4FXCA

Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ATYKVTLINEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGTITSGTIDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIKTHQEEGLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of [2Fe-2S] ferredoxin from Spirulina platensis refined at 2.5 A resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis.
pubmed rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4fxcA00
2BS4B 5C2TB 4YTNB 4C7ZA 5H92C 3LB8C 1L0VB 3SR6A 2QJLA 1J7BA 1KF6B 2WDVB 1FXIA 3P4QB 3AEAB 3AH7A 1F0ZA 1JRPA 3ABVB 4ZOHC 1ZUD2 1E6EB 5AUIA 2PVGC 3P1MA 3RPFC 1E0ZA 2FBWB 3WCQA 2KMMA 1RYJA 1YQ4B 2K5PA 2W55A 3SFDB 3P4PB 1QLBB 2DWQA 4JX1C 4N6EB 1E9MA 1WYGA 2OHFA 3CWIA 1N61A 1YQ3B 1JQ4A 3AN1A 2M19A 1OQQA 1NYRA 2M56B 2MH7A 1A70A 3EUB2 3FAHA 3NRZA 4C80A 2MJ3A 1FIQA 1NVID 3CIRB 4HROA 1UWMA 2CJOA 1TKYA 1XLQA 2Q5WD 1QOGA 2MJDA 2WDQB 4US8A 1QOFA 2HTME 1NENB 1RFKA 2K22A 2N0SB 4A9AA 2AX5A 3B2GA 1KFYB 1ROEA 2DBYA 1FXAA 1XO3A 3P63A 3NVYA 3AB5A 4WWMA 1FFVA 1JWBD 3AEDB 2WDRB 1N62A 1AWDA 1TKEA 5EE3A 2L83A 3W5UB 3L4PA 2W3RA 1KRHA 2MJEA 3DWMA 3NVWA 3VRBB 3VR9B 4YTPB 1FRRA 3PO0A 4YT0B 1ZOYB 2WQYB 1XLNA 2BS2B 2H89B 4N59A 2PIAA 1NYQA 4ITKA 4HRSA 1XLOA 4US9A 3BIID 1L6VA 4YTMB 2E3TA 5MPOA 2H88B 3P4RB 1DOIA 1QT9A 2WP9B 5AUKA 3P4SB 4YSYB 1J7CA 3W9CB 2WS3B 4LTUA 1FFUA 1XLPA 1DGJA 3AEGB 3AM9A 1GAQB 1TYGB 1YJJA 3AEFB 1JWAD 1NEKB 3ETRA 3AE4B 3NS1A 4P6VF 2WLBA 1JALA 3SFEB 1T3QA 5EE1A 2WU2B 3AE2B 4WQMA 1SB3C 3AE5B 5G5HA 1YJIA 2WU5B 4N58A 3AECB 3B9JA 1QF6A 1JW9D 1VDVA 3B2FA 4IDIA 2K9XA 3AE7B 3AE3B 1ZP0B 1ZXIA 2PKOA 3KWLA 1CJEA 4YXDB 1GPXA 1NI3A 2EKIA 4KX6B 4C7YA 4ZHPA 1IUEA 3VRAB 2CJNA 1AYFA 1N60A 2QIEB 3AE6B 2BT6A 2G1EA 5H8YE 1FO4A 1RWSA 5EE0A 1N5WA 5GXGB 2BS3B 2KAJA 3FC4A 4JWUC 1V8CA 1TJEA 2LEKA 2JX5A 1PDXA 1PFDA 1WGKA 2CU3A 3AEBB 1J7AA 4YSZB 2W3SA 1VJKA 2JQRB 3ZYYX 3W5VB 3NVZA 5G5GA 4JWSC 1R7SA 1FRDA 2W54A 2B76B 4YSXB 3AE9B 1E7PB 1FMAD 3AEEB 4FXCA 1N63A 1E10A 1RM6C 4ZHOA 5EE9A 1FM0D 1OFFA 1PUTA 1SIJA 1V97A 2PVOD 2ACZB 3AE1B 3AMZA 3HUIA 3HVZA 1WXQA 1OQRA 1WRIA 1TKGA 1CZPA 1L6UA 1QOBA 3LXFA 3AE8B 5C3JB 1JROA 1DOXA 1DOYA 2Y5CA 3NVVA 1B9RA 3VR8B 3AV8A 1SF0A 1L5PA 1N5XA 3DWGC 4USAA 1QOAA 1EWYC 1WWTA 3HRDD 1I7HA 1VLBA 2L52A
chains in the Genus database with same CATH superfamily
2HJ8A 5C2TB 4AJYB 3IT6B 5JHAA 1E8ZA 2LUMA 1UBQA 1F2RI 2IO1B 4P16A 2AL6A 5T8IA 3UQAA 3OJ3A 2KFJA 1RFAA 2DWQA 5IN7A 3KWVA 5E6NA 4URKA 2MH7A 1N6ZA 3N9YC 2KLCA 4IM2A 5KHOA 2KQ7A 2KX0A 4HCPB 2KQSA 2LHDA 1L0XB 2BYVE 1AARA 4WWMA 3BY4B 3IT4B 4IG7B 2JWUA 2IDYA 2W3RA 2QDFA 2KHWB 4K7SA 4ITKA 2WXPA 1GJZA 4MM3A 2J0MA 3DHIC 3LJ3A 2LWPA 2K39A 2K1FA 3W9CB 4LTUA 3ZUNA 4JIOU 2OJRA 2RSUA 2WX0A 1WXVA 3AECB 1KH0A 1QF6A 2KWUB 1NI3A 2NPTA 4ANXA 5IO9A 3U4EG 2DENB 2HJ1A 2J4XA 2K8HA 2GBNA 3FC4A 4JPSA 3NZ3A 3IFWB 3RI7C 4H2AA 4YSXB 3T8MA 1FM0D 1OQRA 4DHZE 3WANA 5LNK1 2MQJA 2KFKA 2MX2A 2DNFA 2BS4B 4EOYA 1JMLA 2VZKD 3ZKJC 1K52A 3AH7A 3U7ZA 3Q14C 3VUWA 3ZDTA 2ZJDA 4MJSA 1V81A 2DZIA 2G45B 3RFZB 3ZQ4A 3BK1A 3X23A 1BT0A 5CHVC 4ZRJA 1F2RC 2BVCA 2LUEA 4KSKC 1FD6A 2WDQB 3R66C 4ANUA 5DPSA 4AS1A 2I38A 2RGFA 3QC8B 2KC1A 1SE4A 2PTLA 3IXSA 5D3IB 3NY5A 4W9IA 2ZCBA 1TS2A 3DWMA 4YTPB 2OJWA 2EELA 5HFYA 4KKIA 1XLOA 1PQSA 2MP2A 5CTRC 5AUKA 2Z0EB 4NJ6A 3M62B 3QX1A 2KN4A 1MG4A 4W9HA 3PRPB 1SBBB 3VFKA 1ZXIA 3DBRB 1LXDA 3AE6B 3BK2A 1WJ4A 1TY0A 4XZ4A 3N3KB 4RFBA 2ZEQA 4GDKB 1WGKA 4WH4A 1Q10A 3UGBB 1D4BA 4HEA1 4FA6A 2K8CA 4M0WA 4ZHOA 1P0RA 3OG5A 1E8WA 2LJ5A 5AZHA 3PTFC 2JPHA 1UD7A 2FE8A 2LXAA 1E7UA 5C3JB 2HE7A 4DHJD 1I7HA 2L05A 3ZXVA 3PRZA 5HKHA 2CR5A 2PLPA 4K3CA 3MFGA 4AP4C 5D94A 4C4VA 4NPNA 1BXTA 3K9PB 3A9KA 4IKGA 2AL3A 1I4HA 3TEXA 2LJIA 4M01A 1N61A 2REXA 1EUVB 4W9LA 2M19A 4LJOB 3EUB2 4KGSA 2IY1B 3QAQA 1SJED 1SXTA 3H8HA 4HJGE 1LO5D 4PS3A 2MCNB 5L83A 4RNAA 1FNVA 4II2B 1E0ZA 3PVLA 2NBUA 3B2GA 2MA9B 3AB5A 1JWBD 5BMGA 4MELA 1N62A 5IOIA 1P98A 1KRHA 4IC7B 4MSQB 4LDTB 5D3DA 1YQBA 3VQIA 1ZOYB 2KWDA 2MBBB 2J53A 2QSDA 2OEDA 1G6JA 4M8MA 3N32A 4M8NA 1XQQA 4B0EA 1YOVB 3AE5B 2ZPNA 2KJRA 2PKOA 1WE6A 1Z5SB 4GIVA 4OVUA 5BMHA 1P7FA 2C5LC 2QIEB 2G1EA 4D2KA 2L8JA 4XC2A 5HG2A 3VHTC 1VJKA 3NVZA 4PT5A 2UU7A 1OEYJ 1WR6E 3AEEB 4S17A 3ZNGC 1IGDA 1MFWA 4J3OD 3LXFA 1HZ5A 3AE8B 2GRIA 3DQVA 3KW5B 4GLSC 3VR8B 1V9JA 3DWGC 5AEKB 1VZ6A 4LNFA 4HPLB 4AOFA 1V5TA 2LGDA 1JRPA 1DYQA 4HCNB 1Q5WB 2PVGC 2R2QA 1YQ4B 3ECIA 4ZYNA 2A5UA 2X38A 1LGRA 1WX9A 2M17A 2FIFA 4YL8A 1NVID 4TSSA 4BKTA 2FCMA 4WJOA 4MGKE 2I1KA 3MC8A 1UH6A 2UWQA 1TGZB 1EO6A 1GC7A 1WJ6A 5LLIA 1JCKB 1P3QU 3VRBB 4GDKA 3IAS1 3GZNB 2VH1A 2NVUI 3VTWA 2WQYB 3TMPB 5KHQA 4US9A 2K6QA 4MGYE 2WXIA 4HK2A 1UELA 5AZGA 2JVCA 3P4SB 2KT7A 4GB9A 2MHJA 2BB6A 1WGRA 2Z0DB 1WIAA 3N30A 5DPRA 1YJIA 3H1UA 4W9KA 4EKUA 2K9XA 2DYBA 2L0FA 2C9WB 3APFA 4CYEA 3KYDD 4OVZA 4JGHB 2HTHA 2QILA 2M8SA 3RNAC 1RLFA 3FILA 3ZYYX 2VRRB 4A3OA 2K25A 2PE9A 1WRDB 1UGMA 2DLBA 3KUCB 2INPE 3L08A 1P9DU 4AQ7A 3L13A 4B0MA 1I4PA 1VCBA 1SEBD 1V86A 3AULA 2LZ6A 1TIFA 2D5GA 3CSFA 4C7ZA 1SE3A 2ASQA 3VAWA 4CQNA 1MHXA 3ZTCA 3Q8AA 4KGRA 2BYEA 2V3PA 4BOZB 1CK1A 2LI5A 4DXGA 1A5RA 2KTFA 1JQ4A 3IVFA 1C9FA 3QK0A 3HHMA 4KZ0A 5JHBA 2BQQA 3CIRB 4HROA 2D3GA 3UF8A 1BMLC 2K8BA 5BYQA 1QOFA 3Q69A 4K1RB 4A9AA 1WSPA 1V1PB 2AEHA 2QC8A 1AWDA 5EE3A 1SE2A 4MEMA 2KDFB 4LDTD 4C4VB 1XEEA 2GOWA 1X1MA 2WX1A 1JRUA 4YT0B 3R2TA 5GMVA 5DPWA 3UQBA 3ZLZA 3AM9A 2FIDA 4YWGG 3H7PB 4DXFA 1T3QA 3A4RA 1SB3C 2M1MA 3B2FA 2LRUA 4TUUA 3AE7B 4M0WB 4BKSA 4OZCA 2GMIC 1YX5B 3GZNI 4ZHPA 4MDKE 4MGZE 3DVNV 1WY8A 4RCOA 3I9V1 2BPSA 4E74A 1DOYA 3LDZE 5JXVA 4ARCA 2D07B 4FXCA 3A4SC 3V62A 3U8ZA 2LASA 2O6VD 2N9XA 4A3PA 1QOBA 1OEYA 4ZRKA 1HXYD 1YX6B 4LCDE 4WQOB 3M95A 3C0RB 4NAWA 2L52A 4BKSD 1V49A 4RGMA 3RNCC 2AYOB 2QJLA 3SHQA 1FPYA 3B08A 5CX3A 4I6LB 1E6EB 3CSTA 3QARA 4IW0A 4LNKA 4WAFA 4RM8A 3DHHC 1T0RC 2NMQA 2M56B 3PSEB 2C60A 2L7RA 2MJ3A 1GB4A 3ZVVA 1I4QA 3EC8A 1ZW7A 2D3AA 3ZIMA 2LD9A 3QHTA 2PMVA 1ZPSA 1T5XD 4US8A 4R3DA 2ZW0A 1V6EA 2RDGA 1HTOA 3N20C 4XE0A 2XK5B 2WXRA 5JH5C 2R61A 4WURA 3Q3NC 4W9EA 4L1BA 4EZKA 3RULA 2KFKB 4I6PA 2NCNA 2KDMA 4G3XB 2LHEA 2ZCCA 4YTMB 5D6JB 4DXAB 2Y5BB 3D32A 3OJ4B 5MPOA 3DBSA 1UGJA 2WP9B 1KLUD 3MC0B 1MG8A 2O6VA 1XLPA 3NZSA 1EU4A 3L10B 2WLBA 3PHWB 4EE2A 3AE2B 2WXKA 2XBBC 4IDIA 3KWLA 1CJEA 1TBEA 2D3BA 3AU5A 2VH2A 2DYOA 1AYFA 1FNWA 4FN2A 5EE0A 5GXGB 1C76A 2MBHA 1J7AA 4YSZB 2KTRB 2JRHA 1MI0A 4GOCA 4W9JA 1FMAD 3A1QB 1YD8U 1RRBA 2JF5A 2JXXA 3VTUA 5C23A 1TTNA 2N1VA 3QJZA 4F7ZA 1D5XC 1NI2A 1Y8RC 2DAJA 1WXSA 2L0TA 2KDIA 3Q3FA 1F0ZA 3P4QB 3AEAB 3UIOB 4GSWA 4A6QA 2FCSA 2FBWB 1RYJA 4JE3B 2CS4A 4WWPA 1WYGA 3H7SA 3Q8FA 1WH3A 3AN1A 4IM3A 3TCAA 3CMMB 3SU8X 2N7EA 1F1HA 2WGSA 2KVZA 2J42A 2O2VA 3I5JC 4K7UA 4OZBA 3HK0A 5BMIA 1ZXHA 4JLCA 2ONQA 3PZDA 3I63C 2EMSA 1WI0A 1BUIC 1TKEA 5IP4D 4W9DA 1OTRB 4EEWA 1D5MC 3K9OB 2KLGA 4A90A 2KNBA 1HZ6A 2QMTA 3I57A 4MM3B 3RT3B 4WJQA 1WGDA 3VVWB 1S3SG 2RPQA 1C77A 1FFUA 3W2DA 2Z59B 1JALA 1ET6A 4WQMA 1FXTB 2LGYA 1LQBA 2D10A 1M4VA 3PT2B 3EHVA 1QKZA 1Q0WB 3QCAA 2JZPA 1I4RA 2KDEB 4MH8A 3DBRI 2NTTA 2SAKA 4HWIB 2I1JA 3URYA 4PYZA 2FNJB 1WMHB 3RNGC 3BWUD 3AE9B 1IPGA 2ZW1A 1GC6A 2N9PC 2PVOD 3SDLC 4XDDA 3MC9A 4REZA 2X8XX 3W1SC 3V6EB 1CQVA 4EFOA 2KK8A 4FULA 1R4NI 3EA6A 4KIKA 5DPTA 4S0RA 2KJHB 3BVGA 4PYUA 2GI9A 1FXIA 3O65B 2W55A 2WXMA 3SFDB 3BYTB 3ZJUA 1U4AA 2LRWA 3GS2A 2INNE 1ZDXA 2TSSA 3APDA 4ACFA 3NRZA 5LXHA 2HDEA 4BOSC 1FIQA 3IG3A 1C4CA 1T0YA 2CHXA 3GE3C 1B1ZA 4ARIA 3R3MA 2K22A 4ANWA 4WJPA 1L2NA 4DHZB 2WDRB 1UUPA 2YLMA 3X0WA 5E6OA 4MH0E 5IA7A 3NVWA 4W9GA 1L0YB 1LFDA 3AI5A 3DBLB 2L3ZA 2PW9A 2BBCA 2GLSA 3ZRCA 4HRSA 2KC2A 3AEGB 2WXOA 1NEKB 2IZVB 5EE1A 5G5HA 2WU5B 1JW9D 3AE3B 1ZP0B 2QCZA 3WALA 3ZJTA 4FHKA 4KVGB 2NBWB 1N5WA 2BS3B 2WXGA 1ET9A 1HA5A 2JX5A 4OHJA 4NJCA 2W9NA 4BKGA 4KSLC 1XCTL 1ENFA 2FUG1 3W5VB 5G5GA 2IBIB 3RNEC 1GOZA 2B76B 4EZLA 3AE1B 3ZTDA 2LXCA 2KZRA 4RGOS 5C1ZA 1ESFA 1JROA 3WA0A 1B9RA 4G0NB 2CU1A 2IJ0A 1EWYC 3JW0X 3NUHB 1ZKHA 4NJ7A 3KH0A 2AWTA 2XN9C 1STEA 4ZOHC 3APCA 4IUMB 4NZLB 2JSVX 3WCQA 5LXIB 2WNMA 3P4PB 3UIPB 2NPTB 4JX1C 4M02A 3PZ7A 3HM3A 1UNSA 2KKCA 1XCQL 1PGXA 3PGEA 4PS7A 3ZRFA 1QOGA 2N9KA 1L4ZB 3KVFB 4EUTA 3MJWA 1ROEA 1FXAA 3VUXA 1RAXA 3P63A 3AXCA 1KLVA 2PPHA 1UF0A 3L4PA 2O6VB 2IO2B 1WGYA 2JWZA 1J8CA 1Q1OA 1GNUA 4AWJA 4BBNC 3DBLI 2AQ3B 3EGRA 5IAAC 1MPEA 3TEWA 3A9JA 3AEFB 3QA8A 1F9JA 4II3B 2M4NA 2LMCA 2O2VB 2KTRA 2DZKA 2D11A 4P7IA 4KX6B 3U52E 4XYCA 1IUEA 1FCCC 3VRAB 4HDQA 3UINB 1MVKA 3SEBA 4C00A 3PHXB 2JRIB 2L00B 1XF5L 4Q2JA 2CHWA 1R7SA 2W82A 4F8CB 2MEKA 4TMAB 1V1PA 2N7JA 2WXLA 3AMZA 2V4IB 3PV1A 4WAAA 2KD0A 1R4MB 4RMAA 3ZNHB 3A33B 1VLBA 1JWUD 5H92C 4FJZA 2WHIA 3P1MA 3HM6X 3PRMB 4ZRPA 3H7PA 2J0JA 4GN1A 2OHFA 4A20A 2LVQA 3BVMA 2WXJA 4LLGM 3NZUA 4IWQA 3V3XA 2KDBA 4WJNA 3R7QA 1WZ0A 3R7RA 3V05A 2MJDA 1ZE3D 4XWTA 4HVBA 2A4ZA 1C78A 2IPKD 1I35A 2QEJC 3JVZX 4EZJA 4RH6A 2CHZA 2MLBA 1NYQA 3B1LX 3QIJA 3T3NA 3N1ZC 2V3NA 2BB5A 1SSNA 1JWMD 1VZ8A 4BVUC 1AN8A 4AJWA 1R4MI 1YNTE 1DGJA 2FUHB 4LNNA 3VDZA 4C56C 1YN5A 3A9KB 1OQYA 4TQ1A 5E6PA 4CHKA 2EKIA 2G4SA 1KM7A 3PZ8A 1IP9A 2IGGA 3DBHI 1NDDA 2MW5A 5HHDG 1D3ZA 2KAJA 4JWUC 1PFDA 4HPMB 4GDLA 2IY0B 4NNJB 1FCLA 1WE7A 3KUDB 3P2BA 3NJTA 2V0GA 2DYMA 2ACZB 4MSMB 3U7DA 1QILA 1WXAA 1L6UA 3NHEB 2Y5CA 3AV8A 1SF0A 2MSED 4WIPA 5DCNA 4L23A 2J0KA 2V9HA 3LB8C 2JZZA 1ZUD2 4F1SA 4I6NB 3BYYB 1QLBB 3P42A 1YQ3B 3Q8CA 2RDHA 1WF9A 2IGDA 3QWZB 3OWEB 2BGFA 1GB1A 1WJUA 4KDLB 2CJOA 1K50A 2G3QB 3ML8A 1OGWA 1E8YA 1MHHE 3DVNU 1WXMA 3A1QA 2KVRA 4O1NA 4P1BC 1KFYB 5FK9C 1HEZE 1WX7A 3AEDB 2LGIA 2JY6A 3B0AA 3TBLD 4CO7A 2L32A 4FBJB 5J18A 1XLNA 4N59A 1J0GA 2XEWA 4G11A 3TEZA 1IBXA 2YEPB 4NQLB 1ZGUB 1Z2MA 4IWOA 5FR6A 4N58A 4ZRQA 1WJNA 1IBXB 1SJHD 2JUOA 4FJVB 3W1SA 1TT5B 2JYTA 3ZJVA 2LEKA 3N1XC 3GOEA 1D6EC 3M63B 2MBQA 4JWSC 3RNFC 1UBIA 4XWWA 3RUIB 2DZMA 3HIZA 1OFFA 5G2NA 1WXQA 2UYZB 2V1YA 1TKGA 1CZPA 3Q3JA 1E7VA 4FHJA 2BF8B 3EFUA 4TKNA 4MGIE 3M3JA 3ZW3A 1E5WA 1C1YB 2N1WA 4HJKA 2ZPYA 2KWCA 2JT4B 4J6IA 3DHGC 2IYDB 3RPFC 2KMMA 2WYQA 1P7EA 3V60A 1E9MA 3MJ5A 3PS6A 3LYYA 4FADA 4RGTA 3HVDA 4C80A 2GBKA 4W9CA 2AQ1B 3TJPA 1VRAB 3TEYA 1UWMA 1SIFA 3JSVA 1XLQA 1WYWB 1JWSD 1GUAB 4DHJB 2AX5A 3L17A 2DBYA 4RF0A 2KJ6A 3MP9A 2IO3B 4QAYA 1ACCA 2RMMA 4GDLB 1FRRA 1EF5A 4FLHA 2G4DB 4DWFA 1WFYA 2WXNA 2GBMA 3RZWC 1HTQA 4DDGD 1GG3A 4KGTA 1QT9A 4YSYB 5D7GA 3U2SC 1H8CA 3R8BA 1YJJA 2C7MB 3NS1A 3IHPC 1T0SC 2MBEA 1K8RB 1V1OA 4IWPA 2KOXA 1EF1A 1C79A 2ZNVB 2RPVA 2DAFA 4XGAB 4PK1A 3UI3A 1ISNA 1V8CA 2W3SA 1UZXB 2YVCA 2CKHB 1WZ3A 1EU3A 4HKQA 4GU2A 1E10A 1N63A 4KKJA 3HUIA 2C7NB 3AU4A 2PE6B 3ZNZB 2LGSA 1QZEA 2KWVB 1L5PA 1N5XA 2NS5A 4DQOC 3L16A 4ZYSA 1WWTA 4P1CC 2BYTA 2M0AA 2FAZA 5TSSA 4PS8A 3NG0A 1I42A 1FEHA 3W1YA 4ANVA 4LJPB 2R2OA 3CWIA 4WWNA 2KX3A 1NYRA 4N9F4 3RNBC 2KACA 3EECA 2XK5A 4DK5A 5J2RA 3OLMD 4K81A 1TY2A 1ZDVA 2NTSA 1WX8A 2EKEC 4RGNA 5E6JA 1KTKA 1NENB 2INDC 4BBNF 3GB1A 4IOIE 5CHFA 1MJDA 2LVOA 3I3TB 4OW0A 5BYSA 2MJEA 3KUZA 2BWFA 1WM2A 2JXTA 3DVGX 3BVZA 2BS2B 3RZFA 3ML9A 2E6XA 5CHWA 3H9DA 2J7QB 3P4RB 2WS3B 5D2MB 1L4DB 1GAQB 3DCGA 3L54A 3ETRA 3SFEB 1V5OA 2WU2B 3B9JA 1GPXA 4ASWC 4UDUC 4C7YA 2BT6A 1NBFC 1FO4A 1RWSA 3NS8A 3PREA 4JL9A 3AEBB 3R2IA 1WR1A 2DHZA 1EM7A 1XXGA 4HLEA 1RM6C 5EE9A 1SIJA 3GP7A 1F52A 4MT5A 4KDIC 2ZVOA 1M94A 1QOAA 2ON8A 2N7DA 2D2QA 5IKCM 5AZFA 3KQ4A 3DVGY 2MP2B 5FKAC 2FCNA 1J7BA 2WDVB 4WWOA 3ABVB 3ZXRA 3PLUA 5AUIA 4XX5A 1HQRD 2K5PA 3ZNID 3WAPA 1VR9A 4IM0A 2WXQA 4K7WA 1IGCA 4DBGA 3FAHA 1F77A 4ZDVA 2N4FA 4B95A 3RN9C 2HTME 1RFKA 4L2YA 1T0QC 1C3TA 3U30A 4GXBA 1KOTA 2DX5B 2J52A 3W5UB 2WXHA 1EWCA 4GMVA 4BFRA 2GBJA 2H89B 3V6CB 5JZEB 4TV3A 3TL5A 1WM3A 3H6NA 4JQWC 2LGXA 1JWAD 2BKRB 5TR5A 3C19A 3JSVB 1VDVA 4ICUA 2MRPA 4E3CA 2CJNA 1E90A 2QHOA 3BINA 3T3OA 2N9EB 3WAMA 2SEBD 4ICVA 1XD3B 3FILB 4BAXA 4RM9A 2JQRB 2W54A 2KXJA 1IYFA 2WDTB 2MWSB 3BZDB 2DZJA 3ENEA 1V97A 4K3BA 2Y3AA 2PJHA 3A9JB 3MTNB 2NR2A 1DOXA 1P1AA 3SD5A 4MACA 3N1YC 2KN5A 3VH4B 3VXWA 4YTNB 2WWZA 4XDCA 1L0VB 1HE8A 3Q3OC 2LFIA 3VUYA 2RD0A 1AW7A 4NQKE 2JU6X 2YEPF 1V80A 3DDCB 2V3SA 2L76A 1OQQA 4NY0A 3QQ8B 3Q8BA 2ICIA 1YN4A 3E9SA 4OVVA 3PLVA 3RMKC 1TKYA 3VH3B 2Q5WD 1TS3A 4MJSB 2IGHA 3IBEA 2N0SB 2D3CA 3DOWA 1SE9A 4B9KA 1FFVA 3J9CA 4G50A 2L83A 4BZAA 3KYCD 3VR9B 2C7HA 2NBVB 3GE8C 2PIAA 1R4NB 3BIID 1L6VA 2PEAA 4LK0M 2E3TA 3Q8EA 1DOIA 3PPAA 2KO3A 3FKYA 1CMXB 4HPPA 2KQ4X 1S1QB 2KYWA 4P6VF 2GB1A 1YJ1A 4RF1A 1PGBA 2V4LA 2BYFA 2G9HD 2B3AA 3ZGZA 4AUQC 3Q6BA 4YXDB 3EFCA 2Z8LA 1E8XA 1C4PA 3MHSD 3TIXA 3Q3MC 1KLGD 2HD5B 3RD2A 3C8YA 2XNAC 2K3UA 2K6DB 1PDXA 2CU3A 4E71A 4KV2A 3RYTA 1WGGA 2I2YA 4A8XC 1FRDA 1PYWD 1PUTA 5L95C 1WRIA 2AQ2B 1TZOA 2FCQA 1QQRA 4B6WA 3T9LA 3L0WB 4LNOA 1C4AA 4NAWB 3WIMA 5FR3A 3HRDD 3TSSA 4FJYA 1UWXA 3VTVA 2VZKB 3SR6A 2ZVNA 5EDSA 2M0XA 1KF6B 3Q2AC 3S2AA 2N9LA 1YN3A 2RR9A 1LM8B 4TQ0A 2BW2A 4HDOA 1SGHA 2BWES 4N6EB 3MHZA 3O13A 2JYEA 1TS4A 3ONSA 1KJTA 1A70A 5G55A 3ALBA 2KANA 1VD2A 3RCZA 2L1AA 5J17A 2ZNVC 4DDID 3V61A 4M00A 1XO3A 2OOBB 3NVYA 3DBHB 1WMHA 2INCC 1I4GA 2WXFA 3KLSX 3ZDMC 3E56A 2BTEA 4KIKB 3PO0A 3CF6E 3NOBA 4X57B 1WGHA 1H4RA 1D5ZC 2H88B 3ZO5B 5HI1A 1J7CA 4GGQA 1L7YA 4HKZE 1TYGB 2RDBC 3AE4B 1J19A 2Y5PA 3TUOA 1YIWA 5BO4B 1K53A 1TZ1A 4HXDA 1PGAA 2EMTA 4OZAA 3OAWA 1N60A 2BKFA 2KMCA 1T6BX 5H8YE 1TS5A 1K51A 3WAOA 1XT9B 1TJEA 3IAM1 3DPDA 5I4DA 2GBRA 4KZCA 1E7PB 2KMAA 2MBOA 2JZ3B 2LVPA 4W9FA 1I4XA 1V2YA 3HVZA 1VZ7A 4NAMA 2K0PA 4ZRIA 3NVVA 4LNIA 4A55A 5BYRA 2IO0B 2ZZPB 1Y56A 3JYUA 4USAA 1FNUA 1YMHE
chains in the Genus database with same CATH topology
2BYTA 2D5GA 5C2TB 4C7ZA 1SE3A 2M0AA 3IT6B 3NUHB 2LUMA 5TSSA 1F2RI 2XN9C 4CQNA 1STEA 4P16A 4ZOHC 1MHXA 3Q8AA 5T8IA 4KGRA 1FEHA 2V3PA 4NZLB 2JSVX 3WCQA 1CK1A 2WNMA 3P4PB 2DWQA 4JX1C 4DXGA 3CWIA 3PZ7A 1JQ4A 1C9FA 1NYRA 3KWVA 2MH7A 1UNSA 3N9YC 2KACA 1XCQL 3CIRB 4HROA 1PGXA 1BMLC 1TY2A 1ZDVA 2LHDA 2NTSA 5BYQA 1QOGA 2N9KA 1L0XB 4RGNA 5E6JA 1KTKA 1QOFA 1L4ZB 1NENB 3Q69A 4A9AA 1WSPA 1V1PB 1ROEA 3GB1A 4IOIE 1FXAA 3P63A 4WWMA 3IT4B 1AWDA 5EE3A 2JWUA 2IDYA 3L4PA 2W3RA 4OW0A 1SE2A 5BYSA 2MJEA 1XEEA 2JXTA 4YT0B 3BVZA 2BS2B 2E6XA 4ITKA 2AQ3B 2WXPA 3R2TA 3EGRA 3P4RB 3W9CB 1MPEA 2WS3B 4LTUA 1L4DB 3AM9A 3TEWA 1GAQB 3AEFB 3ETRA 4YWGG 4DXFA 3SFEB 1T3QA 2WU2B 1SB3C 2LMCA 3AECB 1KH0A 3B9JA 3B2FA 1QF6A 3AE7B 1GPXA 1NI3A 4OZCA 4KX6B 4UDUC 3U52E 4C7YA 4ZHPA 1IUEA 3U4EG 1FCCC 3VRAB 2BT6A 1MVKA 1FO4A 1RWSA 3SEBA 4RCOA 2J4XA 3I9V1 3FC4A 4JPSA 1DOYA 3AEBB 3R2IA 1XF5L 3NZ3A 4Q2JA 5JXVA 1EM7A 1R7SA 4H2AA 2W82A 4ARCA 4YSXB 1XXGA 2MEKA 4FXCA 4TMAB 1V1PA 1RM6C 5EE9A 1FM0D 1SIJA 2N7JA 2WXLA 3AMZA 3GP7A 2V4IB 4MT5A 1OQRA 1QOBA 1HXYD 1QOAA 2ON8A 5LNK1 1VLBA 2L52A 2BS4B 1JWUD 4RGMA 1JMLA 2VZKD 5H92C 3KQ4A 5FKAC 2QJLA 1K52A 1J7BA 2WDVB 3AH7A 3U7ZA 3ABVB 1E6EB 5AUIA 3P1MA 4WAFA 1HQRD 2K5PA 4ZRPA 1VR9A 2OHFA 3RFZB 3BVMA 3ZQ4A 2WXJA 3BK1A 2NMQA 2M56B 2WXQA 1IGCA 4LLGM 3FAHA 1F77A 2MJ3A 1GB4A 3V3XA 1I4QA 1F2RC 1FD6A 2PMVA 3V05A 1ZPSA 2MJDA 1ZE3D 1T5XD 2WDQB 4XWTA 4US8A 4R3DA 2HTME 2ZW0A 4AS1A 1RFKA 2I38A 4L2YA 2RDGA 1SE4A 2PTLA 3IXSA 4XE0A 5D3IB 2J52A 3W5UB 1C78A 2WXRA 1TS2A 2WXHA 2IPKD 1EWCA 2R61A 3DWMA 4WURA 4L1BA 2QEJC 4YTPB 4RH6A 2H89B 2EELA 2KDMA 5HFYA 1NYQA 4KKIA 1XLOA 3T3NA 2LHEA 4YTMB 2V3NA 2BB5A 5MPOA 1SSNA 1JWMD 1UGJA 1VZ8A 1AN8A 2WP9B 1KLUD 5AUKA 3MC0B 1YNTE 1XLPA 1DGJA 1JWAD 1EU4A 2WLBA 4C56C 4EE2A 3AE2B 2WXKA 2KN4A 1YN5A 1SBBB 4TQ1A 1VDVA 4IDIA 1ZXIA 3KWLA 1CJEA 2EKIA 3PZ8A 2DYOA 2CJNA 1AYFA 2IGGA 3AE6B 3BK2A 1FNWA 1TY0A 5HHDG 5EE0A 3T3OA 5GXGB 2KAJA 2SEBD 4JWUC 1C76A 4RFBA 4GDKB 4WH4A 1PFDA 1WGKA 1Q10A 3FILB 1J7AA 4YSZB 1D4BA 4HEA1 1FCLA 1MI0A 2JQRB 4M0WA 2W54A 1FMAD 3BZDB 4ZHOA 2V0GA 2DYMA 1V97A 2ACZB 2Y3AA 1QILA 1L6UA 2FE8A 5C3JB 1DOXA 2Y5CA 3AV8A 1SF0A 4MACA 4WIPA 1D5XC 1I7HA 4L23A 4YTNB 4XDCA 3LB8C 1L0VB 2PLPA 2LFIA 3MFGA 1F0ZA 3P4QB 3AEAB 1AW7A 4A6QA 1ZUD2 2JU6X 1BXTA 4IKGA 2YEPF 1I4HA 2FBWB 1RYJA 3TEXA 2LJIA 3BYYB 1QLBB 4JE3B 1WYGA 3P42A 1N61A 1YQ3B 3Q8FA 2RDHA 3Q8CA 3AN1A 2M19A 1OQQA 2IGDA 3OWEB 3EUB2 3Q8BA 4KGSA 2ICIA 1YN4A 3E9SA 1GB1A 1SJED 1SXTA 3H8HA 4HJGE 1LO5D 2CJOA 1K50A 1TKYA 2J42A 2Q5WD 1TS3A 4RNAA 4OZBA 1FNVA 5BMIA 1MHHE 2IGHA 1E0ZA 2N0SB 3B2GA 1ZXHA 1KFYB 4O1NA 5FK9C 1HEZE 2ONQA 3AB5A 1FFVA 1JWBD 3AEDB 3J9CA 5BMGA 1N62A 1BUIC 1TKEA 2L83A 2LGIA 1KRHA 1D5MC 5D3DA 3VR9B 4A90A 1HZ6A 2L32A 2QMTA 3I57A 3VQIA 1ZOYB 1XLNA 4MM3B 4N59A 2KWDA 2PIAA 2J53A 2QSDA 3BIID 2OEDA 1L6VA 4LK0M 2E3TA 3Q8EA 3TEZA 1IBXA 1DOIA 2YEPB 1C77A 1FFUA 3W2DA 2KQ4X 4P6VF 1JALA 1ET6A 2GB1A 4WQMA 4B0EA 1PGBA 3AE5B 4RF1A 4N58A 2G9HD 4ZRQA 3ZGZA 1M4VA 4YXDB 2PKOA 2Z8LA 1QKZA 1IBXB 1SJHD 1C4PA 2JZPA 5BMHA 1I4RA 1P7FA 4MH8A 2QIEB 2G1EA 1KLGD 3W1SA 4D2KA 2NTTA 2SAKA 3C8YA 2XNAC 2JYTA 2K3UA 3ZJVA 2LEKA 1PDXA 2CU3A 3URYA 5HG2A 2I2YA 1D6EC 1VJKA 3NVZA 4PT5A 4A8XC 4JWSC 1FRDA 4XWWA 3BWUD 3AE9B 2ZW1A 1PYWD 3AEEB 1OFFA 1PUTA 2PVOD 1WXQA 4XDDA 1IGDA 1WRIA 4REZA 2AQ2B 1TZOA 4J3OD 1TKGA 1CZPA 1CQVA 1QQRA 3LXFA 1HZ5A 3AE8B 2GRIA 4GLSC 1C4AA 4NAWB 3VR8B 3DWGC 3EA6A 5FR3A 3HRDD 3TSSA 1UWXA 3BVGA 2VZKB 1VZ6A 3SR6A 2GI9A 1KF6B 1FXIA 2N9LA 1YN3A 1JRPA 1DYQA 4TQ0A 2BW2A 3RPFC 2PVGC 2KMMA 1YQ4B 2W55A 2WXMA 3SFDB 3BYTB 1P7EA 4N6EB 1E9MA 2X38A 3MJ5A 3ZJUA 3MHZA 3O13A 2JYEA 3GS2A 3LYYA 2INNE 1TS4A 1ZDXA 2TSSA 1A70A 4RGTA 3HVDA 3NRZA 4C80A 2HDEA 1FIQA 2AQ1B 1C4CA 1NVID 4TSSA 1VRAB 2L1AA 3TEYA 1UWMA 1XLQA 1B1ZA 1JWSD 4ARIA 2K22A 2AX5A 2DBYA 1XO3A 3NVYA 4RF0A 2WDRB 1UUPA 1I4GA 2WXFA 3MP9A 1JCKB 3KLSX 1ACCA 2RMMA 3E56A 3NVWA 3VRBB 4GDLB 3IAS1 2BTEA 1L0YB 1FRRA 3PO0A 2WQYB 2PW9A 2WXNA 2BBCA 4HRSA 4US9A 2WXIA 1D5ZC 2H88B 4KGTA 1QT9A 3P4SB 4YSYB 1J7CA 5D7GA 5HI1A 3U2SC 3R8BA 3AEGB 2BB6A 4HKZE 1TYGB 1YJJA 2WXOA 1NEKB 3AE4B 3NS1A 2Y5PA 3TUOA 5EE1A 5G5HA 1YJIA 2WU5B 1JW9D 1V1OA 2K9XA 3AE3B 1ZP0B 1K53A 3ZJTA 1PGAA 4OZAA 4OVZA 1N60A 1C79A 1T6BX 5H8YE 2RPVA 1TS5A 1N5WA 1K51A 3UI3A 2BS3B 2WXGA 2QILA 1V8CA 1TJEA 1ET9A 1HA5A 2JX5A 4OHJA 4NJCA 2W3SA 3IAM1 1XCTL 1ENFA 3FILA 3ZYYX 2FUG1 3W5VB 5G5GA 5I4DA 1GOZA 2B76B 1E7PB 1EU3A 4HKQA 1E10A 1N63A 4KKJA 3HUIA 3AE1B 1I4XA 3HVZA 1VZ7A 2DLBA 4NAMA 2INPE 4RGOS 4AQ7A 2K0PA 4B0MA 1ESFA 1I4PA 1JROA 3NVVA 1B9RA 4A55A 1SEBD 5BYRA 1L5PA 1N5XA 2IJ0A 1Y56A 4USAA 4DQOC 1EWYC 4ZYSA 1WWTA 1FNUA 1YMHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS4 B;  5C2T B;  4YTN B;  4C7Z A;  5H92 C;  3LB8 C;  1L0V B;  3SR6 A;  2QJL A;  1J7B A;  1KF6 B;  2WDV B;  1FXI A;  3P4Q B;  3AEA B;  3AH7 A;  1F0Z A;  1JRP A;  3ABV B;  4ZOH C;  1ZUD 2;  1E6E B;  5AUI A;  2PVG C;  3P1M A;  3RPF C;  1E0Z A;  2FBW B;  3WCQ A;  2KMM A;  1RYJ A;  1YQ4 B;  2K5P A;  2W55 A;  3SFD B;  3P4P B;  1QLB B;  2DWQ A;  4JX1 C;  4N6E B;  1E9M A;  1WYG A;  2OHF A;  3CWI A;  1N61 A;  1YQ3 B;  1JQ4 A;  3AN1 A;  2M19 A;  1OQQ A;  1NYR A;  2M56 B;  2MH7 A;  1A70 A;  3EUB 2;  3FAH A;  3NRZ A;  4C80 A;  2MJ3 A;  1FIQ A;  1NVI D;  3CIR B;  4HRO A;  1UWM A;  2CJO A;  1TKY A;  1XLQ A;  2Q5W D;  1QOG A;  2MJD A;  2WDQ B;  4US8 A;  1QOF A;  2HTM E;  1NEN B;  1RFK A;  2K22 A;  2N0S B;  4A9A A;  2AX5 A;  3B2G A;  1KFY B;  1ROE A;  2DBY A;  1FXA A;  1XO3 A;  3P63 A;  3NVY A;  3AB5 A;  4WWM A;  1FFV A;  1JWB D;  3AED B;  2WDR B;  1N62 A;  1AWD A;  1TKE A;  5EE3 A;  2L83 A;  3W5U B;  3L4P A;  2W3R A;  1KRH A;  2MJE A;  3DWM A;  3NVW A;  3VRB B;  3VR9 B;  4YTP B;  1FRR A;  3PO0 A;  4YT0 B;  1ZOY B;  2WQY B;  1XLN A;  2BS2 B;  2H89 B;  4N59 A;  2PIA A;  1NYQ A;  4ITK A;  4HRS A;  1XLO A;  4US9 A;  3BII D;  1L6V A;  4YTM B;  2E3T A;  5MPO A;  2H88 B;  3P4R B;  1DOI A;  1QT9 A;  2WP9 B;  5AUK A;  3P4S B;  4YSY B;  1J7C A;  3W9C B;  2WS3 B;  4LTU A;  1FFU A;  1XLP A;  1DGJ A;  3AEG B;  3AM9 A;  1GAQ B;  1TYG B;  1YJJ A;  3AEF B;  1JWA D;  1NEK B;  3ETR A;  3AE4 B;  3NS1 A;  4P6V F;  2WLB A;  1JAL A;  3SFE B;  1T3Q A;  5EE1 A;  2WU2 B;  3AE2 B;  4WQM A;  1SB3 C;  3AE5 B;  5G5H A;  1YJI A;  2WU5 B;  4N58 A;  3AEC B;  3B9J A;  1QF6 A;  1JW9 D;  1VDV A;  3B2F A;  4IDI A;  2K9X A;  3AE7 B;  3AE3 B;  1ZP0 B;  1ZXI A;  2PKO A;  3KWL A;  1CJE A;  4YXD B;  1GPX A;  1NI3 A;  2EKI A;  4KX6 B;  4C7Y A;  4ZHP A;  1IUE A;  3VRA B;  2CJN A;  1AYF A;  1N60 A;  2QIE B;  3AE6 B;  2BT6 A;  2G1E A;  5H8Y E;  1FO4 A;  1RWS A;  5EE0 A;  1N5W A;  5GXG B;  2BS3 B;  2KAJ A;  3FC4 A;  4JWU C;  1V8C A;  1TJE A;  2LEK A;  2JX5 A;  1PDX A;  1PFD A;  1WGK A;  2CU3 A;  3AEB B;  1J7A A;  4YSZ B;  2W3S A;  1VJK A;  2JQR B;  3ZYY X;  3W5V B;  3NVZ A;  5G5G A;  4JWS C;  1R7S A;  1FRD A;  2W54 A;  2B76 B;  4YSX B;  3AE9 B;  1E7P B;  1FMA D;  3AEE B;  4FXC A;  1N63 A;  1E10 A;  1RM6 C;  4ZHO A;  5EE9 A;  1FM0 D;  1OFF A;  1PUT A;  1SIJ A;  1V97 A;  2PVO D;  2ACZ B;  3AE1 B;  3AMZ A;  3HUI A;  3HVZ A;  1WXQ A;  1OQR A;  1WRI A;  1TKG A;  1CZP A;  1L6U A;  1QOB A;  3LXF A;  3AE8 B;  5C3J B;  1JRO A;  1DOX A;  1DOY A;  2Y5C A;  3NVV A;  1B9R A;  3VR8 B;  3AV8 A;  1SF0 A;  1L5P A;  1N5X A;  3DWG C;  4USA A;  1QOA A;  1EWY C;  1WWT A;  3HRD D;  1I7H A;  1VLB A;  2L52 A; 
#chains in the Genus database with same CATH topology
 2HJ8 A;  5C2T B;  4AJY B;  3IT6 B;  5JHA A;  1E8Z A;  2LUM A;  1UBQ A;  1F2R I;  2IO1 B;  4P16 A;  2AL6 A;  5T8I A;  3UQA A;  3OJ3 A;  2KFJ A;  1RFA A;  2DWQ A;  5IN7 A;  3KWV A;  5E6N A;  4URK A;  2MH7 A;  1N6Z A;  3N9Y C;  2KLC A;  4IM2 A;  5KHO A;  2KQ7 A;  2KX0 A;  4HCP B;  2KQS A;  2LHD A;  1L0X B;  2BYV E;  1AAR A;  4WWM A;  3BY4 B;  3IT4 B;  4IG7 B;  2JWU A;  2IDY A;  2W3R A;  2QDF A;  2KHW B;  4K7S A;  4ITK A;  2WXP A;  1GJZ A;  4MM3 A;  2J0M A;  3DHI C;  3LJ3 A;  2LWP A;  2K39 A;  2K1F A;  3W9C B;  4LTU A;  3ZUN A;  4JIO U;  2OJR A;  2RSU A;  2WX0 A;  1WXV A;  3AEC B;  1KH0 A;  1QF6 A;  2KWU B;  1NI3 A;  2NPT A;  4ANX A;  5IO9 A;  3U4E G;  2DEN B;  2HJ1 A;  2J4X A;  2K8H A;  2GBN A;  3FC4 A;  4JPS A;  3NZ3 A;  3IFW B;  3RI7 C;  4H2A A;  4YSX B;  3T8M A;  1FM0 D;  1OQR A;  4DHZ E;  3WAN A;  5LNK 1;  2MQJ A;  2KFK A;  2MX2 A;  2DNF A;  2BS4 B;  4EOY A;  1JML A;  2VZK D;  3ZKJ C;  1K52 A;  3AH7 A;  3U7Z A;  3Q14 C;  3VUW A;  3ZDT A;  2ZJD A;  4MJS A;  1V81 A;  2DZI A;  2G45 B;  3RFZ B;  3ZQ4 A;  3BK1 A;  3X23 A;  1BT0 A;  5CHV C;  4ZRJ A;  1F2R C;  2BVC A;  2LUE A;  4KSK C;  1FD6 A;  2WDQ B;  3R66 C;  4ANU A;  5DPS A;  4AS1 A;  2I38 A;  2RGF A;  3QC8 B;  2KC1 A;  1SE4 A;  2PTL A;  3IXS A;  5D3I B;  3NY5 A;  4W9I A;  2ZCB A;  1TS2 A;  3DWM A;  4YTP B;  2OJW A;  2EEL A;  5HFY A;  4KKI A;  1XLO A;  1PQS A;  2MP2 A;  5CTR C;  5AUK A;  2Z0E B;  4NJ6 A;  3M62 B;  3QX1 A;  2KN4 A;  1MG4 A;  4W9H A;  3PRP B;  1SBB B;  3VFK A;  1ZXI A;  3DBR B;  1LXD A;  3AE6 B;  3BK2 A;  1WJ4 A;  1TY0 A;  4XZ4 A;  3N3K B;  4RFB A;  2ZEQ A;  4GDK B;  1WGK A;  4WH4 A;  1Q10 A;  3UGB B;  1D4B A;  4HEA 1;  4FA6 A;  2K8C A;  4M0W A;  4ZHO A;  1P0R A;  3OG5 A;  1E8W A;  2LJ5 A;  5AZH A;  3PTF C;  2JPH A;  1UD7 A;  2FE8 A;  2LXA A;  1E7U A;  5C3J B;  2HE7 A;  4DHJ D;  1I7H A;  2L05 A;  3ZXV A;  3PRZ A;  5HKH A;  2CR5 A;  2PLP A;  4K3C A;  3MFG A;  4AP4 C;  5D94 A;  4C4V A;  4NPN A;  1BXT A;  3K9P B;  3A9K A;  4IKG A;  2AL3 A;  1I4H A;  3TEX A;  2LJI A;  4M01 A;  1N61 A;  2REX A;  1EUV B;  4W9L A;  2M19 A;  4LJO B;  3EUB 2;  4KGS A;  2IY1 B;  3QAQ A;  1SJE D;  1SXT A;  3H8H A;  4HJG E;  1LO5 D;  4PS3 A;  2MCN B;  5L83 A;  4RNA A;  1FNV A;  4II2 B;  1E0Z A;  3PVL A;  2NBU A;  3B2G A;  2MA9 B;  3AB5 A;  1JWB D;  5BMG A;  4MEL A;  1N62 A;  5IOI A;  1P98 A;  1KRH A;  4IC7 B;  4MSQ B;  4LDT B;  5D3D A;  1YQB A;  3VQI A;  1ZOY B;  2KWD A;  2MBB B;  2J53 A;  2QSD A;  2OED A;  1G6J A;  4M8M A;  3N32 A;  4M8N A;  1XQQ A;  4B0E A;  1YOV B;  3AE5 B;  2ZPN A;  2KJR A;  2PKO A;  1WE6 A;  1Z5S B;  4GIV A;  4OVU A;  5BMH A;  1P7F A;  2C5L C;  2QIE B;  2G1E A;  4D2K A;  2L8J A;  4XC2 A;  5HG2 A;  3VHT C;  1VJK A;  3NVZ A;  4PT5 A;  2UU7 A;  1OEY J;  1WR6 E;  3AEE B;  4S17 A;  3ZNG C;  1IGD A;  1MFW A;  4J3O D;  3LXF A;  1HZ5 A;  3AE8 B;  2GRI A;  3DQV A;  3KW5 B;  4GLS C;  3VR8 B;  1V9J A;  3DWG C;  5AEK B;  1VZ6 A;  4LNF A;  4HPL B;  4AOF A;  1V5T A;  2LGD A;  1JRP A;  1DYQ A;  4HCN B;  1Q5W B;  2PVG C;  2R2Q A;  1YQ4 B;  3ECI A;  4ZYN A;  2A5U A;  2X38 A;  1LGR A;  1WX9 A;  2M17 A;  2FIF A;  4YL8 A;  1NVI D;  4TSS A;  4BKT A;  2FCM A;  4WJO A;  4MGK E;  2I1K A;  3MC8 A;  1UH6 A;  2UWQ A;  1TGZ B;  1EO6 A;  1GC7 A;  1WJ6 A;  5LLI A;  1JCK B;  1P3Q U;  3VRB B;  4GDK A;  3IAS 1;  3GZN B;  2VH1 A;  2NVU I;  3VTW A;  2WQY B;  3TMP B;  5KHQ A;  4US9 A;  2K6Q A;  4MGY E;  2WXI A;  4HK2 A;  1UEL A;  5AZG A;  2JVC A;  3P4S B;  2KT7 A;  4GB9 A;  2MHJ A;  2BB6 A;  1WGR A;  2Z0D B;  1WIA A;  3N30 A;  5DPR A;  1YJI A;  3H1U A;  4W9K A;  4EKU A;  2K9X A;  2DYB A;  2L0F A;  2C9W B;  3APF A;  4CYE A;  3KYD D;  4OVZ A;  4JGH B;  2HTH A;  2QIL A;  2M8S A;  3RNA C;  1RLF A;  3FIL A;  3ZYY X;  2VRR B;  4A3O A;  2K25 A;  2PE9 A;  1WRD B;  1UGM A;  2DLB A;  3KUC B;  2INP E;  3L08 A;  1P9D U;  4AQ7 A;  3L13 A;  4B0M A;  1I4P A;  1VCB A;  1SEB D;  1V86 A;  3AUL A;  2LZ6 A;  1TIF A;  2D5G A;  3CSF A;  4C7Z A;  1SE3 A;  2ASQ A;  3VAW A;  4CQN A;  1MHX A;  3ZTC A;  3Q8A A;  4KGR A;  2BYE A;  2V3P A;  4BOZ B;  1CK1 A;  2LI5 A;  4DXG A;  1A5R A;  2KTF A;  1JQ4 A;  3IVF A;  1C9F A;  3QK0 A;  3HHM A;  4KZ0 A;  5JHB A;  2BQQ A;  3CIR B;  4HRO A;  2D3G A;  3UF8 A;  1BML C;  2K8B A;  5BYQ A;  1QOF A;  3Q69 A;  4K1R B;  4A9A A;  1WSP A;  1V1P B;  2AEH A;  2QC8 A;  1AWD A;  5EE3 A;  1SE2 A;  4MEM A;  2KDF B;  4LDT D;  4C4V B;  1XEE A;  2GOW A;  1X1M A;  2WX1 A;  1JRU A;  4YT0 B;  3R2T A;  5GMV A;  5DPW A;  3UQB A;  3ZLZ A;  3AM9 A;  2FID A;  4YWG G;  3H7P B;  4DXF A;  1T3Q A;  3A4R A;  1SB3 C;  2M1M A;  3B2F A;  2LRU A;  4TUU A;  3AE7 B;  4M0W B;  4BKS A;  4OZC A;  2GMI C;  1YX5 B;  3GZN I;  4ZHP A;  4MDK E;  4MGZ E;  3DVN V;  1WY8 A;  4RCO A;  3I9V 1;  2BPS A;  4E74 A;  1DOY A;  3LDZ E;  5JXV A;  4ARC A;  2D07 B;  4FXC A;  3A4S C;  3V62 A;  3U8Z A;  2LAS A;  2O6V D;  2N9X A;  4A3P A;  1QOB A;  1OEY A;  4ZRK A;  1HXY D;  1YX6 B;  4LCD E;  4WQO B;  3M95 A;  3C0R B;  4NAW A;  2L52 A;  4BKS D;  1V49 A;  4RGM A;  3RNC C;  2AYO B;  2QJL A;  3SHQ A;  1FPY A;  3B08 A;  5CX3 A;  4I6L B;  1E6E B;  3CST A;  3QAR A;  4IW0 A;  4LNK A;  4WAF A;  4RM8 A;  3DHH C;  1T0R C;  2NMQ A;  2M56 B;  3PSE B;  2C60 A;  2L7R A;  2MJ3 A;  1GB4 A;  3ZVV A;  1I4Q A;  3EC8 A;  1ZW7 A;  2D3A A;  3ZIM A;  2LD9 A;  3QHT A;  2PMV A;  1ZPS A;  1T5X D;  4US8 A;  4R3D A;  2ZW0 A;  1V6E A;  2RDG A;  1HTO A;  3N20 C;  4XE0 A;  2XK5 B;  2WXR A;  5JH5 C;  2R61 A;  4WUR A;  3Q3N C;  4W9E A;  4L1B A;  4EZK A;  3RUL A;  2KFK B;  4I6P A;  2NCN A;  2KDM A;  4G3X B;  2LHE A;  2ZCC A;  4YTM B;  5D6J B;  4DXA B;  2Y5B B;  3D32 A;  3OJ4 B;  5MPO A;  3DBS A;  1UGJ A;  2WP9 B;  1KLU D;  3MC0 B;  1MG8 A;  2O6V A;  1XLP A;  3NZS A;  1EU4 A;  3L10 B;  2WLB A;  3PHW B;  4EE2 A;  3AE2 B;  2WXK A;  2XBB C;  4IDI A;  3KWL A;  1CJE A;  1TBE A;  2D3B A;  3AU5 A;  2VH2 A;  2DYO A;  1AYF A;  1FNW A;  4FN2 A;  5EE0 A;  5GXG B;  1C76 A;  2MBH A;  1J7A A;  4YSZ B;  2KTR B;  2JRH A;  1MI0 A;  4GOC A;  4W9J A;  1FMA D;  3A1Q B;  1YD8 U;  1RRB A;  2JF5 A;  2JXX A;  3VTU A;  5C23 A;  1TTN A;  2N1V A;  3QJZ A;  4F7Z A;  1D5X C;  1NI2 A;  1Y8R C;  2DAJ A;  1WXS A;  2L0T A;  2KDI A;  3Q3F A;  1F0Z A;  3P4Q B;  3AEA B;  3UIO B;  4GSW A;  4A6Q A;  2FCS A;  2FBW B;  1RYJ A;  4JE3 B;  2CS4 A;  4WWP A;  1WYG A;  3H7S A;  3Q8F A;  1WH3 A;  3AN1 A;  4IM3 A;  3TCA A;  3CMM B;  3SU8 X;  2N7E A;  1F1H A;  2WGS A;  2KVZ A;  2J42 A;  2O2V A;  3I5J C;  4K7U A;  4OZB A;  3HK0 A;  5BMI A;  1ZXH A;  4JLC A;  2ONQ A;  3PZD A;  3I63 C;  2EMS A;  1WI0 A;  1BUI C;  1TKE A;  5IP4 D;  4W9D A;  1OTR B;  4EEW A;  1D5M C;  3K9O B;  2KLG A;  4A90 A;  2KNB A;  1HZ6 A;  2QMT A;  3I57 A;  4MM3 B;  3RT3 B;  4WJQ A;  1WGD A;  3VVW B;  1S3S G;  2RPQ A;  1C77 A;  1FFU A;  3W2D A;  2Z59 B;  1JAL A;  1ET6 A;  4WQM A;  1FXT B;  2LGY A;  1LQB A;  2D10 A;  1M4V A;  3PT2 B;  3EHV A;  1QKZ A;  1Q0W B;  3QCA A;  2JZP A;  1I4R A;  2KDE B;  4MH8 A;  3DBR I;  2NTT A;  2SAK A;  4HWI B;  2I1J A;  3URY A;  4PYZ A;  2FNJ B;  1WMH B;  3RNG C;  3BWU D;  3AE9 B;  1IPG A;  2ZW1 A;  1GC6 A;  2N9P C;  2PVO D;  3SDL C;  4XDD A;  3MC9 A;  4REZ A;  2X8X X;  3W1S C;  3V6E B;  1CQV A;  4EFO A;  2KK8 A;  4FUL A;  1R4N I;  3EA6 A;  4KIK A;  5DPT A;  4S0R A;  2KJH B;  3BVG A;  4PYU A;  2GI9 A;  1FXI A;  3O65 B;  2W55 A;  2WXM A;  3SFD B;  3BYT B;  3ZJU A;  1U4A A;  2LRW A;  3GS2 A;  2INN E;  1ZDX A;  2TSS A;  3APD A;  4ACF A;  3NRZ A;  5LXH A;  2HDE A;  4BOS C;  1FIQ A;  3IG3 A;  1C4C A;  1T0Y A;  2CHX A;  3GE3 C;  1B1Z A;  4ARI A;  3R3M A;  2K22 A;  4ANW A;  4WJP A;  1L2N A;  4DHZ B;  2WDR B;  1UUP A;  2YLM A;  3X0W A;  5E6O A;  4MH0 E;  5IA7 A;  3NVW A;  4W9G A;  1L0Y B;  1LFD A;  3AI5 A;  3DBL B;  2L3Z A;  2PW9 A;  2BBC A;  2GLS A;  3ZRC A;  4HRS A;  2KC2 A;  3AEG B;  2WXO A;  1NEK B;  2IZV B;  5EE1 A;  5G5H A;  2WU5 B;  1JW9 D;  3AE3 B;  1ZP0 B;  2QCZ A;  3WAL A;  3ZJT A;  4FHK A;  4KVG B;  2NBW B;  1N5W A;  2BS3 B;  2WXG A;  1ET9 A;  1HA5 A;  2JX5 A;  4OHJ A;  4NJC A;  2W9N A;  4BKG A;  4KSL C;  1XCT L;  1ENF A;  2FUG 1;  3W5V B;  5G5G A;  2IBI B;  3RNE C;  1GOZ A;  2B76 B;  4EZL A;  3AE1 B;  3ZTD A;  2LXC A;  2KZR A;  4RGO S;  5C1Z A;  1ESF A;  1JRO A;  3WA0 A;  1B9R A;  4G0N B;  2CU1 A;  2IJ0 A;  1EWY C;  3JW0 X;  3NUH B;  1ZKH A;  4NJ7 A;  3KH0 A;  2AWT A;  2XN9 C;  1STE A;  4ZOH C;  3APC A;  4IUM B;  4NZL B;  2JSV X;  3WCQ A;  5LXI B;  2WNM A;  3P4P B;  3UIP B;  2NPT B;  4JX1 C;  4M02 A;  3PZ7 A;  3HM3 A;  1UNS A;  2KKC A;  1XCQ L;  1PGX A;  3PGE A;  4PS7 A;  3ZRF A;  1QOG A;  2N9K A;  1L4Z B;  3KVF B;  4EUT A;  3MJW A;  1ROE A;  1FXA A;  3VUX A;  1RAX A;  3P63 A;  3AXC A;  1KLV A;  2PPH A;  1UF0 A;  3L4P A;  2O6V B;  2IO2 B;  1WGY A;  2JWZ A;  1J8C A;  1Q1O A;  1GNU A;  4AWJ A;  4BBN C;  3DBL I;  2AQ3 B;  3EGR A;  5IAA C;  1MPE A;  3TEW A;  3A9J A;  3AEF B;  3QA8 A;  1F9J A;  4II3 B;  2M4N A;  2LMC A;  2O2V B;  2KTR A;  2DZK A;  2D11 A;  4P7I A;  4KX6 B;  3U52 E;  4XYC A;  1IUE A;  1FCC C;  3VRA B;  4HDQ A;  3UIN B;  1MVK A;  3SEB A;  4C00 A;  3PHX B;  2JRI B;  2L00 B;  1XF5 L;  4Q2J A;  2CHW A;  1R7S A;  2W82 A;  4F8C B;  2MEK A;  4TMA B;  1V1P A;  2N7J A;  2WXL A;  3AMZ A;  2V4I B;  3PV1 A;  4WAA A;  2KD0 A;  1R4M B;  4RMA A;  3ZNH B;  3A33 B;  1VLB A;  1JWU D;  5H92 C;  4FJZ A;  2WHI A;  3P1M A;  3HM6 X;  3PRM B;  4ZRP A;  3H7P A;  2J0J A;  4GN1 A;  2OHF A;  4A20 A;  2LVQ A;  3BVM A;  2WXJ A;  4LLG M;  3NZU A;  4IWQ A;  3V3X A;  2KDB A;  4WJN A;  3R7Q A;  1WZ0 A;  3R7R A;  3V05 A;  2MJD A;  1ZE3 D;  4XWT A;  4HVB A;  2A4Z A;  1C78 A;  2IPK D;  1I35 A;  2QEJ C;  3JVZ X;  4EZJ A;  4RH6 A;  2CHZ A;  2MLB A;  1NYQ A;  3B1L X;  3QIJ A;  3T3N A;  3N1Z C;  2V3N A;  2BB5 A;  1SSN A;  1JWM D;  1VZ8 A;  4BVU C;  1AN8 A;  4AJW A;  1R4M I;  1YNT E;  1DGJ A;  2FUH B;  4LNN A;  3VDZ A;  4C56 C;  1YN5 A;  3A9K B;  1OQY A;  4TQ1 A;  5E6P A;  4CHK A;  2EKI A;  2G4S A;  1KM7 A;  3PZ8 A;  1IP9 A;  2IGG A;  3DBH I;  1NDD A;  2MW5 A;  5HHD G;  1D3Z A;  2KAJ A;  4JWU C;  1PFD A;  4HPM B;  4GDL A;  2IY0 B;  4NNJ B;  1FCL A;  1WE7 A;  3KUD B;  3P2B A;  3NJT A;  2V0G A;  2DYM A;  2ACZ B;  4MSM B;  3U7D A;  1QIL A;  1WXA A;  1L6U A;  3NHE B;  2Y5C A;  3AV8 A;  1SF0 A;  2MSE D;  4WIP A;  5DCN A;  4L23 A;  2J0K A;  2V9H A;  3LB8 C;  2JZZ A;  1ZUD 2;  4F1S A;  4I6N B;  3BYY B;  1QLB B;  3P42 A;  1YQ3 B;  3Q8C A;  2RDH A;  1WF9 A;  2IGD A;  3QWZ B;  3OWE B;  2BGF A;  1GB1 A;  1WJU A;  4KDL B;  2CJO A;  1K50 A;  2G3Q B;  3ML8 A;  1OGW A;  1E8Y A;  1MHH E;  3DVN U;  1WXM A;  3A1Q A;  2KVR A;  4O1N A;  4P1B C;  1KFY B;  5FK9 C;  1HEZ E;  1WX7 A;  3AED B;  2LGI A;  2JY6 A;  3B0A A;  3TBL D;  4CO7 A;  2L32 A;  4FBJ B;  5J18 A;  1XLN A;  4N59 A;  1J0G A;  2XEW A;  4G11 A;  3TEZ A;  1IBX A;  2YEP B;  4NQL B;  1ZGU B;  1Z2M A;  4IWO A;  5FR6 A;  4N58 A;  4ZRQ A;  1WJN A;  1IBX B;  1SJH D;  2JUO A;  4FJV B;  3W1S A;  1TT5 B;  2JYT A;  3ZJV A;  2LEK A;  3N1X C;  3GOE A;  1D6E C;  3M63 B;  2MBQ A;  4JWS C;  3RNF C;  1UBI A;  4XWW A;  3RUI B;  2DZM A;  3HIZ A;  1OFF A;  5G2N A;  1WXQ A;  2UYZ B;  2V1Y A;  1TKG A;  1CZP A;  3Q3J A;  1E7V A;  4FHJ A;  2BF8 B;  3EFU A;  4TKN A;  4MGI E;  3M3J A;  3ZW3 A;  1E5W A;  1C1Y B;  2N1W A;  4HJK A;  2ZPY A;  2KWC A;  2JT4 B;  4J6I A;  3DHG C;  2IYD B;  3RPF C;  2KMM A;  2WYQ A;  1P7E A;  3V60 A;  1E9M A;  3MJ5 A;  3PS6 A;  3LYY A;  4FAD A;  4RGT A;  3HVD A;  4C80 A;  2GBK A;  4W9C A;  2AQ1 B;  3TJP A;  1VRA B;  3TEY A;  1UWM A;  1SIF A;  3JSV A;  1XLQ A;  1WYW B;  1JWS D;  1GUA B;  4DHJ B;  2AX5 A;  3L17 A;  2DBY A;  4RF0 A;  2KJ6 A;  3MP9 A;  2IO3 B;  4QAY A;  1ACC A;  2RMM A;  4GDL B;  1FRR A;  1EF5 A;  4FLH A;  2G4D B;  4DWF A;  1WFY A;  2WXN A;  2GBM A;  3RZW C;  1HTQ A;  4DDG D;  1GG3 A;  4KGT A;  1QT9 A;  4YSY B;  5D7G A;  3U2S C;  1H8C A;  3R8B A;  1YJJ A;  2C7M B;  3NS1 A;  3IHP C;  1T0S C;  2MBE A;  1K8R B;  1V1O A;  4IWP A;  2KOX A;  1EF1 A;  1C79 A;  2ZNV B;  2RPV A;  2DAF A;  4XGA B;  4PK1 A;  3UI3 A;  1ISN A;  1V8C A;  2W3S A;  1UZX B;  2YVC A;  2CKH B;  1WZ3 A;  1EU3 A;  4HKQ A;  4GU2 A;  1E10 A;  1N63 A;  4KKJ A;  3HUI A;  2C7N B;  3AU4 A;  2PE6 B;  3ZNZ B;  2LGS A;  1QZE A;  2KWV B;  1L5P A;  1N5X A;  2NS5 A;  4DQO C;  3L16 A;  4ZYS A;  1WWT A;  4P1C C;  2BYT A;  2M0A A;  2FAZ A;  5TSS A;  4PS8 A;  3NG0 A;  1I42 A;  1FEH A;  3W1Y A;  4ANV A;  4LJP B;  2R2O A;  3CWI A;  4WWN A;  2KX3 A;  1NYR A;  4N9F 4;  3RNB C;  2KAC A;  3EEC A;  2XK5 A;  4DK5 A;  5J2R A;  3OLM D;  4K81 A;  1TY2 A;  1ZDV A;  2NTS A;  1WX8 A;  2EKE C;  4RGN A;  5E6J A;  1KTK A;  1NEN B;  2IND C;  4BBN F;  3GB1 A;  4IOI E;  5CHF A;  1MJD A;  2LVO A;  3I3T B;  4OW0 A;  5BYS A;  2MJE A;  3KUZ A;  2BWF A;  1WM2 A;  2JXT A;  3DVG X;  3BVZ A;  2BS2 B;  3RZF A;  3ML9 A;  2E6X A;  5CHW A;  3H9D A;  2J7Q B;  3P4R B;  2WS3 B;  5D2M B;  1L4D B;  1GAQ B;  3DCG A;  3L54 A;  3ETR A;  3SFE B;  1V5O A;  2WU2 B;  3B9J A;  1GPX A;  4ASW C;  4UDU C;  4C7Y A;  2BT6 A;  1NBF C;  1FO4 A;  1RWS A;  3NS8 A;  3PRE A;  4JL9 A;  3AEB B;  3R2I A;  1WR1 A;  2DHZ A;  1EM7 A;  1XXG A;  4HLE A;  1RM6 C;  5EE9 A;  1SIJ A;  3GP7 A;  1F52 A;  4MT5 A;  4KDI C;  2ZVO A;  1M94 A;  1QOA A;  2ON8 A;  2N7D A;  2D2Q A;  5IKC M;  5AZF A;  3KQ4 A;  3DVG Y;  2MP2 B;  5FKA C;  2FCN A;  1J7B A;  2WDV B;  4WWO A;  3ABV B;  3ZXR A;  3PLU A;  5AUI A;  4XX5 A;  1HQR D;  2K5P A;  3ZNI D;  3WAP A;  1VR9 A;  4IM0 A;  2WXQ A;  4K7W A;  1IGC A;  4DBG A;  3FAH A;  1F77 A;  4ZDV A;  2N4F A;  4B95 A;  3RN9 C;  2HTM E;  1RFK A;  4L2Y A;  1T0Q C;  1C3T A;  3U30 A;  4GXB A;  1KOT A;  2DX5 B;  2J52 A;  3W5U B;  2WXH A;  1EWC A;  4GMV A;  4BFR A;  2GBJ A;  2H89 B;  3V6C B;  5JZE B;  4TV3 A;  3TL5 A;  1WM3 A;  3H6N A;  4JQW C;  2LGX A;  1JWA D;  2BKR B;  5TR5 A;  3C19 A;  3JSV B;  1VDV A;  4ICU A;  2MRP A;  4E3C A;  2CJN A;  1E90 A;  2QHO A;  3BIN A;  3T3O A;  2N9E B;  3WAM A;  2SEB D;  4ICV A;  1XD3 B;  3FIL B;  4BAX A;  4RM9 A;  2JQR B;  2W54 A;  2KXJ A;  1IYF A;  2WDT B;  2MWS B;  3BZD B;  2DZJ A;  3ENE A;  1V97 A;  4K3B A;  2Y3A A;  2PJH A;  3A9J B;  3MTN B;  2NR2 A;  1DOX A;  1P1A A;  3SD5 A;  4MAC A;  3N1Y C;  2KN5 A;  3VH4 B;  3VXW A;  4YTN B;  2WWZ A;  4XDC A;  1L0V B;  1HE8 A;  3Q3O C;  2LFI A;  3VUY A;  2RD0 A;  1AW7 A;  4NQK E;  2JU6 X;  2YEP F;  1V80 A;  3DDC B;  2V3S A;  2L76 A;  1OQQ A;  4NY0 A;  3QQ8 B;  3Q8B A;  2ICI A;  1YN4 A;  3E9S A;  4OVV A;  3PLV A;  3RMK C;  1TKY A;  3VH3 B;  2Q5W D;  1TS3 A;  4MJS B;  2IGH A;  3IBE A;  2N0S B;  2D3C A;  3DOW A;  1SE9 A;  4B9K A;  1FFV A;  3J9C A;  4G50 A;  2L83 A;  4BZA A;  3KYC D;  3VR9 B;  2C7H A;  2NBV B;  3GE8 C;  2PIA A;  1R4N B;  3BII D;  1L6V A;  2PEA A;  4LK0 M;  2E3T A;  3Q8E A;  1DOI A;  3PPA A;  2KO3 A;  3FKY A;  1CMX B;  4HPP A;  2KQ4 X;  1S1Q B;  2KYW A;  4P6V F;  2GB1 A;  1YJ1 A;  4RF1 A;  1PGB A;  2V4L A;  2BYF A;  2G9H D;  2B3A A;  3ZGZ A;  4AUQ C;  3Q6B A;  4YXD B;  3EFC A;  2Z8L A;  1E8X A;  1C4P A;  3MHS D;  3TIX A;  3Q3M C;  1KLG D;  2HD5 B;  3RD2 A;  3C8Y A;  2XNA C;  2K3U A;  2K6D B;  1PDX A;  2CU3 A;  4E71 A;  4KV2 A;  3RYT A;  1WGG A;  2I2Y A;  4A8X C;  1FRD A;  1PYW D;  1PUT A;  5L95 C;  1WRI A;  2AQ2 B;  1TZO A;  2FCQ A;  1QQR A;  4B6W A;  3T9L A;  3L0W B;  4LNO A;  1C4A A;  4NAW B;  3WIM A;  5FR3 A;  3HRD D;  3TSS A;  4FJY A;  1UWX A;  3VTV A;  2VZK B;  3SR6 A;  2ZVN A;  5EDS A;  2M0X A;  1KF6 B;  3Q2A C;  3S2A A;  2N9L A;  1YN3 A;  2RR9 A;  1LM8 B;  4TQ0 A;  2BW2 A;  4HDO A;  1SGH A;  2BWE S;  4N6E B;  3MHZ A;  3O13 A;  2JYE A;  1TS4 A;  3ONS A;  1KJT A;  1A70 A;  5G55 A;  3ALB A;  2KAN A;  1VD2 A;  3RCZ A;  2L1A A;  5J17 A;  2ZNV C;  4DDI D;  3V61 A;  4M00 A;  1XO3 A;  2OOB B;  3NVY A;  3DBH B;  1WMH A;  2INC C;  1I4G A;  2WXF A;  3KLS X;  3ZDM C;  3E56 A;  2BTE A;  4KIK B;  3PO0 A;  3CF6 E;  3NOB A;  4X57 B;  1WGH A;  1H4R A;  1D5Z C;  2H88 B;  3ZO5 B;  5HI1 A;  1J7C A;  4GGQ A;  1L7Y A;  4HKZ E;  1TYG B;  2RDB C;  3AE4 B;  1J19 A;  2Y5P A;  3TUO A;  1YIW A;  5BO4 B;  1K53 A;  1TZ1 A;  4HXD A;  1PGA A;  2EMT A;  4OZA A;  3OAW A;  1N60 A;  2BKF A;  2KMC A;  1T6B X;  5H8Y E;  1TS5 A;  1K51 A;  3WAO A;  1XT9 B;  1TJE A;  3IAM 1;  3DPD A;  5I4D A;  2GBR A;  4KZC A;  1E7P B;  2KMA A;  2MBO A;  2JZ3 B;  2LVP A;  4W9F A;  1I4X A;  1V2Y A;  3HVZ A;  1VZ7 A;  4NAM A;  2K0P A;  4ZRI A;  3NVV A;  4LNI A;  4A55 A;  5BYR A;  2IO0 B;  2ZZP B;  1Y56 A;  3JYU A;  4USA A;  1FNU A;  1YMH E; 
#chains in the Genus database with same CATH homology
 2BYT A;  2D5G A;  5C2T B;  4C7Z A;  1SE3 A;  2M0A A;  3IT6 B;  3NUH B;  2LUM A;  5TSS A;  1F2R I;  2XN9 C;  4CQN A;  1STE A;  4P16 A;  4ZOH C;  1MHX A;  3Q8A A;  5T8I A;  4KGR A;  1FEH A;  2V3P A;  4NZL B;  2JSV X;  3WCQ A;  1CK1 A;  2WNM A;  3P4P B;  2DWQ A;  4JX1 C;  4DXG A;  3CWI A;  3PZ7 A;  1JQ4 A;  1C9F A;  1NYR A;  3KWV A;  2MH7 A;  1UNS A;  3N9Y C;  2KAC A;  1XCQ L;  3CIR B;  4HRO A;  1PGX A;  1BML C;  1TY2 A;  1ZDV A;  2LHD A;  2NTS A;  5BYQ A;  1QOG A;  2N9K A;  1L0X B;  4RGN A;  5E6J A;  1KTK A;  1QOF A;  1L4Z B;  1NEN B;  3Q69 A;  4A9A A;  1WSP A;  1V1P B;  1ROE A;  3GB1 A;  4IOI E;  1FXA A;  3P63 A;  4WWM A;  3IT4 B;  1AWD A;  5EE3 A;  2JWU A;  2IDY A;  3L4P A;  2W3R A;  4OW0 A;  1SE2 A;  5BYS A;  2MJE A;  1XEE A;  2JXT A;  4YT0 B;  3BVZ A;  2BS2 B;  2E6X A;  4ITK A;  2AQ3 B;  2WXP A;  3R2T A;  3EGR A;  3P4R B;  3W9C B;  1MPE A;  2WS3 B;  4LTU A;  1L4D B;  3AM9 A;  3TEW A;  1GAQ B;  3AEF B;  3ETR A;  4YWG G;  4DXF A;  3SFE B;  1T3Q A;  2WU2 B;  1SB3 C;  2LMC A;  3AEC B;  1KH0 A;  3B9J A;  3B2F A;  1QF6 A;  3AE7 B;  1GPX A;  1NI3 A;  4OZC A;  4KX6 B;  4UDU C;  3U52 E;  4C7Y A;  4ZHP A;  1IUE A;  3U4E G;  1FCC C;  3VRA B;  2BT6 A;  1MVK A;  1FO4 A;  1RWS A;  3SEB A;  4RCO A;  2J4X A;  3I9V 1;  3FC4 A;  4JPS A;  1DOY A;  3AEB B;  3R2I A;  1XF5 L;  3NZ3 A;  4Q2J A;  5JXV A;  1EM7 A;  1R7S A;  4H2A A;  2W82 A;  4ARC A;  4YSX B;  1XXG A;  2MEK A;  4FXC A;  4TMA B;  1V1P A;  1RM6 C;  5EE9 A;  1FM0 D;  1SIJ A;  2N7J A;  2WXL A;  3AMZ A;  3GP7 A;  2V4I B;  4MT5 A;  1OQR A;  1QOB A;  1HXY D;  1QOA A;  2ON8 A;  5LNK 1;  1VLB A;  2L52 A;  2BS4 B;  1JWU D;  4RGM A;  1JML A;  2VZK D;  5H92 C;  3KQ4 A;  5FKA C;  2QJL A;  1K52 A;  1J7B A;  2WDV B;  3AH7 A;  3U7Z A;  3ABV B;  1E6E B;  5AUI A;  3P1M A;  4WAF A;  1HQR D;  2K5P A;  4ZRP A;  1VR9 A;  2OHF A;  3RFZ B;  3BVM A;  3ZQ4 A;  2WXJ A;  3BK1 A;  2NMQ A;  2M56 B;  2WXQ A;  1IGC A;  4LLG M;  3FAH A;  1F77 A;  2MJ3 A;  1GB4 A;  3V3X A;  1I4Q A;  1F2R C;  1FD6 A;  2PMV A;  3V05 A;  1ZPS A;  2MJD A;  1ZE3 D;  1T5X D;  2WDQ B;  4XWT A;  4US8 A;  4R3D A;  2HTM E;  2ZW0 A;  4AS1 A;  1RFK A;  2I38 A;  4L2Y A;  2RDG A;  1SE4 A;  2PTL A;  3IXS A;  4XE0 A;  5D3I B;  2J52 A;  3W5U B;  1C78 A;  2WXR A;  1TS2 A;  2WXH A;  2IPK D;  1EWC A;  2R61 A;  3DWM A;  4WUR A;  4L1B A;  2QEJ C;  4YTP B;  4RH6 A;  2H89 B;  2EEL A;  2KDM A;  5HFY A;  1NYQ A;  4KKI A;  1XLO A;  3T3N A;  2LHE A;  4YTM B;  2V3N A;  2BB5 A;  5MPO A;  1SSN A;  1JWM D;  1UGJ A;  1VZ8 A;  1AN8 A;  2WP9 B;  1KLU D;  5AUK A;  3MC0 B;  1YNT E;  1XLP A;  1DGJ A;  1JWA D;  1EU4 A;  2WLB A;  4C56 C;  4EE2 A;  3AE2 B;  2WXK A;  2KN4 A;  1YN5 A;  1SBB B;  4TQ1 A;  1VDV A;  4IDI A;  1ZXI A;  3KWL A;  1CJE A;  2EKI A;  3PZ8 A;  2DYO A;  2CJN A;  1AYF A;  2IGG A;  3AE6 B;  3BK2 A;  1FNW A;  1TY0 A;  5HHD G;  5EE0 A;  3T3O A;  5GXG B;  2KAJ A;  2SEB D;  4JWU C;  1C76 A;  4RFB A;  4GDK B;  4WH4 A;  1PFD A;  1WGK A;  1Q10 A;  3FIL B;  1J7A A;  4YSZ B;  1D4B A;  4HEA 1;  1FCL A;  1MI0 A;  2JQR B;  4M0W A;  2W54 A;  1FMA D;  3BZD B;  4ZHO A;  2V0G A;  2DYM A;  1V97 A;  2ACZ B;  2Y3A A;  1QIL A;  1L6U A;  2FE8 A;  5C3J B;  1DOX A;  2Y5C A;  3AV8 A;  1SF0 A;  4MAC A;  4WIP A;  1D5X C;  1I7H A;  4L23 A;  4YTN B;  4XDC A;  3LB8 C;  1L0V B;  2PLP A;  2LFI A;  3MFG A;  1F0Z A;  3P4Q B;  3AEA B;  1AW7 A;  4A6Q A;  1ZUD 2;  2JU6 X;  1BXT A;  4IKG A;  2YEP F;  1I4H A;  2FBW B;  1RYJ A;  3TEX A;  2LJI A;  3BYY B;  1QLB B;  4JE3 B;  1WYG A;  3P42 A;  1N61 A;  1YQ3 B;  3Q8F A;  2RDH A;  3Q8C A;  3AN1 A;  2M19 A;  1OQQ A;  2IGD A;  3OWE B;  3EUB 2;  3Q8B A;  4KGS A;  2ICI A;  1YN4 A;  3E9S A;  1GB1 A;  1SJE D;  1SXT A;  3H8H A;  4HJG E;  1LO5 D;  2CJO A;  1K50 A;  1TKY A;  2J42 A;  2Q5W D;  1TS3 A;  4RNA A;  4OZB A;  1FNV A;  5BMI A;  1MHH E;  2IGH A;  1E0Z A;  2N0S B;  3B2G A;  1ZXH A;  1KFY B;  4O1N A;  5FK9 C;  1HEZ E;  2ONQ A;  3AB5 A;  1FFV A;  1JWB D;  3AED B;  3J9C A;  5BMG A;  1N62 A;  1BUI C;  1TKE A;  2L83 A;  2LGI A;  1KRH A;  1D5M C;  5D3D A;  3VR9 B;  4A90 A;  1HZ6 A;  2L32 A;  2QMT A;  3I57 A;  3VQI A;  1ZOY B;  1XLN A;  4MM3 B;  4N59 A;  2KWD A;  2PIA A;  2J53 A;  2QSD A;  3BII D;  2OED A;  1L6V A;  4LK0 M;  2E3T A;  3Q8E A;  3TEZ A;  1IBX A;  1DOI A;  2YEP B;  1C77 A;  1FFU A;  3W2D A;  2KQ4 X;  4P6V F;  1JAL A;  1ET6 A;  2GB1 A;  4WQM A;  4B0E A;  1PGB A;  3AE5 B;  4RF1 A;  4N58 A;  2G9H D;  4ZRQ A;  3ZGZ A;  1M4V A;  4YXD B;  2PKO A;  2Z8L A;  1QKZ A;  1IBX B;  1SJH D;  1C4P A;  2JZP A;  5BMH A;  1I4R A;  1P7F A;  4MH8 A;  2QIE B;  2G1E A;  1KLG D;  3W1S A;  4D2K A;  2NTT A;  2SAK A;  3C8Y A;  2XNA C;  2JYT A;  2K3U A;  3ZJV A;  2LEK A;  1PDX A;  2CU3 A;  3URY A;  5HG2 A;  2I2Y A;  1D6E C;  1VJK A;  3NVZ A;  4PT5 A;  4A8X C;  4JWS C;  1FRD A;  4XWW A;  3BWU D;  3AE9 B;  2ZW1 A;  1PYW D;  3AEE B;  1OFF A;  1PUT A;  2PVO D;  1WXQ A;  4XDD A;  1IGD A;  1WRI A;  4REZ A;  2AQ2 B;  1TZO A;  4J3O D;  1TKG A;  1CZP A;  1CQV A;  1QQR A;  3LXF A;  1HZ5 A;  3AE8 B;  2GRI A;  4GLS C;  1C4A A;  4NAW B;  3VR8 B;  3DWG C;  3EA6 A;  5FR3 A;  3HRD D;  3TSS A;  1UWX A;  3BVG A;  2VZK B;  1VZ6 A;  3SR6 A;  2GI9 A;  1KF6 B;  1FXI A;  2N9L A;  1YN3 A;  1JRP A;  1DYQ A;  4TQ0 A;  2BW2 A;  3RPF C;  2PVG C;  2KMM A;  1YQ4 B;  2W55 A;  2WXM A;  3SFD B;  3BYT B;  1P7E A;  4N6E B;  1E9M A;  2X38 A;  3MJ5 A;  3ZJU A;  3MHZ A;  3O13 A;  2JYE A;  3GS2 A;  3LYY A;  2INN E;  1TS4 A;  1ZDX A;  2TSS A;  1A70 A;  4RGT A;  3HVD A;  3NRZ A;  4C80 A;  2HDE A;  1FIQ A;  2AQ1 B;  1C4C A;  1NVI D;  4TSS A;  1VRA B;  2L1A A;  3TEY A;  1UWM A;  1XLQ A;  1B1Z A;  1JWS D;  4ARI A;  2K22 A;  2AX5 A;  2DBY A;  1XO3 A;  3NVY A;  4RF0 A;  2WDR B;  1UUP A;  1I4G A;  2WXF A;  3MP9 A;  1JCK B;  3KLS X;  1ACC A;  2RMM A;  3E56 A;  3NVW A;  3VRB B;  4GDL B;  3IAS 1;  2BTE A;  1L0Y B;  1FRR A;  3PO0 A;  2WQY B;  2PW9 A;  2WXN A;  2BBC A;  4HRS A;  4US9 A;  2WXI A;  1D5Z C;  2H88 B;  4KGT A;  1QT9 A;  3P4S B;  4YSY B;  1J7C A;  5D7G A;  5HI1 A;  3U2S C;  3R8B A;  3AEG B;  2BB6 A;  4HKZ E;  1TYG B;  1YJJ A;  2WXO A;  1NEK B;  3AE4 B;  3NS1 A;  2Y5P A;  3TUO A;  5EE1 A;  5G5H A;  1YJI A;  2WU5 B;  1JW9 D;  1V1O A;  2K9X A;  3AE3 B;  1ZP0 B;  1K53 A;  3ZJT A;  1PGA A;  4OZA A;  4OVZ A;  1N60 A;  1C79 A;  1T6B X;  5H8Y E;  2RPV A;  1TS5 A;  1N5W A;  1K51 A;  3UI3 A;  2BS3 B;  2WXG A;  2QIL A;  1V8C A;  1TJE A;  1ET9 A;  1HA5 A;  2JX5 A;  4OHJ A;  4NJC A;  2W3S A;  3IAM 1;  1XCT L;  1ENF A;  3FIL A;  3ZYY X;  2FUG 1;  3W5V B;  5G5G A;  5I4D A;  1GOZ A;  2B76 B;  1E7P B;  1EU3 A;  4HKQ A;  1E10 A;  1N63 A;  4KKJ A;  3HUI A;  3AE1 B;  1I4X A;  3HVZ A;  1VZ7 A;  2DLB A;  4NAM A;  2INP E;  4RGO S;  4AQ7 A;  2K0P A;  4B0M A;  1ESF A;  1I4P A;  1JRO A;  3NVV A;  1B9R A;  4A55 A;  1SEB D;  5BYR A;  1L5P A;  1N5X A;  2IJ0 A;  1Y56 A;  4USA A;  4DQO C;  1EWY C;  4ZYS A;  1WWT A;  1FNU A;  1YMH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...