2L05A

Solution nmr structure of the ras-binding domain of serine/threonine-protein kinase b-raf from homo sapiens, northeast structural genomics consortium target hr4694f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
HMPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Solution NMR Structure of the Ras-binding domain of Serine/threonine-protein kinase B-raf from Homo sapiens, Northeast Structural Genomics Consortium Target HR4694F
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l05A01
2L00B 1C1YB 4W9GA 2V4LA 3Q3FA 2PE9A 3L0WB 1E7VA 3KYCD 1ZGUB 2Z0DB 5C1ZA 2OJRA 4NQLB 4B6WA 2XK5A 2PEAA 2ZZPB 3M63B 5L95C 3ZNZB 2KOXA 1XQQA 4PS3A 3ECIA 2RD0A 2L0FA 2KLCA 3DBSA 3AI5A 3T9LA 2L8JA 4LCDE 2BKFA 1WMHB 4NQKE 2HJ8A 1YD8U 2ASQA 3DVGX 3V6EB 1X1MA 4W9IA 3WANA 1KLVA 3IHPC 5LXHA 1E8YA 2MSED 4WWNA 2LVOA 5IAAC 3WAOA 5G55A 2IO0B 1JRUA 4MM3A 2BYVE 4FA6A 1QZEA 3TL5A 2BPSA 3LJ3A 5DPRA 2N9EB 4GOCA 4MDKE 2C60A 3QX1A 3PVLA 2KFKA 4MJSB 3QWZB 3DOWA 4GIVA 3TCAA 3WA0A 3CSTA 5C23A 3PPAA 3ZNID 4KIKB 4PYUA 3KH0A 1WX7A 2WX1A 1K8RB 3PTFC 2IO1B 2KWVB 3DQVA 3M62B 2KDEB 3APCA 3QC8B 3U8ZA 2LVPA 3UGBB 2KHWB 2K1FA 3A4RA 4ZRIA 3ZO5B 3R66C 2KFJA 4ICUA 1MG8A 4MGYE 1WX9A 3SDLC 3NOBA 5D6JB 2JRHA 3KYDD 2VRRB 4HDOA 2O2VB 2QHOA 4JL9A 2JPHA 2EMSA 2LXCA 1L2NA 4II2B 4RM8A 4WQOB 4ANXA 2IYDB 1IYFA 4JLCA 3DDCB 4RM9A 3APDA 2MQJA 2O6VD 3VTWA 4YL8A 1V2YA 4GN1A 4XC2A 4A20A 4URKA 2NS5A 2MA9B 2KDFB 2BF8B 2MW5A 3L16A 3QA8A 1XT9B 2AL6A 4DDGD 2GBJA 2G45B 2HTHA 3VDZA 2BGFA 3TBLD 1KM7A 4HLEA 1TGZB 1WM3A 2PE6B 2C7HA 3H6NA 1WYWB 2M17A 1WGRA 3CMMB 2CHWA 3N32A 3OAWA 5AEKB 2R2QA 4K7UA 2DYOA 2NBUA 2ZNVC 4PS8A 2NPTA 3PT2B 2DZMA 2LGXA 1T0YA 3WIMA 4TUUA 2D11A 3KVFB 3DVNV 2KDIA 1WF9A 3S2AA 3TJPA 1KJTA 3SHQA 1L7YA 3OLMD 2O6VB 3RCZA 1F9JA 2ZJDA 4TQ0A 1UD7A 1I42A 1E8WA 1EUVB 4JIOU 4P7IA 4F8CB 2KX0A 4W9FA 2KNBA 3VTUA 3N30A 1GG3A 2R2OA 1S1QB 1V86A 4HCPB 3CF6E 2XK5B 3H9DA 4K7WA 4GDKB 3DBLI 4GSWA 3ZNHB 1WR6E 5E6NA 3QAQA 3VQIA 4MEMA 2ZCBA 3C0RB 2J0KA 5DCNA 4FADA 3V62A 3SU8X 5J18A 3VUXA 2KKCA 4F7ZA 4WAAA 2ZNVB 5LLIA 2N7EA 3DBHI 3GZNI 3RULA 4MSQB 4FJZA 4BVUC 1P98A 2KN5A 3VH4B 4K1RB 1YJ1A 3EFUA 3ZNGC 4FN2A 2YLMA 3R7QA 3DVNU 2NBWB 1WGDA 2BYFA 1SIFA 2DAJA 4NAWA 2KMAA 3VXWA 2GBMA 2KFKB 2CS4A 4FLHA 3TMPB 4AJWA 3UF8A 2AL3A 3WAMA 4ANUA 2CHXA 2N9PC 2BKRB 2ZEQA 2N4FA 3ZKJC 3HHMA 4W9LA 4MELA 3KUDB 3VUYA 1SGHA 3UIOB 2A4ZA 2WX0A 2O6VA 2JF5A 4HPLB 3L13A 3UINB 2ZVNA 4F1SA 4GDLB 3QARA 4I6PA 1V5OA 2D10A 2KTFA 1BT0A 1RAXA 3HK0A 4FJVB 4GDKA 3M3JA 3RD2A 2BWFA 1VCBA 2LGYA 4I6LB 1M94A 2DYMA 3A9JA 3ONSA 1IPGA 4BOSC 2YVCA 1TZ1A 2LZ6A 4HWIB 3ZDMC 3EC8A 2K8BA 4DWFA 1WZ0A 2JZZA 2W9NA 3PGEA 3ZW3A 1WH3A 2KJ6A 3PREA 4LDTD 1P9DU 4M0WB 4EFOA 4CYEA 5IA7A 3ENEA 4AWJA 4IC7B 1UBQA 1YX5B 1C3TA 3ML8A 2DHZA 2N7DA 5D94A 4HVBA 4WJNA 4NY0A 4IUMB 2N1VA 2LWPA 2BWES 4IWOA 4LJOB 3NY5A 4DHZB 1YX6B 1R4NI 1VD2A 2N9XA 2J0MA 2EKEC 4BKTA 5E6OA 1WX8A 2XEWA 2KJRA 2NPTB 4X57B 3ZDTA 5HKHA 3VAWA 4HDQA 2IO3B 2LXAA 4I6NB 1P3QU 2NR2A 3UQBA 2RGFA 1J19A 3HM6X 4M8NA 1WJUA 1UGMA 3BY4B 4GDLA 4PYZA 2L76A 2LJ5A 2UYZB 2B3AA 2LASA 4LDTB 4KDLB 5J2RA 1E8XA 2D2QA 2V1YA 1ZKHA 3ZTCA 4W9EA 2REXA 5CHWA 4MGIE 4A3PA 4DXAB 2Y5BB 1EF5A 1WZ3A 4KZCA 1WXSA 4HXDA 1UZXB 5KHQA 2C7MB 1WJ6A 2C7NB 3X23A 5L83A 1UBIA 4KVGB 1EF1A 4IM2A 3A9KA 1GC7A 2FNJB 4N9F4 3X0WA 1ZW7A 2CHZA 5JHAA 5CHFA 3L17A 4K81A 4AUQC 2CU1A 3L10B 3PLUA 5JHBA 4MGKE 2MBEA 1IP9A 1G6JA 1P1AA 2EMTA 2L7RA 2JRIB 4FHKA 2KDBA 1LQBA 4NAWB 3CSFA 3LDZE 2HE7A 2LD9A 4GXBA 1E8ZA 1AARA 1LM8B 2KC1A 1OTRB 1WE6A 4HJKA 1I35A 4G50A 4HCNB 1OQYA 1NDDA 2GBRA 3AU4A 5FR6A 4W9CA 2WWZA 3A33B 4BBNC 4JGHB 1GNUA 3ML9A 4DBGA 4BKSD 4EEWA 1GC6A 4K7SA 4JQWC 4W9JA 4ZRKA 4EUTA 2AYOB 2FUHB 1WGHA 4EOYA 2KMCA 5GMVA 2BYEA 3A9JB 2AEHA 2C5LC 3VFKA 2WDTB 2DZIA 3WALA 5JZEB 4WJPA 5CTRC 3A1QA 3PV1A 4TV3A 1PQSA 2IY1B 2KX3A 3QIJA 4AOFA 4ZYNA 4HK2A 3K9OB 3L54A 2FIFA 3DBRI 4ZRJA 2MCNB 1J8CA 2N1WA 1OGWA 3RT3B 2RR9A 3V6CB 1J0GA 2K39A 2KANA 5AZHA 2MBQA 4E3CA 1WGYA 4IM3A 1ISNA 3B1LX 4IW0A 3TIXA 2UWQA 2KO3A 4FULA 2MWSB 2J7QB 3JVZX 4GB9A 4W9KA 4GGQA 4CO7A 4TQ1A 2K8CA 3MTNB 4J6IA 1RFAA 1Z5SB 2DYBA 2FCSA 2MP2B 5DPTA 3W1SC 3V61A 3GOEA 2JXXA 3DCGA 4BOZB 3PRZA 4MGZE 3AU5A 3H1UA 4KV2A 1E90A 3Q3JA 1V5TA 2FCNA 2KZRA 2MX2A 2Z59B 4FHJA 1GJZA 3NS8A 2G4DB 1WJ4A 4IWQA 3ZIMA 4WJQA 3ZVVA 1D3ZA 2KTRA 2GMIC 1V81A 3VTVA 2DENB 2D3GA 1GUAB 1WRDB 1WXAA 3PLVA 3RZWC 2LVQA 2HD5B 2NBVB 3QCAA 1U4AA 2CKHB 3PRPB 4E74A 1NI2A 2KJHB 1OEYJ 1XD3B 4B9KA 4XX5A 2MRPA 5TR5A 1NBFC 2KLGA 2AWTA 2KK8A 5AZFA 2NCNA 1H8CA 1RRBA 2OOBB 2RPQA 1V49A 3H7PA 3NZUA 3I3TB 3VUWA 2LI5A 3A9KB 4M8MA 3JW0X 2FAZA 2PJHA 1WIAA 2CR5A 3JYUA 3QQ8B 3R3MA 2KWUB 4GMVA 4FBJB 4NPNA 3A4SC 2IY0B 3OJ3A 4AP4C 4EKUA 1KOTA 4BKSA 2JWZA 4MH0E 3KUCB 1WJNA 3RYTA 2RSUA 2ZVOA 5D7GA 5DPWA 4W9DA 4NJ7A 1TTNA 3QJZA 2MP2A 2IO2B 1WI0A 2L3ZA 3N3KB 1V80A 4DHJD 2C9WB 3ZRFA 2G3QB 5AZGA 1LFDA 1E7UA 3IG3A 3SD5A 3VVWB 3JSVA 3PHWB 4HPMB 4DDID 2K8HA 2KVRA 2MLBA 3UIPB 3K9PB 2KC2A 4RMAA 4WWPA 3ZTDA 1Q0WB 4PS7A 5G2NA 3MHSD 4ANVA 5KHOA 3RUIB 3RZFA 1Q5WB 1Z2MA 2DAFA 3PS6A 3U7DA 4G3XB 1WXMA 3A1QB 3IBEA 1WXVA 5E6PA 3VHTC 4NNJB 3W1SA 2I1JA 4EZKA 3DPDA 4WJOA 3R7RA 1OEYA 2KWCA 2LUEA 4DHJB 2KQSA 5LXIB 2DZJA 2Z0EB 1LXDA 5CHVC 2K25A 1H4RA 1WM2A 1WMHA 1E5WA 2A5UA 4IWPA 1Q1OA 2K6QA 3HIZA 3L08A 3PSEB 1A5RA 1FXTB 2ZCCA 3U30A 2L05A 3AXCA 2ZPNA 4B95A 3EHVA 3V60A 4IM0A 3WAPA 2I1KA 3KW5B 1YIWA 4CHKA 5EDSA 3M95A 4KSKC 2G4SA 4BKGA 4II3B 4G11A 4WWOA 4GU2A 2MBHA 3HM3A 1EO6A 4MJSA 1HE8A 1RLFA 5DPSA 2KTRB 4EZJA 1WE7A 5BO4B 3APFA 2K6DB 2PPHA 2M1MA 5J17A 2KD0A 3IVFA 4KIKA 3B0AA 3D32A 4AJYB 2MBOA 2IZVB 1SE9A 1WFYA 4ASWC 2M0XA 4ZDVA 1UELA 3MJWA 2WYQA 4W9HA 2V3SA 4G0NB 4DHZE 2NVUI 4ANWA 3EECA 5D2MB 2JUOA 3H7PB 1WY8A 3BINA 3PHXB 3KUZA 3PRMB 2JY6A 2O2VA 4ICVA 2GOWA 1Y8RC 2M4NA 2XBBC 4XZ4A 1CMXB 4DK5A 4KSLC 1TBEA 2FCQA 1V6EA 3H7SA 2DX5B 3O65B 4KZ0A 4OVVA 2JVCA 4FJYA 3ZUNA 2LRWA 3NHEB 2FIDA 2J0JA 3DVGY 4TKNA 4BFRA 2ZPYA 4E71A 4MSMB 3B08A 3QK0A 4IG7B 2KXJA 1WGGA 3UQAA 3ZLZA 1UH6A 4LJPB 3ALBA 1R4MI 2D07B 4BBNF 2MBBB 3ZRCA 3NZSA 4OVUA 4A3OA 4EZLA 2IBIB 4KDIC 1WR1A 3OJ4B 3PZDA 2L0TA 2M8SA 3JSVB 5CX3A 2JT4B 2KQ7A 2DZKA 3QHTA 2FCMA 1V9JA 3VH3B 3P2BA 2JZ3B 2LGDA 2GBNA 3AULA 3IFWB 1S3SG 5JH5C 1P0RA 4NJ6A 2LRUA 3W1YA 2GBKA 1YQBA 3T8MA
chains in the Genus database with same CATH superfamily
3KYCD 2OJRA 3M63B 5BMHA 4PS3A 3ECIA 2KLCA 1J7AA 4ZRPA 1WMHB 2HJ8A 2SEBD 1N61A 2LHDA 4W9IA 4A55A 2I38A 1HTOA 1TKEA 2MSED 1R4MB 4WWNA 3KWLA 3TL5A 3LJ3A 3BVZA 2C60A 3QX1A 2KFKA 4MJSB 3DHGC 3DOWA 4GIVA 3ZNID 1JMLA 4PYUA 3R2TA 2WX1A 1K8RB 3PTFC 1SXTA 3DQVA 2KDEB 4ZRIA 2JYTA 2E6XA 3AH7A 1KLUD 5D6JB 2JRHA 3N20C 1FPYA 2JPHA 2WXNA 4II2B 2IYDB 3AE4B 3APDA 4REZA 4YL8A 2HDEA 1V2YA 4GN1A 2BTEA 2ZW1A 3AEAB 4M02A 2G45B 2HTHA 4HKZE 1XXGA 4N6EB 4RF0A 3OAWA 4K7UA 2GRIA 1J7BA 2NPTA 3PT2B 4TUUA 1WGKA 2KDIA 1WF9A 2NTSA 1L7YA 1F9JA 2ZJDA 4ZHOA 1I42A 1YJJA 4P7IA 3AEFB 2L1AA 2KNBA 4HCPB 4USAA 2XK5B 5HI1A 1RM6C 2FUG1 5IO9A 3C0RB 1GB1A 3AEEB 1N62A 5J18A 2KKCA 1K53A 4US9A 3U7ZA 1T0SC 1QOGA 4OW0A 4MM3B 4K1RB 3DWGC 2BYFA 2WGSA 1VZ7A 1QT9A 3WAMA 4ANUA 2BKRB 2CJOA 4BZAA 3HHMA 4MELA 2UU7A 2A4ZA 1FNUA 2JF5A 1JROA 2WDQB 3L13A 4F1SA 4I6PA 2NTTA 4GDKA 3DHIC 3RD2A 2KACA 1MVKA 2DYMA 3A9JA 1ZOYB 4BOSC 4AS1A 2LZ6A 3V05A 2JZZA 2W9NA 1WH3A 3PREA 2AQ1B 1TJEA 4WJNA 1PFDA 2LWPA 2BWES 5FKAC 1YX6B 1UGJA 1XLNA 4WIPA 4GLSC 1WX8A 3RNBC 1T5XD 4HDQA 5AUIA 4I6NB 3B2FA 3HM6X 4OZAA 4M8NA 3BY4B 4US8A 1SSNA 4KDLB 2V1YA 2PVOD 3LYYA 4XDDA 4M00A 1UBIA 1EM7A 2FNJB 5CHFA 2CU1A 4MGKE 1IP9A 1N5XA 2EMTA 2D3AA 2D3CA 4C4VB 4LNNA 3LDZE 1CQVA 1E8ZA 4G50A 1OQYA 1UF0A 1L6VA 2WWZA 3A33B 4JGHB 3HVZA 2HJ1A 3ML9A 4DBGA 1GC6A 3BWUD 4K3BA 3I5JC 2AYOB 4EOYA 4JPSA 2AQ2B 3IT4B 2BS4B 4L23A 1GOZA 2C5LC 3WALA 4ZYNA 2FIFA 3B9JA 3DBRI 2W3RA 3RN9C 3RT3B 2WDRB 2K39A 5AZHA 5IKCM 4E3CA 2H89B 1I4RA 2BBCA 4WAFA 2R61A 1WXQA 3AE7B 1UNSA 2FCSA 2DYBA 3MHZA 3W1SC 4YSYB 3VR8B 3ZJUA 3AU5A 2KZRA 2MX2A 2INPE 3AV8A 3ZIMA 2G4DB 1D3ZA 1V81A 2DENB 1WYGA 3AE6B 3PLVA 2LVQA 2NBVB 2CKHB 2KJHB 3HRDD 1XD3B 3AECB 2KK8A 1OFFA 3LB8C 1H8CA 2OOBB 2JX5A 3NZUA 3VUWA 3A9KB 1LGRA 1T0QC 3JYUA 3QQ8B 3R3MA 2KWUB 4FBJB 3A4SC 1FFUA 1KTKA 4N59A 2JWZA 2W54A 2L3ZA 3N3KB 4YT0B 4ZHPA 2I2YA 4C7ZA 2C9WB 1R7SA 3ZRFA 1QOBA 5AZGA 3DHHC 2WXKA 3SD5A 3AE9B 3IT6B 1AW7A 1DOYA 4HPMB 3ZQ4A 2KC2A 3RNAC 3MHSD 5KHOA 1FCCC 4IDIA 3NVZA 1Z2MA 4G3XB 1WXMA 1E6EB 2LGSA 5E6PA 3VHTC 3W1SA 5MPOA 1YMHE 1TZOA 2Z0EB 2K25A 3L08A 2ZCCA 3AXCA 4B95A 3V60A 4AQ7A 1DOXA 3Q14C 4II3B 4WWOA 4GU2A 2MBHA 5DPSA 1HE8A 3APFA 2FE8A 4ASWC 5HHDG 2NVUI 4ANWA 4KGSA 2JUOA 3PHXB 1ZPSA 3KUZA 1JCKB 4ICVA 3RI7C 1EWYC 2M4NA 4XZ4A 1V6EA 2DX5B 1JW9D 2M19A 4FJYA 2WLBA 2LRWA 2WXIA 2VH1A 4E71A 4MSMB 4IG7B 1WGGA 3UQAA 1ET9A 3Q2AC 4YSZB 1JRPA 4A3OA 1PGXA 4EZLA 1WR1A 3PZDA 4KX6B 4NZLB 1ZXHA 1V9JA 3VH3B 2GBNA 1JALA 3AULA 1HXYD 2DWQA 4NJ6A 1D5MC 2GBKA 1YQBA 3T8MA 2SAKA 2L00B 2V4LA 1HEZE 3L0WB 2Z0DB 5C1ZA 1NYRA 2ZZPB 1KF6B 2RD0A 2EELA 1YD8U 2VZKD 2ASQA 2X8XX 4TSSA 1CK1A 1X1MA 1F77A 3IHPC 1YQ4B 2LVOA 5G55A 1ZE3D 2IO0B 1QZEA 5DPRA 1T3QA 1I4QA 4GOCA 3PVLA 1QF6A 3TCAA 3CSTA 1Q10A 1D5XC 1WX7A 3AE1B 2KHWB 3NZ3A 3ZO5B 3R66C 4C00A 4ICUA 4PK1A 4MGYE 1WX9A 2VZKB 3SDLC 2WXJA 5EE0A 1FXAA 1UWMA 1JQ4A 2EMSA 3EUB2 1PYWD 4RM8A 4WQOB 4ANXA 1IYFA 3RNFC 4JLCA 3DDCB 3NG0A 3VTWA 1C77A 1SE2A 4XC2A 1C9FA 4HPPA 3L16A 3QA8A 3HUIA 1XT9B 3GB1A 2LFIA 3VDZA 3TEZA 1TGZB 2C7HA 1WYWB 2LUMA 1WGRA 2M17A 2CHWA 1RFKA 3N32A 2KVZA 2WXLA 2R2QA 2DYOA 2ZNVC 4PS8A 1V1PA 4ITKA 1KJTA 3SHQA 3OLMD 4TQ0A 4UDUC 5H8YE 3P4SB 1KH0A 1NVID 3VTUA 3N30A 1GG3A 4GDKB 3DBLI 4GSWA 4ARIA 5E6NA 2ZCBA 2G1EA 5DCNA 2BB6A 2W82A 3V62A 4HKQA 1PUTA 4F7ZA 3NJTA 5LLIA 2EKIA 1OQQA 2N7EA 3GZNI 3RULA 3W9CB 2WU5B 2GLSA 3EGRA 3ZNGC 3EFUA 4FN2A 2PLPA 1SIFA 4NAWA 1SF0A 3VXWA 1FIQA 4ZOHC 1SB3C 4YSXB 4FLHA 1NENB 1HQRD 1IUEA 3PZ7A 4P6VF 3AE3B 2BW2A 3KUDB 3Q3MC 3PO0A 3R2IA 1SGHA 2WX0A 2JYEA 4HPLB 1T0RC 4PT5A 4XYCA 3QARA 1N6ZA 4FJVB 1V5OA 2KTFA 1BT0A 2MJDA 2RDBC 3M3JA 1JWSD 3E9SA 2YVCA 3ZDMC 3DBHB 2AQ3B 3PGEA 3DBRB 1N63A 1P9DU 4M0WB 4EFOA 3ENEA 4AWJA 1UBQA 1C3TA 2JQRB 3ML8A 2N7DA 4RH6A 4NY0A 3I63C 4IWOA 2Q5WD 4DHZB 1R4NI 1VD2A 2J0MA 2EKEC 4LNKA 2WHIA 2XEWA 4NJCA 3DWMA 5HKHA 2LMCA 2LXAA 1P3QU 2N7JA 2NR2A 3NVYA 3UQBA 1WRIA 3ZJVA 1WJUA 4GDLA 4PYZA 4KGTA 5BYQA 2B3AA 2LASA 2D2QA 3ZTCA 1E9MA 4W9EA 5CHWA 4P16A 1BMLC 2QMTA 2Y5BB 1SE3A 3RNGC 4KZCA 4HXDA 1UZXB 2C7NB 3AMZA 5BYSA 4LLGM 4LNOA 3PLUA 2MBEA 1FFVA 1FNWA 2L7RA 1NYQA 1LQBA 2HE7A 2LD9A 2AX5A 2V9HA 1DGJA 1WE6A 1I35A 5IP4D 5FR6A 4BBNC 3KQ4A 3AE5B 3Q8CA 1B1ZA 4Q2JA 3Q8FA 2BYEA 2JWUA 2AEHA 3ABVB 4L2YA 2WDTB 2DZIA 2RDHA 3NVWA 1ZDVA 5E6JA 4ZRJA 1J8CA 2N1WA 3P4RB 3OWEB 4N58A 2MHJA 1TIFA 4IW0A 2UWQA 2KO3A 2MWSB 1CZPA 4GGQA 1TKGA 2LHEA 1RFAA 2KN4A 2JXXA 3B2GA 4BOZB 3PRZA 4FHJA 4ZRQA 1ZXIA 2MH7A 3NS8A 1VZ6A 2MJEA 2GMIC 2WXQA 3ZGZA 1WRDB 1WXAA 3RZWC 1FEHA 4E74A 1XF5L 4XX5A 2MRPA 1NBFC 2BYTA 2VH2A 1GB4A 5AZFA 2NCNA 2RPQA 1V49A 2LI5A 4M8MA 1V1OA 1WIAA 4GMVA 4NPNA 1GPXA 1ENFA 3U2SC 1KOTA 2W55A 3KUCB 4NAMA 1WJNA 5DPWA 2IPKD 4W9DA 4NJ7A 1TTNA 1VLBA 2MP2A 3IAS1 4DHJD 3Q8EA 2G3QB 1LFDA 1F1HA 4A90A 3PHWB 4O1NA 2K8HA 2MLBA 3UIPB 2JXTA 2KDMA 1QKZA 4PS7A 2Y5PA 2WXHA 4ANVA 1QILA 1Q5WB 3PS6A 3A1QB 2WNMA 4A8XC 1K51A 3DPDA 4WJOA 3VR9B 4DHJB 5CHVC 1H4RA 1WM2A 1WMHA 2FBWB 1Q1OA 3HIZA 3BYTB 4RGTA 1FXTB 1STEA 3EHVA 4IM0A 2BS2B 2K22A 4KSKC 2G4SA 1VRAB 4G11A 4C7YA 1CJEA 3C19A 4MJSA 2KTRB 1UWXA 5HFYA 2K6DB 2PPHA 3IVFA 4LTUA 4AJYB 1L0XB 2Y5CA 3Q8BA 3MC8A 3AB5A 4ZDVA 1XLPA 4WWMA 1TKYA 1YQ3B 3MJWA 2DBYA 1RYJA 3EECA 5D2MB 2HTME 3H7PB 2E3TA 2V4IB 3P63A 3PRMB 3FILB 1TBEA 3H7SA 4KZ0A 4P1CC 2INNE 3Q8AA 2JVCA 1T6BX 2X38A 3P42A 1HZ5A 2FIDA 1F52A 3DVGY 1ZDXA 2PKOA 2KXJA 2OEDA 1K50A 4LJPB 1R4MI 2D07B 2MBBB 3ZRCA 2IBIB 2L0TA 3JSVB 3WCQA 2JT4B 3GE3C 3QHTA 1C79A 2FCMA 3P2BA 2LGDA 3HVDA 5JH5C 1P0RA 4K3CA 2WXFA 3U4EG 4W9GA 1C1YB 2PE9A 2QIEB 3DBLB 1E7VA 2V3NA 1FXIA 4OZCA 1YN3A 2XK5A 5L95C 2KOXA 2L0FA 1XLQA 4LCDE 2BKFA 4XGAB 1GAQB 4C80A 3GZNB 3DVGX 3WANA 2BVCA 1E8YA 3GE8C 2PVGC 1JRUA 4MM3A 2BYVE 4OHJA 2N9EB 5T8IA 3QWZB 3W2DA 3WA0A 5EE9A 3ZJTA 2QCZA 4KIKB 1EU3A 3U8ZA 2IO1B 2KWVB 4B0MA 3QC8B 1V97A 2LVPA 3VRBB 3UGBB 2K1FA 3A4RA 2RPVA 3GP7A 1JWBD 3KYDD 5H92C 2IJ0A 3MC9A 2VRRB 2O2VB 2QHOA 1ESFA 1L2NA 4EE2A 1TS3A 4LK0M 1QLBB 1J7CA 3URYA 2WP9B 5G5GA 3N9YC 4A20A 4URKA 2MW5A 2AL6A 1R4NB 2H88B 3AN1A 2GBJA 5AUKA 2BGFA 1TT5B 3TBLD 4HLEA 3ZXRA 2PE6B 3H6NA 1AN8A 1JWAD 5FR3A 2XN9C 2BS3B 2WU2B 2OHFA 2LGXA 3WIMA 2D11A 3KVFB 3S2AA 3TJPA 2K9XA 1FMAD 3RCZA 2PMVA 4HJGE 4F8CB 2KX0A 3EA6A 3OG5A 2R2OA 1C4AA 3CF6E 3H9DA 1F0ZA 3ZNHB 4MACA 3QAQA 2KT7A 3P1MA 4MEMA 3VQIA 4L1BA 4JWSC 4FADA 3VUXA 3GS2A 5GXGB 2GI9A 2ZNVB 4RFBA 4FJZA 4BVUC 1P98A 1YN5A 3R7QA 4RNAA 4C4VA 2NBWB 2DAJA 5BMIA 2KMAA 2KFKB 1JWUD 2AL3A 3CIRB 1HZ6A 2M0AA 3NUHB 1PDXA 3VUYA 2O6VA 2ZVNA 4GDLB 3HK0A 1RAXA 2BWFA 2LGYA 2PW9A 4I6LB 5D3IB 3ONSA 1IPGA 1V8CA 1TZ1A 2K8BA 1WZ0A 3ZW3A 3N1ZC 2KJ6A 4LDTD 3ETRA 4CYEA 1I4GA 4IC7B 5FK9C 5HG2A 5D94A 4LJOB 4MH8A 2N9XA 4BKTA 1FM0D 3N1XC 4R3DA 2NPTB 2XNAC 3VAWA 4RGOS 2IO3B 1UGMA 1DYQA 2L76A 2TSSA 4LDTB 5J2RA 1E8XA 1ZKHA 2KAJA 1XEEA 3KLSX 1VDVA 4MGIE 5JXVA 1WXSA 3I9V1 5KHQA 2C7MB 1WJ6A 3X23A 5L83A 2ACZB 2INCC 1EF1A 4IM2A 3A9KA 1GC7A 4N9F4 3X0WA 1ZW7A 2CHZA 4AUQC 5JHBA 2WXPA 1G6JA 1P1AA 5LNK1 2JRIB 4FHKA 2KDBA 3CSFA 3BVMA 4GXBA 2KWDA 1OTRB 4HJKA 3T3NA 4HCNB 4M01A 2GBRA 3N1YC 3MFGA 4W9CA 1D4BA 4P1BC 2IGHA 4TMAB 3UI3A 4ZRKA 1WGHA 2L83A 2KMCA 2QEJC 3A9JB 1VJKA 3TUOA 3PV1A 3RMKC 1PQSA 2IY1B 2KX3A 3QIJA 4AOFA 1MG4A 3K9OB 3R8BA 3EFCA 2MCNB 2RR9A 3V6CB 1J0GA 2KANA 4WURA 1C4CA 2MBQA 1WGYA 3B1LX 3L4PA 1L4DB 3SFDB 3TIXA 4W9KA 3T3OA 4ZYSA 3MTNB 4J6IA 5DPTA 2MP2B 3GOEA 3DCGA 4MGZE 3AEGB 1I7HA 3H1UA 2FCNA 2Z59B 3SFEB 4XWWA 2QDFA 2YEPB 3VTVA 2JZPA 2D3GA 1GUAB 4RF1A 2GB1A 1ZP0B 2HD5B 3QCAA 2LJIA 3PRPB 5I4DA 4WQMA 4B9KA 5TR5A 2KLGA 4OZBA 1OQRA 3JW0X 2FAZA 2PJHA 1PGAA 2PTLA 3OJ3A 4AP4C 4EKUA 4BKSA 1TYGB 4MH0E 3W5VB 2RSUA 1L0VB 3QJZA 2IO2B 1WI0A 3IAM1 4IOIE 1L4ZB 3AM9A 4A6QA 1V80A 2BT6A 1FO4A 1K52A 1E7UA 3NVVA 3IG3A 2WXMA 3VVWB 2KYWA 4DDID 1QQRA 1FRRA 4RMAA 3BIID 1Q0WB 3NRZA 5G2NA 2N9KA 1MPEA 2DAFA 3MJ5A 3IBEA 2J42A 1UUPA 1P7EA 2I1JA 2G9HD 4EZKA 3BK1A 1EWCA 3R7RA 1VZ8A 2KQSA 5LXIB 2DZJA 1LXDA 2A5UA 1A5RA 3U30A 2L05A 2ZPNA 4IKGA 3WAPA 2I1KA 4CHKA 5EDSA 2N9LA 3M95A 1I4PA 1EO6A 3VRAB 4EZJA 4FXCA 1TY2A 3Q3OC 1WE7A 1YNTE 2M1MA 3B0AA 3D32A 2V0GA 2MBOA 2IZVB 1E0ZA 1UELA 4DXFA 2OJWA 4W9HA 2WYQA 1IGDA 1TS4A 1WY8A 3BINA 2JY6A 2GOWA 1CMXB 4KSLC 4XDCA 3O65B 5IOIA 3Q6BA 1QOAA 2K5PA 1AWDA 1YOVB 4TKNA 4BFRA 2ZPYA 2IGGA 3QK0A 2J52A 3TEXA 1A70A 3ZLZA 1UH6A 4BBNF 1FCLA 3OJ4B 2M8SA 2DZKA 1TS2A 2CJNA 4OVZA 3IFWB 1S3SG 2JSVX 5BYRA 2LRUA 3W1YA 4KKJA 3BZDB 3Q3FA 4JWUC 1ZGUB 2YEPF 4WH4A 4NQLB 4B6WA 2PEAA 3ZNZB 1XQQA 1B9RA 3DBSA 2WXRA 3AI5A 3T9LA 2L8JA 1I4HA 4NQKE 3V6EB 2KQ4X 1KLVA 1KRHA 2MJ3A 3RNCC 5LXHA 4RGNA 3WAOA 5IAAC 3P4QB 3H8HA 3RPFC 4RGMA 4FA6A 2BPSA 1IBXA 4LNFA 1L5PA 5EE1A 4MDKE 1MJDA 4B0EA 5C23A 1LO5D 3PPAA 1XCQL 3KH0A 1SJED 1SBBB 3M62B 3APCA 4C56C 2KFJA 1MG8A 3NOBA 1TS5A 1SEBD 4HDOA 4JL9A 4A9AA 3BYYB 2LXCA 2ONQA 1YJIA 4RM9A 2MQJA 2O6VD 1FD6A 2V3PA 1I4XA 4M0WA 1D6EC 2NS5A 2MA9B 1QOFA 2KDFB 2BF8B 2QSDA 3AE8B 4DDGD 2CU3A 1KFYB 1KM7A 1WM3A 4HROA 4H2AA 3CMMB 3NS1A 5AEKB 2L52A 3J9CA 2NBUA 2DZMA 3MP9A 1T0YA 3DVNV 2ICIA 1E10A 2O6VB 1UD7A 1E8WA 1EUVB 4JIOU 1NEKB 4W9FA 1MHHE 1S1QB 1V86A 4K7WA 4KGRA 1WR6E 1DOIA 1SJHD 1C78A 2J0KA 3SU8X 1FRDA 2KMMA 4WAAA 4BAXA 3IXSA 3DBHI 4MSQB 1XCTL 4YTMB 2KN5A 3VH4B 1YJ1A 2BB5A 2YLMA 3DVNU 1ACCA 1WGDA 2GBMA 2CS4A 3TMPB 4AJWA 2WXOA 3UF8A 2J53A 2CHXA 2N9PC 2ZEQA 2N4FA 3ZKJC 2Z8LA 3RFZB 4W9LA 4CQNA 3P4PB 3UIOB 3UINB 1C76A 4YTPB 5D3DA 2M56B 2D10A 3U52E 5BMGA 1VCBA 1Y56A 1M94A 4YTNB 1HTQA 1N5WA 3E56A 4HWIB 4DWFA 3EC8A 1FNVA 4HEA1 4S0RA 2D5GA 5IA7A 1YX5B 2K0PA 4LNIA 2WDVB 2DLBA 2DHZA 4HVBA 3SR6A 2NMQA 4IUMB 2N1VA 3NY5A 1P7FA 3ZYYX 5E6OA 2WQYB 2KJRA 1PGBA 3ZDTA 4X57B 2LGIA 1V1PB 2QILA 2RGFA 1J19A 3TEYA 2LEKA 2LJ5A 2UYZB 4JX1C 2REXA 4A3PA 4DXAB 1EF5A 1F2RC 1WZ3A 3W5UB 2ON8A 4KVGB 4JE3B 5JHAA 3L17A 4K81A 3L10B 1MI0A 3AE2B 3AEDB 4NAWB 1AARA 1LM8B 2KC1A 4HRSA 2K3UA 5G5HA 3CWIA 1ET6A 1RWSA 1NDDA 3AU4A 3RNEC 1BUIC 3ZXVA 1ROEA 4XE0A 1GNUA 1M4VA 5IN7A 4BKSD 4EEWA 3TEWA 4K7SA 4JQWC 4W9JA 4EUTA 1N60A 2FUHB 2J4XA 5GMVA 4ACFA 3SEBA 3VFKA 5JZEB 4WJPA 2ZW0A 5CTRC 3A1QA 4TV3A 4HK2A 3Q3NC 3BVGA 3L54A 5TSSA 1OGWA 5C2TB 2N0SB 2RDGA 1ISNA 1L6UA 2JU6X 4IM3A 3FC4A 4FULA 4DQOC 2J7QB 3JVZX 4GB9A 4CO7A 1SE4A 4TQ1A 2K8CA 1Z5SB 2DNFA 3V61A 4DXGA 4KV2A 1JWMD 1E90A 3Q3JA 1V5TA 1GJZA 4IWQA 1WJ4A 4MT5A 3ZVVA 4WJQA 1C4PA 2KTRA 4ARCA 1NI3A 1U4AA 1NI2A 1OEYJ 1MFWA 4YWGG 2AWTA 3I57A 1RRBA 3H7PA 2D3BA 3FKYA 3I3TB 3FILA 4XWTA 2CR5A 1IGCA 2IY0B 3O13A 3RYTA 2ZVOA 5D7GA 1YN4A 2L32A 1F2RI 2RMMA 3JSVA 4J3OD 1D5ZC 2KVRA 2MEKA 1AYFA 5EE3A 3K9PB 4RCOA 4WWPA 3ZTDA 1HA5A 2W3SA 3RUIB 3RZFA 4S17A 3U7DA 1WXVA 4NNJB 3BK2A 3FAHA 1OEYA 2KWCA 2LUEA 3C8YA 2QC8A 1E5WA 4IWPA 2K6QA 2QJLA 3PSEB 1WSPA 3KW5B 1YIWA 4BKGA 2PIAA 3TSSA 2IDYA 3HM3A 3LXFA 1RLFA 1WWTA 5BO4B 3PZ8A 5J17A 2KD0A 4KIKA 4QAYA 3AEBB 1E7PB 1KLGD 3MC0B 1SE9A 1WFYA 1ZUD2 1MHXA 2M0XA 1XO3A 2V3SA 4G0NB 4DHZE 4YXDB 1SIJA 2IGDA 2O2VA 1TY0A 2WXGA 2Y3AA 2XBBC 1Y8RC 4DK5A 3Q69A 1BXTA 2FCQA 4OVVA 3V3XA 3ZUNA 3NHEB 2J0JA 1VR9A 3B08A 4KKIA 2WS3B 3KWVA 1EU4A 3ALBA 5C3JB 3NZSA 4OVUA 1IBXB 4KDIC 1XLOA 1L0YB 5CX3A 2INDC 2KQ7A 2JZ3B 4D2KA 2B76B 2BQQA
chains in the Genus database with same CATH topology
2L00B 1C1YB 4W9GA 2V4LA 3Q3FA 2PE9A 3L0WB 1E7VA 3KYCD 1ZGUB 2Z0DB 5C1ZA 2OJRA 4NQLB 4B6WA 2XK5A 2PEAA 2ZZPB 3M63B 5L95C 3ZNZB 2KOXA 1XQQA 4PS3A 3ECIA 2RD0A 2L0FA 2KLCA 3DBSA 3AI5A 3T9LA 2L8JA 4LCDE 2BKFA 1WMHB 4NQKE 2HJ8A 1YD8U 2ASQA 3DVGX 3V6EB 1X1MA 4W9IA 3WANA 1KLVA 3IHPC 5LXHA 1E8YA 2MSED 4WWNA 2LVOA 5IAAC 3WAOA 5G55A 2IO0B 1JRUA 4MM3A 2BYVE 4FA6A 1QZEA 3TL5A 2BPSA 3LJ3A 5DPRA 2N9EB 4GOCA 4MDKE 2C60A 3QX1A 3PVLA 2KFKA 4MJSB 3QWZB 3DOWA 4GIVA 3TCAA 3WA0A 3CSTA 5C23A 3PPAA 3ZNID 4KIKB 4PYUA 3KH0A 1WX7A 2WX1A 1K8RB 3PTFC 2IO1B 2KWVB 3DQVA 3M62B 2KDEB 3APCA 3QC8B 3U8ZA 2LVPA 3UGBB 2KHWB 2K1FA 3A4RA 4ZRIA 3ZO5B 3R66C 2KFJA 4ICUA 1MG8A 4MGYE 1WX9A 3SDLC 3NOBA 5D6JB 2JRHA 3KYDD 2VRRB 4HDOA 2O2VB 2QHOA 4JL9A 2JPHA 2EMSA 2LXCA 1L2NA 4II2B 4RM8A 4WQOB 4ANXA 2IYDB 1IYFA 4JLCA 3DDCB 4RM9A 3APDA 2MQJA 2O6VD 3VTWA 4YL8A 1V2YA 4GN1A 4XC2A 4A20A 4URKA 2NS5A 2MA9B 2KDFB 2BF8B 2MW5A 3L16A 3QA8A 1XT9B 2AL6A 4DDGD 2GBJA 2G45B 2HTHA 3VDZA 2BGFA 3TBLD 1KM7A 4HLEA 1TGZB 1WM3A 2PE6B 2C7HA 3H6NA 1WYWB 2M17A 1WGRA 3CMMB 2CHWA 3N32A 3OAWA 5AEKB 2R2QA 4K7UA 2DYOA 2NBUA 2ZNVC 4PS8A 2NPTA 3PT2B 2DZMA 2LGXA 1T0YA 3WIMA 4TUUA 2D11A 3KVFB 3DVNV 2KDIA 1WF9A 3S2AA 3TJPA 1KJTA 3SHQA 1L7YA 3OLMD 2O6VB 3RCZA 1F9JA 2ZJDA 4TQ0A 1UD7A 1I42A 1E8WA 1EUVB 4JIOU 4P7IA 4F8CB 2KX0A 4W9FA 2KNBA 3VTUA 3N30A 1GG3A 2R2OA 1S1QB 1V86A 4HCPB 3CF6E 2XK5B 3H9DA 4K7WA 4GDKB 3DBLI 4GSWA 3ZNHB 1WR6E 5E6NA 3QAQA 3VQIA 4MEMA 2ZCBA 3C0RB 2J0KA 5DCNA 4FADA 3V62A 3SU8X 5J18A 3VUXA 2KKCA 4F7ZA 4WAAA 2ZNVB 5LLIA 2N7EA 3DBHI 3GZNI 3RULA 4MSQB 4FJZA 4BVUC 1P98A 2KN5A 3VH4B 4K1RB 1YJ1A 3EFUA 3ZNGC 4FN2A 2YLMA 3R7QA 3DVNU 2NBWB 1WGDA 2BYFA 1SIFA 2DAJA 4NAWA 2KMAA 3VXWA 2GBMA 2KFKB 2CS4A 4FLHA 3TMPB 4AJWA 3UF8A 2AL3A 3WAMA 4ANUA 2CHXA 2N9PC 2BKRB 2ZEQA 2N4FA 3ZKJC 3HHMA 4W9LA 4MELA 3KUDB 3VUYA 1SGHA 3UIOB 2A4ZA 2WX0A 2O6VA 2JF5A 4HPLB 3L13A 3UINB 2ZVNA 4F1SA 4GDLB 3QARA 4I6PA 1V5OA 2D10A 2KTFA 1BT0A 1RAXA 3HK0A 4FJVB 4GDKA 3M3JA 3RD2A 2BWFA 1VCBA 2LGYA 4I6LB 1M94A 2DYMA 3A9JA 3ONSA 1IPGA 4BOSC 2YVCA 1TZ1A 2LZ6A 4HWIB 3ZDMC 3EC8A 2K8BA 4DWFA 1WZ0A 2JZZA 2W9NA 3PGEA 3ZW3A 1WH3A 2KJ6A 3PREA 4LDTD 1P9DU 4M0WB 4EFOA 4CYEA 5IA7A 3ENEA 4AWJA 4IC7B 1UBQA 1YX5B 1C3TA 3ML8A 2DHZA 2N7DA 5D94A 4HVBA 4WJNA 4NY0A 4IUMB 2N1VA 2LWPA 2BWES 4IWOA 4LJOB 3NY5A 4DHZB 1YX6B 1R4NI 1VD2A 2N9XA 2J0MA 2EKEC 4BKTA 5E6OA 1WX8A 2XEWA 2KJRA 2NPTB 4X57B 3ZDTA 5HKHA 3VAWA 4HDQA 2IO3B 2LXAA 4I6NB 1P3QU 2NR2A 3UQBA 2RGFA 1J19A 3HM6X 4M8NA 1WJUA 1UGMA 3BY4B 4GDLA 4PYZA 2L76A 2LJ5A 2UYZB 2B3AA 2LASA 4LDTB 4KDLB 5J2RA 1E8XA 2D2QA 2V1YA 1ZKHA 3ZTCA 4W9EA 2REXA 5CHWA 4MGIE 4A3PA 4DXAB 2Y5BB 1EF5A 1WZ3A 4KZCA 1WXSA 4HXDA 1UZXB 5KHQA 2C7MB 1WJ6A 2C7NB 3X23A 5L83A 1UBIA 4KVGB 1EF1A 4IM2A 3A9KA 1GC7A 2FNJB 4N9F4 3X0WA 1ZW7A 2CHZA 5JHAA 5CHFA 3L17A 4K81A 4AUQC 2CU1A 3L10B 3PLUA 5JHBA 4MGKE 2MBEA 1IP9A 1G6JA 1P1AA 2EMTA 2L7RA 2JRIB 4FHKA 2KDBA 1LQBA 4NAWB 3CSFA 3LDZE 2HE7A 2LD9A 4GXBA 1E8ZA 1AARA 1LM8B 2KC1A 1OTRB 1WE6A 4HJKA 1I35A 4G50A 4HCNB 1OQYA 1NDDA 2GBRA 3AU4A 5FR6A 4W9CA 2WWZA 3A33B 4BBNC 4JGHB 1GNUA 3ML9A 4DBGA 4BKSD 4EEWA 1GC6A 4K7SA 4JQWC 4W9JA 4ZRKA 4EUTA 2AYOB 2FUHB 1WGHA 4EOYA 2KMCA 5GMVA 2BYEA 3A9JB 2AEHA 2C5LC 3VFKA 2WDTB 2DZIA 3WALA 5JZEB 4WJPA 5CTRC 3A1QA 3PV1A 4TV3A 1PQSA 2IY1B 2KX3A 3QIJA 4AOFA 4ZYNA 4HK2A 3K9OB 3L54A 2FIFA 3DBRI 4ZRJA 2MCNB 1J8CA 2N1WA 1OGWA 3RT3B 2RR9A 3V6CB 1J0GA 2K39A 2KANA 5AZHA 2MBQA 4E3CA 1WGYA 4IM3A 1ISNA 3B1LX 4IW0A 3TIXA 2UWQA 2KO3A 4FULA 2MWSB 2J7QB 3JVZX 4GB9A 4W9KA 4GGQA 4CO7A 4TQ1A 2K8CA 3MTNB 4J6IA 1RFAA 1Z5SB 2DYBA 2FCSA 2MP2B 5DPTA 3W1SC 3V61A 3GOEA 2JXXA 3DCGA 4BOZB 3PRZA 4MGZE 3AU5A 3H1UA 4KV2A 1E90A 3Q3JA 1V5TA 2FCNA 2KZRA 2MX2A 2Z59B 4FHJA 1GJZA 3NS8A 2G4DB 1WJ4A 4IWQA 3ZIMA 4WJQA 3ZVVA 1D3ZA 2KTRA 2GMIC 1V81A 3VTVA 2DENB 2D3GA 1GUAB 1WRDB 1WXAA 3PLVA 3RZWC 2LVQA 2HD5B 2NBVB 3QCAA 1U4AA 2CKHB 3PRPB 4E74A 1NI2A 2KJHB 1OEYJ 1XD3B 4B9KA 4XX5A 2MRPA 5TR5A 1NBFC 2KLGA 2AWTA 2KK8A 5AZFA 2NCNA 1H8CA 1RRBA 2OOBB 2RPQA 1V49A 3H7PA 3NZUA 3I3TB 3VUWA 2LI5A 3A9KB 4M8MA 3JW0X 2FAZA 2PJHA 1WIAA 2CR5A 3JYUA 3QQ8B 3R3MA 2KWUB 4GMVA 4FBJB 4NPNA 3A4SC 2IY0B 3OJ3A 4AP4C 4EKUA 1KOTA 4BKSA 2JWZA 4MH0E 3KUCB 1WJNA 3RYTA 2RSUA 2ZVOA 5D7GA 5DPWA 4W9DA 4NJ7A 1TTNA 3QJZA 2MP2A 2IO2B 1WI0A 2L3ZA 3N3KB 1V80A 4DHJD 2C9WB 3ZRFA 2G3QB 5AZGA 1LFDA 1E7UA 3IG3A 3SD5A 3VVWB 3JSVA 3PHWB 4HPMB 4DDID 2K8HA 2KVRA 2MLBA 3UIPB 3K9PB 2KC2A 4RMAA 4WWPA 3ZTDA 1Q0WB 4PS7A 5G2NA 3MHSD 4ANVA 5KHOA 3RUIB 3RZFA 1Q5WB 1Z2MA 2DAFA 3PS6A 3U7DA 4G3XB 1WXMA 3A1QB 3IBEA 1WXVA 5E6PA 3VHTC 4NNJB 3W1SA 2I1JA 4EZKA 3DPDA 4WJOA 3R7RA 1OEYA 2KWCA 2LUEA 4DHJB 2KQSA 5LXIB 2DZJA 2Z0EB 1LXDA 5CHVC 2K25A 1H4RA 1WM2A 1WMHA 1E5WA 2A5UA 4IWPA 1Q1OA 2K6QA 3HIZA 3L08A 3PSEB 1A5RA 1FXTB 2ZCCA 3U30A 2L05A 3AXCA 2ZPNA 4B95A 3EHVA 3V60A 4IM0A 3WAPA 2I1KA 3KW5B 1YIWA 4CHKA 5EDSA 3M95A 4KSKC 2G4SA 4BKGA 4II3B 4G11A 4WWOA 4GU2A 2MBHA 3HM3A 1EO6A 4MJSA 1HE8A 1RLFA 5DPSA 2KTRB 4EZJA 1WE7A 5BO4B 3APFA 2K6DB 2PPHA 2M1MA 5J17A 2KD0A 3IVFA 4KIKA 3B0AA 3D32A 4AJYB 2MBOA 2IZVB 1SE9A 1WFYA 4ASWC 2M0XA 4ZDVA 1UELA 3MJWA 2WYQA 4W9HA 2V3SA 4G0NB 4DHZE 2NVUI 4ANWA 3EECA 5D2MB 2JUOA 3H7PB 1WY8A 3BINA 3PHXB 3KUZA 3PRMB 2JY6A 2O2VA 4ICVA 2GOWA 1Y8RC 2M4NA 2XBBC 4XZ4A 1CMXB 4DK5A 4KSLC 1TBEA 2FCQA 1V6EA 3H7SA 2DX5B 3O65B 4KZ0A 4OVVA 2JVCA 4FJYA 3ZUNA 2LRWA 3NHEB 2FIDA 2J0JA 3DVGY 4TKNA 4BFRA 2ZPYA 4E71A 4MSMB 3B08A 3QK0A 4IG7B 2KXJA 1WGGA 3UQAA 3ZLZA 1UH6A 4LJPB 3ALBA 1R4MI 2D07B 4BBNF 2MBBB 3ZRCA 3NZSA 4OVUA 4A3OA 4EZLA 2IBIB 4KDIC 1WR1A 3OJ4B 3PZDA 2L0TA 2M8SA 3JSVB 5CX3A 2JT4B 2KQ7A 2DZKA 3QHTA 2FCMA 1V9JA 3VH3B 3P2BA 2JZ3B 2LGDA 2GBNA 3AULA 3IFWB 1S3SG 5JH5C 1P0RA 4NJ6A 2LRUA 3W1YA 2GBKA 1YQBA 3T8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L00 B;  1C1Y B;  4W9G A;  2V4L A;  3Q3F A;  2PE9 A;  3L0W B;  1E7V A;  3KYC D;  1ZGU B;  2Z0D B;  5C1Z A;  2OJR A;  4NQL B;  4B6W A;  2XK5 A;  2PEA A;  2ZZP B;  3M63 B;  5L95 C;  3ZNZ B;  2KOX A;  1XQQ A;  4PS3 A;  3ECI A;  2RD0 A;  2L0F A;  2KLC A;  3DBS A;  3AI5 A;  3T9L A;  2L8J A;  4LCD E;  2BKF A;  1WMH B;  4NQK E;  2HJ8 A;  1YD8 U;  2ASQ A;  3DVG X;  3V6E B;  1X1M A;  4W9I A;  3WAN A;  1KLV A;  3IHP C;  5LXH A;  1E8Y A;  2MSE D;  4WWN A;  2LVO A;  5IAA C;  3WAO A;  5G55 A;  2IO0 B;  1JRU A;  4MM3 A;  2BYV E;  4FA6 A;  1QZE A;  3TL5 A;  2BPS A;  3LJ3 A;  5DPR A;  2N9E B;  4GOC A;  4MDK E;  2C60 A;  3QX1 A;  3PVL A;  2KFK A;  4MJS B;  3QWZ B;  3DOW A;  4GIV A;  3TCA A;  3WA0 A;  3CST A;  5C23 A;  3PPA A;  3ZNI D;  4KIK B;  4PYU A;  3KH0 A;  1WX7 A;  2WX1 A;  1K8R B;  3PTF C;  2IO1 B;  2KWV B;  3DQV A;  3M62 B;  2KDE B;  3APC A;  3QC8 B;  3U8Z A;  2LVP A;  3UGB B;  2KHW B;  2K1F A;  3A4R A;  4ZRI A;  3ZO5 B;  3R66 C;  2KFJ A;  4ICU A;  1MG8 A;  4MGY E;  1WX9 A;  3SDL C;  3NOB A;  5D6J B;  2JRH A;  3KYD D;  2VRR B;  4HDO A;  2O2V B;  2QHO A;  4JL9 A;  2JPH A;  2EMS A;  2LXC A;  1L2N A;  4II2 B;  4RM8 A;  4WQO B;  4ANX A;  2IYD B;  1IYF A;  4JLC A;  3DDC B;  4RM9 A;  3APD A;  2MQJ A;  2O6V D;  3VTW A;  4YL8 A;  1V2Y A;  4GN1 A;  4XC2 A;  4A20 A;  4URK A;  2NS5 A;  2MA9 B;  2KDF B;  2BF8 B;  2MW5 A;  3L16 A;  3QA8 A;  1XT9 B;  2AL6 A;  4DDG D;  2GBJ A;  2G45 B;  2HTH A;  3VDZ A;  2BGF A;  3TBL D;  1KM7 A;  4HLE A;  1TGZ B;  1WM3 A;  2PE6 B;  2C7H A;  3H6N A;  1WYW B;  2M17 A;  1WGR A;  3CMM B;  2CHW A;  3N32 A;  3OAW A;  5AEK B;  2R2Q A;  4K7U A;  2DYO A;  2NBU A;  2ZNV C;  4PS8 A;  2NPT A;  3PT2 B;  2DZM A;  2LGX A;  1T0Y A;  3WIM A;  4TUU A;  2D11 A;  3KVF B;  3DVN V;  2KDI A;  1WF9 A;  3S2A A;  3TJP A;  1KJT A;  3SHQ A;  1L7Y A;  3OLM D;  2O6V B;  3RCZ A;  1F9J A;  2ZJD A;  4TQ0 A;  1UD7 A;  1I42 A;  1E8W A;  1EUV B;  4JIO U;  4P7I A;  4F8C B;  2KX0 A;  4W9F A;  2KNB A;  3VTU A;  3N30 A;  1GG3 A;  2R2O A;  1S1Q B;  1V86 A;  4HCP B;  3CF6 E;  2XK5 B;  3H9D A;  4K7W A;  4GDK B;  3DBL I;  4GSW A;  3ZNH B;  1WR6 E;  5E6N A;  3QAQ A;  3VQI A;  4MEM A;  2ZCB A;  3C0R B;  2J0K A;  5DCN A;  4FAD A;  3V62 A;  3SU8 X;  5J18 A;  3VUX A;  2KKC A;  4F7Z A;  4WAA A;  2ZNV B;  5LLI A;  2N7E A;  3DBH I;  3GZN I;  3RUL A;  4MSQ B;  4FJZ A;  4BVU C;  1P98 A;  2KN5 A;  3VH4 B;  4K1R B;  1YJ1 A;  3EFU A;  3ZNG C;  4FN2 A;  2YLM A;  3R7Q A;  3DVN U;  2NBW B;  1WGD A;  2BYF A;  1SIF A;  2DAJ A;  4NAW A;  2KMA A;  3VXW A;  2GBM A;  2KFK B;  2CS4 A;  4FLH A;  3TMP B;  4AJW A;  3UF8 A;  2AL3 A;  3WAM A;  4ANU A;  2CHX A;  2N9P C;  2BKR B;  2ZEQ A;  2N4F A;  3ZKJ C;  3HHM A;  4W9L A;  4MEL A;  3KUD B;  3VUY A;  1SGH A;  3UIO B;  2A4Z A;  2WX0 A;  2O6V A;  2JF5 A;  4HPL B;  3L13 A;  3UIN B;  2ZVN A;  4F1S A;  4GDL B;  3QAR A;  4I6P A;  1V5O A;  2D10 A;  2KTF A;  1BT0 A;  1RAX A;  3HK0 A;  4FJV B;  4GDK A;  3M3J A;  3RD2 A;  2BWF A;  1VCB A;  2LGY A;  4I6L B;  1M94 A;  2DYM A;  3A9J A;  3ONS A;  1IPG A;  4BOS C;  2YVC A;  1TZ1 A;  2LZ6 A;  4HWI B;  3ZDM C;  3EC8 A;  2K8B A;  4DWF A;  1WZ0 A;  2JZZ A;  2W9N A;  3PGE A;  3ZW3 A;  1WH3 A;  2KJ6 A;  3PRE A;  4LDT D;  1P9D U;  4M0W B;  4EFO A;  4CYE A;  5IA7 A;  3ENE A;  4AWJ A;  4IC7 B;  1UBQ A;  1YX5 B;  1C3T A;  3ML8 A;  2DHZ A;  2N7D A;  5D94 A;  4HVB A;  4WJN A;  4NY0 A;  4IUM B;  2N1V A;  2LWP A;  2BWE S;  4IWO A;  4LJO B;  3NY5 A;  4DHZ B;  1YX6 B;  1R4N I;  1VD2 A;  2N9X A;  2J0M A;  2EKE C;  4BKT A;  5E6O A;  1WX8 A;  2XEW A;  2KJR A;  2NPT B;  4X57 B;  3ZDT A;  5HKH A;  3VAW A;  4HDQ A;  2IO3 B;  2LXA A;  4I6N B;  1P3Q U;  2NR2 A;  3UQB A;  2RGF A;  1J19 A;  3HM6 X;  4M8N A;  1WJU A;  1UGM A;  3BY4 B;  4GDL A;  4PYZ A;  2L76 A;  2LJ5 A;  2UYZ B;  2B3A A;  2LAS A;  4LDT B;  4KDL B;  5J2R A;  1E8X A;  2D2Q A;  2V1Y A;  1ZKH A;  3ZTC A;  4W9E A;  2REX A;  5CHW A;  4MGI E;  4A3P A;  4DXA B;  2Y5B B;  1EF5 A;  1WZ3 A;  4KZC A;  1WXS A;  4HXD A;  1UZX B;  5KHQ A;  2C7M B;  1WJ6 A;  2C7N B;  3X23 A;  5L83 A;  1UBI A;  4KVG B;  1EF1 A;  4IM2 A;  3A9K A;  1GC7 A;  2FNJ B;  4N9F 4;  3X0W A;  1ZW7 A;  2CHZ A;  5JHA A;  5CHF A;  3L17 A;  4K81 A;  4AUQ C;  2CU1 A;  3L10 B;  3PLU A;  5JHB A;  4MGK E;  2MBE A;  1IP9 A;  1G6J A;  1P1A A;  2EMT A;  2L7R A;  2JRI B;  4FHK A;  2KDB A;  1LQB A;  4NAW B;  3CSF A;  3LDZ E;  2HE7 A;  2LD9 A;  4GXB A;  1E8Z A;  1AAR A;  1LM8 B;  2KC1 A;  1OTR B;  1WE6 A;  4HJK A;  1I35 A;  4G50 A;  4HCN B;  1OQY A;  1NDD A;  2GBR A;  3AU4 A;  5FR6 A;  4W9C A;  2WWZ A;  3A33 B;  4BBN C;  4JGH B;  1GNU A;  3ML9 A;  4DBG A;  4BKS D;  4EEW A;  1GC6 A;  4K7S A;  4JQW C;  4W9J A;  4ZRK A;  4EUT A;  2AYO B;  2FUH B;  1WGH A;  4EOY A;  2KMC A;  5GMV A;  2BYE A;  3A9J B;  2AEH A;  2C5L C;  3VFK A;  2WDT B;  2DZI A;  3WAL A;  5JZE B;  4WJP A;  5CTR C;  3A1Q A;  3PV1 A;  4TV3 A;  1PQS A;  2IY1 B;  2KX3 A;  3QIJ A;  4AOF A;  4ZYN A;  4HK2 A;  3K9O B;  3L54 A;  2FIF A;  3DBR I;  4ZRJ A;  2MCN B;  1J8C A;  2N1W A;  1OGW A;  3RT3 B;  2RR9 A;  3V6C B;  1J0G A;  2K39 A;  2KAN A;  5AZH A;  2MBQ A;  4E3C A;  1WGY A;  4IM3 A;  1ISN A;  3B1L X;  4IW0 A;  3TIX A;  2UWQ A;  2KO3 A;  4FUL A;  2MWS B;  2J7Q B;  3JVZ X;  4GB9 A;  4W9K A;  4GGQ A;  4CO7 A;  4TQ1 A;  2K8C A;  3MTN B;  4J6I A;  1RFA A;  1Z5S B;  2DYB A;  2FCS A;  2MP2 B;  5DPT A;  3W1S C;  3V61 A;  3GOE A;  2JXX A;  3DCG A;  4BOZ B;  3PRZ A;  4MGZ E;  3AU5 A;  3H1U A;  4KV2 A;  1E90 A;  3Q3J A;  1V5T A;  2FCN A;  2KZR A;  2MX2 A;  2Z59 B;  4FHJ A;  1GJZ A;  3NS8 A;  2G4D B;  1WJ4 A;  4IWQ A;  3ZIM A;  4WJQ A;  3ZVV A;  1D3Z A;  2KTR A;  2GMI C;  1V81 A;  3VTV A;  2DEN B;  2D3G A;  1GUA B;  1WRD B;  1WXA A;  3PLV A;  3RZW C;  2LVQ A;  2HD5 B;  2NBV B;  3QCA A;  1U4A A;  2CKH B;  3PRP B;  4E74 A;  1NI2 A;  2KJH B;  1OEY J;  1XD3 B;  4B9K A;  4XX5 A;  2MRP A;  5TR5 A;  1NBF C;  2KLG A;  2AWT A;  2KK8 A;  5AZF A;  2NCN A;  1H8C A;  1RRB A;  2OOB B;  2RPQ A;  1V49 A;  3H7P A;  3NZU A;  3I3T B;  3VUW A;  2LI5 A;  3A9K B;  4M8M A;  3JW0 X;  2FAZ A;  2PJH A;  1WIA A;  2CR5 A;  3JYU A;  3QQ8 B;  3R3M A;  2KWU B;  4GMV A;  4FBJ B;  4NPN A;  3A4S C;  2IY0 B;  3OJ3 A;  4AP4 C;  4EKU A;  1KOT A;  4BKS A;  2JWZ A;  4MH0 E;  3KUC B;  1WJN A;  3RYT A;  2RSU A;  2ZVO A;  5D7G A;  5DPW A;  4W9D A;  4NJ7 A;  1TTN A;  3QJZ A;  2MP2 A;  2IO2 B;  1WI0 A;  2L3Z A;  3N3K B;  1V80 A;  4DHJ D;  2C9W B;  3ZRF A;  2G3Q B;  5AZG A;  1LFD A;  1E7U A;  3IG3 A;  3SD5 A;  3VVW B;  3JSV A;  3PHW B;  4HPM B;  4DDI D;  2K8H A;  2KVR A;  2MLB A;  3UIP B;  3K9P B;  2KC2 A;  4RMA A;  4WWP A;  3ZTD A;  1Q0W B;  4PS7 A;  5G2N A;  3MHS D;  4ANV A;  5KHO A;  3RUI B;  3RZF A;  1Q5W B;  1Z2M A;  2DAF A;  3PS6 A;  3U7D A;  4G3X B;  1WXM A;  3A1Q B;  3IBE A;  1WXV A;  5E6P A;  3VHT C;  4NNJ B;  3W1S A;  2I1J A;  4EZK A;  3DPD A;  4WJO A;  3R7R A;  1OEY A;  2KWC A;  2LUE A;  4DHJ B;  2KQS A;  5LXI B;  2DZJ A;  2Z0E B;  1LXD A;  5CHV C;  2K25 A;  1H4R A;  1WM2 A;  1WMH A;  1E5W A;  2A5U A;  4IWP A;  1Q1O A;  2K6Q A;  3HIZ A;  3L08 A;  3PSE B;  1A5R A;  1FXT B;  2ZCC A;  3U30 A;  2L05 A;  3AXC A;  2ZPN A;  4B95 A;  3EHV A;  3V60 A;  4IM0 A;  3WAP A;  2I1K A;  3KW5 B;  1YIW A;  4CHK A;  5EDS A;  3M95 A;  4KSK C;  2G4S A;  4BKG A;  4II3 B;  4G11 A;  4WWO A;  4GU2 A;  2MBH A;  3HM3 A;  1EO6 A;  4MJS A;  1HE8 A;  1RLF A;  5DPS A;  2KTR B;  4EZJ A;  1WE7 A;  5BO4 B;  3APF A;  2K6D B;  2PPH A;  2M1M A;  5J17 A;  2KD0 A;  3IVF A;  4KIK A;  3B0A A;  3D32 A;  4AJY B;  2MBO A;  2IZV B;  1SE9 A;  1WFY A;  4ASW C;  2M0X A;  4ZDV A;  1UEL A;  3MJW A;  2WYQ A;  4W9H A;  2V3S A;  4G0N B;  4DHZ E;  2NVU I;  4ANW A;  3EEC A;  5D2M B;  2JUO A;  3H7P B;  1WY8 A;  3BIN A;  3PHX B;  3KUZ A;  3PRM B;  2JY6 A;  2O2V A;  4ICV A;  2GOW A;  1Y8R C;  2M4N A;  2XBB C;  4XZ4 A;  1CMX B;  4DK5 A;  4KSL C;  1TBE A;  2FCQ A;  1V6E A;  3H7S A;  2DX5 B;  3O65 B;  4KZ0 A;  4OVV A;  2JVC A;  4FJY A;  3ZUN A;  2LRW A;  3NHE B;  2FID A;  2J0J A;  3DVG Y;  4TKN A;  4BFR A;  2ZPY A;  4E71 A;  4MSM B;  3B08 A;  3QK0 A;  4IG7 B;  2KXJ A;  1WGG A;  3UQA A;  3ZLZ A;  1UH6 A;  4LJP B;  3ALB A;  1R4M I;  2D07 B;  4BBN F;  2MBB B;  3ZRC A;  3NZS A;  4OVU A;  4A3O A;  4EZL A;  2IBI B;  4KDI C;  1WR1 A;  3OJ4 B;  3PZD A;  2L0T A;  2M8S A;  3JSV B;  5CX3 A;  2JT4 B;  2KQ7 A;  2DZK A;  3QHT A;  2FCM A;  1V9J A;  3VH3 B;  3P2B A;  2JZ3 B;  2LGD A;  2GBN A;  3AUL A;  3IFW B;  1S3S G;  5JH5 C;  1P0R A;  4NJ6 A;  2LRU A;  3W1Y A;  2GBK A;  1YQB A;  3T8M A; 
#chains in the Genus database with same CATH topology
 3KYC D;  2OJR A;  3M63 B;  5BMH A;  4PS3 A;  3ECI A;  2KLC A;  1J7A A;  4ZRP A;  1WMH B;  2HJ8 A;  2SEB D;  1N61 A;  2LHD A;  4W9I A;  4A55 A;  2I38 A;  1HTO A;  1TKE A;  2MSE D;  1R4M B;  4WWN A;  3KWL A;  3TL5 A;  3LJ3 A;  3BVZ A;  2C60 A;  3QX1 A;  2KFK A;  4MJS B;  3DHG C;  3DOW A;  4GIV A;  3ZNI D;  1JML A;  4PYU A;  3R2T A;  2WX1 A;  1K8R B;  3PTF C;  1SXT A;  3DQV A;  2KDE B;  4ZRI A;  2JYT A;  2E6X A;  3AH7 A;  1KLU D;  5D6J B;  2JRH A;  3N20 C;  1FPY A;  2JPH A;  2WXN A;  4II2 B;  2IYD B;  3AE4 B;  3APD A;  4REZ A;  4YL8 A;  2HDE A;  1V2Y A;  4GN1 A;  2BTE A;  2ZW1 A;  3AEA B;  4M02 A;  2G45 B;  2HTH A;  4HKZ E;  1XXG A;  4N6E B;  4RF0 A;  3OAW A;  4K7U A;  2GRI A;  1J7B A;  2NPT A;  3PT2 B;  4TUU A;  1WGK A;  2KDI A;  1WF9 A;  2NTS A;  1L7Y A;  1F9J A;  2ZJD A;  4ZHO A;  1I42 A;  1YJJ A;  4P7I A;  3AEF B;  2L1A A;  2KNB A;  4HCP B;  4USA A;  2XK5 B;  5HI1 A;  1RM6 C;  2FUG 1;  5IO9 A;  3C0R B;  1GB1 A;  3AEE B;  1N62 A;  5J18 A;  2KKC A;  1K53 A;  4US9 A;  3U7Z A;  1T0S C;  1QOG A;  4OW0 A;  4MM3 B;  4K1R B;  3DWG C;  2BYF A;  2WGS A;  1VZ7 A;  1QT9 A;  3WAM A;  4ANU A;  2BKR B;  2CJO A;  4BZA A;  3HHM A;  4MEL A;  2UU7 A;  2A4Z A;  1FNU A;  2JF5 A;  1JRO A;  2WDQ B;  3L13 A;  4F1S A;  4I6P A;  2NTT A;  4GDK A;  3DHI C;  3RD2 A;  2KAC A;  1MVK A;  2DYM A;  3A9J A;  1ZOY B;  4BOS C;  4AS1 A;  2LZ6 A;  3V05 A;  2JZZ A;  2W9N A;  1WH3 A;  3PRE A;  2AQ1 B;  1TJE A;  4WJN A;  1PFD A;  2LWP A;  2BWE S;  5FKA C;  1YX6 B;  1UGJ A;  1XLN A;  4WIP A;  4GLS C;  1WX8 A;  3RNB C;  1T5X D;  4HDQ A;  5AUI A;  4I6N B;  3B2F A;  3HM6 X;  4OZA A;  4M8N A;  3BY4 B;  4US8 A;  1SSN A;  4KDL B;  2V1Y A;  2PVO D;  3LYY A;  4XDD A;  4M00 A;  1UBI A;  1EM7 A;  2FNJ B;  5CHF A;  2CU1 A;  4MGK E;  1IP9 A;  1N5X A;  2EMT A;  2D3A A;  2D3C A;  4C4V B;  4LNN A;  3LDZ E;  1CQV A;  1E8Z A;  4G50 A;  1OQY A;  1UF0 A;  1L6V A;  2WWZ A;  3A33 B;  4JGH B;  3HVZ A;  2HJ1 A;  3ML9 A;  4DBG A;  1GC6 A;  3BWU D;  4K3B A;  3I5J C;  2AYO B;  4EOY A;  4JPS A;  2AQ2 B;  3IT4 B;  2BS4 B;  4L23 A;  1GOZ A;  2C5L C;  3WAL A;  4ZYN A;  2FIF A;  3B9J A;  3DBR I;  2W3R A;  3RN9 C;  3RT3 B;  2WDR B;  2K39 A;  5AZH A;  5IKC M;  4E3C A;  2H89 B;  1I4R A;  2BBC A;  4WAF A;  2R61 A;  1WXQ A;  3AE7 B;  1UNS A;  2FCS A;  2DYB A;  3MHZ A;  3W1S C;  4YSY B;  3VR8 B;  3ZJU A;  3AU5 A;  2KZR A;  2MX2 A;  2INP E;  3AV8 A;  3ZIM A;  2G4D B;  1D3Z A;  1V81 A;  2DEN B;  1WYG A;  3AE6 B;  3PLV A;  2LVQ A;  2NBV B;  2CKH B;  2KJH B;  3HRD D;  1XD3 B;  3AEC B;  2KK8 A;  1OFF A;  3LB8 C;  1H8C A;  2OOB B;  2JX5 A;  3NZU A;  3VUW A;  3A9K B;  1LGR A;  1T0Q C;  3JYU A;  3QQ8 B;  3R3M A;  2KWU B;  4FBJ B;  3A4S C;  1FFU A;  1KTK A;  4N59 A;  2JWZ A;  2W54 A;  2L3Z A;  3N3K B;  4YT0 B;  4ZHP A;  2I2Y A;  4C7Z A;  2C9W B;  1R7S A;  3ZRF A;  1QOB A;  5AZG A;  3DHH C;  2WXK A;  3SD5 A;  3AE9 B;  3IT6 B;  1AW7 A;  1DOY A;  4HPM B;  3ZQ4 A;  2KC2 A;  3RNA C;  3MHS D;  5KHO A;  1FCC C;  4IDI A;  3NVZ A;  1Z2M A;  4G3X B;  1WXM A;  1E6E B;  2LGS A;  5E6P A;  3VHT C;  3W1S A;  5MPO A;  1YMH E;  1TZO A;  2Z0E B;  2K25 A;  3L08 A;  2ZCC A;  3AXC A;  4B95 A;  3V60 A;  4AQ7 A;  1DOX A;  3Q14 C;  4II3 B;  4WWO A;  4GU2 A;  2MBH A;  5DPS A;  1HE8 A;  3APF A;  2FE8 A;  4ASW C;  5HHD G;  2NVU I;  4ANW A;  4KGS A;  2JUO A;  3PHX B;  1ZPS A;  3KUZ A;  1JCK B;  4ICV A;  3RI7 C;  1EWY C;  2M4N A;  4XZ4 A;  1V6E A;  2DX5 B;  1JW9 D;  2M19 A;  4FJY A;  2WLB A;  2LRW A;  2WXI A;  2VH1 A;  4E71 A;  4MSM B;  4IG7 B;  1WGG A;  3UQA A;  1ET9 A;  3Q2A C;  4YSZ B;  1JRP A;  4A3O A;  1PGX A;  4EZL A;  1WR1 A;  3PZD A;  4KX6 B;  4NZL B;  1ZXH A;  1V9J A;  3VH3 B;  2GBN A;  1JAL A;  3AUL A;  1HXY D;  2DWQ A;  4NJ6 A;  1D5M C;  2GBK A;  1YQB A;  3T8M A;  2SAK A;  2L00 B;  2V4L A;  1HEZ E;  3L0W B;  2Z0D B;  5C1Z A;  1NYR A;  2ZZP B;  1KF6 B;  2RD0 A;  2EEL A;  1YD8 U;  2VZK D;  2ASQ A;  2X8X X;  4TSS A;  1CK1 A;  1X1M A;  1F77 A;  3IHP C;  1YQ4 B;  2LVO A;  5G55 A;  1ZE3 D;  2IO0 B;  1QZE A;  5DPR A;  1T3Q A;  1I4Q A;  4GOC A;  3PVL A;  1QF6 A;  3TCA A;  3CST A;  1Q10 A;  1D5X C;  1WX7 A;  3AE1 B;  2KHW B;  3NZ3 A;  3ZO5 B;  3R66 C;  4C00 A;  4ICU A;  4PK1 A;  4MGY E;  1WX9 A;  2VZK B;  3SDL C;  2WXJ A;  5EE0 A;  1FXA A;  1UWM A;  1JQ4 A;  2EMS A;  3EUB 2;  1PYW D;  4RM8 A;  4WQO B;  4ANX A;  1IYF A;  3RNF C;  4JLC A;  3DDC B;  3NG0 A;  3VTW A;  1C77 A;  1SE2 A;  4XC2 A;  1C9F A;  4HPP A;  3L16 A;  3QA8 A;  3HUI A;  1XT9 B;  3GB1 A;  2LFI A;  3VDZ A;  3TEZ A;  1TGZ B;  2C7H A;  1WYW B;  2LUM A;  1WGR A;  2M17 A;  2CHW A;  1RFK A;  3N32 A;  2KVZ A;  2WXL A;  2R2Q A;  2DYO A;  2ZNV C;  4PS8 A;  1V1P A;  4ITK A;  1KJT A;  3SHQ A;  3OLM D;  4TQ0 A;  4UDU C;  5H8Y E;  3P4S B;  1KH0 A;  1NVI D;  3VTU A;  3N30 A;  1GG3 A;  4GDK B;  3DBL I;  4GSW A;  4ARI A;  5E6N A;  2ZCB A;  2G1E A;  5DCN A;  2BB6 A;  2W82 A;  3V62 A;  4HKQ A;  1PUT A;  4F7Z A;  3NJT A;  5LLI A;  2EKI A;  1OQQ A;  2N7E A;  3GZN I;  3RUL A;  3W9C B;  2WU5 B;  2GLS A;  3EGR A;  3ZNG C;  3EFU A;  4FN2 A;  2PLP A;  1SIF A;  4NAW A;  1SF0 A;  3VXW A;  1FIQ A;  4ZOH C;  1SB3 C;  4YSX B;  4FLH A;  1NEN B;  1HQR D;  1IUE A;  3PZ7 A;  4P6V F;  3AE3 B;  2BW2 A;  3KUD B;  3Q3M C;  3PO0 A;  3R2I A;  1SGH A;  2WX0 A;  2JYE A;  4HPL B;  1T0R C;  4PT5 A;  4XYC A;  3QAR A;  1N6Z A;  4FJV B;  1V5O A;  2KTF A;  1BT0 A;  2MJD A;  2RDB C;  3M3J A;  1JWS D;  3E9S A;  2YVC A;  3ZDM C;  3DBH B;  2AQ3 B;  3PGE A;  3DBR B;  1N63 A;  1P9D U;  4M0W B;  4EFO A;  3ENE A;  4AWJ A;  1UBQ A;  1C3T A;  2JQR B;  3ML8 A;  2N7D A;  4RH6 A;  4NY0 A;  3I63 C;  4IWO A;  2Q5W D;  4DHZ B;  1R4N I;  1VD2 A;  2J0M A;  2EKE C;  4LNK A;  2WHI A;  2XEW A;  4NJC A;  3DWM A;  5HKH A;  2LMC A;  2LXA A;  1P3Q U;  2N7J A;  2NR2 A;  3NVY A;  3UQB A;  1WRI A;  3ZJV A;  1WJU A;  4GDL A;  4PYZ A;  4KGT A;  5BYQ A;  2B3A A;  2LAS A;  2D2Q A;  3ZTC A;  1E9M A;  4W9E A;  5CHW A;  4P16 A;  1BML C;  2QMT A;  2Y5B B;  1SE3 A;  3RNG C;  4KZC A;  4HXD A;  1UZX B;  2C7N B;  3AMZ A;  5BYS A;  4LLG M;  4LNO A;  3PLU A;  2MBE A;  1FFV A;  1FNW A;  2L7R A;  1NYQ A;  1LQB A;  2HE7 A;  2LD9 A;  2AX5 A;  2V9H A;  1DGJ A;  1WE6 A;  1I35 A;  5IP4 D;  5FR6 A;  4BBN C;  3KQ4 A;  3AE5 B;  3Q8C A;  1B1Z A;  4Q2J A;  3Q8F A;  2BYE A;  2JWU A;  2AEH A;  3ABV B;  4L2Y A;  2WDT B;  2DZI A;  2RDH A;  3NVW A;  1ZDV A;  5E6J A;  4ZRJ A;  1J8C A;  2N1W A;  3P4R B;  3OWE B;  4N58 A;  2MHJ A;  1TIF A;  4IW0 A;  2UWQ A;  2KO3 A;  2MWS B;  1CZP A;  4GGQ A;  1TKG A;  2LHE A;  1RFA A;  2KN4 A;  2JXX A;  3B2G A;  4BOZ B;  3PRZ A;  4FHJ A;  4ZRQ A;  1ZXI A;  2MH7 A;  3NS8 A;  1VZ6 A;  2MJE A;  2GMI C;  2WXQ A;  3ZGZ A;  1WRD B;  1WXA A;  3RZW C;  1FEH A;  4E74 A;  1XF5 L;  4XX5 A;  2MRP A;  1NBF C;  2BYT A;  2VH2 A;  1GB4 A;  5AZF A;  2NCN A;  2RPQ A;  1V49 A;  2LI5 A;  4M8M A;  1V1O A;  1WIA A;  4GMV A;  4NPN A;  1GPX A;  1ENF A;  3U2S C;  1KOT A;  2W55 A;  3KUC B;  4NAM A;  1WJN A;  5DPW A;  2IPK D;  4W9D A;  4NJ7 A;  1TTN A;  1VLB A;  2MP2 A;  3IAS 1;  4DHJ D;  3Q8E A;  2G3Q B;  1LFD A;  1F1H A;  4A90 A;  3PHW B;  4O1N A;  2K8H A;  2MLB A;  3UIP B;  2JXT A;  2KDM A;  1QKZ A;  4PS7 A;  2Y5P A;  2WXH A;  4ANV A;  1QIL A;  1Q5W B;  3PS6 A;  3A1Q B;  2WNM A;  4A8X C;  1K51 A;  3DPD A;  4WJO A;  3VR9 B;  4DHJ B;  5CHV C;  1H4R A;  1WM2 A;  1WMH A;  2FBW B;  1Q1O A;  3HIZ A;  3BYT B;  4RGT A;  1FXT B;  1STE A;  3EHV A;  4IM0 A;  2BS2 B;  2K22 A;  4KSK C;  2G4S A;  1VRA B;  4G11 A;  4C7Y A;  1CJE A;  3C19 A;  4MJS A;  2KTR B;  1UWX A;  5HFY A;  2K6D B;  2PPH A;  3IVF A;  4LTU A;  4AJY B;  1L0X B;  2Y5C A;  3Q8B A;  3MC8 A;  3AB5 A;  4ZDV A;  1XLP A;  4WWM A;  1TKY A;  1YQ3 B;  3MJW A;  2DBY A;  1RYJ A;  3EEC A;  5D2M B;  2HTM E;  3H7P B;  2E3T A;  2V4I B;  3P63 A;  3PRM B;  3FIL B;  1TBE A;  3H7S A;  4KZ0 A;  4P1C C;  2INN E;  3Q8A A;  2JVC A;  1T6B X;  2X38 A;  3P42 A;  1HZ5 A;  2FID A;  1F52 A;  3DVG Y;  1ZDX A;  2PKO A;  2KXJ A;  2OED A;  1K50 A;  4LJP B;  1R4M I;  2D07 B;  2MBB B;  3ZRC A;  2IBI B;  2L0T A;  3JSV B;  3WCQ A;  2JT4 B;  3GE3 C;  3QHT A;  1C79 A;  2FCM A;  3P2B A;  2LGD A;  3HVD A;  5JH5 C;  1P0R A;  4K3C A;  2WXF A;  3U4E G;  4W9G A;  1C1Y B;  2PE9 A;  2QIE B;  3DBL B;  1E7V A;  2V3N A;  1FXI A;  4OZC A;  1YN3 A;  2XK5 A;  5L95 C;  2KOX A;  2L0F A;  1XLQ A;  4LCD E;  2BKF A;  4XGA B;  1GAQ B;  4C80 A;  3GZN B;  3DVG X;  3WAN A;  2BVC A;  1E8Y A;  3GE8 C;  2PVG C;  1JRU A;  4MM3 A;  2BYV E;  4OHJ A;  2N9E B;  5T8I A;  3QWZ B;  3W2D A;  3WA0 A;  5EE9 A;  3ZJT A;  2QCZ A;  4KIK B;  1EU3 A;  3U8Z A;  2IO1 B;  2KWV B;  4B0M A;  3QC8 B;  1V97 A;  2LVP A;  3VRB B;  3UGB B;  2K1F A;  3A4R A;  2RPV A;  3GP7 A;  1JWB D;  3KYD D;  5H92 C;  2IJ0 A;  3MC9 A;  2VRR B;  2O2V B;  2QHO A;  1ESF A;  1L2N A;  4EE2 A;  1TS3 A;  4LK0 M;  1QLB B;  1J7C A;  3URY A;  2WP9 B;  5G5G A;  3N9Y C;  4A20 A;  4URK A;  2MW5 A;  2AL6 A;  1R4N B;  2H88 B;  3AN1 A;  2GBJ A;  5AUK A;  2BGF A;  1TT5 B;  3TBL D;  4HLE A;  3ZXR A;  2PE6 B;  3H6N A;  1AN8 A;  1JWA D;  5FR3 A;  2XN9 C;  2BS3 B;  2WU2 B;  2OHF A;  2LGX A;  3WIM A;  2D11 A;  3KVF B;  3S2A A;  3TJP A;  2K9X A;  1FMA D;  3RCZ A;  2PMV A;  4HJG E;  4F8C B;  2KX0 A;  3EA6 A;  3OG5 A;  2R2O A;  1C4A A;  3CF6 E;  3H9D A;  1F0Z A;  3ZNH B;  4MAC A;  3QAQ A;  2KT7 A;  3P1M A;  4MEM A;  3VQI A;  4L1B A;  4JWS C;  4FAD A;  3VUX A;  3GS2 A;  5GXG B;  2GI9 A;  2ZNV B;  4RFB A;  4FJZ A;  4BVU C;  1P98 A;  1YN5 A;  3R7Q A;  4RNA A;  4C4V A;  2NBW B;  2DAJ A;  5BMI A;  2KMA A;  2KFK B;  1JWU D;  2AL3 A;  3CIR B;  1HZ6 A;  2M0A A;  3NUH B;  1PDX A;  3VUY A;  2O6V A;  2ZVN A;  4GDL B;  3HK0 A;  1RAX A;  2BWF A;  2LGY A;  2PW9 A;  4I6L B;  5D3I B;  3ONS A;  1IPG A;  1V8C A;  1TZ1 A;  2K8B A;  1WZ0 A;  3ZW3 A;  3N1Z C;  2KJ6 A;  4LDT D;  3ETR A;  4CYE A;  1I4G A;  4IC7 B;  5FK9 C;  5HG2 A;  5D94 A;  4LJO B;  4MH8 A;  2N9X A;  4BKT A;  1FM0 D;  3N1X C;  4R3D A;  2NPT B;  2XNA C;  3VAW A;  4RGO S;  2IO3 B;  1UGM A;  1DYQ A;  2L76 A;  2TSS A;  4LDT B;  5J2R A;  1E8X A;  1ZKH A;  2KAJ A;  1XEE A;  3KLS X;  1VDV A;  4MGI E;  5JXV A;  1WXS A;  3I9V 1;  5KHQ A;  2C7M B;  1WJ6 A;  3X23 A;  5L83 A;  2ACZ B;  2INC C;  1EF1 A;  4IM2 A;  3A9K A;  1GC7 A;  4N9F 4;  3X0W A;  1ZW7 A;  2CHZ A;  4AUQ C;  5JHB A;  2WXP A;  1G6J A;  1P1A A;  5LNK 1;  2JRI B;  4FHK A;  2KDB A;  3CSF A;  3BVM A;  4GXB A;  2KWD A;  1OTR B;  4HJK A;  3T3N A;  4HCN B;  4M01 A;  2GBR A;  3N1Y C;  3MFG A;  4W9C A;  1D4B A;  4P1B C;  2IGH A;  4TMA B;  3UI3 A;  4ZRK A;  1WGH A;  2L83 A;  2KMC A;  2QEJ C;  3A9J B;  1VJK A;  3TUO A;  3PV1 A;  3RMK C;  1PQS A;  2IY1 B;  2KX3 A;  3QIJ A;  4AOF A;  1MG4 A;  3K9O B;  3R8B A;  3EFC A;  2MCN B;  2RR9 A;  3V6C B;  1J0G A;  2KAN A;  4WUR A;  1C4C A;  2MBQ A;  1WGY A;  3B1L X;  3L4P A;  1L4D B;  3SFD B;  3TIX A;  4W9K A;  3T3O A;  4ZYS A;  3MTN B;  4J6I A;  5DPT A;  2MP2 B;  3GOE A;  3DCG A;  4MGZ E;  3AEG B;  1I7H A;  3H1U A;  2FCN A;  2Z59 B;  3SFE B;  4XWW A;  2QDF A;  2YEP B;  3VTV A;  2JZP A;  2D3G A;  1GUA B;  4RF1 A;  2GB1 A;  1ZP0 B;  2HD5 B;  3QCA A;  2LJI A;  3PRP B;  5I4D A;  4WQM A;  4B9K A;  5TR5 A;  2KLG A;  4OZB A;  1OQR A;  3JW0 X;  2FAZ A;  2PJH A;  1PGA A;  2PTL A;  3OJ3 A;  4AP4 C;  4EKU A;  4BKS A;  1TYG B;  4MH0 E;  3W5V B;  2RSU A;  1L0V B;  3QJZ A;  2IO2 B;  1WI0 A;  3IAM 1;  4IOI E;  1L4Z B;  3AM9 A;  4A6Q A;  1V80 A;  2BT6 A;  1FO4 A;  1K52 A;  1E7U A;  3NVV A;  3IG3 A;  2WXM A;  3VVW B;  2KYW A;  4DDI D;  1QQR A;  1FRR A;  4RMA A;  3BII D;  1Q0W B;  3NRZ A;  5G2N A;  2N9K A;  1MPE A;  2DAF A;  3MJ5 A;  3IBE A;  2J42 A;  1UUP A;  1P7E A;  2I1J A;  2G9H D;  4EZK A;  3BK1 A;  1EWC A;  3R7R A;  1VZ8 A;  2KQS A;  5LXI B;  2DZJ A;  1LXD A;  2A5U A;  1A5R A;  3U30 A;  2L05 A;  2ZPN A;  4IKG A;  3WAP A;  2I1K A;  4CHK A;  5EDS A;  2N9L A;  3M95 A;  1I4P A;  1EO6 A;  3VRA B;  4EZJ A;  4FXC A;  1TY2 A;  3Q3O C;  1WE7 A;  1YNT E;  2M1M A;  3B0A A;  3D32 A;  2V0G A;  2MBO A;  2IZV B;  1E0Z A;  1UEL A;  4DXF A;  2OJW A;  4W9H A;  2WYQ A;  1IGD A;  1TS4 A;  1WY8 A;  3BIN A;  2JY6 A;  2GOW A;  1CMX B;  4KSL C;  4XDC A;  3O65 B;  5IOI A;  3Q6B A;  1QOA A;  2K5P A;  1AWD A;  1YOV B;  4TKN A;  4BFR A;  2ZPY A;  2IGG A;  3QK0 A;  2J52 A;  3TEX A;  1A70 A;  3ZLZ A;  1UH6 A;  4BBN F;  1FCL A;  3OJ4 B;  2M8S A;  2DZK A;  1TS2 A;  2CJN A;  4OVZ A;  3IFW B;  1S3S G;  2JSV X;  5BYR A;  2LRU A;  3W1Y A;  4KKJ A;  3BZD B;  3Q3F A;  4JWU C;  1ZGU B;  2YEP F;  4WH4 A;  4NQL B;  4B6W A;  2PEA A;  3ZNZ B;  1XQQ A;  1B9R A;  3DBS A;  2WXR A;  3AI5 A;  3T9L A;  2L8J A;  1I4H A;  4NQK E;  3V6E B;  2KQ4 X;  1KLV A;  1KRH A;  2MJ3 A;  3RNC C;  5LXH A;  4RGN A;  3WAO A;  5IAA C;  3P4Q B;  3H8H A;  3RPF C;  4RGM A;  4FA6 A;  2BPS A;  1IBX A;  4LNF A;  1L5P A;  5EE1 A;  4MDK E;  1MJD A;  4B0E A;  5C23 A;  1LO5 D;  3PPA A;  1XCQ L;  3KH0 A;  1SJE D;  1SBB B;  3M62 B;  3APC A;  4C56 C;  2KFJ A;  1MG8 A;  3NOB A;  1TS5 A;  1SEB D;  4HDO A;  4JL9 A;  4A9A A;  3BYY B;  2LXC A;  2ONQ A;  1YJI A;  4RM9 A;  2MQJ A;  2O6V D;  1FD6 A;  2V3P A;  1I4X A;  4M0W A;  1D6E C;  2NS5 A;  2MA9 B;  1QOF A;  2KDF B;  2BF8 B;  2QSD A;  3AE8 B;  4DDG D;  2CU3 A;  1KFY B;  1KM7 A;  1WM3 A;  4HRO A;  4H2A A;  3CMM B;  3NS1 A;  5AEK B;  2L52 A;  3J9C A;  2NBU A;  2DZM A;  3MP9 A;  1T0Y A;  3DVN V;  2ICI A;  1E10 A;  2O6V B;  1UD7 A;  1E8W A;  1EUV B;  4JIO U;  1NEK B;  4W9F A;  1MHH E;  1S1Q B;  1V86 A;  4K7W A;  4KGR A;  1WR6 E;  1DOI A;  1SJH D;  1C78 A;  2J0K A;  3SU8 X;  1FRD A;  2KMM A;  4WAA A;  4BAX A;  3IXS A;  3DBH I;  4MSQ B;  1XCT L;  4YTM B;  2KN5 A;  3VH4 B;  1YJ1 A;  2BB5 A;  2YLM A;  3DVN U;  1ACC A;  1WGD A;  2GBM A;  2CS4 A;  3TMP B;  4AJW A;  2WXO A;  3UF8 A;  2J53 A;  2CHX A;  2N9P C;  2ZEQ A;  2N4F A;  3ZKJ C;  2Z8L A;  3RFZ B;  4W9L A;  4CQN A;  3P4P B;  3UIO B;  3UIN B;  1C76 A;  4YTP B;  5D3D A;  2M56 B;  2D10 A;  3U52 E;  5BMG A;  1VCB A;  1Y56 A;  1M94 A;  4YTN B;  1HTQ A;  1N5W A;  3E56 A;  4HWI B;  4DWF A;  3EC8 A;  1FNV A;  4HEA 1;  4S0R A;  2D5G A;  5IA7 A;  1YX5 B;  2K0P A;  4LNI A;  2WDV B;  2DLB A;  2DHZ A;  4HVB A;  3SR6 A;  2NMQ A;  4IUM B;  2N1V A;  3NY5 A;  1P7F A;  3ZYY X;  5E6O A;  2WQY B;  2KJR A;  1PGB A;  3ZDT A;  4X57 B;  2LGI A;  1V1P B;  2QIL A;  2RGF A;  1J19 A;  3TEY A;  2LEK A;  2LJ5 A;  2UYZ B;  4JX1 C;  2REX A;  4A3P A;  4DXA B;  1EF5 A;  1F2R C;  1WZ3 A;  3W5U B;  2ON8 A;  4KVG B;  4JE3 B;  5JHA A;  3L17 A;  4K81 A;  3L10 B;  1MI0 A;  3AE2 B;  3AED B;  4NAW B;  1AAR A;  1LM8 B;  2KC1 A;  4HRS A;  2K3U A;  5G5H A;  3CWI A;  1ET6 A;  1RWS A;  1NDD A;  3AU4 A;  3RNE C;  1BUI C;  3ZXV A;  1ROE A;  4XE0 A;  1GNU A;  1M4V A;  5IN7 A;  4BKS D;  4EEW A;  3TEW A;  4K7S A;  4JQW C;  4W9J A;  4EUT A;  1N60 A;  2FUH B;  2J4X A;  5GMV A;  4ACF A;  3SEB A;  3VFK A;  5JZE B;  4WJP A;  2ZW0 A;  5CTR C;  3A1Q A;  4TV3 A;  4HK2 A;  3Q3N C;  3BVG A;  3L54 A;  5TSS A;  1OGW A;  5C2T B;  2N0S B;  2RDG A;  1ISN A;  1L6U A;  2JU6 X;  4IM3 A;  3FC4 A;  4FUL A;  4DQO C;  2J7Q B;  3JVZ X;  4GB9 A;  4CO7 A;  1SE4 A;  4TQ1 A;  2K8C A;  1Z5S B;  2DNF A;  3V61 A;  4DXG A;  4KV2 A;  1JWM D;  1E90 A;  3Q3J A;  1V5T A;  1GJZ A;  4IWQ A;  1WJ4 A;  4MT5 A;  3ZVV A;  4WJQ A;  1C4P A;  2KTR A;  4ARC A;  1NI3 A;  1U4A A;  1NI2 A;  1OEY J;  1MFW A;  4YWG G;  2AWT A;  3I57 A;  1RRB A;  3H7P A;  2D3B A;  3FKY A;  3I3T B;  3FIL A;  4XWT A;  2CR5 A;  1IGC A;  2IY0 B;  3O13 A;  3RYT A;  2ZVO A;  5D7G A;  1YN4 A;  2L32 A;  1F2R I;  2RMM A;  3JSV A;  4J3O D;  1D5Z C;  2KVR A;  2MEK A;  1AYF A;  5EE3 A;  3K9P B;  4RCO A;  4WWP A;  3ZTD A;  1HA5 A;  2W3S A;  3RUI B;  3RZF A;  4S17 A;  3U7D A;  1WXV A;  4NNJ B;  3BK2 A;  3FAH A;  1OEY A;  2KWC A;  2LUE A;  3C8Y A;  2QC8 A;  1E5W A;  4IWP A;  2K6Q A;  2QJL A;  3PSE B;  1WSP A;  3KW5 B;  1YIW A;  4BKG A;  2PIA A;  3TSS A;  2IDY A;  3HM3 A;  3LXF A;  1RLF A;  1WWT A;  5BO4 B;  3PZ8 A;  5J17 A;  2KD0 A;  4KIK A;  4QAY A;  3AEB B;  1E7P B;  1KLG D;  3MC0 B;  1SE9 A;  1WFY A;  1ZUD 2;  1MHX A;  2M0X A;  1XO3 A;  2V3S A;  4G0N B;  4DHZ E;  4YXD B;  1SIJ A;  2IGD A;  2O2V A;  1TY0 A;  2WXG A;  2Y3A A;  2XBB C;  1Y8R C;  4DK5 A;  3Q69 A;  1BXT A;  2FCQ A;  4OVV A;  3V3X A;  3ZUN A;  3NHE B;  2J0J A;  1VR9 A;  3B08 A;  4KKI A;  2WS3 B;  3KWV A;  1EU4 A;  3ALB A;  5C3J B;  3NZS A;  4OVU A;  1IBX B;  4KDI C;  1XLO A;  1L0Y B;  5CX3 A;  2IND C;  2KQ7 A;  2JZ3 B;  4D2K A;  2B76 B;  2BQQ A; 
#chains in the Genus database with same CATH homology
 2L00 B;  1C1Y B;  4W9G A;  2V4L A;  3Q3F A;  2PE9 A;  3L0W B;  1E7V A;  3KYC D;  1ZGU B;  2Z0D B;  5C1Z A;  2OJR A;  4NQL B;  4B6W A;  2XK5 A;  2PEA A;  2ZZP B;  3M63 B;  5L95 C;  3ZNZ B;  2KOX A;  1XQQ A;  4PS3 A;  3ECI A;  2RD0 A;  2L0F A;  2KLC A;  3DBS A;  3AI5 A;  3T9L A;  2L8J A;  4LCD E;  2BKF A;  1WMH B;  4NQK E;  2HJ8 A;  1YD8 U;  2ASQ A;  3DVG X;  3V6E B;  1X1M A;  4W9I A;  3WAN A;  1KLV A;  3IHP C;  5LXH A;  1E8Y A;  2MSE D;  4WWN A;  2LVO A;  5IAA C;  3WAO A;  5G55 A;  2IO0 B;  1JRU A;  4MM3 A;  2BYV E;  4FA6 A;  1QZE A;  3TL5 A;  2BPS A;  3LJ3 A;  5DPR A;  2N9E B;  4GOC A;  4MDK E;  2C60 A;  3QX1 A;  3PVL A;  2KFK A;  4MJS B;  3QWZ B;  3DOW A;  4GIV A;  3TCA A;  3WA0 A;  3CST A;  5C23 A;  3PPA A;  3ZNI D;  4KIK B;  4PYU A;  3KH0 A;  1WX7 A;  2WX1 A;  1K8R B;  3PTF C;  2IO1 B;  2KWV B;  3DQV A;  3M62 B;  2KDE B;  3APC A;  3QC8 B;  3U8Z A;  2LVP A;  3UGB B;  2KHW B;  2K1F A;  3A4R A;  4ZRI A;  3ZO5 B;  3R66 C;  2KFJ A;  4ICU A;  1MG8 A;  4MGY E;  1WX9 A;  3SDL C;  3NOB A;  5D6J B;  2JRH A;  3KYD D;  2VRR B;  4HDO A;  2O2V B;  2QHO A;  4JL9 A;  2JPH A;  2EMS A;  2LXC A;  1L2N A;  4II2 B;  4RM8 A;  4WQO B;  4ANX A;  2IYD B;  1IYF A;  4JLC A;  3DDC B;  4RM9 A;  3APD A;  2MQJ A;  2O6V D;  3VTW A;  4YL8 A;  1V2Y A;  4GN1 A;  4XC2 A;  4A20 A;  4URK A;  2NS5 A;  2MA9 B;  2KDF B;  2BF8 B;  2MW5 A;  3L16 A;  3QA8 A;  1XT9 B;  2AL6 A;  4DDG D;  2GBJ A;  2G45 B;  2HTH A;  3VDZ A;  2BGF A;  3TBL D;  1KM7 A;  4HLE A;  1TGZ B;  1WM3 A;  2PE6 B;  2C7H A;  3H6N A;  1WYW B;  2M17 A;  1WGR A;  3CMM B;  2CHW A;  3N32 A;  3OAW A;  5AEK B;  2R2Q A;  4K7U A;  2DYO A;  2NBU A;  2ZNV C;  4PS8 A;  2NPT A;  3PT2 B;  2DZM A;  2LGX A;  1T0Y A;  3WIM A;  4TUU A;  2D11 A;  3KVF B;  3DVN V;  2KDI A;  1WF9 A;  3S2A A;  3TJP A;  1KJT A;  3SHQ A;  1L7Y A;  3OLM D;  2O6V B;  3RCZ A;  1F9J A;  2ZJD A;  4TQ0 A;  1UD7 A;  1I42 A;  1E8W A;  1EUV B;  4JIO U;  4P7I A;  4F8C B;  2KX0 A;  4W9F A;  2KNB A;  3VTU A;  3N30 A;  1GG3 A;  2R2O A;  1S1Q B;  1V86 A;  4HCP B;  3CF6 E;  2XK5 B;  3H9D A;  4K7W A;  4GDK B;  3DBL I;  4GSW A;  3ZNH B;  1WR6 E;  5E6N A;  3QAQ A;  3VQI A;  4MEM A;  2ZCB A;  3C0R B;  2J0K A;  5DCN A;  4FAD A;  3V62 A;  3SU8 X;  5J18 A;  3VUX A;  2KKC A;  4F7Z A;  4WAA A;  2ZNV B;  5LLI A;  2N7E A;  3DBH I;  3GZN I;  3RUL A;  4MSQ B;  4FJZ A;  4BVU C;  1P98 A;  2KN5 A;  3VH4 B;  4K1R B;  1YJ1 A;  3EFU A;  3ZNG C;  4FN2 A;  2YLM A;  3R7Q A;  3DVN U;  2NBW B;  1WGD A;  2BYF A;  1SIF A;  2DAJ A;  4NAW A;  2KMA A;  3VXW A;  2GBM A;  2KFK B;  2CS4 A;  4FLH A;  3TMP B;  4AJW A;  3UF8 A;  2AL3 A;  3WAM A;  4ANU A;  2CHX A;  2N9P C;  2BKR B;  2ZEQ A;  2N4F A;  3ZKJ C;  3HHM A;  4W9L A;  4MEL A;  3KUD B;  3VUY A;  1SGH A;  3UIO B;  2A4Z A;  2WX0 A;  2O6V A;  2JF5 A;  4HPL B;  3L13 A;  3UIN B;  2ZVN A;  4F1S A;  4GDL B;  3QAR A;  4I6P A;  1V5O A;  2D10 A;  2KTF A;  1BT0 A;  1RAX A;  3HK0 A;  4FJV B;  4GDK A;  3M3J A;  3RD2 A;  2BWF A;  1VCB A;  2LGY A;  4I6L B;  1M94 A;  2DYM A;  3A9J A;  3ONS A;  1IPG A;  4BOS C;  2YVC A;  1TZ1 A;  2LZ6 A;  4HWI B;  3ZDM C;  3EC8 A;  2K8B A;  4DWF A;  1WZ0 A;  2JZZ A;  2W9N A;  3PGE A;  3ZW3 A;  1WH3 A;  2KJ6 A;  3PRE A;  4LDT D;  1P9D U;  4M0W B;  4EFO A;  4CYE A;  5IA7 A;  3ENE A;  4AWJ A;  4IC7 B;  1UBQ A;  1YX5 B;  1C3T A;  3ML8 A;  2DHZ A;  2N7D A;  5D94 A;  4HVB A;  4WJN A;  4NY0 A;  4IUM B;  2N1V A;  2LWP A;  2BWE S;  4IWO A;  4LJO B;  3NY5 A;  4DHZ B;  1YX6 B;  1R4N I;  1VD2 A;  2N9X A;  2J0M A;  2EKE C;  4BKT A;  5E6O A;  1WX8 A;  2XEW A;  2KJR A;  2NPT B;  4X57 B;  3ZDT A;  5HKH A;  3VAW A;  4HDQ A;  2IO3 B;  2LXA A;  4I6N B;  1P3Q U;  2NR2 A;  3UQB A;  2RGF A;  1J19 A;  3HM6 X;  4M8N A;  1WJU A;  1UGM A;  3BY4 B;  4GDL A;  4PYZ A;  2L76 A;  2LJ5 A;  2UYZ B;  2B3A A;  2LAS A;  4LDT B;  4KDL B;  5J2R A;  1E8X A;  2D2Q A;  2V1Y A;  1ZKH A;  3ZTC A;  4W9E A;  2REX A;  5CHW A;  4MGI E;  4A3P A;  4DXA B;  2Y5B B;  1EF5 A;  1WZ3 A;  4KZC A;  1WXS A;  4HXD A;  1UZX B;  5KHQ A;  2C7M B;  1WJ6 A;  2C7N B;  3X23 A;  5L83 A;  1UBI A;  4KVG B;  1EF1 A;  4IM2 A;  3A9K A;  1GC7 A;  2FNJ B;  4N9F 4;  3X0W A;  1ZW7 A;  2CHZ A;  5JHA A;  5CHF A;  3L17 A;  4K81 A;  4AUQ C;  2CU1 A;  3L10 B;  3PLU A;  5JHB A;  4MGK E;  2MBE A;  1IP9 A;  1G6J A;  1P1A A;  2EMT A;  2L7R A;  2JRI B;  4FHK A;  2KDB A;  1LQB A;  4NAW B;  3CSF A;  3LDZ E;  2HE7 A;  2LD9 A;  4GXB A;  1E8Z A;  1AAR A;  1LM8 B;  2KC1 A;  1OTR B;  1WE6 A;  4HJK A;  1I35 A;  4G50 A;  4HCN B;  1OQY A;  1NDD A;  2GBR A;  3AU4 A;  5FR6 A;  4W9C A;  2WWZ A;  3A33 B;  4BBN C;  4JGH B;  1GNU A;  3ML9 A;  4DBG A;  4BKS D;  4EEW A;  1GC6 A;  4K7S A;  4JQW C;  4W9J A;  4ZRK A;  4EUT A;  2AYO B;  2FUH B;  1WGH A;  4EOY A;  2KMC A;  5GMV A;  2BYE A;  3A9J B;  2AEH A;  2C5L C;  3VFK A;  2WDT B;  2DZI A;  3WAL A;  5JZE B;  4WJP A;  5CTR C;  3A1Q A;  3PV1 A;  4TV3 A;  1PQS A;  2IY1 B;  2KX3 A;  3QIJ A;  4AOF A;  4ZYN A;  4HK2 A;  3K9O B;  3L54 A;  2FIF A;  3DBR I;  4ZRJ A;  2MCN B;  1J8C A;  2N1W A;  1OGW A;  3RT3 B;  2RR9 A;  3V6C B;  1J0G A;  2K39 A;  2KAN A;  5AZH A;  2MBQ A;  4E3C A;  1WGY A;  4IM3 A;  1ISN A;  3B1L X;  4IW0 A;  3TIX A;  2UWQ A;  2KO3 A;  4FUL A;  2MWS B;  2J7Q B;  3JVZ X;  4GB9 A;  4W9K A;  4GGQ A;  4CO7 A;  4TQ1 A;  2K8C A;  3MTN B;  4J6I A;  1RFA A;  1Z5S B;  2DYB A;  2FCS A;  2MP2 B;  5DPT A;  3W1S C;  3V61 A;  3GOE A;  2JXX A;  3DCG A;  4BOZ B;  3PRZ A;  4MGZ E;  3AU5 A;  3H1U A;  4KV2 A;  1E90 A;  3Q3J A;  1V5T A;  2FCN A;  2KZR A;  2MX2 A;  2Z59 B;  4FHJ A;  1GJZ A;  3NS8 A;  2G4D B;  1WJ4 A;  4IWQ A;  3ZIM A;  4WJQ A;  3ZVV A;  1D3Z A;  2KTR A;  2GMI C;  1V81 A;  3VTV A;  2DEN B;  2D3G A;  1GUA B;  1WRD B;  1WXA A;  3PLV A;  3RZW C;  2LVQ A;  2HD5 B;  2NBV B;  3QCA A;  1U4A A;  2CKH B;  3PRP B;  4E74 A;  1NI2 A;  2KJH B;  1OEY J;  1XD3 B;  4B9K A;  4XX5 A;  2MRP A;  5TR5 A;  1NBF C;  2KLG A;  2AWT A;  2KK8 A;  5AZF A;  2NCN A;  1H8C A;  1RRB A;  2OOB B;  2RPQ A;  1V49 A;  3H7P A;  3NZU A;  3I3T B;  3VUW A;  2LI5 A;  3A9K B;  4M8M A;  3JW0 X;  2FAZ A;  2PJH A;  1WIA A;  2CR5 A;  3JYU A;  3QQ8 B;  3R3M A;  2KWU B;  4GMV A;  4FBJ B;  4NPN A;  3A4S C;  2IY0 B;  3OJ3 A;  4AP4 C;  4EKU A;  1KOT A;  4BKS A;  2JWZ A;  4MH0 E;  3KUC B;  1WJN A;  3RYT A;  2RSU A;  2ZVO A;  5D7G A;  5DPW A;  4W9D A;  4NJ7 A;  1TTN A;  3QJZ A;  2MP2 A;  2IO2 B;  1WI0 A;  2L3Z A;  3N3K B;  1V80 A;  4DHJ D;  2C9W B;  3ZRF A;  2G3Q B;  5AZG A;  1LFD A;  1E7U A;  3IG3 A;  3SD5 A;  3VVW B;  3JSV A;  3PHW B;  4HPM B;  4DDI D;  2K8H A;  2KVR A;  2MLB A;  3UIP B;  3K9P B;  2KC2 A;  4RMA A;  4WWP A;  3ZTD A;  1Q0W B;  4PS7 A;  5G2N A;  3MHS D;  4ANV A;  5KHO A;  3RUI B;  3RZF A;  1Q5W B;  1Z2M A;  2DAF A;  3PS6 A;  3U7D A;  4G3X B;  1WXM A;  3A1Q B;  3IBE A;  1WXV A;  5E6P A;  3VHT C;  4NNJ B;  3W1S A;  2I1J A;  4EZK A;  3DPD A;  4WJO A;  3R7R A;  1OEY A;  2KWC A;  2LUE A;  4DHJ B;  2KQS A;  5LXI B;  2DZJ A;  2Z0E B;  1LXD A;  5CHV C;  2K25 A;  1H4R A;  1WM2 A;  1WMH A;  1E5W A;  2A5U A;  4IWP A;  1Q1O A;  2K6Q A;  3HIZ A;  3L08 A;  3PSE B;  1A5R A;  1FXT B;  2ZCC A;  3U30 A;  2L05 A;  3AXC A;  2ZPN A;  4B95 A;  3EHV A;  3V60 A;  4IM0 A;  3WAP A;  2I1K A;  3KW5 B;  1YIW A;  4CHK A;  5EDS A;  3M95 A;  4KSK C;  2G4S A;  4BKG A;  4II3 B;  4G11 A;  4WWO A;  4GU2 A;  2MBH A;  3HM3 A;  1EO6 A;  4MJS A;  1HE8 A;  1RLF A;  5DPS A;  2KTR B;  4EZJ A;  1WE7 A;  5BO4 B;  3APF A;  2K6D B;  2PPH A;  2M1M A;  5J17 A;  2KD0 A;  3IVF A;  4KIK A;  3B0A A;  3D32 A;  4AJY B;  2MBO A;  2IZV B;  1SE9 A;  1WFY A;  4ASW C;  2M0X A;  4ZDV A;  1UEL A;  3MJW A;  2WYQ A;  4W9H A;  2V3S A;  4G0N B;  4DHZ E;  2NVU I;  4ANW A;  3EEC A;  5D2M B;  2JUO A;  3H7P B;  1WY8 A;  3BIN A;  3PHX B;  3KUZ A;  3PRM B;  2JY6 A;  2O2V A;  4ICV A;  2GOW A;  1Y8R C;  2M4N A;  2XBB C;  4XZ4 A;  1CMX B;  4DK5 A;  4KSL C;  1TBE A;  2FCQ A;  1V6E A;  3H7S A;  2DX5 B;  3O65 B;  4KZ0 A;  4OVV A;  2JVC A;  4FJY A;  3ZUN A;  2LRW A;  3NHE B;  2FID A;  2J0J A;  3DVG Y;  4TKN A;  4BFR A;  2ZPY A;  4E71 A;  4MSM B;  3B08 A;  3QK0 A;  4IG7 B;  2KXJ A;  1WGG A;  3UQA A;  3ZLZ A;  1UH6 A;  4LJP B;  3ALB A;  1R4M I;  2D07 B;  4BBN F;  2MBB B;  3ZRC A;  3NZS A;  4OVU A;  4A3O A;  4EZL A;  2IBI B;  4KDI C;  1WR1 A;  3OJ4 B;  3PZD A;  2L0T A;  2M8S A;  3JSV B;  5CX3 A;  2JT4 B;  2KQ7 A;  2DZK A;  3QHT A;  2FCM A;  1V9J A;  3VH3 B;  3P2B A;  2JZ3 B;  2LGD A;  2GBN A;  3AUL A;  3IFW B;  1S3S G;  5JH5 C;  1P0R A;  4NJ6 A;  2LRU A;  3W1Y A;  2GBK A;  1YQB A;  3T8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...