1GJZA

Solution structure of a dimeric n-terminal fragment of human ubiquitin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
b'GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Structure and Properties of a Dimeric N-Terminal Fragment of Human Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin
total genus 6
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gjzA00
3ML9A 2IO0B 3WAMA 3VVWB 2MBBB 2LVOA 3ZO5B 1E90A 2DAFA 2LGYA 4DBGA 2GBJA 2KTRA 1P0RA 3KYCD 4WWPA 3V6CB 4URKA 2LGXA 1P9DU 1V80A 3RCZA 2DZJA 1RRBA 2DAJA 4MGIE 1WGDA 5DPWA 3L08A 3OLMD 4HWIB 3DPDA 3NHEB 3ZW3A 4HPLB 4K1RB 4MGYE 3PLUA 5JHBA 4PS8A 4WJOA 2KC1A 2N9EB 2JZZA 2RD0A 2ZZPB 1VD2A 3KVFB 4M0WB 2XK5B 3K9OB 2JT4B 2JF5A 3QCAA 1X1MA 2O2VB 1R4NI 4GXBA 1WZ0A 4TQ0A 2M0XA 2G45B 3ZKJC 1V81A 2GBKA 3R66C 4ZRKA 4K81A 2OOBB 2HJ8A 4W9KA 5IA7A 1GC7A 3CF6E 2EMSA 2FCMA 2DZKA 3EECA 3H9DA 2MX2A 2IY1B 1YD8U 1U4AA 2O6VB 2LUEA 3SDLC 4B95A 4GOCA 4BOSC 2KHWB 2MBOA 3SU8X 2ZCBA 1TBEA 3V60A 2CHWA 1EF1A 1TZ1A 1NDDA 4CO7A 1WXAA 3DBSA 1MG8A 2IYDB 2LVQA 4TV3A 4ZRIA 5J18A 2K25A 4M8MA 1UBQA 4NPNA 2ZNVB 2B3AA 4IUMB 2RGFA 4N9F4 3QJZA 2REXA 2I1JA 4DHJB 1UZXB 1WJ4A 2CHXA 2ZPNA 3HM6X 4EFOA 3R7QA 1Q1OA 3DOWA 1J19A 2FNJB 4EZLA 5AEKB 1RFAA 2J7QB 3IBEA 2C9WB 4W9JA 5CHWA 3RT3B 1NBFC 4FHKA 2LRWA 5DPSA 4AJWA 1P1AA 2KKCA 3PREA 5C1ZA 3BY4B 1WYWB 3QARA 4NJ7A 2DYMA 2V3SA 3PLVA 2JUOA 4I6LB 3KUCB 3A9JA 3JVZX 5L95C 2WWZA 5JH5C 4W9EA 1D3ZA 4MGKE 2O6VD 4WJQA 2KVRA 4WQOB 4XX5A 2KWVB 3U7DA 5IAAC 3T9LA 4B9KA 1Z5SB 3ML8A 2PJHA 3W1YA 1E8XA 4HK2A 4ZYNA 4BVUC 1J8CA 2A4ZA 1J0GA 1ZW7A 3BINA 4LDTB 2C5LC 4NNJB 4MDKE 3IG3A 2OJRA 2AWTA 3ZNZB 4FULA 1UELA 4WAAA 3PT2B 2N9PC 2NPTB 3WANA 3AU4A 2YLMA 1H8CA 2L0TA 2CS4A 2L8JA 3L17A 3UQAA 3L13A 3QWZB 3DBLI 5DPRA 4EKUA 4EEWA 1WZ3A 1WXMA 2K6QA 1E7UA 1OQYA 2KC2A 3DVGY 4BBNC 1GUAB 2J0MA 2N1VA 2MQJA 2NBUA 2GBMA 2J0KA 3VFKA 3HHMA 3ZTCA 3CSTA 3ECIA 3I3TB 3KUZA 1P98A 3DCGA 4NAWA 2ZPYA 1Z2MA 2HD5B 2BWFA 2L7RA 2PEAA 3RULA 2K6DB 2KOXA 4ANUA 4FJYA 2K8HA 4KVGB 2UYZB 5J17A 4GN1A 2JZ3B 5EDSA 4ASWC 3B1LX 1A5RA 3M3JA 1F9JA 3U8ZA 1SIFA 1P3QU 1ZGUB 2UWQA 4LDTD 4HLEA 2KZRA 2N9XA 4DHZE 4FHJA 2D10A 2C7HA 2KDBA 2DZMA 2LXCA 1L7YA 2LD9A 2NBWB 2KX3A 1E8WA 1TGZB 4BKGA 2K39A 5JHAA 2FUHB 4HDOA 3M63B 4MH0E 2AL3A 2MWSB 2DYBA 3TIXA 4PYZA 2N7EA 2JVCA 3L10B 4CHKA 4II2B 3VUWA 2EMTA 2D11A 4GIVA 1WX7A 2N1WA 4J6IA 2CU1A 2LRUA 1KLVA 2M1MA 4DXAB 3PRMB 2KMCA 1UH6A 1WY8A 4K7WA 2NBVB 1C3TA 3QK0A 3M62B 2L3ZA 3X23A 2XK5A 1IYFA 2KLCA 4MGZE 2O2VA 2KXJA 5TR5A 1KM7A 2G4SA 3HK0A 3PRPB 2K1FA 4KDIC 4EZJA 3WAOA 1FXTB 5J2RA 4RM8A 2XBBC 3DBHI 2RPQA 3VH3B 1IP9A 1WGGA 3AI5A 2L0FA 1Y8RC 2FCQA 3VAWA 4A3PA 1EO6A 3NY5A 2VRRB 2O6VA 2N4FA 4I6NB 4W9IA 2C7MB 5CX3A 2ZNVC 2PPHA 3UGBB 1NI2A 4WJPA 2R2QA 5E6OA 5CTRC 2IO1B 3A1QB 5E6NA 2DZIA 1QZEA 2ZJDA 4LCDE 4F1SA 4IWOA 5FR6A 4BFRA 5DPTA 5LXHA 2CHZA 2LWPA 3AULA 2JWZA 1WJNA 3A9KB 4B6WA 4BKTA 4AOFA 3JW0X 3QX1A 3ZLZA 2Y5BB 3VTVA 2K8BA 3JSVB 1V49A 2D07B 1K8RB 4GU2A 4GB9A 4AJYB 4KIKB 1E7VA 2C7NB 3ZUNA 4PS3A 3PVLA 3NS8A 1PQSA 4XC2A 4TKNA 3O65B 2AEHA 4WWNA 3AXCA 1YX6B 2KWCA 2ZVOA 4IM0A 1UD7A 5LLIA 3QQ8B 5JZEB 4KV2A 2BPSA 2KJHB 2J0JA 3P2BA 2KANA 2LJ5A 3NOBA 5BO4B 1BT0A 3WAPA 4ZRJA 3V62A 3RUIB 2D3GA 4AWJA 4BOZB 4W9DA 4FBJB 4ANWA 4PS7A 1YX5B 3L0WB 3PZDA 2FCSA 4JIOU 4OVVA 1WJ6A 2DHZA 3KYDD 3U30A 1LM8B 4E71A 4FLHA 1WMHB 2MLBA 2IZVB 4W9GA 1V9JA 1OEYA 1IPGA 1E8YA 2AL6A 4LJOB 4W9HA 1LFDA 2NPTA 3ZRCA 4RM9A 2KDEB 2MBEA 1WX8A 3PS6A 2KK8A 2WX1A 3HIZA 2KD0A 2KFKB 2KQSA 1V5OA 2MP2B 3DVNV 4A20A 4FJZA 4FADA 3VDZA 1HE8A 3D32A 5C23A 1OGWA 4DHJD 2L00B 5G2NA 1UBIA 1XT9B 3N3KB 4BKSD 1WR6E 3K9PB 3QC8B 4TQ1A 3ZDMC 3W1SC 1I42A 3PHXB 2LZ6A 2XEWA 3SHQA 1WE6A 4GSWA 3TBLD 1XQQA 2GOWA 4IC7B 5D2MB 4LJPB 4KSLC 2KDIA 3TMPB 3VTWA 2BWES 1GJZA 4FN2A 4II3B 2HE7A 2FIFA 1WX9A 4NQLB 2QHOA 4XZ4A 4HXDA 2KN5A 4DWFA 5G55A 3DDCB 3VHTC 2MBQA 2KQ7A 1TTNA 2KNBA 2LI5A 2KO3A 4GDKA 4ANXA 3IFWB 2HTHA 4GDKB 3MHSD 3APDA 3H7SA 4EUTA 2GBRA 3DBRI 2MCNB 3TJPA 4KZCA 1T0YA 3WALA 4MM3A 2EKEC 4NQKE 5AZHA 1WRDB 4AP4C 1RAXA 2KX0A 1R4MI 2KWUB 3KW5B 3V61A 3ZTDA 3KUDB 4IG7B 1L2NA 4WWOA 4G50A 4GDLB 4JGHB 1ZKHA 5E6PA 5AZFA 4HPMB 3N32A 3JYUA 2IBIB 3CSFA 4IM3A 1YIWA 4FA6A 2MRPA 3AU5A 1WM3A 2NR2A 2Z59B 3DQVA 5GMVA 3H7PB 3R7RA 3DVGX 1UGMA 3UF8A 3ZIMA 2JY6A 2BYVE 3ZNHB 2KLGA 3H1UA 1WFYA 3PTFC 4IWQA 4NY0A 1OEYJ 4DK5A 2JRIB 5KHOA 4FJVB 1I35A 5D6JB 2ZEQA 1KJTA 3Q3JA 3SD5A 1WF9A 3APCA 4G0NB 2GBNA 2V1YA 2I1KA 3A33B 3PGEA 4W9CA 4KSKC 2KTRB 3PPAA 4G3XB 4CYEA 1WGRA 4MELA 3A1QA 4PYUA 3CMMB 4G11A 1V2YA 3MTNB 2GMIC 1WJUA 3PV1A 1V86A 4KDLB 3A9KA 3OAWA 1JRUA 2MSED 2BKFA 2AYOB 1WIAA 3ZNID 2NS5A 3VH4B 1AARA 2W9NA 3JSVA 2MBHA 3LDZE 4DDID 4K7SA 2ZCCA 3APFA 4IWPA 1SGHA 3QIJA 4KIKA 5D7GA 3NZSA 1S1QB 3UQBA 4BKSA 1Q5WB 2KJRA 3L54A 3N30A 4JQWC 2MA9B 3NZUA 1SE9A 1XD3B 2NVUI 2MW5A 2PE6B 5CHVC 4F7ZA 2C60A 4JL9A 3ENEA 2DX5B 4OVUA 4DHZB 2D2QA 4HJKA 3ZRFA 1WH3A 4HCNB 2JRHA 2V4LA 2WDTB 1LQBA 4K7UA 5KHQA 3VUYA 3T8MA 2CKHB 4YL8A 4BBNF 2WYQA 5CHFA 2BKRB 2LGDA 2BYFA 3OJ4B 4HDQA 3UIPB 3UINB 3M95A 3GOEA 1WMHA 4HCPB 3IVFA 5L83A 2G3QB 2FAZA 3IHPC 3VTUA 4ANVA 3MJWA 2A5UA 2Z0EB 3PRZA 1WR1A 4NJ6A 2KFKA 2MP2A 2JXXA 2RR9A 3TCAA 2L05A 5D94A 3H6NA 2K8CA 4EOYA 1WE7A 1WXSA 2LASA 3R3MA 1V6EA 1WM2A 4IW0A 2NCNA 1EF5A 2LXAA 2RSUA 2L76A 2IO2B 3EFUA 3LJ3A 4KZ0A 1CMXB 2LVPA 1WI0A 3VQIA 2ASQA 2YVCA 3A9JB 3B08A 4GGQA 1VCBA 4GMVA 2CR5A 1E5WA 2FIDA 2BYEA 3GZNI 3HM3A 3A4RA 4W9LA 2Z0DB 3W1SA 3WIMA 4ICUA 4DDGD 1ISNA 3S2AA 2JPHA 3L16A 3TL5A 4EZKA 3RZWC 2BF8B 3KH0A 3WA0A 4ICVA 4MSMB 4I6PA 4X57B 1KOTA 1GC6A 1GG3A 5LXIB 4MEMA 3QHTA 3Q3FA 3RD2A 1WXVA 3ZNGC 5HKHA 1RLFA 2R2OA 1S3SG 2WX0A 4MSQB 4WJNA 4MJSA 3RZFA 1WGYA 4TUUA 2FCNA 3B0AA 4M8NA 1EUVB 3V6EB 4MJSB 1V5TA 4P7IA 5AZGA 2BGFA 4ZDVA 3QAQA 2KFJA 2DYOA 3UIOB 1C1YB 4NAWB 3EC8A 3QA8A 4A3OA 4GDLA 4W9FA 2IO3B 2KDFB 2ZVNA 4HVBA 3ONSA 2N7DA 3A4SC 3OJ3A 1OTRB 2KMAA 4IM2A 4RMAA 3ALBA 1LXDA 3DVNU 4E74A 3H7PA 3VXWA 1YJ1A 1YQBA 2PE9A 2DENB 1E8ZA 1GNUA 3PHWB 4JLCA 5DCNA 1Q0WB 1WGHA 2M8SA 4E3CA 3C0RB 4F8CB 3RYTA 3X0WA 2KJ6A 4AUQC 2KTFA 3PSEB 2G4DB 1H4RA 3EHVA 2IY0B 2M17A 1M94A 3ZDTA 3ZVVA 2M4NA 1G6JA 3VUXA
chains in the Genus database with same CATH superfamily
2IO0B 2INNE 2LVOA 2DWQA 2DAFA 5TSSA 3BYYB 4URKA 1P9DU 4HRSA 1RRBA 4HROA 1HXYD 3DPDA 4HPLB 4K1RB 3BVGA 2QC8A 4MGYE 4WJOA 2KC1A 3BK1A 2JZZA 1VD2A 4TQ0A 4XE0A 3B9JA 2M0XA 4P6VF 3ZKJC 3R66C 2KDMA 2OOBB 4BZAA 4W9KA 4YWGG 3CF6E 2DZKA 1NENB 2IY1B 2O6VB 1L4DB 5FK9C 1YN3A 2MBOA 1BXTA 3N20C 1TBEA 1NDDA 1MG8A 1JWSD 2B3AA 2N9KA 4IUMB 2Q5WD 1UZXB 3C8YA 3HRDD 4ZYSA 4EFOA 3R7QA 1Q1OA 3DOWA 1K53A 1J19A 2FNJB 4ZRQA 1K52A 1RFAA 3IBEA 2C9WB 3RT3B 2M0AA 4LNNA 1XXGA 3BY4B 2DYMA 2JUOA 4OW0A 3JVZX 1E6EB 5L95C 5JH5C 4WJQA 4XX5A 5BYQA 1Z5SB 1IGDA 4NNJB 1SJHD 3ZNZB 4WAAA 2CS4A 3L17A 1FXAA 3QWZB 1WXMA 1GUAB 2J0MA 3GB1A 2MQJA 4LNIA 3SEBA 1T0RC 3CSTA 3ECIA 4NAWA 3DCGA 2BWFA 2L7RA 2K6DB 2BQQA 2JYTA 4KVGB 2JZPA 5J17A 4GN1A 1P3QU 1DGJA 4FHJA 4WAFA 5HI1A 2Y3AA 3AECB 3NVWA 3DBHB 4YTNB 4C56C 1VZ6A 4HDOA 3RNBC 2AQ3B 3L10B 2VZKB 1ACCA 3RPFC 2FE8A 3AEFB 4J6IA 1F0ZA 2KMCA 4O1NA 1PUTA 1BUIC 1IYFA 2WXGA 5TR5A 4KDIC 4EZJA 3ABVB 1FXTB 1NI3A 3AMZA 1SEBD 2RPQA 1WGGA 3AI5A 2L0FA 1Y8RC 1ZOYB 1EO6A 3NY5A 2VRRB 2O6VA 3NJTA 1SSNA 4WJPA 5CTRC 5E6NA 1TIFA 2NTSA 5LXHA 2CHZA 2JWZA 3JW0X 1HTQA 3VR8B 2Y5BB 2K8BA 2D07B 4AJYB 4GB9A 2C7NB 1L0VB 1K50A 1QT9A 4XC2A 2WXIA 2AEHA 3O65B 4WWNA 1YX6B 3BIID 3P63A 2BYTA 2BPSA 2BT6A 3MC0B 4JWUC 2KJHB 2LJ5A 5BO4B 5H8YE 3RUIB 1N62A 4W9DA 4ANWA 5GXGB 1Q10A 4E71A 1WMHB 2V3NA 1E9MA 3MHZA 2MBEA 2KK8A 1OFFA 1V5OA 2D3BA 1MHXA 2D5GA 1OQQA 3DBRB 3NRZA 3N3KB 4TQ1A 2LZ6A 2XEWA 4GSWA 3TBLD 1R4MB 5MPOA 4KSLC 4HKZE 2KQ4X 1GJZA 2L52A 4FN2A 2FIFA 2OHFA 5G55A 1FNUA 3VHTC 1CZPA 4GDKA 2BVCA 1N5XA 3APDA 3U2SC 3WALA 3TEYA 2EKEC 4AP4C 5FKAC 3V61A 4P1BC 5AZFA 1IUEA 3N32A 4XWWA 1F2RC 3V3XA 4FA6A 3T3OA 1ZE3D 2QMTA 3DVGX 1UGMA 3UF8A 2BYVE 5G5GA 4IWQA 1WFYA 4NY0A 4DK5A 5KHOA 4YTMB 4ZHPA 4FJVB 3MP9A 3NZ3A 1K51A 2GBNA 3A33B 1SE4A 3NS1A 2KTRB 1T5XD 4LNOA 2BB5A 2X8XX 4G11A 1V2YA 1WJUA 2VZKD 1WIAA 2NS5A 2W9NA 3LDZE 4M02A 4K7SA 1XEEA 2IGHA 5D7GA 3GP7A 2WQYB 3PO0A 1FO4A 2MA9B 1SE9A 4F7ZA 5E6JA 1ZXIA 4LNKA 2DX5B 4OVUA 4DHZB 4HJKA 4HCNB 3PZ7A 4C4VB 2V4LA 2WDTB 1LQBA 2KWDA 2CKHB 2J52A 1WMHA 3KWLA 5L83A 1SE2A 2G3QB 1UGJA 3VTUA 2LGSA 2R61A 4EOYA 2LASA 1V6EA 2NCNA 1EF5A 1F77A 2IO2B 3EFUA 3LJ3A 4KZ0A 4CQNA 2BTEA 1XF5L 3VQIA 2ASQA 3A9JB 4L2YA 1NVID 1N6ZA 1EWCA 3HM3A 1WRIA 3A4RA 4W9LA 2Z0DB 3AEEB 1LO5D 3L16A 3AV8A 3TL5A 4EZKA 3RZWC 1N5WA 2BF8B 3ETRA 4MSMB 4I6PA 1GC6A 4FXCA 5LXIB 1I4PA 2KMMA 3Q3FA 1XLQA 3TEZA 2WX0A 4WJNA 4MJSA 4TUUA 2RMMA 1EUVB 3V6EB 1TT5B 3P4QB 4ZDVA 3QAQA 2KFJA 3UIOB 3EA6A 3AE7B 4A3OA 1FFVA 2IO3B 5HFYA 1ET6A 4MACA 4HVBA 2N7DA 3OJ3A 3BVZA 4IM2A 3RNCC 1DOXA 3ALBA 2PTLA 3VXWA 2PE9A 5DCNA 1E8ZA 1QKZA 1N63A 1JRPA 2M17A 1TYGB 1FCLA 3IXSA 3PS6A 3VUXA 3VVWB 3ZO5B 1E90A 2H89B 4DBGA 2KTRA 3V6CB 1D5MC 4EE2A 1C9FA 1V80A 2DZJA 4MGIE 1WGDA 2BB6A 3L08A 5DPWA 3OLMD 2V4IB 3W9CB 4PS8A 4WURA 2LHDA 2ZZPB 1QLBB 4RFBA 2JYEA 4GXBA 1VZ8A 1SXTA 1I4XA 4S0RA 2WXJA 2EMSA 3EECA 2W3SA 3SDLC 4C4VA 4TMAB 3SU8X 2RDGA 3V60A 2CHWA 1EF1A 4CO7A 4TV3A 4LK0M 2WDVB 1HZ6A 1L4ZB 1T6BX 2I1JA 1ROEA 3HM6X 2QILA 4EZLA 5AEKB 1NBFC 4FHKA 3QARA 2V3SA 4HEA1 3PLVA 4I6LB 3KUCB 1CJEA 2IDYA 5IN7A 3A9JA 2WXNA 1TS2A 4MGKE 4WQOB 2H88B 5IOIA 3ML8A 2PJHA 1E8XA 1J8CA 4RNAA 2C5LC 3C19A 4USAA 2GI9A 2OJRA 2AWTA 4FULA 4ARCA 4C00A 1N60A 2L8JA 3DBLI 1MJDA 1OQYA 3DVGY 1D6EC 1NYQA 2RPVA 2GBMA 3AN1A 3HHMA 3ZTCA 3VRAB 3I3TB 2ZPYA 2I38A 4FJYA 2K8HA 4YSXB 2UYZB 2W82A 3W5VB 1PYWD 1MI0A 3NUHB 1A5RA 3M3JA 1ZGUB 4M01A 1HEZE 4DHZE 3AE5B 1B9RA 2GRIA 2C7HA 2LXCA 2ACZB 1RWSA 4OZAA 2LD9A 2MWSB 2DYBA 3TIXA 1XLOA 2N7EA 3VUWA 2CU1A 1JQ4A 1KLVA 4LNFA 3FILB 4DXAB 2NBVB 4KKJA 1JCKB 3X23A 2KLCA 2KXJA 1KM7A 3BVMA 2XBBC 1IP9A 2JSVX 1KF6B 1D5ZC 2FCQA 4A3PA 2N4FA 4W9IA 1QOGA 2WXKA 5E6OA 3A1QB 4LCDE 1QZEA 4F1SA 4IWOA 1J7AA 2HDEA 2LWPA 3GE8C 4B6WA 4BKTA 4AOFA 3N1YC 2PLPA 2WXPA 1V49A 1K8RB 1E7VA 1JROA 3PVLA 2KWCA 5JZEB 1GB4A 4KV2A 1WSPA 4US8A 3NOBA 4ZOHC 2B76B 3V62A 2OEDA 4PS7A 3L0WB 3PZDA 2FCSA 4JIOU 4YSYB 2CJOA 3U30A 4W9GA 2BS4B 1IPGA 1E8YA 2AL6A 2RDBC 4RGNA 1LFDA 3ZRCA 5BYSA 1T3QA 2KDEB 1A70A 4RM9A 4DQOC 1YMHE 1EM7A 2WX1A 2KD0A 2KFKB 4US9A 4FJZA 4FADA 1HE8A 3D32A 2L00B 4Q2JA 4BKSD 2DBYA 1I42A 3SHQA 1FFUA 4P16A 2WU5B 2K9XA 1XQQA 1XCTL 2GOWA 5D2MB 1SIJA 4LJPB 4WQMA 2KDIA 2WDRB 1VDVA 2JQRB 2QHOA 3HUIA 1RM6C 1ENFA 2KN5A 4HXDA 4ZRPA 5BMHA 2K3UA 2MBQA 2CJNA 2KNBA 2XN9C 3IFWB 4GDKB 2D3AA 1FM0D 1MHHE 2MCNB 3TJPA 4KZCA 1I4QA 3AEBB 1MVKA 1QILA 4MM3A 4NQKE 2Z8LA 1NYRA 1RAXA 2KX0A 2KWUB 2LFIA 3DHGC 1L2NA 4GDLB 4JGHB 1ZKHA 4UDUC 4DXGA 3FILA 1YIWA 1FRRA 2NR2A 2Z59B 3R7RA 3H7PB 3ZIMA 2JY6A 3ZNHB 2KLGA 2MJ3A 2WXHA 1I35A 1KJTA 3SD5A 1WF9A 3APCA 1YJJA 3U52E 2I1KA 3PPAA 4CYEA 4MELA 3KQ4A 3A1QA 4RGMA 4PYUA 2QJLA 3N1ZC 4N59A 2GMIC 4KDLB 1FRDA 3Q2AC 4YXDB 4D2KA 4M00A 3LB8C 2BKFA 1F1HA 1AARA 3DHHC 2SAKA 4IWPA 3I63C 3QIJA 4XYCA 4XWTA 1Q5WB 3L54A 4JQWC 2NVUI 1YQ3B 4JL9A 3Q14C 2D2QA 3ZRFA 2JRHA 3T8MA 3E9SA 3GZNB 2LGDA 1Y56A 3UINB 3M95A 1GOZA 1WR1A 4NJ6A 2KFKA 2JXXA 2RR9A 5D94A 3H6NA 1QOFA 1WM2A 1MG4A 1FMAD 2LXAA 2RSUA 1KTKA 5D3IB 1WI0A 2MEKA 4GGQA 1VCBA 1M4VA 4LLGM 2BYEA 2FBWB 1JWBD 3W1SA 4ICUA 1V8CA 3IAS1 3S2AA 2V9HA 3KH0A 2MJDA 4RF0A 4ICVA 1KOTA 1T0QC 4TSSA 4HPPA 1C76A 3RD2A 1WXVA 5HKHA 1S3SG 5C3JB 2TSSA 2EELA 2LHEA 4MSQB 3RZFA 2FCNA 1R7SA 2OJWA 3B0AA 4M8NA 4MJSB 4P7IA 2MH7A 2BGFA 2AX5A 2M19A 4GDLA 3ONSA 3A4SC 1OTRB 2KMAA 4RMAA 4GLSC 4IDIA 2WNMA 3I5JC 3H7PA 1FCCC 1YQBA 4BFRA 4JLCA 2DENB 3AH7A 3X0WA 2PVOD 2AQ2B 1NEKB 3PSEB 2KACA 3EHVA 2PKOA 1G6JA 2V0GA 3ML9A 1TY2A 3EGRA 5EE3A 4WWPA 3KYCD 2LGXA 4C80A 3DWMA 3RCZA 4RGOS 2DAJA 4HWIB 2IPKD 2L32A 3ZW3A 3PLUA 1KRHA 1I4RA 5JHBA 3RN9C 2N9EB 4M0WB 2XK5B 1D5XC 2WXLA 3K9OB 3QCAA 2O2VB 1R4NI 1GAQB 2IGGA 1WZ0A 3J9CA 3W2DA 1V81A 2GBKA 4ITKA 2HJ8A 1GC7A 4AS1A 3H9DA 2MX2A 1U4AA 2LUEA 2KHWB 3RNEC 5EE0A 1TZ1A 2D3CA 1WGKA 1WXAA 2LVQA 2NTTA 4M8MA 1UBQA 4NPNA 2REXA 2CHXA 5IKCM 2N7JA 4W9JA 2PW9A 2LRWA 1P1AA 2KKCA 1FNVA 1IBXB 2PIAA 1P7FA 3AE3B 3NG0A 2INCC 3KWVA 2WWZA 4W9EA 1D3ZA 1GPXA 4IOIE 2KWVB 4REZA 5IAAC 4B9KA 1CQVA 3W1YA 4HK2A 4ZYNA 2LEKA 2A4ZA 5HHDG 3IG3A 2DNFA 3Q3MC 1UELA 2L1AA 3PT2B 2N9PC 2NPTB 3WANA 3AU4A 2YLMA 5BYRA 5DPRA 4EKUA 2QDFA 1I4HA 1JWAD 1E7UA 4QAYA 2YEPF 4BBNC 2NBUA 2J0KA 3NVZA 3VFKA 3KUZA 1I4GA 1P98A 1YJIA 1Z2MA 2HD5B 2PEAA 3RULA 2KOXA 4ANUA 2ZW0A 3TSSA 3B1LX 3U8ZA 2UWQA 4LDTD 4HLEA 2KZRA 2N9XA 2KDBA 2DZMA 2Y5PA 1L7YA 2NBWB 1TS4A 2KX3A 4BKGA 1TGZB 1AYFA 5JHAA 2FUHB 3M63B 3Q8AA 2AL3A 3HVDA 2KT7A 4PYZA 2JVCA 4CHKA 2HTME 3EFCA 2EMTA 2D11A 2LRUA 2M1MA 3PRMB 4L23A 4K7WA 4M0WA 3M62B 1VLBA 2XK5A 4MGZE 2O2VA 2GB1A 2G4SA 2JU6X 3HK0A 3N9YC 3PRPB 2K1FA 3DBHI 1VJKA 3VH3B 2QEJC 4B0MA 3VAWA 3ZQ4A 1ZDXA 2C7MB 1P7EA 2ZNVC 2QIEB 3UGBB 1EWYC 2R2QA 1FPYA 2IO1B 2ZJDA 4KGSA 5FR6A 3AULA 3QX1A 4P1CC 3VTVA 3JSVB 5G5HA 3TEWA 4YSZB 3FAHA 1TZOA 1PQSA 4TKNA 2QSDA 4KX6B 2ZVOA 4L1BA 4IM0A 1IBXA 1UD7A 1J7BA 3QQ8B 4PK1A 2J0JA 2BBCA 2IJ0A 5D3DA 1C4CA 3U4EG 3KLSX 4ZRJA 5FR3A 2D3GA 4FBJB 1DOYA 2DHZA 3AM9A 3KYDD 3TUOA 2MLBA 1V9JA 1OEYA 4W9HA 4KGRA 2NPTA 3LXFA 3DVNV 2KQSA 2MP2B 1AWDA 1YOVB 1IGCA 3VDZA 1RYJA 1OGWA 5G2NA 1XT9B 3K9PB 3QC8B 2WXOA 2K22A 1UUPA 4K3BA 3MC8A 3ZXVA 3TMPB 2GLSA 3VTWA 4II3B 1WX9A 3Q6BA 3IT6B 4DWFA 3DWGC 1TTNA 2JX5A 2LI5A 3ZJVA 2KO3A 1FEHA 4ANXA 1PGAA 2HTHA 3MHSD 2GBRA 3DBRI 1T0YA 4J3OD 1KH0A 2PMVA 1F52A 5AZHA 1WRDB 4XDDA 4MM3B 1R4MI 4RCOA 3KUDB 3P1MA 4IG7B 4WWOA 3MFGA 1JMLA 1KLGD 4IM3A 2MRPA 3ZGZA 2V3PA 4OZCA 3DQVA 4JPSA 3H1UA 3PTFC 1VRAB 1OEYJ 1FD6A 3P4PB 1C77A 1HTOA 3BYTB 2ZEQA 4G0NB 2V1YA 3OWEB 4KSKC 1JALA 4G3XB 1WGRA 1QOAA 3MTNB 3PV1A 3ZNID 3VH4B 3JSVA 4DDID 1PGBA 2ZCCA 1YN5A 3NZSA 4C7ZA 4BKSA 2KJRA 3L4PA 3NZUA 5CHVC 3TEXA 2C60A 3ENEA 3FKYA 5HG2A 5KHQA 3VUYA 4YL8A 4BBNF 1WWTA 2BKRB 1QF6A 2BYFA 4HDQA 1C79A 3UIPB 1YQ4B 2FUG1 4HCPB 1AN8A 2FAZA 3Q3NC 4KGTA 1I7HA 2A5UA 4HKQA 2MP2A 3NVVA 2K8CA 1WXSA 2WS3B 3R3MA 4RGTA 2AQ1B 2KYWA 3AB5A 2WGSA 1CMXB 3U7ZA 2YVCA 2L83A 1TS5A 5LNK1 3MC9A 2CR5A 4GMVA 1E5WA 2FIDA 3O13A 1L0YB 4JWSC 1E7PB 3WIMA 2BS2B 1MFWA 4DDGD 1ISNA 4ZHOA 3E56A 4IKGA 1GG3A 3QHTA 3VR9B 2E6XA 3R2TA 2K0PA 5T8IA 5AZGA 3RNFC 2DYOA 3W5UB 2LMCA 3EC8A 3Q3OC 1WYGA 4W9FA 1C78A 2BS3B 2KDFB 2ZVNA 1TKGA 3BK2A 1ESFA 3R2IA 3DVNU 2MHJA 2QCZA 4E3CA 2M8SA 1WGHA 4F8CB 3RYTA 4MH8A 2G4DB 1H4RA 2WDQB 2IY0B 3ZDTA 1YN4A 1TKYA 2N0SB 3WAMA 2MBBB 2LGYA 2GBJA 1P0RA 3NHEB 1D4BA 1B1ZA 4N6EB 2RD0A 3KVFB 2JT4B 2JF5A 1X1MA 2E3TA 4XDCA 2G45B 3Q8BA 4ZRKA 1T0SC 4K81A 3AEDB 5IA7A 1QQRA 2FCMA 2MJEA 1PGXA 1JWMD 1YD8U 1TS3A 3P4RB 4B95A 4GOCA 3SFDB 4BOSC 2JWUA 1XLPA 2ZCBA 3DBSA 2IYDB 4ZRIA 2HJ1A 5J18A 2K25A 2WP9B 1C4AA 2ZNVB 2RGFA 4N9F4 3QJZA 2WXQA 2ZPNA 1WJ4A 1SJED 4DHJB 1DOIA 2J7QB 5CHWA 3DBLB 5DPSA 4AJWA 3CWIA 3PREA 2ZW1A 5C1ZA 4MT5A 2LUMA 1WYWB 4NJ7A 2PVGC 1TY0A 3I57A 2G9HD 2LGIA 2WHIA 1HZ5A 2O6VD 2KVRA 4WWMA 3GE3C 3U7DA 1UF0A 4OVZA 4RF1A 3T9LA 4BVUC 4A6QA 1J0GA 1ZW7A 3BINA 4LDTB 2J4XA 4MDKE 4JX1C 2XNAC 3H8HA 4A9AA 1H8CA 1L0XB 2L0TA 3OG5A 3UQAA 3L13A 4EEWA 1WZ3A 2K6QA 2W3RA 2KC2A 1VR9A 1L6VA 2KVZA 2N1VA 5IO9A 4C7YA 3ZYYX 2M56B 2CU3A 1EU4A 3AE8B 2JZ3B 5EDSA 1CK1A 5IP4D 4ASWC 1YNTE 1SE3A 1F9JA 1SIFA 5AUIA 3RNGC 2D10A 4YT0B 4XGAB 3PZ8A 3IT4B 1E8WA 1QOBA 2K39A 4MH0E 2RDHA 2Y5CA 3Q8CA 2VH1A 4N58A 2KN4A 2WLBA 1PFDA 4II2B 1JWUD 3Q8EA 3SR6A 4GIVA 4R3DA 1WX7A 2N1WA 1V97A 1UH6A 1WY8A 1C3TA 2KAJA 3QK0A 5I4DA 2L3ZA 3VRBB 3MJ5A 1MPEA 2INPE 3WAOA 2UU7A 5J2RA 1ET9A 4RM8A 1ZPSA 2W54A 1V1PB 3AE4B 2WXMA 4A8XC 4I6NB 2WU2B 5CX3A 2PPHA 1NI2A 1SF0A 2DZIA 1KFYB 5DPTA 4WH4A 2J42A 4DXFA 1WJNA 2WXFA 3A9KB 1EU3A 1AW7A 3ZLZA 1BMLC 4PT5A 3AE9B 2EKIA 4GU2A 1F2RI 3AEGB 4KIKB 2BW2A 2W55A 4ARIA 3ZUNA 4PS3A 3NS8A 3AXCA 2VH2A 1GB1A 3BWUD 5LLIA 2ON8A 2LJIA 4NAMA 1OQRA 3P2BA 2G1EA 2KANA 1V1OA 1BT0A 3WAPA 4BOZB 4AWJA 3N1XC 2N9LA 1YX5B 1J7CA 3HVZA 4OVVA 1WJ6A 1LM8B 4FLHA 3ZJUA 1FNWA 1FXIA 2IZVB 3AEAB 4LJOB 1C4PA 1WX8A 3HIZA 2SEBD 3AE1B 1FIQA 4A20A 5AUKA 1WXQA 4DHJD 5C23A 1UBIA 1DYQA 1WR6E 4H2AA 3ZDMC 3W1SC 3PHXB 1WE6A 4BAXA 4IC7B 2ONQA 2BWES 4ACFA 3R8BA 2HE7A 4NQLB 4XZ4A 1L5PA 3NVYA 3V05A 3DDCB 1STEA 2KQ7A 1KLUD 1SB3C 3H7SA 3EUB2 4A90A 4EUTA 1N61A 5BMIA 5EE9A 5H92C 3RMKC 4OHJA 3KW5B 3RFZB 3ZTDA 4G50A 3CIRB 3UI3A 1UWXA 2J53A 5E6PA 4HPMB 3JYUA 3IAM1 2IBIB 3CSFA 3T3NA 1ZDVA 3AU5A 1WM3A 5GMVA 3B2FA 3P4SB 3DHIC 2JXTA 3P42A 1TKEA 2JRIB 5D6JB 3Q3JA 4HJGE 1V1PA 1PDXA 5EE1A 4W9CA 3PGEA 3B2GA 2YEPB 3Q8FA 4JE3B 3CMMB 1V86A 3A9KA 3OAWA 1JRUA 2MSED 1TJEA 2AYOB 1XCQL 4OZBA 2MBHA 4AQ7A 3APFA 3SFEB 2WXRA 1SGHA 4KIKA 1S1QB 3UQBA 3N30A 1XD3B 2MW5A 2PE6B 1UWMA 4YTPB 1WH3A 3WCQA 4K7UA 4K3CA 2WYQA 5CHFA 1JW9D 3OJ4B 3RI7C 3RNAC 3GOEA 3IVFA 3IHPC 4ANVA 3MJWA 5JXVA 1SBBB 3AE2B 2Z0EB 3PRZA 4S17A 3TCAA 3ZXRA 2L05A 4LTUA 1E10A 1WE7A 1ZP0B 4IW0A 2K5PA 3I9V1 2L76A 2LVPA 4WIPA 3B08A 3LYYA 1LGRA 2ICIA 3GZNI 4B0EA 4A55A 3AE6B 3URYA 1UNSA 2JPHA 2INDC 3WA0A 4X57B 5BMGA 4KKIA 3ZJTA 4MEMA 3ZNGC 1RLFA 2R2OA 1VZ7A 1WGYA 1RFKA 1ZXHA 1V5TA 1XO3A 1C1YB 2IGDA 4NAWB 1XLNA 3QA8A 2DLBA 5C2TB 1HQRD 1E0ZA 2I2YA 2X38A 1LXDA 1L6UA 4E74A 1YJ1A 1GNUA 3PHWB 1Q0WB 1R4NB 3C0RB 3FC4A 3Q69A 2KJ6A 1ZUD2 4AUQC 2KTFA 4NZLB 4RH6A 3BZDB 1M94A 2NMQA 4NJCA 3ZVVA 3GS2A 2M4NA 1HA5A
chains in the Genus database with same CATH topology
3ML9A 2IO0B 3WAMA 3VVWB 2MBBB 2LVOA 3ZO5B 1E90A 2DAFA 2LGYA 4DBGA 2GBJA 2KTRA 1P0RA 3KYCD 4WWPA 3V6CB 4URKA 2LGXA 1P9DU 1V80A 3RCZA 2DZJA 1RRBA 2DAJA 4MGIE 1WGDA 5DPWA 3L08A 3OLMD 4HWIB 3DPDA 3NHEB 3ZW3A 4HPLB 4K1RB 4MGYE 3PLUA 5JHBA 4PS8A 4WJOA 2KC1A 2N9EB 2JZZA 2RD0A 2ZZPB 1VD2A 3KVFB 4M0WB 2XK5B 3K9OB 2JT4B 2JF5A 3QCAA 1X1MA 2O2VB 1R4NI 4GXBA 1WZ0A 4TQ0A 2M0XA 2G45B 3ZKJC 1V81A 2GBKA 3R66C 4ZRKA 4K81A 2OOBB 2HJ8A 4W9KA 5IA7A 1GC7A 3CF6E 2EMSA 2FCMA 2DZKA 3EECA 3H9DA 2MX2A 2IY1B 1YD8U 1U4AA 2O6VB 2LUEA 3SDLC 4B95A 4GOCA 4BOSC 2KHWB 2MBOA 3SU8X 2ZCBA 1TBEA 3V60A 2CHWA 1EF1A 1TZ1A 1NDDA 4CO7A 1WXAA 3DBSA 1MG8A 2IYDB 2LVQA 4TV3A 4ZRIA 5J18A 2K25A 4M8MA 1UBQA 4NPNA 2ZNVB 2B3AA 4IUMB 2RGFA 4N9F4 3QJZA 2REXA 2I1JA 4DHJB 1UZXB 1WJ4A 2CHXA 2ZPNA 3HM6X 4EFOA 3R7QA 1Q1OA 3DOWA 1J19A 2FNJB 4EZLA 5AEKB 1RFAA 2J7QB 3IBEA 2C9WB 4W9JA 5CHWA 3RT3B 1NBFC 4FHKA 2LRWA 5DPSA 4AJWA 1P1AA 2KKCA 3PREA 5C1ZA 3BY4B 1WYWB 3QARA 4NJ7A 2DYMA 2V3SA 3PLVA 2JUOA 4I6LB 3KUCB 3A9JA 3JVZX 5L95C 2WWZA 5JH5C 4W9EA 1D3ZA 4MGKE 2O6VD 4WJQA 2KVRA 4WQOB 4XX5A 2KWVB 3U7DA 5IAAC 3T9LA 4B9KA 1Z5SB 3ML8A 2PJHA 3W1YA 1E8XA 4HK2A 4ZYNA 4BVUC 1J8CA 2A4ZA 1J0GA 1ZW7A 3BINA 4LDTB 2C5LC 4NNJB 4MDKE 3IG3A 2OJRA 2AWTA 3ZNZB 4FULA 1UELA 4WAAA 3PT2B 2N9PC 2NPTB 3WANA 3AU4A 2YLMA 1H8CA 2L0TA 2CS4A 2L8JA 3L17A 3UQAA 3L13A 3QWZB 3DBLI 5DPRA 4EKUA 4EEWA 1WZ3A 1WXMA 2K6QA 1E7UA 1OQYA 2KC2A 3DVGY 4BBNC 1GUAB 2J0MA 2N1VA 2MQJA 2NBUA 2GBMA 2J0KA 3VFKA 3HHMA 3ZTCA 3CSTA 3ECIA 3I3TB 3KUZA 1P98A 3DCGA 4NAWA 2ZPYA 1Z2MA 2HD5B 2BWFA 2L7RA 2PEAA 3RULA 2K6DB 2KOXA 4ANUA 4FJYA 2K8HA 4KVGB 2UYZB 5J17A 4GN1A 2JZ3B 5EDSA 4ASWC 3B1LX 1A5RA 3M3JA 1F9JA 3U8ZA 1SIFA 1P3QU 1ZGUB 2UWQA 4LDTD 4HLEA 2KZRA 2N9XA 4DHZE 4FHJA 2D10A 2C7HA 2KDBA 2DZMA 2LXCA 1L7YA 2LD9A 2NBWB 2KX3A 1E8WA 1TGZB 4BKGA 2K39A 5JHAA 2FUHB 4HDOA 3M63B 4MH0E 2AL3A 2MWSB 2DYBA 3TIXA 4PYZA 2N7EA 2JVCA 3L10B 4CHKA 4II2B 3VUWA 2EMTA 2D11A 4GIVA 1WX7A 2N1WA 4J6IA 2CU1A 2LRUA 1KLVA 2M1MA 4DXAB 3PRMB 2KMCA 1UH6A 1WY8A 4K7WA 2NBVB 1C3TA 3QK0A 3M62B 2L3ZA 3X23A 2XK5A 1IYFA 2KLCA 4MGZE 2O2VA 2KXJA 5TR5A 1KM7A 2G4SA 3HK0A 3PRPB 2K1FA 4KDIC 4EZJA 3WAOA 1FXTB 5J2RA 4RM8A 2XBBC 3DBHI 2RPQA 3VH3B 1IP9A 1WGGA 3AI5A 2L0FA 1Y8RC 2FCQA 3VAWA 4A3PA 1EO6A 3NY5A 2VRRB 2O6VA 2N4FA 4I6NB 4W9IA 2C7MB 5CX3A 2ZNVC 2PPHA 3UGBB 1NI2A 4WJPA 2R2QA 5E6OA 5CTRC 2IO1B 3A1QB 5E6NA 2DZIA 1QZEA 2ZJDA 4LCDE 4F1SA 4IWOA 5FR6A 4BFRA 5DPTA 5LXHA 2CHZA 2LWPA 3AULA 2JWZA 1WJNA 3A9KB 4B6WA 4BKTA 4AOFA 3JW0X 3QX1A 3ZLZA 2Y5BB 3VTVA 2K8BA 3JSVB 1V49A 2D07B 1K8RB 4GU2A 4GB9A 4AJYB 4KIKB 1E7VA 2C7NB 3ZUNA 4PS3A 3PVLA 3NS8A 1PQSA 4XC2A 4TKNA 3O65B 2AEHA 4WWNA 3AXCA 1YX6B 2KWCA 2ZVOA 4IM0A 1UD7A 5LLIA 3QQ8B 5JZEB 4KV2A 2BPSA 2KJHB 2J0JA 3P2BA 2KANA 2LJ5A 3NOBA 5BO4B 1BT0A 3WAPA 4ZRJA 3V62A 3RUIB 2D3GA 4AWJA 4BOZB 4W9DA 4FBJB 4ANWA 4PS7A 1YX5B 3L0WB 3PZDA 2FCSA 4JIOU 4OVVA 1WJ6A 2DHZA 3KYDD 3U30A 1LM8B 4E71A 4FLHA 1WMHB 2MLBA 2IZVB 4W9GA 1V9JA 1OEYA 1IPGA 1E8YA 2AL6A 4LJOB 4W9HA 1LFDA 2NPTA 3ZRCA 4RM9A 2KDEB 2MBEA 1WX8A 3PS6A 2KK8A 2WX1A 3HIZA 2KD0A 2KFKB 2KQSA 1V5OA 2MP2B 3DVNV 4A20A 4FJZA 4FADA 3VDZA 1HE8A 3D32A 5C23A 1OGWA 4DHJD 2L00B 5G2NA 1UBIA 1XT9B 3N3KB 4BKSD 1WR6E 3K9PB 3QC8B 4TQ1A 3ZDMC 3W1SC 1I42A 3PHXB 2LZ6A 2XEWA 3SHQA 1WE6A 4GSWA 3TBLD 1XQQA 2GOWA 4IC7B 5D2MB 4LJPB 4KSLC 2KDIA 3TMPB 3VTWA 2BWES 1GJZA 4FN2A 4II3B 2HE7A 2FIFA 1WX9A 4NQLB 2QHOA 4XZ4A 4HXDA 2KN5A 4DWFA 5G55A 3DDCB 3VHTC 2MBQA 2KQ7A 1TTNA 2KNBA 2LI5A 2KO3A 4GDKA 4ANXA 3IFWB 2HTHA 4GDKB 3MHSD 3APDA 3H7SA 4EUTA 2GBRA 3DBRI 2MCNB 3TJPA 4KZCA 1T0YA 3WALA 4MM3A 2EKEC 4NQKE 5AZHA 1WRDB 4AP4C 1RAXA 2KX0A 1R4MI 2KWUB 3KW5B 3V61A 3ZTDA 3KUDB 4IG7B 1L2NA 4WWOA 4G50A 4GDLB 4JGHB 1ZKHA 5E6PA 5AZFA 4HPMB 3N32A 3JYUA 2IBIB 3CSFA 4IM3A 1YIWA 4FA6A 2MRPA 3AU5A 1WM3A 2NR2A 2Z59B 3DQVA 5GMVA 3H7PB 3R7RA 3DVGX 1UGMA 3UF8A 3ZIMA 2JY6A 2BYVE 3ZNHB 2KLGA 3H1UA 1WFYA 3PTFC 4IWQA 4NY0A 1OEYJ 4DK5A 2JRIB 5KHOA 4FJVB 1I35A 5D6JB 2ZEQA 1KJTA 3Q3JA 3SD5A 1WF9A 3APCA 4G0NB 2GBNA 2V1YA 2I1KA 3A33B 3PGEA 4W9CA 4KSKC 2KTRB 3PPAA 4G3XB 4CYEA 1WGRA 4MELA 3A1QA 4PYUA 3CMMB 4G11A 1V2YA 3MTNB 2GMIC 1WJUA 3PV1A 1V86A 4KDLB 3A9KA 3OAWA 1JRUA 2MSED 2BKFA 2AYOB 1WIAA 3ZNID 2NS5A 3VH4B 1AARA 2W9NA 3JSVA 2MBHA 3LDZE 4DDID 4K7SA 2ZCCA 3APFA 4IWPA 1SGHA 3QIJA 4KIKA 5D7GA 3NZSA 1S1QB 3UQBA 4BKSA 1Q5WB 2KJRA 3L54A 3N30A 4JQWC 2MA9B 3NZUA 1SE9A 1XD3B 2NVUI 2MW5A 2PE6B 5CHVC 4F7ZA 2C60A 4JL9A 3ENEA 2DX5B 4OVUA 4DHZB 2D2QA 4HJKA 3ZRFA 1WH3A 4HCNB 2JRHA 2V4LA 2WDTB 1LQBA 4K7UA 5KHQA 3VUYA 3T8MA 2CKHB 4YL8A 4BBNF 2WYQA 5CHFA 2BKRB 2LGDA 2BYFA 3OJ4B 4HDQA 3UIPB 3UINB 3M95A 3GOEA 1WMHA 4HCPB 3IVFA 5L83A 2G3QB 2FAZA 3IHPC 3VTUA 4ANVA 3MJWA 2A5UA 2Z0EB 3PRZA 1WR1A 4NJ6A 2KFKA 2MP2A 2JXXA 2RR9A 3TCAA 2L05A 5D94A 3H6NA 2K8CA 4EOYA 1WE7A 1WXSA 2LASA 3R3MA 1V6EA 1WM2A 4IW0A 2NCNA 1EF5A 2LXAA 2RSUA 2L76A 2IO2B 3EFUA 3LJ3A 4KZ0A 1CMXB 2LVPA 1WI0A 3VQIA 2ASQA 2YVCA 3A9JB 3B08A 4GGQA 1VCBA 4GMVA 2CR5A 1E5WA 2FIDA 2BYEA 3GZNI 3HM3A 3A4RA 4W9LA 2Z0DB 3W1SA 3WIMA 4ICUA 4DDGD 1ISNA 3S2AA 2JPHA 3L16A 3TL5A 4EZKA 3RZWC 2BF8B 3KH0A 3WA0A 4ICVA 4MSMB 4I6PA 4X57B 1KOTA 1GC6A 1GG3A 5LXIB 4MEMA 3QHTA 3Q3FA 3RD2A 1WXVA 3ZNGC 5HKHA 1RLFA 2R2OA 1S3SG 2WX0A 4MSQB 4WJNA 4MJSA 3RZFA 1WGYA 4TUUA 2FCNA 3B0AA 4M8NA 1EUVB 3V6EB 4MJSB 1V5TA 4P7IA 5AZGA 2BGFA 4ZDVA 3QAQA 2KFJA 2DYOA 3UIOB 1C1YB 4NAWB 3EC8A 3QA8A 4A3OA 4GDLA 4W9FA 2IO3B 2KDFB 2ZVNA 4HVBA 3ONSA 2N7DA 3A4SC 3OJ3A 1OTRB 2KMAA 4IM2A 4RMAA 3ALBA 1LXDA 3DVNU 4E74A 3H7PA 3VXWA 1YJ1A 1YQBA 2PE9A 2DENB 1E8ZA 1GNUA 3PHWB 4JLCA 5DCNA 1Q0WB 1WGHA 2M8SA 4E3CA 3C0RB 4F8CB 3RYTA 3X0WA 2KJ6A 4AUQC 2KTFA 3PSEB 2G4DB 1H4RA 3EHVA 2IY0B 2M17A 1M94A 3ZDTA 3ZVVA 2M4NA 1G6JA 3VUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML9 A;  2IO0 B;  3WAM A;  3VVW B;  2MBB B;  2LVO A;  3ZO5 B;  1E90 A;  2DAF A;  2LGY A;  4DBG A;  2GBJ A;  2KTR A;  1P0R A;  3KYC D;  4WWP A;  3V6C B;  4URK A;  2LGX A;  1P9D U;  1V80 A;  3RCZ A;  2DZJ A;  1RRB A;  2DAJ A;  4MGI E;  1WGD A;  5DPW A;  3L08 A;  3OLM D;  4HWI B;  3DPD A;  3NHE B;  3ZW3 A;  4HPL B;  4K1R B;  4MGY E;  3PLU A;  5JHB A;  4PS8 A;  4WJO A;  2KC1 A;  2N9E B;  2JZZ A;  2RD0 A;  2ZZP B;  1VD2 A;  3KVF B;  4M0W B;  2XK5 B;  3K9O B;  2JT4 B;  2JF5 A;  3QCA A;  1X1M A;  2O2V B;  1R4N I;  4GXB A;  1WZ0 A;  4TQ0 A;  2M0X A;  2G45 B;  3ZKJ C;  1V81 A;  2GBK A;  3R66 C;  4ZRK A;  4K81 A;  2OOB B;  2HJ8 A;  4W9K A;  5IA7 A;  1GC7 A;  3CF6 E;  2EMS A;  2FCM A;  2DZK A;  3EEC A;  3H9D A;  2MX2 A;  2IY1 B;  1YD8 U;  1U4A A;  2O6V B;  2LUE A;  3SDL C;  4B95 A;  4GOC A;  4BOS C;  2KHW B;  2MBO A;  3SU8 X;  2ZCB A;  1TBE A;  3V60 A;  2CHW A;  1EF1 A;  1TZ1 A;  1NDD A;  4CO7 A;  1WXA A;  3DBS A;  1MG8 A;  2IYD B;  2LVQ A;  4TV3 A;  4ZRI A;  5J18 A;  2K25 A;  4M8M A;  1UBQ A;  4NPN A;  2ZNV B;  2B3A A;  4IUM B;  2RGF A;  4N9F 4;  3QJZ A;  2REX A;  2I1J A;  4DHJ B;  1UZX B;  1WJ4 A;  2CHX A;  2ZPN A;  3HM6 X;  4EFO A;  3R7Q A;  1Q1O A;  3DOW A;  1J19 A;  2FNJ B;  4EZL A;  5AEK B;  1RFA A;  2J7Q B;  3IBE A;  2C9W B;  4W9J A;  5CHW A;  3RT3 B;  1NBF C;  4FHK A;  2LRW A;  5DPS A;  4AJW A;  1P1A A;  2KKC A;  3PRE A;  5C1Z A;  3BY4 B;  1WYW B;  3QAR A;  4NJ7 A;  2DYM A;  2V3S A;  3PLV A;  2JUO A;  4I6L B;  3KUC B;  3A9J A;  3JVZ X;  5L95 C;  2WWZ A;  5JH5 C;  4W9E A;  1D3Z A;  4MGK E;  2O6V D;  4WJQ A;  2KVR A;  4WQO B;  4XX5 A;  2KWV B;  3U7D A;  5IAA C;  3T9L A;  4B9K A;  1Z5S B;  3ML8 A;  2PJH A;  3W1Y A;  1E8X A;  4HK2 A;  4ZYN A;  4BVU C;  1J8C A;  2A4Z A;  1J0G A;  1ZW7 A;  3BIN A;  4LDT B;  2C5L C;  4NNJ B;  4MDK E;  3IG3 A;  2OJR A;  2AWT A;  3ZNZ B;  4FUL A;  1UEL A;  4WAA A;  3PT2 B;  2N9P C;  2NPT B;  3WAN A;  3AU4 A;  2YLM A;  1H8C A;  2L0T A;  2CS4 A;  2L8J A;  3L17 A;  3UQA A;  3L13 A;  3QWZ B;  3DBL I;  5DPR A;  4EKU A;  4EEW A;  1WZ3 A;  1WXM A;  2K6Q A;  1E7U A;  1OQY A;  2KC2 A;  3DVG Y;  4BBN C;  1GUA B;  2J0M A;  2N1V A;  2MQJ A;  2NBU A;  2GBM A;  2J0K A;  3VFK A;  3HHM A;  3ZTC A;  3CST A;  3ECI A;  3I3T B;  3KUZ A;  1P98 A;  3DCG A;  4NAW A;  2ZPY A;  1Z2M A;  2HD5 B;  2BWF A;  2L7R A;  2PEA A;  3RUL A;  2K6D B;  2KOX A;  4ANU A;  4FJY A;  2K8H A;  4KVG B;  2UYZ B;  5J17 A;  4GN1 A;  2JZ3 B;  5EDS A;  4ASW C;  3B1L X;  1A5R A;  3M3J A;  1F9J A;  3U8Z A;  1SIF A;  1P3Q U;  1ZGU B;  2UWQ A;  4LDT D;  4HLE A;  2KZR A;  2N9X A;  4DHZ E;  4FHJ A;  2D10 A;  2C7H A;  2KDB A;  2DZM A;  2LXC A;  1L7Y A;  2LD9 A;  2NBW B;  2KX3 A;  1E8W A;  1TGZ B;  4BKG A;  2K39 A;  5JHA A;  2FUH B;  4HDO A;  3M63 B;  4MH0 E;  2AL3 A;  2MWS B;  2DYB A;  3TIX A;  4PYZ A;  2N7E A;  2JVC A;  3L10 B;  4CHK A;  4II2 B;  3VUW A;  2EMT A;  2D11 A;  4GIV A;  1WX7 A;  2N1W A;  4J6I A;  2CU1 A;  2LRU A;  1KLV A;  2M1M A;  4DXA B;  3PRM B;  2KMC A;  1UH6 A;  1WY8 A;  4K7W A;  2NBV B;  1C3T A;  3QK0 A;  3M62 B;  2L3Z A;  3X23 A;  2XK5 A;  1IYF A;  2KLC A;  4MGZ E;  2O2V A;  2KXJ A;  5TR5 A;  1KM7 A;  2G4S A;  3HK0 A;  3PRP B;  2K1F A;  4KDI C;  4EZJ A;  3WAO A;  1FXT B;  5J2R A;  4RM8 A;  2XBB C;  3DBH I;  2RPQ A;  3VH3 B;  1IP9 A;  1WGG A;  3AI5 A;  2L0F A;  1Y8R C;  2FCQ A;  3VAW A;  4A3P A;  1EO6 A;  3NY5 A;  2VRR B;  2O6V A;  2N4F A;  4I6N B;  4W9I A;  2C7M B;  5CX3 A;  2ZNV C;  2PPH A;  3UGB B;  1NI2 A;  4WJP A;  2R2Q A;  5E6O A;  5CTR C;  2IO1 B;  3A1Q B;  5E6N A;  2DZI A;  1QZE A;  2ZJD A;  4LCD E;  4F1S A;  4IWO A;  5FR6 A;  4BFR A;  5DPT A;  5LXH A;  2CHZ A;  2LWP A;  3AUL A;  2JWZ A;  1WJN A;  3A9K B;  4B6W A;  4BKT A;  4AOF A;  3JW0 X;  3QX1 A;  3ZLZ A;  2Y5B B;  3VTV A;  2K8B A;  3JSV B;  1V49 A;  2D07 B;  1K8R B;  4GU2 A;  4GB9 A;  4AJY B;  4KIK B;  1E7V A;  2C7N B;  3ZUN A;  4PS3 A;  3PVL A;  3NS8 A;  1PQS A;  4XC2 A;  4TKN A;  3O65 B;  2AEH A;  4WWN A;  3AXC A;  1YX6 B;  2KWC A;  2ZVO A;  4IM0 A;  1UD7 A;  5LLI A;  3QQ8 B;  5JZE B;  4KV2 A;  2BPS A;  2KJH B;  2J0J A;  3P2B A;  2KAN A;  2LJ5 A;  3NOB A;  5BO4 B;  1BT0 A;  3WAP A;  4ZRJ A;  3V62 A;  3RUI B;  2D3G A;  4AWJ A;  4BOZ B;  4W9D A;  4FBJ B;  4ANW A;  4PS7 A;  1YX5 B;  3L0W B;  3PZD A;  2FCS A;  4JIO U;  4OVV A;  1WJ6 A;  2DHZ A;  3KYD D;  3U30 A;  1LM8 B;  4E71 A;  4FLH A;  1WMH B;  2MLB A;  2IZV B;  4W9G A;  1V9J A;  1OEY A;  1IPG A;  1E8Y A;  2AL6 A;  4LJO B;  4W9H A;  1LFD A;  2NPT A;  3ZRC A;  4RM9 A;  2KDE B;  2MBE A;  1WX8 A;  3PS6 A;  2KK8 A;  2WX1 A;  3HIZ A;  2KD0 A;  2KFK B;  2KQS A;  1V5O A;  2MP2 B;  3DVN V;  4A20 A;  4FJZ A;  4FAD A;  3VDZ A;  1HE8 A;  3D32 A;  5C23 A;  1OGW A;  4DHJ D;  2L00 B;  5G2N A;  1UBI A;  1XT9 B;  3N3K B;  4BKS D;  1WR6 E;  3K9P B;  3QC8 B;  4TQ1 A;  3ZDM C;  3W1S C;  1I42 A;  3PHX B;  2LZ6 A;  2XEW A;  3SHQ A;  1WE6 A;  4GSW A;  3TBL D;  1XQQ A;  2GOW A;  4IC7 B;  5D2M B;  4LJP B;  4KSL C;  2KDI A;  3TMP B;  3VTW A;  2BWE S;  1GJZ A;  4FN2 A;  4II3 B;  2HE7 A;  2FIF A;  1WX9 A;  4NQL B;  2QHO A;  4XZ4 A;  4HXD A;  2KN5 A;  4DWF A;  5G55 A;  3DDC B;  3VHT C;  2MBQ A;  2KQ7 A;  1TTN A;  2KNB A;  2LI5 A;  2KO3 A;  4GDK A;  4ANX A;  3IFW B;  2HTH A;  4GDK B;  3MHS D;  3APD A;  3H7S A;  4EUT A;  2GBR A;  3DBR I;  2MCN B;  3TJP A;  4KZC A;  1T0Y A;  3WAL A;  4MM3 A;  2EKE C;  4NQK E;  5AZH A;  1WRD B;  4AP4 C;  1RAX A;  2KX0 A;  1R4M I;  2KWU B;  3KW5 B;  3V61 A;  3ZTD A;  3KUD B;  4IG7 B;  1L2N A;  4WWO A;  4G50 A;  4GDL B;  4JGH B;  1ZKH A;  5E6P A;  5AZF A;  4HPM B;  3N32 A;  3JYU A;  2IBI B;  3CSF A;  4IM3 A;  1YIW A;  4FA6 A;  2MRP A;  3AU5 A;  1WM3 A;  2NR2 A;  2Z59 B;  3DQV A;  5GMV A;  3H7P B;  3R7R A;  3DVG X;  1UGM A;  3UF8 A;  3ZIM A;  2JY6 A;  2BYV E;  3ZNH B;  2KLG A;  3H1U A;  1WFY A;  3PTF C;  4IWQ A;  4NY0 A;  1OEY J;  4DK5 A;  2JRI B;  5KHO A;  4FJV B;  1I35 A;  5D6J B;  2ZEQ A;  1KJT A;  3Q3J A;  3SD5 A;  1WF9 A;  3APC A;  4G0N B;  2GBN A;  2V1Y A;  2I1K A;  3A33 B;  3PGE A;  4W9C A;  4KSK C;  2KTR B;  3PPA A;  4G3X B;  4CYE A;  1WGR A;  4MEL A;  3A1Q A;  4PYU A;  3CMM B;  4G11 A;  1V2Y A;  3MTN B;  2GMI C;  1WJU A;  3PV1 A;  1V86 A;  4KDL B;  3A9K A;  3OAW A;  1JRU A;  2MSE D;  2BKF A;  2AYO B;  1WIA A;  3ZNI D;  2NS5 A;  3VH4 B;  1AAR A;  2W9N A;  3JSV A;  2MBH A;  3LDZ E;  4DDI D;  4K7S A;  2ZCC A;  3APF A;  4IWP A;  1SGH A;  3QIJ A;  4KIK A;  5D7G A;  3NZS A;  1S1Q B;  3UQB A;  4BKS A;  1Q5W B;  2KJR A;  3L54 A;  3N30 A;  4JQW C;  2MA9 B;  3NZU A;  1SE9 A;  1XD3 B;  2NVU I;  2MW5 A;  2PE6 B;  5CHV C;  4F7Z A;  2C60 A;  4JL9 A;  3ENE A;  2DX5 B;  4OVU A;  4DHZ B;  2D2Q A;  4HJK A;  3ZRF A;  1WH3 A;  4HCN B;  2JRH A;  2V4L A;  2WDT B;  1LQB A;  4K7U A;  5KHQ A;  3VUY A;  3T8M A;  2CKH B;  4YL8 A;  4BBN F;  2WYQ A;  5CHF A;  2BKR B;  2LGD A;  2BYF A;  3OJ4 B;  4HDQ A;  3UIP B;  3UIN B;  3M95 A;  3GOE A;  1WMH A;  4HCP B;  3IVF A;  5L83 A;  2G3Q B;  2FAZ A;  3IHP C;  3VTU A;  4ANV A;  3MJW A;  2A5U A;  2Z0E B;  3PRZ A;  1WR1 A;  4NJ6 A;  2KFK A;  2MP2 A;  2JXX A;  2RR9 A;  3TCA A;  2L05 A;  5D94 A;  3H6N A;  2K8C A;  4EOY A;  1WE7 A;  1WXS A;  2LAS A;  3R3M A;  1V6E A;  1WM2 A;  4IW0 A;  2NCN A;  1EF5 A;  2LXA A;  2RSU A;  2L76 A;  2IO2 B;  3EFU A;  3LJ3 A;  4KZ0 A;  1CMX B;  2LVP A;  1WI0 A;  3VQI A;  2ASQ A;  2YVC A;  3A9J B;  3B08 A;  4GGQ A;  1VCB A;  4GMV A;  2CR5 A;  1E5W A;  2FID A;  2BYE A;  3GZN I;  3HM3 A;  3A4R A;  4W9L A;  2Z0D B;  3W1S A;  3WIM A;  4ICU A;  4DDG D;  1ISN A;  3S2A A;  2JPH A;  3L16 A;  3TL5 A;  4EZK A;  3RZW C;  2BF8 B;  3KH0 A;  3WA0 A;  4ICV A;  4MSM B;  4I6P A;  4X57 B;  1KOT A;  1GC6 A;  1GG3 A;  5LXI B;  4MEM A;  3QHT A;  3Q3F A;  3RD2 A;  1WXV A;  3ZNG C;  5HKH A;  1RLF A;  2R2O A;  1S3S G;  2WX0 A;  4MSQ B;  4WJN A;  4MJS A;  3RZF A;  1WGY A;  4TUU A;  2FCN A;  3B0A A;  4M8N A;  1EUV B;  3V6E B;  4MJS B;  1V5T A;  4P7I A;  5AZG A;  2BGF A;  4ZDV A;  3QAQ A;  2KFJ A;  2DYO A;  3UIO B;  1C1Y B;  4NAW B;  3EC8 A;  3QA8 A;  4A3O A;  4GDL A;  4W9F A;  2IO3 B;  2KDF B;  2ZVN A;  4HVB A;  3ONS A;  2N7D A;  3A4S C;  3OJ3 A;  1OTR B;  2KMA A;  4IM2 A;  4RMA A;  3ALB A;  1LXD A;  3DVN U;  4E74 A;  3H7P A;  3VXW A;  1YJ1 A;  1YQB A;  2PE9 A;  2DEN B;  1E8Z A;  1GNU A;  3PHW B;  4JLC A;  5DCN A;  1Q0W B;  1WGH A;  2M8S A;  4E3C A;  3C0R B;  4F8C B;  3RYT A;  3X0W A;  2KJ6 A;  4AUQ C;  2KTF A;  3PSE B;  2G4D B;  1H4R A;  3EHV A;  2IY0 B;  2M17 A;  1M94 A;  3ZDT A;  3ZVV A;  2M4N A;  1G6J A;  3VUX A; 
#chains in the Genus database with same CATH topology
 2IO0 B;  2INN E;  2LVO A;  2DWQ A;  2DAF A;  5TSS A;  3BYY B;  4URK A;  1P9D U;  4HRS A;  1RRB A;  4HRO A;  1HXY D;  3DPD A;  4HPL B;  4K1R B;  3BVG A;  2QC8 A;  4MGY E;  4WJO A;  2KC1 A;  3BK1 A;  2JZZ A;  1VD2 A;  4TQ0 A;  4XE0 A;  3B9J A;  2M0X A;  4P6V F;  3ZKJ C;  3R66 C;  2KDM A;  2OOB B;  4BZA A;  4W9K A;  4YWG G;  3CF6 E;  2DZK A;  1NEN B;  2IY1 B;  2O6V B;  1L4D B;  5FK9 C;  1YN3 A;  2MBO A;  1BXT A;  3N20 C;  1TBE A;  1NDD A;  1MG8 A;  1JWS D;  2B3A A;  2N9K A;  4IUM B;  2Q5W D;  1UZX B;  3C8Y A;  3HRD D;  4ZYS A;  4EFO A;  3R7Q A;  1Q1O A;  3DOW A;  1K53 A;  1J19 A;  2FNJ B;  4ZRQ A;  1K52 A;  1RFA A;  3IBE A;  2C9W B;  3RT3 B;  2M0A A;  4LNN A;  1XXG A;  3BY4 B;  2DYM A;  2JUO A;  4OW0 A;  3JVZ X;  1E6E B;  5L95 C;  5JH5 C;  4WJQ A;  4XX5 A;  5BYQ A;  1Z5S B;  1IGD A;  4NNJ B;  1SJH D;  3ZNZ B;  4WAA A;  2CS4 A;  3L17 A;  1FXA A;  3QWZ B;  1WXM A;  1GUA B;  2J0M A;  3GB1 A;  2MQJ A;  4LNI A;  3SEB A;  1T0R C;  3CST A;  3ECI A;  4NAW A;  3DCG A;  2BWF A;  2L7R A;  2K6D B;  2BQQ A;  2JYT A;  4KVG B;  2JZP A;  5J17 A;  4GN1 A;  1P3Q U;  1DGJ A;  4FHJ A;  4WAF A;  5HI1 A;  2Y3A A;  3AEC B;  3NVW A;  3DBH B;  4YTN B;  4C56 C;  1VZ6 A;  4HDO A;  3RNB C;  2AQ3 B;  3L10 B;  2VZK B;  1ACC A;  3RPF C;  2FE8 A;  3AEF B;  4J6I A;  1F0Z A;  2KMC A;  4O1N A;  1PUT A;  1BUI C;  1IYF A;  2WXG A;  5TR5 A;  4KDI C;  4EZJ A;  3ABV B;  1FXT B;  1NI3 A;  3AMZ A;  1SEB D;  2RPQ A;  1WGG A;  3AI5 A;  2L0F A;  1Y8R C;  1ZOY B;  1EO6 A;  3NY5 A;  2VRR B;  2O6V A;  3NJT A;  1SSN A;  4WJP A;  5CTR C;  5E6N A;  1TIF A;  2NTS A;  5LXH A;  2CHZ A;  2JWZ A;  3JW0 X;  1HTQ A;  3VR8 B;  2Y5B B;  2K8B A;  2D07 B;  4AJY B;  4GB9 A;  2C7N B;  1L0V B;  1K50 A;  1QT9 A;  4XC2 A;  2WXI A;  2AEH A;  3O65 B;  4WWN A;  1YX6 B;  3BII D;  3P63 A;  2BYT A;  2BPS A;  2BT6 A;  3MC0 B;  4JWU C;  2KJH B;  2LJ5 A;  5BO4 B;  5H8Y E;  3RUI B;  1N62 A;  4W9D A;  4ANW A;  5GXG B;  1Q10 A;  4E71 A;  1WMH B;  2V3N A;  1E9M A;  3MHZ A;  2MBE A;  2KK8 A;  1OFF A;  1V5O A;  2D3B A;  1MHX A;  2D5G A;  1OQQ A;  3DBR B;  3NRZ A;  3N3K B;  4TQ1 A;  2LZ6 A;  2XEW A;  4GSW A;  3TBL D;  1R4M B;  5MPO A;  4KSL C;  4HKZ E;  2KQ4 X;  1GJZ A;  2L52 A;  4FN2 A;  2FIF A;  2OHF A;  5G55 A;  1FNU A;  3VHT C;  1CZP A;  4GDK A;  2BVC A;  1N5X A;  3APD A;  3U2S C;  3WAL A;  3TEY A;  2EKE C;  4AP4 C;  5FKA C;  3V61 A;  4P1B C;  5AZF A;  1IUE A;  3N32 A;  4XWW A;  1F2R C;  3V3X A;  4FA6 A;  3T3O A;  1ZE3 D;  2QMT A;  3DVG X;  1UGM A;  3UF8 A;  2BYV E;  5G5G A;  4IWQ A;  1WFY A;  4NY0 A;  4DK5 A;  5KHO A;  4YTM B;  4ZHP A;  4FJV B;  3MP9 A;  3NZ3 A;  1K51 A;  2GBN A;  3A33 B;  1SE4 A;  3NS1 A;  2KTR B;  1T5X D;  4LNO A;  2BB5 A;  2X8X X;  4G11 A;  1V2Y A;  1WJU A;  2VZK D;  1WIA A;  2NS5 A;  2W9N A;  3LDZ E;  4M02 A;  4K7S A;  1XEE A;  2IGH A;  5D7G A;  3GP7 A;  2WQY B;  3PO0 A;  1FO4 A;  2MA9 B;  1SE9 A;  4F7Z A;  5E6J A;  1ZXI A;  4LNK A;  2DX5 B;  4OVU A;  4DHZ B;  4HJK A;  4HCN B;  3PZ7 A;  4C4V B;  2V4L A;  2WDT B;  1LQB A;  2KWD A;  2CKH B;  2J52 A;  1WMH A;  3KWL A;  5L83 A;  1SE2 A;  2G3Q B;  1UGJ A;  3VTU A;  2LGS A;  2R61 A;  4EOY A;  2LAS A;  1V6E A;  2NCN A;  1EF5 A;  1F77 A;  2IO2 B;  3EFU A;  3LJ3 A;  4KZ0 A;  4CQN A;  2BTE A;  1XF5 L;  3VQI A;  2ASQ A;  3A9J B;  4L2Y A;  1NVI D;  1N6Z A;  1EWC A;  3HM3 A;  1WRI A;  3A4R A;  4W9L A;  2Z0D B;  3AEE B;  1LO5 D;  3L16 A;  3AV8 A;  3TL5 A;  4EZK A;  3RZW C;  1N5W A;  2BF8 B;  3ETR A;  4MSM B;  4I6P A;  1GC6 A;  4FXC A;  5LXI B;  1I4P A;  2KMM A;  3Q3F A;  1XLQ A;  3TEZ A;  2WX0 A;  4WJN A;  4MJS A;  4TUU A;  2RMM A;  1EUV B;  3V6E B;  1TT5 B;  3P4Q B;  4ZDV A;  3QAQ A;  2KFJ A;  3UIO B;  3EA6 A;  3AE7 B;  4A3O A;  1FFV A;  2IO3 B;  5HFY A;  1ET6 A;  4MAC A;  4HVB A;  2N7D A;  3OJ3 A;  3BVZ A;  4IM2 A;  3RNC C;  1DOX A;  3ALB A;  2PTL A;  3VXW A;  2PE9 A;  5DCN A;  1E8Z A;  1QKZ A;  1N63 A;  1JRP A;  2M17 A;  1TYG B;  1FCL A;  3IXS A;  3PS6 A;  3VUX A;  3VVW B;  3ZO5 B;  1E90 A;  2H89 B;  4DBG A;  2KTR A;  3V6C B;  1D5M C;  4EE2 A;  1C9F A;  1V80 A;  2DZJ A;  4MGI E;  1WGD A;  2BB6 A;  3L08 A;  5DPW A;  3OLM D;  2V4I B;  3W9C B;  4PS8 A;  4WUR A;  2LHD A;  2ZZP B;  1QLB B;  4RFB A;  2JYE A;  4GXB A;  1VZ8 A;  1SXT A;  1I4X A;  4S0R A;  2WXJ A;  2EMS A;  3EEC A;  2W3S A;  3SDL C;  4C4V A;  4TMA B;  3SU8 X;  2RDG A;  3V60 A;  2CHW A;  1EF1 A;  4CO7 A;  4TV3 A;  4LK0 M;  2WDV B;  1HZ6 A;  1L4Z B;  1T6B X;  2I1J A;  1ROE A;  3HM6 X;  2QIL A;  4EZL A;  5AEK B;  1NBF C;  4FHK A;  3QAR A;  2V3S A;  4HEA 1;  3PLV A;  4I6L B;  3KUC B;  1CJE A;  2IDY A;  5IN7 A;  3A9J A;  2WXN A;  1TS2 A;  4MGK E;  4WQO B;  2H88 B;  5IOI A;  3ML8 A;  2PJH A;  1E8X A;  1J8C A;  4RNA A;  2C5L C;  3C19 A;  4USA A;  2GI9 A;  2OJR A;  2AWT A;  4FUL A;  4ARC A;  4C00 A;  1N60 A;  2L8J A;  3DBL I;  1MJD A;  1OQY A;  3DVG Y;  1D6E C;  1NYQ A;  2RPV A;  2GBM A;  3AN1 A;  3HHM A;  3ZTC A;  3VRA B;  3I3T B;  2ZPY A;  2I38 A;  4FJY A;  2K8H A;  4YSX B;  2UYZ B;  2W82 A;  3W5V B;  1PYW D;  1MI0 A;  3NUH B;  1A5R A;  3M3J A;  1ZGU B;  4M01 A;  1HEZ E;  4DHZ E;  3AE5 B;  1B9R A;  2GRI A;  2C7H A;  2LXC A;  2ACZ B;  1RWS A;  4OZA A;  2LD9 A;  2MWS B;  2DYB A;  3TIX A;  1XLO A;  2N7E A;  3VUW A;  2CU1 A;  1JQ4 A;  1KLV A;  4LNF A;  3FIL B;  4DXA B;  2NBV B;  4KKJ A;  1JCK B;  3X23 A;  2KLC A;  2KXJ A;  1KM7 A;  3BVM A;  2XBB C;  1IP9 A;  2JSV X;  1KF6 B;  1D5Z C;  2FCQ A;  4A3P A;  2N4F A;  4W9I A;  1QOG A;  2WXK A;  5E6O A;  3A1Q B;  4LCD E;  1QZE A;  4F1S A;  4IWO A;  1J7A A;  2HDE A;  2LWP A;  3GE8 C;  4B6W A;  4BKT A;  4AOF A;  3N1Y C;  2PLP A;  2WXP A;  1V49 A;  1K8R B;  1E7V A;  1JRO A;  3PVL A;  2KWC A;  5JZE B;  1GB4 A;  4KV2 A;  1WSP A;  4US8 A;  3NOB A;  4ZOH C;  2B76 B;  3V62 A;  2OED A;  4PS7 A;  3L0W B;  3PZD A;  2FCS A;  4JIO U;  4YSY B;  2CJO A;  3U30 A;  4W9G A;  2BS4 B;  1IPG A;  1E8Y A;  2AL6 A;  2RDB C;  4RGN A;  1LFD A;  3ZRC A;  5BYS A;  1T3Q A;  2KDE B;  1A70 A;  4RM9 A;  4DQO C;  1YMH E;  1EM7 A;  2WX1 A;  2KD0 A;  2KFK B;  4US9 A;  4FJZ A;  4FAD A;  1HE8 A;  3D32 A;  2L00 B;  4Q2J A;  4BKS D;  2DBY A;  1I42 A;  3SHQ A;  1FFU A;  4P16 A;  2WU5 B;  2K9X A;  1XQQ A;  1XCT L;  2GOW A;  5D2M B;  1SIJ A;  4LJP B;  4WQM A;  2KDI A;  2WDR B;  1VDV A;  2JQR B;  2QHO A;  3HUI A;  1RM6 C;  1ENF A;  2KN5 A;  4HXD A;  4ZRP A;  5BMH A;  2K3U A;  2MBQ A;  2CJN A;  2KNB A;  2XN9 C;  3IFW B;  4GDK B;  2D3A A;  1FM0 D;  1MHH E;  2MCN B;  3TJP A;  4KZC A;  1I4Q A;  3AEB B;  1MVK A;  1QIL A;  4MM3 A;  4NQK E;  2Z8L A;  1NYR A;  1RAX A;  2KX0 A;  2KWU B;  2LFI A;  3DHG C;  1L2N A;  4GDL B;  4JGH B;  1ZKH A;  4UDU C;  4DXG A;  3FIL A;  1YIW A;  1FRR A;  2NR2 A;  2Z59 B;  3R7R A;  3H7P B;  3ZIM A;  2JY6 A;  3ZNH B;  2KLG A;  2MJ3 A;  2WXH A;  1I35 A;  1KJT A;  3SD5 A;  1WF9 A;  3APC A;  1YJJ A;  3U52 E;  2I1K A;  3PPA A;  4CYE A;  4MEL A;  3KQ4 A;  3A1Q A;  4RGM A;  4PYU A;  2QJL A;  3N1Z C;  4N59 A;  2GMI C;  4KDL B;  1FRD A;  3Q2A C;  4YXD B;  4D2K A;  4M00 A;  3LB8 C;  2BKF A;  1F1H A;  1AAR A;  3DHH C;  2SAK A;  4IWP A;  3I63 C;  3QIJ A;  4XYC A;  4XWT A;  1Q5W B;  3L54 A;  4JQW C;  2NVU I;  1YQ3 B;  4JL9 A;  3Q14 C;  2D2Q A;  3ZRF A;  2JRH A;  3T8M A;  3E9S A;  3GZN B;  2LGD A;  1Y56 A;  3UIN B;  3M95 A;  1GOZ A;  1WR1 A;  4NJ6 A;  2KFK A;  2JXX A;  2RR9 A;  5D94 A;  3H6N A;  1QOF A;  1WM2 A;  1MG4 A;  1FMA D;  2LXA A;  2RSU A;  1KTK A;  5D3I B;  1WI0 A;  2MEK A;  4GGQ A;  1VCB A;  1M4V A;  4LLG M;  2BYE A;  2FBW B;  1JWB D;  3W1S A;  4ICU A;  1V8C A;  3IAS 1;  3S2A A;  2V9H A;  3KH0 A;  2MJD A;  4RF0 A;  4ICV A;  1KOT A;  1T0Q C;  4TSS A;  4HPP A;  1C76 A;  3RD2 A;  1WXV A;  5HKH A;  1S3S G;  5C3J B;  2TSS A;  2EEL A;  2LHE A;  4MSQ B;  3RZF A;  2FCN A;  1R7S A;  2OJW A;  3B0A A;  4M8N A;  4MJS B;  4P7I A;  2MH7 A;  2BGF A;  2AX5 A;  2M19 A;  4GDL A;  3ONS A;  3A4S C;  1OTR B;  2KMA A;  4RMA A;  4GLS C;  4IDI A;  2WNM A;  3I5J C;  3H7P A;  1FCC C;  1YQB A;  4BFR A;  4JLC A;  2DEN B;  3AH7 A;  3X0W A;  2PVO D;  2AQ2 B;  1NEK B;  3PSE B;  2KAC A;  3EHV A;  2PKO A;  1G6J A;  2V0G A;  3ML9 A;  1TY2 A;  3EGR A;  5EE3 A;  4WWP A;  3KYC D;  2LGX A;  4C80 A;  3DWM A;  3RCZ A;  4RGO S;  2DAJ A;  4HWI B;  2IPK D;  2L32 A;  3ZW3 A;  3PLU A;  1KRH A;  1I4R A;  5JHB A;  3RN9 C;  2N9E B;  4M0W B;  2XK5 B;  1D5X C;  2WXL A;  3K9O B;  3QCA A;  2O2V B;  1R4N I;  1GAQ B;  2IGG A;  1WZ0 A;  3J9C A;  3W2D A;  1V81 A;  2GBK A;  4ITK A;  2HJ8 A;  1GC7 A;  4AS1 A;  3H9D A;  2MX2 A;  1U4A A;  2LUE A;  2KHW B;  3RNE C;  5EE0 A;  1TZ1 A;  2D3C A;  1WGK A;  1WXA A;  2LVQ A;  2NTT A;  4M8M A;  1UBQ A;  4NPN A;  2REX A;  2CHX A;  5IKC M;  2N7J A;  4W9J A;  2PW9 A;  2LRW A;  1P1A A;  2KKC A;  1FNV A;  1IBX B;  2PIA A;  1P7F A;  3AE3 B;  3NG0 A;  2INC C;  3KWV A;  2WWZ A;  4W9E A;  1D3Z A;  1GPX A;  4IOI E;  2KWV B;  4REZ A;  5IAA C;  4B9K A;  1CQV A;  3W1Y A;  4HK2 A;  4ZYN A;  2LEK A;  2A4Z A;  5HHD G;  3IG3 A;  2DNF A;  3Q3M C;  1UEL A;  2L1A A;  3PT2 B;  2N9P C;  2NPT B;  3WAN A;  3AU4 A;  2YLM A;  5BYR A;  5DPR A;  4EKU A;  2QDF A;  1I4H A;  1JWA D;  1E7U A;  4QAY A;  2YEP F;  4BBN C;  2NBU A;  2J0K A;  3NVZ A;  3VFK A;  3KUZ A;  1I4G A;  1P98 A;  1YJI A;  1Z2M A;  2HD5 B;  2PEA A;  3RUL A;  2KOX A;  4ANU A;  2ZW0 A;  3TSS A;  3B1L X;  3U8Z A;  2UWQ A;  4LDT D;  4HLE A;  2KZR A;  2N9X A;  2KDB A;  2DZM A;  2Y5P A;  1L7Y A;  2NBW B;  1TS4 A;  2KX3 A;  4BKG A;  1TGZ B;  1AYF A;  5JHA A;  2FUH B;  3M63 B;  3Q8A A;  2AL3 A;  3HVD A;  2KT7 A;  4PYZ A;  2JVC A;  4CHK A;  2HTM E;  3EFC A;  2EMT A;  2D11 A;  2LRU A;  2M1M A;  3PRM B;  4L23 A;  4K7W A;  4M0W A;  3M62 B;  1VLB A;  2XK5 A;  4MGZ E;  2O2V A;  2GB1 A;  2G4S A;  2JU6 X;  3HK0 A;  3N9Y C;  3PRP B;  2K1F A;  3DBH I;  1VJK A;  3VH3 B;  2QEJ C;  4B0M A;  3VAW A;  3ZQ4 A;  1ZDX A;  2C7M B;  1P7E A;  2ZNV C;  2QIE B;  3UGB B;  1EWY C;  2R2Q A;  1FPY A;  2IO1 B;  2ZJD A;  4KGS A;  5FR6 A;  3AUL A;  3QX1 A;  4P1C C;  3VTV A;  3JSV B;  5G5H A;  3TEW A;  4YSZ B;  3FAH A;  1TZO A;  1PQS A;  4TKN A;  2QSD A;  4KX6 B;  2ZVO A;  4L1B A;  4IM0 A;  1IBX A;  1UD7 A;  1J7B A;  3QQ8 B;  4PK1 A;  2J0J A;  2BBC A;  2IJ0 A;  5D3D A;  1C4C A;  3U4E G;  3KLS X;  4ZRJ A;  5FR3 A;  2D3G A;  4FBJ B;  1DOY A;  2DHZ A;  3AM9 A;  3KYD D;  3TUO A;  2MLB A;  1V9J A;  1OEY A;  4W9H A;  4KGR A;  2NPT A;  3LXF A;  3DVN V;  2KQS A;  2MP2 B;  1AWD A;  1YOV B;  1IGC A;  3VDZ A;  1RYJ A;  1OGW A;  5G2N A;  1XT9 B;  3K9P B;  3QC8 B;  2WXO A;  2K22 A;  1UUP A;  4K3B A;  3MC8 A;  3ZXV A;  3TMP B;  2GLS A;  3VTW A;  4II3 B;  1WX9 A;  3Q6B A;  3IT6 B;  4DWF A;  3DWG C;  1TTN A;  2JX5 A;  2LI5 A;  3ZJV A;  2KO3 A;  1FEH A;  4ANX A;  1PGA A;  2HTH A;  3MHS D;  2GBR A;  3DBR I;  1T0Y A;  4J3O D;  1KH0 A;  2PMV A;  1F52 A;  5AZH A;  1WRD B;  4XDD A;  4MM3 B;  1R4M I;  4RCO A;  3KUD B;  3P1M A;  4IG7 B;  4WWO A;  3MFG A;  1JML A;  1KLG D;  4IM3 A;  2MRP A;  3ZGZ A;  2V3P A;  4OZC A;  3DQV A;  4JPS A;  3H1U A;  3PTF C;  1VRA B;  1OEY J;  1FD6 A;  3P4P B;  1C77 A;  1HTO A;  3BYT B;  2ZEQ A;  4G0N B;  2V1Y A;  3OWE B;  4KSK C;  1JAL A;  4G3X B;  1WGR A;  1QOA A;  3MTN B;  3PV1 A;  3ZNI D;  3VH4 B;  3JSV A;  4DDI D;  1PGB A;  2ZCC A;  1YN5 A;  3NZS A;  4C7Z A;  4BKS A;  2KJR A;  3L4P A;  3NZU A;  5CHV C;  3TEX A;  2C60 A;  3ENE A;  3FKY A;  5HG2 A;  5KHQ A;  3VUY A;  4YL8 A;  4BBN F;  1WWT A;  2BKR B;  1QF6 A;  2BYF A;  4HDQ A;  1C79 A;  3UIP B;  1YQ4 B;  2FUG 1;  4HCP B;  1AN8 A;  2FAZ A;  3Q3N C;  4KGT A;  1I7H A;  2A5U A;  4HKQ A;  2MP2 A;  3NVV A;  2K8C A;  1WXS A;  2WS3 B;  3R3M A;  4RGT A;  2AQ1 B;  2KYW A;  3AB5 A;  2WGS A;  1CMX B;  3U7Z A;  2YVC A;  2L83 A;  1TS5 A;  5LNK 1;  3MC9 A;  2CR5 A;  4GMV A;  1E5W A;  2FID A;  3O13 A;  1L0Y B;  4JWS C;  1E7P B;  3WIM A;  2BS2 B;  1MFW A;  4DDG D;  1ISN A;  4ZHO A;  3E56 A;  4IKG A;  1GG3 A;  3QHT A;  3VR9 B;  2E6X A;  3R2T A;  2K0P A;  5T8I A;  5AZG A;  3RNF C;  2DYO A;  3W5U B;  2LMC A;  3EC8 A;  3Q3O C;  1WYG A;  4W9F A;  1C78 A;  2BS3 B;  2KDF B;  2ZVN A;  1TKG A;  3BK2 A;  1ESF A;  3R2I A;  3DVN U;  2MHJ A;  2QCZ A;  4E3C A;  2M8S A;  1WGH A;  4F8C B;  3RYT A;  4MH8 A;  2G4D B;  1H4R A;  2WDQ B;  2IY0 B;  3ZDT A;  1YN4 A;  1TKY A;  2N0S B;  3WAM A;  2MBB B;  2LGY A;  2GBJ A;  1P0R A;  3NHE B;  1D4B A;  1B1Z A;  4N6E B;  2RD0 A;  3KVF B;  2JT4 B;  2JF5 A;  1X1M A;  2E3T A;  4XDC A;  2G45 B;  3Q8B A;  4ZRK A;  1T0S C;  4K81 A;  3AED B;  5IA7 A;  1QQR A;  2FCM A;  2MJE A;  1PGX A;  1JWM D;  1YD8 U;  1TS3 A;  3P4R B;  4B95 A;  4GOC A;  3SFD B;  4BOS C;  2JWU A;  1XLP A;  2ZCB A;  3DBS A;  2IYD B;  4ZRI A;  2HJ1 A;  5J18 A;  2K25 A;  2WP9 B;  1C4A A;  2ZNV B;  2RGF A;  4N9F 4;  3QJZ A;  2WXQ A;  2ZPN A;  1WJ4 A;  1SJE D;  4DHJ B;  1DOI A;  2J7Q B;  5CHW A;  3DBL B;  5DPS A;  4AJW A;  3CWI A;  3PRE A;  2ZW1 A;  5C1Z A;  4MT5 A;  2LUM A;  1WYW B;  4NJ7 A;  2PVG C;  1TY0 A;  3I57 A;  2G9H D;  2LGI A;  2WHI A;  1HZ5 A;  2O6V D;  2KVR A;  4WWM A;  3GE3 C;  3U7D A;  1UF0 A;  4OVZ A;  4RF1 A;  3T9L A;  4BVU C;  4A6Q A;  1J0G A;  1ZW7 A;  3BIN A;  4LDT B;  2J4X A;  4MDK E;  4JX1 C;  2XNA C;  3H8H A;  4A9A A;  1H8C A;  1L0X B;  2L0T A;  3OG5 A;  3UQA A;  3L13 A;  4EEW A;  1WZ3 A;  2K6Q A;  2W3R A;  2KC2 A;  1VR9 A;  1L6V A;  2KVZ A;  2N1V A;  5IO9 A;  4C7Y A;  3ZYY X;  2M56 B;  2CU3 A;  1EU4 A;  3AE8 B;  2JZ3 B;  5EDS A;  1CK1 A;  5IP4 D;  4ASW C;  1YNT E;  1SE3 A;  1F9J A;  1SIF A;  5AUI A;  3RNG C;  2D10 A;  4YT0 B;  4XGA B;  3PZ8 A;  3IT4 B;  1E8W A;  1QOB A;  2K39 A;  4MH0 E;  2RDH A;  2Y5C A;  3Q8C A;  2VH1 A;  4N58 A;  2KN4 A;  2WLB A;  1PFD A;  4II2 B;  1JWU D;  3Q8E A;  3SR6 A;  4GIV A;  4R3D A;  1WX7 A;  2N1W A;  1V97 A;  1UH6 A;  1WY8 A;  1C3T A;  2KAJ A;  3QK0 A;  5I4D A;  2L3Z A;  3VRB B;  3MJ5 A;  1MPE A;  2INP E;  3WAO A;  2UU7 A;  5J2R A;  1ET9 A;  4RM8 A;  1ZPS A;  2W54 A;  1V1P B;  3AE4 B;  2WXM A;  4A8X C;  4I6N B;  2WU2 B;  5CX3 A;  2PPH A;  1NI2 A;  1SF0 A;  2DZI A;  1KFY B;  5DPT A;  4WH4 A;  2J42 A;  4DXF A;  1WJN A;  2WXF A;  3A9K B;  1EU3 A;  1AW7 A;  3ZLZ A;  1BML C;  4PT5 A;  3AE9 B;  2EKI A;  4GU2 A;  1F2R I;  3AEG B;  4KIK B;  2BW2 A;  2W55 A;  4ARI A;  3ZUN A;  4PS3 A;  3NS8 A;  3AXC A;  2VH2 A;  1GB1 A;  3BWU D;  5LLI A;  2ON8 A;  2LJI A;  4NAM A;  1OQR A;  3P2B A;  2G1E A;  2KAN A;  1V1O A;  1BT0 A;  3WAP A;  4BOZ B;  4AWJ A;  3N1X C;  2N9L A;  1YX5 B;  1J7C A;  3HVZ A;  4OVV A;  1WJ6 A;  1LM8 B;  4FLH A;  3ZJU A;  1FNW A;  1FXI A;  2IZV B;  3AEA B;  4LJO B;  1C4P A;  1WX8 A;  3HIZ A;  2SEB D;  3AE1 B;  1FIQ A;  4A20 A;  5AUK A;  1WXQ A;  4DHJ D;  5C23 A;  1UBI A;  1DYQ A;  1WR6 E;  4H2A A;  3ZDM C;  3W1S C;  3PHX B;  1WE6 A;  4BAX A;  4IC7 B;  2ONQ A;  2BWE S;  4ACF A;  3R8B A;  2HE7 A;  4NQL B;  4XZ4 A;  1L5P A;  3NVY A;  3V05 A;  3DDC B;  1STE A;  2KQ7 A;  1KLU D;  1SB3 C;  3H7S A;  3EUB 2;  4A90 A;  4EUT A;  1N61 A;  5BMI A;  5EE9 A;  5H92 C;  3RMK C;  4OHJ A;  3KW5 B;  3RFZ B;  3ZTD A;  4G50 A;  3CIR B;  3UI3 A;  1UWX A;  2J53 A;  5E6P A;  4HPM B;  3JYU A;  3IAM 1;  2IBI B;  3CSF A;  3T3N A;  1ZDV A;  3AU5 A;  1WM3 A;  5GMV A;  3B2F A;  3P4S B;  3DHI C;  2JXT A;  3P42 A;  1TKE A;  2JRI B;  5D6J B;  3Q3J A;  4HJG E;  1V1P A;  1PDX A;  5EE1 A;  4W9C A;  3PGE A;  3B2G A;  2YEP B;  3Q8F A;  4JE3 B;  3CMM B;  1V86 A;  3A9K A;  3OAW A;  1JRU A;  2MSE D;  1TJE A;  2AYO B;  1XCQ L;  4OZB A;  2MBH A;  4AQ7 A;  3APF A;  3SFE B;  2WXR A;  1SGH A;  4KIK A;  1S1Q B;  3UQB A;  3N30 A;  1XD3 B;  2MW5 A;  2PE6 B;  1UWM A;  4YTP B;  1WH3 A;  3WCQ A;  4K7U A;  4K3C A;  2WYQ A;  5CHF A;  1JW9 D;  3OJ4 B;  3RI7 C;  3RNA C;  3GOE A;  3IVF A;  3IHP C;  4ANV A;  3MJW A;  5JXV A;  1SBB B;  3AE2 B;  2Z0E B;  3PRZ A;  4S17 A;  3TCA A;  3ZXR A;  2L05 A;  4LTU A;  1E10 A;  1WE7 A;  1ZP0 B;  4IW0 A;  2K5P A;  3I9V 1;  2L76 A;  2LVP A;  4WIP A;  3B08 A;  3LYY A;  1LGR A;  2ICI A;  3GZN I;  4B0E A;  4A55 A;  3AE6 B;  3URY A;  1UNS A;  2JPH A;  2IND C;  3WA0 A;  4X57 B;  5BMG A;  4KKI A;  3ZJT A;  4MEM A;  3ZNG C;  1RLF A;  2R2O A;  1VZ7 A;  1WGY A;  1RFK A;  1ZXH A;  1V5T A;  1XO3 A;  1C1Y B;  2IGD A;  4NAW B;  1XLN A;  3QA8 A;  2DLB A;  5C2T B;  1HQR D;  1E0Z A;  2I2Y A;  2X38 A;  1LXD A;  1L6U A;  4E74 A;  1YJ1 A;  1GNU A;  3PHW B;  1Q0W B;  1R4N B;  3C0R B;  3FC4 A;  3Q69 A;  2KJ6 A;  1ZUD 2;  4AUQ C;  2KTF A;  4NZL B;  4RH6 A;  3BZD B;  1M94 A;  2NMQ A;  4NJC A;  3ZVV A;  3GS2 A;  2M4N A;  1HA5 A; 
#chains in the Genus database with same CATH homology
 3ML9 A;  2IO0 B;  3WAM A;  3VVW B;  2MBB B;  2LVO A;  3ZO5 B;  1E90 A;  2DAF A;  2LGY A;  4DBG A;  2GBJ A;  2KTR A;  1P0R A;  3KYC D;  4WWP A;  3V6C B;  4URK A;  2LGX A;  1P9D U;  1V80 A;  3RCZ A;  2DZJ A;  1RRB A;  2DAJ A;  4MGI E;  1WGD A;  5DPW A;  3L08 A;  3OLM D;  4HWI B;  3DPD A;  3NHE B;  3ZW3 A;  4HPL B;  4K1R B;  4MGY E;  3PLU A;  5JHB A;  4PS8 A;  4WJO A;  2KC1 A;  2N9E B;  2JZZ A;  2RD0 A;  2ZZP B;  1VD2 A;  3KVF B;  4M0W B;  2XK5 B;  3K9O B;  2JT4 B;  2JF5 A;  3QCA A;  1X1M A;  2O2V B;  1R4N I;  4GXB A;  1WZ0 A;  4TQ0 A;  2M0X A;  2G45 B;  3ZKJ C;  1V81 A;  2GBK A;  3R66 C;  4ZRK A;  4K81 A;  2OOB B;  2HJ8 A;  4W9K A;  5IA7 A;  1GC7 A;  3CF6 E;  2EMS A;  2FCM A;  2DZK A;  3EEC A;  3H9D A;  2MX2 A;  2IY1 B;  1YD8 U;  1U4A A;  2O6V B;  2LUE A;  3SDL C;  4B95 A;  4GOC A;  4BOS C;  2KHW B;  2MBO A;  3SU8 X;  2ZCB A;  1TBE A;  3V60 A;  2CHW A;  1EF1 A;  1TZ1 A;  1NDD A;  4CO7 A;  1WXA A;  3DBS A;  1MG8 A;  2IYD B;  2LVQ A;  4TV3 A;  4ZRI A;  5J18 A;  2K25 A;  4M8M A;  1UBQ A;  4NPN A;  2ZNV B;  2B3A A;  4IUM B;  2RGF A;  4N9F 4;  3QJZ A;  2REX A;  2I1J A;  4DHJ B;  1UZX B;  1WJ4 A;  2CHX A;  2ZPN A;  3HM6 X;  4EFO A;  3R7Q A;  1Q1O A;  3DOW A;  1J19 A;  2FNJ B;  4EZL A;  5AEK B;  1RFA A;  2J7Q B;  3IBE A;  2C9W B;  4W9J A;  5CHW A;  3RT3 B;  1NBF C;  4FHK A;  2LRW A;  5DPS A;  4AJW A;  1P1A A;  2KKC A;  3PRE A;  5C1Z A;  3BY4 B;  1WYW B;  3QAR A;  4NJ7 A;  2DYM A;  2V3S A;  3PLV A;  2JUO A;  4I6L B;  3KUC B;  3A9J A;  3JVZ X;  5L95 C;  2WWZ A;  5JH5 C;  4W9E A;  1D3Z A;  4MGK E;  2O6V D;  4WJQ A;  2KVR A;  4WQO B;  4XX5 A;  2KWV B;  3U7D A;  5IAA C;  3T9L A;  4B9K A;  1Z5S B;  3ML8 A;  2PJH A;  3W1Y A;  1E8X A;  4HK2 A;  4ZYN A;  4BVU C;  1J8C A;  2A4Z A;  1J0G A;  1ZW7 A;  3BIN A;  4LDT B;  2C5L C;  4NNJ B;  4MDK E;  3IG3 A;  2OJR A;  2AWT A;  3ZNZ B;  4FUL A;  1UEL A;  4WAA A;  3PT2 B;  2N9P C;  2NPT B;  3WAN A;  3AU4 A;  2YLM A;  1H8C A;  2L0T A;  2CS4 A;  2L8J A;  3L17 A;  3UQA A;  3L13 A;  3QWZ B;  3DBL I;  5DPR A;  4EKU A;  4EEW A;  1WZ3 A;  1WXM A;  2K6Q A;  1E7U A;  1OQY A;  2KC2 A;  3DVG Y;  4BBN C;  1GUA B;  2J0M A;  2N1V A;  2MQJ A;  2NBU A;  2GBM A;  2J0K A;  3VFK A;  3HHM A;  3ZTC A;  3CST A;  3ECI A;  3I3T B;  3KUZ A;  1P98 A;  3DCG A;  4NAW A;  2ZPY A;  1Z2M A;  2HD5 B;  2BWF A;  2L7R A;  2PEA A;  3RUL A;  2K6D B;  2KOX A;  4ANU A;  4FJY A;  2K8H A;  4KVG B;  2UYZ B;  5J17 A;  4GN1 A;  2JZ3 B;  5EDS A;  4ASW C;  3B1L X;  1A5R A;  3M3J A;  1F9J A;  3U8Z A;  1SIF A;  1P3Q U;  1ZGU B;  2UWQ A;  4LDT D;  4HLE A;  2KZR A;  2N9X A;  4DHZ E;  4FHJ A;  2D10 A;  2C7H A;  2KDB A;  2DZM A;  2LXC A;  1L7Y A;  2LD9 A;  2NBW B;  2KX3 A;  1E8W A;  1TGZ B;  4BKG A;  2K39 A;  5JHA A;  2FUH B;  4HDO A;  3M63 B;  4MH0 E;  2AL3 A;  2MWS B;  2DYB A;  3TIX A;  4PYZ A;  2N7E A;  2JVC A;  3L10 B;  4CHK A;  4II2 B;  3VUW A;  2EMT A;  2D11 A;  4GIV A;  1WX7 A;  2N1W A;  4J6I A;  2CU1 A;  2LRU A;  1KLV A;  2M1M A;  4DXA B;  3PRM B;  2KMC A;  1UH6 A;  1WY8 A;  4K7W A;  2NBV B;  1C3T A;  3QK0 A;  3M62 B;  2L3Z A;  3X23 A;  2XK5 A;  1IYF A;  2KLC A;  4MGZ E;  2O2V A;  2KXJ A;  5TR5 A;  1KM7 A;  2G4S A;  3HK0 A;  3PRP B;  2K1F A;  4KDI C;  4EZJ A;  3WAO A;  1FXT B;  5J2R A;  4RM8 A;  2XBB C;  3DBH I;  2RPQ A;  3VH3 B;  1IP9 A;  1WGG A;  3AI5 A;  2L0F A;  1Y8R C;  2FCQ A;  3VAW A;  4A3P A;  1EO6 A;  3NY5 A;  2VRR B;  2O6V A;  2N4F A;  4I6N B;  4W9I A;  2C7M B;  5CX3 A;  2ZNV C;  2PPH A;  3UGB B;  1NI2 A;  4WJP A;  2R2Q A;  5E6O A;  5CTR C;  2IO1 B;  3A1Q B;  5E6N A;  2DZI A;  1QZE A;  2ZJD A;  4LCD E;  4F1S A;  4IWO A;  5FR6 A;  4BFR A;  5DPT A;  5LXH A;  2CHZ A;  2LWP A;  3AUL A;  2JWZ A;  1WJN A;  3A9K B;  4B6W A;  4BKT A;  4AOF A;  3JW0 X;  3QX1 A;  3ZLZ A;  2Y5B B;  3VTV A;  2K8B A;  3JSV B;  1V49 A;  2D07 B;  1K8R B;  4GU2 A;  4GB9 A;  4AJY B;  4KIK B;  1E7V A;  2C7N B;  3ZUN A;  4PS3 A;  3PVL A;  3NS8 A;  1PQS A;  4XC2 A;  4TKN A;  3O65 B;  2AEH A;  4WWN A;  3AXC A;  1YX6 B;  2KWC A;  2ZVO A;  4IM0 A;  1UD7 A;  5LLI A;  3QQ8 B;  5JZE B;  4KV2 A;  2BPS A;  2KJH B;  2J0J A;  3P2B A;  2KAN A;  2LJ5 A;  3NOB A;  5BO4 B;  1BT0 A;  3WAP A;  4ZRJ A;  3V62 A;  3RUI B;  2D3G A;  4AWJ A;  4BOZ B;  4W9D A;  4FBJ B;  4ANW A;  4PS7 A;  1YX5 B;  3L0W B;  3PZD A;  2FCS A;  4JIO U;  4OVV A;  1WJ6 A;  2DHZ A;  3KYD D;  3U30 A;  1LM8 B;  4E71 A;  4FLH A;  1WMH B;  2MLB A;  2IZV B;  4W9G A;  1V9J A;  1OEY A;  1IPG A;  1E8Y A;  2AL6 A;  4LJO B;  4W9H A;  1LFD A;  2NPT A;  3ZRC A;  4RM9 A;  2KDE B;  2MBE A;  1WX8 A;  3PS6 A;  2KK8 A;  2WX1 A;  3HIZ A;  2KD0 A;  2KFK B;  2KQS A;  1V5O A;  2MP2 B;  3DVN V;  4A20 A;  4FJZ A;  4FAD A;  3VDZ A;  1HE8 A;  3D32 A;  5C23 A;  1OGW A;  4DHJ D;  2L00 B;  5G2N A;  1UBI A;  1XT9 B;  3N3K B;  4BKS D;  1WR6 E;  3K9P B;  3QC8 B;  4TQ1 A;  3ZDM C;  3W1S C;  1I42 A;  3PHX B;  2LZ6 A;  2XEW A;  3SHQ A;  1WE6 A;  4GSW A;  3TBL D;  1XQQ A;  2GOW A;  4IC7 B;  5D2M B;  4LJP B;  4KSL C;  2KDI A;  3TMP B;  3VTW A;  2BWE S;  1GJZ A;  4FN2 A;  4II3 B;  2HE7 A;  2FIF A;  1WX9 A;  4NQL B;  2QHO A;  4XZ4 A;  4HXD A;  2KN5 A;  4DWF A;  5G55 A;  3DDC B;  3VHT C;  2MBQ A;  2KQ7 A;  1TTN A;  2KNB A;  2LI5 A;  2KO3 A;  4GDK A;  4ANX A;  3IFW B;  2HTH A;  4GDK B;  3MHS D;  3APD A;  3H7S A;  4EUT A;  2GBR A;  3DBR I;  2MCN B;  3TJP A;  4KZC A;  1T0Y A;  3WAL A;  4MM3 A;  2EKE C;  4NQK E;  5AZH A;  1WRD B;  4AP4 C;  1RAX A;  2KX0 A;  1R4M I;  2KWU B;  3KW5 B;  3V61 A;  3ZTD A;  3KUD B;  4IG7 B;  1L2N A;  4WWO A;  4G50 A;  4GDL B;  4JGH B;  1ZKH A;  5E6P A;  5AZF A;  4HPM B;  3N32 A;  3JYU A;  2IBI B;  3CSF A;  4IM3 A;  1YIW A;  4FA6 A;  2MRP A;  3AU5 A;  1WM3 A;  2NR2 A;  2Z59 B;  3DQV A;  5GMV A;  3H7P B;  3R7R A;  3DVG X;  1UGM A;  3UF8 A;  3ZIM A;  2JY6 A;  2BYV E;  3ZNH B;  2KLG A;  3H1U A;  1WFY A;  3PTF C;  4IWQ A;  4NY0 A;  1OEY J;  4DK5 A;  2JRI B;  5KHO A;  4FJV B;  1I35 A;  5D6J B;  2ZEQ A;  1KJT A;  3Q3J A;  3SD5 A;  1WF9 A;  3APC A;  4G0N B;  2GBN A;  2V1Y A;  2I1K A;  3A33 B;  3PGE A;  4W9C A;  4KSK C;  2KTR B;  3PPA A;  4G3X B;  4CYE A;  1WGR A;  4MEL A;  3A1Q A;  4PYU A;  3CMM B;  4G11 A;  1V2Y A;  3MTN B;  2GMI C;  1WJU A;  3PV1 A;  1V86 A;  4KDL B;  3A9K A;  3OAW A;  1JRU A;  2MSE D;  2BKF A;  2AYO B;  1WIA A;  3ZNI D;  2NS5 A;  3VH4 B;  1AAR A;  2W9N A;  3JSV A;  2MBH A;  3LDZ E;  4DDI D;  4K7S A;  2ZCC A;  3APF A;  4IWP A;  1SGH A;  3QIJ A;  4KIK A;  5D7G A;  3NZS A;  1S1Q B;  3UQB A;  4BKS A;  1Q5W B;  2KJR A;  3L54 A;  3N30 A;  4JQW C;  2MA9 B;  3NZU A;  1SE9 A;  1XD3 B;  2NVU I;  2MW5 A;  2PE6 B;  5CHV C;  4F7Z A;  2C60 A;  4JL9 A;  3ENE A;  2DX5 B;  4OVU A;  4DHZ B;  2D2Q A;  4HJK A;  3ZRF A;  1WH3 A;  4HCN B;  2JRH A;  2V4L A;  2WDT B;  1LQB A;  4K7U A;  5KHQ A;  3VUY A;  3T8M A;  2CKH B;  4YL8 A;  4BBN F;  2WYQ A;  5CHF A;  2BKR B;  2LGD A;  2BYF A;  3OJ4 B;  4HDQ A;  3UIP B;  3UIN B;  3M95 A;  3GOE A;  1WMH A;  4HCP B;  3IVF A;  5L83 A;  2G3Q B;  2FAZ A;  3IHP C;  3VTU A;  4ANV A;  3MJW A;  2A5U A;  2Z0E B;  3PRZ A;  1WR1 A;  4NJ6 A;  2KFK A;  2MP2 A;  2JXX A;  2RR9 A;  3TCA A;  2L05 A;  5D94 A;  3H6N A;  2K8C A;  4EOY A;  1WE7 A;  1WXS A;  2LAS A;  3R3M A;  1V6E A;  1WM2 A;  4IW0 A;  2NCN A;  1EF5 A;  2LXA A;  2RSU A;  2L76 A;  2IO2 B;  3EFU A;  3LJ3 A;  4KZ0 A;  1CMX B;  2LVP A;  1WI0 A;  3VQI A;  2ASQ A;  2YVC A;  3A9J B;  3B08 A;  4GGQ A;  1VCB A;  4GMV A;  2CR5 A;  1E5W A;  2FID A;  2BYE A;  3GZN I;  3HM3 A;  3A4R A;  4W9L A;  2Z0D B;  3W1S A;  3WIM A;  4ICU A;  4DDG D;  1ISN A;  3S2A A;  2JPH A;  3L16 A;  3TL5 A;  4EZK A;  3RZW C;  2BF8 B;  3KH0 A;  3WA0 A;  4ICV A;  4MSM B;  4I6P A;  4X57 B;  1KOT A;  1GC6 A;  1GG3 A;  5LXI B;  4MEM A;  3QHT A;  3Q3F A;  3RD2 A;  1WXV A;  3ZNG C;  5HKH A;  1RLF A;  2R2O A;  1S3S G;  2WX0 A;  4MSQ B;  4WJN A;  4MJS A;  3RZF A;  1WGY A;  4TUU A;  2FCN A;  3B0A A;  4M8N A;  1EUV B;  3V6E B;  4MJS B;  1V5T A;  4P7I A;  5AZG A;  2BGF A;  4ZDV A;  3QAQ A;  2KFJ A;  2DYO A;  3UIO B;  1C1Y B;  4NAW B;  3EC8 A;  3QA8 A;  4A3O A;  4GDL A;  4W9F A;  2IO3 B;  2KDF B;  2ZVN A;  4HVB A;  3ONS A;  2N7D A;  3A4S C;  3OJ3 A;  1OTR B;  2KMA A;  4IM2 A;  4RMA A;  3ALB A;  1LXD A;  3DVN U;  4E74 A;  3H7P A;  3VXW A;  1YJ1 A;  1YQB A;  2PE9 A;  2DEN B;  1E8Z A;  1GNU A;  3PHW B;  4JLC A;  5DCN A;  1Q0W B;  1WGH A;  2M8S A;  4E3C A;  3C0R B;  4F8C B;  3RYT A;  3X0W A;  2KJ6 A;  4AUQ C;  2KTF A;  3PSE B;  2G4D B;  1H4R A;  3EHV A;  2IY0 B;  2M17 A;  1M94 A;  3ZDT A;  3ZVV A;  2M4N A;  1G6J A;  3VUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...