1PDXA

Putidaredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PROTEIN (PUTIDAREDOXIN)
publication title A refined model for the solution structure of oxidized putidaredoxin.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pdxA00
1WRIA 1FFUA 1L6VA 2CJNA 3AE6B 3ETRA 2CJOA 1SF0A 1V97A 2MJEA 3LXFA 2DBYA 3P4RB 1OQRA 2PIAA 3W9CB 1N62A 4YXDB 2AX5A 1FXAA 2KAJA 1RM6C 1JQ4A 2WLBA 2CU3A 1NYRA 1FM0D 1DOIA 1E7PB 3BIID 1J7BA 1E6EB 1ZOYB 2FBWB 5MPOA 1GPXA 1FIQA 5C3JB 3B2GA 5EE1A 3VR8B 1ROEA 2E3TA 2JX5A 1L0VB 2HTME 5G5HA 1I7HA 5H92C 3AE9B 2BS2B 3AMZA 1N5XA 3KWLA 1L5PA 4USAA 1FXIA 3VRBB 4N59A 1YQ4B 1JW9D 3EUB2 3HUIA 3SFDB 2W54A 4YSZB 2N0SB 1EWYC 2H89B 3B2FA 3HVZA 3FAHA 5GXGB 3AEGB 1JWAD 2WU5B 3AE5B 2JQRB 4US9A 1J7CA 1SIJA 1SB3C 1WWTA 3NS1A 3P4SB 1ZUD2 3P63A 5H8YE 1XO3A 2H88B 2M19A 1CZPA 4IDIA 2Y5CA 3DWGC 3W5VB 1KRHA 1RWSA 2WDQB 2KMMA 3AE4B 4C80A 3AH7A 1N61A 1TJEA 2WDRB 1N63A 3P4QB 4US8A 2EKIA 2DWQA 2Q5WD 1PDXA 4WWMA 4YT0B 1KFYB 3W5UB 1YJJA 3AE1B 1B9RA 3CWIA 4A9AA 1QOAA 4YSYB 3ZYYX 1E0ZA 1N5WA 1V8CA 3AM9A 1TKEA 3P1MA 4JWSC 2QIEB 2K5PA 3AEAB 4WQMA 2G1EA 1CJEA 1NENB 1WXQA 1AYFA 1T3QA 3ABVB 3AEEB 1TYGB 4JWUC 3LB8C 5EE3A 2B76B 2QJLA 2M56B 1DOXA 1TKGA 3NVWA 3AECB 5AUIA 2MH7A 4P6VF 1XLQA 1FO4A 2WS3B 2WU2B 4C7ZA 1QT9A 2LEKA 2WDVB 1KF6B 1FMAD 1WGKA 1XLPA 3AE2B 3FC4A 1QOBA 1FFVA 5EE9A 1NYQA 1N60A 1QOGA 4C7YA 2K9XA 1YQ3B 1FRRA 4YTPB 2ACZB 1JWBD 4N58A 4KX6B 3WCQA 4ZHPA 3B9JA 3NVVA 2PKOA 1TKYA 3AN1A 1YJIA 1XLNA 1AWDA 1RFKA 2WQYB 3CIRB 1NI3A 2BS4B 3SR6A 1XLOA 5EE0A 3AEFB 5C2TB 4ZOHC 2OHFA 1QLBB 4FXCA 3SFEB 1VLBA 1E9MA 3PO0A 3DWMA 4ZHOA 1NEKB 1VDVA 2W3RA 2MJDA 3NVYA 2PVOD 3AEBB 1F0ZA 2W3SA 3P4PB 3HRDD 1QF6A 2PVGC 4YTMB 1L6UA 2BT6A 1IUEA 1J7AA 4LTUA 1WYGA 3AE7B 3AEDB 5G5GA 3VR9B 1OFFA 4N6EB 1ZXIA 3VRAB 1VJKA 4YTNB 1JRPA 2L83A 4HROA 3AB5A 1JALA 4ITKA 1A70A 1RYJA 4JX1C 3RPFC 1E10A 1NVID 4YSXB 1UWMA 1JROA 2L52A 3AV8A 3NRZA 1ZP0B 5AUKA 1GAQB 3AE3B 3L4PA 2MJ3A 1OQQA 1R7SA 1FRDA 2K22A 3NVZA 4HRSA 1PUTA 1DGJA 2BS3B 2W55A 2WP9B 1QOFA 3AE8B 1DOYA 1PFDA
chains in the Genus database with same CATH superfamily
1FFUA 3TUOA 3W9CB 4PYZA 1JWUD 1QKZA 1FM0D 2REXA 1C1YB 4WURA 3PHWB 2CR5A 2JWZA 3C19A 4L1BA 1RFAA 3E56A 4HJGE 1EU4A 2E3TA 5G5HA 4DXAB 4EZLA 3A33B 1L5PA 5IP4D 2RR9A 4NJ6A 4OHJA 2CU1A 1KLVA 2KWDA 1TS2A 4ACFA 1TBEA 3ZKJC 3LYYA 2L1AA 1CZPA 3IAM1 3DWGC 4GIVA 1FD6A 4BKGA 4DQOC 3DBRB 3RNGC 2DNFA 4P1CC 2BB6A 5D7GA 4MJSA 1C4AA 1B9RA 3IHPC 1D5ZC 3O65B 3P1MA 5JH5C 4EZJA 1VR9A 5AZFA 3PREA 1WZ0A 2J0KA 4CQNA 1X1MA 3AE2B 2ZNVB 3X23A 5EE9A 3N3KB 2XNAC 5DPRA 4YTPB 2ACZB 4KVGB 4XZ4A 4OVUA 3ZO5B 2BS4B 5HI1A 1QLBB 1V86A 3U7ZA 4ZHOA 3BY4B 3O13A 3AEBB 2MP2B 1Q10A 4CYEA 2LD9A 3AE7B 4XWTA 1RYJA 4JX1C 1JROA 1ZP0B 5BYQA 2N1VA 1OQQA 3K9OB 2V4LA 2L3ZA 4G0NB 4QAYA 2KXJA 2DZIA 2LXAA 2I1JA 1NI2A 2O2VB 4GDKB 4IM0A 2WXMA 1HZ6A 1SEBD 3RN9C 2WX1A 3RZFA 2KAJA 1TT5B 2WLBA 1DOIA 2M0AA 2YVCA 2KTRB 5C3JB 3EA6A 1ROEA 1FNUA 2A5UA 1WJUA 4LDTD 3BK2A 2NBWB 5IKCM 4N59A 1JW9D 4D2KA 3HVZA 2LRWA 1IBXA 3H8HA 3NS1A 1MG4A 2MBHA 3BZDB 5AZGA 4IDIA 2Y5CA 4HKZE 1WI0A 2WDRB 3VTVA 4EEWA 3IXSA 1KFYB 3ZYYX 3VAWA 4S0RA 3V3XA 4NAWA 2KACA 2KKCA 2IBIB 1MG8A 1T3QA 2XK5A 1P1AA 4MH8A 2MH7A 3N1ZC 4DWFA 4RCOA 5HHDG 3A9KB 4RGOS 3VDZA 2KQSA 3ONSA 4IM2A 4BZAA 3JSVA 4K81A 2KVZA 3VTUA 1WGGA 1T5XD 2DZKA 4W9LA 4B95A 4ZHPA 3UI3A 2N7EA 2BKFA 2JYEA 2PKOA 3CIRB 4MEMA 4B6WA 3IBEA 4P1BC 1EF1A 1WIAA 3P4PB 4GDLA 4YTMB 2KHWB 5IO9A 2K8CA 3Q8FA 3AU4A 4F8CB 2J0MA 2L0TA 1E10A 3NZ3A 1ENFA 3UQBA 3QC8B 3P2BA 1HTOA 3RULA 4ASWC 2G1EA 1WRIA 4LJOB 2MJEA 3JW0X 4KZCA 3QQ8B 2KDEB 2LUEA 2UYZB 4G3XB 4F1SA 1NYRA 2HE7A 1GPXA 2NTSA 4NJCA 3TEZA 2LVQA 1WJNA 2AYOB 2VZKD 3KVFB 4NJ7A 4TUUA 4BBNC 5H92C 3UQAA 2XBBC 1T0RC 2LGIA 1A5RA 4K7UA 3ZDMC 3HUIA 1VZ8A 1C78A 1ZPSA 2W54A 1D6EC 2V4IB 3PGEA 3B2FA 3TMPB 4WJPA 5CHFA 3L13A 1AW7A 3IVFA 3P4SB 3P63A 1WSPA 4E71A 1P7EA 4L2YA 2W82A 1LO5D 5KHQA 3B0AA 2KDIA 1YNTE 3CWIA 4A9AA 4AJWA 1SE2A 1E8WA 3PV1A 5FR6A 1CJEA 1UUPA 3IT6B 3VH4B 5LXIB 2M56B 2INCC 5DPWA 4UDUC 4IM3A 2PEAA 4JL9A 1XLPA 1GG3A 2DX5B 2BYFA 2EELA 2K9XA 3K9PB 2L32A 2WQYB 5FKAC 4NQKE 4ZOHC 2AQ1B 1HXYD 1S3SG 1UGMA 1JRUA 3NVYA 2D3GA 2LZ6A 3TEXA 2SAKA 1V5OA 3DBSA 4ZRQA 1OFFA 3WANA 2BYEA 1VJKA 5HG2A 4MACA 1NVID 2ZPYA 4A55A 4JGHB 4GMVA 2AL6A 3KUDB 1BUIC 2NMQA 3A9JB 2IY0B 1TGZB 2QEJC 4K3BA 2D2QA 1CK1A 2JRIB 1UD7A 5D3DA 4YXDB 1SE4A 2AX5A 3NG0A 3QX1A 2M4NA 3UIOB 1T0YA 3ZIMA 2ZW0A 3EC8A 4MM3A 1YQBA 4IG7B 3IAS1 3B1LX 1L4ZB 4GLSC 2JX5A 4BVUC 3AE9B 3R2TA 3ZTDA 2LGXA 1EF5A 1FXIA 4IC7B 2NBUA 4RF0A 3SFDB 2N0SB 1EWYC 2LWPA 3BINA 3ZLZA 1D3ZA 4A3PA 3H7PA 1ZUD2 4I6NB 4ZRPA 2BQQA 2IZVB 2WXJA 3Q8CA 1LQBA 1KRHA 1IGCA 1MJDA 1ISNA 3VUXA 4US8A 2GBMA 2Q5WD 2RGFA 4HKQA 2R61A 3WAMA 1IYFA 3AE1B 3X0WA 4NAMA 1WXQA 1AYFA 2MLBA 1P0RA 5J17A 1UBIA 1WE6A 1WGKA 2G4DB 2DAFA 3BVMA 1YQ3B 1F2RC 3FILA 3ZNID 2FAZA 4EFOA 5C2TB 4EUTA 3T3NA 1E9MA 2QSDA 1KJTA 4TV3A 4C4VB 2W3SA 2WXKA 3V6CB 1WX9A 3DBRI 1WM2A 2VH2A 4JQWC 2X8XX 2JU6X 4WWPA 2V3NA 2L52A 3KQ4A 2GBJA 3L4PA 4K7SA 5I4DA 2MRPA 2BWFA 3NVZA 1F77A 1WY8A 3BYTB 2KNBA 1SE3A 2NS5A 3DHIC 3RCZA 3ZUNA 4HDOA 2BYTA 1OQRA 2Y5PA 2DZJA 3DVNU 2Z59B 4DDID 4HPMB 1HTQA 2FCSA 4XC2A 2WXFA 1UNSA 2C7NB 1EUVB 1YQ4B 2KN5A 3APCA 4DXGA 4A3OA 3AEGB 3KWVA 4WJQA 2V3PA 3BVZA 3U52E 4OZCA 4FHJA 4ARIA 3NUHB 1H8CA 1PQSA 2RD0A 5JZEB 4LJPB 1C4CA 1GC7A 4XGAB 1FNWA 3TL5A 2RDGA 5D94A 3MC9A 2K5PA 1VZ6A 2BF8B 2KC2A 3ML9A 4RM8A 3PVLA 4WH4A 2WX0A 4FHKA 2JVCA 1P7FA 1BMLC 4MT5A 2FCNA 2D07B 3PRZA 3VFKA 2ONQA 3V05A 1WGYA 1RFKA 3RNFC 2K1FA 4HPLB 2HDEA 1NDDA 2L05A 4E3CA 2MP2A 4LNNA 3DWMA 4IUMB 3V60A 2W3RA 2PE9A 5GMVA 3QA8A 3MC0B 4HDQA 2X38A 4GSWA 5KHOA 1P9DU 3VRAB 4W9EA 1A70A 1XEEA 2KTFA 4XWWA 2PTLA 1E5WA 3QJZA 4HRSA 2O2VA 2WP9B 1QOFA 4GDKA 1FMAD 4A8XC 1C77A 3OWEB 2KFKB 3A4RA 4LK0M 4GXBA 3TJPA 1JCKB 1BXTA 3MFGA 3J9CA 4RM9A 2KTRA 4KV2A 2M1MA 1K51A 3R8BA 3Q8BA 2J53A 3L08A 3SHQA 1F9JA 1L0VB 2CKHB 1XQQA 4ZYNA 1K50A 4WWOA 4ANWA 2IGHA 3MJ5A 1T0QC 4YSZB 3FAHA 1SIJA 1SB3C 2XEWA 2H88B 3N1XC 4OVVA 2WDQB 3CF6E 2J4XA 1V1PB 4KDLB 2MBQA 1V6EA 1WF9A 2LGYA 4I6PA 2MX2A 3VQIA 1FPYA 4P16A 4MGZE 5G2NA 3MP9A 4AOFA 2L0FA 3OJ3A 2K8BA 5TR5A 4XDDA 4RH6A 1KM7A 3A9KA 3Q3JA 2KDMA 2SEBD 4OZAA 1XCTL 1NYQA 3UGBB 4BKSA 2K25A 4KDIC 3TEYA 2J52A 4K7WA 4A20A 2EMTA 4DDGD 2JWUA 1NI3A 3AEFB 3KW5B 1CQVA 3ZDTA 2JZPA 1C3TA 1B1ZA 4AUQC 1L0YB 4HLEA 5CX3A 4OVZA 4N6EB 2OEDA 4IWQA 3RNAC 1Y56A 1JALA 3M95A 4KGTA 3IFWB 1DGJA 1WXSA 2JRHA 2B3AA 2FUG1 2N1WA 1RLFA 5DPTA 4FN2A 4XYCA 4LDTB 3BK1A 2M17A 3DBHB 2D3CA 2MBEA 1JQ4A 1E7PB 3M62B 4WIPA 1ZOYB 5MPOA 5EE1A 3R7QA 2HTME 3PRPB 2NR2A 3OJ4B 1WE7A 1E90A 2H89B 2J7QB 3Q69A 1MHXA 1JWAD 3RYTA 1PGBA 4AWJA 2V3SA 2RPVA 2YLMA 5AEKB 3PZ7A 2QMTA 2N9LA 2WGSA 3D32A 4OW0A 1YJ1A 4YSYB 3KLSX 3H6NA 3JYUA 4NPNA 3R7RA 2GOWA 1XCQL 2V9HA 3NVWA 2PMVA 4AJYB 2LHEA 5L95C 2LFIA 2LI5A 1WFYA 4AS1A 3P42A 2D3BA 2M0XA 3UIPB 1FEHA 4RFBA 2ZCBA 1YJIA 4F7ZA 1MHHE 2LUMA 3RT3B 4GU2A 2I1KA 3M63B 3EFCA 3HM6X 1RRBA 4HEA1 1HQRD 3AB5A 1STEA 3A9JA 3VUYA 3AV8A 4P7IA 1AN8A 3TEWA 3GB1A 3TBLD 3Q8EA 4MH0E 1DOYA 4FJZA 3ZQ4A 2WWZA 1V97A 3L17A 4JE3B 2WXGA 3P4RB 4KKJA 4DHJB 1I4PA 1V9JA 3SDLC 4KGSA 2WXOA 2CU3A 3BIID 4HPPA 2D10A 3U2SC 3R66C 1MFWA 1GUAB 2INPE 3Q6BA 1PGXA 1QILA 4M01A 4URKA 1V2YA 2L00B 3VTWA 4IWPA 1R4MB 2KANA 3IT4B 3DVNV 1ZE3D 1TY0A 1I35A 2FCQA 1XO3A 2GLSA 3WIMA 3VUWA 3OAWA 2KYWA 4ZDVA 3W5UB 4EZKA 4LNKA 3UINB 1MVKA 2LMCA 1NBFC 2HD5B 4WQMA 5CTRC 1EM7A 1RAXA 4PYUA 2OJWA 3GE8C 2KK8A 4JPSA 1P3QU 2KFJA 2WS3B 5G55A 1F1HA 2WU2B 4C7ZA 3U7DA 1FFVA 4W9HA 2ZCCA 4KX6B 1L4DB 1FNVA 1XLNA 3UF8A 5EE0A 4C4VA 1WXAA 4M0WB 4FJYA 2MWSB 4M00A 1QF6A 4LNIA 3TCAA 2LXCA 1J7AA 5BYSA 1ZXIA 1C4PA 3RPFC 1XT9B 4XE0A 1R7SA 1FRDA 2GBRA 1OEYA 3PTFC 3RUIB 2O6VB 2GBKA 1GB4A 2CJNA 4B0EA 2Y5BB 1N62A 1XF5L 2EMSA 1FXAA 1M94A 3H9DA 4HWIB 4IKGA 4MSMB 5FR3A 3I3TB 3RNEC 1E7UA 3Q14C 4M02A 4EOYA 1HA5A 1SXTA 4B0MA 2KMAA 2AL3A 1L0XB 1GNUA 4US9A 2DAJA 2ZNVC 4M8MA 1WRDB 1RWSA 1WX8A 3T9LA 1TJEA 1R4NB 2INDC 1VD2A 2TSSA 5E6OA 1HEZE 2W9NA 5DPSA 3DVGX 4PK1A 3R2IA 2GB1A 2QJLA 3QWZB 4HCNB 2JZZA 3AECB 3DOWA 4WQOB 4FADA 4MGKE 5JHBA 3RD2A 1C79A 1V49A 1I4RA 3ZGZA 4PS3A 1GB1A 3A1QB 1TKYA 1Z5SB 4RF1A 4RGTA 2DYOA 4HCPB 2JXTA 2OHFA 4L23A 4KKIA 2NVUI 3PT2B 4WJOA 4J6IA 3ZTCA 1J8CA 4B9KA 1M4VA 1WMHB 1C76A 4DBGA 2RSUA 1YX5B 2FCMA 4YL8A 3GS2A 1YN3A 3KUCB 2KFKA 2WXPA 1SIFA 2W55A 3AE8B 2WDTB 1YX6B 2KOXA 3I9V1 4K3CA 4G50A 3DDCB 3SD5A 2IYDB 2KN4A 3OG5A 2MCNB 1OTRB 2KVRA 1FIQA 3DCGA 1ZW7A 2DYMA 1FXTB 3V61A 1YMHE 1K53A 2IGDA 4CO7A 1N5XA 3QK0A 4MELA 3U8ZA 2K6DB 3EUB2 1UELA 2UWQA 2K39A 2LRUA 2WU5B 3S2AA 3AI5A 1KOTA 5D6JB 1I42A 1V1PA 1UBQA 3RNCC 1UZXB 1UGJA 3C8YA 1V8CA 4JWSC 2K3UA 2WYQA 3AXCA 2BPSA 3NHEB 1WR6E 4JWUC 1TS4A 1L7YA 4PT5A 1WGHA 3DBHI 4P6VF 2ON8A 2LEKA 4BOZB 4FBJB 1FRRA 1JWBD 2MA9B 4KSLC 4NZLB 2FE8A 1XD3B 3TSSA 2ZW1A 1XLOA 2KLGA 1CMXB 2ZZPB 3SFEB 2G4SA 1VLBA 2RMMA 3I63C 2BYVE 1TTNA 1LFDA 1Q0WB 3EHVA 4WAFA 2AWTA 3HRDD 2N7DA 2LVOA 2KO3A 2JPHA 4PS8A 2RDHA 1JRPA 4ICVA 2L7RA 4HROA 2RDBC 2BVCA 4WJNA 1D4BA 3PS6A 2OOBB 4MGYE 1KH0A 4RGMA 3QIJA 1WZ3A 4MDKE 2CJOA 4C56C 1ESFA 2PIAA 1WGRA 4HVBA 2DZMA 2QHOA 2C60A 1RM6C 2RPQA 4II3B 2ASQA 2HJ1A 5HFYA 2NTTA 4TMAB 4LNOA 4W9KA 3DHHC 3VRBB 2MBOA 2KMCA 2MBBB 5GXGB 5JXVA 3PSEB 2VRRB 2ZPNA 2MW5A 2V1YA 5BMHA 2I38A 1FCCC 1N61A 2D3AA 2K0PA 1SJED 4AQ7A 2WNMA 3R3MA 2ZJDA 4MGIE 2ZVOA 3CMMB 3WAPA 3AM9A 1T0SC 1UWXA 2IO1B 1D5XC 3SEBA 1TYGB 1EO6A 1OGWA 5HKHA 2MEKA 2WDVB 3HHMA 4JIOU 4M8NA 3ZNHB 3PPAA 1K8RB 2IY1B 4KIKB 3WCQA 2WXHA 5D3IB 1R4MI 1WX7A 2J0JA 3ZJTA 1NEKB 2N9PC 2KJRA 1TS5A 3AU5A 2MQJA 4OZBA 4AP4C 2BBCA 3MC8A 1KTKA 1L6UA 2BT6A 3EGRA 4LTUA 1MI0A 2BWES 2BGFA 5BYRA 3ML8A 1UF0A 3NZUA 2K6QA 3CSFA 4REZA 1LXDA 3AE3B 2KC1A 2K22A 2BS3B 1TIFA 1PFDA 2MSED 2LVPA 2KX0A 2KJ6A 3W1SA 2DENB 3LXFA 2K8HA 3NOBA 2KWVB 3Q3OC 3DHGC 1LGRA 2FNJB 3HIZA 4E74A 3BWUD 3V6EB 4ZRKA 2G9HD 3VR8B 2ICIA 1I7HA 2GI9A 3WALA 2FIDA 2KD0A 1E7VA 3T8MA 2QILA 4FJVB 2NPTB 4RMAA 4EKUA 4XX5A 4ZYSA 3Q3MC 3W5VB 2PLPA 3RNBC 3AE4B 4MSQB 1AARA 2IPKD 3Q8AA 4X57B 1EU3A 1YIWA 2UU7A 1TKEA 3PZDA 1LM8B 1TY2A 1WJ4A 2L8JA 3GZNB 5BMGA 1FO4A 4BOSC 4LNFA 3RZWC 3DBLB 4IOIE 1KF6B 2QC8A 2R2QA 1IP9A 4GOCA 2N9EB 2IGGA 4M0WA 4KZ0A 4ICUA 2LHDA 3PO0A 3DQVA 4RNAA 2MJDA 1PGAA 1F0ZA 3KH0A 1S1QB 2CHWA 3T3OA 5J2RA 4G11A 1I4XA 1R4NI 2AQ2B 1WYGA 2IJ0A 2V0GA 2WXLA 2BTEA 1WM3A 4YTNB 2JXXA 2L83A 2ZVNA 3ECIA 3KYCD 2BKRB 1UWMA 4TQ1A 1YN4A 3ZW3A 2O6VA 5C1ZA 4R3DA 2BW2A 3HVDA 5IOIA 1KLUD 2DBYA 3APFA 4BBNF 5TSSA 2R2OA 5E6JA 1SJHD 2IO0B 2FUHB 1J7BA 3WA0A 3RFZB 2C5LC 2Y3AA 2NBVB 2Z0DB 5JHAA 3AMZA 2WHIA 3HK0A 5AZHA 1V5TA 1OEYJ 1UH6A 3AE5B 3RMKC 1J7CA 2VZKB 5C23A 4ZRJA 5H8YE 3PRMB 2M19A 1E8ZA 2C7HA 2KMMA 4C80A 1P98A 4HXDA 3EFUA 4J3OD 4TQ0A 4WWMA 1VZ7A 4II2B 2QDFA 1TZOA 2D5GA 1SSNA 3CSTA 3L54A 5LLIA 2KQ4X 2QIEB 4MJSB 3QCAA 3ZXVA 2JY6A 1WJ6A 3ABVB 1NENB 4W9FA 5EE3A 2INNE 1VCBA 2IO2B 2D11A 1TKGA 5FK9C 1WGDA 5AUIA 2XN9C 1XLQA 2KJHB 4BFRA 2KDFB 3MJWA 4DHZB 2KZRA 2HJ8A 3QHTA 4C7YA 2C7MB 3A1QA 3L10B 3Q3NC 3QAQA 3N30A 4N58A 1I4GA 3B9JA 3PZ8A 1YD8U 2QCZA 1AWDA 1F52A 2JYTA 2PJHA 3APDA 3GOEA 1T6BX 1VDVA 2EKEC 1V1OA 4DXFA 1BT0A 1MPEA 2LGSA 1U4AA 4A90A 4BKSD 1WMHA 3FKYA 2DHZA 1K52A 3AEDB 5LXHA 1I4HA 1Q5WB 2LGDA 1GOZA 2KWUB 2L76A 3L16A 3NRZA 4DHJD 3ENEA 4FULA 3N32A 4EE2A 3NS8A 4LLGM 1WH3A 2KWCA 3C0RB 1SF0A 3ZJUA 5IA7A 1WR1A 3MTNB 2GBNA 5L83A 3PLUA 1E6EB 2WXRA 3B2GA 1V81A 3M3JA 2M8SA 3VXWA 2BS2B 3MHZA 4C00A 2IO3B 3I57A 4USAA 3U4EG 2NCNA 1E8XA 4IWOA 1IGDA 2JQRB 5DCNA 3V62A 1VRAB 4HK2A 3N1YC 3OLMD 4FLHA 3ZJVA 1IBXB 2KT7A 2N9KA 2LASA 1ET9A 4NNJB 3AH7A 1N63A 4YT0B 2JF5A 1E0ZA 2DLBA 1ZXHA 1HZ5A 2AEHA 4W9GA 3JVZX 4JLCA 3LB8C 1H4RA 4NAWB 3H7SA 2DYBA 4TSSA 2BB5A 3I5JC 4N9F4 2XK5B 3E9SA 3HM3A 1PYWD 2N4FA 1YN5A 4GB9A 1ZGUB 2IDYA 5J18A 4KGRA 3B08A 3NVVA 4W9CA 1JWMD 3JSVB 1WXVA 2PW9A 5BO4B 2WXNA 1N6ZA 1V80A 3MHSD 2CHZA 4O1NA 3Q3FA 1IUEA 3GE3C 4PS7A 5G5GA 4I6LB 2O6VD 1YOVB 4GDLB 3VVWB 4BKTA 4YSXB 5AUKA 4ANXA 1I4QA 4A6QA 3Q2AC 1PUTA 2KQ7A 1L6VA 2Z8LA 3ZXRA 2N7JA 4ZRIA 3W1YA 2G3QB 3LJ3A 4K1RB 5CHWA 3BVGA 1ZDVA 3GP7A 4FA6A 3VH3B 5T8IA 1J19A 2HTHA 5IN7A 3NZSA 3DVGY 4ANVA 2YEPB 1HE8A 1GC6A 4YWGG 2JSVX 2PPHA 1ET6A 1ACCA 2WXIA 4GN1A 3ZNZB 3P4QB 2EKIA 4ARCA 1XXGA 1QQRA 2J42A 3BYYB 1YJJA 1QOAA 1N5WA 2KLCA 2JUOA 3ZRCA 2WXQA 3AEAB 3U30A 3AEEB 1SE9A 1DOXA 3ZNGC 2PE6B 1QT9A 3FC4A 4KIKA 1QOBA 3SU8X 4IW0A 1QOGA 2AQ3B 4NY0A 3PLVA 4S17A 2OJRA 1E8YA 2ZEQA 3URYA 4TKNA 1Z2MA 3EECA 4GGQA 5LNK1 3W1SC 4H2AA 2PVOD 2LJIA 2PVGC 2CHXA 3PHXB 4RGNA 3VR9B 3L0WB 1JMLA 1EWCA 1GAQB 3ZRFA 4DK5A 3ZVVA 1GJZA 1ZDXA 3GZNI 3ETRA 3AE6B 3H1UA 3KUZA 3DBLI 2KX3A 1IPGA 1DYQA 1JWSD 3QARA 3N20C 4W9IA 1L2NA 2JZ3B 5EDSA 2FBWB 3NY5A 3W2DA 3A4SC 4MM3B 1C9FA 3LDZE 3KWLA 4Q2JA 2NPTA 3N9YC 1KLGD 4WAAA 3KYDD 3DPDA 1WWTA 4LCDE 5D2MB 4BAXA 2I2YA 1FCLA 1QZEA 3AULA 3H7PB 1G6JA 2FIFA 4NQLB 1OQYA 3VHTC 2MHJA 2DWQA 5E6PA 1TS3A 1SBBB 1F2RI 1PDXA 2CS4A 4KSKC 2KDBA 4WWNA 3IG3A 1J0GA 3ALBA 3RI7C 3WAOA 2G45B 1ZKHA 2B76B 1D5MC 2GMIC 2N9XA 4W9JA 4XDCA 4ANUA 2LJ5A 2VH1A 1TZ1A 1N60A 5IAAC 5CHVC 3AN1A 2Z0EB 3SR6A 3FILB 1SGHA 4FXCA 1WYWB 2C9WB 3TIXA 1WXMA 4HJKA 2YEPF 2E6XA 5E6NA 4DHZE 1Y8RC 2A4ZA 5BMIA 4W9DA 4CHKA 2GRIA 4ITKA 2MJ3A 3NJTA 1Q1OA 2JT4B
chains in the Genus database with same CATH topology
1FFUA 2CJNA 3TUOA 1KLUD 4B0EA 2BYTA 2DBYA 1OQRA 3W9CB 1N62A 2Y5PA 1XF5L 1FXAA 5TSSA 1JWUD 5E6JA 1QKZA 1SJHD 1FM0D 1J7BA 4WURA 4IKGA 4L1BA 5FR3A 3RFZB 3E56A 4HJGE 1EU4A 2Y3AA 2E3TA 5G5HA 2WXFA 1UNSA 1HA5A 1SXTA 3AMZA 1L5PA 1YQ4B 4OHJA 4DXGA 2KWDA 4B0MA 1TS2A 3AEGB 3KWVA 1L0XB 2V3PA 3AE5B 3BVZA 4US9A 1J7CA 2VZKB 5H8YE 3U52E 3LYYA 4OZCA 4ARIA 2L1AA 2M19A 3NUHB 1CZPA 3IAM1 3DWGC 1RWSA 2KMMA 4C80A 1FD6A 4DQOC 4J3OD 1TJEA 2BB6A 2TSSA 5D7GA 4TQ0A 1C4CA 1FNWA 4WWMA 1VZ7A 1C4AA 2RDGA 1B9RA 1TZOA 2D5GA 1HEZE 1SSNA 1D5ZC 2KQ4X 3P1MA 2QIEB 2K5PA 1VZ6A 3ABVB 1NENB 5EE3A 2INNE 1VR9A 3R2IA 2GB1A 4WH4A 2QJLA 1TKGA 5FK9C 3AECB 5AUIA 2XN9C 1XLQA 4CQNA 1P7FA 1BMLC 3AE2B 5EE9A 1C79A 4MT5A 4C7YA 2XNAC 1I4RA 4YTPB 2ACZB 3ZGZA 4N58A 1I4GA 3B9JA 1GB1A 2ONQA 1TKYA 3PZ8A 4RF1A 3V05A 1AWDA 1RFKA 4RGTA 2DYOA 2BS4B 2HDEA 2JYTA 5HI1A 2JXTA 2OHFA 1QLBB 4L23A 3U7ZA 4ZHOA 4KKIA 3DWMA 1T6BX 1VDVA 2W3RA 1V1OA 4DXFA 1MPEA 3O13A 3AEBB 1Q10A 4A90A 3MC0B 3AE7B 1K52A 2X38A 3AEDB 1M4VA 1I4HA 4XWTA 3VRAB 1C76A 1A70A 1GOZA 1RYJA 1XEEA 4JX1C 4XWWA 1JROA 3NRZA 2PTLA 1ZP0B 5BYQA 3GS2A 1OQQA 1YN3A 2WXPA 4HRSA 2W55A 3AE8B 2WP9B 1QOFA 4EE2A 1FMAD 4LLGM 4A8XC 1C77A 3OWEB 4LK0M 1SF0A 4GDKB 3ZJUA 2WXMA 1HZ6A 1SEBD 1JCKB 1BXTA 3I9V1 3J9CA 2KAJA 3MFGA 2KN4A 3R8BA 1K51A 2WLBA 3Q8BA 1DOIA 1E6EB 2J53A 2M0AA 1FIQA 5C3JB 2WXRA 3B2GA 3EA6A 1ROEA 1FNUA 2DYMA 1L0VB 1K50A 2BS2B 3BK2A 1YMHE 3MHZA 1K53A 2IGDA 1N5XA 3I57A 4USAA 2IGHA 4N59A 1JW9D 3EUB2 3MJ5A 4YSZB 3U4EG 4D2KA 3HVZA 3FAHA 2WU5B 1IBXA 1IGDA 2JQRB 3H8HA 1SIJA 1VRAB 1SB3C 3NS1A 3ZJVA 2H88B 3BZDB 1V1PA 1IBXB 4IDIA 2Y5CA 2N9KA 2WDQB 1ET9A 4HKZE 3AH7A 2J4XA 1V1PB 2WDRB 1N63A 3IXSA 3VQIA 4YT0B 1UGJA 3C8YA 4P16A 1KFYB 3MP9A 1E0ZA 2DLBA 3ZYYX 1ZXHA 1V8CA 4JWSC 1HZ5A 2K3UA 3V3XA 2KACA 4JWUC 1T3QA 1TS4A 4PT5A 3LB8C 4RH6A 4XDDA 4MH8A 4NAWB 4TSSA 2KDMA 2SEBD 2BB5A 2MH7A 4P6VF 4RCOA 5HHDG 2ON8A 4OZAA 2LEKA 1XCTL 3E9SA 4RGOS 1PYWD 1YN5A 1NYQA 1FRRA 2IDYA 3TEYA 2J52A 1JWBD 1T5XD 4KGRA 4NZLB 4ZHPA 3NVVA 3UI3A 2PKOA 2FE8A 2JYEA 1JWMD 2JWUA 3TSSA 3CIRB 1NI3A 2ZW1A 2PW9A 1XLOA 2WXNA 3AEFB 3SFEB 1CQVA 1VLBA 2RMMA 2JZPA 4WAFA 3P4PB 3HRDD 1B1ZA 4O1NA 4YTMB 1L0YB 1IUEA 3Q8FA 4OVZA 5G5GA 4GDLB 4N6EB 2OEDA 2RDHA 1JRPA 4HROA 1Y56A 1JALA 1E10A 3NZ3A 4YSXB 4KGTA 5AUKA 1ENFA 1I4QA 1D4BA 4A6QA 1PUTA 1DGJA 1KH0A 2G1EA 4RGMA 1WRIA 1L6VA 2Z8LA 2CJOA 2FUG1 2N7JA 2MJEA 4C56C 1ESFA 2PIAA 3BK1A 1RM6C 1JQ4A 1NYRA 3BVGA 1E7PB 4WIPA 1ZDVA 1ZOYB 3GP7A 5MPOA 1GPXA 2NTSA 4NJCA 5EE1A 5T8IA 5HFYA 3TEZA 2VZKD 2HTME 2NTTA 4TMAB 5H92C 2LGIA 3VRBB 3HUIA 1VZ8A 1C78A 1ZPSA 2W54A 2YEPB 1D6EC 2V4IB 2H89B 3B2FA 4YWGG 3Q69A 5GXGB 1MHXA 1JWAD 1PGBA 1AW7A 5JXVA 2JSVX 3P4SB 3P63A 1WSPA 1ET6A 1ACCA 2WXIA 1P7EA 2RPVA 4L2YA 5BMHA 3PZ7A 2I38A 2QMTA 1FCCC 1N61A 2W82A 1LO5D 2N9LA 2K0PA 3P4QB 1SJED 2EKIA 4AQ7A 4ARCA 1XXGA 2WNMA 1QQRA 2J42A 3BYYB 4OW0A 1YNTE 1YJJA 3CWIA 4A9AA 1QOAA 4YSYB 1SE2A 1N5WA 3KLSX 3AM9A 2WXQA 3AEAB 1UWXA 1CJEA 1D5XC 3SEBA 3AEEB 1UUPA 3IT6B 1TYGB 1XCQL 2M56B 1DOXA 3NVWA 2PMVA 2MEKA 4UDUC 2LHEA 1QT9A 2WDVB 3FC4A 1XLPA 2LFIA 1QOBA 2EELA 1QOGA 2AQ3B 2K9XA 4AS1A 3P42A 1FEHA 3WCQA 4RFBA 2L32A 2WXHA 1YJIA 2WQYB 5D3IB 5FKAC 1MHHE 4ZOHC 2LUMA 2AQ1B 3URYA 3ZJTA 1HXYD 1NEKB 5LNK1 3NVYA 4H2AA 1TS5A 2PVOD 4OZBA 2LJIA 2BBCA 2PVGC 3TEXA 1KTKA 1L6UA 2BT6A 2SAKA 4RGNA 3EGRA 4ZRQA 4LTUA 3VR9B 1MI0A 1OFFA 5BYRA 4HEA1 1VJKA 5HG2A 1HQRD 4MACA 3AB5A 1STEA 1NVID 1JMLA 4A55A 3AV8A 1EWCA 1AN8A 4REZA 1GAQB 3AE3B 3TEWA 3GB1A 2K22A 1BUIC 2NMQA 2BS3B 3Q8EA 1DOYA 1ZDXA 2QEJC 1PFDA 3ETRA 3AE6B 3ZQ4A 3W1SA 3LXFA 1V97A 4JE3B 2WXGA 3P4RB 1CK1A 4KKJA 5D3DA 4YXDB 1I4PA 1SE4A 2AX5A 4KGSA 1DYQA 1JWSD 2WXOA 2CU3A 2ZW0A 3BIID 3BWUD 2FBWB 3IAS1 3U2SC 2G9HD 1L4ZB 4GLSC 3VR8B 3W2DA 2JX5A 2INPE 1PGXA 1I7HA 1QILA 2ICIA 3AE9B 3R2TA 2GI9A 4MM3B 1C9FA 3KWLA 1FXIA 4Q2JA 4RF0A 3SFDB 2N0SB 1EWYC 3N9YC 1KLGD 3IT4B 2QILA 1ZE3D 1TY0A 1WWTA 1ZUD2 2I2YA 1FCLA 4ZRPA 4ZYSA 1XO3A 2WXJA 3Q8CA 2PLPA 3W5VB 1KRHA 3AE4B 1IGCA 2IPKD 3Q8AA 4US8A 2DWQA 2Q5WD 1TS3A 1EU3A 1F2RI 1SBBB 1PDXA 2R61A 4HKQA 3W5UB 3AE1B 1MVKA 2LMCA 1TKEA 4NAMA 4WQMA 1TY2A 1EM7A 1WXQA 1AYFA 2B76B 1D5MC 4JPSA 5BMGA 1FO4A 2WS3B 4XDCA 2WU2B 4C7ZA 4IOIE 1KF6B 1WGKA 3BVMA 1FFVA 1N60A 1YQ3B 2IGGA 1F2RC 3FILA 4KX6B 1L4DB 1FNVA 3AN1A 1XLNA 3SR6A 3FILB 4M0WA 5EE0A 5C2TB 3T3NA 4FXCA 1E9MA 2LHDA 3PO0A 2QSDA 4RNAA 2MJDA 1PGAA 1F0ZA 2W3SA 2WXKA 2YEPF 3T3OA 2E6XA 1QF6A 1J7AA 1I4XA 2AQ2B 1WYGA 2IJ0A 5BMIA 5BYSA 2V0GA 2WXLA 2BTEA 1ZXIA 2JU6X 4YTNB 1C4PA 2L83A 2GRIA 4ITKA 3RPFC 2V3NA 1UWMA 4TQ1A 1YN4A 2L52A 3KQ4A 3L4PA 4R3DA 2MJ3A 4XE0A 5I4DA 1R7SA 1FRDA 2BW2A 3NVZA 1F77A 3HVDA 3BYTB 1GB4A 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRI A;  1FFU A;  1L6V A;  2CJN A;  3AE6 B;  3ETR A;  2CJO A;  1SF0 A;  1V97 A;  2MJE A;  3LXF A;  2DBY A;  3P4R B;  1OQR A;  2PIA A;  3W9C B;  1N62 A;  4YXD B;  2AX5 A;  1FXA A;  2KAJ A;  1RM6 C;  1JQ4 A;  2WLB A;  2CU3 A;  1NYR A;  1FM0 D;  1DOI A;  1E7P B;  3BII D;  1J7B A;  1E6E B;  1ZOY B;  2FBW B;  5MPO A;  1GPX A;  1FIQ A;  5C3J B;  3B2G A;  5EE1 A;  3VR8 B;  1ROE A;  2E3T A;  2JX5 A;  1L0V B;  2HTM E;  5G5H A;  1I7H A;  5H92 C;  3AE9 B;  2BS2 B;  3AMZ A;  1N5X A;  3KWL A;  1L5P A;  4USA A;  1FXI A;  3VRB B;  4N59 A;  1YQ4 B;  1JW9 D;  3EUB 2;  3HUI A;  3SFD B;  2W54 A;  4YSZ B;  2N0S B;  1EWY C;  2H89 B;  3B2F A;  3HVZ A;  3FAH A;  5GXG B;  3AEG B;  1JWA D;  2WU5 B;  3AE5 B;  2JQR B;  4US9 A;  1J7C A;  1SIJ A;  1SB3 C;  1WWT A;  3NS1 A;  3P4S B;  1ZUD 2;  3P63 A;  5H8Y E;  1XO3 A;  2H88 B;  2M19 A;  1CZP A;  4IDI A;  2Y5C A;  3DWG C;  3W5V B;  1KRH A;  1RWS A;  2WDQ B;  2KMM A;  3AE4 B;  4C80 A;  3AH7 A;  1N61 A;  1TJE A;  2WDR B;  1N63 A;  3P4Q B;  4US8 A;  2EKI A;  2DWQ A;  2Q5W D;  1PDX A;  4WWM A;  4YT0 B;  1KFY B;  3W5U B;  1YJJ A;  3AE1 B;  1B9R A;  3CWI A;  4A9A A;  1QOA A;  4YSY B;  3ZYY X;  1E0Z A;  1N5W A;  1V8C A;  3AM9 A;  1TKE A;  3P1M A;  4JWS C;  2QIE B;  2K5P A;  3AEA B;  4WQM A;  2G1E A;  1CJE A;  1NEN B;  1WXQ A;  1AYF A;  1T3Q A;  3ABV B;  3AEE B;  1TYG B;  4JWU C;  3LB8 C;  5EE3 A;  2B76 B;  2QJL A;  2M56 B;  1DOX A;  1TKG A;  3NVW A;  3AEC B;  5AUI A;  2MH7 A;  4P6V F;  1XLQ A;  1FO4 A;  2WS3 B;  2WU2 B;  4C7Z A;  1QT9 A;  2LEK A;  2WDV B;  1KF6 B;  1FMA D;  1WGK A;  1XLP A;  3AE2 B;  3FC4 A;  1QOB A;  1FFV A;  5EE9 A;  1NYQ A;  1N60 A;  1QOG A;  4C7Y A;  2K9X A;  1YQ3 B;  1FRR A;  4YTP B;  2ACZ B;  1JWB D;  4N58 A;  4KX6 B;  3WCQ A;  4ZHP A;  3B9J A;  3NVV A;  2PKO A;  1TKY A;  3AN1 A;  1YJI A;  1XLN A;  1AWD A;  1RFK A;  2WQY B;  3CIR B;  1NI3 A;  2BS4 B;  3SR6 A;  1XLO A;  5EE0 A;  3AEF B;  5C2T B;  4ZOH C;  2OHF A;  1QLB B;  4FXC A;  3SFE B;  1VLB A;  1E9M A;  3PO0 A;  3DWM A;  4ZHO A;  1NEK B;  1VDV A;  2W3R A;  2MJD A;  3NVY A;  2PVO D;  3AEB B;  1F0Z A;  2W3S A;  3P4P B;  3HRD D;  1QF6 A;  2PVG C;  4YTM B;  1L6U A;  2BT6 A;  1IUE A;  1J7A A;  4LTU A;  1WYG A;  3AE7 B;  3AED B;  5G5G A;  3VR9 B;  1OFF A;  4N6E B;  1ZXI A;  3VRA B;  1VJK A;  4YTN B;  1JRP A;  2L83 A;  4HRO A;  3AB5 A;  1JAL A;  4ITK A;  1A70 A;  1RYJ A;  4JX1 C;  3RPF C;  1E10 A;  1NVI D;  4YSX B;  1UWM A;  1JRO A;  2L52 A;  3AV8 A;  3NRZ A;  1ZP0 B;  5AUK A;  1GAQ B;  3AE3 B;  3L4P A;  2MJ3 A;  1OQQ A;  1R7S A;  1FRD A;  2K22 A;  3NVZ A;  4HRS A;  1PUT A;  1DGJ A;  2BS3 B;  2W55 A;  2WP9 B;  1QOF A;  3AE8 B;  1DOY A;  1PFD A; 
#chains in the Genus database with same CATH topology
 1FFU A;  3TUO A;  3W9C B;  4PYZ A;  1JWU D;  1QKZ A;  1FM0 D;  2REX A;  1C1Y B;  4WUR A;  3PHW B;  2CR5 A;  2JWZ A;  3C19 A;  4L1B A;  1RFA A;  3E56 A;  4HJG E;  1EU4 A;  2E3T A;  5G5H A;  4DXA B;  4EZL A;  3A33 B;  1L5P A;  5IP4 D;  2RR9 A;  4NJ6 A;  4OHJ A;  2CU1 A;  1KLV A;  2KWD A;  1TS2 A;  4ACF A;  1TBE A;  3ZKJ C;  3LYY A;  2L1A A;  1CZP A;  3IAM 1;  3DWG C;  4GIV A;  1FD6 A;  4BKG A;  4DQO C;  3DBR B;  3RNG C;  2DNF A;  4P1C C;  2BB6 A;  5D7G A;  4MJS A;  1C4A A;  1B9R A;  3IHP C;  1D5Z C;  3O65 B;  3P1M A;  5JH5 C;  4EZJ A;  1VR9 A;  5AZF A;  3PRE A;  1WZ0 A;  2J0K A;  4CQN A;  1X1M A;  3AE2 B;  2ZNV B;  3X23 A;  5EE9 A;  3N3K B;  2XNA C;  5DPR A;  4YTP B;  2ACZ B;  4KVG B;  4XZ4 A;  4OVU A;  3ZO5 B;  2BS4 B;  5HI1 A;  1QLB B;  1V86 A;  3U7Z A;  4ZHO A;  3BY4 B;  3O13 A;  3AEB B;  2MP2 B;  1Q10 A;  4CYE A;  2LD9 A;  3AE7 B;  4XWT A;  1RYJ A;  4JX1 C;  1JRO A;  1ZP0 B;  5BYQ A;  2N1V A;  1OQQ A;  3K9O B;  2V4L A;  2L3Z A;  4G0N B;  4QAY A;  2KXJ A;  2DZI A;  2LXA A;  2I1J A;  1NI2 A;  2O2V B;  4GDK B;  4IM0 A;  2WXM A;  1HZ6 A;  1SEB D;  3RN9 C;  2WX1 A;  3RZF A;  2KAJ A;  1TT5 B;  2WLB A;  1DOI A;  2M0A A;  2YVC A;  2KTR B;  5C3J B;  3EA6 A;  1ROE A;  1FNU A;  2A5U A;  1WJU A;  4LDT D;  3BK2 A;  2NBW B;  5IKC M;  4N59 A;  1JW9 D;  4D2K A;  3HVZ A;  2LRW A;  1IBX A;  3H8H A;  3NS1 A;  1MG4 A;  2MBH A;  3BZD B;  5AZG A;  4IDI A;  2Y5C A;  4HKZ E;  1WI0 A;  2WDR B;  3VTV A;  4EEW A;  3IXS A;  1KFY B;  3ZYY X;  3VAW A;  4S0R A;  3V3X A;  4NAW A;  2KAC A;  2KKC A;  2IBI B;  1MG8 A;  1T3Q A;  2XK5 A;  1P1A A;  4MH8 A;  2MH7 A;  3N1Z C;  4DWF A;  4RCO A;  5HHD G;  3A9K B;  4RGO S;  3VDZ A;  2KQS A;  3ONS A;  4IM2 A;  4BZA A;  3JSV A;  4K81 A;  2KVZ A;  3VTU A;  1WGG A;  1T5X D;  2DZK A;  4W9L A;  4B95 A;  4ZHP A;  3UI3 A;  2N7E A;  2BKF A;  2JYE A;  2PKO A;  3CIR B;  4MEM A;  4B6W A;  3IBE A;  4P1B C;  1EF1 A;  1WIA A;  3P4P B;  4GDL A;  4YTM B;  2KHW B;  5IO9 A;  2K8C A;  3Q8F A;  3AU4 A;  4F8C B;  2J0M A;  2L0T A;  1E10 A;  3NZ3 A;  1ENF A;  3UQB A;  3QC8 B;  3P2B A;  1HTO A;  3RUL A;  4ASW C;  2G1E A;  1WRI A;  4LJO B;  2MJE A;  3JW0 X;  4KZC A;  3QQ8 B;  2KDE B;  2LUE A;  2UYZ B;  4G3X B;  4F1S A;  1NYR A;  2HE7 A;  1GPX A;  2NTS A;  4NJC A;  3TEZ A;  2LVQ A;  1WJN A;  2AYO B;  2VZK D;  3KVF B;  4NJ7 A;  4TUU A;  4BBN C;  5H92 C;  3UQA A;  2XBB C;  1T0R C;  2LGI A;  1A5R A;  4K7U A;  3ZDM C;  3HUI A;  1VZ8 A;  1C78 A;  1ZPS A;  2W54 A;  1D6E C;  2V4I B;  3PGE A;  3B2F A;  3TMP B;  4WJP A;  5CHF A;  3L13 A;  1AW7 A;  3IVF A;  3P4S B;  3P63 A;  1WSP A;  4E71 A;  1P7E A;  4L2Y A;  2W82 A;  1LO5 D;  5KHQ A;  3B0A A;  2KDI A;  1YNT E;  3CWI A;  4A9A A;  4AJW A;  1SE2 A;  1E8W A;  3PV1 A;  5FR6 A;  1CJE A;  1UUP A;  3IT6 B;  3VH4 B;  5LXI B;  2M56 B;  2INC C;  5DPW A;  4UDU C;  4IM3 A;  2PEA A;  4JL9 A;  1XLP A;  1GG3 A;  2DX5 B;  2BYF A;  2EEL A;  2K9X A;  3K9P B;  2L32 A;  2WQY B;  5FKA C;  4NQK E;  4ZOH C;  2AQ1 B;  1HXY D;  1S3S G;  1UGM A;  1JRU A;  3NVY A;  2D3G A;  2LZ6 A;  3TEX A;  2SAK A;  1V5O A;  3DBS A;  4ZRQ A;  1OFF A;  3WAN A;  2BYE A;  1VJK A;  5HG2 A;  4MAC A;  1NVI D;  2ZPY A;  4A55 A;  4JGH B;  4GMV A;  2AL6 A;  3KUD B;  1BUI C;  2NMQ A;  3A9J B;  2IY0 B;  1TGZ B;  2QEJ C;  4K3B A;  2D2Q A;  1CK1 A;  2JRI B;  1UD7 A;  5D3D A;  4YXD B;  1SE4 A;  2AX5 A;  3NG0 A;  3QX1 A;  2M4N A;  3UIO B;  1T0Y A;  3ZIM A;  2ZW0 A;  3EC8 A;  4MM3 A;  1YQB A;  4IG7 B;  3IAS 1;  3B1L X;  1L4Z B;  4GLS C;  2JX5 A;  4BVU C;  3AE9 B;  3R2T A;  3ZTD A;  2LGX A;  1EF5 A;  1FXI A;  4IC7 B;  2NBU A;  4RF0 A;  3SFD B;  2N0S B;  1EWY C;  2LWP A;  3BIN A;  3ZLZ A;  1D3Z A;  4A3P A;  3H7P A;  1ZUD 2;  4I6N B;  4ZRP A;  2BQQ A;  2IZV B;  2WXJ A;  3Q8C A;  1LQB A;  1KRH A;  1IGC A;  1MJD A;  1ISN A;  3VUX A;  4US8 A;  2GBM A;  2Q5W D;  2RGF A;  4HKQ A;  2R61 A;  3WAM A;  1IYF A;  3AE1 B;  3X0W A;  4NAM A;  1WXQ A;  1AYF A;  2MLB A;  1P0R A;  5J17 A;  1UBI A;  1WE6 A;  1WGK A;  2G4D B;  2DAF A;  3BVM A;  1YQ3 B;  1F2R C;  3FIL A;  3ZNI D;  2FAZ A;  4EFO A;  5C2T B;  4EUT A;  3T3N A;  1E9M A;  2QSD A;  1KJT A;  4TV3 A;  4C4V B;  2W3S A;  2WXK A;  3V6C B;  1WX9 A;  3DBR I;  1WM2 A;  2VH2 A;  4JQW C;  2X8X X;  2JU6 X;  4WWP A;  2V3N A;  2L52 A;  3KQ4 A;  2GBJ A;  3L4P A;  4K7S A;  5I4D A;  2MRP A;  2BWF A;  3NVZ A;  1F77 A;  1WY8 A;  3BYT B;  2KNB A;  1SE3 A;  2NS5 A;  3DHI C;  3RCZ A;  3ZUN A;  4HDO A;  2BYT A;  1OQR A;  2Y5P A;  2DZJ A;  3DVN U;  2Z59 B;  4DDI D;  4HPM B;  1HTQ A;  2FCS A;  4XC2 A;  2WXF A;  1UNS A;  2C7N B;  1EUV B;  1YQ4 B;  2KN5 A;  3APC A;  4DXG A;  4A3O A;  3AEG B;  3KWV A;  4WJQ A;  2V3P A;  3BVZ A;  3U52 E;  4OZC A;  4FHJ A;  4ARI A;  3NUH B;  1H8C A;  1PQS A;  2RD0 A;  5JZE B;  4LJP B;  1C4C A;  1GC7 A;  4XGA B;  1FNW A;  3TL5 A;  2RDG A;  5D94 A;  3MC9 A;  2K5P A;  1VZ6 A;  2BF8 B;  2KC2 A;  3ML9 A;  4RM8 A;  3PVL A;  4WH4 A;  2WX0 A;  4FHK A;  2JVC A;  1P7F A;  1BML C;  4MT5 A;  2FCN A;  2D07 B;  3PRZ A;  3VFK A;  2ONQ A;  3V05 A;  1WGY A;  1RFK A;  3RNF C;  2K1F A;  4HPL B;  2HDE A;  1NDD A;  2L05 A;  4E3C A;  2MP2 A;  4LNN A;  3DWM A;  4IUM B;  3V60 A;  2W3R A;  2PE9 A;  5GMV A;  3QA8 A;  3MC0 B;  4HDQ A;  2X38 A;  4GSW A;  5KHO A;  1P9D U;  3VRA B;  4W9E A;  1A70 A;  1XEE A;  2KTF A;  4XWW A;  2PTL A;  1E5W A;  3QJZ A;  4HRS A;  2O2V A;  2WP9 B;  1QOF A;  4GDK A;  1FMA D;  4A8X C;  1C77 A;  3OWE B;  2KFK B;  3A4R A;  4LK0 M;  4GXB A;  3TJP A;  1JCK B;  1BXT A;  3MFG A;  3J9C A;  4RM9 A;  2KTR A;  4KV2 A;  2M1M A;  1K51 A;  3R8B A;  3Q8B A;  2J53 A;  3L08 A;  3SHQ A;  1F9J A;  1L0V B;  2CKH B;  1XQQ A;  4ZYN A;  1K50 A;  4WWO A;  4ANW A;  2IGH A;  3MJ5 A;  1T0Q C;  4YSZ B;  3FAH A;  1SIJ A;  1SB3 C;  2XEW A;  2H88 B;  3N1X C;  4OVV A;  2WDQ B;  3CF6 E;  2J4X A;  1V1P B;  4KDL B;  2MBQ A;  1V6E A;  1WF9 A;  2LGY A;  4I6P A;  2MX2 A;  3VQI A;  1FPY A;  4P16 A;  4MGZ E;  5G2N A;  3MP9 A;  4AOF A;  2L0F A;  3OJ3 A;  2K8B A;  5TR5 A;  4XDD A;  4RH6 A;  1KM7 A;  3A9K A;  3Q3J A;  2KDM A;  2SEB D;  4OZA A;  1XCT L;  1NYQ A;  3UGB B;  4BKS A;  2K25 A;  4KDI C;  3TEY A;  2J52 A;  4K7W A;  4A20 A;  2EMT A;  4DDG D;  2JWU A;  1NI3 A;  3AEF B;  3KW5 B;  1CQV A;  3ZDT A;  2JZP A;  1C3T A;  1B1Z A;  4AUQ C;  1L0Y B;  4HLE A;  5CX3 A;  4OVZ A;  4N6E B;  2OED A;  4IWQ A;  3RNA C;  1Y56 A;  1JAL A;  3M95 A;  4KGT A;  3IFW B;  1DGJ A;  1WXS A;  2JRH A;  2B3A A;  2FUG 1;  2N1W A;  1RLF A;  5DPT A;  4FN2 A;  4XYC A;  4LDT B;  3BK1 A;  2M17 A;  3DBH B;  2D3C A;  2MBE A;  1JQ4 A;  1E7P B;  3M62 B;  4WIP A;  1ZOY B;  5MPO A;  5EE1 A;  3R7Q A;  2HTM E;  3PRP B;  2NR2 A;  3OJ4 B;  1WE7 A;  1E90 A;  2H89 B;  2J7Q B;  3Q69 A;  1MHX A;  1JWA D;  3RYT A;  1PGB A;  4AWJ A;  2V3S A;  2RPV A;  2YLM A;  5AEK B;  3PZ7 A;  2QMT A;  2N9L A;  2WGS A;  3D32 A;  4OW0 A;  1YJ1 A;  4YSY B;  3KLS X;  3H6N A;  3JYU A;  4NPN A;  3R7R A;  2GOW A;  1XCQ L;  2V9H A;  3NVW A;  2PMV A;  4AJY B;  2LHE A;  5L95 C;  2LFI A;  2LI5 A;  1WFY A;  4AS1 A;  3P42 A;  2D3B A;  2M0X A;  3UIP B;  1FEH A;  4RFB A;  2ZCB A;  1YJI A;  4F7Z A;  1MHH E;  2LUM A;  3RT3 B;  4GU2 A;  2I1K A;  3M63 B;  3EFC A;  3HM6 X;  1RRB A;  4HEA 1;  1HQR D;  3AB5 A;  1STE A;  3A9J A;  3VUY A;  3AV8 A;  4P7I A;  1AN8 A;  3TEW A;  3GB1 A;  3TBL D;  3Q8E A;  4MH0 E;  1DOY A;  4FJZ A;  3ZQ4 A;  2WWZ A;  1V97 A;  3L17 A;  4JE3 B;  2WXG A;  3P4R B;  4KKJ A;  4DHJ B;  1I4P A;  1V9J A;  3SDL C;  4KGS A;  2WXO A;  2CU3 A;  3BII D;  4HPP A;  2D10 A;  3U2S C;  3R66 C;  1MFW A;  1GUA B;  2INP E;  3Q6B A;  1PGX A;  1QIL A;  4M01 A;  4URK A;  1V2Y A;  2L00 B;  3VTW A;  4IWP A;  1R4M B;  2KAN A;  3IT4 B;  3DVN V;  1ZE3 D;  1TY0 A;  1I35 A;  2FCQ A;  1XO3 A;  2GLS A;  3WIM A;  3VUW A;  3OAW A;  2KYW A;  4ZDV A;  3W5U B;  4EZK A;  4LNK A;  3UIN B;  1MVK A;  2LMC A;  1NBF C;  2HD5 B;  4WQM A;  5CTR C;  1EM7 A;  1RAX A;  4PYU A;  2OJW A;  3GE8 C;  2KK8 A;  4JPS A;  1P3Q U;  2KFJ A;  2WS3 B;  5G55 A;  1F1H A;  2WU2 B;  4C7Z A;  3U7D A;  1FFV A;  4W9H A;  2ZCC A;  4KX6 B;  1L4D B;  1FNV A;  1XLN A;  3UF8 A;  5EE0 A;  4C4V A;  1WXA A;  4M0W B;  4FJY A;  2MWS B;  4M00 A;  1QF6 A;  4LNI A;  3TCA A;  2LXC A;  1J7A A;  5BYS A;  1ZXI A;  1C4P A;  3RPF C;  1XT9 B;  4XE0 A;  1R7S A;  1FRD A;  2GBR A;  1OEY A;  3PTF C;  3RUI B;  2O6V B;  2GBK A;  1GB4 A;  2CJN A;  4B0E A;  2Y5B B;  1N62 A;  1XF5 L;  2EMS A;  1FXA A;  1M94 A;  3H9D A;  4HWI B;  4IKG A;  4MSM B;  5FR3 A;  3I3T B;  3RNE C;  1E7U A;  3Q14 C;  4M02 A;  4EOY A;  1HA5 A;  1SXT A;  4B0M A;  2KMA A;  2AL3 A;  1L0X B;  1GNU A;  4US9 A;  2DAJ A;  2ZNV C;  4M8M A;  1WRD B;  1RWS A;  1WX8 A;  3T9L A;  1TJE A;  1R4N B;  2IND C;  1VD2 A;  2TSS A;  5E6O A;  1HEZ E;  2W9N A;  5DPS A;  3DVG X;  4PK1 A;  3R2I A;  2GB1 A;  2QJL A;  3QWZ B;  4HCN B;  2JZZ A;  3AEC B;  3DOW A;  4WQO B;  4FAD A;  4MGK E;  5JHB A;  3RD2 A;  1C79 A;  1V49 A;  1I4R A;  3ZGZ A;  4PS3 A;  1GB1 A;  3A1Q B;  1TKY A;  1Z5S B;  4RF1 A;  4RGT A;  2DYO A;  4HCP B;  2JXT A;  2OHF A;  4L23 A;  4KKI A;  2NVU I;  3PT2 B;  4WJO A;  4J6I A;  3ZTC A;  1J8C A;  4B9K A;  1M4V A;  1WMH B;  1C76 A;  4DBG A;  2RSU A;  1YX5 B;  2FCM A;  4YL8 A;  3GS2 A;  1YN3 A;  3KUC B;  2KFK A;  2WXP A;  1SIF A;  2W55 A;  3AE8 B;  2WDT B;  1YX6 B;  2KOX A;  3I9V 1;  4K3C A;  4G50 A;  3DDC B;  3SD5 A;  2IYD B;  2KN4 A;  3OG5 A;  2MCN B;  1OTR B;  2KVR A;  1FIQ A;  3DCG A;  1ZW7 A;  2DYM A;  1FXT B;  3V61 A;  1YMH E;  1K53 A;  2IGD A;  4CO7 A;  1N5X A;  3QK0 A;  4MEL A;  3U8Z A;  2K6D B;  3EUB 2;  1UEL A;  2UWQ A;  2K39 A;  2LRU A;  2WU5 B;  3S2A A;  3AI5 A;  1KOT A;  5D6J B;  1I42 A;  1V1P A;  1UBQ A;  3RNC C;  1UZX B;  1UGJ A;  3C8Y A;  1V8C A;  4JWS C;  2K3U A;  2WYQ A;  3AXC A;  2BPS A;  3NHE B;  1WR6 E;  4JWU C;  1TS4 A;  1L7Y A;  4PT5 A;  1WGH A;  3DBH I;  4P6V F;  2ON8 A;  2LEK A;  4BOZ B;  4FBJ B;  1FRR A;  1JWB D;  2MA9 B;  4KSL C;  4NZL B;  2FE8 A;  1XD3 B;  3TSS A;  2ZW1 A;  1XLO A;  2KLG A;  1CMX B;  2ZZP B;  3SFE B;  2G4S A;  1VLB A;  2RMM A;  3I63 C;  2BYV E;  1TTN A;  1LFD A;  1Q0W B;  3EHV A;  4WAF A;  2AWT A;  3HRD D;  2N7D A;  2LVO A;  2KO3 A;  2JPH A;  4PS8 A;  2RDH A;  1JRP A;  4ICV A;  2L7R A;  4HRO A;  2RDB C;  2BVC A;  4WJN A;  1D4B A;  3PS6 A;  2OOB B;  4MGY E;  1KH0 A;  4RGM A;  3QIJ A;  1WZ3 A;  4MDK E;  2CJO A;  4C56 C;  1ESF A;  2PIA A;  1WGR A;  4HVB A;  2DZM A;  2QHO A;  2C60 A;  1RM6 C;  2RPQ A;  4II3 B;  2ASQ A;  2HJ1 A;  5HFY A;  2NTT A;  4TMA B;  4LNO A;  4W9K A;  3DHH C;  3VRB B;  2MBO A;  2KMC A;  2MBB B;  5GXG B;  5JXV A;  3PSE B;  2VRR B;  2ZPN A;  2MW5 A;  2V1Y A;  5BMH A;  2I38 A;  1FCC C;  1N61 A;  2D3A A;  2K0P A;  1SJE D;  4AQ7 A;  2WNM A;  3R3M A;  2ZJD A;  4MGI E;  2ZVO A;  3CMM B;  3WAP A;  3AM9 A;  1T0S C;  1UWX A;  2IO1 B;  1D5X C;  3SEB A;  1TYG B;  1EO6 A;  1OGW A;  5HKH A;  2MEK A;  2WDV B;  3HHM A;  4JIO U;  4M8N A;  3ZNH B;  3PPA A;  1K8R B;  2IY1 B;  4KIK B;  3WCQ A;  2WXH A;  5D3I B;  1R4M I;  1WX7 A;  2J0J A;  3ZJT A;  1NEK B;  2N9P C;  2KJR A;  1TS5 A;  3AU5 A;  2MQJ A;  4OZB A;  4AP4 C;  2BBC A;  3MC8 A;  1KTK A;  1L6U A;  2BT6 A;  3EGR A;  4LTU A;  1MI0 A;  2BWE S;  2BGF A;  5BYR A;  3ML8 A;  1UF0 A;  3NZU A;  2K6Q A;  3CSF A;  4REZ A;  1LXD A;  3AE3 B;  2KC1 A;  2K22 A;  2BS3 B;  1TIF A;  1PFD A;  2MSE D;  2LVP A;  2KX0 A;  2KJ6 A;  3W1S A;  2DEN B;  3LXF A;  2K8H A;  3NOB A;  2KWV B;  3Q3O C;  3DHG C;  1LGR A;  2FNJ B;  3HIZ A;  4E74 A;  3BWU D;  3V6E B;  4ZRK A;  2G9H D;  3VR8 B;  2ICI A;  1I7H A;  2GI9 A;  3WAL A;  2FID A;  2KD0 A;  1E7V A;  3T8M A;  2QIL A;  4FJV B;  2NPT B;  4RMA A;  4EKU A;  4XX5 A;  4ZYS A;  3Q3M C;  3W5V B;  2PLP A;  3RNB C;  3AE4 B;  4MSQ B;  1AAR A;  2IPK D;  3Q8A A;  4X57 B;  1EU3 A;  1YIW A;  2UU7 A;  1TKE A;  3PZD A;  1LM8 B;  1TY2 A;  1WJ4 A;  2L8J A;  3GZN B;  5BMG A;  1FO4 A;  4BOS C;  4LNF A;  3RZW C;  3DBL B;  4IOI E;  1KF6 B;  2QC8 A;  2R2Q A;  1IP9 A;  4GOC A;  2N9E B;  2IGG A;  4M0W A;  4KZ0 A;  4ICU A;  2LHD A;  3PO0 A;  3DQV A;  4RNA A;  2MJD A;  1PGA A;  1F0Z A;  3KH0 A;  1S1Q B;  2CHW A;  3T3O A;  5J2R A;  4G11 A;  1I4X A;  1R4N I;  2AQ2 B;  1WYG A;  2IJ0 A;  2V0G A;  2WXL A;  2BTE A;  1WM3 A;  4YTN B;  2JXX A;  2L83 A;  2ZVN A;  3ECI A;  3KYC D;  2BKR B;  1UWM A;  4TQ1 A;  1YN4 A;  3ZW3 A;  2O6V A;  5C1Z A;  4R3D A;  2BW2 A;  3HVD A;  5IOI A;  1KLU D;  2DBY A;  3APF A;  4BBN F;  5TSS A;  2R2O A;  5E6J A;  1SJH D;  2IO0 B;  2FUH B;  1J7B A;  3WA0 A;  3RFZ B;  2C5L C;  2Y3A A;  2NBV B;  2Z0D B;  5JHA A;  3AMZ A;  2WHI A;  3HK0 A;  5AZH A;  1V5T A;  1OEY J;  1UH6 A;  3AE5 B;  3RMK C;  1J7C A;  2VZK B;  5C23 A;  4ZRJ A;  5H8Y E;  3PRM B;  2M19 A;  1E8Z A;  2C7H A;  2KMM A;  4C80 A;  1P98 A;  4HXD A;  3EFU A;  4J3O D;  4TQ0 A;  4WWM A;  1VZ7 A;  4II2 B;  2QDF A;  1TZO A;  2D5G A;  1SSN A;  3CST A;  3L54 A;  5LLI A;  2KQ4 X;  2QIE B;  4MJS B;  3QCA A;  3ZXV A;  2JY6 A;  1WJ6 A;  3ABV B;  1NEN B;  4W9F A;  5EE3 A;  2INN E;  1VCB A;  2IO2 B;  2D11 A;  1TKG A;  5FK9 C;  1WGD A;  5AUI A;  2XN9 C;  1XLQ A;  2KJH B;  4BFR A;  2KDF B;  3MJW A;  4DHZ B;  2KZR A;  2HJ8 A;  3QHT A;  4C7Y A;  2C7M B;  3A1Q A;  3L10 B;  3Q3N C;  3QAQ A;  3N30 A;  4N58 A;  1I4G A;  3B9J A;  3PZ8 A;  1YD8 U;  2QCZ A;  1AWD A;  1F52 A;  2JYT A;  2PJH A;  3APD A;  3GOE A;  1T6B X;  1VDV A;  2EKE C;  1V1O A;  4DXF A;  1BT0 A;  1MPE A;  2LGS A;  1U4A A;  4A90 A;  4BKS D;  1WMH A;  3FKY A;  2DHZ A;  1K52 A;  3AED B;  5LXH A;  1I4H A;  1Q5W B;  2LGD A;  1GOZ A;  2KWU B;  2L76 A;  3L16 A;  3NRZ A;  4DHJ D;  3ENE A;  4FUL A;  3N32 A;  4EE2 A;  3NS8 A;  4LLG M;  1WH3 A;  2KWC A;  3C0R B;  1SF0 A;  3ZJU A;  5IA7 A;  1WR1 A;  3MTN B;  2GBN A;  5L83 A;  3PLU A;  1E6E B;  2WXR A;  3B2G A;  1V81 A;  3M3J A;  2M8S A;  3VXW A;  2BS2 B;  3MHZ A;  4C00 A;  2IO3 B;  3I57 A;  4USA A;  3U4E G;  2NCN A;  1E8X A;  4IWO A;  1IGD A;  2JQR B;  5DCN A;  3V62 A;  1VRA B;  4HK2 A;  3N1Y C;  3OLM D;  4FLH A;  3ZJV A;  1IBX B;  2KT7 A;  2N9K A;  2LAS A;  1ET9 A;  4NNJ B;  3AH7 A;  1N63 A;  4YT0 B;  2JF5 A;  1E0Z A;  2DLB A;  1ZXH A;  1HZ5 A;  2AEH A;  4W9G A;  3JVZ X;  4JLC A;  3LB8 C;  1H4R A;  4NAW B;  3H7S A;  2DYB A;  4TSS A;  2BB5 A;  3I5J C;  4N9F 4;  2XK5 B;  3E9S A;  3HM3 A;  1PYW D;  2N4F A;  1YN5 A;  4GB9 A;  1ZGU B;  2IDY A;  5J18 A;  4KGR A;  3B08 A;  3NVV A;  4W9C A;  1JWM D;  3JSV B;  1WXV A;  2PW9 A;  5BO4 B;  2WXN A;  1N6Z A;  1V80 A;  3MHS D;  2CHZ A;  4O1N A;  3Q3F A;  1IUE A;  3GE3 C;  4PS7 A;  5G5G A;  4I6L B;  2O6V D;  1YOV B;  4GDL B;  3VVW B;  4BKT A;  4YSX B;  5AUK A;  4ANX A;  1I4Q A;  4A6Q A;  3Q2A C;  1PUT A;  2KQ7 A;  1L6V A;  2Z8L A;  3ZXR A;  2N7J A;  4ZRI A;  3W1Y A;  2G3Q B;  3LJ3 A;  4K1R B;  5CHW A;  3BVG A;  1ZDV A;  3GP7 A;  4FA6 A;  3VH3 B;  5T8I A;  1J19 A;  2HTH A;  5IN7 A;  3NZS A;  3DVG Y;  4ANV A;  2YEP B;  1HE8 A;  1GC6 A;  4YWG G;  2JSV X;  2PPH A;  1ET6 A;  1ACC A;  2WXI A;  4GN1 A;  3ZNZ B;  3P4Q B;  2EKI A;  4ARC A;  1XXG A;  1QQR A;  2J42 A;  3BYY B;  1YJJ A;  1QOA A;  1N5W A;  2KLC A;  2JUO A;  3ZRC A;  2WXQ A;  3AEA B;  3U30 A;  3AEE B;  1SE9 A;  1DOX A;  3ZNG C;  2PE6 B;  1QT9 A;  3FC4 A;  4KIK A;  1QOB A;  3SU8 X;  4IW0 A;  1QOG A;  2AQ3 B;  4NY0 A;  3PLV A;  4S17 A;  2OJR A;  1E8Y A;  2ZEQ A;  3URY A;  4TKN A;  1Z2M A;  3EEC A;  4GGQ A;  5LNK 1;  3W1S C;  4H2A A;  2PVO D;  2LJI A;  2PVG C;  2CHX A;  3PHX B;  4RGN A;  3VR9 B;  3L0W B;  1JML A;  1EWC A;  1GAQ B;  3ZRF A;  4DK5 A;  3ZVV A;  1GJZ A;  1ZDX A;  3GZN I;  3ETR A;  3AE6 B;  3H1U A;  3KUZ A;  3DBL I;  2KX3 A;  1IPG A;  1DYQ A;  1JWS D;  3QAR A;  3N20 C;  4W9I A;  1L2N A;  2JZ3 B;  5EDS A;  2FBW B;  3NY5 A;  3W2D A;  3A4S C;  4MM3 B;  1C9F A;  3LDZ E;  3KWL A;  4Q2J A;  2NPT A;  3N9Y C;  1KLG D;  4WAA A;  3KYD D;  3DPD A;  1WWT A;  4LCD E;  5D2M B;  4BAX A;  2I2Y A;  1FCL A;  1QZE A;  3AUL A;  3H7P B;  1G6J A;  2FIF A;  4NQL B;  1OQY A;  3VHT C;  2MHJ A;  2DWQ A;  5E6P A;  1TS3 A;  1SBB B;  1F2R I;  1PDX A;  2CS4 A;  4KSK C;  2KDB A;  4WWN A;  3IG3 A;  1J0G A;  3ALB A;  3RI7 C;  3WAO A;  2G45 B;  1ZKH A;  2B76 B;  1D5M C;  2GMI C;  2N9X A;  4W9J A;  4XDC A;  4ANU A;  2LJ5 A;  2VH1 A;  1TZ1 A;  1N60 A;  5IAA C;  5CHV C;  3AN1 A;  2Z0E B;  3SR6 A;  3FIL B;  1SGH A;  4FXC A;  1WYW B;  2C9W B;  3TIX A;  1WXM A;  4HJK A;  2YEP F;  2E6X A;  5E6N A;  4DHZ E;  1Y8R C;  2A4Z A;  5BMI A;  4W9D A;  4CHK A;  2GRI A;  4ITK A;  2MJ3 A;  3NJT A;  1Q1O A;  2JT4 B; 
#chains in the Genus database with same CATH homology
 1FFU A;  2CJN A;  3TUO A;  1KLU D;  4B0E A;  2BYT A;  2DBY A;  1OQR A;  3W9C B;  1N62 A;  2Y5P A;  1XF5 L;  1FXA A;  5TSS A;  1JWU D;  5E6J A;  1QKZ A;  1SJH D;  1FM0 D;  1J7B A;  4WUR A;  4IKG A;  4L1B A;  5FR3 A;  3RFZ B;  3E56 A;  4HJG E;  1EU4 A;  2Y3A A;  2E3T A;  5G5H A;  2WXF A;  1UNS A;  1HA5 A;  1SXT A;  3AMZ A;  1L5P A;  1YQ4 B;  4OHJ A;  4DXG A;  2KWD A;  4B0M A;  1TS2 A;  3AEG B;  3KWV A;  1L0X B;  2V3P A;  3AE5 B;  3BVZ A;  4US9 A;  1J7C A;  2VZK B;  5H8Y E;  3U52 E;  3LYY A;  4OZC A;  4ARI A;  2L1A A;  2M19 A;  3NUH B;  1CZP A;  3IAM 1;  3DWG C;  1RWS A;  2KMM A;  4C80 A;  1FD6 A;  4DQO C;  4J3O D;  1TJE A;  2BB6 A;  2TSS A;  5D7G A;  4TQ0 A;  1C4C A;  1FNW A;  4WWM A;  1VZ7 A;  1C4A A;  2RDG A;  1B9R A;  1TZO A;  2D5G A;  1HEZ E;  1SSN A;  1D5Z C;  2KQ4 X;  3P1M A;  2QIE B;  2K5P A;  1VZ6 A;  3ABV B;  1NEN B;  5EE3 A;  2INN E;  1VR9 A;  3R2I A;  2GB1 A;  4WH4 A;  2QJL A;  1TKG A;  5FK9 C;  3AEC B;  5AUI A;  2XN9 C;  1XLQ A;  4CQN A;  1P7F A;  1BML C;  3AE2 B;  5EE9 A;  1C79 A;  4MT5 A;  4C7Y A;  2XNA C;  1I4R A;  4YTP B;  2ACZ B;  3ZGZ A;  4N58 A;  1I4G A;  3B9J A;  1GB1 A;  2ONQ A;  1TKY A;  3PZ8 A;  4RF1 A;  3V05 A;  1AWD A;  1RFK A;  4RGT A;  2DYO A;  2BS4 B;  2HDE A;  2JYT A;  5HI1 A;  2JXT A;  2OHF A;  1QLB B;  4L23 A;  3U7Z A;  4ZHO A;  4KKI A;  3DWM A;  1T6B X;  1VDV A;  2W3R A;  1V1O A;  4DXF A;  1MPE A;  3O13 A;  3AEB B;  1Q10 A;  4A90 A;  3MC0 B;  3AE7 B;  1K52 A;  2X38 A;  3AED B;  1M4V A;  1I4H A;  4XWT A;  3VRA B;  1C76 A;  1A70 A;  1GOZ A;  1RYJ A;  1XEE A;  4JX1 C;  4XWW A;  1JRO A;  3NRZ A;  2PTL A;  1ZP0 B;  5BYQ A;  3GS2 A;  1OQQ A;  1YN3 A;  2WXP A;  4HRS A;  2W55 A;  3AE8 B;  2WP9 B;  1QOF A;  4EE2 A;  1FMA D;  4LLG M;  4A8X C;  1C77 A;  3OWE B;  4LK0 M;  1SF0 A;  4GDK B;  3ZJU A;  2WXM A;  1HZ6 A;  1SEB D;  1JCK B;  1BXT A;  3I9V 1;  3J9C A;  2KAJ A;  3MFG A;  2KN4 A;  3R8B A;  1K51 A;  2WLB A;  3Q8B A;  1DOI A;  1E6E B;  2J53 A;  2M0A A;  1FIQ A;  5C3J B;  2WXR A;  3B2G A;  3EA6 A;  1ROE A;  1FNU A;  2DYM A;  1L0V B;  1K50 A;  2BS2 B;  3BK2 A;  1YMH E;  3MHZ A;  1K53 A;  2IGD A;  1N5X A;  3I57 A;  4USA A;  2IGH A;  4N59 A;  1JW9 D;  3EUB 2;  3MJ5 A;  4YSZ B;  3U4E G;  4D2K A;  3HVZ A;  3FAH A;  2WU5 B;  1IBX A;  1IGD A;  2JQR B;  3H8H A;  1SIJ A;  1VRA B;  1SB3 C;  3NS1 A;  3ZJV A;  2H88 B;  3BZD B;  1V1P A;  1IBX B;  4IDI A;  2Y5C A;  2N9K A;  2WDQ B;  1ET9 A;  4HKZ E;  3AH7 A;  2J4X A;  1V1P B;  2WDR B;  1N63 A;  3IXS A;  3VQI A;  4YT0 B;  1UGJ A;  3C8Y A;  4P16 A;  1KFY B;  3MP9 A;  1E0Z A;  2DLB A;  3ZYY X;  1ZXH A;  1V8C A;  4JWS C;  1HZ5 A;  2K3U A;  3V3X A;  2KAC A;  4JWU C;  1T3Q A;  1TS4 A;  4PT5 A;  3LB8 C;  4RH6 A;  4XDD A;  4MH8 A;  4NAW B;  4TSS A;  2KDM A;  2SEB D;  2BB5 A;  2MH7 A;  4P6V F;  4RCO A;  5HHD G;  2ON8 A;  4OZA A;  2LEK A;  1XCT L;  3E9S A;  4RGO S;  1PYW D;  1YN5 A;  1NYQ A;  1FRR A;  2IDY A;  3TEY A;  2J52 A;  1JWB D;  1T5X D;  4KGR A;  4NZL B;  4ZHP A;  3NVV A;  3UI3 A;  2PKO A;  2FE8 A;  2JYE A;  1JWM D;  2JWU A;  3TSS A;  3CIR B;  1NI3 A;  2ZW1 A;  2PW9 A;  1XLO A;  2WXN A;  3AEF B;  3SFE B;  1CQV A;  1VLB A;  2RMM A;  2JZP A;  4WAF A;  3P4P B;  3HRD D;  1B1Z A;  4O1N A;  4YTM B;  1L0Y B;  1IUE A;  3Q8F A;  4OVZ A;  5G5G A;  4GDL B;  4N6E B;  2OED A;  2RDH A;  1JRP A;  4HRO A;  1Y56 A;  1JAL A;  1E10 A;  3NZ3 A;  4YSX B;  4KGT A;  5AUK A;  1ENF A;  1I4Q A;  1D4B A;  4A6Q A;  1PUT A;  1DGJ A;  1KH0 A;  2G1E A;  4RGM A;  1WRI A;  1L6V A;  2Z8L A;  2CJO A;  2FUG 1;  2N7J A;  2MJE A;  4C56 C;  1ESF A;  2PIA A;  3BK1 A;  1RM6 C;  1JQ4 A;  1NYR A;  3BVG A;  1E7P B;  4WIP A;  1ZDV A;  1ZOY B;  3GP7 A;  5MPO A;  1GPX A;  2NTS A;  4NJC A;  5EE1 A;  5T8I A;  5HFY A;  3TEZ A;  2VZK D;  2HTM E;  2NTT A;  4TMA B;  5H92 C;  2LGI A;  3VRB B;  3HUI A;  1VZ8 A;  1C78 A;  1ZPS A;  2W54 A;  2YEP B;  1D6E C;  2V4I B;  2H89 B;  3B2F A;  4YWG G;  3Q69 A;  5GXG B;  1MHX A;  1JWA D;  1PGB A;  1AW7 A;  5JXV A;  2JSV X;  3P4S B;  3P63 A;  1WSP A;  1ET6 A;  1ACC A;  2WXI A;  1P7E A;  2RPV A;  4L2Y A;  5BMH A;  3PZ7 A;  2I38 A;  2QMT A;  1FCC C;  1N61 A;  2W82 A;  1LO5 D;  2N9L A;  2K0P A;  3P4Q B;  1SJE D;  2EKI A;  4AQ7 A;  4ARC A;  1XXG A;  2WNM A;  1QQR A;  2J42 A;  3BYY B;  4OW0 A;  1YNT E;  1YJJ A;  3CWI A;  4A9A A;  1QOA A;  4YSY B;  1SE2 A;  1N5W A;  3KLS X;  3AM9 A;  2WXQ A;  3AEA B;  1UWX A;  1CJE A;  1D5X C;  3SEB A;  3AEE B;  1UUP A;  3IT6 B;  1TYG B;  1XCQ L;  2M56 B;  1DOX A;  3NVW A;  2PMV A;  2MEK A;  4UDU C;  2LHE A;  1QT9 A;  2WDV B;  3FC4 A;  1XLP A;  2LFI A;  1QOB A;  2EEL A;  1QOG A;  2AQ3 B;  2K9X A;  4AS1 A;  3P42 A;  1FEH A;  3WCQ A;  4RFB A;  2L32 A;  2WXH A;  1YJI A;  2WQY B;  5D3I B;  5FKA C;  1MHH E;  4ZOH C;  2LUM A;  2AQ1 B;  3URY A;  3ZJT A;  1HXY D;  1NEK B;  5LNK 1;  3NVY A;  4H2A A;  1TS5 A;  2PVO D;  4OZB A;  2LJI A;  2BBC A;  2PVG C;  3TEX A;  1KTK A;  1L6U A;  2BT6 A;  2SAK A;  4RGN A;  3EGR A;  4ZRQ A;  4LTU A;  3VR9 B;  1MI0 A;  1OFF A;  5BYR A;  4HEA 1;  1VJK A;  5HG2 A;  1HQR D;  4MAC A;  3AB5 A;  1STE A;  1NVI D;  1JML A;  4A55 A;  3AV8 A;  1EWC A;  1AN8 A;  4REZ A;  1GAQ B;  3AE3 B;  3TEW A;  3GB1 A;  2K22 A;  1BUI C;  2NMQ A;  2BS3 B;  3Q8E A;  1DOY A;  1ZDX A;  2QEJ C;  1PFD A;  3ETR A;  3AE6 B;  3ZQ4 A;  3W1S A;  3LXF A;  1V97 A;  4JE3 B;  2WXG A;  3P4R B;  1CK1 A;  4KKJ A;  5D3D A;  4YXD B;  1I4P A;  1SE4 A;  2AX5 A;  4KGS A;  1DYQ A;  1JWS D;  2WXO A;  2CU3 A;  2ZW0 A;  3BII D;  3BWU D;  2FBW B;  3IAS 1;  3U2S C;  2G9H D;  1L4Z B;  4GLS C;  3VR8 B;  3W2D A;  2JX5 A;  2INP E;  1PGX A;  1I7H A;  1QIL A;  2ICI A;  3AE9 B;  3R2T A;  2GI9 A;  4MM3 B;  1C9F A;  3KWL A;  1FXI A;  4Q2J A;  4RF0 A;  3SFD B;  2N0S B;  1EWY C;  3N9Y C;  1KLG D;  3IT4 B;  2QIL A;  1ZE3 D;  1TY0 A;  1WWT A;  1ZUD 2;  2I2Y A;  1FCL A;  4ZRP A;  4ZYS A;  1XO3 A;  2WXJ A;  3Q8C A;  2PLP A;  3W5V B;  1KRH A;  3AE4 B;  1IGC A;  2IPK D;  3Q8A A;  4US8 A;  2DWQ A;  2Q5W D;  1TS3 A;  1EU3 A;  1F2R I;  1SBB B;  1PDX A;  2R61 A;  4HKQ A;  3W5U B;  3AE1 B;  1MVK A;  2LMC A;  1TKE A;  4NAM A;  4WQM A;  1TY2 A;  1EM7 A;  1WXQ A;  1AYF A;  2B76 B;  1D5M C;  4JPS A;  5BMG A;  1FO4 A;  2WS3 B;  4XDC A;  2WU2 B;  4C7Z A;  4IOI E;  1KF6 B;  1WGK A;  3BVM A;  1FFV A;  1N60 A;  1YQ3 B;  2IGG A;  1F2R C;  3FIL A;  4KX6 B;  1L4D B;  1FNV A;  3AN1 A;  1XLN A;  3SR6 A;  3FIL B;  4M0W A;  5EE0 A;  5C2T B;  3T3N A;  4FXC A;  1E9M A;  2LHD A;  3PO0 A;  2QSD A;  4RNA A;  2MJD A;  1PGA A;  1F0Z A;  2W3S A;  2WXK A;  2YEP F;  3T3O A;  2E6X A;  1QF6 A;  1J7A A;  1I4X A;  2AQ2 B;  1WYG A;  2IJ0 A;  5BMI A;  5BYS A;  2V0G A;  2WXL A;  2BTE A;  1ZXI A;  2JU6 X;  4YTN B;  1C4P A;  2L83 A;  2GRI A;  4ITK A;  3RPF C;  2V3N A;  1UWM A;  4TQ1 A;  1YN4 A;  2L52 A;  3KQ4 A;  3L4P A;  4R3D A;  2MJ3 A;  4XE0 A;  5I4D A;  1R7S A;  1FRD A;  2BW2 A;  3NVZ A;  1F77 A;  3HVD A;  3BYT B;  1GB4 A;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...