3RI7C

Toluene 4 monooxygenase hd mutant g103l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ri7C00
1T0QC 3DHHC 3GE8C 3RI7C 3RN9C 3Q3NC 3RNEC 3RNGC 3RNCC 3I63C 3DHGC 4P1CC 3Q3OC 3N1ZC 2INCC 3GE3C 3RNAC 3RNBC 4P1BC 1T0SC 3Q3MC 3I5JC 2INDC 3N1XC 2RDBC 3RNFC 3Q14C 3N20C 3Q2AC 3DHIC 1T0RC 3RMKC 3N1YC
chains in the Genus database with same CATH superfamily
3IAS1 2BB6A 2R2OA 4JL9A 2GBJA 4IM0A 3RNCC 4MSQB 1RFAA 3AEDB 2KX0A 4XZ4A 2A5UA 5L95C 1TYGB 3URYA 4LJPB 4FJZA 4TQ1A 4KDLB 1N62A 2DZKA 4LDTD 4USAA 5CHVC 1I7HA 2M0XA 3DPDA 5AZHA 2NBVB 1NENB 2BVCA 2INDC 4LNKA 4MGZE 3RPFC 3IHPC 1RRBA 4I6NB 3DBHI 2Y5PA 2JWUA 1XT9B 1LO5D 4K7WA 4DDGD 1YJIA 4KZCA 2WGSA 4YL8A 4NZLB 3WANA 1JWBD 4JQWC 3SFDB 3TBLD 1XEEA 2GBRA 4BBNC 4MH8A 2VH1A 2N4FA 4IW0A 3DVGX 2FIFA 1I4QA 1RYJA 5J17A 4W9FA 2IPKD 3CSFA 3SU8X 3BINA 3QCAA 4RCOA 4MSMB 2ASQA 4YSZB 1R4MI 3KWLA 2HJ1A 1QT9A 3Q6BA 4WJNA 2D11A 2WU2B 2EMSA 2ZVNA 3AXCA 2KJHB 4C7YA 4PYZA 1OQQA 2NVUI 3JSVB 1C4CA 4WJOA 4BFRA 3HUIA 3VH3B 3JSVA 1VZ6A 4WWOA 3QQ8B 4HPMB 5DPTA 2KQ4X 1WWTA 4LLGM 4NJCA 4NQKE 4WURA 2YEPB 2KLGA 2VH2A 2JUOA 2CHZA 2KVZA 4KX6B 3AEEB 3WA0A 2H89B 3DVGY 4M02A 2JT4B 4KDIC 2G9HD 4ICUA 1C1YB 1VDVA 3HRDD 4KGRA 5G55A 2OJRA 3UQBA 2KXJA 2WS3B 3R2IA 1P7EA 1X1MA 2N9EB 2KD0A 5AUIA 2DHZA 2L0FA 2V9HA 2DYOA 4RNAA 4RM9A 2NTSA 1I42A 1J8CA 2L83A 1GC7A 1F77A 1L6VA 1SJED 5D6JB 5C23A 2KACA 5EDSA 4PT5A 2WXOA 1L4ZB 3L17A 2IO1B 2NR2A 4M0WB 1E8WA 3MJ5A 1BUIC 4HJKA 3RFZB 1BT0A 2YVCA 3AE2B 1TS3A 4M0WA 2GOWA 3KVFB 1OEYA 3W5UB 3SEBA 3WAOA 2JX5A 2DENB 5D94A 2JSVX 3NOBA 2DZMA 3V62A 3N20C 3VAWA 4NQLB 1SGHA 3PZ7A 1RWSA 2IO2B 4IWPA 2RDGA 1D5XC 1V8CA 1FIQA 4FADA 3ZRFA 1L0YB 3NVVA 3I5JC 2BQQA 5AEKB 3N1XC 2LASA 1I4RA 3P42A 3CWIA 3LYYA 3ZNZB 4C56C 3RCZA 2R2QA 4DWFA 1N6ZA 3PZ8A 4MGIE 1TBEA 1FD6A 1WR1A 3AMZA 4KKIA 2AL3A 3IG3A 4LJOB 2WXKA 3U30A 2WXRA 2D10A 1QKZA 4WJPA 4NJ7A 2QSDA 1HXYD 2LEKA 3MFGA 1KJTA 1TS5A 1QOGA 3OJ4B 2PPHA 1UGJA 2CU3A 4N59A 1V97A 3AB5A 1F0ZA 3AEGB 3PS6A 3VQIA 4IKGA 1Z2MA 2E6XA 2BBCA 1UH6A 2A4ZA 4BBNF 2BYEA 4H2AA 4C00A 1C78A 2R61A 4GDLB 1A5RA 2BYFA 3N9YC 1L5PA 3B08A 4IWQA 4A3OA 3V6EB 3WALA 1V5TA 3AU4A 4YTMB 5IKCM 3A9KB 2K5PA 2XN9C 1JRPA 1EUVB 3H6NA 2KDMA 4W9LA 4II2B 2NPTB 3NZUA 3PO0A 3SR6A 3A4RA 1E6EB 2NPTA 1I4GA 1CMXB 1E90A 2DNFA 4GB9A 2J53A 2KDBA 4ASWC 1SE4A 3E9SA 5G5HA 1ESFA 2ZW0A 1FM0D 2L3ZA 3DBLB 3FC4A 3N32A 3PTFC 1AN8A 1N5WA 3BZDB 1A70A 3NS1A 3W1SA 2GBKA 4P6VF 2YLMA 1MI0A 4TV3A 3IBEA 3WIMA 3ZVVA 2MW5A 4XDCA 3ZKJC 1MVKA 3BWUD 1HA5A 1SSNA 5C1ZA 2J7QB 2MWSB 4WIPA 3BYYB 3BVZA 4BOSC 3RD2A 1JMLA 2ZJDA 3VTUA 1FXIA 2FCQA 2UYZB 2WXHA 1G6JA 2Y5BB 3IT4B 3R7RA 1ENFA 4E71A 5JHBA 1F9JA 4LDTB 2L7RA 3MP9A 4HCPB 3B1LX 1P3QU 2C9WB 2IJ0A 1SE9A 2N9KA 2N7EA 2BS4B 2XNAC 1YD8U 2KAJA 4HLEA 3Q3OC 2BF8B 3V05A 1WJUA 3ZYYX 4MM3A 4C4VB 4FHKA 2JWZA 5E6NA 1IGCA 2G4DB 1EWYC 1SXTA 2WXMA 5D7GA 5GXGB 2CJOA 4GGQA 3A9JB 4XE0A 1XLPA 4C4VA 1OQYA 2OJWA 3P63A 2INNE 2N1VA 2AQ3B 2PVGC 2FE8A 2FCMA 3A9JA 2RPVA 1UWMA 1D5MC 3SFEB 4RM8A 2QC8A 1EF1A 4XX5A 1SE3A 2WU5B 2WXQA 1ET6A 1UELA 1MG8A 2KC2A 3O13A 4LNOA 1D6EC 2L1AA 3U2SC 4GN1A 2JYEA 4TQ0A 3NRZA 2QDFA 4YSYB 3RYTA 2AEHA 3VUXA 2GRIA 1C9FA 3QWZB 4IUMB 3CMMB 1ZXIA 2W82A 2L32A 2JXTA 1GJZA 4GOCA 4P1BC 4WQOB 2QMTA 2Z0DB 3R3MA 5BYQA 4EZKA 1SB3C 2FCNA 3IT6B 3OAWA 2M19A 1WYGA 1HEZE 3JYUA 3HHMA 3PT2B 3DHHC 1FCCC 5IAAC 2KX3A 2KNBA 1T0SC 3AE6B 3AM9A 4MELA 4ZHPA 3Q3JA 2C5LC 5E6OA 3RZWC 4HEA1 2FAZA 1WX7A 3S2AA 2KC1A 2KDIA 5BYSA 4KVGB 1D5ZC 4GLSC 3QK0A 1TKGA 2LHEA 3FAHA 3R2TA 4IM3A 3U7DA 1RFKA 4FLHA 2VZKD 3N30A 5IN7A 3AE3B 4PS8A 4XC2A 4P7IA 2LD9A 5T8IA 3NZ3A 3I3TB 1EM7A 1UUPA 2W54A 4W9GA 1FCLA 4OVZA 1Y56A 3ONSA 3X0WA 1ET9A 4JGHB 2C60A 2LFIA 4YTNB 4W9DA 2BYVE 3BYTB 3GZNB 2Y3AA 1FXTB 1YJJA 2WX0A 2MBEA 2CKHB 3M63B 3P4SB 1EO6A 2N7JA 4FJYA 3HM3A 2DWQA 1TZOA 4MT5A 3BVMA 2MH7A 2LGXA 5GMVA 3UINB 5C2TB 1TZ1A 2RDHA 4HDQA 3SD5A 3ETRA 2J52A 4G0NB 2AYOB 2KJ6A 3JVZX 2PJHA 3QA8A 3CIRB 3Q14C 3W9CB 1L6UA 2MA9B 2KKCA 1MJDA 5FR3A 5HFYA 1NDDA 1ZW7A 1H4RA 2V1YA 4XWTA 2LHDA 1DOIA 3H1UA 1JRUA 1KH0A 2Z59B 1SEBD 3PHXB 3M95A 4REZA 3T3NA 1WGHA 2KWCA 4I6LB 1P9DU 4YT0B 3AE4B 1WRDB 3ZGZA 3PLVA 3ZDTA 2TSSA 4RGOS 4AOFA 4DK5A 3C8YA 3ZXVA 1FO4A 4LNIA 4ANUA 1WJ4A 2K8HA 1L0XB 1LGRA 3KUZA 5LXHA 4E74A 2CS4A 5LXIB 3DBLI 2QCZA 2D2QA 2IY0B 2AQ2B 4F8CB 3U4EG 3MC9A 3VUWA 3R8BA 3RMKC 3E56A 3R66C 5IOIA 3DBRB 2KDFB 1KTKA 2QILA 4US9A 1TGZB 2N1WA 4FJVB 1S1QB 4MH0E 2RPQA 4YWGG 1UZXB 2GBNA 4DBGA 4KGSA 4E3CA 5BYRA 2SEBD 1ZPSA 3ML8A 1VRAB 3ZW3A 4AWJA 1C3TA 2OOBB 1ACCA 2FNJB 3R7QA 2W3RA 4GDKB 4JPSA 3V6CB 1AYFA 2PIAA 4K81A 3AE5B 4GDKA 4B0MA 1LM8B 2PEAA 2PE9A 2G1EA 3NY5A 3OG5A 4RGMA 4EFOA 1E8ZA 1V5OA 2ACZB 2I1JA 2LJIA 5G5GA 4J3OD 1Q10A 4ZHOA 3EECA 2Z0EB 1QOBA 2LUMA 5AZGA 2XK5B 2ZCBA 3DQVA 4YSXB 1KLVA 1YN5A 4YTPB 1P1AA 3APCA 1IYFA 1Y8RC 1DOXA 2XK5A 3JW0X 3VUYA 1HZ5A 3P4RB 3VHTC 2JRIB 3VTWA 2V3SA 2MBQA 1D4BA 1UF0A 3Q3FA 3N3KB 3RI7C 3Q3NC 1KRHA 4D2KA 2KMAA 2G3QB 2KWVB 1U4AA 4BKGA 3GP7A 4HWIB 4W9CA 1WM2A 1E8XA 3K9PB 1I4HA 3MC8A 1WXSA 3FILB 4HKQA 1VLBA 3AU5A 2N9XA 1F2RC 3FILA 4MEMA 2K0PA 2QJLA 4B9KA 4X57B 1XLNA 4MGYE 1ZDXA 2DAJA 1GUAB 3NG0A 1YOVB 2OEDA 1P98A 1C4AA 4TUUA 3VVWB 1GB4A 4KV2A 2PKOA 3PRPB 2BWES 4TSSA 2IYDB 3TSSA 1R4NI 2HDEA 5H92C 3PVLA 1OGWA 2BGFA 3TMPB 2O6VD 1PGAA 1EWCA 4WJQA 1WGGA 2EKEC 2V4LA 2CU1A 3M3JA 4ARCA 4IM2A 4TMAB 2KT7A 3NHEB 1XCTL 2KWDA 4L2YA 1TTNA 3Q69A 1B1ZA 2IO3B 4ZRKA 5BO4B 2M17A 4FHJA 3L16A 4ANVA 3D32A 2MCNB 1QQRA 5MPOA 4IG7B 2WQYB 2LWPA 1OTRB 2D3BA 3PRMB 2JF5A 3RT3B 3MC0B 4GIVA 3P2BA 5DPWA 5EE3A 3HIZA 3WAMA 1ZXHA 4JLCA 1GAQB 3GS2A 2WXFA 3RN9C 5JH5C 1YIWA 1CK1A 3TCAA 1YN4A 1GNUA 4EZLA 3J9CA 4B0EA 2V3PA 3W1SC 2WDRB 4PS7A 4IDIA 1IP9A 1SE2A 4LNNA 4NY0A 5HHDG 4OVUA 4ZYSA 2HE7A 4GDLA 1V6EA 4NPNA 2PLPA 2MSED 3N1ZC 1WI0A 4ZDVA 3Q8CA 2VZKB 3T3OA 2Q5WD 3V60A 1UWXA 3A9KA 3P4QB 1QOAA 3Q8EA 4R3DA 4NNJB 4EUTA 2WXJA 4GMVA 3Q2AC 3EA6A 2BKRB 4NAMA 5IO9A 1T0QC 2KO3A 2MLBA 1YX5B 3C19A 3L54A 1L0VB 4P1CC 3Q8AA 4LK0M 3PSEB 2L76A 2XBBC 3AEAB 1WRIA 4AJYB 3DBHB 4KKJA 2AWTA 2JZPA 3EFCA 1RLFA 1PFDA 1HTOA 2KZRA 2PW9A 4QAYA 1NEKB 1K50A 1J19A 1RM6C 3ZXRA 4II3B 4ZRJA 2JU6X 2EKIA 2N7DA 1QZEA 2UU7A 1WYWB 2FBWB 2N9LA 4MACA 1E0ZA 3AEBB 1KLGD 5CHFA 3H8HA 1WE7A 2BT6A 3DOWA 2X8XX 5JHAA 2KQ7A 3X23A 3CF6E 3QC8B 2KVRA 2L0TA 3DVNV 2WP9B 3L08A 2KTRB 4LNFA 1LFDA 3QJZA 4BKSD 2KN4A 2KTRA 1FFVA 2JY6A 3UIPB 1IPGA 2J4XA 5L83A 4OZBA 4CYEA 1V49A 1JW9D 1C76A 3ZUNA 3PGEA 4BZAA 4W9IA 3PLUA 4HJGE 1HQRD 2DX5B 2LGIA 4RH6A 3SDLC 1DOYA 3LB8C 4IC7B 4JWUC 1FPYA 4JX1C 3ZLZA 2JXXA 4FULA 2Y5CA 3ZJUA 4F7ZA 3TUOA 1ZUD2 4US8A 2KOXA 3DVNU 2RSUA 3QAQA 2DYMA 2FCSA 4WAAA 4ANXA 1NI3A 4HRSA 3DCGA 1XXGA 2RR9A 4WWPA 1NBFC 2AX5A 3RNAC 1K53A 3PREA 2JZZA 2BB5A 2WXGA 2O2VB 2V4IB 3AV8A 4MJSB 1YMHE 2D3AA 4W9HA 1WXMA 3BIID 5KHOA 3UGBB 4KGTA 2RMMA 4BKTA 1PUTA 2O2VA 4N9F4 2L8JA 4XYCA 1E7UA 2K6DB 3DBSA 3VH4B 4UDUC 3T9LA 1WSPA 4HK2A 4W9KA 1ZE3D 3DDCB 1NYQA 4ZYNA 5HG2A 2INCC 3ENEA 3MTNB 1MG4A 2WXNA 1J7CA 4DXFA 2AQ1B 2N9PC 2DAFA 4KIKB 2DYBA 1YQBA 2XEWA 4YXDB 5DCNA 2D5GA 3ZNHB 2NTTA 4KIKA 2OHFA 1YJ1A 2MHJA 2M56B 2IY1B 3H7PB 4RF0A 1XQQA 3RNBC 4EZJA 1T3QA 2NCNA 2LGDA 2WHIA 1STEA 2ZEQA 3KWVA 4AUQC 1YQ4B 3ZJTA 1T0YA 3NVZA 1FRRA 5E6JA 3VR8B 2HJ8A 2LVOA 2MX2A 4M8NA 1Z5SB 5D3IB 1OQRA 2DZIA 4K3CA 4NAWB 4JWSC 2KJRA 2NBUA 3Q8BA 3WCQA 1T5XD 4NAWA 1V80A 4J6IA 1FFUA 1JALA 3MHZA 1CJEA 5LNK1 2GB1A 2BW2A 1JWUD 1NYRA 3U7ZA 1F2RI 4DHZB 1GB1A 2L52A 4WWNA 2FUHB 1VR9A 1TS4A 1FNVA 4BVUC 3TJPA 2SAKA 1WIAA 3ZRCA 1UD7A 1JCKB 2D3GA 1V9JA 2V3NA 1WGYA 4K1RB 4W9EA 3VRBB 3L0WB 1GPXA 1T0RC 3ABVB 2GI9A 2MBOA 4N6EB 1FRDA 1IUEA 2IGGA 2HTHA 2X38A 4BAXA 2BS3B 1E7PB 3KQ4A 1UBIA 1E5WA 2MRPA 4LCDE 2MBHA 4B6WA 2N0SB 5JXVA 4DXAB 2O6VB 3L10B 2WNMA 2CHWA 1SBBB 1M94A 4RFBA 2O6VA 1J7BA 1K8RB 2WDVB 2MQJA 1FNUA 2GBMA 1ZP0B 2IBIB 3T8MA 1WGKA 1K52A 2KYWA 5J18A 5HI1A 1TJEA 3UIOB 3H7SA 4KZ0A 3I9V1 4G3XB 2WXIA 3EFUA 2K6QA 2KK8A 3PRZA 4DXGA 1Q0WB 3VTVA 1QILA 2BPSA 4ZOHC 2PVOD 1WH3A 4XGAB 4C7ZA 4S17A 3A4SC 3P1MA 1VCBA 2M4NA 2WXPA 4WH4A 4NJ6A 4JIOU 2DBYA 2NMQA 3MHSD 3EGRA 3L4PA 4CHKA 1VZ7A 2QHOA 1WY8A 1UNSA 3AE9B 5KHQA 2NBWB 4HPLB 1E9MA 1QOFA 4PK1A 4G50A 3ALBA 5EE9A 3EC8A 5CTRC 2K22A 2J0JA 1SIFA 5JZEB 4K3BA 3GE3C 2KTFA 5HKHA 3SHQA 2KQSA 2MJ3A 3A33B 5AZFA 2K8BA 1I35A 1M4VA 5J2RA 3VR9B 4FN2A 4OZAA 2C7MB 1TY2A 3ECIA 1NVID 4EEWA 2LJ5A 3TEWA 3PZDA 2K39A 2LI5A 4ANWA 1WMHB 2BWFA 1CQVA 3B2GA 4RGNA 1WMHA 1WGDA 1N61A 1ZOYB 4A8XC 2V0GA 5I4DA 2REXA 3KUCB 3K9OB 1XD3B 4GSWA 4HVBA 4C80A 2CR5A 4DDID 1PGXA 4DHJD 4IOIE 2EELA 1PDXA 3AE8B 1WR6E 3AI5A 2LZ6A 1J7AA 1YX6B 1L4DB 1XCQL 2KFJA 1C4PA 1WXAA 1LXDA 1RAXA 3VDZA 3ZNGC 3C0RB 4B95A 4EE2A 3PV1A 5D2MB 3BK1A 3LJ3A 2B76B 3M62B 3RZFA 4XWWA 2J0MA 2KANA 1KFYB 3RULA 3AE7B 2RGFA 5IP4D 2HTME 2LGYA 1WX9A 2LVQA 4I6PA 2M0AA 2DLBA 1AWDA 1V2YA 4FA6A 3N1YC 4M00A 1C77A 3ML9A 3TEYA 1SJHD 4OHJA 1T6BX 4OVVA 1PYWD 2WX1A 2MBBB 5E6PA 5IA7A 4BKSA 4A55A 4Q2JA 1ISNA 2WLBA 1Q1OA 1V81A 3RNFC 2K3UA 3HK0A 5G2NA 2JRHA 1Q5WB 3B2FA 2G4SA 1P7FA 1ROEA 4O1NA 3KUDB 3KYCD 1XO3A 2LXCA 1C79A 3KW5B 4LTUA 1IGDA 1EU3A 1S3SG 1KM7A 2WXLA 1TKEA 3NUHB 1WXQA 3AE1B 2KWUB 4A3PA 3MJWA 1KOTA 1TIFA 2W9NA 4M01A 2J42A 2WDQB 4EOYA 1MPEA 1UBQA 1YNTE 4G11A 5LLIA 3KLSX 1N5XA 1TY0A 3AECB 4HKZE 4N58A 5EE0A 2ZPNA 1AARA 2QIEB 3IVFA 2KMMA 3QX1A 2JQRB 4ZRIA 2D3CA 3ZTCA 4GXBA 2MEKA 3WAPA 2H88B 1WZ0A 1P0RA 2KDEB 1GC6A 1JROA 1FMAD 3O65B 2VRRB 1FXAA 1EF5A 3AEFB 4PYUA 3DHGC 3GZNI 3IFWB 4MDKE 4A6QA 2ZCCA 1WJ6A 4TKNA 2GLSA 1WM3A 2BS2B 3BK2A 2LGSA 4RF1A 3ZJVA 4HPPA 2YEPF 3LXFA 2BYTA 1I4PA 4IWOA 2I38A 1E7VA 3W2DA 1L7YA 3A1QB 3AN1A 4WWMA 2JPHA 2CHXA 1XLQA 4DQOC 3A1QA 4URKA 1UGMA 1ZKHA 3V3XA 3B0AA 1D3ZA 2JZ3B 3HVZA 2JYTA 1IBXB 1FNWA 2GMIC 1EU4A 2ICIA 3RNGC 1V1PB 2E3TA 4OW0A 3Q8FA 1IBXA 4AP4C 4GU2A 3DWGC 1V1PA 2RDBC 3VFKA 1JWMD 2ZZPB 1J0GA 1F52A 3IAM1 2W55A 2PMVA 1QLBB 4FBJB 2EMTA 2ZNVC 1XLOA 1OEYJ 4M8MA 5BMHA 3ZIMA 1MHHE 3W1YA 1QF6A 1WE6A 5FKAC 2M8SA 4ACFA 1V86A 2ZPYA 1HZ6A 3TEXA 4HDOA 2K9XA 3VRAB 4ZRQA 1JWAD 1WJNA 2PE6B 2IZVB 1VJKA 4FXCA 4ARIA 3NZSA 3TEZA 3LDZE 5FK9C 5H8YE 3GB1A 3IXSA 3DBRI 4AJWA 2WDTB 3ZNID 1R4MB 5C3JB 2W3SA 3APFA 3DWMA 4S0RA 4ITKA 2ZNVB 3DHIC 1KLUD 1BXTA 1ZGUB 2L05A 1PQSA 5DPRA 2G45B 1E10A 2CJNA 2MJEA 3KYDD 1BMLC 4AQ7A 3RNEC 4AS1A 2ON8A 5CX3A 3FKYA 4MGKE 2B3AA 2UWQA 2IDYA 1YQ3B 5EE1A 1YN3A 3TIXA 2JVCA 2LRUA 2IGDA 4HCNB 4K7SA 3UI3A 4EKUA 3U8ZA 4KSLC 5DPSA 4A90A 3QARA 3HM6X 4JE3B 1DYQA 4MM3B 1LQBA 3TL5A 5BMGA 2MP2B 4K7UA 1JWSD 1GOZA 1N60A 2I1KA 1WX8A 1TS2A 3APDA 2LMCA 2IGHA 2BKFA 2MP2A 2BTEA 4HROA 1CZPA 3OWEB 4MJSA 4OZCA 1SF0A 2FUG1 1KF6B 1ZDVA 1SIJA 5D3DA 3EHVA 2C7HA 4HXDA 2ZVOA 3RUIB 1GG3A 1V1OA 4CO7A 3V61A 2DZJA 1WFYA 5FR6A 3NJTA 5TR5A 2FIDA 2M1MA 1WGRA 3BVGA 2ZW1A 3CSTA 2J0KA 3BY4B 1L2NA 1TT5B 5CHWA 3NS8A 1K51A 3GE8C 1VD2A 3L13A 3I57A 1JQ4A 1VZ8A 3GOEA 3I63C 1I4XA 4DHJB 4WQMA 2LXAA 2LVPA 2ONQA 4KSKC 3NVWA 2IO0B 3H7PA 5AUKA 1R4NB 1MHXA 2INPE 2K25A 4RGTA 1DGJA 3OLMD 5BMIA 2LRWA 2WWZA 3HVDA 4WAFA 2AL6A 3AULA 1R7SA 2C7NB 2K1FA 1AW7A 3QIJA 1OFFA 1WZ3A 4DHZE 2PTLA 1WXVA 1XF5L 2HD5B 2LUEA 2Z8LA 3KH0A 2K8CA 3B9JA 3ZTDA 1NI2A 3QHTA 2RD0A 1F1HA 1HTQA 3ZO5B 1MFWA 3ZDMC 1TKYA 2WYQA 3H9DA 1WF9A 2I2YA 4ICVA 3AH7A 3PHWB 4CQNA 3OJ3A 4XDDA 3W5VB 3NVYA 3U52E 4L23A 3UF8A 2MJDA 4RMAA 3ZQ4A 2KLCA 2KFKB 2NS5A 2D07B 3VXWA 3EUB2 4F1SA 1N63A 3UQAA 4ZRPA 2KFKA 4A20A 4W9JA 2QEJC 2KN5A 1E8YA 1FEHA 3P4PB 5TSSA 1PGBA 3Q3MC 3PPAA 4BOZB 4PS3A 1HE8A 2KHWB 4P16A 2L00B 1B9RA 4A9AA 4L1BA 2KMCA 1H8CA
chains in the Genus database with same CATH topology
1T0QC 3DHHC 3GE8C 3RI7C 3RN9C 3Q3NC 3RNEC 3RNGC 3RNCC 3I63C 3DHGC 4P1CC 3Q3OC 3N1ZC 2INCC 3GE3C 3RNAC 3RNBC 4P1BC 1T0SC 3Q3MC 3I5JC 2INDC 3N1XC 2RDBC 3RNFC 3Q14C 3N20C 3Q2AC 3DHIC 1T0RC 3RMKC 3N1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3DHH C;  3GE8 C;  3RI7 C;  3RN9 C;  3Q3N C;  3RNE C;  3RNG C;  3RNC C;  3I63 C;  3DHG C;  4P1C C;  3Q3O C;  3N1Z C;  2INC C;  3GE3 C;  3RNA C;  3RNB C;  4P1B C;  1T0S C;  3Q3M C;  3I5J C;  2IND C;  3N1X C;  2RDB C;  3RNF C;  3Q14 C;  3N20 C;  3Q2A C;  3DHI C;  1T0R C;  3RMK C;  3N1Y C; 
#chains in the Genus database with same CATH topology
 3IAS 1;  2BB6 A;  2R2O A;  4JL9 A;  2GBJ A;  4IM0 A;  3RNC C;  4MSQ B;  1RFA A;  3AED B;  2KX0 A;  4XZ4 A;  2A5U A;  5L95 C;  1TYG B;  3URY A;  4LJP B;  4FJZ A;  4TQ1 A;  4KDL B;  1N62 A;  2DZK A;  4LDT D;  4USA A;  5CHV C;  1I7H A;  2M0X A;  3DPD A;  5AZH A;  2NBV B;  1NEN B;  2BVC A;  2IND C;  4LNK A;  4MGZ E;  3RPF C;  3IHP C;  1RRB A;  4I6N B;  3DBH I;  2Y5P A;  2JWU A;  1XT9 B;  1LO5 D;  4K7W A;  4DDG D;  1YJI A;  4KZC A;  2WGS A;  4YL8 A;  4NZL B;  3WAN A;  1JWB D;  4JQW C;  3SFD B;  3TBL D;  1XEE A;  2GBR A;  4BBN C;  4MH8 A;  2VH1 A;  2N4F A;  4IW0 A;  3DVG X;  2FIF A;  1I4Q A;  1RYJ A;  5J17 A;  4W9F A;  2IPK D;  3CSF A;  3SU8 X;  3BIN A;  3QCA A;  4RCO A;  4MSM B;  2ASQ A;  4YSZ B;  1R4M I;  3KWL A;  2HJ1 A;  1QT9 A;  3Q6B A;  4WJN A;  2D11 A;  2WU2 B;  2EMS A;  2ZVN A;  3AXC A;  2KJH B;  4C7Y A;  4PYZ A;  1OQQ A;  2NVU I;  3JSV B;  1C4C A;  4WJO A;  4BFR A;  3HUI A;  3VH3 B;  3JSV A;  1VZ6 A;  4WWO A;  3QQ8 B;  4HPM B;  5DPT A;  2KQ4 X;  1WWT A;  4LLG M;  4NJC A;  4NQK E;  4WUR A;  2YEP B;  2KLG A;  2VH2 A;  2JUO A;  2CHZ A;  2KVZ A;  4KX6 B;  3AEE B;  3WA0 A;  2H89 B;  3DVG Y;  4M02 A;  2JT4 B;  4KDI C;  2G9H D;  4ICU A;  1C1Y B;  1VDV A;  3HRD D;  4KGR A;  5G55 A;  2OJR A;  3UQB A;  2KXJ A;  2WS3 B;  3R2I A;  1P7E A;  1X1M A;  2N9E B;  2KD0 A;  5AUI A;  2DHZ A;  2L0F A;  2V9H A;  2DYO A;  4RNA A;  4RM9 A;  2NTS A;  1I42 A;  1J8C A;  2L83 A;  1GC7 A;  1F77 A;  1L6V A;  1SJE D;  5D6J B;  5C23 A;  2KAC A;  5EDS A;  4PT5 A;  2WXO A;  1L4Z B;  3L17 A;  2IO1 B;  2NR2 A;  4M0W B;  1E8W A;  3MJ5 A;  1BUI C;  4HJK A;  3RFZ B;  1BT0 A;  2YVC A;  3AE2 B;  1TS3 A;  4M0W A;  2GOW A;  3KVF B;  1OEY A;  3W5U B;  3SEB A;  3WAO A;  2JX5 A;  2DEN B;  5D94 A;  2JSV X;  3NOB A;  2DZM A;  3V62 A;  3N20 C;  3VAW A;  4NQL B;  1SGH A;  3PZ7 A;  1RWS A;  2IO2 B;  4IWP A;  2RDG A;  1D5X C;  1V8C A;  1FIQ A;  4FAD A;  3ZRF A;  1L0Y B;  3NVV A;  3I5J C;  2BQQ A;  5AEK B;  3N1X C;  2LAS A;  1I4R A;  3P42 A;  3CWI A;  3LYY A;  3ZNZ B;  4C56 C;  3RCZ A;  2R2Q A;  4DWF A;  1N6Z A;  3PZ8 A;  4MGI E;  1TBE A;  1FD6 A;  1WR1 A;  3AMZ A;  4KKI A;  2AL3 A;  3IG3 A;  4LJO B;  2WXK A;  3U30 A;  2WXR A;  2D10 A;  1QKZ A;  4WJP A;  4NJ7 A;  2QSD A;  1HXY D;  2LEK A;  3MFG A;  1KJT A;  1TS5 A;  1QOG A;  3OJ4 B;  2PPH A;  1UGJ A;  2CU3 A;  4N59 A;  1V97 A;  3AB5 A;  1F0Z A;  3AEG B;  3PS6 A;  3VQI A;  4IKG A;  1Z2M A;  2E6X A;  2BBC A;  1UH6 A;  2A4Z A;  4BBN F;  2BYE A;  4H2A A;  4C00 A;  1C78 A;  2R61 A;  4GDL B;  1A5R A;  2BYF A;  3N9Y C;  1L5P A;  3B08 A;  4IWQ A;  4A3O A;  3V6E B;  3WAL A;  1V5T A;  3AU4 A;  4YTM B;  5IKC M;  3A9K B;  2K5P A;  2XN9 C;  1JRP A;  1EUV B;  3H6N A;  2KDM A;  4W9L A;  4II2 B;  2NPT B;  3NZU A;  3PO0 A;  3SR6 A;  3A4R A;  1E6E B;  2NPT A;  1I4G A;  1CMX B;  1E90 A;  2DNF A;  4GB9 A;  2J53 A;  2KDB A;  4ASW C;  1SE4 A;  3E9S A;  5G5H A;  1ESF A;  2ZW0 A;  1FM0 D;  2L3Z A;  3DBL B;  3FC4 A;  3N32 A;  3PTF C;  1AN8 A;  1N5W A;  3BZD B;  1A70 A;  3NS1 A;  3W1S A;  2GBK A;  4P6V F;  2YLM A;  1MI0 A;  4TV3 A;  3IBE A;  3WIM A;  3ZVV A;  2MW5 A;  4XDC A;  3ZKJ C;  1MVK A;  3BWU D;  1HA5 A;  1SSN A;  5C1Z A;  2J7Q B;  2MWS B;  4WIP A;  3BYY B;  3BVZ A;  4BOS C;  3RD2 A;  1JML A;  2ZJD A;  3VTU A;  1FXI A;  2FCQ A;  2UYZ B;  2WXH A;  1G6J A;  2Y5B B;  3IT4 B;  3R7R A;  1ENF A;  4E71 A;  5JHB A;  1F9J A;  4LDT B;  2L7R A;  3MP9 A;  4HCP B;  3B1L X;  1P3Q U;  2C9W B;  2IJ0 A;  1SE9 A;  2N9K A;  2N7E A;  2BS4 B;  2XNA C;  1YD8 U;  2KAJ A;  4HLE A;  3Q3O C;  2BF8 B;  3V05 A;  1WJU A;  3ZYY X;  4MM3 A;  4C4V B;  4FHK A;  2JWZ A;  5E6N A;  1IGC A;  2G4D B;  1EWY C;  1SXT A;  2WXM A;  5D7G A;  5GXG B;  2CJO A;  4GGQ A;  3A9J B;  4XE0 A;  1XLP A;  4C4V A;  1OQY A;  2OJW A;  3P63 A;  2INN E;  2N1V A;  2AQ3 B;  2PVG C;  2FE8 A;  2FCM A;  3A9J A;  2RPV A;  1UWM A;  1D5M C;  3SFE B;  4RM8 A;  2QC8 A;  1EF1 A;  4XX5 A;  1SE3 A;  2WU5 B;  2WXQ A;  1ET6 A;  1UEL A;  1MG8 A;  2KC2 A;  3O13 A;  4LNO A;  1D6E C;  2L1A A;  3U2S C;  4GN1 A;  2JYE A;  4TQ0 A;  3NRZ A;  2QDF A;  4YSY B;  3RYT A;  2AEH A;  3VUX A;  2GRI A;  1C9F A;  3QWZ B;  4IUM B;  3CMM B;  1ZXI A;  2W82 A;  2L32 A;  2JXT A;  1GJZ A;  4GOC A;  4P1B C;  4WQO B;  2QMT A;  2Z0D B;  3R3M A;  5BYQ A;  4EZK A;  1SB3 C;  2FCN A;  3IT6 B;  3OAW A;  2M19 A;  1WYG A;  1HEZ E;  3JYU A;  3HHM A;  3PT2 B;  3DHH C;  1FCC C;  5IAA C;  2KX3 A;  2KNB A;  1T0S C;  3AE6 B;  3AM9 A;  4MEL A;  4ZHP A;  3Q3J A;  2C5L C;  5E6O A;  3RZW C;  4HEA 1;  2FAZ A;  1WX7 A;  3S2A A;  2KC1 A;  2KDI A;  5BYS A;  4KVG B;  1D5Z C;  4GLS C;  3QK0 A;  1TKG A;  2LHE A;  3FAH A;  3R2T A;  4IM3 A;  3U7D A;  1RFK A;  4FLH A;  2VZK D;  3N30 A;  5IN7 A;  3AE3 B;  4PS8 A;  4XC2 A;  4P7I A;  2LD9 A;  5T8I A;  3NZ3 A;  3I3T B;  1EM7 A;  1UUP A;  2W54 A;  4W9G A;  1FCL A;  4OVZ A;  1Y56 A;  3ONS A;  3X0W A;  1ET9 A;  4JGH B;  2C60 A;  2LFI A;  4YTN B;  4W9D A;  2BYV E;  3BYT B;  3GZN B;  2Y3A A;  1FXT B;  1YJJ A;  2WX0 A;  2MBE A;  2CKH B;  3M63 B;  3P4S B;  1EO6 A;  2N7J A;  4FJY A;  3HM3 A;  2DWQ A;  1TZO A;  4MT5 A;  3BVM A;  2MH7 A;  2LGX A;  5GMV A;  3UIN B;  5C2T B;  1TZ1 A;  2RDH A;  4HDQ A;  3SD5 A;  3ETR A;  2J52 A;  4G0N B;  2AYO B;  2KJ6 A;  3JVZ X;  2PJH A;  3QA8 A;  3CIR B;  3Q14 C;  3W9C B;  1L6U A;  2MA9 B;  2KKC A;  1MJD A;  5FR3 A;  5HFY A;  1NDD A;  1ZW7 A;  1H4R A;  2V1Y A;  4XWT A;  2LHD A;  1DOI A;  3H1U A;  1JRU A;  1KH0 A;  2Z59 B;  1SEB D;  3PHX B;  3M95 A;  4REZ A;  3T3N A;  1WGH A;  2KWC A;  4I6L B;  1P9D U;  4YT0 B;  3AE4 B;  1WRD B;  3ZGZ A;  3PLV A;  3ZDT A;  2TSS A;  4RGO S;  4AOF A;  4DK5 A;  3C8Y A;  3ZXV A;  1FO4 A;  4LNI A;  4ANU A;  1WJ4 A;  2K8H A;  1L0X B;  1LGR A;  3KUZ A;  5LXH A;  4E74 A;  2CS4 A;  5LXI B;  3DBL I;  2QCZ A;  2D2Q A;  2IY0 B;  2AQ2 B;  4F8C B;  3U4E G;  3MC9 A;  3VUW A;  3R8B A;  3RMK C;  3E56 A;  3R66 C;  5IOI A;  3DBR B;  2KDF B;  1KTK A;  2QIL A;  4US9 A;  1TGZ B;  2N1W A;  4FJV B;  1S1Q B;  4MH0 E;  2RPQ A;  4YWG G;  1UZX B;  2GBN A;  4DBG A;  4KGS A;  4E3C A;  5BYR A;  2SEB D;  1ZPS A;  3ML8 A;  1VRA B;  3ZW3 A;  4AWJ A;  1C3T A;  2OOB B;  1ACC A;  2FNJ B;  3R7Q A;  2W3R A;  4GDK B;  4JPS A;  3V6C B;  1AYF A;  2PIA A;  4K81 A;  3AE5 B;  4GDK A;  4B0M A;  1LM8 B;  2PEA A;  2PE9 A;  2G1E A;  3NY5 A;  3OG5 A;  4RGM A;  4EFO A;  1E8Z A;  1V5O A;  2ACZ B;  2I1J A;  2LJI A;  5G5G A;  4J3O D;  1Q10 A;  4ZHO A;  3EEC A;  2Z0E B;  1QOB A;  2LUM A;  5AZG A;  2XK5 B;  2ZCB A;  3DQV A;  4YSX B;  1KLV A;  1YN5 A;  4YTP B;  1P1A A;  3APC A;  1IYF A;  1Y8R C;  1DOX A;  2XK5 A;  3JW0 X;  3VUY A;  1HZ5 A;  3P4R B;  3VHT C;  2JRI B;  3VTW A;  2V3S A;  2MBQ A;  1D4B A;  1UF0 A;  3Q3F A;  3N3K B;  3RI7 C;  3Q3N C;  1KRH A;  4D2K A;  2KMA A;  2G3Q B;  2KWV B;  1U4A A;  4BKG A;  3GP7 A;  4HWI B;  4W9C A;  1WM2 A;  1E8X A;  3K9P B;  1I4H A;  3MC8 A;  1WXS A;  3FIL B;  4HKQ A;  1VLB A;  3AU5 A;  2N9X A;  1F2R C;  3FIL A;  4MEM A;  2K0P A;  2QJL A;  4B9K A;  4X57 B;  1XLN A;  4MGY E;  1ZDX A;  2DAJ A;  1GUA B;  3NG0 A;  1YOV B;  2OED A;  1P98 A;  1C4A A;  4TUU A;  3VVW B;  1GB4 A;  4KV2 A;  2PKO A;  3PRP B;  2BWE S;  4TSS A;  2IYD B;  3TSS A;  1R4N I;  2HDE A;  5H92 C;  3PVL A;  1OGW A;  2BGF A;  3TMP B;  2O6V D;  1PGA A;  1EWC A;  4WJQ A;  1WGG A;  2EKE C;  2V4L A;  2CU1 A;  3M3J A;  4ARC A;  4IM2 A;  4TMA B;  2KT7 A;  3NHE B;  1XCT L;  2KWD A;  4L2Y A;  1TTN A;  3Q69 A;  1B1Z A;  2IO3 B;  4ZRK A;  5BO4 B;  2M17 A;  4FHJ A;  3L16 A;  4ANV A;  3D32 A;  2MCN B;  1QQR A;  5MPO A;  4IG7 B;  2WQY B;  2LWP A;  1OTR B;  2D3B A;  3PRM B;  2JF5 A;  3RT3 B;  3MC0 B;  4GIV A;  3P2B A;  5DPW A;  5EE3 A;  3HIZ A;  3WAM A;  1ZXH A;  4JLC A;  1GAQ B;  3GS2 A;  2WXF A;  3RN9 C;  5JH5 C;  1YIW A;  1CK1 A;  3TCA A;  1YN4 A;  1GNU A;  4EZL A;  3J9C A;  4B0E A;  2V3P A;  3W1S C;  2WDR B;  4PS7 A;  4IDI A;  1IP9 A;  1SE2 A;  4LNN A;  4NY0 A;  5HHD G;  4OVU A;  4ZYS A;  2HE7 A;  4GDL A;  1V6E A;  4NPN A;  2PLP A;  2MSE D;  3N1Z C;  1WI0 A;  4ZDV A;  3Q8C A;  2VZK B;  3T3O A;  2Q5W D;  3V60 A;  1UWX A;  3A9K A;  3P4Q B;  1QOA A;  3Q8E A;  4R3D A;  4NNJ B;  4EUT A;  2WXJ A;  4GMV A;  3Q2A C;  3EA6 A;  2BKR B;  4NAM A;  5IO9 A;  1T0Q C;  2KO3 A;  2MLB A;  1YX5 B;  3C19 A;  3L54 A;  1L0V B;  4P1C C;  3Q8A A;  4LK0 M;  3PSE B;  2L76 A;  2XBB C;  3AEA B;  1WRI A;  4AJY B;  3DBH B;  4KKJ A;  2AWT A;  2JZP A;  3EFC A;  1RLF A;  1PFD A;  1HTO A;  2KZR A;  2PW9 A;  4QAY A;  1NEK B;  1K50 A;  1J19 A;  1RM6 C;  3ZXR A;  4II3 B;  4ZRJ A;  2JU6 X;  2EKI A;  2N7D A;  1QZE A;  2UU7 A;  1WYW B;  2FBW B;  2N9L A;  4MAC A;  1E0Z A;  3AEB B;  1KLG D;  5CHF A;  3H8H A;  1WE7 A;  2BT6 A;  3DOW A;  2X8X X;  5JHA A;  2KQ7 A;  3X23 A;  3CF6 E;  3QC8 B;  2KVR A;  2L0T A;  3DVN V;  2WP9 B;  3L08 A;  2KTR B;  4LNF A;  1LFD A;  3QJZ A;  4BKS D;  2KN4 A;  2KTR A;  1FFV A;  2JY6 A;  3UIP B;  1IPG A;  2J4X A;  5L83 A;  4OZB A;  4CYE A;  1V49 A;  1JW9 D;  1C76 A;  3ZUN A;  3PGE A;  4BZA A;  4W9I A;  3PLU A;  4HJG E;  1HQR D;  2DX5 B;  2LGI A;  4RH6 A;  3SDL C;  1DOY A;  3LB8 C;  4IC7 B;  4JWU C;  1FPY A;  4JX1 C;  3ZLZ A;  2JXX A;  4FUL A;  2Y5C A;  3ZJU A;  4F7Z A;  3TUO A;  1ZUD 2;  4US8 A;  2KOX A;  3DVN U;  2RSU A;  3QAQ A;  2DYM A;  2FCS A;  4WAA A;  4ANX A;  1NI3 A;  4HRS A;  3DCG A;  1XXG A;  2RR9 A;  4WWP A;  1NBF C;  2AX5 A;  3RNA C;  1K53 A;  3PRE A;  2JZZ A;  2BB5 A;  2WXG A;  2O2V B;  2V4I B;  3AV8 A;  4MJS B;  1YMH E;  2D3A A;  4W9H A;  1WXM A;  3BII D;  5KHO A;  3UGB B;  4KGT A;  2RMM A;  4BKT A;  1PUT A;  2O2V A;  4N9F 4;  2L8J A;  4XYC A;  1E7U A;  2K6D B;  3DBS A;  3VH4 B;  4UDU C;  3T9L A;  1WSP A;  4HK2 A;  4W9K A;  1ZE3 D;  3DDC B;  1NYQ A;  4ZYN A;  5HG2 A;  2INC C;  3ENE A;  3MTN B;  1MG4 A;  2WXN A;  1J7C A;  4DXF A;  2AQ1 B;  2N9P C;  2DAF A;  4KIK B;  2DYB A;  1YQB A;  2XEW A;  4YXD B;  5DCN A;  2D5G A;  3ZNH B;  2NTT A;  4KIK A;  2OHF A;  1YJ1 A;  2MHJ A;  2M56 B;  2IY1 B;  3H7P B;  4RF0 A;  1XQQ A;  3RNB C;  4EZJ A;  1T3Q A;  2NCN A;  2LGD A;  2WHI A;  1STE A;  2ZEQ A;  3KWV A;  4AUQ C;  1YQ4 B;  3ZJT A;  1T0Y A;  3NVZ A;  1FRR A;  5E6J A;  3VR8 B;  2HJ8 A;  2LVO A;  2MX2 A;  4M8N A;  1Z5S B;  5D3I B;  1OQR A;  2DZI A;  4K3C A;  4NAW B;  4JWS C;  2KJR A;  2NBU A;  3Q8B A;  3WCQ A;  1T5X D;  4NAW A;  1V80 A;  4J6I A;  1FFU A;  1JAL A;  3MHZ A;  1CJE A;  5LNK 1;  2GB1 A;  2BW2 A;  1JWU D;  1NYR A;  3U7Z A;  1F2R I;  4DHZ B;  1GB1 A;  2L52 A;  4WWN A;  2FUH B;  1VR9 A;  1TS4 A;  1FNV A;  4BVU C;  3TJP A;  2SAK A;  1WIA A;  3ZRC A;  1UD7 A;  1JCK B;  2D3G A;  1V9J A;  2V3N A;  1WGY A;  4K1R B;  4W9E A;  3VRB B;  3L0W B;  1GPX A;  1T0R C;  3ABV B;  2GI9 A;  2MBO A;  4N6E B;  1FRD A;  1IUE A;  2IGG A;  2HTH A;  2X38 A;  4BAX A;  2BS3 B;  1E7P B;  3KQ4 A;  1UBI A;  1E5W A;  2MRP A;  4LCD E;  2MBH A;  4B6W A;  2N0S B;  5JXV A;  4DXA B;  2O6V B;  3L10 B;  2WNM A;  2CHW A;  1SBB B;  1M94 A;  4RFB A;  2O6V A;  1J7B A;  1K8R B;  2WDV B;  2MQJ A;  1FNU A;  2GBM A;  1ZP0 B;  2IBI B;  3T8M A;  1WGK A;  1K52 A;  2KYW A;  5J18 A;  5HI1 A;  1TJE A;  3UIO B;  3H7S A;  4KZ0 A;  3I9V 1;  4G3X B;  2WXI A;  3EFU A;  2K6Q A;  2KK8 A;  3PRZ A;  4DXG A;  1Q0W B;  3VTV A;  1QIL A;  2BPS A;  4ZOH C;  2PVO D;  1WH3 A;  4XGA B;  4C7Z A;  4S17 A;  3A4S C;  3P1M A;  1VCB A;  2M4N A;  2WXP A;  4WH4 A;  4NJ6 A;  4JIO U;  2DBY A;  2NMQ A;  3MHS D;  3EGR A;  3L4P A;  4CHK A;  1VZ7 A;  2QHO A;  1WY8 A;  1UNS A;  3AE9 B;  5KHQ A;  2NBW B;  4HPL B;  1E9M A;  1QOF A;  4PK1 A;  4G50 A;  3ALB A;  5EE9 A;  3EC8 A;  5CTR C;  2K22 A;  2J0J A;  1SIF A;  5JZE B;  4K3B A;  3GE3 C;  2KTF A;  5HKH A;  3SHQ A;  2KQS A;  2MJ3 A;  3A33 B;  5AZF A;  2K8B A;  1I35 A;  1M4V A;  5J2R A;  3VR9 B;  4FN2 A;  4OZA A;  2C7M B;  1TY2 A;  3ECI A;  1NVI D;  4EEW A;  2LJ5 A;  3TEW A;  3PZD A;  2K39 A;  2LI5 A;  4ANW A;  1WMH B;  2BWF A;  1CQV A;  3B2G A;  4RGN A;  1WMH A;  1WGD A;  1N61 A;  1ZOY B;  4A8X C;  2V0G A;  5I4D A;  2REX A;  3KUC B;  3K9O B;  1XD3 B;  4GSW A;  4HVB A;  4C80 A;  2CR5 A;  4DDI D;  1PGX A;  4DHJ D;  4IOI E;  2EEL A;  1PDX A;  3AE8 B;  1WR6 E;  3AI5 A;  2LZ6 A;  1J7A A;  1YX6 B;  1L4D B;  1XCQ L;  2KFJ A;  1C4P A;  1WXA A;  1LXD A;  1RAX A;  3VDZ A;  3ZNG C;  3C0R B;  4B95 A;  4EE2 A;  3PV1 A;  5D2M B;  3BK1 A;  3LJ3 A;  2B76 B;  3M62 B;  3RZF A;  4XWW A;  2J0M A;  2KAN A;  1KFY B;  3RUL A;  3AE7 B;  2RGF A;  5IP4 D;  2HTM E;  2LGY A;  1WX9 A;  2LVQ A;  4I6P A;  2M0A A;  2DLB A;  1AWD A;  1V2Y A;  4FA6 A;  3N1Y C;  4M00 A;  1C77 A;  3ML9 A;  3TEY A;  1SJH D;  4OHJ A;  1T6B X;  4OVV A;  1PYW D;  2WX1 A;  2MBB B;  5E6P A;  5IA7 A;  4BKS A;  4A55 A;  4Q2J A;  1ISN A;  2WLB A;  1Q1O A;  1V81 A;  3RNF C;  2K3U A;  3HK0 A;  5G2N A;  2JRH A;  1Q5W B;  3B2F A;  2G4S A;  1P7F A;  1ROE A;  4O1N A;  3KUD B;  3KYC D;  1XO3 A;  2LXC A;  1C79 A;  3KW5 B;  4LTU A;  1IGD A;  1EU3 A;  1S3S G;  1KM7 A;  2WXL A;  1TKE A;  3NUH B;  1WXQ A;  3AE1 B;  2KWU B;  4A3P A;  3MJW A;  1KOT A;  1TIF A;  2W9N A;  4M01 A;  2J42 A;  2WDQ B;  4EOY A;  1MPE A;  1UBQ A;  1YNT E;  4G11 A;  5LLI A;  3KLS X;  1N5X A;  1TY0 A;  3AEC B;  4HKZ E;  4N58 A;  5EE0 A;  2ZPN A;  1AAR A;  2QIE B;  3IVF A;  2KMM A;  3QX1 A;  2JQR B;  4ZRI A;  2D3C A;  3ZTC A;  4GXB A;  2MEK A;  3WAP A;  2H88 B;  1WZ0 A;  1P0R A;  2KDE B;  1GC6 A;  1JRO A;  1FMA D;  3O65 B;  2VRR B;  1FXA A;  1EF5 A;  3AEF B;  4PYU A;  3DHG C;  3GZN I;  3IFW B;  4MDK E;  4A6Q A;  2ZCC A;  1WJ6 A;  4TKN A;  2GLS A;  1WM3 A;  2BS2 B;  3BK2 A;  2LGS A;  4RF1 A;  3ZJV A;  4HPP A;  2YEP F;  3LXF A;  2BYT A;  1I4P A;  4IWO A;  2I38 A;  1E7V A;  3W2D A;  1L7Y A;  3A1Q B;  3AN1 A;  4WWM A;  2JPH A;  2CHX A;  1XLQ A;  4DQO C;  3A1Q A;  4URK A;  1UGM A;  1ZKH A;  3V3X A;  3B0A A;  1D3Z A;  2JZ3 B;  3HVZ A;  2JYT A;  1IBX B;  1FNW A;  2GMI C;  1EU4 A;  2ICI A;  3RNG C;  1V1P B;  2E3T A;  4OW0 A;  3Q8F A;  1IBX A;  4AP4 C;  4GU2 A;  3DWG C;  1V1P A;  2RDB C;  3VFK A;  1JWM D;  2ZZP B;  1J0G A;  1F52 A;  3IAM 1;  2W55 A;  2PMV A;  1QLB B;  4FBJ B;  2EMT A;  2ZNV C;  1XLO A;  1OEY J;  4M8M A;  5BMH A;  3ZIM A;  1MHH E;  3W1Y A;  1QF6 A;  1WE6 A;  5FKA C;  2M8S A;  4ACF A;  1V86 A;  2ZPY A;  1HZ6 A;  3TEX A;  4HDO A;  2K9X A;  3VRA B;  4ZRQ A;  1JWA D;  1WJN A;  2PE6 B;  2IZV B;  1VJK A;  4FXC A;  4ARI A;  3NZS A;  3TEZ A;  3LDZ E;  5FK9 C;  5H8Y E;  3GB1 A;  3IXS A;  3DBR I;  4AJW A;  2WDT B;  3ZNI D;  1R4M B;  5C3J B;  2W3S A;  3APF A;  3DWM A;  4S0R A;  4ITK A;  2ZNV B;  3DHI C;  1KLU D;  1BXT A;  1ZGU B;  2L05 A;  1PQS A;  5DPR A;  2G45 B;  1E10 A;  2CJN A;  2MJE A;  3KYD D;  1BML C;  4AQ7 A;  3RNE C;  4AS1 A;  2ON8 A;  5CX3 A;  3FKY A;  4MGK E;  2B3A A;  2UWQ A;  2IDY A;  1YQ3 B;  5EE1 A;  1YN3 A;  3TIX A;  2JVC A;  2LRU A;  2IGD A;  4HCN B;  4K7S A;  3UI3 A;  4EKU A;  3U8Z A;  4KSL C;  5DPS A;  4A90 A;  3QAR A;  3HM6 X;  4JE3 B;  1DYQ A;  4MM3 B;  1LQB A;  3TL5 A;  5BMG A;  2MP2 B;  4K7U A;  1JWS D;  1GOZ A;  1N60 A;  2I1K A;  1WX8 A;  1TS2 A;  3APD A;  2LMC A;  2IGH A;  2BKF A;  2MP2 A;  2BTE A;  4HRO A;  1CZP A;  3OWE B;  4MJS A;  4OZC A;  1SF0 A;  2FUG 1;  1KF6 B;  1ZDV A;  1SIJ A;  5D3D A;  3EHV A;  2C7H A;  4HXD A;  2ZVO A;  3RUI B;  1GG3 A;  1V1O A;  4CO7 A;  3V61 A;  2DZJ A;  1WFY A;  5FR6 A;  3NJT A;  5TR5 A;  2FID A;  2M1M A;  1WGR A;  3BVG A;  2ZW1 A;  3CST A;  2J0K A;  3BY4 B;  1L2N A;  1TT5 B;  5CHW A;  3NS8 A;  1K51 A;  3GE8 C;  1VD2 A;  3L13 A;  3I57 A;  1JQ4 A;  1VZ8 A;  3GOE A;  3I63 C;  1I4X A;  4DHJ B;  4WQM A;  2LXA A;  2LVP A;  2ONQ A;  4KSK C;  3NVW A;  2IO0 B;  3H7P A;  5AUK A;  1R4N B;  1MHX A;  2INP E;  2K25 A;  4RGT A;  1DGJ A;  3OLM D;  5BMI A;  2LRW A;  2WWZ A;  3HVD A;  4WAF A;  2AL6 A;  3AUL A;  1R7S A;  2C7N B;  2K1F A;  1AW7 A;  3QIJ A;  1OFF A;  1WZ3 A;  4DHZ E;  2PTL A;  1WXV A;  1XF5 L;  2HD5 B;  2LUE A;  2Z8L A;  3KH0 A;  2K8C A;  3B9J A;  3ZTD A;  1NI2 A;  3QHT A;  2RD0 A;  1F1H A;  1HTQ A;  3ZO5 B;  1MFW A;  3ZDM C;  1TKY A;  2WYQ A;  3H9D A;  1WF9 A;  2I2Y A;  4ICV A;  3AH7 A;  3PHW B;  4CQN A;  3OJ3 A;  4XDD A;  3W5V B;  3NVY A;  3U52 E;  4L23 A;  3UF8 A;  2MJD A;  4RMA A;  3ZQ4 A;  2KLC A;  2KFK B;  2NS5 A;  2D07 B;  3VXW A;  3EUB 2;  4F1S A;  1N63 A;  3UQA A;  4ZRP A;  2KFK A;  4A20 A;  4W9J A;  2QEJ C;  2KN5 A;  1E8Y A;  1FEH A;  3P4P B;  5TSS A;  1PGB A;  3Q3M C;  3PPA A;  4BOZ B;  4PS3 A;  1HE8 A;  2KHW B;  4P16 A;  2L00 B;  1B9R A;  4A9A A;  4L1B A;  2KMC A;  1H8C A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3DHH C;  3GE8 C;  3RI7 C;  3RN9 C;  3Q3N C;  3RNE C;  3RNG C;  3RNC C;  3I63 C;  3DHG C;  4P1C C;  3Q3O C;  3N1Z C;  2INC C;  3GE3 C;  3RNA C;  3RNB C;  4P1B C;  1T0S C;  3Q3M C;  3I5J C;  2IND C;  3N1X C;  2RDB C;  3RNF C;  3Q14 C;  3N20 C;  3Q2A C;  3DHI C;  1T0R C;  3RMK C;  3N1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...