1GJZA

Solution structure of a dimeric n-terminal fragment of human ubiquitin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Structure and Properties of a Dimeric N-Terminal Fragment of Human Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin
total genus 6
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gjzA00
3AU4A 5CHVC 3KUZA 4MJSA 1UZXB 4AJYB 4KVGB 4HWIB 4WJQA 1WXVA 4BKTA 2NS5A 3K9OB 2A4ZA 4GGQA 5TR5A 2KTRB 1Q5WB 3BY4B 1U4AA 3IVFA 3V62A 2KC1A 3ZNID 4ANWA 4EOYA 1NDDA 3PGEA 1WH3A 3ML8A 1V86A 3CSFA 3L54A 3H7PA 4I6PA 5AEKB 4IW0A 4HDQA 3N30A 4GMVA 2KWCA 1VCBA 3APCA 4MM3A 4K1RB 1WYWB 3ZO5B 4KZ0A 4HCPB 4MGKE 4AWJA 1WGGA 1UD7A 1RFAA 3PZDA 2CS4A 3ENEA 2KHWB 2DYMA 3WIMA 1WXMA 1GJZA 3EECA 3APFA 2N1VA 3VUXA 2PEAA 4HJKA 4IWOA 3EHVA 2Z0DB 3OLMD 4ZYNA 3ZRCA 2ZNVB 4FBJB 4GDKB 2N1WA 1HE8A 1WMHB 1WX9A 2NPTA 3ZTCA 2KMCA 1WGRA 4W9HA 3PREA 3QWZB 2I1KA 2WYQA 2N9EB 4J6IA 2MBOA 3H6NA 3PPAA 4BKSD 2FCSA 5C23A 2EMSA 4K81A 4HLEA 2MBBB 2N4FA 1S1QB 5LXHA 4NJ7A 2RPQA 4XZ4A 3ZLZA 5LXIB 4WAAA 4ASWC 3A9JA 1IPGA 3HK0A 2DX5B 3QX1A 1R4MI 3K9PB 2N9PC 1JRUA 2CU1A 4A20A 3DBSA 2D2QA 1OTRB 1Z5SB 3OJ3A 4PS3A 1KOTA 3QHTA 5CHWA 4BKGA 1V49A 3ECIA 3L10B 4G50A 2UYZB 4W9DA 2I1JA 3H7PB 2L0TA 2L76A 3WAPA 5CHFA 2KDIA 2DYBA 4EZLA 3EFUA 3D32A 3A4SC 2PE9A 2EKEC 5BO4B 4BBNF 4FADA 3MTNB 3C0RB 1WJ6A 2JRHA 2A5UA 3QAQA 2G4DB 2RGFA 3P2BA 2L05A 4GDLA 3JSVA 2RR9A 3AI5A 1P9DU 3X0WA 4LDTD 1WR1A 2J0JA 2G45B 3DCGA 5D94A 4AJWA 3ZIMA 3PV1A 3L16A 2K6DB 4MH0E 2JT4B 1LFDA 4JQWC 2RSUA 3DVGY 4KZCA 3DDCB 4RM9A 1UBIA 2KMAA 5JHAA 2C9WB 4E3CA 2JVCA 3WANA 2DZMA 4GN1A 4MGZE 4EFOA 2BPSA 3IFWB 1WGHA 1VD2A 4YL8A 2MSED 4W9GA 3VTUA 1XD3B 4BFRA 2DAJA 3UINB 2KQSA 4WWOA 5E6PA 3QIJA 4II2B 4XC2A 4DDGD 1LQBA 3DOWA 5DPRA 3VXWA 2HJ8A 4DHJD 2FIFA 3IBEA 3UQAA 2UWQA 3PLVA 1SE9A 1WGYA 3QCAA 4KV2A 1S3SG 2IBIB 1J0GA 1M94A 5LLIA 2LGYA 2ZVOA 4MEMA 1RLFA 1YX6B 5J17A 4OVUA 4HPLB 1P0RA 1T0YA 2XEWA 3PRMB 5JH5C 4K7WA 3SDLC 2KJHB 2NBVB 5FR6A 3RCZA 3ZNZB 4RMAA 1WGDA 1H4RA 4IM0A 4JL9A 4F7ZA 3TIXA 1TGZB 2CR5A 2KX3A 4GDLB 1WE6A 1E8WA 5D2MB 2KKCA 3WAOA 2DENB 3BINA 4IWQA 3DVGX 4M8MA 5CX3A 3VUYA 3KYCD 4IM3A 2KK8A 2CHZA 1E8ZA 1GC6A 4GU2A 2MBHA 1R4NI 2KWUB 1EO6A 3U7DA 2KN5A 4ANXA 4E74A 1WM2A 3VUWA 1AARA 4EZJA 1Z2MA 3HHMA 2DHZA 1KM7A 5E6NA 5L83A 2GOWA 4M8NA 2G4SA 3DVNU 1ZW7A 1TTNA 2V3SA 2O6VA 3CF6E 2G3QB 2C7MB 3IG3A 1L2NA 1KJTA 2LXAA 5GMVA 1G6JA 2KD0A 5E6OA 3VTVA 2W9NA 1YQBA 3V60A 3JYUA 1D3ZA 2KDBA 3MHSD 5JZEB 1FXTB 4CO7A 4ZDVA 2LUEA 2LVOA 3OJ4B 2LD9A 3TJPA 2Z59B 2KNBA 4B95A 3NOBA 1L7YA 1E7VA 1WZ3A 3PHXB 4LCDE 3B0AA 3RYTA 3VH3B 3ZKJC 1CMXB 1A5RA 3RZFA 4AUQC 3H7SA 2GBJA 3T8MA 4XX5A 1V5TA 1E90A 3A33B 5HKHA 5DPSA 2K8HA 1OGWA 2LRWA 1WX7A 3DBHI 2DYOA 2MA9B 4WWPA 4G3XB 2L3ZA 4LJOB 3H1UA 4N9F4 3RZWC 5D7GA 4RM8A 2FIDA 5L95C 3HIZA 1V81A 2MLBA 3HM3A 4TV3A 3U30A 1SGHA 2WX1A 4JLCA 4KSKC 1YX5B 2LJ5A 1QZEA 3LJ3A 1GC7A 4DBGA 1WXAA 3ZW3A 3DBRI 2LVQA 2KJ6A 3B08A 4MELA 2BWFA 4A3PA 3A1QB 4ZRKA 5G2NA 1EF1A 1XQQA 3UGBB 1V80A 4EKUA 3AULA 3I3TB 2KDFB 2Y5BB 4GSWA 2DZJA 1J8CA 2R2QA 3IHPC 2KTFA 4GIVA 2O6VB 5IA7A 4FJYA 2WDTB 3N3KB 2GMIC 3T9LA 3MJWA 4FN2A 4TKNA 3M62B 2ZCCA 3VTWA 4MGYE 2PE6B 1WY8A 1BT0A 2LI5A 4FHKA 2MWSB 3QK0A 2BKRB 3KUDB 1Q0WB 2LXCA 4W9LA 1Q1OA 1WIAA 2KVRA 2L00B 2M4NA 4LJPB 1NBFC 2FAZA 2M0XA 3S2AA 4TUUA 4JGHB 2J7QB 4AP4C 1P3QU 1E7UA 1WM3A 4B9KA 2VRRB 2JPHA 2LWPA 2ZEQA 3ZRFA 1KLVA 2FCNA 5J18A 1GG3A 2PPHA 1WZ0A 1NI2A 2KQ7A 3NZUA 3PTFC 1H8CA 4K7SA 3QA8A 2PJHA 2BYEA 4MDKE 2K8CA 1UBQA 2WWZA 2KFJA 2NVUI 1ZGUB 4ICVA 2JWZA 4W9FA 3TL5A 3W1SC 4W9IA 2IO0B 4NQLB 3APDA 3R7RA 1OEYJ 2GBMA 5J2RA 2NR2A 4HDOA 2JRIB 3QC8B 4P7IA 1LXDA 4TQ1A 5DPTA 3WALA 3Q3JA 4FULA 3L13A 3CSTA 1UGMA 4URKA 1E5WA 2C60A 2CKHB 3GOEA 3PSEB 3ONSA 3PHWB 4KDLB 2WX0A 4WQOB 3M3JA 5DCNA 4F1SA 2K39A 5AZHA 2MX2A 4PS8A 4TQ0A 2LASA 1WR6E 1OEYA 2KLCA 2BGFA 2JY6A 3VQIA 4DDID 5AZFA 2JZ3B 2ZPNA 5D6JB 4NAWA 2BYFA 1V5OA 2C7HA 2C7NB 4BVUC 4OVVA 1WX8A 4W9JA 5C1ZA 3ZNHB 3ML9A 2KC2A 3A9KB 3W1SA 3L0WB 3A1QA 3HM6X 3M95A 1F9JA 4WJOA 3UF8A 1E8XA 2D10A 2JXXA 4BOSC 1LM8B 3N32A 1V2YA 2BYVE 2MBEA 4M0WB 2YLMA 2K1FA 2BF8B 3JW0X 4ZRJA 2AL3A 2M1MA 3L08A 4EZKA 2KANA 1WJ4A 4B6WA 3WA0A 4HVBA 4ZRIA 3M63B 4IC7B 2OJRA 2ZJDA 3KYDD 2ZCBA 2LRUA 3DBLI 3VFKA 3ZDMC 2FUHB 4GOCA 2KOXA 2LVPA 3CMMB 3O65B 2J0MA 1J19A 3VVWB 1RRBA 3TCAA 4W9EA 2R2OA 1SIFA 1TBEA 1OQYA 3PT2B 4I6LB 1V9JA 1MG8A 3DVNV 3GZNI 4BOZB 5DPWA 2AEHA 1P98A 2K6QA 4LDTB 4E71A 3RULA 2L8JA 2HE7A 2ZVNA 1TZ1A 2JZZA 2K8BA 2KZRA 2N9XA 3VDZA 2LZ6A 1E8YA 2AWTA 3QARA 3VHTC 3R66C 4FLHA 3UIOB 1IYFA 2XK5A 2MQJA 3V6CB 3VH4B 2M17A 4DHZB 2JF5A 1WJUA 1X1MA 3UQBA 1YD8U 4NQKE 4NAWB 2K25A 3SHQA 3PLUA 1ZKHA 1UH6A 2KFKA 4IM2A 4FJZA 4DXAB 2QHOA 4II3B 3KH0A 2NBUA 3VAWA 1C1YB 2GBNA 3W1YA 2GBKA 4DHJB 3WAMA 2L0FA 3A4RA 2AL6A 1WI0A 2BWES 2IY0B 3B1LX 3ZNGC 4ANUA 3JVZX 4F8CB 2V4LA 1EUVB 2DZKA 4MGIE 2CHWA 4IG7B 2LGXA 3V6EB 2MP2A 3OAWA 3R7QA 4CYEA 4MJSB 2MCNB 2C5LC 3NY5A 1WE7A 3KUCB 4DK5A 5G55A 4DWFA 2REXA 4KIKA 3SD5A 2HTHA 2ASQA 2BKFA 2KWVB 2NBWB 3NHEB 4BKSA 2ZPYA 4PS7A 3RUIB 3ZUNA 3DPDA 5EDSA 2KDEB 4IWPA 2LGDA 3QQ8B 4G0NB 3LDZE 2FNJB 3NZSA 1YIWA 3L17A 4JIOU 4MSMB 4HPMB 1C3TA 2O2VA 2IO2B 2XBBC 4NPNA 1WFYA 2MBQA 3A9KA 4IUMB 3TMPB 1IP9A 2KJRA 4W9KA 4GB9A 3KVFB 2MW5A 1GNUA 4DHZE 3ZTDA 1WF9A 1Y8RC 4NY0A 3ZDTA 2N7EA 5CTRC 5IAAC 1GUAB 2KX0A 1I42A 3ALBA 3AU5A 3DQVA 2XK5B 3AXCA 2IO1B 2N7DA 3V61A 3X23A 2CHXA 4PYZA 4EEWA 3R3MA 3U8ZA 2ZNVC 3PRZA 5AZGA 1WRDB 2NPTB 4W9CA 1EF5A 2IYDB 2KFKB 3SU8X 1RAXA 3PVLA 3RT3B 2KTRA 1I35A 2JUOA 2OOBB 2KO3A 2IZVB 3NS8A 2V1YA 1K8RB 3QJZA 2D3GA 2ZZPB 2M8SA 2RD0A 3KW5B 4WJNA 5KHOA 1V6EA 4HK2A 3TBLD 2MP2B 3EC8A 4BBNC 2NCNA 3ZVVA 3RD2A 3A9JB 4EUTA 2B3AA 3Q3FA 3PRPB 1YJ1A 2MRPA 3H9DA 2KXJA 4FJVB 4G11A 4KIKB 2DAFA 4I6NB 4K7UA 4KDIC 4WJPA 4WWNA 4NJ6A 5JHBA 2FCQA 4A3OA 3PS6A 2D07B 2EMTA 2FCMA 4FA6A 5KHQA 2L7RA 4KSLC 4GDKA 4AOFA 2KLGA 4HXDA 4X57B 1WMHA 2O6VD 2Z0EB 2DZIA 4MSQB 2HD5B 1WJNA 1WXSA 2O2VB 4GXBA 2J0KA 4CHKA 2AYOB 2GBRA 4NNJB 2YVCA 1PQSA 2IO3B 4ICUA 4FHJA 2D11A 3UIPB 4HCNB 2IY1B 1UELA 1XT9B 4ANVA 4PYUA 1ISNA 1P1AA 3JSVB
chains in the Genus database with same CATH superfamily
3AU4A 5CHVC 3KUZA 4AJYB 2SAKA 1MHXA 2NS5A 3IVFA 1U4AA 3V62A 3ZNID 1NDDA 1TS2A 3PGEA 3IT6B 1IGDA 3RN9C 2RDHA 3CSFA 4HDQA 3APCA 4K1RB 1JWMD 3ZO5B 4AWJA 1WGGA 1UD7A 4ITKA 4PT5A 2CS4A 1PGBA 2DYMA 3AE3B 2N1VA 3VUXA 4HJKA 3EHVA 2Z0DB 1HE8A 2EELA 1WMHB 1WX9A 1WGRA 3PREA 2LGSA 2I1KA 2MBOA 1EM7A 5C23A 2EMSA 2HJ1A 4K81A 3P4SB 1S1QB 3ZLZA 1HTQA 2DNFA 2DX5B 3L4PA 1N62A 2QJLA 1R4MI 4J3OD 4B0MA 2CU1A 1Z5SB 3HRDD 4BKGA 1V49A 4W9DA 5CHFA 3Q8AA 1L5PA 4BBNF 4JX1C 1T0RC 1WJ6A 1D5MC 3P1MA 1GOZA 2L05A 3X0WA 3AI5A 1WR1A 3DCGA 2G45B 5D94A 1DOXA 3NVWA 1JROA 3PV1A 4MH8A 1HXYD 3DDCB 2KMAA 4LLGM 2C9WB 4E3CA 3CWIA 4EFOA 1A70A 4EE2A 3UINB 5EE9A 1IBXB 4HPPA 4XC2A 4DDGD 3DOWA 2PTLA 3VXWA 4DHJD 2FIFA 3IBEA 3PLVA 3N1XC 4KV2A 2N0SB 1ACCA 1V1OA 2JU6X 2FUG1 2KACA 3GP7A 2ZVOA 1YX6B 2K0PA 3PRMB 2XEWA 3TUOA 2NBVB 2PLPA 3RCZA 4NZLB 1LO5D 1WGDA 1XLOA 4IM0A 2Q5WD 2DENB 3DVGX 3VUYA 3KYCD 3VR9B 5IO9A 2MBHA 1R4NI 2W54A 4XE0A 4R3DA 2DHZA 1KM7A 2INDC 4N58A 1PFDA 1WWTA 3IG3A 4M8NA 1ZW7A 2JSVX 2V3SA 2C7MB 3TEXA 1KJTA 2INPE 1YQ3B 2KD0A 2QIEB 1C4CA 4C56C 2CU3A 3JYUA 3V60A 1D3ZA 1KTKA 2KDBA 3MHSD 5JZEB 3OJ4B 3TJPA 2Z59B 2KNBA 3NOBA 1WZ3A 3VH3B 1CMXB 3NZ3A 1MG4A 1V5TA 4K3CA 4XX5A 1C4PA 1VR9A 3A33B 1OGWA 2DYOA 4WWPA 4OVZA 4WH4A 2I38A 2MJEA 1T5XD 1FEHA 4C80A 4MACA 3HM3A 2WX1A 4JLCA 1YX5B 2M0AA 2LJ5A 5HI1A 1JRPA 2KJ6A 3B08A 4WQMA 4MELA 5G2NA 3UGBB 1NYQA 3AULA 2B76B 2KDFB 2Y5BB 1C4AA 1QKZA 1ZE3D 4FJYA 2GMIC 2WXNA 3MJWA 1R4MB 1E0ZA 3NVVA 2H88B 3DBRB 3VTWA 5D3DA 2PE6B 1C78A 1WY8A 1XEEA 1OFFA 1Q0WB 2LXCA 2L00B 3S2AA 3NS1A 1F77A 4YSZB 2J7QB 1E7UA 2ICIA 2ZEQA 3ZJUA 1KLUD 1TYGB 1NI2A 4ZOHC 2IPKD 3Q3MC 4W9IA 4NQLB 3R7RA 4RGTA 1RWSA 2NR2A 2WGSA 1MPEA 3QC8B 5DPTA 2QC8A 3Q3JA 4FULA 1UGMA 4URKA 3KWLA 3PHWB 4WQOB 1I4XA 5DCNA 2K39A 1YNTE 5AZHA 3B2FA 2E3TA 2MX2A 5BYQA 2MHJA 4PS8A 2LASA 3BK1A 2BB5A 2KLCA 1I4RA 3VQIA 2DWQA 2JZ3B 1QOGA 5D6JB 1V5OA 4M01A 4BVUC 4W9JA 1RM6C 3ML9A 3ZNHB 3A9KB 3UI3A 1SXTA 3GS2A 4BOSC 1FXIA 1QOBA 2MBEA 4M0WB 4ZDVA 2BF8B 3AB5A 2AL3A 5TSSA 1CZPA 1L0YB 1E10A 2LVPA 3VVWB 3TEYA 1ET6A 1ZPSA 3P4QB 2WU2B 3BVMA 4E71A 1TZ1A 1BMLC 3AEFB 2JZZA 1D5XC 1Y56A 2CJOA 4BAXA 4TSSA 2VZKD 1IYFA 2J52A 2XK5A 3VH4B 2IDYA 1MVKA 4DHZB 3SHQA 1ZKHA 2D3BA 3W1YA 4CQNA 4DHJB 3WAMA 3B1LX 4HEA1 3H8HA 4F8CB 3EFCA 2WXGA 3OAWA 2WDVB 5IOIA 3NY5A 1R7SA 3BZDB 1QLBB 2REXA 1MHHE 5EDSA 3DPDA 2WU5B 3QQ8B 3LDZE 3L17A 1D6EC 3TEWA 2PVOD 4LTUA 2WXPA 4M00A 4OHJA 2MBQA 1IP9A 4GLSC 3EGRA 1FO4A 2MW5A 2WDQB 4DHZE 3ZXRA 4NY0A 2N7EA 4HROA 3DHHC 2EKIA 3RNBC 5LNK1 2XK5B 4H2AA 2IO1B 1MI0A 5AZGA 4FXCA 3RT3B 2LGIA 1V1PA 5BMHA 2TSSA 3KW5B 2RD0A 3C8YA 3IAS1 4US9A 5IP4D 1E9MA 2NCNA 5JXVA 2HTME 2B3AA 4HJGE 3Q3FA 2JQRB 1YN4A 3PRPB 4FJVB 4KDIC 1XLPA 3TSSA 4A3OA 1QF6A 5KHQA 4KSLC 4GDKA 2E6XA 2Z0EB 2DZIA 1HQRD 4MSQB 1WXSA 1UWXA 3ZXVA 4NNJB 5AUIA 4YTMB 4FHJA 1SEBD 1SJED 1TS3A 3UIPB 4HCNB 2IY1B 1XT9B 1JW9D 4L23A 4MJSA 1UZXB 1ZP0B 1C77A 4GGQA 1Q5WB 1TKYA 1HTOA 2M56B 4EOYA 4ARIA 1WH3A 3ML8A 2SEBD 3AECB 4IW0A 3N30A 1VCBA 5AUKA 4HKQA 1TT5B 4MM3A 1HA5A 1WYWB 2AX5A 4KZ0A 2BYTA 1NI3A 2AQ3B 3ENEA 1VJKA 1GJZA 1AN8A 3ZRCA 4GDKB 2N1WA 2NTTA 2NPTA 2WXRA 1YJJA 1YOVB 2QDFA 2WYQA 2N9EB 4J6IA 2FCSA 1VZ7A 4HLEA 2N4FA 1E6EB 5EE1A 4JPSA 3AMZA 5LXIB 1NVID 3QX1A 2N9PC 1AW7A 2PKOA 1QQRA 5CHWA 3AN1A 3PZ7A 1TJEA 2DYBA 1I4PA 4XWTA 3D32A 1FD6A 3FILA 1SSNA 3AE6B 5BO4B 4FADA 3MTNB 3QAQA 2RGFA 2WS3B 4GDLA 2RR9A 3ZIMA 2JT4B 3C19A 1K53A 4OZAA 2QCZA 2WXLA 4DXFA 2Y3AA 3AEEB 4BFRA 3W5UB 2DAJA 3NVZA 2KQSA 5E6PA 3QIJA 1D4BA 4P16A 2HJ8A 3UQAA 3QCAA 2VZKB 1J0GA 1RLFA 1F2RI 5FR6A 3ZNZB 2W82A 1XLNA 2D3CA 1H4RA 5T8IA 3TIXA 4GDLB 5BYRA 4IWQA 3BINA 5CX3A 4YSXB 4A9AA 1TY2A 2WXOA 4PK1A 2ZW0A 2KWUB 3U7DA 2KN5A 4E74A 5D3IB 1AARA 2QILA 1HZ5A 5E6NA 2GOWA 4XDCA 2G4SA 3DVNU 4C4VB 1TTNA 3CF6E 5GMVA 2W9NA 1F0ZA 3MFGA 1YQBA 4IOIE 4LNIA 1FXTB 2MJDA 1J7BA 2LVOA 4B95A 3NRZA 1E7VA 3RYTA 3ZKJC 1GPXA 1A5RA 3RZFA 3H7SA 3T8MA 4JWSC 2LRWA 2MA9B 2BBCA 1VRAB 1IBXA 4RM8A 1N5XA 5BMIA 5L95C 2MLBA 1SGHA 4KSKC 2RPVA 1WXAA 3DBRI 1BXTA 4A3PA 3Q69A 1EF1A 1XQQA 1UWMA 1V80A 2BS3B 1WYGA 2R61A 3NVYA 2R2QA 2WLBA 1F2RC 3ZJVA 1YJIA 3DBHB 1T0QC 4GIVA 1JCKB 2N9KA 3VRAB 4OW0A 2WDTB 1K51A 3OWEB 3BK2A 2LJIA 4ZRPA 4FN2A 5H92C 3M62B 3AE5B 1B1ZA 3RNCC 4MGYE 4S0RA 4A90A 2MWSB 3MP9A 2BKRB 2Y5PA 3BVZA 1WIAA 4LJPB 2M4NA 4JGHB 4ACFA 4AP4C 5G5GA 1P3QU 1WM3A 1N63A 1KLVA 2FCNA 5J18A 1WZ0A 4A8XC 5HHDG 3MC8A 3MC9A 2BYEA 4MDKE 2OEDA 2K8CA 4ICVA 2JWZA 4LNKA 1HEZE 1Q10A 3APDA 1TKGA 5J2RA 4HDOA 2JRIB 1LXDA 3L13A 1E5WA 3GOEA 3PSEB 2WX0A 4F1SA 1T0SC 4WIPA 1WR6E 1OEYA 1V97A 1P7EA 3VR8B 5AZFA 2ZPNA 1I4QA 1XXGA 5FR3A 5C1ZA 2KC2A 2D3AA 3UF8A 3HM6X 4JWUC 2D10A 2JXXA 3KWVA 2YLMA 2KANA 1WJ4A 4HVBA 1SBBB 1NENB 4IC7B 2ZJDA 2I2YA 3KYDD 2LRUA 2L83A 4GOCA 2KOXA 3CMMB 2J0MA 1RRBA 4W9EA 3E9SA 4YXDB 4BOZB 1F52A 2AQ1B 2INNE 2AEHA 3RI7C 3SR6A 3VDZA 2AWTA 3Q3OC 3QARA 3R66C 4FLHA 3CIRB 2WQYB 1X1MA 1YD8U 3GZNB 2AQ2B 3LB8C 3W2DA 4ARCA 1STEA 2AL6A 1ZXIA 3JVZX 1MJDA 2DZKA 4QAYA 4A55A 4CYEA 2C5LC 1HZ6A 3KUCB 3NG0A 5G55A 4DWFA 4KIKA 3SD5A 2ASQA 1ZDVA 2BKFA 2NBWB 3RFZB 4PS7A 3BYTB 2J53A 2KDEB 4ZRQA 2LGDA 4G0NB 4K3BA 4OZBA 1YIWA 4JIOU 5IN7A 1C3TA 2O2VA 3A9KA 4IUMB 3TMPB 1T3QA 2KJRA 4GB9A 3KVFB 4M0WA 3ZDTA 3P4PB 3ETRA 2KX0A 3DQVA 5I4DA 1PDXA 2N7DA 2CHXA 2MEKA 3R3MA 1YQ4B 1WRDB 2V3NA 3EUB2 3BVGA 3PVLA 3W9CB 2JUOA 2PVGC 3NS8A 1FFVA 3EA6A 2WXJA 5KHOA 1MFWA 4RCOA 4HK2A 3ZVVA 3RD2A 3A9JB 4EUTA 4KIKB 3H9DA 1SIJA 2DAFA 4K7UA 3RNAC 3P4RB 5JHBA 4AOFA 1F1HA 4HXDA 3RNEC 1WJNA 2O2VB 4CHKA 3U4EG 1KRHA 2YVCA 4P6VF 4HKZE 2D11A 1KFYB 4ANVA 1BUIC 1P1AA 5BYSA 3JSVB 1FNUA 3N9YC 4KVGB 2RMMA 1I4GA 3K9OB 5TR5A 1FPYA 4YTNB 2KC1A 4ANWA 1N60A 3RMKC 4A6QA 3L54A 5AEKB 4GMVA 3ZGZA 2KT7A 3N1YC 4MGKE 4HCPB 5C2TB 2FBWB 5IKCM 3WIMA 3EECA 1XO3A 3APFA 2PEAA 4IWOA 4ZYNA 1FM0D 3ZTCA 3GE3C 2KMCA 3RNFC 3PPAA 4BKSD 1CQVA 3KQ4A 1VZ6A 2JXTA 4NJ7A 4XZ4A 4WAAA 4ASWC 1AYFA 1IPGA 3HK0A 4LNFA 3K9PB 1JRUA 2D2QA 3AE8B 3QHTA 5GXGB 1OQQA 2NMQA 4G50A 1J7CA 1T6BX 2L0TA 2K22A 4UDUC 3EFUA 5BMGA 2PE9A 2EKEC 2JRHA 1GB1A 3MJ5A 3P2BA 2BW2A 3HUIA 1P9DU 2J4XA 2J0JA 4AJWA 1SE3A 2K6DB 1LFDA 2K3UA 2RSUA 3DVGY 4RM9A 1DOIA 1UBIA 1UGJA 2DZMA 4MGZE 1VDVA 3IFWB 4L2YA 1VD2A 2MSED 2NTSA 4OZCA 4XGAB 2QMTA 4W9GA 1XD3B 2KYWA 3VTUA 2L32A 1LGRA 1LQBA 3AEBB 3WCQA 4KX6B 3AE7B 2IBIB 4TMAB 2BB6A 1M94A 1CJEA 1WSPA 1FXAA 3HVZA 1V8CA 4LNOA 4OVUA 5J17A 3ZJTA 4K7WA 3SDLC 2WDRB 1L6VA 4P1BC 4N59A 4RMAA 3T3NA 2CR5A 2KX3A 3WAOA 1WE6A 2KKCA 1IGCA 1EU3A 5E6JA 1VLBA 2KK8A 2CHZA 2W55A 2ONQA 1DYQA 4ZHPA 3VUWA 1FCLA 3Q8CA 2K9XA 4EZJA 4S17A 1FNVA 1NEKB 1L2NA 1QOAA 1G6JA 2JWUA 1KLGD 2XNAC 3U52E 2XN9C 4CO7A 2LUEA 4LCDE 3B0AA 3ZYYX 1I4HA 1YMHE 3BYYB 2RDGA 1QT9A 2YEPB 3V3XA 1WX7A 3DBHI 2ZW1A 2L3ZA 4LJOB 3H1UA 2V3PA 4N9F4 5D7GA 3LYYA 3IAM1 3HIZA 1V81A 4ZHOA 1TKEA 3LJ3A 1GC7A 1GAQB 2KMMA 2LVQA 3A1QB 3OG5A 5EE0A 3I9V1 3W5VB 3KLSX 4GSWA 2KTFA 3AV8A 1JWAD 2H89B 1ESFA 2G9HD 2K5PA 4RGMA 4NJCA 3T9LA 2WXFA 2LI5A 4FHKA 3QK0A 3KUDB 4W9LA 1Q1OA 2KVRA 2J42A 1NBFC 2FAZA 4HRSA 3BIID 2JZPA 3Q6BA 2VH2A 1GB4A 4B9KA 1C9FA 2JPHA 3R2IA 2GLSA 4C4VA 3Q3NC 2PPHA 2KQ7A 3NZUA 1H8CA 2OHFA 2QSDA 2KFJA 2NVUI 1ZGUB 3TL5A 4WAFA 1SF0A 2GRIA 2GBMA 2IGDA 5H8YE 4US8A 4P7IA 1J7AA 4TQ1A 3WALA 2C60A 3MC0B 3ONSA 4KDLB 3M3JA 4WWMA 4MT5A 2BGFA 4DDID 2MH7A 2X38A 3U2SC 1WX8A 2Y5CA 3L0WB 1F9JA 3URYA 1E8XA 1UUPA 3N32A 1V2YA 2K1FA 2M1MA 3L08A 4EZKA 4WURA 3P42A 2FUHB 2WHIA 3O65B 3TCAA 2R2OA 3B9JA 1TBEA 4L1BA 2KAJA 3PT2B 1JWUD 1NYRA 3DVNV 3GZNI 4ZYSA 1P98A 3RULA 2L8JA 1L4ZB 4AS1A 2K8BA 2N9XA 4RFBA 2LZ6A 1E8YA 2W3SA 3DBLB 3UIOB 2MQJA 3V6CB 1WJUA 4RNAA 1K52A 3PLUA 4IM2A 4FJZA 3KH0A 1FCCC 2NBUA 2GBNA 2CJNA 2IGHA 3Q8BA 2RDBC 1WI0A 2IY0B 3Q14C 3TEZA 2V4LA 3IXSA 4MGIE 2LGXA 3R7QA 3Q2AC 2MCNB 1WE7A 3O13A 3E56A 3FKYA 2HTHA 2KWVB 3NHEB 4XDDA 2ZPYA 3RUIB 2KVZA 4IWPA 1PGAA 2FNJB 3NZSA 4HPMB 1OQRA 1ET9A 2IO2B 2XBBC 1WFYA 1N61A 3AE4B 1WF9A 5IAAC 4N6EB 3RNGC 3AU5A 1RFKA 3X23A 3SFDB 2ZNVC 2JX5A 1EF5A 2IYDB 1RAXA 3NUHB 2IGGA 2KTRA 2WXQA 2OOBB 4KKJA 1K8RB 3QJZA 4WJNA 2M8SA 1ZUD2 1V6EA 2OJWA 3EC8A 2V0GA 1SE2A 4BBNC 1L6UA 1C79A 1FRRA 4G11A 2WXMA 4WWNA 4NJ6A 2INCC 2FCQA 2D07B 4FA6A 2L7RA 4IKGA 1C76A 2KLGA 4X57B 2O6VD 3RPFC 2HD5B 1FFUA 2AYOB 2GBRA 1PQSA 1UF0A 1TS5A 1JQ4A 4PYUA 3PO0A 1SB3C 1TY0A 4USAA 4RF1A 4HWIB 4WJQA 3J9CA 1RYJA 1WXVA 3AEAB 4BKTA 2A4ZA 2KTRB 3BY4B 4C7YA 1V86A 4I6PA 3H7PA 2KWCA 1EWCA 2D5GA 1RFAA 3PZDA 2KHWB 3GE8C 1WXMA 4JE3B 3OLMD 2ZNVB 4FBJB 5MPOA 2ON8A 4O1NA 1WXQA 4W9HA 3QWZB 2DLBA 3H6NA 3T3OA 1JWSD 4C7ZA 2MBBB 5LXHA 2RPQA 3B2GA 3A9JA 2KWDA 2FE8A 3Q8FA 1PUTA 4A20A 3DBSA 1QILA 1OTRB 3OJ3A 4PS3A 1KOTA 1JMLA 3ECIA 3L10B 1FNWA 2UYZB 2I1JA 3MHZA 3H7PB 3GB1A 2L76A 3WAPA 2KDIA 4EZLA 3A4SC 3AE2B 1PGXA 3C0RB 1TIFA 2A5UA 3AEGB 3I57A 2G4DB 3SFEB 1P7FA 2KQ4X 3JSVA 4LDTD 3AH7A 3L16A 2JYEA 4MH0E 4JQWC 4KZCA 2PW9A 5JHAA 4P1CC 2JVCA 3AE9B 3WANA 4GN1A 2X8XX 2BPSA 2BT6A 1XF5L 1WGHA 4YL8A 1KH0A 4WWOA 2ACZB 4II2B 2WP9B 3PZ8A 5DPRA 2KDMA 2UWQA 1SE9A 1WGYA 3R2TA 2BS2B 4M02A 1S3SG 5LLIA 1L0VB 2LGYA 4MEMA 4RH6A 3BWUD 1ROEA 4HPLB 1P0RA 1T0YA 4NAMA 5JH5C 2W3RA 2KJHB 4F7ZA 4JL9A 1PYWD 1TGZB 1FIQA 5D2MB 1E8WA 4M8MA 4IM3A 1ZXHA 1E8ZA 1GC6A 4GU2A 2LHDA 1EO6A 1YN3A 4ANXA 1WM2A 1Z2MA 3HHMA 5L83A 5HFYA 3FAHA 2O6VA 2G3QB 2LXAA 4LK0M 1E7PB 5E6OA 3VTVA 4D2KA 1SE4A 3ABVB 4Q2JA 3Q8EA 1R4NB 2LHEA 2LD9A 1L7YA 3PHXB 3U7ZA 1CK1A 2LUMA 4AUQC 2GBJA 1E90A 5HKHA 5HG2A 5DPSA 2K8HA 1KF6B 3I63C 4G3XB 4DQOC 3RZWC 3FC4A 2FIDA 4TV3A 3U30A 1QZEA 4DBGA 1WGKA 3ZW3A 4REZA 2BWFA 4ZRKA 2V4IB 2YEPF 4EKUA 2BS4B 3I3TB 2N9LA 3IT4B 1DGJA 1J8CA 2DZJA 3IHPC 1N5WA 2O6VB 5IA7A 3R8BA 4BZAA 5G5HA 3N3KB 2LMCA 2JYTA 4TKNA 2ZCCA 1JALA 1SJHD 1L4DB 1BT0A 2GB1A 1I7HA 2M0XA 4KGSA 4TUUA 2L1AA 1YN5A 3N1ZC 2VRRB 3ZQ4A 2LWPA 3ZRFA 1GG3A 4XWWA 3AM9A 3PTFC 1VZ8A 4K7SA 3QA8A 2PJHA 1L0XB 1UBQA 2WWZA 4W9FA 3W1SC 2IO0B 1OEYJ 1XCQL 2KN4A 2L52A 2V9HA 5FK9C 3CSTA 3HVDA 2CKHB 4TQ0A 4DXGA 1FRDA 1AWDA 2BTEA 2JY6A 3SEBA 2BVCA 1B9RA 4NAWA 2BYFA 2C7HA 1TS4A 2C7NB 4OVVA 3AEDB 3W1SA 3A1QA 3M95A 4WJOA 1LM8B 2BYVE 4ZRJA 3JW0X 1K50A 4B6WA 2PIAA 3WA0A 3N20C 4ZRIA 3M63B 2VH1A 4KKIA 2OJRA 4B0EA 2ZCBA 3DBLI 4XYCA 3VFKA 3ZDMC 1XLQA 1J19A 3NJTA 4KGRA 1SIFA 1V1PB 1ZDXA 1OQYA 4I6LB 1V9JA 1MG8A 1XCTL 5DPWA 4LDTB 2K6QA 2HE7A 2MJ3A 2ZVNA 2HDEA 2KZRA 3DHGC 1IUEA 3VHTC 4YSYB 4YT0B 2M17A 2JF5A 4IDIA 2QEJC 3UQBA 4NQKE 4NAWB 2K25A 1D5ZC 2KFKA 1UH6A 2BQQA 4DXAB 2QHOA 4II3B 3DHIC 3VAWA 1C1YB 1JWBD 2GBKA 1ZOYB 2L0FA 2Z8LA 2BWES 3A4RA 2WXHA 3ZNGC 4ANUA 1EU4A 3LXFA 2LEKA 2M19A 2G1EA 1EUVB 2CHWA 4IG7B 3V6EB 2PMVA 2MP2A 1M4VA 4MJSB 4RF0A 4DK5A 5FKAC 4BKSA 3ZUNA 2WXKA 1WRIA 1ENFA 1QOFA 4MSMB 4MM3B 3DWGC 4NPNA 4YTPB 4RGNA 5C3JB 4W9KA 1GNUA 2GI9A 3ZTDA 1Y8RC 1TZOA 2WNMA 4RGOS 5CTRC 4KGTA 4YWGG 1GUAB 1I42A 3ALBA 3AXCA 3V61A 4PYZA 4EEWA 1FMAD 3U8ZA 3PRZA 2NPTB 4W9CA 2KFKB 1UNSA 3SU8X 3VRBB 2WXIA 1I35A 2N7JA 2KO3A 2IZVB 3P63A 2V1YA 3DWMA 1EWYC 2D3GA 2ZZPB 5EE3A 1N6ZA 3TBLD 2MP2B 1DOYA 2DBYA 3V05A 1YJ1A 2MRPA 2KXJA 4I6NB 4WJPA 3PS6A 2FCMA 2EMTA 4LNNA 2UU7A 3AE1B 2LFIA 1WMHA 4GXBA 2J0KA 3I5JC 2IO3B 3FILB 4C00A 4ICUA 2IJ0A 1UELA 4AQ7A 1ISNA
chains in the Genus database with same CATH topology
3AU4A 5CHVC 3KUZA 4MJSA 1UZXB 4AJYB 4KVGB 4HWIB 4WJQA 1WXVA 4BKTA 2NS5A 3K9OB 2A4ZA 4GGQA 5TR5A 2KTRB 1Q5WB 3BY4B 1U4AA 3IVFA 3V62A 2KC1A 3ZNID 4ANWA 4EOYA 1NDDA 3PGEA 1WH3A 3ML8A 1V86A 3CSFA 3L54A 3H7PA 4I6PA 5AEKB 4IW0A 4HDQA 3N30A 4GMVA 2KWCA 1VCBA 3APCA 4MM3A 4K1RB 1WYWB 3ZO5B 4KZ0A 4HCPB 4MGKE 4AWJA 1WGGA 1UD7A 1RFAA 3PZDA 2CS4A 3ENEA 2KHWB 2DYMA 3WIMA 1WXMA 1GJZA 3EECA 3APFA 2N1VA 3VUXA 2PEAA 4HJKA 4IWOA 3EHVA 2Z0DB 3OLMD 4ZYNA 3ZRCA 2ZNVB 4FBJB 4GDKB 2N1WA 1HE8A 1WMHB 1WX9A 2NPTA 3ZTCA 2KMCA 1WGRA 4W9HA 3PREA 3QWZB 2I1KA 2WYQA 2N9EB 4J6IA 2MBOA 3H6NA 3PPAA 4BKSD 2FCSA 5C23A 2EMSA 4K81A 4HLEA 2MBBB 2N4FA 1S1QB 5LXHA 4NJ7A 2RPQA 4XZ4A 3ZLZA 5LXIB 4WAAA 4ASWC 3A9JA 1IPGA 3HK0A 2DX5B 3QX1A 1R4MI 3K9PB 2N9PC 1JRUA 2CU1A 4A20A 3DBSA 2D2QA 1OTRB 1Z5SB 3OJ3A 4PS3A 1KOTA 3QHTA 5CHWA 4BKGA 1V49A 3ECIA 3L10B 4G50A 2UYZB 4W9DA 2I1JA 3H7PB 2L0TA 2L76A 3WAPA 5CHFA 2KDIA 2DYBA 4EZLA 3EFUA 3D32A 3A4SC 2PE9A 2EKEC 5BO4B 4BBNF 4FADA 3MTNB 3C0RB 1WJ6A 2JRHA 2A5UA 3QAQA 2G4DB 2RGFA 3P2BA 2L05A 4GDLA 3JSVA 2RR9A 3AI5A 1P9DU 3X0WA 4LDTD 1WR1A 2J0JA 2G45B 3DCGA 5D94A 4AJWA 3ZIMA 3PV1A 3L16A 2K6DB 4MH0E 2JT4B 1LFDA 4JQWC 2RSUA 3DVGY 4KZCA 3DDCB 4RM9A 1UBIA 2KMAA 5JHAA 2C9WB 4E3CA 2JVCA 3WANA 2DZMA 4GN1A 4MGZE 4EFOA 2BPSA 3IFWB 1WGHA 1VD2A 4YL8A 2MSED 4W9GA 3VTUA 1XD3B 4BFRA 2DAJA 3UINB 2KQSA 4WWOA 5E6PA 3QIJA 4II2B 4XC2A 4DDGD 1LQBA 3DOWA 5DPRA 3VXWA 2HJ8A 4DHJD 2FIFA 3IBEA 3UQAA 2UWQA 3PLVA 1SE9A 1WGYA 3QCAA 4KV2A 1S3SG 2IBIB 1J0GA 1M94A 5LLIA 2LGYA 2ZVOA 4MEMA 1RLFA 1YX6B 5J17A 4OVUA 4HPLB 1P0RA 1T0YA 2XEWA 3PRMB 5JH5C 4K7WA 3SDLC 2KJHB 2NBVB 5FR6A 3RCZA 3ZNZB 4RMAA 1WGDA 1H4RA 4IM0A 4JL9A 4F7ZA 3TIXA 1TGZB 2CR5A 2KX3A 4GDLB 1WE6A 1E8WA 5D2MB 2KKCA 3WAOA 2DENB 3BINA 4IWQA 3DVGX 4M8MA 5CX3A 3VUYA 3KYCD 4IM3A 2KK8A 2CHZA 1E8ZA 1GC6A 4GU2A 2MBHA 1R4NI 2KWUB 1EO6A 3U7DA 2KN5A 4ANXA 4E74A 1WM2A 3VUWA 1AARA 4EZJA 1Z2MA 3HHMA 2DHZA 1KM7A 5E6NA 5L83A 2GOWA 4M8NA 2G4SA 3DVNU 1ZW7A 1TTNA 2V3SA 2O6VA 3CF6E 2G3QB 2C7MB 3IG3A 1L2NA 1KJTA 2LXAA 5GMVA 1G6JA 2KD0A 5E6OA 3VTVA 2W9NA 1YQBA 3V60A 3JYUA 1D3ZA 2KDBA 3MHSD 5JZEB 1FXTB 4CO7A 4ZDVA 2LUEA 2LVOA 3OJ4B 2LD9A 3TJPA 2Z59B 2KNBA 4B95A 3NOBA 1L7YA 1E7VA 1WZ3A 3PHXB 4LCDE 3B0AA 3RYTA 3VH3B 3ZKJC 1CMXB 1A5RA 3RZFA 4AUQC 3H7SA 2GBJA 3T8MA 4XX5A 1V5TA 1E90A 3A33B 5HKHA 5DPSA 2K8HA 1OGWA 2LRWA 1WX7A 3DBHI 2DYOA 2MA9B 4WWPA 4G3XB 2L3ZA 4LJOB 3H1UA 4N9F4 3RZWC 5D7GA 4RM8A 2FIDA 5L95C 3HIZA 1V81A 2MLBA 3HM3A 4TV3A 3U30A 1SGHA 2WX1A 4JLCA 4KSKC 1YX5B 2LJ5A 1QZEA 3LJ3A 1GC7A 4DBGA 1WXAA 3ZW3A 3DBRI 2LVQA 2KJ6A 3B08A 4MELA 2BWFA 4A3PA 3A1QB 4ZRKA 5G2NA 1EF1A 1XQQA 3UGBB 1V80A 4EKUA 3AULA 3I3TB 2KDFB 2Y5BB 4GSWA 2DZJA 1J8CA 2R2QA 3IHPC 2KTFA 4GIVA 2O6VB 5IA7A 4FJYA 2WDTB 3N3KB 2GMIC 3T9LA 3MJWA 4FN2A 4TKNA 3M62B 2ZCCA 3VTWA 4MGYE 2PE6B 1WY8A 1BT0A 2LI5A 4FHKA 2MWSB 3QK0A 2BKRB 3KUDB 1Q0WB 2LXCA 4W9LA 1Q1OA 1WIAA 2KVRA 2L00B 2M4NA 4LJPB 1NBFC 2FAZA 2M0XA 3S2AA 4TUUA 4JGHB 2J7QB 4AP4C 1P3QU 1E7UA 1WM3A 4B9KA 2VRRB 2JPHA 2LWPA 2ZEQA 3ZRFA 1KLVA 2FCNA 5J18A 1GG3A 2PPHA 1WZ0A 1NI2A 2KQ7A 3NZUA 3PTFC 1H8CA 4K7SA 3QA8A 2PJHA 2BYEA 4MDKE 2K8CA 1UBQA 2WWZA 2KFJA 2NVUI 1ZGUB 4ICVA 2JWZA 4W9FA 3TL5A 3W1SC 4W9IA 2IO0B 4NQLB 3APDA 3R7RA 1OEYJ 2GBMA 5J2RA 2NR2A 4HDOA 2JRIB 3QC8B 4P7IA 1LXDA 4TQ1A 5DPTA 3WALA 3Q3JA 4FULA 3L13A 3CSTA 1UGMA 4URKA 1E5WA 2C60A 2CKHB 3GOEA 3PSEB 3ONSA 3PHWB 4KDLB 2WX0A 4WQOB 3M3JA 5DCNA 4F1SA 2K39A 5AZHA 2MX2A 4PS8A 4TQ0A 2LASA 1WR6E 1OEYA 2KLCA 2BGFA 2JY6A 3VQIA 4DDID 5AZFA 2JZ3B 2ZPNA 5D6JB 4NAWA 2BYFA 1V5OA 2C7HA 2C7NB 4BVUC 4OVVA 1WX8A 4W9JA 5C1ZA 3ZNHB 3ML9A 2KC2A 3A9KB 3W1SA 3L0WB 3A1QA 3HM6X 3M95A 1F9JA 4WJOA 3UF8A 1E8XA 2D10A 2JXXA 4BOSC 1LM8B 3N32A 1V2YA 2BYVE 2MBEA 4M0WB 2YLMA 2K1FA 2BF8B 3JW0X 4ZRJA 2AL3A 2M1MA 3L08A 4EZKA 2KANA 1WJ4A 4B6WA 3WA0A 4HVBA 4ZRIA 3M63B 4IC7B 2OJRA 2ZJDA 3KYDD 2ZCBA 2LRUA 3DBLI 3VFKA 3ZDMC 2FUHB 4GOCA 2KOXA 2LVPA 3CMMB 3O65B 2J0MA 1J19A 3VVWB 1RRBA 3TCAA 4W9EA 2R2OA 1SIFA 1TBEA 1OQYA 3PT2B 4I6LB 1V9JA 1MG8A 3DVNV 3GZNI 4BOZB 5DPWA 2AEHA 1P98A 2K6QA 4LDTB 4E71A 3RULA 2L8JA 2HE7A 2ZVNA 1TZ1A 2JZZA 2K8BA 2KZRA 2N9XA 3VDZA 2LZ6A 1E8YA 2AWTA 3QARA 3VHTC 3R66C 4FLHA 3UIOB 1IYFA 2XK5A 2MQJA 3V6CB 3VH4B 2M17A 4DHZB 2JF5A 1WJUA 1X1MA 3UQBA 1YD8U 4NQKE 4NAWB 2K25A 3SHQA 3PLUA 1ZKHA 1UH6A 2KFKA 4IM2A 4FJZA 4DXAB 2QHOA 4II3B 3KH0A 2NBUA 3VAWA 1C1YB 2GBNA 3W1YA 2GBKA 4DHJB 3WAMA 2L0FA 3A4RA 2AL6A 1WI0A 2BWES 2IY0B 3B1LX 3ZNGC 4ANUA 3JVZX 4F8CB 2V4LA 1EUVB 2DZKA 4MGIE 2CHWA 4IG7B 2LGXA 3V6EB 2MP2A 3OAWA 3R7QA 4CYEA 4MJSB 2MCNB 2C5LC 3NY5A 1WE7A 3KUCB 4DK5A 5G55A 4DWFA 2REXA 4KIKA 3SD5A 2HTHA 2ASQA 2BKFA 2KWVB 2NBWB 3NHEB 4BKSA 2ZPYA 4PS7A 3RUIB 3ZUNA 3DPDA 5EDSA 2KDEB 4IWPA 2LGDA 3QQ8B 4G0NB 3LDZE 2FNJB 3NZSA 1YIWA 3L17A 4JIOU 4MSMB 4HPMB 1C3TA 2O2VA 2IO2B 2XBBC 4NPNA 1WFYA 2MBQA 3A9KA 4IUMB 3TMPB 1IP9A 2KJRA 4W9KA 4GB9A 3KVFB 2MW5A 1GNUA 4DHZE 3ZTDA 1WF9A 1Y8RC 4NY0A 3ZDTA 2N7EA 5CTRC 5IAAC 1GUAB 2KX0A 1I42A 3ALBA 3AU5A 3DQVA 2XK5B 3AXCA 2IO1B 2N7DA 3V61A 3X23A 2CHXA 4PYZA 4EEWA 3R3MA 3U8ZA 2ZNVC 3PRZA 5AZGA 1WRDB 2NPTB 4W9CA 1EF5A 2IYDB 2KFKB 3SU8X 1RAXA 3PVLA 3RT3B 2KTRA 1I35A 2JUOA 2OOBB 2KO3A 2IZVB 3NS8A 2V1YA 1K8RB 3QJZA 2D3GA 2ZZPB 2M8SA 2RD0A 3KW5B 4WJNA 5KHOA 1V6EA 4HK2A 3TBLD 2MP2B 3EC8A 4BBNC 2NCNA 3ZVVA 3RD2A 3A9JB 4EUTA 2B3AA 3Q3FA 3PRPB 1YJ1A 2MRPA 3H9DA 2KXJA 4FJVB 4G11A 4KIKB 2DAFA 4I6NB 4K7UA 4KDIC 4WJPA 4WWNA 4NJ6A 5JHBA 2FCQA 4A3OA 3PS6A 2D07B 2EMTA 2FCMA 4FA6A 5KHQA 2L7RA 4KSLC 4GDKA 4AOFA 2KLGA 4HXDA 4X57B 1WMHA 2O6VD 2Z0EB 2DZIA 4MSQB 2HD5B 1WJNA 1WXSA 2O2VB 4GXBA 2J0KA 4CHKA 2AYOB 2GBRA 4NNJB 2YVCA 1PQSA 2IO3B 4ICUA 4FHJA 2D11A 3UIPB 4HCNB 2IY1B 1UELA 1XT9B 4ANVA 4PYUA 1ISNA 1P1AA 3JSVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU4 A;  5CHV C;  3KUZ A;  4MJS A;  1UZX B;  4AJY B;  4KVG B;  4HWI B;  4WJQ A;  1WXV A;  4BKT A;  2NS5 A;  3K9O B;  2A4Z A;  4GGQ A;  5TR5 A;  2KTR B;  1Q5W B;  3BY4 B;  1U4A A;  3IVF A;  3V62 A;  2KC1 A;  3ZNI D;  4ANW A;  4EOY A;  1NDD A;  3PGE A;  1WH3 A;  3ML8 A;  1V86 A;  3CSF A;  3L54 A;  3H7P A;  4I6P A;  5AEK B;  4IW0 A;  4HDQ A;  3N30 A;  4GMV A;  2KWC A;  1VCB A;  3APC A;  4MM3 A;  4K1R B;  1WYW B;  3ZO5 B;  4KZ0 A;  4HCP B;  4MGK E;  4AWJ A;  1WGG A;  1UD7 A;  1RFA A;  3PZD A;  2CS4 A;  3ENE A;  2KHW B;  2DYM A;  3WIM A;  1WXM A;  1GJZ A;  3EEC A;  3APF A;  2N1V A;  3VUX A;  2PEA A;  4HJK A;  4IWO A;  3EHV A;  2Z0D B;  3OLM D;  4ZYN A;  3ZRC A;  2ZNV B;  4FBJ B;  4GDK B;  2N1W A;  1HE8 A;  1WMH B;  1WX9 A;  2NPT A;  3ZTC A;  2KMC A;  1WGR A;  4W9H A;  3PRE A;  3QWZ B;  2I1K A;  2WYQ A;  2N9E B;  4J6I A;  2MBO A;  3H6N A;  3PPA A;  4BKS D;  2FCS A;  5C23 A;  2EMS A;  4K81 A;  4HLE A;  2MBB B;  2N4F A;  1S1Q B;  5LXH A;  4NJ7 A;  2RPQ A;  4XZ4 A;  3ZLZ A;  5LXI B;  4WAA A;  4ASW C;  3A9J A;  1IPG A;  3HK0 A;  2DX5 B;  3QX1 A;  1R4M I;  3K9P B;  2N9P C;  1JRU A;  2CU1 A;  4A20 A;  3DBS A;  2D2Q A;  1OTR B;  1Z5S B;  3OJ3 A;  4PS3 A;  1KOT A;  3QHT A;  5CHW A;  4BKG A;  1V49 A;  3ECI A;  3L10 B;  4G50 A;  2UYZ B;  4W9D A;  2I1J A;  3H7P B;  2L0T A;  2L76 A;  3WAP A;  5CHF A;  2KDI A;  2DYB A;  4EZL A;  3EFU A;  3D32 A;  3A4S C;  2PE9 A;  2EKE C;  5BO4 B;  4BBN F;  4FAD A;  3MTN B;  3C0R B;  1WJ6 A;  2JRH A;  2A5U A;  3QAQ A;  2G4D B;  2RGF A;  3P2B A;  2L05 A;  4GDL A;  3JSV A;  2RR9 A;  3AI5 A;  1P9D U;  3X0W A;  4LDT D;  1WR1 A;  2J0J A;  2G45 B;  3DCG A;  5D94 A;  4AJW A;  3ZIM A;  3PV1 A;  3L16 A;  2K6D B;  4MH0 E;  2JT4 B;  1LFD A;  4JQW C;  2RSU A;  3DVG Y;  4KZC A;  3DDC B;  4RM9 A;  1UBI A;  2KMA A;  5JHA A;  2C9W B;  4E3C A;  2JVC A;  3WAN A;  2DZM A;  4GN1 A;  4MGZ E;  4EFO A;  2BPS A;  3IFW B;  1WGH A;  1VD2 A;  4YL8 A;  2MSE D;  4W9G A;  3VTU A;  1XD3 B;  4BFR A;  2DAJ A;  3UIN B;  2KQS A;  4WWO A;  5E6P A;  3QIJ A;  4II2 B;  4XC2 A;  4DDG D;  1LQB A;  3DOW A;  5DPR A;  3VXW A;  2HJ8 A;  4DHJ D;  2FIF A;  3IBE A;  3UQA A;  2UWQ A;  3PLV A;  1SE9 A;  1WGY A;  3QCA A;  4KV2 A;  1S3S G;  2IBI B;  1J0G A;  1M94 A;  5LLI A;  2LGY A;  2ZVO A;  4MEM A;  1RLF A;  1YX6 B;  5J17 A;  4OVU A;  4HPL B;  1P0R A;  1T0Y A;  2XEW A;  3PRM B;  5JH5 C;  4K7W A;  3SDL C;  2KJH B;  2NBV B;  5FR6 A;  3RCZ A;  3ZNZ B;  4RMA A;  1WGD A;  1H4R A;  4IM0 A;  4JL9 A;  4F7Z A;  3TIX A;  1TGZ B;  2CR5 A;  2KX3 A;  4GDL B;  1WE6 A;  1E8W A;  5D2M B;  2KKC A;  3WAO A;  2DEN B;  3BIN A;  4IWQ A;  3DVG X;  4M8M A;  5CX3 A;  3VUY A;  3KYC D;  4IM3 A;  2KK8 A;  2CHZ A;  1E8Z A;  1GC6 A;  4GU2 A;  2MBH A;  1R4N I;  2KWU B;  1EO6 A;  3U7D A;  2KN5 A;  4ANX A;  4E74 A;  1WM2 A;  3VUW A;  1AAR A;  4EZJ A;  1Z2M A;  3HHM A;  2DHZ A;  1KM7 A;  5E6N A;  5L83 A;  2GOW A;  4M8N A;  2G4S A;  3DVN U;  1ZW7 A;  1TTN A;  2V3S A;  2O6V A;  3CF6 E;  2G3Q B;  2C7M B;  3IG3 A;  1L2N A;  1KJT A;  2LXA A;  5GMV A;  1G6J A;  2KD0 A;  5E6O A;  3VTV A;  2W9N A;  1YQB A;  3V60 A;  3JYU A;  1D3Z A;  2KDB A;  3MHS D;  5JZE B;  1FXT B;  4CO7 A;  4ZDV A;  2LUE A;  2LVO A;  3OJ4 B;  2LD9 A;  3TJP A;  2Z59 B;  2KNB A;  4B95 A;  3NOB A;  1L7Y A;  1E7V A;  1WZ3 A;  3PHX B;  4LCD E;  3B0A A;  3RYT A;  3VH3 B;  3ZKJ C;  1CMX B;  1A5R A;  3RZF A;  4AUQ C;  3H7S A;  2GBJ A;  3T8M A;  4XX5 A;  1V5T A;  1E90 A;  3A33 B;  5HKH A;  5DPS A;  2K8H A;  1OGW A;  2LRW A;  1WX7 A;  3DBH I;  2DYO A;  2MA9 B;  4WWP A;  4G3X B;  2L3Z A;  4LJO B;  3H1U A;  4N9F 4;  3RZW C;  5D7G A;  4RM8 A;  2FID A;  5L95 C;  3HIZ A;  1V81 A;  2MLB A;  3HM3 A;  4TV3 A;  3U30 A;  1SGH A;  2WX1 A;  4JLC A;  4KSK C;  1YX5 B;  2LJ5 A;  1QZE A;  3LJ3 A;  1GC7 A;  4DBG A;  1WXA A;  3ZW3 A;  3DBR I;  2LVQ A;  2KJ6 A;  3B08 A;  4MEL A;  2BWF A;  4A3P A;  3A1Q B;  4ZRK A;  5G2N A;  1EF1 A;  1XQQ A;  3UGB B;  1V80 A;  4EKU A;  3AUL A;  3I3T B;  2KDF B;  2Y5B B;  4GSW A;  2DZJ A;  1J8C A;  2R2Q A;  3IHP C;  2KTF A;  4GIV A;  2O6V B;  5IA7 A;  4FJY A;  2WDT B;  3N3K B;  2GMI C;  3T9L A;  3MJW A;  4FN2 A;  4TKN A;  3M62 B;  2ZCC A;  3VTW A;  4MGY E;  2PE6 B;  1WY8 A;  1BT0 A;  2LI5 A;  4FHK A;  2MWS B;  3QK0 A;  2BKR B;  3KUD B;  1Q0W B;  2LXC A;  4W9L A;  1Q1O A;  1WIA A;  2KVR A;  2L00 B;  2M4N A;  4LJP B;  1NBF C;  2FAZ A;  2M0X A;  3S2A A;  4TUU A;  4JGH B;  2J7Q B;  4AP4 C;  1P3Q U;  1E7U A;  1WM3 A;  4B9K A;  2VRR B;  2JPH A;  2LWP A;  2ZEQ A;  3ZRF A;  1KLV A;  2FCN A;  5J18 A;  1GG3 A;  2PPH A;  1WZ0 A;  1NI2 A;  2KQ7 A;  3NZU A;  3PTF C;  1H8C A;  4K7S A;  3QA8 A;  2PJH A;  2BYE A;  4MDK E;  2K8C A;  1UBQ A;  2WWZ A;  2KFJ A;  2NVU I;  1ZGU B;  4ICV A;  2JWZ A;  4W9F A;  3TL5 A;  3W1S C;  4W9I A;  2IO0 B;  4NQL B;  3APD A;  3R7R A;  1OEY J;  2GBM A;  5J2R A;  2NR2 A;  4HDO A;  2JRI B;  3QC8 B;  4P7I A;  1LXD A;  4TQ1 A;  5DPT A;  3WAL A;  3Q3J A;  4FUL A;  3L13 A;  3CST A;  1UGM A;  4URK A;  1E5W A;  2C60 A;  2CKH B;  3GOE A;  3PSE B;  3ONS A;  3PHW B;  4KDL B;  2WX0 A;  4WQO B;  3M3J A;  5DCN A;  4F1S A;  2K39 A;  5AZH A;  2MX2 A;  4PS8 A;  4TQ0 A;  2LAS A;  1WR6 E;  1OEY A;  2KLC A;  2BGF A;  2JY6 A;  3VQI A;  4DDI D;  5AZF A;  2JZ3 B;  2ZPN A;  5D6J B;  4NAW A;  2BYF A;  1V5O A;  2C7H A;  2C7N B;  4BVU C;  4OVV A;  1WX8 A;  4W9J A;  5C1Z A;  3ZNH B;  3ML9 A;  2KC2 A;  3A9K B;  3W1S A;  3L0W B;  3A1Q A;  3HM6 X;  3M95 A;  1F9J A;  4WJO A;  3UF8 A;  1E8X A;  2D10 A;  2JXX A;  4BOS C;  1LM8 B;  3N32 A;  1V2Y A;  2BYV E;  2MBE A;  4M0W B;  2YLM A;  2K1F A;  2BF8 B;  3JW0 X;  4ZRJ A;  2AL3 A;  2M1M A;  3L08 A;  4EZK A;  2KAN A;  1WJ4 A;  4B6W A;  3WA0 A;  4HVB A;  4ZRI A;  3M63 B;  4IC7 B;  2OJR A;  2ZJD A;  3KYD D;  2ZCB A;  2LRU A;  3DBL I;  3VFK A;  3ZDM C;  2FUH B;  4GOC A;  2KOX A;  2LVP A;  3CMM B;  3O65 B;  2J0M A;  1J19 A;  3VVW B;  1RRB A;  3TCA A;  4W9E A;  2R2O A;  1SIF A;  1TBE A;  1OQY A;  3PT2 B;  4I6L B;  1V9J A;  1MG8 A;  3DVN V;  3GZN I;  4BOZ B;  5DPW A;  2AEH A;  1P98 A;  2K6Q A;  4LDT B;  4E71 A;  3RUL A;  2L8J A;  2HE7 A;  2ZVN A;  1TZ1 A;  2JZZ A;  2K8B A;  2KZR A;  2N9X A;  3VDZ A;  2LZ6 A;  1E8Y A;  2AWT A;  3QAR A;  3VHT C;  3R66 C;  4FLH A;  3UIO B;  1IYF A;  2XK5 A;  2MQJ A;  3V6C B;  3VH4 B;  2M17 A;  4DHZ B;  2JF5 A;  1WJU A;  1X1M A;  3UQB A;  1YD8 U;  4NQK E;  4NAW B;  2K25 A;  3SHQ A;  3PLU A;  1ZKH A;  1UH6 A;  2KFK A;  4IM2 A;  4FJZ A;  4DXA B;  2QHO A;  4II3 B;  3KH0 A;  2NBU A;  3VAW A;  1C1Y B;  2GBN A;  3W1Y A;  2GBK A;  4DHJ B;  3WAM A;  2L0F A;  3A4R A;  2AL6 A;  1WI0 A;  2BWE S;  2IY0 B;  3B1L X;  3ZNG C;  4ANU A;  3JVZ X;  4F8C B;  2V4L A;  1EUV B;  2DZK A;  4MGI E;  2CHW A;  4IG7 B;  2LGX A;  3V6E B;  2MP2 A;  3OAW A;  3R7Q A;  4CYE A;  4MJS B;  2MCN B;  2C5L C;  3NY5 A;  1WE7 A;  3KUC B;  4DK5 A;  5G55 A;  4DWF A;  2REX A;  4KIK A;  3SD5 A;  2HTH A;  2ASQ A;  2BKF A;  2KWV B;  2NBW B;  3NHE B;  4BKS A;  2ZPY A;  4PS7 A;  3RUI B;  3ZUN A;  3DPD A;  5EDS A;  2KDE B;  4IWP A;  2LGD A;  3QQ8 B;  4G0N B;  3LDZ E;  2FNJ B;  3NZS A;  1YIW A;  3L17 A;  4JIO U;  4MSM B;  4HPM B;  1C3T A;  2O2V A;  2IO2 B;  2XBB C;  4NPN A;  1WFY A;  2MBQ A;  3A9K A;  4IUM B;  3TMP B;  1IP9 A;  2KJR A;  4W9K A;  4GB9 A;  3KVF B;  2MW5 A;  1GNU A;  4DHZ E;  3ZTD A;  1WF9 A;  1Y8R C;  4NY0 A;  3ZDT A;  2N7E A;  5CTR C;  5IAA C;  1GUA B;  2KX0 A;  1I42 A;  3ALB A;  3AU5 A;  3DQV A;  2XK5 B;  3AXC A;  2IO1 B;  2N7D A;  3V61 A;  3X23 A;  2CHX A;  4PYZ A;  4EEW A;  3R3M A;  3U8Z A;  2ZNV C;  3PRZ A;  5AZG A;  1WRD B;  2NPT B;  4W9C A;  1EF5 A;  2IYD B;  2KFK B;  3SU8 X;  1RAX A;  3PVL A;  3RT3 B;  2KTR A;  1I35 A;  2JUO A;  2OOB B;  2KO3 A;  2IZV B;  3NS8 A;  2V1Y A;  1K8R B;  3QJZ A;  2D3G A;  2ZZP B;  2M8S A;  2RD0 A;  3KW5 B;  4WJN A;  5KHO A;  1V6E A;  4HK2 A;  3TBL D;  2MP2 B;  3EC8 A;  4BBN C;  2NCN A;  3ZVV A;  3RD2 A;  3A9J B;  4EUT A;  2B3A A;  3Q3F A;  3PRP B;  1YJ1 A;  2MRP A;  3H9D A;  2KXJ A;  4FJV B;  4G11 A;  4KIK B;  2DAF A;  4I6N B;  4K7U A;  4KDI C;  4WJP A;  4WWN A;  4NJ6 A;  5JHB A;  2FCQ A;  4A3O A;  3PS6 A;  2D07 B;  2EMT A;  2FCM A;  4FA6 A;  5KHQ A;  2L7R A;  4KSL C;  4GDK A;  4AOF A;  2KLG A;  4HXD A;  4X57 B;  1WMH A;  2O6V D;  2Z0E B;  2DZI A;  4MSQ B;  2HD5 B;  1WJN A;  1WXS A;  2O2V B;  4GXB A;  2J0K A;  4CHK A;  2AYO B;  2GBR A;  4NNJ B;  2YVC A;  1PQS A;  2IO3 B;  4ICU A;  4FHJ A;  2D11 A;  3UIP B;  4HCN B;  2IY1 B;  1UEL A;  1XT9 B;  4ANV A;  4PYU A;  1ISN A;  1P1A A;  3JSV B; 
#chains in the Genus database with same CATH topology
 3AU4 A;  5CHV C;  3KUZ A;  4AJY B;  2SAK A;  1MHX A;  2NS5 A;  3IVF A;  1U4A A;  3V62 A;  3ZNI D;  1NDD A;  1TS2 A;  3PGE A;  3IT6 B;  1IGD A;  3RN9 C;  2RDH A;  3CSF A;  4HDQ A;  3APC A;  4K1R B;  1JWM D;  3ZO5 B;  4AWJ A;  1WGG A;  1UD7 A;  4ITK A;  4PT5 A;  2CS4 A;  1PGB A;  2DYM A;  3AE3 B;  2N1V A;  3VUX A;  4HJK A;  3EHV A;  2Z0D B;  1HE8 A;  2EEL A;  1WMH B;  1WX9 A;  1WGR A;  3PRE A;  2LGS A;  2I1K A;  2MBO A;  1EM7 A;  5C23 A;  2EMS A;  2HJ1 A;  4K81 A;  3P4S B;  1S1Q B;  3ZLZ A;  1HTQ A;  2DNF A;  2DX5 B;  3L4P A;  1N62 A;  2QJL A;  1R4M I;  4J3O D;  4B0M A;  2CU1 A;  1Z5S B;  3HRD D;  4BKG A;  1V49 A;  4W9D A;  5CHF A;  3Q8A A;  1L5P A;  4BBN F;  4JX1 C;  1T0R C;  1WJ6 A;  1D5M C;  3P1M A;  1GOZ A;  2L05 A;  3X0W A;  3AI5 A;  1WR1 A;  3DCG A;  2G45 B;  5D94 A;  1DOX A;  3NVW A;  1JRO A;  3PV1 A;  4MH8 A;  1HXY D;  3DDC B;  2KMA A;  4LLG M;  2C9W B;  4E3C A;  3CWI A;  4EFO A;  1A70 A;  4EE2 A;  3UIN B;  5EE9 A;  1IBX B;  4HPP A;  4XC2 A;  4DDG D;  3DOW A;  2PTL A;  3VXW A;  4DHJ D;  2FIF A;  3IBE A;  3PLV A;  3N1X C;  4KV2 A;  2N0S B;  1ACC A;  1V1O A;  2JU6 X;  2FUG 1;  2KAC A;  3GP7 A;  2ZVO A;  1YX6 B;  2K0P A;  3PRM B;  2XEW A;  3TUO A;  2NBV B;  2PLP A;  3RCZ A;  4NZL B;  1LO5 D;  1WGD A;  1XLO A;  4IM0 A;  2Q5W D;  2DEN B;  3DVG X;  3VUY A;  3KYC D;  3VR9 B;  5IO9 A;  2MBH A;  1R4N I;  2W54 A;  4XE0 A;  4R3D A;  2DHZ A;  1KM7 A;  2IND C;  4N58 A;  1PFD A;  1WWT A;  3IG3 A;  4M8N A;  1ZW7 A;  2JSV X;  2V3S A;  2C7M B;  3TEX A;  1KJT A;  2INP E;  1YQ3 B;  2KD0 A;  2QIE B;  1C4C A;  4C56 C;  2CU3 A;  3JYU A;  3V60 A;  1D3Z A;  1KTK A;  2KDB A;  3MHS D;  5JZE B;  3OJ4 B;  3TJP A;  2Z59 B;  2KNB A;  3NOB A;  1WZ3 A;  3VH3 B;  1CMX B;  3NZ3 A;  1MG4 A;  1V5T A;  4K3C A;  4XX5 A;  1C4P A;  1VR9 A;  3A33 B;  1OGW A;  2DYO A;  4WWP A;  4OVZ A;  4WH4 A;  2I38 A;  2MJE A;  1T5X D;  1FEH A;  4C80 A;  4MAC A;  3HM3 A;  2WX1 A;  4JLC A;  1YX5 B;  2M0A A;  2LJ5 A;  5HI1 A;  1JRP A;  2KJ6 A;  3B08 A;  4WQM A;  4MEL A;  5G2N A;  3UGB B;  1NYQ A;  3AUL A;  2B76 B;  2KDF B;  2Y5B B;  1C4A A;  1QKZ A;  1ZE3 D;  4FJY A;  2GMI C;  2WXN A;  3MJW A;  1R4M B;  1E0Z A;  3NVV A;  2H88 B;  3DBR B;  3VTW A;  5D3D A;  2PE6 B;  1C78 A;  1WY8 A;  1XEE A;  1OFF A;  1Q0W B;  2LXC A;  2L00 B;  3S2A A;  3NS1 A;  1F77 A;  4YSZ B;  2J7Q B;  1E7U A;  2ICI A;  2ZEQ A;  3ZJU A;  1KLU D;  1TYG B;  1NI2 A;  4ZOH C;  2IPK D;  3Q3M C;  4W9I A;  4NQL B;  3R7R A;  4RGT A;  1RWS A;  2NR2 A;  2WGS A;  1MPE A;  3QC8 B;  5DPT A;  2QC8 A;  3Q3J A;  4FUL A;  1UGM A;  4URK A;  3KWL A;  3PHW B;  4WQO B;  1I4X A;  5DCN A;  2K39 A;  1YNT E;  5AZH A;  3B2F A;  2E3T A;  2MX2 A;  5BYQ A;  2MHJ A;  4PS8 A;  2LAS A;  3BK1 A;  2BB5 A;  2KLC A;  1I4R A;  3VQI A;  2DWQ A;  2JZ3 B;  1QOG A;  5D6J B;  1V5O A;  4M01 A;  4BVU C;  4W9J A;  1RM6 C;  3ML9 A;  3ZNH B;  3A9K B;  3UI3 A;  1SXT A;  3GS2 A;  4BOS C;  1FXI A;  1QOB A;  2MBE A;  4M0W B;  4ZDV A;  2BF8 B;  3AB5 A;  2AL3 A;  5TSS A;  1CZP A;  1L0Y B;  1E10 A;  2LVP A;  3VVW B;  3TEY A;  1ET6 A;  1ZPS A;  3P4Q B;  2WU2 B;  3BVM A;  4E71 A;  1TZ1 A;  1BML C;  3AEF B;  2JZZ A;  1D5X C;  1Y56 A;  2CJO A;  4BAX A;  4TSS A;  2VZK D;  1IYF A;  2J52 A;  2XK5 A;  3VH4 B;  2IDY A;  1MVK A;  4DHZ B;  3SHQ A;  1ZKH A;  2D3B A;  3W1Y A;  4CQN A;  4DHJ B;  3WAM A;  3B1L X;  4HEA 1;  3H8H A;  4F8C B;  3EFC A;  2WXG A;  3OAW A;  2WDV B;  5IOI A;  3NY5 A;  1R7S A;  3BZD B;  1QLB B;  2REX A;  1MHH E;  5EDS A;  3DPD A;  2WU5 B;  3QQ8 B;  3LDZ E;  3L17 A;  1D6E C;  3TEW A;  2PVO D;  4LTU A;  2WXP A;  4M00 A;  4OHJ A;  2MBQ A;  1IP9 A;  4GLS C;  3EGR A;  1FO4 A;  2MW5 A;  2WDQ B;  4DHZ E;  3ZXR A;  4NY0 A;  2N7E A;  4HRO A;  3DHH C;  2EKI A;  3RNB C;  5LNK 1;  2XK5 B;  4H2A A;  2IO1 B;  1MI0 A;  5AZG A;  4FXC A;  3RT3 B;  2LGI A;  1V1P A;  5BMH A;  2TSS A;  3KW5 B;  2RD0 A;  3C8Y A;  3IAS 1;  4US9 A;  5IP4 D;  1E9M A;  2NCN A;  5JXV A;  2HTM E;  2B3A A;  4HJG E;  3Q3F A;  2JQR B;  1YN4 A;  3PRP B;  4FJV B;  4KDI C;  1XLP A;  3TSS A;  4A3O A;  1QF6 A;  5KHQ A;  4KSL C;  4GDK A;  2E6X A;  2Z0E B;  2DZI A;  1HQR D;  4MSQ B;  1WXS A;  1UWX A;  3ZXV A;  4NNJ B;  5AUI A;  4YTM B;  4FHJ A;  1SEB D;  1SJE D;  1TS3 A;  3UIP B;  4HCN B;  2IY1 B;  1XT9 B;  1JW9 D;  4L23 A;  4MJS A;  1UZX B;  1ZP0 B;  1C77 A;  4GGQ A;  1Q5W B;  1TKY A;  1HTO A;  2M56 B;  4EOY A;  4ARI A;  1WH3 A;  3ML8 A;  2SEB D;  3AEC B;  4IW0 A;  3N30 A;  1VCB A;  5AUK A;  4HKQ A;  1TT5 B;  4MM3 A;  1HA5 A;  1WYW B;  2AX5 A;  4KZ0 A;  2BYT A;  1NI3 A;  2AQ3 B;  3ENE A;  1VJK A;  1GJZ A;  1AN8 A;  3ZRC A;  4GDK B;  2N1W A;  2NTT A;  2NPT A;  2WXR A;  1YJJ A;  1YOV B;  2QDF A;  2WYQ A;  2N9E B;  4J6I A;  2FCS A;  1VZ7 A;  4HLE A;  2N4F A;  1E6E B;  5EE1 A;  4JPS A;  3AMZ A;  5LXI B;  1NVI D;  3QX1 A;  2N9P C;  1AW7 A;  2PKO A;  1QQR A;  5CHW A;  3AN1 A;  3PZ7 A;  1TJE A;  2DYB A;  1I4P A;  4XWT A;  3D32 A;  1FD6 A;  3FIL A;  1SSN A;  3AE6 B;  5BO4 B;  4FAD A;  3MTN B;  3QAQ A;  2RGF A;  2WS3 B;  4GDL A;  2RR9 A;  3ZIM A;  2JT4 B;  3C19 A;  1K53 A;  4OZA A;  2QCZ A;  2WXL A;  4DXF A;  2Y3A A;  3AEE B;  4BFR A;  3W5U B;  2DAJ A;  3NVZ A;  2KQS A;  5E6P A;  3QIJ A;  1D4B A;  4P16 A;  2HJ8 A;  3UQA A;  3QCA A;  2VZK B;  1J0G A;  1RLF A;  1F2R I;  5FR6 A;  3ZNZ B;  2W82 A;  1XLN A;  2D3C A;  1H4R A;  5T8I A;  3TIX A;  4GDL B;  5BYR A;  4IWQ A;  3BIN A;  5CX3 A;  4YSX B;  4A9A A;  1TY2 A;  2WXO A;  4PK1 A;  2ZW0 A;  2KWU B;  3U7D A;  2KN5 A;  4E74 A;  5D3I B;  1AAR A;  2QIL A;  1HZ5 A;  5E6N A;  2GOW A;  4XDC A;  2G4S A;  3DVN U;  4C4V B;  1TTN A;  3CF6 E;  5GMV A;  2W9N A;  1F0Z A;  3MFG A;  1YQB A;  4IOI E;  4LNI A;  1FXT B;  2MJD A;  1J7B A;  2LVO A;  4B95 A;  3NRZ A;  1E7V A;  3RYT A;  3ZKJ C;  1GPX A;  1A5R A;  3RZF A;  3H7S A;  3T8M A;  4JWS C;  2LRW A;  2MA9 B;  2BBC A;  1VRA B;  1IBX A;  4RM8 A;  1N5X A;  5BMI A;  5L95 C;  2MLB A;  1SGH A;  4KSK C;  2RPV A;  1WXA A;  3DBR I;  1BXT A;  4A3P A;  3Q69 A;  1EF1 A;  1XQQ A;  1UWM A;  1V80 A;  2BS3 B;  1WYG A;  2R61 A;  3NVY A;  2R2Q A;  2WLB A;  1F2R C;  3ZJV A;  1YJI A;  3DBH B;  1T0Q C;  4GIV A;  1JCK B;  2N9K A;  3VRA B;  4OW0 A;  2WDT B;  1K51 A;  3OWE B;  3BK2 A;  2LJI A;  4ZRP A;  4FN2 A;  5H92 C;  3M62 B;  3AE5 B;  1B1Z A;  3RNC C;  4MGY E;  4S0R A;  4A90 A;  2MWS B;  3MP9 A;  2BKR B;  2Y5P A;  3BVZ A;  1WIA A;  4LJP B;  2M4N A;  4JGH B;  4ACF A;  4AP4 C;  5G5G A;  1P3Q U;  1WM3 A;  1N63 A;  1KLV A;  2FCN A;  5J18 A;  1WZ0 A;  4A8X C;  5HHD G;  3MC8 A;  3MC9 A;  2BYE A;  4MDK E;  2OED A;  2K8C A;  4ICV A;  2JWZ A;  4LNK A;  1HEZ E;  1Q10 A;  3APD A;  1TKG A;  5J2R A;  4HDO A;  2JRI B;  1LXD A;  3L13 A;  1E5W A;  3GOE A;  3PSE B;  2WX0 A;  4F1S A;  1T0S C;  4WIP A;  1WR6 E;  1OEY A;  1V97 A;  1P7E A;  3VR8 B;  5AZF A;  2ZPN A;  1I4Q A;  1XXG A;  5FR3 A;  5C1Z A;  2KC2 A;  2D3A A;  3UF8 A;  3HM6 X;  4JWU C;  2D10 A;  2JXX A;  3KWV A;  2YLM A;  2KAN A;  1WJ4 A;  4HVB A;  1SBB B;  1NEN B;  4IC7 B;  2ZJD A;  2I2Y A;  3KYD D;  2LRU A;  2L83 A;  4GOC A;  2KOX A;  3CMM B;  2J0M A;  1RRB A;  4W9E A;  3E9S A;  4YXD B;  4BOZ B;  1F52 A;  2AQ1 B;  2INN E;  2AEH A;  3RI7 C;  3SR6 A;  3VDZ A;  2AWT A;  3Q3O C;  3QAR A;  3R66 C;  4FLH A;  3CIR B;  2WQY B;  1X1M A;  1YD8 U;  3GZN B;  2AQ2 B;  3LB8 C;  3W2D A;  4ARC A;  1STE A;  2AL6 A;  1ZXI A;  3JVZ X;  1MJD A;  2DZK A;  4QAY A;  4A55 A;  4CYE A;  2C5L C;  1HZ6 A;  3KUC B;  3NG0 A;  5G55 A;  4DWF A;  4KIK A;  3SD5 A;  2ASQ A;  1ZDV A;  2BKF A;  2NBW B;  3RFZ B;  4PS7 A;  3BYT B;  2J53 A;  2KDE B;  4ZRQ A;  2LGD A;  4G0N B;  4K3B A;  4OZB A;  1YIW A;  4JIO U;  5IN7 A;  1C3T A;  2O2V A;  3A9K A;  4IUM B;  3TMP B;  1T3Q A;  2KJR A;  4GB9 A;  3KVF B;  4M0W A;  3ZDT A;  3P4P B;  3ETR A;  2KX0 A;  3DQV A;  5I4D A;  1PDX A;  2N7D A;  2CHX A;  2MEK A;  3R3M A;  1YQ4 B;  1WRD B;  2V3N A;  3EUB 2;  3BVG A;  3PVL A;  3W9C B;  2JUO A;  2PVG C;  3NS8 A;  1FFV A;  3EA6 A;  2WXJ A;  5KHO A;  1MFW A;  4RCO A;  4HK2 A;  3ZVV A;  3RD2 A;  3A9J B;  4EUT A;  4KIK B;  3H9D A;  1SIJ A;  2DAF A;  4K7U A;  3RNA C;  3P4R B;  5JHB A;  4AOF A;  1F1H A;  4HXD A;  3RNE C;  1WJN A;  2O2V B;  4CHK A;  3U4E G;  1KRH A;  2YVC A;  4P6V F;  4HKZ E;  2D11 A;  1KFY B;  4ANV A;  1BUI C;  1P1A A;  5BYS A;  3JSV B;  1FNU A;  3N9Y C;  4KVG B;  2RMM A;  1I4G A;  3K9O B;  5TR5 A;  1FPY A;  4YTN B;  2KC1 A;  4ANW A;  1N60 A;  3RMK C;  4A6Q A;  3L54 A;  5AEK B;  4GMV A;  3ZGZ A;  2KT7 A;  3N1Y C;  4MGK E;  4HCP B;  5C2T B;  2FBW B;  5IKC M;  3WIM A;  3EEC A;  1XO3 A;  3APF A;  2PEA A;  4IWO A;  4ZYN A;  1FM0 D;  3ZTC A;  3GE3 C;  2KMC A;  3RNF C;  3PPA A;  4BKS D;  1CQV A;  3KQ4 A;  1VZ6 A;  2JXT A;  4NJ7 A;  4XZ4 A;  4WAA A;  4ASW C;  1AYF A;  1IPG A;  3HK0 A;  4LNF A;  3K9P B;  1JRU A;  2D2Q A;  3AE8 B;  3QHT A;  5GXG B;  1OQQ A;  2NMQ A;  4G50 A;  1J7C A;  1T6B X;  2L0T A;  2K22 A;  4UDU C;  3EFU A;  5BMG A;  2PE9 A;  2EKE C;  2JRH A;  1GB1 A;  3MJ5 A;  3P2B A;  2BW2 A;  3HUI A;  1P9D U;  2J4X A;  2J0J A;  4AJW A;  1SE3 A;  2K6D B;  1LFD A;  2K3U A;  2RSU A;  3DVG Y;  4RM9 A;  1DOI A;  1UBI A;  1UGJ A;  2DZM A;  4MGZ E;  1VDV A;  3IFW B;  4L2Y A;  1VD2 A;  2MSE D;  2NTS A;  4OZC A;  4XGA B;  2QMT A;  4W9G A;  1XD3 B;  2KYW A;  3VTU A;  2L32 A;  1LGR A;  1LQB A;  3AEB B;  3WCQ A;  4KX6 B;  3AE7 B;  2IBI B;  4TMA B;  2BB6 A;  1M94 A;  1CJE A;  1WSP A;  1FXA A;  3HVZ A;  1V8C A;  4LNO A;  4OVU A;  5J17 A;  3ZJT A;  4K7W A;  3SDL C;  2WDR B;  1L6V A;  4P1B C;  4N59 A;  4RMA A;  3T3N A;  2CR5 A;  2KX3 A;  3WAO A;  1WE6 A;  2KKC A;  1IGC A;  1EU3 A;  5E6J A;  1VLB A;  2KK8 A;  2CHZ A;  2W55 A;  2ONQ A;  1DYQ A;  4ZHP A;  3VUW A;  1FCL A;  3Q8C A;  2K9X A;  4EZJ A;  4S17 A;  1FNV A;  1NEK B;  1L2N A;  1QOA A;  1G6J A;  2JWU A;  1KLG D;  2XNA C;  3U52 E;  2XN9 C;  4CO7 A;  2LUE A;  4LCD E;  3B0A A;  3ZYY X;  1I4H A;  1YMH E;  3BYY B;  2RDG A;  1QT9 A;  2YEP B;  3V3X A;  1WX7 A;  3DBH I;  2ZW1 A;  2L3Z A;  4LJO B;  3H1U A;  2V3P A;  4N9F 4;  5D7G A;  3LYY A;  3IAM 1;  3HIZ A;  1V81 A;  4ZHO A;  1TKE A;  3LJ3 A;  1GC7 A;  1GAQ B;  2KMM A;  2LVQ A;  3A1Q B;  3OG5 A;  5EE0 A;  3I9V 1;  3W5V B;  3KLS X;  4GSW A;  2KTF A;  3AV8 A;  1JWA D;  2H89 B;  1ESF A;  2G9H D;  2K5P A;  4RGM A;  4NJC A;  3T9L A;  2WXF A;  2LI5 A;  4FHK A;  3QK0 A;  3KUD B;  4W9L A;  1Q1O A;  2KVR A;  2J42 A;  1NBF C;  2FAZ A;  4HRS A;  3BII D;  2JZP A;  3Q6B A;  2VH2 A;  1GB4 A;  4B9K A;  1C9F A;  2JPH A;  3R2I A;  2GLS A;  4C4V A;  3Q3N C;  2PPH A;  2KQ7 A;  3NZU A;  1H8C A;  2OHF A;  2QSD A;  2KFJ A;  2NVU I;  1ZGU B;  3TL5 A;  4WAF A;  1SF0 A;  2GRI A;  2GBM A;  2IGD A;  5H8Y E;  4US8 A;  4P7I A;  1J7A A;  4TQ1 A;  3WAL A;  2C60 A;  3MC0 B;  3ONS A;  4KDL B;  3M3J A;  4WWM A;  4MT5 A;  2BGF A;  4DDI D;  2MH7 A;  2X38 A;  3U2S C;  1WX8 A;  2Y5C A;  3L0W B;  1F9J A;  3URY A;  1E8X A;  1UUP A;  3N32 A;  1V2Y A;  2K1F A;  2M1M A;  3L08 A;  4EZK A;  4WUR A;  3P42 A;  2FUH B;  2WHI A;  3O65 B;  3TCA A;  2R2O A;  3B9J A;  1TBE A;  4L1B A;  2KAJ A;  3PT2 B;  1JWU D;  1NYR A;  3DVN V;  3GZN I;  4ZYS A;  1P98 A;  3RUL A;  2L8J A;  1L4Z B;  4AS1 A;  2K8B A;  2N9X A;  4RFB A;  2LZ6 A;  1E8Y A;  2W3S A;  3DBL B;  3UIO B;  2MQJ A;  3V6C B;  1WJU A;  4RNA A;  1K52 A;  3PLU A;  4IM2 A;  4FJZ A;  3KH0 A;  1FCC C;  2NBU A;  2GBN A;  2CJN A;  2IGH A;  3Q8B A;  2RDB C;  1WI0 A;  2IY0 B;  3Q14 C;  3TEZ A;  2V4L A;  3IXS A;  4MGI E;  2LGX A;  3R7Q A;  3Q2A C;  2MCN B;  1WE7 A;  3O13 A;  3E56 A;  3FKY A;  2HTH A;  2KWV B;  3NHE B;  4XDD A;  2ZPY A;  3RUI B;  2KVZ A;  4IWP A;  1PGA A;  2FNJ B;  3NZS A;  4HPM B;  1OQR A;  1ET9 A;  2IO2 B;  2XBB C;  1WFY A;  1N61 A;  3AE4 B;  1WF9 A;  5IAA C;  4N6E B;  3RNG C;  3AU5 A;  1RFK A;  3X23 A;  3SFD B;  2ZNV C;  2JX5 A;  1EF5 A;  2IYD B;  1RAX A;  3NUH B;  2IGG A;  2KTR A;  2WXQ A;  2OOB B;  4KKJ A;  1K8R B;  3QJZ A;  4WJN A;  2M8S A;  1ZUD 2;  1V6E A;  2OJW A;  3EC8 A;  2V0G A;  1SE2 A;  4BBN C;  1L6U A;  1C79 A;  1FRR A;  4G11 A;  2WXM A;  4WWN A;  4NJ6 A;  2INC C;  2FCQ A;  2D07 B;  4FA6 A;  2L7R A;  4IKG A;  1C76 A;  2KLG A;  4X57 B;  2O6V D;  3RPF C;  2HD5 B;  1FFU A;  2AYO B;  2GBR A;  1PQS A;  1UF0 A;  1TS5 A;  1JQ4 A;  4PYU A;  3PO0 A;  1SB3 C;  1TY0 A;  4USA A;  4RF1 A;  4HWI B;  4WJQ A;  3J9C A;  1RYJ A;  1WXV A;  3AEA B;  4BKT A;  2A4Z A;  2KTR B;  3BY4 B;  4C7Y A;  1V86 A;  4I6P A;  3H7P A;  2KWC A;  1EWC A;  2D5G A;  1RFA A;  3PZD A;  2KHW B;  3GE8 C;  1WXM A;  4JE3 B;  3OLM D;  2ZNV B;  4FBJ B;  5MPO A;  2ON8 A;  4O1N A;  1WXQ A;  4W9H A;  3QWZ B;  2DLB A;  3H6N A;  3T3O A;  1JWS D;  4C7Z A;  2MBB B;  5LXH A;  2RPQ A;  3B2G A;  3A9J A;  2KWD A;  2FE8 A;  3Q8F A;  1PUT A;  4A20 A;  3DBS A;  1QIL A;  1OTR B;  3OJ3 A;  4PS3 A;  1KOT A;  1JML A;  3ECI A;  3L10 B;  1FNW A;  2UYZ B;  2I1J A;  3MHZ A;  3H7P B;  3GB1 A;  2L76 A;  3WAP A;  2KDI A;  4EZL A;  3A4S C;  3AE2 B;  1PGX A;  3C0R B;  1TIF A;  2A5U A;  3AEG B;  3I57 A;  2G4D B;  3SFE B;  1P7F A;  2KQ4 X;  3JSV A;  4LDT D;  3AH7 A;  3L16 A;  2JYE A;  4MH0 E;  4JQW C;  4KZC A;  2PW9 A;  5JHA A;  4P1C C;  2JVC A;  3AE9 B;  3WAN A;  4GN1 A;  2X8X X;  2BPS A;  2BT6 A;  1XF5 L;  1WGH A;  4YL8 A;  1KH0 A;  4WWO A;  2ACZ B;  4II2 B;  2WP9 B;  3PZ8 A;  5DPR A;  2KDM A;  2UWQ A;  1SE9 A;  1WGY A;  3R2T A;  2BS2 B;  4M02 A;  1S3S G;  5LLI A;  1L0V B;  2LGY A;  4MEM A;  4RH6 A;  3BWU D;  1ROE A;  4HPL B;  1P0R A;  1T0Y A;  4NAM A;  5JH5 C;  2W3R A;  2KJH B;  4F7Z A;  4JL9 A;  1PYW D;  1TGZ B;  1FIQ A;  5D2M B;  1E8W A;  4M8M A;  4IM3 A;  1ZXH A;  1E8Z A;  1GC6 A;  4GU2 A;  2LHD A;  1EO6 A;  1YN3 A;  4ANX A;  1WM2 A;  1Z2M A;  3HHM A;  5L83 A;  5HFY A;  3FAH A;  2O6V A;  2G3Q B;  2LXA A;  4LK0 M;  1E7P B;  5E6O A;  3VTV A;  4D2K A;  1SE4 A;  3ABV B;  4Q2J A;  3Q8E A;  1R4N B;  2LHE A;  2LD9 A;  1L7Y A;  3PHX B;  3U7Z A;  1CK1 A;  2LUM A;  4AUQ C;  2GBJ A;  1E90 A;  5HKH A;  5HG2 A;  5DPS A;  2K8H A;  1KF6 B;  3I63 C;  4G3X B;  4DQO C;  3RZW C;  3FC4 A;  2FID A;  4TV3 A;  3U30 A;  1QZE A;  4DBG A;  1WGK A;  3ZW3 A;  4REZ A;  2BWF A;  4ZRK A;  2V4I B;  2YEP F;  4EKU A;  2BS4 B;  3I3T B;  2N9L A;  3IT4 B;  1DGJ A;  1J8C A;  2DZJ A;  3IHP C;  1N5W A;  2O6V B;  5IA7 A;  3R8B A;  4BZA A;  5G5H A;  3N3K B;  2LMC A;  2JYT A;  4TKN A;  2ZCC A;  1JAL A;  1SJH D;  1L4D B;  1BT0 A;  2GB1 A;  1I7H A;  2M0X A;  4KGS A;  4TUU A;  2L1A A;  1YN5 A;  3N1Z C;  2VRR B;  3ZQ4 A;  2LWP A;  3ZRF A;  1GG3 A;  4XWW A;  3AM9 A;  3PTF C;  1VZ8 A;  4K7S A;  3QA8 A;  2PJH A;  1L0X B;  1UBQ A;  2WWZ A;  4W9F A;  3W1S C;  2IO0 B;  1OEY J;  1XCQ L;  2KN4 A;  2L52 A;  2V9H A;  5FK9 C;  3CST A;  3HVD A;  2CKH B;  4TQ0 A;  4DXG A;  1FRD A;  1AWD A;  2BTE A;  2JY6 A;  3SEB A;  2BVC A;  1B9R A;  4NAW A;  2BYF A;  2C7H A;  1TS4 A;  2C7N B;  4OVV A;  3AED B;  3W1S A;  3A1Q A;  3M95 A;  4WJO A;  1LM8 B;  2BYV E;  4ZRJ A;  3JW0 X;  1K50 A;  4B6W A;  2PIA A;  3WA0 A;  3N20 C;  4ZRI A;  3M63 B;  2VH1 A;  4KKI A;  2OJR A;  4B0E A;  2ZCB A;  3DBL I;  4XYC A;  3VFK A;  3ZDM C;  1XLQ A;  1J19 A;  3NJT A;  4KGR A;  1SIF A;  1V1P B;  1ZDX A;  1OQY A;  4I6L B;  1V9J A;  1MG8 A;  1XCT L;  5DPW A;  4LDT B;  2K6Q A;  2HE7 A;  2MJ3 A;  2ZVN A;  2HDE A;  2KZR A;  3DHG C;  1IUE A;  3VHT C;  4YSY B;  4YT0 B;  2M17 A;  2JF5 A;  4IDI A;  2QEJ C;  3UQB A;  4NQK E;  4NAW B;  2K25 A;  1D5Z C;  2KFK A;  1UH6 A;  2BQQ A;  4DXA B;  2QHO A;  4II3 B;  3DHI C;  3VAW A;  1C1Y B;  1JWB D;  2GBK A;  1ZOY B;  2L0F A;  2Z8L A;  2BWE S;  3A4R A;  2WXH A;  3ZNG C;  4ANU A;  1EU4 A;  3LXF A;  2LEK A;  2M19 A;  2G1E A;  1EUV B;  2CHW A;  4IG7 B;  3V6E B;  2PMV A;  2MP2 A;  1M4V A;  4MJS B;  4RF0 A;  4DK5 A;  5FKA C;  4BKS A;  3ZUN A;  2WXK A;  1WRI A;  1ENF A;  1QOF A;  4MSM B;  4MM3 B;  3DWG C;  4NPN A;  4YTP B;  4RGN A;  5C3J B;  4W9K A;  1GNU A;  2GI9 A;  3ZTD A;  1Y8R C;  1TZO A;  2WNM A;  4RGO S;  5CTR C;  4KGT A;  4YWG G;  1GUA B;  1I42 A;  3ALB A;  3AXC A;  3V61 A;  4PYZ A;  4EEW A;  1FMA D;  3U8Z A;  3PRZ A;  2NPT B;  4W9C A;  2KFK B;  1UNS A;  3SU8 X;  3VRB B;  2WXI A;  1I35 A;  2N7J A;  2KO3 A;  2IZV B;  3P63 A;  2V1Y A;  3DWM A;  1EWY C;  2D3G A;  2ZZP B;  5EE3 A;  1N6Z A;  3TBL D;  2MP2 B;  1DOY A;  2DBY A;  3V05 A;  1YJ1 A;  2MRP A;  2KXJ A;  4I6N B;  4WJP A;  3PS6 A;  2FCM A;  2EMT A;  4LNN A;  2UU7 A;  3AE1 B;  2LFI A;  1WMH A;  4GXB A;  2J0K A;  3I5J C;  2IO3 B;  3FIL B;  4C00 A;  4ICU A;  2IJ0 A;  1UEL A;  4AQ7 A;  1ISN A; 
#chains in the Genus database with same CATH homology
 3AU4 A;  5CHV C;  3KUZ A;  4MJS A;  1UZX B;  4AJY B;  4KVG B;  4HWI B;  4WJQ A;  1WXV A;  4BKT A;  2NS5 A;  3K9O B;  2A4Z A;  4GGQ A;  5TR5 A;  2KTR B;  1Q5W B;  3BY4 B;  1U4A A;  3IVF A;  3V62 A;  2KC1 A;  3ZNI D;  4ANW A;  4EOY A;  1NDD A;  3PGE A;  1WH3 A;  3ML8 A;  1V86 A;  3CSF A;  3L54 A;  3H7P A;  4I6P A;  5AEK B;  4IW0 A;  4HDQ A;  3N30 A;  4GMV A;  2KWC A;  1VCB A;  3APC A;  4MM3 A;  4K1R B;  1WYW B;  3ZO5 B;  4KZ0 A;  4HCP B;  4MGK E;  4AWJ A;  1WGG A;  1UD7 A;  1RFA A;  3PZD A;  2CS4 A;  3ENE A;  2KHW B;  2DYM A;  3WIM A;  1WXM A;  1GJZ A;  3EEC A;  3APF A;  2N1V A;  3VUX A;  2PEA A;  4HJK A;  4IWO A;  3EHV A;  2Z0D B;  3OLM D;  4ZYN A;  3ZRC A;  2ZNV B;  4FBJ B;  4GDK B;  2N1W A;  1HE8 A;  1WMH B;  1WX9 A;  2NPT A;  3ZTC A;  2KMC A;  1WGR A;  4W9H A;  3PRE A;  3QWZ B;  2I1K A;  2WYQ A;  2N9E B;  4J6I A;  2MBO A;  3H6N A;  3PPA A;  4BKS D;  2FCS A;  5C23 A;  2EMS A;  4K81 A;  4HLE A;  2MBB B;  2N4F A;  1S1Q B;  5LXH A;  4NJ7 A;  2RPQ A;  4XZ4 A;  3ZLZ A;  5LXI B;  4WAA A;  4ASW C;  3A9J A;  1IPG A;  3HK0 A;  2DX5 B;  3QX1 A;  1R4M I;  3K9P B;  2N9P C;  1JRU A;  2CU1 A;  4A20 A;  3DBS A;  2D2Q A;  1OTR B;  1Z5S B;  3OJ3 A;  4PS3 A;  1KOT A;  3QHT A;  5CHW A;  4BKG A;  1V49 A;  3ECI A;  3L10 B;  4G50 A;  2UYZ B;  4W9D A;  2I1J A;  3H7P B;  2L0T A;  2L76 A;  3WAP A;  5CHF A;  2KDI A;  2DYB A;  4EZL A;  3EFU A;  3D32 A;  3A4S C;  2PE9 A;  2EKE C;  5BO4 B;  4BBN F;  4FAD A;  3MTN B;  3C0R B;  1WJ6 A;  2JRH A;  2A5U A;  3QAQ A;  2G4D B;  2RGF A;  3P2B A;  2L05 A;  4GDL A;  3JSV A;  2RR9 A;  3AI5 A;  1P9D U;  3X0W A;  4LDT D;  1WR1 A;  2J0J A;  2G45 B;  3DCG A;  5D94 A;  4AJW A;  3ZIM A;  3PV1 A;  3L16 A;  2K6D B;  4MH0 E;  2JT4 B;  1LFD A;  4JQW C;  2RSU A;  3DVG Y;  4KZC A;  3DDC B;  4RM9 A;  1UBI A;  2KMA A;  5JHA A;  2C9W B;  4E3C A;  2JVC A;  3WAN A;  2DZM A;  4GN1 A;  4MGZ E;  4EFO A;  2BPS A;  3IFW B;  1WGH A;  1VD2 A;  4YL8 A;  2MSE D;  4W9G A;  3VTU A;  1XD3 B;  4BFR A;  2DAJ A;  3UIN B;  2KQS A;  4WWO A;  5E6P A;  3QIJ A;  4II2 B;  4XC2 A;  4DDG D;  1LQB A;  3DOW A;  5DPR A;  3VXW A;  2HJ8 A;  4DHJ D;  2FIF A;  3IBE A;  3UQA A;  2UWQ A;  3PLV A;  1SE9 A;  1WGY A;  3QCA A;  4KV2 A;  1S3S G;  2IBI B;  1J0G A;  1M94 A;  5LLI A;  2LGY A;  2ZVO A;  4MEM A;  1RLF A;  1YX6 B;  5J17 A;  4OVU A;  4HPL B;  1P0R A;  1T0Y A;  2XEW A;  3PRM B;  5JH5 C;  4K7W A;  3SDL C;  2KJH B;  2NBV B;  5FR6 A;  3RCZ A;  3ZNZ B;  4RMA A;  1WGD A;  1H4R A;  4IM0 A;  4JL9 A;  4F7Z A;  3TIX A;  1TGZ B;  2CR5 A;  2KX3 A;  4GDL B;  1WE6 A;  1E8W A;  5D2M B;  2KKC A;  3WAO A;  2DEN B;  3BIN A;  4IWQ A;  3DVG X;  4M8M A;  5CX3 A;  3VUY A;  3KYC D;  4IM3 A;  2KK8 A;  2CHZ A;  1E8Z A;  1GC6 A;  4GU2 A;  2MBH A;  1R4N I;  2KWU B;  1EO6 A;  3U7D A;  2KN5 A;  4ANX A;  4E74 A;  1WM2 A;  3VUW A;  1AAR A;  4EZJ A;  1Z2M A;  3HHM A;  2DHZ A;  1KM7 A;  5E6N A;  5L83 A;  2GOW A;  4M8N A;  2G4S A;  3DVN U;  1ZW7 A;  1TTN A;  2V3S A;  2O6V A;  3CF6 E;  2G3Q B;  2C7M B;  3IG3 A;  1L2N A;  1KJT A;  2LXA A;  5GMV A;  1G6J A;  2KD0 A;  5E6O A;  3VTV A;  2W9N A;  1YQB A;  3V60 A;  3JYU A;  1D3Z A;  2KDB A;  3MHS D;  5JZE B;  1FXT B;  4CO7 A;  4ZDV A;  2LUE A;  2LVO A;  3OJ4 B;  2LD9 A;  3TJP A;  2Z59 B;  2KNB A;  4B95 A;  3NOB A;  1L7Y A;  1E7V A;  1WZ3 A;  3PHX B;  4LCD E;  3B0A A;  3RYT A;  3VH3 B;  3ZKJ C;  1CMX B;  1A5R A;  3RZF A;  4AUQ C;  3H7S A;  2GBJ A;  3T8M A;  4XX5 A;  1V5T A;  1E90 A;  3A33 B;  5HKH A;  5DPS A;  2K8H A;  1OGW A;  2LRW A;  1WX7 A;  3DBH I;  2DYO A;  2MA9 B;  4WWP A;  4G3X B;  2L3Z A;  4LJO B;  3H1U A;  4N9F 4;  3RZW C;  5D7G A;  4RM8 A;  2FID A;  5L95 C;  3HIZ A;  1V81 A;  2MLB A;  3HM3 A;  4TV3 A;  3U30 A;  1SGH A;  2WX1 A;  4JLC A;  4KSK C;  1YX5 B;  2LJ5 A;  1QZE A;  3LJ3 A;  1GC7 A;  4DBG A;  1WXA A;  3ZW3 A;  3DBR I;  2LVQ A;  2KJ6 A;  3B08 A;  4MEL A;  2BWF A;  4A3P A;  3A1Q B;  4ZRK A;  5G2N A;  1EF1 A;  1XQQ A;  3UGB B;  1V80 A;  4EKU A;  3AUL A;  3I3T B;  2KDF B;  2Y5B B;  4GSW A;  2DZJ A;  1J8C A;  2R2Q A;  3IHP C;  2KTF A;  4GIV A;  2O6V B;  5IA7 A;  4FJY A;  2WDT B;  3N3K B;  2GMI C;  3T9L A;  3MJW A;  4FN2 A;  4TKN A;  3M62 B;  2ZCC A;  3VTW A;  4MGY E;  2PE6 B;  1WY8 A;  1BT0 A;  2LI5 A;  4FHK A;  2MWS B;  3QK0 A;  2BKR B;  3KUD B;  1Q0W B;  2LXC A;  4W9L A;  1Q1O A;  1WIA A;  2KVR A;  2L00 B;  2M4N A;  4LJP B;  1NBF C;  2FAZ A;  2M0X A;  3S2A A;  4TUU A;  4JGH B;  2J7Q B;  4AP4 C;  1P3Q U;  1E7U A;  1WM3 A;  4B9K A;  2VRR B;  2JPH A;  2LWP A;  2ZEQ A;  3ZRF A;  1KLV A;  2FCN A;  5J18 A;  1GG3 A;  2PPH A;  1WZ0 A;  1NI2 A;  2KQ7 A;  3NZU A;  3PTF C;  1H8C A;  4K7S A;  3QA8 A;  2PJH A;  2BYE A;  4MDK E;  2K8C A;  1UBQ A;  2WWZ A;  2KFJ A;  2NVU I;  1ZGU B;  4ICV A;  2JWZ A;  4W9F A;  3TL5 A;  3W1S C;  4W9I A;  2IO0 B;  4NQL B;  3APD A;  3R7R A;  1OEY J;  2GBM A;  5J2R A;  2NR2 A;  4HDO A;  2JRI B;  3QC8 B;  4P7I A;  1LXD A;  4TQ1 A;  5DPT A;  3WAL A;  3Q3J A;  4FUL A;  3L13 A;  3CST A;  1UGM A;  4URK A;  1E5W A;  2C60 A;  2CKH B;  3GOE A;  3PSE B;  3ONS A;  3PHW B;  4KDL B;  2WX0 A;  4WQO B;  3M3J A;  5DCN A;  4F1S A;  2K39 A;  5AZH A;  2MX2 A;  4PS8 A;  4TQ0 A;  2LAS A;  1WR6 E;  1OEY A;  2KLC A;  2BGF A;  2JY6 A;  3VQI A;  4DDI D;  5AZF A;  2JZ3 B;  2ZPN A;  5D6J B;  4NAW A;  2BYF A;  1V5O A;  2C7H A;  2C7N B;  4BVU C;  4OVV A;  1WX8 A;  4W9J A;  5C1Z A;  3ZNH B;  3ML9 A;  2KC2 A;  3A9K B;  3W1S A;  3L0W B;  3A1Q A;  3HM6 X;  3M95 A;  1F9J A;  4WJO A;  3UF8 A;  1E8X A;  2D10 A;  2JXX A;  4BOS C;  1LM8 B;  3N32 A;  1V2Y A;  2BYV E;  2MBE A;  4M0W B;  2YLM A;  2K1F A;  2BF8 B;  3JW0 X;  4ZRJ A;  2AL3 A;  2M1M A;  3L08 A;  4EZK A;  2KAN A;  1WJ4 A;  4B6W A;  3WA0 A;  4HVB A;  4ZRI A;  3M63 B;  4IC7 B;  2OJR A;  2ZJD A;  3KYD D;  2ZCB A;  2LRU A;  3DBL I;  3VFK A;  3ZDM C;  2FUH B;  4GOC A;  2KOX A;  2LVP A;  3CMM B;  3O65 B;  2J0M A;  1J19 A;  3VVW B;  1RRB A;  3TCA A;  4W9E A;  2R2O A;  1SIF A;  1TBE A;  1OQY A;  3PT2 B;  4I6L B;  1V9J A;  1MG8 A;  3DVN V;  3GZN I;  4BOZ B;  5DPW A;  2AEH A;  1P98 A;  2K6Q A;  4LDT B;  4E71 A;  3RUL A;  2L8J A;  2HE7 A;  2ZVN A;  1TZ1 A;  2JZZ A;  2K8B A;  2KZR A;  2N9X A;  3VDZ A;  2LZ6 A;  1E8Y A;  2AWT A;  3QAR A;  3VHT C;  3R66 C;  4FLH A;  3UIO B;  1IYF A;  2XK5 A;  2MQJ A;  3V6C B;  3VH4 B;  2M17 A;  4DHZ B;  2JF5 A;  1WJU A;  1X1M A;  3UQB A;  1YD8 U;  4NQK E;  4NAW B;  2K25 A;  3SHQ A;  3PLU A;  1ZKH A;  1UH6 A;  2KFK A;  4IM2 A;  4FJZ A;  4DXA B;  2QHO A;  4II3 B;  3KH0 A;  2NBU A;  3VAW A;  1C1Y B;  2GBN A;  3W1Y A;  2GBK A;  4DHJ B;  3WAM A;  2L0F A;  3A4R A;  2AL6 A;  1WI0 A;  2BWE S;  2IY0 B;  3B1L X;  3ZNG C;  4ANU A;  3JVZ X;  4F8C B;  2V4L A;  1EUV B;  2DZK A;  4MGI E;  2CHW A;  4IG7 B;  2LGX A;  3V6E B;  2MP2 A;  3OAW A;  3R7Q A;  4CYE A;  4MJS B;  2MCN B;  2C5L C;  3NY5 A;  1WE7 A;  3KUC B;  4DK5 A;  5G55 A;  4DWF A;  2REX A;  4KIK A;  3SD5 A;  2HTH A;  2ASQ A;  2BKF A;  2KWV B;  2NBW B;  3NHE B;  4BKS A;  2ZPY A;  4PS7 A;  3RUI B;  3ZUN A;  3DPD A;  5EDS A;  2KDE B;  4IWP A;  2LGD A;  3QQ8 B;  4G0N B;  3LDZ E;  2FNJ B;  3NZS A;  1YIW A;  3L17 A;  4JIO U;  4MSM B;  4HPM B;  1C3T A;  2O2V A;  2IO2 B;  2XBB C;  4NPN A;  1WFY A;  2MBQ A;  3A9K A;  4IUM B;  3TMP B;  1IP9 A;  2KJR A;  4W9K A;  4GB9 A;  3KVF B;  2MW5 A;  1GNU A;  4DHZ E;  3ZTD A;  1WF9 A;  1Y8R C;  4NY0 A;  3ZDT A;  2N7E A;  5CTR C;  5IAA C;  1GUA B;  2KX0 A;  1I42 A;  3ALB A;  3AU5 A;  3DQV A;  2XK5 B;  3AXC A;  2IO1 B;  2N7D A;  3V61 A;  3X23 A;  2CHX A;  4PYZ A;  4EEW A;  3R3M A;  3U8Z A;  2ZNV C;  3PRZ A;  5AZG A;  1WRD B;  2NPT B;  4W9C A;  1EF5 A;  2IYD B;  2KFK B;  3SU8 X;  1RAX A;  3PVL A;  3RT3 B;  2KTR A;  1I35 A;  2JUO A;  2OOB B;  2KO3 A;  2IZV B;  3NS8 A;  2V1Y A;  1K8R B;  3QJZ A;  2D3G A;  2ZZP B;  2M8S A;  2RD0 A;  3KW5 B;  4WJN A;  5KHO A;  1V6E A;  4HK2 A;  3TBL D;  2MP2 B;  3EC8 A;  4BBN C;  2NCN A;  3ZVV A;  3RD2 A;  3A9J B;  4EUT A;  2B3A A;  3Q3F A;  3PRP B;  1YJ1 A;  2MRP A;  3H9D A;  2KXJ A;  4FJV B;  4G11 A;  4KIK B;  2DAF A;  4I6N B;  4K7U A;  4KDI C;  4WJP A;  4WWN A;  4NJ6 A;  5JHB A;  2FCQ A;  4A3O A;  3PS6 A;  2D07 B;  2EMT A;  2FCM A;  4FA6 A;  5KHQ A;  2L7R A;  4KSL C;  4GDK A;  4AOF A;  2KLG A;  4HXD A;  4X57 B;  1WMH A;  2O6V D;  2Z0E B;  2DZI A;  4MSQ B;  2HD5 B;  1WJN A;  1WXS A;  2O2V B;  4GXB A;  2J0K A;  4CHK A;  2AYO B;  2GBR A;  4NNJ B;  2YVC A;  1PQS A;  2IO3 B;  4ICU A;  4FHJ A;  2D11 A;  3UIP B;  4HCN B;  2IY1 B;  1UEL A;  1XT9 B;  4ANV A;  4PYU A;  1ISN A;  1P1A A;  3JSV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...