1TS5A

I140t mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts5A01
1B1ZA 5TSSA 1AN8A 1TY0A 1TS5A 1S5FD 3BYYB 3DWQA 1FGBD 1KTKA 1RD9D 3O13A 4RHSA 1I4XA 1PRTF 1XXGA 3URYA 1M4VA 1CT1D 2XRSD 1ET6A 1PTOB 2CHBD 3MC0B 1HQRD 2R61A 2O2LD 1SE2A 2AQ3B 4DXFA 1GOZA 1DJRD 1SXTA 3W2DA 1SEBD 1UNSA 1CHPD 1KLGD 1MD2D 1LTGD 1JWUD 5ELCA 1PTOC 1ENFA 1EWCA 1D6EC 2QILA 1LTTD 2RDHA 3MFGA 5ELFA 5D3IB 1LT3D 1S5BD 3R8BA 5FK9C 4K6LA 4RGOS 1I4GA 1JR0D 1EU4A 1LTAD 3TSSA 1LO5D 1TS3A 3V05A 1PRTC 4UDUC 1EU3A 3OWEB 2NTTA 1YN5A 1JCKB 1ET9A 2XN9C 1RF2D 1V1PB 1L0YB 1PRTD 3BVZA 1I4QA 4L63B 5ELDA 1EEID 1D5MC 1I4PA 1LT5D 2IJ0A 4RFBA 1LT6D 1BCPC 1BXTA 1G8ZD 4BWGB 1V1OA 1PZKD 5ELEA 4Z9CB 1I4HA 1BCPD 1L0XB 1RDPD 3BVGA 1LTRD 1S5CD 1XTCD 1PRTB 4RGMA 1EFID 3BZDB 1HTLD 5D3DA 3EFXD 1UUPA 1LT4D 5I4DA 2WV6D 3R2IA 3SEBA 1HXYD 1FNWA 3DWAA 2QEJC 1JWMD 1SBBB 1BCPB 1PZJD 1SJHD 1PYWD 1LTBD 1HA5A 2J4XA 3KLSX 4O1NA 1PTOH 1QILA 5ELBA 4RH6A 1F77A 1B44D 1TS2A 4NZLB 1D5ZC 1I4RA 1CHQD 3EA6A 4L6TB 4RHRA 1FD7D 2IPKD 4ZYSA 1PTOF 2G9HD 2NTSA 1EEFD 1LLRD 1PTOD 1TS4A 1FNVA 1CQVA 2SEBD 1D5XC 2ICIA 3BYTB 4RGNA 2AQ2B 3CHBD 1JWSD 1T5XD 1SJED 4RGTA 4TSSA 2XNAC 1YN4A 2XRQD 1S5DD 5FKAC 3GP7A 3DWPA 1STEA 2Z8LA 1SE3A 4RCOA 1LTSD 3R2TA 1LTID 1AW7A 1BCPF 2TSSA 3BVMA 1YN3A 1ESFA 1SE4A 1KLUD 1S5ED 1JQYD 4DXGA 1V1PA 1TY2A 1RCVD 1CK1A 1DYQA 1PZID 4C56C 4OHJA 2AQ1B 2RDGA 1FNUA
chains in the Genus database with same CATH superfamily
1B1ZA 4A76A 1GG3A 3U4ZA 1TS5A 4J1MA 5C0XH 4DV2Q 4W9GA 1QT9A 4GOPB 2KJHB 4L5TA 2VB2X 3A4RA 3PLVA 2F0MA 4B9WA 4O0AA 4WJ4A 2BWES 1YNTE 2WX1A 1YQ3B 2L0CA 5J3BA 4A3MB 3P2BA 2BB6A 1PTOB 2WAQG 5DM73 4GNXA 4A3GB 2R61A 3CC4A 3TIXA 1S72A 4XWTA 4IUPA 3FKIB 4E74A 4DK0A 1OQYA 1VCBA 4X64Q 1MD2D 3M3JA 4NJ6A 2XIWA 2OOBB 3SK5A 2UUBL 4DR4Q 4IG7B 3H94A 1IXRA 3RZDH 5EE3A 4TKNA 3H15A 1TT5B 1EWCA 1WZ0A 1VF7A 5IYCH 2HJ1A 2N9LA 3CC7A 4BY1B 3VR5A 3BZCA 4B0MA 4G7HC 3A1QA 2JXXA 1DOMA 4FXKC 4WWMA 1I4GA 4FF2A 3GDEA 2F4VL 3W9CB 2K50A 1VQFA 2R7ZG 4DV2L 4H7BA 5IYBH 2H1EA 3X3MA 2L00B 3D6WA 1I7HA 2OHFA 2ZM6L 1HNWQ 1IL8A 1ICFB 3DEOA 2PEAA 2FIFA 4LFAQ 1PH2A 5ELOA 1SE9A 1IYVA 2KECA 1PA6A 1SIJA 4JI2L 5DPRA 3TEXA 2B2UA 3MXNB 3HOVG 1RLFA 1O7ZA 1Q46A 1J5EQ 3CRLC 2EXZA 3GD7A 2Q8IB 3QCAA 2INPE 5CV7A 2HIXA 1SROA 1IW7D 4WJOA 2XWJB 3EFXD 1HZ6A 2M4NA 3DLLA 1BQQT 4DR5Q 2QJLA 4JK1C 3JAMi 3NTIA 2QEJC 2SOBA 2O5JC 2UXCL 1K8OA 1VQ5A 2JZ3B 1S1QB 3OJ3A 4MSQB 1CKOA 3BIID 4II3B 1FJGQ 4KKSA 2LVPA 2E76C 1DM0B 2MA9B 3I7FA 1IBMQ 1KHIA 2B8GA 2K33A 3MEHA 2L11A 1YJ9A 3HIZA 3GB1A 1SNQA 1OXUA 2PCFB 5EAYA 3VR6A 1SYGA 1L7YA 4A3OA 2CH4W 1SR3A 1GHJA 4AOFA 1YBYA 1WXSA 1FVIA 2IPKD 1ONLA 3PHWB 4M8MA 2RCNA 2BA0A 1D8LA 2M19A 3DHHC 2NTSA 3Q24A 3NUHB 4GN5A 4IM3A 1ZEQX 3J7A5 2MJEA 2MP1A 4MDKE 4ZYNA 3K5MA 3NZUA 3I90A 1GB4A 2Z0SA 1F0ZA 2VUMG 3AB5A 5CC4A 2XNAC 4XYQA 4R1JA 5A35A 1EY6A 4DR7Q 4ZCKA 2JA6B 1L0WA 2K8BA 4N6EB 2KQ3A 1G51A 3G4SA 4JI4Q 1V49A 3VR3A 2ES2A 1JICA 4A3DG 3D6CA 3OMCA 3A8KE 4US9A 2LI5A 3IT6B 2F0QA 3PRPB 4N9F4 1BCPF 5EJWA 1XNQQ 2YTXA 1CZGA 2R92G 1KLUD 2CW0C 3O65B 3VYUA 1H8CA 5C3EH 4A93H 2I1JA 2R3ZA 4B9KA 4G57A 2AQ1B 4UHVA 1WYDA 5M5YH 4DV3Q 4HK2A 2K5NA 1KC8C 3TL5A 1F9QA 3CCLA 3PGEA 2INDC 4XX5A 4JI7Q 2JYTA 1I6HB 3X0WA 2B2TC 3ERQA 3RNUA 2GBNA 2DUDA 5MPOA 5EBDA 2AX5A 3P4RB 3T3OA 1O78A 4ZRZA 3ZNZB 4JC0A 3WOFA 3W5UB 2UWQA 2D2QA 2IL8A 1QKZA 2ICEC 3GTLB 2A68D 1TWGH 4IC7B 1HHVA 2K52A 1K50A 4RCNA 1WI5A 3HRZC 3TP5A 4BBSG 1TJEA 1TZOA 2DZIA 5DPTA 3ZTDA 2L7RA 1Q10A 4RG1A 4A75A 2JEAI 1GJXA 3H9DA 1STAA 1D1IA 1Q0WB 2FUHB 4KY5A 2ZJQA 3DBLI 2MCNB 1SDFA 5ELCA 4BOSC 4K5XA 4KN4C 3LNNA 1EWHA 2JVCA 4A6QA 5IWAQ 4N59A 2WXPA 4MJSB 2HD3A 2MGSA 3AEAB 4LJZC 2OWOA 4WFN3 3KH0A 2MBEA 1P1AA 3DM3A 1XNRQ 4ANWA 1M8AA 1PRTD 4DV7Q 1LQBA 2OEDA 3UDIA 4IFDJ 2LVOA 3BU2A 3IAM1 5J22A 3LGJA 1CA5A 4LK1C 4A3JG 2PIAA 2KC2A 3U9SA 2KDFB 2UUCL 1I4HA 1XLNA 2CKHB 2PVGC 1RDPD 3MHSD 1X9NA 4BBRH 4EGVA 4IW0A 4KV2A 4S3SA 4YTMB 3ULLA 4A3IH 3L10B 3BZDB 4YWMA 1SYFA 2OF1A 1NJIC 3TMEA 4FXDA 1K53A 4ANVA 3E9SA 1WTVA 5FLMG 4DV0L 5E4WC 3I9V1 4MH0E 3SEBA 3STBC 3NZSA 3I4MG 2LZ6A 1WXAA 2DYOA 2X8XX 4JWUC 5IWAL 3WAOA 1B2TA 1TKYA 1M90C 4R9WA 2EY5A 4GXBA 1KM7A 2L9HA 3GTOB 3GZNI 1A15A 3HOYG 1WCMG 3J7ZC 3G71A 2KEDA 3PO3G 5IOCA 1XNRL 4IDIA 2JA9A 2WXHA 1NSNS 4E71A 4OEMB 4GKJL 1FD6A 1LXDA 2V3SA 2V4LA 2G4SA 1WX7A 3VVWB 2DLBA 4URKA 3BJUA 1ENAA 2EY6A 3W3AA 3EA6A 4XYCA 5BN3A 1FEHA 2KZRA 4J6HA 4C3JB 3LB8C 3PQIA 2FE8A 1BF4A 1SNMA 3D4WA 3AMUA 2DJFC 5CMDA 4XQNA 4GN4B 3HVDA 1K28A 2YU9H 2HJ8A 3R93A 2LD9A 3VDZA 3H0GH 3GTGB 4L5QA 4WIPA 3PSEB 2FJ2A 3NELA 3H3VH 3V3XA 4F1SA 3N30A 4MH8A 1SYEA 4KIKA 4DKAC 3WANA 4DR6Q 1FRDA 3MTNB 1A5RA 2Q2UA 1Q82C 4B08A 4QQBX 4OWWB 4B3SQ 4K8JA 1WXVA 4NAMA 3AE4B 5IP9G 1XPOA 1MFWA 2PO4A 1YMHE 4OZBA 1T9HA 1Y1VG 5KNBA 2K9XA 1E8XA 1OO9B 3T1HQ 5LMNL 3Q3FA 4QUFA 3PO2H 3K57A 1SMXA 4R4TA 4WRDA 3T16A 2KWUB 5LXIB 3FPUB 4F7XA 2VZKB 1XTDA 3RPFC 3DBSA 4X65L 2PJHA 1YD8U 2AKWB 1B7YB 4KDLB 3NK9A 3ICEA 4NJ7A 1XLQA 2UU9Q 4K8IA 2C7NB 2GRIA 2KHWB 2F4IA 2QDFA 1K0RA 4KGSA 4MGYE 4CJ1B 2DGYA 3TP8A 2RR9A 1KXLA 3QAQA 4TV3A 1VMPA 1JWUD 4B3RQ 4ALPA 1K9MC 4JVZA 3RNAC 4ARIA 1DOYA 5C4XB 5JEAG 1AARA 4JL9A 4CDDC 4KTAA 1VQGA 1KAWA 3OOCA 1NYRA 3U30A 1B3QA 5C44G 1HPCA 3R3MA 2EJMA 1J0GA 1XPRA 3EBEA 4WJ3M 1L0VB 1UE6A 2BPSA 5GMVA 3VRAB 1X3EA 1PYBA 1VQ8A 2W9NA 2D3BA 4I7ZC 4LNNA 1U0LA 4EZJA 4B3TQ 1I3QH 3OTOL 2JA8G 2PE6B 2WLBA 1TR5A 1Q7YC 1V1OA 2KVMA 1W6JA 2E2HB 2SNMA 1EIGA 4P7IA 5E6JA 5HI1A 3TBLD 4HJ5A 3B1LX 3KLSA 3Q8BA 2WX0A 5DCNA 3ULPA 1OEYJ 3NXWA 3DBHB 2W54A 2BE5C 1SMYC 2KFJA 1PGAA 4XE0A 3RUIB 2WU2B 3DWAA 4K6DA 3Q8CA 3PIO3 2CU3A 1EIFA 4IKGA 5I2XA 3KUZA 2YTVA 3KBGA 2UXDQ 1DOIA 2RDFA 4R4OA 5ISRA 2RA4A 3KLSX 4HEDA 1CQFA 5IYDG 5GAEC 3PRZA 1VDZA 2GI9A 3KUDB 2WXRA 4GKKL 2KDEB 1H95A 2HDMA 3OPOA 1N33L 2F52A 2VQEL 4B3TL 4A4IA 1K83H 4H0LC 4R4IA 2F0TA 4FF3A 2RBMA 1T3QA 1FR3A 1VQAA 3I4NH 2HHHQ 3DUZA 4A3DB 4DHZE 4NXNQ 2X38A 2A69C 1ESRA 3FAHA 4DUZL 3JAMc 2QHOA 4LDTB 2N0SB 4F7ZA 1Y1WG 2R92B 1YJJA 1FNVA 3A8JE 1HJPA 1Z2MA 2BBCA 2GB1A 4IOCA 2ON8A 2YV5A 1WSPA 1B53A 1GVPA 2WDRB 3OAWA 4ANUA 1X3PA 4FVMA 1Q8KA 4CDEC 1SFOH 1SE3A 3JVZX 1JMLA 4A8XC 1CZWA 1KH0A 1FPYA 3R2TA 2FINB 5C4ZA 4DUYL 3HOUH 2NMQA 3ECIA 2KHSA 2GVBA 5IP7H 2NPTB 3KLRA 4JI3L 5M5XH 3S2HH 5EE9A 1VF5C 5BR8L 1MHWC 4WWNA 2F0WA 2NVQH 4DR3Q 3L4PA 4N58A 4ZQ3A 1XMQQ 2AYOB 2WAQE 2M9VA 1EQTA 2F0KA 1EUJA 1PFMA 2CQOA 1PH9A 4USAA 3Q0AA 1TY0A 3RCZA 1WX9A 3UDFA 4OWXB 4HIDA 1KTKA 3S15B 1AWDA 1EWYC 4H2AA 5DPSA 5EKIA 2RPVA 4MM3A 4P2CB 5HHDG 1KJTA 4W9IA 2AUKA 2QCPX 2L0FA 2CHZA 4A3BH 3U8ZA 3UQBA 2J0TD 1WTHA 4EOYA 4ITKA 4EKUA 1B9NA 4D2KA 2Q2IA 2ZW1A 3JAME 5E6NA 1HZAA 3HOWG 4XXEA 1SYCA 1EF1A 2K5DA 3A4SC 3D32A 3PV0A 3DVNV 1E2ZA 1R4NB 4RKBA 2NCNA 4DR3L 5CV9A 4B95A 2PVOD 2ZXOA 3NTHA 2OQKA 2D62A 4X57B 2ZJRA 1PH1A 1TTNA 2EYMA 2Y0SG 2LJIA 3WDNA 5HFYA 1RTNA 1YN5A 3DOWA 4A3EH 3JSVA 1C4AA 1RRBA 2GMIC 4IN3A 2KLGA 1PH3A 3I4MH 3AULA 1EZ8A 2CWPA 5LLIA 1TGZB 5J18A 4PMBA 1F52A 2CU1A 4LNQA 1CTMA 4W9HA 2Y5BB 1LT5D 1I4PA 4CJ0B 4JI0Q 5K36H 4ODGA 4UP9A 1LABA 1WCMB 4DFAA 4A3CG 2R93B 1OXXK 2Z4HA 1Y8PB 5GAGC 5G2NA 4ZUIA 4S0RA 1KFYB 1YHQA 1KRHA 3PHXB 4LNFA 4JPSA 3OJ4B 1VQKA 2HQEA 1PH5A 2ATWA 3CXCA 4IUVA 1SAPA 1QOBA 2KAJA 2L52A 1B9RA 4HTHA 3R7RA 3MXGA 1G291 5KRUA 1SBBB 4CHKA 5JOBA 1PZJD 2FCQA 3FKIG 2RQXA 3HEJA 1MJEA 3KF6B 1JROA 3RUZA 4LMQD 1L6UA 1YQ4B 1TKWB 2J4XA 4PV1C 3APDA 1IGCA 1Z6HA 1F9RA 2Q5WD 4NMZA 4XTCS 3ONAB 4LJOB 4EE2A 2O5IC 3MP9A 2LKVA 1TS2A 3TBIB 1HUMA 1KL9A 4DNTB 3HOXH 3TJPA 1TWCB 1J7CA 1TIFA 1F2ZA 1JJCB 1FD7D 2NBUA 1Q8IA 4FADA 4CQNA 3NHHA 4PQXA 1MI2A 2KYWA 4K7UA 3K9PB 3Q23A 1GC6A 2BF8B 3QG1A 1C48A 4CKCA 4WAFA 3QB3A 3AFQA 2JF5A 3KOJA 3L0OA 4V0BA 4MELA 4M8NA 2DN8A 4X62Q 2CS4A 4ZKBB 4LF9Q 4RGTA 3VYSA 5C4JB 2GVAA 1YN4A 2I2YA 2XVSA 3CU7A 1G91A 1WWTA 2IO3B 1IBXA 4C3IH 2PW5A 4DR2Q 3VH3B 2CVRA 4RCOA 4UPAA 4YWGG 3AB9A 3BDCA 4ID6A 3UE1A 4DF7A 3U2SC 3M3YB 2PYKA 5M3FH 2TSSA 1FXTB 4ULLA 3ZYYX 1SB3C 2M0AA 1B9MA 4GOPA 2EJGC 4G7ZC 3WIMA 1UBQA 4HKQA 1T6BX 4BKTA 1DYQA 2KVRA 1LGRA 2F0EA 3V96A 1DXMA 2JEBI 1L1OB 1B70B 1PLFA 3K7AB 1KRSA 4LAAA 2IYDB 2KMAA 2KOXA 2W3RA 4WURA 1A3TA 2E5LQ 1DCZA 1AN8A 2EYFA 3PIOA 4DA2A 4L23A 4RNAA 1RL2A 4RF0A 2EOTA 3O13A 2Z4IA 3PUZA 2EKEC 4YL8A 3S17B 2KKCA 4A55A 3LWEA 4HLEA 3PV1A 5EE0A 3URYA 4FHKA 3PLUA 2K04A 1M4VA 1RODA 2A19A 4FLHA 5M3MG 3I56A 4OZCA 5IT9L 4IUNA 3BS1A 3S1QB 3PREA 2DBYA 1X56A 2EE1A 1TWFH 1A63A 3SDLC 4NDXA 4PNYA 3RT3B 2NVXH 2LGDA 5D6JB 5ELNA 5KYLA 2CR5A 4X3SA 2V0GA 3OIPA 4DAMA 4AJWA 1IYFA 5BN5A 3NE5B 2QILA 3MFGA 2J53A 3QA8A 2N7DA 4B9XA 3RNGC 4MGKE 1GHKA 4HJAA 1JR0D 3ABVB 4BFRA 2K14A 2O2VA 1E6EB 1WOCA 4LF6Q 1ZXIA 2YVCA 3OWEB 3K80C 2F0SA 1ET9A 1STGA 2HQLA 1IBLQ 5BYSA 3PZDA 2BKFA 1RAXA 4QF4A 1WGRA 1II3A 3W1YA 5BMHA 5ELEA 1UWXA 2PMZE 4Z9CB 2EVBA 1PFSA 2RSUA 5D3DA 1U4AA 3BK1A 3DCGA 2VQFQ 2H88B 2F1MA 1CKMA 1HR0L 4L1BA 4ACFA 2HT1A 2Z1CA 2PQAA 4AQYL 1C79A 2E6XA 2N1WA 5CTRC 1A8VA 4WAAA 5HGQA 1CKNA 1SLJA 4PZ8A 1N36L 1QOGA 3H8HA 4IO9A 1Y1WB 2GOWA 3VTUA 1VDVA 2MBBB 3GTQH 4IFDI 1DGSA 3RLNA 4DV1L 4HIMA 3MZ5A 4YCUA 1LUZA 3H09A 3CKIB 1KDAA 4ZAIA 2BKRB 1N32Q 4MIUA 3SDZA 1N5WA 2JZZA 5IKCM 4TVAB 4A3FB 1TWAH 2BS2B 3VYRA 2K75A 4GMVA 2BYTA 1VJKA 3HS0C 3N1ZC 4KZCA 2QGQA 4C2MB 2NBWB 1CMXB 3A7AB 2K6QA 3GTPH 1E22A 4WJPA 3ZXRA 2ICIA 4LF5L 2PI2A 3CHBD 4PZ7A 4A90A 4OELB 4JI5Q 4HKZE 5LXHA 4TUUA 2NUCA 2NVTB 1S5DD 1EQVA 5DM63 4K7SA 1KDCA 2F0GA 1C78A 4RM9A 1OQQA 3PS6A 3S16B 4BXXH 3SFEB 1AW7A 2N3SA 5FO9B 2JU6X 1F2RC 2WB1B 1HTPA 3A54A 3U4EG 1QOFA 4KJOA 5JJIA 2ZPYA 2CH4A 1LACA 2G45B 4F88A 5L37A 2L3ZA 3ZDTA 3MXPA 2X6LA 1N34Q 1EFWA 2LGXA 1HFGA 2MPMA 4K2KA 1MIUA 3S1MB 5JJLA 1RWSA 4W9JA 3ZQ4A 3PTFC 3QWNA 2BYVE 3WA0A 3ZW3A 2UU7A 5IGEA 3A74A 4FA6A 3HK0A 1XXGA 3GTJB 2LUEA 4KDIC 1CT1D 2CQAA 1VQ6A 3GTMB 1GUNA 4EQOA 1ET6A 1VS0A 4JG2A 3I55A 2K39A 2O6VB 2XTIA 4W9KA 2RHQB 5EPJA 1NBFC 2MX2A 2Y0SB 4C3JG 1LTLA 4MJSA 5I6WA 4GOPC 3MXUA 4DNRB 5E3FA 5D65A 3S1NH 2DZMA 4Q2JA 1LTGD 1BOSA 1SF0A 1D1KA 1VQPA 3T1YQ 1PTOC 1WI0A 3T51B 5CV4A 2J42A 1YNND 3DVNU 2WXLA 1Z5SB 4FJVB 3NBIA 3ZNHB 4XT1B 3STBD 5IY0A 3TSSA 3E56A 5CV5A 1SSOA 1UAPA 1S40A 5LMUQ 3A8IE 3J80i 4IURA 4LF7Q 1RTOA 2R7FA 1E5WA 1V80A 1T5EA 2ACZB 1IBKQ 4C3HB 2IHFA 4A3MH 4EQNA 4A3GH 2BS4B 4BY7G 4G0NB 1GUGA 1TZ1A 1IL2A 2CJOA 2IJ0A 3T9LA 4RA8A 2V1YA 3J81j 2ZTCA 4DNIA 3NHEB 4HRSA 3EJIA 3CCUA 4KV6A 3DDCB 2BOSA 3RULA 3K0YA 1V81A 5IO9A 5C3JB 2KCMA 4DV6Q 1FRRA 1FM0D 4BY1H 3CSFA 1PFNA 1LYLA 3QO2A 1CZPA 2FCSA 2DAJA 2B63H 5KYIA 3DBHI 2WDTB 2JA5H 1HFNA 2WS3B 1PFBA 1TWHB 2OXPA 3RZWC 3W5OA 1Q81C 3NZ3A 3ZUNA 3P1MA 2AWOA 5L95C 1PYWD 1SNOA 2OCEA 3M4QA 4KD3A 3V2TA 3NEMA 1D3ZA 4OXPA 2VZKD 2HCCA 5D94A 3BY4B 1F77A 1JB7A 3NS8A 1B44D 4TQ1A 5C4XG 3DXJC 3BG3A 2DNFA 1I94Q 2O2VB 2V4DA 3RZDB 4Y7NH 1K8AC 3KDFB 3KFUA 1LV9A 3D4DA 4X64L 1IPGA 1XT9B 4OWTB 4DR4L 2CCZA 2C5LC 2PE9A 3NQTA 4YY3Q 3EECA 2DYMA 2TMPA 3NVVA 2MEKA 2NYZD 3DHIC 2PQEA 1N63A 3HOZH 2B2WA 5CHWA 4FHJA 3ND8A 4Q0FA 1WGKA 3F1ZA 3AE7B 3NOBA 2BS3B 2EELA 3Q8FA 1YX6B 2OTJA 1G6PA 2A1AA 5FJ8G 3L08A 1EY5A 4I65A 3ZXVA 1ROEA 1IKLA 2D9UA 1J7AA 5EPLA 1QQRA 1GO3E 1X32A 3G6JB 3QR8A 1SN8A 5HKHA 3B08A 3ZLZA 3AEVA 2PQAB 5G3LF 1HNWL 2ASQA 2SNSA 5M3MB 4LFAL 1CKNB 4MHEA 1PZID 4OX9Q 3CPWA 2LXJA 2NVYH 2WDVB 3AEBB 1UEAB 4CKEA 4JV5Q 2L0TA 2MWSB 2K01A 3OMGA 5DLQE 1J5EL 2KXJA 3LYYA 3HKSA 1QVGA 1U4PA 3IFTA 4DR5L 4A3KG 1WMHB 5E1FA 2WDQB 5I9OA 2HIVA 2Z59B 2JA6H 1Y56A 4DHJD 3D0FA 5C5MA 2OEOA 3AE8B 1PVOA 1VD2A 1O7IA 2CWAA 1KDBA 3AFPA 4JI1Q 4LTUA 3VTVA 3V60A 2AQ3B 4KHPQ 1IYUA 1FJGL 2JA7G 4L8JA 3N6RA 4FF1A 1IBML 3RLOA 2F3IA 2IX1A 2LRWA 2N9PC 2PPHA 1KLGD 2CHWA 4GLVB 2X69A 2UXBQ 1V8CA 1T0YA 4US8A 3UF8A 1D6EC 2KQ7A 2BT6A 2M56B 3NVZA 4QY7A 1WTXA 3ZRCA 3S1RH 4KHVA 4NAWB 1WTRA 4RGOS 1CJEA 1I6HH 1JALA 4OO1G 1E9MA 1R4NI 2VW9A 2I38A 4NPSA 3V05A 1IUEA 2V3PA 3APCA 3TMPB 4GLAC 1U4RA 1GUTA 2O4XA 1VZ8A 3EIVA 3LX0A 2ZXRA 4LDTD 1I6VC 1RFKA 2LASA 4DR7L 3GTLH 1DGJA 4W9CA 5IN7A 4YSXB 4FBJB 1QF6A 4DN4M 3FILA 2G5DA 4JI4L 2ALYB 1BCPC 1BXTA 1EQRA 3TEWA 3RI7C 3OWFA 5C3EB 1UWVA 4A93B 2W3SA 3OLMD 1XNQL 1S5CD 4JBJA 3NJTA 5IODA 2BDOA 4HJKA 2K5HA 1F9SA 1EF5A 3UGBB 4M1UB 4EZLA 1LT4D 3AE3B 2WXQA 4KI0A 3R2IA 4DV3L 4NPNA 4WJNA 1O7LA 4A3LH 5H8YE 1BNZA 3Q3NC 2F0LA 1BCPB 1CFMA 5IGGA 4JI7L 1OEYA 1A6XA 2K0PA 2CKZB 2MLBA 2N9EB 2JY6A 4GSWA 2DENB 3CP0A 1GKHA 1WGDA 1JJGA 3D31A 1FCCC 3EVQA 1Y8OB 2MJ8A 1ZW7A 3I57A 1TWGB 4W9EA 3OW7A 2B2YA 3NY5A 3OHXC 1C9FA 4JWSC 4MACA 4ARCA 4JBMA 2BCOA 5HURA 1E90A 4CYEA 1R4MB 5T1IA 4P16A 2RSOA 1KNAA 2VB3X 1W3SA 1PHJA 3N9YC 4X6AH 2WP9B 4DV5Q 1TS4A 1ML0D 2IY1B 2A8VA 3HZXA 2W55A 1N5XA 3CAMA 1WFQA 2WXMA 3A9KB 2NPTA 1JWSD 3AEFB 5JJZA 2KA7A 3GTOH 4GU2A 4JX1C 1OTCA 4IFDH 3WCQA 3CCSA 2KCNA 1WFYA 1UBIA 1VMCA 2R93G 1B4OA 1ICWA 3D3RA 2RDBC 4KVGB 4ABNA 1B3AA 4DV7L 1DONA 1XO3A 3NG0A 4W9DA 1ASZA 1C7YA 1EM7A 2WP8J 2JRHA 4IM2A 2D07B 2PLPA 3CCVA 1WM3A 4BBRB 2NN6G 4EZKA 1HH2P 5F2DA 1WYGA 1QWYA 4HVBA 4OHJA 1X55A 3I4OA 5C5LA 3RMKC 2JXTA 3PUYA 4RHRA 3RZOH 2A4ZA 2ZPNA 4WWPA 4A20A 3R3OA 3Q69A 3ETRA 4R8IA 2KCCA 2B2WC 2LS01 3C2PA 3ZVVA 2ZNVC 4ZHOA 3M7GA 3GTGH 1GUSA 1IP9A 3PGZA 5I6YA 3Q3JA 3J81c 4OVZA 2KQ4X 4M02A 1FL0A 3ITPA 5AZFA 5CV6A 4OGQC 4DDID 4QCLA 4HPLB 5BO4B 3H1UA 2L5TA 3HKZB 1NUCA 4RF1A 2VZAA 4ZUJA 1BUVT 1EYGA 2B76B 4AYBB 1DOLA 4PS3A 2K3UA 3QHTA 2LFNA 2ZNVB 3CMMB 1XCTL 4BY7B 2LGIA 1EZ6A 1SGHA 2ZJPA 2GLSA 2QKIC 2V1CC 1VRAB 3VXWA 3QIAA 4HMJA 4EQ5A 4IPDA 2UUAQ 1V2YA 2N7EA 1YNJC 2L83A 2W82A 4XDDA 1QE6A 1L2FA 4BBNF 3H0GB 2I5HA 4DV4Q 1N60A 2IHEA 2Y5PA 2A6EC 5IAAC 3N32A 4DWFA 1D7QA 2JPHA 4IM0A 1K8MA 3KF8B 2RGFA 3APFA 2IO1B 3NRZA 4DR6L 2WYQA 2R7ZH 4TQUS 2ZJDA 1C4PA 3NVWA 4OVVA 2KBNA 4B3SL 4WJQA 3ZNID 1WJJA 3H6MA 3AEEB 3BWUD 4JI6Q 3A0JA 1C9OA 1IW7C 3PO2B 3KF6A 2EKIA 2HDEA 5BMIA 2WXOA 4NQKE 3T1HL 2BYFA 2Z6KA 3I3TB 1G6ZA 3HOVH 1TKGA 1WGHA 2WNMA 3I8ZA 3J80c 4IOIE 4C4VA 3PIPA 3Q22A 3D4RA 5G5HA 1IHZA 2G4DB 1ZPSA 2G1EA 3I5JC 2N88A 4NW2A 2K03A 3DM1A 4H13C 2GBJA 3AM9A 3VR4A 4HN7A 1PH4A 4RH6A 4ICUA 2FHTA 5IP4D 1F2LA 2JUOA 4HJ9A 2UU9L 1HNZQ 4PMCA 4HJ8A 1JMCA 4XDCA 2N9KA 1E1OA 1FGUA 2C7MB 4IJHA 3NBHA 4HJGE 4I6LB 2L12A 1HR0W 2GBRA 1XEEA 4B3RL 3TQYA 3QOLA 1P3QU 2KJ6A 5CGKA 3FILB 3Q2AC 3IG3A 3SK8A 2MW5A 1ILPA 1Y69U 3A33B 4QB4A 5FKAC 1AEXA 1L1OA 1STEA 4HAEA 3I70A 3RD4A 2VUMH 2A5HA 2B2YC 1I3QB 3VA5A 4A3KB 3BVMA 3AE5B 3HM6X 5LL6S 1VQMA 1H9MA 5KNCA 1N9WA 3K0XA 3MJ5A 3A7LA 4IPGA 1QZHA 4A3DH 1NYQA 2AL3A 4AH6A 4QMGA 3TEHB 3K8AA 1SYDA 1EO6A 3BZKA 2EY1A 2JA7B 4KGTA 2R92H 2PZUA 3QOJA 5TSSA 1GXDC 1UH6A 1YEZA 3EROA 3T8MA 3F2DA 4DDGD 2EMTA 4LFBQ 2J0KA 3L3OC 1PRTF 1K8RB 4YCWA 1NVID 1CSPA 4OIKA 2LUMA 2WKDA 4A3FG 1V97A 3M4OB 1JB3A 1HCZA 1O7YA 2UXDL 1I50B 4ILWA 1F2RI 4AQ7A 3M62B 4K3CA 2O2LD 3AH7A 4NB3A 1XLPA 3PMFA 5EGTA 4IALA 3IHPC 1KABA 1K83B 4LWCA 2Q8TA 1X6OA 1MJDA 3I4NB 3CD6A 1GUWA 4FXGC 2OQ0A 2LGYA 2WWZA 1CM9A 2FUG1 4WWOA 1JOQA 5E6OA 3VUYA 4BBSH 4K14A 5HGTA 2HHHL 4FDBA 4QAYA 5CYUA 2OTLA 3SK6A 2KWDA 4NXNL 1KAAA 4RAUC 2WXGA 2ZCCA 1AZPA 5M5WB 1PRTC 2Z0DB 3SHLA 2K05A 4CKBA 1JCKB 3CQZB 3BVZA 5AJ3Q 2KCTA 2WB1G 3PUVA 4JOIA 4MGZE 3NENA 3RN5A 4C00A 4B3MQ 4QL5A 3WAPA 4RFBA 5D2MB 3HOUB 2B3GA 3W1SC 1PZKD 2LMCB 4M0WB 2RCFA 3S2HB 1VQHA 3K9OB 3BVGA 2KDBA 4A3JH 2NVQB 1L5PA 2J52A 1E2WA 5EKKA 1PRTB 3NS1A 2KO3A 1XWEA 3TS2A 1H9RA 1PH7A 1E7UA 1BBUA 2JN4A 1XMQL 1MKHA 2LXCA 1A62A 4PS8A 2IDYA 4OZAA 1WRIA 3Q3OC 1EL0A 1AYFA 2I5MX 3SGIA 1JWAD 1V5OA 3U4VA 4X3KA 2LEKA 1H9JA 5FLMH 3B9JA 3DPDA 1LTBD 3H6NA 2EYLA 3M4YA 2LJ5A 4DAPA 2EYHA 4A3BB 2HE7A 1SIFA 2NS5A 4W9FA 2MBQA 3AN1A 2F0OA 4PMWA 2ID0A 3GV3A 4OVUA 3HOYH 3C1EA 3QIJA 1WCMH 3QJZA 4L6TB 4R3DA 2QDBA 3GTKB 1NI3A 1PGBA 2MO0A 3PO3H 3AEDB 3N20C 5EKLA 1SRUA 4ZYSA 3MHZA 3PCOB 5JVG3 3B2FA 2B39A 2PPBC 4KSKC 2Z6KC 4QJFA 4GOCA 4MTKA 4X3UA 5KGUA 4HMIA 4P75A 1YJWA 3FRPB 1CQVA 2Q2HA 4C3HG 2MSED 5CR3A 3U50C 4LFCQ 3R7QA 2JP1A 4A3EB 3A56A 3CWIA 1JC7A 2LY7A 3VHTC 2MHVA 5GXGB 2L1BA 2B2VA 1NMFA 3VQIA 1C3TA 1EUVB 1XCQL 1MJCA 2VXWA 1WIAA 2AWTA 2OJRA 5KHQA 1WJ4A 1YVCA 4JIOU 3K58A 5J1ZA 3TZDA 1Q86C 1GAQB 1JORA 2IZVB 4JI0L 4C4VB 2KVZA 5C0XG 1E2VA 2WU5B 4K5VA 5IP9H 1UGMA 3SFDB 2A74C 4QIWB 1PTOD 1U9RA 5IGFA 2D3CA 2KJRA 2D0PA 2O6VA 1H9KA 1Y1VH 4R4CA 1QZGA 4OONA 3KW5B 3Q8EA 5LNK1 4KK7A 4I7AA 3NPPA 2E2IH 2AEHA 3E9IA 1L1OC 2MQHA 4X66Q 2KFKA 4G50A 2XRSD 4KSLC 5DPWA 5CX3A 4H44C 4IZ8A 1Q1EA 4YTNB 2CHBD 2DNCA 2RF4A 3MC0B 3LJ3A 4BA1I 3M3YH 2LVQA 1GPXA 1SE2A 3NBHB 2KEEA 5IYCG 2P5ZX 1TVXA 3L54A 3NVYA 1UE5A 3JAML 1QLBB 4XYOA 2SAKA 2EZVA 2AUJD 2PKOA 1TBEA 3Q6BA 4NXMQ 3AU7A 5ELFA 1E8YA 3S14H 1GD7A 3K7AH 3S9WA 3J7YW 5IYBG 4J3OD 4IJLA 2KX0A 1JJ2A 1RM6C 1LTAD 3CCQA 2VRRB 1TS3A 3HVZA 4KKUA 2D5GA 4PYUA 1AE2A 5JEAH 4X62L 4H02A 2JT4B 2R6GA 4LF9L 2IO2B 2QMTA 4YHHQ 1PMRA 5C44H 4KJNA 4FNFA 4JBWA 4GDLB 4II2B 2K32A 4DR2L 3SD5A 4XT3B 4RWSC 2E2JB 3P1HA 3AI5A 1Q3LA 1LTRD 2ZTDA 3QWZB 4MGIE 3KVFB 2FAZA 3PVLA 4RGMA 1LM8B 4G7OC 2JA8H 2SDFA 5AZHA 5GAHC 4YXDB 4PZ6A 5I4DA 2WV6D 3CW2C 1XYIA 1JRPA 2MHJA 4GS3A 1JWMD 3MWYW 2E5LL 1T0RC 4BAXA 1HQMC 3KDFA 4JOIC 2F0HA 4BVUC 3TZUA 3PZ7A 4J6IA 1UD7A 4DU9A 2KUMA 4POFA 3CF5A 4YHHL 3S2DH 4EFOA 4KHZA 2H4OA 2OT2A 2NVXB 5JPMC 3F2UA 1R9TH 5IYDH 4FXCA 2DY8A 2C7HA 2GBMA 2E3TA 2Z9HA 4P72A 2DX5B 3L13A 1R4MI 4K3BA 4KZ0A 5HY6A 2GA4B 2WXNA 2M17A 1HNXQ 1TQOA 3CF6E 3MEFA 2F3WA 2XWBB 1RKNA 4KX6B 1J19A 1TT2A 2XRQD 3BDOA 1Y1WH 3W1GA 3JYUA 4LF6L 1VR9A 2KOLA 5C3EG 4A93G 1GM5A 4O42A 2K1BA 1LTSD 1H9SB 1RHPA 1IBLL 1A2UA 2BVCA 2KN4A 4JI8Q 4IUTA 1ISNA 1SE4A 1WMHA 1RYJA 3VR9B 3RFZB 3AE9B 1JQYD 3MC9A 4J15A 1J9OA 2CW0D 2K6AA 2DJGC 5GQOA 4ZRIA 2C9OA 3ZNGC 1EY4A 1FCLA 3FPPA 1FNUA 4C2MH 1K8GA 3JW0X 4IWQA 3X3NA 2FXQA 3DEPA 3BK2A 1U4LA 4JPBW 2VQFL 1V1QA 2QSDA 4JYAQ 2DZKA 4XQQA 4CJ2C 3AE6B 1PXUA 5JHBA 4CDFC 1VQBA 3SE0A 1YX5B 2NVTH 1MSGA 3UIOB 2AWNA 2B2VC 2I5LX 2L4NA 3J81i 2KDMA 2ONQA 4R4QA 3RYTA 1QUQB 1HQRD 4HDOA 1WZ3A 2J0MA 3AE2B 4NAWA 3ZTCA 1GOZA 1SXTA 3MTSA 2A6HC 4ZK9B 3HUIA 1TWAB 4KY7A 1GUOA 3ND9A 4BKSA 3DWMA 1XD3B 1N32L 4XC2A 3SR6A 4YIJA 5D14A 4FYDA 2H89B 3S1MH 5D3IB 1LT3D 3R8BA 1IGDA 1F2YA 1PH6A 4K6LA 3HOWH 1AH9A 1MHXA 3B0AA 3ALBA 1WJNA 3NWSA 4ME5A 5IGBA 1WH3A 4G4KA 2RHSB 4DAVA 4AS1A 4K1RB 2VH2A 1DOXA 1MG8A 4LF4Q 1OXTA 4JI5L 5C3XA 4BBRG 3VH4B 1NR4A 1BUIC 1S4ZA 2MO1A 2QF7A 4A3IG 1LT6D 3Q8DA 2N7JA 1C4CA 2MJ3A 4BWGB 1VLBA 2BDNA 1F9PA 1SYBA 4HSVA 2JWZA 5C1ZA 1TIID 3DHQA 3IT4B 1KOTA 4YSYB 4MSMB 2K5QA 3VR2A 2K28A 5LMNW 4UAIA 5H92C 4NKLA 3I4LA 3L9AX 1E8ZA 4P73A 2KFKB 4Y52H 4A3CH 4IPHA 2N78A 5HG2A 1FNWA 2H5XA 2A73B 1R4PB 1N34L 1WY8A 4P1CC 3CIRB 3HKZG 1HTQA 5C0XJ 2LHDA 5KIXA 5CBAE 2OJWA 4S17A 5IOIA 1JWBD 5BYRA 3IRBA 1WVLA 2F03A 3PSIA 4AYBG 1EWIA 3WWVA 1K0SA 3A9JB 4KGRA 2YTYA 1WTPA 1TYGB 1PTOH 4XZ4A 3MFYA 2L15A 1WE6A 4YTPB 3GS2A 2KLCA 2UUBQ 3K5OA 3KUCB 1E24A 3A9KA 3M9BA 3N1YC 5JHAA 1K3RA 3FKIH 1SNDA 1I5FA 5J39A 1EY9A 1WGGA 4MEMA 2KT7A 2YEPF 1WRDB 1IZ6A 2IY0B 1RFAA 3H0GG 2J0JA 2Y3AA 4RMFA 3DVGY 3CRKC 4DK1A 5A2QE 1P98A 2F4VQ 3ZJUA 3K6OA 2RPQA 5EQ0A 3T1YL 1HZCA 1HZ5A 4G11A 4P6VF 3X23A 3GE3C 1D5XC 4QGUA 3ENEA 1TWHH 3W5VB 2AQ2B 1PDXA 2M2LA 1N6ZA 3H7PA 4GZYC 2ZM6Q 1KNEA 3RMHA 1C8CA 2F0VA 5LMUL 2VS1A 4JI2Q 4LF7L 2KWCA 1A3VA 2VH1A 4IUQA 1A0IA 1IBKL 1Q5WB 3PO2G 3P20A 3T56B 2FIDA 2EXDA 1YN3A 2HDLA 1OXVA 3M4PA 2AHOB 3OG5A 4HJ7A 1JQ4A 4C7ZA 1E7ZA 3EC8A 3V61A 5IIFA 5CHVC 1WYWB 4EX5A 3E3XA 2PZTA 1V86A 4TMAB 1QOHA 1UE1A 2UXCQ 1JOKA 1Y14B 2B63B 2WGSA 5IA7A 2EQSA 4R8NA 4DV6L 2JA5B 3VUWA 1YNJD 1MHHE 1WXQA 4CGYB 1A2TA 3G6EA 1RD9D 2BYEA 5G5GA 3ONSA 3EQLC 3P42A 2A6ED 2K1FA 2ZT9C 3KJPA 1PDQA 2IGHA 3HM3A 2YEPB 1MSHA 1YNXA 3K7UC 5C4HA 2C35B 1P8LA 4N8X1 2KTFA 4HIOA 4B0EA 2KN5A 1PYSB 3W2DA 4OO1I 1P7EA 1T0QC 3V6EB 2EPBA 4GN3B 3S24A 4MNOA 5M3MH 1F1HA 2PW9A 2KMCA 4Y7NB 2RDHA 1I94L 2IX0A 2WB1E 1LTTD 3KF8A 2K5VA 3VFKA 1TKEA 1W6KA 1UF0A 4TRDA 5KNDA 1BT0A 1QG7A 1M1KC 4HXDA 2D2CC 2WXFA 3HOZB 1DZ1A 3DBRB 4WQMA 2D3AA 1AZQA 4DXAB 1P9DU 1CUKA 2DY7A 3PT2B 2MBHA 4YY3L 2XEWA 3VRBB 2I46A 2NTTA 3PIP3 4HPPA 2EYOA 1UELA 1UE7A 2WXIA 1MVKA 1L0YB 1R7SA 1X65A 3PZ8A 2UYZB 5COYA 2YYZA 4P71A 4M8AA 3ZDMC 5JH5C 3PF4A 5AEKB 3AQQA 5TR5A 5JPNC 3UI3A 5AUIA 3S2AA 2WHIA 3KWVA 4KKIA 1P16A 3ZJTA 4WQOB 3PPAA 3KK7A 2WXKA 1VZ7A 1L0XB 2Y0SE 2NVYB 5A2QL 3EFCA 1BKBA 1W2BA 1ZE3D 4JBKA 4I6PA 3GV6A 4BS9A 3PUWA 2XK5A 4OX9L 4CBVA 2FMMA 2K25A 2YLMA 3J7AV 2BE5D 1SMYD 1ZYRC 2NBFA 4BA2I 3HG9A 4ME3A 4JV5L 1H4RA 3ERSX 2C9WB 2ZVNA 3KYDD 3L16A 3VTWA 1N61A 3Q6SA 4XIGS 3UI2A 3P75A 2R2OA 3CCEA 2JZPA 2L05A 3GOEA 2BA1A 1ZKHA 1SJHD 3BINA 3P63A 1XPUA 2N9XA 2PW7A 5LHY1 1GB1A 1ILQA 1VCIA 4UP8A 2F0PA 3I4NG 2LSSA 3UQAA 4LCDE 5ELBA 1NAPA 3U58A 1D5ZC 1F9JA 4JI1L 3IAS1 1E1TA 1YJNA 4U673 2E74C 4KHPL 5M5YB 2KTRB 1EEFD 3FEWX 1FFVA 3AU4A 2UXBL 3S1RB 3G48A 2V3NA 4ZLTF 1JT8A 2A69D 4HDQA 2BWFA 3T4AC 3U9OA 3BYTB 4RGNA 3QK0A 3PUXA 1BDOA 1BBXC 4ZRJA 2WKCA 3QJYA 1C76A 2NN6I 1C1YB 2NR2A 3NP8A 3EUB2 3HOUG 5FR6A 3TEYA 2DZJA 2KDIA 5IP7G 4N8FA 1CA6A 2KD0A 2UUCQ 1BBWA 1PUTA 2MQJA 2HD5B 3I73A 2Q8RE 2IX3A 1A3UA 1BR9A 4FN2A 1N8RC 1L2NA 2IY5B 1F2MA 3DVGX 2MBOA 3DQVA 1CI3M 3FP9A 1QNUA 1B50A 4LUZA 4DV0Q 3FVQA 1OXSC 2IBIB 1IYJB 2JSOA 2DYBA 4IPCA 1KIXA 3ML8A 4Q5VA 1MPEA 1YIJA 5FOBB 3QQ8B 4M00A 2HTHA 4PG3A 2JSVX 2MNAA 4A3BG 2Z0EB 4HPMB 2LXAA 2D10A 3ZRFA 4ANXA 4C1NI 2K7VA 3AEGB 4GKJQ 4GNXC 1MG4A 4EVOA 1E0ZA 4YSZB 2JX5A 1EIHA 1T0SC 1GC7A 3I3CA 5C23A 1VQ4A 5AFWA 2B3AA 1I35A 1O80A 1UNSA 4NY0A 3VR8B 2WXJA 2NZ1D 1NY4A 3AE1B 1LFDA 4LW1A 4DPGA 3TDQA 1YNNC 3H7PB 4C3JH 3T13A 4A3IB 4JCVE 5J17A 2L76A 4A3EG 4GNXB 3FDTA 3OYYA 1EY7A 2LMCA 3N3KB 4DV5L 4M0WA 3AXCA 3W1BA 5FO8B 1NDDA 3ML9A 1EU3A 5AUKA 3H7SA 1Q12A 5K36G 3UINB 4ASWC 1GUAB 3H91A 2F3VA 5FLXc 3RNFC 5E6PA 4L63B 1BMLC 2LFIA 5ELDA 1VQNA 1D5MC 2INCC 3A1QB 4GLSC 3E0JA 3C46A 2B2UC 1YOVB 3H3VC 3G7LA 5LMNQ 2K8HA 3Q8AA 1P0RA 4DHZB 3K59A 2QW7A 5AZGA 4WJWA 4KN7C 2KNBA 1JW9D 3Q14C 3W1SA 5EBCA 4BY7H 1BO0A 2JE6I 3GO5A 3RZOB 2BH8A 2PI2E 4X65Q 4HR7B 1XMOQ 4FF4A 2J7ZA 3P7JA 3L17A 2PNRC 4A9AA 2YU9B 1V9PA 2KC1A 2HCIA 1K73C 4UY8C 3I91A 2HUGA 2MUYA 1L6VA 1KD1C 1WM2A 2B8FA 4L5SA 3RZFA 1C4QA 3HOXG 1E7PB 1X3FA 3CMAA 3CMEA 2MJDA 4XGAB 4F8MA 2KENA 3GQBA 3UDXA 4JGHB 5NUCA 2JYEA 1UEBA 1YIWA 2I1KA 4TQ0A 2L8JA 1VQIA 4NZLB 1L4DB 1I42A 1GJZA 4K5WA 1FYCA 1E8WA 2WAQB 5BMGA 3C19A 2G9HD 3L7ZC 3TREA 5I2YA 4DK5A 2KHJA 2K5WA 2EYJA 3I2ZA 3K5NA 2G3QB 5CHFA 4B6WA 3ZGZA 5C4XH 1WR6E 4LNIA 1ZDXA 4DAYA 2KHIA 4C3IG 3J81E 4WH4A 1C0AA 1CSQA 1WGYA 4BBNC 1XMOL 1Y8NB 4BKGA 5FLXE 5JAVA 2UUAL 1E3PA 1YQBA 1T5XD 2FCMA 3WOEA 2F0JA 3B6YA 4TSSA 5M3FG 2FNJB 2QCZA 4X3TA 1G6JA 4DV4L 4C1NK 4EUTA 1QNKA 3TP6A 1PV4A 3A5ZB 3OTOQ 2JRIB 3ULJA 3HHMA 4XDXA 2R7ZB 3A5UA 3CC2A 3F2CA 2XK5B 2WFWA 1SNPA 1S5ED 3NUCA 5FJ8H 2E2HH 1IKMA 3OIQA 1V1PA 4LF8Q 1RCVD 2QDLA 1HZBA 2F0DA 3ZJVA 3KJOA 4JI6L 2KMMA 1V43A 4DK3C 4EQPA 3TEZA 2VNUD 1J6QA 1LM0A 3HOVB 1FMAD 5L83A 4AP4C 1FGBD 1NEKB 2G9DA 4RHSA 2RVLA 3NSWA 4KD4A 5C3WA 4G3XB 4EEWA 4GKKQ 4GIVA 4L2YA 2E8GA 1E10A 5KEEA 1MGSA 1N33Q 2VQEQ 4A3KH 1PQSA 4QUCA 3M95A 2V9HA 4DXFA 5T1GA 1VQ7A 3LWUA 3JC66 3SHQA 1J8CA 3RNCC 3AECB 3T3NA 2I0QA 2ZXPA 3SVMA 3NQIA 4GGQA 4DUZQ 4HWIB 2F0FA 4ZKCB 1HA6A 1HNZL 1EY0A 4LF8L 4DHJB 2JA7H 3P4QB 4OW0A 4UP7A 2VY3A 1EOTA 1EYAA 3J80E 4FULA 4GDLA 3VYTA 1L4ZB 1VQLA 1M94A 3ZKJC 4C7YA 2E2DC 4M01A 4A3PA 3SR1A 1X54A 4AUQC 1WTOA 1KF6B 4GDKA 1HEZE 2KANA 1RF2D 1EQQA 1ZDVA 3N52A 2D5DA 3HP3A 4DUYQ 3M4OH 1I50H 2A68C 4OO1H 2E75C 3PO0A 2QA4A 4IUMB 2VUMB 5CV8A 4JI3Q 3T53B 3OW2A 1PGXA 5BR8Q 2NZOA 1G8ZD 4IOAA 3HKZE 2QEXA 5C6AA 3SK4A 2ZVOA 3CPFA 1Q1BA 4AYBE 1WX8A 1Y8RC 1EFID 2K5PA 3QARA 3P4SB 4NP5A 3J81L 4RM8A 1UUPA 4RKLA 1XQQA 1V9JA 5DAUA 1S3OA 2JQOA 5FLXL 1HXYD 1C77A 1VZ6A 2QC8A 3ZO5B 4XWWA 5M5WH 3TS0A 2C60A 3RD2A 3S15H 2A5UA 4O2DA 5BYQA 3CQZH 1YHBA 2IW3A 1WF9A 3MAQA 2J7QB 1Z9FA 4LFBL 2V4IB 4KY6A 2PZWA 4WORA 1PFDA 4NQLB 3ZIMA 4APVA 4U68A 2IGDA 4O1NA 1SFOB 2PMVA 1QILA 2GBKA 4ZRPA 1Q90A 4LUVA 1SE8A 3EN2A 3FKYA 4LJPB 1I4RA 2X6GA 5IT9c 3IBEA 3IFDA 3P4PB 5M5XB 3HRDD 2IWHA 3EHVA 1WD1A 2ZEQA 3CCJA 4BBSB 1H9SA 4OL7A 4ZHPA 5M9OA 3VA7A 2N4FA 3RLFA 2R7DA 1V5TA 1UGJA 4E3CA 1VQOA 2K22A 4BXXG 5JXVA 3TUOA 1SJED 5T8IA 1BVSA 3KBXA 5C0XI 3U7ZA 4HCNB 3FC4A 1WTWA 3GP7A 5FR3A 2DWQA 2VL6A 2Z8LA 3KYHC 4BZAA 2L32A 2JXMB 1LTID 5AJ3L 1A70A 5H1SE 3C0RB 2F0UA 1ESFA 4GB9A 5IGCA 1FIQA 2A6HD 2Q2TA 3GTKH 4DK6C 2XGTA 4B3ML 4IQZA 2WIIB 1E7VA 2KK8A 2R93H 1TY2A 3NTKA 4A3JB 1CK1A 4C56C 3VUXA 5GROA 3KLWA 4KIKB 4AWJA 1X3QA 2IGGA 3J80L 2D3GA 1QUQA 1R4QB 2O6VD 2PNHA 4ZOHC 1PH8A 5EDSA 1UWMA 2NVUI 1NR2A 4PS7A 2NN6H 2BH2A 1S5FD 3BYYB 3DWQA 2LWPA 1ZKOA 3VAWA 2EMSA 3E9HA 4HCEA 5E4XA 5EPKA 2QIEB 1EYDA 1NI2A 3UDGA 3GE8C 3I4MB 1U4MA 2ZW0A 1K51A 3PRMB 4KKJA 3TCAA 4P74A 1KLVA 2PMZB 4F87A 5IT9E 5D7GA 3HFZB 5G55A 1QCBD 3TRZA 3A55A 1MI0A 1MBYA 3HOYB 4DAYB 2D0OA 5IE8A 3DBLB 2IT1A 3HGBA 4HSPA 3C8YA 1D4BA 3C3LA 2BW2A 3PO3B 1NCVA 1TWCH 4K7WA 1ZXHA 2NBVB 1ENCA 2NZHA 2C5CA 4IWOA 2HTME 2FMCA 2F0IA 4MTNA 4MZ9A 4V190 2EY2A 1JE5A 4A3MG 5FK9C 2NB0A 3F2BA 1EU4A 4A3GG 2MP2A 4KKTA 1FO4A 4UDUC 5C2TB 3M63B 3DBRI 5C4JH 4LNOA 3CSTA 2ASBA 1QJOA 1V1PB 1FXAA 1NTGA 2FFKB 4LFCL 3VDYA 1FXIA 3SU8X 1WD0A 3OSOA 2M0XA 3D8GA 1WTQA 1ZUD2 4BY1G 3LDZE 4K2LA 2N1VA 3HOXB 3QC8B 2B63G 1E0BA 2NWGA 2R2QA 4JQWC 2DNEA 2ZTEA 2JA5G 3V6CB 3A9JA 3QX1A 2CFMA 1VQ9A 1JRUA 3DMUA 2INNE 5K5PA 1Y1VB 1RJTA 1J7BA 1G2SA 1GNUA 3MVVA 1WR1A 4FJYA 2EYPA 1DOKA 2LHEA 3GZNB 2WACA 3KUPA 2Y5CA 5FO7B 3FMCA 3I72A 2E2IB 4GN1A 3IL8A 4K0KQ 3S17H 2BTEA 3M7NA 5JEAJ 1QVFA 3AMZA 4C3IB 1G2TA 2AL6A 3U52E 3S1QH 1YJIA 4X66L 5CORA 4LNKA 5M3FB 4GLXA 1XF5L 4ICVA 1U5KA 2E2JH 1YI2A 3TP7A 1SSNA 4HCSA 3HOZG 2BQQA 4PK1A 2EJFC 3RNEC 4GDKB 1EOVA 3S14B 3DWGC 3KYCD 4ZRKA 3IFWB 4NXML 4TKOB 1N62A 4XQJA 3AU5A 4KLKA 1HTOA 4K81A 1RIPA 1EY8A 1P7FA 2D11A 2K6DB 2BGFA 4HEA1 1VQEA 3R66C 5I9PA 5LL6X 1ASYA 1STBA 4J8QA 4N9PA 5DNFA 4K0KL 1FFUA 3K81C 5C44B 1Z7TA 2LRUA 1VQDA 3F8TA 5JVH3 3MC8A 3RR5A 1AP0A 1TWFB 4YWLA 3J7AF 2F0NA 3IVFA 1WXMA 4NJCA 1OTRB 3BDLA 4DR1Q 1NMGA 1HR0Q 1UZXB 2K8CA 2N8NA 2KQSA 3NWTA 4PT5A 5EE1A 4AQYQ 2RDGA 2JA8B 5DEHA 1XX8A 3RN2A 3UE0A 1STNA 2LGSA 2JA6G 4LLGM 1STYA 1N36Q 3DHGC 3MXNA 1KQSA 4IWPA 1JOOA 2EIFA 1D2BA 3RN9C 4HCPB 1I4XA 2XBBC 4DV1Q 2REXA 1ZP0B 3FHWA 5BN4A 2BB5A 2JYOA 4RMAA 3U7DA 1XJVA 4KMUC 3L2PA 1QB5D 2ZZPB 1NENB 1K52A 1KRTA 2ZCBA 4CHTB 1SNCA 3AV8A 1WJUA 3J9CA 2DAFA 4DQOC 1DJRD 2KJXA 1SEBD 3C1FA 4YCVA 1V8QA 3S2DB 1HZ9A 1YITA 1CHPD 1HE8A 2KWVB 3WALA 2JK8A 2KACA 4A3FH 1R9TB 4HROA 2GN5A 4BKSD 5G3LD 2MRPA 1J8IA 5J2RA 4MM3B 4JE3B 1ENFA 4DR1L 3IAYA 5JJKA 4MN3A 1S3SG 4YT0B 3IXSA 4LF5Q 1S5BD 4L5RC 1HRJA 1B8AA 3LXFA 4CDCC 4IUUA 4QIWE 1ACCA 1ZYRD 3V62A 1LO5D 1XLOA 3L0WB 1VQJA 3MHBA 4BOZB 4E6IA 2CHXA 1STHA 4ZDVA 2M1MA 2B29A 5E7NA 1HNXL 2K4KA 2XN9C 2XSCA 3TN2A 1OGWA 1I4QA 1YHAA 2AMCB 1YJ1A 3KQ4A 3GTQB 1ZXTA 3PF5A 1VQCA 2DHZA 1Q1OA 1EEID 3S16H 2N55A 1Z47A 1YZ6A 1NNXA 4I6NB 2FCNA 4C80A 3E5SA 1BCPD 4JI8L 2MFIA 4DGZA 4A3LG 2N49A 3JSVB 1XTCD 1WJ6A 4YWKA 3MA2B 1HTLD 3RNBC 1X1MA 4W9LA 3K5LA 1DD2A 4AJYB 1EYCA 1V6EA 1OQRA 4JLCA 1JE4A 2LXKA 3GTPB 5CBEE 4REZA 3B2GA 1AE3A 4LK0M 4JYAL 1TXYA 2KTRA 4LUOA 3GTJH 3MJWA 3SXHA 1HA5A 3H3VI 3EFUA 3GTMH 4JW0A 1EIYB 4ZRQA 5KHOA 5GADC 4F8CB 2RD0A 1AFPA 1CHQD 2MH7A 2MP2B 2WINB 2WQYB 3Q3MC 2RMMA 1PTOF 4FJZA 1ZGUB 1X3GA 2M00A 4N9TA 3I63C 4PYZA 3M85A 1HUNA 2CJNA 2KX3A 1LLRD 4IFDG 2I07B 1ZOYB 1QVCA 3HOWB 2JWUA 3IKJA 4FO2A 1QZEA 2FBWB 2IO0B 2SEBD 1QOAA 1WE7A 2JQRB 4P1BC 4FP5D 2L1AA 2L55A 2B2TA 4OIJA 4CO7A 2EDGA 4NNJB 4HIKA 1TU2B 3UIPB 2M8SA 2Z6BA 3DWPA 4C3HH 3WAMA 3EGRA 2RSNA 3E6ZX 4AIMA 3KWLA 3AYHB 5IGDA 4MT5A 5JZEB 3E0EA 2PTLA 4LF4L 1NE3A 2ENBA 3N1XC 4DXGA 3ER0A 3S1NB 3CCRA 2RKSA 3CCMA 2JJQA 4POGA 1OFFA 1IBXB 1K3BC 1NBWA 4DBGA 3ZJYC
chains in the Genus database with same CATH topology
1B1ZA 1TS5A 4J1MA 5C0XH 1QT9A 2VB2X 2F0MA 4B9WA 1YNTE 1YQ3B 2L0CA 4A3MB 2BB6A 1PTOB 4A3GB 5DM73 2R61A 4XWTA 4IUPA 3FKIB 4DK0A 1MD2D 2XIWA 3SK5A 3H94A 5EE3A 1EWCA 1VF7A 2N9LA 4BY1B 3VR5A 4B0MA 4G7HC 1DOMA 4FXKC 4WWMA 1I4GA 4FF2A 3W9CB 4H7BA 2H1EA 3X3MA 3D6WA 1I7HA 2OHFA 1IL8A 3DEOA 1SIJA 1IYVA 2KECA 3TEXA 2B2UA 1O7ZA 3CRLC 2EXZA 3GD7A 2Q8IB 2INPE 5CV7A 1IW7D 2XWJB 3EFXD 1HZ6A 2QJLA 1BQQT 4JK1C 3NTIA 2QEJC 2SOBA 2O5JC 1K8OA 3BIID 4KKSA 2E76C 1DM0B 2B8GA 2K33A 3MEHA 2L11A 3GB1A 1SNQA 1OXUA 2PCFB 3VR6A 1SYGA 1GHJA 2IPKD 1ONLA 2BA0A 2M19A 2NTSA 3Q24A 3NUHB 1ZEQX 2MJEA 2MP1A 3K5MA 3I90A 1GB4A 1F0ZA 3AB5A 5CC4A 2XNAC 4XYQA 5A35A 1EY6A 2JA6B 4N6EB 2KQ3A 3VR3A 1JICA 3D6CA 3OMCA 3A8KE 4US9A 3IT6B 2F0QA 1BCPF 5EJWA 1CZGA 1KLUD 2CW0C 3VYUA 2R3ZA 4G57A 2AQ1B 1F9QA 2JYTA 1I6HB 2B2TC 3ERQA 5MPOA 5EBDA 2AX5A 3P4RB 3T3OA 1O78A 4ZRZA 3WOFA 3W5UB 2IL8A 1QKZA 2ICEC 3GTLB 2A68D 1HHVA 1K50A 4RCNA 3TP5A 3HRZC 1TJEA 1TZOA 1Q10A 1GJXA 2JEAI 1STAA 1D1IA 4KY5A 1SDFA 5ELCA 4K5XA 4KN4C 3LNNA 1EWHA 4A6QA 4N59A 2WXPA 2MGSA 3AEAB 4LJZC 4WFN3 1M8AA 1PRTD 3IAM1 2OEDA 4IFDJ 5J22A 1CA5A 4LK1C 2PIAA 3U9SA 1I4HA 1XLNA 2PVGC 1RDPD 4EGVA 4YTMB 4S3SA 3BZDB 4FXDA 1SYFA 2OF1A 1K53A 3TMEA 3E9SA 1WTVA 3I9V1 5E4WC 3SEBA 4JWUC 2DYOA 1B2TA 1TKYA 4R9WA 2EY5A 2L9HA 3GTOB 1A15A 2KEDA 5IOCA 4IDIA 2WXHA 1FD6A 1NSNS 2DLBA 1ENAA 2EY6A 3W3AA 3EA6A 5BN3A 1FEHA 4J6HA 4C3JB 3LB8C 2FE8A 1BF4A 1SNMA 3D4WA 3AMUA 5CMDA 4XQNA 3HVDA 3R93A 3GTGB 4WIPA 2FJ2A 3V3XA 4MH8A 1SYEA 1FRDA 4B08A 4K8JA 4NAMA 3AE4B 2PO4A 1YMHE 4OZBA 5KNBA 2K9XA 1OO9B 4QUFA 3K57A 4WRDA 3T16A 3FPUB 4F7XA 2VZKB 3RPFC 3NK9A 1XLQA 4K8IA 2GRIA 2F4IA 4KGSA 4CJ1B 3TP8A 1VMPA 1JWUD 4ARIA 1DOYA 5C4XB 5JEAG 4KTAA 3OOCA 1NYRA 1HPCA 2EJMA 1L0VB 3VRAB 4I7ZC 2WLBA 1TR5A 1V1OA 2KVMA 1W6JA 2E2HB 2SNMA 1EIGA 5HI1A 5E6JA 3KLSA 3Q8BA 3NXWA 2W54A 2BE5C 1SMYC 1PGAA 4XE0A 2WU2B 3DWAA 4K6DA 3Q8CA 3PIO3 2CU3A 4IKGA 5I2XA 3KBGA 1DOIA 2RDFA 5ISRA 2RA4A 3KLSX 4HEDA 1CQFA 1VDZA 2GI9A 2WXRA 2HDMA 3OPOA 4FF3A 4H0LC 2F0TA 2RBMA 1T3QA 1FR3A 4A3DB 3DUZA 2X38A 2A69C 1ESRA 3FAHA 2N0SB 2R92B 1YJJA 1FNVA 3A8JE 2BBCA 2GB1A 2ON8A 1WSPA 1B53A 2WDRB 1X3PA 4FVMA 1SE3A 4A8XC 1JMLA 1CZWA 1KH0A 3R2TA 2FINB 5C4ZA 2NMQA 2KHSA 3KLRA 5EE9A 1VF5C 2F0WA 3L4PA 4N58A 4ZQ3A 2M9VA 1EQTA 2F0KA 1PFMA 4USAA 3Q0AA 1TY0A 3S15B 1KTKA 4H2AA 1AWDA 1EWYC 5EKIA 2RPVA 4P2CB 5HHDG 2AUKA 2QCPX 2J0TD 4ITKA 1B9NA 4D2KA 2ZW1A 3JAME 4XXEA 1SYCA 2K5DA 3PV0A 1E2ZA 4RKBA 5CV9A 2PVOD 2ZXOA 3NTHA 2D62A 2EYMA 2LJIA 3WDNA 5HFYA 1RTNA 1YN5A 1C4AA 4IN3A 1EZ8A 4PMBA 1CTMA 1LT5D 1I4PA 4CJ0B 5K36H 4ODGA 1LABA 1WCMB 4DFAA 2R93B 1OXXK 2Z4HA 1Y8PB 4ZUIA 1KFYB 1KRHA 4JPSA 2HQEA 2KAJA 2L52A 4IUVA 1SAPA 1QOBA 1B9RA 4HTHA 3MXGA 1G291 5KRUA 1SBBB 5JOBA 1PZJD 2RQXA 3HEJA 1JROA 1YQ4B 3RUZA 4LMQD 1L6UA 1TKWB 2J4XA 4PV1C 1IGCA 1Z6HA 1F9RA 2Q5WD 4NMZA 4XTCS 3ONAB 4EE2A 2O5IC 3MP9A 2LKVA 1TS2A 3TBIB 1HUMA 4DNTB 1TWCB 1J7CA 1F2ZA 1FD7D 1Q8IA 4CQNA 3NHHA 4PQXA 1MI2A 3Q23A 4WAFA 3QG1A 1C48A 4CKCA 3QB3A 4V0BA 2DN8A 4ZKBB 3VYSA 4RGTA 5C4JB 1YN4A 2I2YA 2XVSA 3CU7A 1G91A 1WWTA 1IBXA 2PW5A 2CVRA 4RCOA 4YWGG 4DF7A 3AB9A 3BDCA 4ID6A 3U2SC 3M3YB 2PYKA 2TSSA 4ULLA 3ZYYX 1SB3C 2M0AA 1B9MA 2EJGC 4G7ZC 4HKQA 1T6BX 1DYQA 2F0EA 3V96A 1DXMA 2JEBI 4LAAA 1PLFA 3K7AB 2W3RA 4WURA 1A3TA 1DCZA 1AN8A 2EYFA 4DA2A 4L23A 4RNAA 4RF0A 2EOTA 3O13A 2Z4IA 3PUZA 3S17B 4A55A 3LWEA 5EE0A 3URYA 2K04A 1M4VA 1RODA 4OZCA 5IT9L 4IUNA 3BS1A 3S1QB 2DBYA 2EE1A 4NDXA 4PNYA 5KYLA 4X3SA 2V0GA 3OIPA 5BN5A 3NE5B 2QILA 3MFGA 2J53A 4B9XA 1GHKA 1JR0D 3ABVB 1E6EB 1ZXIA 3OWEB 2F0SA 1ET9A 1STGA 5BYSA 4QF4A 1II3A 5BMHA 5ELEA 1UWXA 4Z9CB 2EVBA 3BK1A 5D3DA 2H88B 2F1MA 4L1BA 2Z1CA 1C79A 2E6XA 1QOGA 3H8HA 1Y1WB 1VDVA 4IFDI 3MZ5A 3H09A 3CKIB 1KDAA 4ZAIA 4MIUA 3SDZA 1N5WA 4A3FB 2BS2B 3VYRA 2BYTA 1VJKA 3HS0C 4C2MB 3A7AB 2ICIA 3CHBD 4A90A 4HKZE 2NUCA 2NVTB 1S5DD 1EQVA 5DM63 1KDCA 2F0GA 1C78A 1OQQA 3S16B 3SFEB 1AW7A 5FO9B 2JU6X 1F2RC 2WB1B 1HTPA 3A54A 3U4EG 1QOFA 4KJOA 1LACA 4F88A 3MXPA 2X6LA 1HFGA 2MPMA 4K2KA 3S1MB 1RWSA 3ZQ4A 3QWNA 5IGEA 1XXGA 3GTJB 1CT1D 2CQAA 3GTMB 1GUNA 4EQOA 1ET6A 5EPJA 2Y0SB 4C3JG 5I6WA 3MXUA 4DNRB 5E3FA 5D65A 4Q2JA 1LTGD 1BOSA 1SF0A 1D1KA 1PTOC 3T51B 5CV4A 2J42A 1YNND 2WXLA 3NBIA 4XT1B 3E56A 3TSSA 5CV5A 1SSOA 1UAPA 1XEEA 3A8IE 2ACZB 4IURA 1RTOA 1T5EA 4C3HB 4EQNA 2BS4B 1GUGA 2CJOA 2IJ0A 4RA8A 4HRSA 3EJIA 4KV6A 2BOSA 3K0YA 5C3JB 1FRRA 1FM0D 1PFNA 3QO2A 1CZPA 5KYIA 1HFNA 2WS3B 1PFBA 1TWHB 2OXPA 3NZ3A 3P1MA 2AWOA 1PYWD 1SNOA 4KD3A 3V2TA 2VZKD 2HCCA 1F77A 1B44D 4TQ1A 3DXJC 3BG3A 2V4DA 3RZDB 1LV9A 3D4DA 3NQTA 2DYMA 2TMPA 3NVVA 2MEKA 2NYZD 2PQEA 1N63A 2B2WA 3ND8A 4Q0FA 1WGKA 3AE7B 2BS3B 2EELA 3Q8FA 1EY5A 4I65A 1ROEA 1IKLA 2D9UA 1J7AA 5EPLA 1QQRA 3G6JB 1X32A 5G3LF 2SNSA 5M3MB 4MHEA 1PZID 2WDVB 3AEBB 1UEAB 4CKEA 2K01A 3OMGA 3LYYA 1U4PA 3IFTA 5E1FA 2WDQB 5I9OA 1Y56A 5C5MA 2OEOA 3AE8B 4LTUA 1KDBA 2AQ3B 1IYUA 4L8JA 3N6RA 4FF1A 2IX1A 1KLGD 2X69A 1V8CA 4US8A 1D6EC 2BT6A 2M56B 3NVZA 1WTXA 4KHVA 4NAWB 1WTRA 4RGOS 1CJEA 1JALA 4OO1G 1E9MA 2I38A 3V05A 1IUEA 2V3PA 1U4RA 1GUTA 2O4XA 1VZ8A 3LX0A 2ZXRA 1I6VC 1RFKA 1DGJA 1QF6A 4YSXB 4DN4M 3FILA 1BCPC 1BXTA 3TEWA 3OWFA 5C3EB 4A93B 2W3SA 1S5CD 5IODA 2BDOA 1F9SA 4M1UB 1LT4D 3AE3B 2WXQA 4KI0A 3R2IA 1O7LA 5H8YE 1BNZA 2F0LA 1BCPB 1CFMA 5IGGA 1A6XA 2K0PA 3D31A 1FCCC 3EVQA 1Y8OB 2MJ8A 3I57A 1TWGB 3OW7A 2B2YA 3OHXC 1C9FA 4JWSC 4MACA 4ARCA 2BCOA 5HURA 5T1IA 4P16A 2RSOA 1KNAA 2VB3X 3N9YC 2WP9B 1TS4A 1ML0D 3HZXA 2W55A 1N5XA 2WXMA 1JWSD 3AEFB 5JJZA 2KA7A 4JX1C 4IFDH 3WCQA 2KCNA 1VMCA 1B4OA 1ICWA 3D3RA 4ABNA 1B3AA 1DONA 1XO3A 1EM7A 2WP8J 2PLPA 4BBRB 2NN6G 1WYGA 5F2DA 1QWYA 4OHJA 5C5LA 2JXTA 3PUYA 4RHRA 3R3OA 3Q69A 3ETRA 4R8IA 2KCCA 2B2WC 2LS01 3C2PA 4ZHOA 3M7GA 1GUSA 5I6YA 4OVZA 2KQ4X 3ITPA 5CV6A 4OGQC 4QCLA 2L5TA 3HKZB 1NUCA 4RF1A 4ZUJA 1BUVT 2B76B 4AYBB 1DOLA 2K3UA 2LFNA 1XCTL 4BY7B 2LGIA 1EZ6A 2QKIC 1VRAB 3QIAA 4HMJA 1YNJC 2L83A 2W82A 4XDDA 1QE6A 3H0GB 1N60A 2Y5PA 2A6EC 1K8MA 3NRZA 4TQUS 1C4PA 3NVWA 3H6MA 3AEEB 3BWUD 1IW7C 3PO2B 2HDEA 2EKIA 5BMIA 2WXOA 1G6ZA 1TKGA 2WNMA 3I8ZA 4IOIE 3Q22A 3D4RA 5G5HA 1IHZA 1ZPSA 2G1EA 2N88A 4NW2A 2K03A 3DM1A 4H13C 3AM9A 3VR4A 4HN7A 4RH6A 2FHTA 1F2LA 4PMCA 4XDCA 2N9KA 3NBHA 4HJGE 2L12A 3QOLA 3FILB 5CGKA 3SK8A 1ILPA 1Y69U 4QB4A 5FKAC 1AEXA 1STEA 4HAEA 3I70A 3RD4A 5BMGA 2A5HA 3VA5A 2B2YC 1I3QB 4A3KB 3BVMA 3AE5B 5LL6S 1H9MA 5KNCA 3MJ5A 3A7LA 1NYQA 4QMGA 1SYDA 2EY1A 2JA7B 4KGTA 2PZUA 3QOJA 5TSSA 1GXDC 3EROA 3L3OC 1PRTF 1NVID 4OIKA 2LUMA 2WKDA 1V97A 3M4OB 1JB3A 1HCZA 1O7YA 1F2RI 1I50B 4ILWA 4AQ7A 2O2LD 3AH7A 1XLPA 3PMFA 5EGTA 4IALA 1KABA 1K83B 2Q8TA 3I4NB 1GUWA 4FXGC 1CM9A 2FUG1 1JOQA 4K14A 5HGTA 5CYUA 3SK6A 2KWDA 1KAAA 4RAUC 2WXGA 1AZPA 5M5WB 1PRTC 3SHLA 2K05A 4CKBA 1JCKB 3CQZB 3BVZA 3PUVA 4RFBA 3HOUB 1PZKD 2LMCB 3S2HB 3BVGA 2NVQB 1L5PA 2J52A 1E2WA 5EKKA 1PRTB 3NS1A 1XWEA 1H9RA 2IDYA 4OZAA 1WRIA 1EL0A 1AYFA 1JWAD 3B9JA 4X3KA 2LEKA 1H9JA 1LTBD 2EYLA 3M4YA 4DAPA 2EYHA 4A3BB 3AN1A 2F0OA 4PMWA 2ID0A 3GV3A 3C1EA 4L6TB 4R3DA 2QDBA 3GTKB 1NI3A 1PGBA 3AEDB 5EKLA 4ZYSA 3MHZA 5JVG3 3B2FA 2B39A 2PPBC 4X3UA 5KGUA 4HMIA 3FRPB 1CQVA 4C3HG 5CR3A 2JP1A 4A3EB 3A56A 3CWIA 1JC7A 2LY7A 2MHVA 5GXGB 2L1BA 2B2VA 3VQIA 1XCQL 2VXWA 3K58A 5J1ZA 3TZDA 1GAQB 1JORA 5C0XG 1E2VA 2WU5B 4K5VA 3SFDB 2A74C 4QIWB 1PTOD 1U9RA 5IGFA 1H9KA 3Q8EA 5LNK1 4KK7A 3NPPA 2XRSD 4YTNB 4H44C 4IZ8A 1Q1EA 1GPXA 2CHBD 2DNCA 3MC0B 4BA1I 1SE2A 2KEEA 1TVXA 3NVYA 3JAML 1QLBB 4XYOA 2SAKA 2EZVA 2AUJD 2PKOA 3AU7A 5ELFA 3S9WA 3J7YW 4J3OD 1RM6C 1LTAD 1TS3A 3HVZA 4KKUA 2D5GA 5JEAH 2R6GA 2QMTA 1PMRA 4KJNA 4FNFA 4JBWA 4GDLB 2K32A 4XT3B 4RWSC 2E2JB 3P1HA 1Q3LA 1LTRD 4RGMA 4G7OC 2SDFA 4YXDB 5I4DA 2WV6D 1XYIA 1JRPA 1JWMD 3MWYW 1HQMC 2F0HA 3TZUA 3PZ7A 4DU9A 2KUMA 4KHZA 2H4OA 2OT2A 2NVXB 5JPMC 3F2UA 4FXCA 2DY8A 2E3TA 2GA4B 2WXNA 1TQOA 2F3WA 2XWBB 1RKNA 4KX6B 1TT2A 2XRQD 3BDOA 1VR9A 2KOLA 4O42A 2K1BA 1H9SB 1LTSD 1RHPA 1A2UA 2KN4A 4IUTA 1SE4A 3VR9B 1RYJA 3RFZB 3AE9B 1JQYD 1J9OA 2CW0D 2K6AA 1FCLA 2C9OA 1EY4A 3FPPA 1FNUA 3X3NA 3DEPA 3BK2A 1U4LA 2QSDA 3AE6B 4XQQA 4CJ2C 1PXUA 3SE0A 1MSGA 2AWNA 2B2VC 2L4NA 2KDMA 2ONQA 1HQRD 3AE2B 1GOZA 1SXTA 3MTSA 2A6HC 4ZK9B 3HUIA 1TWAB 4KY7A 1GUOA 3ND9A 3DWMA 3SR6A 4YIJA 5D14A 4FYDA 2H89B 5D3IB 1LT3D 3R8BA 1IGDA 1F2YA 4K6LA 1MHXA 3NWSA 4ME5A 5IGBA 4G4KA 4DAVA 4AS1A 1DOXA 1OXTA 5C3XA 1NR4A 1BUIC 1S4ZA 2QF7A 1LT6D 2N7JA 1C4CA 2MJ3A 4BWGB 1VLBA 2BDNA 1F9PA 1SYBA 4HSVA 1TIID 3DHQA 3IT4B 4YSYB 2K5QA 3VR2A 2K28A 4UAIA 5H92C 4NKLA 3I4LA 3L9AX 5HG2A 1FNWA 2A73B 1R4PB 3CIRB 5C0XJ 2LHDA 5KIXA 5CBAE 5BYRA 1JWBD 1WVLA 2F03A 4KGRA 1WTPA 1TYGB 1PTOH 3MFYA 4YTPB 3GS2A 3K5OA 1SNDA 5J39A 1EY9A 2YEPF 2Y3AA 3CRKC 4DK1A 5A2QE 3ZJUA 3K6OA 5EQ0A 1HZ5A 4P6VF 1D5XC 3W5VB 2AQ2B 1PDXA 2M2LA 4GZYC 1KNEA 3RMHA 1C8CA 2F0VA 1A3VA 4IUQA 3P20A 3T56B 1YN3A 2HDLA 1OXVA 1JQ4A 4C7ZA 5IIFA 2PZTA 4TMAB 1QOHA 1JOKA 2B63B 4R8NA 2JA5B 1YNJD 1MHHE 1WXQA 4CGYB 1A2TA 1RD9D 5G5GA 3EQLC 3P42A 2A6ED 2ZT9C 1PDQA 2IGHA 2YEPB 1MSHA 5C4HA 4B0EA 3W2DA 4OO1I 1P7EA 2EPBA 2PW9A 4Y7NB 2RDHA 2IX0A 1LTTD 3KF8A 1TKEA 1W6KA 4TRDA 5KNDA 1QG7A 2D2CC 2WXFA 3HOZB 1DZ1A 4WQMA 1AZQA 2DY7A 3VRBB 2I46A 2NTTA 3PIP3 2EYOA 2WXIA 1MVKA 1L0YB 1R7SA 3PZ8A 5COYA 2YYZA 4M8AA 5JPNC 3UI3A 5AUIA 3KWVA 4KKIA 3ZJTA 3KK7A 2WXKA 1VZ7A 1L0XB 2NVYB 5A2QL 1ZE3D 3GV6A 4BS9A 3PUWA 4CBVA 2FMMA 3J7AV 2BE5D 1SMYD 1ZYRC 2NBFA 4BA2I 3HG9A 1N61A 3Q6SA 4XIGS 3UI2A 3P75A 3P63A 2JZPA 2BA1A 1SJHD 1GB1A 2PW7A 5LHY1 1ILQA 1VCIA 2F0PA 5ELBA 1NAPA 1D5ZC 3IAS1 4U673 2E74C 5M5YB 1EEFD 3FEWX 1FFVA 3S1RB 2V3NA 4ZLTF 2A69D 3T4AC 3U9OA 3BYTB 4RGNA 3PUXA 1BDOA 1BBXC 2WKCA 3QJYA 1C76A 2NN6I 3TEYA 3EUB2 3NP8A 1CA6A 1PUTA 3I73A 2Q8RE 2IX3A 1A3UA 1BR9A 1F2MA 1CI3M 1QNUA 1B50A 3FVQA 1OXSC 2JSOA 4Q5VA 1MPEA 5FOBB 2JSVX 4C1NI 2K7VA 3AEGB 4EVOA 1E0ZA 4YSZB 2JX5A 1EIHA 3I3CA 5AFWA 1O80A 1UNSA 3VR8B 2WXJA 2NZ1D 3AE1B 3TDQA 1YNNC 3T13A 4A3IB 3FDTA 1EY7A 2LMCA 4M0WA 5FO8B 1EU3A 5AUKA 1Q12A 5K36G 3H91A 2F3VA 4L63B 1BMLC 2LFIA 5ELDA 4GLSC 1D5MC 3E0JA 3C46A 2B2UC 3Q8AA 3H3VC 3G7LA 3K59A 4WJWA 4KN7C 1JW9D 3W1SA 5EBCA 1BO0A 2JE6I 3GO5A 3RZOB 4HR7B 4FF4A 2J7ZA 3P7JA 2PNRC 4A9AA 2YU9B 2HCIA 3I91A 2HUGA 2MUYA 1L6VA 2B8FA 1C4QA 1E7PB 2MJDA 4F8MA 3GQBA 4TQ0A 5NUCA 2JYEA 4NZLB 1L4DB 4K5WA 1FYCA 2WAQB 2G9HD 3L7ZC 5I2YA 2K5WA 2EYJA 3K5NA 3ZGZA 1ZDXA 4DAYA 4C3IG 3J81E 4WH4A 1Y8NB 5FLXE 5JAVA 1T5XD 3WOEA 2F0JA 4TSSA 4X3TA 4C1NK 1QNKA 3TP6A 4XDXA 2R7ZB 3NUCA 1SNPA 1S5ED 1IKMA 3OIQA 1V1PA 1RCVD 2F0DA 3ZJVA 2KMMA 1V43A 4EQPA 3TEZA 2VNUD 1FMAD 3HOVB 1FGBD 1NEKB 2G9DA 4RHSA 2RVLA 3NSWA 4KD4A 5C3WA 1E10A 4L2YA 5KEEA 1MGSA 4QUCA 4DXFA 5T1GA 3LWUA 3AECB 3T3NA 2ZXPA 3SVMA 3NQIA 2F0FA 4ZKCB 1HA6A 1EY0A 3P4QB 4OW0A 1EOTA 1EYAA 3J80E 3VYTA 1L4ZB 4C7YA 2E2DC 3SR1A 1WTOA 1KF6B 1HEZE 1RF2D 1ZDVA 3N52A 2D5DA 3HP3A 4OO1H 2A68C 3PO0A 2E75C 2VUMB 5CV8A 3T53B 1PGXA 1G8ZD 5C6AA 3SK4A 1Q1BA 1EFID 2K5PA 3P4SB 4NP5A 3J81L 1UUPA 4RKLA 5DAUA 5FLXL 1HXYD 1C77A 1VZ6A 4XWWA 5BYQA 2IW3A 3MAQA 2V4IB 4KY6A 2PZWA 4WORA 1PFDA 2PMVA 4U68A 2IGDA 4O1NA 1SFOB 1QILA 4ZRPA 1Q90A 1I4RA 2X6GA 3IFDA 3P4PB 5M5XB 3HRDD 2IWHA 1WD1A 4BBSB 1H9SA 4OL7A 4ZHPA 5M9OA 3VA7A 3RLFA 1UGJA 5JXVA 2K22A 3TUOA 1SJED 5T8IA 3KBXA 5C0XI 3U7ZA 3FC4A 1WTWA 3GP7A 5FR3A 2DWQA 2Z8LA 2L32A 2JXMB 1LTID 1A70A 2F0UA 1ESFA 5IGCA 1FIQA 2A6HD 4IQZA 2WIIB 1TY2A 3NTKA 4A3JB 1CK1A 4C56C 1X3QA 2IGGA 3J80L 4ZOHC 1R4QB 1UWMA 1NR2A 2NN6H 1S5FD 3BYYB 3DWQA 1ZKOA 4HCEA 5E4XA 2QIEB 5EPKA 1EYDA 3I4MB 1U4MA 2ZW0A 1K51A 4KKJA 2PMZB 4F87A 5IT9E 5D7GA 1QCBD 3A55A 1MI0A 1MBYA 3HOYB 2IT1A 3HGBA 4HSPA 3C8YA 1D4BA 3C3LA 2BW2A 3PO3B 1NCVA 1ZXHA 1ENCA 2C5CA 2HTME 2FMCA 2F0IA 4V190 2EY2A 5FK9C 2NB0A 1EU4A 4KKTA 1FO4A 4UDUC 5C2TB 1QJOA 1V1PB 1FXAA 2FFKB 1FXIA 1WD0A 3OSOA 3D8GA 1WTQA 1ZUD2 4K2LA 3HOXB 1E0BA 2NWGA 2DNEA 3DMUA 2INNE 5K5PA 1Y1VB 1RJTA 1J7BA 1G2SA 3MVVA 2EYPA 1DOKA 2LHEA 2WACA 3KUPA 2Y5CA 5FO7B 3FMCA 3I72A 2E2IB 3IL8A 2BTEA 3M7NA 5JEAJ 3AMZA 4C3IB 1G2TA 3U52E 1YJIA 5CORA 5M3FB 1XF5L 3TP7A 1SSNA 4HCSA 2EJFC 4GDKB 3S14B 3DWGC 4TKOB 1N62A 4XQJA 1EY8A 1P7FA 4HEA1 5I9PA 5LL6X 1STBA 4J8QA 4N9PA 5DNFA 1FFUA 5C44B 1Z7TA 5JVH3 1AP0A 1TWFB 3J7AF 2F0NA 4NJCA 3BDLA 3NWTA 4PT5A 5EE1A 2RDGA 2JA8B 5DEHA 1XX8A 1STNA 4LLGM 1STYA 3MXNA 1JOOA 1D2BA 1I4XA 1ZP0B 5BN4A 2BB5A 2JYOA 4KMUC 1QB5D 1NENB 1K52A 4DQOC 4CHTB 1SNCA 3AV8A 3J9CA 1DJRD 2KJXA 1SEBD 3C1FA 1V8QA 3S2DB 1CHPD 2KACA 4HROA 1R9TB 5G3LD 1J8IA 4MM3B 4JE3B 1ENFA 3IAYA 4MN3A 4YT0B 3IXSA 1S5BD 1HRJA 3LXFA 4IUUA 1ACCA 1ZYRD 1LO5D 1XLOA 3MHBA 4E6IA 1STHA 2XN9C 2XSCA 3TN2A 1I4QA 3KQ4A 3GTQB 1ZXTA