4FXCA

Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ATYKVTLINEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGTITSGTIDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIKTHQEEGLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Tertiary structure of [2Fe-2S] ferredoxin from Spirulina platensis refined at 2.5 A resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis.
pubmed rcsb
molecule tags Electron transport
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4fxcA00
4WQMA 1OQRA 1WYGA 4YSZB 2PIAA 3HUIA 2K22A 3NVYA 1QT9A 1N5XA 3BIID 1RM6C 3AECB 2G1EA 3AE6B 1FIQA 1AWDA 2H89B 1TJEA 2KMMA 4LTUA 5MPOA 1GPXA 3AN1A 2N0SB 3B9JA 1V97A 4C80A 1N5WA 1CJEA 3AE8B 2E3TA 3AMZA 2W54A 2DBYA 3DWMA 1L6VA 3AEDB 1L0VB 4USAA 1JQ4A 3NS1A 1FFVA 3HRDD 3P4RB 1QOFA 3PO0A 1YQ4B 1JWBD 3AEEB 2QJLA 1JALA 1SB3C 1WXQA 1FXIA 4YT0B 5EE3A 2M19A 1T3QA 3AE7B 2W55A 3P63A 4FXCA 4HROA 1TKEA 1NEKB 3ABVB 1FXAA 3NVWA 3W5UB 1XLNA 1TKGA 3WCQA 1NVID 1XLPA 3AV8A 5AUKA 4US8A 1E7PB 1FRDA 1JW9D 1KRHA 1YJJA 3FC4A 2H88B 2B76B 1L6UA 2BS4B 3AEAB 1V8CA 1NYQA 1J7AA 4N58A 1FFUA 3AE3B 1QLBB 1PUTA 3NRZA 2JQRB 4A9AA 3AM9A 1SIJA 2PVOD 3P4SB 3AH7A 1OFFA 3AE2B 1YQ3B 4YTPB 4C7YA 1RYJA 1AYFA 4C7ZA 2MJDA 3AE4B 1PDXA 3L4PA 4YTNB 3W5VB 3B2FA 1F0ZA 2WDQB 1TKYA 4ZHOA 1VLBA 1VDVA 1OQQA 3HVZA 3P4QB 5GXGB 1XLOA 1PFDA 1ZP0B 3NVVA 3LB8C 3W9CB 1EWYC 2DWQA 1QOBA 5H8YE 1FO4A 3CIRB 4IDIA 3RPFC 1JRPA 1DGJA 1UWMA 3VRAB 1RWSA 1B9RA 1VJKA 1A70A 2WU5B 2W3RA 5EE9A 5C2TB 2WLBA 2WS3B 3ZYYX 1DOXA 1IUEA 2Q5WD 4ITKA 1CZPA 1QOAA 4ZHPA 1FRRA 2WDRB 3LXFA 5AUIA 1E9MA 2JX5A 2W3SA 1N60A 2M56B 1XLQA 3FAHA 1NYRA 1QOGA 2FBWB 2KAJA 1JROA 1N61A 3AE9B 3EUB2 4N59A 3VR8B 2CJNA 1TYGB 1WWTA 2BS3B 2K9XA 4US9A 5EE1A 3SFDB 3ETRA 1N62A 2CU3A 3AE5B 1FM0D 1RFKA 2BS2B 1WGKA 2MJ3A 1SF0A 2L83A 2MH7A 3KWLA 1E6EB 2BT6A 4WWMA 1QF6A 3AEGB 1XO3A 3SFEB 3VR9B 2WQYB 2HTME 3AEBB 3CWIA 5G5GA 3P1MA 3P4PB 2EKIA 2MJEA 1L5PA 1GAQB 1ZUD2 3B2GA 4ZOHC 1KF6B 1KFYB 1YJIA 1ZXIA 2WDVB 1E10A 3AE1B 4YSXB 1J7BA 1E0ZA 2WU2B 2QIEB 1NENB 2Y5CA 1N63A 4JWSC 4JX1C 4KX6B 5H92C 3VRBB 3AB5A 5C3JB 1DOYA 1ZOYB 4YTMB 1NI3A 4JWUC 1I7HA 2PVGC 3DWGC 1DOIA 2K5PA 4YSYB 1FMAD 3NVZA 2OHFA 4YXDB 1WRIA 1JWAD 2WP9B 2AX5A 4HRSA 5EE0A 2CJOA 2PKOA 4P6VF 4N6EB 3SR6A 1ROEA 3AEFB 1J7CA 1R7SA 2L52A 2LEKA 5G5HA 2ACZB
chains in the Genus database with same CATH superfamily
4XX5A 2KLGA 1TBEA 4AWJA 3FILB 1TGZB 1TJEA 2Y5PA 1VRAB 5L83A 2MP2B 1N6ZA 1WGDA 3PZ7A 4DDGD 4MGIE 5BMHA 3MHZA 3AE7B 4N9F4 4TQ0A 4ZDVA 2INNE 5FR3A 4HKZE 1QQRA 2VZKB 3OLMD 1GC6A 2QCZA 4GSWA 3N20C 5KHOA 2GBNA 2PVOD 2JZ3B 3APCA 4C7YA 2WXLA 3AE4B 4BKSD 1F0ZA 2K3UA 4AQ7A 1ISNA 1V2YA 2KWCA 1V5OA 2V3NA 4FULA 1I4RA 3A9KA 2LHDA 3BVZA 2CHXA 2JUOA 4IKGA 1VJKA 2WXGA 2WS3B 4EKUA 1JWSD 3ONSA 1CZPA 2ASQA 2KWDA 4EE2A 2NR2A 4HWIB 1WZ3A 1D5ZC 2K39A 4JIOU 1N62A 1FM0D 1NBFC 3PT2B 3A33B 3T3OA 1MG4A 3JYUA 2D3CA 3PSEB 4M8NA 5E6PA 3IHPC 4KKIA 1OQYA 1NI3A 2L32A 2JU6X 1YN5A 1LQBA 3VXWA 3V05A 3QCAA 4RCOA 1ACCA 1KH0A 3L16A 1QT9A 4DHJB 2I38A 5TR5A 4WJOA 2XK5B 2L00B 3OAWA 4RH6A 1STEA 2KC2A 3DBLB 2UWQA 4BKSA 4LDTB 1FNWA 1TKEA 3QWZB 1NDDA 4KSKC 1C3TA 1XLNA 3W2DA 4WJNA 3ZNZB 3MTNB 1XCQL 1V8CA 1EUVB 2DYOA 1QZEA 1PUTA 3A1QB 3QQ8B 3M63B 1J8CA 2KFKA 4HVBA 3Q8FA 4W9KA 1YMHE 1HE8A 2YVCA 4ZHOA 2K1FA 3OWEB 3P4QB 1MHXA 4Q2JA 2DWQA 4YWGG 2I2YA 3RPFC 2BW2A 1WRDB 4JGHB 3RUIB 3ZNGC 3WIMA 1WH3A 3IVFA 2IJ0A 2DHZA 2REXA 3SD5A 4G11A 3AE9B 1EF1A 2KAJA 1N61A 2PW9A 1WXAA 4F8CB 1P9DU 2MH7A 2O6VB 2MWSB 4TV3A 1T5XD 1WI0A 3PRZA 1E8XA 4GLSC 4A6QA 2L76A 2RDHA 3PHXB 1ZUD2 4PS8A 5FR6A 5J17A 2AQ3B 2DZKA 2QEJC 1Y8RC 1FPYA 1ZE3D 2JVCA 4W9FA 4LNKA 2V1YA 3VDZA 1KM7A 3GE3C 2KMMA 3R7QA 1WGGA 3ZW3A 1WX9A 1V86A 3DWMA 1UWXA 3AEDB 4ZRJA 4NZLB 3HVDA 4W9DA 3I57A 2LGIA 4A90A 2M19A 1PGBA 3ABVB 1TKGA 4MJSA 2ZW0A 1C4PA 1V1PB 1EWCA 3UF8A 2KVRA 2INDC 3A4SC 4ZRIA 1SIJA 3ZDTA 3QA8A 4ICVA 3L4PA 1CQVA 2FAZA 2KC1A 4KVGB 2WXOA 4G50A 2KMAA 1L4ZB 4ZYNA 3ZVVA 2E6XA 4F7ZA 1FO4A 2J0KA 5JHBA 2MSED 3QARA 3MJ5A 2K0PA 3LXFA 2Z8LA 4AUQC 2BWFA 1IYFA 2D3GA 3PPAA 4AJYB 3FKYA 2BS2B 4RF1A 3Q8CA 2N7DA 4HDQA 2WHIA 2LUMA 4MH8A 2Z0EB 1PYWD 2MBQA 4OVUA 3VAWA 4DK5A 2JF5A 4NAWA 2QMTA 1GAQB 4M01A 4WWPA 4YSXB 3A9JA 1V5TA 1F52A 3IT6B 4R3DA 1DOIA 4MT5A 1ZW7A 3RD2A 2LFIA 3N3KB 2PKOA 1J7CA 2J0JA 2MA9B 3EHVA 2WXIA 4E3CA 2LASA 1I4PA 3H1UA 3AN1A 4RMAA 2PPHA 1N5WA 4BAXA 1UUPA 5J2RA 3DBLI 1YX6B 1BMLC 4BOZB 4KZ0A 1Y56A 1YQ4B 1R4NB 1JALA 1AARA 4I6NB 3L10B 1U4AA 1XLPA 1KRHA 1GOZA 1WGYA 2D2QA 4IM0A 3AEAB 1AW7A 2DZJA 1FFUA 4LNIA 4WJPA 2JQRB 3ZJUA 3X0WA 2PTLA 2L7RA 1FNUA 3AH7A 3DVGX 3RNCC 4MGYE 4LCDE 4YTPB 4W9IA 1MG8A 1TIFA 2LVQA 1QILA 1VR9A 4MELA 5LNK1 1YX5B 4M00A 1OQQA 2L3ZA 2CHZA 3NVVA 1YNTE 2VH1A 3OJ4B 1XCTL 4XYCA 2RMMA 4B6WA 3VTUA 1IUEA 4GDKA 1FCCC 5AUIA 3APFA 2J0MA 2JSVX 4DDID 1E0ZA 3DHGC 4L23A 2IBIB 3VUXA 3BVMA 2WXPA 2JY6A 1RRBA 1WGKA 2KLCA 1E6EB 1LFDA 4EEWA 3PZ8A 1I4HA 2VZKD 4OZCA 2WDVB 2WX1A 1FEHA 1WZ0A 2FIDA 4JX1C 4X57B 3R3MA 4JWUC 1KTKA 1F9JA 2RPVA 4I6PA 3RN9C 1UBQA 4KIKA 1HZ6A 3U2SC 3TL5A 3GOEA 2Q5WD 2NVUI 3HUIA 3N1ZC 2L8JA 1RM6C 5D94A 1V49A 2TSSA 2IY0B 2N0SB 2BWES 2RD0A 2WX0A 4RFBA 1B1ZA 3IAM1 2WXFA 4USAA 2JWUA 4ACFA 4IWQA 4ANXA 1FXAA 4WAFA 3Q3MC 1WJ4A 4A8XC 2NS5A 4BBNF 4PT5A 4MDKE 5J18A 4HKQA 2BYVE 3QJZA 4NPNA 1L0YB 1WGHA 4A9AA 3AM9A 2D10A 5D6JB 3X23A 4HJKA 2JZPA 3EECA 4QAYA 1VLBA 4A20A 3RNEC 2G4DB 4KDIC 2BF8B 2QC8A 5T8IA 4DHJD 3TBLD 3W9CB 4MGKE 1JMLA 1GB4A 1WJNA 2O2VB 1EU4A 1OEYA 5C23A 4ZHPA 4MM3A 1T0SC 2WDRB 1BUIC 2M0XA 2M56B 3PHWB 4HLEA 1EM7A 3HHMA 3AE5B 2WDTB 1G6JA 2KYWA 3N1YC 1E7UA 2NBWB 3QHTA 2M0AA 3N32A 3GZNI 2A5UA 2HDEA 1SJED 2HTME 3NJTA 3ZTCA 2J7QB 2IYDB 2AWTA 1CK1A 2YLMA 2KTRA 3K9PB 3AE1B 3PVLA 1NENB 2K8CA 2BPSA 3KVFB 4H2AA 1PGAA 3L08A 1K53A 3PGEA 1M94A 5BYQA 1WMHB 1WRIA 2LUEA 4IWOA 3N30A 4GOCA 2ZCCA 2K6DB 2SEBD 1WE7A 1UZXB 4P1BC 1WYGA 2MBOA 1K50A 4EFOA 3BWUD 3AE6B 1AWDA 1T0RC 5MPOA 2IGHA 3PLUA 2FNJB 2MLBA 1L6VA 2FIFA 3P4RB 1ZPSA 4HPLB 2MHJA 1C4CA 2O6VD 2IZVB 2W55A 2KJHB 3NVWA 4IOIE 1Z2MA 3WCQA 4CQNA 5AUKA 4DBGA 4P7IA 2N9XA 4AP4C 2BB5A 2INPE 2KX3A 4JLCA 2Z59B 3EFUA 1XXGA 2KX0A 2KTFA 2IO0B 1P98A 1C79A 3RYTA 2PMVA 1VDVA 2JYEA 2RDGA 4RNAA 1TY0A 3NZUA 1WX8A 5LXHA 2GMIC 4D2KA 4OZBA 4ZRQA 2KACA 2MX2A 2VH2A 3AULA 3DDCB 3MFGA 1E9MA 4IW0A 1JCKB 1A5RA 3CF6E 1C4AA 4HK2A 3WAPA 3UGBB 1TZ1A 4NJCA 2L0TA 4A3PA 1XT9B 3N1XC 2ZEQA 1RLFA 2N1WA 2L83A 3BK1A 2J42A 1XO3A 3VVWB 1UH6A 2ZJDA 1KJTA 3HK0A 4NAMA 1D4BA 2C9WB 3QX1A 1E10A 1KF6B 2WWZA 1F77A 1E5WA 4EZJA 2WYQA 1DOYA 3H7SA 1FMAD 1WXSA 2ZNVB 2AEHA 2IDYA 2O6VA 2CJOA 1WFYA 2V9HA 4M02A 2AYOB 4OW0A 5G5HA 5AZGA 2K8BA 4YSZB 4ASWC 1WIAA 2KT7A 2NMQA 3U52E 2XBBC 2WXJA 1BT0A 1EU3A 1FIQA 2H89B 2BQQA 2YEPB 3EFCA 3H6NA 3EC8A 3PREA 2WXMA 2AQ1B 2L1AA 2PE9A 4W9HA 3NS1A 4IM3A 3H7PB 2DENB 2GRIA 1WXQA 3P63A 1NEKB 4JL9A 1L2NA 4US8A 4TSSA 2WXKA 3DBRB 2IY1B 2BS4B 3ALBA 3U4EG 4DHZE 5CHFA 3ZXVA 1XQQA 3UIOB 3ZQ4A 3PRPB 2MEKA 2KQ4X 1E7VA 4ICUA 3QC8B 1V1PA 2ZNVC 3CIRB 2KFJA 4XE0A 1QOAA 2NTTA 2IO1B 4II3B 1TY2A 1VZ7A 4PK1A 1I4QA 2AL3A 2GBRA 4NJ6A 2IGDA 5G55A 4US9A 5EE1A 2RDBC 3J9CA 2GI9A 3CSTA 3P2BA 4J3OD 1ZGUB 3WANA 1SF0A 5E6NA 1SGHA 1AN8A 2BKRB 2MJEA 3V60A 1KFYB 4WH4A 2Y5CA 4JWSC 5BMIA 1ZOYB 4ANVA 1I7HA 4RF0A 1D3ZA 5E6OA 2OHFA 4CYEA 1BXTA 3R66C 5EE0A 5AZHA 4P6VF 2HJ1A 3APDA 3DVNU 3VQIA 5C1ZA 2PIAA 4FLHA 3BIID 2LJ5A 1C78A 2IO3B 1GPXA 2LXAA 1CJEA 2E3TA 2NPTB 4GGQA 4FJYA 3E9SA 1LM8B 1T3QA 4L1BA 2NBUA 5HI1A 4A3OA 2HD5B 4G0NB 4HJGE 3KUZA 1PQSA 3OG5A 1J7AA 2CR5A 4B0MA 4IM2A 3JSVA 1OFFA 3NG0A 3MC9A 2MJDA 2LD9A 2RPQA 3VH4B 2UU7A 2LWPA 1IGCA 1ESFA 2C60A 4K1RB 4WQOB 5DPWA 4AS1A 2J52A 2OEDA 4W9LA 1V80A 4DXFA 3UQBA 4FHJA 3TCAA 2ZZPB 1VZ8A 3UINB 1VZ6A 3TSSA 1T6BX 2KDIA 1WWTA 5AEKB 3A4RA 4JQWC 4K81A 3VUWA 3BK2A 4FHKA 3KWLA 3NZ3A 3TEYA 2QHOA 2WQYB 3CWIA 1TS2A 2HE7A 3ZIMA 3Q3FA 1YJIA 3GB1A 1K8RB 1WM3A 3Q6BA 1HA5A 3Q8EA 3RNGC 4DXAB 4E71A 3ML8A 2WNMA 2EELA 4MSQB 2N7EA 2KFKB 1HTQA 2B3AA 2WP9B 4REZA 3SR6A 3AEFB 4P1CC 5IKCM 2LEKA 3ZGZA 2K22A 4GB9A 4RGOS 4K7UA 3GZNB 3KQ4A 3MJWA 2MBEA 3AE8B 1DYQA 2QDFA 2R2OA 3NOBA 2LXCA 4BOSC 3TJPA 2AQ2B 3KWVA 4GMVA 1ET9A 4GN1A 1Q0WB 2LVOA 1LO5D 4W9CA 3DBRI 4RGTA 3HIZA 3AV8A 4HCNB 1E90A 4K3CA 3C8YA 1YJJA 4LNFA 3DBSA 2NCNA 3R8BA 1P7FA 3C19A 3U7ZA 1RAXA 2ZW1A 1UGMA 3BY4B 2EKEC 2HJ8A 2KDEB 1TS4A 1UWMA 1WSPA 2WXHA 5JZEB 4NJ7A 5C2TB 1DOXA 2RSUA 2MQJA 2K8HA 2ZVNA 4KGRA 4TKNA 2KWVB 4N59A 2CU1A 3SFDB 3Q3OC 4C4VB 2CU3A 2VRRB 4BZAA 1WR1A 2DNFA 1QKZA 2LRWA 2XN9C 2CHWA 4ZRPA 3H9DA 4LJOB 4MJSB 4M0WA 1F2RC 3KLSX 1Q10A 1ZXIA 4HEA1 2FCSA 2LJIA 2MBHA 1C9FA 3S2AA 5LLIA 1ZXHA 3KYDD 1N63A 3UQAA 4YTMB 5CHWA 5IA7A 2LVPA 2K5PA 3BZDB 4G3XB 3SU8X 5LXIB 1ROEA 2INCC 3T9LA 3O13A 2L52A 1IBXA 1TTNA 1N5XA 4PYUA 1WYWB 4LTUA 4GDLA 2RGFA 4K3BA 2DX5B 3AMZA 1JRUA 1SE4A 3CSFA 3DOWA 1HQRD 1L0VB 1JQ4A 3AEEB 1C1YB 4OHJA 3BINA 3ZUNA 3B0AA 2A4ZA 1E7PB 2DAJA 4EUTA 4NAWB 3VTWA 2D11A 4AOFA 2ZVOA 4XC2A 1TZOA 3ZRFA 1QLBB 3JVZX 3IFWB 4ANWA 3DCGA 4W9GA 2OJWA 1CMXB 2BKFA 4LNNA 5D7GA 1WJUA 1XD3B 1UBIA 2UYZB 2G9HD 5CX3A 2G4SA 1E8ZA 4GIVA 4TQ1A 3ZRCA 1UNSA 3RNFC 4KDLB 3FILA 1RWSA 3AU5A 4DWFA 1IP9A 2FCNA 1S1QB 2MP2A 3B08A 1EO6A 2JT4B 3EUB2 2CJNA 2OJRA 1UELA 1E8WA 1KLVA 1Q1OA 1Q5WB 2BT6A 4WWMA 1QF6A 1VD2A 3N9YC 2FE8A 5G5GA 3UIPB 1YD8U 4EOYA 1KOTA 3Q69A 3BYYB 1GNUA 1WF9A 3PRMB 2PJHA 3U30A 3AXCA 3ENEA 4KGTA 3B1LX 2V4LA 4YXDB 4LDTD 1JWAD 3ML9A 2JWZA 4S0RA 2I1KA 4WQMA 3I63C 2R61A 3P42A 5IP4D 2KOXA 2ZPNA 4K7WA 4GDKB 2X8XX 4ZYSA 2WXRA 1KLUD 1IPGA 3LJ3A 1UD7A 2W54A 3I3TB 4RM8A 1F2RI 1KLGD 2N1VA 4YT0B 3ZTDA 1MFWA 3Q8BA 2KQSA 1SEBD 4IUMB 2IO2B 2V3SA 2H88B 2KJRA 2B76B 1NYQA 5IOIA 1P3QU 3AE3B 3P4SB 1SE9A 3AE2B 1XF5L 4KV2A 5GMVA 1JWMD 3RT3B 4KIKB 1HZ5A 4HCPB 3PTFC 2Y5BB 1EWYC 4LNOA 3WA0A 5L95C 2XNAC 2KMCA 3VH3B 4RGMA 3K9OB 2XK5A 2FCMA 2KQ7A 2PLPA 2JX5A 1NYRA 4WJQA 5G2NA 2K9XA 2LGSA 5HFYA 1RFKA 2IGGA 1L7YA 5BMGA 4BBNC 2AL6A 3KYCD 1WX7A 3TMPB 3DBHB 4MACA 1FXTB 2D07B 3A1QA 2QIEB 4OZAA 5H92C 4B9KA 5BYSA 5D3IB 2PVGC 5DPRA 2V0GA 3NVZA 3R7RA 2AX5A 3KUCB 2YEPF 2M4NA 2WGSA 3BYTB 4N6EB 1V81A 3M95A 4RM9A 2LGYA 4NQLB 4FA6A 4EZLA 1J0GA 2JRIB 3GS2A 4MM3B 3Q3NC 3IAS1 1P1AA 1GB1A 1J19A 4E74A 3KUDB 2G45B 1ZDXA 4W9JA 3W5UB 3R2TA 1JW9D 1ZKHA 3VFKA 1TS3A 1L6UA 4MSMB 4A55A 1I4GA 3QK0A 2KTRB 1MHHE 2NPTA 3KH0A 4CHKA 1RYJA 4NNJB 5JHAA 4F1SA 3NS8A 1V1OA 2V3PA 3EGRA 2IPKD 2BYEA 5BYRA 1V6EA 4HXDA 4IC7B 1ZP0B 1B9RA 3RNBC 3DQVA 3W1SA 3W1YA 4OVZA 4KGSA 1FRRA 2W3SA 3ZLZA 2FBWB 1EF5A 2BS3B 3V61A 3V6EB 2K25A 4MGZE 5JH5C 3T3NA 1WM2A 3M62B 3C0RB 4CO7A 3ZJTA 2JRHA 2V4IB 3V6CB 2W9NA 4ZRKA 1L0XB 4BKTA 1T0QC 1YIWA 3DHIC 3VTVA 2C7MB 1MVKA 2J53A 3M3JA 5HG2A 3ZNID 3ZO5B 1R7SA 2GOWA 1OQRA 3NUHB 4EZKA 4NY0A 2M17A 1L4DB 1D5MC 2C7NB 3T8MA 4URKA 2KXJA 1LGRA 4LLGM 1C76A 2LRUA 3Q3JA 3L54A 2CKHB 4LJPB 3AI5A 3EA6A 1SE2A 1MJDA 3PO0A 1GUAB 2WXNA 5IN7A 2N9KA 4BKGA 4XWTA 1MI0A 3RCZA 3DVGY 4ANUA 3A9KB 5DPTA 1I4XA 3NRZA 3MC8A 5I4DA 5AZFA 1UF0A 3TIXA 3NZSA 3W5VB 3D32A 3MHSD 2KO3A 1R4MI 4K7SA 4L2YA 2DYMA 1IGDA 4LK0M 1H4RA 2C7HA 3VRAB 1A70A 1OTRB 5IAAC 1WGRA 4FBJB 2N7JA 4ITKA 2N9EB 4NQKE 4M8MA 3ZKJC 5GXGB 3TEZA 3VUYA 2DYBA 1JROA 2BVCA 4KKJA 1V9JA 1SXTA 2MJ3A 1GG3A 4KSLC 1LXDA 3AEGB 3SFEB 4P16A 1M4VA 3AEBB 2G3QB 3DBHI 1HEZE 1FCLA 3ZXRA 1J7BA 2PEAA 2N4FA 2L0FA 5D3DA 2RR9A 3VRBB 4KX6B 5C3JB 3AB5A 4C4VA 4FJZA 2KDFB 3DWGC 3HM6X 1K52A 1TS5A 4BVUC 3PV1A 2GBMA 3L0WB 1VCBA 1K51A 2JXTA 3OJ3A 3TEXA 2ACZB 3NVYA 4B95A 5D2MB 4FN2A 2HTHA 3AECB 4ARCA 1I42A 2BB6A 4DHZB 2JYTA 3GE8C 2KD0A 2K6QA 1V97A 3BVGA 1ET6A 2DBYA 2KKCA 5IO9A 3DVNV 2LMCA 1JWBD 2M8SA 1SB3C 3E56A 4FXCA 4WURA 1T0YA 2FUG1 1NVID 3PS6A 2Y3AA 4BFRA 2D3BA 3RFZB 3ZJVA 4C00A 3W1SC 2GBKA 1AYFA 2X38A 3PLVA 3B2FA 2WDQB 3IXSA 3RZWC 1WJ6A 2KZRA 2WXQA 5FK9C 1OEYJ 1XLOA 3ZDMC 3WAOA 4FADA 3LB8C 3IT4B 4KZCA 1QOBA 4ARIA 4IDIA 1DGJA 2WU5B 5EE9A 2BBCA 4XZ4A 1WXMA 2KN4A 2KANA 3L17A 4AJWA 1QOGA 4C80A 4J6IA 3VR8B 1TYGB 2KHWB 2D5GA 3U7DA 1PGXA 4WWOA 4WIPA 4DXGA 1F1HA 3QAQA 3MP9A 3PZDA 4HPPA 4WAAA 2JPHA 3P1MA 2EKIA 4DQOC 2J4XA 4TUUA 4ZOHC 3NHEB 2QSDA 2EMSA 2JZZA 1D5XC 3JSVB 1SSNA 2N9LA 3HM3A 3TEWA 4XGAB 2MCNB 3CMMB 1C77A 2O2VA 3RZFA 4IG7B 2MRPA 3B9JA 2BGFA 1X1MA 1YN4A 1P7EA 2LGXA 3VHTC 4IWPA 3HRDD 4WWNA 4S17A 2KDBA 1FXIA 3Q2AC 4HDOA 4II2B 5EDSA 1YOVB 4HROA 4XWWA 1HTOA 1I35A 2R2QA 3QIJA 3V62A 3WAMA 3Q8AA 3FC4A 1GJZA 2MBBB 2JXXA 4MH0E 2N9PC 2ONQA 1HXYD 3LYYA 3IBEA 1YQ3B 1JWUD 3MC0B 4C7ZA 1PDXA 1WMHA 4JPSA 2LZ6A 5E6JA 1OGWA 1ENFA 1PFDA 1YJ1A 4W9EA 3I5JC 5H8YE 1JRPA 1D6EC 2ZCBA 2W3RA 2BYFA 3SEBA 1WE6A 5JXVA 5FKAC 1XEEA 2LI5A 3A9JB 1N60A 1XLQA 3FAHA 1FD6A 2NTSA 4O1NA 4GXBA 3U8ZA 2EMTA 3RNAC 2GB1A 4TMAB 3B2GA 2NBVB 4YL8A 2BYTA 1Z5SB 2WU2B 3UI3A 2LGDA 1SJHD 4MEMA 5TSSA 1ZDVA 4YSYB 3WALA 2ON8A 2KVZA 4I6LB 1YQBA 2C5LC 4RGNA 2LHEA 3V3XA 2KWUB 1FNVA 3Q14C 3I9V1 2G1EA 2M1MA 3DPDA 3O65B 5CHVC 4PYZA 1E8YA 2FUHB 1FFVA 2KK8A 3AU4A 1QOFA 2BTEA 2QJLA 5EE3A 2KJ6A 5DCNA 5HKHA 3JW0X 3DHHC 1SE3A 2I1JA 4HPMB 1FRDA 1YN3A 4M0WB 2GLSA 4GU2A 1S3SG 4N58A 5HHDG 2DZMA 2KN5A 5KHQA 4XDCA 1WXVA 2XEWA 4YTNB 3L13A 1TKYA 1WR6E 2D3AA 3HVZA 1UGJA 4B0EA 2Z0DB 3SDLC 1IBXB 1TT5B 2GBJA 3H8HA 5DPSA 1MPEA 3ZYYX 2DZIA 4C56C 2WLBA 1H8CA 1WY8A 4GDLB 3R2IA 3RMKC 3IG3A 2KNBA 2OOBB 2ZPYA 1SBBB 3H7PA 3ETRA 3KW5B 1P0RA 2MW5A 3ZNHB 2SAKA 4PS7A 2DAFA 1SIFA 3NY5A 3VR9B 3RULA 2W82A 4XDDA 4UDUC 1R4MB 3LDZE 3P4PB 5BO4B 1L5PA 4OVVA 3GP7A 3URYA 1RFAA 2DLBA 2ICIA 2CS4A 2FCQA 4FJVB 2KDMA 1GC7A 1R4NI 3ECIA 3SHQA 3TUOA 2QILA 2L05A 4JE3B 4PS3A 2PE6B 3RI7C 1NI2A 4HRSA 5CTRC
chains in the Genus database with same CATH topology
1OQRA 3NUHB 3HUIA 2K22A 4RGOS 1L4DB 1D5MC 1RM6C 3FILB 1TJEA 2TSSA 4LLGM 2N0SB 1C76A 2Y5PA 1VRAB 3KQ4A 4RFBA 3AE8B 1DYQA 1B1ZA 3IAM1 2WXFA 3EA6A 4USAA 2JWUA 1SE2A 3PZ7A 3PO0A 2AQ2B 3KWVA 2WXNA 5BMHA 3MHZA 1ET9A 3AE7B 2N9KA 1LO5D 1FXAA 4XWTA 4TQ0A 4WAFA 1MI0A 4RGTA 4A8XC 3AV8A 2INNE 3C8YA 5FR3A 1YJJA 4HKZE 1QQRA 1I4XA 4PT5A 3R8BA 2VZKB 4HKQA 1P7FA 3U7ZA 3NRZA 1L0YB 5I4DA 4A9AA 3AM9A 2PVOD 2ZW1A 4C7YA 2WXLA 2JZPA 3AE4B 3W5VB 1F0ZA 2K3UA 4AQ7A 1VLBA 4L2YA 2DYMA 5T8IA 3W9CB 2V3NA 1I4RA 1IGDA 3BVZA 2LHDA 4LK0M 1JMLA 1TS4A 1GB4A 1UWMA 1WSPA 2WXHA 4IKGA 3VRAB 1VJKA 1A70A 1DOXA 5C2TB 2WXGA 2WS3B 1EU4A 2N7JA 1JWSD 2Q5WD 1CZPA 4ITKA 4ZHPA 2KWDA 4EE2A 2I2YA 2WDRB 1BUIC 4KGRA 5GXGB 3TEZA 2M56B 4N59A 1EM7A 1JROA 3SFDB 1D5ZC 4KKJA 1N62A 2CU3A 3AE5B 1FM0D 1SXTA 2MJ3A 1QKZA 2XN9C 4ZRPA 2M0AA 3AEGB 3T3OA 3SFEB 4P16A 4M0WA 1F2RC 2HDEA 1SJED 1M4VA 2HTME 3AEBB 3KLSX 1CK1A 1Q10A 1HEZE 1ZXIA 1FCLA 4HEA1 2LJIA 3AE1B 1C9FA 1J7BA 5D3DA 1ZXHA 1NENB 3VRBB 1N63A 4KX6B 5C3JB 4KKIA 3AB5A 4H2AA 1PGAA 4YTMB 2L32A 1NI3A 1K53A 2JU6X 1YN5A 1K52A 3DWGC 1TS5A 2K5PA 5BYQA 3BZDB 1WRIA 3V05A 2SEBD 1ROEA 1K51A 3O13A 2L52A 2JXTA 4RCOA 3TEXA 1IBXA 2ACZB 1ACCA 1WYGA 3NVYA 1KH0A 1QT9A 1N5XA 1K50A 4ARCA 3AECB 2I38A 3BWUD 3AE6B 2BB6A 1AWDA 4LTUA 2JYTA 5MPOA 2IGHA 1V97A 4RH6A 3BVGA 1STEA 1ET6A 3AMZA 1SE4A 2DBYA 1L6VA 1HQRD 1L0VB 1JQ4A 3P4RB 1ZPSA 2LMCA 1JWBD 3AEEB 3E56A 1SB3C 1C4CA 4OHJA 1FNWA 4FXCA 2W55A 4WURA 1TKEA 3NVWA 4IOIE 2FUG1 1XLNA 3WCQA 4CQNA 3W2DA 1NVID 5AUKA 1E7PB 4NAWB 2Y3AA 1TZOA 1XCQL 1V8CA 2BB5A 3RFZB 2DYOA 2INPE 3ZJVA 1QLBB 1PUTA 1XXGA 1AYFA 2X38A 3Q8FA 1C79A 5D7GA 1YMHE 3B2FA 2PMVA 2WDQB 4ZHOA 3IXSA 1VDVA 2JYEA 3OWEB 2RDGA 4RNAA 3P4QB 2WXQA 1TY0A 5FK9C 1XLOA 1MHXA 2G9HD 3LB8C 4Q2JA 2DWQA 3IT4B 4YWGG 1QOBA 4OZBA 4TQ1A 4D2KA 4ZRQA 4IDIA 1UNSA 2BW2A 3RPFC 1DGJA 2KACA 3FILA 4ARIA 1RWSA 2WU5B 5EE9A 2BBCA 2IJ0A 2KN4A 3MFGA 1E9MA 1JCKB 1QOGA 3AE9B 2KAJA 1N61A 3EUB2 1C4AA 2PW9A 3VR8B 4C80A 2CJNA 1TYGB 2D5GA 4NJCA 1PGXA 4WIPA 4DXGA 2L83A 2MH7A 3BK1A 2J42A 2BT6A 3MP9A 1T5XD 4WWMA 1QF6A 1XO3A 4GLSC 4A6QA 3N9YC 2RDHA 2FE8A 5G5GA 4NAMA 3P1MA 2EKIA 1D4BA 1ZUD2 2J4XA 4DQOC 4ZOHC 1KF6B 1E10A 1F77A 3Q69A 3BYYB 2QSDA 2AQ3B 2QEJC 1DOYA 1D5XC 4KGTA 1FMAD 4YXDB 1JWAD 1ZE3D 1SSNA 2IDYA 2CJOA 2N9LA 3TEWA 4OW0A 5G5HA 4WQMA 4YSZB 1C77A 2NMQA 2R61A 3P42A 3U52E 2WXJA 1EU3A 1FIQA 2H89B 2KMMA 2YEPB 4GDKB 3B9JA 2WXRA 1KLUD 4ZYSA 2WXMA 2AQ1B 2L1AA 2W54A 1YN4A 1P7EA 3DWMA 1UWXA 3AEDB 3NS1A 4NZLB 3HRDD 1F2RI 3HVDA 1KLGD 3I57A 2GRIA 1WXQA 4YT0B 1FXIA 2LGIA 4A90A 2M19A 4HROA 4XWWA 3P63A 1NEKB 1PGBA 3ABVB 3Q8BA 1TKGA 2ZW0A 4US8A 1SEBD 4TSSA 1C4PA 1V1PB 2WXKA 3Q8AA 3FC4A 2H88B 1EWCA 2B76B 2BS4B 1NYQA 3AE3B 3U4EG 2ONQA 3P4SB 1SIJA 1HXYD 3LYYA 3AE2B 1YQ3B 1JWUD 1XF5L 3MC0B 4C7ZA 3ZQ4A 1PDXA 3L4PA 1CQVA 1JWMD 2MEKA 4JPSA 2KQ4X 5E6JA 2WXOA 1ENFA 1HZ5A 1L4ZB 1PFDA 1V1PA 2E6XA 1EWYC 5H8YE 1FO4A 2XNAC 3CIRB 1JRPA 1D6EC 4RGMA 2W3RA 3MJ5A 4XE0A 3SEBA 1QOAA 2NTTA 2K0PA 5JXVA 5FKAC 1TY2A 1VZ7A 1XEEA 2PLPA 1I4QA 3LXFA 2Z8LA 2JX5A 1N60A 1XLQA 3FAHA 1NYRA 1FD6A 2IGDA 4US9A 5EE1A 2K9XA 2NTSA 3J9CA 2GI9A 4O1NA 4J3OD 1RFKA 2BS2B 4RF1A 2IGGA 5HFYA 1SF0A 3Q8CA 2GB1A 5BMGA 2LUMA 4MH8A 1AN8A 1PYWD 4TMAB 2MJEA 2QMTA 1GAQB 3B2GA 1KFYB 4MACA 4WH4A 4YSXB 2BYTA 2WU2B 2QIEB 2Y5CA 4OZAA 4JWSC 5H92C 3IT6B 5BMIA 5BYSA 1ZOYB 5D3IB 3UI3A 1I7HA 1SJHD 2PVGC 4R3DA 1DOIA 4RF0A 5TSSA 2V0GA 1ZDVA 4MT5A 4YSYB 3NVZA 2LFIA 2OHFA 2ON8A 2AX5A 1BXTA 2YEPF 5EE0A 2PKOA 3BYTB 4P6VF 4N6EB 1J7CA 4RGNA 2LHEA 3VQIA 3V3XA 2WXIA 2PIAA 3BIID 1FNVA 1I4PA 3I9V1 2G1EA 1C78A 1GPXA 3AN1A 3GS2A 1N5WA 4MM3B 1CJEA 3IAS1 1UUPA 2E3TA 1GB1A 1BMLC 1FFVA 1QOFA 2BTEA 1Y56A 1YQ4B 3E9SA 2QJLA 1JALA 5EE3A 1T3QA 4L1BA 5HI1A 1ZDXA 3W5UB 4HJGE 1XLPA 1SE3A 3R2TA 1FRDA 1YN3A 1JW9D 1KRHA 1GOZA 1TS3A 1L6UA 4A55A 3AEAB 1AW7A 4N58A 1I4GA 1J7AA 1FFUA 5HHDG 1MHHE 4B0MA 4XDCA 2JQRB 3ZJUA 2PTLA 3AH7A 1FNUA 1OFFA 4YTPB 1RYJA 2MJDA 4YTNB 1QILA 1VR9A 5LNK1 1V1OA 1IGCA 1TKYA 1OQQA 2V3PA 3EGRA 2IPKD 1ESFA 3HVZA 1UGJA 4B0EA 5BYRA 4AS1A 2J52A 1ZP0B 2OEDA 3NVVA 1IBXB 1YNTE 3H8HA 4DXFA 1XCTL 2RMMA 1MPEA 1B9RA 3ZYYX 3W1SA 4C56C 2WLBA 1IUEA 4OVZA 1VZ8A 4KGSA 4GDLB 3R2IA 1FCCC 1FRRA 5AUIA 2W3SA 1VZ6A 3TSSA 1T6BX 2JSVX 2FBWB 1E0ZA 1WWTA 1SBBB 2BS3B 4L23A 3ETRA 3BVMA 2WXPA 3BK2A 1WGKA 3T3NA 2SAKA 3KWLA 3NZ3A 1E6EB 3TEYA 3PZ8A 1I4HA 3ZJTA 3VR9B 2W82A 2WQYB 3CWIA 4UDUC 4XDDA 3P4PB 1L5PA 2VZKD 2V4IB 1TS2A 3GP7A 4OZCA 3URYA 1YJIA 3GB1A 2DLBA 2WDVB 2ICIA 1FEHA 1L0XB 1HA5A 3Q8EA 4JX1C 2KDMA 4JWUC 2WNMA 1KTKA 2EELA 3TUOA 2QILA 2RPVA 2WP9B 4JE3B 1MVKA 2J53A 4HRSA 4REZA 3SR6A 1HZ6A 5HG2A 3AEFB 3U2SC 1R7SA 3ZGZA 2LEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQM A;  1OQR A;  1WYG A;  4YSZ B;  2PIA A;  3HUI A;  2K22 A;  3NVY A;  1QT9 A;  1N5X A;  3BII D;  1RM6 C;  3AEC B;  2G1E A;  3AE6 B;  1FIQ A;  1AWD A;  2H89 B;  1TJE A;  2KMM A;  4LTU A;  5MPO A;  1GPX A;  3AN1 A;  2N0S B;  3B9J A;  1V97 A;  4C80 A;  1N5W A;  1CJE A;  3AE8 B;  2E3T A;  3AMZ A;  2W54 A;  2DBY A;  3DWM A;  1L6V A;  3AED B;  1L0V B;  4USA A;  1JQ4 A;  3NS1 A;  1FFV A;  3HRD D;  3P4R B;  1QOF A;  3PO0 A;  1YQ4 B;  1JWB D;  3AEE B;  2QJL A;  1JAL A;  1SB3 C;  1WXQ A;  1FXI A;  4YT0 B;  5EE3 A;  2M19 A;  1T3Q A;  3AE7 B;  2W55 A;  3P63 A;  4FXC A;  4HRO A;  1TKE A;  1NEK B;  3ABV B;  1FXA A;  3NVW A;  3W5U B;  1XLN A;  1TKG A;  3WCQ A;  1NVI D;  1XLP A;  3AV8 A;  5AUK A;  4US8 A;  1E7P B;  1FRD A;  1JW9 D;  1KRH A;  1YJJ A;  3FC4 A;  2H88 B;  2B76 B;  1L6U A;  2BS4 B;  3AEA B;  1V8C A;  1NYQ A;  1J7A A;  4N58 A;  1FFU A;  3AE3 B;  1QLB B;  1PUT A;  3NRZ A;  2JQR B;  4A9A A;  3AM9 A;  1SIJ A;  2PVO D;  3P4S B;  3AH7 A;  1OFF A;  3AE2 B;  1YQ3 B;  4YTP B;  4C7Y A;  1RYJ A;  1AYF A;  4C7Z A;  2MJD A;  3AE4 B;  1PDX A;  3L4P A;  4YTN B;  3W5V B;  3B2F A;  1F0Z A;  2WDQ B;  1TKY A;  4ZHO A;  1VLB A;  1VDV A;  1OQQ A;  3HVZ A;  3P4Q B;  5GXG B;  1XLO A;  1PFD A;  1ZP0 B;  3NVV A;  3LB8 C;  3W9C B;  1EWY C;  2DWQ A;  1QOB A;  5H8Y E;  1FO4 A;  3CIR B;  4IDI A;  3RPF C;  1JRP A;  1DGJ A;  1UWM A;  3VRA B;  1RWS A;  1B9R A;  1VJK A;  1A70 A;  2WU5 B;  2W3R A;  5EE9 A;  5C2T B;  2WLB A;  2WS3 B;  3ZYY X;  1DOX A;  1IUE A;  2Q5W D;  4ITK A;  1CZP A;  1QOA A;  4ZHP A;  1FRR A;  2WDR B;  3LXF A;  5AUI A;  1E9M A;  2JX5 A;  2W3S A;  1N60 A;  2M56 B;  1XLQ A;  3FAH A;  1NYR A;  1QOG A;  2FBW B;  2KAJ A;  1JRO A;  1N61 A;  3AE9 B;  3EUB 2;  4N59 A;  3VR8 B;  2CJN A;  1TYG B;  1WWT A;  2BS3 B;  2K9X A;  4US9 A;  5EE1 A;  3SFD B;  3ETR A;  1N62 A;  2CU3 A;  3AE5 B;  1FM0 D;  1RFK A;  2BS2 B;  1WGK A;  2MJ3 A;  1SF0 A;  2L83 A;  2MH7 A;  3KWL A;  1E6E B;  2BT6 A;  4WWM A;  1QF6 A;  3AEG B;  1XO3 A;  3SFE B;  3VR9 B;  2WQY B;  2HTM E;  3AEB B;  3CWI A;  5G5G A;  3P1M A;  3P4P B;  2EKI A;  2MJE A;  1L5P A;  1GAQ B;  1ZUD 2;  3B2G A;  4ZOH C;  1KF6 B;  1KFY B;  1YJI A;  1ZXI A;  2WDV B;  1E10 A;  3AE1 B;  4YSX B;  1J7B A;  1E0Z A;  2WU2 B;  2QIE B;  1NEN B;  2Y5C A;  1N63 A;  4JWS C;  4JX1 C;  4KX6 B;  5H92 C;  3VRB B;  3AB5 A;  5C3J B;  1DOY A;  1ZOY B;  4YTM B;  1NI3 A;  4JWU C;  1I7H A;  2PVG C;  3DWG C;  1DOI A;  2K5P A;  4YSY B;  1FMA D;  3NVZ A;  2OHF A;  4YXD B;  1WRI A;  1JWA D;  2WP9 B;  2AX5 A;  4HRS A;  5EE0 A;  2CJO A;  2PKO A;  4P6V F;  4N6E B;  3SR6 A;  1ROE A;  3AEF B;  1J7C A;  1R7S A;  2L52 A;  2LEK A;  5G5H A;  2ACZ B; 
#chains in the Genus database with same CATH topology
 4XX5 A;  2KLG A;  1TBE A;  4AWJ A;  3FIL B;  1TGZ B;  1TJE A;  2Y5P A;  1VRA B;  5L83 A;  2MP2 B;  1N6Z A;  1WGD A;  3PZ7 A;  4DDG D;  4MGI E;  5BMH A;  3MHZ A;  3AE7 B;  4N9F 4;  4TQ0 A;  4ZDV A;  2INN E;  5FR3 A;  4HKZ E;  1QQR A;  2VZK B;  3OLM D;  1GC6 A;  2QCZ A;  4GSW A;  3N20 C;  5KHO A;  2GBN A;  2PVO D;  2JZ3 B;  3APC A;  4C7Y A;  2WXL A;  3AE4 B;  4BKS D;  1F0Z A;  2K3U A;  4AQ7 A;  1ISN A;  1V2Y A;  2KWC A;  1V5O A;  2V3N A;  4FUL A;  1I4R A;  3A9K A;  2LHD A;  3BVZ A;  2CHX A;  2JUO A;  4IKG A;  1VJK A;  2WXG A;  2WS3 B;  4EKU A;  1JWS D;  3ONS A;  1CZP A;  2ASQ A;  2KWD A;  4EE2 A;  2NR2 A;  4HWI B;  1WZ3 A;  1D5Z C;  2K39 A;  4JIO U;  1N62 A;  1FM0 D;  1NBF C;  3PT2 B;  3A33 B;  3T3O A;  1MG4 A;  3JYU A;  2D3C A;  3PSE B;  4M8N A;  5E6P A;  3IHP C;  4KKI A;  1OQY A;  1NI3 A;  2L32 A;  2JU6 X;  1YN5 A;  1LQB A;  3VXW A;  3V05 A;  3QCA A;  4RCO A;  1ACC A;  1KH0 A;  3L16 A;  1QT9 A;  4DHJ B;  2I38 A;  5TR5 A;  4WJO A;  2XK5 B;  2L00 B;  3OAW A;  4RH6 A;  1STE A;  2KC2 A;  3DBL B;  2UWQ A;  4BKS A;  4LDT B;  1FNW A;  1TKE A;  3QWZ B;  1NDD A;  4KSK C;  1C3T A;  1XLN A;  3W2D A;  4WJN A;  3ZNZ B;  3MTN B;  1XCQ L;  1V8C A;  1EUV B;  2DYO A;  1QZE A;  1PUT A;  3A1Q B;  3QQ8 B;  3M63 B;  1J8C A;  2KFK A;  4HVB A;  3Q8F A;  4W9K A;  1YMH E;  1HE8 A;  2YVC A;  4ZHO A;  2K1F A;  3OWE B;  3P4Q B;  1MHX A;  4Q2J A;  2DWQ A;  4YWG G;  2I2Y A;  3RPF C;  2BW2 A;  1WRD B;  4JGH B;  3RUI B;  3ZNG C;  3WIM A;  1WH3 A;  3IVF A;  2IJ0 A;  2DHZ A;  2REX A;  3SD5 A;  4G11 A;  3AE9 B;  1EF1 A;  2KAJ A;  1N61 A;  2PW9 A;  1WXA A;  4F8C B;  1P9D U;  2MH7 A;  2O6V B;  2MWS B;  4TV3 A;  1T5X D;  1WI0 A;  3PRZ A;  1E8X A;  4GLS C;  4A6Q A;  2L76 A;  2RDH A;  3PHX B;  1ZUD 2;  4PS8 A;  5FR6 A;  5J17 A;  2AQ3 B;  2DZK A;  2QEJ C;  1Y8R C;  1FPY A;  1ZE3 D;  2JVC A;  4W9F A;  4LNK A;  2V1Y A;  3VDZ A;  1KM7 A;  3GE3 C;  2KMM A;  3R7Q A;  1WGG A;  3ZW3 A;  1WX9 A;  1V86 A;  3DWM A;  1UWX A;  3AED B;  4ZRJ A;  4NZL B;  3HVD A;  4W9D A;  3I57 A;  2LGI A;  4A90 A;  2M19 A;  1PGB A;  3ABV B;  1TKG A;  4MJS A;  2ZW0 A;  1C4P A;  1V1P B;  1EWC A;  3UF8 A;  2KVR A;  2IND C;  3A4S C;  4ZRI A;  1SIJ A;  3ZDT A;  3QA8 A;  4ICV A;  3L4P A;  1CQV A;  2FAZ A;  2KC1 A;  4KVG B;  2WXO A;  4G50 A;  2KMA A;  1L4Z B;  4ZYN A;  3ZVV A;  2E6X A;  4F7Z A;  1FO4 A;  2J0K A;  5JHB A;  2MSE D;  3QAR A;  3MJ5 A;  2K0P A;  3LXF A;  2Z8L A;  4AUQ C;  2BWF A;  1IYF A;  2D3G A;  3PPA A;  4AJY B;  3FKY A;  2BS2 B;  4RF1 A;  3Q8C A;  2N7D A;  4HDQ A;  2WHI A;  2LUM A;  4MH8 A;  2Z0E B;  1PYW D;  2MBQ A;  4OVU A;  3VAW A;  4DK5 A;  2JF5 A;  4NAW A;  2QMT A;  1GAQ B;  4M01 A;  4WWP A;  4YSX B;  3A9J A;  1V5T A;  1F52 A;  3IT6 B;  4R3D A;  1DOI A;  4MT5 A;  1ZW7 A;  3RD2 A;  2LFI A;  3N3K B;  2PKO A;  1J7C A;  2J0J A;  2MA9 B;  3EHV A;  2WXI A;  4E3C A;  2LAS A;  1I4P A;  3H1U A;  3AN1 A;  4RMA A;  2PPH A;  1N5W A;  4BAX A;  1UUP A;  5J2R A;  3DBL I;  1YX6 B;  1BML C;  4BOZ B;  4KZ0 A;  1Y56 A;  1YQ4 B;  1R4N B;  1JAL A;  1AAR A;  4I6N B;  3L10 B;  1U4A A;  1XLP A;  1KRH A;  1GOZ A;  1WGY A;  2D2Q A;  4IM0 A;  3AEA B;  1AW7 A;  2DZJ A;  1FFU A;  4LNI A;  4WJP A;  2JQR B;  3ZJU A;  3X0W A;  2PTL A;  2L7R A;  1FNU A;  3AH7 A;  3DVG X;  3RNC C;  4MGY E;  4LCD E;  4YTP B;  4W9I A;  1MG8 A;  1TIF A;  2LVQ A;  1QIL A;  1VR9 A;  4MEL A;  5LNK 1;  1YX5 B;  4M00 A;  1OQQ A;  2L3Z A;  2CHZ A;  3NVV A;  1YNT E;  2VH1 A;  3OJ4 B;  1XCT L;  4XYC A;  2RMM A;  4B6W A;  3VTU A;  1IUE A;  4GDK A;  1FCC C;  5AUI A;  3APF A;  2J0M A;  2JSV X;  4DDI D;  1E0Z A;  3DHG C;  4L23 A;  2IBI B;  3VUX A;  3BVM A;  2WXP A;  2JY6 A;  1RRB A;  1WGK A;  2KLC A;  1E6E B;  1LFD A;  4EEW A;  3PZ8 A;  1I4H A;  2VZK D;  4OZC A;  2WDV B;  2WX1 A;  1FEH A;  1WZ0 A;  2FID A;  4JX1 C;  4X57 B;  3R3M A;  4JWU C;  1KTK A;  1F9J A;  2RPV A;  4I6P A;  3RN9 C;  1UBQ A;  4KIK A;  1HZ6 A;  3U2S C;  3TL5 A;  3GOE A;  2Q5W D;  2NVU I;  3HUI A;  3N1Z C;  2L8J A;  1RM6 C;  5D94 A;  1V49 A;  2TSS A;  2IY0 B;  2N0S B;  2BWE S;  2RD0 A;  2WX0 A;  4RFB A;  1B1Z A;  3IAM 1;  2WXF A;  4USA A;  2JWU A;  4ACF A;  4IWQ A;  4ANX A;  1FXA A;  4WAF A;  3Q3M C;  1WJ4 A;  4A8X C;  2NS5 A;  4BBN F;  4PT5 A;  4MDK E;  5J18 A;  4HKQ A;  2BYV E;  3QJZ A;  4NPN A;  1L0Y B;  1WGH A;  4A9A A;  3AM9 A;  2D10 A;  5D6J B;  3X23 A;  4HJK A;  2JZP A;  3EEC A;  4QAY A;  1VLB A;  4A20 A;  3RNE C;  2G4D B;  4KDI C;  2BF8 B;  2QC8 A;  5T8I A;  4DHJ D;  3TBL D;  3W9C B;  4MGK E;  1JML A;  1GB4 A;  1WJN A;  2O2V B;  1EU4 A;  1OEY A;  5C23 A;  4ZHP A;  4MM3 A;  1T0S C;  2WDR B;  1BUI C;  2M0X A;  2M56 B;  3PHW B;  4HLE A;  1EM7 A;  3HHM A;  3AE5 B;  2WDT B;  1G6J A;  2KYW A;  3N1Y C;  1E7U A;  2NBW B;  3QHT A;  2M0A A;  3N32 A;  3GZN I;  2A5U A;  2HDE A;  1SJE D;  2HTM E;  3NJT A;  3ZTC A;  2J7Q B;  2IYD B;  2AWT A;  1CK1 A;  2YLM A;  2KTR A;  3K9P B;  3AE1 B;  3PVL A;  1NEN B;  2K8C A;  2BPS A;  3KVF B;  4H2A A;  1PGA A;  3L08 A;  1K53 A;  3PGE A;  1M94 A;  5BYQ A;  1WMH B;  1WRI A;  2LUE A;  4IWO A;  3N30 A;  4GOC A;  2ZCC A;  2K6D B;  2SEB D;  1WE7 A;  1UZX B;  4P1B C;  1WYG A;  2MBO A;  1K50 A;  4EFO A;  3BWU D;  3AE6 B;  1AWD A;  1T0R C;  5MPO A;  2IGH A;  3PLU A;  2FNJ B;  2MLB A;  1L6V A;  2FIF A;  3P4R B;  1ZPS A;  4HPL B;  2MHJ A;  1C4C A;  2O6V D;  2IZV B;  2W55 A;  2KJH B;  3NVW A;  4IOI E;  1Z2M A;  3WCQ A;  4CQN A;  5AUK A;  4DBG A;  4P7I A;  2N9X A;  4AP4 C;  2BB5 A;  2INP E;  2KX3 A;  4JLC A;  2Z59 B;  3EFU A;  1XXG A;  2KX0 A;  2KTF A;  2IO0 B;  1P98 A;  1C79 A;  3RYT A;  2PMV A;  1VDV A;  2JYE A;  2RDG A;  4RNA A;  1TY0 A;  3NZU A;  1WX8 A;  5LXH A;  2GMI C;  4D2K A;  4OZB A;  4ZRQ A;  2KAC A;  2MX2 A;  2VH2 A;  3AUL A;  3DDC B;  3MFG A;  1E9M A;  4IW0 A;  1JCK B;  1A5R A;  3CF6 E;  1C4A A;  4HK2 A;  3WAP A;  3UGB B;  1TZ1 A;  4NJC A;  2L0T A;  4A3P A;  1XT9 B;  3N1X C;  2ZEQ A;  1RLF A;  2N1W A;  2L83 A;  3BK1 A;  2J42 A;  1XO3 A;  3VVW B;  1UH6 A;  2ZJD A;  1KJT A;  3HK0 A;  4NAM A;  1D4B A;  2C9W B;  3QX1 A;  1E10 A;  1KF6 B;  2WWZ A;  1F77 A;  1E5W A;  4EZJ A;  2WYQ A;  1DOY A;  3H7S A;  1FMA D;  1WXS A;  2ZNV B;  2AEH A;  2IDY A;  2O6V A;  2CJO A;  1WFY A;  2V9H A;  4M02 A;  2AYO B;  4OW0 A;  5G5H A;  5AZG A;  2K8B A;  4YSZ B;  4ASW C;  1WIA A;  2KT7 A;  2NMQ A;  3U52 E;  2XBB C;  2WXJ A;  1BT0 A;  1EU3 A;  1FIQ A;  2H89 B;  2BQQ A;  2YEP B;  3EFC A;  3H6N A;  3EC8 A;  3PRE A;  2WXM A;  2AQ1 B;  2L1A A;  2PE9 A;  4W9H A;  3NS1 A;  4IM3 A;  3H7P B;  2DEN B;  2GRI A;  1WXQ A;  3P63 A;  1NEK B;  4JL9 A;  1L2N A;  4US8 A;  4TSS A;  2WXK A;  3DBR B;  2IY1 B;  2BS4 B;  3ALB A;  3U4E G;  4DHZ E;  5CHF A;  3ZXV A;  1XQQ A;  3UIO B;  3ZQ4 A;  3PRP B;  2MEK A;  2KQ4 X;  1E7V A;  4ICU A;  3QC8 B;  1V1P A;  2ZNV C;  3CIR B;  2KFJ A;  4XE0 A;  1QOA A;  2NTT A;  2IO1 B;  4II3 B;  1TY2 A;  1VZ7 A;  4PK1 A;  1I4Q A;  2AL3 A;  2GBR A;  4NJ6 A;  2IGD A;  5G55 A;  4US9 A;  5EE1 A;  2RDB C;  3J9C A;  2GI9 A;  3CST A;  3P2B A;  4J3O D;  1ZGU B;  3WAN A;  1SF0 A;  5E6N A;  1SGH A;  1AN8 A;  2BKR B;  2MJE A;  3V60 A;  1KFY B;  4WH4 A;  2Y5C A;  4JWS C;  5BMI A;  1ZOY B;  4ANV A;  1I7H A;  4RF0 A;  1D3Z A;  5E6O A;  2OHF A;  4CYE A;  1BXT A;  3R66 C;  5EE0 A;  5AZH A;  4P6V F;  2HJ1 A;  3APD A;  3DVN U;  3VQI A;  5C1Z A;  2PIA A;  4FLH A;  3BII D;  2LJ5 A;  1C78 A;  2IO3 B;  1GPX A;  2LXA A;  1CJE A;  2E3T A;  2NPT B;  4GGQ A;  4FJY A;  3E9S A;  1LM8 B;  1T3Q A;  4L1B A;  2NBU A;  5HI1 A;  4A3O A;  2HD5 B;  4G0N B;  4HJG E;  3KUZ A;  1PQS A;  3OG5 A;  1J7A A;  2CR5 A;  4B0M A;  4IM2 A;  3JSV A;  1OFF A;  3NG0 A;  3MC9 A;  2MJD A;  2LD9 A;  2RPQ A;  3VH4 B;  2UU7 A;  2LWP A;  1IGC A;  1ESF A;  2C60 A;  4K1R B;  4WQO B;  5DPW A;  4AS1 A;  2J52 A;  2OED A;  4W9L A;  1V80 A;  4DXF A;  3UQB A;  4FHJ A;  3TCA A;  2ZZP B;  1VZ8 A;  3UIN B;  1VZ6 A;  3TSS A;  1T6B X;  2KDI A;  1WWT A;  5AEK B;  3A4R A;  4JQW C;  4K81 A;  3VUW A;  3BK2 A;  4FHK A;  3KWL A;  3NZ3 A;  3TEY A;  2QHO A;  2WQY B;  3CWI A;  1TS2 A;  2HE7 A;  3ZIM A;  3Q3F A;  1YJI A;  3GB1 A;  1K8R B;  1WM3 A;  3Q6B A;  1HA5 A;  3Q8E A;  3RNG C;  4DXA B;  4E71 A;  3ML8 A;  2WNM A;  2EEL A;  4MSQ B;  2N7E A;  2KFK B;  1HTQ A;  2B3A A;  2WP9 B;  4REZ A;  3SR6 A;  3AEF B;  4P1C C;  5IKC M;  2LEK A;  3ZGZ A;  2K22 A;  4GB9 A;  4RGO S;  4K7U A;  3GZN B;  3KQ4 A;  3MJW A;  2MBE A;  3AE8 B;  1DYQ A;  2QDF A;  2R2O A;  3NOB A;  2LXC A;  4BOS C;  3TJP A;  2AQ2 B;  3KWV A;  4GMV A;  1ET9 A;  4GN1 A;  1Q0W B;  2LVO A;  1LO5 D;  4W9C A;  3DBR I;  4RGT A;  3HIZ A;  3AV8 A;  4HCN B;  1E90 A;  4K3C A;  3C8Y A;  1YJJ A;  4LNF A;  3DBS A;  2NCN A;  3R8B A;  1P7F A;  3C19 A;  3U7Z A;  1RAX A;  2ZW1 A;  1UGM A;  3BY4 B;  2EKE C;  2HJ8 A;  2KDE B;  1TS4 A;  1UWM A;  1WSP A;  2WXH A;  5JZE B;  4NJ7 A;  5C2T B;  1DOX A;  2RSU A;  2MQJ A;  2K8H A;  2ZVN A;  4KGR A;  4TKN A;  2KWV B;  4N59 A;  2CU1 A;  3SFD B;  3Q3O C;  4C4V B;  2CU3 A;  2VRR B;  4BZA A;  1WR1 A;  2DNF A;  1QKZ A;  2LRW A;  2XN9 C;  2CHW A;  4ZRP A;  3H9D A;  4LJO B;  4MJS B;  4M0W A;  1F2R C;  3KLS X;  1Q10 A;  1ZXI A;  4HEA 1;  2FCS A;  2LJI A;  2MBH A;  1C9F A;  3S2A A;  5LLI A;  1ZXH A;  3KYD D;  1N63 A;  3UQA A;  4YTM B;  5CHW A;  5IA7 A;  2LVP A;  2K5P A;  3BZD B;  4G3X B;  3SU8 X;  5LXI B;  1ROE A;  2INC C;  3T9L A;  3O13 A;  2L52 A;  1IBX A;  1TTN A;  1N5X A;  4PYU A;  1WYW B;  4LTU A;  4GDL A;  2RGF A;  4K3B A;  2DX5 B;  3AMZ A;  1JRU A;  1SE4 A;  3CSF A;  3DOW A;  1HQR D;  1L0V B;  1JQ4 A;  3AEE B;  1C1Y B;  4OHJ A;  3BIN A;  3ZUN A;  3B0A A;  2A4Z A;  1E7P B;  2DAJ A;  4EUT A;  4NAW B;  3VTW A;  2D11 A;  4AOF A;  2ZVO A;  4XC2 A;  1TZO A;  3ZRF A;  1QLB B;  3JVZ X;  3IFW B;  4ANW A;  3DCG A;  4W9G A;  2OJW A;  1CMX B;  2BKF A;  4LNN A;  5D7G A;  1WJU A;  1XD3 B;  1UBI A;  2UYZ B;  2G9H D;  5CX3 A;  2G4S A;  1E8Z A;  4GIV A;  4TQ1 A;  3ZRC A;  1UNS A;  3RNF C;  4KDL B;  3FIL A;  1RWS A;  3AU5 A;  4DWF A;  1IP9 A;  2FCN A;  1S1Q B;  2MP2 A;  3B08 A;  1EO6 A;  2JT4 B;  3EUB 2;  2CJN A;  2OJR A;  1UEL A;  1E8W A;  1KLV A;  1Q1O A;  1Q5W B;  2BT6 A;  4WWM A;  1QF6 A;  1VD2 A;  3N9Y C;  2FE8 A;  5G5G A;  3UIP B;  1YD8 U;  4EOY A;  1KOT A;  3Q69 A;  3BYY B;  1GNU A;  1WF9 A;  3PRM B;  2PJH A;  3U30 A;  3AXC A;  3ENE A;  4KGT A;  3B1L X;  2V4L A;  4YXD B;  4LDT D;  1JWA D;  3ML9 A;  2JWZ A;  4S0R A;  2I1K A;  4WQM A;  3I63 C;  2R61 A;  3P42 A;  5IP4 D;  2KOX A;  2ZPN A;  4K7W A;  4GDK B;  2X8X X;  4ZYS A;  2WXR A;  1KLU D;  1IPG A;  3LJ3 A;  1UD7 A;  2W54 A;  3I3T B;  4RM8 A;  1F2R I;  1KLG D;  2N1V A;  4YT0 B;  3ZTD A;  1MFW A;  3Q8B A;  2KQS A;  1SEB D;  4IUM B;  2IO2 B;  2V3S A;  2H88 B;  2KJR A;  2B76 B;  1NYQ A;  5IOI A;  1P3Q U;  3AE3 B;  3P4S B;  1SE9 A;  3AE2 B;  1XF5 L;  4KV2 A;  5GMV A;  1JWM D;  3RT3 B;  4KIK B;  1HZ5 A;  4HCP B;  3PTF C;  2Y5B B;  1EWY C;  4LNO A;  3WA0 A;  5L95 C;  2XNA C;  2KMC A;  3VH3 B;  4RGM A;  3K9O B;  2XK5 A;  2FCM A;  2KQ7 A;  2PLP A;  2JX5 A;  1NYR A;  4WJQ A;  5G2N A;  2K9X A;  2LGS A;  5HFY A;  1RFK A;  2IGG A;  1L7Y A;  5BMG A;  4BBN C;  2AL6 A;  3KYC D;  1WX7 A;  3TMP B;  3DBH B;  4MAC A;  1FXT B;  2D07 B;  3A1Q A;  2QIE B;  4OZA A;  5H92 C;  4B9K A;  5BYS A;  5D3I B;  2PVG C;  5DPR A;  2V0G A;  3NVZ A;  3R7R A;  2AX5 A;  3KUC B;  2YEP F;  2M4N A;  2WGS A;  3BYT B;  4N6E B;  1V81 A;  3M95 A;  4RM9 A;  2LGY A;  4NQL B;  4FA6 A;  4EZL A;  1J0G A;  2JRI B;  3GS2 A;  4MM3 B;  3Q3N C;  3IAS 1;  1P1A A;  1GB1 A;  1J19 A;  4E74 A;  3KUD B;  2G45 B;  1ZDX A;  4W9J A;  3W5U B;  3R2T A;  1JW9 D;  1ZKH A;  3VFK A;  1TS3 A;  1L6U A;  4MSM B;  4A55 A;  1I4G A;  3QK0 A;  2KTR B;  1MHH E;  2NPT A;  3KH0 A;  4CHK A;  1RYJ A;  4NNJ B;  5JHA A;  4F1S A;  3NS8 A;  1V1O A;  2V3P A;  3EGR A;  2IPK D;  2BYE A;  5BYR A;  1V6E A;  4HXD A;  4IC7 B;  1ZP0 B;  1B9R A;  3RNB C;  3DQV A;  3W1S A;  3W1Y A;  4OVZ A;  4KGS A;  1FRR A;  2W3S A;  3ZLZ A;  2FBW B;  1EF5 A;  2BS3 B;  3V61 A;  3V6E B;  2K25 A;  4MGZ E;  5JH5 C;  3T3N A;  1WM2 A;  3M62 B;  3C0R B;  4CO7 A;  3ZJT A;  2JRH A;  2V4I B;  3V6C B;  2W9N A;  4ZRK A;  1L0X B;  4BKT A;  1T0Q C;  1YIW A;  3DHI C;  3VTV A;  2C7M B;  1MVK A;  2J53 A;  3M3J A;  5HG2 A;  3ZNI D;  3ZO5 B;  1R7S A;  2GOW A;  1OQR A;  3NUH B;  4EZK A;  4NY0 A;  2M17 A;  1L4D B;  1D5M C;  2C7N B;  3T8M A;  4URK A;  2KXJ A;  1LGR A;  4LLG M;  1C76 A;  2LRU A;  3Q3J A;  3L54 A;  2CKH B;  4LJP B;  3AI5 A;  3EA6 A;  1SE2 A;  1MJD A;  3PO0 A;  1GUA B;  2WXN A;  5IN7 A;  2N9K A;  4BKG A;  4XWT A;  1MI0 A;  3RCZ A;  3DVG Y;  4ANU A;  3A9K B;  5DPT A;  1I4X A;  3NRZ A;  3MC8 A;  5I4D A;  5AZF A;  1UF0 A;  3TIX A;  3NZS A;  3W5V B;  3D32 A;  3MHS D;  2KO3 A;  1R4M I;  4K7S A;  4L2Y A;  2DYM A;  1IGD A;  4LK0 M;  1H4R A;  2C7H A;  3VRA B;  1A70 A;  1OTR B;  5IAA C;  1WGR A;  4FBJ B;  2N7J A;  4ITK A;  2N9E B;  4NQK E;  4M8M A;  3ZKJ C;  5GXG B;  3TEZ A;  3VUY A;  2DYB A;  1JRO A;  2BVC A;  4KKJ A;  1V9J A;  1SXT A;  2MJ3 A;  1GG3 A;  4KSL C;  1LXD A;  3AEG B;  3SFE B;  4P16 A;  1M4V A;  3AEB B;  2G3Q B;  3DBH I;  1HEZ E;  1FCL A;  3ZXR A;  1J7B A;  2PEA A;  2N4F A;  2L0F A;  5D3D A;  2RR9 A;  3VRB B;  4KX6 B;  5C3J B;  3AB5 A;  4C4V A;  4FJZ A;  2KDF B;  3DWG C;  3HM6 X;  1K52 A;  1TS5 A;  4BVU C;  3PV1 A;  2GBM A;  3L0W B;  1VCB A;  1K51 A;  2JXT A;  3OJ3 A;  3TEX A;  2ACZ B;  3NVY A;  4B95 A;  5D2M B;  4FN2 A;  2HTH A;  3AEC B;  4ARC A;  1I42 A;  2BB6 A;  4DHZ B;  2JYT A;  3GE8 C;  2KD0 A;  2K6Q A;  1V97 A;  3BVG A;  1ET6 A;  2DBY A;  2KKC A;  5IO9 A;  3DVN V;  2LMC A;  1JWB D;  2M8S A;  1SB3 C;  3E56 A;  4FXC A;  4WUR A;  1T0Y A;  2FUG 1;  1NVI D;  3PS6 A;  2Y3A A;  4BFR A;  2D3B A;  3RFZ B;  3ZJV A;  4C00 A;  3W1S C;  2GBK A;  1AYF A;  2X38 A;  3PLV A;  3B2F A;  2WDQ B;  3IXS A;  3RZW C;  1WJ6 A;  2KZR A;  2WXQ A;  5FK9 C;  1OEY J;  1XLO A;  3ZDM C;  3WAO A;  4FAD A;  3LB8 C;  3IT4 B;  4KZC A;  1QOB A;  4ARI A;  4IDI A;  1DGJ A;  2WU5 B;  5EE9 A;  2BBC A;  4XZ4 A;  1WXM A;  2KN4 A;  2KAN A;  3L17 A;  4AJW A;  1QOG A;  4C80 A;  4J6I A;  3VR8 B;  1TYG B;  2KHW B;  2D5G A;  3U7D A;  1PGX A;  4WWO A;  4WIP A;  4DXG A;  1F1H A;  3QAQ A;  3MP9 A;  3PZD A;  4HPP A;  4WAA A;  2JPH A;  3P1M A;  2EKI A;  4DQO C;  2J4X A;  4TUU A;  4ZOH C;  3NHE B;  2QSD A;  2EMS A;  2JZZ A;  1D5X C;  3JSV B;  1SSN A;  2N9L A;  3HM3 A;  3TEW A;  4XGA B;  2MCN B;  3CMM B;  1C77 A;  2O2V A;  3RZF A;  4IG7 B;  2MRP A;  3B9J A;  2BGF A;  1X1M A;  1YN4 A;  1P7E A;  2LGX A;  3VHT C;  4IWP A;  3HRD D;  4WWN A;  4S17 A;  2KDB A;  1FXI A;  3Q2A C;  4HDO A;  4II2 B;  5EDS A;  1YOV B;  4HRO A;  4XWW A;  1HTO A;  1I35 A;  2R2Q A;  3QIJ A;  3V62 A;  3WAM A;  3Q8A A;  3FC4 A;  1GJZ A;  2MBB B;  2JXX A;  4MH0 E;  2N9P C;  2ONQ A;  1HXY D;  3LYY A;  3IBE A;  1YQ3 B;  1JWU D;  3MC0 B;  4C7Z A;  1PDX A;  1WMH A;  4JPS A;  2LZ6 A;  5E6J A;  1OGW A;  1ENF A;  1PFD A;  1YJ1 A;  4W9E A;  3I5J C;  5H8Y E;  1JRP A;  1D6E C;  2ZCB A;  2W3R A;  2BYF A;  3SEB A;  1WE6 A;  5JXV A;  5FKA C;  1XEE A;  2LI5 A;  3A9J B;  1N60 A;  1XLQ A;  3FAH A;  1FD6 A;  2NTS A;  4O1N A;  4GXB A;  3U8Z A;  2EMT A;  3RNA C;  2GB1 A;  4TMA B;  3B2G A;  2NBV B;  4YL8 A;  2BYT A;  1Z5S B;  2WU2 B;  3UI3 A;  2LGD A;  1SJH D;  4MEM A;  5TSS A;  1ZDV A;  4YSY B;  3WAL A;  2ON8 A;  2KVZ A;  4I6L B;  1YQB A;  2C5L C;  4RGN A;  2LHE A;  3V3X A;  2KWU B;  1FNV A;  3Q14 C;  3I9V 1;  2G1E A;  2M1M A;  3DPD A;  3O65 B;  5CHV C;  4PYZ A;  1E8Y A;  2FUH B;  1FFV A;  2KK8 A;  3AU4 A;  1QOF A;  2BTE A;  2QJL A;  5EE3 A;  2KJ6 A;  5DCN A;  5HKH A;  3JW0 X;  3DHH C;  1SE3 A;  2I1J A;  4HPM B;  1FRD A;  1YN3 A;  4M0W B;  2GLS A;  4GU2 A;  1S3S G;  4N58 A;  5HHD G;  2DZM A;  2KN5 A;  5KHQ A;  4XDC A;  1WXV A;  2XEW A;  4YTN B;  3L13 A;  1TKY A;  1WR6 E;  2D3A A;  3HVZ A;  1UGJ A;  4B0E A;  2Z0D B;  3SDL C;  1IBX B;  1TT5 B;  2GBJ A;  3H8H A;  5DPS A;  1MPE A;  3ZYY X;  2DZI A;  4C56 C;  2WLB A;  1H8C A;  1WY8 A;  4GDL B;  3R2I A;  3RMK C;  3IG3 A;  2KNB A;  2OOB B;  2ZPY A;  1SBB B;  3H7P A;  3ETR A;  3KW5 B;  1P0R A;  2MW5 A;  3ZNH B;  2SAK A;  4PS7 A;  2DAF A;  1SIF A;  3NY5 A;  3VR9 B;  3RUL A;  2W82 A;  4XDD A;  4UDU C;  1R4M B;  3LDZ E;  3P4P B;  5BO4 B;  1L5P A;  4OVV A;  3GP7 A;  3URY A;  1RFA A;  2DLB A;  2ICI A;  2CS4 A;  2FCQ A;  4FJV B;  2KDM A;  1GC7 A;  1R4N I;  3ECI A;  3SHQ A;  3TUO A;  2QIL A;  2L05 A;  4JE3 B;  4PS3 A;  2PE6 B;  3RI7 C;  1NI2 A;  4HRS A;  5CTR C; 
#chains in the Genus database with same CATH homology
 1OQR A;  3NUH B;  3HUI A;  2K22 A;  4RGO S;  1L4D B;  1D5M C;  1RM6 C;  3FIL B;  1TJE A;  2TSS A;  4LLG M;  2N0S B;  1C76 A;  2Y5P A;  1VRA B;  3KQ4 A;  4RFB A;  3AE8 B;  1DYQ A;  1B1Z A;  3IAM 1;  2WXF A;  3EA6 A;  4USA A;  2JWU A;  1SE2 A;  3PZ7 A;  3PO0 A;  2AQ2 B;  3KWV A;  2WXN A;  5BMH A;  3MHZ A;  1ET9 A;  3AE7 B;  2N9K A;  1LO5 D;  1FXA A;  4XWT A;  4TQ0 A;  4WAF A;  1MI0 A;  4RGT A;  4A8X C;  3AV8 A;  2INN E;  3C8Y A;  5FR3 A;  1YJJ A;  4HKZ E;  1QQR A;  1I4X A;  4PT5 A;  3R8B A;  2VZK B;  4HKQ A;  1P7F A;  3U7Z A;  3NRZ A;  1L0Y B;  5I4D A;  4A9A A;  3AM9 A;  2PVO D;  2ZW1 A;  4C7Y A;  2WXL A;  2JZP A;  3AE4 B;  3W5V B;  1F0Z A;  2K3U A;  4AQ7 A;  1VLB A;  4L2Y A;  2DYM A;  5T8I A;  3W9C B;  2V3N A;  1I4R A;  1IGD A;  3BVZ A;  2LHD A;  4LK0 M;  1JML A;  1TS4 A;  1GB4 A;  1UWM A;  1WSP A;  2WXH A;  4IKG A;  3VRA B;  1VJK A;  1A70 A;  1DOX A;  5C2T B;  2WXG A;  2WS3 B;  1EU4 A;  2N7J A;  1JWS D;  2Q5W D;  1CZP A;  4ITK A;  4ZHP A;  2KWD A;  4EE2 A;  2I2Y A;  2WDR B;  1BUI C;  4KGR A;  5GXG B;  3TEZ A;  2M56 B;  4N59 A;  1EM7 A;  1JRO A;  3SFD B;  1D5Z C;  4KKJ A;  1N62 A;  2CU3 A;  3AE5 B;  1FM0 D;  1SXT A;  2MJ3 A;  1QKZ A;  2XN9 C;  4ZRP A;  2M0A A;  3AEG B;  3T3O A;  3SFE B;  4P16 A;  4M0W A;  1F2R C;  2HDE A;  1SJE D;  1M4V A;  2HTM E;  3AEB B;  3KLS X;  1CK1 A;  1Q10 A;  1HEZ E;  1ZXI A;  1FCL A;  4HEA 1;  2LJI A;  3AE1 B;  1C9F A;  1J7B A;  5D3D A;  1ZXH A;  1NEN B;  3VRB B;  1N63 A;  4KX6 B;  5C3J B;  4KKI A;  3AB5 A;  4H2A A;  1PGA A;  4YTM B;  2L32 A;  1NI3 A;  1K53 A;  2JU6 X;  1YN5 A;  1K52 A;  3DWG C;  1TS5 A;  2K5P A;  5BYQ A;  3BZD B;  1WRI A;  3V05 A;  2SEB D;  1ROE A;  1K51 A;  3O13 A;  2L52 A;  2JXT A;  4RCO A;  3TEX A;  1IBX A;  2ACZ B;  1ACC A;  1WYG A;  3NVY A;  1KH0 A;  1QT9 A;  1N5X A;  1K50 A;  4ARC A;  3AEC B;  2I38 A;  3BWU D;  3AE6 B;  2BB6 A;  1AWD A;  4LTU A;  2JYT A;  5MPO A;  2IGH A;  1V97 A;  4RH6 A;  3BVG A;  1STE A;  1ET6 A;  3AMZ A;  1SE4 A;  2DBY A;  1L6V A;  1HQR D;  1L0V B;  1JQ4 A;  3P4R B;  1ZPS A;  2LMC A;  1JWB D;  3AEE B;  3E56 A;  1SB3 C;  1C4C A;  4OHJ A;  1FNW A;  4FXC A;  2W55 A;  4WUR A;  1TKE A;  3NVW A;  4IOI E;  2FUG 1;  1XLN A;  3WCQ A;  4CQN A;  3W2D A;  1NVI D;  5AUK A;  1E7P B;  4NAW B;  2Y3A A;  1TZO A;  1XCQ L;  1V8C A;  2BB5 A;  3RFZ B;  2DYO A;  2INP E;  3ZJV A;  1QLB B;  1PUT A;  1XXG A;  1AYF A;  2X38 A;  3Q8F A;  1C79 A;  5D7G A;  1YMH E;  3B2F A;  2PMV A;  2WDQ B;  4ZHO A;  3IXS A;  1VDV A;  2JYE A;  3OWE B;  2RDG A;  4RNA A;  3P4Q B;  2WXQ A;  1TY0 A;  5FK9 C;  1XLO A;  1MHX A;  2G9H D;  3LB8 C;  4Q2J A;  2DWQ A;  3IT4 B;  4YWG G;  1QOB A;  4OZB A;  4TQ1 A;  4D2K A;  4ZRQ A;  4IDI A;  1UNS A;  2BW2 A;  3RPF C;  1DGJ A;  2KAC A;  3FIL A;  4ARI A;  1RWS A;  2WU5 B;  5EE9 A;  2BBC A;  2IJ0 A;  2KN4 A;  3MFG A;  1E9M A;  1JCK B;  1QOG A;  3AE9 B;  2KAJ A;  1N61 A;  3EUB 2;  1C4A A;  2PW9 A;  3VR8 B;  4C80 A;  2CJN A;  1TYG B;  2D5G A;  4NJC A;  1PGX A;  4WIP A;  4DXG A;  2L83 A;  2MH7 A;  3BK1 A;  2J42 A;  2BT6 A;  3MP9 A;  1T5X D;  4WWM A;  1QF6 A;  1XO3 A;  4GLS C;  4A6Q A;  3N9Y C;  2RDH A;  2FE8 A;  5G5G A;  4NAM A;  3P1M A;  2EKI A;  1D4B A;  1ZUD 2;  2J4X A;  4DQO C;  4ZOH C;  1KF6 B;  1E10 A;  1F77 A;  3Q69 A;  3BYY B;  2QSD A;  2AQ3 B;  2QEJ C;  1DOY A;  1D5X C;  4KGT A;  1FMA D;  4YXD B;  1JWA D;  1ZE3 D;  1SSN A;  2IDY A;  2CJO A;  2N9L A;  3TEW A;  4OW0 A;  5G5H A;  4WQM A;  4YSZ B;  1C77 A;  2NMQ A;  2R61 A;  3P42 A;  3U52 E;  2WXJ A;  1EU3 A;  1FIQ A;  2H89 B;  2KMM A;  2YEP B;  4GDK B;  3B9J A;  2WXR A;  1KLU D;  4ZYS A;  2WXM A;  2AQ1 B;  2L1A A;  2W54 A;  1YN4 A;  1P7E A;  3DWM A;  1UWX A;  3AED B;  3NS1 A;  4NZL B;  3HRD D;  1F2R I;  3HVD A;  1KLG D;  3I57 A;  2GRI A;  1WXQ A;  4YT0 B;  1FXI A;  2LGI A;  4A90 A;  2M19 A;  4HRO A;  4XWW A;  3P63 A;  1NEK B;  1PGB A;  3ABV B;  3Q8B A;  1TKG A;  2ZW0 A;  4US8 A;  1SEB D;  4TSS A;  1C4P A;  1V1P B;  2WXK A;  3Q8A A;  3FC4 A;  2H88 B;  1EWC A;  2B76 B;  2BS4 B;  1NYQ A;  3AE3 B;  3U4E G;  2ONQ A;  3P4S B;  1SIJ A;  1HXY D;  3LYY A;  3AE2 B;  1YQ3 B;  1JWU D;  1XF5 L;  3MC0 B;  4C7Z A;  3ZQ4 A;  1PDX A;  3L4P A;  1CQV A;  1JWM D;  2MEK A;  4JPS A;  2KQ4 X;  5E6J A;  2WXO A;  1ENF A;  1HZ5 A;  1L4Z B;  1PFD A;  1V1P A;  2E6X A;  1EWY C;  5H8Y E;  1FO4 A;  2XNA C;  3CIR B;  1JRP A;  1D6E C;  4RGM A;  2W3R A;  3MJ5 A;  4XE0 A;  3SEB A;  1QOA A;  2NTT A;  2K0P A;  5JXV A;  5FKA C;  1TY2 A;  1VZ7 A;  1XEE A;  2PLP A;  1I4Q A;  3LXF A;  2Z8L A;  2JX5 A;  1N60 A;  1XLQ A;  3FAH A;  1NYR A;  1FD6 A;  2IGD A;  4US9 A;  5EE1 A;  2K9X A;  2NTS A;  3J9C A;  2GI9 A;  4O1N A;  4J3O D;  1RFK A;  2BS2 B;  4RF1 A;  2IGG A;  5HFY A;  1SF0 A;  3Q8C A;  2GB1 A;  5BMG A;  2LUM A;  4MH8 A;  1AN8 A;  1PYW D;  4TMA B;  2MJE A;  2QMT A;  1GAQ B;  3B2G A;  1KFY B;  4MAC A;  4WH4 A;  4YSX B;  2BYT A;  2WU2 B;  2QIE B;  2Y5C A;  4OZA A;  4JWS C;  5H92 C;  3IT6 B;  5BMI A;  5BYS A;  1ZOY B;  5D3I B;  3UI3 A;  1I7H A;  1SJH D;  2PVG C;  4R3D A;  1DOI A;  4RF0 A;  5TSS A;  2V0G A;  1ZDV A;  4MT5 A;  4YSY B;  3NVZ A;  2LFI A;  2OHF A;  2ON8 A;  2AX5 A;  1BXT A;  2YEP F;  5EE0 A;  2PKO A;  3BYT B;  4P6V F;  4N6E B;  1J7C A;  4RGN A;  2LHE A;  3VQI A;  3V3X A;  2WXI A;  2PIA A;  3BII D;  1FNV A;  1I4P A;  3I9V 1;  2G1E A;  1C78 A;  1GPX A;  3AN1 A;  3GS2 A;  1N5W A;  4MM3 B;  1CJE A;  3IAS 1;  1UUP A;  2E3T A;  1GB1 A;  1BML C;  1FFV A;  1QOF A;  2BTE A;  1Y56 A;  1YQ4 B;  3E9S A;  2QJL A;  1JAL A;  5EE3 A;  1T3Q A;  4L1B A;  5HI1 A;  1ZDX A;  3W5U B;  4HJG E;  1XLP A;  1SE3 A;  3R2T A;  1FRD A;  1YN3 A;  1JW9 D;  1KRH A;  1GOZ A;  1TS3 A;  1L6U A;  4A55 A;  3AEA B;  1AW7 A;  4N58 A;  1I4G A;  1J7A A;  1FFU A;  5HHD G;  1MHH E;  4B0M A;  4XDC A;  2JQR B;  3ZJU A;  2PTL A;  3AH7 A;  1FNU A;  1OFF A;  4YTP B;  1RYJ A;  2MJD A;  4YTN B;  1QIL A;  1VR9 A;  5LNK 1;  1V1O A;  1IGC A;  1TKY A;  1OQQ A;  2V3P A;  3EGR A;  2IPK D;  1ESF A;  3HVZ A;  1UGJ A;  4B0E A;  5BYR A;  4AS1 A;  2J52 A;  1ZP0 B;  2OED A;  3NVV A;  1IBX B;  1YNT E;  3H8H A;  4DXF A;  1XCT L;  2RMM A;  1MPE A;  1B9R A;  3ZYY X;  3W1S A;  4C56 C;  2WLB A;  1IUE A;  4OVZ A;  1VZ8 A;  4KGS A;  4GDL B;  3R2I A;  1FCC C;  1FRR A;  5AUI A;  2W3S A;  1VZ6 A;  3TSS A;  1T6B X;  2JSV X;  2FBW B;  1E0Z A;  1WWT A;  1SBB B;  2BS3 B;  4L23 A;  3ETR A;  3BVM A;  2WXP A;  3BK2 A;  1WGK A;  3T3N A;  2SAK A;  3KWL A;  3NZ3 A;  1E6E B;  3TEY A;  3PZ8 A;  1I4H A;  3ZJT A;  3VR9 B;  2W82 A;  2WQY B;  3CWI A;  4UDU C;  4XDD A;  3P4P B;  1L5P A;  2VZK D;  2V4I B;  1TS2 A;  3GP7 A;  4OZC A;  3URY A;  1YJI A;  3GB1 A;  2DLB A;  2WDV B;  2ICI A;  1FEH A;  1L0X B;  1HA5 A;  3Q8E A;  4JX1 C;  2KDM A;  4JWU C;  2WNM A;  1KTK A;  2EEL A;  3TUO A;  2QIL A;  2RPV A;  2WP9 B;  4JE3 B;  1MVK A;  2J53 A;  4HRS A;  4REZ A;  3SR6 A;  1HZ6 A;  5HG2 A;  3AEF B;  3U2S C;  1R7S A;  3ZGZ A;  2LEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...