2KMAA

Nmr structure of the f0f1 double domain (residues 1-202) of the talin ferm domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
178
structure length
178
Chain Sequence
b'GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin 1
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 34
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA02
1G6JA 3ML8A 4MJSB 4IW0A 2C9WB 2KZRA 2GOWA 1TGZB 2K8HA 4TKNA 4URKA 4EOYA 2RD0A 2LGDA 1H8CA 2KQSA 4IG7B 2YVCA 5C23A 1OGWA 1K8RB 1E8ZA 2Y5BB 2HTHA 4FN2A 4KZ0A 1NDDA 2KFKB 3Q3FA 3WIMA 1XD3B 4B6WA 1CMXB 3ZIMA 4MGIE 1P98A 3DBHI 2ZZPB 2A4ZA 2ZNVC 4PS3A 5AZFA 3X0WA 3PZDA 3PT2B 1V2YA 1WI0A 2PEAA 2G4SA 3N3KB 2IYDB 3HHMA 4I6LB 2DENB 2N4FA 2IO0B 3ZW3A 3AU5A 1V6EA 4WWOA 2C7MB 2J0JA 5D94A 3V6CB 2Z59B 4B9KA 1WF9A 3A9JA 3ENEA 4CHKA 3DBLI 4P7IA 2KTRB 1GJZA 4G0NB 3VXWA 2DZIA 2NVUI 4GU2A 5DPTA 3VTWA 1XQQA 4EFOA 3CF6E 3UIPB 3MJWA 2BKRB 4MM3A 3PS6A 4MSQB 4W9LA 3QK0A 2K8BA 4BBNF 1SE9A 1E5WA 1WRDB 2BYVE 2OJRA 1WE7A 3OLMD 1V81A 4HLEA 4BOSC 3VHTC 2LJ5A 5KHQA 3DDCB 3VQIA 4BBNC 2KDBA 2CHZA 2Z0DB 3R66C 1I42A 2DYBA 2L0FA 4KDIC 4LJPB 1P1AA 3DOWA 2DZKA 2RR9A 3ZDMC 2A5UA 2D2QA 1WGHA 4DK5A 2KX3A 2MQJA 2GBNA 5LXHA 2KLCA 3ZNZB 2D11A 4M8MA 4KIKA 4BKTA 5LXIB 2J0KA 2NR2A 2JY6A 3B0AA 4MGKE 4RM8A 2GBRA 3IVFA 5AZGA 3IHPC 4W9IA 1Z2MA 3TJPA 2ZPYA 4WJQA 4PS7A 2D10A 3JSVA 4AJYB 3OJ3A 4IM3A 4B95A 5D2MB 1E8WA 3IBEA 2R2OA 2N7DA 2D3GA 3DVGY 3CSFA 2JT4B 3MTNB 1WXSA 1GG3A 2EMSA 2GBJA 3HM6X 2DHZA 3OAWA 1WIAA 2AL6A 3VFKA 3U30A 1E90A 1YD8U 2C60A 2KC2A 2LI5A 2V4LA 4N9F4 3MHSD 4BKSA 5E6PA 1R4NI 4EZJA 2KQ7A 4IUMB 1NBFC 2JXXA 2PPHA 4W9DA 4FBJB 2CS4A 5GMVA 2MLBA 3A9KA 4MELA 4JIOU 4I6NB 2EKEC 4KDLB 3O65B 4GMVA 2D07B 3A9JB 3KH0A 3KVFB 2AL3A 2ZJDA 2KN5A 3EECA 4NY0A 4DHJD 1KOTA 3PV1A 4WWPA 4JLCA 2IZVB 3BY4B 2K39A 4ZYNA 2N7EA 1ZW7A 2JF5A 1E8YA 5DPRA 1L7YA 4DDGD 1T0YA 1EO6A 2NBVB 2WYQA 4W9CA 4HK2A 4DHJB 2KC1A 3V6EB 4E74A 2L7RA 1P3QU 1M94A 2DZJA 2K8CA 2KWCA 2O2VA 5G55A 4HPLB 4FADA 1TZ1A 4NNJB 1X1MA 2AYOB 3L16A 3UQBA 3R7RA 4NAWA 2CR5A 3ZDTA 1J0GA 1BT0A 3LDZE 3RULA 3WAPA 3ZRFA 1V80A 4W9KA 2C7NB 1H4RA 2L3ZA 3IFWB 3WALA 4A3PA 2KMAA 3APDA 4MGZE 4FJVB 2MWSB 3VVWB 2KTFA 1YIWA 3T9LA 1TTNA 1Q5WB 2M0XA 4E71A 3A1QA 4KIKB 3VH3B 3KUZA 1ZGUB 1WGGA 4XX5A 3PTFC 3ZNHB 1WFYA 4BOZB 2L0TA 5IA7A 3DBRI 4A3OA 2NPTB 3QQ8B 3JSVB 3UF8A 4TUUA 5TR5A 1SGHA 1IPGA 4GIVA 3UIOB 2KOXA 4JL9A 3W1SC 5J18A 1NI2A 4KZCA 1SIFA 3PRMB 3PGEA 3L0WB 4FLHA 1QZEA 2M1MA 1UBIA 1E7VA 1WYWB 4GN1A 1P9DU 2GBMA 3QWZB 4EZLA 3TCAA 4WAAA 3D32A 3UQAA 5AEKB 3TL5A 2LVPA 1EF1A 3CSTA 2BGFA 3KYDD 4IM0A 1YX5B 2I1JA 2WX1A 1XT9B 4W9GA 2CKHB 5G2NA 2REXA 4HCPB 4GOCA 2L05A 3R7QA 2M4NA 1WM3A 4A20A 4RMAA 2FCQA 3B08A 3SHQA 3KUDB 2FNJB 2ZCCA 4ZDVA 2KD0A 2KHWB 2NBUA 3A9KB 2LUEA 4KSKC 4GDLA 2LXCA 4F8CB 1WH3A 2HJ8A 4PS8A 3DVGX 3EHVA 4WJOA 5BO4B 2KK8A 2MX2A 5DPSA 2AWTA 3HM3A 2DAFA 2WWZA 4G3XB 3DVNU 4WQOB 2JWZA 3ML9A 4IC7B 4W9HA 3QHTA 2JZ3B 2KFJA 4AWJA 1WXVA 2PE9A 4MSMB 3ZRCA 2RPQA 2V1YA 4KV2A 2ZNVB 2BPSA 2FUHB 4GB9A 2QHOA 4ANUA 4ASWC 4HDOA 2IY0B 4NQLB 1IP9A 3UGBB 2NCNA 5CHVC 4ANWA 1C1YB 3APCA 1VD2A 5JHAA 1J8CA 2IO1B 4KVGB 2KDEB 3S2AA 3JYUA 4GDKA 4GXBA 4WJNA 2JUOA 2MCNB 2XBBC 3VUWA 3DPDA 3L10B 3PLVA 3N32A 4K7UA 4ANXA 1V5TA 1V9JA 4TV3A 2N9XA 4JGHB 2BWES 2JPHA 2KDFB 2DYOA 1OEYA 5AZHA 1UH6A 4JQWC 4J6IA 2XK5A 2C7HA 2LRWA 2C5LC 2WDTB 3LJ3A 2FAZA 2UYZB 1LXDA 1Z5SB 2EMTA 4EEWA 4W9FA 1WX8A 2MBOA 2O6VA 3PSEB 4HJKA 2XEWA 3RT3B 4GGQA 4II3B 2LVOA 4TQ0A 3QA8A 3QJZA 5CHWA 4HVBA 2CU1A 2WX0A 5J17A 1GC6A 1J19A 4K7SA 3H7PA 1YJ1A 1HE8A 2JRHA 4FHKA 1WJ4A 2DAJA 3VUXA 1LFDA 2KFKA 5E6NA 2IY1B 1JRUA 3AI5A 3X23A 4II2B 1WMHA 2N9PC 2LD9A 3B1LX 3EC8A 5D6JB 5KHOA 2HE7A 3H6NA 2KO3A 4GDLB 1WX7A 2PE6B 2RSUA 3W1SA 2CHWA 5CX3A 5IAAC 2KJRA 2GBKA 3M95A 1FXTB 2V3SA 3ZTDA 1KLVA 4ANVA 5D7GA 4M0WB 2BWFA 4IWPA 2L76A 3DQVA 3KYCD 3KUCB 3BINA 4DHZB 2KWUB 4MEMA 3QARA 3V61A 4ZRIA 2LGYA 2KNBA 4F1SA 3AU4A 1AARA 3NHEB 4FJZA 1UELA 2MBBB 1OEYJ 3Q3JA 2BYEA 2K1FA 2NBWB 1UD7A 1WR1A 2LZ6A 2JZZA 3C0RB 5JZEB 3NZUA 4LCDE 4FJYA 3HK0A 4MGYE 1Q1OA 2W9NA 3V62A 2CHXA 3TBLD 4MH0E 3P2BA 1WJNA 2ZVOA 4W9EA 4GDKB 2LXAA 1C3TA 3T8MA 2KKCA 1OTRB 3A33B 1RLFA 1R4MI 3A4RA 3M63B 5CTRC 3OJ4B 4I6PA 1OQYA 3RCZA 4DBGA 4DXAB 4HXDA 3DVNV 3ZO5B 2N1VA 2I1KA 1WZ0A 2OOBB 2XK5B 4NJ6A 5DPWA 2FIFA 3W1YA 4G11A 3ECIA 1MG8A 5DCNA 4BKSD 2AEHA 1WX9A 2KANA 1ISNA 4G50A 4AUQC 2MP2A 2O6VB 4RM9A 3M62B 4K81A 3M3JA 2FCSA 1GC7A 3DCGA 3ZKJC 3AXCA 4TQ1A 3GZNI 3N30A 3NY5A 1YQBA 2G4DB 2K6DB 5L95C 3QCAA 4MDKE 2UWQA 2FIDA 2MA9B 4EZKA 2ZPNA 1YX6B 2PJHA 5EDSA 5JH5C 3VAWA 3H7PB 4IWQA 4AP4C 4ZRKA 1ZKHA 3PHWB 3RZWC 4EUTA 2J0MA 1WMHB 2LASA 1Y8RC 2MSED 3CMMB 4HPMB 2KXJA 1Q0WB 5CHFA 2MBHA 3U8ZA 3UINB 2BF8B 4BVUC 2K25A 3QX1A 4M8NA 3ZTCA 2DX5B 1WJ6A 4AOFA 2KX0A 4PYUA 3RUIB 2N1WA 4LDTD 3JW0X 4K1RB 4WWNA 4DDID 5J2RA 4DHZE 1WJUA 3QIJA 4FULA 2G3QB 3SU8X 4YL8A 3H1UA 2O2VB 4LDTB 3L17A 2K6QA 3VDZA 3APFA 3U7DA 4NAWB 1WZ3A 2N9EB 4CO7A 2KDIA 2KLGA 1I35A 2KVRA 4ICUA 3PVLA 2FCMA 3VUYA 3WA0A 3WAMA 2ASQA 4BKGA 3K9OB 3AULA 3TMPB 1UZXB 3A1QB 3DBSA 3QAQA 4IM2A 4NJ7A 4HCNB 2FCNA 3ZUNA 1F9JA 1WXMA 2KWVB 3NOBA 4PYZA 1LQBA 3ZLZA 5LLIA 2KMCA 1TBEA 4HDQA 4IWOA 3NS8A 4MJSA 1RFAA 4X57B 2HD5B 3TIXA 1E8XA 4OVUA 3VTVA 2MP2B 2Z0EB 1WGDA 3H7SA 3ALBA 1L2NA 3SD5A 2L8JA 1PQSA 4F7ZA 1EUVB 2NPTA 2JVCA 3PRZA 2LVQA 3WANA 2IBIB 1WGYA 2MBEA 1IYFA 2JRIB 1V5OA 2J7QB 5E6OA 4XC2A 3ZNID 1WE6A 2BYFA 4OVVA 2MBQA 3L13A 1WM2A 5FR6A 4W9JA 4E3CA 4FA6A 5L83A 3GOEA 2GMIC 2LGXA 1UBQA 3A4SC 3L54A 5C1ZA 4NQKE 3R3MA 2NS5A 4XZ4A 1WXAA 2ZCBA 1E7UA 3EFUA 1U4AA 3PPAA 4HWIB 3VH4B 5JHBA 1KJTA 1RRBA 3ZNGC 2M17A 4GSWA 3L08A 4KSLC 1V86A 4BFRA 2KTRA 2B3AA 2KJHB 3JVZX 4EKUA 2L00B 3NZSA 2RGFA 2MW5A 2LRUA 4CYEA 3PRPB 1V49A 1S1QB 3QC8B 3ONSA 3H9DA 3RZFA 2KJ6A 1S3SG 3V60A 2DZMA 2MRPA 3PLUA 2VRRB 2IO3B 1VCBA 2R2QA 1LM8B 4LJOB 3HIZA 3K9PB 4FHJA 4WJPA 3RD2A 3VTUA 5HKHA 2M8SA 1WY8A 4ZRJA 3WAOA 2G45B 2LWPA 2YLMA 4K7WA 1KM7A 2ZEQA 1D3ZA 1UGMA 3I3TB 1RAXA 3SDLC 3RYTA 2O6VD 2ZVNA 2BKFA 1GNUA 4DWFA 1P0RA 3ZVVA 3PHXB 3KW5B 2DYMA 4AJWA 3IG3A 1WGRA 4NPNA 1A5RA 4ICVA 1EF5A 2IO2B 1WR6E 3PREA 1GUAB
chains in the Genus database with same CATH superfamily
4YXDB 4A9AA 4MJSB 2KZRA 2GOWA 4TKNA 3KQ4A 4EOYA 2RD0A 2LGDA 2YVCA 1JRPA 3WIMA 2HTHA 2WXJA 2KFKB 1C76A 2FUG1 1WGKA 3X0WA 2ZNVC 1TT5B 3PT2B 1WI0A 2YEPF 2SAKA 4LNKA 3HHMA 4I6LB 2DWQA 2WXNA 3ZW3A 2OEDA 4REZA 3IAS1 1ZUD2 2NVUI 3VTWA 2V9HA 1XF5L 2AX5A 2QMTA 4M00A 2BKRB 1CK1A 1GPXA 3QK0A 1XLQA 2K8BA 1ENFA 2KAJA 2OJRA 2UU7A 1V81A 1FRDA 4BOSC 1QT9A 1D4BA 2L52A 3DDCB 2Z0DB 2DYBA 3DWGC 1P1AA 2RR9A 2LFIA 1V8CA 2N0SB 4M8MA 3UI3A 4BKTA 1RWSA 5BYSA 3BZDB 4RM8A 1SB3C 2MEKA 4RGTA 4LNIA 3EUB2 3O13A 1VLBA 1TY2A 2GRIA 2N7DA 2D3GA 2WXFA 2ZW0A 2EMSA 2GBJA 1GB1A 4IOIE 1F2RC 2AL6A 3VFKA 3AECB 1JW9D 2C60A 2LI5A 4BKSA 3MHSD 3TEWA 5E6PA 3LB8C 2PPHA 4W9DA 1UNSA 3A9KA 5EE1A 2J53A 2EKEC 1CZPA 2ZJDA 3EECA 4WWPA 1YJIA 1YOVB 4ZYNA 5DPRA 2JF5A 1L7YA 2EELA 1EO6A 2NBVB 2WYQA 4W9CA 4HK2A 1UUPA 1P3QU 2DZJA 1VZ7A 2KWCA 3LYYA 1XO3A 4HPLB 1E7PB 5BYQA 1X1MA 3ZJUA 4NAWA 3LDZE 1PYWD 3WAPA 1V80A 3IFWB 3APDA 4MGZE 2WXRA 1YIWA 3T9LA 1TTNA 1Q5WB 3KUZA 1ZGUB 3DBRI 4XYCA 4KGSA 2NPTB 3UF8A 5TR5A 1SGHA 4JL9A 4RGNA 2WU2B 3PGEA 2BVCA 3L0WB 2M1MA 4PT5A 2LHEA 4NJCA 2LVPA 2WXPA 2WQYB 1YX5B 5G2NA 2REXA 4HCPB 1P7FA 4GOCA 3R7QA 1WM3A 2XN9C 3SHQA 3KUDB 3B2GA 2ZCCA 4ZDVA 2KHWB 3B2FA 4GDLA 2LXCA 4F8CB 1TIFA 2HJ8A 4M02A 5BO4B 2MX2A 2N9LA 3HM3A 4WQOB 1EM7A 2JWZA 4YWGG 4IC7B 4W9HA 5JXVA 3QHTA 2KFJA 3TEXA 4MSMB 3ZRCA 2RPQA 2ZNVB 2FUHB 4GB9A 1TS3A 1FNVA 2IY0B 3V3XA 1K51A 3UGBB 4ANWA 1C1YB 1VD2A 2BS4B 2IO1B 2KDEB 3S2AA 4WJNA 5D3DA 3TEZA 2WXHA 3PLVA 4ANXA 1V5TA 2JPHA 1JALA 2OJWA 1N5WA 4ITKA 3E56A 2LRWA 1R7SA 2FAZA 1Z5SB 1QOGA 3Q8EA 2EMTA 4W9FA 3BK1A 4WWMA 5HG2A 3V05A 4II3B 2WDQB 1B1ZA 4TMAB 1GC6A 1J19A 1ZXHA 1YJ1A 4L2YA 4WH4A 2DAJA 2KFKA 1SE4A 2IY1B 4KKIA 3VR9B 2LD9A 1DOXA 3AE1B 1QF6A 1D5XC 1VR9A 2I2YA 2KJRA 2V3SA 2IGHA 5E6JA 1I7HA 1AWDA 2L76A 2M0AA 3RNFC 4F1SA 3NHEB 1UELA 2K5PA 2VH1A 1UD7A 2JZZA 3C0RB 2Y5PA 1TKGA 3SFDB 1OTRB 3A33B 1RLFA 3A4RA 1FFUA 1Y56A 2JZPA 1GAQB 1KLGD 1WRIA 1YMHE 4FXCA 1HXYD 1XEEA 1EU4A 3ECIA 2AEHA 1UF0A 2KANA 4G50A 4AUQC 5FR3A 3M62B 4K81A 3M3JA 1GC7A 4TQ1A 3N30A 1YQ3B 2G4DB 5L95C 1SSNA 2K3UA 2K0PA 2UWQA 2MA9B 4C4VB 4EZKA 1YX6B 4WIPA 5JH5C 3VAWA 4IWQA 4AP4C 3Q3MC 4ZRKA 3BIID 1ZKHA 3P63A 1WMHB 5CHFA 1Q0WB 3UINB 4M8NA 1FPYA 1WJ6A 2Y3AA 4WWNA 4DHZE 4YL8A 2O2VB 2BW2A 2I38A 1FM0D 4LDTB 4L23A 4YSYB 4CO7A 5H92C 2LHDA 2KDIA 5TSSA 2OHFA 4RNAA 4JPSA 1NI3A 3P4PB 3PVLA 2BTEA 3N1XC 3RNGC 2PVOD 2ASQA 4BKGA 3K9OB 3A1QB 5H8YE 2WXQA 1N5XA 3NOBA 3Q69A 1VRAB 5LNK1 2V4IB 3AEAB 3GE3C 4MACA 2V0GA 3NS8A 3VTVA 1RFAA 5T8IA 2MP2B 3ALBA 1SEBD 1L2NA 3Q8AA 2NPTA 2JVCA 1WGYA 1IYFA 1I4GA 2MJEA 2LGIA 2BYFA 2MBQA 3L13A 3Q6BA 2CU3A 1OQQA 5AUKA 1E7UA 2Y5CA 2RGFA 3PRPB 1JROA 4DXGA 2KJ6A 4ZHPA 2WXIA 2IO3B 2GLSA 1YJJA 4FHJA 5C2TB 1WY8A 4ZRJA 3C8YA 1ET6A 3W5UB 5HFYA 2E6XA 3P4RB 2LWPA 2PIAA 2ZEQA 1MI0A 3T3NA 2LJIA 3SDLC 3SEBA 2O6VD 4P16A 1P0RA 1BUIC 2B76B 2QIEB 3KW5B 2HTME 1WGRA 2VZKD 4NPNA 4ICVA 4AQ7A 3PREA 1G6JA 4OW0A 4C56C 2C9WB 1H8CA 4IG7B 5C23A 1OGWA 4FN2A 4KZ0A 3Q8FA 2A4ZA 3Q8CA 4PS3A 1NVID 4IDIA 1V2YA 2PEAA 3N3KB 1FXAA 2IO0B 1V6EA 1ROEA 2C7MB 3V6CB 2Z59B 3A9JA 1IBXB 4P7IA 1C4AA 4G0NB 2WU5B 3VXWA 2DZIA 3CF6E 3UIPB 3MJWA 1XLNA 3HVZA 3P4SB 1MHHE 4W9LA 4ZHOA 2FE8A 1E5WA 1WRDB 2BYVE 2WDVB 3OLMD 4HLEA 5BMIA 4YTPB 1T3QA 3DBLB 3VQIA 1JWBD 1I42A 2JWUA 3AM9A 2DZKA 2INPE 2A5UA 2KX3A 2GBNA 3ZNZB 4KIKA 2J0KA 4P1BC 2GBRA 4D2KA 2KYWA 2XNAC 3ETRA 3RNBC 3IBEA 2R2OA 3LXFA 2RDBC 1N60A 3CSFA 2JT4B 1GG3A 5IKCM 3U30A 3AH7A 3B9JA 3I5JC 4N9F4 4C4VA 1SJHD 4HKQA 1R4NI 3R2IA 1QOBA 2KQ7A 4IUMB 3AE8B 1TS4A 2JSVX 3BYYB 3NVVA 4I6NB 2AQ3B 1M4VA 1T0SC 3O65B 4GMVA 2KACA 2AL3A 2MJ3A 1KOTA 1E9MA 3PV1A 2KQ4X 2J52A 2IZVB 2PTLA 2K39A 1JWUD 4WAFA 3HVDA 2WP9B 3EGRA 4DHJB 2KC1A 2L7RA 1M94A 2K8CA 2O2VA 5G55A 2JYTA 1TZ1A 2FBWB 1KH0A 3L16A 5BMHA 1N63A 1TKEA 2EKIA 3UQBA 2QCZA 1NEKB 3AEGB 2L3ZA 1ZXIA 4A3PA 5G5HA 2KMAA 4NZLB 3ZJTA 2MWSB 1FFVA 1V97A 3FC4A 2M0XA 3ZGZA 3A1QA 1L6VA 1WGGA 3PTFC 3ZNHB 1DOIA 4QAYA 3KWLA 3JSVB 2W3RA 4GIVA 4XGAB 1FD6A 1L4DB 2IGGA 3NVZA 4FLHA 1E7VA 4GN1A 5G5GA 3QWZB 4EZLA 3TCAA 4WAAA 3TL5A 2KT7A 2WX1A 1XT9B 2CKHB 3AE9B 4RMAA 3NS1A 3B08A 2FNJB 4ZRPA 4KSKC 4HKZE 1WH3A 3DVGX 3EHVA 2KN4A 2KK8A 2DAFA 2LMCA 1V1PB 2WWZA 3DVNU 4G3XB 4M0WA 2WNMA 2CJOA 1DYQA 1WXVA 1FCLA 2QHOA 2X38A 1D5ZC 4NQLB 2NCNA 5CHVC 3IT6B 5JHAA 3AE6B 2AQ2B 3JYUA 1ACCA 2AQ1B 4N6EB 2JUOA 2XBBC 3VUWA 3DPDA 3L10B 3N32A 3Q3OC 1V9JA 2N9XA 1HZ5A 2DYOA 1C78A 2BT6A 2C7HA 2UYZB 4AS1A 2JQRB 2D3AA 2IJ0A 2WDRB 2MBOA 4N58A 4C80A 2DLBA 3PSEB 2LVOA 4TQ0A 3QA8A 2WX0A 4LK0M 1XLPA 4K7SA 1E10A 3H7PA 4FHKA 2JRHA 1LFDA 3HUIA 5E6NA 1JRUA 3AI5A 2N9PC 5D6JB 2HE7A 3AEFB 1SE3A 1N62A 2KO3A 2QC8A 2PE6B 3SR6A 3FILB 2RSUA 1IGDA 3W1SA 1FMAD 5IAAC 1KLVA 2GBKA 1WYGA 1OQRA 3KYCD 3BINA 1IBXA 1QKZA 2KWUB 3QARA 3Q8BA 3V61A 2LGYA 2KNBA 1AARA 1OEYJ 3Q3JA 4L1BA 2K1FA 2NBWB 1WR1A 3DHIC 5JZEB 2NMQA 3NZUA 2BB5A 2E3TA 3HK0A 3NZ3A 1Q1OA 2W9NA 3TBLD 4MH0E 3P2BA 1WJNA 2ZVOA 4GDKB 2LXAA 1HTOA 3T8MA 4B0MA 2KKCA 3NUHB 3RCZA 4DXAB 3OJ4B 1OQYA 3ZO5B 2I1KA 1WZ0A 3VRBB 4NJ6A 2XK5B 4G11A 5BMGA 1BMLC 1MG8A 1SF0A 4MH8A 4BKSD 1ISNA 4UDUC 2O6VB 1XXGA 2FCSA 3AXCA 2K6DB 4BZAA 3QCAA 1R4MB 2VZKB 2ZPNA 1YN5A 3BK2A 5I4DA 2D3BA 3AE5B 2BB6A 3RZWC 4ZOHC 2LASA 1CQVA 2MSED 3CMMB 2HJ1A 2K25A 2M19A 3QX1A 2TSSA 4AOFA 1L0XB 2KX0A 3GZNB 3JW0X 5J2RA 3ABVB 5C3JB 4B0EA 1CJEA 3Q14C 1XCQL 3APFA 1WZ3A 2N9EB 2KLGA 1MFWA 1UWXA 2RDGA 4ICUA 5BYRA 2YEPB 2FCMA 3WA0A 3NVYA 1UZXB 3GS2A 3DBSA 3QAQA 2FCNA 3ZUNA 1F9JA 1QLBB 2KWVB 4PYZA 3U2SC 1XCTL 5LLIA 1J7CA 4HDQA 3OWEB 1HZ6A 4MJSA 2Z0EB 3H7SA 3MP9A 3PRZA 2LVQA 2JRIB 1V5OA 2J7QB 4XC2A 3HRDD 5L83A 1UGJA 4JE3B 1UBQA 5FK9C 4OVZA 3R3MA 2NS5A 4XZ4A 3EFUA 4HWIB 1KJTA 1RRBA 3P4QB 2M17A 3NRZA 4KSLC 2KJHB 3NZSA 1NYRA 1WXQA 4JWSC 3QC8B 2PKOA 3ONSA 3MFGA 1HEZE 2X8XX 3V60A 3AEDB 3PLUA 1V1PA 1VCBA 1LM8B 2W55A 2WXLA 3HIZA 4LJOB 3RD2A 2M8SA 4H2AA 2L32A 1KM7A 2PVGC 1RAXA 1MVKA 1D6EC 2BKFA 3BVGA 1E0ZA 3ZVVA 1HTQA 3PHXB 2DYMA 3N1ZC 1EF5A 1WR6E 1GUAB 1KFYB 1I4RA 3ML8A 3Q3NC 2D5GA 1TGZB 4P6VF 2K8HA 1PGAA 4URKA 2KQSA 4BAXA 1E8ZA 3Q3FA 1XD3B 4O1NA 4B6WA 1C4PA 1PDXA 1SXTA 5AZFA 4ACFA 2G4SA 2IYDB 2WGSA 3Q2AC 1I4XA 4WWOA 5D94A 2QDFA 1WF9A 3DBLI 4A55A 2KTRB 3ZYYX 1JWAD 4GU2A 5DPTA 2ICIA 3FILA 3DBHB 3PS6A 1PUTA 1B9RA 3I63C 2MHJA 1WE7A 3NVWA 5KHQA 1JWMD 1ET9A 2CHZA 1VDVA 2L0FA 3FKYA 2QILA 3ZDMC 2D2QA 4DK5A 1WGHA 3AE3B 5LXHA 2KLCA 2D11A 1RFKA 2NR2A 2JY6A 3B0AA 4MGKE 2RMMA 3IVFA 1TY0A 3IHPC 1MG4A 4W9IA 1Z2MA 3TJPA 2ZPYA 4WJQA 4B95A 1E8WA 2N7JA 3ZXRA 4N59A 3AN1A 3MTNB 1WXSA 2CJNA 1QOFA 3OAWA 1SBBB 2INDC 1TS5A 4XE0A 2KC2A 4ZYSA 2QEJC 1NENB 4FBJB 1T6BX 2CS4A 2MLBA 4MELA 2D07B 2VH2A 4NY0A 2MH7A 3P42A 4K3CA 3MC0B 3BY4B 2N7EA 1T0YA 3MC8A 1WWTA 1MPEA 1L6UA 4FADA 1LO5D 3R7RA 1YN4A 1J0GA 1BT0A 3ZRFA 2QSDA 1H4RA 3WALA 3T3OA 1YQ4B 3VVWB 4OHJA 4M01A 4A8XC 3VH3B 4XX5A 1KF6B 2JXTA 1WFYA 2L0TA 3MC9A 2KMMA 4A3OA 3DWMA 1JQ4A 4TUUA 1IPGA 5J18A 3PRMB 4C7ZA 3PZ7A 1WYWB 2GBMA 3UQAA 4YTNB 1VZ8A 2BGFA 3CSTA 1MJDA 3URYA 5GXGB 4W9GA 1K53A 2L05A 2M4NA 4WURA 4A20A 3N20C 2FCQA 1E6EB 1QOAA 2NBUA 3A9KB 3AE2B 4KKJA 1F1HA 1VJKA 4WJOA 2AWTA 1MHXA 2ACZB 4DXFA 4AWJA 4S0RA 2PE9A 4KV2A 4ANUA 4HDOA 4KGRA 1IP9A 3APCA 5IOIA 5EE0A 4USAA 4LNNA 2JX5A 4TV3A 2BWES 5AZHA 1UH6A 2C5LC 2WDTB 2G1EA 3LJ3A 1LXDA 1WX8A 2H88B 1K52A 4OZCA 2Z8LA 3RT3B 4GGQA 1FEHA 2RDHA 4CQNA 2CU1A 5J17A 2ON8A 1HE8A 1WJ4A 3RNEC 3AEEB 3X23A 1WMHA 3B1LX 1L4ZB 5KHOA 1L0VB 5HHDG 3H6NA 4GDLB 1WX7A 4JWUC 4MM3B 5CX3A 3M95A 4LNOA 3ZTDA 4ANVA 4IWPA 3KUCB 1YNTE 4DHZB 3AMZA 4FJZA 2MBBB 2BYEA 4LCDE 1SIJA 4HJGE 4MGYE 3V62A 3W2DA 2CHXA 1J7AA 4ARCA 4P1CC 2JYEA 1JCKB 1R4MI 5CTRC 3TEYA 3PO0A 3DVNV 2OOBB 5DPWA 3W1YA 1WX9A 1ZDVA 2MP2A 4RM9A 3DCGA 2KDMA 3GZNI 5FKAC 1YQBA 4MDKE 2PJHA 5EDSA 1TKYA 4LNFA 4EUTA 2WXOA 1T5XD 1Y8RC 5HI1A 4HPMB 3U8ZA 2MBHA 4BVUC 3RUIB 2N1WA 2SEBD 4LDTD 4K1RB 5AUIA 3RPFC 4DDID 2INNE 2W54A 3SU8X 2R61A 3H1UA 2PW9A 3U7DA 2LEKA 2KVRA 1C77A 3L4PA 1PGBA 3VUYA 3WAMA 1TS2A 1LGRA 2BS3B 2WXMA 4IM2A 4HCNB 3E9SA 1KLUD 1RM6C 1LQBA 2KMCA 4MT5A 2GI9A 1V1OA 1WGDA 4J3OD 2J42A 4F7ZA 1EUVB 3WANA 2IBIB 3MHZA 5E6OA 1F2RI 4OVVA 3IAM1 4KGTA 2Q5WD 2LGXA 2NTSA 1WXAA 5JHBA 3L08A 2B3AA 3JVZX 3AEBB 3KLSX 1V49A 1S3SG 2D3CA 2VRRB 2L1AA 4WJPA 4HEA1 2WS3B 3K9PB 3VTUA 2PMVA 2ONQA 3WAOA 1R4NB 2IDYA 1D3ZA 5EE9A 1D5MC 1UGMA 1ZPSA 2LUMA 1FNWA 2ZVNA 3RN9C 1GNUA 2KVZA 4DWFA 1C4CA 3J9CA 4A6QA 2HDEA 2IO2B 4YSXB 2PLPA 4IW0A 1K8RB 1FO4A 4LTUA 2Y5BB 1NDDA 1CMXB 3ZIMA 4IKGA 4MGIE 1P98A 1QILA 3DBHI 2ZZPB 1OFFA 2ZW1A 3PZDA 5IP4D 1QQRA 1AYFA 2DENB 2N4FA 3AU5A 1J7BA 2J0JA 4B9KA 3ENEA 4CHKA 2V3PA 1GJZA 2IPKD 1XQQA 4EFOA 1GB4A 2V3NA 1NYQA 4MM3A 1AN8A 4MSQB 4BBNF 4GLSC 1SE9A 3C19A 3VHTC 2LJ5A 4BBNC 2KDBA 3R66C 4RGMA 1WSPA 4KDIC 4LJPB 3DOWA 1FCCC 1GOZA 3AE4B 2MQJA 5LXIB 4YSZB 1RYJA 5AZGA 1I4PA 3AE7B 4AJYB 3RMKC 4PS7A 2D10A 3JSVA 3W5VB 3OJ3A 4IM3A 3RFZB 5D2MB 1ZE3D 3AV8A 4Q2JA 3DVGY 3RNAC 1EU3A 1DGJA 3HM6X 2DHZA 1WIAA 1L5PA 1E90A 1YD8U 2V4LA 4R3DA 3U4EG 4EZJA 3EA6A 1NBFC 2JXXA 1TZOA 5GMVA 4JIOU 4KDLB 1T0RC 3A9JB 3KH0A 2K22A 3KVFB 4RH6A 3TSSA 1UWMA 2KN5A 3GE8C 4DHJD 1I4QA 4JLCA 1FRRA 1HA5A 3CIRB 1ZW7A 4DDGD 1E8YA 4ARIA 1I4HA 2BBCA 3V6EB 4E74A 3R8BA 1VZ6A 4NNJB 2AYOB 1BXTA 3N1YC 2CR5A 3ZDTA 3RULA 3KWVA 4W9KA 2QJLA 2C7NB 2DNFA 1SE2A 4FJVB 2KTFA 4E71A 4S17A 4KIKB 3BVZA 4BOZB 5IA7A 4LLGM 3QQ8B 2WLBA 3UIOB 3W1SC 2KOXA 3ZJVA 4RFBA 1NI2A 3IT4B 1SIFA 3AB5A 4KZCA 1Q10A 1QZEA 2BQQA 1UBIA 2NTTA 3BYTB 1P9DU 1HQRD 1AW7A 3D32A 5AEKB 1EF1A 3KYDD 4IM0A 2I1JA 3CWIA 4US8A 3DBRB 3ZXVA 2MJDA 4YTMB 4OZAA 4DQOC 2KD0A 2LUEA 2WXKA 4PS8A 1T0QC 2KWDA 1STEA 5DPSA 3ML9A 1ZP0B 2JZ3B 2WHIA 1F0ZA 2V1YA 2BPSA 4C00A 3EFCA 4ASWC 3GP7A 3P1MA 1P7EA 1N61A 1XLOA 1J8CA 3H8HA 4KVGB 4EE2A 4GDKA 4GXBA 1ZDXA 2MCNB 3RI7C 4K7UA 3FAHA 4JGHB 2KDFB 1OEYA 4JQWC 1L0YB 4J6IA 2XK5A 4C7YA 4EEWA 2W3SA 2O6VA 4HJKA 2XEWA 4A90A 4NAMA 5IN7A 3QJZA 5CHWA 4HVBA 4XWWA 1F77A 5EE3A 1KRHA 3BVMA 3U52E 1IGCA 3VUXA 2DBYA 4II2B 3EC8A 3NJTA 2IGDA 3BWUD 2N9KA 4TSSA 2CHWA 1FXTB 5D7GA 1JMLA 2BWFA 4M0WB 3DQVA 2W82A 5IO9A 4MEMA 1N6ZA 4ZRIA 3AU4A 3DHGC 1JWSD 3I9V1 4K3BA 2LZ6A 4FJYA 2LGSA 1C79A 4W9EA 1C3TA 3TUOA 2JU6X 2G9HD 1TJEA 3M63B 4DBGA 3WCQA 4I6PA 1C9FA 4HXDA 2N1VA 4HRSA 2FIFA 3U7ZA 4US9A 5DCNA 4RCOA 5MPOA 3OG5A 1FIQA 3ZKJC 4YT0B 3MJ5A 3NY5A 1SJED 2FIDA 4ZRQA 4XWTA 3H7PB 1EWYC 3PHWB 2J0MA 2KXJA 2BF8B 3ZTCA 2DX5B 4PYUA 1WJUA 3QIJA 1YN3A 4FULA 2G3QB 3VR8B 2K9XA 3L17A 2RPVA 2K6QA 3VDZA 4NAWB 3DHHC 1I35A 1TYGB 1FNUA 2WXGA 4RGOS 3TMPB 3AULA 4NJ7A 1FXIA 1PFDA 3GB1A 2J4XA 3PZ8A 1WXMA 3ZLZA 1TBEA 1KTKA 3W9CB 2INCC 4JX1C 4IWOA 3IXSA 4X57B 3TIXA 2HD5B 3ZQ4A 1E8XA 4OVUA 2BS2B 4HPPA 3SD5A 2L8JA 4RF1A 1PQSA 2MBEA 3ZNID 2L83A 1WE6A 1WM2A 5FR6A 2GB1A 4W9JA 4E3CA 4FA6A 3GOEA 2GMIC 2H89B 3NG0A 3A4SC 3L54A 3VRAB 5C1ZA 4NQKE 3I57A 2ZCBA 2BYTA 3PPAA 1U4AA 3VH4B 1IUEA 3ZNGC 4GSWA 1EWCA 1PGXA 4EKUA 1V86A 4BFRA 2KTRA 2L00B 1DOYA 4HROA 2MW5A 2LRUA 4CYEA 4KX6B 1S1QB 3RZFA 3H9DA 4XDCA 1A70A 2DZMA 2MRPA 4RF0A 2R2QA 5HKHA 5D3IB 3SFEB 1ZOYB 2G45B 1K50A 2YLMA 4K7WA 4WQMA 3I3TB 3N9YC 3RNCC 1F52A 3RYTA 3R2TA 4AJWA 3IG3A 4OZBA 1ESFA 4PK1A 1A5RA 2M56B 4XDDA
chains in the Genus database with same CATH topology
1G6JA 3ML8A 4MJSB 4IW0A 2C9WB 2KZRA 2GOWA 1TGZB 2K8HA 4TKNA 4URKA 4EOYA 2RD0A 2LGDA 1H8CA 2KQSA 4IG7B 2YVCA 5C23A 1OGWA 1K8RB 1E8ZA 2Y5BB 2HTHA 4FN2A 4KZ0A 1NDDA 2KFKB 3Q3FA 3WIMA 1XD3B 4B6WA 1CMXB 3ZIMA 4MGIE 1P98A 3DBHI 2ZZPB 2A4ZA 2ZNVC 4PS3A 5AZFA 3X0WA 3PZDA 3PT2B 1V2YA 1WI0A 2PEAA 2G4SA 3N3KB 2IYDB 3HHMA 4I6LB 2DENB 2N4FA 2IO0B 3ZW3A 3AU5A 1V6EA 4WWOA 2C7MB 2J0JA 5D94A 3V6CB 2Z59B 4B9KA 1WF9A 3A9JA 3ENEA 4CHKA 3DBLI 4P7IA 2KTRB 1GJZA 4G0NB 3VXWA 2DZIA 2NVUI 4GU2A 5DPTA 3VTWA 1XQQA 4EFOA 3CF6E 3UIPB 3MJWA 2BKRB 4MM3A 3PS6A 4MSQB 4W9LA 3QK0A 2K8BA 4BBNF 1SE9A 1E5WA 1WRDB 2BYVE 2OJRA 1WE7A 3OLMD 1V81A 4HLEA 4BOSC 3VHTC 2LJ5A 5KHQA 3DDCB 3VQIA 4BBNC 2KDBA 2CHZA 2Z0DB 3R66C 1I42A 2DYBA 2L0FA 4KDIC 4LJPB 1P1AA 3DOWA 2DZKA 2RR9A 3ZDMC 2A5UA 2D2QA 1WGHA 4DK5A 2KX3A 2MQJA 2GBNA 5LXHA 2KLCA 3ZNZB 2D11A 4M8MA 4KIKA 4BKTA 5LXIB 2J0KA 2NR2A 2JY6A 3B0AA 4MGKE 4RM8A 2GBRA 3IVFA 5AZGA 3IHPC 4W9IA 1Z2MA 3TJPA 2ZPYA 4WJQA 4PS7A 2D10A 3JSVA 4AJYB 3OJ3A 4IM3A 4B95A 5D2MB 1E8WA 3IBEA 2R2OA 2N7DA 2D3GA 3DVGY 3CSFA 2JT4B 3MTNB 1WXSA 1GG3A 2EMSA 2GBJA 3HM6X 2DHZA 3OAWA 1WIAA 2AL6A 3VFKA 3U30A 1E90A 1YD8U 2C60A 2KC2A 2LI5A 2V4LA 4N9F4 3MHSD 4BKSA 5E6PA 1R4NI 4EZJA 2KQ7A 4IUMB 1NBFC 2JXXA 2PPHA 4W9DA 4FBJB 2CS4A 5GMVA 2MLBA 3A9KA 4MELA 4JIOU 4I6NB 2EKEC 4KDLB 3O65B 4GMVA 2D07B 3A9JB 3KH0A 3KVFB 2AL3A 2ZJDA 2KN5A 3EECA 4NY0A 4DHJD 1KOTA 3PV1A 4WWPA 4JLCA 2IZVB 3BY4B 2K39A 4ZYNA 2N7EA 1ZW7A 2JF5A 1E8YA 5DPRA 1L7YA 4DDGD 1T0YA 1EO6A 2NBVB 2WYQA 4W9CA 4HK2A 4DHJB 2KC1A 3V6EB 4E74A 2L7RA 1P3QU 1M94A 2DZJA 2K8CA 2KWCA 2O2VA 5G55A 4HPLB 4FADA 1TZ1A 4NNJB 1X1MA 2AYOB 3L16A 3UQBA 3R7RA 4NAWA 2CR5A 3ZDTA 1J0GA 1BT0A 3LDZE 3RULA 3WAPA 3ZRFA 1V80A 4W9KA 2C7NB 1H4RA 2L3ZA 3IFWB 3WALA 4A3PA 2KMAA 3APDA 4MGZE 4FJVB 2MWSB 3VVWB 2KTFA 1YIWA 3T9LA 1TTNA 1Q5WB 2M0XA 4E71A 3A1QA 4KIKB 3VH3B 3KUZA 1ZGUB 1WGGA 4XX5A 3PTFC 3ZNHB 1WFYA 4BOZB 2L0TA 5IA7A 3DBRI 4A3OA 2NPTB 3QQ8B 3JSVB 3UF8A 4TUUA 5TR5A 1SGHA 1IPGA 4GIVA 3UIOB 2KOXA 4JL9A 3W1SC 5J18A 1NI2A 4KZCA 1SIFA 3PRMB 3PGEA 3L0WB 4FLHA 1QZEA 2M1MA 1UBIA 1E7VA 1WYWB 4GN1A 1P9DU 2GBMA 3QWZB 4EZLA 3TCAA 4WAAA 3D32A 3UQAA 5AEKB 3TL5A 2LVPA 1EF1A 3CSTA 2BGFA 3KYDD 4IM0A 1YX5B 2I1JA 2WX1A 1XT9B 4W9GA 2CKHB 5G2NA 2REXA 4HCPB 4GOCA 2L05A 3R7QA 2M4NA 1WM3A 4A20A 4RMAA 2FCQA 3B08A 3SHQA 3KUDB 2FNJB 2ZCCA 4ZDVA 2KD0A 2KHWB 2NBUA 3A9KB 2LUEA 4KSKC 4GDLA 2LXCA 4F8CB 1WH3A 2HJ8A 4PS8A 3DVGX 3EHVA 4WJOA 5BO4B 2KK8A 2MX2A 5DPSA 2AWTA 3HM3A 2DAFA 2WWZA 4G3XB 3DVNU 4WQOB 2JWZA 3ML9A 4IC7B 4W9HA 3QHTA 2JZ3B 2KFJA 4AWJA 1WXVA 2PE9A 4MSMB 3ZRCA 2RPQA 2V1YA 4KV2A 2ZNVB 2BPSA 2FUHB 4GB9A 2QHOA 4ANUA 4ASWC 4HDOA 2IY0B 4NQLB 1IP9A 3UGBB 2NCNA 5CHVC 4ANWA 1C1YB 3APCA 1VD2A 5JHAA 1J8CA 2IO1B 4KVGB 2KDEB 3S2AA 3JYUA 4GDKA 4GXBA 4WJNA 2JUOA 2MCNB 2XBBC 3VUWA 3DPDA 3L10B 3PLVA 3N32A 4K7UA 4ANXA 1V5TA 1V9JA 4TV3A 2N9XA 4JGHB 2BWES 2JPHA 2KDFB 2DYOA 1OEYA 5AZHA 1UH6A 4JQWC 4J6IA 2XK5A 2C7HA 2LRWA 2C5LC 2WDTB 3LJ3A 2FAZA 2UYZB 1LXDA 1Z5SB 2EMTA 4EEWA 4W9FA 1WX8A 2MBOA 2O6VA 3PSEB 4HJKA 2XEWA 3RT3B 4GGQA 4II3B 2LVOA 4TQ0A 3QA8A 3QJZA 5CHWA 4HVBA 2CU1A 2WX0A 5J17A 1GC6A 1J19A 4K7SA 3H7PA 1YJ1A 1HE8A 2JRHA 4FHKA 1WJ4A 2DAJA 3VUXA 1LFDA 2KFKA 5E6NA 2IY1B 1JRUA 3AI5A 3X23A 4II2B 1WMHA 2N9PC 2LD9A 3B1LX 3EC8A 5D6JB 5KHOA 2HE7A 3H6NA 2KO3A 4GDLB 1WX7A 2PE6B 2RSUA 3W1SA 2CHWA 5CX3A 5IAAC 2KJRA 2GBKA 3M95A 1FXTB 2V3SA 3ZTDA 1KLVA 4ANVA 5D7GA 4M0WB 2BWFA 4IWPA 2L76A 3DQVA 3KYCD 3KUCB 3BINA 4DHZB 2KWUB 4MEMA 3QARA 3V61A 4ZRIA 2LGYA 2KNBA 4F1SA 3AU4A 1AARA 3NHEB 4FJZA 1UELA 2MBBB 1OEYJ 3Q3JA 2BYEA 2K1FA 2NBWB 1UD7A 1WR1A 2LZ6A 2JZZA 3C0RB 5JZEB 3NZUA 4LCDE 4FJYA 3HK0A 4MGYE 1Q1OA 2W9NA 3V62A 2CHXA 3TBLD 4MH0E 3P2BA 1WJNA 2ZVOA 4W9EA 4GDKB 2LXAA 1C3TA 3T8MA 2KKCA 1OTRB 3A33B 1RLFA 1R4MI 3A4RA 3M63B 5CTRC 3OJ4B 4I6PA 1OQYA 3RCZA 4DBGA 4DXAB 4HXDA 3DVNV 3ZO5B 2N1VA 2I1KA 1WZ0A 2OOBB 2XK5B 4NJ6A 5DPWA 2FIFA 3W1YA 4G11A 3ECIA 1MG8A 5DCNA 4BKSD 2AEHA 1WX9A 2KANA 1ISNA 4G50A 4AUQC 2MP2A 2O6VB 4RM9A 3M62B 4K81A 3M3JA 2FCSA 1GC7A 3DCGA 3ZKJC 3AXCA 4TQ1A 3GZNI 3N30A 3NY5A 1YQBA 2G4DB 2K6DB 5L95C 3QCAA 4MDKE 2UWQA 2FIDA 2MA9B 4EZKA 2ZPNA 1YX6B 2PJHA 5EDSA 5JH5C 3VAWA 3H7PB 4IWQA 4AP4C 4ZRKA 1ZKHA 3PHWB 3RZWC 4EUTA 2J0MA 1WMHB 2LASA 1Y8RC 2MSED 3CMMB 4HPMB 2KXJA 1Q0WB 5CHFA 2MBHA 3U8ZA 3UINB 2BF8B 4BVUC 2K25A 3QX1A 4M8NA 3ZTCA 2DX5B 1WJ6A 4AOFA 2KX0A 4PYUA 3RUIB 2N1WA 4LDTD 3JW0X 4K1RB 4WWNA 4DDID 5J2RA 4DHZE 1WJUA 3QIJA 4FULA 2G3QB 3SU8X 4YL8A 3H1UA 2O2VB 4LDTB 3L17A 2K6QA 3VDZA 3APFA 3U7DA 4NAWB 1WZ3A 2N9EB 4CO7A 2KDIA 2KLGA 1I35A 2KVRA 4ICUA 3PVLA 2FCMA 3VUYA 3WA0A 3WAMA 2ASQA 4BKGA 3K9OB 3AULA 3TMPB 1UZXB 3A1QB 3DBSA 3QAQA 4IM2A 4NJ7A 4HCNB 2FCNA 3ZUNA 1F9JA 1WXMA 2KWVB 3NOBA 4PYZA 1LQBA 3ZLZA 5LLIA 2KMCA 1TBEA 4HDQA 4IWOA 3NS8A 4MJSA 1RFAA 4X57B 2HD5B 3TIXA 1E8XA 4OVUA 3VTVA 2MP2B 2Z0EB 1WGDA 3H7SA 3ALBA 1L2NA 3SD5A 2L8JA 1PQSA 4F7ZA 1EUVB 2NPTA 2JVCA 3PRZA 2LVQA 3WANA 2IBIB 1WGYA 2MBEA 1IYFA 2JRIB 1V5OA 2J7QB 5E6OA 4XC2A 3ZNID 1WE6A 2BYFA 4OVVA 2MBQA 3L13A 1WM2A 5FR6A 4W9JA 4E3CA 4FA6A 5L83A 3GOEA 2GMIC 2LGXA 1UBQA 3A4SC 3L54A 5C1ZA 4NQKE 3R3MA 2NS5A 4XZ4A 1WXAA 2ZCBA 1E7UA 3EFUA 1U4AA 3PPAA 4HWIB 3VH4B 5JHBA 1KJTA 1RRBA 3ZNGC 2M17A 4GSWA 3L08A 4KSLC 1V86A 4BFRA 2KTRA 2B3AA 2KJHB 3JVZX 4EKUA 2L00B 3NZSA 2RGFA 2MW5A 2LRUA 4CYEA 3PRPB 1V49A 1S1QB 3QC8B 3ONSA 3H9DA 3RZFA 2KJ6A 1S3SG 3V60A 2DZMA 2MRPA 3PLUA 2VRRB 2IO3B 1VCBA 2R2QA 1LM8B 4LJOB 3HIZA 3K9PB 4FHJA 4WJPA 3RD2A 3VTUA 5HKHA 2M8SA 1WY8A 4ZRJA 3WAOA 2G45B 2LWPA 2YLMA 4K7WA 1KM7A 2ZEQA 1D3ZA 1UGMA 3I3TB 1RAXA 3SDLC 3RYTA 2O6VD 2ZVNA 2BKFA 1GNUA 4DWFA 1P0RA 3ZVVA 3PHXB 3KW5B 2DYMA 4AJWA 3IG3A 1WGRA 4NPNA 1A5RA 4ICVA 1EF5A 2IO2B 1WR6E 3PREA 1GUAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6J A;  3ML8 A;  4MJS B;  4IW0 A;  2C9W B;  2KZR A;  2GOW A;  1TGZ B;  2K8H A;  4TKN A;  4URK A;  4EOY A;  2RD0 A;  2LGD A;  1H8C A;  2KQS A;  4IG7 B;  2YVC A;  5C23 A;  1OGW A;  1K8R B;  1E8Z A;  2Y5B B;  2HTH A;  4FN2 A;  4KZ0 A;  1NDD A;  2KFK B;  3Q3F A;  3WIM A;  1XD3 B;  4B6W A;  1CMX B;  3ZIM A;  4MGI E;  1P98 A;  3DBH I;  2ZZP B;  2A4Z A;  2ZNV C;  4PS3 A;  5AZF A;  3X0W A;  3PZD A;  3PT2 B;  1V2Y A;  1WI0 A;  2PEA A;  2G4S A;  3N3K B;  2IYD B;  3HHM A;  4I6L B;  2DEN B;  2N4F A;  2IO0 B;  3ZW3 A;  3AU5 A;  1V6E A;  4WWO A;  2C7M B;  2J0J A;  5D94 A;  3V6C B;  2Z59 B;  4B9K A;  1WF9 A;  3A9J A;  3ENE A;  4CHK A;  3DBL I;  4P7I A;  2KTR B;  1GJZ A;  4G0N B;  3VXW A;  2DZI A;  2NVU I;  4GU2 A;  5DPT A;  3VTW A;  1XQQ A;  4EFO A;  3CF6 E;  3UIP B;  3MJW A;  2BKR B;  4MM3 A;  3PS6 A;  4MSQ B;  4W9L A;  3QK0 A;  2K8B A;  4BBN F;  1SE9 A;  1E5W A;  1WRD B;  2BYV E;  2OJR A;  1WE7 A;  3OLM D;  1V81 A;  4HLE A;  4BOS C;  3VHT C;  2LJ5 A;  5KHQ A;  3DDC B;  3VQI A;  4BBN C;  2KDB A;  2CHZ A;  2Z0D B;  3R66 C;  1I42 A;  2DYB A;  2L0F A;  4KDI C;  4LJP B;  1P1A A;  3DOW A;  2DZK A;  2RR9 A;  3ZDM C;  2A5U A;  2D2Q A;  1WGH A;  4DK5 A;  2KX3 A;  2MQJ A;  2GBN A;  5LXH A;  2KLC A;  3ZNZ B;  2D11 A;  4M8M A;  4KIK A;  4BKT A;  5LXI B;  2J0K A;  2NR2 A;  2JY6 A;  3B0A A;  4MGK E;  4RM8 A;  2GBR A;  3IVF A;  5AZG A;  3IHP C;  4W9I A;  1Z2M A;  3TJP A;  2ZPY A;  4WJQ A;  4PS7 A;  2D10 A;  3JSV A;  4AJY B;  3OJ3 A;  4IM3 A;  4B95 A;  5D2M B;  1E8W A;  3IBE A;  2R2O A;  2N7D A;  2D3G A;  3DVG Y;  3CSF A;  2JT4 B;  3MTN B;  1WXS A;  1GG3 A;  2EMS A;  2GBJ A;  3HM6 X;  2DHZ A;  3OAW A;  1WIA A;  2AL6 A;  3VFK A;  3U30 A;  1E90 A;  1YD8 U;  2C60 A;  2KC2 A;  2LI5 A;  2V4L A;  4N9F 4;  3MHS D;  4BKS A;  5E6P A;  1R4N I;  4EZJ A;  2KQ7 A;  4IUM B;  1NBF C;  2JXX A;  2PPH A;  4W9D A;  4FBJ B;  2CS4 A;  5GMV A;  2MLB A;  3A9K A;  4MEL A;  4JIO U;  4I6N B;  2EKE C;  4KDL B;  3O65 B;  4GMV A;  2D07 B;  3A9J B;  3KH0 A;  3KVF B;  2AL3 A;  2ZJD A;  2KN5 A;  3EEC A;  4NY0 A;  4DHJ D;  1KOT A;  3PV1 A;  4WWP A;  4JLC A;  2IZV B;  3BY4 B;  2K39 A;  4ZYN A;  2N7E A;  1ZW7 A;  2JF5 A;  1E8Y A;  5DPR A;  1L7Y A;  4DDG D;  1T0Y A;  1EO6 A;  2NBV B;  2WYQ A;  4W9C A;  4HK2 A;  4DHJ B;  2KC1 A;  3V6E B;  4E74 A;  2L7R A;  1P3Q U;  1M94 A;  2DZJ A;  2K8C A;  2KWC A;  2O2V A;  5G55 A;  4HPL B;  4FAD A;  1TZ1 A;  4NNJ B;  1X1M A;  2AYO B;  3L16 A;  3UQB A;  3R7R A;  4NAW A;  2CR5 A;  3ZDT A;  1J0G A;  1BT0 A;  3LDZ E;  3RUL A;  3WAP A;  3ZRF A;  1V80 A;  4W9K A;  2C7N B;  1H4R A;  2L3Z A;  3IFW B;  3WAL A;  4A3P A;  2KMA A;  3APD A;  4MGZ E;  4FJV B;  2MWS B;  3VVW B;  2KTF A;  1YIW A;  3T9L A;  1TTN A;  1Q5W B;  2M0X A;  4E71 A;  3A1Q A;  4KIK B;  3VH3 B;  3KUZ A;  1ZGU B;  1WGG A;  4XX5 A;  3PTF C;  3ZNH B;  1WFY A;  4BOZ B;  2L0T A;  5IA7 A;  3DBR I;  4A3O A;  2NPT B;  3QQ8 B;  3JSV B;  3UF8 A;  4TUU A;  5TR5 A;  1SGH A;  1IPG A;  4GIV A;  3UIO B;  2KOX A;  4JL9 A;  3W1S C;  5J18 A;  1NI2 A;  4KZC A;  1SIF A;  3PRM B;  3PGE A;  3L0W B;  4FLH A;  1QZE A;  2M1M A;  1UBI A;  1E7V A;  1WYW B;  4GN1 A;  1P9D U;  2GBM A;  3QWZ B;  4EZL A;  3TCA A;  4WAA A;  3D32 A;  3UQA A;  5AEK B;  3TL5 A;  2LVP A;  1EF1 A;  3CST A;  2BGF A;  3KYD D;  4IM0 A;  1YX5 B;  2I1J A;  2WX1 A;  1XT9 B;  4W9G A;  2CKH B;  5G2N A;  2REX A;  4HCP B;  4GOC A;  2L05 A;  3R7Q A;  2M4N A;  1WM3 A;  4A20 A;  4RMA A;  2FCQ A;  3B08 A;  3SHQ A;  3KUD B;  2FNJ B;  2ZCC A;  4ZDV A;  2KD0 A;  2KHW B;  2NBU A;  3A9K B;  2LUE A;  4KSK C;  4GDL A;  2LXC A;  4F8C B;  1WH3 A;  2HJ8 A;  4PS8 A;  3DVG X;  3EHV A;  4WJO A;  5BO4 B;  2KK8 A;  2MX2 A;  5DPS A;  2AWT A;  3HM3 A;  2DAF A;  2WWZ A;  4G3X B;  3DVN U;  4WQO B;  2JWZ A;  3ML9 A;  4IC7 B;  4W9H A;  3QHT A;  2JZ3 B;  2KFJ A;  4AWJ A;  1WXV A;  2PE9 A;  4MSM B;  3ZRC A;  2RPQ A;  2V1Y A;  4KV2 A;  2ZNV B;  2BPS A;  2FUH B;  4GB9 A;  2QHO A;  4ANU A;  4ASW C;  4HDO A;  2IY0 B;  4NQL B;  1IP9 A;  3UGB B;  2NCN A;  5CHV C;  4ANW A;  1C1Y B;  3APC A;  1VD2 A;  5JHA A;  1J8C A;  2IO1 B;  4KVG B;  2KDE B;  3S2A A;  3JYU A;  4GDK A;  4GXB A;  4WJN A;  2JUO A;  2MCN B;  2XBB C;  3VUW A;  3DPD A;  3L10 B;  3PLV A;  3N32 A;  4K7U A;  4ANX A;  1V5T A;  1V9J A;  4TV3 A;  2N9X A;  4JGH B;  2BWE S;  2JPH A;  2KDF B;  2DYO A;  1OEY A;  5AZH A;  1UH6 A;  4JQW C;  4J6I A;  2XK5 A;  2C7H A;  2LRW A;  2C5L C;  2WDT B;  3LJ3 A;  2FAZ A;  2UYZ B;  1LXD A;  1Z5S B;  2EMT A;  4EEW A;  4W9F A;  1WX8 A;  2MBO A;  2O6V A;  3PSE B;  4HJK A;  2XEW A;  3RT3 B;  4GGQ A;  4II3 B;  2LVO A;  4TQ0 A;  3QA8 A;  3QJZ A;  5CHW A;  4HVB A;  2CU1 A;  2WX0 A;  5J17 A;  1GC6 A;  1J19 A;  4K7S A;  3H7P A;  1YJ1 A;  1HE8 A;  2JRH A;  4FHK A;  1WJ4 A;  2DAJ A;  3VUX A;  1LFD A;  2KFK A;  5E6N A;  2IY1 B;  1JRU A;  3AI5 A;  3X23 A;  4II2 B;  1WMH A;  2N9P C;  2LD9 A;  3B1L X;  3EC8 A;  5D6J B;  5KHO A;  2HE7 A;  3H6N A;  2KO3 A;  4GDL B;  1WX7 A;  2PE6 B;  2RSU A;  3W1S A;  2CHW A;  5CX3 A;  5IAA C;  2KJR A;  2GBK A;  3M95 A;  1FXT B;  2V3S A;  3ZTD A;  1KLV A;  4ANV A;  5D7G A;  4M0W B;  2BWF A;  4IWP A;  2L76 A;  3DQV A;  3KYC D;  3KUC B;  3BIN A;  4DHZ B;  2KWU B;  4MEM A;  3QAR A;  3V61 A;  4ZRI A;  2LGY A;  2KNB A;  4F1S A;  3AU4 A;  1AAR A;  3NHE B;  4FJZ A;  1UEL A;  2MBB B;  1OEY J;  3Q3J A;  2BYE A;  2K1F A;  2NBW B;  1UD7 A;  1WR1 A;  2LZ6 A;  2JZZ A;  3C0R B;  5JZE B;  3NZU A;  4LCD E;  4FJY A;  3HK0 A;  4MGY E;  1Q1O A;  2W9N A;  3V62 A;  2CHX A;  3TBL D;  4MH0 E;  3P2B A;  1WJN A;  2ZVO A;  4W9E A;  4GDK B;  2LXA A;  1C3T A;  3T8M A;  2KKC A;  1OTR B;  3A33 B;  1RLF A;  1R4M I;  3A4R A;  3M63 B;  5CTR C;  3OJ4 B;  4I6P A;  1OQY A;  3RCZ A;  4DBG A;  4DXA B;  4HXD A;  3DVN V;  3ZO5 B;  2N1V A;  2I1K A;  1WZ0 A;  2OOB B;  2XK5 B;  4NJ6 A;  5DPW A;  2FIF A;  3W1Y A;  4G11 A;  3ECI A;  1MG8 A;  5DCN A;  4BKS D;  2AEH A;  1WX9 A;  2KAN A;  1ISN A;  4G50 A;  4AUQ C;  2MP2 A;  2O6V B;  4RM9 A;  3M62 B;  4K81 A;  3M3J A;  2FCS A;  1GC7 A;  3DCG A;  3ZKJ C;  3AXC A;  4TQ1 A;  3GZN I;  3N30 A;  3NY5 A;  1YQB A;  2G4D B;  2K6D B;  5L95 C;  3QCA A;  4MDK E;  2UWQ A;  2FID A;  2MA9 B;  4EZK A;  2ZPN A;  1YX6 B;  2PJH A;  5EDS A;  5JH5 C;  3VAW A;  3H7P B;  4IWQ A;  4AP4 C;  4ZRK A;  1ZKH A;  3PHW B;  3RZW C;  4EUT A;  2J0M A;  1WMH B;  2LAS A;  1Y8R C;  2MSE D;  3CMM B;  4HPM B;  2KXJ A;  1Q0W B;  5CHF A;  2MBH A;  3U8Z A;  3UIN B;  2BF8 B;  4BVU C;  2K25 A;  3QX1 A;  4M8N A;  3ZTC A;  2DX5 B;  1WJ6 A;  4AOF A;  2KX0 A;  4PYU A;  3RUI B;  2N1W A;  4LDT D;  3JW0 X;  4K1R B;  4WWN A;  4DDI D;  5J2R A;  4DHZ E;  1WJU A;  3QIJ A;  4FUL A;  2G3Q B;  3SU8 X;  4YL8 A;  3H1U A;  2O2V B;  4LDT B;  3L17 A;  2K6Q A;  3VDZ A;  3APF A;  3U7D A;  4NAW B;  1WZ3 A;  2N9E B;  4CO7 A;  2KDI A;  2KLG A;  1I35 A;  2KVR A;  4ICU A;  3PVL A;  2FCM A;  3VUY A;  3WA0 A;  3WAM A;  2ASQ A;  4BKG A;  3K9O B;  3AUL A;  3TMP B;  1UZX B;  3A1Q B;  3DBS A;  3QAQ A;  4IM2 A;  4NJ7 A;  4HCN B;  2FCN A;  3ZUN A;  1F9J A;  1WXM A;  2KWV B;  3NOB A;  4PYZ A;  1LQB A;  3ZLZ A;  5LLI A;  2KMC A;  1TBE A;  4HDQ A;  4IWO A;  3NS8 A;  4MJS A;  1RFA A;  4X57 B;  2HD5 B;  3TIX A;  1E8X A;  4OVU A;  3VTV A;  2MP2 B;  2Z0E B;  1WGD A;  3H7S A;  3ALB A;  1L2N A;  3SD5 A;  2L8J A;  1PQS A;  4F7Z A;  1EUV B;  2NPT A;  2JVC A;  3PRZ A;  2LVQ A;  3WAN A;  2IBI B;  1WGY A;  2MBE A;  1IYF A;  2JRI B;  1V5O A;  2J7Q B;  5E6O A;  4XC2 A;  3ZNI D;  1WE6 A;  2BYF A;  4OVV A;  2MBQ A;  3L13 A;  1WM2 A;  5FR6 A;  4W9J A;  4E3C A;  4FA6 A;  5L83 A;  3GOE A;  2GMI C;  2LGX A;  1UBQ A;  3A4S C;  3L54 A;  5C1Z A;  4NQK E;  3R3M A;  2NS5 A;  4XZ4 A;  1WXA A;  2ZCB A;  1E7U A;  3EFU A;  1U4A A;  3PPA A;  4HWI B;  3VH4 B;  5JHB A;  1KJT A;  1RRB A;  3ZNG C;  2M17 A;  4GSW A;  3L08 A;  4KSL C;  1V86 A;  4BFR A;  2KTR A;  2B3A A;  2KJH B;  3JVZ X;  4EKU A;  2L00 B;  3NZS A;  2RGF A;  2MW5 A;  2LRU A;  4CYE A;  3PRP B;  1V49 A;  1S1Q B;  3QC8 B;  3ONS A;  3H9D A;  3RZF A;  2KJ6 A;  1S3S G;  3V60 A;  2DZM A;  2MRP A;  3PLU A;  2VRR B;  2IO3 B;  1VCB A;  2R2Q A;  1LM8 B;  4LJO B;  3HIZ A;  3K9P B;  4FHJ A;  4WJP A;  3RD2 A;  3VTU A;  5HKH A;  2M8S A;  1WY8 A;  4ZRJ A;  3WAO A;  2G45 B;  2LWP A;  2YLM A;  4K7W A;  1KM7 A;  2ZEQ A;  1D3Z A;  1UGM A;  3I3T B;  1RAX A;  3SDL C;  3RYT A;  2O6V D;  2ZVN A;  2BKF A;  1GNU A;  4DWF A;  1P0R A;  3ZVV A;  3PHX B;  3KW5 B;  2DYM A;  4AJW A;  3IG3 A;  1WGR A;  4NPN A;  1A5R A;  4ICV A;  1EF5 A;  2IO2 B;  1WR6 E;  3PRE A;  1GUA B; 
#chains in the Genus database with same CATH topology
 4YXD B;  4A9A A;  4MJS B;  2KZR A;  2GOW A;  4TKN A;  3KQ4 A;  4EOY A;  2RD0 A;  2LGD A;  2YVC A;  1JRP A;  3WIM A;  2HTH A;  2WXJ A;  2KFK B;  1C76 A;  2FUG 1;  1WGK A;  3X0W A;  2ZNV C;  1TT5 B;  3PT2 B;  1WI0 A;  2YEP F;  2SAK A;  4LNK A;  3HHM A;  4I6L B;  2DWQ A;  2WXN A;  3ZW3 A;  2OED A;  4REZ A;  3IAS 1;  1ZUD 2;  2NVU I;  3VTW A;  2V9H A;  1XF5 L;  2AX5 A;  2QMT A;  4M00 A;  2BKR B;  1CK1 A;  1GPX A;  3QK0 A;  1XLQ A;  2K8B A;  1ENF A;  2KAJ A;  2OJR A;  2UU7 A;  1V81 A;  1FRD A;  4BOS C;  1QT9 A;  1D4B A;  2L52 A;  3DDC B;  2Z0D B;  2DYB A;  3DWG C;  1P1A A;  2RR9 A;  2LFI A;  1V8C A;  2N0S B;  4M8M A;  3UI3 A;  4BKT A;  1RWS A;  5BYS A;  3BZD B;  4RM8 A;  1SB3 C;  2MEK A;  4RGT A;  4LNI A;  3EUB 2;  3O13 A;  1VLB A;  1TY2 A;  2GRI A;  2N7D A;  2D3G A;  2WXF A;  2ZW0 A;  2EMS A;  2GBJ A;  1GB1 A;  4IOI E;  1F2R C;  2AL6 A;  3VFK A;  3AEC B;  1JW9 D;  2C60 A;  2LI5 A;  4BKS A;  3MHS D;  3TEW A;  5E6P A;  3LB8 C;  2PPH A;  4W9D A;  1UNS A;  3A9K A;  5EE1 A;  2J53 A;  2EKE C;  1CZP A;  2ZJD A;  3EEC A;  4WWP A;  1YJI A;  1YOV B;  4ZYN A;  5DPR A;  2JF5 A;  1L7Y A;  2EEL A;  1EO6 A;  2NBV B;  2WYQ A;  4W9C A;  4HK2 A;  1UUP A;  1P3Q U;  2DZJ A;  1VZ7 A;  2KWC A;  3LYY A;  1XO3 A;  4HPL B;  1E7P B;  5BYQ A;  1X1M A;  3ZJU A;  4NAW A;  3LDZ E;  1PYW D;  3WAP A;  1V80 A;  3IFW B;  3APD A;  4MGZ E;  2WXR A;  1YIW A;  3T9L A;  1TTN A;  1Q5W B;  3KUZ A;  1ZGU B;  3DBR I;  4XYC A;  4KGS A;  2NPT B;  3UF8 A;  5TR5 A;  1SGH A;  4JL9 A;  4RGN A;  2WU2 B;  3PGE A;  2BVC A;  3L0W B;  2M1M A;  4PT5 A;  2LHE A;  4NJC A;  2LVP A;  2WXP A;  2WQY B;  1YX5 B;  5G2N A;  2REX A;  4HCP B;  1P7F A;  4GOC A;  3R7Q A;  1WM3 A;  2XN9 C;  3SHQ A;  3KUD B;  3B2G A;  2ZCC A;  4ZDV A;  2KHW B;  3B2F A;  4GDL A;  2LXC A;  4F8C B;  1TIF A;  2HJ8 A;  4M02 A;  5BO4 B;  2MX2 A;  2N9L A;  3HM3 A;  4WQO B;  1EM7 A;  2JWZ A;  4YWG G;  4IC7 B;  4W9H A;  5JXV A;  3QHT A;  2KFJ A;  3TEX A;  4MSM B;  3ZRC A;  2RPQ A;  2ZNV B;  2FUH B;  4GB9 A;  1TS3 A;  1FNV A;  2IY0 B;  3V3X A;  1K51 A;  3UGB B;  4ANW A;  1C1Y B;  1VD2 A;  2BS4 B;  2IO1 B;  2KDE B;  3S2A A;  4WJN A;  5D3D A;  3TEZ A;  2WXH A;  3PLV A;  4ANX A;  1V5T A;  2JPH A;  1JAL A;  2OJW A;  1N5W A;  4ITK A;  3E56 A;  2LRW A;  1R7S A;  2FAZ A;  1Z5S B;  1QOG A;  3Q8E A;  2EMT A;  4W9F A;  3BK1 A;  4WWM A;  5HG2 A;  3V05 A;  4II3 B;  2WDQ B;  1B1Z A;  4TMA B;  1GC6 A;  1J19 A;  1ZXH A;  1YJ1 A;  4L2Y A;  4WH4 A;  2DAJ A;  2KFK A;  1SE4 A;  2IY1 B;  4KKI A;  3VR9 B;  2LD9 A;  1DOX A;  3AE1 B;  1QF6 A;  1D5X C;  1VR9 A;  2I2Y A;  2KJR A;  2V3S A;  2IGH A;  5E6J A;  1I7H A;  1AWD A;  2L76 A;  2M0A A;  3RNF C;  4F1S A;  3NHE B;  1UEL A;  2K5P A;  2VH1 A;  1UD7 A;  2JZZ A;  3C0R B;  2Y5P A;  1TKG A;  3SFD B;  1OTR B;  3A33 B;  1RLF A;  3A4R A;  1FFU A;  1Y56 A;  2JZP A;  1GAQ B;  1KLG D;  1WRI A;  1YMH E;  4FXC A;  1HXY D;  1XEE A;  1EU4 A;  3ECI A;  2AEH A;  1UF0 A;  2KAN A;  4G50 A;  4AUQ C;  5FR3 A;  3M62 B;  4K81 A;  3M3J A;  1GC7 A;  4TQ1 A;  3N30 A;  1YQ3 B;  2G4D B;  5L95 C;  1SSN A;  2K3U A;  2K0P A;  2UWQ A;  2MA9 B;  4C4V B;  4EZK A;  1YX6 B;  4WIP A;  5JH5 C;  3VAW A;  4IWQ A;  4AP4 C;  3Q3M C;  4ZRK A;  3BII D;  1ZKH A;  3P63 A;  1WMH B;  5CHF A;  1Q0W B;  3UIN B;  4M8N A;  1FPY A;  1WJ6 A;  2Y3A A;  4WWN A;  4DHZ E;  4YL8 A;  2O2V B;  2BW2 A;  2I38 A;  1FM0 D;  4LDT B;  4L23 A;  4YSY B;  4CO7 A;  5H92 C;  2LHD A;  2KDI A;  5TSS A;  2OHF A;  4RNA A;  4JPS A;  1NI3 A;  3P4P B;  3PVL A;  2BTE A;  3N1X C;  3RNG C;  2PVO D;  2ASQ A;  4BKG A;  3K9O B;  3A1Q B;  5H8Y E;  2WXQ A;  1N5X A;  3NOB A;  3Q69 A;  1VRA B;  5LNK 1;  2V4I B;  3AEA B;  3GE3 C;  4MAC A;  2V0G A;  3NS8 A;  3VTV A;  1RFA A;  5T8I A;  2MP2 B;  3ALB A;  1SEB D;  1L2N A;  3Q8A A;  2NPT A;  2JVC A;  1WGY A;  1IYF A;  1I4G A;  2MJE A;  2LGI A;  2BYF A;  2MBQ A;  3L13 A;  3Q6B A;  2CU3 A;  1OQQ A;  5AUK A;  1E7U A;  2Y5C A;  2RGF A;  3PRP B;  1JRO A;  4DXG A;  2KJ6 A;  4ZHP A;  2WXI A;  2IO3 B;  2GLS A;  1YJJ A;  4FHJ A;  5C2T B;  1WY8 A;  4ZRJ A;  3C8Y A;  1ET6 A;  3W5U B;  5HFY A;  2E6X A;  3P4R B;  2LWP A;  2PIA A;  2ZEQ A;  1MI0 A;  3T3N A;  2LJI A;  3SDL C;  3SEB A;  2O6V D;  4P16 A;  1P0R A;  1BUI C;  2B76 B;  2QIE B;  3KW5 B;  2HTM E;  1WGR A;  2VZK D;  4NPN A;  4ICV A;  4AQ7 A;  3PRE A;  1G6J A;  4OW0 A;  4C56 C;  2C9W B;  1H8C A;  4IG7 B;  5C23 A;  1OGW A;  4FN2 A;  4KZ0 A;  3Q8F A;  2A4Z A;  3Q8C A;  4PS3 A;  1NVI D;  4IDI A;  1V2Y A;  2PEA A;  3N3K B;  1FXA A;  2IO0 B;  1V6E A;  1ROE A;  2C7M B;  3V6C B;  2Z59 B;  3A9J A;  1IBX B;  4P7I A;  1C4A A;  4G0N B;  2WU5 B;  3VXW A;  2DZI A;  3CF6 E;  3UIP B;  3MJW A;  1XLN A;  3HVZ A;  3P4S B;  1MHH E;  4W9L A;  4ZHO A;  2FE8 A;  1E5W A;  1WRD B;  2BYV E;  2WDV B;  3OLM D;  4HLE A;  5BMI A;  4YTP B;  1T3Q A;  3DBL B;  3VQI A;  1JWB D;  1I42 A;  2JWU A;  3AM9 A;  2DZK A;  2INP E;  2A5U A;  2KX3 A;  2GBN A;  3ZNZ B;  4KIK A;  2J0K A;  4P1B C;  2GBR A;  4D2K A;  2KYW A;  2XNA C;  3ETR A;  3RNB C;  3IBE A;  2R2O A;  3LXF A;  2RDB C;  1N60 A;  3CSF A;  2JT4 B;  1GG3 A;  5IKC M;  3U30 A;  3AH7 A;  3B9J A;  3I5J C;  4N9F 4;  4C4V A;  1SJH D;  4HKQ A;  1R4N I;  3R2I A;  1QOB A;  2KQ7 A;  4IUM B;  3AE8 B;  1TS4 A;  2JSV X;  3BYY B;  3NVV A;  4I6N B;  2AQ3 B;  1M4V A;  1T0S C;  3O65 B;  4GMV A;  2KAC A;  2AL3 A;  2MJ3 A;  1KOT A;  1E9M A;  3PV1 A;  2KQ4 X;  2J52 A;  2IZV B;  2PTL A;  2K39 A;  1JWU D;  4WAF A;  3HVD A;  2WP9 B;  3EGR A;  4DHJ B;  2KC1 A;  2L7R A;  1M94 A;  2K8C A;  2O2V A;  5G55 A;  2JYT A;  1TZ1 A;  2FBW B;  1KH0 A;  3L16 A;  5BMH A;  1N63 A;  1TKE A;  2EKI A;  3UQB A;  2QCZ A;  1NEK B;  3AEG B;  2L3Z A;  1ZXI A;  4A3P A;  5G5H A;  2KMA A;  4NZL B;  3ZJT A;  2MWS B;  1FFV A;  1V97 A;  3FC4 A;  2M0X A;  3ZGZ A;  3A1Q A;  1L6V A;  1WGG A;  3PTF C;  3ZNH B;  1DOI A;  4QAY A;  3KWL A;  3JSV B;  2W3R A;  4GIV A;  4XGA B;  1FD6 A;  1L4D B;  2IGG A;  3NVZ A;  4FLH A;  1E7V A;  4GN1 A;  5G5G A;  3QWZ B;  4EZL A;  3TCA A;  4WAA A;  3TL5 A;  2KT7 A;  2WX1 A;  1XT9 B;  2CKH B;  3AE9 B;  4RMA A;  3NS1 A;  3B08 A;  2FNJ B;  4ZRP A;  4KSK C;  4HKZ E;  1WH3 A;  3DVG X;  3EHV A;  2KN4 A;  2KK8 A;  2DAF A;  2LMC A;  1V1P B;  2WWZ A;  3DVN U;  4G3X B;  4M0W A;  2WNM A;  2CJO A;  1DYQ A;  1WXV A;  1FCL A;  2QHO A;  2X38 A;  1D5Z C;  4NQL B;  2NCN A;  5CHV C;  3IT6 B;  5JHA A;  3AE6 B;  2AQ2 B;  3JYU A;  1ACC A;  2AQ1 B;  4N6E B;  2JUO A;  2XBB C;  3VUW A;  3DPD A;  3L10 B;  3N32 A;  3Q3O C;  1V9J A;  2N9X A;  1HZ5 A;  2DYO A;  1C78 A;  2BT6 A;  2C7H A;  2UYZ B;  4AS1 A;  2JQR B;  2D3A A;  2IJ0 A;  2WDR B;  2MBO A;  4N58 A;  4C80 A;  2DLB A;  3PSE B;  2LVO A;  4TQ0 A;  3QA8 A;  2WX0 A;  4LK0 M;  1XLP A;  4K7S A;  1E10 A;  3H7P A;  4FHK A;  2JRH A;  1LFD A;  3HUI A;  5E6N A;  1JRU A;  3AI5 A;  2N9P C;  5D6J B;  2HE7 A;  3AEF B;  1SE3 A;  1N62 A;  2KO3 A;  2QC8 A;  2PE6 B;  3SR6 A;  3FIL B;  2RSU A;  1IGD A;  3W1S A;  1FMA D;  5IAA C;  1KLV A;  2GBK A;  1WYG A;  1OQR A;  3KYC D;  3BIN A;  1IBX A;  1QKZ A;  2KWU B;  3QAR A;  3Q8B A;  3V61 A;  2LGY A;  2KNB A;  1AAR A;  1OEY J;  3Q3J A;  4L1B A;  2K1F A;  2NBW B;  1WR1 A;  3DHI C;  5JZE B;  2NMQ A;  3NZU A;  2BB5 A;  2E3T A;  3HK0 A;  3NZ3 A;  1Q1O A;  2W9N A;  3TBL D;  4MH0 E;  3P2B A;  1WJN A;  2ZVO A;  4GDK B;  2LXA A;  1HTO A;  3T8M A;  4B0M A;  2KKC A;  3NUH B;  3RCZ A;  4DXA B;  3OJ4 B;  1OQY A;  3ZO5 B;  2I1K A;  1WZ0 A;  3VRB B;  4NJ6 A;  2XK5 B;  4G11 A;  5BMG A;  1BML C;  1MG8 A;  1SF0 A;  4MH8 A;  4BKS D;  1ISN A;  4UDU C;  2O6V B;  1XXG A;  2FCS A;  3AXC A;  2K6D B;  4BZA A;  3QCA A;  1R4M B;  2VZK B;  2ZPN A;  1YN5 A;  3BK2 A;  5I4D A;  2D3B A;  3AE5 B;  2BB6 A;  3RZW C;  4ZOH C;  2LAS A;  1CQV A;  2MSE D;  3CMM B;  2HJ1 A;  2K25 A;  2M19 A;  3QX1 A;  2TSS A;  4AOF A;  1L0X B;  2KX0 A;  3GZN B;  3JW0 X;  5J2R A;  3ABV B;  5C3J B;  4B0E A;  1CJE A;  3Q14 C;  1XCQ L;  3APF A;  1WZ3 A;  2N9E B;  2KLG A;  1MFW A;  1UWX A;  2RDG A;  4ICU A;  5BYR A;  2YEP B;  2FCM A;  3WA0 A;  3NVY A;  1UZX B;  3GS2 A;  3DBS A;  3QAQ A;  2FCN A;  3ZUN A;  1F9J A;  1QLB B;  2KWV B;  4PYZ A;  3U2S C;  1XCT L;  5LLI A;  1J7C A;  4HDQ A;  3OWE B;  1HZ6 A;  4MJS A;  2Z0E B;  3H7S A;  3MP9 A;  3PRZ A;  2LVQ A;  2JRI B;  1V5O A;  2J7Q B;  4XC2 A;  3HRD D;  5L83 A;  1UGJ A;  4JE3 B;  1UBQ A;  5FK9 C;  4OVZ A;  3R3M A;  2NS5 A;  4XZ4 A;  3EFU A;  4HWI B;  1KJT A;  1RRB A;  3P4Q B;  2M17 A;  3NRZ A;  4KSL C;  2KJH B;  3NZS A;  1NYR A;  1WXQ A;  4JWS C;  3QC8 B;  2PKO A;  3ONS A;  3MFG A;  1HEZ E;  2X8X X;  3V60 A;  3AED B;  3PLU A;  1V1P A;  1VCB A;  1LM8 B;  2W55 A;  2WXL A;  3HIZ A;  4LJO B;  3RD2 A;  2M8S A;  4H2A A;  2L32 A;  1KM7 A;  2PVG C;  1RAX A;  1MVK A;  1D6E C;  2BKF A;  3BVG A;  1E0Z A;  3ZVV A;  1HTQ A;  3PHX B;  2DYM A;  3N1Z C;  1EF5 A;  1WR6 E;  1GUA B;  1KFY B;  1I4R A;  3ML8 A;  3Q3N C;  2D5G A;  1TGZ B;  4P6V F;  2K8H A;  1PGA A;  4URK A;  2KQS A;  4BAX A;  1E8Z A;  3Q3F A;  1XD3 B;  4O1N A;  4B6W A;  1C4P A;  1PDX A;  1SXT A;  5AZF A;  4ACF A;  2G4S A;  2IYD B;  2WGS A;  3Q2A C;  1I4X A;  4WWO A;  5D94 A;  2QDF A;  1WF9 A;  3DBL I;  4A55 A;  2KTR B;  3ZYY X;  1JWA D;  4GU2 A;  5DPT A;  2ICI A;  3FIL A;  3DBH B;  3PS6 A;  1PUT A;  1B9R A;  3I63 C;  2MHJ A;  1WE7 A;  3NVW A;  5KHQ A;  1JWM D;  1ET9 A;  2CHZ A;  1VDV A;  2L0F A;  3FKY A;  2QIL A;  3ZDM C;  2D2Q A;  4DK5 A;  1WGH A;  3AE3 B;  5LXH A;  2KLC A;  2D11 A;  1RFK A;  2NR2 A;  2JY6 A;  3B0A A;  4MGK E;  2RMM A;  3IVF A;  1TY0 A;  3IHP C;  1MG4 A;  4W9I A;  1Z2M A;  3TJP A;  2ZPY A;  4WJQ A;  4B95 A;  1E8W A;  2N7J A;  3ZXR A;  4N59 A;  3AN1 A;  3MTN B;  1WXS A;  2CJN A;  1QOF A;  3OAW A;  1SBB B;  2IND C;  1TS5 A;  4XE0 A;  2KC2 A;  4ZYS A;  2QEJ C;  1NEN B;  4FBJ B;  1T6B X;  2CS4 A;  2MLB A;  4MEL A;  2D07 B;  2VH2 A;  4NY0 A;  2MH7 A;  3P42 A;  4K3C A;  3MC0 B;  3BY4 B;  2N7E A;  1T0Y A;  3MC8 A;  1WWT A;  1MPE A;  1L6U A;  4FAD A;  1LO5 D;  3R7R A;  1YN4 A;  1J0G A;  1BT0 A;  3ZRF A;  2QSD A;  1H4R A;  3WAL A;  3T3O A;  1YQ4 B;  3VVW B;  4OHJ A;  4M01 A;  4A8X C;  3VH3 B;  4XX5 A;  1KF6 B;  2JXT A;  1WFY A;  2L0T A;  3MC9 A;  2KMM A;  4A3O A;  3DWM A;  1JQ4 A;  4TUU A;  1IPG A;  5J18 A;  3PRM B;  4C7Z A;  3PZ7 A;  1WYW B;  2GBM A;  3UQA A;  4YTN B;  1VZ8 A;  2BGF A;  3CST A;  1MJD A;  3URY A;  5GXG B;  4W9G A;  1K53 A;  2L05 A;  2M4N A;  4WUR A;  4A20 A;  3N20 C;  2FCQ A;  1E6E B;  1QOA A;  2NBU A;  3A9K B;  3AE2 B;  4KKJ A;  1F1H A;  1VJK A;  4WJO A;  2AWT A;  1MHX A;  2ACZ B;  4DXF A;  4AWJ A;  4S0R A;  2PE9 A;  4KV2 A;  4ANU A;  4HDO A;  4KGR A;  1IP9 A;  3APC A;  5IOI A;  5EE0 A;  4USA A;  4LNN A;  2JX5 A;  4TV3 A;  2BWE S;  5AZH A;  1UH6 A;  2C5L C;  2WDT B;  2G1E A;  3LJ3 A;  1LXD A;  1WX8 A;  2H88 B;  1K52 A;  4OZC A;  2Z8L A;  3RT3 B;  4GGQ A;  1FEH A;  2RDH A;  4CQN A;  2CU1 A;  5J17 A;  2ON8 A;  1HE8 A;  1WJ4 A;  3RNE C;  3AEE B;  3X23 A;  1WMH A;  3B1L X;  1L4Z B;  5KHO A;  1L0V B;  5HHD G;  3H6N A;  4GDL B;  1WX7 A;  4JWU C;  4MM3 B;  5CX3 A;  3M95 A;  4LNO A;  3ZTD A;  4ANV A;  4IWP A;  3KUC B;  1YNT E;  4DHZ B;  3AMZ A;  4FJZ A;  2MBB B;  2BYE A;  4LCD E;  1SIJ A;  4HJG E;  4MGY E;  3V62 A;  3W2D A;  2CHX A;  1J7A A;  4ARC A;  4P1C C;  2JYE A;  1JCK B;  1R4M I;  5CTR C;  3TEY A;  3PO0 A;  3DVN V;  2OOB B;  5DPW A;  3W1Y A;  1WX9 A;  1ZDV A;  2MP2 A;  4RM9 A;  3DCG A;  2KDM A;  3GZN I;  5FKA C;  1YQB A;  4MDK E;  2PJH A;  5EDS A;  1TKY A;  4LNF A;  4EUT A;  2WXO A;  1T5X D;  1Y8R C;  5HI1 A;  4HPM B;  3U8Z A;  2MBH A;  4BVU C;  3RUI B;  2N1W A;  2SEB D;  4LDT D;  4K1R B;  5AUI A;  3RPF C;  4DDI D;  2INN E;  2W54 A;  3SU8 X;  2R61 A;  3H1U A;  2PW9 A;  3U7D A;  2LEK A;  2KVR A;  1C77 A;  3L4P A;  1PGB A;  3VUY A;  3WAM A;  1TS2 A;  1LGR A;  2BS3 B;  2WXM A;  4IM2 A;  4HCN B;  3E9S A;  1KLU D;  1RM6 C;  1LQB A;  2KMC A;  4MT5 A;  2GI9 A;  1V1O A;  1WGD A;  4J3O D;  2J42 A;  4F7Z A;  1EUV B;  3WAN A;  2IBI B;  3MHZ A;  5E6O A;  1F2R I;  4OVV A;  3IAM 1;  4KGT A;  2Q5W D;  2LGX A;  2NTS A;  1WXA A;  5JHB A;  3L08 A;  2B3A A;  3JVZ X;  3AEB B;  3KLS X;  1V49 A;  1S3S G;  2D3C A;  2VRR B;  2L1A A;  4WJP A;  4HEA 1;  2WS3 B;  3K9P B;  3VTU A;  2PMV A;  2ONQ A;  3WAO A;  1R4N B;  2IDY A;  1D3Z A;  5EE9 A;  1D5M C;  1UGM A;  1ZPS A;  2LUM A;  1FNW A;  2ZVN A;  3RN9 C;  1GNU A;  2KVZ A;  4DWF A;  1C4C A;  3J9C A;  4A6Q A;  2HDE A;  2IO2 B;  4YSX B;  2PLP A;  4IW0 A;  1K8R B;  1FO4 A;  4LTU A;  2Y5B B;  1NDD A;  1CMX B;  3ZIM A;  4IKG A;  4MGI E;  1P98 A;  1QIL A;  3DBH I;  2ZZP B;  1OFF A;  2ZW1 A;  3PZD A;  5IP4 D;  1QQR A;  1AYF A;  2DEN B;  2N4F A;  3AU5 A;  1J7B A;  2J0J A;  4B9K A;  3ENE A;  4CHK A;  2V3P A;  1GJZ A;  2IPK D;  1XQQ A;  4EFO A;  1GB4 A;  2V3N A;  1NYQ A;  4MM3 A;  1AN8 A;  4MSQ B;  4BBN F;  4GLS C;  1SE9 A;  3C19 A;  3VHT C;  2LJ5 A;  4BBN C;  2KDB A;  3R66 C;  4RGM A;  1WSP A;  4KDI C;  4LJP B;  3DOW A;  1FCC C;  1GOZ A;  3AE4 B;  2MQJ A;  5LXI B;  4YSZ B;  1RYJ A;  5AZG A;  1I4P A;  3AE7 B;  4AJY B;  3RMK C;  4PS7 A;  2D10 A;  3JSV A;  3W5V B;  3OJ3 A;  4IM3 A;  3RFZ B;  5D2M B;  1ZE3 D;  3AV8 A;  4Q2J A;  3DVG Y;  3RNA C;  1EU3 A;  1DGJ A;  3HM6 X;  2DHZ A;  1WIA A;  1L5P A;  1E90 A;  1YD8 U;  2V4L A;  4R3D A;  3U4E G;  4EZJ A;  3EA6 A;  1NBF C;  2JXX A;  1TZO A;  5GMV A;  4JIO U;  4KDL B;  1T0R C;  3A9J B;  3KH0 A;  2K22 A;  3KVF B;  4RH6 A;  3TSS A;  1UWM A;  2KN5 A;  3GE8 C;  4DHJ D;  1I4Q A;  4JLC A;  1FRR A;  1HA5 A;  3CIR B;  1ZW7 A;  4DDG D;  1E8Y A;  4ARI A;  1I4H A;  2BBC A;  3V6E B;  4E74 A;  3R8B A;  1VZ6 A;  4NNJ B;  2AYO B;  1BXT A;  3N1Y C;  2CR5 A;  3ZDT A;  3RUL A;  3KWV A;  4W9K A;  2QJL A;  2C7N B;  2DNF A;  1SE2 A;  4FJV B;  2KTF A;  4E71 A;  4S17 A;  4KIK B;  3BVZ A;  4BOZ B;  5IA7 A;  4LLG M;  3QQ8 B;  2WLB A;  3UIO B;  3W1S C;  2KOX A;  3ZJV A;  4RFB A;  1NI2 A;  3IT4 B;  1SIF A;  3AB5 A;  4KZC A;  1Q10 A;  1QZE A;  2BQQ A;  1UBI A;  2NTT A;  3BYT B;  1P9D U;  1HQR D;  1AW7 A;  3D32 A;  5AEK B;  1EF1 A;  3KYD D;  4IM0 A;  2I1J A;  3CWI A;  4US8 A;  3DBR B;  3ZXV A;  2MJD A;  4YTM B;  4OZA A;  4DQO C;  2KD0 A;  2LUE A;  2WXK A;  4PS8 A;  1T0Q C;  2KWD A;  1STE A;  5DPS A;  3ML9 A;  1ZP0 B;  2JZ3 B;  2WHI A;  1F0Z A;  2V1Y A;  2BPS A;  4C00 A;  3EFC A;  4ASW C;  3GP7 A;  3P1M A;  1P7E A;  1N61 A;  1XLO A;  1J8C A;  3H8H A;  4KVG B;  4EE2 A;  4GDK A;  4GXB A;  1ZDX A;  2MCN B;  3RI7 C;  4K7U A;  3FAH A;  4JGH B;  2KDF B;  1OEY A;  4JQW C;  1L0Y B;  4J6I A;  2XK5 A;  4C7Y A;  4EEW A;  2W3S A;  2O6V A;  4HJK A;  2XEW A;  4A90 A;  4NAM A;  5IN7 A;  3QJZ A;  5CHW A;  4HVB A;  4XWW A;  1F77 A;  5EE3 A;  1KRH A;  3BVM A;  3U52 E;  1IGC A;  3VUX A;  2DBY A;  4II2 B;  3EC8 A;  3NJT A;  2IGD A;  3BWU D;  2N9K A;  4TSS A;  2CHW A;  1FXT B;  5D7G A;  1JML A;  2BWF A;  4M0W B;  3DQV A;  2W82 A;  5IO9 A;  4MEM A;  1N6Z A;  4ZRI A;  3AU4 A;  3DHG C;  1JWS D;  3I9V 1;  4K3B A;  2LZ6 A;  4FJY A;  2LGS A;  1C79 A;  4W9E A;  1C3T A;  3TUO A;  2JU6 X;  2G9H D;  1TJE A;  3M63 B;  4DBG A;  3WCQ A;  4I6P A;  1C9F A;  4HXD A;  2N1V A;  4HRS A;  2FIF A;  3U7Z A;  4US9 A;  5DCN A;  4RCO A;  5MPO A;  3OG5 A;  1FIQ A;  3ZKJ C;  4YT0 B;  3MJ5 A;  3NY5 A;  1SJE D;  2FID A;  4ZRQ A;  4XWT A;  3H7P B;  1EWY C;  3PHW B;  2J0M A;  2KXJ A;  2BF8 B;  3ZTC A;  2DX5 B;  4PYU A;  1WJU A;  3QIJ A;  1YN3 A;  4FUL A;  2G3Q B;  3VR8 B;  2K9X A;  3L17 A;  2RPV A;  2K6Q A;  3VDZ A;  4NAW B;  3DHH C;  1I35 A;  1TYG B;  1FNU A;  2WXG A;  4RGO S;  3TMP B;  3AUL A;  4NJ7 A;  1FXI A;  1PFD A;  3GB1 A;  2J4X A;  3PZ8 A;  1WXM A;  3ZLZ A;  1TBE A;  1KTK A;  3W9C B;  2INC C;  4JX1 C;  4IWO A;  3IXS A;  4X57 B;  3TIX A;  2HD5 B;  3ZQ4 A;  1E8X A;  4OVU A;  2BS2 B;  4HPP A;  3SD5 A;  2L8J A;  4RF1 A;  1PQS A;  2MBE A;  3ZNI D;  2L83 A;  1WE6 A;  1WM2 A;  5FR6 A;  2GB1 A;  4W9J A;  4E3C A;  4FA6 A;  3GOE A;  2GMI C;  2H89 B;  3NG0 A;  3A4S C;  3L54 A;  3VRA B;  5C1Z A;  4NQK E;  3I57 A;  2ZCB A;  2BYT A;  3PPA A;  1U4A A;  3VH4 B;  1IUE A;  3ZNG C;  4GSW A;  1EWC A;  1PGX A;  4EKU A;  1V86 A;  4BFR A;  2KTR A;  2L00 B;  1DOY A;  4HRO A;  2MW5 A;  2LRU A;  4CYE A;  4KX6 B;  1S1Q B;  3RZF A;  3H9D A;  4XDC A;  1A70 A;  2DZM A;  2MRP A;  4RF0 A;  2R2Q A;  5HKH A;  5D3I B;  3SFE B;  1ZOY B;  2G45 B;  1K50 A;  2YLM A;  4K7W A;  4WQM A;  3I3T B;  3N9Y C;  3RNC C;  1F52 A;  3RYT A;  3R2T A;  4AJW A;  3IG3 A;  4OZB A;  1ESF A;  4PK1 A;  1A5R A;  2M56 B;  4XDD A; 
#chains in the Genus database with same CATH homology
 1G6J A;  3ML8 A;  4MJS B;  4IW0 A;  2C9W B;  2KZR A;  2GOW A;  1TGZ B;  2K8H A;  4TKN A;  4URK A;  4EOY A;  2RD0 A;  2LGD A;  1H8C A;  2KQS A;  4IG7 B;  2YVC A;  5C23 A;  1OGW A;  1K8R B;  1E8Z A;  2Y5B B;  2HTH A;  4FN2 A;  4KZ0 A;  1NDD A;  2KFK B;  3Q3F A;  3WIM A;  1XD3 B;  4B6W A;  1CMX B;  3ZIM A;  4MGI E;  1P98 A;  3DBH I;  2ZZP B;  2A4Z A;  2ZNV C;  4PS3 A;  5AZF A;  3X0W A;  3PZD A;  3PT2 B;  1V2Y A;  1WI0 A;  2PEA A;  2G4S A;  3N3K B;  2IYD B;  3HHM A;  4I6L B;  2DEN B;  2N4F A;  2IO0 B;  3ZW3 A;  3AU5 A;  1V6E A;  4WWO A;  2C7M B;  2J0J A;  5D94 A;  3V6C B;  2Z59 B;  4B9K A;  1WF9 A;  3A9J A;  3ENE A;  4CHK A;  3DBL I;  4P7I A;  2KTR B;  1GJZ A;  4G0N B;  3VXW A;  2DZI A;  2NVU I;  4GU2 A;  5DPT A;  3VTW A;  1XQQ A;  4EFO A;  3CF6 E;  3UIP B;  3MJW A;  2BKR B;  4MM3 A;  3PS6 A;  4MSQ B;  4W9L A;  3QK0 A;  2K8B A;  4BBN F;  1SE9 A;  1E5W A;  1WRD B;  2BYV E;  2OJR A;  1WE7 A;  3OLM D;  1V81 A;  4HLE A;  4BOS C;  3VHT C;  2LJ5 A;  5KHQ A;  3DDC B;  3VQI A;  4BBN C;  2KDB A;  2CHZ A;  2Z0D B;  3R66 C;  1I42 A;  2DYB A;  2L0F A;  4KDI C;  4LJP B;  1P1A A;  3DOW A;  2DZK A;  2RR9 A;  3ZDM C;  2A5U A;  2D2Q A;  1WGH A;  4DK5 A;  2KX3 A;  2MQJ A;  2GBN A;  5LXH A;  2KLC A;  3ZNZ B;  2D11 A;  4M8M A;  4KIK A;  4BKT A;  5LXI B;  2J0K A;  2NR2 A;  2JY6 A;  3B0A A;  4MGK E;  4RM8 A;  2GBR A;  3IVF A;  5AZG A;  3IHP C;  4W9I A;  1Z2M A;  3TJP A;  2ZPY A;  4WJQ A;  4PS7 A;  2D10 A;  3JSV A;  4AJY B;  3OJ3 A;  4IM3 A;  4B95 A;  5D2M B;  1E8W A;  3IBE A;  2R2O A;  2N7D A;  2D3G A;  3DVG Y;  3CSF A;  2JT4 B;  3MTN B;  1WXS A;  1GG3 A;  2EMS A;  2GBJ A;  3HM6 X;  2DHZ A;  3OAW A;  1WIA A;  2AL6 A;  3VFK A;  3U30 A;  1E90 A;  1YD8 U;  2C60 A;  2KC2 A;  2LI5 A;  2V4L A;  4N9F 4;  3MHS D;  4BKS A;  5E6P A;  1R4N I;  4EZJ A;  2KQ7 A;  4IUM B;  1NBF C;  2JXX A;  2PPH A;  4W9D A;  4FBJ B;  2CS4 A;  5GMV A;  2MLB A;  3A9K A;  4MEL A;  4JIO U;  4I6N B;  2EKE C;  4KDL B;  3O65 B;  4GMV A;  2D07 B;  3A9J B;  3KH0 A;  3KVF B;  2AL3 A;  2ZJD A;  2KN5 A;  3EEC A;  4NY0 A;  4DHJ D;  1KOT A;  3PV1 A;  4WWP A;  4JLC A;  2IZV B;  3BY4 B;  2K39 A;  4ZYN A;  2N7E A;  1ZW7 A;  2JF5 A;  1E8Y A;  5DPR A;  1L7Y A;  4DDG D;  1T0Y A;  1EO6 A;  2NBV B;  2WYQ A;  4W9C A;  4HK2 A;  4DHJ B;  2KC1 A;  3V6E B;  4E74 A;  2L7R A;  1P3Q U;  1M94 A;  2DZJ A;  2K8C A;  2KWC A;  2O2V A;  5G55 A;  4HPL B;  4FAD A;  1TZ1 A;  4NNJ B;  1X1M A;  2AYO B;  3L16 A;  3UQB A;  3R7R A;  4NAW A;  2CR5 A;  3ZDT A;  1J0G A;  1BT0 A;  3LDZ E;  3RUL A;  3WAP A;  3ZRF A;  1V80 A;  4W9K A;  2C7N B;  1H4R A;  2L3Z A;  3IFW B;  3WAL A;  4A3P A;  2KMA A;  3APD A;  4MGZ E;  4FJV B;  2MWS B;  3VVW B;  2KTF A;  1YIW A;  3T9L A;  1TTN A;  1Q5W B;  2M0X A;  4E71 A;  3A1Q A;  4KIK B;  3VH3 B;  3KUZ A;  1ZGU B;  1WGG A;  4XX5 A;  3PTF C;  3ZNH B;  1WFY A;  4BOZ B;  2L0T A;  5IA7 A;  3DBR I;  4A3O A;  2NPT B;  3QQ8 B;  3JSV B;  3UF8 A;  4TUU A;  5TR5 A;  1SGH A;  1IPG A;  4GIV A;  3UIO B;  2KOX A;  4JL9 A;  3W1S C;  5J18 A;  1NI2 A;  4KZC A;  1SIF A;  3PRM B;  3PGE A;  3L0W B;  4FLH A;  1QZE A;  2M1M A;  1UBI A;  1E7V A;  1WYW B;  4GN1 A;  1P9D U;  2GBM A;  3QWZ B;  4EZL A;  3TCA A;  4WAA A;  3D32 A;  3UQA A;  5AEK B;  3TL5 A;  2LVP A;  1EF1 A;  3CST A;  2BGF A;  3KYD D;  4IM0 A;  1YX5 B;  2I1J A;  2WX1 A;  1XT9 B;  4W9G A;  2CKH B;  5G2N A;  2REX A;  4HCP B;  4GOC A;  2L05 A;  3R7Q A;  2M4N A;  1WM3 A;  4A20 A;  4RMA A;  2FCQ A;  3B08 A;  3SHQ A;  3KUD B;  2FNJ B;  2ZCC A;  4ZDV A;  2KD0 A;  2KHW B;  2NBU A;  3A9K B;  2LUE A;  4KSK C;  4GDL A;  2LXC A;  4F8C B;  1WH3 A;  2HJ8 A;  4PS8 A;  3DVG X;  3EHV A;  4WJO A;  5BO4 B;  2KK8 A;  2MX2 A;  5DPS A;  2AWT A;  3HM3 A;  2DAF A;  2WWZ A;  4G3X B;  3DVN U;  4WQO B;  2JWZ A;  3ML9 A;  4IC7 B;  4W9H A;  3QHT A;  2JZ3 B;  2KFJ A;  4AWJ A;  1WXV A;  2PE9 A;  4MSM B;  3ZRC A;  2RPQ A;  2V1Y A;  4KV2 A;  2ZNV B;  2BPS A;  2FUH B;  4GB9 A;  2QHO A;  4ANU A;  4ASW C;  4HDO A;  2IY0 B;  4NQL B;  1IP9 A;  3UGB B;  2NCN A;  5CHV C;  4ANW A;  1C1Y B;  3APC A;  1VD2 A;  5JHA A;  1J8C A;  2IO1 B;  4KVG B;  2KDE B;  3S2A A;  3JYU A;  4GDK A;  4GXB A;  4WJN A;  2JUO A;  2MCN B;  2XBB C;  3VUW A;  3DPD A;  3L10 B;  3PLV A;  3N32 A;  4K7U A;  4ANX A;  1V5T A;  1V9J A;  4TV3 A;  2N9X A;  4JGH B;  2BWE S;  2JPH A;  2KDF B;  2DYO A;  1OEY A;  5AZH A;  1UH6 A;  4JQW C;  4J6I A;  2XK5 A;  2C7H A;  2LRW A;  2C5L C;  2WDT B;  3LJ3 A;  2FAZ A;  2UYZ B;  1LXD A;  1Z5S B;  2EMT A;  4EEW A;  4W9F A;  1WX8 A;  2MBO A;  2O6V A;  3PSE B;  4HJK A;  2XEW A;  3RT3 B;  4GGQ A;  4II3 B;  2LVO A;  4TQ0 A;  3QA8 A;  3QJZ A;  5CHW A;  4HVB A;  2CU1 A;  2WX0 A;  5J17 A;  1GC6 A;  1J19 A;  4K7S A;  3H7P A;  1YJ1 A;  1HE8 A;  2JRH A;  4FHK A;  1WJ4 A;  2DAJ A;  3VUX A;  1LFD A;  2KFK A;  5E6N A;  2IY1 B;  1JRU A;  3AI5 A;  3X23 A;  4II2 B;  1WMH A;  2N9P C;  2LD9 A;  3B1L X;  3EC8 A;  5D6J B;  5KHO A;  2HE7 A;  3H6N A;  2KO3 A;  4GDL B;  1WX7 A;  2PE6 B;  2RSU A;  3W1S A;  2CHW A;  5CX3 A;  5IAA C;  2KJR A;  2GBK A;  3M95 A;  1FXT B;  2V3S A;  3ZTD A;  1KLV A;  4ANV A;  5D7G A;  4M0W B;  2BWF A;  4IWP A;  2L76 A;  3DQV A;  3KYC D;  3KUC B;  3BIN A;  4DHZ B;  2KWU B;  4MEM A;  3QAR A;  3V61 A;  4ZRI A;  2LGY A;  2KNB A;  4F1S A;  3AU4 A;  1AAR A;  3NHE B;  4FJZ A;  1UEL A;  2MBB B;  1OEY J;  3Q3J A;  2BYE A;  2K1F A;  2NBW B;  1UD7 A;  1WR1 A;  2LZ6 A;  2JZZ A;  3C0R B;  5JZE B;  3NZU A;  4LCD E;  4FJY A;  3HK0 A;  4MGY E;  1Q1O A;  2W9N A;  3V62 A;  2CHX A;  3TBL D;  4MH0 E;  3P2B A;  1WJN A;  2ZVO A;  4W9E A;  4GDK B;  2LXA A;  1C3T A;  3T8M A;  2KKC A;  1OTR B;  3A33 B;  1RLF A;  1R4M I;  3A4R A;  3M63 B;  5CTR C;  3OJ4 B;  4I6P A;  1OQY A;  3RCZ A;  4DBG A;  4DXA B;  4HXD A;  3DVN V;  3ZO5 B;  2N1V A;  2I1K A;  1WZ0 A;  2OOB B;  2XK5 B;  4NJ6 A;  5DPW A;  2FIF A;  3W1Y A;  4G11 A;  3ECI A;  1MG8 A;  5DCN A;  4BKS D;  2AEH A;  1WX9 A;  2KAN A;  1ISN A;  4G50 A;  4AUQ C;  2MP2 A;  2O6V B;  4RM9 A;  3M62 B;  4K81 A;  3M3J A;  2FCS A;  1GC7 A;  3DCG A;  3ZKJ C;  3AXC A;  4TQ1 A;  3GZN I;  3N30 A;  3NY5 A;  1YQB A;  2G4D B;  2K6D B;  5L95 C;  3QCA A;  4MDK E;  2UWQ A;  2FID A;  2MA9 B;  4EZK A;  2ZPN A;  1YX6 B;  2PJH A;  5EDS A;  5JH5 C;  3VAW A;  3H7P B;  4IWQ A;  4AP4 C;  4ZRK A;  1ZKH A;  3PHW B;  3RZW C;  4EUT A;  2J0M A;  1WMH B;  2LAS A;  1Y8R C;  2MSE D;  3CMM B;  4HPM B;  2KXJ A;  1Q0W B;  5CHF A;  2MBH A;  3U8Z A;  3UIN B;  2BF8 B;  4BVU C;  2K25 A;  3QX1 A;  4M8N A;  3ZTC A;  2DX5 B;  1WJ6 A;  4AOF A;  2KX0 A;  4PYU A;  3RUI B;  2N1W A;  4LDT D;  3JW0 X;  4K1R B;  4WWN A;  4DDI D;  5J2R A;  4DHZ E;  1WJU A;  3QIJ A;  4FUL A;  2G3Q B;  3SU8 X;  4YL8 A;  3H1U A;  2O2V B;  4LDT B;  3L17 A;  2K6Q A;  3VDZ A;  3APF A;  3U7D A;  4NAW B;  1WZ3 A;  2N9E B;  4CO7 A;  2KDI A;  2KLG A;  1I35 A;  2KVR A;  4ICU A;  3PVL A;  2FCM A;  3VUY A;  3WA0 A;  3WAM A;  2ASQ A;  4BKG A;  3K9O B;  3AUL A;  3TMP B;  1UZX B;  3A1Q B;  3DBS A;  3QAQ A;  4IM2 A;  4NJ7 A;  4HCN B;  2FCN A;  3ZUN A;  1F9J A;  1WXM A;  2KWV B;  3NOB A;  4PYZ A;  1LQB A;  3ZLZ A;  5LLI A;  2KMC A;  1TBE A;  4HDQ A;  4IWO A;  3NS8 A;  4MJS A;  1RFA A;  4X57 B;  2HD5 B;  3TIX A;  1E8X A;  4OVU A;  3VTV A;  2MP2 B;  2Z0E B;  1WGD A;  3H7S A;  3ALB A;  1L2N A;  3SD5 A;  2L8J A;  1PQS A;  4F7Z A;  1EUV B;  2NPT A;  2JVC A;  3PRZ A;  2LVQ A;  3WAN A;  2IBI B;  1WGY A;  2MBE A;  1IYF A;  2JRI B;  1V5O A;  2J7Q B;  5E6O A;  4XC2 A;  3ZNI D;  1WE6 A;  2BYF A;  4OVV A;  2MBQ A;  3L13 A;  1WM2 A;  5FR6 A;  4W9J A;  4E3C A;  4FA6 A;  5L83 A;  3GOE A;  2GMI C;  2LGX A;  1UBQ A;  3A4S C;  3L54 A;  5C1Z A;  4NQK E;  3R3M A;  2NS5 A;  4XZ4 A;  1WXA A;  2ZCB A;  1E7U A;  3EFU A;  1U4A A;  3PPA A;  4HWI B;  3VH4 B;  5JHB A;  1KJT A;  1RRB A;  3ZNG C;  2M17 A;  4GSW A;  3L08 A;  4KSL C;  1V86 A;  4BFR A;  2KTR A;  2B3A A;  2KJH B;  3JVZ X;  4EKU A;  2L00 B;  3NZS A;  2RGF A;  2MW5 A;  2LRU A;  4CYE A;  3PRP B;  1V49 A;  1S1Q B;  3QC8 B;  3ONS A;  3H9D A;  3RZF A;  2KJ6 A;  1S3S G;  3V60 A;  2DZM A;  2MRP A;  3PLU A;  2VRR B;  2IO3 B;  1VCB A;  2R2Q A;  1LM8 B;  4LJO B;  3HIZ A;  3K9P B;  4FHJ A;  4WJP A;  3RD2 A;  3VTU A;  5HKH A;  2M8S A;  1WY8 A;  4ZRJ A;  3WAO A;  2G45 B;  2LWP A;  2YLM A;  4K7W A;  1KM7 A;  2ZEQ A;  1D3Z A;  1UGM A;  3I3T B;  1RAX A;  3SDL C;  3RYT A;  2O6V D;  2ZVN A;  2BKF A;  1GNU A;  4DWF A;  1P0R A;  3ZVV A;  3PHX B;  3KW5 B;  2DYM A;  4AJW A;  3IG3 A;  1WGR A;  4NPN A;  1A5R A;  4ICV A;  1EF5 A;  2IO2 B;  1WR6 E;  3PRE A;  1GUA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...