3Q69A

X-ray crystal structure of a mucbp domain of the protein lba1460 from lactobacillus acidophilus, northeast structural genomics consortium target lar80a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
MIEPIKRTQVVTQTIHYRYEDGAVAHDDHVVSLIFTQSGKRDLTNGKEIWDSKWSLTQTFEALPSPVIIGYTADKPMVGPDEVTVDSKNFLDKQNREETVIYSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of a MucBP domain of the protein LBA1460 from Lactobacillus acidophilus, Northeast structural genomics consortium target LaR80A
rcsb
source organism Lactobacillus acidophilus
molecule tags Metal binding protein
molecule keywords probable Zn binding protein
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3q69A00
4MT5A 2LFIA 3NZ3A 3Q69A 3LYYA 3I57A
chains in the Genus database with same CATH superfamily
1UWXA 5T8IA 5IO9A 4YTNB 3SR6A 2J0KA 3VHTC 2NR2A 1JCKB 3AE4B 4ZRKA 2BB6A 2BTEA 1WXVA 1HE8A 1VCBA 3AU5A 1A5RA 3L13A 1RAXA 3TEYA 4BZAA 1VRAB 2LGXA 1TS2A 3GE3C 2CKHB 2NMQA 2CU1A 1XEEA 4JGHB 3RNBC 4KDLB 3EECA 4W9EA 1L7YA 3L17A 1HA5A 4MT5A 2W3SA 4OZCA 1V80A 4S17A 2MBQA 2RSUA 3JW0X 1TT5B 4P6VF 2MP2A 3VAWA 5TSSA 3MHSD 4IWQA 2JWZA 4PT5A 4BKSD 4GDKA 2B3AA 2DAJA 2KDIA 4GMVA 2NBWB 3DQVA 3I57A 1MI0A 1WYGA 3SFEB 1WGKA 3ZNGC 2AWTA 1SJHD 4LTUA 1V81A 3R66C 5IAAC 1P0RA 2WX1A 1YQBA 3A9JA 3UQAA 5HKHA 1GB1A 3PO0A 4XDCA 1T5XD 2PEAA 3RULA 5CX3A 2RPQA 1SIFA 2KWDA 1QOFA 3AEDB 4MJSB 1J19A 4YT0B 1JWUD 1WF9A 4F8CB 1X1MA 1WRDB 2D10A 4DXFA 2ZW1A 4KDIC 4AQ7A 2FCNA 2MCNB 3TSSA 2ASQA 3W1YA 3VTVA 3B9JA 2K6DB 3VVWB 4DHZE 2J53A 4L23A 2V4LA 2ZPYA 1R4NI 1GB4A 3APFA 1UWMA 1WX8A 1WGGA 2LJIA 2MBHA 4C4VA 2D3GA 4HKQA 3RD2A 2LXCA 2I1KA 2KNBA 2IGGA 3P2BA 2D07B 3V05A 1L2NA 3BVMA 3AE6B 4AWJA 4G3XB 2PE6B 2VH2A 3U4EG 1V49A 4LNOA 2N9KA 2R2QA 5C3JB 4MSMB 1N62A 3NG0A 5IA7A 4NAWA 2CHXA 4KZ0A 2INNE 3Q8AA 4ARIA 1KRHA 2YLMA 2AQ2B 4GGQA 4AS1A 3Q6BA 1J7CA 4RF0A 5HG2A 2C7NB 1YN4A 1AYFA 2E3TA 1FNVA 1V8CA 1OQRA 2GOWA 2LFIA 2CJOA 3B1LX 1XF5L 2ZNVB 2ZNVC 2LGYA 1WE6A 3OLMD 1UGMA 5G2NA 1KF6B 1PQSA 3APCA 4IKGA 3V3XA 2O2VA 4KGRA 4RGTA 4CHKA 4EZJA 1QQRA 4ZDVA 2GRIA 4K7WA 1RYJA 1V5TA 1YD8U 2K8CA 2J0JA 3P4QB 3VUXA 2LVPA 5FR3A 4EEWA 3NVVA 5E6PA 1F2RC 2XBBC 1KFYB 1ISNA 3PPAA 2NTTA 5AZFA 3ZTCA 1I35A 5AUIA 3JSVB 2K0PA 2LJ5A 1SF0A 4YSZB 1K50A 1EF5A 4LCDE 3C0RB 2WDQB 1E90A 4OZAA 2JYEA 4JWSC 2EMSA 3FKYA 1EF1A 4DK5A 4LDTB 4N9F4 1KTKA 3PHXB 2MA9B 4JQWC 2K39A 3DBRI 1TS4A 2SEBD 5JXVA 1XO3A 4TKNA 3UGBB 3ZNHB 2H89B 3ZW3A 3S2AA 5AZGA 1J7AA 2GBNA 2O6VA 1A70A 4W9DA 2AQ3B 3ZRFA 3ZXRA 2Y5CA 1ESFA 2KXJA 2WHIA 2GBJA 4K1RB 5HI1A 1YJIA 2N9PC 2KHWB 1XCTL 1TS3A 2L83A 2ZJDA 4LNFA 2PLPA 3P4PB 2Y5PA 5EE1A 1MVKA 1Z5SB 5JH5C 2PVOD 3W1SA 5BYSA 3HUIA 4B0EA 4MGKE 4FJYA 1FRDA 3RZWC 3N20C 5H8YE 5E6JA 5JZEB 2JRIB 4GN1A 2GMIC 3BWUD 1KLVA 4NJ6A 2L76A 3WALA 1E8ZA 1TZ1A 1SJED 3DWGC 4WWMA 5AZHA 1DOYA 2GB1A 1GC6A 2K1FA 3KUZA 2AEHA 3UIOB 3TUOA 5CTRC 1VR9A 1YN5A 4RMAA 3HK0A 2D3AA 1KOTA 4EKUA 2C60A 2FBWB 1IGDA 4MGIE 2FUG1 1PFDA 1WY8A 2JWUA 2N7EA 3A9JB 1OQYA 3DHIC 1WWTA 1WYWB 2D3BA 2UWQA 2M0AA 4LK0M 3FILA 2LUMA 1D5XC 4AUQC 2JRHA 2BT6A 2KDBA 3CIRB 4M8MA 4KKIA 3AE1B 2W82A 1Z2MA 3BVGA 4HVBA 4KIKB 2I2YA 2N9EB 5BMIA 4DDGD 4GDLA 2RDBC 2WDRB 3DBHI 4EZKA 2QCZA 2BYEA 1GAQB 2AYOB 1JWAD 2KFJA 3EA6A 3L4PA 2WNMA 2WXGA 2LI5A 3RN9C 5L95C 4IC7B 1SIJA 4M00A 4Q2JA 3T3OA 2QSDA 2WYQA 4B6WA 4LJPB 2RD0A 4ASWC 3W5UB 1GJZA 3IXSA 1N6ZA 3MP9A 3ML9A 1VLBA 3QQ8B 4FADA 3ZNID 4BKTA 4AJWA 2K5PA 2C9WB 2BPSA 1JRUA 2KD0A 1YJJA 2O6VD 4R3DA 2KMCA 1UBQA 1PGAA 1IP9A 4ANWA 3IVFA 4M0WA 3GS2A 1LGRA 5JHBA 4MH8A 3CWIA 5CHVC 4N59A 1V6EA 3W2DA 3KW5B 3U7DA 3QHTA 4KZCA 1QILA 4GU2A 4N6EB 1WJ6A 2E6XA 2AL3A 5BMGA 4NQKE 2Y5BB 4DHJB 2CJNA 1BMLC 4MGYE 5BO4B 1ACCA 4HPMB 4P16A 3Q3OC 1JROA 1NI3A 4TMAB 4GIVA 5G5GA 1UF0A 1ET6A 1L4DB 2QJLA 3A1QB 4HWIB 2L00B 1TJEA 1SE4A 2J52A 2R61A 1WGRA 3ONSA 5KHQA 4A90A 3AE8B 3U2SC 4DXGA 2JF5A 1WGDA 2ZCCA 1HTOA 3VXWA 2L52A 2WGSA 4TUUA 1WM3A 2M56B 2DNFA 3EHVA 4G50A 1WZ0A 3MFGA 2DX5B 2FCQA 2PTLA 4TV3A 2BW2A 1JWBD 1S1QB 1E7VA 3NY5A 4NY0A 2BQQA 5DPWA 1V1OA 2XK5B 2KC2A 4BOSC 1WGYA 1OQQA 2V4IB 3AEAB 3DHGC 3U30A 1YJ1A 1WX9A 2KWUB 1WI0A 2WXMA 3OJ3A 1KLUD 1NBFC 3RNGC 3L16A 3WCQA 3Q8EA 3UINB 2LHEA 1WZ3A 3AB5A 3B2FA 1XLOA 1WM2A 1E8YA 2FUHB 5C2TB 2BYVE 3KH0A 1WIAA 4WJOA 2ZZPB 2IYDB 3M63B 4WURA 2J4XA 1KJTA 1ET9A 3ZNZB 2D11A 3BY4B 3AH7A 2MJDA 1RWSA 3AI5A 4HEA1 2VZKD 4C7ZA 2KYWA 5AUKA 3RZFA 3N1YC 2FNJB 4II2B 4RM8A 2CHZA 3WAMA 2MH7A 3VQIA 1C77A 5FKAC 4W9JA 1ZKHA 2V3NA 3IAM1 3PT2B 4AJYB 4B0MA 2N9XA 5AEKB 3NZSA 1M4VA 3J9CA 4JE3B 3CSFA 3TL5A 2G4DB 4XDDA 1NYRA 2NPTB 1ZGUB 2WXRA 3CF6E 3DVGY 1GG3A 2QILA 1WXMA 1TY0A 1C76A 4NJ7A 5H92C 1P1AA 2LEKA 4HJKA 1HXYD 1UUPA 1E5WA 1L6UA 3E9SA 3AE2B 2EELA 4XX5A 2W3RA 1Y56A 4K81A 2C7HA 1WR6E 3AECB 3PRPB 1R4MI 4IWPA 1FNUA 2BBCA 3Q8BA 1ZUD2 2DHZA 2NTSA 3PZDA 3KWLA 2W55A 4JPSA 3QAQA 1C4AA 4PS8A 2KQ7A 3K9PB 2XK5A 4BBNF 3L10B 2IJ0A 4ZHPA 1IYFA 3A1QA 1QLBB 1K51A 2WXQA 4JL9A 2MBOA 3O13A 1ZXHA 1I7HA 2KJHB 3OG5A 1ROEA 3DVNV 4XYCA 1DOXA 1T0SC 3N1XC 4FLHA 4E74A 3HHMA 1P9DU 2HD5B 2FCMA 1FXIA 4FA6A 2WWZA 4HK2A 3PRMB 4ARCA 1HZ5A 2KN5A 4JLCA 3FAHA 1YX5B 3N9YC 1SGHA 4HKZE 2WXNA 1FD6A 3WIMA 1TGZB 2JU6X 4A55A 4NJCA 1AARA 5LNK1 1D3ZA 4LNNA 4F1SA 2DENB 1YIWA 4W9KA 1FFVA 3ZJTA 4N58A 4I6PA 2H88B 2VRRB 2YEPF 1ZXIA 2WS3B 3Q8CA 3NJTA 2M17A 4C00A 4XGAB 4EUTA 1SE2A 3VH4B 5GMVA 3PSEB 4ZRPA 1T3QA 4DXAB 3Q2AC 1HEZE 4AOFA 4NNJB 2HJ1A 1E6EB 2JZZA 3H7PA 5D3DA 3R3MA 1TKEA 1SXTA 3DBHB 2BWFA 5C23A 1D5ZC 3N1ZC 3H7SA 2KX3A 4WWOA 2ZVOA 3B2GA 2LWPA 5J2RA 3KUCB 3N3KB 1CMXB 4DDID 4ZOHC 4REZA 2RMMA 3NVWA 3U8ZA 1V86A 4YXDB 2WQYB 4PK1A 2BYFA 4W9GA 1OEYJ 1D5MC 1QKZA 2HE7A 1BT0A 3KWVA 3H7PB 3PREA 1MFWA 1C4CA 2LGDA 3T3NA 4WWNA 1WXAA 3RPFC 3VTUA 2LZ6A 3NS1A 3NOBA 3MC8A 1DGJA 2WP9B 3APDA 2GBRA 3BK2A 3K9OB 2MWSB 3UF8A 2Y3AA 1C9FA 2BWES 5JHAA 1J7BA 3MTNB 3MJ5A 1NEKB 4E3CA 2KLCA 4IOIE 3TBLD 1YNTE 4W9HA 4P1BC 2WXIA 3QCAA 1KM7A 2IDYA 2KWVB 3Q14C 4TQ1A 4B9KA 5G5HA 1RLFA 1BUIC 1YMHE 4WAAA 2G1EA 1F1HA 2JX5A 2WXPA 2KWCA 3ZIMA 2MBEA 4USAA 2D2QA 3RFZB 4ANVA 1V9JA 2DYBA 4H2AA 1FXTB 4C56C 4NQLB 2KKCA 1DYQA 1OTRB 2WXHA 3IG3A 2KTRA 2L0TA 2NCNA 1Q10A 4M0WB 4NPNA 4RGNA 4ICUA 3KVFB 3RI7C 3MC9A 4JX1C 3FILB 4A9AA 3LJ3A 1QOGA 2IGDA 2KDMA 2BS3B 4MEMA 2KDFB 2D5GA 2L3ZA 1F2RI 3A4SC 2QDFA 4HLEA 2INCC 3IT4B 2REXA 4WIPA 1T0RC 3VUWA 4ZRIA 2OJRA 2IY0B 2A5UA 4L2YA 4KX6B 3LDZE 1XLNA 5LLIA 1XLQA 3SU8X 2XNAC 3AEBB 2DZMA 2JT4B 3PGEA 3AE5B 5J17A 4OHJA 3V60A 3DBRB 3PZ8A 2MLBA 4DBGA 2EKEC 2RGFA 3ZJVA 5IKCM 3VR8B 4A20A 4A6QA 2NS5A 2TSSA 1YOVB 2WXOA 1FM0D 3N30A 1I4QA 1E7UA 2KK8A 2K22A 3HM6X 4HPLB 3DVNU 4UDUC 1J0GA 2Z8LA 2MP2B 4MSQB 4KIKA 5FR6A 1TZOA 1SBBB 1FEHA 2GI9A 2L8JA 2INPE 1VZ7A 1R4NB 3RT3B 1QOBA 1TKYA 2JZ3B 4RGOS 4HDQA 4K3BA 3ZQ4A 5TR5A 4M8NA 5MPOA 2EMTA 4S0RA 2L1AA 1FNWA 4CO7A 1E8XA 2M8SA 3BZDB 5LXIB 2FE8A 3V6CB 2BVCA 2WXKA 3BINA 3VRBB 1IGCA 4D2KA 1TKGA 2CS4A 3NZUA 2DZIA 1IUEA 4BFRA 3E56A 3ENEA 2NPTA 2XEWA 4I6LB 3AV8A 2LGSA 4PYUA 2MW5A 2DZJA 2WU5B 3P42A 2ONQA 4MM3B 5BYQA 1Q1OA 2KACA 4FHJA 2XN9C 3P63A 4US8A 4EZLA 1R4MB 4A3OA 2V3SA 1LM8B 3RMKC 1MHHE 4XE0A 1E7PB 1MJDA 1AW7A 2C5LC 3AE3B 2RR9A 3ZO5B 1ZOYB 4ZYNA 2RPVA 4ZYSA 2GLSA 2BS2B 3RNAC 3PZ7A 3ETRA 4K7UA 5D2MB 3QWZB 2Q5WD 2NBUA 4OZBA 2OHFA 3MC0B 3I9V1 3DBLB 1UELA 3B0AA 4DHZB 1CZPA 1Y8RC 2KMMA 1C79A 5CHFA 1T0YA 2KJRA 1VZ6A 2PJHA 5EE0A 4WH4A 1VJKA 1UD7A 4LJOB 2K8HA 1B1ZA 1WE7A 1I4RA 3GOEA 1ZE3D 1N63A 1VD2A 5LXHA 2UYZB 4GDLB 4FXCA 2ZPNA 1QZEA 1AN8A 2N0SB 2KVRA 2ACZB 3R7RA 5I4DA 4J6IA 5DPSA 2PW9A 3VTWA 2MJEA 3ZJUA 1XLPA 5HFYA 3URYA 1XQQA 3VH3B 3EFUA 2IO1B 1FFUA 1PGXA 4BBNC 4ICVA 4MGZE 3IT6B 3LYYA 4C80A 2IGHA 4DQOC 1D6EC 3W5VB 3Q3NC 5DCNA 4IG7B 1RM6C 1JALA 3PS6A 2FIFA 2IO3B 4IUMB 4NAMA 2V3PA 4PYZA 4BKGA 3C19A 4GOCA 3NZ3A 4HRSA 2DBYA 2KTFA 1K8RB 3B08A 2M19A 3VFKA 2WXLA 5CHWA 1RFKA 4WJPA 1WMHA 3W9CB 2LXAA 4KVGB 5EDSA 1ZP0B 2KZRA 4YSYB 3KUDB 3V62A 3NS8A 4BVUC 2KAJA 1HZ6A 2BB5A 1UGJA 3TEZA 1QOAA 4O1NA 1RFAA 5IP4D 5BMHA 3L08A 3NUHB 1D4BA 4MELA 3CMMB 1F77A 4M02A 2LVOA 1L0XB 1WJ4A 3WAPA 2NVUI 3ZUNA 2MQJA 3Q69A 1JMLA 3UI3A 3P4SB 3PRZA 3A9KB 3LB8C 2LRWA 3ZXVA 3ZVVA 1UH6A 2LVQA 2I1JA 4A8XC 2N9LA 3LXFA 3MJWA 3DPDA 1M94A 2A4ZA 4ACFA 3AXCA 1FRRA 2K25A 5J18A 1E9MA 2HTHA 1SB3C 2DYMA 1T0QC 4FJVB 1OEYA 2AX5A 2K8BA 4NAWB 2DAFA 4MM3A 4W9FA 2MSED 3NVZA 3GB1A 1K52A 4RGMA 2I38A 5D94A 2JYTA 1Q5WB 2MEKA 3PVLA 4IWOA 2JPHA 2HJ8A 4F7ZA 3M95A 2WXJA 2KFKA 3ALBA 4BAXA 3OJ4B 2JXTA 1PYWD 3R2IA 1VZ8A 3T8MA 2JZPA 1JW9D 5D6JB 2KLGA 3HM3A 1C78A 3RYTA 2IBIB 3X23A 3ZGZA 1FO4A 3QARA 1C1YB 1IPGA 4ZRJA 1U4AA 3DOWA 1LQBA 3ZDTA 2MRPA 4G0NB 1L4ZB 4DWFA 2KTRB 3IAS1 3VRAB 5IOIA 2J0MA 1SE9A 1FCLA 1L5PA 4C4VB 3ZRCA 2X8XX 4EOYA 1WSPA 2JSVX 3AEEB 4XC2A 1MG8A 2KMAA 3AULA 4E71A 1L0VB 4FN2A 3Q8FA 4JIOU 1WXSA 3BK1A 2LHDA 4KGTA 4XZ4A 5DPRA 3RNFC 4IM0A 4A3PA 3M3JA 4G11A 4IDIA 2DWQA 3QK0A 1FXAA 2O2VB 1T6BX 4CYEA 1V1PA 1MPEA 2VH1A 3IHPC 2ZCBA 3N32A 1H8CA 2KVZA 1GOZA 3SDLC 1N61A 1N60A 3JVZX 4AP4C 3OAWA 3BIID 3RNCC 1YQ4B 3DBSA 4RCOA 2LMCA 3GE8C 2PIAA 1GPXA 3SHQA 2JUOA 3JSVA 3PHWB 2FIDA 3TEXA 1S3SG 3GZNI 1QT9A 1NVID 2L32A 1JWMD 3KYCD 1ZPSA 3NVYA 1EWCA 1YQ3B 3MHZA 1K53A 1I4GA 4LNKA 2CR5A 2G4SA 2M1MA 2O6VB 4CQNA 3QX1A 5KHOA 1LXDA 3V61A 3PTFC 5E6NA 3ZYYX 1EM7A 5C1ZA 2OEDA 1EO6A 3ZDMC 2QC8A 3ZKJC 2IPKD 2WX0A 1L6VA 3WA0A 2WXFA 3I5JC 4WJNA 1IBXA 3M62B 2BKFA 1NI2A 5D3IB 4C7YA 4IM3A 3IBEA 3VR9B 3H8HA 4RH6A 4OVVA 3A4RA 4BOZB 2FAZA 2KFKB 3C8YA 2LRUA 2IO2B 3NHEB 3IFWB 4US9A 2G9HD 1FPYA 1UNSA 4P1CC 2N7DA 2YEPB 3T9LA 2PMVA 4LNIA 2ICIA 3SEBA 3WAOA 4HXDA 4OVUA 3P1MA 3D32A 5DPTA 4WQOB 2KX0A 2BS4B 3DDCB 4KKJA 4W9LA 2KN4A 4GDKB 3I63C 1GUAB 2KJ6A 3EC8A 4ZRQA 1H4RA 5FK9C 1SEBD 2ZEQA 1OGWA 3UQBA 3U52E 2N7JA 3O65B 2VZKB 4GXBA 1STEA 2C7MB 1N5WA 4WAFA 2L05A 3V6EB 3Q3FA 3R8BA 4KV2A 1F0ZA 2ZVNA 1WH3A 3ABVB 1I4XA 2ON8A 1NENB 1SSNA 2X38A 2YVCA 2QEJC 2KANA 4KSKC 3BYTB 1XT9B 3A33B 2N1WA 3A9KA 3AU4A 2B76B 3BYYB 4J3OD 1F52A 4ANXA 2J42A 1FCCC 1RRBA 1TBEA 1GC7A 1LFDA 3R2TA 4BKSA 3DVGX 4QAYA 2AL6A 1WXQA 1YX6B 2QIEB 3L54A 2INDC 2DYOA 1MG4A 3PV1A 2L0FA 3QJZA 5E6OA 1F9JA 2J7QB 1KH0A 1V5OA 1P3QU 4YSXB 2HDEA 2KQSA 2KOXA 4KSLC 2PE9A 5EE9A 2LASA 1UBIA 3TEWA 1TIFA 2EKIA 3DCGA 4TSSA 1ZW7A 1V97A 3DWMA 1XXGA 1L0YB 1TTNA 1CK1A 2GBKA 2RDGA 1E10A 4RNAA 2OJWA 3EGRA 1P7FA 2WU2B 3WANA 1TY2A 4WQMA 2Z0DB 4HROA 4MJSA 4TQ0A 4FULA 3EFCA 1IBXB 1TS5A 4ITKA 1EU4A 3VUYA 2QHOA 2K6QA 4FJZA 4XWTA 4MDKE 1DOIA 4X57B 3ECIA 2V0GA 2BGFA 3HVZA 2CU3A 1UZXB 4MH0E 1R7SA 3AM9A 4XWWA 1WGHA 4URKA 3AN1A 3KLSX 1G6JA 4IW0A 1WFYA 4EE2A 2R2OA 3KQ4A 4OW0A 1V2YA 5EE3A 3ZLZA 3QA8A 1QF6A 3RNEC 2M4NA 4WJQA 4YWGG 3HVDA 3JYUA 3L0WB 5IN7A 2QMTA 2CHWA 2KT7A 1I4PA 2FCSA 1OFFA 1FIQA 2IZVB 3KYDD 2KDEB 1VDVA 3X0WA 1ENFA 4KGSA 4RFBA 2JY6A 1HTQA 4K3CA 1HQRD 1Q0WB 4RF1A 3R7QA 2AQ1B 1J8CA 3GP7A 3DBLI 1WJNA 2KO3A 3Q3JA 5G55A 3TIXA 2JVCA 2BF8B 3Q3MC 3AEFB 4FHKA 4LLGM 3EUB2 5L83A 4K7SA 1EWYC 2MX2A 2W54A 1EUVB 2M0XA 4EFOA 4W9CA 3RCZA 2LGIA 2IY1B 3AE9B 3TJPA 4JWUC 4IM2A 4MACA 4HPPA 4W9IA 2L7RA 2PPHA 1E0ZA 3GZNB 1WX7A 2DLBA 4WWPA 2LUEA 2NBVB 2KC1A 2HTME 2MHJA 2JQRB 4L1BA 4YTPB 2G3QB 2PKOA 2LD9A 3P4RB 2OOBB 3NRZA 1E8WA 4HCPB 1MHXA 3U7ZA 3PLVA 2ZW0A 2GBMA 3H9DA 3OWEB 4B95A 1BXTA 2KQ4X 2W9NA 4P7IA 4NZLB 2BKRB 2V9HA 2DZKA 1ZDXA 4OVZA 1P7EA 2G45B 2PVGC 3UIPB 1JWSD 1P98A 4DHJD 2Z59B 1C3TA 4RM9A 1NYQA 2MBBB 2JXXA 3DHHC 1I4HA 2RDHA 3AE7B 3AMZA 3BVZA 3ML8A 1WR1A 2K3UA 3QIJA 1SE3A 1XD3B 1KLGD 3SD5A 3H1UA 1ZDVA 2WLBA 3I3TB 1V1PB 4GLSC 1TYGB 1GNUA 1PGBA 3PLUA 3CSTA 4ANUA 2WDTB 2D3CA 2IO0B 3HIZA 2SAKA 2MJ3A 5BYRA 4HJGE 3FC4A 4LDTD 5GXGB 5HHDG 1NDDA 1AWDA 2N4FA 2K9XA 1JRPA 1B9RA 4YTMB 1FMAD 3QC8B 1JQ4A 4M01A 3RUIB 3TCAA 1C4PA 3ZTDA 4HDOA 3W1SC 1WMHB 1CQVA 4HCNB 3AEGB 1CJEA 1WJUA 1EU3A 3SFDB 4YL8A 4FBJB 2V1YA 1PUTA 3H6NA 2N1VA 2WDVB 5D7GA 1N5XA 3HRDD 1XCQL 4PS3A 4GSWA 1LO5D 1YN3A 1PDXA 4II3B 4GB9A 4I6NB 3VDZA 1WRIA 2Z0EB 2BYTA 4ZHOA 1I42A 3TMPB 2UU7A 4PS7A
chains in the Genus database with same CATH topology
1UWXA 2CJNA 2K22A 4YTNB 1BMLC 5T8IA 3SR6A 4UDUC 2IPKD 1ACCA 2Z8LA 4P16A 1JROA 1JCKB 3AE4B 1NI3A 4TMAB 1L6VA 2WXFA 1IBXA 1TZOA 2BB6A 5G5GA 1ET6A 1SBBB 2BTEA 1FEHA 1L4DB 2QJLA 2GI9A 1TJEA 2INPE 1SE4A 1VZ7A 5D3IB 2J52A 4C7YA 2R61A 1QOBA 1TKYA 3VR9B 3H8HA 4RGOS 4RH6A 4A90A 3TEYA 3AE8B 1VRAB 3U2SC 4DXGA 3C8YA 3ZQ4A 1TS2A 2NMQA 1XEEA 2L52A 5MPOA 1HA5A 4MT5A 2W3SA 4US9A 2G9HD 2L1AA 1FNWA 4OZCA 1UNSA 2M56B 3BZDB 2YEPB 3MFGA 2FE8A 2WXKA 2PMVA 3VRBB 1IGCA 2ICIA 2PTLA 4P6VF 2BW2A 4D2KA 5TSSA 1TKGA 3SEBA 1JWBD 1IUEA 4PT5A 3E56A 3P1MA 3AV8A 1V1OA 3P42A 2WU5B 2BS4B 2ONQA 4KKJA 3I57A 1MI0A 4MM3B 1WYGA 3SFEB 1WGKA 5BYQA 2KN4A 4GDKB 1OQQA 2V4IB 2KACA 3AEAB 4ZRQA 1SJHD 4LTUA 5FK9C 1SEBD 2XN9C 3P63A 3U52E 4US8A 2N7JA 2WXMA 1GB1A 3PO0A 4XDCA 1KLUD 1T5XD 2VZKB 3WCQA 3Q8EA 1STEA 4WAFA 1N5WA 2LHEA 1MHHE 2KWDA 1QOFA 3AEDB 4XE0A 3R8BA 3AB5A 1E7PB 3B2FA 1AW7A 1F0ZA 3AE3B 4YT0B 3ABVB 1JWUD 1XLOA 1I4XA 2ON8A 1ZOYB 5C2TB 1NENB 2RPVA 4ZYSA 4DXFA 2BS2B 2ZW1A 1SSNA 4AQ7A 2X38A 4WURA 2J4XA 3PZ7A 2QEJC 3ETRA 3TSSA 1ET9A 2Q5WD 4OZBA 2OHFA 3MC0B 3BYTB 3I9V1 3B9JA 3AH7A 2MJDA 1RWSA 2J53A 4L23A 4HEA1 2VZKD 1CZPA 4C7ZA 2KMMA 1C79A 1GB4A 5AUKA 1VZ6A 5EE0A 2B76B 3BYYB 1UWMA 4WH4A 4J3OD 2LJIA 1VJKA 2J42A 1B1ZA 1FCCC 1I4RA 4HKQA 1ZE3D 1N63A 4GDLB 2MH7A 3VQIA 1C77A 2IGGA 4FXCA 3R2TA 1AN8A 5FKAC 2N0SB 3V05A 2V3NA 2ACZB 3IAM1 5I4DA 3BVMA 3AE6B 1WXQA 2PW9A 4B0MA 3U4EG 2MJEA 2QIEB 2N9KA 3ZJUA 1M4VA 3J9CA 2DYOA 5C3JB 1N62A 1XLPA 5HFYA 3URYA 4JE3B 1KH0A 2INNE 4XDDA 1NYRA 3Q8AA 2WXRA 4YSXB 2HDEA 1FFUA 1PGXA 5EE9A 2QILA 1TY0A 4ARIA 3IT6B 1C76A 1KRHA 3LYYA 3TEWA 5H92C 2EKIA 4C80A 2LEKA 2AQ2B 4AS1A 4TSSA 1HXYD 2IGHA 1J7CA 1V97A 4RF0A 1D6EC 4DQOC 3W5VB 3DWMA 5HG2A 1UUPA 1XXGA 1YN4A 1L6UA 3E9SA 1AYFA 2EELA 1L0YB 1RM6C 3AE2B 1JALA 2E3TA 2W3RA 1Y56A 1FNVA 1CK1A 2RDGA 1E10A 4RNAA 1V8CA 1OQRA 3AECB 3EGRA 2LFIA 1P7FA 2BBCA 1FNUA 2CJOA 2WU2B 1TY2A 1ZUD2 2NTSA 3Q8BA 4NAMA 3KWLA 2V3PA 1XF5L 2W55A 4JPSA 4WQMA 1C4AA 4HROA 3NZ3A 1KF6B 4TQ0A 4HRSA 2DBYA 2IJ0A 4ZHPA 4IKGA 3V3XA 4KGRA 4RGTA 1IBXB 1QLBB 1K51A 2WXQA 1TS5A 1QQRA 2GRIA 4ITKA 2M19A 1EU4A 3O13A 1ZXHA 1I7HA 2WXLA 1RFKA 4XWTA 1RYJA 1ROEA 3P4QB 3W9CB 1DOXA 5FR3A 1DOIA 1ZP0B 4YSYB 2V0GA 3NVVA 3HVZA 2KAJA 1HZ6A 2BB5A 2CU3A 1F2RC 1UGJA 3TEZA 1FXIA 1QOAA 1KFYB 4O1NA 5BMHA 1R7SA 4ARCA 1HZ5A 3NUHB 3AM9A 4XWWA 1D4BA 5AUIA 3FAHA 3AN1A 2K0PA 3KLSX 1F77A 1L0XB 1SF0A 4YSZB 1K50A 3N9YC 4HKZE 2WXNA 2WDQB 3Q69A 1FD6A 1JMLA 4EE2A 3KQ4A 2JU6X 4A55A 4OZAA 2JYEA 4NJCA 4JWSC 4OW0A 5LNK1 3UI3A 5EE3A 1KTKA 3P4SB 1TS4A 1FFVA 2SEBD 1XO3A 3LB8C 5JXVA 3ZJTA 2H89B 1QF6A 4N58A 2H88B 2YEPF 4YWGG 3HVDA 1ZXIA 1J7AA 2WS3B 3Q8CA 1A70A 2AQ3B 2QMTA 1SE2A 4A8XC 1I4PA 2N9LA 4ZRPA 2Y5CA 1T3QA 1OFFA 1ESFA 3LXFA 1HEZE 5HI1A 1FIQA 1E6EB 1VDVA 5D3DA 1TKEA 1SXTA 1YJIA 1FRRA 1E9MA 1XCTL 1TS3A 2L83A 1SB3C 2DYMA 1ENFA 4KGSA 1D5ZC 4RFBA 2AX5A 4NAWB 2PLPA 3P4PB 1HQRD 3NVZA 2Y5PA 3GB1A 1K52A 4RGMA 2I38A 5EE1A 2JYTA 1MVKA 3B2GA 4RF1A 2MEKA 2AQ1B 2PVOD 4ZOHC 3W1SA 3GP7A 5BYSA 3HUIA 4B0EA 4REZA 2RMMA 2WXJA 3NVWA 4YXDB 2WQYB 1FRDA 3AEFB 5H8YE 5E6JA 3EUB2 4LLGM 1D5MC 1QKZA 3KWVA 3BWUD 2JXTA 1EWYC 2W54A 1PYWD 3R2IA 1VZ8A 2JZPA 1C4CA 2LGIA 1JW9D 3T3NA 3AE9B 1C78A 4JWUC 1SJED 3RPFC 3DWGC 4WWMA 4MACA 3ZGZA 1DOYA 1FO4A 2GB1A 3NS1A 1E0ZA 1DGJA 2DLBA 2WP9B 3TUOA 1VR9A 1YN5A 3BK2A 2Y3AA 2FBWB 2HTME 1IGDA 2FUG1 1C9FA 1L4ZB 2JQRB 1J7BA 1PFDA 4L1BA 3IAS1 3VRAB 2JWUA 4YTPB 3MJ5A 1NEKB 2PKOA 1FCLA 1L5PA 3P4RB 4IOIE 1WWTA 3NRZA 1YNTE 1MHXA 2M0AA 2WXIA 3U7ZA 4LK0M 3FILA 2LUMA 1WSPA 2ZW0A 1D5XC 2IDYA 2JSVX 4TQ1A 3CIRB 2BT6A 3OWEB 5G5HA 3AEEB 1BXTA 2KQ4X 4KKIA 4NZLB 3AE1B 1BUIC 2W82A 1YMHE 1L0VB 3BVGA 3Q8FA 2G1EA 2JX5A 1ZDXA 2WXPA 4OVZA 4USAA 1P7EA 2I2YA 3RFZB 3BK1A 2PVGC 5BMIA 2LHDA 1JWSD 4KGTA 2WDRB 1GAQB 4H2AA 4C56C 1DYQA 1JWAD 1NYQA 4IDIA 2DWQA 1I4HA 2WXHA 3EA6A 3L4PA 1FXAA 2RDHA 3AE7B 3AMZA 3BVZA 1T6BX 2WNMA 1V1PA 1Q10A 2WXGA 1MPEA 2K3UA 1SE3A 4RGNA 1KLGD 4JX1C 1SIJA 1ZDVA 2WLBA 3FILB 3T3OA 4Q2JA 4A9AA 2QSDA 1QOGA 1V1PB 2IGDA 2KDMA 4GLSC 1TYGB 2BS3B 1GOZA 1PGBA 3W5UB 2D5GA 1N61A 1F2RI 3IXSA 2SAKA 2MJ3A 1N60A 3MP9A 1VLBA 5BYRA 3BIID 1YQ4B 4HJGE 3FC4A 3IT4B 4RCOA 2LMCA 5GXGB 5HHDG 1AWDA 4WIPA 2K9XA 2PIAA 1GPXA 1JRPA 1B9RA 4YTMB 4L2YA 2K5PA 1FMAD 1JQ4A 4KX6B 3TEXA 1YJJA 4R3DA 1C4PA 1PGAA 1XLNA 1CQVA 3AEGB 1QT9A 1CJEA 1XLQA 2XNAC 3GS2A 4M0WA 1NVID 3AEBB 1EU3A 2L32A 3SFDB 3AE5B 1JWMD 4MH8A 4OHJA 3CWIA 1ZPSA 3NVYA 1EWCA 1YQ3B 1PUTA 3MHZA 3PZ8A 4N59A 1K53A 1I4GA 3W2DA 3ZJVA 1QILA 2WDVB 5D7GA 1N5XA 3VR8B 3HRDD 4N6EB 1XCQL 4A6QA 1LO5D 1YN3A 2TSSA 4CQNA 1PDXA 2E6XA 2WXOA 1FM0D 1I4QA 1WRIA 3ZYYX 5BMGA 2BYTA 1EM7A 4ZHOA 2NTTA 2OEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT5 A;  2LFI A;  3NZ3 A;  3Q69 A;  3LYY A;  3I57 A; 
#chains in the Genus database with same CATH topology
 1UWX A;  5T8I A;  5IO9 A;  4YTN B;  3SR6 A;  2J0K A;  3VHT C;  2NR2 A;  1JCK B;  3AE4 B;  4ZRK A;  2BB6 A;  2BTE A;  1WXV A;  1HE8 A;  1VCB A;  3AU5 A;  1A5R A;  3L13 A;  1RAX A;  3TEY A;  4BZA A;  1VRA B;  2LGX A;  1TS2 A;  3GE3 C;  2CKH B;  2NMQ A;  2CU1 A;  1XEE A;  4JGH B;  3RNB C;  4KDL B;  3EEC A;  4W9E A;  1L7Y A;  3L17 A;  1HA5 A;  4MT5 A;  2W3S A;  4OZC A;  1V80 A;  4S17 A;  2MBQ A;  2RSU A;  3JW0 X;  1TT5 B;  4P6V F;  2MP2 A;  3VAW A;  5TSS A;  3MHS D;  4IWQ A;  2JWZ A;  4PT5 A;  4BKS D;  4GDK A;  2B3A A;  2DAJ A;  2KDI A;  4GMV A;  2NBW B;  3DQV A;  3I57 A;  1MI0 A;  1WYG A;  3SFE B;  1WGK A;  3ZNG C;  2AWT A;  1SJH D;  4LTU A;  1V81 A;  3R66 C;  5IAA C;  1P0R A;  2WX1 A;  1YQB A;  3A9J A;  3UQA A;  5HKH A;  1GB1 A;  3PO0 A;  4XDC A;  1T5X D;  2PEA A;  3RUL A;  5CX3 A;  2RPQ A;  1SIF A;  2KWD A;  1QOF A;  3AED B;  4MJS B;  1J19 A;  4YT0 B;  1JWU D;  1WF9 A;  4F8C B;  1X1M A;  1WRD B;  2D10 A;  4DXF A;  2ZW1 A;  4KDI C;  4AQ7 A;  2FCN A;  2MCN B;  3TSS A;  2ASQ A;  3W1Y A;  3VTV A;  3B9J A;  2K6D B;  3VVW B;  4DHZ E;  2J53 A;  4L23 A;  2V4L A;  2ZPY A;  1R4N I;  1GB4 A;  3APF A;  1UWM A;  1WX8 A;  1WGG A;  2LJI A;  2MBH A;  4C4V A;  2D3G A;  4HKQ A;  3RD2 A;  2LXC A;  2I1K A;  2KNB A;  2IGG A;  3P2B A;  2D07 B;  3V05 A;  1L2N A;  3BVM A;  3AE6 B;  4AWJ A;  4G3X B;  2PE6 B;  2VH2 A;  3U4E G;  1V49 A;  4LNO A;  2N9K A;  2R2Q A;  5C3J B;  4MSM B;  1N62 A;  3NG0 A;  5IA7 A;  4NAW A;  2CHX A;  4KZ0 A;  2INN E;  3Q8A A;  4ARI A;  1KRH A;  2YLM A;  2AQ2 B;  4GGQ A;  4AS1 A;  3Q6B A;  1J7C A;  4RF0 A;  5HG2 A;  2C7N B;  1YN4 A;  1AYF A;  2E3T A;  1FNV A;  1V8C A;  1OQR A;  2GOW A;  2LFI A;  2CJO A;  3B1L X;  1XF5 L;  2ZNV B;  2ZNV C;  2LGY A;  1WE6 A;  3OLM D;  1UGM A;  5G2N A;  1KF6 B;  1PQS A;  3APC A;  4IKG A;  3V3X A;  2O2V A;  4KGR A;  4RGT A;  4CHK A;  4EZJ A;  1QQR A;  4ZDV A;  2GRI A;  4K7W A;  1RYJ A;  1V5T A;  1YD8 U;  2K8C A;  2J0J A;  3P4Q B;  3VUX A;  2LVP A;  5FR3 A;  4EEW A;  3NVV A;  5E6P A;  1F2R C;  2XBB C;  1KFY B;  1ISN A;  3PPA A;  2NTT A;  5AZF A;  3ZTC A;  1I35 A;  5AUI A;  3JSV B;  2K0P A;  2LJ5 A;  1SF0 A;  4YSZ B;  1K50 A;  1EF5 A;  4LCD E;  3C0R B;  2WDQ B;  1E90 A;  4OZA A;  2JYE A;  4JWS C;  2EMS A;  3FKY A;  1EF1 A;  4DK5 A;  4LDT B;  4N9F 4;  1KTK A;  3PHX B;  2MA9 B;  4JQW C;  2K39 A;  3DBR I;  1TS4 A;  2SEB D;  5JXV A;  1XO3 A;  4TKN A;  3UGB B;  3ZNH B;  2H89 B;  3ZW3 A;  3S2A A;  5AZG A;  1J7A A;  2GBN A;  2O6V A;  1A70 A;  4W9D A;  2AQ3 B;  3ZRF A;  3ZXR A;  2Y5C A;  1ESF A;  2KXJ A;  2WHI A;  2GBJ A;  4K1R B;  5HI1 A;  1YJI A;  2N9P C;  2KHW B;  1XCT L;  1TS3 A;  2L83 A;  2ZJD A;  4LNF A;  2PLP A;  3P4P B;  2Y5P A;  5EE1 A;  1MVK A;  1Z5S B;  5JH5 C;  2PVO D;  3W1S A;  5BYS A;  3HUI A;  4B0E A;  4MGK E;  4FJY A;  1FRD A;  3RZW C;  3N20 C;  5H8Y E;  5E6J A;  5JZE B;  2JRI B;  4GN1 A;  2GMI C;  3BWU D;  1KLV A;  4NJ6 A;  2L76 A;  3WAL A;  1E8Z A;  1TZ1 A;  1SJE D;  3DWG C;  4WWM A;  5AZH A;  1DOY A;  2GB1 A;  1GC6 A;  2K1F A;  3KUZ A;  2AEH A;  3UIO B;  3TUO A;  5CTR C;  1VR9 A;  1YN5 A;  4RMA A;  3HK0 A;  2D3A A;  1KOT A;  4EKU A;  2C60 A;  2FBW B;  1IGD A;  4MGI E;  2FUG 1;  1PFD A;  1WY8 A;  2JWU A;  2N7E A;  3A9J B;  1OQY A;  3DHI C;  1WWT A;  1WYW B;  2D3B A;  2UWQ A;  2M0A A;  4LK0 M;  3FIL A;  2LUM A;  1D5X C;  4AUQ C;  2JRH A;  2BT6 A;  2KDB A;  3CIR B;  4M8M A;  4KKI A;  3AE1 B;  2W82 A;  1Z2M A;  3BVG A;  4HVB A;  4KIK B;  2I2Y A;  2N9E B;  5BMI A;  4DDG D;  4GDL A;  2RDB C;  2WDR B;  3DBH I;  4EZK A;  2QCZ A;  2BYE A;  1GAQ B;  2AYO B;  1JWA D;  2KFJ A;  3EA6 A;  3L4P A;  2WNM A;  2WXG A;  2LI5 A;  3RN9 C;  5L95 C;  4IC7 B;  1SIJ A;  4M00 A;  4Q2J A;  3T3O A;  2QSD A;  2WYQ A;  4B6W A;  4LJP B;  2RD0 A;  4ASW C;  3W5U B;  1GJZ A;  3IXS A;  1N6Z A;  3MP9 A;  3ML9 A;  1VLB A;  3QQ8 B;  4FAD A;  3ZNI D;  4BKT A;  4AJW A;  2K5P A;  2C9W B;  2BPS A;  1JRU A;  2KD0 A;  1YJJ A;  2O6V D;  4R3D A;  2KMC A;  1UBQ A;  1PGA A;  1IP9 A;  4ANW A;  3IVF A;  4M0W A;  3GS2 A;  1LGR A;  5JHB A;  4MH8 A;  3CWI A;  5CHV C;  4N59 A;  1V6E A;  3W2D A;  3KW5 B;  3U7D A;  3QHT A;  4KZC A;  1QIL A;  4GU2 A;  4N6E B;  1WJ6 A;  2E6X A;  2AL3 A;  5BMG A;  4NQK E;  2Y5B B;  4DHJ B;  2CJN A;  1BML C;  4MGY E;  5BO4 B;  1ACC A;  4HPM B;  4P16 A;  3Q3O C;  1JRO A;  1NI3 A;  4TMA B;  4GIV A;  5G5G A;  1UF0 A;  1ET6 A;  1L4D B;  2QJL A;  3A1Q B;  4HWI B;  2L00 B;  1TJE A;  1SE4 A;  2J52 A;  2R61 A;  1WGR A;  3ONS A;  5KHQ A;  4A90 A;  3AE8 B;  3U2S C;  4DXG A;  2JF5 A;  1WGD A;  2ZCC A;  1HTO A;  3VXW A;  2L52 A;  2WGS A;  4TUU A;  1WM3 A;  2M56 B;  2DNF A;  3EHV A;  4G50 A;  1WZ0 A;  3MFG A;  2DX5 B;  2FCQ A;  2PTL A;  4TV3 A;  2BW2 A;  1JWB D;  1S1Q B;  1E7V A;  3NY5 A;  4NY0 A;  2BQQ A;  5DPW A;  1V1O A;  2XK5 B;  2KC2 A;  4BOS C;  1WGY A;  1OQQ A;  2V4I B;  3AEA B;  3DHG C;  3U30 A;  1YJ1 A;  1WX9 A;  2KWU B;  1WI0 A;  2WXM A;  3OJ3 A;  1KLU D;  1NBF C;  3RNG C;  3L16 A;  3WCQ A;  3Q8E A;  3UIN B;  2LHE A;  1WZ3 A;  3AB5 A;  3B2F A;  1XLO A;  1WM2 A;  1E8Y A;  2FUH B;  5C2T B;  2BYV E;  3KH0 A;  1WIA A;  4WJO A;  2ZZP B;  2IYD B;  3M63 B;  4WUR A;  2J4X A;  1KJT A;  1ET9 A;  3ZNZ B;  2D11 A;  3BY4 B;  3AH7 A;  2MJD A;  1RWS A;  3AI5 A;  4HEA 1;  2VZK D;  4C7Z A;  2KYW A;  5AUK A;  3RZF A;  3N1Y C;  2FNJ B;  4II2 B;  4RM8 A;  2CHZ A;  3WAM A;  2MH7 A;  3VQI A;  1C77 A;  5FKA C;  4W9J A;  1ZKH A;  2V3N A;  3IAM 1;  3PT2 B;  4AJY B;  4B0M A;  2N9X A;  5AEK B;  3NZS A;  1M4V A;  3J9C A;  4JE3 B;  3CSF A;  3TL5 A;  2G4D B;  4XDD A;  1NYR A;  2NPT B;  1ZGU B;  2WXR A;  3CF6 E;  3DVG Y;  1GG3 A;  2QIL A;  1WXM A;  1TY0 A;  1C76 A;  4NJ7 A;  5H92 C;  1P1A A;  2LEK A;  4HJK A;  1HXY D;  1UUP A;  1E5W A;  1L6U A;  3E9S A;  3AE2 B;  2EEL A;  4XX5 A;  2W3R A;  1Y56 A;  4K81 A;  2C7H A;  1WR6 E;  3AEC B;  3PRP B;  1R4M I;  4IWP A;  1FNU A;  2BBC A;  3Q8B A;  1ZUD 2;  2DHZ A;  2NTS A;  3PZD A;  3KWL A;  2W55 A;  4JPS A;  3QAQ A;  1C4A A;  4PS8 A;  2KQ7 A;  3K9P B;  2XK5 A;  4BBN F;  3L10 B;  2IJ0 A;  4ZHP A;  1IYF A;  3A1Q A;  1QLB B;  1K51 A;  2WXQ A;  4JL9 A;  2MBO A;  3O13 A;  1ZXH A;  1I7H A;  2KJH B;  3OG5 A;  1ROE A;  3DVN V;  4XYC A;  1DOX A;  1T0S C;  3N1X C;  4FLH A;  4E74 A;  3HHM A;  1P9D U;  2HD5 B;  2FCM A;  1FXI A;  4FA6 A;  2WWZ A;  4HK2 A;  3PRM B;  4ARC A;  1HZ5 A;  2KN5 A;  4JLC A;  3FAH A;  1YX5 B;  3N9Y C;  1SGH A;  4HKZ E;  2WXN A;  1FD6 A;  3WIM A;  1TGZ B;  2JU6 X;  4A55 A;  4NJC A;  1AAR A;  5LNK 1;  1D3Z A;  4LNN A;  4F1S A;  2DEN B;  1YIW A;  4W9K A;  1FFV A;  3ZJT A;  4N58 A;  4I6P A;  2H88 B;  2VRR B;  2YEP F;  1ZXI A;  2WS3 B;  3Q8C A;  3NJT A;  2M17 A;  4C00 A;  4XGA B;  4EUT A;  1SE2 A;  3VH4 B;  5GMV A;  3PSE B;  4ZRP A;  1T3Q A;  4DXA B;  3Q2A C;  1HEZ E;  4AOF A;  4NNJ B;  2HJ1 A;  1E6E B;  2JZZ A;  3H7P A;  5D3D A;  3R3M A;  1TKE A;  1SXT A;  3DBH B;  2BWF A;  5C23 A;  1D5Z C;  3N1Z C;  3H7S A;  2KX3 A;  4WWO A;  2ZVO A;  3B2G A;  2LWP A;  5J2R A;  3KUC B;  3N3K B;  1CMX B;  4DDI D;  4ZOH C;  4REZ A;  2RMM A;  3NVW A;  3U8Z A;  1V86 A;  4YXD B;  2WQY B;  4PK1 A;  2BYF A;  4W9G A;  1OEY J;  1D5M C;  1QKZ A;  2HE7 A;  1BT0 A;  3KWV A;  3H7P B;  3PRE A;  1MFW A;  1C4C A;  2LGD A;  3T3N A;  4WWN A;  1WXA A;  3RPF C;  3VTU A;  2LZ6 A;  3NS1 A;  3NOB A;  3MC8 A;  1DGJ A;  2WP9 B;  3APD A;  2GBR A;  3BK2 A;  3K9O B;  2MWS B;  3UF8 A;  2Y3A A;  1C9F A;  2BWE S;  5JHA A;  1J7B A;  3MTN B;  3MJ5 A;  1NEK B;  4E3C A;  2KLC A;  4IOI E;  3TBL D;  1YNT E;  4W9H A;  4P1B C;  2WXI A;  3QCA A;  1KM7 A;  2IDY A;  2KWV B;  3Q14 C;  4TQ1 A;  4B9K A;  5G5H A;  1RLF A;  1BUI C;  1YMH E;  4WAA A;  2G1E A;  1F1H A;  2JX5 A;  2WXP A;  2KWC A;  3ZIM A;  2MBE A;  4USA A;  2D2Q A;  3RFZ B;  4ANV A;  1V9J A;  2DYB A;  4H2A A;  1FXT B;  4C56 C;  4NQL B;  2KKC A;  1DYQ A;  1OTR B;  2WXH A;  3IG3 A;  2KTR A;  2L0T A;  2NCN A;  1Q10 A;  4M0W B;  4NPN A;  4RGN A;  4ICU A;  3KVF B;  3RI7 C;  3MC9 A;  4JX1 C;  3FIL B;  4A9A A;  3LJ3 A;  1QOG A;  2IGD A;  2KDM A;  2BS3 B;  4MEM A;  2KDF B;  2D5G A;  2L3Z A;  1F2R I;  3A4S C;  2QDF A;  4HLE A;  2INC C;  3IT4 B;  2REX A;  4WIP A;  1T0R C;  3VUW A;  4ZRI A;  2OJR A;  2IY0 B;  2A5U A;  4L2Y A;  4KX6 B;  3LDZ E;  1XLN A;  5LLI A;  1XLQ A;  3SU8 X;  2XNA C;  3AEB B;  2DZM A;  2JT4 B;  3PGE A;  3AE5 B;  5J17 A;  4OHJ A;  3V60 A;  3DBR B;  3PZ8 A;  2MLB A;  4DBG A;  2EKE C;  2RGF A;  3ZJV A;  5IKC M;  3VR8 B;  4A20 A;  4A6Q A;  2NS5 A;  2TSS A;  1YOV B;  2WXO A;  1FM0 D;  3N30 A;  1I4Q A;  1E7U A;  2KK8 A;  2K22 A;  3HM6 X;  4HPL B;  3DVN U;  4UDU C;  1J0G A;  2Z8L A;  2MP2 B;  4MSQ B;  4KIK A;  5FR6 A;  1TZO A;  1SBB B;  1FEH A;  2GI9 A;  2L8J A;  2INP E;  1VZ7 A;  1R4N B;  3RT3 B;  1QOB A;  1TKY A;  2JZ3 B;  4RGO S;  4HDQ A;  4K3B A;  3ZQ4 A;  5TR5 A;  4M8N A;  5MPO A;  2EMT A;  4S0R A;  2L1A A;  1FNW A;  4CO7 A;  1E8X A;  2M8S A;  3BZD B;  5LXI B;  2FE8 A;  3V6C B;  2BVC A;  2WXK A;  3BIN A;  3VRB B;  1IGC A;  4D2K A;  1TKG A;  2CS4 A;  3NZU A;  2DZI A;  1IUE A;  4BFR A;  3E56 A;  3ENE A;  2NPT A;  2XEW A;  4I6L B;  3AV8 A;  2LGS A;  4PYU A;  2MW5 A;  2DZJ A;  2WU5 B;  3P42 A;  2ONQ A;  4MM3 B;  5BYQ A;  1Q1O A;  2KAC A;  4FHJ A;  2XN9 C;  3P63 A;  4US8 A;  4EZL A;  1R4M B;  4A3O A;  2V3S A;  1LM8 B;  3RMK C;  1MHH E;  4XE0 A;  1E7P B;  1MJD A;  1AW7 A;  2C5L C;  3AE3 B;  2RR9 A;  3ZO5 B;  1ZOY B;  4ZYN A;  2RPV A;  4ZYS A;  2GLS A;  2BS2 B;  3RNA C;  3PZ7 A;  3ETR A;  4K7U A;  5D2M B;  3QWZ B;  2Q5W D;  2NBU A;  4OZB A;  2OHF A;  3MC0 B;  3I9V 1;  3DBL B;  1UEL A;  3B0A A;  4DHZ B;  1CZP A;  1Y8R C;  2KMM A;  1C79 A;  5CHF A;  1T0Y A;  2KJR A;  1VZ6 A;  2PJH A;  5EE0 A;  4WH4 A;  1VJK A;  1UD7 A;  4LJO B;  2K8H A;  1B1Z A;  1WE7 A;  1I4R A;  3GOE A;  1ZE3 D;  1N63 A;  1VD2 A;  5LXH A;  2UYZ B;  4GDL B;  4FXC A;  2ZPN A;  1QZE A;  1AN8 A;  2N0S B;  2KVR A;  2ACZ B;  3R7R A;  5I4D A;  4J6I A;  5DPS A;  2PW9 A;  3VTW A;  2MJE A;  3ZJU A;  1XLP A;  5HFY A;  3URY A;  1XQQ A;  3VH3 B;  3EFU A;  2IO1 B;  1FFU A;  1PGX A;  4BBN C;  4ICV A;  4MGZ E;  3IT6 B;  3LYY A;  4C80 A;  2IGH A;  4DQO C;  1D6E C;  3W5V B;  3Q3N C;  5DCN A;  4IG7 B;  1RM6 C;  1JAL A;  3PS6 A;  2FIF A;  2IO3 B;  4IUM B;  4NAM A;  2V3P A;  4PYZ A;  4BKG A;  3C19 A;  4GOC A;  3NZ3 A;  4HRS A;  2DBY A;  2KTF A;  1K8R B;  3B08 A;  2M19 A;  3VFK A;  2WXL A;  5CHW A;  1RFK A;  4WJP A;  1WMH A;  3W9C B;  2LXA A;  4KVG B;  5EDS A;  1ZP0 B;  2KZR A;  4YSY B;  3KUD B;  3V62 A;  3NS8 A;  4BVU C;  2KAJ A;  1HZ6 A;  2BB5 A;  1UGJ A;  3TEZ A;  1QOA A;  4O1N A;  1RFA A;  5IP4 D;  5BMH A;  3L08 A;  3NUH B;  1D4B A;  4MEL A;  3CMM B;  1F77 A;  4M02 A;  2LVO A;  1L0X B;  1WJ4 A;  3WAP A;  2NVU I;  3ZUN A;  2MQJ A;  3Q69 A;  1JML A;  3UI3 A;  3P4S B;  3PRZ A;  3A9K B;  3LB8 C;  2LRW A;  3ZXV A;  3ZVV A;  1UH6 A;  2LVQ A;  2I1J A;  4A8X C;  2N9L A;  3LXF A;  3MJW A;  3DPD A;  1M94 A;  2A4Z A;  4ACF A;  3AXC A;  1FRR A;  2K25 A;  5J18 A;  1E9M A;  2HTH A;  1SB3 C;  2DYM A;  1T0Q C;  4FJV B;  1OEY A;  2AX5 A;  2K8B A;  4NAW B;  2DAF A;  4MM3 A;  4W9F A;  2MSE D;  3NVZ A;  3GB1 A;  1K52 A;  4RGM A;  2I38 A;  5D94 A;  2JYT A;  1Q5W B;  2MEK A;  3PVL A;  4IWO A;  2JPH A;  2HJ8 A;  4F7Z A;  3M95 A;  2WXJ A;  2KFK A;  3ALB A;  4BAX A;  3OJ4 B;  2JXT A;  1PYW D;  3R2I A;  1VZ8 A;  3T8M A;  2JZP A;  1JW9 D;  5D6J B;  2KLG A;  3HM3 A;  1C78 A;  3RYT A;  2IBI B;  3X23 A;  3ZGZ A;  1FO4 A;  3QAR A;  1C1Y B;  1IPG A;  4ZRJ A;  1U4A A;  3DOW A;  1LQB A;  3ZDT A;  2MRP A;  4G0N B;  1L4Z B;  4DWF A;  2KTR B;  3IAS 1;  3VRA B;  5IOI A;  2J0M A;  1SE9 A;  1FCL A;  1L5P A;  4C4V B;  3ZRC A;  2X8X X;  4EOY A;  1WSP A;  2JSV X;  3AEE B;  4XC2 A;  1MG8 A;  2KMA A;  3AUL A;  4E71 A;  1L0V B;  4FN2 A;  3Q8F A;  4JIO U;  1WXS A;  3BK1 A;  2LHD A;  4KGT A;  4XZ4 A;  5DPR A;  3RNF C;  4IM0 A;  4A3P A;  3M3J A;  4G11 A;  4IDI A;  2DWQ A;  3QK0 A;  1FXA A;  2O2V B;  1T6B X;  4CYE A;  1V1P A;  1MPE A;  2VH1 A;  3IHP C;  2ZCB A;  3N32 A;  1H8C A;  2KVZ A;  1GOZ A;  3SDL C;  1N61 A;  1N60 A;  3JVZ X;  4AP4 C;  3OAW A;  3BII D;  3RNC C;  1YQ4 B;  3DBS A;  4RCO A;  2LMC A;  3GE8 C;  2PIA A;  1GPX A;  3SHQ A;  2JUO A;  3JSV A;  3PHW B;  2FID A;  3TEX A;  1S3S G;  3GZN I;  1QT9 A;  1NVI D;  2L32 A;  1JWM D;  3KYC D;  1ZPS A;  3NVY A;  1EWC A;  1YQ3 B;  3MHZ A;  1K53 A;  1I4G A;  4LNK A;  2CR5 A;  2G4S A;  2M1M A;  2O6V B;  4CQN A;  3QX1 A;  5KHO A;  1LXD A;  3V61 A;  3PTF C;  5E6N A;  3ZYY X;  1EM7 A;  5C1Z A;  2OED A;  1EO6 A;  3ZDM C;  2QC8 A;  3ZKJ C;  2IPK D;  2WX0 A;  1L6V A;  3WA0 A;  2WXF A;  3I5J C;  4WJN A;  1IBX A;  3M62 B;  2BKF A;  1NI2 A;  5D3I B;  4C7Y A;  4IM3 A;  3IBE A;  3VR9 B;  3H8H A;  4RH6 A;  4OVV A;  3A4R A;  4BOZ B;  2FAZ A;  2KFK B;  3C8Y A;  2LRU A;  2IO2 B;  3NHE B;  3IFW B;  4US9 A;  2G9H D;  1FPY A;  1UNS A;  4P1C C;  2N7D A;  2YEP B;  3T9L A;  2PMV A;  4LNI A;  2ICI A;  3SEB A;  3WAO A;  4HXD A;  4OVU A;  3P1M A;  3D32 A;  5DPT A;  4WQO B;  2KX0 A;  2BS4 B;  3DDC B;  4KKJ A;  4W9L A;  2KN4 A;  4GDK B;  3I63 C;  1GUA B;  2KJ6 A;  3EC8 A;  4ZRQ A;  1H4R A;  5FK9 C;  1SEB D;  2ZEQ A;  1OGW A;  3UQB A;  3U52 E;  2N7J A;  3O65 B;  2VZK B;  4GXB A;  1STE A;  2C7M B;  1N5W A;  4WAF A;  2L05 A;  3V6E B;  3Q3F A;  3R8B A;  4KV2 A;  1F0Z A;  2ZVN A;  1WH3 A;  3ABV B;  1I4X A;  2ON8 A;  1NEN B;  1SSN A;  2X38 A;  2YVC A;  2QEJ C;  2KAN A;  4KSK C;  3BYT B;  1XT9 B;  3A33 B;  2N1W A;  3A9K A;  3AU4 A;  2B76 B;  3BYY B;  4J3O D;  1F52 A;  4ANX A;  2J42 A;  1FCC C;  1RRB A;  1TBE A;  1GC7 A;  1LFD A;  3R2T A;  4BKS A;  3DVG X;  4QAY A;  2AL6 A;  1WXQ A;  1YX6 B;  2QIE B;  3L54 A;  2IND C;  2DYO A;  1MG4 A;  3PV1 A;  2L0F A;  3QJZ A;  5E6O A;  1F9J A;  2J7Q B;  1KH0 A;  1V5O A;  1P3Q U;  4YSX B;  2HDE A;  2KQS A;  2KOX A;  4KSL C;  2PE9 A;  5EE9 A;  2LAS A;  1UBI A;  3TEW A;  1TIF A;  2EKI A;  3DCG A;  4TSS A;  1ZW7 A;  1V97 A;  3DWM A;  1XXG A;  1L0Y B;  1TTN A;  1CK1 A;  2GBK A;  2RDG A;  1E10 A;  4RNA A;  2OJW A;  3EGR A;  1P7F A;  2WU2 B;  3WAN A;  1TY2 A;  4WQM A;  2Z0D B;  4HRO A;  4MJS A;  4TQ0 A;  4FUL A;  3EFC A;  1IBX B;  1TS5 A;  4ITK A;  1EU4 A;  3VUY A;  2QHO A;  2K6Q A;  4FJZ A;  4XWT A;  4MDK E;  1DOI A;  4X57 B;  3ECI A;  2V0G A;  2BGF A;  3HVZ A;  2CU3 A;  1UZX B;  4MH0 E;  1R7S A;  3AM9 A;  4XWW A;  1WGH A;  4URK A;  3AN1 A;  3KLS X;  1G6J A;  4IW0 A;  1WFY A;  4EE2 A;  2R2O A;  3KQ4 A;  4OW0 A;  1V2Y A;  5EE3 A;  3ZLZ A;  3QA8 A;  1QF6 A;  3RNE C;  2M4N A;  4WJQ A;  4YWG G;  3HVD A;  3JYU A;  3L0W B;  5IN7 A;  2QMT A;  2CHW A;  2KT7 A;  1I4P A;  2FCS A;  1OFF A;  1FIQ A;  2IZV B;  3KYD D;  2KDE B;  1VDV A;  3X0W A;  1ENF A;  4KGS A;  4RFB A;  2JY6 A;  1HTQ A;  4K3C A;  1HQR D;  1Q0W B;  4RF1 A;  3R7Q A;  2AQ1 B;  1J8C A;  3GP7 A;  3DBL I;  1WJN A;  2KO3 A;  3Q3J A;  5G55 A;  3TIX A;  2JVC A;  2BF8 B;  3Q3M C;  3AEF B;  4FHK A;  4LLG M;  3EUB 2;  5L83 A;  4K7S A;  1EWY C;  2MX2 A;  2W54 A;  1EUV B;  2M0X A;  4EFO A;  4W9C A;  3RCZ A;  2LGI A;  2IY1 B;  3AE9 B;  3TJP A;  4JWU C;  4IM2 A;  4MAC A;  4HPP A;  4W9I A;  2L7R A;  2PPH A;  1E0Z A;  3GZN B;  1WX7 A;  2DLB A;  4WWP A;  2LUE A;  2NBV B;  2KC1 A;  2HTM E;  2MHJ A;  2JQR B;  4L1B A;  4YTP B;  2G3Q B;  2PKO A;  2LD9 A;  3P4R B;  2OOB B;  3NRZ A;  1E8W A;  4HCP B;  1MHX A;  3U7Z A;  3PLV A;  2ZW0 A;  2GBM A;  3H9D A;  3OWE B;  4B95 A;  1BXT A;  2KQ4 X;  2W9N A;  4P7I A;  4NZL B;  2BKR B;  2V9H A;  2DZK A;  1ZDX A;  4OVZ A;  1P7E A;  2G45 B;  2PVG C;  3UIP B;  1JWS D;  1P98 A;  4DHJ D;  2Z59 B;  1C3T A;  4RM9 A;  1NYQ A;  2MBB B;  2JXX A;  3DHH C;  1I4H A;  2RDH A;  3AE7 B;  3AMZ A;  3BVZ A;  3ML8 A;  1WR1 A;  2K3U A;  3QIJ A;  1SE3 A;  1XD3 B;  1KLG D;  3SD5 A;  3H1U A;  1ZDV A;  2WLB A;  3I3T B;  1V1P B;  4GLS C;  1TYG B;  1GNU A;  1PGB A;  3PLU A;  3CST A;  4ANU A;  2WDT B;  2D3C A;  2IO0 B;  3HIZ A;  2SAK A;  2MJ3 A;  5BYR A;  4HJG E;  3FC4 A;  4LDT D;  5GXG B;  5HHD G;  1NDD A;  1AWD A;  2N4F A;  2K9X A;  1JRP A;  1B9R A;  4YTM B;  1FMA D;  3QC8 B;  1JQ4 A;  4M01 A;  3RUI B;  3TCA A;  1C4P A;  3ZTD A;  4HDO A;  3W1S C;  1WMH B;  1CQV A;  4HCN B;  3AEG B;  1CJE A;  1WJU A;  1EU3 A;  3SFD B;  4YL8 A;  4FBJ B;  2V1Y A;  1PUT A;  3H6N A;  2N1V A;  2WDV B;  5D7G A;  1N5X A;  3HRD D;  1XCQ L;  4PS3 A;  4GSW A;  1LO5 D;  1YN3 A;  1PDX A;  4II3 B;  4GB9 A;  4I6N B;  3VDZ A;  1WRI A;  2Z0E B;  2BYT A;  4ZHO A;  1I42 A;  3TMP B;  2UU7 A;  4PS7 A; 
#chains in the Genus database with same CATH homology
 1UWX A;  2CJN A;  2K22 A;  4YTN B;  1BML C;  5T8I A;  3SR6 A;  4UDU C;  2IPK D;  1ACC A;  2Z8L A;  4P16 A;  1JRO A;  1JCK B;  3AE4 B;  1NI3 A;  4TMA B;  1L6V A;  2WXF A;  1IBX A;  1TZO A;  2BB6 A;  5G5G A;  1ET6 A;  1SBB B;  2BTE A;  1FEH A;  1L4D B;  2QJL A;  2GI9 A;  1TJE A;  2INP E;  1SE4 A;  1VZ7 A;  5D3I B;  2J52 A;  4C7Y A;  2R61 A;  1QOB A;  1TKY A;  3VR9 B;  3H8H A;  4RGO S;  4RH6 A;  4A90 A;  3TEY A;  3AE8 B;  1VRA B;  3U2S C;  4DXG A;  3C8Y A;  3ZQ4 A;  1TS2 A;  2NMQ A;  1XEE A;  2L52 A;  5MPO A;  1HA5 A;  4MT5 A;  2W3S A;  4US9 A;  2G9H D;  2L1A A;  1FNW A;  4OZC A;  1UNS A;  2M56 B;  3BZD B;  2YEP B;  3MFG A;  2FE8 A;  2WXK A;  2PMV A;  3VRB B;  1IGC A;  2ICI A;  2PTL A;  4P6V F;  2BW2 A;  4D2K A;  5TSS A;  1TKG A;  3SEB A;  1JWB D;  1IUE A;  4PT5 A;  3E56 A;  3P1M A;  3AV8 A;  1V1O A;  3P42 A;  2WU5 B;  2BS4 B;  2ONQ A;  4KKJ A;  3I57 A;  1MI0 A;  4MM3 B;  1WYG A;  3SFE B;  1WGK A;  5BYQ A;  2KN4 A;  4GDK B;  1OQQ A;  2V4I B;  2KAC A;  3AEA B;  4ZRQ A;  1SJH D;  4LTU A;  5FK9 C;  1SEB D;  2XN9 C;  3P63 A;  3U52 E;  4US8 A;  2N7J A;  2WXM A;  1GB1 A;  3PO0 A;  4XDC A;  1KLU D;  1T5X D;  2VZK B;  3WCQ A;  3Q8E A;  1STE A;  4WAF A;  1N5W A;  2LHE A;  1MHH E;  2KWD A;  1QOF A;  3AED B;  4XE0 A;  3R8B A;  3AB5 A;  1E7P B;  3B2F A;  1AW7 A;  1F0Z A;  3AE3 B;  4YT0 B;  3ABV B;  1JWU D;  1XLO A;  1I4X A;  2ON8 A;  1ZOY B;  5C2T B;  1NEN B;  2RPV A;  4ZYS A;  4DXF A;  2BS2 B;  2ZW1 A;  1SSN A;  4AQ7 A;  2X38 A;  4WUR A;  2J4X A;  3PZ7 A;  2QEJ C;  3ETR A;  3TSS A;  1ET9 A;  2Q5W D;  4OZB A;  2OHF A;  3MC0 B;  3BYT B;  3I9V 1;  3B9J A;  3AH7 A;  2MJD A;  1RWS A;  2J53 A;  4L23 A;  4HEA 1;  2VZK D;  1CZP A;  4C7Z A;  2KMM A;  1C79 A;  1GB4 A;  5AUK A;  1VZ6 A;  5EE0 A;  2B76 B;  3BYY B;  1UWM A;  4WH4 A;  4J3O D;  2LJI A;  1VJK A;  2J42 A;  1B1Z A;  1FCC C;  1I4R A;  4HKQ A;  1ZE3 D;  1N63 A;  4GDL B;  2MH7 A;  3VQI A;  1C77 A;  2IGG A;  4FXC A;  3R2T A;  1AN8 A;  5FKA C;  2N0S B;  3V05 A;  2V3N A;  2ACZ B;  3IAM 1;  5I4D A;  3BVM A;  3AE6 B;  1WXQ A;  2PW9 A;  4B0M A;  3U4E G;  2MJE A;  2QIE B;  2N9K A;  3ZJU A;  1M4V A;  3J9C A;  2DYO A;  5C3J B;  1N62 A;  1XLP A;  5HFY A;  3URY A;  4JE3 B;  1KH0 A;  2INN E;  4XDD A;  1NYR A;  3Q8A A;  2WXR A;  4YSX B;  2HDE A;  1FFU A;  1PGX A;  5EE9 A;  2QIL A;  1TY0 A;  4ARI A;  3IT6 B;  1C76 A;  1KRH A;  3LYY A;  3TEW A;  5H92 C;  2EKI A;  4C80 A;  2LEK A;  2AQ2 B;  4AS1 A;  4TSS A;  1HXY D;  2IGH A;  1J7C A;  1V97 A;  4RF0 A;  1D6E C;  4DQO C;  3W5V B;  3DWM A;  5HG2 A;  1UUP A;  1XXG A;  1YN4 A;  1L6U A;  3E9S A;  1AYF A;  2EEL A;  1L0Y B;  1RM6 C;  3AE2 B;  1JAL A;  2E3T A;  2W3R A;  1Y56 A;  1FNV A;  1CK1 A;  2RDG A;  1E10 A;  4RNA A;  1V8C A;  1OQR A;  3AEC B;  3EGR A;  2LFI A;  1P7F A;  2BBC A;  1FNU A;  2CJO A;  2WU2 B;  1TY2 A;  1ZUD 2;  2NTS A;  3Q8B A;  4NAM A;  3KWL A;  2V3P A;  1XF5 L;  2W55 A;  4JPS A;  4WQM A;  1C4A A;  4HRO A;  3NZ3 A;  1KF6 B;  4TQ0 A;  4HRS A;  2DBY A;  2IJ0 A;  4ZHP A;  4IKG A;  3V3X A;  4KGR A;  4RGT A;  1IBX B;  1QLB B;  1K51 A;  2WXQ A;  1TS5 A;  1QQR A;  2GRI A;  4ITK A;  2M19 A;  1EU4 A;  3O13 A;  1ZXH A;  1I7H A;  2WXL A;  1RFK A;  4XWT A;  1RYJ A;  1ROE A;  3P4Q B;  3W9C B;  1DOX A;  5FR3 A;  1DOI A;  1ZP0 B;  4YSY B;  2V0G A;  3NVV A;  3HVZ A;  2KAJ A;  1HZ6 A;  2BB5 A;  2CU3 A;  1F2R C;  1UGJ A;  3TEZ A;  1FXI A;  1QOA A;  1KFY B;  4O1N A;  5BMH A;  1R7S A;  4ARC A;  1HZ5 A;  3NUH B;  3AM9 A;  4XWW A;  1D4B A;  5AUI A;  3FAH A;  3AN1 A;  2K0P A;  3KLS X;  1F77 A;  1L0X B;  1SF0 A;  4YSZ B;  1K50 A;  3N9Y C;  4HKZ E;  2WXN A;  2WDQ B;  3Q69 A;  1FD6 A;  1JML A;  4EE2 A;  3KQ4 A;  2JU6 X;  4A55 A;  4OZA A;  2JYE A;  4NJC A;  4JWS C;  4OW0 A;  5LNK 1;  3UI3 A;  5EE3 A;  1KTK A;  3P4S B;  1TS4 A;  1FFV A;  2SEB D;  1XO3 A;  3LB8 C;  5JXV A;  3ZJT A;  2H89 B;  1QF6 A;  4N58 A;  2H88 B;  2YEP F;  4YWG G;  3HVD A;  1ZXI A;  1J7A A;  2WS3 B;  3Q8C A;  1A70 A;  2AQ3 B;  2QMT A;  1SE2 A;  4A8X C;  1I4P A;  2N9L A;  4ZRP A;  2Y5C A;  1T3Q A;  1OFF A;  1ESF A;  3LXF A;  1HEZ E;  5HI1 A;  1FIQ A;  1E6E B;  1VDV A;  5D3D A;  1TKE A;  1SXT A;  1YJI A;  1FRR A;  1E9M A;  1XCT L;  1TS3 A;  2L83 A;  1SB3 C;  2DYM A;  1ENF A;  4KGS A;  1D5Z C;  4RFB A;  2AX5 A;  4NAW B;  2PLP A;  3P4P B;  1HQR D;  3NVZ A;  2Y5P A;  3GB1 A;  1K52 A;  4RGM A;  2I38 A;  5EE1 A;  2JYT A;  1MVK A;  3B2G A;  4RF1 A;  2MEK A;  2AQ1 B;  2PVO D;  4ZOH C;  3W1S A;  3GP7 A;  5BYS A;  3HUI A;  4B0E A;  4REZ A;  2RMM A;  2WXJ A;  3NVW A;  4YXD B;  2WQY B;  1FRD A;  3AEF B;  5H8Y E;  5E6J A;  3EUB 2;  4LLG M;  1D5M C;  1QKZ A;  3KWV A;  3BWU D;  2JXT A;  1EWY C;  2W54 A;  1PYW D;  3R2I A;  1VZ8 A;  2JZP A;  1C4C A;  2LGI A;  1JW9 D;  3T3N A;  3AE9 B;  1C78 A;  4JWU C;  1SJE D;  3RPF C;  3DWG C;  4WWM A;  4MAC A;  3ZGZ A;  1DOY A;  1FO4 A;  2GB1 A;  3NS1 A;  1E0Z A;  1DGJ A;  2DLB A;  2WP9 B;  3TUO A;  1VR9 A;  1YN5 A;  3BK2 A;  2Y3A A;  2FBW B;  2HTM E;  1IGD A;  2FUG 1;  1C9F A;  1L4Z B;  2JQR B;  1J7B A;  1PFD A;  4L1B A;  3IAS 1;  3VRA B;  2JWU A;  4YTP B;  3MJ5 A;  1NEK B;  2PKO A;  1FCL A;  1L5P A;  3P4R B;  4IOI E;  1WWT A;  3NRZ A;  1YNT E;  1MHX A;  2M0A A;  2WXI A;  3U7Z A;  4LK0 M;  3FIL A;  2LUM A;  1WSP A;  2ZW0 A;  1D5X C;  2IDY A;  2JSV X;  4TQ1 A;  3CIR B;  2BT6 A;  3OWE B;  5G5H A;  3AEE B;  1BXT A;  2KQ4 X;  4KKI A;  4NZL B;  3AE1 B;  1BUI C;  2W82 A;  1YMH E;  1L0V B;  3BVG A;  3Q8F A;  2G1E A;  2JX5 A;  1ZDX A;  2WXP A;  4OVZ A;  4USA A;  1P7E A;  2I2Y A;  3RFZ B;  3BK1 A;  2PVG C;  5BMI A;  2LHD A;  1JWS D;  4KGT A;  2WDR B;  1GAQ B;  4H2A A;  4C56 C;  1DYQ A;  1JWA D;  1NYQ A;  4IDI A;  2DWQ A;  1I4H A;  2WXH A;  3EA6 A;  3L4P A;  1FXA A;  2RDH A;  3AE7 B;  3AMZ A;  3BVZ A;  1T6B X;  2WNM A;  1V1P A;  1Q10 A;  2WXG A;  1MPE A;  2K3U A;  1SE3 A;  4RGN A;  1KLG D;  4JX1 C;  1SIJ A;  1ZDV A;  2WLB A;  3FIL B;  3T3O A;  4Q2J A;  4A9A A;  2QSD A;  1QOG A;  1V1P B;  2IGD A;  2KDM A;  4GLS C;  1TYG B;  2BS3 B;  1GOZ A;  1PGB A;  3W5U B;  2D5G A;  1N61 A;  1F2R I;  3IXS A;  2SAK A;  2MJ3 A;  1N60 A;  3MP9 A;  1VLB A;  5BYR A;  3BII D;  1YQ4 B;  4HJG E;  3FC4 A;  3IT4 B;  4RCO A;  2LMC A;  5GXG B;  5HHD G;  1AWD A;  4WIP A;  2K9X A;  2PIA A;  1GPX A;  1JRP A;  1B9R A;  4YTM B;  4L2Y A;  2K5P A;  1FMA D;  1JQ4 A;  4KX6 B;  3TEX A;  1YJJ A;  4R3D A;  1C4P A;  1PGA A;  1XLN A;  1CQV A;  3AEG B;  1QT9 A;  1CJE A;  1XLQ A;  2XNA C;  3GS2 A;  4M0W A;  1NVI D;  3AEB B;  1EU3 A;  2L32 A;  3SFD B;  3AE5 B;  1JWM D;  4MH8 A;  4OHJ A;  3CWI A;  1ZPS A;  3NVY A;  1EWC A;  1YQ3 B;  1PUT A;  3MHZ A;  3PZ8 A;  4N59 A;  1K53 A;  1I4G A;  3W2D A;  3ZJV A;  1QIL A;  2WDV B;  5D7G A;  1N5X A;  3VR8 B;  3HRD D;  4N6E B;  1XCQ L;  4A6Q A;  1LO5 D;  1YN3 A;  2TSS A;  4CQN A;  1PDX A;  2E6X A;  2WXO A;  1FM0 D;  1I4Q A;  1WRI A;  3ZYY X;  5BMG A;  2BYT A;  1EM7 A;  4ZHO A;  2NTT A;  2OED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...