2KMAA

Nmr structure of the f0f1 double domain (residues 1-202) of the talin ferm domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
178
structure length
178
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin 1
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 34
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmaA02
2LXCA 2NBUA 4FJZA 2C60A 4DHZE 5E6OA 2AL6A 3U7DA 2GBNA 2EKEC 2JRIB 3QX1A 4A3OA 1P3QU 2CKHB 3ZTCA 1VCBA 2MSED 2DENB 4FJYA 2BKFA 4PYUA 4WAAA 3RULA 2KFKA 3VTWA 2HE7A 3N30A 3KW5B 3T9LA 2XBBC 3MHSD 5KHQA 2KFKB 1ZKHA 3ENEA 4NJ6A 2BYVE 4PS7A 3RZWC 3EHVA 1AARA 2DZKA 2FUHB 2V3SA 1UD7A 3R3MA 1P98A 4IWPA 1WFYA 3OJ3A 4ANWA 2LI5A 2BWES 4II2B 1WZ3A 1V6EA 2A5UA 1PQSA 2MBBB 3R7QA 2JVCA 2CHZA 1YQBA 2DZIA 1UGMA 3PV1A 1P1AA 2JUOA 1R4NI 3CSTA 4KSLC 2UWQA 2KWUB 4KV2A 3KUDB 3PSEB 3LDZE 4NQKE 2JT4B 3W1YA 1UBIA 3IFWB 3DBRI 2IYDB 1IPGA 1LM8B 2JZ3B 2K25A 3MJWA 3A1QA 3KVFB 2GBJA 4HPMB 3VFKA 3PPAA 4WJNA 3UIPB 1K8RB 4XX5A 3A1QB 2O6VA 4HDOA 5CHVC 4EZKA 2AEHA 4GXBA 1NDDA 4PS8A 2KX0A 2CS4A 2O6VB 3GOEA 3ZW3A 4IG7B 2KFJA 2BWFA 4KSKC 3V6EB 2IO0B 1R4MI 2NS5A 4TUUA 4WJOA 4F1SA 2LGDA 2MA9B 2KO3A 3A33B 1RAXA 2LRUA 3VTVA 4N9F4 5LXHA 4ICVA 1TTNA 1NI2A 2KVRA 1WJNA 2NPTA 4FHKA 4CYEA 3JSVA 1RLFA 1WGDA 2KTRA 4G0NB 1EF5A 3RD2A 3DPDA 1S1QB 2NPTB 3QJZA 2DYBA 4IM3A 3JSVB 2KTRB 3DVNU 5CHWA 4BFRA 4MM3A 1I42A 3PZDA 1RRBA 4XC2A 1TZ1A 1WMHA 1P0RA 1Q1OA 2KTFA 3WA0A 3NHEB 1WMHB 1YIWA 3H1UA 2L3ZA 1G6JA 4DK5A 4LDTD 2RPQA 1LQBA 3DBLI 3P2BA 2JY6A 3KYDD 4HJKA 2IZVB 4HCNB 2J0KA 5IAAC 4ZRIA 4TV3A 3QWZB 1ZW7A 2JXXA 1WXVA 2ZNVB 3L08A 2J7QB 2BYFA 5BO4B 2O6VD 4BBNF 2L0FA 1L2NA 4P7IA 4OVVA 4JL9A 3X23A 1E5WA 2N7EA 4WWNA 4DXAB 5IA7A 4G3XB 3DVGX 4HVBA 3L54A 2BPSA 3H7PA 1KM7A 2C7MB 2Z59B 3VUWA 1UZXB 1WRDB 2KN5A 2YVCA 3U8ZA 5J17A 4DHJB 3H7PB 4K7UA 3AU5A 5JHAA 3ZRFA 2LWPA 1WX7A 4WJQA 2ZZPB 1V2YA 2KC1A 1H4RA 3R66C 2K6DB 4AOFA 2V1YA 3A9JA 3W1SA 3NOBA 4I6PA 1HE8A 2PJHA 3B08A 4NY0A 2MBHA 4FULA 4LJOB 4RM8A 1H8CA 2JRHA 3H6NA 3A9JB 3OLMD 5DPWA 4WQOB 1V81A 4HK2A 5AZHA 3VDZA 3JW0X 1WGHA 2OOBB 4I6NB 4FLHA 3A4RA 5CTRC 3K9PB 1J8CA 1WGRA 4W9EA 4IM0A 1XQQA 3PLUA 4G11A 2KXJA 4URKA 4KDLB 1WGGA 2KMCA 3SDLC 3K9OB 3VVWB 2KKCA 3HHMA 3WAOA 3ZDMC 2KLGA 4MEMA 5AZFA 4II3B 4ZRKA 2KJHB 3PVLA 3JVZX 2R2QA 3DQVA 3L16A 2RR9A 3VAWA 4ANXA 2MBQA 5LLIA 4EUTA 3MTNB 1GUAB 2PEAA 4MGZE 1IP9A 3TL5A 4W9LA 1WH3A 2D3GA 4F8CB 3PHWB 5D7GA 2MQJA 1XT9B 2QHOA 2N1VA 2ZPYA 4MGYE 4HDQA 4WWOA 1WX8A 2DYMA 3UF8A 3B1LX 3R7RA 1V49A 5FR6A 2KDBA 3V6CB 1YX5B 1GC6A 3UINB 4E74A 4B9KA 2KWVB 1GC7A 1LFDA 2M4NA 5HKHA 1WY8A 2IY0B 2N9EB 4JQWC 4DHJD 1GJZA 4ICUA 1V9JA 3QAQA 1V5OA 4LDTB 2J0MA 3VUXA 1WJ4A 4J6IA 1WI0A 2K39A 3O65B 2AWTA 2LGXA 5D94A 4IC7B 3TBLD 1GNUA 1WX9A 2BF8B 2KNBA 2FIFA 1F9JA 2FIDA 3ZLZA 2J0JA 1WYWB 2GBMA 4BKSD 2M8SA 4K1RB 2DYOA 4GDKA 5C23A 3DBSA 1V5TA 4EZJA 4GB9A 2R2OA 1E8ZA 2ZCBA 3TCAA 2LRWA 4GDKB 2GOWA 4GDLA 2KC2A 4FHJA 1YJ1A 4IM2A 5DPSA 1V86A 3V61A 3KH0A 2WDTB 3ALBA 1WZ0A 1UELA 2M1MA 3ZVVA 1UBQA 4GDLB 1C3TA 3UQAA 4W9IA 4G50A 4K81A 2EMTA 3KUCB 3TJPA 3ZIMA 4GU2A 1OTRB 2LXAA 5D2MB 3ECIA 1WM2A 2RGFA 3PHXB 3L13A 2KD0A 3QIJA 3AULA 2KQSA 2RD0A 4IW0A 2MCNB 3WAPA 2MW5A 4ZDVA 3ZNID 1LXDA 2ZVNA 4PYZA 4FN2A 2IO1B 5TR5A 3TIXA 5KHOA 2ZVOA 4GGQA 4KZ0A 3SD5A 2KHWB 2CHXA 4M8MA 2DHZA 4WWPA 4MELA 2MWSB 3DBHI 3APFA 4FBJB 3C0RB 1YX6B 5DPRA 3RCZA 1WR6E 2NVUI 2Y5BB 4GSWA 4FADA 4ZYNA 3T8MA 4EFOA 1TGZB 3L17A 2DZMA 2WX1A 2MBEA 2LASA 3N3KB 4MGIE 4AP4C 3WANA 4MSMB 3OJ4B 2KMAA 2FCSA 2FAZA 1ZGUB 2KDEB 1WE7A 2N9PC 3I3TB 1YD8U 4BOSC 1CMXB 3N32A 2G4SA 4RMAA 5AEKB 2K1FA 4W9HA 3LJ3A 3BINA 2JZZA 3QA8A 4DHZB 2WWZA 3A4SC 1WR1A 3L0WB 1L7YA 3DOWA 1OQYA 4ASWC 2XK5A 5EDSA 2CR5A 3WIMA 1KOTA 4FA6A 3M63B 2KOXA 2C7HA 2NBVB 4W9CA 4AJWA 1WGYA 2NBWB 5J18A 2FCMA 2MBOA 2XK5B 4CO7A 4NNJB 3U30A 3ZNZB 3VUYA 3ZNGC 1Y8RC 3IBEA 1EO6A 3ZDTA 1WIAA 3QK0A 3PS6A 3APCA 2L00B 3VQIA 1D3ZA 4BKSA 2MP2A 2V4LA 5DPTA 2ZJDA 4EKUA 1WXSA 5J2RA 2D11A 3DDCB 3EFUA 4HXDA 2MP2B 1NBFC 4AUQC 2BKRB 2ZPNA 3V60A 1VD2A 4K7SA 2ZEQA 2KK8A 2D2QA 2MX2A 2K6QA 3IG3A 4TQ1A 1ISNA 4LJPB 2ZCCA 3JYUA 3X0WA 2KQ7A 2KZRA 2NCNA 4IWQA 3RYTA 1I35A 3APDA 2OJRA 4W9JA 3UGBB 1A5RA 2D07B 2CU1A 2PE9A 2K8BA 2N9XA 2L7RA 3KUZA 1WXAA 5L95C 3ZUNA 3IVFA 4PS3A 2HJ8A 1EUVB 2M17A 3V62A 4HWIB 1OGWA 3RZFA 1MG8A 2LUEA 2DAJA 3GZNI 2AL3A 3QARA 4MH0E 2ASQA 4W9FA 5E6NA 1S3SG 2FCQA 3VXWA 5JH5C 2G45B 4M0WB 3RUIB 2ZNVC 4NJ7A 3SU8X 4A20A 3PT2B 1E7UA 2KANA 3CF6E 5CX3A 5G55A 3PTFC 4RM9A 2JF5A 4E3CA 4A3PA 1E7VA 3M62B 1TBEA 2DZJA 1SIFA 1WJUA 2O2VA 1E8YA 3AXCA 3QHTA 4MDKE 4MJSA 4BBNC 1M94A 1XD3B 3ML8A 2DAFA 3KYCD 4B95A 2IY1B 3PLVA 3ML9A 4LCDE 2O2VB 3DVNV 1SE9A 2LZ6A 3D32A 4MJSB 2LJ5A 2HD5B 3HM3A 2PE6B 2D10A 2KDFB 2K8CA 3AU4A 4ZRJA 2LGYA 4WJPA 4GIVA 2G4DB 2NR2A 2AYOB 2N1WA 2IO2B 2JPHA 5E6PA 4ANUA 4BOZB 3ZKJC 1WJ6A 4JLCA 3W1SC 4MSQB 2FNJB 3VH3B 1RFAA 4W9KA 2JWZA 2Z0DB 3TMPB 3RT3B 4TQ0A 4F7ZA 2YLMA 3A9KA 4YL8A 2BYEA 2LVPA 5JHBA 3M95A 1OEYA 4W9DA 4W9GA 2EMSA 1Q0WB 3A9KB 3DCGA 2FCNA 3PGEA 1T0YA 1E8WA 4NQLB 4DDGD 5GMVA 4X57B 4IUMB 3UQBA 2C9WB 2HTHA 4AWJA 2REXA 3CSFA 1KLVA 1SGHA 3HK0A 3WAMA 4B6WA 2GBRA 2LVOA 5CHFA 5JZEB 2IBIB 5DCNA 2WYQA 5L83A 2DX5B 3AI5A 2GBKA 1P9DU 2LD9A 3Q3FA 4FJVB 1WE6A 5C1ZA 1C1YB 2I1JA 1UH6A 3Q3JA 2RSUA 3EC8A 3BY4B 4EZLA 2UYZB 1IYFA 4AJYB 1KJTA 2G3QB 4M8NA 4ANVA 2L0TA 5G2NA 1JRUA 3NS8A 3ONSA 5D6JB 2L05A 1FXTB 2M0XA 3ZTDA 2K8HA 3OAWA 4HPLB 4DBGA 1Z2MA 2B3AA 3HIZA 4MGKE 1J0GA 2IO3B 4GOCA 3NZUA 3DVGY 1GG3A 2I1KA 2W9NA 3ZRCA 2VRRB 1V80A 4GN1A 4BKGA 5AZGA 3PRMB 3SHQA 3VHTC 3VH4B 2XEWA 2KX3A 2MRPA 4KIKA 4EEWA 3QQ8B 4NAWA 4IWOA 1EF1A 4XZ4A 2PPHA 3PRZA 2C7NB 3PREA 4EOYA 3VTUA 3QCAA 2KLCA 4DDID 4KIKB 3L10B 4NAWB 1X1MA 2BGFA 4KDIC 3CMMB 3EECA 4BKTA 3M3JA 1Q5WB 1QZEA 2MLBA 3PRPB 1Z5SB 3WALA 4K7WA 3ZNHB 1WF9A 3ZO5B 4DWFA 4E71A 5LXIB 4GMVA 2KJ6A 3H9DA 3NZSA 3S2AA 2C5LC 3IHPC 4JIOU 3UIOB 2LVQA 1U4AA 2KJRA 4KZCA 1BT0A 3NY5A 2A4ZA 1J19A 4NPNA 4OVUA 1E8XA 2L8JA 2N4FA 2KWCA 1WXMA 3H7SA 2CHWA 2WX0A 4CHKA 2N7DA 4BVUC 1E90A 4HLEA 4TKNA 4HCPB 2Z0EB 3QC8B 1WM3A 2L76A 1OEYJ 4KVGB 4I6LB 3B0AA 4JGHB 2GMIC 3HM6X 2KDIA
chains in the Genus database with same CATH superfamily
2G1EA 4FJZA 2GBNA 2EKEC 2WXOA 1VCBA 2DENB 4L23A 3RULA 1D5MC 3VTWA 3FAHA 5BYSA 3T9LA 2KFKB 5T8IA 4PS7A 2FUHB 1UD7A 1P98A 4IWPA 1WFYA 1OQRA 2LI5A 4II2B 1V6EA 1PQSA 2MBBB 1KRHA 2D3AA 2CHZA 1YOVB 1UGMA 3PV1A 2UWQA 3KUDB 1L0VB 3PSEB 1DOIA 1SSNA 3IFWB 4TSSA 2IYDB 1LM8B 2X8XX 3MJWA 4RFBA 3KVFB 2W54A 3VFKA 3PPAA 1K8RB 2KX0A 4KX6B 3ZW3A 3RNAC 4IG7B 2KFJA 2IO0B 4TUUA 4F1SA 4NAMA 4XDCA 4FHKA 4JWUC 3MC9A 1EF5A 4C7ZA 4IM3A 2HTME 1JALA 2KTRB 1I42A 2WXQA 1TZ1A 4YTMB 1P0RA 3DBHB 4KGRA 2L3ZA 4LDTD 1LQBA 5IOIA 1XLNA 1ZUD2 3N1XC 2IZVB 3AE9B 4HCNB 1YNTE 4IOIE 4TV3A 4A55A 1XCTL 3TSSA 3QWZB 2IGHA 1AYFA 2J7QB 1FFUA 1ET6A 5FKAC 2L83A 2L0FA 1L2NA 3NRZA 4G3XB 4XE0A 1EM7A 2YVCA 3U8ZA 5J17A 3H7PB 2Y5CA 3P4PB 1FD6A 2ZZPB 2K6DB 3A9JA 3W1SA 3NOBA 1E0ZA 5DPWA 4WQOB 3URYA 3H8HA 2WXJA 3A4RA 1FEHA 2QMTA 4ZYSA 4LNKA 1DYQA 3GB1A 4G11A 4URKA 4ZRKA 2H88B 2ON8A 4LTUA 4TMAB 2R2QA 3DQVA 2RR9A 5H92C 4JPSA 4W9LA 3Q8BA 4F8CB 1Q10A 5D7GA 3AE2B 2BT6A 4N59A 1AW7A 4L2YA 2XN9C 3VRAB 3RI7C 3R7RA 1YX5B 3UINB 5HKHA 4XDDA 2N9EB 4ICUA 2CJOA 1WJ4A 1ROEA 1M4VA 1WI0A 4C00A 3AE7B 2WXIA 2KNBA 2FIFA 4J3OD 1C78A 2GBMA 1JROA 2ZW1A 1E8ZA 3ABVB 1IGDA 3TCAA 2LRWA 4GDKB 2GOWA 2KC2A 4FHJA 1MFWA 3Q8EA 1UELA 3UQAA 4G50A 1JQ4A 2NTSA 2KACA 2D3CA 2LXAA 1C4PA 3U52E 3C8YA 3PHXB 2KD0A 4NJCA 2B76B 1J7BA 4IW0A 2MCNB 1N62A 4PYZA 5TR5A 3OWEB 1L4ZB 3SD5A 4M8MA 2BBCA 5AUIA 3RCZA 1T0RC 2NVUI 3P1MA 5G5HA 1TGZB 3PZ8A 2LASA 1AN8A 4MGIE 3WANA 2BS4B 4C80A 3P4SB 5AEKB 3BVGA 3BINA 2JZZA 1JWSD 4DHZB 2WWZA 4LLGM 2XK5A 2M56B 1V1PA 1YQ3B 2KOXA 4W9CA 4AJWA 5J18A 1WGYA 1C4CA 2FCMA 4REZA 4ZRQA 1VZ7A 3IT4B 1YMHE 4KKIA 3ZDTA 1WIAA 3N9YC 3PS6A 3APCA 2L00B 3VQIA 1N63A 3AEGB 3DDCB 4HXDA 1SE4A 3V60A 2ZEQA 1VZ8A 4KKJA 1NYRA 2KZRA 2OJRA 2N9XA 1WXAA 2MJ3A 5L95C 2HJ8A 1OGWA 3RZFA 3GZNI 2AL3A 2WDQB 1S3SG 3AE5B 3IAM1 1WRIA 4M0WB 2ZNVC 4NJ7A 3PT2B 3N1YC 5CX3A 2WU5B 4RM9A 4E3CA 4M01A 2DZJA 2L52A 4MJSA 4YWGG 1XD3B 3ML8A 3PLVA 1XXGA 2G9HD 3D32A 2LJ5A 2KDFB 4ZRJA 2G4DB 2AYOB 3R2TA 1I4HA 2KQ4X 5EE0A 4BOZB 3SR6A 3BK2A 2V9HA 4CQNA 3Q3OC 3MP9A 3P42A 1KFYB 2BYEA 2Y5PA 1Q0WB 3A9KB 2FCNA 1JMLA 1SJED 4DDGD 1NENB 4IUMB 4YTPB 2C9WB 2HTHA 2H89B 3HK0A 3WAMA 4B6WA 1UGJA 2IBIB 5DCNA 3PO0A 2GBKA 4JX1C 1P9DU 2LD9A 1NVID 1C76A 1SBBB 2VZKB 2WXKA 1IYFA 1KJTA 3ONSA 2QEJC 3AEFB 2M0XA 1FO4A 4HPLB 2B3AA 1J0GA 2K5PA 1VJKA 4RNAA 5AZGA 1C77A 3VHTC 2XEWA 2KX3A 3TEYA 2ACZB 3PRZA 4LK0M 1F2RI 2CJNA 4NAWB 1X1MA 1TZOA 4RGOS 3AN1A 3PRPB 5BYRA 3W2DA 1GB4A 3ZO5B 1U4AA 4OVUA 4BZAA 2A4ZA 4YTNB 2N4FA 2VZKD 4FXCA 4B0EA 2Z0EB 3QC8B 4KVGB 4I6LB 1FRDA 1FNUA 3B0AA 4AQ7A 5E6OA 3U7DA 3B2GA 1L6VA 2CKHB 4NZLB 1EWCA 5KHQA 2XBBC 2J4XA 1QKZA 4RCOA 3EUB2 3AMZA 3EHVA 3FC4A 1AARA 1ET9A 3OJ3A 4RH6A 2BWES 1BMLC 2DZIA 1SE3A 1TS4A 1R4NI 4NQKE 2SEBD 1UBIA 2QC8A 3DBRI 1IBXA 2K25A 2JZ3B 4Q2JA 3A1QA 4HPMB 1QOGA 2O6VA 2AEHA 2LGSA 3GOEA 2BWFA 4KSKC 3V6EB 1UWMA 1ZPSA 3RNBC 3I63C 5GXGB 2MA9B 3A33B 1JWMD 3VTVA 5LXHA 4ICVA 2KVRA 5MPOA 1FRRA 2NPTB 3QJZA 3JSVB 4YSZB 3TEWA 1N5XA 1RRBA 1WMHA 1Q1OA 4MM3B 3NHEB 1YIWA 3H1UA 3DBLI 2JY6A 5HI1A 1IUEA 5BMHA 2J0KA 5IAAC 2JXXA 4RF1A 1WXVA 1D5XC 3ZGZA 2V3PA 4KGTA 4P7IA 3X23A 4HVBA 1GOZA 2BPSA 1WXQA 3T3OA 2VH1A 3W9CB 2HJ1A 1K51A 1QOAA 3NVVA 4WWMA 4RGTA 4K7UA 2J42A 2IGDA 2LWPA 4WJQA 1FFVA 2PVGC 1V2YA 3IAS1 1H4RA 2V1YA 4NY0A 4I6PA 4RM8A 4LNNA 1HTQA 1J7AA 1CQVA 2JRHA 4C4VB 3KQ4A 2E3TA 1V81A 3JW0X 5FR3A 2W3RA 4FLHA 1WGGA 2OJWA 2KMCA 3WAOA 3VVWB 3HHMA 4MEMA 5C2TB 2MBQA 1NYQA 4EUTA 1IP9A 3TL5A 1JRPA 3PHWB 2RPVA 3C19A 2QHOA 2ZPYA 4HDQA 1WX8A 2DYMA 5IP4D 3V6CB 4E74A 2KWVB 2M4NA 3BZDB 3DHIC 4JQWC 1V5OA 5G5GA 4LDTB 1I4RA 2K39A 3O65B 1CZPA 1L4DB 2BB6A 2BF8B 2FIDA 3ZLZA 2V4IB 2J0JA 4RF0A 4K1RB 2DYOA 4LNOA 4GB9A 3NVWA 4GDLA 4IM2A 5DPSA 1WZ0A 3ZVVA 1PFDA 1WWTA 4K81A 1ZXIA 3TJPA 1QOFA 1WM2A 2FE8A 3L13A 1F77A 1Y56A 2KQSA 2MW5A 4UDUC 4P6VF 2IO1B 3TIXA 3V05A 1TJEA 3I57A 3FILA 1TKGA 2KWDA 1GAQB 4WURA 3U4EG 5DPRA 1WR6E 3LYYA 4GSWA 2GB1A 1FNVA 3B9JA 2WX1A 2Q5WD 3HRDD 3AE8B 4AP4C 3BVMA 4MSMB 3SFDB 2FCSA 2KDEB 3BYTB 1ZGUB 1WE7A 4ZDVA 1OFFA 1YD8U 4BOSC 1CMXB 2G4SA 4RMAA 2AQ3B 2K1FA 3LJ3A 1ZDVA 3L0WB 1L7YA 1OQYA 3PZ7A 3WIMA 2ICIA 2MJEA 2NBWB 2MBOA 2WLBA 5I4DA 4NNJB 1XLPA 3U30A 3ZNGC 1Y8RC 2J52A 3AE1B 2V4LA 2ZJDA 5J2RA 4ARCA 1KLGD 2MP2B 4AUQC 4ZHOA 1SXTA 4HRSA 2KK8A 2RDGA 3IG3A 4TQ1A 2MEKA 2DWQA 4LJPB 4R3DA 4IWQA 3RYTA 2XNAC 2PMVA 3APDA 3UGBB 1FIQA 5HHDG 3IT6B 2JYEA 3ZUNA 1EUVB 2M17A 2BYTA 4HEA1 3VR9B 1BUIC 3QARA 5JH5C 2RMMA 3EGRA 4A20A 3RUIB 3MHZA 1E7UA 1RFKA 3I5JC 1SIFA 1WJUA 2WDVB 3AXCA 3QHTA 4HPPA 1YN5A 1TS3A 1LGRA 2O2VB 3TEZA 1SE9A 2LZ6A 2KN4A 1R4NB 2QDFA 1HA5A 2D10A 2K8CA 4WJPA 4GIVA 3DBRB 2JPHA 4GLSC 3AM9A 3ZKJC 2FNJB 3N1ZC 1RFAA 2BS3B 1K50A 2JWZA 3RT3B 1TKEA 2YLMA 4YL8A 3AEEB 2LVPA 5JHBA 1QOBA 5H8YE 1T0YA 4X57B 1VDVA 1N5WA 2REXA 1K52A 3CSFA 3ZXRA 1KLVA 1SGHA 4JE3B 1A70A 4FJVB 3MC8A 2ZW0A 1BXTA 3BY4B 4AJYB 2L0TA 3AE6B 3E56A 3TUOA 1GPXA 3OAWA 3DBLB 1T6BX 2N9LA 4QAYA 3NZUA 3DVGY 1GG3A 3Q14C 2I1KA 3P63A 2W9NA 2QJLA 1N6ZA 1V80A 3VH4B 2PW9A 1EU3A 2BQQA 3QQ8B 1EF1A 1TS2A 1QT9A 3VTUA 4O1NA 3QCAA 2KLCA 4KIKB 2ONQA 2Z8LA 1XCQL 4OHJA 2MLBA 4E71A 1Z5SB 3RN9C 4K7WA 4DWFA 4S17A 1EWYC 2C5LC 3IHPC 4JIOU 2LVQA 4ARIA 2KJRA 4KZCA 3NY5A 4NPNA 3Q6BA 2KWCA 2CHWA 4CHKA 4BVUC 4HLEA 3DHHC 4TKNA 4HCPB 1WM3A 3AE3B 2KDIA 1IGCA 3AEAB 2LXCA 4OZCA 2C60A 2AL6A 2JRIB 2CU3A 3QX1A 4A3OA 1XO3A 1EU4A 3BVZA 1B1ZA 4PYUA 2KFKA 4PT5A 2HE7A 3KW5B 3AEBB 2PVOD 3P4RB 1ZKHA 2BYVE 4KGSA 1YQ4B 3BIID 2LHDA 2DZKA 3MFGA 3R7QA 2A5UA 2JVCA 3Q8AA 1YQBA 2QIEB 1P1AA 1UNSA 2NMQA 1I4PA 2KWUB 4PK1A 3T3NA 1XLQA 1K53A 3UIPB 3L4PA 4YXDB 2I2YA 4HDOA 3ZYYX 1N61A 1LO5D 4GXBA 4PS8A 2W55A 2WXMA 1PGBA 1R4MI 2Y3AA 4USAA 4WJOA 2KO3A 4A6QA 3Q3NC 1C79A 1I4QA 4JWSC 2INCC 1WJNA 1VZ6A 4CYEA 1ZDXA 2KTRA 3RD2A 2FBWB 1S1QB 1MPEA 4DQOC 2DYBA 4BFRA 1JWAD 4XC2A 2LFIA 1KTKA 2IPKD 2KTFA 3WA0A 2LMCA 3ZXVA 1G6JA 2VH2A 2JYTA 1KF6B 2MHJA 4HJKA 2JQRB 4WH4A 3NUHB 2M19A 2MJDA 3L08A 5BO4B 1TS5A 4BBNF 2WP9B 1HXYD 1E5WA 2N7EA 4OZAA 4DXAB 1PYWD 3L54A 3H7PA 1KM7A 3VUWA 1WRDB 2KN5A 2K22A 3AU5A 5JHAA 3ZRFA 1WX7A 2KC1A 3R66C 3W5UB 4AOFA 2PJHA 3B08A 1FM0D 1TKYA 4FULA 4LJOB 2YEPF 3A9JB 4MACA 5AZHA 2OOBB 2YEPB 4I6NB 1J8CA 5CTRC 3K9PB 1WGRA 4W9EA 4IM0A 3RNEC 1XQQA 3PLUA 2KXJA 1MHXA 4KDLB 3ZJUA 3SDLC 3HUIA 3K9OB 2KLGA 5AZFA 4N6EB 3PVLA 2KAJA 4A90A 4M00A 3W5VB 1FXAA 1GUAB 2PEAA 1VRAB 2D3GA 3RMKC 2RDBC 4WWOA 2KT7A 1GC7A 5AUKA 3BK1A 1E6EB 1GJZA 3QAQA 4L1BA 3VR8B 3VUXA 2JXTA 2LHEA 2OHFA 4LNIA 1ZE3D 2LGXA 5D94A 4OVZA 3TBLD 1WX9A 3MC0B 1MHHE 2I38A 3OG5A 1WYWB 2M8SA 5C23A 4GDKA 3DBSA 1V5TA 4EZJA 2JU6X 2PLPA 2R2OA 2ZCBA 1YJ1A 4ZRPA 2DNFA 1V86A 3KH0A 2WDTB 1TIFA 3ALBA 2M1MA 2WHIA 2DBYA 3Q3MC 2K9XA 2BB5A 3KUCB 3ZIMA 1F52A 1OTRB 1SB3C 5D2MB 4XYCA 3ECIA 3QIJA 3AULA 2RD0A 3WCQA 3WAPA 3ZNID 3AH7A 4GGQA 4KZ0A 2KHWB 2DHZA 4WWPA 4MELA 2MWSB 4FBJB 2D5GA 4LNFA 2Y5BB 4DXGA 4FADA 4ZYNA 3T8MA 4EFOA 3L17A 2W3SA 1KH0A 2MBEA 3N3KB 2R61A 1VR9A 2IDYA 3OJ4B 2KMAA 1UUPA 3N32A 2WNMA 3AE4B 3HVZA 1FXIA 4ZOHC 1ESFA 2WXGA 3GE3C 5EDSA 1HTOA 2CR5A 1KOTA 2AQ2B 3CWIA 2C7HA 1SEBD 2XK5B 4CO7A 1V1PB 1I7HA 2IGGA 3ZJVA 3GS2A 3VUYA 3IBEA 1KLUD 4A9AA 1PUTA 4BKSA 1ZP0B 1HZ5A 5DPTA 2BKRB 1VD2A 2D2QA 2K6QA 5HFYA 3RNCC 3JYUA 4W9JA 3VRBB 1A5RA 2PE9A 2CU1A 2V3NA 3RFZB 4PS3A 1T5XD 3GZNB 3V62A 4M0WA 2LEKA 2LUEA 4MH0E 3VXWA 2ASQA 5E6NA 1L0YB 2FCQA 2G45B 2WQYB 3CF6E 3KWVA 3PTFC 4ACFA 2LUMA 2JSVX 1UWXA 2WXLA 1TBEA 2BW2A 1HZ6A 3KYCD 3ML9A 2X38A 1CJEA 3DVNV 4MJSB 3HM3A 1T0SC 1E10A 3E9SA 5E6PA 1PDXA 1XLOA 4JLCA 1L6UA 3VH3B 1XEEA 4W9KA 2Z0DB 3TMPB 3A9KA 1STEA 1SIJA 3M95A 4W9DA 4K3BA 2EMSA 4W9GA 3PGEA 5FK9C 3R8BA 1R4MB 1MI0A 4AWJA 1P7EA 4YSXB 2KMMA 2GBRA 5JZEB 2BVCA 3KLSX 2DX5B 1ENFA 3Q3FA 1DGJA 1WE6A 5C1ZA 1UH6A 4M02A 3Q3JA 2RSUA 4XWTA 1V8CA 4EZLA 2L32A 2G3QB 5G2NA 1JRUA 3NS8A 5D6JB 2L05A 1JW9D 1RYJA 1VLBA 1Z2MA 2WS3B 3HIZA 5HG2A 3UI3A 1CK1A 2HDEA 2VRRB 4GN1A 4HJGE 3SHQA 2N0SB 2OEDA 3V3XA 4EEWA 4NAWA 1E9MA 4XZ4A 2PPHA 3PREA 2C7NB 4OW0A 4YSYB 1I4GA 3L10B 2M0AA 1WSPA 4KDIC 3NJTA 3CMMB 3EECA 1Q5WB 1QZEA 3DWGC 3WALA 5LXIB 4GMVA 1DOXA 2KJ6A 3S2AA 2WXNA 3GE8C 3UIOB 3ZRCA 2E6XA 1J19A 2D3BA 2WXHA 1GB1A 2W82A 2QILA 1I4XA 2WX0A 2N7DA 2L76A 2GMIC 3HM6X 2NBUA 4DHZE 1P3QU 3ZTCA 2KYWA 2MSED 4FJYA 2BKFA 4WAAA 3ETRA 1C4AA 3N30A 3MHSD 3ENEA 3HVDA 1AWDA 4NJ6A 3RZWC 2WGSA 5EE1A 2V3SA 3R3MA 4ANWA 1WZ3A 1F2RC 2QSDA 2NTTA 2JUOA 3CSTA 4KSLC 4KV2A 3LDZE 2JT4B 3U7ZA 3W1YA 1F0ZA 1FMAD 1F1HA 2INPE 1QLBB 1IPGA 5LNK1 2GBJA 1IBXB 4WJNA 4XX5A 1V1OA 3A1QB 5CHVC 1L5PA 4EZKA 1OQQA 1NDDA 4HROA 2CS4A 2O6VB 2WXRA 2NS5A 2LGDA 1RAXA 2LRUA 2WU2B 2PIAA 3GP7A 4N9F4 1TTNA 1NI2A 4WIPA 3MJ5A 2NPTA 1TT5B 1HEZE 3JSVA 1RLFA 1WGDA 4G0NB 4C7YA 3DPDA 4P1CC 3DVNU 5CHWA 4MM3A 3PZDA 5EE3A 3NZ3A 1WMHB 4DK5A 2RPQA 4RGNA 3AECB 2GRIA 3P2BA 3KYDD 3J9CA 4B0MA 5IKCM 4ZRIA 5TSSA 1XF5L 1ZW7A 2ZNVB 2L1AA 4DXFA 3SEBA 1JCKB 2BYFA 2O6VD 5BMIA 4OVVA 4JL9A 5D3DA 4P16A 4WWNA 5IA7A 3DVGX 2GLSA 2FUG1 2C7MB 2Z59B 1UZXB 4DHJB 3DWMA 4C4VA 2K3UA 1HE8A 2MBHA 1H8CA 3H6NA 3OLMD 3B2FA 1E7PB 4HK2A 3VDZA 1WGHA 3ZJTA 1V97A 2KKCA 3ZDMC 2JZPA 4II3B 2DLBA 2KJHB 3JVZX 3L16A 3VAWA 2WXPA 4ANXA 5LLIA 3MTNB 4MGZE 5E6JA 1WH3A 2MQJA 1XT9B 1YJJA 5IO9A 2N1VA 4MGYE 3ZQ4A 3UF8A 2BTEA 4WQMA 1QQRA 3B1LX 3Q69A 1SF0A 1V49A 2PKOA 2KDBA 5FR6A 5BYQA 1GC6A 4B9KA 1LFDA 1WY8A 2IY0B 2LGIA 4DHJD 1V9JA 2SAKA 2J0MA 1R7SA 4J6IA 4HKZE 2AWTA 2J53A 3U2SC 4IC7B 4ITKA 4US9A 1ACCA 1GNUA 1QF6A 1F9JA 3BYYB 4BKSD 1SJHD 1T3QA 1ZXHA 2WDRB 2UU7A 3IXSA 3V61A 2IJ0A 1UBQA 4GDLB 1C3TA 4W9IA 2EMTA 3NVZA 4GU2A 1YN4A 2RGFA 1PGXA 3AB5A 4P1BC 1P7FA 1LXDA 1T0QC 2ZVNA 4FN2A 1D4BA 5KHOA 2ZVOA 1SE2A 4HKQA 4BAXA 2CHXA 1PGAA 4YT0B 4H2AA 5C3JB 3DBHI 3APFA 3LB8C 3C0RB 1YX6B 3FILB 2N7JA 3NS1A 2DZMA 3R2IA 2JWUA 1JWBD 4XGAB 1C9FA 2FAZA 2N9PC 3I3TB 2BS2B 3TEXA 3KWLA 3I9V1 3Q8FA 4W9HA 3QA8A 2N9KA 4MT5A 1J7CA 3A4SC 1WR1A 1YN3A 3EA6A 3DOWA 4ASWC 4FA6A 3M63B 2NBVB 3AV8A 2TSSA 2INDC 1NI3A 3LXFA 4MH8A 3O13A 1L0XB 2KVZA 2V0GA 3ZNZB 1FPYA 1EO6A 4WAFA 1TYGB 4US8A 3QK0A 4OZBA 1D6EC 1D3ZA 2MP2A 2PTLA 1TY2A 1WXSA 4EKUA 2D11A 3Q2AC 3EFUA 5D3IB 1NBFC 2ZPNA 4K7SA 5JXVA 1FCCC 2MX2A 1ISNA 2ZCCA 3X0WA 2KQ7A 2NCNA 1FCLA 1I35A 2D07B 2K8BA 2L7RA 3KUZA 3Q8CA 1RWSA 3IVFA 2KDMA 4IDIA 4HWIB 1MG8A 3AEDB 4K3CA 1TY0A 2DAJA 2INNE 4W9FA 4AS1A 1UF0A 3SU8X 2K0PA 2KANA 4RGMA 5G55A 1FNWA 2JF5A 4A3PA 1E7VA 1ZOYB 3M62B 2LJIA 1JWUD 2O2VA 1E8YA 4MDKE 4BBNC 1M94A 3P4QB 2DAFA 5BMGA 4B95A 2IY1B 4LCDE 2HD5B 2PE6B 3AU4A 1MJDA 2LGYA 2NR2A 4ZHPA 2N1WA 2IO2B 1MVKA 1YJIA 5EE9A 4D2KA 4ANUA 3DHGC 4XWWA 1WJ6A 2EKIA 3W1SC 4MSQB 2AX5A 1D5ZC 3RNGC 4TQ0A 4F7ZA 1B9RA 5IN7A 1OEYA 1NEKB 3DCGA 4NQLB 1E8WA 2EELA 5GMVA 2GI9A 3UQBA 2MH7A 4S0RA 2LVOA 5CHFA 1QILA 2WYQA 5L83A 3AI5A 1C1YB 2I1JA 3RPFC 1DOYA 3BWUD 3EC8A 2UYZB 4M8NA 4ANVA 2AQ1B 1FXTB 3ZTDA 2K8HA 4DBGA 4MGKE 2IO3B 4GOCA 1WYGA 4BKGA 3N20C 3PRMB 4EE2A 2MRPA 4KIKA 1WGKA 3EFCA 4C56C 4IWOA 1RM6C 4EOYA 1HQRD 4N58A 3SFEB 4DDID 2BGFA 3RNFC 4BKTA 3M3JA 3ZNHB 3NG0A 1WF9A 1N60A 3H9DA 3NZSA 2JX5A 1BT0A 1E8XA 1MG4A 2L8JA 2WXFA 1WXMA 3FKYA 3H7SA 4IKGA 2QCZA 1E90A 3CIRB 1OEYJ 3NVYA 4JGHB 2RDHA 4A8XC
chains in the Genus database with same CATH topology
2LXCA 2NBUA 4FJZA 2C60A 4DHZE 5E6OA 2AL6A 3U7DA 2GBNA 2EKEC 2JRIB 3QX1A 4A3OA 1P3QU 2CKHB 3ZTCA 1VCBA 2MSED 2DENB 4FJYA 2BKFA 4PYUA 4WAAA 3RULA 2KFKA 3VTWA 2HE7A 3N30A 3KW5B 3T9LA 2XBBC 3MHSD 5KHQA 2KFKB 1ZKHA 3ENEA 4NJ6A 2BYVE 4PS7A 3RZWC 3EHVA 1AARA 2DZKA 2FUHB 2V3SA 1UD7A 3R3MA 1P98A 4IWPA 1WFYA 3OJ3A 4ANWA 2LI5A 2BWES 4II2B 1WZ3A 1V6EA 2A5UA 1PQSA 2MBBB 3R7QA 2JVCA 2CHZA 1YQBA 2DZIA 1UGMA 3PV1A 1P1AA 2JUOA 1R4NI 3CSTA 4KSLC 2UWQA 2KWUB 4KV2A 3KUDB 3PSEB 3LDZE 4NQKE 2JT4B 3W1YA 1UBIA 3IFWB 3DBRI 2IYDB 1IPGA 1LM8B 2JZ3B 2K25A 3MJWA 3A1QA 3KVFB 2GBJA 4HPMB 3VFKA 3PPAA 4WJNA 3UIPB 1K8RB 4XX5A 3A1QB 2O6VA 4HDOA 5CHVC 4EZKA 2AEHA 4GXBA 1NDDA 4PS8A 2KX0A 2CS4A 2O6VB 3GOEA 3ZW3A 4IG7B 2KFJA 2BWFA 4KSKC 3V6EB 2IO0B 1R4MI 2NS5A 4TUUA 4WJOA 4F1SA 2LGDA 2MA9B 2KO3A 3A33B 1RAXA 2LRUA 3VTVA 4N9F4 5LXHA 4ICVA 1TTNA 1NI2A 2KVRA 1WJNA 2NPTA 4FHKA 4CYEA 3JSVA 1RLFA 1WGDA 2KTRA 4G0NB 1EF5A 3RD2A 3DPDA 1S1QB 2NPTB 3QJZA 2DYBA 4IM3A 3JSVB 2KTRB 3DVNU 5CHWA 4BFRA 4MM3A 1I42A 3PZDA 1RRBA 4XC2A 1TZ1A 1WMHA 1P0RA 1Q1OA 2KTFA 3WA0A 3NHEB 1WMHB 1YIWA 3H1UA 2L3ZA 1G6JA 4DK5A 4LDTD 2RPQA 1LQBA 3DBLI 3P2BA 2JY6A 3KYDD 4HJKA 2IZVB 4HCNB 2J0KA 5IAAC 4ZRIA 4TV3A 3QWZB 1ZW7A 2JXXA 1WXVA 2ZNVB 3L08A 2J7QB 2BYFA 5BO4B 2O6VD 4BBNF 2L0FA 1L2NA 4P7IA 4OVVA 4JL9A 3X23A 1E5WA 2N7EA 4WWNA 4DXAB 5IA7A 4G3XB 3DVGX 4HVBA 3L54A 2BPSA 3H7PA 1KM7A 2C7MB 2Z59B 3VUWA 1UZXB 1WRDB 2KN5A 2YVCA 3U8ZA 5J17A 4DHJB 3H7PB 4K7UA 3AU5A 5JHAA 3ZRFA 2LWPA 1WX7A 4WJQA 2ZZPB 1V2YA 2KC1A 1H4RA 3R66C 2K6DB 4AOFA 2V1YA 3A9JA 3W1SA 3NOBA 4I6PA 1HE8A 2PJHA 3B08A 4NY0A 2MBHA 4FULA 4LJOB 4RM8A 1H8CA 2JRHA 3H6NA 3A9JB 3OLMD 5DPWA 4WQOB 1V81A 4HK2A 5AZHA 3VDZA 3JW0X 1WGHA 2OOBB 4I6NB 4FLHA 3A4RA 5CTRC 3K9PB 1J8CA 1WGRA 4W9EA 4IM0A 1XQQA 3PLUA 4G11A 2KXJA 4URKA 4KDLB 1WGGA 2KMCA 3SDLC 3K9OB 3VVWB 2KKCA 3HHMA 3WAOA 3ZDMC 2KLGA 4MEMA 5AZFA 4II3B 4ZRKA 2KJHB 3PVLA 3JVZX 2R2QA 3DQVA 3L16A 2RR9A 3VAWA 4ANXA 2MBQA 5LLIA 4EUTA 3MTNB 1GUAB 2PEAA 4MGZE 1IP9A 3TL5A 4W9LA 1WH3A 2D3GA 4F8CB 3PHWB 5D7GA 2MQJA 1XT9B 2QHOA 2N1VA 2ZPYA 4MGYE 4HDQA 4WWOA 1WX8A 2DYMA 3UF8A 3B1LX 3R7RA 1V49A 5FR6A 2KDBA 3V6CB 1YX5B 1GC6A 3UINB 4E74A 4B9KA 2KWVB 1GC7A 1LFDA 2M4NA 5HKHA 1WY8A 2IY0B 2N9EB 4JQWC 4DHJD 1GJZA 4ICUA 1V9JA 3QAQA 1V5OA 4LDTB 2J0MA 3VUXA 1WJ4A 4J6IA 1WI0A 2K39A 3O65B 2AWTA 2LGXA 5D94A 4IC7B 3TBLD 1GNUA 1WX9A 2BF8B 2KNBA 2FIFA 1F9JA 2FIDA 3ZLZA 2J0JA 1WYWB 2GBMA 4BKSD 2M8SA 4K1RB 2DYOA 4GDKA 5C23A 3DBSA 1V5TA 4EZJA 4GB9A 2R2OA 1E8ZA 2ZCBA 3TCAA 2LRWA 4GDKB 2GOWA 4GDLA 2KC2A 4FHJA 1YJ1A 4IM2A 5DPSA 1V86A 3V61A 3KH0A 2WDTB 3ALBA 1WZ0A 1UELA 2M1MA 3ZVVA 1UBQA 4GDLB 1C3TA 3UQAA 4W9IA 4G50A 4K81A 2EMTA 3KUCB 3TJPA 3ZIMA 4GU2A 1OTRB 2LXAA 5D2MB 3ECIA 1WM2A 2RGFA 3PHXB 3L13A 2KD0A 3QIJA 3AULA 2KQSA 2RD0A 4IW0A 2MCNB 3WAPA 2MW5A 4ZDVA 3ZNID 1LXDA 2ZVNA 4PYZA 4FN2A 2IO1B 5TR5A 3TIXA 5KHOA 2ZVOA 4GGQA 4KZ0A 3SD5A 2KHWB 2CHXA 4M8MA 2DHZA 4WWPA 4MELA 2MWSB 3DBHI 3APFA 4FBJB 3C0RB 1YX6B 5DPRA 3RCZA 1WR6E 2NVUI 2Y5BB 4GSWA 4FADA 4ZYNA 3T8MA 4EFOA 1TGZB 3L17A 2DZMA 2WX1A 2MBEA 2LASA 3N3KB 4MGIE 4AP4C 3WANA 4MSMB 3OJ4B 2KMAA 2FCSA 2FAZA 1ZGUB 2KDEB 1WE7A 2N9PC 3I3TB 1YD8U 4BOSC 1CMXB 3N32A 2G4SA 4RMAA 5AEKB 2K1FA 4W9HA 3LJ3A 3BINA 2JZZA 3QA8A 4DHZB 2WWZA 3A4SC 1WR1A 3L0WB 1L7YA 3DOWA 1OQYA 4ASWC 2XK5A 5EDSA 2CR5A 3WIMA 1KOTA 4FA6A 3M63B 2KOXA 2C7HA 2NBVB 4W9CA 4AJWA 1WGYA 2NBWB 5J18A 2FCMA 2MBOA 2XK5B 4CO7A 4NNJB 3U30A 3ZNZB 3VUYA 3ZNGC 1Y8RC 3IBEA 1EO6A 3ZDTA 1WIAA 3QK0A 3PS6A 3APCA 2L00B 3VQIA 1D3ZA 4BKSA 2MP2A 2V4LA 5DPTA 2ZJDA 4EKUA 1WXSA 5J2RA 2D11A 3DDCB 3EFUA 4HXDA 2MP2B 1NBFC 4AUQC 2BKRB 2ZPNA 3V60A 1VD2A 4K7SA 2ZEQA 2KK8A 2D2QA 2MX2A 2K6QA 3IG3A 4TQ1A 1ISNA 4LJPB 2ZCCA 3JYUA 3X0WA 2KQ7A 2KZRA 2NCNA 4IWQA 3RYTA 1I35A 3APDA 2OJRA 4W9JA 3UGBB 1A5RA 2D07B 2CU1A 2PE9A 2K8BA 2N9XA 2L7RA 3KUZA 1WXAA 5L95C 3ZUNA 3IVFA 4PS3A 2HJ8A 1EUVB 2M17A 3V62A 4HWIB 1OGWA 3RZFA 1MG8A 2LUEA 2DAJA 3GZNI 2AL3A 3QARA 4MH0E 2ASQA 4W9FA 5E6NA 1S3SG 2FCQA 3VXWA 5JH5C 2G45B 4M0WB 3RUIB 2ZNVC 4NJ7A 3SU8X 4A20A 3PT2B 1E7UA 2KANA 3CF6E 5CX3A 5G55A 3PTFC 4RM9A 2JF5A 4E3CA 4A3PA 1E7VA 3M62B 1TBEA 2DZJA 1SIFA 1WJUA 2O2VA 1E8YA 3AXCA 3QHTA 4MDKE 4MJSA 4BBNC 1M94A 1XD3B 3ML8A 2DAFA 3KYCD 4B95A 2IY1B 3PLVA 3ML9A 4LCDE 2O2VB 3DVNV 1SE9A 2LZ6A 3D32A 4MJSB 2LJ5A 2HD5B 3HM3A 2PE6B 2D10A 2KDFB 2K8CA 3AU4A 4ZRJA 2LGYA 4WJPA 4GIVA 2G4DB 2NR2A 2AYOB 2N1WA 2IO2B 2JPHA 5E6PA 4ANUA 4BOZB 3ZKJC 1WJ6A 4JLCA 3W1SC 4MSQB 2FNJB 3VH3B 1RFAA 4W9KA 2JWZA 2Z0DB 3TMPB 3RT3B 4TQ0A 4F7ZA 2YLMA 3A9KA 4YL8A 2BYEA 2LVPA 5JHBA 3M95A 1OEYA 4W9DA 4W9GA 2EMSA 1Q0WB 3A9KB 3DCGA 2FCNA 3PGEA 1T0YA 1E8WA 4NQLB 4DDGD 5GMVA 4X57B 4IUMB 3UQBA 2C9WB 2HTHA 4AWJA 2REXA 3CSFA 1KLVA 1SGHA 3HK0A 3WAMA 4B6WA 2GBRA 2LVOA 5CHFA 5JZEB 2IBIB 5DCNA 2WYQA 5L83A 2DX5B 3AI5A 2GBKA 1P9DU 2LD9A 3Q3FA 4FJVB 1WE6A 5C1ZA 1C1YB 2I1JA 1UH6A 3Q3JA 2RSUA 3EC8A 3BY4B 4EZLA 2UYZB 1IYFA 4AJYB 1KJTA 2G3QB 4M8NA 4ANVA 2L0TA 5G2NA 1JRUA 3NS8A 3ONSA 5D6JB 2L05A 1FXTB 2M0XA 3ZTDA 2K8HA 3OAWA 4HPLB 4DBGA 1Z2MA 2B3AA 3HIZA 4MGKE 1J0GA 2IO3B 4GOCA 3NZUA 3DVGY 1GG3A 2I1KA 2W9NA 3ZRCA 2VRRB 1V80A 4GN1A 4BKGA 5AZGA 3PRMB 3SHQA 3VHTC 3VH4B 2XEWA 2KX3A 2MRPA 4KIKA 4EEWA 3QQ8B 4NAWA 4IWOA 1EF1A 4XZ4A 2PPHA 3PRZA 2C7NB 3PREA 4EOYA 3VTUA 3QCAA 2KLCA 4DDID 4KIKB 3L10B 4NAWB 1X1MA 2BGFA 4KDIC 3CMMB 3EECA 4BKTA 3M3JA 1Q5WB 1QZEA 2MLBA 3PRPB 1Z5SB 3WALA 4K7WA 3ZNHB 1WF9A 3ZO5B 4DWFA 4E71A 5LXIB 4GMVA 2KJ6A 3H9DA 3NZSA 3S2AA 2C5LC 3IHPC 4JIOU 3UIOB 2LVQA 1U4AA 2KJRA 4KZCA 1BT0A 3NY5A 2A4ZA 1J19A 4NPNA 4OVUA 1E8XA 2L8JA 2N4FA 2KWCA 1WXMA 3H7SA 2CHWA 2WX0A 4CHKA 2N7DA 4BVUC 1E90A 4HLEA 4TKNA 4HCPB 2Z0EB 3QC8B 1WM3A 2L76A 1OEYJ 4KVGB 4I6LB 3B0AA 4JGHB 2GMIC 3HM6X 2KDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXC A;  2NBU A;  4FJZ A;  2C60 A;  4DHZ E;  5E6O A;  2AL6 A;  3U7D A;  2GBN A;  2EKE C;  2JRI B;  3QX1 A;  4A3O A;  1P3Q U;  2CKH B;  3ZTC A;  1VCB A;  2MSE D;  2DEN B;  4FJY A;  2BKF A;  4PYU A;  4WAA A;  3RUL A;  2KFK A;  3VTW A;  2HE7 A;  3N30 A;  3KW5 B;  3T9L A;  2XBB C;  3MHS D;  5KHQ A;  2KFK B;  1ZKH A;  3ENE A;  4NJ6 A;  2BYV E;  4PS7 A;  3RZW C;  3EHV A;  1AAR A;  2DZK A;  2FUH B;  2V3S A;  1UD7 A;  3R3M A;  1P98 A;  4IWP A;  1WFY A;  3OJ3 A;  4ANW A;  2LI5 A;  2BWE S;  4II2 B;  1WZ3 A;  1V6E A;  2A5U A;  1PQS A;  2MBB B;  3R7Q A;  2JVC A;  2CHZ A;  1YQB A;  2DZI A;  1UGM A;  3PV1 A;  1P1A A;  2JUO A;  1R4N I;  3CST A;  4KSL C;  2UWQ A;  2KWU B;  4KV2 A;  3KUD B;  3PSE B;  3LDZ E;  4NQK E;  2JT4 B;  3W1Y A;  1UBI A;  3IFW B;  3DBR I;  2IYD B;  1IPG A;  1LM8 B;  2JZ3 B;  2K25 A;  3MJW A;  3A1Q A;  3KVF B;  2GBJ A;  4HPM B;  3VFK A;  3PPA A;  4WJN A;  3UIP B;  1K8R B;  4XX5 A;  3A1Q B;  2O6V A;  4HDO A;  5CHV C;  4EZK A;  2AEH A;  4GXB A;  1NDD A;  4PS8 A;  2KX0 A;  2CS4 A;  2O6V B;  3GOE A;  3ZW3 A;  4IG7 B;  2KFJ A;  2BWF A;  4KSK C;  3V6E B;  2IO0 B;  1R4M I;  2NS5 A;  4TUU A;  4WJO A;  4F1S A;  2LGD A;  2MA9 B;  2KO3 A;  3A33 B;  1RAX A;  2LRU A;  3VTV A;  4N9F 4;  5LXH A;  4ICV A;  1TTN A;  1NI2 A;  2KVR A;  1WJN A;  2NPT A;  4FHK A;  4CYE A;  3JSV A;  1RLF A;  1WGD A;  2KTR A;  4G0N B;  1EF5 A;  3RD2 A;  3DPD A;  1S1Q B;  2NPT B;  3QJZ A;  2DYB A;  4IM3 A;  3JSV B;  2KTR B;  3DVN U;  5CHW A;  4BFR A;  4MM3 A;  1I42 A;  3PZD A;  1RRB A;  4XC2 A;  1TZ1 A;  1WMH A;  1P0R A;  1Q1O A;  2KTF A;  3WA0 A;  3NHE B;  1WMH B;  1YIW A;  3H1U A;  2L3Z A;  1G6J A;  4DK5 A;  4LDT D;  2RPQ A;  1LQB A;  3DBL I;  3P2B A;  2JY6 A;  3KYD D;  4HJK A;  2IZV B;  4HCN B;  2J0K A;  5IAA C;  4ZRI A;  4TV3 A;  3QWZ B;  1ZW7 A;  2JXX A;  1WXV A;  2ZNV B;  3L08 A;  2J7Q B;  2BYF A;  5BO4 B;  2O6V D;  4BBN F;  2L0F A;  1L2N A;  4P7I A;  4OVV A;  4JL9 A;  3X23 A;  1E5W A;  2N7E A;  4WWN A;  4DXA B;  5IA7 A;  4G3X B;  3DVG X;  4HVB A;  3L54 A;  2BPS A;  3H7P A;  1KM7 A;  2C7M B;  2Z59 B;  3VUW A;  1UZX B;  1WRD B;  2KN5 A;  2YVC A;  3U8Z A;  5J17 A;  4DHJ B;  3H7P B;  4K7U A;  3AU5 A;  5JHA A;  3ZRF A;  2LWP A;  1WX7 A;  4WJQ A;  2ZZP B;  1V2Y A;  2KC1 A;  1H4R A;  3R66 C;  2K6D B;  4AOF A;  2V1Y A;  3A9J A;  3W1S A;  3NOB A;  4I6P A;  1HE8 A;  2PJH A;  3B08 A;  4NY0 A;  2MBH A;  4FUL A;  4LJO B;  4RM8 A;  1H8C A;  2JRH A;  3H6N A;  3A9J B;  3OLM D;  5DPW A;  4WQO B;  1V81 A;  4HK2 A;  5AZH A;  3VDZ A;  3JW0 X;  1WGH A;  2OOB B;  4I6N B;  4FLH A;  3A4R A;  5CTR C;  3K9P B;  1J8C A;  1WGR A;  4W9E A;  4IM0 A;  1XQQ A;  3PLU A;  4G11 A;  2KXJ A;  4URK A;  4KDL B;  1WGG A;  2KMC A;  3SDL C;  3K9O B;  3VVW B;  2KKC A;  3HHM A;  3WAO A;  3ZDM C;  2KLG A;  4MEM A;  5AZF A;  4II3 B;  4ZRK A;  2KJH B;  3PVL A;  3JVZ X;  2R2Q A;  3DQV A;  3L16 A;  2RR9 A;  3VAW A;  4ANX A;  2MBQ A;  5LLI A;  4EUT A;  3MTN B;  1GUA B;  2PEA A;  4MGZ E;  1IP9 A;  3TL5 A;  4W9L A;  1WH3 A;  2D3G A;  4F8C B;  3PHW B;  5D7G A;  2MQJ A;  1XT9 B;  2QHO A;  2N1V A;  2ZPY A;  4MGY E;  4HDQ A;  4WWO A;  1WX8 A;  2DYM A;  3UF8 A;  3B1L X;  3R7R A;  1V49 A;  5FR6 A;  2KDB A;  3V6C B;  1YX5 B;  1GC6 A;  3UIN B;  4E74 A;  4B9K A;  2KWV B;  1GC7 A;  1LFD A;  2M4N A;  5HKH A;  1WY8 A;  2IY0 B;  2N9E B;  4JQW C;  4DHJ D;  1GJZ A;  4ICU A;  1V9J A;  3QAQ A;  1V5O A;  4LDT B;  2J0M A;  3VUX A;  1WJ4 A;  4J6I A;  1WI0 A;  2K39 A;  3O65 B;  2AWT A;  2LGX A;  5D94 A;  4IC7 B;  3TBL D;  1GNU A;  1WX9 A;  2BF8 B;  2KNB A;  2FIF A;  1F9J A;  2FID A;  3ZLZ A;  2J0J A;  1WYW B;  2GBM A;  4BKS D;  2M8S A;  4K1R B;  2DYO A;  4GDK A;  5C23 A;  3DBS A;  1V5T A;  4EZJ A;  4GB9 A;  2R2O A;  1E8Z A;  2ZCB A;  3TCA A;  2LRW A;  4GDK B;  2GOW A;  4GDL A;  2KC2 A;  4FHJ A;  1YJ1 A;  4IM2 A;  5DPS A;  1V86 A;  3V61 A;  3KH0 A;  2WDT B;  3ALB A;  1WZ0 A;  1UEL A;  2M1M A;  3ZVV A;  1UBQ A;  4GDL B;  1C3T A;  3UQA A;  4W9I A;  4G50 A;  4K81 A;  2EMT A;  3KUC B;  3TJP A;  3ZIM A;  4GU2 A;  1OTR B;  2LXA A;  5D2M B;  3ECI A;  1WM2 A;  2RGF A;  3PHX B;  3L13 A;  2KD0 A;  3QIJ A;  3AUL A;  2KQS A;  2RD0 A;  4IW0 A;  2MCN B;  3WAP A;  2MW5 A;  4ZDV A;  3ZNI D;  1LXD A;  2ZVN A;  4PYZ A;  4FN2 A;  2IO1 B;  5TR5 A;  3TIX A;  5KHO A;  2ZVO A;  4GGQ A;  4KZ0 A;  3SD5 A;  2KHW B;  2CHX A;  4M8M A;  2DHZ A;  4WWP A;  4MEL A;  2MWS B;  3DBH I;  3APF A;  4FBJ B;  3C0R B;  1YX6 B;  5DPR A;  3RCZ A;  1WR6 E;  2NVU I;  2Y5B B;  4GSW A;  4FAD A;  4ZYN A;  3T8M A;  4EFO A;  1TGZ B;  3L17 A;  2DZM A;  2WX1 A;  2MBE A;  2LAS A;  3N3K B;  4MGI E;  4AP4 C;  3WAN A;  4MSM B;  3OJ4 B;  2KMA A;  2FCS A;  2FAZ A;  1ZGU B;  2KDE B;  1WE7 A;  2N9P C;  3I3T B;  1YD8 U;  4BOS C;  1CMX B;  3N32 A;  2G4S A;  4RMA A;  5AEK B;  2K1F A;  4W9H A;  3LJ3 A;  3BIN A;  2JZZ A;  3QA8 A;  4DHZ B;  2WWZ A;  3A4S C;  1WR1 A;  3L0W B;  1L7Y A;  3DOW A;  1OQY A;  4ASW C;  2XK5 A;  5EDS A;  2CR5 A;  3WIM A;  1KOT A;  4FA6 A;  3M63 B;  2KOX A;  2C7H A;  2NBV B;  4W9C A;  4AJW A;  1WGY A;  2NBW B;  5J18 A;  2FCM A;  2MBO A;  2XK5 B;  4CO7 A;  4NNJ B;  3U30 A;  3ZNZ B;  3VUY A;  3ZNG C;  1Y8R C;  3IBE A;  1EO6 A;  3ZDT A;  1WIA A;  3QK0 A;  3PS6 A;  3APC A;  2L00 B;  3VQI A;  1D3Z A;  4BKS A;  2MP2 A;  2V4L A;  5DPT A;  2ZJD A;  4EKU A;  1WXS A;  5J2R A;  2D11 A;  3DDC B;  3EFU A;  4HXD A;  2MP2 B;  1NBF C;  4AUQ C;  2BKR B;  2ZPN A;  3V60 A;  1VD2 A;  4K7S A;  2ZEQ A;  2KK8 A;  2D2Q A;  2MX2 A;  2K6Q A;  3IG3 A;  4TQ1 A;  1ISN A;  4LJP B;  2ZCC A;  3JYU A;  3X0W A;  2KQ7 A;  2KZR A;  2NCN A;  4IWQ A;  3RYT A;  1I35 A;  3APD A;  2OJR A;  4W9J A;  3UGB B;  1A5R A;  2D07 B;  2CU1 A;  2PE9 A;  2K8B A;  2N9X A;  2L7R A;  3KUZ A;  1WXA A;  5L95 C;  3ZUN A;  3IVF A;  4PS3 A;  2HJ8 A;  1EUV B;  2M17 A;  3V62 A;  4HWI B;  1OGW A;  3RZF A;  1MG8 A;  2LUE A;  2DAJ A;  3GZN I;  2AL3 A;  3QAR A;  4MH0 E;  2ASQ A;  4W9F A;  5E6N A;  1S3S G;  2FCQ A;  3VXW A;  5JH5 C;  2G45 B;  4M0W B;  3RUI B;  2ZNV C;  4NJ7 A;  3SU8 X;  4A20 A;  3PT2 B;  1E7U A;  2KAN A;  3CF6 E;  5CX3 A;  5G55 A;  3PTF C;  4RM9 A;  2JF5 A;  4E3C A;  4A3P A;  1E7V A;  3M62 B;  1TBE A;  2DZJ A;  1SIF A;  1WJU A;  2O2V A;  1E8Y A;  3AXC A;  3QHT A;  4MDK E;  4MJS A;  4BBN C;  1M94 A;  1XD3 B;  3ML8 A;  2DAF A;  3KYC D;  4B95 A;  2IY1 B;  3PLV A;  3ML9 A;  4LCD E;  2O2V B;  3DVN V;  1SE9 A;  2LZ6 A;  3D32 A;  4MJS B;  2LJ5 A;  2HD5 B;  3HM3 A;  2PE6 B;  2D10 A;  2KDF B;  2K8C A;  3AU4 A;  4ZRJ A;  2LGY A;  4WJP A;  4GIV A;  2G4D B;  2NR2 A;  2AYO B;  2N1W A;  2IO2 B;  2JPH A;  5E6P A;  4ANU A;  4BOZ B;  3ZKJ C;  1WJ6 A;  4JLC A;  3W1S C;  4MSQ B;  2FNJ B;  3VH3 B;  1RFA A;  4W9K A;  2JWZ A;  2Z0D B;  3TMP B;  3RT3 B;  4TQ0 A;  4F7Z A;  2YLM A;  3A9K A;  4YL8 A;  2BYE A;  2LVP A;  5JHB A;  3M95 A;  1OEY A;  4W9D A;  4W9G A;  2EMS A;  1Q0W B;  3A9K B;  3DCG A;  2FCN A;  3PGE A;  1T0Y A;  1E8W A;  4NQL B;  4DDG D;  5GMV A;  4X57 B;  4IUM B;  3UQB A;  2C9W B;  2HTH A;  4AWJ A;  2REX A;  3CSF A;  1KLV A;  1SGH A;  3HK0 A;  3WAM A;  4B6W A;  2GBR A;  2LVO A;  5CHF A;  5JZE B;  2IBI B;  5DCN A;  2WYQ A;  5L83 A;  2DX5 B;  3AI5 A;  2GBK A;  1P9D U;  2LD9 A;  3Q3F A;  4FJV B;  1WE6 A;  5C1Z A;  1C1Y B;  2I1J A;  1UH6 A;  3Q3J A;  2RSU A;  3EC8 A;  3BY4 B;  4EZL A;  2UYZ B;  1IYF A;  4AJY B;  1KJT A;  2G3Q B;  4M8N A;  4ANV A;  2L0T A;  5G2N A;  1JRU A;  3NS8 A;  3ONS A;  5D6J B;  2L05 A;  1FXT B;  2M0X A;  3ZTD A;  2K8H A;  3OAW A;  4HPL B;  4DBG A;  1Z2M A;  2B3A A;  3HIZ A;  4MGK E;  1J0G A;  2IO3 B;  4GOC A;  3NZU A;  3DVG Y;  1GG3 A;  2I1K A;  2W9N A;  3ZRC A;  2VRR B;  1V80 A;  4GN1 A;  4BKG A;  5AZG A;  3PRM B;  3SHQ A;  3VHT C;  3VH4 B;  2XEW A;  2KX3 A;  2MRP A;  4KIK A;  4EEW A;  3QQ8 B;  4NAW A;  4IWO A;  1EF1 A;  4XZ4 A;  2PPH A;  3PRZ A;  2C7N B;  3PRE A;  4EOY A;  3VTU A;  3QCA A;  2KLC A;  4DDI D;  4KIK B;  3L10 B;  4NAW B;  1X1M A;  2BGF A;  4KDI C;  3CMM B;  3EEC A;  4BKT A;  3M3J A;  1Q5W B;  1QZE A;  2MLB A;  3PRP B;  1Z5S B;  3WAL A;  4K7W A;  3ZNH B;  1WF9 A;  3ZO5 B;  4DWF A;  4E71 A;  5LXI B;  4GMV A;  2KJ6 A;  3H9D A;  3NZS A;  3S2A A;  2C5L C;  3IHP C;  4JIO U;  3UIO B;  2LVQ A;  1U4A A;  2KJR A;  4KZC A;  1BT0 A;  3NY5 A;  2A4Z A;  1J19 A;  4NPN A;  4OVU A;  1E8X A;  2L8J A;  2N4F A;  2KWC A;  1WXM A;  3H7S A;  2CHW A;  2WX0 A;  4CHK A;  2N7D A;  4BVU C;  1E90 A;  4HLE A;  4TKN A;  4HCP B;  2Z0E B;  3QC8 B;  1WM3 A;  2L76 A;  1OEY J;  4KVG B;  4I6L B;  3B0A A;  4JGH B;  2GMI C;  3HM6 X;  2KDI A; 
#chains in the Genus database with same CATH topology
 2G1E A;  4FJZ A;  2GBN A;  2EKE C;  2WXO A;  1VCB A;  2DEN B;  4L23 A;  3RUL A;  1D5M C;  3VTW A;  3FAH A;  5BYS A;  3T9L A;  2KFK B;  5T8I A;  4PS7 A;  2FUH B;  1UD7 A;  1P98 A;  4IWP A;  1WFY A;  1OQR A;  2LI5 A;  4II2 B;  1V6E A;  1PQS A;  2MBB B;  1KRH A;  2D3A A;  2CHZ A;  1YOV B;  1UGM A;  3PV1 A;  2UWQ A;  3KUD B;  1L0V B;  3PSE B;  1DOI A;  1SSN A;  3IFW B;  4TSS A;  2IYD B;  1LM8 B;  2X8X X;  3MJW A;  4RFB A;  3KVF B;  2W54 A;  3VFK A;  3PPA A;  1K8R B;  2KX0 A;  4KX6 B;  3ZW3 A;  3RNA C;  4IG7 B;  2KFJ A;  2IO0 B;  4TUU A;  4F1S A;  4NAM A;  4XDC A;  4FHK A;  4JWU C;  3MC9 A;  1EF5 A;  4C7Z A;  4IM3 A;  2HTM E;  1JAL A;  2KTR B;  1I42 A;  2WXQ A;  1TZ1 A;  4YTM B;  1P0R A;  3DBH B;  4KGR A;  2L3Z A;  4LDT D;  1LQB A;  5IOI A;  1XLN A;  1ZUD 2;  3N1X C;  2IZV B;  3AE9 B;  4HCN B;  1YNT E;  4IOI E;  4TV3 A;  4A55 A;  1XCT L;  3TSS A;  3QWZ B;  2IGH A;  1AYF A;  2J7Q B;  1FFU A;  1ET6 A;  5FKA C;  2L83 A;  2L0F A;  1L2N A;  3NRZ A;  4G3X B;  4XE0 A;  1EM7 A;  2YVC A;  3U8Z A;  5J17 A;  3H7P B;  2Y5C A;  3P4P B;  1FD6 A;  2ZZP B;  2K6D B;  3A9J A;  3W1S A;  3NOB A;  1E0Z A;  5DPW A;  4WQO B;  3URY A;  3H8H A;  2WXJ A;  3A4R A;  1FEH A;  2QMT A;  4ZYS A;  4LNK A;  1DYQ A;  3GB1 A;  4G11 A;  4URK A;  4ZRK A;  2H88 B;  2ON8 A;  4LTU A;  4TMA B;  2R2Q A;  3DQV A;  2RR9 A;  5H92 C;  4JPS A;  4W9L A;  3Q8B A;  4F8C B;  1Q10 A;  5D7G A;  3AE2 B;  2BT6 A;  4N59 A;  1AW7 A;  4L2Y A;  2XN9 C;  3VRA B;  3RI7 C;  3R7R A;  1YX5 B;  3UIN B;  5HKH A;  4XDD A;  2N9E B;  4ICU A;  2CJO A;  1WJ4 A;  1ROE A;  1M4V A;  1WI0 A;  4C00 A;  3AE7 B;  2WXI A;  2KNB A;  2FIF A;  4J3O D;  1C78 A;  2GBM A;  1JRO A;  2ZW1 A;  1E8Z A;  3ABV B;  1IGD A;  3TCA A;  2LRW A;  4GDK B;  2GOW A;  2KC2 A;  4FHJ A;  1MFW A;  3Q8E A;  1UEL A;  3UQA A;  4G50 A;  1JQ4 A;  2NTS A;  2KAC A;  2D3C A;  2LXA A;  1C4P A;  3U52 E;  3C8Y A;  3PHX B;  2KD0 A;  4NJC A;  2B76 B;  1J7B A;  4IW0 A;  2MCN B;  1N62 A;  4PYZ A;  5TR5 A;  3OWE B;  1L4Z B;  3SD5 A;  4M8M A;  2BBC A;  5AUI A;  3RCZ A;  1T0R C;  2NVU I;  3P1M A;  5G5H A;  1TGZ B;  3PZ8 A;  2LAS A;  1AN8 A;  4MGI E;  3WAN A;  2BS4 B;  4C80 A;  3P4S B;  5AEK B;  3BVG A;  3BIN A;  2JZZ A;  1JWS D;  4DHZ B;  2WWZ A;  4LLG M;  2XK5 A;  2M56 B;  1V1P A;  1YQ3 B;  2KOX A;  4W9C A;  4AJW A;  5J18 A;  1WGY A;  1C4C A;  2FCM A;  4REZ A;  4ZRQ A;  1VZ7 A;  3IT4 B;  1YMH E;  4KKI A;  3ZDT A;  1WIA A;  3N9Y C;  3PS6 A;  3APC A;  2L00 B;  3VQI A;  1N63 A;  3AEG B;  3DDC B;  4HXD A;  1SE4 A;  3V60 A;  2ZEQ A;  1VZ8 A;  4KKJ A;  1NYR A;  2KZR A;  2OJR A;  2N9X A;  1WXA A;  2MJ3 A;  5L95 C;  2HJ8 A;  1OGW A;  3RZF A;  3GZN I;  2AL3 A;  2WDQ B;  1S3S G;  3AE5 B;  3IAM 1;  1WRI A;  4M0W B;  2ZNV C;  4NJ7 A;  3PT2 B;  3N1Y C;  5CX3 A;  2WU5 B;  4RM9 A;  4E3C A;  4M01 A;  2DZJ A;  2L52 A;  4MJS A;  4YWG G;  1XD3 B;  3ML8 A;  3PLV A;  1XXG A;  2G9H D;  3D32 A;  2LJ5 A;  2KDF B;  4ZRJ A;  2G4D B;  2AYO B;  3R2T A;  1I4H A;  2KQ4 X;  5EE0 A;  4BOZ B;  3SR6 A;  3BK2 A;  2V9H A;  4CQN A;  3Q3O C;  3MP9 A;  3P42 A;  1KFY B;  2BYE A;  2Y5P A;  1Q0W B;  3A9K B;  2FCN A;  1JML A;  1SJE D;  4DDG D;  1NEN B;  4IUM B;  4YTP B;  2C9W B;  2HTH A;  2H89 B;  3HK0 A;  3WAM A;  4B6W A;  1UGJ A;  2IBI B;  5DCN A;  3PO0 A;  2GBK A;  4JX1 C;  1P9D U;  2LD9 A;  1NVI D;  1C76 A;  1SBB B;  2VZK B;  2WXK A;  1IYF A;  1KJT A;  3ONS A;  2QEJ C;  3AEF B;  2M0X A;  1FO4 A;  4HPL B;  2B3A A;  1J0G A;  2K5P A;  1VJK A;  4RNA A;  5AZG A;  1C77 A;  3VHT C;  2XEW A;  2KX3 A;  3TEY A;  2ACZ B;  3PRZ A;  4LK0 M;  1F2R I;  2CJN A;  4NAW B;  1X1M A;  1TZO A;  4RGO S;  3AN1 A;  3PRP B;  5BYR A;  3W2D A;  1GB4 A;  3ZO5 B;  1U4A A;  4OVU A;  4BZA A;  2A4Z A;  4YTN B;  2N4F A;  2VZK D;  4FXC A;  4B0E A;  2Z0E B;  3QC8 B;  4KVG B;  4I6L B;  1FRD A;  1FNU A;  3B0A A;  4AQ7 A;  5E6O A;  3U7D A;  3B2G A;  1L6V A;  2CKH B;  4NZL B;  1EWC A;  5KHQ A;  2XBB C;  2J4X A;  1QKZ A;  4RCO A;  3EUB 2;  3AMZ A;  3EHV A;  3FC4 A;  1AAR A;  1ET9 A;  3OJ3 A;  4RH6 A;  2BWE S;  1BML C;  2DZI A;  1SE3 A;  1TS4 A;  1R4N I;  4NQK E;  2SEB D;  1UBI A;  2QC8 A;  3DBR I;  1IBX A;  2K25 A;  2JZ3 B;  4Q2J A;  3A1Q A;  4HPM B;  1QOG A;  2O6V A;  2AEH A;  2LGS A;  3GOE A;  2BWF A;  4KSK C;  3V6E B;  1UWM A;  1ZPS A;  3RNB C;  3I63 C;  5GXG B;  2MA9 B;  3A33 B;  1JWM D;  3VTV A;  5LXH A;  4ICV A;  2KVR A;  5MPO A;  1FRR A;  2NPT B;  3QJZ A;  3JSV B;  4YSZ B;  3TEW A;  1N5X A;  1RRB A;  1WMH A;  1Q1O A;  4MM3 B;  3NHE B;  1YIW A;  3H1U A;  3DBL I;  2JY6 A;  5HI1 A;  1IUE A;  5BMH A;  2J0K A;  5IAA C;  2JXX A;  4RF1 A;  1WXV A;  1D5X C;  3ZGZ A;  2V3P A;  4KGT A;  4P7I A;  3X23 A;  4HVB A;  1GOZ A;  2BPS A;  1WXQ A;  3T3O A;  2VH1 A;  3W9C B;  2HJ1 A;  1K51 A;  1QOA A;  3NVV A;  4WWM A;  4RGT A;  4K7U A;  2J42 A;  2IGD A;  2LWP A;  4WJQ A;  1FFV A;  2PVG C;  1V2Y A;  3IAS 1;  1H4R A;  2V1Y A;  4NY0 A;  4I6P A;  4RM8 A;  4LNN A;  1HTQ A;  1J7A A;  1CQV A;  2JRH A;  4C4V B;  3KQ4 A;  2E3T A;  1V81 A;  3JW0 X;  5FR3 A;  2W3R A;  4FLH A;  1WGG A;  2OJW A;  2KMC A;  3WAO A;  3VVW B;  3HHM A;  4MEM A;  5C2T B;  2MBQ A;  1NYQ A;  4EUT A;  1IP9 A;  3TL5 A;  1JRP A;  3PHW B;  2RPV A;  3C19 A;  2QHO A;  2ZPY A;  4HDQ A;  1WX8 A;  2DYM A;  5IP4 D;  3V6C B;  4E74 A;  2KWV B;  2M4N A;  3BZD B;  3DHI C;  4JQW C;  1V5O A;  5G5G A;  4LDT B;  1I4R A;  2K39 A;  3O65 B;  1CZP A;  1L4D B;  2BB6 A;  2BF8 B;  2FID A;  3ZLZ A;  2V4I B;  2J0J A;  4RF0 A;  4K1R B;  2DYO A;  4LNO A;  4GB9 A;  3NVW A;  4GDL A;  4IM2 A;  5DPS A;  1WZ0 A;  3ZVV A;  1PFD A;  1WWT A;  4K81 A;  1ZXI A;  3TJP A;  1QOF A;  1WM2 A;  2FE8 A;  3L13 A;  1F77 A;  1Y56 A;  2KQS A;  2MW5 A;  4UDU C;  4P6V F;  2IO1 B;  3TIX A;  3V05 A;  1TJE A;  3I57 A;  3FIL A;  1TKG A;  2KWD A;  1GAQ B;  4WUR A;  3U4E G;  5DPR A;  1WR6 E;  3LYY A;  4GSW A;  2GB1 A;  1FNV A;  3B9J A;  2WX1 A;  2Q5W D;  3HRD D;  3AE8 B;  4AP4 C;  3BVM A;  4MSM B;  3SFD B;  2FCS A;  2KDE B;  3BYT B;  1ZGU B;  1WE7 A;  4ZDV A;  1OFF A;  1YD8 U;  4BOS C;  1CMX B;  2G4S A;  4RMA A;  2AQ3 B;  2K1F A;  3LJ3 A;  1ZDV A;  3L0W B;  1L7Y A;  1OQY A;  3PZ7 A;  3WIM A;  2ICI A;  2MJE A;  2NBW B;  2MBO A;  2WLB A;  5I4D A;  4NNJ B;  1XLP A;  3U30 A;  3ZNG C;  1Y8R C;  2J52 A;  3AE1 B;  2V4L A;  2ZJD A;  5J2R A;  4ARC A;  1KLG D;  2MP2 B;  4AUQ C;  4ZHO A;  1SXT A;  4HRS A;  2KK8 A;  2RDG A;  3IG3 A;  4TQ1 A;  2MEK A;  2DWQ A;  4LJP B;  4R3D A;  4IWQ A;  3RYT A;  2XNA C;  2PMV A;  3APD A;  3UGB B;  1FIQ A;  5HHD G;  3IT6 B;  2JYE A;  3ZUN A;  1EUV B;  2M17 A;  2BYT A;  4HEA 1;  3VR9 B;  1BUI C;  3QAR A;  5JH5 C;  2RMM A;  3EGR A;  4A20 A;  3RUI B;  3MHZ A;  1E7U A;  1RFK A;  3I5J C;  1SIF A;  1WJU A;  2WDV B;  3AXC A;  3QHT A;  4HPP A;  1YN5 A;  1TS3 A;  1LGR A;  2O2V B;  3TEZ A;  1SE9 A;  2LZ6 A;  2KN4 A;  1R4N B;  2QDF A;  1HA5 A;  2D10 A;  2K8C A;  4WJP A;  4GIV A;  3DBR B;  2JPH A;  4GLS C;  3AM9 A;  3ZKJ C;  2FNJ B;  3N1Z C;  1RFA A;  2BS3 B;  1K50 A;  2JWZ A;  3RT3 B;  1TKE A;  2YLM A;  4YL8 A;  3AEE B;  2LVP A;  5JHB A;  1QOB A;  5H8Y E;  1T0Y A;  4X57 B;  1VDV A;  1N5W A;  2REX A;  1K52 A;  3CSF A;  3ZXR A;  1KLV A;  1SGH A;  4JE3 B;  1A70 A;  4FJV B;  3MC8 A;  2ZW0 A;  1BXT A;  3BY4 B;  4AJY B;  2L0T A;  3AE6 B;  3E56 A;  3TUO A;  1GPX A;  3OAW A;  3DBL B;  1T6B X;  2N9L A;  4QAY A;  3NZU A;  3DVG Y;  1GG3 A;  3Q14 C;  2I1K A;  3P63 A;  2W9N A;  2QJL A;  1N6Z A;  1V80 A;  3VH4 B;  2PW9 A;  1EU3 A;  2BQQ A;  3QQ8 B;  1EF1 A;  1TS2 A;  1QT9 A;  3VTU A;  4O1N A;  3QCA A;  2KLC A;  4KIK B;  2ONQ A;  2Z8L A;  1XCQ L;  4OHJ A;  2MLB A;  4E71 A;  1Z5S B;  3RN9 C;  4K7W A;  4DWF A;  4S17 A;  1EWY C;  2C5L C;  3IHP C;  4JIO U;  2LVQ A;  4ARI A;  2KJR A;  4KZC A;  3NY5 A;  4NPN A;  3Q6B A;  2KWC A;  2CHW A;  4CHK A;  4BVU C;  4HLE A;  3DHH C;  4TKN A;  4HCP B;  1WM3 A;  3AE3 B;  2KDI A;  1IGC A;  3AEA B;  2LXC A;  4OZC A;  2C60 A;  2AL6 A;  2JRI B;  2CU3 A;  3QX1 A;  4A3O A;  1XO3 A;  1EU4 A;  3BVZ A;  1B1Z A;  4PYU A;  2KFK A;  4PT5 A;  2HE7 A;  3KW5 B;  3AEB B;  2PVO D;  3P4R B;  1ZKH A;  2BYV E;  4KGS A;  1YQ4 B;  3BII D;  2LHD A;  2DZK A;  3MFG A;  3R7Q A;  2A5U A;  2JVC A;  3Q8A A;  1YQB A;  2QIE B;  1P1A A;  1UNS A;  2NMQ A;  1I4P A;  2KWU B;  4PK1 A;  3T3N A;  1XLQ A;  1K53 A;  3UIP B;  3L4P A;  4YXD B;  2I2Y A;  4HDO A;  3ZYY X;  1N61 A;  1LO5 D;  4GXB A;  4PS8 A;  2W55 A;  2WXM A;  1PGB A;  1R4M I;  2Y3A A;  4USA A;  4WJO A;  2KO3 A;  4A6Q A;  3Q3N C;  1C79 A;  1I4Q A;  4JWS C;  2INC C;  1WJN A;  1VZ6 A;  4CYE A;  1ZDX A;  2KTR A;  3RD2 A;  2FBW B;  1S1Q B;  1MPE A;  4DQO C;  2DYB A;  4BFR A;  1JWA D;  4XC2 A;  2LFI A;  1KTK A;  2IPK D;  2KTF A;  3WA0 A;  2LMC A;  3ZXV A;  1G6J A;  2VH2 A;  2JYT A;  1KF6 B;  2MHJ A;  4HJK A;  2JQR B;  4WH4 A;  3NUH B;  2M19 A;  2MJD A;  3L08 A;  5BO4 B;  1TS5 A;  4BBN F;  2WP9 B;  1HXY D;  1E5W A;  2N7E A;  4OZA A;  4DXA B;  1PYW D;  3L54 A;  3H7P A;  1KM7 A;  3VUW A;  1WRD B;  2KN5 A;  2K22 A;  3AU5 A;  5JHA A;  3ZRF A;  1WX7 A;  2KC1 A;  3R66 C;  3W5U B;  4AOF A;  2PJH A;  3B08 A;  1FM0 D;  1TKY A;  4FUL A;  4LJO B;  2YEP F;  3A9J B;  4MAC A;  5AZH A;  2OOB B;  2YEP B;  4I6N B;  1J8C A;  5CTR C;  3K9P B;  1WGR A;  4W9E A;  4IM0 A;  3RNE C;  1XQQ A;  3PLU A;  2KXJ A;  1MHX A;  4KDL B;  3ZJU A;  3SDL C;  3HUI A;  3K9O B;  2KLG A;  5AZF A;  4N6E B;  3PVL A;  2KAJ A;  4A90 A;  4M00 A;  3W5V B;  1FXA A;  1GUA B;  2PEA A;  1VRA B;  2D3G A;  3RMK C;  2RDB C;  4WWO A;  2KT7 A;  1GC7 A;  5AUK A;  3BK1 A;  1E6E B;  1GJZ A;  3QAQ A;  4L1B A;  3VR8 B;  3VUX A;  2JXT A;  2LHE A;  2OHF A;  4LNI A;  1ZE3 D;  2LGX A;  5D94 A;  4OVZ A;  3TBL D;  1WX9 A;  3MC0 B;  1MHH E;  2I38 A;  3OG5 A;  1WYW B;  2M8S A;  5C23 A;  4GDK A;  3DBS A;  1V5T A;  4EZJ A;  2JU6 X;  2PLP A;  2R2O A;  2ZCB A;  1YJ1 A;  4ZRP A;  2DNF A;  1V86 A;  3KH0 A;  2WDT B;  1TIF A;  3ALB A;  2M1M A;  2WHI A;  2DBY A;  3Q3M C;  2K9X A;  2BB5 A;  3KUC B;  3ZIM A;  1F52 A;  1OTR B;  1SB3 C;  5D2M B;  4XYC A;  3ECI A;  3QIJ A;  3AUL A;  2RD0 A;  3WCQ A;  3WAP A;  3ZNI D;  3AH7 A;  4GGQ A;  4KZ0 A;  2KHW B;  2DHZ A;  4WWP A;  4MEL A;  2MWS B;  4FBJ B;  2D5G A;  4LNF A;  2Y5B B;  4DXG A;  4FAD A;  4ZYN A;  3T8M A;  4EFO A;  3L17 A;  2W3S A;  1KH0 A;  2MBE A;  3N3K B;  2R61 A;  1VR9 A;  2IDY A;  3OJ4 B;  2KMA A;  1UUP A;  3N32 A;  2WNM A;  3AE4 B;  3HVZ A;  1FXI A;  4ZOH C;  1ESF A;  2WXG A;  3GE3 C;  5EDS A;  1HTO A;  2CR5 A;  1KOT A;  2AQ2 B;  3CWI A;  2C7H A;  1SEB D;  2XK5 B;  4CO7 A;  1V1P B;  1I7H A;  2IGG A;  3ZJV A;  3GS2 A;  3VUY A;  3IBE A;  1KLU D;  4A9A A;  1PUT A;  4BKS A;  1ZP0 B;  1HZ5 A;  5DPT A;  2BKR B;  1VD2 A;  2D2Q A;  2K6Q A;  5HFY A;  3RNC C;  3JYU A;  4W9J A;  3VRB B;  1A5R A;  2PE9 A;  2CU1 A;  2V3N A;  3RFZ B;  4PS3 A;  1T5X D;  3GZN B;  3V62 A;  4M0W A;  2LEK A;  2LUE A;  4MH0 E;  3VXW A;  2ASQ A;  5E6N A;  1L0Y B;  2FCQ A;  2G45 B;  2WQY B;  3CF6 E;  3KWV A;  3PTF C;  4ACF A;  2LUM A;  2JSV X;  1UWX A;  2WXL A;  1TBE A;  2BW2 A;  1HZ6 A;  3KYC D;  3ML9 A;  2X38 A;  1CJE A;  3DVN V;  4MJS B;  3HM3 A;  1T0S C;  1E10 A;  3E9S A;  5E6P A;  1PDX A;  1XLO A;  4JLC A;  1L6U A;  3VH3 B;  1XEE A;  4W9K A;  2Z0D B;  3TMP B;  3A9K A;  1STE A;  1SIJ A;  3M95 A;  4W9D A;  4K3B A;  2EMS A;  4W9G A;  3PGE A;  5FK9 C;  3R8B A;  1R4M B;  1MI0 A;  4AWJ A;  1P7E A;  4YSX B;  2KMM A;  2GBR A;  5JZE B;  2BVC A;  3KLS X;  2DX5 B;  1ENF A;  3Q3F A;  1DGJ A;  1WE6 A;  5C1Z A;  1UH6 A;  4M02 A;  3Q3J A;  2RSU A;  4XWT A;  1V8C A;  4EZL A;  2L32 A;  2G3Q B;  5G2N A;  1JRU A;  3NS8 A;  5D6J B;  2L05 A;  1JW9 D;  1RYJ A;  1VLB A;  1Z2M A;  2WS3 B;  3HIZ A;  5HG2 A;  3UI3 A;  1CK1 A;  2HDE A;  2VRR B;  4GN1 A;  4HJG E;  3SHQ A;  2N0S B;  2OED A;  3V3X A;  4EEW A;  4NAW A;  1E9M A;  4XZ4 A;  2PPH A;  3PRE A;  2C7N B;  4OW0 A;  4YSY B;  1I4G A;  3L10 B;  2M0A A;  1WSP A;  4KDI C;  3NJT A;  3CMM B;  3EEC A;  1Q5W B;  1QZE A;  3DWG C;  3WAL A;  5LXI B;  4GMV A;  1DOX A;  2KJ6 A;  3S2A A;  2WXN A;  3GE8 C;  3UIO B;  3ZRC A;  2E6X A;  1J19 A;  2D3B A;  2WXH A;  1GB1 A;  2W82 A;  2QIL A;  1I4X A;  2WX0 A;  2N7D A;  2L76 A;  2GMI C;  3HM6 X;  2NBU A;  4DHZ E;  1P3Q U;  3ZTC A;  2KYW A;  2MSE D;  4FJY A;  2BKF A;  4WAA A;  3ETR A;  1C4A A;  3N30 A;  3MHS D;  3ENE A;  3HVD A;  1AWD A;  4NJ6 A;  3RZW C;  2WGS A;  5EE1 A;  2V3S A;  3R3M A;  4ANW A;  1WZ3 A;  1F2R C;  2QSD A;  2NTT A;  2JUO A;  3CST A;  4KSL C;  4KV2 A;  3LDZ E;  2JT4 B;  3U7Z A;  3W1Y A;  1F0Z A;  1FMA D;  1F1H A;  2INP E;  1QLB B;  1IPG A;  5LNK 1;  2GBJ A;  1IBX B;  4WJN A;  4XX5 A;  1V1O A;  3A1Q B;  5CHV C;  1L5P A;  4EZK A;  1OQQ A;  1NDD A;  4HRO A;  2CS4 A;  2O6V B;  2WXR A;  2NS5 A;  2LGD A;  1RAX A;  2LRU A;  2WU2 B;  2PIA A;  3GP7 A;  4N9F 4;  1TTN A;  1NI2 A;  4WIP A;  3MJ5 A;  2NPT A;  1TT5 B;  1HEZ E;  3JSV A;  1RLF A;  1WGD A;  4G0N B;  4C7Y A;  3DPD A;  4P1C C;  3DVN U;  5CHW A;  4MM3 A;  3PZD A;  5EE3 A;  3NZ3 A;  1WMH B;  4DK5 A;  2RPQ A;  4RGN A;  3AEC B;  2GRI A;  3P2B A;  3KYD D;  3J9C A;  4B0M A;  5IKC M;  4ZRI A;  5TSS A;  1XF5 L;  1ZW7 A;  2ZNV B;  2L1A A;  4DXF A;  3SEB A;  1JCK B;  2BYF A;  2O6V D;  5BMI A;  4OVV A;  4JL9 A;  5D3D A;  4P16 A;  4WWN A;  5IA7 A;  3DVG X;  2GLS A;  2FUG 1;  2C7M B;  2Z59 B;  1UZX B;  4DHJ B;  3DWM A;  4C4V A;  2K3U A;  1HE8 A;  2MBH A;  1H8C A;  3H6N A;  3OLM D;  3B2F A;  1E7P B;  4HK2 A;  3VDZ A;  1WGH A;  3ZJT A;  1V97 A;  2KKC A;  3ZDM C;  2JZP A;  4II3 B;  2DLB A;  2KJH B;  3JVZ X;  3L16 A;  3VAW A;  2WXP A;  4ANX A;  5LLI A;  3MTN B;  4MGZ E;  5E6J A;  1WH3 A;  2MQJ A;  1XT9 B;  1YJJ A;  5IO9 A;  2N1V A;  4MGY E;  3ZQ4 A;  3UF8 A;  2BTE A;  4WQM A;  1QQR A;  3B1L X;  3Q69 A;  1SF0 A;  1V49 A;  2PKO A;  2KDB A;  5FR6 A;  5BYQ A;  1GC6 A;  4B9K A;  1LFD A;  1WY8 A;  2IY0 B;  2LGI A;  4DHJ D;  1V9J A;  2SAK A;  2J0M A;  1R7S A;  4J6I A;  4HKZ E;  2AWT A;  2J53 A;  3U2S C;  4IC7 B;  4ITK A;  4US9 A;  1ACC A;  1GNU A;  1QF6 A;  1F9J A;  3BYY B;  4BKS D;  1SJH D;  1T3Q A;  1ZXH A;  2WDR B;  2UU7 A;  3IXS A;  3V61 A;  2IJ0 A;  1UBQ A;  4GDL B;  1C3T A;  4W9I A;  2EMT A;  3NVZ A;  4GU2 A;  1YN4 A;  2RGF A;  1PGX A;  3AB5 A;  4P1B C;  1P7F A;  1LXD A;  1T0Q C;  2ZVN A;  4FN2 A;  1D4B A;  5KHO A;  2ZVO A;  1SE2 A;  4HKQ A;  4BAX A;  2CHX A;  1PGA A;  4YT0 B;  4H2A A;  5C3J B;  3DBH I;  3APF A;  3LB8 C;  3C0R B;  1YX6 B;  3FIL B;  2N7J A;  3NS1 A;  2DZM A;  3R2I A;  2JWU A;  1JWB D;  4XGA B;  1C9F A;  2FAZ A;  2N9P C;  3I3T B;  2BS2 B;  3TEX A;  3KWL A;  3I9V 1;  3Q8F A;  4W9H A;  3QA8 A;  2N9K A;  4MT5 A;  1J7C A;  3A4S C;  1WR1 A;  1YN3 A;  3EA6 A;  3DOW A;  4ASW C;  4FA6 A;  3M63 B;  2NBV B;  3AV8 A;  2TSS A;  2IND C;  1NI3 A;  3LXF A;  4MH8 A;  3O13 A;  1L0X B;  2KVZ A;  2V0G A;  3ZNZ B;  1FPY A;  1EO6 A;  4WAF A;  1TYG B;  4US8 A;  3QK0 A;  4OZB A;  1D6E C;  1D3Z A;  2MP2 A;  2PTL A;  1TY2 A;  1WXS A;  4EKU A;  2D11 A;  3Q2A C;  3EFU A;  5D3I B;  1NBF C;  2ZPN A;  4K7S A;  5JXV A;  1FCC C;  2MX2 A;  1ISN A;  2ZCC A;  3X0W A;  2KQ7 A;  2NCN A;  1FCL A;  1I35 A;  2D07 B;  2K8B A;  2L7R A;  3KUZ A;  3Q8C A;  1RWS A;  3IVF A;  2KDM A;  4IDI A;  4HWI B;  1MG8 A;  3AED B;  4K3C A;  1TY0 A;  2DAJ A;  2INN E;  4W9F A;  4AS1 A;  1UF0 A;  3SU8 X;  2K0P A;  2KAN A;  4RGM A;  5G55 A;  1FNW A;  2JF5 A;  4A3P A;  1E7V A;  1ZOY B;  3M62 B;  2LJI A;  1JWU D;  2O2V A;  1E8Y A;  4MDK E;  4BBN C;  1M94 A;  3P4Q B;  2DAF A;  5BMG A;  4B95 A;  2IY1 B;  4LCD E;  2HD5 B;  2PE6 B;  3AU4 A;  1MJD A;  2LGY A;  2NR2 A;  4ZHP A;  2N1W A;  2IO2 B;  1MVK A;  1YJI A;  5EE9 A;  4D2K A;  4ANU A;  3DHG C;  4XWW A;  1WJ6 A;  2EKI A;  3W1S C;  4MSQ B;  2AX5 A;  1D5Z C;  3RNG C;  4TQ0 A;  4F7Z A;  1B9R A;  5IN7 A;  1OEY A;  1NEK B;  3DCG A;  4NQL B;  1E8W A;  2EEL A;  5GMV A;  2GI9 A;  3UQB A;  2MH7 A;  4S0R A;  2LVO A;  5CHF A;  1QIL A;  2WYQ A;  5L83 A;  3AI5 A;  1C1Y B;  2I1J A;  3RPF C;  1DOY A;  3BWU D;  3EC8 A;  2UYZ B;  4M8N A;  4ANV A;  2AQ1 B;  1FXT B;  3ZTD A;  2K8H A;  4DBG A;  4MGK E;  2IO3 B;  4GOC A;  1WYG A;  4BKG A;  3N20 C;  3PRM B;  4EE2 A;  2MRP A;  4KIK A;  1WGK A;  3EFC A;  4C56 C;  4IWO A;  1RM6 C;  4EOY A;  1HQR D;  4N58 A;  3SFE B;  4DDI D;  2BGF A;  3RNF C;  4BKT A;  3M3J A;  3ZNH B;  3NG0 A;  1WF9 A;  1N60 A;  3H9D A;  3NZS A;  2JX5 A;  1BT0 A;  1E8X A;  1MG4 A;  2L8J A;  2WXF A;  1WXM A;  3FKY A;  3H7S A;  4IKG A;  2QCZ A;  1E90 A;  3CIR B;  1OEY J;  3NVY A;  4JGH B;  2RDH A;  4A8X C; 
#chains in the Genus database with same CATH homology
 2LXC A;  2NBU A;  4FJZ A;  2C60 A;  4DHZ E;  5E6O A;  2AL6 A;  3U7D A;  2GBN A;  2EKE C;  2JRI B;  3QX1 A;  4A3O A;  1P3Q U;  2CKH B;  3ZTC A;  1VCB A;  2MSE D;  2DEN B;  4FJY A;  2BKF A;  4PYU A;  4WAA A;  3RUL A;  2KFK A;  3VTW A;  2HE7 A;  3N30 A;  3KW5 B;  3T9L A;  2XBB C;  3MHS D;  5KHQ A;  2KFK B;  1ZKH A;  3ENE A;  4NJ6 A;  2BYV E;  4PS7 A;  3RZW C;  3EHV A;  1AAR A;  2DZK A;  2FUH B;  2V3S A;  1UD7 A;  3R3M A;  1P98 A;  4IWP A;  1WFY A;  3OJ3 A;  4ANW A;  2LI5 A;  2BWE S;  4II2 B;  1WZ3 A;  1V6E A;  2A5U A;  1PQS A;  2MBB B;  3R7Q A;  2JVC A;  2CHZ A;  1YQB A;  2DZI A;  1UGM A;  3PV1 A;  1P1A A;  2JUO A;  1R4N I;  3CST A;  4KSL C;  2UWQ A;  2KWU B;  4KV2 A;  3KUD B;  3PSE B;  3LDZ E;  4NQK E;  2JT4 B;  3W1Y A;  1UBI A;  3IFW B;  3DBR I;  2IYD B;  1IPG A;  1LM8 B;  2JZ3 B;  2K25 A;  3MJW A;  3A1Q A;  3KVF B;  2GBJ A;  4HPM B;  3VFK A;  3PPA A;  4WJN A;  3UIP B;  1K8R B;  4XX5 A;  3A1Q B;  2O6V A;  4HDO A;  5CHV C;  4EZK A;  2AEH A;  4GXB A;  1NDD A;  4PS8 A;  2KX0 A;  2CS4 A;  2O6V B;  3GOE A;  3ZW3 A;  4IG7 B;  2KFJ A;  2BWF A;  4KSK C;  3V6E B;  2IO0 B;  1R4M I;  2NS5 A;  4TUU A;  4WJO A;  4F1S A;  2LGD A;  2MA9 B;  2KO3 A;  3A33 B;  1RAX A;  2LRU A;  3VTV A;  4N9F 4;  5LXH A;  4ICV A;  1TTN A;  1NI2 A;  2KVR A;  1WJN A;  2NPT A;  4FHK A;  4CYE A;  3JSV A;  1RLF A;  1WGD A;  2KTR A;  4G0N B;  1EF5 A;  3RD2 A;  3DPD A;  1S1Q B;  2NPT B;  3QJZ A;  2DYB A;  4IM3 A;  3JSV B;  2KTR B;  3DVN U;  5CHW A;  4BFR A;  4MM3 A;  1I42 A;  3PZD A;  1RRB A;  4XC2 A;  1TZ1 A;  1WMH A;  1P0R A;  1Q1O A;  2KTF A;  3WA0 A;  3NHE B;  1WMH B;  1YIW A;  3H1U A;  2L3Z A;  1G6J A;  4DK5 A;  4LDT D;  2RPQ A;  1LQB A;  3DBL I;  3P2B A;  2JY6 A;  3KYD D;  4HJK A;  2IZV B;  4HCN B;  2J0K A;  5IAA C;  4ZRI A;  4TV3 A;  3QWZ B;  1ZW7 A;  2JXX A;  1WXV A;  2ZNV B;  3L08 A;  2J7Q B;  2BYF A;  5BO4 B;  2O6V D;  4BBN F;  2L0F A;  1L2N A;  4P7I A;  4OVV A;  4JL9 A;  3X23 A;  1E5W A;  2N7E A;  4WWN A;  4DXA B;  5IA7 A;  4G3X B;  3DVG X;  4HVB A;  3L54 A;  2BPS A;  3H7P A;  1KM7 A;  2C7M B;  2Z59 B;  3VUW A;  1UZX B;  1WRD B;  2KN5 A;  2YVC A;  3U8Z A;  5J17 A;  4DHJ B;  3H7P B;  4K7U A;  3AU5 A;  5JHA A;  3ZRF A;  2LWP A;  1WX7 A;  4WJQ A;  2ZZP B;  1V2Y A;  2KC1 A;  1H4R A;  3R66 C;  2K6D B;  4AOF A;  2V1Y A;  3A9J A;  3W1S A;  3NOB A;  4I6P A;  1HE8 A;  2PJH A;  3B08 A;  4NY0 A;  2MBH A;  4FUL A;  4LJO B;  4RM8 A;  1H8C A;  2JRH A;  3H6N A;  3A9J B;  3OLM D;  5DPW A;  4WQO B;  1V81 A;  4HK2 A;  5AZH A;  3VDZ A;  3JW0 X;  1WGH A;  2OOB B;  4I6N B;  4FLH A;  3A4R A;  5CTR C;  3K9P B;  1J8C A;  1WGR A;  4W9E A;  4IM0 A;  1XQQ A;  3PLU A;  4G11 A;  2KXJ A;  4URK A;  4KDL B;  1WGG A;  2KMC A;  3SDL C;  3K9O B;  3VVW B;  2KKC A;  3HHM A;  3WAO A;  3ZDM C;  2KLG A;  4MEM A;  5AZF A;  4II3 B;  4ZRK A;  2KJH B;  3PVL A;  3JVZ X;  2R2Q A;  3DQV A;  3L16 A;  2RR9 A;  3VAW A;  4ANX A;  2MBQ A;  5LLI A;  4EUT A;  3MTN B;  1GUA B;  2PEA A;  4MGZ E;  1IP9 A;  3TL5 A;  4W9L A;  1WH3 A;  2D3G A;  4F8C B;  3PHW B;  5D7G A;  2MQJ A;  1XT9 B;  2QHO A;  2N1V A;  2ZPY A;  4MGY E;  4HDQ A;  4WWO A;  1WX8 A;  2DYM A;  3UF8 A;  3B1L X;  3R7R A;  1V49 A;  5FR6 A;  2KDB A;  3V6C B;  1YX5 B;  1GC6 A;  3UIN B;  4E74 A;  4B9K A;  2KWV B;  1GC7 A;  1LFD A;  2M4N A;  5HKH A;  1WY8 A;  2IY0 B;  2N9E B;  4JQW C;  4DHJ D;  1GJZ A;  4ICU A;  1V9J A;  3QAQ A;  1V5O A;  4LDT B;  2J0M A;  3VUX A;  1WJ4 A;  4J6I A;  1WI0 A;  2K39 A;  3O65 B;  2AWT A;  2LGX A;  5D94 A;  4IC7 B;  3TBL D;  1GNU A;  1WX9 A;  2BF8 B;  2KNB A;  2FIF A;  1F9J A;  2FID A;  3ZLZ A;  2J0J A;  1WYW B;  2GBM A;  4BKS D;  2M8S A;  4K1R B;  2DYO A;  4GDK A;  5C23 A;  3DBS A;  1V5T A;  4EZJ A;  4GB9 A;  2R2O A;  1E8Z A;  2ZCB A;  3TCA A;  2LRW A;  4GDK B;  2GOW A;  4GDL A;  2KC2 A;  4FHJ A;  1YJ1 A;  4IM2 A;  5DPS A;  1V86 A;  3V61 A;  3KH0 A;  2WDT B;  3ALB A;  1WZ0 A;  1UEL A;  2M1M A;  3ZVV A;  1UBQ A;  4GDL B;  1C3T A;  3UQA A;  4W9I A;  4G50 A;  4K81 A;  2EMT A;  3KUC B;  3TJP A;  3ZIM A;  4GU2 A;  1OTR B;  2LXA A;  5D2M B;  3ECI A;  1WM2 A;  2RGF A;  3PHX B;  3L13 A;  2KD0 A;  3QIJ A;  3AUL A;  2KQS A;  2RD0 A;  4IW0 A;  2MCN B;  3WAP A;  2MW5 A;  4ZDV A;  3ZNI D;  1LXD A;  2ZVN A;  4PYZ A;  4FN2 A;  2IO1 B;  5TR5 A;  3TIX A;  5KHO A;  2ZVO A;  4GGQ A;  4KZ0 A;  3SD5 A;  2KHW B;  2CHX A;  4M8M A;  2DHZ A;  4WWP A;  4MEL A;  2MWS B;  3DBH I;  3APF A;  4FBJ B;  3C0R B;  1YX6 B;  5DPR A;  3RCZ A;  1WR6 E;  2NVU I;  2Y5B B;  4GSW A;  4FAD A;  4ZYN A;  3T8M A;  4EFO A;  1TGZ B;  3L17 A;  2DZM A;  2WX1 A;  2MBE A;  2LAS A;  3N3K B;  4MGI E;  4AP4 C;  3WAN A;  4MSM B;  3OJ4 B;  2KMA A;  2FCS A;  2FAZ A;  1ZGU B;  2KDE B;  1WE7 A;  2N9P C;  3I3T B;  1YD8 U;  4BOS C;  1CMX B;  3N32 A;  2G4S A;  4RMA A;  5AEK B;  2K1F A;  4W9H A;  3LJ3 A;  3BIN A;  2JZZ A;  3QA8 A;  4DHZ B;  2WWZ A;  3A4S C;  1WR1 A;  3L0W B;  1L7Y A;  3DOW A;  1OQY A;  4ASW C;  2XK5 A;  5EDS A;  2CR5 A;  3WIM A;  1KOT A;  4FA6 A;  3M63 B;  2KOX A;  2C7H A;  2NBV B;  4W9C A;  4AJW A;  1WGY A;  2NBW B;  5J18 A;  2FCM A;  2MBO A;  2XK5 B;  4CO7 A;  4NNJ B;  3U30 A;  3ZNZ B;  3VUY A;  3ZNG C;  1Y8R C;  3IBE A;  1EO6 A;  3ZDT A;  1WIA A;  3QK0 A;  3PS6 A;  3APC A;  2L00 B;  3VQI A;  1D3Z A;  4BKS A;  2MP2 A;  2V4L A;  5DPT A;  2ZJD A;  4EKU A;  1WXS A;  5J2R A;  2D11 A;  3DDC B;  3EFU A;  4HXD A;  2MP2 B;  1NBF C;  4AUQ C;  2BKR B;  2ZPN A;  3V60 A;  1VD2 A;  4K7S A;  2ZEQ A;  2KK8 A;  2D2Q A;  2MX2 A;  2K6Q A;  3IG3 A;  4TQ1 A;  1ISN A;  4LJP B;  2ZCC A;  3JYU A;  3X0W A;  2KQ7 A;  2KZR A;  2NCN A;  4IWQ A;  3RYT A;  1I35 A;  3APD A;  2OJR A;  4W9J A;  3UGB B;  1A5R A;  2D07 B;  2CU1 A;  2PE9 A;  2K8B A;  2N9X A;  2L7R A;  3KUZ A;  1WXA A;  5L95 C;  3ZUN A;  3IVF A;  4PS3 A;  2HJ8 A;  1EUV B;  2M17 A;  3V62 A;  4HWI B;  1OGW A;  3RZF A;  1MG8 A;  2LUE A;  2DAJ A;  3GZN I;  2AL3 A;  3QAR A;  4MH0 E;  2ASQ A;  4W9F A;  5E6N A;  1S3S G;  2FCQ A;  3VXW A;  5JH5 C;  2G45 B;  4M0W B;  3RUI B;  2ZNV C;  4NJ7 A;  3SU8 X;  4A20 A;  3PT2 B;  1E7U A;  2KAN A;  3CF6 E;  5CX3 A;  5G55 A;  3PTF C;  4RM9 A;  2JF5 A;  4E3C A;  4A3P A;  1E7V A;  3M62 B;  1TBE A;  2DZJ A;  1SIF A;  1WJU A;  2O2V A;  1E8Y A;  3AXC A;  3QHT A;  4MDK E;  4MJS A;  4BBN C;  1M94 A;  1XD3 B;  3ML8 A;  2DAF A;  3KYC D;  4B95 A;  2IY1 B;  3PLV A;  3ML9 A;  4LCD E;  2O2V B;  3DVN V;  1SE9 A;  2LZ6 A;  3D32 A;  4MJS B;  2LJ5 A;  2HD5 B;  3HM3 A;  2PE6 B;  2D10 A;  2KDF B;  2K8C A;  3AU4 A;  4ZRJ A;  2LGY A;  4WJP A;  4GIV A;  2G4D B;  2NR2 A;  2AYO B;  2N1W A;  2IO2 B;  2JPH A;  5E6P A;  4ANU A;  4BOZ B;  3ZKJ C;  1WJ6 A;  4JLC A;  3W1S C;  4MSQ B;  2FNJ B;  3VH3 B;  1RFA A;  4W9K A;  2JWZ A;  2Z0D B;  3TMP B;  3RT3 B;  4TQ0 A;  4F7Z A;  2YLM A;  3A9K A;  4YL8 A;  2BYE A;  2LVP A;  5JHB A;  3M95 A;  1OEY A;  4W9D A;  4W9G A;  2EMS A;  1Q0W B;  3A9K B;  3DCG A;  2FCN A;  3PGE A;  1T0Y A;  1E8W A;  4NQL B;  4DDG D;  5GMV A;  4X57 B;  4IUM B;  3UQB A;  2C9W B;  2HTH A;  4AWJ A;  2REX A;  3CSF A;  1KLV A;  1SGH A;  3HK0 A;  3WAM A;  4B6W A;  2GBR A;  2LVO A;  5CHF A;  5JZE B;  2IBI B;  5DCN A;  2WYQ A;  5L83 A;  2DX5 B;  3AI5 A;  2GBK A;  1P9D U;  2LD9 A;  3Q3F A;  4FJV B;  1WE6 A;  5C1Z A;  1C1Y B;  2I1J A;  1UH6 A;  3Q3J A;  2RSU A;  3EC8 A;  3BY4 B;  4EZL A;  2UYZ B;  1IYF A;  4AJY B;  1KJT A;  2G3Q B;  4M8N A;  4ANV A;  2L0T A;  5G2N A;  1JRU A;  3NS8 A;  3ONS A;  5D6J B;  2L05 A;  1FXT B;  2M0X A;  3ZTD A;  2K8H A;  3OAW A;  4HPL B;  4DBG A;  1Z2M A;  2B3A A;  3HIZ A;  4MGK E;  1J0G A;  2IO3 B;  4GOC A;  3NZU A;  3DVG Y;  1GG3 A;  2I1K A;  2W9N A;  3ZRC A;  2VRR B;  1V80 A;  4GN1 A;  4BKG A;  5AZG A;  3PRM B;  3SHQ A;  3VHT C;  3VH4 B;  2XEW A;  2KX3 A;  2MRP A;  4KIK A;  4EEW A;  3QQ8 B;  4NAW A;  4IWO A;  1EF1 A;  4XZ4 A;  2PPH A;  3PRZ A;  2C7N B;  3PRE A;  4EOY A;  3VTU A;  3QCA A;  2KLC A;  4DDI D;  4KIK B;  3L10 B;  4NAW B;  1X1M A;  2BGF A;  4KDI C;  3CMM B;  3EEC A;  4BKT A;  3M3J A;  1Q5W B;  1QZE A;  2MLB A;  3PRP B;  1Z5S B;  3WAL A;  4K7W A;  3ZNH B;  1WF9 A;  3ZO5 B;  4DWF A;  4E71 A;  5LXI B;  4GMV A;  2KJ6 A;  3H9D A;  3NZS A;  3S2A A;  2C5L C;  3IHP C;  4JIO U;  3UIO B;  2LVQ A;  1U4A A;  2KJR A;  4KZC A;  1BT0 A;  3NY5 A;  2A4Z A;  1J19 A;  4NPN A;  4OVU A;  1E8X A;  2L8J A;  2N4F A;  2KWC A;  1WXM A;  3H7S A;  2CHW A;  2WX0 A;  4CHK A;  2N7D A;  4BVU C;  1E90 A;  4HLE A;  4TKN A;  4HCP B;  2Z0E B;  3QC8 B;  1WM3 A;  2L76 A;  1OEY J;  4KVG B;  4I6L B;  3B0A A;  4JGH B;  2GMI C;  3HM6 X;  2KDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...