3RI7C

Toluene 4 monooxygenase hd mutant g103l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ri7C00
3RNAC 1T0RC 3Q14C 3N1ZC 3I63C 3Q3NC 3DHHC 3N1XC 1T0QC 2INDC 3Q3OC 3RNGC 3RNCC 3RNBC 3RMKC 3DHGC 3GE3C 3I5JC 3RN9C 3Q3MC 3N20C 3RI7C 1T0SC 4P1BC 3Q2AC 2INCC 4P1CC 3RNFC 3DHIC 3N1YC 2RDBC 3GE8C 3RNEC
chains in the Genus database with same CATH superfamily
3DBRI 3EFUA 3R7RA 3H1UA 1VRAB 1FXTB 2E3TA 4EKUA 4YSZB 1L7YA 2JPHA 3RFZB 2ZPNA 1UGJA 4NQLB 2V0GA 5L95C 5LLIA 1JMLA 5DPSA 3DVNU 2HD5B 1IUEA 4ARCA 4II2B 4L1BA 3H7PA 4RM9A 2KX3A 2UYZB 3UF8A 1V49A 3ETRA 5I4DA 4P16A 4E71A 2B3AA 3PLVA 1WXQA 1V5TA 3WAOA 2L76A 4W9KA 1PQSA 3OJ4B 4W9LA 2Y5CA 3VR8B 1DOIA 4NNJB 2BWES 1OEYJ 4XGAB 1TKYA 2BWFA 3SHQA 4W9CA 2GBJA 4JLCA 1C4AA 1NI3A 4OZCA 5IN7A 2KJ6A 3KLSX 2LEKA 2K1FA 3BY4B 4NQKE 5JH5C 2KAJA 3AEDB 4C7YA 4GSWA 4HDQA 3ECIA 1I4RA 1K51A 3QWZB 5AUIA 2WWZA 2MX2A 4I6LB 1FPYA 2N4FA 2G3QB 3AMZA 2JX5A 4G0NB 1VLBA 1CZPA 2LJ5A 3PV1A 2FCNA 4LNFA 4FJVB 4LNIA 1E7UA 5E6JA 1E8WA 2D11A 4A90A 1HQRD 3D32A 2KWUB 1V81A 2N9LA 1UBQA 4NZLB 4EZLA 1UELA 2WU5B 3QQ8B 4ASWC 4AJWA 2RPVA 2DX5B 2K8BA 2EKIA 3APCA 4K3BA 3I57A 3GZNB 3FAHA 3NVYA 4ITKA 2LRWA 2ZW1A 1YJ1A 3W2DA 2IZVB 1HEZE 2MH7A 2BVCA 3KUDB 1F0ZA 3NVWA 3UGBB 3OAWA 2D3BA 5DCNA 2KD0A 1AN8A 2MBEA 2V3SA 4RM8A 3TIXA 2YEPB 2D3AA 3N1XC 3UIPB 1E8YA 2ACZB 4OVVA 2FCMA 3VDZA 4ZRJA 4DQOC 3ZVVA 2J53A 4BVUC 2PMVA 3IBEA 2IJ0A 2CHWA 3AE1B 3HHMA 5IA7A 1VZ8A 4KKIA 1ZDVA 1WJ6A 2ICIA 3ZDMC 1GJZA 2AQ3B 4M8MA 2AL3A 4HJKA 5KHQA 5J17A 4PS3A 2K25A 3DVGX 4W9HA 3ZJVA 2EKEC 4IG7B 1ZXIA 1I4QA 3APFA 1WR6E 4YSYB 2O6VB 2W55A 2QMTA 3AE9B 4WH4A 5GMVA 2CHXA 3PREA 4LDTD 2N1WA 3C19A 4TV3A 2MP2B 2YEPF 3N20C 3SD5A 3X23A 3JSVB 2WXMA 4QAYA 3TEXA 2L0FA 2K3UA 3R66C 5T8IA 2Z0DB 4US9A 1WMHA 2BPSA 1L0VB 3M3JA 4CO7A 4GIVA 2I38A 1VDVA 2N0SB 1KLVA 2K0PA 3PZ7A 3PGEA 3AE4B 1T0SC 2NR2A 1Q1OA 3PLUA 3VRAB 2DNFA 3HIZA 3PT2B 1FD6A 3L17A 1UWXA 2LHEA 1TY0A 1OTRB 2BTEA 5CX3A 4JQWC 3VXWA 1GB4A 1C77A 3BVGA 1IP9A 4W9EA 4NJ6A 4KV2A 5BMGA 3MC8A 1KJTA 2PTLA 1BMLC 3M95A 1N6ZA 3V61A 1NI2A 3A9JA 2C7NB 2PKOA 1T0RC 4EZJA 1NBFC 2QC8A 2D2QA 3TCAA 2C7MB 2IBIB 2XBBC 3DBHB 1QOAA 1IBXA 3PPAA 3IAM1 4GDLA 1UWMA 3AM9A 5D6JB 3RN9C 2K5PA 4HPMB 1V9JA 1E0ZA 3A1QB 1D6EC 2JY6A 2BS3B 3BYTB 2L0TA 1SEBD 2R61A 5CHVC 3DHHC 3PSEB 1WJUA 3BK2A 2NPTA 1J8CA 1IYFA 4MACA 3Q8AA 1OEYA 4M8NA 1STEA 2K39A 5HI1A 1E90A 2NBVB 1XCTL 1LO5D 4OZAA 4K1RB 4YSXB 2JYTA 5CHWA 4DHJD 3PVLA 1PGBA 2BB5A 1D5XC 1SE9A 2FNJB 1ENFA 2WXQA 1WFYA 4A8XC 1ZKHA 5BMIA 5D3IB 3LXFA 1N61A 2X38A 4A3OA 3AE3B 4WWOA 3AI5A 4W9GA 1J7CA 4BZAA 2DENB 2FBWB 2KMAA 1FRDA 2KNBA 3PRZA 2KANA 4MH8A 4WWMA 2W54A 1SJHD 1UGMA 2BW2A 5DPWA 4OW0A 3QX1A 4BOSC 2KDIA 3NJTA 2H88B 2MBQA 2O2VA 5EDSA 4BAXA 4GOCA 4GGQA 1XT9B 2ZCCA 3LDZE 2KFJA 1XQQA 4AP4C 2WHIA 3V3XA 3RUIB 5H8YE 3WAPA 2O6VD 2PE6B 4FA6A 3X0WA 4ZDVA 4NJCA 4LCDE 3P2BA 5FKAC 4JIOU 2OEDA 1FMAD 5G2NA 3E56A 2FIFA 2G45B 2Y3AA 2LGXA 4K3CA 2MCNB 1QZEA 4HEA1 5MPOA 3M62B 2IY0B 5E6NA 3AXCA 2WXPA 4ZOHC 2NS5A 1Z5SB 2QILA 1GUAB 1LFDA 2KFKA 2JXTA 5IOIA 3ENEA 1TJEA 2WDRB 2WYQA 3Q2AC 4XDDA 3LYYA 3VQIA 2WXGA 1WSPA 3QA8A 3AEEB 4RMAA 3AEFB 1C3TA 4FADA 4XZ4A 3VRBB 2WXOA 1SE3A 2V9HA 3BK1A 2KMMA 4KDLB 1WI0A 1VR9A 3N3KB 1FO4A 3AE5B 2UU7A 2WXJA 5BMHA 3W5UB 3L4PA 1P7FA 2LVPA 4KX6B 4IM0A 5AZGA 4M0WB 3N30A 3V6CB 1X1MA 2AL6A 2N9EB 2KDEB 4A3PA 1FFVA 4WQOB 1EUVB 2L1AA 1F2RI 2JU6X 3MC9A 3DWMA 3P4SB 4P1BC 1GOZA 3QJZA 4ACFA 2BYVE 1L6UA 2KVRA 3AE6B 3MP9A 2Z59B 2LMCA 2B76B 5IO9A 2J0KA 2KTRB 2XK5B 1Q5WB 1HE8A 2RMMA 3R2IA 1MG8A 3AEGB 3U4EG 4W9IA 3NS8A 2FUG1 3MJ5A 2BQQA 1PYWD 4HJGE 3ML8A 2R2QA 4IUMB 3TEYA 3NVVA 1T0YA 3A9KB 3AU5A 2KACA 1I4GA 1R4NB 3P4QB 2AWTA 4IOIE 3BWUD 3RULA 2PJHA 3ZRCA 3RI7C 2DZIA 2N9XA 3ZXVA 3C0RB 4KIKB 4IWPA 1QT9A 2WLBA 4PYZA 1C76A 3NS1A 4G11A 3W1YA 3I63C 3U8ZA 3PRMB 3MFGA 3LJ3A 1WR1A 5FK9C 1WY8A 2WDTB 2CS4A 4CYEA 1MHHE 2JF5A 3HRDD 4NAWB 4WJPA 1F77A 1RFAA 3AH7A 4MSQB 3HVDA 3ZNID 1N62A 3LB8C 2OJWA 3DBRB 3UQBA 2KWVB 3EGRA 3EA6A 5E6PA 1F9JA 3VH4B 3T8MA 1JWSD 1F2RC 3O65B 1RWSA 1N63A 2ZJDA 5HHDG 2DHZA 2ZW0A 1XCQL 2D07B 3TBLD 2VRRB 2BS4B 3AV8A 4YT0B 5EE3A 3UQAA 4MSMB 1TZ1A 2CHZA 1ISNA 2WXHA 2ZVNA 3T9LA 2L32A 2M56B 2V3PA 3ZUNA 3EFCA 2INNE 2PW9A 1I35A 1J7AA 3ZTCA 4F7ZA 1XEEA 2VZKB 2Y5PA 3P4RB 3TJPA 1JALA 4RF1A 1DOXA 1XO3A 3JW0X 3Q3FA 3WAMA 4YWGG 2BB6A 4C4VA 1HXYD 5IKCM 4KSKC 1LGRA 3DPDA 1NEKB 2D3GA 4WWPA 4J3OD 4OHJA 1TKGA 2BKFA 2LASA 2WX1A 3KH0A 1E7VA 2PEAA 2PE9A 3AULA 1V1OA 3Q8EA 1JRUA 4TQ0A 2DLBA 2FE8A 1L4DB 1JQ4A 1Q10A 1ZE3D 2C5LC 1T3QA 2KC2A 4BKTA 2ZPYA 3DHIC 1LQBA 4RH6A 3U52E 1E9MA 1V97A 4KZ0A 1SF0A 4HCPB 2K22A 2BBCA 3P42A 2RPQA 2RGFA 4CHKA 4MH0E 4WJQA 2QSDA 2RDHA 2I1JA 3DVGY 2C7HA 1YD8U 1JWMD 2L52A 4MGIE 1M94A 3V6EB 4MGZE 3ONSA 3ZW3A 4K81A 2G9HD 3ZNGC 4NJ7A 2K6QA 1WE6A 3R7QA 4FHKA 4I6PA 2O6VA 3AECB 1SIFA 2IO0B 2IY1B 1R7SA 1ROEA 2RSUA 5HG2A 3C8YA 1SE2A 1UZXB 1YX6B 2FUHB 2BF8B 3VTVA 3BVMA 2KXJA 2MP2A 2KQSA 4C56C 1RFKA 1XLNA 2C9WB 4URKA 4RF0A 3AEBB 1V1PB 4IM2A 3CSFA 1ZW7A 4JX1C 4REZA 4A9AA 1L0YB 1WYGA 4RGTA 2N7JA 1P1AA 2SEBD 1XF5L 2L83A 3IHPC 1ZUD2 5TR5A 3VFKA 2N9PC 1L2NA 1C9FA 2KK8A 2K8CA 3ZNZB 1UBIA 2DWQA 1HZ6A 2LXCA 5JHAA 3ALBA 4HROA 1WGYA 1QOFA 1JCKB 1FNVA 3RZWC 2WXFA 4RNAA 1KRHA 2NCNA 3MTNB 1EO6A 1ZPSA 4RCOA 2RDGA 1F1HA 4I6NB 1WF9A 4II3B 1TS2A 3M63B 1JWAD 3FILB 3Q6BA 1U4AA 2LGSA 2X8XX 3TEZA 4HPLB 1Q0WB 3RZFA 3SU8X 4YTMB 1D4BA 3FC4A 4BFRA 3A1QA 3Q8BA 2ZCBA 4HCNB 4MEMA 1FNUA 2EMTA 1UH6A 2VH2A 2BGFA 4GLSC 3RNGC 1H8CA 1JRPA 1GG3A 4MGYE 3DHGC 2QHOA 4WWNA 4XC2A 2ZNVB 1A5RA 4PT5A 2WGSA 3Q8FA 3TSSA 4P1CC 2Z0EB 3KUZA 2IGDA 4DK5A 2N9KA 3H8HA 2KYWA 4MJSA 4FXCA 4B0MA 2VH1A 2MBOA 1SSNA 2ON8A 4ANUA 2PVGC 4JE3B 1WMHB 2M1MA 3OWEB 1VJKA 1GAQB 1JW9D 4TKNA 1WYWB 3DBHI 4ZRPA 2LUEA 5JZEB 3DWGC 2QIEB 2L7RA 1WXAA 1N5XA 1WIAA 2W3RA 1LM8B 3NZ3A 3CMMB 1ET6A 1PUTA 4HDOA 2LI5A 2KC1A 3HUIA 1UNSA 5IP4D 4RFBA 3AE8B 1HTOA 3PZDA 4K7WA 1ZXHA 3WIMA 5HKHA 3PTFC 1TS5A 4B0EA 3T3OA 4YTPB 4FULA 2IGGA 4JWUC 2KJRA 5BO4B 1L4ZB 1WGKA 1Y8RC 1QLBB 4Q2JA 1XLOA 4DHZE 3A9JB 3L0WB 1YN3A 2JT4B 2RD0A 2K8HA 4WAFA 2KWCA 1MPEA 1SIJA 4NPNA 4NY0A 3ZNHB 4ICUA 3U30A 4ANVA 2INPE 1IPGA 2WDQB 4F8CB 4A20A 2MLBA 3RNBC 3EECA 1YIWA 2JZZA 4AUQC 2HDEA 1FEHA 1L5PA 1WWTA 4L23A 4BBNC 4XE0A 3VTUA 3Q3JA 1YJJA 3GOEA 2DYMA 1WRIA 4ZHOA 3UI3A 2AQ2B 3RNCC 3N9YC 3DVNV 5C3JB 1YMHE 2JRIB 2ZZPB 3J9CA 2C60A 2KN4A 3U7ZA 3B0AA 5D7GA 1RRBA 1EU4A 2BYFA 1MG4A 1TS3A 1XLQA 2BS2B 1OGWA 2LUMA 4JPSA 1OQQA 3V60A 2WXKA 2J4XA 4BKSD 3N1ZC 4C00A 3NZUA 3IT6B 3N32A 3Q3NC 4KSLC 4ZHPA 1WGRA 2FCQA 3CSTA 4M0WA 1K50A 3ZYYX 5JHBA 4JWSC 1NYRA 1L6VA 4GB9A 1UD7A 4ZRQA 2KLGA 4TQ1A 5TSSA 1QOGA 2INCC 4B9KA 1BXTA 1A70A 2JVCA 2HJ8A 2HE7A 1VZ7A 5GXGB 3TL5A 2O2VB 3DDCB 4ZYNA 3B2GA 3B2FA 4NAMA 5AZFA 3R2TA 2QCZA 2KTRA 2AX5A 4HKZE 2MBHA 1E5WA 4IWQA 3K9OB 2JXXA 1RM6C 2M0AA 4MM3A 2A5UA 4DWFA 2PLPA 4D2KA 4FHJA 4IWOA 2GBKA 5D2MB 1QF6A 1IGDA 3PHWB 2W82A 1K52A 2DZMA 4DDID 2MQJA 2LHDA 2GOWA 3HVZA 5EE9A 4G3XB 1NVID 3Q14C 3KUCB 4LNNA 2KFKB 1FIQA 4PS7A 1QILA 4E3CA 1YOVB 1V5OA 3DOWA 2ZVOA 3A4SC 4DXGA 1TZOA 1KOTA 3RPFC 1FRRA 4LLGM 1P3QU 1TKEA 2BT6A 1TBEA 3MC0B 4IC7B 4NAWA 2LVQA 3P1MA 3L54A 3L08A 2IO1B 1HA5A 4RGOS 1SE4A 3MJWA 1P7EA 1ACCA 1RLFA 3O13A 3IXSA 3PS6A 3QHTA 2J0JA 1R4MB 3AU4A 3E9SA 4C80A 3I5JC 1IGCA 3SFDB 1QOBA 2MJEA 2XN9C 1JWBD 3R8BA 1C4PA 5D94A 5LNK1 2HJ1A 3KWLA 3H7SA 1CJEA 3CWIA 1E8XA 3ZRFA 1E10A 3BIID 1EM7A 1AWDA 2K9XA 2GMIC 3NOBA 3HM6X 4TMAB 1N5WA 2NMQA 4DDGD 5C2TB 4XWWA 1V2YA 1MVKA 2IPKD 4EZKA 2KOXA 1GC7A 1I4XA 2ASQA 3DBLB 1C4CA 2KKCA 3ZTDA 1WJNA 3NY5A 2CR5A 3Q8CA 2KTFA 2JRHA 4GDKB 1XLPA 5BYQA 2LFIA 4FJYA 2OHFA 4ANXA 1T6BX 3JVZX 3QCAA 2NBUA 4LDTB 2KT7A 2MSED 3K9PB 1WRDB 3L10B 2SAKA 1J0GA 2KO3A 4ICVA 4AQ7A 1DYQA 2IYDB 2KWDA 4N9F4 1YQBA 3KW5B 4TUUA 2WXIA 2XEWA 1MFWA 2QJLA 3EUB2 3NUHB 2NBWB 3Q3MC 2KDMA 2DYBA 2NVUI 4CQNA 1P98A 3ZO5B 3AB5A 2JWZA 2D10A 1FFUA 2MRPA 1GNUA 3PO0A 2LJIA 3ZXRA 1CQVA 3H6NA 2W3SA 3Q69A 4OVUA 2N1VA 3CF6E 4PK1A 2MEKA 5DPTA 1QKZA 4HWIB 4YXDB 2KN5A 1FM0D 2UWQA 1CK1A 5D3DA 3CIRB 4LK0M 2FIDA 3AEAB 1ZP0B 4B95A 5DPRA 1KF6B 2KMCA 3H7PB 3KWVA 4HLEA 3EHVA 2NTTA 4ZRIA 2WS3B 4GMVA 1Y56A 2KVZA 4S0RA 1V86A 2L8JA 4FJZA 3V62A 2JZ3B 4K7SA 3A33B 2Y5BB 1WM3A 2REXA 1VD2A 3OG5A 2L00B 4M00A 3B08A 1FCCC 4L2YA 3B9JA 1WH3A 4HXDA 4BOZB 3RCZA 3KYCD 3VUYA 1SGHA 3ZIMA 2GLSA 4HRSA 1V1PA 2XNAC 1YNTE 4MDKE 1V8CA 1Z2MA 5CHFA 1NENB 1BT0A 2RR9A 3GZNI 4KKJA 4C4VB 3Q3OC 2FAZA 1S1QB 3S2AA 2L3ZA 2LWPA 1VZ6A 3B1LX 1QQRA 1SJED 1E7PB 2PVOD 4DHJB 3L16A 3GP7A 3ZGZA 2WP9B 3W1SA 3TEWA 1KLGD 2LRUA 1YQ4B 4XWTA 2HTME 3L13A 4BKSA 4KGSA 2AEHA 2WNMA 3JSVA 4XX5A 4E74A 3V05A 1WXSA 4LTUA 1E6EB 2V4IB 1UUPA 2DZJA 2G1EA 1B9RA 1TYGB 1B1ZA 4W9DA 1AYFA 4UDUC 4KGTA 5C23A 3DBSA 4P7IA 1WX7A 2GBNA 3NZSA 2V3NA 4EOYA 1EF5A 3APDA 4PYUA 2Z8LA 2G4DB 3FILA 4LNOA 3PZ8A 1JROA 4A55A 4J6IA 2J42A 1EWCA 2JZPA 1EWYC 3GS2A 3URYA 1TT5B 1LXDA 4HK2A 3RMKC 2BYTA 2KDFB 1YQ3B 4LJPB 1GPXA 2LXAA 3IVFA 1TGZB 5BYSA 2I1KA 4C7ZA 1FCLA 4S17A 3RD2A 2KJHB 4H2AA 4LNKA 2DAFA 3SFEB 1I42A 4US8A 1YN4A 1KH0A 1ZGUB 2MBBB 3HM3A 2PIAA 5J18A 2WX0A 4O1NA 4EE2A 1DOYA 2M8SA 1K53A 1P0RA 3WA0A 1KLUD 2LZ6A 3GE8C 3JYUA 2M4NA 3ZKJC 1WX8A 2DBYA 2MW5A 2R2OA 3UINB 2FCSA 4AJYB 2WXRA 3IG3A 1GB1A 3ZQ4A 3IAS1 3W5VB 5HFYA 1YJIA 3NG0A 3PHXB 5LXHA 5KHOA 5EE0A 2LVOA 3KQ4A 2DYOA 5G55A 1ESFA 4WJNA 2IGHA 2VZKD 4HKQA 4X57B 4R3DA 2CU3A 1YN5A 5JXVA 1SB3C 1E8ZA 1MJDA 1WX9A 4XYCA 4XDCA 5AEKB 2DZKA 1J7BA 2D5GA 4RGNA 2KDBA 2KQ7A 1K8RB 3ABVB 4MT5A 1BUIC 2G4SA 1UF0A 3ML9A 3VH3B 2IO2B 1TTNA 2H89B 2D3CA 2E6XA 4WIPA 1YX5B 4N6EB 3VR9B 4ANWA 1TIFA 1N60A 1S3SG 2J52A 4DXAB 2QDFA 4K7UA 3P4PB 4USAA 1MHXA 4DXFA 3QK0A 2KLCA 4N59A 1WGDA 2AYOB 2MWSB 2KZRA 2CKHB 1OQYA 4KGRA 3EC8A 4IW0A 1VCBA 1ZOYB 2IO3B 3W1SC 1WXVA 2MHJA 4BBNF 2KX0A 3SDLC 3FKYA 3AN1A 4YL8A 1IBXB 4MJSB 2OJRA 3TUOA 4GDLB 3VUWA 1J19A 3RNAC 1PGXA 1CMXB 3GB1A 2I2YA 1FXAA 4AOFA 2GB1A 1RYJA 1L0XB 2BKRB 4JL9A 5FR6A 2YVCA 3BINA 1JWUD 5BYRA 3GE3C 4G50A 2LGDA 1XD3B 3RT3B 1NYQA 5H92C 3RNEC 2JQRB 1P9DU 2NPTB 5J2RA 3BYYB 5AZHA 2IDYA 2N7EA 1TS4A 1PDXA 4KVGB 1WE7A 2KHWB 3I9V1 3OJ3A 1V6EA 4B6WA 4KDIC 5AUKA 3QAQA 1AW7A 2ZNVC 1NDDA 1SXTA 4GXBA 2MJDA 4DHZB 3HK0A 3SEBA 3H9DA 2A4ZA 3A4RA 2TSSA 4HVBA 2V1YA 4EUTA 2K6DB 1T0QC 3QIJA 2WXLA 3MHSD 3P63A 3DQVA 2J0MA 4F1SA 1DGJA 2LD9A 4M01A 3VTWA 2J7QB 4TSSA 5E6OA 3DCGA 2WQYB 1OQRA 4EEWA 4ARIA 1I4PA 1OFFA 4AWJA 5FR3A 4EFOA 3RYTA 1KM7A 4KZCA 4MGKE 3UIOB 3OLMD 3AE7B 4OZBA 2GRIA 2PPHA 4FLHA 2OOBB 3I3TB 3NRZA 2KQ4X 2EELA 1KFYB 3BVZA 1D5MC 4PS8A 1WGGA 2V4LA 3U7DA 1F52A 1M4VA 4WQMA 3RNFC 2XK5A 2RDBC 3WCQA 2GI9A 1MI0A 1C1YB 5IAAC 2WDVB 4ZYSA 2MA9B 2M19A 4IM3A 1RAXA 1GC6A 1WXMA 4OVZA 2M17A 1WZ3A 3A9KA 3KYDD 4MELA 4RGMA 3T3NA 3N1YC 2M0XA 4AS1A 2CU1A 2AQ1B 3R3MA 3VVWB 3NHEB 3W9CB 1C79A 1EF1A 4FBJB 2JUOA 2Q5WD 1G6JA 3VUXA 2ONQA 1WJ4A 4KIKA 1WZ0A 4W9FA 1H4RA 2NTSA 4W9JA 2LGYA 1HZ5A 2WXNA 2W9NA 2YLMA 1SBBB 3ZJTA 2DAJA 1D3ZA 4JGHB 4GU2A 3VHTC 3WANA 4GN1A 3QARA 1AARA 1XXGA 3MHZA 2GBRA 1V80A 3IT4B 3U2SC 3ZJUA 5CTRC 4P6VF 3NVZA 3QC8B 2MJ3A 2N7DA 3IFWB 2JYEA 4A6QA 4GDKA 1ET9A 4MM3B 1C78A 3SR6A 1PFDA 5L83A 1EU3A 5EE1A 4ZRKA 1TY2A 2ZEQA 1FXIA 1PGAA 3KVFB 5LXIB 2LGIA 5G5HA 2WU2B 2JSVX 1I4HA 4WURA 1R4MI 1D5ZC 1R4NI 2BYEA 3WALA 4M02A 2HTHA 5C1ZA 4N58A 1WM2A 4HPPA 4DBGA 3ZLZA 1HTQA 1FNWA 4WAAA 3TMPB 4YTNB 3PRPB 1T5XD 1KTKA 2JWUA 3BZDB 3AE2B 2INDC 3VAWA 1ZDXA 2EMSA 4WJOA 5G5GA 1I7HA 4FN2A 4BKGA 2L05A 2GBMA 1WGHA 3ZDTA 2CJOA 3DBLI 4IDIA 4LJOB 2QEJC 2CJNA 4IKGA
chains in the Genus database with same CATH topology
3RNAC 1T0RC 3Q14C 3N1ZC 3I63C 3Q3NC 3DHHC 3N1XC 1T0QC 2INDC 3Q3OC 3RNGC 3RNCC 3RNBC 3RMKC 3DHGC 3GE3C 3I5JC 3RN9C 3Q3MC 3N20C 3RI7C 1T0SC 4P1BC 3Q2AC 2INCC 4P1CC 3RNFC 3DHIC 3N1YC 2RDBC 3GE8C 3RNEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNA C;  1T0R C;  3Q14 C;  3N1Z C;  3I63 C;  3Q3N C;  3DHH C;  3N1X C;  1T0Q C;  2IND C;  3Q3O C;  3RNG C;  3RNC C;  3RNB C;  3RMK C;  3DHG C;  3GE3 C;  3I5J C;  3RN9 C;  3Q3M C;  3N20 C;  3RI7 C;  1T0S C;  4P1B C;  3Q2A C;  2INC C;  4P1C C;  3RNF C;  3DHI C;  3N1Y C;  2RDB C;  3GE8 C;  3RNE C; 
#chains in the Genus database with same CATH topology
 3DBR I;  3EFU A;  3R7R A;  3H1U A;  1VRA B;  1FXT B;  2E3T A;  4EKU A;  4YSZ B;  1L7Y A;  2JPH A;  3RFZ B;  2ZPN A;  1UGJ A;  4NQL B;  2V0G A;  5L95 C;  5LLI A;  1JML A;  5DPS A;  3DVN U;  2HD5 B;  1IUE A;  4ARC A;  4II2 B;  4L1B A;  3H7P A;  4RM9 A;  2KX3 A;  2UYZ B;  3UF8 A;  1V49 A;  3ETR A;  5I4D A;  4P16 A;  4E71 A;  2B3A A;  3PLV A;  1WXQ A;  1V5T A;  3WAO A;  2L76 A;  4W9K A;  1PQS A;  3OJ4 B;  4W9L A;  2Y5C A;  3VR8 B;  1DOI A;  4NNJ B;  2BWE S;  1OEY J;  4XGA B;  1TKY A;  2BWF A;  3SHQ A;  4W9C A;  2GBJ A;  4JLC A;  1C4A A;  1NI3 A;  4OZC A;  5IN7 A;  2KJ6 A;  3KLS X;  2LEK A;  2K1F A;  3BY4 B;  4NQK E;  5JH5 C;  2KAJ A;  3AED B;  4C7Y A;  4GSW A;  4HDQ A;  3ECI A;  1I4R A;  1K51 A;  3QWZ B;  5AUI A;  2WWZ A;  2MX2 A;  4I6L B;  1FPY A;  2N4F A;  2G3Q B;  3AMZ A;  2JX5 A;  4G0N B;  1VLB A;  1CZP A;  2LJ5 A;  3PV1 A;  2FCN A;  4LNF A;  4FJV B;  4LNI A;  1E7U A;  5E6J A;  1E8W A;  2D11 A;  4A90 A;  1HQR D;  3D32 A;  2KWU B;  1V81 A;  2N9L A;  1UBQ A;  4NZL B;  4EZL A;  1UEL A;  2WU5 B;  3QQ8 B;  4ASW C;  4AJW A;  2RPV A;  2DX5 B;  2K8B A;  2EKI A;  3APC A;  4K3B A;  3I57 A;  3GZN B;  3FAH A;  3NVY A;  4ITK A;  2LRW A;  2ZW1 A;  1YJ1 A;  3W2D A;  2IZV B;  1HEZ E;  2MH7 A;  2BVC A;  3KUD B;  1F0Z A;  3NVW A;  3UGB B;  3OAW A;  2D3B A;  5DCN A;  2KD0 A;  1AN8 A;  2MBE A;  2V3S A;  4RM8 A;  3TIX A;  2YEP B;  2D3A A;  3N1X C;  3UIP B;  1E8Y A;  2ACZ B;  4OVV A;  2FCM A;  3VDZ A;  4ZRJ A;  4DQO C;  3ZVV A;  2J53 A;  4BVU C;  2PMV A;  3IBE A;  2IJ0 A;  2CHW A;  3AE1 B;  3HHM A;  5IA7 A;  1VZ8 A;  4KKI A;  1ZDV A;  1WJ6 A;  2ICI A;  3ZDM C;  1GJZ A;  2AQ3 B;  4M8M A;  2AL3 A;  4HJK A;  5KHQ A;  5J17 A;  4PS3 A;  2K25 A;  3DVG X;  4W9H A;  3ZJV A;  2EKE C;  4IG7 B;  1ZXI A;  1I4Q A;  3APF A;  1WR6 E;  4YSY B;  2O6V B;  2W55 A;  2QMT A;  3AE9 B;  4WH4 A;  5GMV A;  2CHX A;  3PRE A;  4LDT D;  2N1W A;  3C19 A;  4TV3 A;  2MP2 B;  2YEP F;  3N20 C;  3SD5 A;  3X23 A;  3JSV B;  2WXM A;  4QAY A;  3TEX A;  2L0F A;  2K3U A;  3R66 C;  5T8I A;  2Z0D B;  4US9 A;  1WMH A;  2BPS A;  1L0V B;  3M3J A;  4CO7 A;  4GIV A;  2I38 A;  1VDV A;  2N0S B;  1KLV A;  2K0P A;  3PZ7 A;  3PGE A;  3AE4 B;  1T0S C;  2NR2 A;  1Q1O A;  3PLU A;  3VRA B;  2DNF A;  3HIZ A;  3PT2 B;  1FD6 A;  3L17 A;  1UWX A;  2LHE A;  1TY0 A;  1OTR B;  2BTE A;  5CX3 A;  4JQW C;  3VXW A;  1GB4 A;  1C77 A;  3BVG A;  1IP9 A;  4W9E A;  4NJ6 A;  4KV2 A;  5BMG A;  3MC8 A;  1KJT A;  2PTL A;  1BML C;  3M95 A;  1N6Z A;  3V61 A;  1NI2 A;  3A9J A;  2C7N B;  2PKO A;  1T0R C;  4EZJ A;  1NBF C;  2QC8 A;  2D2Q A;  3TCA A;  2C7M B;  2IBI B;  2XBB C;  3DBH B;  1QOA A;  1IBX A;  3PPA A;  3IAM 1;  4GDL A;  1UWM A;  3AM9 A;  5D6J B;  3RN9 C;  2K5P A;  4HPM B;  1V9J A;  1E0Z A;  3A1Q B;  1D6E C;  2JY6 A;  2BS3 B;  3BYT B;  2L0T A;  1SEB D;  2R61 A;  5CHV C;  3DHH C;  3PSE B;  1WJU A;  3BK2 A;  2NPT A;  1J8C A;  1IYF A;  4MAC A;  3Q8A A;  1OEY A;  4M8N A;  1STE A;  2K39 A;  5HI1 A;  1E90 A;  2NBV B;  1XCT L;  1LO5 D;  4OZA A;  4K1R B;  4YSX B;  2JYT A;  5CHW A;  4DHJ D;  3PVL A;  1PGB A;  2BB5 A;  1D5X C;  1SE9 A;  2FNJ B;  1ENF A;  2WXQ A;  1WFY A;  4A8X C;  1ZKH A;  5BMI A;  5D3I B;  3LXF A;  1N61 A;  2X38 A;  4A3O A;  3AE3 B;  4WWO A;  3AI5 A;  4W9G A;  1J7C A;  4BZA A;  2DEN B;  2FBW B;  2KMA A;  1FRD A;  2KNB A;  3PRZ A;  2KAN A;  4MH8 A;  4WWM A;  2W54 A;  1SJH D;  1UGM A;  2BW2 A;  5DPW A;  4OW0 A;  3QX1 A;  4BOS C;  2KDI A;  3NJT A;  2H88 B;  2MBQ A;  2O2V A;  5EDS A;  4BAX A;  4GOC A;  4GGQ A;  1XT9 B;  2ZCC A;  3LDZ E;  2KFJ A;  1XQQ A;  4AP4 C;  2WHI A;  3V3X A;  3RUI B;  5H8Y E;  3WAP A;  2O6V D;  2PE6 B;  4FA6 A;  3X0W A;  4ZDV A;  4NJC A;  4LCD E;  3P2B A;  5FKA C;  4JIO U;  2OED A;  1FMA D;  5G2N A;  3E56 A;  2FIF A;  2G45 B;  2Y3A A;  2LGX A;  4K3C A;  2MCN B;  1QZE A;  4HEA 1;  5MPO A;  3M62 B;  2IY0 B;  5E6N A;  3AXC A;  2WXP A;  4ZOH C;  2NS5 A;  1Z5S B;  2QIL A;  1GUA B;  1LFD A;  2KFK A;  2JXT A;  5IOI A;  3ENE A;  1TJE A;  2WDR B;  2WYQ A;  3Q2A C;  4XDD A;  3LYY A;  3VQI A;  2WXG A;  1WSP A;  3QA8 A;  3AEE B;  4RMA A;  3AEF B;  1C3T A;  4FAD A;  4XZ4 A;  3VRB B;  2WXO A;  1SE3 A;  2V9H A;  3BK1 A;  2KMM A;  4KDL B;  1WI0 A;  1VR9 A;  3N3K B;  1FO4 A;  3AE5 B;  2UU7 A;  2WXJ A;  5BMH A;  3W5U B;  3L4P A;  1P7F A;  2LVP A;  4KX6 B;  4IM0 A;  5AZG A;  4M0W B;  3N30 A;  3V6C B;  1X1M A;  2AL6 A;  2N9E B;  2KDE B;  4A3P A;  1FFV A;  4WQO B;  1EUV B;  2L1A A;  1F2R I;  2JU6 X;  3MC9 A;  3DWM A;  3P4S B;  4P1B C;  1GOZ A;  3QJZ A;  4ACF A;  2BYV E;  1L6U A;  2KVR A;  3AE6 B;  3MP9 A;  2Z59 B;  2LMC A;  2B76 B;  5IO9 A;  2J0K A;  2KTR B;  2XK5 B;  1Q5W B;  1HE8 A;  2RMM A;  3R2I A;  1MG8 A;  3AEG B;  3U4E G;  4W9I A;  3NS8 A;  2FUG 1;  3MJ5 A;  2BQQ A;  1PYW D;  4HJG E;  3ML8 A;  2R2Q A;  4IUM B;  3TEY A;  3NVV A;  1T0Y A;  3A9K B;  3AU5 A;  2KAC A;  1I4G A;  1R4N B;  3P4Q B;  2AWT A;  4IOI E;  3BWU D;  3RUL A;  2PJH A;  3ZRC A;  3RI7 C;  2DZI A;  2N9X A;  3ZXV A;  3C0R B;  4KIK B;  4IWP A;  1QT9 A;  2WLB A;  4PYZ A;  1C76 A;  3NS1 A;  4G11 A;  3W1Y A;  3I63 C;  3U8Z A;  3PRM B;  3MFG A;  3LJ3 A;  1WR1 A;  5FK9 C;  1WY8 A;  2WDT B;  2CS4 A;  4CYE A;  1MHH E;  2JF5 A;  3HRD D;  4NAW B;  4WJP A;  1F77 A;  1RFA A;  3AH7 A;  4MSQ B;  3HVD A;  3ZNI D;  1N62 A;  3LB8 C;  2OJW A;  3DBR B;  3UQB A;  2KWV B;  3EGR A;  3EA6 A;  5E6P A;  1F9J A;  3VH4 B;  3T8M A;  1JWS D;  1F2R C;  3O65 B;  1RWS A;  1N63 A;  2ZJD A;  5HHD G;  2DHZ A;  2ZW0 A;  1XCQ L;  2D07 B;  3TBL D;  2VRR B;  2BS4 B;  3AV8 A;  4YT0 B;  5EE3 A;  3UQA A;  4MSM B;  1TZ1 A;  2CHZ A;  1ISN A;  2WXH A;  2ZVN A;  3T9L A;  2L32 A;  2M56 B;  2V3P A;  3ZUN A;  3EFC A;  2INN E;  2PW9 A;  1I35 A;  1J7A A;  3ZTC A;  4F7Z A;  1XEE A;  2VZK B;  2Y5P A;  3P4R B;  3TJP A;  1JAL A;  4RF1 A;  1DOX A;  1XO3 A;  3JW0 X;  3Q3F A;  3WAM A;  4YWG G;  2BB6 A;  4C4V A;  1HXY D;  5IKC M;  4KSK C;  1LGR A;  3DPD A;  1NEK B;  2D3G A;  4WWP A;  4J3O D;  4OHJ A;  1TKG A;  2BKF A;  2LAS A;  2WX1 A;  3KH0 A;  1E7V A;  2PEA A;  2PE9 A;  3AUL A;  1V1O A;  3Q8E A;  1JRU A;  4TQ0 A;  2DLB A;  2FE8 A;  1L4D B;  1JQ4 A;  1Q10 A;  1ZE3 D;  2C5L C;  1T3Q A;  2KC2 A;  4BKT A;  2ZPY A;  3DHI C;  1LQB A;  4RH6 A;  3U52 E;  1E9M A;  1V97 A;  4KZ0 A;  1SF0 A;  4HCP B;  2K22 A;  2BBC A;  3P42 A;  2RPQ A;  2RGF A;  4CHK A;  4MH0 E;  4WJQ A;  2QSD A;  2RDH A;  2I1J A;  3DVG Y;  2C7H A;  1YD8 U;  1JWM D;  2L52 A;  4MGI E;  1M94 A;  3V6E B;  4MGZ E;  3ONS A;  3ZW3 A;  4K81 A;  2G9H D;  3ZNG C;  4NJ7 A;  2K6Q A;  1WE6 A;  3R7Q A;  4FHK A;  4I6P A;  2O6V A;  3AEC B;  1SIF A;  2IO0 B;  2IY1 B;  1R7S A;  1ROE A;  2RSU A;  5HG2 A;  3C8Y A;  1SE2 A;  1UZX B;  1YX6 B;  2FUH B;  2BF8 B;  3VTV A;  3BVM A;  2KXJ A;  2MP2 A;  2KQS A;  4C56 C;  1RFK A;  1XLN A;  2C9W B;  4URK A;  4RF0 A;  3AEB B;  1V1P B;  4IM2 A;  3CSF A;  1ZW7 A;  4JX1 C;  4REZ A;  4A9A A;  1L0Y B;  1WYG A;  4RGT A;  2N7J A;  1P1A A;  2SEB D;  1XF5 L;  2L83 A;  3IHP C;  1ZUD 2;  5TR5 A;  3VFK A;  2N9P C;  1L2N A;  1C9F A;  2KK8 A;  2K8C A;  3ZNZ B;  1UBI A;  2DWQ A;  1HZ6 A;  2LXC A;  5JHA A;  3ALB A;  4HRO A;  1WGY A;  1QOF A;  1JCK B;  1FNV A;  3RZW C;  2WXF A;  4RNA A;  1KRH A;  2NCN A;  3MTN B;  1EO6 A;  1ZPS A;  4RCO A;  2RDG A;  1F1H A;  4I6N B;  1WF9 A;  4II3 B;  1TS2 A;  3M63 B;  1JWA D;  3FIL B;  3Q6B A;  1U4A A;  2LGS A;  2X8X X;  3TEZ A;  4HPL B;  1Q0W B;  3RZF A;  3SU8 X;  4YTM B;  1D4B A;  3FC4 A;  4BFR A;  3A1Q A;  3Q8B A;  2ZCB A;  4HCN B;  4MEM A;  1FNU A;  2EMT A;  1UH6 A;  2VH2 A;  2BGF A;  4GLS C;  3RNG C;  1H8C A;  1JRP A;  1GG3 A;  4MGY E;  3DHG C;  2QHO A;  4WWN A;  4XC2 A;  2ZNV B;  1A5R A;  4PT5 A;  2WGS A;  3Q8F A;  3TSS A;  4P1C C;  2Z0E B;  3KUZ A;  2IGD A;  4DK5 A;  2N9K A;  3H8H A;  2KYW A;  4MJS A;  4FXC A;  4B0M A;  2VH1 A;  2MBO A;  1SSN A;  2ON8 A;  4ANU A;  2PVG C;  4JE3 B;  1WMH B;  2M1M A;  3OWE B;  1VJK A;  1GAQ B;  1JW9 D;  4TKN A;  1WYW B;  3DBH I;  4ZRP A;  2LUE A;  5JZE B;  3DWG C;  2QIE B;  2L7R A;  1WXA A;  1N5X A;  1WIA A;  2W3R A;  1LM8 B;  3NZ3 A;  3CMM B;  1ET6 A;  1PUT A;  4HDO A;  2LI5 A;  2KC1 A;  3HUI A;  1UNS A;  5IP4 D;  4RFB A;  3AE8 B;  1HTO A;  3PZD A;  4K7W A;  1ZXH A;  3WIM A;  5HKH A;  3PTF C;  1TS5 A;  4B0E A;  3T3O A;  4YTP B;  4FUL A;  2IGG A;  4JWU C;  2KJR A;  5BO4 B;  1L4Z B;  1WGK A;  1Y8R C;  1QLB B;  4Q2J A;  1XLO A;  4DHZ E;  3A9J B;  3L0W B;  1YN3 A;  2JT4 B;  2RD0 A;  2K8H A;  4WAF A;  2KWC A;  1MPE A;  1SIJ A;  4NPN A;  4NY0 A;  3ZNH B;  4ICU A;  3U30 A;  4ANV A;  2INP E;  1IPG A;  2WDQ B;  4F8C B;  4A20 A;  2MLB A;  3RNB C;  3EEC A;  1YIW A;  2JZZ A;  4AUQ C;  2HDE A;  1FEH A;  1L5P A;  1WWT A;  4L23 A;  4BBN C;  4XE0 A;  3VTU A;  3Q3J A;  1YJJ A;  3GOE A;  2DYM A;  1WRI A;  4ZHO A;  3UI3 A;  2AQ2 B;  3RNC C;  3N9Y C;  3DVN V;  5C3J B;  1YMH E;  2JRI B;  2ZZP B;  3J9C A;  2C60 A;  2KN4 A;  3U7Z A;  3B0A A;  5D7G A;  1RRB A;  1EU4 A;  2BYF A;  1MG4 A;  1TS3 A;  1XLQ A;  2BS2 B;  1OGW A;  2LUM A;  4JPS A;  1OQQ A;  3V60 A;  2WXK A;  2J4X A;  4BKS D;  3N1Z C;  4C00 A;  3NZU A;  3IT6 B;  3N32 A;  3Q3N C;  4KSL C;  4ZHP A;  1WGR A;  2FCQ A;  3CST A;  4M0W A;  1K50 A;  3ZYY X;  5JHB A;  4JWS C;  1NYR A;  1L6V A;  4GB9 A;  1UD7 A;  4ZRQ A;  2KLG A;  4TQ1 A;  5TSS A;  1QOG A;  2INC C;  4B9K A;  1BXT A;  1A70 A;  2JVC A;  2HJ8 A;  2HE7 A;  1VZ7 A;  5GXG B;  3TL5 A;  2O2V B;  3DDC B;  4ZYN A;  3B2G A;  3B2F A;  4NAM A;  5AZF A;  3R2T A;  2QCZ A;  2KTR A;  2AX5 A;  4HKZ E;  2MBH A;  1E5W A;  4IWQ A;  3K9O B;  2JXX A;  1RM6 C;  2M0A A;  4MM3 A;  2A5U A;  4DWF A;  2PLP A;  4D2K A;  4FHJ A;  4IWO A;  2GBK A;  5D2M B;  1QF6 A;  1IGD A;  3PHW B;  2W82 A;  1K52 A;  2DZM A;  4DDI D;  2MQJ A;  2LHD A;  2GOW A;  3HVZ A;  5EE9 A;  4G3X B;  1NVI D;  3Q14 C;  3KUC B;  4LNN A;  2KFK B;  1FIQ A;  4PS7 A;  1QIL A;  4E3C A;  1YOV B;  1V5O A;  3DOW A;  2ZVO A;  3A4S C;  4DXG A;  1TZO A;  1KOT A;  3RPF C;  1FRR A;  4LLG M;  1P3Q U;  1TKE A;  2BT6 A;  1TBE A;  3MC0 B;  4IC7 B;  4NAW A;  2LVQ A;  3P1M A;  3L54 A;  3L08 A;  2IO1 B;  1HA5 A;  4RGO S;  1SE4 A;  3MJW A;  1P7E A;  1ACC A;  1RLF A;  3O13 A;  3IXS A;  3PS6 A;  3QHT A;  2J0J A;  1R4M B;  3AU4 A;  3E9S A;  4C80 A;  3I5J C;  1IGC A;  3SFD B;  1QOB A;  2MJE A;  2XN9 C;  1JWB D;  3R8B A;  1C4P A;  5D94 A;  5LNK 1;  2HJ1 A;  3KWL A;  3H7S A;  1CJE A;  3CWI A;  1E8X A;  3ZRF A;  1E10 A;  3BII D;  1EM7 A;  1AWD A;  2K9X A;  2GMI C;  3NOB A;  3HM6 X;  4TMA B;  1N5W A;  2NMQ A;  4DDG D;  5C2T B;  4XWW A;  1V2Y A;  1MVK A;  2IPK D;  4EZK A;  2KOX A;  1GC7 A;  1I4X A;  2ASQ A;  3DBL B;  1C4C A;  2KKC A;  3ZTD A;  1WJN A;  3NY5 A;  2CR5 A;  3Q8C A;  2KTF A;  2JRH A;  4GDK B;  1XLP A;  5BYQ A;  2LFI A;  4FJY A;  2OHF A;  4ANX A;  1T6B X;  3JVZ X;  3QCA A;  2NBU A;  4LDT B;  2KT7 A;  2MSE D;  3K9P B;  1WRD B;  3L10 B;  2SAK A;  1J0G A;  2KO3 A;  4ICV A;  4AQ7 A;  1DYQ A;  2IYD B;  2KWD A;  4N9F 4;  1YQB A;  3KW5 B;  4TUU A;  2WXI A;  2XEW A;  1MFW A;  2QJL A;  3EUB 2;  3NUH B;  2NBW B;  3Q3M C;  2KDM A;  2DYB A;  2NVU I;  4CQN A;  1P98 A;  3ZO5 B;  3AB5 A;  2JWZ A;  2D10 A;  1FFU A;  2MRP A;  1GNU A;  3PO0 A;  2LJI A;  3ZXR A;  1CQV A;  3H6N A;  2W3S A;  3Q69 A;  4OVU A;  2N1V A;  3CF6 E;  4PK1 A;  2MEK A;  5DPT A;  1QKZ A;  4HWI B;  4YXD B;  2KN5 A;  1FM0 D;  2UWQ A;  1CK1 A;  5D3D A;  3CIR B;  4LK0 M;  2FID A;  3AEA B;  1ZP0 B;  4B95 A;  5DPR A;  1KF6 B;  2KMC A;  3H7P B;  3KWV A;  4HLE A;  3EHV A;  2NTT A;  4ZRI A;  2WS3 B;  4GMV A;  1Y56 A;  2KVZ A;  4S0R A;  1V86 A;  2L8J A;  4FJZ A;  3V62 A;  2JZ3 B;  4K7S A;  3A33 B;  2Y5B B;  1WM3 A;  2REX A;  1VD2 A;  3OG5 A;  2L00 B;  4M00 A;  3B08 A;  1FCC C;  4L2Y A;  3B9J A;  1WH3 A;  4HXD A;  4BOZ B;  3RCZ A;  3KYC D;  3VUY A;  1SGH A;  3ZIM A;  2GLS A;  4HRS A;  1V1P A;  2XNA C;  1YNT E;  4MDK E;  1V8C A;  1Z2M A;  5CHF A;  1NEN B;  1BT0 A;  2RR9 A;  3GZN I;  4KKJ A;  4C4V B;  3Q3O C;  2FAZ A;  1S1Q B;  3S2A A;  2L3Z A;  2LWP A;  1VZ6 A;  3B1L X;  1QQR A;  1SJE D;  1E7P B;  2PVO D;  4DHJ B;  3L16 A;  3GP7 A;  3ZGZ A;  2WP9 B;  3W1S A;  3TEW A;  1KLG D;  2LRU A;  1YQ4 B;  4XWT A;  2HTM E;  3L13 A;  4BKS A;  4KGS A;  2AEH A;  2WNM A;  3JSV A;  4XX5 A;  4E74 A;  3V05 A;  1WXS A;  4LTU A;  1E6E B;  2V4I B;  1UUP A;  2DZJ A;  2G1E A;  1B9R A;  1TYG B;  1B1Z A;  4W9D A;  1AYF A;  4UDU C;  4KGT A;  5C23 A;  3DBS A;  4P7I A;  1WX7 A;  2GBN A;  3NZS A;  2V3N A;  4EOY A;  1EF5 A;  3APD A;  4PYU A;  2Z8L A;  2G4D B;  3FIL A;  4LNO A;  3PZ8 A;  1JRO A;  4A55 A;  4J6I A;  2J42 A;  1EWC A;  2JZP A;  1EWY C;  3GS2 A;  3URY A;  1TT5 B;  1LXD A;  4HK2 A;  3RMK C;  2BYT A;  2KDF B;  1YQ3 B;  4LJP B;  1GPX A;  2LXA A;  3IVF A;  1TGZ B;  5BYS A;  2I1K A;  4C7Z A;  1FCL A;  4S17 A;  3RD2 A;  2KJH B;  4H2A A;  4LNK A;  2DAF A;  3SFE B;  1I42 A;  4US8 A;  1YN4 A;  1KH0 A;  1ZGU B;  2MBB B;  3HM3 A;  2PIA A;  5J18 A;  2WX0 A;  4O1N A;  4EE2 A;  1DOY A;  2M8S A;  1K53 A;  1P0R A;  3WA0 A;  1KLU D;  2LZ6 A;  3GE8 C;  3JYU A;  2M4N A;  3ZKJ C;  1WX8 A;  2DBY A;  2MW5 A;  2R2O A;  3UIN B;  2FCS A;  4AJY B;  2WXR A;  3IG3 A;  1GB1 A;  3ZQ4 A;  3IAS 1;  3W5V B;  5HFY A;  1YJI A;  3NG0 A;  3PHX B;  5LXH A;  5KHO A;  5EE0 A;  2LVO A;  3KQ4 A;  2DYO A;  5G55 A;  1ESF A;  4WJN A;  2IGH A;  2VZK D;  4HKQ A;  4X57 B;  4R3D A;  2CU3 A;  1YN5 A;  5JXV A;  1SB3 C;  1E8Z A;  1MJD A;  1WX9 A;  4XYC A;  4XDC A;  5AEK B;  2DZK A;  1J7B A;  2D5G A;  4RGN A;  2KDB A;  2KQ7 A;  1K8R B;  3ABV B;  4MT5 A;  1BUI C;  2G4S A;  1UF0 A;  3ML9 A;  3VH3 B;  2IO2 B;  1TTN A;  2H89 B;  2D3C A;  2E6X A;  4WIP A;  1YX5 B;  4N6E B;  3VR9 B;  4ANW A;  1TIF A;  1N60 A;  1S3S G;  2J52 A;  4DXA B;  2QDF A;  4K7U A;  3P4P B;  4USA A;  1MHX A;  4DXF A;  3QK0 A;  2KLC A;  4N59 A;  1WGD A;  2AYO B;  2MWS B;  2KZR A;  2CKH B;  1OQY A;  4KGR A;  3EC8 A;  4IW0 A;  1VCB A;  1ZOY B;  2IO3 B;  3W1S C;  1WXV A;  2MHJ A;  4BBN F;  2KX0 A;  3SDL C;  3FKY A;  3AN1 A;  4YL8 A;  1IBX B;  4MJS B;  2OJR A;  3TUO A;  4GDL B;  3VUW A;  1J19 A;  3RNA C;  1PGX A;  1CMX B;  3GB1 A;  2I2Y A;  1FXA A;  4AOF A;  2GB1 A;  1RYJ A;  1L0X B;  2BKR B;  4JL9 A;  5FR6 A;  2YVC A;  3BIN A;  1JWU D;  5BYR A;  3GE3 C;  4G50 A;  2LGD A;  1XD3 B;  3RT3 B;  1NYQ A;  5H92 C;  3RNE C;  2JQR B;  1P9D U;  2NPT B;  5J2R A;  3BYY B;  5AZH A;  2IDY A;  2N7E A;  1TS4 A;  1PDX A;  4KVG B;  1WE7 A;  2KHW B;  3I9V 1;  3OJ3 A;  1V6E A;  4B6W A;  4KDI C;  5AUK A;  3QAQ A;  1AW7 A;  2ZNV C;  1NDD A;  1SXT A;  4GXB A;  2MJD A;  4DHZ B;  3HK0 A;  3SEB A;  3H9D A;  2A4Z A;  3A4R A;  2TSS A;  4HVB A;  2V1Y A;  4EUT A;  2K6D B;  1T0Q C;  3QIJ A;  2WXL A;  3MHS D;  3P63 A;  3DQV A;  2J0M A;  4F1S A;  1DGJ A;  2LD9 A;  4M01 A;  3VTW A;  2J7Q B;  4TSS A;  5E6O A;  3DCG A;  2WQY B;  1OQR A;  4EEW A;  4ARI A;  1I4P A;  1OFF A;  4AWJ A;  5FR3 A;  4EFO A;  3RYT A;  1KM7 A;  4KZC A;  4MGK E;  3UIO B;  3OLM D;  3AE7 B;  4OZB A;  2GRI A;  2PPH A;  4FLH A;  2OOB B;  3I3T B;  3NRZ A;  2KQ4 X;  2EEL A;  1KFY B;  3BVZ A;  1D5M C;  4PS8 A;  1WGG A;  2V4L A;  3U7D A;  1F52 A;  1M4V A;  4WQM A;  3RNF C;  2XK5 A;  2RDB C;  3WCQ A;  2GI9 A;  1MI0 A;  1C1Y B;  5IAA C;  2WDV B;  4ZYS A;  2MA9 B;  2M19 A;  4IM3 A;  1RAX A;  1GC6 A;  1WXM A;  4OVZ A;  2M17 A;  1WZ3 A;  3A9K A;  3KYD D;  4MEL A;  4RGM A;  3T3N A;  3N1Y C;  2M0X A;  4AS1 A;  2CU1 A;  2AQ1 B;  3R3M A;  3VVW B;  3NHE B;  3W9C B;  1C79 A;  1EF1 A;  4FBJ B;  2JUO A;  2Q5W D;  1G6J A;  3VUX A;  2ONQ A;  1WJ4 A;  4KIK A;  1WZ0 A;  4W9F A;  1H4R A;  2NTS A;  4W9J A;  2LGY A;  1HZ5 A;  2WXN A;  2W9N A;  2YLM A;  1SBB B;  3ZJT A;  2DAJ A;  1D3Z A;  4JGH B;  4GU2 A;  3VHT C;  3WAN A;  4GN1 A;  3QAR A;  1AAR A;  1XXG A;  3MHZ A;  2GBR A;  1V80 A;  3IT4 B;  3U2S C;  3ZJU A;  5CTR C;  4P6V F;  3NVZ A;  3QC8 B;  2MJ3 A;  2N7D A;  3IFW B;  2JYE A;  4A6Q A;  4GDK A;  1ET9 A;  4MM3 B;  1C78 A;  3SR6 A;  1PFD A;  5L83 A;  1EU3 A;  5EE1 A;  4ZRK A;  1TY2 A;  2ZEQ A;  1FXI A;  1PGA A;  3KVF B;  5LXI B;  2LGI A;  5G5H A;  2WU2 B;  2JSV X;  1I4H A;  4WUR A;  1R4M I;  1D5Z C;  1R4N I;  2BYE A;  3WAL A;  4M02 A;  2HTH A;  5C1Z A;  4N58 A;  1WM2 A;  4HPP A;  4DBG A;  3ZLZ A;  1HTQ A;  1FNW A;  4WAA A;  3TMP B;  4YTN B;  3PRP B;  1T5X D;  1KTK A;  2JWU A;  3BZD B;  3AE2 B;  2IND C;  3VAW A;  1ZDX A;  2EMS A;  4WJO A;  5G5G A;  1I7H A;  4FN2 A;  4BKG A;  2L05 A;  2GBM A;  1WGH A;  3ZDT A;  2CJO A;  3DBL I;  4IDI A;  4LJO B;  2QEJ C;  2CJN A;  4IKG A; 
#chains in the Genus database with same CATH homology
 3RNA C;  1T0R C;  3Q14 C;  3N1Z C;  3I63 C;  3Q3N C;  3DHH C;  3N1X C;  1T0Q C;  2IND C;  3Q3O C;  3RNG C;  3RNC C;  3RNB C;  3RMK C;  3DHG C;  3GE3 C;  3I5J C;  3RN9 C;  3Q3M C;  3N20 C;  3RI7 C;  1T0S C;  4P1B C;  3Q2A C;  2INC C;  4P1C C;  3RNF C;  3DHI C;  3N1Y C;  2RDB C;  3GE8 C;  3RNE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...