1ZOYB

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1zoyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zoyB01
4N58A 2CU3A 3VRAB 1I7HA 2DWQA 2HTME 4C7ZA 3HVZA 2PVOD 5EE3A 2WU2B 3ABVB 1NI3A 4ITKA 2CJOA 1TJEA 2CJNA 2M56B 4YXDB 1ZP0B 3SFDB 3VR9B 2AX5A 2KMMA 3AV8A 1XO3A 2QIEB 5G5HA 3W9CB 4YTPB 2BT6A 4C80A 1N61A 1OQRA 1RFKA 3B2GA 3HRDD 1QOFA 2QJLA 1SIJA 2Y5CA 4KX6B 4LTUA 1ROEA 1PDXA 1N5WA 3NS1A 1NENB 1TKYA 1QLBB 3P1MA 1F0ZA 1YJIA 1E7PB 1N62A 3AE9B 1QT9A 1VDVA 3NVYA 2W3SA 1FFUA 4YT0B 4YTNB 4WWMA 1YQ3B 1YQ4B 1FXAA 1JROA 2BS2B 2JQRB 3CIRB 1L0VB 1VLBA 3AE1B 1DOYA 1GPXA 3AEBB 1KRHA 2E3TA 2H89B 3ZYYX 3W5VB 4ZHPA 3AE2B 4FXCA 1DOXA 1NVID 5AUKA 2W3RA 1NEKB 1PFDA 3HUIA 2G1EA 1E0ZA 5H92C 3FAHA 1DOIA 1N63A 3LXFA 3KWLA 1ZXIA 5H8YE 1J7BA 1WRIA 2W54A 3BIID 3W5UB 5G5GA 3DWMA 2WQYB 2PKOA 3AH7A 2BS4B 3AEAB 2MH7A 1FIQA 1E6EB 1WXQA 1FXIA 4JX1C 2KAJA 1KF6B 2WS3B 1SF0A 1RYJA 2Q5WD 1TKGA 1E9MA 4P6VF 3P4SB 1GTHA 2JX5A 3AE3B 3CF4A 2L83A 1TYGB 3P63A 3AECB 1XLQA 2PVGC 1GTEA 1JWBD 4ZHOA 4YSYB 1NYRA 1R7SA 3AEEB 1FO4A 5EE0A 1T3QA 1UWMA 3SR6A 4YSXB 3RPFC 1V8CA 3AEGB 3P4RB 1PUTA 2DBYA 2LEKA 2WDQB 1WYGA 1FFVA 1OFFA 3B9JA 5GXGB 2WP9B 3ETRA 3LB8C 4HRSA 1RM6C 3WCQA 3VR8B 1QOAA 1AWDA 1WWTA 1H7XA 1J7CA 2MJEA 3AM9A 3NRZA 1N5XA 3AE6B 1J7AA 1TKEA 2FBWB 2PIAA 4JWSC 1B9RA 1NYQA 5EE9A 3AE5B 5C2TB 3SFEB 2MJDA 2EKIA 3FC4A 1SB3C 4USAA 2N0SB 4IDIA 5C3JB 1ZUD2 1FMAD 3AEFB 3P4QB 2OHFA 1FRRA 2H88B 1GAQB 1L5PA 3AB5A 4US8A 2K5PA 1FM0D 3AMZA 1OQQA 1XLNA 4JWUC 5EE1A 2BS3B 4N59A 4A9AA 2L52A 1CJEA 1IUEA 1XLOA 1FRDA 1YJJA 4YTMB 1AYFA 1XLPA 2K9XA 3AE7B 2WDVB 4ZOHC 3L4PA 5AUIA 1VJKA 1H7WA 2M19A 3B2FA 1E10A 1KFYB 1RWSA 1A70A 1JALA 1JWAD 2ACZB 4HROA 3CWIA 1GT8A 2W55A 4N6EB 1QF6A 1ZOYB 1CZPA 1N60A 3P4PB 2WDRB 3AEDB 2K22A 1JW9D 1QOGA 3NVVA 3AE8B 3VRBB 2MJ3A 4US9A 2WU5B 3AN1A 3EUB2 2B76B 1L6VA 1QOBA 4C7YA 3NVZA 4YSZB 1WGKA 1JRPA 1EWYC 3DWGC 3NVWA 5MPOA 1DGJA 1JQ4A 2WLBA 4WQMA 3AE4B 3PO0A 1L6UA 1V97A
chains in the Genus database with same CATH superfamily
2KC2A 2DWQA 3MJ5A 2CHZA 1K53A 4DDGD 1QOFA 2BW2A 4HPMB 2JZ3B 3A9JA 2C5LC 4XC2A 3Q14C 3PZ8A 1E7PB 3U7DA 3AE9B 4ZRIA 1T0SC 1ISNA 2MA9B 3PGEA 2K3UA 1R4NI 4WURA 3DVGX 4CYEA 2IJ0A 2D10A 3KUDB 3UI3A 2QDFA 2E6XA 5H8YE 1YD8U 3A4SC 4S17A 1GUAB 1TY2A 2DYBA 2KFKB 4ZRJA 1KTKA 2XBBC 4WJNA 2NPTA 4JX1C 3DBSA 4L23A 1FCLA 3IXSA 3ZUNA 2MW5A 2RPQA 1T0QC 3CF4A 2GLSA 4W9EA 3U8ZA 1NYRA 1YX5B 1UWMA 4II3B 2DBYA 2LASA 2K0PA 4MGZE 1WGDA 2PIAA 3ZJUA 3BVZA 2WXPA 3IT4B 3AULA 2IO1B 2OHFA 4TSSA 2VZKD 1UBIA 4QAYA 2KDMA 1OGWA 2Z0EB 1YIWA 1WR1A 2FIDA 3B2FA 3WAOA 2XEWA 2FCSA 4MGYE 2W55A 1QF6A 2KQ7A 2CS4A 3N1ZC 3OJ4B 3URYA 2IPKD 2C9WB 2WWZA 3PLUA 3RNGC 2DLBA 4AUQC 3QQ8B 3N9YC 1WZ0A 2ZPYA 2JZPA 2INPE 3W1SA 3Q3FA 2WHIA 2CU3A 4ANVA 3ZVVA 3BVGA 4C7ZA 3ZRCA 1JRUA 3T8MA 3VH3B 2CKHB 4GOCA 1YN5A 2KOXA 2FNJB 2QJLA 2EMSA 3MHSD 4KX6B 3PRPB 5IO9A 2MP2B 4CQNA 2GRIA 1F0ZA 1UELA 2BYTA 2W3SA 3RI7C 2JUOA 4BBNF 4LCDE 1F9JA 1GNUA 3SEBA 2G1EA 2BPSA 1Y56A 2JWUA 1J8CA 3DVNV 1WRIA 2OJWA 4RGTA 2WXIA 4W9FA 4MACA 5LNK1 1D5MC 2BYEA 3IFWB 1YN3A 2W9NA 1RFAA 3ZNHB 4RGMA 5E6PA 1KH0A 3AEEB 4TUUA 2D07B 3SR6A 1ZW7A 1SGHA 3AI5A 1GB1A 2FAZA 3LB8C 2PMVA 2FE8A 1H7XA 3RT3B 2Z59B 2KJRA 1VZ7A 3SHQA 5AZHA 3FC4A 3CSTA 2L05A 2L0FA 2MLBA 4HJGE 3MHZA 4KDLB 1M94A 3NOBA 4MELA 1I4PA 2M1MA 2A5UA 2BS3B 1V5OA 2DAFA 2K9XA 1XLPA 1ACCA 1C4AA 2KMCA 2M17A 1KFYB 4HROA 3KWVA 1GT8A 2J7QB 1ZOYB 3AEDB 2G9HD 3E9SA 5JZEB 4US9A 3NUHB 2KFKA 4FN2A 3BWUD 1C79A 2L3ZA 2L76A 2WLBA 2LRUA 2MWSB 1STEA 5IAAC 2N9XA 3WAPA 5BMIA 3DDCB 5LLIA 2HTME 5EE3A 4M01A 4XX5A 2MRPA 2ICIA 2HJ8A 2LXAA 3W9CB 2VZKB 3UINB 2NVUI 3TJPA 4A3OA 3IAM1 1VR9A 5DCNA 3NZUA 3PRZA 1MPEA 1YQ3B 2JVCA 3DBHI 4BFRA 1IPGA 2QMTA 2DHZA 2H89B 2KTRB 1L4ZB 5AUKA 1DOIA 1WGRA 1F2RC 1PQSA 3X23A 3I9V1 2SEBD 4DBGA 2AWTA 4CO7A 2HTHA 4A8XC 3Q8FA 1E6EB 4RMAA 4TKNA 4A6QA 3DVNU 3WAMA 1ZE3D 3H7SA 4MJSB 3AE3B 3P2BA 3TEXA 3ZXRA 4ZRPA 1ENFA 2FUHB 3ZJVA 4KIKB 2WP9B 4ACFA 3WCQA 2XK5B 1WWTA 2ZPNA 1I42A 1FNVA 3V61A 4USAA 2PTLA 5D3IB 1FM0D 5L95C 4N59A 1HQRD 1TIFA 1KM7A 1C77A 3L13A 2V1YA 2D3GA 2CR5A 1A70A 3N30A 5HKHA 2ACZB 3L10B 3KYDD 1WZ3A 5D3DA 2JY6A 3RZWC 3MFGA 2J0KA 2BYFA 1WXSA 4AJWA 1XF5L 2IYDB 1OEYA 3NVWA 2VH2A 3WA0A 2PEAA 3NG0A 2LRWA 4JQWC 2KQSA 4F8CB 1ZKHA 3R8BA 1IBXB 3JYUA 3SFDB 2KMMA 3I57A 4WWOA 2BT6A 4C80A 4GDLB 4GLSC 2Z8LA 4LTUA 3UQBA 3QHTA 4K3CA 1BT0A 5HG2A 4UDUC 3VTWA 2BKFA 3L17A 3AE2B 4FXCA 1JMLA 2GI9A 3KYCD 4RNAA 1T6BX 5KHOA 2MBEA 2LVPA 3L0WB 2HDEA 4MT5A 1WR6E 2JX5A 4EOYA 2IDYA 4A55A 1EF1A 1ET9A 3IAS1 3APCA 1A5RA 1WE6A 2L8JA 4LNKA 5GXGB 1OFFA 4ANWA 4HEA1 3ETRA 3BYYB 4NAMA 4JPSA 3PHXB 2KWDA 4E3CA 1UD7A 2N0SB 3RNBC 1SSNA 5CX3A 3U7ZA 1I35A 2R61A 2I38A 1XD3B 1MI0A 2D5GA 3TUOA 3VDZA 5LXHA 2KJ6A 4JLCA 3HVDA 1XCTL 2KTRA 2JYTA 3CWIA 1WI0A 1N60A 3Q8BA 1QOGA 1H4RA 3GE3C 2KN4A 2RDBC 1BUIC 1V97A 2KNBA 1UZXB 3ABVB 4ITKA 4X57B 1C9FA 4OVZA 1D3ZA 4HCNB 1EO6A 1VD2A 4KIKA 3B2GA 2ON8A 1I4HA 1C78A 2NPTB 1GB4A 1PDXA 4I6PA 5HHDG 2B3AA 3I63C 3ZNZB 1UWXA 4XE0A 3BYTB 4WWNA 4YT0B 1J19A 1L0VB 1OEYJ 1KJTA 4XYCA 2LMCA 3FAHA 2ONQA 1ZXIA 1UF0A 2NTSA 4OHJA 4BKSA 3AH7A 2PKOA 2BS4B 1V2YA 3PZ7A 2LHEA 2I1KA 4FJYA 4DHZE 3U2SC 3QA8A 2MQJA 3PT2B 4HCPB 4W9KA 5DPRA 4KKJA 2WXOA 4KV2A 2RMMA 1E5WA 2AQ1B 1WYGA 3B9JA 4HRSA 4EZJA 1I4QA 4XDDA 1EUVB 3PRMB 2DNFA 5BMHA 5E6OA 2EKIA 1Q10A 2GBRA 1WM3A 5AZGA 3LYYA 1Q5WB 3UGBB 4DQOC 1MHHE 3TIXA 2NBUA 4WJQA 3ZNID 1L7YA 3DBRB 4N6EB 4IUMB 1WIAA 3GS2A 3NVVA 2PPHA 3APDA 4FA6A 4DHZB 2LXCA 4C7YA 1YOVB 1CMXB 1HZ6A 4G50A 5E6JA 2IGDA 3MTNB 2WXFA 3IVFA 3EGRA 3ZRFA 4HKZE 3DVGY 4N9F4 1DYQA 5L83A 3RNFC 2MBQA 3LDZE 3A9KB 1ZPSA 1QT9A 1YQ4B 2L32A 1YQBA 4LDTD 3QIJA 3QJZA 1SE2A 3JVZX 1N63A 3PS6A 4J3OD 1GG3A 1V86A 2ZCCA 1HEZE 1YJ1A 2D11A 5E6NA 3RD2A 2KJHB 4LNNA 4PS7A 1WH3A 3Q3JA 4RGNA 3EC8A 1R7SA 4G11A 3AEGB 1K51A 2WXNA 2ZW0A 2YLMA 2KFJA 4AJYB 3CMMB 2K25A 3RZFA 3FILA 2DYMA 2JXTA 1XT9B 3J9CA 1WJ6A 1FRRA 5DPSA 4S0RA 2DZMA 3RN9C 5EE1A 2IY1B 3MJWA 3QWZB 3N32A 1AYFA 2HE7A 2LVOA 4M8MA 5FR3A 3ZKJC 4KGSA 2M4NA 2NCNA 2A4ZA 2PE6B 2IO3B 2B76B 3ZTDA 2BQQA 2KX0A 3ZTCA 5HI1A 4EZLA 1LFDA 1TTNA 4FADA 4ZRQA 3UIPB 1ZDXA 2RGFA 1I7HA 2UU7A 4A3PA 3HVZA 4KKIA 1TS3A 4EZKA 2M8SA 3WANA 1WXMA 2LGSA 1Z2MA 2BB5A 3ZW3A 2IY0B 1FFUA 1HE8A 3NZSA 4W9JA 4WAAA 1I4GA 4DHJB 3RFZB 1SEBD 1JWMD 2INNE 4TQ0A 2EMTA 1PFDA 1E0ZA 4HWIB 4IWPA 2D3AA 1J7BA 3BIID 3DOWA 4GIVA 2WQYB 1WGYA 4A90A 1FPYA 2N7JA 4IWOA 1E9MA 3R3MA 1XLQA 2PVGC 3DBLB 1NBFC 3RCZA 2J53A 5EE0A 2LJ5A 4K3BA 2BYVE 3M95A 1B1ZA 1U4AA 2HD5B 5CTRC 4HDOA 2WYQA 1AWDA 5EE9A 3H9DA 3BY4B 3AE5B 3KUCB 1BMLC 1UH6A 2D3BA 3A33B 3KQ4A 1RRBA 3OLMD 4LDTB 4LNIA 4MM3A 4P16A 4BKSD 4Q2JA 3A9KA 4US8A 3ECIA 4MH0E 3BK2A 3TMPB 4DDID 1T5XD 2GOWA 5AUIA 2RSUA 3L4PA 3PZDA 1ZXHA 2M19A 2INCC 3IHPC 1ZDVA 1WY8A 3Q2AC 2MJ3A 5IOIA 4F7ZA 3EUB2 1SE3A 4MGKE 2IGGA 2FUG1 2MBBB 2RDGA 2DZJA 4BAXA 4TV3A 3PO0A 5CHFA 4HPLB 2KWUB 3O13A 3E56A 2M56B 1TZOA 4IOIE 4LJOB 4GGQA 1WE7A 1JWUD 5G55A 1WRDB 2IGHA 2LVQA 1V9JA 1QLBB 4K7WA 1FXAA 3NJTA 1G6JA 3VHTC 4ANUA 1WMHB 3AEBB 3W5VB 1GC6A 3K9PB 5J18A 3R66C 4M0WA 4JIOU 2C7NB 1KLGD 3JSVA 2KDFB 1R4MI 1S3SG 4WJOA 3DHHC 1WXQA 3Q69A 4WIPA 1K52A 1SF0A 1LO5D 1TKGA 3P4SB 4JGHB 3I3TB 1MVKA 2LEKA 2KX3A 2WXGA 3PVLA 3KUZA 1RM6C 3Q8EA 4F1SA 2MJEA 2LGIA 3BK1A 3KH0A 1SB3C 2JWZA 3TSSA 1GAQB 3OG5A 4MDKE 2OJRA 4AQ7A 4KZ0A 1IUEA 3UQAA 1UGJA 1IGDA 1C4CA 1YMHE 4YL8A 2LGYA 4KSLC 3V3XA 1D5ZC 1MG4A 3DCGA 1JWAD 2WXKA 3HIZA 3P4PB 2DZKA 2ZW1A 2NBVB 3B1LX 5BYRA 1SIFA 3VRBB 4IM0A 5IP4D 2BVCA 1MHXA 2N7EA 4ANXA 4EEWA 3K9OB 4RH6A 4GDKB 1YJIA 3PLVA 3VUXA 2UWQA 3MC9A 1OQYA 4N58A 2QHOA 2PVOD 5GMVA 3ZDTA 4WAFA 1HTQA 4RF0A 1EWCA 4A20A 3EFCA 1OQRA 2BB6A 3C8YA 4URKA 4DK5A 3DQVA 4XGAB 3B08A 2O6VA 1RAXA 3U4EG 1F52A 4RFBA 3ZYYX 2MHJA 4NQKE 2W3RA 5H92C 4FJVB 4OZBA 1WF9A 3PTFC 4W9CA 2G4DB 3L08A 4EUTA 4NQLB 1C76A 5BYSA 2KAJA 2KANA 4OZAA 3Q6BA 5FK9C 4AS1A 1K50A 5FKAC 4ARIA 5DPTA 3OWEB 1FFVA 3MC8A 4LK0M 1QOAA 2BBCA 1SBBB 4IW0A 1D5XC 2YVCA 2IO0B 2ZNVC 2WX0A 2KN5A 1J0GA 1ZUD2 4PS8A 3AEFB 1XCQL 4DXAB 1TBEA 2NR2A 3AB5A 4EKUA 4IM2A 4RCOA 3R7RA 3AE7B 1WMHA 3H1UA 1I4XA 1RWSA 3Q3NC 4RF1A 2TSSA 4WH4A 3ALBA 4NY0A 2D2QA 2KDBA 1E8WA 2CU1A 3AE8B 4PK1A 1WX8A 2DAJA 4B0EA 2WNMA 3B0AA 1HXYD 1QOBA 1PGXA 1NDDA 3GZNI 1JQ4A 2PJHA 2Z0DB 3U52E 3CF6E 3BVMA 2WU2B 3RUIB 3VR9B 2WGSA 1E7VA 2LI5A 1SIJA 2V3SA 2K8BA 1WX7A 1IGCA 3M63B 4W9IA 2DENB 1TKYA 3P1MA 4FHJA 3A1QA 4JE3B 1VDVA 4GXBA 3QC8B 4BOZB 1VLBA 4PYZA 5FR6A 1GPXA 4ICVA 1E8YA 4MEMA 4B0MA 2JU6X 4FJZA 4XWTA 4GB9A 2J42A 3ENEA 3FILB 2W54A 3W5UB 4C00A 2RD0A 3DWMA 5J2RA 4LNOA 5JHBA 3CSFA 3ZNGC 1SE9A 2C7MB 2KKCA 3ZGZA 1PGAA 3I5JC 5CHWA 2QC8A 3PREA 1S1QB 1TYGB 3RNEC 2FCNA 3DBRI 4HKQA 2BWFA 2L1AA 2K8CA 4GDKA 1T3QA 3RPFC 2JRHA 2DYOA 1E90A 2GBMA 2K1FA 2KDEB 2V3PA 3V6EB 3LJ3A 4I6LB 1WXAA 2Y3AA 2DX5B 2H88B 1P7FA 3T3OA 4A9AA 2L52A 4HDQA 5IKCM 2JSVX 2KLCA 4FLHA 4ZYNA 1AW7A 1H7WA 1E10A 1JWSD 2JF5A 1WFYA 2N9PC 1LM8B 2ZEQA 3QK0A 3V60A 3QCAA 5BMGA 1P98A 3EFUA 4D2KA 4M00A 3L16A 1HZ5A 3RNCC 2LGDA 2WX1A 2KZRA 4YSZB 1WGKA 3ZDMC 1TS2A 5G2NA 4HJKA 2KQ4X 3SD5A 4WQMA 4WWPA 3AE4B 2V4LA 3T3NA 1L6UA 2CJNA 4YXDB 1ZP0B 4DHJD 1XO3A 2MEKA 3JW0X 3ZO5B 2AQ2B 3PSEB 2PE9A 4NPNA 3NS1A 2ZZPB 2LUMA 2GB1A 2Y5BB 4EFOA 1KLUD 2AL3A 1FNUA 4E71A 2E3TA 2C60A 1SE4A 1P9DU 2MBOA 3ML8A 5G5GA 1MFWA 2MH7A 4J6IA 4MM3B 1Q0WB 1FXIA 2J52A 1F1HA 1P3QU 1MJDA 2K6DB 2K6QA 4IKGA 3GB1A 4XDCA 3WIMA 3GE8C 1V1OA 2O6VD 3NHEB 5IN7A 1AARA 1QKZA 3Q3OC 2IO2B 4M02A 1DOYA 2ASQA 2R2OA 1B9RA 2QEJC 4NJ6A 3SFEB 2MJDA 4GU2A 5TR5A 4IM3A 2N7DA 3A4RA 3PV1A 3AMZA 1FRDA 3P42A 3VXWA 3PPAA 2HJ1A 3H7PB 2XNAC 4KZCA 2N1VA 2K39A 2NTTA 3TEYA 2QILA 3ZIMA 4PYUA 2GBJA 4FULA 2FCQA 4AP4C 2V3NA 1L6VA 2REXA 1SXTA 4E74A 1SJHD 1TY0A 2BGFA 3AU4A 3DHGC 4B9KA 3NY5A 5JXVA 4M0WB 1NI3A 3MC0B 2WXQA 3JSVB 2CJOA 1TJEA 2KHWB 1NI2A 2AX5A 3AV8A 2V0GA 1CQVA 5EDSA 1D6EC 3L54A 4DXGA 1RFKA 3O65B 3DBLI 2G4SA 2C7HA 2AEHA 1FCCC 4II2B 1N5WA 4KVGB 3NVYA 2O2VB 1Z5SB 4WQOB 4OZCA 2WDTB 2ZJDA 3VUWA 4W9HA 3T9LA 1TS4A 3M62B 5D94A 1C3TA 5KHQA 1V80A 5BO4B 2N9LA 1FXTB 1AN8A 1V1PB 4RM8A 3W2DA 1EU4A 2AL6A 1KF6B 4BZAA 3KVFB 2Q5WD 3Q8AA 4P6VF 5TSSA 3TEWA 1E8XA 3HM6X 4K81A 2KWCA 3EHVA 5I4DA 3P4RB 3QARA 2LJIA 1R4NB 3V6CB 1UGMA 4ZYSA 1GC7A 2W82A 5C1ZA 4M8NA 1HTOA 2XN9C 4NAWB 3GP7A 3UIOB 4BKGA 1FNWA 1EF5A 1WM2A 3Q3MC 4REZA 4BKTA 4HVBA 2RPVA 3HK0A 2WDRB 2KD0A 2KDIA 4H2AA 2VRRB 4GMVA 2WU5B 1K8RB 2O6VB 1I4RA 2KXJA 3H8HA 3APFA 3SU8X 2YEPF 1V5TA 3FKYA 4C4VA 1TT5B 1YN4A 2WXHA 3GOEA 1N61A 1PYWD 2JYEA 2CHXA 2VH1A 4NNJB 3AU5A 2GBNA 2G45B 2NBWB 3AE1B 3D32A 3TEZA 3QAQA 4ZHPA 1DOXA 1NVID 4JL9A 2N4FA 2LGXA 2KVRA 5IA7A 2L7RA 3LXFA 2AYOB 2GMIC 4L2YA 3H7PA 3ZJTA 3RMKC 2WXJA 1F2RI 4AWJA 3C19A 1XQQA 3DPDA 3P63A 1EM7A 2L83A 1SJED 4BBNC 3S2AA 1FO4A 2JT4B 3QX1A 2JXXA 2UYZB 1V8CA 4OW0A 1FD6A 3VQIA 3VR8B 3MP9A 1J7AA 4R3DA 2J0JA 2ZCBA 2K8HA 3HM3A 1FMAD 4MGIE 1TS5A 3ML9A 2D3CA 2K5PA 3IG3A 4RM9A 1TZ1A 2O2VA 3TCAA 1XLOA 2YEPB 4YTMB 2LWPA 1WYWB 4NZLB 5D2MB 5C23A 3VFKA 3ZXVA 4FHKA 4DXFA 2KC1A 3ONSA 1JW9D 1MG8A 1L4DB 1V1PA 3A1QB 2ZVNA 4TQ1A 3M3JA 3VH4B 3NZ3A 4DWFA 2WXLA 2KTFA 1ET6A 3N1YC 2OEDA 1WGGA 1OTRB 1LGRA 2PLPA 1GJZA 2N9EB 5G5HA 2QIEB 3TBLD 3V62A 1IYFA 1V6EA 4KGTA 1ROEA 4OVVA 2QSDA 1KLVA 1NENB 2INDC 1Y8RC 2L0TA 1L0YB 4YTNB 1JROA 2BS2B 4P7IA 2BF8B 5CHVC 1L2NA 1NEKB 1RLFA 1P0RA 4KDIC 4NAWA 2RDHA 4I6NB 3AEAB 2M0AA 2MP2A 2JRIB 1RYJA 3IT6B 1V81A 1WGHA 2IZVB 5DPWA 1C1YB 1GTHA 1F77A 5LXIB 2V4IB 3AECB 1R4MB 1T0RC 3UF8A 1JWBD 3ZQ4A 4ZHOA 2I2YA 4MSQB 2J4XA 1PUTA 2WDQB 3DBHB 1J7CA 3AM9A 4JWSC 1QILA 2FIFA 2KK8A 4NJCA 4K7UA 1IP9A 4LLGM 1UBQA 4IDIA 4C56C 3U30A 3EA6A 4XZ4A 3VUYA 4GN1A 4MH8A 5D7GA 2WXRA 4ASWC 2M0XA 1CJEA 2LFIA 2N9KA 2RR9A 2DZIA 4BVUC 1CZPA 1N6ZA 2I1JA 3R7QA 4B6WA 3AN1A 1VRAB 1V49A 3NVZA 4WJPA 5MPOA 1DGJA 4O1NA 4L1BA 1P1AA 1L0XB 1WSPA 3KLSX 1HA5A 3OJ3A 1EU3A 2LD9A 4KGRA 3RYTA 2ZNVB 3HRDD 5JHAA 2V9HA 3C0RB 4ZRKA 2KLGA 2N1WA 2QCZA 4CHKA 2LHDA 2JQRB 1LQBA 1YNTE 4IC7B 1T0YA 3HUIA 1QZEA 1PGBA 5HFYA 2NMQA 3AXCA 4HLEA 4PT5A 4W9DA 3OAWA 2J0MA 1E8ZA 1FIQA 1UUPA 2WS3B 3R2TA 4G3XB 1GOZA 3VAWA 3SDLC 4LJPB 2KO3A 1GTEA 4YSYB 4K1RB 1D4BA 4HPPA 4ICUA 3N3KB 1JCKB 1XXGA 2FBWB 3A9JB 4YWGG 1C4PA 3RNAC 1WXVA 1XEEA 1L5PA 2SAKA 2MBHA 2WXMA 4IG7B 4MJSA 2CHWA 3Q8CA 1YJJA 4ZOHC 2MX2A 3NS8A 1UNSA 1QQRA 3PHWB 1BXTA 2XK5A 4ZDVA 2K22A 3H6NA 4IWQA 4G0NB 3V05A 1P7EA 5BYQA 1JRPA 3DWGC 2G3QB 4XWWA 4TMAB 2KMAA 3HHMA 2AQ3B 3VRAB 4HK2A 1TGZB 2IBIB 2BWES 3GZNB 1VZ8A 5JH5C 2MCNB 4YTPB 3KW5B 1WJUA 2Y5CA 2PW9A 1E7UA 4K7SA 1N62A 1VCBA 4P1BC 4FBJB 4W9LA 4W9GA 4WWMA 1WJNA 4GSWA 3VTUA 1CK1A 3CIRB 1VZ6A 1KRHA 2FCMA 1YX6B 3W1SC 4P1CC 2X8XX 4MSMB 3RULA 2KT7A 5AZFA 1H8CA 3KWLA 1M4VA 2JZZA 2R2QA 1IBXA 1ZGUB 2Y5PA 2LZ6A 3R2IA 4AOFA 4GDLA 2JPHA 4RGOS 4PS3A 5J17A 1X1MA 4HXDA 4BOSC 4B95A 2EKEC 1FEHA 3VTVA 2KACA 4YSXB 2GBKA 3X0WA 3N1XC 4EE2A 5AEKB 2KYWA 3NRZA 1N5XA 3AE6B 1TKEA 5D6JB 2MSED 4NJ7A 1NYQA 5C2TB 1WX9A 1WJ4A 3W1YA 5T8IA 3ZLZA 5C3JB 1ESFA 3P4QB 2BKRB 2X38A 3TL5A 3VVWB 1OQQA 1XLNA 4JWUC 2L00B 2NS5A 2EELA 2WDVB 1KOTA 1VJKA 3BINA 3BZDB 4OVUA 4C4VB 1JALA 3N20C 3IBEA 2ZVOA 2LUEA 2OOBB 4ARCA 2KWVB 3DHIC 3WALA 2KVZA 4KSKC 4LNFA 1LXDA 3EECA 1EWYC 1Q1OA 2BTEA
chains in the Genus database with same CATH topology
4N58A 2DWQA 2PVOD 2YEPF 3ABVB 4ITKA 4WAFA 1C9FA 4OVZA 4RF0A 3MJ5A 1EWCA 1YN4A 2WXHA 1N61A 1OQRA 1K53A 1PYWD 2JYEA 1QOFA 2BB6A 2ON8A 3B2GA 1I4HA 2BW2A 1C78A 3C8YA 1GB4A 1PDXA 5HHDG 3PZ8A 1UWXA 1E7PB 3AE9B 4XE0A 3BYTB 4YT0B 2K3UA 3U4EG 1L0VB 3AE1B 4RFBA 4WURA 3ZYYX 3TEZA 4ZHPA 1DOXA 1NVID 2W3RA 2LMCA 5H92C 3FAHA 3LXFA 2ONQA 4OZBA 2IJ0A 1ZXIA 3UI3A 2E6XA 2NTSA 4OHJA 4L2YA 5H8YE 3ZJTA 1TY2A 2PKOA 3AH7A 2BS4B 1C76A 2WXJA 1KTKA 3PZ7A 5BYSA 2LHEA 4JX1C 2KAJA 4L23A 1FCLA 3IXSA 4OZAA 3U2SC 1F2RI 3P63A 3CF4A 1EM7A 2L83A 1SJED 5FK9C 4AS1A 1K50A 1NYRA 1FO4A 5FKAC 4ARIA 1UWMA 4KKJA 3OWEB 1V8CA 2WXOA 2DBYA 4OW0A 2K0PA 2RMMA 1FD6A 2AQ1B 1FFVA 1WYGA 3B9JA 4HRSA 1I4QA 3VQIA 4LK0M 3VR8B 1QOAA 2BBCA 1SBBB 3MP9A 1D5XC 4XDDA 2PIAA 3ZJUA 1J7AA 5BMHA 4R3DA 2EKIA 3BVZA 1Q10A 1ZUD2 1FMAD 3AEFB 1TS5A 2WXPA 3IT4B 1XCQL 2OHFA 4TSSA 3LYYA 3AB5A 2VZKD 2K5PA 4RCOA 4DQOC 2KDMA 1MHHE 1XLOA 2YEPB 4YTMB 3AE7B 3B2FA 4NZLB 1I4XA 1RWSA 4RF1A 2TSSA 4WH4A 2W55A 4N6EB 1QF6A 4DXFA 3GS2A 1JW9D 3NVVA 3AE8B 1L4DB 1V1PA 3URYA 4TQ1A 4B0EA 2IPKD 2WNMA 1HXYD 2DLBA 3NZ3A 1QOBA 4C7YA 1PGXA 3N9YC 2WXLA 1ET6A 1HZ6A 1JQ4A 5E6JA 2OEDA 2IGDA 2JZPA 2INPE 3U52E 3W1SA 2CU3A 2WXFA 4C7ZA 3BVGA 3BVMA 2WU2B 3EGRA 4HKZE 2PLPA 3VR9B 5G5HA 2QIEB 1DYQA 1YN5A 2QJLA 1SIJA 4KX6B 1IGCA 4KGTA 1ROEA 2QSDA 1NENB 1ZPSA 4CQNA 1TKYA 3P1MA 2GRIA 1F0ZA 4JE3B 1L0YB 1QT9A 2BYTA 1VDVA 2W3SA 4YTNB 1YQ4B 2L32A 1JROA 2BS2B 1VLBA 1GPXA 1SE2A 3SEBA 1NEKB 4B0MA 2JU6X 2G1EA 1N63A 1Y56A 4XWTA 2J42A 4J3OD 2JWUA 3FILB 2RDHA 1WRIA 2W54A 3W5UB 4RGTA 2WXIA 3DWMA 4MACA 3AEAB 2M0AA 1HEZE 5LNK1 1D5MC 3IT6B 1RYJA 3ZGZA 1PGAA 1YN3A 1GTHA 1F77A 1TYGB 2V4IB 3AECB 3ZQ4A 4RGMA 4ZHOA 1JWBD 4HKQA 4RGNA 1KH0A 2L1AA 2I2YA 1R7SA 3AEEB 1T3QA 3SR6A 2J4XA 3RPFC 3AEGB 1PUTA 1K51A 2WXNA 2DYOA 2WDQB 2ZW0A 1GB1A 3LB8C 2PMVA 2V3PA 2FE8A 1H7XA 1J7CA 3AM9A 4JWSC 1QILA 1VZ7A 3FILA 4NJCA 4LLGM 3FC4A 2DYMA 2JXTA 4IDIA 4C56C 3J9CA 4HJGE 3MHZA 3EA6A 2Y3AA 1FRRA 2H88B 4MH8A 1P7FA 1I4PA 5D7GA 2WXRA 5EE1A 3T3OA 2BS3B 4A9AA 2L52A 1CJEA 2JSVX 2K9XA 1AYFA 1XLPA 1ACCA 2LFIA 1AW7A 1C4AA 2N9KA 1H7WA 1E10A 1JWSD 1KFYB 4HROA 3KWVA 5FR3A 1GT8A 4KGSA 1ZOYB 1CZPA 3AEDB 2G9HD 5BMGA 4D2KA 3E9SA 4US9A 3NUHB 3BWUD 3AN1A 1HZ5A 1VRAB 2B76B 1C79A 3NVZA 4YSZB 1WGKA 1TS2A 2KQ4X 5MPOA 5HI1A 1DGJA 4O1NA 2WLBA 4WQMA 4L1BA 3AE4B 1STEA 4ZRQA 1L6UA 3T3NA 1L0XB 1ZDXA 5BMIA 1I7HA 2HTME 3HVZA 5EE3A 1WSPA 3KLSX 4KKIA 1TS3A 1HA5A 2CJNA 4YXDB 1ZP0B 1EU3A 2ICIA 1XO3A 2MEKA 3W9CB 4KGRA 2VZKB 3HRDD 2AQ2B 3IAM1 3NS1A 2BB5A 2LUMA 2GB1A 1VR9A 1FFUA 1KLUD 1I4GA 1YQ3B 1MPEA 1SEBD 3RFZB 2LHDA 2JQRB 1FNUA 1YNTE 2QMTA 2E3TA 1JWMD 2H89B 2INNE 1L4ZB 5AUKA 1SE4A 4TQ0A 1PFDA 3HUIA 1E0ZA 1PGBA 1DOIA 5HFYA 2NMQA 1F2RC 1J7BA 3I9V1 2SEBD 3BIID 4PT5A 5G5GA 2WQYB 2MH7A 3Q8FA 4A8XC 1FIQA 4MM3B 1E6EB 1FXIA 4A90A 2J52A 1UUPA 4A6QA 2N7JA 2WS3B 3R2TA 1GOZA 1E9MA 1ZE3D 3AE3B 1XLQA 2PVGC 1GTEA 4IKGA 4YSYB 3TEXA 3GB1A 4XDCA 4ZRPA 2J53A 1ENFA 1V1OA 5EE0A 3ZJVA 1D4BA 1B1ZA 1QKZA 2WP9B 3WCQA 1AWDA 1WWTA 1DOYA 5EE9A 1JCKB 1XXGA 1B9RA 2FBWB 2QEJC 4YWGG 1C4PA 1FNVA 3AE5B 3SFEB 1BMLC 2MJDA 3KQ4A 4USAA 1XEEA 4P16A 2PTLA 1L5PA 2SAKA 4Q2JA 5D3IB 4US8A 1FM0D 2WXMA 3AMZA 4N59A 3BK2A 1HQRD 3Q8CA 1T5XD 1YJJA 1FRDA 5AUIA 3P42A 4ZOHC 3L4PA 1C77A 1ZXHA 2M19A 2XNAC 1UNSA 1A70A 2ACZB 1QQRA 1ZDVA 1BXTA 2NTTA 3TEYA 2QILA 2K22A 5D3DA 2MJ3A 3MFGA 3V05A 2V3NA 3EUB2 1L6VA 1SE3A 1P7EA 1SXTA 2IGGA 2FUG1 1JRPA 1SJHD 1XF5L 2RDGA 3DWGC 1TY0A 3NVWA 5BYQA 4XWWA 4TMAB 3PO0A 2AQ3B 3VRAB 5JXVA 3O13A 1NI3A 3R8BA 2WXQA 3E56A 2CJOA 1TJEA 2M56B 3MC0B 1IBXB 1VZ8A 3SFDB 1TZOA 2AX5A 2KMMA 3AV8A 3I57A 1CQVA 4IOIE 2V0GA 2BT6A 4YTPB 1D6EC 1JWUD 1RFKA 4DXGA 4C80A 4GDLB 4GLSC 1FCCC 2Z8LA 2IGHA 2Y5CA 4LTUA 2PW9A 1N5WA 1QLBB 1N62A 3NVYA 4WWMA 4OZCA 1FXAA 5HG2A 1CK1A 3CIRB 1VZ6A 4UDUC 3AEBB 1KRHA 1TS4A 3W5VB 3AE2B 4FXCA 1JMLA 2GI9A 4RNAA 2N9LA 1T6BX 3KWLA 4M0WA 1KLGD 1AN8A 1M4VA 1IBXA 2Y5PA 1V1PB 2HDEA 4MT5A 3R2IA 3W2DA 1WXQA 4RGOS 1EU4A 3Q69A 4WIPA 1K52A 1KF6B 1SF0A 1LO5D 2Q5WD 1TKGA 3Q8AA 4P6VF 3P4SB 2JX5A 5TSSA 1FEHA 2IDYA 3TEWA 4A55A 1ET9A 3IAS1 2KACA 4YSXB 5I4DA 3P4RB 1MVKA 2LEKA 2WXGA 5GXGB 1OFFA 4EE2A 4HEA1 3ETRA 2LJIA 3BYYB 1RM6C 3Q8EA 3NRZA 2MJEA 4NAMA 4JPSA 1N5XA 3AE6B 1TKEA 4ZYSA 1NYQA 2KWDA 2LGIA 5C2TB 2W82A 3BK1A 1SB3C 3TSSA 2N0SB 5T8IA 5C3JB 1ESFA 3P4QB 1GAQB 2X38A 1SSNA 3U7ZA 1OQQA 1XLNA 4JWUC 2R61A 2I38A 4AQ7A 1MI0A 1IUEA 2D5GA 3TUOA 1UGJA 1IGDA 1C4CA 2EELA 2WDVB 1YMHE 2XN9C 1VJKA 4NAWB 3GP7A 3V3XA 1D5ZC 3BZDB 3HVDA 1XCTL 1FNWA 2JYTA 1JALA 1JWAD 3CWIA 2WXKA 4REZA 2RPVA 1N60A 3P4PB 2WDRB 2ZW1A 3Q8BA 4H2AA 1QOGA 5BYRA 4ARCA 3VRBB 1MHXA 2WU5B 2KN4A 1I4RA 4RH6A 1EWYC 3H8HA 4GDKB 1BUIC 1YJIA 2BTEA 1V97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N58 A;  2CU3 A;  3VRA B;  1I7H A;  2DWQ A;  2HTM E;  4C7Z A;  3HVZ A;  2PVO D;  5EE3 A;  2WU2 B;  3ABV B;  1NI3 A;  4ITK A;  2CJO A;  1TJE A;  2CJN A;  2M56 B;  4YXD B;  1ZP0 B;  3SFD B;  3VR9 B;  2AX5 A;  2KMM A;  3AV8 A;  1XO3 A;  2QIE B;  5G5H A;  3W9C B;  4YTP B;  2BT6 A;  4C80 A;  1N61 A;  1OQR A;  1RFK A;  3B2G A;  3HRD D;  1QOF A;  2QJL A;  1SIJ A;  2Y5C A;  4KX6 B;  4LTU A;  1ROE A;  1PDX A;  1N5W A;  3NS1 A;  1NEN B;  1TKY A;  1QLB B;  3P1M A;  1F0Z A;  1YJI A;  1E7P B;  1N62 A;  3AE9 B;  1QT9 A;  1VDV A;  3NVY A;  2W3S A;  1FFU A;  4YT0 B;  4YTN B;  4WWM A;  1YQ3 B;  1YQ4 B;  1FXA A;  1JRO A;  2BS2 B;  2JQR B;  3CIR B;  1L0V B;  1VLB A;  3AE1 B;  1DOY A;  1GPX A;  3AEB B;  1KRH A;  2E3T A;  2H89 B;  3ZYY X;  3W5V B;  4ZHP A;  3AE2 B;  4FXC A;  1DOX A;  1NVI D;  5AUK A;  2W3R A;  1NEK B;  1PFD A;  3HUI A;  2G1E A;  1E0Z A;  5H92 C;  3FAH A;  1DOI A;  1N63 A;  3LXF A;  3KWL A;  1ZXI A;  5H8Y E;  1J7B A;  1WRI A;  2W54 A;  3BII D;  3W5U B;  5G5G A;  3DWM A;  2WQY B;  2PKO A;  3AH7 A;  2BS4 B;  3AEA B;  2MH7 A;  1FIQ A;  1E6E B;  1WXQ A;  1FXI A;  4JX1 C;  2KAJ A;  1KF6 B;  2WS3 B;  1SF0 A;  1RYJ A;  2Q5W D;  1TKG A;  1E9M A;  4P6V F;  3P4S B;  1GTH A;  2JX5 A;  3AE3 B;  3CF4 A;  2L83 A;  1TYG B;  3P63 A;  3AEC B;  1XLQ A;  2PVG C;  1GTE A;  1JWB D;  4ZHO A;  4YSY B;  1NYR A;  1R7S A;  3AEE B;  1FO4 A;  5EE0 A;  1T3Q A;  1UWM A;  3SR6 A;  4YSX B;  3RPF C;  1V8C A;  3AEG B;  3P4R B;  1PUT A;  2DBY A;  2LEK A;  2WDQ B;  1WYG A;  1FFV A;  1OFF A;  3B9J A;  5GXG B;  2WP9 B;  3ETR A;  3LB8 C;  4HRS A;  1RM6 C;  3WCQ A;  3VR8 B;  1QOA A;  1AWD A;  1WWT A;  1H7X A;  1J7C A;  2MJE A;  3AM9 A;  3NRZ A;  1N5X A;  3AE6 B;  1J7A A;  1TKE A;  2FBW B;  2PIA A;  4JWS C;  1B9R A;  1NYQ A;  5EE9 A;  3AE5 B;  5C2T B;  3SFE B;  2MJD A;  2EKI A;  3FC4 A;  1SB3 C;  4USA A;  2N0S B;  4IDI A;  5C3J B;  1ZUD 2;  1FMA D;  3AEF B;  3P4Q B;  2OHF A;  1FRR A;  2H88 B;  1GAQ B;  1L5P A;  3AB5 A;  4US8 A;  2K5P A;  1FM0 D;  3AMZ A;  1OQQ A;  1XLN A;  4JWU C;  5EE1 A;  2BS3 B;  4N59 A;  4A9A A;  2L52 A;  1CJE A;  1IUE A;  1XLO A;  1FRD A;  1YJJ A;  4YTM B;  1AYF A;  1XLP A;  2K9X A;  3AE7 B;  2WDV B;  4ZOH C;  3L4P A;  5AUI A;  1VJK A;  1H7W A;  2M19 A;  3B2F A;  1E10 A;  1KFY B;  1RWS A;  1A70 A;  1JAL A;  1JWA D;  2ACZ B;  4HRO A;  3CWI A;  1GT8 A;  2W55 A;  4N6E B;  1QF6 A;  1ZOY B;  1CZP A;  1N60 A;  3P4P B;  2WDR B;  3AED B;  2K22 A;  1JW9 D;  1QOG A;  3NVV A;  3AE8 B;  3VRB B;  2MJ3 A;  4US9 A;  2WU5 B;  3AN1 A;  3EUB 2;  2B76 B;  1L6V A;  1QOB A;  4C7Y A;  3NVZ A;  4YSZ B;  1WGK A;  1JRP A;  1EWY C;  3DWG C;  3NVW A;  5MPO A;  1DGJ A;  1JQ4 A;  2WLB A;  4WQM A;  3AE4 B;  3PO0 A;  1L6U A;  1V97 A; 
#chains in the Genus database with same CATH topology
 2KC2 A;  2DWQ A;  3MJ5 A;  2CHZ A;  1K53 A;  4DDG D;  1QOF A;  2BW2 A;  4HPM B;  2JZ3 B;  3A9J A;  2C5L C;  4XC2 A;  3Q14 C;  3PZ8 A;  1E7P B;  3U7D A;  3AE9 B;  4ZRI A;  1T0S C;  1ISN A;  2MA9 B;  3PGE A;  2K3U A;  1R4N I;  4WUR A;  3DVG X;  4CYE A;  2IJ0 A;  2D10 A;  3KUD B;  3UI3 A;  2QDF A;  2E6X A;  5H8Y E;  1YD8 U;  3A4S C;  4S17 A;  1GUA B;  1TY2 A;  2DYB A;  2KFK B;  4ZRJ A;  1KTK A;  2XBB C;  4WJN A;  2NPT A;  4JX1 C;  3DBS A;  4L23 A;  1FCL A;  3IXS A;  3ZUN A;  2MW5 A;  2RPQ A;  1T0Q C;  3CF4 A;  2GLS A;  4W9E A;  3U8Z A;  1NYR A;  1YX5 B;  1UWM A;  4II3 B;  2DBY A;  2LAS A;  2K0P A;  4MGZ E;  1WGD A;  2PIA A;  3ZJU A;  3BVZ A;  2WXP A;  3IT4 B;  3AUL A;  2IO1 B;  2OHF A;  4TSS A;  2VZK D;  1UBI A;  4QAY A;  2KDM A;  1OGW A;  2Z0E B;  1YIW A;  1WR1 A;  2FID A;  3B2F A;  3WAO A;  2XEW A;  2FCS A;  4MGY E;  2W55 A;  1QF6 A;  2KQ7 A;  2CS4 A;  3N1Z C;  3OJ4 B;  3URY A;  2IPK D;  2C9W B;  2WWZ A;  3PLU A;  3RNG C;  2DLB A;  4AUQ C;  3QQ8 B;  3N9Y C;  1WZ0 A;  2ZPY A;  2JZP A;  2INP E;  3W1S A;  3Q3F A;  2WHI A;  2CU3 A;  4ANV A;  3ZVV A;  3BVG A;  4C7Z A;  3ZRC A;  1JRU A;  3T8M A;  3VH3 B;  2CKH B;  4GOC A;  1YN5 A;  2KOX A;  2FNJ B;  2QJL A;  2EMS A;  3MHS D;  4KX6 B;  3PRP B;  5IO9 A;  2MP2 B;  4CQN A;  2GRI A;  1F0Z A;  1UEL A;  2BYT A;  2W3S A;  3RI7 C;  2JUO A;  4BBN F;  4LCD E;  1F9J A;  1GNU A;  3SEB A;  2G1E A;  2BPS A;  1Y56 A;  2JWU A;  1J8C A;  3DVN V;  1WRI A;  2OJW A;  4RGT A;  2WXI A;  4W9F A;  4MAC A;  5LNK 1;  1D5M C;  2BYE A;  3IFW B;  1YN3 A;  2W9N A;  1RFA A;  3ZNH B;  4RGM A;  5E6P A;  1KH0 A;  3AEE B;  4TUU A;  2D07 B;  3SR6 A;  1ZW7 A;  1SGH A;  3AI5 A;  1GB1 A;  2FAZ A;  3LB8 C;  2PMV A;  2FE8 A;  1H7X A;  3RT3 B;  2Z59 B;  2KJR A;  1VZ7 A;  3SHQ A;  5AZH A;  3FC4 A;  3CST A;  2L05 A;  2L0F A;  2MLB A;  4HJG E;  3MHZ A;  4KDL B;  1M94 A;  3NOB A;  4MEL A;  1I4P A;  2M1M A;  2A5U A;  2BS3 B;  1V5O A;  2DAF A;  2K9X A;  1XLP A;  1ACC A;  1C4A A;  2KMC A;  2M17 A;  1KFY B;  4HRO A;  3KWV A;  1GT8 A;  2J7Q B;  1ZOY B;  3AED B;  2G9H D;  3E9S A;  5JZE B;  4US9 A;  3NUH B;  2KFK A;  4FN2 A;  3BWU D;  1C79 A;  2L3Z A;  2L76 A;  2WLB A;  2LRU A;  2MWS B;  1STE A;  5IAA C;  2N9X A;  3WAP A;  5BMI A;  3DDC B;  5LLI A;  2HTM E;  5EE3 A;  4M01 A;  4XX5 A;  2MRP A;  2ICI A;  2HJ8 A;  2LXA A;  3W9C B;  2VZK B;  3UIN B;  2NVU I;  3TJP A;  4A3O A;  3IAM 1;  1VR9 A;  5DCN A;  3NZU A;  3PRZ A;  1MPE A;  1YQ3 B;  2JVC A;  3DBH I;  4BFR A;  1IPG A;  2QMT A;  2DHZ A;  2H89 B;  2KTR B;  1L4Z B;  5AUK A;  1DOI A;  1WGR A;  1F2R C;  1PQS A;  3X23 A;  3I9V 1;  2SEB D;  4DBG A;  2AWT A;  4CO7 A;  2HTH A;  4A8X C;  3Q8F A;  1E6E B;  4RMA A;  4TKN A;  4A6Q A;  3DVN U;  3WAM A;  1ZE3 D;  3H7S A;  4MJS B;  3AE3 B;  3P2B A;  3TEX A;  3ZXR A;  4ZRP A;  1ENF A;  2FUH B;  3ZJV A;  4KIK B;  2WP9 B;  4ACF A;  3WCQ A;  2XK5 B;  1WWT A;  2ZPN A;  1I42 A;  1FNV A;  3V61 A;  4USA A;  2PTL A;  5D3I B;  1FM0 D;  5L95 C;  4N59 A;  1HQR D;  1TIF A;  1KM7 A;  1C77 A;  3L13 A;  2V1Y A;  2D3G A;  2CR5 A;  1A70 A;  3N30 A;  5HKH A;  2ACZ B;  3L10 B;  3KYD D;  1WZ3 A;  5D3D A;  2JY6 A;  3RZW C;  3MFG A;  2J0K A;  2BYF A;  1WXS A;  4AJW A;  1XF5 L;  2IYD B;  1OEY A;  3NVW A;  2VH2 A;  3WA0 A;  2PEA A;  3NG0 A;  2LRW A;  4JQW C;  2KQS A;  4F8C B;  1ZKH A;  3R8B A;  1IBX B;  3JYU A;  3SFD B;  2KMM A;  3I57 A;  4WWO A;  2BT6 A;  4C80 A;  4GDL B;  4GLS C;  2Z8L A;  4LTU A;  3UQB A;  3QHT A;  4K3C A;  1BT0 A;  5HG2 A;  4UDU C;  3VTW A;  2BKF A;  3L17 A;  3AE2 B;  4FXC A;  1JML A;  2GI9 A;  3KYC D;  4RNA A;  1T6B X;  5KHO A;  2MBE A;  2LVP A;  3L0W B;  2HDE A;  4MT5 A;  1WR6 E;  2JX5 A;  4EOY A;  2IDY A;  4A55 A;  1EF1 A;  1ET9 A;  3IAS 1;  3APC A;  1A5R A;  1WE6 A;  2L8J A;  4LNK A;  5GXG B;  1OFF A;  4ANW A;  4HEA 1;  3ETR A;  3BYY B;  4NAM A;  4JPS A;  3PHX B;  2KWD A;  4E3C A;  1UD7 A;  2N0S B;  3RNB C;  1SSN A;  5CX3 A;  3U7Z A;  1I35 A;  2R61 A;  2I38 A;  1XD3 B;  1MI0 A;  2D5G A;  3TUO A;  3VDZ A;  5LXH A;  2KJ6 A;  4JLC A;  3HVD A;  1XCT L;  2KTR A;  2JYT A;  3CWI A;  1WI0 A;  1N60 A;  3Q8B A;  1QOG A;  1H4R A;  3GE3 C;  2KN4 A;  2RDB C;  1BUI C;  1V97 A;  2KNB A;  1UZX B;  3ABV B;  4ITK A;  4X57 B;  1C9F A;  4OVZ A;  1D3Z A;  4HCN B;  1EO6 A;  1VD2 A;  4KIK A;  3B2G A;  2ON8 A;  1I4H A;  1C78 A;  2NPT B;  1GB4 A;  1PDX A;  4I6P A;  5HHD G;  2B3A A;  3I63 C;  3ZNZ B;  1UWX A;  4XE0 A;  3BYT B;  4WWN A;  4YT0 B;  1J19 A;  1L0V B;  1OEY J;  1KJT A;  4XYC A;  2LMC A;  3FAH A;  2ONQ A;  1ZXI A;  1UF0 A;  2NTS A;  4OHJ A;  4BKS A;  3AH7 A;  2PKO A;  2BS4 B;  1V2Y A;  3PZ7 A;  2LHE A;  2I1K A;  4FJY A;  4DHZ E;  3U2S C;  3QA8 A;  2MQJ A;  3PT2 B;  4HCP B;  4W9K A;  5DPR A;  4KKJ A;  2WXO A;  4KV2 A;  2RMM A;  1E5W A;  2AQ1 B;  1WYG A;  3B9J A;  4HRS A;  4EZJ A;  1I4Q A;  4XDD A;  1EUV B;  3PRM B;  2DNF A;  5BMH A;  5E6O A;  2EKI A;  1Q10 A;  2GBR A;  1WM3 A;  5AZG A;  3LYY A;  1Q5W B;  3UGB B;  4DQO C;  1MHH E;  3TIX A;  2NBU A;  4WJQ A;  3ZNI D;  1L7Y A;  3DBR B;  4N6E B;  4IUM B;  1WIA A;  3GS2 A;  3NVV A;  2PPH A;  3APD A;  4FA6 A;  4DHZ B;  2LXC A;  4C7Y A;  1YOV B;  1CMX B;  1HZ6 A;  4G50 A;  5E6J A;  2IGD A;  3MTN B;  2WXF A;  3IVF A;  3EGR A;  3ZRF A;  4HKZ E;  3DVG Y;  4N9F 4;  1DYQ A;  5L83 A;  3RNF C;  2MBQ A;  3LDZ E;  3A9K B;  1ZPS A;  1QT9 A;  1YQ4 B;  2L32 A;  1YQB A;  4LDT D;  3QIJ A;  3QJZ A;  1SE2 A;  3JVZ X;  1N63 A;  3PS6 A;  4J3O D;  1GG3 A;  1V86 A;  2ZCC A;  1HEZ E;  1YJ1 A;  2D11 A;  5E6N A;  3RD2 A;  2KJH B;  4LNN A;  4PS7 A;  1WH3 A;  3Q3J A;  4RGN A;  3EC8 A;  1R7S A;  4G11 A;  3AEG B;  1K51 A;  2WXN A;  2ZW0 A;  2YLM A;  2KFJ A;  4AJY B;  3CMM B;  2K25 A;  3RZF A;  3FIL A;  2DYM A;  2JXT A;  1XT9 B;  3J9C A;  1WJ6 A;  1FRR A;  5DPS A;  4S0R A;  2DZM A;  3RN9 C;  5EE1 A;  2IY1 B;  3MJW A;  3QWZ B;  3N32 A;  1AYF A;  2HE7 A;  2LVO A;  4M8M A;  5FR3 A;  3ZKJ C;  4KGS A;  2M4N A;  2NCN A;  2A4Z A;  2PE6 B;  2IO3 B;  2B76 B;  3ZTD A;  2BQQ A;  2KX0 A;  3ZTC A;  5HI1 A;  4EZL A;  1LFD A;  1TTN A;  4FAD A;  4ZRQ A;  3UIP B;  1ZDX A;  2RGF A;  1I7H A;  2UU7 A;  4A3P A;  3HVZ A;  4KKI A;  1TS3 A;  4EZK A;  2M8S A;  3WAN A;  1WXM A;  2LGS A;  1Z2M A;  2BB5 A;  3ZW3 A;  2IY0 B;  1FFU A;  1HE8 A;  3NZS A;  4W9J A;  4WAA A;  1I4G A;  4DHJ B;  3RFZ B;  1SEB D;  1JWM D;  2INN E;  4TQ0 A;  2EMT A;  1PFD A;  1E0Z A;  4HWI B;  4IWP A;  2D3A A;  1J7B A;  3BII D;  3DOW A;  4GIV A;  2WQY B;  1WGY A;  4A90 A;  1FPY A;  2N7J A;  4IWO A;  1E9M A;  3R3M A;  1XLQ A;  2PVG C;  3DBL B;  1NBF C;  3RCZ A;  2J53 A;  5EE0 A;  2LJ5 A;  4K3B A;  2BYV E;  3M95 A;  1B1Z A;  1U4A A;  2HD5 B;  5CTR C;  4HDO A;  2WYQ A;  1AWD A;  5EE9 A;  3H9D A;  3BY4 B;  3AE5 B;  3KUC B;  1BML C;  1UH6 A;  2D3B A;  3A33 B;  3KQ4 A;  1RRB A;  3OLM D;  4LDT B;  4LNI A;  4MM3 A;  4P16 A;  4BKS D;  4Q2J A;  3A9K A;  4US8 A;  3ECI A;  4MH0 E;  3BK2 A;  3TMP B;  4DDI D;  1T5X D;  2GOW A;  5AUI A;  2RSU A;  3L4P A;  3PZD A;  1ZXH A;  2M19 A;  2INC C;  3IHP C;  1ZDV A;  1WY8 A;  3Q2A C;  2MJ3 A;  5IOI A;  4F7Z A;  3EUB 2;  1SE3 A;  4MGK E;  2IGG A;  2FUG 1;  2MBB B;  2RDG A;  2DZJ A;  4BAX A;  4TV3 A;  3PO0 A;  5CHF A;  4HPL B;  2KWU B;  3O13 A;  3E56 A;  2M56 B;  1TZO A;  4IOI E;  4LJO B;  4GGQ A;  1WE7 A;  1JWU D;  5G55 A;  1WRD B;  2IGH A;  2LVQ A;  1V9J A;  1QLB B;  4K7W A;  1FXA A;  3NJT A;  1G6J A;  3VHT C;  4ANU A;  1WMH B;  3AEB B;  3W5V B;  1GC6 A;  3K9P B;  5J18 A;  3R66 C;  4M0W A;  4JIO U;  2C7N B;  1KLG D;  3JSV A;  2KDF B;  1R4M I;  1S3S G;  4WJO A;  3DHH C;  1WXQ A;  3Q69 A;  4WIP A;  1K52 A;  1SF0 A;  1LO5 D;  1TKG A;  3P4S B;  4JGH B;  3I3T B;  1MVK A;  2LEK A;  2KX3 A;  2WXG A;  3PVL A;  3KUZ A;  1RM6 C;  3Q8E A;  4F1S A;  2MJE A;  2LGI A;  3BK1 A;  3KH0 A;  1SB3 C;  2JWZ A;  3TSS A;  1GAQ B;  3OG5 A;  4MDK E;  2OJR A;  4AQ7 A;  4KZ0 A;  1IUE A;  3UQA A;  1UGJ A;  1IGD A;  1C4C A;  1YMH E;  4YL8 A;  2LGY A;  4KSL C;  3V3X A;  1D5Z C;  1MG4 A;  3DCG A;  1JWA D;  2WXK A;  3HIZ A;  3P4P B;  2DZK A;  2ZW1 A;  2NBV B;  3B1L X;  5BYR A;  1SIF A;  3VRB B;  4IM0 A;  5IP4 D;  2BVC A;  1MHX A;  2N7E A;  4ANX A;  4EEW A;  3K9O B;  4RH6 A;  4GDK B;  1YJI A;  3PLV A;  3VUX A;  2UWQ A;  3MC9 A;  1OQY A;  4N58 A;  2QHO A;  2PVO D;  5GMV A;  3ZDT A;  4WAF A;  1HTQ A;  4RF0 A;  1EWC A;  4A20 A;  3EFC A;  1OQR A;  2BB6 A;  3C8Y A;  4URK A;  4DK5 A;  3DQV A;  4XGA B;  3B08 A;  2O6V A;  1RAX A;  3U4E G;  1F52 A;  4RFB A;  3ZYY X;  2MHJ A;  4NQK E;  2W3R A;  5H92 C;  4FJV B;  4OZB A;  1WF9 A;  3PTF C;  4W9C A;  2G4D B;  3L08 A;  4EUT A;  4NQL B;  1C76 A;  5BYS A;  2KAJ A;  2KAN A;  4OZA A;  3Q6B A;  5FK9 C;  4AS1 A;  1K50 A;  5FKA C;  4ARI A;  5DPT A;  3OWE B;  1FFV A;  3MC8 A;  4LK0 M;  1QOA A;  2BBC A;  1SBB B;  4IW0 A;  1D5X C;  2YVC A;  2IO0 B;  2ZNV C;  2WX0 A;  2KN5 A;  1J0G A;  1ZUD 2;  4PS8 A;  3AEF B;  1XCQ L;  4DXA B;  1TBE A;  2NR2 A;  3AB5 A;  4EKU A;  4IM2 A;  4RCO A;  3R7R A;  3AE7 B;  1WMH A;  3H1U A;  1I4X A;  1RWS A;  3Q3N C;  4RF1 A;  2TSS A;  4WH4 A;  3ALB A;  4NY0 A;  2D2Q A;  2KDB A;  1E8W A;  2CU1 A;  3AE8 B;  4PK1 A;  1WX8 A;  2DAJ A;  4B0E A;  2WNM A;  3B0A A;  1HXY D;  1QOB A;  1PGX A;  1NDD A;  3GZN I;  1JQ4 A;  2PJH A;  2Z0D B;  3U52 E;  3CF6 E;  3BVM A;  2WU2 B;  3RUI B;  3VR9 B;  2WGS A;  1E7V A;  2LI5 A;  1SIJ A;  2V3S A;  2K8B A;  1WX7 A;  1IGC A;  3M63 B;  4W9I A;  2DEN B;  1TKY A;  3P1M A;  4FHJ A;  3A1Q A;  4JE3 B;  1VDV A;  4GXB A;  3QC8 B;  4BOZ B;  1VLB A;  4PYZ A;  5FR6 A;  1GPX A;  4ICV A;  1E8Y A;  4MEM A;  4B0M A;  2JU6 X;  4FJZ A;  4XWT A;  4GB9 A;  2J42 A;  3ENE A;  3FIL B;  2W54 A;  3W5U B;  4C00 A;  2RD0 A;  3DWM A;  5J2R A;  4LNO A;  5JHB A;  3CSF A;  3ZNG C;  1SE9 A;  2C7M B;  2KKC A;  3ZGZ A;  1PGA A;  3I5J C;  5CHW A;  2QC8 A;  3PRE A;  1S1Q B;  1TYG B;  3RNE C;  2FCN A;  3DBR I;  4HKQ A;  2BWF A;  2L1A A;  2K8C A;  4GDK A;  1T3Q A;  3RPF C;  2JRH A;  2DYO A;  1E90 A;  2GBM A;  2K1F A;  2KDE B;  2V3P A;  3V6E B;  3LJ3 A;  4I6L B;  1WXA A;  2Y3A A;  2DX5 B;  2H88 B;  1P7F A;  3T3O A;  4A9A A;  2L52 A;  4HDQ A;  5IKC M;  2JSV X;  2KLC A;  4FLH A;  4ZYN A;  1AW7 A;  1H7W A;  1E10 A;  1JWS D;  2JF5 A;  1WFY A;  2N9P C;  1LM8 B;  2ZEQ A;  3QK0 A;  3V60 A;  3QCA A;  5BMG A;  1P98 A;  3EFU A;  4D2K A;  4M00 A;  3L16 A;  1HZ5 A;  3RNC C;  2LGD A;  2WX1 A;  2KZR A;  4YSZ B;  1WGK A;  3ZDM C;  1TS2 A;  5G2N A;  4HJK A;  2KQ4 X;  3SD5 A;  4WQM A;  4WWP A;  3AE4 B;  2V4L A;  3T3N A;  1L6U A;  2CJN A;  4YXD B;  1ZP0 B;  4DHJ D;  1XO3 A;  2MEK A;  3JW0 X;  3ZO5 B;  2AQ2 B;  3PSE B;  2PE9 A;  4NPN A;  3NS1 A;  2ZZP B;  2LUM A;  2GB1 A;  2Y5B B;  4EFO A;  1KLU D;  2AL3 A;  1FNU A;  4E71 A;  2E3T A;  2C60 A;  1SE4 A;  1P9D U;  2MBO A;  3ML8 A;  5G5G A;  1MFW A;  2MH7 A;  4J6I A;  4MM3 B;  1Q0W B;  1FXI A;  2J52 A;  1F1H A;  1P3Q U;  1MJD A;  2K6D B;  2K6Q A;  4IKG A;  3GB1 A;  4XDC A;  3WIM A;  3GE8 C;  1V1O A;  2O6V D;  3NHE B;  5IN7 A;  1AAR A;  1QKZ A;  3Q3O C;  2IO2 B;  4M02 A;  1DOY A;  2ASQ A;  2R2O A;  1B9R A;  2QEJ C;  4NJ6 A;  3SFE B;  2MJD A;  4GU2 A;  5TR5 A;  4IM3 A;  2N7D A;  3A4R A;  3PV1 A;  3AMZ A;  1FRD A;  3P42 A;  3VXW A;  3PPA A;  2HJ1 A;  3H7P B;  2XNA C;  4KZC A;  2N1V A;  2K39 A;  2NTT A;  3TEY A;  2QIL A;  3ZIM A;  4PYU A;  2GBJ A;  4FUL A;  2FCQ A;  4AP4 C;  2V3N A;  1L6V A;  2REX A;  1SXT A;  4E74 A;  1SJH D;  1TY0 A;  2BGF A;  3AU4 A;  3DHG C;  4B9K A;  3NY5 A;  5JXV A;  4M0W B;  1NI3 A;  3MC0 B;  2WXQ A;  3JSV B;  2CJO A;  1TJE A;  2KHW B;  1NI2 A;  2AX5 A;  3AV8 A;  2V0G A;  1CQV A;  5EDS A;  1D6E C;  3L54 A;  4DXG A;  1RFK A;  3O65 B;  3DBL I;  2G4S A;  2C7H A;  2AEH A;  1FCC C;  4II2 B;  1N5W A;  4KVG B;  3NVY A;  2O2V B;  1Z5S B;  4WQO B;  4OZC A;  2WDT B;  2ZJD A;  3VUW A;  4W9H A;  3T9L A;  1TS4 A;  3M62 B;  5D94 A;  1C3T A;  5KHQ A;  1V80 A;  5BO4 B;  2N9L A;  1FXT B;  1AN8 A;  1V1P B;  4RM8 A;  3W2D A;  1EU4 A;  2AL6 A;  1KF6 B;  4BZA A;  3KVF B;  2Q5W D;  3Q8A A;  4P6V F;  5TSS A;  3TEW A;  1E8X A;  3HM6 X;  4K81 A;  2KWC A;  3EHV A;  5I4D A;  3P4R B;  3QAR A;  2LJI A;  1R4N B;  3V6C B;  1UGM A;  4ZYS A;  1GC7 A;  2W82 A;  5C1Z A;  4M8N A;  1HTO A;  2XN9 C;  4NAW B;  3GP7 A;  3UIO B;  4BKG A;  1FNW A;  1EF5 A;  1WM2 A;  3Q3M C;  4REZ A;  4BKT A;  4HVB A;  2RPV A;  3HK0 A;  2WDR B;  2KD0 A;  2KDI A;  4H2A A;  2VRR B;  4GMV A;  2WU5 B;  1K8R B;  2O6V B;  1I4R A;  2KXJ A;  3H8H A;  3APF A;  3SU8 X;  2YEP F;  1V5T A;  3FKY A;  4C4V A;  1TT5 B;  1YN4 A;  2WXH A;  3GOE A;  1N61 A;  1PYW D;  2JYE A;  2CHX A;  2VH1 A;  4NNJ B;  3AU5 A;  2GBN A;  2G45 B;  2NBW B;  3AE1 B;  3D32 A;  3TEZ A;  3QAQ A;  4ZHP A;  1DOX A;  1NVI D;  4JL9 A;  2N4F A;  2LGX A;  2KVR A;  5IA7 A;  2L7R A;  3LXF A;  2AYO B;  2GMI C;  4L2Y A;  3H7P A;  3ZJT A;  3RMK C;  2WXJ A;  1F2R I;  4AWJ A;  3C19 A;  1XQQ A;  3DPD A;  3P63 A;  1EM7 A;  2L83 A;  1SJE D;  4BBN C;  3S2A A;  1FO4 A;  2JT4 B;  3QX1 A;  2JXX A;  2UYZ B;  1V8C A;  4OW0 A;  1FD6 A;  3VQI A;  3VR8 B;  3MP9 A;  1J7A A;  4R3D A;  2J0J A;  2ZCB A;  2K8H A;  3HM3 A;  1FMA D;  4MGI E;  1TS5 A;  3ML9 A;  2D3C A;  2K5P A;  3IG3 A;  4RM9 A;  1TZ1 A;  2O2V A;  3TCA A;  1XLO A;  2YEP B;  4YTM B;  2LWP A;  1WYW B;  4NZL B;  5D2M B;  5C23 A;  3VFK A;  3ZXV A;  4FHK A;  4DXF A;  2KC1 A;  3ONS A;  1JW9 D;  1MG8 A;  1L4D B;  1V1P A;  3A1Q B;  2ZVN A;  4TQ1 A;  3M3J A;  3VH4 B;  3NZ3 A;  4DWF A;  2WXL A;  2KTF A;  1ET6 A;  3N1Y C;  2OED A;  1WGG A;  1OTR B;  1LGR A;  2PLP A;  1GJZ A;  2N9E B;  5G5H A;  2QIE B;  3TBL D;  3V62 A;  1IYF A;  1V6E A;  4KGT A;  1ROE A;  4OVV A;  2QSD A;  1KLV A;  1NEN B;  2IND C;  1Y8R C;  2L0T A;  1L0Y B;  4YTN B;  1JRO A;  2BS2 B;  4P7I A;  2BF8 B;  5CHV C;  1L2N A;  1NEK B;  1RLF A;  1P0R A;  4KDI C;  4NAW A;  2RDH A;  4I6N B;  3AEA B;  2M0A A;  2MP2 A;  2JRI B;  1RYJ A;  3IT6 B;  1V81 A;  1WGH A;  2IZV B;  5DPW A;  1C1Y B;  1GTH A;  1F77 A;  5LXI B;  2V4I B;  3AEC B;  1R4M B;  1T0R C;  3UF8 A;  1JWB D;  3ZQ4 A;  4ZHO A;  2I2Y A;  4MSQ B;  2J4X A;  1PUT A;  2WDQ B;  3DBH B;  1J7C A;  3AM9 A;  4JWS C;  1QIL A;  2FIF A;  2KK8 A;  4NJC A;  4K7U A;  1IP9 A;  4LLG M;  1UBQ A;  4IDI A;  4C56 C;  3U30 A;  3EA6 A;  4XZ4 A;  3VUY A;  4GN1 A;  4MH8 A;  5D7G A;  2WXR A;  4ASW C;  2M0X A;  1CJE A;  2LFI A;  2N9K A;  2RR9 A;  2DZI A;  4BVU C;  1CZP A;  1N6Z A;  2I1J A;  3R7Q A;  4B6W A;  3AN1 A;  1VRA B;  1V49 A;  3NVZ A;  4WJP A;  5MPO A;  1DGJ A;  4O1N A;  4L1B A;  1P1A A;  1L0X B;  1WSP A;  3KLS X;  1HA5 A;  3OJ3 A;  1EU3 A;  2LD9 A;  4KGR A;  3RYT A;  2ZNV B;  3HRD D;  5JHA A;  2V9H A;  3C0R B;  4ZRK A;  2KLG A;  2N1W A;  2QCZ A;  4CHK A;  2LHD A;  2JQR B;  1LQB A;  1YNT E;  4IC7 B;  1T0Y A;  3HUI A;  1QZE A;  1PGB A;  5HFY A;  2NMQ A;  3AXC A;  4HLE A;  4PT5 A;  4W9D A;  3OAW A;  2J0M A;  1E8Z A;  1FIQ A;  1UUP A;  2WS3 B;  3R2T A;  4G3X B;  1GOZ A;  3VAW A;  3SDL C;  4LJP B;  2KO3 A;  1GTE A;  4YSY B;  4K1R B;  1D4B A;  4HPP A;  4ICU A;  3N3K B;  1JCK B;  1XXG A;  2FBW B;  3A9J B;  4YWG G;  1C4P A;  3RNA C;  1WXV A;  1XEE A;  1L5P A;  2SAK A;  2MBH A;  2WXM A;  4IG7 B;  4MJS A;  2CHW A;  3Q8C A;  1YJJ A;  4ZOH C;  2MX2 A;  3NS8 A;  1UNS A;  1QQR A;  3PHW B;  1BXT A;  2XK5 A;  4ZDV A;  2K22 A;  3H6N A;  4IWQ A;  4G0N B;  3V05 A;  1P7E A;  5BYQ A;  1JRP A;  3DWG C;  2G3Q B;  4XWW A;  4TMA B;  2KMA A;  3HHM A;  2AQ3 B;  3VRA B;  4HK2 A;  1TGZ B;  2IBI B;  2BWE S;  3GZN B;  1VZ8 A;  5JH5 C;  2MCN B;  4YTP B;  3KW5 B;  1WJU A;  2Y5C A;  2PW9 A;  1E7U A;  4K7S A;  1N62 A;  1VCB A;  4P1B C;  4FBJ B;  4W9L A;  4W9G A;  4WWM A;  1WJN A;  4GSW A;  3VTU A;  1CK1 A;  3CIR B;  1VZ6 A;  1KRH A;  2FCM A;  1YX6 B;  3W1S C;  4P1C C;  2X8X X;  4MSM B;  3RUL A;  2KT7 A;  5AZF A;  1H8C A;  3KWL A;  1M4V A;  2JZZ A;  2R2Q A;  1IBX A;  1ZGU B;  2Y5P A;  2LZ6 A;  3R2I A;  4AOF A;  4GDL A;  2JPH A;  4RGO S;  4PS3 A;  5J17 A;  1X1M A;  4HXD A;  4BOS C;  4B95 A;  2EKE C;  1FEH A;  3VTV A;  2KAC A;  4YSX B;  2GBK A;  3X0W A;  3N1X C;  4EE2 A;  5AEK B;  2KYW A;  3NRZ A;  1N5X A;  3AE6 B;  1TKE A;  5D6J B;  2MSE D;  4NJ7 A;  1NYQ A;  5C2T B;  1WX9 A;  1WJ4 A;  3W1Y A;  5T8I A;  3ZLZ A;  5C3J B;  1ESF A;  3P4Q B;  2BKR B;  2X38 A;  3TL5 A;  3VVW B;  1OQQ A;  1XLN A;  4JWU C;  2L00 B;  2NS5 A;  2EEL A;  2WDV B;  1KOT A;  1VJK A;  3BIN A;  3BZD B;  4OVU A;  4C4V B;  1JAL A;  3N20 C;  3IBE A;  2ZVO A;  2LUE A;  2OOB B;  4ARC A;  2KWV B;  3DHI C;  3WAL A;  2KVZ A;  4KSK C;  4LNF A;  1LXD A;  3EEC A;  1EWY C;  1Q1O A;  2BTE A; 
#chains in the Genus database with same CATH homology
 4N58 A;  2DWQ A;  2PVO D;  2YEP F;  3ABV B;  4ITK A;  4WAF A;  1C9F A;  4OVZ A;  4RF0 A;  3MJ5 A;  1EWC A;  1YN4 A;  2WXH A;  1N61 A;  1OQR A;  1K53 A;  1PYW D;  2JYE A;  1QOF A;  2BB6 A;  2ON8 A;  3B2G A;  1I4H A;  2BW2 A;  1C78 A;  3C8Y A;  1GB4 A;  1PDX A;  5HHD G;  3PZ8 A;  1UWX A;  1E7P B;  3AE9 B;  4XE0 A;  3BYT B;  4YT0 B;  2K3U A;  3U4E G;  1L0V B;  3AE1 B;  4RFB A;  4WUR A;  3ZYY X;  3TEZ A;  4ZHP A;  1DOX A;  1NVI D;  2W3R A;  2LMC A;  5H92 C;  3FAH A;  3LXF A;  2ONQ A;  4OZB A;  2IJ0 A;  1ZXI A;  3UI3 A;  2E6X A;  2NTS A;  4OHJ A;  4L2Y A;  5H8Y E;  3ZJT A;  1TY2 A;  2PKO A;  3AH7 A;  2BS4 B;  1C76 A;  2WXJ A;  1KTK A;  3PZ7 A;  5BYS A;  2LHE A;  4JX1 C;  2KAJ A;  4L23 A;  1FCL A;  3IXS A;  4OZA A;  3U2S C;  1F2R I;  3P63 A;  3CF4 A;  1EM7 A;  2L83 A;  1SJE D;  5FK9 C;  4AS1 A;  1K50 A;  1NYR A;  1FO4 A;  5FKA C;  4ARI A;  1UWM A;  4KKJ A;  3OWE B;  1V8C A;  2WXO A;  2DBY A;  4OW0 A;  2K0P A;  2RMM A;  1FD6 A;  2AQ1 B;  1FFV A;  1WYG A;  3B9J A;  4HRS A;  1I4Q A;  3VQI A;  4LK0 M;  3VR8 B;  1QOA A;  2BBC A;  1SBB B;  3MP9 A;  1D5X C;  4XDD A;  2PIA A;  3ZJU A;  1J7A A;  5BMH A;  4R3D A;  2EKI A;  3BVZ A;  1Q10 A;  1ZUD 2;  1FMA D;  3AEF B;  1TS5 A;  2WXP A;  3IT4 B;  1XCQ L;  2OHF A;  4TSS A;  3LYY A;  3AB5 A;  2VZK D;  2K5P A;  4RCO A;  4DQO C;  2KDM A;  1MHH E;  1XLO A;  2YEP B;  4YTM B;  3AE7 B;  3B2F A;  4NZL B;  1I4X A;  1RWS A;  4RF1 A;  2TSS A;  4WH4 A;  2W55 A;  4N6E B;  1QF6 A;  4DXF A;  3GS2 A;  1JW9 D;  3NVV A;  3AE8 B;  1L4D B;  1V1P A;  3URY A;  4TQ1 A;  4B0E A;  2IPK D;  2WNM A;  1HXY D;  2DLB A;  3NZ3 A;  1QOB A;  4C7Y A;  1PGX A;  3N9Y C;  2WXL A;  1ET6 A;  1HZ6 A;  1JQ4 A;  5E6J A;  2OED A;  2IGD A;  2JZP A;  2INP E;  3U52 E;  3W1S A;  2CU3 A;  2WXF A;  4C7Z A;  3BVG A;  3BVM A;  2WU2 B;  3EGR A;  4HKZ E;  2PLP A;  3VR9 B;  5G5H A;  2QIE B;  1DYQ A;  1YN5 A;  2QJL A;  1SIJ A;  4KX6 B;  1IGC A;  4KGT A;  1ROE A;  2QSD A;  1NEN B;  1ZPS A;  4CQN A;  1TKY A;  3P1M A;  2GRI A;  1F0Z A;  4JE3 B;  1L0Y B;  1QT9 A;  2BYT A;  1VDV A;  2W3S A;  4YTN B;  1YQ4 B;  2L32 A;  1JRO A;  2BS2 B;  1VLB A;  1GPX A;  1SE2 A;  3SEB A;  1NEK B;  4B0M A;  2JU6 X;  2G1E A;  1N63 A;  1Y56 A;  4XWT A;  2J42 A;  4J3O D;  2JWU A;  3FIL B;  2RDH A;  1WRI A;  2W54 A;  3W5U B;  4RGT A;  2WXI A;  3DWM A;  4MAC A;  3AEA B;  2M0A A;  1HEZ E;  5LNK 1;  1D5M C;  3IT6 B;  1RYJ A;  3ZGZ A;  1PGA A;  1YN3 A;  1GTH A;  1F77 A;  1TYG B;  2V4I B;  3AEC B;  3ZQ4 A;  4RGM A;  4ZHO A;  1JWB D;  4HKQ A;  4RGN A;  1KH0 A;  2L1A A;  2I2Y A;  1R7S A;  3AEE B;  1T3Q A;  3SR6 A;  2J4X A;  3RPF C;  3AEG B;  1PUT A;  1K51 A;  2WXN A;  2DYO A;  2WDQ B;  2ZW0 A;  1GB1 A;  3LB8 C;  2PMV A;  2V3P A;  2FE8 A;  1H7X A;  1J7C A;  3AM9 A;  4JWS C;  1QIL A;  1VZ7 A;  3FIL A;  4NJC A;  4LLG M;  3FC4 A;  2DYM A;  2JXT A;  4IDI A;  4C56 C;  3J9C A;  4HJG E;  3MHZ A;  3EA6 A;  2Y3A A;  1FRR A;  2H88 B;  4MH8 A;  1P7F A;  1I4P A;  5D7G A;  2WXR A;  5EE1 A;  3T3O A;  2BS3 B;  4A9A A;  2L52 A;  1CJE A;  2JSV X;  2K9X A;  1AYF A;  1XLP A;  1ACC A;  2LFI A;  1AW7 A;  1C4A A;  2N9K A;  1H7W A;  1E10 A;  1JWS D;  1KFY B;  4HRO A;  3KWV A;  5FR3 A;  1GT8 A;  4KGS A;  1ZOY B;  1CZP A;  3AED B;  2G9H D;  5BMG A;  4D2K A;  3E9S A;  4US9 A;  3NUH B;  3BWU D;  3AN1 A;  1HZ5 A;  1VRA B;  2B76 B;  1C79 A;  3NVZ A;  4YSZ B;  1WGK A;  1TS2 A;  2KQ4 X;  5MPO A;  5HI1 A;  1DGJ A;  4O1N A;  2WLB A;  4WQM A;  4L1B A;  3AE4 B;  1STE A;  4ZRQ A;  1L6U A;  3T3N A;  1L0X B;  1ZDX A;  5BMI A;  1I7H A;  2HTM E;  3HVZ A;  5EE3 A;  1WSP A;  3KLS X;  4KKI A;  1TS3 A;  1HA5 A;  2CJN A;  4YXD B;  1ZP0 B;  1EU3 A;  2ICI A;  1XO3 A;  2MEK A;  3W9C B;  4KGR A;  2VZK B;  3HRD D;  2AQ2 B;  3IAM 1;  3NS1 A;  2BB5 A;  2LUM A;  2GB1 A;  1VR9 A;  1FFU A;  1KLU D;  1I4G A;  1YQ3 B;  1MPE A;  1SEB D;  3RFZ B;  2LHD A;  2JQR B;  1FNU A;  1YNT E;  2QMT A;  2E3T A;  1JWM D;  2H89 B;  2INN E;  1L4Z B;  5AUK A;  1SE4 A;  4TQ0 A;  1PFD A;  3HUI A;  1E0Z A;  1PGB A;  1DOI A;  5HFY A;  2NMQ A;  1F2R C;  1J7B A;  3I9V 1;  2SEB D;  3BII D;  4PT5 A;  5G5G A;  2WQY B;  2MH7 A;  3Q8F A;  4A8X C;  1FIQ A;  4MM3 B;  1E6E B;  1FXI A;  4A90 A;  2J52 A;  1UUP A;  4A6Q A;  2N7J A;  2WS3 B;  3R2T A;  1GOZ A;  1E9M A;  1ZE3 D;  3AE3 B;  1XLQ A;  2PVG C;  1GTE A;  4IKG A;  4YSY B;  3TEX A;  3GB1 A;  4XDC A;  4ZRP A;  2J53 A;  1ENF A;  1V1O A;  5EE0 A;  3ZJV A;  1D4B A;  1B1Z A;  1QKZ A;  2WP9 B;  3WCQ A;  1AWD A;  1WWT A;  1DOY A;  5EE9 A;  1JCK B;  1XXG A;  1B9R A;  2FBW B;  2QEJ C;  4YWG G;  1C4P A;  1FNV A;  3AE5 B;  3SFE B;  1BML C;  2MJD A;  3KQ4 A;  4USA A;  1XEE A;  4P16 A;  2PTL A;  1L5P A;  2SAK A;  4Q2J A;  5D3I B;  4US8 A;  1FM0 D;  2WXM A;  3AMZ A;  4N59 A;  3BK2 A;  1HQR D;  3Q8C A;  1T5X D;  1YJJ A;  1FRD A;  5AUI A;  3P42 A;  4ZOH C;  3L4P A;  1C77 A;  1ZXH A;  2M19 A;  2XNA C;  1UNS A;  1A70 A;  2ACZ B;  1QQR A;  1ZDV A;  1BXT A;  2NTT A;  3TEY A;  2QIL A;  2K22 A;  5D3D A;  2MJ3 A;  3MFG A;  3V05 A;  2V3N A;  3EUB 2;  1L6V A;  1SE3 A;  1P7E A;  1SXT A;  2IGG A;  2FUG 1;  1JRP A;  1SJH D;  1XF5 L;  2RDG A;  3DWG C;  1TY0 A;  3NVW A;  5BYQ A;  4XWW A;  4TMA B;  3PO0 A;  2AQ3 B;  3VRA B;  5JXV A;  3O13 A;  1NI3 A;  3R8B A;  2WXQ A;  3E56 A;  2CJO A;  1TJE A;  2M56 B;  3MC0 B;  1IBX B;  1VZ8 A;  3SFD B;  1TZO A;  2AX5 A;  2KMM A;  3AV8 A;  3I57 A;  1CQV A;  4IOI E;  2V0G A;  2BT6 A;  4YTP B;  1D6E C;  1JWU D;  1RFK A;  4DXG A;  4C80 A;  4GDL B;  4GLS C;  1FCC C;  2Z8L A;  2IGH A;  2Y5C A;  4LTU A;  2PW9 A;  1N5W A;  1QLB B;  1N62 A;  3NVY A;  4WWM A;  4OZC A;  1FXA A;  5HG2 A;  1CK1 A;  3CIR B;  1VZ6 A;  4UDU C;  3AEB B;  1KRH A;  1TS4 A;  3W5V B;  3AE2 B;  4FXC A;  1JML A;  2GI9 A;  4RNA A;  2N9L A;  1T6B X;  3KWL A;  4M0W A;  1KLG D;  1AN8 A;  1M4V A;  1IBX A;  2Y5P A;  1V1P B;  2HDE A;  4MT5 A;  3R2I A;  3W2D A;  1WXQ A;  4RGO S;  1EU4 A;  3Q69 A;  4WIP A;  1K52 A;  1KF6 B;  1SF0 A;  1LO5 D;  2Q5W D;  1TKG A;  3Q8A A;  4P6V F;  3P4S B;  2JX5 A;  5TSS A;  1FEH A;  2IDY A;  3TEW A;  4A55 A;  1ET9 A;  3IAS 1;  2KAC A;  4YSX B;  5I4D A;  3P4R B;  1MVK A;  2LEK A;  2WXG A;  5GXG B;  1OFF A;  4EE2 A;  4HEA 1;  3ETR A;  2LJI A;  3BYY B;  1RM6 C;  3Q8E A;  3NRZ A;  2MJE A;  4NAM A;  4JPS A;  1N5X A;  3AE6 B;  1TKE A;  4ZYS A;  1NYQ A;  2KWD A;  2LGI A;  5C2T B;  2W82 A;  3BK1 A;  1SB3 C;  3TSS A;  2N0S B;  5T8I A;  5C3J B;  1ESF A;  3P4Q B;  1GAQ B;  2X38 A;  1SSN A;  3U7Z A;  1OQQ A;  1XLN A;  4JWU C;  2R61 A;  2I38 A;  4AQ7 A;  1MI0 A;  1IUE A;  2D5G A;  3TUO A;  1UGJ A;  1IGD A;  1C4C A;  2EEL A;  2WDV B;  1YMH E;  2XN9 C;  1VJK A;  4NAW B;  3GP7 A;  3V3X A;  1D5Z C;  3BZD B;  3HVD A;  1XCT L;  1FNW A;  2JYT A;  1JAL A;  1JWA D;  3CWI A;  2WXK A;  4REZ A;  2RPV A;  1N60 A;  3P4P B;  2WDR B;  2ZW1 A;  3Q8B A;  4H2A A;  1QOG A;  5BYR A;  4ARC A;  3VRB B;  1MHX A;  2WU5 B;  2KN4 A;  1I4R A;  4RH6 A;  1EWY C;  3H8H A;  4GDK B;  1BUI C;  1YJI A;  2BTE A;  1V97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...