1WX8A

Solution structure of the n-terminal ubiquitin-like domain in the 4931431f19rik protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSSGSSGVSGREPSSRIIRVSVKTPQDCHEFFLAENSNVRRFKKQISKYLHCNADRLVLIFTGKILRDQDILSQRGILDGSTVHVVVRSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
rcsb
source organism Mus musculus
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx8A00
2JF5A 2KZRA 1VCBA 3B1LX 1SIFA 3ZTDA 4MGIE 1V49A 3A4RA 3HHMA 1ZW7A 2KTRB 3APFA 2KQ7A 4MGKE 4EZLA 2C7NB 2RD0A 5CX3A 3RT3B 1E7UA 3KYDD 1LXDA 3KW5B 4GDKB 2IO3B 1GJZA 1P98A 3RCZA 2MBBB 3CSFA 4KVGB 3H1UA 3L17A 2JY6A 1WE6A 4FHJA 2FCMA 3VFKA 4WJNA 3UQBA 2CHWA 3T8MA 2J0KA 2IO1B 4JGHB 2K39A 2YVCA 1WJ6A 2LGYA 1L7YA 2R2QA 3S2AA 4IWOA 1RLFA 4TQ0A 4NPNA 2O6VA 2MBEA 4KSLC 1WRDB 2KANA 2MQJA 3LDZE 3EC8A 2KJ6A 4W9CA 4KZCA 1GC7A 3DQVA 4HCPB 2NBWB 2JVCA 2GBJA 2D3GA 3PS6A 4NJ7A 2OOBB 4WWPA 2NBUA 1T0YA 4KIKA 4NAWB 4NQKE 4HCNB 3H6NA 1G6JA 4F7ZA 1HE8A 2AL6A 2HD5B 4GDLA 5TR5A 2L7RA 2LXCA 2ZPNA 3NHEB 2XK5B 3OAWA 3TJPA 3WANA 1V2YA 2FCQA 4MSMB 3P2BA 1TZ1A 1ZKHA 2K8BA 4XC2A 4B95A 4I6PA 1WMHB 2O2VA 2BYVE 2L3ZA 3ZNID 2RR9A 3VTWA 3TMPB 1J19A 1Z2MA 2UWQA 4PS7A 4CO7A 1V5TA 3QAQA 2FUHB 3UGBB 4OVVA 1Q5WB 5E6PA 4FJZA 5JZEB 1YD8U 4ZYNA 4AP4C 4K7WA 2WWZA 5CHFA 4BKTA 4HJKA 2MWSB 1V6EA 2WX0A 1WGHA 5DPWA 1WJUA 1P3QU 1LM8B 2C7MB 4IC7B 2DAJA 2IYDB 1EO6A 4LDTB 2LUEA 2KFKA 4IWQA 4DHJD 3W1YA 3ZNZB 2LGDA 4LDTD 3QJZA 2MRPA 1YIWA 2QHOA 2LRWA 2EMSA 2XBBC 3GOEA 4GMVA 2L0FA 4LJPB 4II2B 2BYFA 1WGYA 1YX5B 4PYUA 4P7IA 4DHZE 4FN2A 3AU4A 2LGXA 2ZPYA 4DXAB 2DX5B 4JLCA 1AARA 3Q3FA 3AULA 1TBEA 5D2MB 4ANXA 3L0WB 4BKSA 2ASQA 2KX3A 2NVUI 2N7DA 2CU1A 3D32A 1WZ3A 2K8HA 3TL5A 5HKHA 4DHZB 4W9DA 3SHQA 1UGMA 4HLEA 3V6CB 1V86A 4N9F4 2PEAA 4DDGD 1IPGA 3R3MA 1UBIA 4RMAA 1WGRA 1Q0WB 2NPTB 2MP2B 2PE6B 3R66C 3VXWA 3ZDTA 3C0RB 2JRIB 3BINA 2G3QB 4EZKA 2D11A 4W9JA 2EMTA 3BY4B 2JWZA 4B6WA 3EHVA 2DAFA 2K6QA 2FCSA 2RGFA 3QC8B 5IAAC 1LFDA 3M63B 3R7QA 2AYOB 2KLCA 3L16A 2J7QB 2KTRA 2N9PC 2D10A 2ZNVC 2KWCA 1P9DU 3ZW3A 3NY5A 3JVZX 3OLMD 1WI0A 4WWNA 4HK2A 2Y5BB 3MHSD 1CMXB 4GDKA 3RULA 2N7EA 3V60A 3CMMB 2Z0DB 2MA9B 2ZZPB 5FR6A 4MELA 2KDFB 4EOYA 3HM6X 2L0TA 4CYEA 1C1YB 4BOSC 4BFRA 4A20A 3LJ3A 4GN1A 1WM3A 2K8CA 4CHKA 2BYEA 2I1JA 4MJSB 1WX9A 4NNJB 3A1QB 1NI2A 3DVGY 5G2NA 3RZWC 3DPDA 2DZMA 3KH0A 5L83A 2BKFA 4HDOA 2ZCBA 4HPLB 3V62A 3ML8A 2PPHA 3AXCA 3PGEA 4X57B 4ASWC 3QIJA 3H7PB 2KQSA 1TGZB 2DZKA 3JYUA 3RD2A 3KUZA 1WF9A 2XEWA 4HVBA 3VQIA 4EFOA 2REXA 2KJHB 3VUXA 1UH6A 2KMAA 2V1YA 3HM3A 1NBFC 3ZRCA 4GSWA 3DBSA 4IM0A 2AEHA 3H7SA 5J18A 1E8XA 2XK5A 5CHVC 2KC1A 5DPRA 2A4ZA 4GIVA 2I1KA 2MBHA 2N9XA 3K9OB 4WAAA 5D6JB 1SGHA 5DPSA 1WJ4A 3QCAA 1LQBA 2LRUA 1WMHA 2KHWB 5CHWA 3NOBA 5JHAA 3QHTA 2CR5A 3QX1A 3VAWA 4AOFA 2CS4A 4JQWC 3IVFA 3UF8A 2LJ5A 1X1MA 2KKCA 4BVUC 2ZCCA 3JSVA 3U30A 3DVNU 3M62B 1I42A 3ZTCA 2IBIB 2KN5A 5EDSA 4EKUA 1S1QB 5AZGA 1D3ZA 4IUMB 5J17A 2JZZA 3VH3B 4PS3A 5C1ZA 5KHOA 4W9IA 1V81A 2IZVB 4TQ1A 3HIZA 4GB9A 2KMCA 2DENB 3WA0A 1A5RA 3TCAA 2NBVB 3IG3A 4FULA 4ANUA 4M0WB 2LVPA 2BWES 4FADA 4EZJA 3DBRI 2IY1B 5LXHA 2DYBA 4ZRKA 4MH0E 2BPSA 5J2RA 3B08A 4W9KA 4A3PA 3WAPA 3IBEA 4LCDE 5LLIA 4FBJB 3V61A 2MLBA 3PREA 5IA7A 2FAZA 4JIOU 4F1SA 4G0NB 1YQBA 4LJOB 1EF5A 1WZ0A 2Z59B 5L95C 3PLUA 2FIDA 2GBNA 4HDQA 4GGQA 4WJPA 4XZ4A 1WH3A 1XD3B 1SE9A 1F9JA 1WJNA 4NJ6A 2DYOA 3SD5A 1GG3A 1WX7A 3SU8X 4M8NA 2KWVB 2NPTA 2NR2A 1PQSA 2MP2A 3AI5A 2FNJB 2K25A 1IP9A 3ALBA 2D2QA 4HPMB 3X23A 3MJWA 3A9JB 4GU2A 1E8ZA 2M17A 1E7VA 3RUIB 2LXAA 2ZJDA 3HK0A 3ZNGC 2GBRA 2JUOA 4AUQC 2KXJA 1Y8RC 2G4SA 3UIPB 1OQYA 2CHZA 1E90A 1ZGUB 1H8CA 2DZJA 2K1FA 3SDLC 3L54A 3W1SA 1WXMA 3DVNV 4FLHA 1OEYA 4IWPA 2D07B 2JXXA 1QZEA 4W9EA 1WY8A 4RM9A 4TUUA 3VUYA 4WWOA 3A4SC 4AWJA 5CTRC 3ONSA 4MGYE 1OTRB 3U8ZA 2IY0B 3JW0X 2RSUA 2M4NA 4KSKC 3CSTA 3WALA 3ML9A 1GUAB 3O65B 2M8SA 2GBKA 2KX0A 4MJSA 4PYZA 2LVOA 3A1QA 5KHQA 2WDTB 1S3SG 5AEKB 3PRMB 2MSED 5D94A 1H4RA 2HJ8A 2KO3A 3OJ4B 1YX6B 3H7PA 4OVUA 3ZUNA 4URKA 4E3CA 1XT9B 1E5WA 3APDA 1I35A 1E8WA 4KDLB 2KDIA 4AJYB 3V6EB 2G4DB 3PZDA 2NS5A 1NDDA 2C9WB 1R4MI 2PE9A 1C3TA 2KLGA 3T9LA 2W9NA 3VUWA 2L05A 4IW0A 3ECIA 1E8YA 1V5OA 4DWFA 3PRPB 2KDBA 3A9KB 1WGGA 3QK0A 4IM2A 2LWPA 3VVWB 2N4FA 3L10B 4MDKE 4ZRIA 2CHXA 4NAWA 4RM8A 4G3XB 2ZVNA 3ZDMC 3M95A 2M1MA 2BF8B 2C60A 1FXTB 2KJRA 4IM3A 2J0JA 5E6NA 1RRBA 4DK5A 2MW5A 3VTVA 2GOWA 1UELA 4J6IA 5G55A 3RYTA 1WE7A 1UZXB 4K7UA 4KDIC 5GMVA 1RFAA 2ZVOA 5BO4B 3UIOB 2C5LC 5C23A 2IO0B 3KYCD 5AZFA 5DPTA 3UINB 3DVGX 3EFUA 3IFWB 4K7SA 1WXAA 3ZVVA 4E71A 5JH5C 4W9HA 4K1RB 2ZNVB 5E6OA 2Z0EB 2KDEB 2DHZA 2GMIC 1K8RB 1WX8A 1YJ1A 2WYQA 4FA6A 2KD0A 4ANVA 2JT4B 1UD7A 5D7GA 3NZSA 1GC6A 3OJ3A 4K81A 2FCNA 4FJVB 4KZ0A 3QWZB 2G45B 1XQQA 3DDCB 3DCGA 3PVLA 3ZKJC 1TTNA 3ZRFA 2KK8A 4GXBA 4BBNC 1MG8A 1P1AA 1KLVA 4I6NB 2IO2B 2JPHA 4WQOB 2AWTA 1WM2A 3PV1A 1U4AA 2MX2A 4M8MA 5DCNA 3DOWA 2N9EB 3PHWB 4G50A 5AZHA 4EEWA 2LVQA 3QA8A 2EKEC 3PHXB 3N30A 4MSQB 3ZIMA 4ZDVA 2KC2A 3PT2B 4JL9A 2MCNB 4HXDA 3A9JA 2N1VA 4G11A 1KOTA 1WIAA 3DBLI 3N32A 3PLVA 3M3JA 2O6VB 3K9PB 2BKRB 4WJOA 3ZLZA 3WAOA 1WGDA 3TBLD 4EUTA 1GNUA 2O6VD 3ENEA 4MEMA 1WR6E 4DBGA 3EECA 3KUDB 2KOXA 4WJQA 2K6DB 1BT0A 4KIKB 2UYZB 4BKGA 2PJHA 4HWIB 2JRHA 2HTHA 1V80A 3JSVB 3NZUA 4GDLB 4W9FA 1WR1A 1IYFA 3TIXA 2HE7A 3B0AA 2C7HA 1J8CA 2LZ6A 2M0XA 4ICUA 4IG7B 2R2OA 3W1SC 1WFYA 2DZIA 3RZFA 2LASA 1M94A 1WYWB 4TKNA 3PTFC 3Q3JA 4I6LB 3QQ8B 4DHJB 1EF1A 3VDZA 2O2VB 3WAMA 1VD2A 4KV2A 1KM7A 3VH4B 2L8JA 2RPQA 2MBQA 2MBOA 1L2NA 1OGWA 1JRUA 2CKHB 3MTNB 3ZNHB 1Q1OA 2NCNA 2KFJA 4PS8A 4FHKA 4ANWA 1R4NI 2KWUB 1KJTA 2ZEQA 1J0GA 4MGZE 3L08A 4TV3A 4XX5A 4B9KA 2KFKB 4YL8A 3N3KB 3WIMA 3U7DA 1UBQA 4E74A 4A3OA 2J0MA 4MM3A 3PRZA 4II3B 3A9KA 3PPAA 2LD9A 3ZO5B 4NY0A 3VTUA 2A5UA 3CF6E 2AL3A 3L13A 4GOCA 1Z5SB 4ZRJA 3R7RA 1RAXA 2KNBA 1WXVA 4AJWA 2N1WA 4BBNF 2DYMA 4ICVA 4W9GA 3UQAA 1EUVB 4W9LA 4NQLB 2BWFA 4F8CB 4BKSD 1ISNA 1V9JA 2GBMA 2KTFA 2YLMA 3NS8A 1P0RA 3IHPC 3DBHI 3H9DA 2L76A 2OJRA 3KUCB 3KVFB 3AU5A 3APCA 3QARA 3VHTC 3A33B 4DDID 2B3AA 2V4LA 3PSEB 2LI5A 2BGFA 2JZ3B 1WXSA 5LXIB 1OEYJ 2L00B 4FJYA 3X0WA 5JHBA 4BOZB 2FIFA 3I3TB 2KVRA 2V3SA 2VRRB 2WX1A 3GZNI
chains in the Genus database with same CATH superfamily
1VCBA 3A4RA 3BYTB 1PFDA 4RF0A 3KYDD 1LXDA 3KW5B 3IT4B 1IUEA 1GJZA 1DYQA 1MHHE 2V9HA 2MBBB 3RCZA 4KVGB 2JYTA 3H1UA 3L17A 2JY6A 1N60A 1DOYA 3LXFA 3UQBA 4KX6B 1ACCA 1F52A 2YVCA 1WJ6A 1L7YA 3S2AA 1RLFA 4TQ0A 2MBEA 1RYJA 1WRDB 2KANA 3LDZE 1R4NB 1GC7A 3I57A 2GBJA 1T6BX 3OG5A 1L6VA 1J7AA 4WWPA 3H6NA 3AEEB 3VRBB 2AL6A 4GDLA 1OQQA 4ACFA 2L7RA 3NHEB 1PGBA 1V2YA 1TZ1A 1ZKHA 1JALA 1QOFA 3RNGC 3Q3OC 1F2RI 4ZYSA 4LTUA 2UWQA 4CO7A 1N6ZA 4FJZA 1E6EB 1LO5D 4BKTA 2MWSB 2IYDB 1J7BA 2IPKD 4LDTB 4IWQA 3ZNZB 2LRWA 1HA5A 2BYFA 2Q5WD 2WXGA 1L6UA 2LGXA 4Q2JA 4JLCA 3EUB2 1HZ6A 1TBEA 4ANXA 3L0WB 1OFFA 4A90A 2ASQA 4W9DA 4HLEA 3NUHB 4OZAA 3TUOA 3MP9A 1MVKA 1V86A 4N9F4 4DDGD 1UBIA 4K3CA 3KLSX 3VXWA 3C0RB 4EZKA 5I4DA 5T8IA 2JWZA 2K5PA 3W2DA 2FCSA 2XN9C 1FEHA 2K3UA 2N9PC 2D10A 3AE7B 3VR9B 1P9DU 4NJCA 3NY5A 3JVZX 4QAYA 4HK2A 2Y5BB 3MHSD 3Q3MC 2Z0DB 3FAHA 2QSDA 1ZUD2 2L0TA 4CYEA 4BOSC 4BFRA 1JMLA 1TY0A 4O1NA 2G9HD 2G1EA 1WM3A 1YN4A 3VR8B 2BYEA 4CHKA 3DPDA 2BT6A 2PW9A 5IP4D 4HDOA 4XDCA 1YMHE 3ML8A 3PGEA 3KUZA 3V05A 4HVBA 1I4XA 2KJHB 3U52E 1NBFC 3MFGA 3DBSA 2EELA 4NZLB 3WCQA 1F0ZA 4GIVA 2MBHA 5D6JB 3BIID 4WAAA 1WJ4A 2XNAC 1QOBA 3VAWA 4RF1A 4JQWC 2BB6A 4AOFA 3UF8A 2H89B 3AEDB 2J53A 2FUG1 2ZCCA 1VZ8A 2WGSA 5EDSA 1FNUA 1D3ZA 3AE9B 5H92C 1Q10A 4IUMB 4PS3A 1FNWA 1V81A 4GB9A 2L1AA 2KMCA 3WA0A 3TCAA 2NBVB 2BWES 2IY1B 2DYBA 1YQ3B 5J2RA 1VLBA 4W9KA 3WAPA 3IBEA 5D3DA 5LLIA 4FBJB 3V61A 2BW2A 2FAZA 2VH2A 1T0QC 2Z59B 3RPFC 4HDQA 4GGQA 4XZ4A 1WGKA 1VJKA 1SE9A 1WJNA 2D5GA 1C9FA 3SD5A 1GG3A 3SU8X 4C80A 2FNJB 1VZ7A 2SEBD 1ZP0B 3X23A 2SAKA 1E7VA 3W5UB 2LXAA 3ZNGC 1KLUD 4AUQC 3Q8FA 2W82A 1Y8RC 2CHZA 1TS2A 2DZJA 3L54A 1WXMA 1N62A 2H88B 4IWPA 2D07B 2JXXA 1HEZE 1QZEA 3A4SC 2I2YA 4MGYE 3U8ZA 2OJWA 2RSUA 4KSKC 1GUAB 3EGRA 3AE3B 2MSED 5D94A 2HJ8A 3OJ4B 1YX6B 4URKA 3KQ4A 2WXJA 1I35A 1MFWA 1QOAA 4AJYB 3V6EB 3PZDA 2NS5A 1NDDA 1MJDA 1C3TA 3T9LA 2W9NA 4IDIA 2KDBA 1WGGA 1GOZA 2N4FA 3HVDA 2WHIA 3M95A 4LLGM 2BF8B 4P16A 5E6NA 4DK5A 5G55A 4J6IA 1UZXB 1C77A 2ZVOA 1I4GA 5BO4B 1QKZA 3ZVVA 1WXAA 2Z0EB 2DHZA 2GMIC 1YJ1A 2KD0A 4ANVA 2JT4B 2W3SA 4OHJA 4FJVB 4KZ0A 3QWZB 1XQQA 3DDCB 3CIRB 4GXBA 2IO2B 3P1MA 2DBYA 1WM2A 1RFKA 4M8MA 2WU2B 5DCNA 3AV8A 3PHWB 3PHXB 3N30A 3U2SC 3ZIMA 1L4ZB 5EE0A 2INPE 1KOTA 1B9RA 4ZOHC 1ET9A 3GE8C 4YSZB 3K9PB 2BKRB 4WJOA 3ZLZA 2O6VD 3ENEA 1WR6E 3EECA 2K6DB 5BYSA 1QQRA 2JRHA 2HTHA 1V80A 1IYFA 3O13A 1J8CA 5AUIA 3PTFC 2V3NA 3BVGA 3QQ8B 2L8JA 1L2NA 2CKHB 1Q1OA 1GAQB 1ZE3D 1NVID 4XX5A 4ZRQA 1C4AA 1M4VA 3VRAB 4E74A 4A3OA 1ZDXA 3AE1B 4RGOS 4KGRA 2A5UA 1D6EC 5MPOA 1C76A 3R7RA 2JXTA 4BBNF 4AJWA 1YN3A 1EUVB 4F8CB 2JU6X 2MHJA 4BKSD 1SEBD 2KTFA 3Q3NC 3AU5A 3VHTC 4GLSC 5IKCM 2LI5A 1EWYC 1JWUD 1C78A 2L00B 3X0WA 2KWDA 1IGCA 2KVRA 1UNSA 2GLSA 1D5MC 2E6XA 3ZTDA 4MGIE 1V49A 2LHEA 2DNFA 5E6JA 1ZW7A 4REZA 2KTRB 3APFA 1HXYD 4EZLA 3AMZA 2RD0A 1RWSA 1E7UA 4RFBA 1K50A 2BQQA 4FHJA 2FCMA 2PTLA 1EU4A 3T8MA 1TYGB 2K39A 2LGYA 2R2QA 4HJGE 4IWOA 4NPNA 4KSLC 2J42A 4W9CA 4KZCA 2JVCA 3N1YC 2D3GA 3PS6A 3GE3C 2OOBB 1TKEA 2NBUA 4NQKE 5BYQA 1G6JA 4F7ZA 2HD5B 1L0YB 1HQRD 3OAWA 4XWTA 3RFZB 2QCZA 4XC2A 3P2BA 2N0SB 4K3BA 1WMHB 4PT5A 2BYVE 1SE3A 2LUMA 1NYQA 3E56A 4LNOA 3QAQA 1YJJA 5E6PA 4AP4C 4K7WA 1IGDA 2WWZA 4HJKA 2WX0A 1V6EA 4L2YA 1WJUA 1LM8B 4IC7B 1R7SA 3SFEB 4JX1C 2RDBC 1HZ5A 3QJZA 1QT9A 2EMSA 1AW7A 3MC9A 4LJPB 4II2B 1YX5B 3FC4A 4DHZE 2ZPYA 1E0ZA 2DX5B 1B1ZA 2CU1A 3D32A 3SHQA 1XLPA 3V6CB 1IPGA 3R3MA 4B0EA 3TEZA 1WGRA 2K0PA 1Q0WB 1DOXA 1ESFA 3ZDTA 2G3QB 2R61A 3BY4B 3FILB 4B6WA 2RGFA 3RMKC 1LFDA 4C56C 2KLCA 3DHGC 2KTRA 3L16A 4WWMA 3C8YA 3OLMD 1WI0A 3CWIA 2ZZPB 5FR6A 3EFCA 1JWSD 4WAFA 4EOYA 3ETRA 1E10A 2QMTA 4MJSB 3DVGY 2V4IB 4ITKA 5G2NA 3T3NA 5L83A 2PLPA 2ZCBA 4X57B 3P42A 3DWMA 2DZKA 3JYUA 3RD2A 1WF9A 2XEWA 3VQIA 2REXA 3VUXA 1UH6A 2KMAA 4GSWA 4IM0A 5J18A 1E8XA 5BMIA 1K52A 2IGGA 1SGHA 5DPSA 3BK1A 1LQBA 2LRUA 1WMHA 2DLBA 3NOBA 2KKCA 1ENFA 3NZ3A 3DVNU 3E9SA 5AZGA 3VH3B 5C1ZA 2GB1A 4W9IA 4JWUC 3RNAC 1PDXA 4TQ1A 1C4PA 3HIZA 3ZJVA 3IG3A 4M0WB 2WXQA 3B08A 2LMCA 3TEWA 2ZW1A 2MLBA 4ARCA 1OQRA 3PLUA 3P4SB 2IDYA 4XE0A 4NJ6A 1R4MB 3AI5A 2MJDA 3A9JB 2RPVA 1E8ZA 2Y3AA 3FILA 3HK0A 2GBRA 4C7YA 1FFUA 1TS3A 2KXJA 2G4SA 4JE3B 3SFDB 1ZGUB 3AE8B 4XYCA 3SDLC 3B9JA 4W9EA 1XCQL 4TUUA 3VUYA 3ONSA 3MHZA 4US8A 1FCLA 2M4NA 1AN8A 2KX0A 4MJSA 4PYZA 2LVOA 5KHQA 5AEKB 3PRMB 2LHDA 2DWQA 2KO3A 4OVUA 2NMQA 5HFYA 1E5WA 4WURA 3P4QB 2WNMA 2KDIA 2BTEA 1PYWD 2LFIA 2C9WB 2PE9A 1LGRA 2QIEB 1SE4A 1P7FA 4IM2A 3URYA 3L10B 1HTOA 1CZPA 2ZW0A 1FO4A 1FXTB 1E9MA 2KJRA 5IOIA 2GOWA 1DOIA 1WE7A 4K7UA 4J3OD 2C5LC 2KACA 3KYCD 5AZFA 3UINB 3EFUA 2PIAA 1ZXHA 5JH5C 4M0WA 4XDDA 5E6OA 3ZJTA 4LK0M 3SR6A 4FA6A 3AM9A 3NZSA 2KMMA 3TSSA 1TTNA 2YEPB 3RNEC 1JQ4A 1MG8A 1EWCA 4HKQA 2B76B 2L32A 1ET6A 2N9EB 4G50A 5AZHA 2LVQA 3QA8A 2EKEC 3A9JA 2J52A 3N32A 3M3JA 2O6VB 1NEKB 1WGDA 4DQOC 4EUTA 2JSVX 3KUDB 4WJQA 1TZOA 4YTPB 1BT0A 2QJLA 1QOGA 1CK1A 4A9AA 4BKGA 1KLGD 1QILA 3JSVB 4W9FA 1WR1A 3TIXA 2LZ6A 3HRDD 4ICUA 4IG7B 3W1SC 2IGHA 2LGSA 2DZIA 2LASA 1WYWB 4TKNA 2AQ2B 2K22A 1KM7A 3GZNB 3VH4B 2MBQA 1T0RC 2MBOA 4A55A 1NYRA 2BYTA 5BMGA 2HDEA 3BK2A 1YNTE 4PS8A 2L52A 1KJTA 1J0GA 3Q14C 2V3PA 1SBBB 3PRZA 2LD9A 3ZO5B 4NY0A 2NTSA 2ICIA 1AWDA 1FPYA 3CF6E 4GOCA 4ZRJA 2DYMA 1FRRA 2YLMA 3NS8A 1P0RA 1XLNA 2WXFA 3AE2B 3IHPC 1UWXA 2L76A 2OJRA 3KUCB 3QARA 3A33B 3AE4B 2QILA 1WXSA 4FJYA 2KVZA 5JHBA 2LJIA 5FKAC 5HI1A 2TSSA 2V3SA 2VRRB 2WX1A 3ZGZA 3N9YC 4H2AA 2KZRA 1SIFA 3HHMA 5CX3A 4HPPA 4LNKA 4GDKB 3CSFA 1WE6A 4OVZA 3SEBA 2INCC 2GI9A 2CHWA 2J0KA 2IO1B 4JGHB 1FRDA 4HEA1 2BBCA 2O6VA 2MQJA 3AECB 2KJ6A 3DQVA 4HCPB 2NBWB 1UGJA 4NAWB 1T0YA 3NG0A 2FBWB 5TR5A 4AQ7A 2W54A 2ZPNA 1D5ZC 3TJPA 3RNBC 2AX5A 3WANA 2FCQA 4P6VF 4B95A 4I6PA 3AE5B 5IN7A 2L3ZA 3ZNID 2RR9A 3TMPB 4PS7A 4KKJA 3UGBB 4OVVA 1ZDVA 1Q5WB 3AEAB 5JZEB 1YD8U 2BS4B 4ZYNA 4ZHPA 5EE1A 2WXIA 1N63A 1EM7A 1P3QU 3ZYYX 2DAJA 1EO6A 2LUEA 3W9CB 4FXCA 2MRPA 1UWMA 3HUIA 1EU3A 2XBBC 3GOEA 3P4PB 4GMVA 2L0FA 4P7IA 3AU4A 1AARA 3AULA 1KH0A 3FKYA 4BKSA 2RMMA 2NVUI 4RCOA 5HKHA 1L4DB 4DHZB 4OW0A 3AE6B 2AQ3B 4AS1A 3NVZA 4ARIA 2CJOA 2PE6B 2WXLA 5EE3A 1D5XC 1SXTA 2WU5B 2PVGC 2D11A 4W9JA 3AN1A 4D2KA 2DAFA 3DHHC 3QC8B 2AYOB 1FXAA 1V1OA 2ZNVC 2KWCA 2M0AA 2BVCA 1TS5A 4GDKA 3RULA 3CMMB 3R8BA 4MELA 2KDFB 3HM6X 4A6QA 1C1YB 3U4EG 3LJ3A 3N1XC 2MEKA 4NNJB 1NI2A 5D3IB 3KH0A 2MJ3A 3V62A 4HPLB 4ASWC 3QIJA 3H7PB 4YT0B 1TJEA 1E7PB 1GB4A 5BYRA 3HM3A 2V1YA 3ZRCA 2WXMA 3TEYA 5DPRA 2A4ZA 2N9XA 3K9OB 4MT5A 2KHWB 5CHWA 5JHAA 3NVVA 1T5XD 1X1MA 2ACZB 4BVUC 3U30A 1I42A 3ZTCA 2KN5A 4EKUA 1S1QB 3KWLA 3OWEB 5J17A 1TT5B 2Z8LA 2IZVB 2CU3A 2DENB 4ANUA 1JWMD 4EZJA 5G5HA 3DBRI 5EE9A 1PUTA 4ZRKA 4MH0E 2BPSA 1KTKA 2INDC 3AH7A 1WRIA 4F1SA 4G0NB 4YXDB 1YQBA 4LJOB 1HTQA 4WJPA 5H8YE 1XD3B 1FFVA 1I4QA 1WX7A 2KWVB 1IP9A 2K25A 3ALBA 2D2QA 4HPMB 3MJWA 2IJ0A 2ZJDA 1E90A 1OEYA 1L5PA 3J9CA 4A8XC 4N6EB 3BVZA 1WY8A 4WWOA 3HVZA 2IY0B 4YTMB 3PO0A 4M01A 3CSTA 3WALA 3ML9A 3BVMA 2JYEA 2D3AA 3O65B 1UUPA 4YSYB 4C7ZA 3PZ8A 4LNNA 1PGAA 3I63C 3H7PA 3ZUNA 2VZKD 3ZXVA 1XT9B 1E8WA 1ZOYB 3I9V1 1MPEA 1TIFA 2WXKA 3DBRB 4XGAB 2G4DB 1FCCC 1FMAD 3U7ZA 1R4MI 2KLGA 1D4BA 1E8YA 2Y5CA 4MM3B 4DWFA 1C4CA 1SB3C 1QF6A 4TMAB 3VVWB 4ZRIA 2CHXA 3ZQ4A 5AUKA 2ZVNA 4B0MA 2D3BA 2C60A 3NJTA 3BZDB 4C4VB 2J0JA 1RRBA 1JRPA 3VTVA 1UELA 4KDIC 3UIOB 1RFAA 4WIPA 2IO0B 2INNE 4C00A 4IKGA 2W3RA 2KDEB 4MACA 1UF0A 1UD7A 5D7GA 1GC6A 2FCNA 3RNFC 4US9A 2FE8A 3ZRFA 4BBNC 4HROA 1XF5L 1BXTA 3PZ7A 4WQOB 2AWTA 2WDQB 3PV1A 2MX2A 4EE2A 4DXGA 4EEWA 2UU7A 3DWGC 2MH7A 4MSQB 4JL9A 2MCNB 4G11A 1WIAA 3ABVB 4MH8A 1YJIA 1I4HA 1JWBD 3WAOA 3TBLD 4RGMA 1GNUA 3MC0B 2VH1A 4MEMA 5JXVA 4KIKB 3B2FA 2CJNA 4HWIB 3NZUA 2BS3B 3B0AA 1FD6A 4XWWA 4BAXA 4DHJB 1EF1A 4YWGG 2O2VB 1VD2A 2N7JA 4IOIE 4KV2A 2RPQA 1WSPA 1OGWA 2WXPA 3ZNHB 1F2RC 2ONQA 3DHIC 4S17A 2KFJA 3NVWA 2WXRA 4FHKA 4ANWA 2KWUB 1V97A 3L08A 1V1PB 4TV3A 4B9KA 1GB1A 2W55A 2KFKB 4YL8A 3N3KB 4WQMA 3GP7A 3IAM1 1UBQA 2J0MA 1T0SC 4MM3A 4II3B 1VZ6A 3MC8A 1JROA 1SIJA 3TEXA 3R2IA 3IAS1 1RAXA 2KNBA 2N1WA 3UQAA 4W9GA 4C4VA 4N59A 4W9LA 1ZPSA 2QC8A 2BWFA 1ISNA 1MG4A 2GBMA 3DBHI 3APCA 5GXGB 4DDID 2PMVA 2GRIA 2BGFA 4LNIA 4BOZB 2FIFA 1J7CA 2BS2B 3I3TB 3Q8EA 1FNVA 3GZNI 2I38A 2RDGA 2JF5A 4ZHOA 3B1LX 4MGKE 2KQ7A 4M02A 3ZXRA 2C7NB 3RT3B 2N9LA 2IO3B 1P98A 2WXHA 4P1CC 3VFKA 4WJNA 2Y5PA 2KT7A 1FXIA 1C79A 1KF6B 2JX5A 3EC8A 4NJ7A 3KWVA 4KIKA 4HCNB 3RNCC 1T3QA 1HE8A 3BYYB 2LXCA 1ZXIA 2XK5B 3R2TA 1K51A 4MSMB 2K8BA 1SJHD 2O2VA 4PK1A 1I4PA 1SJED 3VTWA 1J19A 1Z2MA 4L1BA 1V5TA 3EA6A 2BB5A 2FUHB 3DBHB 1KRHA 2WP9B 4USAA 5CHFA 2KYWA 5DPWA 1WGHA 2C7MB 1V1PA 1SSNA 2KFKA 3GB1A 5C3JB 4DHJD 4ZRPA 3W1YA 2LGDA 4LDTD 1YIWA 2QHOA 3N1ZC 1WGYA 1IBXB 4PYUA 4FN2A 4DXAB 4M00A 3Q3FA 5D2MB 2EKIA 2X38A 2QEJC 1XCTL 2KX3A 2N7DA 1WZ3A 2K8HA 1YOVB 3TL5A 1UGMA 4UDUC 2WS3B 2PEAA 4RMAA 1PGXA 2L83A 1MI0A 2NPTB 2MP2B 3R66C 2JRIB 3BINA 2AQ1B 2EMTA 3EHVA 1Y56A 4KKIA 4YTNB 2K6QA 1YQ4B 5IAAC 1CQVA 3M63B 3R7QA 2J7QB 4DXFA 1P7EA 3ZW3A 4WWNA 1CMXB 2N7EA 3V60A 2WDVB 2MA9B 4RH6A 2QDFA 3NS1A 4L23A 4A20A 4GN1A 2K8CA 2I1JA 2KN4A 1WX9A 3A1QB 3RZWC 2RDHA 2DZMA 2BKFA 2PPHA 3AXCA 4NAMA 4N58A 1JW9D 2KQSA 1TGZB 1I7HA 4EFOA 1STEA 1SE2A 2K9XA 2AEHA 3H7SA 2XK5A 1YN5A 5CHVC 2KC1A 4HRSA 1VRAB 2I1KA 4OZCA 3Q69A 3QCAA 3QHTA 2CR5A 3QX1A 2CS4A 3IVFA 2V0GA 2LJ5A 1NENB 3B2GA 3JSVA 3M62B 3N20C 2IBIB 2HJ1A 3H8HA 2OEDA 3L4PA 2JZZA 5KHOA 3P63A 1TS4A 3P4RB 2LEKA 1A5RA 2M56B 4FULA 2LVPA 2J4XA 4FADA 5LXHA 3IT6B 1IBXA 1DGJA 3ZJUA 4A3PA 1VDVA 4LCDE 3T3OA 3PREA 2PKOA 3RN9C 5IA7A 4JIOU 1VR9A 3Q8AA 1WYGA 1EF5A 1WWTA 1WZ0A 5L95C 2FIDA 2GBNA 1XXGA 1WH3A 1FM0D 1KFYB 4RNAA 1F9JA 4R3DA 2DYOA 4M8NA 2NPTA 2NR2A 1PQSA 2MP2A 3Q6BA 3MJ5A 4GU2A 4BZAA 2MJEA 4S0RA 2M17A 3RUIB 2JUOA 2D3CA 3UIPB 1L0VB 1OQYA 5BMHA 3I5JC 1H8CA 4OZBA 2K1FA 3W1SA 3DVNV 1JCKB 4FLHA 1JWAD 1XLQA 4RM9A 5G5GA 4JWSC 4AWJA 2IGDA 5CTRC 1OTRB 3JW0X 4LNFA 3NVYA 3W5VB 2M8SA 2GBKA 3A1QA 2E3TA 2WDTB 1S3SG 2VZKB 4KGSA 1H4RA 3AEGB 4E3CA 4HKZE 1N5XA 3APDA 3AEFB 3V3XA 4KDLB 2KAJA 3VUWA 2L05A 4IW0A 3ECIA 1RM6C 1V5OA 3GS2A 3PRPB 3A9KB 3QK0A 2KDMA 2LWPA 3Q2AC 1N61A 4TSSA 1K53A 2WXOA 4MDKE 2WXNA 4NAWA 4RM8A 4G3XB 3ZDMC 1XEEA 2NTTA 2M1MA 2N9KA 3NRZA 2M19A 2JZPA 4IM3A 1V8CA 3IXSA 2JQRB 2MW5A 3RYTA 1SF0A 5GMVA 5C23A 5DPTA 3DVGX 3IFWB 4K7SA 4E71A 4W9HA 4K1RB 2ZNVB 2KQ4X 5LNK1 1K8RB 1WX8A 2WQYB 2WYQA 2OHFA 3OJ3A 4K81A 2G45B 4YSXB 3DCGA 3PVLA 3ZKJC 2KK8A 1KLVA 5C2TB 1P1AA 4I6NB 3UI3A 2JPHA 1XO3A 1U4AA 5IO9A 3DOWA 2LGIA 2ON8A 4ZDVA 2KC2A 3PT2B 4HXDA 2N1VA 3DBLI 1BUIC 3PLVA 1FIQA 1AYFA 4DBGA 2KOXA 1F1HA 1NI3A 3C19A 1A70A 2UYZB 2YEPF 2PJHA 4GDLB 2HTME 1CJEA 2HE7A 2C7HA 3BWUD 2M0XA 2R2OA 1WFYA 1ROEA 1WXQA 3RZFA 1M94A 3Q8BA 3Q3JA 4I6LB 1XLOA 2X8XX 3VDZA 3WAMA 2WLBA 1JRUA 3MTNB 5FK9C 4RGTA 3AEBB 1QLBB 1N5WA 2NCNA 4RGNA 4P1BC 1R4NI 2ZEQA 4MGZE 1TY2A 5TSSA 5FR3A 3WIMA 3U7DA 3Q8CA 1L0XB 3A9KA 3PPAA 3AB5A 4WH4A 3VTUA 4JPSA 2AL3A 3L13A 1Z5SB 1WXVA 3LYYA 1TKGA 4ICVA 5HG2A 2WDRB 4NQLB 1GPXA 1MHXA 1V9JA 4CQNA 3RI7C 2PVOD 3H9DA 3DBLB 3KVFB 4KGTA 2B3AA 5HHDG 2V4LA 3PSEB 2JZ3B 1I4RA 1BMLC 1F77A 1OEYJ 5LXIB 1TKYA 3LB8C 2JWUA
chains in the Genus database with same CATH topology
2JF5A 2KZRA 1VCBA 3B1LX 1SIFA 3ZTDA 4MGIE 1V49A 3A4RA 3HHMA 1ZW7A 2KTRB 3APFA 2KQ7A 4MGKE 4EZLA 2C7NB 2RD0A 5CX3A 3RT3B 1E7UA 3KYDD 1LXDA 3KW5B 4GDKB 2IO3B 1GJZA 1P98A 3RCZA 2MBBB 3CSFA 4KVGB 3H1UA 3L17A 2JY6A 1WE6A 4FHJA 2FCMA 3VFKA 4WJNA 3UQBA 2CHWA 3T8MA 2J0KA 2IO1B 4JGHB 2K39A 2YVCA 1WJ6A 2LGYA 1L7YA 2R2QA 3S2AA 4IWOA 1RLFA 4TQ0A 4NPNA 2O6VA 2MBEA 4KSLC 1WRDB 2KANA 2MQJA 3LDZE 3EC8A 2KJ6A 4W9CA 4KZCA 1GC7A 3DQVA 4HCPB 2NBWB 2JVCA 2GBJA 2D3GA 3PS6A 4NJ7A 2OOBB 4WWPA 2NBUA 1T0YA 4KIKA 4NAWB 4NQKE 4HCNB 3H6NA 1G6JA 4F7ZA 1HE8A 2AL6A 2HD5B 4GDLA 5TR5A 2L7RA 2LXCA 2ZPNA 3NHEB 2XK5B 3OAWA 3TJPA 3WANA 1V2YA 2FCQA 4MSMB 3P2BA 1TZ1A 1ZKHA 2K8BA 4XC2A 4B95A 4I6PA 1WMHB 2O2VA 2BYVE 2L3ZA 3ZNID 2RR9A 3VTWA 3TMPB 1J19A 1Z2MA 2UWQA 4PS7A 4CO7A 1V5TA 3QAQA 2FUHB 3UGBB 4OVVA 1Q5WB 5E6PA 4FJZA 5JZEB 1YD8U 4ZYNA 4AP4C 4K7WA 2WWZA 5CHFA 4BKTA 4HJKA 2MWSB 1V6EA 2WX0A 1WGHA 5DPWA 1WJUA 1P3QU 1LM8B 2C7MB 4IC7B 2DAJA 2IYDB 1EO6A 4LDTB 2LUEA 2KFKA 4IWQA 4DHJD 3W1YA 3ZNZB 2LGDA 4LDTD 3QJZA 2MRPA 1YIWA 2QHOA 2LRWA 2EMSA 2XBBC 3GOEA 4GMVA 2L0FA 4LJPB 4II2B 2BYFA 1WGYA 1YX5B 4PYUA 4P7IA 4DHZE 4FN2A 3AU4A 2LGXA 2ZPYA 4DXAB 2DX5B 4JLCA 1AARA 3Q3FA 3AULA 1TBEA 5D2MB 4ANXA 3L0WB 4BKSA 2ASQA 2KX3A 2NVUI 2N7DA 2CU1A 3D32A 1WZ3A 2K8HA 3TL5A 5HKHA 4DHZB 4W9DA 3SHQA 1UGMA 4HLEA 3V6CB 1V86A 4N9F4 2PEAA 4DDGD 1IPGA 3R3MA 1UBIA 4RMAA 1WGRA 1Q0WB 2NPTB 2MP2B 2PE6B 3R66C 3VXWA 3ZDTA 3C0RB 2JRIB 3BINA 2G3QB 4EZKA 2D11A 4W9JA 2EMTA 3BY4B 2JWZA 4B6WA 3EHVA 2DAFA 2K6QA 2FCSA 2RGFA 3QC8B 5IAAC 1LFDA 3M63B 3R7QA 2AYOB 2KLCA 3L16A 2J7QB 2KTRA 2N9PC 2D10A 2ZNVC 2KWCA 1P9DU 3ZW3A 3NY5A 3JVZX 3OLMD 1WI0A 4WWNA 4HK2A 2Y5BB 3MHSD 1CMXB 4GDKA 3RULA 2N7EA 3V60A 3CMMB 2Z0DB 2MA9B 2ZZPB 5FR6A 4MELA 2KDFB 4EOYA 3HM6X 2L0TA 4CYEA 1C1YB 4BOSC 4BFRA 4A20A 3LJ3A 4GN1A 1WM3A 2K8CA 4CHKA 2BYEA 2I1JA 4MJSB 1WX9A 4NNJB 3A1QB 1NI2A 3DVGY 5G2NA 3RZWC 3DPDA 2DZMA 3KH0A 5L83A 2BKFA 4HDOA 2ZCBA 4HPLB 3V62A 3ML8A 2PPHA 3AXCA 3PGEA 4X57B 4ASWC 3QIJA 3H7PB 2KQSA 1TGZB 2DZKA 3JYUA 3RD2A 3KUZA 1WF9A 2XEWA 4HVBA 3VQIA 4EFOA 2REXA 2KJHB 3VUXA 1UH6A 2KMAA 2V1YA 3HM3A 1NBFC 3ZRCA 4GSWA 3DBSA 4IM0A 2AEHA 3H7SA 5J18A 1E8XA 2XK5A 5CHVC 2KC1A 5DPRA 2A4ZA 4GIVA 2I1KA 2MBHA 2N9XA 3K9OB 4WAAA 5D6JB 1SGHA 5DPSA 1WJ4A 3QCAA 1LQBA 2LRUA 1WMHA 2KHWB 5CHWA 3NOBA 5JHAA 3QHTA 2CR5A 3QX1A 3VAWA 4AOFA 2CS4A 4JQWC 3IVFA 3UF8A 2LJ5A 1X1MA 2KKCA 4BVUC 2ZCCA 3JSVA 3U30A 3DVNU 3M62B 1I42A 3ZTCA 2IBIB 2KN5A 5EDSA 4EKUA 1S1QB 5AZGA 1D3ZA 4IUMB 5J17A 2JZZA 3VH3B 4PS3A 5C1ZA 5KHOA 4W9IA 1V81A 2IZVB 4TQ1A 3HIZA 4GB9A 2KMCA 2DENB 3WA0A 1A5RA 3TCAA 2NBVB 3IG3A 4FULA 4ANUA 4M0WB 2LVPA 2BWES 4FADA 4EZJA 3DBRI 2IY1B 5LXHA 2DYBA 4ZRKA 4MH0E 2BPSA 5J2RA 3B08A 4W9KA 4A3PA 3WAPA 3IBEA 4LCDE 5LLIA 4FBJB 3V61A 2MLBA 3PREA 5IA7A 2FAZA 4JIOU 4F1SA 4G0NB 1YQBA 4LJOB 1EF5A 1WZ0A 2Z59B 5L95C 3PLUA 2FIDA 2GBNA 4HDQA 4GGQA 4WJPA 4XZ4A 1WH3A 1XD3B 1SE9A 1F9JA 1WJNA 4NJ6A 2DYOA 3SD5A 1GG3A 1WX7A 3SU8X 4M8NA 2KWVB 2NPTA 2NR2A 1PQSA 2MP2A 3AI5A 2FNJB 2K25A 1IP9A 3ALBA 2D2QA 4HPMB 3X23A 3MJWA 3A9JB 4GU2A 1E8ZA 2M17A 1E7VA 3RUIB 2LXAA 2ZJDA 3HK0A 3ZNGC 2GBRA 2JUOA 4AUQC 2KXJA 1Y8RC 2G4SA 3UIPB 1OQYA 2CHZA 1E90A 1ZGUB 1H8CA 2DZJA 2K1FA 3SDLC 3L54A 3W1SA 1WXMA 3DVNV 4FLHA 1OEYA 4IWPA 2D07B 2JXXA 1QZEA 4W9EA 1WY8A 4RM9A 4TUUA 3VUYA 4WWOA 3A4SC 4AWJA 5CTRC 3ONSA 4MGYE 1OTRB 3U8ZA 2IY0B 3JW0X 2RSUA 2M4NA 4KSKC 3CSTA 3WALA 3ML9A 1GUAB 3O65B 2M8SA 2GBKA 2KX0A 4MJSA 4PYZA 2LVOA 3A1QA 5KHQA 2WDTB 1S3SG 5AEKB 3PRMB 2MSED 5D94A 1H4RA 2HJ8A 2KO3A 3OJ4B 1YX6B 3H7PA 4OVUA 3ZUNA 4URKA 4E3CA 1XT9B 1E5WA 3APDA 1I35A 1E8WA 4KDLB 2KDIA 4AJYB 3V6EB 2G4DB 3PZDA 2NS5A 1NDDA 2C9WB 1R4MI 2PE9A 1C3TA 2KLGA 3T9LA 2W9NA 3VUWA 2L05A 4IW0A 3ECIA 1E8YA 1V5OA 4DWFA 3PRPB 2KDBA 3A9KB 1WGGA 3QK0A 4IM2A 2LWPA 3VVWB 2N4FA 3L10B 4MDKE 4ZRIA 2CHXA 4NAWA 4RM8A 4G3XB 2ZVNA 3ZDMC 3M95A 2M1MA 2BF8B 2C60A 1FXTB 2KJRA 4IM3A 2J0JA 5E6NA 1RRBA 4DK5A 2MW5A 3VTVA 2GOWA 1UELA 4J6IA 5G55A 3RYTA 1WE7A 1UZXB 4K7UA 4KDIC 5GMVA 1RFAA 2ZVOA 5BO4B 3UIOB 2C5LC 5C23A 2IO0B 3KYCD 5AZFA 5DPTA 3UINB 3DVGX 3EFUA 3IFWB 4K7SA 1WXAA 3ZVVA 4E71A 5JH5C 4W9HA 4K1RB 2ZNVB 5E6OA 2Z0EB 2KDEB 2DHZA 2GMIC 1K8RB 1WX8A 1YJ1A 2WYQA 4FA6A 2KD0A 4ANVA 2JT4B 1UD7A 5D7GA 3NZSA 1GC6A 3OJ3A 4K81A 2FCNA 4FJVB 4KZ0A 3QWZB 2G45B 1XQQA 3DDCB 3DCGA 3PVLA 3ZKJC 1TTNA 3ZRFA 2KK8A 4GXBA 4BBNC 1MG8A 1P1AA 1KLVA 4I6NB 2IO2B 2JPHA 4WQOB 2AWTA 1WM2A 3PV1A 1U4AA 2MX2A 4M8MA 5DCNA 3DOWA 2N9EB 3PHWB 4G50A 5AZHA 4EEWA 2LVQA 3QA8A 2EKEC 3PHXB 3N30A 4MSQB 3ZIMA 4ZDVA 2KC2A 3PT2B 4JL9A 2MCNB 4HXDA 3A9JA 2N1VA 4G11A 1KOTA 1WIAA 3DBLI 3N32A 3PLVA 3M3JA 2O6VB 3K9PB 2BKRB 4WJOA 3ZLZA 3WAOA 1WGDA 3TBLD 4EUTA 1GNUA 2O6VD 3ENEA 4MEMA 1WR6E 4DBGA 3EECA 3KUDB 2KOXA 4WJQA 2K6DB 1BT0A 4KIKB 2UYZB 4BKGA 2PJHA 4HWIB 2JRHA 2HTHA 1V80A 3JSVB 3NZUA 4GDLB 4W9FA 1WR1A 1IYFA 3TIXA 2HE7A 3B0AA 2C7HA 1J8CA 2LZ6A 2M0XA 4ICUA 4IG7B 2R2OA 3W1SC 1WFYA 2DZIA 3RZFA 2LASA 1M94A 1WYWB 4TKNA 3PTFC 3Q3JA 4I6LB 3QQ8B 4DHJB 1EF1A 3VDZA 2O2VB 3WAMA 1VD2A 4KV2A 1KM7A 3VH4B 2L8JA 2RPQA 2MBQA 2MBOA 1L2NA 1OGWA 1JRUA 2CKHB 3MTNB 3ZNHB 1Q1OA 2NCNA 2KFJA 4PS8A 4FHKA 4ANWA 1R4NI 2KWUB 1KJTA 2ZEQA 1J0GA 4MGZE 3L08A 4TV3A 4XX5A 4B9KA 2KFKB 4YL8A 3N3KB 3WIMA 3U7DA 1UBQA 4E74A 4A3OA 2J0MA 4MM3A 3PRZA 4II3B 3A9KA 3PPAA 2LD9A 3ZO5B 4NY0A 3VTUA 2A5UA 3CF6E 2AL3A 3L13A 4GOCA 1Z5SB 4ZRJA 3R7RA 1RAXA 2KNBA 1WXVA 4AJWA 2N1WA 4BBNF 2DYMA 4ICVA 4W9GA 3UQAA 1EUVB 4W9LA 4NQLB 2BWFA 4F8CB 4BKSD 1ISNA 1V9JA 2GBMA 2KTFA 2YLMA 3NS8A 1P0RA 3IHPC 3DBHI 3H9DA 2L76A 2OJRA 3KUCB 3KVFB 3AU5A 3APCA 3QARA 3VHTC 3A33B 4DDID 2B3AA 2V4LA 3PSEB 2LI5A 2BGFA 2JZ3B 1WXSA 5LXIB 1OEYJ 2L00B 4FJYA 3X0WA 5JHBA 4BOZB 2FIFA 3I3TB 2KVRA 2V3SA 2VRRB 2WX1A 3GZNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF5 A;  2KZR A;  1VCB A;  3B1L X;  1SIF A;  3ZTD A;  4MGI E;  1V49 A;  3A4R A;  3HHM A;  1ZW7 A;  2KTR B;  3APF A;  2KQ7 A;  4MGK E;  4EZL A;  2C7N B;  2RD0 A;  5CX3 A;  3RT3 B;  1E7U A;  3KYD D;  1LXD A;  3KW5 B;  4GDK B;  2IO3 B;  1GJZ A;  1P98 A;  3RCZ A;  2MBB B;  3CSF A;  4KVG B;  3H1U A;  3L17 A;  2JY6 A;  1WE6 A;  4FHJ A;  2FCM A;  3VFK A;  4WJN A;  3UQB A;  2CHW A;  3T8M A;  2J0K A;  2IO1 B;  4JGH B;  2K39 A;  2YVC A;  1WJ6 A;  2LGY A;  1L7Y A;  2R2Q A;  3S2A A;  4IWO A;  1RLF A;  4TQ0 A;  4NPN A;  2O6V A;  2MBE A;  4KSL C;  1WRD B;  2KAN A;  2MQJ A;  3LDZ E;  3EC8 A;  2KJ6 A;  4W9C A;  4KZC A;  1GC7 A;  3DQV A;  4HCP B;  2NBW B;  2JVC A;  2GBJ A;  2D3G A;  3PS6 A;  4NJ7 A;  2OOB B;  4WWP A;  2NBU A;  1T0Y A;  4KIK A;  4NAW B;  4NQK E;  4HCN B;  3H6N A;  1G6J A;  4F7Z A;  1HE8 A;  2AL6 A;  2HD5 B;  4GDL A;  5TR5 A;  2L7R A;  2LXC A;  2ZPN A;  3NHE B;  2XK5 B;  3OAW A;  3TJP A;  3WAN A;  1V2Y A;  2FCQ A;  4MSM B;  3P2B A;  1TZ1 A;  1ZKH A;  2K8B A;  4XC2 A;  4B95 A;  4I6P A;  1WMH B;  2O2V A;  2BYV E;  2L3Z A;  3ZNI D;  2RR9 A;  3VTW A;  3TMP B;  1J19 A;  1Z2M A;  2UWQ A;  4PS7 A;  4CO7 A;  1V5T A;  3QAQ A;  2FUH B;  3UGB B;  4OVV A;  1Q5W B;  5E6P A;  4FJZ A;  5JZE B;  1YD8 U;  4ZYN A;  4AP4 C;  4K7W A;  2WWZ A;  5CHF A;  4BKT A;  4HJK A;  2MWS B;  1V6E A;  2WX0 A;  1WGH A;  5DPW A;  1WJU A;  1P3Q U;  1LM8 B;  2C7M B;  4IC7 B;  2DAJ A;  2IYD B;  1EO6 A;  4LDT B;  2LUE A;  2KFK A;  4IWQ A;  4DHJ D;  3W1Y A;  3ZNZ B;  2LGD A;  4LDT D;  3QJZ A;  2MRP A;  1YIW A;  2QHO A;  2LRW A;  2EMS A;  2XBB C;  3GOE A;  4GMV A;  2L0F A;  4LJP B;  4II2 B;  2BYF A;  1WGY A;  1YX5 B;  4PYU A;  4P7I A;  4DHZ E;  4FN2 A;  3AU4 A;  2LGX A;  2ZPY A;  4DXA B;  2DX5 B;  4JLC A;  1AAR A;  3Q3F A;  3AUL A;  1TBE A;  5D2M B;  4ANX A;  3L0W B;  4BKS A;  2ASQ A;  2KX3 A;  2NVU I;  2N7D A;  2CU1 A;  3D32 A;  1WZ3 A;  2K8H A;  3TL5 A;  5HKH A;  4DHZ B;  4W9D A;  3SHQ A;  1UGM A;  4HLE A;  3V6C B;  1V86 A;  4N9F 4;  2PEA A;  4DDG D;  1IPG A;  3R3M A;  1UBI A;  4RMA A;  1WGR A;  1Q0W B;  2NPT B;  2MP2 B;  2PE6 B;  3R66 C;  3VXW A;  3ZDT A;  3C0R B;  2JRI B;  3BIN A;  2G3Q B;  4EZK A;  2D11 A;  4W9J A;  2EMT A;  3BY4 B;  2JWZ A;  4B6W A;  3EHV A;  2DAF A;  2K6Q A;  2FCS A;  2RGF A;  3QC8 B;  5IAA C;  1LFD A;  3M63 B;  3R7Q A;  2AYO B;  2KLC A;  3L16 A;  2J7Q B;  2KTR A;  2N9P C;  2D10 A;  2ZNV C;  2KWC A;  1P9D U;  3ZW3 A;  3NY5 A;  3JVZ X;  3OLM D;  1WI0 A;  4WWN A;  4HK2 A;  2Y5B B;  3MHS D;  1CMX B;  4GDK A;  3RUL A;  2N7E A;  3V60 A;  3CMM B;  2Z0D B;  2MA9 B;  2ZZP B;  5FR6 A;  4MEL A;  2KDF B;  4EOY A;  3HM6 X;  2L0T A;  4CYE A;  1C1Y B;  4BOS C;  4BFR A;  4A20 A;  3LJ3 A;  4GN1 A;  1WM3 A;  2K8C A;  4CHK A;  2BYE A;  2I1J A;  4MJS B;  1WX9 A;  4NNJ B;  3A1Q B;  1NI2 A;  3DVG Y;  5G2N A;  3RZW C;  3DPD A;  2DZM A;  3KH0 A;  5L83 A;  2BKF A;  4HDO A;  2ZCB A;  4HPL B;  3V62 A;  3ML8 A;  2PPH A;  3AXC A;  3PGE A;  4X57 B;  4ASW C;  3QIJ A;  3H7P B;  2KQS A;  1TGZ B;  2DZK A;  3JYU A;  3RD2 A;  3KUZ A;  1WF9 A;  2XEW A;  4HVB A;  3VQI A;  4EFO A;  2REX A;  2KJH B;  3VUX A;  1UH6 A;  2KMA A;  2V1Y A;  3HM3 A;  1NBF C;  3ZRC A;  4GSW A;  3DBS A;  4IM0 A;  2AEH A;  3H7S A;  5J18 A;  1E8X A;  2XK5 A;  5CHV C;  2KC1 A;  5DPR A;  2A4Z A;  4GIV A;  2I1K A;  2MBH A;  2N9X A;  3K9O B;  4WAA A;  5D6J B;  1SGH A;  5DPS A;  1WJ4 A;  3QCA A;  1LQB A;  2LRU A;  1WMH A;  2KHW B;  5CHW A;  3NOB A;  5JHA A;  3QHT A;  2CR5 A;  3QX1 A;  3VAW A;  4AOF A;  2CS4 A;  4JQW C;  3IVF A;  3UF8 A;  2LJ5 A;  1X1M A;  2KKC A;  4BVU C;  2ZCC A;  3JSV A;  3U30 A;  3DVN U;  3M62 B;  1I42 A;  3ZTC A;  2IBI B;  2KN5 A;  5EDS A;  4EKU A;  1S1Q B;  5AZG A;  1D3Z A;  4IUM B;  5J17 A;  2JZZ A;  3VH3 B;  4PS3 A;  5C1Z A;  5KHO A;  4W9I A;  1V81 A;  2IZV B;  4TQ1 A;  3HIZ A;  4GB9 A;  2KMC A;  2DEN B;  3WA0 A;  1A5R A;  3TCA A;  2NBV B;  3IG3 A;  4FUL A;  4ANU A;  4M0W B;  2LVP A;  2BWE S;  4FAD A;  4EZJ A;  3DBR I;  2IY1 B;  5LXH A;  2DYB A;  4ZRK A;  4MH0 E;  2BPS A;  5J2R A;  3B08 A;  4W9K A;  4A3P A;  3WAP A;  3IBE A;  4LCD E;  5LLI A;  4FBJ B;  3V61 A;  2MLB A;  3PRE A;  5IA7 A;  2FAZ A;  4JIO U;  4F1S A;  4G0N B;  1YQB A;  4LJO B;  1EF5 A;  1WZ0 A;  2Z59 B;  5L95 C;  3PLU A;  2FID A;  2GBN A;  4HDQ A;  4GGQ A;  4WJP A;  4XZ4 A;  1WH3 A;  1XD3 B;  1SE9 A;  1F9J A;  1WJN A;  4NJ6 A;  2DYO A;  3SD5 A;  1GG3 A;  1WX7 A;  3SU8 X;  4M8N A;  2KWV B;  2NPT A;  2NR2 A;  1PQS A;  2MP2 A;  3AI5 A;  2FNJ B;  2K25 A;  1IP9 A;  3ALB A;  2D2Q A;  4HPM B;  3X23 A;  3MJW A;  3A9J B;  4GU2 A;  1E8Z A;  2M17 A;  1E7V A;  3RUI B;  2LXA A;  2ZJD A;  3HK0 A;  3ZNG C;  2GBR A;  2JUO A;  4AUQ C;  2KXJ A;  1Y8R C;  2G4S A;  3UIP B;  1OQY A;  2CHZ A;  1E90 A;  1ZGU B;  1H8C A;  2DZJ A;  2K1F A;  3SDL C;  3L54 A;  3W1S A;  1WXM A;  3DVN V;  4FLH A;  1OEY A;  4IWP A;  2D07 B;  2JXX A;  1QZE A;  4W9E A;  1WY8 A;  4RM9 A;  4TUU A;  3VUY A;  4WWO A;  3A4S C;  4AWJ A;  5CTR C;  3ONS A;  4MGY E;  1OTR B;  3U8Z A;  2IY0 B;  3JW0 X;  2RSU A;  2M4N A;  4KSK C;  3CST A;  3WAL A;  3ML9 A;  1GUA B;  3O65 B;  2M8S A;  2GBK A;  2KX0 A;  4MJS A;  4PYZ A;  2LVO A;  3A1Q A;  5KHQ A;  2WDT B;  1S3S G;  5AEK B;  3PRM B;  2MSE D;  5D94 A;  1H4R A;  2HJ8 A;  2KO3 A;  3OJ4 B;  1YX6 B;  3H7P A;  4OVU A;  3ZUN A;  4URK A;  4E3C A;  1XT9 B;  1E5W A;  3APD A;  1I35 A;  1E8W A;  4KDL B;  2KDI A;  4AJY B;  3V6E B;  2G4D B;  3PZD A;  2NS5 A;  1NDD A;  2C9W B;  1R4M I;  2PE9 A;  1C3T A;  2KLG A;  3T9L A;  2W9N A;  3VUW A;  2L05 A;  4IW0 A;  3ECI A;  1E8Y A;  1V5O A;  4DWF A;  3PRP B;  2KDB A;  3A9K B;  1WGG A;  3QK0 A;  4IM2 A;  2LWP A;  3VVW B;  2N4F A;  3L10 B;  4MDK E;  4ZRI A;  2CHX A;  4NAW A;  4RM8 A;  4G3X B;  2ZVN A;  3ZDM C;  3M95 A;  2M1M A;  2BF8 B;  2C60 A;  1FXT B;  2KJR A;  4IM3 A;  2J0J A;  5E6N A;  1RRB A;  4DK5 A;  2MW5 A;  3VTV A;  2GOW A;  1UEL A;  4J6I A;  5G55 A;  3RYT A;  1WE7 A;  1UZX B;  4K7U A;  4KDI C;  5GMV A;  1RFA A;  2ZVO A;  5BO4 B;  3UIO B;  2C5L C;  5C23 A;  2IO0 B;  3KYC D;  5AZF A;  5DPT A;  3UIN B;  3DVG X;  3EFU A;  3IFW B;  4K7S A;  1WXA A;  3ZVV A;  4E71 A;  5JH5 C;  4W9H A;  4K1R B;  2ZNV B;  5E6O A;  2Z0E B;  2KDE B;  2DHZ A;  2GMI C;  1K8R B;  1WX8 A;  1YJ1 A;  2WYQ A;  4FA6 A;  2KD0 A;  4ANV A;  2JT4 B;  1UD7 A;  5D7G A;  3NZS A;  1GC6 A;  3OJ3 A;  4K81 A;  2FCN A;  4FJV B;  4KZ0 A;  3QWZ B;  2G45 B;  1XQQ A;  3DDC B;  3DCG A;  3PVL A;  3ZKJ C;  1TTN A;  3ZRF A;  2KK8 A;  4GXB A;  4BBN C;  1MG8 A;  1P1A A;  1KLV A;  4I6N B;  2IO2 B;  2JPH A;  4WQO B;  2AWT A;  1WM2 A;  3PV1 A;  1U4A A;  2MX2 A;  4M8M A;  5DCN A;  3DOW A;  2N9E B;  3PHW B;  4G50 A;  5AZH A;  4EEW A;  2LVQ A;  3QA8 A;  2EKE C;  3PHX B;  3N30 A;  4MSQ B;  3ZIM A;  4ZDV A;  2KC2 A;  3PT2 B;  4JL9 A;  2MCN B;  4HXD A;  3A9J A;  2N1V A;  4G11 A;  1KOT A;  1WIA A;  3DBL I;  3N32 A;  3PLV A;  3M3J A;  2O6V B;  3K9P B;  2BKR B;  4WJO A;  3ZLZ A;  3WAO A;  1WGD A;  3TBL D;  4EUT A;  1GNU A;  2O6V D;  3ENE A;  4MEM A;  1WR6 E;  4DBG A;  3EEC A;  3KUD B;  2KOX A;  4WJQ A;  2K6D B;  1BT0 A;  4KIK B;  2UYZ B;  4BKG A;  2PJH A;  4HWI B;  2JRH A;  2HTH A;  1V80 A;  3JSV B;  3NZU A;  4GDL B;  4W9F A;  1WR1 A;  1IYF A;  3TIX A;  2HE7 A;  3B0A A;  2C7H A;  1J8C A;  2LZ6 A;  2M0X A;  4ICU A;  4IG7 B;  2R2O A;  3W1S C;  1WFY A;  2DZI A;  3RZF A;  2LAS A;  1M94 A;  1WYW B;  4TKN A;  3PTF C;  3Q3J A;  4I6L B;  3QQ8 B;  4DHJ B;  1EF1 A;  3VDZ A;  2O2V B;  3WAM A;  1VD2 A;  4KV2 A;  1KM7 A;  3VH4 B;  2L8J A;  2RPQ A;  2MBQ A;  2MBO A;  1L2N A;  1OGW A;  1JRU A;  2CKH B;  3MTN B;  3ZNH B;  1Q1O A;  2NCN A;  2KFJ A;  4PS8 A;  4FHK A;  4ANW A;  1R4N I;  2KWU B;  1KJT A;  2ZEQ A;  1J0G A;  4MGZ E;  3L08 A;  4TV3 A;  4XX5 A;  4B9K A;  2KFK B;  4YL8 A;  3N3K B;  3WIM A;  3U7D A;  1UBQ A;  4E74 A;  4A3O A;  2J0M A;  4MM3 A;  3PRZ A;  4II3 B;  3A9K A;  3PPA A;  2LD9 A;  3ZO5 B;  4NY0 A;  3VTU A;  2A5U A;  3CF6 E;  2AL3 A;  3L13 A;  4GOC A;  1Z5S B;  4ZRJ A;  3R7R A;  1RAX A;  2KNB A;  1WXV A;  4AJW A;  2N1W A;  4BBN F;  2DYM A;  4ICV A;  4W9G A;  3UQA A;  1EUV B;  4W9L A;  4NQL B;  2BWF A;  4F8C B;  4BKS D;  1ISN A;  1V9J A;  2GBM A;  2KTF A;  2YLM A;  3NS8 A;  1P0R A;  3IHP C;  3DBH I;  3H9D A;  2L76 A;  2OJR A;  3KUC B;  3KVF B;  3AU5 A;  3APC A;  3QAR A;  3VHT C;  3A33 B;  4DDI D;  2B3A A;  2V4L A;  3PSE B;  2LI5 A;  2BGF A;  2JZ3 B;  1WXS A;  5LXI B;  1OEY J;  2L00 B;  4FJY A;  3X0W A;  5JHB A;  4BOZ B;  2FIF A;  3I3T B;  2KVR A;  2V3S A;  2VRR B;  2WX1 A;  3GZN I; 
#chains in the Genus database with same CATH topology
 1VCB A;  3A4R A;  3BYT B;  1PFD A;  4RF0 A;  3KYD D;  1LXD A;  3KW5 B;  3IT4 B;  1IUE A;  1GJZ A;  1DYQ A;  1MHH E;  2V9H A;  2MBB B;  3RCZ A;  4KVG B;  2JYT A;  3H1U A;  3L17 A;  2JY6 A;  1N60 A;  1DOY A;  3LXF A;  3UQB A;  4KX6 B;  1ACC A;  1F52 A;  2YVC A;  1WJ6 A;  1L7Y A;  3S2A A;  1RLF A;  4TQ0 A;  2MBE A;  1RYJ A;  1WRD B;  2KAN A;  3LDZ E;  1R4N B;  1GC7 A;  3I57 A;  2GBJ A;  1T6B X;  3OG5 A;  1L6V A;  1J7A A;  4WWP A;  3H6N A;  3AEE B;  3VRB B;  2AL6 A;  4GDL A;  1OQQ A;  4ACF A;  2L7R A;  3NHE B;  1PGB A;  1V2Y A;  1TZ1 A;  1ZKH A;  1JAL A;  1QOF A;  3RNG C;  3Q3O C;  1F2R I;  4ZYS A;  4LTU A;  2UWQ A;  4CO7 A;  1N6Z A;  4FJZ A;  1E6E B;  1LO5 D;  4BKT A;  2MWS B;  2IYD B;  1J7B A;  2IPK D;  4LDT B;  4IWQ A;  3ZNZ B;  2LRW A;  1HA5 A;  2BYF A;  2Q5W D;  2WXG A;  1L6U A;  2LGX A;  4Q2J A;  4JLC A;  3EUB 2;  1HZ6 A;  1TBE A;  4ANX A;  3L0W B;  1OFF A;  4A90 A;  2ASQ A;  4W9D A;  4HLE A;  3NUH B;  4OZA A;  3TUO A;  3MP9 A;  1MVK A;  1V86 A;  4N9F 4;  4DDG D;  1UBI A;  4K3C A;  3KLS X;  3VXW A;  3C0R B;  4EZK A;  5I4D A;  5T8I A;  2JWZ A;  2K5P A;  3W2D A;  2FCS A;  2XN9 C;  1FEH A;  2K3U A;  2N9P C;  2D10 A;  3AE7 B;  3VR9 B;  1P9D U;  4NJC A;  3NY5 A;  3JVZ X;  4QAY A;  4HK2 A;  2Y5B B;  3MHS D;  3Q3M C;  2Z0D B;  3FAH A;  2QSD A;  1ZUD 2;  2L0T A;  4CYE A;  4BOS C;  4BFR A;  1JML A;  1TY0 A;  4O1N A;  2G9H D;  2G1E A;  1WM3 A;  1YN4 A;  3VR8 B;  2BYE A;  4CHK A;  3DPD A;  2BT6 A;  2PW9 A;  5IP4 D;  4HDO A;  4XDC A;  1YMH E;  3ML8 A;  3PGE A;  3KUZ A;  3V05 A;  4HVB A;  1I4X A;  2KJH B;  3U52 E;  1NBF C;  3MFG A;  3DBS A;  2EEL A;  4NZL B;  3WCQ A;  1F0Z A;  4GIV A;  2MBH A;  5D6J B;  3BII D;  4WAA A;  1WJ4 A;  2XNA C;  1QOB A;  3VAW A;  4RF1 A;  4JQW C;  2BB6 A;  4AOF A;  3UF8 A;  2H89 B;  3AED B;  2J53 A;  2FUG 1;  2ZCC A;  1VZ8 A;  2WGS A;  5EDS A;  1FNU A;  1D3Z A;  3AE9 B;  5H92 C;  1Q10 A;  4IUM B;  4PS3 A;  1FNW A;  1V81 A;  4GB9 A;  2L1A A;  2KMC A;  3WA0 A;  3TCA A;  2NBV B;  2BWE S;  2IY1 B;  2DYB A;  1YQ3 B;  5J2R A;  1VLB A;  4W9K A;  3WAP A;  3IBE A;  5D3D A;  5LLI A;  4FBJ B;  3V61 A;  2BW2 A;  2FAZ A;  2VH2 A;  1T0Q C;  2Z59 B;  3RPF C;  4HDQ A;  4GGQ A;  4XZ4 A;  1WGK A;  1VJK A;  1SE9 A;  1WJN A;  2D5G A;  1C9F A;  3SD5 A;  1GG3 A;  3SU8 X;  4C80 A;  2FNJ B;  1VZ7 A;  2SEB D;  1ZP0 B;  3X23 A;  2SAK A;  1E7V A;  3W5U B;  2LXA A;  3ZNG C;  1KLU D;  4AUQ C;  3Q8F A;  2W82 A;  1Y8R C;  2CHZ A;  1TS2 A;  2DZJ A;  3L54 A;  1WXM A;  1N62 A;  2H88 B;  4IWP A;  2D07 B;  2JXX A;  1HEZ E;  1QZE A;  3A4S C;  2I2Y A;  4MGY E;  3U8Z A;  2OJW A;  2RSU A;  4KSK C;  1GUA B;  3EGR A;  3AE3 B;  2MSE D;  5D94 A;  2HJ8 A;  3OJ4 B;  1YX6 B;  4URK A;  3KQ4 A;  2WXJ A;  1I35 A;  1MFW A;  1QOA A;  4AJY B;  3V6E B;  3PZD A;  2NS5 A;  1NDD A;  1MJD A;  1C3T A;  3T9L A;  2W9N A;  4IDI A;  2KDB A;  1WGG A;  1GOZ A;  2N4F A;  3HVD A;  2WHI A;  3M95 A;  4LLG M;  2BF8 B;  4P16 A;  5E6N A;  4DK5 A;  5G55 A;  4J6I A;  1UZX B;  1C77 A;  2ZVO A;  1I4G A;  5BO4 B;  1QKZ A;  3ZVV A;  1WXA A;  2Z0E B;  2DHZ A;  2GMI C;  1YJ1 A;  2KD0 A;  4ANV A;  2JT4 B;  2W3S A;  4OHJ A;  4FJV B;  4KZ0 A;  3QWZ B;  1XQQ A;  3DDC B;  3CIR B;  4GXB A;  2IO2 B;  3P1M A;  2DBY A;  1WM2 A;  1RFK A;  4M8M A;  2WU2 B;  5DCN A;  3AV8 A;  3PHW B;  3PHX B;  3N30 A;  3U2S C;  3ZIM A;  1L4Z B;  5EE0 A;  2INP E;  1KOT A;  1B9R A;  4ZOH C;  1ET9 A;  3GE8 C;  4YSZ B;  3K9P B;  2BKR B;  4WJO A;  3ZLZ A;  2O6V D;  3ENE A;  1WR6 E;  3EEC A;  2K6D B;  5BYS A;  1QQR A;  2JRH A;  2HTH A;  1V80 A;  1IYF A;  3O13 A;  1J8C A;  5AUI A;  3PTF C;  2V3N A;  3BVG A;  3QQ8 B;  2L8J A;  1L2N A;  2CKH B;  1Q1O A;  1GAQ B;  1ZE3 D;  1NVI D;  4XX5 A;  4ZRQ A;  1C4A A;  1M4V A;  3VRA B;  4E74 A;  4A3O A;  1ZDX A;  3AE1 B;  4RGO S;  4KGR A;  2A5U A;  1D6E C;  5MPO A;  1C76 A;  3R7R A;  2JXT A;  4BBN F;  4AJW A;  1YN3 A;  1EUV B;  4F8C B;  2JU6 X;  2MHJ A;  4BKS D;  1SEB D;  2KTF A;  3Q3N C;  3AU5 A;  3VHT C;  4GLS C;  5IKC M;  2LI5 A;  1EWY C;  1JWU D;  1C78 A;  2L00 B;  3X0W A;  2KWD A;  1IGC A;  2KVR A;  1UNS A;  2GLS A;  1D5M C;  2E6X A;  3ZTD A;  4MGI E;  1V49 A;  2LHE A;  2DNF A;  5E6J A;  1ZW7 A;  4REZ A;  2KTR B;  3APF A;  1HXY D;  4EZL A;  3AMZ A;  2RD0 A;  1RWS A;  1E7U A;  4RFB A;  1K50 A;  2BQQ A;  4FHJ A;  2FCM A;  2PTL A;  1EU4 A;  3T8M A;  1TYG B;  2K39 A;  2LGY A;  2R2Q A;  4HJG E;  4IWO A;  4NPN A;  4KSL C;  2J42 A;  4W9C A;  4KZC A;  2JVC A;  3N1Y C;  2D3G A;  3PS6 A;  3GE3 C;  2OOB B;  1TKE A;  2NBU A;  4NQK E;  5BYQ A;  1G6J A;  4F7Z A;  2HD5 B;  1L0Y B;  1HQR D;  3OAW A;  4XWT A;  3RFZ B;  2QCZ A;  4XC2 A;  3P2B A;  2N0S B;  4K3B A;  1WMH B;  4PT5 A;  2BYV E;  1SE3 A;  2LUM A;  1NYQ A;  3E56 A;  4LNO A;  3QAQ A;  1YJJ A;  5E6P A;  4AP4 C;  4K7W A;  1IGD A;  2WWZ A;  4HJK A;  2WX0 A;  1V6E A;  4L2Y A;  1WJU A;  1LM8 B;  4IC7 B;  1R7S A;  3SFE B;  4JX1 C;  2RDB C;  1HZ5 A;  3QJZ A;  1QT9 A;  2EMS A;  1AW7 A;  3MC9 A;  4LJP B;  4II2 B;  1YX5 B;  3FC4 A;  4DHZ E;  2ZPY A;  1E0Z A;  2DX5 B;  1B1Z A;  2CU1 A;  3D32 A;  3SHQ A;  1XLP A;  3V6C B;  1IPG A;  3R3M A;  4B0E A;  3TEZ A;  1WGR A;  2K0P A;  1Q0W B;  1DOX A;  1ESF A;  3ZDT A;  2G3Q B;  2R61 A;  3BY4 B;  3FIL B;  4B6W A;  2RGF A;  3RMK C;  1LFD A;  4C56 C;  2KLC A;  3DHG C;  2KTR A;  3L16 A;  4WWM A;  3C8Y A;  3OLM D;  1WI0 A;  3CWI A;  2ZZP B;  5FR6 A;  3EFC A;  1JWS D;  4WAF A;  4EOY A;  3ETR A;  1E10 A;  2QMT A;  4MJS B;  3DVG Y;  2V4I B;  4ITK A;  5G2N A;  3T3N A;  5L83 A;  2PLP A;  2ZCB A;  4X57 B;  3P42 A;  3DWM A;  2DZK A;  3JYU A;  3RD2 A;  1WF9 A;  2XEW A;  3VQI A;  2REX A;  3VUX A;  1UH6 A;  2KMA A;  4GSW A;  4IM0 A;  5J18 A;  1E8X A;  5BMI A;  1K52 A;  2IGG A;  1SGH A;  5DPS A;  3BK1 A;  1LQB A;  2LRU A;  1WMH A;  2DLB A;  3NOB A;  2KKC A;  1ENF A;  3NZ3 A;  3DVN U;  3E9S A;  5AZG A;  3VH3 B;  5C1Z A;  2GB1 A;  4W9I A;  4JWU C;  3RNA C;  1PDX A;  4TQ1 A;  1C4P A;  3HIZ A;  3ZJV A;  3IG3 A;  4M0W B;  2WXQ A;  3B08 A;  2LMC A;  3TEW A;  2ZW1 A;  2MLB A;  4ARC A;  1OQR A;  3PLU A;  3P4S B;  2IDY A;  4XE0 A;  4NJ6 A;  1R4M B;  3AI5 A;  2MJD A;  3A9J B;  2RPV A;  1E8Z A;  2Y3A A;  3FIL A;  3HK0 A;  2GBR A;  4C7Y A;  1FFU A;  1TS3 A;  2KXJ A;  2G4S A;  4JE3 B;  3SFD B;  1ZGU B;  3AE8 B;  4XYC A;  3SDL C;  3B9J A;  4W9E A;  1XCQ L;  4TUU A;  3VUY A;  3ONS A;  3MHZ A;  4US8 A;  1FCL A;  2M4N A;  1AN8 A;  2KX0 A;  4MJS A;  4PYZ A;  2LVO A;  5KHQ A;  5AEK B;  3PRM B;  2LHD A;  2DWQ A;  2KO3 A;  4OVU A;  2NMQ A;  5HFY A;  1E5W A;  4WUR A;  3P4Q B;  2WNM A;  2KDI A;  2BTE A;  1PYW D;  2LFI A;  2C9W B;  2PE9 A;  1LGR A;  2QIE B;  1SE4 A;  1P7F A;  4IM2 A;  3URY A;  3L10 B;  1HTO A;  1CZP A;  2ZW0 A;  1FO4 A;  1FXT B;  1E9M A;  2KJR A;  5IOI A;  2GOW A;  1DOI A;  1WE7 A;  4K7U A;  4J3O D;  2C5L C;  2KAC A;  3KYC D;  5AZF A;  3UIN B;  3EFU A;  2PIA A;  1ZXH A;  5JH5 C;  4M0W A;  4XDD A;  5E6O A;  3ZJT A;  4LK0 M;  3SR6 A;  4FA6 A;  3AM9 A;  3NZS A;  2KMM A;  3TSS A;  1TTN A;  2YEP B;  3RNE C;  1JQ4 A;  1MG8 A;  1EWC A;  4HKQ A;  2B76 B;  2L32 A;  1ET6 A;  2N9E B;  4G50 A;  5AZH A;  2LVQ A;  3QA8 A;  2EKE C;  3A9J A;  2J52 A;  3N32 A;  3M3J A;  2O6V B;  1NEK B;  1WGD A;  4DQO C;  4EUT A;  2JSV X;  3KUD B;  4WJQ A;  1TZO A;  4YTP B;  1BT0 A;  2QJL A;  1QOG A;  1CK1 A;  4A9A A;  4BKG A;  1KLG D;  1QIL A;  3JSV B;  4W9F A;  1WR1 A;  3TIX A;  2LZ6 A;  3HRD D;  4ICU A;  4IG7 B;  3W1S C;  2IGH A;  2LGS A;  2DZI A;  2LAS A;  1WYW B;  4TKN A;  2AQ2 B;  2K22 A;  1KM7 A;  3GZN B;  3VH4 B;  2MBQ A;  1T0R C;  2MBO A;  4A55 A;  1NYR A;  2BYT A;  5BMG A;  2HDE A;  3BK2 A;  1YNT E;  4PS8 A;  2L52 A;  1KJT A;  1J0G A;  3Q14 C;  2V3P A;  1SBB B;  3PRZ A;  2LD9 A;  3ZO5 B;  4NY0 A;  2NTS A;  2ICI A;  1AWD A;  1FPY A;  3CF6 E;  4GOC A;  4ZRJ A;  2DYM A;  1FRR A;  2YLM A;  3NS8 A;  1P0R A;  1XLN A;  2WXF A;  3AE2 B;  3IHP C;  1UWX A;  2L76 A;  2OJR A;  3KUC B;  3QAR A;  3A33 B;  3AE4 B;  2QIL A;  1WXS A;  4FJY A;  2KVZ A;  5JHB A;  2LJI A;  5FKA C;  5HI1 A;  2TSS A;  2V3S A;  2VRR B;  2WX1 A;  3ZGZ A;  3N9Y C;  4H2A A;  2KZR A;  1SIF A;  3HHM A;  5CX3 A;  4HPP A;  4LNK A;  4GDK B;  3CSF A;  1WE6 A;  4OVZ A;  3SEB A;  2INC C;  2GI9 A;  2CHW A;  2J0K A;  2IO1 B;  4JGH B;  1FRD A;  4HEA 1;  2BBC A;  2O6V A;  2MQJ A;  3AEC B;  2KJ6 A;  3DQV A;  4HCP B;  2NBW B;  1UGJ A;  4NAW B;  1T0Y A;  3NG0 A;  2FBW B;  5TR5 A;  4AQ7 A;  2W54 A;  2ZPN A;  1D5Z C;  3TJP A;  3RNB C;  2AX5 A;  3WAN A;  2FCQ A;  4P6V F;  4B95 A;  4I6P A;  3AE5 B;  5IN7 A;  2L3Z A;  3ZNI D;  2RR9 A;  3TMP B;  4PS7 A;  4KKJ A;  3UGB B;  4OVV A;  1ZDV A;  1Q5W B;  3AEA B;  5JZE B;  1YD8 U;  2BS4 B;  4ZYN A;  4ZHP A;  5EE1 A;  2WXI A;  1N63 A;  1EM7 A;  1P3Q U;  3ZYY X;  2DAJ A;  1EO6 A;  2LUE A;  3W9C B;  4FXC A;  2MRP A;  1UWM A;  3HUI A;  1EU3 A;  2XBB C;  3GOE A;  3P4P B;  4GMV A;  2L0F A;  4P7I A;  3AU4 A;  1AAR A;  3AUL A;  1KH0 A;  3FKY A;  4BKS A;  2RMM A;  2NVU I;  4RCO A;  5HKH A;  1L4D B;  4DHZ B;  4OW0 A;  3AE6 B;  2AQ3 B;  4AS1 A;  3NVZ A;  4ARI A;  2CJO A;  2PE6 B;  2WXL A;  5EE3 A;  1D5X C;  1SXT A;  2WU5 B;  2PVG C;  2D11 A;  4W9J A;  3AN1 A;  4D2K A;  2DAF A;  3DHH C;  3QC8 B;  2AYO B;  1FXA A;  1V1O A;  2ZNV C;  2KWC A;  2M0A A;  2BVC A;  1TS5 A;  4GDK A;  3RUL A;  3CMM B;  3R8B A;  4MEL A;  2KDF B;  3HM6 X;  4A6Q A;  1C1Y B;  3U4E G;  3LJ3 A;  3N1X C;  2MEK A;  4NNJ B;  1NI2 A;  5D3I B;  3KH0 A;  2MJ3 A;  3V62 A;  4HPL B;  4ASW C;  3QIJ A;  3H7P B;  4YT0 B;  1TJE A;  1E7P B;  1GB4 A;  5BYR A;  3HM3 A;  2V1Y A;  3ZRC A;  2WXM A;  3TEY A;  5DPR A;  2A4Z A;  2N9X A;  3K9O B;  4MT5 A;  2KHW B;  5CHW A;  5JHA A;  3NVV A;  1T5X D;  1X1M A;  2ACZ B;  4BVU C;  3U30 A;  1I42 A;  3ZTC A;  2KN5 A;  4EKU A;  1S1Q B;  3KWL A;  3OWE B;  5J17 A;  1TT5 B;  2Z8L A;  2IZV B;  2CU3 A;  2DEN B;  4ANU A;  1JWM D;  4EZJ A;  5G5H A;  3DBR I;  5EE9 A;  1PUT A;  4ZRK A;  4MH0 E;  2BPS A;  1KTK A;  2IND C;  3AH7 A;  1WRI A;  4F1S A;  4G0N B;  4YXD B;  1YQB A;  4LJO B;  1HTQ A;  4WJP A;  5H8Y E;  1XD3 B;  1FFV A;  1I4Q A;  1WX7 A;  2KWV B;  1IP9 A;  2K25 A;  3ALB A;  2D2Q A;  4HPM B;  3MJW A;  2IJ0 A;  2ZJD A;  1E90 A;  1OEY A;  1L5P A;  3J9C A;  4A8X C;  4N6E B;  3BVZ A;  1WY8 A;  4WWO A;  3HVZ A;  2IY0 B;  4YTM B;  3PO0 A;  4M01 A;  3CST A;  3WAL A;  3ML9 A;  3BVM A;  2JYE A;  2D3A A;  3O65 B;  1UUP A;  4YSY B;  4C7Z A;  3PZ8 A;  4LNN A;  1PGA A;  3I63 C;  3H7P A;  3ZUN A;  2VZK D;  3ZXV A;  1XT9 B;  1E8W A;  1ZOY B;  3I9V 1;  1MPE A;  1TIF A;  2WXK A;  3DBR B;  4XGA B;  2G4D B;  1FCC C;  1FMA D;  3U7Z A;  1R4M I;  2KLG A;  1D4B A;  1E8Y A;  2Y5C A;  4MM3 B;  4DWF A;  1C4C A;  1SB3 C;  1QF6 A;  4TMA B;  3VVW B;  4ZRI A;  2CHX A;  3ZQ4 A;  5AUK A;  2ZVN A;  4B0M A;  2D3B A;  2C60 A;  3NJT A;  3BZD B;  4C4V B;  2J0J A;  1RRB A;  1JRP A;  3VTV A;  1UEL A;  4KDI C;  3UIO B;  1RFA A;  4WIP A;  2IO0 B;  2INN E;  4C00 A;  4IKG A;  2W3R A;  2KDE B;  4MAC A;  1UF0 A;  1UD7 A;  5D7G A;  1GC6 A;  2FCN A;  3RNF C;  4US9 A;  2FE8 A;  3ZRF A;  4BBN C;  4HRO A;  1XF5 L;  1BXT A;  3PZ7 A;  4WQO B;  2AWT A;  2WDQ B;  3PV1 A;  2MX2 A;  4EE2 A;  4DXG A;  4EEW A;  2UU7 A;  3DWG C;  2MH7 A;  4MSQ B;  4JL9 A;  2MCN B;  4G11 A;  1WIA A;  3ABV B;  4MH8 A;  1YJI A;  1I4H A;  1JWB D;  3WAO A;  3TBL D;  4RGM A;  1GNU A;  3MC0 B;  2VH1 A;  4MEM A;  5JXV A;  4KIK B;  3B2F A;  2CJN A;  4HWI B;  3NZU A;  2BS3 B;  3B0A A;  1FD6 A;  4XWW A;  4BAX A;  4DHJ B;  1EF1 A;  4YWG G;  2O2V B;  1VD2 A;  2N7J A;  4IOI E;  4KV2 A;  2RPQ A;  1WSP A;  1OGW A;  2WXP A;  3ZNH B;  1F2R C;  2ONQ A;  3DHI C;  4S17 A;  2KFJ A;  3NVW A;  2WXR A;  4FHK A;  4ANW A;  2KWU B;  1V97 A;  3L08 A;  1V1P B;  4TV3 A;  4B9K A;  1GB1 A;  2W55 A;  2KFK B;  4YL8 A;  3N3K B;  4WQM A;  3GP7 A;  3IAM 1;  1UBQ A;  2J0M A;  1T0S C;  4MM3 A;  4II3 B;  1VZ6 A;  3MC8 A;  1JRO A;  1SIJ A;  3TEX A;  3R2I A;  3IAS 1;  1RAX A;  2KNB A;  2N1W A;  3UQA A;  4W9G A;  4C4V A;  4N59 A;  4W9L A;  1ZPS A;  2QC8 A;  2BWF A;  1ISN A;  1MG4 A;  2GBM A;  3DBH I;  3APC A;  5GXG B;  4DDI D;  2PMV A;  2GRI A;  2BGF A;  4LNI A;  4BOZ B;  2FIF A;  1J7C A;  2BS2 B;  3I3T B;  3Q8E A;  1FNV A;  3GZN I;  2I38 A;  2RDG A;  2JF5 A;  4ZHO A;  3B1L X;  4MGK E;  2KQ7 A;  4M02 A;  3ZXR A;  2C7N B;  3RT3 B;  2N9L A;  2IO3 B;  1P98 A;  2WXH A;  4P1C C;  3VFK A;  4WJN A;  2Y5P A;  2KT7 A;  1FXI A;  1C79 A;  1KF6 B;  2JX5 A;  3EC8 A;  4NJ7 A;  3KWV A;  4KIK A;  4HCN B;  3RNC C;  1T3Q A;  1HE8 A;  3BYY B;  2LXC A;  1ZXI A;  2XK5 B;  3R2T A;  1K51 A;  4MSM B;  2K8B A;  1SJH D;  2O2V A;  4PK1 A;  1I4P A;  1SJE D;  3VTW A;  1J19 A;  1Z2M A;  4L1B A;  1V5T A;  3EA6 A;  2BB5 A;  2FUH B;  3DBH B;  1KRH A;  2WP9 B;  4USA A;  5CHF A;  2KYW A;  5DPW A;  1WGH A;  2C7M B;  1V1P A;  1SSN A;  2KFK A;  3GB1 A;  5C3J B;  4DHJ D;  4ZRP A;  3W1Y A;  2LGD A;  4LDT D;  1YIW A;  2QHO A;  3N1Z C;  1WGY A;  1IBX B;  4PYU A;  4FN2 A;  4DXA B;  4M00 A;  3Q3F A;  5D2M B;  2EKI A;  2X38 A;  2QEJ C;  1XCT L;  2KX3 A;  2N7D A;  1WZ3 A;  2K8H A;  1YOV B;  3TL5 A;  1UGM A;  4UDU C;  2WS3 B;  2PEA A;  4RMA A;  1PGX A;  2L83 A;  1MI0 A;  2NPT B;  2MP2 B;  3R66 C;  2JRI B;  3BIN A;  2AQ1 B;  2EMT A;  3EHV A;  1Y56 A;  4KKI A;  4YTN B;  2K6Q A;  1YQ4 B;  5IAA C;  1CQV A;  3M63 B;  3R7Q A;  2J7Q B;  4DXF A;  1P7E A;  3ZW3 A;  4WWN A;  1CMX B;  2N7E A;  3V60 A;  2WDV B;  2MA9 B;  4RH6 A;  2QDF A;  3NS1 A;  4L23 A;  4A20 A;  4GN1 A;  2K8C A;  2I1J A;  2KN4 A;  1WX9 A;  3A1Q B;  3RZW C;  2RDH A;  2DZM A;  2BKF A;  2PPH A;  3AXC A;  4NAM A;  4N58 A;  1JW9 D;  2KQS A;  1TGZ B;  1I7H A;  4EFO A;  1STE A;  1SE2 A;  2K9X A;  2AEH A;  3H7S A;  2XK5 A;  1YN5 A;  5CHV C;  2KC1 A;  4HRS A;  1VRA B;  2I1K A;  4OZC A;  3Q69 A;  3QCA A;  3QHT A;  2CR5 A;  3QX1 A;  2CS4 A;  3IVF A;  2V0G A;  2LJ5 A;  1NEN B;  3B2G A;  3JSV A;  3M62 B;  3N20 C;  2IBI B;  2HJ1 A;  3H8H A;  2OED A;  3L4P A;  2JZZ A;  5KHO A;  3P63 A;  1TS4 A;  3P4R B;  2LEK A;  1A5R A;  2M56 B;  4FUL A;  2LVP A;  2J4X A;  4FAD A;  5LXH A;  3IT6 B;  1IBX A;  1DGJ A;  3ZJU A;  4A3P A;  1VDV A;  4LCD E;  3T3O A;  3PRE A;  2PKO A;  3RN9 C;  5IA7 A;  4JIO U;  1VR9 A;  3Q8A A;  1WYG A;  1EF5 A;  1WWT A;  1WZ0 A;  5L95 C;  2FID A;  2GBN A;  1XXG A;  1WH3 A;  1FM0 D;  1KFY B;  4RNA A;  1F9J A;  4R3D A;  2DYO A;  4M8N A;  2NPT A;  2NR2 A;  1PQS A;  2MP2 A;  3Q6B A;  3MJ5 A;  4GU2 A;  4BZA A;  2MJE A;  4S0R A;  2M17 A;  3RUI B;  2JUO A;  2D3C A;  3UIP B;  1L0V B;  1OQY A;  5BMH A;  3I5J C;  1H8C A;  4OZB A;  2K1F A;  3W1S A;  3DVN V;  1JCK B;  4FLH A;  1JWA D;  1XLQ A;  4RM9 A;  5G5G A;  4JWS C;  4AWJ A;  2IGD A;  5CTR C;  1OTR B;  3JW0 X;  4LNF A;  3NVY A;  3W5V B;  2M8S A;  2GBK A;  3A1Q A;  2E3T A;  2WDT B;  1S3S G;  2VZK B;  4KGS A;  1H4R A;  3AEG B;  4E3C A;  4HKZ E;  1N5X A;  3APD A;  3AEF B;  3V3X A;  4KDL B;  2KAJ A;  3VUW A;  2L05 A;  4IW0 A;  3ECI A;  1RM6 C;  1V5O A;  3GS2 A;  3PRP B;  3A9K B;  3QK0 A;  2KDM A;  2LWP A;  3Q2A C;  1N61 A;  4TSS A;  1K53 A;  2WXO A;  4MDK E;  2WXN A;  4NAW A;  4RM8 A;  4G3X B;  3ZDM C;  1XEE A;  2NTT A;  2M1M A;  2N9K A;  3NRZ A;  2M19 A;  2JZP A;  4IM3 A;  1V8C A;  3IXS A;  2JQR B;  2MW5 A;  3RYT A;  1SF0 A;  5GMV A;  5C23 A;  5DPT A;  3DVG X;  3IFW B;  4K7S A;  4E71 A;  4W9H A;  4K1R B;  2ZNV B;  2KQ4 X;  5LNK 1;  1K8R B;  1WX8 A;  2WQY B;  2WYQ A;  2OHF A;  3OJ3 A;  4K81 A;  2G45 B;  4YSX B;  3DCG A;  3PVL A;  3ZKJ C;  2KK8 A;  1KLV A;  5C2T B;  1P1A A;  4I6N B;  3UI3 A;  2JPH A;  1XO3 A;  1U4A A;  5IO9 A;  3DOW A;  2LGI A;  2ON8 A;  4ZDV A;  2KC2 A;  3PT2 B;  4HXD A;  2N1V A;  3DBL I;  1BUI C;  3PLV A;  1FIQ A;  1AYF A;  4DBG A;  2KOX A;  1F1H A;  1NI3 A;  3C19 A;  1A70 A;  2UYZ B;  2YEP F;  2PJH A;  4GDL B;  2HTM E;  1CJE A;  2HE7 A;  2C7H A;  3BWU D;  2M0X A;  2R2O A;  1WFY A;  1ROE A;  1WXQ A;  3RZF A;  1M94 A;  3Q8B A;  3Q3J A;  4I6L B;  1XLO A;  2X8X X;  3VDZ A;  3WAM A;  2WLB A;  1JRU A;  3MTN B;  5FK9 C;  4RGT A;  3AEB B;  1QLB B;  1N5W A;  2NCN A;  4RGN A;  4P1B C;  1R4N I;  2ZEQ A;  4MGZ E;  1TY2 A;  5TSS A;  5FR3 A;  3WIM A;  3U7D A;  3Q8C A;  1L0X B;  3A9K A;  3PPA A;  3AB5 A;  4WH4 A;  3VTU A;  4JPS A;  2AL3 A;  3L13 A;  1Z5S B;  1WXV A;  3LYY A;  1TKG A;  4ICV A;  5HG2 A;  2WDR B;  4NQL B;  1GPX A;  1MHX A;  1V9J A;  4CQN A;  3RI7 C;  2PVO D;  3H9D A;  3DBL B;  3KVF B;  4KGT A;  2B3A A;  5HHD G;  2V4L A;  3PSE B;  2JZ3 B;  1I4R A;  1BML C;  1F77 A;  1OEY J;  5LXI B;  1TKY A;  3LB8 C;  2JWU A; 
#chains in the Genus database with same CATH homology
 2JF5 A;  2KZR A;  1VCB A;  3B1L X;  1SIF A;  3ZTD A;  4MGI E;  1V49 A;  3A4R A;  3HHM A;  1ZW7 A;  2KTR B;  3APF A;  2KQ7 A;  4MGK E;  4EZL A;  2C7N B;  2RD0 A;  5CX3 A;  3RT3 B;  1E7U A;  3KYD D;  1LXD A;  3KW5 B;  4GDK B;  2IO3 B;  1GJZ A;  1P98 A;  3RCZ A;  2MBB B;  3CSF A;  4KVG B;  3H1U A;  3L17 A;  2JY6 A;  1WE6 A;  4FHJ A;  2FCM A;  3VFK A;  4WJN A;  3UQB A;  2CHW A;  3T8M A;  2J0K A;  2IO1 B;  4JGH B;  2K39 A;  2YVC A;  1WJ6 A;  2LGY A;  1L7Y A;  2R2Q A;  3S2A A;  4IWO A;  1RLF A;  4TQ0 A;  4NPN A;  2O6V A;  2MBE A;  4KSL C;  1WRD B;  2KAN A;  2MQJ A;  3LDZ E;  3EC8 A;  2KJ6 A;  4W9C A;  4KZC A;  1GC7 A;  3DQV A;  4HCP B;  2NBW B;  2JVC A;  2GBJ A;  2D3G A;  3PS6 A;  4NJ7 A;  2OOB B;  4WWP A;  2NBU A;  1T0Y A;  4KIK A;  4NAW B;  4NQK E;  4HCN B;  3H6N A;  1G6J A;  4F7Z A;  1HE8 A;  2AL6 A;  2HD5 B;  4GDL A;  5TR5 A;  2L7R A;  2LXC A;  2ZPN A;  3NHE B;  2XK5 B;  3OAW A;  3TJP A;  3WAN A;  1V2Y A;  2FCQ A;  4MSM B;  3P2B A;  1TZ1 A;  1ZKH A;  2K8B A;  4XC2 A;  4B95 A;  4I6P A;  1WMH B;  2O2V A;  2BYV E;  2L3Z A;  3ZNI D;  2RR9 A;  3VTW A;  3TMP B;  1J19 A;  1Z2M A;  2UWQ A;  4PS7 A;  4CO7 A;  1V5T A;  3QAQ A;  2FUH B;  3UGB B;  4OVV A;  1Q5W B;  5E6P A;  4FJZ A;  5JZE B;  1YD8 U;  4ZYN A;  4AP4 C;  4K7W A;  2WWZ A;  5CHF A;  4BKT A;  4HJK A;  2MWS B;  1V6E A;  2WX0 A;  1WGH A;  5DPW A;  1WJU A;  1P3Q U;  1LM8 B;  2C7M B;  4IC7 B;  2DAJ A;  2IYD B;  1EO6 A;  4LDT B;  2LUE A;  2KFK A;  4IWQ A;  4DHJ D;  3W1Y A;  3ZNZ B;  2LGD A;  4LDT D;  3QJZ A;  2MRP A;  1YIW A;  2QHO A;  2LRW A;  2EMS A;  2XBB C;  3GOE A;  4GMV A;  2L0F A;  4LJP B;  4II2 B;  2BYF A;  1WGY A;  1YX5 B;  4PYU A;  4P7I A;  4DHZ E;  4FN2 A;  3AU4 A;  2LGX A;  2ZPY A;  4DXA B;  2DX5 B;  4JLC A;  1AAR A;  3Q3F A;  3AUL A;  1TBE A;  5D2M B;  4ANX A;  3L0W B;  4BKS A;  2ASQ A;  2KX3 A;  2NVU I;  2N7D A;  2CU1 A;  3D32 A;  1WZ3 A;  2K8H A;  3TL5 A;  5HKH A;  4DHZ B;  4W9D A;  3SHQ A;  1UGM A;  4HLE A;  3V6C B;  1V86 A;  4N9F 4;  2PEA A;  4DDG D;  1IPG A;  3R3M A;  1UBI A;  4RMA A;  1WGR A;  1Q0W B;  2NPT B;  2MP2 B;  2PE6 B;  3R66 C;  3VXW A;  3ZDT A;  3C0R B;  2JRI B;  3BIN A;  2G3Q B;  4EZK A;  2D11 A;  4W9J A;  2EMT A;  3BY4 B;  2JWZ A;  4B6W A;  3EHV A;  2DAF A;  2K6Q A;  2FCS A;  2RGF A;  3QC8 B;  5IAA C;  1LFD A;  3M63 B;  3R7Q A;  2AYO B;  2KLC A;  3L16 A;  2J7Q B;  2KTR A;  2N9P C;  2D10 A;  2ZNV C;  2KWC A;  1P9D U;  3ZW3 A;  3NY5 A;  3JVZ X;  3OLM D;  1WI0 A;  4WWN A;  4HK2 A;  2Y5B B;  3MHS D;  1CMX B;  4GDK A;  3RUL A;  2N7E A;  3V60 A;  3CMM B;  2Z0D B;  2MA9 B;  2ZZP B;  5FR6 A;  4MEL A;  2KDF B;  4EOY A;  3HM6 X;  2L0T A;  4CYE A;  1C1Y B;  4BOS C;  4BFR A;  4A20 A;  3LJ3 A;  4GN1 A;  1WM3 A;  2K8C A;  4CHK A;  2BYE A;  2I1J A;  4MJS B;  1WX9 A;  4NNJ B;  3A1Q B;  1NI2 A;  3DVG Y;  5G2N A;  3RZW C;  3DPD A;  2DZM A;  3KH0 A;  5L83 A;  2BKF A;  4HDO A;  2ZCB A;  4HPL B;  3V62 A;  3ML8 A;  2PPH A;  3AXC A;  3PGE A;  4X57 B;  4ASW C;  3QIJ A;  3H7P B;  2KQS A;  1TGZ B;  2DZK A;  3JYU A;  3RD2 A;  3KUZ A;  1WF9 A;  2XEW A;  4HVB A;  3VQI A;  4EFO A;  2REX A;  2KJH B;  3VUX A;  1UH6 A;  2KMA A;  2V1Y A;  3HM3 A;  1NBF C;  3ZRC A;  4GSW A;  3DBS A;  4IM0 A;  2AEH A;  3H7S A;  5J18 A;  1E8X A;  2XK5 A;  5CHV C;  2KC1 A;  5DPR A;  2A4Z A;  4GIV A;  2I1K A;  2MBH A;  2N9X A;  3K9O B;  4WAA A;  5D6J B;  1SGH A;  5DPS A;  1WJ4 A;  3QCA A;  1LQB A;  2LRU A;  1WMH A;  2KHW B;  5CHW A;  3NOB A;  5JHA A;  3QHT A;  2CR5 A;  3QX1 A;  3VAW A;  4AOF A;  2CS4 A;  4JQW C;  3IVF A;  3UF8 A;  2LJ5 A;  1X1M A;  2KKC A;  4BVU C;  2ZCC A;  3JSV A;  3U30 A;  3DVN U;  3M62 B;  1I42 A;  3ZTC A;  2IBI B;  2KN5 A;  5EDS A;  4EKU A;  1S1Q B;  5AZG A;  1D3Z A;  4IUM B;  5J17 A;  2JZZ A;  3VH3 B;  4PS3 A;  5C1Z A;  5KHO A;  4W9I A;  1V81 A;  2IZV B;  4TQ1 A;  3HIZ A;  4GB9 A;  2KMC A;  2DEN B;  3WA0 A;  1A5R A;  3TCA A;  2NBV B;  3IG3 A;  4FUL A;  4ANU A;  4M0W B;  2LVP A;  2BWE S;  4FAD A;  4EZJ A;  3DBR I;  2IY1 B;  5LXH A;  2DYB A;  4ZRK A;  4MH0 E;  2BPS A;  5J2R A;  3B08 A;  4W9K A;  4A3P A;  3WAP A;  3IBE A;  4LCD E;  5LLI A;  4FBJ B;  3V61 A;  2MLB A;  3PRE A;  5IA7 A;  2FAZ A;  4JIO U;  4F1S A;  4G0N B;  1YQB A;  4LJO B;  1EF5 A;  1WZ0 A;  2Z59 B;  5L95 C;  3PLU A;  2FID A;  2GBN A;  4HDQ A;  4GGQ A;  4WJP A;  4XZ4 A;  1WH3 A;  1XD3 B;  1SE9 A;  1F9J A;  1WJN A;  4NJ6 A;  2DYO A;  3SD5 A;  1GG3 A;  1WX7 A;  3SU8 X;  4M8N A;  2KWV B;  2NPT A;  2NR2 A;  1PQS A;  2MP2 A;  3AI5 A;  2FNJ B;  2K25 A;  1IP9 A;  3ALB A;  2D2Q A;  4HPM B;  3X23 A;  3MJW A;  3A9J B;  4GU2 A;  1E8Z A;  2M17 A;  1E7V A;  3RUI B;  2LXA A;  2ZJD A;  3HK0 A;  3ZNG C;  2GBR A;  2JUO A;  4AUQ C;  2KXJ A;  1Y8R C;  2G4S A;  3UIP B;  1OQY A;  2CHZ A;  1E90 A;  1ZGU B;  1H8C A;  2DZJ A;  2K1F A;  3SDL C;  3L54 A;  3W1S A;  1WXM A;  3DVN V;  4FLH A;  1OEY A;  4IWP A;  2D07 B;  2JXX A;  1QZE A;  4W9E A;  1WY8 A;  4RM9 A;  4TUU A;  3VUY A;  4WWO A;  3A4S C;  4AWJ A;  5CTR C;  3ONS A;  4MGY E;  1OTR B;  3U8Z A;  2IY0 B;  3JW0 X;  2RSU A;  2M4N A;  4KSK C;  3CST A;  3WAL A;  3ML9 A;  1GUA B;  3O65 B;  2M8S A;  2GBK A;  2KX0 A;  4MJS A;  4PYZ A;  2LVO A;  3A1Q A;  5KHQ A;  2WDT B;  1S3S G;  5AEK B;  3PRM B;  2MSE D;  5D94 A;  1H4R A;  2HJ8 A;  2KO3 A;  3OJ4 B;  1YX6 B;  3H7P A;  4OVU A;  3ZUN A;  4URK A;  4E3C A;  1XT9 B;  1E5W A;  3APD A;  1I35 A;  1E8W A;  4KDL B;  2KDI A;  4AJY B;  3V6E B;  2G4D B;  3PZD A;  2NS5 A;  1NDD A;  2C9W B;  1R4M I;  2PE9 A;  1C3T A;  2KLG A;  3T9L A;  2W9N A;  3VUW A;  2L05 A;  4IW0 A;  3ECI A;  1E8Y A;  1V5O A;  4DWF A;  3PRP B;  2KDB A;  3A9K B;  1WGG A;  3QK0 A;  4IM2 A;  2LWP A;  3VVW B;  2N4F A;  3L10 B;  4MDK E;  4ZRI A;  2CHX A;  4NAW A;  4RM8 A;  4G3X B;  2ZVN A;  3ZDM C;  3M95 A;  2M1M A;  2BF8 B;  2C60 A;  1FXT B;  2KJR A;  4IM3 A;  2J0J A;  5E6N A;  1RRB A;  4DK5 A;  2MW5 A;  3VTV A;  2GOW A;  1UEL A;  4J6I A;  5G55 A;  3RYT A;  1WE7 A;  1UZX B;  4K7U A;  4KDI C;  5GMV A;  1RFA A;  2ZVO A;  5BO4 B;  3UIO B;  2C5L C;  5C23 A;  2IO0 B;  3KYC D;  5AZF A;  5DPT A;  3UIN B;  3DVG X;  3EFU A;  3IFW B;  4K7S A;  1WXA A;  3ZVV A;  4E71 A;  5JH5 C;  4W9H A;  4K1R B;  2ZNV B;  5E6O A;  2Z0E B;  2KDE B;  2DHZ A;  2GMI C;  1K8R B;  1WX8 A;  1YJ1 A;  2WYQ A;  4FA6 A;  2KD0 A;  4ANV A;  2JT4 B;  1UD7 A;  5D7G A;  3NZS A;  1GC6 A;  3OJ3 A;  4K81 A;  2FCN A;  4FJV B;  4KZ0 A;  3QWZ B;  2G45 B;  1XQQ A;  3DDC B;  3DCG A;  3PVL A;  3ZKJ C;  1TTN A;  3ZRF A;  2KK8 A;  4GXB A;  4BBN C;  1MG8 A;  1P1A A;  1KLV A;  4I6N B;  2IO2 B;  2JPH A;  4WQO B;  2AWT A;  1WM2 A;  3PV1 A;  1U4A A;  2MX2 A;  4M8M A;  5DCN A;  3DOW A;  2N9E B;  3PHW B;  4G50 A;  5AZH A;  4EEW A;  2LVQ A;  3QA8 A;  2EKE C;  3PHX B;  3N30 A;  4MSQ B;  3ZIM A;  4ZDV A;  2KC2 A;  3PT2 B;  4JL9 A;  2MCN B;  4HXD A;  3A9J A;  2N1V A;  4G11 A;  1KOT A;  1WIA A;  3DBL I;  3N32 A;  3PLV A;  3M3J A;  2O6V B;  3K9P B;  2BKR B;  4WJO A;  3ZLZ A;  3WAO A;  1WGD A;  3TBL D;  4EUT A;  1GNU A;  2O6V D;  3ENE A;  4MEM A;  1WR6 E;  4DBG A;  3EEC A;  3KUD B;  2KOX A;  4WJQ A;  2K6D B;  1BT0 A;  4KIK B;  2UYZ B;  4BKG A;  2PJH A;  4HWI B;  2JRH A;  2HTH A;  1V80 A;  3JSV B;  3NZU A;  4GDL B;  4W9F A;  1WR1 A;  1IYF A;  3TIX A;  2HE7 A;  3B0A A;  2C7H A;  1J8C A;  2LZ6 A;  2M0X A;  4ICU A;  4IG7 B;  2R2O A;  3W1S C;  1WFY A;  2DZI A;  3RZF A;  2LAS A;  1M94 A;  1WYW B;  4TKN A;  3PTF C;  3Q3J A;  4I6L B;  3QQ8 B;  4DHJ B;  1EF1 A;  3VDZ A;  2O2V B;  3WAM A;  1VD2 A;  4KV2 A;  1KM7 A;  3VH4 B;  2L8J A;  2RPQ A;  2MBQ A;  2MBO A;  1L2N A;  1OGW A;  1JRU A;  2CKH B;  3MTN B;  3ZNH B;  1Q1O A;  2NCN A;  2KFJ A;  4PS8 A;  4FHK A;  4ANW A;  1R4N I;  2KWU B;  1KJT A;  2ZEQ A;  1J0G A;  4MGZ E;  3L08 A;  4TV3 A;  4XX5 A;  4B9K A;  2KFK B;  4YL8 A;  3N3K B;  3WIM A;  3U7D A;  1UBQ A;  4E74 A;  4A3O A;  2J0M A;  4MM3 A;  3PRZ A;  4II3 B;  3A9K A;  3PPA A;  2LD9 A;  3ZO5 B;  4NY0 A;  3VTU A;  2A5U A;  3CF6 E;  2AL3 A;  3L13 A;  4GOC A;  1Z5S B;  4ZRJ A;  3R7R A;  1RAX A;  2KNB A;  1WXV A;  4AJW A;  2N1W A;  4BBN F;  2DYM A;  4ICV A;  4W9G A;  3UQA A;  1EUV B;  4W9L A;  4NQL B;  2BWF A;  4F8C B;  4BKS D;  1ISN A;  1V9J A;  2GBM A;  2KTF A;  2YLM A;  3NS8 A;  1P0R A;  3IHP C;  3DBH I;  3H9D A;  2L76 A;  2OJR A;  3KUC B;  3KVF B;  3AU5 A;  3APC A;  3QAR A;  3VHT C;  3A33 B;  4DDI D;  2B3A A;  2V4L A;  3PSE B;  2LI5 A;  2BGF A;  2JZ3 B;  1WXS A;  5LXI B;  1OEY J;  2L00 B;  4FJY A;  3X0W A;  5JHB A;  4BOZ B;  2FIF A;  3I3T B;  2KVR A;  2V3S A;  2VRR B;  2WX1 A;  3GZN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...