1WX8A

Solution structure of the n-terminal ubiquitin-like domain in the 4931431f19rik protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
GSSGSSGVSGREPSSRIIRVSVKTPQDCHEFFLAENSNVRRFKKQISKYLHCNADRLVLIFTGKILRDQDILSQRGILDGSTVHVVVRSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 4931431F19
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx8A00
1OQYA 2DAJA 2KQ7A 4JQWC 3BY4B 4WJOA 4MGIE 2N4FA 3NHEB 1UGMA 2BYEA 2ZZPB 1A5RA 4WAAA 4MM3A 4CYEA 5C23A 3UIOB 1WJ4A 4KDLB 3QARA 1NBFC 4OVVA 3DBSA 4RMAA 4MJSB 2NPTB 4FBJB 1J19A 4MEMA 4F1SA 4G11A 3DBRI 1UZXB 3ZO5B 3QC8B 2PEAA 5L83A 1GC6A 3DQVA 3HM3A 3MHSD 4GDKA 1S3SG 4NAWA 5E6OA 4ASWC 3ZTCA 1WGRA 3ENEA 2J0KA 4KV2A 3WAOA 4AP4C 1ZGUB 2K8CA 3VDZA 4EZKA 2BGFA 2I1JA 3JW0X 2W9NA 2IZVB 4HCPB 2O2VB 2LRUA 1Q1OA 3CMMB 2K6DB 4TKNA 1WFYA 4FJVB 1C1YB 3QWZB 1G6JA 3RZWC 3DVNV 2L8JA 3D32A 2KWUB 4IC7B 1V6EA 4TV3A 3TJPA 2HD5B 3VH4B 2CHWA 4EOYA 5DPRA 1KM7A 1SGHA 3ZDTA 1NI2A 3R7RA 2J0JA 1WX9A 3OJ4B 5LXHA 2LXAA 1GJZA 4G0NB 1LXDA 2KDIA 3ECIA 1V5OA 3K9OB 3PLUA 3DVGY 4K81A 3ZTDA 1YD8U 5HKHA 1RRBA 2JXXA 4AOFA 4E3CA 4HPLB 2FAZA 3DCGA 3QAQA 5AEKB 3DBHI 2KVRA 3ZRCA 4X57B 3B08A 4KSKC 4W9KA 2V3SA 2FNJB 3OJ3A 3APDA 3T9LA 1RLFA 5KHQA 2KTRA 3ALBA 1KLVA 4FHKA 4BKSD 4JL9A 2MLBA 3OAWA 3PZDA 2KC1A 4MSMB 1OTRB 1WE6A 2MP2B 2RPQA 3Q3FA 1WGGA 2MBEA 3V6CB 1Q5WB 2VRRB 2O6VB 3V60A 2LRWA 4II3B 2JVCA 4AJWA 1MG8A 4DK5A 2D07B 3M95A 2XK5B 4BBNC 1I42A 2YVCA 2PE6B 2BKRB 5J17A 2FCMA 3WALA 4K7SA 2KC2A 4P7IA 2EMSA 2G45B 3S2AA 4MGYE 4DWFA 3ZLZA 2IBIB 4GOCA 2WWZA 1E8ZA 2KDFB 2O6VA 4GN1A 3WIMA 1Z2MA 3U8ZA 2J7QB 3RD2A 2GBMA 1J0GA 4IUMB 1WZ3A 2BKFA 3ZVVA 2JT4B 2KTRB 2GMIC 2KHWB 2RD0A 3N3KB 3PHWB 4F7ZA 2BWES 4ICUA 2L0FA 2JF5A 3RULA 4IM2A 4JLCA 5LLIA 5GMVA 1WYWB 1LQBA 5AZFA 3RYTA 2KQSA 1WY8A 2KOXA 2BYFA 2N9XA 2ZPYA 4KZCA 4MJSA 2HJ8A 3N30A 3EHVA 2R2QA 2YLMA 2Z0DB 4WWPA 3DDCB 1WR1A 2JRIB 2ZCCA 4W9DA 2XEWA 3QX1A 2MBHA 4I6LB 4W9FA 2G3QB 2GBNA 2ZNVC 5DCNA 3JVZX 2V1YA 2KDBA 3MTNB 5J2RA 2CHXA 3QJZA 2IO1B 2O6VD 3L10B 1E7VA 4EUTA 2K39A 3APFA 2LXCA 4KIKB 2JPHA 4ANVA 4BOSC 3NOBA 1E5WA 3KUDB 4W9GA 4IWQA 4NAWB 4FADA 4NNJB 3LJ3A 1F9JA 5CX3A 3ZW3A 4HDOA 4W9IA 2EKEC 2LGYA 1RAXA 3VQIA 4M8MA 4DXAB 2CR5A 2FIFA 2ASQA 1E7UA 2LUEA 2L00B 3KUCB 4NQKE 3M62B 1WZ0A 1GNUA 2EMTA 4FA6A 2RR9A 4PYUA 5DPTA 2DZMA 3PV1A 2KO3A 2N9PC 3TL5A 1PQSA 2AL3A 4YL8A 2G4DB 2M17A 2MCNB 5AZGA 1WE7A 1R4NI 3KYCD 2MBOA 1IPGA 4ANWA 3PS6A 2FCSA 4WJNA 4E71A 1V2YA 1WM3A 1V9JA 2FIDA 1YJ1A 1ZKHA 4BFRA 5JHAA 3AULA 4CO7A 3VTVA 1WXVA 2KFKA 5CHFA 2K8BA 4ANUA 1SIFA 5EDSA 2D3GA 2ZPNA 3JSVA 3M63B 4MGZE 4WWNA 5G55A 1IP9A 4AWJA 4G3XB 1WM2A 4BVUC 2KTFA 2WYQA 4G50A 2BYVE 2M0XA 3PVLA 4IWPA 4W9CA 3GZNI 4ZYNA 1V86A 1U4AA 3IG3A 3KW5B 4ZRKA 2WX0A 1WF9A 4I6PA 2DENB 3T8MA 4GIVA 4W9JA 3WAMA 2A5UA 3PRMB 4EZJA 3IVFA 4ZDVA 2K8HA 5D94A 2MW5A 1OGWA 3QIJA 1E8YA 1UBQA 3L13A 2GBJA 1EF5A 1Q0WB 5CHVC 3ZNGC 2NCNA 4EZLA 3ZNID 4DDID 3UQAA 4GDLB 2NBVB 3TIXA 2LD9A 3TCAA 1SE9A 3GOEA 3NY5A 4KDIC 3VH3B 2MQJA 3PHXB 1KOTA 3HIZA 1JRUA 3A4RA 3VFKA 2A4ZA 2MX2A 4EFOA 3O65B 3AU5A 4A3PA 2LVPA 2HTHA 2IYDB 3OLMD 4MGKE 3EC8A 4BKGA 2C7MB 2HE7A 3DVNU 5L95C 2CHZA 2KANA 4LDTB 5E6PA 1V49A 5D7GA 1OEYA 3HK0A 3H6NA 2RSUA 3PRPB 3WA0A 1HE8A 2LGDA 1E8XA 3A1QB 2FCQA 4EKUA 2B3AA 1UH6A 1V81A 4W9HA 3PSEB 2AYOB 3A9JA 3IBEA 4FN2A 4GU2A 4NY0A 2DZIA 2GBKA 4IWOA 1NDDA 1WX8A 3SDLC 2KJRA 4GGQA 4LCDE 4WJQA 3C0RB 1UBIA 4RM9A 3L08A 2KMAA 4TUUA 3R66C 2NBUA 3QQ8B 3R7QA 3H7PB 2MBBB 3H9DA 5KHOA 3V6EB 2PPHA 3A4SC 3KVFB 2DHZA 2XK5A 2LWPA 3PTFC 1GC7A 2KX0A 4AUQC 4DHJB 2KNBA 4FHJA 2J0MA 1GUAB 4IG7B 3SD5A 3V62A 4B95A 3H1UA 2Z59B 4ZRIA 4MSQB 4GXBA 3RT3B 2O2VA 1P3QU 1EF1A 3UINB 2C7HA 3DBLI 3UIPB 1C3TA 3EFUA 2DYMA 4IM0A 3A9KA 3PPAA 5G2NA 2M8SA 5E6NA 1UELA 3CSFA 3SU8X 1WRDB 1YQBA 5JHBA 3APCA 2N7EA 2N1WA 2KFKB 3ZNZB 2LGXA 3TMPB 2CU1A 2ZEQA 3DPDA 4FULA 2ZCBA 2NPTA 3KUZA 1I35A 2L05A 2JZ3B 2MWSB 2BWFA 2K1FA 4B6WA 1P1AA 2DX5B 2OJRA 4IM3A 2I1KA 2GOWA 4BOZB 4URKA 3B0AA 3HM6X 2N7DA 2G4SA 2LZ6A 2PE9A 3NZSA 5LXIB 1IYFA 3ML8A 2UYZB 1P98A 2L0TA 3DVGX 4M8NA 4HLEA 1TGZB 2L76A 2KWVB 1Y8RC 5TR5A 2QHOA 1CMXB 3QHTA 2M4NA 1WXSA 2NR2A 3JSVB 4BKSA 1WMHB 4DHZE 2WDTB 2LI5A 2CS4A 2K6QA 4FJZA 2MBQA 2NBWB 4RM8A 3ZUNA 1YX6B 5D6JB 4CHKA 2L7RA 3X0WA 3I3TB 4OVUA 3VVWB 1VD2A 5DPWA 2REXA 4DHJD 2IO3B 3QCAA 3Q3JA 3U7DA 3KYDD 4HK2A 2IY0B 2C5LC 3VAWA 2D10A 1XT9B 4KVGB 2OOBB 3VTWA 1VCBA 4NJ7A 2MA9B 4DDGD 3RZFA 4B9KA 4LJOB 3V61A 3A33B 4LJPB 3VTUA 3WAPA 1OEYJ 4FLHA 2AEHA 5C1ZA 3L17A 2DZKA 1YIWA 2M1MA 2FCNA 2N9EB 2Z0EB 2DAFA 5DPSA 1UD7A 3AI5A 4BKTA 3UQBA 4GB9A 2KXJA 3L16A 2KMCA 1BT0A 2DYOA 1R4MI 1ZW7A 4HWIB 2KWCA 4MDKE 3PRZA 3CF6E 1M94A 4A3OA 3A9KB 2ZVOA 3H7SA 1WGYA 4DHZB 3W1SA 1TTNA 3VHTC 4W9LA 2ZNVB 5D2MB 2KFJA 3PT2B 2LJ5A 5FR6A 2JWZA 1D3ZA 3A1QA 4PYZA 3UGBB 2L3ZA 2V4LA 1YX5B 5JH5C 4W9EA 4WWOA 2C7NB 2KLCA 1E8WA 1WX7A 4ICVA 2XBBC 4E74A 2KK8A 3P2BA 4GSWA 3L0WB 3N32A 4JGHB 3PREA 1WR6E 2K25A 2MSED 3NZUA 1LFDA 2KJHB 2KJ6A 2KN5A 2N1VA 4XZ4A 2NVUI 4KIKA 3VXWA 2AWTA 3MJWA 1Z5SB 1AARA 1QZEA 3U30A 1WI0A 4J6IA 1WJUA 2MP2A 1V80A 3JYUA 4MELA 3LDZE 4XX5A 3DOWA 3A9JB 3W1SC 4PS7A 4F8CB 1TZ1A 2BPSA 4EEWA 1FXTB 2GBRA 3ZNHB 1WH3A 2KD0A 3VUYA 1XQQA 2IO0B 4K1RB 4DBGA 1L7YA 2ZVNA 3H7PA 1RFAA 2C60A 1WJNA 4JIOU 4NQLB 2LASA 4II2B 1K8RB 4IW0A 4NPNA 1XD3B 5JZEB 1ISNA 1E90A 4I6NB 2D11A 3W1YA 3ML9A 4HCNB 4GMVA 1KJTA 3AXCA 2R2OA 4NJ6A 1EUVB 2IO2B 4GDLA 2ZJDA 4KZ0A 2JZZA 3ZIMA 4A20A 4AJYB 4MH0E 3RUIB 3B1LX 1P0RA 4LDTD 3VUXA 5CHWA 4HXDA 5CTRC 3SHQA 2IY1B 4K7UA 2UWQA 4K7WA 1EO6A 1TBEA 4WQOB 1GG3A 4HVBA 2KKCA 4PS3A 3EECA 3QK0A 1WIAA 4N9F4 3WANA 1V5TA 4TQ1A 2FUHB 3VUWA 2DYBA 3NS8A 3PLVA 2CKHB 4PS8A 4BBNF 2LVOA 5IAAC 3RCZA 2JUOA 2AL6A 2D2QA 1S1QB 3R3MA 2KLGA 1P9DU 3IFWB 4FJYA 1WXAA 1T0YA 5IA7A 3M3JA 4HPMB 1WGDA 2LVQA 4XC2A 4HDQA 3L54A 2PJHA 2KX3A 2KZRA 1WJ6A 2C9WB 3UF8A 3AU4A 3ZRFA 1WXMA 5J18A 2BF8B 5AZHA 4TQ0A 1LM8B 3ONSA 4GDKB 5BO4B 4KSLC 4ANXA 2MRPA 2NS5A 1H4RA 3PGEA 4ZRJA 3ZDMC 2WX1A 1X1MA 2JY6A 3QA8A 3IHPC 1WGHA 2JRHA 4WJPA 3TBLD 1L2NA 3BINA 1J8CA 2KDEB 3X23A 3CSTA 1WMHA 3ZKJC 4M0WB 2DZJA 1H8CA 2RGFA 3KH0A 3HHMA 3K9PB 4HJKA 2Y5BB
chains in the Genus database with same CATH superfamily
4JX1C 2DAJA 4MGIE 2WS3B 2LEKA 5H8YE 2KWDA 4ARCA 1A5RA 2HJ1A 2V3NA 4OZBA 1WJ4A 2W82A 4MACA 3DBRB 5L83A 1S3SG 3ZTCA 1WGRA 3ENEA 4AP4C 1K51A 2K9XA 4YTPB 3T3NA 2LRUA 4REZA 4C80A 1QOFA 2Z8LA 1V1PA 4TKNA 1WFYA 3QWZB 4TV3A 1LGRA 1V6EA 1QT9A 5DPRA 3ZDTA 2OHFA 2LMCA 1SE4A 2LXAA 1GJZA 2KDIA 2IDYA 3PLUA 4K81A 2RPVA 4XDCA 4AOFA 2FAZA 2PVOD 1PDXA 3DBHI 2KVRA 2AX5A 1L0XB 2HDEA 4X57B 3B08A 4RGNA 4WQMA 3APDA 3T9LA 2VH1A 1KLVA 3VRAB 4FHKA 4C7ZA 4MSMB 3PZDA 2KC1A 1WE6A 2RPQA 3Q3FA 2MBEA 1UWXA 1FCCC 1MG8A 4DK5A 5J17A 3WALA 1QOAA 3ZLZA 3NJTA 3AE9B 2WNMA 4ZYSA 1B9RA 4P1BC 3C8YA 4GN1A 1C9FA 4N58A 1Z2MA 2PVGC 2GBMA 1N5XA 2KTRB 4F7ZA 2BWES 3T3OA 2INDC 4IM2A 3I9V1 1WYWB 5AZFA 3RYTA 2KQSA 1YN4A 3RN9C 1EU4A 3EHVA 4WWPA 1R4MB 2V3PA 3BVMA 3CWIA 4H2AA 2G3QB 2LHDA 2GBNA 3JVZX 5BYQA 2V1YA 4AS1A 4CQNA 4ANVA 2LXCA 3NOBA 2EKIA 1E5WA 1YN5A 1MVKA 1BUIC 1QQRA 4NNJB 1N61A 1F9JA 5CX3A 4OVZA 3M62B 4A6QA 1MHXA 3MFGA 3L4PA 4LNNA 1L4DB 5DPTA 2N9PC 2X38A 2AL3A 2G4DB 3V05A 1XLQA 2MBOA 4KKJA 4ANWA 5AUKA 1V9JA 1YJJA 4BFRA 5JHAA 1IBXA 1SE2A 4OZAA 3RMKC 5CHFA 1SIFA 3JSVA 3DWMA 4MGZE 4USAA 1WM2A 3R8BA 1Q10A 4G50A 2BYVE 3RNGC 3HVDA 4ZRKA 1DGJA 3T8MA 2N7JA 3NVZA 3WAMA 4ZDVA 2LUMA 2AQ3B 2IJ0A 1UBQA 3L13A 1VJKA 3Q8EA 1JCKB 5CHVC 1XEEA 2NBVB 1HA5A 3GOEA 1KOTA 2MQJA 3FC4A 3PHXB 3HIZA 5D3DA 4RGOS 2WLBA 3OLMD 1RYJA 4ACFA 3EC8A 4ZOHC 1MFWA 5E6PA 4DQOC 3Q2AC 1V49A 1HTQA 5D7GA 3Q14C 3A1QB 1UH6A 3P63A 1KH0A 1WX8A 1T0SC 3AV8A 1UBIA 5IO9A 2WXGA 3MC9A 3URYA 2BTEA 2KDMA 2RDHA 3R7QA 1SE3A 3AN1A 2MBBB 3H9DA 5KHOA 2PPHA 2EELA 3OG5A 3A4SC 1SF0A 1TS5A 2KX0A 4LNIA 4NZLB 4B95A 1OQQA 2Z59B 4GXBA 2O2VA 3AEBB 1TS3A 4C7YA 4EE2A 3EFUA 2DYMA 3TEXA 1VZ8A 3A9KA 3PPAA 3VR9B 1UELA 1WRDB 5JHBA 3APCA 1GPXA 1KF6B 2KFKB 2CU1A 3DPDA 2ZCBA 2NPTA 3MC8A 5IN7A 2DX5B 4IM3A 1MPEA 2GOWA 4BOZB 3HRDD 2PE9A 3NZSA 3ML8A 2UYZB 3IAM1 2L76A 1ZP0B 2KWVB 1Y8RC 3QHTA 1GB4A 2M4NA 2WDTB 3OWEB 4FJZA 3ZJVA 3ZUNA 1RWSA 2WXKA 1VD2A 4DHJD 5D3IB 2IY0B 3VTWA 2MA9B 1IGCA 3RZFA 1FCLA 3IXSA 3WAPA 2WQYB 4FLHA 2AEHA 3N1ZC 1E10A 4A8XC 2DZKA 4C56C 4OZCA 2N9EB 2WXNA 4Q2JA 2AQ1B 3L16A 2DWQA 2WXMA 5H92C 2CJNA 3NVWA 3SFEB 3CF6E 1TTNA 3VHTC 4W9LA 3NZ3A 2ZNVB 1BXTA 3PZ7A 2LJ5A 2JWZA 3A1QA 4J3OD 3DBLB 2JSVX 2GLSA 3SEBA 1WX7A 3AE7B 3P2BA 2MSED 3NZUA 1LFDA 2KN5A 2INPE 1C77A 1YN3A 4S17A 2WXPA 4MELA 3DOWA 3A9JB 4O1NA 4F8CB 4EEWA 4FXCA 5LNK1 2LGIA 2JYEA 1I4HA 2KD0A 3Q8FA 2OJWA 1L7YA 4ZRQA 1RFAA 1WJNA 4II2B 4I6NB 2D11A 3W1YA 3ML9A 2VZKB 5T8IA 1KJTA 4NJ6A 1EUVB 1B1ZA 4KZ0A 3PO0A 4WH4A 3B1LX 2D3AA 3KWVA 3VUXA 1N6ZA 2ONQA 2IY1B 4K7WA 1EO6A 1ZOYB 2KKCA 4PK1A 4LNFA 3QK0A 1WIAA 3WANA 4TQ1A 3NS8A 3PLVA 2CKHB 4PS8A 4BBNF 1DOIA 4ZHOA 4KGSA 3W2DA 2KLGA 1WXAA 1T0YA 5IA7A 2K22A 5I4DA 1HZ6A 4XC2A 2N9KA 2PJHA 2KX3A 2C9WB 1TYGB 3ZRFA 1LM8B 1YOVB 2H89B 3HVZA 2GRIA 3PGEA 1X1MA 1SSNA 4WJPA 3TBLD 1L2NA 3BINA 4MM3B 2DZJA 4ZHPA 2Y5BB 4A55A 2OEDA 4GLSC 1OQYA 4JQWC 3BY4B 4WJOA 3NHEB 2BYEA 2ZZPB 4WAAA 2Y3AA 4MM3A 4L23A 3BK1A 4L1BA 4CYEA 1NBFC 4RMAA 2NPTB 3RNEC 3QC8B 3ZJUA 3DQVA 1D4BA 1EU3A 1WXQA 1MG4A 2MEKA 4KV2A 2IZVB 2O2VB 3RPFC 3DVNV 1SEBD 2W3SA 2D3BA 3VH4B 4YXDB 4EOYA 1SGHA 1NI2A 2J0JA 1WX9A 4G0NB 1LXDA 3ECIA 1V5OA 1F52A 3E56A 1YD8U 5HKHA 5AEKB 1TKYA 4W9KA 4KSKC 1RLFA 2IGGA 2J4XA 2MP2B 1Q5WB 2VRRB 2O6VB 3P1MA 3V60A 2JZPA 3R2IA 2LRWA 2JVCA 4AJWA 2YVCA 1HQRD 2PE6B 4IKGA 1FNWA 4DWFA 2WWZA 4C4VB 2KDFB 3U8ZA 2J7QB 3AM9A 2BKFA 2M19A 3SR6A 2JT4B 3PHWB 3AE3B 4MH8A 4C4VA 3RULA 4JLCA 2QEJC 3PZ8A 1LQBA 1XCTL 4BZAA 3B2GA 4KZCA 1JWUD 2RMMA 2HJ8A 4B0EA 3DDCB 1WR1A 2ZCCA 3DWGC 2MBHA 4W9FA 1XO3A 3MTNB 5J2RA 3QJZA 2X8XX 3AE6B 2O6VD 5HI1A 5TSSA 4BOSC 3KUDB 4YSZB 1C4AA 3FILB 4NAWB 1OQRA 1RM6C 4FADA 4XWTA 5BYRA 4HDOA 4W9IA 2LGYA 1RAXA 3VQIA 4DXAB 2LHEA 2LUEA 3KUCB 2WXJA 2JYTA 3MHZA 2Q5WD 1R7SA 1PQSA 4D2KA 2M17A 1FFVA 1IPGA 1ZXIA 2FIDA 3VTVA 5G5HA 2BQQA 4DXGA 5G55A 1IP9A 3AE8B 1I4XA 3I5JC 1TZOA 4IWPA 2M0XA 4LK0M 4W9CA 1EM7A 1N5WA 2WX0A 3R2TA 4I6PA 1VR9A 2DENB 1ZUD2 3Q8AA 4GIVA 2KAJA 3PRMB 4EZJA 3IVFA 3RFZB 1VLBA 2K3UA 1E8YA 2GBJA 2MJDA 2WP9B 2LD9A 1SE9A 3NY5A 5HHDG 1JRUA 3A4RA 2A4ZA 4EFOA 3AU5A 4A3PA 2LVPA 4XYCA 2MJEA 3DVNU 2CHZA 2KANA 4HKQA 2WDRB 3H6NA 2LGSA 2B3AA 2QMTA 1F77A 1NVID 1SBBB 3AEDB 1V81A 2AYOB 4FN2A 2DZIA 1TY0A 1NDDA 2KJRA 4LCDE 2G1EA 3QQ8B 1ZDXA 4BAXA 2XK5A 3PTFC 4AUQC 1GC7A 2E6XA 1PGXA 1FD6A 1JWAD 3SD5A 3H1UA 3RT3B 1J7AA 2FUG1 2IPKD 3UIPB 2M8SA 5E6NA 4IDIA 2N7EA 3ZNZB 2LGXA 4FULA 3AEFB 2JZ3B 2MWSB 1P1AA 1SJED 2I1KA 3N1XC 2N7DA 1P98A 2L0TA 3DVGX 1TGZB 1ROEA 5TR5A 1TKEA 3JSVB 1YJIA 2NR2A 4ITKA 4BKSA 5FKAC 1ZPSA 2L7RA 4XE0A 1JQ4A 3VVWB 2IO3B 3QCAA 3Q3JA 1UGJA 2C5LC 2OOBB 2QILA 1VCBA 4DDGD 2SAKA 3Q8BA 4B9KA 3A33B 4LJPB 3VTUA 1K52A 1QLBB 5C1ZA 2M1MA 4L2YA 4RNAA 1I7HA 2DAFA 3GE8C 3AI5A 2BBCA 2KMCA 1BT0A 1MHHE 2DYOA 3EGRA 2KQ4X 1JW9D 1TJEA 4A3OA 3MJ5A 3BWUD 3BYYB 1DOXA 1TS2A 3W9CB 3LB8C 4PYZA 3UGBB 5JH5C 2C7NB 1T3QA 2KLCA 1E8WA 4ICVA 2KK8A 2WXHA 3PREA 3V3XA 4XZ4A 2KJHB 2KJ6A 1NYQA 1TIFA 2L1AA 4KIKA 3VXWA 4RGMA 3AECB 1AARA 1WI0A 4J6IA 2MP2A 4TSSA 3H8HA 3LDZE 2BPSA 1FPYA 1AWDA 3BVGA 1SXTA 1D5MC 2C60A 3EUB2 1XD3B 1FM0D 4HCNB 1T0QC 3AXCA 2INCC 3KQ4A 3J9CA 3ZIMA 4A20A 4AJYB 1I4QA 1PYWD 4MH0E 1T5XD 5CHWA 5CTRC 3SHQA 1KFYB 1TBEA 4WQOB 3Q69A 4PS3A 2KACA 2ACZB 1K50A 4HKZE 2FUHB 3AEAB 1IUEA 2DYBA 2FBWB 5HG2A 3DBHB 5IAAC 2IGHA 1NYRA 2BW2A 2JUOA 2TSSA 4PT5A 3IFWB 1V1PB 4FJYA 1BMLC 5FK9C 4KKIA 3N1YC 4C00A 3AU4A 5J18A 2BF8B 1YNTE 5AZHA 2V0GA 1GOZA 1K53A 2WX1A 2WGSA 3ZDMC 1WGHA 2JRHA 3AEGB 3X23A 1HTOA 1H8CA 2RGFA 2KQ7A 1NEKB 3QARA 3DBSA 1FNUA 4FBJB 4WURA 4MEMA 3DBRI 2PEAA 1GC6A 3FILA 3MHSD 4NAWA 2Y5PA 3DHIC 4JWUC 2J0KA 2K8CA 4EZKA 2BGFA 3JW0X 1UUPA 2WXLA 3CMMB 2K6DB 2QDFA 3ZXVA 4UDUC 1FIQA 3RNAC 4A9AA 1C1YB 1A70A 1G6JA 2L8JA 2KWUB 3TJPA 1OFFA 1KM7A 2WXQA 4YTNB 3R7RA 3OJ4B 1TT5B 3K9OB 3DVGY 3TEZA 1PFDA 3BYTB 3ZTDA 2JX5A 1RRBA 4E3CA 4HPLB 3DCGA 2BB5A 2FNJB 4LTUA 5KHQA 2MLBA 3OAWA 1OTRB 2UU7A 1WGGA 3V6CB 1L6VA 4KGRA 4II3B 4WIPA 4WWMA 1GAQB 2D07B 3M95A 2XK5B 1T0RC 1I42A 1YQ3B 2LJIA 4K7SA 2EMSA 2G45B 3S2AA 2IBIB 4GOCA 2XN9C 4US8A 1E8ZA 1P7EA 2O6VA 1EWYC 3RD2A 1WZ3A 2V9HA 2GMIC 2RD0A 2L0FA 1D5XC 2V4IB 5LLIA 1MJDA 5GMVA 2BYFA 2N9XA 3GP7A 4MJSA 2I2YA 2W54A 3N30A 2PKOA 2YLMA 4TMAB 4RF0A 2JRIB 2QIEB 1PUTA 3QX1A 4I6LB 2ZNVC 3NVYA 2KDBA 3I57A 3HUIA 3ETRA 1QILA 2L52A 4EUTA 2K39A 3APFA 4KIKB 3RNCC 4HPPA 1CJEA 2WDVB 4IWQA 1I4RA 3ZW3A 3LJ3A 5BMGA 1CZPA 2FIFA 1E7UA 2L00B 4NQKE 1GNUA 1E7PB 2EMTA 2KMMA 2RR9A 4RH6A 3Q3OC 4PYUA 2DNFA 4LNKA 4R3DA 2DZMA 1L0VB 2ZW1A 4YL8A 1JRPA 2MCNB 4DXFA 4RCOA 5AZGA 3AMZA 2FCSA 4WJNA 2WXOA 4E71A 1WM3A 1ZXHA 3AULA 5EE0A 1V1OA 2MJ3A 2WU2B 2KFKA 1I4PA 2LFIA 4LLGM 4ANUA 2D3GA 2ZPNA 1UWMA 3GE3C 4WWNA 4US9A 1JWBD 3BVZA 3ZYYX 4AWJA 3NRZA 4G3XB 2G9HD 1TS4A 3PVLA 4ZYNA 2FE8A 4HRSA 1XCQL 1OGWA 2JWUA 1RFKA 1XLNA 4B0MA 1Q0WB 2N0SB 1FXAA 3ZNGC 2NCNA 1VZ6A 4EZLA 3ZNID 3TIXA 4KDIC 3VH3B 3VFKA 2MX2A 3O65B 2HTHA 2KN4A 4N6EB 4BKGA 2C7MB 3WA0A 1HE8A 1E8XA 4EKUA 2N9LA 4W9HA 3A9JA 3IBEA 3KWLA 2VZKD 1AN8A 3SDLC 1MI0A 1JMLA 2D3CA 4GGQA 4WJQA 4RM9A 3L08A 2KMAA 4ARIA 3R66C 2NBUA 1ET9A 3V6EB 2BT6A 2ICIA 3FAHA 1P7FA 1GUAB 2BS4B 3V62A 2CJOA 1TKGA 1TY2A 3DBLI 3UI3A 1C3TA 4IM0A 3W5UB 3CSFA 1YQBA 2NTSA 1CQVA 3MC0B 1XLPA 3TMPB 2ZEQA 1IBXB 1PGAA 1I35A 2K1FA 4B6WA 2KVZA 4URKA 1IYFA 5IP4D 3NG0A 1CMXB 5MPOA 1WMHB 2K0PA 2NMQA 2K6QA 2W3RA 2MBQA 2NBWB 4RM8A 1YX6B 4CHKA 5DPWA 2REXA 1ET6A 3KYDD 3P4RB 3VAWA 1XT9B 4KVGB 2YEPB 2YEPF 2QCZA 3V61A 2E3TA 3L17A 1C78A 1YIWA 3GZNB 5HFYA 2FCNA 2Z0EB 4RGTA 5DPSA 1UD7A 3AE2B 4BKTA 4GB9A 1R4MI 4MDKE 1ACCA 3PRZA 2PLPA 2ZVOA 3A9KB 3H7SA 1WGYA 4DHZB 3W1SA 1D6EC 1L0YB 5D2MB 1E9MA 2JU6X 5AUIA 1SIJA 2L3ZA 2V4LA 4OHJA 1YX5B 4WWOA 2XBBC 4E74A 2J53A 4GSWA 3N32A 4JGHB 1KRHA 3TEWA 1YMHE 5GXGB 1Z5SB 1QZEA 2AQ2B 3JYUA 2INNE 4PS7A 3NS1A 1TZ1A 1WWTA 3Q6BA 1FXTB 2GBRA 3ZNHB 3VUYA 3P4SB 4LNOA 4S0RA 3H7PA 4NQLB 4NPNA 1K8RB 4IW0A 4XGAB 5FR3A 5JZEB 1HZ5A 1E90A 3RNFC 4GMVA 1JROA 2R2OA 1C79A 2ZJDA 4HJGE 4KX6B 4NJCA 3RUIB 2L32A 4HXDA 1XXGA 2NTTA 1YQ4B 4HVBA 3BK2A 2MHJA 5C3JB 1M4VA 3B9JA 4N9F4 1V5TA 3C19A 2VH2A 4YT0B 2LVOA 2W55A 2AL6A 3AB5A 3R3MA 4A90A 1P9DU 2ON8A 4HPMB 2LVQA 1N63A 1L6UA 3Q3NC 3N20C 1L5PA 1WJ6A 1UNSA 2JXTA 4TQ0A 2MH7A 3ONSA 4GDKB 3U2SC 5BO4B 4KSLC 4ANXA 2NS5A 3LXFA 4ZRJA 1L4ZB 2JY6A 3GB1A 4AQ7A 2PTLA 3P42A 1WMHA 2WXFA 1C4CA 3KH0A 3K9PB 4HJKA 2N4FA 1UGMA 4JE3B 3RNBC 5C23A 3UIOB 4KDLB 1R4NB 4OVVA 1E0ZA 4MJSB 4F1SA 1J19A 4G11A 3ZO5B 1UZXB 4YSXB 2D5GA 2QC8A 3P4QB 1V97A 1I4GA 3HM3A 4GDKA 5E6OA 4ASWC 2BB6A 3WAOA 1ZGUB 3VDZA 4OW0A 2I1JA 4HCPB 2W9NA 2BVCA 3GS2A 1AYFA 1Q1OA 1DYQA 1F0ZA 4FJVB 3RZWC 4IC7B 1F2RC 2M56B 3D32A 2HD5B 2CHWA 5LXHA 3IT4B 2DBYA 3VR8B 2JXXA 3QAQA 4P1CC 4RFBA 3RI7C 3TSSA 2WHIA 2DLBA 3ZRCA 1WRIA 2V3SA 3OJ3A 1QKZA 3BIID 3SFDB 2KTRA 3ALBA 4BKSD 4JL9A 1QF6A 1J7CA 4WAFA 4BBNC 5EE1A 2BKRB 2FCMA 5EE3A 1QOBA 2KC2A 4P7IA 4MGYE 2H88B 3NUHB 3BZDB 2RDGA 3WIMA 1J0GA 4IUMB 3ZVVA 2KHWB 3KLSX 3N3KB 4ICUA 2ZW0A 3ABVB 1WSPA 2JF5A 2KYWA 3TUOA 1FXIA 4QAYA 3U4EG 4RF1A 3O13A 1E6EB 3AE1B 1WY8A 2KOXA 2ZPYA 2R2QA 3ZQ4A 2Z0DB 1FEHA 1FRDA 4XDDA 4W9DA 2BYTA 2XEWA 2Y5CA 5DCNA 4IOIE 1UF0A 2CHXA 5C2TB 1V8CA 2IO1B 1PGBA 4N59A 3L10B 1E7VA 1STEA 2JPHA 4M01A 4W9GA 4M02A 2J52A 2EKEC 1SJHD 4M8MA 2CR5A 2ASQA 1XF5L 1J7BA 1WZ0A 4FA6A 1DOYA 1FRRA 2IGDA 2KT7A 1KLUD 3PV1A 2KO3A 3TL5A 3DHGC 1C76A 1WE7A 1R4NI 1ZE3D 3KYCD 3PS6A 2L83A 1JALA 1HEZE 1IGDA 1V2YA 1YJ1A 1ZKHA 1FO4A 4CO7A 3TEYA 4XWWA 1WXVA 3P4PB 1C4PA 2K8BA 5EDSA 3I63C 5IKCM 3M63B 1CK1A 5IOIA 4BVUC 2KTFA 2WYQA 4JWSC 3GZNI 1V86A 1U4AA 3IG3A 3KW5B 5BMHA 1WF9A 3EA6A 3AE5B 1HXYD 4W9JA 2HTME 2A5UA 2JQRB 1KLGD 2K8HA 2BS2B 2MW5A 3Q8CA 3QIJA 5D94A 2GI9A 3FKYA 1EF5A 3AE4B 4DDID 3UQAA 4GDLB 3TCAA 2J42A 2WXRA 4HEA1 1WYGA 4YWGG 2IYDB 3DHHC 4MGKE 1XLOA 2HE7A 1SB3C 1QOGA 5L95C 4LDTB 1AW7A 3B2FA 1OEYA 3HK0A 2RSUA 3PRPB 2LGDA 2FCQA 4JPSA 3PSEB 4GU2A 4M00A 4NY0A 2GBKA 4IWOA 4K3CA 1JWSD 5E6JA 2PMVA 1N62A 3C0RB 3LYYA 3U7ZA 4TUUA 3IAS1 2RDBC 3U52E 3VRBB 3H7PB 4ZRPA 3NVVA 5BMIA 3KVFB 2DHZA 2LWPA 3E9SA 4DHJB 1VRAB 2KNBA 4FHJA 2WDQB 2J0MA 4IG7B 4ZRIA 4MSQB 1P3QU 1EF1A 3UINB 2C7HA 3ZGZA 5G2NA 3SU8X 2PIAA 2I38A 2N1WA 4YSYB 1GB1A 2GB1A 3KUZA 2L05A 4K3BA 2BWFA 2SEBD 2OJRA 3B0AA 3HM6X 2G4SA 2LZ6A 4P6VF 5LXIB 4HLEA 4M8NA 2PW9A 2R61A 4KGTA 4YTMB 2QHOA 1FNVA 3WCQA 1WXSA 4DHZE 2LI5A 2CS4A 1FFUA 4MT5A 5D6JB 4P16A 3X0WA 3I3TB 4OVUA 2WXIA 3U7DA 4HK2A 1F1HA 2D10A 2QSDA 1VZ7A 4NJ7A 3N9YC 5JXVA 5G5GA 4LJOB 1OEYJ 3ZXRA 3ZJTA 2B76B 4M0WA 5BYSA 3UQBA 2KXJA 1F2RI 3IT6B 1ZW7A 1WGKA 4HWIB 2KWCA 1M94A 1D5ZC 2KFJA 3PT2B 5FR6A 1D3ZA 3Q3MC 1N60A 2BS3B 4W9EA 3L0WB 1WR6E 2K25A 2N1VA 1NENB 2NVUI 2AWTA 3MJWA 3U30A 1WJUA 1V80A 4XX5A 3W1SC 3CIRB 1ENFA 2K5PA 1FMAD 1WH3A 1XQQA 2IO0B 4K1RB 4DBGA 2ZVNA 1VDVA 1NI3A 4JIOU 2LASA 5EE9A 1ISNA 1T6BX 2WU5B 2IO2B 1ESFA 4GDLA 2JZZA 2XNAC 1P0RA 4LDTD 4NAMA 4K7UA 3MP9A 2UWQA 1Y56A 1GG3A 3EECA 4HROA 2M0AA 3VUWA 2CU3A 1JWMD 3RCZA 2D2QA 1S1QB 3AH7A 3M3JA 1ZDVA 1WGDA 4HDQA 3L54A 2KZRA 2QJLA 3UF8A 1WXMA 3AEEB 3W5VB 1KTKA 1EWCA 2MRPA 1H4RA 3QA8A 3IHPC 1J8CA 2KDEB 3ZKJC 1LO5D 3CSTA 4M0WB 3EFCA 3HHMA
chains in the Genus database with same CATH topology
1OQYA 2DAJA 2KQ7A 4JQWC 3BY4B 4WJOA 4MGIE 2N4FA 3NHEB 1UGMA 2BYEA 2ZZPB 1A5RA 4WAAA 4MM3A 4CYEA 5C23A 3UIOB 1WJ4A 4KDLB 3QARA 1NBFC 4OVVA 3DBSA 4RMAA 4MJSB 2NPTB 4FBJB 1J19A 4MEMA 4F1SA 4G11A 3DBRI 1UZXB 3ZO5B 3QC8B 2PEAA 5L83A 1GC6A 3DQVA 3HM3A 3MHSD 4GDKA 1S3SG 4NAWA 5E6OA 4ASWC 3ZTCA 1WGRA 3ENEA 2J0KA 4KV2A 3WAOA 4AP4C 1ZGUB 2K8CA 3VDZA 4EZKA 2BGFA 2I1JA 3JW0X 2W9NA 2IZVB 4HCPB 2O2VB 2LRUA 1Q1OA 3CMMB 2K6DB 4TKNA 1WFYA 4FJVB 1C1YB 3QWZB 1G6JA 3RZWC 3DVNV 2L8JA 3D32A 2KWUB 4IC7B 1V6EA 4TV3A 3TJPA 2HD5B 3VH4B 2CHWA 4EOYA 5DPRA 1KM7A 1SGHA 3ZDTA 1NI2A 3R7RA 2J0JA 1WX9A 3OJ4B 5LXHA 2LXAA 1GJZA 4G0NB 1LXDA 2KDIA 3ECIA 1V5OA 3K9OB 3PLUA 3DVGY 4K81A 3ZTDA 1YD8U 5HKHA 1RRBA 2JXXA 4AOFA 4E3CA 4HPLB 2FAZA 3DCGA 3QAQA 5AEKB 3DBHI 2KVRA 3ZRCA 4X57B 3B08A 4KSKC 4W9KA 2V3SA 2FNJB 3OJ3A 3APDA 3T9LA 1RLFA 5KHQA 2KTRA 3ALBA 1KLVA 4FHKA 4BKSD 4JL9A 2MLBA 3OAWA 3PZDA 2KC1A 4MSMB 1OTRB 1WE6A 2MP2B 2RPQA 3Q3FA 1WGGA 2MBEA 3V6CB 1Q5WB 2VRRB 2O6VB 3V60A 2LRWA 4II3B 2JVCA 4AJWA 1MG8A 4DK5A 2D07B 3M95A 2XK5B 4BBNC 1I42A 2YVCA 2PE6B 2BKRB 5J17A 2FCMA 3WALA 4K7SA 2KC2A 4P7IA 2EMSA 2G45B 3S2AA 4MGYE 4DWFA 3ZLZA 2IBIB 4GOCA 2WWZA 1E8ZA 2KDFB 2O6VA 4GN1A 3WIMA 1Z2MA 3U8ZA 2J7QB 3RD2A 2GBMA 1J0GA 4IUMB 1WZ3A 2BKFA 3ZVVA 2JT4B 2KTRB 2GMIC 2KHWB 2RD0A 3N3KB 3PHWB 4F7ZA 2BWES 4ICUA 2L0FA 2JF5A 3RULA 4IM2A 4JLCA 5LLIA 5GMVA 1WYWB 1LQBA 5AZFA 3RYTA 2KQSA 1WY8A 2KOXA 2BYFA 2N9XA 2ZPYA 4KZCA 4MJSA 2HJ8A 3N30A 3EHVA 2R2QA 2YLMA 2Z0DB 4WWPA 3DDCB 1WR1A 2JRIB 2ZCCA 4W9DA 2XEWA 3QX1A 2MBHA 4I6LB 4W9FA 2G3QB 2GBNA 2ZNVC 5DCNA 3JVZX 2V1YA 2KDBA 3MTNB 5J2RA 2CHXA 3QJZA 2IO1B 2O6VD 3L10B 1E7VA 4EUTA 2K39A 3APFA 2LXCA 4KIKB 2JPHA 4ANVA 4BOSC 3NOBA 1E5WA 3KUDB 4W9GA 4IWQA 4NAWB 4FADA 4NNJB 3LJ3A 1F9JA 5CX3A 3ZW3A 4HDOA 4W9IA 2EKEC 2LGYA 1RAXA 3VQIA 4M8MA 4DXAB 2CR5A 2FIFA 2ASQA 1E7UA 2LUEA 2L00B 3KUCB 4NQKE 3M62B 1WZ0A 1GNUA 2EMTA 4FA6A 2RR9A 4PYUA 5DPTA 2DZMA 3PV1A 2KO3A 2N9PC 3TL5A 1PQSA 2AL3A 4YL8A 2G4DB 2M17A 2MCNB 5AZGA 1WE7A 1R4NI 3KYCD 2MBOA 1IPGA 4ANWA 3PS6A 2FCSA 4WJNA 4E71A 1V2YA 1WM3A 1V9JA 2FIDA 1YJ1A 1ZKHA 4BFRA 5JHAA 3AULA 4CO7A 3VTVA 1WXVA 2KFKA 5CHFA 2K8BA 4ANUA 1SIFA 5EDSA 2D3GA 2ZPNA 3JSVA 3M63B 4MGZE 4WWNA 5G55A 1IP9A 4AWJA 4G3XB 1WM2A 4BVUC 2KTFA 2WYQA 4G50A 2BYVE 2M0XA 3PVLA 4IWPA 4W9CA 3GZNI 4ZYNA 1V86A 1U4AA 3IG3A 3KW5B 4ZRKA 2WX0A 1WF9A 4I6PA 2DENB 3T8MA 4GIVA 4W9JA 3WAMA 2A5UA 3PRMB 4EZJA 3IVFA 4ZDVA 2K8HA 5D94A 2MW5A 1OGWA 3QIJA 1E8YA 1UBQA 3L13A 2GBJA 1EF5A 1Q0WB 5CHVC 3ZNGC 2NCNA 4EZLA 3ZNID 4DDID 3UQAA 4GDLB 2NBVB 3TIXA 2LD9A 3TCAA 1SE9A 3GOEA 3NY5A 4KDIC 3VH3B 2MQJA 3PHXB 1KOTA 3HIZA 1JRUA 3A4RA 3VFKA 2A4ZA 2MX2A 4EFOA 3O65B 3AU5A 4A3PA 2LVPA 2HTHA 2IYDB 3OLMD 4MGKE 3EC8A 4BKGA 2C7MB 2HE7A 3DVNU 5L95C 2CHZA 2KANA 4LDTB 5E6PA 1V49A 5D7GA 1OEYA 3HK0A 3H6NA 2RSUA 3PRPB 3WA0A 1HE8A 2LGDA 1E8XA 3A1QB 2FCQA 4EKUA 2B3AA 1UH6A 1V81A 4W9HA 3PSEB 2AYOB 3A9JA 3IBEA 4FN2A 4GU2A 4NY0A 2DZIA 2GBKA 4IWOA 1NDDA 1WX8A 3SDLC 2KJRA 4GGQA 4LCDE 4WJQA 3C0RB 1UBIA 4RM9A 3L08A 2KMAA 4TUUA 3R66C 2NBUA 3QQ8B 3R7QA 3H7PB 2MBBB 3H9DA 5KHOA 3V6EB 2PPHA 3A4SC 3KVFB 2DHZA 2XK5A 2LWPA 3PTFC 1GC7A 2KX0A 4AUQC 4DHJB 2KNBA 4FHJA 2J0MA 1GUAB 4IG7B 3SD5A 3V62A 4B95A 3H1UA 2Z59B 4ZRIA 4MSQB 4GXBA 3RT3B 2O2VA 1P3QU 1EF1A 3UINB 2C7HA 3DBLI 3UIPB 1C3TA 3EFUA 2DYMA 4IM0A 3A9KA 3PPAA 5G2NA 2M8SA 5E6NA 1UELA 3CSFA 3SU8X 1WRDB 1YQBA 5JHBA 3APCA 2N7EA 2N1WA 2KFKB 3ZNZB 2LGXA 3TMPB 2CU1A 2ZEQA 3DPDA 4FULA 2ZCBA 2NPTA 3KUZA 1I35A 2L05A 2JZ3B 2MWSB 2BWFA 2K1FA 4B6WA 1P1AA 2DX5B 2OJRA 4IM3A 2I1KA 2GOWA 4BOZB 4URKA 3B0AA 3HM6X 2N7DA 2G4SA 2LZ6A 2PE9A 3NZSA 5LXIB 1IYFA 3ML8A 2UYZB 1P98A 2L0TA 3DVGX 4M8NA 4HLEA 1TGZB 2L76A 2KWVB 1Y8RC 5TR5A 2QHOA 1CMXB 3QHTA 2M4NA 1WXSA 2NR2A 3JSVB 4BKSA 1WMHB 4DHZE 2WDTB 2LI5A 2CS4A 2K6QA 4FJZA 2MBQA 2NBWB 4RM8A 3ZUNA 1YX6B 5D6JB 4CHKA 2L7RA 3X0WA 3I3TB 4OVUA 3VVWB 1VD2A 5DPWA 2REXA 4DHJD 2IO3B 3QCAA 3Q3JA 3U7DA 3KYDD 4HK2A 2IY0B 2C5LC 3VAWA 2D10A 1XT9B 4KVGB 2OOBB 3VTWA 1VCBA 4NJ7A 2MA9B 4DDGD 3RZFA 4B9KA 4LJOB 3V61A 3A33B 4LJPB 3VTUA 3WAPA 1OEYJ 4FLHA 2AEHA 5C1ZA 3L17A 2DZKA 1YIWA 2M1MA 2FCNA 2N9EB 2Z0EB 2DAFA 5DPSA 1UD7A 3AI5A 4BKTA 3UQBA 4GB9A 2KXJA 3L16A 2KMCA 1BT0A 2DYOA 1R4MI 1ZW7A 4HWIB 2KWCA 4MDKE 3PRZA 3CF6E 1M94A 4A3OA 3A9KB 2ZVOA 3H7SA 1WGYA 4DHZB 3W1SA 1TTNA 3VHTC 4W9LA 2ZNVB 5D2MB 2KFJA 3PT2B 2LJ5A 5FR6A 2JWZA 1D3ZA 3A1QA 4PYZA 3UGBB 2L3ZA 2V4LA 1YX5B 5JH5C 4W9EA 4WWOA 2C7NB 2KLCA 1E8WA 1WX7A 4ICVA 2XBBC 4E74A 2KK8A 3P2BA 4GSWA 3L0WB 3N32A 4JGHB 3PREA 1WR6E 2K25A 2MSED 3NZUA 1LFDA 2KJHB 2KJ6A 2KN5A 2N1VA 4XZ4A 2NVUI 4KIKA 3VXWA 2AWTA 3MJWA 1Z5SB 1AARA 1QZEA 3U30A 1WI0A 4J6IA 1WJUA 2MP2A 1V80A 3JYUA 4MELA 3LDZE 4XX5A 3DOWA 3A9JB 3W1SC 4PS7A 4F8CB 1TZ1A 2BPSA 4EEWA 1FXTB 2GBRA 3ZNHB 1WH3A 2KD0A 3VUYA 1XQQA 2IO0B 4K1RB 4DBGA 1L7YA 2ZVNA 3H7PA 1RFAA 2C60A 1WJNA 4JIOU 4NQLB 2LASA 4II2B 1K8RB 4IW0A 4NPNA 1XD3B 5JZEB 1ISNA 1E90A 4I6NB 2D11A 3W1YA 3ML9A 4HCNB 4GMVA 1KJTA 3AXCA 2R2OA 4NJ6A 1EUVB 2IO2B 4GDLA 2ZJDA 4KZ0A 2JZZA 3ZIMA 4A20A 4AJYB 4MH0E 3RUIB 3B1LX 1P0RA 4LDTD 3VUXA 5CHWA 4HXDA 5CTRC 3SHQA 2IY1B 4K7UA 2UWQA 4K7WA 1EO6A 1TBEA 4WQOB 1GG3A 4HVBA 2KKCA 4PS3A 3EECA 3QK0A 1WIAA 4N9F4 3WANA 1V5TA 4TQ1A 2FUHB 3VUWA 2DYBA 3NS8A 3PLVA 2CKHB 4PS8A 4BBNF 2LVOA 5IAAC 3RCZA 2JUOA 2AL6A 2D2QA 1S1QB 3R3MA 2KLGA 1P9DU 3IFWB 4FJYA 1WXAA 1T0YA 5IA7A 3M3JA 4HPMB 1WGDA 2LVQA 4XC2A 4HDQA 3L54A 2PJHA 2KX3A 2KZRA 1WJ6A 2C9WB 3UF8A 3AU4A 3ZRFA 1WXMA 5J18A 2BF8B 5AZHA 4TQ0A 1LM8B 3ONSA 4GDKB 5BO4B 4KSLC 4ANXA 2MRPA 2NS5A 1H4RA 3PGEA 4ZRJA 3ZDMC 2WX1A 1X1MA 2JY6A 3QA8A 3IHPC 1WGHA 2JRHA 4WJPA 3TBLD 1L2NA 3BINA 1J8CA 2KDEB 3X23A 3CSTA 1WMHA 3ZKJC 4M0WB 2DZJA 1H8CA 2RGFA 3KH0A 3HHMA 3K9PB 4HJKA 2Y5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  2DAJ A;  2KQ7 A;  4JQW C;  3BY4 B;  4WJO A;  4MGI E;  2N4F A;  3NHE B;  1UGM A;  2BYE A;  2ZZP B;  1A5R A;  4WAA A;  4MM3 A;  4CYE A;  5C23 A;  3UIO B;  1WJ4 A;  4KDL B;  3QAR A;  1NBF C;  4OVV A;  3DBS A;  4RMA A;  4MJS B;  2NPT B;  4FBJ B;  1J19 A;  4MEM A;  4F1S A;  4G11 A;  3DBR I;  1UZX B;  3ZO5 B;  3QC8 B;  2PEA A;  5L83 A;  1GC6 A;  3DQV A;  3HM3 A;  3MHS D;  4GDK A;  1S3S G;  4NAW A;  5E6O A;  4ASW C;  3ZTC A;  1WGR A;  3ENE A;  2J0K A;  4KV2 A;  3WAO A;  4AP4 C;  1ZGU B;  2K8C A;  3VDZ A;  4EZK A;  2BGF A;  2I1J A;  3JW0 X;  2W9N A;  2IZV B;  4HCP B;  2O2V B;  2LRU A;  1Q1O A;  3CMM B;  2K6D B;  4TKN A;  1WFY A;  4FJV B;  1C1Y B;  3QWZ B;  1G6J A;  3RZW C;  3DVN V;  2L8J A;  3D32 A;  2KWU B;  4IC7 B;  1V6E A;  4TV3 A;  3TJP A;  2HD5 B;  3VH4 B;  2CHW A;  4EOY A;  5DPR A;  1KM7 A;  1SGH A;  3ZDT A;  1NI2 A;  3R7R A;  2J0J A;  1WX9 A;  3OJ4 B;  5LXH A;  2LXA A;  1GJZ A;  4G0N B;  1LXD A;  2KDI A;  3ECI A;  1V5O A;  3K9O B;  3PLU A;  3DVG Y;  4K81 A;  3ZTD A;  1YD8 U;  5HKH A;  1RRB A;  2JXX A;  4AOF A;  4E3C A;  4HPL B;  2FAZ A;  3DCG A;  3QAQ A;  5AEK B;  3DBH I;  2KVR A;  3ZRC A;  4X57 B;  3B08 A;  4KSK C;  4W9K A;  2V3S A;  2FNJ B;  3OJ3 A;  3APD A;  3T9L A;  1RLF A;  5KHQ A;  2KTR A;  3ALB A;  1KLV A;  4FHK A;  4BKS D;  4JL9 A;  2MLB A;  3OAW A;  3PZD A;  2KC1 A;  4MSM B;  1OTR B;  1WE6 A;  2MP2 B;  2RPQ A;  3Q3F A;  1WGG A;  2MBE A;  3V6C B;  1Q5W B;  2VRR B;  2O6V B;  3V60 A;  2LRW A;  4II3 B;  2JVC A;  4AJW A;  1MG8 A;  4DK5 A;  2D07 B;  3M95 A;  2XK5 B;  4BBN C;  1I42 A;  2YVC A;  2PE6 B;  2BKR B;  5J17 A;  2FCM A;  3WAL A;  4K7S A;  2KC2 A;  4P7I A;  2EMS A;  2G45 B;  3S2A A;  4MGY E;  4DWF A;  3ZLZ A;  2IBI B;  4GOC A;  2WWZ A;  1E8Z A;  2KDF B;  2O6V A;  4GN1 A;  3WIM A;  1Z2M A;  3U8Z A;  2J7Q B;  3RD2 A;  2GBM A;  1J0G A;  4IUM B;  1WZ3 A;  2BKF A;  3ZVV A;  2JT4 B;  2KTR B;  2GMI C;  2KHW B;  2RD0 A;  3N3K B;  3PHW B;  4F7Z A;  2BWE S;  4ICU A;  2L0F A;  2JF5 A;  3RUL A;  4IM2 A;  4JLC A;  5LLI A;  5GMV A;  1WYW B;  1LQB A;  5AZF A;  3RYT A;  2KQS A;  1WY8 A;  2KOX A;  2BYF A;  2N9X A;  2ZPY A;  4KZC A;  4MJS A;  2HJ8 A;  3N30 A;  3EHV A;  2R2Q A;  2YLM A;  2Z0D B;  4WWP A;  3DDC B;  1WR1 A;  2JRI B;  2ZCC A;  4W9D A;  2XEW A;  3QX1 A;  2MBH A;  4I6L B;  4W9F A;  2G3Q B;  2GBN A;  2ZNV C;  5DCN A;  3JVZ X;  2V1Y A;  2KDB A;  3MTN B;  5J2R A;  2CHX A;  3QJZ A;  2IO1 B;  2O6V D;  3L10 B;  1E7V A;  4EUT A;  2K39 A;  3APF A;  2LXC A;  4KIK B;  2JPH A;  4ANV A;  4BOS C;  3NOB A;  1E5W A;  3KUD B;  4W9G A;  4IWQ A;  4NAW B;  4FAD A;  4NNJ B;  3LJ3 A;  1F9J A;  5CX3 A;  3ZW3 A;  4HDO A;  4W9I A;  2EKE C;  2LGY A;  1RAX A;  3VQI A;  4M8M A;  4DXA B;  2CR5 A;  2FIF A;  2ASQ A;  1E7U A;  2LUE A;  2L00 B;  3KUC B;  4NQK E;  3M62 B;  1WZ0 A;  1GNU A;  2EMT A;  4FA6 A;  2RR9 A;  4PYU A;  5DPT A;  2DZM A;  3PV1 A;  2KO3 A;  2N9P C;  3TL5 A;  1PQS A;  2AL3 A;  4YL8 A;  2G4D B;  2M17 A;  2MCN B;  5AZG A;  1WE7 A;  1R4N I;  3KYC D;  2MBO A;  1IPG A;  4ANW A;  3PS6 A;  2FCS A;  4WJN A;  4E71 A;  1V2Y A;  1WM3 A;  1V9J A;  2FID A;  1YJ1 A;  1ZKH A;  4BFR A;  5JHA A;  3AUL A;  4CO7 A;  3VTV A;  1WXV A;  2KFK A;  5CHF A;  2K8B A;  4ANU A;  1SIF A;  5EDS A;  2D3G A;  2ZPN A;  3JSV A;  3M63 B;  4MGZ E;  4WWN A;  5G55 A;  1IP9 A;  4AWJ A;  4G3X B;  1WM2 A;  4BVU C;  2KTF A;  2WYQ A;  4G50 A;  2BYV E;  2M0X A;  3PVL A;  4IWP A;  4W9C A;  3GZN I;  4ZYN A;  1V86 A;  1U4A A;  3IG3 A;  3KW5 B;  4ZRK A;  2WX0 A;  1WF9 A;  4I6P A;  2DEN B;  3T8M A;  4GIV A;  4W9J A;  3WAM A;  2A5U A;  3PRM B;  4EZJ A;  3IVF A;  4ZDV A;  2K8H A;  5D94 A;  2MW5 A;  1OGW A;  3QIJ A;  1E8Y A;  1UBQ A;  3L13 A;  2GBJ A;  1EF5 A;  1Q0W B;  5CHV C;  3ZNG C;  2NCN A;  4EZL A;  3ZNI D;  4DDI D;  3UQA A;  4GDL B;  2NBV B;  3TIX A;  2LD9 A;  3TCA A;  1SE9 A;  3GOE A;  3NY5 A;  4KDI C;  3VH3 B;  2MQJ A;  3PHX B;  1KOT A;  3HIZ A;  1JRU A;  3A4R A;  3VFK A;  2A4Z A;  2MX2 A;  4EFO A;  3O65 B;  3AU5 A;  4A3P A;  2LVP A;  2HTH A;  2IYD B;  3OLM D;  4MGK E;  3EC8 A;  4BKG A;  2C7M B;  2HE7 A;  3DVN U;  5L95 C;  2CHZ A;  2KAN A;  4LDT B;  5E6P A;  1V49 A;  5D7G A;  1OEY A;  3HK0 A;  3H6N A;  2RSU A;  3PRP B;  3WA0 A;  1HE8 A;  2LGD A;  1E8X A;  3A1Q B;  2FCQ A;  4EKU A;  2B3A A;  1UH6 A;  1V81 A;  4W9H A;  3PSE B;  2AYO B;  3A9J A;  3IBE A;  4FN2 A;  4GU2 A;  4NY0 A;  2DZI A;  2GBK A;  4IWO A;  1NDD A;  1WX8 A;  3SDL C;  2KJR A;  4GGQ A;  4LCD E;  4WJQ A;  3C0R B;  1UBI A;  4RM9 A;  3L08 A;  2KMA A;  4TUU A;  3R66 C;  2NBU A;  3QQ8 B;  3R7Q A;  3H7P B;  2MBB B;  3H9D A;  5KHO A;  3V6E B;  2PPH A;  3A4S C;  3KVF B;  2DHZ A;  2XK5 A;  2LWP A;  3PTF C;  1GC7 A;  2KX0 A;  4AUQ C;  4DHJ B;  2KNB A;  4FHJ A;  2J0M A;  1GUA B;  4IG7 B;  3SD5 A;  3V62 A;  4B95 A;  3H1U A;  2Z59 B;  4ZRI A;  4MSQ B;  4GXB A;  3RT3 B;  2O2V A;  1P3Q U;  1EF1 A;  3UIN B;  2C7H A;  3DBL I;  3UIP B;  1C3T A;  3EFU A;  2DYM A;  4IM0 A;  3A9K A;  3PPA A;  5G2N A;  2M8S A;  5E6N A;  1UEL A;  3CSF A;  3SU8 X;  1WRD B;  1YQB A;  5JHB A;  3APC A;  2N7E A;  2N1W A;  2KFK B;  3ZNZ B;  2LGX A;  3TMP B;  2CU1 A;  2ZEQ A;  3DPD A;  4FUL A;  2ZCB A;  2NPT A;  3KUZ A;  1I35 A;  2L05 A;  2JZ3 B;  2MWS B;  2BWF A;  2K1F A;  4B6W A;  1P1A A;  2DX5 B;  2OJR A;  4IM3 A;  2I1K A;  2GOW A;  4BOZ B;  4URK A;  3B0A A;  3HM6 X;  2N7D A;  2G4S A;  2LZ6 A;  2PE9 A;  3NZS A;  5LXI B;  1IYF A;  3ML8 A;  2UYZ B;  1P98 A;  2L0T A;  3DVG X;  4M8N A;  4HLE A;  1TGZ B;  2L76 A;  2KWV B;  1Y8R C;  5TR5 A;  2QHO A;  1CMX B;  3QHT A;  2M4N A;  1WXS A;  2NR2 A;  3JSV B;  4BKS A;  1WMH B;  4DHZ E;  2WDT B;  2LI5 A;  2CS4 A;  2K6Q A;  4FJZ A;  2MBQ A;  2NBW B;  4RM8 A;  3ZUN A;  1YX6 B;  5D6J B;  4CHK A;  2L7R A;  3X0W A;  3I3T B;  4OVU A;  3VVW B;  1VD2 A;  5DPW A;  2REX A;  4DHJ D;  2IO3 B;  3QCA A;  3Q3J A;  3U7D A;  3KYD D;  4HK2 A;  2IY0 B;  2C5L C;  3VAW A;  2D10 A;  1XT9 B;  4KVG B;  2OOB B;  3VTW A;  1VCB A;  4NJ7 A;  2MA9 B;  4DDG D;  3RZF A;  4B9K A;  4LJO B;  3V61 A;  3A33 B;  4LJP B;  3VTU A;  3WAP A;  1OEY J;  4FLH A;  2AEH A;  5C1Z A;  3L17 A;  2DZK A;  1YIW A;  2M1M A;  2FCN A;  2N9E B;  2Z0E B;  2DAF A;  5DPS A;  1UD7 A;  3AI5 A;  4BKT A;  3UQB A;  4GB9 A;  2KXJ A;  3L16 A;  2KMC A;  1BT0 A;  2DYO A;  1R4M I;  1ZW7 A;  4HWI B;  2KWC A;  4MDK E;  3PRZ A;  3CF6 E;  1M94 A;  4A3O A;  3A9K B;  2ZVO A;  3H7S A;  1WGY A;  4DHZ B;  3W1S A;  1TTN A;  3VHT C;  4W9L A;  2ZNV B;  5D2M B;  2KFJ A;  3PT2 B;  2LJ5 A;  5FR6 A;  2JWZ A;  1D3Z A;  3A1Q A;  4PYZ A;  3UGB B;  2L3Z A;  2V4L A;  1YX5 B;  5JH5 C;  4W9E A;  4WWO A;  2C7N B;  2KLC A;  1E8W A;  1WX7 A;  4ICV A;  2XBB C;  4E74 A;  2KK8 A;  3P2B A;  4GSW A;  3L0W B;  3N32 A;  4JGH B;  3PRE A;  1WR6 E;  2K25 A;  2MSE D;  3NZU A;  1LFD A;  2KJH B;  2KJ6 A;  2KN5 A;  2N1V A;  4XZ4 A;  2NVU I;  4KIK A;  3VXW A;  2AWT A;  3MJW A;  1Z5S B;  1AAR A;  1QZE A;  3U30 A;  1WI0 A;  4J6I A;  1WJU A;  2MP2 A;  1V80 A;  3JYU A;  4MEL A;  3LDZ E;  4XX5 A;  3DOW A;  3A9J B;  3W1S C;  4PS7 A;  4F8C B;  1TZ1 A;  2BPS A;  4EEW A;  1FXT B;  2GBR A;  3ZNH B;  1WH3 A;  2KD0 A;  3VUY A;  1XQQ A;  2IO0 B;  4K1R B;  4DBG A;  1L7Y A;  2ZVN A;  3H7P A;  1RFA A;  2C60 A;  1WJN A;  4JIO U;  4NQL B;  2LAS A;  4II2 B;  1K8R B;  4IW0 A;  4NPN A;  1XD3 B;  5JZE B;  1ISN A;  1E90 A;  4I6N B;  2D11 A;  3W1Y A;  3ML9 A;  4HCN B;  4GMV A;  1KJT A;  3AXC A;  2R2O A;  4NJ6 A;  1EUV B;  2IO2 B;  4GDL A;  2ZJD A;  4KZ0 A;  2JZZ A;  3ZIM A;  4A20 A;  4AJY B;  4MH0 E;  3RUI B;  3B1L X;  1P0R A;  4LDT D;  3VUX A;  5CHW A;  4HXD A;  5CTR C;  3SHQ A;  2IY1 B;  4K7U A;  2UWQ A;  4K7W A;  1EO6 A;  1TBE A;  4WQO B;  1GG3 A;  4HVB A;  2KKC A;  4PS3 A;  3EEC A;  3QK0 A;  1WIA A;  4N9F 4;  3WAN A;  1V5T A;  4TQ1 A;  2FUH B;  3VUW A;  2DYB A;  3NS8 A;  3PLV A;  2CKH B;  4PS8 A;  4BBN F;  2LVO A;  5IAA C;  3RCZ A;  2JUO A;  2AL6 A;  2D2Q A;  1S1Q B;  3R3M A;  2KLG A;  1P9D U;  3IFW B;  4FJY A;  1WXA A;  1T0Y A;  5IA7 A;  3M3J A;  4HPM B;  1WGD A;  2LVQ A;  4XC2 A;  4HDQ A;  3L54 A;  2PJH A;  2KX3 A;  2KZR A;  1WJ6 A;  2C9W B;  3UF8 A;  3AU4 A;  3ZRF A;  1WXM A;  5J18 A;  2BF8 B;  5AZH A;  4TQ0 A;  1LM8 B;  3ONS A;  4GDK B;  5BO4 B;  4KSL C;  4ANX A;  2MRP A;  2NS5 A;  1H4R A;  3PGE A;  4ZRJ A;  3ZDM C;  2WX1 A;  1X1M A;  2JY6 A;  3QA8 A;  3IHP C;  1WGH A;  2JRH A;  4WJP A;  3TBL D;  1L2N A;  3BIN A;  1J8C A;  2KDE B;  3X23 A;  3CST A;  1WMH A;  3ZKJ C;  4M0W B;  2DZJ A;  1H8C A;  2RGF A;  3KH0 A;  3HHM A;  3K9P B;  4HJK A;  2Y5B B; 
#chains in the Genus database with same CATH topology
 4JX1 C;  2DAJ A;  4MGI E;  2WS3 B;  2LEK A;  5H8Y E;  2KWD A;  4ARC A;  1A5R A;  2HJ1 A;  2V3N A;  4OZB A;  1WJ4 A;  2W82 A;  4MAC A;  3DBR B;  5L83 A;  1S3S G;  3ZTC A;  1WGR A;  3ENE A;  4AP4 C;  1K51 A;  2K9X A;  4YTP B;  3T3N A;  2LRU A;  4REZ A;  4C80 A;  1QOF A;  2Z8L A;  1V1P A;  4TKN A;  1WFY A;  3QWZ B;  4TV3 A;  1LGR A;  1V6E A;  1QT9 A;  5DPR A;  3ZDT A;  2OHF A;  2LMC A;  1SE4 A;  2LXA A;  1GJZ A;  2KDI A;  2IDY A;  3PLU A;  4K81 A;  2RPV A;  4XDC A;  4AOF A;  2FAZ A;  2PVO D;  1PDX A;  3DBH I;  2KVR A;  2AX5 A;  1L0X B;  2HDE A;  4X57 B;  3B08 A;  4RGN A;  4WQM A;  3APD A;  3T9L A;  2VH1 A;  1KLV A;  3VRA B;  4FHK A;  4C7Z A;  4MSM B;  3PZD A;  2KC1 A;  1WE6 A;  2RPQ A;  3Q3F A;  2MBE A;  1UWX A;  1FCC C;  1MG8 A;  4DK5 A;  5J17 A;  3WAL A;  1QOA A;  3ZLZ A;  3NJT A;  3AE9 B;  2WNM A;  4ZYS A;  1B9R A;  4P1B C;  3C8Y A;  4GN1 A;  1C9F A;  4N58 A;  1Z2M A;  2PVG C;  2GBM A;  1N5X A;  2KTR B;  4F7Z A;  2BWE S;  3T3O A;  2IND C;  4IM2 A;  3I9V 1;  1WYW B;  5AZF A;  3RYT A;  2KQS A;  1YN4 A;  3RN9 C;  1EU4 A;  3EHV A;  4WWP A;  1R4M B;  2V3P A;  3BVM A;  3CWI A;  4H2A A;  2G3Q B;  2LHD A;  2GBN A;  3JVZ X;  5BYQ A;  2V1Y A;  4AS1 A;  4CQN A;  4ANV A;  2LXC A;  3NOB A;  2EKI A;  1E5W A;  1YN5 A;  1MVK A;  1BUI C;  1QQR A;  4NNJ B;  1N61 A;  1F9J A;  5CX3 A;  4OVZ A;  3M62 B;  4A6Q A;  1MHX A;  3MFG A;  3L4P A;  4LNN A;  1L4D B;  5DPT A;  2N9P C;  2X38 A;  2AL3 A;  2G4D B;  3V05 A;  1XLQ A;  2MBO A;  4KKJ A;  4ANW A;  5AUK A;  1V9J A;  1YJJ A;  4BFR A;  5JHA A;  1IBX A;  1SE2 A;  4OZA A;  3RMK C;  5CHF A;  1SIF A;  3JSV A;  3DWM A;  4MGZ E;  4USA A;  1WM2 A;  3R8B A;  1Q10 A;  4G50 A;  2BYV E;  3RNG C;  3HVD A;  4ZRK A;  1DGJ A;  3T8M A;  2N7J A;  3NVZ A;  3WAM A;  4ZDV A;  2LUM A;  2AQ3 B;  2IJ0 A;  1UBQ A;  3L13 A;  1VJK A;  3Q8E A;  1JCK B;  5CHV C;  1XEE A;  2NBV B;  1HA5 A;  3GOE A;  1KOT A;  2MQJ A;  3FC4 A;  3PHX B;  3HIZ A;  5D3D A;  4RGO S;  2WLB A;  3OLM D;  1RYJ A;  4ACF A;  3EC8 A;  4ZOH C;  1MFW A;  5E6P A;  4DQO C;  3Q2A C;  1V49 A;  1HTQ A;  5D7G A;  3Q14 C;  3A1Q B;  1UH6 A;  3P63 A;  1KH0 A;  1WX8 A;  1T0S C;  3AV8 A;  1UBI A;  5IO9 A;  2WXG A;  3MC9 A;  3URY A;  2BTE A;  2KDM A;  2RDH A;  3R7Q A;  1SE3 A;  3AN1 A;  2MBB B;  3H9D A;  5KHO A;  2PPH A;  2EEL A;  3OG5 A;  3A4S C;  1SF0 A;  1TS5 A;  2KX0 A;  4LNI A;  4NZL B;  4B95 A;  1OQQ A;  2Z59 B;  4GXB A;  2O2V A;  3AEB B;  1TS3 A;  4C7Y A;  4EE2 A;  3EFU A;  2DYM A;  3TEX A;  1VZ8 A;  3A9K A;  3PPA A;  3VR9 B;  1UEL A;  1WRD B;  5JHB A;  3APC A;  1GPX A;  1KF6 B;  2KFK B;  2CU1 A;  3DPD A;  2ZCB A;  2NPT A;  3MC8 A;  5IN7 A;  2DX5 B;  4IM3 A;  1MPE A;  2GOW A;  4BOZ B;  3HRD D;  2PE9 A;  3NZS A;  3ML8 A;  2UYZ B;  3IAM 1;  2L76 A;  1ZP0 B;  2KWV B;  1Y8R C;  3QHT A;  1GB4 A;  2M4N A;  2WDT B;  3OWE B;  4FJZ A;  3ZJV A;  3ZUN A;  1RWS A;  2WXK A;  1VD2 A;  4DHJ D;  5D3I B;  2IY0 B;  3VTW A;  2MA9 B;  1IGC A;  3RZF A;  1FCL A;  3IXS A;  3WAP A;  2WQY B;  4FLH A;  2AEH A;  3N1Z C;  1E10 A;  4A8X C;  2DZK A;  4C56 C;  4OZC A;  2N9E B;  2WXN A;  4Q2J A;  2AQ1 B;  3L16 A;  2DWQ A;  2WXM A;  5H92 C;  2CJN A;  3NVW A;  3SFE B;  3CF6 E;  1TTN A;  3VHT C;  4W9L A;  3NZ3 A;  2ZNV B;  1BXT A;  3PZ7 A;  2LJ5 A;  2JWZ A;  3A1Q A;  4J3O D;  3DBL B;  2JSV X;  2GLS A;  3SEB A;  1WX7 A;  3AE7 B;  3P2B A;  2MSE D;  3NZU A;  1LFD A;  2KN5 A;  2INP E;  1C77 A;  1YN3 A;  4S17 A;  2WXP A;  4MEL A;  3DOW A;  3A9J B;  4O1N A;  4F8C B;  4EEW A;  4FXC A;  5LNK 1;  2LGI A;  2JYE A;  1I4H A;  2KD0 A;  3Q8F A;  2OJW A;  1L7Y A;  4ZRQ A;  1RFA A;  1WJN A;  4II2 B;  4I6N B;  2D11 A;  3W1Y A;  3ML9 A;  2VZK B;  5T8I A;  1KJT A;  4NJ6 A;  1EUV B;  1B1Z A;  4KZ0 A;  3PO0 A;  4WH4 A;  3B1L X;  2D3A A;  3KWV A;  3VUX A;  1N6Z A;  2ONQ A;  2IY1 B;  4K7W A;  1EO6 A;  1ZOY B;  2KKC A;  4PK1 A;  4LNF A;  3QK0 A;  1WIA A;  3WAN A;  4TQ1 A;  3NS8 A;  3PLV A;  2CKH B;  4PS8 A;  4BBN F;  1DOI A;  4ZHO A;  4KGS A;  3W2D A;  2KLG A;  1WXA A;  1T0Y A;  5IA7 A;  2K22 A;  5I4D A;  1HZ6 A;  4XC2 A;  2N9K A;  2PJH A;  2KX3 A;  2C9W B;  1TYG B;  3ZRF A;  1LM8 B;  1YOV B;  2H89 B;  3HVZ A;  2GRI A;  3PGE A;  1X1M A;  1SSN A;  4WJP A;  3TBL D;  1L2N A;  3BIN A;  4MM3 B;  2DZJ A;  4ZHP A;  2Y5B B;  4A55 A;  2OED A;  4GLS C;  1OQY A;  4JQW C;  3BY4 B;  4WJO A;  3NHE B;  2BYE A;  2ZZP B;  4WAA A;  2Y3A A;  4MM3 A;  4L23 A;  3BK1 A;  4L1B A;  4CYE A;  1NBF C;  4RMA A;  2NPT B;  3RNE C;  3QC8 B;  3ZJU A;  3DQV A;  1D4B A;  1EU3 A;  1WXQ A;  1MG4 A;  2MEK A;  4KV2 A;  2IZV B;  2O2V B;  3RPF C;  3DVN V;  1SEB D;  2W3S A;  2D3B A;  3VH4 B;  4YXD B;  4EOY A;  1SGH A;  1NI2 A;  2J0J A;  1WX9 A;  4G0N B;  1LXD A;  3ECI A;  1V5O A;  1F52 A;  3E56 A;  1YD8 U;  5HKH A;  5AEK B;  1TKY A;  4W9K A;  4KSK C;  1RLF A;  2IGG A;  2J4X A;  2MP2 B;  1Q5W B;  2VRR B;  2O6V B;  3P1M A;  3V60 A;  2JZP A;  3R2I A;  2LRW A;  2JVC A;  4AJW A;  2YVC A;  1HQR D;  2PE6 B;  4IKG A;  1FNW A;  4DWF A;  2WWZ A;  4C4V B;  2KDF B;  3U8Z A;  2J7Q B;  3AM9 A;  2BKF A;  2M19 A;  3SR6 A;  2JT4 B;  3PHW B;  3AE3 B;  4MH8 A;  4C4V A;  3RUL A;  4JLC A;  2QEJ C;  3PZ8 A;  1LQB A;  1XCT L;  4BZA A;  3B2G A;  4KZC A;  1JWU D;  2RMM A;  2HJ8 A;  4B0E A;  3DDC B;  1WR1 A;  2ZCC A;  3DWG C;  2MBH A;  4W9F A;  1XO3 A;  3MTN B;  5J2R A;  3QJZ A;  2X8X X;  3AE6 B;  2O6V D;  5HI1 A;  5TSS A;  4BOS C;  3KUD B;  4YSZ B;  1C4A A;  3FIL B;  4NAW B;  1OQR A;  1RM6 C;  4FAD A;  4XWT A;  5BYR A;  4HDO A;  4W9I A;  2LGY A;  1RAX A;  3VQI A;  4DXA B;  2LHE A;  2LUE A;  3KUC B;  2WXJ A;  2JYT A;  3MHZ A;  2Q5W D;  1R7S A;  1PQS A;  4D2K A;  2M17 A;  1FFV A;  1IPG A;  1ZXI A;  2FID A;  3VTV A;  5G5H A;  2BQQ A;  4DXG A;  5G55 A;  1IP9 A;  3AE8 B;  1I4X A;  3I5J C;  1TZO A;  4IWP A;  2M0X A;  4LK0 M;  4W9C A;  1EM7 A;  1N5W A;  2WX0 A;  3R2T A;  4I6P A;  1VR9 A;  2DEN B;  1ZUD 2;  3Q8A A;  4GIV A;  2KAJ A;  3PRM B;  4EZJ A;  3IVF A;  3RFZ B;  1VLB A;  2K3U A;  1E8Y A;  2GBJ A;  2MJD A;  2WP9 B;  2LD9 A;  1SE9 A;  3NY5 A;  5HHD G;  1JRU A;  3A4R A;  2A4Z A;  4EFO A;  3AU5 A;  4A3P A;  2LVP A;  4XYC A;  2MJE A;  3DVN U;  2CHZ A;  2KAN A;  4HKQ A;  2WDR B;  3H6N A;  2LGS A;  2B3A A;  2QMT A;  1F77 A;  1NVI D;  1SBB B;  3AED B;  1V81 A;  2AYO B;  4FN2 A;  2DZI A;  1TY0 A;  1NDD A;  2KJR A;  4LCD E;  2G1E A;  3QQ8 B;  1ZDX A;  4BAX A;  2XK5 A;  3PTF C;  4AUQ C;  1GC7 A;  2E6X A;  1PGX A;  1FD6 A;  1JWA D;  3SD5 A;  3H1U A;  3RT3 B;  1J7A A;  2FUG 1;  2IPK D;  3UIP B;  2M8S A;  5E6N A;  4IDI A;  2N7E A;  3ZNZ B;  2LGX A;  4FUL A;  3AEF B;  2JZ3 B;  2MWS B;  1P1A A;  1SJE D;  2I1K A;  3N1X C;  2N7D A;  1P98 A;  2L0T A;  3DVG X;  1TGZ B;  1ROE A;  5TR5 A;  1TKE A;  3JSV B;  1YJI A;  2NR2 A;  4ITK A;  4BKS A;  5FKA C;  1ZPS A;  2L7R A;  4XE0 A;  1JQ4 A;  3VVW B;  2IO3 B;  3QCA A;  3Q3J A;  1UGJ A;  2C5L C;  2OOB B;  2QIL A;  1VCB A;  4DDG D;  2SAK A;  3Q8B A;  4B9K A;  3A33 B;  4LJP B;  3VTU A;  1K52 A;  1QLB B;  5C1Z A;  2M1M A;  4L2Y A;  4RNA A;  1I7H A;  2DAF A;  3GE8 C;  3AI5 A;  2BBC A;  2KMC A;  1BT0 A;  1MHH E;  2DYO A;  3EGR A;  2KQ4 X;  1JW9 D;  1TJE A;  4A3O A;  3MJ5 A;  3BWU D;  3BYY B;  1DOX A;  1TS2 A;  3W9C B;  3LB8 C;  4PYZ A;  3UGB B;  5JH5 C;  2C7N B;  1T3Q A;  2KLC A;  1E8W A;  4ICV A;  2KK8 A;  2WXH A;  3PRE A;  3V3X A;  4XZ4 A;  2KJH B;  2KJ6 A;  1NYQ A;  1TIF A;  2L1A A;  4KIK A;  3VXW A;  4RGM A;  3AEC B;  1AAR A;  1WI0 A;  4J6I A;  2MP2 A;  4TSS A;  3H8H A;  3LDZ E;  2BPS A;  1FPY A;  1AWD A;  3BVG A;  1SXT A;  1D5M C;  2C60 A;  3EUB 2;  1XD3 B;  1FM0 D;  4HCN B;  1T0Q C;  3AXC A;  2INC C;  3KQ4 A;  3J9C A;  3ZIM A;  4A20 A;  4AJY B;  1I4Q A;  1PYW D;  4MH0 E;  1T5X D;  5CHW A;  5CTR C;  3SHQ A;  1KFY B;  1TBE A;  4WQO B;  3Q69 A;  4PS3 A;  2KAC A;  2ACZ B;  1K50 A;  4HKZ E;  2FUH B;  3AEA B;  1IUE A;  2DYB A;  2FBW B;  5HG2 A;  3DBH B;  5IAA C;  2IGH A;  1NYR A;  2BW2 A;  2JUO A;  2TSS A;  4PT5 A;  3IFW B;  1V1P B;  4FJY A;  1BML C;  5FK9 C;  4KKI A;  3N1Y C;  4C00 A;  3AU4 A;  5J18 A;  2BF8 B;  1YNT E;  5AZH A;  2V0G A;  1GOZ A;  1K53 A;  2WX1 A;  2WGS A;  3ZDM C;  1WGH A;  2JRH A;  3AEG B;  3X23 A;  1HTO A;  1H8C A;  2RGF A;  2KQ7 A;  1NEK B;  3QAR A;  3DBS A;  1FNU A;  4FBJ B;  4WUR A;  4MEM A;  3DBR I;  2PEA A;  1GC6 A;  3FIL A;  3MHS D;  4NAW A;  2Y5P A;  3DHI C;  4JWU C;  2J0K A;  2K8C A;  4EZK A;  2BGF A;  3JW0 X;  1UUP A;  2WXL A;  3CMM B;  2K6D B;  2QDF A;  3ZXV A;  4UDU C;  1FIQ A;  3RNA C;  4A9A A;  1C1Y B;  1A70 A;  1G6J A;  2L8J A;  2KWU B;  3TJP A;  1OFF A;  1KM7 A;  2WXQ A;  4YTN B;  3R7R A;  3OJ4 B;  1TT5 B;  3K9O B;  3DVG Y;  3TEZ A;  1PFD A;  3BYT B;  3ZTD A;  2JX5 A;  1RRB A;  4E3C A;  4HPL B;  3DCG A;  2BB5 A;  2FNJ B;  4LTU A;  5KHQ A;  2MLB A;  3OAW A;  1OTR B;  2UU7 A;  1WGG A;  3V6C B;  1L6V A;  4KGR A;  4II3 B;  4WIP A;  4WWM A;  1GAQ B;  2D07 B;  3M95 A;  2XK5 B;  1T0R C;  1I42 A;  1YQ3 B;  2LJI A;  4K7S A;  2EMS A;  2G45 B;  3S2A A;  2IBI B;  4GOC A;  2XN9 C;  4US8 A;  1E8Z A;  1P7E A;  2O6V A;  1EWY C;  3RD2 A;  1WZ3 A;  2V9H A;  2GMI C;  2RD0 A;  2L0F A;  1D5X C;  2V4I B;  5LLI A;  1MJD A;  5GMV A;  2BYF A;  2N9X A;  3GP7 A;  4MJS A;  2I2Y A;  2W54 A;  3N30 A;  2PKO A;  2YLM A;  4TMA B;  4RF0 A;  2JRI B;  2QIE B;  1PUT A;  3QX1 A;  4I6L B;  2ZNV C;  3NVY A;  2KDB A;  3I57 A;  3HUI A;  3ETR A;  1QIL A;  2L52 A;  4EUT A;  2K39 A;  3APF A;  4KIK B;  3RNC C;  4HPP A;  1CJE A;  2WDV B;  4IWQ A;  1I4R A;  3ZW3 A;  3LJ3 A;  5BMG A;  1CZP A;  2FIF A;  1E7U A;  2L00 B;  4NQK E;  1GNU A;  1E7P B;  2EMT A;  2KMM A;  2RR9 A;  4RH6 A;  3Q3O C;  4PYU A;  2DNF A;  4LNK A;  4R3D A;  2DZM A;  1L0V B;  2ZW1 A;  4YL8 A;  1JRP A;  2MCN B;  4DXF A;  4RCO A;  5AZG A;  3AMZ A;  2FCS A;  4WJN A;  2WXO A;  4E71 A;  1WM3 A;  1ZXH A;  3AUL A;  5EE0 A;  1V1O A;  2MJ3 A;  2WU2 B;  2KFK A;  1I4P A;  2LFI A;  4LLG M;  4ANU A;  2D3G A;  2ZPN A;  1UWM A;  3GE3 C;  4WWN A;  4US9 A;  1JWB D;  3BVZ A;  3ZYY X;  4AWJ A;  3NRZ A;  4G3X B;  2G9H D;  1TS4 A;  3PVL A;  4ZYN A;  2FE8 A;  4HRS A;  1XCQ L;  1OGW A;  2JWU A;  1RFK A;  1XLN A;  4B0M A;  1Q0W B;  2N0S B;  1FXA A;  3ZNG C;  2NCN A;  1VZ6 A;  4EZL A;  3ZNI D;  3TIX A;  4KDI C;  3VH3 B;  3VFK A;  2MX2 A;  3O65 B;  2HTH A;  2KN4 A;  4N6E B;  4BKG A;  2C7M B;  3WA0 A;  1HE8 A;  1E8X A;  4EKU A;  2N9L A;  4W9H A;  3A9J A;  3IBE A;  3KWL A;  2VZK D;  1AN8 A;  3SDL C;  1MI0 A;  1JML A;  2D3C A;  4GGQ A;  4WJQ A;  4RM9 A;  3L08 A;  2KMA A;  4ARI A;  3R66 C;  2NBU A;  1ET9 A;  3V6E B;  2BT6 A;  2ICI A;  3FAH A;  1P7F A;  1GUA B;  2BS4 B;  3V62 A;  2CJO A;  1TKG A;  1TY2 A;  3DBL I;  3UI3 A;  1C3T A;  4IM0 A;  3W5U B;  3CSF A;  1YQB A;  2NTS A;  1CQV A;  3MC0 B;  1XLP A;  3TMP B;  2ZEQ A;  1IBX B;  1PGA A;  1I35 A;  2K1F A;  4B6W A;  2KVZ A;  4URK A;  1IYF A;  5IP4 D;  3NG0 A;  1CMX B;  5MPO A;  1WMH B;  2K0P A;  2NMQ A;  2K6Q A;  2W3R A;  2MBQ A;  2NBW B;  4RM8 A;  1YX6 B;  4CHK A;  5DPW A;  2REX A;  1ET6 A;  3KYD D;  3P4R B;  3VAW A;  1XT9 B;  4KVG B;  2YEP B;  2YEP F;  2QCZ A;  3V61 A;  2E3T A;  3L17 A;  1C78 A;  1YIW A;  3GZN B;  5HFY A;  2FCN A;  2Z0E B;  4RGT A;  5DPS A;  1UD7 A;  3AE2 B;  4BKT A;  4GB9 A;  1R4M I;  4MDK E;  1ACC A;  3PRZ A;  2PLP A;  2ZVO A;  3A9K B;  3H7S A;  1WGY A;  4DHZ B;  3W1S A;  1D6E C;  1L0Y B;  5D2M B;  1E9M A;  2JU6 X;  5AUI A;  1SIJ A;  2L3Z A;  2V4L A;  4OHJ A;  1YX5 B;  4WWO A;  2XBB C;  4E74 A;  2J53 A;  4GSW A;  3N32 A;  4JGH B;  1KRH A;  3TEW A;  1YMH E;  5GXG B;  1Z5S B;  1QZE A;  2AQ2 B;  3JYU A;  2INN E;  4PS7 A;  3NS1 A;  1TZ1 A;  1WWT A;  3Q6B A;  1FXT B;  2GBR A;  3ZNH B;  3VUY A;  3P4S B;  4LNO A;  4S0R A;  3H7P A;  4NQL B;  4NPN A;  1K8R B;  4IW0 A;  4XGA B;  5FR3 A;  5JZE B;  1HZ5 A;  1E90 A;  3RNF C;  4GMV A;  1JRO A;  2R2O A;  1C79 A;  2ZJD A;  4HJG E;  4KX6 B;  4NJC A;  3RUI B;  2L32 A;  4HXD A;  1XXG A;  2NTT A;  1YQ4 B;  4HVB A;  3BK2 A;  2MHJ A;  5C3J B;  1M4V A;  3B9J A;  4N9F 4;  1V5T A;  3C19 A;  2VH2 A;  4YT0 B;  2LVO A;  2W55 A;  2AL6 A;  3AB5 A;  3R3M A;  4A90 A;  1P9D U;  2ON8 A;  4HPM B;  2LVQ A;  1N63 A;  1L6U A;  3Q3N C;  3N20 C;  1L5P A;  1WJ6 A;  1UNS A;  2JXT A;  4TQ0 A;  2MH7 A;  3ONS A;  4GDK B;  3U2S C;  5BO4 B;  4KSL C;  4ANX A;  2NS5 A;  3LXF A;  4ZRJ A;  1L4Z B;  2JY6 A;  3GB1 A;  4AQ7 A;  2PTL A;  3P42 A;  1WMH A;  2WXF A;  1C4C A;  3KH0 A;  3K9P B;  4HJK A;  2N4F A;  1UGM A;  4JE3 B;  3RNB C;  5C23 A;  3UIO B;  4KDL B;  1R4N B;  4OVV A;  1E0Z A;  4MJS B;  4F1S A;  1J19 A;  4G11 A;  3ZO5 B;  1UZX B;  4YSX B;  2D5G A;  2QC8 A;  3P4Q B;  1V97 A;  1I4G A;  3HM3 A;  4GDK A;  5E6O A;  4ASW C;  2BB6 A;  3WAO A;  1ZGU B;  3VDZ A;  4OW0 A;  2I1J A;  4HCP B;  2W9N A;  2BVC A;  3GS2 A;  1AYF A;  1Q1O A;  1DYQ A;  1F0Z A;  4FJV B;  3RZW C;  4IC7 B;  1F2R C;  2M56 B;  3D32 A;  2HD5 B;  2CHW A;  5LXH A;  3IT4 B;  2DBY A;  3VR8 B;  2JXX A;  3QAQ A;  4P1C C;  4RFB A;  3RI7 C;  3TSS A;  2WHI A;  2DLB A;  3ZRC A;  1WRI A;  2V3S A;  3OJ3 A;  1QKZ A;  3BII D;  3SFD B;  2KTR A;  3ALB A;  4BKS D;  4JL9 A;  1QF6 A;  1J7C A;  4WAF A;  4BBN C;  5EE1 A;  2BKR B;  2FCM A;  5EE3 A;  1QOB A;  2KC2 A;  4P7I A;  4MGY E;  2H88 B;  3NUH B;  3BZD B;  2RDG A;  3WIM A;  1J0G A;  4IUM B;  3ZVV A;  2KHW B;  3KLS X;  3N3K B;  4ICU A;  2ZW0 A;  3ABV B;  1WSP A;  2JF5 A;  2KYW A;  3TUO A;  1FXI A;  4QAY A;  3U4E G;  4RF1 A;  3O13 A;  1E6E B;  3AE1 B;  1WY8 A;  2KOX A;  2ZPY A;  2R2Q A;  3ZQ4 A;  2Z0D B;  1FEH A;  1FRD A;  4XDD A;  4W9D A;  2BYT A;  2XEW A;  2Y5C A;  5DCN A;  4IOI E;  1UF0 A;  2CHX A;  5C2T B;  1V8C A;  2IO1 B;  1PGB A;  4N59 A;  3L10 B;  1E7V A;  1STE A;  2JPH A;  4M01 A;  4W9G A;  4M02 A;  2J52 A;  2EKE C;  1SJH D;  4M8M A;  2CR5 A;  2ASQ A;  1XF5 L;  1J7B A;  1WZ0 A;  4FA6 A;  1DOY A;  1FRR A;  2IGD A;  2KT7 A;  1KLU D;  3PV1 A;  2KO3 A;  3TL5 A;  3DHG C;  1C76 A;  1WE7 A;  1R4N I;  1ZE3 D;  3KYC D;  3PS6 A;  2L83 A;  1JAL A;  1HEZ E;  1IGD A;  1V2Y A;  1YJ1 A;  1ZKH A;  1FO4 A;  4CO7 A;  3TEY A;  4XWW A;  1WXV A;  3P4P B;  1C4P A;  2K8B A;  5EDS A;  3I63 C;  5IKC M;  3M63 B;  1CK1 A;  5IOI A;  4BVU C;  2KTF A;  2WYQ A;  4JWS C;  3GZN I;  1V86 A;  1U4A A;  3IG3 A;  3KW5 B;  5BMH A;  1WF9 A;  3EA6 A;  3AE5 B;  1HXY D;  4W9J A;  2HTM E;  2A5U A;  2JQR B;  1KLG D;  2K8H A;  2BS2 B;  2MW5 A;  3Q8C A;  3QIJ A;  5D94 A;  2GI9 A;  3FKY A;  1EF5 A;  3AE4 B;  4DDI D;  3UQA A;  4GDL B;  3TCA A;  2J42 A;  2WXR A;  4HEA 1;  1WYG A;  4YWG G;  2IYD B;  3DHH C;  4MGK E;  1XLO A;  2HE7 A;  1SB3 C;  1QOG A;  5L95 C;  4LDT B;  1AW7 A;  3B2F A;  1OEY A;  3HK0 A;  2RSU A;  3PRP B;  2LGD A;  2FCQ A;  4JPS A;  3PSE B;  4GU2 A;  4M00 A;  4NY0 A;  2GBK A;  4IWO A;  4K3C A;  1JWS D;  5E6J A;  2PMV A;  1N62 A;  3C0R B;  3LYY A;  3U7Z A;  4TUU A;  3IAS 1;  2RDB C;  3U52 E;  3VRB B;  3H7P B;  4ZRP A;  3NVV A;  5BMI A;  3KVF B;  2DHZ A;  2LWP A;  3E9S A;  4DHJ B;  1VRA B;  2KNB A;  4FHJ A;  2WDQ B;  2J0M A;  4IG7 B;  4ZRI A;  4MSQ B;  1P3Q U;  1EF1 A;  3UIN B;  2C7H A;  3ZGZ A;  5G2N A;  3SU8 X;  2PIA A;  2I38 A;  2N1W A;  4YSY B;  1GB1 A;  2GB1 A;  3KUZ A;  2L05 A;  4K3B A;  2BWF A;  2SEB D;  2OJR A;  3B0A A;  3HM6 X;  2G4S A;  2LZ6 A;  4P6V F;  5LXI B;  4HLE A;  4M8N A;  2PW9 A;  2R61 A;  4KGT A;  4YTM B;  2QHO A;  1FNV A;  3WCQ A;  1WXS A;  4DHZ E;  2LI5 A;  2CS4 A;  1FFU A;  4MT5 A;  5D6J B;  4P16 A;  3X0W A;  3I3T B;  4OVU A;  2WXI A;  3U7D A;  4HK2 A;  1F1H A;  2D10 A;  2QSD A;  1VZ7 A;  4NJ7 A;  3N9Y C;  5JXV A;  5G5G A;  4LJO B;  1OEY J;  3ZXR A;  3ZJT A;  2B76 B;  4M0W A;  5BYS A;  3UQB A;  2KXJ A;  1F2R I;  3IT6 B;  1ZW7 A;  1WGK A;  4HWI B;  2KWC A;  1M94 A;  1D5Z C;  2KFJ A;  3PT2 B;  5FR6 A;  1D3Z A;  3Q3M C;  1N60 A;  2BS3 B;  4W9E A;  3L0W B;  1WR6 E;  2K25 A;  2N1V A;  1NEN B;  2NVU I;  2AWT A;  3MJW A;  3U30 A;  1WJU A;  1V80 A;  4XX5 A;  3W1S C;  3CIR B;  1ENF A;  2K5P A;  1FMA D;  1WH3 A;  1XQQ A;  2IO0 B;  4K1R B;  4DBG A;  2ZVN A;  1VDV A;  1NI3 A;  4JIO U;  2LAS A;  5EE9 A;  1ISN A;  1T6B X;  2WU5 B;  2IO2 B;  1ESF A;  4GDL A;  2JZZ A;  2XNA C;  1P0R A;  4LDT D;  4NAM A;  4K7U A;  3MP9 A;  2UWQ A;  1Y56 A;  1GG3 A;  3EEC A;  4HRO A;  2M0A A;  3VUW A;  2CU3 A;  1JWM D;  3RCZ A;  2D2Q A;  1S1Q B;  3AH7 A;  3M3J A;  1ZDV A;  1WGD A;  4HDQ A;  3L54 A;  2KZR A;  2QJL A;  3UF8 A;  1WXM A;  3AEE B;  3W5V B;  1KTK A;  1EWC A;  2MRP A;  1H4R A;  3QA8 A;  3IHP C;  1J8C A;  2KDE B;  3ZKJ C;  1LO5 D;  3CST A;  4M0W B;  3EFC A;  3HHM A; 
#chains in the Genus database with same CATH homology
 1OQY A;  2DAJ A;  2KQ7 A;  4JQW C;  3BY4 B;  4WJO A;  4MGI E;  2N4F A;  3NHE B;  1UGM A;  2BYE A;  2ZZP B;  1A5R A;  4WAA A;  4MM3 A;  4CYE A;  5C23 A;  3UIO B;  1WJ4 A;  4KDL B;  3QAR A;  1NBF C;  4OVV A;  3DBS A;  4RMA A;  4MJS B;  2NPT B;  4FBJ B;  1J19 A;  4MEM A;  4F1S A;  4G11 A;  3DBR I;  1UZX B;  3ZO5 B;  3QC8 B;  2PEA A;  5L83 A;  1GC6 A;  3DQV A;  3HM3 A;  3MHS D;  4GDK A;  1S3S G;  4NAW A;  5E6O A;  4ASW C;  3ZTC A;  1WGR A;  3ENE A;  2J0K A;  4KV2 A;  3WAO A;  4AP4 C;  1ZGU B;  2K8C A;  3VDZ A;  4EZK A;  2BGF A;  2I1J A;  3JW0 X;  2W9N A;  2IZV B;  4HCP B;  2O2V B;  2LRU A;  1Q1O A;  3CMM B;  2K6D B;  4TKN A;  1WFY A;  4FJV B;  1C1Y B;  3QWZ B;  1G6J A;  3RZW C;  3DVN V;  2L8J A;  3D32 A;  2KWU B;  4IC7 B;  1V6E A;  4TV3 A;  3TJP A;  2HD5 B;  3VH4 B;  2CHW A;  4EOY A;  5DPR A;  1KM7 A;  1SGH A;  3ZDT A;  1NI2 A;  3R7R A;  2J0J A;  1WX9 A;  3OJ4 B;  5LXH A;  2LXA A;  1GJZ A;  4G0N B;  1LXD A;  2KDI A;  3ECI A;  1V5O A;  3K9O B;  3PLU A;  3DVG Y;  4K81 A;  3ZTD A;  1YD8 U;  5HKH A;  1RRB A;  2JXX A;  4AOF A;  4E3C A;  4HPL B;  2FAZ A;  3DCG A;  3QAQ A;  5AEK B;  3DBH I;  2KVR A;  3ZRC A;  4X57 B;  3B08 A;  4KSK C;  4W9K A;  2V3S A;  2FNJ B;  3OJ3 A;  3APD A;  3T9L A;  1RLF A;  5KHQ A;  2KTR A;  3ALB A;  1KLV A;  4FHK A;  4BKS D;  4JL9 A;  2MLB A;  3OAW A;  3PZD A;  2KC1 A;  4MSM B;  1OTR B;  1WE6 A;  2MP2 B;  2RPQ A;  3Q3F A;  1WGG A;  2MBE A;  3V6C B;  1Q5W B;  2VRR B;  2O6V B;  3V60 A;  2LRW A;  4II3 B;  2JVC A;  4AJW A;  1MG8 A;  4DK5 A;  2D07 B;  3M95 A;  2XK5 B;  4BBN C;  1I42 A;  2YVC A;  2PE6 B;  2BKR B;  5J17 A;  2FCM A;  3WAL A;  4K7S A;  2KC2 A;  4P7I A;  2EMS A;  2G45 B;  3S2A A;  4MGY E;  4DWF A;  3ZLZ A;  2IBI B;  4GOC A;  2WWZ A;  1E8Z A;  2KDF B;  2O6V A;  4GN1 A;  3WIM A;  1Z2M A;  3U8Z A;  2J7Q B;  3RD2 A;  2GBM A;  1J0G A;  4IUM B;  1WZ3 A;  2BKF A;  3ZVV A;  2JT4 B;  2KTR B;  2GMI C;  2KHW B;  2RD0 A;  3N3K B;  3PHW B;  4F7Z A;  2BWE S;  4ICU A;  2L0F A;  2JF5 A;  3RUL A;  4IM2 A;  4JLC A;  5LLI A;  5GMV A;  1WYW B;  1LQB A;  5AZF A;  3RYT A;  2KQS A;  1WY8 A;  2KOX A;  2BYF A;  2N9X A;  2ZPY A;  4KZC A;  4MJS A;  2HJ8 A;  3N30 A;  3EHV A;  2R2Q A;  2YLM A;  2Z0D B;  4WWP A;  3DDC B;  1WR1 A;  2JRI B;  2ZCC A;  4W9D A;  2XEW A;  3QX1 A;  2MBH A;  4I6L B;  4W9F A;  2G3Q B;  2GBN A;  2ZNV C;  5DCN A;  3JVZ X;  2V1Y A;  2KDB A;  3MTN B;  5J2R A;  2CHX A;  3QJZ A;  2IO1 B;  2O6V D;  3L10 B;  1E7V A;  4EUT A;  2K39 A;  3APF A;  2LXC A;  4KIK B;  2JPH A;  4ANV A;  4BOS C;  3NOB A;  1E5W A;  3KUD B;  4W9G A;  4IWQ A;  4NAW B;  4FAD A;  4NNJ B;  3LJ3 A;  1F9J A;  5CX3 A;  3ZW3 A;  4HDO A;  4W9I A;  2EKE C;  2LGY A;  1RAX A;  3VQI A;  4M8M A;  4DXA B;  2CR5 A;  2FIF A;  2ASQ A;  1E7U A;  2LUE A;  2L00 B;  3KUC B;  4NQK E;  3M62 B;  1WZ0 A;  1GNU A;  2EMT A;  4FA6 A;  2RR9 A;  4PYU A;  5DPT A;  2DZM A;  3PV1 A;  2KO3 A;  2N9P C;  3TL5 A;  1PQS A;  2AL3 A;  4YL8 A;  2G4D B;  2M17 A;  2MCN B;  5AZG A;  1WE7 A;  1R4N I;  3KYC D;  2MBO A;  1IPG A;  4ANW A;  3PS6 A;  2FCS A;  4WJN A;  4E71 A;  1V2Y A;  1WM3 A;  1V9J A;  2FID A;  1YJ1 A;  1ZKH A;  4BFR A;  5JHA A;  3AUL A;  4CO7 A;  3VTV A;  1WXV A;  2KFK A;  5CHF A;  2K8B A;  4ANU A;  1SIF A;  5EDS A;  2D3G A;  2ZPN A;  3JSV A;  3M63 B;  4MGZ E;  4WWN A;  5G55 A;  1IP9 A;  4AWJ A;  4G3X B;  1WM2 A;  4BVU C;  2KTF A;  2WYQ A;  4G50 A;  2BYV E;  2M0X A;  3PVL A;  4IWP A;  4W9C A;  3GZN I;  4ZYN A;  1V86 A;  1U4A A;  3IG3 A;  3KW5 B;  4ZRK A;  2WX0 A;  1WF9 A;  4I6P A;  2DEN B;  3T8M A;  4GIV A;  4W9J A;  3WAM A;  2A5U A;  3PRM B;  4EZJ A;  3IVF A;  4ZDV A;  2K8H A;  5D94 A;  2MW5 A;  1OGW A;  3QIJ A;  1E8Y A;  1UBQ A;  3L13 A;  2GBJ A;  1EF5 A;  1Q0W B;  5CHV C;  3ZNG C;  2NCN A;  4EZL A;  3ZNI D;  4DDI D;  3UQA A;  4GDL B;  2NBV B;  3TIX A;  2LD9 A;  3TCA A;  1SE9 A;  3GOE A;  3NY5 A;  4KDI C;  3VH3 B;  2MQJ A;  3PHX B;  1KOT A;  3HIZ A;  1JRU A;  3A4R A;  3VFK A;  2A4Z A;  2MX2 A;  4EFO A;  3O65 B;  3AU5 A;  4A3P A;  2LVP A;  2HTH A;  2IYD B;  3OLM D;  4MGK E;  3EC8 A;  4BKG A;  2C7M B;  2HE7 A;  3DVN U;  5L95 C;  2CHZ A;  2KAN A;  4LDT B;  5E6P A;  1V49 A;  5D7G A;  1OEY A;  3HK0 A;  3H6N A;  2RSU A;  3PRP B;  3WA0 A;  1HE8 A;  2LGD A;  1E8X A;  3A1Q B;  2FCQ A;  4EKU A;  2B3A A;  1UH6 A;  1V81 A;  4W9H A;  3PSE B;  2AYO B;  3A9J A;  3IBE A;  4FN2 A;  4GU2 A;  4NY0 A;  2DZI A;  2GBK A;  4IWO A;  1NDD A;  1WX8 A;  3SDL C;  2KJR A;  4GGQ A;  4LCD E;  4WJQ A;  3C0R B;  1UBI A;  4RM9 A;  3L08 A;  2KMA A;  4TUU A;  3R66 C;  2NBU A;  3QQ8 B;  3R7Q A;  3H7P B;  2MBB B;  3H9D A;  5KHO A;  3V6E B;  2PPH A;  3A4S C;  3KVF B;  2DHZ A;  2XK5 A;  2LWP A;  3PTF C;  1GC7 A;  2KX0 A;  4AUQ C;  4DHJ B;  2KNB A;  4FHJ A;  2J0M A;  1GUA B;  4IG7 B;  3SD5 A;  3V62 A;  4B95 A;  3H1U A;  2Z59 B;  4ZRI A;  4MSQ B;  4GXB A;  3RT3 B;  2O2V A;  1P3Q U;  1EF1 A;  3UIN B;  2C7H A;  3DBL I;  3UIP B;  1C3T A;  3EFU A;  2DYM A;  4IM0 A;  3A9K A;  3PPA A;  5G2N A;  2M8S A;  5E6N A;  1UEL A;  3CSF A;  3SU8 X;  1WRD B;  1YQB A;  5JHB A;  3APC A;  2N7E A;  2N1W A;  2KFK B;  3ZNZ B;  2LGX A;  3TMP B;  2CU1 A;  2ZEQ A;  3DPD A;  4FUL A;  2ZCB A;  2NPT A;  3KUZ A;  1I35 A;  2L05 A;  2JZ3 B;  2MWS B;  2BWF A;  2K1F A;  4B6W A;  1P1A A;  2DX5 B;  2OJR A;  4IM3 A;  2I1K A;  2GOW A;  4BOZ B;  4URK A;  3B0A A;  3HM6 X;  2N7D A;  2G4S A;  2LZ6 A;  2PE9 A;  3NZS A;  5LXI B;  1IYF A;  3ML8 A;  2UYZ B;  1P98 A;  2L0T A;  3DVG X;  4M8N A;  4HLE A;  1TGZ B;  2L76 A;  2KWV B;  1Y8R C;  5TR5 A;  2QHO A;  1CMX B;  3QHT A;  2M4N A;  1WXS A;  2NR2 A;  3JSV B;  4BKS A;  1WMH B;  4DHZ E;  2WDT B;  2LI5 A;  2CS4 A;  2K6Q A;  4FJZ A;  2MBQ A;  2NBW B;  4RM8 A;  3ZUN A;  1YX6 B;  5D6J B;  4CHK A;  2L7R A;  3X0W A;  3I3T B;  4OVU A;  3VVW B;  1VD2 A;  5DPW A;  2REX A;  4DHJ D;  2IO3 B;  3QCA A;  3Q3J A;  3U7D A;  3KYD D;  4HK2 A;  2IY0 B;  2C5L C;  3VAW A;  2D10 A;  1XT9 B;  4KVG B;  2OOB B;  3VTW A;  1VCB A;  4NJ7 A;  2MA9 B;  4DDG D;  3RZF A;  4B9K A;  4LJO B;  3V61 A;  3A33 B;  4LJP B;  3VTU A;  3WAP A;  1OEY J;  4FLH A;  2AEH A;  5C1Z A;  3L17 A;  2DZK A;  1YIW A;  2M1M A;  2FCN A;  2N9E B;  2Z0E B;  2DAF A;  5DPS A;  1UD7 A;  3AI5 A;  4BKT A;  3UQB A;  4GB9 A;  2KXJ A;  3L16 A;  2KMC A;  1BT0 A;  2DYO A;  1R4M I;  1ZW7 A;  4HWI B;  2KWC A;  4MDK E;  3PRZ A;  3CF6 E;  1M94 A;  4A3O A;  3A9K B;  2ZVO A;  3H7S A;  1WGY A;  4DHZ B;  3W1S A;  1TTN A;  3VHT C;  4W9L A;  2ZNV B;  5D2M B;  2KFJ A;  3PT2 B;  2LJ5 A;  5FR6 A;  2JWZ A;  1D3Z A;  3A1Q A;  4PYZ A;  3UGB B;  2L3Z A;  2V4L A;  1YX5 B;  5JH5 C;  4W9E A;  4WWO A;  2C7N B;  2KLC A;  1E8W A;  1WX7 A;  4ICV A;  2XBB C;  4E74 A;  2KK8 A;  3P2B A;  4GSW A;  3L0W B;  3N32 A;  4JGH B;  3PRE A;  1WR6 E;  2K25 A;  2MSE D;  3NZU A;  1LFD A;  2KJH B;  2KJ6 A;  2KN5 A;  2N1V A;  4XZ4 A;  2NVU I;  4KIK A;  3VXW A;  2AWT A;  3MJW A;  1Z5S B;  1AAR A;  1QZE A;  3U30 A;  1WI0 A;  4J6I A;  1WJU A;  2MP2 A;  1V80 A;  3JYU A;  4MEL A;  3LDZ E;  4XX5 A;  3DOW A;  3A9J B;  3W1S C;  4PS7 A;  4F8C B;  1TZ1 A;  2BPS A;  4EEW A;  1FXT B;  2GBR A;  3ZNH B;  1WH3 A;  2KD0 A;  3VUY A;  1XQQ A;  2IO0 B;  4K1R B;  4DBG A;  1L7Y A;  2ZVN A;  3H7P A;  1RFA A;  2C60 A;  1WJN A;  4JIO U;  4NQL B;  2LAS A;  4II2 B;  1K8R B;  4IW0 A;  4NPN A;  1XD3 B;  5JZE B;  1ISN A;  1E90 A;  4I6N B;  2D11 A;  3W1Y A;  3ML9 A;  4HCN B;  4GMV A;  1KJT A;  3AXC A;  2R2O A;  4NJ6 A;  1EUV B;  2IO2 B;  4GDL A;  2ZJD A;  4KZ0 A;  2JZZ A;  3ZIM A;  4A20 A;  4AJY B;  4MH0 E;  3RUI B;  3B1L X;  1P0R A;  4LDT D;  3VUX A;  5CHW A;  4HXD A;  5CTR C;  3SHQ A;  2IY1 B;  4K7U A;  2UWQ A;  4K7W A;  1EO6 A;  1TBE A;  4WQO B;  1GG3 A;  4HVB A;  2KKC A;  4PS3 A;  3EEC A;  3QK0 A;  1WIA A;  4N9F 4;  3WAN A;  1V5T A;  4TQ1 A;  2FUH B;  3VUW A;  2DYB A;  3NS8 A;  3PLV A;  2CKH B;  4PS8 A;  4BBN F;  2LVO A;  5IAA C;  3RCZ A;  2JUO A;  2AL6 A;  2D2Q A;  1S1Q B;  3R3M A;  2KLG A;  1P9D U;  3IFW B;  4FJY A;  1WXA A;  1T0Y A;  5IA7 A;  3M3J A;  4HPM B;  1WGD A;  2LVQ A;  4XC2 A;  4HDQ A;  3L54 A;  2PJH A;  2KX3 A;  2KZR A;  1WJ6 A;  2C9W B;  3UF8 A;  3AU4 A;  3ZRF A;  1WXM A;  5J18 A;  2BF8 B;  5AZH A;  4TQ0 A;  1LM8 B;  3ONS A;  4GDK B;  5BO4 B;  4KSL C;  4ANX A;  2MRP A;  2NS5 A;  1H4R A;  3PGE A;  4ZRJ A;  3ZDM C;  2WX1 A;  1X1M A;  2JY6 A;  3QA8 A;  3IHP C;  1WGH A;  2JRH A;  4WJP A;  3TBL D;  1L2N A;  3BIN A;  1J8C A;  2KDE B;  3X23 A;  3CST A;  1WMH A;  3ZKJ C;  4M0W B;  2DZJ A;  1H8C A;  2RGF A;  3KH0 A;  3HHM A;  3K9P B;  4HJK A;  2Y5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...