1TS5A

I140t mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts5A01
4K6LA 5ELCA 1EU3A 1BXTA 1PTOB 1I4XA 1PYWD 5D3IB 1FNVA 4Z9CB 1SE2A 1LT3D 1LTRD 1LT4D 1EEID 1I4GA 1RD9D 1TS4A 3W2DA 1ET9A 1DJRD 2CHBD 2QEJC 1CQVA 1ESFA 3R2IA 1UNSA 1HTLD 1LTAD 1PZKD 1STEA 1PTOC 2XNAC 1FNUA 3DWAA 1D6EC 2QILA 1KLGD 4OHJA 2J4XA 5ELBA 1LTBD 1EEFD 4RGTA 1SBBB 1TY0A 1V1PB 1TS3A 1CHPD 3EA6A 1PZJD 1AW7A 1V1OA 1XXGA 1EFID 4BWGB 4RHRA 1JWSD 1YN4A 1LLRD 1PTOH 1S5DD 1SEBD 2AQ1B 3MC0B 2NTSA 1RF2D 1XTCD 5I4DA 1FD7D 3GP7A 4DXGA 1QILA 1JWMD 1ET6A 1LTID 1TS2A 1DYQA 4RHSA 1JQYD 1LO5D 1UUPA 1M4VA 2XRSD 3SEBA 1HQRD 1HXYD 3OWEB 4RGNA 1LTGD 1SE4A 1I4QA 3BYYB 4RFBA 4DXFA 3V05A 5D3DA 4TSSA 1CHQD 4L63B 1I4HA 3BZDB 1YN5A 5FKAC 4RH6A 5ELEA 1T5XD 3DWQA 2TSSA 3TSSA 2ICIA 3URYA 1EU4A 2G9HD 1V1PA 3DWPA 1F77A 4ZYSA 1D5ZC 1B1ZA 2O2LD 3BVGA 4UDUC 1LT5D 1AN8A 2NTTA 1I4RA 4RCOA 3O13A 1SJHD 4L6TB 3BVZA 1CK1A 1RDPD 1HA5A 2AQ2B 2XRQD 2AQ3B 5ELFA 1LT6D 1RCVD 1JCKB 2RDGA 1PRTF 1BCPF 1S5BD 1EWCA 3CHBD 1GOZA 1B44D 4RGMA 1PTOF 5TSSA 1SE3A 1I4PA 1L0XB 1CT1D 1PZID 2Z8LA 1SJED 2XN9C 1PRTD 1BCPD 1FNWA 3EFXD 2WV6D 2SEBD 1TS5A 1L0YB 1JR0D 1MD2D 1PTOD 1D5MC 1D5XC 1G8ZD 1S5CD 3KLSX 1TY2A 1KLUD 3MFGA 3R2TA 1ENFA 1YN3A 1S5FD 1S5ED 5FK9C 1LTTD 4C56C 1PRTC 1BCPC 5ELDA 1KTKA 4O1NA 4NZLB 3R8BA 1LTSD 2IJ0A 1SXTA 3BYTB 4RGOS 1JWUD 3BVMA 2IPKD 2RDHA 1PRTB 1BCPB 2R61A 1FGBD
chains in the Genus database with same CATH superfamily
1U0LA 1P16A 4KX6B 4B9KA 2LVQA 3W1YA 4J6IA 2YTXA 1SYBA 5JEAH 1BNZA 2K3UA 3VXWA 2ZNVC 5KIXA 1JWBD 3OIPA 3AEFB 5FR3A 2VZAA 3I90A 4RCNA 1HR0L 1PDQA 3AEAB 5IT9E 3KWVA 5JJZA 2CHBD 2MJ8A 4ICUA 1RFKA 2QEJC 5IGEA 1T9HA 1I6HH 1Y1VG 4V0BA 2LZ6A 2EMSA 1Y1WB 2MJEA 2PO4A 4J8QA 3TP8A 3Q0AA 3CF5A 3WAPA 2JN4A 2B8GA 5IP4D 2ZNVB 4YY3Q 4ZRKA 3H7PB 4YSYB 1KXLA 4LLGM 4A3GB 4R1JA 5DAUA 1IL2A 1E10A 4HKQA 1I94Q 4ILWA 2QMTA 1I5FA 2EJMA 2YU9B 2WXGA 4P1CC 4DV1L 2GA4B 1CQFA 2JA5H 5C4XG 4HCPB 3ZDMC 3PREA 2SAKA 1U4AA 1WGKA 2KTRA 2L00B 2R7ZB 1FPYA 3D4RA 1GG3A 3GB1A 1T0QC 4OXPA 4LF9L 1KM7A 2XEWA 1L4ZB 2GI9A 2N9XA 1H9SA 2MHJA 4ZHOA 4HJ5A 5E7NA 3CC2A 1ET6A 1LTID 1MBYA 4LFCQ 1VQNA 3N9YC 1PFSA 4C7YA 1C3TA 5E6NA 3TEWA 5G5HA 1LTGD 5J3BA 1OXTA 2E2DC 2BA0A 3M4OB 4B3ML 4LJOB 3RZOB 4GLXA 1E8XA 3TP5A 5FKAC 4ASWC 4AUQC 2BDOA 2KCNA 1FMAD 2MPMA 3L16A 1Q8KA 3TSSA 3ZRFA 2QW7A 5C0XH 1FXAA 3C0RB 2JU6X 1XF5L 4KKIA 2R7FA 4D2KA 2ONQA 3BVGA 4B3SL 4NKLA 3SFEB 3HRZC 2DBYA 3N3KB 1X3FA 2EDGA 2F1MA 3NBIA 1XNRL 4ITKA 1ZKOA 1D7QA 4PYUA 2F0EA 2L5TA 2EJFC 2AWTA 1VQ6A 3X3MA 1VQMA 1HNXQ 1FJGL 5K36G 4KDIC 1EWCA 3ONSA 2PNRC 2NMQA 2ON8A 2DN8A 1N34L 4DAPA 1PTOF 4GS3A 2KC2A 2KWVB 3DHHC 3VTUA 3VYTA 1PRTD 2J42A 4UPAA 2VZKD 3AV8A 4N59A 5KHQA 2KECA 3V62A 2X69A 3G48A 2F3IA 5IP7G 1PQSA 1XLPA 4L2YA 3AE4B 2ZCBA 3P1HA 5IN7A 4JI2Q 1K0SA 1GM5A 5LLIA 5GMVA 2KDEB 1BQQT 2WKCA 1PRTC 4LNNA 4A93B 1ZDXA 4XDCA 1DOKA 1WTOA 2I5MX 4HXDA 2GBMA 1LTSD 5LMUL 2CU3A 3SR6A 3U2SC 4IM3A 1JWUD 1EY6A 2NZOA 2UUCQ 4BY1H 1QOAA 4GDLA 3VRBB 4DV4Q 3R3OA 3TP7A 1ICWA 1MFWA 2KTRB 1PRTB 2QSDA 3MC8A 3B2GA 2HIVA 2J7ZA 2JA6H 1L0WA 2NBFA 2RVLA 1XMOL 3S14B 3FDTA 3L3OC 3N30A 4G11A 3VQIA 2M9VA 3HOVG 3G4SA 2Y0SE 1VQKA 2Q8IB 1JRUA 5DPSA 1M1KC 4F88A 3H3VH 2WB1E 5M5XB 4HJGE 1NVID 2ZTEA 1IGCA 3M95A 3J80c 4MDKE 4F1SA 2CKZB 1SNDA 4MH8A 5D6JB 2VQEL 2ZCCA 4PS3A 1JALA 1Y1WH 1ZKHA 1XJVA 4DWFA 3BU2A 2UXCL 1V9PA 5LXIB 5E6OA 5IGBA 1K3RA 3CMEA 1EFWA 4J15A 3GTQB 2CS4A 1VQLA 4A3GH 3DQVA 1I35A 3PSEB 4HIDA 2E2IB 1K50A 1E22A 4IKGA 1QE6A 2M00A 2YU9H 1Y8OB 2IX0A 2BE5C 1OQQA 4R3DA 4II3B 4YTMB 4IUPA 4RMFA 2DAJA 3AEDB 3ZKJC 1ZXHA 2Q8RE 3P20A 2L0CA 4P16A 1VQ9A 2R7ZH 4PK1A 1DCZA 1J9OA 1B70B 1SEBD 2RKSA 4FXKC 3I72A 1HQMC 1Q7YC 4TKNA 1FM0D 2X6GA 3DBLB 1KDBA 1QILA 3K7AB 1STAA 1F1HA 2KKCA 3HHMA 4RM9A 2KJ6A 4KKTA 3FP9A 1WXVA 3PT2B 2EPBA 3K7UC 2O5IC 2K5PA 3AB5A 4YY3L 3EC8A 1D1IA 1L7YA 4K0KL 4FHJA 1R4QB 2HDMA 2MHVA 1I6VC 1HEZE 2OHFA 4EUTA 1I94L 4HDOA 4BBSG 1X55A 2EELA 3UF8A 1CHQD 2D0OA 3M4OH 1YI2A 3L0OA 3RZOH 2VNUD 1YNTE 1MKHA 3OOCA 2N1WA 3RN9C 1Z7TA 2ZPNA 2WXMA 1E9MA 4FHKA 4HROA 1EOTA 1FFUA 4FJVB 3S1NB 2CVRA 3P4QB 4ZYSA 3C2PA 1HUMA 4LF7L 3QWZB 1AN8A 1TVXA 2KWCA 4LFCL 5D2MB 2JYOA 2D2QA 3ZRCA 4UP7A 1ENCA 4GN4B 4KHPQ 3EFUA 3OLMD 3PRMB 2M19A 1LT6D 3J80i 2K5QA 2M0XA 2G3QB 1Q1EA 1ZPSA 5HFYA 2V3SA 1Y56A 4G7OC 3W3AA 5H1SE 3HKZE 4DV0Q 3HVZA 4GN3B 4BBNF 4A55A 2JE6I 2LI5A 4AJWA 1L0XB 3STBD 1DZ1A 1VQ8A 5T8IA 4DBGA 1W3SA 2WV6D 3TS0A 3RNBC 4LUZA 1TBEA 4JI1Q 5H92C 4I6PA 1X3GA 1D5MC 2BGFA 4PMCA 2M4NA 3U52E 3VTWA 3CKIB 5GAHC 4DR1Q 3KJPA 1J8IA 2F0NA 2JXXA 4AS1A 4JI5Q 1AE3A 2VB3X 4JC0A 2JA5G 2HJ8A 2WDVB 1EYCA 2RDFA 3P75A 3R8BA 1HNXL 4A93H 2LD9A 2JEBI 5LL6S 1X65A 5C3XA 2SDFA 1D2BA 4A3KB 1WMHA 2MCNB 3A1QB 5AEKB 1QG7A 2IPKD 3B0AA 2RGFA 2A73B 4XYOA 3GOEA 1YJ9A 2PNHA 2IL8A 3RD2A 4AYBB 3LB8C 5HGQA 4DV5Q 1IYUA 2MUYA 1SE2A 3S14H 4JI2L 4NQKE 4JI3Q 1II3A 3E0JA 3HOXB 4CYEA 1EIGA 1ZOYB 2WP8J 1SIFA 3NG0A 5M5XH 2CHXA 4NPSA 3QIJA 3EROA 1K8OA 1LFDA 4NJ7A 3D6WA 2GVAA 2AWNA 5CV5A 5C0XG 3Q8FA 3R7RA 2Y0SG 4MM3A 3VUYA 3P1MA 4A3CH 2UUCL 4KHVA 2WB1G 4DV4L 3GS2A 4XDXA 4LDTD 1DGJA 3NENA 3D8GA 4MN3A 5KYLA 4ZRZA 3PGZA 3CCJA 2G5DA 3GTQH 4KDLB 4JI6Q 2L0FA 2V4DA 2VB2X 1KNEA 1KD1C 4FYDA 2E2IH 1CHPD 3TBIB 3E9HA 3MJ5A 5A35A 1KIXA 1P0RA 2FMCA 3NWTA 3NHEB 3RCZA 1A15A 1VQ7A 2JY6A 3VYSA 1FIQA 1T6BX 1EOVA 2W9NA 3ITPA 1ZEQX 2AQ1B 1EQRA 3MC0B 3DLLA 1Q86C 2KENA 3GTMB 2NBVB 4IJHA 1PLFA 2QKIC 1VQEA 1WTHA 1FVIA 1OEYJ 2GBNA 3K7AH 1DYQA 3JVZX 4YCUA 4FN2A 3MXPA 1VMCA 3CSTA 3OPOA 5E4WC 2A1AA 2DZJA 3VFKA 3WALA 1MVKA 5D7GA 4LDTB 1BDOA 3FPPA 2KQ3A 3A54A 1U4MA 3CCLA 1I4HA 2A6ED 2ZW1A 2WAQE 3G7LA 2IW3A 1QT9A 2BA1A 4HKZE 2R3ZA 4M8AA 3KVFB 3PVLA 2WQYB 4ANVA 1EU4A 1PGAA 1EUVB 4WAAA 3RN2A 2Q2IA 3S1NH 1Q3LA 1RRBA 3RLOA 2DENB 1WF9A 1Z5SB 1XEEA 1VS0A 4RCOA 3QO2A 4BY1G 1HRJA 4YHHQ 2A6EC 1RJTA 3GTPB 1J5EQ 2X38A 5D14A 2D10A 1GXDC 2JA6G 3PO3B 2KMMA 2K39A 1WMHB 4FJZA 4HPPA 1H9MA 1SYFA 2F0OA 2UXBQ 3FEWX 5IA7A 1FCLA 1OXUA 2BKRB 1DOXA 3TP6A 4PNYA 4QUFA 3OYYA 2FCMA 4YWKA 3X3NA 2A4ZA 3MJWA 4KHZA 2C9WB 1IL8A 1Y1WG 1MD2D 3HKZG 3J7AF 3DHGC 4KD4A 4OELB 2WXJA 1EQQA 2KEDA 3NQTA 3I8ZA 3BWUD 3DBHB 1VQIA 1VF5C 2WIIB 4A3GG 3ERSX 1W2BA 1JOQA 4K5WA 1WJNA 2IT1A 4KHPL 5C4XB 5FK9C 1EF1A 3IG3A 4POFA 4MM3B 3A5ZB 3CCQA 1MJDA 1Q5WB 2LXCA 1KTKA 3VH4B 3HP3A 4HJ8A 4F87A 1GUTA 2LWPA 5G2NA 2K4KA 4DV7L 2MLBA 1SMYD 2R7ZG 4CKCA 3P42A 4A3KH 5I2XA 4FF3A 3WIMA 4TMAB 4IUNA 1C77A 3H9DA 1TWAB 2JRHA 5IODA 3LXFA 5M5WB 1R7SA 2V9HA 3BDCA 3W1SA 4JI1L 2SNSA 3PCOB 1I4XA 4BKSA 5C4ZA 4DR3Q 4CGYB 2B63B 2SNMA 2OCEA 3W2DA 4C80A 3DMUA 3HOXH 2E6XA 4K1RB 3J81j 1QOBA 1EIYB 3AEVA 4G7HC 1ESFA 3T1YQ 4WQOB 5DLQE 5IE8A 2E2HB 2D5DA 2FFKB 1B8AA 4ZQ3A 4NY0A 1FNUA 4E71A 1H8CA 1KRTA 2QILA 3Q3OC 4JYAQ 2WP9B 5IAAC 3QOJA 4ZDVA 3PTFC 1EY7A 2J4XA 3F1ZA 3AMZA 2FCQA 4P73A 4RGTA 1R4NB 3EA6A 3J81E 1HZ6A 1E1OA 4DV5L 1YJWA 3AEGB 4A3DB 1X1MA 4GSWA 4JI3L 2F0WA 2L3ZA 1NMGA 1JJCB 2M8SA 2A74C 4ZUJA 2LKVA 1WH3A 3HFZB 5I4DA 1FD7D 3UQAA 3ND8A 1STBA 5C0XJ 3OTOL 3GTMH 3DBRI 4E3CA 2JYTA 1S3SG 2K6QA 5IYDG 4WWPA 4HCEA 4DR7Q 1JWAD 1TYGB 2R7DA 4XQNA 3ZXRA 2CHWA 1Q46A 1SIJA 4A3JG 5AUKA 2JA9A 4DXAB 1CM9A 2KLGA 4L5SA 4DKAC 4JI6L 4EZKA 1HTQA 2K75A 3V2TA 2D07B 1DD2A 2CW0D 2OJWA 4II2B 1KQSA 4BKSD 4XWTA 3D31A 2ASQA 5IYBH 2JYEA 2BOSA 1GPXA 2V4IB 4BA1I 2FBWB 4O2DA 4S3SA 3A7AB 2WAQG 4QGUA 1N5WA 2KNBA 1N63A 1HPCA 1YEZA 2ENBA 2WFWA 1L0VB 4DU9A 2CW0C 3A7LA 3NVZA 2DNEA 3GTPH 3RN5A 5FO7B 2BT6A 3LDZE 4XXEA 1CKMA 3MXUA 3PO3H 2LXAA 2L4NA 3HOVB 1BCPF 1XPRA 5M5YB 2F0FA 3SGIA 4US9A 3WOEA 3NTHA 1RTNA 4P74A 2ZXPA 4CO7A 2K33A 4DV3L 2Z8LA 3HKSA 3RD4A 2V0GA 1C79A 4A20A 4KV6A 4HCSA 1LM0A 3K6OA 4JPSA 1L0YB 1JR0D 4NXNL 2Z4HA 5GROA 2DGYA 2F3VA 3OMGA 4EKUA 2NB0A 1LUZA 5T1GA 2N9PC 3PHXB 4GGQA 1WWTA 4QIWE 4FVMA 1J5EL 1YHAA 5L83A 3FVQA 1V9JA 4OIKA 3J81c 2F0JA 1LTTD 4TRDA 4C56C 5C4XH 3KF6A 3MHZA 1KLVA 4JBJA 4XC2A 3SD5A 3FMCA 4A3OA 2IDYA 3NY5A 4HR7B 4JVZA 3EJIA 1KDAA 4UY8C 1WOCA 2R61A 5IP9H 2GN5A 1QVFA 1TWAH 5C0XI 4H0LC 5ELCA 1N61A 3M63B 2QJLA 4FBJB 1EU3A 5M5WH 1RM6C 3ICEA 1BXTA 2NZ1D 4IOCA 1WE6A 4RF1A 1F0ZA 2F0IA 4QL5A 3E3XA 1LTRD 3TDQA 1LT4D 2KVZA 4LNOA 1PGBA 2B63H 1YOVB 2K0PA 2QDLA 2CKHB 3M3JA 3FC4A 3EECA 3MXNA 2G4SA 3RI7C 3PRPB 1E7VA 4BY7G 5JHAA 2NVUI 1ROEA 3IVFA 4PT5A 2LSSA 3BDOA 1B9RA 3MAQA 2E2HH 1KLGD 2WXPA 3UDGA 5AFWA 2MW5A 2MWSB 4B0MA 1K73C 3L0WB 1LTBD 1O7YA 3Q8DA 2VRRB 4LFBQ 4KGRA 1KRHA 2EYHA 3OIQA 3SK4A 2JRIB 3NBHA 3VAWA 4QB4A 4DR3L 3LYYA 3N1ZC 3CXCA 2XIWA 1WE7A 4GIVA 1X3PA 4F8MA 2HT1A 4A3DH 1JT8A 2N0SB 4JQWC 1MHXA 4RNAA 1A62A 1F52A 2DYBA 2MBQA 3S1RB 1BBUA 1CMXB 5DPWA 1N9WA 3T1YL 1ZE3D 3HS0C 1P8LA 1UE1A 1RODA 2N3SA 5LL6X 3J81i 2N1VA 4ARIA 4EQPA 4JYAL 5D3DA 1SNOA 4TSSA 1ILPA 2N9LA 4LCDE 1YD8U 3V3XA 1AFPA 2NPTB 5HG2A 3IAYA 1T5EA 3RMHA 3OG5A 2A6HD 1UZXB 4NNJB 4EGVA 3DVGX 2BKFA 2V1YA 3CSFA 1BF4A 3QQ8B 3URYA 3KK7A 2Z0EB 4LAAA 2F4VQ 3CCMA 1UELA 2F0PA 3S1MB 3J9CA 1B1ZA 3H3VI 3LJ3A 3VTVA 2EYLA 5FLMH 4A3KG 2GB1A 1WJJA 4L6TB 1D8LA 3QAQA 1L1OA 4LNKA 2A6HC 2G9DA 1JMCA 4DR7L 1EWYC 5BYSA 1PMRA 3P7JA 4CHKA 4IC7B 2QF7A 1DOLA 3GV3A 3VR6A 4AYBG 4DAYA 3CIRB 4USAA 1SLJA 5M5YH 3HOVH 3NZ3A 3CMMB 3WANA 3ND9A 5TSSA 2BH8A 3HOXG 3AE5B 4V190 1RWSA 1SJED 2XN9C 2ZT9C 2JZPA 3SHLA 2O4XA 2MNAA 1BUIC 2Q5WD 5M3FG 5HURA 3I2ZA 4GZYC 1QLBB 4KD3A 4K5XA 4NPNA 5AZFA 1G8ZD 1UE7A 3KLSX 2I5LX 2Q2TA 1LQBA 1IBMQ 1E0BA 1Y8PB 3MFGA 4UAIA 1WY8A 3Q3MC 5KNCA 4ALPA 4C4VA 2MBEA 3VUWA 4HIOA 2CWAA 5C4HA 4MSMB 3PQIA 1C78A 1MI2A 4IW0A 4HAEA 2K04A 2KOXA 1YJJA 2VY3A 1WGGA 2KTFA 4RMAA 3R93A 1E8ZA 1AE2A 3M4PA 3AULA 2N55A 2FXQA 4QMGA 1WXAA 1L2NA 4IURA 3FAHA 5CTRC 3KLSA 2N4FA 2I1JA 1P9DU 1GJZA 3ULPA 5T1IA 2MGSA 4JI7L 3FKYA 3PLVA 4WH4A 2N9EB 3F2DA 1TJEA 2DJFC 1LXDA 4WJ4A 2K22A 3KJOA 3GZNB 3DEPA 1WTQA 3NOBA 5HHDG 1IBKQ 1H9RA 2PI2A 3GTLB 1WVLA 2KDMA 4G7ZC 1PA6A 2LHEA 2BDNA 3RMKC 4HJKA 4ID6A 3AEBB 1FRRA 2ATWA 2PE6B 4YWGG 3TJPA 2A8VA 1G91A 3E6ZX 2FIFA 2GBKA 2CR5A 3OWFA 1IXRA 1PHJA 2PEAA 2FINB 1CQVA 2ZW0A 1Y14B 3VA7A 5J39A 1EIFA 3CRKC 5KYIA 1LTAD 5DM63 3QC8B 4S17A 2AL3A 2E5LQ 4GKKL 1EF5A 5IYBG 4LNQA 3A33B 2PCFB 4IFDH 3K8AA 2DAFA 3NVYA 4A4IA 5HKHA 1R9TB 2R93B 2YTVA 5DPRA 1QOHA 5JHBA 4OZBA 3ZTCA 4RKBA 2IY5B 4Q2JA 1EIHA 5KRUA 3QB3A 4B95A 3I55A 4NDXA 2IGHA 3PO3G 4B6WA 3IT6B 4KVGB 3PIP3 4ANUA 3A8JE 5C4JB 1S3OA 4ANXA 4DAMA 4OVVA 3IFTA 3GP7A 1SRUA 1NE3A 3QHTA 3BS1A 1AWDA 1JWMD 4DV6Q 1TR5A 3S1RH 1O7LA 4FXGC 3VR5A 4A3PA 4XT3B 4DAYB 1N32Q 3HKZB 1HZCA 1TKEA 1S72A 1GKHA 4KTAA 1TU2B 5G3LF 3CW2C 1QB5D 3S9WA 3K58A 4R8NA 3BZDB 3OJ3A 2ZVNA 4LFBL 4OO1H 1NCVA 4WWMA 3D4DA 3HRDD 4OX9Q 3A4RA 2KWDA 1VQJA 4LF6L 2KHIA 2INPE 3I9V1 2L55A 2WXRA 3RNUA 1V49A 4C4VB 2MFIA 1YBYA 3M4YA 4CJ2C 3OAWA 1D4BA 2F52A 3S1MH 3U9OA 1C76A 3SR1A 3G71A 4KZCA 5IP9G 5CHWA 3MEFA 4MELA 3LGJA 1Y8NB 4R8IA 4LNFA 1K0RA 2B8FA 4IG7B 1YVCA 3S15B 2LVPA 2K32A 5JJIA 4NJ6A 4J6HA 4O0AA 3K0YA 1UEAB 2NWGA 2DYOA 3O65B 2B63G 3WDNA 2MRPA 2VS1A 4JPBW 2K8HA 3L10B 2RQXA 2FCSA 1YHBA 4NQLB 1FNWA 5CYUA 4L5QA 3OMCA 2MH7A 3J80E 3JW0X 4URKA 2JSVX 4JOIA 2WKDA 5EGTA 4JI8Q 1TY2A 2RDBC 1G6PA 2BYEA 1KABA 1G2TA 1T0SC 3DBLI 3HEJA 3MEHA 2I07B 3FPUB 1MJEA 2WXKA 1Q82C 5BMHA 2ES2A 2BH2A 2N7DA 1XPUA 3SVMA 4XTCS 4PZ7A 1WJUA 2EY1A 1A2UA 4C1NK 4GNXA 4DR6Q 1LABA 4A3DG 3ZVVA 1UWMA 3PUWA 2H4OA 4P2CB 1MI0A 3VYRA 3NELA 3PS6A 1NI2A 3IXSA 3Q6SA 1X32A 4U673 1PYWD 1WRDB 5EPKA 4A3JB 2XTIA 1IBML 4JWUC 3GTLH 2V4LA 3TS2A 1UBIA 2G45B 3UE0A 3U9SA 1PH5A 2Y3AA 2EYMA 1VQ5A 4IZ8A 1YIJA 3IRBA 4R4IA 3AU7A 2B2WA 3SDZA 1VQAA 5C2TB 3ONAB 2DY8A 4X3TA 1STNA 2J0TD 2WAQB 1OGWA 1V1QA 4FLHA 4PV1C 3Q3JA 1SDFA 2RR9A 2HQEA 5FLMG 2UWQA 4HVBA 3U30A 1R9TH 2R93H 3PIPA 1PV4A 1JOOA 1IBKL 2K5WA 2Q2HA 4R4TA 2HE7A 2VZKB 1L5PA 3R7QA 5G5GA 3KBXA 4AJYB 3NUHB 4M01A 2F03A 1D3ZA 2F0QA 1GO3E 4J1MA 3Q24A 5C3JB 2KZRA 1H9SB 2LS01 4JCVE 3ZYYX 3CWIA 5C4JH 3NTIA 4ZOHC 1KFYB 4N58A 1W6KA 1F2LA 1KNAA 4HWIB 2RCNA 1EZ8A 5GADC 4EVOA 4RHSA 3J7YW 4IM2A 2E5LL 4MIUA 4JOIC 4N8X1 5FLXL 3DPDA 4IUMB 2I46A 1HQRD 3C1FA 1MHWC 1S4ZA 3OWEB 4HSPA 3MFYA 4C3IB 4X64L 2W3SA 1C4QA 2A69D 3EHVA 3GE3C 5DPTA 4IPHA 3L4PA 2IO1B 1UWVA 3H0GG 1DOYA 2KCMA 1V5OA 5CV9A 1TWCB 3FRPB 3EN2A 4RH6A 4AH6A 2KK8A 3DWQA 1VQOA 2TSSA 3ZNHB 1Q12A 3AB9A 4Y7NB 3B08A 4ZYNA 1CKNA 3NTKA 2F0VA 1EM7A 1N36Q 4GNXC 1UGMA 3ULJA 2L52A 4JBMA 2A69C 4A3IB 4X57B 1RLFA 2OWOA 2K01A 2L1AA 1PYSB 1WYDA 3HZXA 1ZXIA 1E1TA 2I1KA 4DV6L 3O13A 1UBQA 4IPDA 3W5UB 3E56A 1EY5A 3CCRA 1N32L 4X6AH 5CV4A 3A9JA 4MTNA 4GNXB 5J18A 3WAMA 2XWBB 2WYQA 4DAVA 1I42A 1DXMA 1VDZA 4IPCA 4IUTA 4DK0A 3S15H 3U4EG 3RZFA 2EY6A 4QY7A 3WWVA 3R3MA 1SYEA 2MP2A 3NVWA 3NZUA 3V6CB 4K3CA 4CJ0B 1PUTA 2K5VA 4OX9L 1HFNA 1P3QU 3ULLA 4OWWB 4MEMA 4HIMA 3VR2A 2JXMB 4BY7B 4MSQB 4EX5A 4LJZC 1E3PA 1O80A 3PUYA 2REXA 3CPWA 2SOBA 4A3MB 4NAWA 2WXFA 3GE8C 4IFDG 4LF4Q 5C3EB 4EEWA 3RNCC 1A2TA 1YN3A 4MNOA 1VLBA 5IGGA 3P4PB 1YJNA 3SXHA 3KYHC 3AE8B 4G57A 1NENB 2KOLA 2VUMB 1GD7A 2EXDA 4GDLB 2A19A 1RFAA 1PYBA 2IJ0A 4RGOS 3SU8X 4CKEA 4M8NA 2D9UA 4YTPB 1SE9A 4FNFA 1G2SA 4IN3A 2QHOA 3Q8BA 5AZGA 1RL2A 1VQPA 3BK1A 4BZAA 5IYDH 2K1FA 4JI8L 1K8AC 2K28A 2ZM6Q 2LUEA 3TUOA 2RPVA 4A3JH 1WI5A 1HNWQ 1RD9D 1C1YB 1ZDVA 1HH2P 2NVQB 1I3QB 4BA2I 1UEBA 3STBC 4OO1G 2D3GA 3Q8AA 3ZDTA 5E6PA 3RUZA 4PMBA 2RHQB 4DR5Q 4YCWA 3Q23A 3F2CA 4DR6L 4IO9A 2EOTA 1XLNA 1JMLA 3DWAA 4W9HA 2RD0A 4DQOC 1GUSA 2HD5B 4DA2A 2PQEA 4DR2Q 3DM1A 2IX1A 1A63A 2E3TA 3AE7B 1LV9A 1RYJA 1Q1BA 1CKNB 3KOJA 1MJCA 4JG2A 2QDBA 1TY0A 1ASZA 2H1EA 2F4IA 1XXGA 1EFID 2VXWA 2PI2E 2MQHA 1WGDA 3OSOA 1F9QA 3DBHI 1HA6A 2KHSA 3TQYA 3DDCB 2ACZB 3NZSA 4IALA 2JA8B 2X6LA 2HUGA 1TKWB 1D1KA 2AKWB 5M3FB 2C5LC 2JZZA 5MPOA 1LTLA 5IY0A 2KWUB 4BAXA 1YHQA 3DOWA 2J0JA 1EY4A 2V1CC 2QCZA 2B29A 4WJQA 4KY5A 3NUCA 4C3IH 1DONA 3HK0A 4HCNB 4BKGA 5ELOA 1WGRA 2K03A 3Q22A 5BO4B 3UI2A 2L15A 4WJNA 2EQSA 5ELEA 1TWCH 4M0WA 4NAWB 4TUUA 1V8QA 3NS8A 4Y7NH 4QIWB 2L0TA 2JX5A 4A3IH 1C4AA 3C1EA 1QOFA 4M8MA 1I4RA 1E2VA 1EUJA 1IYVA 2JUOA 3I3CA 3NK9A 5FO9B 4B3RQ 4ODGA 1KJTA 1F2RC 1AEXA 4C3HB 1XMQQ 3L17A 4BVUC 3DVNV 1ML0D 1CZPA 3SE0A 3NXWA 3KLWA 2G4DB 1Y69U 1SE3A 1R4NI 1CKOA 5I2YA 1N36L 2K6DB 4BY7H 4A9AA 5IGDA 4ANWA 3H94A 3JAML 2DLBA 1PTOD 3CCEA 2JA7B 2IX3A 4P1BC 1SNPA 4A3MH 3X0WA 2EZVA 3SDLC 1T0YA 1E2WA 2QA4A 1U4RA 3KUCB 4IDIA 3RT3B 5JXVA 4GLVB 1PGXA 5C3EH 4DNIA 4JW0A 2R93G 4QAYA 2MJ3A 5J2RA 4MHEA 2B2YA 4NZLB 4JGHB 2MBBB 2I0QA 4I6NB 1L4DB 2DWQA 2LVOA 4CDEC 2VUMH 1SXTA 3NHHA 3MHBA 4Q5VA 3JSVA 4BKTA 2HCIA 2HTHA 2RDHA 3WOFA 1HNZQ 5ISRA 1ISNA 2GRIA 1BT0A 2MP1A 5A2QL 1GUNA 1C9OA 4K6LA 1XD3B 4XQQA 1RAXA 2AHOB 2A5HA 2AWOA 5CORA 4CDCC 1N33Q 1PTOB 4IFDJ 4RF0A 5C23A 2E8GA 5CC4A 1BBXC 1C0AA 3ENEA 3VA5A 4LF4L 3M9BA 1IHZA 1R4MB 3IAM1 4IOIE 1E5WA 1I7HA 2V3NA 4LF5Q 1HFGA 2PPBC 1ET9A 2Z9HA 3HM3A 1ACCA 4R4QA 1Q0WB 2BPSA 3I5JC 4YXDB 3NQIA 2EY5A 4DNRB 4HSVA 2NVQH 2LGSA 1I3QH 5CV6A 3DVGY 3DVNU 1WTRA 1GHKA 3C19A 1B50A 3PV0A 4MH0E 2O6VA 4A3EB 2VH2A 3DM3A 3SFDB 1NUCA 2IZVB 5EPLA 4DV0L 1VMPA 4BXXH 2KFKA 4OHJA 1K52A 2B2UA 3UDIA 4M0WB 4DK1A 2NBUA 3AQQA 3N20C 1NMFA 3M7NA 3FILA 4BOSC 4GXBA 5BN5A 2Y5PA 2HD3A 2K50A 3PSIA 2ZM6L 5L37A 2KVRA 2PMVA 1HNWL 2BYVE 3L54A 1CZGA 2DZKA 3NS1A 1SMYC 2WXOA 4DR1L 1AP0A 2RMMA 3L08A 4JI5L 1DGSA 3AH7A 3B2FA 2LY7A 3VYUA 2JA8H 3D6CA 5JH5C 4DR5L 1JQYD 2E75C 4IPGA 2XRSD 5M3FH 1M4VA 2W54A 1H95A 3AXCA 5IGFA 2EMTA 3CP0A 1SE4A 2WACA 2D3AA 2RCFA 2W82A 4DR2L 4F7XA 3ZTDA 1EWIA 1STYA 4HPLB 3ZNID 1WX8A 4MACA 1VR9A 2MBHA 2NZHA 1OTRB 2YEPF 2B2YC 1EWHA 1Z9FA 1T5XD 4K8IA 1WZ3A 3MTSA 2YV5A 4M02A 2KQ4X 1MGSA 4M00A 2ICEC 1XT9B 1OEYA 1H9JA 4IWOA 2Z4IA 3MXGA 2EY2A 1XCTL 2BVCA 3AE1B 3RUIB 2CCZA 2I38A 1EQVA 2WX1A 4JI4Q 4S0RA 4XYQA 4X3UA 1SYGA 1X6OA 4N9PA 4AQYQ 4B9XA 2YVCA 2Z0DB 1CK1A 1CUKA 1VQCA 1KL9A 1HA5A 2AQ2B 2LXJA 2BWFA 2O6VD 1E90A 1PH6A 1VZ6A 2K7VA 4KY7A 3ML9A 3JSVB 2H5XA 2GVBA 4IFDI 2L9HA 1UWXA 2OOBB 1JQ4A 1L6VA 4C3HH 2XBBC 5AUIA 3ZQ4A 1QVGA 4EOYA 2NYZD 4DHJD 1GUGA 3W5OA 3VVWB 3AEEB 3CCSA 2R6GA 2FE8A 1I4PA 3UINB 2GMIC 1M94A 4ZK9B 4XT1B 3ECIA 3A56A 1VZ8A 2KCCA 1WI0A 4K14A 4LNIA 1WCMB 4W9CA 1CJEA 3ZNGC 4FADA 1GNUA 3EIVA 2JA7H 3F2BA 2BCOA 1AZQA 1TWGB 1F9RA 5EPJA 3V60A 4ZRIA 1JC7A 2LUMA 3AE6B 1ENFA 3IFDA 2UYZB 3S2HB 4X65Q 1EYDA 2O6VB 3L2PA 4OVZA 3W1SC 4C00A 2MO1A 3I63C 1Y8RC 1GHJA 3LWEA 1XMQL 3D0FA 3N1XC 5CX3A 1RTOA 5GAEC 1FCCC 1YQ4B 2KFKB 1JB3A 1GC7A 2MA9B 3PZ8A 3VH3B 3NJTA 4W9IA 1HCZA 2DX5B 1TWFB 2ASBA 5JJKA 4B0EA 3BYTB 3FILB 4OO1I 4ZUIA 1WX7A 4B9WA 1Q10A 2CU1A 5EKIA 1GVPA 2R92B 4WWOA 4MJSA 2DZMA 1F9PA 3PO2B 2WXHA 2CH4W 3RNFC 4X62Q 2FNJB 2WINB 2B39A 1T3QA 2J0KA 2XK5A 5BMIA 4OL7A 1STGA 4C3IG 1I4GA 1L2FA 2HQLA 3H0GB 2E2JB 3HUIA 4YHHL 2XVSA 5BR8Q 2AMCB 2ZJDA 2F0TA 1CSQA 1V81A 1HTLD 2K5DA 1SF0A 2C7NB 4US8A 1A5RA 1FR3A 1MG8A 2UXBL 2LXKA 2WWZA 3APFA 5JJLA 3VDZA 2EYPA 1XCQL 4O42A 4A3EH 1EY9A 3QR8A 3UDXA 4ARCA 4A3IG 4EFOA 3DUZA 1HNZL 2J0MA 1OQYA 1A8VA 2VW9A 3DCGA 1WM2A 4K81A 2IHFA 1EEFD 5DEHA 5ELBA 3KDFA 5KEEA 1A70A 3I73A 3QOLA 2MJDA 2E74C 4DFAA 2AUJD 4G50A 1YITA 3P4RB 2K8CA 4XYCA 4I7AA 3K80C 2DUDA 1S5DD 4LF5L 2BQQA 2WU2B 4N9F4 3IKJA 4XZ4A 1HZBA 3RYTA 1YNJD 2HJ1A 3T13A 2H89B 4OWTB 2CJNA 5C5LA 3ALBA 2HCCA 2KJXA 2JJQA 2BBCA 3APCA 1TKGA 3C3LA 1HUNA 4N6EB 4P7IA 2LGDA 1ICFB 2EKEC 3RLNA 2BB5A 4PS7A 1QWYA 2D0PA 5CMDA 3BYYB 3VR4A 3SK8A 4PQXA 4A3MG 1WX9A 2J53A 2KN4A 4L23A 3DHQA 3PV1A 4A90A 1YNJC 1Q81C 3VR8B 3QJZA 4FF4A 5C3EG 4NP5A 4KKSA 2ID0A 1VQFA 3HOYB 2K25A 1A3VA 3GZNI 1WGYA 4RAUC 4YCVA 2B2TA 3UI3A 3CPFA 2ICIA 2QGQA 3IL8A 2WU5B 5FR6A 1V1PA 3DWPA 3G6EA 2KLCA 4GN1A 1GB4A 4C1NI 1FXTB 4AP4C 4IOAA 5GQOA 1OXXK 1NBWA 2VUMG 1AH9A 1LT5D 3FKIB 1HR0Q 2IY1B 3BVZA 4AIMA 3PLUA 1YNND 5ELFA 2WLBA 1WIAA 4A3FB 1WTWA 2G1EA 4KSLC 5E6JA 3U4VA 1KHIA 2RSOA 2KX3A 1PRTF 1N6ZA 3Q3FA 2KJRA 2IYDB 4LK0M 1GOZA 2MO0A 3KF8A 4MJSB 2RSUA 4DNTB 5BN4A 4ZRQA 2KO3A 4RGMA 4IWQA 2KC1A 2IBIB 1PZID 1NYRA 1YNNC 2XK5B 3P4SB 4YTNB 1C48A 2CFMA 1VCBA 1FGUA 3ER0A 1WCMH 3K59A 1U4LA 4JI4L 1KLUD 1IKLA 2F0DA 4AQYL 4FXDA 2OF1A 4BXXG 2N9KA 1TWGH 2KAJA 3KF6B 5JZEB 5EE1A 5GAGC 3S2HH 2N88A 5ELDA 1Q1OA 1XLQA 2GBJA 2CJOA 3MHSD 2F0SA 4MTKA 2PPHA 4DUZQ 1RKNA 4KGSA 2IO3B 1ESRA 3DEOA 4AWJA 2D2CC 1QCBD 1NR4A 1EQTA 5BN3A 4KJNA 3S17B 2F0KA 1TWFH 2MEKA 1CZWA 3K81C 1WTVA 4ACFA 5EBDA 4EQOA 3APDA 1SAPA 1K83B 1Z6HA 2BB6A 1FGBD 3GTJB 2JA8G 1Z47A 2R92H 2BS3B 3TREA 5BYQA 3PO2H 2CQAA 2Y5CA 4XX5A 3LX0A 1BMLC 3MVVA 4MZ9A 3I70A 1U9RA 5DNFA 3H0GH 3MXNB 3AYHB 5DM73 2E2JH 4W9KA 1MIUA 4JX1C 2LJ5A 2B2TC 2HIXA 1BBWA 2A5UA 4JE3B 4YL8A 1A0IA 2K9XA 2PW9A 2LMCA 1STEA 1KAWA 3C8YA 4K3BA 4KIKA 5IIFA 2C7MB 3KBGA 4WWNA 2F0MA 4YSZB 3BZCA 3PMFA 1CI3M 3PO0A 2LASA 4F8CB 4WAFA 5LMNQ 2OEDA 3NBHB 3CRLC 1ZGUB 1V1PB 2C5CA 3VUXA 1YJIA 1EZ6A 4X62L 2IGGA 2L83A 1ONLA 2WXNA 1OTCA 1E0ZA 4BWGB 2KD0A 4YSXB 1E7ZA 1A3TA 3W1GA 4A3BG 1BR9A 2JVCA 1LLRD 4C3HG 4K7WA 4REZA 2ALYB 4W9EA 1QNUA 1B3QA 5BR8L 3E9IA 3M3YB 1TS2A 4KJOA 5EKLA 3AE9B 3CCUA 5DCNA 5HY6A 5D94A 1LO5D 1YJ1A 1WXMA 2IGDA 3KF8B 1ZW7A 1SSOA 5IKCM 2Q8TA 4P71A 3N32A 4OONA 1V43A 5FJ8G 1ZXTA 3DBSA 5FLXE 2QIEB 1WD0A 2JA7G 4EZJA 2KANA 2KDFB 5KHOA 1L1OC 2K14A 3TEHB 3S2AA 2DJGC 4AOFA 4GDKA 4LJPB 2K1BA 1TQOA 2HDLA 1XYIA 3S16B 1SN8A 3L7ZC 3HOYH 3CU7A 1SYDA 2EIFA 1AARA 1G51A 4W9FA 1V80A 3QCAA 3I4LA 3AM9A 1L1OB 2OXPA 1BUVT 2DHZA 3PHWB 4DV2Q 3FKIH 2BF8B 4EE2A 3K5OA 3IT4B 2PYKA 1J6QA 5E4XA 5GXGB 3JC66 2KN5A 5KGUA 2BS4B 2QDFA 2I2YA 1F2MA 4ME5A 4A3FH 1JCKB 1SSNA 4MGYE 2WHIA 1KH0A 5EJWA 5CV8A 2TMPA 1QVCA 3M85A 1LACA 2IO0B 2LJIA 2HHHQ 3EUB2 1BCPD 3CF6E 1E6EB 3T9LA 5CBEE 1LM8B 3E5SA 1HJPA 1D5XC 1S5CD 1QZHA 4W9GA 4A3EG 1F2YA 3WA0A 3DWMA 4K6DA 3H7SA 3KUPA 5CGKA 1PH8A 1NYQA 2BWES 1PFDA 3BG3A 2KBNA 2LRWA 2LMCB 1OO9B 1BCPC 2JZ3B 1HE8A 2WDTB 3AE3B 2M2LA 4KIKB 3CAMA 3EQLC 1QQRA 1H4RA 1NY4A 4RWSC 4K0KQ 1LYLA 2KEEA 1G6ZA 1NBFC 5C6AA 4K8JA 1U5KA 1RHPA 4ABNA 2B76B 3K5NA 1K28A 3I4OA 4KY6A 1VZ7A 3X23A 3S17H 5M9OA 1BCPB 4HLEA 1VQDA 1K83H 1A6XA 4KN7C 3GTJH 1N8RC 2F4VL 2M56B 1UE5A 1MHHE 1E24A 3RLFA 3BJUA 5FLXc 2UU9Q 4RG1A 4GOCA 3EBEA 4FDBA 3HOZB 3UIPB 1KC8C 1MG4A 1TS4A 4XE0A 4LF7Q 3B1LX 3V6EB 4L5TA 1V5TA 4WJ3M 4DUZL 4X3SA 1ZYRD 4IM0A 3WAOA 3U4ZA 4BS9A 4LWCA 3TCAA 3ZO5B 1WR1A 3ERQA 1XWEA 3ZW3A 1SNMA 1U4PA 3AI5A 3V61A 4JV5Q 5EDSA 1D6EC 4GDKB 2OTLA 2WDQB 4FP5D 4ZKBB 3PF4A 2NUCA 4PG3A 3OHXC 4P75A 1WTXA 1TIFA 4A6QA 3BIID 4DDID 4IJLA 1B9MA 5KNDA 2IY0B 1ZYRC 2LFNA 1H9KA 3HVDA 3RZWC 3A74A 4RHRA 3I4NB 2KMCA 3U50C 1TXYA 1MSGA 2YLMA 2WS3B 3CMAA 1WJ6A 3K9OB 1WFYA 2A68D 1WD1A 2YTYA 4K2KA 4PZ8A 4CDFC 3J7AV 3M3YH 4GLAC 1YQ3B 5CBAE 5JPMC 3GDEA 1WXQA 2DZIA 1E7UA 3D4WA 1CFMA 1HXYD 1SR3A 3NRZA 3A55A 3QK0A 4FULA 4AQ7A 4C3JG 4DK3C 2N7JA 1WCMG 3TL5A 2PQAA 3RPFC 5IT9c 5K5PA 2KQSA 5LMNL 1SFOB 4MGIE 3HOWB 2A68C 4LW1A 2LHDA 2LEKA 2C7HA 2MQJA 2LGXA 1S40A 3S16H 3UE1A 2BYTA 4JI0Q 1SMXA 2PTLA 1P7EA 3Q3NC 4QUCA 2L12A 2UXDQ 3ZXVA 3C46A 2N78A 5C44B 4DUYQ 2XWJB 3RULA 3H6MA 4H02A 3TEZA 2R92G 5CHVC 1I50B 1IYJB 2F0HA 1NDDA 3ZIMA 4TV3A 3PO2G 2AEHA 2NR2A 3HOUB 1L6UA 4HK2A 1UF0A 3H1UA 1S5BD 3CHBD 3CQZB 2BYFA 4KGTA 3TBLD 1B44D 4ZAIA 4I7ZC 5JPNC 3ZJVA 4DF7A 4H2AA 4A76A 5M3MB 1QZGA 3EFXD 1PFNA 2ZPYA 1TS5A 4H13C 4TQ0A 3QWNA 5AZHA 1IP9A 1WR6E 3JAME 4DV2L 3QARA 2ZJQA 2OT2A 2BE5D 2WXLA 4UHVA 3KH0A 1PFBA 3GTKB 3HG9A 1EY8A 4BFRA 5AJ3Q 5BMGA 1IBLQ 3M62B 1UGJA 3H15A 4LFAQ 1P7FA 4WORA 2HHHL 5LXHA 2KXJA 3A1QA 4CJ1B 2FIDA 2ZJPA 2EJGC 1WM3A 2B2WC 2Z0SA 3D32A 4MT5A 2JEAI 4FA6A 5A2QE 4GKJQ 1IZ6A 2MX2A 4Z9CB 3LNNA 3CC7A 5IT9L 4HJ7A 5TR5A 4JL9A 4L8JA 2JWUA 2M17A 4JWSC 3HOZH 2N8NA 2NN6H 1HTPA 2Z1CA 3EFCA 5HI1A 2ZTDA 3W9CB 1UNSA 2PQAB 5EKKA 3VDYA 2JQRB 3HOYG 3P2BA 3PUXA 4N9TA 4LMQD 2ZJRA 3E9SA 3KYCD 4WURA 5FO8B 1ASYA 4XWWA 5L95C 5EQ0A 2DYMA 2W55A 3FKIG 1F2RI 3ABVB 4WFN3 4IUVA 1QOGA 3SK6A 4NMZA 4OEMB 4YIJA 1V1OA 2UU9L 3TN2A 2IO2B 1K8MA 1NNXA 2LGYA 4A3FG 1PVOA 2K6AA 2NBWB 4WIPA 1VQBA 3RZDB 2INCC 3I4NH 1SE8A 1AYFA 2PVGC 2NTSA 4XGAB 4LUVA 1KF6B 4HMIA 5IOCA 1B3AA 2JWZA 4X66Q 2EYJA 1PH3A 4R4CA 4N8FA 1YMHE 2HDEA 3Q8EA 1Z2MA 4IWPA 4HIKA 4OZCA 4OVUA 3RNAC 4HTHA 1YX6B 1O7ZA 3AU5A 3B6YA 3Q14C 5I9PA 4JV5L 4DK5A 5JEAG 2Q2UA 1I4QA 4DXFA 3V05A 3JAMc 3Q69A 2CH4A 2K5NA 2RSNA 2F3WA 4K2LA 2B3GA 1X56A 1QKZA 2KCTA 2K5HA 4HEA1 3RNEC 3J80L 1SFOH 3GV6A 1O7IA 5EBCA 4EQNA 5J22A 4BBRB 4DGZA 3HOWH 1SB3C 2FUHB 2WX0A 3DWGC 3ETRA 3KUDB 3PPAA 5G3LD 4K7SA 2D3BA 2Z6BA 2G9HD 5J1ZA 2BTEA 1R4MI 5EE0A 1D5ZC 5JVG3 3EGRA 2WGSA 3W5VB 2KMAA 1UE6A 1JORA 2NTTA 2C60A 3RNGC 1WSPA 2PIAA 5C44H 3A9JB 1PFMA 1A3UA 1HHVA 1QUQA 3AE2B 1JB7A 3AFQA 1PXUA 2RF4A 3ZUNA 1OXVA 1I50H 4LK1C 2NVYB 3QJYA 3J7A5 3ML8A 4YWMA 2MP2B 3HOUH 2WDRB 1C4CA 5EE3A 3T3OA 3K9PB 1TGZB 3CQZH 1X3EA 2DY7A 2NVTB 1SNCA 2PZUA 1K8RB 3KUZA 2Y5BB 3I4MB 4UP9A 1IUEA 2LFIA 4JI0L 3GD7A 1JE4A 5NUCA 5M3MH 4B3TQ 2PKOA 2UXDL 3AU4A 2WNMA 1WRIA 4NW2A 3DXJC 3PGEA 1NJIC 4DUYL 3N1YC 2INNE 4DK6C 1E8YA 2YYZA 2PMZB 3RR5A 2KACA 3BZKA 3OTOQ 3GQBA 3ZNZB 3HIZA 5KNBA 1BVSA 1VF7A 3M4QA 3Q6BA 4WJPA 1FD6A 1YZ6A 3HGBA 3GTKH 1WFQA 4A3BB 2LGIA 2JQOA 1J0GA 1MPEA 4A75A 2N49A 4KKJA 1GAQB 3GO5A 4P72A 3K5MA 3G6JB 3EVQA 2WXIA 1V6EA 4ME3A 5JOBA 3JAMi 3ZJYC 3R66C 1X3QA 4W9DA 2CQOA 2AYOB 1WZ0A 3K57A 1IKMA 3U7DA 3QA8A 5LHY1 1HTOA 1Q90A 3KQ4A 1JW9D 1WTPA 4QCLA 4POGA 4FXCA 3T1HQ 1HZAA 3NEMA 3A0JA 4KK7A 1E2ZA 2BW2A 5IOIA 1JICA 1B7YB 3MTNB 1ENAA 5C3WA 4KMUC 5AJ3L 1SGHA 1IBLL 3UQBA 1J8CA 4HPMB 4LFAL 1PTOC 2XNAC 3I57A 2JPHA 1JROA 4WJOA 3A9KA 3AMUA 1B4OA 4C2MB 4WQMA 3CC4A 3GTOB 4DR4Q 4DV3Q 4M1UB 4KLKA 1SBBB 4A3LH 2CHZA 2W3RA 1TS3A 4GB9A 4W9JA 1WXSA 4GKJL 3MZ5A 1VQHA 4TQ1A 2OTJA 2EVBA 3ZJUA 3KW5B 4ZRJA 1V2YA 3A8KE 4NXNQ 1FO4A 4G0NB 4IQZA 1JJGA 2GLSA 2PE9A 3RFZB 3RZDH 1RF2D 1QUQB 3A5UA 1UH6A 2KHWB 1IYFA 2RBMA 2QEXA 3PUZA 1XLOA 2MBOA 2AUKA 1STHA 3DHIC 1QF6A 1IBXA 3SEBA 4WRDA 3MC9A 1BOSA 5E1FA 3MWYW 2WXQA 2K52A 1X9NA 1OFFA 1KRSA 3BINA 3U8ZA 2QCPX 2JK8A 1Y1VB 4GMVA 4PS8A 4KZ0A 3QIAA 3NSWA 1IPGA 2PZWA 4BBRH 4X3KA 3ZJTA 4Q0FA 1XNQQ 1PDXA 5I6WA 3T3NA 3N52A 3OW2A 3I91A 4UDUC 5I6YA 3PZ7A 4G4KA 4X66L 1NAPA 4FO2A 1J19A 1AZPA 4PYZA 3PIO3 5JEAJ 1YQBA 4KV2A 2XRQD 4F7ZA 2BS2B 3J7ZC 1SROA 1N62A 1E7PB 1X54A 2EKIA 1C7YA 1V8CA 4K5VA 4HRSA 1V97A 2NVYH 2KVMA 3I56A 1JOKA 4A8XC 3PZDA 3HOZG 2NN6G 1TZOA 4ZLTF 2NVTH 5J17A 2Z59B 3TIXA 1RIPA 3F8TA 3KLRA 1DOIA 4HDQA 3NP8A 2RHSB 3M7GA 2KDBA 1C9FA 3I4MH 2NVXB 5IO9A 1TT2A 3BY4B 4LF8Q 1GB1A 4DPGA 4HJ9A 4UP8A 2DNCA 4XDDA 1B53A 1NI3A 1N5XA 3TMPB 2EYOA 5CV7A 3L13A 3KFUA 3A9KB 3ZLZA 1UAPA 4R4OA 2FMMA 4A3BH 4HEDA 2UUAQ 1N60A 4GU2A 4DDGD 1OXSC 4PMWA 3I4NG 5BYRA 2IHEA 5I9OA 2PLPA 2OQKA 1YIWA 1WJ4A 4L1BA 4O1NA 5IWAQ 2JSOA 2UU7A 4I65A 1K8GA 4B3TL 3NPPA 4B08A 4FF2A 2OEOA 4TKOB 4LUOA 1NEKB 2ZZPB 4WJWA 4C3JB 1GJXA 1TZ1A 2R2OA 4XIGS 3K0XA 4U68A 1M90C 5EAYA 5FJ8H 2JF5A 2B2UC 3SK5A 1VDVA 3PUVA 4DHJB 1IBXB 1DJRD 2B3AA 4B3RL 4DHZB 3HOWG 4C7ZA 3R2IA 3E0EA 2L7RA 3Q8CA 3Q2AC 5IYCH 4BBNC 4PZ6A 3WCQA 2VQFQ 3UDFA 2PW5A 1KAAA 4TVAB 2O2VA 3IAS1 1E8WA 1PH7A 1S1QB 3T51B 3H91A 1ZUD2 4KI0A 4KSKC 4JBWA 1NTGA 5C44G 4C2MH 3W1BA 3GTOH 1PH4A 4W9LA 1B9NA 3TEYA 2NS5A 2ZTCA 3NVVA 1AW7A 4A93G 2D3CA 1K3BC 1KOTA 4EQ5A 1YN4A 3UGBB 1HZ5A 1PTOH 3T1HL 1ZP0B 3HOUG 4AYBE 2RPQA 2FAZA 4Y52H 1EL0A 1JE5A 4DXGA 1Q8IA 4OIJA 1PH2A 3CCVA 2K8BA 3UIOB 3D3RA 3P63A 4MGKE 1WGHA 5HGTA 2L11A 3GTGB 3I3TB 3JYUA 5M3MG 1VQ4A 2PMZE 2M0AA 2PW7A 3I7FA 4RFBA 1HR0W 2UUBQ 1GUAB 4DR4L 4YT0B 2L1BA 1YN5A 4JLCA 1EYAA 3MA2B 1YNXA 4JI7Q 3QX1A 1Y1VH 2JP1A 5D65A 1JJ2A 2J52A 2NPTA 1N33L 2KQ7A 3IHPC 3S2DB 3LWUA 1G291 3PIOA 2EYFA 4A3CG 1F77A 2ZEQA 2O2LD 3A4SC 5C1ZA 1SJHD 3TZDA 4NXMQ 3AFPA 1C4PA 1W6JA 1T0RC 4ZKCB 4QQBX 5H8YE 4XQJA 2VL6A 1PH9A 1RCVD 2L8JA 3AECB 4GKKQ 2RDGA 3NWSA 1K53A 1CTMA 4G3XB 3KWLA 1BO0A 4HN7A 2KT7A 4MGZE 1CT1D 3VRAB 1MSHA 4JK1C 3S1QB 4DV7Q 1XNQL 5FOBB 2FCNA 3TMEA 1DM0B 1NSNS 2KX0A 2X8XX 2F0LA 4E74A 4BBSB 2NVXH 3IBEA 2LRUA 2GBRA 1BKBA 1G6JA 1P1AA 3R2TA 2EXZA 3H09A 1GUWA 2CWPA 4NB3A 2B2VA 1TWHB 4RA8A 3U7ZA 1XX8A 2FJ2A 4CDDC 2H88B 3DBRB 1VJKA 4A3LG 5JAVA 2O2VB 4CQNA 3VHTC 2XSCA 1NR2A 3VR9B 1KDCA 5CR3A 1FL0A 1XPOA 4ZCKA 1IGDA 1QNKA 4H7BA 2P5ZX 2EE1A 1J7CA 1FRDA 2J7QB 4RM8A 2OJRA 2F0UA 1F9JA 1XO3A 3CD6A 2KJHB 5LNK1 3OW7A 1V86A 2QC8A 4DV1Q 4LTUA 5CHFA 2V3PA 4EZLA 2FHTA 4E6IA 3BDLA 4LF6Q 1J7BA 1ILQA 2AL6A 5D3IB 4LF8L 1FNVA 2KDIA 3V96A 5K36H 4APVA 4C3JH 1LT3D 2L05A 1EEID 1SYCA 3T16A 5ELNA 2K05A 5C5MA 5LMNW 2PZTA 4LF9Q 1FFVA 4I6LB 3K5LA 1XQQA 4FF1A 1TIID 3KYDD 1I6HB 2KUMA 2L76A 4BBRG 4QJFA 5IP7H 4DN4M 2UUAL 1PZKD 2IWHA 1CA5A 1J7AA 2PVOD 3L9AX 2AX5A 4GOPA 3B9JA 3J81L 1TTNA 3H6NA 3N6RA 3KDFB 2NCNA 5IWAL 1VQGA 2RA4A 2JA5B 4J3OD 4B3MQ 1SNQA 4QF4A 1CSPA 4OGQC 1DOMA 2D11A 1PZJD 3T56B 1PH1A 3T8MA 3IFWB 4P6VF 2E76C 4HMJA 1JWSD 1UD7A 4ZRPA 3MP9A 3QG1A 1XTCD 4NJCA 3TEXA 2GOWA 3BK2A 4X65L 4B3SQ 4JBKA 2XGTA 1TKYA 4CKBA 3A8IE 3HM6X 1F2ZA 2KHJA 3VR3A 2Z6KA 4CBVA 1UUPA 2ZXRA 2M1MA 1XNRQ 4OWXB 2FUG1 4RGNA 2VQFL 3GTGH 3I4MG 2L32A 1EO6A 4H44C 4L5RC 4CHTB 2B2VC 1FJGQ 4L63B 4YWLA 3H7PA 1N34Q 2D5GA 1O78A 2MSED 4ULLA 1FYCA 1FEHA 4R9WA 4GN5A 3S24A 2Y0SB 2N7EA 1VCIA 5JVH3 1P98A 1F9SA 2WB1B 3S2DH 3TZUA 1EY0A 1K51A 3AN1A 2O5JC 2NN6I 1FXIA 3T4AC 2JT4B 4FJYA 2C9OA 2KA7A 4OZAA 1RDPD 1VD2A 5COYA 5E3FA 2AQ3B 2D62A 2KYWA 3FHWA 3T53B 2UUBL 1QZEA 2HTME 2INDC 2JXTA 4DHZE 4IUQA 2F0GA 2ZXOA 4TQUS 1B2TA 5LMUQ 2PJHA 2I5HA 2ZVOA 3OJ4B 1XTDA 3PRZA 4JIOU 1QJOA 3SHQA 1LGRA 1WYGA 4BOZB 3PF5A 4ICVA 1R4PB 2KFJA 3S1QH 5EE9A 2SEBD 2DNFA 2YEPB 3ZGZA 3H8HA 5IGCA 5IYCG 4GOPC 1XMOQ 1TT5B 4BBSH 2VH1A 1K9MC 1IW7D 4NAMA 1M8AA 4ZHPA 3U58A 4NXML 1GUOA 3NE5B 2C35B 1S5FD 1S5ED 4KKUA 4HJAA 1TWHH 5F2DA 3TRZA 4IUUA 4RKLA 1CA6A 1YX5B 2R2QA 2VQEQ 4GOPB 4KN4C 4X64Q 2OQ0A 1EYGA 4K7UA 4BY1B 2UXCQ 4GLSC 1C8CA 5G55A 1IW7C 1WYWB 4OW0A 3BVMA 3H3VC 1HZ9A 1VRAB 3F2UA 1OQRA 2Z6KC 1JRPA 1GC6A 2JA6B
chains in the Genus database with same CATH topology
4KX6B 1SYBA 5JEAH 1BNZA 2K3UA 5KIXA 1JWBD 3OIPA 3AEFB 5FR3A 3I90A 4RCNA 1PDQA 3AEAB 5IT9E 3KWVA 5JJZA 2CHBD 2MJ8A 1RFKA 2QEJC 5IGEA 4V0BA 2MJEA 1Y1WB 2PO4A 4J8QA 3TP8A 3Q0AA 2B8GA 4YSYB 4LLGM 4A3GB 5DAUA 1E10A 4HKQA 4ILWA 2QMTA 2EJMA 2YU9B 2WXGA 2GA4B 1CQFA 2SAKA 1WGKA 2R7ZB 3D4RA 3GB1A 1L4ZB 2GI9A 1H9SA 4ZHOA 1ET6A 1LTID 1MBYA 3N9YC 4C7YA 3TEWA 5G5HA 1LTGD 1OXTA 2E2DC 2BA0A 3M4OB 3RZOB 3TP5A 5FKAC 2BDOA 2KCNA 1FMAD 2MPMA 3TSSA 5C0XH 1FXAA 2JU6X 1XF5L 4KKIA 4D2KA 2ONQA 3BVGA 4NKLA 3SFEB 3HRZC 2DBYA 2EDGA 2F1MA 3NBIA 4ITKA 1ZKOA 2F0EA 2L5TA 2EJFC 3X3MA 5K36G 1EWCA 2PNRC 2NMQA 2ON8A 2DN8A 4DAPA 1PTOF 3VYTA 1PRTD 2J42A 4N59A 2VZKD 3AV8A 2KECA 2X69A 1XLPA 4L2YA 3AE4B 3P1HA 1BQQT 2WKCA 1PRTC 4A93B 1ZDXA 4XDCA 1DOKA 1WTOA 1LTSD 2CU3A 3SR6A 3U2SC 3VRBB 1JWUD 1EY6A 1QOAA 3R3OA 3TP7A 1ICWA 1PRTB 2QSDA 3B2GA 2J7ZA 2NBFA 2RVLA 3S14B 3FDTA 3L3OC 3VQIA 2M9VA 2Q8IB 4F88A 5M5XB 4HJGE 1NVID 1IGCA 4MH8A 1SNDA 1JALA 5IGBA 3GTQB 2E2IB 1K50A 4IKGA 1QE6A 2M00A 1OQQA 1Y8OB 2IX0A 2BE5C 4R3DA 4YTMB 4IUPA 3AEDB 1ZXHA 2Q8RE 3P20A 2L0CA 4P16A 1DCZA 1J9OA 2RKSA 1SEBD 4FXKC 3I72A 1HQMC 1FM0D 2X6GA 1KDBA 1QILA 3K7AB 1STAA 4KKTA 2EPBA 2O5IC 2K5PA 3AB5A 1D1IA 1R4QB 2HDMA 2MHVA 1I6VC 1HEZE 2OHFA 2EELA 1CHQD 2VNUD 1YNTE 3OOCA 1Z7TA 2WXMA 1E9MA 4HROA 1EOTA 1FFUA 3S1NB 2CVRA 3P4QB 4ZYSA 3C2PA 1HUMA 1AN8A 1TVXA 2JYOA 1ENCA 2M19A 1LT6D 2K5QA 5HFYA 1Q1EA 1ZPSA 1Y56A 4G7OC 3W3AA 3HVZA 4A55A 2JE6I 1L0XB 1DZ1A 5T8IA 2WV6D 5H92C 3U52E 1D5MC 4PMCA 3CKIB 1J8IA 2F0NA 4AS1A 2VB3X 2WDVB 1EYCA 2RDFA 3P75A 3R8BA 2JEBI 5LL6S 5C3XA 2SDFA 1D2BA 4A3KB 1QG7A 2IPKD 2A73B 4XYOA 2IL8A 4AYBB 3LB8C 1IYUA 2MUYA 1SE2A 1II3A 3E0JA 3HOXB 1EIGA 1ZOYB 2WP8J 3EROA 1K8OA 3D6WA 2AWNA 5CV5A 5C0XG 3Q8FA 3P1MA 4KHVA 3GS2A 4XDXA 1DGJA 4MN3A 3D8GA 5KYLA 4ZRZA 2V4DA 2VB2X 1KNEA 4FYDA 1CHPD 3TBIB 3MJ5A 5A35A 2FMCA 3NWTA 1A15A 3VYSA 1FIQA 1T6BX 3ITPA 1ZEQX 2AQ1B 3MC0B 3GTMB 1PLFA 2QKIC 1DYQA 3MXPA 1VMCA 3OPOA 5E4WC 1MVKA 5D7GA 1BDOA 3FPPA 2KQ3A 3A54A 1U4MA 1I4HA 2A6ED 2ZW1A 4HKZE 3G7LA 2IW3A 1QT9A 2BA1A 2R3ZA 4M8AA 2WQYB 1EU4A 1PGAA 1Q3LA 1XEEA 4RCOA 3QO2A 1HRJA 3GTPB 2A6EC 1RJTA 2X38A 5D14A 1GXDC 3PO3B 2KMMA 1H9MA 1SYFA 2F0OA 3FEWX 1FCLA 1OXUA 1DOXA 3TP6A 4PNYA 4QUFA 3X3NA 4KHZA 1IL8A 1MD2D 3J7AF 4KD4A 2WXJA 2KEDA 3NQTA 3I8ZA 3BWUD 1VF5C 2WIIB 1JOQA 4K5WA 2IT1A 5C4XB 5FK9C 4MM3B 1KTKA 3HP3A 4F87A 1GUTA 1SMYD 4CKCA 3P42A 4FF3A 5I2XA 4TMAB 4IUNA 1C77A 1TWAB 5IODA 3LXFA 5M5WB 1R7SA 3BDCA 3W1SA 2SNSA 1I4XA 5C4ZA 4CGYB 2B63B 2SNMA 4C80A 3W2DA 3DMUA 2E6XA 1QOBA 4G7HC 1ESFA 2E2HB 2D5DA 2FFKB 4ZQ3A 1FNUA 2QILA 2WP9B 3QOJA 1EY7A 2J4XA 3AMZA 4RGTA 3EA6A 3J81E 1HZ6A 3AEGB 4A3DB 2F0WA 2A74C 4ZUJA 2LKVA 5I4DA 1FD7D 3ND8A 1STBA 5C0XJ 2JYTA 4HCEA 1JWAD 1TYGB 4XQNA 5AUKA 1SIJA 1CM9A 3V2TA 1DD2A 2CW0D 4XWTA 3D31A 2JYEA 2BOSA 1GPXA 2V4IB 4BA1I 2FBWB 4S3SA 3A7AB 1N5WA 1N63A 1HPCA 2ENBA 1L0VB 4DU9A 2CW0C 3A7LA 3NVZA 2DNEA 5FO7B 2BT6A 4XXEA 3MXUA 2L4NA 3HOVB 1BCPF 5M5YB 2F0FA 4US9A 3WOEA 3NTHA 1RTNA 2ZXPA 2K33A 2V0GA 2Z8LA 3RD4A 1C79A 4KV6A 4HCSA 3K6OA 4JPSA 1L0YB 1JR0D 2Z4HA 2F3VA 3OMGA 2NB0A 5T1GA 1WWTA 4FVMA 3FVQA 4OIKA 2F0JA 1LTTD 4TRDA 4C56C 3MHZA 3FMCA 2IDYA 4HR7B 3EJIA 1KDAA 2R61A 5C0XI 4H0LC 5ELCA 1N61A 2QJLA 1EU3A 1RM6C 1BXTA 2NZ1D 4RF1A 1F0ZA 2F0IA 1LTRD 3TDQA 1LT4D 1PGBA 2K0PA 3FC4A 3MXNA 1ROEA 4PT5A 3BDOA 1B9RA 3MAQA 1KLGD 2WXPA 5AFWA 4B0MA 4KGRA 1LTBD 1O7YA 1KRHA 2EYHA 3OIQA 3SK4A 3NBHA 4QB4A 3LYYA 2XIWA 1X3PA 4F8MA 2N0SB 1MHXA 4RNAA 3S1RB 1ZE3D 3HS0C 1RODA 5LL6X 4ARIA 4EQPA 5D3DA 1SNOA 4TSSA 1ILPA 2N9LA 3V3XA 1AFPA 5HG2A 3IAYA 1T5EA 3RMHA 2A6HD 4EGVA 1BF4A 3URYA 3KK7A 4LAAA 2F0PA 3S1MB 3J9CA 1B1ZA 2EYLA 2GB1A 4L6TB 2A6HC 2G9DA 1EWYC 5BYSA 1PMRA 3P7JA 2QF7A 1DOLA 3GV3A 3VR6A 4DAYA 3CIRB 4USAA 3NZ3A 3ND9A 5TSSA 3AE5B 4V190 1RWSA 1SJED 2XN9C 2ZT9C 2JZPA 3SHLA 2O4XA 2Q5WD 1BUIC 5HURA 4GZYC 1QLBB 4KD3A 4K5XA 1G8ZD 3KLSX 1E0BA 1Y8PB 3MFGA 4UAIA 5KNCA 5C4HA 1C78A 1MI2A 4HAEA 2K04A 1YJJA 3R93A 2N55A 4QMGA 4IURA 3FAHA 3KLSA 5T1IA 2MGSA 4WH4A 1TJEA 2K22A 3DEPA 1WTQA 5HHDG 1H9RA 2KDMA 3GTLB 1WVLA 4G7ZC 2LHEA 2BDNA 4ID6A 3AEBB 1FRRA 4YWGG 1G91A 3E6ZX 3OWFA 2FINB 1CQVA 2ZW0A 3VA7A 5J39A 3CRKC 5KYIA 1LTAD 5DM63 2PCFB 4IFDH 3NVYA 1R9TB 2R93B 1QOHA 4OZBA 4RKBA 1EIHA 5KRUA 3QB3A 4NDXA 2IGHA 3IT6B 3PIP3 3A8JE 5C4JB 3IFTA 3GP7A 3BS1A 1AWDA 1JWMD 1TR5A 1O7LA 4FXGC 3VR5A 4XT3B 3HKZB 1TKEA 4KTAA 1TU2B 5G3LF 3S9WA 1QB5D 3K58A 4R8NA 3BZDB 4OO1H 1NCVA 4WWMA 3D4DA 3HRDD 2KWDA 2INPE 3I9V1 2L55A 2WXRA 3M4YA 4CJ2C 1D4BA 3U9OA 1C76A 3SR1A 1Y8NB 4R8IA 2B8FA 3S15B 2K32A 4J6HA 3K0YA 1UEAB 2NWGA 2DYOA 3WDNA 2RQXA 1FNWA 5CYUA 3OMCA 2MH7A 3J80E 2JSVX 2WKDA 5EGTA 1TY2A 1KABA 1G2TA 3HEJA 3MEHA 2I07B 3FPUB 2WXKA 5BMHA 3SVMA 4XTCS 2EY1A 1A2UA 4C1NK 1LABA 1UWMA 3PUWA 2H4OA 4P2CB 1MI0A 3VYRA 3IXSA 3Q6SA 1X32A 4U673 1PYWD 5EPKA 4A3JB 4JWUC 3U9SA 2Y3AA 2EYMA 4IZ8A 3AU7A 2B2WA 3SDZA 5C2TB 3ONAB 2DY8A 4X3TA 1STNA 2J0TD 2WAQB 4PV1C 1SDFA 2HQEA 1JOOA 2VZKB 2K5WA 1L5PA 5G5GA 3KBXA 3NUHB 2F03A 2F0QA 4J1MA 3Q24A 5C3JB 1H9SB 2LS01 3ZYYX 3CWIA 3NTIA 4ZOHC 1KFYB 4N58A 1W6KA 1F2LA 1KNAA 1EZ8A 3J7YW 4EVOA 4RHSA 4MIUA 5FLXL 2I46A 1HQRD 3C1FA 4C3IB 1S4ZA 3OWEB 4HSPA 3MFYA 2W3SA 1C4QA 2A69D 3L4PA 1DOYA 5CV9A 1TWCB 3FRPB 4RH6A 3DWQA 2TSSA 1Q12A 3AB9A 4Y7NB 3NTKA 2F0VA 1EM7A 2L52A 2A69C 4A3IB 2K01A 2L1AA 1ZXIA 3HZXA 3O13A 3W5UB 3E56A 1EY5A 5CV4A 2XWBB 4DAVA 1DXMA 1VDZA 4IUTA 4DK0A 3U4EG 2EY6A 1SYEA 3NVWA 4CJ0B 1PUTA 1HFNA 3VR2A 2JXMB 4BY7B 4LJZC 1O80A 3PUYA 2SOBA 4A3MB 2WXFA 4IFDG 5C3EB 1A2TA 1YN3A 1VLBA 5IGGA 3P4PB 3SXHA 3AE8B 4G57A 1NENB 2KOLA 2VUMB 4GDLB 2IJ0A 4RGOS 4CKEA 2D9UA 4YTPB 4FNFA 1G2SA 4IN3A 3Q8BA 3BK1A 2K28A 3TUOA 2RPVA 1RD9D 1ZDVA 2NVQB 1I3QB 4BA2I 4OO1G 3Q8AA 3RUZA 4PMBA 3Q23A 2EOTA 1XLNA 1JMLA 3DWAA 4DQOC 1GUSA 4DA2A 2PQEA 4Q2JA 3DM1A 2IX1A 2E3TA 3AE7B 1LV9A 1RYJA 1Q1BA 2QDBA 1TY0A 2H1EA 2F4IA 1XXGA 1EFID 2VXWA 3OSOA 1F9QA 1HA6A 2KHSA 2ACZB 4IALA 2JA8B 2X6LA 2HUGA 1TKWB 1D1KA 5M3FB 5MPOA 1EY4A 4KY5A 3NUCA 1DONA 2K03A 3Q22A 3UI2A 4NAWB 5ELEA 4M0WA 1V8QA 4QIWB 2JX5A 1C4AA 3C1EA 1QOFA 1I4RA 1E2VA 1IYVA 3I3CA 3NK9A 5FO9B 4ODGA 1F2RC 1AEXA 4C3HB 1ML0D 1CZPA 3SE0A 3NXWA 1Y69U 1SE3A 5I2YA 4A9AA 5IGDA 3H94A 3JAML 2DLBA 1PTOD 2JA7B 2IX3A 1SNPA 2EZVA 1E2WA 4IDIA 1U4RA 5JXVA 1PGXA 2MJ3A 4MHEA 2B2YA 4NZLB 1L4DB 2DWQA 1SXTA 3NHHA 3MHBA 4Q5VA 2HCIA 2RDHA 3WOFA 2GRIA 5ISRA 2MP1A 5A2QL 1GUNA 4K6LA 4XQQA 5CORA 2A5HA 2AWOA 4IFDJ 4RF0A 1PTOB 5CC4A 1BBXC 3VA5A 4IOIE 3IAM1 1IHZA 1I7HA 2V3NA 1HFGA 2PPBC 1ET9A 1ACCA 4YXDB 3NQIA 2EY5A 4DNRB 4HSVA 5CV6A 1WTRA 1GHKA 1B50A 3PV0A 4A3EB 1NUCA 5EPLA 1VMPA 4OHJA 1K52A 2B2UA 4DK1A 3M7NA 3FILA 5BN5A 2Y5PA 2PMVA 1CZGA 3NS1A 1SMYC 2WXOA 1AP0A 2RMMA 3AH7A 3B2FA 2LY7A 3VYUA 3D6CA 1JQYD 2E75C 2XRSD 1M4VA 2W54A 5IGFA 1SE4A 2WACA 2W82A 4F7XA 1STYA 4MACA 1VR9A 2YEPF 2B2YC 1EWHA 1T5XD 4K8IA 3MTSA 2KQ4X 1MGSA 2ICEC 1H9JA 2Z4IA 3MXGA 2EY2A 1XCTL 3AE1B 2I38A 3SFDB 1EQVA 4XYQA 4X3UA 1SYGA 4N9PA 4B9XA 1CK1A 1HA5A 2AQ2B 1VZ6A 2K7VA 4KY7A 1UWXA 4IFDI 2L9HA 1JQ4A 1L6VA 5AUIA 3ZQ4A 2NYZD 1GUGA 3AEEB 2FE8A 2R6GA 1I4PA 4ZK9B 4XT1B 3A56A 1VZ8A 2KCCA 4K14A 1WCMB 1CJEA 2BCOA 1AZQA 1TWGB 1F9RA 5EPJA 1JC7A 2LUMA 3AE6B 1ENFA 3IFDA 3S2HB 1EYDA 4OVZA 1GHJA 3LWEA 3TEYA 1RTOA 1FCCC 1YQ4B 3PZ8A 1JB3A 1HCZA 1TWFB 4B0EA 3BYTB 3FILB 4OO1I 4ZUIA 4B9WA 1Q10A 5EKIA 2R92B 1F9PA 3PO2B 2WXHA 2WINB 2B39A 1T3QA 5BMIA 4OL7A 1STGA 4C3IG 1I4GA 3H0GB 2E2JB 3HUIA 2XVSA 2F0TA 1HTLD 2K5DA 1SF0A 4US8A 1FR3A 2EYPA 1XCQL 4O42A 4ARCA 1EY9A 3DUZA 5ELBA 5DEHA 1EEFD 5KEEA 1A70A 3I73A 3QOLA 2MJDA 2E74C 4DFAA 2AUJD 3P4RB 1S5DD 2WU2B 3IKJA 1YNJD 3T13A 2H89B 2CJNA 5C5LA 2HCCA 2KJXA 2BBCA 1TKGA 3C3LA 1HUNA 4N6EB 2BB5A 1QWYA 5CMDA 3BYYB 3VR4A 3SK8A 4PQXA 2J53A 2KN4A 4L23A 3DHQA 4A90A 1YNJC 3VR8B 4FF4A 4NP5A 4KKSA 2ID0A 3HOYB 1A3VA 4RAUC 2B2TA 3UI3A 3IL8A 2ICIA 2WU5B 1V1PA 3DWPA 1GB4A 4C1NI 1OXXK 1LT5D 3FKIB 3BVZA 1YNND 5ELFA 2WLBA 4A3FB 1WTWA 2G1EA 5E6JA 2RSOA 1PRTF 4LK0M 1GOZA 3KF8A 4ZRQA 4DNTB 5BN4A 4RGMA 1PZID 1NYRA 1YNNC 3P4SB 4YTNB 1C48A 3K59A 1U4LA 1KLUD 1IKLA 2F0DA 4FXDA 2OF1A 2N9KA 2KAJA 5EE1A 2N88A 5ELDA 1XLQA 2CJOA 2F0SA 1RKNA 4KGSA 1ESRA 3DEOA 2D2CC 1QCBD 1NR4A 1EQTA 5BN3A 4KJNA 3S17B 2F0KA 2MEKA 1CZWA 1WTVA 5EBDA 4EQOA 1SAPA 1K83B 1Z6HA 2BB6A 1FGBD 3GTJB 2BS3B 1Z47A 2CQAA 2Y5CA 3LX0A 1BMLC 3MVVA 3I70A 1U9RA 5DNFA 5DM73 4JX1C 2B2TC 4JE3B 2K9XA 2PW9A 2LMCA 1STEA 3C8YA 5IIFA 4YSZB 3KBGA 2F0MA 3PMFA 1CI3M 3PO0A 4WAFA 2OEDA 3CRLC 1V1PB 2C5CA 1YJIA 1EZ6A 2IGGA 2L83A 1ONLA 2WXNA 1E0ZA 4BWGB 4YSXB 1A3TA 1BR9A 1LLRD 4C3HG 4REZA 1QNUA 3M3YB 1TS2A 4KJOA 5EKLA 3AE9B 1LO5D 2IGDA 1SSOA 2Q8TA 1V43A 1ZXTA 5FLXE 2QIEB 1WD0A 2K1BA 1TQOA 2HDLA 1XYIA 3S16B 3L7ZC 3CU7A 1SYDA 3I4LA 3AM9A 2OXPA 1BUVT 4EE2A 3K5OA 3IT4B 2PYKA 5E4XA 5GXGB 5KGUA 2BS4B 2I2YA 1F2MA 4ME5A 1SSNA 1JCKB 1KH0A 5EJWA 5CV8A 2TMPA 3M85A 1LACA 2LJIA 3EUB2 1BCPD 1E6EB 5CBEE 3E5SA 1D5XC 1S5CD 1F2YA 3DWMA 4K6DA 3KUPA 5CGKA 1NYQA 1PFDA 3BG3A 2LMCB 1OO9B 1BCPC 3AE3B 2M2LA 3EQLC 1QQRA 4RWSC 1G6ZA 2KEEA 5C6AA 4K8JA 4ABNA 1RHPA 2B76B 3K5NA 1VZ7A 4KY6A 5M9OA 1BCPB 1A6XA 4KN7C 2M56B 1MHHE 3RLFA 3HOZB 1TS4A 4XE0A 4X3SA 1ZYRD 4BS9A 3ERQA 1XWEA 1SNMA 1U4PA 1D6EC 4GDKB 2WDQB 4FP5D 4ZKBB 2NUCA 3OHXC 1WTXA 4A6QA 3BIID 1B9MA 5KNDA 1ZYRC 2LFNA 1H9KA 3HVDA 4RHRA 3I4NB 1MSGA 2WS3B 2A68D 1WD1A 3J7AV 4K2KA 1YQ3B 5CBAE 5JPMC 1WXQA 3D4WA 1CFMA 1HXYD 4AQ7A 3NRZA 3A55A 4C3JG 2N7JA 3RPFC 5K5PA 1SFOB 3HOWB 2A68C 2LHDA 2LEKA 2BYTA 2PTLA 1P7EA 4QUCA 2L12A 3C46A 5C44B 2XWJB 3H6MA 3TEZA 1I50B 2F0HA 3HOUB 1L6UA 1S5BD 3CHBD 3CQZB 4KGTA 1B44D 4ZAIA 4I7ZC 5JPNC 3ZJVA 4DF7A 4H2AA 5M3MB 3EFXD 1PFNA 1TS5A 4H13C 4TQ0A 3QWNA 3JAME 2OT2A 2BE5D 2WXLA 1PFBA 3GTKB 3HG9A 1EY8A 5BMGA 1UGJA 1P7FA 4WORA 4CJ1B 2EJGC 2B2WC 4MT5A 2JEAI 5A2QE 4Z9CB 3LNNA 5IT9L 4L8JA 2JWUA 4JWSC 2NN6H 1HTPA 2Z1CA 5HI1A 3W9CB 1UNSA 5EKKA 2JQRB 3PUXA 4N9TA 4LMQD 3E9SA 4WURA 5FO8B 4XWWA 5EQ0A 2DYMA 2W55A 1F2RI 3ABVB 4WFN3 4IUVA 1QOGA 3SK6A 4NMZA 4YIJA 1V1OA 3TN2A 4WIPA 1K8MA 2K6AA 3RZDB 1AYFA 2PVGC 2NTSA 1KF6B 4HMIA 5IOCA 1B3AA 2EYJA 1YMHE 2HDEA 4OZCA 3Q8EA 4HTHA 1O7ZA 5I9PA 5JEAG 1I4QA 4DXFA 3V05A 3Q69A 2RSNA 4K2LA 2F3WA 1QKZA 4HEA1 3J80L 3GV6A 4EQNA 5EBCA 1SB3C 5J22A 4BBRB 4DGZA 3DWGC 3ETRA 5G3LD 2G9HD 5J1ZA 2BTEA 5EE0A 1D5ZC 5JVG3 3EGRA 3W5VB 1JORA 2NTTA 1WSPA 2PIAA 1PFMA 1A3UA 1HHVA 3AE2B 1PXUA 1OXVA 4LK1C 2NVYB 3QJYA 3T3OA 2WDRB 5EE3A 1C4CA 2DY7A 2NVTB 1SNCA 2PZUA 3I4MB 1IUEA 2LFIA 3GD7A 1JE4A 5NUCA 2PKOA 2WNMA 1WRIA 4NW2A 3DXJC 2INNE 2YYZA 2PMZB 2KACA 3GQBA 5KNBA 1VF7A 1FD6A 3HGBA 4A3BB 2LGIA 1MPEA 4KKJA 1GAQB 3GO5A 3K5MA 3G6JB 3EVQA 2WXIA 5JOBA 1X3QA 3K57A 1IKMA 5LHY1 1Q90A 3KQ4A 1JW9D 1WTPA 4QCLA 4FXCA 4KK7A 1E2ZA 2BW2A 1JICA 1ENAA 5C3WA 4KMUC 1PTOC 2XNAC 3I57A 1JROA 3AMUA 1B4OA 4C2MB 4WQMA 3GTOB 4M1UB 2W3RA 1SBBB 1TS3A 3MZ5A 4TQ1A 2EVBA 3ZJUA 1FO4A 3A8KE 4IQZA 3RFZB 1RF2D 2RBMA 3PUZA 1XLOA 1IBXA 2AUKA 1STHA 1QF6A 3SEBA 4WRDA 1BOSA 5E1FA 3MWYW 2WXQA 1OFFA 2QCPX 1Y1VB 3QIAA 3NSWA 2PZWA 4X3KA 3ZJTA 4Q0FA 1PDXA 5I6WA 3T3NA 3N52A 3I91A 4UDUC 5I6YA 3PZ7A 4G4KA 1NAPA 4FO2A 1AZPA 3PIO3 5JEAJ 2XRQD 2BS2B 1N62A 1E7PB 2EKIA 1V8CA 4K5VA 4HRSA 1V97A 2KVMA 1JOKA 4A8XC 2NN6G 1TZOA 4ZLTF 3KLRA 1DOIA 3NP8A 3M7GA 1C9FA 2NVXB 1TT2A 1GB1A 2DNCA 4XDDA 1B53A 1NI3A 1N5XA 2EYOA 5CV7A 1UAPA 2FMMA 1N60A 4HEDA 1OXSC 4PMWA 5BYRA 5I9OA 2PLPA 4L1BA 4O1NA 2JSOA 4I65A 3NPPA 4B08A 4FF2A 2OEOA 4TKOB 1NEKB 4WJWA 4C3JB 1GJXA 4XIGS 4U68A 2B2UC 3SK5A 1VDVA 3PUVA 1IBXB 1DJRD 4C7ZA 3R2IA 3Q8CA 3WCQA 2PW5A 1KAAA 3IAS1 3T51B 3H91A 1ZUD2 4KI0A 4JBWA 1B9NA 3NVVA 1AW7A 1YN4A 1HZ5A 1PTOH 1ZP0B 1EL0A 4DXGA 1Q8IA 4OIJA 3D3RA 3P63A 5HGTA 2L11A 3GTGB 2M0AA 2PW7A 4RFBA 4YT0B 2L1BA 1YN5A 1EYAA 3MA2B 2JP1A 5D65A 2J52A 3S2DB 3LWUA 1G291 2EYFA 1F77A 2O2LD 1SJHD 3TZDA 1C4PA 1W6JA 4ZKCB 5H8YE 4XQJA 1RCVD 3AECB 2RDGA 3NWSA 1K53A 1CTMA 3KWLA 1BO0A 4HN7A 1CT1D 3VRAB 1MSHA 4JK1C 3S1QB 5FOBB 3TMEA 1DM0B 1NSNS 2F0LA 4BBSB 2EXZA 3R2TA 3H09A 1GUWA 2B2VA 1TWHB 4RA8A 3U7ZA 1XX8A 2FJ2A 2H88B 1VJKA 5JAVA 4CQNA 2XSCA 1NR2A 3VR9B 1KDCA 5CR3A 1IGDA 1QNKA 4H7BA 2EE1A 1J7CA 1FRDA 2F0UA 1XO3A 5LNK1 3OW7A 4LTUA 2V3PA 2FHTA 4E6IA 3BDLA 1J7BA 1ILQA 5D3IB 1FNVA 3V96A 5K36H 1LT3D 1EEID 1SYCA 3T16A 5C5MA 2K05A 1FFVA 2PZTA 3K5LA 4FF1A 1TIID 1I6HB 2KUMA 4DN4M 2IWHA 1PZKD 1CA5A 1J7AA 2PVOD 3L9AX 2AX5A 3B9JA 3J81L 5BYQA 3N6RA 4J3OD 2RA4A 2JA5B 1SNQA 4QF4A 4OGQC 1DOMA 1PZJD 3T56B 4P6VF 2E76C 4HMJA 1JWSD 4ZRPA 3MP9A 3QG1A 1XTCD 4NJCA 3TEXA 3BK2A 1TKYA 4CKBA 3A8IE 1F2ZA 3VR3A 4CBVA 1UUPA 2ZXRA 2FUG1 2L32A 4RGNA 4H44C 4CHTB 2B2VC 4L63B 2D5GA 1O78A