1TS5A

I140t mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts5A01
3MFGA 2SEBD 1PTOF 3KLSX 1D6EC 2NTTA 1L0XB 4RGMA 2IJ0A 1ESFA 1I4XA 1LTTD 1S5DD 3BZDB 2CHBD 2XNAC 1FNWA 1PRTC 1PYWD 1TS5A 1S5ED 1PZJD 1EU3A 1BCPC 1V1OA 1EEID 1EU4A 1AN8A 1SEBD 2R61A 3BVGA 1FNUA 1UUPA 1SE4A 1CHQD 1F77A 2QILA 5I4DA 1ET9A 1JCKB 1AW7A 1S5CD 3R8BA 2XRQD 1CHPD 1LTGD 4TSSA 1LTAD 1FD7D 4DXGA 2J4XA 1LT4D 1EWCA 1ENFA 1LT6D 1UNSA 2ICIA 1DJRD 3GP7A 1GOZA 5FK9C 4ZYSA 1DYQA 2XN9C 3DWAA 1B44D 1I4GA 5TSSA 1SE2A 1JQYD 4RH6A 3SEBA 3BVMA 4RFBA 1S5FD 1TY2A 1BCPD 1SBBB 2NTSA 1D5XC 1V1PA 1YN3A 2G9HD 1I4PA 3DWQA 1PTOD 1PTOH 1T5XD 1LLRD 1PZKD 1RCVD 4O1NA 5ELBA 1D5MC 5FKAC 1I4HA 1XXGA 4RCOA 1CK1A 1YN5A 4NZLB 3R2TA 1KLGD 1G8ZD 1TS3A 3O13A 4K6LA 3W2DA 1LTSD 5D3DA 1L0YB 1SJHD 4BWGB 1LT3D 1PTOB 1B1ZA 1PTOC 4RHSA 5ELDA 2AQ1B 1PZID 4RGOS 2AQ3B 2QEJC 3OWEB 1MD2D 1FGBD 4C56C 1M4VA 4Z9CB 1HQRD 1JWSD 1S5BD 3EA6A 4RGNA 5ELFA 1EFID 1SE3A 3BYTB 3TSSA 3URYA 1HA5A 1HTLD 1LT5D 2O2LD 1QILA 1CQVA 3MC0B 5D3IB 1BXTA 1BCPF 1LTRD 2XRSD 3DWPA 1TS4A 1PRTF 1BCPB 1RF2D 1SXTA 3BYYB 1TY0A 1PRTB 1V1PB 1XTCD 3EFXD 1HXYD 2WV6D 2TSSA 2Z8LA 3R2IA 4L6TB 1LTBD 2AQ2B 4L63B 4UDUC 1D5ZC 1ET6A 1JR0D 1EEFD 1TS2A 1CT1D 5ELCA 3BVZA 5ELEA 1FNVA 1PRTD 1JWMD 4OHJA 4RGTA 3V05A 1YN4A 1SJED 1STEA 1LO5D 3CHBD 1LTID 1I4QA 4RHRA 1RD9D 4DXFA 1JWUD 2RDGA 1KLUD 1KTKA 2RDHA 1RDPD 2IPKD 1I4RA
chains in the Genus database with same CATH superfamily
3N1YC 4JI0Q 1H9SA 2LVOA 2IW3A 3HOXH 4DAYA 1KDAA 4CGYB 4C3JB 5CV4A 1VQ5A 4GLVB 3MVVA 2PMVA 4BKTA 1XNQQ 2XNAC 2EZVA 1NVID 3H7PA 4II3B 5F2DA 4A3DG 4ACFA 3UI3A 2BA1A 2JXMB 2F3WA 3KBXA 4A93B 2L83A 2D3CA 5A2QE 2EXZA 1EU4A 1AN8A 3G7LA 3PF4A 1WJUA 2DNFA 2IY1B 1KDCA 1QLBB 2MBQA 4HEDA 1Q90A 3JC66 3H9DA 3ZYYX 4P71A 2A1AA 1GUOA 4YSXB 2NVUI 1LTGD 3DHQA 1GUNA 1K83H 3NTHA 4LUVA 1GC7A 1EWYC 1V2YA 3PREA 4NQKE 4W9JA 3RZDB 4UPAA 3HOZB 3DLLA 2KWCA 2N9XA 2J42A 4OVVA 4TQ1A 4WJQA 2WB1E 1KRHA 2Z59B 1SGHA 1XD3B 4AUQC 4ALPA 2ZXPA 1IBKL 2LUEA 1F9RA 1KHIA 3C1FA 4P72A 2XK5A 1FPYA 1HR0L 1GG3A 1WXSA 3KLSA 1WXMA 1CQFA 3VH4B 4ITKA 1SE8A 4C3IB 2DENB 2DGYA 2Z0EB 3VTUA 2PZTA 1WJ4A 1KH0A 3PHXB 3Q8DA 4L8JA 2JWUA 3EC8A 3W1SC 4HMJA 4IDIA 1WTXA 3H7SA 1V80A 2D62A 1L4DB 2N9LA 4OEMB 4HJKA 2LXJA 1CZGA 2ZTCA 3TP7A 3I4MG 1H9KA 3STBC 1QOAA 3OSOA 1CKNA 4YCUA 2E2HB 3O13A 2PMZB 2EDGA 4K3BA 1FCLA 2EY2A 1LTSD 1BR9A 1E7VA 1WTOA 4EE2A 4Y7NH 3AB5A 1EYAA 2DAFA 3S1RB 2V9HA 1B1ZA 4CDEC 4A3IB 3VYTA 1Y1VG 3D4WA 1N32Q 1E8ZA 4MELA 5I2XA 1IYVA 4KKJA 1LV9A 3ZDTA 4XQQA 2B63H 2BQQA 2RQXA 2V4IB 4A8XC 5CV7A 1PH5A 2MRPA 4JI8L 3RNFC 1P16A 4B3TQ 3KF6B 4BY7G 4HJGE 4GOCA 3GTOB 2WXGA 2L32A 2JRIB 3R93A 2AL6A 1NMGA 2B39A 3VRAB 4HSPA 3KUPA 2IGGA 2RSOA 2KUMA 3QG1A 2KDMA 2WWZA 2KC1A 5IGCA 2L11A 4U68A 2CR5A 3GB1A 2H5XA 5EDSA 3X3MA 2KDFB 4W9HA 5M3MB 1DXMA 3UINB 1PH9A 4P1CC 3T1YQ 2MO0A 1U4RA 4A3MG 3ZNGC 1L2NA 3TEYA 1QVCA 4A3PA 3T13A 2VZAA 1EIGA 2NVTH 2F4IA 5EE1A 4IWPA 2F0NA 4XT3B 4FULA 4DKAC 4OIKA 1VD2A 4L5SA 4FJZA 2QEXA 1ENCA 3S17H 3P20A 2WXRA 2KXJA 1G6JA 2D5GA 2EKIA 3K58A 3PTFC 1I50B 3AE1B 3LNNA 4JI8Q 1JWAD 3HOYB 1CTMA 4A3JG 5IA7A 2NBVB 4BY1B 2INDC 1CSQA 3NVWA 2IPKD 2K1FA 2K6DB 1IBXB 2VUMG 4K7WA 4X65L 1VQ8A 1A15A 1MKHA 3OYYA 1PA6A 3LYYA 3TBIB 4XT1B 5K36H 1N5WA 2C9WB 1XNQL 4LNIA 2J7ZA 1VDZA 1ESFA 3GTGB 2O2VB 1C79A 1ZE3D 2NVXB 5GMVA 4JI2L 2OQKA 1HFGA 1IBXA 4NXMQ 3I4MH 1R4MI 3M4PA 1IGDA 4BY7B 5JEAG 2A6HC 3SK6A 2CWPA 3V61A 2LKVA 3MXNB 5IYDG 1C4QA 1LTLA 2PQAA 1ZKOA 4NJ7A 1JMCA 1ET9A 1UAPA 3AEFB 3AMZA 3I4NH 4W9GA 1YZ6A 2R93H 4IUQA 1C48A 1TKWB 1BBUA 2KEEA 2R3ZA 4WRDA 4ZRZA 3U50C 1NJIC 1C4AA 1T0QC 4TSSA 1WIAA 5C3JB 2AUJD 1GHKA 3RN9C 5BN3A 4GU2A 3TREA 4BKSA 1J9OA 1VMPA 3EROA 3H6NA 3LWUA 4ZRIA 4LK1C 4A3MB 2K5QA 2KQ4X 4HRSA 4YWKA 5C3XA 2N8NA 3K0XA 2WQYB 4KZ0A 2IO3B 1TTNA 4KJNA 5IGGA 2JA6G 3S2HH 4RF0A 3BVMA 3NS1A 1S5FD 4L23A 1HNXL 1H9MA 1K0RA 4AP4C 5FOBB 5JHBA 1R4PB 3GTMB 1JJCB 4QB4A 4QUCA 3L4PA 1TZ1A 3OLMD 3NPPA 1PGAA 3WAMA 4W9EA 1CM9A 3GTGH 2K0PA 4M0WA 4GNXC 4JL9A 5CBAE 2BWFA 2E2IB 4MGYE 4IPDA 3N30A 3ZRCA 1GUGA 4AJYB 2N55A 3N1ZC 1PYBA 3PIP3 1QQRA 3PUWA 2C5LC 2JU6X 1D4BA 1KQSA 4K81A 2W9NA 4NP5A 4X3SA 1MJDA 1WX9A 3FPUB 2KVRA 3W1GA 4B3TL 1TYGB 4GB9A 3GZNB 3UDFA 2HIXA 1OQQA 2K5WA 5G55A 1VZ7A 3AEGB 4YCVA 2GI9A 2KHWB 4A3FH 2CU3A 1PH1A 1NI2A 3KWVA 1WX7A 1PXUA 4RGNA 4F88A 1C78A 1N5XA 2I1JA 4ZCKA 4DPGA 4A3KH 4IUVA 2LMCA 4KX6B 2KACA 1F2ZA 4HWIB 5D3IB 2MJDA 1CQVA 2YTVA 5CGKA 1WXQA 4A20A 2XRSD 2VW9A 2EQSA 4J1MA 4LF4L 3A74A 2KCMA 5IGBA 1Y69U 3TS2A 4IFDH 5ELNA 4C4VB 2NR2A 3A9JA 5J22A 3LXFA 1HXYD 1UD7A 3KDFB 5DPSA 2QC8A 2BB5A 3S17B 2N7EA 4BXXH 1UH6A 4DQOC 5KIXA 3J81j 5KNDA 3CAMA 3I70A 1TWCB 1E7UA 2M56B 2ZJPA 4KLKA 4TQUS 3CCUA 2WHIA 3N3KB 3NZ3A 4KJOA 1FFUA 1P7EA 1J6QA 1B50A 1DOKA 1Q1OA 1VQGA 3ND8A 3ZJYC 3Q23A 1X3GA 5LMNQ 3CCJA 4DR2Q 4LF7Q 1LO5D 4JI3L 3M4QA 3ZIMA 1UWMA 3DBLI 1O7LA 2IO2B 3ZTDA 2OF1A 3CW2C 4IUNA 5DLQE 3JAME 1CSPA 1VQ4A 4UP9A 2KA7A 1VZ6A 1ZXIA 3EVQA 2OCEA 2IY0B 3ERSX 2FCNA 3HKZE 4YSZB 1HZ9A 3K5MA 4URKA 1D6EC 3PGEA 3PUXA 2KJRA 4DAYB 1PFDA 2N9PC 1GB1A 4HJ8A 3HP3A 3D3RA 4UP8A 3Q6SA 3OWFA 2Y5CA 5G3LD 1E24A 1YX5B 1PZJD 3IRBA 4IUUA 3A33B 2JZ3B 4HKQA 4IUMB 3A7LA 5IWAQ 3JYUA 1Y1WH 3N6RA 1QZHA 3M4OH 3I4LA 2OEOA 3S16H 3TZDA 4F1SA 3OIQA 1UGMA 1GD7A 1WY8A 4A3FG 4H2AA 3VQIA 2K50A 4TRDA 1YMHE 1E8YA 1MBYA 2MCNB 1IZ6A 2AYOB 1NYQA 3VR4A 3T56B 1GAQB 4BBSG 1HZAA 2FXQA 2KX3A 4K6DA 3DWAA 5CV6A 1I4GA 3SVMA 1W6KA 4XWWA 1TY2A 2QDBA 3Q0AA 1Q81C 1A3TA 1D5XC 1STBA 3BK2A 2V3SA 3KUDB 4TUUA 4P6VF 2MA9B 3K5OA 1YEZA 3NVZA 1II3A 5IP9H 3KJOA 2Q8TA 1TGZB 2ZNVC 3QIJA 3O65B 4IO9A 4RMAA 5HFYA 3FKIG 3JVZX 3DWQA 3S1RH 1Y1WG 1PH6A 2C7HA 5G2NA 1F9SA 1PZKD 2PMZE 1QOFA 3UDIA 1I4HA 2BTEA 2B8GA 2K1BA 3G6JB 3HOVH 3PO3H 5LMNL 4DHZE 1Q1EA 4I7AA 1K8OA 5FO7B 3GTKB 1EWHA 3EFCA 1KM7A 4K7SA 4GNXB 1SYCA 2R92B 2KMCA 4CKEA 3H8HA 1HZBA 3D4RA 2VQEQ 2RBMA 2LXCA 4EQ5A 2DX5B 2KQ7A 1PLFA 2F4VL 3QWNA 4ZKCB 1L0VB 1V49A 4DF7A 1V6EA 3M7NA 4NKLA 1YIWA 2YEPB 4L5TA 2EYHA 2Q2IA 3MC0B 1X32A 2YTYA 4LJPB 4WAAA 2OOBB 3DWPA 1L1OA 2VL6A 3AMUA 1PHJA 5CHFA 4JYAL 2WAQB 4P74A 1WTHA 4R9WA 4ZRQA 3MEFA 1C4CA 1T0RC 1JE5A 4ARCA 1F2LA 1ML0D 1V81A 3IL8A 4DAPA 5C23A 2KJXA 4DHJD 1SMYD 5C3EB 3PO2H 1PGBA 3NE5B 4MH8A 2B2VA 4KIKB 1HRJA 2ES2A 2ZTEA 2AHOB 3M4OB 2XEWA 2ZNVB 1I50H 1OTCA 3TZUA 5HURA 3PV0A 2EYFA 2JA8B 4NJ6A 5EJWA 3C8YA 2I5LX 2EIFA 3S14B 4GKJL 3K0YA 1JWMD 4LF7L 2VB2X 2N88A 4DR4Q 3IAYA 1SYGA 2WGSA 4O0AA 3HOUB 4LF4Q 4K0KL 4DHZB 2FE8A 1RKNA 4PS3A 5FR6A 3J7AV 1IPGA 3GTLB 2K22A 3P1MA 2CS4A 1TU2B 2MHVA 1J7AA 2EYMA 3FVQA 3RNUA 2NVXH 1BKBA 2HJ1A 2K7VA 2PLPA 3EGRA 4YY3Q 3HIZA 2KLCA 2BYEA 1F2YA 1RODA 4KV6A 3IBEA 5T8IA 1ICFB 1JRUA 1QNUA 2D9UA 2NTTA 4HCEA 1C4PA 1KRTA 2PPHA 2W3RA 2WDTB 4RKLA 4MSQB 1M94A 3D6WA 4JGHB 3RNAC 3ZRFA 4FNFA 1RHPA 2F0VA 2JPHA 5G3LF 4OVZA 4WWOA 3BZDB 2BDNA 4FVMA 4QF4A 4XXEA 1U4PA 3CRKC 4JI7Q 2CJNA 3NELA 3PHWB 2MJEA 4XWTA 1DCZA 2LI5A 4BOSC 3J7A5 1B9MA 1LFDA 1K28A 3FILB 2J53A 4CDDC 2F0LA 4GGQA 2K5DA 4ASWC 2EOTA 4LFAL 2MBOA 1I3QH 4BFRA 4HPPA 2EXDA 1HNWL 1LTAD 1JOOA 3DBRI 3HRDD 4YTPB 1DZ1A 2LD9A 1J7CA 1A5RA 5ELOA 2V3NA 1H95A 2BDOA 4ZYSA 2CQAA 3EJIA 5C0XJ 2EMSA 2K04A 1STGA 1QOBA 2PQAB 4II2B 1SE2A 1MG4A 3QA8A 1YI2A 4WORA 2ZM6Q 1F0ZA 2WXHA 1VCBA 4EKUA 1F2RI 4PMBA 3CMEA 2B76B 3HKZB 2DNCA 2IBIB 5KRUA 1K3RA 3D6CA 2MBEA 2M19A 4QY7A 2INPE 3A5ZB 2WIIB 2L00B 1K8MA 1KLGD 4K0KQ 2ASBA 1G91A 2D11A 2F0WA 4DUYL 3QO2A 3HOUH 3HOWB 5LXIB 3NBHB 4BWGB 1DGSA 1V8QA 2F0MA 4R4CA 1CZWA 2VUMH 1PTOC 1WGKA 3N32A 2MP1A 2D5DA 2NUCA 4A3DB 3ECIA 4B08A 2MBBB 2LGIA 1X3EA 3M85A 2ZJRA 5E6OA 1L5PA 3E9IA 3TS0A 2BB6A 3TQYA 3PLUA 2VY3A 3SK4A 4HCNB 1T9HA 5I2YA 3I63C 4WAFA 1ILPA 1J19A 4JYAQ 4C3JH 3UDXA 2GVAA 2LFIA 1QWYA 3L0OA 3PO2G 4FA6A 2FCMA 3QWZB 4EQPA 3AE6B 3VHTC 4WIPA 3FC4A 4US8A 3HOXG 4NAWB 1WTRA 4I7ZC 1SF0A 1Q3LA 3LB8C 4A3KB 5GQOA 2BE5D 2O4XA 3NWSA 3GTLH 2LWPA 4AWJA 4AYBB 2HDLA 4POFA 1R9TB 3DBLB 2KCCA 2DY8A 3OTOL 1AARA 1KABA 1BNZA 3DBRB 5AFWA 4DAVA 3AB9A 3Q22A 1BMLC 2WP9B 2KWVB 3CF6E 4RGTA 3M4YA 4JV5L 3AEAB 1JOKA 1PQSA 1LACA 2G9DA 1KF6B 2R7ZH 2SNSA 4DNRB 2VUMB 3RZOB 3OAWA 3U30A 1RD9D 1EY6A 2CFMA 3HGBA 3CU7A 5M9OA 4GNXA 2AKWB 3EFUA 4DR6L 4JC0A 4ICUA 4A75A 1ACCA 3RUIB 3UQAA 5EKIA 2F3IA 4LF9Q 2WDVB 1W3SA 2KCNA 1WVLA 2CHZA 1E3PA 3RT3B 3KLSX 1SRUA 2AUKA 4A3IG 4LFCL 1WTPA 1YIJA 3P7JA 1L0XB 2K8CA 1N8RC 1HR0Q 4WJWA 3PZ8A 3NSWA 3ZNID 1FNWA 2DZIA 4ILWA 1G6ZA 3ND9A 3B6YA 2BS2B 5JVG3 3G71A 2X69A 3LJ3A 1RTOA 2BVCA 1NAPA 1HJPA 2JSOA 4J3OD 1ONLA 2K05A 3HOWH 2MJ8A 3MTSA 4IPCA 4B3RQ 1A8VA 3VVWB 1J5EL 4FBJB 1AW7A 3W5VB 1ZP0B 1F1HA 4LF6L 1EQQA 2B63B 3H3VI 3CSTA 2J4XA 4XQJA 1LT6D 4KDIC 4ANWA 1VQMA 1VQ9A 2HHHQ 4LFBL 1J7BA 2WDRB 5FO8B 1Y1VH 4A3GB 1DYQA 3R66C 2EYJA 5CORA 5C4JH 1FCCC 2G1EA 1BDOA 2KTRB 2DZMA 4JI6Q 2ZJDA 3IAM1 4BKSD 1L4ZB 3F2UA 1SIFA 3NQTA 2OEDA 3ONSA 3TIXA 1V1PA 3V60A 3KOJA 1EYDA 2G9HD 1NBFC 1GUSA 5LLIA 5HKHA 3C19A 4WURA 2MP2A 1QB5D 4JX1C 4EZJA 1N63A 4QQBX 4CDCC 4OIJA 2UWQA 2CW0D 1UE1A 4JI5L 1XMQL 4YTMB 1FRRA 1R4MB 2KTFA 2KENA 1HTOA 1PMRA 2H4OA 2LFNA 4B3MQ 3QOLA 2IDYA 4NAMA 1VQ7A 5HHDG 2GBRA 2HQLA 4K8JA 2XBBC 4K2LA 3PCOB 2EVBA 5BO4B 4CBVA 4DV0Q 1XPRA 1UZXB 2B3GA 1K83B 4ZHOA 4NPNA 1M4VA 1I94L 4FLHA 2RDBC 4C2MH 1MJCA 3ZKJC 3NENA 5ELFA 4X66L 5C6AA 3ULPA 4OO1H 4A3CG 3M7GA 1OO9B 1TWFB 2QSDA 1Y1VB 2OWOA 4A3GH 4BKGA 1XWEA 5C4JB 1UWXA 2ZVOA 1WZ0A 2BPSA 1IBLQ 2L52A 1N61A 4XDDA 1SDFA 2NVYH 3APCA 4HVBA 2ZVNA 1J8CA 2YTXA 2NPTB 1YNND 3FRPB 3J81i 3W5OA 4DBGA 1OTRB 2JA6B 3FKYA 4YIJA 2NWGA 3T53B 5IE8A 2A69C 3TEWA 1Q82C 1GPXA 3N1XC 1OXVA 3Q8CA 4DR3L 2E2HH 5HI1A 1HCZA 3FMCA 4X3KA 4KTAA 3C46A 1A6XA 2NZOA 2DJGC 2IX1A 4TQ0A 3L13A 2G5DA 3CMMB 2M8SA 4FF2A 2WDQB 3VH3B 4ZUIA 3N20C 1VR9A 3S2DB 5CR3A 2H89B 4DAMA 1BBXC 2JA8H 3C3LA 2A73B 1CFMA 5GROA 4ME3A 5AJ3Q 1BUIC 5J39A 2JA7B 3ML8A 2ID0A 2N7JA 4EVOA 5H1SE 1PUTA 1EY5A 3KYCD 3EQLC 2SEBD 2VXWA 1Q5WB 4PS7A 5EKLA 3A55A 3ERQA 3OTOQ 2Q2TA 2YU9H 3SK8A 4A3BG 3M3YB 4M0WB 2QCPX 3NWTA 2HJ8A 1VCIA 1SNCA 2F0HA 2SNMA 1VQCA 2F0KA 3BJUA 1TS5A 1STHA 1V1OA 4NXML 2WB1B 1DOLA 2FCQA 4FXCA 2JA6H 4G57A 4P1BC 4EX5A 3HM6X 2I46A 3A4SC 1Q8KA 2R2OA 4HLEA 2CJOA 3U7DA 3DHHC 3NHEB 2CW0C 4B3SL 2M17A 4FJYA 4LFBQ 4N8X1 4JI6L 2NCNA 2W55A 2N9EB 1UNSA 4PMWA 1WOCA 3QJYA 1BT0A 4WH4A 2FMCA 3NHHA 1TWFH 2A6HD 2L12A 4R4OA 4MM3A 5DM63 2XN9C 4N6EB 3RFZB 1IYFA 2MH7A 4FHJA 4KIKA 4UAIA 2Y0SB 3MA2B 2K75A 2N78A 2IL8A 1PH2A 1XMQQ 4JI5Q 4GMVA 1I5FA 2F1MA 3L7ZC 2HUGA 5C4XH 5DPTA 4JK1C 4KKUA 1XF5L 1D1IA 3APDA 3IVFA 4MJSB 1NI3A 3H15A 4XE0A 4L5QA 2UUAL 2BS4B 2JA7G 1G6PA 3J81L 2F52A 5EPLA 3E0EA 2JVCA 3MC9A 4C1NK 3M63B 5LMNW 1WX8A 2INCC 2VQFL 2IY5B 1W2BA 3S16B 3NVVA 2O6VD 4YWLA 4FXGC 2Q2HA 2A8VA 5DNFA 2DYOA 3UQBA 5ELDA 3ZW3A 3MWYW 4M8AA 1ASYA 3S1MB 4FXDA 5JEAJ 3F2BA 3PUYA 1NNXA 2JXTA 1NYRA 2CQOA 1JB3A 1NCVA 5J3BA 1F2MA 3I8ZA 2JA5G 2LRUA 1UBIA 3OG5A 4TKNA 5C4XG 1Z2MA 3ZVVA 1CMXB 3WOFA 1WGDA 1TKGA 5C3WA 2MP2B 5T1IA 2WU2B 4W9LA 3KLRA 2REXA 1E6EB 3PVLA 4E3CA 3MXNA 3KJPA 2WLBA 1E90A 4TVAB 1HZ6A 5JZEB 2WV6D 5C44G 4K1RB 1I42A 1TIFA 4BA2I 4RKBA 4JLCA 5IIFA 1R7SA 1L1OC 5CBEE 1JMLA 3T1HQ 1D5ZC 4LJZC 2QKIC 1OQYA 3HVZA 3SHQA 4OXPA 4OGQC 3TCAA 3GD7A 3L10B 1WFYA 1MGSA 1EY4A 4R8IA 1MJEA 4RM9A 1QJOA 4QAYA 4ARIA 4TMAB 3DBSA 3AQQA 1SJED 2K5NA 2V4LA 3NOBA 4WWMA 5TR5A 1LM8B 1TVXA 3GTPB 1F9JA 2JXXA 1Y8NB 4GDKA 1R9TH 4JOIC 1K9MC 2AWTA 3K7AB 2KKCA 1KLUD 3Q14C 5E1FA 4ZKBB 3AEBB 2E5LQ 1MIUA 3ZXRA 4C00A 2K03A 1VQOA 2EYLA 1QNKA 2L0FA 2P5ZX 1X9NA 1X1MA 3A56A 1PV4A 3ZUNA 1N33L 3T1YL 3IT6B 4CQNA 4DV2L 3CWIA 2RD0A 5KEEA 4HXDA 4ZLTF 1WXVA 3CCMA 3NTKA 3MXPA 2BS3B 2KMAA 4ZDVA 3W1SA 3TN2A 2JT4B 1UEBA 4GN4B 3AU4A 1YNTE 3OMGA 1EU3A 2IX3A 1QVGA 4GLSC 4P16A 2Z9HA 1P0RA 2C35B 3QX1A 1SEBD 2KBNA 2QCZA 2UYZB 3PUVA 3NXWA 1K52A 5AJ3L 3NUCA 2K6AA 4OELB 2UU7A 4OX9Q 1L1OB 4AQYQ 4LDTD 1S5CD 4A76A 2ZXRA 1E7PB 3HOVG 2XRQD 5I6WA 4NXNQ 1O7ZA 3A4RA 3KVFB 4BBNF 1QE6A 1X54A 2JA5H 3ZXVA 3A8IE 5DPRA 1XT9B 1MHHE 2VQEL 3UF8A 4HPLB 1PDQA 1V1QA 4HN7A 4DV3L 1B44D 1NR2A 2WYQA 4XGAB 2KANA 2ZW1A 2BGFA 1BF4A 2UUAQ 1NDDA 5LNK1 1WRDB 2L15A 3KDFA 4X64L 4F7ZA 3KH0A 4P73A 2MHJA 3QAQA 2N7DA 4C1NI 4IUPA 1U9RA 1TWHB 2KDBA 1PTOD 5KHQA 3E5SA 5MPOA 1EIYB 2FUHB 2PI2E 3HOWG 3DBHI 1RCVD 3ENEA 2F0GA 1G2SA 1MVKA 2IYDB 2M0AA 1YN5A 3PV1A 3TP6A 2UXDQ 1BO0A 2ZCBA 3P42A 2ZJQA 1Y1WB 3CIRB 4GLXA 4DR5L 4F7XA 1RTNA 4G3XB 3P4QB 4NXNL 1UELA 2JN4A 3WOEA 4G50A 2V4DA 3GTPH 1J8IA 2PTLA 1EYCA 2D0OA 2NN6H 4KZCA 4W9CA 4A93G 4C56C 3TUOA 1WM2A 2F0SA 5DCNA 1IUEA 1A0IA 5D94A 1D3ZA 1SE3A 3H0GB 2I5HA 1KAWA 1JC7A 5NUCA 1HTLD 4HDOA 1QILA 2M4NA 1VRAB 2O5JC 3HS0C 2VQFQ 1FXIA 1RF2D 5KGUA 3QCAA 4YTNB 1XTCD 2NVTB 5FLXL 1VQLA 1B3QA 1TQOA 2ONQA 2KHSA 2NBFA 4JBJA 1WSPA 3A9KA 3NZUA 4DDGD 3SU8X 4V0BA 3ZJTA 3RLOA 2HCCA 3ULLA 4ME5A 1OXUA 1Q1BA 1JR0D 1EEFD 5JHAA 1ICWA 1TS2A 1CA6A 1QCBD 2QJLA 2BWES 1CKMA 3HKZG 5IY0A 1SMXA 3GTQB 1ZEQX 1G51A 3J80L 1AYFA 3I5JC 2YEPF 5IYBH 3CQZB 3MEHA 2DZKA 3C0RB 3K57A 4A3JB 2HCIA 4DHJB 2KQSA 1GVPA 3NUHB 2XTIA 3P4PB 3TJPA 1CUKA 3VR6A 4TKOB 2JZZA 3UGBB 4PNYA 1SFOB 2D3BA 4DV2Q 3AE5B 1XMOQ 4QIWE 1SNMA 4DV5L 3IXSA 4UHVA 4HROA 1K0SA 4JBKA 3K9PB 4DU9A 1QF6A 4X62Q 1I6HB 1V5OA 2A68C 2JF5A 2ZPNA 5JPNC 3S1QB 2E3TA 3NY5A 2QF7A 4IFDI 4IQZA 2O5IC 3K5LA 1SNQA 5LL6S 4V190 1L7YA 3CC2A 1CKOA 3U4ZA 2INNE 1SYFA 1EOVA 4GN5A 5M5YH 4XYQA 1PYWD 2WXMA 3FP9A 4K5XA 2MQJA 4JPSA 4H44C 3VR8B 4K5WA 4KGSA 4JW0A 5GAHC 3J7YW 2FIDA 4PYUA 1TWAH 4NMZA 5HGQA 5I9OA 4N8FA 2B63G 3CP0A 1SLJA 4WWPA 1DM0B 2BYFA 5IP7G 4KN4C 4MM3B 5IO9A 3NBIA 2KN5A 4DK0A 2ZT9C 4DV3Q 1X3FA 3VR2A 3X23A 1JE4A 1TWGH 1F2RC 3AV8A 3OPOA 2L3ZA 4X64Q 3NG0A 3WAOA 1EY7A 3DEOA 3DXJC 1MHXA 1FD6A 1YNJC 3DVNU 1ASZA 4AS1A 1IKMA 4ZYNA 2WXOA 3FDTA 2E2IH 3JAMi 1UF0A 4LDTB 4RFBA 2CKHB 3TL5A 2MUYA 4IWOA 3ZJVA 3EHVA 2B3AA 3PO3B 3PF5A 2HDMA 3TEHB 5KNBA 2J0JA 4LCDE 4JI0L 2CVRA 1F52A 3PZDA 5DM73 2KZRA 3D8GA 1K3BC 4ODGA 1NENB 4OWTB 1NBWA 3SDLC 4A3OA 2C7NB 4B9WA 2JEBI 4JOIA 5E3FA 1L2FA 1K53A 3GV3A 3I73A 1D5MC 3IFWB 4CYEA 4G4KA 3A5UA 2DYBA 3EUB2 5GAEC 1CK1A 4W9DA 5EBCA 4PZ6A 4A3EB 3B0AA 1G8ZD 2BKRB 2PVOD 3UE1A 5FJ8H 4HCSA 4YCWA 1XLOA 3AE4B 2EJMA 4JIOU 3Q3MC 4R1JA 1HTPA 2MWSB 1GUAB 2B2YA 1GUWA 2AQ1B 1WJJA 1LYLA 1PVOA 1EL0A 4H13C 1QZEA 1NTGA 2TMPA 4FXKC 2XWBB 1LQBA 1Q0WB 1V97A 3HOZH 5C4ZA 4MEMA 1G291 3AN1A 2K5VA 1P9DU 4J6HA 2KYWA 3GQBA 3HK0A 2A69D 4B0EA 1Z5SB 4DFAA 1JORA 3BK1A 4QCLA 2DUDA 2WXNA 4DR2L 5LL6X 3BYYB 2LEKA 2V3PA 2DHZA 3NBHA 2K28A 1PRTB 4LUZA 2V1CC 3R3MA 3VFKA 4AOFA 1E1TA 1VZ8A 4Q0FA 3BS1A 1LTBD 4R3DA 5JAVA 2GN5A 3LX0A 2WXPA 4BA1I 3T9LA 2K8HA 2BOSA 4DK1A 1TIID 5C1ZA 3K7AH 5LMUQ 3PO3G 2LHDA 4GSWA 2ENBA 4ANVA 2I1KA 2OJRA 2Y5PA 1B7YB 1YNXA 4EGVA 4OWWB 5IODA 2LHEA 4W9IA 3RMKC 2B2WC 4ZRKA 1HE8A 4OHJA 4KDLB 4HEA1 3RNGC 4ZAIA 1YQ4B 1GO3E 1XMOL 2GB1A 2K52A 2B2UC 4LF8Q 2PYKA 1JOQA 2WACA 4A3DH 4M8NA 4KY5A 3TRZA 4XDXA 3G6EA 4C2MB 4KY6A 4A3LG 4GOPB 4KVGB 3AECB 1WYDA 4DK6C 4A90A 3BDOA 1DOYA 1E0ZA 1SNPA 1TWAB 1Y56A 4PT5A 4A55A 3H91A 4DNIA 4IUTA 3KF8B 4KHPQ 1C76A 3T3OA 4A4IA 1WD1A 2KC2A 3L17A 2PO4A 1O7YA 4BAXA 1X65A 3RN5A 2BW2A 1STYA 3KF8A 1HZCA 3BDCA 4E6IA 3F2CA 1I3QB 2FMMA 4DR4L 5DEHA 2DWQA 4JCVE 3KYDD 2N9KA 4BS9A 3A54A 1F9QA 4M02A 2KK8A 1EEID 4RF1A 4YHHL 1EYGA 2KTRA 3SHLA 1TXYA 1WI5A 5KYIA 4K14A 2F4VQ 3PSIA 5T1GA 4YY3L 2JEAI 3BZKA 1J5EQ 2WX0A 4ZRPA 2Q5WD 1PFBA 3J80E 3MP9A 4LF8L 5ISRA 1WD0A 4L2YA 1QG7A 4HJ9A 2X8XX 2PEAA 4M01A 1VQDA 1GUTA 4XQNA 4DR6Q 4GDLB 3GP7A 3P75A 3RMHA 2R7ZB 1GOZA 5FK9C 2C5CA 4IPGA 4APVA 1NSNS 4Q5VA 1VJKA 3SEBA 5J18A 2KDEB 2NTSA 3ITPA 4IPHA 3E9SA 3MAQA 5AZHA 3I3CA 3A9JB 5BMGA 4EFOA 1YN3A 2X6LA 4DGZA 1RLFA 2CHWA 1H9JA 1F9PA 1U4MA 3ZNZB 3L08A 1X3PA 2LVPA 1O7IA 2OTJA 4KKSA 5C5MA 1C8CA 3H1UA 4KN7C 1P3QU 2HTME 1Q8IA 3IT4B 3GV6A 3H0GH 2RF4A 3ZLZA 3GDEA 1E0BA 3SR1A 4LF6Q 4HIMA 4CHTB 3GTMH 1D2BA 1E5WA 5C5LA 3AEVA 3SGIA 1A70A 3RZOH 1KNAA 1ZGUB 4JG2A 5H8YE 4RGOS 1TR5A 4E74A 1NE3A 3HZXA 3HHMA 1NY4A 2OTLA 2HE7A 4NJCA 2BBCA 4P7IA 3W9CB 3PT2B 1SMYC 4G11A 1VQIA 4HSVA 2N4FA 1O80A 4PMCA 1VF7A 3TSSA 5EGTA 4A3MH 1SNDA 4OX9L 1K8AC 4GKJQ 5JJLA 1FFVA 5JVH3 1EQTA 1BXTA 5M5XH 3W5UB 4LF5Q 1FL0A 1PRTF 4K3CA 3KUZA 3RULA 2F03A 2LXKA 2WP8J 1WR1A 3BINA 3EFXD 1RJTA 1IL8A 2MFIA 4A3FB 2VNUD 3VR9B 5LXHA 3BG3A 2FJ2A 1OEYJ 2GBKA 4MZ9A 4LNFA 2E2DC 5M3FH 2C60A 3B2FA 2WX1A 1DOXA 4IZ8A 1FGUA 4DV1L 3NZSA 4PV1C 4BXXG 2E2JH 1QZGA 3PLVA 2K5PA 1P7FA 2JY6A 2KLGA 2VZKB 3WCQA 2JRHA 1YNNC 5FO9B 2FHTA 2LY7A 4F87A 4DR1Q 2BH2A 2JJQA 3CHBD 2X6GA 1MPEA 4HAEA 4XTCS 1WJ6A 1J0GA 4CO7A 4DXFA 4HR7B 3M62B 4C3HG 1GNUA 1EF1A 5HG2A 3LGJA 2UUCL 4ZK9B 1RDPD 4DR5Q 1XX8A 2R92G 1KAAA 3MXUA 4ABNA 3KW5B 4X57B 4DUZQ 5GXGB 3A1QB 2KHJA 1C0AA 2I5MX 3GE3C 2QHOA 1TZOA 2F0EA 2JQOA 1S5ED 2R93G 2BF8B 1JRPA 5IOCA 4JI4Q 1FXAA 4JPBW 4YL8A 1NMFA 2K8BA 3Q8AA 5C2TB 1E9MA 1XPUA 4HIKA 4IN3A 1S72A 4X3UA 4ZRJA 2UXCL 2F0PA 3TEXA 5JXVA 1Z9FA 4K8IA 3I2ZA 2AEHA 3K5NA 4G7OC 2NB0A 3A8JE 3VTVA 2SDFA 2DNEA 3A0JA 3CXCA 1C3TA 3JAMc 2Y5BB 3E3XA 3L9AX 3C2PA 2OQ0A 1ILQA 2FIFA 3H3VC 5FJ8G 1EOTA 1MHWC 4H7BA 4IWQA 2IGDA 4OONA 4PZ8A 4XIGS 1N62A 4HJ7A 4KSKC 3SDZA 3DMUA 1EO6A 3B1LX 1SB3C 3T3NA 4DUZL 2A5HA 1VQPA 2MW5A 3OMCA 2DN8A 3UIPB 2ON8A 1A3UA 3U8ZA 1WZ3A 4FADA 2D2QA 3U2SC 1M90C 3I4NG 1I35A 5M3MH 3TP5A 3PIOA 1ESRA 5IYDH 3CD6A 5ELBA 4I6PA 4E71A 1YBYA 3K6OA 5FKAC 1SAPA 1ZW7A 5C44H 1IXRA 2HHHL 3QR8A 2JWZA 1T6BX 1GHJA 2N1WA 3H3VH 5BR8Q 3JSVA 2FFKB 3ZGZA 1JJ2A 1HR0W 3E9HA 5CV9A 1UGJA 1PZID 1GC6A 1PFSA 2QDLA 2UXBL 2L1AA 1EIHA 2AMCB 2SAKA 1JWSD 2WXIA 1UEAB 3K8AA 5C0XG 3EA6A 1LXDA 1E1OA 1K51A 1IBMQ 5BMHA 2NS5A 2QMTA 3DPDA 3G4SA 1LTRD 2NZHA 4BBRG 2A5UA 1BQQT 1BCPB 5M3MG 4AYBG 3CKIB 4CKCA 2LSSA 1LUZA 1ZPSA 1HNZQ 2TSSA 5C4XB 5BYRA 4S3SA 1EM7A 3VYUA 1Y8PB 4CDFC 4DV1Q 2WS3B 2LVQA 3PZ7A 4G7HC 4PK1A 4DV0L 4KK7A 3VA7A 1IYJB 2F0QA 4KHZA 3NVYA 2YVCA 2CCZA 2F0DA 1DONA 5C3EG 1VDVA 1FNVA 1OXTA 1JROA 1FMAD 1QVFA 3SXHA 1YN4A 3TBLD 1FO4A 4C3IG 1NUCA 3AFQA 3HRZC 4OO1I 3Q8BA 4EZLA 5IYBG 3V62A 1CJEA 2L55A 1DGJA 4LTUA 1BUVT 2JK8A 5IN7A 1JWUD 1UE7A 3HKSA 4ID6A 2KNBA 3ONAB 3I4MB 4IM2A 3CPFA 2E5LL 4XC2A 5K36G 1UWVA 3Q8EA 1PDXA 2FINB 4NDXA 3U52E 5HGTA 2ALYB 1YJ1A 4RGMA 1OFFA 3VDZA 1WGYA 1I4XA 3ETRA 4MGZE 1LTTD 2K01A 2E74C 2KX0A 1KRSA 1BCPC 2BCOA 2F0FA 2K32A 3S1QH 4JWUC 2A19A 4X66Q 2NPTA 1V43A 4OVUA 2I07B 4BBRB 1LABA 2Z6KA 3GTKH 2KAJA 5CC4A 4MH0E 2HIVA 1PGXA 1CHQD 5C0XH 1STAA 2QILA 3IHPC 4GDKB 1JCKB 5JJIA 4AQYL 3GZNI 3R8BA 1XPOA 1RFAA 5AEKB 2R6GA 4QGUA 3SFDB 1XLPA 2JX5A 2LGYA 2WAQE 4A3KG 1SIJA 2PW9A 1ENFA 4RM8A 1GJXA 1SYBA 2B2TA 1DJRD 1IBLL 3S1NB 2LJ5A 3V6CB 2B8FA 4IC7B 2ZPYA 1CI3M 1VQBA 1SBBB 4IJHA 1L6UA 2L0TA 4DR3Q 3RLNA 1YQ3B 1WGGA 3FHWA 2MLBA 3J81E 1IW7D 2EYPA 2F0UA 4QMGA 1I4PA 3VR3A 4B9XA 4DV6L 2A74C 2VH1A 2ACZB 3DQVA 1CZPA 2MO1A 2EY5A 5HY6A 3RCZA 5EQ0A 2A4ZA 3OW2A 1JW9D 3IG3A 4M8MA 1XNRQ 3X0WA 3DVGY 3Q3JA 2Z0DB 4H0LC 1JJGA 3AU7A 1HA6A 4PS8A 4L1BA 3AE9B 3UDGA 2PKOA 1RL2A 1X56A 5CHVC 1TKEA 3VUYA 3NP8A 1XO3A 3K7UC 1C1YB 2BYVE 1TWGB 3MJ5A 2QEJC 5EBDA 4NPSA 2GVBA 3W1BA 2MQHA 3OIPA 3STBD 3L0WB 1GB4A 2K39A 3J7ZC 1MFWA 1Y14B 1Q86C 1HNZL 3MJWA 4WJNA 4DV5Q 2NBUA 4B0MA 2HD3A 3KK7A 4FYDA 1IP9A 1LGRA 1WMHB 1BCPF 5IGDA 2D3AA 3U7ZA 1M8AA 5BR8L 3CCVA 2ZTDA 3P63A 5M5YB 1XLNA 1VS0A 2DBYA 2BA0A 1K50A 2QA4A 1FVIA 1EUVB 2LUMA 2NBWB 3APFA 1MI0A 1CKNB 3RD2A 4L6TB 1Z6HA 1D1KA 3ER0A 3IAS1 4TV3A 3VAWA 3AH7A 2CH4W 1P1AA 3AYHB 2J0KA 1GJZA 1JWBD 5IT9c 4Y52H 1ET6A 3Q3NC 1U4LA 2PW7A 3I55A 4JI3Q 4IFDJ 1V8CA 1N36Q 3CPWA 2L5TA 5D14A 1M1KC 4N58A 3A7AB 5IYCG 2KOLA 2YU9B 1STEA 2L7RA 2WXKA 1RIPA 2XK5B 3S15H 3AU5A 2PZUA 4YWGG 1EY8A 4A3BB 3WIMA 3CCEA 2D2CC 2VRRB 1Q10A 4LLGM 1WGRA 3J80c 1SE9A 2J7QB 2FCSA 1PTOF 2KT7A 2W3SA 1C7YA 3DBHB 2IGHA 2J52A 3E6ZX 5FLMH 4WQMA 2L9HA 1B2TA 3BU2A 3S2DH 2EJFC 2NZ1D 3CCQA 2J0TD 3TDQA 4OZAA 1E8WA 3DHGC 2FNJB 1D8LA 1X3QA 1FJGL 1GKHA 2R61A 3FAHA 1P98A 1UUPA 1F77A 2RSUA 4GLAC 1SR3A 3M3YH 3PQIA 1X6OA 3ML9A 4M00A 5LHY1 5H92C 1TKYA 3ZTCA 4AJWA 4ANXA 2LGDA 3A8KE 1FYCA 4HPMB 5BYQA 2Z6KC 3RPFC 1OGWA 1WCMG 1X55A 5JPMC 3I3TB 2Y0SG 1LT4D 3D4DA 5D6JB 1WRIA 4A93H 4IOAA 3RZFA 2PPBC 1AEXA 1YOVB 1V9PA 4HCPB 3VXWA 3OW7A 5M5WB 1U5KA 4FO2A 2D07B 4LNOA 1EY9A 4FDBA 3TP8A 2YLMA 2DY7A 1ZXTA 3HFZB 2Y3AA 4G0NB 4EUTA 4FHKA 2O2VA 1PTOH 5IT9L 1PH3A 4KI0A 1KLVA 3L54A 4BVUC 1T0YA 5CYUA 1HQMC 1FJGQ 1L6VA 3S2HB 4MJSA 4DR7Q 3R2TA 3X3NA 4HIOA 2KOXA 4X65Q 3R7RA 1VQJA 3CQZH 1I7HA 5D3DA 1R4NB 3NS8A 1LT3D 1YJWA 3SE0A 1LM0A 3FPPA 1EZ8A 2IX0A 3VR5A 1VQKA 3Q8FA 5JJKA 4NNJB 4FF1A 4KV2A 3PMFA 1YQBA 3ICEA 2EY1A 3QARA 1SROA 2AQ3B 5BMIA 3OWEB 1MSGA 2GLSA 2MX2A 1MD2D 4I6LB 1T5EA 4HJAA 4R4QA 3GO5A 1ZDVA 2WXLA 2CWAA 3W1YA 4WWNA 2JE6I 3QK0A 2IHFA 1Z47A 3EECA 5DPWA 1LT5D 4Y7NB 2XGTA 3BWUD 1WH3A 4HMIA 3FILA 2Q8IB 3MC8A 3I72A 2XVSA 1SXTA 2D10A 2KVZA 2WINB 1MSHA 1V1PB 4DK3C 3Q3OC 2OHFA 4JI7L 4IM0A 1XYIA 3L2PA 5A2QL 2R7ZG 1AE2A 3N52A 1N36L 3SK5A 4KHPL 2IO0B 1PH7A 4ICVA 5AUIA 1YVCA 5D65A 1E2ZA 4YT0B 5IKCM 3QJZA 2LZ6A 1UE5A 4H02A 3AXCA 1A2TA 1S3OA 2B2YC 2SOBA 1AWDA 4LJOB 4S0RA 4KGRA 1BBWA 4QL5A 4MDKE 2I2YA 4P2CB 2Q2UA 2JA9A 2LASA 2QDFA 5E6JA 3PSEB 4JI2Q 1SN8A 1S4ZA 3V05A 1OXSC 2KDIA 4A6QA 3DM3A 2GBMA 5FLXE 2RKSA 4A3IH 2JYTA 2F0OA 4ZHPA 2ZEQA 1K73C 1TWCH 4IOCA 4A9AA 4X3TA 4C3JG 3DCGA 1B9RA 1Q46A 3M95A 2DAJA 3AE3B 3QIAA 3PIPA 2YYZA 3VUWA 1GXDC 2RR9A 1EUJA 2AWOA 1E7ZA 2H1EA 2Z4HA 3D32A 4S17A 2AWNA 4UP7A 2N49A 2VB3X 4C7YA 4I65A 3AE2B 3OJ4B 5J17A 4LMQD 4CHKA 3C1EA 1IBML 2JA7H 3F8TA 1ZKHA 2Z0SA 1B70B 3S1NH 1EZ6A 5M3FB 3AFPA 2OJWA 3HOZG 1VF5C 5CTRC 3B9JA 3S9WA 3PIO3 3AM9A 3K81C 2A68D 3WDNA 1ZXHA 2WB1G 4MACA 3T8MA 1WXAA 1OXXK 5EPJA 3I90A 3QB3A 4DXGA 3B08A 1UBQA 2ZM6L 4RA8A 3I56A 4KKTA 1TWHH 3EBEA 5IGEA 2UU9Q 3IKJA 5L37A 2NVQB 1WJNA 3BY4B 3GS2A 2RA4A 1IBKQ 2I38A 3L16A 3V3XA 2F0JA 1WFQA 3K80C 3MZ5A 3K59A 1HUNA 3I57A 1MI2A 1BCPD 5JOBA 4REZA 3I9V1 5EE9A 3GOEA 3RZWC 2UXDL 3AE8B 2LGSA 3KFUA 2KJ6A 1TT2A 3UE0A 2XSCA 2Z1CA 3E56A 2EJGC 1WE6A 4YXDB 2R92H 2RHSB 4IW0A 1EIFA 3RYTA 3CC4A 3U4EG 4LWCA 4J8QA 4FP5D 3ABVB 2IZVB 2JYEA 2C9OA 4IOIE 2LS01 1WTWA 2EPBA 2K33A 5JEAH 2N0SB 3AEEB 2Z4IA 3RNEC 1TS3A 2IWHA 2RVLA 4IURA 4JV5Q 1YNJD 2IT1A 3BDLA 1A2UA 4KMUC 4MTKA 2WKCA 1ENAA 5KYLA 2RGFA 3NTIA 4J6IA 5EAYA 4X62L 5J1ZA 2PW5A 2GBJA 2KEDA 4LNQA 3CSFA 2R93B 1S40A 3VYRA 2UU9L 4HJ5A 2L4NA 3GTJB 3KWLA 2ZZPB 3HOYH 1EWIA 3VRBB 1HQRD 2DJFC 5M3FG 4HK2A 5IP7H 3QC8B 2V0GA 2JUOA 2CKZB 1IW7C 1JQ4A 3CC7A 2BE5C 4DV7Q 1OQRA 3J7AF 2W82A 2LGXA 2O2LD 4DR7L 1JB7A 3HOXB 4JE3B 4BZAA 2K9XA 3F2DA 2KFKA 1O78A 1Y8OB 1TS4A 5AZGA 1TY0A 1EY0A 3QQ8B 1E2WA 1QUQB 3P4RB 4C3HH 2F0TA 3J9CA 4C7ZA 2LXAA 5AZFA 3DOWA 2WXQA 1WTQA 4MTNA 4UDUC 1RRBA 2KN4A 5GAGC 2RHQB 4EQOA 3RI7C 3T4AC 4A3BH 2LRWA 3IFDA 4JI1Q 5C44B 2L8JA 4DXAB 1WF9A 3DHIC 1STNA 5CX3A 2ICEC 5BN5A 3HOYG 4LNNA 3GE8C 2O6VB 3B2GA 4BY1G 1KL9A 3M9BA 1LTID 3Q24A 4A3CH 1XNRL 4LFCQ 2A6ED 4L5RC 5CMDA 2RDGA 1U0LA 1KTKA 1FR3A 3TMEA 3HOUG 1H8CA 4YWMA 3GTQH 2HT1A 2VZKD 3AE7B 2PCFB 4CJ0B 2R7FA 1U4AA 3FEWX 3K9OB 1ZDXA 1KNEA 4MIUA 2AX5A 2E6XA 2K6QA 5E4WC 4QUFA 3RD4A 1JALA 2CHBD 1N34Q 1IGCA 1N60A 2K4KA 3RLFA 4IM3A 1K8GA 1C9FA 1I6HH 1DOIA 3VTWA 1N33Q 4BOZB 2G45B 4LUOA 4F8MA 4NAWA 3ZQ4A 4JI1L 1PH8A 1XCTL 4UY8C 3BVGA 2JQRB 3H7PB 5IYCH 1SE4A 4IFDG 5I4DA 1VMCA 2KWUB 4I6NB 2KCTA 3H0GG 3QOJA 3HUIA 2KVMA 1SYEA 4LNKA 3DEPA 4HTHA 4A3GG 2O6VA 1C77A 1SNOA 2MGSA 3SFEB 1I94Q 1E2VA 2ZXOA 1H9SB 2XWJB 2QGQA 1VQNA 1EWCA 3PS6A 3NQIA 4DDID 5IP4D 1B53A 5L83A 2ICIA 1V86A 4HIDA 3NJTA 5JJZA 4US9A 4IJLA 5BN4A 4EZKA 1V9JA 2RDFA 3VDYA 3HM3A 3H6MA 1R4QB 1Q12A 1JQYD 4RH6A 5M5XB 2GBNA 3U9OA 1KIXA 1QOGA 4MN3A 1IKLA 4KD3A 1HNWQ 5I9PA 2RPQA 1ZYRC 1G2TA 3P4SB 3ZO5B 1SSNA 4MGIE 1WWTA 4MHEA 2BKFA 1YJIA 4N9PA 1PFNA 4B95A 4KGTA 3GTJH 5E6NA 1A62A 4DA2A 1WCMH 2B2UA 2E2JB 5IT9E 5E7NA 1HH2P 4R4IA 4GS3A 3CCLA 1B4OA 5EKKA 2VS1A 2FAZA 3W2DA 2EYOA 1IYUA 2B2WA 1XLQA 3RNBC 1V5TA 2XIWA 3V2TA 1AP0A 1PTOB 4K2KA 1DD2A 1WGHA 3PRPB 3MXGA 3EIVA 4EOYA 2GOWA 1FGBD 4WQOB 2RCFA 4DWFA 1S5BD 2Y0SE 2WNMA 4POGA 1HNXQ 4P75A 1B9NA 3KYHC 3Q69A 4X6AH 3I4OA 5KHOA 4J15A 1E8XA 2KFJA 2KO3A 4EEWA 2MPMA 5L95C 4KSLC 4NB3A 5LMUL 3KQ4A 2B2VC 5IAAC 3V6EB 4DUYQ 2EELA 3JW0X 1AZPA 3OHXC 5COYA 3DVGX 4DV4L 2EMTA 3P1HA 5J2RA 2AQ2B 1YJJA 5FR3A 3PPAA 1NEKB 4OZBA 4D2KA 1VQ6A 1WE7A 2UUBL 5G5GA 2WFWA 3E0JA 4RCNA 3HEJA 1CA5A 3WWVA 5IWAL 3WA0A 1KFYB 5KNCA 1TT5B 3TEZA 4BY1H 3AI5A 3M3JA 2HTHA 2HD5B 1WTVA 2KD0A 2KMMA 3LWEA 5E4XA 1RYJA 1Z7TA 1Q7YC 1TBEA 5D2MB 2EY6A 3OJ3A 1KC8C 1HEZE 2G4DB 1IHZA 2CH4A 4K5VA 2NN6G 1YD8U 2MJ3A 4N9F4 4GOPC 3CCRA 4R4TA 3U9SA 3HVDA 4LFAQ 3PGZA 4GXBA 4W9FA 4YHHQ 2K14A 3PUZA 3U58A 1FM0D 2JYOA 4A3EG 1XJVA 1S1QB 2ZCCA 1PH4A 2JSVX 4GIVA 1N34L 4GZYC 4RWSC 1A63A 4ZQ3A 3RN2A 4O2DA 4RNAA 1PRTC 4CJ1B 4OW0A 4GKKQ 2OT2A 3N9YC 3ZJUA 4M1UB 3OOCA 3NK9A 2WXJA 1FNUA 4A3LH 2KECA 4NY0A 1UE6A 3I91A 3BIID 4C80A 4XDCA 2B2TC 4GDLA 4JBWA 1CHPD 3BZCA 4PQXA 3CMAA 1SSOA 2RPVA 1FD7D 2BH8A 4IG7B 3P2BA 4LF5L 1JT8A 4LK0M 2DLBA 4LAAA 2CHXA 1B8AA 2NN6I 4USAA 3W3AA 2I0QA 1KJTA 3DWMA 1QOHA 1YHQA 2D3GA 4FN2A 2WU5B 2PJHA 4KKIA 1YJNA 2EKEC 1ISNA 1XEEA 2V1YA 2ZW0A 4ZOHC 3RZDH 4PYZA 2IO1B 3Q2AC 4LF9L 1NR4A 2UUBQ 5DAUA 3MHSD 1HFNA 3WAPA 4DV6Q 4MT5A 1E22A 2IHEA 1LLRD 2DYMA 1K8RB 3H94A 4QIWB 4K7UA 4RCOA 3A9KB 5I6YA 3AEDB 3F1ZA 4DR1L 1HHVA 4RAUC 4JWSC 3RNCC 4C3IH 4K6LA 1FRDA 4BBSH 4JVZA 3Q6BA 4IALA 1YJ9A 4CKBA 1SJHD 2ATWA 2OXPA 1HUMA 3CRLC 1VQAA 2C7MB 1MG8A 2CU1A 2D0PA 4RHSA 1VQFA 2KFKB 1KDBA 4RMFA 3ALBA 5FLXc 3H09A 1VQHA 2FUG1 1FXTB 1JICA 2WAQG 4A3EH 4B3ML 2MBHA 4JI4L 2M2LA 4DV4Q 1EFID 3BYTB 2MNAA 1WR6E 3URYA 3MFYA 5JH5C 2E76C 1BVSA 2W54A 3J81c 3NEMA 1XQQA 3AULA 3ZNHB 3T1HL 2RSNA 1PYSB 4GKKL 2N3SA 4QJFA 1WYWB 1I6VC 1N6ZA 2G4SA 2UXCQ 2UUCQ 2QIEB 3S2AA 4KHVA 1AH9A 3DDCB 4ANUA 2UXBQ 2WXFA 4DK5A 2GMIC 3MHBA 2QW7A 3I7FA 1CT1D 2Q8RE 2R7DA 1ZOYB 1B3AA 3HG9A 2NVYB 1TJEA 4B6WA 3CF5A 1PRTD 4OO1G 2BT6A 4B9KA 4C3HB 2PVGC 5CHWA 5GADC 1R4NI 4GOPA 4WJOA 3Q3FA 3PRZA 4ULLA 5CV5A 1YITA 2JP1A 2LJIA 4Q2JA 4F8CB 2WKDA 2PE6B 5M5WH 3FKIB 3IFTA 4FF4A 4OL7A 4KD4A 4B3RL 3RUZA 1IL2A 2MSED 3NRZA 1AE3A 3MFGA 4U673 4BBRH 3V96A 4MNOA 2NMQA 1EQRA 1AZQA 4XX5A 2IJ0A 4CJ2C 2K5HA 3A1QA 1ZUD2 1S5DD 3MHZA 5C4HA 1AFPA 1HTQA 2VH2A 4NW2A 2JA5B 5BYSA 4WFN3 1S3SG 3JAML 4DV7L 3HOVB 2K3UA 1BOSA 3VUXA 2NYZD 1H9RA 1RAXA 4HKZE 4WJPA 1EQVA 1DOMA 4AYBE 1VQEA 3SR6A 4JBMA 4C4VA 3VA5A 4PZ7A 2PIAA 2A6EC 1PFMA 1A3VA 4RG1A 2N1VA 4HDQA 2PQEA 2LMCB 4N9TA 1YHAA 2G3QB 3QHTA 2PE9A 3DVNV 5CV8A 5FLMG 3VYSA 4BY7H 2Z6BA 3KBGA 3CCSA 3DM1A 4W9KA 3S15B 4NQLB 4XYCA 4WJ4A 1Y8RC 1C9OA 5TSSA 1WCMB 4KY7A 3I4NB 5EPKA 4BBNC 3L3OC 1H4RA 1W6JA 2E8GA 2M00A 4B3SQ 1OEYA 2M1MA 3JSVB 4BBSB 4JQWC 5IOIA 3R3OA 3T16A 3R7QA 2GA4B 4LW1A 4AH6A 2BYTA 1T5XD 1WMHA 1GM5A 1N9WA 1YHBA 3KF6A 4O1NA 5C0XI 4G7ZC 4DN4M 3S1MH 5EE0A 3G48A 2ASQA 3WANA 1XXGA 2GRIA 4YSYB 3ULJA 4NZLB 2DZJA 2K25A 2L0CA 2H88B 4R8NA 4WJ3M 3DWGC 3WALA 2RMMA 1L0YB 4A3JH 1VLBA 1KOTA 4PG3A 3DUZA 2E75C 3ZDMC 4AIMA 1SFOH 4FF3A 3J80i 4GN1A 4N59A 3D0FA 2L76A 2RCNA 2HQEA 3UI2A 2B29A 1E10A 2PZWA 3KUCB 4Z9CB 3U4VA 2X38A 1ROEA 5IGFA 3KLWA 1ZYRD 5C3EH 3RR5A 3PO2B 3LDZE 3EN2A 4OZCA 1FIQA 5E6PA 1HA5A 2M0XA 1D7QA 1HPCA 4AQ7A 1XCQL 2JZPA 1WYGA 1P8LA 2L1BA 3SD5A 4ZUJA 1QKZA 5EE3A 3S14H 1T3QA 2KWDA 1EF5A 1T0SC 4MSMB 3T51B 1QUQA 3TMPB 3S24A 1KXLA 2Z8LA 3R2IA 2PNRC 4XYOA 5A35A 2M9VA 4L63B 4GN3B 1HZ5A 3PO0A 3D31A 1RWSA 1FEHA 2L05A 3FKIH 1L0WA 4FJVB 2PNHA 5ELCA 3GTOH 1SYDA 2KJHB 5IP9G 2AL3A 3MTNB 3BVZA 5K5PA 2FBWB 5ELEA 1YX6B 2R2QA 2YV5A 4MGKE 5AUKA 3UIOB 1WI0A 2MEKA 1RFKA 1XTDA 2JA8G 5G5HA 1KD1C 2NVQH 2EE1A 4O42A 1I4QA 4RHRA 3PRMB 2J0MA 4IKGA 4OWXB 1EFWA 4XZ4A 2HDEA 2F0IA 1N32L 2F3VA 1QT9A 2KQ3A 2KHIA 2PI2A 4DNTB 1RM6C 2RDHA 1WM3A 4EQNA 5D7GA 1I4RA
chains in the Genus database with same CATH topology
1H9SA 2IW3A 4DAYA 1KDAA 4CGYB 4C3JB 5CV4A 3MVVA 2PMVA 2XNAC 2EZVA 1NVID 5F2DA 3UI3A 2BA1A 2JXMB 2F3WA 3KBXA 4A93B 2L83A 5A2QE 2EXZA 1EU4A 1AN8A 3G7LA 1KDCA 1QLBB 4HEDA 1Q90A 3ZYYX 1GUOA 4YSXB 1LTGD 3DHQA 1GUNA 3NTHA 1EWYC 3RZDB 3HOZB 4TQ1A 2J42A 1KRHA 2ZXPA 1F9RA 3C1FA 3KLSA 1CQFA 4ITKA 4C3IB 2PZTA 1KH0A 4L8JA 2JWUA 4HMJA 4IDIA 1WTXA 2D62A 1L4DB 2N9LA 3TP7A 1CZGA 1H9KA 1QOAA 3OSOA 2E2HB 3O13A 2PMZB 2EDGA 1FCLA 2EY2A 1LTSD 1BR9A 4EE2A 1WTOA 3AB5A 1EYAA 1FD6A 3S1RB 4AS1A 1B1ZA 4A3IB 3VYTA 3D4WA 5I2XA 1IYVA 4KKJA 1LV9A 4XQQA 2RQXA 2V4IB 4A8XC 5CV7A 4HJGE 3GTOB 2WXGA 2L32A 3R93A 2B39A 3VRAB 4HSPA 3KUPA 2IGGA 2RSOA 2KUMA 3QG1A 2KDMA 5IGCA 2L11A 4U68A 3GB1A 3X3MA 5M3MB 1DXMA 1U4RA 3TEYA 3T13A 1EIGA 2F4IA 5EE1A 2F0NA 4XT3B 4OIKA 1ENCA 3P20A 2WXRA 2D5GA 2EKIA 3K58A 1I50B 3AE1B 3LNNA 1JWAD 3HOYB 1CTMA 3NVWA 4BY1B 2IPKD 1IBXB 1A15A 3LYYA 3TBIB 4XT1B 5K36H 1N5WA 2J7ZA 1VDZA 1ESFA 3GTGB 1C79A 1ZE3D 2NVXB 1HFGA 1IBXA 1IGDA 4BY7B 5JEAG 2A6HC 3SK6A 2LKVA 5HI1A 1C4QA 1ZKOA 1ET9A 1UAPA 3AEFB 3AMZA 4IUQA 1C48A 1TKWB 4WRDA 2KEEA 2R3ZA 4ZRZA 1C4AA 4TSSA 5C3JB 2AUJD 1GHKA 5BN3A 1J9OA 1VMPA 3EROA 3LWUA 4LK1C 4A3MB 2K5QA 2KQ4X 4HRSA 5C3XA 2WQYB 4KJNA 5IGGA 4RF0A 3BVMA 3NS1A 1S5FD 4L23A 1H9MA 5FOBB 1R4PB 3GTMB 4QB4A 4QUCA 3L4PA 3NPPA 1PGAA 1CM9A 2K0PA 4M0WA 5CBAE 2E2IB 1GUGA 2N55A 1QQRA 3PIP3 3PUWA 2JU6X 1D4BA 4NP5A 4X3SA 3FPUB 1TYGB 1OQQA 2K5WA 1VZ7A 3AEGB 2GI9A 2CU3A 3KWVA 1PXUA 4RGNA 4F88A 1C78A 1N5XA 2LMCA 4KX6B 4IUVA 2KACA 1F2ZA 5D3IB 2MJDA 1CQVA 5CGKA 1WXQA 2XRSD 4J1MA 5IGBA 1Y69U 4IFDH 3LXFA 5J22A 1HXYD 2BB5A 3S17B 4DQOC 5KIXA 5KNDA 3I70A 1TWCB 2M56B 4TQUS 3NZ3A 4KJOA 1FFUA 1P7EA 1B50A 1DOKA 3ND8A 3Q23A 1LO5D 1UWMA 1O7LA 2OF1A 4IUNA 3JAME 2KA7A 1VZ6A 1ZXIA 3EVQA 4YSZB 3K5MA 1D6EC 3PUXA 1PFDA 1GB1A 3HP3A 3D3RA 3Q6SA 3OWFA 2Y5CA 5G3LD 1PZJD 4IUUA 4HKQA 3A7LA 3N6RA 3I4LA 2OEOA 3TZDA 3OIQA 4H2AA 3VQIA 4TRDA 1YMHE 1MBYA 1NYQA 3VR4A 3T56B 1GAQB 4K6DA 3DWAA 5CV6A 1I4GA 3SVMA 1W6KA 4XWWA 1TY2A 2QDBA 3Q0AA 1A3TA 1D5XC 1STBA 3BK2A 4P6VF 3K5OA 3NVZA 1II3A 2Q8TA 5HFYA 3DWQA 1F9SA 1PZKD 1QOFA 1I4HA 2BTEA 2B8GA 2K1BA 3G6JB 1Q1EA 1K8OA 5FO7B 3GTKB 1EWHA 1SYCA 2R92B 3H8HA 4CKEA 3D4RA 2RBMA 1PLFA 3QWNA 4ZKCB 1L0VB 4DF7A 3M7NA 4NKLA 2YEPB 2EYHA 3MC0B 1X32A 3DWPA 3AMUA 2WAQB 4R9WA 4ZRQA 1C4CA 4ARCA 1F2LA 1ML0D 3IL8A 4DAPA 2KJXA 1SMYD 5C3EB 1PGBA 4MH8A 3NE5B 2B2VA 1HRJA 3M4OB 3TZUA 5HURA 3PV0A 2EYFA 2JA8B 5EJWA 3C8YA 3S14B 3K0YA 1JWMD 2VB2X 2N88A 3IAYA 1SYGA 3HOUB 2FE8A 1RKNA 3J7AV 3GTLB 2K22A 3P1MA 1TU2B 2MHVA 1J7AA 2EYMA 3FVQA 2PLPA 3EGRA 2K7VA 1F2YA 1RODA 4KV6A 5T8IA 1QNUA 2D9UA 2NTTA 4HCEA 1C4PA 2W3RA 4RKLA 3D6WA 4FNFA 1RHPA 2F0VA 5G3LF 4OVZA 3BZDB 2BDNA 4FVMA 4QF4A 4XXEA 1U4PA 3CRKC 2CJNA 2MJEA 4XWTA 1DCZA 1B9MA 3FILB 2J53A 2F0LA 2K5DA 2EOTA 1LTAD 1JOOA 3HRDD 4YTPB 1DZ1A 1J7CA 2V3NA 2BDOA 4ZYSA 2CQAA 3EJIA 5C0XJ 2K04A 1STGA 1QOBA 1SE2A 4WORA 1F0ZA 2WXHA 1F2RI 4PMBA 2B76B 3HKZB 2DNCA 5KRUA 3D6CA 2M19A 2INPE 2WIIB 1K8MA 1KLGD 1G91A 2F0WA 3QO2A 3HOWB 4BWGB 1V8QA 2F0MA 1CZWA 1WGKA 1PTOC 2MP1A 2D5DA 2NUCA 4A3DB 4B08A 2LGIA 3M85A 1L5PA 2BB6A 3SK4A 5I2YA 4WAFA 1ILPA 2LFIA 1QWYA 4EQPA 3AE6B 4WIPA 3FC4A 4US8A 4NAWB 1WTRA 4I7ZC 1SF0A 1Q3LA 3LB8C 4A3KB 2BE5D 2O4XA 3NWSA 4AYBB 2HDLA 1R9TB 2KCCA 2DY8A 1KABA 1BNZA 5AFWA 4DAVA 3AB9A 3Q22A 1BMLC 2WP9B 4RGTA 3M4YA 3AEAB 1JOKA 1LACA 2G9DA 1KF6B 2SNSA 4DNRB 2VUMB 3RZOB 1RD9D 1EY6A 3HGBA 3CU7A 5M9OA 1ACCA 5EKIA 2WDVB 1WVLA 2KCNA 3KLSX 2AUKA 1WTPA 3P7JA 1L0XB 3PZ8A 4WJWA 3NSWA 1FNWA 4ILWA 1G6ZA 3ND9A 2BS2B 5JVG3 2X69A 1RTOA 1NAPA 2JSOA 4J3OD 1ONLA 2K05A 2MJ8A 3MTSA 1AW7A 3W5VB 1ZP0B 2B63B 2J4XA 4XQJA 1LT6D 1J7BA 2WDRB 5FO8B 4A3GB 1DYQA 2EYJA 5CORA 1FCCC 2G1EA 1BDOA 3IAM1 1L4ZB 3F2UA 3NQTA 2OEDA 1V1PA 1EYDA 2G9HD 1GUSA 4WURA 1QB5D 4JX1C 1N63A 4OIJA 2CW0D 4YTMB 1FRRA 2IDYA 4NAMA 1PMRA 2H4OA 2LFNA 3QOLA 5HHDG 4K8JA 4K2LA 2EVBA 4CBVA 1K83B 4ZHOA 1M4VA 5ELFA 5C6AA 4OO1H 3M7GA 1OO9B 1TWFB 2QSDA 1Y1VB 1XWEA 5C4JB 1UWXA 2L52A 1N61A 4XDDA 1SDFA 1YNND 3FRPB 2JA6B 4YIJA 2NWGA 3T53B 2A69C 3TEWA 1GPXA 1OXVA 3Q8CA 1HCZA 3FMCA 4X3KA 4KTAA 3C46A 1A6XA 4TQ0A 2IX1A 4FF2A 2WDQB 4ZUIA 1VR9A 3S2DB 5CR3A 2H89B 1BBXC 3C3LA 2A73B 1CFMA 1BUIC 5J39A 2JA7B 2ID0A 2N7JA 4EVOA 1PUTA 1EY5A 3EQLC 2SEBD 2VXWA 5EKLA 3A55A 3ERQA 3SK8A 3M3YB 2QCPX 3NWTA 1VCIA 1SNCA 2F0HA 2SNMA 2F0KA 1TS5A 1STHA 1V1OA 2WB1B 1DOLA 4FXCA 4G57A 2I46A 2CJOA 2CW0C 2W55A 1UNSA 4PMWA 3QJYA 4WH4A 2FMCA 3NHHA 2A6HD 2L12A 5DM63 2XN9C 4N6EB 3RFZB 2MH7A 4UAIA 2Y0SB 3MA2B 2IL8A 2F1MA 3L7ZC 2HUGA 4JK1C 4KKUA 1XF5L 1D1IA 1NI3A 4XE0A 2BS4B 3J81L 5EPLA 4C1NK 3S16B 3NVVA 4FXGC 2DYOA 5DNFA 5ELDA 3MWYW 4M8AA 4FXDA 3S1MB 5JEAJ 3PUYA 2JXTA 1NYRA 1JB3A 1NCVA 1F2MA 3I8ZA 3WOFA 2WU2B 1TKGA 5C3WA 5T1IA 3KLRA 1E6EB 3MXNA 2WLBA 1HZ6A 2WV6D 4BA2I 4RKBA 5IIFA 1R7SA 5CBEE 1JMLA 1D5ZC 4LJZC 2QKIC 3HVZA 4OGQC 3GD7A 1MGSA 1EY4A 4R8IA 1QJOA 4ARIA 4TMAB 1SJED 4WWMA 1TVXA 3GTPB 1Y8NB 3K7AB 1KLUD 5E1FA 4ZKBB 3AEBB 2K03A 2EYLA 1QNKA 3A56A 4CQNA 3IT6B 3CWIA 5KEEA 4ZLTF 3NTKA 3MXPA 2BS3B 3W1SA 3TN2A 4GLSC 1YNTE 3OMGA 1EU3A 2IX3A 4P16A 1SEBD 3PUVA 3NXWA 1K52A 3NUCA 2K6AA 1S5CD 2ZXRA 1E7PB 2XRQD 5I6WA 1O7ZA 1QE6A 3A8IE 1MHHE 1PDQA 4HN7A 1B44D 1NR2A 2ZW1A 1BF4A 5LNK1 4C1NI 4IUPA 1U9RA 1TWHB 1PTOD 3E5SA 5MPOA 1RCVD 2F0GA 1G2SA 1MVKA 2M0AA 1YN5A 3TP6A 1BO0A 3P42A 1Y1WB 3CIRB 4F7XA 1RTNA 3P4QB 3WOEA 2V4DA 1J8IA 2PTLA 1EYCA 2NN6H 4C56C 3TUOA 2F0SA 1IUEA 1SE3A 3H0GB 5NUCA 1JC7A 1HTLD 1QILA 1VRAB 2O5JC 3HS0C 1FXIA 4YTNB 1RF2D 5KGUA 1XTCD 2NVTB 5FLXL 1TQOA 2ONQA 2KHSA 2NBFA 1WSPA 3ZJTA 4V0BA 2HCCA 4ME5A 1OXUA 1Q1BA 1JR0D 1EEFD 1ICWA 1TS2A 1CA6A 1QCBD 2QJLA 1AYFA 3GTQB 1ZEQX 3J80L 2YEPF 3CQZB 3MEHA 3K57A 4A3JB 2HCIA 3NUHB 3P4PB 3VR6A 4TKOB 4PNYA 1SFOB 3AE5B 1SNMA 3IXSA 4HROA 1QF6A 4DU9A 1I6HB 2A68C 5JPNC 3S1QB 2E3TA 2QF7A 4IFDI 4IQZA 2O5IC 3K5LA 1SNQA 5LL6S 4V190 2INNE 1SYFA 4XYQA 1PYWD 2WXMA 4JPSA 4K5XA 4H44C 3VR8B 4K5WA 4KGSA 3J7YW 4NMZA 5I9OA 1DM0B 4KN4C 4MM3B 3NBIA 4DK0A 2ZT9C 3VR2A 1JE4A 1F2RC 3AV8A 3OPOA 1EY7A 3DEOA 3DXJC 1MHXA 1YNJC 1IKMA 2WXOA 3FDTA 4RFBA 2MUYA 3ZJVA 3PO3B 2HDMA 5KNBA 2CVRA 5DM73 3D8GA 4ODGA 1NENB 4B9WA 2JEBI 5E3FA 1K53A 3GV3A 3I73A 1D5MC 4G4KA 3EUB2 1CK1A 5EBCA 4A3EB 1G8ZD 2PVOD 4HCSA 1XLOA 3AE4B 2EJMA 1HTPA 2B2YA 1GUWA 2AQ1B 1EL0A 4H13C 2TMPA 4FXKC 2XWBB 1V97A 5C4ZA 1G291 3AN1A 4J6HA 3GQBA 2A69D 4B0EA 4DFAA 1JORA 3BK1A 4QCLA 2WXNA 5LL6X 3BYYB 2LEKA 2V3PA 3NBHA 2K28A 1PRTB 1VZ8A 4Q0FA 3BS1A 1LTBD 4R3DA 5JAVA 3LX0A 2WXPA 4BA1I 2BOSA 4DK1A 1TIID 2LHDA 2ENBA 2Y5PA 4EGVA 2LHEA 5IODA 2B2WC 4OHJA 4HEA1 4ZAIA 1YQ4B 2GB1A 2B2UC 2PYKA 1JOQA 2WACA 4KY5A 4XDXA 4C2MB 4KY6A 4A90A 1E0ZA 1DOYA 3AECB 3BDOA 1SNPA 1TWAB 1Y56A 4PT5A 4A55A 3H91A 1C76A 4IUTA 3T3OA 1WD1A 2PO4A 1O7YA 2BW2A 1STYA 3KF8A 3BDCA 4E6IA 1I3QB 2FMMA 5DEHA 2DWQA 2N9KA 4BS9A 3A54A 1F9QA 1EEID 4RF1A 3SHLA 5KYIA 4K14A 5T1GA 2JEAI 4ZRPA 2Q5WD 1PFBA 3J80E 3MP9A 5ISRA 1WD0A 4L2YA 1QG7A 4XQNA 1GUTA 4GDLB 3GP7A 3P75A 3RMHA 2R7ZB 1GOZA 5FK9C 2C5CA 1NSNS 4Q5VA 1VJKA 3SEBA 2NTSA 3ITPA 3E9SA 3MAQA 3I3CA 5BMGA 1YN3A 2X6LA 4DGZA 1H9JA 1F9PA 1U4MA 1X3PA 4KKSA 5C5MA 1C8CA 4KN7C 2HTME 1Q8IA 3IT4B 3GV6A 1E0BA 3SR1A 4CHTB 1D2BA 5C5LA 1A70A 1KNAA 5H8YE 4RGOS 1TR5A 3HZXA 4NJCA 2BBCA 3W9CB 1SMYC 4HSVA 1O80A 4PMCA 1VF7A 3TSSA 5EGTA 1FFVA 1SNDA 5JVH3 1EQTA 1BXTA 3W5UB 1PRTF 2F03A 2WP8J 3EFXD 1RJTA 1IL8A 4A3FB 2VNUD 3VR9B 3BG3A 2FJ2A 2E2DC 3B2FA 1DOXA 4IZ8A 4PV1C 2K5PA 1P7FA 2VZKB 3WCQA 1YNNC 5FO9B 2FHTA 2LY7A 4F87A 3CHBD 2X6GA 1MPEA 4HAEA 4XTCS 4DXFA 4HR7B 4C3HG 5HG2A 4ZK9B 1RDPD 1XX8A 1KAAA 3MXUA 4ABNA 5GXGB 1TZOA 2F0EA 1S5ED 1JRPA 5IOCA 1FXAA 3Q8AA 5C2TB 1E9MA 4IN3A 4X3UA 3TEXA 5JXVA 2F0PA 4K8IA 3K5NA 4G7OC 2NB0A 3A8JE 2SDFA 2DNEA 3L9AX 3C2PA 1ILQA 3H3VC 1EOTA 4H7BA 2IGDA 1N62A 4XIGS 3T3NA 3SDZA 3DMUA 1SB3C 2A5HA 3OMCA 2DN8A 2ON8A 1A3UA 3U2SC 3TP5A 1ESRA 5ELBA 3K6OA 5FKAC 1SAPA 1T6BX 1GHJA 2FFKB 3ZGZA 5CV9A 1UGJA 1PZID 2L1AA 1EIHA 2SAKA 1JWSD 2WXIA 1UEAB 5C0XG 3EA6A 1K51A 5BMHA 2QMTA 1LTRD 1BQQT 1BCPB 3CKIB 4CKCA 1ZPSA 5C4XB 2TSSA 5BYRA 4S3SA 1EM7A 3VYUA 1Y8PB 2WS3B 3PZ7A 4G7HC 4KK7A 3VA7A 2F0QA 4KHZA 3NVYA 2F0DA 1DONA 1VDVA 1FNVA 1OXTA 1JROA 1FMAD 3SXHA 1YN4A 1FO4A 4C3IG 1NUCA 3HRZC 4OO1I 3Q8BA 1CJEA 2L55A 1DGJA 4LTUA 1BUVT 1JWUD 4ID6A 3ONAB 3I4MB 5K36G 3Q8EA 1PDXA 2FINB 4NDXA 3U52E 5HGTA 4RGMA 1OFFA 1I4XA 3ETRA 1LTTD 2K01A 2E74C 2BCOA 1BCPC 2F0FA 2K32A 4JWUC 1V43A 2I07B 4BBRB 1LABA 2KAJA 5CC4A 1PGXA 4GDKB 1CHQD 5C0XH 1STAA 2QILA 1JCKB 3R8BA 2R6GA 3SFDB 1XLPA 2JX5A 1SIJA 2PW9A 1ENFA 1GJXA 1SYBA 2B2TA 1DJRD 3S1NB 2B8FA 1CI3M 1SBBB 1L6UA 1YQ3B 3J81E 4QMGA 3VR3A 1IW7D 2EYPA 1I4PA 2F0UA 4B9XA 2A74C 2ACZB 1CZPA 2EY5A 5EQ0A 1JW9D 4H0LC 3AU7A 1HA6A 4L1BA 3AE9B 2PKOA 1TKEA 3NP8A 1XO3A 3MJ5A 1TWGB 2QEJC 5EBDA 1GB4A 3OIPA 4B0MA 3KK7A 4FYDA 1BCPF 5IGDA 3U7ZA 1M8AA 3P63A 5M5YB 1XLNA 2DBYA 2BA0A 1K50A 2LUMA 1MI0A 4L6TB 1Z6HA 1D1KA 3IAS1 3AH7A 1JWBD 1ET6A 1U4LA 2PW7A 4IFDJ 1V8CA 2L5TA 5D14A 4N58A 3A7AB 2KOLA 2YU9B 1STEA 2WXKA 2PZUA 4YWGG 1EY8A 4A3BB 2D2CC 1Q10A 4LLGM 1PTOF 2W3SA 2IGHA 2J52A 3E6ZX 4WQMA 2L9HA 1B2TA 2EJFC 2NZ1D 2J0TD 3TDQA 4OZAA 1X3QA 3FAHA 2R61A 1UUPA 1F77A 5H92C 5LHY1 1TKYA 3A8KE 1FYCA 5BYQA 3RPFC 5JPMC 1LT4D 3D4DA 1WRIA 2PPBC 1AEXA 3OW7A 5M5WB 4FO2A 1EY9A 3TP8A 2DY7A 1ZXTA 2Y3AA 1PTOH 5IT9L 4KI0A 5CYUA 1HQMC 1L6VA 3S2HB 3R2TA 3X3NA 1I7HA 5D3DA 1LT3D 3SE0A 3FPPA 1EZ8A 2IX0A 3VR5A 3Q8FA 4FF1A 3PMFA 2EY1A 5BMIA 2AQ3B 3OWEB 1MSGA 1MD2D 1T5EA 2WXLA 1ZDVA 3GO5A 2JE6I 1Z47A 1LT5D 4Y7NB 3BWUD 4HMIA 3FILA 2Q8IB 3I72A 2XVSA 1SXTA 2WINB 1MSHA 1V1PB 2OHFA 1XYIA 5A2QL 3N52A 3SK5A 5AUIA 5D65A 1E2ZA 4YT0B 1A2TA 2B2YC 1AWDA 2SOBA 4KGRA 2I2YA 4P2CB 5E6JA 1S4ZA 3V05A 1OXSC 4A6QA 5FLXE 2RKSA 2JYTA 4ZHPA 2F0OA 4A9AA 4X3TA 4C3JG 1B9RA 3AE3B 3QIAA 2YYZA 1GXDC 2AWOA 2H1EA 2Z4HA 2AWNA 2VB3X 4C7YA 4I65A 3AE2B 4LMQD 3C1EA 1EZ6A 5M3FB 1VF5C 3B9JA 3S9WA 3PIO3 3AM9A 2A68D 3WDNA 1ZXHA 4MACA 1OXXK 5EPJA 3I90A 3QB3A 4DXGA 4RA8A 4KKTA 5IGEA 3IKJA 2NVQB 3GS2A 3V3XA 2RA4A 2I38A 2F0JA 3MZ5A 3K59A 1HUNA 3I57A 1MI2A 1BCPD 5JOBA 4REZA 3I9V1 5EE9A 3AE8B 1TT2A 2XSCA 2Z1CA 3E56A 2EJGC 4YXDB 3U4EG 3ABVB 4J8QA 4FP5D 2JYEA 2C9OA 4IOIE 2LS01 1WTWA 2EPBA 2K33A 5JEAH 2N0SB 3AEEB 2Z4IA 1TS3A 2IWHA 2RVLA 4IURA 1YNJD 2IT1A 3BDLA 1A2UA 4KMUC 5KYLA 2WKCA 1ENAA 3NTIA 5J1ZA 2PW5A 2KEDA 2R93B 3VYRA 2L4NA 3GTJB 3KWLA 3VRBB 1HQRD 2V0GA 1IW7C 1JQ4A 2BE5C 1OQRA 3J7AF 2W82A 2O2LD 3HOXB 4JE3B 2K9XA 1O78A 1Y8OB 1TS4A 1TY0A 1EY0A 1E2WA 3P4RB 3J9CA 2F0TA 4C7ZA 2WXQA 1WTQA 4UDUC 2KN4A 4EQOA 3T4AC 3IFDA 5C44B 1STNA 2ICEC 5BN5A 3B2GA 1LTID 3Q24A 2A6ED 5CMDA 2RDGA 3TMEA 1KTKA 1FR3A 2VZKD 3AE7B 2PCFB 4CJ0B 3FEWX 1ZDXA 1KNEA 4MIUA 2AX5A 2E6XA 5E4WC 4QUFA 3RD4A 1JALA 2CHBD 1N60A 1IGCA 3RLFA 1C9FA 1DOIA 4F8MA 3ZQ4A 1XCTL 2JQRB 3BVGA 1SE4A 4IFDG 5I4DA 1VMCA 3QOJA 3HUIA 2KVMA 1SYEA 3DEPA 4HTHA 1C77A 1SNOA 2MGSA 3SFEB 1E2VA 2ZXOA 1H9SB 2XWJB 1EWCA 3NQIA 1B53A 2ICIA 5JJZA 4US9A 5BN4A 2RDFA 3H6MA 1R4QB 1Q12A 1JQYD 4RH6A 5M5XB 3U9OA 1QOGA 4MN3A 1IKLA 4KD3A 5I9PA 1ZYRC 1G2TA 3P4SB 1SSNA 1WWTA 4MHEA 1YJIA 4N9PA 1PFNA 4KGTA 4DA2A 2B2UA 2E2JB 5IT9E 1B4OA 5EKKA 3W2DA 2EYOA 1IYUA 2B2WA 1XLQA 2XIWA 3V2TA 1AP0A 1PTOB 4K2KA 1DD2A 3MXGA 1FGBD 1S5BD 2WNMA 1B9NA 3Q69A 2MPMA 3KQ4A 2B2VC 2EELA 1AZPA 3OHXC 5COYA 3P1HA 2AQ2B 1YJJA 5FR3A 1NEKB 4OZBA 4D2KA 5G5GA 3E0JA 4RCNA 3HEJA 1CA5A 1KFYB 5KNCA 3TEZA 1WTVA 2KMMA 3LWEA 5E4XA 1RYJA 1Z7TA 2EY6A 1HEZE 1IHZA 4K5VA 2NN6G 2MJ3A 3HVDA 3U9SA 3PUZA 1FM0D 2JYOA 2JSVX 4GZYC 4RWSC 4ZQ3A 4RNAA 1PRTC 4CJ1B 4OW0A 2OT2A 3N9YC 3ZJUA 4M1UB 3OOCA 3NK9A 2WXJA 1FNUA 2KECA 3I91A 3BIID 4C80A 4XDCA 2B2TC 4JBWA 1CHPD 4PQXA 1SSOA 2RPVA 1FD7D 4LK0M 2DLBA 4LAAA 2NN6I 4USAA 3W3AA 3DWMA 1QOHA 2WU5B 4KKIA 2ZW0A 1XEEA 4ZOHC 1NR4A 5DAUA 1HFNA 4MT5A 1LLRD 2DYMA 3H94A 4QIWB 4RCOA 5I6YA 3AEDB 1HHVA 4RAUC 4JWSC 1FRDA 4K6LA 4IALA 4CKBA 1SJHD 2OXPA 1HUMA 3CRLC 4RHSA 1KDBA 3H09A 2FUG1 1JICA 2M2LA 1EFID 3BYTB 3URYA 3MFYA 2E76C 2W54A 2RSNA 1I6VC 2QIEB 4KHVA 2WXFA 3MHBA 1CT1D 2Q8RE 1ZOYB 1B3AA 3HG9A 2NVYB 1TJEA 1PRTD 4OO1G 2BT6A 4C3HB 2PVGC 4ULLA 5CV5A 2JP1A 2LJIA 4Q2JA 2WKDA 3FKIB 3IFTA 4FF4A 4OL7A 4KD4A 3RUZA 3NRZA 3MFGA 4U673 3V96A 2NMQA 1AZQA 2IJ0A 4CJ2C 1ZUD2 1S5DD 3MHZA 5C4HA 1AFPA 4NW2A 2JA5B 5BYSA 4WFN3 3JAML 3HOVB 2K3UA 1BOSA 2NYZD 1H9RA 4HKZE 1EQVA 1DOMA 3SR6A 3VA5A 2PIAA 2A6EC 1PFMA 1A3VA 2PQEA 2LMCB 4N9TA 5CV8A 3VYSA 3KBGA 3DM1A 3S15B 5TSSA 1WCMB 4KY7A 3I4NB 5EPKA 3L3OC 1W6JA 2M00A 4BBSB 3R3OA 3T16A 2GA4B 2BYTA 1T5XD 4G7ZC 4O1NA 5C0XI 4DN4M 5EE0A 1XXGA 2GRIA 4YSYB 4NZLB 2L0CA 2H88B 4R8NA 3DWGC 2RMMA 1L0YB