1ZOYB

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
total genus 66
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1zoyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zoyB01
1N62A 4WWMA 5C2TB 2ACZB 5MPOA 1GPXA 1ROEA 3CIRB 1FFUA 1T3QA 2WQYB 1QOGA 2WLBA 4YTMB 1E10A 1JQ4A 4KX6B 4YSZB 1OFFA 2MJ3A 3KWLA 2MJDA 3AB5A 4USAA 5EE0A 1JROA 1FXAA 2PVGC 1WWTA 3FC4A 1QT9A 2N0SB 3VRBB 4ZHOA 2PVOD 3AEBB 2WU5B 3HRDD 1FIQA 1E6EB 3B2GA 2PKOA 3VR8B 1J7AA 1F0ZA 2PIAA 1YQ3B 2DBYA 1ZP0B 3LXFA 5AUIA 3CF4A 3AE2B 1OQRA 1IUEA 5H92C 1NENB 1L6VA 1DOYA 4P6VF 1QLBB 1GAQB 4US9A 1XLNA 1N5WA 3ETRA 1VDVA 3AEFB 2HTME 1GTHA 1AYFA 1JW9D 1ZXIA 3W5UB 4N59A 1I7HA 5GXGB 1H7XA 1OQQA 3W5VB 3P4RB 3NRZA 2L52A 1H7WA 3AE4B 2K5PA 1YJIA 1JRPA 4JX1C 2LEKA 3AV8A 1DOIA 1KFYB 3WCQA 2WDVB 1EWYC 1NEKB 3AE5B 3AEGB 1RWSA 2QIEB 2WS3B 4YSYB 1CZPA 2H89B 1J7BA 1FXIA 2MH7A 1E7PB 1NYRA 1NYQA 1V97A 1PDXA 3NVZA 2WDQB 3ZYYX 3AE7B 1R7SA 2CJNA 3RPFC 3P63A 1JWAD 2DWQA 2BS4B 3AM9A 2MJEA 1E9MA 4ZOHC 2CJOA 3PO0A 3NVYA 3SFDB 2Q5WD 1DOXA 2W55A 1WYGA 4YT0B 3BIID 3P4SB 1ZUD2 1FRDA 3AE3B 4ZHPA 4C80A 1SF0A 2JQRB 2KMMA 2H88B 5EE3A 1FFVA 3P4PB 1KF6B 3AEDB 1KRHA 3AH7A 4IDIA 4ITKA 3CWIA 3W9CB 2OHFA 4LTUA 1TKYA 1FMAD 1VLBA 1AWDA 3SFEB 1J7CA 3NVWA 3DWMA 3AE9B 1V8CA 1XLOA 2E3TA 3DWGC 3AE1B 1GTEA 3FAHA 3VR9B 3P1MA 5C3JB 1SB3C 3B9JA 4JWUC 1N63A 4A9AA 1JWBD 2KAJA 3NVVA 4HRSA 1E0ZA 1TJEA 1QOFA 1N61A 4N58A 1B9RA 1TYGB 1A70A 1RFKA 2JX5A 1L5PA 1RYJA 1FRRA 2L83A 1NVID 2W54A 5EE1A 3SR6A 1QOBA 3AECB 4YTNB 5H8YE 1PFDA 5G5GA 2BS3B 2M19A 2Y5CA 4YTPB 1WXQA 5EE9A 2K9XA 2M56B 4HROA 3AEAB 1GT8A 3AEEB 4YSXB 2QJLA 1ZOYB 1XLPA 1DGJA 4YXDB 1TKGA 2K22A 3AN1A 1YQ4B 2W3RA 3HVZA 3NS1A 1XO3A 2G1EA 1SIJA 2W3SA 3VRAB 1FM0D 4C7YA 1QOAA 3LB8C 3L4PA 2WDRB 4WQMA 1N60A 2AX5A 4US8A 1WGKA 1FO4A 1JALA 1NI3A 1XLQA 1RM6C 3B2FA 1TKEA 1YJJA 2B76B 1PUTA 3AE6B 3EUB2 4C7ZA 1QF6A 3AE8B 4FXCA 4JWSC 1N5XA 5G5HA 4N6EB 1UWMA 2BT6A 2BS2B 5AUKA 1VJKA 1L6UA 3P4QB 2WP9B 2CU3A 2EKIA 1WRIA 3AMZA 1CJEA 2FBWB 2WU2B 3HUIA 1L0VB 3ABVB
chains in the Genus database with same CATH superfamily
2JWUA 1UNSA 2LI5A 4IM3A 4EE2A 4XX5A 4NPNA 1F52A 2WNMA 1QOGA 2GBMA 3RZWC 4KX6B 3KVFB 3L10B 1PYWD 2V4LA 4L2YA 2N0SB 2Y3AA 5G55A 1J7AA 1DOYA 1ESFA 1NENB 2KOXA 1QLBB 2N4FA 4JGHB 2FIDA 5GXGB 3ZLZA 4RFBA 1XXGA 3A4RA 3ZIMA 2ZVOA 1WGHA 2NTSA 2MBEA 3P63A 3KH0A 3PO0A 4IOIE 5IA7A 3NVYA 2KDMA 3PRZA 1FPYA 4LNOA 4B95A 3KUCB 2QDFA 2LGDA 4ZHPA 3AE3B 1K50A 1CK1A 2CS4A 4BZAA 1KOTA 4LTUA 1F77A 2K6QA 2LVPA 4LK0M 2DHZA 4QAYA 2O6VA 3VTUA 4M8NA 1IPGA 2KQSA 2W82A 3EA6A 1J19A 3DVGY 4N58A 4XE0A 5TR5A 2L83A 1BUIC 1QOBA 2MP2A 5HKHA 2KC1A 5BYSA 3ZJVA 3AN1A 3ZXRA 4J6IA 2I1JA 4NNJB 1XO3A 4DXAB 4EUTA 3UIPB 1GC6A 3DHIC 4EZJA 2C7MB 4HKQA 3V61A 3AU4A 3NZ3A 4IC7B 2NBUA 2EKIA 3IXSA 4AJWA 3N1YC 2DZIA 4ZRQA 4WAAA 2MP2B 1EU4A 3AXCA 2KN4A 4HPMB 2DZMA 4W9EA 3M3JA 2KQ7A 4NQLB 4B9KA 2ZNVB 2INNE 3L13A 4P6VF 2N7EA 1ACCA 3W5UB 3P2BA 3PPAA 1OQQA 3DHGC 2BVCA 5FR6A 1RFAA 5J2RA 3AV8A 2FNJB 1J8CA 2JYEA 4W9CA 1L4DB 4N9F4 5D3DA 3RI7C 2D3CA 3ZYYX 3RZFA 4EZLA 2BS4B 2ASQA 3RUIB 1E9MA 4PK1A 2GI9A 2W55A 3U30A 4P1BC 1R4NI 4LNIA 1NDDA 2UWQA 5EE3A 1P98A 3CWIA 4F1SA 2C7NB 1FMAD 4HDQA 4ANWA 2M4NA 2QCZA 4KDLB 2RDBC 4P7IA 5DPRA 3FAHA 4IUMB 4REZA 1QOFA 2AL3A 4HLEA 1PGBA 1C4PA 2KJ6A 2KACA 3IT6B 4ICUA 4G0NB 3TIXA 2DX5B 2IY1B 4NJ6A 3ZTCA 4ZRPA 2EKEC 3LDZE 1DGJA 3ZNHB 2W3RA 4ANUA 1D5XC 2KDIA 4HCNB 4C7YA 3R66C 4BVUC 2INDC 2ZW1A 3ZDTA 4KKJA 3RNFC 4AS1A 2N9LA 4WJPA 5AUKA 3E9SA 2ICIA 3B9JA 1FXIA 2LRUA 1UGMA 4GDKA 1I4QA 1WGDA 3HM3A 1I4XA 1T3QA 1K53A 4YSZB 3UINB 4M01A 4B0MA 2NS5A 1UGJA 3ML9A 2JXTA 5IAAC 1YQ3B 5G2NA 1WM2A 3EGRA 5H92C 5E6JA 2GBKA 2JRHA 1GG3A 1MPEA 2FE8A 2EMSA 4G3XB 4FLHA 3P42A 3PLVA 1WGGA 1YX5B 1C79A 2O2VA 1ZDVA 4GDKB 1TS2A 3ZKJC 4MGYE 3QA8A 2GBNA 3TSSA 1TT5B 1C78A 2QMTA 3ZRFA 2CJOA 2DENB 3WANA 4URKA 1DOXA 1E8ZA 4RM9A 2KMMA 2KYWA 4ARIA 1T6BX 5BYRA 2BKRB 5LXHA 3UQAA 2AEHA 2KC2A 2OJWA 2BB5A 1ZE3D 2DLBA 1BT0A 4A9AA 1GC7A 1V86A 2GOWA 3WA0A 4FULA 1U4AA 2LGIA 1T0YA 1L5PA 2O2VB 1NVID 4DK5A 1C76A 2Y5CA 4K7SA 2B3AA 3PT2B 4RCOA 1GJZA 2N7DA 2PJHA 3MJ5A 1TBEA 2MRPA 3I5JC 1EO6A 2Z59B 2J53A 2W3SA 2V3SA 1VRAB 1TZ1A 3PZDA 4EZKA 3ZNZB 3X0WA 3RNEC 2BS2B 1IGCA 1VJKA 5BMHA 2WP9B 4GMVA 2LHDA 4H2AA 4TQ0A 1TGZB 2KHWB 5AEKB 3GS2A 2WHIA 3HIZA 2NBVB 3SU8X 1D3ZA 3WIMA 4PS8A 2MJDA 3AB5A 3VQIA 3QCAA 2KDEB 3PZ7A 4ACFA 3AEBB 4A3PA 2HE7A 3SD5A 3LXFA 1IUEA 1L6VA 2LGSA 4US9A 2KKCA 4BKSD 1WGRA 2HTME 2R61A 1AYFA 3H7SA 2M0AA 1ET9A 2WXQA 4HCPB 2ZCCA 3DCGA 3MTNB 4CO7A 1WM3A 3DVNU 1YX6B 2K3UA 2KQ4X 2Y5PA 3KUDB 5L83A 2AWTA 3GB1A 3AEDB 1WR1A 4ITKA 3AH7A 1GB1A 2WXOA 1SIFA 1YN3A 2DNFA 3DWMA 4S17A 3R8BA 4JE3B 3VR9B 4BKGA 4KGTA 2ONQA 2LJIA 1RYJA 3BVMA 4A90A 3KLSX 4XDDA 3BVZA 4CQNA 4OZCA 1R4MI 5D7GA 1KLGD 2RPQA 1YQBA 2G1EA 2DAJA 3RCZA 2WWZA 3W2DA 1FO4A 3LYYA 1F1HA 5G5HA 5JXVA 4PT5A 3O13A 5BMGA 2BTEA 3P4QB 2CU3A 5KHQA 2IYDB 2I2YA 4XYCA 2WXJA 1WSPA 2Z0DB 2ACZB 1WJNA 2WX0A 1WE6A 5EE0A 4MGKE 1KM7A 4HPLB 4IWOA 2BF8B 1F0ZA 4KZCA 4E3CA 4M8MA 1HXYD 1MG4A 1GTHA 4N59A 2L32A 1M94A 2LEKA 1D5ZC 3ZUNA 1NYRA 3DDCB 1P3QU 1FD6A 4W9IA 3AE7B 4ZRJA 2N1WA 2PEAA 2KJHB 1FXTB 2WGSA 1ENFA 1UH6A 2JPHA 4YT0B 4JPSA 3P4SB 5IP4D 1YN4A 4L23A 2KWDA 3P4PB 1KRHA 1LQBA 3J9CA 1XD3B 2IGHA 3AE1B 2C60A 2GBRA 4JWUC 2J0JA 1UBIA 4AUQC 4P16A 3OWEB 1PQSA 3SR6A 2ZEQA 3VHTC 1WXQA 1K52A 3AEAB 1XCTL 1WR6E 4AWJA 4W9DA 4YSXB 2QJLA 3QHTA 4IW0A 4M00A 2LHEA 4LJOB 1JWMD 2LGXA 1RM6C 1L4ZB 1Q10A 1YJJA 3AE8B 2MSED 4JWSC 3ENEA 2JXXA 2IBIB 2Z0EB 4PS3A 5EDSA 3MHSD 2JUOA 2J0MA 2QC8A 3ONSA 3ZXVA 3MC0B 2WDTB 3NG0A 2WXGA 4ICVA 2GBJA 1Q5WB 4TQ1A 1SJED 1FIQA 1GOZA 2REXA 1R4NB 5AUIA 2M0XA 1WZ3A 4KIKA 1JW9D 3UI3A 1EF5A 2ZJDA 1H7WA 3I63C 3V62A 1YIWA 3HHMA 1JRPA 1TZOA 2KMAA 1UBQA 4MJSA 3JYUA 5J17A 4FJYA 4I6PA 3I3TB 2DWQA 3VVWB 1SSNA 5D3IB 4D2KA 1D5MC 1FRDA 4K1RB 2KVZA 2ZW0A 2UU7A 1TIFA 2D2QA 3VH3B 1P1AA 4AJYB 3AE9B 3NUHB 4KIKB 4A20A 2BYVE 4I6LB 1WGYA 1TJEA 1WXVA 2BW2A 2L3ZA 3GE3C 4KGRA 1TY2A 1JRUA 1S3SG 4MJSB 3TUOA 5KHOA 2NMQA 4HROA 2HJ8A 1WMHB 3Q6BA 3M63B 3PHWB 4WAFA 2XBBC 3QC8B 3RNBC 2KWUB 1WJUA 1C77A 2B76B 3TEZA 1HA5A 1I42A 2JF5A 3HUIA 4MELA 1I4GA 2K6DB 1ROEA 4FA6A 4USAA 4MGZE 4PS7A 3B2GA 5HHDG 1HTOA 2N9KA 1OQRA 4A3OA 3AEFB 3U2SC 4GU2A 5T8IA 2WXHA 2KDBA 3NRZA 3AE4B 3CMMB 4JX1C 4W9LA 2OOBB 3CF6E 3MFGA 5DCNA 1KFYB 1EWYC 3AE5B 4DDID 2L0FA 2IZVB 3K9PB 1NYQA 2AL6A 4ZRIA 3RPFC 4P1CC 2FCSA 4F7ZA 3RNCC 3OLMD 1ZW7A 3IAM1 2VZKD 3PGEA 3AU5A 1SF0A 2FCQA 5TSSA 2YLMA 2CU1A 3WAOA 4K3CA 3TMPB 4HJKA 3MHZA 2L76A 2WXIA 1JWBD 3IT4B 4HRSA 3W1YA 1TYGB 1A70A 1SEBD 2D11A 4NJ7A 2V4IB 5IOIA 5EE1A 3AECB 1T0QC 1PFDA 1WIAA 4PYUA 1XQQA 1XF5L 2AQ3B 4OZBA 4G11A 2IO3B 4LCDE 2YVCA 5J18A 4EFOA 1QOAA 1XT9B 2K0PA 4FHJA 3EUB2 1QILA 3NZSA 2WX1A 1LGRA 4FN2A 2N9PC 4LNFA 4W9KA 4WWMA 2INPE 4A55A 2WQYB 3QWZB 3KYDD 3T9LA 3N30A 4FHKA 2PIAA 3GOEA 2PE6B 4KKIA 3L16A 2CR5A 2AYOB 4Q2JA 3ETRA 2KK8A 3BK1A 1I7HA 2TSSA 1H7XA 4EKUA 3L17A 2LASA 4AOFA 5LLIA 2RSUA 4ZDVA 2JU6X 2L8JA 1T0SC 2W9NA 1UD7A 4X57B 2LMCA 3QAQA 4BKTA 3QX1A 4F8CB 1JWAD 1R4MB 2VRRB 3BK2A 1LXDA 2BBCA 5JHAA 1MHHE 3PTFC 1V49A 3AI5A 3BIID 3DOWA 3H1UA 2OHFA 2RR9A 1VLBA 5IO9A 1EWCA 1C4AA 1V8CA 1X1MA 1N63A 2N1VA 3NVVA 3RFZB 1Z2MA 4E74A 2I1KA 4JQWC 3N32A 1FRRA 2W54A 2IDYA 2VZKB 5H8YE 1K51A 4DXGA 3EHVA 4MM3A 4RF0A 4II2B 4HK2A 1GNUA 2V1YA 3E56A 2JZZA 3RNAC 1PGAA 2K1FA 1XLPA 4WWNA 1YQ4B 3PRMB 3CSFA 1TS3A 3V6EB 3I57A 3ECIA 3LB8C 2WXMA 2WDRB 4US8A 1Z5SB 4AQ7A 1WXSA 4KSKC 3OG5A 4ANVA 2KNBA 1MVKA 2BB6A 4W9HA 1VR9A 4DHZE 1YJ1A 3BYTB 2J7QB 2ZVNA 2C5LC 1WF9A 4J3OD 4GN1A 3CIRB 4EEWA 4YTMB 4MDKE 3PV1A 2K39A 4JIOU 4MM3B 2DYOA 1HEZE 1GB4A 4ZHOA 2WU5B 2PW9A 1SBBB 4NZLB 4C4VA 2K25A 3L08A 2LVQA 4C00A 3NY5A 4RMAA 2ZPYA 2ZZPB 3A4SC 2L52A 2MHJA 3DPDA 3QJZA 1YNTE 2LD9A 2IO2B 3ZTDA 1D4BA 3QQ8B 2NBWB 2SEBD 1ZDXA 1TY0A 3PSEB 4GLSC 4G50A 4IKGA 5BO4B 3RMKC 1I4RA 1WFYA 3B0AA 1ZXHA 2GLSA 1SXTA 2JQRB 2V3NA 1OTRB 1MI0A 4C4VB 3U52E 5AZFA 3V6CB 3DBHI 1B1ZA 3R7QA 4BOSC 5L95C 2J0KA 4IWPA 2X38A 1P7EA 2RPVA 4OW0A 4C56C 5EE9A 2JZ3B 4EOYA 4FBJB 2DYMA 1GT8A 5CX3A 4R3DA 2X8XX 5D2MB 3K9OB 1OEYJ 3VRAB 1JMLA 2JY6A 3Q8BA 2KX3A 3L4PA 4WQMA 1N60A 4OZAA 4L1BA 3RULA 3NJTA 4OVZA 1OEYA 1WZ0A 2BQQA 2QHOA 2KN5A 1WRIA 2QSDA 1CJEA 4TSSA 3TBLD 3ZO5B 3ABVB 4W9JA 5DPTA 1WH3A 4KV2A 2G3QB 3Q69A 1V5TA 3ZRCA 4BOZB 3VRBB 1J0GA 1H8CA 4NY0A 1L2NA 2HJ1A 3VR8B 2G4SA 4DHJD 5E6PA 2MBBB 1RRBA 4E71A 2V3PA 4RGMA 3TEWA 2WYQA 1ZXIA 2KO3A 2KFJA 2PE9A 2INCC 2ZPNA 2L00B 3W1SC 3Q3NC 1IYFA 1SE3A 1PDXA 2J42A 4IG7B 2IJ0A 3L54A 1K8RB 3PZ8A 4FJVB 4WH4A 3BWUD 2FCMA 2KWCA 1ZUD2 3VUWA 3IBEA 3UIOB 1UELA 1L0XB 3I9V1 4WJOA 4DDGD 1JWUD 3N9YC 1PGXA 4MEMA 5C1ZA 1FNUA 1RAXA 2KFKA 3TJPA 2KWVB 5CHVC 2L1AA 1E0ZA 1V81A 3Q3MC 2JRIB 1S1QB 1FNVA 3EC8A 4YTNB 1F2RI 2EELA 2KT7A 5E6NA 1VZ6A 3D32A 1F2RC 4TKNA 2DYBA 4YXDB 2K8BA 3H6NA 1DYQA 3IFWB 3NS1A 1BXTA 4OHJA 2KLGA 5CTRC 1N6ZA 3B2FA 2LZ6A 4FXCA 3SEBA 1V6EA 2KFKB 4HXDA 3MJWA 2WU2B 2OJRA 3QK0A 1KTKA 5MPOA 2PLPA 1FFUA 2WLBA 2JSVX 3IHPC 1I4PA 2PVGC 2PVOD 3BINA 2RMMA 3TEXA 3Q8EA 2DZKA 3DBRI 4RF1A 2DZJA 3CF4A 3AE2B 4MH8A 2K8HA 2RDGA 2KTFA 3SDLC 1MG8A 2YEPF 3Q8AA 1D6EC 3ZDMC 1RWSA 2QIEB 4LLGM 4NJCA 4LJPB 2WDQB 4HWIB 1R7SA 4DHJB 4ZOHC 3X23A 3VTWA 3MC8A 1OGWA 1FFVA 2JVCA 2C9WB 1SGHA 2MLBA 2GRIA 3SFEB 2VH1A 2WXLA 1T0RC 3KYCD 1XLOA 3EECA 1EM7A 1SB3C 2A5UA 2KLCA 2LFIA 1HZ5A 1EUVB 3BZDB 4GOCA 1E8XA 1WMHA 4IWQA 3ZNGC 2M19A 3JSVB 4GB9A 3ZJUA 4WWOA 1EU3A 4I6NB 1ZOYB 2MBOA 3GZNI 1FEHA 1HQRD 1HTQA 4B6WA 2VH2A 2JZPA 4LNKA 3N3KB 3FKYA 3U7ZA 2LUEA 2AX5A 1WGKA 1JALA 1XLQA 1QF6A 2MBQA 1E90A 1I4HA 1L6UA 3H8HA 4GGQA 1L7YA 1ET6A 3AMZA 1L0VB 1V2YA 4TMAB 3IAS1 1WI0A 1GPXA 1YN5A 4ASWC 2R2QA 3UF8A 1JROA 3OAWA 1FNWA 1VZ8A 1FCCC 4GIVA 1E5WA 1WX8A 4DWFA 3TL5A 2CHZA 4IM2A 1ZPSA 2BWES 2IGGA 2A4ZA 2RD0A 4ZRKA 5FK9C 2G4DB 1V1OA 1VZ7A 2V9HA 2MCNB 3EFUA 3C19A 3UGBB 3WCQA 2WDVB 1NEKB 3AEGB 2MW5A 1CZPA 2JYTA 1TTNA 2MH7A 1JCKB 4RNAA 2NCNA 4OVUA 3AM9A 2LJ5A 3SFDB 3OJ4B 1SE9A 3TEYA 2Z8LA 4C80A 2K8CA 4KDIC 2KD0A 2KZRA 3APDA 3O65B 2PPHA 1F9JA 3VTVA 2D3BA 4KZ0A 2E3TA 3U4EG 1GTEA 3Q3FA 4DHZB 1Y8RC 2BYFA 2LXCA 3DQVA 3DBLI 4XDCA 5LNK1 2JX5A 2J4XA 4XWTA 1KJTA 2O6VB 4HPPA 2BS3B 1FCLA 1WXMA 3VUXA 2LVOA 4MSMB 4TUUA 1TKGA 2K22A 1WRDB 3QIJA 1BMLC 4W9GA 3H9DA 2R2OA 3PRPB 1WX7A 3B1LX 3AE6B 4ZYSA 4W9FA 3CSTA 1AW7A 1QQRA 2V0GA 4LDTD 5D94A 1L0YB 3ZVVA 5DPSA 2WXKA 4BBNF 3KWVA 1JQ4A 5CHFA 1GUAB 2LUMA 1WWTA 3VFKA 1QT9A 3ZW3A 3HRDD 2N7JA 3T3NA 2DBYA 1V5OA 3BYYB 1SE4A 1GAQB 3Q3JA 1N5WA 2FAZA 3DBHB 1V80A 4XC2A 3T3OA 4TV3A 2XN9C 4RGTA 2FUHB 2M1MA 3IVFA 1J7BA 2Y5BB 4GSWA 3NVZA 1OQYA 3EFCA 2CJNA 3C0RB 4M0WA 3ALBA 1LO5D 5DPWA 2Q5WD 3GP7A 1M4VA 4DBGA 2C7HA 1ZGUB 4LNNA 4RGNA 1KF6B 3RN9C 3W9CB 1ZKHA 2XNAC 2NTTA 3V3XA 2D3GA 3W1SA 1C4CA 2HTHA 4M02A 1UF0A 4YL8A 1SJHD 2RGFA 3Q14C 4A6QA 3WALA 3ZQ4A 4XGAB 2KMCA 4GDLA 5HI1A 1CQVA 3A9KA 4NQKE 1MFWA 2K9XA 4KSLC 4ARCA 2D5GA 4M0WB 2L0TA 1JWSD 3HVZA 4HKZE 2GB1A 2KX0A 3BY4B 2KJRA 3Q3OC 3UQBA 3NS8A 1NI3A 2CHXA 4BFRA 3N1ZC 2BT6A 1HE8A 2BYEA 2WXPA 4WJQA 2OEDA 5FKAC 1I35A 1CMXB 2DAFA 1N62A 5C2TB 3BVGA 3KUZA 2XEWA 1G6JA 4GDLB 1P9DU 3A9KB 3KWLA 1LM8B 4BBNC 2JT4B 1AN8A 2MX2A 3NHEB 2BYTA 2PKOA 2ZCBA 4WIPA 1ZP0B 3APCA 5E6OA 4LDTB 2FCNA 2NR2A 3VXWA 3PVLA 3W5VB 1QKZA 3AULA 2K5PA 1STEA 2HDEA 2IGDA 2D07B 1E7PB 1V97A 5CHWA 4RM8A 3JW0X 3L0WB 4K7WA 3FILA 5HFYA 3M95A 1AARA 2CHWA 1IGDA 4KVGB 2L7RA 2I38A 2H88B 3DBSA 4HEA1 2KXJA 3DHHC 3HK0A 4IDIA 1TKYA 4A8XC 1E8WA 1J7CA 3Q8CA 4UDUC 3NVWA 2ZNVC 5JH5C 3DWGC 1XEEA 3P1MA 5C3JB 2KAJA 2MWSB 1LFDA 1N61A 5AZGA 1UZXB 2FIFA 1IBXA 3PLUA 3URYA 4JLCA 3ZGZA 2KDFB 2FUG1 3C8YA 3GE8C 3ML8A 1VD2A 4GXBA 2E6XA 3ZJTA 3QARA 1P0RA 2KVRA 2KANA 3FILB 2D3AA 1C9FA 3T8MA 3DBRB 1FM0D 5LXIB 4ZYNA 4WQOB 5GMVA 1WJ6A 1WY8A 5AZHA 1E8YA 2HD5B 3MP9A 4CYEA 4N6EB 3ZNID 2MEKA 1UWMA 1EF1A 2NPTA 4S0RA 3A33B 1IBXB 1T5XD 1E10A 3HM6X 4NAMA 2AQ2B 1RLFA 1FXAA 3FC4A 3RT3B 4MH0E 4K7UA 1A5RA 1V1PA 2WXRA 4KGSA 1UWXA 4JL9A 1KH0A 2D10A 1NBFC 1XLNA 4RGOS 2N9EB 1TS4A 3M62B 4YWGG 4XWWA 2BPSA 1YOVB 1H4RA 1YJIA 3SHQA 5I4DA 2NPTB 1DOIA 3VH4B 4NAWA 2GMIC 4MT5A 1C1YB 2G9HD 4CHKA 2J52A 2PMVA 2BKFA 3GZNB 5IN7A 2BGFA 4XZ4A 1V1PB 4WWPA 3S2AA 4PYZA 2WXFA 3RD2A 2QEJC 1KLUD 3PREA 1AWDA 3DVNV 2JWZA 3A9JA 3APFA 3PS6A 2LRWA 4OVVA 1RFKA 4NAWB 1MHXA 4FADA 3N1XC 1E7VA 3Q8FA 5D6JB 5G5GA 3DVGX 4HDOA 2IO0B 3WAPA 4MSQB 5JZEB 2MBHA 4FJZA 4B0EA 3LJ3A 3NZUA 1SIJA 3PHXB 1C3TA 4BKSA 5FR3A 3MC9A 4II3B 2M17A 4C7ZA 1V9JA 4WJNA 1N5XA 3IG3A 3KQ4A 3A9JB 5IKCM 3R7RA 1Q1OA 2MA9B 2YEPB 2IY0B 1QZEA 2FBWB 5BMIA 1MJDA 4HJGE 1IP9A 1VCBA 5C23A 4WURA 2L05A 2AQ1B 1OFFA 2MJ3A 5BYQA 2NVUI 2UYZB 3N20C 3B08A 1E6EB 1WYWB 3R2IA 3V60A 4ANXA 2LXAA 2KTRA 2CKHB 1XCQL 2WXNA 1VDVA 3H7PA 4RH6A 3VUYA 2MQJA 3P4RB 1Y56A 3NOBA 3DBLB 3Q2AC 3VDZA 2WS3B 4YSYB 2H89B 3R2TA 3RNGC 2EMTA 2BWFA 2MJEA 4MGIE 2SAKA 2N9XA 1WYGA 3OJ3A 1WJ4A 1Q0WB 2XK5A 1HZ6A 3TCAA 1E7UA 2IO1B 2KTRB 2QILA 4IM0A 2PTLA 3H7PB 1WX9A 3R3MA 3U8ZA 3JSVA 3A1QA 4DXFA 3U7DA 1B9RA 2RDHA 1YD8U 4MACA 1SE2A 4O1NA 5HG2A 3WAMA 1NI2A 1WXAA 3HVDA 3RYTA 4YTPB 2M56B 2O6VD 2LGYA 3AEEB 1UUPA 3JVZX 4AP4C 4BAXA 2M8SA 4K3BA 3V05A 2ON8A 1YMHE 4DQOC 1WE7A 2XK5B 1P7FA 1TKEA 4HVBA 1PUTA 4K81A 2G45B 5JHBA 1KLVA 1ISNA 1TS5A 2LWPA 2IPKD 3KW5B 3A1QB 3VAWA
chains in the Genus database with same CATH topology
2JWUA 1UNSA 4EE2A 2WXKA 2ACZB 2WNMA 3CIRB 3KWVA 1QOGA 1JQ4A 4YTMB 4KX6B 4MM3B 5EE0A 2LUMA 2DYOA 1PYWD 1HEZE 1WWTA 1QT9A 2N0SB 4L2YA 1GB4A 4ZHOA 2Y3AA 2WU5B 2PW9A 3HRDD 2N7JA 3T3NA 1J7AA 1SBBB 1F0ZA 2DBYA 4NZLB 1DOYA 1ESFA 3BYYB 1NENB 1SE4A 1QLBB 1GAQB 1HXYD 1N5WA 1GTHA 4N59A 5GXGB 4RFBA 2L52A 2L32A 3T3OA 2XN9C 4RGTA 2LEKA 1XXGA 1D5ZC 1YNTE 1J7BA 1NYRA 1D4BA 3NVZA 1FD6A 2SEBD 1ZDXA 3AE7B 1TY0A 2CJNA 2NTSA 4GLSC 3P63A 4M0WA 4IKGA 1LO5D 3PO0A 4IOIE 1I4RA 1ENFA 3NVYA 2KDMA 2Q5WD 1ZXHA 3GP7A 1M4VA 4YT0B 4JPSA 3P4SB 1SXTA 4ZHPA 3AE3B 1YN4A 1K50A 4L23A 2JQRB 1CK1A 2KWDA 2V3NA 4RGNA 3P4PB 1KF6B 1KRHA 1MI0A 3W9CB 4LTUA 3J9CA 3U52E 1F77A 2XNAC 2IGHA 2NTTA 3V3XA 3W1SA 4LK0M 1C4CA 1B1ZA 3AE1B 1SJHD 4JWUC 2W82A 3EA6A 4A6QA 4N58A 3ZQ4A 2X38A 4P16A 3OWEB 4XE0A 1P7EA 2RPVA 2L83A 3SR6A 1BUIC 5HI1A 1QOBA 1CQVA 4OW0A 1WXQA 4C56C 5EE9A 1K52A 2K9XA 5BYSA 3AEAB 1XCTL 1GT8A 2DYMA 4ARCA 4R3DA 4YSXB 2QJLA 2D5GA 3ZJVA 3AN1A 1JWSD 2LHEA 3HVZA 4HKZE 1XO3A 1JWMD 3VRAB 2GB1A 1JMLA 3Q8BA 3L4PA 4WQMA 1N60A 4OZAA 4HKQA 1NI3A 4L1BA 1RM6C 1L4ZB 1Q10A 1YJJA 3AE8B 4JWSC 3NZ3A 4OVZA 2BT6A 2WXPA 2EKIA 3IXSA 2OEDA 1WRIA 5FKAC 2QSDA 1CJEA 4TSSA 3ABVB 1N62A 5C2TB 3BVGA 4ZRQA 4GDLB 3MC0B 1EU4A 2WXGA 3KWLA 3Q69A 2KN4A 3VRBB 1AN8A 1SJED 4TQ1A 2BYTA 1FIQA 1GOZA 2PKOA 3VR8B 4WIPA 1ZP0B 5AUIA 2INNE 4P6VF 1ACCA 2V3PA 4RGMA 3TEWA 3W5UB 1JW9D 1ZXIA 3UI3A 1OQQA 3W5VB 1QKZA 1H7WA 2K5PA 1STEA 2HDEA 1JRPA 2IGDA 3AV8A 2JYEA 1TZOA 1L4DB 1E7PB 5D3DA 1SE3A 1V97A 1PDXA 3ZYYX 2J42A 2DWQA 2BS4B 2IJ0A 3PZ8A 1E9MA 3FILA 1SSNA 4WH4A 5HFYA 2GI9A 3BWUD 5D3IB 4D2KA 1IGDA 1D5MC 2W55A 1ZUD2 1FRDA 2I38A 2H88B 5EE3A 1L0XB 2ZW0A 3I9V1 4IDIA 4HEA1 1JWUD 3CWIA 3N9YC 1TKYA 1FMAD 1PGXA 4A8XC 1J7CA 3Q8CA 4UDUC 3NVWA 3AE9B 3NUHB 1FNUA 3DWGC 3FAHA 1XEEA 3P1MA 4REZA 5C3JB 2KAJA 2L1AA 1E0ZA 1TJEA 1QOFA 1N61A 2BW2A 1PGBA 1C4PA 4KGRA 2KACA 3IT6B 1IBXA 1FNVA 1TY2A 4YTNB 1F2RI 2EELA 3URYA 3ZGZA 3TUOA 2FUG1 3C8YA 2NMQA 4ZRPA 1VZ6A 4HROA 2E6XA 3ZJTA 1F2RC 1DGJA 4YXDB 3FILB 1DYQA 2W3RA 3NS1A 1C9FA 1BXTA 1D5XC 4WAFA 4OHJA 1FM0D 4C7YA 3B2FA 1C77A 3MP9A 2B76B 2ZW1A 3TEZA 4FXCA 4KKJA 4N6EB 1HA5A 3SEBA 2MEKA 1UWMA 4AS1A 2N9LA 5AUKA 3E9SA 2ICIA 3B9JA 1FXIA 2WU2B 3HUIA 1KTKA 1I4QA 1I4GA 5MPOA 1ROEA 2PLPA 1IBXB 1FFUA 1I4XA 1T3QA 1T5XD 2WLBA 1E10A 4NAMA 1K53A 4YSZB 4USAA 2AQ2B 2JSVX 1I4PA 4B0MA 1FXAA 2PVGC 3FC4A 2PVOD 1V1PA 1UGJA 2WXRA 2RMMA 4KGSA 3TEXA 3B2GA 3Q8EA 2JXTA 4RF1A 5HHDG 1YQ3B 1UWXA 3EGRA 1KH0A 2N9KA 3CF4A 3AE2B 1OQRA 5H92C 4MH8A 5E6JA 2RDGA 1XLNA 4RGOS 3AEFB 3U2SC 1TS4A 2YEPF 5T8IA 2WXHA 3NRZA 3Q8AA 1MPEA 3AE4B 4YWGG 4XWWA 2FE8A 1D6EC 1YJIA 3P42A 4JX1C 5I4DA 1DOIA 3MFGA 1KFYB 1EWYC 1C79A 1RWSA 3AE5B 4MT5A 2QIEB 1ZDVA 2G9HD 4GDKB 4LLGM 4NJCA 1TS2A 1NYQA 2J52A 2WDQB 2PMVA 1R7SA 3RPFC 3TSSA 1C78A 2QMTA 4ZOHC 2CJOA 3IAM1 1DOXA 1V1PB 2VZKD 2WXFA 2QEJC 1KLUD 1SF0A 2KMMA 5TSSA 1FFVA 4ARIA 2GRIA 1AWDA 3SFEB 2WXLA 1T6BX 5BYRA 1XLOA 2BB5A 1EM7A 1ZE3D 1SB3C 2DLBA 3MHZA 2WXIA 4A9AA 1JWBD 1HZ5A 2LFIA 3IT4B 4HRSA 1TYGB 1A70A 3BZDB 1SEBD 1RFKA 2LGIA 2V4IB 4NAWB 1MHXA 1L5PA 1NVID 5EE1A 3AECB 1C76A 1PFDA 3Q8FA 5G5GA 2M19A 2Y5CA 3ZJUA 1XF5L 1EU3A 4RCOA 1ZOYB 2AQ3B 4OZBA 1FEHA 1HQRD 3MJ5A 4B0EA 2J53A 2W3SA 1SIJA 2JZPA 3U7ZA 1QOAA 2AX5A 1VRAB 1WGKA 1L0YB 2K0PA 5FR3A 1JALA 1XLQA 4C7ZA 1QF6A 3EUB2 1QILA 1N5XA 3KQ4A 2BS2B 1IGCA 2YEPB 1VJKA 1I4HA 1L6UA 3H8HA 2WP9B 5BMHA 2LHDA 1ET6A 3AMZA 4H2AA 4TQ0A 2FBWB 1L0VB 5BMIA 4HJGE 4TMAB 4WWMA 3GS2A 3IAS1 2INPE 1GPXA 1YN5A 4WURA 4A55A 2WQYB 2AQ1B 1OFFA 2MJ3A 2MJDA 3AB5A 5BYQA 3VQIA 1JROA 1FNWA 1VZ8A 3PZ7A 1FCCC 3AEBB 1E6EB 2PIAA 3R2IA 3LXFA 1ZPSA 4KKIA 1IUEA 1L6VA 2IGGA 4US9A 1XCQL 4Q2JA 2WXNA 3ETRA 1VDVA 2HTME 2R61A 1AYFA 3BK1A 5FK9C 4RH6A 1V1OA 1I7HA 2TSSA 1H7XA 3P4RB 1VZ7A 1Y56A 2M0AA 1ET9A 2WXQA 2JU6X 3WCQA 2WDVB 1NEKB 3AEGB 2WS3B 4YSYB 1CZPA 2H89B 2JYTA 2MH7A 2LMCA 3R2TA 1JCKB 2K3UA 1JWAD 4RNAA 3AM9A 3BK2A 2MJEA 2BBCA 1MHHE 2KQ4X 2SAKA 3SFDB 2Y5PA 3BIID 1WYGA 3TEYA 2Z8LA 4C80A 3GB1A 3AEDB 4ITKA 3AH7A 1GB1A 1HZ6A 2WXOA 2OHFA 1VLBA 1YN3A 1EWCA 2QILA 3DWMA 1C4AA 1V8CA 2PTLA 3R8BA 2E3TA 3U4EG 1GTEA 4JE3B 3VR9B 4KGTA 2ONQA 1N63A 3NVVA 3RFZB 4DXFA 2LJIA 1B9RA 2RDHA 4XDCA 5LNK1 4MACA 1SE2A 4O1NA 2JX5A 2J4XA 1RYJA 4XWTA 1FRRA 2W54A 2IDYA 3BVMA 2VZKB 5H8YE 5HG2A 4A90A 1K51A 4DXGA 2BS3B 3HVDA 3KLSX 4RF0A 4XDDA 4YTPB 1FCLA 2M56B 3BVZA 4CQNA 4OZCA 5D7GA 3AEEB 1KLGD 1UUPA 3E56A 1PGAA 1XLPA 1TKGA 2K22A 1YQ4B 3V05A 1BMLC 2ON8A 1TS3A 2G1EA 3I57A 3W2DA 1YMHE 3LB8C 2WXMA 2WDRB 4US8A 4DQOC 1FO4A 4AQ7A 3LYYA 1P7FA 1TKEA 1PUTA 3AE6B 4ZYSA 5G5HA 1MVKA 5JXVA 4PT5A 2BB6A 1TS5A 1VR9A 3O13A 5BMGA 2BTEA 3P4QB 1AW7A 2CU3A 2IPKD 3BYTB 1QQRA 2I2YA 2V0GA 4J3OD 2WXJA 1WSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N62 A;  4WWM A;  5C2T B;  2ACZ B;  5MPO A;  1GPX A;  1ROE A;  3CIR B;  1FFU A;  1T3Q A;  2WQY B;  1QOG A;  2WLB A;  4YTM B;  1E10 A;  1JQ4 A;  4KX6 B;  4YSZ B;  1OFF A;  2MJ3 A;  3KWL A;  2MJD A;  3AB5 A;  4USA A;  5EE0 A;  1JRO A;  1FXA A;  2PVG C;  1WWT A;  3FC4 A;  1QT9 A;  2N0S B;  3VRB B;  4ZHO A;  2PVO D;  3AEB B;  2WU5 B;  3HRD D;  1FIQ A;  1E6E B;  3B2G A;  2PKO A;  3VR8 B;  1J7A A;  1F0Z A;  2PIA A;  1YQ3 B;  2DBY A;  1ZP0 B;  3LXF A;  5AUI A;  3CF4 A;  3AE2 B;  1OQR A;  1IUE A;  5H92 C;  1NEN B;  1L6V A;  1DOY A;  4P6V F;  1QLB B;  1GAQ B;  4US9 A;  1XLN A;  1N5W A;  3ETR A;  1VDV A;  3AEF B;  2HTM E;  1GTH A;  1AYF A;  1JW9 D;  1ZXI A;  3W5U B;  4N59 A;  1I7H A;  5GXG B;  1H7X A;  1OQQ A;  3W5V B;  3P4R B;  3NRZ A;  2L52 A;  1H7W A;  3AE4 B;  2K5P A;  1YJI A;  1JRP A;  4JX1 C;  2LEK A;  3AV8 A;  1DOI A;  1KFY B;  3WCQ A;  2WDV B;  1EWY C;  1NEK B;  3AE5 B;  3AEG B;  1RWS A;  2QIE B;  2WS3 B;  4YSY B;  1CZP A;  2H89 B;  1J7B A;  1FXI A;  2MH7 A;  1E7P B;  1NYR A;  1NYQ A;  1V97 A;  1PDX A;  3NVZ A;  2WDQ B;  3ZYY X;  3AE7 B;  1R7S A;  2CJN A;  3RPF C;  3P63 A;  1JWA D;  2DWQ A;  2BS4 B;  3AM9 A;  2MJE A;  1E9M A;  4ZOH C;  2CJO A;  3PO0 A;  3NVY A;  3SFD B;  2Q5W D;  1DOX A;  2W55 A;  1WYG A;  4YT0 B;  3BII D;  3P4S B;  1ZUD 2;  1FRD A;  3AE3 B;  4ZHP A;  4C80 A;  1SF0 A;  2JQR B;  2KMM A;  2H88 B;  5EE3 A;  1FFV A;  3P4P B;  1KF6 B;  3AED B;  1KRH A;  3AH7 A;  4IDI A;  4ITK A;  3CWI A;  3W9C B;  2OHF A;  4LTU A;  1TKY A;  1FMA D;  1VLB A;  1AWD A;  3SFE B;  1J7C A;  3NVW A;  3DWM A;  3AE9 B;  1V8C A;  1XLO A;  2E3T A;  3DWG C;  3AE1 B;  1GTE A;  3FAH A;  3VR9 B;  3P1M A;  5C3J B;  1SB3 C;  3B9J A;  4JWU C;  1N63 A;  4A9A A;  1JWB D;  2KAJ A;  3NVV A;  4HRS A;  1E0Z A;  1TJE A;  1QOF A;  1N61 A;  4N58 A;  1B9R A;  1TYG B;  1A70 A;  1RFK A;  2JX5 A;  1L5P A;  1RYJ A;  1FRR A;  2L83 A;  1NVI D;  2W54 A;  5EE1 A;  3SR6 A;  1QOB A;  3AEC B;  4YTN B;  5H8Y E;  1PFD A;  5G5G A;  2BS3 B;  2M19 A;  2Y5C A;  4YTP B;  1WXQ A;  5EE9 A;  2K9X A;  2M56 B;  4HRO A;  3AEA B;  1GT8 A;  3AEE B;  4YSX B;  2QJL A;  1ZOY B;  1XLP A;  1DGJ A;  4YXD B;  1TKG A;  2K22 A;  3AN1 A;  1YQ4 B;  2W3R A;  3HVZ A;  3NS1 A;  1XO3 A;  2G1E A;  1SIJ A;  2W3S A;  3VRA B;  1FM0 D;  4C7Y A;  1QOA A;  3LB8 C;  3L4P A;  2WDR B;  4WQM A;  1N60 A;  2AX5 A;  4US8 A;  1WGK A;  1FO4 A;  1JAL A;  1NI3 A;  1XLQ A;  1RM6 C;  3B2F A;  1TKE A;  1YJJ A;  2B76 B;  1PUT A;  3AE6 B;  3EUB 2;  4C7Z A;  1QF6 A;  3AE8 B;  4FXC A;  4JWS C;  1N5X A;  5G5H A;  4N6E B;  1UWM A;  2BT6 A;  2BS2 B;  5AUK A;  1VJK A;  1L6U A;  3P4Q B;  2WP9 B;  2CU3 A;  2EKI A;  1WRI A;  3AMZ A;  1CJE A;  2FBW B;  2WU2 B;  3HUI A;  1L0V B;  3ABV B; 
#chains in the Genus database with same CATH topology
 2JWU A;  1UNS A;  2LI5 A;  4IM3 A;  4EE2 A;  4XX5 A;  4NPN A;  1F52 A;  2WNM A;  1QOG A;  2GBM A;  3RZW C;  4KX6 B;  3KVF B;  3L10 B;  1PYW D;  2V4L A;  4L2Y A;  2N0S B;  2Y3A A;  5G55 A;  1J7A A;  1DOY A;  1ESF A;  1NEN B;  2KOX A;  1QLB B;  2N4F A;  4JGH B;  2FID A;  5GXG B;  3ZLZ A;  4RFB A;  1XXG A;  3A4R A;  3ZIM A;  2ZVO A;  1WGH A;  2NTS A;  2MBE A;  3P63 A;  3KH0 A;  3PO0 A;  4IOI E;  5IA7 A;  3NVY A;  2KDM A;  3PRZ A;  1FPY A;  4LNO A;  4B95 A;  3KUC B;  2QDF A;  2LGD A;  4ZHP A;  3AE3 B;  1K50 A;  1CK1 A;  2CS4 A;  4BZA A;  1KOT A;  4LTU A;  1F77 A;  2K6Q A;  2LVP A;  4LK0 M;  2DHZ A;  4QAY A;  2O6V A;  3VTU A;  4M8N A;  1IPG A;  2KQS A;  2W82 A;  3EA6 A;  1J19 A;  3DVG Y;  4N58 A;  4XE0 A;  5TR5 A;  2L83 A;  1BUI C;  1QOB A;  2MP2 A;  5HKH A;  2KC1 A;  5BYS A;  3ZJV A;  3AN1 A;  3ZXR A;  4J6I A;  2I1J A;  4NNJ B;  1XO3 A;  4DXA B;  4EUT A;  3UIP B;  1GC6 A;  3DHI C;  4EZJ A;  2C7M B;  4HKQ A;  3V61 A;  3AU4 A;  3NZ3 A;  4IC7 B;  2NBU A;  2EKI A;  3IXS A;  4AJW A;  3N1Y C;  2DZI A;  4ZRQ A;  4WAA A;  2MP2 B;  1EU4 A;  3AXC A;  2KN4 A;  4HPM B;  2DZM A;  4W9E A;  3M3J A;  2KQ7 A;  4NQL B;  4B9K A;  2ZNV B;  2INN E;  3L13 A;  4P6V F;  2N7E A;  1ACC A;  3W5U B;  3P2B A;  3PPA A;  1OQQ A;  3DHG C;  2BVC A;  5FR6 A;  1RFA A;  5J2R A;  3AV8 A;  2FNJ B;  1J8C A;  2JYE A;  4W9C A;  1L4D B;  4N9F 4;  5D3D A;  3RI7 C;  2D3C A;  3ZYY X;  3RZF A;  4EZL A;  2BS4 B;  2ASQ A;  3RUI B;  1E9M A;  4PK1 A;  2GI9 A;  2W55 A;  3U30 A;  4P1B C;  1R4N I;  4LNI A;  1NDD A;  2UWQ A;  5EE3 A;  1P98 A;  3CWI A;  4F1S A;  2C7N B;  1FMA D;  4HDQ A;  4ANW A;  2M4N A;  2QCZ A;  4KDL B;  2RDB C;  4P7I A;  5DPR A;  3FAH A;  4IUM B;  4REZ A;  1QOF A;  2AL3 A;  4HLE A;  1PGB A;  1C4P A;  2KJ6 A;  2KAC A;  3IT6 B;  4ICU A;  4G0N B;  3TIX A;  2DX5 B;  2IY1 B;  4NJ6 A;  3ZTC A;  4ZRP A;  2EKE C;  3LDZ E;  1DGJ A;  3ZNH B;  2W3R A;  4ANU A;  1D5X C;  2KDI A;  4HCN B;  4C7Y A;  3R66 C;  4BVU C;  2IND C;  2ZW1 A;  3ZDT A;  4KKJ A;  3RNF C;  4AS1 A;  2N9L A;  4WJP A;  5AUK A;  3E9S A;  2ICI A;  3B9J A;  1FXI A;  2LRU A;  1UGM A;  4GDK A;  1I4Q A;  1WGD A;  3HM3 A;  1I4X A;  1T3Q A;  1K53 A;  4YSZ B;  3UIN B;  4M01 A;  4B0M A;  2NS5 A;  1UGJ A;  3ML9 A;  2JXT A;  5IAA C;  1YQ3 B;  5G2N A;  1WM2 A;  3EGR A;  5H92 C;  5E6J A;  2GBK A;  2JRH A;  1GG3 A;  1MPE A;  2FE8 A;  2EMS A;  4G3X B;  4FLH A;  3P42 A;  3PLV A;  1WGG A;  1YX5 B;  1C79 A;  2O2V A;  1ZDV A;  4GDK B;  1TS2 A;  3ZKJ C;  4MGY E;  3QA8 A;  2GBN A;  3TSS A;  1TT5 B;  1C78 A;  2QMT A;  3ZRF A;  2CJO A;  2DEN B;  3WAN A;  4URK A;  1DOX A;  1E8Z A;  4RM9 A;  2KMM A;  2KYW A;  4ARI A;  1T6B X;  5BYR A;  2BKR B;  5LXH A;  3UQA A;  2AEH A;  2KC2 A;  2OJW A;  2BB5 A;  1ZE3 D;  2DLB A;  1BT0 A;  4A9A A;  1GC7 A;  1V86 A;  2GOW A;  3WA0 A;  4FUL A;  1U4A A;  2LGI A;  1T0Y A;  1L5P A;  2O2V B;  1NVI D;  4DK5 A;  1C76 A;  2Y5C A;  4K7S A;  2B3A A;  3PT2 B;  4RCO A;  1GJZ A;  2N7D A;  2PJH A;  3MJ5 A;  1TBE A;  2MRP A;  3I5J C;  1EO6 A;  2Z59 B;  2J53 A;  2W3S A;  2V3S A;  1VRA B;  1TZ1 A;  3PZD A;  4EZK A;  3ZNZ B;  3X0W A;  3RNE C;  2BS2 B;  1IGC A;  1VJK A;  5BMH A;  2WP9 B;  4GMV A;  2LHD A;  4H2A A;  4TQ0 A;  1TGZ B;  2KHW B;  5AEK B;  3GS2 A;  2WHI A;  3HIZ A;  2NBV B;  3SU8 X;  1D3Z A;  3WIM A;  4PS8 A;  2MJD A;  3AB5 A;  3VQI A;  3QCA A;  2KDE B;  3PZ7 A;  4ACF A;  3AEB B;  4A3P A;  2HE7 A;  3SD5 A;  3LXF A;  1IUE A;  1L6V A;  2LGS A;  4US9 A;  2KKC A;  4BKS D;  1WGR A;  2HTM E;  2R61 A;  1AYF A;  3H7S A;  2M0A A;  1ET9 A;  2WXQ A;  4HCP B;  2ZCC A;  3DCG A;  3MTN B;  4CO7 A;  1WM3 A;  3DVN U;  1YX6 B;  2K3U A;  2KQ4 X;  2Y5P A;  3KUD B;  5L83 A;  2AWT A;  3GB1 A;  3AED B;  1WR1 A;  4ITK A;  3AH7 A;  1GB1 A;  2WXO A;  1SIF A;  1YN3 A;  2DNF A;  3DWM A;  4S17 A;  3R8B A;  4JE3 B;  3VR9 B;  4BKG A;  4KGT A;  2ONQ A;  2LJI A;  1RYJ A;  3BVM A;  4A90 A;  3KLS X;  4XDD A;  3BVZ A;  4CQN A;  4OZC A;  1R4M I;  5D7G A;  1KLG D;  2RPQ A;  1YQB A;  2G1E A;  2DAJ A;  3RCZ A;  2WWZ A;  3W2D A;  1FO4 A;  3LYY A;  1F1H A;  5G5H A;  5JXV A;  4PT5 A;  3O13 A;  5BMG A;  2BTE A;  3P4Q B;  2CU3 A;  5KHQ A;  2IYD B;  2I2Y A;  4XYC A;  2WXJ A;  1WSP A;  2Z0D B;  2ACZ B;  1WJN A;  2WX0 A;  1WE6 A;  5EE0 A;  4MGK E;  1KM7 A;  4HPL B;  4IWO A;  2BF8 B;  1F0Z A;  4KZC A;  4E3C A;  4M8M A;  1HXY D;  1MG4 A;  1GTH A;  4N59 A;  2L32 A;  1M94 A;  2LEK A;  1D5Z C;  3ZUN A;  1NYR A;  3DDC B;  1P3Q U;  1FD6 A;  4W9I A;  3AE7 B;  4ZRJ A;  2N1W A;  2PEA A;  2KJH B;  1FXT B;  2WGS A;  1ENF A;  1UH6 A;  2JPH A;  4YT0 B;  4JPS A;  3P4S B;  5IP4 D;  1YN4 A;  4L23 A;  2KWD A;  3P4P B;  1KRH A;  1LQB A;  3J9C A;  1XD3 B;  2IGH A;  3AE1 B;  2C60 A;  2GBR A;  4JWU C;  2J0J A;  1UBI A;  4AUQ C;  4P16 A;  3OWE B;  1PQS A;  3SR6 A;  2ZEQ A;  3VHT C;  1WXQ A;  1K52 A;  3AEA B;  1XCT L;  1WR6 E;  4AWJ A;  4W9D A;  4YSX B;  2QJL A;  3QHT A;  4IW0 A;  4M00 A;  2LHE A;  4LJO B;  1JWM D;  2LGX A;  1RM6 C;  1L4Z B;  1Q10 A;  1YJJ A;  3AE8 B;  2MSE D;  4JWS C;  3ENE A;  2JXX A;  2IBI B;  2Z0E B;  4PS3 A;  5EDS A;  3MHS D;  2JUO A;  2J0M A;  2QC8 A;  3ONS A;  3ZXV A;  3MC0 B;  2WDT B;  3NG0 A;  2WXG A;  4ICV A;  2GBJ A;  1Q5W B;  4TQ1 A;  1SJE D;  1FIQ A;  1GOZ A;  2REX A;  1R4N B;  5AUI A;  2M0X A;  1WZ3 A;  4KIK A;  1JW9 D;  3UI3 A;  1EF5 A;  2ZJD A;  1H7W A;  3I63 C;  3V62 A;  1YIW A;  3HHM A;  1JRP A;  1TZO A;  2KMA A;  1UBQ A;  4MJS A;  3JYU A;  5J17 A;  4FJY A;  4I6P A;  3I3T B;  2DWQ A;  3VVW B;  1SSN A;  5D3I B;  4D2K A;  1D5M C;  1FRD A;  4K1R B;  2KVZ A;  2ZW0 A;  2UU7 A;  1TIF A;  2D2Q A;  3VH3 B;  1P1A A;  4AJY B;  3AE9 B;  3NUH B;  4KIK B;  4A20 A;  2BYV E;  4I6L B;  1WGY A;  1TJE A;  1WXV A;  2BW2 A;  2L3Z A;  3GE3 C;  4KGR A;  1TY2 A;  1JRU A;  1S3S G;  4MJS B;  3TUO A;  5KHO A;  2NMQ A;  4HRO A;  2HJ8 A;  1WMH B;  3Q6B A;  3M63 B;  3PHW B;  4WAF A;  2XBB C;  3QC8 B;  3RNB C;  2KWU B;  1WJU A;  1C77 A;  2B76 B;  3TEZ A;  1HA5 A;  1I42 A;  2JF5 A;  3HUI A;  4MEL A;  1I4G A;  2K6D B;  1ROE A;  4FA6 A;  4USA A;  4MGZ E;  4PS7 A;  3B2G A;  5HHD G;  1HTO A;  2N9K A;  1OQR A;  4A3O A;  3AEF B;  3U2S C;  4GU2 A;  5T8I A;  2WXH A;  2KDB A;  3NRZ A;  3AE4 B;  3CMM B;  4JX1 C;  4W9L A;  2OOB B;  3CF6 E;  3MFG A;  5DCN A;  1KFY B;  1EWY C;  3AE5 B;  4DDI D;  2L0F A;  2IZV B;  3K9P B;  1NYQ A;  2AL6 A;  4ZRI A;  3RPF C;  4P1C C;  2FCS A;  4F7Z A;  3RNC C;  3OLM D;  1ZW7 A;  3IAM 1;  2VZK D;  3PGE A;  3AU5 A;  1SF0 A;  2FCQ A;  5TSS A;  2YLM A;  2CU1 A;  3WAO A;  4K3C A;  3TMP B;  4HJK A;  3MHZ A;  2L76 A;  2WXI A;  1JWB D;  3IT4 B;  4HRS A;  3W1Y A;  1TYG B;  1A70 A;  1SEB D;  2D11 A;  4NJ7 A;  2V4I B;  5IOI A;  5EE1 A;  3AEC B;  1T0Q C;  1PFD A;  1WIA A;  4PYU A;  1XQQ A;  1XF5 L;  2AQ3 B;  4OZB A;  4G11 A;  2IO3 B;  4LCD E;  2YVC A;  5J18 A;  4EFO A;  1QOA A;  1XT9 B;  2K0P A;  4FHJ A;  3EUB 2;  1QIL A;  3NZS A;  2WX1 A;  1LGR A;  4FN2 A;  2N9P C;  4LNF A;  4W9K A;  4WWM A;  2INP E;  4A55 A;  2WQY B;  3QWZ B;  3KYD D;  3T9L A;  3N30 A;  4FHK A;  2PIA A;  3GOE A;  2PE6 B;  4KKI A;  3L16 A;  2CR5 A;  2AYO B;  4Q2J A;  3ETR A;  2KK8 A;  3BK1 A;  1I7H A;  2TSS A;  1H7X A;  4EKU A;  3L17 A;  2LAS A;  4AOF A;  5LLI A;  2RSU A;  4ZDV A;  2JU6 X;  2L8J A;  1T0S C;  2W9N A;  1UD7 A;  4X57 B;  2LMC A;  3QAQ A;  4BKT A;  3QX1 A;  4F8C B;  1JWA D;  1R4M B;  2VRR B;  3BK2 A;  1LXD A;  2BBC A;  5JHA A;  1MHH E;  3PTF C;  1V49 A;  3AI5 A;  3BII D;  3DOW A;  3H1U A;  2OHF A;  2RR9 A;  1VLB A;  5IO9 A;  1EWC A;  1C4A A;  1V8C A;  1X1M A;  1N63 A;  2N1V A;  3NVV A;  3RFZ B;  1Z2M A;  4E74 A;  2I1K A;  4JQW C;  3N32 A;  1FRR A;  2W54 A;  2IDY A;  2VZK B;  5H8Y E;  1K51 A;  4DXG A;  3EHV A;  4MM3 A;  4RF0 A;  4II2 B;  4HK2 A;  1GNU A;  2V1Y A;  3E56 A;  2JZZ A;  3RNA C;  1PGA A;  2K1F A;  1XLP A;  4WWN A;  1YQ4 B;  3PRM B;  3CSF A;  1TS3 A;  3V6E B;  3I57 A;  3ECI A;  3LB8 C;  2WXM A;  2WDR B;  4US8 A;  1Z5S B;  4AQ7 A;  1WXS A;  4KSK C;  3OG5 A;  4ANV A;  2KNB A;  1MVK A;  2BB6 A;  4W9H A;  1VR9 A;  4DHZ E;  1YJ1 A;  3BYT B;  2J7Q B;  2ZVN A;  2C5L C;  1WF9 A;  4J3O D;  4GN1 A;  3CIR B;  4EEW A;  4YTM B;  4MDK E;  3PV1 A;  2K39 A;  4JIO U;  4MM3 B;  2DYO A;  1HEZ E;  1GB4 A;  4ZHO A;  2WU5 B;  2PW9 A;  1SBB B;  4NZL B;  4C4V A;  2K25 A;  3L08 A;  2LVQ A;  4C00 A;  3NY5 A;  4RMA A;  2ZPY A;  2ZZP B;  3A4S C;  2L52 A;  2MHJ A;  3DPD A;  3QJZ A;  1YNT E;  2LD9 A;  2IO2 B;  3ZTD A;  1D4B A;  3QQ8 B;  2NBW B;  2SEB D;  1ZDX A;  1TY0 A;  3PSE B;  4GLS C;  4G50 A;  4IKG A;  5BO4 B;  3RMK C;  1I4R A;  1WFY A;  3B0A A;  1ZXH A;  2GLS A;  1SXT A;  2JQR B;  2V3N A;  1OTR B;  1MI0 A;  4C4V B;  3U52 E;  5AZF A;  3V6C B;  3DBH I;  1B1Z A;  3R7Q A;  4BOS C;  5L95 C;  2J0K A;  4IWP A;  2X38 A;  1P7E A;  2RPV A;  4OW0 A;  4C56 C;  5EE9 A;  2JZ3 B;  4EOY A;  4FBJ B;  2DYM A;  1GT8 A;  5CX3 A;  4R3D A;  2X8X X;  5D2M B;  3K9O B;  1OEY J;  3VRA B;  1JML A;  2JY6 A;  3Q8B A;  2KX3 A;  3L4P A;  4WQM A;  1N60 A;  4OZA A;  4L1B A;  3RUL A;  3NJT A;  4OVZ A;  1OEY A;  1WZ0 A;  2BQQ A;  2QHO A;  2KN5 A;  1WRI A;  2QSD A;  1CJE A;  4TSS A;  3TBL D;  3ZO5 B;  3ABV B;  4W9J A;  5DPT A;  1WH3 A;  4KV2 A;  2G3Q B;  3Q69 A;  1V5T A;  3ZRC A;  4BOZ B;  3VRB B;  1J0G A;  1H8C A;  4NY0 A;  1L2N A;  2HJ1 A;  3VR8 B;  2G4S A;  4DHJ D;  5E6P A;  2MBB B;  1RRB A;  4E71 A;  2V3P A;  4RGM A;  3TEW A;  2WYQ A;  1ZXI A;  2KO3 A;  2KFJ A;  2PE9 A;  2INC C;  2ZPN A;  2L00 B;  3W1S C;  3Q3N C;  1IYF A;  1SE3 A;  1PDX A;  2J42 A;  4IG7 B;  2IJ0 A;  3L54 A;  1K8R B;  3PZ8 A;  4FJV B;  4WH4 A;  3BWU D;  2FCM A;  2KWC A;  1ZUD 2;  3VUW A;  3IBE A;  3UIO B;  1UEL A;  1L0X B;  3I9V 1;  4WJO A;  4DDG D;  1JWU D;  3N9Y C;  1PGX A;  4MEM A;  5C1Z A;  1FNU A;  1RAX A;  2KFK A;  3TJP A;  2KWV B;  5CHV C;  2L1A A;  1E0Z A;  1V81 A;  3Q3M C;  2JRI B;  1S1Q B;  1FNV A;  3EC8 A;  4YTN B;  1F2R I;  2EEL A;  2KT7 A;  5E6N A;  1VZ6 A;  3D32 A;  1F2R C;  4TKN A;  2DYB A;  4YXD B;  2K8B A;  3H6N A;  1DYQ A;  3IFW B;  3NS1 A;  1BXT A;  4OHJ A;  2KLG A;  5CTR C;  1N6Z A;  3B2F A;  2LZ6 A;  4FXC A;  3SEB A;  1V6E A;  2KFK B;  4HXD A;  3MJW A;  2WU2 B;  2OJR A;  3QK0 A;  1KTK A;  5MPO A;  2PLP A;  1FFU A;  2WLB A;  2JSV X;  3IHP C;  1I4P A;  2PVG C;  2PVO D;  3BIN A;  2RMM A;  3TEX A;  3Q8E A;  2DZK A;  3DBR I;  4RF1 A;  2DZJ A;  3CF4 A;  3AE2 B;  4MH8 A;  2K8H A;  2RDG A;  2KTF A;  3SDL C;  1MG8 A;  2YEP F;  3Q8A A;  1D6E C;  3ZDM C;  1RWS A;  2QIE B;  4LLG M;  4NJC A;  4LJP B;  2WDQ B;  4HWI B;  1R7S A;  4DHJ B;  4ZOH C;  3X23 A;  3VTW A;  3MC8 A;  1OGW A;  1FFV A;  2JVC A;  2C9W B;  1SGH A;  2MLB A;  2GRI A;  3SFE B;  2VH1 A;  2WXL A;  1T0R C;  3KYC D;  1XLO A;  3EEC A;  1EM7 A;  1SB3 C;  2A5U A;  2KLC A;  2LFI A;  1HZ5 A;  1EUV B;  3BZD B;  4GOC A;  1E8X A;  1WMH A;  4IWQ A;  3ZNG C;  2M19 A;  3JSV B;  4GB9 A;  3ZJU A;  4WWO A;  1EU3 A;  4I6N B;  1ZOY B;  2MBO A;  3GZN I;  1FEH A;  1HQR D;  1HTQ A;  4B6W A;  2VH2 A;  2JZP A;  4LNK A;  3N3K B;  3FKY A;  3U7Z A;  2LUE A;  2AX5 A;  1WGK A;  1JAL A;  1XLQ A;  1QF6 A;  2MBQ A;  1E90 A;  1I4H A;  1L6U A;  3H8H A;  4GGQ A;  1L7Y A;  1ET6 A;  3AMZ A;  1L0V B;  1V2Y A;  4TMA B;  3IAS 1;  1WI0 A;  1GPX A;  1YN5 A;  4ASW C;  2R2Q A;  3UF8 A;  1JRO A;  3OAW A;  1FNW A;  1VZ8 A;  1FCC C;  4GIV A;  1E5W A;  1WX8 A;  4DWF A;  3TL5 A;  2CHZ A;  4IM2 A;  1ZPS A;  2BWE S;  2IGG A;  2A4Z A;  2RD0 A;  4ZRK A;  5FK9 C;  2G4D B;  1V1O A;  1VZ7 A;  2V9H A;  2MCN B;  3EFU A;  3C19 A;  3UGB B;  3WCQ A;  2WDV B;  1NEK B;  3AEG B;  2MW5 A;  1CZP A;  2JYT A;  1TTN A;  2MH7 A;  1JCK B;  4RNA A;  2NCN A;  4OVU A;  3AM9 A;  2LJ5 A;  3SFD B;  3OJ4 B;  1SE9 A;  3TEY A;  2Z8L A;  4C80 A;  2K8C A;  4KDI C;  2KD0 A;  2KZR A;  3APD A;  3O65 B;  2PPH A;  1F9J A;  3VTV A;  2D3B A;  4KZ0 A;  2E3T A;  3U4E G;  1GTE A;  3Q3F A;  4DHZ B;  1Y8R C;  2BYF A;  2LXC A;  3DQV A;  3DBL I;  4XDC A;  5LNK 1;  2JX5 A;  2J4X A;  4XWT A;  1KJT A;  2O6V B;  4HPP A;  2BS3 B;  1FCL A;  1WXM A;  3VUX A;  2LVO A;  4MSM B;  4TUU A;  1TKG A;  2K22 A;  1WRD B;  3QIJ A;  1BML C;  4W9G A;  3H9D A;  2R2O A;  3PRP B;  1WX7 A;  3B1L X;  3AE6 B;  4ZYS A;  4W9F A;  3CST A;  1AW7 A;  1QQR A;  2V0G A;  4LDT D;  5D94 A;  1L0Y B;  3ZVV A;  5DPS A;  2WXK A;  4BBN F;  3KWV A;  1JQ4 A;  5CHF A;  1GUA B;  2LUM A;  1WWT A;  3VFK A;  1QT9 A;  3ZW3 A;  3HRD D;  2N7J A;  3T3N A;  2DBY A;  1V5O A;  3BYY B;  1SE4 A;  1GAQ B;  3Q3J A;  1N5W A;  2FAZ A;  3DBH B;  1V80 A;  4XC2 A;  3T3O A;  4TV3 A;  2XN9 C;  4RGT A;  2FUH B;  2M1M A;  3IVF A;  1J7B A;  2Y5B B;  4GSW A;  3NVZ A;  1OQY A;  3EFC A;  2CJN A;  3C0R B;  4M0W A;  3ALB A;  1LO5 D;  5DPW A;  2Q5W D;  3GP7 A;  1M4V A;  4DBG A;  2C7H A;  1ZGU B;  4LNN A;  4RGN A;  1KF6 B;  3RN9 C;  3W9C B;  1ZKH A;  2XNA C;  2NTT A;  3V3X A;  2D3G A;  3W1S A;  1C4C A;  2HTH A;  4M02 A;  1UF0 A;  4YL8 A;  1SJH D;  2RGF A;  3Q14 C;  4A6Q A;  3WAL A;  3ZQ4 A;  4XGA B;  2KMC A;  4GDL A;  5HI1 A;  1CQV A;  3A9K A;  4NQK E;  1MFW A;  2K9X A;  4KSL C;  4ARC A;  2D5G A;  4M0W B;  2L0T A;  1JWS D;  3HVZ A;  4HKZ E;  2GB1 A;  2KX0 A;  3BY4 B;  2KJR A;  3Q3O C;  3UQB A;  3NS8 A;  1NI3 A;  2CHX A;  4BFR A;  3N1Z C;  2BT6 A;  1HE8 A;  2BYE A;  2WXP A;  4WJQ A;  2OED A;  5FKA C;  1I35 A;  1CMX B;  2DAF A;  1N62 A;  5C2T B;  3BVG A;  3KUZ A;  2XEW A;  1G6J A;  4GDL B;  1P9D U;  3A9K B;  3KWL A;  1LM8 B;  4BBN C;  2JT4 B;  1AN8 A;  2MX2 A;  3NHE B;  2BYT A;  2PKO A;  2ZCB A;  4WIP A;  1ZP0 B;  3APC A;  5E6O A;  4LDT B;  2FCN A;  2NR2 A;  3VXW A;  3PVL A;  3W5V B;  1QKZ A;  3AUL A;  2K5P A;  1STE A;  2HDE A;  2IGD A;  2D07 B;  1E7P B;  1V97 A;  5CHW A;  4RM8 A;  3JW0 X;  3L0W B;  4K7W A;  3FIL A;  5HFY A;  3M95 A;  1AAR A;  2CHW A;  1IGD A;  4KVG B;  2L7R A;  2I38 A;  2H88 B;  3DBS A;  4HEA 1;  2KXJ A;  3DHH C;  3HK0 A;  4IDI A;  1TKY A;  4A8X C;  1E8W A;  1J7C A;  3Q8C A;  4UDU C;  3NVW A;  2ZNV C;  5JH5 C;  3DWG C;  1XEE A;  3P1M A;  5C3J B;  2KAJ A;  2MWS B;  1LFD A;  1N61 A;  5AZG A;  1UZX B;  2FIF A;  1IBX A;  3PLU A;  3URY A;  4JLC A;  3ZGZ A;  2KDF B;  2FUG 1;  3C8Y A;  3GE8 C;  3ML8 A;  1VD2 A;  4GXB A;  2E6X A;  3ZJT A;  3QAR A;  1P0R A;  2KVR A;  2KAN A;  3FIL B;  2D3A A;  1C9F A;  3T8M A;  3DBR B;  1FM0 D;  5LXI B;  4ZYN A;  4WQO B;  5GMV A;  1WJ6 A;  1WY8 A;  5AZH A;  1E8Y A;  2HD5 B;  3MP9 A;  4CYE A;  4N6E B;  3ZNI D;  2MEK A;  1UWM A;  1EF1 A;  2NPT A;  4S0R A;  3A33 B;  1IBX B;  1T5X D;  1E10 A;  3HM6 X;  4NAM A;  2AQ2 B;  1RLF A;  1FXA A;  3FC4 A;  3RT3 B;  4MH0 E;  4K7U A;  1A5R A;  1V1P A;  2WXR A;  4KGS A;  1UWX A;  4JL9 A;  1KH0 A;  2D10 A;  1NBF C;  1XLN A;  4RGO S;  2N9E B;  1TS4 A;  3M62 B;  4YWG G;  4XWW A;  2BPS A;  1YOV B;  1H4R A;  1YJI A;  3SHQ A;  5I4D A;  2NPT B;  1DOI A;  3VH4 B;  4NAW A;  2GMI C;  4MT5 A;  1C1Y B;  2G9H D;  4CHK A;  2J52 A;  2PMV A;  2BKF A;  3GZN B;  5IN7 A;  2BGF A;  4XZ4 A;  1V1P B;  4WWP A;  3S2A A;  4PYZ A;  2WXF A;  3RD2 A;  2QEJ C;  1KLU D;  3PRE A;  1AWD A;  3DVN V;  2JWZ A;  3A9J A;  3APF A;  3PS6 A;  2LRW A;  4OVV A;  1RFK A;  4NAW B;  1MHX A;  4FAD A;  3N1X C;  1E7V A;  3Q8F A;  5D6J B;  5G5G A;  3DVG X;  4HDO A;  2IO0 B;  3WAP A;  4MSQ B;  5JZE B;  2MBH A;  4FJZ A;  4B0E A;  3LJ3 A;  3NZU A;  1SIJ A;  3PHX B;  1C3T A;  4BKS A;  5FR3 A;  3MC9 A;  4II3 B;  2M17 A;  4C7Z A;  1V9J A;  4WJN A;  1N5X A;  3IG3 A;  3KQ4 A;  3A9J B;  5IKC M;  3R7R A;  1Q1O A;  2MA9 B;  2YEP B;  2IY0 B;  1QZE A;  2FBW B;  5BMI A;  1MJD A;  4HJG E;  1IP9 A;  1VCB A;  5C23 A;  4WUR A;  2L05 A;  2AQ1 B;  1OFF A;  2MJ3 A;  5BYQ A;  2NVU I;  2UYZ B;  3N20 C;  3B08 A;  1E6E B;  1WYW B;  3R2I A;  3V60 A;  4ANX A;  2LXA A;  2KTR A;  2CKH B;  1XCQ L;  2WXN A;  1VDV A;  3H7P A;  4RH6 A;  3VUY A;  2MQJ A;  3P4R B;  1Y56 A;  3NOB A;  3DBL B;  3Q2A C;  3VDZ A;  2WS3 B;  4YSY B;  2H89 B;  3R2T A;  3RNG C;  2EMT A;  2BWF A;  2MJE A;  4MGI E;  2SAK A;  2N9X A;  1WYG A;  3OJ3 A;  1WJ4 A;  1Q0W B;  2XK5 A;  1HZ6 A;  3TCA A;  1E7U A;  2IO1 B;  2KTR B;  2QIL A;  4IM0 A;  2PTL A;  3H7P B;  1WX9 A;  3R3M A;  3U8Z A;  3JSV A;  3A1Q A;  4DXF A;  3U7D A;  1B9R A;  2RDH A;  1YD8 U;  4MAC A;  1SE2 A;  4O1N A;  5HG2 A;  3WAM A;  1NI2 A;  1WXA A;  3HVD A;  3RYT A;  4YTP B;  2M56 B;  2O6V D;  2LGY A;  3AEE B;  1UUP A;  3JVZ X;  4AP4 C;  4BAX A;  2M8S A;  4K3B A;  3V05 A;  2ON8 A;  1YMH E;  4DQO C;  1WE7 A;  2XK5 B;  1P7F A;  1TKE A;  4HVB A;  1PUT A;  4K81 A;  2G45 B;  5JHB A;  1KLV A;  1ISN A;  1TS5 A;  2LWP A;  2IPK D;  3KW5 B;  3A1Q B;  3VAW A; 
#chains in the Genus database with same CATH homology
 2JWU A;  1UNS A;  4EE2 A;  2WXK A;  2ACZ B;  2WNM A;  3CIR B;  3KWV A;  1QOG A;  1JQ4 A;  4YTM B;  4KX6 B;  4MM3 B;  5EE0 A;  2LUM A;  2DYO A;  1PYW D;  1HEZ E;  1WWT A;  1QT9 A;  2N0S B;  4L2Y A;  1GB4 A;  4ZHO A;  2Y3A A;  2WU5 B;  2PW9 A;  3HRD D;  2N7J A;  3T3N A;  1J7A A;  1SBB B;  1F0Z A;  2DBY A;  4NZL B;  1DOY A;  1ESF A;  3BYY B;  1NEN B;  1SE4 A;  1QLB B;  1GAQ B;  1HXY D;  1N5W A;  1GTH A;  4N59 A;  5GXG B;  4RFB A;  2L52 A;  2L32 A;  3T3O A;  2XN9 C;  4RGT A;  2LEK A;  1XXG A;  1D5Z C;  1YNT E;  1J7B A;  1NYR A;  1D4B A;  3NVZ A;  1FD6 A;  2SEB D;  1ZDX A;  3AE7 B;  1TY0 A;  2CJN A;  2NTS A;  4GLS C;  3P63 A;  4M0W A;  4IKG A;  1LO5 D;  3PO0 A;  4IOI E;  1I4R A;  1ENF A;  3NVY A;  2KDM A;  2Q5W D;  1ZXH A;  3GP7 A;  1M4V A;  4YT0 B;  4JPS A;  3P4S B;  1SXT A;  4ZHP A;  3AE3 B;  1YN4 A;  1K50 A;  4L23 A;  2JQR B;  1CK1 A;  2KWD A;  2V3N A;  4RGN A;  3P4P B;  1KF6 B;  1KRH A;  1MI0 A;  3W9C B;  4LTU A;  3J9C A;  3U52 E;  1F77 A;  2XNA C;  2IGH A;  2NTT A;  3V3X A;  3W1S A;  4LK0 M;  1C4C A;  1B1Z A;  3AE1 B;  1SJH D;  4JWU C;  2W82 A;  3EA6 A;  4A6Q A;  4N58 A;  3ZQ4 A;  2X38 A;  4P16 A;  3OWE B;  4XE0 A;  1P7E A;  2RPV A;  2L83 A;  3SR6 A;  1BUI C;  5HI1 A;  1QOB A;  1CQV A;  4OW0 A;  1WXQ A;  4C56 C;  5EE9 A;  1K52 A;  2K9X A;  5BYS A;  3AEA B;  1XCT L;  1GT8 A;  2DYM A;  4ARC A;  4R3D A;  4YSX B;  2QJL A;  2D5G A;  3ZJV A;  3AN1 A;  1JWS D;  2LHE A;  3HVZ A;  4HKZ E;  1XO3 A;  1JWM D;  3VRA B;  2GB1 A;  1JML A;  3Q8B A;  3L4P A;  4WQM A;  1N60 A;  4OZA A;  4HKQ A;  1NI3 A;  4L1B A;  1RM6 C;  1L4Z B;  1Q10 A;  1YJJ A;  3AE8 B;  4JWS C;  3NZ3 A;  4OVZ A;  2BT6 A;  2WXP A;  2EKI A;  3IXS A;  2OED A;  1WRI A;  5FKA C;  2QSD A;  1CJE A;  4TSS A;  3ABV B;  1N62 A;  5C2T B;  3BVG A;  4ZRQ A;  4GDL B;  3MC0 B;  1EU4 A;  2WXG A;  3KWL A;  3Q69 A;  2KN4 A;  3VRB B;  1AN8 A;  1SJE D;  4TQ1 A;  2BYT A;  1FIQ A;  1GOZ A;  2PKO A;  3VR8 B;  4WIP A;  1ZP0 B;  5AUI A;  2INN E;  4P6V F;  1ACC A;  2V3P A;  4RGM A;  3TEW A;  3W5U B;  1JW9 D;  1ZXI A;  3UI3 A;  1OQQ A;  3W5V B;  1QKZ A;  1H7W A;  2K5P A;  1STE A;  2HDE A;  1JRP A;  2IGD A;  3AV8 A;  2JYE A;  1TZO A;  1L4D B;  1E7P B;  5D3D A;  1SE3 A;  1V97 A;  1PDX A;  3ZYY X;  2J42 A;  2DWQ A;  2BS4 B;  2IJ0 A;  3PZ8 A;  1E9M A;  3FIL A;  1SSN A;  4WH4 A;  5HFY A;  2GI9 A;  3BWU D;  5D3I B;  4D2K A;  1IGD A;  1D5M C;  2W55 A;  1ZUD 2;  1FRD A;  2I38 A;  2H88 B;  5EE3 A;  1L0X B;  2ZW0 A;  3I9V 1;  4IDI A;  4HEA 1;  1JWU D;  3CWI A;  3N9Y C;  1TKY A;  1FMA D;  1PGX A;  4A8X C;  1J7C A;  3Q8C A;  4UDU C;  3NVW A;  3AE9 B;  3NUH B;  1FNU A;  3DWG C;  3FAH A;  1XEE A;  3P1M A;  4REZ A;  5C3J B;  2KAJ A;  2L1A A;  1E0Z A;  1TJE A;  1QOF A;  1N61 A;  2BW2 A;  1PGB A;  1C4P A;  4KGR A;  2KAC A;  3IT6 B;  1IBX A;  1FNV A;  1TY2 A;  4YTN B;  1F2R I;  2EEL A;  3URY A;  3ZGZ A;  3TUO A;  2FUG 1;  3C8Y A;  2NMQ A;  4ZRP A;  1VZ6 A;  4HRO A;  2E6X A;  3ZJT A;  1F2R C;  1DGJ A;  4YXD B;  3FIL B;  1DYQ A;  2W3R A;  3NS1 A;  1C9F A;  1BXT A;  1D5X C;  4WAF A;  4OHJ A;  1FM0 D;  4C7Y A;  3B2F A;  1C77 A;  3MP9 A;  2B76 B;  2ZW1 A;  3TEZ A;  4FXC A;  4KKJ A;  4N6E B;  1HA5 A;  3SEB A;  2MEK A;  1UWM A;  4AS1 A;  2N9L A;  5AUK A;  3E9S A;  2ICI A;  3B9J A;  1FXI A;  2WU2 B;  3HUI A;  1KTK A;  1I4Q A;  1I4G A;  5MPO A;  1ROE A;  2PLP A;  1IBX B;  1FFU A;  1I4X A;  1T3Q A;  1T5X D;  2WLB A;  1E10 A;  4NAM A;  1K53 A;  4YSZ B;  4USA A;  2AQ2 B;  2JSV X;  1I4P A;  4B0M A;  1FXA A;  2PVG C;  3FC4 A;  2PVO D;  1V1P A;  1UGJ A;  2WXR A;  2RMM A;  4KGS A;  3TEX A;  3B2G A;  3Q8E A;  2JXT A;  4RF1 A;  5HHD G;  1YQ3 B;  1UWX A;  3EGR A;  1KH0 A;  2N9K A;  3CF4 A;  3AE2 B;  1OQR A;  5H92 C;  4MH8 A;  5E6J A;  2RDG A;  1XLN A;  4RGO S;  3AEF B;  3U2S C;  1TS4 A;  2YEP F;  5T8I A;  2WXH A;  3NRZ A;  3Q8A A;  1MPE A;  3AE4 B;  4YWG G;  4XWW A;  2FE8 A;  1D6E C;  1YJI A;  3P42 A;  4JX1 C;  5I4D A;  1DOI A;  3MFG A;  1KFY B;  1EWY C;  1C79 A;  1RWS A;  3AE5 B;  4MT5 A;  2QIE B;  1ZDV A;  2G9H D;  4GDK B;  4LLG M;  4NJC A;  1TS2 A;  1NYQ A;  2J52 A;  2WDQ B;  2PMV A;  1R7S A;  3RPF C;  3TSS A;  1C78 A;  2QMT A;  4ZOH C;  2CJO A;  3IAM 1;  1DOX A;  1V1P B;  2VZK D;  2WXF A;  2QEJ C;  1KLU D;  1SF0 A;  2KMM A;  5TSS A;  1FFV A;  4ARI A;  2GRI A;  1AWD A;  3SFE B;  2WXL A;  1T6B X;  5BYR A;  1XLO A;  2BB5 A;  1EM7 A;  1ZE3 D;  1SB3 C;  2DLB A;  3MHZ A;  2WXI A;  4A9A A;  1JWB D;  1HZ5 A;  2LFI A;  3IT4 B;  4HRS A;  1TYG B;  1A70 A;  3BZD B;  1SEB D;  1RFK A;  2LGI A;  2V4I B;  4NAW B;  1MHX A;  1L5P A;  1NVI D;  5EE1 A;  3AEC B;  1C76 A;  1PFD A;  3Q8F A;  5G5G A;  2M19 A;  2Y5C A;  3ZJU A;  1XF5 L;  1EU3 A;  4RCO A;  1ZOY B;  2AQ3 B;  4OZB A;  1FEH A;  1HQR D;  3MJ5 A;  4B0E A;  2J53 A;  2W3S A;  1SIJ A;  2JZP A;  3U7Z A;  1QOA A;  2AX5 A;  1VRA B;  1WGK A;  1L0Y B;  2K0P A;  5FR3 A;  1JAL A;  1XLQ A;  4C7Z A;  1QF6 A;  3EUB 2;  1QIL A;  1N5X A;  3KQ4 A;  2BS2 B;  1IGC A;  2YEP B;  1VJK A;  1I4H A;  1L6U A;  3H8H A;  2WP9 B;  5BMH A;  2LHD A;  1ET6 A;  3AMZ A;  4H2A A;  4TQ0 A;  2FBW B;  1L0V B;  5BMI A;  4HJG E;  4TMA B;  4WWM A;  3GS2 A;  3IAS 1;  2INP E;  1GPX A;  1YN5 A;  4WUR A;  4A55 A;  2WQY B;  2AQ1 B;  1OFF A;  2MJ3 A;  2MJD A;  3AB5 A;  5BYQ A;  3VQI A;  1JRO A;  1FNW A;  1VZ8 A;  3PZ7 A;  1FCC C;  3AEB B;  1E6E B;  2PIA A;  3R2I A;  3LXF A;  1ZPS A;  4KKI A;  1IUE A;  1L6V A;  2IGG A;  4US9 A;  1XCQ L;  4Q2J A;  2WXN A;  3ETR A;  1VDV A;  2HTM E;  2R61 A;  1AYF A;  3BK1 A;  5FK9 C;  4RH6 A;  1V1O A;  1I7H A;  2TSS A;  1H7X A;  3P4R B;  1VZ7 A;  1Y56 A;  2M0A A;  1ET9 A;  2WXQ A;  2JU6 X;  3WCQ A;  2WDV B;  1NEK B;  3AEG B;  2WS3 B;  4YSY B;  1CZP A;  2H89 B;  2JYT A;  2MH7 A;  2LMC A;  3R2T A;  1JCK B;  2K3U A;  1JWA D;  4RNA A;  3AM9 A;  3BK2 A;  2MJE A;  2BBC A;  1MHH E;  2KQ4 X;  2SAK A;  3SFD B;  2Y5P A;  3BII D;  1WYG A;  3TEY A;  2Z8L A;  4C80 A;  3GB1 A;  3AED B;  4ITK A;  3AH7 A;  1GB1 A;  1HZ6 A;  2WXO A;  2OHF A;  1VLB A;  1YN3 A;  1EWC A;  2QIL A;  3DWM A;  1C4A A;  1V8C A;  2PTL A;  3R8B A;  2E3T A;  3U4E G;  1GTE A;  4JE3 B;  3VR9 B;  4KGT A;  2ONQ A;  1N63 A;  3NVV A;  3RFZ B;  4DXF A;  2LJI A;  1B9R A;  2RDH A;  4XDC A;  5LNK 1;  4MAC A;  1SE2 A;  4O1N A;  2JX5 A;  2J4X A;  1RYJ A;  4XWT A;  1FRR A;  2W54 A;  2IDY A;  3BVM A;  2VZK B;  5H8Y E;  5HG2 A;  4A90 A;  1K51 A;  4DXG A;  2BS3 B;  3HVD A;  3KLS X;  4RF0 A;  4XDD A;  4YTP B;  1FCL A;  2M56 B;  3BVZ A;  4CQN A;  4OZC A;  5D7G A;  3AEE B;  1KLG D;  1UUP A;  3E56 A;  1PGA A;  1XLP A;  1TKG A;  2K22 A;  1YQ4 B;  3V05 A;  1BML C;  2ON8 A;  1TS3 A;  2G1E A;  3I57 A;  3W2D A;  1YMH E;  3LB8 C;  2WXM A;  2WDR B;  4US8 A;  4DQO C;  1FO4 A;  4AQ7 A;  3LYY A;  1P7F A;  1TKE A;  1PUT A;  3AE6 B;  4ZYS A;  5G5H A;  1MVK A;  5JXV A;  4PT5 A;  2BB6 A;  1TS5 A;  1VR9 A;  3O13 A;  5BMG A;  2BTE A;  3P4Q B;  1AW7 A;  2CU3 A;  2IPK D;  3BYT B;  1QQR A;  2I2Y A;  2V0G A;  4J3O D;  2WXJ A;  1WSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...