2JPHA

Nmr solution structure of the rho gtpase binding domain of human plexin-b1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
KKDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLFRRLNTLQHYKVPDGATVALVPCLTKHVLRENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-B1
publication title Insights into Oncogenic Mutations of Plexin-B1 Based on the Solution Structure of the Rho GTPase Binding Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, protein binding
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jphA00
4F7ZA 4IWOA 1TBEA 2BYFA 4JLCA 2JRIB 1P1AA 5CX3A 1E8YA 5L95C 1V6EA 4WAAA 4EFOA 4MGZE 1WE7A 2NBWB 3JYUA 4AJYB 2KFJA 1GUAB 4GDLA 4W9HA 4PS3A 2WWZA 3K9PB 4IC7B 1EF5A 3A9KA 3ML8A 3NHEB 4NY0A 4TKNA 2IY0B 2L8JA 4FLHA 1WX7A 2EMTA 1CMXB 3L17A 2KMCA 1KLVA 3ZDTA 1E7VA 3VAWA 4IM2A 1V81A 2KANA 1WZ0A 3H7PA 4GDKB 4DBGA 3ZIMA 2C60A 2LZ6A 3IG3A 5EDSA 2AL6A 2IYDB 4NJ7A 2L00B 1UD7A 4FJYA 4EZKA 4FA6A 1WXVA 1NI2A 2K1FA 3QAQA 3UQAA 2L76A 4IUMB 3KH0A 2N9EB 2IO2B 3ZKJC 5G55A 3ZTDA 2RD0A 4MEMA 4TQ0A 1WM3A 5DPSA 4PYUA 2KLCA 3KW5B 2AEHA 4K81A 4DXAB 3A1QB 2LXAA 1LQBA 1ZGUB 2MP2B 5J2RA 3APDA 5DPWA 1UBIA 3X0WA 1Z5SB 2HTHA 3UINB 1E8ZA 2DZJA 1UZXB 2JRHA 4P7IA 2KVRA 4GGQA 2KD0A 5IAAC 4G50A 2LWPA 3VVWB 1Q1OA 2R2OA 3R66C 2XK5A 2KFKB 2DAFA 2KHWB 3EFUA 3TIXA 3IBEA 4G3XB 2KC1A 4LCDE 2I1KA 1ZW7A 1J19A 3QHTA 2KC2A 1G6JA 2MSED 3AXCA 2GOWA 2LVQA 2V4LA 2GBKA 4W9KA 4ANVA 1KOTA 2ZCBA 3B0AA 4JL9A 3QWZB 2AWTA 3N32A 2KWUB 2UWQA 2D3GA 4KZ0A 4IG7B 4K7SA 2R2QA 1WE6A 1YX5B 3IHPC 1X1MA 2XBBC 2DZMA 4NAWB 2ZPNA 5DCNA 3TL5A 2BF8B 2C5LC 4TV3A 1V5OA 3ZW3A 2L05A 1OEYA 2DZIA 4ANWA 1WY8A 2G4SA 2K25A 3NZSA 1YD8U 4LDTD 3MTNB 5AZFA 5GMVA 4EUTA 1E8WA 4IW0A 3PS6A 4B6WA 2LI5A 2YVCA 1WYWB 2O2VA 3N3KB 2M0XA 3A9JB 5BO4B 4RMAA 2LD9A 4BVUC 1WZ3A 3L08A 2IO3B 3DVGY 2WYQA 3L54A 4IWPA 4X57B 3H7SA 1WMHB 4W9DA 3L0WB 4AP4C 4KSKC 2KKCA 2FCNA 3UIPB 5E6NA 1P3QU 3PGEA 2JUOA 1K8RB 5D94A 2L3ZA 1EF1A 2GMIC 2ZVOA 3DQVA 4GB9A 4CYEA 4XX5A 2MBEA 4B9KA 3BINA 3H1UA 4GDLB 3QIJA 2IZVB 2D07B 4FHJA 2NBUA 3A33B 3A9KB 1E7UA 2LGDA 3PREA 4URKA 4EOYA 1YJ1A 4FBJB 3ZVVA 3ECIA 3ZNID 1LXDA 1H8CA 2ZEQA 4HK2A 2N4FA 5CHFA 1WR6E 2MBQA 2V1YA 3V6CB 4E3CA 1OEYJ 1WF9A 4DHJD 4M0WB 2LVPA 3R7QA 4DK5A 3RULA 2JZZA 3T9LA 1IP9A 3WA0A 2M4NA 4JGHB 1TZ1A 3ZLZA 4NQLB 4BBNF 2CHWA 1KJTA 1P98A 3QX1A 3KUDB 4BKSD 1R4NI 2KOXA 1SGHA 2NCNA 3CMMB 2FCQA 1UGMA 1Y8RC 3AU5A 4BOZB 2LRUA 2CHZA 2NS5A 1GC6A 3B08A 2HD5B 2JXXA 2GBNA 4HXDA 1MG8A 1XQQA 4K7WA 4FULA 4CO7A 4FN2A 2KJ6A 3AU4A 1XT9B 3RYTA 2DENB 4FADA 1E90A 4N9F4 3RZWC 2KK8A 2YLMA 4MGKE 3A4SC 3VHTC 4AWJA 1OQYA 3TJPA 2DYOA 2G45B 3ZNHB 5L83A 2J0JA 3C0RB 4PS7A 4HPLB 4ANUA 4WWNA 2MBOA 2KQSA 2REXA 5AZGA 4MDKE 3ZNZB 4G0NB 2XEWA 3ALBA 4MSQB 3TMPB 4HCNB 1PQSA 3OJ3A 4MGYE 2Z59B 5DPRA 3V62A 2GBMA 2IY1B 4W9IA 3VUXA 4I6LB 3U30A 1BT0A 3QK0A 4NJ6A 4A20A 2BYEA 2LGXA 3BY4B 2KX3A 3PRZA 3JSVA 3DBLI 4BKSA 4DWFA 3T8MA 3DVGX 3V60A 4M8NA 1V9JA 5FR6A 4KIKA 3JW0X 2K8HA 2KO3A 3M95A 4II2B 2MLBA 1WM2A 1L7YA 3DBRI 2DX5B 1NDDA 3RD2A 3Q3JA 2LASA 4BFRA 4HDOA 3SD5A 3D32A 3ONSA 2MX2A 4WJOA 2LXCA 1U4AA 5J18A 4JQWC 4AJWA 2NPTB 3AULA 2V3SA 4NQKE 1SE9A 3PV1A 4MH0E 3VFKA 4WJQA 4ICUA 4BBNC 3APFA 3N30A 3WAOA 1J8CA 2UYZB 2ZCCA 4TQ1A 1OTRB 4XC2A 3VH3B 2C7NB 2LGYA 3ZRCA 4EZJA 4AUQC 5CHVC 3VTWA 2I1JA 1T0YA 4W9FA 4YL8A 1VD2A 4GDKA 1RLFA 5J17A 2BWFA 3GOEA 2WX0A 1ISNA 2LUEA 1S3SG 2BPSA 4IWQA 3WAPA 3NZUA 4EKUA 5D2MB 4EZLA 3DBHI 1RRBA 3VTVA 2K39A 3VXWA 1S1QB 1WFYA 2LVOA 3AI5A 1P9DU 3M3JA 4LDTB 5AZHA 1HE8A 2IO0B 2CKHB 3PLUA 3A1QA 2KTRB 2MP2A 2K6QA 2MA9B 1AARA 1RFAA 2O6VD 4MELA 2HJ8A 3ML9A 2KDBA 1H4RA 4BKTA 1V49A 3RUIB 3LJ3A 4HCPB 4FJVB 5C1ZA 5D7GA 2MBHA 3PRPB 3HM3A 1FXTB 3R7RA 2J0MA 5LXHA 2EMSA 2PEAA 3VQIA 2HE7A 4RM8A 2BYVE 2A5UA 4K7UA 2FIDA 2MCNB 2WX1A 5JHBA 2MBBB 2CR5A 4LJPB 5JH5C 3WALA 2KTFA 2RSUA 4MGIE 2B3AA 4DDID 1LFDA 4F1SA 5AEKB 1UBQA 3VUYA 3OLMD 1WX9A 3SHQA 4ZRIA 3PTFC 3M62B 2BWES 2RGFA 2MRPA 4FHKA 2MWSB 2FCMA 2NVUI 4KDLB 3X23A 3PHXB 3DCGA 4XZ4A 3SU8X 1WXSA 1R4MI 2WDTB 3H7PB 2KQ7A 2KDIA 4DHZB 5HKHA 4NAWA 2JF5A 2JY6A 4G11A 1YIWA 3EHVA 4GN1A 1QZEA 3KVFB 3PLVA 1GNUA 4ZRKA 4JIOU 4MSMB 2OJRA 4DHJB 3S2AA 1EO6A 2FNJB 3OAWA 4HVBA 2O6VA 4MJSA 1I42A 2ZVNA 3KUZA 3L13A 3A9JA 1WRDB 3JSVB 3IFWB 3IVFA 4ZYNA 2FIFA 3K9OB 2D11A 1GG3A 1F9JA 4NNJB 1WGGA 3B1LX 1TGZB 2L0TA 2MQJA 3RZFA 1WMHA 4KIKB 2Z0DB 3CF6E 4ICVA 2IBIB 2J7QB 2ASQA 1V86A 2PPHA 1GC7A 1YX6B 1Q0WB 2K6DB 3DVNU 2AL3A 4F8CB 3VH4B 2KJHB 4B95A 1ZKHA 2XK5B 5JZEB 1OGWA 1WGRA 3QA8A 2KNBA 2L7RA 3CSFA 2KDEB 3WANA 1VCBA 1D3ZA 1WJ4A 4E71A 1V80A 3R3MA 4HJKA 2L0FA 5CTRC 3V61A 4KZCA 1I35A 4FJZA 4AOFA 2N9PC 5KHOA 3NOBA 1A5RA 5E6PA 2BKRB 1WH3A 4ANXA 3HHMA 2J0KA 1WI0A 1Z2MA 3NY5A 1Q5WB 3ZUNA 4ASWC 4WJNA 2LRWA 4IM0A 4DDGD 3WIMA 3PRMB 2KZRA 1NBFC 2KX0A 1LM8B 4RM9A 3O65B 4OVUA 1E5WA 4ZDVA 2KLGA 2M1MA 1J0GA 2A4ZA 3DDCB 1EUVB 2QHOA 2ZZPB 2G3QB 2O2VB 2OOBB 2C9WB 2ZNVB 2FUHB 4KDIC 4DHZE 2FAZA 5KHQA 3PHWB 5JHAA 4W9CA 2D2QA 2JPHA 1WIAA 4HPMB 3UF8A 3GZNI 3HK0A 4E74A 1WR1A 4KSLC 1C1YB 4J6IA 2FCSA 4WWPA 2C7HA 1WJNA 3PT2B 3WAMA 1WJUA 1WXMA 3ZTCA 3V6EB 2M17A 4I6NB 2K8CA 4A3OA 2K8BA 3W1SA 3W1SC 3QARA 2KDFB 1XD3B 2CS4A 2EKEC 2RR9A 1IPGA 2ZJDA 3UQBA 3H9DA 3VDZA 2KWCA 3OJ4B 3RCZA 4GMVA 1P0RA 1WX8A 1UELA 2BGFA 2C7MB 4GSWA 4BOSC 3PPAA 2KXJA 1SIFA 2Y5BB 4HWIB 4W9JA 3U7DA 4WJPA 3KUCB 5LLIA 2N1WA 1C3TA 2PE6B 3A4RA 1WGHA 2MW5A 5C23A 2LJ5A 3PSEB 2DYBA 3LDZE 1M94A 3ZDMC 1YQBA 2KJRA 4KVGB 5DPTA 2NBVB 3P2BA 4BKGA 3TCAA 4PYZA 2CHXA 3Q3FA 3APCA 4A3PA 3ZO5B 2DYMA 3VUWA 3TBLD 2M8SA 4LJOB 2VRRB 4HLEA 4I6PA 2N7EA 4W9GA 2O6VB 2KFKA 4MJSB 4W9EA 1E8XA 2AYOB 2ZNVC 4IM3A 4CHKA 3SDLC 3QJZA 4GIVA 2RPQA 3U8ZA 3QQ8B 4GXBA 5IA7A 3MJWA 4PS8A 1WJ6A 3W1YA 3ENEA 3L16A 4MM3A 4KV2A 3L10B 4HDQA 2D10A 3QC8B 3DOWA 2DHZA 2NPTA 3ZRFA 1RAXA 3EC8A 3PVLA 2KMAA 1JRUA 3UGBB 3DBSA 4GU2A 4OVVA 1TTNA 2GBRA 2W9NA 5G2NA 3NS8A 2JT4B 1WGDA 4W9LA 2JVCA 2KWVB 2IO1B 4GOCA 5CHWA 4WWOA 3VTUA 4ZRJA 2G4DB 3KYCD 2CU1A 3I3TB 3PZDA 3JVZX 4M8MA 2N7DA 4WQOB 1V5TA 5D6JB 4II3B 5TR5A 2KN5A 1GJZA 2PJHA 1V2YA 2ZPYA 2DZKA 1WGYA 5E6OA 3RT3B 2JWZA 2Z0EB 3DPDA 3QCAA 1L2NA 4EEWA 3H6NA 3HM6X 4K1RB 3ZNGC 3MHSD 3DVNV 3UIOB 3M63B 2N1VA 1UH6A 2GBJA 5LXIB 1IYFA 2DAJA 3HIZA 2KTRA 2N9XA 1WXAA 2NR2A 3CSTA 3EECA 2JZ3B 2BKFA 3KYDD 1KM7A 4NPNA 4TUUA 2PE9A
chains in the Genus database with same CATH superfamily
1OQRA 4IWOA 1TBEA 2JRIB 5CX3A 1E8YA 5L95C 1V6EA 4WAAA 5BYQA 3JYUA 2KFJA 1FXAA 1GUAB 1AWDA 3TEWA 3K9PB 3AE6B 3ML8A 2IY0B 4FLHA 1WX7A 2EMTA 4L1BA 2ON8A 3IAM1 3DBHB 3J9CA 4OZCA 4HPPA 3RNGC 1V81A 2KANA 3GS2A 1WZ0A 1C77A 3T3OA 4M0WA 3H7PA 4GDKB 4DBGA 1XF5L 4NJ7A 1FM0D 2E3TA 4EZKA 1NI2A 4IUMB 1GAQB 3FILB 2WXOA 2ONQA 3KW5B 1ZGUB 5G5HA 1IUEA 4REZA 1E6EB 3X0WA 1Z5SB 2BTEA 4JWUC 2MEKA 3UINB 4P7IA 2KN4A 2KD0A 4GGQA 2KHWB 3AEBB 4G3XB 1DOIA 4LCDE 2I1KA 1J19A 4RCOA 4IDIA 4ANVA 4IG7B 1YX5B 2XBBC 3TL5A 5DCNA 2C5LC 3ZW3A 1FD6A 1N6ZA 2G4SA 2JWUA 1QOAA 2CJNA 4EUTA 1E8WA 2O2VA 3N3KB 2W54A 1WZ3A 1SEBD 3DVGY 1M4VA 1QILA 2BB5A 4X57B 2FCNA 4RGOS 3UIPB 2E6XA 1P3QU 1JMLA 2Q5WD 5D94A 1QOBA 1EF1A 2BBCA 3DQVA 2ZVOA 4GB9A 3C8YA 2MBEA 1F1HA 4B9KA 2ICIA 3QIJA 2D07B 4FHJA 1VDVA 4LNFA 2PW9A 3ZVVA 3ZNID 4NZLB 2N4FA 1UWXA 2V1YA 3AE2B 3V6CB 1OEYJ 2V3PA 4M0WB 3RULA 3T9LA 1AN8A 2IGDA 2KOXA 4YTMB 2FCQA 4BOZB 2BS3B 2BVCA 2KAJA 1GC6A 3B08A 4CO7A 4FN2A 3AEDB 4WAFA 4CQNA 1ZOYB 3DHGC 1E90A 4XWTA 2KK8A 4TSSA 3A4SC 4AWJA 1QT9A 5L83A 2CU3A 3C0RB 2REXA 5AZGA 4G0NB 5IOIA 1B1ZA 1K51A 3OJ3A 2Z59B 2GBMA 3VUXA 4N59A 1BT0A 3QK0A 4NJ6A 2BYEA 3V05A 1F2RC 4BKSA 3DVGX 1N63A 4RH6A 3V60A 1V9JA 5FR6A 1WRIA 3JW0X 4II2B 1FRRA 2MLBA 1L7YA 2W55A 4MACA 1NDDA 3RD2A 3Q3JA 2LASA 4BFRA 3D32A 3NUHB 2SAKA 1U4AA 4TMAB 2N9KA 3P42A 4AJWA 4NQKE 3PV1A 4MH0E 2LGIA 4YTNB 3WAOA 3TEXA 2C7NB 2LGYA 2LGSA 3AE3B 4ARIA 1T0YA 4YL8A 3GOEA 2V0GA 3VR8B 1SIJA 5JXVA 3NZUA 3DBHI 2LVOA 2WXGA 3WCQA 2YEPF 1HTOA 3OG5A 1FIQA 4LDTB 4R3DA 2IO0B 5AZHA 2J42A 1RFAA 3HUIA 4NJCA 3RUIB 1XXGA 3HM3A 1FXTB 3R7RA 2J0MA 2PEAA 3RNBC 3VQIA 3E56A 2WXQA 4RM8A 4K7UA 2FIDA 2CR5A 2MHJA 2RSUA 3EGRA 3ZGZA 1PGXA 1UBQA 3EA6A 1MHXA 4MT5A 3OLMD 2J4XA 4ZRIA 3ZJTA 4YT0B 2FCMA 2NVUI 4KDLB 3DCGA 3SU8X 4NAWA 1JCKB 1YIWA 3EHVA 1I4HA 1TY2A 1RM6C 3AM9A 1MI0A 2FNJB 4MJSA 1TYGB 3A9JA 1T0RC 3IVFA 1GG3A 3DHIC 4NNJB 2PMVA 2MQJA 1WWTA 3P63A 3CF6E 2IBIB 2ASQA 2AL3A 2KJHB 1ZKHA 1OGWA 3SR6A 1EU3A 4FJZA 4AOFA 2N9PC 3NOBA 1XLQA 3N20C 2BKRB 4LK0M 4WH4A 2J0KA 4JE3B 1WI0A 3ZUNA 2HJ1A 4LNNA 4RM9A 4OVUA 2IJ0A 4L23A 2A4ZA 2KVZA 2ZZPB 1RFKA 2QHOA 2ZNVB 2C9WB 4XWWA 2D2QA 3EUB2 2JPHA 1CJEA 1WIAA 4M00A 2FCSA 2C7HA 1WJNA 2INDC 1WXMA 4K3BA 1YN3A 2M17A 4I6NB 2KDFB 2N0SB 1IPGA 3H9DA 4GLSC 2KWCA 3OJ4B 3BYYB 3U52E 2Y5BB 4HWIB 3VRAB 2D3BA 1VR9A 1K52A 2PE6B 2WDVB 1AW7A 4C56C 2KJRA 4KVGB 4S17A 5DPTA 3I63C 3BK1A 2ZW1A 1YJJA 2NTTA 3TBLD 1SJED 4LJOB 4MJSB 2KFKA 4W9EA 3ZJUA 1OFFA 3QJZA 1SE3A 2RPQA 3AE7B 4GXBA 3MJ5A 4KKJA 4PS8A 1JWMD 4ZHPA 1QKZA 1NI3A 1RAXA 3EC8A 2KMAA 3BZDB 3R2IA 1UWMA 2WQYB 5G2NA 3NZ3A 3KYCD 1XCQL 2CU1A 3JVZX 4M8MA 3AE8B 4WQOB 5D6JB 2L32A 4JWSC 2KN5A 2PJHA 1WGYA 4ZRQA 1L2NA 3HM6X 3DVNV 1I4XA 3UIOB 2TSSA 2N1VA 2RDGA 5LXIB 1IYFA 3HIZA 1TY0A 1DOYA 5GXGB 2WXNA 1WSPA 4NPNA 4PS3A 4WURA 4F7ZA 4EFOA 2WWZA 4IC7B 3A9KA 4TKNA 3B2GA 1JROA 2KDMA 1VLBA 2WDQB 1V1OA 1KLVA 3ZDTA 1E7VA 4IM2A 3ZIMA 2C60A 2IYDB 2K1FA 1VRAB 3TSSA 3UQAA 3KH0A 2IO2B 5G55A 4MEMA 4TQ0A 1RYJA 3Q14C 2KLCA 2AEHA 2BYTA 4DXAB 1QOGA 2MJEA 2MP2B 1FXIA 5DPWA 1JWSD 1VZ6A 1E8ZA 2JRHA 4HRSA 4C4VA 4G50A 2LWPA 2KFKB 2DAFA 3EFUA 3P1MA 1L0YB 3IXSA 2KC1A 3MHZA 3QHTA 1G6JA 3I57A 3P4PB 3AXCA 2LVQA 2K5PA 2GBKA 4KGRA 2ZCBA 3QWZB 2XNAC 2KWUB 2UWQA 1L0VB 4K7SA 5D3IB 3IHPC 2BQQA 1DOXA 2DZMA 1HTQA 5BMHA 5HI1A 2DZIA 4ANWA 2RMMA 3NZSA 1KLGD 4LDTD 3MTNB 1EU4A 1PGAA 2YVCA 4BVUC 2D3CA 2IO3B 2WYQA 4JPSA 1WMHB 3MC0B 2V4IB 4W9DA 5HG2A 1FNVA 2L52A 2JUOA 1K8RB 1ACCA 3RN9C 5C2TB 1KRHA 3KWLA 1QF6A 3BINA 1ZP0B 3P4RB 4P16A 3R2TA 3A9KB 3PREA 3DHHC 4EOYA 3EFCA 2GB1A 3ECIA 1H8CA 1E7PB 1T0QC 1V1PA 2MBQA 1ET9A 2LVPA 1JALA 3WA0A 2CHWA 1KJTA 1P98A 3GP7A 4BKSD 1FRDA 1SGHA 3CMMB 1UGMA 1Y8RC 2JYEA 3AU5A 2LRUA 3LYYA 2JXXA 1UNSA 2GBNA 1MG8A 2NMQA 2KJ6A 3RYTA 1YMHE 2AQ3B 3KWVA 2VH2A 2YLMA 2LJIA 5EE9A 2OHFA 2J0JA 2BW2A 4PS7A 4ANUA 2MBOA 1JQ4A 5EE0A 1TKEA 2IGGA 3NJTA 1FCLA 3ALBA 1HZ5A 4HCNB 1PQSA 2WXHA 3IT6B 3B9JA 4I6LB 2MJ3A 3U30A 3RMKC 3BY4B 4YSYB 3JSVA 4DWFA 3T8MA 4M8NA 4KIKA 2K8HA 2KO3A 3M95A 1L4ZB 1JWBD 1FPYA 5EE3A 1E0ZA 4HDOA 4H2AA 2GLSA 3SD5A 3W9CB 2NPTB 3AULA 1LO5D 1AYFA 1ZXHA 3Q69A 4B0MA 5CHVC 3Q8FA 2I1JA 5J17A 2WX0A 2LUEA 1S3SG 1R4NB 4EKUA 1V1PB 2IDYA 3VTVA 1RRBA 1WFYA 1HE8A 3A1QA 2KTRB 2MA9B 1AARA 1I4PA 1H4RA 4HCPB 4FJVB 2HDEA 5D7GA 3KLSX 5LXHA 2EMSA 1YNTE 4KKIA 2MCNB 5JHBA 1ESFA 2KTFA 4MGIE 2AX5A 4F1SA 2I2YA 3VUYA 3SHQA 3PTFC 3M62B 2M0AA 4K3CA 2MWSB 3X23A 1UGJA 1WXSA 1R4MI 2WDTB 3H7PB 2JQRB 3DBLB 1ZE3D 2Y5PA 4GN1A 3PLVA 2OJRA 4DHJB 2J53A 1STEA 1SBBB 4HVBA 3AH7A 3JSVB 4ZYNA 3K9OB 4HEA1 1TGZB 2L0TA 3RZFA 3MP9A 4KIKB 1ROEA 3SDLC 1V86A 4F8CB 1GC7A 1MVKA 1Q0WB 1TZOA 2K6DB 4S0RA 4B95A 5JZEB 3QA8A 4DXGA 1V97A 3U7ZA 2INCC 1V80A 3R3MA 5CTRC 1XEEA 1I35A 4DQOC 1A5RA 1BUIC 1CK1A 2QSDA 3NY5A 1RWSA 4DDGD 2Z8LA 3PZ7A 3WIMA 2KZRA 1LM8B 3O65B 3RPFC 3PZ8A 3I5JC 1EUVB 2O2VB 3P4SB 4DHZE 3PHWB 5JHAA 1I4QA 4Q2JA 3UF8A 3HK0A 4RGTA 3DWGC 1IBXA 2K8CA 3PO0A 1XD3B 2WGSA 2CS4A 2EKEC 2RR9A 2ZJDA 4A90A 3UQBA 3NVZA 3ZJVA 2WLBA 2BGFA 1PUTA 4GSWA 2KWDA 4WJPA 3KUCB 3BWUD 5AUKA 1VZ8A 1WGHA 1I4RA 2LJ5A 3PSEB 3LDZE 1M94A 4M01A 2NBVB 4BKGA 3TCAA 1N5WA 2CHXA 4BZAA 1EWCA 3MFGA 3Q3FA 3APCA 4OVZA 3IT4B 4I6PA 1TJEA 3N1ZC 2AYOB 2ZNVC 2ZW0A 4WWMA 4GIVA 1OQQA 3U8ZA 5IA7A 3ZYYX 3AMZA 2IGHA 1WJ6A 3W1YA 3ENEA 3L16A 2OEDA 4KV2A 3L10B 4HDQA 3UI3A 2D10A 3QC8B 3RFZB 3SEBA 3PVLA 2DNFA 3DBSA 1YOVB 4XGAB 4A6QA 5G5GA 1TTNA 2IPKD 4W9LA 2IO1B 4AQ7A 1T5XD 5CHWA 1SF0A 4WWOA 4YTPB 1KLUD 2ZPYA 4L2YA 5E6OA 3QCAA 4K1RB 3ZNGC 3GZNB 1J7CA 4OHJA 1KF6B 1WXAA 2WXPA 1TS2A 2M56B 2JZ3B 3EECA 1C4PA 3BK2A 1BMLC 4OW0A 3GE3C 2BYFA 2WXRA 4MGZE 4AJYB 3ETRA 4GDLA 4W9HA 1EF5A 1GB1A 2L8JA 3L17A 2KMCA 4USAA 2I38A 5D3DA 1SXTA 2LZ6A 3IG3A 2AL6A 3V3XA 4FJYA 1WXVA 2UU7A 4P1CC 2N9EB 2X38A 3ZTDA 2RD0A 2EKIA 1WXQA 4PYUA 3HVDA 5J2RA 2FBWB 2DZJA 1B9RA 2KVRA 5TSSA 1Q1OA 2R2OA 4LNKA 3R66C 2XK5A 2QCZA 3IBEA 2JSVX 2AQ1B 4XYCA 2N7JA 3NG0A 2V4LA 4RFBA 2QC8A 4W9KA 1KOTA 2AWTA 1I4GA 4ITKA 3N32A 4OZAA 1A70A 4NAWB 2ZPNA 1SE2A 1F52A 4TV3A 1TKGA 4NAMA 1OEYA 1JW9D 2KMMA 1E10A 1DGJA 5GMVA 1HXYD 3NRZA 2M0XA 3A9JB 5BMGA 3N1XC 2LD9A 4RMAA 5BO4B 3L08A 3H7SA 4XDCA 3R8BA 1SB3C 2WXFA 1KTKA 1HA5A 5E6NA 4UDUC 3PGEA 1GOZA 3H8HA 2GMIC 3H1UA 1WGKA 4GDLB 2IZVB 3A33B 1E7UA 4A9AA 3RNAC 4FBJB 1LXDA 2ZEQA 4N6EB 5CHFA 2KT7A 1FNUA 1YQ4B 2VZKB 4DHJD 1GPXA 3R7QA 2JZZA 1UUPA 4P1BC 1IP9A 1XCTL 1FFUA 1TZ1A 3ZLZA 4NQLB 4BBNF 2RPVA 3QX1A 2SEBD 3KUDB 3Q8BA 2WNMA 3E9SA 2NCNA 1N61A 4A8XC 4C7ZA 2NS5A 1YN4A 3OWEB 4HXDA 4K7WA 1XQQA 1T3QA 4XDDA 2DENB 4N9F4 2QDFA 4C80A 3VHTC 3ZNHB 2DYOA 1HQRD 2BS4B 4WWNA 1WYGA 2XEWA 1JWAD 3TMPB 5DPRA 3ZQ4A 2IY1B 4W9IA 4RNAA 3AE5B 2LGXA 3Q3OC 4FXCA 2WXJA 4QAYA 3AE1B 3DWMA 3C19A 4DXFA 2INPE 3HRDD 3ABVB 3FC4A 3ONSA 2MX2A 2M19A 2LXCA 4A55A 2QIEB 2PIAA 2PVGC 3VFKA 4WJQA 1J8CA 2UYZB 2ZCCA 3RNCC 3ZRCA 3VTWA 4EE2A 4C7YA 4W9FA 2WXIA 4GDKA 1FEHA 3Q3NC 1ISNA 2BPSA 3WAPA 2Y3AA 2DWQA 3FILA 4YSZB 3AI5A 3M3JA 1QOFA 2K6QA 3GE8C 4US8A 3NS1A 2HJ8A 3AEAB 3ML9A 2KDBA 4BKTA 3LJ3A 2BT6A 3AE9B 3PRPB 2LFIA 2WX1A 2MBBB 1TKYA 4LJPB 5JH5C 3WALA 3I9V1 5IN7A 4RGNA 1ZPSA 4DDID 3URYA 1WX9A 2BWES 2RGFA 2MRPA 4ARCA 2OJWA 1JWUD 5IKCM 2KQ7A 2KDIA 4DHZB 3U2SC 2JF5A 2W3RA 1QZEA 3KVFB 4ZRKA 4JIOU 4MSMB 3S2AA 1EO6A 5I4DA 3OAWA 1I42A 2O6VA 1TIFA 2ZVNA 3AEFB 1WRDB 2LUMA 2D11A 1F9JA 4PT5A 3B1LX 2Z0DB 2J7QB 4OVVA 1YX6B 4C4VB 5EDSA 3DVNU 3VH4B 5BMIA 2L7RA 3CSFA 3CWIA 3WANA 1VCBA 1WJ4A 4E71A 4HJKA 2L0FA 3RI7C 4KZCA 1FO4A 2Y5CA 3AECB 3SFDB 1YJIA 2QILA 4ANXA 1Z2MA 1NVID 5H92C 1T6BX 2R61A 2LRWA 4IM0A 3PRMB 1SSNA 2B76B 4ZDVA 2M1MA 3DDCB 2OOBB 3NVWA 4KDIC 2FUHB 3Q8EA 2FAZA 4W9CA 4XE0A 1UF0A 2EELA 4E74A 4YSXB 2WHIA 3CIRB 4J6IA 3PT2B 4HJGE 3ZTCA 3V6EB 1EWYC 1T0SC 4JX1C 3IAS1 3QARA 5FK9C 3VDZA 1MFWA 3RCZA 1P0RA 2K3UA 2C7MB 1SIFA 3B2FA 3VR9B 2RDBC 4W9JA 3U7DA 5LLIA 2X8XX 3A4RA 5C23A 4OZBA 1C9FA 3ZDMC 4LNIA 2PTLA 4A3PA 2DYMA 3VUWA 2M8SA 2QJLA 2L1AA 2VRRB 3HVZA 2N7EA 4CHKA 2O6VB 2K22A 2J52A 1D5ZC 5HHDG 4MM3A 4IKGA 1QQRA 3ZRFA 3W5UB 1NYRA 2FE8A 2QEJC 2GBRA 2W9NA 3AN1A 2K9XA 2JT4B 1WGDA 2KWVB 4ZRJA 1I7HA 2G4DB 3BYTB 1FFVA 2VZKD 1Q10A 3DBRB 3RT3B 4EEWA 1UH6A 2GBJA 2DAJA 4P6VF 1MG4A 2KYWA 3KYDD 2BKFA 1KM7A 4TUUA 4JLCA 3W2DA 1P1AA 4RGMA 2WXLA 1SE4A 1WE7A 1PYWD 2NBWB 1CZPA 3ZXRA 3NHEB 4NY0A 1D4BA 1CMXB 5T8IA 3VAWA 3L4PA 1XLOA 5EE1A 3SFEB 5IP4D 2L00B 1UD7A 3RNFC 1HEZE 4FA6A 3BVMA 2WXMA 3QAQA 3AEEB 2L76A 3ZKJC 1WM3A 5DPSA 1MHHE 4K81A 3A1QB 1P7FA 2LXAA 1LQBA 3APDA 1Y56A 1UBIA 4KX6B 2HTHA 1N5XA 3AE4B 1UZXB 1F0ZA 2NTSA 1LGRA 4YXDB 5IAAC 3VVWB 3LXFA 3TIXA 4HKQA 1DYQA 1ZW7A 2KC2A 2MSED 2GOWA 4MM3B 5BYSA 3Q8AA 1ZDVA 4AS1A 3B0AA 4JL9A 1J7BA 2D3GA 4KZ0A 2R2QA 1WE6A 1D6EC 1X1MA 2W3SA 2BF8B 3AB5A 1GB4A 1V5OA 2L05A 1WY8A 2K25A 4HROA 1YD8U 5AZFA 4KGTA 4IW0A 3PS6A 4B6WA 2LI5A 1WYWB 4LNOA 3L54A 2K0PA 4IWPA 1BXTA 5MPOA 5IO9A 1VZ7A 2VH1A 4LTUA 1EM7A 3L0WB 4AP4C 5HFYA 4KSKC 3VRBB 2KKCA 1CQVA 2L3ZA 2MJDA 4ZYSA 4D2KA 4CYEA 3TEYA 2YEPB 4XX5A 3AEGB 3FAHA 3Q2AC 2NBUA 2H88B 3AV8A 1VJKA 2LGDA 4N58A 4URKA 1YJ1A 1PDXA 4HK2A 1KFYB 3FKYA 4O1NA 1WR6E 4E3CA 1WF9A 1TT5B 1ZDXA 4DK5A 2WU2B 2M4NA 4JGHB 1R4NI 1FCCC 1L6UA 2CHZA 4ACFA 2PLPA 2KACA 5FR3A 2L83A 1HZ6A 2HD5B 4J3OD 4FULA 3AU4A 1IBXB 1XT9B 1IGDA 4FADA 2H89B 2DLBA 3RZWC 2GRIA 3NVVA 4MGKE 2W82A 2MH7A 1OQYA 3TJPA 2G45B 2CJOA 4HPLB 2KQSA 4MDKE 3ZNZB 4ZRPA 1V8CA 2BS2B 4MSQB 4MGYE 3V62A 3W5VB 3ZXVA 2PKOA 4IOIE 1C78A 2BB6A 4A20A 2KX3A 3PRZA 3DBLI 1NYQA 3KQ4A 1YN5A 1WM2A 3DBRI 2DX5B 4KGSA 1K53A 1JRPA 1NENB 2G1EA 1R7SA 4WJOA 3U4EG 1IGCA 5J18A 4JQWC 2V3SA 1TS5A 1SE9A 4YWGG 4ICUA 4BBNC 3APFA 1TS4A 3N30A 4TQ1A 1OTRB 4XC2A 3VH3B 2RDHA 1XLPA 2WP9B 1YQ3B 4AUQC 1XLNA 4EZJA 1L4DB 2FUG1 5BYRA 1VD2A 1RLFA 2BWFA 3TUOA 1E9MA 5E6JA 4IWQA 1PGBA 4EZLA 5D2MB 1L0XB 2K39A 3VXWA 1S1QB 1P9DU 2LHDA 1KH0A 2CKHB 3MC8A 3PLUA 4M02A 2MP2A 4MELA 2O6VD 3MC9A 2WS3B 1V49A 5C1ZA 2MBHA 1C79A 4LLGM 2HE7A 2BYVE 1XO3A 2A5UA 2GI9A 3BVGA 1C4CA 2QMTA 5C3JB 2ACZB 4ZOHC 2B3AA 5AEKB 1LFDA 3BVZA 3P4QB 5H8YE 2JZPA 2LHEA 1NEKB 2JX5A 4FHKA 1PFDA 1ZXIA 2DBYA 3PHXB 4XZ4A 1P7EA 3BIID 3NVYA 5HKHA 3LB8C 2JY6A 4G11A 2D5GA 1C76A 2G9HD 1GNUA 4US9A 3RNEC 3Q6BA 2V3NA 3KUZA 3L13A 2INNE 3IFWB 2FIFA 1WGGA 4RF1A 2JXTA 1WMHA 4ICVA 2PPHA 4II3B 1C3TA 2XK5B 1WGRA 1ZUD2 2KNBA 2KDEB 1D3ZA 2D3AA 2WU5B 3T3NA 1D5MC 2LEKA 3V61A 5AUIA 2LMCA 1MPEA 5KHOA 5E6PA 1WH3A 3HHMA 2JU6X 1Q5WB 4ASWC 4WJNA 1FMAD 4RF0A 1NBFC 2KX0A 1E5WA 1L5PA 2KLGA 1J0GA 4BAXA 3QQ8B 2G3QB 5KHQA 4WIPA 3N1YC 1F2RI 4HPMB 3GZNI 1WR1A 4KSLC 1C1YB 1MJDA 1QLBB 4WWPA 3WAMA 1WJUA 3GB1A 4A3OA 2K8BA 3W1SA 3W1SC 3TEZA 2WDRB 1D5XC 5FKAC 4GMVA 1R4MB 1WX8A 1UELA 4BOSC 3PPAA 2KXJA 2V9HA 2N1WA 2MW5A 1F77A 1K50A 2AQ2B 2HTME 2DYBA 1TS3A 1YQBA 3P2BA 1N60A 4PYZA 3ZO5B 4HLEA 4W9GA 1E8XA 4IM3A 2N9LA 2PVOD 4ZHOA 3MJWA 3DOWA 2DHZA 2NPTA 5LNK1 3O13A 2KQ4X 3Q3MC 1JRUA 3UGBB 4GU2A 1C4AA 3NS8A 2JVCA 4MH8A 4PK1A 4GOCA 2JYTA 3VTUA 3I3TB 3PZDA 1SJHD 2N7DA 1L6VA 1V5TA 4C00A 3N9YC 5TR5A 1GJZA 1ET6A 1V2YA 2DZKA 4HKZE 2JWZA 2Z0EB 3DPDA 2WXKA 3H6NA 2XN9C 4B0EA 3MHSD 3Q8CA 4WQMA 3M63B 1ENFA 1N62A 2KTRA 1FNWA 2N9XA 2NR2A 3CSTA 1J7AA 2PE9A
chains in the Genus database with same CATH topology
4F7ZA 4IWOA 1TBEA 2BYFA 4JLCA 2JRIB 1P1AA 5CX3A 1E8YA 5L95C 1V6EA 4WAAA 4EFOA 4MGZE 1WE7A 2NBWB 3JYUA 4AJYB 2KFJA 1GUAB 4GDLA 4W9HA 4PS3A 2WWZA 3K9PB 4IC7B 1EF5A 3A9KA 3ML8A 3NHEB 4NY0A 4TKNA 2IY0B 2L8JA 4FLHA 1WX7A 2EMTA 1CMXB 3L17A 2KMCA 1KLVA 3ZDTA 1E7VA 3VAWA 4IM2A 1V81A 2KANA 1WZ0A 3H7PA 4GDKB 4DBGA 3ZIMA 2C60A 2LZ6A 3IG3A 5EDSA 2AL6A 2IYDB 4NJ7A 2L00B 1UD7A 4FJYA 4EZKA 4FA6A 1WXVA 1NI2A 2K1FA 3QAQA 3UQAA 2L76A 4IUMB 3KH0A 2N9EB 2IO2B 3ZKJC 5G55A 3ZTDA 2RD0A 4MEMA 4TQ0A 1WM3A 5DPSA 4PYUA 2KLCA 3KW5B 2AEHA 4K81A 4DXAB 3A1QB 2LXAA 1LQBA 1ZGUB 2MP2B 5J2RA 3APDA 5DPWA 1UBIA 3X0WA 1Z5SB 2HTHA 3UINB 1E8ZA 2DZJA 1UZXB 2JRHA 4P7IA 2KVRA 4GGQA 2KD0A 5IAAC 4G50A 2LWPA 3VVWB 1Q1OA 2R2OA 3R66C 2XK5A 2KFKB 2DAFA 2KHWB 3EFUA 3TIXA 3IBEA 4G3XB 2KC1A 4LCDE 2I1KA 1ZW7A 1J19A 3QHTA 2KC2A 1G6JA 2MSED 3AXCA 2GOWA 2LVQA 2V4LA 2GBKA 4W9KA 4ANVA 1KOTA 2ZCBA 3B0AA 4JL9A 3QWZB 2AWTA 3N32A 2KWUB 2UWQA 2D3GA 4KZ0A 4IG7B 4K7SA 2R2QA 1WE6A 1YX5B 3IHPC 1X1MA 2XBBC 2DZMA 4NAWB 2ZPNA 5DCNA 3TL5A 2BF8B 2C5LC 4TV3A 1V5OA 3ZW3A 2L05A 1OEYA 2DZIA 4ANWA 1WY8A 2G4SA 2K25A 3NZSA 1YD8U 4LDTD 3MTNB 5AZFA 5GMVA 4EUTA 1E8WA 4IW0A 3PS6A 4B6WA 2LI5A 2YVCA 1WYWB 2O2VA 3N3KB 2M0XA 3A9JB 5BO4B 4RMAA 2LD9A 4BVUC 1WZ3A 3L08A 2IO3B 3DVGY 2WYQA 3L54A 4IWPA 4X57B 3H7SA 1WMHB 4W9DA 3L0WB 4AP4C 4KSKC 2KKCA 2FCNA 3UIPB 5E6NA 1P3QU 3PGEA 2JUOA 1K8RB 5D94A 2L3ZA 1EF1A 2GMIC 2ZVOA 3DQVA 4GB9A 4CYEA 4XX5A 2MBEA 4B9KA 3BINA 3H1UA 4GDLB 3QIJA 2IZVB 2D07B 4FHJA 2NBUA 3A33B 3A9KB 1E7UA 2LGDA 3PREA 4URKA 4EOYA 1YJ1A 4FBJB 3ZVVA 3ECIA 3ZNID 1LXDA 1H8CA 2ZEQA 4HK2A 2N4FA 5CHFA 1WR6E 2MBQA 2V1YA 3V6CB 4E3CA 1OEYJ 1WF9A 4DHJD 4M0WB 2LVPA 3R7QA 4DK5A 3RULA 2JZZA 3T9LA 1IP9A 3WA0A 2M4NA 4JGHB 1TZ1A 3ZLZA 4NQLB 4BBNF 2CHWA 1KJTA 1P98A 3QX1A 3KUDB 4BKSD 1R4NI 2KOXA 1SGHA 2NCNA 3CMMB 2FCQA 1UGMA 1Y8RC 3AU5A 4BOZB 2LRUA 2CHZA 2NS5A 1GC6A 3B08A 2HD5B 2JXXA 2GBNA 4HXDA 1MG8A 1XQQA 4K7WA 4FULA 4CO7A 4FN2A 2KJ6A 3AU4A 1XT9B 3RYTA 2DENB 4FADA 1E90A 4N9F4 3RZWC 2KK8A 2YLMA 4MGKE 3A4SC 3VHTC 4AWJA 1OQYA 3TJPA 2DYOA 2G45B 3ZNHB 5L83A 2J0JA 3C0RB 4PS7A 4HPLB 4ANUA 4WWNA 2MBOA 2KQSA 2REXA 5AZGA 4MDKE 3ZNZB 4G0NB 2XEWA 3ALBA 4MSQB 3TMPB 4HCNB 1PQSA 3OJ3A 4MGYE 2Z59B 5DPRA 3V62A 2GBMA 2IY1B 4W9IA 3VUXA 4I6LB 3U30A 1BT0A 3QK0A 4NJ6A 4A20A 2BYEA 2LGXA 3BY4B 2KX3A 3PRZA 3JSVA 3DBLI 4BKSA 4DWFA 3T8MA 3DVGX 3V60A 4M8NA 1V9JA 5FR6A 4KIKA 3JW0X 2K8HA 2KO3A 3M95A 4II2B 2MLBA 1WM2A 1L7YA 3DBRI 2DX5B 1NDDA 3RD2A 3Q3JA 2LASA 4BFRA 4HDOA 3SD5A 3D32A 3ONSA 2MX2A 4WJOA 2LXCA 1U4AA 5J18A 4JQWC 4AJWA 2NPTB 3AULA 2V3SA 4NQKE 1SE9A 3PV1A 4MH0E 3VFKA 4WJQA 4ICUA 4BBNC 3APFA 3N30A 3WAOA 1J8CA 2UYZB 2ZCCA 4TQ1A 1OTRB 4XC2A 3VH3B 2C7NB 2LGYA 3ZRCA 4EZJA 4AUQC 5CHVC 3VTWA 2I1JA 1T0YA 4W9FA 4YL8A 1VD2A 4GDKA 1RLFA 5J17A 2BWFA 3GOEA 2WX0A 1ISNA 2LUEA 1S3SG 2BPSA 4IWQA 3WAPA 3NZUA 4EKUA 5D2MB 4EZLA 3DBHI 1RRBA 3VTVA 2K39A 3VXWA 1S1QB 1WFYA 2LVOA 3AI5A 1P9DU 3M3JA 4LDTB 5AZHA 1HE8A 2IO0B 2CKHB 3PLUA 3A1QA 2KTRB 2MP2A 2K6QA 2MA9B 1AARA 1RFAA 2O6VD 4MELA 2HJ8A 3ML9A 2KDBA 1H4RA 4BKTA 1V49A 3RUIB 3LJ3A 4HCPB 4FJVB 5C1ZA 5D7GA 2MBHA 3PRPB 3HM3A 1FXTB 3R7RA 2J0MA 5LXHA 2EMSA 2PEAA 3VQIA 2HE7A 4RM8A 2BYVE 2A5UA 4K7UA 2FIDA 2MCNB 2WX1A 5JHBA 2MBBB 2CR5A 4LJPB 5JH5C 3WALA 2KTFA 2RSUA 4MGIE 2B3AA 4DDID 1LFDA 4F1SA 5AEKB 1UBQA 3VUYA 3OLMD 1WX9A 3SHQA 4ZRIA 3PTFC 3M62B 2BWES 2RGFA 2MRPA 4FHKA 2MWSB 2FCMA 2NVUI 4KDLB 3X23A 3PHXB 3DCGA 4XZ4A 3SU8X 1WXSA 1R4MI 2WDTB 3H7PB 2KQ7A 2KDIA 4DHZB 5HKHA 4NAWA 2JF5A 2JY6A 4G11A 1YIWA 3EHVA 4GN1A 1QZEA 3KVFB 3PLVA 1GNUA 4ZRKA 4JIOU 4MSMB 2OJRA 4DHJB 3S2AA 1EO6A 2FNJB 3OAWA 4HVBA 2O6VA 4MJSA 1I42A 2ZVNA 3KUZA 3L13A 3A9JA 1WRDB 3JSVB 3IFWB 3IVFA 4ZYNA 2FIFA 3K9OB 2D11A 1GG3A 1F9JA 4NNJB 1WGGA 3B1LX 1TGZB 2L0TA 2MQJA 3RZFA 1WMHA 4KIKB 2Z0DB 3CF6E 4ICVA 2IBIB 2J7QB 2ASQA 1V86A 2PPHA 1GC7A 1YX6B 1Q0WB 2K6DB 3DVNU 2AL3A 4F8CB 3VH4B 2KJHB 4B95A 1ZKHA 2XK5B 5JZEB 1OGWA 1WGRA 3QA8A 2KNBA 2L7RA 3CSFA 2KDEB 3WANA 1VCBA 1D3ZA 1WJ4A 4E71A 1V80A 3R3MA 4HJKA 2L0FA 5CTRC 3V61A 4KZCA 1I35A 4FJZA 4AOFA 2N9PC 5KHOA 3NOBA 1A5RA 5E6PA 2BKRB 1WH3A 4ANXA 3HHMA 2J0KA 1WI0A 1Z2MA 3NY5A 1Q5WB 3ZUNA 4ASWC 4WJNA 2LRWA 4IM0A 4DDGD 3WIMA 3PRMB 2KZRA 1NBFC 2KX0A 1LM8B 4RM9A 3O65B 4OVUA 1E5WA 4ZDVA 2KLGA 2M1MA 1J0GA 2A4ZA 3DDCB 1EUVB 2QHOA 2ZZPB 2G3QB 2O2VB 2OOBB 2C9WB 2ZNVB 2FUHB 4KDIC 4DHZE 2FAZA 5KHQA 3PHWB 5JHAA 4W9CA 2D2QA 2JPHA 1WIAA 4HPMB 3UF8A 3GZNI 3HK0A 4E74A 1WR1A 4KSLC 1C1YB 4J6IA 2FCSA 4WWPA 2C7HA 1WJNA 3PT2B 3WAMA 1WJUA 1WXMA 3ZTCA 3V6EB 2M17A 4I6NB 2K8CA 4A3OA 2K8BA 3W1SA 3W1SC 3QARA 2KDFB 1XD3B 2CS4A 2EKEC 2RR9A 1IPGA 2ZJDA 3UQBA 3H9DA 3VDZA 2KWCA 3OJ4B 3RCZA 4GMVA 1P0RA 1WX8A 1UELA 2BGFA 2C7MB 4GSWA 4BOSC 3PPAA 2KXJA 1SIFA 2Y5BB 4HWIB 4W9JA 3U7DA 4WJPA 3KUCB 5LLIA 2N1WA 1C3TA 2PE6B 3A4RA 1WGHA 2MW5A 5C23A 2LJ5A 3PSEB 2DYBA 3LDZE 1M94A 3ZDMC 1YQBA 2KJRA 4KVGB 5DPTA 2NBVB 3P2BA 4BKGA 3TCAA 4PYZA 2CHXA 3Q3FA 3APCA 4A3PA 3ZO5B 2DYMA 3VUWA 3TBLD 2M8SA 4LJOB 2VRRB 4HLEA 4I6PA 2N7EA 4W9GA 2O6VB 2KFKA 4MJSB 4W9EA 1E8XA 2AYOB 2ZNVC 4IM3A 4CHKA 3SDLC 3QJZA 4GIVA 2RPQA 3U8ZA 3QQ8B 4GXBA 5IA7A 3MJWA 4PS8A 1WJ6A 3W1YA 3ENEA 3L16A 4MM3A 4KV2A 3L10B 4HDQA 2D10A 3QC8B 3DOWA 2DHZA 2NPTA 3ZRFA 1RAXA 3EC8A 3PVLA 2KMAA 1JRUA 3UGBB 3DBSA 4GU2A 4OVVA 1TTNA 2GBRA 2W9NA 5G2NA 3NS8A 2JT4B 1WGDA 4W9LA 2JVCA 2KWVB 2IO1B 4GOCA 5CHWA 4WWOA 3VTUA 4ZRJA 2G4DB 3KYCD 2CU1A 3I3TB 3PZDA 3JVZX 4M8MA 2N7DA 4WQOB 1V5TA 5D6JB 4II3B 5TR5A 2KN5A 1GJZA 2PJHA 1V2YA 2ZPYA 2DZKA 1WGYA 5E6OA 3RT3B 2JWZA 2Z0EB 3DPDA 3QCAA 1L2NA 4EEWA 3H6NA 3HM6X 4K1RB 3ZNGC 3MHSD 3DVNV 3UIOB 3M63B 2N1VA 1UH6A 2GBJA 5LXIB 1IYFA 2DAJA 3HIZA 2KTRA 2N9XA 1WXAA 2NR2A 3CSTA 3EECA 2JZ3B 2BKFA 3KYDD 1KM7A 4NPNA 4TUUA 2PE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  4IWO A;  1TBE A;  2BYF A;  4JLC A;  2JRI B;  1P1A A;  5CX3 A;  1E8Y A;  5L95 C;  1V6E A;  4WAA A;  4EFO A;  4MGZ E;  1WE7 A;  2NBW B;  3JYU A;  4AJY B;  2KFJ A;  1GUA B;  4GDL A;  4W9H A;  4PS3 A;  2WWZ A;  3K9P B;  4IC7 B;  1EF5 A;  3A9K A;  3ML8 A;  3NHE B;  4NY0 A;  4TKN A;  2IY0 B;  2L8J A;  4FLH A;  1WX7 A;  2EMT A;  1CMX B;  3L17 A;  2KMC A;  1KLV A;  3ZDT A;  1E7V A;  3VAW A;  4IM2 A;  1V81 A;  2KAN A;  1WZ0 A;  3H7P A;  4GDK B;  4DBG A;  3ZIM A;  2C60 A;  2LZ6 A;  3IG3 A;  5EDS A;  2AL6 A;  2IYD B;  4NJ7 A;  2L00 B;  1UD7 A;  4FJY A;  4EZK A;  4FA6 A;  1WXV A;  1NI2 A;  2K1F A;  3QAQ A;  3UQA A;  2L76 A;  4IUM B;  3KH0 A;  2N9E B;  2IO2 B;  3ZKJ C;  5G55 A;  3ZTD A;  2RD0 A;  4MEM A;  4TQ0 A;  1WM3 A;  5DPS A;  4PYU A;  2KLC A;  3KW5 B;  2AEH A;  4K81 A;  4DXA B;  3A1Q B;  2LXA A;  1LQB A;  1ZGU B;  2MP2 B;  5J2R A;  3APD A;  5DPW A;  1UBI A;  3X0W A;  1Z5S B;  2HTH A;  3UIN B;  1E8Z A;  2DZJ A;  1UZX B;  2JRH A;  4P7I A;  2KVR A;  4GGQ A;  2KD0 A;  5IAA C;  4G50 A;  2LWP A;  3VVW B;  1Q1O A;  2R2O A;  3R66 C;  2XK5 A;  2KFK B;  2DAF A;  2KHW B;  3EFU A;  3TIX A;  3IBE A;  4G3X B;  2KC1 A;  4LCD E;  2I1K A;  1ZW7 A;  1J19 A;  3QHT A;  2KC2 A;  1G6J A;  2MSE D;  3AXC A;  2GOW A;  2LVQ A;  2V4L A;  2GBK A;  4W9K A;  4ANV A;  1KOT A;  2ZCB A;  3B0A A;  4JL9 A;  3QWZ B;  2AWT A;  3N32 A;  2KWU B;  2UWQ A;  2D3G A;  4KZ0 A;  4IG7 B;  4K7S A;  2R2Q A;  1WE6 A;  1YX5 B;  3IHP C;  1X1M A;  2XBB C;  2DZM A;  4NAW B;  2ZPN A;  5DCN A;  3TL5 A;  2BF8 B;  2C5L C;  4TV3 A;  1V5O A;  3ZW3 A;  2L05 A;  1OEY A;  2DZI A;  4ANW A;  1WY8 A;  2G4S A;  2K25 A;  3NZS A;  1YD8 U;  4LDT D;  3MTN B;  5AZF A;  5GMV A;  4EUT A;  1E8W A;  4IW0 A;  3PS6 A;  4B6W A;  2LI5 A;  2YVC A;  1WYW B;  2O2V A;  3N3K B;  2M0X A;  3A9J B;  5BO4 B;  4RMA A;  2LD9 A;  4BVU C;  1WZ3 A;  3L08 A;  2IO3 B;  3DVG Y;  2WYQ A;  3L54 A;  4IWP A;  4X57 B;  3H7S A;  1WMH B;  4W9D A;  3L0W B;  4AP4 C;  4KSK C;  2KKC A;  2FCN A;  3UIP B;  5E6N A;  1P3Q U;  3PGE A;  2JUO A;  1K8R B;  5D94 A;  2L3Z A;  1EF1 A;  2GMI C;  2ZVO A;  3DQV A;  4GB9 A;  4CYE A;  4XX5 A;  2MBE A;  4B9K A;  3BIN A;  3H1U A;  4GDL B;  3QIJ A;  2IZV B;  2D07 B;  4FHJ A;  2NBU A;  3A33 B;  3A9K B;  1E7U A;  2LGD A;  3PRE A;  4URK A;  4EOY A;  1YJ1 A;  4FBJ B;  3ZVV A;  3ECI A;  3ZNI D;  1LXD A;  1H8C A;  2ZEQ A;  4HK2 A;  2N4F A;  5CHF A;  1WR6 E;  2MBQ A;  2V1Y A;  3V6C B;  4E3C A;  1OEY J;  1WF9 A;  4DHJ D;  4M0W B;  2LVP A;  3R7Q A;  4DK5 A;  3RUL A;  2JZZ A;  3T9L A;  1IP9 A;  3WA0 A;  2M4N A;  4JGH B;  1TZ1 A;  3ZLZ A;  4NQL B;  4BBN F;  2CHW A;  1KJT A;  1P98 A;  3QX1 A;  3KUD B;  4BKS D;  1R4N I;  2KOX A;  1SGH A;  2NCN A;  3CMM B;  2FCQ A;  1UGM A;  1Y8R C;  3AU5 A;  4BOZ B;  2LRU A;  2CHZ A;  2NS5 A;  1GC6 A;  3B08 A;  2HD5 B;  2JXX A;  2GBN A;  4HXD A;  1MG8 A;  1XQQ A;  4K7W A;  4FUL A;  4CO7 A;  4FN2 A;  2KJ6 A;  3AU4 A;  1XT9 B;  3RYT A;  2DEN B;  4FAD A;  1E90 A;  4N9F 4;  3RZW C;  2KK8 A;  2YLM A;  4MGK E;  3A4S C;  3VHT C;  4AWJ A;  1OQY A;  3TJP A;  2DYO A;  2G45 B;  3ZNH B;  5L83 A;  2J0J A;  3C0R B;  4PS7 A;  4HPL B;  4ANU A;  4WWN A;  2MBO A;  2KQS A;  2REX A;  5AZG A;  4MDK E;  3ZNZ B;  4G0N B;  2XEW A;  3ALB A;  4MSQ B;  3TMP B;  4HCN B;  1PQS A;  3OJ3 A;  4MGY E;  2Z59 B;  5DPR A;  3V62 A;  2GBM A;  2IY1 B;  4W9I A;  3VUX A;  4I6L B;  3U30 A;  1BT0 A;  3QK0 A;  4NJ6 A;  4A20 A;  2BYE A;  2LGX A;  3BY4 B;  2KX3 A;  3PRZ A;  3JSV A;  3DBL I;  4BKS A;  4DWF A;  3T8M A;  3DVG X;  3V60 A;  4M8N A;  1V9J A;  5FR6 A;  4KIK A;  3JW0 X;  2K8H A;  2KO3 A;  3M95 A;  4II2 B;  2MLB A;  1WM2 A;  1L7Y A;  3DBR I;  2DX5 B;  1NDD A;  3RD2 A;  3Q3J A;  2LAS A;  4BFR A;  4HDO A;  3SD5 A;  3D32 A;  3ONS A;  2MX2 A;  4WJO A;  2LXC A;  1U4A A;  5J18 A;  4JQW C;  4AJW A;  2NPT B;  3AUL A;  2V3S A;  4NQK E;  1SE9 A;  3PV1 A;  4MH0 E;  3VFK A;  4WJQ A;  4ICU A;  4BBN C;  3APF A;  3N30 A;  3WAO A;  1J8C A;  2UYZ B;  2ZCC A;  4TQ1 A;  1OTR B;  4XC2 A;  3VH3 B;  2C7N B;  2LGY A;  3ZRC A;  4EZJ A;  4AUQ C;  5CHV C;  3VTW A;  2I1J A;  1T0Y A;  4W9F A;  4YL8 A;  1VD2 A;  4GDK A;  1RLF A;  5J17 A;  2BWF A;  3GOE A;  2WX0 A;  1ISN A;  2LUE A;  1S3S G;  2BPS A;  4IWQ A;  3WAP A;  3NZU A;  4EKU A;  5D2M B;  4EZL A;  3DBH I;  1RRB A;  3VTV A;  2K39 A;  3VXW A;  1S1Q B;  1WFY A;  2LVO A;  3AI5 A;  1P9D U;  3M3J A;  4LDT B;  5AZH A;  1HE8 A;  2IO0 B;  2CKH B;  3PLU A;  3A1Q A;  2KTR B;  2MP2 A;  2K6Q A;  2MA9 B;  1AAR A;  1RFA A;  2O6V D;  4MEL A;  2HJ8 A;  3ML9 A;  2KDB A;  1H4R A;  4BKT A;  1V49 A;  3RUI B;  3LJ3 A;  4HCP B;  4FJV B;  5C1Z A;  5D7G A;  2MBH A;  3PRP B;  3HM3 A;  1FXT B;  3R7R A;  2J0M A;  5LXH A;  2EMS A;  2PEA A;  3VQI A;  2HE7 A;  4RM8 A;  2BYV E;  2A5U A;  4K7U A;  2FID A;  2MCN B;  2WX1 A;  5JHB A;  2MBB B;  2CR5 A;  4LJP B;  5JH5 C;  3WAL A;  2KTF A;  2RSU A;  4MGI E;  2B3A A;  4DDI D;  1LFD A;  4F1S A;  5AEK B;  1UBQ A;  3VUY A;  3OLM D;  1WX9 A;  3SHQ A;  4ZRI A;  3PTF C;  3M62 B;  2BWE S;  2RGF A;  2MRP A;  4FHK A;  2MWS B;  2FCM A;  2NVU I;  4KDL B;  3X23 A;  3PHX B;  3DCG A;  4XZ4 A;  3SU8 X;  1WXS A;  1R4M I;  2WDT B;  3H7P B;  2KQ7 A;  2KDI A;  4DHZ B;  5HKH A;  4NAW A;  2JF5 A;  2JY6 A;  4G11 A;  1YIW A;  3EHV A;  4GN1 A;  1QZE A;  3KVF B;  3PLV A;  1GNU A;  4ZRK A;  4JIO U;  4MSM B;  2OJR A;  4DHJ B;  3S2A A;  1EO6 A;  2FNJ B;  3OAW A;  4HVB A;  2O6V A;  4MJS A;  1I42 A;  2ZVN A;  3KUZ A;  3L13 A;  3A9J A;  1WRD B;  3JSV B;  3IFW B;  3IVF A;  4ZYN A;  2FIF A;  3K9O B;  2D11 A;  1GG3 A;  1F9J A;  4NNJ B;  1WGG A;  3B1L X;  1TGZ B;  2L0T A;  2MQJ A;  3RZF A;  1WMH A;  4KIK B;  2Z0D B;  3CF6 E;  4ICV A;  2IBI B;  2J7Q B;  2ASQ A;  1V86 A;  2PPH A;  1GC7 A;  1YX6 B;  1Q0W B;  2K6D B;  3DVN U;  2AL3 A;  4F8C B;  3VH4 B;  2KJH B;  4B95 A;  1ZKH A;  2XK5 B;  5JZE B;  1OGW A;  1WGR A;  3QA8 A;  2KNB A;  2L7R A;  3CSF A;  2KDE B;  3WAN A;  1VCB A;  1D3Z A;  1WJ4 A;  4E71 A;  1V80 A;  3R3M A;  4HJK A;  2L0F A;  5CTR C;  3V61 A;  4KZC A;  1I35 A;  4FJZ A;  4AOF A;  2N9P C;  5KHO A;  3NOB A;  1A5R A;  5E6P A;  2BKR B;  1WH3 A;  4ANX A;  3HHM A;  2J0K A;  1WI0 A;  1Z2M A;  3NY5 A;  1Q5W B;  3ZUN A;  4ASW C;  4WJN A;  2LRW A;  4IM0 A;  4DDG D;  3WIM A;  3PRM B;  2KZR A;  1NBF C;  2KX0 A;  1LM8 B;  4RM9 A;  3O65 B;  4OVU A;  1E5W A;  4ZDV A;  2KLG A;  2M1M A;  1J0G A;  2A4Z A;  3DDC B;  1EUV B;  2QHO A;  2ZZP B;  2G3Q B;  2O2V B;  2OOB B;  2C9W B;  2ZNV B;  2FUH B;  4KDI C;  4DHZ E;  2FAZ A;  5KHQ A;  3PHW B;  5JHA A;  4W9C A;  2D2Q A;  2JPH A;  1WIA A;  4HPM B;  3UF8 A;  3GZN I;  3HK0 A;  4E74 A;  1WR1 A;  4KSL C;  1C1Y B;  4J6I A;  2FCS A;  4WWP A;  2C7H A;  1WJN A;  3PT2 B;  3WAM A;  1WJU A;  1WXM A;  3ZTC A;  3V6E B;  2M17 A;  4I6N B;  2K8C A;  4A3O A;  2K8B A;  3W1S A;  3W1S C;  3QAR A;  2KDF B;  1XD3 B;  2CS4 A;  2EKE C;  2RR9 A;  1IPG A;  2ZJD A;  3UQB A;  3H9D A;  3VDZ A;  2KWC A;  3OJ4 B;  3RCZ A;  4GMV A;  1P0R A;  1WX8 A;  1UEL A;  2BGF A;  2C7M B;  4GSW A;  4BOS C;  3PPA A;  2KXJ A;  1SIF A;  2Y5B B;  4HWI B;  4W9J A;  3U7D A;  4WJP A;  3KUC B;  5LLI A;  2N1W A;  1C3T A;  2PE6 B;  3A4R A;  1WGH A;  2MW5 A;  5C23 A;  2LJ5 A;  3PSE B;  2DYB A;  3LDZ E;  1M94 A;  3ZDM C;  1YQB A;  2KJR A;  4KVG B;  5DPT A;  2NBV B;  3P2B A;  4BKG A;  3TCA A;  4PYZ A;  2CHX A;  3Q3F A;  3APC A;  4A3P A;  3ZO5 B;  2DYM A;  3VUW A;  3TBL D;  2M8S A;  4LJO B;  2VRR B;  4HLE A;  4I6P A;  2N7E A;  4W9G A;  2O6V B;  2KFK A;  4MJS B;  4W9E A;  1E8X A;  2AYO B;  2ZNV C;  4IM3 A;  4CHK A;  3SDL C;  3QJZ A;  4GIV A;  2RPQ A;  3U8Z A;  3QQ8 B;  4GXB A;  5IA7 A;  3MJW A;  4PS8 A;  1WJ6 A;  3W1Y A;  3ENE A;  3L16 A;  4MM3 A;  4KV2 A;  3L10 B;  4HDQ A;  2D10 A;  3QC8 B;  3DOW A;  2DHZ A;  2NPT A;  3ZRF A;  1RAX A;  3EC8 A;  3PVL A;  2KMA A;  1JRU A;  3UGB B;  3DBS A;  4GU2 A;  4OVV A;  1TTN A;  2GBR A;  2W9N A;  5G2N A;  3NS8 A;  2JT4 B;  1WGD A;  4W9L A;  2JVC A;  2KWV B;  2IO1 B;  4GOC A;  5CHW A;  4WWO A;  3VTU A;  4ZRJ A;  2G4D B;  3KYC D;  2CU1 A;  3I3T B;  3PZD A;  3JVZ X;  4M8M A;  2N7D A;  4WQO B;  1V5T A;  5D6J B;  4II3 B;  5TR5 A;  2KN5 A;  1GJZ A;  2PJH A;  1V2Y A;  2ZPY A;  2DZK A;  1WGY A;  5E6O A;  3RT3 B;  2JWZ A;  2Z0E B;  3DPD A;  3QCA A;  1L2N A;  4EEW A;  3H6N A;  3HM6 X;  4K1R B;  3ZNG C;  3MHS D;  3DVN V;  3UIO B;  3M63 B;  2N1V A;  1UH6 A;  2GBJ A;  5LXI B;  1IYF A;  2DAJ A;  3HIZ A;  2KTR A;  2N9X A;  1WXA A;  2NR2 A;  3CST A;  3EEC A;  2JZ3 B;  2BKF A;  3KYD D;  1KM7 A;  4NPN A;  4TUU A;  2PE9 A; 
#chains in the Genus database with same CATH topology
 1OQR A;  4IWO A;  1TBE A;  2JRI B;  5CX3 A;  1E8Y A;  5L95 C;  1V6E A;  4WAA A;  5BYQ A;  3JYU A;  2KFJ A;  1FXA A;  1GUA B;  1AWD A;  3TEW A;  3K9P B;  3AE6 B;  3ML8 A;  2IY0 B;  4FLH A;  1WX7 A;  2EMT A;  4L1B A;  2ON8 A;  3IAM 1;  3DBH B;  3J9C A;  4OZC A;  4HPP A;  3RNG C;  1V81 A;  2KAN A;  3GS2 A;  1WZ0 A;  1C77 A;  3T3O A;  4M0W A;  3H7P A;  4GDK B;  4DBG A;  1XF5 L;  4NJ7 A;  1FM0 D;  2E3T A;  4EZK A;  1NI2 A;  4IUM B;  1GAQ B;  3FIL B;  2WXO A;  2ONQ A;  3KW5 B;  1ZGU B;  5G5H A;  1IUE A;  4REZ A;  1E6E B;  3X0W A;  1Z5S B;  2BTE A;  4JWU C;  2MEK A;  3UIN B;  4P7I A;  2KN4 A;  2KD0 A;  4GGQ A;  2KHW B;  3AEB B;  4G3X B;  1DOI A;  4LCD E;  2I1K A;  1J19 A;  4RCO A;  4IDI A;  4ANV A;  4IG7 B;  1YX5 B;  2XBB C;  3TL5 A;  5DCN A;  2C5L C;  3ZW3 A;  1FD6 A;  1N6Z A;  2G4S A;  2JWU A;  1QOA A;  2CJN A;  4EUT A;  1E8W A;  2O2V A;  3N3K B;  2W54 A;  1WZ3 A;  1SEB D;  3DVG Y;  1M4V A;  1QIL A;  2BB5 A;  4X57 B;  2FCN A;  4RGO S;  3UIP B;  2E6X A;  1P3Q U;  1JML A;  2Q5W D;  5D94 A;  1QOB A;  1EF1 A;  2BBC A;  3DQV A;  2ZVO A;  4GB9 A;  3C8Y A;  2MBE A;  1F1H A;  4B9K A;  2ICI A;  3QIJ A;  2D07 B;  4FHJ A;  1VDV A;  4LNF A;  2PW9 A;  3ZVV A;  3ZNI D;  4NZL B;  2N4F A;  1UWX A;  2V1Y A;  3AE2 B;  3V6C B;  1OEY J;  2V3P A;  4M0W B;  3RUL A;  3T9L A;  1AN8 A;  2IGD A;  2KOX A;  4YTM B;  2FCQ A;  4BOZ B;  2BS3 B;  2BVC A;  2KAJ A;  1GC6 A;  3B08 A;  4CO7 A;  4FN2 A;  3AED B;  4WAF A;  4CQN A;  1ZOY B;  3DHG C;  1E90 A;  4XWT A;  2KK8 A;  4TSS A;  3A4S C;  4AWJ A;  1QT9 A;  5L83 A;  2CU3 A;  3C0R B;  2REX A;  5AZG A;  4G0N B;  5IOI A;  1B1Z A;  1K51 A;  3OJ3 A;  2Z59 B;  2GBM A;  3VUX A;  4N59 A;  1BT0 A;  3QK0 A;  4NJ6 A;  2BYE A;  3V05 A;  1F2R C;  4BKS A;  3DVG X;  1N63 A;  4RH6 A;  3V60 A;  1V9J A;  5FR6 A;  1WRI A;  3JW0 X;  4II2 B;  1FRR A;  2MLB A;  1L7Y A;  2W55 A;  4MAC A;  1NDD A;  3RD2 A;  3Q3J A;  2LAS A;  4BFR A;  3D32 A;  3NUH B;  2SAK A;  1U4A A;  4TMA B;  2N9K A;  3P42 A;  4AJW A;  4NQK E;  3PV1 A;  4MH0 E;  2LGI A;  4YTN B;  3WAO A;  3TEX A;  2C7N B;  2LGY A;  2LGS A;  3AE3 B;  4ARI A;  1T0Y A;  4YL8 A;  3GOE A;  2V0G A;  3VR8 B;  1SIJ A;  5JXV A;  3NZU A;  3DBH I;  2LVO A;  2WXG A;  3WCQ A;  2YEP F;  1HTO A;  3OG5 A;  1FIQ A;  4LDT B;  4R3D A;  2IO0 B;  5AZH A;  2J42 A;  1RFA A;  3HUI A;  4NJC A;  3RUI B;  1XXG A;  3HM3 A;  1FXT B;  3R7R A;  2J0M A;  2PEA A;  3RNB C;  3VQI A;  3E56 A;  2WXQ A;  4RM8 A;  4K7U A;  2FID A;  2CR5 A;  2MHJ A;  2RSU A;  3EGR A;  3ZGZ A;  1PGX A;  1UBQ A;  3EA6 A;  1MHX A;  4MT5 A;  3OLM D;  2J4X A;  4ZRI A;  3ZJT A;  4YT0 B;  2FCM A;  2NVU I;  4KDL B;  3DCG A;  3SU8 X;  4NAW A;  1JCK B;  1YIW A;  3EHV A;  1I4H A;  1TY2 A;  1RM6 C;  3AM9 A;  1MI0 A;  2FNJ B;  4MJS A;  1TYG B;  3A9J A;  1T0R C;  3IVF A;  1GG3 A;  3DHI C;  4NNJ B;  2PMV A;  2MQJ A;  1WWT A;  3P63 A;  3CF6 E;  2IBI B;  2ASQ A;  2AL3 A;  2KJH B;  1ZKH A;  1OGW A;  3SR6 A;  1EU3 A;  4FJZ A;  4AOF A;  2N9P C;  3NOB A;  1XLQ A;  3N20 C;  2BKR B;  4LK0 M;  4WH4 A;  2J0K A;  4JE3 B;  1WI0 A;  3ZUN A;  2HJ1 A;  4LNN A;  4RM9 A;  4OVU A;  2IJ0 A;  4L23 A;  2A4Z A;  2KVZ A;  2ZZP B;  1RFK A;  2QHO A;  2ZNV B;  2C9W B;  4XWW A;  2D2Q A;  3EUB 2;  2JPH A;  1CJE A;  1WIA A;  4M00 A;  2FCS A;  2C7H A;  1WJN A;  2IND C;  1WXM A;  4K3B A;  1YN3 A;  2M17 A;  4I6N B;  2KDF B;  2N0S B;  1IPG A;  3H9D A;  4GLS C;  2KWC A;  3OJ4 B;  3BYY B;  3U52 E;  2Y5B B;  4HWI B;  3VRA B;  2D3B A;  1VR9 A;  1K52 A;  2PE6 B;  2WDV B;  1AW7 A;  4C56 C;  2KJR A;  4KVG B;  4S17 A;  5DPT A;  3I63 C;  3BK1 A;  2ZW1 A;  1YJJ A;  2NTT A;  3TBL D;  1SJE D;  4LJO B;  4MJS B;  2KFK A;  4W9E A;  3ZJU A;  1OFF A;  3QJZ A;  1SE3 A;  2RPQ A;  3AE7 B;  4GXB A;  3MJ5 A;  4KKJ A;  4PS8 A;  1JWM D;  4ZHP A;  1QKZ A;  1NI3 A;  1RAX A;  3EC8 A;  2KMA A;  3BZD B;  3R2I A;  1UWM A;  2WQY B;  5G2N A;  3NZ3 A;  3KYC D;  1XCQ L;  2CU1 A;  3JVZ X;  4M8M A;  3AE8 B;  4WQO B;  5D6J B;  2L32 A;  4JWS C;  2KN5 A;  2PJH A;  1WGY A;  4ZRQ A;  1L2N A;  3HM6 X;  3DVN V;  1I4X A;  3UIO B;  2TSS A;  2N1V A;  2RDG A;  5LXI B;  1IYF A;  3HIZ A;  1TY0 A;  1DOY A;  5GXG B;  2WXN A;  1WSP A;  4NPN A;  4PS3 A;  4WUR A;  4F7Z A;  4EFO A;  2WWZ A;  4IC7 B;  3A9K A;  4TKN A;  3B2G A;  1JRO A;  2KDM A;  1VLB A;  2WDQ B;  1V1O A;  1KLV A;  3ZDT A;  1E7V A;  4IM2 A;  3ZIM A;  2C60 A;  2IYD B;  2K1F A;  1VRA B;  3TSS A;  3UQA A;  3KH0 A;  2IO2 B;  5G55 A;  4MEM A;  4TQ0 A;  1RYJ A;  3Q14 C;  2KLC A;  2AEH A;  2BYT A;  4DXA B;  1QOG A;  2MJE A;  2MP2 B;  1FXI A;  5DPW A;  1JWS D;  1VZ6 A;  1E8Z A;  2JRH A;  4HRS A;  4C4V A;  4G50 A;  2LWP A;  2KFK B;  2DAF A;  3EFU A;  3P1M A;  1L0Y B;  3IXS A;  2KC1 A;  3MHZ A;  3QHT A;  1G6J A;  3I57 A;  3P4P B;  3AXC A;  2LVQ A;  2K5P A;  2GBK A;  4KGR A;  2ZCB A;  3QWZ B;  2XNA C;  2KWU B;  2UWQ A;  1L0V B;  4K7S A;  5D3I B;  3IHP C;  2BQQ A;  1DOX A;  2DZM A;  1HTQ A;  5BMH A;  5HI1 A;  2DZI A;  4ANW A;  2RMM A;  3NZS A;  1KLG D;  4LDT D;  3MTN B;  1EU4 A;  1PGA A;  2YVC A;  4BVU C;  2D3C A;  2IO3 B;  2WYQ A;  4JPS A;  1WMH B;  3MC0 B;  2V4I B;  4W9D A;  5HG2 A;  1FNV A;  2L52 A;  2JUO A;  1K8R B;  1ACC A;  3RN9 C;  5C2T B;  1KRH A;  3KWL A;  1QF6 A;  3BIN A;  1ZP0 B;  3P4R B;  4P16 A;  3R2T A;  3A9K B;  3PRE A;  3DHH C;  4EOY A;  3EFC A;  2GB1 A;  3ECI A;  1H8C A;  1E7P B;  1T0Q C;  1V1P A;  2MBQ A;  1ET9 A;  2LVP A;  1JAL A;  3WA0 A;  2CHW A;  1KJT A;  1P98 A;  3GP7 A;  4BKS D;  1FRD A;  1SGH A;  3CMM B;  1UGM A;  1Y8R C;  2JYE A;  3AU5 A;  2LRU A;  3LYY A;  2JXX A;  1UNS A;  2GBN A;  1MG8 A;  2NMQ A;  2KJ6 A;  3RYT A;  1YMH E;  2AQ3 B;  3KWV A;  2VH2 A;  2YLM A;  2LJI A;  5EE9 A;  2OHF A;  2J0J A;  2BW2 A;  4PS7 A;  4ANU A;  2MBO A;  1JQ4 A;  5EE0 A;  1TKE A;  2IGG A;  3NJT A;  1FCL A;  3ALB A;  1HZ5 A;  4HCN B;  1PQS A;  2WXH A;  3IT6 B;  3B9J A;  4I6L B;  2MJ3 A;  3U30 A;  3RMK C;  3BY4 B;  4YSY B;  3JSV A;  4DWF A;  3T8M A;  4M8N A;  4KIK A;  2K8H A;  2KO3 A;  3M95 A;  1L4Z B;  1JWB D;  1FPY A;  5EE3 A;  1E0Z A;  4HDO A;  4H2A A;  2GLS A;  3SD5 A;  3W9C B;  2NPT B;  3AUL A;  1LO5 D;  1AYF A;  1ZXH A;  3Q69 A;  4B0M A;  5CHV C;  3Q8F A;  2I1J A;  5J17 A;  2WX0 A;  2LUE A;  1S3S G;  1R4N B;  4EKU A;  1V1P B;  2IDY A;  3VTV A;  1RRB A;  1WFY A;  1HE8 A;  3A1Q A;  2KTR B;  2MA9 B;  1AAR A;  1I4P A;  1H4R A;  4HCP B;  4FJV B;  2HDE A;  5D7G A;  3KLS X;  5LXH A;  2EMS A;  1YNT E;  4KKI A;  2MCN B;  5JHB A;  1ESF A;  2KTF A;  4MGI E;  2AX5 A;  4F1S A;  2I2Y A;  3VUY A;  3SHQ A;  3PTF C;  3M62 B;  2M0A A;  4K3C A;  2MWS B;  3X23 A;  1UGJ A;  1WXS A;  1R4M I;  2WDT B;  3H7P B;  2JQR B;  3DBL B;  1ZE3 D;  2Y5P A;  4GN1 A;  3PLV A;  2OJR A;  4DHJ B;  2J53 A;  1STE A;  1SBB B;  4HVB A;  3AH7 A;  3JSV B;  4ZYN A;  3K9O B;  4HEA 1;  1TGZ B;  2L0T A;  3RZF A;  3MP9 A;  4KIK B;  1ROE A;  3SDL C;  1V86 A;  4F8C B;  1GC7 A;  1MVK A;  1Q0W B;  1TZO A;  2K6D B;  4S0R A;  4B95 A;  5JZE B;  3QA8 A;  4DXG A;  1V97 A;  3U7Z A;  2INC C;  1V80 A;  3R3M A;  5CTR C;  1XEE A;  1I35 A;  4DQO C;  1A5R A;  1BUI C;  1CK1 A;  2QSD A;  3NY5 A;  1RWS A;  4DDG D;  2Z8L A;  3PZ7 A;  3WIM A;  2KZR A;  1LM8 B;  3O65 B;  3RPF C;  3PZ8 A;  3I5J C;  1EUV B;  2O2V B;  3P4S B;  4DHZ E;  3PHW B;  5JHA A;  1I4Q A;  4Q2J A;  3UF8 A;  3HK0 A;  4RGT A;  3DWG C;  1IBX A;  2K8C A;  3PO0 A;  1XD3 B;  2WGS A;  2CS4 A;  2EKE C;  2RR9 A;  2ZJD A;  4A90 A;  3UQB A;  3NVZ A;  3ZJV A;  2WLB A;  2BGF A;  1PUT A;  4GSW A;  2KWD A;  4WJP A;  3KUC B;  3BWU D;  5AUK A;  1VZ8 A;  1WGH A;  1I4R A;  2LJ5 A;  3PSE B;  3LDZ E;  1M94 A;  4M01 A;  2NBV B;  4BKG A;  3TCA A;  1N5W A;  2CHX A;  4BZA A;  1EWC A;  3MFG A;  3Q3F A;  3APC A;  4OVZ A;  3IT4 B;  4I6P A;  1TJE A;  3N1Z C;  2AYO B;  2ZNV C;  2ZW0 A;  4WWM A;  4GIV A;  1OQQ A;  3U8Z A;  5IA7 A;  3ZYY X;  3AMZ A;  2IGH A;  1WJ6 A;  3W1Y A;  3ENE A;  3L16 A;  2OED A;  4KV2 A;  3L10 B;  4HDQ A;  3UI3 A;  2D10 A;  3QC8 B;  3RFZ B;  3SEB A;  3PVL A;  2DNF A;  3DBS A;  1YOV B;  4XGA B;  4A6Q A;  5G5G A;  1TTN A;  2IPK D;  4W9L A;  2IO1 B;  4AQ7 A;  1T5X D;  5CHW A;  1SF0 A;  4WWO A;  4YTP B;  1KLU D;  2ZPY A;  4L2Y A;  5E6O A;  3QCA A;  4K1R B;  3ZNG C;  3GZN B;  1J7C A;  4OHJ A;  1KF6 B;  1WXA A;  2WXP A;  1TS2 A;  2M56 B;  2JZ3 B;  3EEC A;  1C4P A;  3BK2 A;  1BML C;  4OW0 A;  3GE3 C;  2BYF A;  2WXR A;  4MGZ E;  4AJY B;  3ETR A;  4GDL A;  4W9H A;  1EF5 A;  1GB1 A;  2L8J A;  3L17 A;  2KMC A;  4USA A;  2I38 A;  5D3D A;  1SXT A;  2LZ6 A;  3IG3 A;  2AL6 A;  3V3X A;  4FJY A;  1WXV A;  2UU7 A;  4P1C C;  2N9E B;  2X38 A;  3ZTD A;  2RD0 A;  2EKI A;  1WXQ A;  4PYU A;  3HVD A;  5J2R A;  2FBW B;  2DZJ A;  1B9R A;  2KVR A;  5TSS A;  1Q1O A;  2R2O A;  4LNK A;  3R66 C;  2XK5 A;  2QCZ A;  3IBE A;  2JSV X;  2AQ1 B;  4XYC A;  2N7J A;  3NG0 A;  2V4L A;  4RFB A;  2QC8 A;  4W9K A;  1KOT A;  2AWT A;  1I4G A;  4ITK A;  3N32 A;  4OZA A;  1A70 A;  4NAW B;  2ZPN A;  1SE2 A;  1F52 A;  4TV3 A;  1TKG A;  4NAM A;  1OEY A;  1JW9 D;  2KMM A;  1E10 A;  1DGJ A;  5GMV A;  1HXY D;  3NRZ A;  2M0X A;  3A9J B;  5BMG A;  3N1X C;  2LD9 A;  4RMA A;  5BO4 B;  3L08 A;  3H7S A;  4XDC A;  3R8B A;  1SB3 C;  2WXF A;  1KTK A;  1HA5 A;  5E6N A;  4UDU C;  3PGE A;  1GOZ A;  3H8H A;  2GMI C;  3H1U A;  1WGK A;  4GDL B;  2IZV B;  3A33 B;  1E7U A;  4A9A A;  3RNA C;  4FBJ B;  1LXD A;  2ZEQ A;  4N6E B;  5CHF A;  2KT7 A;  1FNU A;  1YQ4 B;  2VZK B;  4DHJ D;  1GPX A;  3R7Q A;  2JZZ A;  1UUP A;  4P1B C;  1IP9 A;  1XCT L;  1FFU A;  1TZ1 A;  3ZLZ A;  4NQL B;  4BBN F;  2RPV A;  3QX1 A;  2SEB D;  3KUD B;  3Q8B A;  2WNM A;  3E9S A;  2NCN A;  1N61 A;  4A8X C;  4C7Z A;  2NS5 A;  1YN4 A;  3OWE B;  4HXD A;  4K7W A;  1XQQ A;  1T3Q A;  4XDD A;  2DEN B;  4N9F 4;  2QDF A;  4C80 A;  3VHT C;  3ZNH B;  2DYO A;  1HQR D;  2BS4 B;  4WWN A;  1WYG A;  2XEW A;  1JWA D;  3TMP B;  5DPR A;  3ZQ4 A;  2IY1 B;  4W9I A;  4RNA A;  3AE5 B;  2LGX A;  3Q3O C;  4FXC A;  2WXJ A;  4QAY A;  3AE1 B;  3DWM A;  3C19 A;  4DXF A;  2INP E;  3HRD D;  3ABV B;  3FC4 A;  3ONS A;  2MX2 A;  2M19 A;  2LXC A;  4A55 A;  2QIE B;  2PIA A;  2PVG C;  3VFK A;  4WJQ A;  1J8C A;  2UYZ B;  2ZCC A;  3RNC C;  3ZRC A;  3VTW A;  4EE2 A;  4C7Y A;  4W9F A;  2WXI A;  4GDK A;  1FEH A;  3Q3N C;  1ISN A;  2BPS A;  3WAP A;  2Y3A A;  2DWQ A;  3FIL A;  4YSZ B;  3AI5 A;  3M3J A;  1QOF A;  2K6Q A;  3GE8 C;  4US8 A;  3NS1 A;  2HJ8 A;  3AEA B;  3ML9 A;  2KDB A;  4BKT A;  3LJ3 A;  2BT6 A;  3AE9 B;  3PRP B;  2LFI A;  2WX1 A;  2MBB B;  1TKY A;  4LJP B;  5JH5 C;  3WAL A;  3I9V 1;  5IN7 A;  4RGN A;  1ZPS A;  4DDI D;  3URY A;  1WX9 A;  2BWE S;  2RGF A;  2MRP A;  4ARC A;  2OJW A;  1JWU D;  5IKC M;  2KQ7 A;  2KDI A;  4DHZ B;  3U2S C;  2JF5 A;  2W3R A;  1QZE A;  3KVF B;  4ZRK A;  4JIO U;  4MSM B;  3S2A A;  1EO6 A;  5I4D A;  3OAW A;  1I42 A;  2O6V A;  1TIF A;  2ZVN A;  3AEF B;  1WRD B;  2LUM A;  2D11 A;  1F9J A;  4PT5 A;  3B1L X;  2Z0D B;  2J7Q B;  4OVV A;  1YX6 B;  4C4V B;  5EDS A;  3DVN U;  3VH4 B;  5BMI A;  2L7R A;  3CSF A;  3CWI A;  3WAN A;  1VCB A;  1WJ4 A;  4E71 A;  4HJK A;  2L0F A;  3RI7 C;  4KZC A;  1FO4 A;  2Y5C A;  3AEC B;  3SFD B;  1YJI A;  2QIL A;  4ANX A;  1Z2M A;  1NVI D;  5H92 C;  1T6B X;  2R61 A;  2LRW A;  4IM0 A;  3PRM B;  1SSN A;  2B76 B;  4ZDV A;  2M1M A;  3DDC B;  2OOB B;  3NVW A;  4KDI C;  2FUH B;  3Q8E A;  2FAZ A;  4W9C A;  4XE0 A;  1UF0 A;  2EEL A;  4E74 A;  4YSX B;  2WHI A;  3CIR B;  4J6I A;  3PT2 B;  4HJG E;  3ZTC A;  3V6E B;  1EWY C;  1T0S C;  4JX1 C;  3IAS 1;  3QAR A;  5FK9 C;  3VDZ A;  1MFW A;  3RCZ A;  1P0R A;  2K3U A;  2C7M B;  1SIF A;  3B2F A;  3VR9 B;  2RDB C;  4W9J A;  3U7D A;  5LLI A;  2X8X X;  3A4R A;  5C23 A;  4OZB A;  1C9F A;  3ZDM C;  4LNI A;  2PTL A;  4A3P A;  2DYM A;  3VUW A;  2M8S A;  2QJL A;  2L1A A;  2VRR B;  3HVZ A;  2N7E A;  4CHK A;  2O6V B;  2K22 A;  2J52 A;  1D5Z C;  5HHD G;  4MM3 A;  4IKG A;  1QQR A;  3ZRF A;  3W5U B;  1NYR A;  2FE8 A;  2QEJ C;  2GBR A;  2W9N A;  3AN1 A;  2K9X A;  2JT4 B;  1WGD A;  2KWV B;  4ZRJ A;  1I7H A;  2G4D B;  3BYT B;  1FFV A;  2VZK D;  1Q10 A;  3DBR B;  3RT3 B;  4EEW A;  1UH6 A;  2GBJ A;  2DAJ A;  4P6V F;  1MG4 A;  2KYW A;  3KYD D;  2BKF A;  1KM7 A;  4TUU A;  4JLC A;  3W2D A;  1P1A A;  4RGM A;  2WXL A;  1SE4 A;  1WE7 A;  1PYW D;  2NBW B;  1CZP A;  3ZXR A;  3NHE B;  4NY0 A;  1D4B A;  1CMX B;  5T8I A;  3VAW A;  3L4P A;  1XLO A;  5EE1 A;  3SFE B;  5IP4 D;  2L00 B;  1UD7 A;  3RNF C;  1HEZ E;  4FA6 A;  3BVM A;  2WXM A;  3QAQ A;  3AEE B;  2L76 A;  3ZKJ C;  1WM3 A;  5DPS A;  1MHH E;  4K81 A;  3A1Q B;  1P7F A;  2LXA A;  1LQB A;  3APD A;  1Y56 A;  1UBI A;  4KX6 B;  2HTH A;  1N5X A;  3AE4 B;  1UZX B;  1F0Z A;  2NTS A;  1LGR A;  4YXD B;  5IAA C;  3VVW B;  3LXF A;  3TIX A;  4HKQ A;  1DYQ A;  1ZW7 A;  2KC2 A;  2MSE D;  2GOW A;  4MM3 B;  5BYS A;  3Q8A A;  1ZDV A;  4AS1 A;  3B0A A;  4JL9 A;  1J7B A;  2D3G A;  4KZ0 A;  2R2Q A;  1WE6 A;  1D6E C;  1X1M A;  2W3S A;  2BF8 B;  3AB5 A;  1GB4 A;  1V5O A;  2L05 A;  1WY8 A;  2K25 A;  4HRO A;  1YD8 U;  5AZF A;  4KGT A;  4IW0 A;  3PS6 A;  4B6W A;  2LI5 A;  1WYW B;  4LNO A;  3L54 A;  2K0P A;  4IWP A;  1BXT A;  5MPO A;  5IO9 A;  1VZ7 A;  2VH1 A;  4LTU A;  1EM7 A;  3L0W B;  4AP4 C;  5HFY A;  4KSK C;  3VRB B;  2KKC A;  1CQV A;  2L3Z A;  2MJD A;  4ZYS A;  4D2K A;  4CYE A;  3TEY A;  2YEP B;  4XX5 A;  3AEG B;  3FAH A;  3Q2A C;  2NBU A;  2H88 B;  3AV8 A;  1VJK A;  2LGD A;  4N58 A;  4URK A;  1YJ1 A;  1PDX A;  4HK2 A;  1KFY B;  3FKY A;  4O1N A;  1WR6 E;  4E3C A;  1WF9 A;  1TT5 B;  1ZDX A;  4DK5 A;  2WU2 B;  2M4N A;  4JGH B;  1R4N I;  1FCC C;  1L6U A;  2CHZ A;  4ACF A;  2PLP A;  2KAC A;  5FR3 A;  2L83 A;  1HZ6 A;  2HD5 B;  4J3O D;  4FUL A;  3AU4 A;  1IBX B;  1XT9 B;  1IGD A;  4FAD A;  2H89 B;  2DLB A;  3RZW C;  2GRI A;  3NVV A;  4MGK E;  2W82 A;  2MH7 A;  1OQY A;  3TJP A;  2G45 B;  2CJO A;  4HPL B;  2KQS A;  4MDK E;  3ZNZ B;  4ZRP A;  1V8C A;  2BS2 B;  4MSQ B;  4MGY E;  3V62 A;  3W5V B;  3ZXV A;  2PKO A;  4IOI E;  1C78 A;  2BB6 A;  4A20 A;  2KX3 A;  3PRZ A;  3DBL I;  1NYQ A;  3KQ4 A;  1YN5 A;  1WM2 A;  3DBR I;  2DX5 B;  4KGS A;  1K53 A;  1JRP A;  1NEN B;  2G1E A;  1R7S A;  4WJO A;  3U4E G;  1IGC A;  5J18 A;  4JQW C;  2V3S A;  1TS5 A;  1SE9 A;  4YWG G;  4ICU A;  4BBN C;  3APF A;  1TS4 A;  3N30 A;  4TQ1 A;  1OTR B;  4XC2 A;  3VH3 B;  2RDH A;  1XLP A;  2WP9 B;  1YQ3 B;  4AUQ C;  1XLN A;  4EZJ A;  1L4D B;  2FUG 1;  5BYR A;  1VD2 A;  1RLF A;  2BWF A;  3TUO A;  1E9M A;  5E6J A;  4IWQ A;  1PGB A;  4EZL A;  5D2M B;  1L0X B;  2K39 A;  3VXW A;  1S1Q B;  1P9D U;  2LHD A;  1KH0 A;  2CKH B;  3MC8 A;  3PLU A;  4M02 A;  2MP2 A;  4MEL A;  2O6V D;  3MC9 A;  2WS3 B;  1V49 A;  5C1Z A;  2MBH A;  1C79 A;  4LLG M;  2HE7 A;  2BYV E;  1XO3 A;  2A5U A;  2GI9 A;  3BVG A;  1C4C A;  2QMT A;  5C3J B;  2ACZ B;  4ZOH C;  2B3A A;  5AEK B;  1LFD A;  3BVZ A;  3P4Q B;  5H8Y E;  2JZP A;  2LHE A;  1NEK B;  2JX5 A;  4FHK A;  1PFD A;  1ZXI A;  2DBY A;  3PHX B;  4XZ4 A;  1P7E A;  3BII D;  3NVY A;  5HKH A;  3LB8 C;  2JY6 A;  4G11 A;  2D5G A;  1C76 A;  2G9H D;  1GNU A;  4US9 A;  3RNE C;  3Q6B A;  2V3N A;  3KUZ A;  3L13 A;  2INN E;  3IFW B;  2FIF A;  1WGG A;  4RF1 A;  2JXT A;  1WMH A;  4ICV A;  2PPH A;  4II3 B;  1C3T A;  2XK5 B;  1WGR A;  1ZUD 2;  2KNB A;  2KDE B;  1D3Z A;  2D3A A;  2WU5 B;  3T3N A;  1D5M C;  2LEK A;  3V61 A;  5AUI A;  2LMC A;  1MPE A;  5KHO A;  5E6P A;  1WH3 A;  3HHM A;  2JU6 X;  1Q5W B;  4ASW C;  4WJN A;  1FMA D;  4RF0 A;  1NBF C;  2KX0 A;  1E5W A;  1L5P A;  2KLG A;  1J0G A;  4BAX A;  3QQ8 B;  2G3Q B;  5KHQ A;  4WIP A;  3N1Y C;  1F2R I;  4HPM B;  3GZN I;  1WR1 A;  4KSL C;  1C1Y B;  1MJD A;  1QLB B;  4WWP A;  3WAM A;  1WJU A;  3GB1 A;  4A3O A;  2K8B A;  3W1S A;  3W1S C;  3TEZ A;  2WDR B;  1D5X C;  5FKA C;  4GMV A;  1R4M B;  1WX8 A;  1UEL A;  4BOS C;  3PPA A;  2KXJ A;  2V9H A;  2N1W A;  2MW5 A;  1F77 A;  1K50 A;  2AQ2 B;  2HTM E;  2DYB A;  1TS3 A;  1YQB A;  3P2B A;  1N60 A;  4PYZ A;  3ZO5 B;  4HLE A;  4W9G A;  1E8X A;  4IM3 A;  2N9L A;  2PVO D;  4ZHO A;  3MJW A;  3DOW A;  2DHZ A;  2NPT A;  5LNK 1;  3O13 A;  2KQ4 X;  3Q3M C;  1JRU A;  3UGB B;  4GU2 A;  1C4A A;  3NS8 A;  2JVC A;  4MH8 A;  4PK1 A;  4GOC A;  2JYT A;  3VTU A;  3I3T B;  3PZD A;  1SJH D;  2N7D A;  1L6V A;  1V5T A;  4C00 A;  3N9Y C;  5TR5 A;  1GJZ A;  1ET6 A;  1V2Y A;  2DZK A;  4HKZ E;  2JWZ A;  2Z0E B;  3DPD A;  2WXK A;  3H6N A;  2XN9 C;  4B0E A;  3MHS D;  3Q8C A;  4WQM A;  3M63 B;  1ENF A;  1N62 A;  2KTR A;  1FNW A;  2N9X A;  2NR2 A;  3CST A;  1J7A A;  2PE9 A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  4IWO A;  1TBE A;  2BYF A;  4JLC A;  2JRI B;  1P1A A;  5CX3 A;  1E8Y A;  5L95 C;  1V6E A;  4WAA A;  4EFO A;  4MGZ E;  1WE7 A;  2NBW B;  3JYU A;  4AJY B;  2KFJ A;  1GUA B;  4GDL A;  4W9H A;  4PS3 A;  2WWZ A;  3K9P B;  4IC7 B;  1EF5 A;  3A9K A;  3ML8 A;  3NHE B;  4NY0 A;  4TKN A;  2IY0 B;  2L8J A;  4FLH A;  1WX7 A;  2EMT A;  1CMX B;  3L17 A;  2KMC A;  1KLV A;  3ZDT A;  1E7V A;  3VAW A;  4IM2 A;  1V81 A;  2KAN A;  1WZ0 A;  3H7P A;  4GDK B;  4DBG A;  3ZIM A;  2C60 A;  2LZ6 A;  3IG3 A;  5EDS A;  2AL6 A;  2IYD B;  4NJ7 A;  2L00 B;  1UD7 A;  4FJY A;  4EZK A;  4FA6 A;  1WXV A;  1NI2 A;  2K1F A;  3QAQ A;  3UQA A;  2L76 A;  4IUM B;  3KH0 A;  2N9E B;  2IO2 B;  3ZKJ C;  5G55 A;  3ZTD A;  2RD0 A;  4MEM A;  4TQ0 A;  1WM3 A;  5DPS A;  4PYU A;  2KLC A;  3KW5 B;  2AEH A;  4K81 A;  4DXA B;  3A1Q B;  2LXA A;  1LQB A;  1ZGU B;  2MP2 B;  5J2R A;  3APD A;  5DPW A;  1UBI A;  3X0W A;  1Z5S B;  2HTH A;  3UIN B;  1E8Z A;  2DZJ A;  1UZX B;  2JRH A;  4P7I A;  2KVR A;  4GGQ A;  2KD0 A;  5IAA C;  4G50 A;  2LWP A;  3VVW B;  1Q1O A;  2R2O A;  3R66 C;  2XK5 A;  2KFK B;  2DAF A;  2KHW B;  3EFU A;  3TIX A;  3IBE A;  4G3X B;  2KC1 A;  4LCD E;  2I1K A;  1ZW7 A;  1J19 A;  3QHT A;  2KC2 A;  1G6J A;  2MSE D;  3AXC A;  2GOW A;  2LVQ A;  2V4L A;  2GBK A;  4W9K A;  4ANV A;  1KOT A;  2ZCB A;  3B0A A;  4JL9 A;  3QWZ B;  2AWT A;  3N32 A;  2KWU B;  2UWQ A;  2D3G A;  4KZ0 A;  4IG7 B;  4K7S A;  2R2Q A;  1WE6 A;  1YX5 B;  3IHP C;  1X1M A;  2XBB C;  2DZM A;  4NAW B;  2ZPN A;  5DCN A;  3TL5 A;  2BF8 B;  2C5L C;  4TV3 A;  1V5O A;  3ZW3 A;  2L05 A;  1OEY A;  2DZI A;  4ANW A;  1WY8 A;  2G4S A;  2K25 A;  3NZS A;  1YD8 U;  4LDT D;  3MTN B;  5AZF A;  5GMV A;  4EUT A;  1E8W A;  4IW0 A;  3PS6 A;  4B6W A;  2LI5 A;  2YVC A;  1WYW B;  2O2V A;  3N3K B;  2M0X A;  3A9J B;  5BO4 B;  4RMA A;  2LD9 A;  4BVU C;  1WZ3 A;  3L08 A;  2IO3 B;  3DVG Y;  2WYQ A;  3L54 A;  4IWP A;  4X57 B;  3H7S A;  1WMH B;  4W9D A;  3L0W B;  4AP4 C;  4KSK C;  2KKC A;  2FCN A;  3UIP B;  5E6N A;  1P3Q U;  3PGE A;  2JUO A;  1K8R B;  5D94 A;  2L3Z A;  1EF1 A;  2GMI C;  2ZVO A;  3DQV A;  4GB9 A;  4CYE A;  4XX5 A;  2MBE A;  4B9K A;  3BIN A;  3H1U A;  4GDL B;  3QIJ A;  2IZV B;  2D07 B;  4FHJ A;  2NBU A;  3A33 B;  3A9K B;  1E7U A;  2LGD A;  3PRE A;  4URK A;  4EOY A;  1YJ1 A;  4FBJ B;  3ZVV A;  3ECI A;  3ZNI D;  1LXD A;  1H8C A;  2ZEQ A;  4HK2 A;  2N4F A;  5CHF A;  1WR6 E;  2MBQ A;  2V1Y A;  3V6C B;  4E3C A;  1OEY J;  1WF9 A;  4DHJ D;  4M0W B;  2LVP A;  3R7Q A;  4DK5 A;  3RUL A;  2JZZ A;  3T9L A;  1IP9 A;  3WA0 A;  2M4N A;  4JGH B;  1TZ1 A;  3ZLZ A;  4NQL B;  4BBN F;  2CHW A;  1KJT A;  1P98 A;  3QX1 A;  3KUD B;  4BKS D;  1R4N I;  2KOX A;  1SGH A;  2NCN A;  3CMM B;  2FCQ A;  1UGM A;  1Y8R C;  3AU5 A;  4BOZ B;  2LRU A;  2CHZ A;  2NS5 A;  1GC6 A;  3B08 A;  2HD5 B;  2JXX A;  2GBN A;  4HXD A;  1MG8 A;  1XQQ A;  4K7W A;  4FUL A;  4CO7 A;  4FN2 A;  2KJ6 A;  3AU4 A;  1XT9 B;  3RYT A;  2DEN B;  4FAD A;  1E90 A;  4N9F 4;  3RZW C;  2KK8 A;  2YLM A;  4MGK E;  3A4S C;  3VHT C;  4AWJ A;  1OQY A;  3TJP A;  2DYO A;  2G45 B;  3ZNH B;  5L83 A;  2J0J A;  3C0R B;  4PS7 A;  4HPL B;  4ANU A;  4WWN A;  2MBO A;  2KQS A;  2REX A;  5AZG A;  4MDK E;  3ZNZ B;  4G0N B;  2XEW A;  3ALB A;  4MSQ B;  3TMP B;  4HCN B;  1PQS A;  3OJ3 A;  4MGY E;  2Z59 B;  5DPR A;  3V62 A;  2GBM A;  2IY1 B;  4W9I A;  3VUX A;  4I6L B;  3U30 A;  1BT0 A;  3QK0 A;  4NJ6 A;  4A20 A;  2BYE A;  2LGX A;  3BY4 B;  2KX3 A;  3PRZ A;  3JSV A;  3DBL I;  4BKS A;  4DWF A;  3T8M A;  3DVG X;  3V60 A;  4M8N A;  1V9J A;  5FR6 A;  4KIK A;  3JW0 X;  2K8H A;  2KO3 A;  3M95 A;  4II2 B;  2MLB A;  1WM2 A;  1L7Y A;  3DBR I;  2DX5 B;  1NDD A;  3RD2 A;  3Q3J A;  2LAS A;  4BFR A;  4HDO A;  3SD5 A;  3D32 A;  3ONS A;  2MX2 A;  4WJO A;  2LXC A;  1U4A A;  5J18 A;  4JQW C;  4AJW A;  2NPT B;  3AUL A;  2V3S A;  4NQK E;  1SE9 A;  3PV1 A;  4MH0 E;  3VFK A;  4WJQ A;  4ICU A;  4BBN C;  3APF A;  3N30 A;  3WAO A;  1J8C A;  2UYZ B;  2ZCC A;  4TQ1 A;  1OTR B;  4XC2 A;  3VH3 B;  2C7N B;  2LGY A;  3ZRC A;  4EZJ A;  4AUQ C;  5CHV C;  3VTW A;  2I1J A;  1T0Y A;  4W9F A;  4YL8 A;  1VD2 A;  4GDK A;  1RLF A;  5J17 A;  2BWF A;  3GOE A;  2WX0 A;  1ISN A;  2LUE A;  1S3S G;  2BPS A;  4IWQ A;  3WAP A;  3NZU A;  4EKU A;  5D2M B;  4EZL A;  3DBH I;  1RRB A;  3VTV A;  2K39 A;  3VXW A;  1S1Q B;  1WFY A;  2LVO A;  3AI5 A;  1P9D U;  3M3J A;  4LDT B;  5AZH A;  1HE8 A;  2IO0 B;  2CKH B;  3PLU A;  3A1Q A;  2KTR B;  2MP2 A;  2K6Q A;  2MA9 B;  1AAR A;  1RFA A;  2O6V D;  4MEL A;  2HJ8 A;  3ML9 A;  2KDB A;  1H4R A;  4BKT A;  1V49 A;  3RUI B;  3LJ3 A;  4HCP B;  4FJV B;  5C1Z A;  5D7G A;  2MBH A;  3PRP B;  3HM3 A;  1FXT B;  3R7R A;  2J0M A;  5LXH A;  2EMS A;  2PEA A;  3VQI A;  2HE7 A;  4RM8 A;  2BYV E;  2A5U A;  4K7U A;  2FID A;  2MCN B;  2WX1 A;  5JHB A;  2MBB B;  2CR5 A;  4LJP B;  5JH5 C;  3WAL A;  2KTF A;  2RSU A;  4MGI E;  2B3A A;  4DDI D;  1LFD A;  4F1S A;  5AEK B;  1UBQ A;  3VUY A;  3OLM D;  1WX9 A;  3SHQ A;  4ZRI A;  3PTF C;  3M62 B;  2BWE S;  2RGF A;  2MRP A;  4FHK A;  2MWS B;  2FCM A;  2NVU I;  4KDL B;  3X23 A;  3PHX B;  3DCG A;  4XZ4 A;  3SU8 X;  1WXS A;  1R4M I;  2WDT B;  3H7P B;  2KQ7 A;  2KDI A;  4DHZ B;  5HKH A;  4NAW A;  2JF5 A;  2JY6 A;  4G11 A;  1YIW A;  3EHV A;  4GN1 A;  1QZE A;  3KVF B;  3PLV A;  1GNU A;  4ZRK A;  4JIO U;  4MSM B;  2OJR A;  4DHJ B;  3S2A A;  1EO6 A;  2FNJ B;  3OAW A;  4HVB A;  2O6V A;  4MJS A;  1I42 A;  2ZVN A;  3KUZ A;  3L13 A;  3A9J A;  1WRD B;  3JSV B;  3IFW B;  3IVF A;  4ZYN A;  2FIF A;  3K9O B;  2D11 A;  1GG3 A;  1F9J A;  4NNJ B;  1WGG A;  3B1L X;  1TGZ B;  2L0T A;  2MQJ A;  3RZF A;  1WMH A;  4KIK B;  2Z0D B;  3CF6 E;  4ICV A;  2IBI B;  2J7Q B;  2ASQ A;  1V86 A;  2PPH A;  1GC7 A;  1YX6 B;  1Q0W B;  2K6D B;  3DVN U;  2AL3 A;  4F8C B;  3VH4 B;  2KJH B;  4B95 A;  1ZKH A;  2XK5 B;  5JZE B;  1OGW A;  1WGR A;  3QA8 A;  2KNB A;  2L7R A;  3CSF A;  2KDE B;  3WAN A;  1VCB A;  1D3Z A;  1WJ4 A;  4E71 A;  1V80 A;  3R3M A;  4HJK A;  2L0F A;  5CTR C;  3V61 A;  4KZC A;  1I35 A;  4FJZ A;  4AOF A;  2N9P C;  5KHO A;  3NOB A;  1A5R A;  5E6P A;  2BKR B;  1WH3 A;  4ANX A;  3HHM A;  2J0K A;  1WI0 A;  1Z2M A;  3NY5 A;  1Q5W B;  3ZUN A;  4ASW C;  4WJN A;  2LRW A;  4IM0 A;  4DDG D;  3WIM A;  3PRM B;  2KZR A;  1NBF C;  2KX0 A;  1LM8 B;  4RM9 A;  3O65 B;  4OVU A;  1E5W A;  4ZDV A;  2KLG A;  2M1M A;  1J0G A;  2A4Z A;  3DDC B;  1EUV B;  2QHO A;  2ZZP B;  2G3Q B;  2O2V B;  2OOB B;  2C9W B;  2ZNV B;  2FUH B;  4KDI C;  4DHZ E;  2FAZ A;  5KHQ A;  3PHW B;  5JHA A;  4W9C A;  2D2Q A;  2JPH A;  1WIA A;  4HPM B;  3UF8 A;  3GZN I;  3HK0 A;  4E74 A;  1WR1 A;  4KSL C;  1C1Y B;  4J6I A;  2FCS A;  4WWP A;  2C7H A;  1WJN A;  3PT2 B;  3WAM A;  1WJU A;  1WXM A;  3ZTC A;  3V6E B;  2M17 A;  4I6N B;  2K8C A;  4A3O A;  2K8B A;  3W1S A;  3W1S C;  3QAR A;  2KDF B;  1XD3 B;  2CS4 A;  2EKE C;  2RR9 A;  1IPG A;  2ZJD A;  3UQB A;  3H9D A;  3VDZ A;  2KWC A;  3OJ4 B;  3RCZ A;  4GMV A;  1P0R A;  1WX8 A;  1UEL A;  2BGF A;  2C7M B;  4GSW A;  4BOS C;  3PPA A;  2KXJ A;  1SIF A;  2Y5B B;  4HWI B;  4W9J A;  3U7D A;  4WJP A;  3KUC B;  5LLI A;  2N1W A;  1C3T A;  2PE6 B;  3A4R A;  1WGH A;  2MW5 A;  5C23 A;  2LJ5 A;  3PSE B;  2DYB A;  3LDZ E;  1M94 A;  3ZDM C;  1YQB A;  2KJR A;  4KVG B;  5DPT A;  2NBV B;  3P2B A;  4BKG A;  3TCA A;  4PYZ A;  2CHX A;  3Q3F A;  3APC A;  4A3P A;  3ZO5 B;  2DYM A;  3VUW A;  3TBL D;  2M8S A;  4LJO B;  2VRR B;  4HLE A;  4I6P A;  2N7E A;  4W9G A;  2O6V B;  2KFK A;  4MJS B;  4W9E A;  1E8X A;  2AYO B;  2ZNV C;  4IM3 A;  4CHK A;  3SDL C;  3QJZ A;  4GIV A;  2RPQ A;  3U8Z A;  3QQ8 B;  4GXB A;  5IA7 A;  3MJW A;  4PS8 A;  1WJ6 A;  3W1Y A;  3ENE A;  3L16 A;  4MM3 A;  4KV2 A;  3L10 B;  4HDQ A;  2D10 A;  3QC8 B;  3DOW A;  2DHZ A;  2NPT A;  3ZRF A;  1RAX A;  3EC8 A;  3PVL A;  2KMA A;  1JRU A;  3UGB B;  3DBS A;  4GU2 A;  4OVV A;  1TTN A;  2GBR A;  2W9N A;  5G2N A;  3NS8 A;  2JT4 B;  1WGD A;  4W9L A;  2JVC A;  2KWV B;  2IO1 B;  4GOC A;  5CHW A;  4WWO A;  3VTU A;  4ZRJ A;  2G4D B;  3KYC D;  2CU1 A;  3I3T B;  3PZD A;  3JVZ X;  4M8M A;  2N7D A;  4WQO B;  1V5T A;  5D6J B;  4II3 B;  5TR5 A;  2KN5 A;  1GJZ A;  2PJH A;  1V2Y A;  2ZPY A;  2DZK A;  1WGY A;  5E6O A;  3RT3 B;  2JWZ A;  2Z0E B;  3DPD A;  3QCA A;  1L2N A;  4EEW A;  3H6N A;  3HM6 X;  4K1R B;  3ZNG C;  3MHS D;  3DVN V;  3UIO B;  3M63 B;  2N1V A;  1UH6 A;  2GBJ A;  5LXI B;  1IYF A;  2DAJ A;  3HIZ A;  2KTR A;  2N9X A;  1WXA A;  2NR2 A;  3CST A;  3EEC A;  2JZ3 B;  2BKF A;  3KYD D;  1KM7 A;  4NPN A;  4TUU A;  2PE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...