2WWZ A;  3T8M A;  2AL6 A;  3PHX B;  2J7Q B;  2IO3 B;  2YLM A;  4HCP B;  3HK0 A;  3U30 A;  2JXX A;  3A4S C;  3WAL A;  5CX3 A;  1S1Q B;  1K8R B;  1MG8 A;  2B3A A;  1YX5 B;  4MH0 E;  2C7H A;  3HIZ A;  4IWQ A;  2MBO A;  3OLM D;  3B1L X;  4PS7 A;  4GSW A;  3OAW A;  3BIN A;  1V9J A;  1ZGU B;  5L83 A;  4ZRI A;  3QAQ A;  2NVU I;  4ICV A;  4WWP A;  4F7Z A;  3RUL A;  2C9W B;  3NZU A;  2N1W A;  1EF5 A;  2KLC A;  3RD2 A;  5CHW A;  4KVG B;  4IW0 A;  2PE6 B;  1G6J A;  2NBU A;  3VUX A;  2KHW B;  2ZZP B;  2ZCC A;  2IO0 B;  3ZO5 B;  1YX6 B;  1EUV B;  1P98 A;  4LCD E;  3QC8 B;  4HPM B;  4M8M A;  4W9G A;  1VCB A;  3ML9 A;  3VXW A;  1WXM A;  1WFY A;  4II3 B;  4XC2 A;  3H7S A;  2ASQ A;  3DVG X;  4A20 A;  2FID A;  3TL5 A;  3SU8 X;  4HJK A;  2KC2 A;  1KJT A;  4DBG A;  4K7U A;  2WX1 A;  2JT4 B;  4IWO A;  5G55 A;  1J8C A;  1LFD A;  1RAX A;  1J0G A;  4IWP A;  1P1A A;  3DBL I;  4HWI B;  3ZVV A;  4HCN B;  3PGE A;  2D3G A;  2MBB B;  3N30 A;  2C7M B;  4TUU A;  2ZEQ A;  2LVP A;  4F1S A;  1NI2 A;  2CHZ A;  2D2Q A;  1GJZ A;  2N9X A;  3DVG Y;  2KOX A;  3A9J B;  1U4A A;  1WXS A;  4GIV A;  1H8C A;  3DCG A;  1E8Z A;  3H9D A;  4CO7 A;  3ALB A;  3GZN I;  3V6C B;  2JRH A;  4P7I A;  3RCZ A;  3WAM A;  1KOT A;  1WX9 A;  2KX3 A;  3MTN B;  2BWE S;  4JIO U;  3M3J A;  4AUQ C;  3UQA A;  2IY1 B;  3ENE A;  3O65 B;  4X57 B;  3NY5 A;  3VTU A;  1IP9 A;  2L00 B;  2KFK A;  3PRZ A;  2R2Q A;  2KMC A;  2KWV B;  3PRP B;  4A3P A;  1V49 A;  3SD5 A;  2R2O A;  3KYC D;  1WMH A;  2RD0 A;  2CS4 A;  4ANU A;  1IPG A;  2I1J A;  3TMP B;  4ANV A;  1V80 A;  2JY6 A;  1GNU A;  3WIM A;  2UWQ A;  3DVN V;  3DBS A;  2L3Z A;  2MX2 A;  2KLG A;  3KYD D;  4I6N B;  3ZNH B;  2V4L A;  3QHT A;  5DPS A;  2BKR B;  2CKH B;  3QX1 A;  1WMH B;  4K1R B;  1JRU A;  5AZF A;  4MEL A;  4WJO A;  2K6D B;  1WJ4 A;  5J18 A;  3W1S C;  3UF8 A;  2KDE B;  4EOY A;  4K81 A;  1RLF A;  1S3S G;  1SIF A;  4EFO A;  4AOF A;  2N7D A;  3R3M A;  1QZE A;  2NS5 A;  3HM3 A;  4KV2 A;  4W9E A;  4URK A;  1SE9 A;  3BY4 B;  4M0W B;  3ZNI D;  1YQB A;  2DZI A;  2KQS A;  2NBV B;  3X0W A;  4N9F 4;  1A5R A;  5D6J B;  3WAN A;  3LJ3 A;  4EKU A;  4CHK A;  3ML8 A;  4W9C A;  1GC6 A;  2DYB A;  4TKN A;  2NPT A;  5DPR A;  2GOW A;  2EMS A;  2I1K A;  4HDQ A;  3A1Q A;  4BFR A;  3A33 B;  2W9N A;  5KHO A;  3KUD B;  1ISN A;  1NBF C;  3C0R B;  2LWP A;  4GGQ A;  4IC7 B;  2JRI B;  2KNB A;  2NPT B;  2D11 A;  4IM2 A;  3ZTC A;  2ZPY A;  2BYE A;  5IAA C;  2MBE A;  3N3K B;  3TBL D;  3DQV A;  4RM8 A;  4W9J A;  2KN5 A;  2MSE D;  1P9D U;  2MW5 A;  1RRB A;  1BT0 A;  1WF9 A;  3L0W B;  3EHV A;  2CR5 A;  3AU4 A;  2M8S A;  4WAA A;  4EZL A;  1HE8 A;  2V3S A;  2LGX A;  2J0K A;  1RFA A;  3AXC A;  3JSV A;  4HPL B;  2K8C A;  4ZDV A;  2UYZ B;  5BO4 B;  3CST A;  3DPD A;  1Q1O A;  1V5T A;  3HHM A;  1R4N I;  1UBQ A;  3U8Z A;  4W9H A;  4MGY E;  4KZC A;  3PHW B;  2MBH A;  2KC1 A;  3VVW B;  3JSV B;  2JPH A;  3A9K B;  3DBH I;  2LAS A;  4PYZ A;  2BWF A;  4BKS A;  5CHV C;  1WGG A;  4DHZ E;  1P0R A;  3R7Q A;  3TIX A;  1UBI A;  2KJ6 A;  2MA9 B;  2LRU A;  4IUM B;  4K7S A;  2JWZ A;  3U7D A;  2CU1 A;  2FAZ A;  4J6I A;  1WY8 A;  2D07 B;  3VQI A;  2BF8 B;  3NS8 A;  1WXV A;  4KZ0 A;  2DYM A;  2K39 A;  3PT2 B;  2WYQ A;  3QWZ B;  4LDT D;  4E3C A;  2N9E B;  1UEL A;  4GDL A;  2LXA A;  1X1M A;  1GUA B;  2MBQ A;  3KUC B;  3CF6 E;  3OJ4 B;  1UH6 A;  1WR6 E;  4JGH B;  5TR5 A;  2LUE A;  4HLE A;  4NAW B;  5D7G A;  3ZNG C;  3ZUN A;  4GDL B;  4GU2 A;  2DAJ A;  3B0A A;  1H4R A;  2ZJD A;  1IYF A;  3L08 A;  3GOE A;  3I3T B;  5DPW A;  3A9J A;  4BVU C;  4ASW C;  5FR6 A;  3MJW A;  1R4M I;  1Z5S B;  3OJ3 A;  2WX0 A;  3RZF A;  2PPH A;  1LXD A;  2LZ6 A;  3JYU A;  1YIW A;  4G0N B;  1E8Y A;  4G11 A;  2G4D B;  1C1Y B;  2KKC A;  1OTR B;  4FJZ A;  4MGI E;  3ZW3 A;  3RUI B;  5L95 C;  2ZNV C;  3AI5 A;  4WQO B;  4W9I A;  1WZ0 A;  4W9D A;  2KMA A;  2KFJ A;  4EZJ A;  3NHE B;  1WYW B;  4PS8 A;  4AJY B;  3M62 B;  3IG3 A;  1V2Y A;  2J0M A;  1Q5W B;  2MP2 A;  1WJU A;  3HM6 X;  4KIK A;  3KH0 A;  4MGK E;  3DVN U;  2ZPN A;  4F8C B;  3L10 B;  4AJW A;  2GBR A;  2K8H A;  4ZRJ A;  1WIA A;  2VRR B;  3APC A;  4IG7 B;  2J0J A;  2OJR A;  4YL8 A;  2C7N B;  1L2N A;  4RM9 A;  4WJQ A;  2HTH A;  2IYD B;  2MP2 B;  4KIK B;  2JZZ A;  3ZRC A;  1Y8R C;  2C5L C;  4KSK C;  3QIJ A;  2FCM A;  3D32 A;  3L54 A;  4DWF A;  1OEY A;  3VTV A;  1NDD A;  2WDT B;  4ANX A;  4DHJ D;  3H1U A;  3RZW C;  3VHT C;  1YD8 U;  1M94 A;  4GMV A;  2KVR A;  1WJ6 A;  2A4Z A;  3VTW A;  3W1S A;  1OGW A;  3VFK A;  4HVB A;  2AL3 A;  2LVQ A;  2FCN A;  3ONS A;  3RT3 B;  4BBN F;  3PPA A;  3ZRF A;  5C1Z A;  3V62 A;  2BYV E;  3NZS A;  1V5O A;  4FN2 A;  2V1Y A;  2JUO A;  4GOC A;  2HJ8 A;  5KHQ A;  4I6P A;  1WGY A;  2BPS A;  3H6N A;  3ZKJ C;  3LDZ E;  3WA0 A;  3CSF A;  4TQ0 A;  2L7R A;  4ZRK A;  1UZX B;  1LQB A;  2HE7 A;  4LJO B;  2KXJ A;  4M8N A;  3VAW A;  5AZH A;  5HKH A;  3KW5 B;  2GMI C;  3KUZ A;  4I6L B;  1WE6 A;  1WRD B;  2DZM A;  1GC7 A;  4WJP A;  3PRM B;  1VD2 A;  3SDL C;  2GBN A;  4KSL C;  4GXB A;  2NR2 A;  4JL9 A;  4B9K A;  2NBW B;  4ICU A;  2XBB C;  4LJP B;  5G2N A;  3V61 A;  1WM2 A;  2NCN A;  2LJ5 A;  4OVU A;  2KDI A;  2MQJ A;  3AU5 A;  2DZK A;  5J2R A;  3WAP A;  2KJH B;  4IM3 A;  3VH3 B;  1C3T A;  4MM3 A;  2EKE C;  2M17 A;  1OQY A;  4MGZ E;  1WZ3 A;  2L05 A;  1WR1 A;  2OOB B;  3A9K A;  5LLI A;  3ZDM C;  4FAD A;  3R66 C;  1WX8 A;  4EEW A;  3TJP A;  3UIO B;  1J19 A;  2GBK A;  3AUL A;  2KD0 A; 
#chains in the Genus database with same CATH topology
 1T5X D;  2PVG C;  2GBM A;  5JH5 C;  1DOI A;  2ZVO A;  2W82 A;  2TSS A;  3IAM 1;  2FCQ A;  1ZW7 A;  4S17 A;  1EF1 A;  1YJI A;  3VUW A;  4W9F A;  1ZOY B;  4WQM A;  4KDI C;  1V81 A;  3FIL B;  4RF0 A;  2KWC A;  3QAR A;  1FNW A;  3AMZ A;  5CHF A;  4DHJ B;  3M95 A;  2HD5 B;  1Q0W B;  3PSE B;  1YJJ A;  1RM6 C;  4ANW A;  3RYT A;  4MT5 A;  1A70 A;  4DXF A;  4CYE A;  2RSU A;  1SF0 A;  2N7E A;  1E10 A;  1SE3 A;  4FHK A;  2KDF B;  2L8J A;  4GDK B;  1TKE A;  2C60 A;  2O6V D;  2Z59 B;  3EGR A;  2WXQ A;  4E74 A;  1E90 A;  2KDB A;  1ZDV A;  4MSQ B;  2J52 A;  1WM3 A;  3P63 A;  2KVZ A;  4EE2 A;  1LGR A;  4A90 A;  4PS3 A;  2YVC A;  1XT9 B;  5FK9 C;  2JQR B;  5CTR C;  1FFU A;  2DEN B;  3O13 A;  3QQ8 B;  2Z0E B;  4K3C A;  2KX0 A;  2RDG A;  4LNI A;  2QSD A;  1E7P B;  1UD7 A;  5IOI A;  2Y3A A;  2LGS A;  2FCS A;  2QJL A;  4ACF A;  1SGH A;  2WXH A;  2LRW A;  5IKC M;  4N59 A;  4NQK E;  2A5U A;  2PEA A;  5GXG B;  1SXT A;  3DHH C;  1KF6 B;  1PQS A;  2GRI A;  1V6E A;  3UIN B;  4KDL B;  2WXI A;  2KTR A;  5E6J A;  2KQ7 A;  3V05 A;  1GOZ A;  2JX5 A;  1TTN A;  2FIF A;  1QQR A;  2KJR A;  3EEC A;  4A55 A;  2DWQ A;  4XWT A;  2AWT A;  1RWS A;  3L13 A;  2DAF A;  5EDS A;  3NUH B;  4FLH A;  1CJE A;  2K8B A;  1I4X A;  2LD9 A;  4BOS C;  1FRD A;  3Q3F A;  3GE8 C;  3PVL A;  1RFK A;  4B95 A;  3AE1 B;  3MC0 B;  2WDR B;  3A1Q B;  3K9P B;  3KWV A;  4JWU C;  1OFF A;  1PDX A;  5AZG A;  2MCN B;  2O6V B;  3SHQ A;  2WWZ A;  3T8M A;  2AL6 A;  1K52 A;  4HCP B;  1JQ4 A;  3HK0 A;  3U30 A;  3W2D A;  1S1Q B;  3AEC B;  5D3I B;  1VR9 A;  5EE0 A;  3HIZ A;  2MBO A;  3OLM D;  5TSS A;  4P1B C;  3OAW A;  4RF1 A;  4ZRI A;  2OED A;  2UU7 A;  1Q10 A;  4XGA B;  3Q8C A;  2KLC A;  3CIR B;  3SR6 A;  4IW0 A;  1G6J A;  2NBU A;  2ZCC A;  1YX6 B;  3BVZ A;  1P98 A;  2QCZ A;  2QC8 A;  2AQ2 B;  4HPM B;  4W9G A;  3VXW A;  1WXM A;  4M02 A;  1SB3 C;  1WFY A;  3C19 A;  2ASQ A;  4B0E A;  4A20 A;  4HJK A;  4LK0 M;  4K7U A;  2HJ1 A;  1J0G A;  4LNK A;  1P1A A;  3PGE A;  2MBB B;  1WSP A;  2V3P A;  3A9J B;  1E8Z A;  4M00 A;  3R8B A;  1PFD A;  2JRH A;  3TEY A;  1YN3 A;  1VRA B;  3MTN B;  2KX3 A;  5EE9 A;  4AUQ C;  3M3J A;  4OHJ A;  2IY1 B;  3ENE A;  4WAF A;  2KMC A;  3PRP B;  1V49 A;  2R2O A;  3ZQ4 A;  3TMP B;  1V80 A;  3KYD D;  1FNU A;  3QHT A;  1WMH B;  1IGD A;  1PGB A;  4N58 A;  3W1S C;  3UF8 A;  2KDE B;  4EOY A;  1SE2 A;  4K81 A;  1V8C A;  3BY4 B;  2H88 B;  2NBV B;  4N9F 4;  3LJ3 A;  2DYB A;  4YTM B;  1D6E C;  2EMS A;  4HDQ A;  1AW7 A;  2WQY B;  1ISN A;  1FD6 A;  3C0R B;  2R61 A;  4IC7 B;  2JRI B;  2KNB A;  2ZPY A;  1YNT E;  4YSZ B;  1I4P A;  3TBL D;  3I57 A;  3DQV A;  3WCQ A;  4W9J A;  2MW5 A;  3AU4 A;  3AE3 B;  4WAA A;  2V3S A;  3AXC A;  5BYS A;  5BO4 B;  1Q1O A;  3HHM A;  1D5X C;  2QIL A;  3U8Z A;  4KX6 B;  2JWU A;  2MBH A;  2KC1 A;  3VVW B;  3A9K B;  3DBH I;  5CHV C;  4YT0 B;  2MHJ A;  1UGJ A;  1P0R A;  3Q69 A;  3R7Q A;  2KJ6 A;  2MA9 B;  3AEB B;  1GB4 A;  5IO9 A;  2CU1 A;  2WP9 B;  2MH7 A;  1WY8 A;  2D07 B;  2RPV A;  3VQI A;  2BF8 B;  2CJN A;  3LYY A;  3PT2 B;  2Z8L A;  2LXA A;  1GUA B;  4S0R A;  3CF6 E;  1ZXI A;  1UH6 A;  1L6U A;  1M4V A;  1WR6 E;  2L52 A;  4JGH B;  1I4Q A;  1FPY A;  4HLE A;  3ZNG C;  1AYF A;  3B0A A;  1BUI C;  4JPS A;  1E9M A;  4BVU C;  1LO5 D;  3IXS A;  3DBR B;  3OJ3 A;  1C79 A;  3RZF A;  2PPH A;  3JYU A;  4G0N B;  1YIW A;  4IOI E;  2G4D B;  1V97 A;  2YEP F;  3RUI B;  1C77 A;  2KMA A;  1MJD A;  3AE7 B;  1N6Z A;  3PZ7 A;  4PS8 A;  3IG3 A;  1V2Y A;  1Q5W B;  2AQ1 B;  2ZPN A;  4XE0 A;  3L10 B;  2GBR A;  1N63 A;  4ZRJ A;  1NVI D;  3APC A;  2J0J A;  3R2T A;  5T8I A;  2MP2 B;  4KIK B;  3W5V B;  2JZZ A;  3Q3N C;  2WHI A;  2KWD A;  3L54 A;  2LUM A;  1AWD A;  4GMV A;  4M0W A;  3VR9 B;  2KVR A;  1WJ6 A;  2A4Z A;  4HVB A;  1TS3 A;  4BBN F;  3ZRF A;  1QIL A;  1JWB D;  2WU5 B;  3NZS A;  1QOG A;  1D4B A;  2HJ8 A;  3GP7 A;  2BPS A;  3ZKJ C;  1HTQ A;  1SJE D;  3LDZ E;  4TQ0 A;  1UZX B;  4NZL B;  1LQB A;  2HE7 A;  3P4P B;  1FM0 D;  3Q8B A;  3VAW A;  5HKH A;  3KW5 B;  3UI3 A;  3PO0 A;  3PRM B;  3SDL C;  2BS3 B;  3MC8 A;  3BVG A;  2XBB C;  2SEB D;  3NVW A;  2KDI A;  2MJE A;  2DZK A;  3EUB 2;  1P7E A;  3VH3 B;  4RNA A;  2Q5W D;  3T3O A;  2KQ4 X;  2PLP A;  3ZDM C;  3R66 C;  2IND C;  3ZXR A;  3TJP A;  2KD0 A;  2DHZ A;  2WXJ A;  2CHW A;  4DK5 A;  4MM3 B;  3MHS D;  1E5W A;  1SBB B;  2FNJ B;  1WGR A;  1JWU D;  4REZ A;  3T9L A;  1JAL A;  4G50 A;  5IP4 D;  4A3O A;  3DOW A;  3KVF B;  2IO1 B;  1TKY A;  3PZD A;  4NNJ B;  4NPN A;  3AE4 B;  3S2A A;  5C3J B;  2Y5B B;  1I7H A;  4JWS C;  2ONQ A;  2W3S A;  1K53 A;  1XEE A;  2XNA C;  2V3N A;  5EE3 A;  1MI0 A;  1YMH E;  1T0S C;  2N4F A;  1V1P B;  2IY0 B;  2N9L A;  2PTL A;  4II2 B;  2N1V A;  2LMC A;  2WDQ B;  4FJV B;  4HK2 A;  3RNE C;  2LGY A;  2JVC A;  1E7U A;  3ABV B;  2PIA A;  1HZ6 A;  2RGF A;  4WJN A;  5LXH A;  1LM8 B;  4B6W A;  3TSS A;  1K51 A;  4MH8 A;  1YJ1 A;  2M1M A;  3VUY A;  4NQL B;  5BYR A;  2KK8 A;  5DCN A;  3WAO A;  2AEH A;  1KLV A;  1TYG B;  4A8X C;  2ZCB A;  3Q6B A;  3W5U B;  3PLU A;  2EEL A;  1F9J A;  1D5Z C;  2BGF A;  1NYR A;  1AN8 A;  1WXA A;  1FO4 A;  1HQR D;  1P3Q U;  2EMT A;  4USA A;  3VH4 B;  2JF5 A;  3NOB A;  3B2G A;  4AWJ A;  3Q2A C;  3N32 A;  3P2B A;  2L0T A;  1V86 A;  2XK5 B;  2I2Y A;  4LNN A;  1T0Y A;  1OEY J;  3L16 A;  3TUO A;  3QJZ A;  5EE1 A;  3NVZ A;  1ESF A;  4FA6 A;  3TEX A;  4AP4 C;  4JLC A;  3VDZ A;  2O2V A;  3GB1 A;  2LVO A;  1DOY A;  2RPQ A;  4PT5 A;  4XX5 A;  3APD A;  3JVZ X;  3TCA A;  3IVF A;  3APF A;  4MJS A;  1TZ1 A;  2LGD A;  1E8X A;  2QHO A;  2WGS A;  3EC8 A;  2MLB A;  1UWX A;  1T3Q A;  3R7R A;  1VZ7 A;  1CZP A;  2WXO A;  1KM7 A;  3BZD B;  3H7P B;  1F52 A;  4H2A A;  2YLM A;  1YQ3 B;  3A4S C;  1IBX A;  5CX3 A;  1K8R B;  1ZUD 2;  2WXP A;  2C7H A;  1XCT L;  3DWM A;  1N61 A;  3BIN A;  1V9J A;  3L4P A;  1ZGU B;  2INC C;  5C2T B;  4L1B A;  2NVU I;  4F7Z A;  3RUL A;  2C9W B;  3AEF B;  4CQN A;  3GZN B;  4JX1 C;  3BYY B;  2E3T A;  4II3 B;  3P4R B;  1HEZ E;  2FID A;  3TL5 A;  3SU8 X;  4IWP A;  3ZVV A;  1UWM A;  2D3G A;  2C7M B;  4TUU A;  2LVP A;  2CHZ A;  2D2Q A;  1FXI A;  3ZJV A;  1WXS A;  2PMV A;  4GIV A;  3RN9 C;  2ZW0 A;  3OWE B;  3AE5 B;  1ZDX A;  3GZN I;  3V6C B;  4BZA A;  4P7I A;  3RCZ A;  1KOT A;  2I38 A;  4J3O D;  3UQA A;  4X57 B;  3IAS 1;  4ZRQ A;  2KFK A;  2R2Q A;  3IT4 B;  4C7Z A;  4A3P A;  3KYC D;  3Q8A A;  4ANV A;  3WIM A;  4I6N B;  4DHZ E;  2MX2 A;  4AQ7 A;  2V4L A;  4WJO A;  1WJ4 A;  1RLF A;  1S3S G;  1SIF A;  1F1H A;  1TY0 A;  3R3M A;  2NS5 A;  3HM3 A;  4M0W B;  4OW0 A;  3X0W A;  1D5M C;  2D3C A;  3ML8 A;  4W9C A;  1C4A A;  4TKN A;  2GOW A;  3RNF C;  2MJ3 A;  2K22 A;  1V1O A;  1C4P A;  4BFR A;  3BVM A;  5KHO A;  1IGC A;  1NBF C;  5I4D A;  2NPT B;  2D11 A;  4IM2 A;  3KQ4 A;  3ZTC A;  2MBE A;  2WXL A;  2MSE D;  3LXF A;  4OVZ A;  1HE8 A;  2J0K A;  3EA6 A;  1EM7 A;  1C4C A;  4HPL B;  2D3A A;  3DPD A;  3N1Y C;  4XDD A;  3PHW B;  3JSV B;  1WGG A;  1GPX A;  3Q8F A;  4K7S A;  1XLQ A;  4LNO A;  1I4H A;  2VH1 A;  2BVC A;  2K39 A;  4YSY B;  2WYQ A;  4LDT D;  1FRR A;  1DYQ A;  2MBQ A;  1TIF A;  1NEN B;  2FUG 1;  2BTE A;  1I4R A;  4C00 A;  5D7G A;  4GDL B;  2DAJ A;  1QOB A;  1FFV A;  1IYF A;  3L08 A;  3GOE A;  4ASW C;  5FR6 A;  3MJW A;  2CJO A;  1LXD A;  3DHG C;  4G11 A;  1TS2 A;  3ZW3 A;  3VR8 B;  5L95 C;  4OZB A;  4WQO B;  1WZ0 A;  4L2Y A;  3T3N A;  3I9V 1;  4AJY B;  3HM6 X;  5HI1 A;  3KH0 A;  3BII D;  1XLN A;  3I5J C;  2Y5P A;  4RM9 A;  2IYD B;  3ZRC A;  2WLB A;  2FCM A;  3D32 A;  2WDT B;  3FKY A;  3H1U A;  3VHT C;  1YD8 U;  1M94 A;  4C7Y A;  3VTW A;  3W1S A;  4ARI A;  2FE8 A;  4KGS A;  4D2K A;  4GOC A;  3WA0 A;  4YTN B;  3BK2 A;  1ZXH A;  1XLP A;  4ZRK A;  1ZPS A;  2VZK D;  2KXJ A;  5LNK 1;  5AZH A;  4RH6 A;  3P1M A;  1GC7 A;  4A9A A;  4KSL C;  1EWY C;  3V60 A;  4LJP B;  4KGT A;  1WM2 A;  2MEK A;  5J2R A;  4IM3 A;  1J7A A;  2DBY A;  1WR1 A;  2FBW B;  1J19 A;  1QT9 A;  2GBK A;  3AUL A;  2BYF A;  2N9P C;  2L0F A;  4EUT A;  4FUL A;  3NVV A;  2WXM A;  4WUR A;  2DLB A;  3IFW B;  3AEA B;  1RYJ A;  3ZLZ A;  3FIL A;  4NAW A;  4NJ6 A;  4XZ4 A;  2AYO B;  3ZYY X;  2IZV B;  3GE3 C;  4MDK E;  2JZP A;  2M4N A;  3AE8 B;  1ZKH A;  4RGM A;  2BBC A;  2WDV B;  3ZDT A;  1TY2 A;  5AEK B;  3M63 B;  4TSS A;  3ECI A;  1YN5 A;  4RFB A;  1JWS D;  2G45 B;  4C80 A;  4GDK A;  4ZYS A;  3QK0 A;  2JYT A;  4LLG M;  4ZYN A;  4BOZ B;  1UGM A;  4FJY A;  3PS6 A;  2G3Q B;  4EKU A;  3IHP C;  4FHJ A;  2GI9 A;  3A4R A;  1HZ5 A;  1C3T A;  1NI3 A;  4FBJ B;  2IJ0 A;  3UGB B;  4K7W A;  1AAR A;  3L17 A;  2ICI A;  3X23 A;  3NS1 A;  5JZE B;  2G4S A;  4HEA 1;  4DDG D;  3DBR I;  4L23 A;  1EO6 A;  1I35 A;  2K1F A;  2JSV X;  2XN9 C;  5E6N A;  2L76 A;  2PE9 A;  5D94 A;  2KWU B;  5H8Y E;  1Z2M A;  1GG3 A;  2INP E;  2M19 A;  3IBE A;  2LXC A;  2KAN A;  1WGH A;  3Q3J A;  2KFK B;  3V3X A;  1MHX A;  1I42 A;  2BQQ A;  2LI5 A;  2IBI B;  1C78 A;  4GB9 A;  2VH2 A;  4HDO A;  2FUH B;  1VZ6 A;  4MSM B;  4QAY A;  2D5G A;  2WU2 B;  1QLB B;  2Y5C A;  5FKA C;  2K5P A;  1TBE A;  3K9O B;  1WXQ A;  1P7F A;  3UIP B;  4OVV A;  2V9H A;  2YEP B;  1XLO A;  2KTF A;  2KTR B;  2ZVN A;  3OG5 A;  4WWN A;  1D3Z A;  4JQW C;  5E6P A;  1R4N B;  2RR9 A;  1F77 A;  1WYG A;  3BYT B;  3CWI A;  4BKG A;  2O6V A;  4IM0 A;  2ACZ B;  2GBJ A;  3MHZ A;  3RNB C;  2PVO D;  1SEB D;  5G5H A;  2M56 B;  4BKT A;  2L83 A;  3PV1 A;  2KO3 A;  3QA8 A;  1FXT B;  3PTF C;  4C4V A;  3PHX B;  1JCK B;  1N60 A;  2IGD A;  1L4Z B;  4MH0 E;  3NG0 A;  4IWQ A;  4P6V F;  4GSW A;  4RGN A;  2HTM E;  2D3B A;  4WWP A;  3NZU A;  2N1W A;  5CHW A;  4JE3 B;  4KVG B;  3N9Y C;  2V0G A;  2OHF A;  3ZO5 B;  4LCD E;  1PGA A;  3ZGZ A;  5BMH A;  3LB8 C;  4XC2 A;  4MAC A;  1SE4 A;  1N5W A;  1PYW D;  3ZJU A;  2KC2 A;  1KJT A;  4P16 A;  4DBG A;  5AUK A;  4IWO A;  1J8C A;  1LFD A;  1RAX A;  3ZJT A;  4HWI B;  3DWG C;  1L6V A;  3NJT A;  2ZEQ A;  1GJZ A;  3DVG Y;  2KOX A;  3IT6 B;  1WWT A;  3AM9 A;  1H8C A;  3H9D A;  4CO7 A;  3ALB A;  3DHI C;  1J7B A;  3RNC C;  1WX9 A;  3B9J A;  4JIO U;  5BMI A;  4ZOH C;  3O65 B;  3NY5 A;  3VTU A;  2KWV B;  3SD5 A;  1WMH A;  1QKZ A;  1IPG A;  2I1J A;  1MG4 A;  2JY6 A;  1GNU A;  2UWQ A;  3DVN V;  3DBS A;  4PK1 A;  2KLG A;  2CKH B;  4Q2J A;  2L32 A;  1MPE A;  2QDF A;  3AH7 A;  2AQ3 B;  1JRU A;  4P1C C;  3KWL A;  3ZXV A;  4EFO A;  4AOF A;  3U52 E;  1EWC A;  1JWA D;  2N7D A;  1QZE A;  4W9E A;  1SE9 A;  2J42 A;  4DXG A;  2DZI A;  2KQS A;  1A5R A;  5D6J B;  3RPF C;  4CHK A;  2MJD A;  1GC6 A;  4YSX B;  1I4G A;  1ZP0 B;  1L4D B;  3A33 B;  2W9N A;  4WWM A;  3KUD B;  2RDB C;  2LWP A;  3FC4 A;  1PUT A;  2W3R A;  3N3K B;  3AB5 A;  2E6X A;  1P9D U;  1F0Z A;  1BT0 A;  3L0W B;  3EHV A;  2CR5 A;  3AE2 B;  2M8S A;  4EZL A;  3RNA C;  1RFA A;  1TT5 B;  2K8C A;  4ZDV A;  2UYZ B;  1JWM D;  4AS1 A;  3MFG A;  3CST A;  1JW9 D;  4W9H A;  4HPP A;  4MGY E;  4KZC A;  2LAS A;  2BWF A;  4BKS A;  3AE6 B;  1PGX A;  2GB1 A;  3TIX A;  1VDV A;  4IUM B;  2FAZ A;  3NS8 A;  1WXV A;  1UNS A;  2DYM A;  4KZ0 A;  4E3C A;  3QWZ B;  2WXF A;  3N20 C;  1UEL A;  3KUC B;  3NZ3 A;  2KAJ A;  3AN1 A;  2RDH A;  3KLS X;  1IUE A;  2J53 A;  3AV8 A;  4NAW B;  3ZUN A;  4GU2 A;  1GB1 A;  5HHD G;  2WX0 A;  2LZ6 A;  3EFC A;  1E8Y A;  3AI5 A;  2IGH A;  1BML C;  4W9D A;  3PZ8 A;  4EZJ A;  2EKI A;  1SSN A;  4IDI A;  3M62 B;  4ZHO A;  2G9H D;  2MP2 A;  4KIK A;  3DVN U;  4F8C B;  4AJW A;  1WIA A;  2VRR B;  4IG7 B;  2OJR A;  1C9F A;  3SFE B;  4HKQ A;  3TEW A;  3U2S C;  2HTH A;  2QEJ C;  1XF5 L;  1Y8R C;  1TZO A;  1ROE A;  3MC9 A;  3VTV A;  2BS4 B;  1NDD A;  4ANX A;  3RZW C;  1YN4 A;  2KAC A;  1STE A;  1MFW A;  2AL3 A;  2N7J A;  2LVQ A;  3Q3M C;  2FCN A;  3ONS A;  3RT3 B;  1L5P A;  3PPA A;  1MVK A;  1QOF A;  2WS3 B;  5C1Z A;  4FN2 A;  1R7S A;  3HVD A;  4HKZ E;  2V1Y A;  4ARC A;  5KHQ A;  1WGY A;  4XYC A;  3CSF A;  5HFY A;  2LGI A;  2GMI C;  2L1A A;  1WRD B;  2DZM A;  4K3B A;  2KDM A;  1VD2 A;  1EU3 A;  4BAX A;  2GBN A;  2IGG A;  4GXB A;  2NR2 A;  4ICU A;  5G2N A;  1QF6 A;  2NCN A;  2LJ5 A;  3AU5 A;  3WAP A;  1GAQ B;  4XWW A;  3R2I A;  2H89 B;  4MM3 A;  1OQY A;  3P42 A;  1WZ3 A;  4MGZ E;  1SIJ A;  3NRZ A;  4FAD A;  2WXK A;  1T6B X;  1WX8 A;  3UIO B;  5JXV A;  2ZW1 A;  3CMM B;  3V6E B;  3RMK C;  2LFI A;  3EFU A;  1E8W A;  1E7V A;  2QMT A;  4WH4 A;  1WGD A;  2PKO A;  1YQ4 B;  2LHD A;  4BBN C;  2X38 A;  5IA7 A;  4R3D A;  1CMX B;  5BMG A;  4DXA B;  2DZJ A;  2BKF A;  4C4V B;  4DHZ B;  3AE9 B;  5J17 A;  3FAH A;  2K6Q A;  4HJG E;  3I63 C;  4NJ7 A;  1NYQ A;  1V1P A;  4E71 A;  2REX A;  4G3X B;  1XCQ L;  1EU4 A;  2PJH A;  2JYE A;  2WXN A;  1WJN A;  2BB6 A;  2KMM A;  2CHX A;  3QCA A;  3ZNZ B;  1ZE3 D;  5DPT A;  4TQ1 A;  1OQR A;  1WI0 A;  2ZNV B;  3AEG B;  2DX5 B;  2M0X A;  3W9C B;  4RGT A;  3PRE A;  4RMA A;  1ET6 A;  4MEM A;  3DDC B;  2INN E;  2DYO A;  1E0Z A;  5E6O A;  3PLV A;  2MWS B;  3JW0 X;  2WNM A;  1L7Y A;  4NY0 A;  1JRO A;  1TGZ B;  4DDI D;  3RI7 C;  5D2M B;  1CQV A;  1BXT A;  3ZIM A;  1WH3 A;  3NVY A;  4BKS D;  4EZK A;  2IO2 B;  3W1Y A;  3ZTD A;  4ITK A;  5JHB A;  2MRP A;  4ZRP A;  3URY A;  3E56 A;  3Q14 C;  2XK5 A;  2V4I B;  3RFZ B;  5MPO A;  3UQB A;  4TMA B;  4W9L A;  2D10 A;  1ACC A;  4HRS A;  1Y56 A;  2Z0D B;  3TEZ A;  4KKJ A;  1WX7 A;  2JZ3 B;  2ON8 A;  3B08 A;  4LDT B;  2KZR A;  4GN1 A;  2XEW A;  4HXD A;  1VZ8 A;  1XD3 B;  4NJC A;  2KYW A;  2B76 B;  5JHA A;  4WIP A;  1DGJ A;  5GMV A;  1XQQ A;  4FXC A;  2KN4 A;  4TV3 A;  2G1E A;  3ETR A;  3DBH B;  2O2V B;  1KRH A;  3MP9 A;  4W9K A;  3H7P A;  2SAK A;  2KT7 A;  5C23 A;  3SFD B;  1WE7 A;  1ET9 A;  1HA5 A;  4ZHP A;  4HRO A;  3HVZ A;  4MJS B;  4WWO A;  2N0S B;  4PYU A;  2K25 A;  5LXI B;  2J7Q B;  2IO3 B;  3H8H A;  2JXX A;  2GLS A;  3WAL A;  3N1Z C;  1FNV A;  5HG2 A;  3B2F A;  1MG8 A;  2B3A A;  1YX5 B;  2BYT A;  3DBL B;  4PS7 A;  3B1L X;  4RCO A;  5L83 A;  1J7C A;  1IBX B;  3QAQ A;  4ICV A;  3E9S A;  1KLG D;  1EF5 A;  3RD2 A;  3BK1 A;  2PE6 B;  3VUX A;  2BW2 A;  2KHW B;  2ZZP B;  2IO0 B;  1KFY B;  1EUV B;  1F2R I;  3QC8 B;  4M8M A;  1L0V B;  1VCB A;  1NEK B;  3ML9 A;  3H7S A;  1QOA A;  3DVG X;  1TS5 A;  1B1Z A;  1JML A;  5G5G A;  1HXY D;  2WX1 A;  2JT4 B;  5G55 A;  3DBL I;  2VZK B;  4HCN B;  3N30 A;  2CU3 A;  4F1S A;  1NI2 A;  2N9X A;  1U4A A;  3DCG A;  4OZA A;  3P4S B;  1KLU D;  2BT6 A;  5AUI A;  3WAM A;  1T0R C;  2BWE S;  2PW9 A;  4M01 A;  1FIQ A;  1IP9 A;  2L00 B;  3PRZ A;  2K0P A;  3U4E G;  2NTS A;  1DOX A;  2RD0 A;  2CS4 A;  4ANU A;  2WXR A;  2L3Z A;  3ZNH B;  2LHE A;  5DPS A;  2BKR B;  3QX1 A;  1HTO A;  1WGK A;  4UDU C;  4K1R B;  1KTK A;  5AZF A;  4MEL A;  2K6D B;  3SEB A;  5J18 A;  3RNG C;  5BYQ A;  4KV2 A;  3P4Q B;  4URK A;  3ZNI D;  1YQB A;  1FCC C;  1FEH A;  4DQO C;  3WAN A;  1TS4 A;  2J4X A;  2NPT A;  5DPR A;  5IN7 A;  3U7Z A;  1TJE A;  2I1K A;  3A1Q A;  1OQQ A;  4GGQ A;  2BYE A;  5IAA C;  4O1N A;  1KH0 A;  4RM8 A;  2KN5 A;  1RRB A;  1WF9 A;  2M0A A;  3Q8E A;  2LGX A;  4US9 A;  3JSV A;  2X8X X;  2AX5 A;  3BWU D;  1N62 A;  1V5T A;  3VRB B;  1R4N I;  1K50 A;  1UBQ A;  4B0M A;  4KKI A;  4LNF A;  2W54 A;  4GLS C;  3AEE B;  2JPH A;  1MHH E;  1R4M B;  4PYZ A;  3GS2 A;  4YWG G;  1UBI A;  2LRU A;  2JWZ A;  1FXA A;  3U7D A;  4J6I A;  2N9K A;  2RMM A;  4A6Q A;  1SJH D;  4RGO S;  2N9E B;  4GDL A;  1X1M A;  2NTT A;  1B9R A;  3HUI A;  3OJ4 B;  2OJW A;  1UUP A;  5TR5 A;  2LUE A;  1T0Q C;  1H4R A;  2ZJD A;  4OZC A;  3I3T B;  2W55 A;  5DPW A;  4XDC A;  3A9J A;  1R4M I;  1Z5S B;  2JXT A;  1YOV B;  1L0Y B;  1XO3 A;  1C1Y B;  2KKC A;  1OTR B;  4FJZ A;  4MGI E;  2QIE B;  2ZNV C;  4C56 C;  3Q3O C;  4W9I A;  2BS2 B;  1N5X A;  2KFJ A;  3NHE B;  2IDY A;  1WYW B;  2J0M A;  5H92 C;  1WJU A;  4MGK E;  4YTP B;  3N1X C;  2K8H A;  4NAM A;  4YL8 A;  2C7N B;  4KGR A;  1L2N A;  4WJQ A;  1XXG A;  2NMQ A;  2HDE A;  2C5L C;  4KSK C;  4DWF A;  3QIJ A;  1OEY A;  4N6E B;  4DHJ D;  3VRA B;  3HRD D;  1WRI A;  2DNF A;  1OGW A;  3VFK A;  2K3U A;  1E6E B;  1JRP A;  1UF0 A;  3V62 A;  2BYV E;  1V5O A;  2IPK D;  1VLB A;  2JUO A;  4I6P A;  1ENF A;  3H6N A;  1L0X B;  1FCL A;  2K9X A;  2LEK A;  2L7R A;  4YXD B;  4LJO B;  4M8N A;  2BB5 A;  4US8 A;  3C8Y A;  3KUZ A;  2LJI A;  4I6L B;  1WE6 A;  1TKG A;  4WJP A;  2JU6 X;  4JL9 A;  4B9K A;  4IKG A;  2NBW B;  3V61 A;  1FMA D;  4OVU A;  2MQJ A;  2WXG A;  3AED B;  5FR3 A;  2KJH B;  1CK1 A;  2EKE C;  2M17 A;  4LTU A;  1VJK A;  2L05 A;  1C76 A;  2OOB B;  3J9C A;  3A9K A;  5D3D A;  5LLI A;  3MJ5 A;  4EEW A;  1F2R C; 
#chains in the Genus database with same CATH homology
 2DHZ A;  3CMM B;  2BYF A;  2CHW A;  4DK5 A;  3V6E B;  2GBM A;  2N9P C;  5JH5 C;  3MHS D;  2L0F A;  1E5W A;  2FNJ B;  3EFU A;  1WGR A;  4EUT A;  1E8W A;  1E7V A;  4FUL A;  2ZVO A;  3T9L A;  4G50 A;  1WGD A;  4A3O A;  3DOW A;  3KVF B;  3IFW B;  2IO1 B;  4BBN C;  2FCQ A;  1ZW7 A;  3ZLZ A;  5IA7 A;  3PZD A;  1EF1 A;  4NNJ B;  4NAW A;  3VUW A;  1CMX B;  4NPN A;  4W9F A;  4NJ6 A;  4XZ4 A;  2AYO B;  4DXA B;  3S2A A;  2DZJ A;  2Y5B B;  2BKF A;  2IZV B;  4MDK E;  4DHZ B;  5J17 A;  4KDI C;  1V81 A;  2M4N A;  2K6Q A;  2KWC A;  1ZKH A;  3QAR A;  5CHF A;  4NJ7 A;  4DHJ B;  3M95 A;  3ZDT A;  2HD5 B;  5AEK B;  1Q0W B;  3M63 B;  3PSE B;  4E71 A;  3ECI A;  4ANW A;  3RYT A;  2REX A;  4G3X B;  2G45 B;  4CYE A;  2PJH A;  2RSU A;  2N4F A;  4GDK A;  3QK0 A;  2IY0 B;  1WJN A;  4II2 B;  2N1V A;  4ZYN A;  2CHX A;  4BOZ B;  1UGM A;  2N7E A;  3QCA A;  4FJV B;  4FJY A;  4HK2 A;  4FHK A;  3ZNZ B;  2LGY A;  3PS6 A;  2KDF B;  2G3Q B;  2L8J A;  2JVC A;  2C60 A;  2O6V D;  2Z59 B;  3A4R A;  3IHP C;  1E7U A;  4FHJ A;  4TQ1 A;  5DPT A;  4FBJ B;  1WI0 A;  3UGB B;  4E74 A;  4K7W A;  2ZNV B;  1E90 A;  1AAR A;  3L17 A;  2DX5 B;  2KDB A;  3X23 A;  2M0X A;  4MSQ B;  5JZE B;  2G4S A;  3PRE A;  4DDG D;  4RMA A;  1WM3 A;  4GDK B;  2RGF A;  4MEM A;  3DDC B;  4PS3 A;  2DYO A;  2YVC A;  3DBR I;  1EO6 A;  1XT9 B;  3PLV A;  5E6O A;  1I35 A;  2K1F A;  2MWS B;  4WJN A;  3JW0 X;  5E6N A;  2L76 A;  1L7Y A;  2PE9 A;  5CTR C;  5LXH A;  2DEN B;  4NY0 A;  5D94 A;  1TGZ B;  3QQ8 B;  2Z0E B;  4DDI D;  2KWU B;  5D2M B;  2KX0 A;  1LM8 B;  3ZIM A;  4B6W A;  1Z2M A;  1UD7 A;  1WH3 A;  1GG3 A;  4BKS D;  4EZK A;  2IO2 B;  3W1Y A;  1YJ1 A;  3ZTD A;  2M1M A;  3VUY A;  4NQL B;  1KLV A;  2KK8 A;  2FCS A;  5DCN A;  2AEH A;  3IBE A;  1SGH A;  3WAO A;  5JHB A;  2MRP A;  2ZCB A;  2LRW A;  2LXC A;  2KAN A;  1WGH A;  3PLU A;  3Q3J A;  2KFK B;  1F9J A;  4NQK E;  2A5U A;  2BGF A;  2PEA A;  2XK5 A;  1WXA A;  1I42 A;  1P3Q U;  2EMT A;  2LI5 A;  3UQB A;  4W9L A;  3VH4 B;  2D10 A;  2IBI B;  2JF5 A;  3NOB A;  4GB9 A;  4AWJ A;  4HDO A;  1PQS A;  2FUH B;  1V6E A;  3N32 A;  4MSM B;  3UIN B;  3P2B A;  2L0T A;  1V86 A;  2Z0D B;  2XK5 B;  4KDL B;  2KTR A;  1T0Y A;  1OEY J;  1TBE A;  1WX7 A;  2KQ7 A;  3K9O B;  3L16 A;  2JZ3 B;  3B08 A;  3QJZ A;  4LDT B;  3V60 A;  3UIP B;  1TTN A;  2KZR A;  4OVV A;  4GN1 A;  2FIF A;  2XEW A;  2KJR A;  3EEC A;  4FA6 A;  4HXD A;  2KTF A;  2KTR B;  1XD3 B;  2ZVN A;  2AWT A;  4WWN A;  4AP4 C;  4JLC A;  1D3Z A;  3VDZ A;  3L13 A;  4JQW C;  2O2V A;  5E6P A;  2DAF A;  5EDS A;  2RR9 A;  2LVO A;  5JHA A;  4FLH A;  5GMV A;  1XQQ A;  2K8B A;  4TV3 A;  2LD9 A;  4BOS C;  3Q3F A;  3PVL A;  2RPQ A;  3TCA A;  2O2V B;  3APD A;  3JVZ X;  4XX5 A;  4B95 A;  3IVF A;  3APF A;  4MJS A;  4BKG A;  1TZ1 A;  2LGD A;  2O6V A;  4IM0 A;  4W9K A;  1E8X A;  2GBJ A;  2QHO A;  3A1Q B;  3EC8 A;  3H7P A;  2MLB A;  3K9P B;  5C23 A;  3R7R A;  1WE7 A;  1KM7 A;  4BKT A;  5AZG A;  2MCN B;  3PV1 A;  2KO3 A;  4MJS B;  2O6V B;  1FXT B;  3QA8 A;  4PYU A;  2K25 A;  4WWO A;  3PTF C;  3SHQ A;  3H7P B;  5LXI B;  2WWZ A;  3T8M A;  2AL6 A;  3PHX B;  2J7Q B;  2IO3 B;  2YLM A;  4HCP B;  3HK0 A;  3U30 A;  2JXX A;  3A4S C;  3WAL A;  5CX3 A;  1S1Q B;  1K8R B;  1MG8 A;  2B3A A;  1YX5 B;  4MH0 E;  2C7H A;  3HIZ A;  4IWQ A;  2MBO A;  3OLM D;  3B1L X;  4PS7 A;  4GSW A;  3OAW A;  3BIN A;  1V9J A;  1ZGU B;  5L83 A;  4ZRI A;  3QAQ A;  2NVU I;  4ICV A;  4WWP A;  4F7Z A;  3RUL A;  2C9W B;  3NZU A;  2N1W A;  1EF5 A;  2KLC A;  3RD2 A;  5CHW A;  4KVG B;  4IW0 A;  2PE6 B;  1G6J A;  2NBU A;  3VUX A;  2KHW B;  2ZZP B;  2ZCC A;  2IO0 B;  3ZO5 B;  1YX6 B;  1EUV B;  1P98 A;  4LCD E;  3QC8 B;  4HPM B;  4M8M A;  4W9G A;  1VCB A;  3ML9 A;  3VXW A;  1WXM A;  1WFY A;  4II3 B;  4XC2 A;  3H7S A;  2ASQ A;  3DVG X;  4A20 A;  2FID A;  3TL5 A;  3SU8 X;  4HJK A;  2KC2 A;  1KJT A;  4DBG A;  4K7U A;  2WX1 A;  2JT4 B;  4IWO A;  5G55 A;  1J8C A;  1LFD A;  1RAX A;  1J0G A;  4IWP A;  1P1A A;  3DBL I;  4HWI B;  3ZVV A;  4HCN B;  3PGE A;  2D3G A;  2MBB B;  3N30 A;  2C7M B;  4TUU A;  2ZEQ A;  2LVP A;  4F1S A;  1NI2 A;  2CHZ A;  2D2Q A;  1GJZ A;  2N9X A;  3DVG Y;  2KOX A;  3A9J B;  1U4A A;  1WXS A;  4GIV A;  1H8C A;  3DCG A;  1E8Z A;  3H9D A;  4CO7 A;  3ALB A;  3GZN I;  3V6C B;  2JRH A;  4P7I A;  3RCZ A;  3WAM A;  1KOT A;  1WX9 A;  2KX3 A;  3MTN B;  2BWE S;  4JIO U;  3M3J A;  4AUQ C;  3UQA A;  2IY1 B;  3ENE A;  3O65 B;  4X57 B;  3NY5 A;  3VTU A;  1IP9 A;  2L00 B;  2KFK A;  3PRZ A;  2R2Q A;  2KMC A;  2KWV B;  3PRP B;  4A3P A;  1V49 A;  3SD5 A;  2R2O A;  3KYC D;  1WMH A;  2RD0 A;  2CS4 A;  4ANU A;  1IPG A;  2I1J A;  3TMP B;  4ANV A;  1V80 A;  2JY6 A;  1GNU A;  3WIM A;  2UWQ A;  3DVN V;  3DBS A;  2L3Z A;  2MX2 A;  2KLG A;  3KYD D;  4I6N B;  3ZNH B;  2V4L A;  3QHT A;  5DPS A;  2BKR B;  2CKH B;  3QX1 A;  1WMH B;  4K1R B;  1JRU A;  5AZF A;  4MEL A;  4WJO A;  2K6D B;  1WJ4 A;  5J18 A;  3W1S C;  3UF8 A;  2KDE B;  4EOY A;  4K81 A;  1RLF A;  1S3S G;  1SIF A;  4EFO A;  4AOF A;  2N7D A;  3R3M A;  1QZE A;  2NS5 A;  3HM3 A;  4KV2 A;  4W9E A;  4URK A;  1SE9 A;  3BY4 B;  4M0W B;  3ZNI D;  1YQB A;  2DZI A;  2KQS A;  2NBV B;  3X0W A;  4N9F 4;  1A5R A;  5D6J B;  3WAN A;  3LJ3 A;  4EKU A;  4CHK A;  3ML8 A;  4W9C A;  1GC6 A;  2DYB A;  4TKN A;  2NPT A;  5DPR A;  2GOW A;  2EMS A;  2I1K A;  4HDQ A;  3A1Q A;  4BFR A;  3A33 B;  2W9N A;  5KHO A;  3KUD B;  1ISN A;  1NBF C;  3C0R B;  2LWP A;  4GGQ A;  4IC7 B;  2JRI B;  2KNB A;  2NPT B;  2D11 A;  4IM2 A;  3ZTC A;  2ZPY A;  2BYE A;  5IAA C;  2MBE A;  3N3K B;  3TBL D;  3DQV A;  4RM8 A;  4W9J A;  2KN5 A;  2MSE D;  1P9D U;  2MW5 A;  1RRB A;  1BT0 A;  1WF9 A;  3L0W B;  3EHV A;  2CR5 A;  3AU4 A;  2M8S A;  4WAA A;  4EZL A;  1HE8 A;  2V3S A;  2LGX A;  2J0K A;  1RFA A;  3AXC A;  3JSV A;  4HPL B;  2K8C A;  4ZDV A;  2UYZ B;  5BO4 B;  3CST A;  3DPD A;  1Q1O A;  1V5T A;  3HHM A;  1R4N I;  1UBQ A;  3U8Z A;  4W9H A;  4MGY E;  4KZC A;  3PHW B;  2MBH A;  2KC1 A;  3VVW B;  3JSV B;  2JPH A;  3A9K B;  3DBH I;  2LAS A;  4PYZ A;  2BWF A;  4BKS A;  5CHV C;  1WGG A;  4DHZ E;  1P0R A;  3R7Q A;  3TIX A;  1UBI A;  2KJ6 A;  2MA9 B;  2LRU A;  4IUM B;  4K7S A;  2JWZ A;  3U7D A;  2CU1 A;  2FAZ A;  4J6I A;  1WY8 A;  2D07 B;  3VQI A;  2BF8 B;  3NS8 A;  1WXV A;  4KZ0 A;  2DYM A;  2K39 A;  3PT2 B;  2WYQ A;  3QWZ B;  4LDT D;  4E3C A;  2N9E B;  1UEL A;  4GDL A;  2LXA A;  1X1M A;  1GUA B;  2MBQ A;  3KUC B;  3CF6 E;  3OJ4 B;  1UH6 A;  1WR6 E;  4JGH B;  5TR5 A;  2LUE A;  4HLE A;  4NAW B;  5D7G A;  3ZNG C;  3ZUN A;  4GDL B;  4GU2 A;  2DAJ A;  3B0A A;  1H4R A;  2ZJD A;  1IYF A;  3L08 A;  3GOE A;  3I3T B;  5DPW A;  3A9J A;  4BVU C;  4ASW C;  5FR6 A;  3MJW A;  1R4M I;  1Z5S B;  3OJ3 A;  2WX0 A;  3RZF A;  2PPH A;  1LXD A;  2LZ6 A;  3JYU A;  1YIW A;  4G0N B;  1E8Y A;  4G11 A;  2G4D B;  1C1Y B;  2KKC A;  1OTR B;  4FJZ A;  4MGI E;  3ZW3 A;  3RUI B;  5L95 C;  2ZNV C;  3AI5 A;  4WQO B;  4W9I A;  1WZ0 A;  4W9D A;  2KMA A;  2KFJ A;  4EZJ A;  3NHE B;  1WYW B;  4PS8 A;  4AJY B;  3M62 B;  3IG3 A;  1V2Y A;  2J0M A;  1Q5W B;  2MP2 A;  1WJU A;  3HM6 X;  4KIK A;  3KH0 A;  4MGK E;  3DVN U;  2ZPN A;  4F8C B;  3L10 B;  4AJW A;  2GBR A;  2K8H A;  4ZRJ A;  1WIA A;  2VRR B;  3APC A;  4IG7 B;  2J0J A;  2OJR A;  4YL8 A;  2C7N B;  1L2N A;  4RM9 A;  4WJQ A;  2HTH A;  2IYD B;  2MP2 B;  4KIK B;  2JZZ A;  3ZRC A;  1Y8R C;  2C5L C;  4KSK C;  3QIJ A;  2FCM A;  3D32 A;  3L54 A;  4DWF A;  1OEY A;  3VTV A;  1NDD A;  2WDT B;  4ANX A;  4DHJ D;  3H1U A;  3RZW C;  3VHT C;  1YD8 U;  1M94 A;  4GMV A;  2KVR A;  1WJ6 A;  2A4Z A;  3VTW A;  3W1S A;  1OGW A;  3VFK A;  4HVB A;  2AL3 A;  2LVQ A;  2FCN A;  3ONS A;  3RT3 B;  4BBN F;  3PPA A;  3ZRF A;  5C1Z A;  3V62 A;  2BYV E;  3NZS A;  1V5O A;  4FN2 A;  2V1Y A;  2JUO A;  4GOC A;  2HJ8 A;  5KHQ A;  4I6P A;  1WGY A;  2BPS A;  3H6N A;  3ZKJ C;  3LDZ E;  3WA0 A;  3CSF A;  4TQ0 A;  2L7R A;  4ZRK A;  1UZX B;  1LQB A;  2HE7 A;  4LJO B;  2KXJ A;  4M8N A;  3VAW A;  5AZH A;  5HKH A;  3KW5 B;  2GMI C;  3KUZ A;  4I6L B;  1WE6 A;  1WRD B;  2DZM A;  1GC7 A;  4WJP A;  3PRM B;  1VD2 A;  3SDL C;  2GBN A;  4KSL C;  4GXB A;  2NR2 A;  4JL9 A;  4B9K A;  2NBW B;  4ICU A;  2XBB C;  4LJP B;  5G2N A;  3V61 A;  1WM2 A;  2NCN A;  2LJ5 A;  4OVU A;  2KDI A;  2MQJ A;  3AU5 A;  2DZK A;  5J2R A;  3WAP A;  2KJH B;  4IM3 A;  3VH3 B;  1C3T A;  4MM3 A;  2EKE C;  2M17 A;  1OQY A;  4MGZ E;  1WZ3 A;  2L05 A;  1WR1 A;  2OOB B;  3A9K A;  5LLI A;  3ZDM C;  4FAD A;  3R66 C;  1WX8 A;  4EEW A;  3TJP A;  3UIO B;  1J19 A;  2GBK A;  3AUL A;  2KD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...