1GJZA

Solution structure of a dimeric n-terminal fragment of human ubiquitin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Dimeric N-Terminal Fragment of Human Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin
molecule keywords UBIQUITIN
total genus 6
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gjzA00
3QHTA 2ASQA 3AU5A 4MGKE 3VQIA 2NCNA 4RM9A 3VTUA 2RGFA 2MBBB 4HJKA 3HHMA 3L16A 4K7SA 2MLBA 3KUCB 5CHVC 2L05A 3V6CB 4PS3A 3EFUA 4XC2A 5FR6A 1V6EA 2JF5A 2KANA 2KWCA 4WWNA 4HK2A 4LDTB 2GBMA 2K25A 2BWES 2JZZA 4NPNA 4DXAB 1I35A 1UZXB 2KLGA 4LJPB 4ASWC 3Q3FA 3WALA 2PPHA 4DDID 2MBEA 2AL3A 2LD9A 4BKGA 3KYDD 3WIMA 1CMXB 2REXA 4YL8A 4W9JA 4W9GA 4BKSA 2BGFA 1WE6A 4W9DA 3VFKA 2LXCA 4WJQA 3DQVA 1LFDA 3JSVB 1A5RA 2LRWA 1OTRB 2JY6A 3B1LX 3CMMB 3ECIA 4MSQB 5CTRC 2G4DB 1WR1A 2IO3B 3DVGX 4ANUA 2WX1A 4K7WA 3SD5A 3A9JA 3CSFA 4NAWB 1I42A 3JW0X 4DHZE 2O6VA 1WGGA 1SIFA 1GG3A 5L83A 2G3QB 4ZYNA 1Z5SB 2Z59B 2N4FA 3DVNV 2ZCCA 4DK5A 3EC8A 3WAMA 3PREA 2FIDA 4W9CA 1BT0A 5D2MB 3TCAA 4W9EA 4ANWA 2O6VD 2UWQA 2QHOA 4HDQA 4KVGB 2KKCA 3VUXA 4W9IA 1E7VA 1VD2A 2DAJA 1WMHB 1Q0WB 1IPGA 2KJRA 2MRPA 3KW5B 2LGXA 1WGYA 2BKRB 2CHXA 4MGYE 3U7DA 3NS8A 3N32A 1WZ0A 1V80A 3K9OB 2DYBA 2GBKA 3DDCB 4IM2A 2MCNB 1C3TA 2KN5A 1V81A 4FA6A 4HLEA 3WAOA 4FULA 1WJ6A 3VTVA 2M0XA 2LASA 1UH6A 3APDA 5DPRA 3RCZA 2LI5A 2KJ6A 2FIFA 3T8MA 3ZDMC 2LXAA 3OAWA 3WA0A 2CU1A 2JVCA 3PRZA 3X23A 2L7RA 4HCNB 4RMAA 2K8CA 1ISNA 2KX3A 2KC1A 3L08A 3QC8B 4IWQA 1WGHA 2G4SA 1E8ZA 3I3TB 3JVZX 3DVNU 1Y8RC 3SU8X 2PE6B 4E71A 2NVUI 1ZGUB 3A1QA 2Z0DB 2N7DA 4MJSA 3AI5A 2KWUB 2ZJDA 3NOBA 2KWVB 2KJHB 2RSUA 2L0TA 3A9JB 3A4RA 3PV1A 4GU2A 4MEMA 1L2NA 3DCGA 5C1ZA 3UQBA 1WM3A 4X57B 3L54A 4GDLB 4DHJB 2N1WA 2MBHA 1WI0A 2KDBA 2L0FA 3BY4B 4M8NA 2J0KA 1IP9A 2KDIA 2DYMA 1GJZA 4KZCA 4PS8A 2NR2A 3NZUA 1WXAA 2C9WB 4XZ4A 5AEKB 4W9KA 3PHXB 2KD0A 4FHKA 2GMIC 3M95A 3TIXA 4MELA 2O2VA 1WZ3A 2NBUA 1SE9A 1WR6E 4KIKB 2G45B 4I6PA 2CHZA 2LRUA 3H7SA 4FLHA 4WJPA 1ZW7A 1R4MI 4KIKA 1V2YA 2D10A 3PLUA 3PT2B 1WM2A 1AARA 5E6PA 2DENB 4G11A 3OJ3A 4KV2A 3DBLI 1NI2A 3HM6X 2LVQA 5JZEB 4WJOA 3WANA 2N9PC 3RT3B 3ZNHB 1GC6A 2ZPNA 4BOSC 2OJRA 5G2NA 1WE7A 1GNUA 4AP4C 3VAWA 2CKHB 2EMSA 1XT9B 1X1MA 4M0WB 1E8YA 4CHKA 3PLVA 2JRIB 3IBEA 1LQBA 4NJ6A 3S2AA 3KH0A 1KOTA 2NBWB 3HK0A 1XD3B 3TJPA 4B6WA 3B0AA 4KSLC 2FCQA 1V5OA 3ZUNA 4PS7A 1NDDA 3H7PB 4E74A 1OGWA 5EDSA 2KHWB 1P0RA 1UD7A 1YX5B 2M17A 3R66C 4FBJB 2LVOA 4EZKA 2C7NB 1WY8A 2MQJA 4HPLB 3RULA 3VVWB 2HJ8A 1YD8U 4IWOA 2W9NA 2RD0A 4A3OA 2IYDB 2FAZA 3V60A 1WJ4A 5D6JB 4ZRIA 3PPAA 1H4RA 2NPTB 3L13A 1J0GA 3QK0A 2MA9B 3NHEB 1NBFC 2BWFA 2M1MA 4IUMB 1IYFA 3A9KA 1OEYA 3PTFC 3ZNZB 3ZTDA 4ICUA 4ICVA 3U30A 3L10B 2MP2B 4DWFA 2KX0A 5KHQA 3ZW3A 2CHWA 4TV3A 1K8RB 1MG8A 4II2B 2DZMA 3D32A 1HE8A 2EKEC 2JPHA 2CS4A 1FXTB 1Q5WB 2EMTA 4NY0A 3M62B 2KTFA 3H6NA 2LUEA 2K6DB 4WJNA 3HIZA 2R2OA 1WF9A 3A1QB 5GMVA 4RM8A 4MGIE 1UELA 2A5UA 2V3SA 4FJVB 4GDLA 2O6VB 1YX6B 1E90A 1WX7A 2FUHB 1KLVA 4DHZB 5AZFA 1Z2MA 1WXMA 4IG7B 3OJ4B 3VUWA 3VH4B 2I1JA 4MGZE 2DZKA 3V61A 3APFA 2C7HA 1YJ1A 4FADA 1PQSA 3TL5A 2K8BA 1J8CA 2KDFB 4FJZA 5BO4B 3VXWA 5J17A 1YQBA 3ENEA 4HCPB 1ZKHA 2GBJA 4MJSB 4PYZA 4ANXA 4NQKE 2BYVE 3L0WB 3ZRFA 2JZ3B 3KYCD 4E3CA 3RUIB 2IO0B 2FCMA 3DPDA 4HPMB 4EUTA 3DOWA 1P1AA 2WYQA 2D2QA 3SDLC 2OOBB 2L00B 5AZHA 2C5LC 3QAQA 4F8CB 3DVGY 2J0MA 1L7YA 5LLIA 3ZLZA 4GN1A 3QARA 2WX0A 3DBHI 1WGRA 3CSTA 3MTNB 4GB9A 4IW0A 4J6IA 4TUUA 3QCAA 1D3ZA 3R7RA 3QIJA 4G0NB 5JHAA 4B95A 1V49A 2DAFA 3NZSA 4DDGD 1UGMA 1U4AA 5D94A 5E6NA 4EFOA 2XEWA 2C7MB 4ZDVA 1EF1A 1LXDA 2KQ7A 4URKA 1P9DU 2FCNA 3ML9A 4CYEA 5J18A 5IAAC 4DHJD 4TQ0A 2HTHA 1WJUA 4I6NB 3K9PB 3DBRI 3ZDTA 3C0RB 3QX1A 3ZTCA 1TBEA 3R7QA 3QQ8B 5D7GA 4KZ0A 3ONSA 4HWIB 1GC7A 1E7UA 3AU4A 3L17A 2XK5A 3PRPB 2LGYA 2IY1B 4F7ZA 3WAPA 3QWZB 4MM3A 3B08A 1WH3A 2ZVOA 2KNBA 2A4ZA 4K1RB 2MP2A 4AJWA 1C1YB 2KZRA 2NPTA 1S1QB 4NJ7A 3VDZA 3A9KB 5DPTA 3U8ZA 1WXVA 2BKFA 2JWZA 4KDLB 4EZLA 2KVRA 4JGHB 2PE9A 3VH3B 3IVFA 1E8XA 4ZRJA 5DPSA 2MW5A 3APCA 2KK8A 1T0YA 4FHJA 1H8CA 1WMHA 3VHTC 1EUVB 4MDKE 5JHBA 3RZFA 4II3B 2WWZA 3A4SC 1R4NI 2O2VB 2ZNVB 3VTWA 3H7PA 2R2QA 3A33B 3ZO5B 2KFJA 2BYEA 4BKTA 3UIPB 2RPQA 4GOCA 4M8MA 3PS6A 2FNJB 2K8HA 4GSWA 3N30A 1S3SG 3X0WA 3ZKJC 2V4LA 3T9LA 5HKHA 4JL9A 4JLCA 3KUZA 2D11A 1QZEA 2KXJA 2NBVB 2UYZB 4IM3A 2CR5A 2PJHA 1J19A 3JSVA 2KTRB 5TR5A 2IO1B 3SHQA 5E6OA 1EO6A 3LJ3A 3PGEA 2ZVNA 4BOZB 2YVCA 3AULA 3PRMB 2MWSB 2BPSA 4BVUC 1E8WA 2JRHA 3HM3A 4HVBA 2KQSA 4HDOA 4BFRA 3KUDB 4MSMB 2LWPA 2K6QA 2AWTA 3CF6E 1WJNA 4P7IA 3QJZA 4GDKB 4OVUA 1OQYA 4AOFA 3TMPB 1RAXA 2GBNA 3ZNGC 1UBQA 2Z0EB 1GUAB 2N7EA 1KJTA 2DZJA 3M3JA 3Q3JA 4IC7B 5AZGA 5LXIB 3W1SA 2DHZA 1JRUA 2RR9A 1EF5A 1Q1OA 3IFWB 2NS5A 3RZWC 3ZRCA 4GIVA 5J2RA 2D3GA 3UF8A 2HD5B 4OVVA 3PHWB 3PZDA 5L95C 4AWJA 3N3KB 3PSEB 1M94A 4GDKA 4NQLB 5C23A 3GZNI 2PEAA 2M8SA 3V6EB 2KFKB 2XK5B 4IWPA 3NY5A 3DBSA 4JIOU 3UIOB 4TQ1A 2LJ5A 2KDEB 3R3MA 1WYWB 3PVLA 4TKNA 4KSKC 4W9FA 3UQAA 1SGHA 4B9KA 2DZIA 2IZVB 3RYTA 3IHPC 4GMVA 5KHOA 2ZNVC 2JUOA 1G6JA 3LDZE 2FCSA 4K7UA 2KFKA 3W1SC 1V5TA 1TTNA 4EOYA 2MX2A 3UGBB 1WX8A 1WRDB 5IA7A 3KVFB 3VUYA 3MHSD 2VRRB 5JH5C 1V9JA 2KOXA 5CHWA 1WIAA 4NAWA 3ZIMA 4F1SA 2J0JA 2KMCA 4FJYA 2WDTB 3TBLD 4CO7A 5LXHA 1WGDA 4I6LB 1VCBA 2KC2A 2V1YA 5CX3A 1TZ1A 2HE7A 2K1FA 3EHVA 3JYUA 3OLMD 2L3ZA 2AEHA 4LCDE 1WFYA 2Y5BB 4WWPA 3ZNID 5DPWA 2IY0B 2N1VA 4A20A 1P3QU 3EECA 2GBRA 2KMAA 2L76A 3IG3A 3QA8A 1F9JA 2N9XA 4FN2A 4MH0E 2L8JA 2DYOA 2N9EB 3UINB 3H9DA 4WWOA 2MBQA 1V86A 4BKSD 3ML8A 2K39A 3W1YA 3BINA 2ZZPB 4BBNF 1TGZB 2B3AA 1RLFA 4KDIC 5CHFA 1LM8B 3M63B 4AJYB 2MBOA 2ZCBA 3RD2A 2ZPYA 4WQOB 4WAAA 4HXDA 4IM0A 2ZEQA 4ANVA 2LVPA 2KO3A 4EZJA 1KM7A 2AYOB 2LZ6A 3V62A 4DBGA 1WX9A 4A3PA 2LGDA 2XBBC 3O65B 1WXSA 2M4NA 1OEYJ 1P98A 4W9HA 4W9LA 4G50A 4EKUA 2IO2B 2DX5B 4BBNC 3MJWA 4K81A 4JQWC 4LDTD 4ZRKA 1YIWA 2YLMA 2BF8B 4AUQC 2AL6A 1XQQA 2BYFA 2C60A 2D07B 2MSED 1RFAA 2IBIB 4GGQA 3GOEA 5DCNA 2GOWA 2KLCA 4GXBA 4PYUA 4G3XB 4EEWA 3P2BA 4NNJB 2KTRA 4XX5A 5G55A 3H1UA 2JXXA 3ZVVA 1E5WA 1UBIA 3AXCA 2I1KA 2JT4B 4N9F4 1RRBA 2J7QB 3ALBA 4LJOB
chains in the Genus database with same CATH superfamily
1F2RI 3QHTA 2ONQA 1TKEA 3AE4B 2NCNA 3B2GA 3DBHB 3EFUA 4HK2A 4IDIA 2GBMA 2K25A 3WALA 1FNWA 2LD9A 4BKGA 3KYDD 3WIMA 3Q14C 1WGKA 1CMXB 3RNBC 4W9DA 1CK1A 1HEZE 3CMMB 4MSQB 1WR1A 3SD5A 4NAWB 1I42A 2WHIA 2Z59B 4W9CA 2LJIA 3KWVA 2OHFA 4W9EA 4ANWA 1XEEA 5HG2A 2Q5WD 1QOBA 2KJRA 1MHXA 2MRPA 2LGXA 1KLUD 2PVGC 1TIFA 1WZ0A 3K9OB 1V1PB 2MCNB 4S17A 3SR6A 4FULA 1WJ6A 2LASA 3AEFB 4MACA 5DPRA 4C00A 2KJ6A 2FIFA 1DOYA 4ARIA 3X23A 4RMAA 1ROEA 2WDQB 4E71A 1ET6A 4Q2JA 1ZGUB 1QQRA 3A1QA 1MI0A 2N7DA 3AI5A 1VR9A 2LMCA 2UU7A 3NOBA 4L1BA 1SJED 1R7SA 2WU5B 3DCGA 5C1ZA 4X57B 4DHJB 2MBHA 4M8NA 2J0KA 2WNMA 1D5MC 1XCQL 2Y5CA 3NZUA 4XZ4A 3PHXB 4A55A 2GMIC 4MELA 4KIKB 2VZKB 1C76A 2LRUA 4FLHA 1R4MI 3IAS1 3MC8A 2JWUA 1NI2A 4ZHPA 2LVQA 3WANA 2V3NA 2RDBC 1XXGA 1GNUA 3RNGC 2CKHB 2EMSA 1XT9B 2TSSA 1RYJA 1E8YA 4CHKA 3PLVA 1KTKA 1FEHA 1FFUA 4NJ6A 3S2AA 3KH0A 1KOTA 3TJPA 4B6WA 3B0AA 3EA6A 2KHWB 4M00A 4M0WA 3R66C 4FBJB 4EZKA 3VVWB 2MH7A 4HPLB 2W9NA 4A3OA 1QF6A 3V60A 1WJ4A 1DOXA 2JU6X 3L13A 4IOIE 2PTLA 2BWFA 1IGDA 2HJ1A 1UUPA 2D5GA 1OEYA 3PTFC 4B0MA 4K3BA 2KX0A 1MG8A 3D32A 2SAKA 2EMTA 3M62B 1C77A 2LUEA 2K6DB 1GAQB 3HIZA 3NRZA 4A90A 1UWXA 3AV8A 1N62A 4GDLA 2O6VB 1E90A 1L5PA 2FUHB 1TYGB 1Z2MA 3VUWA 4MGZE 3APFA 1J8CA 4FADA 1PQSA 1HA5A 4MJSB 4HEA1 2BYVE 3L0WB 4HROA 2PMVA 4E3CA 2JXTA 2FCMA 3DPDA 1XLNA 4AQ7A 2KAJA 2OOBB 1E0ZA 5AZHA 3DVGY 2I2YA 1WGRA 2JZPA 4JPSA 3QIJA 2RMMA 3NG0A 4B95A 1YJJA 5JHAA 4DDGD 1SB3C 2V9HA 1F0ZA 5AUIA 3MC9A 4CYEA 3AM9A 4XGAB 2L1AA 3K9PB 1EWYC 3C0RB 3QX1A 1KF6B 3ZTCA 1UNSA 4C56C 2AQ2B 2XK5A 3AB5A 2LGYA 2KNBA 2MP2A 1C1YB 2KZRA 4WH4A 2M0AA 2WXNA 2VH2A 4XDDA 1ESFA 1V1OA 2WGSA 1H8CA 1WMHA 2K22A 4P6VF 4OZBA 4USAA 3H7PA 2R2QA 2INCC 3PZ8A 2KFJA 4M8MA 3PS6A 1I4HA 2V4LA 3AEGB 4MT5A 4JLCA 2KXJA 2CR5A 2KTRB 5TR5A 3SHQA 3PGEA 1BXTA 3BVZA 2YVCA 1LGRA 3PO0A 2MWSB 4BVUC 2JRHA 3RNCC 5TSSA 2LWPA 2WDRB 2AWTA 4NJCA 1VJKA 1JWMD 1WJNA 4P7IA 4LLGM 1V97A 2MJEA 3MJ5A 4OVUA 1OQYA 5BMIA 1QOAA 1ZOYB 3E56A 1ZXIA 2G9HD 1GUAB 1KJTA 3Q3JA 2WLBA 4YTPB 2LFIA 3N20C 1FO4A 2NS5A 3UF8A 3TEYA 2MJDA 3PSEB 3Q8AA 1ENFA 1PFDA 4GDKA 4NQLB 3GZNI 5C23A 3RN9C 2KACA 2M8SA 3NY5A 5FKAC 4W9FA 2KDEB 4KSKC 1ZUD2 3URYA 4B9KA 4YSXB 3RYTA 4M01A 3IHPC 2WXOA 1T0SC 3W1SC 2LGIA 1V1PA 4OZCA 3MHSD 2VRRB 1V9JA 1KFYB 2J0JA 1DGJA 2WDTB 1WGDA 3KWLA 3VRAB 2V1YA 1SF0A 3EHVA 3JYUA 4KKJA 4ZHOA 5DPWA 3H8HA 2IY0B 2N1VA 4P1CC 5G5HA 2J53A 2GBRA 2KMAA 2IGHA 2N9EB 1NENB 3ML8A 2K39A 1JCKB 1TGZB 5GXGB 2B3AA 4KDIC 1JWBD 4NAMA 1N60A 2ZPYA 3W5UB 4US9A 1E6EB 2KVZA 4EZJA 4KGTA 1WX9A 4A3PA 4W9LA 3ZJTA 4EKUA 4JQWC 4LDTD 1YIWA 3ZXRA 2BF8B 2AL6A 2C60A 2QC8A 1E9MA 3RMKC 4PYUA 1RM6C 3DBRB 5G55A 2JXXA 1UBIA 3B2FA 4LJOB 3AU5A 4MGKE 1R4NB 4KGSA 3VTUA 4RM9A 2RGFA 4HJKA 1B1ZA 4YTMB 3HHMA 4K7SA 5CHVC 3V6CB 2L05A 2KT7A 5E6JA 4XC2A 3AE1B 5FR6A 1V6EA 2KANA 4WWNA 4NPNA 2BWES 4DXAB 1UZXB 2KLGA 2PIAA 4ASWC 3T3NA 2MBEA 2AL3A 4YL8A 3AN1A 4W9JA 3RI7C 2Y5PA 3VFKA 2NTSA 1JROA 1GB4A 1LFDA 3JSVB 3SFEB 1OTRB 2JY6A 5CTRC 2IO3B 3DVGX 3A9JA 1L0YB 3JW0X 4DHZE 4GLSC 2G3QB 2J52A 3BYTB 3BK2A 4DK5A 3OG5A 3WAMA 1EU4A 1L6UA 4YSYB 2UWQA 2J42A 2FBWB 1Q0WB 3KW5B 2BKRB 2CHXA 2K5PA 3GB1A 1QKZA 3LXFA 2DYBA 2GBKA 1T3QA 4HLEA 3WAOA 3VTVA 3RCZA 2LXAA 3OAWA 4S0RA 2JVCA 2L7RA 2BB6A 1VZ7A 2KX3A 3QC8B 2KC1A 2ON8A 4IWQA 1E8ZA 4OZAA 3OWEB 1Y8RC 1SE4A 2INPE 2KWUB 2ZJDA 2QJLA 2KWVB 4ZYSA 2FE8A 3A4RA 4TMAB 3L54A 3BY4B 1OQRA 3E9SA 4LTUA 1GJZA 2DYMA 2WXGA 4KZCA 1C79A 1WXAA 1L4ZB 2INNE 1AYFA 1VZ8A 2RDHA 4FHKA 2O2VA 2NBUA 2PVOD 1SE9A 1WR6E 1F1HA 2LHEA 1HZ5A 3PT2B 1XLQA 1AARA 4G11A 4RFBA 1TS5A 2KMMA 5JZEB 2N9PC 4BOSC 1J7CA 2OJRA 1X1MA 1LQBA 2NBWB 3N1ZC 4N59A 2FCQA 3H7PB 1YN4A 1FNUA 1WY8A 2MQJA 4YXDB 5BMHA 2RD0A 1PGXA 1N5XA 5D6JB 1L0XB 3FC4A 1J0GA 2MA9B 3NHEB 1VZ6A 4MM3B 2IGDA 4ICUA 4ICVA 3U30A 2MP2B 3ZJUA 2CHWA 2JPHA 4OHJA 1Y56A 2IJ0A 2R2OA 1WF9A 3A1QB 3RPFC 4JX1C 2CU3A 2GB1A 1SE3A 1L6VA 1YX6B 2WXHA 1I4PA 1KLVA 3OJ4B 3VH4B 1PYWD 2I1JA 3AH7A 3BVGA 3V61A 2K8BA 1FMAD 2WS3B 4FJZA 5BO4B 1YQBA 3ENEA 4PYZA 4RF1A 1MFWA 4NQKE 3RFZB 3ZRFA 4EUTA 3DOWA 1P1AA 2D2QA 3SDLC 2QEJC 1VDVA 4F8CB 2J0MA 3ZLZA 1QLBB 3QARA 2WX0A 3IXSA 3V05A 3CSTA 4IW0A 4GB9A 3QCAA 1D3ZA 3FILA 1ZPSA 1KLGD 3R2TA 1L0VB 1UGMA 2G1EA 3MHZA 2V4IB 4RGTA 2XEWA 1EF1A 1LXDA 4URKA 5G5GA 4DHJD 4TQ0A 2HTHA 2QMTA 1MHHE 5D7GA 4H2AA 3ONSA 3V3XA 3AU4A 1OFFA 1NI3A 2D3CA 2IY1B 4C7ZA 3WAPA 3B08A 2ZVOA 2MHJA 1FPYA 1BUIC 1WXVA 4REZA 4KDLB 3U4EG 3IVFA 5DPSA 2MW5A 3APCA 3DBLB 2KK8A 1T0YA 2KDMA 3VHTC 1FXAA 5JHBA 2DNFA 3UI3A 3AEBB 3A4SC 1R4NI 2O2VB 2ZNVB 3A33B 2W55A 2BYEA 4BKTA 1T0QC 1UF0A 2FNJB 3N30A 5HKHA 4IM3A 3JSVA 4HJGE 3HVZA 2IO1B 3P4RB 1TZOA 5AUKA 1SJHD 1EO6A 3DWGC 3LJ3A 4BOZB 1I4GA 3AULA 2BPSA 3EUB2 3Q2AC 1I4QA 2XNAC 4BFRA 4MSMB 2K6QA 4A9AA 2WU2B 4GDKB 3TMPB 2YEPB 1JMLA 2AQ3B 2BB5A 2GBNA 2DLBA 3WCQA 1LO5D 1STEA 3P1MA 3W1SA 4J3OD 2RR9A 1AN8A 4XYCA 2X38A 3RNAC 2HD5B 3PZDA 2N7JA 5BYRA 2PEAA 5D3DA 3V6EB 2K3UA 2XK5B 3NUHB 3TEZA 3HUIA 2WXRA 5C2TB 3UIOB 3R3MA 4TKNA 4RGMA 1SBBB 2K0PA 5KHOA 2ZNVC 1TKYA 2WXKA 2KFKA 1V8CA 1C9FA 3U2SC 2MX2A 1WRDB 4KKIA 4FJYA 3DHIC 3TBLD 4CO7A 2N9KA 2BS2B 5CX3A 1TZ1A 2K1FA 4ZOHC 2L3ZA 4LCDE 1TS4A 1WFYA 2Y5BB 3HRDD 2JX5A 3AEAB 1T6BX 3EECA 3IG3A 2N9XA 2DYOA 2MBQA 1V86A 3VR9B 5CHFA 1CQVA 1LM8B 4WQOB 4WAAA 4HXDA 4IM0A 2ZEQA 1ZP0B 2LZ6A 2WXQA 1WXSA 1P98A 2IO2B 4WIPA 3Q8FA 2YLMA 4AUQC 1XQQA 1RFAA 2MSED 5DCNA 2W54A 1ACCA 2LUMA 3W2DA 3AE2B 1SXTA 3ZVVA 3R2IA 1RRBA 3ALBA 1TJEA 4XE0A 4IKGA 1PGBA 3VQIA 1FFVA 1K50A 2MLBA 1WXQA 3DHGC 1F77A 3T3OA 2JF5A 3BZDB 2PPHA 1JW9D 1RFKA 4W9GA 3DHHC 2BGFA 3HVDA 2CJOA 2OJWA 4WJQA 3Q3OC 4P1BC 4HKZE 1ZXHA 3B1LX 3NVWA 4K7WA 2JYEA 1N63A 3CSFA 1FRDA 2O6VA 1SIFA 1GG3A 5L83A 1JQ4A 1Z5SB 2BYTA 3C8YA 3EC8A 2FIDA 1K52A 3TCAA 2KKCA 3VUXA 4W9IA 1E7VA 1VD2A 2DAJA 1WMHB 1IPGA 2YEPF 4MGYE 1SIJA 3U7DA 3N32A 1V80A 2KQ4X 1N61A 2KN5A 3R8BA 1V81A 2WDVB 5FK9C 4FA6A 5IN7A 2M0XA 1UH6A 3APDA 3T8MA 3ZDMC 3P42A 2HTME 3L08A 1WGHA 1IBXB 4C7YA 3I3TB 3JVZX 3SU8X 2PE6B 4LNOA 2Z0DB 3BYYB 1KRHA 1F2RC 5IP4D 3A9JB 1B9RA 2L0TA 3PV1A 4ZRPA 1EU3A 4QAYA 2WXLA 5MPOA 1FXIA 1WI0A 2L0FA 1IP9A 3TSSA 2NR2A 1E7PB 2C9WB 5EE9A 2KD0A 3M95A 3TIXA 2D3AA 4M02A 2BQQA 2G45B 1DYQA 1YOVB 3H7SA 4WJPA 1ZW7A 4KIKA 5EE3A 2D10A 2DENB 3OJ3A 3DBLI 4N58A 3GE3C 3P4SB 3RT3B 3ZNHB 2ZPNA 1IGCA 2B76B 5G2NA 1WE7A 3KLSX 4AP4C 5HFYA 1FM0D 4TSSA 2PKOA 1FD6A 3IBEA 4D2KA 3HK0A 2WXIA 4KSLC 3IT6B 4E74A 1OGWA 1HTOA 1P0RA 2M17A 2CJNA 3KQ4A 4B0EA 5T8IA 3RNEC 1YD8U 4IWOA 5IO9A 2L52A 3ETRA 3PPAA 1EM7A 2NPTB 1NBFC 2M1MA 4PK1A 4IUMB 1WYGA 3A9KA 3ZTDA 1CZPA 2WXMA 5KHQA 3ZW3A 1XO3A 4II2B 1HE8A 1QILA 2EKEC 2W82A 1MJDA 1FXTB 1Q5WB 4NY0A 1D6EC 2BBCA 4WJNA 5GMVA 2A5UA 2V3SA 4KGRA 1WX7A 5I4DA 4DHZB 2WP9B 3GE8C 4IG7B 2BS3B 4DXFA 1TY2A 2INDC 5J17A 2J4XA 3VXWA 1ZKHA 4YSZB 1SSNA 1HTQA 3TEWA 2JZ3B 1UGJA 4HPMB 3RUIB 2L00B 2GI9A 2C5LC 3QAQA 5LLIA 3AEEB 3VRBB 3MFGA 4BZAA 3SEBA 3MTNB 4J6IA 4TUUA 1YQ4B 3AEDB 1V49A 2DAFA 3NZSA 5E6NA 1ZE3D 2KQ7A 3W5VB 5EE0A 5J18A 5IAAC 3NZ3A 1ET9A 4DXGA 1FCCC 3R7QA 3NVZA 2L32A 1MPEA 1GC7A 1YN5A 2W3SA 2QCZA 4A6QA 4HRSA 2M56B 3BK1A 3L17A 3PRPB 2A4ZA 4AJWA 3C19A 2NPTA 3CWIA 1S1QB 4NJ7A 2JQRB 3TUOA 5DPTA 3FKYA 4RH6A 4LNNA 4EZLA 2KVRA 3VH3B 2QIEB 3Q3NC 4FHJA 3BIID 1A70A 1EUVB 4MDKE 3J9CA 2WWZA 4RNAA 3VTWA 1L4DB 4WURA 4RF0A 1KH0A 2KYWA 2BT6A 1QOFA 3UIPB 2RPQA 2SEBD 1S3SG 3X0WA 2H88B 3T9LA 1XLPA 2FUG1 3U7ZA 3TEXA 4JWUC 2D11A 1JWSD 2NBVB 1T0RC 1AW7A 3N1YC 2PJHA 1YJIA 3DWMA 1QT9A 4L23A 4LNKA 3PRMB 4RCOA 5H8YE 2BVCA 2KQSA 4R3DA 3PZ7A 1RAXA 3ZNGC 2Z0EB 3M3JA 2N7EA 5AZGA 1MVKA 4IC7B 1PUTA 1UWMA 1D5ZC 4RGNA 1C4PA 1EF5A 1Q1OA 1XLOA 3ZRCA 4GIVA 5J2RA 2D3GA 1D4BA 4OVVA 5L95C 2WXJA 2ZW0A 1QOGA 4JIOU 1IBXA 5BYSA 4TQ1A 1FNVA 2LJ5A 3PVLA 3LYYA 1SGHA 4EE2A 2IZVB 3LDZE 4K7UA 1EWCA 1V5TA 4EOYA 1XCTL 1WX8A 3KVFB 3VUYA 1J7BA 4P16A 1P7FA 1YN3A 2KMCA 1NVID 2ACZB 1AWDA 1VCBA 2KC2A 4OVZA 2HE7A 3OLMD 3SFDB 1P3QU 2L83A 1A5RA 4FN2A 1F9JA 2L8JA 2LHDA 2ZZPB 4BBNF 1RLFA 2OEDA 4AJYB 3RD2A 1GOZA 2PLPA 3AE6B 2XN9C 2AYOB 3V62A 1K53A 3P4PB 2XBBC 2M4NA 4W9HA 4ITKA 4YTNB 2RDGA 3MJWA 4K81A 1VRAB 4GGQA 2D07B 2GOWA 2KLCA 1N5WA 1SE2A 3I57A 4ZRQA 3P2BA 2KTRA 2V3PA 1ZDXA 4N9F4 2I1KA 2JT4B 2J7QB 1I4RA 1OQQA 1JWUD 2GRIA 1JWAD 2ASQA 2KWDA 3AE9B 2MBBB 2EELA 3L16A 4LK0M 3KUCB 1HQRD 4PS3A 2IPKD 3LB8C 2JSVX 2KWCA 2N9LA 4LDTB 2JZZA 4LJPB 3Q3FA 3BVMA 2K9XA 3Q6BA 4DDID 1TY0A 1RWSA 4RGOS 4LNIA 4L2YA 2BTEA 2REXA 3NVYA 4BKSA 1WE6A 2LXCA 3VR8B 3DQVA 2LGSA 2LRWA 3P63A 3ECIA 2G4DB 4ANUA 5H92C 2WX1A 2VZKD 3I5JC 5JXVA 1WGGA 4ZYNA 3I63C 2N4FA 1XF5L 3DVNV 3AMZA 2ZCCA 2BW2A 1D5XC 3PREA 4XWTA 2VH1A 1BT0A 5D2MB 2O6VD 2QHOA 2IDYA 4HDQA 4KVGB 2E3TA 2NMQA 4KX6B 2QSDA 1WGYA 3I9V1 4LNFA 3NS8A 1WRIA 1C3TA 1GB1A 3DDCB 4IM2A 2WXFA 1HZ6A 2LI5A 1PGAA 3WA0A 2CU1A 3PRZA 4HCNB 2K8CA 1ISNA 4FXCA 4MH8A 2G4SA 3GS2A 2WXPA 3DVNU 2AQ1B 4JE3B 2NVUI 3BWUD 1VLBA 4MJSA 3N9YC 3ZJVA 1E10A 2KJHB 2RSUA 4GU2A 4MEMA 1L2NA 3W9CB 3UQBA 1WM3A 2DWQA 4GDLB 2KDBA 2N1WA 2N0SB 1P7EA 2KDIA 4PS8A 5AEKB 4W9KA 4CQNA 1WZ3A 2AX5A 4I6PA 2KN4A 2CHZA 5HHDG 2X8XX 1HXYD 1I4XA 1V2YA 1ZDVA 3PLUA 3U52E 1WM2A 5E6PA 1C4AA 4KV2A 4WQMA 3HM6X 2I38A 4WJOA 1GC6A 4N6EB 3ZYYX 3VAWA 1NYQA 4M0WB 4C4VB 2W3RA 2JRIB 1XD3B 1V5OA 3ZUNA 4PS7A 1NDDA 5EDSA 1C78A 1UD7A 1YX5B 2R61A 1I35A 2LVOA 1GPXA 2C7NB 3RULA 2HJ8A 3O13A 2BS4B 3IAM1 2IYDB 2FAZA 4ZRIA 1H4RA 4C80A 3QK0A 3GZNB 1IYFA 3ZNZB 2MEKA 3L10B 4UDUC 4DWFA 4O1NA 4TV3A 4BAXA 1K8RB 2DZMA 1M4VA 2CS4A 1TS2A 2KTFA 3H6NA 3AE3B 2Y3AA 2Z8LA 1FCLA 4RM8A 4MGIE 1UELA 5IOIA 4FJVB 4C4VA 2E6XA 5AZFA 1K51A 1WXMA 5D3IB 1FIQA 3Q8EA 1NYRA 3ZQ4A 2DZKA 2C7HA 1YJ1A 1JRPA 3TL5A 2KDFB 3AE8B 4HCPB 2GBJA 1WSPA 4ANXA 3AE5B 2V0GA 4YT0B 3KYCD 2IO0B 1YMHE 1JALA 2HDEA 2MJ3A 3EFCA 2WYQA 3NS1A 4HPPA 1L7YA 4GN1A 1J7AA 3DBHI 4PT5A 3R7RA 2H89B 4G0NB 5IKCM 1U4AA 5D94A 4EFOA 2C7MB 4ZDVA 2QILA 1P9DU 2FCNA 4US8A 3ML9A 4OW0A 4XDCA 1WJUA 4AS1A 1N6ZA 1YNTE 4I6NB 3DBRI 3ZDTA 1TBEA 3ZXVA 3QQ8B 4KZ0A 4HWIB 1E7UA 3AECB 4F7ZA 2D3BA 3QWZB 4MM3A 1WH3A 1BMLC 4K1RB 5LNK1 3VDZA 3A9KB 3U8ZA 2BKFA 2JWZA 3ABVB 4JGHB 2PE9A 3P4QB 1E8XA 4ZRJA 3N1XC 3RZFA 4II3B 3IT4B 1SEBD 5FR3A 3ZO5B 1MG4A 1I7HA 4GOCA 2K8HA 4GSWA 3ZKJC 4JL9A 3KUZA 2GLSA 1QZEA 2WQYB 2LEKA 2UYZB 3Q8BA 1J19A 5E6OA 2M19A 2ZVNA 4XWWA 1E8WA 2RPVA 3HM3A 4HVBA 4HDOA 3KUDB 3FAHA 1FRRA 5EE1A 4A8XC 3CF6E 5HI1A 3ZGZA 3QJZA 4AOFA 1NEKB 1UBQA 2DZJA 3Q3MC 3MC0B 1IUEA 5BMGA 5LXIB 2DHZA 2NTTA 1JRUA 3CIRB 1R4MB 3IFWB 3B9JA 3RZWC 3PHWB 2QDFA 4AWJA 3N3KB 1M94A 5BYQA 2KFKB 1TKGA 4IWPA 3DBSA 3UQAA 1WYWB 2DZIA 1DOIA 4GMVA 2JUOA 1G6JA 2FCSA 2IGGA 2DBYA 1TTNA 3UGBB 3FILB 5IA7A 4ARCA 1F52A 5JH5C 2PW9A 2KOXA 5CHWA 1WIAA 3Q8CA 4NAWA 1WWTA 5C3JB 3ZIMA 4F1SA 5LXHA 2ZW1A 4I6LB 1T5XD 4JWSC 4HKQA 4DQOC 3NVVA 1TS3A 4WWMA 2AEHA 4WWPA 3ZNID 3Q69A 4A20A 3QA8A 2L76A 1Q10A 4MH0E 3UINB 1YQ3B 3H9DA 4WWOA 3RNFC 4BKSD 4YWGG 1TT5B 3W1YA 3BINA 3GP7A 3M63B 2MBOA 2ZCBA 3L4PA 4NZLB 4ANVA 2LVPA 2KO3A 1KM7A 4K3CA 4DBGA 2LGDA 3O65B 1OEYJ 3MP9A 3AE7B 4G50A 1C4CA 4BBNC 2DX5B 2ICIA 4ZRKA 3NJTA 2BYFA 2EKIA 1CJEA 2IBIB 4WAFA 3GOEA 4GXBA 4EEWA 4G3XB 3EGRA 4ACFA 2JYTA 4NNJB 4XX5A 3H1UA 1E5WA 3AXCA 1PDXA
chains in the Genus database with same CATH topology
3QHTA 2ASQA 3AU5A 4MGKE 3VQIA 2NCNA 4RM9A 3VTUA 2RGFA 2MBBB 4HJKA 3HHMA 3L16A 4K7SA 2MLBA 3KUCB 5CHVC 2L05A 3V6CB 4PS3A 3EFUA 4XC2A 5FR6A 1V6EA 2JF5A 2KANA 2KWCA 4WWNA 4HK2A 4LDTB 2GBMA 2K25A 2BWES 2JZZA 4NPNA 4DXAB 1I35A 1UZXB 2KLGA 4LJPB 4ASWC 3Q3FA 3WALA 2PPHA 4DDID 2MBEA 2AL3A 2LD9A 4BKGA 3KYDD 3WIMA 1CMXB 2REXA 4YL8A 4W9JA 4W9GA 4BKSA 2BGFA 1WE6A 4W9DA 3VFKA 2LXCA 4WJQA 3DQVA 1LFDA 3JSVB 1A5RA 2LRWA 1OTRB 2JY6A 3B1LX 3CMMB 3ECIA 4MSQB 5CTRC 2G4DB 1WR1A 2IO3B 3DVGX 4ANUA 2WX1A 4K7WA 3SD5A 3A9JA 3CSFA 4NAWB 1I42A 3JW0X 4DHZE 2O6VA 1WGGA 1SIFA 1GG3A 5L83A 2G3QB 4ZYNA 1Z5SB 2Z59B 2N4FA 3DVNV 2ZCCA 4DK5A 3EC8A 3WAMA 3PREA 2FIDA 4W9CA 1BT0A 5D2MB 3TCAA 4W9EA 4ANWA 2O6VD 2UWQA 2QHOA 4HDQA 4KVGB 2KKCA 3VUXA 4W9IA 1E7VA 1VD2A 2DAJA 1WMHB 1Q0WB 1IPGA 2KJRA 2MRPA 3KW5B 2LGXA 1WGYA 2BKRB 2CHXA 4MGYE 3U7DA 3NS8A 3N32A 1WZ0A 1V80A 3K9OB 2DYBA 2GBKA 3DDCB 4IM2A 2MCNB 1C3TA 2KN5A 1V81A 4FA6A 4HLEA 3WAOA 4FULA 1WJ6A 3VTVA 2M0XA 2LASA 1UH6A 3APDA 5DPRA 3RCZA 2LI5A 2KJ6A 2FIFA 3T8MA 3ZDMC 2LXAA 3OAWA 3WA0A 2CU1A 2JVCA 3PRZA 3X23A 2L7RA 4HCNB 4RMAA 2K8CA 1ISNA 2KX3A 2KC1A 3L08A 3QC8B 4IWQA 1WGHA 2G4SA 1E8ZA 3I3TB 3JVZX 3DVNU 1Y8RC 3SU8X 2PE6B 4E71A 2NVUI 1ZGUB 3A1QA 2Z0DB 2N7DA 4MJSA 3AI5A 2KWUB 2ZJDA 3NOBA 2KWVB 2KJHB 2RSUA 2L0TA 3A9JB 3A4RA 3PV1A 4GU2A 4MEMA 1L2NA 3DCGA 5C1ZA 3UQBA 1WM3A 4X57B 3L54A 4GDLB 4DHJB 2N1WA 2MBHA 1WI0A 2KDBA 2L0FA 3BY4B 4M8NA 2J0KA 1IP9A 2KDIA 2DYMA 1GJZA 4KZCA 4PS8A 2NR2A 3NZUA 1WXAA 2C9WB 4XZ4A 5AEKB 4W9KA 3PHXB 2KD0A 4FHKA 2GMIC 3M95A 3TIXA 4MELA 2O2VA 1WZ3A 2NBUA 1SE9A 1WR6E 4KIKB 2G45B 4I6PA 2CHZA 2LRUA 3H7SA 4FLHA 4WJPA 1ZW7A 1R4MI 4KIKA 1V2YA 2D10A 3PLUA 3PT2B 1WM2A 1AARA 5E6PA 2DENB 4G11A 3OJ3A 4KV2A 3DBLI 1NI2A 3HM6X 2LVQA 5JZEB 4WJOA 3WANA 2N9PC 3RT3B 3ZNHB 1GC6A 2ZPNA 4BOSC 2OJRA 5G2NA 1WE7A 1GNUA 4AP4C 3VAWA 2CKHB 2EMSA 1XT9B 1X1MA 4M0WB 1E8YA 4CHKA 3PLVA 2JRIB 3IBEA 1LQBA 4NJ6A 3S2AA 3KH0A 1KOTA 2NBWB 3HK0A 1XD3B 3TJPA 4B6WA 3B0AA 4KSLC 2FCQA 1V5OA 3ZUNA 4PS7A 1NDDA 3H7PB 4E74A 1OGWA 5EDSA 2KHWB 1P0RA 1UD7A 1YX5B 2M17A 3R66C 4FBJB 2LVOA 4EZKA 2C7NB 1WY8A 2MQJA 4HPLB 3RULA 3VVWB 2HJ8A 1YD8U 4IWOA 2W9NA 2RD0A 4A3OA 2IYDB 2FAZA 3V60A 1WJ4A 5D6JB 4ZRIA 3PPAA 1H4RA 2NPTB 3L13A 1J0GA 3QK0A 2MA9B 3NHEB 1NBFC 2BWFA 2M1MA 4IUMB 1IYFA 3A9KA 1OEYA 3PTFC 3ZNZB 3ZTDA 4ICUA 4ICVA 3U30A 3L10B 2MP2B 4DWFA 2KX0A 5KHQA 3ZW3A 2CHWA 4TV3A 1K8RB 1MG8A 4II2B 2DZMA 3D32A 1HE8A 2EKEC 2JPHA 2CS4A 1FXTB 1Q5WB 2EMTA 4NY0A 3M62B 2KTFA 3H6NA 2LUEA 2K6DB 4WJNA 3HIZA 2R2OA 1WF9A 3A1QB 5GMVA 4RM8A 4MGIE 1UELA 2A5UA 2V3SA 4FJVB 4GDLA 2O6VB 1YX6B 1E90A 1WX7A 2FUHB 1KLVA 4DHZB 5AZFA 1Z2MA 1WXMA 4IG7B 3OJ4B 3VUWA 3VH4B 2I1JA 4MGZE 2DZKA 3V61A 3APFA 2C7HA 1YJ1A 4FADA 1PQSA 3TL5A 2K8BA 1J8CA 2KDFB 4FJZA 5BO4B 3VXWA 5J17A 1YQBA 3ENEA 4HCPB 1ZKHA 2GBJA 4MJSB 4PYZA 4ANXA 4NQKE 2BYVE 3L0WB 3ZRFA 2JZ3B 3KYCD 4E3CA 3RUIB 2IO0B 2FCMA 3DPDA 4HPMB 4EUTA 3DOWA 1P1AA 2WYQA 2D2QA 3SDLC 2OOBB 2L00B 5AZHA 2C5LC 3QAQA 4F8CB 3DVGY 2J0MA 1L7YA 5LLIA 3ZLZA 4GN1A 3QARA 2WX0A 3DBHI 1WGRA 3CSTA 3MTNB 4GB9A 4IW0A 4J6IA 4TUUA 3QCAA 1D3ZA 3R7RA 3QIJA 4G0NB 5JHAA 4B95A 1V49A 2DAFA 3NZSA 4DDGD 1UGMA 1U4AA 5D94A 5E6NA 4EFOA 2XEWA 2C7MB 4ZDVA 1EF1A 1LXDA 2KQ7A 4URKA 1P9DU 2FCNA 3ML9A 4CYEA 5J18A 5IAAC 4DHJD 4TQ0A 2HTHA 1WJUA 4I6NB 3K9PB 3DBRI 3ZDTA 3C0RB 3QX1A 3ZTCA 1TBEA 3R7QA 3QQ8B 5D7GA 4KZ0A 3ONSA 4HWIB 1GC7A 1E7UA 3AU4A 3L17A 2XK5A 3PRPB 2LGYA 2IY1B 4F7ZA 3WAPA 3QWZB 4MM3A 3B08A 1WH3A 2ZVOA 2KNBA 2A4ZA 4K1RB 2MP2A 4AJWA 1C1YB 2KZRA 2NPTA 1S1QB 4NJ7A 3VDZA 3A9KB 5DPTA 3U8ZA 1WXVA 2BKFA 2JWZA 4KDLB 4EZLA 2KVRA 4JGHB 2PE9A 3VH3B 3IVFA 1E8XA 4ZRJA 5DPSA 2MW5A 3APCA 2KK8A 1T0YA 4FHJA 1H8CA 1WMHA 3VHTC 1EUVB 4MDKE 5JHBA 3RZFA 4II3B 2WWZA 3A4SC 1R4NI 2O2VB 2ZNVB 3VTWA 3H7PA 2R2QA 3A33B 3ZO5B 2KFJA 2BYEA 4BKTA 3UIPB 2RPQA 4GOCA 4M8MA 3PS6A 2FNJB 2K8HA 4GSWA 3N30A 1S3SG 3X0WA 3ZKJC 2V4LA 3T9LA 5HKHA 4JL9A 4JLCA 3KUZA 2D11A 1QZEA 2KXJA 2NBVB 2UYZB 4IM3A 2CR5A 2PJHA 1J19A 3JSVA 2KTRB 5TR5A 2IO1B 3SHQA 5E6OA 1EO6A 3LJ3A 3PGEA 2ZVNA 4BOZB 2YVCA 3AULA 3PRMB 2MWSB 2BPSA 4BVUC 1E8WA 2JRHA 3HM3A 4HVBA 2KQSA 4HDOA 4BFRA 3KUDB 4MSMB 2LWPA 2K6QA 2AWTA 3CF6E 1WJNA 4P7IA 3QJZA 4GDKB 4OVUA 1OQYA 4AOFA 3TMPB 1RAXA 2GBNA 3ZNGC 1UBQA 2Z0EB 1GUAB 2N7EA 1KJTA 2DZJA 3M3JA 3Q3JA 4IC7B 5AZGA 5LXIB 3W1SA 2DHZA 1JRUA 2RR9A 1EF5A 1Q1OA 3IFWB 2NS5A 3RZWC 3ZRCA 4GIVA 5J2RA 2D3GA 3UF8A 2HD5B 4OVVA 3PHWB 3PZDA 5L95C 4AWJA 3N3KB 3PSEB 1M94A 4GDKA 4NQLB 5C23A 3GZNI 2PEAA 2M8SA 3V6EB 2KFKB 2XK5B 4IWPA 3NY5A 3DBSA 4JIOU 3UIOB 4TQ1A 2LJ5A 2KDEB 3R3MA 1WYWB 3PVLA 4TKNA 4KSKC 4W9FA 3UQAA 1SGHA 4B9KA 2DZIA 2IZVB 3RYTA 3IHPC 4GMVA 5KHOA 2ZNVC 2JUOA 1G6JA 3LDZE 2FCSA 4K7UA 2KFKA 3W1SC 1V5TA 1TTNA 4EOYA 2MX2A 3UGBB 1WX8A 1WRDB 5IA7A 3KVFB 3VUYA 3MHSD 2VRRB 5JH5C 1V9JA 2KOXA 5CHWA 1WIAA 4NAWA 3ZIMA 4F1SA 2J0JA 2KMCA 4FJYA 2WDTB 3TBLD 4CO7A 5LXHA 1WGDA 4I6LB 1VCBA 2KC2A 2V1YA 5CX3A 1TZ1A 2HE7A 2K1FA 3EHVA 3JYUA 3OLMD 2L3ZA 2AEHA 4LCDE 1WFYA 2Y5BB 4WWPA 3ZNID 5DPWA 2IY0B 2N1VA 4A20A 1P3QU 3EECA 2GBRA 2KMAA 2L76A 3IG3A 3QA8A 1F9JA 2N9XA 4FN2A 4MH0E 2L8JA 2DYOA 2N9EB 3UINB 3H9DA 4WWOA 2MBQA 1V86A 4BKSD 3ML8A 2K39A 3W1YA 3BINA 2ZZPB 4BBNF 1TGZB 2B3AA 1RLFA 4KDIC 5CHFA 1LM8B 3M63B 4AJYB 2MBOA 2ZCBA 3RD2A 2ZPYA 4WQOB 4WAAA 4HXDA 4IM0A 2ZEQA 4ANVA 2LVPA 2KO3A 4EZJA 1KM7A 2AYOB 2LZ6A 3V62A 4DBGA 1WX9A 4A3PA 2LGDA 2XBBC 3O65B 1WXSA 2M4NA 1OEYJ 1P98A 4W9HA 4W9LA 4G50A 4EKUA 2IO2B 2DX5B 4BBNC 3MJWA 4K81A 4JQWC 4LDTD 4ZRKA 1YIWA 2YLMA 2BF8B 4AUQC 2AL6A 1XQQA 2BYFA 2C60A 2D07B 2MSED 1RFAA 2IBIB 4GGQA 3GOEA 5DCNA 2GOWA 2KLCA 4GXBA 4PYUA 4G3XB 4EEWA 3P2BA 4NNJB 2KTRA 4XX5A 5G55A 3H1UA 2JXXA 3ZVVA 1E5WA 1UBIA 3AXCA 2I1KA 2JT4B 4N9F4 1RRBA 2J7QB 3ALBA 4LJOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHT A;  2ASQ A;  3AU5 A;  4MGK E;  3VQI A;  2NCN A;  4RM9 A;  3VTU A;  2RGF A;  2MBB B;  4HJK A;  3HHM A;  3L16 A;  4K7S A;  2MLB A;  3KUC B;  5CHV C;  2L05 A;  3V6C B;  4PS3 A;  3EFU A;  4XC2 A;  5FR6 A;  1V6E A;  2JF5 A;  2KAN A;  2KWC A;  4WWN A;  4HK2 A;  4LDT B;  2GBM A;  2K25 A;  2BWE S;  2JZZ A;  4NPN A;  4DXA B;  1I35 A;  1UZX B;  2KLG A;  4LJP B;  4ASW C;  3Q3F A;  3WAL A;  2PPH A;  4DDI D;  2MBE A;  2AL3 A;  2LD9 A;  4BKG A;  3KYD D;  3WIM A;  1CMX B;  2REX A;  4YL8 A;  4W9J A;  4W9G A;  4BKS A;  2BGF A;  1WE6 A;  4W9D A;  3VFK A;  2LXC A;  4WJQ A;  3DQV A;  1LFD A;  3JSV B;  1A5R A;  2LRW A;  1OTR B;  2JY6 A;  3B1L X;  3CMM B;  3ECI A;  4MSQ B;  5CTR C;  2G4D B;  1WR1 A;  2IO3 B;  3DVG X;  4ANU A;  2WX1 A;  4K7W A;  3SD5 A;  3A9J A;  3CSF A;  4NAW B;  1I42 A;  3JW0 X;  4DHZ E;  2O6V A;  1WGG A;  1SIF A;  1GG3 A;  5L83 A;  2G3Q B;  4ZYN A;  1Z5S B;  2Z59 B;  2N4F A;  3DVN V;  2ZCC A;  4DK5 A;  3EC8 A;  3WAM A;  3PRE A;  2FID A;  4W9C A;  1BT0 A;  5D2M B;  3TCA A;  4W9E A;  4ANW A;  2O6V D;  2UWQ A;  2QHO A;  4HDQ A;  4KVG B;  2KKC A;  3VUX A;  4W9I A;  1E7V A;  1VD2 A;  2DAJ A;  1WMH B;  1Q0W B;  1IPG A;  2KJR A;  2MRP A;  3KW5 B;  2LGX A;  1WGY A;  2BKR B;  2CHX A;  4MGY E;  3U7D A;  3NS8 A;  3N32 A;  1WZ0 A;  1V80 A;  3K9O B;  2DYB A;  2GBK A;  3DDC B;  4IM2 A;  2MCN B;  1C3T A;  2KN5 A;  1V81 A;  4FA6 A;  4HLE A;  3WAO A;  4FUL A;  1WJ6 A;  3VTV A;  2M0X A;  2LAS A;  1UH6 A;  3APD A;  5DPR A;  3RCZ A;  2LI5 A;  2KJ6 A;  2FIF A;  3T8M A;  3ZDM C;  2LXA A;  3OAW A;  3WA0 A;  2CU1 A;  2JVC A;  3PRZ A;  3X23 A;  2L7R A;  4HCN B;  4RMA A;  2K8C A;  1ISN A;  2KX3 A;  2KC1 A;  3L08 A;  3QC8 B;  4IWQ A;  1WGH A;  2G4S A;  1E8Z A;  3I3T B;  3JVZ X;  3DVN U;  1Y8R C;  3SU8 X;  2PE6 B;  4E71 A;  2NVU I;  1ZGU B;  3A1Q A;  2Z0D B;  2N7D A;  4MJS A;  3AI5 A;  2KWU B;  2ZJD A;  3NOB A;  2KWV B;  2KJH B;  2RSU A;  2L0T A;  3A9J B;  3A4R A;  3PV1 A;  4GU2 A;  4MEM A;  1L2N A;  3DCG A;  5C1Z A;  3UQB A;  1WM3 A;  4X57 B;  3L54 A;  4GDL B;  4DHJ B;  2N1W A;  2MBH A;  1WI0 A;  2KDB A;  2L0F A;  3BY4 B;  4M8N A;  2J0K A;  1IP9 A;  2KDI A;  2DYM A;  1GJZ A;  4KZC A;  4PS8 A;  2NR2 A;  3NZU A;  1WXA A;  2C9W B;  4XZ4 A;  5AEK B;  4W9K A;  3PHX B;  2KD0 A;  4FHK A;  2GMI C;  3M95 A;  3TIX A;  4MEL A;  2O2V A;  1WZ3 A;  2NBU A;  1SE9 A;  1WR6 E;  4KIK B;  2G45 B;  4I6P A;  2CHZ A;  2LRU A;  3H7S A;  4FLH A;  4WJP A;  1ZW7 A;  1R4M I;  4KIK A;  1V2Y A;  2D10 A;  3PLU A;  3PT2 B;  1WM2 A;  1AAR A;  5E6P A;  2DEN B;  4G11 A;  3OJ3 A;  4KV2 A;  3DBL I;  1NI2 A;  3HM6 X;  2LVQ A;  5JZE B;  4WJO A;  3WAN A;  2N9P C;  3RT3 B;  3ZNH B;  1GC6 A;  2ZPN A;  4BOS C;  2OJR A;  5G2N A;  1WE7 A;  1GNU A;  4AP4 C;  3VAW A;  2CKH B;  2EMS A;  1XT9 B;  1X1M A;  4M0W B;  1E8Y A;  4CHK A;  3PLV A;  2JRI B;  3IBE A;  1LQB A;  4NJ6 A;  3S2A A;  3KH0 A;  1KOT A;  2NBW B;  3HK0 A;  1XD3 B;  3TJP A;  4B6W A;  3B0A A;  4KSL C;  2FCQ A;  1V5O A;  3ZUN A;  4PS7 A;  1NDD A;  3H7P B;  4E74 A;  1OGW A;  5EDS A;  2KHW B;  1P0R A;  1UD7 A;  1YX5 B;  2M17 A;  3R66 C;  4FBJ B;  2LVO A;  4EZK A;  2C7N B;  1WY8 A;  2MQJ A;  4HPL B;  3RUL A;  3VVW B;  2HJ8 A;  1YD8 U;  4IWO A;  2W9N A;  2RD0 A;  4A3O A;  2IYD B;  2FAZ A;  3V60 A;  1WJ4 A;  5D6J B;  4ZRI A;  3PPA A;  1H4R A;  2NPT B;  3L13 A;  1J0G A;  3QK0 A;  2MA9 B;  3NHE B;  1NBF C;  2BWF A;  2M1M A;  4IUM B;  1IYF A;  3A9K A;  1OEY A;  3PTF C;  3ZNZ B;  3ZTD A;  4ICU A;  4ICV A;  3U30 A;  3L10 B;  2MP2 B;  4DWF A;  2KX0 A;  5KHQ A;  3ZW3 A;  2CHW A;  4TV3 A;  1K8R B;  1MG8 A;  4II2 B;  2DZM A;  3D32 A;  1HE8 A;  2EKE C;  2JPH A;  2CS4 A;  1FXT B;  1Q5W B;  2EMT A;  4NY0 A;  3M62 B;  2KTF A;  3H6N A;  2LUE A;  2K6D B;  4WJN A;  3HIZ A;  2R2O A;  1WF9 A;  3A1Q B;  5GMV A;  4RM8 A;  4MGI E;  1UEL A;  2A5U A;  2V3S A;  4FJV B;  4GDL A;  2O6V B;  1YX6 B;  1E90 A;  1WX7 A;  2FUH B;  1KLV A;  4DHZ B;  5AZF A;  1Z2M A;  1WXM A;  4IG7 B;  3OJ4 B;  3VUW A;  3VH4 B;  2I1J A;  4MGZ E;  2DZK A;  3V61 A;  3APF A;  2C7H A;  1YJ1 A;  4FAD A;  1PQS A;  3TL5 A;  2K8B A;  1J8C A;  2KDF B;  4FJZ A;  5BO4 B;  3VXW A;  5J17 A;  1YQB A;  3ENE A;  4HCP B;  1ZKH A;  2GBJ A;  4MJS B;  4PYZ A;  4ANX A;  4NQK E;  2BYV E;  3L0W B;  3ZRF A;  2JZ3 B;  3KYC D;  4E3C A;  3RUI B;  2IO0 B;  2FCM A;  3DPD A;  4HPM B;  4EUT A;  3DOW A;  1P1A A;  2WYQ A;  2D2Q A;  3SDL C;  2OOB B;  2L00 B;  5AZH A;  2C5L C;  3QAQ A;  4F8C B;  3DVG Y;  2J0M A;  1L7Y A;  5LLI A;  3ZLZ A;  4GN1 A;  3QAR A;  2WX0 A;  3DBH I;  1WGR A;  3CST A;  3MTN B;  4GB9 A;  4IW0 A;  4J6I A;  4TUU A;  3QCA A;  1D3Z A;  3R7R A;  3QIJ A;  4G0N B;  5JHA A;  4B95 A;  1V49 A;  2DAF A;  3NZS A;  4DDG D;  1UGM A;  1U4A A;  5D94 A;  5E6N A;  4EFO A;  2XEW A;  2C7M B;  4ZDV A;  1EF1 A;  1LXD A;  2KQ7 A;  4URK A;  1P9D U;  2FCN A;  3ML9 A;  4CYE A;  5J18 A;  5IAA C;  4DHJ D;  4TQ0 A;  2HTH A;  1WJU A;  4I6N B;  3K9P B;  3DBR I;  3ZDT A;  3C0R B;  3QX1 A;  3ZTC A;  1TBE A;  3R7Q A;  3QQ8 B;  5D7G A;  4KZ0 A;  3ONS A;  4HWI B;  1GC7 A;  1E7U A;  3AU4 A;  3L17 A;  2XK5 A;  3PRP B;  2LGY A;  2IY1 B;  4F7Z A;  3WAP A;  3QWZ B;  4MM3 A;  3B08 A;  1WH3 A;  2ZVO A;  2KNB A;  2A4Z A;  4K1R B;  2MP2 A;  4AJW A;  1C1Y B;  2KZR A;  2NPT A;  1S1Q B;  4NJ7 A;  3VDZ A;  3A9K B;  5DPT A;  3U8Z A;  1WXV A;  2BKF A;  2JWZ A;  4KDL B;  4EZL A;  2KVR A;  4JGH B;  2PE9 A;  3VH3 B;  3IVF A;  1E8X A;  4ZRJ A;  5DPS A;  2MW5 A;  3APC A;  2KK8 A;  1T0Y A;  4FHJ A;  1H8C A;  1WMH A;  3VHT C;  1EUV B;  4MDK E;  5JHB A;  3RZF A;  4II3 B;  2WWZ A;  3A4S C;  1R4N I;  2O2V B;  2ZNV B;  3VTW A;  3H7P A;  2R2Q A;  3A33 B;  3ZO5 B;  2KFJ A;  2BYE A;  4BKT A;  3UIP B;  2RPQ A;  4GOC A;  4M8M A;  3PS6 A;  2FNJ B;  2K8H A;  4GSW A;  3N30 A;  1S3S G;  3X0W A;  3ZKJ C;  2V4L A;  3T9L A;  5HKH A;  4JL9 A;  4JLC A;  3KUZ A;  2D11 A;  1QZE A;  2KXJ A;  2NBV B;  2UYZ B;  4IM3 A;  2CR5 A;  2PJH A;  1J19 A;  3JSV A;  2KTR B;  5TR5 A;  2IO1 B;  3SHQ A;  5E6O A;  1EO6 A;  3LJ3 A;  3PGE A;  2ZVN A;  4BOZ B;  2YVC A;  3AUL A;  3PRM B;  2MWS B;  2BPS A;  4BVU C;  1E8W A;  2JRH A;  3HM3 A;  4HVB A;  2KQS A;  4HDO A;  4BFR A;  3KUD B;  4MSM B;  2LWP A;  2K6Q A;  2AWT A;  3CF6 E;  1WJN A;  4P7I A;  3QJZ A;  4GDK B;  4OVU A;  1OQY A;  4AOF A;  3TMP B;  1RAX A;  2GBN A;  3ZNG C;  1UBQ A;  2Z0E B;  1GUA B;  2N7E A;  1KJT A;  2DZJ A;  3M3J A;  3Q3J A;  4IC7 B;  5AZG A;  5LXI B;  3W1S A;  2DHZ A;  1JRU A;  2RR9 A;  1EF5 A;  1Q1O A;  3IFW B;  2NS5 A;  3RZW C;  3ZRC A;  4GIV A;  5J2R A;  2D3G A;  3UF8 A;  2HD5 B;  4OVV A;  3PHW B;  3PZD A;  5L95 C;  4AWJ A;  3N3K B;  3PSE B;  1M94 A;  4GDK A;  4NQL B;  5C23 A;  3GZN I;  2PEA A;  2M8S A;  3V6E B;  2KFK B;  2XK5 B;  4IWP A;  3NY5 A;  3DBS A;  4JIO U;  3UIO B;  4TQ1 A;  2LJ5 A;  2KDE B;  3R3M A;  1WYW B;  3PVL A;  4TKN A;  4KSK C;  4W9F A;  3UQA A;  1SGH A;  4B9K A;  2DZI A;  2IZV B;  3RYT A;  3IHP C;  4GMV A;  5KHO A;  2ZNV C;  2JUO A;  1G6J A;  3LDZ E;  2FCS A;  4K7U A;  2KFK A;  3W1S C;  1V5T A;  1TTN A;  4EOY A;  2MX2 A;  3UGB B;  1WX8 A;  1WRD B;  5IA7 A;  3KVF B;  3VUY A;  3MHS D;  2VRR B;  5JH5 C;  1V9J A;  2KOX A;  5CHW A;  1WIA A;  4NAW A;  3ZIM A;  4F1S A;  2J0J A;  2KMC A;  4FJY A;  2WDT B;  3TBL D;  4CO7 A;  5LXH A;  1WGD A;  4I6L B;  1VCB A;  2KC2 A;  2V1Y A;  5CX3 A;  1TZ1 A;  2HE7 A;  2K1F A;  3EHV A;  3JYU A;  3OLM D;  2L3Z A;  2AEH A;  4LCD E;  1WFY A;  2Y5B B;  4WWP A;  3ZNI D;  5DPW A;  2IY0 B;  2N1V A;  4A20 A;  1P3Q U;  3EEC A;  2GBR A;  2KMA A;  2L76 A;  3IG3 A;  3QA8 A;  1F9J A;  2N9X A;  4FN2 A;  4MH0 E;  2L8J A;  2DYO A;  2N9E B;  3UIN B;  3H9D A;  4WWO A;  2MBQ A;  1V86 A;  4BKS D;  3ML8 A;  2K39 A;  3W1Y A;  3BIN A;  2ZZP B;  4BBN F;  1TGZ B;  2B3A A;  1RLF A;  4KDI C;  5CHF A;  1LM8 B;  3M63 B;  4AJY B;  2MBO A;  2ZCB A;  3RD2 A;  2ZPY A;  4WQO B;  4WAA A;  4HXD A;  4IM0 A;  2ZEQ A;  4ANV A;  2LVP A;  2KO3 A;  4EZJ A;  1KM7 A;  2AYO B;  2LZ6 A;  3V62 A;  4DBG A;  1WX9 A;  4A3P A;  2LGD A;  2XBB C;  3O65 B;  1WXS A;  2M4N A;  1OEY J;  1P98 A;  4W9H A;  4W9L A;  4G50 A;  4EKU A;  2IO2 B;  2DX5 B;  4BBN C;  3MJW A;  4K81 A;  4JQW C;  4LDT D;  4ZRK A;  1YIW A;  2YLM A;  2BF8 B;  4AUQ C;  2AL6 A;  1XQQ A;  2BYF A;  2C60 A;  2D07 B;  2MSE D;  1RFA A;  2IBI B;  4GGQ A;  3GOE A;  5DCN A;  2GOW A;  2KLC A;  4GXB A;  4PYU A;  4G3X B;  4EEW A;  3P2B A;  4NNJ B;  2KTR A;  4XX5 A;  5G55 A;  3H1U A;  2JXX A;  3ZVV A;  1E5W A;  1UBI A;  3AXC A;  2I1K A;  2JT4 B;  4N9F 4;  1RRB A;  2J7Q B;  3ALB A;  4LJO B; 
#chains in the Genus database with same CATH topology
 1F2R I;  3QHT A;  2ONQ A;  1TKE A;  3AE4 B;  2NCN A;  3B2G A;  3DBH B;  3EFU A;  4HK2 A;  4IDI A;  2GBM A;  2K25 A;  3WAL A;  1FNW A;  2LD9 A;  4BKG A;  3KYD D;  3WIM A;  3Q14 C;  1WGK A;  1CMX B;  3RNB C;  4W9D A;  1CK1 A;  1HEZ E;  3CMM B;  4MSQ B;  1WR1 A;  3SD5 A;  4NAW B;  1I42 A;  2WHI A;  2Z59 B;  4W9C A;  2LJI A;  3KWV A;  2OHF A;  4W9E A;  4ANW A;  1XEE A;  5HG2 A;  2Q5W D;  1QOB A;  2KJR A;  1MHX A;  2MRP A;  2LGX A;  1KLU D;  2PVG C;  1TIF A;  1WZ0 A;  3K9O B;  1V1P B;  2MCN B;  4S17 A;  3SR6 A;  4FUL A;  1WJ6 A;  2LAS A;  3AEF B;  4MAC A;  5DPR A;  4C00 A;  2KJ6 A;  2FIF A;  1DOY A;  4ARI A;  3X23 A;  4RMA A;  1ROE A;  2WDQ B;  4E71 A;  1ET6 A;  4Q2J A;  1ZGU B;  1QQR A;  3A1Q A;  1MI0 A;  2N7D A;  3AI5 A;  1VR9 A;  2LMC A;  2UU7 A;  3NOB A;  4L1B A;  1SJE D;  1R7S A;  2WU5 B;  3DCG A;  5C1Z A;  4X57 B;  4DHJ B;  2MBH A;  4M8N A;  2J0K A;  2WNM A;  1D5M C;  1XCQ L;  2Y5C A;  3NZU A;  4XZ4 A;  3PHX B;  4A55 A;  2GMI C;  4MEL A;  4KIK B;  2VZK B;  1C76 A;  2LRU A;  4FLH A;  1R4M I;  3IAS 1;  3MC8 A;  2JWU A;  1NI2 A;  4ZHP A;  2LVQ A;  3WAN A;  2V3N A;  2RDB C;  1XXG A;  1GNU A;  3RNG C;  2CKH B;  2EMS A;  1XT9 B;  2TSS A;  1RYJ A;  1E8Y A;  4CHK A;  3PLV A;  1KTK A;  1FEH A;  1FFU A;  4NJ6 A;  3S2A A;  3KH0 A;  1KOT A;  3TJP A;  4B6W A;  3B0A A;  3EA6 A;  2KHW B;  4M00 A;  4M0W A;  3R66 C;  4FBJ B;  4EZK A;  3VVW B;  2MH7 A;  4HPL B;  2W9N A;  4A3O A;  1QF6 A;  3V60 A;  1WJ4 A;  1DOX A;  2JU6 X;  3L13 A;  4IOI E;  2PTL A;  2BWF A;  1IGD A;  2HJ1 A;  1UUP A;  2D5G A;  1OEY A;  3PTF C;  4B0M A;  4K3B A;  2KX0 A;  1MG8 A;  3D32 A;  2SAK A;  2EMT A;  3M62 B;  1C77 A;  2LUE A;  2K6D B;  1GAQ B;  3HIZ A;  3NRZ A;  4A90 A;  1UWX A;  3AV8 A;  1N62 A;  4GDL A;  2O6V B;  1E90 A;  1L5P A;  2FUH B;  1TYG B;  1Z2M A;  3VUW A;  4MGZ E;  3APF A;  1J8C A;  4FAD A;  1PQS A;  1HA5 A;  4MJS B;  4HEA 1;  2BYV E;  3L0W B;  4HRO A;  2PMV A;  4E3C A;  2JXT A;  2FCM A;  3DPD A;  1XLN A;  4AQ7 A;  2KAJ A;  2OOB B;  1E0Z A;  5AZH A;  3DVG Y;  2I2Y A;  1WGR A;  2JZP A;  4JPS A;  3QIJ A;  2RMM A;  3NG0 A;  4B95 A;  1YJJ A;  5JHA A;  4DDG D;  1SB3 C;  2V9H A;  1F0Z A;  5AUI A;  3MC9 A;  4CYE A;  3AM9 A;  4XGA B;  2L1A A;  3K9P B;  1EWY C;  3C0R B;  3QX1 A;  1KF6 B;  3ZTC A;  1UNS A;  4C56 C;  2AQ2 B;  2XK5 A;  3AB5 A;  2LGY A;  2KNB A;  2MP2 A;  1C1Y B;  2KZR A;  4WH4 A;  2M0A A;  2WXN A;  2VH2 A;  4XDD A;  1ESF A;  1V1O A;  2WGS A;  1H8C A;  1WMH A;  2K22 A;  4P6V F;  4OZB A;  4USA A;  3H7P A;  2R2Q A;  2INC C;  3PZ8 A;  2KFJ A;  4M8M A;  3PS6 A;  1I4H A;  2V4L A;  3AEG B;  4MT5 A;  4JLC A;  2KXJ A;  2CR5 A;  2KTR B;  5TR5 A;  3SHQ A;  3PGE A;  1BXT A;  3BVZ A;  2YVC A;  1LGR A;  3PO0 A;  2MWS B;  4BVU C;  2JRH A;  3RNC C;  5TSS A;  2LWP A;  2WDR B;  2AWT A;  4NJC A;  1VJK A;  1JWM D;  1WJN A;  4P7I A;  4LLG M;  1V97 A;  2MJE A;  3MJ5 A;  4OVU A;  1OQY A;  5BMI A;  1QOA A;  1ZOY B;  3E56 A;  1ZXI A;  2G9H D;  1GUA B;  1KJT A;  3Q3J A;  2WLB A;  4YTP B;  2LFI A;  3N20 C;  1FO4 A;  2NS5 A;  3UF8 A;  3TEY A;  2MJD A;  3PSE B;  3Q8A A;  1ENF A;  1PFD A;  4GDK A;  4NQL B;  3GZN I;  5C23 A;  3RN9 C;  2KAC A;  2M8S A;  3NY5 A;  5FKA C;  4W9F A;  2KDE B;  4KSK C;  1ZUD 2;  3URY A;  4B9K A;  4YSX B;  3RYT A;  4M01 A;  3IHP C;  2WXO A;  1T0S C;  3W1S C;  2LGI A;  1V1P A;  4OZC A;  3MHS D;  2VRR B;  1V9J A;  1KFY B;  2J0J A;  1DGJ A;  2WDT B;  1WGD A;  3KWL A;  3VRA B;  2V1Y A;  1SF0 A;  3EHV A;  3JYU A;  4KKJ A;  4ZHO A;  5DPW A;  3H8H A;  2IY0 B;  2N1V A;  4P1C C;  5G5H A;  2J53 A;  2GBR A;  2KMA A;  2IGH A;  2N9E B;  1NEN B;  3ML8 A;  2K39 A;  1JCK B;  1TGZ B;  5GXG B;  2B3A A;  4KDI C;  1JWB D;  4NAM A;  1N60 A;  2ZPY A;  3W5U B;  4US9 A;  1E6E B;  2KVZ A;  4EZJ A;  4KGT A;  1WX9 A;  4A3P A;  4W9L A;  3ZJT A;  4EKU A;  4JQW C;  4LDT D;  1YIW A;  3ZXR A;  2BF8 B;  2AL6 A;  2C60 A;  2QC8 A;  1E9M A;  3RMK C;  4PYU A;  1RM6 C;  3DBR B;  5G55 A;  2JXX A;  1UBI A;  3B2F A;  4LJO B;  3AU5 A;  4MGK E;  1R4N B;  4KGS A;  3VTU A;  4RM9 A;  2RGF A;  4HJK A;  1B1Z A;  4YTM B;  3HHM A;  4K7S A;  5CHV C;  3V6C B;  2L05 A;  2KT7 A;  5E6J A;  4XC2 A;  3AE1 B;  5FR6 A;  1V6E A;  2KAN A;  4WWN A;  4NPN A;  2BWE S;  4DXA B;  1UZX B;  2KLG A;  2PIA A;  4ASW C;  3T3N A;  2MBE A;  2AL3 A;  4YL8 A;  3AN1 A;  4W9J A;  3RI7 C;  2Y5P A;  3VFK A;  2NTS A;  1JRO A;  1GB4 A;  1LFD A;  3JSV B;  3SFE B;  1OTR B;  2JY6 A;  5CTR C;  2IO3 B;  3DVG X;  3A9J A;  1L0Y B;  3JW0 X;  4DHZ E;  4GLS C;  2G3Q B;  2J52 A;  3BYT B;  3BK2 A;  4DK5 A;  3OG5 A;  3WAM A;  1EU4 A;  1L6U A;  4YSY B;  2UWQ A;  2J42 A;  2FBW B;  1Q0W B;  3KW5 B;  2BKR B;  2CHX A;  2K5P A;  3GB1 A;  1QKZ A;  3LXF A;  2DYB A;  2GBK A;  1T3Q A;  4HLE A;  3WAO A;  3VTV A;  3RCZ A;  2LXA A;  3OAW A;  4S0R A;  2JVC A;  2L7R A;  2BB6 A;  1VZ7 A;  2KX3 A;  3QC8 B;  2KC1 A;  2ON8 A;  4IWQ A;  1E8Z A;  4OZA A;  3OWE B;  1Y8R C;  1SE4 A;  2INP E;  2KWU B;  2ZJD A;  2QJL A;  2KWV B;  4ZYS A;  2FE8 A;  3A4R A;  4TMA B;  3L54 A;  3BY4 B;  1OQR A;  3E9S A;  4LTU A;  1GJZ A;  2DYM A;  2WXG A;  4KZC A;  1C79 A;  1WXA A;  1L4Z B;  2INN E;  1AYF A;  1VZ8 A;  2RDH A;  4FHK A;  2O2V A;  2NBU A;  2PVO D;  1SE9 A;  1WR6 E;  1F1H A;  2LHE A;  1HZ5 A;  3PT2 B;  1XLQ A;  1AAR A;  4G11 A;  4RFB A;  1TS5 A;  2KMM A;  5JZE B;  2N9P C;  4BOS C;  1J7C A;  2OJR A;  1X1M A;  1LQB A;  2NBW B;  3N1Z C;  4N59 A;  2FCQ A;  3H7P B;  1YN4 A;  1FNU A;  1WY8 A;  2MQJ A;  4YXD B;  5BMH A;  2RD0 A;  1PGX A;  1N5X A;  5D6J B;  1L0X B;  3FC4 A;  1J0G A;  2MA9 B;  3NHE B;  1VZ6 A;  4MM3 B;  2IGD A;  4ICU A;  4ICV A;  3U30 A;  2MP2 B;  3ZJU A;  2CHW A;  2JPH A;  4OHJ A;  1Y56 A;  2IJ0 A;  2R2O A;  1WF9 A;  3A1Q B;  3RPF C;  4JX1 C;  2CU3 A;  2GB1 A;  1SE3 A;  1L6V A;  1YX6 B;  2WXH A;  1I4P A;  1KLV A;  3OJ4 B;  3VH4 B;  1PYW D;  2I1J A;  3AH7 A;  3BVG A;  3V61 A;  2K8B A;  1FMA D;  2WS3 B;  4FJZ A;  5BO4 B;  1YQB A;  3ENE A;  4PYZ A;  4RF1 A;  1MFW A;  4NQK E;  3RFZ B;  3ZRF A;  4EUT A;  3DOW A;  1P1A A;  2D2Q A;  3SDL C;  2QEJ C;  1VDV A;  4F8C B;  2J0M A;  3ZLZ A;  1QLB B;  3QAR A;  2WX0 A;  3IXS A;  3V05 A;  3CST A;  4IW0 A;  4GB9 A;  3QCA A;  1D3Z A;  3FIL A;  1ZPS A;  1KLG D;  3R2T A;  1L0V B;  1UGM A;  2G1E A;  3MHZ A;  2V4I B;  4RGT A;  2XEW A;  1EF1 A;  1LXD A;  4URK A;  5G5G A;  4DHJ D;  4TQ0 A;  2HTH A;  2QMT A;  1MHH E;  5D7G A;  4H2A A;  3ONS A;  3V3X A;  3AU4 A;  1OFF A;  1NI3 A;  2D3C A;  2IY1 B;  4C7Z A;  3WAP A;  3B08 A;  2ZVO A;  2MHJ A;  1FPY A;  1BUI C;  1WXV A;  4REZ A;  4KDL B;  3U4E G;  3IVF A;  5DPS A;  2MW5 A;  3APC A;  3DBL B;  2KK8 A;  1T0Y A;  2KDM A;  3VHT C;  1FXA A;  5JHB A;  2DNF A;  3UI3 A;  3AEB B;  3A4S C;  1R4N I;  2O2V B;  2ZNV B;  3A33 B;  2W55 A;  2BYE A;  4BKT A;  1T0Q C;  1UF0 A;  2FNJ B;  3N30 A;  5HKH A;  4IM3 A;  3JSV A;  4HJG E;  3HVZ A;  2IO1 B;  3P4R B;  1TZO A;  5AUK A;  1SJH D;  1EO6 A;  3DWG C;  3LJ3 A;  4BOZ B;  1I4G A;  3AUL A;  2BPS A;  3EUB 2;  3Q2A C;  1I4Q A;  2XNA C;  4BFR A;  4MSM B;  2K6Q A;  4A9A A;  2WU2 B;  4GDK B;  3TMP B;  2YEP B;  1JML A;  2AQ3 B;  2BB5 A;  2GBN A;  2DLB A;  3WCQ A;  1LO5 D;  1STE A;  3P1M A;  3W1S A;  4J3O D;  2RR9 A;  1AN8 A;  4XYC A;  2X38 A;  3RNA C;  2HD5 B;  3PZD A;  2N7J A;  5BYR A;  2PEA A;  5D3D A;  3V6E B;  2K3U A;  2XK5 B;  3NUH B;  3TEZ A;  3HUI A;  2WXR A;  5C2T B;  3UIO B;  3R3M A;  4TKN A;  4RGM A;  1SBB B;  2K0P A;  5KHO A;  2ZNV C;  1TKY A;  2WXK A;  2KFK A;  1V8C A;  1C9F A;  3U2S C;  2MX2 A;  1WRD B;  4KKI A;  4FJY A;  3DHI C;  3TBL D;  4CO7 A;  2N9K A;  2BS2 B;  5CX3 A;  1TZ1 A;  2K1F A;  4ZOH C;  2L3Z A;  4LCD E;  1TS4 A;  1WFY A;  2Y5B B;  3HRD D;  2JX5 A;  3AEA B;  1T6B X;  3EEC A;  3IG3 A;  2N9X A;  2DYO A;  2MBQ A;  1V86 A;  3VR9 B;  5CHF A;  1CQV A;  1LM8 B;  4WQO B;  4WAA A;  4HXD A;  4IM0 A;  2ZEQ A;  1ZP0 B;  2LZ6 A;  2WXQ A;  1WXS A;  1P98 A;  2IO2 B;  4WIP A;  3Q8F A;  2YLM A;  4AUQ C;  1XQQ A;  1RFA A;  2MSE D;  5DCN A;  2W54 A;  1ACC A;  2LUM A;  3W2D A;  3AE2 B;  1SXT A;  3ZVV A;  3R2I A;  1RRB A;  3ALB A;  1TJE A;  4XE0 A;  4IKG A;  1PGB A;  3VQI A;  1FFV A;  1K50 A;  2MLB A;  1WXQ A;  3DHG C;  1F77 A;  3T3O A;  2JF5 A;  3BZD B;  2PPH A;  1JW9 D;  1RFK A;  4W9G A;  3DHH C;  2BGF A;  3HVD A;  2CJO A;  2OJW A;  4WJQ A;  3Q3O C;  4P1B C;  4HKZ E;  1ZXH A;  3B1L X;  3NVW A;  4K7W A;  2JYE A;  1N63 A;  3CSF A;  1FRD A;  2O6V A;  1SIF A;  1GG3 A;  5L83 A;  1JQ4 A;  1Z5S B;  2BYT A;  3C8Y A;  3EC8 A;  2FID A;  1K52 A;  3TCA A;  2KKC A;  3VUX A;  4W9I A;  1E7V A;  1VD2 A;  2DAJ A;  1WMH B;  1IPG A;  2YEP F;  4MGY E;  1SIJ A;  3U7D A;  3N32 A;  1V80 A;  2KQ4 X;  1N61 A;  2KN5 A;  3R8B A;  1V81 A;  2WDV B;  5FK9 C;  4FA6 A;  5IN7 A;  2M0X A;  1UH6 A;  3APD A;  3T8M A;  3ZDM C;  3P42 A;  2HTM E;  3L08 A;  1WGH A;  1IBX B;  4C7Y A;  3I3T B;  3JVZ X;  3SU8 X;  2PE6 B;  4LNO A;  2Z0D B;  3BYY B;  1KRH A;  1F2R C;  5IP4 D;  3A9J B;  1B9R A;  2L0T A;  3PV1 A;  4ZRP A;  1EU3 A;  4QAY A;  2WXL A;  5MPO A;  1FXI A;  1WI0 A;  2L0F A;  1IP9 A;  3TSS A;  2NR2 A;  1E7P B;  2C9W B;  5EE9 A;  2KD0 A;  3M95 A;  3TIX A;  2D3A A;  4M02 A;  2BQQ A;  2G45 B;  1DYQ A;  1YOV B;  3H7S A;  4WJP A;  1ZW7 A;  4KIK A;  5EE3 A;  2D10 A;  2DEN B;  3OJ3 A;  3DBL I;  4N58 A;  3GE3 C;  3P4S B;  3RT3 B;  3ZNH B;  2ZPN A;  1IGC A;  2B76 B;  5G2N A;  1WE7 A;  3KLS X;  4AP4 C;  5HFY A;  1FM0 D;  4TSS A;  2PKO A;  1FD6 A;  3IBE A;  4D2K A;  3HK0 A;  2WXI A;  4KSL C;  3IT6 B;  4E74 A;  1OGW A;  1HTO A;  1P0R A;  2M17 A;  2CJN A;  3KQ4 A;  4B0E A;  5T8I A;  3RNE C;  1YD8 U;  4IWO A;  5IO9 A;  2L52 A;  3ETR A;  3PPA A;  1EM7 A;  2NPT B;  1NBF C;  2M1M A;  4PK1 A;  4IUM B;  1WYG A;  3A9K A;  3ZTD A;  1CZP A;  2WXM A;  5KHQ A;  3ZW3 A;  1XO3 A;  4II2 B;  1HE8 A;  1QIL A;  2EKE C;  2W82 A;  1MJD A;  1FXT B;  1Q5W B;  4NY0 A;  1D6E C;  2BBC A;  4WJN A;  5GMV A;  2A5U A;  2V3S A;  4KGR A;  1WX7 A;  5I4D A;  4DHZ B;  2WP9 B;  3GE8 C;  4IG7 B;  2BS3 B;  4DXF A;  1TY2 A;  2IND C;  5J17 A;  2J4X A;  3VXW A;  1ZKH A;  4YSZ B;  1SSN A;  1HTQ A;  3TEW A;  2JZ3 B;  1UGJ A;  4HPM B;  3RUI B;  2L00 B;  2GI9 A;  2C5L C;  3QAQ A;  5LLI A;  3AEE B;  3VRB B;  3MFG A;  4BZA A;  3SEB A;  3MTN B;  4J6I A;  4TUU A;  1YQ4 B;  3AED B;  1V49 A;  2DAF A;  3NZS A;  5E6N A;  1ZE3 D;  2KQ7 A;  3W5V B;  5EE0 A;  5J18 A;  5IAA C;  3NZ3 A;  1ET9 A;  4DXG A;  1FCC C;  3R7Q A;  3NVZ A;  2L32 A;  1MPE A;  1GC7 A;  1YN5 A;  2W3S A;  2QCZ A;  4A6Q A;  4HRS A;  2M56 B;  3BK1 A;  3L17 A;  3PRP B;  2A4Z A;  4AJW A;  3C19 A;  2NPT A;  3CWI A;  1S1Q B;  4NJ7 A;  2JQR B;  3TUO A;  5DPT A;  3FKY A;  4RH6 A;  4LNN A;  4EZL A;  2KVR A;  3VH3 B;  2QIE B;  3Q3N C;  4FHJ A;  3BII D;  1A70 A;  1EUV B;  4MDK E;  3J9C A;  2WWZ A;  4RNA A;  3VTW A;  1L4D B;  4WUR A;  4RF0 A;  1KH0 A;  2KYW A;  2BT6 A;  1QOF A;  3UIP B;  2RPQ A;  2SEB D;  1S3S G;  3X0W A;  2H88 B;  3T9L A;  1XLP A;  2FUG 1;  3U7Z A;  3TEX A;  4JWU C;  2D11 A;  1JWS D;  2NBV B;  1T0R C;  1AW7 A;  3N1Y C;  2PJH A;  1YJI A;  3DWM A;  1QT9 A;  4L23 A;  4LNK A;  3PRM B;  4RCO A;  5H8Y E;  2BVC A;  2KQS A;  4R3D A;  3PZ7 A;  1RAX A;  3ZNG C;  2Z0E B;  3M3J A;  2N7E A;  5AZG A;  1MVK A;  4IC7 B;  1PUT A;  1UWM A;  1D5Z C;  4RGN A;  1C4P A;  1EF5 A;  1Q1O A;  1XLO A;  3ZRC A;  4GIV A;  5J2R A;  2D3G A;  1D4B A;  4OVV A;  5L95 C;  2WXJ A;  2ZW0 A;  1QOG A;  4JIO U;  1IBX A;  5BYS A;  4TQ1 A;  1FNV A;  2LJ5 A;  3PVL A;  3LYY A;  1SGH A;  4EE2 A;  2IZV B;  3LDZ E;  4K7U A;  1EWC A;  1V5T A;  4EOY A;  1XCT L;  1WX8 A;  3KVF B;  3VUY A;  1J7B A;  4P16 A;  1P7F A;  1YN3 A;  2KMC A;  1NVI D;  2ACZ B;  1AWD A;  1VCB A;  2KC2 A;  4OVZ A;  2HE7 A;  3OLM D;  3SFD B;  1P3Q U;  2L83 A;  1A5R A;  4FN2 A;  1F9J A;  2L8J A;  2LHD A;  2ZZP B;  4BBN F;  1RLF A;  2OED A;  4AJY B;  3RD2 A;  1GOZ A;  2PLP A;  3AE6 B;  2XN9 C;  2AYO B;  3V62 A;  1K53 A;  3P4P B;  2XBB C;  2M4N A;  4W9H A;  4ITK A;  4YTN B;  2RDG A;  3MJW A;  4K81 A;  1VRA B;  4GGQ A;  2D07 B;  2GOW A;  2KLC A;  1N5W A;  1SE2 A;  3I57 A;  4ZRQ A;  3P2B A;  2KTR A;  2V3P A;  1ZDX A;  4N9F 4;  2I1K A;  2JT4 B;  2J7Q B;  1I4R A;  1OQQ A;  1JWU D;  2GRI A;  1JWA D;  2ASQ A;  2KWD A;  3AE9 B;  2MBB B;  2EEL A;  3L16 A;  4LK0 M;  3KUC B;  1HQR D;  4PS3 A;  2IPK D;  3LB8 C;  2JSV X;  2KWC A;  2N9L A;  4LDT B;  2JZZ A;  4LJP B;  3Q3F A;  3BVM A;  2K9X A;  3Q6B A;  4DDI D;  1TY0 A;  1RWS A;  4RGO S;  4LNI A;  4L2Y A;  2BTE A;  2REX A;  3NVY A;  4BKS A;  1WE6 A;  2LXC A;  3VR8 B;  3DQV A;  2LGS A;  2LRW A;  3P63 A;  3ECI A;  2G4D B;  4ANU A;  5H92 C;  2WX1 A;  2VZK D;  3I5J C;  5JXV A;  1WGG A;  4ZYN A;  3I63 C;  2N4F A;  1XF5 L;  3DVN V;  3AMZ A;  2ZCC A;  2BW2 A;  1D5X C;  3PRE A;  4XWT A;  2VH1 A;  1BT0 A;  5D2M B;  2O6V D;  2QHO A;  2IDY A;  4HDQ A;  4KVG B;  2E3T A;  2NMQ A;  4KX6 B;  2QSD A;  1WGY A;  3I9V 1;  4LNF A;  3NS8 A;  1WRI A;  1C3T A;  1GB1 A;  3DDC B;  4IM2 A;  2WXF A;  1HZ6 A;  2LI5 A;  1PGA A;  3WA0 A;  2CU1 A;  3PRZ A;  4HCN B;  2K8C A;  1ISN A;  4FXC A;  4MH8 A;  2G4S A;  3GS2 A;  2WXP A;  3DVN U;  2AQ1 B;  4JE3 B;  2NVU I;  3BWU D;  1VLB A;  4MJS A;  3N9Y C;  3ZJV A;  1E10 A;  2KJH B;  2RSU A;  4GU2 A;  4MEM A;  1L2N A;  3W9C B;  3UQB A;  1WM3 A;  2DWQ A;  4GDL B;  2KDB A;  2N1W A;  2N0S B;  1P7E A;  2KDI A;  4PS8 A;  5AEK B;  4W9K A;  4CQN A;  1WZ3 A;  2AX5 A;  4I6P A;  2KN4 A;  2CHZ A;  5HHD G;  2X8X X;  1HXY D;  1I4X A;  1V2Y A;  1ZDV A;  3PLU A;  3U52 E;  1WM2 A;  5E6P A;  1C4A A;  4KV2 A;  4WQM A;  3HM6 X;  2I38 A;  4WJO A;  1GC6 A;  4N6E B;  3ZYY X;  3VAW A;  1NYQ A;  4M0W B;  4C4V B;  2W3R A;  2JRI B;  1XD3 B;  1V5O A;  3ZUN A;  4PS7 A;  1NDD A;  5EDS A;  1C78 A;  1UD7 A;  1YX5 B;  2R61 A;  1I35 A;  2LVO A;  1GPX A;  2C7N B;  3RUL A;  2HJ8 A;  3O13 A;  2BS4 B;  3IAM 1;  2IYD B;  2FAZ A;  4ZRI A;  1H4R A;  4C80 A;  3QK0 A;  3GZN B;  1IYF A;  3ZNZ B;  2MEK A;  3L10 B;  4UDU C;  4DWF A;  4O1N A;  4TV3 A;  4BAX A;  1K8R B;  2DZM A;  1M4V A;  2CS4 A;  1TS2 A;  2KTF A;  3H6N A;  3AE3 B;  2Y3A A;  2Z8L A;  1FCL A;  4RM8 A;  4MGI E;  1UEL A;  5IOI A;  4FJV B;  4C4V A;  2E6X A;  5AZF A;  1K51 A;  1WXM A;  5D3I B;  1FIQ A;  3Q8E A;  1NYR A;  3ZQ4 A;  2DZK A;  2C7H A;  1YJ1 A;  1JRP A;  3TL5 A;  2KDF B;  3AE8 B;  4HCP B;  2GBJ A;  1WSP A;  4ANX A;  3AE5 B;  2V0G A;  4YT0 B;  3KYC D;  2IO0 B;  1YMH E;  1JAL A;  2HDE A;  2MJ3 A;  3EFC A;  2WYQ A;  3NS1 A;  4HPP A;  1L7Y A;  4GN1 A;  1J7A A;  3DBH I;  4PT5 A;  3R7R A;  2H89 B;  4G0N B;  5IKC M;  1U4A A;  5D94 A;  4EFO A;  2C7M B;  4ZDV A;  2QIL A;  1P9D U;  2FCN A;  4US8 A;  3ML9 A;  4OW0 A;  4XDC A;  1WJU A;  4AS1 A;  1N6Z A;  1YNT E;  4I6N B;  3DBR I;  3ZDT A;  1TBE A;  3ZXV A;  3QQ8 B;  4KZ0 A;  4HWI B;  1E7U A;  3AEC B;  4F7Z A;  2D3B A;  3QWZ B;  4MM3 A;  1WH3 A;  1BML C;  4K1R B;  5LNK 1;  3VDZ A;  3A9K B;  3U8Z A;  2BKF A;  2JWZ A;  3ABV B;  4JGH B;  2PE9 A;  3P4Q B;  1E8X A;  4ZRJ A;  3N1X C;  3RZF A;  4II3 B;  3IT4 B;  1SEB D;  5FR3 A;  3ZO5 B;  1MG4 A;  1I7H A;  4GOC A;  2K8H A;  4GSW A;  3ZKJ C;  4JL9 A;  3KUZ A;  2GLS A;  1QZE A;  2WQY B;  2LEK A;  2UYZ B;  3Q8B A;  1J19 A;  5E6O A;  2M19 A;  2ZVN A;  4XWW A;  1E8W A;  2RPV A;  3HM3 A;  4HVB A;  4HDO A;  3KUD B;  3FAH A;  1FRR A;  5EE1 A;  4A8X C;  3CF6 E;  5HI1 A;  3ZGZ A;  3QJZ A;  4AOF A;  1NEK B;  1UBQ A;  2DZJ A;  3Q3M C;  3MC0 B;  1IUE A;  5BMG A;  5LXI B;  2DHZ A;  2NTT A;  1JRU A;  3CIR B;  1R4M B;  3IFW B;  3B9J A;  3RZW C;  3PHW B;  2QDF A;  4AWJ A;  3N3K B;  1M94 A;  5BYQ A;  2KFK B;  1TKG A;  4IWP A;  3DBS A;  3UQA A;  1WYW B;  2DZI A;  1DOI A;  4GMV A;  2JUO A;  1G6J A;  2FCS A;  2IGG A;  2DBY A;  1TTN A;  3UGB B;  3FIL B;  5IA7 A;  4ARC A;  1F52 A;  5JH5 C;  2PW9 A;  2KOX A;  5CHW A;  1WIA A;  3Q8C A;  4NAW A;  1WWT A;  5C3J B;  3ZIM A;  4F1S A;  5LXH A;  2ZW1 A;  4I6L B;  1T5X D;  4JWS C;  4HKQ A;  4DQO C;  3NVV A;  1TS3 A;  4WWM A;  2AEH A;  4WWP A;  3ZNI D;  3Q69 A;  4A20 A;  3QA8 A;  2L76 A;  1Q10 A;  4MH0 E;  3UIN B;  1YQ3 B;  3H9D A;  4WWO A;  3RNF C;  4BKS D;  4YWG G;  1TT5 B;  3W1Y A;  3BIN A;  3GP7 A;  3M63 B;  2MBO A;  2ZCB A;  3L4P A;  4NZL B;  4ANV A;  2LVP A;  2KO3 A;  1KM7 A;  4K3C A;  4DBG A;  2LGD A;  3O65 B;  1OEY J;  3MP9 A;  3AE7 B;  4G50 A;  1C4C A;  4BBN C;  2DX5 B;  2ICI A;  4ZRK A;  3NJT A;  2BYF A;  2EKI A;  1CJE A;  2IBI B;  4WAF A;  3GOE A;  4GXB A;  4EEW A;  4G3X B;  3EGR A;  4ACF A;  2JYT A;  4NNJ B;  4XX5 A;  3H1U A;  1E5W A;  3AXC A;  1PDX A; 
#chains in the Genus database with same CATH homology
 3QHT A;  2ASQ A;  3AU5 A;  4MGK E;  3VQI A;  2NCN A;  4RM9 A;  3VTU A;  2RGF A;  2MBB B;  4HJK A;  3HHM A;  3L16 A;  4K7S A;  2MLB A;  3KUC B;  5CHV C;  2L05 A;  3V6C B;  4PS3 A;  3EFU A;  4XC2 A;  5FR6 A;  1V6E A;  2JF5 A;  2KAN A;  2KWC A;  4WWN A;  4HK2 A;  4LDT B;  2GBM A;  2K25 A;  2BWE S;  2JZZ A;  4NPN A;  4DXA B;  1I35 A;  1UZX B;  2KLG A;  4LJP B;  4ASW C;  3Q3F A;  3WAL A;  2PPH A;  4DDI D;  2MBE A;  2AL3 A;  2LD9 A;  4BKG A;  3KYD D;  3WIM A;  1CMX B;  2REX A;  4YL8 A;  4W9J A;  4W9G A;  4BKS A;  2BGF A;  1WE6 A;  4W9D A;  3VFK A;  2LXC A;  4WJQ A;  3DQV A;  1LFD A;  3JSV B;  1A5R A;  2LRW A;  1OTR B;  2JY6 A;  3B1L X;  3CMM B;  3ECI A;  4MSQ B;  5CTR C;  2G4D B;  1WR1 A;  2IO3 B;  3DVG X;  4ANU A;  2WX1 A;  4K7W A;  3SD5 A;  3A9J A;  3CSF A;  4NAW B;  1I42 A;  3JW0 X;  4DHZ E;  2O6V A;  1WGG A;  1SIF A;  1GG3 A;  5L83 A;  2G3Q B;  4ZYN A;  1Z5S B;  2Z59 B;  2N4F A;  3DVN V;  2ZCC A;  4DK5 A;  3EC8 A;  3WAM A;  3PRE A;  2FID A;  4W9C A;  1BT0 A;  5D2M B;  3TCA A;  4W9E A;  4ANW A;  2O6V D;  2UWQ A;  2QHO A;  4HDQ A;  4KVG B;  2KKC A;  3VUX A;  4W9I A;  1E7V A;  1VD2 A;  2DAJ A;  1WMH B;  1Q0W B;  1IPG A;  2KJR A;  2MRP A;  3KW5 B;  2LGX A;  1WGY A;  2BKR B;  2CHX A;  4MGY E;  3U7D A;  3NS8 A;  3N32 A;  1WZ0 A;  1V80 A;  3K9O B;  2DYB A;  2GBK A;  3DDC B;  4IM2 A;  2MCN B;  1C3T A;  2KN5 A;  1V81 A;  4FA6 A;  4HLE A;  3WAO A;  4FUL A;  1WJ6 A;  3VTV A;  2M0X A;  2LAS A;  1UH6 A;  3APD A;  5DPR A;  3RCZ A;  2LI5 A;  2KJ6 A;  2FIF A;  3T8M A;  3ZDM C;  2LXA A;  3OAW A;  3WA0 A;  2CU1 A;  2JVC A;  3PRZ A;  3X23 A;  2L7R A;  4HCN B;  4RMA A;  2K8C A;  1ISN A;  2KX3 A;  2KC1 A;  3L08 A;  3QC8 B;  4IWQ A;  1WGH A;  2G4S A;  1E8Z A;  3I3T B;  3JVZ X;  3DVN U;  1Y8R C;  3SU8 X;  2PE6 B;  4E71 A;  2NVU I;  1ZGU B;  3A1Q A;  2Z0D B;  2N7D A;  4MJS A;  3AI5 A;  2KWU B;  2ZJD A;  3NOB A;  2KWV B;  2KJH B;  2RSU A;  2L0T A;  3A9J B;  3A4R A;  3PV1 A;  4GU2 A;  4MEM A;  1L2N A;  3DCG A;  5C1Z A;  3UQB A;  1WM3 A;  4X57 B;  3L54 A;  4GDL B;  4DHJ B;  2N1W A;  2MBH A;  1WI0 A;  2KDB A;  2L0F A;  3BY4 B;  4M8N A;  2J0K A;  1IP9 A;  2KDI A;  2DYM A;  1GJZ A;  4KZC A;  4PS8 A;  2NR2 A;  3NZU A;  1WXA A;  2C9W B;  4XZ4 A;  5AEK B;  4W9K A;  3PHX B;  2KD0 A;  4FHK A;  2GMI C;  3M95 A;  3TIX A;  4MEL A;  2O2V A;  1WZ3 A;  2NBU A;  1SE9 A;  1WR6 E;  4KIK B;  2G45 B;  4I6P A;  2CHZ A;  2LRU A;  3H7S A;  4FLH A;  4WJP A;  1ZW7 A;  1R4M I;  4KIK A;  1V2Y A;  2D10 A;  3PLU A;  3PT2 B;  1WM2 A;  1AAR A;  5E6P A;  2DEN B;  4G11 A;  3OJ3 A;  4KV2 A;  3DBL I;  1NI2 A;  3HM6 X;  2LVQ A;  5JZE B;  4WJO A;  3WAN A;  2N9P C;  3RT3 B;  3ZNH B;  1GC6 A;  2ZPN A;  4BOS C;  2OJR A;  5G2N A;  1WE7 A;  1GNU A;  4AP4 C;  3VAW A;  2CKH B;  2EMS A;  1XT9 B;  1X1M A;  4M0W B;  1E8Y A;  4CHK A;  3PLV A;  2JRI B;  3IBE A;  1LQB A;  4NJ6 A;  3S2A A;  3KH0 A;  1KOT A;  2NBW B;  3HK0 A;  1XD3 B;  3TJP A;  4B6W A;  3B0A A;  4KSL C;  2FCQ A;  1V5O A;  3ZUN A;  4PS7 A;  1NDD A;  3H7P B;  4E74 A;  1OGW A;  5EDS A;  2KHW B;  1P0R A;  1UD7 A;  1YX5 B;  2M17 A;  3R66 C;  4FBJ B;  2LVO A;  4EZK A;  2C7N B;  1WY8 A;  2MQJ A;  4HPL B;  3RUL A;  3VVW B;  2HJ8 A;  1YD8 U;  4IWO A;  2W9N A;  2RD0 A;  4A3O A;  2IYD B;  2FAZ A;  3V60 A;  1WJ4 A;  5D6J B;  4ZRI A;  3PPA A;  1H4R A;  2NPT B;  3L13 A;  1J0G A;  3QK0 A;  2MA9 B;  3NHE B;  1NBF C;  2BWF A;  2M1M A;  4IUM B;  1IYF A;  3A9K A;  1OEY A;  3PTF C;  3ZNZ B;  3ZTD A;  4ICU A;  4ICV A;  3U30 A;  3L10 B;  2MP2 B;  4DWF A;  2KX0 A;  5KHQ A;  3ZW3 A;  2CHW A;  4TV3 A;  1K8R B;  1MG8 A;  4II2 B;  2DZM A;  3D32 A;  1HE8 A;  2EKE C;  2JPH A;  2CS4 A;  1FXT B;  1Q5W B;  2EMT A;  4NY0 A;  3M62 B;  2KTF A;  3H6N A;  2LUE A;  2K6D B;  4WJN A;  3HIZ A;  2R2O A;  1WF9 A;  3A1Q B;  5GMV A;  4RM8 A;  4MGI E;  1UEL A;  2A5U A;  2V3S A;  4FJV B;  4GDL A;  2O6V B;  1YX6 B;  1E90 A;  1WX7 A;  2FUH B;  1KLV A;  4DHZ B;  5AZF A;  1Z2M A;  1WXM A;  4IG7 B;  3OJ4 B;  3VUW A;  3VH4 B;  2I1J A;  4MGZ E;  2DZK A;  3V61 A;  3APF A;  2C7H A;  1YJ1 A;  4FAD A;  1PQS A;  3TL5 A;  2K8B A;  1J8C A;  2KDF B;  4FJZ A;  5BO4 B;  3VXW A;  5J17 A;  1YQB A;  3ENE A;  4HCP B;  1ZKH A;  2GBJ A;  4MJS B;  4PYZ A;  4ANX A;  4NQK E;  2BYV E;  3L0W B;  3ZRF A;  2JZ3 B;  3KYC D;  4E3C A;  3RUI B;  2IO0 B;  2FCM A;  3DPD A;  4HPM B;  4EUT A;  3DOW A;  1P1A A;  2WYQ A;  2D2Q A;  3SDL C;  2OOB B;  2L00 B;  5AZH A;  2C5L C;  3QAQ A;  4F8C B;  3DVG Y;  2J0M A;  1L7Y A;  5LLI A;  3ZLZ A;  4GN1 A;  3QAR A;  2WX0 A;  3DBH I;  1WGR A;  3CST A;  3MTN B;  4GB9 A;  4IW0 A;  4J6I A;  4TUU A;  3QCA A;  1D3Z A;  3R7R A;  3QIJ A;  4G0N B;  5JHA A;  4B95 A;  1V49 A;  2DAF A;  3NZS A;  4DDG D;  1UGM A;  1U4A A;  5D94 A;  5E6N A;  4EFO A;  2XEW A;  2C7M B;  4ZDV A;  1EF1 A;  1LXD A;  2KQ7 A;  4URK A;  1P9D U;  2FCN A;  3ML9 A;  4CYE A;  5J18 A;  5IAA C;  4DHJ D;  4TQ0 A;  2HTH A;  1WJU A;  4I6N B;  3K9P B;  3DBR I;  3ZDT A;  3C0R B;  3QX1 A;  3ZTC A;  1TBE A;  3R7Q A;  3QQ8 B;  5D7G A;  4KZ0 A;  3ONS A;  4HWI B;  1GC7 A;  1E7U A;  3AU4 A;  3L17 A;  2XK5 A;  3PRP B;  2LGY A;  2IY1 B;  4F7Z A;  3WAP A;  3QWZ B;  4MM3 A;  3B08 A;  1WH3 A;  2ZVO A;  2KNB A;  2A4Z A;  4K1R B;  2MP2 A;  4AJW A;  1C1Y B;  2KZR A;  2NPT A;  1S1Q B;  4NJ7 A;  3VDZ A;  3A9K B;  5DPT A;  3U8Z A;  1WXV A;  2BKF A;  2JWZ A;  4KDL B;  4EZL A;  2KVR A;  4JGH B;  2PE9 A;  3VH3 B;  3IVF A;  1E8X A;  4ZRJ A;  5DPS A;  2MW5 A;  3APC A;  2KK8 A;  1T0Y A;  4FHJ A;  1H8C A;  1WMH A;  3VHT C;  1EUV B;  4MDK E;  5JHB A;  3RZF A;  4II3 B;  2WWZ A;  3A4S C;  1R4N I;  2O2V B;  2ZNV B;  3VTW A;  3H7P A;  2R2Q A;  3A33 B;  3ZO5 B;  2KFJ A;  2BYE A;  4BKT A;  3UIP B;  2RPQ A;  4GOC A;  4M8M A;  3PS6 A;  2FNJ B;  2K8H A;  4GSW A;  3N30 A;  1S3S G;  3X0W A;  3ZKJ C;  2V4L A;  3T9L A;  5HKH A;  4JL9 A;  4JLC A;  3KUZ A;  2D11 A;  1QZE A;  2KXJ A;  2NBV B;  2UYZ B;  4IM3 A;  2CR5 A;  2PJH A;  1J19 A;  3JSV A;  2KTR B;  5TR5 A;  2IO1 B;  3SHQ A;  5E6O A;  1EO6 A;  3LJ3 A;  3PGE A;  2ZVN A;  4BOZ B;  2YVC A;  3AUL A;  3PRM B;  2MWS B;  2BPS A;  4BVU C;  1E8W A;  2JRH A;  3HM3 A;  4HVB A;  2KQS A;  4HDO A;  4BFR A;  3KUD B;  4MSM B;  2LWP A;  2K6Q A;  2AWT A;  3CF6 E;  1WJN A;  4P7I A;  3QJZ A;  4GDK B;  4OVU A;  1OQY A;  4AOF A;  3TMP B;  1RAX A;  2GBN A;  3ZNG C;  1UBQ A;  2Z0E B;  1GUA B;  2N7E A;  1KJT A;  2DZJ A;  3M3J A;  3Q3J A;  4IC7 B;  5AZG A;  5LXI B;  3W1S A;  2DHZ A;  1JRU A;  2RR9 A;  1EF5 A;  1Q1O A;  3IFW B;  2NS5 A;  3RZW C;  3ZRC A;  4GIV A;  5J2R A;  2D3G A;  3UF8 A;  2HD5 B;  4OVV A;  3PHW B;  3PZD A;  5L95 C;  4AWJ A;  3N3K B;  3PSE B;  1M94 A;  4GDK A;  4NQL B;  5C23 A;  3GZN I;  2PEA A;  2M8S A;  3V6E B;  2KFK B;  2XK5 B;  4IWP A;  3NY5 A;  3DBS A;  4JIO U;  3UIO B;  4TQ1 A;  2LJ5 A;  2KDE B;  3R3M A;  1WYW B;  3PVL A;  4TKN A;  4KSK C;  4W9F A;  3UQA A;  1SGH A;  4B9K A;  2DZI A;  2IZV B;  3RYT A;  3IHP C;  4GMV A;  5KHO A;  2ZNV C;  2JUO A;  1G6J A;  3LDZ E;  2FCS A;  4K7U A;  2KFK A;  3W1S C;  1V5T A;  1TTN A;  4EOY A;  2MX2 A;  3UGB B;  1WX8 A;  1WRD B;  5IA7 A;  3KVF B;  3VUY A;  3MHS D;  2VRR B;  5JH5 C;  1V9J A;  2KOX A;  5CHW A;  1WIA A;  4NAW A;  3ZIM A;  4F1S A;  2J0J A;  2KMC A;  4FJY A;  2WDT B;  3TBL D;  4CO7 A;  5LXH A;  1WGD A;  4I6L B;  1VCB A;  2KC2 A;  2V1Y A;  5CX3 A;  1TZ1 A;  2HE7 A;  2K1F A;  3EHV A;  3JYU A;  3OLM D;  2L3Z A;  2AEH A;  4LCD E;  1WFY A;  2Y5B B;  4WWP A;  3ZNI D;  5DPW A;  2IY0 B;  2N1V A;  4A20 A;  1P3Q U;  3EEC A;  2GBR A;  2KMA A;  2L76 A;  3IG3 A;  3QA8 A;  1F9J A;  2N9X A;  4FN2 A;  4MH0 E;  2L8J A;  2DYO A;  2N9E B;  3UIN B;  3H9D A;  4WWO A;  2MBQ A;  1V86 A;  4BKS D;  3ML8 A;  2K39 A;  3W1Y A;  3BIN A;  2ZZP B;  4BBN F;  1TGZ B;  2B3A A;  1RLF A;  4KDI C;  5CHF A;  1LM8 B;  3M63 B;  4AJY B;  2MBO A;  2ZCB A;  3RD2 A;  2ZPY A;  4WQO B;  4WAA A;  4HXD A;  4IM0 A;  2ZEQ A;  4ANV A;  2LVP A;  2KO3 A;  4EZJ A;  1KM7 A;  2AYO B;  2LZ6 A;  3V62 A;  4DBG A;  1WX9 A;  4A3P A;  2LGD A;  2XBB C;  3O65 B;  1WXS A;  2M4N A;  1OEY J;  1P98 A;  4W9H A;  4W9L A;  4G50 A;  4EKU A;  2IO2 B;  2DX5 B;  4BBN C;  3MJW A;  4K81 A;  4JQW C;  4LDT D;  4ZRK A;  1YIW A;  2YLM A;  2BF8 B;  4AUQ C;  2AL6 A;  1XQQ A;  2BYF A;  2C60 A;  2D07 B;  2MSE D;  1RFA A;  2IBI B;  4GGQ A;  3GOE A;  5DCN A;  2GOW A;  2KLC A;  4GXB A;  4PYU A;  4G3X B;  4EEW A;  3P2B A;  4NNJ B;  2KTR A;  4XX5 A;  5G55 A;  3H1U A;  2JXX A;  3ZVV A;  1E5W A;  1UBI A;  3AXC A;  2I1K A;  2JT4 B;  4N9F 4;  1RRB A;  2J7Q B;  3ALB A;  4LJO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...