2L05A

Solution nmr structure of the ras-binding domain of serine/threonine-protein kinase b-raf from homo sapiens, northeast structural genomics consortium target hr4694f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
HMPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR Structure of the Ras-binding domain of Serine/threonine-protein kinase B-raf from Homo sapiens, Northeast Structural Genomics Consortium Target HR4694F
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase B-raf
total genus 17
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l05A01
2DZJA 2LVPA 4AWJA 3PRMB 4TQ0A 1QZEA 2IZVB 4W9DA 3DBRI 4TV3A 2NPTA 5DPTA 4FHKA 3X0WA 1E7VA 3L10B 4EZJA 3X23A 4E74A 4MGIE 1XQQA 3U30A 3L54A 3ZVVA 4K7WA 5DPWA 2MA9B 3MJWA 3SDLC 1WX9A 1TZ1A 2KZRA 4HCNB 3ZTCA 4NNJB 4KDIC 4AP4C 4DHZB 4LJOB 2BYEA 3ZDTA 2O2VA 2FIDA 1WR1A 3M95A 2BKFA 3VTWA 2M0XA 2PJHA 4PS3A 4W9LA 5D7GA 2IYDB 4GIVA 1GG3A 3AI5A 2I1KA 3RCZA 5J18A 2KQSA 5DPSA 3ZIMA 1YJ1A 2MRPA 1WGRA 3PTFC 1WZ3A 5CHFA 4W9FA 3NOBA 2FNJB 1UZXB 3QHTA 2GBKA 4IWQA 3WANA 2EMTA 4HLEA 4FADA 1WGGA 3T9LA 3A4SC 2OOBB 5CHVC 3PHWB 2XK5A 2DYOA 4DHZE 3N3KB 1MG8A 4HVBA 1E8XA 1GNUA 3SHQA 3SD5A 2LGXA 2KWVB 4WJQA 3MHSD 1E90A 4BBNC 4EFOA 4M0WB 3ZRCA 2L05A 2CHWA 3ZNID 2R2OA 1K8RB 3EC8A 1P0RA 1YX6B 1U4AA 1Z2MA 3KW5B 3QA8A 2GBNA 1WM3A 2JPHA 4FA6A 3PV1A 3PS6A 5KHQA 2KX0A 2L0FA 3NHEB 2O2VB 5D2MB 3GOEA 4BKTA 1A5RA 3AXCA 3RT3B 4JIOU 2IY0B 3CSFA 3H9DA 2LASA 4WJOA 2KTRB 2V1YA 3VUYA 3ZW3A 4ZYNA 3JSVA 2JVCA 2ZNVB 3APCA 3A9JB 1RFAA 4GDKB 4KVGB 2D3GA 1M94A 3KUCB 3PT2B 4RMAA 1R4MI 2CHXA 2NVUI 4GMVA 3U7DA 1WJUA 2KO3A 3U8ZA 4DHJD 1WXMA 2K1FA 2MWSB 1V5TA 2MQJA 2L76A 4K81A 2ZPYA 3A4RA 5E6OA 2C9WB 2UYZB 4ICUA 3RUIB 2MW5A 1EUVB 2JT4B 2IO0B 4MGYE 4W9EA 3VVWB 2KLCA 4HDQA 3PREA 4JLCA 2RD0A 2IBIB 3KUZA 4RM8A 3ENEA 3QARA 4WAAA 3K9OB 1NDDA 3DBHI 3WAOA 2GBJA 3P2BA 1V86A 3M62B 2A5UA 3VH3B 1GC6A 5JZEB 2MP2B 1WJ6A 4DDGD 3DDCB 4DDID 1VD2A 1TTNA 3RZWC 3WALA 1WJNA 4A3PA 2JUOA 3VTUA 4MGKE 3ZNHB 4CYEA 4FJYA 4JQWC 2KXJA 3PLVA 4BOZB 2AYOB 2WX0A 3AU5A 4NJ7A 3Q3FA 1GUAB 1Q5WB 1SGHA 4KSLC 4ANWA 2REXA 3VDZA 5GMVA 1R4NI 2JY6A 1WXAA 4HPMB 4WWPA 4W9CA 3UIPB 4MM3A 3OAWA 2GMIC 4TQ1A 2ZCBA 3H1UA 5J2RA 3PVLA 1V80A 4G50A 2O6VB 3ECIA 3VTVA 5AZGA 2LXCA 1NBFC 2PE9A 3JVZX 3VAWA 4GU2A 4DHJB 3JYUA 3DCGA 1WE7A 1ZKHA 3R3MA 1CMXB 2KQ7A 3Q3JA 4FJZA 5CTRC 4KIKB 3ZDMC 3ZRFA 3QC8B 3WAMA 1HE8A 3H6NA 4BKSD 3VFKA 2N1VA 2QHOA 2BWFA 3TL5A 2AL3A 3UGBB 3D32A 2A4ZA 3ML9A 2AL6A 2LVQA 1YIWA 3DVNV 2L00B 2B3AA 4X57B 2KDBA 3UQAA 1WGYA 4GDLA 1WIAA 1KM7A 3IBEA 3IHPC 1YQBA 3ZUNA 4OVUA 3H7PA 2RPQA 1X1MA 1WY8A 2MBBB 1LXDA 2DYMA 2XBBC 2KVRA 2MBEA 1P9DU 1ZW7A 4WWNA 4IW0A 2LXAA 3DVGY 3NS8A 4K7SA 3ZLZA 1SIFA 1WI0A 3QQ8B 3QX1A 4NQLB 2RGFA 2G4DB 2MP2A 2FAZA 5G2NA 1J8CA 4HJKA 4J6IA 2BYFA 4IM2A 4HPLB 5DCNA 2LVOA 4MDKE 5D94A 4HWIB 4DK5A 1F9JA 2WYQA 2JXXA 2KTRA 1EO6A 2YVCA 4LJPB 4NPNA 2C7HA 2FUHB 2PPHA 4MJSA 5C23A 2LRUA 2BYVE 5LXHA 4KIKA 2KDFB 4NJ6A 1WMHA 2K8BA 2MCNB 3WA0A 5EDSA 3PHXB 2NCNA 3CSTA 2PE6B 2WWZA 4ZRKA 2HE7A 3M63B 2LRWA 1IP9A 1UGMA 1L7YA 1LFDA 1UBIA 4GGQA 4FBJB 2DZKA 2JZ3B 4MGZE 3H7PB 2KX3A 1ISNA 2MLBA 2WDTB 4KZ0A 2Z59B 2DENB 2V4LA 1KJTA 4DWFA 4WJNA 1Y8RC 3DQVA 4BKSA 1WXSA 1WJ4A 2FIFA 2KJHB 4LDTB 4MJSB 2LD9A 2RSUA 1E8YA 3OJ3A 5AZFA 1OEYJ 1V6EA 2CR5A 4BVUC 1E5WA 3N32A 4NQKE 1WR6E 1I35A 1YD8U 1XT9B 2NS5A 1D3ZA 1GC7A 1JRUA 1YX5B 2KJ6A 4M8MA 3IFWB 3DVNU 4ZRJA 3APDA 1XD3B 2MX2A 4ANVA 4FJVB 2CKHB 1IYFA 1KOTA 3ZNGC 1VCBA 2NBUA 4EKUA 4HCPB 1WRDB 4AOFA 2KANA 3VH4B 1E8WA 2J0KA 2FCMA 1LQBA 4IG7B 2KC1A 2AEHA 2XEWA 3V6EB 4AUQC 2DX5B 4HXDA 3A33B 2J0MA 2KN5A 3DOWA 3NY5A 2LZ6A 1V2YA 2KMCA 2KWUB 1J0GA 2VRRB 3JSVB 4GDKA 4BKGA 2G45B 2N7DA 4MEMA 2NBWB 2PEAA 2KDIA 3R66C 4PYZA 3ZNZB 5KHOA 3V61A 3ZKJC 3M3JA 2GOWA 3OLMD 5E6PA 4ANXA 3EHVA 2M1MA 1V9JA 2DYBA 3PRPB 2ASQA 2DAJA 4ICVA 1EF5A 2BKRB 4JGHB 2KLGA 3ONSA 5D6JB 3TBLD 3UF8A 1RAXA 1L2NA 2AWTA 3L16A 4YL8A 1UBQA 5JH5C 4LCDE 2M8SA 4HK2A 2C5LC 2KTFA 4F8CB 3QIJA 4IWOA 2IO3B 2NR2A 1Q0WB 2D10A 2DZMA 3GZNI 4ZRIA 3SU8X 1AARA 1GJZA 3PSEB 4NAWB 1PQSA 2KFKB 4BFRA 4NY0A 2ZVOA 4URKA 5IA7A 3VXWA 2IO2B 2XK5B 2KWCA 2NPTB 2K8HA 3S2AA 4BOSC 4IC7B 1TGZB 4OVVA 2K39A 3N30A 2N9EB 4MELA 4II3B 1SE9A 4W9IA 3VQIA 3CMMB 5AZHA 3W1SC 3UINB 3TJPA 4DXAB 2N4FA 2ZCCA 2M17A 3BINA 4W9KA 4XX5A 2IY1B 3A9KA 4TKNA 3A9KB 3PGEA 3RZFA 4EEWA 2MSED 3V6CB 1E7UA 2KKCA 2MBQA 1OTRB 2Y5BB 3KUDB 5HKHA 2I1JA 1WE6A 2JRHA 2GBRA 4WWOA 1P1AA 2UWQA 4W9HA 3C0RB 1C3TA 1IPGA 3NZUA 1J19A 4B6WA 2MBOA 4F1SA 4IM0A 4DBGA 4FN2A 3HIZA 4I6PA 4TUUA 5TR5A 3L13A 1LM8B 3R7QA 2G4SA 4CHKA 2LUEA 4ANUA 5JHAA 3QCAA 1I42A 1Q1OA 4GB9A 5L83A 2NBVB 3KVFB 3TIXA 3WAPA 3A9JA 4E3CA 3OJ4B 3QAQA 4A3OA 2WX1A 3AU4A 2FCNA 4GXBA 1H8CA 2L7RA 3BY4B 2KNBA 3DBSA 3DPDA 2HD5B 4HDOA 4N9F4 5DPRA 3EECA 1T0YA 1RLFA 2KDEB 4MSQB 2MBHA 3QK0A 1C1YB 2YLMA 2BWES 2N1WA 4PS7A 2LI5A 3KH0A 5C1ZA 2RR9A 2C60A 5BO4B 4AJWA 5AEKB 1V5OA 4JL9A 2KHWB 3LJ3A 1TBEA 1KLVA 1Z5SB 2V3SA 4FLHA 1S1QB 2ZNVC 4I6NB 4K1RB 3EFUA 3L08A 4MH0E 3L17A 1NI2A 4GDLB 5G55A 4XZ4A 2BGFA 4K7UA 3DBLI 1WM2A 4AJYB 2HJ8A 3CF6E 3HM6X 1RRBA 3VUXA 3B1LX 2CU1A 3H7SA 2KFJA 2KD0A 2ZJDA 4XC2A 4FULA 5CHWA 2EKEC 3K9PB 3KYDD 1V81A 2JWZA 2O6VA 2LGYA 4PYUA 4E71A 4EZKA 1WGDA 4EZLA 5L95C 2JZZA 2KOXA 4LDTD 2J0JA 5CX3A 2G3QB 3QJZA 4I6LB 3RYTA 4IUMB 4EUTA 2BF8B 2KC2A 1WGHA 2KK8A 1P98A 4ASWC 4BBNF 2ZPNA 2O6VD 4GOCA 3MTNB 2L0TA 4M8NA 2C7NB 2IO1B 2W9NA 4II2B 3B0AA 4CO7A 2FCQA 2JRIB 4WJPA 2K6DB 4RM9A 3AULA 2L3ZA 4B9KA 4EOYA 2D2QA 3UQBA 4NAWA 2N9PC 2LGDA 5FR6A 3A1QA 1WXVA 2K8CA 2D07B 3RULA 2J7QB 4W9GA 3LDZE 3PLUA 2D11A 3PZDA 4G0NB 1FXTB 3QWZB 2LJ5A 4W9JA 3HK0A 2ZEQA 3PPAA 2DAFA 1G6JA 3I3TB 2CHZA 4P7IA 5LXIB 2OJRA 4GN1A 2LWPA 1V49A 3ZTDA 2KJRA 3HM3A 3V60A 1UD7A 1H4RA 2C7MB 4KDLB 2M4NA 3ALBA 4KZCA 3APFA 1WX7A 2ZZPB 1E8ZA 2N9XA 2CS4A 4KSKC 3V62A 3HHMA 1EF1A 1UH6A 3VHTC 3VUWA 2JF5A 4KV2A 2L8JA 5J17A 3W1SA 4IM3A 3ML8A 1WX8A 2DZIA 3L0WB 3O65B 2ZVNA 3PRZA 1WMHB 3A1QB 4WQOB 5LLIA 4PS8A 2K6QA 4G11A 4IWPA 3UIOB 3ZO5B 2BPSA 2GBMA 3DVGX 1WFYA 2EMSA 2KFKA 1WYWB 4F7ZA 1OQYA 4B95A 3TMPB 3RD2A 2N7EA 3IVFA 3IG3A 1OEYA 2FCSA 1UELA 3TCAA 2Z0DB 3JW0X 4GSWA 4MSMB 1P3QU 2KMAA 1S3SG 3W1YA 1WF9A 2HTHA 3R7RA 3KYCD 3B08A 2Z0EB 4FHJA 2R2QA 2DHZA 5E6NA 4A20A 5JHBA 3T8MA 1WH3A 2K25A 5IAAC 4G3XB 1OGWA 3NZSA 1BT0A 1ZGUB 4ZDVA 3WIMA 1WZ0A
chains in the Genus database with same CATH superfamily
2DZJA 2RMMA 3P1MA 5DPTA 5D3DA 3FILB 3L10B 4MGIE 3L54A 5T8IA 4PK1A 5DPWA 2MA9B 2VH1A 3SDLC 1WX9A 2KZRA 2Y3AA 3B2GA 4DHZB 2PKOA 3DHIC 3M95A 3VTWA 3NVZA 2M0XA 1V8CA 4JWUC 2INPE 4GIVA 1GG3A 2I1KA 3ZIMA 2BS2B 3NOBA 4D2KA 2GBKA 5CHVC 3C8YA 4DHZE 4US8A 4HVBA 1E8XA 1E90A 3GB1A 4M0WB 3ZRCA 4UDUC 2CHWA 3ZNID 3VRAB 1K8RB 2N7JA 3AE9B 1YX6B 1U4AA 3EUB2 2GBNA 1WM3A 2IJ0A 3PS6A 4L1BA 3NHEB 3RI7C 4LNNA 5D2MB 1ET9A 4BKTA 1A5RA 4HEA1 5C3JB 4JIOU 1D5ZC 2E6XA 3BZDB 3H9DA 1HEZE 3JSVA 3DBLB 1R4MI 2WS3B 1AWDA 2KO3A 4YTNB 4HROA 1MHXA 1C79A 3LYYA 3Q3NC 1FCLA 4ICUA 3AEBB 1EWYC 4MGYE 2WXKA 3U2SC 2KLCA 3RPFC 3PREA 2RD0A 3QARA 3PZ8A 3DBHI 2BT6A 4AQ7A 2A5UA 1TTNA 3RZWC 3WALA 3H8HA 3VTUA 1IGDA 3Q8FA 4FJYA 3P4SB 3R2TA 4C00A 2REXA 5GMVA 4RGNA 3AH7A 2JY6A 4HPMB 3P63A 3U7ZA 4W9CA 5J2RA 1V80A 4G50A 2IPKD 3ECIA 2PE9A 3VAWA 3NRZA 1ZP0B 3JYUA 1WE7A 1CMXB 2M56B 4KIKB 3AN1A 1VZ7A 2QSDA 3QC8B 3WAMA 4YXDB 4XDCA 1SB3C 3VFKA 3TEWA 2N1VA 4REZA 2YEPF 3D32A 3L4PA 3DVNV 2JSVX 2L00B 3EGRA 4XGAB 2B3AA 4X57B 2KDBA 2D3BA 1KM7A 3IHPC 1YQBA 4OVUA 1LXDA 2DYMA 3ZGZA 2HTME 1FFUA 2WXGA 1WI0A 3QX1A 2WXJA 2G4DB 1L0VB 5G2NA 2AX5A 4MDKE 3AV8A 2WYQA 4LJPB 2PPHA 5C23A 2BYVE 2KDFB 4NJ6A 2H89B 4ZRKA 1E9MA 1JRPA 1IP9A 3H7PB 2WDTB 2Z59B 2V4LA 1KJTA 1KFYB 3DQVA 4TSSA 2LHEA 1WJ4A 2FIFA 2KJHB 2LD9A 2RSUA 2X38A 5AZFA 1OEYJ 1V6EA 4BVUC 1E5WA 3N32A 1D3ZA 4M8MA 1QLBB 3DVNU 5IN7A 4ZRJA 1XD3B 2MX2A 1N5XA 4EKUA 3AM9A 1WRDB 1E8WA 3AE5B 4LNIA 4Q2JA 4IG7B 2XEWA 3A33B 3DOWA 3RMKC 2N7DA 4MEMA 1QF6A 1QKZA 3I57A 4YSXB 5KHOA 5E6PA 2M1MA 1V9JA 1TIFA 5D6JB 3TBLD 4YL8A 1AYFA 4JWSC 4F8CB 2D5GA 4A9AA 2KDMA 1GJZA 1NVID 3KWVA 4NY0A 2L52A 3AE8B 2XK5B 1TGZB 4OVVA 2K39A 3N30A 1HTQA 2L83A 3Q3OC 2RDGA 3UINB 2CJOA 1I7HA 2M0AA 4EEWA 2Y5BB 2JRHA 4YTPB 1IGCA 1I4GA 1VR9A 3C0RB 3Q3MC 3NZUA 4F1SA 2BYTA 4IM0A 1AN8A 1N61A 2MH7A 3HIZA 4I6PA 3L13A 2QJLA 4CHKA 2LUEA 3QCAA 1I42A 1TS2A 4GB9A 2MJDA 3KVFB 3WAPA 2WX1A 1XLNA 1H8CA 1K53A 3BY4B 2KNBA 3E9SA 1GB1A 4MSQB 1C1YB 2N1WA 2JZPA 2V0GA 1WSPA 2C60A 5BO4B 5AEKB 4XE0A 3LJ3A 1TBEA 2KWDA 3RN9C 3V05A 5G55A 4M0WA 3ABVB 3VUXA 3H7SA 2ZJDA 4XC2A 4FULA 4H2AA 3K9PB 2O6VA 1TJEA 4RGMA 2MJEA 4EE2A 3QJZA 1YQ4B 2ZPNA 1R7SA 5HFYA 4CO7A 4RM9A 1KH0A 4EOYA 3UQBA 3I9V1 2LGDA 3P4PB 3UI3A 3A1QA 1ZOYB 2WDRB 2V4IB 1Y56A 2J7QB 3LDZE 3PLUA 2D11A 2L32A 4ARCA 1FXTB 1P7FA 2JQRB 3HK0A 2ZEQA 3FAHA 1WWTA 5LXIB 4GN1A 1V49A 3HM3A 3V60A 1PGAA 1H4RA 2Q5WD 2K3UA 3APFA 1WX7A 1QOGA 2DWQA 1ZUD2 4KSKC 4KGRA 2K22A 1C9FA 3VHTC 4KV2A 1F1HA 1T5XD 3ZYYX 2K6QA 2BPSA 1WYWB 4F7ZA 4B95A 3RD2A 2PLPA 2ICIA 3DBRB 1OEYA 2IDYA 3JW0X 4GSWA 3U4EG 1P3QU 2KMAA 4A20A 5E6NA 1FNUA 1KLUD 3N1XC 3NZSA 4YSYB 3SR6A 1OQQA 1QZEA 4P16A 3X0WA 4NAMA 3U30A 2WDQB 4K7WA 1DOYA 4C7YA 2BYEA 2O2VA 2FIDA 1WR1A 4ZYSA 2PJHA 4W9LA 1WGKA 1R4MB 5J18A 2KQSA 1WGRA 1TS3A 1WZ3A 5CHFA 4W9FA 2FNJB 1KF6B 4IWQA 2EMTA 4FADA 1WGGA 1C4AA 3N20C 3PHWB 1MG8A 3SHQA 3DBHB 1P7EA 2AQ3B 1EM7A 3MHSD 4IOIE 1ZPSA 1ROEA 4WH4A 2O2VB 1NENB 3RT3B 2IY0B 1ZDVA 1IBXA 2V1YA 3VUYA 5FR3A 3GE3C 1JWBD 3IT4B 4HKQA 1M94A 3KUCB 2NVUI 3U7DA 1CZPA 1WRIA 3GS2A 2MWSB 1V5TA 4P1BC 4K81A 2D3CA 2L76A 2MQJA 3P4QB 3N1YC 3BK1A 4W9EA 1M4VA 3Q8CA 2IBIB 4RM8A 4WAAA 1NDDA 3P2BA 1V86A 2FBWB 4YWGG 3ZNHB 2KXJA 4BOZB 1ACCA 2WX0A 1GAQB 3Q3FA 1Q5WB 1SGHA 4ANWA 1FCCC 1SE4A 1JMLA 4MM3A 2V3PA 2X8XX 4LK0M 3VTVA 5AZGA 1K52A 4B0MA 3NS1A 1XXGA 4KX6B 3RNAC 1L0XB 1JROA 3P42A 1FRDA 2KQ7A 3Q3JA 1CK1A 2JXTA 1HE8A 4C4VA 1I4RA 2QHOA 2BWFA 2TSSA 3TL5A 2AL3A 3UGBB 4RGTA 2A4ZA 3ML9A 3IBEA 3MFGA 4DQOC 1WY8A 4WWNA 2KVRA 2MBEA 1ZW7A 5I4DA 2MJ3A 4LNKA 3IAM1 2LXAA 1E10A 3DVGY 4K7SA 3QQ8B 1VRAB 1SIJA 1FRRA 4NQLB 2RGFA 3RNBC 2MP2A 1FMAD 1XO3A 3Q8EA 2BYFA 1L0YB 5DCNA 2LVOA 1D6EC 1F0ZA 2LGIA 5D94A 2VZKD 4RH6A 1F9JA 1IBXB 4K3BA 2C7HA 4ZHOA 4MJSA 4KIKA 3WA0A 3T3NA 3AE3B 4LNFA 3BYYB 1GB4A 4FBJB 1YN3A 1N63A 4WJNA 2PVOD 1R4NB 1J7AA 2CR5A 1TY0A 1TKYA 1YD8U 1XT9B 4C56C 4XWTA 1JRUA 1YX5B 2KJ6A 2WP9B 4ANVA 2LMCA 1VCBA 2NBUA 4XDDA 1FNVA 3VH4B 4YTMB 2N0SB 4HXDA 1FXIA 1PGBA 1V2YA 2KMCA 1YNTE 3FILA 2VRRB 4BKGA 1C4PA 2NBWB 3KQ4A 2KDIA 3V61A 3OLMD 3SFEB 4ANXA 2DYBA 3HVDA 2ASQA 2DAJA 4ICVA 1EF5A 4HKZE 4ARIA 3ONSA 3UF8A 1RAXA 2JWUA 1UBQA 4LCDE 1VZ8A 3QIJA 2IO3B 3TEXA 3SU8X 1AARA 1RWSA 4NAWB 1HZ5A 2J52A 2KFKB 4BFRA 4LTUA 5IA7A 2IO2B 1HXYD 4K3CA 3S2AA 4IC7B 1N5WA 4W9IA 4PT5A 1HA5A 5AZHA 1UF0A 3TJPA 2N4FA 4W9KA 2ZCCA 4XX5A 5BYRA 2AQ1B 2IY1B 3ZXVA 3A9KA 4TKNA 1KLGD 1K50A 2WXMA 5HKHA 1TYGB 3KUDB 2GBRA 1IPGA 1PDXA 1DYQA 1LO5D 4C7ZA 2N9LA 1Q1OA 2E3TA 1TY2A 3OG5A 1B1ZA 4WWMA 2JYEA 3TIXA 3A9JA 3QAQA 3BK2A 1WYGA 3DBSA 4HDOA 4N9F4 1T0YA 1RLFA 3KLSX 3QK0A 2YLMA 4PS7A 1A70A 2LI5A 2DBYA 4JL9A 1Z5SB 1S1QB 4I6NB 4MH0E 3L08A 2M19A 1NI2A 2HJ1A 4XZ4A 1QT9A 1WM2A 4CQNA 5EE1A 1L4DB 5HI1A 1QOFA 3AEDB 2EKEC 2KT7A 3KYDD 2LGYA 4EZLA 5L95C 1WGDA 4I6LB 3ZJTA 4EUTA 4B0EA 1STEA 2ACZB 4BBNF 2O6VD 4M8NA 2W9NA 2NMQA 2HDEA 2JRIB 3AE1B 1E0ZA 2K6DB 3IAS1 2L3ZA 2D2QA 4N59A 2N9PC 5FR6A 4ACFA 2WXLA 5E6JA 4TMAB 3PZDA 1G6JA 4P7IA 4OZAA 3N1ZC 1RFKA 2OJRA 2WXOA 1ZDXA 2ZW1A 3Q8BA 1UWMA 1UD7A 2INCC 4JX1C 2OEDA 4KZCA 1NEKB 2N9XA 1XLQA 3GP7A 3VUWA 2L8JA 2FE8A 5J17A 2PMVA 3W1SA 4C4VB 4IM3A 2DZIA 4KGTA 3A1QB 2W55A 4PS8A 2I38A 4IWPA 3ZO5B 3PO0A 1OFFA 1MVKA 4S0RA 2K5PA 2WQYB 3BIID 2N7EA 2FCSA 1UELA 2VH2A 3TCAA 2MHJA 2J42A 2KN4A 2G9HD 4P6VF 3BVZA 3KYCD 4FHJA 5JHBA 2DHZA 3T8MA 1FPYA 1UUPA 2WXNA 1L2NA 2ON8A 2LVPA 4AWJA 3PRMB 2IZVB 4W9DA 4FHKA 2EKIA 1E7VA 4E74A 5TSSA 2INNE 2DLBA 4R3DA 3MJWA 1TZ1A 1E7PB 3PZ7A 3ZTCA 3HVZA 4NNJB 4KDIC 1QILA 1YJIA 4M02A 1ZE3D 1SEBD 4US9A 1ZXIA 1XEEA 4GLSC 3DHGC 3IXSA 1LGRA 2BKFA 4KGSA 1BXTA 5BMGA 4ITKA 4RCOA 5D7GA 2UU7A 3RCZA 5DPSA 3NZ3A 3MC8A 1NYRA 4HLEA 1SXTA 3T9LA 2OOBB 3AMZA 2XK5A 2DYOA 3N3KB 5MPOA 1GNUA 2JU6X 2KVZA 2Z8LA 4RGOS 4WAFA 4WJQA 3W5VB 4EFOA 2R2OA 3EC8A 1N60A 1P0RA 2QCZA 1Z2MA 2B76B 3KW5B 4A6QA 2JPHA 3ETRA 4FA6A 5IKCM 1HZ6A 3ZJUA 4N58A 2W3RA 1L4ZB 3AXCA 3T3OA 3CSFA 1TS4A 1DOXA 2LASA 4WJOA 1T6BX 2MEKA 1TKEA 5AUIA 1MG4A 2JVCA 4ZYNA 3APCA 1RFAA 4KVGB 4XYCA 2D3GA 2SAKA 2PW9A 2CHXA 3EFCA 1WJUA 4RF0A 1BUIC 1WXMA 2K1FA 5E6OA 1FO4A 1HTOA 3A4RA 2C9WB 4LNOA 2UYZB 5LNK1 3VVWB 2BB6A 2GI9A 4JLCA 3K9OB 3WAOA 2GBJA 1D5XC 1F2RC 3M62B 3RNGC 2MP2B 1WJ6A 1FEHA 4DDGD 3DDCB 4IDIA 1VD2A 2PVGC 1JWAD 4OHJA 4MGKE 4CYEA 2QMTA 4JQWC 1FD6A 2Y5PA 1GUAB 4KSLC 3Q2AC 3UIPB 2W3SA 4TQ1A 2ZCBA 3H1UA 2QDFA 1JWSD 1N6ZA 2O6VB 1F2RI 1NBFC 3JVZX 4DHJB 3BVGA 1AW7A 3Q6BA 2CU3A 1C4CA 2XNAC 4FJZA 5CTRC 3ZDMC 5HG2A 1C76A 2DNFA 3H6NA 2KMMA 1V1PA 3UQAA 1WGYA 1WIAA 1NYQA 1BMLC 3ZUNA 1X1MA 1P9DU 4IW0A 4KKIA 3NS8A 4HRSA 3ZLZA 3I5JC 4WURA 1FIQA 1YQ3B 2PIAA 1J8CA 4HJKA 4HPLB 3ZXRA 2CJNA 4HWIB 5C2TB 2YVCA 3BYTB 2FUHB 5G5GA 3R2IA 5LXHA 3NJTA 2MCNB 5EDSA 1C77A 2PE6B 2WWZA 2HE7A 2LRWA 1LFDA 1UBIA 2DZKA 2BW2A 1I4XA 1ISNA 2MLBA 1MPEA 2DENB 4DWFA 2J4XA 3RNCC 1T0SC 4BKSA 1WXSA 4LDTB 2NTSA 2WGSA 1E8YA 3DWGC 3AECB 1WR6E 2NS5A 1NI3A 5AUKA 2KACA 2V9HA 2CKHB 5EE9A 5BMIA 4HCPB 3SFDB 2KANA 2J0KA 1LQBA 3V6EB 1EU3A 4AUQC 2DX5B 2KN5A 4L2YA 3NY5A 3JSVB 1FXAA 2G45B 4WIPA 2PEAA 2NTTA 3ZNZB 3ZKJC 4A90A 2LFIA 3Q69A 1E6EB 4JGHB 2KLGA 1L6VA 5EE3A 3L16A 5JH5C 2GB1A 4HK2A 2K0PA 4XWWA 2KTFA 3NVVA 4IWOA 4ZRIA 1Q0WB 2D10A 2DZMA 3GZNI 2GRIA 1YMHE 3PSEB 1PFDA 2ZW0A 2WU5B 1PQSA 4URKA 3VXWA 2NPTB 2QILA 4BOSC 3AEGB 1SE9A 5H92C 4O1NA 3BINA 2M17A 1XCQL 2INDC 3A9KB 2QC8A 1E7UA 2KKCA 2MBQA 1WE6A 3CWIA 2WXFA 2UWQA 2IGHA 1KTKA 4B6WA 5GXGB 3W2DA 4DBGA 2WHIA 4RF1A 3TSSA 3C19A 5TR5A 2WXQA 1LM8B 3R7QA 2G4SA 4ANUA 5JHAA 5L83A 2NBVB 4E3CA 4A3OA 3O13A 2FCNA 2L7RA 3ZJVA 5HHDG 2KDEB 1I4HA 3N9YC 3KH0A 3Q14C 5C1ZA 2RR9A 1PUTA 2KHWB 4FLHA 2ZNVC 4K1RB 3EFUA 1DGJA 1MFWA 3L17A 1CQVA 4GDLB 2BGFA 4K7UA 3DBLI 3B9JA 4DXFA 4AJYB 2HJ8A 3HM6X 1RRBA 3B1LX 1D4BA 2KD0A 5CHWA 1V81A 4EZKA 2JYTA 2IGDA 4LDTD 2JZZA 2KOXA 3NVWA 3RYTA 4IUMB 2KC2A 3BVMA 1WGHA 2KK8A 3IT6B 3WCQA 2LGSA 4GOCA 3MTNB 2C7NB 1SJHD 3B0AA 3AE4B 4WJPA 2R61A 4JPSA 2D3AA 3QWZB 4W9JA 1UWXA 3PPAA 3I3TB 2CHZA 5G5HA 1TZOA 2LWPA 5BYSA 2KJRA 3VR9B 2C7MB 4KDLB 4S17A 1T0RC 1JALA 2ZZPB 2KYWA 4J3OD 4LLGM 3HHMA 1ZXHA 1UH6A 4OZBA 3MC0B 2QEJC 3O65B 1SJED 4WQOB 5LLIA 2J53A 4G11A 2JX5A 5H8YE 3UIOB 4FXCA 3DVGX 2WU2B 3B2FA 2KAJA 4USAA 1KRHA 3IVFA 3IG3A 1I4PA 2Z0DB 4MSMB 1S3SG 2HTHA 2Z0EB 1WH3A 2K25A 4G3XB 1T0QC 1BT0A 1ZGUB 3WIMA 2FUG1 2WXHA 4TQ0A 1TT5B 3HUIA 3DBRI 4TV3A 2NPTA 4OW0A 2BVCA 4A55A 4EZJA 3Q8AA 3X23A 1XQQA 2H88B 4MT5A 3ZVVA 4OVZA 4ZRPA 4N6EB 4HCNB 4AP4C 4LJOB 3ZDTA 3W9CB 1SBBB 4PS3A 2IYDB 3AI5A 2YEPB 1YJ1A 2MRPA 3PTFC 2WLBA 3QHTA 1UZXB 3WANA 3P4RB 1V1PB 4RNAA 5EE0A 4AS1A 3A4SC 2L1AA 3SD5A 2LGXA 2BTEA 2KWVB 3W5UB 4BBNC 2L05A 4QAYA 1VJKA 3QA8A 3PV1A 5KHQA 2KX0A 2L0FA 2QIEB 1QOBA 3GOEA 4MH8A 4BZAA 3AB5A 2KTRB 1ESFA 3ZW3A 4GDKB 2ZNVB 3A9JB 1XLPA 4ZRQA 3PT2B 4NJCA 4RMAA 5JXVA 4GMVA 4HPPA 3U8ZA 4DHJD 1SF0A 2ZPYA 4IKGA 4YT0B 1FFVA 3RUIB 1K51A 2MW5A 1EUVB 3URYA 2JT4B 2IO0B 4ZOHC 3TUOA 4HDQA 2LUMA 3KUZA 3ENEA 3HRDD 2AQ2B 1IUEA 3VH3B 1GC6A 5JZEB 4DDID 4A3PA 1WJNA 2JUOA 2WXIA 3PLVA 1YN5A 2AYOB 3AU5A 4NJ7A 2IGGA 3EA6A 2BBCA 1L5PA 3VDZA 1R4NI 1WXAA 1WXQA 4WWPA 4RFBA 3OAWA 2GMIC 3PVLA 2LJIA 5FK9C 2LXCA 4GU2A 2EELA 3DCGA 1ZKHA 3R3MA 1TKGA 1ENFA 1HQRD 3ZRFA 1RYJA 3AEEB 4BAXA 3E56A 4BKSD 2Y5CA 2LHDA 1QQRA 2AL6A 2LVQA 1YIWA 3MHZA 4YSZB 4GDLA 3J9CA 3RNEC 3H7PA 2RPQA 1L6UA 4A8XC 3DHHC 2W54A 2MBBB 1EWCA 1QOAA 2XBBC 3I63C 1SIFA 2OHFA 1MI0A 1JCKB 2W82A 2FAZA 5BYQA 2VZKB 4P1CC 2BQQA 4J6IA 4IM2A 3OWEB 4DK5A 2JXXA 2KTRA 1EO6A 2GLSA 4NPNA 2LRUA 1SE2A 1FNWA 1WMHA 2K8BA 4NZLB 3PHXB 2NCNA 2OJWA 3CSTA 3M63B 1UGMA 1L7YA 3MJ5A 4GGQA 4MGZE 2JZ3B 1DOIA 2KX3A 5D3IB 1V97A 4KZ0A 3TEZA 3AEFB 2SEBD 1Y8RC 4MJSB 3OJ3A 3FKYA 4NQKE 1I35A 1GC7A 5FKAC 3MP9A 5IP4D 1VDVA 1GPXA 3IFWB 3APDA 4FJVB 1IYFA 1KOTA 3ZNGC 3LXFA 4AOFA 2WDVB 3NUHB 3BWUD 2FCMA 2KC1A 2AEHA 2V3NA 2I2YA 2J0MA 2LZ6A 1YOVB 2KWUB 1GOZA 1J0GA 1JQ4A 4GDKA 3VR8B 1YN4A 3R66C 4PYZA 3M3JA 2LEKA 2GOWA 3NVYA 3EHVA 3PRPB 1J7BA 2BKRB 3AE2B 2AWTA 2M8SA 2C5LC 4ZHPA 1F77A 2NR2A 1D5MC 1C78A 2BS3B 3R8BA 5BMHA 2BB5A 1XLOA 3FC4A 4KKJA 2ZVOA 2WNMA 1UGJA 2KWCA 3MC9A 1MHHE 2K8HA 4M00A 1PYWD 2N9EB 1JW9D 4MELA 4II3B 3VQIA 3CMMB 3U52E 3W1SC 4C80A 1ET6A 4DXAB 4HJGE 2RDBC 4MACA 1CJEA 1TS5A 3RZFA 3PGEA 2MSED 3V6CB 1Q10A 5IO9A 1OTRB 2I1JA 1SE3A 4WWOA 2PTLA 1P1AA 1OQRA 4W9HA 1SSNA 1C3TA 1J19A 2MBOA 1JWUD 3NG0A 4FN2A 3TEYA 4JE3B 4TUUA 2N9KA 1VLBA 1JWMD 1XF5L 3OJ4B 2K9XA 3AU4A 4GXBA 3DPDA 2HD5B 5DPRA 3EECA 3KWLA 2MBHA 2BWES 2WXPA 4OZCA 4AJWA 1V5OA 1MJDA 1KLVA 2V3SA 1B9RA 3DWMA 3CIRB 1F52A 1XCTL 3VRBB 3CF6E 3RNFC 2CU1A 2WXRA 2KFJA 2XN9C 4MM3B 2JWZA 4E71A 4PYUA 1PGXA 3AE7B 4DXGA 2J0JA 5CX3A 2G3QB 2BF8B 3AE6B 5IOIA 1P98A 4M01A 4ASWC 3ZQ4A 2L0TA 2G1EA 2IO1B 4II2B 2FCQA 1I4QA 3RFZB 3AULA 4WQMA 3LB8C 1RM6C 4B9KA 3SEBA 4NAWA 1WXVA 2K8CA 2D07B 3RULA 2RPVA 4W9GA 1VZ6A 4G0NB 2LJ5A 2DAFA 1YJJA 3AEAB 3GE8C 2KQ4X 3ZTDA 2M4NA 3ALBA 2RDHA 1E8ZA 2CS4A 1EU4A 3V62A 1EF1A 1N62A 2JF5A 1J7CA 3ML8A 1WX8A 3PRZA 3L0WB 4L23A 2ZVNA 1WMHB 1FM0D 1UNSA 2GBMA 1WFYA 2EMSA 1T3QA 2KFKA 1OQYA 3TMPB 3V3XA 2ONQA 1V1OA 3W1YA 1WF9A 3R7RA 3B08A 2R2QA 2BS4B 3GZNB 5IAAC 1OGWA 4ZDVA 1WZ0A
chains in the Genus database with same CATH topology
2DZJA 2LVPA 4AWJA 3PRMB 4TQ0A 1QZEA 2IZVB 4W9DA 3DBRI 4TV3A 2NPTA 5DPTA 4FHKA 3X0WA 1E7VA 3L10B 4EZJA 3X23A 4E74A 4MGIE 1XQQA 3U30A 3L54A 3ZVVA 4K7WA 5DPWA 2MA9B 3MJWA 3SDLC 1WX9A 1TZ1A 2KZRA 4HCNB 3ZTCA 4NNJB 4KDIC 4AP4C 4DHZB 4LJOB 2BYEA 3ZDTA 2O2VA 2FIDA 1WR1A 3M95A 2BKFA 3VTWA 2M0XA 2PJHA 4PS3A 4W9LA 5D7GA 2IYDB 4GIVA 1GG3A 3AI5A 2I1KA 3RCZA 5J18A 2KQSA 5DPSA 3ZIMA 1YJ1A 2MRPA 1WGRA 3PTFC 1WZ3A 5CHFA 4W9FA 3NOBA 2FNJB 1UZXB 3QHTA 2GBKA 4IWQA 3WANA 2EMTA 4HLEA 4FADA 1WGGA 3T9LA 3A4SC 2OOBB 5CHVC 3PHWB 2XK5A 2DYOA 4DHZE 3N3KB 1MG8A 4HVBA 1E8XA 1GNUA 3SHQA 3SD5A 2LGXA 2KWVB 4WJQA 3MHSD 1E90A 4BBNC 4EFOA 4M0WB 3ZRCA 2L05A 2CHWA 3ZNID 2R2OA 1K8RB 3EC8A 1P0RA 1YX6B 1U4AA 1Z2MA 3KW5B 3QA8A 2GBNA 1WM3A 2JPHA 4FA6A 3PV1A 3PS6A 5KHQA 2KX0A 2L0FA 3NHEB 2O2VB 5D2MB 3GOEA 4BKTA 1A5RA 3AXCA 3RT3B 4JIOU 2IY0B 3CSFA 3H9DA 2LASA 4WJOA 2KTRB 2V1YA 3VUYA 3ZW3A 4ZYNA 3JSVA 2JVCA 2ZNVB 3APCA 3A9JB 1RFAA 4GDKB 4KVGB 2D3GA 1M94A 3KUCB 3PT2B 4RMAA 1R4MI 2CHXA 2NVUI 4GMVA 3U7DA 1WJUA 2KO3A 3U8ZA 4DHJD 1WXMA 2K1FA 2MWSB 1V5TA 2MQJA 2L76A 4K81A 2ZPYA 3A4RA 5E6OA 2C9WB 2UYZB 4ICUA 3RUIB 2MW5A 1EUVB 2JT4B 2IO0B 4MGYE 4W9EA 3VVWB 2KLCA 4HDQA 3PREA 4JLCA 2RD0A 2IBIB 3KUZA 4RM8A 3ENEA 3QARA 4WAAA 3K9OB 1NDDA 3DBHI 3WAOA 2GBJA 3P2BA 1V86A 3M62B 2A5UA 3VH3B 1GC6A 5JZEB 2MP2B 1WJ6A 4DDGD 3DDCB 4DDID 1VD2A 1TTNA 3RZWC 3WALA 1WJNA 4A3PA 2JUOA 3VTUA 4MGKE 3ZNHB 4CYEA 4FJYA 4JQWC 2KXJA 3PLVA 4BOZB 2AYOB 2WX0A 3AU5A 4NJ7A 3Q3FA 1GUAB 1Q5WB 1SGHA 4KSLC 4ANWA 2REXA 3VDZA 5GMVA 1R4NI 2JY6A 1WXAA 4HPMB 4WWPA 4W9CA 3UIPB 4MM3A 3OAWA 2GMIC 4TQ1A 2ZCBA 3H1UA 5J2RA 3PVLA 1V80A 4G50A 2O6VB 3ECIA 3VTVA 5AZGA 2LXCA 1NBFC 2PE9A 3JVZX 3VAWA 4GU2A 4DHJB 3JYUA 3DCGA 1WE7A 1ZKHA 3R3MA 1CMXB 2KQ7A 3Q3JA 4FJZA 5CTRC 4KIKB 3ZDMC 3ZRFA 3QC8B 3WAMA 1HE8A 3H6NA 4BKSD 3VFKA 2N1VA 2QHOA 2BWFA 3TL5A 2AL3A 3UGBB 3D32A 2A4ZA 3ML9A 2AL6A 2LVQA 1YIWA 3DVNV 2L00B 2B3AA 4X57B 2KDBA 3UQAA 1WGYA 4GDLA 1WIAA 1KM7A 3IBEA 3IHPC 1YQBA 3ZUNA 4OVUA 3H7PA 2RPQA 1X1MA 1WY8A 2MBBB 1LXDA 2DYMA 2XBBC 2KVRA 2MBEA 1P9DU 1ZW7A 4WWNA 4IW0A 2LXAA 3DVGY 3NS8A 4K7SA 3ZLZA 1SIFA 1WI0A 3QQ8B 3QX1A 4NQLB 2RGFA 2G4DB 2MP2A 2FAZA 5G2NA 1J8CA 4HJKA 4J6IA 2BYFA 4IM2A 4HPLB 5DCNA 2LVOA 4MDKE 5D94A 4HWIB 4DK5A 1F9JA 2WYQA 2JXXA 2KTRA 1EO6A 2YVCA 4LJPB 4NPNA 2C7HA 2FUHB 2PPHA 4MJSA 5C23A 2LRUA 2BYVE 5LXHA 4KIKA 2KDFB 4NJ6A 1WMHA 2K8BA 2MCNB 3WA0A 5EDSA 3PHXB 2NCNA 3CSTA 2PE6B 2WWZA 4ZRKA 2HE7A 3M63B 2LRWA 1IP9A 1UGMA 1L7YA 1LFDA 1UBIA 4GGQA 4FBJB 2DZKA 2JZ3B 4MGZE 3H7PB 2KX3A 1ISNA 2MLBA 2WDTB 4KZ0A 2Z59B 2DENB 2V4LA 1KJTA 4DWFA 4WJNA 1Y8RC 3DQVA 4BKSA 1WXSA 1WJ4A 2FIFA 2KJHB 4LDTB 4MJSB 2LD9A 2RSUA 1E8YA 3OJ3A 5AZFA 1OEYJ 1V6EA 2CR5A 4BVUC 1E5WA 3N32A 4NQKE 1WR6E 1I35A 1YD8U 1XT9B 2NS5A 1D3ZA 1GC7A 1JRUA 1YX5B 2KJ6A 4M8MA 3IFWB 3DVNU 4ZRJA 3APDA 1XD3B 2MX2A 4ANVA 4FJVB 2CKHB 1IYFA 1KOTA 3ZNGC 1VCBA 2NBUA 4EKUA 4HCPB 1WRDB 4AOFA 2KANA 3VH4B 1E8WA 2J0KA 2FCMA 1LQBA 4IG7B 2KC1A 2AEHA 2XEWA 3V6EB 4AUQC 2DX5B 4HXDA 3A33B 2J0MA 2KN5A 3DOWA 3NY5A 2LZ6A 1V2YA 2KMCA 2KWUB 1J0GA 2VRRB 3JSVB 4GDKA 4BKGA 2G45B 2N7DA 4MEMA 2NBWB 2PEAA 2KDIA 3R66C 4PYZA 3ZNZB 5KHOA 3V61A 3ZKJC 3M3JA 2GOWA 3OLMD 5E6PA 4ANXA 3EHVA 2M1MA 1V9JA 2DYBA 3PRPB 2ASQA 2DAJA 4ICVA 1EF5A 2BKRB 4JGHB 2KLGA 3ONSA 5D6JB 3TBLD 3UF8A 1RAXA 1L2NA 2AWTA 3L16A 4YL8A 1UBQA 5JH5C 4LCDE 2M8SA 4HK2A 2C5LC 2KTFA 4F8CB 3QIJA 4IWOA 2IO3B 2NR2A 1Q0WB 2D10A 2DZMA 3GZNI 4ZRIA 3SU8X 1AARA 1GJZA 3PSEB 4NAWB 1PQSA 2KFKB 4BFRA 4NY0A 2ZVOA 4URKA 5IA7A 3VXWA 2IO2B 2XK5B 2KWCA 2NPTB 2K8HA 3S2AA 4BOSC 4IC7B 1TGZB 4OVVA 2K39A 3N30A 2N9EB 4MELA 4II3B 1SE9A 4W9IA 3VQIA 3CMMB 5AZHA 3W1SC 3UINB 3TJPA 4DXAB 2N4FA 2ZCCA 2M17A 3BINA 4W9KA 4XX5A 2IY1B 3A9KA 4TKNA 3A9KB 3PGEA 3RZFA 4EEWA 2MSED 3V6CB 1E7UA 2KKCA 2MBQA 1OTRB 2Y5BB 3KUDB 5HKHA 2I1JA 1WE6A 2JRHA 2GBRA 4WWOA 1P1AA 2UWQA 4W9HA 3C0RB 1C3TA 1IPGA 3NZUA 1J19A 4B6WA 2MBOA 4F1SA 4IM0A 4DBGA 4FN2A 3HIZA 4I6PA 4TUUA 5TR5A 3L13A 1LM8B 3R7QA 2G4SA 4CHKA 2LUEA 4ANUA 5JHAA 3QCAA 1I42A 1Q1OA 4GB9A 5L83A 2NBVB 3KVFB 3TIXA 3WAPA 3A9JA 4E3CA 3OJ4B 3QAQA 4A3OA 2WX1A 3AU4A 2FCNA 4GXBA 1H8CA 2L7RA 3BY4B 2KNBA 3DBSA 3DPDA 2HD5B 4HDOA 4N9F4 5DPRA 3EECA 1T0YA 1RLFA 2KDEB 4MSQB 2MBHA 3QK0A 1C1YB 2YLMA 2BWES 2N1WA 4PS7A 2LI5A 3KH0A 5C1ZA 2RR9A 2C60A 5BO4B 4AJWA 5AEKB 1V5OA 4JL9A 2KHWB 3LJ3A 1TBEA 1KLVA 1Z5SB 2V3SA 4FLHA 1S1QB 2ZNVC 4I6NB 4K1RB 3EFUA 3L08A 4MH0E 3L17A 1NI2A 4GDLB 5G55A 4XZ4A 2BGFA 4K7UA 3DBLI 1WM2A 4AJYB 2HJ8A 3CF6E 3HM6X 1RRBA 3VUXA 3B1LX 2CU1A 3H7SA 2KFJA 2KD0A 2ZJDA 4XC2A 4FULA 5CHWA 2EKEC 3K9PB 3KYDD 1V81A 2JWZA 2O6VA 2LGYA 4PYUA 4E71A 4EZKA 1WGDA 4EZLA 5L95C 2JZZA 2KOXA 4LDTD 2J0JA 5CX3A 2G3QB 3QJZA 4I6LB 3RYTA 4IUMB 4EUTA 2BF8B 2KC2A 1WGHA 2KK8A 1P98A 4ASWC 4BBNF 2ZPNA 2O6VD 4GOCA 3MTNB 2L0TA 4M8NA 2C7NB 2IO1B 2W9NA 4II2B 3B0AA 4CO7A 2FCQA 2JRIB 4WJPA 2K6DB 4RM9A 3AULA 2L3ZA 4B9KA 4EOYA 2D2QA 3UQBA 4NAWA 2N9PC 2LGDA 5FR6A 3A1QA 1WXVA 2K8CA 2D07B 3RULA 2J7QB 4W9GA 3LDZE 3PLUA 2D11A 3PZDA 4G0NB 1FXTB 3QWZB 2LJ5A 4W9JA 3HK0A 2ZEQA 3PPAA 2DAFA 1G6JA 3I3TB 2CHZA 4P7IA 5LXIB 2OJRA 4GN1A 2LWPA 1V49A 3ZTDA 2KJRA 3HM3A 3V60A 1UD7A 1H4RA 2C7MB 4KDLB 2M4NA 3ALBA 4KZCA 3APFA 1WX7A 2ZZPB 1E8ZA 2N9XA 2CS4A 4KSKC 3V62A 3HHMA 1EF1A 1UH6A 3VHTC 3VUWA 2JF5A 4KV2A 2L8JA 5J17A 3W1SA 4IM3A 3ML8A 1WX8A 2DZIA 3L0WB 3O65B 2ZVNA 3PRZA 1WMHB 3A1QB 4WQOB 5LLIA 4PS8A 2K6QA 4G11A 4IWPA 3UIOB 3ZO5B 2BPSA 2GBMA 3DVGX 1WFYA 2EMSA 2KFKA 1WYWB 4F7ZA 1OQYA 4B95A 3TMPB 3RD2A 2N7EA 3IVFA 3IG3A 1OEYA 2FCSA 1UELA 3TCAA 2Z0DB 3JW0X 4GSWA 4MSMB 1P3QU 2KMAA 1S3SG 3W1YA 1WF9A 2HTHA 3R7RA 3KYCD 3B08A 2Z0EB 4FHJA 2R2QA 2DHZA 5E6NA 4A20A 5JHBA 3T8MA 1WH3A 2K25A 5IAAC 4G3XB 1OGWA 3NZSA 1BT0A 1ZGUB 4ZDVA 3WIMA 1WZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZJ A;  2LVP A;  4AWJ A;  3PRM B;  4TQ0 A;  1QZE A;  2IZV B;  4W9D A;  3DBR I;  4TV3 A;  2NPT A;  5DPT A;  4FHK A;  3X0W A;  1E7V A;  3L10 B;  4EZJ A;  3X23 A;  4E74 A;  4MGI E;  1XQQ A;  3U30 A;  3L54 A;  3ZVV A;  4K7W A;  5DPW A;  2MA9 B;  3MJW A;  3SDL C;  1WX9 A;  1TZ1 A;  2KZR A;  4HCN B;  3ZTC A;  4NNJ B;  4KDI C;  4AP4 C;  4DHZ B;  4LJO B;  2BYE A;  3ZDT A;  2O2V A;  2FID A;  1WR1 A;  3M95 A;  2BKF A;  3VTW A;  2M0X A;  2PJH A;  4PS3 A;  4W9L A;  5D7G A;  2IYD B;  4GIV A;  1GG3 A;  3AI5 A;  2I1K A;  3RCZ A;  5J18 A;  2KQS A;  5DPS A;  3ZIM A;  1YJ1 A;  2MRP A;  1WGR A;  3PTF C;  1WZ3 A;  5CHF A;  4W9F A;  3NOB A;  2FNJ B;  1UZX B;  3QHT A;  2GBK A;  4IWQ A;  3WAN A;  2EMT A;  4HLE A;  4FAD A;  1WGG A;  3T9L A;  3A4S C;  2OOB B;  5CHV C;  3PHW B;  2XK5 A;  2DYO A;  4DHZ E;  3N3K B;  1MG8 A;  4HVB A;  1E8X A;  1GNU A;  3SHQ A;  3SD5 A;  2LGX A;  2KWV B;  4WJQ A;  3MHS D;  1E90 A;  4BBN C;  4EFO A;  4M0W B;  3ZRC A;  2L05 A;  2CHW A;  3ZNI D;  2R2O A;  1K8R B;  3EC8 A;  1P0R A;  1YX6 B;  1U4A A;  1Z2M A;  3KW5 B;  3QA8 A;  2GBN A;  1WM3 A;  2JPH A;  4FA6 A;  3PV1 A;  3PS6 A;  5KHQ A;  2KX0 A;  2L0F A;  3NHE B;  2O2V B;  5D2M B;  3GOE A;  4BKT A;  1A5R A;  3AXC A;  3RT3 B;  4JIO U;  2IY0 B;  3CSF A;  3H9D A;  2LAS A;  4WJO A;  2KTR B;  2V1Y A;  3VUY A;  3ZW3 A;  4ZYN A;  3JSV A;  2JVC A;  2ZNV B;  3APC A;  3A9J B;  1RFA A;  4GDK B;  4KVG B;  2D3G A;  1M94 A;  3KUC B;  3PT2 B;  4RMA A;  1R4M I;  2CHX A;  2NVU I;  4GMV A;  3U7D A;  1WJU A;  2KO3 A;  3U8Z A;  4DHJ D;  1WXM A;  2K1F A;  2MWS B;  1V5T A;  2MQJ A;  2L76 A;  4K81 A;  2ZPY A;  3A4R A;  5E6O A;  2C9W B;  2UYZ B;  4ICU A;  3RUI B;  2MW5 A;  1EUV B;  2JT4 B;  2IO0 B;  4MGY E;  4W9E A;  3VVW B;  2KLC A;  4HDQ A;  3PRE A;  4JLC A;  2RD0 A;  2IBI B;  3KUZ A;  4RM8 A;  3ENE A;  3QAR A;  4WAA A;  3K9O B;  1NDD A;  3DBH I;  3WAO A;  2GBJ A;  3P2B A;  1V86 A;  3M62 B;  2A5U A;  3VH3 B;  1GC6 A;  5JZE B;  2MP2 B;  1WJ6 A;  4DDG D;  3DDC B;  4DDI D;  1VD2 A;  1TTN A;  3RZW C;  3WAL A;  1WJN A;  4A3P A;  2JUO A;  3VTU A;  4MGK E;  3ZNH B;  4CYE A;  4FJY A;  4JQW C;  2KXJ A;  3PLV A;  4BOZ B;  2AYO B;  2WX0 A;  3AU5 A;  4NJ7 A;  3Q3F A;  1GUA B;  1Q5W B;  1SGH A;  4KSL C;  4ANW A;  2REX A;  3VDZ A;  5GMV A;  1R4N I;  2JY6 A;  1WXA A;  4HPM B;  4WWP A;  4W9C A;  3UIP B;  4MM3 A;  3OAW A;  2GMI C;  4TQ1 A;  2ZCB A;  3H1U A;  5J2R A;  3PVL A;  1V80 A;  4G50 A;  2O6V B;  3ECI A;  3VTV A;  5AZG A;  2LXC A;  1NBF C;  2PE9 A;  3JVZ X;  3VAW A;  4GU2 A;  4DHJ B;  3JYU A;  3DCG A;  1WE7 A;  1ZKH A;  3R3M A;  1CMX B;  2KQ7 A;  3Q3J A;  4FJZ A;  5CTR C;  4KIK B;  3ZDM C;  3ZRF A;  3QC8 B;  3WAM A;  1HE8 A;  3H6N A;  4BKS D;  3VFK A;  2N1V A;  2QHO A;  2BWF A;  3TL5 A;  2AL3 A;  3UGB B;  3D32 A;  2A4Z A;  3ML9 A;  2AL6 A;  2LVQ A;  1YIW A;  3DVN V;  2L00 B;  2B3A A;  4X57 B;  2KDB A;  3UQA A;  1WGY A;  4GDL A;  1WIA A;  1KM7 A;  3IBE A;  3IHP C;  1YQB A;  3ZUN A;  4OVU A;  3H7P A;  2RPQ A;  1X1M A;  1WY8 A;  2MBB B;  1LXD A;  2DYM A;  2XBB C;  2KVR A;  2MBE A;  1P9D U;  1ZW7 A;  4WWN A;  4IW0 A;  2LXA A;  3DVG Y;  3NS8 A;  4K7S A;  3ZLZ A;  1SIF A;  1WI0 A;  3QQ8 B;  3QX1 A;  4NQL B;  2RGF A;  2G4D B;  2MP2 A;  2FAZ A;  5G2N A;  1J8C A;  4HJK A;  4J6I A;  2BYF A;  4IM2 A;  4HPL B;  5DCN A;  2LVO A;  4MDK E;  5D94 A;  4HWI B;  4DK5 A;  1F9J A;  2WYQ A;  2JXX A;  2KTR A;  1EO6 A;  2YVC A;  4LJP B;  4NPN A;  2C7H A;  2FUH B;  2PPH A;  4MJS A;  5C23 A;  2LRU A;  2BYV E;  5LXH A;  4KIK A;  2KDF B;  4NJ6 A;  1WMH A;  2K8B A;  2MCN B;  3WA0 A;  5EDS A;  3PHX B;  2NCN A;  3CST A;  2PE6 B;  2WWZ A;  4ZRK A;  2HE7 A;  3M63 B;  2LRW A;  1IP9 A;  1UGM A;  1L7Y A;  1LFD A;  1UBI A;  4GGQ A;  4FBJ B;  2DZK A;  2JZ3 B;  4MGZ E;  3H7P B;  2KX3 A;  1ISN A;  2MLB A;  2WDT B;  4KZ0 A;  2Z59 B;  2DEN B;  2V4L A;  1KJT A;  4DWF A;  4WJN A;  1Y8R C;  3DQV A;  4BKS A;  1WXS A;  1WJ4 A;  2FIF A;  2KJH B;  4LDT B;  4MJS B;  2LD9 A;  2RSU A;  1E8Y A;  3OJ3 A;  5AZF A;  1OEY J;  1V6E A;  2CR5 A;  4BVU C;  1E5W A;  3N32 A;  4NQK E;  1WR6 E;  1I35 A;  1YD8 U;  1XT9 B;  2NS5 A;  1D3Z A;  1GC7 A;  1JRU A;  1YX5 B;  2KJ6 A;  4M8M A;  3IFW B;  3DVN U;  4ZRJ A;  3APD A;  1XD3 B;  2MX2 A;  4ANV A;  4FJV B;  2CKH B;  1IYF A;  1KOT A;  3ZNG C;  1VCB A;  2NBU A;  4EKU A;  4HCP B;  1WRD B;  4AOF A;  2KAN A;  3VH4 B;  1E8W A;  2J0K A;  2FCM A;  1LQB A;  4IG7 B;  2KC1 A;  2AEH A;  2XEW A;  3V6E B;  4AUQ C;  2DX5 B;  4HXD A;  3A33 B;  2J0M A;  2KN5 A;  3DOW A;  3NY5 A;  2LZ6 A;  1V2Y A;  2KMC A;  2KWU B;  1J0G A;  2VRR B;  3JSV B;  4GDK A;  4BKG A;  2G45 B;  2N7D A;  4MEM A;  2NBW B;  2PEA A;  2KDI A;  3R66 C;  4PYZ A;  3ZNZ B;  5KHO A;  3V61 A;  3ZKJ C;  3M3J A;  2GOW A;  3OLM D;  5E6P A;  4ANX A;  3EHV A;  2M1M A;  1V9J A;  2DYB A;  3PRP B;  2ASQ A;  2DAJ A;  4ICV A;  1EF5 A;  2BKR B;  4JGH B;  2KLG A;  3ONS A;  5D6J B;  3TBL D;  3UF8 A;  1RAX A;  1L2N A;  2AWT A;  3L16 A;  4YL8 A;  1UBQ A;  5JH5 C;  4LCD E;  2M8S A;  4HK2 A;  2C5L C;  2KTF A;  4F8C B;  3QIJ A;  4IWO A;  2IO3 B;  2NR2 A;  1Q0W B;  2D10 A;  2DZM A;  3GZN I;  4ZRI A;  3SU8 X;  1AAR A;  1GJZ A;  3PSE B;  4NAW B;  1PQS A;  2KFK B;  4BFR A;  4NY0 A;  2ZVO A;  4URK A;  5IA7 A;  3VXW A;  2IO2 B;  2XK5 B;  2KWC A;  2NPT B;  2K8H A;  3S2A A;  4BOS C;  4IC7 B;  1TGZ B;  4OVV A;  2K39 A;  3N30 A;  2N9E B;  4MEL A;  4II3 B;  1SE9 A;  4W9I A;  3VQI A;  3CMM B;  5AZH A;  3W1S C;  3UIN B;  3TJP A;  4DXA B;  2N4F A;  2ZCC A;  2M17 A;  3BIN A;  4W9K A;  4XX5 A;  2IY1 B;  3A9K A;  4TKN A;  3A9K B;  3PGE A;  3RZF A;  4EEW A;  2MSE D;  3V6C B;  1E7U A;  2KKC A;  2MBQ A;  1OTR B;  2Y5B B;  3KUD B;  5HKH A;  2I1J A;  1WE6 A;  2JRH A;  2GBR A;  4WWO A;  1P1A A;  2UWQ A;  4W9H A;  3C0R B;  1C3T A;  1IPG A;  3NZU A;  1J19 A;  4B6W A;  2MBO A;  4F1S A;  4IM0 A;  4DBG A;  4FN2 A;  3HIZ A;  4I6P A;  4TUU A;  5TR5 A;  3L13 A;  1LM8 B;  3R7Q A;  2G4S A;  4CHK A;  2LUE A;  4ANU A;  5JHA A;  3QCA A;  1I42 A;  1Q1O A;  4GB9 A;  5L83 A;  2NBV B;  3KVF B;  3TIX A;  3WAP A;  3A9J A;  4E3C A;  3OJ4 B;  3QAQ A;  4A3O A;  2WX1 A;  3AU4 A;  2FCN A;  4GXB A;  1H8C A;  2L7R A;  3BY4 B;  2KNB A;  3DBS A;  3DPD A;  2HD5 B;  4HDO A;  4N9F 4;  5DPR A;  3EEC A;  1T0Y A;  1RLF A;  2KDE B;  4MSQ B;  2MBH A;  3QK0 A;  1C1Y B;  2YLM A;  2BWE S;  2N1W A;  4PS7 A;  2LI5 A;  3KH0 A;  5C1Z A;  2RR9 A;  2C60 A;  5BO4 B;  4AJW A;  5AEK B;  1V5O A;  4JL9 A;  2KHW B;  3LJ3 A;  1TBE A;  1KLV A;  1Z5S B;  2V3S A;  4FLH A;  1S1Q B;  2ZNV C;  4I6N B;  4K1R B;  3EFU A;  3L08 A;  4MH0 E;  3L17 A;  1NI2 A;  4GDL B;  5G55 A;  4XZ4 A;  2BGF A;  4K7U A;  3DBL I;  1WM2 A;  4AJY B;  2HJ8 A;  3CF6 E;  3HM6 X;  1RRB A;  3VUX A;  3B1L X;  2CU1 A;  3H7S A;  2KFJ A;  2KD0 A;  2ZJD A;  4XC2 A;  4FUL A;  5CHW A;  2EKE C;  3K9P B;  3KYD D;  1V81 A;  2JWZ A;  2O6V A;  2LGY A;  4PYU A;  4E71 A;  4EZK A;  1WGD A;  4EZL A;  5L95 C;  2JZZ A;  2KOX A;  4LDT D;  2J0J A;  5CX3 A;  2G3Q B;  3QJZ A;  4I6L B;  3RYT A;  4IUM B;  4EUT A;  2BF8 B;  2KC2 A;  1WGH A;  2KK8 A;  1P98 A;  4ASW C;  4BBN F;  2ZPN A;  2O6V D;  4GOC A;  3MTN B;  2L0T A;  4M8N A;  2C7N B;  2IO1 B;  2W9N A;  4II2 B;  3B0A A;  4CO7 A;  2FCQ A;  2JRI B;  4WJP A;  2K6D B;  4RM9 A;  3AUL A;  2L3Z A;  4B9K A;  4EOY A;  2D2Q A;  3UQB A;  4NAW A;  2N9P C;  2LGD A;  5FR6 A;  3A1Q A;  1WXV A;  2K8C A;  2D07 B;  3RUL A;  2J7Q B;  4W9G A;  3LDZ E;  3PLU A;  2D11 A;  3PZD A;  4G0N B;  1FXT B;  3QWZ B;  2LJ5 A;  4W9J A;  3HK0 A;  2ZEQ A;  3PPA A;  2DAF A;  1G6J A;  3I3T B;  2CHZ A;  4P7I A;  5LXI B;  2OJR A;  4GN1 A;  2LWP A;  1V49 A;  3ZTD A;  2KJR A;  3HM3 A;  3V60 A;  1UD7 A;  1H4R A;  2C7M B;  4KDL B;  2M4N A;  3ALB A;  4KZC A;  3APF A;  1WX7 A;  2ZZP B;  1E8Z A;  2N9X A;  2CS4 A;  4KSK C;  3V62 A;  3HHM A;  1EF1 A;  1UH6 A;  3VHT C;  3VUW A;  2JF5 A;  4KV2 A;  2L8J A;  5J17 A;  3W1S A;  4IM3 A;  3ML8 A;  1WX8 A;  2DZI A;  3L0W B;  3O65 B;  2ZVN A;  3PRZ A;  1WMH B;  3A1Q B;  4WQO B;  5LLI A;  4PS8 A;  2K6Q A;  4G11 A;  4IWP A;  3UIO B;  3ZO5 B;  2BPS A;  2GBM A;  3DVG X;  1WFY A;  2EMS A;  2KFK A;  1WYW B;  4F7Z A;  1OQY A;  4B95 A;  3TMP B;  3RD2 A;  2N7E A;  3IVF A;  3IG3 A;  1OEY A;  2FCS A;  1UEL A;  3TCA A;  2Z0D B;  3JW0 X;  4GSW A;  4MSM B;  1P3Q U;  2KMA A;  1S3S G;  3W1Y A;  1WF9 A;  2HTH A;  3R7R A;  3KYC D;  3B08 A;  2Z0E B;  4FHJ A;  2R2Q A;  2DHZ A;  5E6N A;  4A20 A;  5JHB A;  3T8M A;  1WH3 A;  2K25 A;  5IAA C;  4G3X B;  1OGW A;  3NZS A;  1BT0 A;  1ZGU B;  4ZDV A;  3WIM A;  1WZ0 A; 
#chains in the Genus database with same CATH topology
 2DZJ A;  2RMM A;  3P1M A;  5DPT A;  5D3D A;  3FIL B;  3L10 B;  4MGI E;  3L54 A;  5T8I A;  4PK1 A;  5DPW A;  2MA9 B;  2VH1 A;  3SDL C;  1WX9 A;  2KZR A;  2Y3A A;  3B2G A;  4DHZ B;  2PKO A;  3DHI C;  3M95 A;  3VTW A;  3NVZ A;  2M0X A;  1V8C A;  4JWU C;  2INP E;  4GIV A;  1GG3 A;  2I1K A;  3ZIM A;  2BS2 B;  3NOB A;  4D2K A;  2GBK A;  5CHV C;  3C8Y A;  4DHZ E;  4US8 A;  4HVB A;  1E8X A;  1E90 A;  3GB1 A;  4M0W B;  3ZRC A;  4UDU C;  2CHW A;  3ZNI D;  3VRA B;  1K8R B;  2N7J A;  3AE9 B;  1YX6 B;  1U4A A;  3EUB 2;  2GBN A;  1WM3 A;  2IJ0 A;  3PS6 A;  4L1B A;  3NHE B;  3RI7 C;  4LNN A;  5D2M B;  1ET9 A;  4BKT A;  1A5R A;  4HEA 1;  5C3J B;  4JIO U;  1D5Z C;  2E6X A;  3BZD B;  3H9D A;  1HEZ E;  3JSV A;  3DBL B;  1R4M I;  2WS3 B;  1AWD A;  2KO3 A;  4YTN B;  4HRO A;  1MHX A;  1C79 A;  3LYY A;  3Q3N C;  1FCL A;  4ICU A;  3AEB B;  1EWY C;  4MGY E;  2WXK A;  3U2S C;  2KLC A;  3RPF C;  3PRE A;  2RD0 A;  3QAR A;  3PZ8 A;  3DBH I;  2BT6 A;  4AQ7 A;  2A5U A;  1TTN A;  3RZW C;  3WAL A;  3H8H A;  3VTU A;  1IGD A;  3Q8F A;  4FJY A;  3P4S B;  3R2T A;  4C00 A;  2REX A;  5GMV A;  4RGN A;  3AH7 A;  2JY6 A;  4HPM B;  3P63 A;  3U7Z A;  4W9C A;  5J2R A;  1V80 A;  4G50 A;  2IPK D;  3ECI A;  2PE9 A;  3VAW A;  3NRZ A;  1ZP0 B;  3JYU A;  1WE7 A;  1CMX B;  2M56 B;  4KIK B;  3AN1 A;  1VZ7 A;  2QSD A;  3QC8 B;  3WAM A;  4YXD B;  4XDC A;  1SB3 C;  3VFK A;  3TEW A;  2N1V A;  4REZ A;  2YEP F;  3D32 A;  3L4P A;  3DVN V;  2JSV X;  2L00 B;  3EGR A;  4XGA B;  2B3A A;  4X57 B;  2KDB A;  2D3B A;  1KM7 A;  3IHP C;  1YQB A;  4OVU A;  1LXD A;  2DYM A;  3ZGZ A;  2HTM E;  1FFU A;  2WXG A;  1WI0 A;  3QX1 A;  2WXJ A;  2G4D B;  1L0V B;  5G2N A;  2AX5 A;  4MDK E;  3AV8 A;  2WYQ A;  4LJP B;  2PPH A;  5C23 A;  2BYV E;  2KDF B;  4NJ6 A;  2H89 B;  4ZRK A;  1E9M A;  1JRP A;  1IP9 A;  3H7P B;  2WDT B;  2Z59 B;  2V4L A;  1KJT A;  1KFY B;  3DQV A;  4TSS A;  2LHE A;  1WJ4 A;  2FIF A;  2KJH B;  2LD9 A;  2RSU A;  2X38 A;  5AZF A;  1OEY J;  1V6E A;  4BVU C;  1E5W A;  3N32 A;  1D3Z A;  4M8M A;  1QLB B;  3DVN U;  5IN7 A;  4ZRJ A;  1XD3 B;  2MX2 A;  1N5X A;  4EKU A;  3AM9 A;  1WRD B;  1E8W A;  3AE5 B;  4LNI A;  4Q2J A;  4IG7 B;  2XEW A;  3A33 B;  3DOW A;  3RMK C;  2N7D A;  4MEM A;  1QF6 A;  1QKZ A;  3I57 A;  4YSX B;  5KHO A;  5E6P A;  2M1M A;  1V9J A;  1TIF A;  5D6J B;  3TBL D;  4YL8 A;  1AYF A;  4JWS C;  4F8C B;  2D5G A;  4A9A A;  2KDM A;  1GJZ A;  1NVI D;  3KWV A;  4NY0 A;  2L52 A;  3AE8 B;  2XK5 B;  1TGZ B;  4OVV A;  2K39 A;  3N30 A;  1HTQ A;  2L83 A;  3Q3O C;  2RDG A;  3UIN B;  2CJO A;  1I7H A;  2M0A A;  4EEW A;  2Y5B B;  2JRH A;  4YTP B;  1IGC A;  1I4G A;  1VR9 A;  3C0R B;  3Q3M C;  3NZU A;  4F1S A;  2BYT A;  4IM0 A;  1AN8 A;  1N61 A;  2MH7 A;  3HIZ A;  4I6P A;  3L13 A;  2QJL A;  4CHK A;  2LUE A;  3QCA A;  1I42 A;  1TS2 A;  4GB9 A;  2MJD A;  3KVF B;  3WAP A;  2WX1 A;  1XLN A;  1H8C A;  1K53 A;  3BY4 B;  2KNB A;  3E9S A;  1GB1 A;  4MSQ B;  1C1Y B;  2N1W A;  2JZP A;  2V0G A;  1WSP A;  2C60 A;  5BO4 B;  5AEK B;  4XE0 A;  3LJ3 A;  1TBE A;  2KWD A;  3RN9 C;  3V05 A;  5G55 A;  4M0W A;  3ABV B;  3VUX A;  3H7S A;  2ZJD A;  4XC2 A;  4FUL A;  4H2A A;  3K9P B;  2O6V A;  1TJE A;  4RGM A;  2MJE A;  4EE2 A;  3QJZ A;  1YQ4 B;  2ZPN A;  1R7S A;  5HFY A;  4CO7 A;  4RM9 A;  1KH0 A;  4EOY A;  3UQB A;  3I9V 1;  2LGD A;  3P4P B;  3UI3 A;  3A1Q A;  1ZOY B;  2WDR B;  2V4I B;  1Y56 A;  2J7Q B;  3LDZ E;  3PLU A;  2D11 A;  2L32 A;  4ARC A;  1FXT B;  1P7F A;  2JQR B;  3HK0 A;  2ZEQ A;  3FAH A;  1WWT A;  5LXI B;  4GN1 A;  1V49 A;  3HM3 A;  3V60 A;  1PGA A;  1H4R A;  2Q5W D;  2K3U A;  3APF A;  1WX7 A;  1QOG A;  2DWQ A;  1ZUD 2;  4KSK C;  4KGR A;  2K22 A;  1C9F A;  3VHT C;  4KV2 A;  1F1H A;  1T5X D;  3ZYY X;  2K6Q A;  2BPS A;  1WYW B;  4F7Z A;  4B95 A;  3RD2 A;  2PLP A;  2ICI A;  3DBR B;  1OEY A;  2IDY A;  3JW0 X;  4GSW A;  3U4E G;  1P3Q U;  2KMA A;  4A20 A;  5E6N A;  1FNU A;  1KLU D;  3N1X C;  3NZS A;  4YSY B;  3SR6 A;  1OQQ A;  1QZE A;  4P16 A;  3X0W A;  4NAM A;  3U30 A;  2WDQ B;  4K7W A;  1DOY A;  4C7Y A;  2BYE A;  2O2V A;  2FID A;  1WR1 A;  4ZYS A;  2PJH A;  4W9L A;  1WGK A;  1R4M B;  5J18 A;  2KQS A;  1WGR A;  1TS3 A;  1WZ3 A;  5CHF A;  4W9F A;  2FNJ B;  1KF6 B;  4IWQ A;  2EMT A;  4FAD A;  1WGG A;  1C4A A;  3N20 C;  3PHW B;  1MG8 A;  3SHQ A;  3DBH B;  1P7E A;  2AQ3 B;  1EM7 A;  3MHS D;  4IOI E;  1ZPS A;  1ROE A;  4WH4 A;  2O2V B;  1NEN B;  3RT3 B;  2IY0 B;  1ZDV A;  1IBX A;  2V1Y A;  3VUY A;  5FR3 A;  3GE3 C;  1JWB D;  3IT4 B;  4HKQ A;  1M94 A;  3KUC B;  2NVU I;  3U7D A;  1CZP A;  1WRI A;  3GS2 A;  2MWS B;  1V5T A;  4P1B C;  4K81 A;  2D3C A;  2L76 A;  2MQJ A;  3P4Q B;  3N1Y C;  3BK1 A;  4W9E A;  1M4V A;  3Q8C A;  2IBI B;  4RM8 A;  4WAA A;  1NDD A;  3P2B A;  1V86 A;  2FBW B;  4YWG G;  3ZNH B;  2KXJ A;  4BOZ B;  1ACC A;  2WX0 A;  1GAQ B;  3Q3F A;  1Q5W B;  1SGH A;  4ANW A;  1FCC C;  1SE4 A;  1JML A;  4MM3 A;  2V3P A;  2X8X X;  4LK0 M;  3VTV A;  5AZG A;  1K52 A;  4B0M A;  3NS1 A;  1XXG A;  4KX6 B;  3RNA C;  1L0X B;  1JRO A;  3P42 A;  1FRD A;  2KQ7 A;  3Q3J A;  1CK1 A;  2JXT A;  1HE8 A;  4C4V A;  1I4R A;  2QHO A;  2BWF A;  2TSS A;  3TL5 A;  2AL3 A;  3UGB B;  4RGT A;  2A4Z A;  3ML9 A;  3IBE A;  3MFG A;  4DQO C;  1WY8 A;  4WWN A;  2KVR A;  2MBE A;  1ZW7 A;  5I4D A;  2MJ3 A;  4LNK A;  3IAM 1;  2LXA A;  1E10 A;  3DVG Y;  4K7S A;  3QQ8 B;  1VRA B;  1SIJ A;  1FRR A;  4NQL B;  2RGF A;  3RNB C;  2MP2 A;  1FMA D;  1XO3 A;  3Q8E A;  2BYF A;  1L0Y B;  5DCN A;  2LVO A;  1D6E C;  1F0Z A;  2LGI A;  5D94 A;  2VZK D;  4RH6 A;  1F9J A;  1IBX B;  4K3B A;  2C7H A;  4ZHO A;  4MJS A;  4KIK A;  3WA0 A;  3T3N A;  3AE3 B;  4LNF A;  3BYY B;  1GB4 A;  4FBJ B;  1YN3 A;  1N63 A;  4WJN A;  2PVO D;  1R4N B;  1J7A A;  2CR5 A;  1TY0 A;  1TKY A;  1YD8 U;  1XT9 B;  4C56 C;  4XWT A;  1JRU A;  1YX5 B;  2KJ6 A;  2WP9 B;  4ANV A;  2LMC A;  1VCB A;  2NBU A;  4XDD A;  1FNV A;  3VH4 B;  4YTM B;  2N0S B;  4HXD A;  1FXI A;  1PGB A;  1V2Y A;  2KMC A;  1YNT E;  3FIL A;  2VRR B;  4BKG A;  1C4P A;  2NBW B;  3KQ4 A;  2KDI A;  3V61 A;  3OLM D;  3SFE B;  4ANX A;  2DYB A;  3HVD A;  2ASQ A;  2DAJ A;  4ICV A;  1EF5 A;  4HKZ E;  4ARI A;  3ONS A;  3UF8 A;  1RAX A;  2JWU A;  1UBQ A;  4LCD E;  1VZ8 A;  3QIJ A;  2IO3 B;  3TEX A;  3SU8 X;  1AAR A;  1RWS A;  4NAW B;  1HZ5 A;  2J52 A;  2KFK B;  4BFR A;  4LTU A;  5IA7 A;  2IO2 B;  1HXY D;  4K3C A;  3S2A A;  4IC7 B;  1N5W A;  4W9I A;  4PT5 A;  1HA5 A;  5AZH A;  1UF0 A;  3TJP A;  2N4F A;  4W9K A;  2ZCC A;  4XX5 A;  5BYR A;  2AQ1 B;  2IY1 B;  3ZXV A;  3A9K A;  4TKN A;  1KLG D;  1K50 A;  2WXM A;  5HKH A;  1TYG B;  3KUD B;  2GBR A;  1IPG A;  1PDX A;  1DYQ A;  1LO5 D;  4C7Z A;  2N9L A;  1Q1O A;  2E3T A;  1TY2 A;  3OG5 A;  1B1Z A;  4WWM A;  2JYE A;  3TIX A;  3A9J A;  3QAQ A;  3BK2 A;  1WYG A;  3DBS A;  4HDO A;  4N9F 4;  1T0Y A;  1RLF A;  3KLS X;  3QK0 A;  2YLM A;  4PS7 A;  1A70 A;  2LI5 A;  2DBY A;  4JL9 A;  1Z5S B;  1S1Q B;  4I6N B;  4MH0 E;  3L08 A;  2M19 A;  1NI2 A;  2HJ1 A;  4XZ4 A;  1QT9 A;  1WM2 A;  4CQN A;  5EE1 A;  1L4D B;  5HI1 A;  1QOF A;  3AED B;  2EKE C;  2KT7 A;  3KYD D;  2LGY A;  4EZL A;  5L95 C;  1WGD A;  4I6L B;  3ZJT A;  4EUT A;  4B0E A;  1STE A;  2ACZ B;  4BBN F;  2O6V D;  4M8N A;  2W9N A;  2NMQ A;  2HDE A;  2JRI B;  3AE1 B;  1E0Z A;  2K6D B;  3IAS 1;  2L3Z A;  2D2Q A;  4N59 A;  2N9P C;  5FR6 A;  4ACF A;  2WXL A;  5E6J A;  4TMA B;  3PZD A;  1G6J A;  4P7I A;  4OZA A;  3N1Z C;  1RFK A;  2OJR A;  2WXO A;  1ZDX A;  2ZW1 A;  3Q8B A;  1UWM A;  1UD7 A;  2INC C;  4JX1 C;  2OED A;  4KZC A;  1NEK B;  2N9X A;  1XLQ A;  3GP7 A;  3VUW A;  2L8J A;  2FE8 A;  5J17 A;  2PMV A;  3W1S A;  4C4V B;  4IM3 A;  2DZI A;  4KGT A;  3A1Q B;  2W55 A;  4PS8 A;  2I38 A;  4IWP A;  3ZO5 B;  3PO0 A;  1OFF A;  1MVK A;  4S0R A;  2K5P A;  2WQY B;  3BII D;  2N7E A;  2FCS A;  1UEL A;  2VH2 A;  3TCA A;  2MHJ A;  2J42 A;  2KN4 A;  2G9H D;  4P6V F;  3BVZ A;  3KYC D;  4FHJ A;  5JHB A;  2DHZ A;  3T8M A;  1FPY A;  1UUP A;  2WXN A;  1L2N A;  2ON8 A;  2LVP A;  4AWJ A;  3PRM B;  2IZV B;  4W9D A;  4FHK A;  2EKI A;  1E7V A;  4E74 A;  5TSS A;  2INN E;  2DLB A;  4R3D A;  3MJW A;  1TZ1 A;  1E7P B;  3PZ7 A;  3ZTC A;  3HVZ A;  4NNJ B;  4KDI C;  1QIL A;  1YJI A;  4M02 A;  1ZE3 D;  1SEB D;  4US9 A;  1ZXI A;  1XEE A;  4GLS C;  3DHG C;  3IXS A;  1LGR A;  2BKF A;  4KGS A;  1BXT A;  5BMG A;  4ITK A;  4RCO A;  5D7G A;  2UU7 A;  3RCZ A;  5DPS A;  3NZ3 A;  3MC8 A;  1NYR A;  4HLE A;  1SXT A;  3T9L A;  2OOB B;  3AMZ A;  2XK5 A;  2DYO A;  3N3K B;  5MPO A;  1GNU A;  2JU6 X;  2KVZ A;  2Z8L A;  4RGO S;  4WAF A;  4WJQ A;  3W5V B;  4EFO A;  2R2O A;  3EC8 A;  1N60 A;  1P0R A;  2QCZ A;  1Z2M A;  2B76 B;  3KW5 B;  4A6Q A;  2JPH A;  3ETR A;  4FA6 A;  5IKC M;  1HZ6 A;  3ZJU A;  4N58 A;  2W3R A;  1L4Z B;  3AXC A;  3T3O A;  3CSF A;  1TS4 A;  1DOX A;  2LAS A;  4WJO A;  1T6B X;  2MEK A;  1TKE A;  5AUI A;  1MG4 A;  2JVC A;  4ZYN A;  3APC A;  1RFA A;  4KVG B;  4XYC A;  2D3G A;  2SAK A;  2PW9 A;  2CHX A;  3EFC A;  1WJU A;  4RF0 A;  1BUI C;  1WXM A;  2K1F A;  5E6O A;  1FO4 A;  1HTO A;  3A4R A;  2C9W B;  4LNO A;  2UYZ B;  5LNK 1;  3VVW B;  2BB6 A;  2GI9 A;  4JLC A;  3K9O B;  3WAO A;  2GBJ A;  1D5X C;  1F2R C;  3M62 B;  3RNG C;  2MP2 B;  1WJ6 A;  1FEH A;  4DDG D;  3DDC B;  4IDI A;  1VD2 A;  2PVG C;  1JWA D;  4OHJ A;  4MGK E;  4CYE A;  2QMT A;  4JQW C;  1FD6 A;  2Y5P A;  1GUA B;  4KSL C;  3Q2A C;  3UIP B;  2W3S A;  4TQ1 A;  2ZCB A;  3H1U A;  2QDF A;  1JWS D;  1N6Z A;  2O6V B;  1F2R I;  1NBF C;  3JVZ X;  4DHJ B;  3BVG A;  1AW7 A;  3Q6B A;  2CU3 A;  1C4C A;  2XNA C;  4FJZ A;  5CTR C;  3ZDM C;  5HG2 A;  1C76 A;  2DNF A;  3H6N A;  2KMM A;  1V1P A;  3UQA A;  1WGY A;  1WIA A;  1NYQ A;  1BML C;  3ZUN A;  1X1M A;  1P9D U;  4IW0 A;  4KKI A;  3NS8 A;  4HRS A;  3ZLZ A;  3I5J C;  4WUR A;  1FIQ A;  1YQ3 B;  2PIA A;  1J8C A;  4HJK A;  4HPL B;  3ZXR A;  2CJN A;  4HWI B;  5C2T B;  2YVC A;  3BYT B;  2FUH B;  5G5G A;  3R2I A;  5LXH A;  3NJT A;  2MCN B;  5EDS A;  1C77 A;  2PE6 B;  2WWZ A;  2HE7 A;  2LRW A;  1LFD A;  1UBI A;  2DZK A;  2BW2 A;  1I4X A;  1ISN A;  2MLB A;  1MPE A;  2DEN B;  4DWF A;  2J4X A;  3RNC C;  1T0S C;  4BKS A;  1WXS A;  4LDT B;  2NTS A;  2WGS A;  1E8Y A;  3DWG C;  3AEC B;  1WR6 E;  2NS5 A;  1NI3 A;  5AUK A;  2KAC A;  2V9H A;  2CKH B;  5EE9 A;  5BMI A;  4HCP B;  3SFD B;  2KAN A;  2J0K A;  1LQB A;  3V6E B;  1EU3 A;  4AUQ C;  2DX5 B;  2KN5 A;  4L2Y A;  3NY5 A;  3JSV B;  1FXA A;  2G45 B;  4WIP A;  2PEA A;  2NTT A;  3ZNZ B;  3ZKJ C;  4A90 A;  2LFI A;  3Q69 A;  1E6E B;  4JGH B;  2KLG A;  1L6V A;  5EE3 A;  3L16 A;  5JH5 C;  2GB1 A;  4HK2 A;  2K0P A;  4XWW A;  2KTF A;  3NVV A;  4IWO A;  4ZRI A;  1Q0W B;  2D10 A;  2DZM A;  3GZN I;  2GRI A;  1YMH E;  3PSE B;  1PFD A;  2ZW0 A;  2WU5 B;  1PQS A;  4URK A;  3VXW A;  2NPT B;  2QIL A;  4BOS C;  3AEG B;  1SE9 A;  5H92 C;  4O1N A;  3BIN A;  2M17 A;  1XCQ L;  2IND C;  3A9K B;  2QC8 A;  1E7U A;  2KKC A;  2MBQ A;  1WE6 A;  3CWI A;  2WXF A;  2UWQ A;  2IGH A;  1KTK A;  4B6W A;  5GXG B;  3W2D A;  4DBG A;  2WHI A;  4RF1 A;  3TSS A;  3C19 A;  5TR5 A;  2WXQ A;  1LM8 B;  3R7Q A;  2G4S A;  4ANU A;  5JHA A;  5L83 A;  2NBV B;  4E3C A;  4A3O A;  3O13 A;  2FCN A;  2L7R A;  3ZJV A;  5HHD G;  2KDE B;  1I4H A;  3N9Y C;  3KH0 A;  3Q14 C;  5C1Z A;  2RR9 A;  1PUT A;  2KHW B;  4FLH A;  2ZNV C;  4K1R B;  3EFU A;  1DGJ A;  1MFW A;  3L17 A;  1CQV A;  4GDL B;  2BGF A;  4K7U A;  3DBL I;  3B9J A;  4DXF A;  4AJY B;  2HJ8 A;  3HM6 X;  1RRB A;  3B1L X;  1D4B A;  2KD0 A;  5CHW A;  1V81 A;  4EZK A;  2JYT A;  2IGD A;  4LDT D;  2JZZ A;  2KOX A;  3NVW A;  3RYT A;  4IUM B;  2KC2 A;  3BVM A;  1WGH A;  2KK8 A;  3IT6 B;  3WCQ A;  2LGS A;  4GOC A;  3MTN B;  2C7N B;  1SJH D;  3B0A A;  3AE4 B;  4WJP A;  2R61 A;  4JPS A;  2D3A A;  3QWZ B;  4W9J A;  1UWX A;  3PPA A;  3I3T B;  2CHZ A;  5G5H A;  1TZO A;  2LWP A;  5BYS A;  2KJR A;  3VR9 B;  2C7M B;  4KDL B;  4S17 A;  1T0R C;  1JAL A;  2ZZP B;  2KYW A;  4J3O D;  4LLG M;  3HHM A;  1ZXH A;  1UH6 A;  4OZB A;  3MC0 B;  2QEJ C;  3O65 B;  1SJE D;  4WQO B;  5LLI A;  2J53 A;  4G11 A;  2JX5 A;  5H8Y E;  3UIO B;  4FXC A;  3DVG X;  2WU2 B;  3B2F A;  2KAJ A;  4USA A;  1KRH A;  3IVF A;  3IG3 A;  1I4P A;  2Z0D B;  4MSM B;  1S3S G;  2HTH A;  2Z0E B;  1WH3 A;  2K25 A;  4G3X B;  1T0Q C;  1BT0 A;  1ZGU B;  3WIM A;  2FUG 1;  2WXH A;  4TQ0 A;  1TT5 B;  3HUI A;  3DBR I;  4TV3 A;  2NPT A;  4OW0 A;  2BVC A;  4A55 A;  4EZJ A;  3Q8A A;  3X23 A;  1XQQ A;  2H88 B;  4MT5 A;  3ZVV A;  4OVZ A;  4ZRP A;  4N6E B;  4HCN B;  4AP4 C;  4LJO B;  3ZDT A;  3W9C B;  1SBB B;  4PS3 A;  2IYD B;  3AI5 A;  2YEP B;  1YJ1 A;  2MRP A;  3PTF C;  2WLB A;  3QHT A;  1UZX B;  3WAN A;  3P4R B;  1V1P B;  4RNA A;  5EE0 A;  4AS1 A;  3A4S C;  2L1A A;  3SD5 A;  2LGX A;  2BTE A;  2KWV B;  3W5U B;  4BBN C;  2L05 A;  4QAY A;  1VJK A;  3QA8 A;  3PV1 A;  5KHQ A;  2KX0 A;  2L0F A;  2QIE B;  1QOB A;  3GOE A;  4MH8 A;  4BZA A;  3AB5 A;  2KTR B;  1ESF A;  3ZW3 A;  4GDK B;  2ZNV B;  3A9J B;  1XLP A;  4ZRQ A;  3PT2 B;  4NJC A;  4RMA A;  5JXV A;  4GMV A;  4HPP A;  3U8Z A;  4DHJ D;  1SF0 A;  2ZPY A;  4IKG A;  4YT0 B;  1FFV A;  3RUI B;  1K51 A;  2MW5 A;  1EUV B;  3URY A;  2JT4 B;  2IO0 B;  4ZOH C;  3TUO A;  4HDQ A;  2LUM A;  3KUZ A;  3ENE A;  3HRD D;  2AQ2 B;  1IUE A;  3VH3 B;  1GC6 A;  5JZE B;  4DDI D;  4A3P A;  1WJN A;  2JUO A;  2WXI A;  3PLV A;  1YN5 A;  2AYO B;  3AU5 A;  4NJ7 A;  2IGG A;  3EA6 A;  2BBC A;  1L5P A;  3VDZ A;  1R4N I;  1WXA A;  1WXQ A;  4WWP A;  4RFB A;  3OAW A;  2GMI C;  3PVL A;  2LJI A;  5FK9 C;  2LXC A;  4GU2 A;  2EEL A;  3DCG A;  1ZKH A;  3R3M A;  1TKG A;  1ENF A;  1HQR D;  3ZRF A;  1RYJ A;  3AEE B;  4BAX A;  3E56 A;  4BKS D;  2Y5C A;  2LHD A;  1QQR A;  2AL6 A;  2LVQ A;  1YIW A;  3MHZ A;  4YSZ B;  4GDL A;  3J9C A;  3RNE C;  3H7P A;  2RPQ A;  1L6U A;  4A8X C;  3DHH C;  2W54 A;  2MBB B;  1EWC A;  1QOA A;  2XBB C;  3I63 C;  1SIF A;  2OHF A;  1MI0 A;  1JCK B;  2W82 A;  2FAZ A;  5BYQ A;  2VZK B;  4P1C C;  2BQQ A;  4J6I A;  4IM2 A;  3OWE B;  4DK5 A;  2JXX A;  2KTR A;  1EO6 A;  2GLS A;  4NPN A;  2LRU A;  1SE2 A;  1FNW A;  1WMH A;  2K8B A;  4NZL B;  3PHX B;  2NCN A;  2OJW A;  3CST A;  3M63 B;  1UGM A;  1L7Y A;  3MJ5 A;  4GGQ A;  4MGZ E;  2JZ3 B;  1DOI A;  2KX3 A;  5D3I B;  1V97 A;  4KZ0 A;  3TEZ A;  3AEF B;  2SEB D;  1Y8R C;  4MJS B;  3OJ3 A;  3FKY A;  4NQK E;  1I35 A;  1GC7 A;  5FKA C;  3MP9 A;  5IP4 D;  1VDV A;  1GPX A;  3IFW B;  3APD A;  4FJV B;  1IYF A;  1KOT A;  3ZNG C;  3LXF A;  4AOF A;  2WDV B;  3NUH B;  3BWU D;  2FCM A;  2KC1 A;  2AEH A;  2V3N A;  2I2Y A;  2J0M A;  2LZ6 A;  1YOV B;  2KWU B;  1GOZ A;  1J0G A;  1JQ4 A;  4GDK A;  3VR8 B;  1YN4 A;  3R66 C;  4PYZ A;  3M3J A;  2LEK A;  2GOW A;  3NVY A;  3EHV A;  3PRP B;  1J7B A;  2BKR B;  3AE2 B;  2AWT A;  2M8S A;  2C5L C;  4ZHP A;  1F77 A;  2NR2 A;  1D5M C;  1C78 A;  2BS3 B;  3R8B A;  5BMH A;  2BB5 A;  1XLO A;  3FC4 A;  4KKJ A;  2ZVO A;  2WNM A;  1UGJ A;  2KWC A;  3MC9 A;  1MHH E;  2K8H A;  4M00 A;  1PYW D;  2N9E B;  1JW9 D;  4MEL A;  4II3 B;  3VQI A;  3CMM B;  3U52 E;  3W1S C;  4C80 A;  1ET6 A;  4DXA B;  4HJG E;  2RDB C;  4MAC A;  1CJE A;  1TS5 A;  3RZF A;  3PGE A;  2MSE D;  3V6C B;  1Q10 A;  5IO9 A;  1OTR B;  2I1J A;  1SE3 A;  4WWO A;  2PTL A;  1P1A A;  1OQR A;  4W9H A;  1SSN A;  1C3T A;  1J19 A;  2MBO A;  1JWU D;  3NG0 A;  4FN2 A;  3TEY A;  4JE3 B;  4TUU A;  2N9K A;  1VLB A;  1JWM D;  1XF5 L;  3OJ4 B;  2K9X A;  3AU4 A;  4GXB A;  3DPD A;  2HD5 B;  5DPR A;  3EEC A;  3KWL A;  2MBH A;  2BWE S;  2WXP A;  4OZC A;  4AJW A;  1V5O A;  1MJD A;  1KLV A;  2V3S A;  1B9R A;  3DWM A;  3CIR B;  1F52 A;  1XCT L;  3VRB B;  3CF6 E;  3RNF C;  2CU1 A;  2WXR A;  2KFJ A;  2XN9 C;  4MM3 B;  2JWZ A;  4E71 A;  4PYU A;  1PGX A;  3AE7 B;  4DXG A;  2J0J A;  5CX3 A;  2G3Q B;  2BF8 B;  3AE6 B;  5IOI A;  1P98 A;  4M01 A;  4ASW C;  3ZQ4 A;  2L0T A;  2G1E A;  2IO1 B;  4II2 B;  2FCQ A;  1I4Q A;  3RFZ B;  3AUL A;  4WQM A;  3LB8 C;  1RM6 C;  4B9K A;  3SEB A;  4NAW A;  1WXV A;  2K8C A;  2D07 B;  3RUL A;  2RPV A;  4W9G A;  1VZ6 A;  4G0N B;  2LJ5 A;  2DAF A;  1YJJ A;  3AEA B;  3GE8 C;  2KQ4 X;  3ZTD A;  2M4N A;  3ALB A;  2RDH A;  1E8Z A;  2CS4 A;  1EU4 A;  3V62 A;  1EF1 A;  1N62 A;  2JF5 A;  1J7C A;  3ML8 A;  1WX8 A;  3PRZ A;  3L0W B;  4L23 A;  2ZVN A;  1WMH B;  1FM0 D;  1UNS A;  2GBM A;  1WFY A;  2EMS A;  1T3Q A;  2KFK A;  1OQY A;  3TMP B;  3V3X A;  2ONQ A;  1V1O A;  3W1Y A;  1WF9 A;  3R7R A;  3B08 A;  2R2Q A;  2BS4 B;  3GZN B;  5IAA C;  1OGW A;  4ZDV A;  1WZ0 A; 
#chains in the Genus database with same CATH homology
 2DZJ A;  2LVP A;  4AWJ A;  3PRM B;  4TQ0 A;  1QZE A;  2IZV B;  4W9D A;  3DBR I;  4TV3 A;  2NPT A;  5DPT A;  4FHK A;  3X0W A;  1E7V A;  3L10 B;  4EZJ A;  3X23 A;  4E74 A;  4MGI E;  1XQQ A;  3U30 A;  3L54 A;  3ZVV A;  4K7W A;  5DPW A;  2MA9 B;  3MJW A;  3SDL C;  1WX9 A;  1TZ1 A;  2KZR A;  4HCN B;  3ZTC A;  4NNJ B;  4KDI C;  4AP4 C;  4DHZ B;  4LJO B;  2BYE A;  3ZDT A;  2O2V A;  2FID A;  1WR1 A;  3M95 A;  2BKF A;  3VTW A;  2M0X A;  2PJH A;  4PS3 A;  4W9L A;  5D7G A;  2IYD B;  4GIV A;  1GG3 A;  3AI5 A;  2I1K A;  3RCZ A;  5J18 A;  2KQS A;  5DPS A;  3ZIM A;  1YJ1 A;  2MRP A;  1WGR A;  3PTF C;  1WZ3 A;  5CHF A;  4W9F A;  3NOB A;  2FNJ B;  1UZX B;  3QHT A;  2GBK A;  4IWQ A;  3WAN A;  2EMT A;  4HLE A;  4FAD A;  1WGG A;  3T9L A;  3A4S C;  2OOB B;  5CHV C;  3PHW B;  2XK5 A;  2DYO A;  4DHZ E;  3N3K B;  1MG8 A;  4HVB A;  1E8X A;  1GNU A;  3SHQ A;  3SD5 A;  2LGX A;  2KWV B;  4WJQ A;  3MHS D;  1E90 A;  4BBN C;  4EFO A;  4M0W B;  3ZRC A;  2L05 A;  2CHW A;  3ZNI D;  2R2O A;  1K8R B;  3EC8 A;  1P0R A;  1YX6 B;  1U4A A;  1Z2M A;  3KW5 B;  3QA8 A;  2GBN A;  1WM3 A;  2JPH A;  4FA6 A;  3PV1 A;  3PS6 A;  5KHQ A;  2KX0 A;  2L0F A;  3NHE B;  2O2V B;  5D2M B;  3GOE A;  4BKT A;  1A5R A;  3AXC A;  3RT3 B;  4JIO U;  2IY0 B;  3CSF A;  3H9D A;  2LAS A;  4WJO A;  2KTR B;  2V1Y A;  3VUY A;  3ZW3 A;  4ZYN A;  3JSV A;  2JVC A;  2ZNV B;  3APC A;  3A9J B;  1RFA A;  4GDK B;  4KVG B;  2D3G A;  1M94 A;  3KUC B;  3PT2 B;  4RMA A;  1R4M I;  2CHX A;  2NVU I;  4GMV A;  3U7D A;  1WJU A;  2KO3 A;  3U8Z A;  4DHJ D;  1WXM A;  2K1F A;  2MWS B;  1V5T A;  2MQJ A;  2L76 A;  4K81 A;  2ZPY A;  3A4R A;  5E6O A;  2C9W B;  2UYZ B;  4ICU A;  3RUI B;  2MW5 A;  1EUV B;  2JT4 B;  2IO0 B;  4MGY E;  4W9E A;  3VVW B;  2KLC A;  4HDQ A;  3PRE A;  4JLC A;  2RD0 A;  2IBI B;  3KUZ A;  4RM8 A;  3ENE A;  3QAR A;  4WAA A;  3K9O B;  1NDD A;  3DBH I;  3WAO A;  2GBJ A;  3P2B A;  1V86 A;  3M62 B;  2A5U A;  3VH3 B;  1GC6 A;  5JZE B;  2MP2 B;  1WJ6 A;  4DDG D;  3DDC B;  4DDI D;  1VD2 A;  1TTN A;  3RZW C;  3WAL A;  1WJN A;  4A3P A;  2JUO A;  3VTU A;  4MGK E;  3ZNH B;  4CYE A;  4FJY A;  4JQW C;  2KXJ A;  3PLV A;  4BOZ B;  2AYO B;  2WX0 A;  3AU5 A;  4NJ7 A;  3Q3F A;  1GUA B;  1Q5W B;  1SGH A;  4KSL C;  4ANW A;  2REX A;  3VDZ A;  5GMV A;  1R4N I;  2JY6 A;  1WXA A;  4HPM B;  4WWP A;  4W9C A;  3UIP B;  4MM3 A;  3OAW A;  2GMI C;  4TQ1 A;  2ZCB A;  3H1U A;  5J2R A;  3PVL A;  1V80 A;  4G50 A;  2O6V B;  3ECI A;  3VTV A;  5AZG A;  2LXC A;  1NBF C;  2PE9 A;  3JVZ X;  3VAW A;  4GU2 A;  4DHJ B;  3JYU A;  3DCG A;  1WE7 A;  1ZKH A;  3R3M A;  1CMX B;  2KQ7 A;  3Q3J A;  4FJZ A;  5CTR C;  4KIK B;  3ZDM C;  3ZRF A;  3QC8 B;  3WAM A;  1HE8 A;  3H6N A;  4BKS D;  3VFK A;  2N1V A;  2QHO A;  2BWF A;  3TL5 A;  2AL3 A;  3UGB B;  3D32 A;  2A4Z A;  3ML9 A;  2AL6 A;  2LVQ A;  1YIW A;  3DVN V;  2L00 B;  2B3A A;  4X57 B;  2KDB A;  3UQA A;  1WGY A;  4GDL A;  1WIA A;  1KM7 A;  3IBE A;  3IHP C;  1YQB A;  3ZUN A;  4OVU A;  3H7P A;  2RPQ A;  1X1M A;  1WY8 A;  2MBB B;  1LXD A;  2DYM A;  2XBB C;  2KVR A;  2MBE A;  1P9D U;  1ZW7 A;  4WWN A;  4IW0 A;  2LXA A;  3DVG Y;  3NS8 A;  4K7S A;  3ZLZ A;  1SIF A;  1WI0 A;  3QQ8 B;  3QX1 A;  4NQL B;  2RGF A;  2G4D B;  2MP2 A;  2FAZ A;  5G2N A;  1J8C A;  4HJK A;  4J6I A;  2BYF A;  4IM2 A;  4HPL B;  5DCN A;  2LVO A;  4MDK E;  5D94 A;  4HWI B;  4DK5 A;  1F9J A;  2WYQ A;  2JXX A;  2KTR A;  1EO6 A;  2YVC A;  4LJP B;  4NPN A;  2C7H A;  2FUH B;  2PPH A;  4MJS A;  5C23 A;  2LRU A;  2BYV E;  5LXH A;  4KIK A;  2KDF B;  4NJ6 A;  1WMH A;  2K8B A;  2MCN B;  3WA0 A;  5EDS A;  3PHX B;  2NCN A;  3CST A;  2PE6 B;  2WWZ A;  4ZRK A;  2HE7 A;  3M63 B;  2LRW A;  1IP9 A;  1UGM A;  1L7Y A;  1LFD A;  1UBI A;  4GGQ A;  4FBJ B;  2DZK A;  2JZ3 B;  4MGZ E;  3H7P B;  2KX3 A;  1ISN A;  2MLB A;  2WDT B;  4KZ0 A;  2Z59 B;  2DEN B;  2V4L A;  1KJT A;  4DWF A;  4WJN A;  1Y8R C;  3DQV A;  4BKS A;  1WXS A;  1WJ4 A;  2FIF A;  2KJH B;  4LDT B;  4MJS B;  2LD9 A;  2RSU A;  1E8Y A;  3OJ3 A;  5AZF A;  1OEY J;  1V6E A;  2CR5 A;  4BVU C;  1E5W A;  3N32 A;  4NQK E;  1WR6 E;  1I35 A;  1YD8 U;  1XT9 B;  2NS5 A;  1D3Z A;  1GC7 A;  1JRU A;  1YX5 B;  2KJ6 A;  4M8M A;  3IFW B;  3DVN U;  4ZRJ A;  3APD A;  1XD3 B;  2MX2 A;  4ANV A;  4FJV B;  2CKH B;  1IYF A;  1KOT A;  3ZNG C;  1VCB A;  2NBU A;  4EKU A;  4HCP B;  1WRD B;  4AOF A;  2KAN A;  3VH4 B;  1E8W A;  2J0K A;  2FCM A;  1LQB A;  4IG7 B;  2KC1 A;  2AEH A;  2XEW A;  3V6E B;  4AUQ C;  2DX5 B;  4HXD A;  3A33 B;  2J0M A;  2KN5 A;  3DOW A;  3NY5 A;  2LZ6 A;  1V2Y A;  2KMC A;  2KWU B;  1J0G A;  2VRR B;  3JSV B;  4GDK A;  4BKG A;  2G45 B;  2N7D A;  4MEM A;  2NBW B;  2PEA A;  2KDI A;  3R66 C;  4PYZ A;  3ZNZ B;  5KHO A;  3V61 A;  3ZKJ C;  3M3J A;  2GOW A;  3OLM D;  5E6P A;  4ANX A;  3EHV A;  2M1M A;  1V9J A;  2DYB A;  3PRP B;  2ASQ A;  2DAJ A;  4ICV A;  1EF5 A;  2BKR B;  4JGH B;  2KLG A;  3ONS A;  5D6J B;  3TBL D;  3UF8 A;  1RAX A;  1L2N A;  2AWT A;  3L16 A;  4YL8 A;  1UBQ A;  5JH5 C;  4LCD E;  2M8S A;  4HK2 A;  2C5L C;  2KTF A;  4F8C B;  3QIJ A;  4IWO A;  2IO3 B;  2NR2 A;  1Q0W B;  2D10 A;  2DZM A;  3GZN I;  4ZRI A;  3SU8 X;  1AAR A;  1GJZ A;  3PSE B;  4NAW B;  1PQS A;  2KFK B;  4BFR A;  4NY0 A;  2ZVO A;  4URK A;  5IA7 A;  3VXW A;  2IO2 B;  2XK5 B;  2KWC A;  2NPT B;  2K8H A;  3S2A A;  4BOS C;  4IC7 B;  1TGZ B;  4OVV A;  2K39 A;  3N30 A;  2N9E B;  4MEL A;  4II3 B;  1SE9 A;  4W9I A;  3VQI A;  3CMM B;  5AZH A;  3W1S C;  3UIN B;  3TJP A;  4DXA B;  2N4F A;  2ZCC A;  2M17 A;  3BIN A;  4W9K A;  4XX5 A;  2IY1 B;  3A9K A;  4TKN A;  3A9K B;  3PGE A;  3RZF A;  4EEW A;  2MSE D;  3V6C B;  1E7U A;  2KKC A;  2MBQ A;  1OTR B;  2Y5B B;  3KUD B;  5HKH A;  2I1J A;  1WE6 A;  2JRH A;  2GBR A;  4WWO A;  1P1A A;  2UWQ A;  4W9H A;  3C0R B;  1C3T A;  1IPG A;  3NZU A;  1J19 A;  4B6W A;  2MBO A;  4F1S A;  4IM0 A;  4DBG A;  4FN2 A;  3HIZ A;  4I6P A;  4TUU A;  5TR5 A;  3L13 A;  1LM8 B;  3R7Q A;  2G4S A;  4CHK A;  2LUE A;  4ANU A;  5JHA A;  3QCA A;  1I42 A;  1Q1O A;  4GB9 A;  5L83 A;  2NBV B;  3KVF B;  3TIX A;  3WAP A;  3A9J A;  4E3C A;  3OJ4 B;  3QAQ A;  4A3O A;  2WX1 A;  3AU4 A;  2FCN A;  4GXB A;  1H8C A;  2L7R A;  3BY4 B;  2KNB A;  3DBS A;  3DPD A;  2HD5 B;  4HDO A;  4N9F 4;  5DPR A;  3EEC A;  1T0Y A;  1RLF A;  2KDE B;  4MSQ B;  2MBH A;  3QK0 A;  1C1Y B;  2YLM A;  2BWE S;  2N1W A;  4PS7 A;  2LI5 A;  3KH0 A;  5C1Z A;  2RR9 A;  2C60 A;  5BO4 B;  4AJW A;  5AEK B;  1V5O A;  4JL9 A;  2KHW B;  3LJ3 A;  1TBE A;  1KLV A;  1Z5S B;  2V3S A;  4FLH A;  1S1Q B;  2ZNV C;  4I6N B;  4K1R B;  3EFU A;  3L08 A;  4MH0 E;  3L17 A;  1NI2 A;  4GDL B;  5G55 A;  4XZ4 A;  2BGF A;  4K7U A;  3DBL I;  1WM2 A;  4AJY B;  2HJ8 A;  3CF6 E;  3HM6 X;  1RRB A;  3VUX A;  3B1L X;  2CU1 A;  3H7S A;  2KFJ A;  2KD0 A;  2ZJD A;  4XC2 A;  4FUL A;  5CHW A;  2EKE C;  3K9P B;  3KYD D;  1V81 A;  2JWZ A;  2O6V A;  2LGY A;  4PYU A;  4E71 A;  4EZK A;  1WGD A;  4EZL A;  5L95 C;  2JZZ A;  2KOX A;  4LDT D;  2J0J A;  5CX3 A;  2G3Q B;  3QJZ A;  4I6L B;  3RYT A;  4IUM B;  4EUT A;  2BF8 B;  2KC2 A;  1WGH A;  2KK8 A;  1P98 A;  4ASW C;  4BBN F;  2ZPN A;  2O6V D;  4GOC A;  3MTN B;  2L0T A;  4M8N A;  2C7N B;  2IO1 B;  2W9N A;  4II2 B;  3B0A A;  4CO7 A;  2FCQ A;  2JRI B;  4WJP A;  2K6D B;  4RM9 A;  3AUL A;  2L3Z A;  4B9K A;  4EOY A;  2D2Q A;  3UQB A;  4NAW A;  2N9P C;  2LGD A;  5FR6 A;  3A1Q A;  1WXV A;  2K8C A;  2D07 B;  3RUL A;  2J7Q B;  4W9G A;  3LDZ E;  3PLU A;  2D11 A;  3PZD A;  4G0N B;  1FXT B;  3QWZ B;  2LJ5 A;  4W9J A;  3HK0 A;  2ZEQ A;  3PPA A;  2DAF A;  1G6J A;  3I3T B;  2CHZ A;  4P7I A;  5LXI B;  2OJR A;  4GN1 A;  2LWP A;  1V49 A;  3ZTD A;  2KJR A;  3HM3 A;  3V60 A;  1UD7 A;  1H4R A;  2C7M B;  4KDL B;  2M4N A;  3ALB A;  4KZC A;  3APF A;  1WX7 A;  2ZZP B;  1E8Z A;  2N9X A;  2CS4 A;  4KSK C;  3V62 A;  3HHM A;  1EF1 A;  1UH6 A;  3VHT C;  3VUW A;  2JF5 A;  4KV2 A;  2L8J A;  5J17 A;  3W1S A;  4IM3 A;  3ML8 A;  1WX8 A;  2DZI A;  3L0W B;  3O65 B;  2ZVN A;  3PRZ A;  1WMH B;  3A1Q B;  4WQO B;  5LLI A;  4PS8 A;  2K6Q A;  4G11 A;  4IWP A;  3UIO B;  3ZO5 B;  2BPS A;  2GBM A;  3DVG X;  1WFY A;  2EMS A;  2KFK A;  1WYW B;  4F7Z A;  1OQY A;  4B95 A;  3TMP B;  3RD2 A;  2N7E A;  3IVF A;  3IG3 A;  1OEY A;  2FCS A;  1UEL A;  3TCA A;  2Z0D B;  3JW0 X;  4GSW A;  4MSM B;  1P3Q U;  2KMA A;  1S3S G;  3W1Y A;  1WF9 A;  2HTH A;  3R7R A;  3KYC D;  3B08 A;  2Z0E B;  4FHJ A;  2R2Q A;  2DHZ A;  5E6N A;  4A20 A;  5JHB A;  3T8M A;  1WH3 A;  2K25 A;  5IAA C;  4G3X B;  1OGW A;  3NZS A;  1BT0 A;  1ZGU B;  4ZDV A;  3WIM A;  1WZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...