2KMAA

Nmr structure of the f0f1 double domain (residues 1-202) of the talin ferm domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
178
structure length
178
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Talin 1
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA02
3UINB 1HE8A 1NI2A 2M4NA 3VUXA 2JT4B 4MJSA 3ZNHB 1PQSA 2MW5A 1UELA 3OAWA 4JLCA 2GOWA 2C7MB 5CHVC 3SU8X 4RM8A 2HTHA 2BKRB 4F7ZA 3IHPC 4IUMB 1WXVA 1WF9A 2XK5A 3RT3B 3ZTDA 4JIOU 2KTRA 2ZPNA 2OOBB 4ZDVA 2K6DB 4GXBA 3UIPB 3W1YA 2CR5A 3A9KA 2ASQA 3EC8A 2B3AA 2IO1B 3DPDA 4KZ0A 3S2AA 1OTRB 2NBVB 2JF5A 4PS3A 2MWSB 2V1YA 1E8XA 2G4DB 3A1QB 1WIAA 1Y8RC 2KFKA 4W9JA 4FHJA 3DVNU 4PYZA 5GMVA 3UF8A 1LQBA 2BPSA 1E8YA 1EO6A 3H6NA 2C60A 4FADA 1WI0A 4F1SA 4EZJA 4K7SA 3VTUA 2ZJDA 2AL3A 4HCNB 2KDEB 4IM2A 1TGZB 2JY6A 1SIFA 2DYOA 2KANA 3VUYA 3APFA 1YD8U 2D11A 2K8BA 3CSTA 4XC2A 1KJTA 4IW0A 4ANUA 3H7PA 3RCZA 2FIDA 3ZNZB 4TV3A 3VFKA 3U7DA 2IBIB 1UZXB 4FN2A 3V6CB 5DPTA 4I6LB 3OJ3A 1V81A 2DHZA 3HHMA 5DPRA 4NJ7A 3OLMD 3PPAA 4TUUA 1GC7A 2MBHA 4AUQC 1I42A 3VTVA 4GDKB 2L7RA 1TBEA 3C0RB 2Z0EB 4IM0A 3NZUA 4URKA 3R3MA 1P0RA 2XEWA 5E6NA 3QK0A 5IAAC 2CU1A 4W9EA 2MBOA 3QHTA 4JGHB 2FIFA 2ZPYA 4A3OA 3DBHI 3KVFB 4KDIC 4XX5A 4NY0A 4ZRJA 3RZFA 2WDTB 4BBNF 4IWQA 3MJWA 1XT9B 2XBBC 3H7SA 2DYBA 4PS8A 4EZLA 4II2B 2BF8B 2A4ZA 1WZ0A 4ANXA 1S1QB 3L17A 1OEYJ 4RM9A 1GUAB 1KLVA 3X23A 4MM3A 3DVGY 5LXIB 4BKGA 2KJHB 1CMXB 2G45B 2KO3A 2L3ZA 2C9WB 2LRWA 1GNUA 4HWIB 2BWFA 3B0AA 2KN5A 4HK2A 3P2BA 2GBJA 3ZDMC 2AL6A 4YL8A 4KIKB 2BYFA 5J2RA 2KWVB 5D2MB 1WGRA 2JZ3B 3L13A 2IYDB 4M8MA 3TL5A 4TQ0A 2RPQA 2LGYA 3HM6X 2KWCA 3PRZA 2BYVE 2KKCA 4GB9A 3A9JB 2AYOB 3DQVA 2KQ7A 5HKHA 2IZVB 3ZUNA 2IY0B 4WJQA 3L54A 3QIJA 2FCNA 2NPTA 4DK5A 2DX5B 2JZZA 3QC8B 2PEAA 4MSQB 2J0MA 2MX2A 2NS5A 2KTRB 2IO2B 1J0GA 1WJNA 2C5LC 2JVCA 3A9KB 2RSUA 3PS6A 4LJPB 3H1UA 1KM7A 2EMSA 4HPLB 3LDZE 3RULA 4FJYA 2M8SA 2KC1A 5FR6A 4DDID 2J7QB 2JRHA 2KFKB 2KXJA 1I35A 2RGFA 3HIZA 4GSWA 3AU4A 2LASA 4NPNA 1P3QU 2IO3B 1WGHA 2KLGA 1OQYA 3ZKJC 2LD9A 4EEWA 1J19A 3L10B 1WMHA 3UQAA 4GMVA 2GBKA 2D10A 2HD5B 4DHJD 4W9CA 4ZYNA 3BY4B 1E5WA 4MELA 3QWZB 3EECA 2WX0A 2N9EB 2QHOA 3QA8A 1EF1A 4OVUA 2DYMA 2KVRA 2LGXA 4DBGA 3PVLA 3WAOA 4GDLA 1LFDA 1EUVB 3ONSA 4IG7B 4KV2A 3ZRCA 3L08A 4JL9A 3Q3JA 2O6VA 4M8NA 2LXAA 5CHWA 4WAAA 2L00B 3JSVA 1J8CA 2PJHA 4FLHA 2IY1B 2KK8A 3RZWC 4AJYB 5KHQA 1E7UA 5JHAA 3ZRFA 3TBLD 1V2YA 4TQ1A 2FAZA 4E71A 1WX8A 1GJZA 2M1MA 2REXA 1R4MI 1YX5B 5C1ZA 2GBRA 4HDOA 4KZCA 3SHQA 1NDDA 2MBQA 4AP4C 5DPSA 2K8HA 3AU5A 3N30A 2V3SA 1H8CA 5JHBA 4FJVB 4HVBA 2NR2A 1IPGA 2PE6B 4W9LA 1AARA 3PT2B 3ZLZA 4GOCA 4B6WA 1WFYA 3KYCD 2BWES 4IWOA 4G3XB 3CSFA 2G3QB 2M17A 2JPHA 1WYWB 4WQOB 2LUEA 2ZNVC 2ZVNA 3DBRI 3EFUA 3U30A 3ZNID 3W1SC 2I1KA 4MH0E 3ECIA 3B1LX 1RRBA 4ZRKA 2GBMA 4W9FA 1RAXA 3ZDTA 3NZSA 5D7GA 2MBEA 3TCAA 4GIVA 2JRIB 1YQBA 2Y5BB 5AZGA 4BKSA 2K39A 2MA9B 2LI5A 1KOTA 3TMPB 5D6JB 3DOWA 2KC2A 1D3ZA 3R7QA 3ALBA 5J17A 4LJOB 1XD3B 3DVNV 2WYQA 2KDBA 1E7VA 1LXDA 1U4AA 3NY5A 3UQBA 3T8MA 1LM8B 3ENEA 4MSMB 3RD2A 3RUIB 1M94A 3D32A 1V49A 2KNBA 2NPTB 3GOEA 3T9LA 3PGEA 2CHXA 3A1QA 4HPMB 3TJPA 5L83A 5DPWA 3IFWB 1TTNA 3B08A 3Q3FA 3N3KB 4FULA 3VAWA 1QZEA 3SDLC 4ASWC 5IA7A 4M0WB 4E3CA 2UYZB 3K9OB 3ZW3A 2YLMA 1ZKHA 2DZMA 2IO0B 2AEHA 1WR6E 4GGQA 4K81A 3V61A 2KLCA 4BOSC 1WX9A 2KFJA 1YX6B 3HM3A 2LVOA 1MG8A 5CTRC 2LXCA 2MCNB 2K8CA 5DCNA 4AWJA 3TIXA 3WA0A 1P98A 4MEMA 1K8RB 2LJ5A 3HK0A 1Q5WB 1YJ1A 3A33B 1V5TA 4G0NB 3PRMB 2DZIA 4FBJB 1RLFA 1L2NA 1VD2A 5D94A 3JW0X 2DAFA 2KJRA 1V6EA 1WMHB 1WR1A 1F9JA 3ZIMA 2N7EA 2FCQA 1P1AA 2L0TA 1YIWA 4BFRA 2FUHB 4MJSB 4F8CB 2ZZPB 2L8JA 4A3PA 2MSED 3VH3B 2O6VD 3AULA 1WJUA 4EKUA 1E90A 2XK5B 4EFOA 5CHFA 4DHZB 4HJKA 2KDFB 1WXSA 4MGIE 2WWZA 2YVCA 4MGKE 4GDLB 5G55A 3X0WA 4EZKA 4WWNA 1Q1OA 3QQ8B 2DENB 3ZVVA 4IM3A 4BVUC 3DCGA 1ISNA 3UIOB 3IVFA 3APDA 4B95A 3ML8A 2N9XA 3PRPB 4GU2A 4II3B 2N4FA 5BO4B 2OJRA 2CKHB 3O65B 4IWPA 4DHZE 3QX1A 2V4LA 1WH3A 2J0KA 2JWZA 4DWFA 2ZEQA 3CF6E 4WWPA 2KMAA 1JRUA 2D07B 4G11A 4ICUA 3WAPA 4HXDA 1V86A 3PTFC 3EHVA 5EDSA 2O2VA 1FXTB 1Q0WB 2WX1A 3ZO5B 1WE7A 3A4RA 4OVVA 2MP2A 5AZHA 2D2QA 3L0WB 2JXXA 4CO7A 4W9DA 3H7PB 3IBEA 1E8WA 1XQQA 2KX0A 4BKSD 5J18A 2K1FA 4FA6A 2LWPA 4DHJB 3DBLI 3IG3A 4NAWA 3ML9A 2BYEA 4W9IA 4GN1A 4A20A 4B9KA 1Z5SB 5C23A 3NOBA 5E6PA 1P9DU 3KYDD 1WXAA 2NBUA 5JH5C 1UGMA 3UGBB 2HE7A 4FHKA 4HLEA 4K7WA 4N9F4 3PLVA 1VCBA 5AEKB 2UWQA 1WGDA 2CHWA 3V60A 2M0XA 4I6NB 2KJ6A 1WM2A 2ZVOA 1EF5A 4BBNC 1A5RA 3QJZA 3V6EB 2RD0A 4KSLC 4TKNA 4RMAA 3VHTC 3KH0A 3W1SA 2LGDA 3DVGX 2LVPA 2KHWB 1T0YA 4BKTA 3L16A 2L05A 3VH4B 2RR9A 3U8ZA 3NHEB 4AOFA 3CMMB 2MLBA 2PE9A 4W9GA 1IYFA 2G4SA 3I3TB 1UH6A 4FJZA 3A4SC 4DXAB 2FCSA 4EUTA 4ZRIA 2I1JA 2NBWB 4NQLB 3KUDB 3QAQA 3WANA 1BT0A 2W9NA 3KW5B 2N1WA 3JYUA 4WJPA 1GG3A 3PHWB 1OEYA 2Z59B 2HJ8A 4NQKE 4ANWA 1WY8A 2CHZA 4PYUA 3V62A 3R66C 2GBNA 4BOZB 3APCA 2L0FA 1WRDB 2N1VA 2N7DA 3N32A 5G2NA 3PV1A 3AI5A 1V9JA 3VDZA 1UBQA 1L7YA 3PREA 3QARA 4I6PA 2D3GA 2CS4A 2N9PC 1IP9A 3MHSD 2ZCCA 4HDQA 2LZ6A 3PSEB 2GMIC 2J0JA 1S3SG 2KOXA 4ICVA 3OJ4B 3RYTA 1C3TA 4KSKC 3AXCA 3M63B 5CX3A 5KHOA 1WGYA 3QCAA 5LXHA 1X1MA 3KUCB 4KVGB 2LVQA 3VVWB 3SD5A 4P7IA 3M95A 1NBFC 3VUWA 3WALA 3WIMA 1OGWA 2BKFA 2DZKA 2MBBB 4IC7B 3VTWA 1SE9A 4KDLB 3ZTCA 2KDIA 4NJ6A 5AZFA 5L95C 1WGGA 2MQJA 2KZRA 1WE6A 4LDTD 1WJ6A 1UD7A 1WM3A 2L76A 1ZGUB 3JVZX 1WZ3A 4G50A 2K25A 4WWOA 4WJOA 1Z2MA 3DDCB 3PZDA 3LJ3A 1UBIA 3DBSA 2A5UA 4CYEA 2O2VB 3WAMA 4LDTB 4K7UA 4GDKA 4X57B 2MP2B 1C1YB 4MGYE 4NNJB 2K6QA 4DDGD 2DAJA 1WX7A 2Z0DB 4K1RB 4LCDE 2R2OA 2R2QA 4EOYA 4HCPB 2C7HA 2DZJA 3ZNGC 2VRRB 4NAWB 3NS8A 2O6VB 2AWTA 3H9DA 2ZCBA 2LRUA 2KQSA 3K9PB 1GC6A 3PHXB 3JSVB 4MDKE 5E6OA 4ANVA 1G6JA 3M3JA 2EMTA 3VQIA 2FCMA 1R4NI 1WXMA 2MRPA 3R7RA 4W9HA 3BINA 4AJWA 2NVUI 5TR5A 2KWUB 3VXWA 5JZEB 2KD0A 2JUOA 1TZ1A 4E74A 2EKEC 4MGZE 2KX3A 1V5OA 5LLIA 4JQWC 1ZW7A 2PPHA 2ZNVB 4W9KA 2KMCA 4WJNA 4KIKA 1SGHA 2BGFA 1WJ4A 2FNJB 3MTNB 3PLUA 1V80A 1E8ZA 3GZNI 2NCNA 3M62B 4CHKA 4PS7A 2KTFA 1H4RA 3KUZA 4J6IA 3A9JA 2C7NB 4XZ4A 1RFAA
chains in the Genus database with same CATH superfamily
3FILB 3UINB 1PQSA 1UELA 4NAMA 3BK2A 2XK5A 4ZRQA 2IJ0A 2ZPNA 3GE8C 4GXBA 3UIPB 2B3AA 3S2AA 3Q3MC 3Q8BA 3ZYYX 3NRZA 1ZXIA 4XE0A 4PS3A 2MWSB 2G4DB 3P63A 3A1QB 3AECB 4PYZA 3AH7A 1EO6A 3H6NA 5D3IB 1QOAA 4FADA 4K7SA 1D6EC 3URYA 2ZJDA 2AL3A 3RNFC 4HCNB 4RFBA 2WGSA 1I4HA 1SIFA 2DYOA 1YD8U 2HTME 4ANUA 2D5GA 1CK1A 3U7DA 2BBCA 3V6CB 5DPTA 1V81A 3AE4B 2DHZA 3HHMA 3C19A 5DPRA 2Z0EB 3NZUA 4URKA 4P1BC 3U52E 2DWQA 3QK0A 3AEEB 5AUIA 3DBHI 4A6QA 4ZRJA 2BW2A 1XT9B 3MJ5A 1FD6A 4PS8A 1EM7A 4II2B 5EE3A 2A4ZA 3MC9A 3ZXRA 3P4SB 4HPPA 5D3DA 1KLVA 4MM3A 5LXIB 4LNKA 1CMXB 4IOIE 2C9WB 2KN5A 1OQQA 4ZHOA 2GBJA 4KIKB 3P1MA 2BYFA 5J2RA 1WGRA 3L13A 1ET9A 3EA6A 4HKQA 3FAHA 3MC8A 2L52A 4GB9A 4OHJA 1XLNA 4RGMA 5HKHA 2IZVB 2IY0B 1TS4A 4R3DA 2INNE 2JZZA 4K3BA 2J0MA 3NVWA 2MX2A 2NS5A 2PVGC 1J0GA 2C5LC 4C80A 1FNWA 3LDZE 5FR6A 3KLSX 2JRHA 2VH2A 1I35A 3DHHC 1P3QU 1ZP0B 3I9V1 5C2TB 3UQAA 2QILA 1I4QA 2D10A 2HD5B 1KF6B 4W9CA 1E5WA 4TMAB 2N9EB 1TYGB 3Q3JA 2O6VA 4M01A 1J8CA 1RFKA 3BYTB 4AJYB 1LGRA 4HKZE 2IGHA 5JHAA 3TBLD 4TQ1A 4E71A 3AEAB 1GJZA 2M1MA 1TY0A 4XDCA 1XLPA 2L1AA 3U7ZA 4ZRPA 5DPSA 2K8HA 1SIJA 2KACA 1T6BX 1UNSA 3KYCD 2WS3B 2JPHA 2LUEA 3DBRI 3W1SC 4IDIA 4ZRKA 5BYQA 4W9FA 2MBEA 3TCAA 5AZGA 4BKSA 1L4DB 2MA9B 4PT5A 2KC2A 3AE5B 1GB1A 4KGSA 2WYQA 1U4AA 3MC0B 3T8MA 4WQMA 1XO3A 1LM8B 3ENEA 5BMIA 1DOIA 3HVZA 1C4CA 3RUIB 3GOEA 2KNBA 3T9LA 5L83A 1VZ6A 4FULA 3VAWA 5IA7A 3K9OB 4M02A 1E9MA 2YLMA 1ZKHA 2IO0B 4BOSC 1DYQA 1NYRA 1YX6B 3HM3A 1MG8A 1BMLC 4RH6A 1FRRA 3B2GA 3IAM1 1V5TA 2LUMA 2ACZB 3ZIMA 3U4EG 5AUKA 4F8CB 4OZCA 2ZZPB 2MSED 3VH3B 3AEGB 2O6VD 1RM6C 3AULA 1WJUA 1E90A 3BZDB 4EFOA 5CHFA 3EGRA 2KDFB 1WXSA 2QIEB 4EZKA 5G55A 4WWNA 1T0RC 2QEJC 1Q1OA 2SEBD 3AE3B 1QT9A 3GZNB 1MHXA 2NMQA 1ENFA 2J0KA 3N9YC 4ZYSA 3CF6E 2L32A 2KMAA 3AM9A 4LNIA 2WX1A 1NENB 3GP7A 2WHIA 1C77A 4CO7A 3H7PB 3IBEA 4BKSD 4KX6B 2TSSA 4DXGA 2LWPA 1L6VA 3IG3A 4W9IA 1MJDA 1YN4A 3LYYA 5E6PA 1P9DU 2RDHA 2RMMA 2NBUA 1UGMA 2KMMA 5T8IA 2CHWA 2KJ6A 1BXTA 1I7HA 4TKNA 5I4DA 3FC4A 3DVGX 2LVPA 4ACFA 2L05A 1TKGA 3VH4B 2Y3AA 1IYFA 2G4SA 1UH6A 1DOYA 4DXAB 2I1JA 4USAA 4D2KA 3WANA 2QSDA 1JWSD 2W9NA 2Z59B 3V62A 3R66C 1P7FA 1V9JA 2W3RA 4I6PA 2CS4A 1ROEA 2AQ3B 1IP9A 4HDQA 1TZOA 1KH0A 2H88B 3M63B 3SD5A 1KFYB 5IKCM 2BKFA 2MBBB 1SE9A 4KDLB 1XF5L 1NVID 1C78A 2WNMA 1JCKB 1WZ3A 3JVZX 2N7JA 3LJ3A 1UBIA 3DBSA 4DXFA 3WAMA 4XYCA 4X57B 1C1YB 3I63C 1F0ZA 3IAS1 4EOYA 2YEPF 2DZJA 1E0ZA 1K53A 3H9DA 5G5HA 1RYJA 3K9PB 1HZ6A 4ANVA 3H8HA 3M3JA 2AQ2B 2FCMA 1STEA 4HEA1 1R4NI 3I57A 2RDGA 1QF6A 1TZ1A 1V5OA 2ZNVB 1ZUD2 4W9KA 1SE3A 3SFEB 1VDVA 1GAQB 2BS4B 4US8A 1T0SC 1QLBB 3M62B 1R7SA 2WXJA 2YEPB 1UF0A 3A9JA 2AEHA 1RFAA 2WU2B 1HE8A 1NI2A 2FE8A 2M4NA 1QQRA 2JT4B 1B9RA 1J7BA 4MJSA 2UU7A 5CHVC 3SU8X 4RM8A 3IHPC 4IUMB 3RT3B 4JIOU 2OOBB 2IO1B 3DPDA 4KZ0A 1OTRB 4M00A 1FPYA 1MG4A 4J3OD 2V1YA 4AQ7A 2VZKB 3W5VB 1Y8RC 4C7ZA 4W9JA 3UF8A 5GMVA 3RNAC 2OEDA 1TKEA 2MJ3A 2W54A 4IM2A 5HI1A 3VUYA 2K8BA 3ZJTA 4XC2A 4IW0A 1FO4A 3TSSA 4TV3A 1SBBB 4YSZB 5MPOA 4FN2A 4I6LB 3E56A 1F1HA 2Y5CA 1GC7A 2MBHA 1TBEA 3R8BA 2BB5A 2W55A 2XEWA 3BK1A 5E6NA 2CU1A 4W9EA 3QHTA 5IP4D 4A3OA 3IXSA 3P4RB 4KDIC 2N9KA 4XGAB 4BBNF 4IWQA 3MJWA 5G5GA 4BZAA 3RNGC 1WZ0A 3ZJVA 1FNUA 1S1QB 1SJED 3T3NA 5H8YE 3X23A 4BKGA 4WIPA 5HHDG 2KO3A 2L3ZA 2LRWA 1GNUA 4HK2A 3P2BA 4XWWA 4C7YA 5EE1A 2IYDB 4UDUC 3AE2B 4YSYB 4C4VA 1V97A 2CU3A 2INCC 4WWMA 2WQYB 2KKCA 3A9JB 2AYOB 1PGBA 1N61A 4A8XC 1I4PA 2LJIA 2WXQA 2MEKA 2WU5B 1TY2A 3QC8B 2PEAA 1V1PA 4M0WA 2K22A 3PS6A 1IUEA 4LTUA 2M8SA 4DDID 4WURA 3GB1A 3RPFC 3VRAB 2IPKD 2KXJA 3WCQA 4GSWA 3RFZB 2LASA 2N9LA 1ET6A 2WXMA 2KLGA 4RNAA 1WMHA 3AE9B 1IGDA 3BY4B 1HQRD 3EECA 3NVZA 2DYMA 2LGXA 4GDLA 2WLBA 4JL9A 1HEZE 2KYWA 3SEBA 2L00B 3JSVA 2RPVA 2QC8A 4FLHA 2IY1B 1E7UA 3ZRFA 1R4MI 5C1ZA 2GBRA 3SHQA 1NDDA 2OHFA 3N30A 3VR9B 2R61A 1C76A 2I2YA 2PE6B 1ZDVA 3PT2B 1UUPA 2Z8LA 1K50A 4IWOA 3MFGA 2ZNVC 4MH0E 2WXOA 4LLGM 1RRBA 2GBMA 1RAXA 1HA5A 4A9AA 2JRIB 1YQBA 2Y5BB 2K39A 3AMZA 3ETRA 4C4VB 1JWMD 4LJOB 1XD3B 4PK1A 3P4QB 4L23A 2JYEA 3Q69A 2GRIA 3DHGC 1LO5D 1WWTA 4YTNB 4MSMB 1M94A 3D32A 1SE4A 1C4AA 2CHXA 4HPMB 3TJPA 4HJGE 3IFWB 3R2IA 3VR8B 4ASWC 3CWIA 4M0WB 1C9FA 2DZMA 4GGQA 3V61A 2JXTA 4ZHPA 3Q14C 4AWJA 3TEYA 2LGIA 4MEMA 2JZPA 1K8RB 1OQRA 2LJ5A 1JWAD 3A33B 3U2SC 1L2NA 3PZ7A 1V6EA 1WMHB 1WR1A 5HG2A 2N7EA 2FCQA 2PW9A 2BS3B 4N59A 2XK5B 2YVCA 4GDLB 1CZPA 2DENB 4K3CA 3UIOB 1ISNA 1L0VB 1HTQA 3IVFA 4B95A 3ML8A 3PRPB 4II3B 3Q6BA 2N4FA 2CKHB 3O65B 1N60A 2V4LA 2M0AA 4DWFA 4WWPA 3AB5A 4ICUA 3WAPA 4HXDA 1JW9D 3PTFC 3EHVA 1FXTB 4JX1C 5AZHA 2MP2A 2JXXA 1XXGA 1E8WA 1WGKA 2VH1A 2KX0A 2K1FA 4NAWA 1D5MC 3ML9A 4A20A 1FFUA 3Q8AA 4JPSA 3B2FA 2HJ1A 2W82A 4K7WA 3PLVA 2UWQA 2EELA 1JRPA 1WM2A 2LFIA 1EF5A 2ZVOA 4BBNC 1A5RA 1TS5A 2RD0A 2B76B 2IGGA 2LGDA 2KHWB 1T0YA 4BKTA 3L16A 4YXDB 3NHEB 4MM3B 3CMMB 2WXNA 4EUTA 4NQLB 1BT0A 2N1WA 4WJPA 3DBHB 1XLOA 3PHWB 1M4VA 2GBNA 5G2NA 3PV1A 1UBQA 3QARA 2D3GA 3SFDB 5FKAC 3MHZA 1XLQA 3PSEB 3RNCC 2J0JA 1S3SG 2KOXA 1TT5B 1C3TA 1ZXHA 2M19A 1X1MA 3KUCB 4XWTA 3VVWB 4P7IA 1NBFC 3VUWA 3WIMA 3AEDB 5EE0A 2DZKA 4MH8A 1WGGA 1WE6A 3O13A 2MH7A 4LDTD 1WJ6A 1UD7A 1WM3A 1ZGUB 4RCOA 3P4PB 1EWCA 4WWOA 4WJOA 5EE9A 4LDTB 4K7UA 3Q2AC 2MP2B 4NNJB 1WX7A 2Z0DB 4K1RB 2R2QA 1V8CA 2C7HA 2VRRB 4NAWB 1XEEA 1RWSA 2O6VB 2AWTA 1GOZA 1L5PA 5E6JA 1JWBD 2E3TA 3VQIA 2MRPA 4RF0A 3R7RA 4W9HA 2LMCA 1E10A 1KRHA 1SXTA 1JQ4A 2WXRA 2G1EA 1B1ZA 2JYTA 3DHIC 2V4IB 2BGFA 1WJ4A 2W3SA 2FNJB 3E9SA 3PLUA 1E8ZA 4CHKA 2BT6A 4QAYA 4JWSC 3AE1B 2MW5A 2WP9B 3TEZA 2EKIA 1JALA 4F7ZA 3N1XC 1WF9A 4ZOHC 2KTRA 4ZDVA 2K6DB 2ASQA 2BYTA 2NBVB 1Y56A 1IGCA 1E8XA 1JMLA 3BWUD 5IO9A 1WIAA 3FKYA 3DBRB 1MHHE 2KFKA 2BPSA 2KVZA 2C60A 4RGTA 4F1SA 2QDFA 3VTUA 1N63A 2WDQB 3T3OA 2KANA 3APFA 3CSTA 1KJTA 1MI0A 4H2AA 3RCZA 4GLSC 2FIDA 1PGAA 2MHJA 3VFKA 2IBIB 1UWXA 1UZXB 1IBXA 1BUIC 2WXGA 3OLMD 3PPAA 4TUUA 4ARCA 4AUQC 4RGOS 2WXKA 3C0RB 4IM0A 3R3MA 5IAAC 1L0XB 3ZJUA 2CJNA 2WXIA 1ZDXA 4IKGA 3KVFB 3J9CA 1VLBA 4NY0A 3RZFA 2WDTB 1YOVB 2XBBC 1P7EA 2BF8B 4ANXA 4OVZA 1FMAD 1OEYJ 3L17A 1GUAB 3DVGY 1I4RA 1ACCA 2RDBC 4HWIB 2D3AA 3B0AA 3ZDMC 2AL6A 2KWVB 4M8MA 3EUB2 2RPQA 3HM6X 3IT4B 3V3XA 3L54A 3QIJA 3GS2A 2NPTA 4DK5A 4S17A 1DGJA 2DX5B 2PMVA 1EWYC 2KTRB 1C4PA 1WJNA 2RSUA 2KAJA 4LJPB 3CIRB 1KM7A 3H1UA 3IT6B 2EMSA 4HPLB 3RULA 4FJYA 1WSPA 2KC1A 2BQQA 4JWUC 2KFKB 1FXIA 3AU4A 2IO3B 2LD9A 4EEWA 1J19A 1JWUD 2HDEA 4US9A 4GMVA 2GBKA 4A90A 3RNBC 5JXVA 4DHJD 1QOBA 1YN5A 4ZYNA 2QCZA 3QWZB 2WX0A 2QHOA 1EF1A 1VJKA 4OVUA 5IN7A 3PVLA 1LFDA 3NUHB 4L2YA 4IG7B 3L08A 3TEWA 1VRAB 2LXAA 5CHWA 4WAAA 1CJEA 2Q5WD 4P1CC 5KHQA 1V2YA 2AX5A 2FAZA 4HDOA 2MBQA 4AP4C 5JHBA 1XCTL 3R2TA 3N1ZC 4W9LA 3ZLZA 1WFYA 4G3XB 3CSFA 2G3QB 3ZNID 3EFUA 2I1KA 3ABVB 3LXFA 2KQ4X 3ZDTA 5D7GA 1EU3A 3FILA 4GIVA 3ZGZA 4MT5A 5D6JB 1T5XD 2WXFA 3R7QA 3ALBA 5J17A 2L83A 1WXQA 2KDBA 1LXDA 3NY5A 4YTPB 3GE3C 1J7AA 1V49A 2NPTB 5DPWA 3A1QA 1TTNA 5H92C 1FCCC 1L4ZB 1VZ8A 2IGDA 4E3CA 5FK9C 2UYZB 3ZW3A 4K81A 1WR6E 2KLCA 1WX9A 1UWMA 3PZ8A 5TSSA 2D3BA 2QJLA 2J42A 2LVOA 5CTRC 2LXCA 2K8CA 1F52A 1C79A 3TIXA 3WA0A 1P98A 1SJHD 2K3UA 3HK0A 1RLFA 2MJDA 4Q2JA 1VD2A 5D94A 4JE3B 2KJRA 1P1AA 1YIWA 2FUHB 4MJSB 1R4NB 2L8JA 3BIID 4A3PA 1SEBD 2KWDA 4EKUA 2FBWB 3VRBB 4HJKA 4MGKE 4KKIA 2CJOA 2E6XA 4IM3A 1SSNA 1T3QA 3APDA 4LK0M 2N9XA 3AEBB 3RNEC 1ZE3D 2LHEA 4CQNA 1JRUA 2ZW1A 1HZ5A 1CQVA 2K9XA 2V0GA 5EDSA 1YQ4B 2O2VA 4ARIA 2G9HD 3ZO5B 1WE7A 2QMTA 4OVVA 2ONQA 1TS2A 1XQQA 5J18A 2WXLA 3DBLI 5BMGA 1NYQA 2BYEA 4P6VF 2WXHA 1Z5SB 4B9KA 5C23A 1WXAA 2GB1A 2WDVB 3UGBB 2HE7A 4HLEA 4N9F4 1WGDA 4O1NA 4BAXA 2M0XA 3TUOA 4RMAA 3KH0A 3RN9C 1N62A 2MLBA 2PE9A 1FCLA 3I3TB 3A4SC 2NBWB 1F2RI 1QILA 3AEFB 3JYUA 1GG3A 4NQKE 1OEYA 2HJ8A 4ANWA 1WY8A 2V3PA 1WRDB 3N32A 1SF0A 1J7CA 3PREA 4OZAA 4P16A 1GPXA 2N9PC 2SAKA 3MHSD 2ZCCA 2GMIC 1V1PB 1UGJA 3L4PA 1PYWD 4KSKC 3AXCA 1FEHA 1SE2A 1WGYA 3QCAA 5CX3A 5LXHA 4KVGB 2DLBA 2V9HA 3M95A 3WALA 4DQOC 4A55A 3VTWA 5L95C 3HVDA 2KDIA 4NJ6A 5AZFA 5BYRA 4G50A 2K25A 1WRIA 1Z2MA 4REZA 3DDCB 3RI7C 2MJEA 4YSXB 2O2VB 3NS1A 1YMHE 2GI9A 2PTLA 4GDKA 4MGYE 4LCDE 2PLPA 1ZPSA 3AE8B 3PO0A 3Q8CA 4MACA 1E7PB 2KQSA 1GC6A 3PHXB 3JSVB 5E6OA 1G6JA 1I4GA 1KLUD 2EMTA 3NJTA 3DWGC 5GXGB 1WXMA 3NVYA 4OW0A 3BINA 5TR5A 5JZEB 3VXWA 2KD0A 4E74A 2EKEC 4MGZE 4JQWC 4WAFA 2PPHA 2KMCA 4WJNA 1SGHA 3Q8EA 4HROA 2I38A 3DBLB 3GZNI 2NCNA 2KTFA 1H4RA 3BVMA 3KUZA 2V3NA 3NG0A 4J6IA 4ITKA 3VUXA 3ZNHB 3OAWA 4JLCA 1F77A 2GOWA 2C7MB 2HTHA 1R4MB 2BKRB 3HUIA 1WXVA 3ZTDA 2ON8A 3W1YA 2CR5A 2JSVX 2DNFA 3A9KA 3EC8A 2JF5A 2WDRB 3OWEB 1FRDA 1QOGA 4FHJA 2XN9C 3DVNU 1LQBA 1E8YA 4LNNA 1TKYA 1WI0A 4EZJA 2BTEA 4XDDA 4KGTA 5HFYA 2KDEB 1TGZB 2JY6A 4C00A 2K5PA 3OG5A 3AV8A 2D11A 1GB4A 4YWGG 1D5XC 3H7PA 4KKJA 3EFCA 2KT7A 3ZNZB 5FR3A 1NEKB 3OJ3A 3Q3OC 4NJ7A 2NTSA 1I42A 3VTVA 4GDKB 2L7RA 2AQ1B 1A70A 4RGNA 1P0RA 4LNFA 5BYSA 2MBOA 4JGHB 1ZOYB 3KWLA 2FIFA 2ZPYA 4XX5A 2PIAA 1YQ3B 3H7SA 2DYBA 4EZLA 2H89B 2J53A 4RM9A 4EE2A 3N1YC 2KJHB 2G45B 2BWFA 1MPEA 1D4BA 4YL8A 2K0PA 2J4XA 5D2MB 2JZ3B 3TL5A 4TQ0A 1N5XA 2LGYA 3PRZA 2KWCA 2BYVE 1Q10A 1JROA 3DQVA 4TSSA 2KQ7A 3ZUNA 4WJQA 4L1BA 3W5UB 2FCNA 3Q8FA 1PGXA 1DOXA 4MSQB 4B0MA 2IO2B 2JVCA 3A9KB 3SR6A 1PUTA 1OFFA 1MVKA 3AN1A 3BYYB 2J7QB 4WH4A 3BVGA 1AYFA 2J52A 2RGFA 3HIZA 3ZQ4A 2BVCA 4NPNA 3I5JC 3AE6B 1WGHA 1OQYA 3ZKJC 2ICIA 1FNVA 3L10B 1N5WA 4LNOA 1YNTE 4MELA 3QA8A 3LB8C 2KVRA 4DBGA 3WAOA 1EUVB 3ONSA 4KV2A 3ZRCA 3BVZA 2INDC 2ZW0A 2JU6X 1FFVA 4M8NA 3ZXVA 2INPE 2PJHA 2LHDA 2JQRB 2KK8A 3RZWC 1WX8A 2REXA 1YX5B 4KZCA 3AU5A 2V3SA 1H8CA 4FJVB 4HVBA 2NR2A 1IPGA 1NI3A 3HRDD 1AARA 4GOCA 4B6WA 2BWES 2M17A 1WYWB 4WQOB 2ZVNA 3U30A 2Y5PA 3ECIA 3B1LX 4YTMB 3NZSA 2LI5A 3W2DA 1KOTA 1KLGD 3TMPB 3DOWA 1D3ZA 2XNAC 1FIQA 3DVNV 3C8YA 1E7VA 3UQBA 2PKOA 4B0EA 2IDYA 3RMKC 3N20C 3RD2A 5BMHA 2X8XX 1HTOA 3PGEA 5C3JB 3B08A 3Q3FA 3N3KB 1QZEA 3SDLC 2NTTA 1L0YB 4S0RA 2KFJA 2MCNB 5DCNA 3B9JA 1Q5WB 1YJ1A 4G0NB 3PRMB 4NZLB 4AS1A 2DZIA 3W9CB 4FBJB 4OZBA 1AWDA 1F2RC 3JW0X 2DAFA 1N6ZA 1F9JA 1E6EB 2L0TA 4BFRA 1VR9A 1YJJA 1V1OA 2BS2B 4DHZB 4MGIE 2WWZA 3X0WA 3QQ8B 3ZVVA 4BVUC 3KQ4A 3DCGA 5LNK1 4GU2A 5BO4B 2OJRA 1QOFA 2PVOD 4IWPA 4DHZE 3QX1A 2KN4A 1WH3A 2JWZA 2ZEQA 2D07B 4G11A 2X38A 1YN3A 1V86A 1FM0D 1Q0WB 1K51A 3A4RA 1TJEA 2D2QA 3L0WB 4W9DA 3NZ3A 4FA6A 4DHJB 1IBXB 4C56C 1I4XA 4GN1A 3NOBA 5JH5C 3KYDD 4FHKA 3V05A 1VCBA 5AEKB 1SB3C 1WYGA 3V60A 2N0SB 2VZKD 4I6NB 3KWVA 3QJZA 1K52A 3Q3NC 4N6EB 3V6EB 4KSLC 3VHTC 1MFWA 3W1SA 2M56B 2KDMA 2RR9A 4YT0B 3U8ZA 2OJWA 4AOFA 2LEKA 3UI3A 4W9GA 4FJZA 1AN8A 2FCSA 4N58A 4ZRIA 1TS3A 1T0QC 3KUDB 3QAQA 3KW5B 1QKZA 1YJIA 2CHZA 4PYUA 4BOZB 3APCA 2L0FA 2N7DA 2N1VA 3VDZA 3AI5A 1XCQL 1L7YA 2LZ6A 4FXCA 4ICVA 3OJ4B 3RYTA 5KHOA 2LGSA 2LVQA 1VZ7A 3NVVA 1OGWA 1AW7A 4IC7B 3ZTCA 1HXYD 2MQJA 2KZRA 2FUG1 2WXPA 2L76A 3DWMA 4KGRA 2GLSA 3PZDA 2A5UA 4CYEA 1PDXA 2JWUA 2K6QA 4DDGD 2DAJA 2R2OA 4HCPB 3MP9A 3TEXA 3ZNGC 3NS8A 2ZCBA 2LRUA 4MDKE 1KTKA 1FXAA 2BB6A 4RF1A 3P42A 4HRSA 3AE7B 2NVUI 2JX5A 4AJWA 2KWUB 1TIFA 2JUOA 4NJCA 1L6UA 2KX3A 5LLIA 1ZW7A 1EU4A 2D3CA 4KIKA 1PFDA 3MTNB 1V80A 1D5ZC 1ESFA 2DBYA 4PS7A 5IOIA 2C7NB 4XZ4A
chains in the Genus database with same CATH topology
3UINB 1HE8A 1NI2A 2M4NA 3VUXA 2JT4B 4MJSA 3ZNHB 1PQSA 2MW5A 1UELA 3OAWA 4JLCA 2GOWA 2C7MB 5CHVC 3SU8X 4RM8A 2HTHA 2BKRB 4F7ZA 3IHPC 4IUMB 1WXVA 1WF9A 2XK5A 3RT3B 3ZTDA 4JIOU 2KTRA 2ZPNA 2OOBB 4ZDVA 2K6DB 4GXBA 3UIPB 3W1YA 2CR5A 3A9KA 2ASQA 3EC8A 2B3AA 2IO1B 3DPDA 4KZ0A 3S2AA 1OTRB 2NBVB 2JF5A 4PS3A 2MWSB 2V1YA 1E8XA 2G4DB 3A1QB 1WIAA 1Y8RC 2KFKA 4W9JA 4FHJA 3DVNU 4PYZA 5GMVA 3UF8A 1LQBA 2BPSA 1E8YA 1EO6A 3H6NA 2C60A 4FADA 1WI0A 4F1SA 4EZJA 4K7SA 3VTUA 2ZJDA 2AL3A 4HCNB 2KDEB 4IM2A 1TGZB 2JY6A 1SIFA 2DYOA 2KANA 3VUYA 3APFA 1YD8U 2D11A 2K8BA 3CSTA 4XC2A 1KJTA 4IW0A 4ANUA 3H7PA 3RCZA 2FIDA 3ZNZB 4TV3A 3VFKA 3U7DA 2IBIB 1UZXB 4FN2A 3V6CB 5DPTA 4I6LB 3OJ3A 1V81A 2DHZA 3HHMA 5DPRA 4NJ7A 3OLMD 3PPAA 4TUUA 1GC7A 2MBHA 4AUQC 1I42A 3VTVA 4GDKB 2L7RA 1TBEA 3C0RB 2Z0EB 4IM0A 3NZUA 4URKA 3R3MA 1P0RA 2XEWA 5E6NA 3QK0A 5IAAC 2CU1A 4W9EA 2MBOA 3QHTA 4JGHB 2FIFA 2ZPYA 4A3OA 3DBHI 3KVFB 4KDIC 4XX5A 4NY0A 4ZRJA 3RZFA 2WDTB 4BBNF 4IWQA 3MJWA 1XT9B 2XBBC 3H7SA 2DYBA 4PS8A 4EZLA 4II2B 2BF8B 2A4ZA 1WZ0A 4ANXA 1S1QB 3L17A 1OEYJ 4RM9A 1GUAB 1KLVA 3X23A 4MM3A 3DVGY 5LXIB 4BKGA 2KJHB 1CMXB 2G45B 2KO3A 2L3ZA 2C9WB 2LRWA 1GNUA 4HWIB 2BWFA 3B0AA 2KN5A 4HK2A 3P2BA 2GBJA 3ZDMC 2AL6A 4YL8A 4KIKB 2BYFA 5J2RA 2KWVB 5D2MB 1WGRA 2JZ3B 3L13A 2IYDB 4M8MA 3TL5A 4TQ0A 2RPQA 2LGYA 3HM6X 2KWCA 3PRZA 2BYVE 2KKCA 4GB9A 3A9JB 2AYOB 3DQVA 2KQ7A 5HKHA 2IZVB 3ZUNA 2IY0B 4WJQA 3L54A 3QIJA 2FCNA 2NPTA 4DK5A 2DX5B 2JZZA 3QC8B 2PEAA 4MSQB 2J0MA 2MX2A 2NS5A 2KTRB 2IO2B 1J0GA 1WJNA 2C5LC 2JVCA 3A9KB 2RSUA 3PS6A 4LJPB 3H1UA 1KM7A 2EMSA 4HPLB 3LDZE 3RULA 4FJYA 2M8SA 2KC1A 5FR6A 4DDID 2J7QB 2JRHA 2KFKB 2KXJA 1I35A 2RGFA 3HIZA 4GSWA 3AU4A 2LASA 4NPNA 1P3QU 2IO3B 1WGHA 2KLGA 1OQYA 3ZKJC 2LD9A 4EEWA 1J19A 3L10B 1WMHA 3UQAA 4GMVA 2GBKA 2D10A 2HD5B 4DHJD 4W9CA 4ZYNA 3BY4B 1E5WA 4MELA 3QWZB 3EECA 2WX0A 2N9EB 2QHOA 3QA8A 1EF1A 4OVUA 2DYMA 2KVRA 2LGXA 4DBGA 3PVLA 3WAOA 4GDLA 1LFDA 1EUVB 3ONSA 4IG7B 4KV2A 3ZRCA 3L08A 4JL9A 3Q3JA 2O6VA 4M8NA 2LXAA 5CHWA 4WAAA 2L00B 3JSVA 1J8CA 2PJHA 4FLHA 2IY1B 2KK8A 3RZWC 4AJYB 5KHQA 1E7UA 5JHAA 3ZRFA 3TBLD 1V2YA 4TQ1A 2FAZA 4E71A 1WX8A 1GJZA 2M1MA 2REXA 1R4MI 1YX5B 5C1ZA 2GBRA 4HDOA 4KZCA 3SHQA 1NDDA 2MBQA 4AP4C 5DPSA 2K8HA 3AU5A 3N30A 2V3SA 1H8CA 5JHBA 4FJVB 4HVBA 2NR2A 1IPGA 2PE6B 4W9LA 1AARA 3PT2B 3ZLZA 4GOCA 4B6WA 1WFYA 3KYCD 2BWES 4IWOA 4G3XB 3CSFA 2G3QB 2M17A 2JPHA 1WYWB 4WQOB 2LUEA 2ZNVC 2ZVNA 3DBRI 3EFUA 3U30A 3ZNID 3W1SC 2I1KA 4MH0E 3ECIA 3B1LX 1RRBA 4ZRKA 2GBMA 4W9FA 1RAXA 3ZDTA 3NZSA 5D7GA 2MBEA 3TCAA 4GIVA 2JRIB 1YQBA 2Y5BB 5AZGA 4BKSA 2K39A 2MA9B 2LI5A 1KOTA 3TMPB 5D6JB 3DOWA 2KC2A 1D3ZA 3R7QA 3ALBA 5J17A 4LJOB 1XD3B 3DVNV 2WYQA 2KDBA 1E7VA 1LXDA 1U4AA 3NY5A 3UQBA 3T8MA 1LM8B 3ENEA 4MSMB 3RD2A 3RUIB 1M94A 3D32A 1V49A 2KNBA 2NPTB 3GOEA 3T9LA 3PGEA 2CHXA 3A1QA 4HPMB 3TJPA 5L83A 5DPWA 3IFWB 1TTNA 3B08A 3Q3FA 3N3KB 4FULA 3VAWA 1QZEA 3SDLC 4ASWC 5IA7A 4M0WB 4E3CA 2UYZB 3K9OB 3ZW3A 2YLMA 1ZKHA 2DZMA 2IO0B 2AEHA 1WR6E 4GGQA 4K81A 3V61A 2KLCA 4BOSC 1WX9A 2KFJA 1YX6B 3HM3A 2LVOA 1MG8A 5CTRC 2LXCA 2MCNB 2K8CA 5DCNA 4AWJA 3TIXA 3WA0A 1P98A 4MEMA 1K8RB 2LJ5A 3HK0A 1Q5WB 1YJ1A 3A33B 1V5TA 4G0NB 3PRMB 2DZIA 4FBJB 1RLFA 1L2NA 1VD2A 5D94A 3JW0X 2DAFA 2KJRA 1V6EA 1WMHB 1WR1A 1F9JA 3ZIMA 2N7EA 2FCQA 1P1AA 2L0TA 1YIWA 4BFRA 2FUHB 4MJSB 4F8CB 2ZZPB 2L8JA 4A3PA 2MSED 3VH3B 2O6VD 3AULA 1WJUA 4EKUA 1E90A 2XK5B 4EFOA 5CHFA 4DHZB 4HJKA 2KDFB 1WXSA 4MGIE 2WWZA 2YVCA 4MGKE 4GDLB 5G55A 3X0WA 4EZKA 4WWNA 1Q1OA 3QQ8B 2DENB 3ZVVA 4IM3A 4BVUC 3DCGA 1ISNA 3UIOB 3IVFA 3APDA 4B95A 3ML8A 2N9XA 3PRPB 4GU2A 4II3B 2N4FA 5BO4B 2OJRA 2CKHB 3O65B 4IWPA 4DHZE 3QX1A 2V4LA 1WH3A 2J0KA 2JWZA 4DWFA 2ZEQA 3CF6E 4WWPA 2KMAA 1JRUA 2D07B 4G11A 4ICUA 3WAPA 4HXDA 1V86A 3PTFC 3EHVA 5EDSA 2O2VA 1FXTB 1Q0WB 2WX1A 3ZO5B 1WE7A 3A4RA 4OVVA 2MP2A 5AZHA 2D2QA 3L0WB 2JXXA 4CO7A 4W9DA 3H7PB 3IBEA 1E8WA 1XQQA 2KX0A 4BKSD 5J18A 2K1FA 4FA6A 2LWPA 4DHJB 3DBLI 3IG3A 4NAWA 3ML9A 2BYEA 4W9IA 4GN1A 4A20A 4B9KA 1Z5SB 5C23A 3NOBA 5E6PA 1P9DU 3KYDD 1WXAA 2NBUA 5JH5C 1UGMA 3UGBB 2HE7A 4FHKA 4HLEA 4K7WA 4N9F4 3PLVA 1VCBA 5AEKB 2UWQA 1WGDA 2CHWA 3V60A 2M0XA 4I6NB 2KJ6A 1WM2A 2ZVOA 1EF5A 4BBNC 1A5RA 3QJZA 3V6EB 2RD0A 4KSLC 4TKNA 4RMAA 3VHTC 3KH0A 3W1SA 2LGDA 3DVGX 2LVPA 2KHWB 1T0YA 4BKTA 3L16A 2L05A 3VH4B 2RR9A 3U8ZA 3NHEB 4AOFA 3CMMB 2MLBA 2PE9A 4W9GA 1IYFA 2G4SA 3I3TB 1UH6A 4FJZA 3A4SC 4DXAB 2FCSA 4EUTA 4ZRIA 2I1JA 2NBWB 4NQLB 3KUDB 3QAQA 3WANA 1BT0A 2W9NA 3KW5B 2N1WA 3JYUA 4WJPA 1GG3A 3PHWB 1OEYA 2Z59B 2HJ8A 4NQKE 4ANWA 1WY8A 2CHZA 4PYUA 3V62A 3R66C 2GBNA 4BOZB 3APCA 2L0FA 1WRDB 2N1VA 2N7DA 3N32A 5G2NA 3PV1A 3AI5A 1V9JA 3VDZA 1UBQA 1L7YA 3PREA 3QARA 4I6PA 2D3GA 2CS4A 2N9PC 1IP9A 3MHSD 2ZCCA 4HDQA 2LZ6A 3PSEB 2GMIC 2J0JA 1S3SG 2KOXA 4ICVA 3OJ4B 3RYTA 1C3TA 4KSKC 3AXCA 3M63B 5CX3A 5KHOA 1WGYA 3QCAA 5LXHA 1X1MA 3KUCB 4KVGB 2LVQA 3VVWB 3SD5A 4P7IA 3M95A 1NBFC 3VUWA 3WALA 3WIMA 1OGWA 2BKFA 2DZKA 2MBBB 4IC7B 3VTWA 1SE9A 4KDLB 3ZTCA 2KDIA 4NJ6A 5AZFA 5L95C 1WGGA 2MQJA 2KZRA 1WE6A 4LDTD 1WJ6A 1UD7A 1WM3A 2L76A 1ZGUB 3JVZX 1WZ3A 4G50A 2K25A 4WWOA 4WJOA 1Z2MA 3DDCB 3PZDA 3LJ3A 1UBIA 3DBSA 2A5UA 4CYEA 2O2VB 3WAMA 4LDTB 4K7UA 4GDKA 4X57B 2MP2B 1C1YB 4MGYE 4NNJB 2K6QA 4DDGD 2DAJA 1WX7A 2Z0DB 4K1RB 4LCDE 2R2OA 2R2QA 4EOYA 4HCPB 2C7HA 2DZJA 3ZNGC 2VRRB 4NAWB 3NS8A 2O6VB 2AWTA 3H9DA 2ZCBA 2LRUA 2KQSA 3K9PB 1GC6A 3PHXB 3JSVB 4MDKE 5E6OA 4ANVA 1G6JA 3M3JA 2EMTA 3VQIA 2FCMA 1R4NI 1WXMA 2MRPA 3R7RA 4W9HA 3BINA 4AJWA 2NVUI 5TR5A 2KWUB 3VXWA 5JZEB 2KD0A 2JUOA 1TZ1A 4E74A 2EKEC 4MGZE 2KX3A 1V5OA 5LLIA 4JQWC 1ZW7A 2PPHA 2ZNVB 4W9KA 2KMCA 4WJNA 4KIKA 1SGHA 2BGFA 1WJ4A 2FNJB 3MTNB 3PLUA 1V80A 1E8ZA 3GZNI 2NCNA 3M62B 4CHKA 4PS7A 2KTFA 1H4RA 3KUZA 4J6IA 3A9JA 2C7NB 4XZ4A 1RFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIN B;  1HE8 A;  1NI2 A;  2M4N A;  3VUX A;  2JT4 B;  4MJS A;  3ZNH B;  1PQS A;  2MW5 A;  1UEL A;  3OAW A;  4JLC A;  2GOW A;  2C7M B;  5CHV C;  3SU8 X;  4RM8 A;  2HTH A;  2BKR B;  4F7Z A;  3IHP C;  4IUM B;  1WXV A;  1WF9 A;  2XK5 A;  3RT3 B;  3ZTD A;  4JIO U;  2KTR A;  2ZPN A;  2OOB B;  4ZDV A;  2K6D B;  4GXB A;  3UIP B;  3W1Y A;  2CR5 A;  3A9K A;  2ASQ A;  3EC8 A;  2B3A A;  2IO1 B;  3DPD A;  4KZ0 A;  3S2A A;  1OTR B;  2NBV B;  2JF5 A;  4PS3 A;  2MWS B;  2V1Y A;  1E8X A;  2G4D B;  3A1Q B;  1WIA A;  1Y8R C;  2KFK A;  4W9J A;  4FHJ A;  3DVN U;  4PYZ A;  5GMV A;  3UF8 A;  1LQB A;  2BPS A;  1E8Y A;  1EO6 A;  3H6N A;  2C60 A;  4FAD A;  1WI0 A;  4F1S A;  4EZJ A;  4K7S A;  3VTU A;  2ZJD A;  2AL3 A;  4HCN B;  2KDE B;  4IM2 A;  1TGZ B;  2JY6 A;  1SIF A;  2DYO A;  2KAN A;  3VUY A;  3APF A;  1YD8 U;  2D11 A;  2K8B A;  3CST A;  4XC2 A;  1KJT A;  4IW0 A;  4ANU A;  3H7P A;  3RCZ A;  2FID A;  3ZNZ B;  4TV3 A;  3VFK A;  3U7D A;  2IBI B;  1UZX B;  4FN2 A;  3V6C B;  5DPT A;  4I6L B;  3OJ3 A;  1V81 A;  2DHZ A;  3HHM A;  5DPR A;  4NJ7 A;  3OLM D;  3PPA A;  4TUU A;  1GC7 A;  2MBH A;  4AUQ C;  1I42 A;  3VTV A;  4GDK B;  2L7R A;  1TBE A;  3C0R B;  2Z0E B;  4IM0 A;  3NZU A;  4URK A;  3R3M A;  1P0R A;  2XEW A;  5E6N A;  3QK0 A;  5IAA C;  2CU1 A;  4W9E A;  2MBO A;  3QHT A;  4JGH B;  2FIF A;  2ZPY A;  4A3O A;  3DBH I;  3KVF B;  4KDI C;  4XX5 A;  4NY0 A;  4ZRJ A;  3RZF A;  2WDT B;  4BBN F;  4IWQ A;  3MJW A;  1XT9 B;  2XBB C;  3H7S A;  2DYB A;  4PS8 A;  4EZL A;  4II2 B;  2BF8 B;  2A4Z A;  1WZ0 A;  4ANX A;  1S1Q B;  3L17 A;  1OEY J;  4RM9 A;  1GUA B;  1KLV A;  3X23 A;  4MM3 A;  3DVG Y;  5LXI B;  4BKG A;  2KJH B;  1CMX B;  2G45 B;  2KO3 A;  2L3Z A;  2C9W B;  2LRW A;  1GNU A;  4HWI B;  2BWF A;  3B0A A;  2KN5 A;  4HK2 A;  3P2B A;  2GBJ A;  3ZDM C;  2AL6 A;  4YL8 A;  4KIK B;  2BYF A;  5J2R A;  2KWV B;  5D2M B;  1WGR A;  2JZ3 B;  3L13 A;  2IYD B;  4M8M A;  3TL5 A;  4TQ0 A;  2RPQ A;  2LGY A;  3HM6 X;  2KWC A;  3PRZ A;  2BYV E;  2KKC A;  4GB9 A;  3A9J B;  2AYO B;  3DQV A;  2KQ7 A;  5HKH A;  2IZV B;  3ZUN A;  2IY0 B;  4WJQ A;  3L54 A;  3QIJ A;  2FCN A;  2NPT A;  4DK5 A;  2DX5 B;  2JZZ A;  3QC8 B;  2PEA A;  4MSQ B;  2J0M A;  2MX2 A;  2NS5 A;  2KTR B;  2IO2 B;  1J0G A;  1WJN A;  2C5L C;  2JVC A;  3A9K B;  2RSU A;  3PS6 A;  4LJP B;  3H1U A;  1KM7 A;  2EMS A;  4HPL B;  3LDZ E;  3RUL A;  4FJY A;  2M8S A;  2KC1 A;  5FR6 A;  4DDI D;  2J7Q B;  2JRH A;  2KFK B;  2KXJ A;  1I35 A;  2RGF A;  3HIZ A;  4GSW A;  3AU4 A;  2LAS A;  4NPN A;  1P3Q U;  2IO3 B;  1WGH A;  2KLG A;  1OQY A;  3ZKJ C;  2LD9 A;  4EEW A;  1J19 A;  3L10 B;  1WMH A;  3UQA A;  4GMV A;  2GBK A;  2D10 A;  2HD5 B;  4DHJ D;  4W9C A;  4ZYN A;  3BY4 B;  1E5W A;  4MEL A;  3QWZ B;  3EEC A;  2WX0 A;  2N9E B;  2QHO A;  3QA8 A;  1EF1 A;  4OVU A;  2DYM A;  2KVR A;  2LGX A;  4DBG A;  3PVL A;  3WAO A;  4GDL A;  1LFD A;  1EUV B;  3ONS A;  4IG7 B;  4KV2 A;  3ZRC A;  3L08 A;  4JL9 A;  3Q3J A;  2O6V A;  4M8N A;  2LXA A;  5CHW A;  4WAA A;  2L00 B;  3JSV A;  1J8C A;  2PJH A;  4FLH A;  2IY1 B;  2KK8 A;  3RZW C;  4AJY B;  5KHQ A;  1E7U A;  5JHA A;  3ZRF A;  3TBL D;  1V2Y A;  4TQ1 A;  2FAZ A;  4E71 A;  1WX8 A;  1GJZ A;  2M1M A;  2REX A;  1R4M I;  1YX5 B;  5C1Z A;  2GBR A;  4HDO A;  4KZC A;  3SHQ A;  1NDD A;  2MBQ A;  4AP4 C;  5DPS A;  2K8H A;  3AU5 A;  3N30 A;  2V3S A;  1H8C A;  5JHB A;  4FJV B;  4HVB A;  2NR2 A;  1IPG A;  2PE6 B;  4W9L A;  1AAR A;  3PT2 B;  3ZLZ A;  4GOC A;  4B6W A;  1WFY A;  3KYC D;  2BWE S;  4IWO A;  4G3X B;  3CSF A;  2G3Q B;  2M17 A;  2JPH A;  1WYW B;  4WQO B;  2LUE A;  2ZNV C;  2ZVN A;  3DBR I;  3EFU A;  3U30 A;  3ZNI D;  3W1S C;  2I1K A;  4MH0 E;  3ECI A;  3B1L X;  1RRB A;  4ZRK A;  2GBM A;  4W9F A;  1RAX A;  3ZDT A;  3NZS A;  5D7G A;  2MBE A;  3TCA A;  4GIV A;  2JRI B;  1YQB A;  2Y5B B;  5AZG A;  4BKS A;  2K39 A;  2MA9 B;  2LI5 A;  1KOT A;  3TMP B;  5D6J B;  3DOW A;  2KC2 A;  1D3Z A;  3R7Q A;  3ALB A;  5J17 A;  4LJO B;  1XD3 B;  3DVN V;  2WYQ A;  2KDB A;  1E7V A;  1LXD A;  1U4A A;  3NY5 A;  3UQB A;  3T8M A;  1LM8 B;  3ENE A;  4MSM B;  3RD2 A;  3RUI B;  1M94 A;  3D32 A;  1V49 A;  2KNB A;  2NPT B;  3GOE A;  3T9L A;  3PGE A;  2CHX A;  3A1Q A;  4HPM B;  3TJP A;  5L83 A;  5DPW A;  3IFW B;  1TTN A;  3B08 A;  3Q3F A;  3N3K B;  4FUL A;  3VAW A;  1QZE A;  3SDL C;  4ASW C;  5IA7 A;  4M0W B;  4E3C A;  2UYZ B;  3K9O B;  3ZW3 A;  2YLM A;  1ZKH A;  2DZM A;  2IO0 B;  2AEH A;  1WR6 E;  4GGQ A;  4K81 A;  3V61 A;  2KLC A;  4BOS C;  1WX9 A;  2KFJ A;  1YX6 B;  3HM3 A;  2LVO A;  1MG8 A;  5CTR C;  2LXC A;  2MCN B;  2K8C A;  5DCN A;  4AWJ A;  3TIX A;  3WA0 A;  1P98 A;  4MEM A;  1K8R B;  2LJ5 A;  3HK0 A;  1Q5W B;  1YJ1 A;  3A33 B;  1V5T A;  4G0N B;  3PRM B;  2DZI A;  4FBJ B;  1RLF A;  1L2N A;  1VD2 A;  5D94 A;  3JW0 X;  2DAF A;  2KJR A;  1V6E A;  1WMH B;  1WR1 A;  1F9J A;  3ZIM A;  2N7E A;  2FCQ A;  1P1A A;  2L0T A;  1YIW A;  4BFR A;  2FUH B;  4MJS B;  4F8C B;  2ZZP B;  2L8J A;  4A3P A;  2MSE D;  3VH3 B;  2O6V D;  3AUL A;  1WJU A;  4EKU A;  1E90 A;  2XK5 B;  4EFO A;  5CHF A;  4DHZ B;  4HJK A;  2KDF B;  1WXS A;  4MGI E;  2WWZ A;  2YVC A;  4MGK E;  4GDL B;  5G55 A;  3X0W A;  4EZK A;  4WWN A;  1Q1O A;  3QQ8 B;  2DEN B;  3ZVV A;  4IM3 A;  4BVU C;  3DCG A;  1ISN A;  3UIO B;  3IVF A;  3APD A;  4B95 A;  3ML8 A;  2N9X A;  3PRP B;  4GU2 A;  4II3 B;  2N4F A;  5BO4 B;  2OJR A;  2CKH B;  3O65 B;  4IWP A;  4DHZ E;  3QX1 A;  2V4L A;  1WH3 A;  2J0K A;  2JWZ A;  4DWF A;  2ZEQ A;  3CF6 E;  4WWP A;  2KMA A;  1JRU A;  2D07 B;  4G11 A;  4ICU A;  3WAP A;  4HXD A;  1V86 A;  3PTF C;  3EHV A;  5EDS A;  2O2V A;  1FXT B;  1Q0W B;  2WX1 A;  3ZO5 B;  1WE7 A;  3A4R A;  4OVV A;  2MP2 A;  5AZH A;  2D2Q A;  3L0W B;  2JXX A;  4CO7 A;  4W9D A;  3H7P B;  3IBE A;  1E8W A;  1XQQ A;  2KX0 A;  4BKS D;  5J18 A;  2K1F A;  4FA6 A;  2LWP A;  4DHJ B;  3DBL I;  3IG3 A;  4NAW A;  3ML9 A;  2BYE A;  4W9I A;  4GN1 A;  4A20 A;  4B9K A;  1Z5S B;  5C23 A;  3NOB A;  5E6P A;  1P9D U;  3KYD D;  1WXA A;  2NBU A;  5JH5 C;  1UGM A;  3UGB B;  2HE7 A;  4FHK A;  4HLE A;  4K7W A;  4N9F 4;  3PLV A;  1VCB A;  5AEK B;  2UWQ A;  1WGD A;  2CHW A;  3V60 A;  2M0X A;  4I6N B;  2KJ6 A;  1WM2 A;  2ZVO A;  1EF5 A;  4BBN C;  1A5R A;  3QJZ A;  3V6E B;  2RD0 A;  4KSL C;  4TKN A;  4RMA A;  3VHT C;  3KH0 A;  3W1S A;  2LGD A;  3DVG X;  2LVP A;  2KHW B;  1T0Y A;  4BKT A;  3L16 A;  2L05 A;  3VH4 B;  2RR9 A;  3U8Z A;  3NHE B;  4AOF A;  3CMM B;  2MLB A;  2PE9 A;  4W9G A;  1IYF A;  2G4S A;  3I3T B;  1UH6 A;  4FJZ A;  3A4S C;  4DXA B;  2FCS A;  4EUT A;  4ZRI A;  2I1J A;  2NBW B;  4NQL B;  3KUD B;  3QAQ A;  3WAN A;  1BT0 A;  2W9N A;  3KW5 B;  2N1W A;  3JYU A;  4WJP A;  1GG3 A;  3PHW B;  1OEY A;  2Z59 B;  2HJ8 A;  4NQK E;  4ANW A;  1WY8 A;  2CHZ A;  4PYU A;  3V62 A;  3R66 C;  2GBN A;  4BOZ B;  3APC A;  2L0F A;  1WRD B;  2N1V A;  2N7D A;  3N32 A;  5G2N A;  3PV1 A;  3AI5 A;  1V9J A;  3VDZ A;  1UBQ A;  1L7Y A;  3PRE A;  3QAR A;  4I6P A;  2D3G A;  2CS4 A;  2N9P C;  1IP9 A;  3MHS D;  2ZCC A;  4HDQ A;  2LZ6 A;  3PSE B;  2GMI C;  2J0J A;  1S3S G;  2KOX A;  4ICV A;  3OJ4 B;  3RYT A;  1C3T A;  4KSK C;  3AXC A;  3M63 B;  5CX3 A;  5KHO A;  1WGY A;  3QCA A;  5LXH A;  1X1M A;  3KUC B;  4KVG B;  2LVQ A;  3VVW B;  3SD5 A;  4P7I A;  3M95 A;  1NBF C;  3VUW A;  3WAL A;  3WIM A;  1OGW A;  2BKF A;  2DZK A;  2MBB B;  4IC7 B;  3VTW A;  1SE9 A;  4KDL B;  3ZTC A;  2KDI A;  4NJ6 A;  5AZF A;  5L95 C;  1WGG A;  2MQJ A;  2KZR A;  1WE6 A;  4LDT D;  1WJ6 A;  1UD7 A;  1WM3 A;  2L76 A;  1ZGU B;  3JVZ X;  1WZ3 A;  4G50 A;  2K25 A;  4WWO A;  4WJO A;  1Z2M A;  3DDC B;  3PZD A;  3LJ3 A;  1UBI A;  3DBS A;  2A5U A;  4CYE A;  2O2V B;  3WAM A;  4LDT B;  4K7U A;  4GDK A;  4X57 B;  2MP2 B;  1C1Y B;  4MGY E;  4NNJ B;  2K6Q A;  4DDG D;  2DAJ A;  1WX7 A;  2Z0D B;  4K1R B;  4LCD E;  2R2O A;  2R2Q A;  4EOY A;  4HCP B;  2C7H A;  2DZJ A;  3ZNG C;  2VRR B;  4NAW B;  3NS8 A;  2O6V B;  2AWT A;  3H9D A;  2ZCB A;  2LRU A;  2KQS A;  3K9P B;  1GC6 A;  3PHX B;  3JSV B;  4MDK E;  5E6O A;  4ANV A;  1G6J A;  3M3J A;  2EMT A;  3VQI A;  2FCM A;  1R4N I;  1WXM A;  2MRP A;  3R7R A;  4W9H A;  3BIN A;  4AJW A;  2NVU I;  5TR5 A;  2KWU B;  3VXW A;  5JZE B;  2KD0 A;  2JUO A;  1TZ1 A;  4E74 A;  2EKE C;  4MGZ E;  2KX3 A;  1V5O A;  5LLI A;  4JQW C;  1ZW7 A;  2PPH A;  2ZNV B;  4W9K A;  2KMC A;  4WJN A;  4KIK A;  1SGH A;  2BGF A;  1WJ4 A;  2FNJ B;  3MTN B;  3PLU A;  1V80 A;  1E8Z A;  3GZN I;  2NCN A;  3M62 B;  4CHK A;  4PS7 A;  2KTF A;  1H4R A;  3KUZ A;  4J6I A;  3A9J A;  2C7N B;  4XZ4 A;  1RFA A; 
#chains in the Genus database with same CATH topology
 3FIL B;  3UIN B;  1PQS A;  1UEL A;  4NAM A;  3BK2 A;  2XK5 A;  4ZRQ A;  2IJ0 A;  2ZPN A;  3GE8 C;  4GXB A;  3UIP B;  2B3A A;  3S2A A;  3Q3M C;  3Q8B A;  3ZYY X;  3NRZ A;  1ZXI A;  4XE0 A;  4PS3 A;  2MWS B;  2G4D B;  3P63 A;  3A1Q B;  3AEC B;  4PYZ A;  3AH7 A;  1EO6 A;  3H6N A;  5D3I B;  1QOA A;  4FAD A;  4K7S A;  1D6E C;  3URY A;  2ZJD A;  2AL3 A;  3RNF C;  4HCN B;  4RFB A;  2WGS A;  1I4H A;  1SIF A;  2DYO A;  1YD8 U;  2HTM E;  4ANU A;  2D5G A;  1CK1 A;  3U7D A;  2BBC A;  3V6C B;  5DPT A;  1V81 A;  3AE4 B;  2DHZ A;  3HHM A;  3C19 A;  5DPR A;  2Z0E B;  3NZU A;  4URK A;  4P1B C;  3U52 E;  2DWQ A;  3QK0 A;  3AEE B;  5AUI A;  3DBH I;  4A6Q A;  4ZRJ A;  2BW2 A;  1XT9 B;  3MJ5 A;  1FD6 A;  4PS8 A;  1EM7 A;  4II2 B;  5EE3 A;  2A4Z A;  3MC9 A;  3ZXR A;  3P4S B;  4HPP A;  5D3D A;  1KLV A;  4MM3 A;  5LXI B;  4LNK A;  1CMX B;  4IOI E;  2C9W B;  2KN5 A;  1OQQ A;  4ZHO A;  2GBJ A;  4KIK B;  3P1M A;  2BYF A;  5J2R A;  1WGR A;  3L13 A;  1ET9 A;  3EA6 A;  4HKQ A;  3FAH A;  3MC8 A;  2L52 A;  4GB9 A;  4OHJ A;  1XLN A;  4RGM A;  5HKH A;  2IZV B;  2IY0 B;  1TS4 A;  4R3D A;  2INN E;  2JZZ A;  4K3B A;  2J0M A;  3NVW A;  2MX2 A;  2NS5 A;  2PVG C;  1J0G A;  2C5L C;  4C80 A;  1FNW A;  3LDZ E;  5FR6 A;  3KLS X;  2JRH A;  2VH2 A;  1I35 A;  3DHH C;  1P3Q U;  1ZP0 B;  3I9V 1;  5C2T B;  3UQA A;  2QIL A;  1I4Q A;  2D10 A;  2HD5 B;  1KF6 B;  4W9C A;  1E5W A;  4TMA B;  2N9E B;  1TYG B;  3Q3J A;  2O6V A;  4M01 A;  1J8C A;  1RFK A;  3BYT B;  4AJY B;  1LGR A;  4HKZ E;  2IGH A;  5JHA A;  3TBL D;  4TQ1 A;  4E71 A;  3AEA B;  1GJZ A;  2M1M A;  1TY0 A;  4XDC A;  1XLP A;  2L1A A;  3U7Z A;  4ZRP A;  5DPS A;  2K8H A;  1SIJ A;  2KAC A;  1T6B X;  1UNS A;  3KYC D;  2WS3 B;  2JPH A;  2LUE A;  3DBR I;  3W1S C;  4IDI A;  4ZRK A;  5BYQ A;  4W9F A;  2MBE A;  3TCA A;  5AZG A;  4BKS A;  1L4D B;  2MA9 B;  4PT5 A;  2KC2 A;  3AE5 B;  1GB1 A;  4KGS A;  2WYQ A;  1U4A A;  3MC0 B;  3T8M A;  4WQM A;  1XO3 A;  1LM8 B;  3ENE A;  5BMI A;  1DOI A;  3HVZ A;  1C4C A;  3RUI B;  3GOE A;  2KNB A;  3T9L A;  5L83 A;  1VZ6 A;  4FUL A;  3VAW A;  5IA7 A;  3K9O B;  4M02 A;  1E9M A;  2YLM A;  1ZKH A;  2IO0 B;  4BOS C;  1DYQ A;  1NYR A;  1YX6 B;  3HM3 A;  1MG8 A;  1BML C;  4RH6 A;  1FRR A;  3B2G A;  3IAM 1;  1V5T A;  2LUM A;  2ACZ B;  3ZIM A;  3U4E G;  5AUK A;  4F8C B;  4OZC A;  2ZZP B;  2MSE D;  3VH3 B;  3AEG B;  2O6V D;  1RM6 C;  3AUL A;  1WJU A;  1E90 A;  3BZD B;  4EFO A;  5CHF A;  3EGR A;  2KDF B;  1WXS A;  2QIE B;  4EZK A;  5G55 A;  4WWN A;  1T0R C;  2QEJ C;  1Q1O A;  2SEB D;  3AE3 B;  1QT9 A;  3GZN B;  1MHX A;  2NMQ A;  1ENF A;  2J0K A;  3N9Y C;  4ZYS A;  3CF6 E;  2L32 A;  2KMA A;  3AM9 A;  4LNI A;  2WX1 A;  1NEN B;  3GP7 A;  2WHI A;  1C77 A;  4CO7 A;  3H7P B;  3IBE A;  4BKS D;  4KX6 B;  2TSS A;  4DXG A;  2LWP A;  1L6V A;  3IG3 A;  4W9I A;  1MJD A;  1YN4 A;  3LYY A;  5E6P A;  1P9D U;  2RDH A;  2RMM A;  2NBU A;  1UGM A;  2KMM A;  5T8I A;  2CHW A;  2KJ6 A;  1BXT A;  1I7H A;  4TKN A;  5I4D A;  3FC4 A;  3DVG X;  2LVP A;  4ACF A;  2L05 A;  1TKG A;  3VH4 B;  2Y3A A;  1IYF A;  2G4S A;  1UH6 A;  1DOY A;  4DXA B;  2I1J A;  4USA A;  4D2K A;  3WAN A;  2QSD A;  1JWS D;  2W9N A;  2Z59 B;  3V62 A;  3R66 C;  1P7F A;  1V9J A;  2W3R A;  4I6P A;  2CS4 A;  1ROE A;  2AQ3 B;  1IP9 A;  4HDQ A;  1TZO A;  1KH0 A;  2H88 B;  3M63 B;  3SD5 A;  1KFY B;  5IKC M;  2BKF A;  2MBB B;  1SE9 A;  4KDL B;  1XF5 L;  1NVI D;  1C78 A;  2WNM A;  1JCK B;  1WZ3 A;  3JVZ X;  2N7J A;  3LJ3 A;  1UBI A;  3DBS A;  4DXF A;  3WAM A;  4XYC A;  4X57 B;  1C1Y B;  3I63 C;  1F0Z A;  3IAS 1;  4EOY A;  2YEP F;  2DZJ A;  1E0Z A;  1K53 A;  3H9D A;  5G5H A;  1RYJ A;  3K9P B;  1HZ6 A;  4ANV A;  3H8H A;  3M3J A;  2AQ2 B;  2FCM A;  1STE A;  4HEA 1;  1R4N I;  3I57 A;  2RDG A;  1QF6 A;  1TZ1 A;  1V5O A;  2ZNV B;  1ZUD 2;  4W9K A;  1SE3 A;  3SFE B;  1VDV A;  1GAQ B;  2BS4 B;  4US8 A;  1T0S C;  1QLB B;  3M62 B;  1R7S A;  2WXJ A;  2YEP B;  1UF0 A;  3A9J A;  2AEH A;  1RFA A;  2WU2 B;  1HE8 A;  1NI2 A;  2FE8 A;  2M4N A;  1QQR A;  2JT4 B;  1B9R A;  1J7B A;  4MJS A;  2UU7 A;  5CHV C;  3SU8 X;  4RM8 A;  3IHP C;  4IUM B;  3RT3 B;  4JIO U;  2OOB B;  2IO1 B;  3DPD A;  4KZ0 A;  1OTR B;  4M00 A;  1FPY A;  1MG4 A;  4J3O D;  2V1Y A;  4AQ7 A;  2VZK B;  3W5V B;  1Y8R C;  4C7Z A;  4W9J A;  3UF8 A;  5GMV A;  3RNA C;  2OED A;  1TKE A;  2MJ3 A;  2W54 A;  4IM2 A;  5HI1 A;  3VUY A;  2K8B A;  3ZJT A;  4XC2 A;  4IW0 A;  1FO4 A;  3TSS A;  4TV3 A;  1SBB B;  4YSZ B;  5MPO A;  4FN2 A;  4I6L B;  3E56 A;  1F1H A;  2Y5C A;  1GC7 A;  2MBH A;  1TBE A;  3R8B A;  2BB5 A;  2W55 A;  2XEW A;  3BK1 A;  5E6N A;  2CU1 A;  4W9E A;  3QHT A;  5IP4 D;  4A3O A;  3IXS A;  3P4R B;  4KDI C;  2N9K A;  4XGA B;  4BBN F;  4IWQ A;  3MJW A;  5G5G A;  4BZA A;  3RNG C;  1WZ0 A;  3ZJV A;  1FNU A;  1S1Q B;  1SJE D;  3T3N A;  5H8Y E;  3X23 A;  4BKG A;  4WIP A;  5HHD G;  2KO3 A;  2L3Z A;  2LRW A;  1GNU A;  4HK2 A;  3P2B A;  4XWW A;  4C7Y A;  5EE1 A;  2IYD B;  4UDU C;  3AE2 B;  4YSY B;  4C4V A;  1V97 A;  2CU3 A;  2INC C;  4WWM A;  2WQY B;  2KKC A;  3A9J B;  2AYO B;  1PGB A;  1N61 A;  4A8X C;  1I4P A;  2LJI A;  2WXQ A;  2MEK A;  2WU5 B;  1TY2 A;  3QC8 B;  2PEA A;  1V1P A;  4M0W A;  2K22 A;  3PS6 A;  1IUE A;  4LTU A;  2M8S A;  4DDI D;  4WUR A;  3GB1 A;  3RPF C;  3VRA B;  2IPK D;  2KXJ A;  3WCQ A;  4GSW A;  3RFZ B;  2LAS A;  2N9L A;  1ET6 A;  2WXM A;  2KLG A;  4RNA A;  1WMH A;  3AE9 B;  1IGD A;  3BY4 B;  1HQR D;  3EEC A;  3NVZ A;  2DYM A;  2LGX A;  4GDL A;  2WLB A;  4JL9 A;  1HEZ E;  2KYW A;  3SEB A;  2L00 B;  3JSV A;  2RPV A;  2QC8 A;  4FLH A;  2IY1 B;  1E7U A;  3ZRF A;  1R4M I;  5C1Z A;  2GBR A;  3SHQ A;  1NDD A;  2OHF A;  3N30 A;  3VR9 B;  2R61 A;  1C76 A;  2I2Y A;  2PE6 B;  1ZDV A;  3PT2 B;  1UUP A;  2Z8L A;  1K50 A;  4IWO A;  3MFG A;  2ZNV C;  4MH0 E;  2WXO A;  4LLG M;  1RRB A;  2GBM A;  1RAX A;  1HA5 A;  4A9A A;  2JRI B;  1YQB A;  2Y5B B;  2K39 A;  3AMZ A;  3ETR A;  4C4V B;  1JWM D;  4LJO B;  1XD3 B;  4PK1 A;  3P4Q B;  4L23 A;  2JYE A;  3Q69 A;  2GRI A;  3DHG C;  1LO5 D;  1WWT A;  4YTN B;  4MSM B;  1M94 A;  3D32 A;  1SE4 A;  1C4A A;  2CHX A;  4HPM B;  3TJP A;  4HJG E;  3IFW B;  3R2I A;  3VR8 B;  4ASW C;  3CWI A;  4M0W B;  1C9F A;  2DZM A;  4GGQ A;  3V61 A;  2JXT A;  4ZHP A;  3Q14 C;  4AWJ A;  3TEY A;  2LGI A;  4MEM A;  2JZP A;  1K8R B;  1OQR A;  2LJ5 A;  1JWA D;  3A33 B;  3U2S C;  1L2N A;  3PZ7 A;  1V6E A;  1WMH B;  1WR1 A;  5HG2 A;  2N7E A;  2FCQ A;  2PW9 A;  2BS3 B;  4N59 A;  2XK5 B;  2YVC A;  4GDL B;  1CZP A;  2DEN B;  4K3C A;  3UIO B;  1ISN A;  1L0V B;  1HTQ A;  3IVF A;  4B95 A;  3ML8 A;  3PRP B;  4II3 B;  3Q6B A;  2N4F A;  2CKH B;  3O65 B;  1N60 A;  2V4L A;  2M0A A;  4DWF A;  4WWP A;  3AB5 A;  4ICU A;  3WAP A;  4HXD A;  1JW9 D;  3PTF C;  3EHV A;  1FXT B;  4JX1 C;  5AZH A;  2MP2 A;  2JXX A;  1XXG A;  1E8W A;  1WGK A;  2VH1 A;  2KX0 A;  2K1F A;  4NAW A;  1D5M C;  3ML9 A;  4A20 A;  1FFU A;  3Q8A A;  4JPS A;  3B2F A;  2HJ1 A;  2W82 A;  4K7W A;  3PLV A;  2UWQ A;  2EEL A;  1JRP A;  1WM2 A;  2LFI A;  1EF5 A;  2ZVO A;  4BBN C;  1A5R A;  1TS5 A;  2RD0 A;  2B76 B;  2IGG A;  2LGD A;  2KHW B;  1T0Y A;  4BKT A;  3L16 A;  4YXD B;  3NHE B;  4MM3 B;  3CMM B;  2WXN A;  4EUT A;  4NQL B;  1BT0 A;  2N1W A;  4WJP A;  3DBH B;  1XLO A;  3PHW B;  1M4V A;  2GBN A;  5G2N A;  3PV1 A;  1UBQ A;  3QAR A;  2D3G A;  3SFD B;  5FKA C;  3MHZ A;  1XLQ A;  3PSE B;  3RNC C;  2J0J A;  1S3S G;  2KOX A;  1TT5 B;  1C3T A;  1ZXH A;  2M19 A;  1X1M A;  3KUC B;  4XWT A;  3VVW B;  4P7I A;  1NBF C;  3VUW A;  3WIM A;  3AED B;  5EE0 A;  2DZK A;  4MH8 A;  1WGG A;  1WE6 A;  3O13 A;  2MH7 A;  4LDT D;  1WJ6 A;  1UD7 A;  1WM3 A;  1ZGU B;  4RCO A;  3P4P B;  1EWC A;  4WWO A;  4WJO A;  5EE9 A;  4LDT B;  4K7U A;  3Q2A C;  2MP2 B;  4NNJ B;  1WX7 A;  2Z0D B;  4K1R B;  2R2Q A;  1V8C A;  2C7H A;  2VRR B;  4NAW B;  1XEE A;  1RWS A;  2O6V B;  2AWT A;  1GOZ A;  1L5P A;  5E6J A;  1JWB D;  2E3T A;  3VQI A;  2MRP A;  4RF0 A;  3R7R A;  4W9H A;  2LMC A;  1E10 A;  1KRH A;  1SXT A;  1JQ4 A;  2WXR A;  2G1E A;  1B1Z A;  2JYT A;  3DHI C;  2V4I B;  2BGF A;  1WJ4 A;  2W3S A;  2FNJ B;  3E9S A;  3PLU A;  1E8Z A;  4CHK A;  2BT6 A;  4QAY A;  4JWS C;  3AE1 B;  2MW5 A;  2WP9 B;  3TEZ A;  2EKI A;  1JAL A;  4F7Z A;  3N1X C;  1WF9 A;  4ZOH C;  2KTR A;  4ZDV A;  2K6D B;  2ASQ A;  2BYT A;  2NBV B;  1Y56 A;  1IGC A;  1E8X A;  1JML A;  3BWU D;  5IO9 A;  1WIA A;  3FKY A;  3DBR B;  1MHH E;  2KFK A;  2BPS A;  2KVZ A;  2C60 A;  4RGT A;  4F1S A;  2QDF A;  3VTU A;  1N63 A;  2WDQ B;  3T3O A;  2KAN A;  3APF A;  3CST A;  1KJT A;  1MI0 A;  4H2A A;  3RCZ A;  4GLS C;  2FID A;  1PGA A;  2MHJ A;  3VFK A;  2IBI B;  1UWX A;  1UZX B;  1IBX A;  1BUI C;  2WXG A;  3OLM D;  3PPA A;  4TUU A;  4ARC A;  4AUQ C;  4RGO S;  2WXK A;  3C0R B;  4IM0 A;  3R3M A;  5IAA C;  1L0X B;  3ZJU A;  2CJN A;  2WXI A;  1ZDX A;  4IKG A;  3KVF B;  3J9C A;  1VLB A;  4NY0 A;  3RZF A;  2WDT B;  1YOV B;  2XBB C;  1P7E A;  2BF8 B;  4ANX A;  4OVZ A;  1FMA D;  1OEY J;  3L17 A;  1GUA B;  3DVG Y;  1I4R A;  1ACC A;  2RDB C;  4HWI B;  2D3A A;  3B0A A;  3ZDM C;  2AL6 A;  2KWV B;  4M8M A;  3EUB 2;  2RPQ A;  3HM6 X;  3IT4 B;  3V3X A;  3L54 A;  3QIJ A;  3GS2 A;  2NPT A;  4DK5 A;  4S17 A;  1DGJ A;  2DX5 B;  2PMV A;  1EWY C;  2KTR B;  1C4P A;  1WJN A;  2RSU A;  2KAJ A;  4LJP B;  3CIR B;  1KM7 A;  3H1U A;  3IT6 B;  2EMS A;  4HPL B;  3RUL A;  4FJY A;  1WSP A;  2KC1 A;  2BQQ A;  4JWU C;  2KFK B;  1FXI A;  3AU4 A;  2IO3 B;  2LD9 A;  4EEW A;  1J19 A;  1JWU D;  2HDE A;  4US9 A;  4GMV A;  2GBK A;  4A90 A;  3RNB C;  5JXV A;  4DHJ D;  1QOB A;  1YN5 A;  4ZYN A;  2QCZ A;  3QWZ B;  2WX0 A;  2QHO A;  1EF1 A;  1VJK A;  4OVU A;  5IN7 A;  3PVL A;  1LFD A;  3NUH B;  4L2Y A;  4IG7 B;  3L08 A;  3TEW A;  1VRA B;  2LXA A;  5CHW A;  4WAA A;  1CJE A;  2Q5W D;  4P1C C;  5KHQ A;  1V2Y A;  2AX5 A;  2FAZ A;  4HDO A;  2MBQ A;  4AP4 C;  5JHB A;  1XCT L;  3R2T A;  3N1Z C;  4W9L A;  3ZLZ A;  1WFY A;  4G3X B;  3CSF A;  2G3Q B;  3ZNI D;  3EFU A;  2I1K A;  3ABV B;  3LXF A;  2KQ4 X;  3ZDT A;  5D7G A;  1EU3 A;  3FIL A;  4GIV A;  3ZGZ A;  4MT5 A;  5D6J B;  1T5X D;  2WXF A;  3R7Q A;  3ALB A;  5J17 A;  2L83 A;  1WXQ A;  2KDB A;  1LXD A;  3NY5 A;  4YTP B;  3GE3 C;  1J7A A;  1V49 A;  2NPT B;  5DPW A;  3A1Q A;  1TTN A;  5H92 C;  1FCC C;  1L4Z B;  1VZ8 A;  2IGD A;  4E3C A;  5FK9 C;  2UYZ B;  3ZW3 A;  4K81 A;  1WR6 E;  2KLC A;  1WX9 A;  1UWM A;  3PZ8 A;  5TSS A;  2D3B A;  2QJL A;  2J42 A;  2LVO A;  5CTR C;  2LXC A;  2K8C A;  1F52 A;  1C79 A;  3TIX A;  3WA0 A;  1P98 A;  1SJH D;  2K3U A;  3HK0 A;  1RLF A;  2MJD A;  4Q2J A;  1VD2 A;  5D94 A;  4JE3 B;  2KJR A;  1P1A A;  1YIW A;  2FUH B;  4MJS B;  1R4N B;  2L8J A;  3BII D;  4A3P A;  1SEB D;  2KWD A;  4EKU A;  2FBW B;  3VRB B;  4HJK A;  4MGK E;  4KKI A;  2CJO A;  2E6X A;  4IM3 A;  1SSN A;  1T3Q A;  3APD A;  4LK0 M;  2N9X A;  3AEB B;  3RNE C;  1ZE3 D;  2LHE A;  4CQN A;  1JRU A;  2ZW1 A;  1HZ5 A;  1CQV A;  2K9X A;  2V0G A;  5EDS A;  1YQ4 B;  2O2V A;  4ARI A;  2G9H D;  3ZO5 B;  1WE7 A;  2QMT A;  4OVV A;  2ONQ A;  1TS2 A;  1XQQ A;  5J18 A;  2WXL A;  3DBL I;  5BMG A;  1NYQ A;  2BYE A;  4P6V F;  2WXH A;  1Z5S B;  4B9K A;  5C23 A;  1WXA A;  2GB1 A;  2WDV B;  3UGB B;  2HE7 A;  4HLE A;  4N9F 4;  1WGD A;  4O1N A;  4BAX A;  2M0X A;  3TUO A;  4RMA A;  3KH0 A;  3RN9 C;  1N62 A;  2MLB A;  2PE9 A;  1FCL A;  3I3T B;  3A4S C;  2NBW B;  1F2R I;  1QIL A;  3AEF B;  3JYU A;  1GG3 A;  4NQK E;  1OEY A;  2HJ8 A;  4ANW A;  1WY8 A;  2V3P A;  1WRD B;  3N32 A;  1SF0 A;  1J7C A;  3PRE A;  4OZA A;  4P16 A;  1GPX A;  2N9P C;  2SAK A;  3MHS D;  2ZCC A;  2GMI C;  1V1P B;  1UGJ A;  3L4P A;  1PYW D;  4KSK C;  3AXC A;  1FEH A;  1SE2 A;  1WGY A;  3QCA A;  5CX3 A;  5LXH A;  4KVG B;  2DLB A;  2V9H A;  3M95 A;  3WAL A;  4DQO C;  4A55 A;  3VTW A;  5L95 C;  3HVD A;  2KDI A;  4NJ6 A;  5AZF A;  5BYR A;  4G50 A;  2K25 A;  1WRI A;  1Z2M A;  4REZ A;  3DDC B;  3RI7 C;  2MJE A;  4YSX B;  2O2V B;  3NS1 A;  1YMH E;  2GI9 A;  2PTL A;  4GDK A;  4MGY E;  4LCD E;  2PLP A;  1ZPS A;  3AE8 B;  3PO0 A;  3Q8C A;  4MAC A;  1E7P B;  2KQS A;  1GC6 A;  3PHX B;  3JSV B;  5E6O A;  1G6J A;  1I4G A;  1KLU D;  2EMT A;  3NJT A;  3DWG C;  5GXG B;  1WXM A;  3NVY A;  4OW0 A;  3BIN A;  5TR5 A;  5JZE B;  3VXW A;  2KD0 A;  4E74 A;  2EKE C;  4MGZ E;  4JQW C;  4WAF A;  2PPH A;  2KMC A;  4WJN A;  1SGH A;  3Q8E A;  4HRO A;  2I38 A;  3DBL B;  3GZN I;  2NCN A;  2KTF A;  1H4R A;  3BVM A;  3KUZ A;  2V3N A;  3NG0 A;  4J6I A;  4ITK A;  3VUX A;  3ZNH B;  3OAW A;  4JLC A;  1F77 A;  2GOW A;  2C7M B;  2HTH A;  1R4M B;  2BKR B;  3HUI A;  1WXV A;  3ZTD A;  2ON8 A;  3W1Y A;  2CR5 A;  2JSV X;  2DNF A;  3A9K A;  3EC8 A;  2JF5 A;  2WDR B;  3OWE B;  1FRD A;  1QOG A;  4FHJ A;  2XN9 C;  3DVN U;  1LQB A;  1E8Y A;  4LNN A;  1TKY A;  1WI0 A;  4EZJ A;  2BTE A;  4XDD A;  4KGT A;  5HFY A;  2KDE B;  1TGZ B;  2JY6 A;  4C00 A;  2K5P A;  3OG5 A;  3AV8 A;  2D11 A;  1GB4 A;  4YWG G;  1D5X C;  3H7P A;  4KKJ A;  3EFC A;  2KT7 A;  3ZNZ B;  5FR3 A;  1NEK B;  3OJ3 A;  3Q3O C;  4NJ7 A;  2NTS A;  1I42 A;  3VTV A;  4GDK B;  2L7R A;  2AQ1 B;  1A70 A;  4RGN A;  1P0R A;  4LNF A;  5BYS A;  2MBO A;  4JGH B;  1ZOY B;  3KWL A;  2FIF A;  2ZPY A;  4XX5 A;  2PIA A;  1YQ3 B;  3H7S A;  2DYB A;  4EZL A;  2H89 B;  2J53 A;  4RM9 A;  4EE2 A;  3N1Y C;  2KJH B;  2G45 B;  2BWF A;  1MPE A;  1D4B A;  4YL8 A;  2K0P A;  2J4X A;  5D2M B;  2JZ3 B;  3TL5 A;  4TQ0 A;  1N5X A;  2LGY A;  3PRZ A;  2KWC A;  2BYV E;  1Q10 A;  1JRO A;  3DQV A;  4TSS A;  2KQ7 A;  3ZUN A;  4WJQ A;  4L1B A;  3W5U B;  2FCN A;  3Q8F A;  1PGX A;  1DOX A;  4MSQ B;  4B0M A;  2IO2 B;  2JVC A;  3A9K B;  3SR6 A;  1PUT A;  1OFF A;  1MVK A;  3AN1 A;  3BYY B;  2J7Q B;  4WH4 A;  3BVG A;  1AYF A;  2J52 A;  2RGF A;  3HIZ A;  3ZQ4 A;  2BVC A;  4NPN A;  3I5J C;  3AE6 B;  1WGH A;  1OQY A;  3ZKJ C;  2ICI A;  1FNV A;  3L10 B;  1N5W A;  4LNO A;  1YNT E;  4MEL A;  3QA8 A;  3LB8 C;  2KVR A;  4DBG A;  3WAO A;  1EUV B;  3ONS A;  4KV2 A;  3ZRC A;  3BVZ A;  2IND C;  2ZW0 A;  2JU6 X;  1FFV A;  4M8N A;  3ZXV A;  2INP E;  2PJH A;  2LHD A;  2JQR B;  2KK8 A;  3RZW C;  1WX8 A;  2REX A;  1YX5 B;  4KZC A;  3AU5 A;  2V3S A;  1H8C A;  4FJV B;  4HVB A;  2NR2 A;  1IPG A;  1NI3 A;  3HRD D;  1AAR A;  4GOC A;  4B6W A;  2BWE S;  2M17 A;  1WYW B;  4WQO B;  2ZVN A;  3U30 A;  2Y5P A;  3ECI A;  3B1L X;  4YTM B;  3NZS A;  2LI5 A;  3W2D A;  1KOT A;  1KLG D;  3TMP B;  3DOW A;  1D3Z A;  2XNA C;  1FIQ A;  3DVN V;  3C8Y A;  1E7V A;  3UQB A;  2PKO A;  4B0E A;  2IDY A;  3RMK C;  3N20 C;  3RD2 A;  5BMH A;  2X8X X;  1HTO A;  3PGE A;  5C3J B;  3B08 A;  3Q3F A;  3N3K B;  1QZE A;  3SDL C;  2NTT A;  1L0Y B;  4S0R A;  2KFJ A;  2MCN B;  5DCN A;  3B9J A;  1Q5W B;  1YJ1 A;  4G0N B;  3PRM B;  4NZL B;  4AS1 A;  2DZI A;  3W9C B;  4FBJ B;  4OZB A;  1AWD A;  1F2R C;  3JW0 X;  2DAF A;  1N6Z A;  1F9J A;  1E6E B;  2L0T A;  4BFR A;  1VR9 A;  1YJJ A;  1V1O A;  2BS2 B;  4DHZ B;  4MGI E;  2WWZ A;  3X0W A;  3QQ8 B;  3ZVV A;  4BVU C;  3KQ4 A;  3DCG A;  5LNK 1;  4GU2 A;  5BO4 B;  2OJR A;  1QOF A;  2PVO D;  4IWP A;  4DHZ E;  3QX1 A;  2KN4 A;  1WH3 A;  2JWZ A;  2ZEQ A;  2D07 B;  4G11 A;  2X38 A;  1YN3 A;  1V86 A;  1FM0 D;  1Q0W B;  1K51 A;  3A4R A;  1TJE A;  2D2Q A;  3L0W B;  4W9D A;  3NZ3 A;  4FA6 A;  4DHJ B;  1IBX B;  4C56 C;  1I4X A;  4GN1 A;  3NOB A;  5JH5 C;  3KYD D;  4FHK A;  3V05 A;  1VCB A;  5AEK B;  1SB3 C;  1WYG A;  3V60 A;  2N0S B;  2VZK D;  4I6N B;  3KWV A;  3QJZ A;  1K52 A;  3Q3N C;  4N6E B;  3V6E B;  4KSL C;  3VHT C;  1MFW A;  3W1S A;  2M56 B;  2KDM A;  2RR9 A;  4YT0 B;  3U8Z A;  2OJW A;  4AOF A;  2LEK A;  3UI3 A;  4W9G A;  4FJZ A;  1AN8 A;  2FCS A;  4N58 A;  4ZRI A;  1TS3 A;  1T0Q C;  3KUD B;  3QAQ A;  3KW5 B;  1QKZ A;  1YJI A;  2CHZ A;  4PYU A;  4BOZ B;  3APC A;  2L0F A;  2N7D A;  2N1V A;  3VDZ A;  3AI5 A;  1XCQ L;  1L7Y A;  2LZ6 A;  4FXC A;  4ICV A;  3OJ4 B;  3RYT A;  5KHO A;  2LGS A;  2LVQ A;  1VZ7 A;  3NVV A;  1OGW A;  1AW7 A;  4IC7 B;  3ZTC A;  1HXY D;  2MQJ A;  2KZR A;  2FUG 1;  2WXP A;  2L76 A;  3DWM A;  4KGR A;  2GLS A;  3PZD A;  2A5U A;  4CYE A;  1PDX A;  2JWU A;  2K6Q A;  4DDG D;  2DAJ A;  2R2O A;  4HCP B;  3MP9 A;  3TEX A;  3ZNG C;  3NS8 A;  2ZCB A;  2LRU A;  4MDK E;  1KTK A;  1FXA A;  2BB6 A;  4RF1 A;  3P42 A;  4HRS A;  3AE7 B;  2NVU I;  2JX5 A;  4AJW A;  2KWU B;  1TIF A;  2JUO A;  4NJC A;  1L6U A;  2KX3 A;  5LLI A;  1ZW7 A;  1EU4 A;  2D3C A;  4KIK A;  1PFD A;  3MTN B;  1V80 A;  1D5Z C;  1ESF A;  2DBY A;  4PS7 A;  5IOI A;  2C7N B;  4XZ4 A; 
#chains in the Genus database with same CATH homology
 3UIN B;  1HE8 A;  1NI2 A;  2M4N A;  3VUX A;  2JT4 B;  4MJS A;  3ZNH B;  1PQS A;  2MW5 A;  1UEL A;  3OAW A;  4JLC A;  2GOW A;  2C7M B;  5CHV C;  3SU8 X;  4RM8 A;  2HTH A;  2BKR B;  4F7Z A;  3IHP C;  4IUM B;  1WXV A;  1WF9 A;  2XK5 A;  3RT3 B;  3ZTD A;  4JIO U;  2KTR A;  2ZPN A;  2OOB B;  4ZDV A;  2K6D B;  4GXB A;  3UIP B;  3W1Y A;  2CR5 A;  3A9K A;  2ASQ A;  3EC8 A;  2B3A A;  2IO1 B;  3DPD A;  4KZ0 A;  3S2A A;  1OTR B;  2NBV B;  2JF5 A;  4PS3 A;  2MWS B;  2V1Y A;  1E8X A;  2G4D B;  3A1Q B;  1WIA A;  1Y8R C;  2KFK A;  4W9J A;  4FHJ A;  3DVN U;  4PYZ A;  5GMV A;  3UF8 A;  1LQB A;  2BPS A;  1E8Y A;  1EO6 A;  3H6N A;  2C60 A;  4FAD A;  1WI0 A;  4F1S A;  4EZJ A;  4K7S A;  3VTU A;  2ZJD A;  2AL3 A;  4HCN B;  2KDE B;  4IM2 A;  1TGZ B;  2JY6 A;  1SIF A;  2DYO A;  2KAN A;  3VUY A;  3APF A;  1YD8 U;  2D11 A;  2K8B A;  3CST A;  4XC2 A;  1KJT A;  4IW0 A;  4ANU A;  3H7P A;  3RCZ A;  2FID A;  3ZNZ B;  4TV3 A;  3VFK A;  3U7D A;  2IBI B;  1UZX B;  4FN2 A;  3V6C B;  5DPT A;  4I6L B;  3OJ3 A;  1V81 A;  2DHZ A;  3HHM A;  5DPR A;  4NJ7 A;  3OLM D;  3PPA A;  4TUU A;  1GC7 A;  2MBH A;  4AUQ C;  1I42 A;  3VTV A;  4GDK B;  2L7R A;  1TBE A;  3C0R B;  2Z0E B;  4IM0 A;  3NZU A;  4URK A;  3R3M A;  1P0R A;  2XEW A;  5E6N A;  3QK0 A;  5IAA C;  2CU1 A;  4W9E A;  2MBO A;  3QHT A;  4JGH B;  2FIF A;  2ZPY A;  4A3O A;  3DBH I;  3KVF B;  4KDI C;  4XX5 A;  4NY0 A;  4ZRJ A;  3RZF A;  2WDT B;  4BBN F;  4IWQ A;  3MJW A;  1XT9 B;  2XBB C;  3H7S A;  2DYB A;  4PS8 A;  4EZL A;  4II2 B;  2BF8 B;  2A4Z A;  1WZ0 A;  4ANX A;  1S1Q B;  3L17 A;  1OEY J;  4RM9 A;  1GUA B;  1KLV A;  3X23 A;  4MM3 A;  3DVG Y;  5LXI B;  4BKG A;  2KJH B;  1CMX B;  2G45 B;  2KO3 A;  2L3Z A;  2C9W B;  2LRW A;  1GNU A;  4HWI B;  2BWF A;  3B0A A;  2KN5 A;  4HK2 A;  3P2B A;  2GBJ A;  3ZDM C;  2AL6 A;  4YL8 A;  4KIK B;  2BYF A;  5J2R A;  2KWV B;  5D2M B;  1WGR A;  2JZ3 B;  3L13 A;  2IYD B;  4M8M A;  3TL5 A;  4TQ0 A;  2RPQ A;  2LGY A;  3HM6 X;  2KWC A;  3PRZ A;  2BYV E;  2KKC A;  4GB9 A;  3A9J B;  2AYO B;  3DQV A;  2KQ7 A;  5HKH A;  2IZV B;  3ZUN A;  2IY0 B;  4WJQ A;  3L54 A;  3QIJ A;  2FCN A;  2NPT A;  4DK5 A;  2DX5 B;  2JZZ A;  3QC8 B;  2PEA A;  4MSQ B;  2J0M A;  2MX2 A;  2NS5 A;  2KTR B;  2IO2 B;  1J0G A;  1WJN A;  2C5L C;  2JVC A;  3A9K B;  2RSU A;  3PS6 A;  4LJP B;  3H1U A;  1KM7 A;  2EMS A;  4HPL B;  3LDZ E;  3RUL A;  4FJY A;  2M8S A;  2KC1 A;  5FR6 A;  4DDI D;  2J7Q B;  2JRH A;  2KFK B;  2KXJ A;  1I35 A;  2RGF A;  3HIZ A;  4GSW A;  3AU4 A;  2LAS A;  4NPN A;  1P3Q U;  2IO3 B;  1WGH A;  2KLG A;  1OQY A;  3ZKJ C;  2LD9 A;  4EEW A;  1J19 A;  3L10 B;  1WMH A;  3UQA A;  4GMV A;  2GBK A;  2D10 A;  2HD5 B;  4DHJ D;  4W9C A;  4ZYN A;  3BY4 B;  1E5W A;  4MEL A;  3QWZ B;  3EEC A;  2WX0 A;  2N9E B;  2QHO A;  3QA8 A;  1EF1 A;  4OVU A;  2DYM A;  2KVR A;  2LGX A;  4DBG A;  3PVL A;  3WAO A;  4GDL A;  1LFD A;  1EUV B;  3ONS A;  4IG7 B;  4KV2 A;  3ZRC A;  3L08 A;  4JL9 A;  3Q3J A;  2O6V A;  4M8N A;  2LXA A;  5CHW A;  4WAA A;  2L00 B;  3JSV A;  1J8C A;  2PJH A;  4FLH A;  2IY1 B;  2KK8 A;  3RZW C;  4AJY B;  5KHQ A;  1E7U A;  5JHA A;  3ZRF A;  3TBL D;  1V2Y A;  4TQ1 A;  2FAZ A;  4E71 A;  1WX8 A;  1GJZ A;  2M1M A;  2REX A;  1R4M I;  1YX5 B;  5C1Z A;  2GBR A;  4HDO A;  4KZC A;  3SHQ A;  1NDD A;  2MBQ A;  4AP4 C;  5DPS A;  2K8H A;  3AU5 A;  3N30 A;  2V3S A;  1H8C A;  5JHB A;  4FJV B;  4HVB A;  2NR2 A;  1IPG A;  2PE6 B;  4W9L A;  1AAR A;  3PT2 B;  3ZLZ A;  4GOC A;  4B6W A;  1WFY A;  3KYC D;  2BWE S;  4IWO A;  4G3X B;  3CSF A;  2G3Q B;  2M17 A;  2JPH A;  1WYW B;  4WQO B;  2LUE A;  2ZNV C;  2ZVN A;  3DBR I;  3EFU A;  3U30 A;  3ZNI D;  3W1S C;  2I1K A;  4MH0 E;  3ECI A;  3B1L X;  1RRB A;  4ZRK A;  2GBM A;  4W9F A;  1RAX A;  3ZDT A;  3NZS A;  5D7G A;  2MBE A;  3TCA A;  4GIV A;  2JRI B;  1YQB A;  2Y5B B;  5AZG A;  4BKS A;  2K39 A;  2MA9 B;  2LI5 A;  1KOT A;  3TMP B;  5D6J B;  3DOW A;  2KC2 A;  1D3Z A;  3R7Q A;  3ALB A;  5J17 A;  4LJO B;  1XD3 B;  3DVN V;  2WYQ A;  2KDB A;  1E7V A;  1LXD A;  1U4A A;  3NY5 A;  3UQB A;  3T8M A;  1LM8 B;  3ENE A;  4MSM B;  3RD2 A;  3RUI B;  1M94 A;  3D32 A;  1V49 A;  2KNB A;  2NPT B;  3GOE A;  3T9L A;  3PGE A;  2CHX A;  3A1Q A;  4HPM B;  3TJP A;  5L83 A;  5DPW A;  3IFW B;  1TTN A;  3B08 A;  3Q3F A;  3N3K B;  4FUL A;  3VAW A;  1QZE A;  3SDL C;  4ASW C;  5IA7 A;  4M0W B;  4E3C A;  2UYZ B;  3K9O B;  3ZW3 A;  2YLM A;  1ZKH A;  2DZM A;  2IO0 B;  2AEH A;  1WR6 E;  4GGQ A;  4K81 A;  3V61 A;  2KLC A;  4BOS C;  1WX9 A;  2KFJ A;  1YX6 B;  3HM3 A;  2LVO A;  1MG8 A;  5CTR C;  2LXC A;  2MCN B;  2K8C A;  5DCN A;  4AWJ A;  3TIX A;  3WA0 A;  1P98 A;  4MEM A;  1K8R B;  2LJ5 A;  3HK0 A;  1Q5W B;  1YJ1 A;  3A33 B;  1V5T A;  4G0N B;  3PRM B;  2DZI A;  4FBJ B;  1RLF A;  1L2N A;  1VD2 A;  5D94 A;  3JW0 X;  2DAF A;  2KJR A;  1V6E A;  1WMH B;  1WR1 A;  1F9J A;  3ZIM A;  2N7E A;  2FCQ A;  1P1A A;  2L0T A;  1YIW A;  4BFR A;  2FUH B;  4MJS B;  4F8C B;  2ZZP B;  2L8J A;  4A3P A;  2MSE D;  3VH3 B;  2O6V D;  3AUL A;  1WJU A;  4EKU A;  1E90 A;  2XK5 B;  4EFO A;  5CHF A;  4DHZ B;  4HJK A;  2KDF B;  1WXS A;  4MGI E;  2WWZ A;  2YVC A;  4MGK E;  4GDL B;  5G55 A;  3X0W A;  4EZK A;  4WWN A;  1Q1O A;  3QQ8 B;  2DEN B;  3ZVV A;  4IM3 A;  4BVU C;  3DCG A;  1ISN A;  3UIO B;  3IVF A;  3APD A;  4B95 A;  3ML8 A;  2N9X A;  3PRP B;  4GU2 A;  4II3 B;  2N4F A;  5BO4 B;  2OJR A;  2CKH B;  3O65 B;  4IWP A;  4DHZ E;  3QX1 A;  2V4L A;  1WH3 A;  2J0K A;  2JWZ A;  4DWF A;  2ZEQ A;  3CF6 E;  4WWP A;  2KMA A;  1JRU A;  2D07 B;  4G11 A;  4ICU A;  3WAP A;  4HXD A;  1V86 A;  3PTF C;  3EHV A;  5EDS A;  2O2V A;  1FXT B;  1Q0W B;  2WX1 A;  3ZO5 B;  1WE7 A;  3A4R A;  4OVV A;  2MP2 A;  5AZH A;  2D2Q A;  3L0W B;  2JXX A;  4CO7 A;  4W9D A;  3H7P B;  3IBE A;  1E8W A;  1XQQ A;  2KX0 A;  4BKS D;  5J18 A;  2K1F A;  4FA6 A;  2LWP A;  4DHJ B;  3DBL I;  3IG3 A;  4NAW A;  3ML9 A;  2BYE A;  4W9I A;  4GN1 A;  4A20 A;  4B9K A;  1Z5S B;  5C23 A;  3NOB A;  5E6P A;  1P9D U;  3KYD D;  1WXA A;  2NBU A;  5JH5 C;  1UGM A;  3UGB B;  2HE7 A;  4FHK A;  4HLE A;  4K7W A;  4N9F 4;  3PLV A;  1VCB A;  5AEK B;  2UWQ A;  1WGD A;  2CHW A;  3V60 A;  2M0X A;  4I6N B;  2KJ6 A;  1WM2 A;  2ZVO A;  1EF5 A;  4BBN C;  1A5R A;  3QJZ A;  3V6E B;  2RD0 A;  4KSL C;  4TKN A;  4RMA A;  3VHT C;  3KH0 A;  3W1S A;  2LGD A;  3DVG X;  2LVP A;  2KHW B;  1T0Y A;  4BKT A;  3L16 A;  2L05 A;  3VH4 B;  2RR9 A;  3U8Z A;  3NHE B;  4AOF A;  3CMM B;  2MLB A;  2PE9 A;  4W9G A;  1IYF A;  2G4S A;  3I3T B;  1UH6 A;  4FJZ A;  3A4S C;  4DXA B;  2FCS A;  4EUT A;  4ZRI A;  2I1J A;  2NBW B;  4NQL B;  3KUD B;  3QAQ A;  3WAN A;  1BT0 A;  2W9N A;  3KW5 B;  2N1W A;  3JYU A;  4WJP A;  1GG3 A;  3PHW B;  1OEY A;  2Z59 B;  2HJ8 A;  4NQK E;  4ANW A;  1WY8 A;  2CHZ A;  4PYU A;  3V62 A;  3R66 C;  2GBN A;  4BOZ B;  3APC A;  2L0F A;  1WRD B;  2N1V A;  2N7D A;  3N32 A;  5G2N A;  3PV1 A;  3AI5 A;  1V9J A;  3VDZ A;  1UBQ A;  1L7Y A;  3PRE A;  3QAR A;  4I6P A;  2D3G A;  2CS4 A;  2N9P C;  1IP9 A;  3MHS D;  2ZCC A;  4HDQ A;  2LZ6 A;  3PSE B;  2GMI C;  2J0J A;  1S3S G;  2KOX A;  4ICV A;  3OJ4 B;  3RYT A;  1C3T A;  4KSK C;  3AXC A;  3M63 B;  5CX3 A;  5KHO A;  1WGY A;  3QCA A;  5LXH A;  1X1M A;  3KUC B;  4KVG B;  2LVQ A;  3VVW B;  3SD5 A;  4P7I A;  3M95 A;  1NBF C;  3VUW A;  3WAL A;  3WIM A;  1OGW A;  2BKF A;  2DZK A;  2MBB B;  4IC7 B;  3VTW A;  1SE9 A;  4KDL B;  3ZTC A;  2KDI A;  4NJ6 A;  5AZF A;  5L95 C;  1WGG A;  2MQJ A;  2KZR A;  1WE6 A;  4LDT D;  1WJ6 A;  1UD7 A;  1WM3 A;  2L76 A;  1ZGU B;  3JVZ X;  1WZ3 A;  4G50 A;  2K25 A;  4WWO A;  4WJO A;  1Z2M A;  3DDC B;  3PZD A;  3LJ3 A;  1UBI A;  3DBS A;  2A5U A;  4CYE A;  2O2V B;  3WAM A;  4LDT B;  4K7U A;  4GDK A;  4X57 B;  2MP2 B;  1C1Y B;  4MGY E;  4NNJ B;  2K6Q A;  4DDG D;  2DAJ A;  1WX7 A;  2Z0D B;  4K1R B;  4LCD E;  2R2O A;  2R2Q A;  4EOY A;  4HCP B;  2C7H A;  2DZJ A;  3ZNG C;  2VRR B;  4NAW B;  3NS8 A;  2O6V B;  2AWT A;  3H9D A;  2ZCB A;  2LRU A;  2KQS A;  3K9P B;  1GC6 A;  3PHX B;  3JSV B;  4MDK E;  5E6O A;  4ANV A;  1G6J A;  3M3J A;  2EMT A;  3VQI A;  2FCM A;  1R4N I;  1WXM A;  2MRP A;  3R7R A;  4W9H A;  3BIN A;  4AJW A;  2NVU I;  5TR5 A;  2KWU B;  3VXW A;  5JZE B;  2KD0 A;  2JUO A;  1TZ1 A;  4E74 A;  2EKE C;  4MGZ E;  2KX3 A;  1V5O A;  5LLI A;  4JQW C;  1ZW7 A;  2PPH A;  2ZNV B;  4W9K A;  2KMC A;  4WJN A;  4KIK A;  1SGH A;  2BGF A;  1WJ4 A;  2FNJ B;  3MTN B;  3PLU A;  1V80 A;  1E8Z A;  3GZN I;  2NCN A;  3M62 B;  4CHK A;  4PS7 A;  2KTF A;  1H4R A;  3KUZ A;  4J6I A;  3A9J A;  2C7N B;  4XZ4 A;  1RFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...