1PDXA

Putidaredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PUTIDAREDOXIN)
publication title A refined model for the solution structure of oxidized putidaredoxin.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transfer
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pdxA00
1ZP0B 1FXIA 3B9JA 3NVVA 1QLBB 1CZPA 2JQRB 1B9RA 3AE6B 4KX6B 1XO3A 1AWDA 1VJKA 1DGJA 1N5XA 2PVGC 3AEEB 3FAHA 3NVZA 3P4SB 3RPFC 2CJNA 1SF0A 3AEDB 3P4RB 1ZUD2 3AE8B 1N60A 4HRSA 2WU5B 1ZOYB 2Y5CA 1OQRA 3EUB2 2BS3B 2H89B 2K5PA 3AEFB 2BS2B 4HROA 1AYFA 3KWLA 4N6EB 1PDXA 5G5HA 3DWMA 3L4PA 1E6EB 4US8A 3HVZA 1FRRA 1TKEA 1NI3A 4US9A 1FMAD 4P6VF 3NVWA 1E10A 1JQ4A 1CJEA 4YXDB 3AEGB 1KRHA 4YT0B 5G5GA 2M19A 2L52A 1R7SA 2M56B 3AEBB 2W3RA 4C80A 1UWMA 1JWBD 4ZOHC 2WDVB 1NVID 4YTPB 5EE0A 1XLOA 2K22A 2MJDA 3BIID 1FO4A 1QF6A 2EKIA 3AE4B 2CJOA 2OHFA 1L5PA 4USAA 3VRAB 1YJJA 3AE7B 3AE5B 1V97A 3AE3B 1OQQA 1E7PB 1N63A 2E3TA 2WDQB 2QJLA 2W55A 1OFFA 1TJEA 2W3SA 4WQMA 2WP9B 2HTME 3HRDD 3DWGC 1NYRA 4JX1C 1TYGB 1YQ4B 1WXQA 3NRZA 4N58A 5EE9A 2PVOD 3VR8B 4JWUC 2KAJA 3W5VB 2ACZB 1WWTA 1PFDA 1TKGA 1WYGA 3AN1A 3P1MA 2KMMA 1N62A 4YTNB 5EE3A 3AB5A 5C2TB 4YSZB 2B76B 1IUEA 3ABVB 3NVYA 3B2GA 3AECB 1FIQA 4YSXB 3P4PB 3ETRA 1FM0D 1QOGA 1RM6C 3CWIA 3NS1A 4LTUA 3AE9B 1QOBA 3W5UB 2LEKA 3B2FA 2MJ3A 1J7CA 1NEKB 1JROA 1XLNA 1V8CA 1T3QA 1YJIA 3LB8C 1A70A 4C7YA 4N59A 1NYQA 4ITKA 1FFUA 1RFKA 1YQ3B 3LXFA 1F0ZA 2QIEB 1SB3C 2WQYB 1NENB 5MPOA 5GXGB 5AUIA 2DBYA 4ZHPA 2PIAA 2N0SB 1QT9A 1GPXA 1FXAA 1ROEA 3VRBB 5H8YE 2WU2B 2G1EA 2BS4B 5AUKA 3W9CB 1DOXA 2DWQA 5H92C 3SFEB 1L0VB 3AM9A 1RWSA 1XLPA 3AE1B 1E0ZA 1PUTA 1JWAD 1QOFA 1XLQA 2MH7A 3AH7A 3VR9B 1FRDA 1EWYC 4JWSC 1KF6B 1ZXIA 2WDRB 3PO0A 3ZYYX 1L6VA 2K9XA 3AEAB 1JALA 5C3JB 3SR6A 5EE1A 3SFDB 1DOIA 3P4QB 2W54A 3P63A 2JX5A 2WLBA 1I7HA 2L83A 4IDIA 2H88B 1WGKA 1L6UA 1VLBA 1TKYA 4YTMB 1QOAA 1DOYA 4YSYB 1VDVA 2AX5A 3AV8A 4ZHOA 1J7AA 1RYJA 3AE2B 1JW9D 1N5WA 4A9AA 3WCQA 3CIRB 1N61A 2MJEA 1KFYB 1E9MA 2BT6A 2FBWB 4WWMA 2PKOA 3AMZA 4C7ZA 2WS3B 1SIJA 3FC4A 1J7BA 4FXCA 3HUIA 1FFVA 1WRIA 1JRPA 2Q5WD 1GAQB 2CU3A
chains in the Genus database with same CATH superfamily
1YN3A 3ZLZA 3ENEA 4ARIA 2KTRA 1N60A 1OTRB 3RN9C 2UU7A 1KTKA 2MWSB 2BS2B 3URYA 2LHDA 2BKRB 1E6EB 3S2AA 1I42A 5FKAC 2KQSA 5D7GA 1F52A 3HM3A 1TZOA 1XCTL 4XDCA 1FO4A 4I6NB 1UH6A 2CJOA 3AE4B 2MQJA 4GGQA 3ZIMA 2DYBA 3H7PA 2JZPA 3BYYB 4DXGA 3NUHB 2LJIA 1BMLC 3RZFA 2KAJA 3UF8A 3W5VB 4HCPB 4S17A 2N9XA 4W9DA 2KVZA 2BF8B 3NS1A 5IAAC 2N7EA 4GDKB 4DXFA 4EZKA 4W9HA 2KDMA 5FR6A 1GC7A 2BVCA 4W9KA 1E7UA 1ZW7A 2DZMA 1YX5B 3IT6B 2DBYA 4H2AA 1H8CA 3PZ8A 1L2NA 1S1QB 3ML9A 3HK0A 3PV1A 3AE1B 2ZCBA 2MH7A 4MM3B 3V60A 3RZWC 4B6WA 3SFDB 1QZEA 2PE6B 2AX5A 4ZHOA 1WY8A 1WH3A 4M0WA 4O1NA 1N61A 5JZEB 3UQBA 1E9MA 3UQAA 2WS3B 3EFUA 2MHJA 1SEBD 3UIOB 2CU3A 4G0NB 3IG3A 3BK2A 4K3BA 4DHZE 3VHTC 4AOFA 3PLUA 1EU3A 2CU1A 2INPE 1QQRA 2HD5B 1VCBA 3HM6X 3BY4B 4ZRIA 2QEJC 4GXBA 2KXJA 4CHKA 2GBRA 1YNTE 2FCNA 2LUEA 4ZYNA 4X57B 4FJZA 2KNBA 4MSMB 2G9HD 1L5PA 2IZVB 1YJJA 2KFKB 1WX8A 1TJEA 2L0TA 4WQMA 2KMCA 3E56A 4AP4C 1C3TA 1WXQA 1ACCA 3BZDB 3JVZX 3IAM1 1TS3A 3R8BA 2WX1A 2WYQA 3Q3JA 2GB1A 4RCOA 4WIPA 3VTVA 4FA6A 1WE7A 4FULA 1YN4A 4JPSA 5BMGA 3VAWA 1WZ3A 2NBVB 1S3SG 3EGRA 2G3QB 1J8CA 5AUIA 2VZKB 2N0SB 3VQIA 1UBQA 1FXAA 4WJPA 3ZVVA 3K9PB 5BYRA 2G1EA 3OJ4B 5AUKA 1DOXA 2MSED 3Q8BA 4G11A 4EZJA 3Q3NC 3TJPA 5FK9C 1KOTA 2RR9A 1KM7A 4KDIC 2MRPA 2IYDB 2L32A 1HZ5A 3VTUA 1DOYA 5BO4B 3KYCD 3DHIC 1HTQA 5E6OA 1HEZE 2M17A 3KW5B 4PYZA 3X0WA 4R3DA 3P4PB 1Q10A 1I4GA 3VUYA 4EOYA 1BT0A 4A20A 4IWPA 1AWDA 4OVUA 4WURA 2PMVA 4XZ4A 1C4AA 2K6QA 1VZ6A 1XEEA 1FMAD 4HDOA 2XBBC 3B1LX 3WANA 2TSSA 3ZTCA 2KX3A 2LRWA 2KDEB 1L4ZB 3T3NA 2HE7A 1F2RI 3ZW3A 4OW0A 2LXAA 2WHIA 1C76A 1V97A 4RM9A 1WGGA 3V61A 4TKNA 2LWPA 1E90A 2FAZA 2HJ8A 2KO3A 2JWZA 1E7VA 4G50A 4HWIB 1IUEA 2BWFA 2GBNA 1FM0D 2WGSA 3PRPB 5TR5A 1V80A 1WGDA 3W5UB 2MJ3A 5D6JB 4AS1A 3FILB 1D4BA 3KUZA 4XDDA 2GI9A 3IT4B 1SBBB 3AXCA 2WQYB 5MPOA 2L0FA 1TS5A 3ZNID 3CF6E 3N9YC 2DAFA 4C4VB 2NPTB 2WX0A 3W9CB 5H92C 5D94A 3SHQA 1MHHE 3R7QA 2LASA 3AH7A 3NZ3A 3ZNZB 1EWYC 2D3CA 2MX2A 2L00B 4F8CB 1MI0A 3ZRFA 4RM8A 4JQWC 3P63A 1WX9A 3KYDD 3DVGY 5G55A 1XT9B 5CHVC 4IWOA 3AV8A 1JWMD 1D3ZA 1Z2MA 4A55A 2FBWB 4FJVB 1FCCC 4HK2A 1XQQA 3QAQA 4KKIA 4AJYB 3W1SA 4FADA 2JWUA 1CZPA 3BYTB 2I2YA 1DGJA 4JGHB 3AEDB 4OVVA 2EKEC 1IGDA 2CS4A 2MA9B 5G2NA 4LLGM 5I4DA 1VZ7A 1YX6B 4ZOHC 2JSVX 3DBHB 3QA8A 2N9EB 2BYFA 1EF5A 3AE7B 4KSKC 3MTNB 1N63A 2BYEA 5LXIB 4BZAA 3M62B 3PTFC 4UDUC 2R2OA 3WALA 4OVZA 3U7ZA 3ONSA 4BBNC 4BFRA 4DWFA 3AB5A 3Q8EA 2B76B 3RULA 2D2QA 3M3JA 5GMVA 3B2GA 3PRZA 1WRDB 3AE9B 1FNWA 2IJ0A 2LEKA 1J7CA 2UYZB 4HDQA 2J0MA 1YJIA 4KVGB 4C7YA 3R2TA 3A4SC 4IUMB 5LXHA 1NYQA 4KZCA 1HA5A 4HPLB 4KIKA 5JHBA 1C4PA 1I4RA 3RNGC 3L54A 1PYWD 3TL5A 3APDA 5AZFA 4P1CC 3AM9A 4LNOA 4LCDE 1M94A 3JYUA 5HHDG 2N1VA 2OJWA 3N32A 4W9JA 2I1JA 3BK1A 3RNCC 3A9KB 2INCC 1ISNA 2LD9A 4M00A 3DBLI 1VDVA 4XWTA 1D6EC 2BT6A 3APFA 5BMIA 1FEHA 1SE3A 1JRPA 5L95C 2WXGA 2IY1B 1B9RA 2NMQA 4KX6B 1N5XA 2AYOB 3PZ7A 2J0KA 4E74A 3VVWB 2WXJA 1UBIA 2RGFA 1ZOYB 3MC9A 3BWUD 5G5HA 1JWSD 1JWUD 3QCAA 4AUQC 4YWGG 4EKUA 5CTRC 3AEGB 2M56B 1NVID 1HZ6A 1L0XB 2RSUA 2OHFA 4PS8A 2N1WA 2KC1A 2Z59B 3Q3FA 2C60A 4FJYA 1VRAB 1ZGUB 2WXFA 2A5UA 3ZDMC 3R3MA 1ZE3D 2KYWA 2GBMA 3RYTA 1FIQA 1QOBA 4ANWA 1XLNA 4MH8A 2GOWA 1YD8U 2KTFA 2VH2A 3EECA 4K7UA 4W9IA 1FFUA 1SXTA 2PTLA 3DVNV 3MJ5A 1QT9A 1EU4A 3N1YC 2KJ6A 1QKZA 3QARA 1J19A 1PUTA 2JT4B 1D5XC 1ZXIA 3PO0A 2K9XA 4NAWA 3VFKA 1OQYA 1MFWA 2JX5A 2Z0EB 1L6UA 2WDTB 3ZJTA 3DHHC 1J7AA 4A9AA 5BMHA 1CQVA 5HI1A 1YN5A 2D07B 3ZRCA 3ZTDA 1R4NB 4DBGA 5D3DA 1V1PA 2V0GA 4CYEA 5JHAA 4A3PA 3NVZA 2BWES 3FAHA 3P4RB 1LO5D 3EUB2 2AQ3B 2K8CA 4PS7A 1BUIC 2I38A 3Q8FA 2V4IB 2XEWA 2DX5B 2LMCA 2FUG1 2QHOA 2EMSA 2YLMA 2Y3AA 1UF0A 1LGRA 2ZZPB 2M19A 5DCNA 2M4NA 3TIXA 3ZDTA 2RDBC 2G4DB 1IP9A 4KGSA 3VRAB 4FN2A 1WM3A 4K7SA 3AE3B 4MT5A 4KGTA 2KACA 3VDZA 4JE3B 2FIDA 3AN1A 1YIWA 4REZA 3N20C 4YTNB 4ICVA 1MG8A 2V9HA 2BYVE 2PPHA 1H4RA 1C79A 1CMXB 2IDYA 1A70A 2L1AA 4TSSA 4IOIE 2R61A 3AI5A 1X1MA 1GUAB 5GXGB 2WU2B 2BS4B 1FD6A 1LXDA 1E0ZA 2C5LC 1Q5WB 1FRDA 1KF6B 3PRMB 2DAJA 2ZW0A 2FCSA 1YJ1A 3ZNGC 2L8JA 3P4QB 1Q0WB 3V6CB 4IDIA 4MGZE 3HVDA 1SIFA 1UNSA 5CX3A 2MJEA 2KANA 1WRIA 2WXQA 2KJHB 1ZP0B 1FXIA 3B9JA 4DHJB 3AE6B 2FNJB 4HXDA 3U7DA 4HRSA 3LJ3A 2KWUB 2D3BA 2NTTA 3PSEB 2REXA 4E3CA 1TKEA 3SU8X 4P6VF 3U30A 3OAWA 4YXDB 3APCA 2MBEA 1UZXB 2KDFB 1GOZA 2WDVB 2VH1A 4GDLB 2EKIA 1P98A 4USAA 5HKHA 2O6VA 1XD3B 4B9KA 4II2B 1SSNA 3A33B 1WJ4A 3B08A 3NRZA 1M4VA 1P1AA 4LNKA 4G3XB 1KH0A 1EUVB 1WWTA 4KKJA 3I5JC 1UUPA 3NVYA 4J6IA 2MBQA 1QILA 4WWPA 4B95A 3QWZB 4KZ0A 5DPWA 1T0RC 3E9SA 1TTNA 3PVLA 4GU2A 2CHZA 1HTOA 1OGWA 1WGHA 4GB9A 2KOXA 3RFZB 4NQLB 1NENB 2KVRA 3L08A 4WAFA 2RMMA 1K52A 4LDTB 2L3ZA 3TUOA 3U2SC 1FXTB 2DHZA 3TEWA 4JWSC 3R2IA 2C9WB 3N30A 4BAXA 2WXPA 2XK5B 2Y5BB 4IM2A 2KQ7A 2H88B 1NI2A 3I3TB 4RH6A 3ZKJC 3DPDA 4C7ZA 2WXMA 1SIJA 3A9JA 3FC4A 4FXCA 1E5WA 2MP2B 3IHPC 1PGAA 1F9JA 1XO3A 2KZRA 4ARCA 2AL6A 2R2QA 3IXSA 3PREA 3W1SC 3W2DA 3NS8A 4NJ7A 2K5PA 2BKFA 1GC6A 4HROA 1I4QA 3I9V1 1TS4A 3RNAC 1E8ZA 3NVWA 2K3UA 2AEHA 1VD2A 2C7HA 4YT0B 1KRHA 1ZDVA 3H7SA 5TSSA 1FCLA 2L52A 4JL9A 4KSLC 5IP4D 1ZDXA 1XLOA 4W9LA 4K3CA 1RRBA 3MJWA 2J0JA 3AE5B 4MGYE 4TMAB 4AJWA 3ZQ4A 2W55A 3NZUA 1OFFA 3ZGZA 1NYRA 5IO9A 4JLCA 2O2VB 1V49A 2LGXA 1PFDA 3P1MA 2SEBD 3DBRI 2J7QB 3QK0A 3Q14C 3NHEB 4LTUA 3QIJA 2KC2A 4PK1A 2IO2B 1IBXB 4HJKA 2SAKA 4N59A 2INDC 4GDKA 1SB3C 1V86A 3H1UA 2QSDA 3Q3MC 5EDSA 1YOVB 1ROEA 2M0XA 3KQ4A 1SE4A 1WX7A 3IFWB 3DQVA 2EMTA 2DENB 2RPQA 4WJOA 2W54A 2ZPYA 4WAAA 4MM3A 4MELA 4A6QA 4BOZB 3V3XA 3LYYA 2GLSA 3QHTA 2M0AA 4TQ0A 3ECIA 1WGRA 1HQRD 4DK5A 4N9F4 3PPAA 2O6VD 5DPRA 3PT2B 2JQRB 2RDHA 2J53A 2DNFA 2OOBB 3RPFC 3ALBA 4ANXA 1UD7A 1EM7A 1ZUD2 1F1HA 4IWQA 2KWVB 4MJSB 2WXKA 2DZKA 4TV3A 4B0EA 3DWMA 1MJDA 4LJPB 1FRRA 2MBHA 3DVGX 2ZCCA 4ZRPA 1RAXA 4L2YA 4W9EA 3RMKC 3DHGC 2QC8A 1WE6A 2LXCA 1JWBD 3GB1A 2CHWA 2NCNA 3L0WB 3P2BA 3UINB 3ZJVA 4P1BC 3HRDD 1YQ4B 2KFKA 3Q3OC 3DBSA 2ACZB 4BVUC 5LNK1 1T5XD 3H6NA 4P7IA 4YSZB 1WMHB 2KFJA 2LVQA 4JIOU 1QOGA 1SE9A 3A1QB 3JSVB 1R4MI 3VTWA 5T8IA 4WJNA 3K9OB 2BTEA 3RCZA 2Y5PA 1I35A 3LXFA 5CHFA 2DZIA 3VRBB 3PHWB 1STEA 3PGEA 3GZNI 1R4MB 4P16A 1XLPA 2FUHB 3AU4A 3VR9B 3MC0B 3KUDB 1L6VA 5C3JB 4ZRJA 3SR6A 1DOIA 4XGAB 2AQ1B 5FR3A 2AQ2B 4IW0A 4ACFA 3I63C 2PW9A 1K51A 1L0YB 1FNVA 3X23A 2NR2A 4L23A 3VH4B 1T0YA 1HXYD 3EFCA 5J17A 1C78A 1KLUD 2KTRB 3TEYA 2IGGA 2LGIA 5JXVA 4CQNA 3AULA 2LGSA 4A8XC 2PVGC 1P9DU 3MHZA 2D3AA 3BVZA 2H89B 4LNNA 4N6EB 3Q8AA 4GN1A 3U4EG 2ZNVC 1ET9A 3Q2AC 1V1OA 3BVMA 3KVFB 1Y56A 2PLPA 3AEBB 2BBCA 4GMVA 2N9PC 4EEWA 3H7PB 2KQ4X 2YEPF 3DBLB 2E3TA 3U52E 1ET6A 2N7JA 4IM0A 2W3SA 2HTME 2KX0A 2GRIA 1TT5B 1TYGB 1UGMA 2BB5A 5AZHA 1P3QU 2ZEQA 4GOCA 3UGBB 2RPVA 3HIZA 1ZXHA 2BW2A 2KWCA 2G4SA 5HFYA 2WWZA 2WXIA 3SDLC 2KN4A 4DHJD 3M95A 2LJ5A 1AARA 1V8CA 4MGKE 1WM2A 4BKTA 2N9KA 3KUCB 1JMLA 1RFKA 3FILA 3B0AA 4ZHPA 2PIAA 1ZKHA 4EE2A 1WXMA 3NJTA 2JZ3B 2GBKA 2JPHA 1JWAD 2WDRB 4C4VA 2M1MA 2NPTA 3NG0A 2MBOA 4M0WB 2QILA 2KDIA 2YVCA 1DYQA 3AE2B 1JW9D 2I1KA 3OJ3A 4RGMA 2JRHA 2JZZA 4K81A 3QX1A 1QLBB 3VUWA 1IPGA 2V4LA 4ZDVA 5J2RA 4XYCA 2K0PA 2CJNA 3T3OA 4HEA1 1SJHD 1MHXA 4WQOB 2Y5CA 1T0QC 2GMIC 3AEFB 3KH0A 1GJZA 1AYFA 4I6PA 3RD2A 4NJCA 1V5TA 3V05A 4AQ7A 1N6ZA 2FCMA 1JQ4A 4Q2JA 1TZ1A 1WJUA 1QF6A 1GNUA 4OZCA 3V62A 2HDEA 4W9GA 2WP9B 3IVFA 1TKGA 2VZKD 4HJGE 4WJQA 2KMAA 3TCAA 3TEXA 3CWIA 3TBLD 5DPSA 2WNMA 3W1YA 4M01A 3BINA 3GP7A 3GE8C 2D11A 1WXAA 1LQBA 1XF5L 2G45B 2BYTA 2ZVNA 3EC8A 4BKSD 4HCNB 1F0ZA 4K1RB 1UGJA 3N1ZC 3O13A 3DOWA 2DYOA 4A90A 1WF9A 1WR6E 3N3KB 3R66C 4FHKA 1XLQA 1SGHA 2LFIA 4TUUA 5BYQA 3RNFC 2L83A 2CHXA 3HHMA 3JW0X 1WR1A 4ASWC 1TKYA 5KHOA 2LHEA 4RGOS 3WCQA 3A9KA 4WWMA 2C7MB 2PKOA 1FFVA 1U4AA 4XX5A 1V5OA 1PGXA 2KLCA 2K6DB 3U8ZA 2NVUI 1EF1A 2KT7A 2J4XA 3WAOA 2PE9A 1RLFA 3OWEB 3AE8B 1WJNA 1I4HA 2KHWB 3MFGA 3WAMA 3KWVA 4EUTA 3L4PA 1JRUA 2JXXA 3P42A 2K8BA 1E10A 1TBEA 4NPNA 4XE0A 4LNFA 3QQ8B 4HVBA 4WH4A 2N7DA 4OZAA 4IC7B 1V2YA 2ASQA 2ZJDA 2HTHA 2IO1B 1OQQA 2K8HA 1TGZB 4OZBA 4OHJA 4GSWA 1V6EA 4JWUC 2KLGA 2KMMA 3L13A 3TMPB 1K8RB 5C2TB 2BPSA 3NZSA 3VH3B 4CO7A 1TY2A 2KD0A 2QCZA 5KHQA 1WIAA 1NEKB 1VZ8A 1IYFA 4FLHA 3BVGA 4DHZB 1K53A 4ITKA 1YQ3B 4HKZE 3Q69A 1XCQL 2W82A 3D32A 3WAPA 2MBBB 1C1YB 3Q6BA 4M8MA 3DVNU 2KJRA 1IGCA 1CK1A 3NOBA 2V3SA 1RYJA 4QAYA 3GE3C 2KK8A 3AMZA 1MPEA 3OG5A 5IKCM 3HUIA 4HLEA 2IY0B 3MP9A 2WLBA 5AEKB 3IBEA 1LM8B 4RF0A 5L83A 3AEEB 3P4SB 4LK0M 4IG7B 3SEBA 2LUMA 1WXSA 2ON8A 2YEPB 2RDGA 4ANVA 4DXAB 2ZPNA 2X8XX 5C23A 2VRRB 3RUIB 2A4ZA 3HVZA 4L1BA 3M63B 3VXWA 3CMMB 4NZLB 1R7SA 5E6JA 2B3AA 1J0GA 2K22A 2OEDA 1GG3A 3L16A 2LVPA 1ESFA 4W9CA 2CR5A 1E8YA 2D3GA 4MDKE 2HJ1A 2JU6X 3H8HA 1GB1A 1LFDA 3O65B 4NAMA 2BQQA 1N62A 3ZO5B 3EHVA 3DDCB 3ETRA 1P7FA 4KIKB 1B1ZA 3UIPB 1E8WA 1NDDA 3H9DA 1I4PA 4EZLA 4RGTA 3L17A 4HPMB 3ZJUA 2LZ6A 4KGRA 1WI0A 3SFEB 4M8NA 2L05A 2JYEA 4PYUA 3RNEC 3WA0A 1KLVA 2IGDA 5EE1A 1T0SC 4RF1A 5J18A 1WJ6A 4PS3A 4W9FA 1GB4A 1VLBA 2JUOA 2XNAC 5D3IB 1V9JA 4IKGA 3DBRB 1KFYB 2JY6A 3CSFA 3N1XC 1I4XA 3C0RB 1Z5SB 4E71A 3OLMD 2M8SA 2J52A 3SD5A 2DZJA 2L7RA 4ZRQA 3NVVA 1T6BX 1EO6A 1SE2A 5CHWA 2XN9C 2AWTA 3QJZA 2WXHA 1SF0A 2N9LA 2V3PA 4RNAA 1OQRA 1PDXA 4RGNA 1C77A 1NI3A 4US9A 1C4CA 3RNBC 1CJEA 3WIMA 2BGFA 2DLBA 1UWMA 2FCQA 1E8XA 4YTPB 2NTSA 3GOEA 2N4FA 3DCGA 2V1YA 5IA7A 1E7PB 1SJED 4BKGA 4GDLA 3QC8B 1TY0A 4MACA 2V3NA 2E6XA 1PQSA 3VR8B 3T9LA 3C8YA 2UWQA 5EE3A 3Q8CA 1WFYA 5AZGA 3ABVB 3MHSD 3AECB 1RM6C 2NBUA 4ZRKA 2EELA 1P0RA 3TSSA 1T3QA 4URKA 1EWCA 3FKYA 4MSQB 1F2RC 4K7WA 2WXLA 1GPXA 4NAWB 2BB6A 2NBWB 1RWSA 4ZYSA 1QOFA 4M02A 1JALA 3NY5A 1JCKB 1VR9A 2KN5A 3ZUNA 3DBHI 1NBFC 1WGKA 1F77A 5LLIA 1MG4A 1QOAA 3ZXRA 2LRUA 2XK5A 1OEYA 4PT5A 3CIRB 1V1PB 3T8MA 2ZW1A 1GAQB 2ZNVB 3RT3B 2JRIB 4TQ1A 4FHJA 2JVCA 2MP2A 1P7EA 1OEYJ 2IGHA 2INNE 4F7ZA 1YMHE 2FIFA 4IM3A 2JYTA 2WU5B 1TS2A 2K1FA 2ZVOA 5HG2A 1XXGA 3IAS1 3CSTA 4US8A 5BYSA 4BKSA 3GZNB 1UWXA 2W9NA 2IPKD 4C80A 3V6EB 2W3RA 2OJRA 3BIID 2Z0DB 5D2MB 2J42A 2JXTA 4GLSC 2PJHA 2WDQB 1WSPA 1UELA 3PHXB 3DWGC 2MW5A 5EE9A 4N58A 4MH0E 1AW7A 1Y8RC 4FBJB 3AU5A 4LJOB 4HPPA 2O2VA 1L7YA 4KV2A 4YSXB 1K50A 2ICIA 2JF5A 1BXTA 3B2FA 2LGYA 4J3OD 3PZDA 3R7RA 4I6LB 2K25A 4RMAA 2QIEB 3ML8A 1PGBA 1IBXA 3PLVA 5E6NA 5H8YE 2Z8LA 1HE8A 2QDFA 2IBIB 4HKQA 1L0VB 1ENFA 2AL3A 1WZ0A 2QMTA 2X38A 2WXNA 4A3OA 2MLBA 3VUXA 4YTMB 4II3B 3MC8A 1MVKA 5JH5C 3I57A 3ZNHB 1C9FA 5IOIA 1WXVA 4YL8A 3ZXVA 1J7BA 1FPYA 2LVOA 2Q5WD 4DDGD 3TEZA 1KLGD 4RFBA 2D5GA 2CKHB 1L4DB 4WWOA 1VJKA 4NJ6A 5IN7A 3C19A 4DDID 2FE8A 4NQKE 4AWJA 2BS3B 2LI5A 2DYMA 3KWLA 4GIVA 4C56C 3L10B 2L76A 3PS6A 3KLSX 4C00A 4BOSC 4MJSA 4WWNA 5G5GA 2O6VB 5EE0A 2GBJA 3UI3A 4B0MA 2MJDA 4MGIE 1FNUA 2ONQA 2WXRA 2QJLA 1TIFA 4F1SA 4EFOA 1WGYA 4JX1C 4ICUA 2MCNB 1A5RA 2PVOD 4NY0A 1WYWB 1WYGA 5E6PA 2KDBA 3LDZE 4ANUA 4NNJB 1G6JA 4LDTD 4S0RA 2K39A 2MEKA 3RI7C 2KKCA 2RD0A 3EA6A 1R4NI 1WMHA 1YQBA 3J9CA 2D10A 1Q1OA 1JROA 3LB8C 3A1QA 3JSVA 4KDLB 1KJTA 1D5MC 3GS2A 2IO3B 5C1ZA 4DQOC 2C7NB 2DWQA 2IO0B 4D2KA 1RFAA 1V81A 3ZYYX 2PEAA 3AEAB 1AN8A 2WXOA 1I7HA 2LGDA 2NS5A 4XWWA 3A9JB 4YSYB 4MEMA 3A4RA 1N5WA 2KWDA 5DPTA 4BBNF 1D5ZC 4LNIA 4XC2A 1ZPSA
chains in the Genus database with same CATH topology
1YN3A 2WXGA 2JQRB 2RDHA 1B9RA 2J53A 4ARIA 2NMQA 4KX6B 4RF0A 3RPFC 1N5XA 3PZ7A 3AEEB 3P4SB 2WXJA 4LK0M 3SEBA 2LUMA 1EM7A 1ZUD2 1N60A 1ZOYB 2ON8A 3BWUD 1KTKA 2WXKA 2YEPB 2RDGA 2BS2B 3URYA 2LHDA 5G5HA 1JWSD 1JWUD 4B0EA 3DWMA 1E6EB 3HVZA 1FRRA 4YWGG 4L1BA 5FKAC 5D7GA 4NZLB 3AEGB 4L2YA 4ZRPA 1R7SA 2M56B 5E6JA 1TZOA 1XCTL 1JWBD 1NVID 2K22A 1HZ6A 1L0XB 4XDCA 1FO4A 2OEDA 3GB1A 3AE4B 2CJOA 1ESFA 2OHFA 3ZJVA 2JZPA 1VRAB 3BYYB 3HRDD 2JU6X 4DXGA 3H8HA 3NUHB 1GB1A 1YQ4B 2LJIA 2WXFA 1BMLC 2KAJA 3W5VB 2ACZB 5LNK1 1T5XD 4NAMA 1N62A 4YSZB 1ZE3D 1FIQA 3ETRA 1QOGA 3NS1A 1QOBA 4GDKB 4DXFA 5T8IA 1P7FA 1B1ZA 2KDMA 1XLNA 4MH8A 2BTEA 2Y5PA 1FFUA 1I4PA 1SXTA 2PTLA 3LXFA 4RGTA 3MJ5A 3IT6B 2DBYA 4H2AA 3ZJUA 3PZ8A 1QT9A 1EU4A 4KGRA 3VRBB 1STEA 1QKZA 4P16A 3SFEB 1XLPA 3AE1B 2JYEA 1PUTA 2MH7A 4MM3B 3VR9B 3MC0B 1D5XC 1ZXIA 3PO0A 1L6VA 2K9XA 2IGDA 5C3JB 3SR6A 5EE1A 3SFDB 1DOIA 4RF1A 2JX5A 3MP9A 2AQ1B 5FR3A 1GB4A 2AQ2B 1L6UA 1VLBA 2XNAC 5D3IB 4IKGA 2AX5A 2PW9A 1K51A 4ZHOA 1L0YB 3ZJTA 1J7AA 1FNVA 4M0WA 4A9AA 4O1NA 1N61A 5BMHA 1KFYB 1E9MA 1CQVA 5HI1A 1YN5A 1I4XA 2WS3B 4L23A 1HXYD 1SEBD 2J52A 2CU3A 1C78A 1KLUD 3TEYA 4ZRQA 5D3DA 2IGGA 3NVVA 2LGIA 1V1PA 5JXVA 1T6BX 2V0GA 1SE2A 4CQNA 2XN9C 4A8XC 3BK2A 2PVGC 3NVZA 3FAHA 2WXHA 1SF0A 2N9LA 1EU3A 3P4RB 3MHZA 2INPE 1LO5D 2V3PA 4RNAA 1QQRA 3BVZA 1OQRA 3EUB2 2AQ3B 2H89B 1BUIC 2I38A 4N6EB 1PDXA 3Q8FA 3Q8AA 2V4IB 1C77A 2QEJC 4RGNA 2LMCA 3U4EG 1ET9A 1V1OA 1NI3A 3BVMA 1C4CA 2FUG1 4US9A 1YNTE 1CJEA 1Y56A 2PLPA 2Y3AA 2M19A 3AEBB 2BBCA 2DLBA 1UWMA 4YTPB 2NTSA 2KQ4X 2G9HD 4KGSA 1L5PA 3VRAB 1YJJA 2YEPF 3AE3B 1E7PB 2E3TA 1SJED 4KGTA 4MT5A 3U52E 1ET6A 2N7JA 4WQMA 1TJEA 2W3SA 1TY0A 4MACA 2HTME 2V3NA 2E6XA 2GRIA 2KACA 3E56A 1TYGB 1WXQA 1ACCA 2BB5A 4JE3B 3BZDB 3VR8B 3C8YA 3AN1A 3IAM1 1TS3A 4REZA 3R8BA 4YTNB 5EE3A 3Q8CA 2RPVA 1ZXHA 2BW2A 3ABVB 2GB1A 3AECB 5HFYA 4RCOA 4WIPA 1RM6C 2WXIA 2KN4A 2EELA 1C79A 2IDYA 1YN4A 4JPSA 1V8CA 3TSSA 1T3QA 5BMGA 1A70A 2N9KA 2L1AA 4TSSA 1EWCA 4IOIE 1JMLA 1RFKA 2R61A 3EGRA 5GXGB 3FILA 1F2RC 5AUIA 4ZHPA 2PIAA 2VZKB 2WXLA 2N0SB 4EE2A 3VQIA 1GPXA 1FXAA 5BYRA 2WU2B 4NAWB 2G1EA 2BS4B 5AUKA 2BB6A 1DOXA 1FD6A 1E0ZA 3Q8BA 1RWSA 4ZYSA 1JWAD 1QOFA 1FRDA 5FK9C 1KF6B 2WDRB 2ZW0A 1JALA 1JCKB 1VR9A 3P4QB 2L32A 4IDIA 1HZ5A 1WGKA 1F77A 2QILA 1QOAA 1DOYA 3HVDA 1DYQA 3AE2B 1JW9D 1UNSA 4PT5A 3CIRB 2MJEA 1V1PB 1HEZE 4RGMA 4R3DA 1WRIA 2ZW1A 2WXQA 3P4PB 1GAQB 1Q10A 1I4GA 1ZP0B 1FXIA 3B9JA 1QLBB 3AE6B 4TQ1A 1AWDA 2K0PA 1P7EA 2IGHA 2CJNA 2INNE 3T3OA 4HEA1 1YMHE 1SJHD 1MHXA 2JYTA 4HRSA 2WU5B 1TS2A 2Y5CA 5HG2A 1XXGA 4WURA 3AEFB 3IAS1 1AYFA 2PMVA 2NTTA 1C4AA 4US8A 5BYSA 4NJCA 1TKEA 1UWXA 1VZ6A 1XEEA 3V05A 4AQ7A 1FMAD 4P6VF 2IPKD 1JQ4A 4YXDB 4Q2JA 4C80A 2TSSA 2W3RA 1GOZA 2WDVB 1L4ZB 3BIID 3T3NA 1QF6A 4GDLB 2EKIA 4OZCA 2HDEA 1F2RI 4OW0A 4USAA 2J42A 2JXTA 1C76A 1V97A 4GLSC 1SSNA 2WDQB 1WSPA 2WP9B 3DWGC 5EE9A 4N58A 3NRZA 1M4VA 1AW7A 1KH0A 1WWTA 1TKGA 4KKJA 2VZKD 4HJGE 1UUPA 1IUEA 3NVYA 1QILA 4YSXB 3TEXA 1FM0D 1K50A 2ICIA 3CWIA 2WNMA 1BXTA 3W5UB 3B2FA 2MJ3A 3GP7A 4AS1A 3E9SA 4J3OD 3FILB 1D4BA 1XF5L 4XDDA 2BYTA 2GI9A 3IT4B 3RFZB 1SBBB 1F0ZA 2QIEB 2WQYB 1NENB 1PGBA 5MPOA 1IBXA 1UGJA 3O13A 1TS5A 4WAFA 2DYOA 2RMMA 4A90A 3N9YC 1K52A 5H8YE 2Z8LA 3W9CB 3TUOA 4HKQA 5H92C 1L0VB 1ENFA 1MHHE 3U2SC 1XLQA 3AH7A 3NZ3A 3TEWA 4JWSC 1EWYC 3R2IA 2LFIA 1MI0A 2QMTA 2WXPA 5BYQA 2X38A 2WXNA 3P63A 2L83A 2H88B 1TKYA 4YTMB 3AV8A 1MVKA 1JWMD 3I57A 2LHEA 4RH6A 4RGOS 3WCQA 1C9FA 4WWMA 4A55A 2FBWB 2PKOA 4C7ZA 2WXMA 1SIJA 1FCCC 1J7BA 3FC4A 4FXCA 1FFVA 4KKIA 1PGAA 2Q5WD 3W1SA 3TEZA 1KLGD 2JWUA 1CZPA 3BYTB 4RFBA 2D5GA 1PGXA 2I2YA 1L4DB 1XO3A 1VJKA 1DGJA 4ARCA 2J4XA 3AEDB 3OWEB 3IXSA 2FE8A 3AE8B 1IGDA 3W2DA 1I4HA 2BS3B 2K5PA 3MFGA 2DYMA 4HROA 3KWLA 3KWVA 1I4QA 3I9V1 1TS4A 3L4PA 3P42A 4C56C 4LLGM 3KLSX 5I4DA 1E10A 3NVWA 2K3UA 1VZ7A 4XE0A 1FCLA 4YT0B 1KRHA 1ZDVA 5G5GA 5TSSA 2L52A 4WH4A 4ZOHC 1ZDXA 2JSVX 5EE0A 3UI3A 1XLOA 2MJDA 4OZAA 4B0MA 1FNUA 2ONQA 3AE7B 2WXRA 3AE5B 1OQQA 1N63A 4TMAB 2QJLA 2W55A 3ZQ4A 1OFFA 4OZBA 4UDUC 3ZGZA 1NYRA 4JX1C 4OHJA 4OVZA 2PVOD 3U7ZA 4JWUC 1PFDA 1WYGA 3P1MA 2KMMA 2SEBD 3AB5A 5C2TB 3Q8EA 2B76B 2MEKA 1TY2A 3B2GA 4LTUA 3EA6A 3AE9B 1FNWA 2IJ0A 2LEKA 3J9CA 1J7CA 1NEKB 1VZ8A 1IBXB 1JROA 1YJIA 3LB8C 4C7YA 3R2TA 2SAKA 4N59A 3BVGA 1K53A 1NYQA 4ITKA 1YQ3B 4HKZE 3Q69A 1SB3C 1HA5A 1XCQL 2QSDA 1D5MC 2W82A 1C4PA 3GS2A 1I4RA 1PYWD 1ROEA 4DQOC 2DWQA 3KQ4A 3AM9A 1SE4A 4D2KA 3ZYYX 3AEAB 5HHDG 1AN8A 2W54A 2WLBA 2WXOA 1I7HA 1IGCA 3BK1A 1CK1A 4XWWA 4A6QA 4YSYB 1VDVA 4XWTA 3V3XA 1RYJA 3LYYA 1D6EC 1N5WA 2M0AA 2KWDA 4TQ0A 2BT6A 5BMIA 3AMZA 1FEHA 1MPEA 1SE3A 1D5ZC 3HUIA 1HQRD 1JRPA 1ZPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 B;  1FXI A;  3B9J A;  3NVV A;  1QLB B;  1CZP A;  2JQR B;  1B9R A;  3AE6 B;  4KX6 B;  1XO3 A;  1AWD A;  1VJK A;  1DGJ A;  1N5X A;  2PVG C;  3AEE B;  3FAH A;  3NVZ A;  3P4S B;  3RPF C;  2CJN A;  1SF0 A;  3AED B;  3P4R B;  1ZUD 2;  3AE8 B;  1N60 A;  4HRS A;  2WU5 B;  1ZOY B;  2Y5C A;  1OQR A;  3EUB 2;  2BS3 B;  2H89 B;  2K5P A;  3AEF B;  2BS2 B;  4HRO A;  1AYF A;  3KWL A;  4N6E B;  1PDX A;  5G5H A;  3DWM A;  3L4P A;  1E6E B;  4US8 A;  3HVZ A;  1FRR A;  1TKE A;  1NI3 A;  4US9 A;  1FMA D;  4P6V F;  3NVW A;  1E10 A;  1JQ4 A;  1CJE A;  4YXD B;  3AEG B;  1KRH A;  4YT0 B;  5G5G A;  2M19 A;  2L52 A;  1R7S A;  2M56 B;  3AEB B;  2W3R A;  4C80 A;  1UWM A;  1JWB D;  4ZOH C;  2WDV B;  1NVI D;  4YTP B;  5EE0 A;  1XLO A;  2K22 A;  2MJD A;  3BII D;  1FO4 A;  1QF6 A;  2EKI A;  3AE4 B;  2CJO A;  2OHF A;  1L5P A;  4USA A;  3VRA B;  1YJJ A;  3AE7 B;  3AE5 B;  1V97 A;  3AE3 B;  1OQQ A;  1E7P B;  1N63 A;  2E3T A;  2WDQ B;  2QJL A;  2W55 A;  1OFF A;  1TJE A;  2W3S A;  4WQM A;  2WP9 B;  2HTM E;  3HRD D;  3DWG C;  1NYR A;  4JX1 C;  1TYG B;  1YQ4 B;  1WXQ A;  3NRZ A;  4N58 A;  5EE9 A;  2PVO D;  3VR8 B;  4JWU C;  2KAJ A;  3W5V B;  2ACZ B;  1WWT A;  1PFD A;  1TKG A;  1WYG A;  3AN1 A;  3P1M A;  2KMM A;  1N62 A;  4YTN B;  5EE3 A;  3AB5 A;  5C2T B;  4YSZ B;  2B76 B;  1IUE A;  3ABV B;  3NVY A;  3B2G A;  3AEC B;  1FIQ A;  4YSX B;  3P4P B;  3ETR A;  1FM0 D;  1QOG A;  1RM6 C;  3CWI A;  3NS1 A;  4LTU A;  3AE9 B;  1QOB A;  3W5U B;  2LEK A;  3B2F A;  2MJ3 A;  1J7C A;  1NEK B;  1JRO A;  1XLN A;  1V8C A;  1T3Q A;  1YJI A;  3LB8 C;  1A70 A;  4C7Y A;  4N59 A;  1NYQ A;  4ITK A;  1FFU A;  1RFK A;  1YQ3 B;  3LXF A;  1F0Z A;  2QIE B;  1SB3 C;  2WQY B;  1NEN B;  5MPO A;  5GXG B;  5AUI A;  2DBY A;  4ZHP A;  2PIA A;  2N0S B;  1QT9 A;  1GPX A;  1FXA A;  1ROE A;  3VRB B;  5H8Y E;  2WU2 B;  2G1E A;  2BS4 B;  5AUK A;  3W9C B;  1DOX A;  2DWQ A;  5H92 C;  3SFE B;  1L0V B;  3AM9 A;  1RWS A;  1XLP A;  3AE1 B;  1E0Z A;  1PUT A;  1JWA D;  1QOF A;  1XLQ A;  2MH7 A;  3AH7 A;  3VR9 B;  1FRD A;  1EWY C;  4JWS C;  1KF6 B;  1ZXI A;  2WDR B;  3PO0 A;  3ZYY X;  1L6V A;  2K9X A;  3AEA B;  1JAL A;  5C3J B;  3SR6 A;  5EE1 A;  3SFD B;  1DOI A;  3P4Q B;  2W54 A;  3P63 A;  2JX5 A;  2WLB A;  1I7H A;  2L83 A;  4IDI A;  2H88 B;  1WGK A;  1L6U A;  1VLB A;  1TKY A;  4YTM B;  1QOA A;  1DOY A;  4YSY B;  1VDV A;  2AX5 A;  3AV8 A;  4ZHO A;  1J7A A;  1RYJ A;  3AE2 B;  1JW9 D;  1N5W A;  4A9A A;  3WCQ A;  3CIR B;  1N61 A;  2MJE A;  1KFY B;  1E9M A;  2BT6 A;  2FBW B;  4WWM A;  2PKO A;  3AMZ A;  4C7Z A;  2WS3 B;  1SIJ A;  3FC4 A;  1J7B A;  4FXC A;  3HUI A;  1FFV A;  1WRI A;  1JRP A;  2Q5W D;  1GAQ B;  2CU3 A; 
#chains in the Genus database with same CATH topology
 1YN3 A;  3ZLZ A;  3ENE A;  4ARI A;  2KTR A;  1N60 A;  1OTR B;  3RN9 C;  2UU7 A;  1KTK A;  2MWS B;  2BS2 B;  3URY A;  2LHD A;  2BKR B;  1E6E B;  3S2A A;  1I42 A;  5FKA C;  2KQS A;  5D7G A;  1F52 A;  3HM3 A;  1TZO A;  1XCT L;  4XDC A;  1FO4 A;  4I6N B;  1UH6 A;  2CJO A;  3AE4 B;  2MQJ A;  4GGQ A;  3ZIM A;  2DYB A;  3H7P A;  2JZP A;  3BYY B;  4DXG A;  3NUH B;  2LJI A;  1BML C;  3RZF A;  2KAJ A;  3UF8 A;  3W5V B;  4HCP B;  4S17 A;  2N9X A;  4W9D A;  2KVZ A;  2BF8 B;  3NS1 A;  5IAA C;  2N7E A;  4GDK B;  4DXF A;  4EZK A;  4W9H A;  2KDM A;  5FR6 A;  1GC7 A;  2BVC A;  4W9K A;  1E7U A;  1ZW7 A;  2DZM A;  1YX5 B;  3IT6 B;  2DBY A;  4H2A A;  1H8C A;  3PZ8 A;  1L2N A;  1S1Q B;  3ML9 A;  3HK0 A;  3PV1 A;  3AE1 B;  2ZCB A;  2MH7 A;  4MM3 B;  3V60 A;  3RZW C;  4B6W A;  3SFD B;  1QZE A;  2PE6 B;  2AX5 A;  4ZHO A;  1WY8 A;  1WH3 A;  4M0W A;  4O1N A;  1N61 A;  5JZE B;  3UQB A;  1E9M A;  3UQA A;  2WS3 B;  3EFU A;  2MHJ A;  1SEB D;  3UIO B;  2CU3 A;  4G0N B;  3IG3 A;  3BK2 A;  4K3B A;  4DHZ E;  3VHT C;  4AOF A;  3PLU A;  1EU3 A;  2CU1 A;  2INP E;  1QQR A;  2HD5 B;  1VCB A;  3HM6 X;  3BY4 B;  4ZRI A;  2QEJ C;  4GXB A;  2KXJ A;  4CHK A;  2GBR A;  1YNT E;  2FCN A;  2LUE A;  4ZYN A;  4X57 B;  4FJZ A;  2KNB A;  4MSM B;  2G9H D;  1L5P A;  2IZV B;  1YJJ A;  2KFK B;  1WX8 A;  1TJE A;  2L0T A;  4WQM A;  2KMC A;  3E56 A;  4AP4 C;  1C3T A;  1WXQ A;  1ACC A;  3BZD B;  3JVZ X;  3IAM 1;  1TS3 A;  3R8B A;  2WX1 A;  2WYQ A;  3Q3J A;  2GB1 A;  4RCO A;  4WIP A;  3VTV A;  4FA6 A;  1WE7 A;  4FUL A;  1YN4 A;  4JPS A;  5BMG A;  3VAW A;  1WZ3 A;  2NBV B;  1S3S G;  3EGR A;  2G3Q B;  1J8C A;  5AUI A;  2VZK B;  2N0S B;  3VQI A;  1UBQ A;  1FXA A;  4WJP A;  3ZVV A;  3K9P B;  5BYR A;  2G1E A;  3OJ4 B;  5AUK A;  1DOX A;  2MSE D;  3Q8B A;  4G11 A;  4EZJ A;  3Q3N C;  3TJP A;  5FK9 C;  1KOT A;  2RR9 A;  1KM7 A;  4KDI C;  2MRP A;  2IYD B;  2L32 A;  1HZ5 A;  3VTU A;  1DOY A;  5BO4 B;  3KYC D;  3DHI C;  1HTQ A;  5E6O A;  1HEZ E;  2M17 A;  3KW5 B;  4PYZ A;  3X0W A;  4R3D A;  3P4P B;  1Q10 A;  1I4G A;  3VUY A;  4EOY A;  1BT0 A;  4A20 A;  4IWP A;  1AWD A;  4OVU A;  4WUR A;  2PMV A;  4XZ4 A;  1C4A A;  2K6Q A;  1VZ6 A;  1XEE A;  1FMA D;  4HDO A;  2XBB C;  3B1L X;  3WAN A;  2TSS A;  3ZTC A;  2KX3 A;  2LRW A;  2KDE B;  1L4Z B;  3T3N A;  2HE7 A;  1F2R I;  3ZW3 A;  4OW0 A;  2LXA A;  2WHI A;  1C76 A;  1V97 A;  4RM9 A;  1WGG A;  3V61 A;  4TKN A;  2LWP A;  1E90 A;  2FAZ A;  2HJ8 A;  2KO3 A;  2JWZ A;  1E7V A;  4G50 A;  4HWI B;  1IUE A;  2BWF A;  2GBN A;  1FM0 D;  2WGS A;  3PRP B;  5TR5 A;  1V80 A;  1WGD A;  3W5U B;  2MJ3 A;  5D6J B;  4AS1 A;  3FIL B;  1D4B A;  3KUZ A;  4XDD A;  2GI9 A;  3IT4 B;  1SBB B;  3AXC A;  2WQY B;  5MPO A;  2L0F A;  1TS5 A;  3ZNI D;  3CF6 E;  3N9Y C;  2DAF A;  4C4V B;  2NPT B;  2WX0 A;  3W9C B;  5H92 C;  5D94 A;  3SHQ A;  1MHH E;  3R7Q A;  2LAS A;  3AH7 A;  3NZ3 A;  3ZNZ B;  1EWY C;  2D3C A;  2MX2 A;  2L00 B;  4F8C B;  1MI0 A;  3ZRF A;  4RM8 A;  4JQW C;  3P63 A;  1WX9 A;  3KYD D;  3DVG Y;  5G55 A;  1XT9 B;  5CHV C;  4IWO A;  3AV8 A;  1JWM D;  1D3Z A;  1Z2M A;  4A55 A;  2FBW B;  4FJV B;  1FCC C;  4HK2 A;  1XQQ A;  3QAQ A;  4KKI A;  4AJY B;  3W1S A;  4FAD A;  2JWU A;  1CZP A;  3BYT B;  2I2Y A;  1DGJ A;  4JGH B;  3AED B;  4OVV A;  2EKE C;  1IGD A;  2CS4 A;  2MA9 B;  5G2N A;  4LLG M;  5I4D A;  1VZ7 A;  1YX6 B;  4ZOH C;  2JSV X;  3DBH B;  3QA8 A;  2N9E B;  2BYF A;  1EF5 A;  3AE7 B;  4KSK C;  3MTN B;  1N63 A;  2BYE A;  5LXI B;  4BZA A;  3M62 B;  3PTF C;  4UDU C;  2R2O A;  3WAL A;  4OVZ A;  3U7Z A;  3ONS A;  4BBN C;  4BFR A;  4DWF A;  3AB5 A;  3Q8E A;  2B76 B;  3RUL A;  2D2Q A;  3M3J A;  5GMV A;  3B2G A;  3PRZ A;  1WRD B;  3AE9 B;  1FNW A;  2IJ0 A;  2LEK A;  1J7C A;  2UYZ B;  4HDQ A;  2J0M A;  1YJI A;  4KVG B;  4C7Y A;  3R2T A;  3A4S C;  4IUM B;  5LXH A;  1NYQ A;  4KZC A;  1HA5 A;  4HPL B;  4KIK A;  5JHB A;  1C4P A;  1I4R A;  3RNG C;  3L54 A;  1PYW D;  3TL5 A;  3APD A;  5AZF A;  4P1C C;  3AM9 A;  4LNO A;  4LCD E;  1M94 A;  3JYU A;  5HHD G;  2N1V A;  2OJW A;  3N32 A;  4W9J A;  2I1J A;  3BK1 A;  3RNC C;  3A9K B;  2INC C;  1ISN A;  2LD9 A;  4M00 A;  3DBL I;  1VDV A;  4XWT A;  1D6E C;  2BT6 A;  3APF A;  5BMI A;  1FEH A;  1SE3 A;  1JRP A;  5L95 C;  2WXG A;  2IY1 B;  1B9R A;  2NMQ A;  4KX6 B;  1N5X A;  2AYO B;  3PZ7 A;  2J0K A;  4E74 A;  3VVW B;  2WXJ A;  1UBI A;  2RGF A;  1ZOY B;  3MC9 A;  3BWU D;  5G5H A;  1JWS D;  1JWU D;  3QCA A;  4AUQ C;  4YWG G;  4EKU A;  5CTR C;  3AEG B;  2M56 B;  1NVI D;  1HZ6 A;  1L0X B;  2RSU A;  2OHF A;  4PS8 A;  2N1W A;  2KC1 A;  2Z59 B;  3Q3F A;  2C60 A;  4FJY A;  1VRA B;  1ZGU B;  2WXF A;  2A5U A;  3ZDM C;  3R3M A;  1ZE3 D;  2KYW A;  2GBM A;  3RYT A;  1FIQ A;  1QOB A;  4ANW A;  1XLN A;  4MH8 A;  2GOW A;  1YD8 U;  2KTF A;  2VH2 A;  3EEC A;  4K7U A;  4W9I A;  1FFU A;  1SXT A;  2PTL A;  3DVN V;  3MJ5 A;  1QT9 A;  1EU4 A;  3N1Y C;  2KJ6 A;  1QKZ A;  3QAR A;  1J19 A;  1PUT A;  2JT4 B;  1D5X C;  1ZXI A;  3PO0 A;  2K9X A;  4NAW A;  3VFK A;  1OQY A;  1MFW A;  2JX5 A;  2Z0E B;  1L6U A;  2WDT B;  3ZJT A;  3DHH C;  1J7A A;  4A9A A;  5BMH A;  1CQV A;  5HI1 A;  1YN5 A;  2D07 B;  3ZRC A;  3ZTD A;  1R4N B;  4DBG A;  5D3D A;  1V1P A;  2V0G A;  4CYE A;  5JHA A;  4A3P A;  3NVZ A;  2BWE S;  3FAH A;  3P4R B;  1LO5 D;  3EUB 2;  2AQ3 B;  2K8C A;  4PS7 A;  1BUI C;  2I38 A;  3Q8F A;  2V4I B;  2XEW A;  2DX5 B;  2LMC A;  2FUG 1;  2QHO A;  2EMS A;  2YLM A;  2Y3A A;  1UF0 A;  1LGR A;  2ZZP B;  2M19 A;  5DCN A;  2M4N A;  3TIX A;  3ZDT A;  2RDB C;  2G4D B;  1IP9 A;  4KGS A;  3VRA B;  4FN2 A;  1WM3 A;  4K7S A;  3AE3 B;  4MT5 A;  4KGT A;  2KAC A;  3VDZ A;  4JE3 B;  2FID A;  3AN1 A;  1YIW A;  4REZ A;  3N20 C;  4YTN B;  4ICV A;  1MG8 A;  2V9H A;  2BYV E;  2PPH A;  1H4R A;  1C79 A;  1CMX B;  2IDY A;  1A70 A;  2L1A A;  4TSS A;  4IOI E;  2R61 A;  3AI5 A;  1X1M A;  1GUA B;  5GXG B;  2WU2 B;  2BS4 B;  1FD6 A;  1LXD A;  1E0Z A;  2C5L C;  1Q5W B;  1FRD A;  1KF6 B;  3PRM B;  2DAJ A;  2ZW0 A;  2FCS A;  1YJ1 A;  3ZNG C;  2L8J A;  3P4Q B;  1Q0W B;  3V6C B;  4IDI A;  4MGZ E;  3HVD A;  1SIF A;  1UNS A;  5CX3 A;  2MJE A;  2KAN A;  1WRI A;  2WXQ A;  2KJH B;  1ZP0 B;  1FXI A;  3B9J A;  4DHJ B;  3AE6 B;  2FNJ B;  4HXD A;  3U7D A;  4HRS A;  3LJ3 A;  2KWU B;  2D3B A;  2NTT A;  3PSE B;  2REX A;  4E3C A;  1TKE A;  3SU8 X;  4P6V F;  3U30 A;  3OAW A;  4YXD B;  3APC A;  2MBE A;  1UZX B;  2KDF B;  1GOZ A;  2WDV B;  2VH1 A;  4GDL B;  2EKI A;  1P98 A;  4USA A;  5HKH A;  2O6V A;  1XD3 B;  4B9K A;  4II2 B;  1SSN A;  3A33 B;  1WJ4 A;  3B08 A;  3NRZ A;  1M4V A;  1P1A A;  4LNK A;  4G3X B;  1KH0 A;  1EUV B;  1WWT A;  4KKJ A;  3I5J C;  1UUP A;  3NVY A;  4J6I A;  2MBQ A;  1QIL A;  4WWP A;  4B95 A;  3QWZ B;  4KZ0 A;  5DPW A;  1T0R C;  3E9S A;  1TTN A;  3PVL A;  4GU2 A;  2CHZ A;  1HTO A;  1OGW A;  1WGH A;  4GB9 A;  2KOX A;  3RFZ B;  4NQL B;  1NEN B;  2KVR A;  3L08 A;  4WAF A;  2RMM A;  1K52 A;  4LDT B;  2L3Z A;  3TUO A;  3U2S C;  1FXT B;  2DHZ A;  3TEW A;  4JWS C;  3R2I A;  2C9W B;  3N30 A;  4BAX A;  2WXP A;  2XK5 B;  2Y5B B;  4IM2 A;  2KQ7 A;  2H88 B;  1NI2 A;  3I3T B;  4RH6 A;  3ZKJ C;  3DPD A;  4C7Z A;  2WXM A;  1SIJ A;  3A9J A;  3FC4 A;  4FXC A;  1E5W A;  2MP2 B;  3IHP C;  1PGA A;  1F9J A;  1XO3 A;  2KZR A;  4ARC A;  2AL6 A;  2R2Q A;  3IXS A;  3PRE A;  3W1S C;  3W2D A;  3NS8 A;  4NJ7 A;  2K5P A;  2BKF A;  1GC6 A;  4HRO A;  1I4Q A;  3I9V 1;  1TS4 A;  3RNA C;  1E8Z A;  3NVW A;  2K3U A;  2AEH A;  1VD2 A;  2C7H A;  4YT0 B;  1KRH A;  1ZDV A;  3H7S A;  5TSS A;  1FCL A;  2L52 A;  4JL9 A;  4KSL C;  5IP4 D;  1ZDX A;  1XLO A;  4W9L A;  4K3C A;  1RRB A;  3MJW A;  2J0J A;  3AE5 B;  4MGY E;  4TMA B;  4AJW A;  3ZQ4 A;  2W55 A;  3NZU A;  1OFF A;  3ZGZ A;  1NYR A;  5IO9 A;  4JLC A;  2O2V B;  1V49 A;  2LGX A;  1PFD A;  3P1M A;  2SEB D;  3DBR I;  2J7Q B;  3QK0 A;  3Q14 C;  3NHE B;  4LTU A;  3QIJ A;  2KC2 A;  4PK1 A;  2IO2 B;  1IBX B;  4HJK A;  2SAK A;  4N59 A;  2IND C;  4GDK A;  1SB3 C;  1V86 A;  3H1U A;  2QSD A;  3Q3M C;  5EDS A;  1YOV B;  1ROE A;  2M0X A;  3KQ4 A;  1SE4 A;  1WX7 A;  3IFW B;  3DQV A;  2EMT A;  2DEN B;  2RPQ A;  4WJO A;  2W54 A;  2ZPY A;  4WAA A;  4MM3 A;  4MEL A;  4A6Q A;  4BOZ B;  3V3X A;  3LYY A;  2GLS A;  3QHT A;  2M0A A;  4TQ0 A;  3ECI A;  1WGR A;  1HQR D;  4DK5 A;  4N9F 4;  3PPA A;  2O6V D;  5DPR A;  3PT2 B;  2JQR B;  2RDH A;  2J53 A;  2DNF A;  2OOB B;  3RPF C;  3ALB A;  4ANX A;  1UD7 A;  1EM7 A;  1ZUD 2;  1F1H A;  4IWQ A;  2KWV B;  4MJS B;  2WXK A;  2DZK A;  4TV3 A;  4B0E A;  3DWM A;  1MJD A;  4LJP B;  1FRR A;  2MBH A;  3DVG X;  2ZCC A;  4ZRP A;  1RAX A;  4L2Y A;  4W9E A;  3RMK C;  3DHG C;  2QC8 A;  1WE6 A;  2LXC A;  1JWB D;  3GB1 A;  2CHW A;  2NCN A;  3L0W B;  3P2B A;  3UIN B;  3ZJV A;  4P1B C;  3HRD D;  1YQ4 B;  2KFK A;  3Q3O C;  3DBS A;  2ACZ B;  4BVU C;  5LNK 1;  1T5X D;  3H6N A;  4P7I A;  4YSZ B;  1WMH B;  2KFJ A;  2LVQ A;  4JIO U;  1QOG A;  1SE9 A;  3A1Q B;  3JSV B;  1R4M I;  3VTW A;  5T8I A;  4WJN A;  3K9O B;  2BTE A;  3RCZ A;  2Y5P A;  1I35 A;  3LXF A;  5CHF A;  2DZI A;  3VRB B;  3PHW B;  1STE A;  3PGE A;  3GZN I;  1R4M B;  4P16 A;  1XLP A;  2FUH B;  3AU4 A;  3VR9 B;  3MC0 B;  3KUD B;  1L6V A;  5C3J B;  4ZRJ A;  3SR6 A;  1DOI A;  4XGA B;  2AQ1 B;  5FR3 A;  2AQ2 B;  4IW0 A;  4ACF A;  3I63 C;  2PW9 A;  1K51 A;  1L0Y B;  1FNV A;  3X23 A;  2NR2 A;  4L23 A;  3VH4 B;  1T0Y A;  1HXY D;  3EFC A;  5J17 A;  1C78 A;  1KLU D;  2KTR B;  3TEY A;  2IGG A;  2LGI A;  5JXV A;  4CQN A;  3AUL A;  2LGS A;  4A8X C;  2PVG C;  1P9D U;  3MHZ A;  2D3A A;  3BVZ A;  2H89 B;  4LNN A;  4N6E B;  3Q8A A;  4GN1 A;  3U4E G;  2ZNV C;  1ET9 A;  3Q2A C;  1V1O A;  3BVM A;  3KVF B;  1Y56 A;  2PLP A;  3AEB B;  2BBC A;  4GMV A;  2N9P C;  4EEW A;  3H7P B;  2KQ4 X;  2YEP F;  3DBL B;  2E3T A;  3U52 E;  1ET6 A;  2N7J A;  4IM0 A;  2W3S A;  2HTM E;  2KX0 A;  2GRI A;  1TT5 B;  1TYG B;  1UGM A;  2BB5 A;  5AZH A;  1P3Q U;  2ZEQ A;  4GOC A;  3UGB B;  2RPV A;  3HIZ A;  1ZXH A;  2BW2 A;  2KWC A;  2G4S A;  5HFY A;  2WWZ A;  2WXI A;  3SDL C;  2KN4 A;  4DHJ D;  3M95 A;  2LJ5 A;  1AAR A;  1V8C A;  4MGK E;  1WM2 A;  4BKT A;  2N9K A;  3KUC B;  1JML A;  1RFK A;  3FIL A;  3B0A A;  4ZHP A;  2PIA A;  1ZKH A;  4EE2 A;  1WXM A;  3NJT A;  2JZ3 B;  2GBK A;  2JPH A;  1JWA D;  2WDR B;  4C4V A;  2M1M A;  2NPT A;  3NG0 A;  2MBO A;  4M0W B;  2QIL A;  2KDI A;  2YVC A;  1DYQ A;  3AE2 B;  1JW9 D;  2I1K A;  3OJ3 A;  4RGM A;  2JRH A;  2JZZ A;  4K81 A;  3QX1 A;  1QLB B;  3VUW A;  1IPG A;  2V4L A;  4ZDV A;  5J2R A;  4XYC A;  2K0P A;  2CJN A;  3T3O A;  4HEA 1;  1SJH D;  1MHX A;  4WQO B;  2Y5C A;  1T0Q C;  2GMI C;  3AEF B;  3KH0 A;  1GJZ A;  1AYF A;  4I6P A;  3RD2 A;  4NJC A;  1V5T A;  3V05 A;  4AQ7 A;  1N6Z A;  2FCM A;  1JQ4 A;  4Q2J A;  1TZ1 A;  1WJU A;  1QF6 A;  1GNU A;  4OZC A;  3V62 A;  2HDE A;  4W9G A;  2WP9 B;  3IVF A;  1TKG A;  2VZK D;  4HJG E;  4WJQ A;  2KMA A;  3TCA A;  3TEX A;  3CWI A;  3TBL D;  5DPS A;  2WNM A;  3W1Y A;  4M01 A;  3BIN A;  3GP7 A;  3GE8 C;  2D11 A;  1WXA A;  1LQB A;  1XF5 L;  2G45 B;  2BYT A;  2ZVN A;  3EC8 A;  4BKS D;  4HCN B;  1F0Z A;  4K1R B;  1UGJ A;  3N1Z C;  3O13 A;  3DOW A;  2DYO A;  4A90 A;  1WF9 A;  1WR6 E;  3N3K B;  3R66 C;  4FHK A;  1XLQ A;  1SGH A;  2LFI A;  4TUU A;  5BYQ A;  3RNF C;  2L83 A;  2CHX A;  3HHM A;  3JW0 X;  1WR1 A;  4ASW C;  1TKY A;  5KHO A;  2LHE A;  4RGO S;  3WCQ A;  3A9K A;  4WWM A;  2C7M B;  2PKO A;  1FFV A;  1U4A A;  4XX5 A;  1V5O A;  1PGX A;  2KLC A;  2K6D B;  3U8Z A;  2NVU I;  1EF1 A;  2KT7 A;  2J4X A;  3WAO A;  2PE9 A;  1RLF A;  3OWE B;  3AE8 B;  1WJN A;  1I4H A;  2KHW B;  3MFG A;  3WAM A;  3KWV A;  4EUT A;  3L4P A;  1JRU A;  2JXX A;  3P42 A;  2K8B A;  1E10 A;  1TBE A;  4NPN A;  4XE0 A;  4LNF A;  3QQ8 B;  4HVB A;  4WH4 A;  2N7D A;  4OZA A;  4IC7 B;  1V2Y A;  2ASQ A;  2ZJD A;  2HTH A;  2IO1 B;  1OQQ A;  2K8H A;  1TGZ B;  4OZB A;  4OHJ A;  4GSW A;  1V6E A;  4JWU C;  2KLG A;  2KMM A;  3L13 A;  3TMP B;  1K8R B;  5C2T B;  2BPS A;  3NZS A;  3VH3 B;  4CO7 A;  1TY2 A;  2KD0 A;  2QCZ A;  5KHQ A;  1WIA A;  1NEK B;  1VZ8 A;  1IYF A;  4FLH A;  3BVG A;  4DHZ B;  1K53 A;  4ITK A;  1YQ3 B;  4HKZ E;  3Q69 A;  1XCQ L;  2W82 A;  3D32 A;  3WAP A;  2MBB B;  1C1Y B;  3Q6B A;  4M8M A;  3DVN U;  2KJR A;  1IGC A;  1CK1 A;  3NOB A;  2V3S A;  1RYJ A;  4QAY A;  3GE3 C;  2KK8 A;  3AMZ A;  1MPE A;  3OG5 A;  5IKC M;  3HUI A;  4HLE A;  2IY0 B;  3MP9 A;  2WLB A;  5AEK B;  3IBE A;  1LM8 B;  4RF0 A;  5L83 A;  3AEE B;  3P4S B;  4LK0 M;  4IG7 B;  3SEB A;  2LUM A;  1WXS A;  2ON8 A;  2YEP B;  2RDG A;  4ANV A;  4DXA B;  2ZPN A;  2X8X X;  5C23 A;  2VRR B;  3RUI B;  2A4Z A;  3HVZ A;  4L1B A;  3M63 B;  3VXW A;  3CMM B;  4NZL B;  1R7S A;  5E6J A;  2B3A A;  1J0G A;  2K22 A;  2OED A;  1GG3 A;  3L16 A;  2LVP A;  1ESF A;  4W9C A;  2CR5 A;  1E8Y A;  2D3G A;  4MDK E;  2HJ1 A;  2JU6 X;  3H8H A;  1GB1 A;  1LFD A;  3O65 B;  4NAM A;  2BQQ A;  1N62 A;  3ZO5 B;  3EHV A;  3DDC B;  3ETR A;  1P7F A;  4KIK B;  1B1Z A;  3UIP B;  1E8W A;  1NDD A;  3H9D A;  1I4P A;  4EZL A;  4RGT A;  3L17 A;  4HPM B;  3ZJU A;  2LZ6 A;  4KGR A;  1WI0 A;  3SFE B;  4M8N A;  2L05 A;  2JYE A;  4PYU A;  3RNE C;  3WA0 A;  1KLV A;  2IGD A;  5EE1 A;  1T0S C;  4RF1 A;  5J18 A;  1WJ6 A;  4PS3 A;  4W9F A;  1GB4 A;  1VLB A;  2JUO A;  2XNA C;  5D3I B;  1V9J A;  4IKG A;  3DBR B;  1KFY B;  2JY6 A;  3CSF A;  3N1X C;  1I4X A;  3C0R B;  1Z5S B;  4E71 A;  3OLM D;  2M8S A;  2J52 A;  3SD5 A;  2DZJ A;  2L7R A;  4ZRQ A;  3NVV A;  1T6B X;  1EO6 A;  1SE2 A;  5CHW A;  2XN9 C;  2AWT A;  3QJZ A;  2WXH A;  1SF0 A;  2N9L A;  2V3P A;  4RNA A;  1OQR A;  1PDX A;  4RGN A;  1C77 A;  1NI3 A;  4US9 A;  1C4C A;  3RNB C;  1CJE A;  3WIM A;  2BGF A;  2DLB A;  1UWM A;  2FCQ A;  1E8X A;  4YTP B;  2NTS A;  3GOE A;  2N4F A;  3DCG A;  2V1Y A;  5IA7 A;  1E7P B;  1SJE D;  4BKG A;  4GDL A;  3QC8 B;  1TY0 A;  4MAC A;  2V3N A;  2E6X A;  1PQS A;  3VR8 B;  3T9L A;  3C8Y A;  2UWQ A;  5EE3 A;  3Q8C A;  1WFY A;  5AZG A;  3ABV B;  3MHS D;  3AEC B;  1RM6 C;  2NBU A;  4ZRK A;  2EEL A;  1P0R A;  3TSS A;  1T3Q A;  4URK A;  1EWC A;  3FKY A;  4MSQ B;  1F2R C;  4K7W A;  2WXL A;  1GPX A;  4NAW B;  2BB6 A;  2NBW B;  1RWS A;  4ZYS A;  1QOF A;  4M02 A;  1JAL A;  3NY5 A;  1JCK B;  1VR9 A;  2KN5 A;  3ZUN A;  3DBH I;  1NBF C;  1WGK A;  1F77 A;  5LLI A;  1MG4 A;  1QOA A;  3ZXR A;  2LRU A;  2XK5 A;  1OEY A;  4PT5 A;  3CIR B;  1V1P B;  3T8M A;  2ZW1 A;  1GAQ B;  2ZNV B;  3RT3 B;  2JRI B;  4TQ1 A;  4FHJ A;  2JVC A;  2MP2 A;  1P7E A;  1OEY J;  2IGH A;  2INN E;  4F7Z A;  1YMH E;  2FIF A;  4IM3 A;  2JYT A;  2WU5 B;  1TS2 A;  2K1F A;  2ZVO A;  5HG2 A;  1XXG A;  3IAS 1;  3CST A;  4US8 A;  5BYS A;  4BKS A;  3GZN B;  1UWX A;  2W9N A;  2IPK D;  4C80 A;  3V6E B;  2W3R A;  2OJR A;  3BII D;  2Z0D B;  5D2M B;  2J42 A;  2JXT A;  4GLS C;  2PJH A;  2WDQ B;  1WSP A;  1UEL A;  3PHX B;  3DWG C;  2MW5 A;  5EE9 A;  4N58 A;  4MH0 E;  1AW7 A;  1Y8R C;  4FBJ B;  3AU5 A;  4LJO B;  4HPP A;  2O2V A;  1L7Y A;  4KV2 A;  4YSX B;  1K50 A;  2ICI A;  2JF5 A;  1BXT A;  3B2F A;  2LGY A;  4J3O D;  3PZD A;  3R7R A;  4I6L B;  2K25 A;  4RMA A;  2QIE B;  3ML8 A;  1PGB A;  1IBX A;  3PLV A;  5E6N A;  5H8Y E;  2Z8L A;  1HE8 A;  2QDF A;  2IBI B;  4HKQ A;  1L0V B;  1ENF A;  2AL3 A;  1WZ0 A;  2QMT A;  2X38 A;  2WXN A;  4A3O A;  2MLB A;  3VUX A;  4YTM B;  4II3 B;  3MC8 A;  1MVK A;  5JH5 C;  3I57 A;  3ZNH B;  1C9F A;  5IOI A;  1WXV A;  4YL8 A;  3ZXV A;  1J7B A;  1FPY A;  2LVO A;  2Q5W D;  4DDG D;  3TEZ A;  1KLG D;  4RFB A;  2D5G A;  2CKH B;  1L4D B;  4WWO A;  1VJK A;  4NJ6 A;  5IN7 A;  3C19 A;  4DDI D;  2FE8 A;  4NQK E;  4AWJ A;  2BS3 B;  2LI5 A;  2DYM A;  3KWL A;  4GIV A;  4C56 C;  3L10 B;  2L76 A;  3PS6 A;  3KLS X;  4C00 A;  4BOS C;  4MJS A;  4WWN A;  5G5G A;  2O6V B;  5EE0 A;  2GBJ A;  3UI3 A;  4B0M A;  2MJD A;  4MGI E;  1FNU A;  2ONQ A;  2WXR A;  2QJL A;  1TIF A;  4F1S A;  4EFO A;  1WGY A;  4JX1 C;  4ICU A;  2MCN B;  1A5R A;  2PVO D;  4NY0 A;  1WYW B;  1WYG A;  5E6P A;  2KDB A;  3LDZ E;  4ANU A;  4NNJ B;  1G6J A;  4LDT D;  4S0R A;  2K39 A;  2MEK A;  3RI7 C;  2KKC A;  2RD0 A;  3EA6 A;  1R4N I;  1WMH A;  1YQB A;  3J9C A;  2D10 A;  1Q1O A;  1JRO A;  3LB8 C;  3A1Q A;  3JSV A;  4KDL B;  1KJT A;  1D5M C;  3GS2 A;  2IO3 B;  5C1Z A;  4DQO C;  2C7N B;  2DWQ A;  2IO0 B;  4D2K A;  1RFA A;  1V81 A;  3ZYY X;  2PEA A;  3AEA B;  1AN8 A;  2WXO A;  1I7H A;  2LGD A;  2NS5 A;  4XWW A;  3A9J B;  4YSY B;  4MEM A;  3A4R A;  1N5W A;  2KWD A;  5DPT A;  4BBN F;  1D5Z C;  4LNI A;  4XC2 A;  1ZPS A; 
#chains in the Genus database with same CATH homology
 1YN3 A;  2WXG A;  2JQR B;  2RDH A;  1B9R A;  2J53 A;  4ARI A;  2NMQ A;  4KX6 B;  4RF0 A;  3RPF C;  1N5X A;  3PZ7 A;  3AEE B;  3P4S B;  2WXJ A;  4LK0 M;  3SEB A;  2LUM A;  1EM7 A;  1ZUD 2;  1N60 A;  1ZOY B;  2ON8 A;  3BWU D;  1KTK A;  2WXK A;  2YEP B;  2RDG A;  2BS2 B;  3URY A;  2LHD A;  5G5H A;  1JWS D;  1JWU D;  4B0E A;  3DWM A;  1E6E B;  3HVZ A;  1FRR A;  4YWG G;  4L1B A;  5FKA C;  5D7G A;  4NZL B;  3AEG B;  4L2Y A;  4ZRP A;  1R7S A;  2M56 B;  5E6J A;  1TZO A;  1XCT L;  1JWB D;  1NVI D;  2K22 A;  1HZ6 A;  1L0X B;  4XDC A;  1FO4 A;  2OED A;  3GB1 A;  3AE4 B;  2CJO A;  1ESF A;  2OHF A;  3ZJV A;  2JZP A;  1VRA B;  3BYY B;  3HRD D;  2JU6 X;  4DXG A;  3H8H A;  3NUH B;  1GB1 A;  1YQ4 B;  2LJI A;  2WXF A;  1BML C;  2KAJ A;  3W5V B;  2ACZ B;  5LNK 1;  1T5X D;  4NAM A;  1N62 A;  4YSZ B;  1ZE3 D;  1FIQ A;  3ETR A;  1QOG A;  3NS1 A;  1QOB A;  4GDK B;  4DXF A;  5T8I A;  1P7F A;  1B1Z A;  2KDM A;  1XLN A;  4MH8 A;  2BTE A;  2Y5P A;  1FFU A;  1I4P A;  1SXT A;  2PTL A;  3LXF A;  4RGT A;  3MJ5 A;  3IT6 B;  2DBY A;  4H2A A;  3ZJU A;  3PZ8 A;  1QT9 A;  1EU4 A;  4KGR A;  3VRB B;  1STE A;  1QKZ A;  4P16 A;  3SFE B;  1XLP A;  3AE1 B;  2JYE A;  1PUT A;  2MH7 A;  4MM3 B;  3VR9 B;  3MC0 B;  1D5X C;  1ZXI A;  3PO0 A;  1L6V A;  2K9X A;  2IGD A;  5C3J B;  3SR6 A;  5EE1 A;  3SFD B;  1DOI A;  4RF1 A;  2JX5 A;  3MP9 A;  2AQ1 B;  5FR3 A;  1GB4 A;  2AQ2 B;  1L6U A;  1VLB A;  2XNA C;  5D3I B;  4IKG A;  2AX5 A;  2PW9 A;  1K51 A;  4ZHO A;  1L0Y B;  3ZJT A;  1J7A A;  1FNV A;  4M0W A;  4A9A A;  4O1N A;  1N61 A;  5BMH A;  1KFY B;  1E9M A;  1CQV A;  5HI1 A;  1YN5 A;  1I4X A;  2WS3 B;  4L23 A;  1HXY D;  1SEB D;  2J52 A;  2CU3 A;  1C78 A;  1KLU D;  3TEY A;  4ZRQ A;  5D3D A;  2IGG A;  3NVV A;  2LGI A;  1V1P A;  5JXV A;  1T6B X;  2V0G A;  1SE2 A;  4CQN A;  2XN9 C;  4A8X C;  3BK2 A;  2PVG C;  3NVZ A;  3FAH A;  2WXH A;  1SF0 A;  2N9L A;  1EU3 A;  3P4R B;  3MHZ A;  2INP E;  1LO5 D;  2V3P A;  4RNA A;  1QQR A;  3BVZ A;  1OQR A;  3EUB 2;  2AQ3 B;  2H89 B;  1BUI C;  2I38 A;  4N6E B;  1PDX A;  3Q8F A;  3Q8A A;  2V4I B;  1C77 A;  2QEJ C;  4RGN A;  2LMC A;  3U4E G;  1ET9 A;  1V1O A;  1NI3 A;  3BVM A;  1C4C A;  2FUG 1;  4US9 A;  1YNT E;  1CJE A;  1Y56 A;  2PLP A;  2Y3A A;  2M19 A;  3AEB B;  2BBC A;  2DLB A;  1UWM A;  4YTP B;  2NTS A;  2KQ4 X;  2G9H D;  4KGS A;  1L5P A;  3VRA B;  1YJJ A;  2YEP F;  3AE3 B;  1E7P B;  2E3T A;  1SJE D;  4KGT A;  4MT5 A;  3U52 E;  1ET6 A;  2N7J A;  4WQM A;  1TJE A;  2W3S A;  1TY0 A;  4MAC A;  2HTM E;  2V3N A;  2E6X A;  2GRI A;  2KAC A;  3E56 A;  1TYG B;  1WXQ A;  1ACC A;  2BB5 A;  4JE3 B;  3BZD B;  3VR8 B;  3C8Y A;  3AN1 A;  3IAM 1;  1TS3 A;  4REZ A;  3R8B A;  4YTN B;  5EE3 A;  3Q8C A;  2RPV A;  1ZXH A;  2BW2 A;  3ABV B;  2GB1 A;  3AEC B;  5HFY A;  4RCO A;  4WIP A;  1RM6 C;  2WXI A;  2KN4 A;  2EEL A;  1C79 A;  2IDY A;  1YN4 A;  4JPS A;  1V8C A;  3TSS A;  1T3Q A;  5BMG A;  1A70 A;  2N9K A;  2L1A A;  4TSS A;  1EWC A;  4IOI E;  1JML A;  1RFK A;  2R61 A;  3EGR A;  5GXG B;  3FIL A;  1F2R C;  5AUI A;  4ZHP A;  2PIA A;  2VZK B;  2WXL A;  2N0S B;  4EE2 A;  3VQI A;  1GPX A;  1FXA A;  5BYR A;  2WU2 B;  4NAW B;  2G1E A;  2BS4 B;  5AUK A;  2BB6 A;  1DOX A;  1FD6 A;  1E0Z A;  3Q8B A;  1RWS A;  4ZYS A;  1JWA D;  1QOF A;  1FRD A;  5FK9 C;  1KF6 B;  2WDR B;  2ZW0 A;  1JAL A;  1JCK B;  1VR9 A;  3P4Q B;  2L32 A;  4IDI A;  1HZ5 A;  1WGK A;  1F77 A;  2QIL A;  1QOA A;  1DOY A;  3HVD A;  1DYQ A;  3AE2 B;  1JW9 D;  1UNS A;  4PT5 A;  3CIR B;  2MJE A;  1V1P B;  1HEZ E;  4RGM A;  4R3D A;  1WRI A;  2ZW1 A;  2WXQ A;  3P4P B;  1GAQ B;  1Q10 A;  1I4G A;  1ZP0 B;  1FXI A;  3B9J A;  1QLB B;  3AE6 B;  4TQ1 A;  1AWD A;  2K0P A;  1P7E A;  2IGH A;  2CJN A;  2INN E;  3T3O A;  4HEA 1;  1YMH E;  1SJH D;  1MHX A;  2JYT A;  4HRS A;  2WU5 B;  1TS2 A;  2Y5C A;  5HG2 A;  1XXG A;  4WUR A;  3AEF B;  3IAS 1;  1AYF A;  2PMV A;  2NTT A;  1C4A A;  4US8 A;  5BYS A;  4NJC A;  1TKE A;  1UWX A;  1VZ6 A;  1XEE A;  3V05 A;  4AQ7 A;  1FMA D;  4P6V F;  2IPK D;  1JQ4 A;  4YXD B;  4Q2J A;  4C80 A;  2TSS A;  2W3R A;  1GOZ A;  2WDV B;  1L4Z B;  3BII D;  3T3N A;  1QF6 A;  4GDL B;  2EKI A;  4OZC A;  2HDE A;  1F2R I;  4OW0 A;  4USA A;  2J42 A;  2JXT A;  1C76 A;  1V97 A;  4GLS C;  1SSN A;  2WDQ B;  1WSP A;  2WP9 B;  3DWG C;  5EE9 A;  4N58 A;  3NRZ A;  1M4V A;  1AW7 A;  1KH0 A;  1WWT A;  1TKG A;  4KKJ A;  2VZK D;  4HJG E;  1UUP A;  1IUE A;  3NVY A;  1QIL A;  4YSX B;  3TEX A;  1FM0 D;  1K50 A;  2ICI A;  3CWI A;  2WNM A;  1BXT A;  3W5U B;  3B2F A;  2MJ3 A;  3GP7 A;  4AS1 A;  3E9S A;  4J3O D;  3FIL B;  1D4B A;  1XF5 L;  4XDD A;  2BYT A;  2GI9 A;  3IT4 B;  3RFZ B;  1SBB B;  1F0Z A;  2QIE B;  2WQY B;  1NEN B;  1PGB A;  5MPO A;  1IBX A;  1UGJ A;  3O13 A;  1TS5 A;  4WAF A;  2DYO A;  2RMM A;  4A90 A;  3N9Y C;  1K52 A;  5H8Y E;  2Z8L A;  3W9C B;  3TUO A;  4HKQ A;  5H92 C;  1L0V B;  1ENF A;  1MHH E;  3U2S C;  1XLQ A;  3AH7 A;  3NZ3 A;  3TEW A;  4JWS C;  1EWY C;  3R2I A;  2LFI A;  1MI0 A;  2QMT A;  2WXP A;  5BYQ A;  2X38 A;  2WXN A;  3P63 A;  2L83 A;  2H88 B;  1TKY A;  4YTM B;  3AV8 A;  1MVK A;  1JWM D;  3I57 A;  2LHE A;  4RH6 A;  4RGO S;  3WCQ A;  1C9F A;  4WWM A;  4A55 A;  2FBW B;  2PKO A;  4C7Z A;  2WXM A;  1SIJ A;  1FCC C;  1J7B A;  3FC4 A;  4FXC A;  1FFV A;  4KKI A;  1PGA A;  2Q5W D;  3W1S A;  3TEZ A;  1KLG D;  2JWU A;  1CZP A;  3BYT B;  4RFB A;  2D5G A;  1PGX A;  2I2Y A;  1L4D B;  1XO3 A;  1VJK A;  1DGJ A;  4ARC A;  2J4X A;  3AED B;  3OWE B;  3IXS A;  2FE8 A;  3AE8 B;  1IGD A;  3W2D A;  1I4H A;  2BS3 B;  2K5P A;  3MFG A;  2DYM A;  4HRO A;  3KWL A;  3KWV A;  1I4Q A;  3I9V 1;  1TS4 A;  3L4P A;  3P42 A;  4C56 C;  4LLG M;  3KLS X;  5I4D A;  1E10 A;  3NVW A;  2K3U A;  1VZ7 A;  4XE0 A;  1FCL A;  4YT0 B;  1KRH A;  1ZDV A;  5G5G A;  5TSS A;  2L52 A;  4WH4 A;  4ZOH C;  1ZDX A;  2JSV X;  5EE0 A;  3UI3 A;  1XLO A;  2MJD A;  4OZA A;  4B0M A;  1FNU A;  2ONQ A;  3AE7 B;  2WXR A;  3AE5 B;  1OQQ A;  1N63 A;  4TMA B;  2QJL A;  2W55 A;  3ZQ4 A;  1OFF A;  4OZB A;  4UDU C;  3ZGZ A;  1NYR A;  4JX1 C;  4OHJ A;  4OVZ A;  2PVO D;  3U7Z A;  4JWU C;  1PFD A;  1WYG A;  3P1M A;  2KMM A;  2SEB D;  3AB5 A;  5C2T B;  3Q8E A;  2B76 B;  2MEK A;  1TY2 A;  3B2G A;  4LTU A;  3EA6 A;  3AE9 B;  1FNW A;  2IJ0 A;  2LEK A;  3J9C A;  1J7C A;  1NEK B;  1VZ8 A;  1IBX B;  1JRO A;  1YJI A;  3LB8 C;  4C7Y A;  3R2T A;  2SAK A;  4N59 A;  3BVG A;  1K53 A;  1NYQ A;  4ITK A;  1YQ3 B;  4HKZ E;  3Q69 A;  1SB3 C;  1HA5 A;  1XCQ L;  2QSD A;  1D5M C;  2W82 A;  1C4P A;  3GS2 A;  1I4R A;  1PYW D;  1ROE A;  4DQO C;  2DWQ A;  3KQ4 A;  3AM9 A;  1SE4 A;  4D2K A;  3ZYY X;  3AEA B;  5HHD G;  1AN8 A;  2W54 A;  2WLB A;  2WXO A;  1I7H A;  1IGC A;  3BK1 A;  1CK1 A;  4XWW A;  4A6Q A;  4YSY B;  1VDV A;  4XWT A;  3V3X A;  1RYJ A;  3LYY A;  1D6E C;  1N5W A;  2M0A A;  2KWD A;  4TQ0 A;  2BT6 A;  5BMI A;  3AMZ A;  1FEH A;  1MPE A;  1SE3 A;  1D5Z C;  3HUI A;  1HQR D;  1JRP A;  1ZPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...