1WGDA

Solution structure of the ubl-domain of herp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GSSGSSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Homocysteine-responsive endoplasmic reticulum-resident ubiqu
publication title Solution structure of the Ubl-domain of Herp
rcsb
source organism Homo sapiens
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgdA00
4K1RB 4K7UA 1WY8A 2JT4B 1V5OA 2N9PC 2ASQA 3PREA 2JPHA 1NI2A 2IY0B 3PRPB 3VTVA 4MELA 1WM3A 3WA0A 4BBNF 2K1FA 1I35A 1IYFA 4IWPA 4GIVA 3VAWA 3ZNID 3PGEA 3PLVA 3NOBA 3PTFC 3T8MA 3SU8X 4BBNC 1K8RB 5GMVA 2MBBB 3A9KA 2KZRA 3TIXA 4MH0E 1V49A 2KDBA 2ZJDA 4NAWB 2J7QB 2L8JA 2DZIA 2D3GA 3IVFA 4K7WA 1T0YA 4KIKA 5FR6A 2IZVB 1V81A 2CKHB 2GMIC 2GBMA 2R2OA 3AI5A 1WRDB 1WZ0A 2LRUA 2DX5B 2WX1A 2W9NA 3QHTA 3ZUNA 2L3ZA 2C60A 2K6DB 2N7EA 2IO3B 3N32A 4WWPA 1V86A 5C23A 1ZKHA 2MBOA 3N30A 2Z59B 4M0WB 2MX2A 1Z2MA 4KVGB 2A4ZA 3WAOA 1XQQA 1WGGA 1H4RA 1ZW7A 4PS3A 4GSWA 5DPWA 5E6NA 1P1AA 1EO6A 3ZNZB 3M63B 4EZKA 2MW5A 4GB9A 3TMPB 4CO7A 3Q3FA 1CMXB 4IC7B 2JXXA 3QCAA 4FA6A 1J0GA 4JL9A 3UIPB 4ZDVA 5CHWA 4HPMB 2KJ6A 4DBGA 2G4SA 2MQJA 1UGMA 2DAFA 4MGZE 2KK8A 3R7QA 4CYEA 1WR6E 1WR1A 2NCNA 2K39A 5KHOA 2V1YA 3HHMA 1WGRA 2M8SA 4KDLB 1TTNA 1G6JA 3EHVA 4IW0A 5DPRA 1WJ4A 4LCDE 3UINB 2MBQA 3VTWA 2L00B 3I3TB 3JSVB 3AU5A 3QA8A 4FADA 2J0JA 3ML9A 4IM2A 4LDTB 5E6OA 2L76A 2Y5BB 3MTNB 3VTUA 3APFA 3ZRCA 2BKRB 3DBRI 4N9F4 4TV3A 4BVUC 1GUAB 4EZLA 3WAMA 2ZZPB 3VXWA 4IWQA 2NBVB 4IUMB 4FN2A 2LZ6A 2NPTB 3C0RB 4FJVB 4ANUA 2AL6A 3PVLA 5C1ZA 3WIMA 3L10B 4P7IA 3ECIA 4I6NB 3BY4B 2LRWA 2JVCA 3JW0X 4NJ7A 3CSTA 2JUOA 2FCMA 1LM8B 2C7HA 3A9KB 2IY1B 2L0FA 2LD9A 2KX3A 1KM7A 3HM6X 3ZIMA 1PQSA 1I42A 3WALA 2KANA 2KFKB 1P3QU 3QC8B 4G11A 2GBNA 3R3MA 3QIJA 3U8ZA 3KYDD 2GOWA 1XD3B 3UGBB 2DZJA 3ZO5B 4AOFA 4G50A 1E8WA 4G0NB 4A3OA 2N4FA 1P9DU 2L0TA 2BPSA 3AULA 3H7PB 2WDTB 1NBFC 3M95A 1WE6A 4GGQA 3W1SA 3WANA 5IA7A 1D3ZA 1UZXB 3UQBA 2KX0A 4GMVA 1GNUA 1X1MA 4BKSA 4RM9A 3HM3A 4NQKE 3ZDTA 2BKFA 2FCSA 3DVNU 3HIZA 4HPLB 3EFUA 3H9DA 4FJZA 4KDIC 3R7RA 5KHQA 1E5WA 2IYDB 1OEYJ 4M8NA 4GDLA 1Z5SB 3EECA 1V80A 2PPHA 4MGIE 5AZHA 4KSLC 2KNBA 4URKA 5LLIA 1F9JA 3PLUA 3ZTDA 1RFAA 3ENEA 1NDDA 4HJKA 1WI0A 2ZNVC 3A9JA 5EDSA 2KDFB 2NPTA 1S1QB 4AP4C 3RD2A 4A3PA 2LGXA 2B3AA 3V6CB 1UD7A 3APDA 5CTRC 1WJUA 2OOBB 4XC2A 3VQIA 1VCBA 1R4MI 3TL5A 1HE8A 2LASA 3A4RA 3NHEB 4ZYNA 3MHSD 4G3XB 1L7YA 2KMCA 4HDQA 3DBLI 4AJWA 3NZSA 1WGDA 2DENB 2KFKA 3CSFA 4F7ZA 2KWCA 3PS6A 2KJRA 3GZNI 1YX5B 5CHFA 3RZWC 3JVZX 5AZGA 3CMMB 3U30A 4F1SA 4MGYE 2CR5A 2RD0A 3ZNGC 4W9HA 3ZKJC 2MLBA 5AZFA 2NS5A 3V61A 3VFKA 4ANXA 2MSED 3QAQA 5D7GA 3S2AA 3SHQA 3VH4B 3L54A 4HCPB 1WH3A 1WGYA 4TKNA 2L05A 5IAAC 3OLMD 3GOEA 2Z0EB 1WX8A 1E90A 1GG3A 2CHZA 3B0AA 3H7PA 4HXDA 1LXDA 3M62B 4ANWA 2FAZA 2J0MA 2C5LC 4GU2A 2N9EB 4WJQA 3R66C 3KVFB 2NR2A 3PSEB 2M0XA 4E74A 4KSKC 5LXHA 2LWPA 3B1LX 4NNJB 1ISNA 3PZDA 3KUDB 1XT9B 2BF8B 3OJ3A 4RMAA 4W9FA 4E71A 2YLMA 3ALBA 4GN1A 3DOWA 2M4NA 3V62A 1TZ1A 3K9OB 4BOZB 4FULA 3RUIB 1YD8U 4DHJD 2XEWA 3UIOB 2GBRA 1ZGUB 3EC8A 1WYWB 3QARA 4OVVA 4YL8A 4GDLB 3ZNHB 2LXCA 2O6VD 4WJNA 4WQOB 1Q1OA 3NS8A 3QJZA 2JZ3B 4BOSC 4ASWC 2KN5A 1WJ6A 2M1MA 3IG3A 2KHWB 3A9JB 1P98A 3ZRFA 4CHKA 2K8CA 3RULA 4EEWA 3IFWB 3UQAA 2DZKA 3IBEA 2K8BA 2N9XA 3V6EB 1V2YA 2WX0A 2C7MB 2MA9B 1BT0A 3M3JA 2EKEC 4DK5A 2DYOA 2XK5A 3DQVA 1E7UA 2MP2B 2WWZA 4NJ6A 1SIFA 2K8HA 2LVPA 1YX6B 4W9DA 2KTRA 1E8XA 2LUEA 2V4LA 4EUTA 4TUUA 5G2NA 1A5RA 2FUHB 2LGYA 1WX9A 1SGHA 4X57B 4II3B 1H8CA 2QHOA 1YIWA 2PEAA 2KDIA 1LQBA 2EMTA 4PS7A 4ANVA 3DBHI 5BO4B 4DHZB 5HKHA 2OJRA 2CHXA 4LJOB 1WXSA 2KC1A 4PYZA 3NZUA 3SDLC 1WIAA 4EZJA 1IP9A 1WGHA 3WAPA 4DHZE 2ZPNA 1MG8A 1WM2A 4J6IA 2GBJA 4W9LA 4B9KA 4WWNA 2AL3A 5DPTA 1KJTA 2DHZA 2R2QA 4BFRA 3DDCB 1GJZA 2MRPA 3AU4A 3KH0A 3VDZA 4MDKE 5LXIB 2BYFA 3QQ8B 3RCZA 1LFDA 2D2QA 3PT2B 2RSUA 2I1JA 3L16A 2KQSA 3H6NA 1AARA 1OEYA 2JF5A 3X23A 2JY6A 4F8CB 5G55A 2AEHA 3W1SC 2CHWA 4W9CA 3QWZB 2MBEA 2MCNB 4W9KA 1WZ3A 3DVGY 1KOTA 1OQYA 4KZCA 2YVCA 1C3TA 4MM3A 4TQ1A 4K7SA 1WXVA 4MSMB 2LXAA 3A33B 4HLEA 2IBIB 1JRUA 1P0RA 2FIDA 2PE6B 3OAWA 2REXA 2K25A 3O65B 4FLHA 5JH5C 3H7SA 1WF9A 3L08A 2O6VA 3A4SC 4MSQB 1GC6A 4A20A 4HDOA 1UELA 3PRZA 1WXAA 3DVGX 4JLCA 2FIFA 2KQ7A 2MP2A 2ZVNA 2KFJA 1EF5A 1RRBA 2HD5B 4HWIB 2JWZA 2MWSB 4WWOA 2NBUA 2ZCCA 3X0WA 1EUVB 2XK5B 1V6EA 4ZRIA 1TGZB 2IO0B 2RPQA 1YQBA 3T9LA 3RZFA 3RYTA 1RAXA 2KD0A 4IWOA 4KZ0A 1GC7A 3KYCD 2IO1B 2KTRB 3RT3B 2BYEA 2I1KA 2XBBC 1J8CA 4W9JA 2BGFA 4FHJA 5CHVC 1E8YA 3PRMB 3OJ4B 4HVBA 1M94A 4HK2A 1Q5WB 1WMHA 3PHXB 3ZVVA 4MEMA 4BKTA 3PV1A 2LJ5A 5J17A 4PYUA 2ZPYA 2KVRA 2D10A 3KUZA 2DYMA 4AJYB 2CS4A 3PHWB 2KWVB 1S3SG 4WAAA 3AXCA 4XZ4A 4GDKB 1WX7A 3N3KB 4ICUA 1UBIA 2JRIB 5JZEB 1RLFA 3QK0A 4MGKE 4ICVA 2C7NB 2L7RA 2LI5A 4EOYA 2KXJA 3KW5B 3H1UA 4HCNB 2KMAA 4W9EA 4TQ0A 4ZRKA 4DXAB 4B6WA 3VVWB 4JGHB 5AEKB 1VD2A 3SD5A 1V9JA 2NVUI 1U4AA 3PPAA 2UWQA 3A1QB 3ZW3A 2ZVOA 4BKSD 2V3SA 1IPGA 2HE7A 4MJSA 3IHPC 4E3CA 2WYQA 2KDEB 1WJNA 3K9PB 3U7DA 4DHJB 4LDTD 4XX5A 4AWJA 1FXTB 2M17A 5DCNA 2BYVE 2FNJB 3ML8A 4RM8A 3DBSA 4I6LB 2RGFA 2KLGA 2KC2A 2UYZB 3LJ3A 5D6JB 4EKUA 2BWES 2N1VA 2K6QA 2O6VB 4DDGD 4WJPA 4NY0A 2KTFA 5L83A 2KLCA 2O2VB 2VRRB 2KJHB 3DCGA 3NY5A 3ZLZA 2MBHA 4IM0A 2ZNVB 1QZEA 2GBKA 2G45B 2HJ8A 3QX1A 2HTHA 4EFOA 5J2RA 4OVUA 2ZCBA 4ZRJA 4DWFA 1UH6A 2FCQA 3D32A 3KUCB 2AWTA 3LDZE 2KOXA 3MJWA 4II2B 2G4DB 2D07B 1V5TA 3BINA 4NAWA 4NQLB 2JZZA 1Y8RC 2LVQA 2C9WB 2JRHA 3W1YA 5L95C 4AUQC 2DZMA 1UBQA 2N1WA 4GDKA 4K81A 1WMHB 3CF6E 1WFYA 4WJOA 1R4NI 3JYUA 2KO3A 3B08A 4JQWC 2PJHA 2D11A 5D2MB 4GOCA 2NBWB 2FCNA 3TCAA 3P2BA 4JIOU 2ZEQA 1E7VA 1C1YB 3DVNV 5JHAA 3ONSA 4KIKB 5J18A 3L17A 2BWFA 2RR9A 1SE9A 3UF8A 4DDID 1E8ZA 5JHBA 1OGWA 3VUXA 3VUWA 5TR5A 5D94A 3L0WB 1YJ1A 2Z0DB 4FJYA 3VUYA 3A1QA 4B95A 3HK0A 4NPNA 4PS8A 2LGDA 4W9IA 1Q0WB 3VH3B 3ZDMC 4W9GA 2N7DA 2PE9A 1L2NA 2CU1A 1KLVA 3DPDA 4FHKA 2DAJA 4IM3A 1WXMA 4BKGA 4M8MA 2KKCA 2LVOA 1J19A 3ZTCA 2AYOB 2J0KA 2DYBA 4GXBA 3TBLD 4LJPB 4MJSB 2KWUB 4KV2A 3V60A 4IG7B 5E6PA 1OTRB 5CX3A 3JSVA 2O2VA 1EF1A 2EMSA 4FBJB 1WE7A 2IO2B 3VHTC 1TBEA 3Q3JA 3APCA 3L13A 4I6PA 3TJPA 2G3QB 2A5UA 5DPSA
chains in the Genus database with same CATH superfamily
4K7UA 2JT4B 3SR6A 2K0PA 3AE6B 4ZHPA 1XCTL 4NJCA 3VTVA 4MELA 4GIVA 1SJED 3PLVA 3B9JA 3T8MA 3AEGB 3HUIA 1STEA 3A9KA 3ZXVA 2WP9B 4NAWB 4C4VA 4KIKA 1WRDB 2LRUA 3P4SB 2KWDA 3ZUNA 3VR8B 3ZYYX 2C60A 2N7EA 2IO3B 3N32A 3AEBB 4WURA 5C23A 2MBOA 2Z59B 1VZ6A 4KVGB 1JWMD 1WGGA 4PS3A 4GSWA 5E6NA 1P1AA 4CO7A 1YJIA 1RM6C 4IC7B 4FA6A 2WXIA 2Z8LA 5FKAC 3ZXRA 4C7ZA 1FIQA 2KJ6A 2G4SA 2JSVX 4ZHOA 2DAFA 4MGZE 2KK8A 2WHIA 2NCNA 2K39A 1TT5B 3GB1A 2M8SA 1G6JA 1QOGA 2J0JA 4LDTB 2Y5BB 3VTUA 3APFA 3ZRCA 4TV3A 3DWMA 3VXWA 4FJVB 1CJEA 2JUOA 2FUG1 1LM8B 1KM7A 3ZIMA 3UI3A 1P3QU 5HHDG 3EGRA 2GBNA 2E3TA 3QIJA 3U8ZA 3ZQ4A 1QILA 2QEJC 2L1AA 2WQYB 3AE3B 1J7BA 2WDTB 1WE6A 2INDC 1YOVB 3BVMA 4RM9A 3HIZA 3TEXA 4MACA 4KDIC 1FRDA 1E5WA 2OEDA 4HROA 2IGDA 3URYA 1WWTA 1P7FA 2AX5A 5LLIA 3ZTDA 1RFAA 2GRIA 2LUMA 2WXJA 3A9JA 3V05A 3AE9B 4A3PA 4M00A 1JWBD 1YN5A 3RN9C 3APDA 3BIID 5C2TB 3VQIA 2LASA 3NHEB 3MHSD 4G3XB 2KMCA 2WU5B 4AJWA 1N60A 2DENB 2KFKA 2KWCA 2Q5WD 3CMMB 1L0XB 4W9HA 3ZKJC 3T3OA 2MH7A 3VFKA 4O1NA 3QAQA 1VDVA 3S2AA 5MPOA 1WH3A 1WGYA 4LLGM 1WX8A 1E90A 3H7PA 3NG0A 4HPPA 2FAZA 1ZPSA 1T6BX 2C5LC 4GU2A 2ICIA 3MHZA 5LNK1 3PSEB 3AE8B 3GS2A 4E74A 4MH8A 1FCCC 3OJ3A 2OJWA 4RF1A 1IGCA 3ALBA 1TS3A 4GN1A 1A70A 3AECB 3ZJUA 3AE2B 4N6EB 1TZ1A 2V9HA 1CQVA 2W3RA 2XEWA 1ET6A 1SIJA 3BZDB 2LXCA 4MM3B 4WJNA 2K9XA 4K3CA 2M1MA 3IG3A 4ZOHC 3RULA 2CJOA 3UQAA 4BAXA 3IBEA 3V6EB 3C19A 5BYRA 3M3JA 2XK5A 3DQVA 4H2AA 3ETRA 2LVPA 2BS3B 2V4LA 2FUHB 3RNBC 1WX9A 1C4PA 3TEWA 3W9CB 2PEAA 2EMTA 1V1PA 1E6EB 3DBHI 1J7AA 1VLBA 1WXSA 1FD6A 3SDLC 4EZJA 3NZUA 1TS4A 2ZPNA 1WM2A 4J6IA 2AL3A 1KJTA 2DHZA 2DBYA 1F2RI 3KH0A 4MDKE 5LXIB 2BYFA 3QQ8B 3IAM1 1AARA 3FKYA 2JF5A 4ZRQA 1SE4A 3QWZB 1WZ3A 4TQ1A 2LXAA 3A33B 4S0RA 1P0RA 3O65B 2VH2A 1AN8A 2I2YA 1WF9A 2LEKA 1GB1A 2KQ7A 2N0SB 2MP2A 2ZVNA 1I4XA 2JWZA 2MJEA 4WWOA 4MT5A 1C4AA 3X0WA 4YTPB 4ZRIA 5IOIA 1YQBA 2BBCA 4IWOA 2KD0A 3BVGA 4KZ0A 2IO1B 2QJLA 3N9YC 2BGFA 5CHVC 1WGKA 1I4QA 3FC4A 3PZ8A 4HVBA 1M94A 1Q5WB 4KGTA 4GLSC 1JQ4A 2LJ5A 3KUZA 3EA6A 4XZ4A 4ICUA 1UBIA 4KGRA 3OG5A 2KMAA 4DXAB 2H88B 3RNCC 3SD5A 5EE1A 2ZW1A 1ZUD2 3A1QB 1TY0A 2ZVOA 1WJNA 3K9PB 1TIFA 4DHJB 4XX5A 5DCNA 4OW0A 3DBSA 4I6LB 2RGFA 1VJKA 1E9MA 2N1VA 1Y56A 2O6VB 3L4PA 4DDGD 2AQ1B 4IM0A 2GBKA 2G45B 3IXSA 4DQOC 2BT6A 4EFOA 2KVZA 3LDZE 2KOXA 2X38A 3AM9A 1Y8RC 2KACA 2WXOA 2DZMA 2N1WA 4WH4A 2QSDA 3B08A 2WXHA 3Q8BA 2FCNA 4C4VB 2J4XA 1CK1A 5JHAA 4KIKB 3L17A 4DDID 1E8ZA 4US9A 4QAYA 3T3NA 1P7EA 5AUIA 3HK0A 4W9IA 1Q0WB 3VH3B 4W9GA 2CU1A 1KLVA 4FHKA 2DLBA 3AEAB 1J19A 2BVCA 2WS3B 2L52A 3AEDB 4IG7B 3Q3OC 4N59A 1EF1A 2IO2B 3Q3JA 4I6PA 2QMTA 2A5UA 1MG4A 1YN3A 1WY8A 2ASQA 3PREA 1NI2A 1HTOA 3PRPB 1TKEA 2K1FA 3OWEB 3ZNID 2NMQA 4A55A 3IT6B 3SU8X 3MC8A 4BBNC 1K8RB 2KZRA 1V49A 2X8XX 1MVKA 3IVFA 4K7WA 1T0YA 1HXYD 1DOXA 2W9NA 4L1BA 2L3ZA 2K6DB 4WWPA 1FPYA 1AWDA 1JWSD 1Z2MA 1XQQA 2E6XA 4P6VF 1F0ZA 1YNTE 3Q3NC 1I4RA 2B76B 1NENB 3Q3FA 3KWLA 1J0GA 4JL9A 3UIPB 5CHWA 2J53A 1V8CA 4CYEA 1WR6E 3GE3C 2V3NA 1L0VB 3HHMA 1WGRA 2MBQA 2L00B 4FADA 3JSVB 3AU5A 1EM7A 4IM2A 5E6OA 1N6ZA 3MTNB 2BKRB 3DBRI 4IKGA 3TSSA 2WDRB 1QOAA 2NBVB 2TSSA 4FN2A 3C0RB 2IJ0A 2N9LA 2AL6A 3E9SA 3PVLA 3BK1A 4P7IA 3RNAC 1C4CA 3CSTA 4IDIA 2I38A 3DHIC 1WYGA 2IY1B 2L0FA 2LD9A 3HM6X 2HDEA 2KANA 2KFKB 3FILA 4M0WA 3QC8B 1WXQA 3Q6BA 1YMHE 3EFCA 2GOWA 1XD3B 4JE3B 2DZJA 1JROA 3ZO5B 4G50A 2PVOD 4A9AA 4A3OA 4TSSA 2N4FA 2L0TA 3AULA 1E10A 3VR9B 1GB4A 3H7PB 3BWUD 5IA7A 3UQBA 2KX0A 1GNUA 1X1MA 3ZDTA 3W5VB 2NTSA 2FCSA 4HPLB 3EFUA 3H9DA 2JQRB 4GDLA 3EECA 1V80A 3Q8EA 2SEBD 4MGIE 2KNBA 1RFKA 4AP4C 3Q14C 3DBHB 4JX1C 2B3AA 3V6CB 1UD7A 5CTRC 1N61A 1SE2A 1R4MI 4ZYNA 3U4EG 2INCC 3N1XC 5I4DA 2IDYA 3NZSA 4F7ZA 2RMMA 3PS6A 2KJRA 4UDUC 3GZNI 5CHFA 4F1SA 2PW9A 4MGYE 1UF0A 1TJEA 4ANXA 2NS5A 5D7GA 4HCPB 1FXAA 2L05A 3OLMD 1WSPA 3B0AA 1GG3A 4HXDA 4ANWA 2WXGA 2J0MA 2WXPA 2UU7A 3R66C 3KVFB 2M0XA 1FM0D 3MFGA 4FXCA 1ISNA 3PZDA 4XDDA 3SFDB 4E71A 2YLMA 2VH1A 1XLPA 3H8HA 1LO5D 3N1YC 1YD8U 2GBRA 1ZGUB 3EC8A 4OVVA 4TMAB 4YSXB 1Q1OA 1K50A 3QJZA 2KN5A 1BUIC 3DWGC 3ZRFA 1OQQA 2K8CA 1SXTA 2DZKA 2N9XA 1HQRD 3J9CA 1V2YA 2WX0A 3BYYB 2EKEC 4DK5A 1QQRA 3AB5A 5JXVA 1E7UA 2MP2B 4NJ6A 2GI9A 1L4DB 2K8HA 1VZ8A 4II3B 3P4PB 1LQBA 3Q3MC 4PS7A 1BMLC 3R2IA 2KC1A 1IP9A 4DHZE 2ZW0A 1AW7A 4W9LA 4B9KA 5DPTA 4A8XC 2MRPA 2PLPA 3VDZA 1OFFA 4YT0B 1TY2A 2WGSA 3ZGZA 1OEYA 3TJPA 2AEHA 2ONQA 5EE9A 2D3BA 2YEPB 4B0EA 4KZCA 4K7SA 1XF5L 4HLEA 2BQQA 1D5ZC 2WXNA 1N63A 2IBIB 1MJDA 3MP9A 2PE6B 3OAWA 1FRRA 1TKGA 2W54A 5H8YE 1GC6A 4A20A 3PO0A 1PGAA 2FIFA 1FNVA 1EF5A 4HWIB 2MWSB 2ZCCA 4RF0A 2WDQB 2V0GA 3RYTA 1RAXA 3LXFA 2G9HD 3KYCD 1B1ZA 2KTRB 1J8CA 1WRIA 3I63C 3W2DA 1WMHA 3PHXB 1LGRA 4MEMA 3IT4B 2ZPYA 2KVRA 1ACCA 2CS4A 3PHWB 4WAAA 3AXCA 4HEA1 3N3KB 4AQ7A 1UUPA 4XDCA 3BVZA 2DNFA 4ZYSA 1TYGB 2C7NB 2L7RA 2LI5A 4EOYA 2KXJA 3KW5B 3H1UA 1V9JA 2K5PA 2NVUI 1U4AA 3PPAA 2QC8A 1IPGA 4MJSA 2QDFA 4RCOA 2BYVE 2KLGA 4NY0A 1MHHE 2VRRB 3NY5A 3DCGA 3ZLZA 1NYQA 3QX1A 2HTHA 3I9V1 5J2RA 2MJDA 2LGIA 3KUCB 2G4DB 2BW2A 2LHDA 4NAWA 2LVQA 1RYJA 2JRHA 3AN1A 3RNEC 1C76A 2PKOA 4WJOA 3JYUA 2KO3A 2D11A 2NBWB 3SEBA 1C1YB 1N62A 3DVNV 4LNNA 2M0AA 3ONSA 5J18A 4M01A 3UF8A 5JHBA 1OGWA 3VUXA 1QKZA 3L0WB 2Z0DB 1KH0A 4PS8A 2LGDA 3SFEB 2SAKA 5H92C 2KAJA 3DBRB 2BTEA 4BKGA 3V3XA 2KKCA 4US8A 4JPSA 1FXIA 4YTMB 1SJHD 4KV2A 4WQMA 5E6PA 1OTRB 2O2VA 4YTNB 1KLUD 3VHTC 3L13A 1V5OA 3U52E 1DOYA 1IBXA 2IY0B 3HVDA 4A90A 4KGSA 4J3OD 1WM3A 3WA0A 1IYFA 3VAWA 3ZJVA 3NOBA 3PTFC 2IGGA 3RPFC 5BYSA 3TIXA 2DZIA 2D3GA 4YSYB 2CKHB 1QOBA 2GMIC 2GBMA 2JX5A 1ESFA 2DX5B 3QHTA 3NVVA 1DYQA 1V86A 1QOFA 3N30A 3NRZA 4M0WB 2MX2A 3MC0B 2A4ZA 1C77A 1ZW7A 2W55A 1IGDA 4EZKA 2MW5A 4GB9A 3TMPB 1KTKA 3N1ZC 1CMXB 2WDVB 3R2TA 3QCAA 4ZDVA 4WWMA 2MQJA 1UGMA 3NS1A 3R7QA 1R4MB 3AE1B 4RNAA 1VR9A 1FMAD 1TTNA 4IW0A 4LCDE 3UINB 3VTWA 2LMCA 3I3TB 3QA8A 1PYWD 3GZNB 2HJ1A 2FE8A 3RNFC 2L76A 4N9F4 5EE0A 4BVUC 1GUAB 4EZLA 1K52A 4IUMB 1T0RC 2LZ6A 3P63A 3O13A 4ANUA 1MHXA 2W82A 5C1ZA 3L10B 3ECIA 4I6NB 1MPEA 2LRWA 2FCMA 1EU3A 3A9KB 1PGXA 1PDXA 1JRPA 2JU6X 3UGBB 4AOFA 1E8WA 4G0NB 4JWSC 1P9DU 2BPSA 4XWWA 1NBFC 5IO9A 2VZKD 3M95A 3RFZB 4GGQA 1UZXB 3LYYA 4KKIA 4NQKE 4FJZA 3TEZA 1GPXA 2LJIA 3R8BA 5KHQA 1OEYJ 1Z5SB 2BB6A 2PIAA 5AZHA 4KSLC 3I5JC 3ENEA 1NDDA 3TEYA 2ZNVC 2NPTA 1VZ7A 3RD2A 2LGXA 1T0SC 1L4ZB 1WJUA 3AEFB 3VRBB 5BMHA 1VCBA 1HE8A 5FR3A 3C8YA 1IUEA 4HDQA 3RNGC 1WGDA 3CSFA 1YX5B 3RZWC 3JVZX 2QCZA 4RGOS 2CR5A 3ZNGC 1SE3A 2QIEB 2MSED 4TKNA 5IAAC 3GOEA 2Z0EB 2CHZA 4HKQA 2DWQA 1LXDA 3M62B 4WIPA 2N9EB 1CZPA 3B1LX 3KWVA 1I4HA 4LNIA 2BF8B 4NZLB 4W9FA 2IPKD 3DOWA 4JWUC 4USAA 3V62A 1QLBB 3K9OB 4BOZB 3RUIB 1F77A 4OZBA 3EUB2 1PGBA 4S17A 2JWUA 4B0MA 4OHJA 1TZOA 2H89B 1D5XC 4ASWC 1WJ6A 4CHKA 3A9JB 1GOZA 2C7MB 2MA9B 1BT0A 1HZ6A 2DYOA 1FNUA 3LB8C 1FFUA 2N7JA 4DXFA 2WWZA 1D4BA 2JYEA 1YX6B 2KYWA 1TS5A 4XYCA 2WXKA 4TUUA 5G2NA 1C78A 1A5RA 2LGYA 1SGHA 1YIWA 2KDIA 4ANVA 4DHZB 1E7PB 5HKHA 2CHXA 4PT5A 4LJOB 1WIAA 3WAPA 2WXLA 2GBJA 4WWNA 2R2QA 4BFRA 2K3UA 1FFVA 3AU4A 4P16A 1TS2A 2I1JA 3L16A 3H6NA 1B9RA 1T0QC 3P1MA 1PUTA 2CHWA 4W9CA 3NUHB 2MCNB 4W9KA 1KOTA 1C3TA 2YVCA 2LHEA 1WXVA 4MSMB 2WXFA 4D2KA 1JW9D 4KKJA 1JRUA 1SEBD 1C79A 2K25A 4C00A 4FLHA 5JH5C 3L08A 1JALA 2O6VA 2JYTA 3A4SC 4MSQB 4YXDB 1UELA 1L5PA 1RRBA 2HD5B 2L83A 4RGNA 2NBUA 1EUVB 3Q69A 2XK5B 1V6EA 1TGZB 2RPQA 1KF6B 1YQ3B 1ET9A 3RZFA 3NZ3A 1FEHA 1GC7A 2BYEA 2I1KA 2XBBC 2Y3AA 2GB1A 4FHJA 1E8YA 3OJ4B 4HK2A 1HTQA 3NVYA 1V1PB 3NVWA 3PV1A 4AJYB 3WCQA 2KWVB 1WX7A 5JZEB 1RLFA 2PTLA 3HVZA 1YJJA 3QK0A 2EELA 5E6JA 4W9EA 2MEKA 2LFIA 4TQ0A 4ZRKA 1J7CA 4B6WA 2KDMA 4JGHB 1JCKB 5AEKB 1VD2A 5GXGB 1R7SA 4BKSD 2V3SA 2INPE 2WYQA 2KDEB 4LDTD 4AWJA 1E0ZA 1FXTB 2M17A 2KC2A 1ZDVA 4EKUA 2BWES 2K6QA 3DBLB 1MFWA 1BXTA 2KLCA 2O2VB 2J52A 2WLBA 2ZNVB 2AQ3B 4BZAA 1KFYB 4OVUA 1UH6A 2FCQA 3D32A 1IBXB 3MJWA 4OZAA 2D07B 2MJ3A 4NQLB 5BMIA 3AE5B 3W1YA 4GDKA 3CF6E 4JQWC 5IN7A 2PJHA 3Q2AC 5D2MB 1E7VA 3B2GA 1HZ5A 1I7HA 1SB3C 1SE9A 3KQ4A 4REZA 3VUWA 5TR5A 5D94A 1YJ1A 3NJTA 1NEKB 4B95A 2N7DA 2PE9A 3TUOA 4RGMA 4IM3A 1WXMA 1T3QA 4M8MA 3ZTCA 2LVOA 2DYBA 4GXBA 3TBLD 4LJPB 4OZCA 3JSVA 2D3AA 3APCA 2J42A 5DPSA 4K1RB 4ITKA 4CQNA 2N9PC 4A6QA 2JPHA 5TSSA 1FO4A 2V4IB 4PK1A 3AEEB 4BBNF 1I35A 4IWPA 5HFYA 3PGEA 2ON8A 2RPVA 5GMVA 2MBBB 1SSNA 5T8IA 3ABVB 4MH0E 1ROEA 2KDBA 2ZJDA 2J7QB 2L8JA 5FR6A 2ACZB 4ARCA 2IZVB 1XEEA 1V81A 2CU3A 2R2OA 3AI5A 1WZ0A 2WX1A 3AV8A 2QILA 1VRAB 1L0YB 4LK0M 2YEPF 1ZKHA 3WAOA 1DOIA 1H4RA 1UGJA 5DPWA 1EO6A 1ZXIA 3ZNZB 3M63B 2JXXA 3NVZA 4HPMB 1ZOYB 4DBGA 4HRSA 3HRDD 1WR1A 2OHFA 5KHOA 2V1YA 1ENFA 1N5XA 4KDLB 3EHVA 5DPRA 1WJ4A 4C80A 3ML9A 1NI3A 3FAHA 2MHJA 4M02A 4P1BC 3WAMA 2ZZPB 3BYTB 4IWQA 2NPTB 3AH7A 2Y5CA 4K3BA 2N9KA 3WIMA 2KMMA 1NVID 3P42A 3BY4B 1UWXA 2JVCA 3JW0X 4NJ7A 2AQ2B 2C7HA 2V3PA 2WNMA 2RDGA 5G5HA 2KX3A 1I42A 1EWYC 1PQSA 1ZXHA 4XE0A 4WAFA 3WALA 2Y5PA 4G11A 5HG2A 3VRAB 2PVGC 3MC9A 3R3MA 3KYDD 2JXTA 2K22A 1JWUD 2KN4A 1L6UA 3W1SA 3WANA 5C3JB 1D3ZA 1FCLA 4GMVA 4R3DA 4BKSA 3HM3A 2BKFA 3DVNU 3I57A 3R7RA 4M8NA 2IYDB 2PPHA 1HA5A 4URKA 1F9JA 3PLUA 4EE2A 4HJKA 1WI0A 5EDSA 2PMVA 2KDFB 1S1QB 5FK9C 2RDHA 4XC2A 2OOBB 2LGSA 1V1OA 1V97A 1SBBB 3TL5A 3A4RA 1R4NB 1N5WA 1L7YA 3DBLI 5AZGA 3U30A 1YQ4B 2RD0A 4P1CC 4HJGE 2MLBA 5AZFA 3V61A 2WU2B 3SHQA 3VH4B 3L54A 3FILB 1QF6A 3RMKC 4LNFA 3Q8CA 4HKZE 1PFDA 4XWTA 3GE8C 4WJQA 2NR2A 1I4PA 1ZDXA 2LWPA 4KSKC 4Q2JA 5LXHA 4NNJB 1D6EC 3KUDB 1QT9A 1XT9B 1NYRA 4RMAA 1RWSA 3Q8AA 1XXGA 2M4NA 4FULA 4DHJD 3UIOB 1WYWB 3QARA 2KT7A 4YL8A 4GDLB 3ZNHB 2O6VD 4WQOB 3NS8A 1DGJA 4BOSC 2JZ3B 1ZE3D 2KHWB 1P98A 4EEWA 3IFWB 1FNWA 2K8BA 1GAQB 5IP4D 2KQ4X 4LNKA 5BYQA 1SIFA 1F2RC 1XLNA 1TKYA 4W9DA 2KTRA 3Q8FA 2BB5A 1E8XA 2LUEA 4EUTA 1SF0A 4X57B 1H8CA 5IKCM 2QHOA 1YN4A 5BO4B 4RFBA 2OJRA 4PYZA 1WGHA 5D3IB 1MG8A 2JZPA 3AMZA 2FBWB 1K53A 3DDCB 4YSZB 1JWAD 1GJZA 5EE3A 1ZP0B 3RCZA 1LFDA 2D2QA 2W3SA 3PT2B 2RSUA 2KQSA 4C7YA 3X23A 2JY6A 4F8CB 5G55A 3W1SC 1XO3A 4LNOA 2VZKB 2MBEA 4AS1A 3DVGY 1OQYA 4MM3A 4N58A 2XN9C 2FIDA 4L2YA 2REXA 3H7SA 2IGHA 3U2SC 3DHGC 4HDOA 3PRZA 4JLCA 1WXAA 3DVGX 4NAMA 2KFJA 2HTME 1MI0A 2RDBC 5BMGA 3DHHC 2IO0B 3CIRB 3T9LA 1F1HA 3RT3B 3P4QB 4W9JA 1UWMA 2NTTA 3PRMB 5G5GA 1XCQL 4RH6A 4RGTA 2WXRA 3ZVVA 4BKTA 5J17A 4PYUA 5D3DA 2D3CA 3W5UB 2INNE 2D10A 2DYMA 5HI1A 3P4RB 4OVZA 1S3SG 4GDKB 2JRIB 4IOIE 1UNSA 5AUKA 3B2FA 1XLOA 4MGKE 4ICVA 4L23A 1K51A 4HCNB 1D5MC 4XGAB 3VVWB 2CJNA 2EKIA 2UWQA 1XLQA 3ZW3A 3IAS1 2G1EA 3KLSX 2HE7A 3N20C 3IHPC 4E3CA 3U7DA 3AE7B 2FNJB 3ML8A 4RM8A 3BK2A 5D6JB 2UYZB 3LJ3A 2R61A 4WJPA 2WXMA 2KTFA 5L83A 2KJHB 1OQRA 4ACFA 2MBHA 1AYFA 2M56B 4C56C 1QZEA 2HJ8A 2ZCBA 4ZRJA 2XNAC 4DWFA 3PZ7A 2AWTA 2GLSA 1M4VA 4II2B 1HEZE 1V5TA 2D5GA 1JMLA 3CWIA 3BINA 2JZZA 2WXQA 3ZJTA 2C9WB 5L95C 4AUQC 1UBQA 4ARIA 3GP7A 3U7ZA 1C9FA 4K81A 1WMHB 4ZRPA 1WFYA 1R4NI 3TCAA 4GOCA 3P2BA 4JIOU 2ZEQA 2M19A 2BWFA 2RR9A 4DXGA 1KLGD 2BS4B 2BYTA 4FJYA 4KX6B 3VUYA 3RI7C 3A1QA 4NPNA 3ZDMC 1EWCA 2BS2B 3MJ5A 1L2NA 3DPDA 2DAJA 1KRHA 2AYOB 3AE4B 2J0KA 4MJSB 2KWUB 3V60A 5CX3A 4YWGG 1EU4A 4LTUA 2EMSA 4FBJB 1L6VA 1WE7A 1TBEA 1Q10A 2L32A 1F52A 1T5XD 3E56A 1I4GA 2G3QB
chains in the Genus database with same CATH topology
4K1RB 4K7UA 1WY8A 2JT4B 1V5OA 2N9PC 2ASQA 3PREA 2JPHA 1NI2A 2IY0B 3PRPB 3VTVA 4MELA 1WM3A 3WA0A 4BBNF 2K1FA 1I35A 1IYFA 4IWPA 4GIVA 3VAWA 3ZNID 3PGEA 3PLVA 3NOBA 3PTFC 3T8MA 3SU8X 4BBNC 1K8RB 5GMVA 2MBBB 3A9KA 2KZRA 3TIXA 4MH0E 1V49A 2KDBA 2ZJDA 4NAWB 2J7QB 2L8JA 2DZIA 2D3GA 3IVFA 4K7WA 1T0YA 4KIKA 5FR6A 2IZVB 1V81A 2CKHB 2GMIC 2GBMA 2R2OA 3AI5A 1WRDB 1WZ0A 2LRUA 2DX5B 2WX1A 2W9NA 3QHTA 3ZUNA 2L3ZA 2C60A 2K6DB 2N7EA 2IO3B 3N32A 4WWPA 1V86A 5C23A 1ZKHA 2MBOA 3N30A 2Z59B 4M0WB 2MX2A 1Z2MA 4KVGB 2A4ZA 3WAOA 1XQQA 1WGGA 1H4RA 1ZW7A 4PS3A 4GSWA 5DPWA 5E6NA 1P1AA 1EO6A 3ZNZB 3M63B 4EZKA 2MW5A 4GB9A 3TMPB 4CO7A 3Q3FA 1CMXB 4IC7B 2JXXA 3QCAA 4FA6A 1J0GA 4JL9A 3UIPB 4ZDVA 5CHWA 4HPMB 2KJ6A 4DBGA 2G4SA 2MQJA 1UGMA 2DAFA 4MGZE 2KK8A 3R7QA 4CYEA 1WR6E 1WR1A 2NCNA 2K39A 5KHOA 2V1YA 3HHMA 1WGRA 2M8SA 4KDLB 1TTNA 1G6JA 3EHVA 4IW0A 5DPRA 1WJ4A 4LCDE 3UINB 2MBQA 3VTWA 2L00B 3I3TB 3JSVB 3AU5A 3QA8A 4FADA 2J0JA 3ML9A 4IM2A 4LDTB 5E6OA 2L76A 2Y5BB 3MTNB 3VTUA 3APFA 3ZRCA 2BKRB 3DBRI 4N9F4 4TV3A 4BVUC 1GUAB 4EZLA 3WAMA 2ZZPB 3VXWA 4IWQA 2NBVB 4IUMB 4FN2A 2LZ6A 2NPTB 3C0RB 4FJVB 4ANUA 2AL6A 3PVLA 5C1ZA 3WIMA 3L10B 4P7IA 3ECIA 4I6NB 3BY4B 2LRWA 2JVCA 3JW0X 4NJ7A 3CSTA 2JUOA 2FCMA 1LM8B 2C7HA 3A9KB 2IY1B 2L0FA 2LD9A 2KX3A 1KM7A 3HM6X 3ZIMA 1PQSA 1I42A 3WALA 2KANA 2KFKB 1P3QU 3QC8B 4G11A 2GBNA 3R3MA 3QIJA 3U8ZA 3KYDD 2GOWA 1XD3B 3UGBB 2DZJA 3ZO5B 4AOFA 4G50A 1E8WA 4G0NB 4A3OA 2N4FA 1P9DU 2L0TA 2BPSA 3AULA 3H7PB 2WDTB 1NBFC 3M95A 1WE6A 4GGQA 3W1SA 3WANA 5IA7A 1D3ZA 1UZXB 3UQBA 2KX0A 4GMVA 1GNUA 1X1MA 4BKSA 4RM9A 3HM3A 4NQKE 3ZDTA 2BKFA 2FCSA 3DVNU 3HIZA 4HPLB 3EFUA 3H9DA 4FJZA 4KDIC 3R7RA 5KHQA 1E5WA 2IYDB 1OEYJ 4M8NA 4GDLA 1Z5SB 3EECA 1V80A 2PPHA 4MGIE 5AZHA 4KSLC 2KNBA 4URKA 5LLIA 1F9JA 3PLUA 3ZTDA 1RFAA 3ENEA 1NDDA 4HJKA 1WI0A 2ZNVC 3A9JA 5EDSA 2KDFB 2NPTA 1S1QB 4AP4C 3RD2A 4A3PA 2LGXA 2B3AA 3V6CB 1UD7A 3APDA 5CTRC 1WJUA 2OOBB 4XC2A 3VQIA 1VCBA 1R4MI 3TL5A 1HE8A 2LASA 3A4RA 3NHEB 4ZYNA 3MHSD 4G3XB 1L7YA 2KMCA 4HDQA 3DBLI 4AJWA 3NZSA 1WGDA 2DENB 2KFKA 3CSFA 4F7ZA 2KWCA 3PS6A 2KJRA 3GZNI 1YX5B 5CHFA 3RZWC 3JVZX 5AZGA 3CMMB 3U30A 4F1SA 4MGYE 2CR5A 2RD0A 3ZNGC 4W9HA 3ZKJC 2MLBA 5AZFA 2NS5A 3V61A 3VFKA 4ANXA 2MSED 3QAQA 5D7GA 3S2AA 3SHQA 3VH4B 3L54A 4HCPB 1WH3A 1WGYA 4TKNA 2L05A 5IAAC 3OLMD 3GOEA 2Z0EB 1WX8A 1E90A 1GG3A 2CHZA 3B0AA 3H7PA 4HXDA 1LXDA 3M62B 4ANWA 2FAZA 2J0MA 2C5LC 4GU2A 2N9EB 4WJQA 3R66C 3KVFB 2NR2A 3PSEB 2M0XA 4E74A 4KSKC 5LXHA 2LWPA 3B1LX 4NNJB 1ISNA 3PZDA 3KUDB 1XT9B 2BF8B 3OJ3A 4RMAA 4W9FA 4E71A 2YLMA 3ALBA 4GN1A 3DOWA 2M4NA 3V62A 1TZ1A 3K9OB 4BOZB 4FULA 3RUIB 1YD8U 4DHJD 2XEWA 3UIOB 2GBRA 1ZGUB 3EC8A 1WYWB 3QARA 4OVVA 4YL8A 4GDLB 3ZNHB 2LXCA 2O6VD 4WJNA 4WQOB 1Q1OA 3NS8A 3QJZA 2JZ3B 4BOSC 4ASWC 2KN5A 1WJ6A 2M1MA 3IG3A 2KHWB 3A9JB 1P98A 3ZRFA 4CHKA 2K8CA 3RULA 4EEWA 3IFWB 3UQAA 2DZKA 3IBEA 2K8BA 2N9XA 3V6EB 1V2YA 2WX0A 2C7MB 2MA9B 1BT0A 3M3JA 2EKEC 4DK5A 2DYOA 2XK5A 3DQVA 1E7UA 2MP2B 2WWZA 4NJ6A 1SIFA 2K8HA 2LVPA 1YX6B 4W9DA 2KTRA 1E8XA 2LUEA 2V4LA 4EUTA 4TUUA 5G2NA 1A5RA 2FUHB 2LGYA 1WX9A 1SGHA 4X57B 4II3B 1H8CA 2QHOA 1YIWA 2PEAA 2KDIA 1LQBA 2EMTA 4PS7A 4ANVA 3DBHI 5BO4B 4DHZB 5HKHA 2OJRA 2CHXA 4LJOB 1WXSA 2KC1A 4PYZA 3NZUA 3SDLC 1WIAA 4EZJA 1IP9A 1WGHA 3WAPA 4DHZE 2ZPNA 1MG8A 1WM2A 4J6IA 2GBJA 4W9LA 4B9KA 4WWNA 2AL3A 5DPTA 1KJTA 2DHZA 2R2QA 4BFRA 3DDCB 1GJZA 2MRPA 3AU4A 3KH0A 3VDZA 4MDKE 5LXIB 2BYFA 3QQ8B 3RCZA 1LFDA 2D2QA 3PT2B 2RSUA 2I1JA 3L16A 2KQSA 3H6NA 1AARA 1OEYA 2JF5A 3X23A 2JY6A 4F8CB 5G55A 2AEHA 3W1SC 2CHWA 4W9CA 3QWZB 2MBEA 2MCNB 4W9KA 1WZ3A 3DVGY 1KOTA 1OQYA 4KZCA 2YVCA 1C3TA 4MM3A 4TQ1A 4K7SA 1WXVA 4MSMB 2LXAA 3A33B 4HLEA 2IBIB 1JRUA 1P0RA 2FIDA 2PE6B 3OAWA 2REXA 2K25A 3O65B 4FLHA 5JH5C 3H7SA 1WF9A 3L08A 2O6VA 3A4SC 4MSQB 1GC6A 4A20A 4HDOA 1UELA 3PRZA 1WXAA 3DVGX 4JLCA 2FIFA 2KQ7A 2MP2A 2ZVNA 2KFJA 1EF5A 1RRBA 2HD5B 4HWIB 2JWZA 2MWSB 4WWOA 2NBUA 2ZCCA 3X0WA 1EUVB 2XK5B 1V6EA 4ZRIA 1TGZB 2IO0B 2RPQA 1YQBA 3T9LA 3RZFA 3RYTA 1RAXA 2KD0A 4IWOA 4KZ0A 1GC7A 3KYCD 2IO1B 2KTRB 3RT3B 2BYEA 2I1KA 2XBBC 1J8CA 4W9JA 2BGFA 4FHJA 5CHVC 1E8YA 3PRMB 3OJ4B 4HVBA 1M94A 4HK2A 1Q5WB 1WMHA 3PHXB 3ZVVA 4MEMA 4BKTA 3PV1A 2LJ5A 5J17A 4PYUA 2ZPYA 2KVRA 2D10A 3KUZA 2DYMA 4AJYB 2CS4A 3PHWB 2KWVB 1S3SG 4WAAA 3AXCA 4XZ4A 4GDKB 1WX7A 3N3KB 4ICUA 1UBIA 2JRIB 5JZEB 1RLFA 3QK0A 4MGKE 4ICVA 2C7NB 2L7RA 2LI5A 4EOYA 2KXJA 3KW5B 3H1UA 4HCNB 2KMAA 4W9EA 4TQ0A 4ZRKA 4DXAB 4B6WA 3VVWB 4JGHB 5AEKB 1VD2A 3SD5A 1V9JA 2NVUI 1U4AA 3PPAA 2UWQA 3A1QB 3ZW3A 2ZVOA 4BKSD 2V3SA 1IPGA 2HE7A 4MJSA 3IHPC 4E3CA 2WYQA 2KDEB 1WJNA 3K9PB 3U7DA 4DHJB 4LDTD 4XX5A 4AWJA 1FXTB 2M17A 5DCNA 2BYVE 2FNJB 3ML8A 4RM8A 3DBSA 4I6LB 2RGFA 2KLGA 2KC2A 2UYZB 3LJ3A 5D6JB 4EKUA 2BWES 2N1VA 2K6QA 2O6VB 4DDGD 4WJPA 4NY0A 2KTFA 5L83A 2KLCA 2O2VB 2VRRB 2KJHB 3DCGA 3NY5A 3ZLZA 2MBHA 4IM0A 2ZNVB 1QZEA 2GBKA 2G45B 2HJ8A 3QX1A 2HTHA 4EFOA 5J2RA 4OVUA 2ZCBA 4ZRJA 4DWFA 1UH6A 2FCQA 3D32A 3KUCB 2AWTA 3LDZE 2KOXA 3MJWA 4II2B 2G4DB 2D07B 1V5TA 3BINA 4NAWA 4NQLB 2JZZA 1Y8RC 2LVQA 2C9WB 2JRHA 3W1YA 5L95C 4AUQC 2DZMA 1UBQA 2N1WA 4GDKA 4K81A 1WMHB 3CF6E 1WFYA 4WJOA 1R4NI 3JYUA 2KO3A 3B08A 4JQWC 2PJHA 2D11A 5D2MB 4GOCA 2NBWB 2FCNA 3TCAA 3P2BA 4JIOU 2ZEQA 1E7VA 1C1YB 3DVNV 5JHAA 3ONSA 4KIKB 5J18A 3L17A 2BWFA 2RR9A 1SE9A 3UF8A 4DDID 1E8ZA 5JHBA 1OGWA 3VUXA 3VUWA 5TR5A 5D94A 3L0WB 1YJ1A 2Z0DB 4FJYA 3VUYA 3A1QA 4B95A 3HK0A 4NPNA 4PS8A 2LGDA 4W9IA 1Q0WB 3VH3B 3ZDMC 4W9GA 2N7DA 2PE9A 1L2NA 2CU1A 1KLVA 3DPDA 4FHKA 2DAJA 4IM3A 1WXMA 4BKGA 4M8MA 2KKCA 2LVOA 1J19A 3ZTCA 2AYOB 2J0KA 2DYBA 4GXBA 3TBLD 4LJPB 4MJSB 2KWUB 4KV2A 3V60A 4IG7B 5E6PA 1OTRB 5CX3A 3JSVA 2O2VA 1EF1A 2EMSA 4FBJB 1WE7A 2IO2B 3VHTC 1TBEA 3Q3JA 3APCA 3L13A 4I6PA 3TJPA 2G3QB 2A5UA 5DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1R B;  4K7U A;  1WY8 A;  2JT4 B;  1V5O A;  2N9P C;  2ASQ A;  3PRE A;  2JPH A;  1NI2 A;  2IY0 B;  3PRP B;  3VTV A;  4MEL A;  1WM3 A;  3WA0 A;  4BBN F;  2K1F A;  1I35 A;  1IYF A;  4IWP A;  4GIV A;  3VAW A;  3ZNI D;  3PGE A;  3PLV A;  3NOB A;  3PTF C;  3T8M A;  3SU8 X;  4BBN C;  1K8R B;  5GMV A;  2MBB B;  3A9K A;  2KZR A;  3TIX A;  4MH0 E;  1V49 A;  2KDB A;  2ZJD A;  4NAW B;  2J7Q B;  2L8J A;  2DZI A;  2D3G A;  3IVF A;  4K7W A;  1T0Y A;  4KIK A;  5FR6 A;  2IZV B;  1V81 A;  2CKH B;  2GMI C;  2GBM A;  2R2O A;  3AI5 A;  1WRD B;  1WZ0 A;  2LRU A;  2DX5 B;  2WX1 A;  2W9N A;  3QHT A;  3ZUN A;  2L3Z A;  2C60 A;  2K6D B;  2N7E A;  2IO3 B;  3N32 A;  4WWP A;  1V86 A;  5C23 A;  1ZKH A;  2MBO A;  3N30 A;  2Z59 B;  4M0W B;  2MX2 A;  1Z2M A;  4KVG B;  2A4Z A;  3WAO A;  1XQQ A;  1WGG A;  1H4R A;  1ZW7 A;  4PS3 A;  4GSW A;  5DPW A;  5E6N A;  1P1A A;  1EO6 A;  3ZNZ B;  3M63 B;  4EZK A;  2MW5 A;  4GB9 A;  3TMP B;  4CO7 A;  3Q3F A;  1CMX B;  4IC7 B;  2JXX A;  3QCA A;  4FA6 A;  1J0G A;  4JL9 A;  3UIP B;  4ZDV A;  5CHW A;  4HPM B;  2KJ6 A;  4DBG A;  2G4S A;  2MQJ A;  1UGM A;  2DAF A;  4MGZ E;  2KK8 A;  3R7Q A;  4CYE A;  1WR6 E;  1WR1 A;  2NCN A;  2K39 A;  5KHO A;  2V1Y A;  3HHM A;  1WGR A;  2M8S A;  4KDL B;  1TTN A;  1G6J A;  3EHV A;  4IW0 A;  5DPR A;  1WJ4 A;  4LCD E;  3UIN B;  2MBQ A;  3VTW A;  2L00 B;  3I3T B;  3JSV B;  3AU5 A;  3QA8 A;  4FAD A;  2J0J A;  3ML9 A;  4IM2 A;  4LDT B;  5E6O A;  2L76 A;  2Y5B B;  3MTN B;  3VTU A;  3APF A;  3ZRC A;  2BKR B;  3DBR I;  4N9F 4;  4TV3 A;  4BVU C;  1GUA B;  4EZL A;  3WAM A;  2ZZP B;  3VXW A;  4IWQ A;  2NBV B;  4IUM B;  4FN2 A;  2LZ6 A;  2NPT B;  3C0R B;  4FJV B;  4ANU A;  2AL6 A;  3PVL A;  5C1Z A;  3WIM A;  3L10 B;  4P7I A;  3ECI A;  4I6N B;  3BY4 B;  2LRW A;  2JVC A;  3JW0 X;  4NJ7 A;  3CST A;  2JUO A;  2FCM A;  1LM8 B;  2C7H A;  3A9K B;  2IY1 B;  2L0F A;  2LD9 A;  2KX3 A;  1KM7 A;  3HM6 X;  3ZIM A;  1PQS A;  1I42 A;  3WAL A;  2KAN A;  2KFK B;  1P3Q U;  3QC8 B;  4G11 A;  2GBN A;  3R3M A;  3QIJ A;  3U8Z A;  3KYD D;  2GOW A;  1XD3 B;  3UGB B;  2DZJ A;  3ZO5 B;  4AOF A;  4G50 A;  1E8W A;  4G0N B;  4A3O A;  2N4F A;  1P9D U;  2L0T A;  2BPS A;  3AUL A;  3H7P B;  2WDT B;  1NBF C;  3M95 A;  1WE6 A;  4GGQ A;  3W1S A;  3WAN A;  5IA7 A;  1D3Z A;  1UZX B;  3UQB A;  2KX0 A;  4GMV A;  1GNU A;  1X1M A;  4BKS A;  4RM9 A;  3HM3 A;  4NQK E;  3ZDT A;  2BKF A;  2FCS A;  3DVN U;  3HIZ A;  4HPL B;  3EFU A;  3H9D A;  4FJZ A;  4KDI C;  3R7R A;  5KHQ A;  1E5W A;  2IYD B;  1OEY J;  4M8N A;  4GDL A;  1Z5S B;  3EEC A;  1V80 A;  2PPH A;  4MGI E;  5AZH A;  4KSL C;  2KNB A;  4URK A;  5LLI A;  1F9J A;  3PLU A;  3ZTD A;  1RFA A;  3ENE A;  1NDD A;  4HJK A;  1WI0 A;  2ZNV C;  3A9J A;  5EDS A;  2KDF B;  2NPT A;  1S1Q B;  4AP4 C;  3RD2 A;  4A3P A;  2LGX A;  2B3A A;  3V6C B;  1UD7 A;  3APD A;  5CTR C;  1WJU A;  2OOB B;  4XC2 A;  3VQI A;  1VCB A;  1R4M I;  3TL5 A;  1HE8 A;  2LAS A;  3A4R A;  3NHE B;  4ZYN A;  3MHS D;  4G3X B;  1L7Y A;  2KMC A;  4HDQ A;  3DBL I;  4AJW A;  3NZS A;  1WGD A;  2DEN B;  2KFK A;  3CSF A;  4F7Z A;  2KWC A;  3PS6 A;  2KJR A;  3GZN I;  1YX5 B;  5CHF A;  3RZW C;  3JVZ X;  5AZG A;  3CMM B;  3U30 A;  4F1S A;  4MGY E;  2CR5 A;  2RD0 A;  3ZNG C;  4W9H A;  3ZKJ C;  2MLB A;  5AZF A;  2NS5 A;  3V61 A;  3VFK A;  4ANX A;  2MSE D;  3QAQ A;  5D7G A;  3S2A A;  3SHQ A;  3VH4 B;  3L54 A;  4HCP B;  1WH3 A;  1WGY A;  4TKN A;  2L05 A;  5IAA C;  3OLM D;  3GOE A;  2Z0E B;  1WX8 A;  1E90 A;  1GG3 A;  2CHZ A;  3B0A A;  3H7P A;  4HXD A;  1LXD A;  3M62 B;  4ANW A;  2FAZ A;  2J0M A;  2C5L C;  4GU2 A;  2N9E B;  4WJQ A;  3R66 C;  3KVF B;  2NR2 A;  3PSE B;  2M0X A;  4E74 A;  4KSK C;  5LXH A;  2LWP A;  3B1L X;  4NNJ B;  1ISN A;  3PZD A;  3KUD B;  1XT9 B;  2BF8 B;  3OJ3 A;  4RMA A;  4W9F A;  4E71 A;  2YLM A;  3ALB A;  4GN1 A;  3DOW A;  2M4N A;  3V62 A;  1TZ1 A;  3K9O B;  4BOZ B;  4FUL A;  3RUI B;  1YD8 U;  4DHJ D;  2XEW A;  3UIO B;  2GBR A;  1ZGU B;  3EC8 A;  1WYW B;  3QAR A;  4OVV A;  4YL8 A;  4GDL B;  3ZNH B;  2LXC A;  2O6V D;  4WJN A;  4WQO B;  1Q1O A;  3NS8 A;  3QJZ A;  2JZ3 B;  4BOS C;  4ASW C;  2KN5 A;  1WJ6 A;  2M1M A;  3IG3 A;  2KHW B;  3A9J B;  1P98 A;  3ZRF A;  4CHK A;  2K8C A;  3RUL A;  4EEW A;  3IFW B;  3UQA A;  2DZK A;  3IBE A;  2K8B A;  2N9X A;  3V6E B;  1V2Y A;  2WX0 A;  2C7M B;  2MA9 B;  1BT0 A;  3M3J A;  2EKE C;  4DK5 A;  2DYO A;  2XK5 A;  3DQV A;  1E7U A;  2MP2 B;  2WWZ A;  4NJ6 A;  1SIF A;  2K8H A;  2LVP A;  1YX6 B;  4W9D A;  2KTR A;  1E8X A;  2LUE A;  2V4L A;  4EUT A;  4TUU A;  5G2N A;  1A5R A;  2FUH B;  2LGY A;  1WX9 A;  1SGH A;  4X57 B;  4II3 B;  1H8C A;  2QHO A;  1YIW A;  2PEA A;  2KDI A;  1LQB A;  2EMT A;  4PS7 A;  4ANV A;  3DBH I;  5BO4 B;  4DHZ B;  5HKH A;  2OJR A;  2CHX A;  4LJO B;  1WXS A;  2KC1 A;  4PYZ A;  3NZU A;  3SDL C;  1WIA A;  4EZJ A;  1IP9 A;  1WGH A;  3WAP A;  4DHZ E;  2ZPN A;  1MG8 A;  1WM2 A;  4J6I A;  2GBJ A;  4W9L A;  4B9K A;  4WWN A;  2AL3 A;  5DPT A;  1KJT A;  2DHZ A;  2R2Q A;  4BFR A;  3DDC B;  1GJZ A;  2MRP A;  3AU4 A;  3KH0 A;  3VDZ A;  4MDK E;  5LXI B;  2BYF A;  3QQ8 B;  3RCZ A;  1LFD A;  2D2Q A;  3PT2 B;  2RSU A;  2I1J A;  3L16 A;  2KQS A;  3H6N A;  1AAR A;  1OEY A;  2JF5 A;  3X23 A;  2JY6 A;  4F8C B;  5G55 A;  2AEH A;  3W1S C;  2CHW A;  4W9C A;  3QWZ B;  2MBE A;  2MCN B;  4W9K A;  1WZ3 A;  3DVG Y;  1KOT A;  1OQY A;  4KZC A;  2YVC A;  1C3T A;  4MM3 A;  4TQ1 A;  4K7S A;  1WXV A;  4MSM B;  2LXA A;  3A33 B;  4HLE A;  2IBI B;  1JRU A;  1P0R A;  2FID A;  2PE6 B;  3OAW A;  2REX A;  2K25 A;  3O65 B;  4FLH A;  5JH5 C;  3H7S A;  1WF9 A;  3L08 A;  2O6V A;  3A4S C;  4MSQ B;  1GC6 A;  4A20 A;  4HDO A;  1UEL A;  3PRZ A;  1WXA A;  3DVG X;  4JLC A;  2FIF A;  2KQ7 A;  2MP2 A;  2ZVN A;  2KFJ A;  1EF5 A;  1RRB A;  2HD5 B;  4HWI B;  2JWZ A;  2MWS B;  4WWO A;  2NBU A;  2ZCC A;  3X0W A;  1EUV B;  2XK5 B;  1V6E A;  4ZRI A;  1TGZ B;  2IO0 B;  2RPQ A;  1YQB A;  3T9L A;  3RZF A;  3RYT A;  1RAX A;  2KD0 A;  4IWO A;  4KZ0 A;  1GC7 A;  3KYC D;  2IO1 B;  2KTR B;  3RT3 B;  2BYE A;  2I1K A;  2XBB C;  1J8C A;  4W9J A;  2BGF A;  4FHJ A;  5CHV C;  1E8Y A;  3PRM B;  3OJ4 B;  4HVB A;  1M94 A;  4HK2 A;  1Q5W B;  1WMH A;  3PHX B;  3ZVV A;  4MEM A;  4BKT A;  3PV1 A;  2LJ5 A;  5J17 A;  4PYU A;  2ZPY A;  2KVR A;  2D10 A;  3KUZ A;  2DYM A;  4AJY B;  2CS4 A;  3PHW B;  2KWV B;  1S3S G;  4WAA A;  3AXC A;  4XZ4 A;  4GDK B;  1WX7 A;  3N3K B;  4ICU A;  1UBI A;  2JRI B;  5JZE B;  1RLF A;  3QK0 A;  4MGK E;  4ICV A;  2C7N B;  2L7R A;  2LI5 A;  4EOY A;  2KXJ A;  3KW5 B;  3H1U A;  4HCN B;  2KMA A;  4W9E A;  4TQ0 A;  4ZRK A;  4DXA B;  4B6W A;  3VVW B;  4JGH B;  5AEK B;  1VD2 A;  3SD5 A;  1V9J A;  2NVU I;  1U4A A;  3PPA A;  2UWQ A;  3A1Q B;  3ZW3 A;  2ZVO A;  4BKS D;  2V3S A;  1IPG A;  2HE7 A;  4MJS A;  3IHP C;  4E3C A;  2WYQ A;  2KDE B;  1WJN A;  3K9P B;  3U7D A;  4DHJ B;  4LDT D;  4XX5 A;  4AWJ A;  1FXT B;  2M17 A;  5DCN A;  2BYV E;  2FNJ B;  3ML8 A;  4RM8 A;  3DBS A;  4I6L B;  2RGF A;  2KLG A;  2KC2 A;  2UYZ B;  3LJ3 A;  5D6J B;  4EKU A;  2BWE S;  2N1V A;  2K6Q A;  2O6V B;  4DDG D;  4WJP A;  4NY0 A;  2KTF A;  5L83 A;  2KLC A;  2O2V B;  2VRR B;  2KJH B;  3DCG A;  3NY5 A;  3ZLZ A;  2MBH A;  4IM0 A;  2ZNV B;  1QZE A;  2GBK A;  2G45 B;  2HJ8 A;  3QX1 A;  2HTH A;  4EFO A;  5J2R A;  4OVU A;  2ZCB A;  4ZRJ A;  4DWF A;  1UH6 A;  2FCQ A;  3D32 A;  3KUC B;  2AWT A;  3LDZ E;  2KOX A;  3MJW A;  4II2 B;  2G4D B;  2D07 B;  1V5T A;  3BIN A;  4NAW A;  4NQL B;  2JZZ A;  1Y8R C;  2LVQ A;  2C9W B;  2JRH A;  3W1Y A;  5L95 C;  4AUQ C;  2DZM A;  1UBQ A;  2N1W A;  4GDK A;  4K81 A;  1WMH B;  3CF6 E;  1WFY A;  4WJO A;  1R4N I;  3JYU A;  2KO3 A;  3B08 A;  4JQW C;  2PJH A;  2D11 A;  5D2M B;  4GOC A;  2NBW B;  2FCN A;  3TCA A;  3P2B A;  4JIO U;  2ZEQ A;  1E7V A;  1C1Y B;  3DVN V;  5JHA A;  3ONS A;  4KIK B;  5J18 A;  3L17 A;  2BWF A;  2RR9 A;  1SE9 A;  3UF8 A;  4DDI D;  1E8Z A;  5JHB A;  1OGW A;  3VUX A;  3VUW A;  5TR5 A;  5D94 A;  3L0W B;  1YJ1 A;  2Z0D B;  4FJY A;  3VUY A;  3A1Q A;  4B95 A;  3HK0 A;  4NPN A;  4PS8 A;  2LGD A;  4W9I A;  1Q0W B;  3VH3 B;  3ZDM C;  4W9G A;  2N7D A;  2PE9 A;  1L2N A;  2CU1 A;  1KLV A;  3DPD A;  4FHK A;  2DAJ A;  4IM3 A;  1WXM A;  4BKG A;  4M8M A;  2KKC A;  2LVO A;  1J19 A;  3ZTC A;  2AYO B;  2J0K A;  2DYB A;  4GXB A;  3TBL D;  4LJP B;  4MJS B;  2KWU B;  4KV2 A;  3V60 A;  4IG7 B;  5E6P A;  1OTR B;  5CX3 A;  3JSV A;  2O2V A;  1EF1 A;  2EMS A;  4FBJ B;  1WE7 A;  2IO2 B;  3VHT C;  1TBE A;  3Q3J A;  3APC A;  3L13 A;  4I6P A;  3TJP A;  2G3Q B;  2A5U A;  5DPS A; 
#chains in the Genus database with same CATH topology
 4K7U A;  2JT4 B;  3SR6 A;  2K0P A;  3AE6 B;  4ZHP A;  1XCT L;  4NJC A;  3VTV A;  4MEL A;  4GIV A;  1SJE D;  3PLV A;  3B9J A;  3T8M A;  3AEG B;  3HUI A;  1STE A;  3A9K A;  3ZXV A;  2WP9 B;  4NAW B;  4C4V A;  4KIK A;  1WRD B;  2LRU A;  3P4S B;  2KWD A;  3ZUN A;  3VR8 B;  3ZYY X;  2C60 A;  2N7E A;  2IO3 B;  3N32 A;  3AEB B;  4WUR A;  5C23 A;  2MBO A;  2Z59 B;  1VZ6 A;  4KVG B;  1JWM D;  1WGG A;  4PS3 A;  4GSW A;  5E6N A;  1P1A A;  4CO7 A;  1YJI A;  1RM6 C;  4IC7 B;  4FA6 A;  2WXI A;  2Z8L A;  5FKA C;  3ZXR A;  4C7Z A;  1FIQ A;  2KJ6 A;  2G4S A;  2JSV X;  4ZHO A;  2DAF A;  4MGZ E;  2KK8 A;  2WHI A;  2NCN A;  2K39 A;  1TT5 B;  3GB1 A;  2M8S A;  1G6J A;  1QOG A;  2J0J A;  4LDT B;  2Y5B B;  3VTU A;  3APF A;  3ZRC A;  4TV3 A;  3DWM A;  3VXW A;  4FJV B;  1CJE A;  2JUO A;  2FUG 1;  1LM8 B;  1KM7 A;  3ZIM A;  3UI3 A;  1P3Q U;  5HHD G;  3EGR A;  2GBN A;  2E3T A;  3QIJ A;  3U8Z A;  3ZQ4 A;  1QIL A;  2QEJ C;  2L1A A;  2WQY B;  3AE3 B;  1J7B A;  2WDT B;  1WE6 A;  2IND C;  1YOV B;  3BVM A;  4RM9 A;  3HIZ A;  3TEX A;  4MAC A;  4KDI C;  1FRD A;  1E5W A;  2OED A;  4HRO A;  2IGD A;  3URY A;  1WWT A;  1P7F A;  2AX5 A;  5LLI A;  3ZTD A;  1RFA A;  2GRI A;  2LUM A;  2WXJ A;  3A9J A;  3V05 A;  3AE9 B;  4A3P A;  4M00 A;  1JWB D;  1YN5 A;  3RN9 C;  3APD A;  3BII D;  5C2T B;  3VQI A;  2LAS A;  3NHE B;  3MHS D;  4G3X B;  2KMC A;  2WU5 B;  4AJW A;  1N60 A;  2DEN B;  2KFK A;  2KWC A;  2Q5W D;  3CMM B;  1L0X B;  4W9H A;  3ZKJ C;  3T3O A;  2MH7 A;  3VFK A;  4O1N A;  3QAQ A;  1VDV A;  3S2A A;  5MPO A;  1WH3 A;  1WGY A;  4LLG M;  1WX8 A;  1E90 A;  3H7P A;  3NG0 A;  4HPP A;  2FAZ A;  1ZPS A;  1T6B X;  2C5L C;  4GU2 A;  2ICI A;  3MHZ A;  5LNK 1;  3PSE B;  3AE8 B;  3GS2 A;  4E74 A;  4MH8 A;  1FCC C;  3OJ3 A;  2OJW A;  4RF1 A;  1IGC A;  3ALB A;  1TS3 A;  4GN1 A;  1A70 A;  3AEC B;  3ZJU A;  3AE2 B;  4N6E B;  1TZ1 A;  2V9H A;  1CQV A;  2W3R A;  2XEW A;  1ET6 A;  1SIJ A;  3BZD B;  2LXC A;  4MM3 B;  4WJN A;  2K9X A;  4K3C A;  2M1M A;  3IG3 A;  4ZOH C;  3RUL A;  2CJO A;  3UQA A;  4BAX A;  3IBE A;  3V6E B;  3C19 A;  5BYR A;  3M3J A;  2XK5 A;  3DQV A;  4H2A A;  3ETR A;  2LVP A;  2BS3 B;  2V4L A;  2FUH B;  3RNB C;  1WX9 A;  1C4P A;  3TEW A;  3W9C B;  2PEA A;  2EMT A;  1V1P A;  1E6E B;  3DBH I;  1J7A A;  1VLB A;  1WXS A;  1FD6 A;  3SDL C;  4EZJ A;  3NZU A;  1TS4 A;  2ZPN A;  1WM2 A;  4J6I A;  2AL3 A;  1KJT A;  2DHZ A;  2DBY A;  1F2R I;  3KH0 A;  4MDK E;  5LXI B;  2BYF A;  3QQ8 B;  3IAM 1;  1AAR A;  3FKY A;  2JF5 A;  4ZRQ A;  1SE4 A;  3QWZ B;  1WZ3 A;  4TQ1 A;  2LXA A;  3A33 B;  4S0R A;  1P0R A;  3O65 B;  2VH2 A;  1AN8 A;  2I2Y A;  1WF9 A;  2LEK A;  1GB1 A;  2KQ7 A;  2N0S B;  2MP2 A;  2ZVN A;  1I4X A;  2JWZ A;  2MJE A;  4WWO A;  4MT5 A;  1C4A A;  3X0W A;  4YTP B;  4ZRI A;  5IOI A;  1YQB A;  2BBC A;  4IWO A;  2KD0 A;  3BVG A;  4KZ0 A;  2IO1 B;  2QJL A;  3N9Y C;  2BGF A;  5CHV C;  1WGK A;  1I4Q A;  3FC4 A;  3PZ8 A;  4HVB A;  1M94 A;  1Q5W B;  4KGT A;  4GLS C;  1JQ4 A;  2LJ5 A;  3KUZ A;  3EA6 A;  4XZ4 A;  4ICU A;  1UBI A;  4KGR A;  3OG5 A;  2KMA A;  4DXA B;  2H88 B;  3RNC C;  3SD5 A;  5EE1 A;  2ZW1 A;  1ZUD 2;  3A1Q B;  1TY0 A;  2ZVO A;  1WJN A;  3K9P B;  1TIF A;  4DHJ B;  4XX5 A;  5DCN A;  4OW0 A;  3DBS A;  4I6L B;  2RGF A;  1VJK A;  1E9M A;  2N1V A;  1Y56 A;  2O6V B;  3L4P A;  4DDG D;  2AQ1 B;  4IM0 A;  2GBK A;  2G45 B;  3IXS A;  4DQO C;  2BT6 A;  4EFO A;  2KVZ A;  3LDZ E;  2KOX A;  2X38 A;  3AM9 A;  1Y8R C;  2KAC A;  2WXO A;  2DZM A;  2N1W A;  4WH4 A;  2QSD A;  3B08 A;  2WXH A;  3Q8B A;  2FCN A;  4C4V B;  2J4X A;  1CK1 A;  5JHA A;  4KIK B;  3L17 A;  4DDI D;  1E8Z A;  4US9 A;  4QAY A;  3T3N A;  1P7E A;  5AUI A;  3HK0 A;  4W9I A;  1Q0W B;  3VH3 B;  4W9G A;  2CU1 A;  1KLV A;  4FHK A;  2DLB A;  3AEA B;  1J19 A;  2BVC A;  2WS3 B;  2L52 A;  3AED B;  4IG7 B;  3Q3O C;  4N59 A;  1EF1 A;  2IO2 B;  3Q3J A;  4I6P A;  2QMT A;  2A5U A;  1MG4 A;  1YN3 A;  1WY8 A;  2ASQ A;  3PRE A;  1NI2 A;  1HTO A;  3PRP B;  1TKE A;  2K1F A;  3OWE B;  3ZNI D;  2NMQ A;  4A55 A;  3IT6 B;  3SU8 X;  3MC8 A;  4BBN C;  1K8R B;  2KZR A;  1V49 A;  2X8X X;  1MVK A;  3IVF A;  4K7W A;  1T0Y A;  1HXY D;  1DOX A;  2W9N A;  4L1B A;  2L3Z A;  2K6D B;  4WWP A;  1FPY A;  1AWD A;  1JWS D;  1Z2M A;  1XQQ A;  2E6X A;  4P6V F;  1F0Z A;  1YNT E;  3Q3N C;  1I4R A;  2B76 B;  1NEN B;  3Q3F A;  3KWL A;  1J0G A;  4JL9 A;  3UIP B;  5CHW A;  2J53 A;  1V8C A;  4CYE A;  1WR6 E;  3GE3 C;  2V3N A;  1L0V B;  3HHM A;  1WGR A;  2MBQ A;  2L00 B;  4FAD A;  3JSV B;  3AU5 A;  1EM7 A;  4IM2 A;  5E6O A;  1N6Z A;  3MTN B;  2BKR B;  3DBR I;  4IKG A;  3TSS A;  2WDR B;  1QOA A;  2NBV B;  2TSS A;  4FN2 A;  3C0R B;  2IJ0 A;  2N9L A;  2AL6 A;  3E9S A;  3PVL A;  3BK1 A;  4P7I A;  3RNA C;  1C4C A;  3CST A;  4IDI A;  2I38 A;  3DHI C;  1WYG A;  2IY1 B;  2L0F A;  2LD9 A;  3HM6 X;  2HDE A;  2KAN A;  2KFK B;  3FIL A;  4M0W A;  3QC8 B;  1WXQ A;  3Q6B A;  1YMH E;  3EFC A;  2GOW A;  1XD3 B;  4JE3 B;  2DZJ A;  1JRO A;  3ZO5 B;  4G50 A;  2PVO D;  4A9A A;  4A3O A;  4TSS A;  2N4F A;  2L0T A;  3AUL A;  1E10 A;  3VR9 B;  1GB4 A;  3H7P B;  3BWU D;  5IA7 A;  3UQB A;  2KX0 A;  1GNU A;  1X1M A;  3ZDT A;  3W5V B;  2NTS A;  2FCS A;  4HPL B;  3EFU A;  3H9D A;  2JQR B;  4GDL A;  3EEC A;  1V80 A;  3Q8E A;  2SEB D;  4MGI E;  2KNB A;  1RFK A;  4AP4 C;  3Q14 C;  3DBH B;  4JX1 C;  2B3A A;  3V6C B;  1UD7 A;  5CTR C;  1N61 A;  1SE2 A;  1R4M I;  4ZYN A;  3U4E G;  2INC C;  3N1X C;  5I4D A;  2IDY A;  3NZS A;  4F7Z A;  2RMM A;  3PS6 A;  2KJR A;  4UDU C;  3GZN I;  5CHF A;  4F1S A;  2PW9 A;  4MGY E;  1UF0 A;  1TJE A;  4ANX A;  2NS5 A;  5D7G A;  4HCP B;  1FXA A;  2L05 A;  3OLM D;  1WSP A;  3B0A A;  1GG3 A;  4HXD A;  4ANW A;  2WXG A;  2J0M A;  2WXP A;  2UU7 A;  3R66 C;  3KVF B;  2M0X A;  1FM0 D;  3MFG A;  4FXC A;  1ISN A;  3PZD A;  4XDD A;  3SFD B;  4E71 A;  2YLM A;  2VH1 A;  1XLP A;  3H8H A;  1LO5 D;  3N1Y C;  1YD8 U;  2GBR A;  1ZGU B;  3EC8 A;  4OVV A;  4TMA B;  4YSX B;  1Q1O A;  1K50 A;  3QJZ A;  2KN5 A;  1BUI C;  3DWG C;  3ZRF A;  1OQQ A;  2K8C A;  1SXT A;  2DZK A;  2N9X A;  1HQR D;  3J9C A;  1V2Y A;  2WX0 A;  3BYY B;  2EKE C;  4DK5 A;  1QQR A;  3AB5 A;  5JXV A;  1E7U A;  2MP2 B;  4NJ6 A;  2GI9 A;  1L4D B;  2K8H A;  1VZ8 A;  4II3 B;  3P4P B;  1LQB A;  3Q3M C;  4PS7 A;  1BML C;  3R2I A;  2KC1 A;  1IP9 A;  4DHZ E;  2ZW0 A;  1AW7 A;  4W9L A;  4B9K A;  5DPT A;  4A8X C;  2MRP A;  2PLP A;  3VDZ A;  1OFF A;  4YT0 B;  1TY2 A;  2WGS A;  3ZGZ A;  1OEY A;  3TJP A;  2AEH A;  2ONQ A;  5EE9 A;  2D3B A;  2YEP B;  4B0E A;  4KZC A;  4K7S A;  1XF5 L;  4HLE A;  2BQQ A;  1D5Z C;  2WXN A;  1N63 A;  2IBI B;  1MJD A;  3MP9 A;  2PE6 B;  3OAW A;  1FRR A;  1TKG A;  2W54 A;  5H8Y E;  1GC6 A;  4A20 A;  3PO0 A;  1PGA A;  2FIF A;  1FNV A;  1EF5 A;  4HWI B;  2MWS B;  2ZCC A;  4RF0 A;  2WDQ B;  2V0G A;  3RYT A;  1RAX A;  3LXF A;  2G9H D;  3KYC D;  1B1Z A;  2KTR B;  1J8C A;  1WRI A;  3I63 C;  3W2D A;  1WMH A;  3PHX B;  1LGR A;  4MEM A;  3IT4 B;  2ZPY A;  2KVR A;  1ACC A;  2CS4 A;  3PHW B;  4WAA A;  3AXC A;  4HEA 1;  3N3K B;  4AQ7 A;  1UUP A;  4XDC A;  3BVZ A;  2DNF A;  4ZYS A;  1TYG B;  2C7N B;  2L7R A;  2LI5 A;  4EOY A;  2KXJ A;  3KW5 B;  3H1U A;  1V9J A;  2K5P A;  2NVU I;  1U4A A;  3PPA A;  2QC8 A;  1IPG A;  4MJS A;  2QDF A;  4RCO A;  2BYV E;  2KLG A;  4NY0 A;  1MHH E;  2VRR B;  3NY5 A;  3DCG A;  3ZLZ A;  1NYQ A;  3QX1 A;  2HTH A;  3I9V 1;  5J2R A;  2MJD A;  2LGI A;  3KUC B;  2G4D B;  2BW2 A;  2LHD A;  4NAW A;  2LVQ A;  1RYJ A;  2JRH A;  3AN1 A;  3RNE C;  1C76 A;  2PKO A;  4WJO A;  3JYU A;  2KO3 A;  2D11 A;  2NBW B;  3SEB A;  1C1Y B;  1N62 A;  3DVN V;  4LNN A;  2M0A A;  3ONS A;  5J18 A;  4M01 A;  3UF8 A;  5JHB A;  1OGW A;  3VUX A;  1QKZ A;  3L0W B;  2Z0D B;  1KH0 A;  4PS8 A;  2LGD A;  3SFE B;  2SAK A;  5H92 C;  2KAJ A;  3DBR B;  2BTE A;  4BKG A;  3V3X A;  2KKC A;  4US8 A;  4JPS A;  1FXI A;  4YTM B;  1SJH D;  4KV2 A;  4WQM A;  5E6P A;  1OTR B;  2O2V A;  4YTN B;  1KLU D;  3VHT C;  3L13 A;  1V5O A;  3U52 E;  1DOY A;  1IBX A;  2IY0 B;  3HVD A;  4A90 A;  4KGS A;  4J3O D;  1WM3 A;  3WA0 A;  1IYF A;  3VAW A;  3ZJV A;  3NOB A;  3PTF C;  2IGG A;  3RPF C;  5BYS A;  3TIX A;  2DZI A;  2D3G A;  4YSY B;  2CKH B;  1QOB A;  2GMI C;  2GBM A;  2JX5 A;  1ESF A;  2DX5 B;  3QHT A;  3NVV A;  1DYQ A;  1V86 A;  1QOF A;  3N30 A;  3NRZ A;  4M0W B;  2MX2 A;  3MC0 B;  2A4Z A;  1C77 A;  1ZW7 A;  2W55 A;  1IGD A;  4EZK A;  2MW5 A;  4GB9 A;  3TMP B;  1KTK A;  3N1Z C;  1CMX B;  2WDV B;  3R2T A;  3QCA A;  4ZDV A;  4WWM A;  2MQJ A;  1UGM A;  3NS1 A;  3R7Q A;  1R4M B;  3AE1 B;  4RNA A;  1VR9 A;  1FMA D;  1TTN A;  4IW0 A;  4LCD E;  3UIN B;  3VTW A;  2LMC A;  3I3T B;  3QA8 A;  1PYW D;  3GZN B;  2HJ1 A;  2FE8 A;  3RNF C;  2L76 A;  4N9F 4;  5EE0 A;  4BVU C;  1GUA B;  4EZL A;  1K52 A;  4IUM B;  1T0R C;  2LZ6 A;  3P63 A;  3O13 A;  4ANU A;  1MHX A;  2W82 A;  5C1Z A;  3L10 B;  3ECI A;  4I6N B;  1MPE A;  2LRW A;  2FCM A;  1EU3 A;  3A9K B;  1PGX A;  1PDX A;  1JRP A;  2JU6 X;  3UGB B;  4AOF A;  1E8W A;  4G0N B;  4JWS C;  1P9D U;  2BPS A;  4XWW A;  1NBF C;  5IO9 A;  2VZK D;  3M95 A;  3RFZ B;  4GGQ A;  1UZX B;  3LYY A;  4KKI A;  4NQK E;  4FJZ A;  3TEZ A;  1GPX A;  2LJI A;  3R8B A;  5KHQ A;  1OEY J;  1Z5S B;  2BB6 A;  2PIA A;  5AZH A;  4KSL C;  3I5J C;  3ENE A;  1NDD A;  3TEY A;  2ZNV C;  2NPT A;  1VZ7 A;  3RD2 A;  2LGX A;  1T0S C;  1L4Z B;  1WJU A;  3AEF B;  3VRB B;  5BMH A;  1VCB A;  1HE8 A;  5FR3 A;  3C8Y A;  1IUE A;  4HDQ A;  3RNG C;  1WGD A;  3CSF A;  1YX5 B;  3RZW C;  3JVZ X;  2QCZ A;  4RGO S;  2CR5 A;  3ZNG C;  1SE3 A;  2QIE B;  2MSE D;  4TKN A;  5IAA C;  3GOE A;  2Z0E B;  2CHZ A;  4HKQ A;  2DWQ A;  1LXD A;  3M62 B;  4WIP A;  2N9E B;  1CZP A;  3B1L X;  3KWV A;  1I4H A;  4LNI A;  2BF8 B;  4NZL B;  4W9F A;  2IPK D;  3DOW A;  4JWU C;  4USA A;  3V62 A;  1QLB B;  3K9O B;  4BOZ B;  3RUI B;  1F77 A;  4OZB A;  3EUB 2;  1PGB A;  4S17 A;  2JWU A;  4B0M A;  4OHJ A;  1TZO A;  2H89 B;  1D5X C;  4ASW C;  1WJ6 A;  4CHK A;  3A9J B;  1GOZ A;  2C7M B;  2MA9 B;  1BT0 A;  1HZ6 A;  2DYO A;  1FNU A;  3LB8 C;  1FFU A;  2N7J A;  4DXF A;  2WWZ A;  1D4B A;  2JYE A;  1YX6 B;  2KYW A;  1TS5 A;  4XYC A;  2WXK A;  4TUU A;  5G2N A;  1C78 A;  1A5R A;  2LGY A;  1SGH A;  1YIW A;  2KDI A;  4ANV A;  4DHZ B;  1E7P B;  5HKH A;  2CHX A;  4PT5 A;  4LJO B;  1WIA A;  3WAP A;  2WXL A;  2GBJ A;  4WWN A;  2R2Q A;  4BFR A;  2K3U A;  1FFV A;  3AU4 A;  4P16 A;  1TS2 A;  2I1J A;  3L16 A;  3H6N A;  1B9R A;  1T0Q C;  3P1M A;  1PUT A;  2CHW A;  4W9C A;  3NUH B;  2MCN B;  4W9K A;  1KOT A;  1C3T A;  2YVC A;  2LHE A;  1WXV A;  4MSM B;  2WXF A;  4D2K A;  1JW9 D;  4KKJ A;  1JRU A;  1SEB D;  1C79 A;  2K25 A;  4C00 A;  4FLH A;  5JH5 C;  3L08 A;  1JAL A;  2O6V A;  2JYT A;  3A4S C;  4MSQ B;  4YXD B;  1UEL A;  1L5P A;  1RRB A;  2HD5 B;  2L83 A;  4RGN A;  2NBU A;  1EUV B;  3Q69 A;  2XK5 B;  1V6E A;  1TGZ B;  2RPQ A;  1KF6 B;  1YQ3 B;  1ET9 A;  3RZF A;  3NZ3 A;  1FEH A;  1GC7 A;  2BYE A;  2I1K A;  2XBB C;  2Y3A A;  2GB1 A;  4FHJ A;  1E8Y A;  3OJ4 B;  4HK2 A;  1HTQ A;  3NVY A;  1V1P B;  3NVW A;  3PV1 A;  4AJY B;  3WCQ A;  2KWV B;  1WX7 A;  5JZE B;  1RLF A;  2PTL A;  3HVZ A;  1YJJ A;  3QK0 A;  2EEL A;  5E6J A;  4W9E A;  2MEK A;  2LFI A;  4TQ0 A;  4ZRK A;  1J7C A;  4B6W A;  2KDM A;  4JGH B;  1JCK B;  5AEK B;  1VD2 A;  5GXG B;  1R7S A;  4BKS D;  2V3S A;  2INP E;  2WYQ A;  2KDE B;  4LDT D;  4AWJ A;  1E0Z A;  1FXT B;  2M17 A;  2KC2 A;  1ZDV A;  4EKU A;  2BWE S;  2K6Q A;  3DBL B;  1MFW A;  1BXT A;  2KLC A;  2O2V B;  2J52 A;  2WLB A;  2ZNV B;  2AQ3 B;  4BZA A;  1KFY B;  4OVU A;  1UH6 A;  2FCQ A;  3D32 A;  1IBX B;  3MJW A;  4OZA A;  2D07 B;  2MJ3 A;  4NQL B;  5BMI A;  3AE5 B;  3W1Y A;  4GDK A;  3CF6 E;  4JQW C;  5IN7 A;  2PJH A;  3Q2A C;  5D2M B;  1E7V A;  3B2G A;  1HZ5 A;  1I7H A;  1SB3 C;  1SE9 A;  3KQ4 A;  4REZ A;  3VUW A;  5TR5 A;  5D94 A;  1YJ1 A;  3NJT A;  1NEK B;  4B95 A;  2N7D A;  2PE9 A;  3TUO A;  4RGM A;  4IM3 A;  1WXM A;  1T3Q A;  4M8M A;  3ZTC A;  2LVO A;  2DYB A;  4GXB A;  3TBL D;  4LJP B;  4OZC A;  3JSV A;  2D3A A;  3APC A;  2J42 A;  5DPS A;  4K1R B;  4ITK A;  4CQN A;  2N9P C;  4A6Q A;  2JPH A;  5TSS A;  1FO4 A;  2V4I B;  4PK1 A;  3AEE B;  4BBN F;  1I35 A;  4IWP A;  5HFY A;  3PGE A;  2ON8 A;  2RPV A;  5GMV A;  2MBB B;  1SSN A;  5T8I A;  3ABV B;  4MH0 E;  1ROE A;  2KDB A;  2ZJD A;  2J7Q B;  2L8J A;  5FR6 A;  2ACZ B;  4ARC A;  2IZV B;  1XEE A;  1V81 A;  2CU3 A;  2R2O A;  3AI5 A;  1WZ0 A;  2WX1 A;  3AV8 A;  2QIL A;  1VRA B;  1L0Y B;  4LK0 M;  2YEP F;  1ZKH A;  3WAO A;  1DOI A;  1H4R A;  1UGJ A;  5DPW A;  1EO6 A;  1ZXI A;  3ZNZ B;  3M63 B;  2JXX A;  3NVZ A;  4HPM B;  1ZOY B;  4DBG A;  4HRS A;  3HRD D;  1WR1 A;  2OHF A;  5KHO A;  2V1Y A;  1ENF A;  1N5X A;  4KDL B;  3EHV A;  5DPR A;  1WJ4 A;  4C80 A;  3ML9 A;  1NI3 A;  3FAH A;  2MHJ A;  4M02 A;  4P1B C;  3WAM A;  2ZZP B;  3BYT B;  4IWQ A;  2NPT B;  3AH7 A;  2Y5C A;  4K3B A;  2N9K A;  3WIM A;  2KMM A;  1NVI D;  3P42 A;  3BY4 B;  1UWX A;  2JVC A;  3JW0 X;  4NJ7 A;  2AQ2 B;  2C7H A;  2V3P A;  2WNM A;  2RDG A;  5G5H A;  2KX3 A;  1I42 A;  1EWY C;  1PQS A;  1ZXH A;  4XE0 A;  4WAF A;  3WAL A;  2Y5P A;  4G11 A;  5HG2 A;  3VRA B;  2PVG C;  3MC9 A;  3R3M A;  3KYD D;  2JXT A;  2K22 A;  1JWU D;  2KN4 A;  1L6U A;  3W1S A;  3WAN A;  5C3J B;  1D3Z A;  1FCL A;  4GMV A;  4R3D A;  4BKS A;  3HM3 A;  2BKF A;  3DVN U;  3I57 A;  3R7R A;  4M8N A;  2IYD B;  2PPH A;  1HA5 A;  4URK A;  1F9J A;  3PLU A;  4EE2 A;  4HJK A;  1WI0 A;  5EDS A;  2PMV A;  2KDF B;  1S1Q B;  5FK9 C;  2RDH A;  4XC2 A;  2OOB B;  2LGS A;  1V1O A;  1V97 A;  1SBB B;  3TL5 A;  3A4R A;  1R4N B;  1N5W A;  1L7Y A;  3DBL I;  5AZG A;  3U30 A;  1YQ4 B;  2RD0 A;  4P1C C;  4HJG E;  2MLB A;  5AZF A;  3V61 A;  2WU2 B;  3SHQ A;  3VH4 B;  3L54 A;  3FIL B;  1QF6 A;  3RMK C;  4LNF A;  3Q8C A;  4HKZ E;  1PFD A;  4XWT A;  3GE8 C;  4WJQ A;  2NR2 A;  1I4P A;  1ZDX A;  2LWP A;  4KSK C;  4Q2J A;  5LXH A;  4NNJ B;  1D6E C;  3KUD B;  1QT9 A;  1XT9 B;  1NYR A;  4RMA A;  1RWS A;  3Q8A A;  1XXG A;  2M4N A;  4FUL A;  4DHJ D;  3UIO B;  1WYW B;  3QAR A;  2KT7 A;  4YL8 A;  4GDL B;  3ZNH B;  2O6V D;  4WQO B;  3NS8 A;  1DGJ A;  4BOS C;  2JZ3 B;  1ZE3 D;  2KHW B;  1P98 A;  4EEW A;  3IFW B;  1FNW A;  2K8B A;  1GAQ B;  5IP4 D;  2KQ4 X;  4LNK A;  5BYQ A;  1SIF A;  1F2R C;  1XLN A;  1TKY A;  4W9D A;  2KTR A;  3Q8F A;  2BB5 A;  1E8X A;  2LUE A;  4EUT A;  1SF0 A;  4X57 B;  1H8C A;  5IKC M;  2QHO A;  1YN4 A;  5BO4 B;  4RFB A;  2OJR A;  4PYZ A;  1WGH A;  5D3I B;  1MG8 A;  2JZP A;  3AMZ A;  2FBW B;  1K53 A;  3DDC B;  4YSZ B;  1JWA D;  1GJZ A;  5EE3 A;  1ZP0 B;  3RCZ A;  1LFD A;  2D2Q A;  2W3S A;  3PT2 B;  2RSU A;  2KQS A;  4C7Y A;  3X23 A;  2JY6 A;  4F8C B;  5G55 A;  3W1S C;  1XO3 A;  4LNO A;  2VZK B;  2MBE A;  4AS1 A;  3DVG Y;  1OQY A;  4MM3 A;  4N58 A;  2XN9 C;  2FID A;  4L2Y A;  2REX A;  3H7S A;  2IGH A;  3U2S C;  3DHG C;  4HDO A;  3PRZ A;  4JLC A;  1WXA A;  3DVG X;  4NAM A;  2KFJ A;  2HTM E;  1MI0 A;  2RDB C;  5BMG A;  3DHH C;  2IO0 B;  3CIR B;  3T9L A;  1F1H A;  3RT3 B;  3P4Q B;  4W9J A;  1UWM A;  2NTT A;  3PRM B;  5G5G A;  1XCQ L;  4RH6 A;  4RGT A;  2WXR A;  3ZVV A;  4BKT A;  5J17 A;  4PYU A;  5D3D A;  2D3C A;  3W5U B;  2INN E;  2D10 A;  2DYM A;  5HI1 A;  3P4R B;  4OVZ A;  1S3S G;  4GDK B;  2JRI B;  4IOI E;  1UNS A;  5AUK A;  3B2F A;  1XLO A;  4MGK E;  4ICV A;  4L23 A;  1K51 A;  4HCN B;  1D5M C;  4XGA B;  3VVW B;  2CJN A;  2EKI A;  2UWQ A;  1XLQ A;  3ZW3 A;  3IAS 1;  2G1E A;  3KLS X;  2HE7 A;  3N20 C;  3IHP C;  4E3C A;  3U7D A;  3AE7 B;  2FNJ B;  3ML8 A;  4RM8 A;  3BK2 A;  5D6J B;  2UYZ B;  3LJ3 A;  2R61 A;  4WJP A;  2WXM A;  2KTF A;  5L83 A;  2KJH B;  1OQR A;  4ACF A;  2MBH A;  1AYF A;  2M56 B;  4C56 C;  1QZE A;  2HJ8 A;  2ZCB A;  4ZRJ A;  2XNA C;  4DWF A;  3PZ7 A;  2AWT A;  2GLS A;  1M4V A;  4II2 B;  1HEZ E;  1V5T A;  2D5G A;  1JML A;  3CWI A;  3BIN A;  2JZZ A;  2WXQ A;  3ZJT A;  2C9W B;  5L95 C;  4AUQ C;  1UBQ A;  4ARI A;  3GP7 A;  3U7Z A;  1C9F A;  4K81 A;  1WMH B;  4ZRP A;  1WFY A;  1R4N I;  3TCA A;  4GOC A;  3P2B A;  4JIO U;  2ZEQ A;  2M19 A;  2BWF A;  2RR9 A;  4DXG A;  1KLG D;  2BS4 B;  2BYT A;  4FJY A;  4KX6 B;  3VUY A;  3RI7 C;  3A1Q A;  4NPN A;  3ZDM C;  1EWC A;  2BS2 B;  3MJ5 A;  1L2N A;  3DPD A;  2DAJ A;  1KRH A;  2AYO B;  3AE4 B;  2J0K A;  4MJS B;  2KWU B;  3V60 A;  5CX3 A;  4YWG G;  1EU4 A;  4LTU A;  2EMS A;  4FBJ B;  1L6V A;  1WE7 A;  1TBE A;  1Q10 A;  2L32 A;  1F52 A;  1T5X D;  3E56 A;  1I4G A;  2G3Q B; 
#chains in the Genus database with same CATH homology
 4K1R B;  4K7U A;  1WY8 A;  2JT4 B;  1V5O A;  2N9P C;  2ASQ A;  3PRE A;  2JPH A;  1NI2 A;  2IY0 B;  3PRP B;  3VTV A;  4MEL A;  1WM3 A;  3WA0 A;  4BBN F;  2K1F A;  1I35 A;  1IYF A;  4IWP A;  4GIV A;  3VAW A;  3ZNI D;  3PGE A;  3PLV A;  3NOB A;  3PTF C;  3T8M A;  3SU8 X;  4BBN C;  1K8R B;  5GMV A;  2MBB B;  3A9K A;  2KZR A;  3TIX A;  4MH0 E;  1V49 A;  2KDB A;  2ZJD A;  4NAW B;  2J7Q B;  2L8J A;  2DZI A;  2D3G A;  3IVF A;  4K7W A;  1T0Y A;  4KIK A;  5FR6 A;  2IZV B;  1V81 A;  2CKH B;  2GMI C;  2GBM A;  2R2O A;  3AI5 A;  1WRD B;  1WZ0 A;  2LRU A;  2DX5 B;  2WX1 A;  2W9N A;  3QHT A;  3ZUN A;  2L3Z A;  2C60 A;  2K6D B;  2N7E A;  2IO3 B;  3N32 A;  4WWP A;  1V86 A;  5C23 A;  1ZKH A;  2MBO A;  3N30 A;  2Z59 B;  4M0W B;  2MX2 A;  1Z2M A;  4KVG B;  2A4Z A;  3WAO A;  1XQQ A;  1WGG A;  1H4R A;  1ZW7 A;  4PS3 A;  4GSW A;  5DPW A;  5E6N A;  1P1A A;  1EO6 A;  3ZNZ B;  3M63 B;  4EZK A;  2MW5 A;  4GB9 A;  3TMP B;  4CO7 A;  3Q3F A;  1CMX B;  4IC7 B;  2JXX A;  3QCA A;  4FA6 A;  1J0G A;  4JL9 A;  3UIP B;  4ZDV A;  5CHW A;  4HPM B;  2KJ6 A;  4DBG A;  2G4S A;  2MQJ A;  1UGM A;  2DAF A;  4MGZ E;  2KK8 A;  3R7Q A;  4CYE A;  1WR6 E;  1WR1 A;  2NCN A;  2K39 A;  5KHO A;  2V1Y A;  3HHM A;  1WGR A;  2M8S A;  4KDL B;  1TTN A;  1G6J A;  3EHV A;  4IW0 A;  5DPR A;  1WJ4 A;  4LCD E;  3UIN B;  2MBQ A;  3VTW A;  2L00 B;  3I3T B;  3JSV B;  3AU5 A;  3QA8 A;  4FAD A;  2J0J A;  3ML9 A;  4IM2 A;  4LDT B;  5E6O A;  2L76 A;  2Y5B B;  3MTN B;  3VTU A;  3APF A;  3ZRC A;  2BKR B;  3DBR I;  4N9F 4;  4TV3 A;  4BVU C;  1GUA B;  4EZL A;  3WAM A;  2ZZP B;  3VXW A;  4IWQ A;  2NBV B;  4IUM B;  4FN2 A;  2LZ6 A;  2NPT B;  3C0R B;  4FJV B;  4ANU A;  2AL6 A;  3PVL A;  5C1Z A;  3WIM A;  3L10 B;  4P7I A;  3ECI A;  4I6N B;  3BY4 B;  2LRW A;  2JVC A;  3JW0 X;  4NJ7 A;  3CST A;  2JUO A;  2FCM A;  1LM8 B;  2C7H A;  3A9K B;  2IY1 B;  2L0F A;  2LD9 A;  2KX3 A;  1KM7 A;  3HM6 X;  3ZIM A;  1PQS A;  1I42 A;  3WAL A;  2KAN A;  2KFK B;  1P3Q U;  3QC8 B;  4G11 A;  2GBN A;  3R3M A;  3QIJ A;  3U8Z A;  3KYD D;  2GOW A;  1XD3 B;  3UGB B;  2DZJ A;  3ZO5 B;  4AOF A;  4G50 A;  1E8W A;  4G0N B;  4A3O A;  2N4F A;  1P9D U;  2L0T A;  2BPS A;  3AUL A;  3H7P B;  2WDT B;  1NBF C;  3M95 A;  1WE6 A;  4GGQ A;  3W1S A;  3WAN A;  5IA7 A;  1D3Z A;  1UZX B;  3UQB A;  2KX0 A;  4GMV A;  1GNU A;  1X1M A;  4BKS A;  4RM9 A;  3HM3 A;  4NQK E;  3ZDT A;  2BKF A;  2FCS A;  3DVN U;  3HIZ A;  4HPL B;  3EFU A;  3H9D A;  4FJZ A;  4KDI C;  3R7R A;  5KHQ A;  1E5W A;  2IYD B;  1OEY J;  4M8N A;  4GDL A;  1Z5S B;  3EEC A;  1V80 A;  2PPH A;  4MGI E;  5AZH A;  4KSL C;  2KNB A;  4URK A;  5LLI A;  1F9J A;  3PLU A;  3ZTD A;  1RFA A;  3ENE A;  1NDD A;  4HJK A;  1WI0 A;  2ZNV C;  3A9J A;  5EDS A;  2KDF B;  2NPT A;  1S1Q B;  4AP4 C;  3RD2 A;  4A3P A;  2LGX A;  2B3A A;  3V6C B;  1UD7 A;  3APD A;  5CTR C;  1WJU A;  2OOB B;  4XC2 A;  3VQI A;  1VCB A;  1R4M I;  3TL5 A;  1HE8 A;  2LAS A;  3A4R A;  3NHE B;  4ZYN A;  3MHS D;  4G3X B;  1L7Y A;  2KMC A;  4HDQ A;  3DBL I;  4AJW A;  3NZS A;  1WGD A;  2DEN B;  2KFK A;  3CSF A;  4F7Z A;  2KWC A;  3PS6 A;  2KJR A;  3GZN I;  1YX5 B;  5CHF A;  3RZW C;  3JVZ X;  5AZG A;  3CMM B;  3U30 A;  4F1S A;  4MGY E;  2CR5 A;  2RD0 A;  3ZNG C;  4W9H A;  3ZKJ C;  2MLB A;  5AZF A;  2NS5 A;  3V61 A;  3VFK A;  4ANX A;  2MSE D;  3QAQ A;  5D7G A;  3S2A A;  3SHQ A;  3VH4 B;  3L54 A;  4HCP B;  1WH3 A;  1WGY A;  4TKN A;  2L05 A;  5IAA C;  3OLM D;  3GOE A;  2Z0E B;  1WX8 A;  1E90 A;  1GG3 A;  2CHZ A;  3B0A A;  3H7P A;  4HXD A;  1LXD A;  3M62 B;  4ANW A;  2FAZ A;  2J0M A;  2C5L C;  4GU2 A;  2N9E B;  4WJQ A;  3R66 C;  3KVF B;  2NR2 A;  3PSE B;  2M0X A;  4E74 A;  4KSK C;  5LXH A;  2LWP A;  3B1L X;  4NNJ B;  1ISN A;  3PZD A;  3KUD B;  1XT9 B;  2BF8 B;  3OJ3 A;  4RMA A;  4W9F A;  4E71 A;  2YLM A;  3ALB A;  4GN1 A;  3DOW A;  2M4N A;  3V62 A;  1TZ1 A;  3K9O B;  4BOZ B;  4FUL A;  3RUI B;  1YD8 U;  4DHJ D;  2XEW A;  3UIO B;  2GBR A;  1ZGU B;  3EC8 A;  1WYW B;  3QAR A;  4OVV A;  4YL8 A;  4GDL B;  3ZNH B;  2LXC A;  2O6V D;  4WJN A;  4WQO B;  1Q1O A;  3NS8 A;  3QJZ A;  2JZ3 B;  4BOS C;  4ASW C;  2KN5 A;  1WJ6 A;  2M1M A;  3IG3 A;  2KHW B;  3A9J B;  1P98 A;  3ZRF A;  4CHK A;  2K8C A;  3RUL A;  4EEW A;  3IFW B;  3UQA A;  2DZK A;  3IBE A;  2K8B A;  2N9X A;  3V6E B;  1V2Y A;  2WX0 A;  2C7M B;  2MA9 B;  1BT0 A;  3M3J A;  2EKE C;  4DK5 A;  2DYO A;  2XK5 A;  3DQV A;  1E7U A;  2MP2 B;  2WWZ A;  4NJ6 A;  1SIF A;  2K8H A;  2LVP A;  1YX6 B;  4W9D A;  2KTR A;  1E8X A;  2LUE A;  2V4L A;  4EUT A;  4TUU A;  5G2N A;  1A5R A;  2FUH B;  2LGY A;  1WX9 A;  1SGH A;  4X57 B;  4II3 B;  1H8C A;  2QHO A;  1YIW A;  2PEA A;  2KDI A;  1LQB A;  2EMT A;  4PS7 A;  4ANV A;  3DBH I;  5BO4 B;  4DHZ B;  5HKH A;  2OJR A;  2CHX A;  4LJO B;  1WXS A;  2KC1 A;  4PYZ A;  3NZU A;  3SDL C;  1WIA A;  4EZJ A;  1IP9 A;  1WGH A;  3WAP A;  4DHZ E;  2ZPN A;  1MG8 A;  1WM2 A;  4J6I A;  2GBJ A;  4W9L A;  4B9K A;  4WWN A;  2AL3 A;  5DPT A;  1KJT A;  2DHZ A;  2R2Q A;  4BFR A;  3DDC B;  1GJZ A;  2MRP A;  3AU4 A;  3KH0 A;  3VDZ A;  4MDK E;  5LXI B;  2BYF A;  3QQ8 B;  3RCZ A;  1LFD A;  2D2Q A;  3PT2 B;  2RSU A;  2I1J A;  3L16 A;  2KQS A;  3H6N A;  1AAR A;  1OEY A;  2JF5 A;  3X23 A;  2JY6 A;  4F8C B;  5G55 A;  2AEH A;  3W1S C;  2CHW A;  4W9C A;  3QWZ B;  2MBE A;  2MCN B;  4W9K A;  1WZ3 A;  3DVG Y;  1KOT A;  1OQY A;  4KZC A;  2YVC A;  1C3T A;  4MM3 A;  4TQ1 A;  4K7S A;  1WXV A;  4MSM B;  2LXA A;  3A33 B;  4HLE A;  2IBI B;  1JRU A;  1P0R A;  2FID A;  2PE6 B;  3OAW A;  2REX A;  2K25 A;  3O65 B;  4FLH A;  5JH5 C;  3H7S A;  1WF9 A;  3L08 A;  2O6V A;  3A4S C;  4MSQ B;  1GC6 A;  4A20 A;  4HDO A;  1UEL A;  3PRZ A;  1WXA A;  3DVG X;  4JLC A;  2FIF A;  2KQ7 A;  2MP2 A;  2ZVN A;  2KFJ A;  1EF5 A;  1RRB A;  2HD5 B;  4HWI B;  2JWZ A;  2MWS B;  4WWO A;  2NBU A;  2ZCC A;  3X0W A;  1EUV B;  2XK5 B;  1V6E A;  4ZRI A;  1TGZ B;  2IO0 B;  2RPQ A;  1YQB A;  3T9L A;  3RZF A;  3RYT A;  1RAX A;  2KD0 A;  4IWO A;  4KZ0 A;  1GC7 A;  3KYC D;  2IO1 B;  2KTR B;  3RT3 B;  2BYE A;  2I1K A;  2XBB C;  1J8C A;  4W9J A;  2BGF A;  4FHJ A;  5CHV C;  1E8Y A;  3PRM B;  3OJ4 B;  4HVB A;  1M94 A;  4HK2 A;  1Q5W B;  1WMH A;  3PHX B;  3ZVV A;  4MEM A;  4BKT A;  3PV1 A;  2LJ5 A;  5J17 A;  4PYU A;  2ZPY A;  2KVR A;  2D10 A;  3KUZ A;  2DYM A;  4AJY B;  2CS4 A;  3PHW B;  2KWV B;  1S3S G;  4WAA A;  3AXC A;  4XZ4 A;  4GDK B;  1WX7 A;  3N3K B;  4ICU A;  1UBI A;  2JRI B;  5JZE B;  1RLF A;  3QK0 A;  4MGK E;  4ICV A;  2C7N B;  2L7R A;  2LI5 A;  4EOY A;  2KXJ A;  3KW5 B;  3H1U A;  4HCN B;  2KMA A;  4W9E A;  4TQ0 A;  4ZRK A;  4DXA B;  4B6W A;  3VVW B;  4JGH B;  5AEK B;  1VD2 A;  3SD5 A;  1V9J A;  2NVU I;  1U4A A;  3PPA A;  2UWQ A;  3A1Q B;  3ZW3 A;  2ZVO A;  4BKS D;  2V3S A;  1IPG A;  2HE7 A;  4MJS A;  3IHP C;  4E3C A;  2WYQ A;  2KDE B;  1WJN A;  3K9P B;  3U7D A;  4DHJ B;  4LDT D;  4XX5 A;  4AWJ A;  1FXT B;  2M17 A;  5DCN A;  2BYV E;  2FNJ B;  3ML8 A;  4RM8 A;  3DBS A;  4I6L B;  2RGF A;  2KLG A;  2KC2 A;  2UYZ B;  3LJ3 A;  5D6J B;  4EKU A;  2BWE S;  2N1V A;  2K6Q A;  2O6V B;  4DDG D;  4WJP A;  4NY0 A;  2KTF A;  5L83 A;  2KLC A;  2O2V B;  2VRR B;  2KJH B;  3DCG A;  3NY5 A;  3ZLZ A;  2MBH A;  4IM0 A;  2ZNV B;  1QZE A;  2GBK A;  2G45 B;  2HJ8 A;  3QX1 A;  2HTH A;  4EFO A;  5J2R A;  4OVU A;  2ZCB A;  4ZRJ A;  4DWF A;  1UH6 A;  2FCQ A;  3D32 A;  3KUC B;  2AWT A;  3LDZ E;  2KOX A;  3MJW A;  4II2 B;  2G4D B;  2D07 B;  1V5T A;  3BIN A;  4NAW A;  4NQL B;  2JZZ A;  1Y8R C;  2LVQ A;  2C9W B;  2JRH A;  3W1Y A;  5L95 C;  4AUQ C;  2DZM A;  1UBQ A;  2N1W A;  4GDK A;  4K81 A;  1WMH B;  3CF6 E;  1WFY A;  4WJO A;  1R4N I;  3JYU A;  2KO3 A;  3B08 A;  4JQW C;  2PJH A;  2D11 A;  5D2M B;  4GOC A;  2NBW B;  2FCN A;  3TCA A;  3P2B A;  4JIO U;  2ZEQ A;  1E7V A;  1C1Y B;  3DVN V;  5JHA A;  3ONS A;  4KIK B;  5J18 A;  3L17 A;  2BWF A;  2RR9 A;  1SE9 A;  3UF8 A;  4DDI D;  1E8Z A;  5JHB A;  1OGW A;  3VUX A;  3VUW A;  5TR5 A;  5D94 A;  3L0W B;  1YJ1 A;  2Z0D B;  4FJY A;  3VUY A;  3A1Q A;  4B95 A;  3HK0 A;  4NPN A;  4PS8 A;  2LGD A;  4W9I A;  1Q0W B;  3VH3 B;  3ZDM C;  4W9G A;  2N7D A;  2PE9 A;  1L2N A;  2CU1 A;  1KLV A;  3DPD A;  4FHK A;  2DAJ A;  4IM3 A;  1WXM A;  4BKG A;  4M8M A;  2KKC A;  2LVO A;  1J19 A;  3ZTC A;  2AYO B;  2J0K A;  2DYB A;  4GXB A;  3TBL D;  4LJP B;  4MJS B;  2KWU B;  4KV2 A;  3V60 A;  4IG7 B;  5E6P A;  1OTR B;  5CX3 A;  3JSV A;  2O2V A;  1EF1 A;  2EMS A;  4FBJ B;  1WE7 A;  2IO2 B;  3VHT C;  1TBE A;  3Q3J A;  3APC A;  3L13 A;  4I6P A;  3TJP A;  2G3Q B;  2A5U A;  5DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...