3RI7C

Toluene 4 monooxygenase hd mutant g103l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ri7C00
1T0RC 3RNFC 3RNAC 3Q3OC 3GE8C 4P1CC 3N1ZC 3DHGC 3N20C 3Q3MC 3RNBC 3N1YC 3GE3C 2INDC 3Q2AC 3Q14C 2RDBC 3DHIC 3I63C 4P1BC 1T0SC 3I5JC 3RMKC 3RNCC 3RI7C 1T0QC 3N1XC 3RNEC 2INCC 3Q3NC 3DHHC 3RN9C 3RNGC
chains in the Genus database with same CATH superfamily
3PGEA 3APDA 3MC8A 2SAKA 4HRSA 2KJHB 2KN4A 3HUIA 1C1YB 2IO1B 2HJ1A 2WNMA 1OQQA 3TEYA 3AE1B 4Q2JA 3AEAB 2DYBA 2LGDA 3P1MA 2IPKD 2N9KA 3RZFA 3ZNGC 3L17A 1FFUA 1V97A 4D2KA 2CHXA 3RYTA 4C56C 3WIMA 3CMMB 3RNGC 2QHOA 3LYYA 3NS8A 4EOYA 3RT3B 1XLNA 2KTRA 2SEBD 1K50A 2AQ2B 4GMVA 4NQLB 1SJED 4WJQA 2Z59B 2IY0B 3M3JA 3AN1A 4G11A 4JLCA 3SFDB 1ZE3D 3SU8X 1E9MA 4N59A 2H89B 5FR3A 5MPOA 3APFA 5JZEB 1GG3A 1XT9B 2N9EB 2IGHA 4RM8A 1VCBA 4TV3A 4HPPA 3ZIMA 3IG3A 1NI3A 1R7SA 1WXAA 2RMMA 4DXFA 3DBRI 2D3GA 1T0YA 1ACCA 1WZ0A 3Q6BA 1FEHA 2LD9A 1GB4A 1R4MB 2V9HA 3AV8A 3N20C 2VH2A 2IYDB 4C80A 1E90A 2LHEA 3DBSA 1T6BX 4EZLA 2FCNA 2LZ6A 5I4DA 1Y8RC 1OTRB 4QAYA 4CYEA 4I6LB 1C9FA 3FC4A 4HJGE 1WM2A 3ZJVA 2LHDA 1WRIA 4W9FA 4US8A 2BYFA 4EZKA 2WXFA 2C5LC 4L1BA 4RGNA 1QOGA 1QLBB 2DZIA 4YTNB 1RLFA 2BYEA 4URKA 3VTVA 2KQ4X 1J19A 3KWLA 3AEFB 1IPGA 5AZFA 2INNE 4W9JA 1WXVA 2NBWB 1VDVA 2UYZB 1FNUA 2KJ6A 2DHZA 2LWPA 4WAFA 3RPFC 1AARA 4FHKA 2QEJC 4BKSD 3Q3JA 3PPAA 3Q3MC 3MHSD 3TIXA 2CHWA 1ZKHA 4TQ0A 1WYGA 2INPE 2J0KA 3IHPC 4W9LA 2WQYB 3NVVA 3A33B 2OEDA 1V8CA 3QC8B 4HVBA 3SD5A 2CS4A 3HK0A 2BKFA 2HD5B 3Q3OC 4XX5A 2V1YA 1QQRA 2Y5BB 4KZCA 2M0XA 1P0RA 2KOXA 2DENB 1MG8A 1TIFA 2JPHA 3B0AA 3DVGY 3U52E 3RFZB 1ET9A 3L54A 5EE3A 2ON8A 1SGHA 1C78A 2WXPA 5D6JB 1ROEA 2KFJA 3AE3B 1OGWA 2JX5A 4M8MA 4F1SA 5T8IA 2FAZA 3L16A 3M62B 1L0YB 2PJHA 4ZOHC 1CQVA 3PZ8A 3VH4B 1NYQA 4JX1C 3D32A 3AE6B 1WF9A 2GMIC 2IO3B 1P7FA 4PT5A 2L05A 2KDEB 3BZDB 1EWYC 2N4FA 2KDIA 5AUIA 1GNUA 2JT4B 3C0RB 4DDID 1UWMA 1UELA 1U4AA 3AECB 2BTEA 4MACA 3AU5A 3DPDA 3R8BA 4RM9A 3HIZA 2Q5WD 3ZTDA 2CU1A 3AEEB 5FR6A 3PRMB 2PLPA 5TR5A 1F9JA 2AWTA 4FHJA 3A1QB 3UIPB 1T0RC 3OAWA 1LO5D 1TKEA 3E9SA 1TY0A 1L0VB 3ABVB 4H2AA 3NJTA 3PT2B 2N9PC 2BWFA 3ZXVA 4KKIA 1M94A 3I5JC 3PLVA 1V80A 3QJZA 1MPEA 1J7CA 4WH4A 4HK2A 3B9JA 3PZ7A 2D5GA 1C76A 4OZAA 2KXJA 3IT4B 4ANVA 5HKHA 3UQAA 2N7EA 2KANA 2IJ0A 2KYWA 3X0WA 3KWVA 3M63B 3QA8A 2UWQA 4M02A 1QILA 2FUG1 3VRBB 2C60A 1QOFA 3MJWA 1C4CA 3L08A 2KD0A 2QDFA 1ZOYB 3ZJUA 2ZVOA 4USAA 2MBBB 1QF6A 1T3QA 2MH7A 4BVUC 3PSEB 2E6XA 1SXTA 2JY6A 2KX0A 5DCNA 2ZNVC 3ZGZA 2ZJDA 2XK5B 3ZYYX 1K8RB 4AUQC 2VRRB 1WM3A 2R2QA 1K51A 2BB6A 1NI2A 2GRIA 5BMGA 2V3NA 1OQYA 1XXGA 4LNNA 4O1NA 3TEZA 3DBHI 2EELA 3QX1A 2Y5PA 4GLSC 1JWSD 2XK5A 4PS8A 3U7ZA 1L6UA 1IGDA 1V9JA 3APCA 1IGCA 1FD6A 4P6VF 4NQKE 1FRDA 1FXIA 3N30A 1T0QC 3MP9A 3QWZB 2MA9B 1J8CA 3VUWA 4IM0A 4UDUC 1RRBA 4HKZE 4REZA 4EEWA 3UGBB 1GPXA 1YN5A 1R4NI 1YD8U 2BS3B 2A5UA 2KACA 1WJ6A 3Q2AC 4HLEA 2MX2A 3JW0X 4MSMB 2PKOA 4RH6A 3EFUA 2NCNA 2L0TA 3QARA 4TMAB 3U4EG 1VZ7A 2L76A 4HDOA 4E71A 1Q5WB 2MRPA 2MBEA 4IG7B 3V6CB 1TGZB 4IM2A 1RM6C 4GIVA 3U7DA 2PVOD 3ZVVA 3ZNID 3L13A 3V61A 2LUEA 5J2RA 2NVUI 1XLPA 1MI0A 3IT6B 1UH6A 3ZRFA 1G6JA 3SDLC 4A90A 1T5XD 4OZCA 2K8HA 5E6PA 1M4VA 2KFKB 2GB1A 3GE3C 1SEBD 2RDBC 2WDTB 3L0WB 2JVCA 5CTRC 2LVPA 2K6DB 4ZHOA 3GP7A 2L3ZA 2DZKA 5CHFA 1DOIA 3QQ8B 1OEYJ 2KFKA 3N9YC 3ECIA 1UWXA 5BO4B 4GDKB 3OWEB 4IWQA 2WDRB 1EU3A 1L4ZB 1Q1OA 3O65B 5IN7A 1L2NA 5IP4D 2BS4B 1F52A 1GC7A 2JWZA 4DDGD 1FMAD 2WX0A 3ZRCA 4GDKA 4WQMA 4L23A 1D6EC 2KZRA 3EA6A 4GN1A 2CKHB 2MJDA 1YMHE 4LJOB 3L4PA 1P98A 2KDMA 3PHXB 1WSPA 3NRZA 3U8ZA 2MEKA 4LNOA 2RPQA 1SB3C 2J53A 4CO7A 1V49A 4PYUA 2WXKA 3MC0B 2I38A 4BFRA 3DBLI 5EE9A 2N1WA 1TY2A 1XCTL 2PMVA 3AE8B 1T0SC 3BY4B 2LFIA 3DHHC 3P4RB 3HRDD 2WXGA 3KUDB 2JRIB 2WXHA 4MSQB 5AEKB 2KK8A 1CMXB 4A3OA 5C2TB 2L8JA 4OHJA 2WYQA 5IO9A 1P3QU 2LXAA 2QMTA 4DXAB 4LNKA 4XE0A 2WU2B 2HJ8A 1B9RA 1PGXA 1LFDA 1F0ZA 1NEKB 3OJ4B 1SIJA 1HTQA 3N32A 4P1BC 4ANWA 1UBQA 2D10A 2PEAA 4X57B 2NTSA 4LCDE 3WANA 3H9DA 4AS1A 3IXSA 1OEYA 2HTHA 4C00A 1TKGA 3A4RA 4W9IA 1I4GA 2JU6X 2KHWB 2WXOA 3B08A 3Q8FA 2MBOA 1KOTA 1DYQA 1PQSA 3P2BA 5FK9C 2KX3A 2FCSA 1JCKB 1WGRA 5D3IB 4EFOA 3VAWA 1ET6A 3RN9C 3LB8C 5JH5C 1WE7A 3GS2A 4OVVA 5AUKA 3AH7A 5BYQA 4ANUA 4YXDB 4J3OD 3RD2A 1I42A 4RGOS 3BVMA 3DBRB 4GDLB 2AYOB 3VHTC 1VR9A 2BYVE 4MDKE 3IAM1 2KWUB 3PV1A 3C8YA 2V4LA 2PPHA 1MHXA 2ACZB 2CJNA 2W3SA 4GDLA 2JXXA 3BIID 2L83A 2LJ5A 3DQVA 3B2GA 1FCCC 4N9F4 4PYZA 3PLUA 3EHVA 3DHIC 1WXSA 1IP9A 5G5GA 1N60A 4I6PA 4BZAA 2WWZA 5GMVA 1YQ3B 4LLGM 2DZMA 1YJ1A 4ZRPA 2BT6A 4LK0M 3CF6E 4A6QA 1L6VA 3Q3FA 3MJ5A 1HZ6A 1HTOA 3OG5A 1MJDA 3NHEB 4MGKE 1MVKA 4RF0A 4YTMB 3AXCA 4FLHA 2ZPYA 3RMKC 2G4DB 3W5UB 2KKCA 1NBFC 2WXNA 4OZBA 4W9KA 1WR6E 5TSSA 1S3SG 2BBCA 3Q8AA 2QCZA 1SE9A 3VTUA 1YJIA 1WGKA 1E0ZA 3NVWA 4AJWA 3NY5A 2KAJA 4M01A 4IC7B 3AMZA 3CSFA 5DPSA 3ZXRA 3MHZA 3EGRA 2AEHA 4K81A 1Z5SB 1WY8A 1WH3A 1WX9A 4JE3B 2CHZA 3TMPB 5JHAA 2L1AA 1YNTE 1WMHB 4AWJA 4FBJB 1UUPA 2ASQA 2INDC 2BW2A 1YN3A 2KVZA 1I4XA 1DGJA 1WMHA 3RI7C 2L0FA 3MC9A 3SHQA 1Y56A 2B76B 1E8XA 3PO0A 2K9XA 2O6VB 3GB1A 1L0XB 1PUTA 4K7UA 1JWUD 4YSZB 3N3KB 1P7EA 3VDZA 4EE2A 1C77A 2Y5CA 1WE6A 4WJOA 3C19A 4LDTD 2O6VA 2PE6B 5C3JB 5HG2A 3BWUD 4AJYB 2O2VB 3PS6A 3KYDD 5FKAC 2BB5A 3ML9A 1ZDVA 3VTWA 4ZHPA 1KLGD 4K1RB 2J0JA 3P4QB 1QT9A 2WU5B 2ZEQA 2KMAA 3KUZA 2O2VA 3PRZA 2MBQA 4M8NA 2REXA 3TL5A 2CR5A 2JSVX 1WR1A 1QOBA 2LGIA 1F1HA 2ZW0A 2JF5A 1JROA 4OW0A 5JHBA 2ZPNA 1XCQL 4KSLC 2E3TA 4WURA 2BS2B 1F77A 1XF5L 2AL6A 3VH3B 5CX3A 1E7UA 2WLBA 4YWGG 2KJRA 1TT5B 3A9KB 2N7DA 1GAQB 4MH8A 4FJVB 3R7RA 2RDHA 2GBNA 1FFVA 4IWPA 4J6IA 3ML8A 4NJCA 4GU2A 3A9KA 1HQRD 2C7HA 4ZRKA 3RCZA 3MTNB 3DDCB 4JWSC 4TSSA 4A3PA 2QSDA 3TSSA 3HVZA 4XC2A 2MJ3A 1EUVB 1Z2MA 1V81A 1TS2A 1XLOA 5LXHA 1WRDB 2ZZPB 3A4SC 3DHGC 1IYFA 4C7ZA 1SE3A 4KIKB 1EO6A 2JUOA 2C9WB 4MT5A 4ZRQA 1FNVA 4FJYA 4M0WB 2DYOA 2QILA 3W1YA 4HCPB 1WZ3A 4KX6B 4BOZB 2RGFA 1P9DU 1WI0A 3R66C 2HTME 1OFFA 1CK1A 3W5VB 2C7NB 3V62A 2JZ3B 2M0AA 3A1QA 4XWTA 2A4ZA 3KH0A 1D4BA 1F2RI 5E6JA 2V3PA 5BMHA 1YJJA 2XN9C 2V3SA 3DVNU 2EMSA 3PHWB 1FM0D 3DBHB 3BK1A 2G3QB 2FCMA 1HZ5A 4ZYSA 3QIJA 1WX8A 5IKCM 4BKTA 3WALA 1PGAA 2K8CA 2WXMA 2K6QA 2MP2B 2MBHA 1TBEA 1STEA 4KGTA 2JWUA 1TS3A 2GBKA 4JPSA 3ZNHB 1QZEA 1R4NB 2C7MB 2MP2A 1V5OA 4C4VB 4P1CC 3H1UA 4FXCA 2N1VA 2TSSA 3R3MA 2G45B 1KLUD 1UNSA 4DXGA 1ZW7A 1J0GA 3GOEA 1WGGA 4C4VA 1FO4A 2DAFA 2ZW1A 5C23A 4IDIA 2MJEA 5J18A 1V5TA 1LM8B 1D5ZC 2W3RA 3VVWB 3VXWA 2K5PA 2QIEB 2KN5A 5EE1A 4HXDA 3DWMA 2G4SA 4DBGA 1N5XA 4EZJA 1OQRA 2Z8LA 1VZ6A 3AE9B 3I57A 4E74A 4W9EA 3E56A 1GB1A 4BKSA 3NS1A 2NS5A 2XEWA 2CU3A 2JQRB 2KT7A 3P42A 1VLBA 4I6NB 4A55A 3IVFA 4XWWA 1GUAB 4FJZA 2PW9A 5C1ZA 2RD0A 2R2OA 2MLBA 3R7QA 3H8HA 1UF0A 3GZNI 4ZRIA 3VUXA 3A9JB 5BYSA 1E7VA 3KLSX 4ARIA 1H8CA 4MJSB 1V86A 3A9JA 4B6WA 3KVFB 4GSWA 4NY0A 3W1SA 4GB9A 5D2MB 4K7WA 1H4RA 2FNJB 3BVZA 3VR8B 1HXYD 2J7QB 1C3TA 3DBLB 4LNFA 2AL3A 3VQIA 3ZDMC 4DHZB 2BPSA 1IBXB 2J4XA 1VD2A 5LLIA 1I4QA 2BGFA 1VZ8A 3RNEC 1L7YA 4LTUA 3NVYA 4AP4C 1UGMA 3UF8A 1I4RA 1GC6A 1IBXA 3WAOA 2IY1B 3WCQA 3X23A 2L32A 5BYRA 4LJPB 5JXVA 1DOXA 5D7GA 2VH1A 2LEKA 4ZYNA 2LGSA 4G3XB 2M4NA 1RFKA 2YVCA 1K53A 5IAAC 2CJOA 4KV2A 3BINA 2IO2B 3TCAA 3N1ZC 3RNBC 1V1PB 2EMTA 1TS4A 3H7PB 1SE4A 2MW5A 3IAS1 4NJ7A 1CJEA 5E6OA 3SR6A 3VRAB 2LRUA 3PZDA 1Q10A 2KLGA 3NG0A 4K3BA 2KLCA 2R61A 1ZP0B 5DPTA 2XNAC 3LJ3A 2QC8A 1V1PA 2INCC 4KGSA 2M1MA 1E8YA 3H7PA 2LMCA 4IOIE 1YN4A 4BOSC 4K7SA 3RUIB 3TUOA 3TJPA 4PS7A 4MH0E 1BXTA 1L5PA 4GOCA 3B2FA 1VJKA 1ZUD2 4ZDVA 1JWMD 3TBLD 2KC2A 3RNFC 3RNAC 3U30A 5D3DA 3BK2A 1S1QB 4EUTA 3HHMA 4W9GA 1FRRA 2I1JA 4IKGA 2K0PA 2JYEA 3PTFC 3JYUA 3H6NA 2OOBB 2IZVB 4JWUC 4JQWC 2IDYA 2VZKD 2K1FA 2WXLA 2LRWA 3NUHB 3QHTA 2KO3A 3ZDTA 2K22A 4KVGB 1E8ZA 1YQBA 1C4PA 2ZCBA 3RULA 2MSED 2DYMA 3P4SB 5D94A 1JRUA 2V0GA 4OVUA 4FN2A 4XGAB 1D5MC 4MM3B 1RWSA 2PIAA 3TEXA 2BVCA 1FPYA 4RGMA 1LXDA 3BYTB 3CSTA 2NMQA 5H8YE 4HEA1 2DNFA 2LJIA 1KFYB 1N63A 3I9V1 3V6EB 1AYFA 4MM3A 3PREA 2KTRB 4DK5A 4WWNA 1JWAD 3ZNZB 4W9CA 3M95A 2LVOA 4ANXA 2NR2A 4ITKA 1WYWB 3DVNV 3WA0A 4RCOA 4WAAA 4KDLB 1F2RC 2KMMA 1VRAB 2WDQB 3B1LX 3L10B 2JXTA 4XDDA 2KWCA 1PYWD 2YEPB 4HPLB 3NZSA 2WHIA 2WDVB 3P63A 4NJ6A 3T3OA 4B0MA 2FBWB 2GLSA 5DPWA 5HFYA 4BAXA 1MG4A 3VUYA 4WIPA 1BUIC 2J0MA 2D2QA 1EM7A 4WWPA 4FA6A 2LVQA 1GOZA 2MHJA 3NZ3A 2K25A 1ZGUB 1N61A 1TYGB 3EC8A 2MCNB 5IA7A 4IUMB 1JWBD 2RR9A 1YOVB 3HM6X 1TS5A 1SF0A 1SSNA 4XDCA 1YIWA 5CHVC 4IM3A 3AE5B 3AE4B 3CIRB 1HE8A 2DZJA 4A8XC 2FE8A 2K39A 4IW0A 4YTPB 5G2NA 4NPNA 5EE0A 1WXMA 5H92C 5HI1A 2GI9A 4ASWC 2ONQA 1KM7A 4L2YA 1QKZA 1I4PA 1EF1A 1LGRA 3ENEA 4TKNA 2JZZA 2QJLA 4BKGA 1YQ4B 2RDGA 4BBNF 2N9XA 4OVZA 3DVGX 1AWDA 3AULA 1TTNA 2FIFA 1WXQA 2D3AA 1TJEA 4JGHB 1CZPA 1WJ4A 2D3BA 3PVLA 1FIQA 4TQ1A 3V60A 3FILB 4HKQA 5GXGB 4EKUA 4HROA 2M8SA 1L4DB 1J7BA 5AZHA 4K3CA 3S2AA 1R4MI 1RFAA 5G55A 2LUMA 1A70A 1YX5B 3FILA 3ZW3A 2MQJA 4PS3A 2OJRA 4DQOC 1KF6B 1JMLA 3FAHA 4C7YA 3JSVB 2D3CA 2WXQA 2KDBA 4A20A 5CHWA 3UQBA 2DLBA 3NOBA 2X38A 1PGBA 1SBBB 3VR9B 1K52A 2GBRA 2BF8B 2I1KA 2VZKB 2KC1A 3K9OB 2I2YA 1TZ1A 2BKRB 3AI5A 3JSVA 4IWOA 1KJTA 3UIOB 4RMAA 5L95C 1WWTA 1RYJA 3SEBA 1ZDXA 1SJHD 4MEMA 1I35A 3RZWC 4S17A 2KNBA 2KMCA 4P7IA 4NZLB 2L7RA 2WGSA 1WIAA 5EDSA 4RFBA 5L83A 1FXTB 4HDQA 4RF1A 1JQ4A 4G50A 4PK1A 3U2SC 2W55A 3AU4A 3UI3A 3P4PB 3Q69A 4R3DA 1ISNA 2ZVNA 2YEPF 1WGYA 3W1SC 4CHKA 3KQ4A 3BVGA 1KTKA 3KYCD 3O13A 2RSUA 1EWCA 3AM9A 4YL8A 4MGIE 5LXIB 1NYRA 4MGYE 5AZGA 3H7SA 1RAXA 3NZUA 3ETRA 1LQBA 1WFYA 4II3B 2KQ7A 1UD7A 1ZXIA 2G1EA 4KIKA 5E6NA 1A5RA 3Q8CA 2WP9B 1TZOA 2NPTB 4GXBA 1JALA 1HEZE 1XO3A 3K9PB 4WJNA 2DX5B 4M0WA 1WJNA 2LI5A 4JIOU 3ZTCA 2W9NA 2RPVA 2N7JA 5KHOA 3ZQ4A 5HHDG 3KUCB 2Z0DB 4MGZE 4HCNB 1QOAA 3MFGA 4WJPA 2NPTA 4KGRA 2W54A 1N5WA 2AQ1B 4KKJA 3URYA 3IFWB 3WAMA 1NVID 4DHJD 1FNWA 4US9A 1YX6B 4YSYB 3LDZE 1J7AA 2DBYA 3ZUNA 1N6ZA 2D07B 4MELA 1WJUA 1V6EA 3ZO5B 3Q14C 4FULA 1EF5A 2B3AA 4TUUA 4M00A 1SE2A 1N62A 3AB5A 3JVZX 2BYTA 2LASA 5LNK1 2IGGA 3W2DA 3QK0A 2JYTA 4JL9A 1BMLC 2V4IB 2Z0EB 2WX1A 3V3XA 2PE9A 1C4AA 4ICVA 3GZNB 4HPMB 2PTLA 1P1AA 3I63C 1EU4A 4FADA 2KQSA 1I7HA 3EECA 2AX5A 3LXFA 4F8CB 4KSKC 3CWIA 2FIDA 4LDTB 1ZXHA 2K3UA 3J9CA 1SIFA 2DWQA 2UU7A 2NBVB 2M19A 4DHZE 2LGXA 4S0RA 4ZRJA 1V1OA 1BT0A 1B1ZA 3VFKA 4RGTA 1KLVA 3OLMD 1NDDA 4BBNC 3BYYB 1I4HA 4HJKA 1DOYA 1XD3B 4A9AA 2WXRA 3T3NA 1FXAA 4ICUA 1WGDA 3R2TA 3Q8BA 2IO0B 2OJWA 2N0SB 1ENFA 3DCGA 4RNAA 4NNJB 4CQNA 1JRPA 3ZKJC 2ICIA 2J42A 2KWDA 3DWGC 3HM3A 5IOIA 4NAWB 4DWFA 3FKYA 3RNCC 5BMIA 1Q0WB 4MJSA 3QCAA 2X8XX 3WAPA 1D3ZA 1XEEA 4AQ7A 3ZJTA 4G0NB 2PVGC 4NAWA 3SFEB 2GBMA 4XZ4A 1GJZA 4II2B 1AW7A 2WS3B 4XYCA 4NAMA 1E10A 4N58A 1V2YA 2IGDA 3OJ3A 3N1XC 1ESFA 2GBJA 1JW9D 3EUB2 2LGYA 1XQQA 1E8WA 2DAJA 2M17A 2NTTA 3R2IA 1PFDA 1KRHA 1WGHA 3ONSA 1AN8A 4HWIB 4N6EB 3KW5B 4E3CA 2J52A 5DPRA 3Q8EA 2GOWA 2D11A 2FCQA 4F7ZA 2IBIB 4WWMA 1FCLA 2G9HD 2JRHA 3NVZA 1C79A 2BQQA 3HVDA 3W9CB 2FUHB 4WWOA 5G5HA 2OHFA 3PRPB 4DHJB 1TKYA 2W82A 4ACFA 4AOFA 1KH0A 4YSXB 1UZXB 1X1MA 4W9DA 3Q3NC 5J17A 2JZPA 4B9KA 1D5XC 1E7PB 2KTFA 2K8BA 3I3TB 3GE8C 3T8MA 4YT0B 3AEBB 3ZLZA 2WXIA 3AE7B 1WX7A 3AEDB 3N1YC 3AE2B 2HE7A 2YLMA 4P16A 2LXCA 3EFCA 2AQ3B 1IUEA 2O6VD 3ALBA 2ZNVB 2KVRA 2L00B 1NENB 3UINB 2H88B 1E5WA 4B0EA 1UGJA 1PDXA 1UBIA 3V05A 2M56B 4WQOB 2HDEA 4GGQA 4W9HA 2N9LA 2KDFB 4KDIC 3T9LA 1ZPSA 3AEGB 1E6EB 2XBBC 3DOWA 4KZ0A 2MWSB 1XLQA 5KHQA 2BWES 2L52A 2EKEC 4LNIA 1HA5A 1MFWA 2ZCCA 1MHHE 2EKIA 2Y3AA 3QAQA 3IBEA 2NBUA 3TEWA 2KWVB 4ARCA 2WXJA 4B95A
chains in the Genus database with same CATH topology
1T0RC 3RNFC 3RNAC 3Q3OC 3GE8C 4P1CC 3N1ZC 3DHGC 3N20C 3Q3MC 3RNBC 3N1YC 3GE3C 2INDC 3Q2AC 3Q14C 2RDBC 3DHIC 3I63C 4P1BC 1T0SC 3I5JC 3RMKC 3RNCC 3RI7C 1T0QC 3N1XC 3RNEC 2INCC 3Q3NC 3DHHC 3RN9C 3RNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0R C;  3RNF C;  3RNA C;  3Q3O C;  3GE8 C;  4P1C C;  3N1Z C;  3DHG C;  3N20 C;  3Q3M C;  3RNB C;  3N1Y C;  3GE3 C;  2IND C;  3Q2A C;  3Q14 C;  2RDB C;  3DHI C;  3I63 C;  4P1B C;  1T0S C;  3I5J C;  3RMK C;  3RNC C;  3RI7 C;  1T0Q C;  3N1X C;  3RNE C;  2INC C;  3Q3N C;  3DHH C;  3RN9 C;  3RNG C; 
#chains in the Genus database with same CATH topology
 3PGE A;  3APD A;  3MC8 A;  2SAK A;  4HRS A;  2KJH B;  2KN4 A;  3HUI A;  1C1Y B;  2IO1 B;  2HJ1 A;  2WNM A;  1OQQ A;  3TEY A;  3AE1 B;  4Q2J A;  3AEA B;  2DYB A;  2LGD A;  3P1M A;  2IPK D;  2N9K A;  3RZF A;  3ZNG C;  3L17 A;  1FFU A;  1V97 A;  4D2K A;  2CHX A;  3RYT A;  4C56 C;  3WIM A;  3CMM B;  3RNG C;  2QHO A;  3LYY A;  3NS8 A;  4EOY A;  3RT3 B;  1XLN A;  2KTR A;  2SEB D;  1K50 A;  2AQ2 B;  4GMV A;  4NQL B;  1SJE D;  4WJQ A;  2Z59 B;  2IY0 B;  3M3J A;  3AN1 A;  4G11 A;  4JLC A;  3SFD B;  1ZE3 D;  3SU8 X;  1E9M A;  4N59 A;  2H89 B;  5FR3 A;  5MPO A;  3APF A;  5JZE B;  1GG3 A;  1XT9 B;  2N9E B;  2IGH A;  4RM8 A;  1VCB A;  4TV3 A;  4HPP A;  3ZIM A;  3IG3 A;  1NI3 A;  1R7S A;  1WXA A;  2RMM A;  4DXF A;  3DBR I;  2D3G A;  1T0Y A;  1ACC A;  1WZ0 A;  3Q6B A;  1FEH A;  2LD9 A;  1GB4 A;  1R4M B;  2V9H A;  3AV8 A;  3N20 C;  2VH2 A;  2IYD B;  4C80 A;  1E90 A;  2LHE A;  3DBS A;  1T6B X;  4EZL A;  2FCN A;  2LZ6 A;  5I4D A;  1Y8R C;  1OTR B;  4QAY A;  4CYE A;  4I6L B;  1C9F A;  3FC4 A;  4HJG E;  1WM2 A;  3ZJV A;  2LHD A;  1WRI A;  4W9F A;  4US8 A;  2BYF A;  4EZK A;  2WXF A;  2C5L C;  4L1B A;  4RGN A;  1QOG A;  1QLB B;  2DZI A;  4YTN B;  1RLF A;  2BYE A;  4URK A;  3VTV A;  2KQ4 X;  1J19 A;  3KWL A;  3AEF B;  1IPG A;  5AZF A;  2INN E;  4W9J A;  1WXV A;  2NBW B;  1VDV A;  2UYZ B;  1FNU A;  2KJ6 A;  2DHZ A;  2LWP A;  4WAF A;  3RPF C;  1AAR A;  4FHK A;  2QEJ C;  4BKS D;  3Q3J A;  3PPA A;  3Q3M C;  3MHS D;  3TIX A;  2CHW A;  1ZKH A;  4TQ0 A;  1WYG A;  2INP E;  2J0K A;  3IHP C;  4W9L A;  2WQY B;  3NVV A;  3A33 B;  2OED A;  1V8C A;  3QC8 B;  4HVB A;  3SD5 A;  2CS4 A;  3HK0 A;  2BKF A;  2HD5 B;  3Q3O C;  4XX5 A;  2V1Y A;  1QQR A;  2Y5B B;  4KZC A;  2M0X A;  1P0R A;  2KOX A;  2DEN B;  1MG8 A;  1TIF A;  2JPH A;  3B0A A;  3DVG Y;  3U52 E;  3RFZ B;  1ET9 A;  3L54 A;  5EE3 A;  2ON8 A;  1SGH A;  1C78 A;  2WXP A;  5D6J B;  1ROE A;  2KFJ A;  3AE3 B;  1OGW A;  2JX5 A;  4M8M A;  4F1S A;  5T8I A;  2FAZ A;  3L16 A;  3M62 B;  1L0Y B;  2PJH A;  4ZOH C;  1CQV A;  3PZ8 A;  3VH4 B;  1NYQ A;  4JX1 C;  3D32 A;  3AE6 B;  1WF9 A;  2GMI C;  2IO3 B;  1P7F A;  4PT5 A;  2L05 A;  2KDE B;  3BZD B;  1EWY C;  2N4F A;  2KDI A;  5AUI A;  1GNU A;  2JT4 B;  3C0R B;  4DDI D;  1UWM A;  1UEL A;  1U4A A;  3AEC B;  2BTE A;  4MAC A;  3AU5 A;  3DPD A;  3R8B A;  4RM9 A;  3HIZ A;  2Q5W D;  3ZTD A;  2CU1 A;  3AEE B;  5FR6 A;  3PRM B;  2PLP A;  5TR5 A;  1F9J A;  2AWT A;  4FHJ A;  3A1Q B;  3UIP B;  1T0R C;  3OAW A;  1LO5 D;  1TKE A;  3E9S A;  1TY0 A;  1L0V B;  3ABV B;  4H2A A;  3NJT A;  3PT2 B;  2N9P C;  2BWF A;  3ZXV A;  4KKI A;  1M94 A;  3I5J C;  3PLV A;  1V80 A;  3QJZ A;  1MPE A;  1J7C A;  4WH4 A;  4HK2 A;  3B9J A;  3PZ7 A;  2D5G A;  1C76 A;  4OZA A;  2KXJ A;  3IT4 B;  4ANV A;  5HKH A;  3UQA A;  2N7E A;  2KAN A;  2IJ0 A;  2KYW A;  3X0W A;  3KWV A;  3M63 B;  3QA8 A;  2UWQ A;  4M02 A;  1QIL A;  2FUG 1;  3VRB B;  2C60 A;  1QOF A;  3MJW A;  1C4C A;  3L08 A;  2KD0 A;  2QDF A;  1ZOY B;  3ZJU A;  2ZVO A;  4USA A;  2MBB B;  1QF6 A;  1T3Q A;  2MH7 A;  4BVU C;  3PSE B;  2E6X A;  1SXT A;  2JY6 A;  2KX0 A;  5DCN A;  2ZNV C;  3ZGZ A;  2ZJD A;  2XK5 B;  3ZYY X;  1K8R B;  4AUQ C;  2VRR B;  1WM3 A;  2R2Q A;  1K51 A;  2BB6 A;  1NI2 A;  2GRI A;  5BMG A;  2V3N A;  1OQY A;  1XXG A;  4LNN A;  4O1N A;  3TEZ A;  3DBH I;  2EEL A;  3QX1 A;  2Y5P A;  4GLS C;  1JWS D;  2XK5 A;  4PS8 A;  3U7Z A;  1L6U A;  1IGD A;  1V9J A;  3APC A;  1IGC A;  1FD6 A;  4P6V F;  4NQK E;  1FRD A;  1FXI A;  3N30 A;  1T0Q C;  3MP9 A;  3QWZ B;  2MA9 B;  1J8C A;  3VUW A;  4IM0 A;  4UDU C;  1RRB A;  4HKZ E;  4REZ A;  4EEW A;  3UGB B;  1GPX A;  1YN5 A;  1R4N I;  1YD8 U;  2BS3 B;  2A5U A;  2KAC A;  1WJ6 A;  3Q2A C;  4HLE A;  2MX2 A;  3JW0 X;  4MSM B;  2PKO A;  4RH6 A;  3EFU A;  2NCN A;  2L0T A;  3QAR A;  4TMA B;  3U4E G;  1VZ7 A;  2L76 A;  4HDO A;  4E71 A;  1Q5W B;  2MRP A;  2MBE A;  4IG7 B;  3V6C B;  1TGZ B;  4IM2 A;  1RM6 C;  4GIV A;  3U7D A;  2PVO D;  3ZVV A;  3ZNI D;  3L13 A;  3V61 A;  2LUE A;  5J2R A;  2NVU I;  1XLP A;  1MI0 A;  3IT6 B;  1UH6 A;  3ZRF A;  1G6J A;  3SDL C;  4A90 A;  1T5X D;  4OZC A;  2K8H A;  5E6P A;  1M4V A;  2KFK B;  2GB1 A;  3GE3 C;  1SEB D;  2RDB C;  2WDT B;  3L0W B;  2JVC A;  5CTR C;  2LVP A;  2K6D B;  4ZHO A;  3GP7 A;  2L3Z A;  2DZK A;  5CHF A;  1DOI A;  3QQ8 B;  1OEY J;  2KFK A;  3N9Y C;  3ECI A;  1UWX A;  5BO4 B;  4GDK B;  3OWE B;  4IWQ A;  2WDR B;  1EU3 A;  1L4Z B;  1Q1O A;  3O65 B;  5IN7 A;  1L2N A;  5IP4 D;  2BS4 B;  1F52 A;  1GC7 A;  2JWZ A;  4DDG D;  1FMA D;  2WX0 A;  3ZRC A;  4GDK A;  4WQM A;  4L23 A;  1D6E C;  2KZR A;  3EA6 A;  4GN1 A;  2CKH B;  2MJD A;  1YMH E;  4LJO B;  3L4P A;  1P98 A;  2KDM A;  3PHX B;  1WSP A;  3NRZ A;  3U8Z A;  2MEK A;  4LNO A;  2RPQ A;  1SB3 C;  2J53 A;  4CO7 A;  1V49 A;  4PYU A;  2WXK A;  3MC0 B;  2I38 A;  4BFR A;  3DBL I;  5EE9 A;  2N1W A;  1TY2 A;  1XCT L;  2PMV A;  3AE8 B;  1T0S C;  3BY4 B;  2LFI A;  3DHH C;  3P4R B;  3HRD D;  2WXG A;  3KUD B;  2JRI B;  2WXH A;  4MSQ B;  5AEK B;  2KK8 A;  1CMX B;  4A3O A;  5C2T B;  2L8J A;  4OHJ A;  2WYQ A;  5IO9 A;  1P3Q U;  2LXA A;  2QMT A;  4DXA B;  4LNK A;  4XE0 A;  2WU2 B;  2HJ8 A;  1B9R A;  1PGX A;  1LFD A;  1F0Z A;  1NEK B;  3OJ4 B;  1SIJ A;  1HTQ A;  3N32 A;  4P1B C;  4ANW A;  1UBQ A;  2D10 A;  2PEA A;  4X57 B;  2NTS A;  4LCD E;  3WAN A;  3H9D A;  4AS1 A;  3IXS A;  1OEY A;  2HTH A;  4C00 A;  1TKG A;  3A4R A;  4W9I A;  1I4G A;  2JU6 X;  2KHW B;  2WXO A;  3B08 A;  3Q8F A;  2MBO A;  1KOT A;  1DYQ A;  1PQS A;  3P2B A;  5FK9 C;  2KX3 A;  2FCS A;  1JCK B;  1WGR A;  5D3I B;  4EFO A;  3VAW A;  1ET6 A;  3RN9 C;  3LB8 C;  5JH5 C;  1WE7 A;  3GS2 A;  4OVV A;  5AUK A;  3AH7 A;  5BYQ A;  4ANU A;  4YXD B;  4J3O D;  3RD2 A;  1I42 A;  4RGO S;  3BVM A;  3DBR B;  4GDL B;  2AYO B;  3VHT C;  1VR9 A;  2BYV E;  4MDK E;  3IAM 1;  2KWU B;  3PV1 A;  3C8Y A;  2V4L A;  2PPH A;  1MHX A;  2ACZ B;  2CJN A;  2W3S A;  4GDL A;  2JXX A;  3BII D;  2L83 A;  2LJ5 A;  3DQV A;  3B2G A;  1FCC C;  4N9F 4;  4PYZ A;  3PLU A;  3EHV A;  3DHI C;  1WXS A;  1IP9 A;  5G5G A;  1N60 A;  4I6P A;  4BZA A;  2WWZ A;  5GMV A;  1YQ3 B;  4LLG M;  2DZM A;  1YJ1 A;  4ZRP A;  2BT6 A;  4LK0 M;  3CF6 E;  4A6Q A;  1L6V A;  3Q3F A;  3MJ5 A;  1HZ6 A;  1HTO A;  3OG5 A;  1MJD A;  3NHE B;  4MGK E;  1MVK A;  4RF0 A;  4YTM B;  3AXC A;  4FLH A;  2ZPY A;  3RMK C;  2G4D B;  3W5U B;  2KKC A;  1NBF C;  2WXN A;  4OZB A;  4W9K A;  1WR6 E;  5TSS A;  1S3S G;  2BBC A;  3Q8A A;  2QCZ A;  1SE9 A;  3VTU A;  1YJI A;  1WGK A;  1E0Z A;  3NVW A;  4AJW A;  3NY5 A;  2KAJ A;  4M01 A;  4IC7 B;  3AMZ A;  3CSF A;  5DPS A;  3ZXR A;  3MHZ A;  3EGR A;  2AEH A;  4K81 A;  1Z5S B;  1WY8 A;  1WH3 A;  1WX9 A;  4JE3 B;  2CHZ A;  3TMP B;  5JHA A;  2L1A A;  1YNT E;  1WMH B;  4AWJ A;  4FBJ B;  1UUP A;  2ASQ A;  2IND C;  2BW2 A;  1YN3 A;  2KVZ A;  1I4X A;  1DGJ A;  1WMH A;  3RI7 C;  2L0F A;  3MC9 A;  3SHQ A;  1Y56 A;  2B76 B;  1E8X A;  3PO0 A;  2K9X A;  2O6V B;  3GB1 A;  1L0X B;  1PUT A;  4K7U A;  1JWU D;  4YSZ B;  3N3K B;  1P7E A;  3VDZ A;  4EE2 A;  1C77 A;  2Y5C A;  1WE6 A;  4WJO A;  3C19 A;  4LDT D;  2O6V A;  2PE6 B;  5C3J B;  5HG2 A;  3BWU D;  4AJY B;  2O2V B;  3PS6 A;  3KYD D;  5FKA C;  2BB5 A;  3ML9 A;  1ZDV A;  3VTW A;  4ZHP A;  1KLG D;  4K1R B;  2J0J A;  3P4Q B;  1QT9 A;  2WU5 B;  2ZEQ A;  2KMA A;  3KUZ A;  2O2V A;  3PRZ A;  2MBQ A;  4M8N A;  2REX A;  3TL5 A;  2CR5 A;  2JSV X;  1WR1 A;  1QOB A;  2LGI A;  1F1H A;  2ZW0 A;  2JF5 A;  1JRO A;  4OW0 A;  5JHB A;  2ZPN A;  1XCQ L;  4KSL C;  2E3T A;  4WUR A;  2BS2 B;  1F77 A;  1XF5 L;  2AL6 A;  3VH3 B;  5CX3 A;  1E7U A;  2WLB A;  4YWG G;  2KJR A;  1TT5 B;  3A9K B;  2N7D A;  1GAQ B;  4MH8 A;  4FJV B;  3R7R A;  2RDH A;  2GBN A;  1FFV A;  4IWP A;  4J6I A;  3ML8 A;  4NJC A;  4GU2 A;  3A9K A;  1HQR D;  2C7H A;  4ZRK A;  3RCZ A;  3MTN B;  3DDC B;  4JWS C;  4TSS A;  4A3P A;  2QSD A;  3TSS A;  3HVZ A;  4XC2 A;  2MJ3 A;  1EUV B;  1Z2M A;  1V81 A;  1TS2 A;  1XLO A;  5LXH A;  1WRD B;  2ZZP B;  3A4S C;  3DHG C;  1IYF A;  4C7Z A;  1SE3 A;  4KIK B;  1EO6 A;  2JUO A;  2C9W B;  4MT5 A;  4ZRQ A;  1FNV A;  4FJY A;  4M0W B;  2DYO A;  2QIL A;  3W1Y A;  4HCP B;  1WZ3 A;  4KX6 B;  4BOZ B;  2RGF A;  1P9D U;  1WI0 A;  3R66 C;  2HTM E;  1OFF A;  1CK1 A;  3W5V B;  2C7N B;  3V62 A;  2JZ3 B;  2M0A A;  3A1Q A;  4XWT A;  2A4Z A;  3KH0 A;  1D4B A;  1F2R I;  5E6J A;  2V3P A;  5BMH A;  1YJJ A;  2XN9 C;  2V3S A;  3DVN U;  2EMS A;  3PHW B;  1FM0 D;  3DBH B;  3BK1 A;  2G3Q B;  2FCM A;  1HZ5 A;  4ZYS A;  3QIJ A;  1WX8 A;  5IKC M;  4BKT A;  3WAL A;  1PGA A;  2K8C A;  2WXM A;  2K6Q A;  2MP2 B;  2MBH A;  1TBE A;  1STE A;  4KGT A;  2JWU A;  1TS3 A;  2GBK A;  4JPS A;  3ZNH B;  1QZE A;  1R4N B;  2C7M B;  2MP2 A;  1V5O A;  4C4V B;  4P1C C;  3H1U A;  4FXC A;  2N1V A;  2TSS A;  3R3M A;  2G45 B;  1KLU D;  1UNS A;  4DXG A;  1ZW7 A;  1J0G A;  3GOE A;  1WGG A;  4C4V A;  1FO4 A;  2DAF A;  2ZW1 A;  5C23 A;  4IDI A;  2MJE A;  5J18 A;  1V5T A;  1LM8 B;  1D5Z C;  2W3R A;  3VVW B;  3VXW A;  2K5P A;  2QIE B;  2KN5 A;  5EE1 A;  4HXD A;  3DWM A;  2G4S A;  4DBG A;  1N5X A;  4EZJ A;  1OQR A;  2Z8L A;  1VZ6 A;  3AE9 B;  3I57 A;  4E74 A;  4W9E A;  3E56 A;  1GB1 A;  4BKS A;  3NS1 A;  2NS5 A;  2XEW A;  2CU3 A;  2JQR B;  2KT7 A;  3P42 A;  1VLB A;  4I6N B;  4A55 A;  3IVF A;  4XWW A;  1GUA B;  4FJZ A;  2PW9 A;  5C1Z A;  2RD0 A;  2R2O A;  2MLB A;  3R7Q A;  3H8H A;  1UF0 A;  3GZN I;  4ZRI A;  3VUX A;  3A9J B;  5BYS A;  1E7V A;  3KLS X;  4ARI A;  1H8C A;  4MJS B;  1V86 A;  3A9J A;  4B6W A;  3KVF B;  4GSW A;  4NY0 A;  3W1S A;  4GB9 A;  5D2M B;  4K7W A;  1H4R A;  2FNJ B;  3BVZ A;  3VR8 B;  1HXY D;  2J7Q B;  1C3T A;  3DBL B;  4LNF A;  2AL3 A;  3VQI A;  3ZDM C;  4DHZ B;  2BPS A;  1IBX B;  2J4X A;  1VD2 A;  5LLI A;  1I4Q A;  2BGF A;  1VZ8 A;  3RNE C;  1L7Y A;  4LTU A;  3NVY A;  4AP4 C;  1UGM A;  3UF8 A;  1I4R A;  1GC6 A;  1IBX A;  3WAO A;  2IY1 B;  3WCQ A;  3X23 A;  2L32 A;  5BYR A;  4LJP B;  5JXV A;  1DOX A;  5D7G A;  2VH1 A;  2LEK A;  4ZYN A;  2LGS A;  4G3X B;  2M4N A;  1RFK A;  2YVC A;  1K53 A;  5IAA C;  2CJO A;  4KV2 A;  3BIN A;  2IO2 B;  3TCA A;  3N1Z C;  3RNB C;  1V1P B;  2EMT A;  1TS4 A;  3H7P B;  1SE4 A;  2MW5 A;  3IAS 1;  4NJ7 A;  1CJE A;  5E6O A;  3SR6 A;  3VRA B;  2LRU A;  3PZD A;  1Q10 A;  2KLG A;  3NG0 A;  4K3B A;  2KLC A;  2R61 A;  1ZP0 B;  5DPT A;  2XNA C;  3LJ3 A;  2QC8 A;  1V1P A;  2INC C;  4KGS A;  2M1M A;  1E8Y A;  3H7P A;  2LMC A;  4IOI E;  1YN4 A;  4BOS C;  4K7S A;  3RUI B;  3TUO A;  3TJP A;  4PS7 A;  4MH0 E;  1BXT A;  1L5P A;  4GOC A;  3B2F A;  1VJK A;  1ZUD 2;  4ZDV A;  1JWM D;  3TBL D;  2KC2 A;  3RNF C;  3RNA C;  3U30 A;  5D3D A;  3BK2 A;  1S1Q B;  4EUT A;  3HHM A;  4W9G A;  1FRR A;  2I1J A;  4IKG A;  2K0P A;  2JYE A;  3PTF C;  3JYU A;  3H6N A;  2OOB B;  2IZV B;  4JWU C;  4JQW C;  2IDY A;  2VZK D;  2K1F A;  2WXL A;  2LRW A;  3NUH B;  3QHT A;  2KO3 A;  3ZDT A;  2K22 A;  4KVG B;  1E8Z A;  1YQB A;  1C4P A;  2ZCB A;  3RUL A;  2MSE D;  2DYM A;  3P4S B;  5D94 A;  1JRU A;  2V0G A;  4OVU A;  4FN2 A;  4XGA B;  1D5M C;  4MM3 B;  1RWS A;  2PIA A;  3TEX A;  2BVC A;  1FPY A;  4RGM A;  1LXD A;  3BYT B;  3CST A;  2NMQ A;  5H8Y E;  4HEA 1;  2DNF A;  2LJI A;  1KFY B;  1N63 A;  3I9V 1;  3V6E B;  1AYF A;  4MM3 A;  3PRE A;  2KTR B;  4DK5 A;  4WWN A;  1JWA D;  3ZNZ B;  4W9C A;  3M95 A;  2LVO A;  4ANX A;  2NR2 A;  4ITK A;  1WYW B;  3DVN V;  3WA0 A;  4RCO A;  4WAA A;  4KDL B;  1F2R C;  2KMM A;  1VRA B;  2WDQ B;  3B1L X;  3L10 B;  2JXT A;  4XDD A;  2KWC A;  1PYW D;  2YEP B;  4HPL B;  3NZS A;  2WHI A;  2WDV B;  3P63 A;  4NJ6 A;  3T3O A;  4B0M A;  2FBW B;  2GLS A;  5DPW A;  5HFY A;  4BAX A;  1MG4 A;  3VUY A;  4WIP A;  1BUI C;  2J0M A;  2D2Q A;  1EM7 A;  4WWP A;  4FA6 A;  2LVQ A;  1GOZ A;  2MHJ A;  3NZ3 A;  2K25 A;  1ZGU B;  1N61 A;  1TYG B;  3EC8 A;  2MCN B;  5IA7 A;  4IUM B;  1JWB D;  2RR9 A;  1YOV B;  3HM6 X;  1TS5 A;  1SF0 A;  1SSN A;  4XDC A;  1YIW A;  5CHV C;  4IM3 A;  3AE5 B;  3AE4 B;  3CIR B;  1HE8 A;  2DZJ A;  4A8X C;  2FE8 A;  2K39 A;  4IW0 A;  4YTP B;  5G2N A;  4NPN A;  5EE0 A;  1WXM A;  5H92 C;  5HI1 A;  2GI9 A;  4ASW C;  2ONQ A;  1KM7 A;  4L2Y A;  1QKZ A;  1I4P A;  1EF1 A;  1LGR A;  3ENE A;  4TKN A;  2JZZ A;  2QJL A;  4BKG A;  1YQ4 B;  2RDG A;  4BBN F;  2N9X A;  4OVZ A;  3DVG X;  1AWD A;  3AUL A;  1TTN A;  2FIF A;  1WXQ A;  2D3A A;  1TJE A;  4JGH B;  1CZP A;  1WJ4 A;  2D3B A;  3PVL A;  1FIQ A;  4TQ1 A;  3V60 A;  3FIL B;  4HKQ A;  5GXG B;  4EKU A;  4HRO A;  2M8S A;  1L4D B;  1J7B A;  5AZH A;  4K3C A;  3S2A A;  1R4M I;  1RFA A;  5G55 A;  2LUM A;  1A70 A;  1YX5 B;  3FIL A;  3ZW3 A;  2MQJ A;  4PS3 A;  2OJR A;  4DQO C;  1KF6 B;  1JML A;  3FAH A;  4C7Y A;  3JSV B;  2D3C A;  2WXQ A;  2KDB A;  4A20 A;  5CHW A;  3UQB A;  2DLB A;  3NOB A;  2X38 A;  1PGB A;  1SBB B;  3VR9 B;  1K52 A;  2GBR A;  2BF8 B;  2I1K A;  2VZK B;  2KC1 A;  3K9O B;  2I2Y A;  1TZ1 A;  2BKR B;  3AI5 A;  3JSV A;  4IWO A;  1KJT A;  3UIO B;  4RMA A;  5L95 C;  1WWT A;  1RYJ A;  3SEB A;  1ZDX A;  1SJH D;  4MEM A;  1I35 A;  3RZW C;  4S17 A;  2KNB A;  2KMC A;  4P7I A;  4NZL B;  2L7R A;  2WGS A;  1WIA A;  5EDS A;  4RFB A;  5L83 A;  1FXT B;  4HDQ A;  4RF1 A;  1JQ4 A;  4G50 A;  4PK1 A;  3U2S C;  2W55 A;  3AU4 A;  3UI3 A;  3P4P B;  3Q69 A;  4R3D A;  1ISN A;  2ZVN A;  2YEP F;  1WGY A;  3W1S C;  4CHK A;  3KQ4 A;  3BVG A;  1KTK A;  3KYC D;  3O13 A;  2RSU A;  1EWC A;  3AM9 A;  4YL8 A;  4MGI E;  5LXI B;  1NYR A;  4MGY E;  5AZG A;  3H7S A;  1RAX A;  3NZU A;  3ETR A;  1LQB A;  1WFY A;  4II3 B;  2KQ7 A;  1UD7 A;  1ZXI A;  2G1E A;  4KIK A;  5E6N A;  1A5R A;  3Q8C A;  2WP9 B;  1TZO A;  2NPT B;  4GXB A;  1JAL A;  1HEZ E;  1XO3 A;  3K9P B;  4WJN A;  2DX5 B;  4M0W A;  1WJN A;  2LI5 A;  4JIO U;  3ZTC A;  2W9N A;  2RPV A;  2N7J A;  5KHO A;  3ZQ4 A;  5HHD G;  3KUC B;  2Z0D B;  4MGZ E;  4HCN B;  1QOA A;  3MFG A;  4WJP A;  2NPT A;  4KGR A;  2W54 A;  1N5W A;  2AQ1 B;  4KKJ A;  3URY A;  3IFW B;  3WAM A;  1NVI D;  4DHJ D;  1FNW A;  4US9 A;  1YX6 B;  4YSY B;  3LDZ E;  1J7A A;  2DBY A;  3ZUN A;  1N6Z A;  2D07 B;  4MEL A;  1WJU A;  1V6E A;  3ZO5 B;  3Q14 C;  4FUL A;  1EF5 A;  2B3A A;  4TUU A;  4M00 A;  1SE2 A;  1N62 A;  3AB5 A;  3JVZ X;  2BYT A;  2LAS A;  5LNK 1;  2IGG A;  3W2D A;  3QK0 A;  2JYT A;  4JL9 A;  1BML C;  2V4I B;  2Z0E B;  2WX1 A;  3V3X A;  2PE9 A;  1C4A A;  4ICV A;  3GZN B;  4HPM B;  2PTL A;  1P1A A;  3I63 C;  1EU4 A;  4FAD A;  2KQS A;  1I7H A;  3EEC A;  2AX5 A;  3LXF A;  4F8C B;  4KSK C;  3CWI A;  2FID A;  4LDT B;  1ZXH A;  2K3U A;  3J9C A;  1SIF A;  2DWQ A;  2UU7 A;  2NBV B;  2M19 A;  4DHZ E;  2LGX A;  4S0R A;  4ZRJ A;  1V1O A;  1BT0 A;  1B1Z A;  3VFK A;  4RGT A;  1KLV A;  3OLM D;  1NDD A;  4BBN C;  3BYY B;  1I4H A;  4HJK A;  1DOY A;  1XD3 B;  4A9A A;  2WXR A;  3T3N A;  1FXA A;  4ICU A;  1WGD A;  3R2T A;  3Q8B A;  2IO0 B;  2OJW A;  2N0S B;  1ENF A;  3DCG A;  4RNA A;  4NNJ B;  4CQN A;  1JRP A;  3ZKJ C;  2ICI A;  2J42 A;  2KWD A;  3DWG C;  3HM3 A;  5IOI A;  4NAW B;  4DWF A;  3FKY A;  3RNC C;  5BMI A;  1Q0W B;  4MJS A;  3QCA A;  2X8X X;  3WAP A;  1D3Z A;  1XEE A;  4AQ7 A;  3ZJT A;  4G0N B;  2PVG C;  4NAW A;  3SFE B;  2GBM A;  4XZ4 A;  1GJZ A;  4II2 B;  1AW7 A;  2WS3 B;  4XYC A;  4NAM A;  1E10 A;  4N58 A;  1V2Y A;  2IGD A;  3OJ3 A;  3N1X C;  1ESF A;  2GBJ A;  1JW9 D;  3EUB 2;  2LGY A;  1XQQ A;  1E8W A;  2DAJ A;  2M17 A;  2NTT A;  3R2I A;  1PFD A;  1KRH A;  1WGH A;  3ONS A;  1AN8 A;  4HWI B;  4N6E B;  3KW5 B;  4E3C A;  2J52 A;  5DPR A;  3Q8E A;  2GOW A;  2D11 A;  2FCQ A;  4F7Z A;  2IBI B;  4WWM A;  1FCL A;  2G9H D;  2JRH A;  3NVZ A;  1C79 A;  2BQQ A;  3HVD A;  3W9C B;  2FUH B;  4WWO A;  5G5H A;  2OHF A;  3PRP B;  4DHJ B;  1TKY A;  2W82 A;  4ACF A;  4AOF A;  1KH0 A;  4YSX B;  1UZX B;  1X1M A;  4W9D A;  3Q3N C;  5J17 A;  2JZP A;  4B9K A;  1D5X C;  1E7P B;  2KTF A;  2K8B A;  3I3T B;  3GE8 C;  3T8M A;  4YT0 B;  3AEB B;  3ZLZ A;  2WXI A;  3AE7 B;  1WX7 A;  3AED B;  3N1Y C;  3AE2 B;  2HE7 A;  2YLM A;  4P16 A;  2LXC A;  3EFC A;  2AQ3 B;  1IUE A;  2O6V D;  3ALB A;  2ZNV B;  2KVR A;  2L00 B;  1NEN B;  3UIN B;  2H88 B;  1E5W A;  4B0E A;  1UGJ A;  1PDX A;  1UBI A;  3V05 A;  2M56 B;  4WQO B;  2HDE A;  4GGQ A;  4W9H A;  2N9L A;  2KDF B;  4KDI C;  3T9L A;  1ZPS A;  3AEG B;  1E6E B;  2XBB C;  3DOW A;  4KZ0 A;  2MWS B;  1XLQ A;  5KHQ A;  2BWE S;  2L52 A;  2EKE C;  4LNI A;  1HA5 A;  1MFW A;  2ZCC A;  1MHH E;  2EKI A;  2Y3A A;  3QAQ A;  3IBE A;  2NBU A;  3TEW A;  2KWV B;  4ARC A;  2WXJ A;  4B95 A; 
#chains in the Genus database with same CATH homology
 1T0R C;  3RNF C;  3RNA C;  3Q3O C;  3GE8 C;  4P1C C;  3N1Z C;  3DHG C;  3N20 C;  3Q3M C;  3RNB C;  3N1Y C;  3GE3 C;  2IND C;  3Q2A C;  3Q14 C;  2RDB C;  3DHI C;  3I63 C;  4P1B C;  1T0S C;  3I5J C;  3RMK C;  3RNC C;  3RI7 C;  1T0Q C;  3N1X C;  3RNE C;  2INC C;  3Q3N C;  3DHH C;  3RN9 C;  3RNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...