1WGDA

Solution structure of the ubl-domain of herp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GSSGSSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ubl-domain of Herp
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Homocysteine-responsive endoplasmic reticulum-resident ubiqu
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgdA00
2MBBB 2IBIB 2N9XA 2PE9A 2AYOB 2L3ZA 1UH6A 3M3JA 5C1ZA 4WQOB 4ZRKA 1V9JA 4EZJA 2NVUI 3APFA 1WJUA 4I6NB 5G55A 2LI5A 2L0TA 5L83A 4KIKA 2MWSB 5DPSA 2EKEC 3SU8X 2G4SA 2ZPNA 3L54A 4G3XB 3HM3A 2HE7A 3EFUA 2EMTA 3UQAA 4ANXA 3KH0A 3VTWA 3BINA 3EHVA 5DPTA 4DHZB 3T9LA 3GOEA 1I42A 1Q1OA 2UYZB 1LFDA 3ZNHB 2LGXA 1E8WA 5IA7A 4JL9A 4XZ4A 5AZHA 4W9CA 4JGHB 3VUWA 4DWFA 4EUTA 2J0KA 3DOWA 2DX5B 2PE6B 5D94A 2DAFA 1ISNA 3AULA 4GDKA 2ZVOA 3DBRI 1TTNA 1VCBA 2BYVE 3OJ3A 4WAAA 2W9NA 1EF5A 3M95A 3ZTDA 1WIAA 3ONSA 3TJPA 3VTUA 4HPLB 4AJYB 4I6LB 2KD0A 3DVNV 2IZVB 2KJHB 2V3SA 3PV1A 2M1MA 3WAMA 1KOTA 2ZNVB 2K6DB 3TIXA 4TQ1A 2R2QA 3A9JB 1OQYA 2CKHB 4WJOA 1ZKHA 3QK0A 1UBIA 3PGEA 3NS8A 2KMAA 4AJWA 3H6NA 2GBKA 2Z59B 4IWQA 2REXA 3KYDD 5GMVA 4X57B 1XD3B 2KQ7A 2BYFA 2Z0EB 4TQ0A 2KNBA 2KX0A 2JF5A 2LVPA 4KDIC 1YQBA 1TBEA 1WGDA 2J0MA 2ZCBA 3VHTC 1V5TA 4DK5A 2G4DB 4NAWA 3TL5A 3X0WA 2KK8A 2DZJA 1YJ1A 3A9KA 2JRHA 4F1SA 1XQQA 3VXWA 2IO1B 3DBLI 3PREA 4NAWB 2MBEA 2KC1A 4G50A 2IO0B 2WX0A 1P0RA 1ZGUB 1GNUA 1H4RA 3VQIA 2LRWA 2DZIA 4JQWC 4HDOA 2A4ZA 1QZEA 2N9EB 2RR9A 2FCNA 4NNJB 1E5WA 2LASA 1L7YA 4TUUA 5DPRA 3UF8A 2KDIA 5BO4B 4RM9A 3SHQA 1YD8U 1PQSA 1WGGA 3SDLC 2GBMA 1FXTB 4TV3A 2AL3A 2D07B 2LXAA 2JWZA 4KZCA 4KVGB 1EF1A 3DVGY 1WRDB 4RM8A 3NZUA 3V6CB 2N7DA 4IM0A 2HJ8A 3DCGA 4CO7A 1NI2A 2VRRB 1LXDA 3ZNID 2JUOA 3ZNZB 4PS8A 3NZSA 2ZEQA 4FULA 3RCZA 3BY4B 1NDDA 3QHTA 3WAOA 2KTRA 2AWTA 5CHVC 2AL6A 1JRUA 3DBHI 4LCDE 1M94A 1GJZA 4MSMB 3A9JA 3PRPB 1A5RA 3UIOB 4GSWA 2O2VB 2ZPYA 2NBVB 2C7NB 3VUYA 3H7PA 1V6EA 1LQBA 2ZJDA 1V81A 2MRPA 2KC2A 1I35A 2FIDA 2O6VB 5LXIB 2KVRA 4E3CA 2K39A 2MBQA 3IFWB 4HWIB 2FCSA 2Y5BB 2YLMA 4IWOA 3TMPB 3L10B 1UGMA 1WX8A 2A5UA 4IWPA 1H8CA 1TZ1A 4MGKE 1EO6A 4ZRIA 2C9WB 5E6PA 4KDLB 4FJZA 2O6VD 2RD0A 3JSVB 3ML8A 2UWQA 5JZEB 2CHWA 2ZNVC 4BOSC 4DHJD 1E8ZA 2K25A 2N9PC 2L00B 1WX7A 1RRBA 3ZRFA 2KDEB 2LVOA 2M4NA 3VVWB 3W1SA 2KO3A 5CTRC 4II2B 4AP4C 4GB9A 2GBJA 3AI5A 4HCNB 2XK5A 4I6PA 3GZNI 1J8CA 2FNJB 3ZTCA 4IC7B 5EDSA 3PHXB 3N3KB 4JIOU 1X1MA 2J7QB 2WYQA 4NQKE 4TKNA 3B08A 3QCAA 2N4FA 3KVFB 4PS3A 2KFKA 4OVVA 4BBNC 3PRMB 3R66C 4AUQC 4MEMA 4IUMB 4URKA 3A4RA 3PHWB 2LWPA 2LVQA 3EC8A 3U30A 3UINB 5L95C 1RLFA 2IY1B 4FHJA 2FUHB 3VTVA 5D6JB 2KX3A 3O65B 3A4SC 2FCQA 4EFOA 2GOWA 3B1LX 4F7ZA 4GDLA 2L0FA 2O6VA 2WDTB 2J0JA 3AU4A 3U8ZA 3L0WB 4NY0A 3NY5A 1OTRB 2M17A 3QQ8B 2I1JA 4DBGA 3RULA 3HM6X 2YVCA 3QX1A 1WE6A 2LD9A 3A9KB 2IO3B 4GOCA 2MQJA 4IM2A 5AZGA 3RD2A 5TR5A 2MW5A 1R4MI 4HPMB 1WF9A 1UZXB 2XBBC 1IP9A 4A20A 1WR6E 2CU1A 3OLMD 3QA8A 3KUZA 4B6WA 2GMIC 1RAXA 5E6NA 1E90A 1WXAA 4XC2A 4EZKA 4WJNA 2IY0B 3PTFC 1WXVA 1G6JA 2NPTB 4LJPB 4W9JA 3U7DA 4FADA 5LLIA 2N7EA 2AEHA 3KUCB 2LGDA 4MH0E 4OVUA 4E71A 1OEYJ 2L76A 4NQLB 3PS6A 2ZZPB 1YX6B 2GBNA 4WJQA 1UBQA 4HK2A 5KHQA 4K7SA 5AZFA 3A1QA 3VUXA 4NPNA 4DHZE 1V2YA 2LRUA 1WMHB 2CHXA 3RZWC 1P9DU 3IG3A 2JPHA 4MJSB 4ANWA 2KMCA 1L2NA 1WXSA 3OAWA 3NOBA 2MP2B 5CHWA 2NS5A 1V49A 3VDZA 3H9DA 2KLGA 5AEKB 5JHAA 3R7QA 3ECIA 2KTRB 3HHMA 3CMMB 5CHFA 4HDQA 4MDKE 4DHJB 1IPGA 2KZRA 2MLBA 4FJYA 3SD5A 5IAAC 2R2OA 3LJ3A 3ZDMC 1P98A 5G2NA 3L16A 3NHEB 1Z2MA 4K7WA 2XEWA 2ASQA 1SE9A 4N9F4 4M8MA 1GC6A 1D3ZA 1E7UA 4F8CB 4GMVA 4K7UA 4ANVA 3RT3B 3QIJA 4DDGD 2NBWB 4B9KA 3R7RA 4A3PA 2LJ5A 1V5OA 2KWUB 3K9OB 3M62B 1WM3A 3MHSD 4BKSA 1E7VA 4W9IA 4CYEA 3APCA 4G11A 1WXMA 2D2QA 1S3SG 3CSTA 2KXJA 5D7GA 4GN1A 3DPDA 3ZRCA 3DVNU 4AOFA 4M0WB 5D2MB 3A33B 1UD7A 4LDTD 3QJZA 2PEAA 4ZRJA 4XX5A 2IO2B 2K8BA 1P1AA 2RGFA 3ZKJC 3CSFA 3VAWA 3WALA 1AARA 4A3OA 2G45B 3HK0A 3Q3JA 3QARA 3IVFA 2CHZA 1WYWB 2K1FA 4RMAA 2MP2A 3OJ4B 2JRIB 4EKUA 2DAJA 1E8XA 1SIFA 2KQSA 1YIWA 4PS7A 3ZUNA 2WX1A 2JT4B 2V4LA 3L08A 2MBOA 2KJ6A 2BGFA 1SGHA 2L05A 2K6QA 3ZVVA 4MGZE 1UELA 2G3QB 2DHZA 2KOXA 3UIPB 4ASWC 4B95A 4KIKB 2O2VA 2BF8B 4ZDVA 1WGRA 2DYBA 1T0YA 2KWCA 2KLCA 2CR5A 3AU5A 3L17A 2OJRA 4G0NB 2JXXA 3QC8B 3X23A 4BKSD 1C3TA 2I1KA 2HD5B 1KLVA 2BKRB 4LJOB 4HLEA 2KANA 3APDA 3ENEA 4ICUA 3PSEB 3WA0A 4EOYA 4K81A 2BYEA 1WFYA 4ANUA 3IBEA 3KYCD 4DXAB 2KN5A 2DYOA 4GGQA 4JLCA 1V80A 2BKFA 1WJNA 3MJWA 2DENB 2NCNA 2RSUA 2V1YA 3RZFA 1Q0WB 2QHOA 2MA9B 2OOBB 2NR2A 2D10A 2KFKB 3PZDA 2ZVNA 1S1QB 4MM3A 3L13A 4IM3A 1LM8B 1GG3A 2HTHA 1IYFA 3K9PB 3ALBA 3A1QB 4HXDA 2LZ6A 1WMHA 2KWVB 2IYDB 2DZMA 3H1UA 4PYZA 4BKGA 3V60A 4HVBA 3KUDB 4WWPA 1WZ0A 4P7IA 3MTNB 4CHKA 1Y8RC 1E8YA 3QWZB 4M8NA 2JZZA 1VD2A 3QAQA 4K1RB 2ZCCA 3PLUA 3DBSA 4FHKA 5CX3A 4BFRA 2NBUA 4ZYNA 1GC7A 1KM7A 3WANA 1WM2A 3Q3FA 3M63B 4GDLB 3VH3B 4AWJA 2LUEA 1OEYA 2PJHA 3CF6E 1HE8A 2MSED 3VFKA 1WJ6A 3W1YA 2FAZA 1Q5WB 2GBRA 2M8SA 1F9JA 1TGZB 3ML9A 5DCNA 5JH5C 4FN2A 4EEWA 2N1VA 3V6EB 3JW0X 3D32A 2KDFB 3WAPA 3V61A 3DQVA 1WH3A 3PVLA 3UGBB 1J19A 4W9GA 4BKTA 3LDZE 4KZ0A 4FBJB 3PRZA 4MGIE 2C7HA 4W9EA 4YL8A 1R4NI 1ZW7A 1YX5B 1WI0A 1WR1A 3RUIB 3ZO5B 4GIVA 2L7RA 2JVCA 2CS4A 1RFAA 4BBNF 1WJ4A 2L8JA 3P2BA 5J18A 4II3B 4KSKC 3T8MA 3ZW3A 4W9LA 3DVGX 1V86A 3EECA 1WY8A 4W9HA 3UQBA 2RPQA 4BOZB 4BVUC 2DYMA 4W9FA 3IHPC 4HJKA 2JY6A 3KW5B 4MJSA 2PPHA 3C0RB 3JYUA 3TBLD 3AXCA 5J17A 1Z5SB 2KTFA 2KKCA 1K8RB 4KSLC 4MSQB 1XT9B 1NBFC 4LDTB 1WX9A 3R3MA 5E6OA 3S2AA 4W9KA 3ZNGC 2B3AA 4IW0A 1KJTA 3H7PB 1CMXB 2N1WA 2MX2A 3V62A 3JVZX 4J6IA 3WIMA 1C1YB 1U4AA 4E74A 2KFJA 2Z0DB 4FLHA 4NJ7A 1WGYA 4WWNA 5KHOA 2BWES 4NJ6A 3PT2B 2WWZA 2BWFA 3DDCB 4EZLA 1P3QU 3JSVA 3H7SA 2LGYA 2MCNB 3RYTA 1GUAB 1WE7A 2LXCA 3PPAA 2MBHA 3N30A 3N32A 4GDKB 4DDID 1OGWA 2DZKA 4PYUA 5JHBA 2D11A 3HIZA 4GXBA 1WGHA 4FJVB 4KV2A 1WZ3A 4W9DA 2C5LC 2C60A 3TCAA 2C7MB 2EMSA 2M0XA 1J0GA 2K8CA 1BT0A 3B0AA 4MELA 2FIFA 3ZIMA 4IG7B 3ZLZA 4MGYE 5FR6A 3ZDTA 5LXHA 5DPWA 2NPTA 3PLVA 3W1SC 4WWOA 2BPSA 4FA6A 2D3GA 2XK5B 2KHWB 2KJRA 2FCMA 1MG8A 4ICVA 2KDBA 4GU2A 4HCPB 5C23A 4WJPA 3I3TB 2K8HA 1EUVB 5HKHA 3VH4B 5J2RA 2JZ3B
chains in the Genus database with same CATH superfamily
2MBBB 2IBIB 1SE4A 2AYOB 1EWCA 4WQOB 3R8BA 2NVUI 1WJUA 4I6NB 2L0TA 4HKZE 4S17A 3TEWA 3ZJTA 1I4HA 4G3XB 2ZPNA 3HM3A 2HE7A 3GP7A 3BYTB 3GS2A 3AM9A 3VTWA 3EHVA 1I42A 1HZ6A 1Q1OA 1LFDA 1T5XD 5IA7A 4JL9A 1ZXHA 4JGHB 5HHDG 4EUTA 3DOWA 2V4IB 2DAFA 2ON8A 3TEXA 3AULA 2BS4B 3IXSA 1EF5A 3M95A 3ONSA 4HEA1 3TJPA 4HPLB 1NVID 2IZVB 2KJHB 1FXIA 2V3SA 2M1MA 1KOTA 2K6DB 3TIXA 4C4VA 4LNNA 1UGJA 1I4XA 2R61A 3QK0A 3PGEA 3NS8A 2KMAA 3H6NA 4YWGG 5GMVA 3W2DA 2KQ7A 2BYFA 2Z0EB 4EE2A 4KDIC 2ZCBA 3Q69A 1V5TA 2INCC 2M0AA 2DZJA 2JRHA 3RMKC 3DBLI 1TS5A 3SR6A 1C9FA 1PDXA 3Q8CA 1JWMD 3E56A 3VQIA 1GAQB 2V9HA 4HDOA 3Q3NC 2N9EB 3UF8A 4NNJB 2LASA 4YT0B 5DPRA 4PK1A 2AL3A 2D07B 4KZCA 2DLBA 1EF1A 1YN4A 3V6CB 2N7DA 4IM0A 3ZNID 3HUIA 4PS8A 3NZSA 2K0PA 4A9AA 5BYQA 3BY4B 3QHTA 2KTRA 2AWTA 2LFIA 1JRUA 4LCDE 4JWUC 2WGSA 3KWVA 2QMTA 2O2VB 3VUYA 2MRPA 1I35A 2O6VB 3DBHB 2MBQA 3IFWB 2FCSA 1I4RA 4NZLB 3VRBB 1UGMA 1WX8A 1JMLA 3Q3OC 5GXGB 2C9WB 3AB5A 2JYTA 2NMQA 4A90A 2UWQA 1P7EA 4LNOA 2DBYA 4YSYB 2JQRB 4LTUA 2K25A 1RRBA 2IGGA 2KO3A 1V97A 4GB9A 3BK1A 3AI5A 4HCNB 2XK5A 2L52A 3PHXB 4TKNA 1X1MA 2J7QB 4RGNA 1JWBD 4ZYSA 3KVFB 1KLUD 2KFKA 4OVVA 3VRAB 3A4RA 3U30A 2RMMA 3VTVA 5D6JB 3B1LX 1JALA 4GDLA 2L0FA 1R4MB 3AU4A 4NY0A 2J53A 4MACA 3EUB2 2YVCA 2IO3B 2MW5A 4HPMB 4M02A 3N1ZC 5BYSA 1RAXA 4XC2A 1YN3A 5IN7A 4W9JA 5LLIA 2AEHA 1JWAD 3KUCB 4MH0E 4WIPA 2L76A 2X8XX 3PS6A 3PZ8A 1YX6B 1VLBA 5IO9A 3MC0B 4IOIE 4DHZE 5BMGA 3ZYYX 1P9DU 3GB1A 1ZP0B 4ANWA 1WXSA 1FFUA 5FK9C 2QDFA 3HVDA 1WGKA 3R7QA 3HHMA 3CMMB 3BYYB 1V8CA 4OW0A 4FJYA 5IAAC 2R2OA 2WDQB 4C56C 1E6EB 4RCOA 4RGTA 3AE2B 2PW9A 2XEWA 1GC6A 3T3OA 3RNBC 1NEKB 1E7UA 3NJTA 4ANVA 3RT3B 1MJDA 2NBWB 4B9KA 2ACZB 4A3PA 1HTOA 4BKSA 4W9IA 3CSTA 1TS4A 3DVNU 5FKAC 5D2MB 2LHDA 4LDTD 4ZRJA 2W3RA 1P1AA 4M00A 3WALA 3N1XC 1FXAA 2G45B 1OQQA 4S0RA 2GLSA 3QARA 3RNEC 2ZW1A 2JRIB 1YIWA 4PS7A 2JT4B 3L08A 1ACCA 1UWXA 3ZVVA 4KIKB 3W5VB 2BF8B 4ZDVA 2DYBA 1T0YA 1F0ZA 3AE5B 2KLCA 3AU5A 4L2YA 4OZBA 3ENEA 3AEDB 2BTEA 3E9SA 3IBEA 3KYCD 1FCLA 3MJWA 1ZDXA 2D3CA 2OOBB 3RI7C 3PZDA 4IM3A 3ALBA 2CJNA 3RNFC 4HXDA 2IYDB 2WXNA 3H1UA 3MTNB 1P7FA 1Y8RC 1TY0A 3PLUA 5CX3A 4FHKA 1RFKA 3WANA 3VH3B 4GDLB 1OEYA 2PJHA 1HE8A 3VFKA 1TYGB 1WJ6A 2KMMA 1I7HA 2GBRA 2L1AA 4FN2A 1GB4A 2N1VA 3V6EB 4W9GA 1F52A 1RWSA 3PRZA 1D5MC 2J42A 4W9EA 3NS1A 1HZ5A 1BUIC 5LNK1 3HVZA 1WI0A 3EFCA 4C00A 1HXYD 1WJ4A 3P2BA 1TS2A 1VZ8A 3ZW3A 1VRAB 1T0SC 3GE3C 1R4NB 3DVGX 1I4QA 3TEZA 3AEEB 4BOZB 4C4VB 3C0RB 3TBLD 2QIEB 1Z5SB 2KTFA 1EU3A 1F2RI 2KKCA 2WXIA 4MSQB 1DGJA 1XF5L 3S2AA 4W9KA 4WQMA 3JVZX 4J6IA 5KHOA 2ICIA 4XGAB 4NJ6A 2WWZA 4EZLA 2LGYA 2TSSA 4UDUC 3RYTA 5IKCM 2LXCA 2MBHA 3MHZA 1CQVA 4GDKB 4DDID 2DZKA 3B9JA 3HIZA 4GXBA 2WXLA 1WGHA 1WZ3A 2HDEA 2VZKD 2C7MB 1PFDA 4ACFA 5AUIA 1YQ3B 3AV8A 5DPWA 4MGYE 5LXHA 1IBXB 3HRDD 2G9HD 4WWOA 2BPSA 2VZKB 4FA6A 2KHWB 1MG8A 3NZ3A 1EUVB 5J2RA 2N9XA 3U4EG 2L3ZA 1UH6A 5C1ZA 4ZRKA 1V9JA 1SB3C 3APFA 2LI5A 1FNVA 4KGRA 2EMTA 2I2YA 3W9CB 5DPTA 5C3JB 3GOEA 1VZ7A 2LGXA 2BB5A 4RF1A 2QILA 2J0KA 1KH0A 5D94A 1ISNA 4GDKA 3MFGA 1C79A 1WIAA 2YEPF 2Y3AA 1PGAA 1T3QA 2R2QA 1WYGA 1VDVA 1OQYA 1UBIA 2GBKA 2DNFA 2REXA 3KYDD 4TQ0A 2AQ2B 5AUKA 3P4QB 1YQBA 2D5GA 2J0MA 2G4DB 4NAWA 1CZPA 1GPXA 1LGRA 1YJ1A 3A9KA 3FAHA 2BYTA 2PLPA 4F1SA 2PTLA 2IO1B 2EELA 3P4SB 2MBEA 2VH1A 4H2AA 2KC1A 2IO0B 2WXJA 2Y5CA 1GNUA 3SEBA 2A4ZA 3RN9C 4TUUA 2FCNA 1GOZA 1SF0A 5BO4B 1PQSA 3SDLC 1WSPA 2GBMA 1FXTB 2JWZA 3DVGY 4RM8A 1WRDB 3WCQA 1XLPA 1QOGA 2OJWA 2ZEQA 3URYA 2OHFA 2AL6A 1GJZA 1FO4A 1A5RA 4GSWA 2AQ1B 2NBVB 3SFEB 3H7PA 1V6EA 3Q8AA 2V0GA 1V81A 1YJIA 1STEA 4E3CA 3PZ7A 3TMPB 4XDCA 3OG5A 4IWPA 1EO6A 5E6PA 4KDLB 2RPVA 2W3SA 2RD0A 3ML8A 4BOSC 3ZXRA 4DHJD 1V1PB 2L00B 1WX7A 1HEZE 4M0WA 3VVWB 4NAMA 4II2B 4I6PA 3GZNI 3IT4B 4JWSC 4NJCA 4IC7B 2MEKA 1I4GA 4NQKE 2WYQA 4US9A 3QCAA 4PS3A 1MPEA 2D3AA 4N6EB 3PRMB 1E9MA 1WXQA 1ZOYB 2LWPA 2LVQA 3AE9B 1ET9A 2PVGC 3O65B 4JPSA 1AYFA 2EKIA 2LGSA 2O6VA 3W5UB 1QOFA 1JCKB 2J0JA 4P1CC 1OTRB 2M17A 3QQ8B 2I1JA 3QX1A 2MQJA 1R4MI 3AE3B 2XBBC 1IP9A 1WR6E 3QA8A 1J7AA 2IGHA 1WXAA 2KVZA 3OWEB 5BYRA 4C7ZA 3U7DA 4FADA 3NVYA 2BS3B 1D5XC 2ZZPB 2WXFA 4AQ7A 4DXGA 4LNIA 3VUXA 2LRUA 2N7JA 1IBXA 3FKYA 3IG3A 2JPHA 2WLBA 2WDVB 3OAWA 5CHWA 3NOBA 2MP2B 2DWQA 2KLGA 3ECIA 2KTRB 2SAKA 1IPGA 2LUMA 1K50A 2MLBA 4XWTA 1F77A 3ZDMC 2PMVA 3L16A 5G2NA 1Z2MA 2E6XA 1VR9A 4N9F4 2UU7A 3KWLA 4M8MA 1D3ZA 1ROEA 1L5PA 3Q2AC 3QIJA 1I4PA 1UUPA 2LJ5A 1V5OA 2LMCA 3M62B 4Q2JA 1WXMA 4RFBA 1VZ6A 5D7GA 1SEBD 3DPDA 3GZNB 4GN1A 3IAM1 3ZRCA 3AEFB 4AOFA 5FR3A 1DOYA 1FM0D 2PEAA 4J3OD 1NYQA 3QJZA 2IO2B 2K8BA 2LGIA 4US8A 3VAWA 3Q3JA 3IVFA 3GE8C 2K1FA 4RMAA 2J52A 1SIFA 3ZQ4A 2KQSA 1N60A 1YOVB 3ZUNA 2WX1A 2V4LA 3SFDB 1V1OA 3NVWA 1SGHA 2N0SB 4MGZE 1UELA 4ASWC 2DHZA 3UIPB 2KWCA 4G0NB 3Q8FA 1PYWD 3QC8B 3X23A 2I1KA 2HD5B 1KLVA 4L23A 3PSEB 4EOYA 2W55A 4PT5A 2BYEA 4RGOS 3CIRB 3MJ5A 3AN1A 2BKFA 3N1YC 1ZXIA 2L83A 1L4ZB 4K3CA 3L13A 5TSSA 1FD6A 2HTHA 1WMHA 2W54A 2DZMA 2IGDA 4LK0M 4PYZA 3V60A 4CHKA 1E8YA 3QWZB 4M8NA 4K3BA 3QAQA 1OFFA 2ZCCA 4K1RB 3DBSA 4BFRA 2N9LA 2NBUA 4ZRQA 1KM7A 2MJEA 1XCQL 3KLSX 1C4AA 2LHEA 3Q3FA 1QKZA 2MSED 4O1NA 2FAZA 2I38A 5DCNA 3ML9A 4WURA 3LXFA 2KDFB 2MJDA 1D5ZC 1WH3A 1J19A 4KZ0A 3AEGB 2C7HA 4MT5A 4IKGA 1WR1A 4TMAB 2M56B 3RUIB 2L7RA 2JVCA 2CS4A 4BBNF 4II3B 2CJOA 4KSKC 5G5HA 4RNAA 5C2TB 5HFYA 4W9HA 1IGDA 4BVUC 4HJKA 3H8HA 5J17A 3MC9A 2K3UA 1XT9B 5E6OA 3ZNGC 1GB1A 4IW0A 1KJTA 3V62A 1E7PB 1TS3A 4FLHA 4NJ7A 1WGYA 3R2TA 2KYWA 3PT2B 2BWFA 1YQ4B 3JSVA 2SEBD 2MCNB 3N30A 2D11A 4WH4A 4XE0A 2FE8A 2KWDA 5EE3A 2C60A 4HRSA 1BT0A 3B0AA 4GLSC 2FIFA 3ZIMA 4IG7B 3ZDTA 1QT9A 1TJEA 2D3GA 2XK5B 2IJ0A 4GU2A 4HCPB 1FIQA 5C23A 4WJPA 1MG4A 3VR9B 4RF0A 4LNFA 2JZ3B 2PE9A 1MHXA 2ONQA 5L83A 4KIKA 1E0ZA 2MWSB 3DHGC 5DPSA 2EKEC 3SU8X 3L54A 4N58A 2WHIA 3ZXVA 5EE1A 3EFUA 3UQAA 1L0XB 2BB6A 3L4PA 3BINA 1D6EC 1FNUA 2UYZB 1CJEA 1N5XA 3FILA 4KKJA 3Q14C 1CK1A 5AZHA 4DXFA 3VUWA 3BWUD 2DX5B 2H89B 2ZVOA 3DBRI 2NTTA 1EM7A 4WAAA 3OJ3A 2GI9A 2W9NA 2JYEA 2KD0A 2ZNVB 3RPFC 1MFWA 3A9JB 4WJOA 1XEEA 1ZKHA 4JX1C 4AJWA 2Z59B 4IWQA 1PUTA 4X57B 1XD3B 2BT6A 2KNBA 3P1MA 2KX0A 2JF5A 2LVPA 3KQ4A 4DK5A 2XNAC 4KKIA 2KK8A 1XQQA 4G50A 1SBBB 2WX0A 1TIFA 1P0RA 1ZGUB 4XWWA 4JQWC 1QZEA 2RR9A 1L7YA 2KDIA 3CWIA 1WGGA 4TV3A 1YMHE 4KVGB 1PGXA 3DCGA 4YTPB 1NI2A 2VRRB 4USAA 2WXHA 2QCZA 2KDMA 4FULA 1NDDA 3NG0A 1JWUD 2E3TA 3WAOA 3BIID 1M94A 5IP4D 3A9JA 3UIOB 1OQRA 3DHIC 2ZJDA 2KC2A 3Q8BA 2FIDA 2KVRA 2K39A 4IWOA 2Y5BB 3EA6A 1TZ1A 4MGKE 4ZRIA 3J9CA 2AX5A 3JSVB 5MPOA 3T3NA 2CHWA 2ZNVC 4WAFA 1JW9D 3AE7B 4N59A 3W1SA 4AP4C 1F1HA 3ZTCA 4ZHOA 5EDSA 1BXTA 1L0VB 3BVGA 1T0QC 3MC8A 3B08A 4IDIA 2N4FA 2INPE 4BBNC 2WU5B 4MEMA 4IUMB 1L6VA 1MVKA 3PHWB 3UINB 2IY1B 2FUHB 1AW7A 3TSSA 1K52A 2KX3A 2FCQA 4EFOA 4F7ZA 2WDTB 2WXRA 3NY5A 2V3PA 1WE6A 2LD9A 3A9KB 4GOCA 4IM2A 5TR5A 1WF9A 1UZXB 2QC8A 2CU1A 2WXPA 3KUZA 4ZHPA 2BBCA 1YN5A 5E6NA 1E90A 4LNKA 4EZKA 4WJNA 2IY0B 1WXVA 1G6JA 3ZGZA 2LGDA 4OVUA 4E71A 1OEYJ 2BS2B 2BW2A 5H92C 3P4RB 4WJQA 4HK2A 2QSDA 1SXTA 4NPNA 1V2YA 1TKGA 1WMHB 5HI1A 2CHXA 2G1EA 2H88B 4MJSB 5EE9A 2KMCA 1L2NA 1V49A 5BMHA 3VDZA 1JQ4A 5JHAA 2OEDA 4MDKE 4DHJB 3AECB 2KZRA 3SD5A 2WXGA 3C19A 2ASQA 4A6QA 3EGRA 1Y56A 4F8CB 1TT5B 1VJKA 1R7SA 3R7RA 1XLNA 2BQQA 1ENFA 1WM3A 3MHSD 4CYEA 3APCA 4G11A 2D2QA 3AH7A 4C80A 4L1BA 1FMAD 4M0WB 1XCTL 3A33B 1UD7A 4XX5A 2WP9B 2KQ4X 1M4VA 3CSFA 1T0RC 4HPPA 1WYWB 1FRRA 1ZDVA 2LEKA 2MBOA 3V3XA 2BGFA 2Q5WD 4B95A 2O2VA 2WXOA 1FRDA 1WGRA 1DYQA 3AE6B 1MHHE 3L17A 2OJRA 2JXXA 4YSXB 1BMLC 4BKSD 5EE0A 1C3TA 4HLEA 4ICUA 4K81A 3PO0A 2WS3B 1WFYA 4ANUA 4DXAB 2KN5A 2DYOA 4GGQA 4JLCA 1WJNA 1C77A 2DENB 2W82A 3NUHB 1Q0WB 5T8IA 2MA9B 4DQOC 2NR2A 2Z8LA 2KFKB 3O13A 1C4PA 1LM8B 1IYFA 1NENB 3A1QB 5IOIA 2LZ6A 1B9RA 2GB1A 4HVBA 3KUDB 4YXDB 4P7IA 1B1ZA 4A55A 4ZYNA 1GC7A 3R2IA 1E10A 4R3DA 3M63B 1QQRA 4AWJA 3CF6E 3DBLB 3W1YA 1KFYB 1Q5WB 1TGZB 5JH5C 4EEWA 4KGSA 2ZW0A 3DQVA 1FEHA 4P16A 2J4XA 1QLBB 4FBJB 4XDDA 1TKYA 3BK2A 1HA5A 3BVZA 1ZW7A 1YX5B 1N62A 4GIVA 1RFAA 1D4BA 1J7BA 3I57A 3T8MA 4ZRPA 4W9LA 1V86A 3LYYA 3EECA 2RPQA 2DYMA 3IHPC 2KT7A 3JYUA 3AE4B 2AQ3B 2WXMA 4QAYA 4KSLC 3R3MA 2Y5PA 4JE3B 2B3AA 2NTSA 2N1WA 2MX2A 3WIMA 1C1YB 2PVOD 2Z0DB 2BWES 1QILA 4P1BC 1SIJA 1P3QU 3AEAB 1GUAB 1C78A 2RDBC 3N32A 1OGWA 5JHBA 3NVZA 4KV2A 2EMSA 2JWUA 4C7YA 2M0XA 4MM3B 1J0GA 5FR6A 3PLVA 3Q8EA 3C8YA 4ICVA 2KDBA 4B0MA 2K8HA 5HKHA 4ZOHC 3VH4B 1ZUD2 1KF6B 1YJJA 1KTKA 3M3JA 4EZJA 5G55A 1FFVA 1XLQA 2G4SA 4RH6A 4RGMA 4ANXA 3KH0A 3BVMA 4DHZB 1L0YB 3T9LA 3ZNHB 1E8WA 4XZ4A 1V1PA 4OZAA 2HTME 4W9CA 1JRPA 3UI3A 2WQYB 4DWFA 2PE6B 1JWSD 1TTNA 1VCBA 1EWYC 2BYVE 3ZTDA 2JXTA 1YNTE 3VTUA 2JSVX 4I6LB 4AJYB 3Q6BA 3U52E 3DVNV 1N5WA 3PV1A 3WAMA 1Q10A 3I63C 1T6BX 2KN4A 1UF0A 4P6VF 1N63A 4TQ1A 2CKHB 2QEJC 3DWGC 1F2RC 5H8YE 5JXVA 3LB8C 3VHTC 1TBEA 1WGDA 2XN9C 1ESFA 3TL5A 1WWTA 3X0WA 4HKQA 2KACA 1TZOA 4YTNB 2RDHA 3VXWA 5BMIA 3PREA 4NAWB 1ZE3D 2INDC 1H4RA 2LRWA 2DZIA 1FCCC 1E5WA 4RM9A 3SHQA 1YD8U 4ARIA 1J7CA 2LXAA 1QOBA 1QOAA 1AN8A 2MJ3A 3NZUA 1HTQA 2HJ8A 3B2GA 2B76B 1EU4A 4CO7A 2IDYA 1LXDA 3RNAC 4FXCA 2JUOA 3ZNZB 3P42A 3RCZA 1RYJA 5CHVC 3BZDB 3DBHI 4MSMB 3PRPB 1RM6C 4KX6B 2ZPYA 4WWMA 2C7NB 1LQBA 2KAJA 5LXIB 4HWIB 2YLMA 3L10B 2A5UA 3AEBB 1H8CA 2V3NA 4M01A 4FJZA 2O6VD 2L32A 5JZEB 4LLGM 1E8ZA 3FILB 1SSNA 2N9PC 1DOXA 5D3IB 3ZRFA 2KDEB 2LVOA 2M4NA 5CTRC 2K22A 2GBJA 1J8CA 1WRIA 2FNJB 4TSSA 3I5JC 3N3KB 4JIOU 1A70A 1QF6A 2PKOA 3R66C 3U7ZA 4AUQC 4URKA 1TKEA 4KGTA 1KRHA 3TEYA 4HJGE 4CQNA 3DWMA 3EC8A 5L95C 3P4PB 1RLFA 2M19A 3I9V1 4FHJA 3A4SC 1PGBA 1K51A 2GOWA 2WXKA 2HJ1A 2MHJA 3U8ZA 2GRIA 3L0WB 5D3DA 4DBGA 1L6UA 3RULA 3HM6X 5AZGA 2PIAA 4MH8A 3RD2A 3ZJUA 4D2KA 3NVVA 2INNE 1MI0A 4A20A 3OLMD 4B6WA 2GMIC 4YSZB 2WU2B 1LO5D 3PTFC 2NPTB 4LJPB 2JX5A 2N7EA 2X38A 4NQLB 1ZPSA 2GBNA 1DOIA 2CU3A 1UBQA 5KHQA 4K7SA 2JZPA 5AZFA 3A1QA 1IGCA 3RZWC 2NS5A 2WXQA 3AMZA 3H9DA 5AEKB 1NI3A 5I4DA 4ARCA 5HG2A 5CHFA 4HDQA 3LJ3A 1P98A 3NHEB 4K7WA 1SE9A 3RNCC 4GMVA 2FUG1 3DBRB 4K7UA 4DDGD 2WNMA 2KWUB 3K9OB 1E7VA 3AE1B 1UWMA 1S3SG 1JROA 2KXJA 3RNGC 4BAXA 5E6JA 2RGFA 3ZKJC 1AARA 4A3OA 1TY2A 3HK0A 4BZAA 2CHZA 2QJLA 3N20C 2MP2A 3OJ4B 4EKUA 2DAJA 1E8XA 1XO3A 2KJ6A 2L05A 2K6QA 2G3QB 2KOXA 3AE8B 3FC4A 2CR5A 3Q3MC 2BKRB 4LJOB 2KANA 3APDA 3WA0A 1XXGA 1NYRA 2K9XA 1N6ZA 3VR8B 1V80A 1N61A 1SJED 2NCNA 2RSUA 2V1YA 3RZFA 2QHOA 4REZA 2D10A 1HQRD 2ZVNA 1S1QB 4MM3A 4ITKA 1SJHD 1GG3A 3K9PB 1AWDA 3NRZA 2KWVB 2IPKD 4BKGA 3U2SC 3ABVB 4WWPA 1WZ0A 1FPYA 2JU6X 2JZZA 1VD2A 1KLGD 3IAS1 1L4DB 1WM2A 1ET6A 2LUEA 1C4CA 2M8SA 1XLOA 1F9JA 3ETRA 3JW0X 3D32A 3WAPA 3V61A 4A8XC 2WDRB 3PVLA 4BKTA 3UGBB 2K5PA 3LDZE 4MGIE 1IUEA 3MP9A 4YL8A 2N9KA 1R4NI 3DHHC 3ZO5B 2D3BA 2BVCA 2L8JA 5J18A 3IT6B 4YTMB 4AS1A 4OHJA 1WY8A 3UQBA 4W9FA 2JY6A 3KW5B 4MJSA 2PPHA 3AXCA 3ZJVA 1K8RB 3TUOA 1NBFC 4LDTB 1WX9A 2MH7A 5G5GA 1SE3A 1K53A 3P63A 3H7PB 1CMXB 3RFZB 2FBWB 1U4AA 4E74A 2KFJA 4WWNA 3B2FA 3DDCB 1UNSA 3H7SA 1WE7A 1C76A 3PPAA 2LJIA 1SE2A 4PYUA 4FJVB 4OVZA 4B0EA 4W9DA 2C5LC 3TCAA 2YEPB 2K8CA 4OZCA 4MELA 3ZLZA 2RDGA 2NPTA 3W1SC 2VH2A 3N9YC 4HROA 2KJRA 2FCMA 4XYCA 3I3TB 3V05A 1FNWA
chains in the Genus database with same CATH topology
2MBBB 2IBIB 2N9XA 2PE9A 2AYOB 2L3ZA 1UH6A 3M3JA 5C1ZA 4WQOB 4ZRKA 1V9JA 4EZJA 2NVUI 3APFA 1WJUA 4I6NB 5G55A 2LI5A 2L0TA 5L83A 4KIKA 2MWSB 5DPSA 2EKEC 3SU8X 2G4SA 2ZPNA 3L54A 4G3XB 3HM3A 2HE7A 3EFUA 2EMTA 3UQAA 4ANXA 3KH0A 3VTWA 3BINA 3EHVA 5DPTA 4DHZB 3T9LA 3GOEA 1I42A 1Q1OA 2UYZB 1LFDA 3ZNHB 2LGXA 1E8WA 5IA7A 4JL9A 4XZ4A 5AZHA 4W9CA 4JGHB 3VUWA 4DWFA 4EUTA 2J0KA 3DOWA 2DX5B 2PE6B 5D94A 2DAFA 1ISNA 3AULA 4GDKA 2ZVOA 3DBRI 1TTNA 1VCBA 2BYVE 3OJ3A 4WAAA 2W9NA 1EF5A 3M95A 3ZTDA 1WIAA 3ONSA 3TJPA 3VTUA 4HPLB 4AJYB 4I6LB 2KD0A 3DVNV 2IZVB 2KJHB 2V3SA 3PV1A 2M1MA 3WAMA 1KOTA 2ZNVB 2K6DB 3TIXA 4TQ1A 2R2QA 3A9JB 1OQYA 2CKHB 4WJOA 1ZKHA 3QK0A 1UBIA 3PGEA 3NS8A 2KMAA 4AJWA 3H6NA 2GBKA 2Z59B 4IWQA 2REXA 3KYDD 5GMVA 4X57B 1XD3B 2KQ7A 2BYFA 2Z0EB 4TQ0A 2KNBA 2KX0A 2JF5A 2LVPA 4KDIC 1YQBA 1TBEA 1WGDA 2J0MA 2ZCBA 3VHTC 1V5TA 4DK5A 2G4DB 4NAWA 3TL5A 3X0WA 2KK8A 2DZJA 1YJ1A 3A9KA 2JRHA 4F1SA 1XQQA 3VXWA 2IO1B 3DBLI 3PREA 4NAWB 2MBEA 2KC1A 4G50A 2IO0B 2WX0A 1P0RA 1ZGUB 1GNUA 1H4RA 3VQIA 2LRWA 2DZIA 4JQWC 4HDOA 2A4ZA 1QZEA 2N9EB 2RR9A 2FCNA 4NNJB 1E5WA 2LASA 1L7YA 4TUUA 5DPRA 3UF8A 2KDIA 5BO4B 4RM9A 3SHQA 1YD8U 1PQSA 1WGGA 3SDLC 2GBMA 1FXTB 4TV3A 2AL3A 2D07B 2LXAA 2JWZA 4KZCA 4KVGB 1EF1A 3DVGY 1WRDB 4RM8A 3NZUA 3V6CB 2N7DA 4IM0A 2HJ8A 3DCGA 4CO7A 1NI2A 2VRRB 1LXDA 3ZNID 2JUOA 3ZNZB 4PS8A 3NZSA 2ZEQA 4FULA 3RCZA 3BY4B 1NDDA 3QHTA 3WAOA 2KTRA 2AWTA 5CHVC 2AL6A 1JRUA 3DBHI 4LCDE 1M94A 1GJZA 4MSMB 3A9JA 3PRPB 1A5RA 3UIOB 4GSWA 2O2VB 2ZPYA 2NBVB 2C7NB 3VUYA 3H7PA 1V6EA 1LQBA 2ZJDA 1V81A 2MRPA 2KC2A 1I35A 2FIDA 2O6VB 5LXIB 2KVRA 4E3CA 2K39A 2MBQA 3IFWB 4HWIB 2FCSA 2Y5BB 2YLMA 4IWOA 3TMPB 3L10B 1UGMA 1WX8A 2A5UA 4IWPA 1H8CA 1TZ1A 4MGKE 1EO6A 4ZRIA 2C9WB 5E6PA 4KDLB 4FJZA 2O6VD 2RD0A 3JSVB 3ML8A 2UWQA 5JZEB 2CHWA 2ZNVC 4BOSC 4DHJD 1E8ZA 2K25A 2N9PC 2L00B 1WX7A 1RRBA 3ZRFA 2KDEB 2LVOA 2M4NA 3VVWB 3W1SA 2KO3A 5CTRC 4II2B 4AP4C 4GB9A 2GBJA 3AI5A 4HCNB 2XK5A 4I6PA 3GZNI 1J8CA 2FNJB 3ZTCA 4IC7B 5EDSA 3PHXB 3N3KB 4JIOU 1X1MA 2J7QB 2WYQA 4NQKE 4TKNA 3B08A 3QCAA 2N4FA 3KVFB 4PS3A 2KFKA 4OVVA 4BBNC 3PRMB 3R66C 4AUQC 4MEMA 4IUMB 4URKA 3A4RA 3PHWB 2LWPA 2LVQA 3EC8A 3U30A 3UINB 5L95C 1RLFA 2IY1B 4FHJA 2FUHB 3VTVA 5D6JB 2KX3A 3O65B 3A4SC 2FCQA 4EFOA 2GOWA 3B1LX 4F7ZA 4GDLA 2L0FA 2O6VA 2WDTB 2J0JA 3AU4A 3U8ZA 3L0WB 4NY0A 3NY5A 1OTRB 2M17A 3QQ8B 2I1JA 4DBGA 3RULA 3HM6X 2YVCA 3QX1A 1WE6A 2LD9A 3A9KB 2IO3B 4GOCA 2MQJA 4IM2A 5AZGA 3RD2A 5TR5A 2MW5A 1R4MI 4HPMB 1WF9A 1UZXB 2XBBC 1IP9A 4A20A 1WR6E 2CU1A 3OLMD 3QA8A 3KUZA 4B6WA 2GMIC 1RAXA 5E6NA 1E90A 1WXAA 4XC2A 4EZKA 4WJNA 2IY0B 3PTFC 1WXVA 1G6JA 2NPTB 4LJPB 4W9JA 3U7DA 4FADA 5LLIA 2N7EA 2AEHA 3KUCB 2LGDA 4MH0E 4OVUA 4E71A 1OEYJ 2L76A 4NQLB 3PS6A 2ZZPB 1YX6B 2GBNA 4WJQA 1UBQA 4HK2A 5KHQA 4K7SA 5AZFA 3A1QA 3VUXA 4NPNA 4DHZE 1V2YA 2LRUA 1WMHB 2CHXA 3RZWC 1P9DU 3IG3A 2JPHA 4MJSB 4ANWA 2KMCA 1L2NA 1WXSA 3OAWA 3NOBA 2MP2B 5CHWA 2NS5A 1V49A 3VDZA 3H9DA 2KLGA 5AEKB 5JHAA 3R7QA 3ECIA 2KTRB 3HHMA 3CMMB 5CHFA 4HDQA 4MDKE 4DHJB 1IPGA 2KZRA 2MLBA 4FJYA 3SD5A 5IAAC 2R2OA 3LJ3A 3ZDMC 1P98A 5G2NA 3L16A 3NHEB 1Z2MA 4K7WA 2XEWA 2ASQA 1SE9A 4N9F4 4M8MA 1GC6A 1D3ZA 1E7UA 4F8CB 4GMVA 4K7UA 4ANVA 3RT3B 3QIJA 4DDGD 2NBWB 4B9KA 3R7RA 4A3PA 2LJ5A 1V5OA 2KWUB 3K9OB 3M62B 1WM3A 3MHSD 4BKSA 1E7VA 4W9IA 4CYEA 3APCA 4G11A 1WXMA 2D2QA 1S3SG 3CSTA 2KXJA 5D7GA 4GN1A 3DPDA 3ZRCA 3DVNU 4AOFA 4M0WB 5D2MB 3A33B 1UD7A 4LDTD 3QJZA 2PEAA 4ZRJA 4XX5A 2IO2B 2K8BA 1P1AA 2RGFA 3ZKJC 3CSFA 3VAWA 3WALA 1AARA 4A3OA 2G45B 3HK0A 3Q3JA 3QARA 3IVFA 2CHZA 1WYWB 2K1FA 4RMAA 2MP2A 3OJ4B 2JRIB 4EKUA 2DAJA 1E8XA 1SIFA 2KQSA 1YIWA 4PS7A 3ZUNA 2WX1A 2JT4B 2V4LA 3L08A 2MBOA 2KJ6A 2BGFA 1SGHA 2L05A 2K6QA 3ZVVA 4MGZE 1UELA 2G3QB 2DHZA 2KOXA 3UIPB 4ASWC 4B95A 4KIKB 2O2VA 2BF8B 4ZDVA 1WGRA 2DYBA 1T0YA 2KWCA 2KLCA 2CR5A 3AU5A 3L17A 2OJRA 4G0NB 2JXXA 3QC8B 3X23A 4BKSD 1C3TA 2I1KA 2HD5B 1KLVA 2BKRB 4LJOB 4HLEA 2KANA 3APDA 3ENEA 4ICUA 3PSEB 3WA0A 4EOYA 4K81A 2BYEA 1WFYA 4ANUA 3IBEA 3KYCD 4DXAB 2KN5A 2DYOA 4GGQA 4JLCA 1V80A 2BKFA 1WJNA 3MJWA 2DENB 2NCNA 2RSUA 2V1YA 3RZFA 1Q0WB 2QHOA 2MA9B 2OOBB 2NR2A 2D10A 2KFKB 3PZDA 2ZVNA 1S1QB 4MM3A 3L13A 4IM3A 1LM8B 1GG3A 2HTHA 1IYFA 3K9PB 3ALBA 3A1QB 4HXDA 2LZ6A 1WMHA 2KWVB 2IYDB 2DZMA 3H1UA 4PYZA 4BKGA 3V60A 4HVBA 3KUDB 4WWPA 1WZ0A 4P7IA 3MTNB 4CHKA 1Y8RC 1E8YA 3QWZB 4M8NA 2JZZA 1VD2A 3QAQA 4K1RB 2ZCCA 3PLUA 3DBSA 4FHKA 5CX3A 4BFRA 2NBUA 4ZYNA 1GC7A 1KM7A 3WANA 1WM2A 3Q3FA 3M63B 4GDLB 3VH3B 4AWJA 2LUEA 1OEYA 2PJHA 3CF6E 1HE8A 2MSED 3VFKA 1WJ6A 3W1YA 2FAZA 1Q5WB 2GBRA 2M8SA 1F9JA 1TGZB 3ML9A 5DCNA 5JH5C 4FN2A 4EEWA 2N1VA 3V6EB 3JW0X 3D32A 2KDFB 3WAPA 3V61A 3DQVA 1WH3A 3PVLA 3UGBB 1J19A 4W9GA 4BKTA 3LDZE 4KZ0A 4FBJB 3PRZA 4MGIE 2C7HA 4W9EA 4YL8A 1R4NI 1ZW7A 1YX5B 1WI0A 1WR1A 3RUIB 3ZO5B 4GIVA 2L7RA 2JVCA 2CS4A 1RFAA 4BBNF 1WJ4A 2L8JA 3P2BA 5J18A 4II3B 4KSKC 3T8MA 3ZW3A 4W9LA 3DVGX 1V86A 3EECA 1WY8A 4W9HA 3UQBA 2RPQA 4BOZB 4BVUC 2DYMA 4W9FA 3IHPC 4HJKA 2JY6A 3KW5B 4MJSA 2PPHA 3C0RB 3JYUA 3TBLD 3AXCA 5J17A 1Z5SB 2KTFA 2KKCA 1K8RB 4KSLC 4MSQB 1XT9B 1NBFC 4LDTB 1WX9A 3R3MA 5E6OA 3S2AA 4W9KA 3ZNGC 2B3AA 4IW0A 1KJTA 3H7PB 1CMXB 2N1WA 2MX2A 3V62A 3JVZX 4J6IA 3WIMA 1C1YB 1U4AA 4E74A 2KFJA 2Z0DB 4FLHA 4NJ7A 1WGYA 4WWNA 5KHOA 2BWES 4NJ6A 3PT2B 2WWZA 2BWFA 3DDCB 4EZLA 1P3QU 3JSVA 3H7SA 2LGYA 2MCNB 3RYTA 1GUAB 1WE7A 2LXCA 3PPAA 2MBHA 3N30A 3N32A 4GDKB 4DDID 1OGWA 2DZKA 4PYUA 5JHBA 2D11A 3HIZA 4GXBA 1WGHA 4FJVB 4KV2A 1WZ3A 4W9DA 2C5LC 2C60A 3TCAA 2C7MB 2EMSA 2M0XA 1J0GA 2K8CA 1BT0A 3B0AA 4MELA 2FIFA 3ZIMA 4IG7B 3ZLZA 4MGYE 5FR6A 3ZDTA 5LXHA 5DPWA 2NPTA 3PLVA 3W1SC 4WWOA 2BPSA 4FA6A 2D3GA 2XK5B 2KHWB 2KJRA 2FCMA 1MG8A 4ICVA 2KDBA 4GU2A 4HCPB 5C23A 4WJPA 3I3TB 2K8HA 1EUVB 5HKHA 3VH4B 5J2RA 2JZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBB B;  2IBI B;  2N9X A;  2PE9 A;  2AYO B;  2L3Z A;  1UH6 A;  3M3J A;  5C1Z A;  4WQO B;  4ZRK A;  1V9J A;  4EZJ A;  2NVU I;  3APF A;  1WJU A;  4I6N B;  5G55 A;  2LI5 A;  2L0T A;  5L83 A;  4KIK A;  2MWS B;  5DPS A;  2EKE C;  3SU8 X;  2G4S A;  2ZPN A;  3L54 A;  4G3X B;  3HM3 A;  2HE7 A;  3EFU A;  2EMT A;  3UQA A;  4ANX A;  3KH0 A;  3VTW A;  3BIN A;  3EHV A;  5DPT A;  4DHZ B;  3T9L A;  3GOE A;  1I42 A;  1Q1O A;  2UYZ B;  1LFD A;  3ZNH B;  2LGX A;  1E8W A;  5IA7 A;  4JL9 A;  4XZ4 A;  5AZH A;  4W9C A;  4JGH B;  3VUW A;  4DWF A;  4EUT A;  2J0K A;  3DOW A;  2DX5 B;  2PE6 B;  5D94 A;  2DAF A;  1ISN A;  3AUL A;  4GDK A;  2ZVO A;  3DBR I;  1TTN A;  1VCB A;  2BYV E;  3OJ3 A;  4WAA A;  2W9N A;  1EF5 A;  3M95 A;  3ZTD A;  1WIA A;  3ONS A;  3TJP A;  3VTU A;  4HPL B;  4AJY B;  4I6L B;  2KD0 A;  3DVN V;  2IZV B;  2KJH B;  2V3S A;  3PV1 A;  2M1M A;  3WAM A;  1KOT A;  2ZNV B;  2K6D B;  3TIX A;  4TQ1 A;  2R2Q A;  3A9J B;  1OQY A;  2CKH B;  4WJO A;  1ZKH A;  3QK0 A;  1UBI A;  3PGE A;  3NS8 A;  2KMA A;  4AJW A;  3H6N A;  2GBK A;  2Z59 B;  4IWQ A;  2REX A;  3KYD D;  5GMV A;  4X57 B;  1XD3 B;  2KQ7 A;  2BYF A;  2Z0E B;  4TQ0 A;  2KNB A;  2KX0 A;  2JF5 A;  2LVP A;  4KDI C;  1YQB A;  1TBE A;  1WGD A;  2J0M A;  2ZCB A;  3VHT C;  1V5T A;  4DK5 A;  2G4D B;  4NAW A;  3TL5 A;  3X0W A;  2KK8 A;  2DZJ A;  1YJ1 A;  3A9K A;  2JRH A;  4F1S A;  1XQQ A;  3VXW A;  2IO1 B;  3DBL I;  3PRE A;  4NAW B;  2MBE A;  2KC1 A;  4G50 A;  2IO0 B;  2WX0 A;  1P0R A;  1ZGU B;  1GNU A;  1H4R A;  3VQI A;  2LRW A;  2DZI A;  4JQW C;  4HDO A;  2A4Z A;  1QZE A;  2N9E B;  2RR9 A;  2FCN A;  4NNJ B;  1E5W A;  2LAS A;  1L7Y A;  4TUU A;  5DPR A;  3UF8 A;  2KDI A;  5BO4 B;  4RM9 A;  3SHQ A;  1YD8 U;  1PQS A;  1WGG A;  3SDL C;  2GBM A;  1FXT B;  4TV3 A;  2AL3 A;  2D07 B;  2LXA A;  2JWZ A;  4KZC A;  4KVG B;  1EF1 A;  3DVG Y;  1WRD B;  4RM8 A;  3NZU A;  3V6C B;  2N7D A;  4IM0 A;  2HJ8 A;  3DCG A;  4CO7 A;  1NI2 A;  2VRR B;  1LXD A;  3ZNI D;  2JUO A;  3ZNZ B;  4PS8 A;  3NZS A;  2ZEQ A;  4FUL A;  3RCZ A;  3BY4 B;  1NDD A;  3QHT A;  3WAO A;  2KTR A;  2AWT A;  5CHV C;  2AL6 A;  1JRU A;  3DBH I;  4LCD E;  1M94 A;  1GJZ A;  4MSM B;  3A9J A;  3PRP B;  1A5R A;  3UIO B;  4GSW A;  2O2V B;  2ZPY A;  2NBV B;  2C7N B;  3VUY A;  3H7P A;  1V6E A;  1LQB A;  2ZJD A;  1V81 A;  2MRP A;  2KC2 A;  1I35 A;  2FID A;  2O6V B;  5LXI B;  2KVR A;  4E3C A;  2K39 A;  2MBQ A;  3IFW B;  4HWI B;  2FCS A;  2Y5B B;  2YLM A;  4IWO A;  3TMP B;  3L10 B;  1UGM A;  1WX8 A;  2A5U A;  4IWP A;  1H8C A;  1TZ1 A;  4MGK E;  1EO6 A;  4ZRI A;  2C9W B;  5E6P A;  4KDL B;  4FJZ A;  2O6V D;  2RD0 A;  3JSV B;  3ML8 A;  2UWQ A;  5JZE B;  2CHW A;  2ZNV C;  4BOS C;  4DHJ D;  1E8Z A;  2K25 A;  2N9P C;  2L00 B;  1WX7 A;  1RRB A;  3ZRF A;  2KDE B;  2LVO A;  2M4N A;  3VVW B;  3W1S A;  2KO3 A;  5CTR C;  4II2 B;  4AP4 C;  4GB9 A;  2GBJ A;  3AI5 A;  4HCN B;  2XK5 A;  4I6P A;  3GZN I;  1J8C A;  2FNJ B;  3ZTC A;  4IC7 B;  5EDS A;  3PHX B;  3N3K B;  4JIO U;  1X1M A;  2J7Q B;  2WYQ A;  4NQK E;  4TKN A;  3B08 A;  3QCA A;  2N4F A;  3KVF B;  4PS3 A;  2KFK A;  4OVV A;  4BBN C;  3PRM B;  3R66 C;  4AUQ C;  4MEM A;  4IUM B;  4URK A;  3A4R A;  3PHW B;  2LWP A;  2LVQ A;  3EC8 A;  3U30 A;  3UIN B;  5L95 C;  1RLF A;  2IY1 B;  4FHJ A;  2FUH B;  3VTV A;  5D6J B;  2KX3 A;  3O65 B;  3A4S C;  2FCQ A;  4EFO A;  2GOW A;  3B1L X;  4F7Z A;  4GDL A;  2L0F A;  2O6V A;  2WDT B;  2J0J A;  3AU4 A;  3U8Z A;  3L0W B;  4NY0 A;  3NY5 A;  1OTR B;  2M17 A;  3QQ8 B;  2I1J A;  4DBG A;  3RUL A;  3HM6 X;  2YVC A;  3QX1 A;  1WE6 A;  2LD9 A;  3A9K B;  2IO3 B;  4GOC A;  2MQJ A;  4IM2 A;  5AZG A;  3RD2 A;  5TR5 A;  2MW5 A;  1R4M I;  4HPM B;  1WF9 A;  1UZX B;  2XBB C;  1IP9 A;  4A20 A;  1WR6 E;  2CU1 A;  3OLM D;  3QA8 A;  3KUZ A;  4B6W A;  2GMI C;  1RAX A;  5E6N A;  1E90 A;  1WXA A;  4XC2 A;  4EZK A;  4WJN A;  2IY0 B;  3PTF C;  1WXV A;  1G6J A;  2NPT B;  4LJP B;  4W9J A;  3U7D A;  4FAD A;  5LLI A;  2N7E A;  2AEH A;  3KUC B;  2LGD A;  4MH0 E;  4OVU A;  4E71 A;  1OEY J;  2L76 A;  4NQL B;  3PS6 A;  2ZZP B;  1YX6 B;  2GBN A;  4WJQ A;  1UBQ A;  4HK2 A;  5KHQ A;  4K7S A;  5AZF A;  3A1Q A;  3VUX A;  4NPN A;  4DHZ E;  1V2Y A;  2LRU A;  1WMH B;  2CHX A;  3RZW C;  1P9D U;  3IG3 A;  2JPH A;  4MJS B;  4ANW A;  2KMC A;  1L2N A;  1WXS A;  3OAW A;  3NOB A;  2MP2 B;  5CHW A;  2NS5 A;  1V49 A;  3VDZ A;  3H9D A;  2KLG A;  5AEK B;  5JHA A;  3R7Q A;  3ECI A;  2KTR B;  3HHM A;  3CMM B;  5CHF A;  4HDQ A;  4MDK E;  4DHJ B;  1IPG A;  2KZR A;  2MLB A;  4FJY A;  3SD5 A;  5IAA C;  2R2O A;  3LJ3 A;  3ZDM C;  1P98 A;  5G2N A;  3L16 A;  3NHE B;  1Z2M A;  4K7W A;  2XEW A;  2ASQ A;  1SE9 A;  4N9F 4;  4M8M A;  1GC6 A;  1D3Z A;  1E7U A;  4F8C B;  4GMV A;  4K7U A;  4ANV A;  3RT3 B;  3QIJ A;  4DDG D;  2NBW B;  4B9K A;  3R7R A;  4A3P A;  2LJ5 A;  1V5O A;  2KWU B;  3K9O B;  3M62 B;  1WM3 A;  3MHS D;  4BKS A;  1E7V A;  4W9I A;  4CYE A;  3APC A;  4G11 A;  1WXM A;  2D2Q A;  1S3S G;  3CST A;  2KXJ A;  5D7G A;  4GN1 A;  3DPD A;  3ZRC A;  3DVN U;  4AOF A;  4M0W B;  5D2M B;  3A33 B;  1UD7 A;  4LDT D;  3QJZ A;  2PEA A;  4ZRJ A;  4XX5 A;  2IO2 B;  2K8B A;  1P1A A;  2RGF A;  3ZKJ C;  3CSF A;  3VAW A;  3WAL A;  1AAR A;  4A3O A;  2G45 B;  3HK0 A;  3Q3J A;  3QAR A;  3IVF A;  2CHZ A;  1WYW B;  2K1F A;  4RMA A;  2MP2 A;  3OJ4 B;  2JRI B;  4EKU A;  2DAJ A;  1E8X A;  1SIF A;  2KQS A;  1YIW A;  4PS7 A;  3ZUN A;  2WX1 A;  2JT4 B;  2V4L A;  3L08 A;  2MBO A;  2KJ6 A;  2BGF A;  1SGH A;  2L05 A;  2K6Q A;  3ZVV A;  4MGZ E;  1UEL A;  2G3Q B;  2DHZ A;  2KOX A;  3UIP B;  4ASW C;  4B95 A;  4KIK B;  2O2V A;  2BF8 B;  4ZDV A;  1WGR A;  2DYB A;  1T0Y A;  2KWC A;  2KLC A;  2CR5 A;  3AU5 A;  3L17 A;  2OJR A;  4G0N B;  2JXX A;  3QC8 B;  3X23 A;  4BKS D;  1C3T A;  2I1K A;  2HD5 B;  1KLV A;  2BKR B;  4LJO B;  4HLE A;  2KAN A;  3APD A;  3ENE A;  4ICU A;  3PSE B;  3WA0 A;  4EOY A;  4K81 A;  2BYE A;  1WFY A;  4ANU A;  3IBE A;  3KYC D;  4DXA B;  2KN5 A;  2DYO A;  4GGQ A;  4JLC A;  1V80 A;  2BKF A;  1WJN A;  3MJW A;  2DEN B;  2NCN A;  2RSU A;  2V1Y A;  3RZF A;  1Q0W B;  2QHO A;  2MA9 B;  2OOB B;  2NR2 A;  2D10 A;  2KFK B;  3PZD A;  2ZVN A;  1S1Q B;  4MM3 A;  3L13 A;  4IM3 A;  1LM8 B;  1GG3 A;  2HTH A;  1IYF A;  3K9P B;  3ALB A;  3A1Q B;  4HXD A;  2LZ6 A;  1WMH A;  2KWV B;  2IYD B;  2DZM A;  3H1U A;  4PYZ A;  4BKG A;  3V60 A;  4HVB A;  3KUD B;  4WWP A;  1WZ0 A;  4P7I A;  3MTN B;  4CHK A;  1Y8R C;  1E8Y A;  3QWZ B;  4M8N A;  2JZZ A;  1VD2 A;  3QAQ A;  4K1R B;  2ZCC A;  3PLU A;  3DBS A;  4FHK A;  5CX3 A;  4BFR A;  2NBU A;  4ZYN A;  1GC7 A;  1KM7 A;  3WAN A;  1WM2 A;  3Q3F A;  3M63 B;  4GDL B;  3VH3 B;  4AWJ A;  2LUE A;  1OEY A;  2PJH A;  3CF6 E;  1HE8 A;  2MSE D;  3VFK A;  1WJ6 A;  3W1Y A;  2FAZ A;  1Q5W B;  2GBR A;  2M8S A;  1F9J A;  1TGZ B;  3ML9 A;  5DCN A;  5JH5 C;  4FN2 A;  4EEW A;  2N1V A;  3V6E B;  3JW0 X;  3D32 A;  2KDF B;  3WAP A;  3V61 A;  3DQV A;  1WH3 A;  3PVL A;  3UGB B;  1J19 A;  4W9G A;  4BKT A;  3LDZ E;  4KZ0 A;  4FBJ B;  3PRZ A;  4MGI E;  2C7H A;  4W9E A;  4YL8 A;  1R4N I;  1ZW7 A;  1YX5 B;  1WI0 A;  1WR1 A;  3RUI B;  3ZO5 B;  4GIV A;  2L7R A;  2JVC A;  2CS4 A;  1RFA A;  4BBN F;  1WJ4 A;  2L8J A;  3P2B A;  5J18 A;  4II3 B;  4KSK C;  3T8M A;  3ZW3 A;  4W9L A;  3DVG X;  1V86 A;  3EEC A;  1WY8 A;  4W9H A;  3UQB A;  2RPQ A;  4BOZ B;  4BVU C;  2DYM A;  4W9F A;  3IHP C;  4HJK A;  2JY6 A;  3KW5 B;  4MJS A;  2PPH A;  3C0R B;  3JYU A;  3TBL D;  3AXC A;  5J17 A;  1Z5S B;  2KTF A;  2KKC A;  1K8R B;  4KSL C;  4MSQ B;  1XT9 B;  1NBF C;  4LDT B;  1WX9 A;  3R3M A;  5E6O A;  3S2A A;  4W9K A;  3ZNG C;  2B3A A;  4IW0 A;  1KJT A;  3H7P B;  1CMX B;  2N1W A;  2MX2 A;  3V62 A;  3JVZ X;  4J6I A;  3WIM A;  1C1Y B;  1U4A A;  4E74 A;  2KFJ A;  2Z0D B;  4FLH A;  4NJ7 A;  1WGY A;  4WWN A;  5KHO A;  2BWE S;  4NJ6 A;  3PT2 B;  2WWZ A;  2BWF A;  3DDC B;  4EZL A;  1P3Q U;  3JSV A;  3H7S A;  2LGY A;  2MCN B;  3RYT A;  1GUA B;  1WE7 A;  2LXC A;  3PPA A;  2MBH A;  3N30 A;  3N32 A;  4GDK B;  4DDI D;  1OGW A;  2DZK A;  4PYU A;  5JHB A;  2D11 A;  3HIZ A;  4GXB A;  1WGH A;  4FJV B;  4KV2 A;  1WZ3 A;  4W9D A;  2C5L C;  2C60 A;  3TCA A;  2C7M B;  2EMS A;  2M0X A;  1J0G A;  2K8C A;  1BT0 A;  3B0A A;  4MEL A;  2FIF A;  3ZIM A;  4IG7 B;  3ZLZ A;  4MGY E;  5FR6 A;  3ZDT A;  5LXH A;  5DPW A;  2NPT A;  3PLV A;  3W1S C;  4WWO A;  2BPS A;  4FA6 A;  2D3G A;  2XK5 B;  2KHW B;  2KJR A;  2FCM A;  1MG8 A;  4ICV A;  2KDB A;  4GU2 A;  4HCP B;  5C23 A;  4WJP A;  3I3T B;  2K8H A;  1EUV B;  5HKH A;  3VH4 B;  5J2R A;  2JZ3 B; 
#chains in the Genus database with same CATH topology
 2MBB B;  2IBI B;  1SE4 A;  2AYO B;  1EWC A;  4WQO B;  3R8B A;  2NVU I;  1WJU A;  4I6N B;  2L0T A;  4HKZ E;  4S17 A;  3TEW A;  3ZJT A;  1I4H A;  4G3X B;  2ZPN A;  3HM3 A;  2HE7 A;  3GP7 A;  3BYT B;  3GS2 A;  3AM9 A;  3VTW A;  3EHV A;  1I42 A;  1HZ6 A;  1Q1O A;  1LFD A;  1T5X D;  5IA7 A;  4JL9 A;  1ZXH A;  4JGH B;  5HHD G;  4EUT A;  3DOW A;  2V4I B;  2DAF A;  2ON8 A;  3TEX A;  3AUL A;  2BS4 B;  3IXS A;  1EF5 A;  3M95 A;  3ONS A;  4HEA 1;  3TJP A;  4HPL B;  1NVI D;  2IZV B;  2KJH B;  1FXI A;  2V3S A;  2M1M A;  1KOT A;  2K6D B;  3TIX A;  4C4V A;  4LNN A;  1UGJ A;  1I4X A;  2R61 A;  3QK0 A;  3PGE A;  3NS8 A;  2KMA A;  3H6N A;  4YWG G;  5GMV A;  3W2D A;  2KQ7 A;  2BYF A;  2Z0E B;  4EE2 A;  4KDI C;  2ZCB A;  3Q69 A;  1V5T A;  2INC C;  2M0A A;  2DZJ A;  2JRH A;  3RMK C;  3DBL I;  1TS5 A;  3SR6 A;  1C9F A;  1PDX A;  3Q8C A;  1JWM D;  3E56 A;  3VQI A;  1GAQ B;  2V9H A;  4HDO A;  3Q3N C;  2N9E B;  3UF8 A;  4NNJ B;  2LAS A;  4YT0 B;  5DPR A;  4PK1 A;  2AL3 A;  2D07 B;  4KZC A;  2DLB A;  1EF1 A;  1YN4 A;  3V6C B;  2N7D A;  4IM0 A;  3ZNI D;  3HUI A;  4PS8 A;  3NZS A;  2K0P A;  4A9A A;  5BYQ A;  3BY4 B;  3QHT A;  2KTR A;  2AWT A;  2LFI A;  1JRU A;  4LCD E;  4JWU C;  2WGS A;  3KWV A;  2QMT A;  2O2V B;  3VUY A;  2MRP A;  1I35 A;  2O6V B;  3DBH B;  2MBQ A;  3IFW B;  2FCS A;  1I4R A;  4NZL B;  3VRB B;  1UGM A;  1WX8 A;  1JML A;  3Q3O C;  5GXG B;  2C9W B;  3AB5 A;  2JYT A;  2NMQ A;  4A90 A;  2UWQ A;  1P7E A;  4LNO A;  2DBY A;  4YSY B;  2JQR B;  4LTU A;  2K25 A;  1RRB A;  2IGG A;  2KO3 A;  1V97 A;  4GB9 A;  3BK1 A;  3AI5 A;  4HCN B;  2XK5 A;  2L52 A;  3PHX B;  4TKN A;  1X1M A;  2J7Q B;  4RGN A;  1JWB D;  4ZYS A;  3KVF B;  1KLU D;  2KFK A;  4OVV A;  3VRA B;  3A4R A;  3U30 A;  2RMM A;  3VTV A;  5D6J B;  3B1L X;  1JAL A;  4GDL A;  2L0F A;  1R4M B;  3AU4 A;  4NY0 A;  2J53 A;  4MAC A;  3EUB 2;  2YVC A;  2IO3 B;  2MW5 A;  4HPM B;  4M02 A;  3N1Z C;  5BYS A;  1RAX A;  4XC2 A;  1YN3 A;  5IN7 A;  4W9J A;  5LLI A;  2AEH A;  1JWA D;  3KUC B;  4MH0 E;  4WIP A;  2L76 A;  2X8X X;  3PS6 A;  3PZ8 A;  1YX6 B;  1VLB A;  5IO9 A;  3MC0 B;  4IOI E;  4DHZ E;  5BMG A;  3ZYY X;  1P9D U;  3GB1 A;  1ZP0 B;  4ANW A;  1WXS A;  1FFU A;  5FK9 C;  2QDF A;  3HVD A;  1WGK A;  3R7Q A;  3HHM A;  3CMM B;  3BYY B;  1V8C A;  4OW0 A;  4FJY A;  5IAA C;  2R2O A;  2WDQ B;  4C56 C;  1E6E B;  4RCO A;  4RGT A;  3AE2 B;  2PW9 A;  2XEW A;  1GC6 A;  3T3O A;  3RNB C;  1NEK B;  1E7U A;  3NJT A;  4ANV A;  3RT3 B;  1MJD A;  2NBW B;  4B9K A;  2ACZ B;  4A3P A;  1HTO A;  4BKS A;  4W9I A;  3CST A;  1TS4 A;  3DVN U;  5FKA C;  5D2M B;  2LHD A;  4LDT D;  4ZRJ A;  2W3R A;  1P1A A;  4M00 A;  3WAL A;  3N1X C;  1FXA A;  2G45 B;  1OQQ A;  4S0R A;  2GLS A;  3QAR A;  3RNE C;  2ZW1 A;  2JRI B;  1YIW A;  4PS7 A;  2JT4 B;  3L08 A;  1ACC A;  1UWX A;  3ZVV A;  4KIK B;  3W5V B;  2BF8 B;  4ZDV A;  2DYB A;  1T0Y A;  1F0Z A;  3AE5 B;  2KLC A;  3AU5 A;  4L2Y A;  4OZB A;  3ENE A;  3AED B;  2BTE A;  3E9S A;  3IBE A;  3KYC D;  1FCL A;  3MJW A;  1ZDX A;  2D3C A;  2OOB B;  3RI7 C;  3PZD A;  4IM3 A;  3ALB A;  2CJN A;  3RNF C;  4HXD A;  2IYD B;  2WXN A;  3H1U A;  3MTN B;  1P7F A;  1Y8R C;  1TY0 A;  3PLU A;  5CX3 A;  4FHK A;  1RFK A;  3WAN A;  3VH3 B;  4GDL B;  1OEY A;  2PJH A;  1HE8 A;  3VFK A;  1TYG B;  1WJ6 A;  2KMM A;  1I7H A;  2GBR A;  2L1A A;  4FN2 A;  1GB4 A;  2N1V A;  3V6E B;  4W9G A;  1F52 A;  1RWS A;  3PRZ A;  1D5M C;  2J42 A;  4W9E A;  3NS1 A;  1HZ5 A;  1BUI C;  5LNK 1;  3HVZ A;  1WI0 A;  3EFC A;  4C00 A;  1HXY D;  1WJ4 A;  3P2B A;  1TS2 A;  1VZ8 A;  3ZW3 A;  1VRA B;  1T0S C;  3GE3 C;  1R4N B;  3DVG X;  1I4Q A;  3TEZ A;  3AEE B;  4BOZ B;  4C4V B;  3C0R B;  3TBL D;  2QIE B;  1Z5S B;  2KTF A;  1EU3 A;  1F2R I;  2KKC A;  2WXI A;  4MSQ B;  1DGJ A;  1XF5 L;  3S2A A;  4W9K A;  4WQM A;  3JVZ X;  4J6I A;  5KHO A;  2ICI A;  4XGA B;  4NJ6 A;  2WWZ A;  4EZL A;  2LGY A;  2TSS A;  4UDU C;  3RYT A;  5IKC M;  2LXC A;  2MBH A;  3MHZ A;  1CQV A;  4GDK B;  4DDI D;  2DZK A;  3B9J A;  3HIZ A;  4GXB A;  2WXL A;  1WGH A;  1WZ3 A;  2HDE A;  2VZK D;  2C7M B;  1PFD A;  4ACF A;  5AUI A;  1YQ3 B;  3AV8 A;  5DPW A;  4MGY E;  5LXH A;  1IBX B;  3HRD D;  2G9H D;  4WWO A;  2BPS A;  2VZK B;  4FA6 A;  2KHW B;  1MG8 A;  3NZ3 A;  1EUV B;  5J2R A;  2N9X A;  3U4E G;  2L3Z A;  1UH6 A;  5C1Z A;  4ZRK A;  1V9J A;  1SB3 C;  3APF A;  2LI5 A;  1FNV A;  4KGR A;  2EMT A;  2I2Y A;  3W9C B;  5DPT A;  5C3J B;  3GOE A;  1VZ7 A;  2LGX A;  2BB5 A;  4RF1 A;  2QIL A;  2J0K A;  1KH0 A;  5D94 A;  1ISN A;  4GDK A;  3MFG A;  1C79 A;  1WIA A;  2YEP F;  2Y3A A;  1PGA A;  1T3Q A;  2R2Q A;  1WYG A;  1VDV A;  1OQY A;  1UBI A;  2GBK A;  2DNF A;  2REX A;  3KYD D;  4TQ0 A;  2AQ2 B;  5AUK A;  3P4Q B;  1YQB A;  2D5G A;  2J0M A;  2G4D B;  4NAW A;  1CZP A;  1GPX A;  1LGR A;  1YJ1 A;  3A9K A;  3FAH A;  2BYT A;  2PLP A;  4F1S A;  2PTL A;  2IO1 B;  2EEL A;  3P4S B;  2MBE A;  2VH1 A;  4H2A A;  2KC1 A;  2IO0 B;  2WXJ A;  2Y5C A;  1GNU A;  3SEB A;  2A4Z A;  3RN9 C;  4TUU A;  2FCN A;  1GOZ A;  1SF0 A;  5BO4 B;  1PQS A;  3SDL C;  1WSP A;  2GBM A;  1FXT B;  2JWZ A;  3DVG Y;  4RM8 A;  1WRD B;  3WCQ A;  1XLP A;  1QOG A;  2OJW A;  2ZEQ A;  3URY A;  2OHF A;  2AL6 A;  1GJZ A;  1FO4 A;  1A5R A;  4GSW A;  2AQ1 B;  2NBV B;  3SFE B;  3H7P A;  1V6E A;  3Q8A A;  2V0G A;  1V81 A;  1YJI A;  1STE A;  4E3C A;  3PZ7 A;  3TMP B;  4XDC A;  3OG5 A;  4IWP A;  1EO6 A;  5E6P A;  4KDL B;  2RPV A;  2W3S A;  2RD0 A;  3ML8 A;  4BOS C;  3ZXR A;  4DHJ D;  1V1P B;  2L00 B;  1WX7 A;  1HEZ E;  4M0W A;  3VVW B;  4NAM A;  4II2 B;  4I6P A;  3GZN I;  3IT4 B;  4JWS C;  4NJC A;  4IC7 B;  2MEK A;  1I4G A;  4NQK E;  2WYQ A;  4US9 A;  3QCA A;  4PS3 A;  1MPE A;  2D3A A;  4N6E B;  3PRM B;  1E9M A;  1WXQ A;  1ZOY B;  2LWP A;  2LVQ A;  3AE9 B;  1ET9 A;  2PVG C;  3O65 B;  4JPS A;  1AYF A;  2EKI A;  2LGS A;  2O6V A;  3W5U B;  1QOF A;  1JCK B;  2J0J A;  4P1C C;  1OTR B;  2M17 A;  3QQ8 B;  2I1J A;  3QX1 A;  2MQJ A;  1R4M I;  3AE3 B;  2XBB C;  1IP9 A;  1WR6 E;  3QA8 A;  1J7A A;  2IGH A;  1WXA A;  2KVZ A;  3OWE B;  5BYR A;  4C7Z A;  3U7D A;  4FAD A;  3NVY A;  2BS3 B;  1D5X C;  2ZZP B;  2WXF A;  4AQ7 A;  4DXG A;  4LNI A;  3VUX A;  2LRU A;  2N7J A;  1IBX A;  3FKY A;  3IG3 A;  2JPH A;  2WLB A;  2WDV B;  3OAW A;  5CHW A;  3NOB A;  2MP2 B;  2DWQ A;  2KLG A;  3ECI A;  2KTR B;  2SAK A;  1IPG A;  2LUM A;  1K50 A;  2MLB A;  4XWT A;  1F77 A;  3ZDM C;  2PMV A;  3L16 A;  5G2N A;  1Z2M A;  2E6X A;  1VR9 A;  4N9F 4;  2UU7 A;  3KWL A;  4M8M A;  1D3Z A;  1ROE A;  1L5P A;  3Q2A C;  3QIJ A;  1I4P A;  1UUP A;  2LJ5 A;  1V5O A;  2LMC A;  3M62 B;  4Q2J A;  1WXM A;  4RFB A;  1VZ6 A;  5D7G A;  1SEB D;  3DPD A;  3GZN B;  4GN1 A;  3IAM 1;  3ZRC A;  3AEF B;  4AOF A;  5FR3 A;  1DOY A;  1FM0 D;  2PEA A;  4J3O D;  1NYQ A;  3QJZ A;  2IO2 B;  2K8B A;  2LGI A;  4US8 A;  3VAW A;  3Q3J A;  3IVF A;  3GE8 C;  2K1F A;  4RMA A;  2J52 A;  1SIF A;  3ZQ4 A;  2KQS A;  1N60 A;  1YOV B;  3ZUN A;  2WX1 A;  2V4L A;  3SFD B;  1V1O A;  3NVW A;  1SGH A;  2N0S B;  4MGZ E;  1UEL A;  4ASW C;  2DHZ A;  3UIP B;  2KWC A;  4G0N B;  3Q8F A;  1PYW D;  3QC8 B;  3X23 A;  2I1K A;  2HD5 B;  1KLV A;  4L23 A;  3PSE B;  4EOY A;  2W55 A;  4PT5 A;  2BYE A;  4RGO S;  3CIR B;  3MJ5 A;  3AN1 A;  2BKF A;  3N1Y C;  1ZXI A;  2L83 A;  1L4Z B;  4K3C A;  3L13 A;  5TSS A;  1FD6 A;  2HTH A;  1WMH A;  2W54 A;  2DZM A;  2IGD A;  4LK0 M;  4PYZ A;  3V60 A;  4CHK A;  1E8Y A;  3QWZ B;  4M8N A;  4K3B A;  3QAQ A;  1OFF A;  2ZCC A;  4K1R B;  3DBS A;  4BFR A;  2N9L A;  2NBU A;  4ZRQ A;  1KM7 A;  2MJE A;  1XCQ L;  3KLS X;  1C4A A;  2LHE A;  3Q3F A;  1QKZ A;  2MSE D;  4O1N A;  2FAZ A;  2I38 A;  5DCN A;  3ML9 A;  4WUR A;  3LXF A;  2KDF B;  2MJD A;  1D5Z C;  1WH3 A;  1J19 A;  4KZ0 A;  3AEG B;  2C7H A;  4MT5 A;  4IKG A;  1WR1 A;  4TMA B;  2M56 B;  3RUI B;  2L7R A;  2JVC A;  2CS4 A;  4BBN F;  4II3 B;  2CJO A;  4KSK C;  5G5H A;  4RNA A;  5C2T B;  5HFY A;  4W9H A;  1IGD A;  4BVU C;  4HJK A;  3H8H A;  5J17 A;  3MC9 A;  2K3U A;  1XT9 B;  5E6O A;  3ZNG C;  1GB1 A;  4IW0 A;  1KJT A;  3V62 A;  1E7P B;  1TS3 A;  4FLH A;  4NJ7 A;  1WGY A;  3R2T A;  2KYW A;  3PT2 B;  2BWF A;  1YQ4 B;  3JSV A;  2SEB D;  2MCN B;  3N30 A;  2D11 A;  4WH4 A;  4XE0 A;  2FE8 A;  2KWD A;  5EE3 A;  2C60 A;  4HRS A;  1BT0 A;  3B0A A;  4GLS C;  2FIF A;  3ZIM A;  4IG7 B;  3ZDT A;  1QT9 A;  1TJE A;  2D3G A;  2XK5 B;  2IJ0 A;  4GU2 A;  4HCP B;  1FIQ A;  5C23 A;  4WJP A;  1MG4 A;  3VR9 B;  4RF0 A;  4LNF A;  2JZ3 B;  2PE9 A;  1MHX A;  2ONQ A;  5L83 A;  4KIK A;  1E0Z A;  2MWS B;  3DHG C;  5DPS A;  2EKE C;  3SU8 X;  3L54 A;  4N58 A;  2WHI A;  3ZXV A;  5EE1 A;  3EFU A;  3UQA A;  1L0X B;  2BB6 A;  3L4P A;  3BIN A;  1D6E C;  1FNU A;  2UYZ B;  1CJE A;  1N5X A;  3FIL A;  4KKJ A;  3Q14 C;  1CK1 A;  5AZH A;  4DXF A;  3VUW A;  3BWU D;  2DX5 B;  2H89 B;  2ZVO A;  3DBR I;  2NTT A;  1EM7 A;  4WAA A;  3OJ3 A;  2GI9 A;  2W9N A;  2JYE A;  2KD0 A;  2ZNV B;  3RPF C;  1MFW A;  3A9J B;  4WJO A;  1XEE A;  1ZKH A;  4JX1 C;  4AJW A;  2Z59 B;  4IWQ A;  1PUT A;  4X57 B;  1XD3 B;  2BT6 A;  2KNB A;  3P1M A;  2KX0 A;  2JF5 A;  2LVP A;  3KQ4 A;  4DK5 A;  2XNA C;  4KKI A;  2KK8 A;  1XQQ A;  4G50 A;  1SBB B;  2WX0 A;  1TIF A;  1P0R A;  1ZGU B;  4XWW A;  4JQW C;  1QZE A;  2RR9 A;  1L7Y A;  2KDI A;  3CWI A;  1WGG A;  4TV3 A;  1YMH E;  4KVG B;  1PGX A;  3DCG A;  4YTP B;  1NI2 A;  2VRR B;  4USA A;  2WXH A;  2QCZ A;  2KDM A;  4FUL A;  1NDD A;  3NG0 A;  1JWU D;  2E3T A;  3WAO A;  3BII D;  1M94 A;  5IP4 D;  3A9J A;  3UIO B;  1OQR A;  3DHI C;  2ZJD A;  2KC2 A;  3Q8B A;  2FID A;  2KVR A;  2K39 A;  4IWO A;  2Y5B B;  3EA6 A;  1TZ1 A;  4MGK E;  4ZRI A;  3J9C A;  2AX5 A;  3JSV B;  5MPO A;  3T3N A;  2CHW A;  2ZNV C;  4WAF A;  1JW9 D;  3AE7 B;  4N59 A;  3W1S A;  4AP4 C;  1F1H A;  3ZTC A;  4ZHO A;  5EDS A;  1BXT A;  1L0V B;  3BVG A;  1T0Q C;  3MC8 A;  3B08 A;  4IDI A;  2N4F A;  2INP E;  4BBN C;  2WU5 B;  4MEM A;  4IUM B;  1L6V A;  1MVK A;  3PHW B;  3UIN B;  2IY1 B;  2FUH B;  1AW7 A;  3TSS A;  1K52 A;  2KX3 A;  2FCQ A;  4EFO A;  4F7Z A;  2WDT B;  2WXR A;  3NY5 A;  2V3P A;  1WE6 A;  2LD9 A;  3A9K B;  4GOC A;  4IM2 A;  5TR5 A;  1WF9 A;  1UZX B;  2QC8 A;  2CU1 A;  2WXP A;  3KUZ A;  4ZHP A;  2BBC A;  1YN5 A;  5E6N A;  1E90 A;  4LNK A;  4EZK A;  4WJN A;  2IY0 B;  1WXV A;  1G6J A;  3ZGZ A;  2LGD A;  4OVU A;  4E71 A;  1OEY J;  2BS2 B;  2BW2 A;  5H92 C;  3P4R B;  4WJQ A;  4HK2 A;  2QSD A;  1SXT A;  4NPN A;  1V2Y A;  1TKG A;  1WMH B;  5HI1 A;  2CHX A;  2G1E A;  2H88 B;  4MJS B;  5EE9 A;  2KMC A;  1L2N A;  1V49 A;  5BMH A;  3VDZ A;  1JQ4 A;  5JHA A;  2OED A;  4MDK E;  4DHJ B;  3AEC B;  2KZR A;  3SD5 A;  2WXG A;  3C19 A;  2ASQ A;  4A6Q A;  3EGR A;  1Y56 A;  4F8C B;  1TT5 B;  1VJK A;  1R7S A;  3R7R A;  1XLN A;  2BQQ A;  1ENF A;  1WM3 A;  3MHS D;  4CYE A;  3APC A;  4G11 A;  2D2Q A;  3AH7 A;  4C80 A;  4L1B A;  1FMA D;  4M0W B;  1XCT L;  3A33 B;  1UD7 A;  4XX5 A;  2WP9 B;  2KQ4 X;  1M4V A;  3CSF A;  1T0R C;  4HPP A;  1WYW B;  1FRR A;  1ZDV A;  2LEK A;  2MBO A;  3V3X A;  2BGF A;  2Q5W D;  4B95 A;  2O2V A;  2WXO A;  1FRD A;  1WGR A;  1DYQ A;  3AE6 B;  1MHH E;  3L17 A;  2OJR A;  2JXX A;  4YSX B;  1BML C;  4BKS D;  5EE0 A;  1C3T A;  4HLE A;  4ICU A;  4K81 A;  3PO0 A;  2WS3 B;  1WFY A;  4ANU A;  4DXA B;  2KN5 A;  2DYO A;  4GGQ A;  4JLC A;  1WJN A;  1C77 A;  2DEN B;  2W82 A;  3NUH B;  1Q0W B;  5T8I A;  2MA9 B;  4DQO C;  2NR2 A;  2Z8L A;  2KFK B;  3O13 A;  1C4P A;  1LM8 B;  1IYF A;  1NEN B;  3A1Q B;  5IOI A;  2LZ6 A;  1B9R A;  2GB1 A;  4HVB A;  3KUD B;  4YXD B;  4P7I A;  1B1Z A;  4A55 A;  4ZYN A;  1GC7 A;  3R2I A;  1E10 A;  4R3D A;  3M63 B;  1QQR A;  4AWJ A;  3CF6 E;  3DBL B;  3W1Y A;  1KFY B;  1Q5W B;  1TGZ B;  5JH5 C;  4EEW A;  4KGS A;  2ZW0 A;  3DQV A;  1FEH A;  4P16 A;  2J4X A;  1QLB B;  4FBJ B;  4XDD A;  1TKY A;  3BK2 A;  1HA5 A;  3BVZ A;  1ZW7 A;  1YX5 B;  1N62 A;  4GIV A;  1RFA A;  1D4B A;  1J7B A;  3I57 A;  3T8M A;  4ZRP A;  4W9L A;  1V86 A;  3LYY A;  3EEC A;  2RPQ A;  2DYM A;  3IHP C;  2KT7 A;  3JYU A;  3AE4 B;  2AQ3 B;  2WXM A;  4QAY A;  4KSL C;  3R3M A;  2Y5P A;  4JE3 B;  2B3A A;  2NTS A;  2N1W A;  2MX2 A;  3WIM A;  1C1Y B;  2PVO D;  2Z0D B;  2BWE S;  1QIL A;  4P1B C;  1SIJ A;  1P3Q U;  3AEA B;  1GUA B;  1C78 A;  2RDB C;  3N32 A;  1OGW A;  5JHB A;  3NVZ A;  4KV2 A;  2EMS A;  2JWU A;  4C7Y A;  2M0X A;  4MM3 B;  1J0G A;  5FR6 A;  3PLV A;  3Q8E A;  3C8Y A;  4ICV A;  2KDB A;  4B0M A;  2K8H A;  5HKH A;  4ZOH C;  3VH4 B;  1ZUD 2;  1KF6 B;  1YJJ A;  1KTK A;  3M3J A;  4EZJ A;  5G55 A;  1FFV A;  1XLQ A;  2G4S A;  4RH6 A;  4RGM A;  4ANX A;  3KH0 A;  3BVM A;  4DHZ B;  1L0Y B;  3T9L A;  3ZNH B;  1E8W A;  4XZ4 A;  1V1P A;  4OZA A;  2HTM E;  4W9C A;  1JRP A;  3UI3 A;  2WQY B;  4DWF A;  2PE6 B;  1JWS D;  1TTN A;  1VCB A;  1EWY C;  2BYV E;  3ZTD A;  2JXT A;  1YNT E;  3VTU A;  2JSV X;  4I6L B;  4AJY B;  3Q6B A;  3U52 E;  3DVN V;  1N5W A;  3PV1 A;  3WAM A;  1Q10 A;  3I63 C;  1T6B X;  2KN4 A;  1UF0 A;  4P6V F;  1N63 A;  4TQ1 A;  2CKH B;  2QEJ C;  3DWG C;  1F2R C;  5H8Y E;  5JXV A;  3LB8 C;  3VHT C;  1TBE A;  1WGD A;  2XN9 C;  1ESF A;  3TL5 A;  1WWT A;  3X0W A;  4HKQ A;  2KAC A;  1TZO A;  4YTN B;  2RDH A;  3VXW A;  5BMI A;  3PRE A;  4NAW B;  1ZE3 D;  2IND C;  1H4R A;  2LRW A;  2DZI A;  1FCC C;  1E5W A;  4RM9 A;  3SHQ A;  1YD8 U;  4ARI A;  1J7C A;  2LXA A;  1QOB A;  1QOA A;  1AN8 A;  2MJ3 A;  3NZU A;  1HTQ A;  2HJ8 A;  3B2G A;  2B76 B;  1EU4 A;  4CO7 A;  2IDY A;  1LXD A;  3RNA C;  4FXC A;  2JUO A;  3ZNZ B;  3P42 A;  3RCZ A;  1RYJ A;  5CHV C;  3BZD B;  3DBH I;  4MSM B;  3PRP B;  1RM6 C;  4KX6 B;  2ZPY A;  4WWM A;  2C7N B;  1LQB A;  2KAJ A;  5LXI B;  4HWI B;  2YLM A;  3L10 B;  2A5U A;  3AEB B;  1H8C A;  2V3N A;  4M01 A;  4FJZ A;  2O6V D;  2L32 A;  5JZE B;  4LLG M;  1E8Z A;  3FIL B;  1SSN A;  2N9P C;  1DOX A;  5D3I B;  3ZRF A;  2KDE B;  2LVO A;  2M4N A;  5CTR C;  2K22 A;  2GBJ A;  1J8C A;  1WRI A;  2FNJ B;  4TSS A;  3I5J C;  3N3K B;  4JIO U;  1A70 A;  1QF6 A;  2PKO A;  3R66 C;  3U7Z A;  4AUQ C;  4URK A;  1TKE A;  4KGT A;  1KRH A;  3TEY A;  4HJG E;  4CQN A;  3DWM A;  3EC8 A;  5L95 C;  3P4P B;  1RLF A;  2M19 A;  3I9V 1;  4FHJ A;  3A4S C;  1PGB A;  1K51 A;  2GOW A;  2WXK A;  2HJ1 A;  2MHJ A;  3U8Z A;  2GRI A;  3L0W B;  5D3D A;  4DBG A;  1L6U A;  3RUL A;  3HM6 X;  5AZG A;  2PIA A;  4MH8 A;  3RD2 A;  3ZJU A;  4D2K A;  3NVV A;  2INN E;  1MI0 A;  4A20 A;  3OLM D;  4B6W A;  2GMI C;  4YSZ B;  2WU2 B;  1LO5 D;  3PTF C;  2NPT B;  4LJP B;  2JX5 A;  2N7E A;  2X38 A;  4NQL B;  1ZPS A;  2GBN A;  1DOI A;  2CU3 A;  1UBQ A;  5KHQ A;  4K7S A;  2JZP A;  5AZF A;  3A1Q A;  1IGC A;  3RZW C;  2NS5 A;  2WXQ A;  3AMZ A;  3H9D A;  5AEK B;  1NI3 A;  5I4D A;  4ARC A;  5HG2 A;  5CHF A;  4HDQ A;  3LJ3 A;  1P98 A;  3NHE B;  4K7W A;  1SE9 A;  3RNC C;  4GMV A;  2FUG 1;  3DBR B;  4K7U A;  4DDG D;  2WNM A;  2KWU B;  3K9O B;  1E7V A;  3AE1 B;  1UWM A;  1S3S G;  1JRO A;  2KXJ A;  3RNG C;  4BAX A;  5E6J A;  2RGF A;  3ZKJ C;  1AAR A;  4A3O A;  1TY2 A;  3HK0 A;  4BZA A;  2CHZ A;  2QJL A;  3N20 C;  2MP2 A;  3OJ4 B;  4EKU A;  2DAJ A;  1E8X A;  1XO3 A;  2KJ6 A;  2L05 A;  2K6Q A;  2G3Q B;  2KOX A;  3AE8 B;  3FC4 A;  2CR5 A;  3Q3M C;  2BKR B;  4LJO B;  2KAN A;  3APD A;  3WA0 A;  1XXG A;  1NYR A;  2K9X A;  1N6Z A;  3VR8 B;  1V80 A;  1N61 A;  1SJE D;  2NCN A;  2RSU A;  2V1Y A;  3RZF A;  2QHO A;  4REZ A;  2D10 A;  1HQR D;  2ZVN A;  1S1Q B;  4MM3 A;  4ITK A;  1SJH D;  1GG3 A;  3K9P B;  1AWD A;  3NRZ A;  2KWV B;  2IPK D;  4BKG A;  3U2S C;  3ABV B;  4WWP A;  1WZ0 A;  1FPY A;  2JU6 X;  2JZZ A;  1VD2 A;  1KLG D;  3IAS 1;  1L4D B;  1WM2 A;  1ET6 A;  2LUE A;  1C4C A;  2M8S A;  1XLO A;  1F9J A;  3ETR A;  3JW0 X;  3D32 A;  3WAP A;  3V61 A;  4A8X C;  2WDR B;  3PVL A;  4BKT A;  3UGB B;  2K5P A;  3LDZ E;  4MGI E;  1IUE A;  3MP9 A;  4YL8 A;  2N9K A;  1R4N I;  3DHH C;  3ZO5 B;  2D3B A;  2BVC A;  2L8J A;  5J18 A;  3IT6 B;  4YTM B;  4AS1 A;  4OHJ A;  1WY8 A;  3UQB A;  4W9F A;  2JY6 A;  3KW5 B;  4MJS A;  2PPH A;  3AXC A;  3ZJV A;  1K8R B;  3TUO A;  1NBF C;  4LDT B;  1WX9 A;  2MH7 A;  5G5G A;  1SE3 A;  1K53 A;  3P63 A;  3H7P B;  1CMX B;  3RFZ B;  2FBW B;  1U4A A;  4E74 A;  2KFJ A;  4WWN A;  3B2F A;  3DDC B;  1UNS A;  3H7S A;  1WE7 A;  1C76 A;  3PPA A;  2LJI A;  1SE2 A;  4PYU A;  4FJV B;  4OVZ A;  4B0E A;  4W9D A;  2C5L C;  3TCA A;  2YEP B;  2K8C A;  4OZC A;  4MEL A;  3ZLZ A;  2RDG A;  2NPT A;  3W1S C;  2VH2 A;  3N9Y C;  4HRO A;  2KJR A;  2FCM A;  4XYC A;  3I3T B;  3V05 A;  1FNW A; 
#chains in the Genus database with same CATH homology
 2MBB B;  2IBI B;  2N9X A;  2PE9 A;  2AYO B;  2L3Z A;  1UH6 A;  3M3J A;  5C1Z A;  4WQO B;  4ZRK A;  1V9J A;  4EZJ A;  2NVU I;  3APF A;  1WJU A;  4I6N B;  5G55 A;  2LI5 A;  2L0T A;  5L83 A;  4KIK A;  2MWS B;  5DPS A;  2EKE C;  3SU8 X;  2G4S A;  2ZPN A;  3L54 A;  4G3X B;  3HM3 A;  2HE7 A;  3EFU A;  2EMT A;  3UQA A;  4ANX A;  3KH0 A;  3VTW A;  3BIN A;  3EHV A;  5DPT A;  4DHZ B;  3T9L A;  3GOE A;  1I42 A;  1Q1O A;  2UYZ B;  1LFD A;  3ZNH B;  2LGX A;  1E8W A;  5IA7 A;  4JL9 A;  4XZ4 A;  5AZH A;  4W9C A;  4JGH B;  3VUW A;  4DWF A;  4EUT A;  2J0K A;  3DOW A;  2DX5 B;  2PE6 B;  5D94 A;  2DAF A;  1ISN A;  3AUL A;  4GDK A;  2ZVO A;  3DBR I;  1TTN A;  1VCB A;  2BYV E;  3OJ3 A;  4WAA A;  2W9N A;  1EF5 A;  3M95 A;  3ZTD A;  1WIA A;  3ONS A;  3TJP A;  3VTU A;  4HPL B;  4AJY B;  4I6L B;  2KD0 A;  3DVN V;  2IZV B;  2KJH B;  2V3S A;  3PV1 A;  2M1M A;  3WAM A;  1KOT A;  2ZNV B;  2K6D B;  3TIX A;  4TQ1 A;  2R2Q A;  3A9J B;  1OQY A;  2CKH B;  4WJO A;  1ZKH A;  3QK0 A;  1UBI A;  3PGE A;  3NS8 A;  2KMA A;  4AJW A;  3H6N A;  2GBK A;  2Z59 B;  4IWQ A;  2REX A;  3KYD D;  5GMV A;  4X57 B;  1XD3 B;  2KQ7 A;  2BYF A;  2Z0E B;  4TQ0 A;  2KNB A;  2KX0 A;  2JF5 A;  2LVP A;  4KDI C;  1YQB A;  1TBE A;  1WGD A;  2J0M A;  2ZCB A;  3VHT C;  1V5T A;  4DK5 A;  2G4D B;  4NAW A;  3TL5 A;  3X0W A;  2KK8 A;  2DZJ A;  1YJ1 A;  3A9K A;  2JRH A;  4F1S A;  1XQQ A;  3VXW A;  2IO1 B;  3DBL I;  3PRE A;  4NAW B;  2MBE A;  2KC1 A;  4G50 A;  2IO0 B;  2WX0 A;  1P0R A;  1ZGU B;  1GNU A;  1H4R A;  3VQI A;  2LRW A;  2DZI A;  4JQW C;  4HDO A;  2A4Z A;  1QZE A;  2N9E B;  2RR9 A;  2FCN A;  4NNJ B;  1E5W A;  2LAS A;  1L7Y A;  4TUU A;  5DPR A;  3UF8 A;  2KDI A;  5BO4 B;  4RM9 A;  3SHQ A;  1YD8 U;  1PQS A;  1WGG A;  3SDL C;  2GBM A;  1FXT B;  4TV3 A;  2AL3 A;  2D07 B;  2LXA A;  2JWZ A;  4KZC A;  4KVG B;  1EF1 A;  3DVG Y;  1WRD B;  4RM8 A;  3NZU A;  3V6C B;  2N7D A;  4IM0 A;  2HJ8 A;  3DCG A;  4CO7 A;  1NI2 A;  2VRR B;  1LXD A;  3ZNI D;  2JUO A;  3ZNZ B;  4PS8 A;  3NZS A;  2ZEQ A;  4FUL A;  3RCZ A;  3BY4 B;  1NDD A;  3QHT A;  3WAO A;  2KTR A;  2AWT A;  5CHV C;  2AL6 A;  1JRU A;  3DBH I;  4LCD E;  1M94 A;  1GJZ A;  4MSM B;  3A9J A;  3PRP B;  1A5R A;  3UIO B;  4GSW A;  2O2V B;  2ZPY A;  2NBV B;  2C7N B;  3VUY A;  3H7P A;  1V6E A;  1LQB A;  2ZJD A;  1V81 A;  2MRP A;  2KC2 A;  1I35 A;  2FID A;  2O6V B;  5LXI B;  2KVR A;  4E3C A;  2K39 A;  2MBQ A;  3IFW B;  4HWI B;  2FCS A;  2Y5B B;  2YLM A;  4IWO A;  3TMP B;  3L10 B;  1UGM A;  1WX8 A;  2A5U A;  4IWP A;  1H8C A;  1TZ1 A;  4MGK E;  1EO6 A;  4ZRI A;  2C9W B;  5E6P A;  4KDL B;  4FJZ A;  2O6V D;  2RD0 A;  3JSV B;  3ML8 A;  2UWQ A;  5JZE B;  2CHW A;  2ZNV C;  4BOS C;  4DHJ D;  1E8Z A;  2K25 A;  2N9P C;  2L00 B;  1WX7 A;  1RRB A;  3ZRF A;  2KDE B;  2LVO A;  2M4N A;  3VVW B;  3W1S A;  2KO3 A;  5CTR C;  4II2 B;  4AP4 C;  4GB9 A;  2GBJ A;  3AI5 A;  4HCN B;  2XK5 A;  4I6P A;  3GZN I;  1J8C A;  2FNJ B;  3ZTC A;  4IC7 B;  5EDS A;  3PHX B;  3N3K B;  4JIO U;  1X1M A;  2J7Q B;  2WYQ A;  4NQK E;  4TKN A;  3B08 A;  3QCA A;  2N4F A;  3KVF B;  4PS3 A;  2KFK A;  4OVV A;  4BBN C;  3PRM B;  3R66 C;  4AUQ C;  4MEM A;  4IUM B;  4URK A;  3A4R A;  3PHW B;  2LWP A;  2LVQ A;  3EC8 A;  3U30 A;  3UIN B;  5L95 C;  1RLF A;  2IY1 B;  4FHJ A;  2FUH B;  3VTV A;  5D6J B;  2KX3 A;  3O65 B;  3A4S C;  2FCQ A;  4EFO A;  2GOW A;  3B1L X;  4F7Z A;  4GDL A;  2L0F A;  2O6V A;  2WDT B;  2J0J A;  3AU4 A;  3U8Z A;  3L0W B;  4NY0 A;  3NY5 A;  1OTR B;  2M17 A;  3QQ8 B;  2I1J A;  4DBG A;  3RUL A;  3HM6 X;  2YVC A;  3QX1 A;  1WE6 A;  2LD9 A;  3A9K B;  2IO3 B;  4GOC A;  2MQJ A;  4IM2 A;  5AZG A;  3RD2 A;  5TR5 A;  2MW5 A;  1R4M I;  4HPM B;  1WF9 A;  1UZX B;  2XBB C;  1IP9 A;  4A20 A;  1WR6 E;  2CU1 A;  3OLM D;  3QA8 A;  3KUZ A;  4B6W A;  2GMI C;  1RAX A;  5E6N A;  1E90 A;  1WXA A;  4XC2 A;  4EZK A;  4WJN A;  2IY0 B;  3PTF C;  1WXV A;  1G6J A;  2NPT B;  4LJP B;  4W9J A;  3U7D A;  4FAD A;  5LLI A;  2N7E A;  2AEH A;  3KUC B;  2LGD A;  4MH0 E;  4OVU A;  4E71 A;  1OEY J;  2L76 A;  4NQL B;  3PS6 A;  2ZZP B;  1YX6 B;  2GBN A;  4WJQ A;  1UBQ A;  4HK2 A;  5KHQ A;  4K7S A;  5AZF A;  3A1Q A;  3VUX A;  4NPN A;  4DHZ E;  1V2Y A;  2LRU A;  1WMH B;  2CHX A;  3RZW C;  1P9D U;  3IG3 A;  2JPH A;  4MJS B;  4ANW A;  2KMC A;  1L2N A;  1WXS A;  3OAW A;  3NOB A;  2MP2 B;  5CHW A;  2NS5 A;  1V49 A;  3VDZ A;  3H9D A;  2KLG A;  5AEK B;  5JHA A;  3R7Q A;  3ECI A;  2KTR B;  3HHM A;  3CMM B;  5CHF A;  4HDQ A;  4MDK E;  4DHJ B;  1IPG A;  2KZR A;  2MLB A;  4FJY A;  3SD5 A;  5IAA C;  2R2O A;  3LJ3 A;  3ZDM C;  1P98 A;  5G2N A;  3L16 A;  3NHE B;  1Z2M A;  4K7W A;  2XEW A;  2ASQ A;  1SE9 A;  4N9F 4;  4M8M A;  1GC6 A;  1D3Z A;  1E7U A;  4F8C B;  4GMV A;  4K7U A;  4ANV A;  3RT3 B;  3QIJ A;  4DDG D;  2NBW B;  4B9K A;  3R7R A;  4A3P A;  2LJ5 A;  1V5O A;  2KWU B;  3K9O B;  3M62 B;  1WM3 A;  3MHS D;  4BKS A;  1E7V A;  4W9I A;  4CYE A;  3APC A;  4G11 A;  1WXM A;  2D2Q A;  1S3S G;  3CST A;  2KXJ A;  5D7G A;  4GN1 A;  3DPD A;  3ZRC A;  3DVN U;  4AOF A;  4M0W B;  5D2M B;  3A33 B;  1UD7 A;  4LDT D;  3QJZ A;  2PEA A;  4ZRJ A;  4XX5 A;  2IO2 B;  2K8B A;  1P1A A;  2RGF A;  3ZKJ C;  3CSF A;  3VAW A;  3WAL A;  1AAR A;  4A3O A;  2G45 B;  3HK0 A;  3Q3J A;  3QAR A;  3IVF A;  2CHZ A;  1WYW B;  2K1F A;  4RMA A;  2MP2 A;  3OJ4 B;  2JRI B;  4EKU A;  2DAJ A;  1E8X A;  1SIF A;  2KQS A;  1YIW A;  4PS7 A;  3ZUN A;  2WX1 A;  2JT4 B;  2V4L A;  3L08 A;  2MBO A;  2KJ6 A;  2BGF A;  1SGH A;  2L05 A;  2K6Q A;  3ZVV A;  4MGZ E;  1UEL A;  2G3Q B;  2DHZ A;  2KOX A;  3UIP B;  4ASW C;  4B95 A;  4KIK B;  2O2V A;  2BF8 B;  4ZDV A;  1WGR A;  2DYB A;  1T0Y A;  2KWC A;  2KLC A;  2CR5 A;  3AU5 A;  3L17 A;  2OJR A;  4G0N B;  2JXX A;  3QC8 B;  3X23 A;  4BKS D;  1C3T A;  2I1K A;  2HD5 B;  1KLV A;  2BKR B;  4LJO B;  4HLE A;  2KAN A;  3APD A;  3ENE A;  4ICU A;  3PSE B;  3WA0 A;  4EOY A;  4K81 A;  2BYE A;  1WFY A;  4ANU A;  3IBE A;  3KYC D;  4DXA B;  2KN5 A;  2DYO A;  4GGQ A;  4JLC A;  1V80 A;  2BKF A;  1WJN A;  3MJW A;  2DEN B;  2NCN A;  2RSU A;  2V1Y A;  3RZF A;  1Q0W B;  2QHO A;  2MA9 B;  2OOB B;  2NR2 A;  2D10 A;  2KFK B;  3PZD A;  2ZVN A;  1S1Q B;  4MM3 A;  3L13 A;  4IM3 A;  1LM8 B;  1GG3 A;  2HTH A;  1IYF A;  3K9P B;  3ALB A;  3A1Q B;  4HXD A;  2LZ6 A;  1WMH A;  2KWV B;  2IYD B;  2DZM A;  3H1U A;  4PYZ A;  4BKG A;  3V60 A;  4HVB A;  3KUD B;  4WWP A;  1WZ0 A;  4P7I A;  3MTN B;  4CHK A;  1Y8R C;  1E8Y A;  3QWZ B;  4M8N A;  2JZZ A;  1VD2 A;  3QAQ A;  4K1R B;  2ZCC A;  3PLU A;  3DBS A;  4FHK A;  5CX3 A;  4BFR A;  2NBU A;  4ZYN A;  1GC7 A;  1KM7 A;  3WAN A;  1WM2 A;  3Q3F A;  3M63 B;  4GDL B;  3VH3 B;  4AWJ A;  2LUE A;  1OEY A;  2PJH A;  3CF6 E;  1HE8 A;  2MSE D;  3VFK A;  1WJ6 A;  3W1Y A;  2FAZ A;  1Q5W B;  2GBR A;  2M8S A;  1F9J A;  1TGZ B;  3ML9 A;  5DCN A;  5JH5 C;  4FN2 A;  4EEW A;  2N1V A;  3V6E B;  3JW0 X;  3D32 A;  2KDF B;  3WAP A;  3V61 A;  3DQV A;  1WH3 A;  3PVL A;  3UGB B;  1J19 A;  4W9G A;  4BKT A;  3LDZ E;  4KZ0 A;  4FBJ B;  3PRZ A;  4MGI E;  2C7H A;  4W9E A;  4YL8 A;  1R4N I;  1ZW7 A;  1YX5 B;  1WI0 A;  1WR1 A;  3RUI B;  3ZO5 B;  4GIV A;  2L7R A;  2JVC A;  2CS4 A;  1RFA A;  4BBN F;  1WJ4 A;  2L8J A;  3P2B A;  5J18 A;  4II3 B;  4KSK C;  3T8M A;  3ZW3 A;  4W9L A;  3DVG X;  1V86 A;  3EEC A;  1WY8 A;  4W9H A;  3UQB A;  2RPQ A;  4BOZ B;  4BVU C;  2DYM A;  4W9F A;  3IHP C;  4HJK A;  2JY6 A;  3KW5 B;  4MJS A;  2PPH A;  3C0R B;  3JYU A;  3TBL D;  3AXC A;  5J17 A;  1Z5S B;  2KTF A;  2KKC A;  1K8R B;  4KSL C;  4MSQ B;  1XT9 B;  1NBF C;  4LDT B;  1WX9 A;  3R3M A;  5E6O A;  3S2A A;  4W9K A;  3ZNG C;  2B3A A;  4IW0 A;  1KJT A;  3H7P B;  1CMX B;  2N1W A;  2MX2 A;  3V62 A;  3JVZ X;  4J6I A;  3WIM A;  1C1Y B;  1U4A A;  4E74 A;  2KFJ A;  2Z0D B;  4FLH A;  4NJ7 A;  1WGY A;  4WWN A;  5KHO A;  2BWE S;  4NJ6 A;  3PT2 B;  2WWZ A;  2BWF A;  3DDC B;  4EZL A;  1P3Q U;  3JSV A;  3H7S A;  2LGY A;  2MCN B;  3RYT A;  1GUA B;  1WE7 A;  2LXC A;  3PPA A;  2MBH A;  3N30 A;  3N32 A;  4GDK B;  4DDI D;  1OGW A;  2DZK A;  4PYU A;  5JHB A;  2D11 A;  3HIZ A;  4GXB A;  1WGH A;  4FJV B;  4KV2 A;  1WZ3 A;  4W9D A;  2C5L C;  2C60 A;  3TCA A;  2C7M B;  2EMS A;  2M0X A;  1J0G A;  2K8C A;  1BT0 A;  3B0A A;  4MEL A;  2FIF A;  3ZIM A;  4IG7 B;  3ZLZ A;  4MGY E;  5FR6 A;  3ZDT A;  5LXH A;  5DPW A;  2NPT A;  3PLV A;  3W1S C;  4WWO A;  2BPS A;  4FA6 A;  2D3G A;  2XK5 B;  2KHW B;  2KJR A;  2FCM A;  1MG8 A;  4ICV A;  2KDB A;  4GU2 A;  4HCP B;  5C23 A;  4WJP A;  3I3T B;  2K8H A;  1EUV B;  5HKH A;  3VH4 B;  5J2R A;  2JZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...