1PDXA

Putidaredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PUTIDAREDOXIN)
publication title A refined model for the solution structure of oxidized putidaredoxin.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transfer
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pdxA00
2WDQB 1NENB 3NRZA 4JWUC 1JQ4A 1CZPA 1WYGA 1JWAD 4P6VF 1FMAD 5AUKA 1B9RA 2N0SB 2BS2B 2WDVB 2W55A 1J7BA 3AEGB 3HVZA 3W9CB 1VDVA 2L83A 2W3RA 1E10A 1ZXIA 1NYQA 2HTME 1WGKA 3AEDB 1XO3A 2G1EA 3AEFB 2MJEA 3NVVA 2W54A 5EE3A 1NYRA 3AEEB 1NI3A 3WCQA 1PDXA 5G5GA 3AB5A 1JW9D 3P1MA 1E7PB 1YQ3B 2DWQA 2K22A 1GAQB 4ZHOA 4FXCA 4IDIA 2OHFA 4C7ZA 4HROA 2H88B 1QOBA 1FFVA 3ETRA 3PO0A 3CWIA 1JRPA 4WWMA 1XLOA 2PKOA 3NVYA 1N5WA 4JWSC 2CJOA 2WP9B 1VJKA 1JALA 1EWYC 3SFEB 1A70A 2QJLA 4USAA 3VRBB 1YJIA 1KRHA 1YQ4B 3FC4A 2PVGC 1V8CA 4N59A 5AUIA 3AE5B 1KF6B 2M19A 3W5VB 3AE1B 3AH7A 1F0ZA 3AE4B 2K9XA 1ROEA 4N58A 4YSYB 1FIQA 5H92C 3SFDB 1SB3C 3ABVB 4US8A 1NEKB 2W3SA 1XLPA 2Q5WD 3EUB2 4YTMB 2MJ3A 2MJDA 4YSZB 1AWDA 1N5XA 1E6EB 1L6VA 1YJJA 2WLBA 3AE8B 1QF6A 4ZHPA 3LXFA 1JWBD 2KAJA 1DGJA 3BIID 3P4SB 3VR9B 4ZOHC 3KWLA 3NVZA 2E3TA 3NVWA 4YT0B 1UWMA 2CU3A 2M56B 1J7CA 1J7AA 2BS4B 2DBYA 2FBWB 3AE6B 5C3JB 1QLBB 1RM6C 1N60A 4YTPB 4HRSA 5EE0A 1FRDA 1PFDA 4US9A 3P63A 1QOAA 3SR6A 1T3QA 3W5UB 3AM9A 1SIJA 3AECB 3RPFC 2EKIA 3VRAB 1XLNA 1N61A 1QOGA 3AE2B 1TKEA 1FXAA 1N63A 4WQMA 1R7SA 3P4PB 4A9AA 3DWGC 2QIEB 1FM0D 1RYJA 1DOYA 2Y5CA 1IUEA 3LB8C 2H89B 1WWTA 1TYGB 1JROA 1E0ZA 5GXGB 2KMMA 1SF0A 2JX5A 2LEKA 1TKGA 2WU5B 1FXIA 1OQQA 1FRRA 3P4QB 1ZUD2 1DOIA 1AYFA 2ACZB 1V97A 3VR8B 2L52A 5EE1A 5EE9A 2BS3B 1VLBA 1L5PA 1OFFA 3HRDD 3CIRB 1L0VB 2MH7A 3P4RB 4YXDB 1GPXA 2WS3B 1ZOYB 3AV8A 1NVID 2WQYB 1ZP0B 3B9JA 5MPOA 3AE7B 1QOFA 4N6EB 3AMZA 2K5PA 1RFKA 3B2GA 3AEAB 5H8YE 1FFUA 3L4PA 3AE3B 2JQRB 4JX1C 3FAHA 1CJEA 2AX5A 2PIAA 4LTUA 1TKYA 4YTNB 4YSXB 1RWSA 1TJEA 3AE9B 5G5HA 5C2TB 1OQRA 1QT9A 1FO4A 1N62A 3B2FA 3HUIA 4KX6B 2B76B 2PVOD 3ZYYX 4ITKA 3DWMA 2CJNA 2BT6A 1DOXA 3NS1A 1WRIA 3AEBB 4C7YA 2WDRB 3AN1A 1KFYB 1L6UA 1PUTA 1WXQA 2WU2B 4C80A 1XLQA 1I7HA 1E9MA
chains in the Genus database with same CATH superfamily
4FJVB 4PYZA 4RH6A 4JQWC 2WDVB 3AEGB 3HVZA 1A5RA 2EMTA 2G1EA 3Q69A 5EE3A 3CMMB 3P1MA 2LMCA 2LRUA 2CU1A 3ZO5B 1F52A 4BZAA 2GI9A 4A8XC 1D4BA 1XLOA 1JWSD 3BWUD 3NVYA 1VJKA 4W9IA 4USAA 2KX3A 3A9JA 4DBGA 2KD0A 2I2YA 4BKTA 3ONSA 4C4VB 4PS3A 5IP4D 3W1YA 2Q5WD 2MJDA 4ZRKA 2XK5B 3N1XC 1QF6A 1GC6A 4ZHPA 4II3B 4WJNA 4ZOHC 5C23A 4E74A 3ZRCA 2M56B 2PLPA 3A33B 2ZPNA 5EDSA 3H7PB 5C3JB 2ZW0A 4WAAA 2WX1A 1F2RC 4A9AA 2WX0A 4LDTD 3ZJVA 2LEKA 5AZHA 1V1PA 2NBWB 3OAWA 3RN9C 3N3KB 1D5XC 1OTRB 4ANUA 3U7DA 1GPXA 2NBVB 4W9LA 4D2KA 1WJNA 3RZFA 4DXAB 1VCBA 3A1QB 2LRWA 5DPSA 4ZRIA 3Q8EA 1DYQA 4HPMB 1DOXA 1GC7A 1ZW7A 3AN1A 4ZRJA 1PUTA 5G55A 1XLQA 1I4RA 1TZ1A 2RDHA 3UQAA 1Y56A 4P6VF 1YIWA 3ZVVA 2NR2A 5KHQA 2DYOA 3PRPB 4GB9A 2L76A 1WGKA 2RGFA 1XO3A 2CS4A 4LJOB 1AN8A 3AEEB 1C79A 2KJHB 3DBHI 1GAQB 2L05A 1QILA 4KVGB 2IO2B 1N5WA 2QSDA 5DPTA 1TY0A 3VRBB 2JU6X 4G11A 3OJ4B 5AUIA 4DDID 3ZNHB 2R2QA 3ABVB 2HE7A 2J0KA 2LGYA 4BKSD 4IM0A 3BINA 3EA6A 1P1AA 2O6VD 2UYZB 1J8CA 4JLCA 2L0FA 4P7IA 2ZJDA 1C9FA 3V60A 4K1RB 2QC8A 1R7SA 2BKRB 4IUMB 2H89B 4PK1A 3KUCB 1E0ZA 1RAXA 2K25A 4IWPA 2V4LA 3GP7A 1MFWA 3P42A 2O2VA 2K1FA 3AV8A 2LVOA 4MEMA 1X1MA 3IT4B 5MPOA 2WXRA 3C19A 4JPSA 2HJ1A 3U30A 4FADA 1OEYA 3Q14C 1E8XA 1UH6A 1TJEA 2KDBA 5C2TB 3QCAA 1KM7A 3H6NA 4W9HA 1FD6A 3PZ7A 2IY0B 1WYWB 4FHKA 2IPKD 1V81A 1PGAA 1QKZA 2JYTA 1CZPA 4Q2JA 4NQKE 4NZLB 5JH5C 5HKHA 1WM3A 1WX9A 2JVCA 2MHJA 4QAYA 4GDKA 5FKAC 1LQBA 5LXHA 4ZHOA 2M4NA 4IDIA 1E8ZA 4HROA 5IKCM 4IOIE 2JWUA 3BVMA 3D32A 3A4SC 2MBEA 4I6LB 1AW7A 1XD3B 3DBLI 4RGOS 3DBRB 4K7SA 4M8MA 2EELA 4GIVA 1ZKHA 3RNFC 1F0ZA 4W9JA 2D3CA 3TEYA 1I4HA 4B95A 3JW0X 1AWDA 2INPE 4MH8A 2LUMA 1VZ8A 1MPEA 2PW9A 2WYQA 4W9EA 2FIDA 1J0GA 2BYVE 3VUXA 3TMPB 3N32A 2GB1A 1C3TA 3ZNZB 2RDBC 3VTUA 2LUEA 1SIFA 5I4DA 2V4IB 3VR8B 4NJ7A 1FNVA 2MEKA 1L5PA 1YD8U 2Z8LA 4HCNB 2A4ZA 1IGCA 4ZDVA 4KGSA 3KYDD 3DBSA 1WIAA 2Y3AA 2N1VA 1FFUA 4FJYA 1V6EA 2BWES 3TCAA 3R2TA 1Y8RC 1OQRA 1XEEA 5FR6A 2N7JA 4ITKA 3GZNI 4C4VA 1KH0A 2LJ5A 3BYTB 1ISNA 1FEHA 3AU4A 1WXQA 2IO1B 1WXSA 3KLSX 2XBBC 1T6BX 1UBQA 2LD9A 2N9XA 2R2OA 2MSED 1WYGA 3DCGA 1I35A 4GSWA 4BBNC 3PZ8A 1UF0A 2CKHB 2ZEQA 1NYQA 2JYEA 3NVVA 1OGWA 3OJ3A 2DWQA 2Y5BB 4RFBA 3ML9A 4TUUA 1MG8A 2OHFA 1BT0A 1FFVA 1MHHE 4HKZE 5HI1A 2KXJA 4G3XB 2K9XA 3VH4B 5H92C 3SFDB 3QK0A 1YX5B 3ZNID 1NEKB 3WALA 1FNUA 1ET9A 5AZGA 3A1QA 2IJ0A 2J7QB 5J17A 1TT5B 2B3AA 1J7AA 2JF5A 3L0WB 4ICVA 2IZVB 3MC0B 3GOEA 2FNJB 2MWSB 1R4MB 1KOTA 5JHBA 3DVGY 3SR6A 1WF9A 3U2SC 3RPFC 3HM3A 1N61A 2JWZA 2L3ZA 2N7DA 1HZ6A 2NBUA 1LFDA 3DOWA 2E6XA 5KHOA 5CHWA 3O65B 2D07B 2KYWA 2Z59B 3K9PB 1OEYJ 4GU2A 1S3SG 5D6JB 1V49A 3ECIA 2KVZA 3BVGA 5H8YE 3TIXA 3APCA 2R61A 2GMIC 3U8ZA 5D7GA 1S1QB 4E3CA 1RWSA 3ZUNA 3TEWA 4MJSB 4RGMA 3URYA 2PVOD 3V61A 3TEXA 1GUAB 4P16A 2INNE 2V3SA 3VXWA 4CQNA 3E56A 1WX8A 1L6UA 3Q8AA 3HVDA 3T3OA 1LXDA 4GDLB 5AUKA 4RM9A 3EFUA 1SXTA 2W55A 4KSLC 4OHJA 3LYYA 3QJZA 2N9LA 4F7ZA 3KW5B 1XQQA 4TMAB 2ZCCA 2I38A 2WP9B 4K3BA 2DAFA 1IBXA 1A70A 4DXFA 1RRBA 5BO4B 3AE5B 3VTVA 1NBFC 3AU5A 4ZYSA 3W1SA 2KFJA 3Q3FA 1P9DU 2BYFA 3T3NA 3NVWA 3CF6E 3ML8A 4HLEA 1L4ZB 4TQ1A 3P63A 2ASQA 3SU8X 1TGZB 4R3DA 2BPSA 4B0EA 4RCOA 3LB8C 4M02A 3Q3JA 3N20C 2JRHA 2WU5B 1DOIA 2DX5B 1V97A 2VH1A 2WXQA 3BYYB 4YXDB 4RNAA 1RFAA 4ANWA 4B6WA 1ENFA 4M0WB 4RF0A 2ZW1A 3PHXB 4MGZE 4LNNA 4WJOA 4LNOA 3DPDA 2REXA 3IFWB 1V80A 3AEBB 3VQIA 2KACA 3R7RA 1WJ4A 2WDQB 4P1BC 2ZNVB 3DHIC 3AEFB 1NYRA 1WXMA 1HXYD 1JW9D 2ICIA 2K22A 3ZJTA 5IOIA 3EGRA 5IAAC 3TJPA 1PYWD 1QOBA 1JRPA 4XX5A 2PKOA 2DAJA 4MDKE 2GBNA 5BYQA 3RT3B 2KK8A 2DZKA 1KF6B 3C0RB 2C60A 1FIQA 1GB4A 1WGYA 4C00A 3IG3A 4B9KA 2W3SA 1YX6B 1WR1A 2D10A 2WLBA 4YWGG 3MC8A 3QHTA 5JHAA 3ZGZA 3KYCD 2EKEC 3AE6B 3RYTA 3MC9A 5EE0A 1FRDA 1QOAA 2I1KA 3W5UB 2YEPB 3BVZA 1P3QU 2PMVA 1D5ZC 1FNWA 3JSVA 1WWTA 1UELA 4RGTA 3PSEB 4P1CC 4KGTA 2FCMA 2L7RA 1F1HA 1C4CA 4NAWA 3BK2A 1G6JA 4AOFA 3HRDD 3NOBA 2L8JA 1L0VB 3P4RB 2WXFA 2A5UA 2YLMA 3B9JA 1Q0WB 4A6QA 2KOXA 3EHVA 4N6EB 1Q10A 2KVRA 1P0RA 2LHDA 4XWWA 1PGXA 3M3JA 1C76A 3L4PA 4EKUA 3ZJUA 3RI7C 1JRUA 4YSXB 2UU7A 1QT9A 4S17A 4JGHB 4MACA 4HPPA 3IT6B 2J0MA 2LI5A 2KLCA 4K7WA 3UF8A 1KFYB 3MHZA 4C80A 1CK1A 5G5GA 2N9EB 2RSUA 4WAFA 4HKQA 1WR6E 2N0SB 2BS2B 1K52A 2KQSA 2L83A 3DVNV 3KWVA 4HWIB 2C7HA 4CYEA 2K8HA 1SEBD 2OOBB 4FXCA 5C1ZA 3MJ5A 4WJPA 2WXNA 4I6PA 4L2YA 2CJOA 1EWYC 2KQ4X 2IGGA 2SEBD 1YQ4B 1LGRA 1V8CA 1HZ5A 2M1MA 1YOVB 1TY2A 3AH7A 4KV2A 1YN4A 3QA8A 1GJZA 3H7SA 3DBHB 4OW0A 4G0NB 2J4XA 5CHFA 1DGJA 1P7FA 2CR5A 1ZPSA 4IWQA 2ZZPB 3WAOA 4MJSA 3DQVA 2AL6A 1WGDA 3VUWA 2KFKB 3WA0A 2BWFA 4US8A 4EUTA 5HFYA 2LVQA 1EU3A 2NPTB 2GBKA 3MJWA 4A20A 1FM0D 2AL3A 3PHWB 2G45B 3PLVA 1TYGB 4AJYB 4AWJA 3RMKC 4EEWA 2FIFA 1OQQA 3PPAA 2C7MB 2C7NB 3PVLA 4LDTB 2L52A 1SSNA 4M00A 4WWNA 4XDDA 3PRMB 5BMGA 2GLSA 4IM2A 3A9KB 1HQRD 3OLMD 3AEAB 1Q1OA 2KQ7A 5GMVA 2L1AA 1TKYA 4MM3A 1QZEA 1WE7A 4NQLB 1ACCA 2CJNA 5D94A 2AQ2B 2RMMA 3E9SA 4LJPB 2ZNVC 4LNFA 2FUHB 1SE3A 4J6IA 1JQ4A 1CMXB 1T0YA 1BUIC 3GB1A 1XCQL 1VDVA 3V62A 1KLUD 2WGSA 2W54A 1H4RA 3HHMA 3UIOB 1VZ7A 5IA7A 2ZCBA 1YMHE 1E8WA 4KKIA 4ICUA 2H88B 4FULA 2DLBA 4KIKB 2X38A 2ZVOA 5HG2A 2M19A 3ZQ4A 3LDZE 3Q2AC 3L08A 3EFCA 4BFRA 3R8BA 1F9JA 5HHDG 3EUB2 4YTMB 5CTRC 1L7YA 4WIPA 1UNSA 1M94A 2G4SA 3AE8B 4HPLB 3N1ZC 3P4SB 1UBIA 5BMHA 2IO3B 3R66C 1J7CA 2Z0EB 3DBLB 1N60A 3PZDA 4IWOA 4LK0M 2O6VB 3AM9A 4GN1A 3UQBA 3VRAB 2YEPF 3DWGC 4MT5A 2BGFA 2M8SA 5FR3A 3ZXRA 3V6EB 1TKGA 1FXIA 3X0WA 2KMAA 2ACZB 3DVNU 3IXSA 1VLBA 3RNBC 3HIZA 2MH7A 3VUYA 1UUPA 4XZ4A 1ZP0B 3M63B 3ENEA 3QWZB 2INCC 1IPGA 4DHJD 4IKGA 2L0TA 1UGJA 4A3OA 2IY1B 3NZUA 2BT6A 4L23A 3J9CA 1HE8A 4EE2A 3NG0A 5FK9C 2MP2B 2WDRB 2GBRA 4JIOU 3PLUA 4JL9A 4JWUC 1FPYA 1JWAD 3M62B 2KDIA 1I4GA 4OVVA 3Q8FA 2JRIB 2DHZA 3ZXVA 5LXIB 4NNJB 3GZNB 2CHZA 1YQ3B 2Z0DB 4XE0A 4ACFA 3RULA 3SFEB 2XK5A 2KN4A 3UGBB 1KRHA 1IP9A 3RFZB 3JYUA 1ROEA 4YSYB 3H7PA 4DQOC 1H8CA 3U4EG 3Q8BA 1WZ3A 2MJ3A 4YSZB 1F77A 1N5XA 1L6VA 3Q8CA 1V9JA 4BBNF 4NPNA 2D3BA 3VTWA 1C4PA 1TS5A 4HJGE 4II2B 4ARIA 2DBYA 1NDDA 1RM6C 4KDIC 2MBQA 1NI2A 5J2RA 2SAKA 2K8CA 1SIJA 3JVZX 3KH0A 2ZVNA 1FCCC 3KUZA 2KMMA 2KJ6A 4DHJB 2WXHA 3CSTA 2YVCA 4ZYNA 1U4AA 4J3OD 2WS3B 1NVID 1WM2A 3DHGC 2J0JA 4KZ0A 4UDUC 4PT5A 4GGQA 2MA9B 1QOFA 3B08A 5JZEB 4JX1C 4LTUA 2KWDA 1C77A 3PT2B 2OEDA 2FUG1 3WIMA 1C1YB 1J19A 1CQVA 5IN7A 2M0AA 4W9FA 2JZ3B 2WHIA 4PYUA 5TR5A 2K6QA 1EF1A 3FC4A 1WI0A 4JE3B 3W9CB 1VZ6A 2W3RA 3QARA 4ZRPA 3AEDB 2KFKA 2MJEA 1C78A 1TBEA 2KMCA 1I4XA 4GMVA 3HM6X 1OQYA 1K50A 3R2IA 3W2DA 4REZA 2IDYA 2JT4B 1N6ZA 2MBBB 3A4RA 2JPHA 3APDA 4FLHA 2MBOA 2PVGC 3I9V1 2RPVA 1YN3A 3VHTC 2JZZA 2MCNB 5TSSA 3A9KA 1L4DB 1XLPA 2N1WA 2BQQA 4WURA 1F2RI 2LZ6A 1E8YA 1ESFA 2KZRA 2KDFB 1SBBB 5AZFA 1YQBA 4MSQB 4HRSA 4LCDE 3AXCA 2KLGA 1FXAA 2K3UA 3P4PB 1KLVA 1Q5WB 5GXGB 1XF5L 3P4QB 3X23A 2JY6A 3QX1A 3L10B 1BXTA 2QILA 2D3AA 2CHXA 2NS5A 3UINB 1HA5A 1SE4A 3VVWB 1KTKA 3AE7B 1B1ZA 2N7EA 3B2GA 2EMSA 4KGRA 2JQRB 2O2VB 2AX5A 2PIAA 5G5HA 1FO4A 1N62A 3RUIB 4KX6B 4GXBA 1D5MC 4HDOA 2NVUI 2PEAA 2WXLA 2V0GA 1ZXHA 3SHQA 1V86A 2KT7A 2J52A 3ZDTA 4L1BA 1P98A 3I63C 3N9YC 4ARCA 1QQRA 3VAWA 4MH0E 2K39A 4BOSC 1MHXA 1B9RA 4BKSA 3GS2A 1E10A 3BY4B 1R4NI 3TL5A 2O6VA 4A3PA 2WNMA 4X57B 1TIFA 4YL8A 2Y5PA 2I1JA 3L17A 1SJED 1HEZE 1ET6A 4DDGD 3NY5A 3PTFC 3MHSD 1L2NA 4HJKA 2NTSA 5L83A 1SB3C 3SD5A 1V2YA 4HDQA 3RCZA 2MBHA 1D3ZA 2KN5A 5E6JA 4IM3A 2DZIA 3BIID 4FBJB 1UWMA 3TEZA 4W9GA 2ONQA 4IW0A 4LLGM 4XWTA 1UWXA 1JMLA 2MP2A 2OJRA 2IGDA 4G50A 3TBLD 2KHWB 1M4VA 3RNEC 1AARA 4W9CA 1V5OA 4NJCA 4EZKA 5CHVC 4WWOA 3ZLZA 1T5XD 1SE2A 2JXTA 3CIRB 2LGDA 3C8YA 2AWTA 1WMHB 3AMZA 2G3QB 1RFKA 3FAHA 3DDCB 2QCZA 5L95C 2N4FA 1JCKB 3CSFA 3DWMA 3FILB 2HJ8A 4ANVA 2BBCA 1STEA 3BK1A 4TV3A 2GBMA 2KC1A 3NUHB 3BZDB 2WDTB 3RZWC 5DPWA 1K51A 4RGNA 1J7BA 2BYTA 4KSKC 1ZXIA 2K0PA 3PREA 2IO0B 1NI3A 3WCQA 4XGAB 4DK5A 1WGHA 3IVFA 2LWPA 3PO0A 1UD7A 2BW2A 2BVCA 4W9KA 2KO3A 4OZAA 1PGBA 2QJLA 2WXJA 1EUVB 3AI5A 4DHZE 3AULA 4N59A 1WH3A 4MELA 3W5VB 5CX3A 5AEKB 5J18A 2JSVX 1WGRA 2FAZA 4AUQC 1JWBD 3L16A 3KWLA 4E71A 2E3TA 3MTNB 4EZJA 2KTRB 4FA6A 2LJIA 1MVKA 3SDLC 1T3QA 4FHJA 1QOGA 4WQMA 4B0MA 5D3DA 1IUEA 1WZ0A 1SF0A 2JX5A 4GLSC 1WSPA 4EZLA 2AYOB 5JXVA 2BS3B 4NJ6A 2VH2A 2V3NA 2BTEA 4FJZA 3V6CB 4K3CA 5G2NA 2NTTA 2XEWA 1GNUA 1PQSA 4YTNB 4AJWA 2IYDB 2JZPA 3ZTCA 3QIJA 4GDLA 4IG7B 3R7QA 2DZJA 2V9HA 2MLBA 1EM7A 3IAS1 3I5JC 1WRIA 2DZMA 1I4QA 3UI3A 4WJQA 2D11A 3ZRFA 2WXMA 3RNCC 4WH4A 3EC8A 1RLFA 2QMTA 1PDXA 4HK2A 4C7ZA 2PPHA 3T9LA 3ETRA 3CWIA 2X8XX 3TSSA 1JALA 2OJWA 3VFKA 2LXCA 3ZW3A 2FCSA 1GOZA 3I57A 2C5LC 3ZNGC 4N58A 2GBJA 3GE8C 1V5TA 4CHKA 3IBEA 4XC2A 2FCQA 2RDGA 1E6EB 1IBXB 3WANA 3FKYA 2AEHA 1KLGD 3RNGC 1K8RB 3DVGX 4TQ0A 1EWCA 1PFDA 3L13A 1IGDA 3AECB 2EKIA 4DHZB 2PE6B 4DXGA 2V1YA 1VRAB 1C4AA 1JROA 2XNAC 2M0XA 4BKGA 3RNAC 4M0WA 1AYFA 3IAM1 5EE1A 5EE9A 2BB6A 1OFFA 5DPRA 3APFA 4OZCA 2WQYB 3ALBA 4HXDA 1FXTB 2LASA 4HEA1 3PRZA 3QAQA 3Q6BA 5LLIA 3AE3B 4XDCA 3UIPB 3B2FA 1UZXB 5E6OA 2B76B 3ZYYX 3VH3B 3L54A 3PS6A 3NS1A 3Q3NC 1E90A 3B0AA 2J53A 3EECA 1NENB 1FCLA 4OVZA 1Z2MA 2G4DB 2KWCA 4KDLB 3DBRI 4HVBA 1I42A 2RD0A 5LNK1 4HCPB 3Q3MC 2CHWA 4BVUC 3ZDMC 2JUOA 1T0QC 1L0YB 3AB5A 2MRPA 2UWQA 4F1SA 2L32A 2WXOA 4LNIA 1E5WA 3MFGA 2HDEA 1TS3A 3M95A 3T8MA 2KJRA 2C9WB 1LO5D 4URKA 1P7EA 3ZKJC 1WMHA 4ASWC 1WGGA 2KAJA 2W82A 3MP9A 1WXAA 2BB5A 3NVZA 4N9F4 1HTOA 3V3XA 2BS4B 5BYSA 2N9KA 2FBWB 1QLBB 4YTPB 1L0XB 1YNTE 3FILA 2JXXA 3OG5A 3NZ3A 3N30A 3WAMA 2DENB 1DOYA 2D2QA 5IO9A 1SE9A 4RF1A 1VD2A 1TZOA 1IYFA 1LM8B 2HD5B 3A9JB 2WXKA 1MJDA 2KKCA 1ZGUB 1WY8A 1E7VA 1KJTA 4OVUA 3JSVB 3U52E 3K9OB 3VDZA 2LGIA 4DWFA 2GOWA 1T0RC 4FN2A 2K5PA 4KKJA 4NAWB 2IGHA 3NZSA 4M8NA 2DYMA 4WQOB 1YJ1A 4MGKE 1XT9B 3S2AA 3Q3OC 2K8BA 2NCNA 4AS1A 4BOZB 2WU2B 3N1YC 1I7HA 3NRZA 2LGSA 2KTRA 2FE8A 4XYCA 1TS4A 1V1PB 1VR9A 3KUDB 2D3GA 2MQJA 2WWZA 2HTHA 2KWUB 4BAXA 3OWEB 4F8CB 1E7PB 4TSSA 1MG4A 2KDMA 4MGYE 3QC8B 4GOCA 2RR9A 3H8HA 5D2MB 4JWSC 1V1OA 2XN9C 3H9DA 1R4MI 2BKFA 2MX2A 3AE1B 3AE4B 2D5GA 3NS8A 5T8IA 1ZE3D 2N9PC 1WX7A 1YJJA 2KX0A 2BF8B 3W1SC 2NPTA 1JWMD 2RPQA 2LFIA 4YT0B 1WE6A 3WAPA 2PJHA 4AQ7A 1WXVA 2WXPA 2KNBA 4US9A 3KQ4A 2GRIA 4H2AA 3AE2B 1GB1A 1N63A 4O1NA 1ZDVA 3NHEB 3DHHC 5BMIA 1EU4A 4RM8A 4ANXA 1ZUD2 1WRDB 2FCNA 4I6NB 2MW5A 2PE9A 3PV1A 4CO7A 3NJTA 3RD2A 2M17A 1WJUA 1ZOYB 4PS8A 2LHEA 3R3MA 1I4PA 3O13A 4M01A 2J42A 4S0RA 4A90A 2L00B 3AE9B 1WJ6A 3HK0A 3TUOA 4IC7B 4A55A 3GE3C 4MGIE 5DCNA 4C7YA 1E7UA 1JWUD 2QEJC 4MM3B 4RMAA 1UGMA 1FMAD 3H1UA 2LGXA 3LJ3A 4KIKA 2HTME 3KVFB 2KDEB 2PTLA 2VZKD 2ZPYA 4KZCA 4WWPA 3ZIMA 4C56C 1WFYA 4W9DA 4WWMA 4LNKA 2IBIB 1EO6A 2QDFA 1YJIA 3QQ8B 2DYBA 1XXGA 1EF5A 2W9NA 2AQ3B 1R4NB 1XCTL 2BYEA 4NAMA 1BMLC 2KC2A 4OZBA 2LVPA 1SJHD 3LXFA 3VR9B 2NMQA 5E6NA 5E6PA 2CU3A 1HTQA 2KANA 2LXAA 1TTNA 1SGHA 5D3IB 3SEBA 1XLNA 1TKEA 4GDKB 2QIEB 1YN5A 1RYJA 2Y5CA 2QHOA 1MI0A 2TSSA 1FRRA 2KTFA 2INDC 2ON8A 1Z5SB 2AQ1B 2VRRB 3B1LX 4K7UA 1ZDXA 3U7ZA 2K6DB 4AP4C 5BYRA 4ZRQA 3IHPC 1GG3A 2WXIA 4K81A 4NY0A 1T0SC 1K53A 4EFOA 3ZTDA 1TS2A 3P2BA 2DNFA 1CJEA 1D6EC 3HUIA 4TKNA 3I3TB 2G9HD 2KWVB 2VZKB 3PGEA 2WXGA 4EOYA 4MSMB 3V05A 2V3PA 4PS7A 1E9MA
chains in the Genus database with same CATH topology
4JWUC 1I4QA 1JWAD 4GDLB 4RH6A 5AUKA 3UI3A 2WDVB 1SXTA 2W55A 3AEGB 3HVZA 4OHJA 3LYYA 1I4GA 3Q8FA 2WXMA 4WH4A 2G1EA 3Q69A 5EE3A 2N9LA 2QMTA 1PDXA 3P1MA 2LMCA 1YQ3B 4TMAB 4XE0A 4C7ZA 2I38A 3ETRA 3CWIA 2GI9A 4A8XC 1D4BA 1XLOA 1JWSD 3BWUD 3NVYA 2WP9B 1VJKA 1JALA 3SFEB 3TSSA 1IBXA 1A70A 2KN4A 4USAA 4DXFA 1KRHA 1GOZA 3I57A 3AE5B 3RFZB 4N58A 1ROEA 4YSYB 2I2YA 4DQOC 4ZYSA 3U4EG 3W1SA 3Q8BA 2Q5WD 2MJ3A 2MJDA 2RDGA 4YSZB 1F77A 1E6EB 1L6VA 1N5XA 3Q8CA 1IBXB 1QF6A 4ZHPA 3T3NA 4ZOHC 3NVWA 2M56B 2PLPA 1KLGD 1C4PA 1TS5A 4HJGE 4ARIA 2DBYA 5C3JB 1L4ZB 1RM6C 2ZW0A 4TQ1A 4TQ0A 1EWCA 1PFDA 3P63A 2SAKA 1IGDA 1SIJA 4R3DA 3AECB 2EKIA 4DXGA 4B0EA 1F2RC 1FCCC 1VRAB 4RCOA 4A9AA 3LB8C 3ZJVA 1C4AA 1JROA 2XNAC 2KMMA 2LEKA 2WU5B 4M0WA 1DOIA 1AYFA 1V1PA 2WXHA 1V97A 1D5XC 2WXQA 3IAM1 5EE1A 3BYYB 5EE9A 4J3OD 2BB6A 1OFFA 4YXDB 1GPXA 2WS3B 4RNAA 4OZCA 1NVID 2WQYB 4UDUC 4PT5A 1ENFA 1QOFA 4RF0A 4D2KA 2ZW1A 4HEA1 3AE3B 4JX1C 4LTUA 4XDCA 2KWDA 3B2FA 1C77A 2B76B 3ZYYX 3Q8EA 2OEDA 1DYQA 2FUG1 1DOXA 1CQVA 3NS1A 2M0AA 3AEBB 3AN1A 3VQIA 1PUTA 2KACA 1XLQA 1I4RA 2J53A 3FC4A 2WDQB 2RDHA 1NENB 1Y56A 4P6VF 1FCLA 4OVZA 4JE3B 3W9CB 1VZ6A 2DYOA 2W3RA 4ZRPA 5LNK1 1WGKA 3AEDB 1XO3A 3AEFB 1AN8A 2MJEA 1NYRA 3AEEB 1HXYD 1C79A 3AB5A 1JW9D 1L0YB 2ICIA 2K22A 1C78A 1GAQB 3ZJTA 1QILA 1I4XA 2L32A 3EGRA 1PYWD 1K50A 3R2IA 1QOBA 3W2DA 1JRPA 2WXOA 2PKOA 4REZA 2IDYA 1N5WA 2QSDA 1TY0A 3MFGA 5BYQA 2JU6X 3VRBB 2HDEA 1TS3A 5AUIA 2PVGC 3I9V1 2RPVA 1KF6B 1LO5D 1YN3A 1FIQA 1GB4A 1P7EA 3ABVB 5TSSA 2W3SA 1L4DB 1XLPA 2WLBA 3EA6A 4YWGG 2KAJA 2W82A 3MP9A 2BB5A 3ZGZA 4WURA 3NVZA 1F2RI 3V3XA 1ESFA 2BS4B 2N9KA 5BYSA 1SBBB 2FBWB 3AE6B 1QLBB 4YTPB 1L0XB 1YNTE 3FILA 4HRSA 5EE0A 1FRDA 1QOAA 3W5UB 3NZ3A 1C9FA 2YEPB 3BVZA 1FXAA 1R7SA 2K3UA 2PMVA 3P4PB 1D5ZC 1DOYA 1FNWA 2H89B 1WWTA 4RF1A 4RGTA 1E0ZA 5GXGB 1TZOA 1XF5L 3P4QB 4KGTA 3GP7A 3P42A 1C4CA 2WXKA 3BK2A 1BXTA 3HRDD 1L0VB 2QILA 3P4RB 2WXFA 3AV8A 3U52E 1HA5A 3B9JA 3IT4B 1SE4A 1KTKA 2LGIA 4A6QA 5MPOA 3AE7B 2WXRA 4N6EB 1B1ZA 1Q10A 2K5PA 2LHDA 4JPSA 3B2GA 4KKJA 4NAWB 4XWWA 1PGXA 2IGHA 1C76A 3L4PA 4KGRA 3ZJUA 2DYMA 2JQRB 4YSXB 2AX5A 2PIAA 1TJEA 5C2TB 5G5HA 1QT9A 1FO4A 1N62A 4KX6B 1D5MC 4MACA 3IT6B 4AS1A 2WXLA 2V0GA 1ZXHA 1FD6A 3PZ7A 1KFYB 2WU2B 3MHZA 1CK1A 2J52A 4C80A 1I7HA 4L1BA 2IPKD 3N9YC 5G5GA 4ARCA 1QQRA 1PGAA 1QKZA 2JYTA 3NRZA 1CZPA 4Q2JA 4WAFA 4HKQA 1MHXA 1B9RA 4NZLB 2N0SB 2BS2B 2FE8A 1K52A 1TS4A 1V1PB 1VR9A 3GS2A 2L83A 1E10A 3KWVA 3OWEB 2WNMA 1SEBD 5FKAC 1E7PB 4TSSA 4ZHOA 2Y5PA 2KDMA 4FXCA 4IDIA 3MJ5A 4HROA 1SJED 1HEZE 1ET6A 4IOIE 3H8HA 2WXNA 2JWUA 3BVMA 4JWSC 4L2YA 2CJOA 1EWYC 1V1OA 2KQ4X 2XN9C 2IGGA 1AW7A 2SEBD 1YQ4B 1V8CA 1HZ5A 4RGOS 2EELA 1TY2A 3AE1B 3AH7A 1F0ZA 3AE4B 2NTSA 2D5GA 3TEYA 1YN4A 1I4HA 1SB3C 5T8IA 1ZE3D 4OW0A 1AWDA 1YJJA 2INPE 2LUMA 4MH8A 1VZ8A 5E6JA 1MPEA 2J4XA 3BIID 1DGJA 1JWMD 1P7FA 2LFIA 4YT0B 1ZPSA 1UWMA 3TEZA 4AQ7A 2ONQA 2PW9A 2WXPA 4LLGM 4XWTA 4US9A 3KQ4A 1UWXA 1JMLA 2GRIA 4H2AA 4US8A 5HFYA 3AE2B 1GB1A 1N63A 4O1NA 1EU3A 1ZDVA 2IGDA 1FM0D 2GB1A 1M4VA 1TYGB 5BMIA 1EU4A 1OQQA 5I4DA 1ZUD2 4NJCA 2V4IB 3VR8B 2L52A 1FNVA 2MEKA 1L5PA 1SE2A 1SSNA 1T5XD 2JXTA 3CIRB 4XDDA 5BMGA 2Z8LA 1ZOYB 1IGCA 3C8YA 2LHEA 4KGSA 1HQRD 3AMZA 2Y3AA 1RFKA 3AEAB 1FFUA 1I4PA 3O13A 2J42A 3FAHA 2L1AA 4A90A 1TKYA 3AE9B 3R2TA 1OQRA 1XEEA 1ACCA 2N7JA 1JCKB 4ITKA 3DWMA 2CJNA 3FILB 1KH0A 3TUOA 4A55A 3BYTB 2AQ2B 4C7YA 1JWUD 1FEHA 2BBCA 1STEA 2RMMA 3BK1A 3E9SA 1WXQA 2QEJC 3KLSX 1SE3A 1T6BX 4MM3B 3NUHB 3BZDB 1JQ4A 1WYGA 1K51A 1FMAD 4RGNA 3PZ8A 1BUIC 1J7BA 3GB1A 1XCQL 1VDVA 2BYTA 1ZXIA 1NYQA 2HTME 1KLUD 2JYEA 2K0PA 2PTLA 2VZKD 3NVVA 2W54A 1NI3A 3WCQA 1VZ7A 2DWQA 4RFBA 4C56C 1YMHE 4KKIA 2OHFA 2H88B 1MHHE 1FFVA 3PO0A 4WWMA 2BW2A 4HKZE 2DLBA 4OZAA 5HI1A 1PGBA 2QJLA 2WXJA 2X38A 1YJIA 4N59A 1XXGA 5HG2A 2M19A 2AQ3B 3W5VB 3ZQ4A 2K9XA 5H92C 3R8BA 3SFDB 1XCTL 4NAMA 1NEKB 2JSVX 5HHDG 1BMLC 3EUB2 4YTMB 1FNUA 1ET9A 4WIPA 1UNSA 3AE8B 4OZBA 1SJHD 1JWBD 3LXFA 3VR9B 2IJ0A 3P4SB 3KWLA 5BMHA 2NMQA 2E3TA 2CU3A 1J7CA 1J7AA 3MC0B 2LJIA 1MVKA 1N60A 4LK0M 5D3IB 1T3QA 3SEBA 3SR6A 3AM9A 3U2SC 3VRAB 3RPFC 1XLNA 1N61A 1QOGA 2YEPF 1TKEA 4WQMA 4B0MA 4GDKB 5D3DA 1HZ6A 3DWGC 2QIEB 1YN5A 1RYJA 4MT5A 2Y5CA 1IUEA 1MI0A 5FR3A 2TSSA 1SF0A 2E6XA 2JX5A 1TKGA 4GLSC 1FXIA 1FRRA 1WSPA 2ON8A 2ACZB 2AQ1B 5JXVA 1ZDXA 2BS3B 1VLBA 3IXSA 2MH7A 3U7ZA 1UUPA 2V3NA 5BYRA 1ZP0B 2BTEA 4ZRQA 2WXIA 3BVGA 1K53A 2NTTA 5H8YE 2R61A 1TS2A 4IKGA 4YTNB 1CJEA 5D7GA 1UGJA 1RWSA 1D6EC 2JZPA 3HUIA 3TEWA 3URYA 4RGMA 2PVOD 2BT6A 4L23A 2G9HD 3J9CA 3TEXA 1EM7A 4EE2A 3IAS1 2VZKB 4P16A 2INNE 5FK9C 1WRIA 4CQNA 2WDRB 2WXGA 3E56A 1L6UA 3Q8AA 3HVDA 3T3OA 3V05A 2V3PA 1E9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  1NEN B;  3NRZ A;  4JWU C;  1JQ4 A;  1CZP A;  1WYG A;  1JWA D;  4P6V F;  1FMA D;  5AUK A;  1B9R A;  2N0S B;  2BS2 B;  2WDV B;  2W55 A;  1J7B A;  3AEG B;  3HVZ A;  3W9C B;  1VDV A;  2L83 A;  2W3R A;  1E10 A;  1ZXI A;  1NYQ A;  2HTM E;  1WGK A;  3AED B;  1XO3 A;  2G1E A;  3AEF B;  2MJE A;  3NVV A;  2W54 A;  5EE3 A;  1NYR A;  3AEE B;  1NI3 A;  3WCQ A;  1PDX A;  5G5G A;  3AB5 A;  1JW9 D;  3P1M A;  1E7P B;  1YQ3 B;  2DWQ A;  2K22 A;  1GAQ B;  4ZHO A;  4FXC A;  4IDI A;  2OHF A;  4C7Z A;  4HRO A;  2H88 B;  1QOB A;  1FFV A;  3ETR A;  3PO0 A;  3CWI A;  1JRP A;  4WWM A;  1XLO A;  2PKO A;  3NVY A;  1N5W A;  4JWS C;  2CJO A;  2WP9 B;  1VJK A;  1JAL A;  1EWY C;  3SFE B;  1A70 A;  2QJL A;  4USA A;  3VRB B;  1YJI A;  1KRH A;  1YQ4 B;  3FC4 A;  2PVG C;  1V8C A;  4N59 A;  5AUI A;  3AE5 B;  1KF6 B;  2M19 A;  3W5V B;  3AE1 B;  3AH7 A;  1F0Z A;  3AE4 B;  2K9X A;  1ROE A;  4N58 A;  4YSY B;  1FIQ A;  5H92 C;  3SFD B;  1SB3 C;  3ABV B;  4US8 A;  1NEK B;  2W3S A;  1XLP A;  2Q5W D;  3EUB 2;  4YTM B;  2MJ3 A;  2MJD A;  4YSZ B;  1AWD A;  1N5X A;  1E6E B;  1L6V A;  1YJJ A;  2WLB A;  3AE8 B;  1QF6 A;  4ZHP A;  3LXF A;  1JWB D;  2KAJ A;  1DGJ A;  3BII D;  3P4S B;  3VR9 B;  4ZOH C;  3KWL A;  3NVZ A;  2E3T A;  3NVW A;  4YT0 B;  1UWM A;  2CU3 A;  2M56 B;  1J7C A;  1J7A A;  2BS4 B;  2DBY A;  2FBW B;  3AE6 B;  5C3J B;  1QLB B;  1RM6 C;  1N60 A;  4YTP B;  4HRS A;  5EE0 A;  1FRD A;  1PFD A;  4US9 A;  3P63 A;  1QOA A;  3SR6 A;  1T3Q A;  3W5U B;  3AM9 A;  1SIJ A;  3AEC B;  3RPF C;  2EKI A;  3VRA B;  1XLN A;  1N61 A;  1QOG A;  3AE2 B;  1TKE A;  1FXA A;  1N63 A;  4WQM A;  1R7S A;  3P4P B;  4A9A A;  3DWG C;  2QIE B;  1FM0 D;  1RYJ A;  1DOY A;  2Y5C A;  1IUE A;  3LB8 C;  2H89 B;  1WWT A;  1TYG B;  1JRO A;  1E0Z A;  5GXG B;  2KMM A;  1SF0 A;  2JX5 A;  2LEK A;  1TKG A;  2WU5 B;  1FXI A;  1OQQ A;  1FRR A;  3P4Q B;  1ZUD 2;  1DOI A;  1AYF A;  2ACZ B;  1V97 A;  3VR8 B;  2L52 A;  5EE1 A;  5EE9 A;  2BS3 B;  1VLB A;  1L5P A;  1OFF A;  3HRD D;  3CIR B;  1L0V B;  2MH7 A;  3P4R B;  4YXD B;  1GPX A;  2WS3 B;  1ZOY B;  3AV8 A;  1NVI D;  2WQY B;  1ZP0 B;  3B9J A;  5MPO A;  3AE7 B;  1QOF A;  4N6E B;  3AMZ A;  2K5P A;  1RFK A;  3B2G A;  3AEA B;  5H8Y E;  1FFU A;  3L4P A;  3AE3 B;  2JQR B;  4JX1 C;  3FAH A;  1CJE A;  2AX5 A;  2PIA A;  4LTU A;  1TKY A;  4YTN B;  4YSX B;  1RWS A;  1TJE A;  3AE9 B;  5G5H A;  5C2T B;  1OQR A;  1QT9 A;  1FO4 A;  1N62 A;  3B2F A;  3HUI A;  4KX6 B;  2B76 B;  2PVO D;  3ZYY X;  4ITK A;  3DWM A;  2CJN A;  2BT6 A;  1DOX A;  3NS1 A;  1WRI A;  3AEB B;  4C7Y A;  2WDR B;  3AN1 A;  1KFY B;  1L6U A;  1PUT A;  1WXQ A;  2WU2 B;  4C80 A;  1XLQ A;  1I7H A;  1E9M A; 
#chains in the Genus database with same CATH topology
 4FJV B;  4PYZ A;  4RH6 A;  4JQW C;  2WDV B;  3AEG B;  3HVZ A;  1A5R A;  2EMT A;  2G1E A;  3Q69 A;  5EE3 A;  3CMM B;  3P1M A;  2LMC A;  2LRU A;  2CU1 A;  3ZO5 B;  1F52 A;  4BZA A;  2GI9 A;  4A8X C;  1D4B A;  1XLO A;  1JWS D;  3BWU D;  3NVY A;  1VJK A;  4W9I A;  4USA A;  2KX3 A;  3A9J A;  4DBG A;  2KD0 A;  2I2Y A;  4BKT A;  3ONS A;  4C4V B;  4PS3 A;  5IP4 D;  3W1Y A;  2Q5W D;  2MJD A;  4ZRK A;  2XK5 B;  3N1X C;  1QF6 A;  1GC6 A;  4ZHP A;  4II3 B;  4WJN A;  4ZOH C;  5C23 A;  4E74 A;  3ZRC A;  2M56 B;  2PLP A;  3A33 B;  2ZPN A;  5EDS A;  3H7P B;  5C3J B;  2ZW0 A;  4WAA A;  2WX1 A;  1F2R C;  4A9A A;  2WX0 A;  4LDT D;  3ZJV A;  2LEK A;  5AZH A;  1V1P A;  2NBW B;  3OAW A;  3RN9 C;  3N3K B;  1D5X C;  1OTR B;  4ANU A;  3U7D A;  1GPX A;  2NBV B;  4W9L A;  4D2K A;  1WJN A;  3RZF A;  4DXA B;  1VCB A;  3A1Q B;  2LRW A;  5DPS A;  4ZRI A;  3Q8E A;  1DYQ A;  4HPM B;  1DOX A;  1GC7 A;  1ZW7 A;  3AN1 A;  4ZRJ A;  1PUT A;  5G55 A;  1XLQ A;  1I4R A;  1TZ1 A;  2RDH A;  3UQA A;  1Y56 A;  4P6V F;  1YIW A;  3ZVV A;  2NR2 A;  5KHQ A;  2DYO A;  3PRP B;  4GB9 A;  2L76 A;  1WGK A;  2RGF A;  1XO3 A;  2CS4 A;  4LJO B;  1AN8 A;  3AEE B;  1C79 A;  2KJH B;  3DBH I;  1GAQ B;  2L05 A;  1QIL A;  4KVG B;  2IO2 B;  1N5W A;  2QSD A;  5DPT A;  1TY0 A;  3VRB B;  2JU6 X;  4G11 A;  3OJ4 B;  5AUI A;  4DDI D;  3ZNH B;  2R2Q A;  3ABV B;  2HE7 A;  2J0K A;  2LGY A;  4BKS D;  4IM0 A;  3BIN A;  3EA6 A;  1P1A A;  2O6V D;  2UYZ B;  1J8C A;  4JLC A;  2L0F A;  4P7I A;  2ZJD A;  1C9F A;  3V60 A;  4K1R B;  2QC8 A;  1R7S A;  2BKR B;  4IUM B;  2H89 B;  4PK1 A;  3KUC B;  1E0Z A;  1RAX A;  2K25 A;  4IWP A;  2V4L A;  3GP7 A;  1MFW A;  3P42 A;  2O2V A;  2K1F A;  3AV8 A;  2LVO A;  4MEM A;  1X1M A;  3IT4 B;  5MPO A;  2WXR A;  3C19 A;  4JPS A;  2HJ1 A;  3U30 A;  4FAD A;  1OEY A;  3Q14 C;  1E8X A;  1UH6 A;  1TJE A;  2KDB A;  5C2T B;  3QCA A;  1KM7 A;  3H6N A;  4W9H A;  1FD6 A;  3PZ7 A;  2IY0 B;  1WYW B;  4FHK A;  2IPK D;  1V81 A;  1PGA A;  1QKZ A;  2JYT A;  1CZP A;  4Q2J A;  4NQK E;  4NZL B;  5JH5 C;  5HKH A;  1WM3 A;  1WX9 A;  2JVC A;  2MHJ A;  4QAY A;  4GDK A;  5FKA C;  1LQB A;  5LXH A;  4ZHO A;  2M4N A;  4IDI A;  1E8Z A;  4HRO A;  5IKC M;  4IOI E;  2JWU A;  3BVM A;  3D32 A;  3A4S C;  2MBE A;  4I6L B;  1AW7 A;  1XD3 B;  3DBL I;  4RGO S;  3DBR B;  4K7S A;  4M8M A;  2EEL A;  4GIV A;  1ZKH A;  3RNF C;  1F0Z A;  4W9J A;  2D3C A;  3TEY A;  1I4H A;  4B95 A;  3JW0 X;  1AWD A;  2INP E;  4MH8 A;  2LUM A;  1VZ8 A;  1MPE A;  2PW9 A;  2WYQ A;  4W9E A;  2FID A;  1J0G A;  2BYV E;  3VUX A;  3TMP B;  3N32 A;  2GB1 A;  1C3T A;  3ZNZ B;  2RDB C;  3VTU A;  2LUE A;  1SIF A;  5I4D A;  2V4I B;  3VR8 B;  4NJ7 A;  1FNV A;  2MEK A;  1L5P A;  1YD8 U;  2Z8L A;  4HCN B;  2A4Z A;  1IGC A;  4ZDV A;  4KGS A;  3KYD D;  3DBS A;  1WIA A;  2Y3A A;  2N1V A;  1FFU A;  4FJY A;  1V6E A;  2BWE S;  3TCA A;  3R2T A;  1Y8R C;  1OQR A;  1XEE A;  5FR6 A;  2N7J A;  4ITK A;  3GZN I;  4C4V A;  1KH0 A;  2LJ5 A;  3BYT B;  1ISN A;  1FEH A;  3AU4 A;  1WXQ A;  2IO1 B;  1WXS A;  3KLS X;  2XBB C;  1T6B X;  1UBQ A;  2LD9 A;  2N9X A;  2R2O A;  2MSE D;  1WYG A;  3DCG A;  1I35 A;  4GSW A;  4BBN C;  3PZ8 A;  1UF0 A;  2CKH B;  2ZEQ A;  1NYQ A;  2JYE A;  3NVV A;  1OGW A;  3OJ3 A;  2DWQ A;  2Y5B B;  4RFB A;  3ML9 A;  4TUU A;  1MG8 A;  2OHF A;  1BT0 A;  1FFV A;  1MHH E;  4HKZ E;  5HI1 A;  2KXJ A;  4G3X B;  2K9X A;  3VH4 B;  5H92 C;  3SFD B;  3QK0 A;  1YX5 B;  3ZNI D;  1NEK B;  3WAL A;  1FNU A;  1ET9 A;  5AZG A;  3A1Q A;  2IJ0 A;  2J7Q B;  5J17 A;  1TT5 B;  2B3A A;  1J7A A;  2JF5 A;  3L0W B;  4ICV A;  2IZV B;  3MC0 B;  3GOE A;  2FNJ B;  2MWS B;  1R4M B;  1KOT A;  5JHB A;  3DVG Y;  3SR6 A;  1WF9 A;  3U2S C;  3RPF C;  3HM3 A;  1N61 A;  2JWZ A;  2L3Z A;  2N7D A;  1HZ6 A;  2NBU A;  1LFD A;  3DOW A;  2E6X A;  5KHO A;  5CHW A;  3O65 B;  2D07 B;  2KYW A;  2Z59 B;  3K9P B;  1OEY J;  4GU2 A;  1S3S G;  5D6J B;  1V49 A;  3ECI A;  2KVZ A;  3BVG A;  5H8Y E;  3TIX A;  3APC A;  2R61 A;  2GMI C;  3U8Z A;  5D7G A;  1S1Q B;  4E3C A;  1RWS A;  3ZUN A;  3TEW A;  4MJS B;  4RGM A;  3URY A;  2PVO D;  3V61 A;  3TEX A;  1GUA B;  4P16 A;  2INN E;  2V3S A;  3VXW A;  4CQN A;  3E56 A;  1WX8 A;  1L6U A;  3Q8A A;  3HVD A;  3T3O A;  1LXD A;  4GDL B;  5AUK A;  4RM9 A;  3EFU A;  1SXT A;  2W55 A;  4KSL C;  4OHJ A;  3LYY A;  3QJZ A;  2N9L A;  4F7Z A;  3KW5 B;  1XQQ A;  4TMA B;  2ZCC A;  2I38 A;  2WP9 B;  4K3B A;  2DAF A;  1IBX A;  1A70 A;  4DXF A;  1RRB A;  5BO4 B;  3AE5 B;  3VTV A;  1NBF C;  3AU5 A;  4ZYS A;  3W1S A;  2KFJ A;  3Q3F A;  1P9D U;  2BYF A;  3T3N A;  3NVW A;  3CF6 E;  3ML8 A;  4HLE A;  1L4Z B;  4TQ1 A;  3P63 A;  2ASQ A;  3SU8 X;  1TGZ B;  4R3D A;  2BPS A;  4B0E A;  4RCO A;  3LB8 C;  4M02 A;  3Q3J A;  3N20 C;  2JRH A;  2WU5 B;  1DOI A;  2DX5 B;  1V97 A;  2VH1 A;  2WXQ A;  3BYY B;  4YXD B;  4RNA A;  1RFA A;  4ANW A;  4B6W A;  1ENF A;  4M0W B;  4RF0 A;  2ZW1 A;  3PHX B;  4MGZ E;  4LNN A;  4WJO A;  4LNO A;  3DPD A;  2REX A;  3IFW B;  1V80 A;  3AEB B;  3VQI A;  2KAC A;  3R7R A;  1WJ4 A;  2WDQ B;  4P1B C;  2ZNV B;  3DHI C;  3AEF B;  1NYR A;  1WXM A;  1HXY D;  1JW9 D;  2ICI A;  2K22 A;  3ZJT A;  5IOI A;  3EGR A;  5IAA C;  3TJP A;  1PYW D;  1QOB A;  1JRP A;  4XX5 A;  2PKO A;  2DAJ A;  4MDK E;  2GBN A;  5BYQ A;  3RT3 B;  2KK8 A;  2DZK A;  1KF6 B;  3C0R B;  2C60 A;  1FIQ A;  1GB4 A;  1WGY A;  4C00 A;  3IG3 A;  4B9K A;  2W3S A;  1YX6 B;  1WR1 A;  2D10 A;  2WLB A;  4YWG G;  3MC8 A;  3QHT A;  5JHA A;  3ZGZ A;  3KYC D;  2EKE C;  3AE6 B;  3RYT A;  3MC9 A;  5EE0 A;  1FRD A;  1QOA A;  2I1K A;  3W5U B;  2YEP B;  3BVZ A;  1P3Q U;  2PMV A;  1D5Z C;  1FNW A;  3JSV A;  1WWT A;  1UEL A;  4RGT A;  3PSE B;  4P1C C;  4KGT A;  2FCM A;  2L7R A;  1F1H A;  1C4C A;  4NAW A;  3BK2 A;  1G6J A;  4AOF A;  3HRD D;  3NOB A;  2L8J A;  1L0V B;  3P4R B;  2WXF A;  2A5U A;  2YLM A;  3B9J A;  1Q0W B;  4A6Q A;  2KOX A;  3EHV A;  4N6E B;  1Q10 A;  2KVR A;  1P0R A;  2LHD A;  4XWW A;  1PGX A;  3M3J A;  1C76 A;  3L4P A;  4EKU A;  3ZJU A;  3RI7 C;  1JRU A;  4YSX B;  2UU7 A;  1QT9 A;  4S17 A;  4JGH B;  4MAC A;  4HPP A;  3IT6 B;  2J0M A;  2LI5 A;  2KLC A;  4K7W A;  3UF8 A;  1KFY B;  3MHZ A;  4C80 A;  1CK1 A;  5G5G A;  2N9E B;  2RSU A;  4WAF A;  4HKQ A;  1WR6 E;  2N0S B;  2BS2 B;  1K52 A;  2KQS A;  2L83 A;  3DVN V;  3KWV A;  4HWI B;  2C7H A;  4CYE A;  2K8H A;  1SEB D;  2OOB B;  4FXC A;  5C1Z A;  3MJ5 A;  4WJP A;  2WXN A;  4I6P A;  4L2Y A;  2CJO A;  1EWY C;  2KQ4 X;  2IGG A;  2SEB D;  1YQ4 B;  1LGR A;  1V8C A;  1HZ5 A;  2M1M A;  1YOV B;  1TY2 A;  3AH7 A;  4KV2 A;  1YN4 A;  3QA8 A;  1GJZ A;  3H7S A;  3DBH B;  4OW0 A;  4G0N B;  2J4X A;  5CHF A;  1DGJ A;  1P7F A;  2CR5 A;  1ZPS A;  4IWQ A;  2ZZP B;  3WAO A;  4MJS A;  3DQV A;  2AL6 A;  1WGD A;  3VUW A;  2KFK B;  3WA0 A;  2BWF A;  4US8 A;  4EUT A;  5HFY A;  2LVQ A;  1EU3 A;  2NPT B;  2GBK A;  3MJW A;  4A20 A;  1FM0 D;  2AL3 A;  3PHW B;  2G45 B;  3PLV A;  1TYG B;  4AJY B;  4AWJ A;  3RMK C;  4EEW A;  2FIF A;  1OQQ A;  3PPA A;  2C7M B;  2C7N B;  3PVL A;  4LDT B;  2L52 A;  1SSN A;  4M00 A;  4WWN A;  4XDD A;  3PRM B;  5BMG A;  2GLS A;  4IM2 A;  3A9K B;  1HQR D;  3OLM D;  3AEA B;  1Q1O A;  2KQ7 A;  5GMV A;  2L1A A;  1TKY A;  4MM3 A;  1QZE A;  1WE7 A;  4NQL B;  1ACC A;  2CJN A;  5D94 A;  2AQ2 B;  2RMM A;  3E9S A;  4LJP B;  2ZNV C;  4LNF A;  2FUH B;  1SE3 A;  4J6I A;  1JQ4 A;  1CMX B;  1T0Y A;  1BUI C;  3GB1 A;  1XCQ L;  1VDV A;  3V62 A;  1KLU D;  2WGS A;  2W54 A;  1H4R A;  3HHM A;  3UIO B;  1VZ7 A;  5IA7 A;  2ZCB A;  1YMH E;  1E8W A;  4KKI A;  4ICU A;  2H88 B;  4FUL A;  2DLB A;  4KIK B;  2X38 A;  2ZVO A;  5HG2 A;  2M19 A;  3ZQ4 A;  3LDZ E;  3Q2A C;  3L08 A;  3EFC A;  4BFR A;  3R8B A;  1F9J A;  5HHD G;  3EUB 2;  4YTM B;  5CTR C;  1L7Y A;  4WIP A;  1UNS A;  1M94 A;  2G4S A;  3AE8 B;  4HPL B;  3N1Z C;  3P4S B;  1UBI A;  5BMH A;  2IO3 B;  3R66 C;  1J7C A;  2Z0E B;  3DBL B;  1N60 A;  3PZD A;  4IWO A;  4LK0 M;  2O6V B;  3AM9 A;  4GN1 A;  3UQB A;  3VRA B;  2YEP F;  3DWG C;  4MT5 A;  2BGF A;  2M8S A;  5FR3 A;  3ZXR A;  3V6E B;  1TKG A;  1FXI A;  3X0W A;  2KMA A;  2ACZ B;  3DVN U;  3IXS A;  1VLB A;  3RNB C;  3HIZ A;  2MH7 A;  3VUY A;  1UUP A;  4XZ4 A;  1ZP0 B;  3M63 B;  3ENE A;  3QWZ B;  2INC C;  1IPG A;  4DHJ D;  4IKG A;  2L0T A;  1UGJ A;  4A3O A;  2IY1 B;  3NZU A;  2BT6 A;  4L23 A;  3J9C A;  1HE8 A;  4EE2 A;  3NG0 A;  5FK9 C;  2MP2 B;  2WDR B;  2GBR A;  4JIO U;  3PLU A;  4JL9 A;  4JWU C;  1FPY A;  1JWA D;  3M62 B;  2KDI A;  1I4G A;  4OVV A;  3Q8F A;  2JRI B;  2DHZ A;  3ZXV A;  5LXI B;  4NNJ B;  3GZN B;  2CHZ A;  1YQ3 B;  2Z0D B;  4XE0 A;  4ACF A;  3RUL A;  3SFE B;  2XK5 A;  2KN4 A;  3UGB B;  1KRH A;  1IP9 A;  3RFZ B;  3JYU A;  1ROE A;  4YSY B;  3H7P A;  4DQO C;  1H8C A;  3U4E G;  3Q8B A;  1WZ3 A;  2MJ3 A;  4YSZ B;  1F77 A;  1N5X A;  1L6V A;  3Q8C A;  1V9J A;  4BBN F;  4NPN A;  2D3B A;  3VTW A;  1C4P A;  1TS5 A;  4HJG E;  4II2 B;  4ARI A;  2DBY A;  1NDD A;  1RM6 C;  4KDI C;  2MBQ A;  1NI2 A;  5J2R A;  2SAK A;  2K8C A;  1SIJ A;  3JVZ X;  3KH0 A;  2ZVN A;  1FCC C;  3KUZ A;  2KMM A;  2KJ6 A;  4DHJ B;  2WXH A;  3CST A;  2YVC A;  4ZYN A;  1U4A A;  4J3O D;  2WS3 B;  1NVI D;  1WM2 A;  3DHG C;  2J0J A;  4KZ0 A;  4UDU C;  4PT5 A;  4GGQ A;  2MA9 B;  1QOF A;  3B08 A;  5JZE B;  4JX1 C;  4LTU A;  2KWD A;  1C77 A;  3PT2 B;  2OED A;  2FUG 1;  3WIM A;  1C1Y B;  1J19 A;  1CQV A;  5IN7 A;  2M0A A;  4W9F A;  2JZ3 B;  2WHI A;  4PYU A;  5TR5 A;  2K6Q A;  1EF1 A;  3FC4 A;  1WI0 A;  4JE3 B;  3W9C B;  1VZ6 A;  2W3R A;  3QAR A;  4ZRP A;  3AED B;  2KFK A;  2MJE A;  1C78 A;  1TBE A;  2KMC A;  1I4X A;  4GMV A;  3HM6 X;  1OQY A;  1K50 A;  3R2I A;  3W2D A;  4REZ A;  2IDY A;  2JT4 B;  1N6Z A;  2MBB B;  3A4R A;  2JPH A;  3APD A;  4FLH A;  2MBO A;  2PVG C;  3I9V 1;  2RPV A;  1YN3 A;  3VHT C;  2JZZ A;  2MCN B;  5TSS A;  3A9K A;  1L4D B;  1XLP A;  2N1W A;  2BQQ A;  4WUR A;  1F2R I;  2LZ6 A;  1E8Y A;  1ESF A;  2KZR A;  2KDF B;  1SBB B;  5AZF A;  1YQB A;  4MSQ B;  4HRS A;  4LCD E;  3AXC A;  2KLG A;  1FXA A;  2K3U A;  3P4P B;  1KLV A;  1Q5W B;  5GXG B;  1XF5 L;  3P4Q B;  3X23 A;  2JY6 A;  3QX1 A;  3L10 B;  1BXT A;  2QIL A;  2D3A A;  2CHX A;  2NS5 A;  3UIN B;  1HA5 A;  1SE4 A;  3VVW B;  1KTK A;  3AE7 B;  1B1Z A;  2N7E A;  3B2G A;  2EMS A;  4KGR A;  2JQR B;  2O2V B;  2AX5 A;  2PIA A;  5G5H A;  1FO4 A;  1N62 A;  3RUI B;  4KX6 B;  4GXB A;  1D5M C;  4HDO A;  2NVU I;  2PEA A;  2WXL A;  2V0G A;  1ZXH A;  3SHQ A;  1V86 A;  2KT7 A;  2J52 A;  3ZDT A;  4L1B A;  1P98 A;  3I63 C;  3N9Y C;  4ARC A;  1QQR A;  3VAW A;  4MH0 E;  2K39 A;  4BOS C;  1MHX A;  1B9R A;  4BKS A;  3GS2 A;  1E10 A;  3BY4 B;  1R4N I;  3TL5 A;  2O6V A;  4A3P A;  2WNM A;  4X57 B;  1TIF A;  4YL8 A;  2Y5P A;  2I1J A;  3L17 A;  1SJE D;  1HEZ E;  1ET6 A;  4DDG D;  3NY5 A;  3PTF C;  3MHS D;  1L2N A;  4HJK A;  2NTS A;  5L83 A;  1SB3 C;  3SD5 A;  1V2Y A;  4HDQ A;  3RCZ A;  2MBH A;  1D3Z A;  2KN5 A;  5E6J A;  4IM3 A;  2DZI A;  3BII D;  4FBJ B;  1UWM A;  3TEZ A;  4W9G A;  2ONQ A;  4IW0 A;  4LLG M;  4XWT A;  1UWX A;  1JML A;  2MP2 A;  2OJR A;  2IGD A;  4G50 A;  3TBL D;  2KHW B;  1M4V A;  3RNE C;  1AAR A;  4W9C A;  1V5O A;  4NJC A;  4EZK A;  5CHV C;  4WWO A;  3ZLZ A;  1T5X D;  1SE2 A;  2JXT A;  3CIR B;  2LGD A;  3C8Y A;  2AWT A;  1WMH B;  3AMZ A;  2G3Q B;  1RFK A;  3FAH A;  3DDC B;  2QCZ A;  5L95 C;  2N4F A;  1JCK B;  3CSF A;  3DWM A;  3FIL B;  2HJ8 A;  4ANV A;  2BBC A;  1STE A;  3BK1 A;  4TV3 A;  2GBM A;  2KC1 A;  3NUH B;  3BZD B;  2WDT B;  3RZW C;  5DPW A;  1K51 A;  4RGN A;  1J7B A;  2BYT A;  4KSK C;  1ZXI A;  2K0P A;  3PRE A;  2IO0 B;  1NI3 A;  3WCQ A;  4XGA B;  4DK5 A;  1WGH A;  3IVF A;  2LWP A;  3PO0 A;  1UD7 A;  2BW2 A;  2BVC A;  4W9K A;  2KO3 A;  4OZA A;  1PGB A;  2QJL A;  2WXJ A;  1EUV B;  3AI5 A;  4DHZ E;  3AUL A;  4N59 A;  1WH3 A;  4MEL A;  3W5V B;  5CX3 A;  5AEK B;  5J18 A;  2JSV X;  1WGR A;  2FAZ A;  4AUQ C;  1JWB D;  3L16 A;  3KWL A;  4E71 A;  2E3T A;  3MTN B;  4EZJ A;  2KTR B;  4FA6 A;  2LJI A;  1MVK A;  3SDL C;  1T3Q A;  4FHJ A;  1QOG A;  4WQM A;  4B0M A;  5D3D A;  1IUE A;  1WZ0 A;  1SF0 A;  2JX5 A;  4GLS C;  1WSP A;  4EZL A;  2AYO B;  5JXV A;  2BS3 B;  4NJ6 A;  2VH2 A;  2V3N A;  2BTE A;  4FJZ A;  3V6C B;  4K3C A;  5G2N A;  2NTT A;  2XEW A;  1GNU A;  1PQS A;  4YTN B;  4AJW A;  2IYD B;  2JZP A;  3ZTC A;  3QIJ A;  4GDL A;  4IG7 B;  3R7Q A;  2DZJ A;  2V9H A;  2MLB A;  1EM7 A;  3IAS 1;  3I5J C;  1WRI A;  2DZM A;  1I4Q A;  3UI3 A;  4WJQ A;  2D11 A;  3ZRF A;  2WXM A;  3RNC C;  4WH4 A;  3EC8 A;  1RLF A;  2QMT A;  1PDX A;  4HK2 A;  4C7Z A;  2PPH A;  3T9L A;  3ETR A;  3CWI A;  2X8X X;  3TSS A;  1JAL A;  2OJW A;  3VFK A;  2LXC A;  3ZW3 A;  2FCS A;  1GOZ A;  3I57 A;  2C5L C;  3ZNG C;  4N58 A;  2GBJ A;  3GE8 C;  1V5T A;  4CHK A;  3IBE A;  4XC2 A;  2FCQ A;  2RDG A;  1E6E B;  1IBX B;  3WAN A;  3FKY A;  2AEH A;  1KLG D;  3RNG C;  1K8R B;  3DVG X;  4TQ0 A;  1EWC A;  1PFD A;  3L13 A;  1IGD A;  3AEC B;  2EKI A;  4DHZ B;  2PE6 B;  4DXG A;  2V1Y A;  1VRA B;  1C4A A;  1JRO A;  2XNA C;  2M0X A;  4BKG A;  3RNA C;  4M0W A;  1AYF A;  3IAM 1;  5EE1 A;  5EE9 A;  2BB6 A;  1OFF A;  5DPR A;  3APF A;  4OZC A;  2WQY B;  3ALB A;  4HXD A;  1FXT B;  2LAS A;  4HEA 1;  3PRZ A;  3QAQ A;  3Q6B A;  5LLI A;  3AE3 B;  4XDC A;  3UIP B;  3B2F A;  1UZX B;  5E6O A;  2B76 B;  3ZYY X;  3VH3 B;  3L54 A;  3PS6 A;  3NS1 A;  3Q3N C;  1E90 A;  3B0A A;  2J53 A;  3EEC A;  1NEN B;  1FCL A;  4OVZ A;  1Z2M A;  2G4D B;  2KWC A;  4KDL B;  3DBR I;  4HVB A;  1I42 A;  2RD0 A;  5LNK 1;  4HCP B;  3Q3M C;  2CHW A;  4BVU C;  3ZDM C;  2JUO A;  1T0Q C;  1L0Y B;  3AB5 A;  2MRP A;  2UWQ A;  4F1S A;  2L32 A;  2WXO A;  4LNI A;  1E5W A;  3MFG A;  2HDE A;  1TS3 A;  3M95 A;  3T8M A;  2KJR A;  2C9W B;  1LO5 D;  4URK A;  1P7E A;  3ZKJ C;  1WMH A;  4ASW C;  1WGG A;  2KAJ A;  2W82 A;  3MP9 A;  1WXA A;  2BB5 A;  3NVZ A;  4N9F 4;  1HTO A;  3V3X A;  2BS4 B;  5BYS A;  2N9K A;  2FBW B;  1QLB B;  4YTP B;  1L0X B;  1YNT E;  3FIL A;  2JXX A;  3OG5 A;  3NZ3 A;  3N30 A;  3WAM A;  2DEN B;  1DOY A;  2D2Q A;  5IO9 A;  1SE9 A;  4RF1 A;  1VD2 A;  1TZO A;  1IYF A;  1LM8 B;  2HD5 B;  3A9J B;  2WXK A;  1MJD A;  2KKC A;  1ZGU B;  1WY8 A;  1E7V A;  1KJT A;  4OVU A;  3JSV B;  3U52 E;  3K9O B;  3VDZ A;  2LGI A;  4DWF A;  2GOW A;  1T0R C;  4FN2 A;  2K5P A;  4KKJ A;  4NAW B;  2IGH A;  3NZS A;  4M8N A;  2DYM A;  4WQO B;  1YJ1 A;  4MGK E;  1XT9 B;  3S2A A;  3Q3O C;  2K8B A;  2NCN A;  4AS1 A;  4BOZ B;  2WU2 B;  3N1Y C;  1I7H A;  3NRZ A;  2LGS A;  2KTR A;  2FE8 A;  4XYC A;  1TS4 A;  1V1P B;  1VR9 A;  3KUD B;  2D3G A;  2MQJ A;  2WWZ A;  2HTH A;  2KWU B;  4BAX A;  3OWE B;  4F8C B;  1E7P B;  4TSS A;  1MG4 A;  2KDM A;  4MGY E;  3QC8 B;  4GOC A;  2RR9 A;  3H8H A;  5D2M B;  4JWS C;  1V1O A;  2XN9 C;  3H9D A;  1R4M I;  2BKF A;  2MX2 A;  3AE1 B;  3AE4 B;  2D5G A;  3NS8 A;  5T8I A;  1ZE3 D;  2N9P C;  1WX7 A;  1YJJ A;  2KX0 A;  2BF8 B;  3W1S C;  2NPT A;  1JWM D;  2RPQ A;  2LFI A;  4YT0 B;  1WE6 A;  3WAP A;  2PJH A;  4AQ7 A;  1WXV A;  2WXP A;  2KNB A;  4US9 A;  3KQ4 A;  2GRI A;  4H2A A;  3AE2 B;  1GB1 A;  1N63 A;  4O1N A;  1ZDV A;  3NHE B;  3DHH C;  5BMI A;  1EU4 A;  4RM8 A;  4ANX A;  1ZUD 2;  1WRD B;  2FCN A;  4I6N B;  2MW5 A;  2PE9 A;  3PV1 A;  4CO7 A;  3NJT A;  3RD2 A;  2M17 A;  1WJU A;  1ZOY B;  4PS8 A;  2LHE A;  3R3M A;  1I4P A;  3O13 A;  4M01 A;  2J42 A;  4S0R A;  4A90 A;  2L00 B;  3AE9 B;  1WJ6 A;  3HK0 A;  3TUO A;  4IC7 B;  4A55 A;  3GE3 C;  4MGI E;  5DCN A;  4C7Y A;  1E7U A;  1JWU D;  2QEJ C;  4MM3 B;  4RMA A;  1UGM A;  1FMA D;  3H1U A;  2LGX A;  3LJ3 A;  4KIK A;  2HTM E;  3KVF B;  2KDE B;  2PTL A;  2VZK D;  2ZPY A;  4KZC A;  4WWP A;  3ZIM A;  4C56 C;  1WFY A;  4W9D A;  4WWM A;  4LNK A;  2IBI B;  1EO6 A;  2QDF A;  1YJI A;  3QQ8 B;  2DYB A;  1XXG A;  1EF5 A;  2W9N A;  2AQ3 B;  1R4N B;  1XCT L;  2BYE A;  4NAM A;  1BML C;  2KC2 A;  4OZB A;  2LVP A;  1SJH D;  3LXF A;  3VR9 B;  2NMQ A;  5E6N A;  5E6P A;  2CU3 A;  1HTQ A;  2KAN A;  2LXA A;  1TTN A;  1SGH A;  5D3I B;  3SEB A;  1XLN A;  1TKE A;  4GDK B;  2QIE B;  1YN5 A;  1RYJ A;  2Y5C A;  2QHO A;  1MI0 A;  2TSS A;  1FRR A;  2KTF A;  2IND C;  2ON8 A;  1Z5S B;  2AQ1 B;  2VRR B;  3B1L X;  4K7U A;  1ZDX A;  3U7Z A;  2K6D B;  4AP4 C;  5BYR A;  4ZRQ A;  3IHP C;  1GG3 A;  2WXI A;  4K81 A;  4NY0 A;  1T0S C;  1K53 A;  4EFO A;  3ZTD A;  1TS2 A;  3P2B A;  2DNF A;  1CJE A;  1D6E C;  3HUI A;  4TKN A;  3I3T B;  2G9H D;  2KWV B;  2VZK B;  3PGE A;  2WXG A;  4EOY A;  4MSM B;  3V05 A;  2V3P A;  4PS7 A;  1E9M A; 
#chains in the Genus database with same CATH homology
 4JWU C;  1I4Q A;  1JWA D;  4GDL B;  4RH6 A;  5AUK A;  3UI3 A;  2WDV B;  1SXT A;  2W55 A;  3AEG B;  3HVZ A;  4OHJ A;  3LYY A;  1I4G A;  3Q8F A;  2WXM A;  4WH4 A;  2G1E A;  3Q69 A;  5EE3 A;  2N9L A;  2QMT A;  1PDX A;  3P1M A;  2LMC A;  1YQ3 B;  4TMA B;  4XE0 A;  4C7Z A;  2I38 A;  3ETR A;  3CWI A;  2GI9 A;  4A8X C;  1D4B A;  1XLO A;  1JWS D;  3BWU D;  3NVY A;  2WP9 B;  1VJK A;  1JAL A;  3SFE B;  3TSS A;  1IBX A;  1A70 A;  2KN4 A;  4USA A;  4DXF A;  1KRH A;  1GOZ A;  3I57 A;  3AE5 B;  3RFZ B;  4N58 A;  1ROE A;  4YSY B;  2I2Y A;  4DQO C;  4ZYS A;  3U4E G;  3W1S A;  3Q8B A;  2Q5W D;  2MJ3 A;  2MJD A;  2RDG A;  4YSZ B;  1F77 A;  1E6E B;  1L6V A;  1N5X A;  3Q8C A;  1IBX B;  1QF6 A;  4ZHP A;  3T3N A;  4ZOH C;  3NVW A;  2M56 B;  2PLP A;  1KLG D;  1C4P A;  1TS5 A;  4HJG E;  4ARI A;  2DBY A;  5C3J B;  1L4Z B;  1RM6 C;  2ZW0 A;  4TQ1 A;  4TQ0 A;  1EWC A;  1PFD A;  3P63 A;  2SAK A;  1IGD A;  1SIJ A;  4R3D A;  3AEC B;  2EKI A;  4DXG A;  4B0E A;  1F2R C;  1FCC C;  1VRA B;  4RCO A;  4A9A A;  3LB8 C;  3ZJV A;  1C4A A;  1JRO A;  2XNA C;  2KMM A;  2LEK A;  2WU5 B;  4M0W A;  1DOI A;  1AYF A;  1V1P A;  2WXH A;  1V97 A;  1D5X C;  2WXQ A;  3IAM 1;  5EE1 A;  3BYY B;  5EE9 A;  4J3O D;  2BB6 A;  1OFF A;  4YXD B;  1GPX A;  2WS3 B;  4RNA A;  4OZC A;  1NVI D;  2WQY B;  4UDU C;  4PT5 A;  1ENF A;  1QOF A;  4RF0 A;  4D2K A;  2ZW1 A;  4HEA 1;  3AE3 B;  4JX1 C;  4LTU A;  4XDC A;  2KWD A;  3B2F A;  1C77 A;  2B76 B;  3ZYY X;  3Q8E A;  2OED A;  1DYQ A;  2FUG 1;  1DOX A;  1CQV A;  3NS1 A;  2M0A A;  3AEB B;  3AN1 A;  3VQI A;  1PUT A;  2KAC A;  1XLQ A;  1I4R A;  2J53 A;  3FC4 A;  2WDQ B;  2RDH A;  1NEN B;  1Y56 A;  4P6V F;  1FCL A;  4OVZ A;  4JE3 B;  3W9C B;  1VZ6 A;  2DYO A;  2W3R A;  4ZRP A;  5LNK 1;  1WGK A;  3AED B;  1XO3 A;  3AEF B;  1AN8 A;  2MJE A;  1NYR A;  3AEE B;  1HXY D;  1C79 A;  3AB5 A;  1JW9 D;  1L0Y B;  2ICI A;  2K22 A;  1C78 A;  1GAQ B;  3ZJT A;  1QIL A;  1I4X A;  2L32 A;  3EGR A;  1PYW D;  1K50 A;  3R2I A;  1QOB A;  3W2D A;  1JRP A;  2WXO A;  2PKO A;  4REZ A;  2IDY A;  1N5W A;  2QSD A;  1TY0 A;  3MFG A;  5BYQ A;  2JU6 X;  3VRB B;  2HDE A;  1TS3 A;  5AUI A;  2PVG C;  3I9V 1;  2RPV A;  1KF6 B;  1LO5 D;  1YN3 A;  1FIQ A;  1GB4 A;  1P7E A;  3ABV B;  5TSS A;  2W3S A;  1L4D B;  1XLP A;  2WLB A;  3EA6 A;  4YWG G;  2KAJ A;  2W82 A;  3MP9 A;  2BB5 A;  3ZGZ A;  4WUR A;  3NVZ A;  1F2R I;  3V3X A;  1ESF A;  2BS4 B;  2N9K A;  5BYS A;  1SBB B;  2FBW B;  3AE6 B;  1QLB B;  4YTP B;  1L0X B;  1YNT E;  3FIL A;  4HRS A;  5EE0 A;  1FRD A;  1QOA A;  3W5U B;  3NZ3 A;  1C9F A;  2YEP B;  3BVZ A;  1FXA A;  1R7S A;  2K3U A;  2PMV A;  3P4P B;  1D5Z C;  1DOY A;  1FNW A;  2H89 B;  1WWT A;  4RF1 A;  4RGT A;  1E0Z A;  5GXG B;  1TZO A;  1XF5 L;  3P4Q B;  4KGT A;  3GP7 A;  3P42 A;  1C4C A;  2WXK A;  3BK2 A;  1BXT A;  3HRD D;  1L0V B;  2QIL A;  3P4R B;  2WXF A;  3AV8 A;  3U52 E;  1HA5 A;  3B9J A;  3IT4 B;  1SE4 A;  1KTK A;  2LGI A;  4A6Q A;  5MPO A;  3AE7 B;  2WXR A;  4N6E B;  1B1Z A;  1Q10 A;  2K5P A;  2LHD A;  4JPS A;  3B2G A;  4KKJ A;  4NAW B;  4XWW A;  1PGX A;  2IGH A;  1C76 A;  3L4P A;  4KGR A;  3ZJU A;  2DYM A;  2JQR B;  4YSX B;  2AX5 A;  2PIA A;  1TJE A;  5C2T B;  5G5H A;  1QT9 A;  1FO4 A;  1N62 A;  4KX6 B;  1D5M C;  4MAC A;  3IT6 B;  4AS1 A;  2WXL A;  2V0G A;  1ZXH A;  1FD6 A;  3PZ7 A;  1KFY B;  2WU2 B;  3MHZ A;  1CK1 A;  2J52 A;  4C80 A;  1I7H A;  4L1B A;  2IPK D;  3N9Y C;  5G5G A;  4ARC A;  1QQR A;  1PGA A;  1QKZ A;  2JYT A;  3NRZ A;  1CZP A;  4Q2J A;  4WAF A;  4HKQ A;  1MHX A;  1B9R A;  4NZL B;  2N0S B;  2BS2 B;  2FE8 A;  1K52 A;  1TS4 A;  1V1P B;  1VR9 A;  3GS2 A;  2L83 A;  1E10 A;  3KWV A;  3OWE B;  2WNM A;  1SEB D;  5FKA C;  1E7P B;  4TSS A;  4ZHO A;  2Y5P A;  2KDM A;  4FXC A;  4IDI A;  3MJ5 A;  4HRO A;  1SJE D;  1HEZ E;  1ET6 A;  4IOI E;  3H8H A;  2WXN A;  2JWU A;  3BVM A;  4JWS C;  4L2Y A;  2CJO A;  1EWY C;  1V1O A;  2KQ4 X;  2XN9 C;  2IGG A;  1AW7 A;  2SEB D;  1YQ4 B;  1V8C A;  1HZ5 A;  4RGO S;  2EEL A;  1TY2 A;  3AE1 B;  3AH7 A;  1F0Z A;  3AE4 B;  2NTS A;  2D5G A;  3TEY A;  1YN4 A;  1I4H A;  1SB3 C;  5T8I A;  1ZE3 D;  4OW0 A;  1AWD A;  1YJJ A;  2INP E;  2LUM A;  4MH8 A;  1VZ8 A;  5E6J A;  1MPE A;  2J4X A;  3BII D;  1DGJ A;  1JWM D;  1P7F A;  2LFI A;  4YT0 B;  1ZPS A;  1UWM A;  3TEZ A;  4AQ7 A;  2ONQ A;  2PW9 A;  2WXP A;  4LLG M;  4XWT A;  4US9 A;  3KQ4 A;  1UWX A;  1JML A;  2GRI A;  4H2A A;  4US8 A;  5HFY A;  3AE2 B;  1GB1 A;  1N63 A;  4O1N A;  1EU3 A;  1ZDV A;  2IGD A;  1FM0 D;  2GB1 A;  1M4V A;  1TYG B;  5BMI A;  1EU4 A;  1OQQ A;  5I4D A;  1ZUD 2;  4NJC A;  2V4I B;  3VR8 B;  2L52 A;  1FNV A;  2MEK A;  1L5P A;  1SE2 A;  1SSN A;  1T5X D;  2JXT A;  3CIR B;  4XDD A;  5BMG A;  2Z8L A;  1ZOY B;  1IGC A;  3C8Y A;  2LHE A;  4KGS A;  1HQR D;  3AMZ A;  2Y3A A;  1RFK A;  3AEA B;  1FFU A;  1I4P A;  3O13 A;  2J42 A;  3FAH A;  2L1A A;  4A90 A;  1TKY A;  3AE9 B;  3R2T A;  1OQR A;  1XEE A;  1ACC A;  2N7J A;  1JCK B;  4ITK A;  3DWM A;  2CJN A;  3FIL B;  1KH0 A;  3TUO A;  4A55 A;  3BYT B;  2AQ2 B;  4C7Y A;  1JWU D;  1FEH A;  2BBC A;  1STE A;  2RMM A;  3BK1 A;  3E9S A;  1WXQ A;  2QEJ C;  3KLS X;  1SE3 A;  1T6B X;  4MM3 B;  3NUH B;  3BZD B;  1JQ4 A;  1WYG A;  1K51 A;  1FMA D;  4RGN A;  3PZ8 A;  1BUI C;  1J7B A;  3GB1 A;  1XCQ L;  1VDV A;  2BYT A;  1ZXI A;  1NYQ A;  2HTM E;  1KLU D;  2JYE A;  2K0P A;  2PTL A;  2VZK D;  3NVV A;  2W54 A;  1NI3 A;  3WCQ A;  1VZ7 A;  2DWQ A;  4RFB A;  4C56 C;  1YMH E;  4KKI A;  2OHF A;  2H88 B;  1MHH E;  1FFV A;  3PO0 A;  4WWM A;  2BW2 A;  4HKZ E;  2DLB A;  4OZA A;  5HI1 A;  1PGB A;  2QJL A;  2WXJ A;  2X38 A;  1YJI A;  4N59 A;  1XXG A;  5HG2 A;  2M19 A;  2AQ3 B;  3W5V B;  3ZQ4 A;  2K9X A;  5H92 C;  3R8B A;  3SFD B;  1XCT L;  4NAM A;  1NEK B;  2JSV X;  5HHD G;  1BML C;  3EUB 2;  4YTM B;  1FNU A;  1ET9 A;  4WIP A;  1UNS A;  3AE8 B;  4OZB A;  1SJH D;  1JWB D;  3LXF A;  3VR9 B;  2IJ0 A;  3P4S B;  3KWL A;  5BMH A;  2NMQ A;  2E3T A;  2CU3 A;  1J7C A;  1J7A A;  3MC0 B;  2LJI A;  1MVK A;  1N60 A;  4LK0 M;  5D3I B;  1T3Q A;  3SEB A;  3SR6 A;  3AM9 A;  3U2S C;  3VRA B;  3RPF C;  1XLN A;  1N61 A;  1QOG A;  2YEP F;  1TKE A;  4WQM A;  4B0M A;  4GDK B;  5D3D A;  1HZ6 A;  3DWG C;  2QIE B;  1YN5 A;  1RYJ A;  4MT5 A;  2Y5C A;  1IUE A;  1MI0 A;  5FR3 A;  2TSS A;  1SF0 A;  2E6X A;  2JX5 A;  1TKG A;  4GLS C;  1FXI A;  1FRR A;  1WSP A;  2ON8 A;  2ACZ B;  2AQ1 B;  5JXV A;  1ZDX A;  2BS3 B;  1VLB A;  3IXS A;  2MH7 A;  3U7Z A;  1UUP A;  2V3N A;  5BYR A;  1ZP0 B;  2BTE A;  4ZRQ A;  2WXI A;  3BVG A;  1K53 A;  2NTT A;  5H8Y E;  2R61 A;  1TS2 A;  4IKG A;  4YTN B;  1CJE A;  5D7G A;  1UGJ A;  1RWS A;  1D6E C;  2JZP A;  3HUI A;  3TEW A;  3URY A;  4RGM A;  2PVO D;  2BT6 A;  4L23 A;  2G9H D;  3J9C A;  3TEX A;  1EM7 A;  4EE2 A;  3IAS 1;  2VZK B;  4P16 A;  2INN E;  5FK9 C;  1WRI A;  4CQN A;  2WDR B;  2WXG A;  3E56 A;  1L6U A;  3Q8A A;  3HVD A;  3T3O A;  3V05 A;  2V3P A;  1E9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...