4FXCA

Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ATYKVTLINEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGTITSGTIDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIKTHQEEGLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Tertiary structure of [2Fe-2S] ferredoxin from Spirulina platensis refined at 2.5 A resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis.
pubmed rcsb
molecule tags Electron transport
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4fxcA00
1SIJA 1XLPA 2K22A 4YTPB 1JWBD 2JQRB 3NRZA 1J7BA 1JWAD 1QLBB 1TKEA 1KFYB 1L5PA 1WRIA 2WP9B 3HUIA 1VDVA 1QOFA 3DWMA 1V8CA 1OFFA 2N0SB 3W9CB 1B9RA 1RWSA 3B2GA 1QOBA 2PKOA 2MJDA 1I7HA 1RM6C 3WCQA 4YSYB 2L83A 1R7SA 2K9XA 1DOXA 1WWTA 1JQ4A 1FXIA 4ZOHC 1TKYA 1AWDA 2WQYB 1KF6B 4C7ZA 3LXFA 1OQRA 4LTUA 3FAHA 2MJEA 4A9AA 4ZHOA 3EUB2 3HRDD 2CJOA 3AE9B 1TJEA 3AEAB 1KRHA 2FBWB 2HTME 1PUTA 3CWIA 2BS2B 2OHFA 5EE0A 3AMZA 1QOGA 2EKIA 1QOAA 3CIRB 3LB8C 1YJJA 3KWLA 1N5WA 1V97A 4FXCA 5G5HA 1WGKA 2H88B 5C3JB 2M19A 3AN1A 2Q5WD 1YQ3B 4YSZB 1RFKA 1E10A 1PDXA 2WLBA 4US8A 4YXDB 1TYGB 1JW9D 1WXQA 1NENB 3AE5B 3AE8B 1RYJA 3NVYA 3P4QB 3ETRA 4JWUC 4N6EB 3P4RB 4YSXB 1E7PB 3NVWA 1FXAA 1N60A 2PIAA 5EE1A 1GAQB 1ROEA 2QJLA 1JALA 2W3SA 2WU2B 1NYRA 3AE4B 4N59A 3AE3B 1N5XA 1A70A 1L0VB 1WYGA 2M56B 5G5GA 1QF6A 3AECB 3W5VB 5H8YE 2ACZB 5C2TB 4JWSC 3AM9A 3P4SB 4US9A 3ZYYX 1CZPA 1FRRA 4YTNB 1FRDA 2DBYA 3AH7A 3PO0A 1F0ZA 1E9MA 2AX5A 3P63A 3AE7B 2BS4B 3AEGB 4IDIA 1L6VA 2W3RA 1YJIA 4WQMA 2BS3B 3SFEB 3AEBB 1IUEA 3P4PB 1NI3A 2CU3A 1TKGA 1ZXIA 3B9JA 4ITKA 3B2FA 3VRBB 4KX6B 4C7YA 5AUKA 1XLQA 2G1EA 2E3TA 1SB3C 1VJKA 5EE9A 1SF0A 1FIQA 4C80A 1J7CA 1QT9A 4YTMB 5AUIA 1L6UA 2WS3B 3NVVA 2KAJA 1FO4A 1NVID 5H92C 2B76B 1XO3A 3HVZA 1ZP0B 2PVGC 2QIEB 2JX5A 2BT6A 3FC4A 4HROA 3SR6A 1GPXA 2Y5CA 1YQ4B 3NVZA 1NEKB 2DWQA 2H89B 2W55A 1T3QA 1VLBA 4P6VF 4USAA 1FMAD 1XLOA 3W5UB 2MH7A 1AYFA 1JROA 1JRPA 2WU5B 1N61A 1PFDA 1FFVA 1UWMA 3AE6B 3VR8B 3BIID 3AB5A 1DOIA 3AEDB 3NS1A 2PVOD 2W54A 1XLNA 2WDVB 3AEFB 3AV8A 5MPOA 4YT0B 1CJEA 4HRSA 3VRAB 1N63A 3SFDB 1EWYC 4N58A 3RPFC 1N62A 4WWMA 5GXGB 1NYQA 2WDQB 3AE1B 3AEEB 2LEKA 3AE2B 3DWGC 3P1MA 1DGJA 2MJ3A 2L52A 3VR9B 1FM0D 3ABVB 5EE3A 4ZHPA 2KMMA 1DOYA 1E0ZA 1OQQA 2K5PA 1J7AA 3L4PA 2WDRB 4JX1C 2CJNA 1ZUD2 1E6EB 1FFUA 1ZOYB
chains in the Genus database with same CATH superfamily
2BB5A 2RDGA 2JU6X 3H1UA 3HUIA 3U8ZA 3W2DA 2D07B 2XN9C 2K8BA 5D6JB 1HXYD 1DOXA 1JQ4A 3NZ3A 3H7PB 1TKYA 2KDMA 2IGDA 4OHJA 2RSUA 3EUB2 4FA6A 2FAZA 2C7MB 4K3CA 2QSDA 1QOAA 3TEZA 4EUTA 2I1KA 5EDSA 1TIFA 4LNNA 1D3ZA 1I4QA 2D10A 1XT9B 3GP7A 3NY5A 5KHOA 5D3DA 4EZJA 4S17A 1BUIC 3PLVA 1MHHE 2KQSA 1HTQA 1ET6A 2BB6A 3AE3B 2IY0B 1TS3A 3RULA 4QAYA 1D4BA 3AM9A 3QAQA 1L7YA 3S2AA 1F0ZA 1B1ZA 4BOZB 1SIFA 2SAKA 2LRUA 3BVGA 1J8CA 4XDCA 1XD3B 1NI3A 2CKHB 4M00A 2E3TA 4L1BA 1CQVA 3KUCB 4MSQB 4B0EA 2X38A 1WMHA 4KDLB 1Q10A 2FCMA 1WGHA 1XO3A 3QCAA 4LK0M 4BBNF 4YL8A 1ZKHA 2WWZA 1GPXA 1OGWA 4EFOA 3A9KA 2TSSA 2WXRA 3A4SC 1XLOA 4KSKC 4GDKA 2XBBC 5CTRC 3NS1A 3AEFB 4HPLB 5G2NA 1JWSD 1N63A 3DVGX 4D2KA 2K5PA 1P7FA 1XCTL 3PREA 4IWPA 4GXBA 4K1RB 3ZJVA 1JWBD 4JLCA 1J7BA 1KFYB 1WFYA 3RNAC 2DYOA 1J0GA 1MG4A 3VTWA 1SBBB 2YEPB 2LVOA 2ZCCA 4ASWC 5D7GA 1AWDA 2BQQA 2N9EB 1FCCC 5DPWA 4IWQA 1KRHA 3BK2A 4OZBA 3PV1A 4C00A 4NZLB 1V6EA 1N5WA 1ESFA 3FILA 1RAXA 4LNIA 5LXHA 1WXQA 2KHWB 3P4QB 3QQ8B 2KN4A 2AL3A 3P4RB 4LDTD 2BYFA 2FUG1 1WI0A 2K25A 3D32A 4PT5A 4BKTA 3Q3FA 1T0YA 1ZPSA 2RD0A 3TEXA 4TKNA 3ZYYX 4ANVA 2KFKA 3C8YA 1C4AA 2NBWB 1WYWB 2HDEA 2DZMA 4AQ7A 2C9WB 2MX2A 2G1EA 3V6CB 4GDLB 2C60A 1WGYA 2LHDA 2NS5A 2B76B 4KVGB 5FK9C 3U2SC 4I6NB 1OQYA 5GMVA 2H89B 1FMAD 1XXGA 1L0XB 2KLCA 3RCZA 1JRPA 1TT5B 5L95C 2N4FA 4Q2JA 2WXMA 3PVLA 4YT0B 2JYEA 1WM3A 4B95A 3MC0B 3IT4B 3DWGC 3PZ7A 2KWUB 4RCOA 1PGAA 2KDIA 2J7QB 2L32A 3DDCB 2L8JA 2KT7A 5H8YE 4DWFA 2KK8A 5J2RA 1SIJA 3NHEB 3PTFC 4J3OD 1L5PA 3A1QB 3ML9A 2BKFA 4MACA 4NAMA 2J0MA 2M4NA 1HTOA 3ENEA 2L05A 2PE6B 2PW9A 3WANA 4C7ZA 3PPAA 4A3OA 4DBGA 2W9NA 3LYYA 4KGTA 2PTLA 2KMCA 5CHVC 5JXVA 2O6VB 1EU4A 2OJRA 1YQ3B 1PDXA 2B3AA 1GG3A 4PS8A 3NVYA 3ETRA 3A9JA 3OLMD 1JALA 1STEA 1E7VA 1EM7A 5G5GA 3ZTCA 3NZUA 1UGMA 1EWCA 2O2VA 4HPMB 1H4RA 1WGGA 2J4XA 2ZJDA 2AX5A 2N9KA 4REZA 2LGYA 3APDA 2W3RA 3GZNB 3TBLD 2BS3B 4ZDVA 3H7SA 1SJED 3E9SA 4W9FA 2NBUA 4C80A 4MJSA 4RMAA 4YTMB 4EKUA 2Y5BB 3I5JC 3OJ4B 4WJQA 4RGOS 4XWWA 1HEZE 4HROA 2QCZA 5BMGA 3EFCA 2I38A 1AYFA 3ONSA 5IKCM 2QEJC 3VR8B 2N1VA 3KYDD 4WWOA 2YVCA 4EE2A 3SFDB 4W9EA 1SE9A 3SDLC 2WHIA 2MRPA 3AE2B 4IOIE 3I57A 2ONQA 3T8MA 1OEYJ 1WZ0A 2QHOA 2MQJA 4OZCA 2M1MA 3DWMA 2RMMA 2KX3A 4G11A 2WP9B 3DBSA 2WXOA 3W9CB 4CHKA 1CMXB 1WXMA 4C4VB 4TUUA 1RRBA 3TIXA 4XWTA 1KF6B 1ET9A 3V3XA 4W9HA 2MJEA 2RGFA 2CJOA 3R2TA 1PUTA 5AZGA 1LQBA 2JYTA 4GSWA 3KWLA 3N30A 1T0SC 3ZO5B 4KIKA 1K53A 1BT0A 2PPHA 2LHEA 1TGZB 4YSXB 4K7WA 1TS2A 4AUQC 1GAQB 1ROEA 1V49A 2WU2B 2DZJA 4W9LA 1HZ5A 1TY0A 2MP2B 5DPRA 2M56B 2PJHA 3AECB 3DBHI 2LASA 3BYTB 2BWFA 4DXFA 2BS4B 3VH4B 3TMPB 2AQ1B 4OZAA 3PRPB 1SGHA 2BKRB 3VRBB 4H2AA 5AUKA 1XLQA 3UQAA 3M62B 1QT9A 3U7ZA 4NAWA 1NVID 4ZYNA 1X1MA 3QC8B 2JX5A 3FC4A 1IPGA 2NR2A 1PGXA 1GOZA 1HE8A 2WU5B 1I4RA 2D3BA 4DXGA 1PQSA 4TQ1A 5CX3A 3E56A 1D5XC 4XGAB 3VFKA 1WRDB 3RD2A 3T3NA 1DYQA 2IO3B 1FM0D 1XCQL 3ABVB 5D3IB 3L4PA 2VH2A 1FPYA 3KVFB 3JW0X 3DBLI 1KOTA 4K7UA 3KYCD 4LNFA 2G3QB 2UYZB 1UD7A 3TEWA 3L54A 1B9RA 1MI0A 1Z5SB 1RM6C 2FCQA 3IAS1 4IWOA 3L08A 2NTTA 3NZSA 4ARIA 4WJNA 2MSED 2FBWB 4RM8A 5IAAC 1QOGA 1P7EA 4FXCA 4CO7A 1WGKA 5C3JB 2LFIA 2Q5WD 3H7PA 3DPDA 1E10A 1TYGB 1JW9D 2INCC 1TBEA 4FJVB 4NPNA 3ZTDA 1L4DB 2WXQA 1SE3A 5D2MB 3A4RA 2KWCA 2M17A 3J9CA 4DHJD 1NYRA 2D3GA 1BMLC 3DBRI 1JWUD 1L0VB 3B1LX 3AI5A 3PZ8A 3MC9A 4DHJB 2BTEA 3LDZE 2MA9B 1YJIA 3U30A 2LI5A 2BBCA 4XC2A 5C23A 3RUIB 3I9V1 3ML8A 2WXPA 4X57B 3R3MA 4FADA 1C9FA 2DENB 3U52E 4ICUA 1R4MI 2ZVNA 1GUAB 4HDQA 4L23A 3QJZA 5IA7A 2JWUA 2W54A 2WGSA 3AV8A 1Y8RC 2YLMA 5C1ZA 1YD8U 1WJ6A 2OOBB 1WIAA 3WAMA 1F77A 2MJ3A 3SHQA 2MBQA 1DOYA 3URYA 1WX8A 3DHHC 1JWAD 1QLBB 3SD5A 4AOFA 2N7EA 2QC8A 4J6IA 3AXCA 2HD5B 1UF0A 1V8CA 3VTVA 1RWSA 3B2GA 2PLPA 3GE3C 4YSYB 1R7SA 4ZOHC 3VVWB 3IAM1 2DAJA 2GRIA 3FKYA 2AL6A 4P16A 3IHPC 2R2OA 5HKHA 1NENB 2AWTA 4JWUC 4HJGE 3EGRA 2K1FA 5AZHA 2IGHA 2QJLA 1WSPA 2WXLA 1R4NI 4HWIB 4FJYA 2N9XA 1V1OA 4US9A 2KDFB 3RZWC 3ZNGC 2D5GA 3PRMB 1JRUA 3HM3A 2DLBA 1YX6B 2KFJA 3ZVVA 3JSVB 4FJZA 4GGQA 4ICVA 5T8IA 5J17A 2VZKB 2KQ4X 3KQ4A 2LUMA 3IBEA 2LWPA 4DDGD 4E3CA 4BKSD 4I6PA 1UELA 2DWQA 2N7JA 1Q5WB 1Z2MA 3UGBB 4GDLA 4C56C 1XLNA 2KO3A 1TZ1A 1WE6A 4W9CA 4N58A 3W1YA 2DYBA 3AE1B 3AEEB 4GB9A 2INDC 1JMLA 3ALBA 5EE3A 2GBMA 3Q69A 1NI2A 1IP9A 3GS2A 4FBJB 2G9HD 3U7DA 1XLPA 4YTPB 1J19A 2RR9A 3NJTA 4MGZE 3Q8FA 4NJ6A 3TUOA 1L0YB 1P0RA 2C5LC 5IOIA 3Q3MC 5E6PA 4M8MA 1QILA 4FULA 3N1XC 2ZW0A 3LXFA 3R66C 1JCKB 3IT6B 3A1QA 3HRDD 3QWZB 3VUYA 3AE9B 4F8CB 1WXAA 3VXWA 1YJJA 4MH8A 4MM3B 1ZE3D 4K7SA 4GMVA 4N6EB 2KLGA 3ZW3A 2O6VA 4GOCA 3I3TB 1VZ6A 3V60A 2I2YA 1K8RB 2KACA 4A90A 3RFZB 2JWZA 2JZ3B 3AEGB 1WR1A 3P4PB 2KJHB 3N1YC 5LNK1 4KX6B 2DZIA 1Q1OA 2XNAC 3Q8BA 2MBBB 5H92C 2IPKD 2ICIA 3VTUA 2GI9A 2Y5CA 2W55A 1MVKA 2MEKA 1Q0WB 1PFDA 1UWMA 4G50A 3K9OB 3O13A 2N1WA 4EZKA 3AEDB 3OG5A 2GBRA 2G4DB 4HRSA 3UI3A 3RPFC 4IM2A 4JIOU 2INPE 2RPVA 4RGMA 4ANUA 2LJ5A 1UH6A 1C1YB 1YOVB 1WR6E 1ZUD2 1IGCA 1WY8A 2V3PA 2KX0A 2LD9A 2ON8A 4BKGA 4BOSC 1F2RC 2LGSA 2REXA 1HZ6A 4R3DA 2L0FA 1UBIA 2IY1B 4ANXA 1FXIA 1WGDA 4RH6A 1I4GA 2R2QA 2ZCBA 4MGYE 3AEAB 2OJWA 2LZ6A 1T0QC 3CIRB 3R8BA 4C4VA 1WMHB 1XEEA 4DXAB 4NJCA 3R2IA 4AWJA 2V3SA 4YSZB 2G4SA 1RFKA 2KNBA 4FN2A 1U4AA 2IYDB 3AE5B 3H6NA 1ZDVA 4PS7A 1HA5A 1WX7A 4A55A 2GB1A 2WXJA 3M63B 1MPEA 3RNCC 1V86A 3EECA 4RFBA 2JT4B 2O6VD 3DVGY 4ZRKA 3KWVA 1K51A 2DX5B 3HHMA 2NCNA 5C2TB 3P4SB 1L2NA 1WZ3A 1FRRA 4JE3B 4DHZE 2JF5A 4PYUA 3P63A 2KVRA 2WXGA 1UZXB 3AE7B 1VCBA 4GIVA 2MP2A 2FCNA 1TKGA 2XK5B 2HJ8A 4KGSA 1SXTA 4B6WA 3PLUA 2ZPNA 2W82A 1E5WA 4KV2A 1VZ8A 3ZDMC 4GU2A 2L0TA 1UWXA 2JRIB 4P6VF 2BGFA 2RPQA 3AE6B 4PK1A 3ZLZA 3QK0A 5E6JA 2KDEB 2IGGA 3C19A 1E90A 2CHXA 2GBJA 2LEKA 2QILA 2WXFA 2WX1A 1K52A 5E6OA 4JX1C 2CJNA 3GOEA 1ZDXA 4P7IA 2AYOB 5DCNA 3HVDA 1WRIA 4KGRA 2PEAA 3B08A 2NPTA 1XQQA 4FHJA 2JRHA 5DPTA 2KFKB 4EZLA 3Q2AC 1V1PB 2L83A 3NS8A 3TSSA 1WWTA 4MDKE 1YJ1A 2CU1A 1S1QB 4N9F4 2DAFA 2BS2B 5EE0A 2X8XX 5J18A 2EMTA 1KH0A 1V97A 2M19A 4IUMB 1LXDA 4RF0A 3A33B 2CS4A 4I6LB 4O1NA 4KDIC 3AE8B 1G6JA 3AULA 4ACFA 1V2YA 2W3SA 2AQ3B 2IZVB 2MBHA 2ACZB 2LVPA 1P3QU 4YTNB 1FRDA 3AH7A 1IBXB 4LJPB 1WM2A 2JSVX 2IO0B 2KKCA 3B9JA 4IC7B 4XDDA 1D5ZC 1MHXA 1WJ4A 2BWES 2IJ0A 4TMAB 4XYCA 1N6ZA 2RDBC 3CSFA 2LGXA 4ARCA 1I4HA 2KANA 4URKA 3BIID 3HM6X 4JGHB 4K81A 4WWMA 3P1MA 2MW5A 3VR9B 4LJOB 2M0XA 4IM3A 2KMMA 3PSEB 3UIOB 3VH3B 1S3SG 2ASQA 4KZCA 2D11A 1YN3A 2A5UA 2K8CA 1QOFA 2O2VB 1XF5L 3ZNID 2HE7A 3ZGZA 2K9XA 2LVQA 3H8HA 1ACCA 3ZIMA 1GC6A 1TS4A 4ZRQA 1ISNA 1I4XA 1SE4A 3QIJA 1MG8A 2H88B 3AN1A 2GBKA 1EF5A 2WLBA 4HEA1 4WJPA 2KWVB 4LLGM 2JY6A 1YNTE 2PE9A 2LXAA 4P1CC 4W9GA 3QA8A 2ZZPB 3OWEB 1YMHE 1FNWA 5FKAC 5D94A 5LLIA 3W1SC 2BYTA 3SFEB 4A6QA 5JH5C 3TCAA 2JZPA 3ZKJC 4C7YA 4NJ7A 1LFDA 1EO6A 2KYWA 3GE8C 4KZ0A 2K39A 3RT3B 2PVGC 1T3QA 2BYVE 2KC1A 4AJYB 2K3UA 3SU8X 2JUOA 3DOWA 1ZGUB 3MTNB 1C4CA 1E7UA 4DK5A 1V5TA 4WAFA 2J42A 5MPOA 3ZQ4A 2NBVB 2BVCA 4W9KA 2L7RA 4L2YA 3Q3NC 4RM9A 1E0ZA 4BKSA 1OEYA 3DCGA 2KWDA 3WALA 3NRZA 1I4PA 2Y5PA 3BINA 4XE0A 4M0WB 1OFFA 3O65B 1VR9A 1T5XD 1SE2A 1ZXHA 2BW2A 3GZNI 1OQRA 3DVNU 1TJEA 3V05A 3Q3OC 3V6EB 1I35A 3JVZX 2EKIA 2DNFA 3LB8C 2BYEA 5G5HA 1AN8A 5LXIB 2AEHA 4XX5A 2MHJA 4OVVA 4AJWA 4AS1A 2CHWA 1E7PB 2VH1A 4TV3A 1GB1A 4N59A 5TSSA 4MM3A 5BO4B 2Y3AA 1WJNA 1WE7A 4F7ZA 2K6QA 4GLSC 4M01A 1RFAA 3CMMB 3MFGA 2Z8LA 4HCPB 3BY4B 4IDIA 2FIDA 1L6VA 3MHZA 3WAPA 3AEBB 2YEPF 3PT2B 1VJKA 1SB3C 2KAJA 1ZP0B 2QIEB 1TS5A 4LNKA 3SR6A 4USAA 1V9JA 3EC8A 2CHZA 1JROA 2K8HA 2L76A 2VZKD 3AB5A 5HFYA 3KUZA 2WDVB 3N20C 4ZRPA 5GXGB 3N3KB 1DGJA 5CHWA 4A8XC 4IM0A 3L0WB 3PS6A 3RI7C 2C7NB 2INNE 1V5OA 2LXCA 3RN9C 4MGKE 2N0SB 3HIZA 2KOXA 4WWNA 1QOBA 3X23A 2PKOA 3WCQA 4F1SA 4WQOB 2KTRB 1T0RC 3KLSX 3WIMA 3KH0A 4OW0A 3MC8A 3M3JA 1SJHD 1GNUA 4BBNC 2GMIC 4CYEA 1EF1A 5IN7A 3VHTC 1E8XA 4RF1A 4KSLC 3QARA 4WWPA 3B0AA 4XZ4A 3N32A 4HK2A 3WAOA 3X0WA 3ZDTA 3C0RB 2KQ7A 3JYUA 3P2BA 1C77A 2PIAA 1PGBA 1C4PA 4BZAA 4HVBA 2JVCA 3ZJTA 3I63C 2IO2B 3MP9A 2V0GA 3RNFC 4UDUC 4K3BA 1E8WA 2UWQA 4MEMA 4JWSC 5AZFA 1E9MA 3VQIA 1KLVA 1PYWD 2L3ZA 2KZRA 1ZXIA 2WYQA 2KD0A 3APFA 3AU4A 3MHSD 2KJ6A 2WXIA 3BWUD 2KN5A 3CF6E 1YN5A 2LJIA 4HKQA 3NVZA 1V81A 2XK5A 2MH7A 3W5UB 3UQBA 2M0AA 4OVZA 4A20A 3L16A 4P1BC 5FR3A 2WDQB 3DBHB 1D6EC 2D2QA 3PGEA 2V1YA 1ZOYB 1TKEA 4E74A 2FNJB 4W9IA 3IXSA 3ZRCA 3RMKC 4IG7B 2BPSA 2LGDA 1UUPA 1WGRA 1I7HA 1F1HA 1UNSA 4NQLB 2K0PA 1F9JA 1LGRA 5E6NA 1C76A 4LDTB 3K9PB 4RGTA 4ZHOA 1I42A 1EU3A 4EEWA 2KVZA 2MCNB 3ZUNA 1WXVA 5DPSA 1TZOA 1V1PA 1TY2A 2WDTB 3N9YC 1KJTA 1NDDA 1OTRB 4US8A 3HK0A 3UF8A 1RYJA 3TEYA 2G45B 3IFWB 4TQ0A 5KHQA 4II3B 1N60A 1YQBA 3L10B 3RYTA 3DBLB 2NVUI 2EELA 4II2B 4WJOA 5BYSA 2ZPYA 3RZFA 1WH3A 1Y56A 4BVUC 2FE8A 4BFRA 2JXTA 1FNVA 2EMSA 3R7QA 2QMTA 2N9PC 3A9KB 2DHZA 2C7HA 2LUEA 4GDKB 2WXKA 3NVVA 1FO4A 5JHBA 5HHDG 3OAWA 4HXDA 3BYYB 1K50A 1IBXA 4HCNB 1CK1A 1VLBA 2A4ZA 1LM8B 3R7RA 1N61A 2V3NA 4NQKE 1CJEA 3Q8CA 4G0NB 3DBRB 1TTNA 2KTFA 2ZNVC 4HKZE 2L52A 1IGDA 2WXNA 2KMAA 1QQRA 3L13A 4LCDE 1FFUA 3OJ3A 5BYRA 4FHKA 2HTHA 3Q14C 3WA0A 4HDOA 5JZEB 3DQVA 2MWSB 2J52A 4KKJA 4OVUA 4MGIE 4MELA 3RNBC 2GOWA 3Q6BA 3FILB 3NOBA 4NY0A 3N1ZC 1R4MB 2KC2A 1GC7A 1JWMD 3M95A 1YX5B 4DQOC 3AMZA 1T6BX 2ZEQA 1P98A 3Q8EA 1RLFA 2FUHB 3CSTA 1F52A 4MH0E 3VDZA 4ANWA 2NTSA 4HJKA 4ZRIA 1IYFA 4B9KA 2E6XA 3AE4B 3Q3JA 1N5XA 3RNGC 4M02A 1UGJA 1M94A 3PO0A 4MSMB 1ZW7A 1NBFC 4WQMA 2MBEA 1IUEA 2CU3A 4RGNA 1C3TA 5EE9A 1SSNA 1J7CA 1HQRD 5JHAA 5IO9A 3PZDA 3UIPB 4DDID 2JPHA 1AARA 4JQWC 3GB1A 1VZ7A 1C79A 4KKIA 3Q8AA 2CR5A 3P42A 2DYMA 1P9DU 1WXSA 4GN1A 2PVOD 2DZKA 4LNOA 3H9DA 2IDYA 1R4NB 1L4ZB 1KLUD 1KTKA 2L00B 3BVMA 1FD6A 2OEDA 3DHGC 1OQQA 2WDRB 1ENFA 1E6EB 4JL9A 2ZW1A 3KW5B 2JQRB 2LRWA 1VDVA 3RNEC 2WX0A 3PRZA 4E71A 2I1JA 2FCSA 3ZNZB 2GBNA 1FCLA 3VAWA 2MJDA 5CHFA 4W9JA 1QKZA 1FNUA 1KLGD 3QX1A 4LTUA 3FAHA 2JZZA 2ZNVB 3A9JB 2HTME 3KUDB 4M0WA 2OHFA 1VRAB 3QHTA 1MJDA 4PS3A 3L17A 2Z0EB 1EUVB 2KXJA 3ZXVA 2SEBD 1YIWA 4RNAA 2M8SA 1V80A 2QDFA 2J0JA 3NG0A 1GB4A 3NVWA 1FXAA 4B0MA 2WNMA 3AU5A 4WIPA 1QF6A 5BMIA 4HLEA 1KM7A 1YN4A 4MJSB 5G55A 3MJWA 3ECIA 2DBYA 2D3CA 2UU7A 4FLHA 2J53A 3ZJUA 1SEBD 1QZEA 1MFWA 4CQNA 2NPTB 1WX9A 5AUIA 5I4DA 2WS3B 4M8NA 3SEBA 2BT6A 2NMQA 4AP4C 1A5RA 3BVZA 2BF8B 4ZRJA 4W9DA 1FFVA 3EA6A 3IG3A 5L83A 1GJZA 1WJUA 3EHVA 1EWYC 3VUWA 3ZRFA 1M4VA 3TL5A 1E8ZA 4PYZA 4DHZB 1J7AA 2V9HA 2KDBA 2PMVA 2V4LA 3DVNV 3JSVA 5HG2A 3W1SA 1D5MC 2KJRA 1FXTB 2K22A 4YWGG 1FEHA 1WF9A 3T9LA 4S0RA 1P1AA 2EKEC 2Z59B 4TSSA 3PHXB 2R61A 2WQYB 4KIKB 4A9AA 2K6DB 3CWIA 1LO5D 2L1AA 3TJPA 5BYQA 4WURA 3UINB 4NNJB 2KTRA 4ZYSA 2VRRB 4YXDB 5FR6A 3U4EG 2JXXA 2Z0DB 5HI1A 3PHWB 4EOYA 2LGIA 5EE1A 2V4IB 3V61A 2FIFA 3ZNHB 1A70A 1WYGA 5BMHA 3EFUA 3IVFA 3V62A 3W5VB 4IW0A 2IBIB 2N9LA 1C78A 1UBQA 1BXTA 3T3OA 1CZPA 2MLBA 3DHIC 4WAAA 3VUXA 4NAWB 2WXHA 5IP4D 2D3AA 4A3PA 4ITKA 3B2FA 3APCA 2RDHA 4WH4A 1E8YA 3MJ5A 1SF0A 1FIQA 3ZXRA 1L6UA 4BAXA 2ZVOA 3HVZA 1YQ4B 1NEKB 4MT5A 2IO1B 1DOIA 4HPPA 4IKGA 2AQ2B 2XEWA 3VRAB 2GLSA 3NUHB 1N62A 1NYQA 1AW7A 2N7DA 3BK1A 2MBOA 3LJ3A 5AEKB 4ZHPA 2LMCA 2HJ1A 4G3XB 1H8CA 1F2RI 4JPSA 1VD2A 2J0KA 5TR5A 3BZDB
chains in the Genus database with same CATH topology
2BB5A 2RDGA 2JU6X 3HVDA 3HUIA 1TKEA 1WRIA 4KGRA 3W2DA 3IXSA 2XN9C 3TEWA 1B9RA 1MI0A 1UUPA 1I7HA 1RM6C 3IAS1 1UNSA 1V1PB 2L83A 1HXYD 3TSSA 1DOXA 1WWTA 2NTTA 1JQ4A 3NZ3A 4ARIA 2K0PA 1TKYA 2KDMA 2IGDA 1C76A 4OHJA 4ZHOA 3EUB2 4RGTA 1EU3A 2FBWB 2BS2B 5EE0A 1QOGA 2QSDA 1QOAA 3TEZA 1KH0A 1TZOA 1P7EA 1TY2A 1V1PA 1V97A 1WGKA 3N9YC 4FXCA 2LFIA 2M19A 5C3JB 2Q5WD 4RF0A 1I4QA 1E10A 4US8A 1TYGB 4O1NA 1JW9D 3GP7A 3AE8B 1RYJA 5D3DA 1L4DB 2WXQA 3TEYA 1SE3A 4TQ0A 1BUIC 1MHHE 1N60A 3J9CA 1ET6A 2W3SA 1NYRA 2BB6A 1BMLC 3AE3B 1JWUD 1L0VB 1TS3A 2AQ3B 2EELA 3PZ8A 2ACZB 2BTEA 1D4BA 3AM9A 5BYSA 4YTNB 1FRDA 3AH7A 1F0ZA 1Y56A 1B1ZA 2FE8A 2JXTA 2SAKA 1FNVA 1IBXB 1YJIA 3BVGA 2QMTA 2BBCA 4XDCA 1NI3A 2JSVX 4XDDA 3B9JA 3I9V1 2WXPA 4GDKB 2WXKA 2E3TA 1D5ZC 4L1BA 1CQVA 1C9FA 4B0EA 1MHXA 2X38A 3NVVA 1Q10A 3U52E 1FO4A 5HHDG 2IJ0A 1XO3A 4LK0M 4TMAB 3BYYB 1K50A 1IBXA 1GPXA 1CK1A 1VLBA 2TSSA 2WXRA 1XLOA 4ARCA 1I4HA 1N61A 4L23A 2V3NA 3BIID 3NS1A 2JWUA 2W54A 3AEFB 3AV8A 1CJEA 1JWSD 1N63A 3Q8CA 4WWMA 3P1MA 1F77A 3VR9B 4HKZE 2MJ3A 2L52A 1IGDA 2WXNA 1DOYA 1QQRA 2KMMA 3URYA 4D2KA 2K5PA 1P7FA 1XCTL 1FFUA 3ZJVA 5BYRA 1JWBD 1J7BA 1JWAD 1QLBB 1YN3A 1KFYB 2DYOA 1QOFA 1V8CA 2J52A 4KKJA 1RWSA 3B2GA 2PLPA 1SBBB 1XF5L 2YEPB 3ZGZA 4YSYB 1R7SA 2K9XA 4ZOHC 3FILB 5D7GA 1AWDA 3H8HA 1ACCA 3IAM1 1TS4A 1FCCC 2GRIA 4ZRQA 1JWMD 4P16A 1KRHA 3BK2A 4OZBA 1I4XA 4DQOC 3AMZA 1T6BX 4NZLB 1N5WA 1SE4A 3Q8EA 1ESFA 2H88B 3AN1A 3FILA 2WLBA 4HEA1 1WXQA 1NENB 3P4QB 4JWUC 4LLGM 4HJGE 2KN4A 3EGRA 3P4RB 2NTSA 1YNTE 2IGHA 2QJLA 1WSPA 2E6XA 3AE4B 2FUG1 2WXLA 1N5XA 4PT5A 1ZPSA 1UGJA 3TEXA 1V1OA 4US9A 3ZYYX 3OWEB 1YMHE 1FNWA 3C8YA 3PO0A 5FKAC 2D5GA 1C4AA 2DLBA 2HDEA 4WQMA 5T8IA 2BYTA 3SFEB 4A6QA 1IUEA 2JZPA 2VZKB 2CU3A 4RGNA 4AQ7A 4C7YA 2G1EA 2KQ4X 1SSNA 4GDLB 3KQ4A 5EE9A 1HQRD 1J7CA 2LUMA 2LHDA 2B76B 2PVGC 5FK9C 3U2SC 2DWQA 2H89B 1T3QA 3GB1A 1FMAD 1XXGA 1L0XB 2K3UA 2N7JA 1JRPA 1C79A 1VZ7A 4KKIA 3P42A 3Q8AA 2DYMA 4Q2JA 1C4CA 2WXMA 4C56C 2PVOD 2J42A 1XLNA 4WAFA 5MPOA 4YT0B 2JYEA 3ZQ4A 4N58A 2IDYA 3MC0B 3IT4B 3AE1B 3AEEB 3DWGC 1L4ZB 1KLUD 1KTKA 1JMLA 3PZ7A 3BVMA 4RCOA 1PGAA 4L2YA 2OEDA 5EE3A 1FD6A 1E0ZA 1OQQA 3Q69A 2L32A 2WDRB 1ENFA 1E6EB 3GS2A 5H8YE 2G9HD 1SIJA 1XLPA 2KWDA 4YTPB 2ZW1A 2JQRB 3NRZA 1I4PA 4J3OD 2Y5PA 1L5PA 4XE0A 1VDVA 4MACA 1OFFA 4NAMA 3Q8FA 1VR9A 1FCLA 2MJDA 1T5XD 1L0YB 1SE2A 3TUOA 1ZXHA 1QKZA 1FNUA 2BW2A 1QILA 2PW9A 4C7ZA 1KLGD 2ZW0A 3LXFA 1JCKB 1OQRA 3IT6B 3FAHA 4LTUA 3HRDD 3AE9B 1TJEA 3V05A 3LYYA 2HTME 4KGTA 4M0WA 2OHFA 2PTLA 1VRAB 2EKIA 3LB8C 1YJJA 5JXVA 5G5HA 4MH8A 4MM3B 1EU4A 1YQ3B 1AN8A 2SEBD 4RNAA 1PDXA 1ZE3D 3NVYA 4N6EB 3ETRA 4AS1A 1GB4A 1E7PB 3NVWA 1FXAA 4B0MA 1GB1A 4N59A 5TSSA 1JALA 1STEA 2WNMA 2Y3AA 1EM7A 4WIPA 1VZ6A 5G5GA 1QF6A 2I2YA 4GLSC 2KACA 5BMIA 1EWCA 4A90A 3MFGA 3RFZB 1YN4A 2DBYA 2Z8LA 2J4XA 2AX5A 2N9KA 4REZA 3AEGB 4IDIA 2J53A 1L6VA 2W3RA 3MHZA 3ZJUA 2BS3B 3AEBB 2YEPF 1SEBD 3P4PB 1SJED 5LNK1 4KX6B 3E9SA 4CQNA 1VJKA 1SB3C 4C80A 4YTMB 5AUIA 2XNAC 5I4DA 2WS3B 3Q8BA 2KAJA 4XWWA 4RGOS 5H92C 3SEBA 1HEZE 1ZP0B 1TS5A 2QIEB 4HROA 2BT6A 2IPKD 3SR6A 2ICIA 2GI9A 2Y5CA 2NMQA 2W55A 5BMGA 4USAA 1MVKA 2I38A 3BVZA 2MEKA 1AYFA 1JROA 1PFDA 1FFVA 1UWMA 2QEJC 2VZKD 3VR8B 3AB5A 3EA6A 3O13A 5HFYA 3AEDB 2WDVB 4EE2A 4HRSA 3UI3A 3SFDB 1EWYC 4ZRPA 3RPFC 5GXGB 2INPE 1M4VA 2RPVA 3AE2B 1DGJA 4RGMA 4IOIE 3I57A 2ONQA 4A8XC 1J7AA 1ZUD2 2PMVA 4OZCA 1IGCA 5HG2A 3DWMA 3W1SA 1D5MC 2INNE 2K22A 2RMMA 2V3PA 2WP9B 2ON8A 4YWGG 1FEHA 2WXOA 2N0SB 3W9CB 1F2RC 1QOBA 2PKOA 3WCQA 1HZ6A 4R3DA 4TSSA 1FXIA 3KLSX 2R61A 2WQYB 1KF6B 4RH6A 4XWTA 4OW0A 1ET9A 3V3XA 1I4GA 4A9AA 1SJHD 2MJEA 2CJOA 3AEAB 4RF1A 3R2TA 1PUTA 3CWIA 1LO5D 2JYTA 2L1AA 3R8BA 3CIRB 3KWLA 5BYQA 4WURA 1XEEA 4NJCA 3R2IA 4ZYSA 4YSZB 1RFKA 1K53A 4YXDB 3U4EG 2LHEA 3AE5B 5HI1A 1ZDVA 1HA5A 4A55A 2GB1A 2WXJA 4YSXB 1MPEA 1C77A 2PIAA 1TS2A 2LGIA 5EE1A 1PGBA 2V4IB 1GAQB 1ROEA 2WU2B 1C4PA 1HZ5A 1TY0A 1A70A 4RFBA 1WYGA 2M56B 5BMHA 3ZJTA 3MP9A 1K51A 3AECB 3KWVA 3W5VB 2V0GA 4UDUC 2N9LA 1C78A 5C2TB 3BYTB 1BXTA 4JWSC 3P4SB 3T3OA 1CZPA 1FRRA 4DXFA 4JE3B 4NAWB 2WXHA 1E9MA 3P63A 3AE7B 2WXGA 3VQIA 2BS4B 1PYWD 2AQ1B 4OZAA 4ITKA 1TKGA 1ZXIA 3B2FA 4KGSA 3VRBB 4H2AA 2RDHA 4WH4A 1XLQA 5AUKA 3MJ5A 1SXTA 1SF0A 1FIQA 1QT9A 2W82A 1L6UA 3U7ZA 2WXIA 3BWUD 1NVID 1VZ8A 3HVZA 1UWXA 2JX5A 1YN5A 3FC4A 2LJIA 4HKQA 1YQ4B 3NVZA 1NEKB 4P6VF 1PGXA 1GOZA 3W5UB 2MH7A 2WU5B 1I4RA 4MT5A 2M0AA 3AE6B 4OVZA 4DXGA 1DOIA 5E6JA 4TQ1A 4IKGA 3E56A 2IGGA 1D5XC 2AQ2B 3VRAB 3NUHB 1N62A 5FR3A 1NYQA 1AW7A 2WDQB 2LEKA 2QILA 2WXFA 3BK1A 1K52A 1DYQA 3T3NA 1FM0D 1D6EC 1XCQL 3ABVB 4ZHPA 5D3IB 2LMCA 3L4PA 1F2RI 4JX1C 2CJNA 4JPSA 1ZDXA 3BZDB 1ZOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIJ A;  1XLP A;  2K22 A;  4YTP B;  1JWB D;  2JQR B;  3NRZ A;  1J7B A;  1JWA D;  1QLB B;  1TKE A;  1KFY B;  1L5P A;  1WRI A;  2WP9 B;  3HUI A;  1VDV A;  1QOF A;  3DWM A;  1V8C A;  1OFF A;  2N0S B;  3W9C B;  1B9R A;  1RWS A;  3B2G A;  1QOB A;  2PKO A;  2MJD A;  1I7H A;  1RM6 C;  3WCQ A;  4YSY B;  2L83 A;  1R7S A;  2K9X A;  1DOX A;  1WWT A;  1JQ4 A;  1FXI A;  4ZOH C;  1TKY A;  1AWD A;  2WQY B;  1KF6 B;  4C7Z A;  3LXF A;  1OQR A;  4LTU A;  3FAH A;  2MJE A;  4A9A A;  4ZHO A;  3EUB 2;  3HRD D;  2CJO A;  3AE9 B;  1TJE A;  3AEA B;  1KRH A;  2FBW B;  2HTM E;  1PUT A;  3CWI A;  2BS2 B;  2OHF A;  5EE0 A;  3AMZ A;  1QOG A;  2EKI A;  1QOA A;  3CIR B;  3LB8 C;  1YJJ A;  3KWL A;  1N5W A;  1V97 A;  4FXC A;  5G5H A;  1WGK A;  2H88 B;  5C3J B;  2M19 A;  3AN1 A;  2Q5W D;  1YQ3 B;  4YSZ B;  1RFK A;  1E10 A;  1PDX A;  2WLB A;  4US8 A;  4YXD B;  1TYG B;  1JW9 D;  1WXQ A;  1NEN B;  3AE5 B;  3AE8 B;  1RYJ A;  3NVY A;  3P4Q B;  3ETR A;  4JWU C;  4N6E B;  3P4R B;  4YSX B;  1E7P B;  3NVW A;  1FXA A;  1N60 A;  2PIA A;  5EE1 A;  1GAQ B;  1ROE A;  2QJL A;  1JAL A;  2W3S A;  2WU2 B;  1NYR A;  3AE4 B;  4N59 A;  3AE3 B;  1N5X A;  1A70 A;  1L0V B;  1WYG A;  2M56 B;  5G5G A;  1QF6 A;  3AEC B;  3W5V B;  5H8Y E;  2ACZ B;  5C2T B;  4JWS C;  3AM9 A;  3P4S B;  4US9 A;  3ZYY X;  1CZP A;  1FRR A;  4YTN B;  1FRD A;  2DBY A;  3AH7 A;  3PO0 A;  1F0Z A;  1E9M A;  2AX5 A;  3P63 A;  3AE7 B;  2BS4 B;  3AEG B;  4IDI A;  1L6V A;  2W3R A;  1YJI A;  4WQM A;  2BS3 B;  3SFE B;  3AEB B;  1IUE A;  3P4P B;  1NI3 A;  2CU3 A;  1TKG A;  1ZXI A;  3B9J A;  4ITK A;  3B2F A;  3VRB B;  4KX6 B;  4C7Y A;  5AUK A;  1XLQ A;  2G1E A;  2E3T A;  1SB3 C;  1VJK A;  5EE9 A;  1SF0 A;  1FIQ A;  4C80 A;  1J7C A;  1QT9 A;  4YTM B;  5AUI A;  1L6U A;  2WS3 B;  3NVV A;  2KAJ A;  1FO4 A;  1NVI D;  5H92 C;  2B76 B;  1XO3 A;  3HVZ A;  1ZP0 B;  2PVG C;  2QIE B;  2JX5 A;  2BT6 A;  3FC4 A;  4HRO A;  3SR6 A;  1GPX A;  2Y5C A;  1YQ4 B;  3NVZ A;  1NEK B;  2DWQ A;  2H89 B;  2W55 A;  1T3Q A;  1VLB A;  4P6V F;  4USA A;  1FMA D;  1XLO A;  3W5U B;  2MH7 A;  1AYF A;  1JRO A;  1JRP A;  2WU5 B;  1N61 A;  1PFD A;  1FFV A;  1UWM A;  3AE6 B;  3VR8 B;  3BII D;  3AB5 A;  1DOI A;  3AED B;  3NS1 A;  2PVO D;  2W54 A;  1XLN A;  2WDV B;  3AEF B;  3AV8 A;  5MPO A;  4YT0 B;  1CJE A;  4HRS A;  3VRA B;  1N63 A;  3SFD B;  1EWY C;  4N58 A;  3RPF C;  1N62 A;  4WWM A;  5GXG B;  1NYQ A;  2WDQ B;  3AE1 B;  3AEE B;  2LEK A;  3AE2 B;  3DWG C;  3P1M A;  1DGJ A;  2MJ3 A;  2L52 A;  3VR9 B;  1FM0 D;  3ABV B;  5EE3 A;  4ZHP A;  2KMM A;  1DOY A;  1E0Z A;  1OQQ A;  2K5P A;  1J7A A;  3L4P A;  2WDR B;  4JX1 C;  2CJN A;  1ZUD 2;  1E6E B;  1FFU A;  1ZOY B; 
#chains in the Genus database with same CATH topology
 2BB5 A;  2RDG A;  2JU6 X;  3H1U A;  3HUI A;  3U8Z A;  3W2D A;  2D07 B;  2XN9 C;  2K8B A;  5D6J B;  1HXY D;  1DOX A;  1JQ4 A;  3NZ3 A;  3H7P B;  1TKY A;  2KDM A;  2IGD A;  4OHJ A;  2RSU A;  3EUB 2;  4FA6 A;  2FAZ A;  2C7M B;  4K3C A;  2QSD A;  1QOA A;  3TEZ A;  4EUT A;  2I1K A;  5EDS A;  1TIF A;  4LNN A;  1D3Z A;  1I4Q A;  2D10 A;  1XT9 B;  3GP7 A;  3NY5 A;  5KHO A;  5D3D A;  4EZJ A;  4S17 A;  1BUI C;  3PLV A;  1MHH E;  2KQS A;  1HTQ A;  1ET6 A;  2BB6 A;  3AE3 B;  2IY0 B;  1TS3 A;  3RUL A;  4QAY A;  1D4B A;  3AM9 A;  3QAQ A;  1L7Y A;  3S2A A;  1F0Z A;  1B1Z A;  4BOZ B;  1SIF A;  2SAK A;  2LRU A;  3BVG A;  1J8C A;  4XDC A;  1XD3 B;  1NI3 A;  2CKH B;  4M00 A;  2E3T A;  4L1B A;  1CQV A;  3KUC B;  4MSQ B;  4B0E A;  2X38 A;  1WMH A;  4KDL B;  1Q10 A;  2FCM A;  1WGH A;  1XO3 A;  3QCA A;  4LK0 M;  4BBN F;  4YL8 A;  1ZKH A;  2WWZ A;  1GPX A;  1OGW A;  4EFO A;  3A9K A;  2TSS A;  2WXR A;  3A4S C;  1XLO A;  4KSK C;  4GDK A;  2XBB C;  5CTR C;  3NS1 A;  3AEF B;  4HPL B;  5G2N A;  1JWS D;  1N63 A;  3DVG X;  4D2K A;  2K5P A;  1P7F A;  1XCT L;  3PRE A;  4IWP A;  4GXB A;  4K1R B;  3ZJV A;  1JWB D;  4JLC A;  1J7B A;  1KFY B;  1WFY A;  3RNA C;  2DYO A;  1J0G A;  1MG4 A;  3VTW A;  1SBB B;  2YEP B;  2LVO A;  2ZCC A;  4ASW C;  5D7G A;  1AWD A;  2BQQ A;  2N9E B;  1FCC C;  5DPW A;  4IWQ A;  1KRH A;  3BK2 A;  4OZB A;  3PV1 A;  4C00 A;  4NZL B;  1V6E A;  1N5W A;  1ESF A;  3FIL A;  1RAX A;  4LNI A;  5LXH A;  1WXQ A;  2KHW B;  3P4Q B;  3QQ8 B;  2KN4 A;  2AL3 A;  3P4R B;  4LDT D;  2BYF A;  2FUG 1;  1WI0 A;  2K25 A;  3D32 A;  4PT5 A;  4BKT A;  3Q3F A;  1T0Y A;  1ZPS A;  2RD0 A;  3TEX A;  4TKN A;  3ZYY X;  4ANV A;  2KFK A;  3C8Y A;  1C4A A;  2NBW B;  1WYW B;  2HDE A;  2DZM A;  4AQ7 A;  2C9W B;  2MX2 A;  2G1E A;  3V6C B;  4GDL B;  2C60 A;  1WGY A;  2LHD A;  2NS5 A;  2B76 B;  4KVG B;  5FK9 C;  3U2S C;  4I6N B;  1OQY A;  5GMV A;  2H89 B;  1FMA D;  1XXG A;  1L0X B;  2KLC A;  3RCZ A;  1JRP A;  1TT5 B;  5L95 C;  2N4F A;  4Q2J A;  2WXM A;  3PVL A;  4YT0 B;  2JYE A;  1WM3 A;  4B95 A;  3MC0 B;  3IT4 B;  3DWG C;  3PZ7 A;  2KWU B;  4RCO A;  1PGA A;  2KDI A;  2J7Q B;  2L32 A;  3DDC B;  2L8J A;  2KT7 A;  5H8Y E;  4DWF A;  2KK8 A;  5J2R A;  1SIJ A;  3NHE B;  3PTF C;  4J3O D;  1L5P A;  3A1Q B;  3ML9 A;  2BKF A;  4MAC A;  4NAM A;  2J0M A;  2M4N A;  1HTO A;  3ENE A;  2L05 A;  2PE6 B;  2PW9 A;  3WAN A;  4C7Z A;  3PPA A;  4A3O A;  4DBG A;  2W9N A;  3LYY A;  4KGT A;  2PTL A;  2KMC A;  5CHV C;  5JXV A;  2O6V B;  1EU4 A;  2OJR A;  1YQ3 B;  1PDX A;  2B3A A;  1GG3 A;  4PS8 A;  3NVY A;  3ETR A;  3A9J A;  3OLM D;  1JAL A;  1STE A;  1E7V A;  1EM7 A;  5G5G A;  3ZTC A;  3NZU A;  1UGM A;  1EWC A;  2O2V A;  4HPM B;  1H4R A;  1WGG A;  2J4X A;  2ZJD A;  2AX5 A;  2N9K A;  4REZ A;  2LGY A;  3APD A;  2W3R A;  3GZN B;  3TBL D;  2BS3 B;  4ZDV A;  3H7S A;  1SJE D;  3E9S A;  4W9F A;  2NBU A;  4C80 A;  4MJS A;  4RMA A;  4YTM B;  4EKU A;  2Y5B B;  3I5J C;  3OJ4 B;  4WJQ A;  4RGO S;  4XWW A;  1HEZ E;  4HRO A;  2QCZ A;  5BMG A;  3EFC A;  2I38 A;  1AYF A;  3ONS A;  5IKC M;  2QEJ C;  3VR8 B;  2N1V A;  3KYD D;  4WWO A;  2YVC A;  4EE2 A;  3SFD B;  4W9E A;  1SE9 A;  3SDL C;  2WHI A;  2MRP A;  3AE2 B;  4IOI E;  3I57 A;  2ONQ A;  3T8M A;  1OEY J;  1WZ0 A;  2QHO A;  2MQJ A;  4OZC A;  2M1M A;  3DWM A;  2RMM A;  2KX3 A;  4G11 A;  2WP9 B;  3DBS A;  2WXO A;  3W9C B;  4CHK A;  1CMX B;  1WXM A;  4C4V B;  4TUU A;  1RRB A;  3TIX A;  4XWT A;  1KF6 B;  1ET9 A;  3V3X A;  4W9H A;  2MJE A;  2RGF A;  2CJO A;  3R2T A;  1PUT A;  5AZG A;  1LQB A;  2JYT A;  4GSW A;  3KWL A;  3N30 A;  1T0S C;  3ZO5 B;  4KIK A;  1K53 A;  1BT0 A;  2PPH A;  2LHE A;  1TGZ B;  4YSX B;  4K7W A;  1TS2 A;  4AUQ C;  1GAQ B;  1ROE A;  1V49 A;  2WU2 B;  2DZJ A;  4W9L A;  1HZ5 A;  1TY0 A;  2MP2 B;  5DPR A;  2M56 B;  2PJH A;  3AEC B;  3DBH I;  2LAS A;  3BYT B;  2BWF A;  4DXF A;  2BS4 B;  3VH4 B;  3TMP B;  2AQ1 B;  4OZA A;  3PRP B;  1SGH A;  2BKR B;  3VRB B;  4H2A A;  5AUK A;  1XLQ A;  3UQA A;  3M62 B;  1QT9 A;  3U7Z A;  4NAW A;  1NVI D;  4ZYN A;  1X1M A;  3QC8 B;  2JX5 A;  3FC4 A;  1IPG A;  2NR2 A;  1PGX A;  1GOZ A;  1HE8 A;  2WU5 B;  1I4R A;  2D3B A;  4DXG A;  1PQS A;  4TQ1 A;  5CX3 A;  3E56 A;  1D5X C;  4XGA B;  3VFK A;  1WRD B;  3RD2 A;  3T3N A;  1DYQ A;  2IO3 B;  1FM0 D;  1XCQ L;  3ABV B;  5D3I B;  3L4P A;  2VH2 A;  1FPY A;  3KVF B;  3JW0 X;  3DBL I;  1KOT A;  4K7U A;  3KYC D;  4LNF A;  2G3Q B;  2UYZ B;  1UD7 A;  3TEW A;  3L54 A;  1B9R A;  1MI0 A;  1Z5S B;  1RM6 C;  2FCQ A;  3IAS 1;  4IWO A;  3L08 A;  2NTT A;  3NZS A;  4ARI A;  4WJN A;  2MSE D;  2FBW B;  4RM8 A;  5IAA C;  1QOG A;  1P7E A;  4FXC A;  4CO7 A;  1WGK A;  5C3J B;  2LFI A;  2Q5W D;  3H7P A;  3DPD A;  1E10 A;  1TYG B;  1JW9 D;  2INC C;  1TBE A;  4FJV B;  4NPN A;  3ZTD A;  1L4D B;  2WXQ A;  1SE3 A;  5D2M B;  3A4R A;  2KWC A;  2M17 A;  3J9C A;  4DHJ D;  1NYR A;  2D3G A;  1BML C;  3DBR I;  1JWU D;  1L0V B;  3B1L X;  3AI5 A;  3PZ8 A;  3MC9 A;  4DHJ B;  2BTE A;  3LDZ E;  2MA9 B;  1YJI A;  3U30 A;  2LI5 A;  2BBC A;  4XC2 A;  5C23 A;  3RUI B;  3I9V 1;  3ML8 A;  2WXP A;  4X57 B;  3R3M A;  4FAD A;  1C9F A;  2DEN B;  3U52 E;  4ICU A;  1R4M I;  2ZVN A;  1GUA B;  4HDQ A;  4L23 A;  3QJZ A;  5IA7 A;  2JWU A;  2W54 A;  2WGS A;  3AV8 A;  1Y8R C;  2YLM A;  5C1Z A;  1YD8 U;  1WJ6 A;  2OOB B;  1WIA A;  3WAM A;  1F77 A;  2MJ3 A;  3SHQ A;  2MBQ A;  1DOY A;  3URY A;  1WX8 A;  3DHH C;  1JWA D;  1QLB B;  3SD5 A;  4AOF A;  2N7E A;  2QC8 A;  4J6I A;  3AXC A;  2HD5 B;  1UF0 A;  1V8C A;  3VTV A;  1RWS A;  3B2G A;  2PLP A;  3GE3 C;  4YSY B;  1R7S A;  4ZOH C;  3VVW B;  3IAM 1;  2DAJ A;  2GRI A;  3FKY A;  2AL6 A;  4P16 A;  3IHP C;  2R2O A;  5HKH A;  1NEN B;  2AWT A;  4JWU C;  4HJG E;  3EGR A;  2K1F A;  5AZH A;  2IGH A;  2QJL A;  1WSP A;  2WXL A;  1R4N I;  4HWI B;  4FJY A;  2N9X A;  1V1O A;  4US9 A;  2KDF B;  3RZW C;  3ZNG C;  2D5G A;  3PRM B;  1JRU A;  3HM3 A;  2DLB A;  1YX6 B;  2KFJ A;  3ZVV A;  3JSV B;  4FJZ A;  4GGQ A;  4ICV A;  5T8I A;  5J17 A;  2VZK B;  2KQ4 X;  3KQ4 A;  2LUM A;  3IBE A;  2LWP A;  4DDG D;  4E3C A;  4BKS D;  4I6P A;  1UEL A;  2DWQ A;  2N7J A;  1Q5W B;  1Z2M A;  3UGB B;  4GDL A;  4C56 C;  1XLN A;  2KO3 A;  1TZ1 A;  1WE6 A;  4W9C A;  4N58 A;  3W1Y A;  2DYB A;  3AE1 B;  3AEE B;  4GB9 A;  2IND C;  1JML A;  3ALB A;  5EE3 A;  2GBM A;  3Q69 A;  1NI2 A;  1IP9 A;  3GS2 A;  4FBJ B;  2G9H D;  3U7D A;  1XLP A;  4YTP B;  1J19 A;  2RR9 A;  3NJT A;  4MGZ E;  3Q8F A;  4NJ6 A;  3TUO A;  1L0Y B;  1P0R A;  2C5L C;  5IOI A;  3Q3M C;  5E6P A;  4M8M A;  1QIL A;  4FUL A;  3N1X C;  2ZW0 A;  3LXF A;  3R66 C;  1JCK B;  3IT6 B;  3A1Q A;  3HRD D;  3QWZ B;  3VUY A;  3AE9 B;  4F8C B;  1WXA A;  3VXW A;  1YJJ A;  4MH8 A;  4MM3 B;  1ZE3 D;  4K7S A;  4GMV A;  4N6E B;  2KLG A;  3ZW3 A;  2O6V A;  4GOC A;  3I3T B;  1VZ6 A;  3V60 A;  2I2Y A;  1K8R B;  2KAC A;  4A90 A;  3RFZ B;  2JWZ A;  2JZ3 B;  3AEG B;  1WR1 A;  3P4P B;  2KJH B;  3N1Y C;  5LNK 1;  4KX6 B;  2DZI A;  1Q1O A;  2XNA C;  3Q8B A;  2MBB B;  5H92 C;  2IPK D;  2ICI A;  3VTU A;  2GI9 A;  2Y5C A;  2W55 A;  1MVK A;  2MEK A;  1Q0W B;  1PFD A;  1UWM A;  4G50 A;  3K9O B;  3O13 A;  2N1W A;  4EZK A;  3AED B;  3OG5 A;  2GBR A;  2G4D B;  4HRS A;  3UI3 A;  3RPF C;  4IM2 A;  4JIO U;  2INP E;  2RPV A;  4RGM A;  4ANU A;  2LJ5 A;  1UH6 A;  1C1Y B;  1YOV B;  1WR6 E;  1ZUD 2;  1IGC A;  1WY8 A;  2V3P A;  2KX0 A;  2LD9 A;  2ON8 A;  4BKG A;  4BOS C;  1F2R C;  2LGS A;  2REX A;  1HZ6 A;  4R3D A;  2L0F A;  1UBI A;  2IY1 B;  4ANX A;  1FXI A;  1WGD A;  4RH6 A;  1I4G A;  2R2Q A;  2ZCB A;  4MGY E;  3AEA B;  2OJW A;  2LZ6 A;  1T0Q C;  3CIR B;  3R8B A;  4C4V A;  1WMH B;  1XEE A;  4DXA B;  4NJC A;  3R2I A;  4AWJ A;  2V3S A;  4YSZ B;  2G4S A;  1RFK A;  2KNB A;  4FN2 A;  1U4A A;  2IYD B;  3AE5 B;  3H6N A;  1ZDV A;  4PS7 A;  1HA5 A;  1WX7 A;  4A55 A;  2GB1 A;  2WXJ A;  3M63 B;  1MPE A;  3RNC C;  1V86 A;  3EEC A;  4RFB A;  2JT4 B;  2O6V D;  3DVG Y;  4ZRK A;  3KWV A;  1K51 A;  2DX5 B;  3HHM A;  2NCN A;  5C2T B;  3P4S B;  1L2N A;  1WZ3 A;  1FRR A;  4JE3 B;  4DHZ E;  2JF5 A;  4PYU A;  3P63 A;  2KVR A;  2WXG A;  1UZX B;  3AE7 B;  1VCB A;  4GIV A;  2MP2 A;  2FCN A;  1TKG A;  2XK5 B;  2HJ8 A;  4KGS A;  1SXT A;  4B6W A;  3PLU A;  2ZPN A;  2W82 A;  1E5W A;  4KV2 A;  1VZ8 A;  3ZDM C;  4GU2 A;  2L0T A;  1UWX A;  2JRI B;  4P6V F;  2BGF A;  2RPQ A;  3AE6 B;  4PK1 A;  3ZLZ A;  3QK0 A;  5E6J A;  2KDE B;  2IGG A;  3C19 A;  1E90 A;  2CHX A;  2GBJ A;  2LEK A;  2QIL A;  2WXF A;  2WX1 A;  1K52 A;  5E6O A;  4JX1 C;  2CJN A;  3GOE A;  1ZDX A;  4P7I A;  2AYO B;  5DCN A;  3HVD A;  1WRI A;  4KGR A;  2PEA A;  3B08 A;  2NPT A;  1XQQ A;  4FHJ A;  2JRH A;  5DPT A;  2KFK B;  4EZL A;  3Q2A C;  1V1P B;  2L83 A;  3NS8 A;  3TSS A;  1WWT A;  4MDK E;  1YJ1 A;  2CU1 A;  1S1Q B;  4N9F 4;  2DAF A;  2BS2 B;  5EE0 A;  2X8X X;  5J18 A;  2EMT A;  1KH0 A;  1V97 A;  2M19 A;  4IUM B;  1LXD A;  4RF0 A;  3A33 B;  2CS4 A;  4I6L B;  4O1N A;  4KDI C;  3AE8 B;  1G6J A;  3AUL A;  4ACF A;  1V2Y A;  2W3S A;  2AQ3 B;  2IZV B;  2MBH A;  2ACZ B;  2LVP A;  1P3Q U;  4YTN B;  1FRD A;  3AH7 A;  1IBX B;  4LJP B;  1WM2 A;  2JSV X;  2IO0 B;  2KKC A;  3B9J A;  4IC7 B;  4XDD A;  1D5Z C;  1MHX A;  1WJ4 A;  2BWE S;  2IJ0 A;  4TMA B;  4XYC A;  1N6Z A;  2RDB C;  3CSF A;  2LGX A;  4ARC A;  1I4H A;  2KAN A;  4URK A;  3BII D;  3HM6 X;  4JGH B;  4K81 A;  4WWM A;  3P1M A;  2MW5 A;  3VR9 B;  4LJO B;  2M0X A;  4IM3 A;  2KMM A;  3PSE B;  3UIO B;  3VH3 B;  1S3S G;  2ASQ A;  4KZC A;  2D11 A;  1YN3 A;  2A5U A;  2K8C A;  1QOF A;  2O2V B;  1XF5 L;  3ZNI D;  2HE7 A;  3ZGZ A;  2K9X A;  2LVQ A;  3H8H A;  1ACC A;  3ZIM A;  1GC6 A;  1TS4 A;  4ZRQ A;  1ISN A;  1I4X A;  1SE4 A;  3QIJ A;  1MG8 A;  2H88 B;  3AN1 A;  2GBK A;  1EF5 A;  2WLB A;  4HEA 1;  4WJP A;  2KWV B;  4LLG M;  2JY6 A;  1YNT E;  2PE9 A;  2LXA A;  4P1C C;  4W9G A;  3QA8 A;  2ZZP B;  3OWE B;  1YMH E;  1FNW A;  5FKA C;  5D94 A;  5LLI A;  3W1S C;  2BYT A;  3SFE B;  4A6Q A;  5JH5 C;  3TCA A;  2JZP A;  3ZKJ C;  4C7Y A;  4NJ7 A;  1LFD A;  1EO6 A;  2KYW A;  3GE8 C;  4KZ0 A;  2K39 A;  3RT3 B;  2PVG C;  1T3Q A;  2BYV E;  2KC1 A;  4AJY B;  2K3U A;  3SU8 X;  2JUO A;  3DOW A;  1ZGU B;  3MTN B;  1C4C A;  1E7U A;  4DK5 A;  1V5T A;  4WAF A;  2J42 A;  5MPO A;  3ZQ4 A;  2NBV B;  2BVC A;  4W9K A;  2L7R A;  4L2Y A;  3Q3N C;  4RM9 A;  1E0Z A;  4BKS A;  1OEY A;  3DCG A;  2KWD A;  3WAL A;  3NRZ A;  1I4P A;  2Y5P A;  3BIN A;  4XE0 A;  4M0W B;  1OFF A;  3O65 B;  1VR9 A;  1T5X D;  1SE2 A;  1ZXH A;  2BW2 A;  3GZN I;  1OQR A;  3DVN U;  1TJE A;  3V05 A;  3Q3O C;  3V6E B;  1I35 A;  3JVZ X;  2EKI A;  2DNF A;  3LB8 C;  2BYE A;  5G5H A;  1AN8 A;  5LXI B;  2AEH A;  4XX5 A;  2MHJ A;  4OVV A;  4AJW A;  4AS1 A;  2CHW A;  1E7P B;  2VH1 A;  4TV3 A;  1GB1 A;  4N59 A;  5TSS A;  4MM3 A;  5BO4 B;  2Y3A A;  1WJN A;  1WE7 A;  4F7Z A;  2K6Q A;  4GLS C;  4M01 A;  1RFA A;  3CMM B;  3MFG A;  2Z8L A;  4HCP B;  3BY4 B;  4IDI A;  2FID A;  1L6V A;  3MHZ A;  3WAP A;  3AEB B;  2YEP F;  3PT2 B;  1VJK A;  1SB3 C;  2KAJ A;  1ZP0 B;  2QIE B;  1TS5 A;  4LNK A;  3SR6 A;  4USA A;  1V9J A;  3EC8 A;  2CHZ A;  1JRO A;  2K8H A;  2L76 A;  2VZK D;  3AB5 A;  5HFY A;  3KUZ A;  2WDV B;  3N20 C;  4ZRP A;  5GXG B;  3N3K B;  1DGJ A;  5CHW A;  4A8X C;  4IM0 A;  3L0W B;  3PS6 A;  3RI7 C;  2C7N B;  2INN E;  1V5O A;  2LXC A;  3RN9 C;  4MGK E;  2N0S B;  3HIZ A;  2KOX A;  4WWN A;  1QOB A;  3X23 A;  2PKO A;  3WCQ A;  4F1S A;  4WQO B;  2KTR B;  1T0R C;  3KLS X;  3WIM A;  3KH0 A;  4OW0 A;  3MC8 A;  3M3J A;  1SJH D;  1GNU A;  4BBN C;  2GMI C;  4CYE A;  1EF1 A;  5IN7 A;  3VHT C;  1E8X A;  4RF1 A;  4KSL C;  3QAR A;  4WWP A;  3B0A A;  4XZ4 A;  3N32 A;  4HK2 A;  3WAO A;  3X0W A;  3ZDT A;  3C0R B;  2KQ7 A;  3JYU A;  3P2B A;  1C77 A;  2PIA A;  1PGB A;  1C4P A;  4BZA A;  4HVB A;  2JVC A;  3ZJT A;  3I63 C;  2IO2 B;  3MP9 A;  2V0G A;  3RNF C;  4UDU C;  4K3B A;  1E8W A;  2UWQ A;  4MEM A;  4JWS C;  5AZF A;  1E9M A;  3VQI A;  1KLV A;  1PYW D;  2L3Z A;  2KZR A;  1ZXI A;  2WYQ A;  2KD0 A;  3APF A;  3AU4 A;  3MHS D;  2KJ6 A;  2WXI A;  3BWU D;  2KN5 A;  3CF6 E;  1YN5 A;  2LJI A;  4HKQ A;  3NVZ A;  1V81 A;  2XK5 A;  2MH7 A;  3W5U B;  3UQB A;  2M0A A;  4OVZ A;  4A20 A;  3L16 A;  4P1B C;  5FR3 A;  2WDQ B;  3DBH B;  1D6E C;  2D2Q A;  3PGE A;  2V1Y A;  1ZOY B;  1TKE A;  4E74 A;  2FNJ B;  4W9I A;  3IXS A;  3ZRC A;  3RMK C;  4IG7 B;  2BPS A;  2LGD A;  1UUP A;  1WGR A;  1I7H A;  1F1H A;  1UNS A;  4NQL B;  2K0P A;  1F9J A;  1LGR A;  5E6N A;  1C76 A;  4LDT B;  3K9P B;  4RGT A;  4ZHO A;  1I42 A;  1EU3 A;  4EEW A;  2KVZ A;  2MCN B;  3ZUN A;  1WXV A;  5DPS A;  1TZO A;  1V1P A;  1TY2 A;  2WDT B;  3N9Y C;  1KJT A;  1NDD A;  1OTR B;  4US8 A;  3HK0 A;  3UF8 A;  1RYJ A;  3TEY A;  2G45 B;  3IFW B;  4TQ0 A;  5KHQ A;  4II3 B;  1N60 A;  1YQB A;  3L10 B;  3RYT A;  3DBL B;  2NVU I;  2EEL A;  4II2 B;  4WJO A;  5BYS A;  2ZPY A;  3RZF A;  1WH3 A;  1Y56 A;  4BVU C;  2FE8 A;  4BFR A;  2JXT A;  1FNV A;  2EMS A;  3R7Q A;  2QMT A;  2N9P C;  3A9K B;  2DHZ A;  2C7H A;  2LUE A;  4GDK B;  2WXK A;  3NVV A;  1FO4 A;  5JHB A;  5HHD G;  3OAW A;  4HXD A;  3BYY B;  1K50 A;  1IBX A;  4HCN B;  1CK1 A;  1VLB A;  2A4Z A;  1LM8 B;  3R7R A;  1N61 A;  2V3N A;  4NQK E;  1CJE A;  3Q8C A;  4G0N B;  3DBR B;  1TTN A;  2KTF A;  2ZNV C;  4HKZ E;  2L52 A;  1IGD A;  2WXN A;  2KMA A;  1QQR A;  3L13 A;  4LCD E;  1FFU A;  3OJ3 A;  5BYR A;  4FHK A;  2HTH A;  3Q14 C;  3WA0 A;  4HDO A;  5JZE B;  3DQV A;  2MWS B;  2J52 A;  4KKJ A;  4OVU A;  4MGI E;  4MEL A;  3RNB C;  2GOW A;  3Q6B A;  3FIL B;  3NOB A;  4NY0 A;  3N1Z C;  1R4M B;  2KC2 A;  1GC7 A;  1JWM D;  3M95 A;  1YX5 B;  4DQO C;  3AMZ A;  1T6B X;  2ZEQ A;  1P98 A;  3Q8E A;  1RLF A;  2FUH B;  3CST A;  1F52 A;  4MH0 E;  3VDZ A;  4ANW A;  2NTS A;  4HJK A;  4ZRI A;  1IYF A;  4B9K A;  2E6X A;  3AE4 B;  3Q3J A;  1N5X A;  3RNG C;  4M02 A;  1UGJ A;  1M94 A;  3PO0 A;  4MSM B;  1ZW7 A;  1NBF C;  4WQM A;  2MBE A;  1IUE A;  2CU3 A;  4RGN A;  1C3T A;  5EE9 A;  1SSN A;  1J7C A;  1HQR D;  5JHA A;  5IO9 A;  3PZD A;  3UIP B;  4DDI D;  2JPH A;  1AAR A;  4JQW C;  3GB1 A;  1VZ7 A;  1C79 A;  4KKI A;  3Q8A A;  2CR5 A;  3P42 A;  2DYM A;  1P9D U;  1WXS A;  4GN1 A;  2PVO D;  2DZK A;  4LNO A;  3H9D A;  2IDY A;  1R4N B;  1L4Z B;  1KLU D;  1KTK A;  2L00 B;  3BVM A;  1FD6 A;  2OED A;  3DHG C;  1OQQ A;  2WDR B;  1ENF A;  1E6E B;  4JL9 A;  2ZW1 A;  3KW5 B;  2JQR B;  2LRW A;  1VDV A;  3RNE C;  2WX0 A;  3PRZ A;  4E71 A;  2I1J A;  2FCS A;  3ZNZ B;  2GBN A;  1FCL A;  3VAW A;  2MJD A;  5CHF A;  4W9J A;  1QKZ A;  1FNU A;  1KLG D;  3QX1 A;  4LTU A;  3FAH A;  2JZZ A;  2ZNV B;  3A9J B;  2HTM E;  3KUD B;  4M0W A;  2OHF A;  1VRA B;  3QHT A;  1MJD A;  4PS3 A;  3L17 A;  2Z0E B;  1EUV B;  2KXJ A;  3ZXV A;  2SEB D;  1YIW A;  4RNA A;  2M8S A;  1V80 A;  2QDF A;  2J0J A;  3NG0 A;  1GB4 A;  3NVW A;  1FXA A;  4B0M A;  2WNM A;  3AU5 A;  4WIP A;  1QF6 A;  5BMI A;  4HLE A;  1KM7 A;  1YN4 A;  4MJS B;  5G55 A;  3MJW A;  3ECI A;  2DBY A;  2D3C A;  2UU7 A;  4FLH A;  2J53 A;  3ZJU A;  1SEB D;  1QZE A;  1MFW A;  4CQN A;  2NPT B;  1WX9 A;  5AUI A;  5I4D A;  2WS3 B;  4M8N A;  3SEB A;  2BT6 A;  2NMQ A;  4AP4 C;  1A5R A;  3BVZ A;  2BF8 B;  4ZRJ A;  4W9D A;  1FFV A;  3EA6 A;  3IG3 A;  5L83 A;  1GJZ A;  1WJU A;  3EHV A;  1EWY C;  3VUW A;  3ZRF A;  1M4V A;  3TL5 A;  1E8Z A;  4PYZ A;  4DHZ B;  1J7A A;  2V9H A;  2KDB A;  2PMV A;  2V4L A;  3DVN V;  3JSV A;  5HG2 A;  3W1S A;  1D5M C;  2KJR A;  1FXT B;  2K22 A;  4YWG G;  1FEH A;  1WF9 A;  3T9L A;  4S0R A;  1P1A A;  2EKE C;  2Z59 B;  4TSS A;  3PHX B;  2R61 A;  2WQY B;  4KIK B;  4A9A A;  2K6D B;  3CWI A;  1LO5 D;  2L1A A;  3TJP A;  5BYQ A;  4WUR A;  3UIN B;  4NNJ B;  2KTR A;  4ZYS A;  2VRR B;  4YXD B;  5FR6 A;  3U4E G;  2JXX A;  2Z0D B;  5HI1 A;  3PHW B;  4EOY A;  2LGI A;  5EE1 A;  2V4I B;  3V61 A;  2FIF A;  3ZNH B;  1A70 A;  1WYG A;  5BMH A;  3EFU A;  3IVF A;  3V62 A;  3W5V B;  4IW0 A;  2IBI B;  2N9L A;  1C78 A;  1UBQ A;  1BXT A;  3T3O A;  1CZP A;  2MLB A;  3DHI C;  4WAA A;  3VUX A;  4NAW B;  2WXH A;  5IP4 D;  2D3A A;  4A3P A;  4ITK A;  3B2F A;  3APC A;  2RDH A;  4WH4 A;  1E8Y A;  3MJ5 A;  1SF0 A;  1FIQ A;  3ZXR A;  1L6U A;  4BAX A;  2ZVO A;  3HVZ A;  1YQ4 B;  1NEK B;  4MT5 A;  2IO1 B;  1DOI A;  4HPP A;  4IKG A;  2AQ2 B;  2XEW A;  3VRA B;  2GLS A;  3NUH B;  1N62 A;  1NYQ A;  1AW7 A;  2N7D A;  3BK1 A;  2MBO A;  3LJ3 A;  5AEK B;  4ZHP A;  2LMC A;  2HJ1 A;  4G3X B;  1H8C A;  1F2R I;  4JPS A;  1VD2 A;  2J0K A;  5TR5 A;  3BZD B; 
#chains in the Genus database with same CATH homology
 2BB5 A;  2RDG A;  2JU6 X;  3HVD A;  3HUI A;  1TKE A;  1WRI A;  4KGR A;  3W2D A;  3IXS A;  2XN9 C;  3TEW A;  1B9R A;  1MI0 A;  1UUP A;  1I7H A;  1RM6 C;  3IAS 1;  1UNS A;  1V1P B;  2L83 A;  1HXY D;  3TSS A;  1DOX A;  1WWT A;  2NTT A;  1JQ4 A;  3NZ3 A;  4ARI A;  2K0P A;  1TKY A;  2KDM A;  2IGD A;  1C76 A;  4OHJ A;  4ZHO A;  3EUB 2;  4RGT A;  1EU3 A;  2FBW B;  2BS2 B;  5EE0 A;  1QOG A;  2QSD A;  1QOA A;  3TEZ A;  1KH0 A;  1TZO A;  1P7E A;  1TY2 A;  1V1P A;  1V97 A;  1WGK A;  3N9Y C;  4FXC A;  2LFI A;  2M19 A;  5C3J B;  2Q5W D;  4RF0 A;  1I4Q A;  1E10 A;  4US8 A;  1TYG B;  4O1N A;  1JW9 D;  3GP7 A;  3AE8 B;  1RYJ A;  5D3D A;  1L4D B;  2WXQ A;  3TEY A;  1SE3 A;  4TQ0 A;  1BUI C;  1MHH E;  1N60 A;  3J9C A;  1ET6 A;  2W3S A;  1NYR A;  2BB6 A;  1BML C;  3AE3 B;  1JWU D;  1L0V B;  1TS3 A;  2AQ3 B;  2EEL A;  3PZ8 A;  2ACZ B;  2BTE A;  1D4B A;  3AM9 A;  5BYS A;  4YTN B;  1FRD A;  3AH7 A;  1F0Z A;  1Y56 A;  1B1Z A;  2FE8 A;  2JXT A;  2SAK A;  1FNV A;  1IBX B;  1YJI A;  3BVG A;  2QMT A;  2BBC A;  4XDC A;  1NI3 A;  2JSV X;  4XDD A;  3B9J A;  3I9V 1;  2WXP A;  4GDK B;  2WXK A;  2E3T A;  1D5Z C;  4L1B A;  1CQV A;  1C9F A;  4B0E A;  1MHX A;  2X38 A;  3NVV A;  1Q10 A;  3U52 E;  1FO4 A;  5HHD G;  2IJ0 A;  1XO3 A;  4LK0 M;  4TMA B;  3BYY B;  1K50 A;  1IBX A;  1GPX A;  1CK1 A;  1VLB A;  2TSS A;  2WXR A;  1XLO A;  4ARC A;  1I4H A;  1N61 A;  4L23 A;  2V3N A;  3BII D;  3NS1 A;  2JWU A;  2W54 A;  3AEF B;  3AV8 A;  1CJE A;  1JWS D;  1N63 A;  3Q8C A;  4WWM A;  3P1M A;  1F77 A;  3VR9 B;  4HKZ E;  2MJ3 A;  2L52 A;  1IGD A;  2WXN A;  1DOY A;  1QQR A;  2KMM A;  3URY A;  4D2K A;  2K5P A;  1P7F A;  1XCT L;  1FFU A;  3ZJV A;  5BYR A;  1JWB D;  1J7B A;  1JWA D;  1QLB B;  1YN3 A;  1KFY B;  2DYO A;  1QOF A;  1V8C A;  2J52 A;  4KKJ A;  1RWS A;  3B2G A;  2PLP A;  1SBB B;  1XF5 L;  2YEP B;  3ZGZ A;  4YSY B;  1R7S A;  2K9X A;  4ZOH C;  3FIL B;  5D7G A;  1AWD A;  3H8H A;  1ACC A;  3IAM 1;  1TS4 A;  1FCC C;  2GRI A;  4ZRQ A;  1JWM D;  4P16 A;  1KRH A;  3BK2 A;  4OZB A;  1I4X A;  4DQO C;  3AMZ A;  1T6B X;  4NZL B;  1N5W A;  1SE4 A;  3Q8E A;  1ESF A;  2H88 B;  3AN1 A;  3FIL A;  2WLB A;  4HEA 1;  1WXQ A;  1NEN B;  3P4Q B;  4JWU C;  4LLG M;  4HJG E;  2KN4 A;  3EGR A;  3P4R B;  2NTS A;  1YNT E;  2IGH A;  2QJL A;  1WSP A;  2E6X A;  3AE4 B;  2FUG 1;  2WXL A;  1N5X A;  4PT5 A;  1ZPS A;  1UGJ A;  3TEX A;  1V1O A;  4US9 A;  3ZYY X;  3OWE B;  1YMH E;  1FNW A;  3C8Y A;  3PO0 A;  5FKA C;  2D5G A;  1C4A A;  2DLB A;  2HDE A;  4WQM A;  5T8I A;  2BYT A;  3SFE B;  4A6Q A;  1IUE A;  2JZP A;  2VZK B;  2CU3 A;  4RGN A;  4AQ7 A;  4C7Y A;  2G1E A;  2KQ4 X;  1SSN A;  4GDL B;  3KQ4 A;  5EE9 A;  1HQR D;  1J7C A;  2LUM A;  2LHD A;  2B76 B;  2PVG C;  5FK9 C;  3U2S C;  2DWQ A;  2H89 B;  1T3Q A;  3GB1 A;  1FMA D;  1XXG A;  1L0X B;  2K3U A;  2N7J A;  1JRP A;  1C79 A;  1VZ7 A;  4KKI A;  3P42 A;  3Q8A A;  2DYM A;  4Q2J A;  1C4C A;  2WXM A;  4C56 C;  2PVO D;  2J42 A;  1XLN A;  4WAF A;  5MPO A;  4YT0 B;  2JYE A;  3ZQ4 A;  4N58 A;  2IDY A;  3MC0 B;  3IT4 B;  3AE1 B;  3AEE B;  3DWG C;  1L4Z B;  1KLU D;  1KTK A;  1JML A;  3PZ7 A;  3BVM A;  4RCO A;  1PGA A;  4L2Y A;  2OED A;  5EE3 A;  1FD6 A;  1E0Z A;  1OQQ A;  3Q69 A;  2L32 A;  2WDR B;  1ENF A;  1E6E B;  3GS2 A;  5H8Y E;  2G9H D;  1SIJ A;  1XLP A;  2KWD A;  4YTP B;  2ZW1 A;  2JQR B;  3NRZ A;  1I4P A;  4J3O D;  2Y5P A;  1L5P A;  4XE0 A;  1VDV A;  4MAC A;  1OFF A;  4NAM A;  3Q8F A;  1VR9 A;  1FCL A;  2MJD A;  1T5X D;  1L0Y B;  1SE2 A;  3TUO A;  1ZXH A;  1QKZ A;  1FNU A;  2BW2 A;  1QIL A;  2PW9 A;  4C7Z A;  1KLG D;  2ZW0 A;  3LXF A;  1JCK B;  1OQR A;  3IT6 B;  3FAH A;  4LTU A;  3HRD D;  3AE9 B;  1TJE A;  3V05 A;  3LYY A;  2HTM E;  4KGT A;  4M0W A;  2OHF A;  2PTL A;  1VRA B;  2EKI A;  3LB8 C;  1YJJ A;  5JXV A;  5G5H A;  4MH8 A;  4MM3 B;  1EU4 A;  1YQ3 B;  1AN8 A;  2SEB D;  4RNA A;  1PDX A;  1ZE3 D;  3NVY A;  4N6E B;  3ETR A;  4AS1 A;  1GB4 A;  1E7P B;  3NVW A;  1FXA A;  4B0M A;  1GB1 A;  4N59 A;  5TSS A;  1JAL A;  1STE A;  2WNM A;  2Y3A A;  1EM7 A;  4WIP A;  1VZ6 A;  5G5G A;  1QF6 A;  2I2Y A;  4GLS C;  2KAC A;  5BMI A;  1EWC A;  4A90 A;  3MFG A;  3RFZ B;  1YN4 A;  2DBY A;  2Z8L A;  2J4X A;  2AX5 A;  2N9K A;  4REZ A;  3AEG B;  4IDI A;  2J53 A;  1L6V A;  2W3R A;  3MHZ A;  3ZJU A;  2BS3 B;  3AEB B;  2YEP F;  1SEB D;  3P4P B;  1SJE D;  5LNK 1;  4KX6 B;  3E9S A;  4CQN A;  1VJK A;  1SB3 C;  4C80 A;  4YTM B;  5AUI A;  2XNA C;  5I4D A;  2WS3 B;  3Q8B A;  2KAJ A;  4XWW A;  4RGO S;  5H92 C;  3SEB A;  1HEZ E;  1ZP0 B;  1TS5 A;  2QIE B;  4HRO A;  2BT6 A;  2IPK D;  3SR6 A;  2ICI A;  2GI9 A;  2Y5C A;  2NMQ A;  2W55 A;  5BMG A;  4USA A;  1MVK A;  2I38 A;  3BVZ A;  2MEK A;  1AYF A;  1JRO A;  1PFD A;  1FFV A;  1UWM A;  2QEJ C;  2VZK D;  3VR8 B;  3AB5 A;  3EA6 A;  3O13 A;  5HFY A;  3AED B;  2WDV B;  4EE2 A;  4HRS A;  3UI3 A;  3SFD B;  1EWY C;  4ZRP A;  3RPF C;  5GXG B;  2INP E;  1M4V A;  2RPV A;  3AE2 B;  1DGJ A;  4RGM A;  4IOI E;  3I57 A;  2ONQ A;  4A8X C;  1J7A A;  1ZUD 2;  2PMV A;  4OZC A;  1IGC A;  5HG2 A;  3DWM A;  3W1S A;  1D5M C;  2INN E;  2K22 A;  2RMM A;  2V3P A;  2WP9 B;  2ON8 A;  4YWG G;  1FEH A;  2WXO A;  2N0S B;  3W9C B;  1F2R C;  1QOB A;  2PKO A;  3WCQ A;  1HZ6 A;  4R3D A;  4TSS A;  1FXI A;  3KLS X;  2R61 A;  2WQY B;  1KF6 B;  4RH6 A;  4XWT A;  4OW0 A;  1ET9 A;  3V3X A;  1I4G A;  4A9A A;  1SJH D;  2MJE A;  2CJO A;  3AEA B;  4RF1 A;  3R2T A;  1PUT A;  3CWI A;  1LO5 D;  2JYT A;  2L1A A;  3R8B A;  3CIR B;  3KWL A;  5BYQ A;  4WUR A;  1XEE A;  4NJC A;  3R2I A;  4ZYS A;  4YSZ B;  1RFK A;  1K53 A;  4YXD B;  3U4E G;  2LHE A;  3AE5 B;  5HI1 A;  1ZDV A;  1HA5 A;  4A55 A;  2GB1 A;  2WXJ A;  4YSX B;  1MPE A;  1C77 A;  2PIA A;  1TS2 A;  2LGI A;  5EE1 A;  1PGB A;  2V4I B;  1GAQ B;  1ROE A;  2WU2 B;  1C4P A;  1HZ5 A;  1TY0 A;  1A70 A;  4RFB A;  1WYG A;  2M56 B;  5BMH A;  3ZJT A;  3MP9 A;  1K51 A;  3AEC B;  3KWV A;  3W5V B;  2V0G A;  4UDU C;  2N9L A;  1C78 A;  5C2T B;  3BYT B;  1BXT A;  4JWS C;  3P4S B;  3T3O A;  1CZP A;  1FRR A;  4DXF A;  4JE3 B;  4NAW B;  2WXH A;  1E9M A;  3P63 A;  3AE7 B;  2WXG A;  3VQI A;  2BS4 B;  1PYW D;  2AQ1 B;  4OZA A;  4ITK A;  1TKG A;  1ZXI A;  3B2F A;  4KGS A;  3VRB B;  4H2A A;  2RDH A;  4WH4 A;  1XLQ A;  5AUK A;  3MJ5 A;  1SXT A;  1SF0 A;  1FIQ A;  1QT9 A;  2W82 A;  1L6U A;  3U7Z A;  2WXI A;  3BWU D;  1NVI D;  1VZ8 A;  3HVZ A;  1UWX A;  2JX5 A;  1YN5 A;  3FC4 A;  2LJI A;  4HKQ A;  1YQ4 B;  3NVZ A;  1NEK B;  4P6V F;  1PGX A;  1GOZ A;  3W5U B;  2MH7 A;  2WU5 B;  1I4R A;  4MT5 A;  2M0A A;  3AE6 B;  4OVZ A;  4DXG A;  1DOI A;  5E6J A;  4TQ1 A;  4IKG A;  3E56 A;  2IGG A;  1D5X C;  2AQ2 B;  3VRA B;  3NUH B;  1N62 A;  5FR3 A;  1NYQ A;  1AW7 A;  2WDQ B;  2LEK A;  2QIL A;  2WXF A;  3BK1 A;  1K52 A;  1DYQ A;  3T3N A;  1FM0 D;  1D6E C;  1XCQ L;  3ABV B;  4ZHP A;  5D3I B;  2LMC A;  3L4P A;  1F2R I;  4JX1 C;  2CJN A;  4JPS A;  1ZDX A;  3BZD B;  1ZOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...