1TS5A

I140t mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQTHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
molecule tags Toxin
source organism Staphylococcus aureus
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts5A01
2NTSA 2R61A 1BCPF 1FNVA 1LLRD 3R2TA 1FNWA 1KTKA 1LT6D 3R2IA 1EWCA 1JWSD 1G8ZD 2QILA 5ELCA 1MD2D 1PRTB 1BCPD 1XTCD 1ESFA 1LTRD 2AQ2B 3CHBD 1D5ZC 1BXTA 1SE4A 1PTOC 1TY2A 3TSSA 1V1OA 3O13A 5TSSA 1I4RA 2XNAC 1LT4D 1SEBD 4RGTA 1FNUA 2AQ3B 1JWUD 3DWAA 1PRTC 4K6LA 1I4HA 1ET9A 1SXTA 1LTGD 1TY0A 3V05A 1S5BD 1LT3D 1PZKD 1TS5A 3KLSX 5FK9C 2J4XA 3MFGA 4UDUC 5FKAC 3DWPA 2SEBD 2XN9C 1AW7A 1D6EC 3BZDB 1GOZA 1S5ED 4L63B 3EA6A 1TS2A 3BYTB 1F77A 4RCOA 1PRTD 2Z8LA 4RGOS 1TS4A 1TS3A 1B44D 1ENFA 1EFID 1PRTF 2RDGA 1FD7D 1LO5D 1KLGD 3SEBA 4ZYSA 2IPKD 2G9HD 1V1PB 5ELFA 1FGBD 4OHJA 1M4VA 1SE3A 3BYYB 1DJRD 2AQ1B 1B1ZA 1L0XB 3DWQA 4RH6A 4C56C 1S5FD 1SJHD 5D3DA 1KLUD 1ET6A 1JQYD 1EEID 1RCVD 1CHQD 2NTTA 1PTOF 2O2LD 1T5XD 1I4GA 1L0YB 2TSSA 1D5MC 1XXGA 1YN5A 1JCKB 3URYA 1CQVA 1UUPA 2QEJC 3BVZA 1PZJD 3R8BA 1CT1D 1SBBB 1LTAD 5D3IB 1S5CD 1EU3A 1RD9D 4DXFA 1LTTD 1EU4A 1HTLD 1PYWD 1LT5D 1CK1A 3BVGA 4L6TB 1RDPD 1I4PA 1YN4A 3GP7A 4RGNA 3BVMA 5I4DA 4RHRA 1JR0D 1QILA 4RHSA 3OWEB 1HXYD 2WV6D 1EEFD 1V1PA 1D5XC 1UNSA 1BCPB 2ICIA 1I4QA 1BCPC 1AN8A 2RDHA 1LTSD 1HQRD 3MC0B 1HA5A 1PTOD 1DYQA 2XRQD 1JWMD 1PZID 1PTOH 1CHPD 1YN3A 1LTBD 3EFXD 2XRSD 4BWGB 1S5DD 4DXGA 5ELBA 1SE2A 4Z9CB 1I4XA 1LTID 1STEA 4TSSA 1SJED 4O1NA 4RFBA 4NZLB 3W2DA 2IJ0A 4RGMA 5ELEA 5ELDA 2CHBD 1RF2D 1PTOB
chains in the Genus database with same CATH superfamily
2R93G 3AE4B 2KTRB 4EX5A 3IT6B 3S16B 2V4IB 4DAVA 5IE8A 2J42A 1IW7D 2K05A 1WTXA 1ESFA 1LTRD 1VQ8A 1FXTB 5CV7A 1JMCA 1BXTA 1PH5A 3NUCA 4PNYA 3X3MA 5LL6X 3P1MA 3I8ZA 2KX0A 1WGYA 2V9HA 3AEDB 4NKLA 1JWUD 2RA4A 4IUMB 2BB6A 2QIEB 3NTHA 1ENCA 1LTGD 1TY0A 4O2DA 4U68A 5G3LD 4HJ9A 4KZ0A 1EY8A 4FF3A 3RT3B 3RLOA 3PGZA 5FK9C 1JWAD 1RYJA 5GQOA 1SLJA 1SB3C 3ZQ4A 2SEBD 1TXYA 1ZKOA 3QIJA 4H02A 3RN9C 4W9IA 1GG3A 1QZEA 4QMGA 5KHQA 4RA8A 4BBNF 2KCTA 1GVPA 1LV9A 3DM1A 1BMLC 4MT5A 3I4LA 3QA8A 1D1IA 3RYTA 5IP9H 3D0FA 4LF6L 4LNIA 1WIAA 3MHZA 1C3TA 4AYBE 4G7HC 4DAYA 3S24A 3MXNB 5GAGC 2CFMA 1V9JA 2VZAA 2PVOD 2K6QA 1NEKB 4GKKL 4ARIA 4ZYSA 4A3EB 2QC8A 3HOZB 2GN5A 2KEDA 5GAHC 2Z0EB 2PQEA 1SE3A 1TGZB 3CSFA 1DM0B 1MJCA 3ULLA 5CV4A 2M17A 2A5UA 3K9PB 1BOSA 1EY5A 3DM3A 2D3GA 4LFCQ 1EEID 3DHIC 3Q69A 4WJNA 1KQSA 4Q0FA 2PE9A 3PV1A 3QR8A 4MACA 1I4GA 2KVMA 2MLBA 4KIKB 3WIMA 2YV5A 2TMPA 1EF5A 4HCEA 1ZXHA 1JCKB 2KOLA 4CDEC 4OWWB 1JOQA 1IGDA 3PZ7A 2YTVA 2K04A 1N33L 4IKGA 4ZUJA 2ZTDA 1CT1D 3GDEA 4MTNA 4GU2A 1FCLA 1WGGA 5IP7H 1I7HA 4KN4C 4LMQD 2A19A 3HKSA 3E9IA 2KZRA 2WX0A 3A9KB 3G7LA 4OEMB 1QOFA 1PH1A 2HQLA 1OFFA 4II2B 2BYEA 1QB5D 1GNUA 4XWWA 1M94A 2JXXA 3SK4A 3HRZC 1WI5A 3PIP3 2K8HA 2JRHA 1E3PA 2VQEL 4NXML 1FFUA 2WB1B 4NJ6A 1C9OA 2KCNA 4AP4C 1EIFA 3PO2G 3PS6A 2F0VA 1UNSA 3L13A 3OJ4B 4M0WB 3P7JA 5IYCG 3EQLC 1X9NA 3J7AF 4UY8C 2PJHA 5T8IA 3SK8A 2AX5A 4DV6Q 1GC6A 4K7UA 2LFNA 1R9TH 1AH9A 4JI2Q 1CKNA 2WHIA 1TZ1A 1K50A 2EMTA 1FXAA 1K8RB 5IYCH 2DBYA 3F8TA 2N8NA 3J81i 5L37A 2O4XA 3KQ4A 3N1XC 1VMCA 5CTRC 1NCVA 4P1CC 3VR2A 3DVGX 1CM9A 1MPEA 2YTXA 2IDYA 2F3WA 4A9AA 2IBIB 3FEWX 3AMZA 4ZHOA 5HKHA 3H0GG 3E9SA 3ZNID 2A6HD 4CDCC 4P71A 1BCPF 2Z4IA 3H7SA 2BYVE 2MCNB 2K6DB 1UEBA 2D3BA 1QG7A 1UH6A 2W9NA 1H95A 3HOWG 1WYWB 4W9JA 2WNMA 5AEKB 2GVAA 2F0WA 5ELOA 4A3DH 3AE7B 4PYZA 2BWES 1TVXA 1EOVA 3O13A 1BNZA 4PT5A 4DK5A 2XNAC 2OHFA 4GOCA 1B8AA 4L5TA 1PFDA 1NJIC 2UU7A 4CJ0B 3FILA 1EY0A 4KY6A 3OHXC 4LJZC 4WJ3M 4MGKE 1HE8A 1LYLA 1DOXA 2IY1B 1GB4A 4DR7Q 2INPE 3DBSA 4OIKA 2JA5B 3OWFA 1V80A 1VQNA 3AFPA 5DPWA 4AJWA 1E2WA 1KXLA 1KD1C 1IL2A 4PYUA 1C9FA 2QGQA 4GKKQ 2ASQA 3C19A 4POFA 4IWQA 5G2NA 3IFTA 3VH4B 1Q8KA 1S5ED 1C78A 5M3MB 2EDGA 4F88A 1J8IA 1AEXA 2A6EC 1HZ9A 3QJYA 3HRDD 4BY1B 4LFCL 4RGOS 4LF9Q 2RPVA 5CBAE 3GTLH 3ZLZA 1WH3A 4QGUA 1K8OA 1SE8A 1H9SB 2EE1A 2Z6BA 2YU9H 1HNWQ 4MSQB 5FR6A 1K0RA 3GTKB 1E6EB 2DUDA 3RLNA 3NG0A 4N8X1 3L3OC 4RWSC 4WFN3 1SFOB 4FVMA 1Z9FA 4GKJQ 3DXJC 4LJPB 4PZ6A 1K83H 3P4SB 5A2QL 1RCVD 1A62A 1KDAA 5IT9L 2NTTA 1YX5B 2C60A 1FJGQ 2JA8G 1J8CA 3K81C 1T5XD 1WXAA 4P6VF 1PH4A 3S14B 1WXMA 1UE6A 1YN5A 4FYDA 2JVCA 5DLQE 3GE8C 3QIAA 1UF0A 5CV9A 1F9RA 2WXOA 1EIGA 3R8BA 2G4SA 3JVZX 1NE3A 2NCNA 2NBVB 1NAPA 4UP9A 4URKA 4CJ1B 1SBBB 5C3JB 2OTJA 1EWYC 3L4PA 4G7ZC 2V0GA 1FR3A 1EO6A 4L6TB 2RD0A 3KJPA 3U4VA 1WGRA 1L4ZB 5ISRA 3NBHB 2EKIA 3P4RB 3GP7A 3MXNA 4OWTB 3J9CA 1NI3A 1J7AA 1R9TB 2WGSA 3S1RB 1JC7A 2N7EA 1ZKHA 2JPHA 5C4JH 5JVG3 4RNAA 4NPNA 3SHLA 4X3KA 2FE8A 3TZDA 1WY8A 3VDYA 1T6BX 2NR2A 3DQVA 3WA0A 3OYYA 1E90A 2MJEA 2F0DA 3BZKA 1WJUA 5C3WA 1RKNA 1D8LA 1WGHA 4JPSA 1EIHA 2MGSA 4JI4Q 1WVLA 4DK6C 3NVVA 4FHKA 5JJIA 1RAXA 5KIXA 4L8JA 4B3RL 3MEHA 5FR3A 2WXFA 3RZWC 3W2DA 2K8BA 2V4LA 3T1HQ 4K1RB 1PTOB 4BOZB 3LXFA 1VDVA 2L15A 5IA7A 2VW9A 1CKOA 4EOYA 3KH0A 1J6QA 2N88A 2BS3B 4LJOB 4DBGA 1QT9A 3AE9B 2MQJA 1JWSD 5CGKA 2Z9HA 5ELCA 3PF4A 4LDTD 5GROA 3HOWH 2IYDB 3UE0A 1WD1A 1QOHA 3TSSA 3PRPB 4JBMA 1V1OA 2KBNA 2BTEA 1QF6A 1AWDA 4JBWA 2Z4HA 4GB9A 2LVPA 1S3OA 4PG3A 3UF8A 3DEPA 5D65A 2WKDA 3ZVVA 3V2TA 2JA9A 1ET9A 1WXVA 5I2XA 3AEGB 1SNCA 1CKNB 1BVSA 3HOYB 2J4XA 4HR7B 2CQOA 5F2DA 4N9PA 2OJWA 1AW7A 1TJEA 2B3AA 2FJ2A 1EL0A 3NVZA 3W3AA 2WXPA 2IWHA 3DHGC 2JRIB 5C0XI 3FPUB 4L63B 2CKHB 2EJFC 2EJMA 1VQEA 4KMUC 1HR0W 3L10B 2HE7A 3ALBA 3BWUD 3TDQA 3K7AB 3U7DA 4JGHB 2C7NB 2K1FA 3MAQA 2F0QA 1L5PA 1QQRA 2B2WC 2WP9B 5E6JA 3PUWA 4LW1A 3V3XA 2MRPA 4AOFA 4X62Q 3OTOL 2HDMA 5HG2A 4ANUA 4J6HA 1F1HA 2JZZA 1WTHA 1BUVT 2MP2A 1XX8A 4QB4A 2BH8A 1WXSA 2CQAA 4B3SQ 2OOBB 3CCUA 3EIVA 1T0SC 1CZGA 2VB3X 1NR4A 4JK1C 3RUZA 1DZ1A 4DUYL 1QKZA 2O2LD 2WXRA 2JZ3B 4JI1Q 2L4NA 4HIKA 1Y14B 2I5LX 1ROEA 1RFKA 2WB1E 1TWHH 2AL6A 5BYSA 1NYQA 1XF5L 2K0PA 2YEPB 3GS2A 1MHXA 4XDDA 1K8AC 1XJVA 3U7ZA 4L2YA 3EUB2 1KJTA 3AE3B 1GC7A 2KMCA 3Q23A 2RCFA 4EVOA 1GUWA 1W6JA 2RSNA 1F2RC 1MFWA 4YTPB 3PUZA 2EYFA 3M4OB 3GTJB 2D62A 3C8YA 2MUYA 1PQSA 2KAJA 3TMEA 1G2TA 1S40A 1YNJD 1UZXB 4IOIE 4B95A 4LF7Q 1SIFA 3AB5A 3CAMA 4RHSA 3WWVA 2PZUA 4LF5Q 1UWXA 1WE7A 5JEAJ 2NVYH 3RZDB 3PRMB 3K5OA 2AUKA 4GZYC 1WTOA 1MVKA 4YTNB 1BUIC 4BKSA 3N32A 4BZAA 1BCPC 1PDXA 1F9SA 3I3TB 5J2RA 3U58A 4GOPA 4MNOA 2QA4A 3NRZA 1K9MC 1DYQA 4A3MB 4DR3Q 4KTAA 5IP9G 3L2PA 1TKYA 3DHQA 2C9WB 4P74A 4CHKA 3NELA 1EY6A 4DR1L 2ALYB 4A3IH 4LF8Q 2E3TA 4BS9A 2CHWA 1Q10A 2NN6G 2GLSA 5EKLA 4OZBA 3IAYA 2G3QB 2KJHB 3NOBA 5IN7A 1VCIA 1N32Q 3SFEB 2KHWB 2BB5A 2BCOA 4AH6A 4CYEA 2M56B 3ZTDA 2F0UA 3CC4A 3OPOA 3LX0A 4B9WA 3HOVH 3HOYG 3M62B 1HEZE 1LT6D 3R2IA 1YZ6A 1EWCA 3HZXA 4QY7A 3R7RA 4EE2A 1JE5A 4I7AA 2Y5PA 3PZ8A 3DCGA 1E7ZA 1WOCA 1QNKA 3A74A 3GTMB 4G7OC 1WX7A 4EQNA 2PNHA 1ENAA 2ZTEA 1T9HA 3HGBA 4KSKC 2JYOA 2AWNA 3I2ZA 1AZPA 2KJ6A 1V8QA 3KUZA 4LCDE 2KTFA 1A2TA 1PRTC 1GUTA 4K6LA 5CYUA 2KWDA 3RD4A 3CW2C 2QDFA 4W9HA 1R4NI 1TS5A 4B3TQ 4JI0Q 4GN4B 2YYZA 3APDA 1GB1A 2WINB 2IZVB 2LGXA 4OO1G 4A3JG 3HIZA 3A5ZB 3JAMi 4F8CB 2BDOA 2XGTA 3MA2B 4EQ5A 5FO8B 2NBWB 1Y69U 5BYQA 3CD6A 3PSEB 1QWYA 4B3SL 1IBXA 3B1LX 2BE5D 1HZAA 1AE2A 4A3JH 2CCZA 5AJ3Q 2KN5A 4ASWC 3GTOB 3ZRFA 1FXIA 1YEZA 4KD3A 5GAEC 2B2UA 4DV5L 3NK9A 2KVRA 4ICUA 4MM3A 1XPOA 3A54A 1JB3A 4JIOU 4RM9A 1X3GA 2NZOA 1K51A 1FGBD 3L54A 3AU5A 4KHPL 4RH6A 1HCZA 2LS01 1Q81C 4M1UB 1N62A 4DNRB 2A4ZA 2WLBA 5IYBG 3CF6E 4FA6A 5D3DA 4BBRH 1HTPA 1SNPA 3LYYA 4MGYE 1DONA 1N63A 1HZCA 3L9AX 4Y7NB 1FL0A 1KAWA 4NXMQ 2HTHA 1UUPA 1GO3E 1LTLA 4A3KG 3NTIA 4JCVE 1N5XA 2DY7A 3SE0A 2CH4W 2B39A 1DGJA 2ATWA 1WI0A 1DOKA 5BN3A 5C23A 2HIVA 1VQBA 5D3IB 2N0SB 4M00A 3HOUG 3F2DA 2JA7H 1KOTA 2EY6A 1V97A 1E2ZA 4GIVA 1HTLD 1E8YA 1BBXC 3VUXA 2GI9A 3PRZA 3P4PB 2NUCA 1WJJA 2ASBA 1NUCA 2G45B 4BOSC 3I4NG 1EUVB 2BYFA 4PMWA 2H1EA 1IZ6A 1FRDA 2F0PA 1D2BA 2CJNA 2JA6H 2KT7A 4OIJA 3CMEA 4ZHPA 1IUEA 4B3ML 4DXAB 2NVYB 3RZDH 4ALPA 3BDCA 4HEDA 1PTOD 3PO3B 2I1KA 2HQEA 3I73A 2C7MB 2D3AA 2R7ZG 1YOVB 4B6WA 3EFXD 2V3PA 4C4VB 1VQKA 3ZJYC 5AFWA 2EMSA 4A3IG 3AQQA 2ZTCA 3H7PB 4LF4Q 2F0MA 3SXHA 2NN6H 4HCNB 5LL6S 5A2QE 2XK5B 2YU9B 1MSGA 1X6OA 2D0OA 1RF2D 4C3IG 4OXPA 3IHPC 3GV6A 4HPLB 4W9DA 3EHVA 5IGEA 4FJYA 3Q6SA 3JAML 4NAWB 1CSQA 2VNUD 2JA7G 2F0TA 1Y1WH 2J0MA 1FEHA 2MP1A 4WWPA 3WCQA 4L5SA 2FIFA 1H9SA 2DYOA 1WRIA 4YY3Q 1I6HH 4POGA 5C5MA 3U50C 4UHVA 1SE4A 3UI2A 1HR0L 3A5UA 4LNFA 5IP7G 1WE6A 4ZRZA 4A8XC 4IM2A 3VTUA 4IPHA 4PZ7A 2MBEA 3PLVA 3QQ8B 1JOOA 1FFVA 2LJ5A 1F2RI 2RHQB 1H4RA 2LSSA 4JV5L 1F2LA 1EUJA 3TS0A 1H9KA 3KYDD 1G291 1PZKD 3Q3NC 4I6PA 3G6EA 1N34L 2MBBB 2WXHA 2EJGC 3CPWA 4DAPA 1VQOA 2IX1A 1FM0D 2HJ8A 1ICWA 4EFOA 1XD3B 3BYTB 1EYGA 3UDXA 4R4CA 1PFSA 4G57A 1TZOA 4JYAQ 4I7ZC 2UUBL 5IOIA 2W54A 2L3ZA 3T53B 4J1MA 2NVTH 1JMLA 1EFID 1TWFH 1SYFA 1V5OA 2ZM6L 1QUQA 1RLFA 2EY2A 4ILWA 1SE9A 1UE1A 1YMHE 5G5GA 3ZDMC 1ML0D 2JF5A 2B63H 4IFDI 2MO0A 3DWQA 2IGDA 3DBHI 1KNAA 1SJHD 5FJ8H 1PFNA 2GBKA 2PQAA 3DBRB 2KQSA 3PLUA 4A3EG 1OO9B 1U9RA 5H92C 2DAFA 2F03A 1SYCA 1KC8C 3DWMA 5BR8L 3OIPA 4OONA 3ML9A 1X65A 4BA2I 3N30A 3AECB 1LM8B 3BIID 2RQXA 2D11A 3UIOB 4XDCA 3HOWB 1V81A 4GLVB 1Q0WB 3UDIA 4C7ZA 1FPYA 1K8GA 2JA6B 2E2HH 1JT8A 2CHZA 2X38A 1CK1A 4N9TA 1T5EA 4IOCA 1O7LA 3BU2A 3HKZG 1A70A 4KVGB 3VRAB 2JU6X 3RZFA 1JJGA 1JWBD 3Q8CA 3EVQA 4HJGE 4HMJA 4PMBA 1WMHB 2N7JA 2KDIA 4XTCS 4A20A 1V49A 2JT4B 1E1TA 2ZXOA 2KWCA 2V3SA 1TQOA 3PCOB 2KANA 1AN8A 2ZVOA 4IUNA 2J52A 4H0LC 1NTGA 1FGUA 1YI2A 1PZID 3KBGA 3CPFA 1VQLA 3MXUA 3DMUA 1XQQA 2PVGC 3GOEA 5JPNC 5JJKA 3OAWA 3A1QA 1A3UA 2WXNA 1C76A 1VQ9A 2RF4A 2Y0SE 3HOXH 3N1ZC 4RF1A 2PEAA 3HKZE 2E2IB 2A1AA 1D5ZC 3IBEA 1YIWA 2O5IC 1YIJA 2R61A 1V9PA 1PGBA 2Q2HA 4V0BA 3EJIA 2HHHL 2UYZB 3U9SA 4WJOA 1JJ2A 1JJCB 1O7IA 2F0GA 5CV6A 5DEHA 2JA7B 2B76B 4HCSA 2LEKA 2NBUA 3VTVA 1DOLA 1MD2D 3KLWA 2BQQA 2K9XA 4G3XB 2OWOA 3SR6A 3WOFA 3ERSX 2AQ2B 4TKOB 3W1YA 4IOAA 4A3FG 2EY1A 2WXIA 3VR9B 4RKLA 1Q12A 3PF5A 2BOSA 1WF9A 1A5RA 3S1MB 5GADC 2AQ3B 4HN7A 1YNTE 2WAQB 4QIWB 3GTPH 2L83A 1LT3D 2E74C 1N33Q 3NUHB 4JX1C 5C44G 3TQYA 1IBKL 4DR4Q 1L1OC 4KV2A 2DZKA 2NVTB 3NHHA 4NPSA 3NTKA 3JAME 2MW5A 1F9PA 4S3SA 1P0RA 2N9PC 4R8IA 4GNXB 3MHSD 5D6JB 4QUCA 1HA6A 2M9VA 1A63A 2GRIA 1IBLL 2A73B 5A35A 2X6GA 2L8JA 2PE6B 3W5UB 1F77A 4JI3L 2YEPF 4FF2A 2DZIA 2KUMA 2F4IA 4KY5A 4KGTA 4W9GA 2K5NA 2L1BA 3Q6BA 2KDFB 3S17H 4DN4M 1TS3A 3I90A 3QB3A 2KFKA 5C5LA 3PIPA 1IBKQ 1Q82C 2JYEA 1UBIA 2M2LA 3AEFB 3SEBA 2N9LA 4M8NA 2E6XA 4PV1C 4OHJA 2KTRA 1UAPA 2PCFB 3MP9A 3VDZA 3H3VC 2MSED 1J9OA 2A5HA 1VDZA 3RPFC 1PH7A 3AV8A 3N1YC 1JQYD 4RMFA 1L0VB 4KKJA 1VMPA 1DD2A 2EZVA 2O2VA 1IYFA 4BKSD 4EZLA 1KRTA 1QOBA 3CCEA 2BW2A 2V3NA 1E0ZA 1D5MC 1KNEA 1TIID 2RR9A 4N58A 3F2UA 1HR0Q 5JJZA 3DEOA 4UAIA 3BVZA 5BMGA 4ACFA 2I5MX 1OXUA 4CKEA 4DGZA 2N9EB 2RPQA 2Z59B 4K7WA 4KX6B 4IDIA 3JAMc 5EPJA 2KDEB 1YNJC 1RD9D 4CKBA 5KNBA 4DR7L 1OGWA 1C7YA 3GQBA 3AU7A 3MXGA 2BA1A 2VQFQ 1PUTA 4M01A 3V60A 4RGNA 5I4DA 1L7YA 1V2YA 3UI3A 4JPBW 2L00B 4BBSG 4IPCA 4IUTA 2KQ7A 4CDDC 2G1EA 1QJOA 1HXYD 4I6NB 2G5DA 4A3BG 4M8AA 4AWJA 1ZXTA 2EYPA 2Y3AA 4HAEA 4QF4A 2IO1B 2ICIA 3APCA 3TBLD 1I4QA 4XYQA 2AKWB 4YHHQ 1QVFA 3AYHB 4F7ZA 2LZ6A 2JX5A 1OQYA 2FUHB 4OVZA 1J5EQ 3EROA 2WFWA 1FCCC 1K53A 2I1JA 2K22A 4BBNC 1HPCA 4A3KB 1VLBA 3G6JB 5IIFA 5AZHA 1S5DD 2MHJA 4IZ8A 1B9MA 4FHJA 2FHTA 1PYBA 1CMXB 5JJLA 1TWAB 3S2DH 2QCZA 3VTWA 5HFYA 3ERQA 5IGBA 1E5WA 2WXQA 1SJED 4KHVA 2V4DA 3NEMA 4LNOA 1A2UA 1IBML 2UUAQ 1F9QA 2FMMA 3R93A 1VQMA 2MJ8A 1SGHA 1K83B 4KY7A 1ASZA 3RNEC 2N1VA 2PPBC 1ZXIA 3STBD 1N9WA 2D07B 2LASA 1STBA 4KD4A 2H4OA 1JE4A 1X3EA 3RN5A 3I3CA 4NJCA 1BCPD 4P1BC 5EGTA 2FXQA 2F4VQ 4A6QA 1NMGA 1UE5A 4A90A 4PZ8A 4TQ0A 4RGTA 5EKKA 4Y7NH 3P20A 2Z6KC 5C1ZA 2FINB 1MBYA 2E2JH 1R4NB 2JWUA 3KWVA 3LJ3A 2OXPA 2RDFA 3V05A 2B3GA 1YQ4B 3FVQA 2ACZB 4XT1B 2XIWA 3MFGA 5C44H 5C44B 5K36G 2M8SA 4JW0A 1MSHA 2BDNA 1X3QA 4LNNA 3HS0C 5M5WB 4W9CA 3VUYA 4KJOA 3AFQA 4R9WA 2R6GA 3T16A 5EJWA 5BR8Q 3MEFA 1OXTA 4TQUS 5M5WH 5FO9B 5FLXc 2INNE 2HDEA 3AE5B 4GS3A 5AUIA 2N7DA 1GUSA 4MDKE 2F0LA 1L4DB 2VUMG 2KMMA 2K32A 2KLGA 2Y5BB 5BMHA 5KNCA 2IPKD 5M3MH 3ONAB 4DPGA 4W9EA 5DPRA 3SR1A 1SNQA 2HD3A 5T1IA 3NS8A 4NB3A 1KABA 1XTDA 4K5WA 2AQ1B 3H0GH 1HTQA 4MHEA 2E8GA 4EZJA 4X6AH 3J7A5 3VR4A 4ZRPA 2L7RA 3I70A 2I0QA 5LMNW 1K0SA 2O6VA 1R4MB 3CMAA 1PGXA 1WCMH 3GO5A 5CX3A 1IYUA 4OELB 4KLKA 1RJTA 3Q8EA 4B3MQ 3VR5A 2BWFA 2D9UA 2JSVX 4WURA 5HGQA 2K52A 1WTPA 3AH7A 4HROA 1LABA 2L12A 3VA5A 2L1AA 1RODA 3CRLC 4TVAB 2KO3A 3DUZA 2L9HA 4DR2L 4IW0A 1MGSA 2JUOA 3MXPA 2PMZB 3M4PA 2KACA 5I6WA 1E8ZA 4HEA1 2C9OA 4JV5Q 1I5FA 4YWKA 4A3DG 3JSVB 1U4MA 3F2CA 1RRBA 4DR1Q 2ZW0A 3QHTA 2K33A 4HTHA 4BY7H 3HKZB 2J7QB 1U4LA 4K8IA 3QJZA 5D2MB 4A3GB 2K5DA 1I94Q 3TJPA 3TEYA 3AEVA 2W55A 2MX2A 4E3CA 1RHPA 4FNFA 4DK0A 3RR5A 4NNJB 3KDFB 3IG3A 4NAMA 1EQTA 2XRQD 3NVWA 3CP0A 2D0PA 1CHPD 4OWXB 5CC4A 3KYCD 2P5ZX 2LXJA 4MSMB 2X69A 2XVSA 4X57B 2RBMA 5E6PA 4O1NA 4H44C 1OQQA 3NENA 4NXNL 1G6PA 1ZP0B 1H9RA 2VRRB 4F87A 1B53A 3I63C 1ICFB 1YNNC 4X65Q 4D2KA 1E7VA 2K5HA 5M5XH 2KDMA 4OZAA 1FNVA 3KFUA 3N9YC 2FCSA 1HFGA 5E1FA 1WGKA 4NP5A 1JW9D 3SU8X 1Y1WG 4JI8Q 5LNK1 1TWHB 4JC0A 5C0XJ 4ZKBB 2AYOB 3IXSA 3Q8FA 3VHTC 2RSOA 2MO1A 3Q3FA 1IYVA 2KWUB 2F3VA 1PTOC 3WOEA 1RWSA 3EGRA 3A56A 4DR3L 2IGGA 1Q1EA 2RMMA 2C5LC 3AEEB 1LT4D 4HRSA 3TREA 5M5YH 4DUYQ 3MVVA 2A74C 3OSOA 4US8A 2KQ4X 1U5KA 1OTCA 4OO1I 4FADA 4MELA 1SXTA 4A3PA 2K1BA 4PS3A 1CFMA 2JY6A 3JW0X 5GMVA 2E2JB 3MWYW 3PREA 1XWEA 2PI2A 4LUOA 2Q8RE 2F0JA 4FO2A 1D6EC 4A3OA 1VQHA 1XNRL 2L05A 3EA6A 3PMFA 1B3QA 1K28A 1M8AA 1KRHA 4DV2Q 3QK0A 3S2HH 3I55A 1EOTA 2KDBA 4NW2A 3BDOA 3JYUA 3ZNGC 1ZOYB 1U4RA 4A3LH 2WU5B 2G9DA 2JQOA 2KXJA 1F2MA 4G4KA 3HEJA 3E6ZX 4XIGS 1BT0A 4FLHA 2KCMA 5CORA 1B3AA 3GTKH 2BS4B 3DWGC 4F1SA 4DV0L 2VZKB 1N32L 3X23A 2B63G 3DBRI 2CHXA 1L0XB 2B2UC 1ZDVA 4XGAB 5IWAQ 1IPGA 1Q5WB 2WXJA 2JA5H 3VR6A 4YSYB 1NY4A 4CBVA 4R1JA 5HURA 1X3FA 4K6DA 3FKIH 2NS5A 4II3B 3H1UA 2MHVA 4FJVB 1WCMG 5BYRA 4KGSA 1HUMA 5EDSA 3BDLA 2ZPNA 1SSOA 1DOMA 4RAUC 2N55A 3TP7A 3ZDTA 5C4XH 1T3QA 4JWSC 4IQZA 2UXBQ 3X0WA 2NVXH 1EM7A 4FXCA 1KF6B 4ABNA 3GTPB 3SDZA 1EF1A 2PZWA 3QOLA 1XPUA 3K5LA 5M3FG 4IC7B 4HKQA 1E7UA 1HH2P 4WWOA 3AE2B 2LMCA 5EE9A 2K25A 1L0WA 1A3VA 2QDLA 1VQ7A 4PK1A 4DV7L 4FF4A 1WJNA 2DAJA 1EY9A 1CA6A 3RZOH 2JP1A 4XXEA 3MZ5A 3VYUA 5K5PA 3UE1A 2WQYB 3LDZE 1GHJA 4EKUA 4C2MB 2EY5A 2VY3A 1XPRA 1YITA 4HDOA 1SYBA 2K28A 3KVFB 3ZIMA 2FIDA 1GPXA 4PQXA 4GDKA 3S1NH 1FRRA 2D5GA 3BJUA 3A9JB 1M1KC 2DHZA 4C2MH 1UD7A 4TQ1A 1C79A 3SDLC 2XEWA 3K9OB 4LK0M 3I4NB 4DUZQ 2ZXPA 1BKBA 4UP7A 1V6EA 5C4JB 5FLXE 4B9KA 4Z9CB 2R93H 3QWNA 4ZDVA 4FXKC 2KFKB 1P7EA 4H7BA 2UWQA 4GNXA 3ULPA 1KH0A 2NN6I 3GB1A 1QUQB 2K4KA 5JEAH 2CHBD 1Q90A 4IUVA 1FIQA 2UXCQ 1WTRA 4BBRB 2BBCA 2N1WA 3OW7A 3CKIB 1TWFB 4YWLA 1TKGA 1X32A 1G6JA 5JEAG 1BO0A 1H9JA 1WCMB 1G8ZD 2QEXA 1P7FA 1F2ZA 2HIXA 4PMCA 4JI1L 3PHWB 4FF1A 3EBEA 3CHBD 4GN3B 2A68C 1TY2A 2WACA 3VYRA 3HHMA 1I4RA 2BVCA 5E7NA 2LMCB 3PV0A 4YWMA 5HGTA 5DPSA 3FHWA 2I46A 1XNQL 4O0AA 4ITKA 2QCPX 4Q5VA 1A8VA 5J22A 2L76A 4UDUC 1P3QU 3AM9A 1C1YB 2LRWA 2M1MA 3I91A 1HNWL 3D3RA 1PH8A 2OTLA 1XEEA 1SIJA 2B29A 3KOJA 4BBSH 1YQBA 3S15B 3A4SC 1WWTA 4K14A 4AQ7A 5L95C 3RLFA 2X8XX 2N3SA 2OEOA 3UDFA 1EQRA 3NBIA 2CW0D 2BPSA 4BBSB 1TS4A 2L52A 2Q5WD 3NHEB 2BYTA 1WTWA 5LXHA 1B44D 1ENFA 4DR5Q 3D4DA 3QX1A 4HDQA 3S2AA 3ZJVA 3L0WB 1BDOA 1GKHA 2GBMA 3H09A 1B9NA 4GN5A 3ZKJC 2N9XA 1YQ3B 1ONLA 4ZRJA 4FDBA 4IG7B 4B0MA 1YBYA 3OLMD 2EYJA 2VH1A 5EKIA 4BBRG 3CQZH 3CQZB 2UUCL 2K75A 3Q8AA 3S1QB 4R4QA 4CDFC 3KDFA 1STYA 2JA8H 4B0EA 1WM3A 2LGYA 3TEZA 2CWPA 4FULA 3WAPA 1RTNA 1XMOQ 3BY4B 1IP9A 2FMCA 4LNQA 1XMQL 1P8LA 4K3BA 2WU2B 1E0BA 2XSCA 2M00A 1GUOA 3FMCA 5IAAC 5KYIA 4QUFA 5E4XA 2KJRA 3RZOB 1E8XA 1PH3A 1I3QB 1L2NA 2VB2X 3RUIB 4K8JA 3NZ3A 3V61A 1NSNS 3CXCA 4JE3B 1N36Q 2LHDA 1YX6B 2R92B 2GB1A 4IM0A 4EGVA 3KUPA 3I4NH 3H3VI 4US9A 5CBEE 4YXDB 2UU9L 1EEFD 1V1PA 2N49A 4WORA 4A3MG 1C8CA 2JA6G 1A3TA 1JROA 4LWCA 1Q1BA 5H1SE 3HG9A 2J53A 4WWMA 1WFYA 2LY7A 3JC66 1IW7C 4MM3B 1WTVA 4X66L 2OQKA 1II3A 4A3MH 5D7GA 4IUQA 3C46A 4DAMA 3KLSA 4LF5L 1G51A 2C5CA 2SAKA 3F1ZA 4N6EB 4HJ5A 3GZNI 3SD5A 1GD7A 4DV4Q 3M4OH 4ZRIA 4OL7A 3M7GA 4ULLA 1U4AA 2Y5CA 1XCTL 1VZ7A 3PPAA 2IHFA 4DK1A 3TEHB 1J0GA 3R66C 3P42A 4HVBA 4PS8A 5FJ8G 3R2TA 1KTKA 3SVMA 4LTUA 4ZUIA 2PPHA 2Q2IA 5BMIA 3GTGB 2UXDQ 1TBEA 3AEBB 1PRTB 5E6OA 2K7VA 1PGAA 3OW2A 3J7ZC 3WALA 2REXA 2O6VB 1GXDC 3ZXVA 2MNAA 3R3MA 2KC1A 2MP2B 2B2WA 1K3BC 5IYBH 2LI5A 4B9XA 3DOWA 2KK8A 2E5LL 3D32A 5KEEA 1N8RC 1QOAA 1ZE3D 2CU1A 2INCC 2SNSA 2E2HB 2D2QA 1RM6C 1B4OA 4LLGM 4GLAC 4X64L 4IURA 5FKAC 4A3BH 2JK8A 2XN9C 2F0FA 2VQEQ 1PA6A 4GDLB 3MJWA 3NBHA 3BZDB 2WAQG 1NYRA 1Z5SB 2OEDA 3PUVA 2L55A 4O42A 3U52E 1Y1WB 1VF7A 3B0AA 4TUUA 5IYDG 1XO3A 3GTMH 3VQIA 4EQOA 1O7ZA 5M5XB 3SHQA 3T9LA 4S0RA 1KLGD 2N4FA 2EPBA 2QKIC 2FCMA 2MA9B 3UQBA 2CW0C 1TT2A 1WFQA 1HTOA 2HD5B 3HM3A 1ESRA 4X3SA 1WJ4A 2GA4B 1KDCA 4DR6L 5TR5A 4U673 1MI2A 3SK6A 1B1ZA 1VQGA 3M4YA 2CVRA 4HIOA 3GTOH 1Y8PB 2EYMA 2PYKA 5I9OA 1SNDA 4JI7L 2NWGA 2R7FA 2QHOA 2FBWB 2WIIB 3Q14C 1CUKA 2R92G 3ZNZB 1C48A 1SRUA 1TU2B 2WP8J 1UBQA 1WZ3A 2KX3A 4WJQA 1TWAH 2F0EA 4XC2A 4KKIA 4G0NB 3FP9A 4XDXA 3URYA 1LM0A 2WKCA 3PZDA 1VQDA 3TEWA 1D4BA 2QEJC 4JBJA 1XYIA 1MJDA 3FKIG 2E5LQ 4KHPQ 1NI2A 3RNGC 1CA5A 3Q8DA 4H13C 2NVQH 1IXRA 1SF0A 3Q2AC 3WANA 2KD0A 1YJWA 1XLNA 4XQNA 4DWFA 3VUWA 2UXDL 3A7AB 1PYWD 1LT5D 2PNRC 4ODGA 1OTRB 3T51B 2W3RA 5M5YB 4JOIA 5AUKA 1ILQA 1F52A 4OZCA 1QILA 3X3NA 3OWEB 2WDTB 3PO0A 4TKNA 1E9MA 5JZEB 4DV5Q 3HP3A 3U4EG 1SAPA 2EOTA 3ML8A 4N59A 3PUXA 2AEHA 4CKCA 1ZGUB 4ZKCB 2HDLA 3BK2A 1Y1VH 1Y1VB 1KLVA 1VQAA 4KV6A 1I50H 1STHA 4RG1A 1OXSC 2DNCA 5KYLA 1A15A 1WM2A 2RDBC 1YJNA 4XT3B 4OVUA 3W5OA 4PS7A 3IKJA 3NWSA 2F0KA 4WJWA 1B70B 4DA2A 3A8KE 1Y8RC 4OVVA 4HIMA 1L6UA 2WDRB 5HI1A 4X62L 3OTOQ 1K3RA 5I2YA 1L1OA 3C1FA 4DR6Q 1R7SA 3ZNHB 1I4XA 4HJKA 4RMAA 3NZUA 4TSSA 2UUCQ 4K2KA 2MJDA 4IN3A 4NZLB 2ZT9C 2BKFA 4NQLB 5M3FB 4W9KA 2WXMA 3G71A 4WRDA 3I4MB 4XQQA 4M02A 3H8HA 4WH4A 2GOWA 3H0GB 3ETRA 2JA5G 1LLRD 1AFPA 1WR6E 4HXDA 3QCAA 2J0JA 4CO7A 1AYFA 1IYJB 3J81j 4LFAL 2D10A 2EKEC 4P72A 4E74A 3FKIB 3H94A 1VS0A 1ZDXA 4FN2A 1VJKA 1TYGB 4UPAA 3BS1A 1J5EL 3Q22A 1EFWA 2Y0SG 5CHFA 2FUG1 1X3PA 1NR2A 2Z1CA 4R3DA 5JPMC 3V6EB 3K8AA 4BXXG 2UXBL 1PH2A 1OEYA 4G11A 4DHJB 4M0WA 3DPDA 3DWAA 1Q8IA 1QZGA 3W1SC 2LXAA 3MFYA 3S1RH 1N36L 2NVUI 3CIRB 3PSIA 3AB9A 3KLSX 3L0OA 4FBJB 3RMKC 3TEXA 4BY7G 2ZNVC 3A1QB 4JOIC 3TIXA 1ACCA 4Y52H 2KEEA 4BY1H 4FJZA 3TS2A 1T0QC 1IHZA 2NZ1D 2EXDA 2MJ3A 1EY7A 3A9KA 3T4AC 2ZJQA 3KW5B 1R4MI 4NAWA 2MQHA 4BY1G 4P16A 3WAOA 3B6YA 3DDCB 3H6MA 1JALA 5MPOA 3IFDA 3ITPA 4IO9A 3O65B 3K0YA 1WD0A 4A93G 3L7ZC 4X3TA 1X54A 2V1YA 3CCLA 1VCBA 2DYBA 4AJYB 3H91A 2V1CC 1MHHE 3E5SA 2KFJA 1TKWB 3ER0A 4K5VA 2ZPYA 3W5VB 3PIOA 3Q3OC 4CHTB 3NXWA 1HFNA 1QZHA 1SN8A 3AULA 4XZ4A 3CC7A 1E2VA 4CJ2C 2GBNA 3A9JA 3NZSA 1Q86C 4DF7A 4DR5L 4QL5A 3QAQA 1L0YB 2EYLA 3PGEA 2F3IA 3TP5A 3G48A 3KWLA 2PW9A 2KECA 2KHJA 3HOXG 1AZQA 3FILB 1E22A 3W9CB 4A3CG 2ZZPB 2LGSA 3RN2A 1WYDA 2WAQE 3D4WA 3TRZA 1TIFA 4ARCA 2C35B 3LNNA 2XTIA 1PXUA 2Z0SA 4LUVA 1IKMA 1NENB 3K58A 3M7NA 1HHVA 4A3CH 3H6NA 4HJ7A 2Z6KA 1KIXA 3KF6B 3ZJTA 4DV6L 4OX9L 1WYGA 3AN1A 2JXMB 3A8IE 2A69D 1YN4A 1V8CA 3BVMA 3TN2A 4LFBQ 3Q24A 1ZW7A 4QJFA 2ZJRA 1TT5B 4J3OD 2DENB 4MH8A 4ANWA 4K0KQ 2LUMA 1STAA 2QJLA 2WV6D 3V96A 5K36H 1QVGA 3Q0AA 4JVZA 1P98A 4NJ7A 2GBJA 4GSWA 1B50A 3N3KB 5C2TB 1EY4A 2RDHA 5COYA 1HQMC 4GKJL 1VQ5A 2ZW1A 3VAWA 2D3CA 3I4MH 2M19A 2INDC 1MKHA 2FCNA 4ZLTF 3PVLA 1UWVA 1FJGL 3GD7A 3MC9A 4NMZA 4A3GG 4BVUC 1KFYB 3GTJH 5IGDA 2BA0A 4P2CB 5IWAL 3BINA 2QW7A 2PMVA 5ELDA 1AARA 3LB8C 2K50A 3NQIA 4LF7L 2HT1A 1X56A 4LDTB 4RF0A 1C4AA 4DU9A 4IUPA 2HJ1A 3PT2B 3M3YH 4DUZL 2JYTA 2B2VC 4DKAC 2LHEA 2IHEA 3I56A 2WWZA 3I57A 1QOGA 4YL8A 3FRPB 1VQFA 1YHAA 2XBBC 4DDGD 3HOVG 3EFUA 3GTLB 5AJ3L 3C3LA 3U9OA 3ICEA 1HUNA 4KIKA 4MN3A 1KRSA 1P16A 5EQ0A 2KVZA 2DY8A 2KWVB 3N20C 4E71A 1FNUA 4JI5L 2QMTA 2VH2A 4P7IA 1ZEQX 3K80C 2KLCA 4MJSA 1Y56A 1BBWA 2KENA 4DV3L 4C1NI 4JYAL 4OO1H 3NY5A 3UQAA 2ENBA 1D7QA 1VRAB 2F0OA 2LFIA 2ZNVB 2ZM6Q 4IPDA 3KUCB 3GV3A 3EN2A 4ME5A 4IALA 3M63B 2KHIA 5IKCM 1WR1A 3HOUH 1YJIA 1GOZA 5C6AA 3BG3A 1SROA 1W6KA 2JN4A 3VA7A 5E4WC 1Z47A 1KM7A 1VQ4A 4IWOA 1PRTD 4A76A 2Z8LA 5KHOA 3CCMA 3PTFC 3RI7C 2IO3B 1E1OA 4DK3C 1K73C 2EIFA 2RDGA 3U30A 1IKLA 5L83A 2NPTB 3L16A 3A0JA 1TWCB 2JEAI 1KL9A 2SDFA 1SYEA 2OQ0A 2J0KA 4WQOB 2Q8TA 3T1YQ 2W82A 3VR3A 1HNXQ 1DJRD 1P1AA 4TRDA 4A3BB 1SMYD 2L0FA 4ZYNA 1VQCA 2IO2B 1O80A 1STGA 4OW0A 4GLSC 2M0AA 4CGYB 4N8FA 4GOPC 1G6ZA 3B08A 4RKBA 3ZYYX 1S3SG 5LMUQ 3EFCA 3VR8B 4KI0A 1CQVA 4L5QA 2R3ZA 2CWAA 3HOVB 3I5JC 1M90C 4H2AA 1WRDB 1PFBA 1NBFC 1RTOA 1PZJD 2L11A 5FLXL 2PTLA 1LFDA 4QQBX 3PO3H 2WX1A 3S1NB 1DOYA 4JI7Q 1UGJA 1S5CD 2H5XA 4TMAB 1EU4A 3P75A 4W9FA 4LF4L 1X1MA 4J6IA 2B8FA 2JXTA 4JI3Q 4IJHA 4YSXB 1WXQA 4J8QA 3SGIA 2W3SA 4X65L 2ZJDA 3CRKC 3CU7A 2A8VA 4M8MA 1C4QA 1CZWA 2WS3B 4B3RQ 1D5XC 2E76C 1BCPB 3J81E 1IL8A 2UUBQ 1E7PB 5HY6A 3OMGA 2LRUA 5DCNA 2IO0B 1HA5A 2JEBI 3ENEA 1OXVA 1PTOH 1I50B 1YN3A 2ZCBA 3D6WA 1NVID 1H9MA 1Y1VG 2XRSD 3WDNA 3FC4A 2HCCA 5C3EG 4DV0Q 2FCQA 3J80E 4A3GH 1Z6HA 2IY5B 3S2DB 4S17A 4GN1A 3VH3B 1HJPA 1EQQA 5ELEA 4C3JH 4A4IA 3R3OA 4A3KH 3NWTA 1I35A 2NTSA 3VYTA 2HTME 2RHSB 4GNXC 2DGYA 5CHWA 5GXGB 2LXKA 4APVA 3H15A 2IL8A 1XNQQ 4JLCA 2J0TD 1T0RC 4B08A 4N9F4 4P73A 3K59A 1E10A 1Y8OB 2DJFC 1NDDA 2GVBA 5C3XA 2NVQB 2VQFL 4IPGA 2QSDA 3S15H 1PYSB 1EZ6A 1VQJA 5C4XB 3S9WA 3F2BA 5CR3A 3RMHA 2JA8B 1V1QA 4KJNA 2PMZE 1GHKA 1ZUD2 4IFDJ 5FLMH 1SFOH 1E24A 3JSVA 2CR5A 3B9JA 3QC8B 5LLIA 3I9V1 3Q8BA 3SFDB 3W1GA 1STNA 1HNZL 5FLMG 3NJTA 4HCPB 5EE0A 2E2DC 3ULJA 1L1OB 1B9RA 1O78A 2R7ZH 5LXIB 2SOBA 3K7AH 1QVCA 1OXXK 5IGCA 2AL3A 2IGHA 2KMAA 1BBUA 1I3QH 1NNXA 2ICEC 2MPMA 3L17A 3LWUA 2IW3A 4XWTA 3RCZA 1TS2A 1I6HB 2VUMH 5DNFA 4X66Q 1EWIA 1PHJA 2VUMB 5KGUA 2NVXB 5KNDA 1N6ZA 1OEYJ 3PO2B 4ZCKA 4WAAA 3RNCC 3KF6A 4UP8A 2AWTA 2G4DB 4FP5D 2R7ZB 3QO2A 3K7UC 2XWJB 4AQYL 1JORA 1T0YA 3FAHA 4HKZE 1FD7D 2PKOA 4REZA 4DHZB 2JWZA 3MHBA 3CCVA 2ES2A 2WDVB 3CMMB 2G9HD 5C4ZA 2VL6A 4JI8L 2F52A 3VXWA 1EYCA 2X6LA 3KBXA 1HZ6A 1M4VA 3IRBA 4ICVA 2RVLA 4HIDA 3DVNV 1V5TA 4KDLB 4DV7Q 2NBFA 3AXCA 2DLBA 1KHIA 4GOPB 1CHQD 2M4NA 1BR9A 5IY0A 3GE3C 2Q8IB 5H8YE 3UIPB 3ZW3A 1IBLQ 4YWGG 3TUOA 1XXGA 1ZYRC 3AE1B 1NMFA 4MIUA 4IUUA 5C4XG 1LXDA 3U4ZA 3M3YB 3T8MA 3ZO5B 4A3FB 2ON8A 3A55A 3OMCA 3TP6A 5JHBA 4DHJD 1SDFA 3ZJUA 1BQQT 3K5NA 2HHHQ 1EYDA 2VS1A 1PLFA 3UINB 1EU3A 3V62A 5AZGA 3HOUB 1VR9A 5EE3A 1EQVA 2MBOA 4BXXH 2O5JC 3BVGA 4KN7C 1VZ8A 1VQIA 4NXNQ 3S1MH 4A3IB 4C1NK 4WIPA 3N6RA 3KJOA 1CTMA 4DQOC 2Q2TA 3FKYA 1C77A 2BS2B 1SR3A 2R2OA 3GTQH 1F2YA 3Q3MC 5C0XH 4DV4L 2FFKB 4MH0E 3ECIA 4ZOHC 1XMQQ 2K14A 2PO4A 5IYDH 1V86A 2F0HA 1F9JA 3MJ5A 1HQRD 3I7FA 1C4CA 1S72A 4BY7B 1L2FA 2MH7A 3VFKA 4XX5A 1JWMD 2XWBB 3IAS1 4ANXA 5IT9E 2Q2UA 1HZBA 3AE8B 3QOJA 3DBHB 1Q1OA 4I65A 2D5DA 1STEA 3RNUA 3ABVB 2IJ0A 2I2YA 2EYOA 4BA1I 2KA7A 1XLPA 2PI2E 3W1BA 1TTNA 3QARA 5DM73 1Q3LA 1SYGA 1FNWA 4AUQC 3J80i 4IWPA 4JG2A 4BKGA 2CH4A 1TWGH 3J81c 1RFAA 3TZUA 2KJXA 2PZTA 5LMNL 3HVDA 4I6LB 2VZKD 4YCWA 3S1QH 5TSSA 5EBDA 2DZMA 4YIJA 4YT0B 2DJGC 1GUAB 2KN4A 3J80c 3KF8A 1LGRA 3QWZB 3VRBB 1JB7A 3TCAA 2YLMA 3LGJA 3NSWA 1U0LA 1N5WA 1I4HA 4C3HB 1JRPA 4J15A 3D8GA 1GM5A 2F0NA 2MBHA 2ZCCA 2PW7A 3CF5A 3E3XA 3D4RA 1D1KA 2AUJD 3D6CA 1FMAD 3MC8A 4XYCA 4HSVA 4DV1L 2LGIA 2FAZA 2M0XA 3AEAB 5T1GA 4RM8A 1SSNA 1FYCA 2BGFA 3RNBC 4BFRA 1J19A 2JQRB 1W3SA 5CV8A 5EPLA 3P1HA 2DZJA 3DBLB 2D2CC 4L1BA 4A3JB 2MEKA 5IP4D 2BE5C 4HK2A 4Q2JA 2AHOB 2LD9A 3EECA 4HWIB 1WJ6A 3OG5A 1LO5D 2ZJPA 4R4OA 5C4HA 2BF8B 2IX0A 4YCVA 5M3MG 3DHHC 2ZXRA 4A93H 1I94L 1YJ9A 4IFDG 5ELFA 1PDQA 3PQIA 4DV1Q 3A7LA 3OOCA 2CU3A 2LGDA 1TWCH 4EZKA 3T13A 2BH2A 3K0XA 2ID0A 1YJ1A 2FNJB 3B2GA 1ET6A 2DX5B 3H3VH 1W2BA 3OJ3A 4KKSA 3CWIA 4JI6Q 2RSUA 4AYBG 3E9HA 4KSLC 2B8GA 4LFAQ 2IT1A 3L08A 3GTGH 1VZ6A 3PUYA 4MTKA 3CCJA 2L5TA 2R7DA 3T1YL 2UUAL 1H8CA 4YY3L 3S2HB 1GJZA 4QAYA 1N34Q 2K5QA 2KQ3A 1J7CA 1CI3M 1ZYRD 4K3CA 3AU4A 3M3JA 1LTAD 3MTNB 2VXWA 2RKSA 3VVWB 1FD6A 1LQBA 3ZRCA 1LUZA 4C3HG 1N61A 2QF7A 1XLQA 4B3TL 4JI0L 1DGSA 2NMQA 5EBCA 4DV2L 1I6VC 1B2TA 1VD2A 2JE6I 4AIMA 4RHRA 2KNBA 1JR0D 1C4PA 1PH9A 2KOXA 5D94A 1XNRQ 2LKVA 3NPPA 5BN4A 3J80L 2K3UA 5J1ZA 2LVOA 3NVYA 3Q3JA 1K8MA 3CC2A 5JXVA 4R4IA 2ONQA 3HOZG 1R4PB 3NQTA 2MFIA 3GTQB 3TMPB 1G91A 2PQAB 1K52A 4HMIA 3SK5A 2DN8A 3G4SA 1UWMA 3STBC 2B2TC 1Z7TA 1JQ4A 3CSTA 3I4MG 5DAUA 1RIPA 3ZGZA 1UE7A 3FPPA 1DCZA 5D14A 1CJEA 3IFWB 3TBIB 4DXGA 4JBKA 4AS1A 1XMOL 2R93B 1LTID 2B2TA 4NY0A 2DNFA 3ONSA 1S4ZA 5AZFA 5IO9A 2A69C 1P9DU 3N52A 4EEWA 2AWOA 2CS4A 4GGQA 1RL2A 1SNMA 3EC8A 5IT9c 3U2SC 1Y8NB 2DWQA 2NZHA 4DAYB 3APFA 4KKUA 3E0EA 2KYWA 5I9PA 4DFAA 2QILA 2WDQB 2A6HC 4MZ9A 3KLRA 4X3UA 3P63A 1L6VA 4A3FH 1KAAA 3DVGY 3DBLI 1SEBD 5G3LF 4JI6L 3AE6B 3PO3G 2RGFA 3KK7A 5IGFA 1ILPA 5BN5A 1Z2MA 1WMHA 4K7SA 2C7HA 2EXZA 3HOZH 1Q7YC 1NBWA 1UEAB 5JVH3 1S5BD 1EIYB 2BKRB 3CCSA 4BAXA 4DHZE 1HNXL 1WX9A 3LWEA 2SNMA 1VQPA 1PFMA 2N9KA 4GLXA 2K01A 3W1SA 2F0IA 4C00A 3R7QA 4JI4L 4C3IB 1IGCA 1WZ0A 2MWSB 4A93B 4ZRQA 1I42A 4V190 3MTSA 4OX9Q 1ISNA 2GBRA 3P2BA 1BF4A 1IBMQ 4JI2L 2BT6A 4C3IH 1XLOA 4LFBL 5FO7B 1VQ6A 4WQMA 1HNZQ 3KYHC 3M9BA 3PO2H 1AE3A 3C0RB 5LMUL 3IL8A 4E6IA 3GZNB 3K5MA 1OQRA 2K5VA 4FXDA 2LWPA 4C4VA 1UELA 1KDBA 4FXGC 3FDTA 4K5XA 3D31A 3HOYH 2AMCB 5CMDA 2WYQA 3RULA 4C3JG 3B2FA 1YVCA 3H9DA 1MG4A 1ZPSA 1TKEA 2I07B 5DM63 4C7YA 2LUEA 2PW5A 4AYBB 1QLBB 2E75C 2J7ZA 5E3FA 5IODA 2EQSA 2K03A 2KCCA 5LMNQ 1WX8A 5J17A 5JOBA 5JHAA 5J3BA 3KF8B 2H88B 4YHHL 4L5RC 2OCEA 1PMRA 1SYDA 5NUCA 3A4RA 1SNOA 5M3FH 4DV3Q 4DXFA 2CJOA 3HOXB 1D3ZA 3ND8A 2KC2A 4A55A 1RDPD 3E0JA 2WXKA 2ZEQA 1SMYC 4WJPA 3NE5B 4RCNA 3BZCA 2LXCA 4TV3A 4GXBA 1JICA 3K6OA 4ZRKA 1WTQA 3NS1A 1HZ5A 3WAMA 2QDBA 1UGMA 2K5WA 1WSPA 4JQWC 4OGQC 4LF9L 4WWNA 4YTMB 4EUTA 2JJQA 4A75A 1PV4A 1F0ZA 3MC0B 1PH6A 4QCLA 2CKZB 1GUGA 2WXGA 5CHVC 4LF6Q 4R4TA 1LTBD 4DNTB 3P4QB 3CCRA 4XQJA 4USAA 3OIQA 2JSOA 2OF1A 5IOCA 1EWHA 1SE2A 5C3EH 2IY0B 5LHY1 4KDIC 3UDGA 5EPKA 2K39A 4RFBA 2EELA 5ELNA 2NPTA 1CSPA 4RGMA 2O2VB 3M4QA 1YHBA 3BK1A 2L32A 2R92H 2L0CA 1FVIA 1CZPA 4K0KL 1QE6A 1YNXA 4DDID 4WJ4A 4DNIA 3A8JE 1ASYA 3HUIA 3T56B 4NQKE 1YHQA 1MJEA 1S1QB 4DR2Q 1MI0A 2JZPA 2Z0DB 3ZXRA 4F8MA 4LF8L 4MGZE 5HHDG 5J18A 4DR4L 1XTCD 2EVBA 3S14H 3PHXB 2B2YC 3J7AV 4XYOA 4W9LA 5FOBB 4F7XA 2NB0A 3T1HL 2R2QA 1FO4A 3I72A 3E56A 4HJ8A 1YNND 1CKMA 2N78A 3QG1A 5C0XG 1MG8A 5G55A 3RFZB 4P75A 2DNEA 2K8CA 1DXMA 2O6VD 1SMXA 3J81L 4MGIE 2UXCL 4EQPA 3M95A 5IGGA 3DWPA 2ZVNA 4ZK9B 2H89B 4IM3A 1QCBD 4HSPA 4K81A 4CQNA 2F0SA 4BKTA 3K57A 2KKCA 4HLEA 3UGBB 3AMUA 1TWGB 4G50A 4KHZA 2OJRA 3T3OA 4RCOA 3IVFA 2RCNA 3RNFC 1A6XA 3S17B 5I6YA 2LJIA 4LK1C 2A6ED 3ZUNA 3TP8A 1PRTF 3HM6X 4JL9A 2OT2A 2UU9Q 3HK0A 3IAM1 4GDKB 4HPPA 1LACA 3VYSA 5J39A 3I4OA 4LUZA 1XCQL 2L0TA 1GAQB 1V1PB 3M85A 3DVNU 4ME3A 1JRUA 3BYYB 4C56C 1EYAA 1U4PA 4HJAA 4A3LG 3IT4B 3CCQA 4ZAIA 1S5FD 4KZCA 2HCIA 1R4QB 1GJXA 3A33B 3T3NA 1KLUD 2PIAA 1VF5C 3H7PA 2Y0SB 4C3JB 2IX3A 1PTOF 2LVQA 4A3DB 2XK5A 3NP8A 4A3EH 2TSSA 1YJJA 2KHSA 3RD2A 2EYHA 1G2SA 4YCUA 3ZTCA 3C1EA 5EAYA 2I38A 4HPMB 2B2VA 3V6CB 1JOKA 2K6AA 1B7YB 4MJSB 2K5PA 3PIO3 4WAFA 1C0AA 1A0IA 1MIUA 4NDXA 2B2YA 1QNUA 5EE1A 1HRJA 5BO4B 1PVOA 4KKTA 2E2IH 1J7BA 4JWUC 3ND9A 1LTTD 2WXLA 1E8WA 4IJLA 5JAVA 4X64Q 1I4PA 2F4VL 1XT9B 4YSZB 2WB1G 3RNAC 4QIWE 1N60A 1CQFA 4K2LA 1MHWC 4KK7A 4C3HH 3J7YW 4JI5Q 1IBXB 1Q46A 4KGRA 4GMVA 1O7YA 4ZQ3A 1EZ8A 5C3EB 5JH5C 2F1MA 5CV5A 3DLLA 1X55A 3U8ZA 3HFZB 1LTSD 1YD8U 2DYMA 4LNKA 4MEMA 4L23A 4AQYQ 2NYZD 2I5HA 1V43A 2MBQA 5G5HA 4ANVA 1AP0A 5KRUA 1DOIA 2PLPA 1TR5A 5E6NA 4BWGB 4C80A 4R8NA 5ELBA 1WGDA 3S16H 4LAAA 3HVZA 4GDLA 2A68D 2YTYA 2B63B 2HUGA 1GUNA 2YVCA 3TL5A 3C2PA 4IFDH 2GMIC 3AI5A 4XE0A 5DPTA 4ID6A 5M9OA 3KUDB
chains in the Genus database with same CATH topology
3AE4B 3IT6B 3S16B 2V4IB 4DAVA 2J42A 1IW7D 2K05A 1WTXA 1ESFA 1LTRD 5CV7A 1BXTA 3NUCA 4PNYA 3X3MA 5LL6X 3P1MA 3I8ZA 3AEDB 4NKLA 1JWUD 2RA4A 2BB6A 2QIEB 3NTHA 1ENCA 1LTGD 1TY0A 4U68A 5G3LD 1EY8A 4FF3A 1JWAD 5FK9C 1RYJA 1SB3C 3ZQ4A 2SEBD 1ZKOA 4QMGA 4RA8A 1LV9A 1BMLC 3DM1A 4MT5A 3I4LA 1D1IA 3MHZA 4G7HC 4DAYA 2PVOD 1NEKB 4ARIA 4ZYSA 4A3EB 3HOZB 2KEDA 2PQEA 1SE3A 1DM0B 5CV4A 1BOSA 1EY5A 3Q69A 1EEID 4Q0FA 4MACA 1I4GA 2KVMA 2TMPA 4HCEA 1ZXHA 1JCKB 2KOLA 1IGDA 1JOQA 3PZ7A 2K04A 4IKGA 4ZUJA 1CT1D 1FCLA 1I7HA 4KN4C 4LMQD 3G7LA 1QOFA 1OFFA 1QB5D 4XWWA 3SK4A 3HRZC 3PIP3 1FFUA 2WB1B 2KCNA 2F0VA 1UNSA 3P7JA 3EQLC 5T8IA 3J7AF 3SK8A 2AX5A 2LFNA 1K50A 1FXAA 2DBYA 2O4XA 3KQ4A 1VMCA 1NCVA 3VR2A 1CM9A 1MPEA 2IDYA 2F3WA 4A9AA 3FEWX 3AMZA 3E9SA 2A6HD 1BCPF 2Z4IA 1QG7A 2WNMA 2F0WA 3AE7B 1TVXA 3O13A 1BNZA 4PT5A 2XNAC 2OHFA 1PFDA 4CJ0B 3FILA 1EY0A 4KY6A 3OHXC 4LJZC 1DOXA 1GB4A 2INPE 4OIKA 2JA5B 3OWFA 1E2WA 1C9FA 3IFTA 1S5ED 1C78A 5M3MB 2EDGA 4F88A 1J8IA 1AEXA 2A6EC 3QJYA 3HRDD 4BY1B 2RPVA 4RGOS 5CBAE 1K8OA 1H9SB 2EE1A 3GTKB 1E6EB 4WFN3 3L3OC 4RWSC 1SFOB 4FVMA 3DXJC 3P4SB 5A2QL 1RCVD 1KDAA 5IT9L 2NTTA 1T5XD 4P6VF 3S14B 1YN5A 4FYDA 3QIAA 5CV9A 1F9RA 2WXOA 1EIGA 3R8BA 1NAPA 4CJ1B 1SBBB 5C3JB 1EWYC 3L4PA 4G7ZC 2V0GA 1FR3A 4L6TB 1L4ZB 5ISRA 2EKIA 3P4RB 3GP7A 3MXNA 3J9CA 1NI3A 1J7AA 1R9TB 3S1RB 1JC7A 5JVG3 4RNAA 3SHLA 4X3KA 2FE8A 3TZDA 1T6BX 2MJEA 2F0DA 5C3WA 1RKNA 4JPSA 1EIHA 2MGSA 1WVLA 3NVVA 5FR3A 5KIXA 4L8JA 3MEHA 2WXFA 3W2DA 1PTOB 3LXFA 1VDVA 2N88A 2BS3B 1QT9A 3AE9B 1JWSD 5CGKA 5ELCA 1WD1A 1QOHA 3TSSA 1V1OA 2BTEA 1QF6A 1AWDA 4JBWA 2Z4HA 3DEPA 5D65A 2WKDA 3V2TA 1ET9A 5I2XA 3AEGB 1SNCA 3HOYB 2J4XA 4HR7B 5F2DA 4N9PA 1AW7A 1TJEA 2FJ2A 1EL0A 3NVZA 3W3AA 2WXPA 2IWHA 5C0XI 3FPUB 4L63B 2EJFC 2EJMA 4KMUC 3BWUD 3TDQA 3K7AB 3MAQA 2F0QA 1L5PA 1QQRA 2B2WC 2WP9B 5E6JA 3PUWA 3V3XA 2HDMA 5HG2A 4J6HA 1BUVT 1XX8A 4QB4A 2CQAA 1CZGA 2VB3X 1NR4A 4JK1C 3RUZA 1DZ1A 1QKZA 2O2LD 2WXRA 3PO0A 2L4NA 1ROEA 5BYSA 1RFKA 1NYQA 1XF5L 2K0PA 2YEPB 3GS2A 1MHXA 4XDDA 3U7ZA 4L2YA 3EUB2 3AE3B 3Q23A 4EVOA 1GUWA 1W6JA 2RSNA 1F2RC 4YTPB 3PUZA 2EYFA 3M4OB 3GTJB 2D62A 3C8YA 2MUYA 2KAJA 3TMEA 1G2TA 4IOIE 1YNJD 3AB5A 4RHSA 2PZUA 1UWXA 5JEAJ 3RZDB 3K5OA 2AUKA 4GZYC 1WTOA 1MVKA 4YTNB 1BUIC 1BCPC 1PDXA 1F9SA 3NRZA 1DYQA 4A3MB 4KTAA 1TKYA 3DHQA 1EY6A 2E3TA 4BS9A 1Q10A 2NN6G 5EKLA 4OZBA 3IAYA 1VCIA 3SFEB 2BB5A 2BCOA 2M56B 2F0UA 3OPOA 3LX0A 4B9WA 1HEZE 1LT6D 3R2IA 3HZXA 1EWCA 4EE2A 2Y5PA 3PZ8A 4G7OC 3GTMB 1QNKA 4EQNA 1ENAA 3HGBA 2JYOA 2AWNA 1AZPA 1V8QA 1A2TA 1PRTC 1GUTA 4K6LA 5CYUA 2KWDA 3RD4A 1TS5A 2YYZA 1GB1A 2WINB 4OO1G 2BDOA 3MA2B 5FO8B 1Y69U 5BYQA 1QWYA 1IBXA 2BE5D 3GTOB 1FXIA 4KD3A 2B2UA 3NK9A 3A54A 1JB3A 1K51A 1FGBD 4RH6A 1HCZA 2LS01 1N62A 4M1UB 2WLBA 4DNRB 5D3DA 1HTPA 1SNPA 3LYYA 1DONA 1N63A 3L9AX 4Y7NB 1UUPA 3NTIA 1N5XA 2DY7A 3SE0A 1DGJA 2B39A 1DOKA 5BN3A 5D3IB 2N0SB 2EY6A 1V97A 1E2ZA 1HTLD 1BBXC 2GI9A 3P4PB 2NUCA 1NUCA 4PMWA 2H1EA 1FRDA 2F0PA 1D2BA 2CJNA 4OIJA 4ZHPA 1IUEA 2NVYB 3BDCA 4HEDA 1PTOD 3PO3B 2HQEA 3I73A 3EFXD 2V3PA 5AFWA 2F0MA 3SXHA 2NN6H 5LL6S 5A2QE 2YU9B 1MSGA 4C3IG 1RF2D 3GV6A 5IGEA 3Q6SA 3JAML 4NAWB 2VNUD 2F0TA 1FEHA 2MP1A 3WCQA 1H9SA 2DYOA 1WRIA 5C5MA 1SE4A 3UI2A 4ZRZA 4A8XC 1JOOA 1FFVA 1F2RI 1F2LA 1H9KA 1G291 1PZKD 2WXHA 2EJGC 4DAPA 2IX1A 1FM0D 1ICWA 3BYTB 4G57A 1TZOA 4I7ZC 2W54A 3T53B 4J1MA 1JMLA 1EFID 1SYFA 2EY2A 4ILWA 1YMHE 5G5GA 1ML0D 4IFDI 3DWQA 2IGDA 1KNAA 1SJHD 1PFNA 1OO9B 1U9RA 5H92C 2F03A 1SYCA 3DWMA 3OIPA 4BA2I 3AECB 3BIID 2RQXA 4XDCA 3HOWB 4C7ZA 2JA6B 2X38A 1CK1A 4N9TA 1T5EA 1O7LA 1A70A 3VRAB 2JU6X 1JWBD 3Q8CA 3EVQA 4HJGE 4HMJA 4PMBA 2N7JA 4XTCS 2ZXOA 1TQOA 1AN8A 4IUNA 2J52A 4H0LC 1PZID 3KBGA 3MXUA 3DMUA 2PVGC 5JPNC 1A3UA 2WXNA 1C76A 4RF1A 2E2IB 1D5ZC 2O5IC 2R61A 1PGBA 4V0BA 3EJIA 3U9SA 5DEHA 2F0GA 5CV6A 2JA7B 2B76B 2LEKA 4HCSA 1DOLA 1MD2D 2K9XA 3SR6A 3WOFA 2AQ2B 4TKOB 2EY1A 2WXIA 3VR9B 4RKLA 1Q12A 2BOSA 3S1MB 2AQ3B 4HN7A 1YNTE 2WAQB 4QIWB 2L83A 1LT3D 2E74C 3NUHB 4JX1C 2NVTB 3NHHA 3NTKA 3JAME 1F9PA 4S3SA 4R8IA 4QUCA 1HA6A 2M9VA 2GRIA 2A73B 5A35A 2X6GA 3W5UB 1F77A 2YEPF 4FF2A 4KGTA 2KUMA 2F4IA 4KY5A 2L1BA 4DN4M 1TS3A 3I90A 3QB3A 5C5LA 2JYEA 2M2LA 3AEFB 3SEBA 2N9LA 2E6XA 4PV1C 4OHJA 1UAPA 2PCFB 3MP9A 3H3VC 1J9OA 2A5HA 1VDZA 3RPFC 3AV8A 1JQYD 1L0VB 4KKJA 1VMPA 1DD2A 2EZVA 1QOBA 2V3NA 1E0ZA 2BW2A 1D5MC 1KNEA 1TIID 4N58A 3F2UA 5JJZA 3DEOA 4UAIA 3BVZA 5BMGA 1OXUA 4CKEA 4DGZA 4KX6B 4IDIA 5EPJA 1YNJC 1RD9D 4CKBA 5KNBA 3GQBA 3AU7A 3MXGA 2BA1A 1PUTA 4RGNA 5I4DA 3UI3A 4IUTA 2G1EA 1QJOA 1HXYD 4M8AA 1ZXTA 2EYPA 2Y3AA 4HAEA 4QF4A 2ICIA 1I4QA 4XYQA 2JX5A 4OVZA 3EROA 1FCCC 1K53A 2K22A 1HPCA 4A3KB 1VLBA 3G6JB 5IIFA 1S5DD 4IZ8A 1B9MA 2FHTA 1TWAB 5HFYA 3ERQA 5IGBA 2WXQA 1SJED 4KHVA 2V4DA 1A2UA 1F9QA 2FMMA 3R93A 2MJ8A 1K83B 4KY7A 2PPBC 1ZXIA 1STBA 4KD4A 2H4OA 1JE4A 3I3CA 4NJCA 1BCPD 5EGTA 4A6QA 4A90A 4TQ0A 4RGTA 5EKKA 3P20A 2FINB 1MBYA 2JWUA 3KWVA 2OXPA 2RDFA 3V05A 1YQ4B 3FVQA 2ACZB 4XT1B 2XIWA 3MFGA 5C44B 5K36G 1MSHA 2BDNA 1X3QA 3HS0C 5M5WB 4KJOA 4R9WA 2R6GA 3T16A 5EJWA 1OXTA 4TQUS 3AE5B 5FO9B 2INNE 5AUIA 2HDEA 1GUSA 2F0LA 1L4DB 2KMMA 2K32A 5BMHA 5KNCA 2IPKD 3ONAB 3SR1A 1SNQA 5T1IA 1KABA 4K5WA 2AQ1B 4MHEA 3VR4A 4ZRPA 3I70A 1PGXA 3GO5A 1IYUA 1RJTA 3Q8EA 3VR5A 2D9UA 2JSVX 4WURA 1WTPA 3AH7A 4HROA 1LABA 2L12A 3VA5A 2L1AA 1RODA 3CRLC 3DUZA 2L9HA 1MGSA 3MXPA 2PMZB 2KACA 5I6WA 4HEA1 2C9OA 1U4MA 2ZW0A 2K33A 4HTHA 3HKZB 1U4LA 4K8IA 4A3GB 2K5DA 3TEYA 2W55A 1RHPA 4FNFA 4DK0A 4NAMA 1EQTA 2XRQD 3NVWA 1CHPD 5CC4A 2X69A 2XVSA 2RBMA 4O1NA 4H44C 1OQQA 1ZP0B 1H9RA 4F87A 1B53A 4D2KA 1YNNC 2KDMA 4OZAA 1FNVA 3N9YC 1HFGA 5E1FA 1WGKA 4NP5A 1JW9D 5LNK1 1TWHB 5C0XJ 4ZKBB 3IXSA 3Q8FA 2RSOA 1IYVA 2F3VA 1PTOC 3WOEA 1RWSA 3EGRA 3A56A 2IGGA 1Q1EA 2RMMA 3AEEB 1LT4D 4HRSA 3MVVA 2A74C 3OSOA 4US8A 2KQ4X 4OO1I 1SXTA 2K1BA 1CFMA 2E2JB 3MWYW 1XWEA 2Q8RE 2F0JA 4FO2A 1D6EC 3EA6A 3PMFA 1M8AA 1KRHA 1EOTA 4NW2A 3BDOA 1ZOYB 1U4RA 2WU5B 2G9DA 1F2MA 3HEJA 4G4KA 3E6ZX 4XIGS 5CORA 1B3AA 2BS4B 3DWGC 2VZKB 1L0XB 2B2UC 1ZDVA 2WXJA 3VR6A 4YSYB 4CBVA 5HURA 4K6DA 2MHVA 5BYRA 4KGSA 1HUMA 3BDLA 1SSOA 1DOMA 4RAUC 2N55A 3TP7A 1T3QA 4JWSC 4IQZA 1EM7A 4FXCA 1KF6B 4ABNA 3GTPB 3SDZA 2PZWA 3QOLA 3K5LA 4HKQA 3AE2B 2LMCA 5EE9A 1A3VA 4FF4A 1EY9A 1CA6A 2JP1A 3VYUA 3MZ5A 5K5PA 4XXEA 2WQYB 1GHJA 4C2MB 2EY5A 1SYBA 2K28A 1GPXA 4PQXA 1FRRA 2D5GA 4TQ1A 1C79A 4LK0M 3I4NB 2ZXPA 5C4JB 5FLXE 4Z9CB 3QWNA 4FXKC 1P7EA 4H7BA 1KH0A 2NN6I 3GB1A 5JEAH 2CHBD 1Q90A 4IUVA 1FIQA 1WTRA 4BBRB 2BBCA 3OW7A 3CKIB 1TWFB 1TKGA 1X32A 5JEAG 1BO0A 1H9JA 1WCMB 1G8ZD 1P7FA 1F2ZA 4PMCA 4FF1A 3CHBD 2A68C 1TY2A 2WACA 3VYRA 1I4RA 2LMCB 3PV0A 5HGTA 2I46A 4ITKA 2QCPX 4Q5VA 5J22A 4UDUC 3AM9A 3I91A 3D3RA 1XEEA 1SIJA 3S15B 4AQ7A 1WWTA 4K14A 3RLFA 2OEOA 3NBIA 2CW0D 4BBSB 1TS4A 2L52A 2Q5WD 2BYTA 1WTWA 1B44D 1ENFA 3D4DA 3ZJVA 1BDOA 3H09A 1B9NA 1YQ3B 1ONLA 4B0MA 2EYJA 5EKIA 3Q8AA 3CQZB 3S1QB 4B0EA 1STYA 3TEZA 1RTNA 2FMCA 2WU2B 1E0BA 2XSCA 2M00A 1GUOA 3FMCA 5KYIA 4QUFA 5E4XA 3RZOB 1I3QB 2VB2X 4K8JA 3NZ3A 1NSNS 4JE3B 2LHDA 2R92B 2GB1A 4EGVA 3KUPA 4US9A 5CBEE 4YXDB 1EEFD 1V1PA 4WORA 1C8CA 1JROA 1A3TA 1Q1BA 2J53A 3HG9A 4WWMA 2LY7A 1IW7C 4MM3B 1WTVA 1II3A 5D7GA 4IUQA 3C46A 3KLSA 2C5CA 2SAKA 4N6EB 4OL7A 3M7GA 4ULLA 2Y5CA 1XCTL 1VZ7A 4DK1A 3P42A 3R2TA 1KTKA 3SVMA 4LTUA 4ZUIA 5BMIA 3GTGB 3AEBB 1PRTB 2K7VA 1PGAA 1GXDC 2B2WA 4B9XA 5KEEA 1QOAA 1ZE3D 2SNSA 2E2HB 1RM6C 1B4OA 4LLGM 4IURA 5FKAC 2XN9C 2F0FA 4GDLB 3NBHA 3BZDB 1NYRA 2OEDA 3PUVA 2L55A 4O42A 3U52E 1Y1WB 1VF7A 1XO3A 3VQIA 4EQOA 1O7ZA 5M5XB 1KLGD 2EPBA 2QKIC 2CW0C 1TT2A 1ESRA 4X3SA 2GA4B 1KDCA 4U673 1MI2A 3SK6A 1B1ZA 3M4YA 2CVRA 1Y8PB 2EYMA 2PYKA 5I9OA 1SNDA 2NWGA 2FBWB 2WIIB 1C48A 1TU2B 2WP8J 4ZHOA 2F0EA 4KKIA 4XDXA 3URYA 2WKCA 3TEWA 1D4BA 2QEJC 1XYIA 1CA5A 4H13C 1SF0A 1XLNA 4XQNA 3A7AB 1PYWD 1LT5D 2PNRC 4ODGA 3T51B 2W3RA 5M5YB 5AUKA 1ILQA 4OZCA 1QILA 3X3NA 3OWEB 1E9MA 3HP3A 3U4EG 1SAPA 2EOTA 4N59A 3PUXA 4CKCA 3BK2A 4ZKCB 2HDLA 1Y1VB 4KV6A 1STHA 1OXSC 2DNCA 5KYLA 1A15A 4XT3B 3IKJA 3NWSA 2F0KA 4WJWA 4DA2A 3A8KE 1L6UA 2WDRB 5HI1A 5I2YA 3C1FA 1R7SA 1I4XA 4TSSA 4K2KA 2MJDA 4IN3A 4NZLB 2ZT9C 5M3FB 2WXMA 4WRDA 3I4MB 4XQQA 3H8HA 4WH4A 3H0GB 3ETRA 1LLRD 1AFPA 1AYFA 3FKIB 3H94A 1ZDXA 1VJKA 1TYGB 3BS1A 3Q22A 2FUG1 1X3PA 1NR2A 2Z1CA 4R3DA 5JPMC 4M0WA 3DWAA 1Q8IA 3MFYA 3CIRB 3AB9A 3KLSX 3TEXA 1ACCA 2KEEA 1IHZA 2NZ1D 2MJ3A 1EY7A 3T4AC 4P16A 3H6MA 1JALA 5MPOA 3IFDA 3ITPA 3K0YA 1WD0A 3L7ZC 4X3TA 3H91A 1MHHE 3E5SA 1TKWB 4K5VA 3W5VB 4CHTB 3NXWA 1HFNA 1E2VA 4CJ2C 4DF7A 1L0YB 2EYLA 3TP5A 3KWLA 2PW9A 2KECA 1AZQA 3FILB 3W9CB 3D4WA 4ARCA 3LNNA 1IKMA 1PXUA 1NENB 3K58A 3M7NA 1HHVA 3ZJTA 3AN1A 1WYGA 2JXMB 3A8IE 2A69D 1YN4A 1V8CA 3BVMA 3TN2A 3Q24A 4J3OD 4MH8A 2LUMA 1STAA 2QJLA 2WV6D 3V96A 5K36H 3Q0AA 1B50A 5C2TB 1EY4A 2RDHA 5COYA 1HQMC 2ZW1A 2M19A 4ZLTF 3GD7A 4NMZA 1KFYB 5IGDA 2BA0A 4P2CB 2PMVA 5ELDA 3LB8C 3NQIA 4RF0A 1C4AA 4DU9A 4IUPA 2JYTA 2B2VC 2LHEA 3I57A 1QOGA 3FRPB 3GTLB 1HUNA 3C3LA 3U9OA 4MN3A 5EQ0A 2DY8A 1FNUA 2QMTA 1ZEQX 1Y56A 4OO1H 4C1NI 2ENBA 1VRAB 2F0OA 2LFIA 3GV3A 4IALA 4ME5A 1YJIA 1GOZA 5C6AA 3BG3A 1W6KA 3VA7A 5E4WC 1Z47A 1PRTD 2Z8LA 2RDGA 1IKLA 2JEAI 1TWCB 2SDFA 1SYEA 2Q8TA 2W82A 3VR3A 1DJRD 4TRDA 4A3BB 1SMYD 1O80A 1STGA 4OW0A 4GLSC 2M0AA 4CGYB 1G6ZA 4RKBA 3ZYYX 3VR8B 4KI0A 1CQVA 2R3ZA 3HOVB 4H2AA 1PFBA 5FLXL 1RTOA 1PZJD 2L11A 2PTLA 1DOYA 3S1NB 1UGJA 1S5CD 4TMAB 1EU4A 3P75A 2B8FA 2JXTA 4YSXB 1WXQA 4J8QA 2W3SA 3CRKC 3CU7A 1C4QA 1CZWA 2WS3B 1D5XC 2E76C 1BCPB 3J81E 1IL8A 1E7PB 3OMGA 1HA5A 2JEBI 1OXVA 1PTOH 1I50B 1YN3A 3D6WA 1NVID 1H9MA 2XRSD 3WDNA 3FC4A 2HCCA 3J80E 1Z6HA 3S2DB 5ELEA 3R3OA 3NWTA 2NTSA 3VYTA 2HTME 5GXGB 2IL8A 2J0TD 4B08A 1E10A 3K59A 1Y8OB 5C3XA 2NVQB 2QSDA 1EZ6A 5C4XB 3S9WA 5CR3A 3RMHA 2JA8B 1GHKA 4KJNA 1ZUD2 4IFDJ 3B9JA 3I9V1 3Q8BA 3SFDB 1STNA 5EE0A 2E2DC 1B9RA 1O78A 2SOBA 1OXXK 5IGCA 3NS1A 2IGHA 4XWTA 2ICEC 2MPMA 3LWUA 2IW3A 1TS2A 1I6HB 5DNFA 2VUMB 2NVXB 5KGUA 5KNDA 3PO2B 4FP5D 2R7ZB 3QO2A 1JORA 2XWJB 3FAHA 4HKZE 1FD7D 2PKOA 4REZA 3MHBA 2WDVB 2G9HD 5C4ZA 1EYCA 2X6LA 3KBXA 1HZ6A 1M4VA 2RVLA 2NBFA 2DLBA 1CHQD 1BR9A 2Q8IB 5H8YE 4YWGG 3TUOA 1XXGA 1ZYRC 3AE1B 4MIUA 4IUUA 3M3YB 4A3FB 2ON8A 3A55A 3OMCA 3TP6A 3ZJUA 1SDFA 1BQQT 3K5NA 1EYDA 1PLFA 1EU3A 3HOUB 1VR9A 5EE3A 1EQVA 2O5JC 3BVGA 4KN7C 1VZ8A 4A3IB 4C1NK 4WIPA 3N6RA 1CTMA 4DQOC 1C77A 2BS2B 1F2YA 5C0XH 2FFKB 4ZOHC 2PO4A 2F0HA 3MJ5A 1HQRD 1C4CA 4BY7B 2MH7A 1JWMD 2XWBB 3IAS1 5IT9E 3AE8B 3QOJA 4I65A 2D5DA 1STEA 3ABVB 2IJ0A 2I2YA 2EYOA 4BA1I 2KA7A 1XLPA 5DM73 1Q3LA 1SYGA 1FNWA 3TZUA 2KJXA 2PZTA 3HVDA 2VZKD 5TSSA 5EBDA 4YIJA 4YT0B 2KN4A 3VRBB 3KF8A 3NSWA 1N5WA 1I4HA 4C3HB 1JRPA 3D8GA 2F0NA 2PW7A 3D4RA 1D1KA 2AUJD 3D6CA 1FMAD 4HSVA 2LGIA 3AEAB 5T1GA 1SSNA 1FYCA 4L1BA 2JQRB 5CV8A 5EPLA 3P1HA 2D2CC 4A3JB 2MEKA 2BE5C 4Q2JA 1LO5D 5C4HA 2IX0A 2ZXRA 4IFDG 5ELFA 1PDQA 3A7LA 3OOCA 2CU3A 3T13A 2ID0A 3B2GA 1ET6A 4KKSA 3CWIA 2B8GA 2IT1A 1VZ6A 3PUYA 2L5TA 3S2HB 2K5QA 2KQ3A 1J7CA 1CI3M 1ZYRD 1FD6A 1LTAD 2VXWA 2RKSA 4C3HG 1N61A 2QF7A 1XLQA 2NMQA 5EBCA 1I6VC 1B2TA 2JE6I 4RHRA 1JR0D 1C4PA 2LKVA 3NPPA 5BN4A 3J80L 2K3UA 5J1ZA 3NVYA 1K8MA 5JXVA 2ONQA 1R4PB 3NQTA 3GTQB 1G91A 1K52A 4HMIA 3SK5A 2DN8A 1UWMA 2B2TC 1Z7TA 1JQ4A 5DAUA 3ZGZA 3FPPA 5D14A 1DCZA 1CJEA 3TBIB 4DXGA 4AS1A 2R93B 1LTID 2B2TA 1S4ZA 2A69C 3N52A 2AWOA 1SNMA 3U2SC 1Y8NB 2DWQA 4KKUA 5I9PA 4DFAA 2QILA 2WDQB 2A6HC 3KLRA 4X3UA 3P63A 1L6VA 1KAAA 1SEBD 5G3LF 3AE6B 3KK7A 5IGFA 1ILPA 5BN5A 2EXZA 5JVH3 1UEAB 1S5BD 3LWEA 2SNMA 1PFMA 2N9KA 2K01A 3W1SA 2F0IA 4C3IB 1IGCA 4A93B 4ZRQA 4V190 3MTSA 1BF4A 2BT6A 1XLOA 5FO7B 4WQMA 3IL8A 4E6IA 3K5MA 1OQRA 4FXDA 1KDBA 4FXGC 3FDTA 4K5XA 3D31A 5CMDA 4C3JG 3B2FA 1ZPSA 1TKEA 2I07B 5DM63 4C7YA 2PW5A 4AYBB 1QLBB 2E75C 2J7ZA 5E3FA 5IODA 2K03A 2KCCA 5JOBA 2H88B 1PMRA 1SYDA 5NUCA 1SNOA 4DXFA 2CJOA 3HOXB 3ND8A 4A55A 1RDPD 3E0JA 2WXKA 1SMYC 3NE5B 4RCNA 1JICA 3K6OA 1WTQA 1HZ5A 2QDBA 2K5WA 1WSPA 4OGQC 4YTMB 1F0ZA 3MC0B 4QCLA 1GUGA 2WXGA 1LTBD 4DNTB 3P4QB 4XQJA 4USAA 3OIQA 2JSOA 2OF1A 5IOCA 1EWHA 1SE2A 5LHY1 5EPKA 4RFBA 2EELA 4RGMA 3BK1A 2L32A 2L0CA 1CZPA 1QE6A 3A8JE 3HUIA 3T56B 1MI0A 2JZPA 4F8MA 5HHDG 1XTCD 2EVBA 2B2YC 3J7AV 4XYOA 5FOBB 4F7XA 2NB0A 1FO4A 3I72A 3E56A 1YNND 5C0XG 3QG1A 3RFZB 2DNEA 1DXMA 3J81L 4EQPA 5IGGA 3DWPA 4ZK9B 2H89B 1QCBD 4HSPA 4CQNA 2F0SA 3K57A 3AMUA 1TWGB 4KHZA 3T3OA 4RCOA 1A6XA 3S17B 5I6YA 2LJIA 4LK1C 2A6ED 3TP8A 1PRTF 2OT2A 3IAM1 4GDKB 1LACA 3VYSA 5J39A 1XCQL 1GAQB 1V1PB 3M85A 3BYYB 4C56C 1U4PA 1EYAA 3IT4B 4ZAIA 1S5FD 3T3NA 2HCIA 1R4QB 1GJXA 1KLUD 2PIAA 1VF5C 2Y0SB 4C3JB 2IX3A 1PTOF