2L05A

Solution nmr structure of the ras-binding domain of serine/threonine-protein kinase b-raf from homo sapiens, northeast structural genomics consortium target hr4694f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
HMPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase B-raf
publication title Solution NMR Structure of the Ras-binding domain of Serine/threonine-protein kinase B-raf from Homo sapiens, Northeast Structural Genomics Consortium Target HR4694F
rcsb
source organism Homo sapiens
total genus 17
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l05A01
2ZNVC 4WJNA 5C23A 1WJNA 3VHTC 2XEWA 3H6NA 3V60A 2DX5B 2V1YA 2DZKA 3QK0A 5D6JB 2PE9A 4DXAB 2K6DB 4KIKA 4NY0A 1SIFA 3V62A 2IBIB 3BY4B 3QC8B 2KJHB 5DPRA 3VXWA 1E8ZA 1WM2A 3A9KA 4PYZA 2L7RA 5G55A 3IBEA 3PS6A 1TGZB 4BOSC 1V49A 4W9HA 4WJQA 2NS5A 5JH5C 2K39A 3QWZB 3ZNGC 3VUWA 2KZRA 4ASWC 4ANXA 2KK8A 3DPDA 1T0YA 2GMIC 3R66C 3R7QA 1SE9A 4KVGB 2MBHA 1GC7A 3W1YA 4B6WA 4FHJA 4NJ6A 2AL3A 3TJPA 1WR6E 1GJZA 3HM6X 2MBEA 2MQJA 4W9GA 2KOXA 1QZEA 1WXAA 2ZNVB 2C9WB 2N9XA 2BGFA 1WE6A 4TQ1A 3L10B 2GBMA 4KV2A 4BKSD 2LUEA 1WGHA 3RYTA 4EFOA 2IY1B 1NI2A 3NHEB 2KFKA 3OLMD 2FCNA 5HKHA 3N30A 1MG8A 4ANWA 2GBNA 2LWPA 1WI0A 2K25A 3X0WA 4IWPA 1EF5A 2KDEB 3TBLD 2K8BA 2FCSA 3CF6E 3P2BA 3TCAA 4BFRA 3JYUA 4B9KA 4HDQA 3EFUA 4IM0A 3RCZA 4A20A 1WGGA 1WZ0A 3QX1A 5BO4B 1OEYA 4CO7A 3M3JA 2AL6A 3A4SC 3ZTDA 1E7VA 2NR2A 4IG7B 5FR6A 2KFJA 2M17A 1WX7A 4DDGD 2ZEQA 2IO0B 3PREA 3WA0A 2LI5A 4HPMB 4DHJD 4MM3A 4BKTA 2K8CA 4KZCA 4URKA 1WE7A 3A9JA 1Z2MA 2I1KA 3VUXA 2MRPA 3OJ4B 2O6VA 2G45B 4HPLB 3QIJA 4W9CA 3VQIA 1YIWA 2DYMA 4GDKA 4PS7A 1F9JA 3M63B 2FNJB 2BYVE 4I6NB 3PV1A 3SDLC 2LXCA 1WMHA 1Q1OA 1UH6A 3V6EB 1E90A 3DCGA 3PHXB 2JWZA 5L95C 3L16A 1AARA 1WZ3A 3QCAA 4IM3A 3PT2B 1EUVB 2JUOA 3DQVA 2L0TA 2GOWA 3PRZA 3R3MA 1I35A 1V2YA 3L54A 4WWOA 3UIOB 3NS8A 5GMVA 2JF5A 3C0RB 2I1JA 3I3TB 4KSKC 4AUQC 4EOYA 2M0XA 4AJYB 4IUMB 4DHZE 1SGHA 4LDTD 1J8CA 1I42A 2K1FA 2D10A 3VVWB 3WAOA 3GZNI 1NDDA 3GOEA 1P3QU 1OQYA 2G4SA 2N7EA 1H8CA 1X1MA 2HJ8A 1JRUA 3M62B 3ZVVA 2RSUA 2EKEC 1GUAB 2KJRA 1WGDA 3UINB 2IO3B 3VAWA 3ZRCA 3U7DA 1GG3A 4B95A 3PZDA 4TKNA 2J0KA 2XBBC 4KDLB 3ONSA 3UGBB 3B0AA 4GOCA 1WJ4A 3DVNV 1XT9B 3L17A 4MGZE 3TL5A 2O6VD 3ML9A 3VH4B 2K6QA 2D3GA 2J7QB 1K8RB 3X23A 4ANUA 2LVPA 4NQLB 3JSVB 1YX5B 4W9IA 4W9LA 3VTVA 3A33B 1YQBA 2MBQA 3APCA 3EECA 3UIPB 2BKRB 3H9DA 2BYFA 2CHZA 2KN5A 2LJ5A 3PRPB 1UBIA 4IC7B 4I6LB 4CHKA 3ZW3A 2N1VA 5EDSA 5IA7A 3M95A 5AZFA 4FN2A 5D2MB 2DAFA 2O2VB 1KM7A 1E5WA 2AEHA 2KD0A 2M8SA 4KDIC 4MSQB 2UWQA 3VUYA 4BVUC 2JPHA 4E74A 2RD0A 4EEWA 2OOBB 4M0WB 2IZVB 4W9EA 4W9FA 4OVUA 4FADA 2AWTA 1VCBA 4NNJB 3WAPA 1WGRA 2CR5A 2DYOA 4PS3A 4BKGA 4X57B 1U4AA 2KX0A 2KDIA 1P1AA 3D32A 4W9DA 4WWPA 2JRIB 4HXDA 1Z5SB 2YLMA 1ZKHA 4WAAA 3KVFB 4BOZB 1LQBA 3DVGX 5CTRC 4YL8A 5J18A 2D11A 2M1MA 2ZPNA 4HWIB 4XC2A 3V61A 5DPWA 4FULA 2LGYA 3T8MA 1UZXB 5CHVC 2LRWA 3ZTCA 4MEMA 2N1WA 4RMAA 5DPTA 2KJ6A 2ZPYA 2Z59B 2EMSA 1P98A 2Y5BB 1EF1A 4ZDVA 1R4MI 3PHWB 2IYDB 1WYWB 1ZGUB 3RULA 4E3CA 3TIXA 2G3QB 2LRUA 4MJSB 5LXHA 5LXIB 2AYOB 4GDLB 4JGHB 1J0GA 2JVCA 3BINA 3LJ3A 5AEKB 1E7UA 3JVZX 3KUZA 4N9F4 2N9PC 3KW5B 2NPTB 4GMVA 4PS8A 2WDTB 2HD5B 2N4FA 3N3KB 3ZKJC 4DHJB 2DZIA 4FA6A 2N9EB 3DBHI 2J0JA 4MELA 3RZFA 2JZZA 3DBRI 4ICVA 4A3OA 2KDBA 3T9LA 1TZ1A 2J0MA 2YVCA 3LDZE 2QHOA 1R4NI 1YJ1A 2C7NB 2C7HA 4K7UA 4AWJA 1V86A 4KZ0A 4DK5A 2D07B 2DZJA 4ANVA 4AOFA 1Q0WB 1IPGA 4RM8A 1L7YA 4XX5A 2ZCBA 3RT3B 1RLFA 1Y8RC 2KXJA 2JXXA 5L83A 1ZW7A 4EKUA 3ECIA 1GNUA 1V9JA 3IHPC 3JW0X 4ICUA 1Q5WB 2ZCCA 3NY5A 1A5RA 1RFAA 1OEYJ 1WXSA 2KQ7A 3JSVA 2VRRB 4FHKA 3NZUA 4FLHA 4I6PA 1EO6A 3B08A 3KYDD 4F7ZA 4AJWA 3MJWA 2ZVNA 4HJKA 3A1QB 2KMCA 2V4LA 2ASQA 2ZJDA 3EHVA 3ZUNA 2MBBB 1WF9A 2KTFA 2OJRA 4OVVA 4LDTB 4F8CB 2C5LC 2O2VA 4FJYA 2KVRA 5DPSA 3OJ3A 4GGQA 1V5TA 1RAXA 3WIMA 2KHWB 1V6EA 3NZSA 3AU4A 1E8YA 4M8MA 3QQ8B 1GC6A 2WX0A 1UBQA 4G11A 3ZNID 1WFYA 2CHWA 2GBRA 1S1QB 1WX9A 4GU2A 3KUDB 4FJZA 2KTRB 4WQOB 2MSED 1PQSA 2JT4B 2RGFA 3ZLZA 2ZVOA 3DDCB 3RUIB 2C7MB 4W9JA 4DDID 4GSWA 2CS4A 3QA8A 2PEAA 3VDZA 2FAZA 3A4RA 3QAQA 1WGYA 2NBVB 4NAWB 5KHQA 2XK5B 2DHZA 2L0FA 1E8WA 2L05A 4IWQA 4PYUA 5E6PA 3WAMA 4MH0E 4BKSA 3APDA 5D7GA 3EC8A 3KH0A 3QARA 3W1SA 3W1SC 3UF8A 3B1LX 2MP2B 2MBOA 3UQBA 1BT0A 3Q3FA 2L3ZA 1OTRB 2DAJA 3MTNB 4HDOA 2NBWB 3PVLA 4KSLC 3SHQA 3CSFA 1XQQA 2LXAA 3KYCD 2KMAA 2KO3A 2KWUB 4MJSA 2CU1A 4GDLA 4LJOB 4NQKE 4RM9A 2DENB 1C1YB 4XZ4A 5CHWA 1WJ6A 2IO1B 2JRHA 3WALA 1G6JA 2LVQA 5DCNA 2HE7A 2NPTA 4WWNA 4ZRIA 2IY0B 1UD7A 4LJPB 1UGMA 2C60A 5JHAA 2D2QA 2FIDA 3APFA 4GIVA 2K8HA 4NJ7A 3ZIMA 1OGWA 1TBEA 1S3SG 2BF8B 2BKFA 2JZ3B 4HCNB 4JLCA 2EMTA 4BBNF 3H7PB 2WX1A 2WWZA 2BWES 2LGXA 3L0WB 4HK2A 4MGKE 3VTWA 4DBGA 4HLEA 1XD3B 2CHXA 4WJPA 1HE8A 4A3PA 4IW0A 1IP9A 2MWSB 5D94A 2LZ6A 1WY8A 5E6OA 2MX2A 4EZJA 4G50A 2LD9A 4WJOA 4II3B 2G4DB 3PGEA 5JHBA 4J6IA 2FCQA 4KIKB 4BBNC 1P9DU 2FCMA 2KWCA 2BPSA 4K1RB 1V80A 3A1QA 2B3AA 4P7IA 2KQSA 5AZGA 3DVGY 1M94A 1WXVA 2PJHA 3HK0A 3DBSA 1UELA 3Q3JA 1WXMA 1WX8A 2R2QA 3PSEB 3A9KB 2KDFB 1V5OA 2KANA 1P0RA 3H7SA 4II2B 2Z0EB 2N7DA 2NCNA 3KUCB 4G0NB 5IAAC 3ZNZB 1VD2A 5KHOA 4LCDE 4TV3A 1L2NA 5CHFA 5LLIA 5J2RA 3RZWC 5J17A 3OAWA 3IVFA 2NBUA 3CSTA 3V6CB 4EZLA 3PPAA 2A5UA 1ISNA 3AXCA 3WANA 4G3XB 3ZNHB 4JL9A 4ZRKA 2KTRA 3R7RA 2FIFA 3DBLI 3S2AA 4IM2A 3ZO5B 4EZKA 1WJUA 4DHZB 2DZMA 2LVOA 1WH3A 3DVNU 4MSMB 1KOTA 3DOWA 2LGDA 2MW5A 4IWOA 3PTFC 3AULA 4MGYE 4E71A 1NBFC 1TTNA 3IG3A 4NAWA 2L76A 3VFKA 2MA9B 4EUTA 3RD2A 1LM8B 4JQWC 2XK5A 3N32A 2L8JA 2FUHB 2KLGA 4MGIE 2A4ZA 3UQAA 5CX3A 4M8NA 2KFKB 2WYQA 2NVUI 1WRDB 2CKHB 2JY6A 2RR9A 2MP2A 2R2OA 4FJVB 4K7SA 2PE6B 1WM3A 3ALBA 2KX3A 5AZHA 2L00B 3L08A 1WIAA 4W9KA 2BWFA 4ZYNA 5C1ZA 1J19A 4FBJB 3H1UA 4GXBA 3CMMB 4MDKE 5JZEB 2RPQA 2MLBA 1C3TA 3AI5A 2ZZPB 2KNBA 3NOBA 2IO2B 4HVBA 3ENEA 4NPNA 2KLCA 2UYZB 4TUUA 3O65B 3HHMA 3ML8A 3TMPB 4CYEA 1WR1A 1E8XA 3SD5A 2W9NA 2MCNB 3AU5A 3HIZA 3MHSD 4K7WA 4DWFA 4AP4C 1LXDA 5TR5A 4JIOU 2KKCA 1IYFA 2V3SA 3ZDTA 2BYEA 3VTUA 3QJZA 3A9JB 3L13A 3PLVA 3U8ZA 1LFDA 1YX6B 1FXTB 5G2NA 3VH3B 2O6VB 1KLVA 1YD8U 2GBKA 3PLUA 2Z0DB 3K9OB 4GB9A 1KJTA 1CMXB 2KC1A 2GBJA 3ZDMC 4K81A 1H4RA 1V81A 3H7PA 3SU8X 2KWVB 3IFWB 4GN1A 3HM3A 3ZRFA 4TQ0A 4GDKB 2PPHA 3PRMB 2HTHA 2DYBA 1RRBA 3QHTA 2M4NA 3U30A 4F1SA 4HCPB 3K9PB 1D3ZA 2LASA 2KC2A 1WMHB 5E6NA 4ZRJA 2REXA
chains in the Genus database with same CATH superfamily
4WJNA 2WXRA 2DZKA 3OWEB 2V3PA 2K6DB 3V62A 4OVZA 2IBIB 3BY4B 2KJHB 1TS4A 3VXWA 3PS6A 3URYA 4W9HA 2VZKD 2PMVA 5JH5C 1JROA 2K39A 2L1AA 1GC7A 4NJ6A 1QOAA 2MQJA 2ZNVB 1F1HA 1ZXHA 4EFOA 2IY1B 1XF5L 2W55A 3BVZA 3N30A 1MG8A 4ANWA 4Q2JA 4HRSA 1C76A 1EF5A 4ACFA 3TCAA 4BFRA 4B9KA 1WGGA 3QX1A 5BO4B 1OEYA 4LTUA 3AE5B 2NR2A 4ZRPA 1C4AA 4REZA 2KFJA 1WX7A 3PREA 4DHJD 2LUMA 4BKTA 4KZCA 2V0GA 1WE7A 3DBLB 3PO0A 3VUXA 2MRPA 2WGSA 2O6VA 5H92C 1L4DB 2WDVB 3VQIA 1SJHD 2DYMA 4RF0A 4GDKA 4PS7A 1F9JA 5I4DA 4JWUC 2D3AA 3PHXB 2JWZA 3I5JC 3DQVA 2L0TA 1I35A 1V2YA 4WWOA 3NS8A 4NAMA 3ZJVA 4JE3B 1N60A 4ARIA 4NJCA 2N0SB 1NDDA 3GOEA 1P3QU 1OQYA 3Q8FA 1H8CA 3AECB 2HJ8A 3DWMA 3M62B 3GB1A 3ZVVA 3RI7C 1E9MA 3VAWA 2IO3B 3ZRCA 4K3BA 5BYSA 1SB3C 2J0KA 1TYGB 3UGBB 3B0AA 3VH4B 4J3OD 2K6QA 3DHIC 1C4CA 1ZE3D 4MT5A 1I4PA 1YX5B 4W9IA 2MBQA 3APCA 3J9CA 4RF1A 1L6UA 5HFYA 3PRPB 2LJ5A 2N1VA 3M95A 1OQRA 2AEHA 4KDIC 2UWQA 4S0RA 1EU3A 2VZKB 1WGKA 5MPOA 4CQNA 2CR5A 5BMIA 2JYTA 5C2TB 2KDIA 3D32A 4W9DA 4HEA1 2BTEA 2YLMA 3NVYA 1IUEA 4BOZB 1LQBA 1VRAB 5J18A 1FEHA 1JWBD 4P16A 3DHGC 5D3DA 4HWIB 4XC2A 1C78A 5DPWA 3SFEB 1UZXB 3MC0B 2N1WA 4RMAA 2KJ6A 1EWYC 4XYCA 2EMSA 1V8CA 3IT4B 2ON8A 2IYDB 1WYWB 2G3QB 2ACZB 5LXIB 2Y3AA 4GDLB 4JGHB 3BINA 3JVZX 3B2GA 3CIRB 2NPTB 5EE9A 2HD5B 4DHJB 3DBHI 3R8BA 2JZZA 3T9LA 1TZ1A 3V3XA 2QHOA 1R4NI 2C7NB 2QC8A 2Z8LA 4DK5A 3P4QB 1IPGA 1L7YA 2KXJA 3AB5A 3O13A 1XLPA 3TEZA 2ZCCA 1RFAA 2KQ7A 4YWGG 4FHKA 4FLHA 2I2YA 1VR9A 2CJOA 4F7ZA 3AEFB 4F8CB 4FJYA 4KKJA 3FILB 4JPSA 1C77A 1V6EA 2KT7A 3NZSA 3U2SC 1E8YA 4M8MA 5FK9C 4C00A 1QOFA 1WFYA 5G5GA 1NEKB 3KUDB 1NYRA 2RDHA 4WQOB 1L0VB 4C4VB 1FFUA 3DDCB 4KGSA 3QA8A 5E6JA 4PK1A 1PDXA 1YJIA 4PYUA 2HTME 4MH0E 4BKSA 5D7GA 3QARA 3W1SA 3UF8A 3B1LX 2MBOA 3UQBA 2L3ZA 2DAJA 1TY0A 3PVLA 4P6VF 2OEDA 2KMAA 3SR6A 3AE7B 4LJOB 4MH8A 4NQKE 5EE1A 5CHWA 3WALA 2IY0B 2C60A 1TY2A 4NJ7A 2D3CA 1Y56A 1TBEA 2BKFA 4YTNB 4B0EA 4HCNB 4JLCA 2WWZA 1J7AA 2LGXA 3P4PB 3TUOA 2CHXA 1JWAD 2LZ6A 1FXAA 4EZJA 2JQRB 3ZYYX 3NRZA 2G4DB 1FXIA 1OFFA 1QOBA 4J6IA 4BBNC 3Q69A 1MPEA 2BPSA 3A1QA 4ANVA 5AZGA 4XX5A 3MC9A 3PSEB 2KACA 1P0RA 2Z0EB 1YMHE 2N7DA 3KUCB 4XDDA 5IAAC 1I4QA 1L2NA 1VZ6A 5CHFA 5J2RA 1FMAD 1J7BA 1VZ8A 4FXCA 2A5UA 1IGDA 1ISNA 3AXCA 4G3XB 4OHJA 3ZNHB 2KTRA 2OJWA 3R7RA 1FRDA 3DBLI 1XCQL 4IM2A 1WJUA 4DHZB 2MW5A 2KAJA 1PGAA 1TTNA 2INPE 4MGIE 1XCTL 3Q3MC 2WYQA 2RR9A 3N20C 3ALBA 2L00B 1F2RC 2WXQA 4ZYNA 2BWFA 1J19A 1ZOYB 2WU2B 2L32A 2ZZPB 3EGRA 1T3QA 5H8YE 3RPFC 4HVBA 1UWMA 4ZRQA 3SD5A 2PTLA 2W9NA 3Q3OC 3ZDTA 2BYEA 1C4PA 2JX5A 1NENB 1N63A 3PLVA 2Y5PA 1FNWA 1FRRA 1HEZE 2O6VB 1TIFA 2GLSA 4K81A 1V81A 2BS2B 3H7PA 2DWQA 4GN1A 2WXPA 4TQ0A 4GDKB 1SE3A 3QHTA 3IXSA 4JWSC 4KZ0A 1EU4A 5C23A 3VHTC 2XEWA 3H6NA 2V1YA 3QK0A 1TKEA 3QC8B 2CJNA 3BVMA 1E8ZA 3A9KA 2L7RA 2E3TA 4LNFA 3IBEA 1NVID 1TGZB 1V49A 1DOIA 4OZBA 2LGSA 3ETRA 3QWZB 4ANXA 2KK8A 3DPDA 4S17A 2GMIC 3W1YA 3IAS1 2JSVX 4HJGE 2WXOA 4FHJA 3TJPA 1GJZA 3HM6X 5D3IB 4W9GA 2KOXA 1WXAA 4KGTA 3KWVA 4MACA 1L5PA 2BGFA 3SEBA 1RM6C 2W3SA 2GBMA 4KV2A 4BKSD 2LUEA 3RYTA 2V9HA 3RMKC 4JX1C 1K50A 2KFKA 3OLMD 4AQ7A 2BVCA 1WI0A 2R61A 2KDEB 4WAFA 2K8BA 4YT0B 2FCSA 1VDVA 3EFUA 3RCZA 2K22A 3M3JA 2AL6A 3ZTDA 3H8HA 1ROEA 4GLSC 4DDGD 2LI5A 4HPMB 4MM3A 2ZW0A 4URKA 3I57A 2GB1A 2I1KA 3FAHA 1KH0A 3W5VB 1T6BX 1JMLA 2INNE 4HPLB 1TKGA 4WURA 2BYVE 2IGGA 1FNVA 1WZ3A 3QCAA 4D2KA 3R3MA 2GOWA 3UIOB 3SFDB 3AEEB 3C0RB 4KSKC 4EOYA 1CZPA 5BYQA 4AJYB 1GB1A 4LDTD 4K3CA 4ZOHC 3N1YC 1PGXA 2G4SA 1I4HA 4US8A 2RSUA 2KJRA 1GUAB 1GG3A 3RFZB 3PZDA 4KDLB 3KWLA 1N61A 1WJ4A 3DVNV 1XT9B 4MGZE 2RDBC 3ML9A 2J7QB 1HTQA 3BYYB 2K5PA 1GPXA 3W5UB 3GE8C 2BKRB 1VZ7A 2CHZA 4ITKA 1UBIA 4IC7B 3ZW3A 2K3UA 5IA7A 5AZFA 4FN2A 5D2MB 1KM7A 4MSQB 1TS5A 2KD0A 4UDUC 1CQVA 4L23A 5IKCM 1T0QC 2RD0A 1WXQA 2IZVB 4W9EA 1KFYB 5IOIA 2AWTA 1VCBA 4ZYSA 3NZ3A 4WH4A 2IGHA 4PS3A 3P1MA 5HI1A 4BKGA 1U4AA 4RGTA 2JRIB 5FKAC 1Z5SB 4YL8A 3RN9C 2AX5A 2EKIA 3MC8A 2LGYA 5CHVC 4A90A 2WLBA 3ZTCA 2ZPYA 2Z59B 4ZDVA 4C7ZA 3Q6BA 2LRUA 2WDQB 1R4MB 2AYOB 1F0ZA 2W82A 2JVCA 2KYWA 1UWXA 1E7UA 3EA6A 4GMVA 2WDTB 2DZIA 4FA6A 1FIQA 2J0JA 4AS1A 3RZFA 1CJEA 4ICVA 1AN8A 1YJJA 2KDBA 2J0MA 3LDZE 2BYTA 2X8XX 4K7UA 4TSSA 1ET9A 4ZHPA 4AOFA 2ZCBA 3RT3B 5L83A 3NVVA 1CK1A 1ZW7A 1PGBA 3ECIA 1GNUA 4M00A 1V9JA 3JW0X 1SJED 1ZDXA 2JYEA 4I6PA 4USAA 4AJWA 3MJWA 2ZVNA 3A1QB 3ZUNA 1JWSD 2MBBB 2KTFA 2OJRA 4LDTB 2C5LC 2O2VA 4C80A 1SF0A 1P7EA 4GGQA 1V5TA 1BXTA 1I7HA 2BS4B 4HKQA 3AU4A 3GZNB 3QQ8B 1STEA 4G11A 3ZNID 2KTRB 3WCQA 1D5MC 2FUG1 1ET6A 1QQRA 1KF6B 4W9JA 4DDID 1KRHA 2FAZA 3QAQA 2NBVB 3AN1A 2DHZA 2L0FA 1E8WA 2WNMA 3BIID 3APDA 3EC8A 3W1SC 1XEEA 3MTNB 4HDOA 3SHQA 4HROA 1NYQA 2LXAA 4IKGA 2CU1A 4OZAA 3TSSA 2BW2A 1WJ6A 2IO1B 5DCNA 4WWNA 4ZRIA 4A6QA 1UD7A 3APFA 2K8HA 3ZIMA 3BZDB 2BS3B 2LFIA 3H7PB 1FNUA 1RYJA 3L0WB 4DBGA 1XD3B 1D5XC 1AYFA 4XGAB 1JCKB 4A3PA 3T3NA 1IP9A 2Q5WD 5D94A 1E7PB 3ZXRA 2H89B 2QILA 4G50A 2LD9A 1QF6A 3PGEA 1B1ZA 1P9DU 2FCMA 4K1RB 1V80A 1PUTA 2KQSA 3Q3JA 3DVGY 1WXVA 2PJHA 2Y5CA 3HK0A 1UELA 5J17A 1WXMA 1WX8A 5TSSA 3A9KB 2KDFB 4HLEA 4II2B 3H7SA 2NCNA 3ZNZB 1VD2A 5KHOA 2WXNA 4LCDE 3MHZA 3OAWA 2NBUA 5HG2A 3PPAA 1FO4A 1YN5A 2ICIA 4JL9A 1N5WA 2FIFA 3NUHB 3NG0A 1FFVA 4HKZE 2DZMA 1WH3A 3ZQ4A 2J4XA 2LMCA 2WXKA 4E71A 4NAWA 2L76A 3TEXA 2MA9B 4EUTA 2L8JA 2FUHB 3R2IA 1HQRD 4C56C 4M8NA 2KFKB 2FE8A 2NVUI 2R2OA 1ZXIA 4FJVB 4YSXB 1WM3A 2KX3A 3GE3C 3Q3NC 1LO5D 1WIAA 4W9KA 3TEYA 4FBJB 4MDKE 2LGIA 2RPQA 3ZXVA 3AI5A 2KNBA 3NOBA 4TUUA 3ML8A 2QEJC 1WR1A 1E8XA 2MCNB 3HIZA 3MHSD 2LJIA 4DWFA 1LXDA 4MM3B 5G2NA 5LNK1 3VH3B 1TS3A 1KLVA 1YD8U 3MP9A 2WXMA 3PLUA 2BT6A 2GBJA 2PIAA 3ZDMC 2RDGA 3ZRFA 2HTHA 1RRBA 1D3ZA 1HXYD 2LASA 5E6NA 1YOVB 2JU6X 3RNBC 3V60A 2DX5B 2QJLA 5D6JB 2YEPB 4NY0A 1SIFA 3KLSX 3RNGC 1WM2A 1RWSA 1E10A 2NS5A 4YSZB 1T0RC 4US9A 3VUWA 3R66C 4KVGB 4LNIA 1V1OA 1YN4A 2AL3A 1ZPSA 4R3DA 1IBXA 2V3NA 3AE9B 4TMAB 2ZW1A 1PYWD 2M19A 4TQ1A 1WGHA 1B9RA 1NI2A 3NHEB 5HKHA 2FCNA 2BB5A 1R7SA 2GBNA 3X0WA 4IWPA 3MFGA 3TBLD 3JYUA 4HDQA 4A20A 1WZ0A 1E7VA 1ACCA 1SE4A 5FR6A 1MJDA 1MHXA 2IO0B 2ZEQA 2K8CA 4YTMB 3A9JA 2IDYA 2G45B 1DOXA 1GOZA 3QIJA 1UUPA 2FNJB 3PV1A 1I4RA 1FCCC 1Q1OA 1UH6A 2INCC 3DCGA 5L95C 3L16A 2JUOA 3PRZA 5EE0A 2WP9B 3NVWA 2JF5A 3I3TB 4AUQC 2BQQA 4N6EB 2M0XA 4N58A 1UNSA 4DHZE 5BMHA 2LHDA 1SGHA 2K9XA 2AQ3B 2G9HD 3WAOA 3GZNI 1JWUD 3W2DA 2N7EA 2V4IB 4BZAA 2EKEC 4B95A 1TS2A 3HVZA 3U7DA 1N5XA 4TKNA 2XBBC 2X38A 3ONSA 1T0SC 3HRDD 3L17A 2WS3B 3TL5A 2D3GA 3X23A 1K8RB 3AEAB 3P4SB 4ANUA 4NQLB 2IGDA 3A33B 1YQBA 3EECA 3DHHC 4CHKA 4I6LB 2J42A 2O2VB 2M8SA 1TT5B 3VUYA 2JPHA 2KQ4X 4LK0M 4E74A 4EEWA 1SXTA 4YSYB 3WAPA 2M0AA 3V05A 3AV8A 4X57B 2KX0A 1P1AA 4WWPA 2KVZA 4HXDA 1ZKHA 4WAAA 2LEKA 2MHJA 5CTRC 1N62A 2AQ1B 2ZPNA 3BVGA 3V61A 3DWGC 4FULA 2PLPA 2J53A 1HTOA 4MEMA 5DPTA 2N9KA 1P98A 4P1BC 2Y5BB 4WQMA 3AE3B 1ZGUB 4E3CA 3TIXA 3CWIA 1FCLA 1EWCA 4BAXA 5LXHA 2M56B 1JW9D 1J0GA 3LJ3A 2J52A 4N9F4 4PS8A 3ZKJC 2N9EB 1TZOA 4MELA 4RFBA 4A3OA 1J7CA 3DBHB 4AWJA 5AUKA 5IN7A 1LGRA 1SE2A 4RM8A 1RLFA 1Y8RC 2JXXA 2BBCA 4EKUA 4ICUA 1Q5WB 3NY5A 1OEYJ 3JSVA 1EO6A 3KYDD 1YQ3B 1UGJA 3AE1B 2KMCA 2V4LA 2ASQA 2ZJDA 1YQ4B 2UU7A 2QDFA 3EHVA 2KVRA 5DPSA 1A70A 5BMGA 2KHWB 5IP4D 1C9FA 3AEDB 4M0WA 1GC6A 2GBRA 1S1QB 1WX9A 1KTKA 3LB8C 4FJZA 1PQSA 2JT4B 2RGFA 4RGMA 3ZLZA 2ZVOA 2C7MB 3NVZA 4GSWA 2CS4A 2PEAA 1I4GA 1WGYA 4NAWB 2L05A 5E6PA 2N7JA 1XO3A 1F2RI 3BWUD 4WIPA 1BT0A 2RPVA 1E0ZA 3AEBB 3CSFA 2SAKA 2KWUB 4MJSA 4RM9A 1MFWA 2DENB 3N9YC 1RFKA 2JRHA 2WXIA 1MI0A 2LVQA 2HE7A 3B2FA 3Q8EA 4LJPB 2FIDA 4GIVA 1L0XB 1OGWA 1S3SG 4LNKA 4XWWA 2EMTA 1TJEA 1HA5A 4MGKE 3VTWA 4DXGA 2W3RA 4KGRA 4IW0A 1ESFA 2SEBD 1WY8A 2G1EA 5E6OA 4WJOA 3MJ5A 1NI3A 4OZCA 5JHBA 3Q8CA 4YTPB 2RMMA 3LYYA 2MJEA 5IO9A 2N9LA 4PT5A 4TV3A 5LLIA 3RZWC 2L52A 3IVFA 3V6CB 1SBBB 2MEKA 1QOGA 3WANA 3DBRB 2LHEA 4ZRKA 2HJ1A 2PW9A 4XDCA 4EZKA 4WWMA 3DVNU 3R2TA 5JXVA 4OW0A 1QLBB 1IBXB 3DOWA 4NZLB 1AW7A 3PTFC 3AULA 4MGYE 1NBFC 2XN9C 2OHFA 4RGOS 2XK5A 2AQ2B 2KLGA 2A4ZA 5CX3A 1WRDB 2CKHB 2JY6A 3W9CB 2MP2A 2PE6B 2NTSA 1WSPA 3AE2B 5C1ZA 3H1UA 1XLNA 2MLBA 1C3TA 4XE0A 3ZJUA 2JZPA 1C79A 2IO2B 4LNOA 4NPNA 1SIJA 3TMPB 4CYEA 3Q14C 1VJKA 3AU5A 4K7WA 5TR5A 4JIOU 2KKCA 2WXGA 3QJZA 3A9JB 3L13A 1LFDA 3OG5A 3K9OB 1E6EB 1CMXB 3SU8X 3HM3A 1Q10A 2DYBA 2WQYB 4HCPB 3U7ZA 3AM9A 2KC2A 3T3OA 4ZRJA 2Z0DB 4N59A 2ZNVC 5C3JB 1WJNA 1DGJA 3ZGZA 2PE9A 4DXAB 1ZDVA 4KIKA 5DPRA 1L4ZB 4PYZA 5G55A 4BOSC 1ZUD2 4WJQA 3ZNGC 2KZRA 4ASWC 1T0YA 4YXDB 3R7QA 1SE9A 2MBHA 2D5GA 3VR9B 4B6WA 2WXJA 4A9AA 4XWTA 3RNEC 1XLOA 1WR6E 2MBEA 1D6EC 1HZ6A 1F52A 1QZEA 5AUIA 3P63A 3U4EG 2C9WB 2N9XA 1WE6A 3L10B 1XLQA 2JWUA 2QMTA 1ZP0B 2LWPA 2K25A 4QAYA 1GB4A 1L0YB 1K53A 1V1PA 1K51A 3CF6E 3P2BA 4IM0A 3AE6B 4CO7A 1D5ZC 3A4SC 4IG7B 3Q8AA 2M17A 1QKZA 3WA0A 4ARCA 2CU3A 1Z2MA 3OJ4B 3AMZA 3C19A 2INDC 2IJ0A 4W9CA 1YIWA 3M63B 4I6NB 3U52E 4ZHOA 3SDLC 4HPPA 2LXCA 4L2YA 1WMHA 3V6EB 1E90A 2GI9A 1UF0A 1PFDA 1AARA 4IM3A 3PT2B 1EUVB 3IAM1 3L54A 5GMVA 2I1JA 4H2AA 1M4VA 2WDRB 1SEBD 4IUMB 2VH2A 1BUIC 2I38A 1J8CA 1I42A 2QIEB 1MHHE 3P42A 2K1FA 2D10A 3VVWB 2EELA 5FR3A 1JQ4A 1X1MA 5EE3A 3VRBB 1JRUA 3UINB 1WGDA 3ABVB 2WXLA 4GOCA 1JALA 1MG4A 2O6VD 2LVPA 1WYGA 3B9JA 2KWDA 3JSVB 4W9LA 3VTVA 3UIPB 3H9DA 3AH7A 1L6VA 2WXFA 2BYFA 1KLGD 1KLUD 3HUIA 2DBYA 2KN5A 5EDSA 4KX6B 2DAFA 1E5WA 4BVUC 3PZ8A 2BB6A 2PVGC 1GAQB 2PVOD 3AE4B 2OOBB 4M0WB 4EE2A 4W9FA 4FADA 4OVUA 4NNJB 1WGRA 2DYOA 3E56A 2JXTA 3UI3A 2MJ3A 3KVFB 3DVGX 3Q2AC 2D11A 2M1MA 4M01A 4P1CC 3T8MA 5T8IA 1HZ5A 4RGNA 2LRWA 1N6ZA 4RH6A 1EF1A 3LXFA 3FKYA 3RNFC 1R4MI 3PHWB 3RULA 1XXGA 4MJSB 2WU5B 5AEKB 2HDEA 3KUZA 2N9PC 3KW5B 2H88B 2N4FA 3N3KB 1D4BA 2KMMA 1AWDA 2TSSA 3DBRI 1QT9A 2YVCA 1YJ1A 2C7HA 1FPYA 1V86A 2B76B 2W54A 3VR8B 2D07B 2DZJA 1Q0WB 3VRAB 3IHPC 3P4RB 1A5RA 1WXSA 2KN4A 2VRRB 3NZUA 3AEGB 3B08A 3I63C 5G5HA 3RNAC 4HJKA 2ONQA 2WXHA 1OQQA 1WF9A 4OVVA 3OJ3A 3EUB2 1EM7A 2GRIA 4B0MA 1RAXA 2K0PA 3WIMA 3I9V1 1DYQA 2E6XA 3E9SA 1SSNA 2WX0A 1UBQA 2CHWA 4GU2A 1MVKA 3GS2A 2MSED 3RUIB 3NJTA 3VDZA 3A4RA 5KHQA 2XK5B 3WAMA 4IWQA 1F77A 3KH0A 3BK2A 1I4XA 2MH7A 2MP2B 3HVDA 3Q3FA 1OTRB 2NBWB 4O1NA 1YNTE 1WRIA 4KSLC 1FM0D 1FD6A 1XQQA 2QCZA 3KYCD 2KO3A 2PKOA 1P7FA 3EFCA 4GDLA 1C1YB 4XZ4A 1IGCA 4RNAA 1G6JA 2NPTA 4IOIE 1UGMA 5JHAA 1DOYA 2D2QA 2NTTA 2BF8B 4A55A 2JZ3B 4BBNF 1JWMD 1BMLC 2WX1A 2BWES 1WWTA 5GXGB 3TEWA 4DQOC 4HK2A 3IT6B 3N1XC 4WJPA 1HE8A 4A8XC 2MJDA 2MWSB 4C7YA 2MX2A 3AE8B 4M02A 3KQ4A 4II3B 2QSDA 1V97A 2FCQA 1YN3A 4IDIA 2WHIA 2KWCA 4KIKB 3L4PA 2B3AA 4P7IA 1M94A 4L1BA 3DBSA 2R2QA 5HHDG 1V5OA 2KANA 1T5XD 4LLGM 4G0NB 2NMQA 2DNFA 3FILA 3FC4A 4EZLA 3CSTA 1JRPA 2L83A 2DLBA 2KDMA 4RCOA 3NS1A 1R4NB 3ZO5B 2FBWB 3S2AA 4C4VA 2LVOA 4MSMB 1KOTA 2LGDA 4IWOA 3IG3A 3VFKA 3N1ZC 3RD2A 1LM8B 2YEPF 4JQWC 3N32A 1K52A 3UQAA 3PZ7A 1VLBA 4K7SA 5AZHA 3L08A 2VH1A 2IPKD 1V1PB 3GP7A 2XNAC 3CMMB 4GXBA 5JZEB 3C8YA 1ENFA 3ENEA 2KLCA 3Q8BA 2UYZB 3O65B 3HHMA 3ZJTA 3BK1A 3BYTB 5BYRA 4AP4C 1IYFA 2D3BA 2V3SA 3VTUA 3U8ZA 4LNNA 1YX6B 1FXTB 4DXFA 2GBKA 4GB9A 1KJTA 2KC1A 1H4RA 2KWVB 1TKYA 3IFWB 2PPHA 3PRMB 1QILA 3U30A 2M4NA 3K9PB 4KKIA 3RNCC 1WMHB 4F1SA 2REXA
chains in the Genus database with same CATH topology
2ZNVC 4WJNA 5C23A 1WJNA 3VHTC 2XEWA 3H6NA 3V60A 2DX5B 2V1YA 2DZKA 3QK0A 5D6JB 2PE9A 4DXAB 2K6DB 4KIKA 4NY0A 1SIFA 3V62A 2IBIB 3BY4B 3QC8B 2KJHB 5DPRA 3VXWA 1E8ZA 1WM2A 3A9KA 4PYZA 2L7RA 5G55A 3IBEA 3PS6A 1TGZB 4BOSC 1V49A 4W9HA 4WJQA 2NS5A 5JH5C 2K39A 3QWZB 3ZNGC 3VUWA 2KZRA 4ASWC 4ANXA 2KK8A 3DPDA 1T0YA 2GMIC 3R66C 3R7QA 1SE9A 4KVGB 2MBHA 1GC7A 3W1YA 4B6WA 4FHJA 4NJ6A 2AL3A 3TJPA 1WR6E 1GJZA 3HM6X 2MBEA 2MQJA 4W9GA 2KOXA 1QZEA 1WXAA 2ZNVB 2C9WB 2N9XA 2BGFA 1WE6A 4TQ1A 3L10B 2GBMA 4KV2A 4BKSD 2LUEA 1WGHA 3RYTA 4EFOA 2IY1B 1NI2A 3NHEB 2KFKA 3OLMD 2FCNA 5HKHA 3N30A 1MG8A 4ANWA 2GBNA 2LWPA 1WI0A 2K25A 3X0WA 4IWPA 1EF5A 2KDEB 3TBLD 2K8BA 2FCSA 3CF6E 3P2BA 3TCAA 4BFRA 3JYUA 4B9KA 4HDQA 3EFUA 4IM0A 3RCZA 4A20A 1WGGA 1WZ0A 3QX1A 5BO4B 1OEYA 4CO7A 3M3JA 2AL6A 3A4SC 3ZTDA 1E7VA 2NR2A 4IG7B 5FR6A 2KFJA 2M17A 1WX7A 4DDGD 2ZEQA 2IO0B 3PREA 3WA0A 2LI5A 4HPMB 4DHJD 4MM3A 4BKTA 2K8CA 4KZCA 4URKA 1WE7A 3A9JA 1Z2MA 2I1KA 3VUXA 2MRPA 3OJ4B 2O6VA 2G45B 4HPLB 3QIJA 4W9CA 3VQIA 1YIWA 2DYMA 4GDKA 4PS7A 1F9JA 3M63B 2FNJB 2BYVE 4I6NB 3PV1A 3SDLC 2LXCA 1WMHA 1Q1OA 1UH6A 3V6EB 1E90A 3DCGA 3PHXB 2JWZA 5L95C 3L16A 1AARA 1WZ3A 3QCAA 4IM3A 3PT2B 1EUVB 2JUOA 3DQVA 2L0TA 2GOWA 3PRZA 3R3MA 1I35A 1V2YA 3L54A 4WWOA 3UIOB 3NS8A 5GMVA 2JF5A 3C0RB 2I1JA 3I3TB 4KSKC 4AUQC 4EOYA 2M0XA 4AJYB 4IUMB 4DHZE 1SGHA 4LDTD 1J8CA 1I42A 2K1FA 2D10A 3VVWB 3WAOA 3GZNI 1NDDA 3GOEA 1P3QU 1OQYA 2G4SA 2N7EA 1H8CA 1X1MA 2HJ8A 1JRUA 3M62B 3ZVVA 2RSUA 2EKEC 1GUAB 2KJRA 1WGDA 3UINB 2IO3B 3VAWA 3ZRCA 3U7DA 1GG3A 4B95A 3PZDA 4TKNA 2J0KA 2XBBC 4KDLB 3ONSA 3UGBB 3B0AA 4GOCA 1WJ4A 3DVNV 1XT9B 3L17A 4MGZE 3TL5A 2O6VD 3ML9A 3VH4B 2K6QA 2D3GA 2J7QB 1K8RB 3X23A 4ANUA 2LVPA 4NQLB 3JSVB 1YX5B 4W9IA 4W9LA 3VTVA 3A33B 1YQBA 2MBQA 3APCA 3EECA 3UIPB 2BKRB 3H9DA 2BYFA 2CHZA 2KN5A 2LJ5A 3PRPB 1UBIA 4IC7B 4I6LB 4CHKA 3ZW3A 2N1VA 5EDSA 5IA7A 3M95A 5AZFA 4FN2A 5D2MB 2DAFA 2O2VB 1KM7A 1E5WA 2AEHA 2KD0A 2M8SA 4KDIC 4MSQB 2UWQA 3VUYA 4BVUC 2JPHA 4E74A 2RD0A 4EEWA 2OOBB 4M0WB 2IZVB 4W9EA 4W9FA 4OVUA 4FADA 2AWTA 1VCBA 4NNJB 3WAPA 1WGRA 2CR5A 2DYOA 4PS3A 4BKGA 4X57B 1U4AA 2KX0A 2KDIA 1P1AA 3D32A 4W9DA 4WWPA 2JRIB 4HXDA 1Z5SB 2YLMA 1ZKHA 4WAAA 3KVFB 4BOZB 1LQBA 3DVGX 5CTRC 4YL8A 5J18A 2D11A 2M1MA 2ZPNA 4HWIB 4XC2A 3V61A 5DPWA 4FULA 2LGYA 3T8MA 1UZXB 5CHVC 2LRWA 3ZTCA 4MEMA 2N1WA 4RMAA 5DPTA 2KJ6A 2ZPYA 2Z59B 2EMSA 1P98A 2Y5BB 1EF1A 4ZDVA 1R4MI 3PHWB 2IYDB 1WYWB 1ZGUB 3RULA 4E3CA 3TIXA 2G3QB 2LRUA 4MJSB 5LXHA 5LXIB 2AYOB 4GDLB 4JGHB 1J0GA 2JVCA 3BINA 3LJ3A 5AEKB 1E7UA 3JVZX 3KUZA 4N9F4 2N9PC 3KW5B 2NPTB 4GMVA 4PS8A 2WDTB 2HD5B 2N4FA 3N3KB 3ZKJC 4DHJB 2DZIA 4FA6A 2N9EB 3DBHI 2J0JA 4MELA 3RZFA 2JZZA 3DBRI 4ICVA 4A3OA 2KDBA 3T9LA 1TZ1A 2J0MA 2YVCA 3LDZE 2QHOA 1R4NI 1YJ1A 2C7NB 2C7HA 4K7UA 4AWJA 1V86A 4KZ0A 4DK5A 2D07B 2DZJA 4ANVA 4AOFA 1Q0WB 1IPGA 4RM8A 1L7YA 4XX5A 2ZCBA 3RT3B 1RLFA 1Y8RC 2KXJA 2JXXA 5L83A 1ZW7A 4EKUA 3ECIA 1GNUA 1V9JA 3IHPC 3JW0X 4ICUA 1Q5WB 2ZCCA 3NY5A 1A5RA 1RFAA 1OEYJ 1WXSA 2KQ7A 3JSVA 2VRRB 4FHKA 3NZUA 4FLHA 4I6PA 1EO6A 3B08A 3KYDD 4F7ZA 4AJWA 3MJWA 2ZVNA 4HJKA 3A1QB 2KMCA 2V4LA 2ASQA 2ZJDA 3EHVA 3ZUNA 2MBBB 1WF9A 2KTFA 2OJRA 4OVVA 4LDTB 4F8CB 2C5LC 2O2VA 4FJYA 2KVRA 5DPSA 3OJ3A 4GGQA 1V5TA 1RAXA 3WIMA 2KHWB 1V6EA 3NZSA 3AU4A 1E8YA 4M8MA 3QQ8B 1GC6A 2WX0A 1UBQA 4G11A 3ZNID 1WFYA 2CHWA 2GBRA 1S1QB 1WX9A 4GU2A 3KUDB 4FJZA 2KTRB 4WQOB 2MSED 1PQSA 2JT4B 2RGFA 3ZLZA 2ZVOA 3DDCB 3RUIB 2C7MB 4W9JA 4DDID 4GSWA 2CS4A 3QA8A 2PEAA 3VDZA 2FAZA 3A4RA 3QAQA 1WGYA 2NBVB 4NAWB 5KHQA 2XK5B 2DHZA 2L0FA 1E8WA 2L05A 4IWQA 4PYUA 5E6PA 3WAMA 4MH0E 4BKSA 3APDA 5D7GA 3EC8A 3KH0A 3QARA 3W1SA 3W1SC 3UF8A 3B1LX 2MP2B 2MBOA 3UQBA 1BT0A 3Q3FA 2L3ZA 1OTRB 2DAJA 3MTNB 4HDOA 2NBWB 3PVLA 4KSLC 3SHQA 3CSFA 1XQQA 2LXAA 3KYCD 2KMAA 2KO3A 2KWUB 4MJSA 2CU1A 4GDLA 4LJOB 4NQKE 4RM9A 2DENB 1C1YB 4XZ4A 5CHWA 1WJ6A 2IO1B 2JRHA 3WALA 1G6JA 2LVQA 5DCNA 2HE7A 2NPTA 4WWNA 4ZRIA 2IY0B 1UD7A 4LJPB 1UGMA 2C60A 5JHAA 2D2QA 2FIDA 3APFA 4GIVA 2K8HA 4NJ7A 3ZIMA 1OGWA 1TBEA 1S3SG 2BF8B 2BKFA 2JZ3B 4HCNB 4JLCA 2EMTA 4BBNF 3H7PB 2WX1A 2WWZA 2BWES 2LGXA 3L0WB 4HK2A 4MGKE 3VTWA 4DBGA 4HLEA 1XD3B 2CHXA 4WJPA 1HE8A 4A3PA 4IW0A 1IP9A 2MWSB 5D94A 2LZ6A 1WY8A 5E6OA 2MX2A 4EZJA 4G50A 2LD9A 4WJOA 4II3B 2G4DB 3PGEA 5JHBA 4J6IA 2FCQA 4KIKB 4BBNC 1P9DU 2FCMA 2KWCA 2BPSA 4K1RB 1V80A 3A1QA 2B3AA 4P7IA 2KQSA 5AZGA 3DVGY 1M94A 1WXVA 2PJHA 3HK0A 3DBSA 1UELA 3Q3JA 1WXMA 1WX8A 2R2QA 3PSEB 3A9KB 2KDFB 1V5OA 2KANA 1P0RA 3H7SA 4II2B 2Z0EB 2N7DA 2NCNA 3KUCB 4G0NB 5IAAC 3ZNZB 1VD2A 5KHOA 4LCDE 4TV3A 1L2NA 5CHFA 5LLIA 5J2RA 3RZWC 5J17A 3OAWA 3IVFA 2NBUA 3CSTA 3V6CB 4EZLA 3PPAA 2A5UA 1ISNA 3AXCA 3WANA 4G3XB 3ZNHB 4JL9A 4ZRKA 2KTRA 3R7RA 2FIFA 3DBLI 3S2AA 4IM2A 3ZO5B 4EZKA 1WJUA 4DHZB 2DZMA 2LVOA 1WH3A 3DVNU 4MSMB 1KOTA 3DOWA 2LGDA 2MW5A 4IWOA 3PTFC 3AULA 4MGYE 4E71A 1NBFC 1TTNA 3IG3A 4NAWA 2L76A 3VFKA 2MA9B 4EUTA 3RD2A 1LM8B 4JQWC 2XK5A 3N32A 2L8JA 2FUHB 2KLGA 4MGIE 2A4ZA 3UQAA 5CX3A 4M8NA 2KFKB 2WYQA 2NVUI 1WRDB 2CKHB 2JY6A 2RR9A 2MP2A 2R2OA 4FJVB 4K7SA 2PE6B 1WM3A 3ALBA 2KX3A 5AZHA 2L00B 3L08A 1WIAA 4W9KA 2BWFA 4ZYNA 5C1ZA 1J19A 4FBJB 3H1UA 4GXBA 3CMMB 4MDKE 5JZEB 2RPQA 2MLBA 1C3TA 3AI5A 2ZZPB 2KNBA 3NOBA 2IO2B 4HVBA 3ENEA 4NPNA 2KLCA 2UYZB 4TUUA 3O65B 3HHMA 3ML8A 3TMPB 4CYEA 1WR1A 1E8XA 3SD5A 2W9NA 2MCNB 3AU5A 3HIZA 3MHSD 4K7WA 4DWFA 4AP4C 1LXDA 5TR5A 4JIOU 2KKCA 1IYFA 2V3SA 3ZDTA 2BYEA 3VTUA 3QJZA 3A9JB 3L13A 3PLVA 3U8ZA 1LFDA 1YX6B 1FXTB 5G2NA 3VH3B 2O6VB 1KLVA 1YD8U 2GBKA 3PLUA 2Z0DB 3K9OB 4GB9A 1KJTA 1CMXB 2KC1A 2GBJA 3ZDMC 4K81A 1H4RA 1V81A 3H7PA 3SU8X 2KWVB 3IFWB 4GN1A 3HM3A 3ZRFA 4TQ0A 4GDKB 2PPHA 3PRMB 2HTHA 2DYBA 1RRBA 3QHTA 2M4NA 3U30A 4F1SA 4HCPB 3K9PB 1D3ZA 2LASA 2KC2A 1WMHB 5E6NA 4ZRJA 2REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNV C;  4WJN A;  5C23 A;  1WJN A;  3VHT C;  2XEW A;  3H6N A;  3V60 A;  2DX5 B;  2V1Y A;  2DZK A;  3QK0 A;  5D6J B;  2PE9 A;  4DXA B;  2K6D B;  4KIK A;  4NY0 A;  1SIF A;  3V62 A;  2IBI B;  3BY4 B;  3QC8 B;  2KJH B;  5DPR A;  3VXW A;  1E8Z A;  1WM2 A;  3A9K A;  4PYZ A;  2L7R A;  5G55 A;  3IBE A;  3PS6 A;  1TGZ B;  4BOS C;  1V49 A;  4W9H A;  4WJQ A;  2NS5 A;  5JH5 C;  2K39 A;  3QWZ B;  3ZNG C;  3VUW A;  2KZR A;  4ASW C;  4ANX A;  2KK8 A;  3DPD A;  1T0Y A;  2GMI C;  3R66 C;  3R7Q A;  1SE9 A;  4KVG B;  2MBH A;  1GC7 A;  3W1Y A;  4B6W A;  4FHJ A;  4NJ6 A;  2AL3 A;  3TJP A;  1WR6 E;  1GJZ A;  3HM6 X;  2MBE A;  2MQJ A;  4W9G A;  2KOX A;  1QZE A;  1WXA A;  2ZNV B;  2C9W B;  2N9X A;  2BGF A;  1WE6 A;  4TQ1 A;  3L10 B;  2GBM A;  4KV2 A;  4BKS D;  2LUE A;  1WGH A;  3RYT A;  4EFO A;  2IY1 B;  1NI2 A;  3NHE B;  2KFK A;  3OLM D;  2FCN A;  5HKH A;  3N30 A;  1MG8 A;  4ANW A;  2GBN A;  2LWP A;  1WI0 A;  2K25 A;  3X0W A;  4IWP A;  1EF5 A;  2KDE B;  3TBL D;  2K8B A;  2FCS A;  3CF6 E;  3P2B A;  3TCA A;  4BFR A;  3JYU A;  4B9K A;  4HDQ A;  3EFU A;  4IM0 A;  3RCZ A;  4A20 A;  1WGG A;  1WZ0 A;  3QX1 A;  5BO4 B;  1OEY A;  4CO7 A;  3M3J A;  2AL6 A;  3A4S C;  3ZTD A;  1E7V A;  2NR2 A;  4IG7 B;  5FR6 A;  2KFJ A;  2M17 A;  1WX7 A;  4DDG D;  2ZEQ A;  2IO0 B;  3PRE A;  3WA0 A;  2LI5 A;  4HPM B;  4DHJ D;  4MM3 A;  4BKT A;  2K8C A;  4KZC A;  4URK A;  1WE7 A;  3A9J A;  1Z2M A;  2I1K A;  3VUX A;  2MRP A;  3OJ4 B;  2O6V A;  2G45 B;  4HPL B;  3QIJ A;  4W9C A;  3VQI A;  1YIW A;  2DYM A;  4GDK A;  4PS7 A;  1F9J A;  3M63 B;  2FNJ B;  2BYV E;  4I6N B;  3PV1 A;  3SDL C;  2LXC A;  1WMH A;  1Q1O A;  1UH6 A;  3V6E B;  1E90 A;  3DCG A;  3PHX B;  2JWZ A;  5L95 C;  3L16 A;  1AAR A;  1WZ3 A;  3QCA A;  4IM3 A;  3PT2 B;  1EUV B;  2JUO A;  3DQV A;  2L0T A;  2GOW A;  3PRZ A;  3R3M A;  1I35 A;  1V2Y A;  3L54 A;  4WWO A;  3UIO B;  3NS8 A;  5GMV A;  2JF5 A;  3C0R B;  2I1J A;  3I3T B;  4KSK C;  4AUQ C;  4EOY A;  2M0X A;  4AJY B;  4IUM B;  4DHZ E;  1SGH A;  4LDT D;  1J8C A;  1I42 A;  2K1F A;  2D10 A;  3VVW B;  3WAO A;  3GZN I;  1NDD A;  3GOE A;  1P3Q U;  1OQY A;  2G4S A;  2N7E A;  1H8C A;  1X1M A;  2HJ8 A;  1JRU A;  3M62 B;  3ZVV A;  2RSU A;  2EKE C;  1GUA B;  2KJR A;  1WGD A;  3UIN B;  2IO3 B;  3VAW A;  3ZRC A;  3U7D A;  1GG3 A;  4B95 A;  3PZD A;  4TKN A;  2J0K A;  2XBB C;  4KDL B;  3ONS A;  3UGB B;  3B0A A;  4GOC A;  1WJ4 A;  3DVN V;  1XT9 B;  3L17 A;  4MGZ E;  3TL5 A;  2O6V D;  3ML9 A;  3VH4 B;  2K6Q A;  2D3G A;  2J7Q B;  1K8R B;  3X23 A;  4ANU A;  2LVP A;  4NQL B;  3JSV B;  1YX5 B;  4W9I A;  4W9L A;  3VTV A;  3A33 B;  1YQB A;  2MBQ A;  3APC A;  3EEC A;  3UIP B;  2BKR B;  3H9D A;  2BYF A;  2CHZ A;  2KN5 A;  2LJ5 A;  3PRP B;  1UBI A;  4IC7 B;  4I6L B;  4CHK A;  3ZW3 A;  2N1V A;  5EDS A;  5IA7 A;  3M95 A;  5AZF A;  4FN2 A;  5D2M B;  2DAF A;  2O2V B;  1KM7 A;  1E5W A;  2AEH A;  2KD0 A;  2M8S A;  4KDI C;  4MSQ B;  2UWQ A;  3VUY A;  4BVU C;  2JPH A;  4E74 A;  2RD0 A;  4EEW A;  2OOB B;  4M0W B;  2IZV B;  4W9E A;  4W9F A;  4OVU A;  4FAD A;  2AWT A;  1VCB A;  4NNJ B;  3WAP A;  1WGR A;  2CR5 A;  2DYO A;  4PS3 A;  4BKG A;  4X57 B;  1U4A A;  2KX0 A;  2KDI A;  1P1A A;  3D32 A;  4W9D A;  4WWP A;  2JRI B;  4HXD A;  1Z5S B;  2YLM A;  1ZKH A;  4WAA A;  3KVF B;  4BOZ B;  1LQB A;  3DVG X;  5CTR C;  4YL8 A;  5J18 A;  2D11 A;  2M1M A;  2ZPN A;  4HWI B;  4XC2 A;  3V61 A;  5DPW A;  4FUL A;  2LGY A;  3T8M A;  1UZX B;  5CHV C;  2LRW A;  3ZTC A;  4MEM A;  2N1W A;  4RMA A;  5DPT A;  2KJ6 A;  2ZPY A;  2Z59 B;  2EMS A;  1P98 A;  2Y5B B;  1EF1 A;  4ZDV A;  1R4M I;  3PHW B;  2IYD B;  1WYW B;  1ZGU B;  3RUL A;  4E3C A;  3TIX A;  2G3Q B;  2LRU A;  4MJS B;  5LXH A;  5LXI B;  2AYO B;  4GDL B;  4JGH B;  1J0G A;  2JVC A;  3BIN A;  3LJ3 A;  5AEK B;  1E7U A;  3JVZ X;  3KUZ A;  4N9F 4;  2N9P C;  3KW5 B;  2NPT B;  4GMV A;  4PS8 A;  2WDT B;  2HD5 B;  2N4F A;  3N3K B;  3ZKJ C;  4DHJ B;  2DZI A;  4FA6 A;  2N9E B;  3DBH I;  2J0J A;  4MEL A;  3RZF A;  2JZZ A;  3DBR I;  4ICV A;  4A3O A;  2KDB A;  3T9L A;  1TZ1 A;  2J0M A;  2YVC A;  3LDZ E;  2QHO A;  1R4N I;  1YJ1 A;  2C7N B;  2C7H A;  4K7U A;  4AWJ A;  1V86 A;  4KZ0 A;  4DK5 A;  2D07 B;  2DZJ A;  4ANV A;  4AOF A;  1Q0W B;  1IPG A;  4RM8 A;  1L7Y A;  4XX5 A;  2ZCB A;  3RT3 B;  1RLF A;  1Y8R C;  2KXJ A;  2JXX A;  5L83 A;  1ZW7 A;  4EKU A;  3ECI A;  1GNU A;  1V9J A;  3IHP C;  3JW0 X;  4ICU A;  1Q5W B;  2ZCC A;  3NY5 A;  1A5R A;  1RFA A;  1OEY J;  1WXS A;  2KQ7 A;  3JSV A;  2VRR B;  4FHK A;  3NZU A;  4FLH A;  4I6P A;  1EO6 A;  3B08 A;  3KYD D;  4F7Z A;  4AJW A;  3MJW A;  2ZVN A;  4HJK A;  3A1Q B;  2KMC A;  2V4L A;  2ASQ A;  2ZJD A;  3EHV A;  3ZUN A;  2MBB B;  1WF9 A;  2KTF A;  2OJR A;  4OVV A;  4LDT B;  4F8C B;  2C5L C;  2O2V A;  4FJY A;  2KVR A;  5DPS A;  3OJ3 A;  4GGQ A;  1V5T A;  1RAX A;  3WIM A;  2KHW B;  1V6E A;  3NZS A;  3AU4 A;  1E8Y A;  4M8M A;  3QQ8 B;  1GC6 A;  2WX0 A;  1UBQ A;  4G11 A;  3ZNI D;  1WFY A;  2CHW A;  2GBR A;  1S1Q B;  1WX9 A;  4GU2 A;  3KUD B;  4FJZ A;  2KTR B;  4WQO B;  2MSE D;  1PQS A;  2JT4 B;  2RGF A;  3ZLZ A;  2ZVO A;  3DDC B;  3RUI B;  2C7M B;  4W9J A;  4DDI D;  4GSW A;  2CS4 A;  3QA8 A;  2PEA A;  3VDZ A;  2FAZ A;  3A4R A;  3QAQ A;  1WGY A;  2NBV B;  4NAW B;  5KHQ A;  2XK5 B;  2DHZ A;  2L0F A;  1E8W A;  2L05 A;  4IWQ A;  4PYU A;  5E6P A;  3WAM A;  4MH0 E;  4BKS A;  3APD A;  5D7G A;  3EC8 A;  3KH0 A;  3QAR A;  3W1S A;  3W1S C;  3UF8 A;  3B1L X;  2MP2 B;  2MBO A;  3UQB A;  1BT0 A;  3Q3F A;  2L3Z A;  1OTR B;  2DAJ A;  3MTN B;  4HDO A;  2NBW B;  3PVL A;  4KSL C;  3SHQ A;  3CSF A;  1XQQ A;  2LXA A;  3KYC D;  2KMA A;  2KO3 A;  2KWU B;  4MJS A;  2CU1 A;  4GDL A;  4LJO B;  4NQK E;  4RM9 A;  2DEN B;  1C1Y B;  4XZ4 A;  5CHW A;  1WJ6 A;  2IO1 B;  2JRH A;  3WAL A;  1G6J A;  2LVQ A;  5DCN A;  2HE7 A;  2NPT A;  4WWN A;  4ZRI A;  2IY0 B;  1UD7 A;  4LJP B;  1UGM A;  2C60 A;  5JHA A;  2D2Q A;  2FID A;  3APF A;  4GIV A;  2K8H A;  4NJ7 A;  3ZIM A;  1OGW A;  1TBE A;  1S3S G;  2BF8 B;  2BKF A;  2JZ3 B;  4HCN B;  4JLC A;  2EMT A;  4BBN F;  3H7P B;  2WX1 A;  2WWZ A;  2BWE S;  2LGX A;  3L0W B;  4HK2 A;  4MGK E;  3VTW A;  4DBG A;  4HLE A;  1XD3 B;  2CHX A;  4WJP A;  1HE8 A;  4A3P A;  4IW0 A;  1IP9 A;  2MWS B;  5D94 A;  2LZ6 A;  1WY8 A;  5E6O A;  2MX2 A;  4EZJ A;  4G50 A;  2LD9 A;  4WJO A;  4II3 B;  2G4D B;  3PGE A;  5JHB A;  4J6I A;  2FCQ A;  4KIK B;  4BBN C;  1P9D U;  2FCM A;  2KWC A;  2BPS A;  4K1R B;  1V80 A;  3A1Q A;  2B3A A;  4P7I A;  2KQS A;  5AZG A;  3DVG Y;  1M94 A;  1WXV A;  2PJH A;  3HK0 A;  3DBS A;  1UEL A;  3Q3J A;  1WXM A;  1WX8 A;  2R2Q A;  3PSE B;  3A9K B;  2KDF B;  1V5O A;  2KAN A;  1P0R A;  3H7S A;  4II2 B;  2Z0E B;  2N7D A;  2NCN A;  3KUC B;  4G0N B;  5IAA C;  3ZNZ B;  1VD2 A;  5KHO A;  4LCD E;  4TV3 A;  1L2N A;  5CHF A;  5LLI A;  5J2R A;  3RZW C;  5J17 A;  3OAW A;  3IVF A;  2NBU A;  3CST A;  3V6C B;  4EZL A;  3PPA A;  2A5U A;  1ISN A;  3AXC A;  3WAN A;  4G3X B;  3ZNH B;  4JL9 A;  4ZRK A;  2KTR A;  3R7R A;  2FIF A;  3DBL I;  3S2A A;  4IM2 A;  3ZO5 B;  4EZK A;  1WJU A;  4DHZ B;  2DZM A;  2LVO A;  1WH3 A;  3DVN U;  4MSM B;  1KOT A;  3DOW A;  2LGD A;  2MW5 A;  4IWO A;  3PTF C;  3AUL A;  4MGY E;  4E71 A;  1NBF C;  1TTN A;  3IG3 A;  4NAW A;  2L76 A;  3VFK A;  2MA9 B;  4EUT A;  3RD2 A;  1LM8 B;  4JQW C;  2XK5 A;  3N32 A;  2L8J A;  2FUH B;  2KLG A;  4MGI E;  2A4Z A;  3UQA A;  5CX3 A;  4M8N A;  2KFK B;  2WYQ A;  2NVU I;  1WRD B;  2CKH B;  2JY6 A;  2RR9 A;  2MP2 A;  2R2O A;  4FJV B;  4K7S A;  2PE6 B;  1WM3 A;  3ALB A;  2KX3 A;  5AZH A;  2L00 B;  3L08 A;  1WIA A;  4W9K A;  2BWF A;  4ZYN A;  5C1Z A;  1J19 A;  4FBJ B;  3H1U A;  4GXB A;  3CMM B;  4MDK E;  5JZE B;  2RPQ A;  2MLB A;  1C3T A;  3AI5 A;  2ZZP B;  2KNB A;  3NOB A;  2IO2 B;  4HVB A;  3ENE A;  4NPN A;  2KLC A;  2UYZ B;  4TUU A;  3O65 B;  3HHM A;  3ML8 A;  3TMP B;  4CYE A;  1WR1 A;  1E8X A;  3SD5 A;  2W9N A;  2MCN B;  3AU5 A;  3HIZ A;  3MHS D;  4K7W A;  4DWF A;  4AP4 C;  1LXD A;  5TR5 A;  4JIO U;  2KKC A;  1IYF A;  2V3S A;  3ZDT A;  2BYE A;  3VTU A;  3QJZ A;  3A9J B;  3L13 A;  3PLV A;  3U8Z A;  1LFD A;  1YX6 B;  1FXT B;  5G2N A;  3VH3 B;  2O6V B;  1KLV A;  1YD8 U;  2GBK A;  3PLU A;  2Z0D B;  3K9O B;  4GB9 A;  1KJT A;  1CMX B;  2KC1 A;  2GBJ A;  3ZDM C;  4K81 A;  1H4R A;  1V81 A;  3H7P A;  3SU8 X;  2KWV B;  3IFW B;  4GN1 A;  3HM3 A;  3ZRF A;  4TQ0 A;  4GDK B;  2PPH A;  3PRM B;  2HTH A;  2DYB A;  1RRB A;  3QHT A;  2M4N A;  3U30 A;  4F1S A;  4HCP B;  3K9P B;  1D3Z A;  2LAS A;  2KC2 A;  1WMH B;  5E6N A;  4ZRJ A;  2REX A; 
#chains in the Genus database with same CATH topology
 4WJN A;  2WXR A;  2DZK A;  3OWE B;  2V3P A;  2K6D B;  3V62 A;  4OVZ A;  2IBI B;  3BY4 B;  2KJH B;  1TS4 A;  3VXW A;  3PS6 A;  3URY A;  4W9H A;  2VZK D;  2PMV A;  5JH5 C;  1JRO A;  2K39 A;  2L1A A;  1GC7 A;  4NJ6 A;  1QOA A;  2MQJ A;  2ZNV B;  1F1H A;  1ZXH A;  4EFO A;  2IY1 B;  1XF5 L;  2W55 A;  3BVZ A;  3N30 A;  1MG8 A;  4ANW A;  4Q2J A;  4HRS A;  1C76 A;  1EF5 A;  4ACF A;  3TCA A;  4BFR A;  4B9K A;  1WGG A;  3QX1 A;  5BO4 B;  1OEY A;  4LTU A;  3AE5 B;  2NR2 A;  4ZRP A;  1C4A A;  4REZ A;  2KFJ A;  1WX7 A;  3PRE A;  4DHJ D;  2LUM A;  4BKT A;  4KZC A;  2V0G A;  1WE7 A;  3DBL B;  3PO0 A;  3VUX A;  2MRP A;  2WGS A;  2O6V A;  5H92 C;  1L4D B;  2WDV B;  3VQI A;  1SJH D;  2DYM A;  4RF0 A;  4GDK A;  4PS7 A;  1F9J A;  5I4D A;  4JWU C;  2D3A A;  3PHX B;  2JWZ A;  3I5J C;  3DQV A;  2L0T A;  1I35 A;  1V2Y A;  4WWO A;  3NS8 A;  4NAM A;  3ZJV A;  4JE3 B;  1N60 A;  4ARI A;  4NJC A;  2N0S B;  1NDD A;  3GOE A;  1P3Q U;  1OQY A;  3Q8F A;  1H8C A;  3AEC B;  2HJ8 A;  3DWM A;  3M62 B;  3GB1 A;  3ZVV A;  3RI7 C;  1E9M A;  3VAW A;  2IO3 B;  3ZRC A;  4K3B A;  5BYS A;  1SB3 C;  2J0K A;  1TYG B;  3UGB B;  3B0A A;  3VH4 B;  4J3O D;  2K6Q A;  3DHI C;  1C4C A;  1ZE3 D;  4MT5 A;  1I4P A;  1YX5 B;  4W9I A;  2MBQ A;  3APC A;  3J9C A;  4RF1 A;  1L6U A;  5HFY A;  3PRP B;  2LJ5 A;  2N1V A;  3M95 A;  1OQR A;  2AEH A;  4KDI C;  2UWQ A;  4S0R A;  1EU3 A;  2VZK B;  1WGK A;  5MPO A;  4CQN A;  2CR5 A;  5BMI A;  2JYT A;  5C2T B;  2KDI A;  3D32 A;  4W9D A;  4HEA 1;  2BTE A;  2YLM A;  3NVY A;  1IUE A;  4BOZ B;  1LQB A;  1VRA B;  5J18 A;  1FEH A;  1JWB D;  4P16 A;  3DHG C;  5D3D A;  4HWI B;  4XC2 A;  1C78 A;  5DPW A;  3SFE B;  1UZX B;  3MC0 B;  2N1W A;  4RMA A;  2KJ6 A;  1EWY C;  4XYC A;  2EMS A;  1V8C A;  3IT4 B;  2ON8 A;  2IYD B;  1WYW B;  2G3Q B;  2ACZ B;  5LXI B;  2Y3A A;  4GDL B;  4JGH B;  3BIN A;  3JVZ X;  3B2G A;  3CIR B;  2NPT B;  5EE9 A;  2HD5 B;  4DHJ B;  3DBH I;  3R8B A;  2JZZ A;  3T9L A;  1TZ1 A;  3V3X A;  2QHO A;  1R4N I;  2C7N B;  2QC8 A;  2Z8L A;  4DK5 A;  3P4Q B;  1IPG A;  1L7Y A;  2KXJ A;  3AB5 A;  3O13 A;  1XLP A;  3TEZ A;  2ZCC A;  1RFA A;  2KQ7 A;  4YWG G;  4FHK A;  4FLH A;  2I2Y A;  1VR9 A;  2CJO A;  4F7Z A;  3AEF B;  4F8C B;  4FJY A;  4KKJ A;  3FIL B;  4JPS A;  1C77 A;  1V6E A;  2KT7 A;  3NZS A;  3U2S C;  1E8Y A;  4M8M A;  5FK9 C;  4C00 A;  1QOF A;  1WFY A;  5G5G A;  1NEK B;  3KUD B;  1NYR A;  2RDH A;  4WQO B;  1L0V B;  4C4V B;  1FFU A;  3DDC B;  4KGS A;  3QA8 A;  5E6J A;  4PK1 A;  1PDX A;  1YJI A;  4PYU A;  2HTM E;  4MH0 E;  4BKS A;  5D7G A;  3QAR A;  3W1S A;  3UF8 A;  3B1L X;  2MBO A;  3UQB A;  2L3Z A;  2DAJ A;  1TY0 A;  3PVL A;  4P6V F;  2OED A;  2KMA A;  3SR6 A;  3AE7 B;  4LJO B;  4MH8 A;  4NQK E;  5EE1 A;  5CHW A;  3WAL A;  2IY0 B;  2C60 A;  1TY2 A;  4NJ7 A;  2D3C A;  1Y56 A;  1TBE A;  2BKF A;  4YTN B;  4B0E A;  4HCN B;  4JLC A;  2WWZ A;  1J7A A;  2LGX A;  3P4P B;  3TUO A;  2CHX A;  1JWA D;  2LZ6 A;  1FXA A;  4EZJ A;  2JQR B;  3ZYY X;  3NRZ A;  2G4D B;  1FXI A;  1OFF A;  1QOB A;  4J6I A;  4BBN C;  3Q69 A;  1MPE A;  2BPS A;  3A1Q A;  4ANV A;  5AZG A;  4XX5 A;  3MC9 A;  3PSE B;  2KAC A;  1P0R A;  2Z0E B;  1YMH E;  2N7D A;  3KUC B;  4XDD A;  5IAA C;  1I4Q A;  1L2N A;  1VZ6 A;  5CHF A;  5J2R A;  1FMA D;  1J7B A;  1VZ8 A;  4FXC A;  2A5U A;  1IGD A;  1ISN A;  3AXC A;  4G3X B;  4OHJ A;  3ZNH B;  2KTR A;  2OJW A;  3R7R A;  1FRD A;  3DBL I;  1XCQ L;  4IM2 A;  1WJU A;  4DHZ B;  2MW5 A;  2KAJ A;  1PGA A;  1TTN A;  2INP E;  4MGI E;  1XCT L;  3Q3M C;  2WYQ A;  2RR9 A;  3N20 C;  3ALB A;  2L00 B;  1F2R C;  2WXQ A;  4ZYN A;  2BWF A;  1J19 A;  1ZOY B;  2WU2 B;  2L32 A;  2ZZP B;  3EGR A;  1T3Q A;  5H8Y E;  3RPF C;  4HVB A;  1UWM A;  4ZRQ A;  3SD5 A;  2PTL A;  2W9N A;  3Q3O C;  3ZDT A;  2BYE A;  1C4P A;  2JX5 A;  1NEN B;  1N63 A;  3PLV A;  2Y5P A;  1FNW A;  1FRR A;  1HEZ E;  2O6V B;  1TIF A;  2GLS A;  4K81 A;  1V81 A;  2BS2 B;  3H7P A;  2DWQ A;  4GN1 A;  2WXP A;  4TQ0 A;  4GDK B;  1SE3 A;  3QHT A;  3IXS A;  4JWS C;  4KZ0 A;  1EU4 A;  5C23 A;  3VHT C;  2XEW A;  3H6N A;  2V1Y A;  3QK0 A;  1TKE A;  3QC8 B;  2CJN A;  3BVM A;  1E8Z A;  3A9K A;  2L7R A;  2E3T A;  4LNF A;  3IBE A;  1NVI D;  1TGZ B;  1V49 A;  1DOI A;  4OZB A;  2LGS A;  3ETR A;  3QWZ B;  4ANX A;  2KK8 A;  3DPD A;  4S17 A;  2GMI C;  3W1Y A;  3IAS 1;  2JSV X;  4HJG E;  2WXO A;  4FHJ A;  3TJP A;  1GJZ A;  3HM6 X;  5D3I B;  4W9G A;  2KOX A;  1WXA A;  4KGT A;  3KWV A;  4MAC A;  1L5P A;  2BGF A;  3SEB A;  1RM6 C;  2W3S A;  2GBM A;  4KV2 A;  4BKS D;  2LUE A;  3RYT A;  2V9H A;  3RMK C;  4JX1 C;  1K50 A;  2KFK A;  3OLM D;  4AQ7 A;  2BVC A;  1WI0 A;  2R61 A;  2KDE B;  4WAF A;  2K8B A;  4YT0 B;  2FCS A;  1VDV A;  3EFU A;  3RCZ A;  2K22 A;  3M3J A;  2AL6 A;  3ZTD A;  3H8H A;  1ROE A;  4GLS C;  4DDG D;  2LI5 A;  4HPM B;  4MM3 A;  2ZW0 A;  4URK A;  3I57 A;  2GB1 A;  2I1K A;  3FAH A;  1KH0 A;  3W5V B;  1T6B X;  1JML A;  2INN E;  4HPL B;  1TKG A;  4WUR A;  2BYV E;  2IGG A;  1FNV A;  1WZ3 A;  3QCA A;  4D2K A;  3R3M A;  2GOW A;  3UIO B;  3SFD B;  3AEE B;  3C0R B;  4KSK C;  4EOY A;  1CZP A;  5BYQ A;  4AJY B;  1GB1 A;  4LDT D;  4K3C A;  4ZOH C;  3N1Y C;  1PGX A;  2G4S A;  1I4H A;  4US8 A;  2RSU A;  2KJR A;  1GUA B;  1GG3 A;  3RFZ B;  3PZD A;  4KDL B;  3KWL A;  1N61 A;  1WJ4 A;  3DVN V;  1XT9 B;  4MGZ E;  2RDB C;  3ML9 A;  2J7Q B;  1HTQ A;  3BYY B;  2K5P A;  1GPX A;  3W5U B;  3GE8 C;  2BKR B;  1VZ7 A;  2CHZ A;  4ITK A;  1UBI A;  4IC7 B;  3ZW3 A;  2K3U A;  5IA7 A;  5AZF A;  4FN2 A;  5D2M B;  1KM7 A;  4MSQ B;  1TS5 A;  2KD0 A;  4UDU C;  1CQV A;  4L23 A;  5IKC M;  1T0Q C;  2RD0 A;  1WXQ A;  2IZV B;  4W9E A;  1KFY B;  5IOI A;  2AWT A;  1VCB A;  4ZYS A;  3NZ3 A;  4WH4 A;  2IGH A;  4PS3 A;  3P1M A;  5HI1 A;  4BKG A;  1U4A A;  4RGT A;  2JRI B;  5FKA C;  1Z5S B;  4YL8 A;  3RN9 C;  2AX5 A;  2EKI A;  3MC8 A;  2LGY A;  5CHV C;  4A90 A;  2WLB A;  3ZTC A;  2ZPY A;  2Z59 B;  4ZDV A;  4C7Z A;  3Q6B A;  2LRU A;  2WDQ B;  1R4M B;  2AYO B;  1F0Z A;  2W82 A;  2JVC A;  2KYW A;  1UWX A;  1E7U A;  3EA6 A;  4GMV A;  2WDT B;  2DZI A;  4FA6 A;  1FIQ A;  2J0J A;  4AS1 A;  3RZF A;  1CJE A;  4ICV A;  1AN8 A;  1YJJ A;  2KDB A;  2J0M A;  3LDZ E;  2BYT A;  2X8X X;  4K7U A;  4TSS A;  1ET9 A;  4ZHP A;  4AOF A;  2ZCB A;  3RT3 B;  5L83 A;  3NVV A;  1CK1 A;  1ZW7 A;  1PGB A;  3ECI A;  1GNU A;  4M00 A;  1V9J A;  3JW0 X;  1SJE D;  1ZDX A;  2JYE A;  4I6P A;  4USA A;  4AJW A;  3MJW A;  2ZVN A;  3A1Q B;  3ZUN A;  1JWS D;  2MBB B;  2KTF A;  2OJR A;  4LDT B;  2C5L C;  2O2V A;  4C80 A;  1SF0 A;  1P7E A;  4GGQ A;  1V5T A;  1BXT A;  1I7H A;  2BS4 B;  4HKQ A;  3AU4 A;  3GZN B;  3QQ8 B;  1STE A;  4G11 A;  3ZNI D;  2KTR B;  3WCQ A;  1D5M C;  2FUG 1;  1ET6 A;  1QQR A;  1KF6 B;  4W9J A;  4DDI D;  1KRH A;  2FAZ A;  3QAQ A;  2NBV B;  3AN1 A;  2DHZ A;  2L0F A;  1E8W A;  2WNM A;  3BII D;  3APD A;  3EC8 A;  3W1S C;  1XEE A;  3MTN B;  4HDO A;  3SHQ A;  4HRO A;  1NYQ A;  2LXA A;  4IKG A;  2CU1 A;  4OZA A;  3TSS A;  2BW2 A;  1WJ6 A;  2IO1 B;  5DCN A;  4WWN A;  4ZRI A;  4A6Q A;  1UD7 A;  3APF A;  2K8H A;  3ZIM A;  3BZD B;  2BS3 B;  2LFI A;  3H7P B;  1FNU A;  1RYJ A;  3L0W B;  4DBG A;  1XD3 B;  1D5X C;  1AYF A;  4XGA B;  1JCK B;  4A3P A;  3T3N A;  1IP9 A;  2Q5W D;  5D94 A;  1E7P B;  3ZXR A;  2H89 B;  2QIL A;  4G50 A;  2LD9 A;  1QF6 A;  3PGE A;  1B1Z A;  1P9D U;  2FCM A;  4K1R B;  1V80 A;  1PUT A;  2KQS A;  3Q3J A;  3DVG Y;  1WXV A;  2PJH A;  2Y5C A;  3HK0 A;  1UEL A;  5J17 A;  1WXM A;  1WX8 A;  5TSS A;  3A9K B;  2KDF B;  4HLE A;  4II2 B;  3H7S A;  2NCN A;  3ZNZ B;  1VD2 A;  5KHO A;  2WXN A;  4LCD E;  3MHZ A;  3OAW A;  2NBU A;  5HG2 A;  3PPA A;  1FO4 A;  1YN5 A;  2ICI A;  4JL9 A;  1N5W A;  2FIF A;  3NUH B;  3NG0 A;  1FFV A;  4HKZ E;  2DZM A;  1WH3 A;  3ZQ4 A;  2J4X A;  2LMC A;  2WXK A;  4E71 A;  4NAW A;  2L76 A;  3TEX A;  2MA9 B;  4EUT A;  2L8J A;  2FUH B;  3R2I A;  1HQR D;  4C56 C;  4M8N A;  2KFK B;  2FE8 A;  2NVU I;  2R2O A;  1ZXI A;  4FJV B;  4YSX B;  1WM3 A;  2KX3 A;  3GE3 C;  3Q3N C;  1LO5 D;  1WIA A;  4W9K A;  3TEY A;  4FBJ B;  4MDK E;  2LGI A;  2RPQ A;  3ZXV A;  3AI5 A;  2KNB A;  3NOB A;  4TUU A;  3ML8 A;  2QEJ C;  1WR1 A;  1E8X A;  2MCN B;  3HIZ A;  3MHS D;  2LJI A;  4DWF A;  1LXD A;  4MM3 B;  5G2N A;  5LNK 1;  3VH3 B;  1TS3 A;  1KLV A;  1YD8 U;  3MP9 A;  2WXM A;  3PLU A;  2BT6 A;  2GBJ A;  2PIA A;  3ZDM C;  2RDG A;  3ZRF A;  2HTH A;  1RRB A;  1D3Z A;  1HXY D;  2LAS A;  5E6N A;  1YOV B;  2JU6 X;  3RNB C;  3V60 A;  2DX5 B;  2QJL A;  5D6J B;  2YEP B;  4NY0 A;  1SIF A;  3KLS X;  3RNG C;  1WM2 A;  1RWS A;  1E10 A;  2NS5 A;  4YSZ B;  1T0R C;  4US9 A;  3VUW A;  3R66 C;  4KVG B;  4LNI A;  1V1O A;  1YN4 A;  2AL3 A;  1ZPS A;  4R3D A;  1IBX A;  2V3N A;  3AE9 B;  4TMA B;  2ZW1 A;  1PYW D;  2M19 A;  4TQ1 A;  1WGH A;  1B9R A;  1NI2 A;  3NHE B;  5HKH A;  2FCN A;  2BB5 A;  1R7S A;  2GBN A;  3X0W A;  4IWP A;  3MFG A;  3TBL D;  3JYU A;  4HDQ A;  4A20 A;  1WZ0 A;  1E7V A;  1ACC A;  1SE4 A;  5FR6 A;  1MJD A;  1MHX A;  2IO0 B;  2ZEQ A;  2K8C A;  4YTM B;  3A9J A;  2IDY A;  2G45 B;  1DOX A;  1GOZ A;  3QIJ A;  1UUP A;  2FNJ B;  3PV1 A;  1I4R A;  1FCC C;  1Q1O A;  1UH6 A;  2INC C;  3DCG A;  5L95 C;  3L16 A;  2JUO A;  3PRZ A;  5EE0 A;  2WP9 B;  3NVW A;  2JF5 A;  3I3T B;  4AUQ C;  2BQQ A;  4N6E B;  2M0X A;  4N58 A;  1UNS A;  4DHZ E;  5BMH A;  2LHD A;  1SGH A;  2K9X A;  2AQ3 B;  2G9H D;  3WAO A;  3GZN I;  1JWU D;  3W2D A;  2N7E A;  2V4I B;  4BZA A;  2EKE C;  4B95 A;  1TS2 A;  3HVZ A;  3U7D A;  1N5X A;  4TKN A;  2XBB C;  2X38 A;  3ONS A;  1T0S C;  3HRD D;  3L17 A;  2WS3 B;  3TL5 A;  2D3G A;  3X23 A;  1K8R B;  3AEA B;  3P4S B;  4ANU A;  4NQL B;  2IGD A;  3A33 B;  1YQB A;  3EEC A;  3DHH C;  4CHK A;  4I6L B;  2J42 A;  2O2V B;  2M8S A;  1TT5 B;  3VUY A;  2JPH A;  2KQ4 X;  4LK0 M;  4E74 A;  4EEW A;  1SXT A;  4YSY B;  3WAP A;  2M0A A;  3V05 A;  3AV8 A;  4X57 B;  2KX0 A;  1P1A A;  4WWP A;  2KVZ A;  4HXD A;  1ZKH A;  4WAA A;  2LEK A;  2MHJ A;  5CTR C;  1N62 A;  2AQ1 B;  2ZPN A;  3BVG A;  3V61 A;  3DWG C;  4FUL A;  2PLP A;  2J53 A;  1HTO A;  4MEM A;  5DPT A;  2N9K A;  1P98 A;  4P1B C;  2Y5B B;  4WQM A;  3AE3 B;  1ZGU B;  4E3C A;  3TIX A;  3CWI A;  1FCL A;  1EWC A;  4BAX A;  5LXH A;  2M56 B;  1JW9 D;  1J0G A;  3LJ3 A;  2J52 A;  4N9F 4;  4PS8 A;  3ZKJ C;  2N9E B;  1TZO A;  4MEL A;  4RFB A;  4A3O A;  1J7C A;  3DBH B;  4AWJ A;  5AUK A;  5IN7 A;  1LGR A;  1SE2 A;  4RM8 A;  1RLF A;  1Y8R C;  2JXX A;  2BBC A;  4EKU A;  4ICU A;  1Q5W B;  3NY5 A;  1OEY J;  3JSV A;  1EO6 A;  3KYD D;  1YQ3 B;  1UGJ A;  3AE1 B;  2KMC A;  2V4L A;  2ASQ A;  2ZJD A;  1YQ4 B;  2UU7 A;  2QDF A;  3EHV A;  2KVR A;  5DPS A;  1A70 A;  5BMG A;  2KHW B;  5IP4 D;  1C9F A;  3AED B;  4M0W A;  1GC6 A;  2GBR A;  1S1Q B;  1WX9 A;  1KTK A;  3LB8 C;  4FJZ A;  1PQS A;  2JT4 B;  2RGF A;  4RGM A;  3ZLZ A;  2ZVO A;  2C7M B;  3NVZ A;  4GSW A;  2CS4 A;  2PEA A;  1I4G A;  1WGY A;  4NAW B;  2L05 A;  5E6P A;  2N7J A;  1XO3 A;  1F2R I;  3BWU D;  4WIP A;  1BT0 A;  2RPV A;  1E0Z A;  3AEB B;  3CSF A;  2SAK A;  2KWU B;  4MJS A;  4RM9 A;  1MFW A;  2DEN B;  3N9Y C;  1RFK A;  2JRH A;  2WXI A;  1MI0 A;  2LVQ A;  2HE7 A;  3B2F A;  3Q8E A;  4LJP B;  2FID A;  4GIV A;  1L0X B;  1OGW A;  1S3S G;  4LNK A;  4XWW A;  2EMT A;  1TJE A;  1HA5 A;  4MGK E;  3VTW A;  4DXG A;  2W3R A;  4KGR A;  4IW0 A;  1ESF A;  2SEB D;  1WY8 A;  2G1E A;  5E6O A;  4WJO A;  3MJ5 A;  1NI3 A;  4OZC A;  5JHB A;  3Q8C A;  4YTP B;  2RMM A;  3LYY A;  2MJE A;  5IO9 A;  2N9L A;  4PT5 A;  4TV3 A;  5LLI A;  3RZW C;  2L52 A;  3IVF A;  3V6C B;  1SBB B;  2MEK A;  1QOG A;  3WAN A;  3DBR B;  2LHE A;  4ZRK A;  2HJ1 A;  2PW9 A;  4XDC A;  4EZK A;  4WWM A;  3DVN U;  3R2T A;  5JXV A;  4OW0 A;  1QLB B;  1IBX B;  3DOW A;  4NZL B;  1AW7 A;  3PTF C;  3AUL A;  4MGY E;  1NBF C;  2XN9 C;  2OHF A;  4RGO S;  2XK5 A;  2AQ2 B;  2KLG A;  2A4Z A;  5CX3 A;  1WRD B;  2CKH B;  2JY6 A;  3W9C B;  2MP2 A;  2PE6 B;  2NTS A;  1WSP A;  3AE2 B;  5C1Z A;  3H1U A;  1XLN A;  2MLB A;  1C3T A;  4XE0 A;  3ZJU A;  2JZP A;  1C79 A;  2IO2 B;  4LNO A;  4NPN A;  1SIJ A;  3TMP B;  4CYE A;  3Q14 C;  1VJK A;  3AU5 A;  4K7W A;  5TR5 A;  4JIO U;  2KKC A;  2WXG A;  3QJZ A;  3A9J B;  3L13 A;  1LFD A;  3OG5 A;  3K9O B;  1E6E B;  1CMX B;  3SU8 X;  3HM3 A;  1Q10 A;  2DYB A;  2WQY B;  4HCP B;  3U7Z A;  3AM9 A;  2KC2 A;  3T3O A;  4ZRJ A;  2Z0D B;  4N59 A;  2ZNV C;  5C3J B;  1WJN A;  1DGJ A;  3ZGZ A;  2PE9 A;  4DXA B;  1ZDV A;  4KIK A;  5DPR A;  1L4Z B;  4PYZ A;  5G55 A;  4BOS C;  1ZUD 2;  4WJQ A;  3ZNG C;  2KZR A;  4ASW C;  1T0Y A;  4YXD B;  3R7Q A;  1SE9 A;  2MBH A;  2D5G A;  3VR9 B;  4B6W A;  2WXJ A;  4A9A A;  4XWT A;  3RNE C;  1XLO A;  1WR6 E;  2MBE A;  1D6E C;  1HZ6 A;  1F52 A;  1QZE A;  5AUI A;  3P63 A;  3U4E G;  2C9W B;  2N9X A;  1WE6 A;  3L10 B;  1XLQ A;  2JWU A;  2QMT A;  1ZP0 B;  2LWP A;  2K25 A;  4QAY A;  1GB4 A;  1L0Y B;  1K53 A;  1V1P A;  1K51 A;  3CF6 E;  3P2B A;  4IM0 A;  3AE6 B;  4CO7 A;  1D5Z C;  3A4S C;  4IG7 B;  3Q8A A;  2M17 A;  1QKZ A;  3WA0 A;  4ARC A;  2CU3 A;  1Z2M A;  3OJ4 B;  3AMZ A;  3C19 A;  2IND C;  2IJ0 A;  4W9C A;  1YIW A;  3M63 B;  4I6N B;  3U52 E;  4ZHO A;  3SDL C;  4HPP A;  2LXC A;  4L2Y A;  1WMH A;  3V6E B;  1E90 A;  2GI9 A;  1UF0 A;  1PFD A;  1AAR A;  4IM3 A;  3PT2 B;  1EUV B;  3IAM 1;  3L54 A;  5GMV A;  2I1J A;  4H2A A;  1M4V A;  2WDR B;  1SEB D;  4IUM B;  2VH2 A;  1BUI C;  2I38 A;  1J8C A;  1I42 A;  2QIE B;  1MHH E;  3P42 A;  2K1F A;  2D10 A;  3VVW B;  2EEL A;  5FR3 A;  1JQ4 A;  1X1M A;  5EE3 A;  3VRB B;  1JRU A;  3UIN B;  1WGD A;  3ABV B;  2WXL A;  4GOC A;  1JAL A;  1MG4 A;  2O6V D;  2LVP A;  1WYG A;  3B9J A;  2KWD A;  3JSV B;  4W9L A;  3VTV A;  3UIP B;  3H9D A;  3AH7 A;  1L6V A;  2WXF A;  2BYF A;  1KLG D;  1KLU D;  3HUI A;  2DBY A;  2KN5 A;  5EDS A;  4KX6 B;  2DAF A;  1E5W A;  4BVU C;  3PZ8 A;  2BB6 A;  2PVG C;  1GAQ B;  2PVO D;  3AE4 B;  2OOB B;  4M0W B;  4EE2 A;  4W9F A;  4FAD A;  4OVU A;  4NNJ B;  1WGR A;  2DYO A;  3E56 A;  2JXT A;  3UI3 A;  2MJ3 A;  3KVF B;  3DVG X;  3Q2A C;  2D11 A;  2M1M A;  4M01 A;  4P1C C;  3T8M A;  5T8I A;  1HZ5 A;  4RGN A;  2LRW A;  1N6Z A;  4RH6 A;  1EF1 A;  3LXF A;  3FKY A;  3RNF C;  1R4M I;  3PHW B;  3RUL A;  1XXG A;  4MJS B;  2WU5 B;  5AEK B;  2HDE A;  3KUZ A;  2N9P C;  3KW5 B;  2H88 B;  2N4F A;  3N3K B;  1D4B A;  2KMM A;  1AWD A;  2TSS A;  3DBR I;  1QT9 A;  2YVC A;  1YJ1 A;  2C7H A;  1FPY A;  1V86 A;  2B76 B;  2W54 A;  3VR8 B;  2D07 B;  2DZJ A;  1Q0W B;  3VRA B;  3IHP C;  3P4R B;  1A5R A;  1WXS A;  2KN4 A;  2VRR B;  3NZU A;  3AEG B;  3B08 A;  3I63 C;  5G5H A;  3RNA C;  4HJK A;  2ONQ A;  2WXH A;  1OQQ A;  1WF9 A;  4OVV A;  3OJ3 A;  3EUB 2;  1EM7 A;  2GRI A;  4B0M A;  1RAX A;  2K0P A;  3WIM A;  3I9V 1;  1DYQ A;  2E6X A;  3E9S A;  1SSN A;  2WX0 A;  1UBQ A;  2CHW A;  4GU2 A;  1MVK A;  3GS2 A;  2MSE D;  3RUI B;  3NJT A;  3VDZ A;  3A4R A;  5KHQ A;  2XK5 B;  3WAM A;  4IWQ A;  1F77 A;  3KH0 A;  3BK2 A;  1I4X A;  2MH7 A;  2MP2 B;  3HVD A;  3Q3F A;  1OTR B;  2NBW B;  4O1N A;  1YNT E;  1WRI A;  4KSL C;  1FM0 D;  1FD6 A;  1XQQ A;  2QCZ A;  3KYC D;  2KO3 A;  2PKO A;  1P7F A;  3EFC A;  4GDL A;  1C1Y B;  4XZ4 A;  1IGC A;  4RNA A;  1G6J A;  2NPT A;  4IOI E;  1UGM A;  5JHA A;  1DOY A;  2D2Q A;  2NTT A;  2BF8 B;  4A55 A;  2JZ3 B;  4BBN F;  1JWM D;  1BML C;  2WX1 A;  2BWE S;  1WWT A;  5GXG B;  3TEW A;  4DQO C;  4HK2 A;  3IT6 B;  3N1X C;  4WJP A;  1HE8 A;  4A8X C;  2MJD A;  2MWS B;  4C7Y A;  2MX2 A;  3AE8 B;  4M02 A;  3KQ4 A;  4II3 B;  2QSD A;  1V97 A;  2FCQ A;  1YN3 A;  4IDI A;  2WHI A;  2KWC A;  4KIK B;  3L4P A;  2B3A A;  4P7I A;  1M94 A;  4L1B A;  3DBS A;  2R2Q A;  5HHD G;  1V5O A;  2KAN A;  1T5X D;  4LLG M;  4G0N B;  2NMQ A;  2DNF A;  3FIL A;  3FC4 A;  4EZL A;  3CST A;  1JRP A;  2L83 A;  2DLB A;  2KDM A;  4RCO A;  3NS1 A;  1R4N B;  3ZO5 B;  2FBW B;  3S2A A;  4C4V A;  2LVO A;  4MSM B;  1KOT A;  2LGD A;  4IWO A;  3IG3 A;  3VFK A;  3N1Z C;  3RD2 A;  1LM8 B;  2YEP F;  4JQW C;  3N32 A;  1K52 A;  3UQA A;  3PZ7 A;  1VLB A;  4K7S A;  5AZH A;  3L08 A;  2VH1 A;  2IPK D;  1V1P B;  3GP7 A;  2XNA C;  3CMM B;  4GXB A;  5JZE B;  3C8Y A;  1ENF A;  3ENE A;  2KLC A;  3Q8B A;  2UYZ B;  3O65 B;  3HHM A;  3ZJT A;  3BK1 A;  3BYT B;  5BYR A;  4AP4 C;  1IYF A;  2D3B A;  2V3S A;  3VTU A;  3U8Z A;  4LNN A;  1YX6 B;  1FXT B;  4DXF A;  2GBK A;  4GB9 A;  1KJT A;  2KC1 A;  1H4R A;  2KWV B;  1TKY A;  3IFW B;  2PPH A;  3PRM B;  1QIL A;  3U30 A;  2M4N A;  3K9P B;  4KKI A;  3RNC C;  1WMH B;  4F1S A;  2REX A; 
#chains in the Genus database with same CATH homology
 2ZNV C;  4WJN A;  5C23 A;  1WJN A;  3VHT C;  2XEW A;  3H6N A;  3V60 A;  2DX5 B;  2V1Y A;  2DZK A;  3QK0 A;  5D6J B;  2PE9 A;  4DXA B;  2K6D B;  4KIK A;  4NY0 A;  1SIF A;  3V62 A;  2IBI B;  3BY4 B;  3QC8 B;  2KJH B;  5DPR A;  3VXW A;  1E8Z A;  1WM2 A;  3A9K A;  4PYZ A;  2L7R A;  5G55 A;  3IBE A;  3PS6 A;  1TGZ B;  4BOS C;  1V49 A;  4W9H A;  4WJQ A;  2NS5 A;  5JH5 C;  2K39 A;  3QWZ B;  3ZNG C;  3VUW A;  2KZR A;  4ASW C;  4ANX A;  2KK8 A;  3DPD A;  1T0Y A;  2GMI C;  3R66 C;  3R7Q A;  1SE9 A;  4KVG B;  2MBH A;  1GC7 A;  3W1Y A;  4B6W A;  4FHJ A;  4NJ6 A;  2AL3 A;  3TJP A;  1WR6 E;  1GJZ A;  3HM6 X;  2MBE A;  2MQJ A;  4W9G A;  2KOX A;  1QZE A;  1WXA A;  2ZNV B;  2C9W B;  2N9X A;  2BGF A;  1WE6 A;  4TQ1 A;  3L10 B;  2GBM A;  4KV2 A;  4BKS D;  2LUE A;  1WGH A;  3RYT A;  4EFO A;  2IY1 B;  1NI2 A;  3NHE B;  2KFK A;  3OLM D;  2FCN A;  5HKH A;  3N30 A;  1MG8 A;  4ANW A;  2GBN A;  2LWP A;  1WI0 A;  2K25 A;  3X0W A;  4IWP A;  1EF5 A;  2KDE B;  3TBL D;  2K8B A;  2FCS A;  3CF6 E;  3P2B A;  3TCA A;  4BFR A;  3JYU A;  4B9K A;  4HDQ A;  3EFU A;  4IM0 A;  3RCZ A;  4A20 A;  1WGG A;  1WZ0 A;  3QX1 A;  5BO4 B;  1OEY A;  4CO7 A;  3M3J A;  2AL6 A;  3A4S C;  3ZTD A;  1E7V A;  2NR2 A;  4IG7 B;  5FR6 A;  2KFJ A;  2M17 A;  1WX7 A;  4DDG D;  2ZEQ A;  2IO0 B;  3PRE A;  3WA0 A;  2LI5 A;  4HPM B;  4DHJ D;  4MM3 A;  4BKT A;  2K8C A;  4KZC A;  4URK A;  1WE7 A;  3A9J A;  1Z2M A;  2I1K A;  3VUX A;  2MRP A;  3OJ4 B;  2O6V A;  2G45 B;  4HPL B;  3QIJ A;  4W9C A;  3VQI A;  1YIW A;  2DYM A;  4GDK A;  4PS7 A;  1F9J A;  3M63 B;  2FNJ B;  2BYV E;  4I6N B;  3PV1 A;  3SDL C;  2LXC A;  1WMH A;  1Q1O A;  1UH6 A;  3V6E B;  1E90 A;  3DCG A;  3PHX B;  2JWZ A;  5L95 C;  3L16 A;  1AAR A;  1WZ3 A;  3QCA A;  4IM3 A;  3PT2 B;  1EUV B;  2JUO A;  3DQV A;  2L0T A;  2GOW A;  3PRZ A;  3R3M A;  1I35 A;  1V2Y A;  3L54 A;  4WWO A;  3UIO B;  3NS8 A;  5GMV A;  2JF5 A;  3C0R B;  2I1J A;  3I3T B;  4KSK C;  4AUQ C;  4EOY A;  2M0X A;  4AJY B;  4IUM B;  4DHZ E;  1SGH A;  4LDT D;  1J8C A;  1I42 A;  2K1F A;  2D10 A;  3VVW B;  3WAO A;  3GZN I;  1NDD A;  3GOE A;  1P3Q U;  1OQY A;  2G4S A;  2N7E A;  1H8C A;  1X1M A;  2HJ8 A;  1JRU A;  3M62 B;  3ZVV A;  2RSU A;  2EKE C;  1GUA B;  2KJR A;  1WGD A;  3UIN B;  2IO3 B;  3VAW A;  3ZRC A;  3U7D A;  1GG3 A;  4B95 A;  3PZD A;  4TKN A;  2J0K A;  2XBB C;  4KDL B;  3ONS A;  3UGB B;  3B0A A;  4GOC A;  1WJ4 A;  3DVN V;  1XT9 B;  3L17 A;  4MGZ E;  3TL5 A;  2O6V D;  3ML9 A;  3VH4 B;  2K6Q A;  2D3G A;  2J7Q B;  1K8R B;  3X23 A;  4ANU A;  2LVP A;  4NQL B;  3JSV B;  1YX5 B;  4W9I A;  4W9L A;  3VTV A;  3A33 B;  1YQB A;  2MBQ A;  3APC A;  3EEC A;  3UIP B;  2BKR B;  3H9D A;  2BYF A;  2CHZ A;  2KN5 A;  2LJ5 A;  3PRP B;  1UBI A;  4IC7 B;  4I6L B;  4CHK A;  3ZW3 A;  2N1V A;  5EDS A;  5IA7 A;  3M95 A;  5AZF A;  4FN2 A;  5D2M B;  2DAF A;  2O2V B;  1KM7 A;  1E5W A;  2AEH A;  2KD0 A;  2M8S A;  4KDI C;  4MSQ B;  2UWQ A;  3VUY A;  4BVU C;  2JPH A;  4E74 A;  2RD0 A;  4EEW A;  2OOB B;  4M0W B;  2IZV B;  4W9E A;  4W9F A;  4OVU A;  4FAD A;  2AWT A;  1VCB A;  4NNJ B;  3WAP A;  1WGR A;  2CR5 A;  2DYO A;  4PS3 A;  4BKG A;  4X57 B;  1U4A A;  2KX0 A;  2KDI A;  1P1A A;  3D32 A;  4W9D A;  4WWP A;  2JRI B;  4HXD A;  1Z5S B;  2YLM A;  1ZKH A;  4WAA A;  3KVF B;  4BOZ B;  1LQB A;  3DVG X;  5CTR C;  4YL8 A;  5J18 A;  2D11 A;  2M1M A;  2ZPN A;  4HWI B;  4XC2 A;  3V61 A;  5DPW A;  4FUL A;  2LGY A;  3T8M A;  1UZX B;  5CHV C;  2LRW A;  3ZTC A;  4MEM A;  2N1W A;  4RMA A;  5DPT A;  2KJ6 A;  2ZPY A;  2Z59 B;  2EMS A;  1P98 A;  2Y5B B;  1EF1 A;  4ZDV A;  1R4M I;  3PHW B;  2IYD B;  1WYW B;  1ZGU B;  3RUL A;  4E3C A;  3TIX A;  2G3Q B;  2LRU A;  4MJS B;  5LXH A;  5LXI B;  2AYO B;  4GDL B;  4JGH B;  1J0G A;  2JVC A;  3BIN A;  3LJ3 A;  5AEK B;  1E7U A;  3JVZ X;  3KUZ A;  4N9F 4;  2N9P C;  3KW5 B;  2NPT B;  4GMV A;  4PS8 A;  2WDT B;  2HD5 B;  2N4F A;  3N3K B;  3ZKJ C;  4DHJ B;  2DZI A;  4FA6 A;  2N9E B;  3DBH I;  2J0J A;  4MEL A;  3RZF A;  2JZZ A;  3DBR I;  4ICV A;  4A3O A;  2KDB A;  3T9L A;  1TZ1 A;  2J0M A;  2YVC A;  3LDZ E;  2QHO A;  1R4N I;  1YJ1 A;  2C7N B;  2C7H A;  4K7U A;  4AWJ A;  1V86 A;  4KZ0 A;  4DK5 A;  2D07 B;  2DZJ A;  4ANV A;  4AOF A;  1Q0W B;  1IPG A;  4RM8 A;  1L7Y A;  4XX5 A;  2ZCB A;  3RT3 B;  1RLF A;  1Y8R C;  2KXJ A;  2JXX A;  5L83 A;  1ZW7 A;  4EKU A;  3ECI A;  1GNU A;  1V9J A;  3IHP C;  3JW0 X;  4ICU A;  1Q5W B;  2ZCC A;  3NY5 A;  1A5R A;  1RFA A;  1OEY J;  1WXS A;  2KQ7 A;  3JSV A;  2VRR B;  4FHK A;  3NZU A;  4FLH A;  4I6P A;  1EO6 A;  3B08 A;  3KYD D;  4F7Z A;  4AJW A;  3MJW A;  2ZVN A;  4HJK A;  3A1Q B;  2KMC A;  2V4L A;  2ASQ A;  2ZJD A;  3EHV A;  3ZUN A;  2MBB B;  1WF9 A;  2KTF A;  2OJR A;  4OVV A;  4LDT B;  4F8C B;  2C5L C;  2O2V A;  4FJY A;  2KVR A;  5DPS A;  3OJ3 A;  4GGQ A;  1V5T A;  1RAX A;  3WIM A;  2KHW B;  1V6E A;  3NZS A;  3AU4 A;  1E8Y A;  4M8M A;  3QQ8 B;  1GC6 A;  2WX0 A;  1UBQ A;  4G11 A;  3ZNI D;  1WFY A;  2CHW A;  2GBR A;  1S1Q B;  1WX9 A;  4GU2 A;  3KUD B;  4FJZ A;  2KTR B;  4WQO B;  2MSE D;  1PQS A;  2JT4 B;  2RGF A;  3ZLZ A;  2ZVO A;  3DDC B;  3RUI B;  2C7M B;  4W9J A;  4DDI D;  4GSW A;  2CS4 A;  3QA8 A;  2PEA A;  3VDZ A;  2FAZ A;  3A4R A;  3QAQ A;  1WGY A;  2NBV B;  4NAW B;  5KHQ A;  2XK5 B;  2DHZ A;  2L0F A;  1E8W A;  2L05 A;  4IWQ A;  4PYU A;  5E6P A;  3WAM A;  4MH0 E;  4BKS A;  3APD A;  5D7G A;  3EC8 A;  3KH0 A;  3QAR A;  3W1S A;  3W1S C;  3UF8 A;  3B1L X;  2MP2 B;  2MBO A;  3UQB A;  1BT0 A;  3Q3F A;  2L3Z A;  1OTR B;  2DAJ A;  3MTN B;  4HDO A;  2NBW B;  3PVL A;  4KSL C;  3SHQ A;  3CSF A;  1XQQ A;  2LXA A;  3KYC D;  2KMA A;  2KO3 A;  2KWU B;  4MJS A;  2CU1 A;  4GDL A;  4LJO B;  4NQK E;  4RM9 A;  2DEN B;  1C1Y B;  4XZ4 A;  5CHW A;  1WJ6 A;  2IO1 B;  2JRH A;  3WAL A;  1G6J A;  2LVQ A;  5DCN A;  2HE7 A;  2NPT A;  4WWN A;  4ZRI A;  2IY0 B;  1UD7 A;  4LJP B;  1UGM A;  2C60 A;  5JHA A;  2D2Q A;  2FID A;  3APF A;  4GIV A;  2K8H A;  4NJ7 A;  3ZIM A;  1OGW A;  1TBE A;  1S3S G;  2BF8 B;  2BKF A;  2JZ3 B;  4HCN B;  4JLC A;  2EMT A;  4BBN F;  3H7P B;  2WX1 A;  2WWZ A;  2BWE S;  2LGX A;  3L0W B;  4HK2 A;  4MGK E;  3VTW A;  4DBG A;  4HLE A;  1XD3 B;  2CHX A;  4WJP A;  1HE8 A;  4A3P A;  4IW0 A;  1IP9 A;  2MWS B;  5D94 A;  2LZ6 A;  1WY8 A;  5E6O A;  2MX2 A;  4EZJ A;  4G50 A;  2LD9 A;  4WJO A;  4II3 B;  2G4D B;  3PGE A;  5JHB A;  4J6I A;  2FCQ A;  4KIK B;  4BBN C;  1P9D U;  2FCM A;  2KWC A;  2BPS A;  4K1R B;  1V80 A;  3A1Q A;  2B3A A;  4P7I A;  2KQS A;  5AZG A;  3DVG Y;  1M94 A;  1WXV A;  2PJH A;  3HK0 A;  3DBS A;  1UEL A;  3Q3J A;  1WXM A;  1WX8 A;  2R2Q A;  3PSE B;  3A9K B;  2KDF B;  1V5O A;  2KAN A;  1P0R A;  3H7S A;  4II2 B;  2Z0E B;  2N7D A;  2NCN A;  3KUC B;  4G0N B;  5IAA C;  3ZNZ B;  1VD2 A;  5KHO A;  4LCD E;  4TV3 A;  1L2N A;  5CHF A;  5LLI A;  5J2R A;  3RZW C;  5J17 A;  3OAW A;  3IVF A;  2NBU A;  3CST A;  3V6C B;  4EZL A;  3PPA A;  2A5U A;  1ISN A;  3AXC A;  3WAN A;  4G3X B;  3ZNH B;  4JL9 A;  4ZRK A;  2KTR A;  3R7R A;  2FIF A;  3DBL I;  3S2A A;  4IM2 A;  3ZO5 B;  4EZK A;  1WJU A;  4DHZ B;  2DZM A;  2LVO A;  1WH3 A;  3DVN U;  4MSM B;  1KOT A;  3DOW A;  2LGD A;  2MW5 A;  4IWO A;  3PTF C;  3AUL A;  4MGY E;  4E71 A;  1NBF C;  1TTN A;  3IG3 A;  4NAW A;  2L76 A;  3VFK A;  2MA9 B;  4EUT A;  3RD2 A;  1LM8 B;  4JQW C;  2XK5 A;  3N32 A;  2L8J A;  2FUH B;  2KLG A;  4MGI E;  2A4Z A;  3UQA A;  5CX3 A;  4M8N A;  2KFK B;  2WYQ A;  2NVU I;  1WRD B;  2CKH B;  2JY6 A;  2RR9 A;  2MP2 A;  2R2O A;  4FJV B;  4K7S A;  2PE6 B;  1WM3 A;  3ALB A;  2KX3 A;  5AZH A;  2L00 B;  3L08 A;  1WIA A;  4W9K A;  2BWF A;  4ZYN A;  5C1Z A;  1J19 A;  4FBJ B;  3H1U A;  4GXB A;  3CMM B;  4MDK E;  5JZE B;  2RPQ A;  2MLB A;  1C3T A;  3AI5 A;  2ZZP B;  2KNB A;  3NOB A;  2IO2 B;  4HVB A;  3ENE A;  4NPN A;  2KLC A;  2UYZ B;  4TUU A;  3O65 B;  3HHM A;  3ML8 A;  3TMP B;  4CYE A;  1WR1 A;  1E8X A;  3SD5 A;  2W9N A;  2MCN B;  3AU5 A;  3HIZ A;  3MHS D;  4K7W A;  4DWF A;  4AP4 C;  1LXD A;  5TR5 A;  4JIO U;  2KKC A;  1IYF A;  2V3S A;  3ZDT A;  2BYE A;  3VTU A;  3QJZ A;  3A9J B;  3L13 A;  3PLV A;  3U8Z A;  1LFD A;  1YX6 B;  1FXT B;  5G2N A;  3VH3 B;  2O6V B;  1KLV A;  1YD8 U;  2GBK A;  3PLU A;  2Z0D B;  3K9O B;  4GB9 A;  1KJT A;  1CMX B;  2KC1 A;  2GBJ A;  3ZDM C;  4K81 A;  1H4R A;  1V81 A;  3H7P A;  3SU8 X;  2KWV B;  3IFW B;  4GN1 A;  3HM3 A;  3ZRF A;  4TQ0 A;  4GDK B;  2PPH A;  3PRM B;  2HTH A;  2DYB A;  1RRB A;  3QHT A;  2M4N A;  3U30 A;  4F1S A;  4HCP B;  3K9P B;  1D3Z A;  2LAS A;  2KC2 A;  1WMH B;  5E6N A;  4ZRJ A;  2REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...