1WGDA

Solution structure of the ubl-domain of herp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GSSGSSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ubl-domain of Herp
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Homocysteine-responsive endoplasmic reticulum-resident ubiqu
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgdA00
3PHXB 1OTRB 1NDDA 1UELA 2FCNA 2N9XA 2GMIC 3APFA 2ZZPB 2RPQA 4PYUA 2ZCBA 2N1VA 3ZRFA 1UZXB 2MWSB 2AWTA 4LJPB 1WZ3A 2D3GA 2DZIA 2MBHA 3H6NA 4DBGA 2C60A 1WMHB 3KW5B 1LFDA 2XK5A 1M94A 2JWZA 2O6VA 2PE6B 4JL9A 2KN5A 2R2OA 4XX5A 1WIAA 3R7RA 1ZKHA 3R3MA 2UWQA 5CHFA 3WA0A 2A4ZA 1Q1OA 3VQIA 1GG3A 5JHBA 3ZNGC 1T0YA 4GXBA 1E90A 2BF8B 4HCNB 4HXDA 2NPTA 3UIOB 2WX0A 2KVRA 2R2QA 4PYZA 5KHOA 2C5LC 3PT2B 4KDLB 1IYFA 1L7YA 1WI0A 3UQBA 4DHJB 3ML8A 3TJPA 2KHWB 3H1UA 5HKHA 1GC6A 2LVPA 3A9KA 3QIJA 4FJZA 2KMCA 1WXSA 3V60A 4HVBA 3WIMA 2LD9A 3IBEA 4A20A 1P1AA 3DVGX 3OAWA 1NBFC 3K9PB 3R66C 5AZGA 3W1SC 3V6EB 2KTRA 1WF9A 4LCDE 4EUTA 5EDSA 1WXMA 4AJWA 2XEWA 3CF6E 1WH3A 2G3QB 4NAWB 4CHKA 1Q0WB 3VUYA 4E3CA 4HK2A 2WDTB 1WX9A 3EFUA 3QK0A 5C23A 3WAOA 2FUHB 4G50A 3R7QA 5E6PA 4HLEA 4ZRJA 2KXJA 3ALBA 4YL8A 2ZNVB 4GB9A 4KV2A 3ZTDA 3T9LA 4BFRA 4BVUC 3WALA 3PSEB 2MP2A 3VAWA 2GBNA 2KANA 1WJ6A 1J0GA 4E71A 5J17A 3HM6X 4GMVA 1HE8A 4JGHB 2C7MB 1H4RA 1LXDA 2AYOB 4F7ZA 3IVFA 4B6WA 1IP9A 4NPNA 1OGWA 4NAWA 2KLGA 4GSWA 3T8MA 2IZVB 1ISNA 1YX6B 3N30A 2NR2A 1S3SG 4BOSC 2Z0DB 4EKUA 4II3B 5DCNA 3JSVA 2HE7A 1C3TA 2J0JA 2UYZB 4WWPA 2BKFA 3UQAA 2DAFA 4K7SA 5L95C 3PRPB 3ZTCA 3VH3B 4EEWA 2JUOA 2KMAA 3B0AA 3PVLA 3NS8A 4W9FA 2MBBB 3PV1A 2NCNA 1XQQA 2G4DB 2BKRB 3MTNB 1YD8U 3OJ4B 4PS7A 3Q3JA 5AEKB 2KOXA 4CO7A 4XZ4A 2AEHA 3QCAA 3P2BA 1SE9A 2K8BA 2LI5A 3VTWA 1P3QU 1UBQA 2DENB 2FNJB 2ZCCA 5BO4B 3S2AA 1V2YA 2PPHA 3ONSA 2KD0A 2K8CA 2O6VD 2GBRA 3A9JA 2ZVOA 1Q5WB 3A9JB 3NOBA 3NY5A 5D7GA 3I3TB 2KX0A 5IAAC 3H7SA 3QAQA 1UH6A 3A1QA 3CSFA 1H8CA 3ZRCA 5AZHA 4W9GA 2D2QA 5KHQA 2KJHB 3PGEA 3MHSD 1UGMA 3RT3B 2LXCA 1K8RB 4DHZE 3VTUA 2AL3A 4MDKE 2C7NB 3UF8A 4A3OA 1WRDB 2WYQA 4MEMA 1ZGUB 4GDKA 3L13A 4FULA 4IM2A 3UINB 2KJ6A 5J2RA 2DZMA 4OVUA 3O65B 3AXCA 1E8ZA 2XBBC 3BY4B 4I6PA 2KFKB 1YQBA 2A5UA 3OJ3A 5G2NA 4FJVB 2J0KA 1C1YB 3QHTA 5IA7A 2C9WB 2DZKA 2LGXA 4MJSA 2FIDA 3Q3FA 2FCMA 1V49A 4BBNF 1J19A 2LXAA 2MRPA 4FLHA 2BGFA 3ZLZA 5DPWA 3UGBB 1YIWA 2LVQA 3RD2A 3N3KB 2IY1B 4DDGD 1L2NA 4FN2A 4KDIC 2KNBA 3DVNV 4EOYA 1P9DU 1JRUA 2MA9B 4HDQA 1RRBA 5FR6A 3ZDTA 4KIKB 1E8WA 1WGHA 2L05A 3N32A 3KUDB 3H9DA 1FXTB 3QWZB 2MBEA 4KSLC 5CTRC 2MCNB 1WE6A 4JIOU 2K25A 2KWCA 5CHVC 3JSVB 3RUIB 3RZWC 3VFKA 3PS6A 4DWFA 4F1SA 1Y8RC 4GGQA 2ASQA 2LGYA 4HPMB 2IBIB 2CKHB 3BINA 2KDFB 3AU5A 2JRIB 4FADA 4ICVA 2GBMA 1V5OA 3ECIA 1V81A 2HD5B 2MSED 3A1QB 4MSMB 1WMHA 3ZKJC 5JZEB 2L76A 3W1YA 2O6VB 3DDCB 2JVCA 3GOEA 3PRMB 3RCZA 4B95A 5C1ZA 4AJYB 3DVGY 3KUCB 4TUUA 4EZLA 1QZEA 1WX7A 3IHPC 4RM8A 4BKSA 5LXIB 2DAJA 3U8ZA 2L3ZA 4TV3A 1E7UA 4WWOA 1WGGA 3EECA 2KC2A 3U30A 4IG7B 3AU4A 2JRHA 4I6LB 2Z0EB 4BBNC 2JT4B 1KJTA 4ZRKA 2CR5A 2V4LA 3DVNU 3ENEA 2DHZA 4M8MA 4IWPA 3WAPA 3SHQA 3HHMA 3MJWA 4DHZB 3NHEB 2JZ3B 1XD3B 1MG8A 1KOTA 1SIFA 2M0XA 3HK0A 1WM3A 2DX5B 2GOWA 2DYOA 3APCA 1A5RA 1OEYJ 2LASA 4DXAB 1WXVA 2LUEA 4IM0A 4MGYE 3TBLD 1I42A 4JQWC 2HTHA 5GMVA 2KX3A 4BKSD 4HCPB 1OEYA 2PE9A 2AL6A 3OLMD 2IO0B 3DBRI 1WJ4A 3GZNI 4W9JA 4EZKA 2GBJA 4NQKE 3KYDD 2NVUI 2MBQA 4KSKC 4MH0E 2YVCA 3SDLC 2LZ6A 1WGDA 3EHVA 1WGRA 4DHJD 2JF5A 1WXAA 4LJOB 2EKEC 3TIXA 3CMMB 3QJZA 4WQOB 3ZUNA 2LVOA 4URKA 5J18A 1TZ1A 1GJZA 2LRUA 3DBHI 1Z5SB 3VUXA 4GDKB 2J7QB 2Y5BB 1SGHA 3KYCD 2ZPYA 2BPSA 2BWFA 2KTRB 1XT9B 2CS4A 5LXHA 2D07B 2YLMA 3RZFA 4A3PA 2WWZA 4MJSB 1UD7A 1WR6E 2KZRA 3A9KB 1GUAB 4P7IA 4NNJB 1UBIA 2BYEA 2C7HA 2EMSA 2N4FA 3EC8A 1WZ0A 4CYEA 3QQ8B 4FA6A 1S1QB 1WYWB 2LWPA 1E7VA 3B08A 5AZFA 3V6CB 1GNUA 3B1LX 4G3XB 3M63B 2PJHA 5TR5A 1EO6A 3PRZA 2REXA 3TL5A 4ANWA 2FCQA 2NPTB 3VH4B 3LJ3A 1WX8A 2OJRA 4GOCA 4IUMB 4M0WB 3W1SA 3ZIMA 4E74A 1E8XA 1X1MA 4IM3A 2MQJA 1WFYA 4LDTD 1U4AA 4KIKA 1EF5A 2MX2A 2KTFA 4W9LA 1OQYA 3LDZE 1WJNA 3ML9A 4II2B 2KDEB 3PHWB 2KDIA 1KLVA 4W9EA 2KQ7A 1IPGA 1V5TA 2Z59B 2XK5B 3L16A 2NBWB 4TQ0A 5CX3A 4AOFA 5E6OA 4XC2A 4IW0A 4OVVA 2L7RA 1V86A 3AULA 3HIZA 4WJQA 3V62A 4HPLB 2ZEQA 2FCSA 2M4NA 2M17A 4BKGA 3M62B 5DPSA 3HM3A 2MBOA 4K7WA 1J8CA 2MLBA 4G0NB 4LDTB 3RYTA 3ZNHB 2CU1A 2DZJA 2JY6A 4MM3A 3L54A 4K7UA 1V6EA 2G4SA 4F8CB 2W9NA 1WY8A 4FHKA 2NBVB 5JH5C 3PTFC 3L17A 4G11A 4NY0A 2LJ5A 3DBLI 4MGIE 1Z2MA 2KO3A 5G55A 5DPRA 3SD5A 4FJYA 2I1JA 3A4SC 3VUWA 2D10A 4NJ6A 3A4RA 2IO3B 1VD2A 3PLVA 4HWIB 4EZJA 3WAMA 4ANVA 4MGKE 3QC8B 2I1KA 1E8YA 4GIVA 4DDID 4TKNA 2EMTA 2KLCA 4IWQA 4WAAA 2KKCA 4NJ7A 4FBJB 2L00B 2BWES 5D6JB 5JHAA 1YJ1A 3DOWA 1GC7A 4JLCA 4W9HA 5CHWA 2KFKA 2K39A 1V9JA 3APDA 1D3ZA 3ZDMC 4HDOA 1P0RA 3UIPB 2M8SA 2RGFA 2IYDB 2RSUA 4RM9A 3TCAA 3NZSA 2IO1B 2VRRB 4GN1A 1YX5B 3QX1A 4KZ0A 2V1YA 3V61A 4HJKA 2ZVNA 4ICUA 2RD0A 1CMXB 3X23A 4M8NA 2ZNVC 1PQSA 3H7PB 2JPHA 1KM7A 4GU2A 3CSTA 4J6IA 4N9F4 3DPDA 3JYUA 1TGZB 4GDLA 1WJUA 4K81A 4X57B 3VTVA 4KVGB 1R4MI 5LLIA 2O2VA 3U7DA 4BOZB 2L0TA 2O2VB 4AWJA 3VVWB 2NS5A 2N9EB 4MELA 1WR1A 2L0FA 4ZYNA 3VXWA 3JW0X 2RR9A 1V80A 1BT0A 2K6DB 2N7EA 2CHZA 5D2MB 2DYMA 3PLUA 4AP4C 3L08A 1I35A 2CHWA 4KZCA 3WANA 2V3SA 4EFOA 2N1WA 3KH0A 3ZO5B 3H7PA 2B3AA 3KVFB 3PPAA 3ZVVA 2KJRA 4NQLB 2M1MA 2KWVB 3QARA 2ZJDA 5D94A 5E6NA 2K8HA 3X0WA 4K1RB 1E5WA 4IWOA 2KK8A 3AI5A 2ZPNA 2LGDA 2GBKA 2QHOA 2DYBA 3A33B 1WE7A 4ANUA 2HJ8A 1WGYA 4RMAA 2KDBA 4WJNA 2WX1A 3L10B 3C0RB 3SU8X 3D32A 4TQ1A 3PREA 4WJPA 1NI2A 1RFAA 3K9OB 3PZDA 1G6JA 5DPTA 1EF1A 1P98A 2IO2B 2N7DA 3IFWB 1TBEA 1LM8B 3NZUA 3IG3A 2NBUA 4ZRIA 4GDLB 4W9IA 4ANXA 3JVZX 2MW5A 2D11A 4DK5A 1RLFA 4WWNA 4ASWC 2J0MA 4AUQC 3QA8A 2IY0B 1TTNA 2BYFA 2FIFA 2KQSA 3DBSA 4PS8A 3RULA 1LQBA 3VHTC 3ZNID 4ZDVA 4FHJA 4I6NB 2KFJA 2JZZA 2BYVE 4WJOA 1AARA 2KWUB 3TMPB 3VDZA 3ZNZB 3DCGA 3M3JA 2L8JA 2K6QA 3ZW3A 4W9KA 3KUZA 2KC1A 1VCBA 2OOBB 2CHXA 2JXXA 1EUVB 4MSQB 1F9JA 4B9KA 4MGZE 3DQVA 1WM2A 2PEAA 2G45B 1R4NI 1RAXA 2FAZA 2LRWA 2K1FA 4W9CA 5L83A 2MP2B 2N9PC 3L0WB 1ZW7A 4IC7B 3M95A 4BKTA 4W9DA 4PS3A
chains in the Genus database with same CATH superfamily
3PHXB 3ZXRA 1TKGA 1NDDA 2N9XA 2RPQA 3RMKC 2ZCBA 3ZRFA 4HJGE 2MWSB 3VRAB 2AWTA 2DZIA 1FCCC 2BBCA 2MBHA 5HHDG 2XK5A 1M94A 2KN5A 1WIAA 1K52A 3R3MA 5BMHA 5BMIA 1Q1OA 4XGAB 3VQIA 2N9LA 3RNBC 4YT0B 2BF8B 4HCNB 2MHJA 4HXDA 1J7BA 4PYZA 2KVRA 2GLSA 4WQMA 1L7YA 1IUEA 3UQBA 4DHJB 3H1UA 1GC6A 2KMCA 3IBEA 1P1AA 1NBFC 4KX6B 1IGCA 2XNAC 2N9KA 4AJWA 2XEWA 1WH3A 1TS4A 5D3IB 1YN3A 2V9HA 5D3DA 3WAOA 4K3CA 5E6PA 1AWDA 4ZRJA 1BUIC 2ZNVB 4GB9A 5HI1A 3VAWA 3Q3OC 1J0GA 4E71A 3LYYA 4GMVA 1HE8A 3EFCA 4HKZE 4ZRQA 4JGHB 4L23A 3IVFA 2VZKD 4D2KA 4NAWA 1UNSA 3RNGC 4GSWA 2IZVB 1ISNA 1YX6B 3N30A 2NR2A 5IOIA 4BOSC 2WU2B 3TSSA 2LHEA 1ZPSA 2BKFA 2BB5A 1V1PA 4EEWA 4IDIA 2KMAA 2LEKA 2Y5CA 1L6UA 4W9FA 2RDBC 4ZRPA 3OJ4B 3P2BA 2QEJC 2LI5A 4A3PA 1UBQA 2DENB 2FNJB 1T5XD 3S2AA 3ONSA 4JE3B 3A9JA 3NRZA 5D7GA 3I3TB 1MFWA 2KX0A 4PK1A 3H7SA 3QAQA 2LJIA 4W9GA 2D2QA 4UDUC 3MHSD 4MDKE 1E10A 4C7ZA 2C7NB 3UF8A 1WRDB 4MEMA 1SSNA 4GDKA 3L13A 1QT9A 1GAQB 2KJ6A 4OVUA 5G2NA 2K9XA 5IA7A 1NYRA 1V49A 1XLOA 3O13A 4FLHA 3GE3C 2WNMA 4DDGD 3I57A 2IY1B 4A9AA 5HFYA 1E8WA 1WGHA 2L05A 3KUDB 2MCNB 1WE6A 2CU3A 4JIOU 2KWCA 3RUIB 1YNTE 3PS6A 4DWFA 3NVWA 2BYTA 2V3NA 4RNAA 4BZAA 2HD5B 3A1QB 4MSMB 3ZKJC 4JX1C 3DDCB 3GOEA 2HJ1A 4RGOS 2LHDA 2NMQA 3KUCB 4TUUA 2I2YA 3ZYYX 1C79A 4RM8A 3BZDB 5IP4D 2KVZA 3Q8FA 1M4VA 1WGGA 3J9CA 3OWEB 5EE3A 4I6LB 1KJTA 3DVNU 2QDFA 4DHZB 3KWLA 1QILA 4HROA 2X8XX 2EELA 2AQ1B 2Y5PA 2LUEA 1FO4A 4R3DA 2KT7A 4JQWC 2HTHA 4NAMA 1T0RC 4LNNA 2AL6A 2K5PA 2IO0B 3SFEB 3GZNB 1I4RA 2NVUI 4NZLB 4KSKC 1L4ZB 2LZ6A 5C2TB 2IGHA 2EKEC 2I38A 2LVOA 4DXGA 1GJZA 2J7QB 2WGSA 3U2SC 4P1BC 3W5VB 1UGJA 2K3UA 1NENB 2CS4A 4BAXA 1B1ZA 1WR6E 2QSDA 4LNFA 1UBIA 2BYEA 2C7HA 4CYEA 3QQ8B 2HTME 2LWPA 1WYWB 2L1AA 1GNUA 2PJHA 2YEPB 3SFDB 2AQ3B 2AQ2B 3AE3B 2OJRA 1E8XA 4IM3A 4MACA 2MQJA 1U4AA 1WJNA 3Q2AC 3BWUD 2K0PA 2KDEB 2J52A 4W9EA 1IPGA 2XK5B 1K53A 5CX3A 1B9RA 3AM9A 1V86A 3V62A 4HPLB 2FCSA 4YWGG 4BKGA 3M62B 5DPSA 2WDVB 4K7WA 1T6BX 4G0NB 3UI3A 2JY6A 4IKGA 1C4PA 1V6EA 3I9V1 1I4GA 2NBVB 5JH5C 2LJ5A 3DBLI 4MGIE 1Z2MA 2KO3A 3SD5A 4FJYA 2I1JA 2D10A 3RNFC 4NJ6A 1ZDVA 3A4RA 3R2TA 1VD2A 2QJLA 4HWIB 4MGKE 2I1KA 2WXLA 1WXQA 1ET9A 4IWQA 2KKCA 5D6JB 2WHIA 5JHAA 1YJ1A 3DOWA 2KFKA 2W55A 1F52A 3APDA 3FILB 1D3ZA 3U52E 1MPEA 2BVCA 1PYWD 4DXFA 3IT6B 3X23A 4JPSA 1KF6B 1PQSA 3CSTA 1D5XC 4X57B 4C80A 1IBXB 2D3BA 2O2VA 3U7DA 2L0TA 4AWJA 3VVWB 3FAHA 1WR1A 2KWDA 1FFVA 2M56B 2G1EA 2K6DB 1FNUA 3PLUA 3L08A 1VR9A 3ZO5B 3PPAA 4NQLB 2WP9B 1R4MB 2KWVB 4US8A 1QOGA 1ZXIA 3AN1A 2KK8A 1SJHD 1WE7A 3RFZB 1K51A 3WCQA 4WJNA 3L10B 3D32A 4TQ1A 4WJPA 3K9OB 5DPTA 3P4RB 3CIRB 1N63A 2N7DA 2K22A 3LB8C 2W54A 2KQSA 4PS8A 4F7ZA 3RNAC 3VHTC 1RM6C 4M0WA 1SBBB 3TMPB 4YTMB 3ZW3A 2KC1A 3GE8C 1DOYA 2CHXA 2JXXA 1EUVB 4LTUA 1F9JA 1I4QA 2CJNA 5L83A 1VZ7A 5IO9A 4WAFA 2B76B 2ZZPB 2N1VA 1FCLA 1TIFA 2WDRB 4AQ7A 4CQNA 1JWMD 1VZ6A 3AEEB 2J4XA 2D3GA 4NJCA 1YMHE 3H6NA 3KW5B 2PE6B 2R2OA 1ZKHA 3AB5A 5CHFA 3WA0A 2D3AA 3ZNGC 1HQRD 4GXBA 2R2QA 1YN4A 3FILA 2AX5A 1JWUD 5HKHA 4RF0A 1WXSA 3WIMA 2LD9A 4ZOHC 1OQQA 4A20A 3DVGX 3OAWA 3MJ5A 3K9PB 1ZXHA 3TEXA 4LCDE 2INPE 4EUTA 1WXMA 3AE5B 1TY2A 1T0SC 4WIPA 3U4EG 3Q8CA 1AYFA 1Q0WB 4E3CA 1ZUD2 2WDTB 1ET6A 3QK0A 2PMVA 2FUHB 4HLEA 1TKYA 4YL8A 4BFRA 4BVUC 2FE8A 2M19A 4A90A 2KANA 1JQ4A 1WJ6A 5J17A 3Q8EA 2BW2A 1H4RA 2BTEA 1LXDA 4LLGM 1VLBA 3DBLB 2MJ3A 4EE2A 1OGWA 3P42A 1S3SG 2KQ4X 2XN9C 2Z0DB 4EKUA 2JSVX 2J0JA 2UYZB 1EWCA 1UF0A 4WWPA 3RN9C 1WYGA 1HA5A 1D5ZC 3ZTCA 2JUOA 3PVLA 3NS8A 1MI0A 3PV1A 1TZOA 3MTNB 2KOXA 1L5PA 3AE2B 2R61A 5BO4B 1V2YA 2K8CA 2HDEA 3NOBA 1TS2A 5IAAC 5GXGB 2KN4A 1I4HA 3CSFA 1STEA 5AZHA 3ZRCA 2KJHB 4ZYSA 4A3OA 2WYQA 1ZGUB 4FULA 3VR8B 1KRHA 3DWGC 4I6PA 3BY4B 2KFKB 1YQBA 2ZW0A 4FJVB 5IKCM 1C1YB 3QHTA 2DZKA 2LGXA 5EE0A 4BBNF 2WXOA 2MRPA 2BGFA 3ZLZA 3DHGC 3N3KB 1L2NA 1JWSD 3AE6B 1QLBB 2ON8A 3DVNV 1P9DU 1BXTA 1JRUA 4MT5A 1RRBA 1JW9D 5FR6A 3ZDTA 3RNCC 1PGAA 4F1SA 1FM0D 2ASQA 2LGYA 4HPMB 4LK0M 2CKHB 3RI7C 5H92C 3AU5A 1E0ZA 4ICVA 2GBMA 1WMHA 2L76A 5C1ZA 1FEHA 3RCZA 4YXDB 2N7JA 1FRDA 4AJYB 4EZLA 1WX7A 5LXIB 2DAJA 2L3ZA 1E7UA 4WWOA 2JU6X 4P16A 2BS4B 1CZPA 2KC2A 4IG7B 2JRHA 2JT4B 1R7SA 3MJWA 3AEBB 2JZ3B 1I4XA 3MC0B 1KH0A 3Q14C 3HK0A 2TSSA 1VRAB 3APCA 2VZKB 1NYQA 3AE4B 4IM0A 3TBLD 2NTSA 5GMVA 4BKSD 4HCPB 4WH4A 3OLMD 1WJ4A 3GZNI 3FC4A 5EE9A 4L1BA 4M00A 4HRSA 1HTOA 3EHVA 1WGRA 2JF5A 1WXAA 2RPVA 3CMMB 4URKA 5J18A 1TZ1A 2LRUA 4GDKB 2Y5BB 3AE1B 3ABVB 4J3OD 2ZPYA 5G5GA 2EKIA 2BWFA 2KTRB 5LXHA 1ZE3D 2YLMA 3NZ3A 2GB1A 2KZRA 3A9KB 4NNJB 2EMSA 2N4FA 4FA6A 1N60A 1S1QB 5AZFA 1E7VA 3M63B 1EO6A 3NG0A 4OZCA 2NPTB 3VH4B 1WX8A 2BT6A 4GOCA 3W1SA 3GB1A 4KKJA 2JZPA 2KTFA 2JWUA 2G9HD 4QAYA 5HG2A 1KLVA 2KQ7A 1V5TA 2GRIA 3L16A 1SF0A 4AOFA 4C7YA 4XC2A 2L52A 3HIZA 4WJQA 4USAA 5BYSA 4ACFA 1J8CA 2MLBA 4LDTB 3RYTA 3ZNHB 2JQRB 4MM3A 3L54A 1WWTA 3BVMA 3MP9A 4S0RA 5AUKA 1WSPA 1QOAA 5DPRA 1HZ6A 3A4SC 3CWIA 3VR9B 3QC8B 4GIVA 2QIEB 1WRIA 2KLCA 1Y56A 2WS3B 3BYYB 1P7FA 2K39A 1V1OA 3UIPB 4XDCA 2RGFA 1ENFA 4RM9A 1JALA 1V1PB 2WXHA 4GN1A 3V61A 1GB1A 2ZVNA 4Q2JA 4M8NA 3Q69A 4MM3B 3GP7A 1UUPA 3DPDA 3JYUA 1TGZB 4K81A 2DNFA 3EUB2 1YQ4B 2L0FA 2WXFA 3JW0X 2RR9A 1BT0A 1TYGB 2H89B 3KLSX 4KZCA 3WANA 2V3SA 1A70A 2WXGA 3KH0A 3H7PA 3KVFB 3H8HA 2M1MA 2D5GA 5D94A 4OVZA 5E6NA 1PFDA 4K1RB 1HEZE 3AI5A 2ZPNA 2LGDA 5FK9C 4RFBA 2WXJA 1WGYA 4RMAA 2KDBA 3HVDA 3SU8X 1SXTA 1NI2A 1QQRA 1RFAA 4O1NA 3IFWB 1TBEA 1LM8B 3IG3A 2NBUA 4GDLB 1QF6A 2MW5A 4DK5A 2J0MA 2LMCA 4AUQC 3QA8A 1TTNA 2BYFA 4GLSC 4FHJA 2JZZA 2BYVE 1AARA 3ZNZB 2W3RA 3KQ4A 5EE1A 2OJWA 2OOBB 3HRDD 4MSQB 4MGZE 5BMGA 1F2RI 2G45B 2WXMA 1RAXA 4IOIE 4W9CA 2MP2B 3DHHC 1DOIA 4IC7B 1SE3A 1XCTL 3M95A 4BKTA 3BK1A 1OTRB 1UELA 2ACZB 1F2RC 1V97A 4LJPB 1WZ3A 3LXFA 2C60A 1WMHB 2BS3B 4B0EA 4JL9A 2D3CA 2JWZA 2O6VA 4XX5A 3R7RA 3N1XC 2SEBD 4LNOA 1ESFA 2A4ZA 5JHBA 1E90A 2NPTA 2W82A 2WX0A 4M01A 5KHOA 3B9JA 1IYFA 1WI0A 1T0QC 2WDQB 3ML8A 3TJPA 2KHWB 3A9KA 4FJZA 1L4DB 3BIID 3V60A 4HVBA 1RYJA 1YJJA 1C77A 3R66C 3AECB 1XCQL 2INCC 5FKAC 3AE8B 2PTLA 1N6ZA 4XYCA 2OHFA 2BB6A 3CF6E 2G3QB 1T3QA 4CHKA 1QOFA 3VUYA 3AH7A 4HK2A 2KDMA 5C23A 4G50A 3R7QA 2QC8A 3I5JC 1KFYB 3ALBA 3ZTDA 3T9LA 3WALA 3PSEB 2MP2A 2GBNA 1C76A 4XWWA 3U7ZA 4C4VB 1QOBA 2VH2A 1Q10A 3RPFC 3NUHB 4M02A 1XXGA 2AYOB 1IBXA 2LGSA 2QILA 2KLGA 4LNKA 3T8MA 4N6EB 3NS1A 4B0MA 3JSVA 2HE7A 4K7SA 5L95C 3B0AA 4RGNA 2NCNA 3Q3MC 1XQQA 1XF5L 2BKRB 1YD8U 3IXSA 1XLNA 3Q3JA 2N0SB 4XZ4A 1SE9A 3VTWA 1P3QU 4US9A 2ZCCA 1G6JA 2O6VD 2GBRA 2W3SA 2ZVOA 1Q5WB 3A9JB 3A1QA 1UGMA 2Y3AA 3RT3B 2LXCA 3VTUA 4WURA 2VH1A 2GI9A 1XEEA 4C4VA 2OEDA 3UINB 4A6QA 1TJEA 5J2RA 2PIAA 2QCZA 2XBBC 2A5UA 5H8YE 2E6XA 1FD6A 4MJSA 2FCMA 1NEKB 2LXAA 3DHIC 3URYA 5T8IA 2ICIA 1L0XB 5DPWA 2J42A 3UGBB 4JWUC 1YIWA 2LVQA 1RFKA 4KDIC 4ITKA 2MA9B 1JROA 3B2GA 4KIKB 1OFFA 3N32A 4KSLC 1FXTB 2MBEA 1MG4A 2K25A 5MPOA 3JSVB 4GGQA 2KDFB 4K3BA 2JRIB 3V3XA 1L6VA 2E3TA 3TEYA 3ECIA 1KLGD 5JZEB 3W1YA 3PRMB 3BYTB 2JVCA 1ZDXA 3DVGY 1QZEA 3IHPC 3U8ZA 4TV3A 4FXCA 4ZRKA 1GOZA 2V4LA 2PLPA 3SHQA 1MHXA 1VZ8A 1CK1A 3NHEB 1NVID 4REZA 3TEZA 1SIFA 1WM3A 2DYOA 1OEYJ 2DBYA 3L4PA 3C8YA 4DXAB 5I4DA 3Q8AA 1FPYA 1OEYA 1FFUA 4EZKA 1L0YB 4W9JA 4NQKE 1N5XA 3KYDD 3T3NA 3NJTA 3MFGA 3SDLC 1WGDA 1SE2A 1I7HA 3ZUNA 2MJDA 4WQOB 2BQQA 1SJED 3DBHI 3VUXA 1TS5A 1SGHA 4AS1A 3SR6A 3IT4B 1XT9B 2D07B 1SEBD 3RZFA 4L2YA 1YOVB 3P1MA 3Q6BA 3BK2A 4P7IA 4KKIA 1EU3A 3EC8A 1WZ0A 2JXTA 1TY0A 1GB4A 1LGRA 3V6CB 5TR5A 3B1LX 3TL5A 3ZJVA 2REXA 2FCQA 2WXQA 2WLBA 3N9YC 4M0WB 4IUMB 1X1MA 1DGJA 1WFYA 4W9LA 1K50A 1EF5A 2MX2A 3AEDB 3ML9A 2KDIA 1TKEA 1I4PA 3EGRA 2Z59B 3ZJTA 2NBWB 2DWQA 5E6OA 2PVGC 2L7RA 3AULA 5BYQA 2M4NA 2M17A 2MBOA 3MC8A 4K7UA 1FXAA 1WY8A 4FHKA 4ARIA 2SAKA 4XDDA 4YTPB 1N5WA 4XE0A 3L17A 4LNIA 1EWYC 3GS2A 1QKZA 3OG5A 1CQVA 2IO3B 1N61A 1C78A 4OHJA 3PLVA 4DQOC 4EZJA 2JYTA 3WAMA 4ANVA 1E8YA 4TKNA 2EMTA 2V0GA 4RGMA 5BYRA 2CJOA 4FBJB 2L00B 4RH6A 5CHWA 1GC7A 3ZDMC 4HDOA 1P0RA 1XLPA 2NTTA 2LFIA 4TSSA 3Q8BA 4HEA1 3TCAA 2IO1B 2V4IB 2VRRB 1YX5B 4KGTA 4KZ0A 3W5UB 1UWXA 2RD0A 2ZNVC 2JPHA 1KM7A 4N9F4 3VTVA 4KVGB 1R4MI 5LLIA 4BOZB 2O2VB 1D4BA 4MELA 3VXWA 1V80A 3C19A 2PVOD 5D2MB 1JWBD 2DYMA 4P6VF 2CHWA 1FXIA 1MHHE 2N1WA 3ZVVA 2KJRA 2WXKA 1JRPA 5JXVA 2ZJDA 2ONQA 5E6JA 2QHOA 3A33B 3ZQ4A 2LUMA 2HJ8A 4ARCA 2WX1A 3AE9B 1ZOYB 3PZDA 4W9IA 4ANXA 1RWSA 4PT5A 1RLFA 1D6EC 4A8XC 5FR3A 3SEBA 4ZDVA 1LQBA 4I6NB 3AE7B 4WJOA 2KWUB 3B2FA 3VDZA 2L83A 2RMMA 3DCGA 3M3JA 3R2IA 4MH8A 4W9KA 3KUZA 1VCBA 2LGIA 1WM2A 1R4NI 2LRWA 2K1FA 2N9PC 4W9DA 4B6WA 5AUIA 3ZJUA 3IAM1 3NVYA 4HPPA 2FCNA 3APFA 2GMIC 2IPKD 4PYUA 1AW7A 1UZXB 1V8CA 4DBGA 2Z8LA 1LFDA 4P1CC 2UWQA 1SIJA 1GG3A 4RGTA 4ZHOA 1T0YA 1IGDA 3UIOB 4HKQA 2WXRA 1BMLC 2C5LC 3PT2B 1YQ3B 2MH7A 2IDYA 4KDLB 3W9CB 3P63A 3T3OA 3ZXVA 3BVZA 1EM7A 3QIJA 2LVPA 2JYEA 1PUTA 2KYWA 3W1SC 5AZGA 3V6EB 2KTRA 1WF9A 1FRRA 2RDGA 4OW0A 5EDSA 3N1ZC 4NAWB 1WX9A 3EFUA 1KTKA 3DBRB 2KXJA 4RF1A 3Q3NC 4KV2A 5IN7A 2FUG1 3E9SA 3HM6X 3W2DA 5LNK1 3ZGZA 2C7MB 2KMMA 3AEGB 4RCOA 1IP9A 4NPNA 4II3B 5DCNA 5C3JB 1C3TA 4ZHPA 3UQAA 2DAFA 3PRPB 3VH3B 1FMAD 1AN8A 2MBBB 2G4DB 3VRBB 2L32A 4PS7A 1YN5A 5AEKB 3AEFB 4CO7A 2AEHA 3QCAA 2K8BA 2INNE 1J7CA 2PPHA 2KD0A 1FIQA 3NY5A 1E6EB 1UH6A 1H8CA 4YSZB 3EA6A 5KHQA 3PGEA 1K8RB 4DHZE 3KWVA 2AL3A 3E56A 3N1YC 3TEWA 4IM2A 2DZMA 4WWMA 3O65B 1E7PB 3AXCA 1E8ZA 3OJ3A 2J0KA 5G5HA 3PZ7A 1L0VB 2C9WB 1XLQA 2FIDA 3Q3FA 1XO3A 2ZW1A 1J19A 3PZ8A 3DBHB 3N20C 1VJKA 3RD2A 4FN2A 2KNBA 4EOYA 4HDQA 4KGRA 4OZBA 1C4AA 1DOXA 2M0AA 1OQRA 2JX5A 1CJEA 3H9DA 3QWZB 5CTRC 3NVZA 5CHVC 3RZWC 1JCKB 3VFKA 1Y8RC 2IBIB 3BINA 2UU7A 4FADA 1V5OA 1V81A 2MSED 1ROEA 3MHZA 2O6VB 4B95A 2DLBA 4BKSA 1R4NB 3EECA 1FNWA 3U30A 3AU4A 2Z0EB 1VDVA 4BBNC 2CR5A 3ENEA 3WAPA 2DHZA 4M8MA 4IWPA 3HHMA 2IGGA 3ETRA 4N59A 1XD3B 4TMAB 1MG8A 1EU4A 1KOTA 1JWAD 3HUIA 2M0XA 2DX5B 2GOWA 1A5RA 2IJ0A 2LASA 1WXVA 4MGYE 2IGDA 1I42A 4H2AA 4YSXB 4JWSC 1MVKA 4OZAA 2KX3A 2PE9A 1HTQA 1C4CA 2QMTA 3DBRI 1ZP0B 2GBJA 3BVGA 2H88B 2MBQA 2PW9A 4MH0E 2YVCA 2WXIA 4DHJD 4LJOB 3TIXA 3QJZA 4KGSA 4A55A 4S17A 1ACCA 1Z5SB 2MEKA 1DYQA 1PGBA 3KYCD 2BPSA 3AV8A 5TSSA 1P7EA 3I63C 1FNVA 2WWZA 4MJSB 1UD7A 4YTNB 1GUAB 1LO5D 1N62A 3HVZA 4XWTA 2J53A 3B08A 1TT5B 4G3XB 4ANWA 3PRZA 3TUOA 1GPXA 1MJDA 3LJ3A 3ZIMA 4E74A 4LDTD 4KIKA 3RNEC 2KAJA 1OQYA 3LDZE 2RDHA 4II2B 3PHWB 2Q5WD 3V05A 4TQ0A 3DWMA 2FBWB 2WXPA 4IW0A 4OVVA 1TS3A 2ZEQA 3R8BA 2X38A 1PDXA 3HM3A 1PGXA 3P4QB 2CU1A 2DZJA 4C56C 1SE4A 1UWMA 2G4SA 4F8CB 2W9NA 1NI3A 3AEAB 3PTFC 4G11A 4NY0A 1SB3C 5G55A 3VUWA 3FKYA 3P4PB 4DDID 1J7AA 4WAAA 4NJ7A 2BWES 4JLCA 4W9HA 1WGKA 1V9JA 2M8SA 2KACA 2IYDB 2MJEA 2RSUA 3NZSA 3QX1A 2V1YA 4HJKA 4ICUA 1CMXB 3H7PB 4GU2A 2YEPF 4J6IA 4GDLA 1WJUA 3MC9A 1YJIA 3P4SB 2NS5A 2PKOA 2N9EB 4ZYNA 1HZ5A 2N7EA 2CHZA 4YSYB 1JMLA 4AP4C 2WXNA 1I35A 3AMZA 4EFOA 2B3AA 1D5MC 3QARA 2K8HA 3X0WA 1E5WA 4IWOA 2GBKA 4ANUA 2DYBA 2V3PA 1KLUD 1F77A 3C0RB 3PREA 1EF1A 2INDC 1P98A 2IO2B 3NZUA 1F1HA 3IAS1 4ZRIA 3JVZX 2D11A 2BS2B 4WWNA 2WU5B 4ASWC 4C00A 2IY0B 2FIFA 3DBSA 3RULA 3ZNID 2KFJA 3PO0A 4N58A 2L8JA 2K6QA 2WQYB 3NVVA 4B9KA 3DQVA 1C9FA 2PEAA 2FAZA 1F0ZA 3L0WB 1ZW7A 1E9MA 1HXYD 4PS3A
chains in the Genus database with same CATH topology
3PHXB 1OTRB 1NDDA 1UELA 2FCNA 2N9XA 2GMIC 3APFA 2ZZPB 2RPQA 4PYUA 2ZCBA 2N1VA 3ZRFA 1UZXB 2MWSB 2AWTA 4LJPB 1WZ3A 2D3GA 2DZIA 2MBHA 3H6NA 4DBGA 2C60A 1WMHB 3KW5B 1LFDA 2XK5A 1M94A 2JWZA 2O6VA 2PE6B 4JL9A 2KN5A 2R2OA 4XX5A 1WIAA 3R7RA 1ZKHA 3R3MA 2UWQA 5CHFA 3WA0A 2A4ZA 1Q1OA 3VQIA 1GG3A 5JHBA 3ZNGC 1T0YA 4GXBA 1E90A 2BF8B 4HCNB 4HXDA 2NPTA 3UIOB 2WX0A 2KVRA 2R2QA 4PYZA 5KHOA 2C5LC 3PT2B 4KDLB 1IYFA 1L7YA 1WI0A 3UQBA 4DHJB 3ML8A 3TJPA 2KHWB 3H1UA 5HKHA 1GC6A 2LVPA 3A9KA 3QIJA 4FJZA 2KMCA 1WXSA 3V60A 4HVBA 3WIMA 2LD9A 3IBEA 4A20A 1P1AA 3DVGX 3OAWA 1NBFC 3K9PB 3R66C 5AZGA 3W1SC 3V6EB 2KTRA 1WF9A 4LCDE 4EUTA 5EDSA 1WXMA 4AJWA 2XEWA 3CF6E 1WH3A 2G3QB 4NAWB 4CHKA 1Q0WB 3VUYA 4E3CA 4HK2A 2WDTB 1WX9A 3EFUA 3QK0A 5C23A 3WAOA 2FUHB 4G50A 3R7QA 5E6PA 4HLEA 4ZRJA 2KXJA 3ALBA 4YL8A 2ZNVB 4GB9A 4KV2A 3ZTDA 3T9LA 4BFRA 4BVUC 3WALA 3PSEB 2MP2A 3VAWA 2GBNA 2KANA 1WJ6A 1J0GA 4E71A 5J17A 3HM6X 4GMVA 1HE8A 4JGHB 2C7MB 1H4RA 1LXDA 2AYOB 4F7ZA 3IVFA 4B6WA 1IP9A 4NPNA 1OGWA 4NAWA 2KLGA 4GSWA 3T8MA 2IZVB 1ISNA 1YX6B 3N30A 2NR2A 1S3SG 4BOSC 2Z0DB 4EKUA 4II3B 5DCNA 3JSVA 2HE7A 1C3TA 2J0JA 2UYZB 4WWPA 2BKFA 3UQAA 2DAFA 4K7SA 5L95C 3PRPB 3ZTCA 3VH3B 4EEWA 2JUOA 2KMAA 3B0AA 3PVLA 3NS8A 4W9FA 2MBBB 3PV1A 2NCNA 1XQQA 2G4DB 2BKRB 3MTNB 1YD8U 3OJ4B 4PS7A 3Q3JA 5AEKB 2KOXA 4CO7A 4XZ4A 2AEHA 3QCAA 3P2BA 1SE9A 2K8BA 2LI5A 3VTWA 1P3QU 1UBQA 2DENB 2FNJB 2ZCCA 5BO4B 3S2AA 1V2YA 2PPHA 3ONSA 2KD0A 2K8CA 2O6VD 2GBRA 3A9JA 2ZVOA 1Q5WB 3A9JB 3NOBA 3NY5A 5D7GA 3I3TB 2KX0A 5IAAC 3H7SA 3QAQA 1UH6A 3A1QA 3CSFA 1H8CA 3ZRCA 5AZHA 4W9GA 2D2QA 5KHQA 2KJHB 3PGEA 3MHSD 1UGMA 3RT3B 2LXCA 1K8RB 4DHZE 3VTUA 2AL3A 4MDKE 2C7NB 3UF8A 4A3OA 1WRDB 2WYQA 4MEMA 1ZGUB 4GDKA 3L13A 4FULA 4IM2A 3UINB 2KJ6A 5J2RA 2DZMA 4OVUA 3O65B 3AXCA 1E8ZA 2XBBC 3BY4B 4I6PA 2KFKB 1YQBA 2A5UA 3OJ3A 5G2NA 4FJVB 2J0KA 1C1YB 3QHTA 5IA7A 2C9WB 2DZKA 2LGXA 4MJSA 2FIDA 3Q3FA 2FCMA 1V49A 4BBNF 1J19A 2LXAA 2MRPA 4FLHA 2BGFA 3ZLZA 5DPWA 3UGBB 1YIWA 2LVQA 3RD2A 3N3KB 2IY1B 4DDGD 1L2NA 4FN2A 4KDIC 2KNBA 3DVNV 4EOYA 1P9DU 1JRUA 2MA9B 4HDQA 1RRBA 5FR6A 3ZDTA 4KIKB 1E8WA 1WGHA 2L05A 3N32A 3KUDB 3H9DA 1FXTB 3QWZB 2MBEA 4KSLC 5CTRC 2MCNB 1WE6A 4JIOU 2K25A 2KWCA 5CHVC 3JSVB 3RUIB 3RZWC 3VFKA 3PS6A 4DWFA 4F1SA 1Y8RC 4GGQA 2ASQA 2LGYA 4HPMB 2IBIB 2CKHB 3BINA 2KDFB 3AU5A 2JRIB 4FADA 4ICVA 2GBMA 1V5OA 3ECIA 1V81A 2HD5B 2MSED 3A1QB 4MSMB 1WMHA 3ZKJC 5JZEB 2L76A 3W1YA 2O6VB 3DDCB 2JVCA 3GOEA 3PRMB 3RCZA 4B95A 5C1ZA 4AJYB 3DVGY 3KUCB 4TUUA 4EZLA 1QZEA 1WX7A 3IHPC 4RM8A 4BKSA 5LXIB 2DAJA 3U8ZA 2L3ZA 4TV3A 1E7UA 4WWOA 1WGGA 3EECA 2KC2A 3U30A 4IG7B 3AU4A 2JRHA 4I6LB 2Z0EB 4BBNC 2JT4B 1KJTA 4ZRKA 2CR5A 2V4LA 3DVNU 3ENEA 2DHZA 4M8MA 4IWPA 3WAPA 3SHQA 3HHMA 3MJWA 4DHZB 3NHEB 2JZ3B 1XD3B 1MG8A 1KOTA 1SIFA 2M0XA 3HK0A 1WM3A 2DX5B 2GOWA 2DYOA 3APCA 1A5RA 1OEYJ 2LASA 4DXAB 1WXVA 2LUEA 4IM0A 4MGYE 3TBLD 1I42A 4JQWC 2HTHA 5GMVA 2KX3A 4BKSD 4HCPB 1OEYA 2PE9A 2AL6A 3OLMD 2IO0B 3DBRI 1WJ4A 3GZNI 4W9JA 4EZKA 2GBJA 4NQKE 3KYDD 2NVUI 2MBQA 4KSKC 4MH0E 2YVCA 3SDLC 2LZ6A 1WGDA 3EHVA 1WGRA 4DHJD 2JF5A 1WXAA 4LJOB 2EKEC 3TIXA 3CMMB 3QJZA 4WQOB 3ZUNA 2LVOA 4URKA 5J18A 1TZ1A 1GJZA 2LRUA 3DBHI 1Z5SB 3VUXA 4GDKB 2J7QB 2Y5BB 1SGHA 3KYCD 2ZPYA 2BPSA 2BWFA 2KTRB 1XT9B 2CS4A 5LXHA 2D07B 2YLMA 3RZFA 4A3PA 2WWZA 4MJSB 1UD7A 1WR6E 2KZRA 3A9KB 1GUAB 4P7IA 4NNJB 1UBIA 2BYEA 2C7HA 2EMSA 2N4FA 3EC8A 1WZ0A 4CYEA 3QQ8B 4FA6A 1S1QB 1WYWB 2LWPA 1E7VA 3B08A 5AZFA 3V6CB 1GNUA 3B1LX 4G3XB 3M63B 2PJHA 5TR5A 1EO6A 3PRZA 2REXA 3TL5A 4ANWA 2FCQA 2NPTB 3VH4B 3LJ3A 1WX8A 2OJRA 4GOCA 4IUMB 4M0WB 3W1SA 3ZIMA 4E74A 1E8XA 1X1MA 4IM3A 2MQJA 1WFYA 4LDTD 1U4AA 4KIKA 1EF5A 2MX2A 2KTFA 4W9LA 1OQYA 3LDZE 1WJNA 3ML9A 4II2B 2KDEB 3PHWB 2KDIA 1KLVA 4W9EA 2KQ7A 1IPGA 1V5TA 2Z59B 2XK5B 3L16A 2NBWB 4TQ0A 5CX3A 4AOFA 5E6OA 4XC2A 4IW0A 4OVVA 2L7RA 1V86A 3AULA 3HIZA 4WJQA 3V62A 4HPLB 2ZEQA 2FCSA 2M4NA 2M17A 4BKGA 3M62B 5DPSA 3HM3A 2MBOA 4K7WA 1J8CA 2MLBA 4G0NB 4LDTB 3RYTA 3ZNHB 2CU1A 2DZJA 2JY6A 4MM3A 3L54A 4K7UA 1V6EA 2G4SA 4F8CB 2W9NA 1WY8A 4FHKA 2NBVB 5JH5C 3PTFC 3L17A 4G11A 4NY0A 2LJ5A 3DBLI 4MGIE 1Z2MA 2KO3A 5G55A 5DPRA 3SD5A 4FJYA 2I1JA 3A4SC 3VUWA 2D10A 4NJ6A 3A4RA 2IO3B 1VD2A 3PLVA 4HWIB 4EZJA 3WAMA 4ANVA 4MGKE 3QC8B 2I1KA 1E8YA 4GIVA 4DDID 4TKNA 2EMTA 2KLCA 4IWQA 4WAAA 2KKCA 4NJ7A 4FBJB 2L00B 2BWES 5D6JB 5JHAA 1YJ1A 3DOWA 1GC7A 4JLCA 4W9HA 5CHWA 2KFKA 2K39A 1V9JA 3APDA 1D3ZA 3ZDMC 4HDOA 1P0RA 3UIPB 2M8SA 2RGFA 2IYDB 2RSUA 4RM9A 3TCAA 3NZSA 2IO1B 2VRRB 4GN1A 1YX5B 3QX1A 4KZ0A 2V1YA 3V61A 4HJKA 2ZVNA 4ICUA 2RD0A 1CMXB 3X23A 4M8NA 2ZNVC 1PQSA 3H7PB 2JPHA 1KM7A 4GU2A 3CSTA 4J6IA 4N9F4 3DPDA 3JYUA 1TGZB 4GDLA 1WJUA 4K81A 4X57B 3VTVA 4KVGB 1R4MI 5LLIA 2O2VA 3U7DA 4BOZB 2L0TA 2O2VB 4AWJA 3VVWB 2NS5A 2N9EB 4MELA 1WR1A 2L0FA 4ZYNA 3VXWA 3JW0X 2RR9A 1V80A 1BT0A 2K6DB 2N7EA 2CHZA 5D2MB 2DYMA 3PLUA 4AP4C 3L08A 1I35A 2CHWA 4KZCA 3WANA 2V3SA 4EFOA 2N1WA 3KH0A 3ZO5B 3H7PA 2B3AA 3KVFB 3PPAA 3ZVVA 2KJRA 4NQLB 2M1MA 2KWVB 3QARA 2ZJDA 5D94A 5E6NA 2K8HA 3X0WA 4K1RB 1E5WA 4IWOA 2KK8A 3AI5A 2ZPNA 2LGDA 2GBKA 2QHOA 2DYBA 3A33B 1WE7A 4ANUA 2HJ8A 1WGYA 4RMAA 2KDBA 4WJNA 2WX1A 3L10B 3C0RB 3SU8X 3D32A 4TQ1A 3PREA 4WJPA 1NI2A 1RFAA 3K9OB 3PZDA 1G6JA 5DPTA 1EF1A 1P98A 2IO2B 2N7DA 3IFWB 1TBEA 1LM8B 3NZUA 3IG3A 2NBUA 4ZRIA 4GDLB 4W9IA 4ANXA 3JVZX 2MW5A 2D11A 4DK5A 1RLFA 4WWNA 4ASWC 2J0MA 4AUQC 3QA8A 2IY0B 1TTNA 2BYFA 2FIFA 2KQSA 3DBSA 4PS8A 3RULA 1LQBA 3VHTC 3ZNID 4ZDVA 4FHJA 4I6NB 2KFJA 2JZZA 2BYVE 4WJOA 1AARA 2KWUB 3TMPB 3VDZA 3ZNZB 3DCGA 3M3JA 2L8JA 2K6QA 3ZW3A 4W9KA 3KUZA 2KC1A 1VCBA 2OOBB 2CHXA 2JXXA 1EUVB 4MSQB 1F9JA 4B9KA 4MGZE 3DQVA 1WM2A 2PEAA 2G45B 1R4NI 1RAXA 2FAZA 2LRWA 2K1FA 4W9CA 5L83A 2MP2B 2N9PC 3L0WB 1ZW7A 4IC7B 3M95A 4BKTA 4W9DA 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX B;  1OTR B;  1NDD A;  1UEL A;  2FCN A;  2N9X A;  2GMI C;  3APF A;  2ZZP B;  2RPQ A;  4PYU A;  2ZCB A;  2N1V A;  3ZRF A;  1UZX B;  2MWS B;  2AWT A;  4LJP B;  1WZ3 A;  2D3G A;  2DZI A;  2MBH A;  3H6N A;  4DBG A;  2C60 A;  1WMH B;  3KW5 B;  1LFD A;  2XK5 A;  1M94 A;  2JWZ A;  2O6V A;  2PE6 B;  4JL9 A;  2KN5 A;  2R2O A;  4XX5 A;  1WIA A;  3R7R A;  1ZKH A;  3R3M A;  2UWQ A;  5CHF A;  3WA0 A;  2A4Z A;  1Q1O A;  3VQI A;  1GG3 A;  5JHB A;  3ZNG C;  1T0Y A;  4GXB A;  1E90 A;  2BF8 B;  4HCN B;  4HXD A;  2NPT A;  3UIO B;  2WX0 A;  2KVR A;  2R2Q A;  4PYZ A;  5KHO A;  2C5L C;  3PT2 B;  4KDL B;  1IYF A;  1L7Y A;  1WI0 A;  3UQB A;  4DHJ B;  3ML8 A;  3TJP A;  2KHW B;  3H1U A;  5HKH A;  1GC6 A;  2LVP A;  3A9K A;  3QIJ A;  4FJZ A;  2KMC A;  1WXS A;  3V60 A;  4HVB A;  3WIM A;  2LD9 A;  3IBE A;  4A20 A;  1P1A A;  3DVG X;  3OAW A;  1NBF C;  3K9P B;  3R66 C;  5AZG A;  3W1S C;  3V6E B;  2KTR A;  1WF9 A;  4LCD E;  4EUT A;  5EDS A;  1WXM A;  4AJW A;  2XEW A;  3CF6 E;  1WH3 A;  2G3Q B;  4NAW B;  4CHK A;  1Q0W B;  3VUY A;  4E3C A;  4HK2 A;  2WDT B;  1WX9 A;  3EFU A;  3QK0 A;  5C23 A;  3WAO A;  2FUH B;  4G50 A;  3R7Q A;  5E6P A;  4HLE A;  4ZRJ A;  2KXJ A;  3ALB A;  4YL8 A;  2ZNV B;  4GB9 A;  4KV2 A;  3ZTD A;  3T9L A;  4BFR A;  4BVU C;  3WAL A;  3PSE B;  2MP2 A;  3VAW A;  2GBN A;  2KAN A;  1WJ6 A;  1J0G A;  4E71 A;  5J17 A;  3HM6 X;  4GMV A;  1HE8 A;  4JGH B;  2C7M B;  1H4R A;  1LXD A;  2AYO B;  4F7Z A;  3IVF A;  4B6W A;  1IP9 A;  4NPN A;  1OGW A;  4NAW A;  2KLG A;  4GSW A;  3T8M A;  2IZV B;  1ISN A;  1YX6 B;  3N30 A;  2NR2 A;  1S3S G;  4BOS C;  2Z0D B;  4EKU A;  4II3 B;  5DCN A;  3JSV A;  2HE7 A;  1C3T A;  2J0J A;  2UYZ B;  4WWP A;  2BKF A;  3UQA A;  2DAF A;  4K7S A;  5L95 C;  3PRP B;  3ZTC A;  3VH3 B;  4EEW A;  2JUO A;  2KMA A;  3B0A A;  3PVL A;  3NS8 A;  4W9F A;  2MBB B;  3PV1 A;  2NCN A;  1XQQ A;  2G4D B;  2BKR B;  3MTN B;  1YD8 U;  3OJ4 B;  4PS7 A;  3Q3J A;  5AEK B;  2KOX A;  4CO7 A;  4XZ4 A;  2AEH A;  3QCA A;  3P2B A;  1SE9 A;  2K8B A;  2LI5 A;  3VTW A;  1P3Q U;  1UBQ A;  2DEN B;  2FNJ B;  2ZCC A;  5BO4 B;  3S2A A;  1V2Y A;  2PPH A;  3ONS A;  2KD0 A;  2K8C A;  2O6V D;  2GBR A;  3A9J A;  2ZVO A;  1Q5W B;  3A9J B;  3NOB A;  3NY5 A;  5D7G A;  3I3T B;  2KX0 A;  5IAA C;  3H7S A;  3QAQ A;  1UH6 A;  3A1Q A;  3CSF A;  1H8C A;  3ZRC A;  5AZH A;  4W9G A;  2D2Q A;  5KHQ A;  2KJH B;  3PGE A;  3MHS D;  1UGM A;  3RT3 B;  2LXC A;  1K8R B;  4DHZ E;  3VTU A;  2AL3 A;  4MDK E;  2C7N B;  3UF8 A;  4A3O A;  1WRD B;  2WYQ A;  4MEM A;  1ZGU B;  4GDK A;  3L13 A;  4FUL A;  4IM2 A;  3UIN B;  2KJ6 A;  5J2R A;  2DZM A;  4OVU A;  3O65 B;  3AXC A;  1E8Z A;  2XBB C;  3BY4 B;  4I6P A;  2KFK B;  1YQB A;  2A5U A;  3OJ3 A;  5G2N A;  4FJV B;  2J0K A;  1C1Y B;  3QHT A;  5IA7 A;  2C9W B;  2DZK A;  2LGX A;  4MJS A;  2FID A;  3Q3F A;  2FCM A;  1V49 A;  4BBN F;  1J19 A;  2LXA A;  2MRP A;  4FLH A;  2BGF A;  3ZLZ A;  5DPW A;  3UGB B;  1YIW A;  2LVQ A;  3RD2 A;  3N3K B;  2IY1 B;  4DDG D;  1L2N A;  4FN2 A;  4KDI C;  2KNB A;  3DVN V;  4EOY A;  1P9D U;  1JRU A;  2MA9 B;  4HDQ A;  1RRB A;  5FR6 A;  3ZDT A;  4KIK B;  1E8W A;  1WGH A;  2L05 A;  3N32 A;  3KUD B;  3H9D A;  1FXT B;  3QWZ B;  2MBE A;  4KSL C;  5CTR C;  2MCN B;  1WE6 A;  4JIO U;  2K25 A;  2KWC A;  5CHV C;  3JSV B;  3RUI B;  3RZW C;  3VFK A;  3PS6 A;  4DWF A;  4F1S A;  1Y8R C;  4GGQ A;  2ASQ A;  2LGY A;  4HPM B;  2IBI B;  2CKH B;  3BIN A;  2KDF B;  3AU5 A;  2JRI B;  4FAD A;  4ICV A;  2GBM A;  1V5O A;  3ECI A;  1V81 A;  2HD5 B;  2MSE D;  3A1Q B;  4MSM B;  1WMH A;  3ZKJ C;  5JZE B;  2L76 A;  3W1Y A;  2O6V B;  3DDC B;  2JVC A;  3GOE A;  3PRM B;  3RCZ A;  4B95 A;  5C1Z A;  4AJY B;  3DVG Y;  3KUC B;  4TUU A;  4EZL A;  1QZE A;  1WX7 A;  3IHP C;  4RM8 A;  4BKS A;  5LXI B;  2DAJ A;  3U8Z A;  2L3Z A;  4TV3 A;  1E7U A;  4WWO A;  1WGG A;  3EEC A;  2KC2 A;  3U30 A;  4IG7 B;  3AU4 A;  2JRH A;  4I6L B;  2Z0E B;  4BBN C;  2JT4 B;  1KJT A;  4ZRK A;  2CR5 A;  2V4L A;  3DVN U;  3ENE A;  2DHZ A;  4M8M A;  4IWP A;  3WAP A;  3SHQ A;  3HHM A;  3MJW A;  4DHZ B;  3NHE B;  2JZ3 B;  1XD3 B;  1MG8 A;  1KOT A;  1SIF A;  2M0X A;  3HK0 A;  1WM3 A;  2DX5 B;  2GOW A;  2DYO A;  3APC A;  1A5R A;  1OEY J;  2LAS A;  4DXA B;  1WXV A;  2LUE A;  4IM0 A;  4MGY E;  3TBL D;  1I42 A;  4JQW C;  2HTH A;  5GMV A;  2KX3 A;  4BKS D;  4HCP B;  1OEY A;  2PE9 A;  2AL6 A;  3OLM D;  2IO0 B;  3DBR I;  1WJ4 A;  3GZN I;  4W9J A;  4EZK A;  2GBJ A;  4NQK E;  3KYD D;  2NVU I;  2MBQ A;  4KSK C;  4MH0 E;  2YVC A;  3SDL C;  2LZ6 A;  1WGD A;  3EHV A;  1WGR A;  4DHJ D;  2JF5 A;  1WXA A;  4LJO B;  2EKE C;  3TIX A;  3CMM B;  3QJZ A;  4WQO B;  3ZUN A;  2LVO A;  4URK A;  5J18 A;  1TZ1 A;  1GJZ A;  2LRU A;  3DBH I;  1Z5S B;  3VUX A;  4GDK B;  2J7Q B;  2Y5B B;  1SGH A;  3KYC D;  2ZPY A;  2BPS A;  2BWF A;  2KTR B;  1XT9 B;  2CS4 A;  5LXH A;  2D07 B;  2YLM A;  3RZF A;  4A3P A;  2WWZ A;  4MJS B;  1UD7 A;  1WR6 E;  2KZR A;  3A9K B;  1GUA B;  4P7I A;  4NNJ B;  1UBI A;  2BYE A;  2C7H A;  2EMS A;  2N4F A;  3EC8 A;  1WZ0 A;  4CYE A;  3QQ8 B;  4FA6 A;  1S1Q B;  1WYW B;  2LWP A;  1E7V A;  3B08 A;  5AZF A;  3V6C B;  1GNU A;  3B1L X;  4G3X B;  3M63 B;  2PJH A;  5TR5 A;  1EO6 A;  3PRZ A;  2REX A;  3TL5 A;  4ANW A;  2FCQ A;  2NPT B;  3VH4 B;  3LJ3 A;  1WX8 A;  2OJR A;  4GOC A;  4IUM B;  4M0W B;  3W1S A;  3ZIM A;  4E74 A;  1E8X A;  1X1M A;  4IM3 A;  2MQJ A;  1WFY A;  4LDT D;  1U4A A;  4KIK A;  1EF5 A;  2MX2 A;  2KTF A;  4W9L A;  1OQY A;  3LDZ E;  1WJN A;  3ML9 A;  4II2 B;  2KDE B;  3PHW B;  2KDI A;  1KLV A;  4W9E A;  2KQ7 A;  1IPG A;  1V5T A;  2Z59 B;  2XK5 B;  3L16 A;  2NBW B;  4TQ0 A;  5CX3 A;  4AOF A;  5E6O A;  4XC2 A;  4IW0 A;  4OVV A;  2L7R A;  1V86 A;  3AUL A;  3HIZ A;  4WJQ A;  3V62 A;  4HPL B;  2ZEQ A;  2FCS A;  2M4N A;  2M17 A;  4BKG A;  3M62 B;  5DPS A;  3HM3 A;  2MBO A;  4K7W A;  1J8C A;  2MLB A;  4G0N B;  4LDT B;  3RYT A;  3ZNH B;  2CU1 A;  2DZJ A;  2JY6 A;  4MM3 A;  3L54 A;  4K7U A;  1V6E A;  2G4S A;  4F8C B;  2W9N A;  1WY8 A;  4FHK A;  2NBV B;  5JH5 C;  3PTF C;  3L17 A;  4G11 A;  4NY0 A;  2LJ5 A;  3DBL I;  4MGI E;  1Z2M A;  2KO3 A;  5G55 A;  5DPR A;  3SD5 A;  4FJY A;  2I1J A;  3A4S C;  3VUW A;  2D10 A;  4NJ6 A;  3A4R A;  2IO3 B;  1VD2 A;  3PLV A;  4HWI B;  4EZJ A;  3WAM A;  4ANV A;  4MGK E;  3QC8 B;  2I1K A;  1E8Y A;  4GIV A;  4DDI D;  4TKN A;  2EMT A;  2KLC A;  4IWQ A;  4WAA A;  2KKC A;  4NJ7 A;  4FBJ B;  2L00 B;  2BWE S;  5D6J B;  5JHA A;  1YJ1 A;  3DOW A;  1GC7 A;  4JLC A;  4W9H A;  5CHW A;  2KFK A;  2K39 A;  1V9J A;  3APD A;  1D3Z A;  3ZDM C;  4HDO A;  1P0R A;  3UIP B;  2M8S A;  2RGF A;  2IYD B;  2RSU A;  4RM9 A;  3TCA A;  3NZS A;  2IO1 B;  2VRR B;  4GN1 A;  1YX5 B;  3QX1 A;  4KZ0 A;  2V1Y A;  3V61 A;  4HJK A;  2ZVN A;  4ICU A;  2RD0 A;  1CMX B;  3X23 A;  4M8N A;  2ZNV C;  1PQS A;  3H7P B;  2JPH A;  1KM7 A;  4GU2 A;  3CST A;  4J6I A;  4N9F 4;  3DPD A;  3JYU A;  1TGZ B;  4GDL A;  1WJU A;  4K81 A;  4X57 B;  3VTV A;  4KVG B;  1R4M I;  5LLI A;  2O2V A;  3U7D A;  4BOZ B;  2L0T A;  2O2V B;  4AWJ A;  3VVW B;  2NS5 A;  2N9E B;  4MEL A;  1WR1 A;  2L0F A;  4ZYN A;  3VXW A;  3JW0 X;  2RR9 A;  1V80 A;  1BT0 A;  2K6D B;  2N7E A;  2CHZ A;  5D2M B;  2DYM A;  3PLU A;  4AP4 C;  3L08 A;  1I35 A;  2CHW A;  4KZC A;  3WAN A;  2V3S A;  4EFO A;  2N1W A;  3KH0 A;  3ZO5 B;  3H7P A;  2B3A A;  3KVF B;  3PPA A;  3ZVV A;  2KJR A;  4NQL B;  2M1M A;  2KWV B;  3QAR A;  2ZJD A;  5D94 A;  5E6N A;  2K8H A;  3X0W A;  4K1R B;  1E5W A;  4IWO A;  2KK8 A;  3AI5 A;  2ZPN A;  2LGD A;  2GBK A;  2QHO A;  2DYB A;  3A33 B;  1WE7 A;  4ANU A;  2HJ8 A;  1WGY A;  4RMA A;  2KDB A;  4WJN A;  2WX1 A;  3L10 B;  3C0R B;  3SU8 X;  3D32 A;  4TQ1 A;  3PRE A;  4WJP A;  1NI2 A;  1RFA A;  3K9O B;  3PZD A;  1G6J A;  5DPT A;  1EF1 A;  1P98 A;  2IO2 B;  2N7D A;  3IFW B;  1TBE A;  1LM8 B;  3NZU A;  3IG3 A;  2NBU A;  4ZRI A;  4GDL B;  4W9I A;  4ANX A;  3JVZ X;  2MW5 A;  2D11 A;  4DK5 A;  1RLF A;  4WWN A;  4ASW C;  2J0M A;  4AUQ C;  3QA8 A;  2IY0 B;  1TTN A;  2BYF A;  2FIF A;  2KQS A;  3DBS A;  4PS8 A;  3RUL A;  1LQB A;  3VHT C;  3ZNI D;  4ZDV A;  4FHJ A;  4I6N B;  2KFJ A;  2JZZ A;  2BYV E;  4WJO A;  1AAR A;  2KWU B;  3TMP B;  3VDZ A;  3ZNZ B;  3DCG A;  3M3J A;  2L8J A;  2K6Q A;  3ZW3 A;  4W9K A;  3KUZ A;  2KC1 A;  1VCB A;  2OOB B;  2CHX A;  2JXX A;  1EUV B;  4MSQ B;  1F9J A;  4B9K A;  4MGZ E;  3DQV A;  1WM2 A;  2PEA A;  2G45 B;  1R4N I;  1RAX A;  2FAZ A;  2LRW A;  2K1F A;  4W9C A;  5L83 A;  2MP2 B;  2N9P C;  3L0W B;  1ZW7 A;  4IC7 B;  3M95 A;  4BKT A;  4W9D A;  4PS3 A; 
#chains in the Genus database with same CATH topology
 3PHX B;  3ZXR A;  1TKG A;  1NDD A;  2N9X A;  2RPQ A;  3RMK C;  2ZCB A;  3ZRF A;  4HJG E;  2MWS B;  3VRA B;  2AWT A;  2DZI A;  1FCC C;  2BBC A;  2MBH A;  5HHD G;  2XK5 A;  1M94 A;  2KN5 A;  1WIA A;  1K52 A;  3R3M A;  5BMH A;  5BMI A;  1Q1O A;  4XGA B;  3VQI A;  2N9L A;  3RNB C;  4YT0 B;  2BF8 B;  4HCN B;  2MHJ A;  4HXD A;  1J7B A;  4PYZ A;  2KVR A;  2GLS A;  4WQM A;  1L7Y A;  1IUE A;  3UQB A;  4DHJ B;  3H1U A;  1GC6 A;  2KMC A;  3IBE A;  1P1A A;  1NBF C;  4KX6 B;  1IGC A;  2XNA C;  2N9K A;  4AJW A;  2XEW A;  1WH3 A;  1TS4 A;  5D3I B;  1YN3 A;  2V9H A;  5D3D A;  3WAO A;  4K3C A;  5E6P A;  1AWD A;  4ZRJ A;  1BUI C;  2ZNV B;  4GB9 A;  5HI1 A;  3VAW A;  3Q3O C;  1J0G A;  4E71 A;  3LYY A;  4GMV A;  1HE8 A;  3EFC A;  4HKZ E;  4ZRQ A;  4JGH B;  4L23 A;  3IVF A;  2VZK D;  4D2K A;  4NAW A;  1UNS A;  3RNG C;  4GSW A;  2IZV B;  1ISN A;  1YX6 B;  3N30 A;  2NR2 A;  5IOI A;  4BOS C;  2WU2 B;  3TSS A;  2LHE A;  1ZPS A;  2BKF A;  2BB5 A;  1V1P A;  4EEW A;  4IDI A;  2KMA A;  2LEK A;  2Y5C A;  1L6U A;  4W9F A;  2RDB C;  4ZRP A;  3OJ4 B;  3P2B A;  2QEJ C;  2LI5 A;  4A3P A;  1UBQ A;  2DEN B;  2FNJ B;  1T5X D;  3S2A A;  3ONS A;  4JE3 B;  3A9J A;  3NRZ A;  5D7G A;  3I3T B;  1MFW A;  2KX0 A;  4PK1 A;  3H7S A;  3QAQ A;  2LJI A;  4W9G A;  2D2Q A;  4UDU C;  3MHS D;  4MDK E;  1E10 A;  4C7Z A;  2C7N B;  3UF8 A;  1WRD B;  4MEM A;  1SSN A;  4GDK A;  3L13 A;  1QT9 A;  1GAQ B;  2KJ6 A;  4OVU A;  5G2N A;  2K9X A;  5IA7 A;  1NYR A;  1V49 A;  1XLO A;  3O13 A;  4FLH A;  3GE3 C;  2WNM A;  4DDG D;  3I57 A;  2IY1 B;  4A9A A;  5HFY A;  1E8W A;  1WGH A;  2L05 A;  3KUD B;  2MCN B;  1WE6 A;  2CU3 A;  4JIO U;  2KWC A;  3RUI B;  1YNT E;  3PS6 A;  4DWF A;  3NVW A;  2BYT A;  2V3N A;  4RNA A;  4BZA A;  2HD5 B;  3A1Q B;  4MSM B;  3ZKJ C;  4JX1 C;  3DDC B;  3GOE A;  2HJ1 A;  4RGO S;  2LHD A;  2NMQ A;  3KUC B;  4TUU A;  2I2Y A;  3ZYY X;  1C79 A;  4RM8 A;  3BZD B;  5IP4 D;  2KVZ A;  3Q8F A;  1M4V A;  1WGG A;  3J9C A;  3OWE B;  5EE3 A;  4I6L B;  1KJT A;  3DVN U;  2QDF A;  4DHZ B;  3KWL A;  1QIL A;  4HRO A;  2X8X X;  2EEL A;  2AQ1 B;  2Y5P A;  2LUE A;  1FO4 A;  4R3D A;  2KT7 A;  4JQW C;  2HTH A;  4NAM A;  1T0R C;  4LNN A;  2AL6 A;  2K5P A;  2IO0 B;  3SFE B;  3GZN B;  1I4R A;  2NVU I;  4NZL B;  4KSK C;  1L4Z B;  2LZ6 A;  5C2T B;  2IGH A;  2EKE C;  2I38 A;  2LVO A;  4DXG A;  1GJZ A;  2J7Q B;  2WGS A;  3U2S C;  4P1B C;  3W5V B;  1UGJ A;  2K3U A;  1NEN B;  2CS4 A;  4BAX A;  1B1Z A;  1WR6 E;  2QSD A;  4LNF A;  1UBI A;  2BYE A;  2C7H A;  4CYE A;  3QQ8 B;  2HTM E;  2LWP A;  1WYW B;  2L1A A;  1GNU A;  2PJH A;  2YEP B;  3SFD B;  2AQ3 B;  2AQ2 B;  3AE3 B;  2OJR A;  1E8X A;  4IM3 A;  4MAC A;  2MQJ A;  1U4A A;  1WJN A;  3Q2A C;  3BWU D;  2K0P A;  2KDE B;  2J52 A;  4W9E A;  1IPG A;  2XK5 B;  1K53 A;  5CX3 A;  1B9R A;  3AM9 A;  1V86 A;  3V62 A;  4HPL B;  2FCS A;  4YWG G;  4BKG A;  3M62 B;  5DPS A;  2WDV B;  4K7W A;  1T6B X;  4G0N B;  3UI3 A;  2JY6 A;  4IKG A;  1C4P A;  1V6E A;  3I9V 1;  1I4G A;  2NBV B;  5JH5 C;  2LJ5 A;  3DBL I;  4MGI E;  1Z2M A;  2KO3 A;  3SD5 A;  4FJY A;  2I1J A;  2D10 A;  3RNF C;  4NJ6 A;  1ZDV A;  3A4R A;  3R2T A;  1VD2 A;  2QJL A;  4HWI B;  4MGK E;  2I1K A;  2WXL A;  1WXQ A;  1ET9 A;  4IWQ A;  2KKC A;  5D6J B;  2WHI A;  5JHA A;  1YJ1 A;  3DOW A;  2KFK A;  2W55 A;  1F52 A;  3APD A;  3FIL B;  1D3Z A;  3U52 E;  1MPE A;  2BVC A;  1PYW D;  4DXF A;  3IT6 B;  3X23 A;  4JPS A;  1KF6 B;  1PQS A;  3CST A;  1D5X C;  4X57 B;  4C80 A;  1IBX B;  2D3B A;  2O2V A;  3U7D A;  2L0T A;  4AWJ A;  3VVW B;  3FAH A;  1WR1 A;  2KWD A;  1FFV A;  2M56 B;  2G1E A;  2K6D B;  1FNU A;  3PLU A;  3L08 A;  1VR9 A;  3ZO5 B;  3PPA A;  4NQL B;  2WP9 B;  1R4M B;  2KWV B;  4US8 A;  1QOG A;  1ZXI A;  3AN1 A;  2KK8 A;  1SJH D;  1WE7 A;  3RFZ B;  1K51 A;  3WCQ A;  4WJN A;  3L10 B;  3D32 A;  4TQ1 A;  4WJP A;  3K9O B;  5DPT A;  3P4R B;  3CIR B;  1N63 A;  2N7D A;  2K22 A;  3LB8 C;  2W54 A;  2KQS A;  4PS8 A;  4F7Z A;  3RNA C;  3VHT C;  1RM6 C;  4M0W A;  1SBB B;  3TMP B;  4YTM B;  3ZW3 A;  2KC1 A;  3GE8 C;  1DOY A;  2CHX A;  2JXX A;  1EUV B;  4LTU A;  1F9J A;  1I4Q A;  2CJN A;  5L83 A;  1VZ7 A;  5IO9 A;  4WAF A;  2B76 B;  2ZZP B;  2N1V A;  1FCL A;  1TIF A;  2WDR B;  4AQ7 A;  4CQN A;  1JWM D;  1VZ6 A;  3AEE B;  2J4X A;  2D3G A;  4NJC A;  1YMH E;  3H6N A;  3KW5 B;  2PE6 B;  2R2O A;  1ZKH A;  3AB5 A;  5CHF A;  3WA0 A;  2D3A A;  3ZNG C;  1HQR D;  4GXB A;  2R2Q A;  1YN4 A;  3FIL A;  2AX5 A;  1JWU D;  5HKH A;  4RF0 A;  1WXS A;  3WIM A;  2LD9 A;  4ZOH C;  1OQQ A;  4A20 A;  3DVG X;  3OAW A;  3MJ5 A;  3K9P B;  1ZXH A;  3TEX A;  4LCD E;  2INP E;  4EUT A;  1WXM A;  3AE5 B;  1TY2 A;  1T0S C;  4WIP A;  3U4E G;  3Q8C A;  1AYF A;  1Q0W B;  4E3C A;  1ZUD 2;  2WDT B;  1ET6 A;  3QK0 A;  2PMV A;  2FUH B;  4HLE A;  1TKY A;  4YL8 A;  4BFR A;  4BVU C;  2FE8 A;  2M19 A;  4A90 A;  2KAN A;  1JQ4 A;  1WJ6 A;  5J17 A;  3Q8E A;  2BW2 A;  1H4R A;  2BTE A;  1LXD A;  4LLG M;  1VLB A;  3DBL B;  2MJ3 A;  4EE2 A;  1OGW A;  3P42 A;  1S3S G;  2KQ4 X;  2XN9 C;  2Z0D B;  4EKU A;  2JSV X;  2J0J A;  2UYZ B;  1EWC A;  1UF0 A;  4WWP A;  3RN9 C;  1WYG A;  1HA5 A;  1D5Z C;  3ZTC A;  2JUO A;  3PVL A;  3NS8 A;  1MI0 A;  3PV1 A;  1TZO A;  3MTN B;  2KOX A;  1L5P A;  3AE2 B;  2R61 A;  5BO4 B;  1V2Y A;  2K8C A;  2HDE A;  3NOB A;  1TS2 A;  5IAA C;  5GXG B;  2KN4 A;  1I4H A;  3CSF A;  1STE A;  5AZH A;  3ZRC A;  2KJH B;  4ZYS A;  4A3O A;  2WYQ A;  1ZGU B;  4FUL A;  3VR8 B;  1KRH A;  3DWG C;  4I6P A;  3BY4 B;  2KFK B;  1YQB A;  2ZW0 A;  4FJV B;  5IKC M;  1C1Y B;  3QHT A;  2DZK A;  2LGX A;  5EE0 A;  4BBN F;  2WXO A;  2MRP A;  2BGF A;  3ZLZ A;  3DHG C;  3N3K B;  1L2N A;  1JWS D;  3AE6 B;  1QLB B;  2ON8 A;  3DVN V;  1P9D U;  1BXT A;  1JRU A;  4MT5 A;  1RRB A;  1JW9 D;  5FR6 A;  3ZDT A;  3RNC C;  1PGA A;  4F1S A;  1FM0 D;  2ASQ A;  2LGY A;  4HPM B;  4LK0 M;  2CKH B;  3RI7 C;  5H92 C;  3AU5 A;  1E0Z A;  4ICV A;  2GBM A;  1WMH A;  2L76 A;  5C1Z A;  1FEH A;  3RCZ A;  4YXD B;  2N7J A;  1FRD A;  4AJY B;  4EZL A;  1WX7 A;  5LXI B;  2DAJ A;  2L3Z A;  1E7U A;  4WWO A;  2JU6 X;  4P16 A;  2BS4 B;  1CZP A;  2KC2 A;  4IG7 B;  2JRH A;  2JT4 B;  1R7S A;  3MJW A;  3AEB B;  2JZ3 B;  1I4X A;  3MC0 B;  1KH0 A;  3Q14 C;  3HK0 A;  2TSS A;  1VRA B;  3APC A;  2VZK B;  1NYQ A;  3AE4 B;  4IM0 A;  3TBL D;  2NTS A;  5GMV A;  4BKS D;  4HCP B;  4WH4 A;  3OLM D;  1WJ4 A;  3GZN I;  3FC4 A;  5EE9 A;  4L1B A;  4M00 A;  4HRS A;  1HTO A;  3EHV A;  1WGR A;  2JF5 A;  1WXA A;  2RPV A;  3CMM B;  4URK A;  5J18 A;  1TZ1 A;  2LRU A;  4GDK B;  2Y5B B;  3AE1 B;  3ABV B;  4J3O D;  2ZPY A;  5G5G A;  2EKI A;  2BWF A;  2KTR B;  5LXH A;  1ZE3 D;  2YLM A;  3NZ3 A;  2GB1 A;  2KZR A;  3A9K B;  4NNJ B;  2EMS A;  2N4F A;  4FA6 A;  1N60 A;  1S1Q B;  5AZF A;  1E7V A;  3M63 B;  1EO6 A;  3NG0 A;  4OZC A;  2NPT B;  3VH4 B;  1WX8 A;  2BT6 A;  4GOC A;  3W1S A;  3GB1 A;  4KKJ A;  2JZP A;  2KTF A;  2JWU A;  2G9H D;  4QAY A;  5HG2 A;  1KLV A;  2KQ7 A;  1V5T A;  2GRI A;  3L16 A;  1SF0 A;  4AOF A;  4C7Y A;  4XC2 A;  2L52 A;  3HIZ A;  4WJQ A;  4USA A;  5BYS A;  4ACF A;  1J8C A;  2MLB A;  4LDT B;  3RYT A;  3ZNH B;  2JQR B;  4MM3 A;  3L54 A;  1WWT A;  3BVM A;  3MP9 A;  4S0R A;  5AUK A;  1WSP A;  1QOA A;  5DPR A;  1HZ6 A;  3A4S C;  3CWI A;  3VR9 B;  3QC8 B;  4GIV A;  2QIE B;  1WRI A;  2KLC A;  1Y56 A;  2WS3 B;  3BYY B;  1P7F A;  2K39 A;  1V1O A;  3UIP B;  4XDC A;  2RGF A;  1ENF A;  4RM9 A;  1JAL A;  1V1P B;  2WXH A;  4GN1 A;  3V61 A;  1GB1 A;  2ZVN A;  4Q2J A;  4M8N A;  3Q69 A;  4MM3 B;  3GP7 A;  1UUP A;  3DPD A;  3JYU A;  1TGZ B;  4K81 A;  2DNF A;  3EUB 2;  1YQ4 B;  2L0F A;  2WXF A;  3JW0 X;  2RR9 A;  1BT0 A;  1TYG B;  2H89 B;  3KLS X;  4KZC A;  3WAN A;  2V3S A;  1A70 A;  2WXG A;  3KH0 A;  3H7P A;  3KVF B;  3H8H A;  2M1M A;  2D5G A;  5D94 A;  4OVZ A;  5E6N A;  1PFD A;  4K1R B;  1HEZ E;  3AI5 A;  2ZPN A;  2LGD A;  5FK9 C;  4RFB A;  2WXJ A;  1WGY A;  4RMA A;  2KDB A;  3HVD A;  3SU8 X;  1SXT A;  1NI2 A;  1QQR A;  1RFA A;  4O1N A;  3IFW B;  1TBE A;  1LM8 B;  3IG3 A;  2NBU A;  4GDL B;  1QF6 A;  2MW5 A;  4DK5 A;  2J0M A;  2LMC A;  4AUQ C;  3QA8 A;  1TTN A;  2BYF A;  4GLS C;  4FHJ A;  2JZZ A;  2BYV E;  1AAR A;  3ZNZ B;  2W3R A;  3KQ4 A;  5EE1 A;  2OJW A;  2OOB B;  3HRD D;  4MSQ B;  4MGZ E;  5BMG A;  1F2R I;  2G45 B;  2WXM A;  1RAX A;  4IOI E;  4W9C A;  2MP2 B;  3DHH C;  1DOI A;  4IC7 B;  1SE3 A;  1XCT L;  3M95 A;  4BKT A;  3BK1 A;  1OTR B;  1UEL A;  2ACZ B;  1F2R C;  1V97 A;  4LJP B;  1WZ3 A;  3LXF A;  2C60 A;  1WMH B;  2BS3 B;  4B0E A;  4JL9 A;  2D3C A;  2JWZ A;  2O6V A;  4XX5 A;  3R7R A;  3N1X C;  2SEB D;  4LNO A;  1ESF A;  2A4Z A;  5JHB A;  1E90 A;  2NPT A;  2W82 A;  2WX0 A;  4M01 A;  5KHO A;  3B9J A;  1IYF A;  1WI0 A;  1T0Q C;  2WDQ B;  3ML8 A;  3TJP A;  2KHW B;  3A9K A;  4FJZ A;  1L4D B;  3BII D;  3V60 A;  4HVB A;  1RYJ A;  1YJJ A;  1C77 A;  3R66 C;  3AEC B;  1XCQ L;  2INC C;  5FKA C;  3AE8 B;  2PTL A;  1N6Z A;  4XYC A;  2OHF A;  2BB6 A;  3CF6 E;  2G3Q B;  1T3Q A;  4CHK A;  1QOF A;  3VUY A;  3AH7 A;  4HK2 A;  2KDM A;  5C23 A;  4G50 A;  3R7Q A;  2QC8 A;  3I5J C;  1KFY B;  3ALB A;  3ZTD A;  3T9L A;  3WAL A;  3PSE B;  2MP2 A;  2GBN A;  1C76 A;  4XWW A;  3U7Z A;  4C4V B;  1QOB A;  2VH2 A;  1Q10 A;  3RPF C;  3NUH B;  4M02 A;  1XXG A;  2AYO B;  1IBX A;  2LGS A;  2QIL A;  2KLG A;  4LNK A;  3T8M A;  4N6E B;  3NS1 A;  4B0M A;  3JSV A;  2HE7 A;  4K7S A;  5L95 C;  3B0A A;  4RGN A;  2NCN A;  3Q3M C;  1XQQ A;  1XF5 L;  2BKR B;  1YD8 U;  3IXS A;  1XLN A;  3Q3J A;  2N0S B;  4XZ4 A;  1SE9 A;  3VTW A;  1P3Q U;  4US9 A;  2ZCC A;  1G6J A;  2O6V D;  2GBR A;  2W3S A;  2ZVO A;  1Q5W B;  3A9J B;  3A1Q A;  1UGM A;  2Y3A A;  3RT3 B;  2LXC A;  3VTU A;  4WUR A;  2VH1 A;  2GI9 A;  1XEE A;  4C4V A;  2OED A;  3UIN B;  4A6Q A;  1TJE A;  5J2R A;  2PIA A;  2QCZ A;  2XBB C;  2A5U A;  5H8Y E;  2E6X A;  1FD6 A;  4MJS A;  2FCM A;  1NEK B;  2LXA A;  3DHI C;  3URY A;  5T8I A;  2ICI A;  1L0X B;  5DPW A;  2J42 A;  3UGB B;  4JWU C;  1YIW A;  2LVQ A;  1RFK A;  4KDI C;  4ITK A;  2MA9 B;  1JRO A;  3B2G A;  4KIK B;  1OFF A;  3N32 A;  4KSL C;  1FXT B;  2MBE A;  1MG4 A;  2K25 A;  5MPO A;  3JSV B;  4GGQ A;  2KDF B;  4K3B A;  2JRI B;  3V3X A;  1L6V A;  2E3T A;  3TEY A;  3ECI A;  1KLG D;  5JZE B;  3W1Y A;  3PRM B;  3BYT B;  2JVC A;  1ZDX A;  3DVG Y;  1QZE A;  3IHP C;  3U8Z A;  4TV3 A;  4FXC A;  4ZRK A;  1GOZ A;  2V4L A;  2PLP A;  3SHQ A;  1MHX A;  1VZ8 A;  1CK1 A;  3NHE B;  1NVI D;  4REZ A;  3TEZ A;  1SIF A;  1WM3 A;  2DYO A;  1OEY J;  2DBY A;  3L4P A;  3C8Y A;  4DXA B;  5I4D A;  3Q8A A;  1FPY A;  1OEY A;  1FFU A;  4EZK A;  1L0Y B;  4W9J A;  4NQK E;  1N5X A;  3KYD D;  3T3N A;  3NJT A;  3MFG A;  3SDL C;  1WGD A;  1SE2 A;  1I7H A;  3ZUN A;  2MJD A;  4WQO B;  2BQQ A;  1SJE D;  3DBH I;  3VUX A;  1TS5 A;  1SGH A;  4AS1 A;  3SR6 A;  3IT4 B;  1XT9 B;  2D07 B;  1SEB D;  3RZF A;  4L2Y A;  1YOV B;  3P1M A;  3Q6B A;  3BK2 A;  4P7I A;  4KKI A;  1EU3 A;  3EC8 A;  1WZ0 A;  2JXT A;  1TY0 A;  1GB4 A;  1LGR A;  3V6C B;  5TR5 A;  3B1L X;  3TL5 A;  3ZJV A;  2REX A;  2FCQ A;  2WXQ A;  2WLB A;  3N9Y C;  4M0W B;  4IUM B;  1X1M A;  1DGJ A;  1WFY A;  4W9L A;  1K50 A;  1EF5 A;  2MX2 A;  3AED B;  3ML9 A;  2KDI A;  1TKE A;  1I4P A;  3EGR A;  2Z59 B;  3ZJT A;  2NBW B;  2DWQ A;  5E6O A;  2PVG C;  2L7R A;  3AUL A;  5BYQ A;  2M4N A;  2M17 A;  2MBO A;  3MC8 A;  4K7U A;  1FXA A;  1WY8 A;  4FHK A;  4ARI A;  2SAK A;  4XDD A;  4YTP B;  1N5W A;  4XE0 A;  3L17 A;  4LNI A;  1EWY C;  3GS2 A;  1QKZ A;  3OG5 A;  1CQV A;  2IO3 B;  1N61 A;  1C78 A;  4OHJ A;  3PLV A;  4DQO C;  4EZJ A;  2JYT A;  3WAM A;  4ANV A;  1E8Y A;  4TKN A;  2EMT A;  2V0G A;  4RGM A;  5BYR A;  2CJO A;  4FBJ B;  2L00 B;  4RH6 A;  5CHW A;  1GC7 A;  3ZDM C;  4HDO A;  1P0R A;  1XLP A;  2NTT A;  2LFI A;  4TSS A;  3Q8B A;  4HEA 1;  3TCA A;  2IO1 B;  2V4I B;  2VRR B;  1YX5 B;  4KGT A;  4KZ0 A;  3W5U B;  1UWX A;  2RD0 A;  2ZNV C;  2JPH A;  1KM7 A;  4N9F 4;  3VTV A;  4KVG B;  1R4M I;  5LLI A;  4BOZ B;  2O2V B;  1D4B A;  4MEL A;  3VXW A;  1V80 A;  3C19 A;  2PVO D;  5D2M B;  1JWB D;  2DYM A;  4P6V F;  2CHW A;  1FXI A;  1MHH E;  2N1W A;  3ZVV A;  2KJR A;  2WXK A;  1JRP A;  5JXV A;  2ZJD A;  2ONQ A;  5E6J A;  2QHO A;  3A33 B;  3ZQ4 A;  2LUM A;  2HJ8 A;  4ARC A;  2WX1 A;  3AE9 B;  1ZOY B;  3PZD A;  4W9I A;  4ANX A;  1RWS A;  4PT5 A;  1RLF A;  1D6E C;  4A8X C;  5FR3 A;  3SEB A;  4ZDV A;  1LQB A;  4I6N B;  3AE7 B;  4WJO A;  2KWU B;  3B2F A;  3VDZ A;  2L83 A;  2RMM A;  3DCG A;  3M3J A;  3R2I A;  4MH8 A;  4W9K A;  3KUZ A;  1VCB A;  2LGI A;  1WM2 A;  1R4N I;  2LRW A;  2K1F A;  2N9P C;  4W9D A;  4B6W A;  5AUI A;  3ZJU A;  3IAM 1;  3NVY A;  4HPP A;  2FCN A;  3APF A;  2GMI C;  2IPK D;  4PYU A;  1AW7 A;  1UZX B;  1V8C A;  4DBG A;  2Z8L A;  1LFD A;  4P1C C;  2UWQ A;  1SIJ A;  1GG3 A;  4RGT A;  4ZHO A;  1T0Y A;  1IGD A;  3UIO B;  4HKQ A;  2WXR A;  1BML C;  2C5L C;  3PT2 B;  1YQ3 B;  2MH7 A;  2IDY A;  4KDL B;  3W9C B;  3P63 A;  3T3O A;  3ZXV A;  3BVZ A;  1EM7 A;  3QIJ A;  2LVP A;  2JYE A;  1PUT A;  2KYW A;  3W1S C;  5AZG A;  3V6E B;  2KTR A;  1WF9 A;  1FRR A;  2RDG A;  4OW0 A;  5EDS A;  3N1Z C;  4NAW B;  1WX9 A;  3EFU A;  1KTK A;  3DBR B;  2KXJ A;  4RF1 A;  3Q3N C;  4KV2 A;  5IN7 A;  2FUG 1;  3E9S A;  3HM6 X;  3W2D A;  5LNK 1;  3ZGZ A;  2C7M B;  2KMM A;  3AEG B;  4RCO A;  1IP9 A;  4NPN A;  4II3 B;  5DCN A;  5C3J B;  1C3T A;  4ZHP A;  3UQA A;  2DAF A;  3PRP B;  3VH3 B;  1FMA D;  1AN8 A;  2MBB B;  2G4D B;  3VRB B;  2L32 A;  4PS7 A;  1YN5 A;  5AEK B;  3AEF B;  4CO7 A;  2AEH A;  3QCA A;  2K8B A;  2INN E;  1J7C A;  2PPH A;  2KD0 A;  1FIQ A;  3NY5 A;  1E6E B;  1UH6 A;  1H8C A;  4YSZ B;  3EA6 A;  5KHQ A;  3PGE A;  1K8R B;  4DHZ E;  3KWV A;  2AL3 A;  3E56 A;  3N1Y C;  3TEW A;  4IM2 A;  2DZM A;  4WWM A;  3O65 B;  1E7P B;  3AXC A;  1E8Z A;  3OJ3 A;  2J0K A;  5G5H A;  3PZ7 A;  1L0V B;  2C9W B;  1XLQ A;  2FID A;  3Q3F A;  1XO3 A;  2ZW1 A;  1J19 A;  3PZ8 A;  3DBH B;  3N20 C;  1VJK A;  3RD2 A;  4FN2 A;  2KNB A;  4EOY A;  4HDQ A;  4KGR A;  4OZB A;  1C4A A;  1DOX A;  2M0A A;  1OQR A;  2JX5 A;  1CJE A;  3H9D A;  3QWZ B;  5CTR C;  3NVZ A;  5CHV C;  3RZW C;  1JCK B;  3VFK A;  1Y8R C;  2IBI B;  3BIN A;  2UU7 A;  4FAD A;  1V5O A;  1V81 A;  2MSE D;  1ROE A;  3MHZ A;  2O6V B;  4B95 A;  2DLB A;  4BKS A;  1R4N B;  3EEC A;  1FNW A;  3U30 A;  3AU4 A;  2Z0E B;  1VDV A;  4BBN C;  2CR5 A;  3ENE A;  3WAP A;  2DHZ A;  4M8M A;  4IWP A;  3HHM A;  2IGG A;  3ETR A;  4N59 A;  1XD3 B;  4TMA B;  1MG8 A;  1EU4 A;  1KOT A;  1JWA D;  3HUI A;  2M0X A;  2DX5 B;  2GOW A;  1A5R A;  2IJ0 A;  2LAS A;  1WXV A;  4MGY E;  2IGD A;  1I42 A;  4H2A A;  4YSX B;  4JWS C;  1MVK A;  4OZA A;  2KX3 A;  2PE9 A;  1HTQ A;  1C4C A;  2QMT A;  3DBR I;  1ZP0 B;  2GBJ A;  3BVG A;  2H88 B;  2MBQ A;  2PW9 A;  4MH0 E;  2YVC A;  2WXI A;  4DHJ D;  4LJO B;  3TIX A;  3QJZ A;  4KGS A;  4A55 A;  4S17 A;  1ACC A;  1Z5S B;  2MEK A;  1DYQ A;  1PGB A;  3KYC D;  2BPS A;  3AV8 A;  5TSS A;  1P7E A;  3I63 C;  1FNV A;  2WWZ A;  4MJS B;  1UD7 A;  4YTN B;  1GUA B;  1LO5 D;  1N62 A;  3HVZ A;  4XWT A;  2J53 A;  3B08 A;  1TT5 B;  4G3X B;  4ANW A;  3PRZ A;  3TUO A;  1GPX A;  1MJD A;  3LJ3 A;  3ZIM A;  4E74 A;  4LDT D;  4KIK A;  3RNE C;  2KAJ A;  1OQY A;  3LDZ E;  2RDH A;  4II2 B;  3PHW B;  2Q5W D;  3V05 A;  4TQ0 A;  3DWM A;  2FBW B;  2WXP A;  4IW0 A;  4OVV A;  1TS3 A;  2ZEQ A;  3R8B A;  2X38 A;  1PDX A;  3HM3 A;  1PGX A;  3P4Q B;  2CU1 A;  2DZJ A;  4C56 C;  1SE4 A;  1UWM A;  2G4S A;  4F8C B;  2W9N A;  1NI3 A;  3AEA B;  3PTF C;  4G11 A;  4NY0 A;  1SB3 C;  5G55 A;  3VUW A;  3FKY A;  3P4P B;  4DDI D;  1J7A A;  4WAA A;  4NJ7 A;  2BWE S;  4JLC A;  4W9H A;  1WGK A;  1V9J A;  2M8S A;  2KAC A;  2IYD B;  2MJE A;  2RSU A;  3NZS A;  3QX1 A;  2V1Y A;  4HJK A;  4ICU A;  1CMX B;  3H7P B;  4GU2 A;  2YEP F;  4J6I A;  4GDL A;  1WJU A;  3MC9 A;  1YJI A;  3P4S B;  2NS5 A;  2PKO A;  2N9E B;  4ZYN A;  1HZ5 A;  2N7E A;  2CHZ A;  4YSY B;  1JML A;  4AP4 C;  2WXN A;  1I35 A;  3AMZ A;  4EFO A;  2B3A A;  1D5M C;  3QAR A;  2K8H A;  3X0W A;  1E5W A;  4IWO A;  2GBK A;  4ANU A;  2DYB A;  2V3P A;  1KLU D;  1F77 A;  3C0R B;  3PRE A;  1EF1 A;  2IND C;  1P98 A;  2IO2 B;  3NZU A;  1F1H A;  3IAS 1;  4ZRI A;  3JVZ X;  2D11 A;  2BS2 B;  4WWN A;  2WU5 B;  4ASW C;  4C00 A;  2IY0 B;  2FIF A;  3DBS A;  3RUL A;  3ZNI D;  2KFJ A;  3PO0 A;  4N58 A;  2L8J A;  2K6Q A;  2WQY B;  3NVV A;  4B9K A;  3DQV A;  1C9F A;  2PEA A;  2FAZ A;  1F0Z A;  3L0W B;  1ZW7 A;  1E9M A;  1HXY D;  4PS3 A; 
#chains in the Genus database with same CATH homology
 3PHX B;  1OTR B;  1NDD A;  1UEL A;  2FCN A;  2N9X A;  2GMI C;  3APF A;  2ZZP B;  2RPQ A;  4PYU A;  2ZCB A;  2N1V A;  3ZRF A;  1UZX B;  2MWS B;  2AWT A;  4LJP B;  1WZ3 A;  2D3G A;  2DZI A;  2MBH A;  3H6N A;  4DBG A;  2C60 A;  1WMH B;  3KW5 B;  1LFD A;  2XK5 A;  1M94 A;  2JWZ A;  2O6V A;  2PE6 B;  4JL9 A;  2KN5 A;  2R2O A;  4XX5 A;  1WIA A;  3R7R A;  1ZKH A;  3R3M A;  2UWQ A;  5CHF A;  3WA0 A;  2A4Z A;  1Q1O A;  3VQI A;  1GG3 A;  5JHB A;  3ZNG C;  1T0Y A;  4GXB A;  1E90 A;  2BF8 B;  4HCN B;  4HXD A;  2NPT A;  3UIO B;  2WX0 A;  2KVR A;  2R2Q A;  4PYZ A;  5KHO A;  2C5L C;  3PT2 B;  4KDL B;  1IYF A;  1L7Y A;  1WI0 A;  3UQB A;  4DHJ B;  3ML8 A;  3TJP A;  2KHW B;  3H1U A;  5HKH A;  1GC6 A;  2LVP A;  3A9K A;  3QIJ A;  4FJZ A;  2KMC A;  1WXS A;  3V60 A;  4HVB A;  3WIM A;  2LD9 A;  3IBE A;  4A20 A;  1P1A A;  3DVG X;  3OAW A;  1NBF C;  3K9P B;  3R66 C;  5AZG A;  3W1S C;  3V6E B;  2KTR A;  1WF9 A;  4LCD E;  4EUT A;  5EDS A;  1WXM A;  4AJW A;  2XEW A;  3CF6 E;  1WH3 A;  2G3Q B;  4NAW B;  4CHK A;  1Q0W B;  3VUY A;  4E3C A;  4HK2 A;  2WDT B;  1WX9 A;  3EFU A;  3QK0 A;  5C23 A;  3WAO A;  2FUH B;  4G50 A;  3R7Q A;  5E6P A;  4HLE A;  4ZRJ A;  2KXJ A;  3ALB A;  4YL8 A;  2ZNV B;  4GB9 A;  4KV2 A;  3ZTD A;  3T9L A;  4BFR A;  4BVU C;  3WAL A;  3PSE B;  2MP2 A;  3VAW A;  2GBN A;  2KAN A;  1WJ6 A;  1J0G A;  4E71 A;  5J17 A;  3HM6 X;  4GMV A;  1HE8 A;  4JGH B;  2C7M B;  1H4R A;  1LXD A;  2AYO B;  4F7Z A;  3IVF A;  4B6W A;  1IP9 A;  4NPN A;  1OGW A;  4NAW A;  2KLG A;  4GSW A;  3T8M A;  2IZV B;  1ISN A;  1YX6 B;  3N30 A;  2NR2 A;  1S3S G;  4BOS C;  2Z0D B;  4EKU A;  4II3 B;  5DCN A;  3JSV A;  2HE7 A;  1C3T A;  2J0J A;  2UYZ B;  4WWP A;  2BKF A;  3UQA A;  2DAF A;  4K7S A;  5L95 C;  3PRP B;  3ZTC A;  3VH3 B;  4EEW A;  2JUO A;  2KMA A;  3B0A A;  3PVL A;  3NS8 A;  4W9F A;  2MBB B;  3PV1 A;  2NCN A;  1XQQ A;  2G4D B;  2BKR B;  3MTN B;  1YD8 U;  3OJ4 B;  4PS7 A;  3Q3J A;  5AEK B;  2KOX A;  4CO7 A;  4XZ4 A;  2AEH A;  3QCA A;  3P2B A;  1SE9 A;  2K8B A;  2LI5 A;  3VTW A;  1P3Q U;  1UBQ A;  2DEN B;  2FNJ B;  2ZCC A;  5BO4 B;  3S2A A;  1V2Y A;  2PPH A;  3ONS A;  2KD0 A;  2K8C A;  2O6V D;  2GBR A;  3A9J A;  2ZVO A;  1Q5W B;  3A9J B;  3NOB A;  3NY5 A;  5D7G A;  3I3T B;  2KX0 A;  5IAA C;  3H7S A;  3QAQ A;  1UH6 A;  3A1Q A;  3CSF A;  1H8C A;  3ZRC A;  5AZH A;  4W9G A;  2D2Q A;  5KHQ A;  2KJH B;  3PGE A;  3MHS D;  1UGM A;  3RT3 B;  2LXC A;  1K8R B;  4DHZ E;  3VTU A;  2AL3 A;  4MDK E;  2C7N B;  3UF8 A;  4A3O A;  1WRD B;  2WYQ A;  4MEM A;  1ZGU B;  4GDK A;  3L13 A;  4FUL A;  4IM2 A;  3UIN B;  2KJ6 A;  5J2R A;  2DZM A;  4OVU A;  3O65 B;  3AXC A;  1E8Z A;  2XBB C;  3BY4 B;  4I6P A;  2KFK B;  1YQB A;  2A5U A;  3OJ3 A;  5G2N A;  4FJV B;  2J0K A;  1C1Y B;  3QHT A;  5IA7 A;  2C9W B;  2DZK A;  2LGX A;  4MJS A;  2FID A;  3Q3F A;  2FCM A;  1V49 A;  4BBN F;  1J19 A;  2LXA A;  2MRP A;  4FLH A;  2BGF A;  3ZLZ A;  5DPW A;  3UGB B;  1YIW A;  2LVQ A;  3RD2 A;  3N3K B;  2IY1 B;  4DDG D;  1L2N A;  4FN2 A;  4KDI C;  2KNB A;  3DVN V;  4EOY A;  1P9D U;  1JRU A;  2MA9 B;  4HDQ A;  1RRB A;  5FR6 A;  3ZDT A;  4KIK B;  1E8W A;  1WGH A;  2L05 A;  3N32 A;  3KUD B;  3H9D A;  1FXT B;  3QWZ B;  2MBE A;  4KSL C;  5CTR C;  2MCN B;  1WE6 A;  4JIO U;  2K25 A;  2KWC A;  5CHV C;  3JSV B;  3RUI B;  3RZW C;  3VFK A;  3PS6 A;  4DWF A;  4F1S A;  1Y8R C;  4GGQ A;  2ASQ A;  2LGY A;  4HPM B;  2IBI B;  2CKH B;  3BIN A;  2KDF B;  3AU5 A;  2JRI B;  4FAD A;  4ICV A;  2GBM A;  1V5O A;  3ECI A;  1V81 A;  2HD5 B;  2MSE D;  3A1Q B;  4MSM B;  1WMH A;  3ZKJ C;  5JZE B;  2L76 A;  3W1Y A;  2O6V B;  3DDC B;  2JVC A;  3GOE A;  3PRM B;  3RCZ A;  4B95 A;  5C1Z A;  4AJY B;  3DVG Y;  3KUC B;  4TUU A;  4EZL A;  1QZE A;  1WX7 A;  3IHP C;  4RM8 A;  4BKS A;  5LXI B;  2DAJ A;  3U8Z A;  2L3Z A;  4TV3 A;  1E7U A;  4WWO A;  1WGG A;  3EEC A;  2KC2 A;  3U30 A;  4IG7 B;  3AU4 A;  2JRH A;  4I6L B;  2Z0E B;  4BBN C;  2JT4 B;  1KJT A;  4ZRK A;  2CR5 A;  2V4L A;  3DVN U;  3ENE A;  2DHZ A;  4M8M A;  4IWP A;  3WAP A;  3SHQ A;  3HHM A;  3MJW A;  4DHZ B;  3NHE B;  2JZ3 B;  1XD3 B;  1MG8 A;  1KOT A;  1SIF A;  2M0X A;  3HK0 A;  1WM3 A;  2DX5 B;  2GOW A;  2DYO A;  3APC A;  1A5R A;  1OEY J;  2LAS A;  4DXA B;  1WXV A;  2LUE A;  4IM0 A;  4MGY E;  3TBL D;  1I42 A;  4JQW C;  2HTH A;  5GMV A;  2KX3 A;  4BKS D;  4HCP B;  1OEY A;  2PE9 A;  2AL6 A;  3OLM D;  2IO0 B;  3DBR I;  1WJ4 A;  3GZN I;  4W9J A;  4EZK A;  2GBJ A;  4NQK E;  3KYD D;  2NVU I;  2MBQ A;  4KSK C;  4MH0 E;  2YVC A;  3SDL C;  2LZ6 A;  1WGD A;  3EHV A;  1WGR A;  4DHJ D;  2JF5 A;  1WXA A;  4LJO B;  2EKE C;  3TIX A;  3CMM B;  3QJZ A;  4WQO B;  3ZUN A;  2LVO A;  4URK A;  5J18 A;  1TZ1 A;  1GJZ A;  2LRU A;  3DBH I;  1Z5S B;  3VUX A;  4GDK B;  2J7Q B;  2Y5B B;  1SGH A;  3KYC D;  2ZPY A;  2BPS A;  2BWF A;  2KTR B;  1XT9 B;  2CS4 A;  5LXH A;  2D07 B;  2YLM A;  3RZF A;  4A3P A;  2WWZ A;  4MJS B;  1UD7 A;  1WR6 E;  2KZR A;  3A9K B;  1GUA B;  4P7I A;  4NNJ B;  1UBI A;  2BYE A;  2C7H A;  2EMS A;  2N4F A;  3EC8 A;  1WZ0 A;  4CYE A;  3QQ8 B;  4FA6 A;  1S1Q B;  1WYW B;  2LWP A;  1E7V A;  3B08 A;  5AZF A;  3V6C B;  1GNU A;  3B1L X;  4G3X B;  3M63 B;  2PJH A;  5TR5 A;  1EO6 A;  3PRZ A;  2REX A;  3TL5 A;  4ANW A;  2FCQ A;  2NPT B;  3VH4 B;  3LJ3 A;  1WX8 A;  2OJR A;  4GOC A;  4IUM B;  4M0W B;  3W1S A;  3ZIM A;  4E74 A;  1E8X A;  1X1M A;  4IM3 A;  2MQJ A;  1WFY A;  4LDT D;  1U4A A;  4KIK A;  1EF5 A;  2MX2 A;  2KTF A;  4W9L A;  1OQY A;  3LDZ E;  1WJN A;  3ML9 A;  4II2 B;  2KDE B;  3PHW B;  2KDI A;  1KLV A;  4W9E A;  2KQ7 A;  1IPG A;  1V5T A;  2Z59 B;  2XK5 B;  3L16 A;  2NBW B;  4TQ0 A;  5CX3 A;  4AOF A;  5E6O A;  4XC2 A;  4IW0 A;  4OVV A;  2L7R A;  1V86 A;  3AUL A;  3HIZ A;  4WJQ A;  3V62 A;  4HPL B;  2ZEQ A;  2FCS A;  2M4N A;  2M17 A;  4BKG A;  3M62 B;  5DPS A;  3HM3 A;  2MBO A;  4K7W A;  1J8C A;  2MLB A;  4G0N B;  4LDT B;  3RYT A;  3ZNH B;  2CU1 A;  2DZJ A;  2JY6 A;  4MM3 A;  3L54 A;  4K7U A;  1V6E A;  2G4S A;  4F8C B;  2W9N A;  1WY8 A;  4FHK A;  2NBV B;  5JH5 C;  3PTF C;  3L17 A;  4G11 A;  4NY0 A;  2LJ5 A;  3DBL I;  4MGI E;  1Z2M A;  2KO3 A;  5G55 A;  5DPR A;  3SD5 A;  4FJY A;  2I1J A;  3A4S C;  3VUW A;  2D10 A;  4NJ6 A;  3A4R A;  2IO3 B;  1VD2 A;  3PLV A;  4HWI B;  4EZJ A;  3WAM A;  4ANV A;  4MGK E;  3QC8 B;  2I1K A;  1E8Y A;  4GIV A;  4DDI D;  4TKN A;  2EMT A;  2KLC A;  4IWQ A;  4WAA A;  2KKC A;  4NJ7 A;  4FBJ B;  2L00 B;  2BWE S;  5D6J B;  5JHA A;  1YJ1 A;  3DOW A;  1GC7 A;  4JLC A;  4W9H A;  5CHW A;  2KFK A;  2K39 A;  1V9J A;  3APD A;  1D3Z A;  3ZDM C;  4HDO A;  1P0R A;  3UIP B;  2M8S A;  2RGF A;  2IYD B;  2RSU A;  4RM9 A;  3TCA A;  3NZS A;  2IO1 B;  2VRR B;  4GN1 A;  1YX5 B;  3QX1 A;  4KZ0 A;  2V1Y A;  3V61 A;  4HJK A;  2ZVN A;  4ICU A;  2RD0 A;  1CMX B;  3X23 A;  4M8N A;  2ZNV C;  1PQS A;  3H7P B;  2JPH A;  1KM7 A;  4GU2 A;  3CST A;  4J6I A;  4N9F 4;  3DPD A;  3JYU A;  1TGZ B;  4GDL A;  1WJU A;  4K81 A;  4X57 B;  3VTV A;  4KVG B;  1R4M I;  5LLI A;  2O2V A;  3U7D A;  4BOZ B;  2L0T A;  2O2V B;  4AWJ A;  3VVW B;  2NS5 A;  2N9E B;  4MEL A;  1WR1 A;  2L0F A;  4ZYN A;  3VXW A;  3JW0 X;  2RR9 A;  1V80 A;  1BT0 A;  2K6D B;  2N7E A;  2CHZ A;  5D2M B;  2DYM A;  3PLU A;  4AP4 C;  3L08 A;  1I35 A;  2CHW A;  4KZC A;  3WAN A;  2V3S A;  4EFO A;  2N1W A;  3KH0 A;  3ZO5 B;  3H7P A;  2B3A A;  3KVF B;  3PPA A;  3ZVV A;  2KJR A;  4NQL B;  2M1M A;  2KWV B;  3QAR A;  2ZJD A;  5D94 A;  5E6N A;  2K8H A;  3X0W A;  4K1R B;  1E5W A;  4IWO A;  2KK8 A;  3AI5 A;  2ZPN A;  2LGD A;  2GBK A;  2QHO A;  2DYB A;  3A33 B;  1WE7 A;  4ANU A;  2HJ8 A;  1WGY A;  4RMA A;  2KDB A;  4WJN A;  2WX1 A;  3L10 B;  3C0R B;  3SU8 X;  3D32 A;  4TQ1 A;  3PRE A;  4WJP A;  1NI2 A;  1RFA A;  3K9O B;  3PZD A;  1G6J A;  5DPT A;  1EF1 A;  1P98 A;  2IO2 B;  2N7D A;  3IFW B;  1TBE A;  1LM8 B;  3NZU A;  3IG3 A;  2NBU A;  4ZRI A;  4GDL B;  4W9I A;  4ANX A;  3JVZ X;  2MW5 A;  2D11 A;  4DK5 A;  1RLF A;  4WWN A;  4ASW C;  2J0M A;  4AUQ C;  3QA8 A;  2IY0 B;  1TTN A;  2BYF A;  2FIF A;  2KQS A;  3DBS A;  4PS8 A;  3RUL A;  1LQB A;  3VHT C;  3ZNI D;  4ZDV A;  4FHJ A;  4I6N B;  2KFJ A;  2JZZ A;  2BYV E;  4WJO A;  1AAR A;  2KWU B;  3TMP B;  3VDZ A;  3ZNZ B;  3DCG A;  3M3J A;  2L8J A;  2K6Q A;  3ZW3 A;  4W9K A;  3KUZ A;  2KC1 A;  1VCB A;  2OOB B;  2CHX A;  2JXX A;  1EUV B;  4MSQ B;  1F9J A;  4B9K A;  4MGZ E;  3DQV A;  1WM2 A;  2PEA A;  2G45 B;  1R4N I;  1RAX A;  2FAZ A;  2LRW A;  2K1F A;  4W9C A;  5L83 A;  2MP2 B;  2N9P C;  3L0W B;  1ZW7 A;  4IC7 B;  3M95 A;  4BKT A;  4W9D A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...