1ZOYB

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1zoyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zoyB01
3AEDB 2OHFA 1DOIA 4YTNB 1QOGA 1OQQA 2KMMA 3DWGC 2WDQB 2H88B 3RPFC 3SFEB 1AWDA 1DGJA 2MJDA 2B76B 3FC4A 1XLPA 2WP9B 1V97A 2W3RA 3AE8B 3P4QB 1ZP0B 4YSZB 1GAQB 1N62A 3B2GA 3NVZA 1QOAA 3KWLA 1QT9A 3AEFB 3LXFA 4C7ZA 4USAA 2PVOD 1FO4A 1OFFA 1YJJA 2K5PA 2QIEB 2ACZB 4WQMA 4N6EB 5AUKA 2DBYA 2BS4B 1FMAD 2CJNA 1GT8A 1FXIA 3BIID 3ABVB 3NVYA 3P4RB 1YQ4B 3AEGB 1PDXA 1ROEA 1ZXIA 1JRPA 1JW9D 1TYGB 1FRRA 2W54A 3P1MA 4HRSA 2MJ3A 1T3QA 1N61A 1NYRA 1E9MA 1QOBA 2WS3B 3AE7B 1J7AA 1SIJA 3B9JA 1AYFA 2CU3A 1KFYB 1J7BA 1YJIA 3AV8A 3AECB 1N60A 3FAHA 4YTPB 2M56B 5EE9A 2WDVB 1NEKB 5EE1A 1N63A 1XLQA 3AM9A 4YTMB 1NVID 3NVWA 1L5PA 5C2TB 1TKYA 3AEEB 3NS1A 5MPOA 2G1EA 1XLOA 2L52A 1VLBA 4YT0B 4US8A 2W55A 2AX5A 4P6VF 4FXCA 1F0ZA 3VR8B 4JX1C 3W5UB 1YQ3B 3AEAB 2BT6A 1NENB 3P4SB 1CZPA 2PVGC 3AMZA 1TKEA 3B2FA 3L4PA 5H92C 4ZHPA 1E0ZA 4YSYB 1ZOYB 4IDIA 4JWSC 4A9AA 1NI3A 2WQYB 2JQRB 3P4PB 2KAJA 1EWYC 1DOYA 3ZYYX 4ZOHC 1FFUA 2WU2B 2L83A 1H7WA 1B9RA 1E6EB 1WWTA 2Y5CA 1JWAD 1RFKA 3DWMA 2MJEA 3CWIA 1TJEA 1DOXA 1TKGA 1CJEA 1GTEA 1OQRA 3AB5A 3P63A 2BS2B 1QOFA 1XLNA 4C80A 4ZHOA 2JX5A 3SFDB 1SF0A 4KX6B 2WDRB 2PKOA 3AN1A 1JROA 1I7HA 2DWQA 4HROA 3AE2B 4US9A 3W5VB 2W3SA 3HRDD 5EE0A 4LTUA 3VRAB 2LEKA 2M19A 1GTHA 5EE3A 1PUTA 1ZUD2 1RM6C 1WYGA 5AUIA 3SR6A 1QLBB 1SB3C 2N0SB 1N5XA 3NVVA 1JQ4A 2WLBA 3AEBB 1JWBD 3NRZA 4JWUC 3AE6B 1VJKA 1KF6B 3AE5B 1XO3A 5G5HA 4N58A 1PFDA 4YXDB 3WCQA 1A70A 1RWSA 3AE9B 3ETRA 2Q5WD 1V8CA 5G5GA 1E10A 1FIQA 1JALA 1UWMA 1FRDA 2PIAA 1H7XA 2HTME 3CF4A 1L6VA 2BS3B 3PO0A 1WXQA 5C3JB 4N59A 2MH7A 2FBWB 2WU5B 1R7SA 1WGKA 1NYQA 2E3TA 3VRBB 3AE4B 1J7CA 1VDVA 3AH7A 4WWMA 1WRIA 2H89B 2QJLA 3EUB2 3LB8C 3CIRB 3VR9B 3AE3B 1L0VB 4C7YA 2K22A 4ITKA 4YSXB 1L6UA 2CJOA 1E7PB 1QF6A 1FM0D 1IUEA 3W9CB 1FXAA 3HVZA 5H8YE 1FFVA 1N5WA 1KRHA 1RYJA 2EKIA 3AE1B 2K9XA 3HUIA 1GPXA 5GXGB
chains in the Genus database with same CATH superfamily
4XWTA 2C7HA 1MJDA 2H88B 4BOZB 3E9SA 1I4RA 3AE8B 1WJ4A 3NVZA 3QX1A 2PEAA 2OJRA 3R7QA 1C76A 4MGKE 1VRAB 3K9PB 3BVGA 2PMVA 4EZKA 1LFDA 1A5RA 4KGTA 1WGRA 1WJ6A 1C78A 1KFYB 4B0EA 4KIKB 4NNJB 3RMKC 1WGHA 2G4SA 4XE0A 1WY8A 5MPOA 1YX5B 2INDC 1CK1A 4FHKA 2BKRB 1GUAB 1JWSD 2LASA 1E0ZA 2IPKD 1TZ1A 3P4PB 2KLCA 2WXFA 1WWTA 1I4XA 3VUYA 3WANA 4MGYE 2JX5A 4HJGE 3UQAA 5KHQA 1NDDA 2D10A 3RULA 2LEKA 3EECA 4EZLA 1WE7A 1VJKA 1IPGA 3DHIC 4TUUA 1AW7A 5J17A 3OWEB 5G5GA 2PIAA 3L0WB 2OOBB 3BYYB 1Z5SB 1T0RC 3NS8A 2JWZA 3Q3JA 4AWJA 3DBSA 1EWCA 1SE3A 2K22A 2XEWA 4DDID 3SU8X 2N1VA 1QF6A 2OEDA 3V61A 1F52A 2O2VA 3KUDB 4TQ1A 1QOGA 4M8NA 5D7GA 4TKNA 2CU1A 1AWDA 3EA6A 1HZ5A 3N1XC 3B2GA 1QT9A 1ZW7A 5LXIB 4BKTA 5HI1A 3RNGC 4N6EB 2LJIA 2DBYA 2J0KA 2NMQA 4EOYA 3U7ZA 4FJVB 4ANUA 3AV8A 1PGBA 3HIZA 4DHJD 1R4MI 1IP9A 1KLGD 3MC0B 2IY1B 1LM8B 3W5UB 3AMZA 3B2FA 4ZHPA 3R8BA 3JVZX 3VHTC 1T0QC 1SE9A 5EDSA 1EUVB 4C56C 3H6NA 2DLBA 2K8HA 3RCZA 2KQSA 4B95A 3W1SC 1D6EC 1WZ3A 2A5UA 2IYDB 2YEPF 4WURA 1N5XA 2KQ4X 2KTRB 1J0GA 3DBLI 2KN4A 3UF8A 3URYA 4EUTA 1L6VA 2KT7A 3EC8A 2DHZA 2E3TA 3VRBB 2QJLA 4C7YA 2MEKA 2CJOA 1E7PB 2NTTA 2MBEA 4F8CB 1FFVA 3R2IA 3OJ3A 1GB4A 3C0RB 1JCKB 1DOIA 2N4FA 3BVZA 1E7VA 3M3JA 4KKIA 1N62A 1F77A 4ICVA 4R3DA 4HLEA 2WGSA 4HKZE 1FMAD 3GE3C 1P7EA 2FE8A 3TUOA 4ANVA 1YJIA 3AECB 2KACA 5JHBA 3U7DA 3RT3B 4GDKA 2AX5A 1GNUA 2KDBA 4PYZA 1NENB 5IP4D 1D3ZA 1AARA 4A9AA 2DX5B 3IXSA 3GS2A 1V49A 2FCNA 2KC2A 2BKFA 2MJEA 4ZHOA 5D3IB 4MM3B 4G3XB 2VH2A 4MH8A 1YJ1A 4P1CC 3SD5A 1JROA 3EFCA 2GBKA 4W9CA 3N1ZC 2L0TA 3Q3OC 4N9F4 4MACA 4XWWA 1IBXA 2M19A 2AQ3B 5CHVC 3TEYA 1C4CA 3W1SA 3DVNV 1UD7A 1TS4A 3WIMA 1WR1A 5BMIA 2LI5A 2C7MB 4GU2A 4KZ0A 3ZJVA 2KD0A 2KZRA 3O65B 1CQVA 1NYQA 2R2QA 1VDVA 1UGJA 3EUB2 3CIRB 1XD3B 2N9LA 4DQOC 2WYQA 5D3DA 4B9KA 3RZWC 2C60A 1V1OA 3FILA 5DPTA 1K8RB 2J42A 5DPSA 2QDFA 3ZDTA 3ZW3A 1KLUD 1UBQA 3VVWB 2PVOD 2KO3A 5JZEB 3JSVA 4GDLA 2JXTA 3DBRI 4ZRJA 2V4LA 3KH0A 2R2OA 4WJQA 3NVWA 1UH6A 1FD6A 4MGZE 1PQSA 4WQOB 1YQ3B 1OEYJ 3KW5B 1L4ZB 2LXAA 2KFJA 2KDEB 1ZOYB 3TCAA 5TSSA 1H7WA 2WXHA 3L16A 2O6VD 1JWAD 4M01A 4BZAA 2SAKA 5AZHA 5AEKB 4E3CA 5JXVA 1BUIC 4ICUA 3ML8A 3NJTA 2BWFA 1JQ4A 2M4NA 1YQBA 3RNFC 4JQWC 3I5JC 4WIPA 3VTVA 3WCQA 1A70A 2KQ7A 5FR6A 1YD8U 2YLMA 4IWOA 3MJWA 3CF6E 2HD5B 3RFZB 1R4NB 1S3SG 2MQJA 2IGGA 2H89B 5IOIA 2B3AA 4HPMB 2JY6A 1T0SC 2CKHB 3W9CB 2BB6A 4HCPB 1KRHA 1GB1A 4A90A 2N7EA 3ZDMC 2FCMA 1HQRD 4F1SA 1E8XA 2WNMA 1OQQA 3PT2B 3BZDB 2M0XA 3SFEB 3R2TA 3PTFC 2W3RA 2MX2A 3V62A 3PZ8A 4NJ6A 4ZYNA 1ET6A 4DXGA 3AEFB 2MBOA 1WYWB 1FO4A 5L95C 1YX6B 3C19A 1YJJA 2QIEB 2WXMA 2ACZB 1ZDXA 2CHXA 3ABVB 1YQ4B 4LJPB 5HHDG 2NBUA 4HEA1 2HTHA 2JRIB 2NS5A 4WH4A 3ZO5B 1EO6A 2INNE 3FAHA 2HJ8A 3N30A 1CMXB 2WWZA 1E90A 2K0PA 3ML9A 1HXYD 4HK2A 3UIPB 3RNCC 3A9KA 4G50A 2JWUA 3BINA 3ZYYX 1M94A 3TEWA 2WXLA 1CJEA 1GTEA 1TT5B 1WI0A 2KXJA 3W2DA 4KGSA 2W82A 1WGGA 4FULA 3KUCB 4JPSA 2PLPA 2EKEC 2LUMA 5E6OA 1SIFA 1LXDA 3RZFA 4IWQA 1FEHA 2JZZA 1MG4A 2JF5A 3ZXVA 1E8YA 1WXQA 2D07B 3QHTA 3VXWA 2AL3A 2ZNVB 3DVGX 5BMHA 1K51A 5AZGA 2K3UA 2GBJA 2LHEA 2GBRA 5GMVA 4FA6A 3EGRA 3PRZA 3HUIA 3AEDB 4YTNB 4RNAA 4HDOA 3NY5A 4XGAB 2J0JA 1DGJA 3APDA 4IUMB 1XEEA 4B6WA 1IGDA 3VDZA 2ON8A 5KHOA 3T8MA 2D2QA 2KTFA 2GOWA 1GT8A 4DHJB 1J19A 3AEGB 4BVUC 2XK5B 3B1LX 2WX1A 4NQLB 3VUXA 2I38A 1ACCA 1J7AA 1Q5WB 4ZYSA 1KM7A 4GMVA 4M0WB 2MP2A 1TIFA 2JPHA 3AEEB 2BYEA 3TJPA 3WAMA 1SJED 4A8XC 3N3KB 1Q0WB 4HXDA 4K7SA 2WXRA 4EE2A 5H92C 4I6NB 4JWSC 1N6ZA 3ENEA 1DOYA 3I63C 1DOXA 1B1ZA 1LGRA 4W9KA 3NG0A 5J2RA 1GC6A 1ISNA 4ZRPA 2NVUI 4HROA 3HRDD 3HM3A 4W9IA 4DXFA 5E6NA 3ZNHB 1WYGA 5D6JB 3SR6A 3R7RA 3QC8B 1JWBD 4W9LA 1H4RA 1NBFC 1WX9A 3VFKA 3QK0A 5G5HA 3J9CA 4J6IA 2CS4A 4RGNA 4M00A 3PO0A 3M95A 2QCZA 4IG7B 2M0AA 1FNWA 4ZRKA 1T5XD 1TS5A 2BYTA 2WU5B 3QQ8B 2MA9B 5BYSA 3Q3NC 3QAQA 5IAAC 3DQVA 2D11A 2K9XA 5G55A 4W9EA 1WH3A 3M62B 2OJWA 4HJKA 4LDTB 2KMMA 1V80A 3GP7A 4MGIE 2FCSA 2MJDA 1C9FA 5J18A 3P4QB 1S1QB 2FUHB 1J8CA 1LO5D 2KNBA 1HEZE 3PRPB 2K5PA 3N32A 3BIID 2BS4B 3NVYA 3P4RB 4BKSD 1TY0A 1ROEA 1ZXIA 3P1MA 1VZ7A 2L00B 2HDEA 4P7IA 3MHZA 4XDDA 4OZCA 5FK9C 2JT4B 1QZEA 3Q14C 1XLQA 1ET9A 4KV2A 2FIFA 1I4GA 3MHSD 3IBEA 1VLBA 3V60A 2ZPNA 1UGMA 3VQIA 1D4BA 2VZKD 3TIXA 2I1JA 2W9NA 4ANXA 2ZW1A 4RM9A 2PVGC 4IDIA 4KSKC 3DHHC 1ZKHA 1VD2A 2L83A 2YVCA 4W9JA 4FHJA 3U8ZA 3DWMA 3OLMD 1M4VA 1OQYA 2DZJA 2KMCA 2LGYA 3BK2A 4NQKE 3SFDB 2K8BA 3CSTA 4E71A 2N1WA 2GBMA 3PLUA 4KSLC 4KX6B 2KJ6A 3AN1A 2Y5PA 3H7SA 3HK0A 5AUIA 2CR5A 1TTNA 1RLFA 2JZPA 4HDQA 1KF6B 1VCBA 2O6VA 3Q8CA 2K6QA 3AE9B 1FCLA 2QSDA 3ETRA 2D3BA 4KVGB 1WIAA 1H7XA 1GG3A 2L0FA 3A9JA 1EU3A 4S0RA 2O2VB 1HTOA 5BYQA 1U4AA 1C4AA 1WX7A 3S2AA 3AXCA 2RPVA 1G6JA 2JU6X 1N5WA 5GXGB 2XBBC 4NJCA 1FCCC 3DCGA 2JVCA 4L1BA 1UWXA 4PS8A 5TR5A 1FNUA 2DZMA 3PVLA 4CHKA 5L83A 4EEWA 2SEBD 2LRUA 1FXIA 1LQBA 2J4XA 4PYUA 3UGBB 1WXVA 2ASQA 2LWPA 1R4NI 2UYZB 1ESFA 1NYRA 2ZZPB 3AE7B 3N9YC 5EE9A 3QARA 2HJ1A 3APFA 1F9JA 1I4QA 2IO2B 4FXCA 5IO9A 3PPAA 2MWSB 2CHWA 1UELA 2PE9A 1CZPA 1MFWA 2QHOA 3Q8FA 4K3BA 4FBJB 2ZJDA 4URKA 4RGTA 3CWIA 3ZVVA 4C80A 4GXBA 1P3QU 3ALBA 2WHIA 3NUHB 2DAFA 2DWQA 3B0AA 1PGAA 3ECIA 1YMHE 3NRZA 3AEBB 4JWUC 4A55A 3AE6B 3VH3B 4N58A 4M8MA 1EU4A 2G9HD 2KDIA 2KK8A 1UWMA 1RRBA 1MI0A 3T3OA 4K7UA 4CO7A 3ZLZA 4BBNF 2LUEA 4FADA 1BXTA 3U52E 4C4VA 2ZCCA 4IW0A 3TL5A 2PW9A 3HVZA 4JIOU 3AE1B 2JYEA 3C8YA 1YOVB 3APCA 3BWUD 2GRIA 2LVPA 5AZFA 2BWES 1GAQB 1YN3A 1V5TA 4K3CA 5I4DA 3LXFA 2WXNA 3O13A 1P98A 1PYWD 4WQMA 2M17A 3QJZA 1OEYA 4NPNA 1JRPA 1STEA 4GDKB 4ANWA 2BW2A 2QC8A 4BFRA 4YTPB 1WXAA 4BAXA 1V1PA 2MCNB 3VUWA 2Z0EB 1WXSA 4D2KA 2W55A 1I4PA 2JZ3B 3MP9A 2INCC 3WA0A 4I6PA 3KWVA 4FN2A 4GLSC 2MSED 1EWYC 2RDBC 4P1BC 2KX0A 4JLCA 1IBXB 4RGOS 1UUPA 3AI5A 1TKGA 2LRWA 5HKHA 4MJSA 3ZRFA 3NHEB 2WDRB 5E6JA 4GGQA 2N9EB 3RNAC 2KJRA 5EE3A 1C3TA 3H8HA 1ZUD2 2K1FA 4A6QA 3N20C 3DOWA 5E6PA 2LFIA 4LNNA 3KQ4A 3HVDA 4GN1A 4K1RB 1QILA 1L0YB 1V5OA 3LDZE 2HTME 3RN9C 2BS3B 1QKZA 2D3AA 3ZKJC 1VZ6A 3IVFA 2X8XX 2KFKA 2MHJA 3FILB 1L7YA 4I6LB 3HHMA 4ZDVA 2KKCA 1XF5L 4WWPA 1GPXA 3LYYA 2IBIB 1XT9B 3MFGA 2DZIA 3JW0X 3DBHB 3P42A 2L3ZA 3FC4A 3DBLB 3JSVB 3Q3FA 3L13A 1XLPA 4GDLB 4NZLB 3TMPB 1TY2A 3PSEB 1KH0A 4LLGM 3KUZA 4ZRIA 4H2AA 2YEPB 4XDCA 3L08A 1KLVA 3EFUA 4OVUA 1VZ8A 1X1MA 2N7JA 1FRRA 2IY0B 2J53A 1KOTA 1IYFA 1QOBA 2N9PC 1SE2A 4E74A 4LNKA 1NEKB 5G2NA 4MSQB 3KLSX 1NVID 5C2TB 3TEZA 3NS1A 2G1EA 3V05A 2KANA 3KVFB 2R61A 2KWDA 1HA5A 2FNJB 3VR8B 2IO1B 2HE7A 2JXXA 2ZW0A 4EKUA 2FUG1 4BKSA 1E7UA 1UBIA 3QWZB 2RGFA 4PK1A 3TEXA 1RAXA 2KN5A 4IOIE 3BVMA 1XCQL 1SF0A 2LZ6A 2WXGA 2KLGA 3OJ4B 1I7HA 3Q8EA 1F2RI 3VAWA 3CSFA 3KYDD 1PUTA 2DYMA 3WALA 4J3OD 2BYVE 4WWNA 1QQRA 4GB9A 5DPRA 4HKQA 3H7PA 3QA8A 1WXMA 4IC7B 1PFDA 2LHDA 4LCDE 2NPTA 4W9FA 3UI3A 4REZA 1K50A 1HZ6A 3PRMB 4YWGG 3PHWB 5IKCM 4MT5A 3SEBA 2IGHA 2L05A 2G3QB 3AH7A 2JRHA 2V0GA 2GB1A 2V1YA 4ITKA 1L6UA 2AEHA 2RMMA 1FXAA 3R66C 4W9GA 4UDUC 1SSNA 3RUIB 4XYCA 2KX3A 2BPSA 2IO3B 4MEMA 4AJYB 1BMLC 1ZDVA 4C7ZA 1SEBD 4USAA 3ZTDA 1WM2A 2C5LC 2Z59B 3A4RA 3IT4B 3K9OB 3VH4B 1SJHD 2DNFA 2VZKB 4HRSA 5CHFA 2KWCA 2WS3B 3VTWA 1XQQA 1AYFA 1I42A 2L1AA 3A9KB 3GE8C 2ZCBA 4XZ4A 5EE1A 2I2YA 2QILA 2V9HA 4DDGD 1D5MC 2GBNA 3BK1A 4LNOA 4P6VF 4KIKA 2TSSA 2J52A 4YSYB 2KVZA 2JQRB 4JL9A 1FFUA 4TV3A 2AQ2B 5C1ZA 3D32A 1QOFA 2WXKA 1XCTL 2UWQA 2PKOA 3Q69A 2Z0DB 4RH6A 1L0XB 3RD2A 2W3SA 2BB5A 3VRAB 3BYTB 2RPQA 2IGDA 3H1UA 3V3XA 3ZGZA 1TS2A 1HTQA 3I3TB 4YXDB 3VTUA 3CF4A 2RD0A 4CQNA 2LMCA 1R7SA 2E6XA 4PS7A 4TSSA 3VR9B 2XN9C 4KKJA 2K6DB 3Q2AC 2KYWA 2GI9A 4FJZA 1RYJA 3DVNU 2LXCA 3GOEA 2NBWB 2BTEA 4LK0M 4DXAB 3Q3MC 1WMHA 4AUQC 3IFWB 3U30A 1V6EA 4II3B 3GB1A 3KYCD 2KC1A 2REXA 1L2NA 2M1MA 4OVZA 5BO4B 2MBQA 1OFFA 1YN4A 4A3PA 3OAWA 1FNVA 2DYOA 2KDMA 5AUKA 1C77A 3N1YC 2MP2B 1PDXA 4K7WA 2WXQA 3IG3A 1TYGB 2NR2A 4HCNB 1SIJA 1J7BA 2ZVOA 4OW0A 3ZTCA 2NTSA 1GOZA 1JWUD 1TKYA 2N7DA 4YT0B 3V6EB 2WXJA 4US8A 4DHZE 4NAWA 2G45B 3GZNB 2WDTB 5CHWA 3P4SB 3MJ5A 1H8CA 2PTLA 3PZ7A 2G4DB 1E5WA 1MHHE 1PGXA 1E6EB 2VRRB 4XX5A 1MVKA 4A3OA 4MSMB 3W1YA 1MPEA 3SDLC 4US9A 3AE2B 3A1QA 1Q10A 1WMHB 2ICIA 1GTHA 4AS1A 3NVVA 4ARCA 5FR3A 1SXTA 2JYTA 2C9WB 4EFOA 5LXHA 3P2BA 1UZXB 2LD9A 1KTKA 4TQ0A 3MC8A 2FAZA 1I35A 2INPE 2NBVB 2KTRA 3V6CB 4DWFA 2KOXA 1HE8A 2IDYA 5JHAA 4G0NB 4MDKE 1WR6E 2LJ5A 1ZE3D 4NAWB 3HM6X 4NY0A 2L8JA 2DZKA 1SBBB 1KJTA 4ARIA 2EMTA 1P9DU 2K8CA 1UNSA 4RGMA 1WM3A 4BOSC 1QOAA 4ACFA 4A20A 1I4HA 2PPHA 4ASWC 1SGHA 5HFYA 2L7RA 2J0MA 3ZXRA 1JW9D 3A1QB 1V81A 2W54A 5D2MB 3Q8BA 4WAFA 3QIJA 2MBBB 1N60A 2V3NA 2KVRA 4OZBA 2FIDA 1N63A 4YTMB 1JWMD 3AULA 1WFYA 3PREA 2L52A 3PGEA 1WSPA 2ZVNA 3DDCB 2DYBA 1F0ZA 4JGHB 4JX1C 2XNAC 2PE6B 4MH0E 3DBHI 1C1YB 4WJPA 2L32A 3EHVA 3IAS1 4LNIA 1YIWA 4RF0A 3ZNZB 3H9DA 3RNEC 5IN7A 1TJEA 1JMLA 1OQRA 3MC9A 4RMAA 2BS2B 2RR9A 4JE3B 5DPWA 3UIOB 3UINB 1WX8A 3NZ3A 4DBGA 4IM3A 2O6VB 2IJ0A 2BF8B 1QLBB 1F1HA 3A9JB 4MM3A 2WLBA 5JH5C 2UU7A 1WF9A 3AE5B 1FXTB 4ZRQA 4G11A 1WRDB 1K53A 1E10A 1JALA 3NOBA 4N59A 2D3CA 4M02A 2EELA 2FBWB 5T8IA 3PS6A 1WGKA 4YL8A 2I1KA 3AE4B 4WWMA 4OHJA 1WJUA 1ZPSA 4RM8A 4LDTD 2AYOB 3WAPA 4YSXB 2M8SA 1IUEA 1Y56A 4O1NA 2EKIA 2LVOA 1WE6A 1UF0A 2Z8LA 4GOCA 1P0RA 3RPFC 4WWOA 2B76B 1V97A 3WAOA 2D5GA 4RCOA 4WJOA 4YSZB 2LGDA 3KWLA 4NJ7A 4WJNA 2LGIA 5D94A 3RI7C 2RSUA 4X57B 5C23A 3L17A 3B9JA 2ZEQA 2AQ1B 1NI2A 3PLVA 2KJHB 2MRPA 2DAJA 3AM9A 2NCNA 4OZAA 4IM2A 1XLOA 1L4DB 2ONQA 3LJ3A 2L76A 1TKEA 4FLHA 4GIVA 3AU5A 1NI3A 2WQYB 2GMIC 1B9RA 5IA7A 3I9V1 3RYTA 1TZOA 2EMSA 2KWVB 4EZJA 2N9KA 2WXIA 1XXGA 2KMAA 3ZJTA 1IGCA 4BBNC 2PJHA 1RM6C 2BVCA 1ENFA 4BKGA 3PHXB 2KDFB 3NZSA 2Q5WD 4B0MA 2V3SA 1FRDA 5HG2A 3BY4B 4C4VB 4OVVA 2MH7A 1E8ZA 3ZIMA 4PT5A 2BQQA 3MTNB 2ZNVC 2BGFA 3LB8C 2A4ZA 2J7QB 3AE3B 2C7NB 2RDHA 3CMMB 1R4MB 3DPDA 1FPYA 3TBLD 1TGZB 1YNTE 3M63B 2MBHA 2WDQB 4MELA 4P16A 1YN5A 2WP9B 2LGSA 4W9DA 1RFAA 1EM7A 4AOFA 5LNK1 2CJNA 3IT6B 1V86A 1Y8RC 1C79A 1V1PB 1Q1OA 3Q6BA 4KDIC 4AP4C 3UQBA 1K52A 3IHPC 1DYQA 2CU3A 1TBEA 3DHGC 1L5PA 2FCQA 3IAM1 1EF5A 5LLIA 4MJSB 3ZJUA 1WZ0A 2QEJC 2WXOA 4ZOHC 2WU2B 5DCNA 3JYUA 2Y5CA 1RFKA 2LGXA 2N9XA 3P63A 1XLNA 2K25A 1C4PA 4PS3A 1WGYA 3T9LA 2IZVB 4C00A 3W5VB 1OGWA 4XC2A 4AQ7A 1P7FA 3SHQA 1SB3C 4IWPA 2LVQA 4KZCA 1XO3A 2CHZA 2KFKB 1RWSA 2D3GA 4K81A 3U4EG 5CTRC 5C3JB 3GZNI 4KDLB 2BYFA 4RFBA 1GJZA 2BBCA 2V3PA 4AJWA 2VH1A 1J7CA 4KGRA 1JRUA 1MHXA 3ZUNA 1AN8A 4IKGA 2X38A 4HPLB 2OHFA 3DWGC 2WXPA 1TS3A 2Y3AA 3FKYA 1D5ZC 1D5XC 3AU4A 1ZP0B 5CX3A 2AWTA 2MW5A 1VR9A 3A4SC 2K39A 2KWUB 4HPPA 1P1AA 1F2RC 1V9JA 3I57A 1V2YA 3T3NA 1ZXHA 2MJ3A 4S17A 1T3QA 1N61A 3ZQ4A 2Y5BB 1E9MA 2RDGA 2M56B 2WDVB 3QCAA 1E8WA 5FKAC 1Z2MA 3Q8AA 2JSVX 4W9HA 3B08A 2XK5A 3TSSA 2V4IB 1BT0A 1GC7A 4Q2JA 1MG8A 2KHWB 3R3MA 3AEAB 2BT6A 3A33B 4NAMA 4L23A 3L54A 3L4PA 4M0WA 4LNFA 3X23A 3U2SC 2KAJA 4DHZB 3AB5A 1T6BX 3ONSA 1ZGUB 1T0YA 1WJNA 3H7PB 2GLSA 4IM0A 3ZNID 3PV1A 4DK5A 5EE0A 2JUOA 3DVGY 2IO0B 4LTUA 2NPTB 3ZNGC 2ZPYA 2DENB 3X0WA 2N0SB 4L2YA 4WAAA 3E56A 4RF1A 3ZRCA 5BMGA 4LJOB 4QAYA 4HWIB 1V8CA 1WGDA 3OG5A 1FIQA 4CYEA 2AL6A 3DBRB 4II2B 1OTRB 4GSWA 1SE4A 2MLBA 4F7ZA 1WRIA 2QMTA 1L0VB 5BYRA 1EF1A 2WX0A 4TMAB 1FM0D 3PZDA 5H8YE 4HVBA 4FJYA 3L10B 3RNBC 3NZUA
chains in the Genus database with same CATH topology
3C8YA 4XWTA 1HQRD 4NAWB 2WNMA 1OQQA 3BZDB 1SBBB 3BWUD 2H88B 3SFEB 2GRIA 4ARIA 3R2TA 3E9SA 1I4RA 1UNSA 2W3RA 4RGMA 3PZ8A 3AE8B 1GAQB 1YN3A 3NVZA 1QOAA 4DXGA 1ET6A 5I4DA 1C76A 3AEFB 3LXFA 2WXNA 1VRAB 1I4HA 3O13A 1FO4A 3BVGA 2PMVA 1PYWD 1YJJA 2QIEB 2ACZB 1ZDXA 2WXMA 4WQMA 5HFYA 3ABVB 1YQ4B 5HHDG 4HEA1 1JRPA 1JW9D 1STEA 4GDKB 2W54A 2BW2A 4KGTA 3Q8BA 4WH4A 4WAFA 1C78A 1KFYB 2INNE 3FAHA 1N60A 4B0EA 4YTPB 2V3NA 4OZBA 1N63A 4YTMB 1V1PA 1JWMD 4XE0A 5MPOA 4D2KA 2L52A 2K0PA 1WSPA 1HXYD 2W55A 1I4PA 1F0ZA 3MP9A 4JX1C 1CK1A 2XNAC 1JWSD 1E0ZA 2IPKD 2L32A 3KWVA 4GLSC 3IAS1 3P4PB 2JWUA 1EWYC 2WXFA 3ZYYX 4RF0A 1WWTA 1I4XA 1IBXB 4RGOS 3TEWA 1UUPA 1TJEA 2WXLA 1JMLA 1CJEA 1GTEA 1OQRA 1TKGA 2BS2B 2JX5A 4HJGE 4JE3B 3W2DA 2WDRB 3NZ3A 4KGSA 2W82A 5E6JA 2IJ0A 4JPSA 2LEKA 5EE3A 3H8HA 1ZUD2 2PLPA 2LUMA 1QLBB 4A6QA 2WLBA 2LFIA 1VJKA 3KQ4A 3HVDA 3AE5B 1FEHA 4ZRQA 1AW7A 1QILA 3OWEB 1L0YB 1K53A 5G5GA 1E10A 1JALA 2PIAA 2HTME 2BS3B 1QKZA 1WXQA 3BYYB 4N59A 2EELA 2FBWB 5T8IA 1VZ6A 1WGKA 5BMHA 3AE4B 4WWMA 1EWCA 4OHJA 1ZPSA 3FILB 1K51A 1SE3A 2K3UA 2LHEA 2K22A 4YSXB 1QF6A 3EGRA 2OEDA 1IUEA 1Y56A 4O1NA 1XF5L 1GPXA 3HUIA 2EKIA 3LYYA 3AEDB 4TQ1A 3MFGA 4YTNB 1QOGA 4RNAA 5D7GA 2Z8LA 3RPFC 1AWDA 1DGJA 3EA6A 3P42A 3FC4A 2B76B 1HZ5A 4NZLB 4GDLB 1XLPA 1V97A 1TY2A 2D5GA 4RCOA 1XEEA 4YSZB 3B2GA 1IGDA 3KWLA 1QT9A 2ON8A 1KH0A 4LLGM 2LGIA 4H2AA 5HI1A 2YEPB 4N6EB 2LJIA 2DBYA 1GT8A 4XDCA 2NMQA 3AEGB 1VZ8A 3U7ZA 2N7JA 1FRRA 2J53A 2I38A 1ACCA 3B9JA 1QOBA 1J7AA 2AQ1B 1SE2A 3AV8A 4ZYSA 1NEKB 3AM9A 3KLSX 1NVID 1PGBA 5C2TB 3TEZA 3AEEB 3NS1A 4OZAA 2G1EA 1XLOA 3V05A 1KLGD 3MC0B 2R61A 2KWDA 1HA5A 1SJED 3VR8B 4A8XC 1L4DB 2ONQA 3W5UB 2ZW0A 2WXRA 4EE2A 3AMZA 2FUG1 1TKEA 3B2FA 5H92C 3R8BA 4ZHPA 4JWSC 1NI3A 2WQYB 1DOYA 1B9RA 3I9V1 3TEXA 4C56C 1DOXA 1B1ZA 4IOIE 1TZOA 3BVMA 2DLBA 1XCQL 1SF0A 2N9KA 2WXIA 1XXGA 2WXGA 3ZJTA 4ZRPA 1I7HA 3Q8EA 1F2RI 4HROA 1D6EC 1IGCA 4A90A 3HRDD 4DXFA 2YEPF 4WURA 1PUTA 2DYMA 4J3OD 1RM6C 1WYGA 3SR6A 1N5XA 1ENFA 1QQRA 1JWBD 2KQ4X 4HKQA 5G5HA 3J9CA 1PFDA 2KN4A 2LHDA 3URYA 3UI3A 2Q5WD 4B0MA 4REZA 1FRDA 4RGNA 1K50A 1L6VA 3PO0A 5HG2A 1HZ6A 2M0AA 4YWGG 2MH7A 1FNWA 4PT5A 4MT5A 1T5XD 1TS5A 3SEBA 2BYTA 2IGHA 2WU5B 2E3TA 3VRBB 3AH7A 2V0GA 3LB8C 2GB1A 2QJLA 4C7YA 3AE3B 2MEKA 5BYSA 4ITKA 1L6UA 2RDHA 2CJOA 1E7PB 2RMMA 2NTTA 1FXAA 1FFVA 2K9XA 3R2IA 1GB4A 1JCKB 4UDUC 1SSNA 1YNTE 1DOIA 2KMMA 2WDQB 3BVZA 4P16A 3GP7A 2MJDA 1YN5A 2WP9B 1C9FA 4KKIA 3P4QB 1N62A 1F77A 1BMLC 1ZDVA 4R3DA 4C7ZA 1SEBD 1LO5D 4USAA 1HEZE 2K5PA 1EM7A 5LNK1 2BS4B 1FMAD 2CJNA 3BIID 3IT6B 3IT4B 3NVYA 4HKZE 1C79A 3P4RB 1TY0A 1ROEA 1V1PB 1ZXIA 1SJHD 3P1MA 1P7EA 1VZ7A 2VZKB 4HRSA 1K52A 2FE8A 3TUOA 2WS3B 1AYFA 1DYQA 2CU3A 1YJIA 2HDEA 3MHZA 4XDDA 3AECB 2L1AA 4OZCA 5FK9C 5EE1A 1XLQA 1ET9A 2KACA 2I2YA 1L5PA 3IAM1 1I4GA 1VLBA 2QILA 1D5MC 3VQIA 2AX5A 3BK1A 4P6VF 1D4BA 2VZKD 2ZW1A 1NENB 3ZJUA 2PVGC 2TSSA 2J52A 4YSYB 2QEJC 4IDIA 2WXOA 4A9AA 2JQRB 3IXSA 3GS2A 4ZOHC 1FFUA 2WU2B 2L83A 2Y5CA 1RFKA 3DWMA 2MJEA 2AQ2B 1M4VA 3P63A 1QOFA 1XLNA 4ZHOA 1C4PA 3BK2A 5D3IB 3SFDB 2WXKA 4MM3B 1XCTL 4MH8A 4KX6B 2PKOA 3Q69A 3AN1A 1JROA 4RH6A 1L0XB 3W5VB 2W3SA 2BB5A 2Y5PA 4MACA 3VRAB 3BYTB 4XWWA 2M19A 1IBXA 4AQ7A 1P7FA 2AQ3B 5AUIA 1SB3C 3TEYA 2IGDA 3V3XA 2JZPA 1C4CA 3ZGZA 1TS2A 3W1SA 1KF6B 1XO3A 1TS4A 4YXDB 3Q8CA 1RWSA 3AE9B 5BMIA 1FCLA 2QSDA 3ETRA 3U4EG 1H7XA 3CF4A 4CQNA 5C3JB 1EU3A 3ZJVA 4RFBA 2BBCA 2LMCA 2V3PA 1CQVA 1R7SA 1NYQA 2E6XA 5BYQA 1J7CA 1UGJA 1VDVA 4TSSA 3EUB2 4KGRA 3CIRB 3VR9B 1C4AA 2XN9C 4KKJA 2N9LA 4DQOC 2GI9A 2RPVA 5D3DA 1MHXA 2JU6X 1RYJA 1AN8A 1N5WA 4IKGA 2X38A 5GXGB 4NJCA 2BTEA 2OHFA 1V1OA 1FCCC 4LK0M 3FILA 3DWGC 2WXPA 1TS3A 2Y3AA 3GB1A 1D5ZC 2J42A 1D5XC 4L1BA 1UWXA 1ZP0B 1FNUA 4OVZA 1KLUD 1VR9A 2PVOD 1OFFA 1YN4A 1FNVA 2DYOA 2KDMA 2SEBD 5AUKA 1C77A 1FXIA 2JXTA 2J4XA 1F2RC 1PDXA 3I57A 2WXQA 3T3NA 1TYGB 1ZXHA 2MJ3A 1T3QA 1N61A 1ESFA 1NYRA 1E9MA 3ZQ4A 3AE7B 1SIJA 1J7BA 3N9YC 2RDGA 4OW0A 2M56B 5EE9A 2WDVB 3NVWA 2NTSA 1GOZA 5FKAC 1JWUD 3Q8AA 1TKYA 2JSVX 1FD6A 3TSSA 4YT0B 2V4IB 2WXJA 4US8A 1I4QA 4Q2JA 4FXCA 1YQ3B 3AEAB 2BT6A 1L4ZB 3P4SB 3MJ5A 1CZPA 4NAMA 4L23A 2PTLA 3L4PA 4M0WA 1ZOYB 3PZ7A 3Q8FA 3U2SC 1MHHE 1PGXA 2KAJA 5TSSA 1H7WA 1E6EB 2WXHA 1JWAD 4RGTA 3CWIA 3AB5A 4C80A 1MVKA 1T6BX 1MPEA 2SAKA 3NUHB 4US9A 2DWQA 5JXVA 3AE2B 1BUIC 1PGAA 5EE0A 4LTUA 1Q10A 2ICIA 1GTHA 4AS1A 1JQ4A 2N0SB 3NVVA 4ARCA 1YMHE 4L2YA 5FR3A 1SXTA 3NRZA 3AEBB 4JWUC 2JYTA 4A55A 3E56A 4RF1A 3AE6B 4N58A 4WIPA 5BMGA 3WCQA 1A70A 1EU4A 2G9HD 1KTKA 1V8CA 1FIQA 1UWMA 4TQ0A 1MI0A 3T3OA 1SE4A 2INPE 3RFZB 1BXTA 2IGGA 1WRIA 2H89B 2QMTA 3U52E 1L0VB 5BYRA 2IDYA 4TMAB 2PW9A 1FM0D 3W9CB 5H8YE 3HVZA 2BB6A 1KRHA 3AE1B 1GB1A 1ZE3D 2JYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED B;  2OHF A;  1DOI A;  4YTN B;  1QOG A;  1OQQ A;  2KMM A;  3DWG C;  2WDQ B;  2H88 B;  3RPF C;  3SFE B;  1AWD A;  1DGJ A;  2MJD A;  2B76 B;  3FC4 A;  1XLP A;  2WP9 B;  1V97 A;  2W3R A;  3AE8 B;  3P4Q B;  1ZP0 B;  4YSZ B;  1GAQ B;  1N62 A;  3B2G A;  3NVZ A;  1QOA A;  3KWL A;  1QT9 A;  3AEF B;  3LXF A;  4C7Z A;  4USA A;  2PVO D;  1FO4 A;  1OFF A;  1YJJ A;  2K5P A;  2QIE B;  2ACZ B;  4WQM A;  4N6E B;  5AUK A;  2DBY A;  2BS4 B;  1FMA D;  2CJN A;  1GT8 A;  1FXI A;  3BII D;  3ABV B;  3NVY A;  3P4R B;  1YQ4 B;  3AEG B;  1PDX A;  1ROE A;  1ZXI A;  1JRP A;  1JW9 D;  1TYG B;  1FRR A;  2W54 A;  3P1M A;  4HRS A;  2MJ3 A;  1T3Q A;  1N61 A;  1NYR A;  1E9M A;  1QOB A;  2WS3 B;  3AE7 B;  1J7A A;  1SIJ A;  3B9J A;  1AYF A;  2CU3 A;  1KFY B;  1J7B A;  1YJI A;  3AV8 A;  3AEC B;  1N60 A;  3FAH A;  4YTP B;  2M56 B;  5EE9 A;  2WDV B;  1NEK B;  5EE1 A;  1N63 A;  1XLQ A;  3AM9 A;  4YTM B;  1NVI D;  3NVW A;  1L5P A;  5C2T B;  1TKY A;  3AEE B;  3NS1 A;  5MPO A;  2G1E A;  1XLO A;  2L52 A;  1VLB A;  4YT0 B;  4US8 A;  2W55 A;  2AX5 A;  4P6V F;  4FXC A;  1F0Z A;  3VR8 B;  4JX1 C;  3W5U B;  1YQ3 B;  3AEA B;  2BT6 A;  1NEN B;  3P4S B;  1CZP A;  2PVG C;  3AMZ A;  1TKE A;  3B2F A;  3L4P A;  5H92 C;  4ZHP A;  1E0Z A;  4YSY B;  1ZOY B;  4IDI A;  4JWS C;  4A9A A;  1NI3 A;  2WQY B;  2JQR B;  3P4P B;  2KAJ A;  1EWY C;  1DOY A;  3ZYY X;  4ZOH C;  1FFU A;  2WU2 B;  2L83 A;  1H7W A;  1B9R A;  1E6E B;  1WWT A;  2Y5C A;  1JWA D;  1RFK A;  3DWM A;  2MJE A;  3CWI A;  1TJE A;  1DOX A;  1TKG A;  1CJE A;  1GTE A;  1OQR A;  3AB5 A;  3P63 A;  2BS2 B;  1QOF A;  1XLN A;  4C80 A;  4ZHO A;  2JX5 A;  3SFD B;  1SF0 A;  4KX6 B;  2WDR B;  2PKO A;  3AN1 A;  1JRO A;  1I7H A;  2DWQ A;  4HRO A;  3AE2 B;  4US9 A;  3W5V B;  2W3S A;  3HRD D;  5EE0 A;  4LTU A;  3VRA B;  2LEK A;  2M19 A;  1GTH A;  5EE3 A;  1PUT A;  1ZUD 2;  1RM6 C;  1WYG A;  5AUI A;  3SR6 A;  1QLB B;  1SB3 C;  2N0S B;  1N5X A;  3NVV A;  1JQ4 A;  2WLB A;  3AEB B;  1JWB D;  3NRZ A;  4JWU C;  3AE6 B;  1VJK A;  1KF6 B;  3AE5 B;  1XO3 A;  5G5H A;  4N58 A;  1PFD A;  4YXD B;  3WCQ A;  1A70 A;  1RWS A;  3AE9 B;  3ETR A;  2Q5W D;  1V8C A;  5G5G A;  1E10 A;  1FIQ A;  1JAL A;  1UWM A;  1FRD A;  2PIA A;  1H7X A;  2HTM E;  3CF4 A;  1L6V A;  2BS3 B;  3PO0 A;  1WXQ A;  5C3J B;  4N59 A;  2MH7 A;  2FBW B;  2WU5 B;  1R7S A;  1WGK A;  1NYQ A;  2E3T A;  3VRB B;  3AE4 B;  1J7C A;  1VDV A;  3AH7 A;  4WWM A;  1WRI A;  2H89 B;  2QJL A;  3EUB 2;  3LB8 C;  3CIR B;  3VR9 B;  3AE3 B;  1L0V B;  4C7Y A;  2K22 A;  4ITK A;  4YSX B;  1L6U A;  2CJO A;  1E7P B;  1QF6 A;  1FM0 D;  1IUE A;  3W9C B;  1FXA A;  3HVZ A;  5H8Y E;  1FFV A;  1N5W A;  1KRH A;  1RYJ A;  2EKI A;  3AE1 B;  2K9X A;  3HUI A;  1GPX A;  5GXG B; 
#chains in the Genus database with same CATH topology
 4XWT A;  2C7H A;  1MJD A;  2H88 B;  4BOZ B;  3E9S A;  1I4R A;  3AE8 B;  1WJ4 A;  3NVZ A;  3QX1 A;  2PEA A;  2OJR A;  3R7Q A;  1C76 A;  4MGK E;  1VRA B;  3K9P B;  3BVG A;  2PMV A;  4EZK A;  1LFD A;  1A5R A;  4KGT A;  1WGR A;  1WJ6 A;  1C78 A;  1KFY B;  4B0E A;  4KIK B;  4NNJ B;  3RMK C;  1WGH A;  2G4S A;  4XE0 A;  1WY8 A;  5MPO A;  1YX5 B;  2IND C;  1CK1 A;  4FHK A;  2BKR B;  1GUA B;  1JWS D;  2LAS A;  1E0Z A;  2IPK D;  1TZ1 A;  3P4P B;  2KLC A;  2WXF A;  1WWT A;  1I4X A;  3VUY A;  3WAN A;  4MGY E;  2JX5 A;  4HJG E;  3UQA A;  5KHQ A;  1NDD A;  2D10 A;  3RUL A;  2LEK A;  3EEC A;  4EZL A;  1WE7 A;  1VJK A;  1IPG A;  3DHI C;  4TUU A;  1AW7 A;  5J17 A;  3OWE B;  5G5G A;  2PIA A;  3L0W B;  2OOB B;  3BYY B;  1Z5S B;  1T0R C;  3NS8 A;  2JWZ A;  3Q3J A;  4AWJ A;  3DBS A;  1EWC A;  1SE3 A;  2K22 A;  2XEW A;  4DDI D;  3SU8 X;  2N1V A;  1QF6 A;  2OED A;  3V61 A;  1F52 A;  2O2V A;  3KUD B;  4TQ1 A;  1QOG A;  4M8N A;  5D7G A;  4TKN A;  2CU1 A;  1AWD A;  3EA6 A;  1HZ5 A;  3N1X C;  3B2G A;  1QT9 A;  1ZW7 A;  5LXI B;  4BKT A;  5HI1 A;  3RNG C;  4N6E B;  2LJI A;  2DBY A;  2J0K A;  2NMQ A;  4EOY A;  3U7Z A;  4FJV B;  4ANU A;  3AV8 A;  1PGB A;  3HIZ A;  4DHJ D;  1R4M I;  1IP9 A;  1KLG D;  3MC0 B;  2IY1 B;  1LM8 B;  3W5U B;  3AMZ A;  3B2F A;  4ZHP A;  3R8B A;  3JVZ X;  3VHT C;  1T0Q C;  1SE9 A;  5EDS A;  1EUV B;  4C56 C;  3H6N A;  2DLB A;  2K8H A;  3RCZ A;  2KQS A;  4B95 A;  3W1S C;  1D6E C;  1WZ3 A;  2A5U A;  2IYD B;  2YEP F;  4WUR A;  1N5X A;  2KQ4 X;  2KTR B;  1J0G A;  3DBL I;  2KN4 A;  3UF8 A;  3URY A;  4EUT A;  1L6V A;  2KT7 A;  3EC8 A;  2DHZ A;  2E3T A;  3VRB B;  2QJL A;  4C7Y A;  2MEK A;  2CJO A;  1E7P B;  2NTT A;  2MBE A;  4F8C B;  1FFV A;  3R2I A;  3OJ3 A;  1GB4 A;  3C0R B;  1JCK B;  1DOI A;  2N4F A;  3BVZ A;  1E7V A;  3M3J A;  4KKI A;  1N62 A;  1F77 A;  4ICV A;  4R3D A;  4HLE A;  2WGS A;  4HKZ E;  1FMA D;  3GE3 C;  1P7E A;  2FE8 A;  3TUO A;  4ANV A;  1YJI A;  3AEC B;  2KAC A;  5JHB A;  3U7D A;  3RT3 B;  4GDK A;  2AX5 A;  1GNU A;  2KDB A;  4PYZ A;  1NEN B;  5IP4 D;  1D3Z A;  1AAR A;  4A9A A;  2DX5 B;  3IXS A;  3GS2 A;  1V49 A;  2FCN A;  2KC2 A;  2BKF A;  2MJE A;  4ZHO A;  5D3I B;  4MM3 B;  4G3X B;  2VH2 A;  4MH8 A;  1YJ1 A;  4P1C C;  3SD5 A;  1JRO A;  3EFC A;  2GBK A;  4W9C A;  3N1Z C;  2L0T A;  3Q3O C;  4N9F 4;  4MAC A;  4XWW A;  1IBX A;  2M19 A;  2AQ3 B;  5CHV C;  3TEY A;  1C4C A;  3W1S A;  3DVN V;  1UD7 A;  1TS4 A;  3WIM A;  1WR1 A;  5BMI A;  2LI5 A;  2C7M B;  4GU2 A;  4KZ0 A;  3ZJV A;  2KD0 A;  2KZR A;  3O65 B;  1CQV A;  1NYQ A;  2R2Q A;  1VDV A;  1UGJ A;  3EUB 2;  3CIR B;  1XD3 B;  2N9L A;  4DQO C;  2WYQ A;  5D3D A;  4B9K A;  3RZW C;  2C60 A;  1V1O A;  3FIL A;  5DPT A;  1K8R B;  2J42 A;  5DPS A;  2QDF A;  3ZDT A;  3ZW3 A;  1KLU D;  1UBQ A;  3VVW B;  2PVO D;  2KO3 A;  5JZE B;  3JSV A;  4GDL A;  2JXT A;  3DBR I;  4ZRJ A;  2V4L A;  3KH0 A;  2R2O A;  4WJQ A;  3NVW A;  1UH6 A;  1FD6 A;  4MGZ E;  1PQS A;  4WQO B;  1YQ3 B;  1OEY J;  3KW5 B;  1L4Z B;  2LXA A;  2KFJ A;  2KDE B;  1ZOY B;  3TCA A;  5TSS A;  1H7W A;  2WXH A;  3L16 A;  2O6V D;  1JWA D;  4M01 A;  4BZA A;  2SAK A;  5AZH A;  5AEK B;  4E3C A;  5JXV A;  1BUI C;  4ICU A;  3ML8 A;  3NJT A;  2BWF A;  1JQ4 A;  2M4N A;  1YQB A;  3RNF C;  4JQW C;  3I5J C;  4WIP A;  3VTV A;  3WCQ A;  1A70 A;  2KQ7 A;  5FR6 A;  1YD8 U;  2YLM A;  4IWO A;  3MJW A;  3CF6 E;  2HD5 B;  3RFZ B;  1R4N B;  1S3S G;  2MQJ A;  2IGG A;  2H89 B;  5IOI A;  2B3A A;  4HPM B;  2JY6 A;  1T0S C;  2CKH B;  3W9C B;  2BB6 A;  4HCP B;  1KRH A;  1GB1 A;  4A90 A;  2N7E A;  3ZDM C;  2FCM A;  1HQR D;  4F1S A;  1E8X A;  2WNM A;  1OQQ A;  3PT2 B;  3BZD B;  2M0X A;  3SFE B;  3R2T A;  3PTF C;  2W3R A;  2MX2 A;  3V62 A;  3PZ8 A;  4NJ6 A;  4ZYN A;  1ET6 A;  4DXG A;  3AEF B;  2MBO A;  1WYW B;  1FO4 A;  5L95 C;  1YX6 B;  3C19 A;  1YJJ A;  2QIE B;  2WXM A;  2ACZ B;  1ZDX A;  2CHX A;  3ABV B;  1YQ4 B;  4LJP B;  5HHD G;  2NBU A;  4HEA 1;  2HTH A;  2JRI B;  2NS5 A;  4WH4 A;  3ZO5 B;  1EO6 A;  2INN E;  3FAH A;  2HJ8 A;  3N30 A;  1CMX B;  2WWZ A;  1E90 A;  2K0P A;  3ML9 A;  1HXY D;  4HK2 A;  3UIP B;  3RNC C;  3A9K A;  4G50 A;  2JWU A;  3BIN A;  3ZYY X;  1M94 A;  3TEW A;  2WXL A;  1CJE A;  1GTE A;  1TT5 B;  1WI0 A;  2KXJ A;  3W2D A;  4KGS A;  2W82 A;  1WGG A;  4FUL A;  3KUC B;  4JPS A;  2PLP A;  2EKE C;  2LUM A;  5E6O A;  1SIF A;  1LXD A;  3RZF A;  4IWQ A;  1FEH A;  2JZZ A;  1MG4 A;  2JF5 A;  3ZXV A;  1E8Y A;  1WXQ A;  2D07 B;  3QHT A;  3VXW A;  2AL3 A;  2ZNV B;  3DVG X;  5BMH A;  1K51 A;  5AZG A;  2K3U A;  2GBJ A;  2LHE A;  2GBR A;  5GMV A;  4FA6 A;  3EGR A;  3PRZ A;  3HUI A;  3AED B;  4YTN B;  4RNA A;  4HDO A;  3NY5 A;  4XGA B;  2J0J A;  1DGJ A;  3APD A;  4IUM B;  1XEE A;  4B6W A;  1IGD A;  3VDZ A;  2ON8 A;  5KHO A;  3T8M A;  2D2Q A;  2KTF A;  2GOW A;  1GT8 A;  4DHJ B;  1J19 A;  3AEG B;  4BVU C;  2XK5 B;  3B1L X;  2WX1 A;  4NQL B;  3VUX A;  2I38 A;  1ACC A;  1J7A A;  1Q5W B;  4ZYS A;  1KM7 A;  4GMV A;  4M0W B;  2MP2 A;  1TIF A;  2JPH A;  3AEE B;  2BYE A;  3TJP A;  3WAM A;  1SJE D;  4A8X C;  3N3K B;  1Q0W B;  4HXD A;  4K7S A;  2WXR A;  4EE2 A;  5H92 C;  4I6N B;  4JWS C;  1N6Z A;  3ENE A;  1DOY A;  3I63 C;  1DOX A;  1B1Z A;  1LGR A;  4W9K A;  3NG0 A;  5J2R A;  1GC6 A;  1ISN A;  4ZRP A;  2NVU I;  4HRO A;  3HRD D;  3HM3 A;  4W9I A;  4DXF A;  5E6N A;  3ZNH B;  1WYG A;  5D6J B;  3SR6 A;  3R7R A;  3QC8 B;  1JWB D;  4W9L A;  1H4R A;  1NBF C;  1WX9 A;  3VFK A;  3QK0 A;  5G5H A;  3J9C A;  4J6I A;  2CS4 A;  4RGN A;  4M00 A;  3PO0 A;  3M95 A;  2QCZ A;  4IG7 B;  2M0A A;  1FNW A;  4ZRK A;  1T5X D;  1TS5 A;  2BYT A;  2WU5 B;  3QQ8 B;  2MA9 B;  5BYS A;  3Q3N C;  3QAQ A;  5IAA C;  3DQV A;  2D11 A;  2K9X A;  5G55 A;  4W9E A;  1WH3 A;  3M62 B;  2OJW A;  4HJK A;  4LDT B;  2KMM A;  1V80 A;  3GP7 A;  4MGI E;  2FCS A;  2MJD A;  1C9F A;  5J18 A;  3P4Q B;  1S1Q B;  2FUH B;  1J8C A;  1LO5 D;  2KNB A;  1HEZ E;  3PRP B;  2K5P A;  3N32 A;  3BII D;  2BS4 B;  3NVY A;  3P4R B;  4BKS D;  1TY0 A;  1ROE A;  1ZXI A;  3P1M A;  1VZ7 A;  2L00 B;  2HDE A;  4P7I A;  3MHZ A;  4XDD A;  4OZC A;  5FK9 C;  2JT4 B;  1QZE A;  3Q14 C;  1XLQ A;  1ET9 A;  4KV2 A;  2FIF A;  1I4G A;  3MHS D;  3IBE A;  1VLB A;  3V60 A;  2ZPN A;  1UGM A;  3VQI A;  1D4B A;  2VZK D;  3TIX A;  2I1J A;  2W9N A;  4ANX A;  2ZW1 A;  4RM9 A;  2PVG C;  4IDI A;  4KSK C;  3DHH C;  1ZKH A;  1VD2 A;  2L83 A;  2YVC A;  4W9J A;  4FHJ A;  3U8Z A;  3DWM A;  3OLM D;  1M4V A;  1OQY A;  2DZJ A;  2KMC A;  2LGY A;  3BK2 A;  4NQK E;  3SFD B;  2K8B A;  3CST A;  4E71 A;  2N1W A;  2GBM A;  3PLU A;  4KSL C;  4KX6 B;  2KJ6 A;  3AN1 A;  2Y5P A;  3H7S A;  3HK0 A;  5AUI A;  2CR5 A;  1TTN A;  1RLF A;  2JZP A;  4HDQ A;  1KF6 B;  1VCB A;  2O6V A;  3Q8C A;  2K6Q A;  3AE9 B;  1FCL A;  2QSD A;  3ETR A;  2D3B A;  4KVG B;  1WIA A;  1H7X A;  1GG3 A;  2L0F A;  3A9J A;  1EU3 A;  4S0R A;  2O2V B;  1HTO A;  5BYQ A;  1U4A A;  1C4A A;  1WX7 A;  3S2A A;  3AXC A;  2RPV A;  1G6J A;  2JU6 X;  1N5W A;  5GXG B;  2XBB C;  4NJC A;  1FCC C;  3DCG A;  2JVC A;  4L1B A;  1UWX A;  4PS8 A;  5TR5 A;  1FNU A;  2DZM A;  3PVL A;  4CHK A;  5L83 A;  4EEW A;  2SEB D;  2LRU A;  1FXI A;  1LQB A;  2J4X A;  4PYU A;  3UGB B;  1WXV A;  2ASQ A;  2LWP A;  1R4N I;  2UYZ B;  1ESF A;  1NYR A;  2ZZP B;  3AE7 B;  3N9Y C;  5EE9 A;  3QAR A;  2HJ1 A;  3APF A;  1F9J A;  1I4Q A;  2IO2 B;  4FXC A;  5IO9 A;  3PPA A;  2MWS B;  2CHW A;  1UEL A;  2PE9 A;  1CZP A;  1MFW A;  2QHO A;  3Q8F A;  4K3B A;  4FBJ B;  2ZJD A;  4URK A;  4RGT A;  3CWI A;  3ZVV A;  4C80 A;  4GXB A;  1P3Q U;  3ALB A;  2WHI A;  3NUH B;  2DAF A;  2DWQ A;  3B0A A;  1PGA A;  3ECI A;  1YMH E;  3NRZ A;  3AEB B;  4JWU C;  4A55 A;  3AE6 B;  3VH3 B;  4N58 A;  4M8M A;  1EU4 A;  2G9H D;  2KDI A;  2KK8 A;  1UWM A;  1RRB A;  1MI0 A;  3T3O A;  4K7U A;  4CO7 A;  3ZLZ A;  4BBN F;  2LUE A;  4FAD A;  1BXT A;  3U52 E;  4C4V A;  2ZCC A;  4IW0 A;  3TL5 A;  2PW9 A;  3HVZ A;  4JIO U;  3AE1 B;  2JYE A;  3C8Y A;  1YOV B;  3APC A;  3BWU D;  2GRI A;  2LVP A;  5AZF A;  2BWE S;  1GAQ B;  1YN3 A;  1V5T A;  4K3C A;  5I4D A;  3LXF A;  2WXN A;  3O13 A;  1P98 A;  1PYW D;  4WQM A;  2M17 A;  3QJZ A;  1OEY A;  4NPN A;  1JRP A;  1STE A;  4GDK B;  4ANW A;  2BW2 A;  2QC8 A;  4BFR A;  4YTP B;  1WXA A;  4BAX A;  1V1P A;  2MCN B;  3VUW A;  2Z0E B;  1WXS A;  4D2K A;  2W55 A;  1I4P A;  2JZ3 B;  3MP9 A;  2INC C;  3WA0 A;  4I6P A;  3KWV A;  4FN2 A;  4GLS C;  2MSE D;  1EWY C;  2RDB C;  4P1B C;  2KX0 A;  4JLC A;  1IBX B;  4RGO S;  1UUP A;  3AI5 A;  1TKG A;  2LRW A;  5HKH A;  4MJS A;  3ZRF A;  3NHE B;  2WDR B;  5E6J A;  4GGQ A;  2N9E B;  3RNA C;  2KJR A;  5EE3 A;  1C3T A;  3H8H A;  1ZUD 2;  2K1F A;  4A6Q A;  3N20 C;  3DOW A;  5E6P A;  2LFI A;  4LNN A;  3KQ4 A;  3HVD A;  4GN1 A;  4K1R B;  1QIL A;  1L0Y B;  1V5O A;  3LDZ E;  2HTM E;  3RN9 C;  2BS3 B;  1QKZ A;  2D3A A;  3ZKJ C;  1VZ6 A;  3IVF A;  2X8X X;  2KFK A;  2MHJ A;  3FIL B;  1L7Y A;  4I6L B;  3HHM A;  4ZDV A;  2KKC A;  1XF5 L;  4WWP A;  1GPX A;  3LYY A;  2IBI B;  1XT9 B;  3MFG A;  2DZI A;  3JW0 X;  3DBH B;  3P42 A;  2L3Z A;  3FC4 A;  3DBL B;  3JSV B;  3Q3F A;  3L13 A;  1XLP A;  4GDL B;  4NZL B;  3TMP B;  1TY2 A;  3PSE B;  1KH0 A;  4LLG M;  3KUZ A;  4ZRI A;  4H2A A;  2YEP B;  4XDC A;  3L08 A;  1KLV A;  3EFU A;  4OVU A;  1VZ8 A;  1X1M A;  2N7J A;  1FRR A;  2IY0 B;  2J53 A;  1KOT A;  1IYF A;  1QOB A;  2N9P C;  1SE2 A;  4E74 A;  4LNK A;  1NEK B;  5G2N A;  4MSQ B;  3KLS X;  1NVI D;  5C2T B;  3TEZ A;  3NS1 A;  2G1E A;  3V05 A;  2KAN A;  3KVF B;  2R61 A;  2KWD A;  1HA5 A;  2FNJ B;  3VR8 B;  2IO1 B;  2HE7 A;  2JXX A;  2ZW0 A;  4EKU A;  2FUG 1;  4BKS A;  1E7U A;  1UBI A;  3QWZ B;  2RGF A;  4PK1 A;  3TEX A;  1RAX A;  2KN5 A;  4IOI E;  3BVM A;  1XCQ L;  1SF0 A;  2LZ6 A;  2WXG A;  2KLG A;  3OJ4 B;  1I7H A;  3Q8E A;  1F2R I;  3VAW A;  3CSF A;  3KYD D;  1PUT A;  2DYM A;  3WAL A;  4J3O D;  2BYV E;  4WWN A;  1QQR A;  4GB9 A;  5DPR A;  4HKQ A;  3H7P A;  3QA8 A;  1WXM A;  4IC7 B;  1PFD A;  2LHD A;  4LCD E;  2NPT A;  4W9F A;  3UI3 A;  4REZ A;  1K50 A;  1HZ6 A;  3PRM B;  4YWG G;  3PHW B;  5IKC M;  4MT5 A;  3SEB A;  2IGH A;  2L05 A;  2G3Q B;  3AH7 A;  2JRH A;  2V0G A;  2GB1 A;  2V1Y A;  4ITK A;  1L6U A;  2AEH A;  2RMM A;  1FXA A;  3R66 C;  4W9G A;  4UDU C;  1SSN A;  3RUI B;  4XYC A;  2KX3 A;  2BPS A;  2IO3 B;  4MEM A;  4AJY B;  1BML C;  1ZDV A;  4C7Z A;  1SEB D;  4USA A;  3ZTD A;  1WM2 A;  2C5L C;  2Z59 B;  3A4R A;  3IT4 B;  3K9O B;  3VH4 B;  1SJH D;  2DNF A;  2VZK B;  4HRS A;  5CHF A;  2KWC A;  2WS3 B;  3VTW A;  1XQQ A;  1AYF A;  1I42 A;  2L1A A;  3A9K B;  3GE8 C;  2ZCB A;  4XZ4 A;  5EE1 A;  2I2Y A;  2QIL A;  2V9H A;  4DDG D;  1D5M C;  2GBN A;  3BK1 A;  4LNO A;  4P6V F;  4KIK A;  2TSS A;  2J52 A;  4YSY B;  2KVZ A;  2JQR B;  4JL9 A;  1FFU A;  4TV3 A;  2AQ2 B;  5C1Z A;  3D32 A;  1QOF A;  2WXK A;  1XCT L;  2UWQ A;  2PKO A;  3Q69 A;  2Z0D B;  4RH6 A;  1L0X B;  3RD2 A;  2W3S A;  2BB5 A;  3VRA B;  3BYT B;  2RPQ A;  2IGD A;  3H1U A;  3V3X A;  3ZGZ A;  1TS2 A;  1HTQ A;  3I3T B;  4YXD B;  3VTU A;  3CF4 A;  2RD0 A;  4CQN A;  2LMC A;  1R7S A;  2E6X A;  4PS7 A;  4TSS A;  3VR9 B;  2XN9 C;  4KKJ A;  2K6D B;  3Q2A C;  2KYW A;  2GI9 A;  4FJZ A;  1RYJ A;  3DVN U;  2LXC A;  3GOE A;  2NBW B;  2BTE A;  4LK0 M;  4DXA B;  3Q3M C;  1WMH A;  4AUQ C;  3IFW B;  3U30 A;  1V6E A;  4II3 B;  3GB1 A;  3KYC D;  2KC1 A;  2REX A;  1L2N A;  2M1M A;  4OVZ A;  5BO4 B;  2MBQ A;  1OFF A;  1YN4 A;  4A3P A;  3OAW A;  1FNV A;  2DYO A;  2KDM A;  5AUK A;  1C77 A;  3N1Y C;  2MP2 B;  1PDX A;  4K7W A;  2WXQ A;  3IG3 A;  1TYG B;  2NR2 A;  4HCN B;  1SIJ A;  1J7B A;  2ZVO A;  4OW0 A;  3ZTC A;  2NTS A;  1GOZ A;  1JWU D;  1TKY A;  2N7D A;  4YT0 B;  3V6E B;  2WXJ A;  4US8 A;  4DHZ E;  4NAW A;  2G45 B;  3GZN B;  2WDT B;  5CHW A;  3P4S B;  3MJ5 A;  1H8C A;  2PTL A;  3PZ7 A;  2G4D B;  1E5W A;  1MHH E;  1PGX A;  1E6E B;  2VRR B;  4XX5 A;  1MVK A;  4A3O A;  4MSM B;  3W1Y A;  1MPE A;  3SDL C;  4US9 A;  3AE2 B;  3A1Q A;  1Q10 A;  1WMH B;  2ICI A;  1GTH A;  4AS1 A;  3NVV A;  4ARC A;  5FR3 A;  1SXT A;  2JYT A;  2C9W B;  4EFO A;  5LXH A;  3P2B A;  1UZX B;  2LD9 A;  1KTK A;  4TQ0 A;  3MC8 A;  2FAZ A;  1I35 A;  2INP E;  2NBV B;  2KTR A;  3V6C B;  4DWF A;  2KOX A;  1HE8 A;  2IDY A;  5JHA A;  4G0N B;  4MDK E;  1WR6 E;  2LJ5 A;  1ZE3 D;  4NAW B;  3HM6 X;  4NY0 A;  2L8J A;  2DZK A;  1SBB B;  1KJT A;  4ARI A;  2EMT A;  1P9D U;  2K8C A;  1UNS A;  4RGM A;  1WM3 A;  4BOS C;  1QOA A;  4ACF A;  4A20 A;  1I4H A;  2PPH A;  4ASW C;  1SGH A;  5HFY A;  2L7R A;  2J0M A;  3ZXR A;  1JW9 D;  3A1Q B;  1V81 A;  2W54 A;  5D2M B;  3Q8B A;  4WAF A;  3QIJ A;  2MBB B;  1N60 A;  2V3N A;  2KVR A;  4OZB A;  2FID A;  1N63 A;  4YTM B;  1JWM D;  3AUL A;  1WFY A;  3PRE A;  2L52 A;  3PGE A;  1WSP A;  2ZVN A;  3DDC B;  2DYB A;  1F0Z A;  4JGH B;  4JX1 C;  2XNA C;  2PE6 B;  4MH0 E;  3DBH I;  1C1Y B;  4WJP A;  2L32 A;  3EHV A;  3IAS 1;  4LNI A;  1YIW A;  4RF0 A;  3ZNZ B;  3H9D A;  3RNE C;  5IN7 A;  1TJE A;  1JML A;  1OQR A;  3MC9 A;  4RMA A;  2BS2 B;  2RR9 A;  4JE3 B;  5DPW A;  3UIO B;  3UIN B;  1WX8 A;  3NZ3 A;  4DBG A;  4IM3 A;  2O6V B;  2IJ0 A;  2BF8 B;  1QLB B;  1F1H A;  3A9J B;  4MM3 A;  2WLB A;  5JH5 C;  2UU7 A;  1WF9 A;  3AE5 B;  1FXT B;  4ZRQ A;  4G11 A;  1WRD B;  1K53 A;  1E10 A;  1JAL A;  3NOB A;  4N59 A;  2D3C A;  4M02 A;  2EEL A;  2FBW B;  5T8I A;  3PS6 A;  1WGK A;  4YL8 A;  2I1K A;  3AE4 B;  4WWM A;  4OHJ A;  1WJU A;  1ZPS A;  4RM8 A;  4LDT D;  2AYO B;  3WAP A;  4YSX B;  2M8S A;  1IUE A;  1Y56 A;  4O1N A;  2EKI A;  2LVO A;  1WE6 A;  1UF0 A;  2Z8L A;  4GOC A;  1P0R A;  3RPF C;  4WWO A;  2B76 B;  1V97 A;  3WAO A;  2D5G A;  4RCO A;  4WJO A;  4YSZ B;  2LGD A;  3KWL A;  4NJ7 A;  4WJN A;  2LGI A;  5D94 A;  3RI7 C;  2RSU A;  4X57 B;  5C23 A;  3L17 A;  3B9J A;  2ZEQ A;  2AQ1 B;  1NI2 A;  3PLV A;  2KJH B;  2MRP A;  2DAJ A;  3AM9 A;  2NCN A;  4OZA A;  4IM2 A;  1XLO A;  1L4D B;  2ONQ A;  3LJ3 A;  2L76 A;  1TKE A;  4FLH A;  4GIV A;  3AU5 A;  1NI3 A;  2WQY B;  2GMI C;  1B9R A;  5IA7 A;  3I9V 1;  3RYT A;  1TZO A;  2EMS A;  2KWV B;  4EZJ A;  2N9K A;  2WXI A;  1XXG A;  2KMA A;  3ZJT A;  1IGC A;  4BBN C;  2PJH A;  1RM6 C;  2BVC A;  1ENF A;  4BKG A;  3PHX B;  2KDF B;  3NZS A;  2Q5W D;  4B0M A;  2V3S A;  1FRD A;  5HG2 A;  3BY4 B;  4C4V B;  4OVV A;  2MH7 A;  1E8Z A;  3ZIM A;  4PT5 A;  2BQQ A;  3MTN B;  2ZNV C;  2BGF A;  3LB8 C;  2A4Z A;  2J7Q B;  3AE3 B;  2C7N B;  2RDH A;  3CMM B;  1R4M B;  3DPD A;  1FPY A;  3TBL D;  1TGZ B;  1YNT E;  3M63 B;  2MBH A;  2WDQ B;  4MEL A;  4P16 A;  1YN5 A;  2WP9 B;  2LGS A;  4W9D A;  1RFA A;  1EM7 A;  4AOF A;  5LNK 1;  2CJN A;  3IT6 B;  1V86 A;  1Y8R C;  1C79 A;  1V1P B;  1Q1O A;  3Q6B A;  4KDI C;  4AP4 C;  3UQB A;  1K52 A;  3IHP C;  1DYQ A;  2CU3 A;  1TBE A;  3DHG C;  1L5P A;  2FCQ A;  3IAM 1;  1EF5 A;  5LLI A;  4MJS B;  3ZJU A;  1WZ0 A;  2QEJ C;  2WXO A;  4ZOH C;  2WU2 B;  5DCN A;  3JYU A;  2Y5C A;  1RFK A;  2LGX A;  2N9X A;  3P63 A;  1XLN A;  2K25 A;  1C4P A;  4PS3 A;  1WGY A;  3T9L A;  2IZV B;  4C00 A;  3W5V B;  1OGW A;  4XC2 A;  4AQ7 A;  1P7F A;  3SHQ A;  1SB3 C;  4IWP A;  2LVQ A;  4KZC A;  1XO3 A;  2CHZ A;  2KFK B;  1RWS A;  2D3G A;  4K81 A;  3U4E G;  5CTR C;  5C3J B;  3GZN I;  4KDL B;  2BYF A;  4RFB A;  1GJZ A;  2BBC A;  2V3P A;  4AJW A;  2VH1 A;  1J7C A;  4KGR A;  1JRU A;  1MHX A;  3ZUN A;  1AN8 A;  4IKG A;  2X38 A;  4HPL B;  2OHF A;  3DWG C;  2WXP A;  1TS3 A;  2Y3A A;  3FKY A;  1D5Z C;  1D5X C;  3AU4 A;  1ZP0 B;  5CX3 A;  2AWT A;  2MW5 A;  1VR9 A;  3A4S C;  2K39 A;  2KWU B;  4HPP A;  1P1A A;  1F2R C;  1V9J A;  3I57 A;  1V2Y A;  3T3N A;  1ZXH A;  2MJ3 A;  4S17 A;  1T3Q A;  1N61 A;  3ZQ4 A;  2Y5B B;  1E9M A;  2RDG A;  2M56 B;  2WDV B;  3QCA A;  1E8W A;  5FKA C;  1Z2M A;  3Q8A A;  2JSV X;  4W9H A;  3B08 A;  2XK5 A;  3TSS A;  2V4I B;  1BT0 A;  1GC7 A;  4Q2J A;  1MG8 A;  2KHW B;  3R3M A;  3AEA B;  2BT6 A;  3A33 B;  4NAM A;  4L23 A;  3L54 A;  3L4P A;  4M0W A;  4LNF A;  3X23 A;  3U2S C;  2KAJ A;  4DHZ B;  3AB5 A;  1T6B X;  3ONS A;  1ZGU B;  1T0Y A;  1WJN A;  3H7P B;  2GLS A;  4IM0 A;  3ZNI D;  3PV1 A;  4DK5 A;  5EE0 A;  2JUO A;  3DVG Y;  2IO0 B;  4LTU A;  2NPT B;  3ZNG C;  2ZPY A;  2DEN B;  3X0W A;  2N0S B;  4L2Y A;  4WAA A;  3E56 A;  4RF1 A;  3ZRC A;  5BMG A;  4LJO B;  4QAY A;  4HWI B;  1V8C A;  1WGD A;  3OG5 A;  1FIQ A;  4CYE A;  2AL6 A;  3DBR B;  4II2 B;  1OTR B;  4GSW A;  1SE4 A;  2MLB A;  4F7Z A;  1WRI A;  2QMT A;  1L0V B;  5BYR A;  1EF1 A;  2WX0 A;  4TMA B;  1FM0 D;  3PZD A;  5H8Y E;  4HVB A;  4FJY A;  3L10 B;  3RNB C;  3NZU A; 
#chains in the Genus database with same CATH homology
 3C8Y A;  4XWT A;  1HQR D;  4NAW B;  2WNM A;  1OQQ A;  3BZD B;  1SBB B;  3BWU D;  2H88 B;  3SFE B;  2GRI A;  4ARI A;  3R2T A;  3E9S A;  1I4R A;  1UNS A;  2W3R A;  4RGM A;  3PZ8 A;  3AE8 B;  1GAQ B;  1YN3 A;  3NVZ A;  1QOA A;  4DXG A;  1ET6 A;  5I4D A;  1C76 A;  3AEF B;  3LXF A;  2WXN A;  1VRA B;  1I4H A;  3O13 A;  1FO4 A;  3BVG A;  2PMV A;  1PYW D;  1YJJ A;  2QIE B;  2ACZ B;  1ZDX A;  2WXM A;  4WQM A;  5HFY A;  3ABV B;  1YQ4 B;  5HHD G;  4HEA 1;  1JRP A;  1JW9 D;  1STE A;  4GDK B;  2W54 A;  2BW2 A;  4KGT A;  3Q8B A;  4WH4 A;  4WAF A;  1C78 A;  1KFY B;  2INN E;  3FAH A;  1N60 A;  4B0E A;  4YTP B;  2V3N A;  4OZB A;  1N63 A;  4YTM B;  1V1P A;  1JWM D;  4XE0 A;  5MPO A;  4D2K A;  2L52 A;  2K0P A;  1WSP A;  1HXY D;  2W55 A;  1I4P A;  1F0Z A;  3MP9 A;  4JX1 C;  1CK1 A;  2XNA C;  1JWS D;  1E0Z A;  2IPK D;  2L32 A;  3KWV A;  4GLS C;  3IAS 1;  3P4P B;  2JWU A;  1EWY C;  2WXF A;  3ZYY X;  4RF0 A;  1WWT A;  1I4X A;  1IBX B;  4RGO S;  3TEW A;  1UUP A;  1TJE A;  2WXL A;  1JML A;  1CJE A;  1GTE A;  1OQR A;  1TKG A;  2BS2 B;  2JX5 A;  4HJG E;  4JE3 B;  3W2D A;  2WDR B;  3NZ3 A;  4KGS A;  2W82 A;  5E6J A;  2IJ0 A;  4JPS A;  2LEK A;  5EE3 A;  3H8H A;  1ZUD 2;  2PLP A;  2LUM A;  1QLB B;  4A6Q A;  2WLB A;  2LFI A;  1VJK A;  3KQ4 A;  3HVD A;  3AE5 B;  1FEH A;  4ZRQ A;  1AW7 A;  1QIL A;  3OWE B;  1L0Y B;  1K53 A;  5G5G A;  1E10 A;  1JAL A;  2PIA A;  2HTM E;  2BS3 B;  1QKZ A;  1WXQ A;  3BYY B;  4N59 A;  2EEL A;  2FBW B;  5T8I A;  1VZ6 A;  1WGK A;  5BMH A;  3AE4 B;  4WWM A;  1EWC A;  4OHJ A;  1ZPS A;  3FIL B;  1K51 A;  1SE3 A;  2K3U A;  2LHE A;  2K22 A;  4YSX B;  1QF6 A;  3EGR A;  2OED A;  1IUE A;  1Y56 A;  4O1N A;  1XF5 L;  1GPX A;  3HUI A;  2EKI A;  3LYY A;  3AED B;  4TQ1 A;  3MFG A;  4YTN B;  1QOG A;  4RNA A;  5D7G A;  2Z8L A;  3RPF C;  1AWD A;  1DGJ A;  3EA6 A;  3P42 A;  3FC4 A;  2B76 B;  1HZ5 A;  4NZL B;  4GDL B;  1XLP A;  1V97 A;  1TY2 A;  2D5G A;  4RCO A;  1XEE A;  4YSZ B;  3B2G A;  1IGD A;  3KWL A;  1QT9 A;  2ON8 A;  1KH0 A;  4LLG M;  2LGI A;  4H2A A;  5HI1 A;  2YEP B;  4N6E B;  2LJI A;  2DBY A;  1GT8 A;  4XDC A;  2NMQ A;  3AEG B;  1VZ8 A;  3U7Z A;  2N7J A;  1FRR A;  2J53 A;  2I38 A;  1ACC A;  3B9J A;  1QOB A;  1J7A A;  2AQ1 B;  1SE2 A;  3AV8 A;  4ZYS A;  1NEK B;  3AM9 A;  3KLS X;  1NVI D;  1PGB A;  5C2T B;  3TEZ A;  3AEE B;  3NS1 A;  4OZA A;  2G1E A;  1XLO A;  3V05 A;  1KLG D;  3MC0 B;  2R61 A;  2KWD A;  1HA5 A;  1SJE D;  3VR8 B;  4A8X C;  1L4D B;  2ONQ A;  3W5U B;  2ZW0 A;  2WXR A;  4EE2 A;  3AMZ A;  2FUG 1;  1TKE A;  3B2F A;  5H92 C;  3R8B A;  4ZHP A;  4JWS C;  1NI3 A;  2WQY B;  1DOY A;  1B9R A;  3I9V 1;  3TEX A;  4C56 C;  1DOX A;  1B1Z A;  4IOI E;  1TZO A;  3BVM A;  2DLB A;  1XCQ L;  1SF0 A;  2N9K A;  2WXI A;  1XXG A;  2WXG A;  3ZJT A;  4ZRP A;  1I7H A;  3Q8E A;  1F2R I;  4HRO A;  1D6E C;  1IGC A;  4A90 A;  3HRD D;  4DXF A;  2YEP F;  4WUR A;  1PUT A;  2DYM A;  4J3O D;  1RM6 C;  1WYG A;  3SR6 A;  1N5X A;  1ENF A;  1QQR A;  1JWB D;  2KQ4 X;  4HKQ A;  5G5H A;  3J9C A;  1PFD A;  2KN4 A;  2LHD A;  3URY A;  3UI3 A;  2Q5W D;  4B0M A;  4REZ A;  1FRD A;  4RGN A;  1K50 A;  1L6V A;  3PO0 A;  5HG2 A;  1HZ6 A;  2M0A A;  4YWG G;  2MH7 A;  1FNW A;  4PT5 A;  4MT5 A;  1T5X D;  1TS5 A;  3SEB A;  2BYT A;  2IGH A;  2WU5 B;  2E3T A;  3VRB B;  3AH7 A;  2V0G A;  3LB8 C;  2GB1 A;  2QJL A;  4C7Y A;  3AE3 B;  2MEK A;  5BYS A;  4ITK A;  1L6U A;  2RDH A;  2CJO A;  1E7P B;  2RMM A;  2NTT A;  1FXA A;  1FFV A;  2K9X A;  3R2I A;  1GB4 A;  1JCK B;  4UDU C;  1SSN A;  1YNT E;  1DOI A;  2KMM A;  2WDQ B;  3BVZ A;  4P16 A;  3GP7 A;  2MJD A;  1YN5 A;  2WP9 B;  1C9F A;  4KKI A;  3P4Q B;  1N62 A;  1F77 A;  1BML C;  1ZDV A;  4R3D A;  4C7Z A;  1SEB D;  1LO5 D;  4USA A;  1HEZ E;  2K5P A;  1EM7 A;  5LNK 1;  2BS4 B;  1FMA D;  2CJN A;  3BII D;  3IT6 B;  3IT4 B;  3NVY A;  4HKZ E;  1C79 A;  3P4R B;  1TY0 A;  1ROE A;  1V1P B;  1ZXI A;  1SJH D;  3P1M A;  1P7E A;  1VZ7 A;  2VZK B;  4HRS A;  1K52 A;  2FE8 A;  3TUO A;  2WS3 B;  1AYF A;  1DYQ A;  2CU3 A;  1YJI A;  2HDE A;  3MHZ A;  4XDD A;  3AEC B;  2L1A A;  4OZC A;  5FK9 C;  5EE1 A;  1XLQ A;  1ET9 A;  2KAC A;  2I2Y A;  1L5P A;  3IAM 1;  1I4G A;  1VLB A;  2QIL A;  1D5M C;  3VQI A;  2AX5 A;  3BK1 A;  4P6V F;  1D4B A;  2VZK D;  2ZW1 A;  1NEN B;  3ZJU A;  2PVG C;  2TSS A;  2J52 A;  4YSY B;  2QEJ C;  4IDI A;  2WXO A;  4A9A A;  2JQR B;  3IXS A;  3GS2 A;  4ZOH C;  1FFU A;  2WU2 B;  2L83 A;  2Y5C A;  1RFK A;  3DWM A;  2MJE A;  2AQ2 B;  1M4V A;  3P63 A;  1QOF A;  1XLN A;  4ZHO A;  1C4P A;  3BK2 A;  5D3I B;  3SFD B;  2WXK A;  4MM3 B;  1XCT L;  4MH8 A;  4KX6 B;  2PKO A;  3Q69 A;  3AN1 A;  1JRO A;  4RH6 A;  1L0X B;  3W5V B;  2W3S A;  2BB5 A;  2Y5P A;  4MAC A;  3VRA B;  3BYT B;  4XWW A;  2M19 A;  1IBX A;  4AQ7 A;  1P7F A;  2AQ3 B;  5AUI A;  1SB3 C;  3TEY A;  2IGD A;  3V3X A;  2JZP A;  1C4C A;  3ZGZ A;  1TS2 A;  3W1S A;  1KF6 B;  1XO3 A;  1TS4 A;  4YXD B;  3Q8C A;  1RWS A;  3AE9 B;  5BMI A;  1FCL A;  2QSD A;  3ETR A;  3U4E G;  1H7X A;  3CF4 A;  4CQN A;  5C3J B;  1EU3 A;  3ZJV A;  4RFB A;  2BBC A;  2LMC A;  2V3P A;  1CQV A;  1R7S A;  1NYQ A;  2E6X A;  5BYQ A;  1J7C A;  1UGJ A;  1VDV A;  4TSS A;  3EUB 2;  4KGR A;  3CIR B;  3VR9 B;  1C4A A;  2XN9 C;  4KKJ A;  2N9L A;  4DQO C;  2GI9 A;  2RPV A;  5D3D A;  1MHX A;  2JU6 X;  1RYJ A;  1AN8 A;  1N5W A;  4IKG A;  2X38 A;  5GXG B;  4NJC A;  2BTE A;  2OHF A;  1V1O A;  1FCC C;  4LK0 M;  3FIL A;  3DWG C;  2WXP A;  1TS3 A;  2Y3A A;  3GB1 A;  1D5Z C;  2J42 A;  1D5X C;  4L1B A;  1UWX A;  1ZP0 B;  1FNU A;  4OVZ A;  1KLU D;  1VR9 A;  2PVO D;  1OFF A;  1YN4 A;  1FNV A;  2DYO A;  2KDM A;  2SEB D;  5AUK A;  1C77 A;  1FXI A;  2JXT A;  2J4X A;  1F2R C;  1PDX A;  3I57 A;  2WXQ A;  3T3N A;  1TYG B;  1ZXH A;  2MJ3 A;  1T3Q A;  1N61 A;  1ESF A;  1NYR A;  1E9M A;  3ZQ4 A;  3AE7 B;  1SIJ A;  1J7B A;  3N9Y C;  2RDG A;  4OW0 A;  2M56 B;  5EE9 A;  2WDV B;  3NVW A;  2NTS A;  1GOZ A;  5FKA C;  1JWU D;  3Q8A A;  1TKY A;  2JSV X;  1FD6 A;  3TSS A;  4YT0 B;  2V4I B;  2WXJ A;  4US8 A;  1I4Q A;  4Q2J A;  4FXC A;  1YQ3 B;  3AEA B;  2BT6 A;  1L4Z B;  3P4S B;  3MJ5 A;  1CZP A;  4NAM A;  4L23 A;  2PTL A;  3L4P A;  4M0W A;  1ZOY B;  3PZ7 A;  3Q8F A;  3U2S C;  1MHH E;  1PGX A;  2KAJ A;  5TSS A;  1H7W A;  1E6E B;  2WXH A;  1JWA D;  4RGT A;  3CWI A;  3AB5 A;  4C80 A;  1MVK A;  1T6B X;  1MPE A;  2SAK A;  3NUH B;  4US9 A;  2DWQ A;  5JXV A;  3AE2 B;  1BUI C;  1PGA A;  5EE0 A;  4LTU A;  1Q10 A;  2ICI A;  1GTH A;  4AS1 A;  1JQ4 A;  2N0S B;  3NVV A;  4ARC A;  1YMH E;  4L2Y A;  5FR3 A;  1SXT A;  3NRZ A;  3AEB B;  4JWU C;  2JYT A;  4A55 A;  3E56 A;  4RF1 A;  3AE6 B;  4N58 A;  4WIP A;  5BMG A;  3WCQ A;  1A70 A;  1EU4 A;  2G9H D;  1KTK A;  1V8C A;  1FIQ A;  1UWM A;  4TQ0 A;  1MI0 A;  3T3O A;  1SE4 A;  2INP E;  3RFZ B;  1BXT A;  2IGG A;  1WRI A;  2H89 B;  2QMT A;  3U52 E;  1L0V B;  5BYR A;  2IDY A;  4TMA B;  2PW9 A;  1FM0 D;  3W9C B;  5H8Y E;  3HVZ A;  2BB6 A;  1KRH A;  3AE1 B;  1GB1 A;  1ZE3 D;  2JYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...