2KMAA

Nmr structure of the f0f1 double domain (residues 1-202) of the talin ferm domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
178
structure length
178
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Talin 1
total genus 34
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA02
3SU8X 4OVVA 2D07B 4GN1A 4BOZB 1C3TA 2KANA 3LJ3A 4W9GA 3U8ZA 3HHMA 3UQBA 1SE9A 3MTNB 4M8NA 2AL6A 2IO2B 3VDZA 3W1SA 1CMXB 2K1FA 1GC7A 2PJHA 5AEKB 4TQ1A 2GBRA 4A20A 1P0RA 4A3OA 2R2QA 1WGGA 2ZPNA 1J8CA 1OEYJ 4WJQA 3DBRI 1V2YA 4RM8A 1I35A 1KLVA 2KTRB 5CHWA 4G11A 3KUZA 4LJPB 3KH0A 2GBMA 2YLMA 2N1WA 3L0WB 1WGDA 4IWQA 4NPNA 3UIOB 1WM2A 3DBSA 3H7PB 4ZYNA 4PS8A 4HCNB 4PS7A 1Q0WB 3EHVA 4I6NB 1TZ1A 3VVWB 2LRWA 4GDLB 3OAWA 2C60A 4RM9A 4TUUA 3QQ8B 4JGHB 2G4SA 3KUDB 1NI2A 2CKHB 4FJZA 4XC2A 2KFJA 3DVNU 4KDLB 3ZTDA 5D7GA 2K8HA 2M17A 2KC2A 5C23A 2C9WB 1VCBA 4AWJA 1V80A 4W9CA 1L2NA 2CHXA 4DHZE 1VD2A 4W9KA 4DWFA 1YX6B 3NHEB 3PRMB 3ZW3A 4CYEA 3GZNI 3PHWB 3UQAA 3IFWB 1ZKHA 3KVFB 1UH6A 2NR2A 4W9DA 2W9NA 1GJZA 2ZZPB 5CTRC 4P7IA 2NPTA 3ZO5B 2L7RA 2O6VD 1E5WA 3R3MA 3DCGA 1P98A 1F9JA 3NS8A 2MCNB 4HLEA 5GMVA 2HE7A 4F8CB 2KKCA 2ZCCA 2J0JA 1V9JA 2FCMA 4I6LB 2IO1B 2K8BA 4DHZB 2JXXA 2JF5A 1OQYA 2KFKA 2KOXA 5G2NA 4ICVA 3JW0X 2L76A 2LGYA 2KN5A 4JQWC 2DYOA 3JYUA 4X57B 3V61A 3R7RA 2IBIB 3KYCD 3H7PA 2AEHA 4G3XB 4IG7B 2FCSA 3ONSA 3JSVB 3ZVVA 4FN2A 3EFUA 1E7UA 3PSEB 2LVQA 5BO4B 1V49A 3BINA 2DZKA 2MP2B 1UELA 3K9OB 4IM0A 3R66C 2J0MA 5C1ZA 3VUWA 2N7EA 1WE7A 3OJ3A 2RSUA 4II3B 4II2B 2BYFA 4WAAA 4K7UA 1E90A 4HWIB 5E6OA 4GSWA 3ML8A 5IAAC 1WYWB 5CHFA 5CX3A 5D6JB 3VQIA 4HPMB 2MLBA 2BPSA 4URKA 2FCQA 2RPQA 2MBEA 1UBQA 4NNJB 1IP9A 2UYZB 2KD0A 1E8WA 2LXCA 4K7WA 4KSKC 2KWVB 4MGZE 4BVUC 1J0GA 3L17A 1PQSA 2K25A 2BKRB 1G6JA 4NY0A 5DPRA 3PHXB 2BGFA 2DZJA 3T9LA 4JL9A 4K81A 4MJSA 3VTUA 1XQQA 2M0XA 4DBGA 2KMCA 4FADA 3QCAA 4GU2A 2V1YA 5DPSA 2JUOA 3IVFA 3RUIB 3VAWA 1WY8A 1J19A 2KLGA 2MWSB 3S2AA 1TGZB 2MBOA 2PE6B 2CHWA 2I1KA 3ZIMA 4LCDE 1WXVA 2L05A 3AU5A 2IY0B 3SDLC 3UINB 4M0WB 3UGBB 5KHQA 5KHOA 4KZCA 4FJVB 4MSQB 2JY6A 1YJ1A 2JRIB 2KDFB 3CSFA 2K6DB 1S1QB 5CHVC 4J6IA 5JHBA 3ENEA 4WWOA 5L83A 2KDBA 4ASWC 3SD5A 4ANXA 3ZKJC 2K39A 3A4RA 2D2QA 1UGMA 2O2VB 1EUVB 4DDID 1WX8A 3DVNV 2Z0DB 2YVCA 2NPTB 4W9IA 1H4RA 4TQ0A 4W9LA 3A1QA 2IYDB 3ML9A 3K9PB 4GMVA 1L7YA 2O6VB 2MRPA 2MX2A 3APDA 4TV3A 5G55A 2KC1A 4HXDA 1V5OA 2G4DB 4LDTD 3ZNZB 2IO3B 2NS5A 1WX7A 2FCNA 3AXCA 4NAWB 3HK0A 3U7DA 5D94A 2ZVOA 3H1UA 1IYFA 1WZ3A 4GGQA 2KX3A 3OJ4B 5DPTA 1Z2MA 2Y5BB 3WAMA 5J17A 4K1RB 5IA7A 1ZW7A 2WYQA 3DBLI 4W9HA 2M4NA 2KTFA 2JRHA 1WI0A 2N1VA 2KMAA 2AWTA 3KW5B 2FNJB 2EMTA 1MG8A 1FXTB 1TBEA 2RD0A 2ZEQA 1EF1A 3R7QA 5J18A 3VXWA 2PE9A 4EEWA 2O6VA 1XD3B 2A5UA 4B9KA 5L95C 5D2MB 2XEWA 2KO3A 4F1SA 1GC6A 1AARA 3CMMB 1UZXB 3A9KA 4KIKA 2KZRA 2KLCA 2BKFA 2GOWA 3KYDD 2D10A 3PV1A 2A4ZA 4GOCA 4TKNA 1ISNA 2O2VA 1WR1A 2KNBA 4WQOB 4IM3A 4HVBA 2FIFA 2NBUA 4MSMB 2FAZA 2NCNA 5E6NA 2DHZA 3DDCB 2ZCBA 3ECIA 3WAPA 1S3SG 1KM7A 3PRPB 1U4AA 1KJTA 2KJRA 2N4FA 2HTHA 2WX0A 2VRRB 3PTFC 3B0AA 1WX9A 1GNUA 1K8RB 4WWNA 3MJWA 2Z0EB 1P3QU 2C7HA 2LVPA 1Y8RC 1E7VA 2MBQA 3Q3FA 5LXIB 1BT0A 3M3JA 1LQBA 3TCAA 3P2BA 2DYBA 1OTRB 3ZRCA 4IC7B 4ZRKA 2DAFA 4PYZA 1V5TA 2JZZA 3PREA 4EFOA 5EDSA 4MM3A 2EKEC 2HD5B 2M8SA 3ALBA 3DOWA 2KVRA 1NBFC 1ZGUB 1WGRA 4WWPA 1UD7A 4A3PA 2KJHB 4G0NB 3QX1A 4DHJD 3ZUNA 2MQJA 4WJPA 2ZVNA 2K6QA 4MH0E 3PLUA 3RULA 2PEAA 2N9PC 2LRUA 3ZNHB 3N3KB 1WRDB 3A1QB 3QJZA 2JWZA 4RMAA 4EKUA 1SGHA 1JRUA 4MGIE 4IUMB 3QK0A 2CU1A 3EC8A 2LASA 2WDTB 3DQVA 5J2RA 4EOYA 4FBJB 4NAWA 4GXBA 2KQSA 2LD9A 3A9JB 1V86A 2UWQA 1WXSA 4IM2A 4LJOB 2KDIA 3B08A 4PS3A 2JVCA 2QHOA 3B1LX 2LGDA 5DPWA 3A33B 4BBNF 2OOBB 4KZ0A 3APFA 4BOSC 4NJ6A 2DENB 2L0TA 4LDTB 4JIOU 2IO0B 3WIMA 2N9XA 1WR6E 2D11A 2EMSA 4ANVA 5AZFA 3IG3A 4NQKE 2ZNVC 1WIAA 4IW0A 3DVGX 3WAOA 3NOBA 3DBHI 3JVZX 3L10B 4KSLC 4NJ7A 2GBJA 4FHKA 2KDEB 4GDKA 3AI5A 2MSED 4MELA 5LLIA 3QA8A 3RT3B 2LUEA 4HPLB 1WH3A 3HIZA 3PPAA 4YL8A 3RCZA 3VHTC 2LWPA 2WX1A 3U30A 3NZSA 4GIVA 3Q3JA 4I6PA 4MDKE 2BWES 3EECA 4F7ZA 2OJRA 1WM3A 3H7SA 4HK2A 2K8CA 4IWPA 3VH3B 4BFRA 4FULA 4FJYA 3UF8A 2DX5B 3LDZE 3DPDA 4ANUA 2I1JA 4GDKB 3TIXA 3PLVA 4MEMA 2N9EB 1GG3A 3T8MA 2GMIC 3WALA 1I42A 1YIWA 2R2OA 3MHSD 3V6CB 3L54A 1LFDA 2DAJA 3HM6X 3OLMD 2ASQA 1YX5B 1RRBA 3H9DA 2AL3A 3VUXA 2GBKA 2JZ3B 2IY1B 1WFYA 4KDIC 1GUAB 2CR5A 4FLHA 2BF8B 3ZNGC 1OGWA 3PS6A 1H8CA 4XX5A 1WE6A 2L8JA 1C1YB 2LXAA 1E8ZA 1RLFA 2NVUI 1HE8A 4KVGB 3VFKA 5AZHA 3VH4B 1SIFA 4DXAB 1WGYA 5E6PA 1E8YA 1Q1OA 2KFKB 2L00B 3PZDA 2ZNVB 3N32A 4MGKE 4ZRJA 4EZJA 1LM8B 2XK5B 3RZFA 2NBVB 2WWZA 5HKHA 4B95A 1LXDA 2BWFA 4ZRIA 3SHQA 3ZDMC 5FR6A 3L08A 1EO6A 4DK5A 3PGEA 4W9FA 4HJKA 5DCNA 2MP2A 1R4NI 3V6EB 3X23A 2LZ6A 4JLCA 4B6WA 4DDGD 3QWZB 4K7SA 1OEYA 3VTWA 3ZLZA 1WJ4A 1E8XA 2G3QB 2ZJDA 2N7DA 3M62B 4FHJA 4E74A 1WXMA 3ZNID 5TR5A 4BKTA 2C5LC 2MBBB 2Z59B 4WJNA 3ZRFA 4M8MA 3O65B 1P1AA 2FUHB 3IHPC 2XBBC 3M95A 5JH5C 3W1YA 3WANA 3L13A 4AOFA 3DVGY 4AUQC 2RR9A 2FIDA 4GB9A 2D3GA 2C7MB 2KHWB 3VTVA 1WMHA 1P9DU 1WZ0A 2KX0A 4GDLA 2MBHA 2RGFA 3D32A 2CS4A 1V81A 3TMPB 2M1MA 2KTRA 3C0RB 3QC8B 2NBWB 3BY4B 2HJ8A 1RFAA 4MJSB 4HDOA 1T0YA 1YQBA 1IPGA 2GBNA 3APCA 2JT4B 4G50A 3A9KB 2KWUB 1Z5SB 2PPHA 3N30A 2LVOA 4FA6A 3WA0A 4E71A 5JZEB 4DHJB 1WMHB 3ZDTA 3HM3A 3TJPA 5AZGA 2REXA 1WF9A 4CO7A 1WJ6A 3AU4A 3QAQA 5JHAA 3PVLA 1Q5WB 2KJ6A 2LI5A 3CF6E 4BKSA 2L3ZA 4OVUA 1R4MI 4AJYB 1A5RA 3CSTA 1WXAA 1QZEA 2BYEA 3V62A 1RAXA 3TL5A 1TTNA 3RZWC 1XT9B 4EZLA 4N9F4 3W1SC 1NDDA 2BYVE 4HDQA 1WJNA 3PRZA 2DYMA 2ZPYA 3JSVA 3QARA 5LXHA 2KWCA 3RD2A 3AULA 3I3TB 2J7QB 2G45B 2XK5A 1UBIA 3H6NA 2CHZA 3A4SC 4KIKB 1WJUA 3NZUA 4HCPB 3L16A 1YD8U 4AP4C 4BKSD 4KV2A 2MA9B 2LGXA 2J0KA 2AYOB 4EZKA 4WJOA 2DZMA 2KQ7A 2MW5A 4ICUA 1EF5A 3M63B 4ANWA 2DZIA 3GOEA 3IBEA 4MGYE 3ZTCA 4E3CA 2JPHA 2KK8A 3QHTA 2B3AA 4W9JA 3QIJA 1KOTA 4BBNC 4IWOA 4EUTA 1X1MA 1D3ZA 4AJWA 2V4LA 2C7NB 1M94A 2L0FA 1WGHA 3RYTA 3NY5A 2LJ5A 4PYUA 4W9EA 3PT2B 3X0WA 4BKGA 3UIPB 2IZVB 2V3SA 3A9JA 3TBLD 3V60A 4CHKA 2KXJA 4NQLB 4XZ4A 3KUCB 4ZDVA 3VUYA 1V6EA
chains in the Genus database with same CATH superfamily
1HZ5A 1C3TA 4W9GA 3U8ZA 2MHJA 3Q14C 4M8NA 1MG4A 1TS4A 4BAXA 5IOIA 4A20A 1RYJA 2JU6X 2ONQA 4PK1A 3PZ7A 3TUOA 4WJQA 1I35A 4RM8A 2KTRB 3KUZA 1TS3A 1FCLA 2YLMA 1QT9A 1VRAB 3L0WB 4NPNA 3UIOB 1K53A 4PS8A 5C2TB 4I6NB 4A9AA 1TZ1A 3VVWB 2FUG1 4JGHB 2RPVA 2K5PA 2CKHB 4FJZA 4KDLB 4AQ7A 5D7GA 2M17A 1L2NA 4W9CA 2CHXA 4W9KA 3NHEB 3PRMB 2MJEA 3GZNI 3UQAA 2NTTA 2WGSA 3KVFB 1UH6A 2NR2A 4W9DA 5CTRC 4P7IA 3R3MA 1P98A 2MCNB 2HE7A 1ZPSA 4US9A 2FCMA 2IO1B 2JXXA 1DOYA 4XWTA 1OQYA 1UWXA 5G2NA 4A90A 1C78A 2BB5A 2J42A 1JWAD 1TJEA 3MHZA 1VDVA 3KYCD 2B76B 3LYYA 2WXLA 3ZVVA 4REZA 1I4PA 3B9JA 3SEBA 1ZP0B 2LVQA 3BVMA 5BO4B 1VZ7A 1TY0A 4LLGM 3SFDB 1D5XC 2JWUA 2EELA 3NJTA 2RSUA 2BYFA 3AEFB 1E90A 5E6OA 4ZHPA 3ETRA 3VQIA 4HPMB 2RPQA 4KGRA 1MFWA 3BVGA 2K25A 2BKRB 1ZXIA 4WWMA 3T3NA 3PHXB 4JL9A 4IKGA 3VTUA 1QKZA 2KMCA 4FADA 1EWYC 4IOIE 1WSPA 2MWSB 5FK9C 4B0EA 3ZIMA 5EE3A 2L05A 3U7ZA 3DBLB 2IY0B 3SDLC 1YJIA 4M0WB 5HHDG 2JY6A 1J7CA 5CHVC 2JX5A 5BYQA 5JHBA 4WWOA 5L83A 2IGGA 4IDIA 4ASWC 3SD5A 1WX8A 2Z0DB 3EA6A 4C7YA 4TQ0A 4W9LA 5FR3A 3ML9A 3K9PB 4GMVA 2H88B 1V5OA 4LDTD 3U7DA 3AXCA 5D94A 2DWQA 3H1UA 3AE9B 2KX3A 5DPTA 3VRBB 5J17A 3AEEB 2JRHA 2N1VA 1QOGA 2AWTA 4YSYB 2AX5A 3DBRB 3R7QA 1FXTB 2ZEQA 5J18A 1ZUD2 3I57A 4B9KA 5L95C 1NYRA 5D2MB 3RNEC 1FPYA 1UZXB 2GOWA 3PV1A 2V3PA 2WP9B 2IPKD 3V3XA 1WR1A 3Q3NC 4MSMB 2PKOA 1PGBA 4YTNB 3ECIA 2N4FA 3P1MA 3PTFC 4B0MA 3RMKC 2Z0EB 1V8CA 1Y8RC 1PDXA 1SJED 3PREA 5EDSA 4MM3A 3CIRB 3ALBA 3I63C 4ARIA 1ZGUB 1WGRA 2INNE 2KJHB 2BW2A 4DHJD 2W54A 1FD6A 4RGMA 2N9PC 3FKYA 4RMAA 4EKUA 1JRUA 1PYWD 4KKJA 5T8IA 2CU1A 4OW0A 3EC8A 4GXBA 1V86A 5IO9A 2KDIA 5C3JB 3AE3B 2JVCA 5BYRA 3O13A 4ZYSA 5DPWA 3A33B 2JQRB 4BOSC 2VH2A 4NJ6A 4LK0M 4EE2A 3WIMA 4JPSA 2D11A 3WAOA 4M01A 3MC0B 4DDID 4MELA 3AI5A 2MSED 3RT3B 4HPLB 2DNFA 4YL8A 2RMMA 2WX1A 3NZSA 3Q3JA 4MDKE 3EECA 3KLSX 1WXQA 4HK2A 3VH3B 3W9CB 4FJYA 2DX5B 2PLPA 4GDKB 1VZ6A 1GG3A 3T8MA 1I42A 3H9DA 1GAQB 5HFYA 2CR5A 1H8CA 3C19A 2WXKA 1C1YB 2N0SB 1E8ZA 3VFKA 3VH4B 1BUIC 4C4VA 1VLBA 1QF6A 3PZDA 2XK5B 3RZFA 3NVWA 2NBVB 4B95A 1LXDA 2BWFA 4ZRIA 3ZDMC 4DK5A 1EO6A 5EE0A 2DLBA 3PGEA 1L6UA 4HJKA 5DCNA 5AUIA 1R4NI 3DBHB 1QOBA 1E8XA 2G3QB 4E74A 2K0PA 4FHJA 1SJHD 2KN4A 2MBBB 2Z59B 3I9V1 5EE9A 2RR9A 3GP7A 2D3GA 1C76A 1FNUA 1YN3A 2MBHA 3D32A 1XXGA 2M1MA 3C0RB 3BY4B 1RFAA 3NUHB 4HDOA 1T0YA 4G50A 4C00A 3N30A 2CU3A 4D2KA 2FE8A 2LVOA 4J3OD 5AUKA 4E71A 4DHJB 5BMIA 3HM3A 4CO7A 3QAQA 3AU4A 3N1YC 2V3NA 4K3CA 1WXAA 3W5UB 2INCC 1QZEA 4DXGA 3V62A 1RAXA 3TL5A 1TTNA 3RZWC 3W1SC 2DYMA 3AE5B 3EGRA 5LXHA 3AULA 3I3TB 2LJIA 4DQOC 2XK5A 1UBIA 2WQYB 3HRDD 2ZW0A 2CJOA 2AYOB 2K22A 1ZE3D 1AW7A 2MW5A 4MGYE 3GOEA 4P6VF 2JPHA 3QHTA 4BBNC 1X1MA 1D3ZA 4AJWA 1UWMA 1C4CA 3X0WA 4BKGA 1PGAA 2BT6A 2IZVB 4MH8A 3V60A 2KXJA 4NQLB 4XE0A 1KLGD 2PVGC 2PMVA 3AE1B 4P16A 1TKEA 2KDMA 4N58A 3BVZA 4BOZB 2KANA 3LJ3A 3UQBA 2PTLA 1SE9A 4HEA1 2K1FA 1GC7A 5AEKB 1QOFA 2GBRA 1P0RA 5IN7A 3NVZA 2R2QA 3DBRI 3NVVA 1UGJA 1T5XD 2N1WA 3BYTB 3MP9A 2MH7A 1N62A 1TS5A 3DBSA 4ZYNA 1YJJA 1Q0WB 3EHVA 1KH0A 2LRWA 3OAWA 4TUUA 1F0ZA 1P7EA 2WXPA 4ITKA 3RNFC 1NVID 2K8HA 3AEBB 5C23A 4C7ZA 1V80A 2KAJA 1YX6B 3ZW3A 2NMQA 4OVZA 1GB4A 1XLQA 2UU7A 1GJZA 3ZO5B 2O6VD 4HLEA 2JSVX 3DCGA 3NS8A 2ZCCA 2J0JA 1V9JA 1C79A 4I6LB 5E6JA 1WRIA 2KFKA 2WDVB 2KVZA 1ENFA 5FKAC 1R4NB 4X57B 3V61A 5MPOA 4KKIA 1AWDA 3JSVB 1BXTA 3EFUA 3PSEB 5GXGB 3RNGC 3PZ8A 5C1ZA 2N7EA 1WE7A 3OJ3A 2W55A 4II2B 3ML8A 5IAAC 1TYGB 4HJGE 3W5VB 2GRIA 2FCQA 2BQQA 1UBQA 4LNOA 1IP9A 2UYZB 1E8WA 4BVUC 4MGZE 3OG5A 2N9LA 2DZJA 3GE8C 3T9LA 1T6BX 4MJSA 4TSSA 3QCAA 1FRDA 3RUIB 1J19A 1T0QC 2WXOA 3TEWA 1FFUA 2PE6B 1WXVA 1FEHA 4K3BA 3UINB 1YN4A 2XN9C 4KZCA 3LXFA 2PVOD 3P4RB 1YJ1A 2JRIB 3CSFA 1S1QB 3R2IA 3ZJUA 1A70A 2KDBA 2ICIA 2K39A 3A4RA 2D2QA 2W82A 3Q69A 3BK2A 2YVCA 4W9IA 3U52E 5BMGA 2KACA 4O1NA 2MX2A 4TV3A 5G55A 1IGDA 2LGSA 2IO3B 2NS5A 1GPXA 1IYFA 1ZOYB 1WZ3A 1Z2MA 1QOAA 1ZW7A 1FRRA 1WI0A 1RFKA 4BZAA 2RDGA 1MG8A 2DBYA 2PE9A 4EEWA 1XD3B 2A5UA 4F1SA 2RDBC 1GC6A 4KIKA 1FNVA 1OQQA 4IM3A 2NCNA 4H2AA 4RGTA 4L23A 5E6NA 5D3DA 1KJTA 2WX0A 1EU4A 3L4PA 1GNUA 1K8RB 4WWNA 2C7HA 3Q3FA 2WHIA 3M3JA 3BIID 1DYQA 4PYZA 4KGSA 1IUEA 1E0ZA 2EKEC 2HD5B 4MACA 2M8SA 1D4BA 1L0YB 1NBFC 2D3BA 4A3PA 2MQJA 2ZVNA 3RULA 2LRUA 3ZNHB 3N3KB 3A1QB 3QJZA 1SGHA 5BYSA 3TSSA 3DQVA 5J2RA 4FBJB 2LD9A 3A9JB 5I4DA 4HKZE 2QHOA 2LGDA 2OOBB 1KFYB 5AZFA 3IG3A 2M0AA 3DBHI 3JVZX 3L10B 2GBJA 3KQ4A 2LUEA 1WH3A 1Y56A 3AE7B 1WGKA 3DHIC 2WXQA 4GIVA 5D3IB 4I6PA 4F7ZA 1ZXHA 1MVKA 1MHHE 2WXIA 4HROA 3LDZE 2I1JA 1QILA 2N9EB 2W3RA 1YIWA 5H92C 1N5WA 1YX5B 3VUXA 2LHEA 2LFIA 2JZ3B 3AN1A 2IY1B 1E9MA 3ZNGC 1K52A 4XX5A 1WE6A 2L8JA 1RLFA 4KVGB 1NENB 4DXAB 5E6PA 2L00B 2ZNVB 3N32A 4ZRJA 1LM8B 4W9FA 2WDRB 4C56C 4B6WA 2LZ6A 4JLCA 4DDGD 3AE4B 1OEYA 2J53A 2Q5WD 5TR5A 3VR9B 4BKTA 1YN5A 1I4QA 4QAYA 3O65B 1P1AA 3IT4B 3IHPC 2SAKA 3M95A 3P4PB 1MI0A 3ZYYX 4AUQC 4YXDB 2OJWA 2FIDA 1L6VA 1WMHA 1L0VB 4GDLA 4OZBA 3RNAC 2NBWB 2HJ8A 1KF6B 3ZGZA 1KTKA 1I4HA 5JZEB 4US8A 1WMHB 1ACCA 3ZDTA 2QMTA 3OWEB 4BKSA 2L3ZA 2V9HA 4OVUA 3DWMA 1A5RA 3N20C 3ABVB 3TEYA 1ZDVA 4HDQA 4WH4A 3RD2A 1NI3A 3FILA 1FM0D 2KMMA 1NYQA 3BK1A 4WURA 4M02A 4KIKB 4HCPB 3L16A 2INPE 4KV2A 2J0KA 4EZKA 1EF5A 2JXTA 1HTQA 4ANWA 1KLUD 1SIJA 1YNTE 1TKYA 4E3CA 2C7NB 2WU2B 3N1XC 1V1PB 4W9EA 3NY5A 3RYTA 3PT2B 1F1HA 3A9JA 3TBLD 2WU5B 2I2YA 1TIFA 2WDQB 3VUYA 3QK0A 1V6EA 3SU8X 4GN1A 1B9RA 1V97A 3U4EG 4JWSC 3VDZA 3W1SA 2PJHA 1CQVA 3AB5A 1DOIA 1J8CA 1OEYJ 1V2YA 4LJPB 3KH0A 2GBMA 4IWQA 3H7PB 4PS7A 1I4XA 1E7PB 2M56B 2J4XA 4RM9A 3QQ8B 4RH6A 2G4SA 3AECB 4CQNA 1NI2A 2L1AA 2KFJA 2BB6A 3ZTDA 2MEKA 1AYFA 3PO0A 2KC2A 3ZXRA 3PHWB 3IFWB 1L0XB 1ZKHA 4OHJA 1STEA 3RNCC 5EE1A 1F9JA 2TSSA 5GMVA 4RFBA 3R8BA 2K8BA 4DHZB 3JW0X 3Q8EA 2KN5A 4JQWC 2DYOA 3JYUA 2IBIB 4USAA 4OZCA 2AEHA 4G3XB 1UUPA 4N6EB 1CK1A 2JYEA 2DZKA 1UELA 3P4SB 3K9OB 5HI1A 3R66C 2J0MA 3VUWA 4II3B 4K7UA 1SB3C 1WYWB 4KX6B 5CHFA 5CX3A 2MLBA 2BPSA 1JMLA 4URKA 2MBEA 3HVZA 2KD0A 2KWVB 1G6JA 4NY0A 5DPRA 4WQMA 1KRHA 1SEBD 2BGFA 4YTMB 1XQQA 2L32A 4GU2A 5DPSA 1HA5A 1SE2A 2MBOA 2CHWA 2I1KA 4LCDE 3U2SC 2LGIA 3UGBB 5KHQA 5KHOA 2V0GA 4AS1A 1LO5D 4HPPA 3ENEA 4C4VB 2E3TA 2WXRA 2QDFA 4YWGG 1EUVB 2ACZB 2YEPB 3DVNV 5H8YE 4YSXB 2IYDB 1L7YA 2O6VB 2G4DB 3ZNZB 2FCNA 3HK0A 2ZVOA 4LNKA 3OJ4B 2Y5BB 3MC8A 4K1RB 1J7BA 5IA7A 1JWSD 1YQ4B 4W9HA 2M4NA 2KTFA 2KMAA 3LB8C 3AEAB 3RN9C 2RD0A 3AE2B 3VXWA 2O6VA 2XEWA 3A9KA 3IAS1 2KZRA 2N7JA 3KYDD 2D10A 2IGHA 2JYTA 1FMAD 1ISNA 1HZ6A 2O2VA 2KNBA 3AV8A 4HVBA 2NBUA 3CWIA 4WAFA 2AQ3B 3DDCB 2ZCBA 1GB1A 2WXNA 3WAPA 1KM7A 3PRPB 1U4AA 1BMLC 3B0AA 1WX9A 2WLBA 3MJWA 1P3QU 2LVPA 2SEBD 5LXIB 3TCAA 4XWWA 2DYBA 3ZRCA 2WXJA 4ZRKA 2DAFA 1V5TA 4EFOA 4YSZB 4RF0A 3I5JC 1C77A 3SR6A 2BBCA 4G0NB 3ZUNA 3GE3C 4WJPA 4ZRPA 3PLUA 3IT6B 1IBXB 2PEAA 1FFVA 1P7FA 2JWZA 4OZAA 4MGIE 4IUMB 1F2RI 2LASA 1R4MB 4LJOB 4IM2A 3B08A 3B1LX 1GOZA 3AEGB 3APFA 2DENB 2G9HD 4JIOU 2IO0B 1WR6E 2EMSA 4ANVA 4NQKE 2ZNVC 1WIAA 4IW0A 3DVGX 3NOBA 4NJ7A 4KSLC 4FHKA 2KDEB 1QLBB 3BZDB 3B2GA 3RNBC 3Q8BA 1SF0A 4M0WA 3U30A 3T3OA 2BWES 2D3CA 1L5PA 3H7SA 2K8CA 4IWPA 4FULA 2WS3B 3DPDA 4ANUA 1N5XA 1SSNA 3TIXA 2LMCA 3PLVA 1HXYD 4MEMA 2Y5PA 3Q8CA 2CJNA 3WALA 2R2OA 3MHSD 2GLSA 1LFDA 2DAJA 3OLMD 2AL3A 2I38A 2GBKA 3ZQ4A 1WFYA 4HRSA 1QQRA 2X8XX 2D3AA 2VZKD 2BF8B 2VH1A 2H89B 3DWGC 3RI7C 2NVUI 4XDCA 5AZHA 3W2DA 1SIFA 1HQRD 1WGYA 1Q1OA 4EZJA 4TMAB 1V1OA 2QILA 5FR6A 4UDUC 1D5ZC 2MP2A 4RF1A 3X23A 3QWZB 3ZLZA 1WJ4A 3M62B 2ZJDA 1PFDA 2BS3B 4WJNA 3ZRFA 4M8MA 1JQ4A 2XBBC 5JH5C 3WANA 4AOFA 1JALA 2WNMA 1XLNA 4PT5A 2GB1A 2C7MB 2KHWB 1I4GA 1P9DU 2KX0A 1EWCA 2RGFA 3ZJTA 2CS4A 3TMPB 1NEKB 2KTRA 2AQ1B 3QC8B 4MJSB 1IPGA 2JT4B 2QC8A 1JW9D 1K51A 4L2YA 4S17A 2KWUB 2PPHA 2YEPF 4S0RA 3TJPA 1YOVB 5AZGA 2REXA 1WF9A 5JHAA 2BS4B 3Q8AA 2LI5A 3CF6E 1T0SC 3GB1A 1TKGA 1R4MI 4AJYB 3CSTA 1VR9A 2BYEA 3AH7A 3ZJVA 3BWUD 3DHHC 4N9F4 3RPFC 2BYVE 2RDHA 2ZPYA 3JSVA 3E56A 1TT5B 2KYWA 1PUTA 1TS2A 3A4SC 3NZUA 1C4AA 4AP4C 2MA9B 4MT5A 3AEDB 4RNAA 3VR8B 3P63A 2DZMA 3P42A 4ICUA 3IBEA 3ZTCA 3QIJA 4IWOA 4EUTA 3GZNB 2Y5CA 1M94A 2L0FA 2LJ5A 3HUIA 5LNK1 1EM7A 3UIPB 4NZLB 4CHKA 4LTUA 4XZ4A 4OVVA 2D07B 3HHMA 4HKQA 3MTNB 2AL6A 2IO2B 1CMXB 4TQ1A 4A3OA 1J7AA 1VZ8A 1WGGA 2ZPNA 2Y3AA 2KQ4X 1KLVA 1L4DB 5CHWA 4G11A 5BMHA 2JZPA 3UI3A 1WGDA 1WM2A 4HCNB 2WXFA 4GDLB 4NAMA 1JWBD 3SFEB 4YT0B 2C60A 3KUDB 4XC2A 3DVNU 3MJ5A 2C9WB 1VCBA 4AWJA 1HEZE 3AE8B 4DHZE 1VD2A 4A55A 4DWFA 2LUMA 4CYEA 3WCQA 1K50A 1IBXA 2W9NA 2ZZPB 2NPTA 2L7RA 1E5WA 3BYYB 2M19A 4F8CB 2KKCA 3HVDA 2JF5A 2KOXA 3MC9A 3Q8FA 4ICVA 3AE6B 2L76A 2LGYA 4JX1C 2N9KA 3H7PA 4IG7B 2FCSA 1MJDA 3ONSA 4FN2A 1E7UA 2E6XA 1C9FA 4XDDA 1V49A 3BINA 2MP2B 4ACFA 3Q3MC 4IM0A 1TY2A 1OFFA 2OEDA 1HTOA 4WAAA 4HWIB 4GSWA 3IXSA 5D6JB 1CZPA 2K9XA 3TEZA 4NNJB 4K7WA 2LXCA 4KSKC 5TSSA 1J0GA 2XNAC 3L17A 1JCKB 1PQSA 1RM6C 4LNNA 1AN8A 1FNWA 1D6EC 3C8YA 4K81A 2M0XA 4DBGA 2GI9A 1FO4A 2V1YA 2W3SA 2JUOA 3IVFA 4DXFA 3VAWA 1WY8A 2LHDA 2KLGA 1I7HA 3S2AA 1TGZB 3Q2AC 5JXVA 3N9YC 3AU5A 4N59A 4FJVB 1B1ZA 4MSQB 3RFZB 2KDFB 2K6DB 4J6IA 2VZKB 4ANXA 3ZKJC 2QIEB 4ZOHC 4FXCA 3Q3OC 1Q10A 1UGMA 2O2VB 1VJKA 2NPTB 1H4RA 1E6EB 4ARCA 3A1QA 1T3QA 2BYTA 2MRPA 3APDA 2KC1A 4HXDA 3NZ3A 1WX7A 4NAWB 4GGQA 4P1CC 3WAMA 1V1PA 2WYQA 3DBLI 4GLSC 3NG0A 1D5MC 3KW5B 2FNJB 2EMTA 1TBEA 2D5GA 2L52A 1EF1A 4Q2JA 2V4IB 3ZXVA 1JWUD 2KO3A 1F77A 1N6ZA 2G1EA 1AARA 3CMMB 5IKCM 2EKIA 3GS2A 1ET9A 2KLCA 2BKFA 2HDEA 3IAM1 2A4ZA 3AMZA 4GOCA 3KWLA 4TKNA 1SXTA 1JRPA 4WQOB 2FIFA 2INDC 2FAZA 3Q6BA 2DHZA 1S3SG 1IGCA 1JWMD 2KJRA 2HTHA 2VRRB 2MJ3A 2K3UA 1OQRA 1E7VA 2MBQA 1BT0A 1LQBA 3AM9A 3P2BA 3KWVA 2HTME 1OTRB 1XCTL 1JROA 4IC7B 2JZZA 4WIPA 4R3DA 3DOWA 2KVRA 4WWPA 1UD7A 5G5HA 1DOXA 1C4PA 3QX1A 1T0RC 1SBBB 2K6QA 4MH0E 1WRDB 1XLOA 5IP4D 1MHXA 4RGNA 3TEXA 2WDTB 4EOYA 4NAWA 2WXMA 2KQSA 2R61A 2UWQA 1WXSA 1SE4A 2X38A 4PS3A 4BBNF 4KZ0A 1RWSA 2BTEA 1WWTA 5HG2A 2L0TA 4LDTB 2N9XA 3NVYA 3EUB2 1FIQA 3R7RA 4GDKA 5LLIA 3QA8A 1WYGA 3HIZA 3PPAA 3RCZA 3VHTC 2LWPA 3VRAB 4RGOS 3EFCA 2OJRA 1WM3A 2QEJC 2ON8A 2ZW1A 4BFRA 3URYA 1XLPA 3UF8A 4XGAB 2GMIC 1N63A 2KT7A 3V6CB 3L54A 3HM6X 2ASQA 1RRBA 2MJDA 4KDIC 1GUAB 4A8XC 4FLHA 1XEEA 3B2FA 1OGWA 3PS6A 3R2TA 1EU3A 1I4RA 2LXAA 1F2RC 1HE8A 3FAHA 3H8HA 1DGJA 1E8YA 2KFKB 1YMHE 4MGKE 4XYCA 2WWZA 5HKHA 3SHQA 1FCCC 4LNFA 1XO3A 3L08A 2KWDA 1FXIA 4RCOA 3N1ZC 3V6EB 4KGTA 1N60A 2BS2B 4K7SA 3VTWA 3MFGA 2N7DA 1WXMA 3ZNID 2C5LC 1FXAA 4ZRQA 4JE3B 2FUHB 3NS1A 2FBWB 3W1YA 3L13A 3DVGY 2IDYA 1UNSA 4GB9A 4A6QA 4C80A 2IJ0A 3VTVA 1XCQL 1WZ0A 4L1BA 1CJEA 1XF5L 2J52A 1V81A 1YQBA 3APCA 2GBNA 1R7SA 1MPEA 2QJLA 2QSDA 2PIAA 3A9KB 2BVCA 2NTSA 1Z5SB 4FA6A 1ROEA 2Z8LA 3WA0A 4NJCA 1WJ6A 3PVLA 1Q5WB 2KJ6A 2IGDA 2OHFA 3P4QB 1ET6A 1ESFA 4EZLA 1XT9B 3NRZA 3FC4A 1NDDA 4P1BC 1WJNA 3PRZA 1M4VA 4JWUC 3QARA 1TZOA 2KWCA 4YTPB 1F52A 2J7QB 2HJ1A 2G45B 3V05A 3H6NA 1ZDXA 4ZHOA 2CHZA 1LGRA 1WJUA 4MM3B 1YD8U 4BKSD 2QCZA 2LGXA 1L4ZB 4WJOA 2KQ7A 3M63B 4LNIA 3FILB 1PGXA 2DZIA 2KK8A 1YQ3B 2B3AA 4W9JA 2WXGA 1KOTA 1UF0A 2L83A 2V4LA 3E9SA 1E10A 1N61A 4M00A 3J9CA 5G5GA 1WGHA 2LEKA 4PYUA 2PW9A 1SE3A 2V3SA 3DHGC 3KUCB 4ZDVA 2AQ2B 2WXHA
chains in the Genus database with same CATH topology
3SU8X 4OVVA 2D07B 4GN1A 4BOZB 1C3TA 2KANA 3LJ3A 4W9GA 3U8ZA 3HHMA 3UQBA 1SE9A 3MTNB 4M8NA 2AL6A 2IO2B 3VDZA 3W1SA 1CMXB 2K1FA 1GC7A 2PJHA 5AEKB 4TQ1A 2GBRA 4A20A 1P0RA 4A3OA 2R2QA 1WGGA 2ZPNA 1J8CA 1OEYJ 4WJQA 3DBRI 1V2YA 4RM8A 1I35A 1KLVA 2KTRB 5CHWA 4G11A 3KUZA 4LJPB 3KH0A 2GBMA 2YLMA 2N1WA 3L0WB 1WGDA 4IWQA 4NPNA 3UIOB 1WM2A 3DBSA 3H7PB 4ZYNA 4PS8A 4HCNB 4PS7A 1Q0WB 3EHVA 4I6NB 1TZ1A 3VVWB 2LRWA 4GDLB 3OAWA 2C60A 4RM9A 4TUUA 3QQ8B 4JGHB 2G4SA 3KUDB 1NI2A 2CKHB 4FJZA 4XC2A 2KFJA 3DVNU 4KDLB 3ZTDA 5D7GA 2K8HA 2M17A 2KC2A 5C23A 2C9WB 1VCBA 4AWJA 1V80A 4W9CA 1L2NA 2CHXA 4DHZE 1VD2A 4W9KA 4DWFA 1YX6B 3NHEB 3PRMB 3ZW3A 4CYEA 3GZNI 3PHWB 3UQAA 3IFWB 1ZKHA 3KVFB 1UH6A 2NR2A 4W9DA 2W9NA 1GJZA 2ZZPB 5CTRC 4P7IA 2NPTA 3ZO5B 2L7RA 2O6VD 1E5WA 3R3MA 3DCGA 1P98A 1F9JA 3NS8A 2MCNB 4HLEA 5GMVA 2HE7A 4F8CB 2KKCA 2ZCCA 2J0JA 1V9JA 2FCMA 4I6LB 2IO1B 2K8BA 4DHZB 2JXXA 2JF5A 1OQYA 2KFKA 2KOXA 5G2NA 4ICVA 3JW0X 2L76A 2LGYA 2KN5A 4JQWC 2DYOA 3JYUA 4X57B 3V61A 3R7RA 2IBIB 3KYCD 3H7PA 2AEHA 4G3XB 4IG7B 2FCSA 3ONSA 3JSVB 3ZVVA 4FN2A 3EFUA 1E7UA 3PSEB 2LVQA 5BO4B 1V49A 3BINA 2DZKA 2MP2B 1UELA 3K9OB 4IM0A 3R66C 2J0MA 5C1ZA 3VUWA 2N7EA 1WE7A 3OJ3A 2RSUA 4II3B 4II2B 2BYFA 4WAAA 4K7UA 1E90A 4HWIB 5E6OA 4GSWA 3ML8A 5IAAC 1WYWB 5CHFA 5CX3A 5D6JB 3VQIA 4HPMB 2MLBA 2BPSA 4URKA 2FCQA 2RPQA 2MBEA 1UBQA 4NNJB 1IP9A 2UYZB 2KD0A 1E8WA 2LXCA 4K7WA 4KSKC 2KWVB 4MGZE 4BVUC 1J0GA 3L17A 1PQSA 2K25A 2BKRB 1G6JA 4NY0A 5DPRA 3PHXB 2BGFA 2DZJA 3T9LA 4JL9A 4K81A 4MJSA 3VTUA 1XQQA 2M0XA 4DBGA 2KMCA 4FADA 3QCAA 4GU2A 2V1YA 5DPSA 2JUOA 3IVFA 3RUIB 3VAWA 1WY8A 1J19A 2KLGA 2MWSB 3S2AA 1TGZB 2MBOA 2PE6B 2CHWA 2I1KA 3ZIMA 4LCDE 1WXVA 2L05A 3AU5A 2IY0B 3SDLC 3UINB 4M0WB 3UGBB 5KHQA 5KHOA 4KZCA 4FJVB 4MSQB 2JY6A 1YJ1A 2JRIB 2KDFB 3CSFA 2K6DB 1S1QB 5CHVC 4J6IA 5JHBA 3ENEA 4WWOA 5L83A 2KDBA 4ASWC 3SD5A 4ANXA 3ZKJC 2K39A 3A4RA 2D2QA 1UGMA 2O2VB 1EUVB 4DDID 1WX8A 3DVNV 2Z0DB 2YVCA 2NPTB 4W9IA 1H4RA 4TQ0A 4W9LA 3A1QA 2IYDB 3ML9A 3K9PB 4GMVA 1L7YA 2O6VB 2MRPA 2MX2A 3APDA 4TV3A 5G55A 2KC1A 4HXDA 1V5OA 2G4DB 4LDTD 3ZNZB 2IO3B 2NS5A 1WX7A 2FCNA 3AXCA 4NAWB 3HK0A 3U7DA 5D94A 2ZVOA 3H1UA 1IYFA 1WZ3A 4GGQA 2KX3A 3OJ4B 5DPTA 1Z2MA 2Y5BB 3WAMA 5J17A 4K1RB 5IA7A 1ZW7A 2WYQA 3DBLI 4W9HA 2M4NA 2KTFA 2JRHA 1WI0A 2N1VA 2KMAA 2AWTA 3KW5B 2FNJB 2EMTA 1MG8A 1FXTB 1TBEA 2RD0A 2ZEQA 1EF1A 3R7QA 5J18A 3VXWA 2PE9A 4EEWA 2O6VA 1XD3B 2A5UA 4B9KA 5L95C 5D2MB 2XEWA 2KO3A 4F1SA 1GC6A 1AARA 3CMMB 1UZXB 3A9KA 4KIKA 2KZRA 2KLCA 2BKFA 2GOWA 3KYDD 2D10A 3PV1A 2A4ZA 4GOCA 4TKNA 1ISNA 2O2VA 1WR1A 2KNBA 4WQOB 4IM3A 4HVBA 2FIFA 2NBUA 4MSMB 2FAZA 2NCNA 5E6NA 2DHZA 3DDCB 2ZCBA 3ECIA 3WAPA 1S3SG 1KM7A 3PRPB 1U4AA 1KJTA 2KJRA 2N4FA 2HTHA 2WX0A 2VRRB 3PTFC 3B0AA 1WX9A 1GNUA 1K8RB 4WWNA 3MJWA 2Z0EB 1P3QU 2C7HA 2LVPA 1Y8RC 1E7VA 2MBQA 3Q3FA 5LXIB 1BT0A 3M3JA 1LQBA 3TCAA 3P2BA 2DYBA 1OTRB 3ZRCA 4IC7B 4ZRKA 2DAFA 4PYZA 1V5TA 2JZZA 3PREA 4EFOA 5EDSA 4MM3A 2EKEC 2HD5B 2M8SA 3ALBA 3DOWA 2KVRA 1NBFC 1ZGUB 1WGRA 4WWPA 1UD7A 4A3PA 2KJHB 4G0NB 3QX1A 4DHJD 3ZUNA 2MQJA 4WJPA 2ZVNA 2K6QA 4MH0E 3PLUA 3RULA 2PEAA 2N9PC 2LRUA 3ZNHB 3N3KB 1WRDB 3A1QB 3QJZA 2JWZA 4RMAA 4EKUA 1SGHA 1JRUA 4MGIE 4IUMB 3QK0A 2CU1A 3EC8A 2LASA 2WDTB 3DQVA 5J2RA 4EOYA 4FBJB 4NAWA 4GXBA 2KQSA 2LD9A 3A9JB 1V86A 2UWQA 1WXSA 4IM2A 4LJOB 2KDIA 3B08A 4PS3A 2JVCA 2QHOA 3B1LX 2LGDA 5DPWA 3A33B 4BBNF 2OOBB 4KZ0A 3APFA 4BOSC 4NJ6A 2DENB 2L0TA 4LDTB 4JIOU 2IO0B 3WIMA 2N9XA 1WR6E 2D11A 2EMSA 4ANVA 5AZFA 3IG3A 4NQKE 2ZNVC 1WIAA 4IW0A 3DVGX 3WAOA 3NOBA 3DBHI 3JVZX 3L10B 4KSLC 4NJ7A 2GBJA 4FHKA 2KDEB 4GDKA 3AI5A 2MSED 4MELA 5LLIA 3QA8A 3RT3B 2LUEA 4HPLB 1WH3A 3HIZA 3PPAA 4YL8A 3RCZA 3VHTC 2LWPA 2WX1A 3U30A 3NZSA 4GIVA 3Q3JA 4I6PA 4MDKE 2BWES 3EECA 4F7ZA 2OJRA 1WM3A 3H7SA 4HK2A 2K8CA 4IWPA 3VH3B 4BFRA 4FULA 4FJYA 3UF8A 2DX5B 3LDZE 3DPDA 4ANUA 2I1JA 4GDKB 3TIXA 3PLVA 4MEMA 2N9EB 1GG3A 3T8MA 2GMIC 3WALA 1I42A 1YIWA 2R2OA 3MHSD 3V6CB 3L54A 1LFDA 2DAJA 3HM6X 3OLMD 2ASQA 1YX5B 1RRBA 3H9DA 2AL3A 3VUXA 2GBKA 2JZ3B 2IY1B 1WFYA 4KDIC 1GUAB 2CR5A 4FLHA 2BF8B 3ZNGC 1OGWA 3PS6A 1H8CA 4XX5A 1WE6A 2L8JA 1C1YB 2LXAA 1E8ZA 1RLFA 2NVUI 1HE8A 4KVGB 3VFKA 5AZHA 3VH4B 1SIFA 4DXAB 1WGYA 5E6PA 1E8YA 1Q1OA 2KFKB 2L00B 3PZDA 2ZNVB 3N32A 4MGKE 4ZRJA 4EZJA 1LM8B 2XK5B 3RZFA 2NBVB 2WWZA 5HKHA 4B95A 1LXDA 2BWFA 4ZRIA 3SHQA 3ZDMC 5FR6A 3L08A 1EO6A 4DK5A 3PGEA 4W9FA 4HJKA 5DCNA 2MP2A 1R4NI 3V6EB 3X23A 2LZ6A 4JLCA 4B6WA 4DDGD 3QWZB 4K7SA 1OEYA 3VTWA 3ZLZA 1WJ4A 1E8XA 2G3QB 2ZJDA 2N7DA 3M62B 4FHJA 4E74A 1WXMA 3ZNID 5TR5A 4BKTA 2C5LC 2MBBB 2Z59B 4WJNA 3ZRFA 4M8MA 3O65B 1P1AA 2FUHB 3IHPC 2XBBC 3M95A 5JH5C 3W1YA 3WANA 3L13A 4AOFA 3DVGY 4AUQC 2RR9A 2FIDA 4GB9A 2D3GA 2C7MB 2KHWB 3VTVA 1WMHA 1P9DU 1WZ0A 2KX0A 4GDLA 2MBHA 2RGFA 3D32A 2CS4A 1V81A 3TMPB 2M1MA 2KTRA 3C0RB 3QC8B 2NBWB 3BY4B 2HJ8A 1RFAA 4MJSB 4HDOA 1T0YA 1YQBA 1IPGA 2GBNA 3APCA 2JT4B 4G50A 3A9KB 2KWUB 1Z5SB 2PPHA 3N30A 2LVOA 4FA6A 3WA0A 4E71A 5JZEB 4DHJB 1WMHB 3ZDTA 3HM3A 3TJPA 5AZGA 2REXA 1WF9A 4CO7A 1WJ6A 3AU4A 3QAQA 5JHAA 3PVLA 1Q5WB 2KJ6A 2LI5A 3CF6E 4BKSA 2L3ZA 4OVUA 1R4MI 4AJYB 1A5RA 3CSTA 1WXAA 1QZEA 2BYEA 3V62A 1RAXA 3TL5A 1TTNA 3RZWC 1XT9B 4EZLA 4N9F4 3W1SC 1NDDA 2BYVE 4HDQA 1WJNA 3PRZA 2DYMA 2ZPYA 3JSVA 3QARA 5LXHA 2KWCA 3RD2A 3AULA 3I3TB 2J7QB 2G45B 2XK5A 1UBIA 3H6NA 2CHZA 3A4SC 4KIKB 1WJUA 3NZUA 4HCPB 3L16A 1YD8U 4AP4C 4BKSD 4KV2A 2MA9B 2LGXA 2J0KA 2AYOB 4EZKA 4WJOA 2DZMA 2KQ7A 2MW5A 4ICUA 1EF5A 3M63B 4ANWA 2DZIA 3GOEA 3IBEA 4MGYE 3ZTCA 4E3CA 2JPHA 2KK8A 3QHTA 2B3AA 4W9JA 3QIJA 1KOTA 4BBNC 4IWOA 4EUTA 1X1MA 1D3ZA 4AJWA 2V4LA 2C7NB 1M94A 2L0FA 1WGHA 3RYTA 3NY5A 2LJ5A 4PYUA 4W9EA 3PT2B 3X0WA 4BKGA 3UIPB 2IZVB 2V3SA 3A9JA 3TBLD 3V60A 4CHKA 2KXJA 4NQLB 4XZ4A 3KUCB 4ZDVA 3VUYA 1V6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SU8 X;  4OVV A;  2D07 B;  4GN1 A;  4BOZ B;  1C3T A;  2KAN A;  3LJ3 A;  4W9G A;  3U8Z A;  3HHM A;  3UQB A;  1SE9 A;  3MTN B;  4M8N A;  2AL6 A;  2IO2 B;  3VDZ A;  3W1S A;  1CMX B;  2K1F A;  1GC7 A;  2PJH A;  5AEK B;  4TQ1 A;  2GBR A;  4A20 A;  1P0R A;  4A3O A;  2R2Q A;  1WGG A;  2ZPN A;  1J8C A;  1OEY J;  4WJQ A;  3DBR I;  1V2Y A;  4RM8 A;  1I35 A;  1KLV A;  2KTR B;  5CHW A;  4G11 A;  3KUZ A;  4LJP B;  3KH0 A;  2GBM A;  2YLM A;  2N1W A;  3L0W B;  1WGD A;  4IWQ A;  4NPN A;  3UIO B;  1WM2 A;  3DBS A;  3H7P B;  4ZYN A;  4PS8 A;  4HCN B;  4PS7 A;  1Q0W B;  3EHV A;  4I6N B;  1TZ1 A;  3VVW B;  2LRW A;  4GDL B;  3OAW A;  2C60 A;  4RM9 A;  4TUU A;  3QQ8 B;  4JGH B;  2G4S A;  3KUD B;  1NI2 A;  2CKH B;  4FJZ A;  4XC2 A;  2KFJ A;  3DVN U;  4KDL B;  3ZTD A;  5D7G A;  2K8H A;  2M17 A;  2KC2 A;  5C23 A;  2C9W B;  1VCB A;  4AWJ A;  1V80 A;  4W9C A;  1L2N A;  2CHX A;  4DHZ E;  1VD2 A;  4W9K A;  4DWF A;  1YX6 B;  3NHE B;  3PRM B;  3ZW3 A;  4CYE A;  3GZN I;  3PHW B;  3UQA A;  3IFW B;  1ZKH A;  3KVF B;  1UH6 A;  2NR2 A;  4W9D A;  2W9N A;  1GJZ A;  2ZZP B;  5CTR C;  4P7I A;  2NPT A;  3ZO5 B;  2L7R A;  2O6V D;  1E5W A;  3R3M A;  3DCG A;  1P98 A;  1F9J A;  3NS8 A;  2MCN B;  4HLE A;  5GMV A;  2HE7 A;  4F8C B;  2KKC A;  2ZCC A;  2J0J A;  1V9J A;  2FCM A;  4I6L B;  2IO1 B;  2K8B A;  4DHZ B;  2JXX A;  2JF5 A;  1OQY A;  2KFK A;  2KOX A;  5G2N A;  4ICV A;  3JW0 X;  2L76 A;  2LGY A;  2KN5 A;  4JQW C;  2DYO A;  3JYU A;  4X57 B;  3V61 A;  3R7R A;  2IBI B;  3KYC D;  3H7P A;  2AEH A;  4G3X B;  4IG7 B;  2FCS A;  3ONS A;  3JSV B;  3ZVV A;  4FN2 A;  3EFU A;  1E7U A;  3PSE B;  2LVQ A;  5BO4 B;  1V49 A;  3BIN A;  2DZK A;  2MP2 B;  1UEL A;  3K9O B;  4IM0 A;  3R66 C;  2J0M A;  5C1Z A;  3VUW A;  2N7E A;  1WE7 A;  3OJ3 A;  2RSU A;  4II3 B;  4II2 B;  2BYF A;  4WAA A;  4K7U A;  1E90 A;  4HWI B;  5E6O A;  4GSW A;  3ML8 A;  5IAA C;  1WYW B;  5CHF A;  5CX3 A;  5D6J B;  3VQI A;  4HPM B;  2MLB A;  2BPS A;  4URK A;  2FCQ A;  2RPQ A;  2MBE A;  1UBQ A;  4NNJ B;  1IP9 A;  2UYZ B;  2KD0 A;  1E8W A;  2LXC A;  4K7W A;  4KSK C;  2KWV B;  4MGZ E;  4BVU C;  1J0G A;  3L17 A;  1PQS A;  2K25 A;  2BKR B;  1G6J A;  4NY0 A;  5DPR A;  3PHX B;  2BGF A;  2DZJ A;  3T9L A;  4JL9 A;  4K81 A;  4MJS A;  3VTU A;  1XQQ A;  2M0X A;  4DBG A;  2KMC A;  4FAD A;  3QCA A;  4GU2 A;  2V1Y A;  5DPS A;  2JUO A;  3IVF A;  3RUI B;  3VAW A;  1WY8 A;  1J19 A;  2KLG A;  2MWS B;  3S2A A;  1TGZ B;  2MBO A;  2PE6 B;  2CHW A;  2I1K A;  3ZIM A;  4LCD E;  1WXV A;  2L05 A;  3AU5 A;  2IY0 B;  3SDL C;  3UIN B;  4M0W B;  3UGB B;  5KHQ A;  5KHO A;  4KZC A;  4FJV B;  4MSQ B;  2JY6 A;  1YJ1 A;  2JRI B;  2KDF B;  3CSF A;  2K6D B;  1S1Q B;  5CHV C;  4J6I A;  5JHB A;  3ENE A;  4WWO A;  5L83 A;  2KDB A;  4ASW C;  3SD5 A;  4ANX A;  3ZKJ C;  2K39 A;  3A4R A;  2D2Q A;  1UGM A;  2O2V B;  1EUV B;  4DDI D;  1WX8 A;  3DVN V;  2Z0D B;  2YVC A;  2NPT B;  4W9I A;  1H4R A;  4TQ0 A;  4W9L A;  3A1Q A;  2IYD B;  3ML9 A;  3K9P B;  4GMV A;  1L7Y A;  2O6V B;  2MRP A;  2MX2 A;  3APD A;  4TV3 A;  5G55 A;  2KC1 A;  4HXD A;  1V5O A;  2G4D B;  4LDT D;  3ZNZ B;  2IO3 B;  2NS5 A;  1WX7 A;  2FCN A;  3AXC A;  4NAW B;  3HK0 A;  3U7D A;  5D94 A;  2ZVO A;  3H1U A;  1IYF A;  1WZ3 A;  4GGQ A;  2KX3 A;  3OJ4 B;  5DPT A;  1Z2M A;  2Y5B B;  3WAM A;  5J17 A;  4K1R B;  5IA7 A;  1ZW7 A;  2WYQ A;  3DBL I;  4W9H A;  2M4N A;  2KTF A;  2JRH A;  1WI0 A;  2N1V A;  2KMA A;  2AWT A;  3KW5 B;  2FNJ B;  2EMT A;  1MG8 A;  1FXT B;  1TBE A;  2RD0 A;  2ZEQ A;  1EF1 A;  3R7Q A;  5J18 A;  3VXW A;  2PE9 A;  4EEW A;  2O6V A;  1XD3 B;  2A5U A;  4B9K A;  5L95 C;  5D2M B;  2XEW A;  2KO3 A;  4F1S A;  1GC6 A;  1AAR A;  3CMM B;  1UZX B;  3A9K A;  4KIK A;  2KZR A;  2KLC A;  2BKF A;  2GOW A;  3KYD D;  2D10 A;  3PV1 A;  2A4Z A;  4GOC A;  4TKN A;  1ISN A;  2O2V A;  1WR1 A;  2KNB A;  4WQO B;  4IM3 A;  4HVB A;  2FIF A;  2NBU A;  4MSM B;  2FAZ A;  2NCN A;  5E6N A;  2DHZ A;  3DDC B;  2ZCB A;  3ECI A;  3WAP A;  1S3S G;  1KM7 A;  3PRP B;  1U4A A;  1KJT A;  2KJR A;  2N4F A;  2HTH A;  2WX0 A;  2VRR B;  3PTF C;  3B0A A;  1WX9 A;  1GNU A;  1K8R B;  4WWN A;  3MJW A;  2Z0E B;  1P3Q U;  2C7H A;  2LVP A;  1Y8R C;  1E7V A;  2MBQ A;  3Q3F A;  5LXI B;  1BT0 A;  3M3J A;  1LQB A;  3TCA A;  3P2B A;  2DYB A;  1OTR B;  3ZRC A;  4IC7 B;  4ZRK A;  2DAF A;  4PYZ A;  1V5T A;  2JZZ A;  3PRE A;  4EFO A;  5EDS A;  4MM3 A;  2EKE C;  2HD5 B;  2M8S A;  3ALB A;  3DOW A;  2KVR A;  1NBF C;  1ZGU B;  1WGR A;  4WWP A;  1UD7 A;  4A3P A;  2KJH B;  4G0N B;  3QX1 A;  4DHJ D;  3ZUN A;  2MQJ A;  4WJP A;  2ZVN A;  2K6Q A;  4MH0 E;  3PLU A;  3RUL A;  2PEA A;  2N9P C;  2LRU A;  3ZNH B;  3N3K B;  1WRD B;  3A1Q B;  3QJZ A;  2JWZ A;  4RMA A;  4EKU A;  1SGH A;  1JRU A;  4MGI E;  4IUM B;  3QK0 A;  2CU1 A;  3EC8 A;  2LAS A;  2WDT B;  3DQV A;  5J2R A;  4EOY A;  4FBJ B;  4NAW A;  4GXB A;  2KQS A;  2LD9 A;  3A9J B;  1V86 A;  2UWQ A;  1WXS A;  4IM2 A;  4LJO B;  2KDI A;  3B08 A;  4PS3 A;  2JVC A;  2QHO A;  3B1L X;  2LGD A;  5DPW A;  3A33 B;  4BBN F;  2OOB B;  4KZ0 A;  3APF A;  4BOS C;  4NJ6 A;  2DEN B;  2L0T A;  4LDT B;  4JIO U;  2IO0 B;  3WIM A;  2N9X A;  1WR6 E;  2D11 A;  2EMS A;  4ANV A;  5AZF A;  3IG3 A;  4NQK E;  2ZNV C;  1WIA A;  4IW0 A;  3DVG X;  3WAO A;  3NOB A;  3DBH I;  3JVZ X;  3L10 B;  4KSL C;  4NJ7 A;  2GBJ A;  4FHK A;  2KDE B;  4GDK A;  3AI5 A;  2MSE D;  4MEL A;  5LLI A;  3QA8 A;  3RT3 B;  2LUE A;  4HPL B;  1WH3 A;  3HIZ A;  3PPA A;  4YL8 A;  3RCZ A;  3VHT C;  2LWP A;  2WX1 A;  3U30 A;  3NZS A;  4GIV A;  3Q3J A;  4I6P A;  4MDK E;  2BWE S;  3EEC A;  4F7Z A;  2OJR A;  1WM3 A;  3H7S A;  4HK2 A;  2K8C A;  4IWP A;  3VH3 B;  4BFR A;  4FUL A;  4FJY A;  3UF8 A;  2DX5 B;  3LDZ E;  3DPD A;  4ANU A;  2I1J A;  4GDK B;  3TIX A;  3PLV A;  4MEM A;  2N9E B;  1GG3 A;  3T8M A;  2GMI C;  3WAL A;  1I42 A;  1YIW A;  2R2O A;  3MHS D;  3V6C B;  3L54 A;  1LFD A;  2DAJ A;  3HM6 X;  3OLM D;  2ASQ A;  1YX5 B;  1RRB A;  3H9D A;  2AL3 A;  3VUX A;  2GBK A;  2JZ3 B;  2IY1 B;  1WFY A;  4KDI C;  1GUA B;  2CR5 A;  4FLH A;  2BF8 B;  3ZNG C;  1OGW A;  3PS6 A;  1H8C A;  4XX5 A;  1WE6 A;  2L8J A;  1C1Y B;  2LXA A;  1E8Z A;  1RLF A;  2NVU I;  1HE8 A;  4KVG B;  3VFK A;  5AZH A;  3VH4 B;  1SIF A;  4DXA B;  1WGY A;  5E6P A;  1E8Y A;  1Q1O A;  2KFK B;  2L00 B;  3PZD A;  2ZNV B;  3N32 A;  4MGK E;  4ZRJ A;  4EZJ A;  1LM8 B;  2XK5 B;  3RZF A;  2NBV B;  2WWZ A;  5HKH A;  4B95 A;  1LXD A;  2BWF A;  4ZRI A;  3SHQ A;  3ZDM C;  5FR6 A;  3L08 A;  1EO6 A;  4DK5 A;  3PGE A;  4W9F A;  4HJK A;  5DCN A;  2MP2 A;  1R4N I;  3V6E B;  3X23 A;  2LZ6 A;  4JLC A;  4B6W A;  4DDG D;  3QWZ B;  4K7S A;  1OEY A;  3VTW A;  3ZLZ A;  1WJ4 A;  1E8X A;  2G3Q B;  2ZJD A;  2N7D A;  3M62 B;  4FHJ A;  4E74 A;  1WXM A;  3ZNI D;  5TR5 A;  4BKT A;  2C5L C;  2MBB B;  2Z59 B;  4WJN A;  3ZRF A;  4M8M A;  3O65 B;  1P1A A;  2FUH B;  3IHP C;  2XBB C;  3M95 A;  5JH5 C;  3W1Y A;  3WAN A;  3L13 A;  4AOF A;  3DVG Y;  4AUQ C;  2RR9 A;  2FID A;  4GB9 A;  2D3G A;  2C7M B;  2KHW B;  3VTV A;  1WMH A;  1P9D U;  1WZ0 A;  2KX0 A;  4GDL A;  2MBH A;  2RGF A;  3D32 A;  2CS4 A;  1V81 A;  3TMP B;  2M1M A;  2KTR A;  3C0R B;  3QC8 B;  2NBW B;  3BY4 B;  2HJ8 A;  1RFA A;  4MJS B;  4HDO A;  1T0Y A;  1YQB A;  1IPG A;  2GBN A;  3APC A;  2JT4 B;  4G50 A;  3A9K B;  2KWU B;  1Z5S B;  2PPH A;  3N30 A;  2LVO A;  4FA6 A;  3WA0 A;  4E71 A;  5JZE B;  4DHJ B;  1WMH B;  3ZDT A;  3HM3 A;  3TJP A;  5AZG A;  2REX A;  1WF9 A;  4CO7 A;  1WJ6 A;  3AU4 A;  3QAQ A;  5JHA A;  3PVL A;  1Q5W B;  2KJ6 A;  2LI5 A;  3CF6 E;  4BKS A;  2L3Z A;  4OVU A;  1R4M I;  4AJY B;  1A5R A;  3CST A;  1WXA A;  1QZE A;  2BYE A;  3V62 A;  1RAX A;  3TL5 A;  1TTN A;  3RZW C;  1XT9 B;  4EZL A;  4N9F 4;  3W1S C;  1NDD A;  2BYV E;  4HDQ A;  1WJN A;  3PRZ A;  2DYM A;  2ZPY A;  3JSV A;  3QAR A;  5LXH A;  2KWC A;  3RD2 A;  3AUL A;  3I3T B;  2J7Q B;  2G45 B;  2XK5 A;  1UBI A;  3H6N A;  2CHZ A;  3A4S C;  4KIK B;  1WJU A;  3NZU A;  4HCP B;  3L16 A;  1YD8 U;  4AP4 C;  4BKS D;  4KV2 A;  2MA9 B;  2LGX A;  2J0K A;  2AYO B;  4EZK A;  4WJO A;  2DZM A;  2KQ7 A;  2MW5 A;  4ICU A;  1EF5 A;  3M63 B;  4ANW A;  2DZI A;  3GOE A;  3IBE A;  4MGY E;  3ZTC A;  4E3C A;  2JPH A;  2KK8 A;  3QHT A;  2B3A A;  4W9J A;  3QIJ A;  1KOT A;  4BBN C;  4IWO A;  4EUT A;  1X1M A;  1D3Z A;  4AJW A;  2V4L A;  2C7N B;  1M94 A;  2L0F A;  1WGH A;  3RYT A;  3NY5 A;  2LJ5 A;  4PYU A;  4W9E A;  3PT2 B;  3X0W A;  4BKG A;  3UIP B;  2IZV B;  2V3S A;  3A9J A;  3TBL D;  3V60 A;  4CHK A;  2KXJ A;  4NQL B;  4XZ4 A;  3KUC B;  4ZDV A;  3VUY A;  1V6E A; 
#chains in the Genus database with same CATH topology
 1HZ5 A;  1C3T A;  4W9G A;  3U8Z A;  2MHJ A;  3Q14 C;  4M8N A;  1MG4 A;  1TS4 A;  4BAX A;  5IOI A;  4A20 A;  1RYJ A;  2JU6 X;  2ONQ A;  4PK1 A;  3PZ7 A;  3TUO A;  4WJQ A;  1I35 A;  4RM8 A;  2KTR B;  3KUZ A;  1TS3 A;  1FCL A;  2YLM A;  1QT9 A;  1VRA B;  3L0W B;  4NPN A;  3UIO B;  1K53 A;  4PS8 A;  5C2T B;  4I6N B;  4A9A A;  1TZ1 A;  3VVW B;  2FUG 1;  4JGH B;  2RPV A;  2K5P A;  2CKH B;  4FJZ A;  4KDL B;  4AQ7 A;  5D7G A;  2M17 A;  1L2N A;  4W9C A;  2CHX A;  4W9K A;  3NHE B;  3PRM B;  2MJE A;  3GZN I;  3UQA A;  2NTT A;  2WGS A;  3KVF B;  1UH6 A;  2NR2 A;  4W9D A;  5CTR C;  4P7I A;  3R3M A;  1P98 A;  2MCN B;  2HE7 A;  1ZPS A;  4US9 A;  2FCM A;  2IO1 B;  2JXX A;  1DOY A;  4XWT A;  1OQY A;  1UWX A;  5G2N A;  4A90 A;  1C78 A;  2BB5 A;  2J42 A;  1JWA D;  1TJE A;  3MHZ A;  1VDV A;  3KYC D;  2B76 B;  3LYY A;  2WXL A;  3ZVV A;  4REZ A;  1I4P A;  3B9J A;  3SEB A;  1ZP0 B;  2LVQ A;  3BVM A;  5BO4 B;  1VZ7 A;  1TY0 A;  4LLG M;  3SFD B;  1D5X C;  2JWU A;  2EEL A;  3NJT A;  2RSU A;  2BYF A;  3AEF B;  1E90 A;  5E6O A;  4ZHP A;  3ETR A;  3VQI A;  4HPM B;  2RPQ A;  4KGR A;  1MFW A;  3BVG A;  2K25 A;  2BKR B;  1ZXI A;  4WWM A;  3T3N A;  3PHX B;  4JL9 A;  4IKG A;  3VTU A;  1QKZ A;  2KMC A;  4FAD A;  1EWY C;  4IOI E;  1WSP A;  2MWS B;  5FK9 C;  4B0E A;  3ZIM A;  5EE3 A;  2L05 A;  3U7Z A;  3DBL B;  2IY0 B;  3SDL C;  1YJI A;  4M0W B;  5HHD G;  2JY6 A;  1J7C A;  5CHV C;  2JX5 A;  5BYQ A;  5JHB A;  4WWO A;  5L83 A;  2IGG A;  4IDI A;  4ASW C;  3SD5 A;  1WX8 A;  2Z0D B;  3EA6 A;  4C7Y A;  4TQ0 A;  4W9L A;  5FR3 A;  3ML9 A;  3K9P B;  4GMV A;  2H88 B;  1V5O A;  4LDT D;  3U7D A;  3AXC A;  5D94 A;  2DWQ A;  3H1U A;  3AE9 B;  2KX3 A;  5DPT A;  3VRB B;  5J17 A;  3AEE B;  2JRH A;  2N1V A;  1QOG A;  2AWT A;  4YSY B;  2AX5 A;  3DBR B;  3R7Q A;  1FXT B;  2ZEQ A;  5J18 A;  1ZUD 2;  3I57 A;  4B9K A;  5L95 C;  1NYR A;  5D2M B;  3RNE C;  1FPY A;  1UZX B;  2GOW A;  3PV1 A;  2V3P A;  2WP9 B;  2IPK D;  3V3X A;  1WR1 A;  3Q3N C;  4MSM B;  2PKO A;  1PGB A;  4YTN B;  3ECI A;  2N4F A;  3P1M A;  3PTF C;  4B0M A;  3RMK C;  2Z0E B;  1V8C A;  1Y8R C;  1PDX A;  1SJE D;  3PRE A;  5EDS A;  4MM3 A;  3CIR B;  3ALB A;  3I63 C;  4ARI A;  1ZGU B;  1WGR A;  2INN E;  2KJH B;  2BW2 A;  4DHJ D;  2W54 A;  1FD6 A;  4RGM A;  2N9P C;  3FKY A;  4RMA A;  4EKU A;  1JRU A;  1PYW D;  4KKJ A;  5T8I A;  2CU1 A;  4OW0 A;  3EC8 A;  4GXB A;  1V86 A;  5IO9 A;  2KDI A;  5C3J B;  3AE3 B;  2JVC A;  5BYR A;  3O13 A;  4ZYS A;  5DPW A;  3A33 B;  2JQR B;  4BOS C;  2VH2 A;  4NJ6 A;  4LK0 M;  4EE2 A;  3WIM A;  4JPS A;  2D11 A;  3WAO A;  4M01 A;  3MC0 B;  4DDI D;  4MEL A;  3AI5 A;  2MSE D;  3RT3 B;  4HPL B;  2DNF A;  4YL8 A;  2RMM A;  2WX1 A;  3NZS A;  3Q3J A;  4MDK E;  3EEC A;  3KLS X;  1WXQ A;  4HK2 A;  3VH3 B;  3W9C B;  4FJY A;  2DX5 B;  2PLP A;  4GDK B;  1VZ6 A;  1GG3 A;  3T8M A;  1I42 A;  3H9D A;  1GAQ B;  5HFY A;  2CR5 A;  1H8C A;  3C19 A;  2WXK A;  1C1Y B;  2N0S B;  1E8Z A;  3VFK A;  3VH4 B;  1BUI C;  4C4V A;  1VLB A;  1QF6 A;  3PZD A;  2XK5 B;  3RZF A;  3NVW A;  2NBV B;  4B95 A;  1LXD A;  2BWF A;  4ZRI A;  3ZDM C;  4DK5 A;  1EO6 A;  5EE0 A;  2DLB A;  3PGE A;  1L6U A;  4HJK A;  5DCN A;  5AUI A;  1R4N I;  3DBH B;  1QOB A;  1E8X A;  2G3Q B;  4E74 A;  2K0P A;  4FHJ A;  1SJH D;  2KN4 A;  2MBB B;  2Z59 B;  3I9V 1;  5EE9 A;  2RR9 A;  3GP7 A;  2D3G A;  1C76 A;  1FNU A;  1YN3 A;  2MBH A;  3D32 A;  1XXG A;  2M1M A;  3C0R B;  3BY4 B;  1RFA A;  3NUH B;  4HDO A;  1T0Y A;  4G50 A;  4C00 A;  3N30 A;  2CU3 A;  4D2K A;  2FE8 A;  2LVO A;  4J3O D;  5AUK A;  4E71 A;  4DHJ B;  5BMI A;  3HM3 A;  4CO7 A;  3QAQ A;  3AU4 A;  3N1Y C;  2V3N A;  4K3C A;  1WXA A;  3W5U B;  2INC C;  1QZE A;  4DXG A;  3V62 A;  1RAX A;  3TL5 A;  1TTN A;  3RZW C;  3W1S C;  2DYM A;  3AE5 B;  3EGR A;  5LXH A;  3AUL A;  3I3T B;  2LJI A;  4DQO C;  2XK5 A;  1UBI A;  2WQY B;  3HRD D;  2ZW0 A;  2CJO A;  2AYO B;  2K22 A;  1ZE3 D;  1AW7 A;  2MW5 A;  4MGY E;  3GOE A;  4P6V F;  2JPH A;  3QHT A;  4BBN C;  1X1M A;  1D3Z A;  4AJW A;  1UWM A;  1C4C A;  3X0W A;  4BKG A;  1PGA A;  2BT6 A;  2IZV B;  4MH8 A;  3V60 A;  2KXJ A;  4NQL B;  4XE0 A;  1KLG D;  2PVG C;  2PMV A;  3AE1 B;  4P16 A;  1TKE A;  2KDM A;  4N58 A;  3BVZ A;  4BOZ B;  2KAN A;  3LJ3 A;  3UQB A;  2PTL A;  1SE9 A;  4HEA 1;  2K1F A;  1GC7 A;  5AEK B;  1QOF A;  2GBR A;  1P0R A;  5IN7 A;  3NVZ A;  2R2Q A;  3DBR I;  3NVV A;  1UGJ A;  1T5X D;  2N1W A;  3BYT B;  3MP9 A;  2MH7 A;  1N62 A;  1TS5 A;  3DBS A;  4ZYN A;  1YJJ A;  1Q0W B;  3EHV A;  1KH0 A;  2LRW A;  3OAW A;  4TUU A;  1F0Z A;  1P7E A;  2WXP A;  4ITK A;  3RNF C;  1NVI D;  2K8H A;  3AEB B;  5C23 A;  4C7Z A;  1V80 A;  2KAJ A;  1YX6 B;  3ZW3 A;  2NMQ A;  4OVZ A;  1GB4 A;  1XLQ A;  2UU7 A;  1GJZ A;  3ZO5 B;  2O6V D;  4HLE A;  2JSV X;  3DCG A;  3NS8 A;  2ZCC A;  2J0J A;  1V9J A;  1C79 A;  4I6L B;  5E6J A;  1WRI A;  2KFK A;  2WDV B;  2KVZ A;  1ENF A;  5FKA C;  1R4N B;  4X57 B;  3V61 A;  5MPO A;  4KKI A;  1AWD A;  3JSV B;  1BXT A;  3EFU A;  3PSE B;  5GXG B;  3RNG C;  3PZ8 A;  5C1Z A;  2N7E A;  1WE7 A;  3OJ3 A;  2W55 A;  4II2 B;  3ML8 A;  5IAA C;  1TYG B;  4HJG E;  3W5V B;  2GRI A;  2FCQ A;  2BQQ A;  1UBQ A;  4LNO A;  1IP9 A;  2UYZ B;  1E8W A;  4BVU C;  4MGZ E;  3OG5 A;  2N9L A;  2DZJ A;  3GE8 C;  3T9L A;  1T6B X;  4MJS A;  4TSS A;  3QCA A;  1FRD A;  3RUI B;  1J19 A;  1T0Q C;  2WXO A;  3TEW A;  1FFU A;  2PE6 B;  1WXV A;  1FEH A;  4K3B A;  3UIN B;  1YN4 A;  2XN9 C;  4KZC A;  3LXF A;  2PVO D;  3P4R B;  1YJ1 A;  2JRI B;  3CSF A;  1S1Q B;  3R2I A;  3ZJU A;  1A70 A;  2KDB A;  2ICI A;  2K39 A;  3A4R A;  2D2Q A;  2W82 A;  3Q69 A;  3BK2 A;  2YVC A;  4W9I A;  3U52 E;  5BMG A;  2KAC A;  4O1N A;  2MX2 A;  4TV3 A;  5G55 A;  1IGD A;  2LGS A;  2IO3 B;  2NS5 A;  1GPX A;  1IYF A;  1ZOY B;  1WZ3 A;  1Z2M A;  1QOA A;  1ZW7 A;  1FRR A;  1WI0 A;  1RFK A;  4BZA A;  2RDG A;  1MG8 A;  2DBY A;  2PE9 A;  4EEW A;  1XD3 B;  2A5U A;  4F1S A;  2RDB C;  1GC6 A;  4KIK A;  1FNV A;  1OQQ A;  4IM3 A;  2NCN A;  4H2A A;  4RGT A;  4L23 A;  5E6N A;  5D3D A;  1KJT A;  2WX0 A;  1EU4 A;  3L4P A;  1GNU A;  1K8R B;  4WWN A;  2C7H A;  3Q3F A;  2WHI A;  3M3J A;  3BII D;  1DYQ A;  4PYZ A;  4KGS A;  1IUE A;  1E0Z A;  2EKE C;  2HD5 B;  4MAC A;  2M8S A;  1D4B A;  1L0Y B;  1NBF C;  2D3B A;  4A3P A;  2MQJ A;  2ZVN A;  3RUL A;  2LRU A;  3ZNH B;  3N3K B;  3A1Q B;  3QJZ A;  1SGH A;  5BYS A;  3TSS A;  3DQV A;  5J2R A;  4FBJ B;  2LD9 A;  3A9J B;  5I4D A;  4HKZ E;  2QHO A;  2LGD A;  2OOB B;  1KFY B;  5AZF A;  3IG3 A;  2M0A A;  3DBH I;  3JVZ X;  3L10 B;  2GBJ A;  3KQ4 A;  2LUE A;  1WH3 A;  1Y56 A;  3AE7 B;  1WGK A;  3DHI C;  2WXQ A;  4GIV A;  5D3I B;  4I6P A;  4F7Z A;  1ZXH A;  1MVK A;  1MHH E;  2WXI A;  4HRO A;  3LDZ E;  2I1J A;  1QIL A;  2N9E B;  2W3R A;  1YIW A;  5H92 C;  1N5W A;  1YX5 B;  3VUX A;  2LHE A;  2LFI A;  2JZ3 B;  3AN1 A;  2IY1 B;  1E9M A;  3ZNG C;  1K52 A;  4XX5 A;  1WE6 A;  2L8J A;  1RLF A;  4KVG B;  1NEN B;  4DXA B;  5E6P A;  2L00 B;  2ZNV B;  3N32 A;  4ZRJ A;  1LM8 B;  4W9F A;  2WDR B;  4C56 C;  4B6W A;  2LZ6 A;  4JLC A;  4DDG D;  3AE4 B;  1OEY A;  2J53 A;  2Q5W D;  5TR5 A;  3VR9 B;  4BKT A;  1YN5 A;  1I4Q A;  4QAY A;  3O65 B;  1P1A A;  3IT4 B;  3IHP C;  2SAK A;  3M95 A;  3P4P B;  1MI0 A;  3ZYY X;  4AUQ C;  4YXD B;  2OJW A;  2FID A;  1L6V A;  1WMH A;  1L0V B;  4GDL A;  4OZB A;  3RNA C;  2NBW B;  2HJ8 A;  1KF6 B;  3ZGZ A;  1KTK A;  1I4H A;  5JZE B;  4US8 A;  1WMH B;  1ACC A;  3ZDT A;  2QMT A;  3OWE B;  4BKS A;  2L3Z A;  2V9H A;  4OVU A;  3DWM A;  1A5R A;  3N20 C;  3ABV B;  3TEY A;  1ZDV A;  4HDQ A;  4WH4 A;  3RD2 A;  1NI3 A;  3FIL A;  1FM0 D;  2KMM A;  1NYQ A;  3BK1 A;  4WUR A;  4M02 A;  4KIK B;  4HCP B;  3L16 A;  2INP E;  4KV2 A;  2J0K A;  4EZK A;  1EF5 A;  2JXT A;  1HTQ A;  4ANW A;  1KLU D;  1SIJ A;  1YNT E;  1TKY A;  4E3C A;  2C7N B;  2WU2 B;  3N1X C;  1V1P B;  4W9E A;  3NY5 A;  3RYT A;  3PT2 B;  1F1H A;  3A9J A;  3TBL D;  2WU5 B;  2I2Y A;  1TIF A;  2WDQ B;  3VUY A;  3QK0 A;  1V6E A;  3SU8 X;  4GN1 A;  1B9R A;  1V97 A;  3U4E G;  4JWS C;  3VDZ A;  3W1S A;  2PJH A;  1CQV A;  3AB5 A;  1DOI A;  1J8C A;  1OEY J;  1V2Y A;  4LJP B;  3KH0 A;  2GBM A;  4IWQ A;  3H7P B;  4PS7 A;  1I4X A;  1E7P B;  2M56 B;  2J4X A;  4RM9 A;  3QQ8 B;  4RH6 A;  2G4S A;  3AEC B;  4CQN A;  1NI2 A;  2L1A A;  2KFJ A;  2BB6 A;  3ZTD A;  2MEK A;  1AYF A;  3PO0 A;  2KC2 A;  3ZXR A;  3PHW B;  3IFW B;  1L0X B;  1ZKH A;  4OHJ A;  1STE A;  3RNC C;  5EE1 A;  1F9J A;  2TSS A;  5GMV A;  4RFB A;  3R8B A;  2K8B A;  4DHZ B;  3JW0 X;  3Q8E A;  2KN5 A;  4JQW C;  2DYO A;  3JYU A;  2IBI B;  4USA A;  4OZC A;  2AEH A;  4G3X B;  1UUP A;  4N6E B;  1CK1 A;  2JYE A;  2DZK A;  1UEL A;  3P4S B;  3K9O B;  5HI1 A;  3R66 C;  2J0M A;  3VUW A;  4II3 B;  4K7U A;  1SB3 C;  1WYW B;  4KX6 B;  5CHF A;  5CX3 A;  2MLB A;  2BPS A;  1JML A;  4URK A;  2MBE A;  3HVZ A;  2KD0 A;  2KWV B;  1G6J A;  4NY0 A;  5DPR A;  4WQM A;  1KRH A;  1SEB D;  2BGF A;  4YTM B;  1XQQ A;  2L32 A;  4GU2 A;  5DPS A;  1HA5 A;  1SE2 A;  2MBO A;  2CHW A;  2I1K A;  4LCD E;  3U2S C;  2LGI A;  3UGB B;  5KHQ A;  5KHO A;  2V0G A;  4AS1 A;  1LO5 D;  4HPP A;  3ENE A;  4C4V B;  2E3T A;  2WXR A;  2QDF A;  4YWG G;  1EUV B;  2ACZ B;  2YEP B;  3DVN V;  5H8Y E;  4YSX B;  2IYD B;  1L7Y A;  2O6V B;  2G4D B;  3ZNZ B;  2FCN A;  3HK0 A;  2ZVO A;  4LNK A;  3OJ4 B;  2Y5B B;  3MC8 A;  4K1R B;  1J7B A;  5IA7 A;  1JWS D;  1YQ4 B;  4W9H A;  2M4N A;  2KTF A;  2KMA A;  3LB8 C;  3AEA B;  3RN9 C;  2RD0 A;  3AE2 B;  3VXW A;  2O6V A;  2XEW A;  3A9K A;  3IAS 1;  2KZR A;  2N7J A;  3KYD D;  2D10 A;  2IGH A;  2JYT A;  1FMA D;  1ISN A;  1HZ6 A;  2O2V A;  2KNB A;  3AV8 A;  4HVB A;  2NBU A;  3CWI A;  4WAF A;  2AQ3 B;  3DDC B;  2ZCB A;  1GB1 A;  2WXN A;  3WAP A;  1KM7 A;  3PRP B;  1U4A A;  1BML C;  3B0A A;  1WX9 A;  2WLB A;  3MJW A;  1P3Q U;  2LVP A;  2SEB D;  5LXI B;  3TCA A;  4XWW A;  2DYB A;  3ZRC A;  2WXJ A;  4ZRK A;  2DAF A;  1V5T A;  4EFO A;  4YSZ B;  4RF0 A;  3I5J C;  1C77 A;  3SR6 A;  2BBC A;  4G0N B;  3ZUN A;  3GE3 C;  4WJP A;  4ZRP A;  3PLU A;  3IT6 B;  1IBX B;  2PEA A;  1FFV A;  1P7F A;  2JWZ A;  4OZA A;  4MGI E;  4IUM B;  1F2R I;  2LAS A;  1R4M B;  4LJO B;  4IM2 A;  3B08 A;  3B1L X;  1GOZ A;  3AEG B;  3APF A;  2DEN B;  2G9H D;  4JIO U;  2IO0 B;  1WR6 E;  2EMS A;  4ANV A;  4NQK E;  2ZNV C;  1WIA A;  4IW0 A;  3DVG X;  3NOB A;  4NJ7 A;  4KSL C;  4FHK A;  2KDE B;  1QLB B;  3BZD B;  3B2G A;  3RNB C;  3Q8B A;  1SF0 A;  4M0W A;  3U30 A;  3T3O A;  2BWE S;  2D3C A;  1L5P A;  3H7S A;  2K8C A;  4IWP A;  4FUL A;  2WS3 B;  3DPD A;  4ANU A;  1N5X A;  1SSN A;  3TIX A;  2LMC A;  3PLV A;  1HXY D;  4MEM A;  2Y5P A;  3Q8C A;  2CJN A;  3WAL A;  2R2O A;  3MHS D;  2GLS A;  1LFD A;  2DAJ A;  3OLM D;  2AL3 A;  2I38 A;  2GBK A;  3ZQ4 A;  1WFY A;  4HRS A;  1QQR A;  2X8X X;  2D3A A;  2VZK D;  2BF8 B;  2VH1 A;  2H89 B;  3DWG C;  3RI7 C;  2NVU I;  4XDC A;  5AZH A;  3W2D A;  1SIF A;  1HQR D;  1WGY A;  1Q1O A;  4EZJ A;  4TMA B;  1V1O A;  2QIL A;  5FR6 A;  4UDU C;  1D5Z C;  2MP2 A;  4RF1 A;  3X23 A;  3QWZ B;  3ZLZ A;  1WJ4 A;  3M62 B;  2ZJD A;  1PFD A;  2BS3 B;  4WJN A;  3ZRF A;  4M8M A;  1JQ4 A;  2XBB C;  5JH5 C;  3WAN A;  4AOF A;  1JAL A;  2WNM A;  1XLN A;  4PT5 A;  2GB1 A;  2C7M B;  2KHW B;  1I4G A;  1P9D U;  2KX0 A;  1EWC A;  2RGF A;  3ZJT A;  2CS4 A;  3TMP B;  1NEK B;  2KTR A;  2AQ1 B;  3QC8 B;  4MJS B;  1IPG A;  2JT4 B;  2QC8 A;  1JW9 D;  1K51 A;  4L2Y A;  4S17 A;  2KWU B;  2PPH A;  2YEP F;  4S0R A;  3TJP A;  1YOV B;  5AZG A;  2REX A;  1WF9 A;  5JHA A;  2BS4 B;  3Q8A A;  2LI5 A;  3CF6 E;  1T0S C;  3GB1 A;  1TKG A;  1R4M I;  4AJY B;  3CST A;  1VR9 A;  2BYE A;  3AH7 A;  3ZJV A;  3BWU D;  3DHH C;  4N9F 4;  3RPF C;  2BYV E;  2RDH A;  2ZPY A;  3JSV A;  3E56 A;  1TT5 B;  2KYW A;  1PUT A;  1TS2 A;  3A4S C;  3NZU A;  1C4A A;  4AP4 C;  2MA9 B;  4MT5 A;  3AED B;  4RNA A;  3VR8 B;  3P63 A;  2DZM A;  3P42 A;  4ICU A;  3IBE A;  3ZTC A;  3QIJ A;  4IWO A;  4EUT A;  3GZN B;  2Y5C A;  1M94 A;  2L0F A;  2LJ5 A;  3HUI A;  5LNK 1;  1EM7 A;  3UIP B;  4NZL B;  4CHK A;  4LTU A;  4XZ4 A;  4OVV A;  2D07 B;  3HHM A;  4HKQ A;  3MTN B;  2AL6 A;  2IO2 B;  1CMX B;  4TQ1 A;  4A3O A;  1J7A A;  1VZ8 A;  1WGG A;  2ZPN A;  2Y3A A;  2KQ4 X;  1KLV A;  1L4D B;  5CHW A;  4G11 A;  5BMH A;  2JZP A;  3UI3 A;  1WGD A;  1WM2 A;  4HCN B;  2WXF A;  4GDL B;  4NAM A;  1JWB D;  3SFE B;  4YT0 B;  2C60 A;  3KUD B;  4XC2 A;  3DVN U;  3MJ5 A;  2C9W B;  1VCB A;  4AWJ A;  1HEZ E;  3AE8 B;  4DHZ E;  1VD2 A;  4A55 A;  4DWF A;  2LUM A;  4CYE A;  3WCQ A;  1K50 A;  1IBX A;  2W9N A;  2ZZP B;  2NPT A;  2L7R A;  1E5W A;  3BYY B;  2M19 A;  4F8C B;  2KKC A;  3HVD A;  2JF5 A;  2KOX A;  3MC9 A;  3Q8F A;  4ICV A;  3AE6 B;  2L76 A;  2LGY A;  4JX1 C;  2N9K A;  3H7P A;  4IG7 B;  2FCS A;  1MJD A;  3ONS A;  4FN2 A;  1E7U A;  2E6X A;  1C9F A;  4XDD A;  1V49 A;  3BIN A;  2MP2 B;  4ACF A;  3Q3M C;  4IM0 A;  1TY2 A;  1OFF A;  2OED A;  1HTO A;  4WAA A;  4HWI B;  4GSW A;  3IXS A;  5D6J B;  1CZP A;  2K9X A;  3TEZ A;  4NNJ B;  4K7W A;  2LXC A;  4KSK C;  5TSS A;  1J0G A;  2XNA C;  3L17 A;  1JCK B;  1PQS A;  1RM6 C;  4LNN A;  1AN8 A;  1FNW A;  1D6E C;  3C8Y A;  4K81 A;  2M0X A;  4DBG A;  2GI9 A;  1FO4 A;  2V1Y A;  2W3S A;  2JUO A;  3IVF A;  4DXF A;  3VAW A;  1WY8 A;  2LHD A;  2KLG A;  1I7H A;  3S2A A;  1TGZ B;  3Q2A C;  5JXV A;  3N9Y C;  3AU5 A;  4N59 A;  4FJV B;  1B1Z A;  4MSQ B;  3RFZ B;  2KDF B;  2K6D B;  4J6I A;  2VZK B;  4ANX A;  3ZKJ C;  2QIE B;  4ZOH C;  4FXC A;  3Q3O C;  1Q10 A;  1UGM A;  2O2V B;  1VJK A;  2NPT B;  1H4R A;  1E6E B;  4ARC A;  3A1Q A;  1T3Q A;  2BYT A;  2MRP A;  3APD A;  2KC1 A;  4HXD A;  3NZ3 A;  1WX7 A;  4NAW B;  4GGQ A;  4P1C C;  3WAM A;  1V1P A;  2WYQ A;  3DBL I;  4GLS C;  3NG0 A;  1D5M C;  3KW5 B;  2FNJ B;  2EMT A;  1TBE A;  2D5G A;  2L52 A;  1EF1 A;  4Q2J A;  2V4I B;  3ZXV A;  1JWU D;  2KO3 A;  1F77 A;  1N6Z A;  2G1E A;  1AAR A;  3CMM B;  5IKC M;  2EKI A;  3GS2 A;  1ET9 A;  2KLC A;  2BKF A;  2HDE A;  3IAM 1;  2A4Z A;  3AMZ A;  4GOC A;  3KWL A;  4TKN A;  1SXT A;  1JRP A;  4WQO B;  2FIF A;  2IND C;  2FAZ A;  3Q6B A;  2DHZ A;  1S3S G;  1IGC A;  1JWM D;  2KJR A;  2HTH A;  2VRR B;  2MJ3 A;  2K3U A;  1OQR A;  1E7V A;  2MBQ A;  1BT0 A;  1LQB A;  3AM9 A;  3P2B A;  3KWV A;  2HTM E;  1OTR B;  1XCT L;  1JRO A;  4IC7 B;  2JZZ A;  4WIP A;  4R3D A;  3DOW A;  2KVR A;  4WWP A;  1UD7 A;  5G5H A;  1DOX A;  1C4P A;  3QX1 A;  1T0R C;  1SBB B;  2K6Q A;  4MH0 E;  1WRD B;  1XLO A;  5IP4 D;  1MHX A;  4RGN A;  3TEX A;  2WDT B;  4EOY A;  4NAW A;  2WXM A;  2KQS A;  2R61 A;  2UWQ A;  1WXS A;  1SE4 A;  2X38 A;  4PS3 A;  4BBN F;  4KZ0 A;  1RWS A;  2BTE A;  1WWT A;  5HG2 A;  2L0T A;  4LDT B;  2N9X A;  3NVY A;  3EUB 2;  1FIQ A;  3R7R A;  4GDK A;  5LLI A;  3QA8 A;  1WYG A;  3HIZ A;  3PPA A;  3RCZ A;  3VHT C;  2LWP A;  3VRA B;  4RGO S;  3EFC A;  2OJR A;  1WM3 A;  2QEJ C;  2ON8 A;  2ZW1 A;  4BFR A;  3URY A;  1XLP A;  3UF8 A;  4XGA B;  2GMI C;  1N63 A;  2KT7 A;  3V6C B;  3L54 A;  3HM6 X;  2ASQ A;  1RRB A;  2MJD A;  4KDI C;  1GUA B;  4A8X C;  4FLH A;  1XEE A;  3B2F A;  1OGW A;  3PS6 A;  3R2T A;  1EU3 A;  1I4R A;  2LXA A;  1F2R C;  1HE8 A;  3FAH A;  3H8H A;  1DGJ A;  1E8Y A;  2KFK B;  1YMH E;  4MGK E;  4XYC A;  2WWZ A;  5HKH A;  3SHQ A;  1FCC C;  4LNF A;  1XO3 A;  3L08 A;  2KWD A;  1FXI A;  4RCO A;  3N1Z C;  3V6E B;  4KGT A;  1N60 A;  2BS2 B;  4K7S A;  3VTW A;  3MFG A;  2N7D A;  1WXM A;  3ZNI D;  2C5L C;  1FXA A;  4ZRQ A;  4JE3 B;  2FUH B;  3NS1 A;  2FBW B;  3W1Y A;  3L13 A;  3DVG Y;  2IDY A;  1UNS A;  4GB9 A;  4A6Q A;  4C80 A;  2IJ0 A;  3VTV A;  1XCQ L;  1WZ0 A;  4L1B A;  1CJE A;  1XF5 L;  2J52 A;  1V81 A;  1YQB A;  3APC A;  2GBN A;  1R7S A;  1MPE A;  2QJL A;  2QSD A;  2PIA A;  3A9K B;  2BVC A;  2NTS A;  1Z5S B;  4FA6 A;  1ROE A;  2Z8L A;  3WA0 A;  4NJC A;  1WJ6 A;  3PVL A;  1Q5W B;  2KJ6 A;  2IGD A;  2OHF A;  3P4Q B;  1ET6 A;  1ESF A;  4EZL A;  1XT9 B;  3NRZ A;  3FC4 A;  1NDD A;  4P1B C;  1WJN A;  3PRZ A;  1M4V A;  4JWU C;  3QAR A;  1TZO A;  2KWC A;  4YTP B;  1F52 A;  2J7Q B;  2HJ1 A;  2G45 B;  3V05 A;  3H6N A;  1ZDX A;  4ZHO A;  2CHZ A;  1LGR A;  1WJU A;  4MM3 B;  1YD8 U;  4BKS D;  2QCZ A;  2LGX A;  1L4Z B;  4WJO A;  2KQ7 A;  3M63 B;  4LNI A;  3FIL B;  1PGX A;  2DZI A;  2KK8 A;  1YQ3 B;  2B3A A;  4W9J A;  2WXG A;  1KOT A;  1UF0 A;  2L83 A;  2V4L A;  3E9S A;  1E10 A;  1N61 A;  4M00 A;  3J9C A;  5G5G A;  1WGH A;  2LEK A;  4PYU A;  2PW9 A;  1SE3 A;  2V3S A;  3DHG C;  3KUC B;  4ZDV A;  2AQ2 B;  2WXH A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  4OVV A;  2D07 B;  4GN1 A;  4BOZ B;  1C3T A;  2KAN A;  3LJ3 A;  4W9G A;  3U8Z A;  3HHM A;  3UQB A;  1SE9 A;  3MTN B;  4M8N A;  2AL6 A;  2IO2 B;  3VDZ A;  3W1S A;  1CMX B;  2K1F A;  1GC7 A;  2PJH A;  5AEK B;  4TQ1 A;  2GBR A;  4A20 A;  1P0R A;  4A3O A;  2R2Q A;  1WGG A;  2ZPN A;  1J8C A;  1OEY J;  4WJQ A;  3DBR I;  1V2Y A;  4RM8 A;  1I35 A;  1KLV A;  2KTR B;  5CHW A;  4G11 A;  3KUZ A;  4LJP B;  3KH0 A;  2GBM A;  2YLM A;  2N1W A;  3L0W B;  1WGD A;  4IWQ A;  4NPN A;  3UIO B;  1WM2 A;  3DBS A;  3H7P B;  4ZYN A;  4PS8 A;  4HCN B;  4PS7 A;  1Q0W B;  3EHV A;  4I6N B;  1TZ1 A;  3VVW B;  2LRW A;  4GDL B;  3OAW A;  2C60 A;  4RM9 A;  4TUU A;  3QQ8 B;  4JGH B;  2G4S A;  3KUD B;  1NI2 A;  2CKH B;  4FJZ A;  4XC2 A;  2KFJ A;  3DVN U;  4KDL B;  3ZTD A;  5D7G A;  2K8H A;  2M17 A;  2KC2 A;  5C23 A;  2C9W B;  1VCB A;  4AWJ A;  1V80 A;  4W9C A;  1L2N A;  2CHX A;  4DHZ E;  1VD2 A;  4W9K A;  4DWF A;  1YX6 B;  3NHE B;  3PRM B;  3ZW3 A;  4CYE A;  3GZN I;  3PHW B;  3UQA A;  3IFW B;  1ZKH A;  3KVF B;  1UH6 A;  2NR2 A;  4W9D A;  2W9N A;  1GJZ A;  2ZZP B;  5CTR C;  4P7I A;  2NPT A;  3ZO5 B;  2L7R A;  2O6V D;  1E5W A;  3R3M A;  3DCG A;  1P98 A;  1F9J A;  3NS8 A;  2MCN B;  4HLE A;  5GMV A;  2HE7 A;  4F8C B;  2KKC A;  2ZCC A;  2J0J A;  1V9J A;  2FCM A;  4I6L B;  2IO1 B;  2K8B A;  4DHZ B;  2JXX A;  2JF5 A;  1OQY A;  2KFK A;  2KOX A;  5G2N A;  4ICV A;  3JW0 X;  2L76 A;  2LGY A;  2KN5 A;  4JQW C;  2DYO A;  3JYU A;  4X57 B;  3V61 A;  3R7R A;  2IBI B;  3KYC D;  3H7P A;  2AEH A;  4G3X B;  4IG7 B;  2FCS A;  3ONS A;  3JSV B;  3ZVV A;  4FN2 A;  3EFU A;  1E7U A;  3PSE B;  2LVQ A;  5BO4 B;  1V49 A;  3BIN A;  2DZK A;  2MP2 B;  1UEL A;  3K9O B;  4IM0 A;  3R66 C;  2J0M A;  5C1Z A;  3VUW A;  2N7E A;  1WE7 A;  3OJ3 A;  2RSU A;  4II3 B;  4II2 B;  2BYF A;  4WAA A;  4K7U A;  1E90 A;  4HWI B;  5E6O A;  4GSW A;  3ML8 A;  5IAA C;  1WYW B;  5CHF A;  5CX3 A;  5D6J B;  3VQI A;  4HPM B;  2MLB A;  2BPS A;  4URK A;  2FCQ A;  2RPQ A;  2MBE A;  1UBQ A;  4NNJ B;  1IP9 A;  2UYZ B;  2KD0 A;  1E8W A;  2LXC A;  4K7W A;  4KSK C;  2KWV B;  4MGZ E;  4BVU C;  1J0G A;  3L17 A;  1PQS A;  2K25 A;  2BKR B;  1G6J A;  4NY0 A;  5DPR A;  3PHX B;  2BGF A;  2DZJ A;  3T9L A;  4JL9 A;  4K81 A;  4MJS A;  3VTU A;  1XQQ A;  2M0X A;  4DBG A;  2KMC A;  4FAD A;  3QCA A;  4GU2 A;  2V1Y A;  5DPS A;  2JUO A;  3IVF A;  3RUI B;  3VAW A;  1WY8 A;  1J19 A;  2KLG A;  2MWS B;  3S2A A;  1TGZ B;  2MBO A;  2PE6 B;  2CHW A;  2I1K A;  3ZIM A;  4LCD E;  1WXV A;  2L05 A;  3AU5 A;  2IY0 B;  3SDL C;  3UIN B;  4M0W B;  3UGB B;  5KHQ A;  5KHO A;  4KZC A;  4FJV B;  4MSQ B;  2JY6 A;  1YJ1 A;  2JRI B;  2KDF B;  3CSF A;  2K6D B;  1S1Q B;  5CHV C;  4J6I A;  5JHB A;  3ENE A;  4WWO A;  5L83 A;  2KDB A;  4ASW C;  3SD5 A;  4ANX A;  3ZKJ C;  2K39 A;  3A4R A;  2D2Q A;  1UGM A;  2O2V B;  1EUV B;  4DDI D;  1WX8 A;  3DVN V;  2Z0D B;  2YVC A;  2NPT B;  4W9I A;  1H4R A;  4TQ0 A;  4W9L A;  3A1Q A;  2IYD B;  3ML9 A;  3K9P B;  4GMV A;  1L7Y A;  2O6V B;  2MRP A;  2MX2 A;  3APD A;  4TV3 A;  5G55 A;  2KC1 A;  4HXD A;  1V5O A;  2G4D B;  4LDT D;  3ZNZ B;  2IO3 B;  2NS5 A;  1WX7 A;  2FCN A;  3AXC A;  4NAW B;  3HK0 A;  3U7D A;  5D94 A;  2ZVO A;  3H1U A;  1IYF A;  1WZ3 A;  4GGQ A;  2KX3 A;  3OJ4 B;  5DPT A;  1Z2M A;  2Y5B B;  3WAM A;  5J17 A;  4K1R B;  5IA7 A;  1ZW7 A;  2WYQ A;  3DBL I;  4W9H A;  2M4N A;  2KTF A;  2JRH A;  1WI0 A;  2N1V A;  2KMA A;  2AWT A;  3KW5 B;  2FNJ B;  2EMT A;  1MG8 A;  1FXT B;  1TBE A;  2RD0 A;  2ZEQ A;  1EF1 A;  3R7Q A;  5J18 A;  3VXW A;  2PE9 A;  4EEW A;  2O6V A;  1XD3 B;  2A5U A;  4B9K A;  5L95 C;  5D2M B;  2XEW A;  2KO3 A;  4F1S A;  1GC6 A;  1AAR A;  3CMM B;  1UZX B;  3A9K A;  4KIK A;  2KZR A;  2KLC A;  2BKF A;  2GOW A;  3KYD D;  2D10 A;  3PV1 A;  2A4Z A;  4GOC A;  4TKN A;  1ISN A;  2O2V A;  1WR1 A;  2KNB A;  4WQO B;  4IM3 A;  4HVB A;  2FIF A;  2NBU A;  4MSM B;  2FAZ A;  2NCN A;  5E6N A;  2DHZ A;  3DDC B;  2ZCB A;  3ECI A;  3WAP A;  1S3S G;  1KM7 A;  3PRP B;  1U4A A;  1KJT A;  2KJR A;  2N4F A;  2HTH A;  2WX0 A;  2VRR B;  3PTF C;  3B0A A;  1WX9 A;  1GNU A;  1K8R B;  4WWN A;  3MJW A;  2Z0E B;  1P3Q U;  2C7H A;  2LVP A;  1Y8R C;  1E7V A;  2MBQ A;  3Q3F A;  5LXI B;  1BT0 A;  3M3J A;  1LQB A;  3TCA A;  3P2B A;  2DYB A;  1OTR B;  3ZRC A;  4IC7 B;  4ZRK A;  2DAF A;  4PYZ A;  1V5T A;  2JZZ A;  3PRE A;  4EFO A;  5EDS A;  4MM3 A;  2EKE C;  2HD5 B;  2M8S A;  3ALB A;  3DOW A;  2KVR A;  1NBF C;  1ZGU B;  1WGR A;  4WWP A;  1UD7 A;  4A3P A;  2KJH B;  4G0N B;  3QX1 A;  4DHJ D;  3ZUN A;  2MQJ A;  4WJP A;  2ZVN A;  2K6Q A;  4MH0 E;  3PLU A;  3RUL A;  2PEA A;  2N9P C;  2LRU A;  3ZNH B;  3N3K B;  1WRD B;  3A1Q B;  3QJZ A;  2JWZ A;  4RMA A;  4EKU A;  1SGH A;  1JRU A;  4MGI E;  4IUM B;  3QK0 A;  2CU1 A;  3EC8 A;  2LAS A;  2WDT B;  3DQV A;  5J2R A;  4EOY A;  4FBJ B;  4NAW A;  4GXB A;  2KQS A;  2LD9 A;  3A9J B;  1V86 A;  2UWQ A;  1WXS A;  4IM2 A;  4LJO B;  2KDI A;  3B08 A;  4PS3 A;  2JVC A;  2QHO A;  3B1L X;  2LGD A;  5DPW A;  3A33 B;  4BBN F;  2OOB B;  4KZ0 A;  3APF A;  4BOS C;  4NJ6 A;  2DEN B;  2L0T A;  4LDT B;  4JIO U;  2IO0 B;  3WIM A;  2N9X A;  1WR6 E;  2D11 A;  2EMS A;  4ANV A;  5AZF A;  3IG3 A;  4NQK E;  2ZNV C;  1WIA A;  4IW0 A;  3DVG X;  3WAO A;  3NOB A;  3DBH I;  3JVZ X;  3L10 B;  4KSL C;  4NJ7 A;  2GBJ A;  4FHK A;  2KDE B;  4GDK A;  3AI5 A;  2MSE D;  4MEL A;  5LLI A;  3QA8 A;  3RT3 B;  2LUE A;  4HPL B;  1WH3 A;  3HIZ A;  3PPA A;  4YL8 A;  3RCZ A;  3VHT C;  2LWP A;  2WX1 A;  3U30 A;  3NZS A;  4GIV A;  3Q3J A;  4I6P A;  4MDK E;  2BWE S;  3EEC A;  4F7Z A;  2OJR A;  1WM3 A;  3H7S A;  4HK2 A;  2K8C A;  4IWP A;  3VH3 B;  4BFR A;  4FUL A;  4FJY A;  3UF8 A;  2DX5 B;  3LDZ E;  3DPD A;  4ANU A;  2I1J A;  4GDK B;  3TIX A;  3PLV A;  4MEM A;  2N9E B;  1GG3 A;  3T8M A;  2GMI C;  3WAL A;  1I42 A;  1YIW A;  2R2O A;  3MHS D;  3V6C B;  3L54 A;  1LFD A;  2DAJ A;  3HM6 X;  3OLM D;  2ASQ A;  1YX5 B;  1RRB A;  3H9D A;  2AL3 A;  3VUX A;  2GBK A;  2JZ3 B;  2IY1 B;  1WFY A;  4KDI C;  1GUA B;  2CR5 A;  4FLH A;  2BF8 B;  3ZNG C;  1OGW A;  3PS6 A;  1H8C A;  4XX5 A;  1WE6 A;  2L8J A;  1C1Y B;  2LXA A;  1E8Z A;  1RLF A;  2NVU I;  1HE8 A;  4KVG B;  3VFK A;  5AZH A;  3VH4 B;  1SIF A;  4DXA B;  1WGY A;  5E6P A;  1E8Y A;  1Q1O A;  2KFK B;  2L00 B;  3PZD A;  2ZNV B;  3N32 A;  4MGK E;  4ZRJ A;  4EZJ A;  1LM8 B;  2XK5 B;  3RZF A;  2NBV B;  2WWZ A;  5HKH A;  4B95 A;  1LXD A;  2BWF A;  4ZRI A;  3SHQ A;  3ZDM C;  5FR6 A;  3L08 A;  1EO6 A;  4DK5 A;  3PGE A;  4W9F A;  4HJK A;  5DCN A;  2MP2 A;  1R4N I;  3V6E B;  3X23 A;  2LZ6 A;  4JLC A;  4B6W A;  4DDG D;  3QWZ B;  4K7S A;  1OEY A;  3VTW A;  3ZLZ A;  1WJ4 A;  1E8X A;  2G3Q B;  2ZJD A;  2N7D A;  3M62 B;  4FHJ A;  4E74 A;  1WXM A;  3ZNI D;  5TR5 A;  4BKT A;  2C5L C;  2MBB B;  2Z59 B;  4WJN A;  3ZRF A;  4M8M A;  3O65 B;  1P1A A;  2FUH B;  3IHP C;  2XBB C;  3M95 A;  5JH5 C;  3W1Y A;  3WAN A;  3L13 A;  4AOF A;  3DVG Y;  4AUQ C;  2RR9 A;  2FID A;  4GB9 A;  2D3G A;  2C7M B;  2KHW B;  3VTV A;  1WMH A;  1P9D U;  1WZ0 A;  2KX0 A;  4GDL A;  2MBH A;  2RGF A;  3D32 A;  2CS4 A;  1V81 A;  3TMP B;  2M1M A;  2KTR A;  3C0R B;  3QC8 B;  2NBW B;  3BY4 B;  2HJ8 A;  1RFA A;  4MJS B;  4HDO A;  1T0Y A;  1YQB A;  1IPG A;  2GBN A;  3APC A;  2JT4 B;  4G50 A;  3A9K B;  2KWU B;  1Z5S B;  2PPH A;  3N30 A;  2LVO A;  4FA6 A;  3WA0 A;  4E71 A;  5JZE B;  4DHJ B;  1WMH B;  3ZDT A;  3HM3 A;  3TJP A;  5AZG A;  2REX A;  1WF9 A;  4CO7 A;  1WJ6 A;  3AU4 A;  3QAQ A;  5JHA A;  3PVL A;  1Q5W B;  2KJ6 A;  2LI5 A;  3CF6 E;  4BKS A;  2L3Z A;  4OVU A;  1R4M I;  4AJY B;  1A5R A;  3CST A;  1WXA A;  1QZE A;  2BYE A;  3V62 A;  1RAX A;  3TL5 A;  1TTN A;  3RZW C;  1XT9 B;  4EZL A;  4N9F 4;  3W1S C;  1NDD A;  2BYV E;  4HDQ A;  1WJN A;  3PRZ A;  2DYM A;  2ZPY A;  3JSV A;  3QAR A;  5LXH A;  2KWC A;  3RD2 A;  3AUL A;  3I3T B;  2J7Q B;  2G45 B;  2XK5 A;  1UBI A;  3H6N A;  2CHZ A;  3A4S C;  4KIK B;  1WJU A;  3NZU A;  4HCP B;  3L16 A;  1YD8 U;  4AP4 C;  4BKS D;  4KV2 A;  2MA9 B;  2LGX A;  2J0K A;  2AYO B;  4EZK A;  4WJO A;  2DZM A;  2KQ7 A;  2MW5 A;  4ICU A;  1EF5 A;  3M63 B;  4ANW A;  2DZI A;  3GOE A;  3IBE A;  4MGY E;  3ZTC A;  4E3C A;  2JPH A;  2KK8 A;  3QHT A;  2B3A A;  4W9J A;  3QIJ A;  1KOT A;  4BBN C;  4IWO A;  4EUT A;  1X1M A;  1D3Z A;  4AJW A;  2V4L A;  2C7N B;  1M94 A;  2L0F A;  1WGH A;  3RYT A;  3NY5 A;  2LJ5 A;  4PYU A;  4W9E A;  3PT2 B;  3X0W A;  4BKG A;  3UIP B;  2IZV B;  2V3S A;  3A9J A;  3TBL D;  3V60 A;  4CHK A;  2KXJ A;  4NQL B;  4XZ4 A;  3KUC B;  4ZDV A;  3VUY A;  1V6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...