4FXCA

Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ATYKVTLINEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGTITSGTIDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIKTHQEEGLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Tertiary structure of [2Fe-2S] ferredoxin from Spirulina platensis refined at 2.5 A resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis.
pubmed rcsb
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4fxcA00
2G1EA 3KWLA 3P4SB 3P4RB 3P4PB 1AWDA 1NENB 3SFEB 2K5PA 2MJDA 3AE2B 3BIID 4HRSA 1DGJA 2H89B 1XO3A 1SIJA 1QF6A 2DWQA 1E9MA 1AYFA 2MJEA 3AE3B 3WCQA 2WU2B 2BS3B 1J7AA 2QJLA 3DWMA 1RM6C 4P6VF 5AUIA 1N5WA 1WYGA 2K9XA 5EE3A 2KMMA 3SR6A 1NVID 3HUIA 1CZPA 1GPXA 2PKOA 1ZP0B 3AEAB 4US9A 4YTMB 2BS4B 1E0ZA 3ABVB 1KRHA 1QOAA 3VRBB 3VRAB 2W3RA 3LXFA 2FBWB 4A9AA 4N58A 1NEKB 4C7ZA 1FXAA 1L5PA 1ZXIA 1ROEA 2WS3B 2WU5B 4YXDB 4WWMA 1FIQA 2K22A 5EE9A 1JALA 3AE4B 3AE6B 3HVZA 3AH7A 3DWGC 1JW9D 3AEDB 1RWSA 1OQQA 1NYRA 1NI3A 2MH7A 3W9CB 4US8A 1F0ZA 1RYJA 5GXGB 1N62A 4N59A 3AE7B 2Q5WD 3AECB 1FMAD 4HROA 4JWUC 4JX1C 1V97A 2ACZB 1WGKA 1SF0A 1TKGA 1N63A 1I7HA 2N0SB 5C3JB 3CWIA 1FM0D 1FXIA 1L0VB 4YSYB 4YSZB 1PUTA 3AMZA 1J7CA 4ZHPA 2L83A 3LB8C 1DOXA 4YT0B 1QOFA 2W54A 3SFDB 2WDRB 1ZUD2 1WRIA 1L6UA 1JRPA 1FFVA 2OHFA 3NS1A 1GAQB 3AEFB 4ZOHC 2H88B 2M19A 4ZHOA 3HRDD 3VR8B 1RFKA 1FRDA 1VDVA 1FFUA 3CIRB 3AM9A 3ZYYX 5H8YE 5H92C 2BS2B 3P63A 5G5GA 1ZOYB 1FRRA 3AV8A 3FC4A 1WXQA 2W55A 1R7SA 3FAHA 1OFFA 1XLNA 2JX5A 1EWYC 2M56B 3NRZA 5EE1A 2Y5CA 1FO4A 3NVYA 5EE0A 3AN1A 2DBYA 2CU3A 1YQ4B 3AE9B 4C7YA 1XLQA 2MJ3A 4N6EB 2PIAA 2CJNA 1TKEA 3P1MA 2WDVB 1A70A 1QOGA 1SB3C 1N5XA 2KAJA 3NVVA 1QT9A 4WQMA 3VR9B 4IDIA 1N60A 1VLBA 3AEEB 3EUB2 4YTPB 3W5UB 1E7PB 1KF6B 4FXCA 1UWMA 3W5VB 3B2FA 3AEGB 1QLBB 1N61A 1V8CA 1TYGB 2JQRB 4JWSC 2CJOA 1KFYB 4YTNB 5AUKA 2WQYB 4USAA 5MPOA 1TKYA 3L4PA 3RPFC 1XLOA 3B9JA 3PO0A 2E3TA 1E6EB 3AEBB 3P4QB 2W3SA 2PVOD 5G5HA 2WLBA 3AE1B 3ETRA 2EKIA 4YSXB 2LEKA 1WWTA 1NYQA 1JWBD 2QIEB 1E10A 1VJKA 1B9RA 1DOIA 1OQRA 1YJJA 1YJIA 4LTUA 2HTME 1XLPA 2WP9B 1PDXA 5C2TB 1JWAD 1L6VA 3B2GA 1IUEA 2L52A 3AE8B 1CJEA 3NVZA 1QOBA 3AE5B 3AB5A 1DOYA 1YQ3B 2B76B 1PFDA 3NVWA 2PVGC 2BT6A 1TJEA 1J7BA 4ITKA 4KX6B 4C80A 2WDQB 1T3QA 1JQ4A 2AX5A 1JROA
chains in the Genus database with same CATH superfamily
2G1EA 3PRPB 3P4PB 4JPSA 2K5PA 3AE2B 3PZ8A 4F1SA 4WWNA 1XO3A 3DBLB 4BKGA 2KO3A 4LCDE 5J17A 1ZDVA 1I4QA 2MX2A 4KV2A 4MEMA 1L0YB 1RM6C 1BUIC 4EKUA 3GE3C 1WRDB 2KK8A 2IYDB 4A9AA 4WAAA 4IG7B 1I42A 3IT6B 4DHJD 2GBNA 3AE7B 4DXFA 2NMQA 3Q8EA 1SF0A 2ZCBA 3UI3A 2J52A 3RULA 3SFDB 2M19A 1FRDA 2JXTA 3QIJA 3KUDB 1HE8A 2WHIA 3PHWB 5C1ZA 2WXFA 3C0RB 1R4MI 1TS5A 1GG3A 1SB3C 4MJSB 2INCC 2JXXA 4HCPB 3ZXRA 3Q3MC 3AEGB 2J0JA 1ZW7A 1M4VA 2LGXA 4MJSA 2LJIA 1HA5A 3DBLI 3H7PB 1UWXA 3ONSA 1YD8U 2J0MA 4F7ZA 4EEWA 2ON8A 3H7PA 1V80A 1P3QU 3NY5A 3GOEA 4MELA 2B76B 3L10B 1PFDA 4OW0A 2LJ5A 3WANA 3R7RA 1T3QA 3ZNHB 2C7HA 4RM9A 2FCQA 1IP9A 1DGJA 2KN5A 3SU8X 3CSFA 5JHAA 2KJ6A 5CHVC 2RPVA 4QAYA 4ANUA 2OJWA 3DHGC 3MC9A 1CZPA 2MCNB 4JL9A 3R2TA 3QQ8B 4LNKA 3VRAB 2NBVB 1V86A 2RMMA 3BVZA 5LLIA 1DYQA 3AE4B 3GZNI 3DHIC 4IWOA 3DVGX 2K25A 3Q6BA 1JWUD 1WF9A 4WIPA 4KIKB 4NQLB 4RNAA 4B95A 2WXHA 3LB8C 3TBLD 3A9KB 2AQ1B 4OZCA 4KIKA 1P7FA 2JVCA 3A9KA 1R4NB 2UWQA 3PTFC 3H8HA 3DPDA 2JRHA 4JGHB 2G9HD 3ZQ4A 2M17A 4KSLC 2BYVE 1YMHE 3AE9B 1IPGA 2KJRA 3N9YC 4BKSD 4KSKC 3DQVA 3FKYA 1D4BA 4BZAA 2O2VA 1WR1A 5TR5A 3W5VB 3HM3A 3NHEB 1KFYB 1L7YA 2WXNA 1WMHB 2INDC 2M0XA 2AEHA 4LNOA 4GU2A 2PPHA 2CS4A 1WMHA 2HTME 3AE8B 3KYDD 4REZA 3AE5B 2ZZPB 1LO5D 3QWZB 3OJ4B 2WXKA 1ZKHA 4G50A 4MM3B 1VZ7A 3VTWA 1HQRD 2V3PA 2D3GA 4ANWA 4A6QA 3H9DA 4XDDA 2QCZA 2KTRB 2WU2B 3T9LA 4DK5A 1E7UA 1FPYA 2K6QA 4KZCA 4TV3A 2KTRA 1JCKB 4EZJA 1KH0A 1NEKB 4A90A 1K50A 4YXDB 2K22A 2XEWA 3AEDB 2K39A 2MSED 1R4NI 4HKQA 1I4HA 2BPSA 3B0AA 2RDBC 1EU4A 3RCZA 5C3JB 4MDKE 1FM0D 1WXSA 3NZUA 3PLUA 3NG0A 4D2KA 2Y3AA 1WGGA 1KM7A 4E3CA 4ZOHC 2Z0DB 1RFKA 3Q8CA 4HDOA 3WIMA 3MP9A 3PHXB 1S1QB 5IA7A 2V3NA 2NS5A 2JT4B 2UU7A 1EWYC 2N7JA 2DZKA 2KWVB 1STEA 3UGBB 3RZWC 1J0GA 1TT5B 1SBBB 2OOBB 3UQBA 3ZJVA 1WIAA 2YEPF 4RGTA 4F8CB 2WDVB 1IBXB 4KGTA 4WURA 1E8YA 2KYWA 2D3CA 4O1NA 4YTNB 1XCQL 3S2AA 1IBXA 1GOZA 3B9JA 1I4XA 2BF8B 1WXAA 2E6XA 2LVOA 3SHQA 2WXOA 4NY0A 3UQAA 1J8CA 1F2RI 1MG4A 4ZRJA 1JROA 1XQQA 3P4SB 4AUQC 4RGOS 2BYFA 2KXJA 2INNE 3VDZA 4W9LA 3DCGA 2MBOA 4EE2A 1J7AA 2TSSA 3MHZA 4M0WB 3U8ZA 2KMAA 2KMMA 3Q2AC 4JQWC 4FULA 1UUPA 2PKOA 3U7DA 4DQOC 1HXYD 1T6BX 4M0WA 2W3RA 2D07B 2IJ0A 2WU5B 2LD9A 4HJGE 3W1SC 4GN1A 3MHSD 2KMCA 3EECA 2GOWA 4RH6A 3ZJTA 1SSNA 2WXLA 1YN3A 4A20A 4FBJB 3VTVA 3Q3FA 5LXIB 4KDIC 3AMZA 2M1MA 2L1AA 2FUG1 1ZUD2 1WRIA 5HFYA 3AEFB 2H88B 1P7EA 3T3OA 3APCA 3PGEA 2LGDA 3EFCA 2M8SA 5DPSA 3PLVA 3PZDA 1J19A 4ZRPA 3AU4A 4LDTB 3A33B 2KX3A 2HE7A 1QZEA 2MHJA 4TQ0A 3ZRFA 2BYEA 4W9GA 1ENFA 5AUKA 2IBIB 2LWPA 4RM8A 1UD7A 4G0NB 2N9EB 3P4QB 5E6OA 1ZDXA 3BWUD 4EUTA 1C79A 2C60A 2LASA 4RFBA 3APFA 2LXCA 1B9RA 4DHZE 1L6VA 1OEYA 2KQSA 1WI0A 1QOBA 2B3AA 3LYYA 3PRZA 4LNNA 2K6DB 2VRRB 3TCAA 2XN9C 2G3QB 2KN4A 3ZDMC 3VAWA 1E7VA 3UIOB 1EF1A 4DHZB 3IFWB 4I6PA 3TEYA 3JYUA 1NVID 1N6ZA 4IWQA 1GPXA 3W2DA 4P7IA 3SDLC 1E0ZA 1MG8A 3VUXA 2JU6X 1RFAA 5EE9A 4AWJA 3AE6B 1I35A 3IBEA 1I4PA 2BKFA 2MBQA 4W9IA 4US8A 2IO2B 1RYJA 4K3CA 3D32A 1TKGA 1D5XC 1N63A 1I7HA 3P2BA 1FXIA 1D5ZC 1J7CA 4YT0B 4XDCA 4C56C 1UBQA 3Q8BA 1UBIA 1MFWA 1B1ZA 2WXMA 2FCNA 5BMIA 2DHZA 1C1YB 1V9JA 2JX5A 1G6JA 3NZ3A 2KFKB 4J6IA 1Y8RC 3NVYA 2KHWB 2PMVA 4KKJA 4MGIE 2KWDA 3N1ZC 3TMPB 1KTKA 2KFKA 2OJRA 1LFDA 4BKTA 1SGHA 1E5WA 2WWZA 1TYGB 3RNAC 1YN5A 4NJ6A 1PGAA 1TS4A 3L4PA 4ICVA 3JW0X 3RNGC 1I4GA 5I4DA 1FNUA 2WGSA 2OEDA 3RN9C 1IUEA 2KVRA 5CTRC 1EF5A 1WFYA 1H8CA 2KNBA 4NZLB 1LGRA 2VH1A 4M02A 3P4RB 4NNJB 4P1CC 1MVKA 4LJOB 3PT2B 1HZ5A 4HVBA 1H4RA 3PV1A 1K8RB 1R4MB 4RGMA 1QOAA 2IY0B 2XBBC 4TKNA 2JUOA 5AZFA 4OVVA 1FXAA 3DDCB 3ECIA 3PVLA 1JALA 4DXGA 3HVZA 1ESFA 1FEHA 5BO4B 1U4AA 2JZPA 2O6VB 3ALBA 2L0TA 3OLMD 2Q5WD 3AECB 1MPEA 4JX1C 3DVNV 2CHWA 4M01A 3ZNGC 1QKZA 2O6VA 4YSZB 2IO1B 4A3OA 3LDZE 3M63B 1L6UA 3VTUA 2EMSA 5LXHA 4IWPA 1C9FA 1L0XB 3L13A 3MJWA 2NBUA 3P42A 2MLBA 3WALA 3R2IA 4FADA 4XYCA 3DVNU 1P1AA 2R2OA 1WXQA 2W55A 2MBBB 3I5JC 3QC8B 3HK0A 3MFGA 2CU3A 4AS1A 2QHOA 2EMTA 4EZLA 3V05A 3NUHB 4YTPB 2IPKD 3E56A 3H6NA 2IGHA 4Q2JA 1JQ4A 2JYEA 4W9KA 2LGSA 1TKYA 3NOBA 3GZNB 4LLGM 2W3SA 1P0RA 2KQ4X 2Y5BB 4WAFA 2JYTA 3IG3A 4ARIA 1JWBD 1GUAB 1YJIA 3GE8C 1XLPA 2KDEB 2DAJA 3T3NA 3NVZA 1CJEA 3EFUA 1YQ3B 2DENB 1TGZB 1ET6A 1ET9A 2BTEA 1BMLC 4MGZE 1AYFA 2MJEA 3N30A 3BZDB 2C7MB 5AUIA 1N5WA 3ZNZB 2ZNVB 1ZP0B 4YTMB 2NR2A 4W9FA 1F77A 2GMIC 2V4IB 2PTLA 2RPQA 4MACA 1RWSA 2YVCA 1F52A 1NYRA 2QMTA 3HHMA 2FAZA 2VZKB 3SD5A 2ACZB 1F1HA 1NI2A 1WGKA 1CMXB 1ZE3D 3ZNID 4MGYE 2N9XA 2I1KA 2KX0A 4ZRKA 1AW7A 1PUTA 2L00B 2IGDA 3PS6A 2KZRA 2BKRB 2KFJA 2QDFA 1L4ZB 1VDVA 1FFUA 2DYOA 2BWES 5H8YE 3BK1A 3U4EG 2KWCA 2SAKA 3FAHA 1OFFA 3NRZA 2IO0B 1VZ6A 4C7YA 2MJ3A 1T0RC 3V62A 4WWOA 3KH0A 1WE7A 4PS7A 4TQ1A 1EO6A 2LGIA 1MI0A 2CHXA 3V3XA 1E6EB 2PVOD 3AULA 1V2YA 3RNCC 2EKIA 2V3SA 2QIEB 4A8XC 1OQRA 1WX7A 2O2VB 4W9EA 1JWAD 2L52A 4GLSC 4M8NA 3BYTB 1CK1A 2KLCA 4KX6B 3RI7C 2AL3A 5DPRA 1NENB 3AI5A 3SFEB 2V9HA 2RDGA 1UZXB 1YJ1A 4NAWB 1WZ3A 1WJUA 2DZMA 3WAPA 3WAOA 3AE3B 3KVFB 2QJLA 4P6VF 2ICIA 4NAWA 5HKHA 2MW5A 4ZDVA 1WZ0A 4CO7A 2N9LA 2A5UA 2BS4B 3KUZA 3EGRA 4C7ZA 3ML8A 4MSQB 4WJQA 4URKA 3TIXA 2N9KA 5FR6A 1WXVA 3W9CB 3IHPC 1C4PA 2N9PC 4N59A 3U7ZA 3TEXA 2MA9B 4II2B 1SE9A 4IW0A 1P98A 3CWIA 1VR9A 1ACCA 2JPHA 2D10A 3C19A 3R7QA 3NS1A 2JWUA 3ZGZA 2RR9A 5FK9C 4IOIE 4MH8A 3ZRCA 1QILA 2KT7A 1C3TA 1XLNA 1Q10A 3N1YC 3TEZA 2C5LC 1FD6A 1K53A 4CYEA 4XC2A 3Q8FA 3ML9A 1QOGA 2J4XA 3NVVA 4JLCA 3PREA 1ZGUB 3AEEB 2QSDA 3B2FA 2IZVB 3IAM1 5J18A 2AL6A 3L54A 2ZCCA 2E3TA 5TSSA 2I38A 1S3SG 1CQVA 5L95C 1SJED 3B2GA 4K1RB 4DDID 3AU5A 3E9SA 3BINA 3T8MA 2KC2A 2VH2A 1Q0WB 1WGRA 4WJNA 4YL8A 1RLFA 2J7QB 2PE6B 4HCNB 1WXMA 1WX9A 2X8XX 1A5RA 3U2SC 1QF6A 4FA6A 4ZRIA 4B0MA 5JH5C 2BS3B 3B1LX 1V1OA 4IM0A 4RF0A 3U52E 4G11A 2WXQA 4LK0M 4JE3B 3VRBB 3VQIA 2FE8A 2YLMA 4B9KA 3HIZA 1TS3A 1UGJA 4HROA 1XCTL 4ASWC 1FMAD 1Q1OA 3R3MA 4S17A 1Z2MA 2G4DB 4YSYB 1FNVA 3NJTA 1SJHD 1OEYJ 1T0SC 2LI5A 1GNUA 3VH3B 2GBMA 4L2YA 5E6JA 2D5GA 3AXCA 4ICUA 4TMAB 5G55A 3N32A 1MHHE 2IO3B 2ONQA 3TJPA 5FR3A 1I4RA 3AV8A 4H2AA 2LUEA 4ZYNA 5HG2A 3BVMA 3A1QB 2IGGA 5EE0A 2DBYA 3IVFA 1PGXA 1N5XA 3VR9B 1QT9A 4DHJB 3A1QA 3BY4B 5KHQA 3U30A 1QLBB 2JQRB 4K7UA 4A55A 4ARCA 3AEBB 3AE1B 1WH3A 3KYCD 3L16A 1WX8A 3RUIB 5JHBA 1SIFA 2PEAA 1LM8B 5LNK1 1TTNA 1D6EC 4OHJA 2FIDA 4N9F4 1X1MA 2PJHA 1VCBA 3JVZX 4GXBA 1YQBA 2MEKA 1AN8A 1HTOA 1C78A 3URYA 2ZW1A 3ENEA 3KUCB 1WYGA 2BQQA 4IM3A 1RRBA 4MGKE 2JY6A 2DX5B 1GB1A 1MJDA 3V6EB 2L32A 3N20C 2WXJA 1ROEA 3H7SA 3B08A 2ZEQA 3MC8A 1E8WA 2WXPA 4HKZE 3QARA 1XXGA 2AYOB 2L05A 5D7GA 5L83A 4HJKA 1SXTA 1FXTB 4AP4C 4E74A 3W1YA 2ZW0A 5G2NA 1YN4A 2BBCA 2BVCA 2K8BA 1JWMD 4S0RA 1FFVA 2OHFA 1GAQB 2INPE 3OJ3A 4A3PA 3VR8B 1EM7A 5D6JB 5E6NA 2ZVNA 4BBNC 3IXSA 3Q3NC 3FC4A 1IGCA 4XWWA 3AN1A 4OVUA 3P1MA 2ASQA 3W5UB 2KVZA 2KAJA 2KANA 2LZ6A 3EUB2 2MBEA 3JSVB 1TIFA 1V5OA 1V8CA 4JWSC 2NBWB 2BW2A 5JZEB 1XLOA 4MSMB 2D3AA 1GC7A 3JSVA 1AARA 2V0GA 2LEKA 1KLGD 2RSUA 1LQBA 4KZ0A 2BYTA 2AQ3B 3QHTA 2LGYA 1D3ZA 2KDIA 3N3KB 3A4RA 1FCCC 1WJ6A 1MHXA 2KLGA 1TJEA 4ITKA 5GMVA 5HHDG 1RAXA 3KWLA 4KKIA 4EOYA 3VUYA 4C00A 3O13A 3Q14C 4EFOA 3ZTDA 3KW5B 2DWQA 2LHDA 2DLBA 5EE3A 3HUIA 3X0WA 4XE0A 2GB1A 4L1BA 4BKSA 2KDBA 2K3UA 3I63C 3WA0A 5KHOA 2NTSA 3DBHI 2A4ZA 5D2MB 4ACFA 4WWMA 1NBFC 4P16A 4FLHA 1FCLA 2LFIA 1F0ZA 4KVGB 4W9JA 3KLSX 1ZPSA 5CHWA 4KGRA 5D3DA 4ZHPA 2GLSA 3ZKJC 2LRWA 4IC7B 2QEJC 2JRIB 3AM9A 3ZIMA 4BFRA 4JIOU 4WJOA 2GRIA 3CF6E 1R7SA 3NS8A 2DNFA 2NCNA 1HZ6A 2GBRA 1WM2A 1TKEA 1WGDA 2KOXA 3HM6X 1GC6A 1KLVA 4HK2A 3TL5A 2SEBD 2PW9A 1KOTA 2HDEA 2WQYB 3O65B 3QAQA 4ANXA 3ZDTA 2ZNVC 5AZHA 1JRUA 3WAMA 2V1YA 3CSTA 3I57A 4HLEA 3VFKA 1DOIA 3DVGY 1KLUD 4XZ4A 2YEPB 2KD0A 1T5XD 3AB5A 3M62B 3MC0B 2BB6A 3NVWA 2WXGA 2BT6A 2AX5A 4DBGA 5IAAC 2REXA 2K8HA 3PSEB 4YWGG 1SIJA 4DDGD 1XD3B 3ZUNA 4OVZA 4RF1A 2HJ1A 2N4FA 1WE6A 4LDTD 1C76A 2JZZA 2JWZA 2QILA 1F9JA 2D3BA 3GP7A 1FNWA 2FBWB 1L5PA 4GGQA 4KDLB 2WS3B 3AH7A 4PS8A 3A4SC 3IT4B 2KJHB 2J0KA 5BYQA 2M0AA 2C9WB 3I9V1 2N7EA 1L0VB 4PT5A 1DOXA 2HD5B 1Q5WB 1YOVB 4AOFA 3IAS1 4LJPB 4OZBA 4BOSC 1E8XA 3UIPB 2J53A 1T0QC 3FILB 4M00A 5HI1A 2ZJDA 3P63A 1FRRA 1UELA 5J2RA 3FILA 1EWCA 4X57B 5EE1A 4KGSA 4XX5A 1GB4A 2PIAA 3RNEC 3TEWA 4AQ7A 1UGMA 1QQRA 4WQMA 1HEZE 4BVUC 1UWMA 1N61A 3K9OB 2CJOA 4XWTA 3A9JB 1PYWD 3MJ5A 4YSXB 2IDYA 2PE9A 1IGDA 3A9JA 3NZSA 5C2TB 2Z8LA 1DOYA 1K52A 2Y5PA 2RD0A 3ZLZA 3J9CA 2MJDA 2KTFA 2X38A 2GBKA 3BIID 1WY8A 1WYWB 2J42A 4HXDA 3VH4B 1WGHA 3TUOA 3BK2A 2K9XA 2EELA 1WSPA 4K3BA 1F2RC 3OAWA 3AEAB 4US9A 1Y56A 3ABVB 3SEBA 4I6LB 3HVDA 4B6WA 1V49A 4GDLB 1FIQA 1IYFA 3X23A 1OQQA 2N1VA 2W82A 4GDLA 1N62A 1VZ8A 4DWFA 1L2NA 2N1WA 2ZPYA 1QOFA 2BGFA 1WGYA 3Q3JA 5DPWA 1WR6E 1YX5B 2IY1B 4TUUA 5BYRA 3R8BA 4WH4A 1V81A 2W9NA 2FIFA 2C7NB 2FCMA 2LUMA 5H92C 2DYBA 2EKEC 4ZRQA 3C8YA 4LNFA 5FKAC 3RT3B 2NVUI 1VRAB 5BMHA 1JMLA 3UINB 1EU3A 4BBNF 4BAXA 2Z59B 2BWFA 4I6NB 1XLQA 4PK1A 2KKCA 1A70A 2HTHA 5C23A 4MT5A 4HPLB 2L0FA 1E7PB 2WXIA 1TZOA 2MP2B 4K7WA 1YX6B 3DHHC 3V60A 1JWSD 3RD2A 3PO0A 2LVPA 1TY0A 2N7DA 1UF0A 3VVWB 1GJZA 2MP2A 1EUVB 4MM3A 2G4SA 3ZJUA 4W9HA 3N1XC 4PYZA 2DAFA 1UNSA 2O6VD 3QJZA 3L08A 2PVGC 4C80A 5AZGA 1SE4A 4HRSA 5T8IA 2BB5A 3L0WB 1D5MC 4FN2A 3R66C 2PLPA 1E90A 1WJ4A 4R3DA 1KRHA 1SE2A 2K1FA 4HEA1 2FNJB 2AWTA 1V5TA 1JW9D 4HPMB 2MH7A 3QX1A 5DCNA 1ZXHA 4JWUC 2NPTB 3ZXVA 2DYMA 5D94A 4NJ7A 2FUHB 5E6PA 4XGAB 3VXWA 2CU1A 4K7SA 2WDRB 2NPTA 3RZFA 2DZIA 2WX0A 3PRMB 1BXTA 4EZKA 1P9DU 4TSSA 4GOCA 1XT9B 3ZTCA 4W9CA 1FO4A 4NPNA 3V61A 2GI9A 2RGFA 2MRPA 5MPOA 1NDDA 2FCSA 5G5HA 2CR5A 4IM2A 2WLBA 3ETRA 4PYUA 4J3OD 3TSSA 4RCOA 4WQOB 3OG5A 4FJVB 5CHFA 2VZKD 2L76A 4GMVA 1C4CA 4P1BC 2WX1A 2KQ7A 2XNAC 4ZYSA 2R61A 2JZ3B 3DOWA 2R2QA 1PQSA 2D11A 1WJNA 5IO9A 4CQNA 5DPTA 3WCQA 3OWEB 2DZJA 3SR6A 1L4DB 2L7RA 2RDHA 1V1PB 4WWPA 4PS3A 3VUWA 1SE3A 2NTTA 3Q8AA 4RGNA 4OZAA 3LXFA 2LHEA 4N58A 2QC8A 1V1PA 1OQYA 3DWGC 3RNFC 1UH6A 1NI3A 4GB9A 3RMKC 4L23A 4K81A 5GXGB 5IKCM 1T0YA 3DBRB 1V97A 1BT0A 3DBSA 5BYSA 1HTQA 2N0SB 4G3XB 4HPPA 2ZPNA 2L83A 3ZVVA 2LXAA 3CMMB 4CHKA 2WDTB 2LRUA 3HRDD 3CIRB 3ZYYX 4ANVA 2BS2B 3APDA 5G5GA 1E8ZA 4B0EA 4II3B 5JXVA 1XEEA 2M56B 3RYTA 2JSVX 4IUMB 1YQ4B 3QA8A 3W1SA 4GSWA 2KACA 1TBEA 4GDKB 2UYZB 1VLBA 1KF6B 3DBHB 3Q3OC 3RPFC 4GDKA 3KWVA 3MTNB 2D2QA 2XK5B 3GB1A 1E10A 1YJJA 2L3ZA 2KWUB 1M94A 2WP9B 1C4AA 2MBHA 2XK5A 1LXDA 4NAMA 2KDMA 2KC1A 5IOIA 3M3JA 2CHZA 4FJZA 1J7BA 1AWDA 2H89B 1KJTA 1YIWA 3GS2A 2AQ2B 1XF5L 3K9PB 1E9MA 4BOZB 3DBRI 1K51A 3PPAA 3V6CB 1VD2A 2WXRA 4NQKE 4RMAA 1YNTE 3DWMA 1WM3A 4W9DA 4WJPA 2I2YA 3L17A 1C77A 4E71A 2ZVOA 5CX3A 4HWIB 1TY2A 1ZXIA 4IKGA 3UF8A 1ISNA 3LJ3A 5BMGA 1OTRB 4GIVA 3PZ7A 1V6EA 2Z0EB 5IN7A 2I1JA 1SEBD 3I3TB 2V4LA 2W54A 4NJCA 4AJWA 3ZO5B 1OGWA 2KDFB 1JRPA 2WYQA 5AEKB 1PGBA 4ZHOA 2LVQA 4FHKA 4M8MA 3Q69A 5IP4D 3EHVA 1Z5SB 3QK0A 1ZOYB 2G45B 4DXAB 4FHJA 2Y5CA 1TZ1A 1TS2A 3VHTC 2JF5A 2WNMA 2MWSB 3EC8A 4N6EB 2CJNA 3M95A 4HDQA 4IDIA 1N60A 4FXCA 4MH0E 5D3IB 3BVGA 2MQJA 4USAA 3ZW3A 4FJYA 5EDSA 4UDUC 3RNBC 3EA6A 1WWTA 2M4NA 3RFZB 1NYQA 2L8JA 2LMCA 4C4VB 1VJKA 3QCAA 4LTUA 2K8CA 2K0PA 4LNIA 1PDXA 3BYYB 3H1UA 4C4VA 3KQ4A 2CKHB 2GBJA 2HJ8A 2WDQB 4AJYB
chains in the Genus database with same CATH topology
2G1EA 3P4PB 4JPSA 2K5PA 2MJDA 3J9CA 3AE2B 3PZ8A 2X38A 3BIID 2XN9C 1XO3A 3U2SC 2J42A 1QF6A 2KN4A 1ZDVA 1I4QA 4B0MA 3TUOA 2BS3B 1L0YB 3BK2A 1RM6C 1V1OA 3TEYA 2K9XA 2EELA 1BUIC 1WSPA 1NVID 4RF0A 1F2RC 3U52E 1GPXA 3W2DA 2WXQA 4LK0M 3AEAB 4US9A 4JE3B 1E0ZA 1Y56A 3ABVB 3VRBB 2JU6X 3VQIA 4A9AA 3SEBA 3HVDA 2FE8A 4GDLB 1FIQA 5EE9A 3IT6B 3AE6B 1I4PA 1OQQA 4US8A 1RYJA 1TS3A 2W82A 1N62A 1UGJA 3AE7B 1XCTL 1VZ8A 1FMAD 4HROA 4DXFA 2NMQA 3Q8EA 1SF0A 1D5XC 1N63A 1TKGA 1I7HA 1FXIA 4YSYB 1D5ZC 1FNVA 3UI3A 1SJHD 2J52A 1J7CA 4YT0B 4XDCA 1QOFA 3SFDB 4L2YA 5E6JA 4C56C 5BYRA 3R8BA 2D5GA 3Q8BA 2M19A 4TMAB 4WH4A 1FRDA 2JXTA 1MHHE 1B1ZA 2ONQA 2LUMA 5H92C 4ZRQA 2WXMA 5BMIA 5FR3A 1I4RA 3AV8A 3C8YA 4H2AA 5FKAC 5HG2A 3BVMA 2JX5A 1VRAB 2WXFA 5BMHA 3NZ3A 1JMLA 1EU3A 2IGGA 3NVYA 5EE0A 2DBYA 2PMVA 4KKJA 1XLQA 1PGXA 1TS5A 2KWDA 1A70A 1SB3C 1N5XA 3VR9B 1QT9A 4MT5A 1KTKA 1E7PB 2WXIA 1TZOA 3AEGB 1QLBB 1M4VA 1TYGB 2JQRB 1YN5A 1PGAA 1TS4A 3L4PA 4A55A 1JWSD 2LJIA 1HA5A 3PO0A 4ARCA 3AEBB 1TY0A 1I4GA 5I4DA 1UWXA 1FNUA 3AE1B 3ZJUA 2ON8A 1UNSA 2OEDA 1IUEA 5LNK1 1D6EC 4OHJA 2B76B 1PFDA 4NZLB 4OW0A 2PVGC 4C80A 1T3QA 1SE4A 3P4RB 2MEKA 1AN8A 4HRSA 1MVKA 1DGJA 5T8IA 2BB5A 1C78A 3URYA 2ZW1A 1D5MC 2RPVA 1HZ5A 2PLPA 1WYGA 1CZPA 3R2TA 1GB1A 4R3DA 4RGMA 3VRAB 1KRHA 1QOAA 2L32A 2WXJA 1SE2A 1FXAA 4HEA1 2RMMA 1ROEA 3BVZA 1DYQA 1JALA 3AE4B 4DXGA 3HVZA 1ESFA 1JW9D 1FEHA 4HKZE 2WXPA 2MH7A 2JZPA 1XXGA 1ZXHA 2Q5WD 1MPEA 3AECB 4JWUC 4JX1C 5D7GA 1JWUD 2DYMA 4WIPA 1QKZA 1SXTA 4RNAA 4YSZB 2WXHA 2ZW0A 3LB8C 1YN4A 2BBCA 2WDRB 2AQ1B 4OZCA 1JWMD 1L6UA 1FFVA 1P7FA 2OHFA 1GAQB 2INPE 1BXTA 3VR8B 1C9FA 1EM7A 1L0XB 3P42A 4TSSA 3R2IA 3IXSA 3FC4A 3H8HA 1WXQA 2W55A 1IGCA 3ZQ4A 2G9HD 4XWWA 3MFGA 1FO4A 3AN1A 1YMHE 2CU3A 3AE9B 4AS1A 3N9YC 3P1MA 3W5UB 2KAJA 1D4BA 3V05A 3EUB2 3NUHB 4YTPB 2IPKD 3E56A 3W5VB 1V8CA 2GI9A 2IGHA 4JWSC 4Q2JA 1KFYB 2BW2A 2JYEA 5MPOA 1JQ4A 1TKYA 2WXNA 1XLOA 4LLGM 2W3SA 5G5HA 2KQ4X 4WAFA 2WLBA 2JYTA 3ETRA 2V0GA 2LEKA 1KLGD 4J3OD 4ARIA 1JWBD 3TSSA 4RCOA 1YJIA 2HTME 1XLPA 2BYTA 2AQ3B 2VZKD 3T3NA 3NVZA 3AE8B 1CJEA 1C4CA 4REZA 3AE5B 1YQ3B 1FCCC 1MHXA 2XNAC 1LO5D 1TJEA 4ITKA 4ZYSA 5HHDG 2R61A 1ET6A 3KWLA 2WXKA 4KKIA 4MM3B 1ET9A 1VZ7A 3O13A 1HQRD 2V3PA 4A6QA 4CQNA 2BTEA 1BMLC 2DWQA 1AYFA 2MJEA 4XDDA 3WCQA 2WU2B 3BZDB 2LHDA 3OWEB 2DLBA 5AUIA 1N5WA 5EE3A 3SR6A 1L4DB 3HUIA 2RDHA 1V1PB 4XE0A 2GB1A 4L1BA 1ZP0B 1SE3A 2K3UA 2NTTA 3Q8AA 4YTMB 1JCKB 4RGNA 1F77A 1KH0A 2NTSA 3LXFA 4OZAA 2LHEA 4N58A 1NEKB 2V4IB 4A90A 2PTLA 1V1PA 1K50A 4YXDB 4WWMA 2K22A 3DWGC 4MACA 3AEDB 1RWSA 4P16A 1FCLA 1NYRA 2QMTA 1NI3A 2LFIA 4HKQA 1I4HA 4L23A 1F0ZA 5GXGB 2VZKB 3KLSX 1EU4A 1ZPSA 1V97A 2ACZB 1WGKA 5BYSA 1ZE3D 2N0SB 5C3JB 1FM0D 4KGRA 1AW7A 1PUTA 5D3DA 4ZHPA 2L83A 2IGDA 4D2KA 2Y3AA 4ZOHC 3HRDD 1L4ZB 1RFKA 1VDVA 1FFUA 2QEJC 3CIRB 2DYOA 3AM9A 3Q8CA 3ZYYX 5H8YE 3BK1A 3MP9A 3U4EG 2BS2B 5G5GA 2GRIA 2V3NA 2SAKA 4B0EA 1R7SA 3FAHA 1OFFA 1XEEA 3NRZA 1EWYC 2M56B 1VZ6A 2N7JA 5JXVA 1STEA 2JSVX 1HZ6A 1SBBB 1YQ4B 4C7YA 3ZJVA 2YEPF 2MJ3A 4RGTA 1TKEA 2WDVB 1IBXB 4KGTA 3W1SA 2KACA 4GDKB 1VLBA 4WURA 1KF6B 2SEBD 2PW9A 4O1NA 4YTNB 1XCQL 2HDEA 2WQYB 4TQ1A 1IBXA 2LGIA 3RPFC 1MI0A 1GOZA 3B9JA 1I4XA 1E6EB 3KWVA 3V3XA 2PVOD 2E6XA 3I57A 2EKIA 3GB1A 2QIEB 1E10A 4A8XC 1DOIA 1OQRA 1YJJA 2WP9B 2WXOA 1C4AA 1KLUD 2YEPB 1JWAD 4NAMA 2L52A 2KDMA 4GLSC 1T5XD 3AB5A 3MC0B 3BYTB 1CK1A 2BB6A 3NVWA 1F2RI 2WXGA 2BT6A 1J7BA 4KX6B 2AX5A 1JROA 3P4SB 1AWDA 1NENB 4RGOS 2INNE 3SFEB 2RDGA 4YWGG 2H89B 4NAWB 3GS2A 1SIJA 2AQ2B 1XF5L 4OVZA 1E9MA 1K51A 3AE3B 4EE2A 2WXRA 1YNTE 1J7AA 2TSSA 2QJLA 3DWMA 2ICIA 3MHZA 4P6VF 4RF1A 2KMMA 1C76A 2I2YA 1UUPA 1C77A 2PKOA 2QILA 3GP7A 2N9LA 1FNWA 2BS4B 4DQOC 3EGRA 1HXYD 1T6BX 4M0WA 2W3RA 4C7ZA 2FBWB 1L5PA 1TY2A 1ZXIA 2WS3B 2IJ0A 2WU5B 4IKGA 4HJGE 3AH7A 3IT4B 5BMGA 2N9KA 3W9CB 1C4PA 3PZ7A 4N59A 3U7ZA 5BYQA 4RH6A 3TEXA 2M0AA 3ZJTA 1SSNA 3I9V1 1SEBD 2WXLA 1YN3A 3CWIA 1L0VB 4PT5A 1VR9A 3AMZA 1DOXA 2L1AA 2W54A 4NJCA 2FUG1 1ZUD2 1ACCA 3IAS1 1WRIA 4OZBA 1JRPA 5HFYA 3NS1A 2JWUA 3AEFB 3ZGZA 1PGBA 2H88B 4ZHOA 1P7EA 2J53A 3T3OA 3FILB 3Q69A 5FK9C 4IOIE 4MH8A 5HI1A 3P63A 1ZOYB 4ZRPA 1FRRA 1QILA 3FILA 1EWCA 1Q10A 1XLNA 5EE1A 2Y5CA 4KGSA 3TEZA 1TS2A 1FD6A 4TQ0A 1K53A 2WNMA 1GB4A 4N6EB 2PIAA 2CJNA 3Q8FA 3TEWA 4AQ7A 1QOGA 1QQRA 2J4XA 3NVVA 4WQMA 4IDIA 1N60A 2QSDA 3AEEB 1HEZE 4FXCA 1UWMA 3B2FA 1ENFA 5D3IB 3IAM1 1N61A 3BVGA 5AUKA 2CJOA 4USAA 2E3TA 3P4QB 4XWTA 1ZDXA 5TSSA 4UDUC 1PYWD 3BWUD 3MJ5A 2I38A 4YSXB 3EA6A 1WWTA 2IDYA 3RFZB 1C79A 4RFBA 1NYQA 2LMCA 1VJKA 1B9RA 1CQVA 1IGDA 4LTUA 2K0PA 1PDXA 1SJED 3BYYB 3B2GA 1L6VA 5C2TB 1QOBA 2Z8LA 3E9SA 1DOYA 3KQ4A 3LYYA 1K52A 2Y5PA 2WDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1E A;  3KWL A;  3P4S B;  3P4R B;  3P4P B;  1AWD A;  1NEN B;  3SFE B;  2K5P A;  2MJD A;  3AE2 B;  3BII D;  4HRS A;  1DGJ A;  2H89 B;  1XO3 A;  1SIJ A;  1QF6 A;  2DWQ A;  1E9M A;  1AYF A;  2MJE A;  3AE3 B;  3WCQ A;  2WU2 B;  2BS3 B;  1J7A A;  2QJL A;  3DWM A;  1RM6 C;  4P6V F;  5AUI A;  1N5W A;  1WYG A;  2K9X A;  5EE3 A;  2KMM A;  3SR6 A;  1NVI D;  3HUI A;  1CZP A;  1GPX A;  2PKO A;  1ZP0 B;  3AEA B;  4US9 A;  4YTM B;  2BS4 B;  1E0Z A;  3ABV B;  1KRH A;  1QOA A;  3VRB B;  3VRA B;  2W3R A;  3LXF A;  2FBW B;  4A9A A;  4N58 A;  1NEK B;  4C7Z A;  1FXA A;  1L5P A;  1ZXI A;  1ROE A;  2WS3 B;  2WU5 B;  4YXD B;  4WWM A;  1FIQ A;  2K22 A;  5EE9 A;  1JAL A;  3AE4 B;  3AE6 B;  3HVZ A;  3AH7 A;  3DWG C;  1JW9 D;  3AED B;  1RWS A;  1OQQ A;  1NYR A;  1NI3 A;  2MH7 A;  3W9C B;  4US8 A;  1F0Z A;  1RYJ A;  5GXG B;  1N62 A;  4N59 A;  3AE7 B;  2Q5W D;  3AEC B;  1FMA D;  4HRO A;  4JWU C;  4JX1 C;  1V97 A;  2ACZ B;  1WGK A;  1SF0 A;  1TKG A;  1N63 A;  1I7H A;  2N0S B;  5C3J B;  3CWI A;  1FM0 D;  1FXI A;  1L0V B;  4YSY B;  4YSZ B;  1PUT A;  3AMZ A;  1J7C A;  4ZHP A;  2L83 A;  3LB8 C;  1DOX A;  4YT0 B;  1QOF A;  2W54 A;  3SFD B;  2WDR B;  1ZUD 2;  1WRI A;  1L6U A;  1JRP A;  1FFV A;  2OHF A;  3NS1 A;  1GAQ B;  3AEF B;  4ZOH C;  2H88 B;  2M19 A;  4ZHO A;  3HRD D;  3VR8 B;  1RFK A;  1FRD A;  1VDV A;  1FFU A;  3CIR B;  3AM9 A;  3ZYY X;  5H8Y E;  5H92 C;  2BS2 B;  3P63 A;  5G5G A;  1ZOY B;  1FRR A;  3AV8 A;  3FC4 A;  1WXQ A;  2W55 A;  1R7S A;  3FAH A;  1OFF A;  1XLN A;  2JX5 A;  1EWY C;  2M56 B;  3NRZ A;  5EE1 A;  2Y5C A;  1FO4 A;  3NVY A;  5EE0 A;  3AN1 A;  2DBY A;  2CU3 A;  1YQ4 B;  3AE9 B;  4C7Y A;  1XLQ A;  2MJ3 A;  4N6E B;  2PIA A;  2CJN A;  1TKE A;  3P1M A;  2WDV B;  1A70 A;  1QOG A;  1SB3 C;  1N5X A;  2KAJ A;  3NVV A;  1QT9 A;  4WQM A;  3VR9 B;  4IDI A;  1N60 A;  1VLB A;  3AEE B;  3EUB 2;  4YTP B;  3W5U B;  1E7P B;  1KF6 B;  4FXC A;  1UWM A;  3W5V B;  3B2F A;  3AEG B;  1QLB B;  1N61 A;  1V8C A;  1TYG B;  2JQR B;  4JWS C;  2CJO A;  1KFY B;  4YTN B;  5AUK A;  2WQY B;  4USA A;  5MPO A;  1TKY A;  3L4P A;  3RPF C;  1XLO A;  3B9J A;  3PO0 A;  2E3T A;  1E6E B;  3AEB B;  3P4Q B;  2W3S A;  2PVO D;  5G5H A;  2WLB A;  3AE1 B;  3ETR A;  2EKI A;  4YSX B;  2LEK A;  1WWT A;  1NYQ A;  1JWB D;  2QIE B;  1E10 A;  1VJK A;  1B9R A;  1DOI A;  1OQR A;  1YJJ A;  1YJI A;  4LTU A;  2HTM E;  1XLP A;  2WP9 B;  1PDX A;  5C2T B;  1JWA D;  1L6V A;  3B2G A;  1IUE A;  2L52 A;  3AE8 B;  1CJE A;  3NVZ A;  1QOB A;  3AE5 B;  3AB5 A;  1DOY A;  1YQ3 B;  2B76 B;  1PFD A;  3NVW A;  2PVG C;  2BT6 A;  1TJE A;  1J7B A;  4ITK A;  4KX6 B;  4C80 A;  2WDQ B;  1T3Q A;  1JQ4 A;  2AX5 A;  1JRO A; 
#chains in the Genus database with same CATH topology
 2G1E A;  3PRP B;  3P4P B;  4JPS A;  2K5P A;  3AE2 B;  3PZ8 A;  4F1S A;  4WWN A;  1XO3 A;  3DBL B;  4BKG A;  2KO3 A;  4LCD E;  5J17 A;  1ZDV A;  1I4Q A;  2MX2 A;  4KV2 A;  4MEM A;  1L0Y B;  1RM6 C;  1BUI C;  4EKU A;  3GE3 C;  1WRD B;  2KK8 A;  2IYD B;  4A9A A;  4WAA A;  4IG7 B;  1I42 A;  3IT6 B;  4DHJ D;  2GBN A;  3AE7 B;  4DXF A;  2NMQ A;  3Q8E A;  1SF0 A;  2ZCB A;  3UI3 A;  2J52 A;  3RUL A;  3SFD B;  2M19 A;  1FRD A;  2JXT A;  3QIJ A;  3KUD B;  1HE8 A;  2WHI A;  3PHW B;  5C1Z A;  2WXF A;  3C0R B;  1R4M I;  1TS5 A;  1GG3 A;  1SB3 C;  4MJS B;  2INC C;  2JXX A;  4HCP B;  3ZXR A;  3Q3M C;  3AEG B;  2J0J A;  1ZW7 A;  1M4V A;  2LGX A;  4MJS A;  2LJI A;  1HA5 A;  3DBL I;  3H7P B;  1UWX A;  3ONS A;  1YD8 U;  2J0M A;  4F7Z A;  4EEW A;  2ON8 A;  3H7P A;  1V80 A;  1P3Q U;  3NY5 A;  3GOE A;  4MEL A;  2B76 B;  3L10 B;  1PFD A;  4OW0 A;  2LJ5 A;  3WAN A;  3R7R A;  1T3Q A;  3ZNH B;  2C7H A;  4RM9 A;  2FCQ A;  1IP9 A;  1DGJ A;  2KN5 A;  3SU8 X;  3CSF A;  5JHA A;  2KJ6 A;  5CHV C;  2RPV A;  4QAY A;  4ANU A;  2OJW A;  3DHG C;  3MC9 A;  1CZP A;  2MCN B;  4JL9 A;  3R2T A;  3QQ8 B;  4LNK A;  3VRA B;  2NBV B;  1V86 A;  2RMM A;  3BVZ A;  5LLI A;  1DYQ A;  3AE4 B;  3GZN I;  3DHI C;  4IWO A;  3DVG X;  2K25 A;  3Q6B A;  1JWU D;  1WF9 A;  4WIP A;  4KIK B;  4NQL B;  4RNA A;  4B95 A;  2WXH A;  3LB8 C;  3TBL D;  3A9K B;  2AQ1 B;  4OZC A;  4KIK A;  1P7F A;  2JVC A;  3A9K A;  1R4N B;  2UWQ A;  3PTF C;  3H8H A;  3DPD A;  2JRH A;  4JGH B;  2G9H D;  3ZQ4 A;  2M17 A;  4KSL C;  2BYV E;  1YMH E;  3AE9 B;  1IPG A;  2KJR A;  3N9Y C;  4BKS D;  4KSK C;  3DQV A;  3FKY A;  1D4B A;  4BZA A;  2O2V A;  1WR1 A;  5TR5 A;  3W5V B;  3HM3 A;  3NHE B;  1KFY B;  1L7Y A;  2WXN A;  1WMH B;  2IND C;  2M0X A;  2AEH A;  4LNO A;  4GU2 A;  2PPH A;  2CS4 A;  1WMH A;  2HTM E;  3AE8 B;  3KYD D;  4REZ A;  3AE5 B;  2ZZP B;  1LO5 D;  3QWZ B;  3OJ4 B;  2WXK A;  1ZKH A;  4G50 A;  4MM3 B;  1VZ7 A;  3VTW A;  1HQR D;  2V3P A;  2D3G A;  4ANW A;  4A6Q A;  3H9D A;  4XDD A;  2QCZ A;  2KTR B;  2WU2 B;  3T9L A;  4DK5 A;  1E7U A;  1FPY A;  2K6Q A;  4KZC A;  4TV3 A;  2KTR A;  1JCK B;  4EZJ A;  1KH0 A;  1NEK B;  4A90 A;  1K50 A;  4YXD B;  2K22 A;  2XEW A;  3AED B;  2K39 A;  2MSE D;  1R4N I;  4HKQ A;  1I4H A;  2BPS A;  3B0A A;  2RDB C;  1EU4 A;  3RCZ A;  5C3J B;  4MDK E;  1FM0 D;  1WXS A;  3NZU A;  3PLU A;  3NG0 A;  4D2K A;  2Y3A A;  1WGG A;  1KM7 A;  4E3C A;  4ZOH C;  2Z0D B;  1RFK A;  3Q8C A;  4HDO A;  3WIM A;  3MP9 A;  3PHX B;  1S1Q B;  5IA7 A;  2V3N A;  2NS5 A;  2JT4 B;  2UU7 A;  1EWY C;  2N7J A;  2DZK A;  2KWV B;  1STE A;  3UGB B;  3RZW C;  1J0G A;  1TT5 B;  1SBB B;  2OOB B;  3UQB A;  3ZJV A;  1WIA A;  2YEP F;  4RGT A;  4F8C B;  2WDV B;  1IBX B;  4KGT A;  4WUR A;  1E8Y A;  2KYW A;  2D3C A;  4O1N A;  4YTN B;  1XCQ L;  3S2A A;  1IBX A;  1GOZ A;  3B9J A;  1I4X A;  2BF8 B;  1WXA A;  2E6X A;  2LVO A;  3SHQ A;  2WXO A;  4NY0 A;  3UQA A;  1J8C A;  1F2R I;  1MG4 A;  4ZRJ A;  1JRO A;  1XQQ A;  3P4S B;  4AUQ C;  4RGO S;  2BYF A;  2KXJ A;  2INN E;  3VDZ A;  4W9L A;  3DCG A;  2MBO A;  4EE2 A;  1J7A A;  2TSS A;  3MHZ A;  4M0W B;  3U8Z A;  2KMA A;  2KMM A;  3Q2A C;  4JQW C;  4FUL A;  1UUP A;  2PKO A;  3U7D A;  4DQO C;  1HXY D;  1T6B X;  4M0W A;  2W3R A;  2D07 B;  2IJ0 A;  2WU5 B;  2LD9 A;  4HJG E;  3W1S C;  4GN1 A;  3MHS D;  2KMC A;  3EEC A;  2GOW A;  4RH6 A;  3ZJT A;  1SSN A;  2WXL A;  1YN3 A;  4A20 A;  4FBJ B;  3VTV A;  3Q3F A;  5LXI B;  4KDI C;  3AMZ A;  2M1M A;  2L1A A;  2FUG 1;  1ZUD 2;  1WRI A;  5HFY A;  3AEF B;  2H88 B;  1P7E A;  3T3O A;  3APC A;  3PGE A;  2LGD A;  3EFC A;  2M8S A;  5DPS A;  3PLV A;  3PZD A;  1J19 A;  4ZRP A;  3AU4 A;  4LDT B;  3A33 B;  2KX3 A;  2HE7 A;  1QZE A;  2MHJ A;  4TQ0 A;  3ZRF A;  2BYE A;  4W9G A;  1ENF A;  5AUK A;  2IBI B;  2LWP A;  4RM8 A;  1UD7 A;  4G0N B;  2N9E B;  3P4Q B;  5E6O A;  1ZDX A;  3BWU D;  4EUT A;  1C79 A;  2C60 A;  2LAS A;  4RFB A;  3APF A;  2LXC A;  1B9R A;  4DHZ E;  1L6V A;  1OEY A;  2KQS A;  1WI0 A;  1QOB A;  2B3A A;  3LYY A;  3PRZ A;  4LNN A;  2K6D B;  2VRR B;  3TCA A;  2XN9 C;  2G3Q B;  2KN4 A;  3ZDM C;  3VAW A;  1E7V A;  3UIO B;  1EF1 A;  4DHZ B;  3IFW B;  4I6P A;  3TEY A;  3JYU A;  1NVI D;  1N6Z A;  4IWQ A;  1GPX A;  3W2D A;  4P7I A;  3SDL C;  1E0Z A;  1MG8 A;  3VUX A;  2JU6 X;  1RFA A;  5EE9 A;  4AWJ A;  3AE6 B;  1I35 A;  3IBE A;  1I4P A;  2BKF A;  2MBQ A;  4W9I A;  4US8 A;  2IO2 B;  1RYJ A;  4K3C A;  3D32 A;  1TKG A;  1D5X C;  1N63 A;  1I7H A;  3P2B A;  1FXI A;  1D5Z C;  1J7C A;  4YT0 B;  4XDC A;  4C56 C;  1UBQ A;  3Q8B A;  1UBI A;  1MFW A;  1B1Z A;  2WXM A;  2FCN A;  5BMI A;  2DHZ A;  1C1Y B;  1V9J A;  2JX5 A;  1G6J A;  3NZ3 A;  2KFK B;  4J6I A;  1Y8R C;  3NVY A;  2KHW B;  2PMV A;  4KKJ A;  4MGI E;  2KWD A;  3N1Z C;  3TMP B;  1KTK A;  2KFK A;  2OJR A;  1LFD A;  4BKT A;  1SGH A;  1E5W A;  2WWZ A;  1TYG B;  3RNA C;  1YN5 A;  4NJ6 A;  1PGA A;  1TS4 A;  3L4P A;  4ICV A;  3JW0 X;  3RNG C;  1I4G A;  5I4D A;  1FNU A;  2WGS A;  2OED A;  3RN9 C;  1IUE A;  2KVR A;  5CTR C;  1EF5 A;  1WFY A;  1H8C A;  2KNB A;  4NZL B;  1LGR A;  2VH1 A;  4M02 A;  3P4R B;  4NNJ B;  4P1C C;  1MVK A;  4LJO B;  3PT2 B;  1HZ5 A;  4HVB A;  1H4R A;  3PV1 A;  1K8R B;  1R4M B;  4RGM A;  1QOA A;  2IY0 B;  2XBB C;  4TKN A;  2JUO A;  5AZF A;  4OVV A;  1FXA A;  3DDC B;  3ECI A;  3PVL A;  1JAL A;  4DXG A;  3HVZ A;  1ESF A;  1FEH A;  5BO4 B;  1U4A A;  2JZP A;  2O6V B;  3ALB A;  2L0T A;  3OLM D;  2Q5W D;  3AEC B;  1MPE A;  4JX1 C;  3DVN V;  2CHW A;  4M01 A;  3ZNG C;  1QKZ A;  2O6V A;  4YSZ B;  2IO1 B;  4A3O A;  3LDZ E;  3M63 B;  1L6U A;  3VTU A;  2EMS A;  5LXH A;  4IWP A;  1C9F A;  1L0X B;  3L13 A;  3MJW A;  2NBU A;  3P42 A;  2MLB A;  3WAL A;  3R2I A;  4FAD A;  4XYC A;  3DVN U;  1P1A A;  2R2O A;  1WXQ A;  2W55 A;  2MBB B;  3I5J C;  3QC8 B;  3HK0 A;  3MFG A;  2CU3 A;  4AS1 A;  2QHO A;  2EMT A;  4EZL A;  3V05 A;  3NUH B;  4YTP B;  2IPK D;  3E56 A;  3H6N A;  2IGH A;  4Q2J A;  1JQ4 A;  2JYE A;  4W9K A;  2LGS A;  1TKY A;  3NOB A;  3GZN B;  4LLG M;  2W3S A;  1P0R A;  2KQ4 X;  2Y5B B;  4WAF A;  2JYT A;  3IG3 A;  4ARI A;  1JWB D;  1GUA B;  1YJI A;  3GE8 C;  1XLP A;  2KDE B;  2DAJ A;  3T3N A;  3NVZ A;  1CJE A;  3EFU A;  1YQ3 B;  2DEN B;  1TGZ B;  1ET6 A;  1ET9 A;  2BTE A;  1BML C;  4MGZ E;  1AYF A;  2MJE A;  3N30 A;  3BZD B;  2C7M B;  5AUI A;  1N5W A;  3ZNZ B;  2ZNV B;  1ZP0 B;  4YTM B;  2NR2 A;  4W9F A;  1F77 A;  2GMI C;  2V4I B;  2PTL A;  2RPQ A;  4MAC A;  1RWS A;  2YVC A;  1F52 A;  1NYR A;  2QMT A;  3HHM A;  2FAZ A;  2VZK B;  3SD5 A;  2ACZ B;  1F1H A;  1NI2 A;  1WGK A;  1CMX B;  1ZE3 D;  3ZNI D;  4MGY E;  2N9X A;  2I1K A;  2KX0 A;  4ZRK A;  1AW7 A;  1PUT A;  2L00 B;  2IGD A;  3PS6 A;  2KZR A;  2BKR B;  2KFJ A;  2QDF A;  1L4Z B;  1VDV A;  1FFU A;  2DYO A;  2BWE S;  5H8Y E;  3BK1 A;  3U4E G;  2KWC A;  2SAK A;  3FAH A;  1OFF A;  3NRZ A;  2IO0 B;  1VZ6 A;  4C7Y A;  2MJ3 A;  1T0R C;  3V62 A;  4WWO A;  3KH0 A;  1WE7 A;  4PS7 A;  4TQ1 A;  1EO6 A;  2LGI A;  1MI0 A;  2CHX A;  3V3X A;  1E6E B;  2PVO D;  3AUL A;  1V2Y A;  3RNC C;  2EKI A;  2V3S A;  2QIE B;  4A8X C;  1OQR A;  1WX7 A;  2O2V B;  4W9E A;  1JWA D;  2L52 A;  4GLS C;  4M8N A;  3BYT B;  1CK1 A;  2KLC A;  4KX6 B;  3RI7 C;  2AL3 A;  5DPR A;  1NEN B;  3AI5 A;  3SFE B;  2V9H A;  2RDG A;  1UZX B;  1YJ1 A;  4NAW B;  1WZ3 A;  1WJU A;  2DZM A;  3WAP A;  3WAO A;  3AE3 B;  3KVF B;  2QJL A;  4P6V F;  2ICI A;  4NAW A;  5HKH A;  2MW5 A;  4ZDV A;  1WZ0 A;  4CO7 A;  2N9L A;  2A5U A;  2BS4 B;  3KUZ A;  3EGR A;  4C7Z A;  3ML8 A;  4MSQ B;  4WJQ A;  4URK A;  3TIX A;  2N9K A;  5FR6 A;  1WXV A;  3W9C B;  3IHP C;  1C4P A;  2N9P C;  4N59 A;  3U7Z A;  3TEX A;  2MA9 B;  4II2 B;  1SE9 A;  4IW0 A;  1P98 A;  3CWI A;  1VR9 A;  1ACC A;  2JPH A;  2D10 A;  3C19 A;  3R7Q A;  3NS1 A;  2JWU A;  3ZGZ A;  2RR9 A;  5FK9 C;  4IOI E;  4MH8 A;  3ZRC A;  1QIL A;  2KT7 A;  1C3T A;  1XLN A;  1Q10 A;  3N1Y C;  3TEZ A;  2C5L C;  1FD6 A;  1K53 A;  4CYE A;  4XC2 A;  3Q8F A;  3ML9 A;  1QOG A;  2J4X A;  3NVV A;  4JLC A;  3PRE A;  1ZGU B;  3AEE B;  2QSD A;  3B2F A;  2IZV B;  3IAM 1;  5J18 A;  2AL6 A;  3L54 A;  2ZCC A;  2E3T A;  5TSS A;  2I38 A;  1S3S G;  1CQV A;  5L95 C;  1SJE D;  3B2G A;  4K1R B;  4DDI D;  3AU5 A;  3E9S A;  3BIN A;  3T8M A;  2KC2 A;  2VH2 A;  1Q0W B;  1WGR A;  4WJN A;  4YL8 A;  1RLF A;  2J7Q B;  2PE6 B;  4HCN B;  1WXM A;  1WX9 A;  2X8X X;  1A5R A;  3U2S C;  1QF6 A;  4FA6 A;  4ZRI A;  4B0M A;  5JH5 C;  2BS3 B;  3B1L X;  1V1O A;  4IM0 A;  4RF0 A;  3U52 E;  4G11 A;  2WXQ A;  4LK0 M;  4JE3 B;  3VRB B;  3VQI A;  2FE8 A;  2YLM A;  4B9K A;  3HIZ A;  1TS3 A;  1UGJ A;  4HRO A;  1XCT L;  4ASW C;  1FMA D;  1Q1O A;  3R3M A;  4S17 A;  1Z2M A;  2G4D B;  4YSY B;  1FNV A;  3NJT A;  1SJH D;  1OEY J;  1T0S C;  2LI5 A;  1GNU A;  3VH3 B;  2GBM A;  4L2Y A;  5E6J A;  2D5G A;  3AXC A;  4ICU A;  4TMA B;  5G55 A;  3N32 A;  1MHH E;  2IO3 B;  2ONQ A;  3TJP A;  5FR3 A;  1I4R A;  3AV8 A;  4H2A A;  2LUE A;  4ZYN A;  5HG2 A;  3BVM A;  3A1Q B;  2IGG A;  5EE0 A;  2DBY A;  3IVF A;  1PGX A;  1N5X A;  3VR9 B;  1QT9 A;  4DHJ B;  3A1Q A;  3BY4 B;  5KHQ A;  3U30 A;  1QLB B;  2JQR B;  4K7U A;  4A55 A;  4ARC A;  3AEB B;  3AE1 B;  1WH3 A;  3KYC D;  3L16 A;  1WX8 A;  3RUI B;  5JHB A;  1SIF A;  2PEA A;  1LM8 B;  5LNK 1;  1TTN A;  1D6E C;  4OHJ A;  2FID A;  4N9F 4;  1X1M A;  2PJH A;  1VCB A;  3JVZ X;  4GXB A;  1YQB A;  2MEK A;  1AN8 A;  1HTO A;  1C78 A;  3URY A;  2ZW1 A;  3ENE A;  3KUC B;  1WYG A;  2BQQ A;  4IM3 A;  1RRB A;  4MGK E;  2JY6 A;  2DX5 B;  1GB1 A;  1MJD A;  3V6E B;  2L32 A;  3N20 C;  2WXJ A;  1ROE A;  3H7S A;  3B08 A;  2ZEQ A;  3MC8 A;  1E8W A;  2WXP A;  4HKZ E;  3QAR A;  1XXG A;  2AYO B;  2L05 A;  5D7G A;  5L83 A;  4HJK A;  1SXT A;  1FXT B;  4AP4 C;  4E74 A;  3W1Y A;  2ZW0 A;  5G2N A;  1YN4 A;  2BBC A;  2BVC A;  2K8B A;  1JWM D;  4S0R A;  1FFV A;  2OHF A;  1GAQ B;  2INP E;  3OJ3 A;  4A3P A;  3VR8 B;  1EM7 A;  5D6J B;  5E6N A;  2ZVN A;  4BBN C;  3IXS A;  3Q3N C;  3FC4 A;  1IGC A;  4XWW A;  3AN1 A;  4OVU A;  3P1M A;  2ASQ A;  3W5U B;  2KVZ A;  2KAJ A;  2KAN A;  2LZ6 A;  3EUB 2;  2MBE A;  3JSV B;  1TIF A;  1V5O A;  1V8C A;  4JWS C;  2NBW B;  2BW2 A;  5JZE B;  1XLO A;  4MSM B;  2D3A A;  1GC7 A;  3JSV A;  1AAR A;  2V0G A;  2LEK A;  1KLG D;  2RSU A;  1LQB A;  4KZ0 A;  2BYT A;  2AQ3 B;  3QHT A;  2LGY A;  1D3Z A;  2KDI A;  3N3K B;  3A4R A;  1FCC C;  1WJ6 A;  1MHX A;  2KLG A;  1TJE A;  4ITK A;  5GMV A;  5HHD G;  1RAX A;  3KWL A;  4KKI A;  4EOY A;  3VUY A;  4C00 A;  3O13 A;  3Q14 C;  4EFO A;  3ZTD A;  3KW5 B;  2DWQ A;  2LHD A;  2DLB A;  5EE3 A;  3HUI A;  3X0W A;  4XE0 A;  2GB1 A;  4L1B A;  4BKS A;  2KDB A;  2K3U A;  3I63 C;  3WA0 A;  5KHO A;  2NTS A;  3DBH I;  2A4Z A;  5D2M B;  4ACF A;  4WWM A;  1NBF C;  4P16 A;  4FLH A;  1FCL A;  2LFI A;  1F0Z A;  4KVG B;  4W9J A;  3KLS X;  1ZPS A;  5CHW A;  4KGR A;  5D3D A;  4ZHP A;  2GLS A;  3ZKJ C;  2LRW A;  4IC7 B;  2QEJ C;  2JRI B;  3AM9 A;  3ZIM A;  4BFR A;  4JIO U;  4WJO A;  2GRI A;  3CF6 E;  1R7S A;  3NS8 A;  2DNF A;  2NCN A;  1HZ6 A;  2GBR A;  1WM2 A;  1TKE A;  1WGD A;  2KOX A;  3HM6 X;  1GC6 A;  1KLV A;  4HK2 A;  3TL5 A;  2SEB D;  2PW9 A;  1KOT A;  2HDE A;  2WQY B;  3O65 B;  3QAQ A;  4ANX A;  3ZDT A;  2ZNV C;  5AZH A;  1JRU A;  3WAM A;  2V1Y A;  3CST A;  3I57 A;  4HLE A;  3VFK A;  1DOI A;  3DVG Y;  1KLU D;  4XZ4 A;  2YEP B;  2KD0 A;  1T5X D;  3AB5 A;  3M62 B;  3MC0 B;  2BB6 A;  3NVW A;  2WXG A;  2BT6 A;  2AX5 A;  4DBG A;  5IAA C;  2REX A;  2K8H A;  3PSE B;  4YWG G;  1SIJ A;  4DDG D;  1XD3 B;  3ZUN A;  4OVZ A;  4RF1 A;  2HJ1 A;  2N4F A;  1WE6 A;  4LDT D;  1C76 A;  2JZZ A;  2JWZ A;  2QIL A;  1F9J A;  2D3B A;  3GP7 A;  1FNW A;  2FBW B;  1L5P A;  4GGQ A;  4KDL B;  2WS3 B;  3AH7 A;  4PS8 A;  3A4S C;  3IT4 B;  2KJH B;  2J0K A;  5BYQ A;  2M0A A;  2C9W B;  3I9V 1;  2N7E A;  1L0V B;  4PT5 A;  1DOX A;  2HD5 B;  1Q5W B;  1YOV B;  4AOF A;  3IAS 1;  4LJP B;  4OZB A;  4BOS C;  1E8X A;  3UIP B;  2J53 A;  1T0Q C;  3FIL B;  4M00 A;  5HI1 A;  2ZJD A;  3P63 A;  1FRR A;  1UEL A;  5J2R A;  3FIL A;  1EWC A;  4X57 B;  5EE1 A;  4KGS A;  4XX5 A;  1GB4 A;  2PIA A;  3RNE C;  3TEW A;  4AQ7 A;  1UGM A;  1QQR A;  4WQM A;  1HEZ E;  4BVU C;  1UWM A;  1N61 A;  3K9O B;  2CJO A;  4XWT A;  3A9J B;  1PYW D;  3MJ5 A;  4YSX B;  2IDY A;  2PE9 A;  1IGD A;  3A9J A;  3NZS A;  5C2T B;  2Z8L A;  1DOY A;  1K52 A;  2Y5P A;  2RD0 A;  3ZLZ A;  3J9C A;  2MJD A;  2KTF A;  2X38 A;  2GBK A;  3BII D;  1WY8 A;  1WYW B;  2J42 A;  4HXD A;  3VH4 B;  1WGH A;  3TUO A;  3BK2 A;  2K9X A;  2EEL A;  1WSP A;  4K3B A;  1F2R C;  3OAW A;  3AEA B;  4US9 A;  1Y56 A;  3ABV B;  3SEB A;  4I6L B;  3HVD A;  4B6W A;  1V49 A;  4GDL B;  1FIQ A;  1IYF A;  3X23 A;  1OQQ A;  2N1V A;  2W82 A;  4GDL A;  1N62 A;  1VZ8 A;  4DWF A;  1L2N A;  2N1W A;  2ZPY A;  1QOF A;  2BGF A;  1WGY A;  3Q3J A;  5DPW A;  1WR6 E;  1YX5 B;  2IY1 B;  4TUU A;  5BYR A;  3R8B A;  4WH4 A;  1V81 A;  2W9N A;  2FIF A;  2C7N B;  2FCM A;  2LUM A;  5H92 C;  2DYB A;  2EKE C;  4ZRQ A;  3C8Y A;  4LNF A;  5FKA C;  3RT3 B;  2NVU I;  1VRA B;  5BMH A;  1JML A;  3UIN B;  1EU3 A;  4BBN F;  4BAX A;  2Z59 B;  2BWF A;  4I6N B;  1XLQ A;  4PK1 A;  2KKC A;  1A70 A;  2HTH A;  5C23 A;  4MT5 A;  4HPL B;  2L0F A;  1E7P B;  2WXI A;  1TZO A;  2MP2 B;  4K7W A;  1YX6 B;  3DHH C;  3V60 A;  1JWS D;  3RD2 A;  3PO0 A;  2LVP A;  1TY0 A;  2N7D A;  1UF0 A;  3VVW B;  1GJZ A;  2MP2 A;  1EUV B;  4MM3 A;  2G4S A;  3ZJU A;  4W9H A;  3N1X C;  4PYZ A;  2DAF A;  1UNS A;  2O6V D;  3QJZ A;  3L08 A;  2PVG C;  4C80 A;  5AZG A;  1SE4 A;  4HRS A;  5T8I A;  2BB5 A;  3L0W B;  1D5M C;  4FN2 A;  3R66 C;  2PLP A;  1E90 A;  1WJ4 A;  4R3D A;  1KRH A;  1SE2 A;  2K1F A;  4HEA 1;  2FNJ B;  2AWT A;  1V5T A;  1JW9 D;  4HPM B;  2MH7 A;  3QX1 A;  5DCN A;  1ZXH A;  4JWU C;  2NPT B;  3ZXV A;  2DYM A;  5D94 A;  4NJ7 A;  2FUH B;  5E6P A;  4XGA B;  3VXW A;  2CU1 A;  4K7S A;  2WDR B;  2NPT A;  3RZF A;  2DZI A;  2WX0 A;  3PRM B;  1BXT A;  4EZK A;  1P9D U;  4TSS A;  4GOC A;  1XT9 B;  3ZTC A;  4W9C A;  1FO4 A;  4NPN A;  3V61 A;  2GI9 A;  2RGF A;  2MRP A;  5MPO A;  1NDD A;  2FCS A;  5G5H A;  2CR5 A;  4IM2 A;  2WLB A;  3ETR A;  4PYU A;  4J3O D;  3TSS A;  4RCO A;  4WQO B;  3OG5 A;  4FJV B;  5CHF A;  2VZK D;  2L76 A;  4GMV A;  1C4C A;  4P1B C;  2WX1 A;  2KQ7 A;  2XNA C;  4ZYS A;  2R61 A;  2JZ3 B;  3DOW A;  2R2Q A;  1PQS A;  2D11 A;  1WJN A;  5IO9 A;  4CQN A;  5DPT A;  3WCQ A;  3OWE B;  2DZJ A;  3SR6 A;  1L4D B;  2L7R A;  2RDH A;  1V1P B;  4WWP A;  4PS3 A;  3VUW A;  1SE3 A;  2NTT A;  3Q8A A;  4RGN A;  4OZA A;  3LXF A;  2LHE A;  4N58 A;  2QC8 A;  1V1P A;  1OQY A;  3DWG C;  3RNF C;  1UH6 A;  1NI3 A;  4GB9 A;  3RMK C;  4L23 A;  4K81 A;  5GXG B;  5IKC M;  1T0Y A;  3DBR B;  1V97 A;  1BT0 A;  3DBS A;  5BYS A;  1HTQ A;  2N0S B;  4G3X B;  4HPP A;  2ZPN A;  2L83 A;  3ZVV A;  2LXA A;  3CMM B;  4CHK A;  2WDT B;  2LRU A;  3HRD D;  3CIR B;  3ZYY X;  4ANV A;  2BS2 B;  3APD A;  5G5G A;  1E8Z A;  4B0E A;  4II3 B;  5JXV A;  1XEE A;  2M56 B;  3RYT A;  2JSV X;  4IUM B;  1YQ4 B;  3QA8 A;  3W1S A;  4GSW A;  2KAC A;  1TBE A;  4GDK B;  2UYZ B;  1VLB A;  1KF6 B;  3DBH B;  3Q3O C;  3RPF C;  4GDK A;  3KWV A;  3MTN B;  2D2Q A;  2XK5 B;  3GB1 A;  1E10 A;  1YJJ A;  2L3Z A;  2KWU B;  1M94 A;  2WP9 B;  1C4A A;  2MBH A;  2XK5 A;  1LXD A;  4NAM A;  2KDM A;  2KC1 A;  5IOI A;  3M3J A;  2CHZ A;  4FJZ A;  1J7B A;  1AWD A;  2H89 B;  1KJT A;  1YIW A;  3GS2 A;  2AQ2 B;  1XF5 L;  3K9P B;  1E9M A;  4BOZ B;  3DBR I;  1K51 A;  3PPA A;  3V6C B;  1VD2 A;  2WXR A;  4NQK E;  4RMA A;  1YNT E;  3DWM A;  1WM3 A;  4W9D A;  4WJP A;  2I2Y A;  3L17 A;  1C77 A;  4E71 A;  2ZVO A;  5CX3 A;  4HWI B;  1TY2 A;  1ZXI A;  4IKG A;  3UF8 A;  1ISN A;  3LJ3 A;  5BMG A;  1OTR B;  4GIV A;  3PZ7 A;  1V6E A;  2Z0E B;  5IN7 A;  2I1J A;  1SEB D;  3I3T B;  2V4L A;  2W54 A;  4NJC A;  4AJW A;  3ZO5 B;  1OGW A;  2KDF B;  1JRP A;  2WYQ A;  5AEK B;  1PGB A;  4ZHO A;  2LVQ A;  4FHK A;  4M8M A;  3Q69 A;  5IP4 D;  3EHV A;  1Z5S B;  3QK0 A;  1ZOY B;  2G45 B;  4DXA B;  4FHJ A;  2Y5C A;  1TZ1 A;  1TS2 A;  3VHT C;  2JF5 A;  2WNM A;  2MWS B;  3EC8 A;  4N6E B;  2CJN A;  3M95 A;  4HDQ A;  4IDI A;  1N60 A;  4FXC A;  4MH0 E;  5D3I B;  3BVG A;  2MQJ A;  4USA A;  3ZW3 A;  4FJY A;  5EDS A;  4UDU C;  3RNB C;  3EA6 A;  1WWT A;  2M4N A;  3RFZ B;  1NYQ A;  2L8J A;  2LMC A;  4C4V B;  1VJK A;  3QCA A;  4LTU A;  2K8C A;  2K0P A;  4LNI A;  1PDX A;  3BYY B;  3H1U A;  4C4V A;  3KQ4 A;  2CKH B;  2GBJ A;  2HJ8 A;  2WDQ B;  4AJY B; 
#chains in the Genus database with same CATH homology
 2G1E A;  3P4P B;  4JPS A;  2K5P A;  2MJD A;  3J9C A;  3AE2 B;  3PZ8 A;  2X38 A;  3BII D;  2XN9 C;  1XO3 A;  3U2S C;  2J42 A;  1QF6 A;  2KN4 A;  1ZDV A;  1I4Q A;  4B0M A;  3TUO A;  2BS3 B;  1L0Y B;  3BK2 A;  1RM6 C;  1V1O A;  3TEY A;  2K9X A;  2EEL A;  1BUI C;  1WSP A;  1NVI D;  4RF0 A;  1F2R C;  3U52 E;  1GPX A;  3W2D A;  2WXQ A;  4LK0 M;  3AEA B;  4US9 A;  4JE3 B;  1E0Z A;  1Y56 A;  3ABV B;  3VRB B;  2JU6 X;  3VQI A;  4A9A A;  3SEB A;  3HVD A;  2FE8 A;  4GDL B;  1FIQ A;  5EE9 A;  3IT6 B;  3AE6 B;  1I4P A;  1OQQ A;  4US8 A;  1RYJ A;  1TS3 A;  2W82 A;  1N62 A;  1UGJ A;  3AE7 B;  1XCT L;  1VZ8 A;  1FMA D;  4HRO A;  4DXF A;  2NMQ A;  3Q8E A;  1SF0 A;  1D5X C;  1N63 A;  1TKG A;  1I7H A;  1FXI A;  4YSY B;  1D5Z C;  1FNV A;  3UI3 A;  1SJH D;  2J52 A;  1J7C A;  4YT0 B;  4XDC A;  1QOF A;  3SFD B;  4L2Y A;  5E6J A;  4C56 C;  5BYR A;  3R8B A;  2D5G A;  3Q8B A;  2M19 A;  4TMA B;  4WH4 A;  1FRD A;  2JXT A;  1MHH E;  1B1Z A;  2ONQ A;  2LUM A;  5H92 C;  4ZRQ A;  2WXM A;  5BMI A;  5FR3 A;  1I4R A;  3AV8 A;  3C8Y A;  4H2A A;  5FKA C;  5HG2 A;  3BVM A;  2JX5 A;  1VRA B;  2WXF A;  5BMH A;  3NZ3 A;  1JML A;  1EU3 A;  2IGG A;  3NVY A;  5EE0 A;  2DBY A;  2PMV A;  4KKJ A;  1XLQ A;  1PGX A;  1TS5 A;  2KWD A;  1A70 A;  1SB3 C;  1N5X A;  3VR9 B;  1QT9 A;  4MT5 A;  1KTK A;  1E7P B;  2WXI A;  1TZO A;  3AEG B;  1QLB B;  1M4V A;  1TYG B;  2JQR B;  1YN5 A;  1PGA A;  1TS4 A;  3L4P A;  4A55 A;  1JWS D;  2LJI A;  1HA5 A;  3PO0 A;  4ARC A;  3AEB B;  1TY0 A;  1I4G A;  5I4D A;  1UWX A;  1FNU A;  3AE1 B;  3ZJU A;  2ON8 A;  1UNS A;  2OED A;  1IUE A;  5LNK 1;  1D6E C;  4OHJ A;  2B76 B;  1PFD A;  4NZL B;  4OW0 A;  2PVG C;  4C80 A;  1T3Q A;  1SE4 A;  3P4R B;  2MEK A;  1AN8 A;  4HRS A;  1MVK A;  1DGJ A;  5T8I A;  2BB5 A;  1C78 A;  3URY A;  2ZW1 A;  1D5M C;  2RPV A;  1HZ5 A;  2PLP A;  1WYG A;  1CZP A;  3R2T A;  1GB1 A;  4R3D A;  4RGM A;  3VRA B;  1KRH A;  1QOA A;  2L32 A;  2WXJ A;  1SE2 A;  1FXA A;  4HEA 1;  2RMM A;  1ROE A;  3BVZ A;  1DYQ A;  1JAL A;  3AE4 B;  4DXG A;  3HVZ A;  1ESF A;  1JW9 D;  1FEH A;  4HKZ E;  2WXP A;  2MH7 A;  2JZP A;  1XXG A;  1ZXH A;  2Q5W D;  1MPE A;  3AEC B;  4JWU C;  4JX1 C;  5D7G A;  1JWU D;  2DYM A;  4WIP A;  1QKZ A;  1SXT A;  4RNA A;  4YSZ B;  2WXH A;  2ZW0 A;  3LB8 C;  1YN4 A;  2BBC A;  2WDR B;  2AQ1 B;  4OZC A;  1JWM D;  1L6U A;  1FFV A;  1P7F A;  2OHF A;  1GAQ B;  2INP E;  1BXT A;  3VR8 B;  1C9F A;  1EM7 A;  1L0X B;  3P42 A;  4TSS A;  3R2I A;  3IXS A;  3FC4 A;  3H8H A;  1WXQ A;  2W55 A;  1IGC A;  3ZQ4 A;  2G9H D;  4XWW A;  3MFG A;  1FO4 A;  3AN1 A;  1YMH E;  2CU3 A;  3AE9 B;  4AS1 A;  3N9Y C;  3P1M A;  3W5U B;  2KAJ A;  1D4B A;  3V05 A;  3EUB 2;  3NUH B;  4YTP B;  2IPK D;  3E56 A;  3W5V B;  1V8C A;  2GI9 A;  2IGH A;  4JWS C;  4Q2J A;  1KFY B;  2BW2 A;  2JYE A;  5MPO A;  1JQ4 A;  1TKY A;  2WXN A;  1XLO A;  4LLG M;  2W3S A;  5G5H A;  2KQ4 X;  4WAF A;  2WLB A;  2JYT A;  3ETR A;  2V0G A;  2LEK A;  1KLG D;  4J3O D;  4ARI A;  1JWB D;  3TSS A;  4RCO A;  1YJI A;  2HTM E;  1XLP A;  2BYT A;  2AQ3 B;  2VZK D;  3T3N A;  3NVZ A;  3AE8 B;  1CJE A;  1C4C A;  4REZ A;  3AE5 B;  1YQ3 B;  1FCC C;  1MHX A;  2XNA C;  1LO5 D;  1TJE A;  4ITK A;  4ZYS A;  5HHD G;  2R61 A;  1ET6 A;  3KWL A;  2WXK A;  4KKI A;  4MM3 B;  1ET9 A;  1VZ7 A;  3O13 A;  1HQR D;  2V3P A;  4A6Q A;  4CQN A;  2BTE A;  1BML C;  2DWQ A;  1AYF A;  2MJE A;  4XDD A;  3WCQ A;  2WU2 B;  3BZD B;  2LHD A;  3OWE B;  2DLB A;  5AUI A;  1N5W A;  5EE3 A;  3SR6 A;  1L4D B;  3HUI A;  2RDH A;  1V1P B;  4XE0 A;  2GB1 A;  4L1B A;  1ZP0 B;  1SE3 A;  2K3U A;  2NTT A;  3Q8A A;  4YTM B;  1JCK B;  4RGN A;  1F77 A;  1KH0 A;  2NTS A;  3LXF A;  4OZA A;  2LHE A;  4N58 A;  1NEK B;  2V4I B;  4A90 A;  2PTL A;  1V1P A;  1K50 A;  4YXD B;  4WWM A;  2K22 A;  3DWG C;  4MAC A;  3AED B;  1RWS A;  4P16 A;  1FCL A;  1NYR A;  2QMT A;  1NI3 A;  2LFI A;  4HKQ A;  1I4H A;  4L23 A;  1F0Z A;  5GXG B;  2VZK B;  3KLS X;  1EU4 A;  1ZPS A;  1V97 A;  2ACZ B;  1WGK A;  5BYS A;  1ZE3 D;  2N0S B;  5C3J B;  1FM0 D;  4KGR A;  1AW7 A;  1PUT A;  5D3D A;  4ZHP A;  2L83 A;  2IGD A;  4D2K A;  2Y3A A;  4ZOH C;  3HRD D;  1L4Z B;  1RFK A;  1VDV A;  1FFU A;  2QEJ C;  3CIR B;  2DYO A;  3AM9 A;  3Q8C A;  3ZYY X;  5H8Y E;  3BK1 A;  3MP9 A;  3U4E G;  2BS2 B;  5G5G A;  2GRI A;  2V3N A;  2SAK A;  4B0E A;  1R7S A;  3FAH A;  1OFF A;  1XEE A;  3NRZ A;  1EWY C;  2M56 B;  1VZ6 A;  2N7J A;  5JXV A;  1STE A;  2JSV X;  1HZ6 A;  1SBB B;  1YQ4 B;  4C7Y A;  3ZJV A;  2YEP F;  2MJ3 A;  4RGT A;  1TKE A;  2WDV B;  1IBX B;  4KGT A;  3W1S A;  2KAC A;  4GDK B;  1VLB A;  4WUR A;  1KF6 B;  2SEB D;  2PW9 A;  4O1N A;  4YTN B;  1XCQ L;  2HDE A;  2WQY B;  4TQ1 A;  1IBX A;  2LGI A;  3RPF C;  1MI0 A;  1GOZ A;  3B9J A;  1I4X A;  1E6E B;  3KWV A;  3V3X A;  2PVO D;  2E6X A;  3I57 A;  2EKI A;  3GB1 A;  2QIE B;  1E10 A;  4A8X C;  1DOI A;  1OQR A;  1YJJ A;  2WP9 B;  2WXO A;  1C4A A;  1KLU D;  2YEP B;  1JWA D;  4NAM A;  2L52 A;  2KDM A;  4GLS C;  1T5X D;  3AB5 A;  3MC0 B;  3BYT B;  1CK1 A;  2BB6 A;  3NVW A;  1F2R I;  2WXG A;  2BT6 A;  1J7B A;  4KX6 B;  2AX5 A;  1JRO A;  3P4S B;  1AWD A;  1NEN B;  4RGO S;  2INN E;  3SFE B;  2RDG A;  4YWG G;  2H89 B;  4NAW B;  3GS2 A;  1SIJ A;  2AQ2 B;  1XF5 L;  4OVZ A;  1E9M A;  1K51 A;  3AE3 B;  4EE2 A;  2WXR A;  1YNT E;  1J7A A;  2TSS A;  2QJL A;  3DWM A;  2ICI A;  3MHZ A;  4P6V F;  4RF1 A;  2KMM A;  1C76 A;  2I2Y A;  1UUP A;  1C77 A;  2PKO A;  2QIL A;  3GP7 A;  2N9L A;  1FNW A;  2BS4 B;  4DQO C;  3EGR A;  1HXY D;  1T6B X;  4M0W A;  2W3R A;  4C7Z A;  2FBW B;  1L5P A;  1TY2 A;  1ZXI A;  2WS3 B;  2IJ0 A;  2WU5 B;  4IKG A;  4HJG E;  3AH7 A;  3IT4 B;  5BMG A;  2N9K A;  3W9C B;  1C4P A;  3PZ7 A;  4N59 A;  3U7Z A;  5BYQ A;  4RH6 A;  3TEX A;  2M0A A;  3ZJT A;  1SSN A;  3I9V 1;  1SEB D;  2WXL A;  1YN3 A;  3CWI A;  1L0V B;  4PT5 A;  1VR9 A;  3AMZ A;  1DOX A;  2L1A A;  2W54 A;  4NJC A;  2FUG 1;  1ZUD 2;  1ACC A;  3IAS 1;  1WRI A;  4OZB A;  1JRP A;  5HFY A;  3NS1 A;  2JWU A;  3AEF B;  3ZGZ A;  1PGB A;  2H88 B;  4ZHO A;  1P7E A;  2J53 A;  3T3O A;  3FIL B;  3Q69 A;  5FK9 C;  4IOI E;  4MH8 A;  5HI1 A;  3P63 A;  1ZOY B;  4ZRP A;  1FRR A;  1QIL A;  3FIL A;  1EWC A;  1Q10 A;  1XLN A;  5EE1 A;  2Y5C A;  4KGS A;  3TEZ A;  1TS2 A;  1FD6 A;  4TQ0 A;  1K53 A;  2WNM A;  1GB4 A;  4N6E B;  2PIA A;  2CJN A;  3Q8F A;  3TEW A;  4AQ7 A;  1QOG A;  1QQR A;  2J4X A;  3NVV A;  4WQM A;  4IDI A;  1N60 A;  2QSD A;  3AEE B;  1HEZ E;  4FXC A;  1UWM A;  3B2F A;  1ENF A;  5D3I B;  3IAM 1;  1N61 A;  3BVG A;  5AUK A;  2CJO A;  4USA A;  2E3T A;  3P4Q B;  4XWT A;  1ZDX A;  5TSS A;  4UDU C;  1PYW D;  3BWU D;  3MJ5 A;  2I38 A;  4YSX B;  3EA6 A;  1WWT A;  2IDY A;  3RFZ B;  1C79 A;  4RFB A;  1NYQ A;  2LMC A;  1VJK A;  1B9R A;  1CQV A;  1IGD A;  4LTU A;  2K0P A;  1PDX A;  1SJE D;  3BYY B;  3B2G A;  1L6V A;  5C2T B;  1QOB A;  2Z8L A;  3E9S A;  1DOY A;  3KQ4 A;  3LYY A;  1K52 A;  2Y5P A;  2WDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...