1TS5A

I140t mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts5A01
1PTOF 5FK9C 1LTAD 1JWSD 4L6TB 3GP7A 1LTRD 1PZID 1KLGD 1ET6A 1M4VA 2XRSD 4UDUC 1D5MC 3R8BA 3BYTB 1D6EC 1BXTA 1CHPD 1TS4A 1PRTB 1PZKD 3R2IA 1L0YB 4Z9CB 1V1PA 1CQVA 1EU3A 1LT4D 3V05A 3W2DA 1HXYD 1TS2A 1G8ZD 1I4HA 2XNAC 1RD9D 3DWAA 1L0XB 4RGOS 2IJ0A 1B44D 3BVZA 5FKAC 1CK1A 3SEBA 1BCPB 1SEBD 1D5ZC 4O1NA 4BWGB 3KLSX 5ELEA 2XN9C 5I4DA 2RDHA 1PTOD 1ESFA 1YN5A 2IPKD 3BZDB 2QILA 1CT1D 1PRTC 1XXGA 1HQRD 5ELFA 1RF2D 2CHBD 1KLUD 3MFGA 1PYWD 1AN8A 3OWEB 1LT3D 1PRTF 5ELDA 3BYYB 1V1PB 2WV6D 1S5FD 3DWQA 2Z8LA 1SJED 5D3IB 1FNWA 1PTOB 1MD2D 1BCPC 1LT6D 2ICIA 1TY2A 1S5CD 5ELCA 1SE3A 1FNUA 1FD7D 1EEID 1ET9A 1JWMD 1JWUD 2J4XA 4TSSA 1SE4A 2XRQD 2NTSA 4RGTA 2NTTA 3TSSA 1RDPD 1CHQD 1LLRD 1FNVA 4RH6A 2AQ2B 1EFID 5ELBA 1I4QA 3DWPA 3URYA 1I4XA 1I4GA 1UUPA 1SJHD 1TS5A 4RGMA 4NZLB 1LTGD 1SE2A 4K6LA 1PRTD 1D5XC 1LTTD 1STEA 1TY0A 2TSSA 1T5XD 3R2TA 4OHJA 1KTKA 4RHSA 1PZJD 1LO5D 3EA6A 1LTSD 2O2LD 5TSSA 1F77A 4DXGA 3MC0B 1S5DD 3BVMA 1EEFD 1S5BD 1ENFA 1YN4A 1I4PA 1UNSA 1QILA 2AQ3B 2QEJC 1TS3A 4RFBA 1SBBB 1PTOH 1FGBD 3CHBD 4L63B 1BCPD 1LT5D 5D3DA 1BCPF 1JR0D 2G9HD 1RCVD 4RGNA 1B1ZA 1YN3A 1HA5A 2AQ1B 2SEBD 4DXFA 1AW7A 1LTBD 1V1OA 1EU4A 1XTCD 3BVGA 1I4RA 4ZYSA 1PTOC 1LTID 1SXTA 1GOZA 4C56C 3EFXD 4RCOA 1EWCA 2RDGA 1DJRD 1DYQA 3O13A 1JCKB 1JQYD 4RHRA 1HTLD 2R61A 1S5ED
chains in the Genus database with same CATH superfamily
3Q69A 1HZCA 3NQTA 1N6ZA 1EY5A 4L6TB 3NJTA 3V62A 4EZLA 4NMZA 2ZJRA 1BR9A 2R92H 4DR4L 3KJPA 2OTLA 1DM0B 1EY0A 1VF5C 4X66L 1A5RA 2INDC 4A3IB 5BMHA 1HZ9A 2VXWA 2LASA 3P20A 3MEFA 4GKJL 1GO3E 4FNFA 4JBKA 1CTMA 5JJZA 2L05A 1MG4A 2HCCA 1E10A 3PCOB 1BF4A 2RR9A 1IBLQ 5J3BA 2KENA 1X32A 2HD3A 2KT7A 4OL7A 1HR0L 2YU9B 1UBIA 2JT4B 2WWZA 2V1YA 1R7SA 4P73A 1BNZA 2G4SA 4LK0M 1WGRA 2BS3B 1LUZA 4LUZA 3S2HH 3ONSA 4AQ7A 3BZCA 1X9NA 3KLSX 2Z6KA 2IX1A 3W5UB 2QF7A 2FCNA 3A0JA 4ULLA 1WTWA 5EE3A 1PRTC 3G6EA 4DR2L 1CSPA 4GLSC 1F2ZA 4HPPA 3V6EB 3TIXA 1VQCA 2KDIA 3VYUA 4ZDVA 2L1AA 4JCVE 1W2BA 2KOXA 3OWEB 3VXWA 1KJTA 3H7SA 3WAPA 2KXJA 4QIWB 1TKYA 1PTOB 2I07B 3QO2A 4WIPA 5I9OA 4B0MA 4X62Q 4DR5L 2GOWA 2YEPB 4YY3Q 2VNUD 2OT2A 4GN5A 1YJ9A 2INPE 2GBMA 1LV9A 2F0QA 4DV2Q 1KD1C 1BT0A 4HEDA 4FF4A 2K33A 1GUTA 3EBEA 3I72A 4POFA 1EYGA 3T1YQ 2UXBQ 3DQVA 2PZWA 4CKBA 2B39A 2FXQA 5KRUA 3VYSA 4DNIA 4NPSA 1EFID 2IDYA 3PIO3 2B76B 2YTVA 3NEMA 2A73B 1YQ4B 3ZRFA 4KN4C 2D3AA 4WJQA 5ELOA 3S2HB 3C19A 3EFUA 5HY6A 2LRUA 3BG3A 1XO3A 1PHJA 1BBXC 4WURA 4MGKE 1R4PB 1M94A 4GN3B 5TSSA 1TKEA 3N30A 3GTLH 4G0NB 4A3KH 1MHXA 2CCZA 1UNSA 3Q3MC 4A93H 3CW2C 3P42A 2K6QA 4ZOHC 3WIMA 4IFDH 3JAMi 1KHIA 3A1QB 1LM0A 4A3LG 1WWTA 2L76A 3RZOH 5C5LA 1XX8A 4MJSB 1RCVD 3ZRCA 2DHZA 2MBBB 3Q8BA 2DGYA 4F8MA 1HA5A 2AQ1B 2M00A 4ILWA 4IUUA 4DXFA 4RKBA 3UIOB 3G4SA 3VR2A 3A9JB 1VQMA 4X64L 3GTPB 3BVGA 4N8X1 1JMLA 4JQWC 1E7VA 2D0OA 1JJ2A 4WWMA 3M7GA 4RCOA 1OO9B 4WJ3M 2Z1CA 2K25A 2K22A 1N32L 3MXNA 1HNWQ 4ID6A 4ZLTF 2MQHA 4IPCA 3WOFA 1STAA 2Z59B 4OO1H 2LS01 4HAEA 1K8GA 1TBEA 3PO0A 2ZTDA 4KI0A 2RCFA 5EE0A 3VH4B 5JAVA 4JI4Q 4B3SL 1EWHA 3ERQA 2SNSA 1MFWA 3HEJA 2K0PA 3OAWA 2JA5G 3TEWA 4X6AH 3RFZB 1BMLC 4F88A 1A6XA 1V9PA 3APFA 1GVPA 1VQEA 3L2PA 4C4VA 3WANA 3W1SA 2NUCA 3HOZH 3U7DA 4DHZE 4KZCA 1CKOA 4NP5A 3K81C 2PPBC 2W55A 2UYZB 3KDFB 1E2WA 2VRRB 3HOVH 3DM1A 4FN2A 1SYDA 2JA7H 2LFIA 4RAUC 3MTNB 3HOUG 4C3IH 2KFKA 3U9OA 4DAVA 4B08A 3STBD 5JEAH 3U4EG 2KHIA 2W3RA 3R3MA 3IT4B 3TDQA 4JIOU 1T0SC 4A3DG 1XEEA 4AJYB 2O4XA 3Q3NC 3AH7A 3IG3A 2VH1A 2IYDB 3RLNA 3BZDB 2KJXA 3I70A 3NSWA 2J0JA 3CF6E 2UXDL 4GKKQ 2NWGA 3KOJA 3CCEA 5M5WB 2O5IC 3MHZA 3AE8B 4EE2A 4LFBQ 1KLUD 1U0LA 2XK5A 5CX3A 2DYMA 2RSNA 2L7RA 3CRLC 2PMZE 4N58A 4C3HG 3M85A 4IFDJ 2D07B 1JORA 4G11A 1UAPA 1EY7A 5IIFA 3EQLC 4A3JH 4DUZL 2R93H 3J9CA 3V60A 3ZTDA 2FMMA 2LFNA 3OYYA 2AYOB 2DBYA 4DV7L 1R9TH 5CHWA 3E9SA 1YJJA 1YEZA 4LNFA 4Y7NH 5C1ZA 1QOGA 2LZ6A 2LUEA 1FD7D 1EEID 1DOIA 5JPNC 1J5EQ 1Z5SB 1HNZL 3H09A 3C46A 1HZ5A 1IYUA 3TRZA 5G3LF 3LB8C 4OZCA 3NHHA 3RYTA 2ZVOA 1RDPD 4PG3A 4OX9Q 4NXMQ 1EF1A 1UE5A 4A3EB 5DPWA 2N78A 1L7YA 3HVZA 1F52A 4JI3Q 2N8NA 4IUPA 3MP9A 1JQ4A 4C3IB 1EOVA 1UE6A 2ZT9C 4YCVA 4KGRA 5EE9A 4P71A 2E74C 3VR5A 1XD3B 1XLQA 1X3GA 2ZM6Q 1SNDA 1N33Q 4LLGM 2CKHB 3LWEA 1WZ0A 3R2TA 4BFRA 1H9JA 2F0LA 3UDIA 3CMEA 3ZJYC 3SR1A 4A3GH 3M63B 4NY0A 5LXIB 5H92C 2D10A 3S1QB 1LYLA 4G4KA 1AP0A 1I4PA 5DNFA 4NQKE 1I42A 2CW0D 3CHBD 1DOYA 1O7ZA 2AMCB 3HOWH 3DWMA 3SU8X 1BCPF 1JR0D 1IL2A 4BVUC 1EUJA 3U8ZA 5JEAJ 5CV6A 1WTVA 2SEBD 4G57A 1U4MA 2ZVNA 3W3AA 1PH7A 1EFWA 4A3IG 2FJ2A 2O6VB 4BBNC 1G91A 1DOLA 4ZYSA 3LWUA 2KNBA 4R1JA 3AB5A 2UUBQ 2JJQA 2PKOA 4JK1C 1L2NA 4UY8C 1F0ZA 4CDCC 2WP8J 3AU4A 3O13A 2N9LA 2E2IB 1BBWA 5EBCA 2CU3A 3QQ8B 4ZRIA 4H44C 5FK9C 1PH5A 3ZNHB 1K9MC 3U7ZA 3TMEA 3GP7A 4B3MQ 4ZQ3A 4JPSA 2HHHL 4CDEC 3ZNZB 2PQAA 1TXYA 1KRHA 1OQYA 3PZ7A 2DX5B 2NPTB 1PRTB 1FFVA 5E6NA 4JPBW 1LTLA 2AWNA 3V2TA 2IY5B 5IP7G 1IYVA 3SR6A 3MC8A 1HTOA 3IAYA 1WIAA 4DBGA 3AB9A 3H94A 2CR5A 1EU3A 1WJ6A 4NXML 2WXGA 4PK1A 4A3MH 4CBVA 2KWCA 3QK0A 3FVQA 1ZDVA 2FCMA 3HOWB 1UGJA 5CV7A 1D8LA 4LF7L 1GKHA 2EY2A 3RNCC 2K01A 1TIID 2R92G 2L4NA 1CK1A 1K83H 5IGBA 1QOAA 1G51A 1SEBD 3R3OA 1YQ3B 1WFYA 3L3OC 4LDTB 5BO4B 3T8MA 3IFWB 1YN5A 4DAYB 5C3EB 3KW5B 3OHXC 4XTCS 4LF8L 2HUGA 1Y1WB 2F0MA 1XXGA 4MTNA 4RCNA 4BBRB 3RPFC 2Q2TA 4A3BH 3A33B 1RF2D 4KIKB 5IGEA 3MHSD 2KO3A 4MT5A 4NNJB 2BS4B 1IKMA 1AN8A 2GA4B 1ICWA 3I9V1 3VAWA 4LFCL 2K32A 4KD4A 2UUAQ 2B8FA 2LKVA 4DV3Q 1B9RA 3PUWA 3SK8A 4QCLA 4RA8A 2DZIA 5AZGA 1LT6D 2C9OA 1QB5D 3S16H 2C9WB 2ZJDA 2EDGA 1RWSA 1EY6A 5IGDA 4US8A 2WXKA 2JUOA 3NZSA 2O5JC 2ZNVC 3AE7B 3IRBA 4IQZA 2N7EA 4MGZE 1NBFC 3H8HA 2EJGC 2ZPNA 4II3B 1VZ6A 4WRDA 4JI2L 2PW9A 1CHQD 1NSNS 3BS1A 4AOFA 1Q10A 3PRPB 5ELBA 4TUUA 2A69C 2KTRA 1F9PA 4MDKE 2RCNA 1G291 4DK3C 2LGDA 4KX6B 3GTMH 1KAWA 3FKYA 2ASBA 1PGAA 1EUVB 3PUZA 4KJNA 4XYCA 3ZJTA 3DBLB 2FINB 1SN8A 3J80i 2K6AA 4DXGA 5GROA 4KV2A 1FD6A 4OWTB 4HIMA 1X54A 3BZKA 3DUZA 2A6HD 1SDFA 1QWYA 5FLXE 3AYHB 4CDFC 2OCEA 4ME3A 1VZ8A 4OVZA 2KTFA 2Z6KC 1YNND 3PV0A 4BY1H 1G2TA 4RMAA 3GZNI 4JI5L 4KVGB 1H9KA 4G7OC 5NUCA 4OWXB 5ISRA 1BCPD 3RZDB 1WMHA 3NWSA 3ND9A 1E2ZA 1SFOB 1WCMB 4Q5VA 1I94L 4K3BA 3TP7A 4MGYE 5IYCH 3PRZA 4HWIB 1B1ZA 3M95A 4GDLA 3H1UA 4JI0Q 4LF6L 1AW7A 4CJ1B 1UEBA 1B4OA 1V1OA 1EU4A 4JBWA 3C8YA 4B0EA 1MI2A 4A3KG 4H7BA 4IPHA 1LM8B 2KDFB 4B3RL 4W9DA 3PRMB 2JRHA 2RDGA 2JA6H 1IZ6A 4IFDG 1BVSA 1JCKB 1WGGA 5BMGA 4DV1Q 5EAYA 1ASYA 1TWFB 3F2CA 4DPGA 2KC2A 4JWUC 1A0IA 2VW9A 2L15A 1KDBA 1STNA 3KF8B 4P16A 1UH6A 1NJIC 3IAM1 2HDMA 3AM9A 3I55A 2KA7A 2Z6BA 3ECIA 3V96A 2SNMA 3R2IA 5DM73 2L11A 1E7PB 4P1BC 2INCC 2KCMA 1WR6E 2WXQA 3GZNB 3U2SC 2NZHA 1BOSA 1QUQB 2XNAC 3TMPB 4OO1G 3RNFC 3CAMA 4RGOS 4AH6A 1NY4A 3GD7A 1CUKA 1PV4A 2L3ZA 3RNBC 3ZO5B 3CKIB 3D4DA 1C9OA 4R4QA 2JQOA 2KVMA 4FXGC 2EXDA 4PZ8A 1TGZB 3CQZB 1JWBD 2CHXA 3VH3B 3P1HA 3GTOH 5I4DA 4K8JA 4LF5L 1ENAA 2UUCQ 2BDOA 5BR8L 3HOZG 5L95C 5LMUL 2NZOA 3JC66 3S24A 2CHBD 5IYBH 4QF4A 4NDXA 5LL6X 2JN4A 3BIID 2JA7G 2XEWA 4DA2A 2EMTA 4G3XB 4C3IG 4WFN3 3NPPA 2K1BA 4YHHL 2Z8LA 3Q8AA 4ZRKA 4KSLC 1AE3A 4JI1Q 3M4OB 3S15H 1SNPA 3HM6X 2WKCA 2DWQA 2WX0A 2F3WA 3RLFA 4DUYQ 1SE3A 3U58A 2EELA 5C0XH 1VQ9A 4F1SA 3TREA 3UI2A 4JV5L 1E3PA 1C76A 2ENBA 1BQQT 4JG2A 3LNNA 1A3VA 1CKMA 1GB1A 1U4LA 2LSSA 4YWGG 5D2MB 3W1SC 5I2YA 3NVVA 3ICEA 1V80A 4A3JG 1NEKB 4ZHOA 1PH9A 3L54A 1MKHA 3NTKA 5M9OA 4NZLB 1SE2A 2AX5A 4LF4L 1WXMA 4R8IA 1VQNA 4HPMB 1H9RA 1T5XD 4K14A 4ZAIA 3TZUA 1FJGQ 1GUWA 3FDTA 1AZQA 3S1MH 1S3SG 5C3WA 3BWUD 2BE5D 1QJOA 1F77A 1F2RC 3A7LA 3TP8A 4N9TA 4M8MA 3A55A 1VS0A 5IT9c 5BYQA 3U30A 3TZDA 4YT0B 1ESRA 2Q2IA 3SXHA 2KDBA 1WXVA 1PMRA 3KF6B 3CSFA 1JICA 1ASZA 1SIFA 3BJUA 2RDBC 2KN4A 4PNYA 4HN7A 1JB7A 3N52A 2DUDA 3TS0A 4A3GG 5EQ0A 3STBC 4K2KA 2DY7A 3D32A 1PTOC 4X3UA 3K59A 2LD9A 4L2YA 4UAIA 3SGIA 4KKSA 1XT9B 5C4JB 2FMCA 1Y69U 3PUYA 4AQYQ 4C7ZA 4GDKA 3HOWG 3MJ5A 2PI2E 5I6YA 1XMOL 1KDCA 1VDVA 2E3TA 1LTAD 2RSOA 2FFKB 2ZJQA 1C4PA 4FA6A 3SFEB 1QVCA 3IVFA 2BTEA 4NJ6A 2EJMA 1HZ6A 5DPTA 2A19A 1HEZE 2VQFL 2MEKA 5BMIA 2ALYB 3EROA 1TWHB 4KY7A 2JWZA 4JLCA 2VB3X 3B2GA 2IHFA 1Y1WG 3NS1A 4REZA 2JYOA 5C6AA 2KN5A 3GTKH 1NCVA 5G5HA 1F2YA 2D0PA 2R7FA 4IUNA 5C0XJ 1K8AC 3Q8EA 1CJEA 5IN7A 1CQVA 1YNJD 2BA0A 3T3OA 1XNRQ 1IHZA 2E75C 2ATWA 3CMMB 2C5LC 3BK1A 2JQRB 1F9QA 2DNFA 1NNXA 3J81c 3Q6SA 2GN5A 4DR6L 2WXHA 2HJ8A 5FKAC 3A9KB 1GUOA 1AWDA 2G1EA 2EOTA 4O1NA 2D9UA 5K36H 3M4YA 5GMVA 4DDGD 5IA7A 5ELEA 2UU9L 2LWPA 1WH3A 2XGTA 2PO4A 4FO2A 4R4OA 2QILA 5CC4A 3C2PA 2WU2B 2MBQA 5EDSA 1MSHA 4FF3A 2ACZB 2CJOA 4AJWA 2HT1A 4A6QA 4E71A 4DF7A 2CJNA 4A3MG 4W9JA 2YTYA 2V3SA 1PYWD 3UQAA 5FO8B 3C3LA 1X3QA 1ZDXA 3JW0X 4K5XA 5CTRC 1UWVA 2LVPA 1D2BA 3DBHI 1PXUA 2CW0C 3ND8A 1IBXA 3U9SA 4OWWB 4II2B 5T1IA 1YD8U 3RNAC 5AUKA 1QNUA 4IUVA 3RN9C 1WTRA 3FPUB 5FLXc 2JEBI 4DR4Q 1HA6A 1IXRA 1TTNA 2JRIB 4X66Q 5FJ8H 1TKGA 2OJWA 4GNXA 5CORA 4YWLA 3PF5A 2HCIA 4GKJQ 1NI3A 1OEYJ 2WDVB 2CHZA 1VD2A 4J15A 1AARA 2JA5B 3TSSA 1KXLA 3ONAB 1X6OA 3I4LA 4BA2I 3RMKC 3CC4A 3DDCB 1MGSA 2RMMA 3PVLA 1C7YA 2NVUI 4LFAQ 2WAQG 1JB3A 2R3ZA 1HFGA 1VZ7A 3URYA 1EIFA 1SIJA 2LVOA 3DWGC 3HIZA 1SJHD 4A9AA 1YVCA 2B2VC 2DNEA 1VQPA 1L1OA 3S14B 3NUHB 1STEA 3S17B 2K3UA 2B2YC 2JSOA 1I50B 3QOJA 1SSNA 1WX7A 1KL9A 4MM3A 3JAME 1U4RA 2JZZA 1A2TA 2IW3A 3I90A 1YJNA 2DZMA 2KMAA 5EKIA 2N9PC 3L13A 4GSWA 4DV4L 3IBEA 3L16A 4DV5Q 4KJOA 1XPOA 1FIQA 1WR1A 3CCMA 3H3VC 2E76C 1YITA 2IO1B 2ZW1A 2A68D 4USAA 3HUIA 2NYZD 2L1BA 5E3FA 4C3HB 4DR5Q 2MSED 1FCLA 4UPAA 3PQIA 2PE6B 2GBKA 3GQBA 5FOBB 4CKCA 2MP2A 4LNKA 1I4RA 2KCNA 1VQDA 2K04A 2KHWB 1P7FA 1Z6HA 3NENA 4UHVA 1EQRA 3L0OA 4BY1G 3OSOA 5I2XA 3S1RB 1C8CA 1FM0D 3LYYA 2IGGA 3HRZC 2JF5A 3AE9B 1HTLD 3O65B 2XTIA 1U5KA 2NCNA 5C4XB 4K0KL 2E2HH 3HG9A 1CKNA 1QZEA 4BY7H 2AL3A 4G7ZC 2Q8RE 3ITPA 1WE7A 3H15A 1HZAA 1MIUA 3ZW3A 2GLSA 3IFDA 3K80C 4R4CA 4IW0A 4MH0E 1F2RI 2GVAA 1ACCA 3Q3JA 2KEDA 4L5QA 2RPVA 1GD7A 1Z47A 4FP5D 2PW5A 4IN3A 3U4ZA 4JI8Q 4KTAA 4ALPA 2GRIA 3V05A 5M5XH 4HCSA 5JH5C 1TS2A 2ZTCA 1QOFA 3M3YH 2N3SA 2IO3B 3TBLD 1KRSA 4W9HA 3RNGC 4HJ8A 4KV6A 1HTPA 1NUCA 3CU7A 3QAQA 1I3QH 3N1YC 3SEBA 1EZ8A 2Y0SG 3I4OA 3T4AC 4DK1A 5EPLA 3SVMA 1WYGA 2Y5PA 1IL8A 1BKBA 2BYEA 5J39A 2WYQA 4W9GA 3DXJC 3BDCA 1OEYA 4C80A 3NUCA 4JYAL 1ZYRD 2B8GA 1V9JA 5D14A 2B2TC 1GG3A 3ALBA 1J9OA 3PV1A 4C4VB 3NELA 4FVMA 2VUMH 3I4NH 4P6VF 2AUKA 2XVSA 2DNCA 1N32Q 3AQQA 1KQSA 4H02A 2Z4IA 1WM2A 1WJJA 2A6HC 2JEAI 3H9DA 2K75A 3P4SB 4JI6L 3QIJA 5HGTA 4L1BA 4R4IA 3OTOQ 1J8CA 1YNNC 1QZHA 1ILPA 1X65A 4GOCA 2ZJPA 2AWTA 2RD0A 1IYJB 1EY4A 4X3KA 1N8RC 2L5TA 2BS2B 5HI1A 3IKJA 5E4XA 1BCPC 1EL0A 2KFKB 4B3SQ 5JXVA 1FMAD 3N1XC 3DCGA 1JWMD 3PO3H 1WJNA 2BW2A 3KWLA 1AEXA 1SE4A 2K50A 1BUVT 1WRDB 2FNJB 2UXCL 3AE1B 1NDDA 1SSOA 1N36L 3CCRA 1MJCA 3SD5A 3DEOA 2NS5A 1NMFA 3QARA 3D8GA 4IJLA 5JVG3 2KCTA 5JPMC 3GTQB 2XK5B 3HOXB 4RGMA 2RQXA 1GC7A 2KWVB 1Q81C 4FHJA 3NBIA 1V8QA 1OTRB 4C1NK 2CQAA 4QL5A 5JHAA 2IY1B 4JX1C 2NBWB 2RF4A 5JHBA 4DR3L 4Q0FA 3K5MA 5C0XG 4LNIA 1J6QA 4I7AA 3TUOA 2R92B 4KKJA 4LWCA 3BVMA 3I2ZA 1D3ZA 1JW9D 1YJ1A 1VQIA 2UXDQ 3X23A 4C3JH 3T1HQ 1WJ4A 1E2VA 2KVZA 4F7XA 3NK9A 1XF5L 2YEPF 4F7ZA 5IYDG 4C2MH 4L8JA 3H7PA 3AULA 4W9EA 2LJ5A 3JVZX 3CCSA 2K5PA 2G9HD 2PMVA 4DUZQ 1UBQA 2G3QB 4KMUC 1SRUA 1WM3A 5GAEC 4XWTA 4DV7Q 3ZQ4A 4FADA 1E7UA 3K9PB 3GOEA 4KGSA 2J7ZA 3PO3B 1PH8A 4LNNA 4HTHA 4ANWA 2J0TD 3A9KA 4RG1A 4U68A 1IGCA 2GBNA 5C3XA 2KX0A 3P1MA 4LJPB 4J8QA 1YMHE 2NBFA 2K52A 1IGDA 2N7JA 5IWAL 1YIJA 4BXXH 2B3AA 2BBCA 3OW7A 5D6JB 5FR6A 1Q8KA 1YHBA 2N7DA 4G50A 1TWGH 4IFDI 1E0BA 2A1AA 4I7ZC 2L0FA 4BBSH 2HE7A 4DR7L 4OVUA 3PLVA 1M4VA 2KBNA 4QIWE 3P2BA 1GHKA 2MA9B 1CHPD 1XYIA 2BYFA 3CMAA 4M1UB 3ER0A 3VR6A 2VB2X 1YX5B 4K6DA 2GBRA 5LLIA 2EYOA 4P1CC 1L0YB 3MAQA 2NVTH 4NJ7A 2WNMA 4B9KA 3SDZA 4DK6C 3I7FA 2J0MA 1HXYD 4JI7L 2KAJA 2LXKA 3H3VI 5AJ3L 4M0WA 3DEPA 4YL8A 3F2UA 3OPOA 1P0RA 2LMCA 3WCQA 4B9XA 2KX3A 4HVBA 2IGHA 5LHY1 1K3RA 3Q3OC 4C7YA 2F0OA 4OO1I 1B9NA 5EGTA 3TP6A 1ESFA 1UE7A 5IO9A 2PQAB 3MWYW 5CMDA 2KACA 4KLKA 2QDBA 2MWSB 1HQRD 1NAPA 1V1QA 5ELFA 1N9WA 3GV6A 3ZJUA 2BE5C 3GTJH 2MPMA 1BUIC 4OIKA 4XQQA 3GTLB 1DZ1A 1T0RC 4A3KB 3A5UA 2UWQA 5ELDA 4A93B 4PQXA 1S5FD 5IODA 4IPDA 3TEZA 2OWOA 4PS8A 4L23A 3E5SA 2RGFA 3K7AH 2JVCA 2HHHQ 5K36G 4PMWA 4CYEA 3L9AX 3RZOB 1QG7A 4WJOA 3VYTA 1KFYB 4J6IA 3UE0A 1KAAA 2H5XA 4CJ2C 4HCEA 3AECB 1E1TA 2RHQB 2YYZA 3CPFA 1I35A 2EIFA 3VA7A 2FHTA 4IM3A 4ZYNA 5M3FH 1EY8A 5D94A 1RTOA 1J7BA 2KQ4X 2F0IA 2WB1B 2IL8A 2O2VB 3S2DH 1VQFA 1CZPA 1OQRA 5AUIA 1HTQA 1OXVA 3J7A5 3UDFA 1YNTE 2IWHA 4LF7Q 2ASQA 1PQSA 3TEYA 4WWNA 2BCOA 2FCSA 5FJ8G 3RD4A 2B2WA 3WDNA 2JA8H 1LTSD 3OMCA 2K5WA 1S5DD 1HRJA 1DONA 1XQQA 4AYBB 1CZGA 3GTGH 4S0RA 1YOVB 4X57B 3RULA 2B63H 4I6LB 2D3GA 1FXAA 5C4XG 3HOZB 3IXSA 5D7GA 3KK7A 3I73A 1GHJA 2Q2UA 2F0JA 1S3OA 3AE6B 5CHVC 3K0XA 4LFCQ 2MJ8A 1YNJC 2MNAA 1K0SA 1QLBB 3CXCA 4RGNA 3HOVB 1X3PA 2KQSA 2JA7B 1DOMA 2OHFA 5EKKA 2BH2A 2KTRB 5IGFA 2FUG1 3KBGA 1HJPA 1C4AA 5BN4A 3NG0A 3K5NA 1WZ3A 3ZXVA 3J7ZC 3JAML 3TJPA 5DAUA 1CZWA 5IE8A 5KNBA 2AEHA 5G5GA 4C56C 3VTUA 1CQFA 4P7IA 1E24A 4QJFA 2PPHA 3APDA 2EXZA 3ETRA 4XZ4A 3E9HA 4GNXC 2KFJA 4EUTA 4JI2Q 1VQAA 4TQ0A 4YSZB 1SMYD 3MA2B 4HR7B 2NB0A 3R7RA 2BYTA 4AS1A 3AV8A 3OIPA 4FLHA 5E1FA 2PJHA 3D4RA 3UQBA 1PA6A 1EQVA 1WMHB 5LL6S 1IBKQ 1Q7YC 1MJDA 2DZJA 3GB1A 4BS9A 1DGSA 3KUPA 4O2DA 5LNK1 1D6EC 2EYMA 4A3JB 2R93B 1TS4A 4GDLB 1R9TB 4DAMA 4IM2A 5IOCA 4P75A 1H9SA 1T9HA 3EGRA 5J2RA 2IO2B 4Y7NB 3PHXB 1V1PA 2R7ZH 2B63B 5DM63 1T3QA 4JI5Q 1I4HA 2JY6A 2LGSA 4EX5A 3VUYA 1ZKHA 1N34L 3A4RA 4K5VA 3BINA 2PIAA 1I94Q 5G2NA 1FXTB 3VQIA 2K1FA 1B9MA 1BCPB 2A5HA 1VQGA 2M19A 1HNWL 3FKIH 2BT6A 3DBRB 4P72A 1U4PA 1K8RB 1HHVA 3CP0A 3TCAA 4FHKA 4NXNQ 4ANXA 1V2YA 4B3RQ 1ZOYB 4IUTA 4A3GB 4JOIA 3EFCA 2L32A 1SNCA 5HGQA 2I0QA 3E9IA 1N62A 4BOZB 2K8BA 2RDFA 1DXMA 3WWVA 1PRTF 4E74A 3PUVA 1RFKA 4MACA 4C1NI 1N60A 2F0EA 2VS1A 3FP9A 1Q46A 3HOXG 4KY6A 2M56B 2MBEA 1QE6A 3AI5A 2GVBA 4KGTA 4L5RC 4OIJA 2P5ZX 2E2JH 3RNUA 2XBBC 5C3JB 1N5WA 3L4PA 4OW0A 3B1LX 2A68C 2L0CA 5GAGC 2L83A 2NTTA 2G5DA 5CBAE 1Y8RC 2VUMG 3I4NG 3DBLI 4BOSC 1C3TA 4JGHB 3S2AA 1Q1BA 1LQBA 5I9PA 2AQ2B 2PE9A 4JW0A 1WTHA 3C0RB 4TV3A 3A7AB 1SAPA 2OQKA 1LTGD 3WAMA 2JXXA 3APCA 2H89B 3HP3A 5KNCA 4GKKL 4LJZC 1K51A 3UF8A 4AP4C 4GLAC 4OHJA 2HJ1A 1H4RA 3AEBB 1KTKA 1PZJD 4QGUA 3PO3G 2MQJA 3Q14C 1TWCH 3MC0B 1GAQB 5BR8Q 4A3CH 5LMUQ 1XCQL 3P4RB 4PMCA 5L37A 1QCBD 5G3LD 1T5EA 1LT5D 2EY6A 3E6ZX 2WGSA 2M8SA 3R66C 4IM0A 1IKLA 1D4BA 4YHHQ 1F2LA 2MP1A 1VCIA 1K28A 4GLVB 4A3MB 2KYWA 2N9EB 4GIVA 3ZLZA 2K5DA 4JBMA 2YVCA 1E9MA 1TJEA 3VDZA 3W1GA 1GM5A 5M3MH 2KJRA 1A2UA 3K5LA 1K83B 2KK8A 3ENEA 2Y5BB 3GS2A 2CQOA 3P7JA 4JV5Q 4C3JG 4WJNA 2EE1A 1DJRD 1N33L 4LCDE 2LVQA 1JQYD 1ZYRC 4IDIA 2MFIA 1S5ED 2K8HA 4A3BB 1WVLA 1AH9A 2K4KA 4PS7A 3S9WA 1N63A 5A2QE 1ET6A 5GQOA 4X3TA 1K3BC 3R8BA 4APVA 4LF4Q 3JSVA 4BKGA 2WAQB 3Q22A 1EYDA 1YHAA 1RKNA 4N8FA 1J19A 1R4NI 2BWFA 3HK0A 3P63A 4D2KA 2M0XA 1PDXA 4JC0A 5GADC 1IBMQ 5BYRA 3S16B 1DOKA 1E8WA 2EYFA 3H0GH 3D3RA 1VQOA 3U52E 3MXUA 4BXXG 1G8ZD 1SGHA 1MG8A 3SK6A 4A93G 1PFDA 3FILA 1EIYB 1AE2A 1XPUA 4B95A 1B3QA 1F9JA 4BBSG 2KOLA 1EYCA 4GDKB 3QJYA 1MPEA 2KD0A 1TWAH 3IFTA 2W54A 2LGIA 2WXJA 2XN9C 1VF7A 1FEHA 4ANUA 2IPKD 3GTMB 1V6EA 2BKRB 3P4PB 3NXWA 3VUXA 3OMGA 4HJAA 2EQSA 5JZEB 5LMNQ 1XNQL 1H9MA 2ES2A 3MXPA 2BKFA 2O6VA 1WTPA 2JWUA 2WB1G 1L6VA 2N9KA 2WLBA 5L83A 1IPGA 3HZXA 1ZE3D 3R7QA 2K9XA 1XMOQ 4TQUS 3BYYB 3SFDB 1OXXK 4ZKBB 4BY1B 4LUOA 4DKAC 1SJED 5J1ZA 2KJ6A 1PH6A 3CSTA 3NE5B 1UGMA 2F3VA 1NTGA 2X6GA 1G2SA 2QW7A 3I5JC 1Y1VH 2VQFQ 4XYOA 1R4NB 3A4SC 2KEEA 3QIAA 1HFNA 1K52A 3AE4B 3FC4A 2DENB 2GB1A 1UEAB 1GJZA 1RAXA 4RGTA 4AYBG 2I1JA 2IY0B 3DVNV 4ICUA 2N9XA 2W9NA 3AU5A 4ZUJA 3TP5A 1WXQA 5I6WA 2KQ3A 4EZKA 2KHJA 1H95A 2F0WA 1M8AA 1RL2A 2Z0DB 2SAKA 5LXHA 4G7HC 4RH6A 2Q8IB 1TIFA 4NJCA 4W9CA 5KGUA 1I4QA 2JA6B 1EIGA 1GB4A 1VQBA 3HOVG 4WORA 1YI2A 4NAWA 4DR6Q 1D5XC 2EJFC 4DR1Q 2W82A 1TY0A 3OW2A 4O42A 5JEAG 2Z4HA 2E6XA 3NQIA 2ZEQA 3KUCB 3KWVA 4HEA1 1IBXB 1KNAA 2W3SA 2DY8A 1BBUA 4GN4B 2TMPA 3PO2H 3A8IE 1P3QU 3AEEB 2Y0SB 1YN4A 1EY9A 2UUAL 1FGUA 3NWTA 3C1EA 1NR4A 5M3FG 4DNTB 4BKTA 4GNXB 1X3FA 5C0XI 1PH3A 1HCZA 3PHWB 3RI7C 1BO0A 4P2CB 3F2DA 3ULPA 1XLNA 3L17A 1I6HH 2I5LX 5C2TB 3J80L 4YCUA 4YWMA 1JT8A 2JA8G 2R93G 3KJOA 2QIEB 5GAHC 3K9OB 2EMSA 5MPOA 2BWES 2WXIA 1JROA 3FMCA 3TBIB 3NY5A 5COYA 4CQNA 5M5YH 1EIHA 1GNUA 4N59A 4ANVA 1JMCA 3PSEB 5DCNA 4MM3B 2DLBA 3VR4A 3GTOB 2BOSA 1TR5A 2B63G 5FO7B 3VRBB 4BBNF 1X56A 1Q8IA 4ODGA 3UDGA 2FUHB 3KYCD 3UE1A 1SNQA 2QSDA 4KHPL 2IO0B 2F4IA 1O78A 2F0UA 1CI3M 3P4QB 4MNOA 2KANA 4A4IA 4WH4A 2XRSD 3G6JB 2SDFA 3H6NA 2CKZB 5CV8A 3F8TA 1MHHE 4KZ0A 2FE8A 3S15B 2DAFA 3CCVA 3PLUA 3J81j 2Y0SE 3SE0A 2WXOA 1M90C 1P16A 5T1GA 1YZ6A 1FCCC 1Z2MA 2B2WC 2MP2B 1N5XA 2F4VQ 1QOHA 2YV5A 2B3GA 2CFMA 4WJPA 1DCZA 3C1FA 3QB3A 1PFNA 1RD9D 3HOYH 2C60A 4H13C 2EY5A 2NVYH 1WXAA 2AWOA 3PTFC 2F1MA 3BVZA 1QF6A 2F3IA 4TRDA 2E5LL 2VZKD 3PIOA 1YNXA 2CVRA 3NBHA 1CKNB 4HDQA 1N61A 4GOPA 4ZKCB 1PFMA 1WF9A 2BB5A 4MTKA 1YJIA 2PVGC 1WI5A 2IX3A 1DGJA 3J81i 2WDQB 4CKEA 4DV1L 2V3NA 3ULJA 2KZRA 4RMFA 2LEKA 4A3LH 3NS8A 3S1MB 3MZ5A 4A8XC 3RN2A 1SROA 3RCZA 2B2UA 2F0VA 2I5HA 3PT2B 4HIKA 1H8CA 4DAPA 2WV6D 4K0KQ 2NMQA 5C4HA 1T0QC 3ULLA 1M1KC 4B3TQ 1L0VB 4MN3A 1JRPA 2I1KA 4AIMA 2QCPX 4R9WA 2KWUB 4H2AA 4YIJA 5IP9H 1RM6C 3A56A 4WWOA 1TT5B 3AE5B 5CV5A 4FXDA 3DM3A 3FKIG 2MX2A 2MCNB 1JRUA 2PYKA 2QC8A 2J4XA 3BY4B 2JU6X 2MBHA 1RODA 3EUB2 3Q8CA 4LF9L 1GUNA 1X1MA 4WJWA 2D11A 3DBSA 2BDNA 4X65Q 1QZGA 1LABA 3D0FA 1LLRD 5EE1A 3DLLA 3J7AF 2MHJA 3DHHC 1XMQL 2C5CA 2UUCL 3KLSA 2HIXA 3CRKC 2MGSA 1GXDC 2N4FA 2N0SB 1SMYC 3HKZG 2E2JB 2ZTEA 5HKHA 4PMBA 3ZNGC 4NW2A 2BPSA 4TQ1A 3HOUH 1P9DU 4JI1L 3VRAB 4QQBX 1TS3A 3G48A 4RFBA 4JVZA 3AFQA 3GTKB 1S72A 3Q8FA 3AMUA 4A3BG 2MW5A 2CH4A 4IPGA 1Q90A 3W5VB 1GJXA 4MGIE 3ZDMC 4IOAA 4I6NB 2NN6H 4JI6Q 2WXMA 4R4TA 5DEHA 4KKTA 1SE9A 2CWAA 2MJDA 4XE0A 1HR0Q 1W6JA 1MVKA 3ML8A 1SNOA 5CR3A 1ZEQX 4EGVA 2J53A 3NZ3A 4QY7A 2NVQH 4OGQC 2F0KA 2NVXH 2UU7A 2DN8A 1E7ZA 3S1NH 2JXTA 4A3CG 3X3MA 2UXCQ 2I38A 1DYQA 1N36Q 4AWJA 1E1OA 1WGDA 4BA1I 3K6OA 1WYDA 4IG7B 2A74C 1KOTA 4DR2Q 3ABVB 1GUAB 1NI2A 3KVFB 4N9F4 4DV6L 4O0AA 1UELA 4FXCA 4M01A 3H7PB 1ROEA 1YJWA 3FEWX 2PI2A 1Y56A 3PSIA 5ELNA 2OEDA 1XPRA 1BXTA 5M3MG 2A8VA 1K53A 4DR3Q 4NPNA 1A3TA 1LGRA 2RA4A 4U673 4ASWC 2PNHA 2IHEA 4Z9CB 4HSPA 2V9HA 2LXJA 2FBWB 1X3EA 4HIOA 1Q82C 3CF5A 4L5SA 5JOBA 3I63C 2ZCCA 4FULA 1FR3A 1G6PA 2GBJA 5C44H 4F87A 2RPQA 4PV1C 3WOEA 1TU2B 2E8GA 1D5ZC 5A2QL 4IWQA 5IYCG 1T0YA 5HHDG 1RLFA 3QWZB 4A76A 4AQYL 3WA0A 3S1NB 1A63A 1XWEA 2Z9HA 3LX0A 1FFUA 3H0GG 3I4MH 2F0HA 1D1IA 1II3A 3MFGA 5FR3A 1SYBA 2N49A 4V0BA 3ZKJC 1K8OA 2JA6G 5IWAQ 2ID0A 1UE1A 4L5TA 3D6CA 4A3IH 1PLFA 1STHA 2QHOA 2Z0EB 4A3PA 1JE5A 2Q8TA 2HQLA 4M0WB 4DR7Q 1UF0A 5J17A 2X8XX 2LMCB 5ELCA 1XNRL 3MXNB 2IGDA 3KFUA 3ZIMA 3VYRA 3QOLA 2X69A 2J7QB 2G45B 1LACA 2YU9H 1AYFA 2CU1A 1EOTA 2L8JA 2MLBA 3GV3A 2VY3A 4HPLB 4K81A 4X64Q 3CC7A 4JI7Q 4N6EB 4A3OA 5AJ3Q 2K03A 4DV0L 1C77A 3VA5A 1P7EA 3GO5A 1YBYA 1MHWC 4DHJD 1ZKOA 3E56A 3LXFA 3PREA 1R4QB 2E2HB 1Y1VG 2TSSA 2Y3AA 4RHSA 1OXTA 4BY7B 1KDAA 5IP7H 2WHIA 4HJ9A 2HTME 1LO5D 2ZZPB 1GPXA 2C7NB 1W6KA 3Q6BA 3VDYA 1VQ8A 5KIXA 1S5BD 4HROA 3VUWA 1C4CA 4KDLB 3I4MB 5CGKA 2A5UA 2K8CA 3U50C 1QILA 2GMIC 4DQOC 1PTOH 2ZXOA 5LMNW 4FJVB 1ZXTA 2QMTA 1B70B 2MHVA 3B6YA 5IYBG 2I5MX 4FYDA 1TZOA 5M5XB 2C7HA 2NBVB 2QEXA 5H8YE 4LUVA 3M3YB 4XDDA 1EZ6A 1WTQA 1PGBA 3PO2G 1I3QB 1HZBA 2BQQA 4LFAL 1RYJA 2IZVB 3RN5A 3M7NA 2ZXRA 2JZ3B 4CJ0B 3EFXD 1VQ4A 1HUNA 2QCZA 2YTXA 2KKCA 5IP4D 2VH2A 1I5FA 1V97A 1PTOF 4IO9A 1XLOA 2MJ3A 3Q0AA 3AXCA 5EJWA 3MEHA 4A75A 2VUMB 3I4NB 2PQEA 2EZVA 4MEMA 5E7NA 4YSYB 2OEOA 2MH7A 4XWWA 1A8VA 4A90A 3BDLA 3LGJA 4DV5L 2N1WA 3B0AA 2A6ED 1PZKD 4S3SA 2K05A 2VQEL 3ZTCA 4YTMB 5HG2A 4LK1C 4M8AA 5FLMH 3NP8A 3QHTA 5AZHA 1JJGA 1HUMA 3H91A 4C00A 3SHQA 1HNZQ 3M62B 1HNXL 2IJ0A 3NOBA 2JYEA 1W3SA 3HKSA 3GTPH 4LAAA 2X6LA 4DXAB 3KQ4A 2BF8B 2PEAA 2K14A 1WE6A 2JYTA 4ARIA 1CT1D 2OJRA 1B50A 4OXPA 3Q24A 3QR8A 1E0ZA 4CDDC 2KCCA 1KH0A 3L10B 2KLCA 2XSCA 3HOYG 2KDMA 1H9SB 2ZW0A 1WD0A 1V1PB 4C3JB 3EHVA 3VTWA 1VLBA 3W1BA 3PS6A 1Q5WB 2WDTB 3J7AV 4C2MB 2LY7A 3DVNU 2L9HA 4IKGA 5E6OA 2XWBB 4JI8L 3PPAA 4DHZB 3MC9A 1CSQA 3QC8B 1WGKA 2V0GA 2NZ1D 3MXGA 2D3CA 4TSSA 1EYAA 1WY8A 5CYUA 4MZ9A 4DK0A 2M4NA 4HCNB 2K5QA 3K5OA 3W9CB 1J7CA 3Q8DA 3I8ZA 1EO6A 4M00A 1L4ZB 4LTUA 1WRIA 1V5TA 4KHZA 1N34Q 1WI0A 5IP9G 3AEGB 2REXA 2WXPA 5DPRA 1U9RA 3H3VH 5M5WH 1TWGB 2F52A 3JAMc 1GUGA 3L7ZC 3EA6A 2BYVE 4BBSB 3OJ4B 4W9LA 4PS3A 2PMZB 1WTOA 3OTOL 4GOPC 1IBLL 2AQ3B 3D31A 2JP1A 2QEJC 3A8KE 4LW1A 4EZJA 1L6UA 3WALA 4UP9A 1F9RA 3P75A 4ZK9B 4TVAB 2LGXA 4XQNA 2NVTB 1E6EB 4IWPA 4MHEA 3KBXA 2B2UC 4PZ7A 1WYWB 2KMMA 2QKIC 2ON8A 3J80E 3AN1A 3NVZA 4A3EH 1JWAD 4S17A 1SNMA 2K28A 4YSXB 2V4LA 1HQMC 2WXRA 4RHRA 1C0AA 1PTOD 1P1AA 4HIDA 4LF8Q 2ZPYA 3QA8A 1AFPA 1JWSD 4H0LC 5JJIA 2NN6G 4IURA 3D6WA 1IUEA 3GTJB 1TQOA 4XT3B 5E4WC 4X62L 3IT6B 5EBDA 4ZRJA 1Z7TA 1KLGD 2AUJD 4YY3L 3S1QH 1D5MC 4HMIA 4YTPB 3F1ZA 3T1HL 1A70A 2KUMA 1Q0WB 1PDQA 2MO0A 4DV2L 3K7AB 1QVFA 2J52A 4XDXA 2F0TA 2ONQA 3NRZA 4ZHPA 1X55A 2UXBL 3B9JA 3T1YL 3AFPA 4GGQA 1VDZA 3KH0A 4EQPA 2WP9B 3GE3C 3DBRI 3FRPB 4XT1B 3V6CB 3QG1A 4LJOB 2EKIA 2D3BA 3ML9A 4GXBA 2IX0A 3DWAA 1SB3C 3HVDA 4TMAB 1SE8A 1O7LA 4Q2JA 4ZRQA 4DNRB 5M3FB 4OEMB 1CA5A 1RRBA 1T6BX 4DDID 4LNQA 2WB1E 4FXKC 2FAZA 3VR8B 2MRPA 3S2DB 3AEAB 3AMZA 2RSUA 4BWGB 1QKZA 2E2DC 4DFAA 3PIP3 1PUTA 3DVGX 2J0KA 1PVOA 2YLMA 1HR0W 2XWJB 2E2IH 2KQ7A 3IAS1 2H1EA 2BA1A 3JSVB 3N6RA 4IOIE 2JA8B 3MVVA 4UP8A 2R7DA 1JALA 1E8XA 4A3FH 1L1OC 4AYBE 4W9FA 1C78A 1K50A 3GTGB 4EFOA 3OG5A 3ZXRA 3DWQA 3DHIC 1QNKA 2F0NA 5C44G 1ZGUB 2M0AA 3ZUNA 1WD1A 1MD2D 2D2CC 3FPPA 3AE3B 2ICIA 4QMGA 4BY7G 3FILB 4K7SA 4EEWA 1Q1OA 5EKLA 1SYFA 3X3NA 3E0EA 2WDRB 3ZJVA 1JWUD 2FIFA 2XRQD 5BN3A 5C4ZA 3I4MG 3A1QA 3PMFA 4NKLA 4XIGS 3T16A 1YIWA 4LF6Q 2WS3B 5D65A 1ILQA 4GB9A 1JOOA 3GE8C 1O80A 3I3TB 4MJSA 1FNVA 3A5ZB 1B53A 3K57A 5CV9A 3SK4A 2PLPA 3VFKA 2RKSA 2DAJA 4JI4L 3A9JA 5DLQE 5C3EH 5KYIA 1VJKA 5F2DA 5CHFA 3RZFA 1IYFA 1Y1WH 2K5VA 2LUMA 4BBRH 2FIDA 2BGFA 3D4WA 2LXAA 5BYSA 1OXUA 1LFDA 5DPSA 4HRSA 2WU5B 4BKSD 2O2LD 4QB4A 2A4ZA 4HCPB 1ENCA 1HPCA 4MSQB 5IT9E 5G55A 3BDOA 1XNQQ 2JX5A 4A3FB 3HHMA 1VQKA 4IZ8A 2CH4W 4L63B 5D3DA 3M4PA 4XDCA 3AEFB 3NZUA 2F0FA 5BN5A 2R7ZB 2I46A 3CC2A 3CCLA 3PUXA 2JSVX 2OTJA 2GI9A 3RLOA 1OGWA 3N3KB 4YTNB 3RUIB 1Q12A 1C9FA 4J1MA 1EQTA 1PFBA 1NYQA 2G9DA 1ZP0B 1V43A 5E6JA 4NAWB 4BKSA 3PZDA 2B2VA 3KDFA 1LTID 2KECA 3TS2A 2PTLA 1SXTA 1VQLA 1NMGA 4LFBL 2B2YA 4LNOA 3OLMD 4WAAA 3FKIB 2R6GA 4TKNA 3L0WB 2MJEA 4LF5Q 2FCQA 2HIVA 4OONA 3LDZE 4ME5A 1IW7D 5J18A 1NVID 3QX1A 1PZID 1RHPA 1PH2A 1V49A 4UDUC 1ZXIA 3UIPB 4NB3A 2O2VA 1EWIA 2RBMA 5TR5A 1FPYA 3VVWB 3WAOA 4K2LA 1J5EL 2KC1A 4WQMA 4XGAB 1C79A 1B3AA 3CPWA 4HJ5A 3FAHA 4CHKA 4EVOA 4QAYA 3RZDH 1NBWA 3DHQA 3EN2A 4HJKA 3I56A 4OX9L 2K7VA 3HKZB 4IJHA 1SFOH 1WCMH 1A62A 3G71A 2RVLA 2EVBA 4K8IA 1LT4D 4JI3L 1QQRA 2PZTA 2MO1A 1A3UA 2F03A 1VQ5A 4US9A 1PFSA 1L0XB 2JPHA 2HQEA 2WXNA 1L0WA 1V5OA 2V4IB 2ZM6L 2QDFA 4M8NA 3J81E 3NVWA 1J8IA 3QWNA 1EM7A 4XX5A 5IOIA 3VR3A 1MBYA 2M2LA 4OELB 3I57A 1UD7A 4KY5A 4GN1A 4HLEA 1QVGA 1ICFB 3CCJA 3N9YC 1KC8C 2L00B 2LJIA 2F0PA 3UI3A 3GDEA 5FLMG 5JVH3 1OFFA 1DOXA 1TWFH 2LI5A 1E22A 2AHOB 1IBKL 2DZKA 1TWCB 1K8MA 4GMVA 4ZRPA 1FO4A 4IALA 4ICVA 1LT3D 4IUMB 4K3CA 3BK2A 3ZDTA 4ARCA 4ZRZA 5EPJA 2O6VD 4FJYA 1FNWA 3NTIA 4KD3A 4KHPQ 2X38A 1TY2A 2JK8A 2V4DA 5IGGA 2IBIB 2N55A 4W9KA 1PYBA 3HM3A 1FNUA 4E3CA 1ET9A 1Q1EA 2UUBL 3QJZA 4MELA 3NBHB 2K5NA 3SHLA 1ZXHA 3HKZE 4GOPB 4Y52H 1WTXA 1Y8OB 2RHSB 5KHQA 2WINB 5M3MB 1OTCA 1NENB 4KK7A 2B2TA 3ZVVA 1SYCA 2KLGA 2NR2A 3ZGZA 4JL9A 4PZ6A 3K8AA 2DJFC 2KHSA 3CQZH 1KNEA 3OOCA 3J80c 4B3ML 2WQYB 3TEXA 1I4GA 1S40A 3UGBB 3K58A 4K6LA 4NXNL 1PRTD 4DWFA 1I6VC 3IL8A 1GC6A 1D1KA 2J42A 1GUSA 2E5LQ 4KHVA 5JJLA 2HDLA 1E8ZA 5KYLA 1L5PA 3DPDA 3Q2AC 2VZKB 4RM9A 5GXGB 5HURA 2WAQE 1JJCB 4FBJB 3RT3B 3W1YA 1RIPA 2OF1A 4CHTB 1FGBD 2A6EC 3M4OH 1FVIA 3RNEC 2EYLA 4EOYA 5AEKB 3N20C 5EPKA 3H0GB 3CCUA 4LDTD 4J3OD 2NPTA 3DVGY 4HK2A 1JOKA 1PH1A 5IY0A 1FXIA 3N1ZC 2BVCA 2C35B 1KLVA 5CV4A 1CM9A 2KMCA 2VZAA 3ERSX 4R8NA 3Q23A 4KN7C 2LHEA 4B6WA 3U4VA 4RF1A 3V61A 3FHWA 4N9PA 2OQ0A 2KVRA 2MBOA 1TWAB 3K7UC 1R4MI 4MSMB 1WXSA 1WX9A 4LF9Q 3T53B 4JBJA 2KJHB 3ZNID 2UU9Q 1K0RA 2R61A 2WIIB 5C23A 2CWPA 1P8LA 4YXDB 3K0YA 4RKLA 4DV3L 2PCFB 4TKOB 4DAYA 1XMQQ 4EQOA 1F9SA 1TVXA 2K5HA 3BYTB 4OVVA 4A3EG 3DOWA 1B7YB 1VR9A 3IHPC 3KUDB 2WX1A 4FJZA 4KIKA 1Z9FA 1Y8PB 1VQ6A 3L08A 1Y1VB 3DHGC 2JXMB 4FDBA 2QGQA 4IOCA 2JZPA 4X3SA 1L1OB 3ZYYX 4K7WA 2ZNVB 2M9VA 4URKA 3A74A 2Z0SA 1XJVA 5IAAC 1C48A 2LGYA 1F2MA 1KIXA 2R2OA 1CFMA 4HJGE 1RJTA 2B29A 1HE8A 3DMUA 3EECA 2WACA 3A54A 1S4ZA 3CWIA 1L2FA 1EWYC 2XIWA 5C4JH 3RMHA 1K73C 4WWPA 1Y14B 1J7AA 4KKIA 3PF4A 5IYDH 1R4MB 1EQQA 4K1RB 4ITKA 4NAMA 3TN2A 3PO2B 1FYCA 1MJEA 4XXEA 1WGHA 1ZW7A 4F8CB 3OJ3A 1PYSB 4RM8A 3HFZB 1BDOA 1TWHH 2DJGC 5CBEE 3X0WA 3I91A 2MUYA 4DV6Q 1IBML 4DV4Q 4JI0L 4P74A 1C1YB 2SOBA 1FRRA 4DGZA 2CS4A 1V8CA 2WKDA 1Q3LA 1PGXA 4OZBA 1WFQA 2F0GA 1TKWB 1I6HB 1O7IA 3V3XA 1ISNA 3T56B 2C7MB 3TL5A 1SYGA 2LRWA 4MIUA 3EVQA 1KF6B 2PZUA 1TZ1A 2D2QA 3RD2A 2R2QA 4A3FG 2WXLA 4XYQA 2D62A 3RZWC 5H1SE 2OXPA 5M5YB 2EYPA 1TT2A 2BB6A 3EIVA 1MI0A 2I2YA 4QUCA 2R7ZG 2Q5WD 2EYJA 3DWPA 4PYUA 4E6IA 1B8AA 3RR5A 1LXDA 2QA4A 4FF1A 1LTTD 2Q2HA 4JE3B 2L12A 5FO9B 5LMNL 1VMPA 3JYUA 4HSVA 4ZCKA 3RUZA 1V86A 1YX6B 1STBA 4KDIC 1E8YA 2F0SA 2HDEA 3MTSA 1EEFD 3J7YW 3T9LA 3M4QA 4GZYC 2V3PA 1KABA 1V81A 4MH8A 2PW7A 3AU7A 1STGA 5AFWA 4WJ4A 1U4AA 4K5WA 4HXDA 4DK5A 3KF8A 1KRTA 3EC8A 2F0DA 4W9IA 1SLJA 1UWXA 5C3EG 5E6PA 3M9BA 3B08A 1QOBA 1UZXB 1CMXB 1EF5A 5KNDA 1JOQA 3T13A 4DU9A 4BBRG 3HOYB 1D7QA 2NVYB 2M17A 2DYOA 2JA5H 4B9WA 2WXFA 1WOCA 4UP7A 1XTCD 1E90A 1WJUA 2K6DB 3AE2B 4CGYB 3CIRB 4EQ5A 4HKQA 1QUQA 4FF2A 1SMXA 1G6JA 3MJWA 1EWCA 2Y5CA 4XQJA 4BZAA 5IT9L 4DR1L 4JYAQ 3QCAA 3KYHC 3S14H 5KEEA 1AZPA 3S17H 4QUFA 1I50H 2M1MA 4J6HA 4DV0Q 1ZPSA 1VQHA 1L4DB 2V1CC 1LTRD 3W5OA 3KUZA 2D5GA 1Y8NB 4NQLB 4DUYL 4A3DH 3E0JA 4A20A 2CHWA 3VTVA 3OWFA 2NN6I 3TQYA 4JOIC 4LMQD 1SF0A 2N88A 3A8JE 4KKUA 3LJ3A 1VRAB 3N32A 3CCQA 4DHJB 3VR9B 2WFWA 5IGCA 2IT1A 4RF0A 5A35A 1B2TA 3W2DA 2K39A 5KHOA 4V190 4CO7A 2QJLA 4BAXA 5JJKA 1XCTL 2N1VA 2BH8A 4C3HH 1FRDA 3HRDD 2KWDA 4R3DA 1B44D 3KYDD 2ICEC 3G7LA 2JE6I 3Q3FA 4HDOA 2AKWB 1STYA 2LHDA 3T51B 4HKZE 1O7YA 1FJGL 3B2FA 2ZXPA 1NE3A 4ZUIA 1A15A 3S1RH 4EKUA 4ABNA 1F1HA 2RDHA 2EY1A 2AL6A 1FL0A 3M3JA 1YQBA 3MHBA 1YHQA 1WCMG 5C4XH 4GU2A 1CA6A 3H6MA 3F2BA 3AEVA 1Q86C 3I3CA 1PH4A 1DD2A 4I65A 5K5PA 3HOUB 1XTDA 4AUQC 2VL6A 3PGZA 5D3IB 3AEDB 5T8IA 3NTHA 3HGBA 2D5DA 4M02A 3J81L 1J0GA 2EPBA 4WQOB 3T3NA 4A3DB 4GS3A 3TEHB 1MSGA 1S5CD 4ACFA 1QT9A 3KLRA 2F4VL 3KLWA 4RWSC 2INNE 4HMJA 3PZ8A 1JC7A 4WAFA 2NTSA 2H88B 1WX8A 3UINB 2VQEQ 1VQJA 3KF6A 2NVQB 1P98A 2NVXB 3DBHB 1ONLA 2PNRC 2OOBB 1ML0D 4YWKA 3UDXA 3BU2A 3SDLC 1SYEA 4K7UA 1HH2P 1UWMA 2KDEB 2QDLA 2LXCA 4KSKC 1HNXQ 1G6ZA 1I4XA 1UUPA 4RNAA 1TS5A 3SK5A 4I6PA 2DYBA 1OQQA 3PIPA 5FLXL 5C5MA 4EQNA 1IW7C 5J22A 2HTHA 4PYZA 1RTNA 4XC2A 2EYHA 4POGA 1ENFA 1E5WA 1NYRA 3R93A 1XLPA 4B3TL 1WSPA 2HD5B 2H4OA 3VHTC 2L52A 1SBBB 1VQ7A 5HFYA 1ZUD2 3HS0C 3NHEB 1VMCA 3PGEA 1IP9A 4HJ7A 5IKCM 1RFAA 4IC7B 1KM7A 1C4QA 3OIQA 1YN3A 4GLXA 1NR2A 4IUQA 4DN4M 1S1QB 1VCBA 4OZAA 4A55A 2ZCBA 3E3XA 4X65L 2L55A 1LTBD 1SR3A 5C44B 2L0TA 2EKEC 2G4DB 4IWOA 3NVYA 3MFYA 4JWSC 1GOZA 4PT5A 2A69D 4YCWA 1TYGB 1OXSC 1I7HA 3GTQH 3CD6A 3HOXH 1WGYA 2PVOD 3EJIA 1JE4A 5AZFA 2NBUA 2JA9A
chains in the Genus database with same CATH topology
3Q69A 3NQTA 1EY5A 4L6TB 4NMZA 1BR9A 1DM0B 1EY0A 1VF5C 5BMHA 4A3IB 2VXWA 3P20A 4FNFA 1CTMA 5JJZA 2HCCA 1E10A 1BF4A 1X32A 4OL7A 2YU9B 1R7SA 1BNZA 4LK0M 2BS3B 4AQ7A 3KLSX 2IX1A 3W5UB 2QF7A 4ULLA 1WTWA 5EE3A 1PRTC 4GLSC 1F2ZA 3VYUA 2L1AA 3OWEB 4QIWB 1TKYA 1PTOB 2I07B 3QO2A 4WIPA 5I9OA 4B0MA 2YEPB 2VNUD 2OT2A 2INPE 1LV9A 2F0QA 4HEDA 4FF4A 2K33A 1GUTA 3I72A 2PZWA 4CKBA 2B39A 5KRUA 3VYSA 1EFID 2IDYA 3PIO3 2B76B 2A73B 1YQ4B 4KN4C 3S2HB 3BG3A 1XO3A 1BBXC 4WURA 1R4PB 5TSSA 1TKEA 1MHXA 1UNSA 3P42A 4ZOHC 4IFDH 1WWTA 5C5LA 1XX8A 1RCVD 3Q8BA 4F8MA 1HA5A 2AQ1B 2M00A 4ILWA 4IUUA 4DXFA 4RKBA 3VR2A 1JMLA 3GTPB 3BVGA 4WWMA 3M7GA 4RCOA 1OO9B 2Z1CA 2K22A 3MXNA 4ID6A 4ZLTF 3WOFA 1STAA 4OO1H 2LS01 4HAEA 3PO0A 4KI0A 5EE0A 5JAVA 1EWHA 3ERQA 2SNSA 3TEWA 3HEJA 2K0PA 3RFZB 1BMLC 4F88A 1A6XA 3W1SA 2NUCA 4NP5A 2PPBC 2W55A 1E2WA 3DM1A 1SYDA 2LFIA 4RAUC 3U9OA 4DAVA 4B08A 5JEAH 3U4EG 2W3RA 3IT4B 3TDQA 1XEEA 2O4XA 3AH7A 3BZDB 2KJXA 3I70A 3NSWA 2NWGA 5M5WB 2O5IC 3MHZA 3AE8B 4EE2A 1KLUD 2DYMA 2RSNA 3CRLC 4N58A 4C3HG 3M85A 4IFDJ 1JORA 1UAPA 1EY7A 5IIFA 3EQLC 3J9CA 2FMMA 2LFNA 2DBYA 3E9SA 1YJJA 1QOGA 1FD7D 1EEID 1DOIA 5JPNC 3H09A 3C46A 1HZ5A 1IYUA 3LB8C 5G3LF 4OZCA 3NHHA 1RDPD 4A3EB 3HVZA 1JQ4A 3MP9A 4IUPA 4C3IB 2ZT9C 5EE9A 4KGRA 3VR5A 2E74C 1XLQA 1SNDA 4LLGM 3LWEA 3R2TA 1H9JA 2F0LA 3SR1A 5H92C 3S1QB 4G4KA 1AP0A 1I4PA 5DNFA 2CW0D 3CHBD 1DOYA 1O7ZA 3DWMA 1BCPF 1JR0D 5JEAJ 5CV6A 1WTVA 2SEBD 4G57A 1U4MA 3W3AA 2FJ2A 1G91A 1DOLA 4ZYSA 3LWUA 3AB5A 2PKOA 4JK1C 1F0ZA 2WP8J 3O13A 2N9LA 2E2IB 5EBCA 2CU3A 4H44C 5FK9C 3U7ZA 3TMEA 3GP7A 4ZQ3A 4JPSA 1KRHA 3PZ7A 1PRTB 1FFVA 2AWNA 3V2TA 1IYVA 3SR6A 3IAYA 3AB9A 3H94A 2WXGA 1EU3A 4CBVA 3FVQA 1ZDVA 3HOWB 1UGJA 5CV7A 2EY2A 2K01A 1TIID 2L4NA 1CK1A 1QOAA 5IGBA 1SEBD 3R3OA 1YQ3B 3L3OC 1YN5A 5C3EB 3OHXC 4XTCS 2HUGA 1Y1WB 2F0MA 1XXGA 4RCNA 4BBRB 3RPFC 1RF2D 5IGEA 4MT5A 2BS4B 1IKMA 1AN8A 2GA4B 1ICWA 3I9V1 2K32A 4KD4A 2B8FA 2LKVA 1B9RA 3PUWA 3SK8A 4QCLA 4RA8A 1LT6D 2C9OA 2EDGA 1RWSA 1EY6A 5IGDA 4US8A 2WXKA 2O5JC 3AE7B 4IQZA 3H8HA 2EJGC 1VZ6A 4WRDA 2PW9A 1CHQD 1NSNS 3BS1A 1Q10A 5ELBA 2A69C 1F9PA 1G291 4KX6B 1PGAA 3ZJTA 3PUZA 4KJNA 2FINB 2K6AA 4DXGA 1FD6A 3DUZA 2A6HD 1SDFA 1QWYA 5FLXE 4OVZA 1VZ8A 1YNND 3PV0A 1G2TA 1H9KA 4G7OC 5NUCA 5ISRA 3RZDB 1BCPD 3NWSA 3ND9A 1E2ZA 1SFOB 1WCMB 4Q5VA 3TP7A 1B1ZA 1AW7A 4CJ1B 1B4OA 1V1OA 1EU4A 4JBWA 3C8YA 4B0EA 1MI2A 4H7BA 2RDGA 4IFDG 1JCKB 5BMGA 1TWFB 4JWUC 1KDBA 1STNA 4P16A 3IAM1 2HDMA 3AM9A 2KA7A 3V96A 2SNMA 3R2IA 5DM73 2L11A 1E7PB 2WXQA 3U2SC 1BOSA 2XNAC 4OO1G 4RGOS 3GD7A 3CKIB 3D4DA 2KVMA 4FXGC 3CQZB 1JWBD 3P1HA 5I4DA 4K8JA 1ENAA 2BDOA 2CHBD 4QF4A 4NDXA 5LL6X 3BIID 4DA2A 4C3IG 4WFN3 3NPPA 2K1BA 2Z8LA 3Q8AA 3M4OB 1SNPA 2WKCA 2DWQA 2F3WA 3RLFA 1SE3A 2EELA 5C0XH 3UI2A 1C76A 2ENBA 1BQQT 3LNNA 1A3VA 1GB1A 1U4LA 4YWGG 5I2YA 3NVVA 1NEKB 4ZHOA 3NTKA 5M9OA 4NZLB 1SE2A 2AX5A 4R8IA 1H9RA 1T5XD 4K14A 4ZAIA 3TZUA 1GUWA 3BWUD 3FDTA 1AZQA 5C3WA 2BE5D 1QJOA 1F77A 1F2RC 3A7LA 3TP8A 4N9TA 3A55A 5BYQA 3TZDA 4YT0B 1ESRA 3SXHA 1PMRA 1JICA 2KN4A 4PNYA 4HN7A 3N52A 5EQ0A 4K2KA 2DY7A 1PTOC 4X3UA 3K59A 4L2YA 4UAIA 4KKSA 5C4JB 2FMCA 1Y69U 3PUYA 4C7ZA 3MJ5A 5I6YA 1KDCA 1VDVA 2E3TA 1LTAD 2RSOA 2FFKB 1C4PA 3SFEB 2BTEA 2EJMA 1HZ6A 1HEZE 2MEKA 5BMIA 3EROA 1TWHB 4KY7A 2VB3X 3B2GA 3NS1A 4REZA 2JYOA 5C6AA 5G5HA 1NCVA 1F2YA 4IUNA 5C0XJ 3Q8EA 1CJEA 1CQVA 1YNJD 2BA0A 3T3OA 1IHZA 2E75C 3BK1A 2JQRB 1F9QA 3Q6SA 2WXHA 5FKAC 1GUOA 1AWDA 2G1EA 2EOTA 4O1NA 2D9UA 5K36H 3M4YA 5ELEA 2PO4A 4FO2A 3C2PA 2QILA 5CC4A 2WU2B 1MSHA 4FF3A 2ACZB 2CJOA 4A6QA 4DF7A 2CJNA 1PYWD 5FO8B 3C3LA 1X3QA 1ZDXA 4K5XA 1D2BA 1PXUA 2CW0C 3ND8A 1IBXA 3U9SA 5T1IA 5AUKA 1QNUA 4IUVA 1WTRA 3FPUB 1HA6A 2JEBI 1TKGA 5CORA 1NI3A 2HCIA 2WDVB 2JA5B 3TSSA 3ONAB 3I4LA 4BA2I 1MGSA 2RMMA 1JB3A 2R3ZA 1HFGA 1VZ7A 3URYA 1SIJA 3DWGC 4A9AA 1SJHD 2B2VC 2DNEA 3S14B 3NUHB 1STEA 3S17B 2K3UA 2B2YC 2JSOA 1I50B 3QOJA 1SSNA 3JAME 1U4RA 1A2TA 2IW3A 3I90A 5EKIA 4KJOA 1FIQA 3H3VC 2E76C 2ZW1A 2A68D 4USAA 3HUIA 2NYZD 2L1BA 5E3FA 4C3HB 1FCLA 3GQBA 5FOBB 4CKCA 1I4RA 2KCNA 2K04A 1P7FA 1Z6HA 1C4AA 3S1RB 5I2XA 3OSOA 3LYYA 1C8CA 1FM0D 2IGGA 3HRZC 3AE9B 1HTLD 5C4XB 3HG9A 4G7ZC 2Q8RE 3ITPA 3IFDA 1F2RI 1ACCA 2KEDA 2RPVA 1Z47A 4IN3A 4FP5D 2PW5A 4KTAA 2GRIA 3V05A 4HCSA 1TS2A 1QOFA 4KV6A 1HTPA 1NUCA 3CU7A 3SEBA 1EZ8A 3T4AC 3SVMA 4DK1A 5EPLA 1WYGA 2Y5PA 1IL8A 5J39A 3DXJC 3BDCA 4C80A 3NUCA 1ZYRD 2B8GA 5D14A 2B2TC 1J9OA 4FVMA 4P6VF 2AUKA 2XVSA 2DNCA 2Z4IA 2A6HC 2JEAI 3P4SB 5HGTA 4L1BA 1YNNC 1ILPA 1EY4A 4X3KA 2L5TA 2BS2B 5HI1A 3IKJA 5E4XA 1BCPC 1EL0A 5JXVA 1FMAD 3KWLA 1JWMD 2BW2A 1AEXA 1SE4A 1BUVT 3AE1B 1SSOA 3DEOA 3D8GA 5JVG3 5JPMC 3GTQB 3HOXB 4RGMA 2RQXA 3NBIA 1V8QA 4C1NK 2CQAA 4JX1C 4Q0FA 3K5MA 5C0XG 3TUOA 2R92B 4KKJA 3BVMA 1JW9D 1E2VA 2YEPF 4F7XA 3NK9A 1XF5L 4L8JA 2K5PA 2G9HD 2PMVA 4XWTA 4KMUC 3ZQ4A 4KGSA 2J7ZA 3PO3B 4HTHA 2J0TD 4U68A 1IGCA 5C3XA 3P1MA 4J8QA 1YMHE 2NBFA 1IGDA 2N7JA 2BBCA 3OW7A 4IFDI 1E0BA 4I7ZC 1M4VA 1GHKA 1CHPD 1XYIA 4M1UB 3VR6A 2VB2X 4K6DA 2EYOA 1L0YB 3MAQA 2WNMA 3SDZA 1HXYD 2KAJA 4M0WA 3DEPA 3F2UA 3OPOA 2LMCA 3WCQA 4B9XA 2IGHA 5LHY1 4C7YA 2F0OA 4OO1I 1B9NA 5EGTA 3TP6A 1ESFA 3MWYW 5CMDA 2KACA 2QDBA 1HQRD 1NAPA 5ELFA 3GV6A 3ZJUA 2BE5C 1BUIC 2MPMA 4OIKA 4XQQA 3GTLB 1DZ1A 4A3KB 5ELDA 4A93B 4PQXA 1S5FD 5IODA 3TEZA 4L23A 3E5SA 5K36G 4PMWA 3L9AX 3RZOB 1QG7A 3VYTA 1KFYB 1KAAA 4CJ2C 4HCEA 3AECB 2YYZA 3VA7A 2FHTA 1EY8A 1RTOA 1J7BA 2KQ4X 2F0IA 2WB1B 2IL8A 1CZPA 1OQRA 5AUIA 1OXVA 1YNTE 2IWHA 3TEYA 2BCOA 3RD4A 3WDNA 2B2WA 1LTSD 3OMCA 2K5WA 1S5DD 1HRJA 1DONA 4AYBB 1CZGA 1FXAA 3IXSA 3HOZB 5D7GA 3I73A 1GHJA 3KK7A 2F0JA 3AE6B 2MJ8A 1YNJC 1QLBB 4RGNA 3HOVB 1X3PA 2JA7B 1DOMA 2OHFA 5EKKA 5IGFA 2FUG1 3KBGA 5BN4A 3K5NA 3JAML 5DAUA 1CZWA 5KNBA 5G5GA 4C56C 1CQFA 3ETRA 2EXZA 4TQ0A 4YSZB 1SMYD 3MA2B 4HR7B 2NB0A 2BYTA 4AS1A 3AV8A 3OIPA 5E1FA 3D4RA 1EQVA 5LL6S 3GB1A 4BS9A 3KUPA 5LNK1 1D6EC 2EYMA 4A3JB 2R93B 1TS4A 4GDLB 1R9TB 5IOCA 1H9SA 3EGRA 4Y7NB 1V1PA 2B63B 5DM63 1T3QA 1I4HA 4K5VA 3VQIA 2PIAA 1B9MA 1BCPB 2A5HA 2M19A 2BT6A 1U4PA 1HHVA 1ZOYB 4IUTA 4A3GB 2L32A 1SNCA 1N62A 2RDFA 1DXMA 1PRTF 3PUVA 1RFKA 4MACA 4C1NI 1N60A 2F0EA 2M56B 4KY6A 1QE6A 4KGTA 4OIJA 5C3JB 1N5WA 3L4PA 4OW0A 2A68C 2L0CA 2L83A 2NTTA 5CBAE 1Q1BA 5I9PA 2AQ2B 3A7AB 1SAPA 1LTGD 2H89B 3HP3A 5KNCA 1K51A 4LJZC 4OHJA 3AEBB 1KTKA 1PZJD 3MC0B 1GAQB 1XCQL 3P4RB 4PMCA 1QCBD 5G3LD 1T5EA 1LT5D 2EY6A 3E6ZX 1IKLA 1D4BA 1F2LA 2MP1A 1VCIA 4A3MB 2K5DA 1E9MA 1TJEA 1A2UA 3K5LA 1K83B 3GS2A 3P7JA 4C3JG 2EE1A 1DJRD 1JQYD 1ZYRC 4IDIA 1S5ED 4A3BB 1WVLA 3S9WA 1N63A 5A2QE 1ET6A 4X3TA 3R8BA 2WAQB 3Q22A 1EYDA 1RKNA 3P63A 4D2KA 1PDXA 5BYRA 3S16B 1DOKA 2EYFA 3D3RA 3U52E 3MXUA 1G8ZD 3SK6A 1PFDA 3FILA 2KOLA 1EYCA 4GDKB 3QJYA 1MPEA 3IFTA 2W54A 2LGIA 2WXJA 2XN9C 1VF7A 1FEHA 2IPKD 3GTMB 3P4PB 3NXWA 3OMGA 1H9MA 2WLBA 3MXPA 1WTPA 2JWUA 1L6VA 2N9KA 3HZXA 1ZE3D 2K9XA 4TQUS 3BYYB 3SFDB 1OXXK 4ZKBB 4BY1B 1SJED 5J1ZA 3NE5B 2F3VA 2X6GA 1G2SA 4XYOA 2KEEA 3QIAA 1HFNA 1K52A 3AE4B 3FC4A 2GB1A 1UEAB 4RGTA 4ZUJA 3TP5A 1WXQA 5I6WA 2KQ3A 2F0WA 1M8AA 2SAKA 4G7HC 4RH6A 2Q8IB 4NJCA 5KGUA 1I4QA 2JA6B 1EIGA 1GB4A 4WORA 1D5XC 2EJFC 2W82A 1TY0A 4O42A 5JEAG 2Z4HA 2E6XA 3NQIA 4HEA1 1IBXB 3KWVA 1KNAA 2W3SA 2DY8A 3AEEB 2TMPA 3A8IE 2Y0SB 1YN4A 1EY9A 3NWTA 3C1EA 1NR4A 4DNTB 5C0XI 1HCZA 1BO0A 4P2CB 1XLNA 5C2TB 3J80L 5MPOA 2QIEB 2WXIA 1JROA 3FMCA 3TBIB 4CQNA 5COYA 4N59A 1EIHA 4MM3B 2DLBA 3VR4A 3GTOB 2BOSA 1TR5A 5FO7B 3VRBB 1Q8IA 4ODGA 1SNQA 2QSDA 2F4IA 1O78A 2F0UA 1CI3M 3P4QB 4WH4A 2XRSD 3G6JB 2SDFA 5CV8A 1MHHE 2FE8A 3S15B 3SE0A 2WXOA 5T1GA 1FCCC 2B2WC 1N5XA 1QOHA 1DCZA 3C1FA 3QB3A 1PFNA 1RD9D 4H13C 2EY5A 2AWOA 2F1MA 3BVZA 1QF6A 4TRDA 2VZKD 2CVRA 3NBHA 1N61A 4ZKCB 1PFMA 2BB5A 2PVGC 1YJIA 1DGJA 2IX3A 2WDQB 4CKEA 2V3NA 2LEKA 3S1MB 3MZ5A 4A8XC 2B2UA 2F0VA 4DAPA 2WV6D 2NMQA 5C4HA 1L0VB 4MN3A 1JRPA 4H2AA 2QCPX 4R9WA 4YIJA 1RM6C 3A56A 3AE5B 5CV5A 4FXDA 2PYKA 2J4XA 2JU6X 1RODA 3EUB2 3Q8CA 1GUNA 4WJWA 2BDNA 1LABA 5EE1A 1LLRD 3J7AF 2C5CA 3KLSA 3CRKC 2MGSA 1GXDC 2N0SB 1SMYC 4PMBA 4NW2A 4TQ1A 3VRAB 1TS3A 4RFBA 3GTKB 3Q8FA 3AMUA 1Q90A 3W5VB 1GJXA 2NN6H 2WXMA 5DEHA 4KKTA 2MJDA 4XE0A 1W6JA 1MVKA 1SNOA 5CR3A 1ZEQX 4EGVA 2J53A 3NZ3A 4OGQC 2F0KA 2DN8A 2JXTA 3X3MA 2I38A 1DYQA 4BA1I 3K6OA 2A74C 3ABVB 4FXCA 1ROEA 3FEWX 1Y56A 2OEDA 1BXTA 1K53A 1A3TA 2RA4A 4U673 4Z9CB 4HSPA 2FBWB 5JOBA 1FR3A 4F87A 4PV1C 3WOEA 1TU2B 1D5ZC 5A2QL 5HHDG 3S1NB 1XWEA 3LX0A 1FFUA 2F0HA 1D1IA 1II3A 3MFGA 5FR3A 1SYBA 4V0BA 1K8OA 2ID0A 3D6CA 1PLFA 1STHA 2Q8TA 2LMCB 5ELCA 2IGDA 3VYRA 3QOLA 2X69A 1LACA 1AYFA 1EOTA 3GV3A 4N6EB 2K03A 1C77A 3VA5A 1P7EA 3GO5A 1ZKOA 3E56A 3LXFA 1R4QB 2E2HB 2TSSA 2Y3AA 4RHSA 1OXTA 4BY7B 1KDAA 2HTME 1GPXA 1LO5D 1W6KA 5KIXA 1S5BD 4HROA 1C4CA 3I4MB 5CGKA 1QILA 4DQOC 1PTOH 2ZXOA 1ZXTA 2QMTA 2MHVA 4FYDA 1TZOA 5M5XB 5H8YE 3M3YB 4XDDA 1EZ6A 1WTQA 1PGBA 1I3QB 1RYJA 3M7NA 2ZXRA 4CJ0B 3EFXD 1HUNA 1V97A 1PTOF 1XLOA 2MJ3A 3Q0AA 5EJWA 3MEHA 2VUMB 3I4NB 2PQEA 2EZVA 4YSYB 2OEOA 2MH7A 4XWWA 4A90A 3BDLA 2A6ED 1PZKD 4S3SA 2K05A 4YTMB 5HG2A 4LK1C 4M8AA 3NP8A 1HUMA 3H91A 2IJ0A 2JYEA 4LAAA 2X6LA 3KQ4A 2JYTA 4ARIA 1CT1D 1B50A 3Q24A 1E0ZA 2KCCA 1KH0A 2XSCA 2KDMA 2ZW0A 1H9SB 1WD0A 1V1PB 4C3JB 1VLBA 3J7AV 4C2MB 2LY7A 2L9HA 4IKGA 2XWBB 1WGKA 2V0GA 2NZ1D 3MXGA 4TSSA 1EYAA 5CYUA 4DK0A 2K5QA 3K5OA 3W9CB 1J7CA 3I8ZA 1L4ZB 4LTUA 1WRIA 4KHZA 3AEGB 2WXPA 1U9RA 1TWGB 1GUGA 3L7ZC 3EA6A 4BBSB 2PMZB 1WTOA 2AQ3B 3D31A 2JP1A 2QEJC 3A8KE 1L6UA 1F9RA 3P75A 4ZK9B 4XQNA 2NVTB 1E6EB 4MHEA 3KBXA 2B2UC 2KMMA 2QKIC 2ON8A 3J80E 3AN1A 3NVZA 1JWAD 1SNMA 2K28A 4YSXB 1HQMC 2WXRA 4RHRA 1PTOD 1AFPA 1JWSD 4H0LC 2NN6G 4IURA 3D6WA 1IUEA 3GTJB 1TQOA 4XT3B 5E4WC 3IT6B 5EBDA 1Z7TA 1KLGD 2AUJD 1D5MC 4HMIA 4YTPB 1A70A 2KUMA 1PDQA 2ONQA 2J52A 3K7AB 4XDXA 2F0TA 3NRZA 4ZHPA 3B9JA 1VDZA 4EQPA 2WP9B 3FRPB 4XT1B 3QG1A 2EKIA 2IX0A 3DWAA 1SB3C 3HVDA 4TMAB 1O7LA 4Q2JA 4ZRQA 4DNRB 5M3FB 1CA5A 1T6BX 4FXKC 3VR8B 3S2DB 3AEAB 3AMZA 4BWGB 1QKZA 2E2DC 4DFAA 3PIP3 1PUTA 2XWJB 3IAS1 2H1EA 2BA1A 3N6RA 4IOIE 2JA8B 3MVVA 1JALA 1C78A 1K50A 3GTGB 3DWQA 1QNKA 2F0NA 2M0AA 1WD1A 1MD2D 2D2CC 3FPPA 3AE3B 2ICIA 4QMGA 3FILB 5EKLA 1SYFA 3X3NA 2WDRB 3ZJVA 1JWUD 2XRQD 5BN3A 5C4ZA 3PMFA 4NKLA 4XIGS 3T16A 2WS3B 5D65A 1ILQA 1JOOA 1O80A 1FNVA 1B53A 3K57A 5CV9A 3SK4A 2PLPA 2RKSA 1VJKA 5KYIA 5F2DA 2LUMA 3D4WA 5BYSA 1OXUA 4HRSA 2WU5B 2O2LD 4QB4A 1ENCA 1HPCA 5IT9E 3BDOA 2JX5A 4A3FB 4IZ8A 4L63B 5D3DA 4XDCA 3AEFB 2F0FA 5BN5A 2R7ZB 2I46A 2JSVX 3PUXA 2GI9A 4YTNB 1C9FA 1Q12A 4J1MA 1EQTA 1PFBA 1NYQA 2G9DA 1ZP0B 1V43A 5E6JA 4NAWB 2B2VA 1LTID 2KECA 2PTLA 1SXTA 2B2YA 3FKIB 2R6GA 2MJEA 4ME5A 1IW7D 1NVID 1PZID 1RHPA 1ZXIA 4UDUC 2RBMA 4K2LA 4WQMA 1C79A 1B3AA 3FAHA 4EVOA 3DHQA 2K7VA 3HKZB 2E2JB 2RVLA 2EVBA 4K8IA 1LT4D 1QQRA 2PZTA 1A3UA 2F03A 4US9A 1L0XB 2HQEA 2WXNA 2V4IB 3J81E 3NVWA 1J8IA 3QWNA 1EM7A 3VR3A 1MBYA 2M2LA 3I57A 4KY5A 3N9YC 2LJIA 2F0PA 3UI3A 5JVH3 1OFFA 1DOXA 1TWCB 1K8MA 4ZRPA 1FO4A 4IALA 4ARCA 1LT3D 3BK2A 4ZRZA 5EPJA 1FNWA 3NTIA 4KD3A 2X38A 1TY2A 2V4DA 5IGGA 2N55A 1FNUA 1ET9A 1Q1EA 1ZXHA 3SHLA 1WTXA 1Y8OB 2WINB 5M3MB 1NENB 4KK7A 2B2TA 1SYCA 3ZGZA 2KHSA 3OOCA 1KNEA 3TEXA 2WQYB 1I4GA 3K58A 4K6LA 1PRTD 1I6VC 3IL8A 1D1KA 2J42A 1GUSA 4KHVA 2HDLA 5KYLA 1L5PA 2VZKB 5GXGB 5HURA 2OF1A 4CHTB 1FGBD 2A6EC 2EYLA 5EPKA 3H0GB 4J3OD 1JOKA 1FXIA 5CV4A 1CM9A 4R8NA 3Q23A 4KN7C 2LHEA 4RF1A 4N9PA 1TWAB 3T53B 2R61A 2WIIB 4YXDB 3K0YA 4RKLA 2PCFB 4TKOB 4DAYA 4EQOA 1F9SA 1TVXA 3BYTB 1VR9A 1Y8PB 1Y1VB 2JXMB 2JZPA 4X3SA 3ZYYX 2M9VA 1C48A 1F2MA 1CFMA 4HJGE 1RJTA 3DMUA 2WACA 3A54A 1S4ZA 3CWIA 1EWYC 2XIWA 3RMHA 1J7AA 4KKIA 4ITKA 4NAMA 3TN2A 3PO2B 1FYCA 4XXEA 1BDOA 5CBEE 3I91A 2MUYA 2SOBA 1FRRA 4DGZA 1V8CA 2WKDA 1Q3LA 1PGXA 4OZBA 2F0GA 1I6HB 1TKWB 3V3XA 3T56B 1SYGA 4MIUA 3EVQA 1KF6B 2PZUA 2WXLA 4XYQA 2D62A 2OXPA 5M5YB 2EYPA 1TT2A 2BB6A 1MI0A 2I2YA 4QUCA 2Q5WD 2EYJA 3DWPA 4E6IA 4FF1A 1LTTD 4JE3B 2L12A 5FO9B 1VMPA 4HSVA 3RUZA 1STBA 2F0SA 2HDEA 3MTSA 1EEFD 3J7YW 4GZYC 2V3PA 1KABA 4MH8A 2PW7A 3AU7A 1STGA 5AFWA 4K5WA 3KF8A 2F0DA 1UWXA 1QOBA 5KNDA 1JOQA 3T13A 4DU9A 3HOYB 2NVYB 2DYOA 4B9WA 2WXFA 1XTCD 3AE2B 4CGYB 3CIRB 4HKQA 4FF2A 1EWCA 2Y5CA 4XQJA 5IT9L 5KEEA 1AZPA 4QUFA 4J6HA 1ZPSA 1L4DB 1LTRD 2D5GA 1Y8NB 3E0JA 3OWFA 2NN6I 1SF0A 4LMQD 2N88A 3A8JE 4KKUA 1VRAB 3VR9B 5IGCA 2IT1A 4RF0A 5A35A 1B2TA 3W2DA 4V190 2QJLA 1XCTL 3HRDD 1FRDA 2KWDA 4R3DA 1B44D 2ICEC 3G7LA 2JE6I 1STYA 2LHDA 3T51B 4HKZE 1O7YA 3B2FA 2ZXPA 4ZUIA 1A15A 4ABNA 2RDHA 2EY1A 3MHBA 1CA6A 3H6MA 3I3CA 1DD2A 4I65A 5K5PA 3HOUB 5T8IA 5D3IB 3AEDB 3NTHA 3HGBA 2D5DA 3J81L 2EPBA 3T3NA 4A3DB 1MSGA