1PDXA

Putidaredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A refined model for the solution structure of oxidized putidaredoxin.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transfer
molecule keywords PROTEIN (PUTIDAREDOXIN)
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pdxA00
1QLBB 3AE6B 5EE0A 3EUB2 1XLPA 3W5VB 1PDXA 1XLNA 1L6UA 1JROA 3VR9B 1QF6A 3KWLA 1JQ4A 1TKGA 1FIQA 1ROEA 1YQ4B 2W54A 3AMZA 2ACZB 3NRZA 2BS2B 1NYRA 1PFDA 1AWDA 1EWYC 1VDVA 1V97A 1NENB 3AEAB 2CU3A 3B2FA 3AN1A 3WCQA 1IUEA 1KFYB 3AE5B 1WYGA 3DWMA 1YJJA 2MJDA 1XLQA 4LTUA 1A70A 5GXGB 1I7HA 2L52A 1TJEA 1E0ZA 2H89B 1WGKA 4N58A 4YT0B 1OQQA 1TYGB 4HRSA 2WS3B 2H88B 2WU5B 3AEEB 2QJLA 5EE9A 1DGJA 1QT9A 4ZHOA 1J7BA 4ZHPA 1JWAD 1FMAD 2B76B 2CJNA 2QIEB 1J7CA 2PKOA 1FO4A 2G1EA 2Q5WD 5C2TB 3DWGC 3VRBB 1UWMA 5C3JB 1FXIA 1CZPA 1NVID 1OFFA 4YSYB 1NI3A 2K22A 1E10A 1FRRA 2KAJA 2M19A 1WWTA 1SIJA 3AB5A 2KMMA 1QOFA 2BS4B 1E6EB 4JX1C 1E7PB 3BIID 3HUIA 1L0VB 2PVGC 2WP9B 1B9RA 1NEKB 4N6EB 1J7AA 1XO3A 3FAHA 1SB3C 4C80A 1FXAA 1F0ZA 4JWSC 2W3SA 3NVYA 3LB8C 1ZP0B 1YJIA 3AECB 2WDVB 1RWSA 3SFDB 1L6VA 4YTMB 1N60A 1V8CA 4YXDB 1TKEA 1VJKA 3P4SB 1KRHA 4ZOHC 3NVVA 3AE7B 5AUKA 2W3RA 3AE3B 3RPFC 2WLBA 4WWMA 3NVZA 1L5PA 3CIRB 3AE9B 1VLBA 1RM6C 1FRDA 1RYJA 3AEGB 4YSXB 2MJEA 2FBWB 3AV8A 3AE2B 3HVZA 2MJ3A 1T3QA 2WDRB 1CJEA 2Y5CA 3AE1B 4KX6B 5H92C 3AE8B 2CJOA 4FXCA 4WQMA 3ZYYX 1WXQA 3B2GA 1DOIA 1FFVA 2EKIA 3ETRA 1N61A 3P63A 5AUIA 2JX5A 4YSZB 3VR8B 3P4PB 3CWIA 1FM0D 2JQRB 2MH7A 1OQRA 4A9AA 1KF6B 1QOBA 4US8A 4P6VF 2PVOD 5EE3A 1N5WA 1ZUD2 2L83A 3P4RB 3W5UB 2DBYA 1RFKA 3B9JA 1SF0A 1WRIA 1DOYA 2M56B 2OHFA 1NYQA 1ZXIA 1GPXA 1QOAA 5G5GA 3P4QB 4YTPB 2K5PA 4JWUC 2AX5A 1GAQB 1JALA 1N62A 1YQ3B 3AE4B 1TKYA 2BS3B 3P1MA 3SR6A 3AEFB 2K9XA 3VRAB 3ABVB 1XLOA 1ZOYB 2PIAA 4N59A 2BT6A 3FC4A 3NVWA 5MPOA 3AEBB 3HRDD 2E3TA 2WDQB 1DOXA 4US9A 5EE1A 4C7YA 4IDIA 3L4PA 1AYFA 4HROA 3NS1A 5G5HA 3SFEB 2W55A 4USAA 4YTNB 2LEKA 1E9MA 2HTME 1JWBD 1N5XA 3PO0A 2DWQA 1N63A 2N0SB 4ITKA 3W9CB 4C7ZA 1PUTA 3AEDB 1QOGA 2WU2B 3LXFA 3AM9A 3AH7A 1JW9D 1R7SA 2WQYB 5H8YE 1FFUA 1JRPA
chains in the Genus database with same CATH superfamily
5DCNA 5BYQA 1ZKHA 4MEMA 5BYSA 3WALA 2FCQA 4MELA 2RMMA 1IYFA 2KFJA 3DWMA 1Y8RC 2H89B 4S0RA 3DBRI 2QJLA 2KJ6A 4ZHOA 3ZXVA 4FHJA 1ZW7A 3KQ4A 2Q5WD 2L32A 1E8ZA 1FXIA 1NI3A 1E10A 1MI0A 1A5RA 1Q5WB 3HVDA 1JCKB 1TY0A 4KZCA 2V4LA 2B3AA 2HDEA 3VH3B 1VD2A 3VVWB 2N9LA 1RWSA 3DQVA 1SJED 2IYDB 1IBXB 5LLIA 2EELA 2Z0EB 3ZIMA 1KLUD 1QKZA 1J19A 3V62A 2V9HA 2QSDA 1GNUA 2BKFA 3AE2B 3HVZA 1XCQL 1SE3A 3H7PA 1WMHB 3Q8CA 1DOIA 1EU4A 4RM8A 2VZKB 4KV2A 2BWFA 3VHTC 3RNBC 3A4RA 3KUZA 4US8A 2V1YA 4P6VF 4KVGB 5HI1A 4B9KA 3QIJA 2OHFA 2WXRA 1GAQB 3VXWA 3P1MA 1FNUA 2K9XA 1I42A 1XLOA 4QAYA 2JRIB 3U2SC 3HRDD 1HTOA 3VTUA 2NBWB 1ET6A 5DPSA 3ZRFA 1LXDA 3A9KA 3AEDB 1QOGA 3AM9A 3QAQA 1UD7A 4RM9A 1QLBB 1HQRD 3GS2A 2EMTA 4I6LB 4UDUC 1BUIC 1SEBD 4HPMB 1V97A 2RPQA 3WCQA 3ZTDA 2KN5A 1T5XD 2CHZA 2AL6A 5L83A 4HVBA 1E8WA 2M8SA 1WGKA 3W1SC 1I4XA 3R2TA 2H88B 1K50A 2LVPA 2QIEB 5LNK1 1N6ZA 1WJNA 1CMXB 2D11A 4XX5A 1UWXA 1E7PB 2NBUA 3HM3A 1ACCA 1UUPA 2K3UA 3LB8C 1YJIA 2BKRB 1FD6A 1ESFA 1BT0A 1V8CA 2D10A 1F52A 1VLBA 4AOFA 4YSXB 3QQ8B 5BMGA 3AE8B 4DDGD 4DXGA 4ACFA 2KT7A 2RDHA 2RD0A 1OEYA 4AQ7A 3V05A 2GOWA 4HPLB 3I5JC 1STEA 4LCDE 4XZ4A 1JMLA 3VFKA 1UF0A 2KLCA 1B1ZA 1TGZB 4AUQC 3RNCC 2FCMA 5E6JA 4MH0E 1WH3A 1Z5SB 2OJRA 2NPTB 1JRUA 1RRBA 1T0YA 2N7DA 1SBBB 2LHEA 4A3OA 3R7RA 2E3TA 3MJWA 3R66C 4HROA 2L05A 4A20A 4LNIA 2KNBA 4CYEA 3MP9A 3W5VB 3OWEB 1JROA 1C4PA 4WWOA 2OEDA 4GIVA 4HDOA 3DVNV 1I4QA 2MRPA 2C7NB 2MP2A 1ZGUB 1V6EA 2WXQA 2MHJA 4TUUA 2JZ3B 2LVQA 4M00A 4ZYNA 1TJEA 2ASQA 3LYYA 2QILA 1ZDXA 3QA8A 2INNE 1D6EC 4IM0A 4A55A 1F2RC 1Q0WB 4AJYB 3V6EB 1FO4A 1WIAA 4P16A 2KK8A 2K22A 4DHZB 3APCA 1D5XC 3HUIA 1XO3A 2WXMA 1ZXHA 2PPHA 2A5UA 5G55A 3QJZA 1EF5A 3R3MA 3RPFC 3PPAA 3U8ZA 1YX5B 5IAAC 4BFRA 1T3QA 3H7SA 2LI5A 1KM7A 5AUIA 1WGDA 1FM0D 1T6BX 3U7DA 3TBLD 3P4RB 3DBRB 1UBIA 1OGWA 1GPXA 4M8NA 1I35A 2QC8A 3W2DA 5HFYA 5TR5A 5E6OA 4JL9A 1WYWB 2DENB 1JWMD 2PIAA 2JY6A 3B1LX 2HJ1A 3I3TB 4B0EA 4W9KA 1LGRA 2J0MA 4X57B 4YTNB 2MCNB 2WHIA 3T9LA 2O6VB 2L7RA 4CHKA 4GU2A 4W9HA 3EUB2 2C9WB 2I2YA 1K53A 1QF6A 3A1QB 3VUWA 4EZLA 1TY2A 2WXHA 3ZRCA 2ACZB 2FE8A 3Q8AA 2NTTA 3PS6A 4IC7B 2MJDA 3V3XA 1UGJA 3RYTA 3L54A 2ZZPB 2LGIA 2WS3B 3AEEB 1F77A 2G45B 1DGJA 1QT9A 2B76B 3EECA 2MP2B 2L0FA 5T8IA 3DBHB 3KH0A 3GZNI 3VDZA 2J7QB 4YL8A 2HE7A 3ZXRA 1E6EB 3ZJUA 3TEYA 5AZHA 1HE8A 4H2AA 3ZKJC 4YXDB 1TKEA 4HJKA 1Q10A 4HDQA 4W9DA 4EE2A 2KTRB 2KDEB 3AE9B 2K8HA 1GUAB 3NZ3A 4HKQA 3V6CB 2WDRB 4KDIC 4PYZA 2GBNA 1UGMA 3NG0A 4KGTA 4NJCA 4JGHB 4HXDA 1WXSA 4E71A 1QILA 2TSSA 3B9JA 5D3IB 1KLGD 3X0WA 2PE9A 2GI9A 1TS5A 3AEFB 1WE6A 5CHFA 1HTQA 2SEBD 4CQNA 3P2BA 2KLGA 2I1KA 2BPSA 5IA7A 1C78A 4IDIA 3ZNID 1TS4A 1VZ8A 2D3GA 5LXIB 2Y3AA 3ONSA 4K1RB 2R61A 2L00B 4LNFA 3IXSA 4BBNC 4BKSA 2KWUB 2YLMA 5C1ZA 5EE0A 1IGCA 2MW5A 4ZRKA 4IM3A 4IWPA 1TKGA 3FILB 2D3AA 3AN1A 3BK2A 5BMHA 2GRIA 4LTUA 1L7YA 3S2AA 3U52E 2MLBA 1KOTA 5EE9A 4K3CA 4G11A 4W9GA 2WXJA 2MBHA 2LGDA 3N3KB 4KKIA 2JXTA 1FRRA 5KHOA 2KXJA 1E7VA 1P1AA 2DNFA 2INCC 2JYEA 1F0ZA 4LJPB 4O1NA 4JWSC 4L2YA 3UQAA 3ML8A 3PSEB 4FJYA 4XE0A 2YEPF 4PS8A 3W1SA 5AEKB 3NVVA 3QK0A 3AE7B 4WWMA 5DPRA 2CJOA 1E8YA 2ON8A 1MG4A 3B2GA 2X8XX 1WI0A 2PEAA 2JQRB 2I1JA 4B95A 3C19A 3MJ5A 1NBFC 4BKTA 1RFKA 3RD2A 4HPPA 4PT5A 3P4QB 1AARA 1N62A 2BS3B 4E3CA 2INDC 2I38A 3GOEA 1ISNA 1SE2A 2BW2A 5JXVA 5AZFA 4AJWA 3A9JA 2M4NA 1JWBD 3CF6E 3RNGC 4N9F4 2WQYB 5H8YE 1FFUA 2BYFA 1J8CA 3EFUA 1PDXA 5D6JB 1NYRA 3VUXA 2REXA 3AE5B 1WYGA 2BYEA 4M0WB 4BBNF 3PVLA 2CR5A 2K8CA 1E0ZA 2ZPYA 1E90A 4DDID 3ZVVA 2CKHB 4ZHPA 2KX3A 4MM3B 4TV3A 4XYCA 1OFFA 2ZVNA 1CQVA 2MQJA 1FNVA 1R4NI 1L0VB 1NEKB 3GZNB 1WGRA 4LNKA 1GC7A 2Z59B 1VZ6A 3NVYA 3URYA 4XWWA 3MC0B 1XCTL 4P1CC 2N9XA 2WLBA 2KQSA 2ZVOA 1LM8B 2G3QB 3AEGB 4WWNA 2MJEA 1P98A 2LJ5A 2ZNVB 4ARIA 1VRAB 3A4SC 2EKIA 2GBRA 1N61A 2VH1A 4NPNA 2LZ6A 2AWTA 3IG3A 2JWUA 2KWCA 1ZUD2 3KLSX 4TSSA 2DBYA 1WRIA 3UQBA 1QOAA 1C3TA 1TBEA 4JWUC 4A3PA 4XDCA 1TKYA 4TQ1A 2JXXA 4KDLB 2ZCBA 1ZOYB 3VAWA 4TMAB 2DYMA 4WH4A 4EZJA 2Y5PA 2CU1A 1YOVB 1WR1A 2D3CA 4JLCA 1EU3A 2QDFA 4DXAB 1JRPA 1WX8A 3WAMA 3AE6B 2BBCA 3ZLZA 4IW0A 3RNAC 4F1SA 2GBJA 3Q8BA 1JQ4A 4GDLB 3V61A 4HLEA 2PJHA 3WAPA 4MH8A 1IUEA 1CK1A 2QHOA 4BOSC 3IVFA 1L4DB 2LRUA 1GOZA 3RZFA 2L8JA 2WNMA 3OJ4B 5CHVC 4OZCA 1Q1OA 4HJGE 1LQBA 4F8CB 3BVGA 2A4ZA 3ECIA 4NNJB 3NZUA 2KMMA 1QOFA 3ML9A 5IOIA 1KJTA 1P7FA 4N6EB 2BWES 1SB3C 1YQBA 2LJIA 3IAS1 4ANXA 4WAFA 3B0AA 1WE7A 4IM2A 4XGAB 2KYWA 5AUKA 3AE3B 1H4RA 2KQ7A 2MBEA 4EFOA 4HK2A 3U7ZA 1GG3A 1K8RB 1K52A 1WXQA 2WDTB 4URKA 2BF8B 2IDYA 3BYYB 3UI3A 1QOBA 2CS4A 2LVOA 1WR6E 3PRZA 3JSVB 4JQWC 1KH0A 4C4VA 3WIMA 3ZJVA 5KHQA 2WXKA 4LNNA 4ZRQA 1WXVA 2K5PA 3ALBA 4GDKA 2QEJC 2GLSA 4IOIE 4FBJB 2BT6A 4I6PA 1BMLC 1V1PA 2QMTA 3DCGA 2GMIC 2NCNA 2BB6A 1PGAA 2LEKA 4IUMB 1C77A 4G0NB 3W9CB 4ITKA 3PREA 3PZ7A 2WU2B 1OTRB 1TTNA 1HA5A 3RN9C 1OQYA 3ZDTA 4JE3B 3VTVA 2WXPA 4EUTA 3AU4A 3PT2B 1FIQA 1NENB 3AEAB 3PTFC 2L3ZA 3T3OA 3WANA 3R2IA 4W9JA 4RH6A 1TS3A 4W9LA 1JWAD 4RGMA 3NHEB 3WA0A 4II2B 1J7CA 3OLMD 2KACA 5C3JB 4YSYB 2IO2B 3AB5A 2BS4B 1IP9A 1C1YB 3BVZA 1B9RA 1J7AA 1MHXA 3KVFB 4PK1A 4F7ZA 3I63C 4MJSB 3IFWB 5FK9C 4MSQB 4J3OD 5IKCM 2G4SA 3N1YC 1C79A 4ZRPA 3K9OB 3AULA 2AL3A 1TIFA 1V2YA 3L13A 2KO3A 2KKCA 1V5OA 3ZYYX 1C9FA 1M4VA 2MBBB 4A90A 4RNAA 1PYWD 4YSZB 3M63B 3O13A 1P9DU 2RDBC 4NAWB 2MH7A 4JIOU 2C7HA 2IPKD 3Q3FA 4GOCA 2AEHA 3Q8FA 3KYDD 3WAOA 2AX5A 2IO3B 4OZBA 3RI7C 2IJ0A 3ZTCA 2W82A 3NVWA 3E9SA 3AEBB 3SHQA 2UYZB 1WGYA 5D7GA 1WSPA 4ANUA 1PUTA 3LXFA 2ZW1A 3RULA 1V49A 4IWQA 3NJTA 4BZAA 1GJZA 1V1PB 3DHIC 1UBQA 4MACA 4W9CA 3VR9B 3Q3OC 2KANA 1YQ4B 2W54A 1FPYA 3B08A 2O6VA 3L16A 4ASWC 3ZNZB 2ZEQA 2KC1A 4FLHA 2EMSA 2C5LC 1XT9B 2VRRB 2WWZA 3H7PB 1MJDA 2JT4B 2D3BA 2ZPNA 1FCCC 4IG7B 5IN7A 1YJ1A 2LFIA 1NVID 2D2QA 3MC8A 2V0GA 3I9V1 2WXOA 1WWTA 2J0KA 2K39A 3FAHA 3DBHI 1FXAA 3X23A 2WXLA 4BKGA 1E7UA 1Z2MA 3MHSD 4I6NB 4LK0M 1P7EA 3ZJTA 3A9JB 2FAZA 1D5ZC 5EDSA 4FJVB 5G2NA 3TJPA 1EM7A 3CMMB 3ZDMC 5JHAA 5H92C 2LMCA 4FXCA 3RCZA 4OVUA 5LXHA 1S3SG 2DHZA 2MEKA 3TIXA 1SIFA 5C23A 5TSSA 2O2VA 4FULA 3MC9A 1WM2A 3DDCB 2DLBA 1PQSA 4M0WA 3QHTA 4BKSD 3NY5A 1JALA 3VRAB 3ABVB 4NAWA 2BGFA 1G6JA 5GMVA 4N59A 4KIKB 5IO9A 2OOBB 1WXAA 3MTNB 5BYRA 2KN4A 1IBXA 3NS1A 1KLVA 4USAA 1NI2A 3DVGY 1XF5L 1UNSA 2DWQA 2Z0DB 3PO0A 4M02A 4IWOA 5BMIA 3VTWA 3SEBA 2J42A 3DVGX 2KTFA 1J0GA 3UIOB 5J17A 2INPE 3U30A 3NRZA 2M17A 4GXBA 4J6IA 5CX3A 1MG8A 3FKYA 4A6QA 2C7MB 4WAAA 2MA9B 2VH2A 1TYGB 2N1VA 3FILA 4MT5A 2FUHB 1S1QB 2KD0A 2PKOA 3MHZA 2G1EA 1V81A 1WZ3A 4FA6A 2JWZA 2MBQA 4ICUA 4RGNA 1F1HA 1TZ1A 3BIID 1FEHA 1YIWA 1SJHD 3KWVA 2WDVB 3SFDB 2XEWA 1VJKA 4ZOHC 5BO4B 3Q3MC 1RM6C 4LDTB 3BVMA 4B6WA 2C60A 3JYUA 4W9IA 4K7WA 3Q2AC 3VR8B 1YNTE 4GDLA 5EE3A 4OHJA 2KFKA 2L83A 2WX0A 2XK5B 1GB1A 4KSKC 2BB5A 4OVZA 2BQQA 1GB4A 4CO7A 5J18A 3PRMB 2O2VB 3FC4A 1ENFA 1RFAA 2K6DB 5EE1A 3Q6BA 3L4PA 2KZRA 2W55A 1WF9A 1SE4A 4KIKA 2QCZA 3GE3C 2UU7A 3DBLB 5CTRC 3ZNHB 1V1OA 3BWUD 4S17A 2DYOA 2JRHA 2MWSB 1WGHA 2L76A 1KFYB 2J4XA 4NQKE 1E8XA 5GXGB 3N20C 3ZQ4A 1U4AA 2L52A 2IY0B 4N58A 2SAKA 2EKEC 5FKAC 4GLSC 5E6NA 4IKGA 1J7BA 3P42A 3D32A 3CSTA 1SSNA 4AWJA 1OEYJ 2M0AA 1UWMA 2RDGA 4NAMA 4C4VB 3DHHC 3L0WB 1SE9A 2PMVA 1YMHE 3EC8A 2PVGC 4GDKB 1ET9A 2AQ3B 2R2OA 2RGFA 4RMAA 1L6VA 3EHVA 1C4AA 5HG2A 1XEEA 2N4FA 3T8MA 1LO5D 1EF1A 1L5PA 3NVZA 4BOZB 1R4NB 2YVCA 4G3XB 2UWQA 3DBSA 2KQ4X 3ETRA 2N9KA 2IZVB 1VZ7A 1JWUD 3HHMA 4LLGM 4EKUA 1PGXA 4RGTA 1JWSD 4DBGA 2WXNA 1DOYA 1V5TA 4RF0A 4P7IA 1I4PA 2MBOA 3TEWA 2GBKA 4NJ7A 4R3DA 3AE4B 1WJ4A 4ANVA 4ZDVA 1YN5A 4EOYA 1V80A 1MFWA 4GSWA 2HD5B 1DOXA 2XK5A 1HZ5A 2DX5B 2W9NA 1FCLA 3SDLC 4BAXA 1UH6A 4OZAA 4Q2JA 4MGZE 3AXCA 2HJ8A 3EGRA 4AS1A 3VQIA 4NJ6A 4ANWA 1XLNA 2IGDA 4WIPA 3TSSA 3AMZA 5JH5C 2D5GA 1YJJA 2GBMA 4DHJB 1XLQA 3Q8EA 4FHKA 1LFDA 3IAM1 4L23A 4ZYSA 2KJRA 3QARA 4AP4C 1CZPA 1MPEA 3Q3NC 2AQ1B 5E6PA 2Y5BB 1BXTA 1KTKA 2DYBA 3ENEA 3KW5B 3DBLI 4W9FA 3C0RB 5FR6A 3HIZA 2IGGA 5I4DA 2K6QA 1AN8A 2MX2A 2L1AA 4D2KA 1I4RA 3OG5A 2FBWB 2JVCA 3TEXA 1CJEA 4K7SA 4WQMA 3GE8C 5HKHA 3BK1A 2R2QA 1AW7A 4MGIE 1FFVA 4LDTD 2D07B 3L08A 3PZDA 3ZO5B 1OQRA 1P0RA 4A9AA 2WXGA 3PLVA 4JPSA 2V3SA 2M56B 2N9EB 1ZXIA 2J52A 3A9KB 2LWPA 4FADA 5HHDG 1EUVB 3JVZX 3UF8A 4DHJD 2WDQB 3TL5A 2KVRA 5DPTA 2FIFA 3QX1A 4NQLB 2PE6B 1E9MA 2HTME 1N5XA 3KUDB 4DHZE 5JHBA 2DZIA 1F9JA 1QZEA 4HWIB 3RNEC 1WZ0A 4WJOA 2JSVX 4ICVA 3H8HA 3KWLA 3TUOA 2WXFA 3TMPB 2LUMA 3BYTB 2BS2B 2ZNVC 1T0RC 2K25A 1VDVA 3N1XC 3R7QA 1A70A 1I7HA 3W1YA 4ARCA 1HEZE 1OQQA 2NMQA 5JZEB 1T0SC 3BY4B 1FMAD 3DWGC 2V3PA 3KUCB 1FNWA 4DXFA 2FCNA 1H8CA 2KAJA 3A33B 4WWPA 2KHWB 2NR2A 2FIDA 4WJPA 3APFA 3ZGZA 3H1UA 4C80A 3QC8B 2BVCA 2KDBA 3AECB 3DHGC 2GB1A 3P4SB 1YD8U 3IT4B 2J53A 3CIRB 2MSED 1FRDA 3Q3JA 3BZDB 3IHPC 2JZPA 4KSLC 1L0YB 2MJ3A 2CHXA 2XN9C 2G9HD 2KDIA 4WQOB 2DAJA 2LXCA 3PV1A 3RFZB 2WX1A 4YWGG 3PHXB 1D4BA 1SF0A 4PS7A 3PZ8A 5IP4D 3SR6A 4OVVA 3GB1A 3RZWC 4C56C 2LGYA 3NUHB 2DZMA 5L95C 1RAXA 2G4DB 1GC6A 4LNOA 1DYQA 2DAFA 3O65B 4C7YA 5G5HA 4C00A 2AQ2B 2JPHA 1N63A 3TCAA 1F2RI 4WJNA 4C7ZA 3N32A 2LGXA 3PHWB 2XBBC 1V9JA 1WMHA 2LUEA 5MPOA 3JW0X 3M95A 3KYCD 1L6UA 3Q69A 4DWFA 4DK5A 2K1FA 2ZJDA 2N7JA 4MGKE 3B2FA 2M0XA 2KJHB 2VZKD 3NZSA 1WJUA 1R4MB 1IGDA 4HRSA 4MSMB 3TEZA 2KDFB 4GGQA 1MVKA 3HM6X 1EWCA 2KMCA 5C2TB 1D3ZA 3SU8X 2KFKB 3DPDA 2DZKA 3N1ZC 2M19A 4XDDA 1SIJA 3UIPB 2WP9B 2JUOA 3L17A 3J9CA 3M62B 2N1WA 5D3DA 3EFCA 1KRHA 4GB9A 3IT6B 4XC2A 1HZ6A 3L10B 2NBVB 1X1MA 1WX7A 2BYVE 4HKZE 1YX6B 1K51A 2LRWA 2KOXA 4K81A 4M8MA 1EO6A 4OW0A 3I57A 3K9PB 4MM3A 1L2NA 3P4PB 3CWIA 1YN3A 2RR9A 4FN2A 2KC2A 1N5WA 1XD3B 4GN1A 4WURA 1L0XB 2BYTA 5DPWA 2ZW0A 4KZ0A 1NYQA 3PGEA 4TQ0A 3APDA 4RGOS 5D2MB 5FR3A 2NS5A 4K3BA 2V4IB 2N9PC 1E5WA 3RT3B 3MFGA 2FUG1 2ICIA 2XNAC 2O6VD 3SFEB 3A1QA 3SD5A 1XXGA 1RLFA 1P3QU 2X38A 2LXAA 3QWZB 3V60A 1IPGA 1JW9D 1R7SA 2M1MA 2N7EA 2HTHA 5D94A 3E56A 3RNFC 1XLPA 4BVUC 3ZUNA 1ROEA 3PLUA 4K7UA 1PFDA 1EWYC 2LD9A 3N9YC 2JU6X 1Y56A 2CU3A 2ONQA 2PLPA 3Q14C 4REZA 3BINA 3DOWA 1ZE3D 1WX9A 5J2RA 2NPTA 2LASA 2WU5B 2WGSA 2CJNA 2IBIB 3QCAA 3VRBB 3JSVA 5CHWA 1SXTA 4W9EA 3VUYA 2WXIA 2KWDA 2OJWA 2RPVA 3NOBA 2KVZA 1ZDVA 1L4ZB 1TZOA 4G50A 3RMKC 2W3RA 1R4MI 2LGSA 4PYUA 4GMVA 4L1BA 1RYJA 3EA6A 3N30A 3OJ3A 1WGGA 3R8BA 2Y5CA 1WXMA 4HCNB 4KX6B 3U4EG 2K8BA 2NTSA 3P63A 2JX5A 4KGRA 4ZRIA 1KF6B 4A8XC 1WJ6A 3ZNGC 4DQOC 2YEPB 4YTPB 4WJQA 4HCPB 2L0TA 4M01A 4II3B 4NY0A 1HXYD 2AYOB 4US9A 1WY8A 3AU5A 1AYFA 5AZGA 2KMAA 3C8YA 2PTLA 1PGBA 2N0SB 4TKNA 3LDZE 1WRDB 1I4GA 3AH7A 4EEWA 2JZZA 2W3SA 3HK0A 4LJOB 2LHDA 1V86A 2IO0B 4MDKE 3PRPB 1AWDA 1UZXB 3NS8A 1VR9A 3VH4B 3H9DA 2IO1B 1M94A 1I4HA 2E6XA 2DZJA 4YT0B 4MGYE 2FCSA 1VCBA 1WM3A 3CSFA 2J0JA 3UINB 1D5MC 2WYQA 4KGSA 2CHWA 4EZKA 3GP7A 4JX1C 1YN4A 2RSUA 1TT5B 1WFYA 4B0MA 3OAWA 1ZPSA 1XQQA 1ZP0B 2NVUI 2IGHA 1T0QC 4YTMB 1N60A 3DVNU 1C4CA 2KDMA 1SGHA 2KX0A 3AV8A 3AE1B 4P1BC 1MHHE 2JYTA 4RCOA 4KKJA 3T3NA 3AI5A 3IBEA 4PS3A 4FJZA 2PVOD 3W5UB 4RF1A 4NZLB 2FNJB 2V3NA 1UELA 2K0PA 5G5GA 1TS2A 1C76A 1YQ3B 3ZW3A 2PW9A 4MJSA 3M3JA 3RUIB 4E74A 3H6NA 3LJ3A 2KTRA 2KWVB 2ZCCA 4RFBA 1FXTB 4ZRJA 2IY1B 2BTEA 3UGBB 1QQRA 2Z8LA 1NDDA 2JF5A 4HEA1 4XWTA
chains in the Genus database with same CATH topology
5EE0A 2JSVX 1V1PB 4MACA 1IGCA 3H8HA 3VR9B 3KWLA 3TUOA 2WXFA 2LUMA 5BYQA 1TKGA 3BYTB 1YQ4B 2W54A 3FILB 2BS2B 5BYSA 1VDVA 2RMMA 3AN1A 3BK2A 5BMHA 3DWMA 2GRIA 4LTUA 1A70A 1I7HA 4ARCA 2H89B 1HEZE 1OQQA 2NMQA 3U52E 5EE9A 2QJLA 4ZHOA 1FMAD 2WXJA 1FCCC 3KQ4A 2LFIA 2Q5WD 2L32A 3DWGC 1FXIA 1NVID 4KKIA 2V3PA 1NI3A 2JXTA 1E10A 1FRRA 1FNWA 4DXFA 2V0GA 3I9V1 2KAJA 2WXOA 1MI0A 1WWTA 3HVDA 1JCKB 1TY0A 3ZGZA 3FAHA 2JYEA 4C80A 2HDEA 1FXAA 4O1NA 1F0ZA 4JWSC 2WXLA 4L2YA 2N9LA 3AECB 2YEPF 1RWSA 4XE0A 2GB1A 3W1SA 3P4SB 3NVVA 3AE7B 4LK0M 1SJED 1P7EA 3IT4B 1IBXB 2J53A 3ZJTA 2EELA 4WWMA 3CIRB 1D5ZC 1FRDA 1KLUD 1QKZA 3BZDB 2JZPA 2QSDA 1L0YB 3AE2B 3HVZA 1EM7A 2MJ3A 1XCQL 2XN9C 1SE3A 2LMCA 2CJOA 4FXCA 5H92C 3Q8CA 2ON8A 2G9HD 3B2GA 1DOIA 1EU4A 2VZKB 2MEKA 2JQRB 4US8A 3RFZB 4P6VF 5TSSA 5HI1A 3MJ5A 4YWGG 1RFKA 1D4BA 1SF0A 2DLBA 2OHFA 3PZ8A 4PT5A 4M0WA 3P4QB 2WXRA 1GAQB 1JALA 1N62A 3SR6A 3GB1A 2BS3B 3P1MA 4C56C 1FNUA 2K9XA 3VRAB 3ABVB 3NUHB 1XLOA 4N59A 2I38A 3U2SC 3HRDD 5BYRA 1SE2A 2BW2A 1DYQA 4C7YA 1ET6A 2KN4A 5JXVA 1IBXA 5G5HA 3NS1A 2AQ2B 4USAA 1JWBD 1XF5L 1UNSA 2DWQA 1N63A 3PO0A 1F2RI 4C7ZA 5BMIA 3AEDB 1QOGA 3AM9A 2WQYB 5H8YE 3SEBA 1FFUA 5MPOA 2J42A 1QLBB 1HQRD 3GS2A 1PDXA 1L6UA 2INPE 3Q69A 4UDUC 1BUIC 1SEBD 3NRZA 1NYRA 2N7JA 1V97A 3B2FA 3WCQA 3AE5B 1WYGA 1T5XD 2VZKD 4A6QA 1E0ZA 1IGDA 1WGKA 1I4XA 1TYGB 3R2TA 4HRSA 2H88B 3TEZA 4ZHPA 3FILA 1K50A 4MT5A 4MM3B 1MVKA 1EWCA 2QIEB 2PKOA 3MHZA 2G1EA 5C2TB 5LNK1 1OFFA 1CQVA 2M19A 4XDDA 1SIJA 4RGNA 1UWXA 1FNVA 1E7PB 3BIID 1L0VB 2WP9B 1NEKB 1ACCA 1VZ6A 3J9CA 1UUPA 1FEHA 2K3UA 3LB8C 1SJHD 3NVYA 1YJIA 3KWVA 3URYA 4XWWA 1FD6A 1ESFA 2WDVB 3MC0B 3SFDB 1XCTL 5D3DA 1V8CA 1VJKA 4ZOHC 1KRHA 2WLBA 1VLBA 1RM6C 3IT6B 3AEGB 1HZ6A 4YSXB 2MJEA 3BVMA 5BMGA 4ARIA 3AE8B 4HKZE 1K51A 4DXGA 1VRAB 2EKIA 4OW0A 1N61A 2RDHA 3I57A 3VR8B 3P4PB 1YNTE 3CWIA 1YN3A 4AQ7A 3V05A 2JWUA 5EE3A 4OHJA 1N5WA 1STEA 1ZUD2 3KLSX 4WURA 2L83A 4TSSA 2DBYA 1JMLA 1L0XB 2BYTA 1GB1A 1WRIA 2ZW0A 2BB5A 1NYQA 4TQ0A 4OVZA 1QOAA 4RGOS 1B1ZA 1GB4A 5FR3A 4JWUC 5E6JA 4XDCA 1TKYA 4TQ1A 2V4IB 1ZOYB 1SBBB 3MFGA 2LHEA 3FC4A 4TMAB 1ENFA 2FUG1 2DYMA 2E3TA 2ICIA 2XNAC 5EE1A 4WH4A 3L4PA 4HROA 3SFEB 2W55A 2Y5PA 1XXGA 2X38A 1SE4A 1JW9D 1R7SA 1EU3A 1JRPA 3AE6B 3E56A 3MP9A 2BBCA 1XLPA 3W5VB 3OWEB 1JROA 3Q8BA 1C4PA 1JQ4A 2OEDA 4GDLB 1V1OA 3BWUD 2DYOA 1I4QA 1ROEA 1PFDA 1EWYC 3N9YC 2JU6X 4MH8A 1Y56A 2CU3A 1IUEA 1CK1A 1KFYB 2ONQA 2PLPA 2WXQA 4REZA 1L4DB 1ZE3D 2J4XA 5GXGB 3ZQ4A 2L52A 1GOZA 1TJEA 3LYYA 2SAKA 4N58A 2QILA 5FKAC 1ZDXA 4GLSC 2WNMA 2WU5B 4IKGA 1J7BA 2INNE 1D6EC 3P42A 4HJGE 4OZCA 4A55A 2CJNA 1F2RC 1SSNA 3BVGA 2M0AA 1FO4A 3VRBB 4P16A 1UWMA 2RDGA 1SXTA 4NAMA 2K22A 2KMMA 1QOFA 2WXIA 1D5XC 2PMVA 2KWDA 1YMHE 3HUIA 2RPVA 1P7FA 2PVGC 4N6EB 1XO3A 2WXMA 1SB3C 1ZXHA 4GDKB 1ET9A 2AQ3B 2LJIA 3IAS1 1ZDVA 4WAFA 1L4ZB 1TZOA 1L6VA 1C4AA 5AUKA 2W3RA 1XEEA 3AE3B 5HG2A 3RPFC 1LO5D 3NVZA 1L5PA 4L1BA 1RYJA 3EA6A 3R8BA 3U7ZA 1T3QA 2Y5CA 4KX6B 3U4EG 1K52A 1WXQA 2NTSA 2IDYA 2KQ4X 3BYYB 3ETRA 2N9KA 3P63A 5AUIA 3UI3A 2JX5A 4KGRA 1VZ7A 1FM0D 1JWUD 1T6BX 4LLGM 1PGXA 4RGTA 1KF6B 1QOBA 1JWSD 4A8XC 1KH0A 3P4RB 4DQOC 3ZJVA 2WXNA 1DOYA 1GPXA 4RF0A 2YEPB 2WXKA 1I4PA 4YTPB 4ZRQA 2K5PA 3TEWA 4R3DA 3AE4B 3W2DA 5HFYA 2QEJC 1YN5A 4IOIE 1JWMD 2PIAA 2BT6A 1HXYD 4B0EA 1DOXA 1HZ5A 1BMLC 4US9A 1V1PA 2QMTA 1AYFA 2BB6A 3C8YA 1PGAA 2PTLA 4YTNB 2LEKA 1FCLA 1C77A 1PGBA 2N0SB 3W9CB 4ITKA 4OZAA 3PZ7A 4Q2JA 2WU2B 1I4GA 3AH7A 3EGRA 4AS1A 2W3SA 1HA5A 3VQIA 3EUB2 2I2YA 1K53A 1XLNA 2IGDA 2LHDA 4JE3B 4WIPA 1QF6A 3TSSA 2WXPA 1TY2A 2WXHA 1FIQA 3AMZA 2ACZB 1AWDA 2FE8A 1NENB 2D5GA 1VR9A 3AEAB 3Q8AA 2NTTA 1YJJA 2MJDA 1XLQA 3V3XA 1I4HA 1UGJA 2E6XA 3T3OA 4YT0B 2LGIA 3Q8EA 2WS3B 3AEEB 1F77A 3R2IA 1DGJA 1QT9A 4RH6A 1TS3A 1JWAD 2B76B 3IAM1 4RGMA 4L23A 1J7CA 4ZYSA 5T8IA 1D5MC 4KGSA 2KACA 5C3JB 1CZPA 4YSYB 3GP7A 1MPEA 4JX1C 1YN4A 3AB5A 2BS4B 1E6EB 2AQ1B 3BVZA 1B9RA 4B0MA 1J7AA 1BXTA 1KTKA 1MHXA 1ZPSA 3ZJUA 1ZP0B 3TEYA 2IGHA 4H2AA 4YTMB 5FK9C 1N60A 4J3OD 4YXDB 1TKEA 1C4CA 1Q10A 2IGGA 2KDMA 5I4DA 1C79A 4EE2A 1AN8A 4ZRPA 3AE9B 2L1AA 3NZ3A 4D2KA 1I4RA 4HKQA 2FBWB 3AV8A 2WDRB 1CJEA 3AE1B 3TEXA 1MHHE 2JYTA 4WQMA 4RCOA 4KKJA 3BK1A 1M4VA 3ZYYX 3T3NA 1C9FA 1AW7A 1FFVA 4A90A 4RNAA 1PYWD 4YSZB 3O13A 4KGTA 4NJCA 2MH7A 4NAWB 1OQRA 4A9AA 1QILA 2IPKD 2PVOD 2WXGA 4JPSA 3W5UB 4RF1A 2TSSA 3B9JA 4NZLB 5D3IB 2M56B 2V3NA 1KLGD 1ZXIA 2K0PA 3Q8FA 5G5GA 2GI9A 1TS2A 2AX5A 1C76A 2J52A 1YQ3B 4OZBA 1TS5A 3AEFB 5HHDG 2IJ0A 2PW9A 2SEBD 4CQNA 2W82A 3NVWA 3E9SA 3AEBB 2WDQB 1C78A 4IDIA 1TS4A 1VZ8A 2Y3AA 4RFBA 1E9MA 2HTME 1N5XA 5D7GA 1WSPA 2R61A 2BTEA 1PUTA 1QQRA 2Z8LA 3LXFA 3IXSA 4HEA1 4XWTA 2ZW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLB B;  3AE6 B;  5EE0 A;  3EUB 2;  1XLP A;  3W5V B;  1PDX A;  1XLN A;  1L6U A;  1JRO A;  3VR9 B;  1QF6 A;  3KWL A;  1JQ4 A;  1TKG A;  1FIQ A;  1ROE A;  1YQ4 B;  2W54 A;  3AMZ A;  2ACZ B;  3NRZ A;  2BS2 B;  1NYR A;  1PFD A;  1AWD A;  1EWY C;  1VDV A;  1V97 A;  1NEN B;  3AEA B;  2CU3 A;  3B2F A;  3AN1 A;  3WCQ A;  1IUE A;  1KFY B;  3AE5 B;  1WYG A;  3DWM A;  1YJJ A;  2MJD A;  1XLQ A;  4LTU A;  1A70 A;  5GXG B;  1I7H A;  2L52 A;  1TJE A;  1E0Z A;  2H89 B;  1WGK A;  4N58 A;  4YT0 B;  1OQQ A;  1TYG B;  4HRS A;  2WS3 B;  2H88 B;  2WU5 B;  3AEE B;  2QJL A;  5EE9 A;  1DGJ A;  1QT9 A;  4ZHO A;  1J7B A;  4ZHP A;  1JWA D;  1FMA D;  2B76 B;  2CJN A;  2QIE B;  1J7C A;  2PKO A;  1FO4 A;  2G1E A;  2Q5W D;  5C2T B;  3DWG C;  3VRB B;  1UWM A;  5C3J B;  1FXI A;  1CZP A;  1NVI D;  1OFF A;  4YSY B;  1NI3 A;  2K22 A;  1E10 A;  1FRR A;  2KAJ A;  2M19 A;  1WWT A;  1SIJ A;  3AB5 A;  2KMM A;  1QOF A;  2BS4 B;  1E6E B;  4JX1 C;  1E7P B;  3BII D;  3HUI A;  1L0V B;  2PVG C;  2WP9 B;  1B9R A;  1NEK B;  4N6E B;  1J7A A;  1XO3 A;  3FAH A;  1SB3 C;  4C80 A;  1FXA A;  1F0Z A;  4JWS C;  2W3S A;  3NVY A;  3LB8 C;  1ZP0 B;  1YJI A;  3AEC B;  2WDV B;  1RWS A;  3SFD B;  1L6V A;  4YTM B;  1N60 A;  1V8C A;  4YXD B;  1TKE A;  1VJK A;  3P4S B;  1KRH A;  4ZOH C;  3NVV A;  3AE7 B;  5AUK A;  2W3R A;  3AE3 B;  3RPF C;  2WLB A;  4WWM A;  3NVZ A;  1L5P A;  3CIR B;  3AE9 B;  1VLB A;  1RM6 C;  1FRD A;  1RYJ A;  3AEG B;  4YSX B;  2MJE A;  2FBW B;  3AV8 A;  3AE2 B;  3HVZ A;  2MJ3 A;  1T3Q A;  2WDR B;  1CJE A;  2Y5C A;  3AE1 B;  4KX6 B;  5H92 C;  3AE8 B;  2CJO A;  4FXC A;  4WQM A;  3ZYY X;  1WXQ A;  3B2G A;  1DOI A;  1FFV A;  2EKI A;  3ETR A;  1N61 A;  3P63 A;  5AUI A;  2JX5 A;  4YSZ B;  3VR8 B;  3P4P B;  3CWI A;  1FM0 D;  2JQR B;  2MH7 A;  1OQR A;  4A9A A;  1KF6 B;  1QOB A;  4US8 A;  4P6V F;  2PVO D;  5EE3 A;  1N5W A;  1ZUD 2;  2L83 A;  3P4R B;  3W5U B;  2DBY A;  1RFK A;  3B9J A;  1SF0 A;  1WRI A;  1DOY A;  2M56 B;  2OHF A;  1NYQ A;  1ZXI A;  1GPX A;  1QOA A;  5G5G A;  3P4Q B;  4YTP B;  2K5P A;  4JWU C;  2AX5 A;  1GAQ B;  1JAL A;  1N62 A;  1YQ3 B;  3AE4 B;  1TKY A;  2BS3 B;  3P1M A;  3SR6 A;  3AEF B;  2K9X A;  3VRA B;  3ABV B;  1XLO A;  1ZOY B;  2PIA A;  4N59 A;  2BT6 A;  3FC4 A;  3NVW A;  5MPO A;  3AEB B;  3HRD D;  2E3T A;  2WDQ B;  1DOX A;  4US9 A;  5EE1 A;  4C7Y A;  4IDI A;  3L4P A;  1AYF A;  4HRO A;  3NS1 A;  5G5H A;  3SFE B;  2W55 A;  4USA A;  4YTN B;  2LEK A;  1E9M A;  2HTM E;  1JWB D;  1N5X A;  3PO0 A;  2DWQ A;  1N63 A;  2N0S B;  4ITK A;  3W9C B;  4C7Z A;  1PUT A;  3AED B;  1QOG A;  2WU2 B;  3LXF A;  3AM9 A;  3AH7 A;  1JW9 D;  1R7S A;  2WQY B;  5H8Y E;  1FFU A;  1JRP A; 
#chains in the Genus database with same CATH topology
 5DCN A;  5BYQ A;  1ZKH A;  4MEM A;  5BYS A;  3WAL A;  2FCQ A;  4MEL A;  2RMM A;  1IYF A;  2KFJ A;  3DWM A;  1Y8R C;  2H89 B;  4S0R A;  3DBR I;  2QJL A;  2KJ6 A;  4ZHO A;  3ZXV A;  4FHJ A;  1ZW7 A;  3KQ4 A;  2Q5W D;  2L32 A;  1E8Z A;  1FXI A;  1NI3 A;  1E10 A;  1MI0 A;  1A5R A;  1Q5W B;  3HVD A;  1JCK B;  1TY0 A;  4KZC A;  2V4L A;  2B3A A;  2HDE A;  3VH3 B;  1VD2 A;  3VVW B;  2N9L A;  1RWS A;  3DQV A;  1SJE D;  2IYD B;  1IBX B;  5LLI A;  2EEL A;  2Z0E B;  3ZIM A;  1KLU D;  1QKZ A;  1J19 A;  3V62 A;  2V9H A;  2QSD A;  1GNU A;  2BKF A;  3AE2 B;  3HVZ A;  1XCQ L;  1SE3 A;  3H7P A;  1WMH B;  3Q8C A;  1DOI A;  1EU4 A;  4RM8 A;  2VZK B;  4KV2 A;  2BWF A;  3VHT C;  3RNB C;  3A4R A;  3KUZ A;  4US8 A;  2V1Y A;  4P6V F;  4KVG B;  5HI1 A;  4B9K A;  3QIJ A;  2OHF A;  2WXR A;  1GAQ B;  3VXW A;  3P1M A;  1FNU A;  2K9X A;  1I42 A;  1XLO A;  4QAY A;  2JRI B;  3U2S C;  3HRD D;  1HTO A;  3VTU A;  2NBW B;  1ET6 A;  5DPS A;  3ZRF A;  1LXD A;  3A9K A;  3AED B;  1QOG A;  3AM9 A;  3QAQ A;  1UD7 A;  4RM9 A;  1QLB B;  1HQR D;  3GS2 A;  2EMT A;  4I6L B;  4UDU C;  1BUI C;  1SEB D;  4HPM B;  1V97 A;  2RPQ A;  3WCQ A;  3ZTD A;  2KN5 A;  1T5X D;  2CHZ A;  2AL6 A;  5L83 A;  4HVB A;  1E8W A;  2M8S A;  1WGK A;  3W1S C;  1I4X A;  3R2T A;  2H88 B;  1K50 A;  2LVP A;  2QIE B;  5LNK 1;  1N6Z A;  1WJN A;  1CMX B;  2D11 A;  4XX5 A;  1UWX A;  1E7P B;  2NBU A;  3HM3 A;  1ACC A;  1UUP A;  2K3U A;  3LB8 C;  1YJI A;  2BKR B;  1FD6 A;  1ESF A;  1BT0 A;  1V8C A;  2D10 A;  1F52 A;  1VLB A;  4AOF A;  4YSX B;  3QQ8 B;  5BMG A;  3AE8 B;  4DDG D;  4DXG A;  4ACF A;  2KT7 A;  2RDH A;  2RD0 A;  1OEY A;  4AQ7 A;  3V05 A;  2GOW A;  4HPL B;  3I5J C;  1STE A;  4LCD E;  4XZ4 A;  1JML A;  3VFK A;  1UF0 A;  2KLC A;  1B1Z A;  1TGZ B;  4AUQ C;  3RNC C;  2FCM A;  5E6J A;  4MH0 E;  1WH3 A;  1Z5S B;  2OJR A;  2NPT B;  1JRU A;  1RRB A;  1T0Y A;  2N7D A;  1SBB B;  2LHE A;  4A3O A;  3R7R A;  2E3T A;  3MJW A;  3R66 C;  4HRO A;  2L05 A;  4A20 A;  4LNI A;  2KNB A;  4CYE A;  3MP9 A;  3W5V B;  3OWE B;  1JRO A;  1C4P A;  4WWO A;  2OED A;  4GIV A;  4HDO A;  3DVN V;  1I4Q A;  2MRP A;  2C7N B;  2MP2 A;  1ZGU B;  1V6E A;  2WXQ A;  2MHJ A;  4TUU A;  2JZ3 B;  2LVQ A;  4M00 A;  4ZYN A;  1TJE A;  2ASQ A;  3LYY A;  2QIL A;  1ZDX A;  3QA8 A;  2INN E;  1D6E C;  4IM0 A;  4A55 A;  1F2R C;  1Q0W B;  4AJY B;  3V6E B;  1FO4 A;  1WIA A;  4P16 A;  2KK8 A;  2K22 A;  4DHZ B;  3APC A;  1D5X C;  3HUI A;  1XO3 A;  2WXM A;  1ZXH A;  2PPH A;  2A5U A;  5G55 A;  3QJZ A;  1EF5 A;  3R3M A;  3RPF C;  3PPA A;  3U8Z A;  1YX5 B;  5IAA C;  4BFR A;  1T3Q A;  3H7S A;  2LI5 A;  1KM7 A;  5AUI A;  1WGD A;  1FM0 D;  1T6B X;  3U7D A;  3TBL D;  3P4R B;  3DBR B;  1UBI A;  1OGW A;  1GPX A;  4M8N A;  1I35 A;  2QC8 A;  3W2D A;  5HFY A;  5TR5 A;  5E6O A;  4JL9 A;  1WYW B;  2DEN B;  1JWM D;  2PIA A;  2JY6 A;  3B1L X;  2HJ1 A;  3I3T B;  4B0E A;  4W9K A;  1LGR A;  2J0M A;  4X57 B;  4YTN B;  2MCN B;  2WHI A;  3T9L A;  2O6V B;  2L7R A;  4CHK A;  4GU2 A;  4W9H A;  3EUB 2;  2C9W B;  2I2Y A;  1K53 A;  1QF6 A;  3A1Q B;  3VUW A;  4EZL A;  1TY2 A;  2WXH A;  3ZRC A;  2ACZ B;  2FE8 A;  3Q8A A;  2NTT A;  3PS6 A;  4IC7 B;  2MJD A;  3V3X A;  1UGJ A;  3RYT A;  3L54 A;  2ZZP B;  2LGI A;  2WS3 B;  3AEE B;  1F77 A;  2G45 B;  1DGJ A;  1QT9 A;  2B76 B;  3EEC A;  2MP2 B;  2L0F A;  5T8I A;  3DBH B;  3KH0 A;  3GZN I;  3VDZ A;  2J7Q B;  4YL8 A;  2HE7 A;  3ZXR A;  1E6E B;  3ZJU A;  3TEY A;  5AZH A;  1HE8 A;  4H2A A;  3ZKJ C;  4YXD B;  1TKE A;  4HJK A;  1Q10 A;  4HDQ A;  4W9D A;  4EE2 A;  2KTR B;  2KDE B;  3AE9 B;  2K8H A;  1GUA B;  3NZ3 A;  4HKQ A;  3V6C B;  2WDR B;  4KDI C;  4PYZ A;  2GBN A;  1UGM A;  3NG0 A;  4KGT A;  4NJC A;  4JGH B;  4HXD A;  1WXS A;  4E71 A;  1QIL A;  2TSS A;  3B9J A;  5D3I B;  1KLG D;  3X0W A;  2PE9 A;  2GI9 A;  1TS5 A;  3AEF B;  1WE6 A;  5CHF A;  1HTQ A;  2SEB D;  4CQN A;  3P2B A;  2KLG A;  2I1K A;  2BPS A;  5IA7 A;  1C78 A;  4IDI A;  3ZNI D;  1TS4 A;  1VZ8 A;  2D3G A;  5LXI B;  2Y3A A;  3ONS A;  4K1R B;  2R61 A;  2L00 B;  4LNF A;  3IXS A;  4BBN C;  4BKS A;  2KWU B;  2YLM A;  5C1Z A;  5EE0 A;  1IGC A;  2MW5 A;  4ZRK A;  4IM3 A;  4IWP A;  1TKG A;  3FIL B;  2D3A A;  3AN1 A;  3BK2 A;  5BMH A;  2GRI A;  4LTU A;  1L7Y A;  3S2A A;  3U52 E;  2MLB A;  1KOT A;  5EE9 A;  4K3C A;  4G11 A;  4W9G A;  2WXJ A;  2MBH A;  2LGD A;  3N3K B;  4KKI A;  2JXT A;  1FRR A;  5KHO A;  2KXJ A;  1E7V A;  1P1A A;  2DNF A;  2INC C;  2JYE A;  1F0Z A;  4LJP B;  4O1N A;  4JWS C;  4L2Y A;  3UQA A;  3ML8 A;  3PSE B;  4FJY A;  4XE0 A;  2YEP F;  4PS8 A;  3W1S A;  5AEK B;  3NVV A;  3QK0 A;  3AE7 B;  4WWM A;  5DPR A;  2CJO A;  1E8Y A;  2ON8 A;  1MG4 A;  3B2G A;  2X8X X;  1WI0 A;  2PEA A;  2JQR B;  2I1J A;  4B95 A;  3C19 A;  3MJ5 A;  1NBF C;  4BKT A;  1RFK A;  3RD2 A;  4HPP A;  4PT5 A;  3P4Q B;  1AAR A;  1N62 A;  2BS3 B;  4E3C A;  2IND C;  2I38 A;  3GOE A;  1ISN A;  1SE2 A;  2BW2 A;  5JXV A;  5AZF A;  4AJW A;  3A9J A;  2M4N A;  1JWB D;  3CF6 E;  3RNG C;  4N9F 4;  2WQY B;  5H8Y E;  1FFU A;  2BYF A;  1J8C A;  3EFU A;  1PDX A;  5D6J B;  1NYR A;  3VUX A;  2REX A;  3AE5 B;  1WYG A;  2BYE A;  4M0W B;  4BBN F;  3PVL A;  2CR5 A;  2K8C A;  1E0Z A;  2ZPY A;  1E90 A;  4DDI D;  3ZVV A;  2CKH B;  4ZHP A;  2KX3 A;  4MM3 B;  4TV3 A;  4XYC A;  1OFF A;  2ZVN A;  1CQV A;  2MQJ A;  1FNV A;  1R4N I;  1L0V B;  1NEK B;  3GZN B;  1WGR A;  4LNK A;  1GC7 A;  2Z59 B;  1VZ6 A;  3NVY A;  3URY A;  4XWW A;  3MC0 B;  1XCT L;  4P1C C;  2N9X A;  2WLB A;  2KQS A;  2ZVO A;  1LM8 B;  2G3Q B;  3AEG B;  4WWN A;  2MJE A;  1P98 A;  2LJ5 A;  2ZNV B;  4ARI A;  1VRA B;  3A4S C;  2EKI A;  2GBR A;  1N61 A;  2VH1 A;  4NPN A;  2LZ6 A;  2AWT A;  3IG3 A;  2JWU A;  2KWC A;  1ZUD 2;  3KLS X;  4TSS A;  2DBY A;  1WRI A;  3UQB A;  1QOA A;  1C3T A;  1TBE A;  4JWU C;  4A3P A;  4XDC A;  1TKY A;  4TQ1 A;  2JXX A;  4KDL B;  2ZCB A;  1ZOY B;  3VAW A;  4TMA B;  2DYM A;  4WH4 A;  4EZJ A;  2Y5P A;  2CU1 A;  1YOV B;  1WR1 A;  2D3C A;  4JLC A;  1EU3 A;  2QDF A;  4DXA B;  1JRP A;  1WX8 A;  3WAM A;  3AE6 B;  2BBC A;  3ZLZ A;  4IW0 A;  3RNA C;  4F1S A;  2GBJ A;  3Q8B A;  1JQ4 A;  4GDL B;  3V61 A;  4HLE A;  2PJH A;  3WAP A;  4MH8 A;  1IUE A;  1CK1 A;  2QHO A;  4BOS C;  3IVF A;  1L4D B;  2LRU A;  1GOZ A;  3RZF A;  2L8J A;  2WNM A;  3OJ4 B;  5CHV C;  4OZC A;  1Q1O A;  4HJG E;  1LQB A;  4F8C B;  3BVG A;  2A4Z A;  3ECI A;  4NNJ B;  3NZU A;  2KMM A;  1QOF A;  3ML9 A;  5IOI A;  1KJT A;  1P7F A;  4N6E B;  2BWE S;  1SB3 C;  1YQB A;  2LJI A;  3IAS 1;  4ANX A;  4WAF A;  3B0A A;  1WE7 A;  4IM2 A;  4XGA B;  2KYW A;  5AUK A;  3AE3 B;  1H4R A;  2KQ7 A;  2MBE A;  4EFO A;  4HK2 A;  3U7Z A;  1GG3 A;  1K8R B;  1K52 A;  1WXQ A;  2WDT B;  4URK A;  2BF8 B;  2IDY A;  3BYY B;  3UI3 A;  1QOB A;  2CS4 A;  2LVO A;  1WR6 E;  3PRZ A;  3JSV B;  4JQW C;  1KH0 A;  4C4V A;  3WIM A;  3ZJV A;  5KHQ A;  2WXK A;  4LNN A;  4ZRQ A;  1WXV A;  2K5P A;  3ALB A;  4GDK A;  2QEJ C;  2GLS A;  4IOI E;  4FBJ B;  2BT6 A;  4I6P A;  1BML C;  1V1P A;  2QMT A;  3DCG A;  2GMI C;  2NCN A;  2BB6 A;  1PGA A;  2LEK A;  4IUM B;  1C77 A;  4G0N B;  3W9C B;  4ITK A;  3PRE A;  3PZ7 A;  2WU2 B;  1OTR B;  1TTN A;  1HA5 A;  3RN9 C;  1OQY A;  3ZDT A;  4JE3 B;  3VTV A;  2WXP A;  4EUT A;  3AU4 A;  3PT2 B;  1FIQ A;  1NEN B;  3AEA B;  3PTF C;  2L3Z A;  3T3O A;  3WAN A;  3R2I A;  4W9J A;  4RH6 A;  1TS3 A;  4W9L A;  1JWA D;  4RGM A;  3NHE B;  3WA0 A;  4II2 B;  1J7C A;  3OLM D;  2KAC A;  5C3J B;  4YSY B;  2IO2 B;  3AB5 A;  2BS4 B;  1IP9 A;  1C1Y B;  3BVZ A;  1B9R A;  1J7A A;  1MHX A;  3KVF B;  4PK1 A;  4F7Z A;  3I63 C;  4MJS B;  3IFW B;  5FK9 C;  4MSQ B;  4J3O D;  5IKC M;  2G4S A;  3N1Y C;  1C79 A;  4ZRP A;  3K9O B;  3AUL A;  2AL3 A;  1TIF A;  1V2Y A;  3L13 A;  2KO3 A;  2KKC A;  1V5O A;  3ZYY X;  1C9F A;  1M4V A;  2MBB B;  4A90 A;  4RNA A;  1PYW D;  4YSZ B;  3M63 B;  3O13 A;  1P9D U;  2RDB C;  4NAW B;  2MH7 A;  4JIO U;  2C7H A;  2IPK D;  3Q3F A;  4GOC A;  2AEH A;  3Q8F A;  3KYD D;  3WAO A;  2AX5 A;  2IO3 B;  4OZB A;  3RI7 C;  2IJ0 A;  3ZTC A;  2W82 A;  3NVW A;  3E9S A;  3AEB B;  3SHQ A;  2UYZ B;  1WGY A;  5D7G A;  1WSP A;  4ANU A;  1PUT A;  3LXF A;  2ZW1 A;  3RUL A;  1V49 A;  4IWQ A;  3NJT A;  4BZA A;  1GJZ A;  1V1P B;  3DHI C;  1UBQ A;  4MAC A;  4W9C A;  3VR9 B;  3Q3O C;  2KAN A;  1YQ4 B;  2W54 A;  1FPY A;  3B08 A;  2O6V A;  3L16 A;  4ASW C;  3ZNZ B;  2ZEQ A;  2KC1 A;  4FLH A;  2EMS A;  2C5L C;  1XT9 B;  2VRR B;  2WWZ A;  3H7P B;  1MJD A;  2JT4 B;  2D3B A;  2ZPN A;  1FCC C;  4IG7 B;  5IN7 A;  1YJ1 A;  2LFI A;  1NVI D;  2D2Q A;  3MC8 A;  2V0G A;  3I9V 1;  2WXO A;  1WWT A;  2J0K A;  2K39 A;  3FAH A;  3DBH I;  1FXA A;  3X23 A;  2WXL A;  4BKG A;  1E7U A;  1Z2M A;  3MHS D;  4I6N B;  4LK0 M;  1P7E A;  3ZJT A;  3A9J B;  2FAZ A;  1D5Z C;  5EDS A;  4FJV B;  5G2N A;  3TJP A;  1EM7 A;  3CMM B;  3ZDM C;  5JHA A;  5H92 C;  2LMC A;  4FXC A;  3RCZ A;  4OVU A;  5LXH A;  1S3S G;  2DHZ A;  2MEK A;  3TIX A;  1SIF A;  5C23 A;  5TSS A;  2O2V A;  4FUL A;  3MC9 A;  1WM2 A;  3DDC B;  2DLB A;  1PQS A;  4M0W A;  3QHT A;  4BKS D;  3NY5 A;  1JAL A;  3VRA B;  3ABV B;  4NAW A;  2BGF A;  1G6J A;  5GMV A;  4N59 A;  4KIK B;  5IO9 A;  2OOB B;  1WXA A;  3MTN B;  5BYR A;  2KN4 A;  1IBX A;  3NS1 A;  1KLV A;  4USA A;  1NI2 A;  3DVG Y;  1XF5 L;  1UNS A;  2DWQ A;  2Z0D B;  3PO0 A;  4M02 A;  4IWO A;  5BMI A;  3VTW A;  3SEB A;  2J42 A;  3DVG X;  2KTF A;  1J0G A;  3UIO B;  5J17 A;  2INP E;  3U30 A;  3NRZ A;  2M17 A;  4GXB A;  4J6I A;  5CX3 A;  1MG8 A;  3FKY A;  4A6Q A;  2C7M B;  4WAA A;  2MA9 B;  2VH2 A;  1TYG B;  2N1V A;  3FIL A;  4MT5 A;  2FUH B;  1S1Q B;  2KD0 A;  2PKO A;  3MHZ A;  2G1E A;  1V81 A;  1WZ3 A;  4FA6 A;  2JWZ A;  2MBQ A;  4ICU A;  4RGN A;  1F1H A;  1TZ1 A;  3BII D;  1FEH A;  1YIW A;  1SJH D;  3KWV A;  2WDV B;  3SFD B;  2XEW A;  1VJK A;  4ZOH C;  5BO4 B;  3Q3M C;  1RM6 C;  4LDT B;  3BVM A;  4B6W A;  2C60 A;  3JYU A;  4W9I A;  4K7W A;  3Q2A C;  3VR8 B;  1YNT E;  4GDL A;  5EE3 A;  4OHJ A;  2KFK A;  2L83 A;  2WX0 A;  2XK5 B;  1GB1 A;  4KSK C;  2BB5 A;  4OVZ A;  2BQQ A;  1GB4 A;  4CO7 A;  5J18 A;  3PRM B;  2O2V B;  3FC4 A;  1ENF A;  1RFA A;  2K6D B;  5EE1 A;  3Q6B A;  3L4P A;  2KZR A;  2W55 A;  1WF9 A;  1SE4 A;  4KIK A;  2QCZ A;  3GE3 C;  2UU7 A;  3DBL B;  5CTR C;  3ZNH B;  1V1O A;  3BWU D;  4S17 A;  2DYO A;  2JRH A;  2MWS B;  1WGH A;  2L76 A;  1KFY B;  2J4X A;  4NQK E;  1E8X A;  5GXG B;  3N20 C;  3ZQ4 A;  1U4A A;  2L52 A;  2IY0 B;  4N58 A;  2SAK A;  2EKE C;  5FKA C;  4GLS C;  5E6N A;  4IKG A;  1J7B A;  3P42 A;  3D32 A;  3CST A;  1SSN A;  4AWJ A;  1OEY J;  2M0A A;  1UWM A;  2RDG A;  4NAM A;  4C4V B;  3DHH C;  3L0W B;  1SE9 A;  2PMV A;  1YMH E;  3EC8 A;  2PVG C;  4GDK B;  1ET9 A;  2AQ3 B;  2R2O A;  2RGF A;  4RMA A;  1L6V A;  3EHV A;  1C4A A;  5HG2 A;  1XEE A;  2N4F A;  3T8M A;  1LO5 D;  1EF1 A;  1L5P A;  3NVZ A;  4BOZ B;  1R4N B;  2YVC A;  4G3X B;  2UWQ A;  3DBS A;  2KQ4 X;  3ETR A;  2N9K A;  2IZV B;  1VZ7 A;  1JWU D;  3HHM A;  4LLG M;  4EKU A;  1PGX A;  4RGT A;  1JWS D;  4DBG A;  2WXN A;  1DOY A;  1V5T A;  4RF0 A;  4P7I A;  1I4P A;  2MBO A;  3TEW A;  2GBK A;  4NJ7 A;  4R3D A;  3AE4 B;  1WJ4 A;  4ANV A;  4ZDV A;  1YN5 A;  4EOY A;  1V80 A;  1MFW A;  4GSW A;  2HD5 B;  1DOX A;  2XK5 A;  1HZ5 A;  2DX5 B;  2W9N A;  1FCL A;  3SDL C;  4BAX A;  1UH6 A;  4OZA A;  4Q2J A;  4MGZ E;  3AXC A;  2HJ8 A;  3EGR A;  4AS1 A;  3VQI A;  4NJ6 A;  4ANW A;  1XLN A;  2IGD A;  4WIP A;  3TSS A;  3AMZ A;  5JH5 C;  2D5G A;  1YJJ A;  2GBM A;  4DHJ B;  1XLQ A;  3Q8E A;  4FHK A;  1LFD A;  3IAM 1;  4L23 A;  4ZYS A;  2KJR A;  3QAR A;  4AP4 C;  1CZP A;  1MPE A;  3Q3N C;  2AQ1 B;  5E6P A;  2Y5B B;  1BXT A;  1KTK A;  2DYB A;  3ENE A;  3KW5 B;  3DBL I;  4W9F A;  3C0R B;  5FR6 A;  3HIZ A;  2IGG A;  5I4D A;  2K6Q A;  1AN8 A;  2MX2 A;  2L1A A;  4D2K A;  1I4R A;  3OG5 A;  2FBW B;  2JVC A;  3TEX A;  1CJE A;  4K7S A;  4WQM A;  3GE8 C;  5HKH A;  3BK1 A;  2R2Q A;  1AW7 A;  4MGI E;  1FFV A;  4LDT D;  2D07 B;  3L08 A;  3PZD A;  3ZO5 B;  1OQR A;  1P0R A;  4A9A A;  2WXG A;  3PLV A;  4JPS A;  2V3S A;  2M56 B;  2N9E B;  1ZXI A;  2J52 A;  3A9K B;  2LWP A;  4FAD A;  5HHD G;  1EUV B;  3JVZ X;  3UF8 A;  4DHJ D;  2WDQ B;  3TL5 A;  2KVR A;  5DPT A;  2FIF A;  3QX1 A;  4NQL B;  2PE6 B;  1E9M A;  2HTM E;  1N5X A;  3KUD B;  4DHZ E;  5JHB A;  2DZI A;  1F9J A;  1QZE A;  4HWI B;  3RNE C;  1WZ0 A;  4WJO A;  2JSV X;  4ICV A;  3H8H A;  3KWL A;  3TUO A;  2WXF A;  3TMP B;  2LUM A;  3BYT B;  2BS2 B;  2ZNV C;  1T0R C;  2K25 A;  1VDV A;  3N1X C;  3R7Q A;  1A70 A;  1I7H A;  3W1Y A;  4ARC A;  1HEZ E;  1OQQ A;  2NMQ A;  5JZE B;  1T0S C;  3BY4 B;  1FMA D;  3DWG C;  2V3P A;  3KUC B;  1FNW A;  4DXF A;  2FCN A;  1H8C A;  2KAJ A;  3A33 B;  4WWP A;  2KHW B;  2NR2 A;  2FID A;  4WJP A;  3APF A;  3ZGZ A;  3H1U A;  4C80 A;  3QC8 B;  2BVC A;  2KDB A;  3AEC B;  3DHG C;  2GB1 A;  3P4S B;  1YD8 U;  3IT4 B;  2J53 A;  3CIR B;  2MSE D;  1FRD A;  3Q3J A;  3BZD B;  3IHP C;  2JZP A;  4KSL C;  1L0Y B;  2MJ3 A;  2CHX A;  2XN9 C;  2G9H D;  2KDI A;  4WQO B;  2DAJ A;  2LXC A;  3PV1 A;  3RFZ B;  2WX1 A;  4YWG G;  3PHX B;  1D4B A;  1SF0 A;  4PS7 A;  3PZ8 A;  5IP4 D;  3SR6 A;  4OVV A;  3GB1 A;  3RZW C;  4C56 C;  2LGY A;  3NUH B;  2DZM A;  5L95 C;  1RAX A;  2G4D B;  1GC6 A;  4LNO A;  1DYQ A;  2DAF A;  3O65 B;  4C7Y A;  5G5H A;  4C00 A;  2AQ2 B;  2JPH A;  1N63 A;  3TCA A;  1F2R I;  4WJN A;  4C7Z A;  3N32 A;  2LGX A;  3PHW B;  2XBB C;  1V9J A;  1WMH A;  2LUE A;  5MPO A;  3JW0 X;  3M95 A;  3KYC D;  1L6U A;  3Q69 A;  4DWF A;  4DK5 A;  2K1F A;  2ZJD A;  2N7J A;  4MGK E;  3B2F A;  2M0X A;  2KJH B;  2VZK D;  3NZS A;  1WJU A;  1R4M B;  1IGD A;  4HRS A;  4MSM B;  3TEZ A;  2KDF B;  4GGQ A;  1MVK A;  3HM6 X;  1EWC A;  2KMC A;  5C2T B;  1D3Z A;  3SU8 X;  2KFK B;  3DPD A;  2DZK A;  3N1Z C;  2M19 A;  4XDD A;  1SIJ A;  3UIP B;  2WP9 B;  2JUO A;  3L17 A;  3J9C A;  3M62 B;  2N1W A;  5D3D A;  3EFC A;  1KRH A;  4GB9 A;  3IT6 B;  4XC2 A;  1HZ6 A;  3L10 B;  2NBV B;  1X1M A;  1WX7 A;  2BYV E;  4HKZ E;  1YX6 B;  1K51 A;  2LRW A;  2KOX A;  4K81 A;  4M8M A;  1EO6 A;  4OW0 A;  3I57 A;  3K9P B;  4MM3 A;  1L2N A;  3P4P B;  3CWI A;  1YN3 A;  2RR9 A;  4FN2 A;  2KC2 A;  1N5W A;  1XD3 B;  4GN1 A;  4WUR A;  1L0X B;  2BYT A;  5DPW A;  2ZW0 A;  4KZ0 A;  1NYQ A;  3PGE A;  4TQ0 A;  3APD A;  4RGO S;  5D2M B;  5FR3 A;  2NS5 A;  4K3B A;  2V4I B;  2N9P C;  1E5W A;  3RT3 B;  3MFG A;  2FUG 1;  2ICI A;  2XNA C;  2O6V D;  3SFE B;  3A1Q A;  3SD5 A;  1XXG A;  1RLF A;  1P3Q U;  2X38 A;  2LXA A;  3QWZ B;  3V60 A;  1IPG A;  1JW9 D;  1R7S A;  2M1M A;  2N7E A;  2HTH A;  5D94 A;  3E56 A;  3RNF C;  1XLP A;  4BVU C;  3ZUN A;  1ROE A;  3PLU A;  4K7U A;  1PFD A;  1EWY C;  2LD9 A;  3N9Y C;  2JU6 X;  1Y56 A;  2CU3 A;  2ONQ A;  2PLP A;  3Q14 C;  4REZ A;  3BIN A;  3DOW A;  1ZE3 D;  1WX9 A;  5J2R A;  2NPT A;  2LAS A;  2WU5 B;  2WGS A;  2CJN A;  2IBI B;  3QCA A;  3VRB B;  3JSV A;  5CHW A;  1SXT A;  4W9E A;  3VUY A;  2WXI A;  2KWD A;  2OJW A;  2RPV A;  3NOB A;  2KVZ A;  1ZDV A;  1L4Z B;  1TZO A;  4G50 A;  3RMK C;  2W3R A;  1R4M I;  2LGS A;  4PYU A;  4GMV A;  4L1B A;  1RYJ A;  3EA6 A;  3N30 A;  3OJ3 A;  1WGG A;  3R8B A;  2Y5C A;  1WXM A;  4HCN B;  4KX6 B;  3U4E G;  2K8B A;  2NTS A;  3P63 A;  2JX5 A;  4KGR A;  4ZRI A;  1KF6 B;  4A8X C;  1WJ6 A;  3ZNG C;  4DQO C;  2YEP B;  4YTP B;  4WJQ A;  4HCP B;  2L0T A;  4M01 A;  4II3 B;  4NY0 A;  1HXY D;  2AYO B;  4US9 A;  1WY8 A;  3AU5 A;  1AYF A;  5AZG A;  2KMA A;  3C8Y A;  2PTL A;  1PGB A;  2N0S B;  4TKN A;  3LDZ E;  1WRD B;  1I4G A;  3AH7 A;  4EEW A;  2JZZ A;  2W3S A;  3HK0 A;  4LJO B;  2LHD A;  1V86 A;  2IO0 B;  4MDK E;  3PRP B;  1AWD A;  1UZX B;  3NS8 A;  1VR9 A;  3VH4 B;  3H9D A;  2IO1 B;  1M94 A;  1I4H A;  2E6X A;  2DZJ A;  4YT0 B;  4MGY E;  2FCS A;  1VCB A;  1WM3 A;  3CSF A;  2J0J A;  3UIN B;  1D5M C;  2WYQ A;  4KGS A;  2CHW A;  4EZK A;  3GP7 A;  4JX1 C;  1YN4 A;  2RSU A;  1TT5 B;  1WFY A;  4B0M A;  3OAW A;  1ZPS A;  1XQQ A;  1ZP0 B;  2NVU I;  2IGH A;  1T0Q C;  4YTM B;  1N60 A;  3DVN U;  1C4C A;  2KDM A;  1SGH A;  2KX0 A;  3AV8 A;  3AE1 B;  4P1B C;  1MHH E;  2JYT A;  4RCO A;  4KKJ A;  3T3N A;  3AI5 A;  3IBE A;  4PS3 A;  4FJZ A;  2PVO D;  3W5U B;  4RF1 A;  4NZL B;  2FNJ B;  2V3N A;  1UEL A;  2K0P A;  5G5G A;  1TS2 A;  1C76 A;  1YQ3 B;  3ZW3 A;  2PW9 A;  4MJS A;  3M3J A;  3RUI B;  4E74 A;  3H6N A;  3LJ3 A;  2KTR A;  2KWV B;  2ZCC A;  4RFB A;  1FXT B;  4ZRJ A;  2IY1 B;  2BTE A;  3UGB B;  1QQR A;  2Z8L A;  1NDD A;  2JF5 A;  4HEA 1;  4XWT A; 
#chains in the Genus database with same CATH homology
 5EE0 A;  2JSV X;  1V1P B;  4MAC A;  1IGC A;  3H8H A;  3VR9 B;  3KWL A;  3TUO A;  2WXF A;  2LUM A;  5BYQ A;  1TKG A;  3BYT B;  1YQ4 B;  2W54 A;  3FIL B;  2BS2 B;  5BYS A;  1VDV A;  2RMM A;  3AN1 A;  3BK2 A;  5BMH A;  3DWM A;  2GRI A;  4LTU A;  1A70 A;  1I7H A;  4ARC A;  2H89 B;  1HEZ E;  1OQQ A;  2NMQ A;  3U52 E;  5EE9 A;  2QJL A;  4ZHO A;  1FMA D;  2WXJ A;  1FCC C;  3KQ4 A;  2LFI A;  2Q5W D;  2L32 A;  3DWG C;  1FXI A;  1NVI D;  4KKI A;  2V3P A;  1NI3 A;  2JXT A;  1E10 A;  1FRR A;  1FNW A;  4DXF A;  2V0G A;  3I9V 1;  2KAJ A;  2WXO A;  1MI0 A;  1WWT A;  3HVD A;  1JCK B;  1TY0 A;  3ZGZ A;  3FAH A;  2JYE A;  4C80 A;  2HDE A;  1FXA A;  4O1N A;  1F0Z A;  4JWS C;  2WXL A;  4L2Y A;  2N9L A;  3AEC B;  2YEP F;  1RWS A;  4XE0 A;  2GB1 A;  3W1S A;  3P4S B;  3NVV A;  3AE7 B;  4LK0 M;  1SJE D;  1P7E A;  3IT4 B;  1IBX B;  2J53 A;  3ZJT A;  2EEL A;  4WWM A;  3CIR B;  1D5Z C;  1FRD A;  1KLU D;  1QKZ A;  3BZD B;  2JZP A;  2QSD A;  1L0Y B;  3AE2 B;  3HVZ A;  1EM7 A;  2MJ3 A;  1XCQ L;  2XN9 C;  1SE3 A;  2LMC A;  2CJO A;  4FXC A;  5H92 C;  3Q8C A;  2ON8 A;  2G9H D;  3B2G A;  1DOI A;  1EU4 A;  2VZK B;  2MEK A;  2JQR B;  4US8 A;  3RFZ B;  4P6V F;  5TSS A;  5HI1 A;  3MJ5 A;  4YWG G;  1RFK A;  1D4B A;  1SF0 A;  2DLB A;  2OHF A;  3PZ8 A;  4PT5 A;  4M0W A;  3P4Q B;  2WXR A;  1GAQ B;  1JAL A;  1N62 A;  3SR6 A;  3GB1 A;  2BS3 B;  3P1M A;  4C56 C;  1FNU A;  2K9X A;  3VRA B;  3ABV B;  3NUH B;  1XLO A;  4N59 A;  2I38 A;  3U2S C;  3HRD D;  5BYR A;  1SE2 A;  2BW2 A;  1DYQ A;  4C7Y A;  1ET6 A;  2KN4 A;  5JXV A;  1IBX A;  5G5H A;  3NS1 A;  2AQ2 B;  4USA A;  1JWB D;  1XF5 L;  1UNS A;  2DWQ A;  1N63 A;  3PO0 A;  1F2R I;  4C7Z A;  5BMI A;  3AED B;  1QOG A;  3AM9 A;  2WQY B;  5H8Y E;  3SEB A;  1FFU A;  5MPO A;  2J42 A;  1QLB B;  1HQR D;  3GS2 A;  1PDX A;  1L6U A;  2INP E;  3Q69 A;  4UDU C;  1BUI C;  1SEB D;  3NRZ A;  1NYR A;  2N7J A;  1V97 A;  3B2F A;  3WCQ A;  3AE5 B;  1WYG A;  1T5X D;  2VZK D;  4A6Q A;  1E0Z A;  1IGD A;  1WGK A;  1I4X A;  1TYG B;  3R2T A;  4HRS A;  2H88 B;  3TEZ A;  4ZHP A;  3FIL A;  1K50 A;  4MT5 A;  4MM3 B;  1MVK A;  1EWC A;  2QIE B;  2PKO A;  3MHZ A;  2G1E A;  5C2T B;  5LNK 1;  1OFF A;  1CQV A;  2M19 A;  4XDD A;  1SIJ A;  4RGN A;  1UWX A;  1FNV A;  1E7P B;  3BII D;  1L0V B;  2WP9 B;  1NEK B;  1ACC A;  1VZ6 A;  3J9C A;  1UUP A;  1FEH A;  2K3U A;  3LB8 C;  1SJH D;  3NVY A;  1YJI A;  3KWV A;  3URY A;  4XWW A;  1FD6 A;  1ESF A;  2WDV B;  3MC0 B;  3SFD B;  1XCT L;  5D3D A;  1V8C A;  1VJK A;  4ZOH C;  1KRH A;  2WLB A;  1VLB A;  1RM6 C;  3IT6 B;  3AEG B;  1HZ6 A;  4YSX B;  2MJE A;  3BVM A;  5BMG A;  4ARI A;  3AE8 B;  4HKZ E;  1K51 A;  4DXG A;  1VRA B;  2EKI A;  4OW0 A;  1N61 A;  2RDH A;  3I57 A;  3VR8 B;  3P4P B;  1YNT E;  3CWI A;  1YN3 A;  4AQ7 A;  3V05 A;  2JWU A;  5EE3 A;  4OHJ A;  1N5W A;  1STE A;  1ZUD 2;  3KLS X;  4WUR A;  2L83 A;  4TSS A;  2DBY A;  1JML A;  1L0X B;  2BYT A;  1GB1 A;  1WRI A;  2ZW0 A;  2BB5 A;  1NYQ A;  4TQ0 A;  4OVZ A;  1QOA A;  4RGO S;  1B1Z A;  1GB4 A;  5FR3 A;  4JWU C;  5E6J A;  4XDC A;  1TKY A;  4TQ1 A;  2V4I B;  1ZOY B;  1SBB B;  3MFG A;  2LHE A;  3FC4 A;  4TMA B;  1ENF A;  2FUG 1;  2DYM A;  2E3T A;  2ICI A;  2XNA C;  5EE1 A;  4WH4 A;  3L4P A;  4HRO A;  3SFE B;  2W55 A;  2Y5P A;  1XXG A;  2X38 A;  1SE4 A;  1JW9 D;  1R7S A;  1EU3 A;  1JRP A;  3AE6 B;  3E56 A;  3MP9 A;  2BBC A;  1XLP A;  3W5V B;  3OWE B;  1JRO A;  3Q8B A;  1C4P A;  1JQ4 A;  2OED A;  4GDL B;  1V1O A;  3BWU D;  2DYO A;  1I4Q A;  1ROE A;  1PFD A;  1EWY C;  3N9Y C;  2JU6 X;  4MH8 A;  1Y56 A;  2CU3 A;  1IUE A;  1CK1 A;  1KFY B;  2ONQ A;  2PLP A;  2WXQ A;  4REZ A;  1L4D B;  1ZE3 D;  2J4X A;  5GXG B;  3ZQ4 A;  2L52 A;  1GOZ A;  1TJE A;  3LYY A;  2SAK A;  4N58 A;  2QIL A;  5FKA C;  1ZDX A;  4GLS C;  2WNM A;  2WU5 B;  4IKG A;  1J7B A;  2INN E;  1D6E C;  3P42 A;  4HJG E;  4OZC A;  4A55 A;  2CJN A;  1F2R C;  1SSN A;  3BVG A;  2M0A A;  1FO4 A;  3VRB B;  4P16 A;  1UWM A;  2RDG A;  1SXT A;  4NAM A;  2K22 A;  2KMM A;  1QOF A;  2WXI A;  1D5X C;  2PMV A;  2KWD A;  1YMH E;  3HUI A;  2RPV A;  1P7F A;  2PVG C;  4N6E B;  1XO3 A;  2WXM A;  1SB3 C;  1ZXH A;  4GDK B;  1ET9 A;  2AQ3 B;  2LJI A;  3IAS 1;  1ZDV A;  4WAF A;  1L4Z B;  1TZO A;  1L6V A;  1C4A A;  5AUK A;  2W3R A;  1XEE A;  3AE3 B;  5HG2 A;  3RPF C;  1LO5 D;  3NVZ A;  1L5P A;  4L1B A;  1RYJ A;  3EA6 A;  3R8B A;  3U7Z A;  1T3Q A;  2Y5C A;  4KX6 B;  3U4E G;  1K52 A;  1WXQ A;  2NTS A;  2IDY A;  2KQ4 X;  3BYY B;  3ETR A;  2N9K A;  3P63 A;  5AUI A;  3UI3 A;  2JX5 A;  4KGR A;  1VZ7 A;  1FM0 D;  1JWU D;  1T6B X;  4LLG M;  1PGX A;  4RGT A;  1KF6 B;  1QOB A;  1JWS D;  4A8X C;  1KH0 A;  3P4R B;  4DQO C;  3ZJV A;  2WXN A;  1DOY A;  1GPX A;  4RF0 A;  2YEP B;  2WXK A;  1I4P A;  4YTP B;  4ZRQ A;  2K5P A;  3TEW A;  4R3D A;  3AE4 B;  3W2D A;  5HFY A;  2QEJ C;  1YN5 A;  4IOI E;  1JWM D;  2PIA A;  2BT6 A;  1HXY D;  4B0E A;  1DOX A;  1HZ5 A;  1BML C;  4US9 A;  1V1P A;  2QMT A;  1AYF A;  2BB6 A;  3C8Y A;  1PGA A;  2PTL A;  4YTN B;  2LEK A;  1FCL A;  1C77 A;  1PGB A;  2N0S B;  3W9C B;  4ITK A;  4OZA A;  3PZ7 A;  4Q2J A;  2WU2 B;  1I4G A;  3AH7 A;  3EGR A;  4AS1 A;  2W3S A;  1HA5 A;  3VQI A;  3EUB 2;  2I2Y A;  1K53 A;  1XLN A;  2IGD A;  2LHD A;  4JE3 B;  4WIP A;  1QF6 A;  3TSS A;  2WXP A;  1TY2 A;  2WXH A;  1FIQ A;  3AMZ A;  2ACZ B;  1AWD A;  2FE8 A;  1NEN B;  2D5G A;  1VR9 A;  3AEA B;  3Q8A A;  2NTT A;  1YJJ A;  2MJD A;  1XLQ A;  3V3X A;  1I4H A;  1UGJ A;  2E6X A;  3T3O A;  4YT0 B;  2LGI A;  3Q8E A;  2WS3 B;  3AEE B;  1F77 A;  3R2I A;  1DGJ A;  1QT9 A;  4RH6 A;  1TS3 A;  1JWA D;  2B76 B;  3IAM 1;  4RGM A;  4L23 A;  1J7C A;  4ZYS A;  5T8I A;  1D5M C;  4KGS A;  2KAC A;  5C3J B;  1CZP A;  4YSY B;  3GP7 A;  1MPE A;  4JX1 C;  1YN4 A;  3AB5 A;  2BS4 B;  1E6E B;  2AQ1 B;  3BVZ A;  1B9R A;  4B0M A;  1J7A A;  1BXT A;  1KTK A;  1MHX A;  1ZPS A;  3ZJU A;  1ZP0 B;  3TEY A;  2IGH A;  4H2A A;  4YTM B;  5FK9 C;  1N60 A;  4J3O D;  4YXD B;  1TKE A;  1C4C A;  1Q10 A;  2IGG A;  2KDM A;  5I4D A;  1C79 A;  4EE2 A;  1AN8 A;  4ZRP A;  3AE9 B;  2L1A A;  3NZ3 A;  4D2K A;  1I4R A;  4HKQ A;  2FBW B;  3AV8 A;  2WDR B;  1CJE A;  3AE1 B;  3TEX A;  1MHH E;  2JYT A;  4WQM A;  4RCO A;  4KKJ A;  3BK1 A;  1M4V A;  3ZYY X;  3T3N A;  1C9F A;  1AW7 A;  1FFV A;  4A90 A;  4RNA A;  1PYW D;  4YSZ B;  3O13 A;  4KGT A;  4NJC A;  2MH7 A;  4NAW B;  1OQR A;  4A9A A;  1QIL A;  2IPK D;  2PVO D;  2WXG A;  4JPS A;  3W5U B;  4RF1 A;  2TSS A;  3B9J A;  4NZL B;  5D3I B;  2M56 B;  2V3N A;  1KLG D;  1ZXI A;  2K0P A;  3Q8F A;  5G5G A;  2GI9 A;  1TS2 A;  2AX5 A;  1C76 A;  2J52 A;  1YQ3 B;  4OZB A;  1TS5 A;  3AEF B;  5HHD G;  2IJ0 A;  2PW9 A;  2SEB D;  4CQN A;  2W82 A;  3NVW A;  3E9S A;  3AEB B;  2WDQ B;  1C78 A;  4IDI A;  1TS4 A;  1VZ8 A;  2Y3A A;  4RFB A;  1E9M A;  2HTM E;  1N5X A;  5D7G A;  1WSP A;  2R61 A;  2BTE A;  1PUT A;  1QQR A;  2Z8L A;  3LXF A;  3IXS A;  4HEA 1;  4XWT A;  2ZW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...