3RI7C

Toluene 4 monooxygenase hd mutant g103l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ri7C00
3DHHC 3RN9C 3Q2AC 3RNGC 2INCC 2RDBC 3DHIC 3Q14C 1T0SC 3I63C 4P1CC 2INDC 1T0QC 3RMKC 3RNEC 3N20C 3RNCC 3N1YC 3Q3MC 3RNBC 3RNAC 3DHGC 3RNFC 3Q3OC 3GE3C 3N1XC 3Q3NC 3RI7C 3I5JC 1T0RC 4P1BC 3GE8C 3N1ZC
chains in the Genus database with same CATH superfamily
2BYFA 4XE0A 1F52A 3RFZB 3B2FA 3PREA 3MHSD 1D5MC 1JWUD 1VZ7A 3NVWA 1A5RA 3DVNV 1SBBB 3RNEC 2CHWA 2V1YA 2HTME 1CK1A 4KZCA 2KMMA 4P7IA 1OQRA 1C76A 3I5JC 1WR1A 1I7HA 3OJ3A 2NCNA 2INPE 2WX0A 1E90A 1Z5SB 2NPTA 2DWQA 1C79A 3EUB2 3H7PA 2JT4B 1WX9A 2WXPA 2AQ1B 4GXBA 1PFDA 1FNWA 4KKJA 5L83A 1XEEA 1Q5WB 2N9EB 3CSFA 3MC9A 5DPTA 4ZRIA 3T9LA 3BIID 1EF1A 2WXRA 1TS5A 1F2RI 2L05A 3V62A 3VRBB 1UD7A 2MJEA 4ZHPA 3MP9A 2WNMA 1JCKB 1V80A 1ROEA 4IWQA 3SDLC 2H89B 4WH4A 5CHWA 1H4RA 2NBUA 4HKZE 4FLHA 2AQ2B 1VDVA 1R4MB 3GB1A 4A6QA 1FEHA 2MRPA 4EZKA 4HWIB 3VVWB 4XWWA 3MJ5A 3O13A 1GB4A 3ZUNA 3CIRB 2N7EA 1E5WA 2KQ4X 1NENB 4MSMB 3EGRA 3IFWB 2OHFA 2KXJA 3R8BA 1P7FA 2L00B 2LGYA 2C7NB 3NS1A 2MP2A 2L0TA 3W5VB 2JF5A 4OHJA 3RUIB 2O6VB 4MELA 2DZMA 2BYVE 3U7DA 5E6OA 3WAPA 1FIQA 3NRZA 4C80A 1CJEA 2NTSA 3AU5A 3BVZA 3T8MA 4OZAA 3Q3MC 1SSNA 1FMAD 5EDSA 3NUHB 1V5TA 5IN7A 3P4QB 3DVNU 1KLGD 1YNTE 3P4RB 3VH4B 3KUDB 5HG2A 1XCTL 2O2VB 1JRPA 1NBFC 4FXCA 2I1KA 5E6PA 2K3UA 2DYMA 2N9PC 4RMAA 4XDCA 1I42A 3AE5B 2KWDA 2V3NA 3C8YA 2MQJA 3NVVA 4E3CA 3I57A 2BYTA 4F8CB 2KO3A 4NAWA 4M8NA 4MH0E 1TKGA 1K50A 4KGTA 2V3SA 2FBWB 3PRMB 4ICVA 2LXCA 3KVFB 3JSVB 2G9HD 1T5XD 2WXFA 2B76B 4C7ZA 2BKRB 2FUHB 5AZGA 1QF6A 4BFRA 1N5WA 1SJED 3LB8C 2J42A 4WWOA 1NYQA 5GXGB 3QARA 1HXYD 2L1AA 4AJYB 2RDBC 2W3SA 1JWSD 1FNVA 1V8CA 4LNIA 2INNE 1WJ4A 4HRSA 2PE9A 1PGAA 1X1MA 1VLBA 2GBNA 2FIDA 5AZFA 1L4DB 2PE6B 2ACZB 4ACFA 2VRRB 1HTOA 3WAOA 3N30A 2KKCA 1TS4A 5HI1A 3VFKA 3ZJVA 2D3AA 2DZJA 1TJEA 2MP2B 1C77A 4KDLB 1FRDA 3TIXA 2KFKA 2JWZA 2K8BA 4NNJB 2MEKA 1WIAA 1P98A 2EKEC 4JE3B 3B08A 2M1MA 2K22A 2N1VA 4MH8A 1QT9A 1LGRA 4FHKA 4G3XB 2HDEA 1R4NB 4G11A 5CX3A 3PHWB 4PYZA 3GE3C 1KH0A 2J0KA 2GI9A 2SEBD 2MLBA 1E0ZA 1UGMA 3X23A 1IPGA 5D3IB 2KTRA 4DHJB 4GN1A 2IZVB 4AP4C 1LM8B 2NBVB 1PGBA 2BYEA 3DOWA 4RCOA 3B1LX 3H7SA 5GMVA 3EC8A 1BT0A 3UGBB 2ICIA 3SD5A 1RYJA 3ZJUA 2BT6A 2MJDA 1GG3A 2QSDA 2XK5B 4RF0A 5AUIA 2BS3B 2WXHA 2NPTB 3CMMB 1H8CA 4HKQA 3UIOB 1XT9B 3HM6X 3VHTC 4IM3A 4A55A 1RFKA 2MHJA 2D10A 4N58A 2JPHA 2BKFA 4I6LB 2LGXA 4TQ1A 1EU4A 4WWPA 3MC8A 2WP9B 4FJZA 3ECIA 3PSEB 4PK1A 4OZBA 2KX0A 2DENB 3DCGA 1WJUA 1N60A 4EOYA 1YQ3B 3RNAC 4L23A 1F9JA 1ZP0B 2Y5CA 3EFCA 1F0ZA 4E74A 2KN5A 2QCZA 2HJ1A 3GP7A 2N9KA 3T3OA 3AE1B 4AOFA 3X0WA 3JVZX 3RPFC 4ZHOA 5JHAA 3AV8A 5J18A 5IO9A 2CHXA 2KZRA 1KM7A 1KRHA 1DGJA 2XBBC 2YEPB 3TL5A 4LJPB 2D07B 3LYYA 2LVOA 2HD5B 2LVQA 3B0AA 2LRWA 2HE7A 1T3QA 4MJSB 4DHZE 3ZRCA 1Z2MA 4CYEA 5E6NA 1JWAD 2MBEA 4GLSC 3N1YC 4EZJA 2JRHA 4FJVB 3HIZA 4US8A 1OQQA 1RLFA 4ANXA 3QHTA 1E7UA 2WGSA 4YWGG 4KZ0A 5CTRC 2HTHA 2M17A 1E6EB 2IGGA 4TQ0A 2AQ3B 4ZRKA 3J9CA 1WRIA 3E56A 2LGIA 2LASA 2NS5A 2D11A 2I2YA 1SXTA 3EHVA 1J8CA 1BXTA 1YX6B 4OVUA 3SFEB 4IDIA 2DX5B 4E71A 4JIOU 3IVFA 4IG7B 4JPSA 2GBKA 4JX1C 2VH1A 1AW7A 2RGFA 3N9YC 1UZXB 4HEA1 4EEWA 1CMXB 1N6ZA 2E6XA 3LDZE 4W9GA 3ZNHB 1T0QC 1RFAA 2DZKA 1FFVA 2KDMA 4N59A 2MH7A 3ONSA 3L13A 4RGMA 2L7RA 3GOEA 3U8ZA 3NVZA 1B1ZA 4GDLB 3VAWA 1QILA 3PV1A 4ZRPA 1NVID 1WXVA 3BVGA 3QC8B 4NQKE 4IC7B 2DAJA 2EMSA 3AECB 1OEYA 2IO1B 3AEFB 1RRBA 2PIAA 3WCQA 2CJNA 2WDVB 2WDTB 2D3GA 3FC4A 3P1MA 1J7BA 1FM0D 2N0SB 1WH3A 3ZYYX 4ANWA 1WGHA 1T6BX 4PS8A 1K51A 3MHZA 4NJCA 2GB1A 3MC0B 2L52A 2KYWA 2AL6A 1XO3A 1B9RA 1V9JA 3M63B 4M01A 3Q69A 4DHZB 5G55A 5CHVC 4XX5A 2H88B 2N7DA 1NDDA 1ZDXA 4WURA 3HVZA 4CQNA 2IGHA 3PPAA 1ZE3D 2WXLA 1ZOYB 2ZPYA 2DYOA 1WGDA 1VZ8A 3P63A 3Q8BA 3VTVA 1KJTA 2G4DB 2LGSA 4FADA 3NHEB 1F2RC 1V1PB 1TBEA 3PZ8A 1E10A 2QC8A 4WQOB 5BYQA 5BYSA 4EE2A 5E6JA 3SU8X 4BBNC 3UI3A 1I4XA 1WI0A 2C7MB 4JWSC 2V4IB 4W9EA 4P1BC 2D3CA 3H7PB 4BOZB 1FXTB 3DHHC 4KIKB 1Q0WB 3VTUA 5TSSA 1C4CA 4C56C 1AYFA 4BOSC 3RT3B 1ESFA 3OWEB 3JSVA 3N20C 4C00A 2W54A 2WDRB 1L5PA 1ZXIA 3FILB 3BVMA 4OW0A 4MT5A 3HM3A 4NAWB 4MGYE 2R2QA 3KW5B 4A3OA 2WYQA 2A4ZA 4JL9A 4WJNA 3KUCB 3QK0A 3KWVA 2M4NA 2WXKA 2RPVA 2Z8LA 4C4VB 1C4AA 3OLMD 3PLUA 1FD6A 1YQBA 2LD9A 2UYZB 3L10B 4NPNA 1R4NI 4LLGM 3DBSA 2BQQA 3ZNID 4DXAB 3MTNB 4AQ7A 3E9SA 4TMAB 1ET9A 3M3JA 3H9DA 1TS2A 4BKSD 1D3ZA 4OVZA 1L0XB 3HRDD 4Q2JA 2ZW1A 2KDFB 1N62A 2INDC 2CHZA 4ZYSA 4B9KA 3KYCD 4WAAA 2D5GA 2JZPA 2KC2A 1LQBA 3BINA 2WU2B 1UH6A 5EE1A 5BMHA 3QWZB 4WAFA 3L08A 4ITKA 2VH2A 1Y56A 2K9XA 3QA8A 3ZDMC 3VUWA 2N4FA 3B9JA 2C60A 3EECA 4KDIC 4XDDA 3RZFA 4PYUA 2JXXA 1P7EA 3CWIA 1GNUA 4GOCA 4TSSA 1IYFA 2QMTA 3L16A 3AE2B 4AUQC 2W82A 1ZKHA 1QOBA 3AULA 4S17A 1TZOA 3K9PB 3TBLD 1BMLC 2QHOA 1V2YA 5KHOA 3SHQA 2LI5A 4LK0M 1WMHB 2BWFA 1JQ4A 1AARA 1V5OA 2ZNVB 1QZEA 2V3PA 1VD2A 1C3TA 1WJ6A 2L83A 2LWPA 2YEPF 2GBJA 3RD2A 2GBMA 3A33B 4KKIA 2L0FA 4LDTB 3DBLI 3LJ3A 1WY8A 1IBXA 2KWUB 2D3BA 2V4LA 4QAYA 4GGQA 2KTFA 4MM3B 2OJWA 3AE3B 2EKIA 5AUKA 1BUIC 1SE4A 3N1XC 3IXSA 3A9JA 3BK2A 2Z0EB 1PQSA 1UBIA 1Q10A 3TSSA 1K8RB 2PJHA 1IGCA 1I4QA 3QCAA 4K81A 4MACA 3VUYA 5I4DA 3OAWA 1WGYA 4TV3A 4TUUA 1L0YB 1KTKA 3VXWA 1T0RC 2C9WB 2OEDA 4GDKA 4A9AA 3RCZA 3TCAA 3BK1A 3W2DA 3BYTB 2LFIA 3UIPB 2KVRA 2G3QB 2PKOA 1UELA 1XXGA 1DYQA 3P4SB 3GZNB 5FKAC 4BAXA 1PDXA 2X8XX 4XWTA 4LTUA 2AL3A 3PZ7A 1TYGB 1MVKA 3IT6B 1UF0A 4RGNA 2NTTA 4BKGA 1L2NA 4ARIA 3BYYB 3U4EG 2CU3A 3A9KB 1FPYA 5KHQA 3ZNGC 1VR9A 2M19A 2QIEB 3H8HA 2GLSA 2MBHA 2ZNVC 2IO2B 3P42A 1N63A 3AXCA 4ZDVA 2W9NA 4HJKA 2PMVA 3PO0A 4N9F4 3B2GA 2IY0B 1E8XA 4BVUC 4W9CA 4YTMB 2REXA 2N1WA 3FKYA 1YD8U 3AE4B 1YN3A 2WXMA 2RMMA 3DHIC 1I4HA 5LLIA 3W9CB 4K1RB 1WJNA 4ANVA 3PRPB 1QOGA 4KVGB 1VJKA 4USAA 4DXFA 5D94A 1G6JA 2L3ZA 3HK0A 3ZGZA 3MFGA 3AEAB 3Q3OC 1F77A 1R7SA 3ALBA 4GDLA 3DDCB 3VTWA 4K7WA 3ZLZA 1SEBD 5DPRA 4ANUA 2FAZA 2IO0B 1XLNA 4B95A 2ASQA 3WALA 5IA7A 2MBBB 4WWMA 1EO6A 3ML9A 4EZLA 1WRDB 2KT7A 2DBYA 2KLCA 1ACCA 1OEYJ 4PT5A 1KLUD 3VQIA 2GRIA 2Y5BB 3S2AA 5FR3A 3UF8A 1IP9A 5DCNA 1J7CA 2DYBA 4RFBA 2QEJC 3BZDB 2KX3A 3N3KB 3H1UA 1ZW7A 2K25A 1JMLA 5C2TB 3AB5A 4S0RA 3H6NA 2DZIA 3KLSX 1XCQL 4NAMA 3V61A 2ZJDA 3RULA 2C7HA 1GC6A 1SIFA 3IBEA 3KYDD 2JUOA 3UQAA 1UWMA 1TZ1A 1S3SG 4UDUC 1HE8A 1D6EC 1LO5D 1TS3A 2INCC 2CR5A 4ZRQA 3P2BA 4DXGA 1WYWB 2J0MA 2WX1A 4M8MA 3GZNI 4G0NB 2VZKB 1V81A 2EMTA 2G1EA 2QJLA 4GDKB 1NI3A 1ZPSA 4MGIE 2N9LA 1Q1OA 3EFUA 1OFFA 2E3TA 4HPMB 4GU2A 1DOXA 5TR5A 2M8SA 5H8YE 1NEKB 3VH3B 1ISNA 3DQVA 5LXHA 1D5XC 4WJOA 2DLBA 2DHZA 1YJJA 1PYWD 4HK2A 4LNKA 1F1HA 4IOIE 3TEXA 3DBRB 4HROA 3GS2A 5C3JB 2AEHA 4R3DA 2LRUA 3V3XA 3T3NA 2XNAC 2V0GA 3V05A 2OJRA 3V6EB 3PRZA 1MFWA 4PS7A 5HFYA 1GPXA 1WXSA 4KSKC 2K5PA 3BY4B 4FULA 5J2RA 1RM6C 3PLVA 2XN9C 4YTPB 3OG5A 3NJTA 2KFJA 1TKYA 3DWGC 1YX5B 2CU1A 2K1FA 3Q3FA 2V9HA 1J0GA 5MPOA 3QIJA 2ZCCA 4K3CA 2WXOA 2ZPNA 2VZKD 4RH6A 2BW2A 2LGDA 3V6CB 5FR6A 4HLEA 1E7PB 3MJWA 2GMIC 3RNFC 3M95A 4B6WA 2W3RA 3AH7A 2KOXA 3ZXRA 4YSYB 5IOIA 4L2YA 3RNGC 1M94A 2BWES 2KWVB 3AEEB 1YN5A 1STEA 4I6PA 4CO7A 2JSVX 1IGDA 5AEKB 3BWUD 3V60A 4ZYNA 4KV2A 3QX1A 2R2OA 4BBNF 2BGFA 3CF6E 2M0AA 3DBRI 4XZ4A 4W9FA 4A3PA 3ML8A 1FCLA 4HPPA 1S1QB 1XLQA 4WIPA 4HVBA 2YLMA 1QQRA 2ZCBA 1DOYA 2K6QA 3TMPB 1WM3A 1A70A 4KX6B 1C9FA 4ZRJA 5JH5C 4KGSA 3SFDB 2YVCA 3HVDA 1SE9A 2WHIA 5JXVA 1V49A 2FIFA 4KSLC 2FCQA 3AE8B 4C4VA 4NZLB 3ZVVA 2J0JA 2LZ6A 3N32A 4D2KA 3W1SC 1JWMD 3ZQ4A 2KD0A 2DNFA 3SR6A 2I38A 2QDFA 2LXAA 2Q5WD 2QILA 4P16A 1QOFA 2LMCA 1HTQA 2Y5PA 4NQLB 4LDTD 4YXDB 4FHJA 2LUEA 4F1SA 4GIVA 2J7QB 4JGHB 4RF1A 2Y3AA 3PGEA 1OGWA 3WAMA 2C5LC 2O2VA 4ARCA 2A5UA 3SEBA 4DBGA 1L6VA 3A9KA 4W9DA 3AN1A 4ZOHC 4JLCA 1EWCA 3TEWA 2MA9B 3QAQA 3NZ3A 3PS6A 1QKZA 1KOTA 2JU6X 4IWOA 3L4PA 4NY0A 1P1AA 3WANA 1GC7A 1XD3B 4IUMB 5AZHA 3U52E 2JYEA 3A4SC 5BYRA 1C1YB 5EE9A 3A1QB 3O65B 4K3BA 3ZRFA 5G5GA 4XC2A 2KWCA 4C7YA 2BF8B 3I3TB 4K7SA 2JRIB 1EWYC 2Z0DB 5H92C 1EM7A 1E8WA 2KJHB 4RGOS 4AJWA 1VCBA 1UNSA 2UWQA 2WS3B 2FNJB 1FNUA 3URYA 1CQVA 4KGRA 4J6IA 3RNCC 2JZZA 4AS1A 3Q8EA 1VRAB 1WZ0A 4IWPA 5DPSA 2LHEA 3U7ZA 1EU3A 1L4ZB 3JYUA 2JY6A 5C23A 1E8ZA 3R7QA 1YN4A 4W9IA 4US9A 2ZEQA 4DWFA 2NBWB 4URKA 2PW9A 5D7GA 3U2SC 2MBQA 2MW5A 2R61A 1WXAA 3DBHB 1MI0A 4WJQA 2KQ7A 2FCNA 3AEGB 4MEMA 1WGKA 4GSWA 1I4PA 2MSED 1R4MI 2IBIB 2LVPA 4W9HA 3FAHA 4RNAA 2MCNB 5CHFA 4F7ZA 2MX2A 2RDHA 3R2TA 2JZ3B 2NVUI 3N1ZC 3Q3JA 2KJRA 1WX8A 1P3QU 1WXMA 3I63C 2ZVOA 3VR8B 4NJ7A 5LXIB 4A20A 3K9OB 1I35A 4M0WA 3AM9A 1KFYB 3ZJTA 2XK5A 4M02A 2BVCA 4LNNA 4HJGE 4DK5A 2BB5A 4HPLB 2WXQA 2JX5A 1YJIA 1MJDA 4IM2A 2FUG1 1JROA 3AE9B 3NY5A 5D2MB 4YT0B 5IAAC 4MM3A 2CS4A 4NJ6A 2MBOA 3RMKC 4DHJD 3L0WB 3APFA 3R3MA 1L7YA 3AMZA 4RGTA 3DHGC 1ZGUB 1WFYA 3ZW3A 1JWBD 2KVZA 2WXJA 1P0RA 1WYGA 2K0PA 2WQYB 1FCCC 3UINB 2RDGA 2MJ3A 4HCNB 2NR2A 4BZAA 5JHBA 1U4AA 1WE6A 5DPWA 5BMIA 1L6UA 3M62B 4JQWC 2BTEA 2PVGC 3KWLA 4P6VF 1FO4A 1HEZE 1WR6E 2MWSB 3QJZA 4HDOA 1GJZA 3Q8CA 1ZDVA 3HUIA 1SIJA 1TGZB 4ASWC 1MHXA 1SJHD 2AWTA 4DDGD 2JYTA 1ENFA 3RYTA 3FILA 3Q8FA 2IDYA 1WE7A 2WDQB 3ENEA 2AYOB 1TT5B 1JW9D 1IBXB 1OTRB 1UUPA 2JQRB 3QQ8B 3ZTDA 2PTLA 1KF6B 4LNOA 2WXNA 3W5UB 1ET6A 2JWUA 2KAJA 2LJIA 2RD0A 2KDIA 2KDEB 4MDKE 1HZ5A 3APCA 1E8YA 1XLOA 4CHKA 2B3AA 3DVGY 3GE8C 4J3OD 4II2B 2EELA 2WLBA 2BBCA 4G50A 2O6VD 2LJ5A 4REZA 2SAKA 5BO4B 3ZDTA 2RSUA 3TEZA 4MSQB 1HA5A 3WA0A 3I9V1 2IGDA 2ZW0A 2L8JA 3DBLB 1YOVB 5EE0A 1WGGA 3Q8AA 2GBRA 1LFDA 3RN9C 4N6EB 2IY1B 1V1PA 5C1ZA 4EKUA 1NYRA 2IYDB 1UGJA 2ONQA 2KJ6A 1FXAA 2N9XA 1WSPA 3AE7B 3ZXVA 1YMHE 3ZIMA 3PTFC 3L17A 3IT4B 2J4XA 1XLPA 3TJPA 3ZO5B 1E9MA 1UWXA 2KANA 3NG0A 1PUTA 3RI7C 3NZSA 2KACA 3L54A 3IAS1 4KIKA 2Z59B 4YL8A 2W55A 2PLPA 4JWUC 1K53A 4MGKE 3RZWC 1IUEA 2CJOA 5BMGA 3ZTCA 1FRRA 2UU7A 1ZUD2 3NVYA 3TEYA 3KUZA 2ZVNA 3PZDA 2IO3B 4FN2A 4DQOC 3Q6BA 3KH0A 4A90A 4I6NB 1D5ZC 1EF5A 2O6VA 4OZCA 2WXIA 1VZ6A 4X57B 1YIWA 4YSZB 2G45B 2BPSA 4GMVA 1TIFA 5IKCM 4PS3A 4YSXB 3Q3NC 3VUXA 4RM8A 1XQQA 5LNK1 3AE6B 3R7RA 4HXDA 2XEWA 3VRAB 1V6EA 2FE8A 3ABVB 4OVVA 3ZNZB 4W9JA 1LXDA 3U30A 4FJYA 2N7JA 4H2AA 2KDBA 4XGAB 1L0VB 1I4RA 4L1BA 4B0EA 1I4GA 2LUMA 4IW0A 1P9DU 2HJ8A 1UBQA 1AWDA 2PVOD 5HKHA 3W1YA 2FCMA 2BS4B 5L95C 1D4BA 2JVCA 2J52A 3A4RA 1TY0A 3C19A 3PVLA 1FFUA 3NOBA 1TTNA 3RNBC 2JXTA 1OQYA 1ZXHA 1DOIA 1C78A 1M4VA 2RR9A 2PPHA 2BS2B 2TSSA 3AEBB 4WJPA 3Q14C 4DDID 4BKTA 1GUAB 2I1JA 4AWJA 3KQ4A 2IPKD 1HQRD 3JW0X 1J7AA 1TY2A 3C0RB 3CSTA 1J19A 1MG4A 2K8HA 1K52A 3NS8A 2FCSA 1WF9A 3R2IA 1XF5L 4BKSA 3APDA 1V1OA 1T0YA 1WX7A 3AEDB 3IG3A 4A8XC 4O1NA 2X38A 2LEKA 2KLGA 2K6DB 4FA6A 2IJ0A 5EE3A 2J53A 1SE3A 3OJ4B 1CZPA 5T8IA 4EUTA 1PGXA 1GAQB 3P4PB 3LXFA 2D2QA 4M00A 2AX5A 1MPEA 1YQ4B 3DWMA 2K8CA 4P1CC 4XYCA 1QOAA 4M0WB 5JZEB 1N5XA 2BB6A 1FXIA 5IP4D 1WXQA 4W9KA 2WWZA 1WMHA 1AN8A 4WWNA 5G5HA 4MGZE 3VR9B 1WWTA 5D3DA 4LCDE 3IHPC 2OOBB 2WXGA 3UQBA 1C4PA 4TKNA 4FBJB 2KHWB 1GB1A 2KTRB 3PHXB 1SF0A 1YJ1A 3Q2AC 4IM0A 2PEAA 1E7VA 4ICUA 1V97A 1WGRA 3A1QA 2CKHB 2M56B 4II3B 2G4SA 1QLBB 2GOWA 3PT2B 4GB9A 1N61A 3AI5A 1SGHA 2L76A 2WU5B 4IKGA 1MG8A 4RM9A 4HDQA 2LHDA 5D6JB 1TKEA 2ZZPB 2K39A 1WZ3A 3EA6A 2KK8A 3WIMA 2L32A 1EUVB 1GOZA 1T0SC 3HHMA 3NZUA 1KLVA 2KN4A 3R66C 1MHHE 3AU4A 3DVGX 3DPDA 3DBHI 1HZ6A 4B0MA 3W1SA 1Y8RC 2DAFA 3VDZA 4EFOA 3TUOA 3ZKJC 1SE2A 2M0XA 4WQMA 5HHDG 5J17A 1JALA 1JRUA 1NI2A 2KC1A 3ETRA 4MJSA 2KMAA 1WM2A 2ON8A 4LJOB 4W9LA 1V86A 5G2NA 4YTNB 2KNBA 1SB3C 2KFKB 1RAXA 2KMCA 4LNFA 5FK9C 3IAM1 2KQSA 3D32A 3A9JB 2RPQA 1RWSA 4K7UA 2NMQA 4HCPB
chains in the Genus database with same CATH topology
3DHHC 3RN9C 3Q2AC 3RNGC 2INCC 2RDBC 3DHIC 3Q14C 1T0SC 3I63C 4P1CC 2INDC 1T0QC 3RMKC 3RNEC 3N20C 3RNCC 3N1YC 3Q3MC 3RNBC 3RNAC 3DHGC 3RNFC 3Q3OC 3GE3C 3N1XC 3Q3NC 3RI7C 3I5JC 1T0RC 4P1BC 3GE8C 3N1ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  3RN9 C;  3Q2A C;  3RNG C;  2INC C;  2RDB C;  3DHI C;  3Q14 C;  1T0S C;  3I63 C;  4P1C C;  2IND C;  1T0Q C;  3RMK C;  3RNE C;  3N20 C;  3RNC C;  3N1Y C;  3Q3M C;  3RNB C;  3RNA C;  3DHG C;  3RNF C;  3Q3O C;  3GE3 C;  3N1X C;  3Q3N C;  3RI7 C;  3I5J C;  1T0R C;  4P1B C;  3GE8 C;  3N1Z C; 
#chains in the Genus database with same CATH topology
 2BYF A;  4XE0 A;  1F52 A;  3RFZ B;  3B2F A;  3PRE A;  3MHS D;  1D5M C;  1JWU D;  1VZ7 A;  3NVW A;  1A5R A;  3DVN V;  1SBB B;  3RNE C;  2CHW A;  2V1Y A;  2HTM E;  1CK1 A;  4KZC A;  2KMM A;  4P7I A;  1OQR A;  1C76 A;  3I5J C;  1WR1 A;  1I7H A;  3OJ3 A;  2NCN A;  2INP E;  2WX0 A;  1E90 A;  1Z5S B;  2NPT A;  2DWQ A;  1C79 A;  3EUB 2;  3H7P A;  2JT4 B;  1WX9 A;  2WXP A;  2AQ1 B;  4GXB A;  1PFD A;  1FNW A;  4KKJ A;  5L83 A;  1XEE A;  1Q5W B;  2N9E B;  3CSF A;  3MC9 A;  5DPT A;  4ZRI A;  3T9L A;  3BII D;  1EF1 A;  2WXR A;  1TS5 A;  1F2R I;  2L05 A;  3V62 A;  3VRB B;  1UD7 A;  2MJE A;  4ZHP A;  3MP9 A;  2WNM A;  1JCK B;  1V80 A;  1ROE A;  4IWQ A;  3SDL C;  2H89 B;  4WH4 A;  5CHW A;  1H4R A;  2NBU A;  4HKZ E;  4FLH A;  2AQ2 B;  1VDV A;  1R4M B;  3GB1 A;  4A6Q A;  1FEH A;  2MRP A;  4EZK A;  4HWI B;  3VVW B;  4XWW A;  3MJ5 A;  3O13 A;  1GB4 A;  3ZUN A;  3CIR B;  2N7E A;  1E5W A;  2KQ4 X;  1NEN B;  4MSM B;  3EGR A;  3IFW B;  2OHF A;  2KXJ A;  3R8B A;  1P7F A;  2L00 B;  2LGY A;  2C7N B;  3NS1 A;  2MP2 A;  2L0T A;  3W5V B;  2JF5 A;  4OHJ A;  3RUI B;  2O6V B;  4MEL A;  2DZM A;  2BYV E;  3U7D A;  5E6O A;  3WAP A;  1FIQ A;  3NRZ A;  4C80 A;  1CJE A;  2NTS A;  3AU5 A;  3BVZ A;  3T8M A;  4OZA A;  3Q3M C;  1SSN A;  1FMA D;  5EDS A;  3NUH B;  1V5T A;  5IN7 A;  3P4Q B;  3DVN U;  1KLG D;  1YNT E;  3P4R B;  3VH4 B;  3KUD B;  5HG2 A;  1XCT L;  2O2V B;  1JRP A;  1NBF C;  4FXC A;  2I1K A;  5E6P A;  2K3U A;  2DYM A;  2N9P C;  4RMA A;  4XDC A;  1I42 A;  3AE5 B;  2KWD A;  2V3N A;  3C8Y A;  2MQJ A;  3NVV A;  4E3C A;  3I57 A;  2BYT A;  4F8C B;  2KO3 A;  4NAW A;  4M8N A;  4MH0 E;  1TKG A;  1K50 A;  4KGT A;  2V3S A;  2FBW B;  3PRM B;  4ICV A;  2LXC A;  3KVF B;  3JSV B;  2G9H D;  1T5X D;  2WXF A;  2B76 B;  4C7Z A;  2BKR B;  2FUH B;  5AZG A;  1QF6 A;  4BFR A;  1N5W A;  1SJE D;  3LB8 C;  2J42 A;  4WWO A;  1NYQ A;  5GXG B;  3QAR A;  1HXY D;  2L1A A;  4AJY B;  2RDB C;  2W3S A;  1JWS D;  1FNV A;  1V8C A;  4LNI A;  2INN E;  1WJ4 A;  4HRS A;  2PE9 A;  1PGA A;  1X1M A;  1VLB A;  2GBN A;  2FID A;  5AZF A;  1L4D B;  2PE6 B;  2ACZ B;  4ACF A;  2VRR B;  1HTO A;  3WAO A;  3N30 A;  2KKC A;  1TS4 A;  5HI1 A;  3VFK A;  3ZJV A;  2D3A A;  2DZJ A;  1TJE A;  2MP2 B;  1C77 A;  4KDL B;  1FRD A;  3TIX A;  2KFK A;  2JWZ A;  2K8B A;  4NNJ B;  2MEK A;  1WIA A;  1P98 A;  2EKE C;  4JE3 B;  3B08 A;  2M1M A;  2K22 A;  2N1V A;  4MH8 A;  1QT9 A;  1LGR A;  4FHK A;  4G3X B;  2HDE A;  1R4N B;  4G11 A;  5CX3 A;  3PHW B;  4PYZ A;  3GE3 C;  1KH0 A;  2J0K A;  2GI9 A;  2SEB D;  2MLB A;  1E0Z A;  1UGM A;  3X23 A;  1IPG A;  5D3I B;  2KTR A;  4DHJ B;  4GN1 A;  2IZV B;  4AP4 C;  1LM8 B;  2NBV B;  1PGB A;  2BYE A;  3DOW A;  4RCO A;  3B1L X;  3H7S A;  5GMV A;  3EC8 A;  1BT0 A;  3UGB B;  2ICI A;  3SD5 A;  1RYJ A;  3ZJU A;  2BT6 A;  2MJD A;  1GG3 A;  2QSD A;  2XK5 B;  4RF0 A;  5AUI A;  2BS3 B;  2WXH A;  2NPT B;  3CMM B;  1H8C A;  4HKQ A;  3UIO B;  1XT9 B;  3HM6 X;  3VHT C;  4IM3 A;  4A55 A;  1RFK A;  2MHJ A;  2D10 A;  4N58 A;  2JPH A;  2BKF A;  4I6L B;  2LGX A;  4TQ1 A;  1EU4 A;  4WWP A;  3MC8 A;  2WP9 B;  4FJZ A;  3ECI A;  3PSE B;  4PK1 A;  4OZB A;  2KX0 A;  2DEN B;  3DCG A;  1WJU A;  1N60 A;  4EOY A;  1YQ3 B;  3RNA C;  4L23 A;  1F9J A;  1ZP0 B;  2Y5C A;  3EFC A;  1F0Z A;  4E74 A;  2KN5 A;  2QCZ A;  2HJ1 A;  3GP7 A;  2N9K A;  3T3O A;  3AE1 B;  4AOF A;  3X0W A;  3JVZ X;  3RPF C;  4ZHO A;  5JHA A;  3AV8 A;  5J18 A;  5IO9 A;  2CHX A;  2KZR A;  1KM7 A;  1KRH A;  1DGJ A;  2XBB C;  2YEP B;  3TL5 A;  4LJP B;  2D07 B;  3LYY A;  2LVO A;  2HD5 B;  2LVQ A;  3B0A A;  2LRW A;  2HE7 A;  1T3Q A;  4MJS B;  4DHZ E;  3ZRC A;  1Z2M A;  4CYE A;  5E6N A;  1JWA D;  2MBE A;  4GLS C;  3N1Y C;  4EZJ A;  2JRH A;  4FJV B;  3HIZ A;  4US8 A;  1OQQ A;  1RLF A;  4ANX A;  3QHT A;  1E7U A;  2WGS A;  4YWG G;  4KZ0 A;  5CTR C;  2HTH A;  2M17 A;  1E6E B;  2IGG A;  4TQ0 A;  2AQ3 B;  4ZRK A;  3J9C A;  1WRI A;  3E56 A;  2LGI A;  2LAS A;  2NS5 A;  2D11 A;  2I2Y A;  1SXT A;  3EHV A;  1J8C A;  1BXT A;  1YX6 B;  4OVU A;  3SFE B;  4IDI A;  2DX5 B;  4E71 A;  4JIO U;  3IVF A;  4IG7 B;  4JPS A;  2GBK A;  4JX1 C;  2VH1 A;  1AW7 A;  2RGF A;  3N9Y C;  1UZX B;  4HEA 1;  4EEW A;  1CMX B;  1N6Z A;  2E6X A;  3LDZ E;  4W9G A;  3ZNH B;  1T0Q C;  1RFA A;  2DZK A;  1FFV A;  2KDM A;  4N59 A;  2MH7 A;  3ONS A;  3L13 A;  4RGM A;  2L7R A;  3GOE A;  3U8Z A;  3NVZ A;  1B1Z A;  4GDL B;  3VAW A;  1QIL A;  3PV1 A;  4ZRP A;  1NVI D;  1WXV A;  3BVG A;  3QC8 B;  4NQK E;  4IC7 B;  2DAJ A;  2EMS A;  3AEC B;  1OEY A;  2IO1 B;  3AEF B;  1RRB A;  2PIA A;  3WCQ A;  2CJN A;  2WDV B;  2WDT B;  2D3G A;  3FC4 A;  3P1M A;  1J7B A;  1FM0 D;  2N0S B;  1WH3 A;  3ZYY X;  4ANW A;  1WGH A;  1T6B X;  4PS8 A;  1K51 A;  3MHZ A;  4NJC A;  2GB1 A;  3MC0 B;  2L52 A;  2KYW A;  2AL6 A;  1XO3 A;  1B9R A;  1V9J A;  3M63 B;  4M01 A;  3Q69 A;  4DHZ B;  5G55 A;  5CHV C;  4XX5 A;  2H88 B;  2N7D A;  1NDD A;  1ZDX A;  4WUR A;  3HVZ A;  4CQN A;  2IGH A;  3PPA A;  1ZE3 D;  2WXL A;  1ZOY B;  2ZPY A;  2DYO A;  1WGD A;  1VZ8 A;  3P63 A;  3Q8B A;  3VTV A;  1KJT A;  2G4D B;  2LGS A;  4FAD A;  3NHE B;  1F2R C;  1V1P B;  1TBE A;  3PZ8 A;  1E10 A;  2QC8 A;  4WQO B;  5BYQ A;  5BYS A;  4EE2 A;  5E6J A;  3SU8 X;  4BBN C;  3UI3 A;  1I4X A;  1WI0 A;  2C7M B;  4JWS C;  2V4I B;  4W9E A;  4P1B C;  2D3C A;  3H7P B;  4BOZ B;  1FXT B;  3DHH C;  4KIK B;  1Q0W B;  3VTU A;  5TSS A;  1C4C A;  4C56 C;  1AYF A;  4BOS C;  3RT3 B;  1ESF A;  3OWE B;  3JSV A;  3N20 C;  4C00 A;  2W54 A;  2WDR B;  1L5P A;  1ZXI A;  3FIL B;  3BVM A;  4OW0 A;  4MT5 A;  3HM3 A;  4NAW B;  4MGY E;  2R2Q A;  3KW5 B;  4A3O A;  2WYQ A;  2A4Z A;  4JL9 A;  4WJN A;  3KUC B;  3QK0 A;  3KWV A;  2M4N A;  2WXK A;  2RPV A;  2Z8L A;  4C4V B;  1C4A A;  3OLM D;  3PLU A;  1FD6 A;  1YQB A;  2LD9 A;  2UYZ B;  3L10 B;  4NPN A;  1R4N I;  4LLG M;  3DBS A;  2BQQ A;  3ZNI D;  4DXA B;  3MTN B;  4AQ7 A;  3E9S A;  4TMA B;  1ET9 A;  3M3J A;  3H9D A;  1TS2 A;  4BKS D;  1D3Z A;  4OVZ A;  1L0X B;  3HRD D;  4Q2J A;  2ZW1 A;  2KDF B;  1N62 A;  2IND C;  2CHZ A;  4ZYS A;  4B9K A;  3KYC D;  4WAA A;  2D5G A;  2JZP A;  2KC2 A;  1LQB A;  3BIN A;  2WU2 B;  1UH6 A;  5EE1 A;  5BMH A;  3QWZ B;  4WAF A;  3L08 A;  4ITK A;  2VH2 A;  1Y56 A;  2K9X A;  3QA8 A;  3ZDM C;  3VUW A;  2N4F A;  3B9J A;  2C60 A;  3EEC A;  4KDI C;  4XDD A;  3RZF A;  4PYU A;  2JXX A;  1P7E A;  3CWI A;  1GNU A;  4GOC A;  4TSS A;  1IYF A;  2QMT A;  3L16 A;  3AE2 B;  4AUQ C;  2W82 A;  1ZKH A;  1QOB A;  3AUL A;  4S17 A;  1TZO A;  3K9P B;  3TBL D;  1BML C;  2QHO A;  1V2Y A;  5KHO A;  3SHQ A;  2LI5 A;  4LK0 M;  1WMH B;  2BWF A;  1JQ4 A;  1AAR A;  1V5O A;  2ZNV B;  1QZE A;  2V3P A;  1VD2 A;  1C3T A;  1WJ6 A;  2L83 A;  2LWP A;  2YEP F;  2GBJ A;  3RD2 A;  2GBM A;  3A33 B;  4KKI A;  2L0F A;  4LDT B;  3DBL I;  3LJ3 A;  1WY8 A;  1IBX A;  2KWU B;  2D3B A;  2V4L A;  4QAY A;  4GGQ A;  2KTF A;  4MM3 B;  2OJW A;  3AE3 B;  2EKI A;  5AUK A;  1BUI C;  1SE4 A;  3N1X C;  3IXS A;  3A9J A;  3BK2 A;  2Z0E B;  1PQS A;  1UBI A;  1Q10 A;  3TSS A;  1K8R B;  2PJH A;  1IGC A;  1I4Q A;  3QCA A;  4K81 A;  4MAC A;  3VUY A;  5I4D A;  3OAW A;  1WGY A;  4TV3 A;  4TUU A;  1L0Y B;  1KTK A;  3VXW A;  1T0R C;  2C9W B;  2OED A;  4GDK A;  4A9A A;  3RCZ A;  3TCA A;  3BK1 A;  3W2D A;  3BYT B;  2LFI A;  3UIP B;  2KVR A;  2G3Q B;  2PKO A;  1UEL A;  1XXG A;  1DYQ A;  3P4S B;  3GZN B;  5FKA C;  4BAX A;  1PDX A;  2X8X X;  4XWT A;  4LTU A;  2AL3 A;  3PZ7 A;  1TYG B;  1MVK A;  3IT6 B;  1UF0 A;  4RGN A;  2NTT A;  4BKG A;  1L2N A;  4ARI A;  3BYY B;  3U4E G;  2CU3 A;  3A9K B;  1FPY A;  5KHQ A;  3ZNG C;  1VR9 A;  2M19 A;  2QIE B;  3H8H A;  2GLS A;  2MBH A;  2ZNV C;  2IO2 B;  3P42 A;  1N63 A;  3AXC A;  4ZDV A;  2W9N A;  4HJK A;  2PMV A;  3PO0 A;  4N9F 4;  3B2G A;  2IY0 B;  1E8X A;  4BVU C;  4W9C A;  4YTM B;  2REX A;  2N1W A;  3FKY A;  1YD8 U;  3AE4 B;  1YN3 A;  2WXM A;  2RMM A;  3DHI C;  1I4H A;  5LLI A;  3W9C B;  4K1R B;  1WJN A;  4ANV A;  3PRP B;  1QOG A;  4KVG B;  1VJK A;  4USA A;  4DXF A;  5D94 A;  1G6J A;  2L3Z A;  3HK0 A;  3ZGZ A;  3MFG A;  3AEA B;  3Q3O C;  1F77 A;  1R7S A;  3ALB A;  4GDL A;  3DDC B;  3VTW A;  4K7W A;  3ZLZ A;  1SEB D;  5DPR A;  4ANU A;  2FAZ A;  2IO0 B;  1XLN A;  4B95 A;  2ASQ A;  3WAL A;  5IA7 A;  2MBB B;  4WWM A;  1EO6 A;  3ML9 A;  4EZL A;  1WRD B;  2KT7 A;  2DBY A;  2KLC A;  1ACC A;  1OEY J;  4PT5 A;  1KLU D;  3VQI A;  2GRI A;  2Y5B B;  3S2A A;  5FR3 A;  3UF8 A;  1IP9 A;  5DCN A;  1J7C A;  2DYB A;  4RFB A;  2QEJ C;  3BZD B;  2KX3 A;  3N3K B;  3H1U A;  1ZW7 A;  2K25 A;  1JML A;  5C2T B;  3AB5 A;  4S0R A;  3H6N A;  2DZI A;  3KLS X;  1XCQ L;  4NAM A;  3V61 A;  2ZJD A;  3RUL A;  2C7H A;  1GC6 A;  1SIF A;  3IBE A;  3KYD D;  2JUO A;  3UQA A;  1UWM A;  1TZ1 A;  1S3S G;  4UDU C;  1HE8 A;  1D6E C;  1LO5 D;  1TS3 A;  2INC C;  2CR5 A;  4ZRQ A;  3P2B A;  4DXG A;  1WYW B;  2J0M A;  2WX1 A;  4M8M A;  3GZN I;  4G0N B;  2VZK B;  1V81 A;  2EMT A;  2G1E A;  2QJL A;  4GDK B;  1NI3 A;  1ZPS A;  4MGI E;  2N9L A;  1Q1O A;  3EFU A;  1OFF A;  2E3T A;  4HPM B;  4GU2 A;  1DOX A;  5TR5 A;  2M8S A;  5H8Y E;  1NEK B;  3VH3 B;  1ISN A;  3DQV A;  5LXH A;  1D5X C;  4WJO A;  2DLB A;  2DHZ A;  1YJJ A;  1PYW D;  4HK2 A;  4LNK A;  1F1H A;  4IOI E;  3TEX A;  3DBR B;  4HRO A;  3GS2 A;  5C3J B;  2AEH A;  4R3D A;  2LRU A;  3V3X A;  3T3N A;  2XNA C;  2V0G A;  3V05 A;  2OJR A;  3V6E B;  3PRZ A;  1MFW A;  4PS7 A;  5HFY A;  1GPX A;  1WXS A;  4KSK C;  2K5P A;  3BY4 B;  4FUL A;  5J2R A;  1RM6 C;  3PLV A;  2XN9 C;  4YTP B;  3OG5 A;  3NJT A;  2KFJ A;  1TKY A;  3DWG C;  1YX5 B;  2CU1 A;  2K1F A;  3Q3F A;  2V9H A;  1J0G A;  5MPO A;  3QIJ A;  2ZCC A;  4K3C A;  2WXO A;  2ZPN A;  2VZK D;  4RH6 A;  2BW2 A;  2LGD A;  3V6C B;  5FR6 A;  4HLE A;  1E7P B;  3MJW A;  2GMI C;  3RNF C;  3M95 A;  4B6W A;  2W3R A;  3AH7 A;  2KOX A;  3ZXR A;  4YSY B;  5IOI A;  4L2Y A;  3RNG C;  1M94 A;  2BWE S;  2KWV B;  3AEE B;  1YN5 A;  1STE A;  4I6P A;  4CO7 A;  2JSV X;  1IGD A;  5AEK B;  3BWU D;  3V60 A;  4ZYN A;  4KV2 A;  3QX1 A;  2R2O A;  4BBN F;  2BGF A;  3CF6 E;  2M0A A;  3DBR I;  4XZ4 A;  4W9F A;  4A3P A;  3ML8 A;  1FCL A;  4HPP A;  1S1Q B;  1XLQ A;  4WIP A;  4HVB A;  2YLM A;  1QQR A;  2ZCB A;  1DOY A;  2K6Q A;  3TMP B;  1WM3 A;  1A70 A;  4KX6 B;  1C9F A;  4ZRJ A;  5JH5 C;  4KGS A;  3SFD B;  2YVC A;  3HVD A;  1SE9 A;  2WHI A;  5JXV A;  1V49 A;  2FIF A;  4KSL C;  2FCQ A;  3AE8 B;  4C4V A;  4NZL B;  3ZVV A;  2J0J A;  2LZ6 A;  3N32 A;  4D2K A;  3W1S C;  1JWM D;  3ZQ4 A;  2KD0 A;  2DNF A;  3SR6 A;  2I38 A;  2QDF A;  2LXA A;  2Q5W D;  2QIL A;  4P16 A;  1QOF A;  2LMC A;  1HTQ A;  2Y5P A;  4NQL B;  4LDT D;  4YXD B;  4FHJ A;  2LUE A;  4F1S A;  4GIV A;  2J7Q B;  4JGH B;  4RF1 A;  2Y3A A;  3PGE A;  1OGW A;  3WAM A;  2C5L C;  2O2V A;  4ARC A;  2A5U A;  3SEB A;  4DBG A;  1L6V A;  3A9K A;  4W9D A;  3AN1 A;  4ZOH C;  4JLC A;  1EWC A;  3TEW A;  2MA9 B;  3QAQ A;  3NZ3 A;  3PS6 A;  1QKZ A;  1KOT A;  2JU6 X;  4IWO A;  3L4P A;  4NY0 A;  1P1A A;  3WAN A;  1GC7 A;  1XD3 B;  4IUM B;  5AZH A;  3U52 E;  2JYE A;  3A4S C;  5BYR A;  1C1Y B;  5EE9 A;  3A1Q B;  3O65 B;  4K3B A;  3ZRF A;  5G5G A;  4XC2 A;  2KWC A;  4C7Y A;  2BF8 B;  3I3T B;  4K7S A;  2JRI B;  1EWY C;  2Z0D B;  5H92 C;  1EM7 A;  1E8W A;  2KJH B;  4RGO S;  4AJW A;  1VCB A;  1UNS A;  2UWQ A;  2WS3 B;  2FNJ B;  1FNU A;  3URY A;  1CQV A;  4KGR A;  4J6I A;  3RNC C;  2JZZ A;  4AS1 A;  3Q8E A;  1VRA B;  1WZ0 A;  4IWP A;  5DPS A;  2LHE A;  3U7Z A;  1EU3 A;  1L4Z B;  3JYU A;  2JY6 A;  5C23 A;  1E8Z A;  3R7Q A;  1YN4 A;  4W9I A;  4US9 A;  2ZEQ A;  4DWF A;  2NBW B;  4URK A;  2PW9 A;  5D7G A;  3U2S C;  2MBQ A;  2MW5 A;  2R61 A;  1WXA A;  3DBH B;  1MI0 A;  4WJQ A;  2KQ7 A;  2FCN A;  3AEG B;  4MEM A;  1WGK A;  4GSW A;  1I4P A;  2MSE D;  1R4M I;  2IBI B;  2LVP A;  4W9H A;  3FAH A;  4RNA A;  2MCN B;  5CHF A;  4F7Z A;  2MX2 A;  2RDH A;  3R2T A;  2JZ3 B;  2NVU I;  3N1Z C;  3Q3J A;  2KJR A;  1WX8 A;  1P3Q U;  1WXM A;  3I63 C;  2ZVO A;  3VR8 B;  4NJ7 A;  5LXI B;  4A20 A;  3K9O B;  1I35 A;  4M0W A;  3AM9 A;  1KFY B;  3ZJT A;  2XK5 A;  4M02 A;  2BVC A;  4LNN A;  4HJG E;  4DK5 A;  2BB5 A;  4HPL B;  2WXQ A;  2JX5 A;  1YJI A;  1MJD A;  4IM2 A;  2FUG 1;  1JRO A;  3AE9 B;  3NY5 A;  5D2M B;  4YT0 B;  5IAA C;  4MM3 A;  2CS4 A;  4NJ6 A;  2MBO A;  3RMK C;  4DHJ D;  3L0W B;  3APF A;  3R3M A;  1L7Y A;  3AMZ A;  4RGT A;  3DHG C;  1ZGU B;  1WFY A;  3ZW3 A;  1JWB D;  2KVZ A;  2WXJ A;  1P0R A;  1WYG A;  2K0P A;  2WQY B;  1FCC C;  3UIN B;  2RDG A;  2MJ3 A;  4HCN B;  2NR2 A;  4BZA A;  5JHB A;  1U4A A;  1WE6 A;  5DPW A;  5BMI A;  1L6U A;  3M62 B;  4JQW C;  2BTE A;  2PVG C;  3KWL A;  4P6V F;  1FO4 A;  1HEZ E;  1WR6 E;  2MWS B;  3QJZ A;  4HDO A;  1GJZ A;  3Q8C A;  1ZDV A;  3HUI A;  1SIJ A;  1TGZ B;  4ASW C;  1MHX A;  1SJH D;  2AWT A;  4DDG D;  2JYT A;  1ENF A;  3RYT A;  3FIL A;  3Q8F A;  2IDY A;  1WE7 A;  2WDQ B;  3ENE A;  2AYO B;  1TT5 B;  1JW9 D;  1IBX B;  1OTR B;  1UUP A;  2JQR B;  3QQ8 B;  3ZTD A;  2PTL A;  1KF6 B;  4LNO A;  2WXN A;  3W5U B;  1ET6 A;  2JWU A;  2KAJ A;  2LJI A;  2RD0 A;  2KDI A;  2KDE B;  4MDK E;  1HZ5 A;  3APC A;  1E8Y A;  1XLO A;  4CHK A;  2B3A A;  3DVG Y;  3GE8 C;  4J3O D;  4II2 B;  2EEL A;  2WLB A;  2BBC A;  4G50 A;  2O6V D;  2LJ5 A;  4REZ A;  2SAK A;  5BO4 B;  3ZDT A;  2RSU A;  3TEZ A;  4MSQ B;  1HA5 A;  3WA0 A;  3I9V 1;  2IGD A;  2ZW0 A;  2L8J A;  3DBL B;  1YOV B;  5EE0 A;  1WGG A;  3Q8A A;  2GBR A;  1LFD A;  3RN9 C;  4N6E B;  2IY1 B;  1V1P A;  5C1Z A;  4EKU A;  1NYR A;  2IYD B;  1UGJ A;  2ONQ A;  2KJ6 A;  1FXA A;  2N9X A;  1WSP A;  3AE7 B;  3ZXV A;  1YMH E;  3ZIM A;  3PTF C;  3L17 A;  3IT4 B;  2J4X A;  1XLP A;  3TJP A;  3ZO5 B;  1E9M A;  1UWX A;  2KAN A;  3NG0 A;  1PUT A;  3RI7 C;  3NZS A;  2KAC A;  3L54 A;  3IAS 1;  4KIK A;  2Z59 B;  4YL8 A;  2W55 A;  2PLP A;  4JWU C;  1K53 A;  4MGK E;  3RZW C;  1IUE A;  2CJO A;  5BMG A;  3ZTC A;  1FRR A;  2UU7 A;  1ZUD 2;  3NVY A;  3TEY A;  3KUZ A;  2ZVN A;  3PZD A;  2IO3 B;  4FN2 A;  4DQO C;  3Q6B A;  3KH0 A;  4A90 A;  4I6N B;  1D5Z C;  1EF5 A;  2O6V A;  4OZC A;  2WXI A;  1VZ6 A;  4X57 B;  1YIW A;  4YSZ B;  2G45 B;  2BPS A;  4GMV A;  1TIF A;  5IKC M;  4PS3 A;  4YSX B;  3Q3N C;  3VUX A;  4RM8 A;  1XQQ A;  5LNK 1;  3AE6 B;  3R7R A;  4HXD A;  2XEW A;  3VRA B;  1V6E A;  2FE8 A;  3ABV B;  4OVV A;  3ZNZ B;  4W9J A;  1LXD A;  3U30 A;  4FJY A;  2N7J A;  4H2A A;  2KDB A;  4XGA B;  1L0V B;  1I4R A;  4L1B A;  4B0E A;  1I4G A;  2LUM A;  4IW0 A;  1P9D U;  2HJ8 A;  1UBQ A;  1AWD A;  2PVO D;  5HKH A;  3W1Y A;  2FCM A;  2BS4 B;  5L95 C;  1D4B A;  2JVC A;  2J52 A;  3A4R A;  1TY0 A;  3C19 A;  3PVL A;  1FFU A;  3NOB A;  1TTN A;  3RNB C;  2JXT A;  1OQY A;  1ZXH A;  1DOI A;  1C78 A;  1M4V A;  2RR9 A;  2PPH A;  2BS2 B;  2TSS A;  3AEB B;  4WJP A;  3Q14 C;  4DDI D;  4BKT A;  1GUA B;  2I1J A;  4AWJ A;  3KQ4 A;  2IPK D;  1HQR D;  3JW0 X;  1J7A A;  1TY2 A;  3C0R B;  3CST A;  1J19 A;  1MG4 A;  2K8H A;  1K52 A;  3NS8 A;  2FCS A;  1WF9 A;  3R2I A;  1XF5 L;  4BKS A;  3APD A;  1V1O A;  1T0Y A;  1WX7 A;  3AED B;  3IG3 A;  4A8X C;  4O1N A;  2X38 A;  2LEK A;  2KLG A;  2K6D B;  4FA6 A;  2IJ0 A;  5EE3 A;  2J53 A;  1SE3 A;  3OJ4 B;  1CZP A;  5T8I A;  4EUT A;  1PGX A;  1GAQ B;  3P4P B;  3LXF A;  2D2Q A;  4M00 A;  2AX5 A;  1MPE A;  1YQ4 B;  3DWM A;  2K8C A;  4P1C C;  4XYC A;  1QOA A;  4M0W B;  5JZE B;  1N5X A;  2BB6 A;  1FXI A;  5IP4 D;  1WXQ A;  4W9K A;  2WWZ A;  1WMH A;  1AN8 A;  4WWN A;  5G5H A;  4MGZ E;  3VR9 B;  1WWT A;  5D3D A;  4LCD E;  3IHP C;  2OOB B;  2WXG A;  3UQB A;  1C4P A;  4TKN A;  4FBJ B;  2KHW B;  1GB1 A;  2KTR B;  3PHX B;  1SF0 A;  1YJ1 A;  3Q2A C;  4IM0 A;  2PEA A;  1E7V A;  4ICU A;  1V97 A;  1WGR A;  3A1Q A;  2CKH B;  2M56 B;  4II3 B;  2G4S A;  1QLB B;  2GOW A;  3PT2 B;  4GB9 A;  1N61 A;  3AI5 A;  1SGH A;  2L76 A;  2WU5 B;  4IKG A;  1MG8 A;  4RM9 A;  4HDQ A;  2LHD A;  5D6J B;  1TKE A;  2ZZP B;  2K39 A;  1WZ3 A;  3EA6 A;  2KK8 A;  3WIM A;  2L32 A;  1EUV B;  1GOZ A;  1T0S C;  3HHM A;  3NZU A;  1KLV A;  2KN4 A;  3R66 C;  1MHH E;  3AU4 A;  3DVG X;  3DPD A;  3DBH I;  1HZ6 A;  4B0M A;  3W1S A;  1Y8R C;  2DAF A;  3VDZ A;  4EFO A;  3TUO A;  3ZKJ C;  1SE2 A;  2M0X A;  4WQM A;  5HHD G;  5J17 A;  1JAL A;  1JRU A;  1NI2 A;  2KC1 A;  3ETR A;  4MJS A;  2KMA A;  1WM2 A;  2ON8 A;  4LJO B;  4W9L A;  1V86 A;  5G2N A;  4YTN B;  2KNB A;  1SB3 C;  2KFK B;  1RAX A;  2KMC A;  4LNF A;  5FK9 C;  3IAM 1;  2KQS A;  3D32 A;  3A9J B;  2RPQ A;  1RWS A;  4K7U A;  2NMQ A;  4HCP B; 
#chains in the Genus database with same CATH homology
 3DHH C;  3RN9 C;  3Q2A C;  3RNG C;  2INC C;  2RDB C;  3DHI C;  3Q14 C;  1T0S C;  3I63 C;  4P1C C;  2IND C;  1T0Q C;  3RMK C;  3RNE C;  3N20 C;  3RNC C;  3N1Y C;  3Q3M C;  3RNB C;  3RNA C;  3DHG C;  3RNF C;  3Q3O C;  3GE3 C;  3N1X C;  3Q3N C;  3RI7 C;  3I5J C;  1T0R C;  4P1B C;  3GE8 C;  3N1Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...