3QWZB

Crystal structure of faf1 ubx-p97n-domain complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
79
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 19
structure length 79
sequence length 81
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qwzB00
2N7EA 2LI5A 1YIWA 4TUUA 2DAFA 4J6IA 5JHBA 4IC7B 3CSTA 3RD2A 2KTRA 3CF6E 2RPQA 2ZVNA 4GXBA 5DPRA 3CSFA 2BKFA 2R2OA 3EECA 3OAWA 2KVRA 4OVUA 2KQSA 2K6DB 1FXTB 2DYMA 5DPTA 4GIVA 4PYUA 3UGBB 1WJUA 1LXDA 2O2VB 1V49A 1LQBA 2KDEB 3ZTCA 5IA7A 2JVCA 4NJ7A 4DWFA 1XD3B 1WGHA 2KWVB 1OGWA 2KMCA 2DHZA 2DZKA 4KIKB 4ANWA 3A9KA 2PJHA 2WDTB 3AU4A 3KUDB 2IO1B 3L16A 2LVOA 4E3CA 3R7RA 1WMHB 3EC8A 3QJZA 2DZIA 4KDLB 4BKSD 4E74A 4EEWA 4IG7B 1WZ0A 3H6NA 1E8YA 2Y5BB 4ZDVA 5JZEB 3L08A 4BVUC 1IP9A 1WY8A 3QAQA 2CHZA 2K8CA 1WJ4A 4LJOB 5E6PA 4DDID 2XK5B 2NR2A 3VH3B 5E6OA 3DQVA 3WALA 3QWZB 2BGFA 3V62A 4MEMA 1J19A 4MGIE 4ANXA 2KMAA 3L0WB 1KJTA 3L54A 2J0KA 2A4ZA 3VTUA 4W9KA 1WGGA 3LJ3A 4WWPA 2M17A 2M0XA 5C1ZA 5BO4B 4MJSA 2AL6A 2FCNA 1WXMA 4FJZA 1WE6A 3I3TB 2KOXA 3PT2B 4G50A 4WJNA 2KDBA 2CKHB 3BINA 2K8HA 3LDZE 5TR5A 4F7ZA 5DPWA 2KFKB 2GMIC 3V6EB 3VXWA 2ZPYA 3H7PB 1WFYA 1Q5WB 4B95A 1GC7A 3QK0A 4GMVA 2HTHA 4NAWB 2XK5A 2KTFA 2NVUI 2EMTA 4FJVB 4CO7A 4FJYA 2IZVB 3BY4B 2I1KA 4MSQB 3X23A 3KYCD 4HXDA 4NQKE 3K9PB 1ZGUB 3DVNV 3AULA 1E90A 4II3B 2BF8B 5C23A 4XZ4A 2CHWA 3TBLD 2MLBA 2LD9A 3SHQA 1P1AA 2MWSB 2KANA 2ZZPB 1TBEA 1V2YA 3H7SA 4MGKE 3DVGY 4W9LA 4GB9A 3ZUNA 3Q3FA 4W9JA 1SGHA 3EFUA 4YL8A 1GG3A 3OJ4B 3PGEA 1J0GA 3HHMA 3CMMB 3PPAA 5IAAC 3RULA 2MP2B 1D3ZA 2XBBC 4HCPB 4G11A 1BT0A 3VUWA 2KD0A 4EOYA 3ZO5B 3Q3JA 4N9F4 2N1WA 3NZSA 1LM8B 3NZUA 3U8ZA 3MTNB 2JY6A 2KJRA 2NS5A 2WX0A 1I42A 3L13A 2O2VA 5HKHA 4M8NA 1MG8A 3QA8A 5AEKB 1S1QB 3ONSA 1YQBA 4GDLA 3APFA 2JZZA 3JSVA 2CHXA 2MSED 1P9DU 1OQYA 2IO3B 3KW5B 3W1YA 4ASWC 4F8CB 4FADA 2MX2A 2GBKA 3VDZA 4PYZA 1E8WA 1ZW7A 2IY0B 3PTFC 4BKGA 3B1LX 2B3AA 3NS8A 1WGRA 3N32A 4JGHB 4B6WA 2RGFA 4HK2A 2Z0EB 1GJZA 4KVGB 4TV3A 1V9JA 5DPSA 2L00B 3M62B 1I35A 2NBVB 3WAMA 4TQ0A 4G0NB 4EFOA 4AWJA 1UGMA 2C5LC 2O6VB 3RYTA 1WZ3A 4KSKC 2MBHA 3QX1A 4MM3A 1Z2MA 4E71A 2CU1A 4GN1A 4MSMB 3PREA 5CX3A 3ENEA 3D32A 3T8MA 4M0WB 2IYDB 4WWOA 3JW0X 2D3GA 1L7YA 2J0JA 4MDKE 2Z0DB 1GC6A 3RUIB 4W9FA 3IHPC 3UQAA 2HJ8A 3QHTA 3DVNU 4PS8A 4ZRJA 2D11A 3EHVA 4WJPA 1IPGA 3PVLA 1WYWB 3TIXA 3VUXA 1G6JA 3TJPA 2MBOA 2JRHA 1XT9B 3A4RA 5JH5C 2G4SA 2ZJDA 1UELA 2FNJB 2D07B 2MW5A 4HWIB 4JIOU 2KJHB 2NCNA 1WH3A 5CHVC 3PS6A 2I1JA 3N30A 4II2B 3ML9A 2FCQA 1WX7A 2NBUA 4PS7A 2XEWA 4I6NB 1WRDB 4TQ1A 1J8CA 3OLMD 2KNBA 1SE9A 5G2NA 4A20A 2DYBA 3L17A 4X57B 4FN2A 3VVWB 2KX3A 2LVQA 4EKUA 3VAWA 5AZFA 2N9XA 4HDQA 3A9KB 1RLFA 3KVFB 5DCNA 5KHOA 3ALBA 4DK5A 3DBRI 2KDIA 2JWZA 1OEYA 3HIZA 1WMHA 3QARA 4JL9A 1RFAA 1P98A 2YVCA 4EZKA 1WF9A 1SIFA 2UWQA 4EUTA 1VCBA 2K8BA 1EO6A 3A9JA 1PQSA 4FLHA 4HVBA 3ZDTA 3DBLI 4AJYB 4GSWA 2PEAA 3DOWA 1KM7A 2WX1A 1NDDA 1R4MI 1WXVA 3RT3B 2KJ6A 1WE7A 2MQJA 1ZKHA 4GOCA 4TKNA 2FAZA 3TCAA 4FHJA 4DXAB 3WANA 1H8CA 4G3XB 2MBBB 4W9EA 2DX5B 1E7VA 2JF5A 3V60A 2G45B 4XC2A 2NPTA 3U30A 2L8JA 3W1SA 1IYFA 3ZNGC 3A1QB 3DDCB 2LGYA 3KH0A 3U7DA 3L10B 4FULA 1HE8A 1V81A 2LZ6A 1P3QU 3IG3A 3KUZA 5L95C 1NI2A 3SU8X 4NY0A 2KFKA 3VTWA 2AYOB 4BBNF 2EMSA 3H7PA 4IWPA 3UQBA 1KLVA 5D94A 1V86A 3IFWB 4K81A 2AWTA 1WXSA 3APDA 2K25A 3ZTDA 2RSUA 2L05A 2DENB 2KX0A 1WGDA 2O6VA 1YD8U 4IM2A 2L3ZA 2V4LA 4ICUA 2D10A 1E8XA 3UIPB 2D2QA 1OEYJ 4F1SA 3DVGX 1WXAA 4KZ0A 1AARA 2C7MB 2DAJA 4CYEA 3DCGA 3PLVA 2JXXA 3M95A 3ZRCA 4OVVA 4BOSC 4LDTD 4RM8A 2KK8A 2LASA 3A4SC 2MBEA 2KLCA 1RAXA 4BKSA 4GU2A 4GDKA 3A33B 4K7WA 1F9JA 3R66C 3H1UA 2L0TA 3X0WA 5FR6A 1TGZB 2Z59B 2ASQA 1S3SG 3VTVA 4BOZB 3VUYA 2N7DA 4EZLA 1LFDA 5L83A 1QZEA 1E8ZA 1WJ6A 1E7UA 2DZJA 1M94A 4NAWA 2CS4A 2NBWB 4GGQA 5D6JB 4B9KA 2PPHA 3RZFA 3KUCB 4W9CA 3RCZA 3GZNI 1WJNA 4W9GA 3OJ3A 3K9OB 2YLMA 2W9NA 3SDLC 5LXIB 2VRRB 2FCMA 1R4NI 2G3QB 2KFJA 3VH4B 3WA0A 5CHFA 2KDFB 2FCSA 2LUEA 1JRUA 4ZRKA 1YX5B 3ZIMA 1EF5A 2J7QB 1WX9A 5CTRC 2ZNVC 4IUMB 2GBMA 3MHSD 3JYUA 3QIJA 3ZLZA 5E6NA 1WR6E 1NBFC 2LVPA 2ZPNA 3PRPB 2KC1A 3PSEB 4GDKB 4WJQA 3TMPB 2K39A 3AXCA 3WIMA 3ZVVA 4NQLB 5AZGA 2REXA 2V1YA 2BKRB 1Q0WB 4WAAA 2K1FA 2MP2A 4WJOA 1EF1A 4IWQA 4DHZB 4MGZE 1U4AA 4AJWA 1RRBA 4MH0E 4KV2A 4K7UA 3TL5A 4LDTB 3ZRFA 3QC8B 1UH6A 2M8SA 1WI0A 3WAPA 1P0RA 4ZYNA 3R7QA 4ICVA 2AEHA 1ISNA 1WGYA 2N9PC 2ZVOA 2L76A 3O65B 2N9EB 4K7SA 2KO3A 2CR5A 4FA6A 4MGYE 4XX5A 2BWFA 2MRPA 2IY1B 1T0YA 2NPTB 3B0AA 4HJKA 2LWPA 3UIOB 1WX8A 3C0RB 4A3OA 3A1QA 2M4NA 1XQQA 2KHWB 3V61A 2BYFA 1L2NA 3AU5A 2JRIB 3IVFA 4HPMB 1V5OA 4BFRA 2UYZB 3RZWC 2HE7A 1UBIA 2HD5B 4NNJB 3UF8A 2BYEA 2ZCCA 4HCNB 1A5RA 4IM0A 1KOTA 2JPHA 3HM6X 1WM3A 3ML8A 2GBNA 5CHWA 5EDSA 5D2MB 3ZNZB 4ZRIA 5JHAA 3HM3A 3V6CB 5J17A 2L7RA 2JUOA 4WQOB 2WWZA 2JZ3B 2BPSA 2LGXA 3M63B 1K8RB 5LXHA 3H9DA 1E5WA 4WWNA 4W9DA 3T9LA 1X1MA 1Y8RC 3NY5A 4IWOA 4W9HA 4DDGD 4AUQC 1Z5SB 2KQ7A 2GBRA 2L0FA 3ECIA 2KKCA 3ZDMC 3ZKJC 3R3MA 2KXJA 3DBSA 4MELA 5KHQA 4I6LB 2JT4B 2RD0A 4KZCA 2C9WB 4DHJD 2QHOA 2DYOA 5GMVA 2J0MA 3APCA 2WYQA 3NHEB 1TZ1A 3VQIA 5J2RA 3A9JB 3QQ8B 4I6PA 2C7HA 2AL3A 2IO0B 2O6VD 2R2QA 4KDIC 2IO2B 3PLUA 3UINB 3ZNHB 2KWCA 2ZCBA 3HK0A 1UBQA 5LLIA 2IBIB 3PV1A 2OOBB 2KWUB 3M3JA 3N3KB 1UZXB 4NPNA 2A5UA 3GOEA 4RM9A 2K6QA 4LCDE 4URKA 1EUVB 4BBNC 2PE6B 2FIDA 2MA9B 2RR9A 1GUAB 3KYDD 3B08A 4DHZE 3PHWB 3VHTC 1C1YB 2BWES 4GDLB 1VD2A 4BKTA 4MJSB 3JSVB 2FUHB 3IBEA 1V5TA 4JQWC 2DZMA 4FHKA 2MCNB 4IM3A 4M8MA 2LJ5A 2KN5A 2N1VA 4FBJB 3P2BA 2ZEQA 5AZHA 4RMAA 4ANUA 1YX6B 2LGDA 4NJ6A 4DBGA 3ZW3A 3PRZA 4LJPB 4JLCA 3NOBA 2LRWA 4HDOA 4PS3A 3WAOA 1WM2A 4KSLC 4W9IA 2GOWA 1Q1OA 1YJ1A 2KTRB 3JVZX 1TTNA 3VFKA 1V80A 4CHKA 2OJRA 4A3PA 1OTRB 4P7IA 1UD7A 1WIAA 3AI5A 3PRMB 3SD5A 4ANVA 5G55A 1GNUA 2KC2A 1WR1A 4HLEA 2LXAA 3QCAA 4IW0A 2KZRA 5J18A 3MJWA 2BYVE 2C7NB 4HPLB 2GBJA 4K1RB 2EKEC 1C3TA 4EZJA 3S2AA 2V3SA 3PZDA 5D7GA 2ZNVB 3ZNID 4AP4C 2M1MA 1CMXB 2G4DB 4KIKA 2PE9A 1H4RA 2LRUA 3DPDA 2C60A 3DBHI 2N4FA 4AOFA 2MBQA 3PHXB 4DHJB 3W1SC 2LXCA 2FIFA 1V6EA 2KLGA
chains in the Genus database with same CATH superfamily
1YIWA 1XLOA 4J6IA 4M02A 2RPQA 4B0EA 2ZVNA 4GXBA 5DPRA 1D4BA 4P6VF 4OVUA 1XLNA 1L6UA 2DYMA 3AB5A 3UGBB 4P1CC 1MI0A 1LQBA 2RMMA 1L5PA 1XD3B 2W55A 2DHZA 2L52A 3A9KA 2WDTB 3L16A 2IO1B 5C2TB 2M0AA 2WXIA 3QJZA 4E74A 2DZIA 1PYWD 5JZEB 1SE2A 1WJ4A 3DQVA 1TS5A 2BGFA 1F1HA 2V0GA 3AEGB 3L0WB 4NJCA 1WGGA 2BS3B 1WYGA 2M0XA 1JMLA 2E6XA 2BQQA 4MJSA 4RGTA 2JQRB 1XCQL 3ZYYX 4WJNA 2CKHB 2QILA 2K8HA 2JSVX 2KFKB 4C00A 3V6EB 1ZE3D 2ZPYA 4B95A 3RNGC 2KTFA 2EMTA 2QEJC 2I1KA 4MSQB 3X23A 4KGRA 3R2TA 4NQKE 1V1PB 1ZGUB 3DVNV 1QF6A 1N61A 4XZ4A 3GS2A 2LD9A 1LGRA 2ZZPB 1TBEA 2HTME 4MGKE 2QCZA 4LLGM 3AE2B 3EFUA 1DOIA 1NYRA 3CMMB 3PPAA 2G9HD 3RULA 4HCPB 3VUWA 4NAMA 2KD0A 1YN4A 1I4PA 1HTQA 2GRIA 2QDFA 3IAM1 2N1WA 3AE1B 2JY6A 1JALA 1MHXA 2KJRA 3L13A 1E9MA 1AYFA 4M8NA 4M01A 1B9RA 4JPSA 2IGDA 1S1QB 3DBHB 3APFA 5BMIA 2IO3B 3Q3NC 4FADA 2MX2A 4BKGA 3PTFC 2BS4B 2B3AA 3N32A 2RPVA 4JGHB 4KVGB 4TV3A 4N58A 3M62B 1QT9A 1FMAD 3Q8AA 4G0NB 4US8A 1DOXA 1ZXIA 3RYTA 4WWMA 4KSKC 2MBHA 3QX1A 3KLSX 4HKZE 4MM3A 4MSMB 4GN1A 4YTPB 3IT6B 3D32A 3JW0X 1KLUD 3NUHB 2JYTA 4S17A 4PS8A 4ZRJA 3PVLA 2JRHA 5JH5C 5IKCM 1UELA 3AM9A 2D07B 2MW5A 1WH3A 3PS6A 4II2B 3AE6B 3ML9A 2FCQA 1BXTA 2XEWA 4I6NB 1QOAA 4ZHPA 1J8CA 5BMGA 4X57B 2LMCA 2LUMA 5AZFA 1RLFA 1ZUD2 2R61A 1F77A 2KDMA 3HIZA 2WQYB 4KGSA 3FAHA 4C7ZA 1WF9A 1SIFA 1OFFA 4EUTA 3MJ5A 3TSSA 1WE7A 4GOCA 3LB8C 3NS1A 4G3XB 2MBBB 1MFWA 4W9EA 2DX5B 3P1MA 1PFDA 2NPTA 2L8JA 3PZ7A 3L10B 2OEDA 1HE8A 2IGGA 2LZ6A 1P3QU 1C4PA 5L95C 5MPOA 1IBXA 3VTWA 4JWSC 2AYOB 1HEZE 1KLVA 5D94A 2E3TA 2MJEA 4REZA 2K25A 2INDC 2V9HA 4M00A 4GLSC 2D3CA 2O6VA 2I2YA 1E8XA 2WXQA 1EWYC 3BYYB 1T0QC 2D5GA 1WXAA 2DAJA 1ZOYB 3GZNB 4LDTD 2K0PA 1GPXA 2LASA 2M19A 2MBEA 3ZJVA 2L0TA 2XN9C 2ASQA 1WXQA 2N7DA 3GB1A 1E8ZA 3AV8A 2NBWB 2PPHA 3FKYA 3RZFA 3GZNI 3OJ3A 1F0ZA 5LXIB 2VRRB 2G3QB 3WA0A 1JRUA 3ZIMA 2ZNVC 1L6VA 1WR6E 1ZXHA 2KC1A 2CU3A 2Y5CA 2V1YA 1Q0WB 2K5PA 5TSSA 1EF1A 1I4GA 4DHZB 1TKEA 1RRBA 1RFKA 4K7UA 3R7QA 3Q14C 4ICVA 2AEHA 1WGYA 2N9PC 3N20C 1WGKA 4MGYE 2BWFA 2NPTB 3A1QA 2M4NA 2WNMA 2BYFA 2N7JA 3IVFA 4HPMB 1UBIA 2ZCCA 2N0SB 4IM0A 3B2FA 4C7YA 3ZNZB 2QMTA 2DBYA 3V6CB 5J17A 1J7BA 2BPSA 2LGXA 4WWNA 1ZP0B 1GB1A 4IWOA 5EE3A 3IT4B 3ZDMC 4OZBA 4HKQA 1I4QA 3DBSA 1MVKA 1T0RC 2Y3AA 4XYCA 3NJTA 2C9WB 4DHJD 2QHOA 1JWUD 1FXIA 3VQIA 1TZ1A 1XXGA 1LO5D 3RNBC 2IO0B 3UINB 3BVMA 3ZNHB 2HDEA 1CQVA 3FILB 2KWUB 3AE3B 4ACFA 2A5UA 2FIDA 1N5WA 3PHWB 4GDLB 1TIFA 4MJSB 1JRPA 3IBEA 4NZLB 2KN4A 4HRSA 5AZHA 4DQOC 2LGDA 4NJ6A 1SJHD 3TEXA 2WXHA 3NOBA 4KSLC 2JWUA 4W9IA 3NVYA 2CJOA 2VZKB 4CHKA 3BVZA 3C19A 3PRMB 3DWMA 2INCC 1VR9A 2PTLA 4XWWA 2LXAA 4IW0A 1ESFA 2C7NB 2GBJA 2EKEC 3P4RB 2V3SA 4AP4C 3H8HA 1TS3A 1CMXB 3U2SC 4KKJA 3NZ3A 4XDCA 1M4VA 5FR3A 1V6EA 2N7EA 4WQMA 4C56C 2DAFA 4EE2A 1C9FA 2WDQB 1ROEA 2OHFA 2NTSA 4IC7B 2KTRA 3CF6E 3DHGC 2KQSA 5DPTA 2TSSA 1WJUA 1FCCC 2O2VB 1V49A 1ZDVA 1BUIC 2KDEB 2JVCA 2WP9B 4NJ7A 1FPYA 4DWFA 4L23A 4ARIA 2KMCA 2PJHA 2LVOA 4YSYB 1WMHB 1WZ0A 2Y5BB 4ZDVA 1IP9A 4BVUC 4RGMA 2K8CA 5E6PA 1K51A 3DHIC 4BZAA 3WALA 3V62A 4C4VA 4MEMA 1J19A 3FILA 4ANXA 2H88B 2KMAA 3V3XA 2MJ3A 2J0KA 3Q8EA 2M17A 2PMVA 3P42A 2QSDA 1WXMA 4FJZA 5JXVA 1CZPA 3BINA 3LDZE 3AE4B 5DPWA 1XF5L 3VXWA 4GMVA 2AQ2B 4CO7A 4FJYA 3BY4B 5FKAC 4A9AA 3GE8C 3K9PB 2IPKD 1WRIA 3AEBB 2BF8B 3TBLD 2CHWA 3SHQA 2MWSB 4AS1A 2WXRA 3ZUNA 3Q3FA 1N63A 1SGHA 3W5VB 2N9KA 1GG3A 3OJ4B 1C78A 3HHMA 2MP2B 2XBBC 4G11A 4J3OD 3ZO5B 4N9F4 1LM8B 3NZUA 2O2VA 5AEKB 1MHHE 3ONSA 1YQBA 4GDLA 3L4PA 3JSVA 3W5UB 2YEPF 2MSED 4S0RA 1FNUA 3W1YA 4ASWC 2GBKA 1E8WA 2IY0B 4Q2JA 2NTTA 4TSSA 3B1LX 4B6WA 1I4HA 4HK2A 3Q69A 1WWTA 1I35A 3WAMA 1CJEA 4TQ0A 2ACZB 4EFOA 1PGXA 2O6VB 1Z2MA 1XCTL 2CU1A 5CX3A 1L0YB 1UF0A 1ET6A 3DBLB 2J0JA 4MDKE 1CK1A 4JWUC 3RUIB 1N62A 3EHVA 3TIXA 1IPGA 3SEBA 5AUIA 3C8YA 2K9XA 1XO3A 2KJHB 4A90A 3U4EG 4A6QA 5CHVC 1D5XC 3N30A 1WX7A 2NBUA 1UGJA 4TQ1A 2WXNA 2KNBA 5G2NA 2K22A 3VVWB 3SFEB 1D5ZC 2N9XA 4HDQA 3A9KB 3KVFB 1JW9D 2L32A 2WDVB 3ALBA 1OEYA 4JL9A 1RFAA 2YVCA 1I4XA 1VCBA 2K8BA 3A9JA 3I63C 3DBLI 2WX1A 4YTMB 1WXVA 3N1ZC 3TCAA 4DXAB 2BTEA 3WANA 2LHEA 1E7VA 2JF5A 1KLGD 2J53A 1RYJA 5H92C 2G45B 4XC2A 3ZNGC 3A1QB 2LGYA 3U7DA 4P1BC 1V81A 3IG3A 3KUZA 4LNKA 3HVDA 4NY0A 2KFKA 2KYWA 3OG5A 1SE3A 4ARCA 1JWBD 1XLPA 3APDA 1WXSA 3N1XC 1YD8U 2V4LA 3AE9B 1GAQB 2ON8A 4KZ0A 2C7MB 4CYEA 3DCGA 1HXYD 4OVVA 4BOSC 1OQQA 4RM8A 4BKSA 1NENB 4GDKA 3A33B 4K7WA 3R66C 3H1UA 1PGBA 5FR6A 2KQ4X 1E10A 1LFDA 1V8CA 1QZEA 3HUIA 3WCQA 1M94A 2D3BA 4W9CA 1DOYA 2Q5WD 4W9GA 2FCMA 3VH4B 2J52A 2FCSA 4ZRKA 3BIID 1SJED 1WX9A 3MHSD 3TMPB 2LVPA 3PSEB 2WXJA 2REXA 2K1FA 4ZOHC 4WJOA 4IWQA 1K52A 2PLPA 3R8BA 4MGZE 4LDTB 3QC8B 1UH6A 2ONQA 3P4QB 1NI3A 5GXGB 2FE8A 3B0AA 2MRPA 1T0YA 4HJKA 2LWPA 3UIOB 4A3OA 2KHWB 3AU5A 3IAS1 2LEKA 3E9SA 2HE7A 1A5RA 4HCNB 4YXDB 1KOTA 3HM6X 1WM3A 4WIPA 5EDSA 1R4MB 1VZ6A 2JUOA 4USAA 2JZ3B 1L4ZB 3M63B 3H9DA 1SB3C 4W9HA 4DXGA 3T3NA 2GBRA 2KKCA 3R3MA 3AN1A 5KHQA 3B9JA 2RD0A 2XNAC 4KZCA 4LNNA 1VJKA 4LNIA 2J0MA 3APCA 3NHEB 2WXFA 2R2QA 4LNOA 2KWCA 2ICIA 3AE8B 4BAXA 5LLIA 5EE0A 2X38A 2OOBB 1UZXB 2PVGC 4RM9A 2K6QA 4LCDE 4URKA 3DBRB 2PE6B 3I57A 2MA9B 2RR9A 3KYDD 4B0MA 3PZ8A 4BKTA 4YSXB 1TJEA 2FUHB 5HFYA 1FIQA 4JQWC 4FHKA 4IM3A 2LJ5A 2KN5A 3O13A 3P4SB 2N1VA 4ANUA 4RMAA 1TKYA 4LJPB 3ZJTA 4JLCA 1E0ZA 4PS3A 2V4IB 1WM2A 1Q1OA 2KTRB 2PVOD 3JVZX 2W54A 4DXFA 1V80A 3AH7A 4A3PA 1OTRB 4P7IA 1IGCA 1GNUA 1SIJA 1WR1A 2WU2B 1NYQA 5J18A 3MJWA 2IGHA 5BYQA 2N9LA 1C3TA 4XDDA 5D7GA 2PIAA 1H4RA 2V3NA 2W82A 2MBQA 4DHJB 3TUOA 3BYTB 2FIFA 3OLMD 3JYUA 4RGOS 3LXFA 2L1AA 2LFIA 3CSTA 4MT5A 1QKZA 3CSFA 3OAWA 2KVRA 2K6DB 4GIVA 2J42A 3BWUD 3ZTCA 1C76A 5IA7A 3I9V1 2HJ1A 2KWVB 2WGSA 2D3AA 2DZKA 4KIKB 3KUDB 2GB1A 1PGAA 1MG4A 4E3CA 4KDLB 1MPEA 3HRDD 1N5XA 4IG7B 1PDXA 1QLBB 2G1EA 3H6NA 3VR9B 1WY8A 3QAQA 2CHZA 1EM7A 2KT7A 3VH3B 4JX1C 5E6OA 1QQRA 4MGIE 1FM0D 1JWSD 3VTUA 3LJ3A 4WWPA 3MC0B 4H2AA 4XGAB 3PT2B 2KOXA 4WAFA 2KDBA 4D2KA 1D5MC 4RGNA 5EE1A 4F7ZA 2GMIC 1GC7A 3QK0A 2HTHA 4NAWB 2XK5A 4FJVB 2KAJA 2IZVB 4N59A 3ABVB 4WURA 3KYCD 2JXTA 3Q6BA 3AULA 1E90A 4II3B 3HVZA 2MLBA 1P1AA 2KANA 1DGJA 3H7SA 3DVGY 3GP7A 5G5HA 4YL8A 3PGEA 5IOIA 1J0GA 4OHJA 1D3ZA 1TY0A 3NVVA 4EOYA 3VRAB 2SEBD 2BB6A 1FEHA 4RNAA 4WH4A 3MTNB 2NS5A 2WX0A 3W2DA 5HKHA 3QA8A 2WDRB 1AWDA 2CHXA 1P9DU 4IKGA 3KW5B 3VDZA 1TYGB 1ZW7A 2WS3B 3MP9A 3NS8A 1BMLC 1WGRA 2Y5PA 3ZGZA 2WU5B 2Z0EB 1GJZA 3MFGA 1V9JA 5DPSA 3FC4A 2M56B 4AWJA 4JE3B 2C5LC 2AQ1B 3NRZA 1SSNA 2BVCA 3ENEA 3T8MA 4WWOA 2D3GA 3RI7C 2Z0DB 4W9FA 5I4DA 3QHTA 3N9YC 4FXCA 2D11A 4WJPA 1G6JA 3VUXA 3TJPA 2MBOA 1UUPA 3RMKC 3RNAC 1XT9B 3A4RA 2G4SA 2ZJDA 5FK9C 3J9CA 4HWIB 2PW9A 1J7CA 3MC8A 2NCNA 2EELA 4PS7A 1SE4A 2VH2A 1WRDB 4OVZA 4IDIA 2B76B 4FN2A 2KX3A 2LVQA 5IN7A 3VAWA 2JU6X 4DK5A 3DBRI 1WMHA 3QARA 4EZKA 4R3DA 2RDGA 4FLHA 4CQNA 3ZDTA 2PEAA 1KM7A 1R4MI 2KJ6A 2MQJA 1ZKHA 2FAZA 1N6ZA 4LK0M 1C4CA 4LTUA 1VDVA 2ZW1A 1R4NB 3U30A 1IGDA 1IYFA 3DDCB 1XEEA 4FULA 1E6EB 1JROA 3SU8X 2WXMA 1HTOA 4OZAA 4IWPA 1V86A 4K81A 3RNFC 1FNVA 2RSUA 1I7HA 2BYTA 2L05A 1F2RC 2DENB 5IO9A 1JWMD 1MJDA 2L3ZA 1YNTE 1Q10A 4ICUA 2D10A 2D2QA 1D6EC 4F1SA 3DVGX 2LJIA 3PLVA 3KWLA 1EWCA 3U52E 2KWDA 3TEZA 3A4SC 5BYRA 1ACCA 1ZDXA 4K3CA 3X0WA 1TGZB 3VTVA 1S3SG 4L1BA 4EZLA 5L83A 3EGRA 1WJ6A 3AEEB 1E7UA 4C4VB 4B9KA 2W3SA 3RCZA 1WJNA 4YWGG 3K9OB 1TS4A 2YLMA 3SDLC 1R4NI 2KFJA 3T3OA 2KDFB 1YX5B 1EF5A 2J7QB 1P7EA 4KKIA 5CTRC 5D3IB 4IUMB 2GBMA 3QIJA 5BMHA 5E6NA 4WJQA 2K39A 3EUB2 3ZVVA 1K50A 1T5XD 4WAAA 2BKRB 1E7PB 4A8XC 2MP2A 1T6BX 1U4AA 5HHDG 2X8XX 3ZRFA 3WAPA 1P0RA 4XWTA 1V1PA 1KTKA 2ZVOA 2L76A 2I38A 2N9EB 4K7SA 2WLBA 2YEPB 2CR5A 3P63A 1T0SC 4FA6A 2WHIA 3BK2A 4XX5A 1AW7A 2IY1B 3NG0A 1FFVA 1KH0A 1XQQA 3Q8FA 1RWSA 4BFRA 2UYZB 4NNJB 2HD5B 5LNK1 2BYEA 1F2RI 3IXSA 1VLBA 2GBNA 1HQRD 3LYYA 4ZRIA 2L7RA 1F52A 4KGTA 2WWZA 3BZDB 5HG2A 3N1YC 2BS2B 4RFBA 4MM3B 4OW0A 4AQ7A 1X1MA 3NY5A 3DHHC 4AUQC 2L0FA 3ZKJC 2KXJA 2MHJA 5GMVA 1FO4A 2WYQA 3A9JB 3QQ8B 2NMQA 4I6PA 2RDBC 2O6VD 4KDIC 2IO2B 1NEKB 1C77A 2IBIB 1HZ5A 3M3JA 1EUVB 4BBNC 3DWGC 1C1YB 2BWES 1YN3A 1C79A 1V5TA 2MCNB 4M8MA 1YMHE 1ZPSA 2ZEQA 1YX6B 1R7SA 4DBGA 3ZW3A 3PRZA 4RH6A 2Z8LA 2SAKA 4PK1A 3NVZA 3WAOA 1TKGA 3AE7B 2GOWA 3AMZA 1TTNA 3VFKA 1WIAA 3AI5A 3SD5A 4ANVA 1XLQA 2K3UA 4KX6B 4HPPA 2KZRA 2GLSA 3W9CB 2BYVE 4HEA1 4HPLB 1A70A 1YJJA 3VR8B 4EZJA 3S2AA 1FXAA 3ZNID 2M1MA 1V97A 2G4DB 2PE9A 2LRUA 3DPDA 2C60A 2N4FA 3PHXB 3I5JC 2LXCA 4US9A 2KLGA 1GB4A 2LI5A 4TUUA 1QOBA 1OQRA 5JHBA 3RD2A 1N60A 4ZRQA 2BKFA 2R2OA 3EECA 1FXTB 4PYUA 4RCOA 1LXDA 1C4AA 3EFCA 1WGHA 1OGWA 4RF1A 4ANWA 3BK1A 3AU4A 4A55A 4ZHOA 3AE5B 1IBXB 3R7RA 3EC8A 4BKSD 4EEWA 3ZXRA 3CIRB 4XE0A 1E8YA 2CJNA 3L08A 4LJOB 4DDID 4YTNB 2XK5B 2NR2A 2WXKA 3QWZB 1KJTA 3L54A 4ZRPA 2A4ZA 4W9KA 1RM6C 5C1ZA 1YN5A 2QJLA 5BO4B 2AL6A 4OZCA 2FCNA 1WE6A 3I3TB 4RF0A 4G50A 5TR5A 4MH8A 1FFUA 4C80A 2FBWB 3H7PB 1WFYA 1Q5WB 3RN9C 1WSPA 2NVUI 2KMMA 3Q8CA 4HXDA 5AUKA 5C23A 1V2YA 2IDYA 4W9LA 1UWXA 4GB9A 4W9JA 3KQ4A 5IP4D 3P4PB 3OWEB 5IAAC 1BT0A 4IOIE 3Q3JA 3NZSA 2WXOA 1UNSA 3E56A 3U8ZA 1I42A 3PO0A 3AEAB 3RPFC 3CWIA 1MG8A 3SFDB 3URYA 4HJGE 2JZZA 1OQYA 4F8CB 4PYZA 1J7AA 2VH1A 3MC9A 2RGFA 1FRRA 1FNWA 2L00B 1AN8A 2NBVB 2LGSA 1UGMA 3TEYA 1DYQA 1WZ3A 1QOGA 4E71A 2J4XA 3PREA 4M0WB 2IYDB 1L7YA 1T3QA 1GC6A 2AX5A 3IHPC 3UQAA 2HJ8A 3DVNU 2L83A 3NVWA 2MH7A 1JQ4A 1WYWB 3RNEC 2FNJB 4JIOU 1FD6A 2JZPA 4UDUC 3EA6A 2DNFA 2I1JA 2BBCA 2FUG1 2GI9A 1SXTA 1SE9A 4A20A 2DYBA 3L17A 4P16A 3VRBB 4EKUA 5HI1A 5DCNA 5KHOA 2LHDA 2KDIA 2JWZA 2MEKA 1P98A 2UWQA 2JYEA 3V05A 1EO6A 1PQSA 1NVID 2INPE 4HVBA 4ITKA 4AJYB 4GSWA 3KWVA 3DOWA 1NDDA 3RT3B 1P7FA 3Q8BA 4TKNA 4FHJA 1H8CA 3ZXVA 2WXGA 4L2YA 3B2GA 1L4DB 3V60A 3MHZA 1SF0A 4LNFA 3W1SA 4TMAB 4YT0B 2UU7A 3KH0A 2JX5A 1KF6B 1NI2A 4K3BA 1FCLA 4BBNF 1PUTA 2EMSA 3H7PA 3UQBA 3R2IA 2MJDA 3IFWB 2AWTA 5E6JA 3ZTDA 2QIEB 1TT5B 2KX0A 3U7ZA 1WGDA 3AEDB 1TS2A 4IM2A 2W3RA 3UIPB 1OEYJ 1AARA 2JXXA 3M95A 3ZRCA 5G5GA 2KK8A 3GE3C 2KLCA 1RAXA 4GU2A 2DWQA 1F9JA 1QILA 2Z59B 2LGIA 1JCKB 1FRDA 4BOZB 2DLBA 3VUYA 2DZJA 4O1NA 4NAWA 3AEFB 1UWMA 2CS4A 4GGQA 5D6JB 3KUCB 1K53A 5D3DA 2IJ0A 2W9NA 4HROA 5CHFA 2LUEA 2AQ3B 3ZLZA 3TEWA 2ZPNA 1NBFC 3PRPB 5JHAA 3AECB 4GDKB 1YOVB 3AXCA 2BT6A 2WXPA 3WIMA 4NQLB 5AZGA 2V3PA 4ZYSA 1L0XB 4AJWA 2EKIA 4MH0E 4KV2A 3TL5A 2BW2A 2M8SA 1WI0A 4ZYNA 1QOFA 1B1ZA 1ISNA 3SR6A 1Y56A 3O65B 2OJWA 1VRAB 2KO3A 4M0WA 5T8IA 1YQ4B 1WX8A 3C0RB 2PKOA 3V61A 1L2NA 2JRIB 1V5OA 3RZWC 4MACA 3UF8A 2BB5A 2H89B 2JPHA 1GOZA 3ML8A 5CHWA 5D2MB 3HM3A 4YSZB 4WQOB 1ET9A 1TZOA 2QC8A 2KACA 1K8RB 5C3JB 5LXHA 1EU4A 1E5WA 4W9DA 3T9LA 1Y8RC 3BVGA 4DDGD 3RFZB 1Z5SB 2KQ7A 3ECIA 1KFYB 4MELA 4I6LB 2JT4B 1V1OA 5BYSA 1YQ3B 3Q3MC 2WXLA 1SBBB 2DYOA 5J2RA 4PT5A 1IUEA 2C7HA 3Q3OC 2AL3A 1HA5A 1ENFA 2ZCBA 3HK0A 1UBQA 2VZKD 2INNE 3PV1A 3ZJUA 3N3KB 1EU3A 4NPNA 1L0VB 3GOEA 2RDHA 1I4RA 1GUAB 3B08A 4DHZE 1JWAD 3VHTC 1VD2A 3JSVB 2DZMA 2KVZA 1TY2A 4FBJB 3P2BA 4QAYA 1VZ8A 1YJIA 2LRWA 4HDOA 1HZ6A 1YJ1A 2OJRA 5H8YE 1UD7A 3UI3A 5G55A 1SEBD 2KC2A 4HLEA 3QCAA 3RNCC 3ETRA 5EE9A 4K1RB 3PZDA 2ZNVB 1VZ7A 4KIKA 3Q2AC 3DBHI 4AOFA 4N6EB 1KRHA 1STEA 3W1SC 3ZQ4A 2ZW0A 3PLUA
chains in the Genus database with same CATH topology
2N7EA 2LI5A 1YIWA 4TUUA 2DAFA 4J6IA 5JHBA 4IC7B 3CSTA 3RD2A 2KTRA 3CF6E 2RPQA 2ZVNA 4GXBA 5DPRA 3CSFA 2BKFA 2R2OA 3EECA 3OAWA 2KVRA 4OVUA 2KQSA 2K6DB 1FXTB 2DYMA 5DPTA 4GIVA 4PYUA 3UGBB 1WJUA 1LXDA 2O2VB 1V49A 1LQBA 2KDEB 3ZTCA 5IA7A 2JVCA 4NJ7A 4DWFA 1XD3B 1WGHA 2KWVB 1OGWA 2KMCA 2DHZA 2DZKA 4KIKB 4ANWA 3A9KA 2PJHA 2WDTB 3AU4A 3KUDB 2IO1B 3L16A 2LVOA 4E3CA 3R7RA 1WMHB 3EC8A 3QJZA 2DZIA 4KDLB 4BKSD 4E74A 4EEWA 4IG7B 1WZ0A 3H6NA 1E8YA 2Y5BB 4ZDVA 5JZEB 3L08A 4BVUC 1IP9A 1WY8A 3QAQA 2CHZA 2K8CA 1WJ4A 4LJOB 5E6PA 4DDID 2XK5B 2NR2A 3VH3B 5E6OA 3DQVA 3WALA 3QWZB 2BGFA 3V62A 4MEMA 1J19A 4MGIE 4ANXA 2KMAA 3L0WB 1KJTA 3L54A 2J0KA 2A4ZA 3VTUA 4W9KA 1WGGA 3LJ3A 4WWPA 2M17A 2M0XA 5C1ZA 5BO4B 4MJSA 2AL6A 2FCNA 1WXMA 4FJZA 1WE6A 3I3TB 2KOXA 3PT2B 4G50A 4WJNA 2KDBA 2CKHB 3BINA 2K8HA 3LDZE 5TR5A 4F7ZA 5DPWA 2KFKB 2GMIC 3V6EB 3VXWA 2ZPYA 3H7PB 1WFYA 1Q5WB 4B95A 1GC7A 3QK0A 4GMVA 2HTHA 4NAWB 2XK5A 2KTFA 2NVUI 2EMTA 4FJVB 4CO7A 4FJYA 2IZVB 3BY4B 2I1KA 4MSQB 3X23A 3KYCD 4HXDA 4NQKE 3K9PB 1ZGUB 3DVNV 3AULA 1E90A 4II3B 2BF8B 5C23A 4XZ4A 2CHWA 3TBLD 2MLBA 2LD9A 3SHQA 1P1AA 2MWSB 2KANA 2ZZPB 1TBEA 1V2YA 3H7SA 4MGKE 3DVGY 4W9LA 4GB9A 3ZUNA 3Q3FA 4W9JA 1SGHA 3EFUA 4YL8A 1GG3A 3OJ4B 3PGEA 1J0GA 3HHMA 3CMMB 3PPAA 5IAAC 3RULA 2MP2B 1D3ZA 2XBBC 4HCPB 4G11A 1BT0A 3VUWA 2KD0A 4EOYA 3ZO5B 3Q3JA 4N9F4 2N1WA 3NZSA 1LM8B 3NZUA 3U8ZA 3MTNB 2JY6A 2KJRA 2NS5A 2WX0A 1I42A 3L13A 2O2VA 5HKHA 4M8NA 1MG8A 3QA8A 5AEKB 1S1QB 3ONSA 1YQBA 4GDLA 3APFA 2JZZA 3JSVA 2CHXA 2MSED 1P9DU 1OQYA 2IO3B 3KW5B 3W1YA 4ASWC 4F8CB 4FADA 2MX2A 2GBKA 3VDZA 4PYZA 1E8WA 1ZW7A 2IY0B 3PTFC 4BKGA 3B1LX 2B3AA 3NS8A 1WGRA 3N32A 4JGHB 4B6WA 2RGFA 4HK2A 2Z0EB 1GJZA 4KVGB 4TV3A 1V9JA 5DPSA 2L00B 3M62B 1I35A 2NBVB 3WAMA 4TQ0A 4G0NB 4EFOA 4AWJA 1UGMA 2C5LC 2O6VB 3RYTA 1WZ3A 4KSKC 2MBHA 3QX1A 4MM3A 1Z2MA 4E71A 2CU1A 4GN1A 4MSMB 3PREA 5CX3A 3ENEA 3D32A 3T8MA 4M0WB 2IYDB 4WWOA 3JW0X 2D3GA 1L7YA 2J0JA 4MDKE 2Z0DB 1GC6A 3RUIB 4W9FA 3IHPC 3UQAA 2HJ8A 3QHTA 3DVNU 4PS8A 4ZRJA 2D11A 3EHVA 4WJPA 1IPGA 3PVLA 1WYWB 3TIXA 3VUXA 1G6JA 3TJPA 2MBOA 2JRHA 1XT9B 3A4RA 5JH5C 2G4SA 2ZJDA 1UELA 2FNJB 2D07B 2MW5A 4HWIB 4JIOU 2KJHB 2NCNA 1WH3A 5CHVC 3PS6A 2I1JA 3N30A 4II2B 3ML9A 2FCQA 1WX7A 2NBUA 4PS7A 2XEWA 4I6NB 1WRDB 4TQ1A 1J8CA 3OLMD 2KNBA 1SE9A 5G2NA 4A20A 2DYBA 3L17A 4X57B 4FN2A 3VVWB 2KX3A 2LVQA 4EKUA 3VAWA 5AZFA 2N9XA 4HDQA 3A9KB 1RLFA 3KVFB 5DCNA 5KHOA 3ALBA 4DK5A 3DBRI 2KDIA 2JWZA 1OEYA 3HIZA 1WMHA 3QARA 4JL9A 1RFAA 1P98A 2YVCA 4EZKA 1WF9A 1SIFA 2UWQA 4EUTA 1VCBA 2K8BA 1EO6A 3A9JA 1PQSA 4FLHA 4HVBA 3ZDTA 3DBLI 4AJYB 4GSWA 2PEAA 3DOWA 1KM7A 2WX1A 1NDDA 1R4MI 1WXVA 3RT3B 2KJ6A 1WE7A 2MQJA 1ZKHA 4GOCA 4TKNA 2FAZA 3TCAA 4FHJA 4DXAB 3WANA 1H8CA 4G3XB 2MBBB 4W9EA 2DX5B 1E7VA 2JF5A 3V60A 2G45B 4XC2A 2NPTA 3U30A 2L8JA 3W1SA 1IYFA 3ZNGC 3A1QB 3DDCB 2LGYA 3KH0A 3U7DA 3L10B 4FULA 1HE8A 1V81A 2LZ6A 1P3QU 3IG3A 3KUZA 5L95C 1NI2A 3SU8X 4NY0A 2KFKA 3VTWA 2AYOB 4BBNF 2EMSA 3H7PA 4IWPA 3UQBA 1KLVA 5D94A 1V86A 3IFWB 4K81A 2AWTA 1WXSA 3APDA 2K25A 3ZTDA 2RSUA 2L05A 2DENB 2KX0A 1WGDA 2O6VA 1YD8U 4IM2A 2L3ZA 2V4LA 4ICUA 2D10A 1E8XA 3UIPB 2D2QA 1OEYJ 4F1SA 3DVGX 1WXAA 4KZ0A 1AARA 2C7MB 2DAJA 4CYEA 3DCGA 3PLVA 2JXXA 3M95A 3ZRCA 4OVVA 4BOSC 4LDTD 4RM8A 2KK8A 2LASA 3A4SC 2MBEA 2KLCA 1RAXA 4BKSA 4GU2A 4GDKA 3A33B 4K7WA 1F9JA 3R66C 3H1UA 2L0TA 3X0WA 5FR6A 1TGZB 2Z59B 2ASQA 1S3SG 3VTVA 4BOZB 3VUYA 2N7DA 4EZLA 1LFDA 5L83A 1QZEA 1E8ZA 1WJ6A 1E7UA 2DZJA 1M94A 4NAWA 2CS4A 2NBWB 4GGQA 5D6JB 4B9KA 2PPHA 3RZFA 3KUCB 4W9CA 3RCZA 3GZNI 1WJNA 4W9GA 3OJ3A 3K9OB 2YLMA 2W9NA 3SDLC 5LXIB 2VRRB 2FCMA 1R4NI 2G3QB 2KFJA 3VH4B 3WA0A 5CHFA 2KDFB 2FCSA 2LUEA 1JRUA 4ZRKA 1YX5B 3ZIMA 1EF5A 2J7QB 1WX9A 5CTRC 2ZNVC 4IUMB 2GBMA 3MHSD 3JYUA 3QIJA 3ZLZA 5E6NA 1WR6E 1NBFC 2LVPA 2ZPNA 3PRPB 2KC1A 3PSEB 4GDKB 4WJQA 3TMPB 2K39A 3AXCA 3WIMA 3ZVVA 4NQLB 5AZGA 2REXA 2V1YA 2BKRB 1Q0WB 4WAAA 2K1FA 2MP2A 4WJOA 1EF1A 4IWQA 4DHZB 4MGZE 1U4AA 4AJWA 1RRBA 4MH0E 4KV2A 4K7UA 3TL5A 4LDTB 3ZRFA 3QC8B 1UH6A 2M8SA 1WI0A 3WAPA 1P0RA 4ZYNA 3R7QA 4ICVA 2AEHA 1ISNA 1WGYA 2N9PC 2ZVOA 2L76A 3O65B 2N9EB 4K7SA 2KO3A 2CR5A 4FA6A 4MGYE 4XX5A 2BWFA 2MRPA 2IY1B 1T0YA 2NPTB 3B0AA 4HJKA 2LWPA 3UIOB 1WX8A 3C0RB 4A3OA 3A1QA 2M4NA 1XQQA 2KHWB 3V61A 2BYFA 1L2NA 3AU5A 2JRIB 3IVFA 4HPMB 1V5OA 4BFRA 2UYZB 3RZWC 2HE7A 1UBIA 2HD5B 4NNJB 3UF8A 2BYEA 2ZCCA 4HCNB 1A5RA 4IM0A 1KOTA 2JPHA 3HM6X 1WM3A 3ML8A 2GBNA 5CHWA 5EDSA 5D2MB 3ZNZB 4ZRIA 5JHAA 3HM3A 3V6CB 5J17A 2L7RA 2JUOA 4WQOB 2WWZA 2JZ3B 2BPSA 2LGXA 3M63B 1K8RB 5LXHA 3H9DA 1E5WA 4WWNA 4W9DA 3T9LA 1X1MA 1Y8RC 3NY5A 4IWOA 4W9HA 4DDGD 4AUQC 1Z5SB 2KQ7A 2GBRA 2L0FA 3ECIA 2KKCA 3ZDMC 3ZKJC 3R3MA 2KXJA 3DBSA 4MELA 5KHQA 4I6LB 2JT4B 2RD0A 4KZCA 2C9WB 4DHJD 2QHOA 2DYOA 5GMVA 2J0MA 3APCA 2WYQA 3NHEB 1TZ1A 3VQIA 5J2RA 3A9JB 3QQ8B 4I6PA 2C7HA 2AL3A 2IO0B 2O6VD 2R2QA 4KDIC 2IO2B 3PLUA 3UINB 3ZNHB 2KWCA 2ZCBA 3HK0A 1UBQA 5LLIA 2IBIB 3PV1A 2OOBB 2KWUB 3M3JA 3N3KB 1UZXB 4NPNA 2A5UA 3GOEA 4RM9A 2K6QA 4LCDE 4URKA 1EUVB 4BBNC 2PE6B 2FIDA 2MA9B 2RR9A 1GUAB 3KYDD 3B08A 4DHZE 3PHWB 3VHTC 1C1YB 2BWES 4GDLB 1VD2A 4BKTA 4MJSB 3JSVB 2FUHB 3IBEA 1V5TA 4JQWC 2DZMA 4FHKA 2MCNB 4IM3A 4M8MA 2LJ5A 2KN5A 2N1VA 4FBJB 3P2BA 2ZEQA 5AZHA 4RMAA 4ANUA 1YX6B 2LGDA 4NJ6A 4DBGA 3ZW3A 3PRZA 4LJPB 4JLCA 3NOBA 2LRWA 4HDOA 4PS3A 3WAOA 1WM2A 4KSLC 4W9IA 2GOWA 1Q1OA 1YJ1A 2KTRB 3JVZX 1TTNA 3VFKA 1V80A 4CHKA 2OJRA 4A3PA 1OTRB 4P7IA 1UD7A 1WIAA 3AI5A 3PRMB 3SD5A 4ANVA 5G55A 1GNUA 2KC2A 1WR1A 4HLEA 2LXAA 3QCAA 4IW0A 2KZRA 5J18A 3MJWA 2BYVE 2C7NB 4HPLB 2GBJA 4K1RB 2EKEC 1C3TA 4EZJA 3S2AA 2V3SA 3PZDA 5D7GA 2ZNVB 3ZNID 4AP4C 2M1MA 1CMXB 2G4DB 4KIKA 2PE9A 1H4RA 2LRUA 3DPDA 2C60A 3DBHI 2N4FA 4AOFA 2MBQA 3PHXB 4DHJB 3W1SC 2LXCA 2FIFA 1V6EA 2KLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7E A;  2LI5 A;  1YIW A;  4TUU A;  2DAF A;  4J6I A;  5JHB A;  4IC7 B;  3CST A;  3RD2 A;  2KTR A;  3CF6 E;  2RPQ A;  2ZVN A;  4GXB A;  5DPR A;  3CSF A;  2BKF A;  2R2O A;  3EEC A;  3OAW A;  2KVR A;  4OVU A;  2KQS A;  2K6D B;  1FXT B;  2DYM A;  5DPT A;  4GIV A;  4PYU A;  3UGB B;  1WJU A;  1LXD A;  2O2V B;  1V49 A;  1LQB A;  2KDE B;  3ZTC A;  5IA7 A;  2JVC A;  4NJ7 A;  4DWF A;  1XD3 B;  1WGH A;  2KWV B;  1OGW A;  2KMC A;  2DHZ A;  2DZK A;  4KIK B;  4ANW A;  3A9K A;  2PJH A;  2WDT B;  3AU4 A;  3KUD B;  2IO1 B;  3L16 A;  2LVO A;  4E3C A;  3R7R A;  1WMH B;  3EC8 A;  3QJZ A;  2DZI A;  4KDL B;  4BKS D;  4E74 A;  4EEW A;  4IG7 B;  1WZ0 A;  3H6N A;  1E8Y A;  2Y5B B;  4ZDV A;  5JZE B;  3L08 A;  4BVU C;  1IP9 A;  1WY8 A;  3QAQ A;  2CHZ A;  2K8C A;  1WJ4 A;  4LJO B;  5E6P A;  4DDI D;  2XK5 B;  2NR2 A;  3VH3 B;  5E6O A;  3DQV A;  3WAL A;  3QWZ B;  2BGF A;  3V62 A;  4MEM A;  1J19 A;  4MGI E;  4ANX A;  2KMA A;  3L0W B;  1KJT A;  3L54 A;  2J0K A;  2A4Z A;  3VTU A;  4W9K A;  1WGG A;  3LJ3 A;  4WWP A;  2M17 A;  2M0X A;  5C1Z A;  5BO4 B;  4MJS A;  2AL6 A;  2FCN A;  1WXM A;  4FJZ A;  1WE6 A;  3I3T B;  2KOX A;  3PT2 B;  4G50 A;  4WJN A;  2KDB A;  2CKH B;  3BIN A;  2K8H A;  3LDZ E;  5TR5 A;  4F7Z A;  5DPW A;  2KFK B;  2GMI C;  3V6E B;  3VXW A;  2ZPY A;  3H7P B;  1WFY A;  1Q5W B;  4B95 A;  1GC7 A;  3QK0 A;  4GMV A;  2HTH A;  4NAW B;  2XK5 A;  2KTF A;  2NVU I;  2EMT A;  4FJV B;  4CO7 A;  4FJY A;  2IZV B;  3BY4 B;  2I1K A;  4MSQ B;  3X23 A;  3KYC D;  4HXD A;  4NQK E;  3K9P B;  1ZGU B;  3DVN V;  3AUL A;  1E90 A;  4II3 B;  2BF8 B;  5C23 A;  4XZ4 A;  2CHW A;  3TBL D;  2MLB A;  2LD9 A;  3SHQ A;  1P1A A;  2MWS B;  2KAN A;  2ZZP B;  1TBE A;  1V2Y A;  3H7S A;  4MGK E;  3DVG Y;  4W9L A;  4GB9 A;  3ZUN A;  3Q3F A;  4W9J A;  1SGH A;  3EFU A;  4YL8 A;  1GG3 A;  3OJ4 B;  3PGE A;  1J0G A;  3HHM A;  3CMM B;  3PPA A;  5IAA C;  3RUL A;  2MP2 B;  1D3Z A;  2XBB C;  4HCP B;  4G11 A;  1BT0 A;  3VUW A;  2KD0 A;  4EOY A;  3ZO5 B;  3Q3J A;  4N9F 4;  2N1W A;  3NZS A;  1LM8 B;  3NZU A;  3U8Z A;  3MTN B;  2JY6 A;  2KJR A;  2NS5 A;  2WX0 A;  1I42 A;  3L13 A;  2O2V A;  5HKH A;  4M8N A;  1MG8 A;  3QA8 A;  5AEK B;  1S1Q B;  3ONS A;  1YQB A;  4GDL A;  3APF A;  2JZZ A;  3JSV A;  2CHX A;  2MSE D;  1P9D U;  1OQY A;  2IO3 B;  3KW5 B;  3W1Y A;  4ASW C;  4F8C B;  4FAD A;  2MX2 A;  2GBK A;  3VDZ A;  4PYZ A;  1E8W A;  1ZW7 A;  2IY0 B;  3PTF C;  4BKG A;  3B1L X;  2B3A A;  3NS8 A;  1WGR A;  3N32 A;  4JGH B;  4B6W A;  2RGF A;  4HK2 A;  2Z0E B;  1GJZ A;  4KVG B;  4TV3 A;  1V9J A;  5DPS A;  2L00 B;  3M62 B;  1I35 A;  2NBV B;  3WAM A;  4TQ0 A;  4G0N B;  4EFO A;  4AWJ A;  1UGM A;  2C5L C;  2O6V B;  3RYT A;  1WZ3 A;  4KSK C;  2MBH A;  3QX1 A;  4MM3 A;  1Z2M A;  4E71 A;  2CU1 A;  4GN1 A;  4MSM B;  3PRE A;  5CX3 A;  3ENE A;  3D32 A;  3T8M A;  4M0W B;  2IYD B;  4WWO A;  3JW0 X;  2D3G A;  1L7Y A;  2J0J A;  4MDK E;  2Z0D B;  1GC6 A;  3RUI B;  4W9F A;  3IHP C;  3UQA A;  2HJ8 A;  3QHT A;  3DVN U;  4PS8 A;  4ZRJ A;  2D11 A;  3EHV A;  4WJP A;  1IPG A;  3PVL A;  1WYW B;  3TIX A;  3VUX A;  1G6J A;  3TJP A;  2MBO A;  2JRH A;  1XT9 B;  3A4R A;  5JH5 C;  2G4S A;  2ZJD A;  1UEL A;  2FNJ B;  2D07 B;  2MW5 A;  4HWI B;  4JIO U;  2KJH B;  2NCN A;  1WH3 A;  5CHV C;  3PS6 A;  2I1J A;  3N30 A;  4II2 B;  3ML9 A;  2FCQ A;  1WX7 A;  2NBU A;  4PS7 A;  2XEW A;  4I6N B;  1WRD B;  4TQ1 A;  1J8C A;  3OLM D;  2KNB A;  1SE9 A;  5G2N A;  4A20 A;  2DYB A;  3L17 A;  4X57 B;  4FN2 A;  3VVW B;  2KX3 A;  2LVQ A;  4EKU A;  3VAW A;  5AZF A;  2N9X A;  4HDQ A;  3A9K B;  1RLF A;  3KVF B;  5DCN A;  5KHO A;  3ALB A;  4DK5 A;  3DBR I;  2KDI A;  2JWZ A;  1OEY A;  3HIZ A;  1WMH A;  3QAR A;  4JL9 A;  1RFA A;  1P98 A;  2YVC A;  4EZK A;  1WF9 A;  1SIF A;  2UWQ A;  4EUT A;  1VCB A;  2K8B A;  1EO6 A;  3A9J A;  1PQS A;  4FLH A;  4HVB A;  3ZDT A;  3DBL I;  4AJY B;  4GSW A;  2PEA A;  3DOW A;  1KM7 A;  2WX1 A;  1NDD A;  1R4M I;  1WXV A;  3RT3 B;  2KJ6 A;  1WE7 A;  2MQJ A;  1ZKH A;  4GOC A;  4TKN A;  2FAZ A;  3TCA A;  4FHJ A;  4DXA B;  3WAN A;  1H8C A;  4G3X B;  2MBB B;  4W9E A;  2DX5 B;  1E7V A;  2JF5 A;  3V60 A;  2G45 B;  4XC2 A;  2NPT A;  3U30 A;  2L8J A;  3W1S A;  1IYF A;  3ZNG C;  3A1Q B;  3DDC B;  2LGY A;  3KH0 A;  3U7D A;  3L10 B;  4FUL A;  1HE8 A;  1V81 A;  2LZ6 A;  1P3Q U;  3IG3 A;  3KUZ A;  5L95 C;  1NI2 A;  3SU8 X;  4NY0 A;  2KFK A;  3VTW A;  2AYO B;  4BBN F;  2EMS A;  3H7P A;  4IWP A;  3UQB A;  1KLV A;  5D94 A;  1V86 A;  3IFW B;  4K81 A;  2AWT A;  1WXS A;  3APD A;  2K25 A;  3ZTD A;  2RSU A;  2L05 A;  2DEN B;  2KX0 A;  1WGD A;  2O6V A;  1YD8 U;  4IM2 A;  2L3Z A;  2V4L A;  4ICU A;  2D10 A;  1E8X A;  3UIP B;  2D2Q A;  1OEY J;  4F1S A;  3DVG X;  1WXA A;  4KZ0 A;  1AAR A;  2C7M B;  2DAJ A;  4CYE A;  3DCG A;  3PLV A;  2JXX A;  3M95 A;  3ZRC A;  4OVV A;  4BOS C;  4LDT D;  4RM8 A;  2KK8 A;  2LAS A;  3A4S C;  2MBE A;  2KLC A;  1RAX A;  4BKS A;  4GU2 A;  4GDK A;  3A33 B;  4K7W A;  1F9J A;  3R66 C;  3H1U A;  2L0T A;  3X0W A;  5FR6 A;  1TGZ B;  2Z59 B;  2ASQ A;  1S3S G;  3VTV A;  4BOZ B;  3VUY A;  2N7D A;  4EZL A;  1LFD A;  5L83 A;  1QZE A;  1E8Z A;  1WJ6 A;  1E7U A;  2DZJ A;  1M94 A;  4NAW A;  2CS4 A;  2NBW B;  4GGQ A;  5D6J B;  4B9K A;  2PPH A;  3RZF A;  3KUC B;  4W9C A;  3RCZ A;  3GZN I;  1WJN A;  4W9G A;  3OJ3 A;  3K9O B;  2YLM A;  2W9N A;  3SDL C;  5LXI B;  2VRR B;  2FCM A;  1R4N I;  2G3Q B;  2KFJ A;  3VH4 B;  3WA0 A;  5CHF A;  2KDF B;  2FCS A;  2LUE A;  1JRU A;  4ZRK A;  1YX5 B;  3ZIM A;  1EF5 A;  2J7Q B;  1WX9 A;  5CTR C;  2ZNV C;  4IUM B;  2GBM A;  3MHS D;  3JYU A;  3QIJ A;  3ZLZ A;  5E6N A;  1WR6 E;  1NBF C;  2LVP A;  2ZPN A;  3PRP B;  2KC1 A;  3PSE B;  4GDK B;  4WJQ A;  3TMP B;  2K39 A;  3AXC A;  3WIM A;  3ZVV A;  4NQL B;  5AZG A;  2REX A;  2V1Y A;  2BKR B;  1Q0W B;  4WAA A;  2K1F A;  2MP2 A;  4WJO A;  1EF1 A;  4IWQ A;  4DHZ B;  4MGZ E;  1U4A A;  4AJW A;  1RRB A;  4MH0 E;  4KV2 A;  4K7U A;  3TL5 A;  4LDT B;  3ZRF A;  3QC8 B;  1UH6 A;  2M8S A;  1WI0 A;  3WAP A;  1P0R A;  4ZYN A;  3R7Q A;  4ICV A;  2AEH A;  1ISN A;  1WGY A;  2N9P C;  2ZVO A;  2L76 A;  3O65 B;  2N9E B;  4K7S A;  2KO3 A;  2CR5 A;  4FA6 A;  4MGY E;  4XX5 A;  2BWF A;  2MRP A;  2IY1 B;  1T0Y A;  2NPT B;  3B0A A;  4HJK A;  2LWP A;  3UIO B;  1WX8 A;  3C0R B;  4A3O A;  3A1Q A;  2M4N A;  1XQQ A;  2KHW B;  3V61 A;  2BYF A;  1L2N A;  3AU5 A;  2JRI B;  3IVF A;  4HPM B;  1V5O A;  4BFR A;  2UYZ B;  3RZW C;  2HE7 A;  1UBI A;  2HD5 B;  4NNJ B;  3UF8 A;  2BYE A;  2ZCC A;  4HCN B;  1A5R A;  4IM0 A;  1KOT A;  2JPH A;  3HM6 X;  1WM3 A;  3ML8 A;  2GBN A;  5CHW A;  5EDS A;  5D2M B;  3ZNZ B;  4ZRI A;  5JHA A;  3HM3 A;  3V6C B;  5J17 A;  2L7R A;  2JUO A;  4WQO B;  2WWZ A;  2JZ3 B;  2BPS A;  2LGX A;  3M63 B;  1K8R B;  5LXH A;  3H9D A;  1E5W A;  4WWN A;  4W9D A;  3T9L A;  1X1M A;  1Y8R C;  3NY5 A;  4IWO A;  4W9H A;  4DDG D;  4AUQ C;  1Z5S B;  2KQ7 A;  2GBR A;  2L0F A;  3ECI A;  2KKC A;  3ZDM C;  3ZKJ C;  3R3M A;  2KXJ A;  3DBS A;  4MEL A;  5KHQ A;  4I6L B;  2JT4 B;  2RD0 A;  4KZC A;  2C9W B;  4DHJ D;  2QHO A;  2DYO A;  5GMV A;  2J0M A;  3APC A;  2WYQ A;  3NHE B;  1TZ1 A;  3VQI A;  5J2R A;  3A9J B;  3QQ8 B;  4I6P A;  2C7H A;  2AL3 A;  2IO0 B;  2O6V D;  2R2Q A;  4KDI C;  2IO2 B;  3PLU A;  3UIN B;  3ZNH B;  2KWC A;  2ZCB A;  3HK0 A;  1UBQ A;  5LLI A;  2IBI B;  3PV1 A;  2OOB B;  2KWU B;  3M3J A;  3N3K B;  1UZX B;  4NPN A;  2A5U A;  3GOE A;  4RM9 A;  2K6Q A;  4LCD E;  4URK A;  1EUV B;  4BBN C;  2PE6 B;  2FID A;  2MA9 B;  2RR9 A;  1GUA B;  3KYD D;  3B08 A;  4DHZ E;  3PHW B;  3VHT C;  1C1Y B;  2BWE S;  4GDL B;  1VD2 A;  4BKT A;  4MJS B;  3JSV B;  2FUH B;  3IBE A;  1V5T A;  4JQW C;  2DZM A;  4FHK A;  2MCN B;  4IM3 A;  4M8M A;  2LJ5 A;  2KN5 A;  2N1V A;  4FBJ B;  3P2B A;  2ZEQ A;  5AZH A;  4RMA A;  4ANU A;  1YX6 B;  2LGD A;  4NJ6 A;  4DBG A;  3ZW3 A;  3PRZ A;  4LJP B;  4JLC A;  3NOB A;  2LRW A;  4HDO A;  4PS3 A;  3WAO A;  1WM2 A;  4KSL C;  4W9I A;  2GOW A;  1Q1O A;  1YJ1 A;  2KTR B;  3JVZ X;  1TTN A;  3VFK A;  1V80 A;  4CHK A;  2OJR A;  4A3P A;  1OTR B;  4P7I A;  1UD7 A;  1WIA A;  3AI5 A;  3PRM B;  3SD5 A;  4ANV A;  5G55 A;  1GNU A;  2KC2 A;  1WR1 A;  4HLE A;  2LXA A;  3QCA A;  4IW0 A;  2KZR A;  5J18 A;  3MJW A;  2BYV E;  2C7N B;  4HPL B;  2GBJ A;  4K1R B;  2EKE C;  1C3T A;  4EZJ A;  3S2A A;  2V3S A;  3PZD A;  5D7G A;  2ZNV B;  3ZNI D;  4AP4 C;  2M1M A;  1CMX B;  2G4D B;  4KIK A;  2PE9 A;  1H4R A;  2LRU A;  3DPD A;  2C60 A;  3DBH I;  2N4F A;  4AOF A;  2MBQ A;  3PHX B;  4DHJ B;  3W1S C;  2LXC A;  2FIF A;  1V6E A;  2KLG A; 
#chains in the Genus database with same CATH topology
 1YIW A;  1XLO A;  4J6I A;  4M02 A;  2RPQ A;  4B0E A;  2ZVN A;  4GXB A;  5DPR A;  1D4B A;  4P6V F;  4OVU A;  1XLN A;  1L6U A;  2DYM A;  3AB5 A;  3UGB B;  4P1C C;  1MI0 A;  1LQB A;  2RMM A;  1L5P A;  1XD3 B;  2W55 A;  2DHZ A;  2L52 A;  3A9K A;  2WDT B;  3L16 A;  2IO1 B;  5C2T B;  2M0A A;  2WXI A;  3QJZ A;  4E74 A;  2DZI A;  1PYW D;  5JZE B;  1SE2 A;  1WJ4 A;  3DQV A;  1TS5 A;  2BGF A;  1F1H A;  2V0G A;  3AEG B;  3L0W B;  4NJC A;  1WGG A;  2BS3 B;  1WYG A;  2M0X A;  1JML A;  2E6X A;  2BQQ A;  4MJS A;  4RGT A;  2JQR B;  1XCQ L;  3ZYY X;  4WJN A;  2CKH B;  2QIL A;  2K8H A;  2JSV X;  2KFK B;  4C00 A;  3V6E B;  1ZE3 D;  2ZPY A;  4B95 A;  3RNG C;  2KTF A;  2EMT A;  2QEJ C;  2I1K A;  4MSQ B;  3X23 A;  4KGR A;  3R2T A;  4NQK E;  1V1P B;  1ZGU B;  3DVN V;  1QF6 A;  1N61 A;  4XZ4 A;  3GS2 A;  2LD9 A;  1LGR A;  2ZZP B;  1TBE A;  2HTM E;  4MGK E;  2QCZ A;  4LLG M;  3AE2 B;  3EFU A;  1DOI A;  1NYR A;  3CMM B;  3PPA A;  2G9H D;  3RUL A;  4HCP B;  3VUW A;  4NAM A;  2KD0 A;  1YN4 A;  1I4P A;  1HTQ A;  2GRI A;  2QDF A;  3IAM 1;  2N1W A;  3AE1 B;  2JY6 A;  1JAL A;  1MHX A;  2KJR A;  3L13 A;  1E9M A;  1AYF A;  4M8N A;  4M01 A;  1B9R A;  4JPS A;  2IGD A;  1S1Q B;  3DBH B;  3APF A;  5BMI A;  2IO3 B;  3Q3N C;  4FAD A;  2MX2 A;  4BKG A;  3PTF C;  2BS4 B;  2B3A A;  3N32 A;  2RPV A;  4JGH B;  4KVG B;  4TV3 A;  4N58 A;  3M62 B;  1QT9 A;  1FMA D;  3Q8A A;  4G0N B;  4US8 A;  1DOX A;  1ZXI A;  3RYT A;  4WWM A;  4KSK C;  2MBH A;  3QX1 A;  3KLS X;  4HKZ E;  4MM3 A;  4MSM B;  4GN1 A;  4YTP B;  3IT6 B;  3D32 A;  3JW0 X;  1KLU D;  3NUH B;  2JYT A;  4S17 A;  4PS8 A;  4ZRJ A;  3PVL A;  2JRH A;  5JH5 C;  5IKC M;  1UEL A;  3AM9 A;  2D07 B;  2MW5 A;  1WH3 A;  3PS6 A;  4II2 B;  3AE6 B;  3ML9 A;  2FCQ A;  1BXT A;  2XEW A;  4I6N B;  1QOA A;  4ZHP A;  1J8C A;  5BMG A;  4X57 B;  2LMC A;  2LUM A;  5AZF A;  1RLF A;  1ZUD 2;  2R61 A;  1F77 A;  2KDM A;  3HIZ A;  2WQY B;  4KGS A;  3FAH A;  4C7Z A;  1WF9 A;  1SIF A;  1OFF A;  4EUT A;  3MJ5 A;  3TSS A;  1WE7 A;  4GOC A;  3LB8 C;  3NS1 A;  4G3X B;  2MBB B;  1MFW A;  4W9E A;  2DX5 B;  3P1M A;  1PFD A;  2NPT A;  2L8J A;  3PZ7 A;  3L10 B;  2OED A;  1HE8 A;  2IGG A;  2LZ6 A;  1P3Q U;  1C4P A;  5L95 C;  5MPO A;  1IBX A;  3VTW A;  4JWS C;  2AYO B;  1HEZ E;  1KLV A;  5D94 A;  2E3T A;  2MJE A;  4REZ A;  2K25 A;  2IND C;  2V9H A;  4M00 A;  4GLS C;  2D3C A;  2O6V A;  2I2Y A;  1E8X A;  2WXQ A;  1EWY C;  3BYY B;  1T0Q C;  2D5G A;  1WXA A;  2DAJ A;  1ZOY B;  3GZN B;  4LDT D;  2K0P A;  1GPX A;  2LAS A;  2M19 A;  2MBE A;  3ZJV A;  2L0T A;  2XN9 C;  2ASQ A;  1WXQ A;  2N7D A;  3GB1 A;  1E8Z A;  3AV8 A;  2NBW B;  2PPH A;  3FKY A;  3RZF A;  3GZN I;  3OJ3 A;  1F0Z A;  5LXI B;  2VRR B;  2G3Q B;  3WA0 A;  1JRU A;  3ZIM A;  2ZNV C;  1L6V A;  1WR6 E;  1ZXH A;  2KC1 A;  2CU3 A;  2Y5C A;  2V1Y A;  1Q0W B;  2K5P A;  5TSS A;  1EF1 A;  1I4G A;  4DHZ B;  1TKE A;  1RRB A;  1RFK A;  4K7U A;  3R7Q A;  3Q14 C;  4ICV A;  2AEH A;  1WGY A;  2N9P C;  3N20 C;  1WGK A;  4MGY E;  2BWF A;  2NPT B;  3A1Q A;  2M4N A;  2WNM A;  2BYF A;  2N7J A;  3IVF A;  4HPM B;  1UBI A;  2ZCC A;  2N0S B;  4IM0 A;  3B2F A;  4C7Y A;  3ZNZ B;  2QMT A;  2DBY A;  3V6C B;  5J17 A;  1J7B A;  2BPS A;  2LGX A;  4WWN A;  1ZP0 B;  1GB1 A;  4IWO A;  5EE3 A;  3IT4 B;  3ZDM C;  4OZB A;  4HKQ A;  1I4Q A;  3DBS A;  1MVK A;  1T0R C;  2Y3A A;  4XYC A;  3NJT A;  2C9W B;  4DHJ D;  2QHO A;  1JWU D;  1FXI A;  3VQI A;  1TZ1 A;  1XXG A;  1LO5 D;  3RNB C;  2IO0 B;  3UIN B;  3BVM A;  3ZNH B;  2HDE A;  1CQV A;  3FIL B;  2KWU B;  3AE3 B;  4ACF A;  2A5U A;  2FID A;  1N5W A;  3PHW B;  4GDL B;  1TIF A;  4MJS B;  1JRP A;  3IBE A;  4NZL B;  2KN4 A;  4HRS A;  5AZH A;  4DQO C;  2LGD A;  4NJ6 A;  1SJH D;  3TEX A;  2WXH A;  3NOB A;  4KSL C;  2JWU A;  4W9I A;  3NVY A;  2CJO A;  2VZK B;  4CHK A;  3BVZ A;  3C19 A;  3PRM B;  3DWM A;  2INC C;  1VR9 A;  2PTL A;  4XWW A;  2LXA A;  4IW0 A;  1ESF A;  2C7N B;  2GBJ A;  2EKE C;  3P4R B;  2V3S A;  4AP4 C;  3H8H A;  1TS3 A;  1CMX B;  3U2S C;  4KKJ A;  3NZ3 A;  4XDC A;  1M4V A;  5FR3 A;  1V6E A;  2N7E A;  4WQM A;  4C56 C;  2DAF A;  4EE2 A;  1C9F A;  2WDQ B;  1ROE A;  2OHF A;  2NTS A;  4IC7 B;  2KTR A;  3CF6 E;  3DHG C;  2KQS A;  5DPT A;  2TSS A;  1WJU A;  1FCC C;  2O2V B;  1V49 A;  1ZDV A;  1BUI C;  2KDE B;  2JVC A;  2WP9 B;  4NJ7 A;  1FPY A;  4DWF A;  4L23 A;  4ARI A;  2KMC A;  2PJH A;  2LVO A;  4YSY B;  1WMH B;  1WZ0 A;  2Y5B B;  4ZDV A;  1IP9 A;  4BVU C;  4RGM A;  2K8C A;  5E6P A;  1K51 A;  3DHI C;  4BZA A;  3WAL A;  3V62 A;  4C4V A;  4MEM A;  1J19 A;  3FIL A;  4ANX A;  2H88 B;  2KMA A;  3V3X A;  2MJ3 A;  2J0K A;  3Q8E A;  2M17 A;  2PMV A;  3P42 A;  2QSD A;  1WXM A;  4FJZ A;  5JXV A;  1CZP A;  3BIN A;  3LDZ E;  3AE4 B;  5DPW A;  1XF5 L;  3VXW A;  4GMV A;  2AQ2 B;  4CO7 A;  4FJY A;  3BY4 B;  5FKA C;  4A9A A;  3GE8 C;  3K9P B;  2IPK D;  1WRI A;  3AEB B;  2BF8 B;  3TBL D;  2CHW A;  3SHQ A;  2MWS B;  4AS1 A;  2WXR A;  3ZUN A;  3Q3F A;  1N63 A;  1SGH A;  3W5V B;  2N9K A;  1GG3 A;  3OJ4 B;  1C78 A;  3HHM A;  2MP2 B;  2XBB C;  4G11 A;  4J3O D;  3ZO5 B;  4N9F 4;  1LM8 B;  3NZU A;  2O2V A;  5AEK B;  1MHH E;  3ONS A;  1YQB A;  4GDL A;  3L4P A;  3JSV A;  3W5U B;  2YEP F;  2MSE D;  4S0R A;  1FNU A;  3W1Y A;  4ASW C;  2GBK A;  1E8W A;  2IY0 B;  4Q2J A;  2NTT A;  4TSS A;  3B1L X;  4B6W A;  1I4H A;  4HK2 A;  3Q69 A;  1WWT A;  1I35 A;  3WAM A;  1CJE A;  4TQ0 A;  2ACZ B;  4EFO A;  1PGX A;  2O6V B;  1Z2M A;  1XCT L;  2CU1 A;  5CX3 A;  1L0Y B;  1UF0 A;  1ET6 A;  3DBL B;  2J0J A;  4MDK E;  1CK1 A;  4JWU C;  3RUI B;  1N62 A;  3EHV A;  3TIX A;  1IPG A;  3SEB A;  5AUI A;  3C8Y A;  2K9X A;  1XO3 A;  2KJH B;  4A90 A;  3U4E G;  4A6Q A;  5CHV C;  1D5X C;  3N30 A;  1WX7 A;  2NBU A;  1UGJ A;  4TQ1 A;  2WXN A;  2KNB A;  5G2N A;  2K22 A;  3VVW B;  3SFE B;  1D5Z C;  2N9X A;  4HDQ A;  3A9K B;  3KVF B;  1JW9 D;  2L32 A;  2WDV B;  3ALB A;  1OEY A;  4JL9 A;  1RFA A;  2YVC A;  1I4X A;  1VCB A;  2K8B A;  3A9J A;  3I63 C;  3DBL I;  2WX1 A;  4YTM B;  1WXV A;  3N1Z C;  3TCA A;  4DXA B;  2BTE A;  3WAN A;  2LHE A;  1E7V A;  2JF5 A;  1KLG D;  2J53 A;  1RYJ A;  5H92 C;  2G45 B;  4XC2 A;  3ZNG C;  3A1Q B;  2LGY A;  3U7D A;  4P1B C;  1V81 A;  3IG3 A;  3KUZ A;  4LNK A;  3HVD A;  4NY0 A;  2KFK A;  2KYW A;  3OG5 A;  1SE3 A;  4ARC A;  1JWB D;  1XLP A;  3APD A;  1WXS A;  3N1X C;  1YD8 U;  2V4L A;  3AE9 B;  1GAQ B;  2ON8 A;  4KZ0 A;  2C7M B;  4CYE A;  3DCG A;  1HXY D;  4OVV A;  4BOS C;  1OQQ A;  4RM8 A;  4BKS A;  1NEN B;  4GDK A;  3A33 B;  4K7W A;  3R66 C;  3H1U A;  1PGB A;  5FR6 A;  2KQ4 X;  1E10 A;  1LFD A;  1V8C A;  1QZE A;  3HUI A;  3WCQ A;  1M94 A;  2D3B A;  4W9C A;  1DOY A;  2Q5W D;  4W9G A;  2FCM A;  3VH4 B;  2J52 A;  2FCS A;  4ZRK A;  3BII D;  1SJE D;  1WX9 A;  3MHS D;  3TMP B;  2LVP A;  3PSE B;  2WXJ A;  2REX A;  2K1F A;  4ZOH C;  4WJO A;  4IWQ A;  1K52 A;  2PLP A;  3R8B A;  4MGZ E;  4LDT B;  3QC8 B;  1UH6 A;  2ONQ A;  3P4Q B;  1NI3 A;  5GXG B;  2FE8 A;  3B0A A;  2MRP A;  1T0Y A;  4HJK A;  2LWP A;  3UIO B;  4A3O A;  2KHW B;  3AU5 A;  3IAS 1;  2LEK A;  3E9S A;  2HE7 A;  1A5R A;  4HCN B;  4YXD B;  1KOT A;  3HM6 X;  1WM3 A;  4WIP A;  5EDS A;  1R4M B;  1VZ6 A;  2JUO A;  4USA A;  2JZ3 B;  1L4Z B;  3M63 B;  3H9D A;  1SB3 C;  4W9H A;  4DXG A;  3T3N A;  2GBR A;  2KKC A;  3R3M A;  3AN1 A;  5KHQ A;  3B9J A;  2RD0 A;  2XNA C;  4KZC A;  4LNN A;  1VJK A;  4LNI A;  2J0M A;  3APC A;  3NHE B;  2WXF A;  2R2Q A;  4LNO A;  2KWC A;  2ICI A;  3AE8 B;  4BAX A;  5LLI A;  5EE0 A;  2X38 A;  2OOB B;  1UZX B;  2PVG C;  4RM9 A;  2K6Q A;  4LCD E;  4URK A;  3DBR B;  2PE6 B;  3I57 A;  2MA9 B;  2RR9 A;  3KYD D;  4B0M A;  3PZ8 A;  4BKT A;  4YSX B;  1TJE A;  2FUH B;  5HFY A;  1FIQ A;  4JQW C;  4FHK A;  4IM3 A;  2LJ5 A;  2KN5 A;  3O13 A;  3P4S B;  2N1V A;  4ANU A;  4RMA A;  1TKY A;  4LJP B;  3ZJT A;  4JLC A;  1E0Z A;  4PS3 A;  2V4I B;  1WM2 A;  1Q1O A;  2KTR B;  2PVO D;  3JVZ X;  2W54 A;  4DXF A;  1V80 A;  3AH7 A;  4A3P A;  1OTR B;  4P7I A;  1IGC A;  1GNU A;  1SIJ A;  1WR1 A;  2WU2 B;  1NYQ A;  5J18 A;  3MJW A;  2IGH A;  5BYQ A;  2N9L A;  1C3T A;  4XDD A;  5D7G A;  2PIA A;  1H4R A;  2V3N A;  2W82 A;  2MBQ A;  4DHJ B;  3TUO A;  3BYT B;  2FIF A;  3OLM D;  3JYU A;  4RGO S;  3LXF A;  2L1A A;  2LFI A;  3CST A;  4MT5 A;  1QKZ A;  3CSF A;  3OAW A;  2KVR A;  2K6D B;  4GIV A;  2J42 A;  3BWU D;  3ZTC A;  1C76 A;  5IA7 A;  3I9V 1;  2HJ1 A;  2KWV B;  2WGS A;  2D3A A;  2DZK A;  4KIK B;  3KUD B;  2GB1 A;  1PGA A;  1MG4 A;  4E3C A;  4KDL B;  1MPE A;  3HRD D;  1N5X A;  4IG7 B;  1PDX A;  1QLB B;  2G1E A;  3H6N A;  3VR9 B;  1WY8 A;  3QAQ A;  2CHZ A;  1EM7 A;  2KT7 A;  3VH3 B;  4JX1 C;  5E6O A;  1QQR A;  4MGI E;  1FM0 D;  1JWS D;  3VTU A;  3LJ3 A;  4WWP A;  3MC0 B;  4H2A A;  4XGA B;  3PT2 B;  2KOX A;  4WAF A;  2KDB A;  4D2K A;  1D5M C;  4RGN A;  5EE1 A;  4F7Z A;  2GMI C;  1GC7 A;  3QK0 A;  2HTH A;  4NAW B;  2XK5 A;  4FJV B;  2KAJ A;  2IZV B;  4N59 A;  3ABV B;  4WUR A;  3KYC D;  2JXT A;  3Q6B A;  3AUL A;  1E90 A;  4II3 B;  3HVZ A;  2MLB A;  1P1A A;  2KAN A;  1DGJ A;  3H7S A;  3DVG Y;  3GP7 A;  5G5H A;  4YL8 A;  3PGE A;  5IOI A;  1J0G A;  4OHJ A;  1D3Z A;  1TY0 A;  3NVV A;  4EOY A;  3VRA B;  2SEB D;  2BB6 A;  1FEH A;  4RNA A;  4WH4 A;  3MTN B;  2NS5 A;  2WX0 A;  3W2D A;  5HKH A;  3QA8 A;  2WDR B;  1AWD A;  2CHX A;  1P9D U;  4IKG A;  3KW5 B;  3VDZ A;  1TYG B;  1ZW7 A;  2WS3 B;  3MP9 A;  3NS8 A;  1BML C;  1WGR A;  2Y5P A;  3ZGZ A;  2WU5 B;  2Z0E B;  1GJZ A;  3MFG A;  1V9J A;  5DPS A;  3FC4 A;  2M56 B;  4AWJ A;  4JE3 B;  2C5L C;  2AQ1 B;  3NRZ A;  1SSN A;  2BVC A;  3ENE A;  3T8M A;  4WWO A;  2D3G A;  3RI7 C;  2Z0D B;  4W9F A;  5I4D A;  3QHT A;  3N9Y C;  4FXC A;  2D11 A;  4WJP A;  1G6J A;  3VUX A;  3TJP A;  2MBO A;  1UUP A;  3RMK C;  3RNA C;  1XT9 B;  3A4R A;  2G4S A;  2ZJD A;  5FK9 C;  3J9C A;  4HWI B;  2PW9 A;  1J7C A;  3MC8 A;  2NCN A;  2EEL A;  4PS7 A;  1SE4 A;  2VH2 A;  1WRD B;  4OVZ A;  4IDI A;  2B76 B;  4FN2 A;  2KX3 A;  2LVQ A;  5IN7 A;  3VAW A;  2JU6 X;  4DK5 A;  3DBR I;  1WMH A;  3QAR A;  4EZK A;  4R3D A;  2RDG A;  4FLH A;  4CQN A;  3ZDT A;  2PEA A;  1KM7 A;  1R4M I;  2KJ6 A;  2MQJ A;  1ZKH A;  2FAZ A;  1N6Z A;  4LK0 M;  1C4C A;  4LTU A;  1VDV A;  2ZW1 A;  1R4N B;  3U30 A;  1IGD A;  1IYF A;  3DDC B;  1XEE A;  4FUL A;  1E6E B;  1JRO A;  3SU8 X;  2WXM A;  1HTO A;  4OZA A;  4IWP A;  1V86 A;  4K81 A;  3RNF C;  1FNV A;  2RSU A;  1I7H A;  2BYT A;  2L05 A;  1F2R C;  2DEN B;  5IO9 A;  1JWM D;  1MJD A;  2L3Z A;  1YNT E;  1Q10 A;  4ICU A;  2D10 A;  2D2Q A;  1D6E C;  4F1S A;  3DVG X;  2LJI A;  3PLV A;  3KWL A;  1EWC A;  3U52 E;  2KWD A;  3TEZ A;  3A4S C;  5BYR A;  1ACC A;  1ZDX A;  4K3C A;  3X0W A;  1TGZ B;  3VTV A;  1S3S G;  4L1B A;  4EZL A;  5L83 A;  3EGR A;  1WJ6 A;  3AEE B;  1E7U A;  4C4V B;  4B9K A;  2W3S A;  3RCZ A;  1WJN A;  4YWG G;  3K9O B;  1TS4 A;  2YLM A;  3SDL C;  1R4N I;  2KFJ A;  3T3O A;  2KDF B;  1YX5 B;  1EF5 A;  2J7Q B;  1P7E A;  4KKI A;  5CTR C;  5D3I B;  4IUM B;  2GBM A;  3QIJ A;  5BMH A;  5E6N A;  4WJQ A;  2K39 A;  3EUB 2;  3ZVV A;  1K50 A;  1T5X D;  4WAA A;  2BKR B;  1E7P B;  4A8X C;  2MP2 A;  1T6B X;  1U4A A;  5HHD G;  2X8X X;  3ZRF A;  3WAP A;  1P0R A;  4XWT A;  1V1P A;  1KTK A;  2ZVO A;  2L76 A;  2I38 A;  2N9E B;  4K7S A;  2WLB A;  2YEP B;  2CR5 A;  3P63 A;  1T0S C;  4FA6 A;  2WHI A;  3BK2 A;  4XX5 A;  1AW7 A;  2IY1 B;  3NG0 A;  1FFV A;  1KH0 A;  1XQQ A;  3Q8F A;  1RWS A;  4BFR A;  2UYZ B;  4NNJ B;  2HD5 B;  5LNK 1;  2BYE A;  1F2R I;  3IXS A;  1VLB A;  2GBN A;  1HQR D;  3LYY A;  4ZRI A;  2L7R A;  1F52 A;  4KGT A;  2WWZ A;  3BZD B;  5HG2 A;  3N1Y C;  2BS2 B;  4RFB A;  4MM3 B;  4OW0 A;  4AQ7 A;  1X1M A;  3NY5 A;  3DHH C;  4AUQ C;  2L0F A;  3ZKJ C;  2KXJ A;  2MHJ A;  5GMV A;  1FO4 A;  2WYQ A;  3A9J B;  3QQ8 B;  2NMQ A;  4I6P A;  2RDB C;  2O6V D;  4KDI C;  2IO2 B;  1NEK B;  1C77 A;  2IBI B;  1HZ5 A;  3M3J A;  1EUV B;  4BBN C;  3DWG C;  1C1Y B;  2BWE S;  1YN3 A;  1C79 A;  1V5T A;  2MCN B;  4M8M A;  1YMH E;  1ZPS A;  2ZEQ A;  1YX6 B;  1R7S A;  4DBG A;  3ZW3 A;  3PRZ A;  4RH6 A;  2Z8L A;  2SAK A;  4PK1 A;  3NVZ A;  3WAO A;  1TKG A;  3AE7 B;  2GOW A;  3AMZ A;  1TTN A;  3VFK A;  1WIA A;  3AI5 A;  3SD5 A;  4ANV A;  1XLQ A;  2K3U A;  4KX6 B;  4HPP A;  2KZR A;  2GLS A;  3W9C B;  2BYV E;  4HEA 1;  4HPL B;  1A70 A;  1YJJ A;  3VR8 B;  4EZJ A;  3S2A A;  1FXA A;  3ZNI D;  2M1M A;  1V97 A;  2G4D B;  2PE9 A;  2LRU A;  3DPD A;  2C60 A;  2N4F A;  3PHX B;  3I5J C;  2LXC A;  4US9 A;  2KLG A;  1GB4 A;  2LI5 A;  4TUU A;  1QOB A;  1OQR A;  5JHB A;  3RD2 A;  1N60 A;  4ZRQ A;  2BKF A;  2R2O A;  3EEC A;  1FXT B;  4PYU A;  4RCO A;  1LXD A;  1C4A A;  3EFC A;  1WGH A;  1OGW A;  4RF1 A;  4ANW A;  3BK1 A;  3AU4 A;  4A55 A;  4ZHO A;  3AE5 B;  1IBX B;  3R7R A;  3EC8 A;  4BKS D;  4EEW A;  3ZXR A;  3CIR B;  4XE0 A;  1E8Y A;  2CJN A;  3L08 A;  4LJO B;  4DDI D;  4YTN B;  2XK5 B;  2NR2 A;  2WXK A;  3QWZ B;  1KJT A;  3L54 A;  4ZRP A;  2A4Z A;  4W9K A;  1RM6 C;  5C1Z A;  1YN5 A;  2QJL A;  5BO4 B;  2AL6 A;  4OZC A;  2FCN A;  1WE6 A;  3I3T B;  4RF0 A;  4G50 A;  5TR5 A;  4MH8 A;  1FFU A;  4C80 A;  2FBW B;  3H7P B;  1WFY A;  1Q5W B;  3RN9 C;  1WSP A;  2NVU I;  2KMM A;  3Q8C A;  4HXD A;  5AUK A;  5C23 A;  1V2Y A;  2IDY A;  4W9L A;  1UWX A;  4GB9 A;  4W9J A;  3KQ4 A;  5IP4 D;  3P4P B;  3OWE B;  5IAA C;  1BT0 A;  4IOI E;  3Q3J A;  3NZS A;  2WXO A;  1UNS A;  3E56 A;  3U8Z A;  1I42 A;  3PO0 A;  3AEA B;  3RPF C;  3CWI A;  1MG8 A;  3SFD B;  3URY A;  4HJG E;  2JZZ A;  1OQY A;  4F8C B;  4PYZ A;  1J7A A;  2VH1 A;  3MC9 A;  2RGF A;  1FRR A;  1FNW A;  2L00 B;  1AN8 A;  2NBV B;  2LGS A;  1UGM A;  3TEY A;  1DYQ A;  1WZ3 A;  1QOG A;  4E71 A;  2J4X A;  3PRE A;  4M0W B;  2IYD B;  1L7Y A;  1T3Q A;  1GC6 A;  2AX5 A;  3IHP C;  3UQA A;  2HJ8 A;  3DVN U;  2L83 A;  3NVW A;  2MH7 A;  1JQ4 A;  1WYW B;  3RNE C;  2FNJ B;  4JIO U;  1FD6 A;  2JZP A;  4UDU C;  3EA6 A;  2DNF A;  2I1J A;  2BBC A;  2FUG 1;  2GI9 A;  1SXT A;  1SE9 A;  4A20 A;  2DYB A;  3L17 A;  4P16 A;  3VRB B;  4EKU A;  5HI1 A;  5DCN A;  5KHO A;  2LHD A;  2KDI A;  2JWZ A;  2MEK A;  1P98 A;  2UWQ A;  2JYE A;  3V05 A;  1EO6 A;  1PQS A;  1NVI D;  2INP E;  4HVB A;  4ITK A;  4AJY B;  4GSW A;  3KWV A;  3DOW A;  1NDD A;  3RT3 B;  1P7F A;  3Q8B A;  4TKN A;  4FHJ A;  1H8C A;  3ZXV A;  2WXG A;  4L2Y A;  3B2G A;  1L4D B;  3V60 A;  3MHZ A;  1SF0 A;  4LNF A;  3W1S A;  4TMA B;  4YT0 B;  2UU7 A;  3KH0 A;  2JX5 A;  1KF6 B;  1NI2 A;  4K3B A;  1FCL A;  4BBN F;  1PUT A;  2EMS A;  3H7P A;  3UQB A;  3R2I A;  2MJD A;  3IFW B;  2AWT A;  5E6J A;  3ZTD A;  2QIE B;  1TT5 B;  2KX0 A;  3U7Z A;  1WGD A;  3AED B;  1TS2 A;  4IM2 A;  2W3R A;  3UIP B;  1OEY J;  1AAR A;  2JXX A;  3M95 A;  3ZRC A;  5G5G A;  2KK8 A;  3GE3 C;  2KLC A;  1RAX A;  4GU2 A;  2DWQ A;  1F9J A;  1QIL A;  2Z59 B;  2LGI A;  1JCK B;  1FRD A;  4BOZ B;  2DLB A;  3VUY A;  2DZJ A;  4O1N A;  4NAW A;  3AEF B;  1UWM A;  2CS4 A;  4GGQ A;  5D6J B;  3KUC B;  1K53 A;  5D3D A;  2IJ0 A;  2W9N A;  4HRO A;  5CHF A;  2LUE A;  2AQ3 B;  3ZLZ A;  3TEW A;  2ZPN A;  1NBF C;  3PRP B;  5JHA A;  3AEC B;  4GDK B;  1YOV B;  3AXC A;  2BT6 A;  2WXP A;  3WIM A;  4NQL B;  5AZG A;  2V3P A;  4ZYS A;  1L0X B;  4AJW A;  2EKI A;  4MH0 E;  4KV2 A;  3TL5 A;  2BW2 A;  2M8S A;  1WI0 A;  4ZYN A;  1QOF A;  1B1Z A;  1ISN A;  3SR6 A;  1Y56 A;  3O65 B;  2OJW A;  1VRA B;  2KO3 A;  4M0W A;  5T8I A;  1YQ4 B;  1WX8 A;  3C0R B;  2PKO A;  3V61 A;  1L2N A;  2JRI B;  1V5O A;  3RZW C;  4MAC A;  3UF8 A;  2BB5 A;  2H89 B;  2JPH A;  1GOZ A;  3ML8 A;  5CHW A;  5D2M B;  3HM3 A;  4YSZ B;  4WQO B;  1ET9 A;  1TZO A;  2QC8 A;  2KAC A;  1K8R B;  5C3J B;  5LXH A;  1EU4 A;  1E5W A;  4W9D A;  3T9L A;  1Y8R C;  3BVG A;  4DDG D;  3RFZ B;  1Z5S B;  2KQ7 A;  3ECI A;  1KFY B;  4MEL A;  4I6L B;  2JT4 B;  1V1O A;  5BYS A;  1YQ3 B;  3Q3M C;  2WXL A;  1SBB B;  2DYO A;  5J2R A;  4PT5 A;  1IUE A;  2C7H A;  3Q3O C;  2AL3 A;  1HA5 A;  1ENF A;  2ZCB A;  3HK0 A;  1UBQ A;  2VZK D;  2INN E;  3PV1 A;  3ZJU A;  3N3K B;  1EU3 A;  4NPN A;  1L0V B;  3GOE A;  2RDH A;  1I4R A;  1GUA B;  3B08 A;  4DHZ E;  1JWA D;  3VHT C;  1VD2 A;  3JSV B;  2DZM A;  2KVZ A;  1TY2 A;  4FBJ B;  3P2B A;  4QAY A;  1VZ8 A;  1YJI A;  2LRW A;  4HDO A;  1HZ6 A;  1YJ1 A;  2OJR A;  5H8Y E;  1UD7 A;  3UI3 A;  5G55 A;  1SEB D;  2KC2 A;  4HLE A;  3QCA A;  3RNC C;  3ETR A;  5EE9 A;  4K1R B;  3PZD A;  2ZNV B;  1VZ7 A;  4KIK A;  3Q2A C;  3DBH I;  4AOF A;  4N6E B;  1KRH A;  1STE A;  3W1S C;  3ZQ4 A;  2ZW0 A;  3PLU A; 
#chains in the Genus database with same CATH homology
 2N7E A;  2LI5 A;  1YIW A;  4TUU A;  2DAF A;  4J6I A;  5JHB A;  4IC7 B;  3CST A;  3RD2 A;  2KTR A;  3CF6 E;  2RPQ A;  2ZVN A;  4GXB A;  5DPR A;  3CSF A;  2BKF A;  2R2O A;  3EEC A;  3OAW A;  2KVR A;  4OVU A;  2KQS A;  2K6D B;  1FXT B;  2DYM A;  5DPT A;  4GIV A;  4PYU A;  3UGB B;  1WJU A;  1LXD A;  2O2V B;  1V49 A;  1LQB A;  2KDE B;  3ZTC A;  5IA7 A;  2JVC A;  4NJ7 A;  4DWF A;  1XD3 B;  1WGH A;  2KWV B;  1OGW A;  2KMC A;  2DHZ A;  2DZK A;  4KIK B;  4ANW A;  3A9K A;  2PJH A;  2WDT B;  3AU4 A;  3KUD B;  2IO1 B;  3L16 A;  2LVO A;  4E3C A;  3R7R A;  1WMH B;  3EC8 A;  3QJZ A;  2DZI A;  4KDL B;  4BKS D;  4E74 A;  4EEW A;  4IG7 B;  1WZ0 A;  3H6N A;  1E8Y A;  2Y5B B;  4ZDV A;  5JZE B;  3L08 A;  4BVU C;  1IP9 A;  1WY8 A;  3QAQ A;  2CHZ A;  2K8C A;  1WJ4 A;  4LJO B;  5E6P A;  4DDI D;  2XK5 B;  2NR2 A;  3VH3 B;  5E6O A;  3DQV A;  3WAL A;  3QWZ B;  2BGF A;  3V62 A;  4MEM A;  1J19 A;  4MGI E;  4ANX A;  2KMA A;  3L0W B;  1KJT A;  3L54 A;  2J0K A;  2A4Z A;  3VTU A;  4W9K A;  1WGG A;  3LJ3 A;  4WWP A;  2M17 A;  2M0X A;  5C1Z A;  5BO4 B;  4MJS A;  2AL6 A;  2FCN A;  1WXM A;  4FJZ A;  1WE6 A;  3I3T B;  2KOX A;  3PT2 B;  4G50 A;  4WJN A;  2KDB A;  2CKH B;  3BIN A;  2K8H A;  3LDZ E;  5TR5 A;  4F7Z A;  5DPW A;  2KFK B;  2GMI C;  3V6E B;  3VXW A;  2ZPY A;  3H7P B;  1WFY A;  1Q5W B;  4B95 A;  1GC7 A;  3QK0 A;  4GMV A;  2HTH A;  4NAW B;  2XK5 A;  2KTF A;  2NVU I;  2EMT A;  4FJV B;  4CO7 A;  4FJY A;  2IZV B;  3BY4 B;  2I1K A;  4MSQ B;  3X23 A;  3KYC D;  4HXD A;  4NQK E;  3K9P B;  1ZGU B;  3DVN V;  3AUL A;  1E90 A;  4II3 B;  2BF8 B;  5C23 A;  4XZ4 A;  2CHW A;  3TBL D;  2MLB A;  2LD9 A;  3SHQ A;  1P1A A;  2MWS B;  2KAN A;  2ZZP B;  1TBE A;  1V2Y A;  3H7S A;  4MGK E;  3DVG Y;  4W9L A;  4GB9 A;  3ZUN A;  3Q3F A;  4W9J A;  1SGH A;  3EFU A;  4YL8 A;  1GG3 A;  3OJ4 B;  3PGE A;  1J0G A;  3HHM A;  3CMM B;  3PPA A;  5IAA C;  3RUL A;  2MP2 B;  1D3Z A;  2XBB C;  4HCP B;  4G11 A;  1BT0 A;  3VUW A;  2KD0 A;  4EOY A;  3ZO5 B;  3Q3J A;  4N9F 4;  2N1W A;  3NZS A;  1LM8 B;  3NZU A;  3U8Z A;  3MTN B;  2JY6 A;  2KJR A;  2NS5 A;  2WX0 A;  1I42 A;  3L13 A;  2O2V A;  5HKH A;  4M8N A;  1MG8 A;  3QA8 A;  5AEK B;  1S1Q B;  3ONS A;  1YQB A;  4GDL A;  3APF A;  2JZZ A;  3JSV A;  2CHX A;  2MSE D;  1P9D U;  1OQY A;  2IO3 B;  3KW5 B;  3W1Y A;  4ASW C;  4F8C B;  4FAD A;  2MX2 A;  2GBK A;  3VDZ A;  4PYZ A;  1E8W A;  1ZW7 A;  2IY0 B;  3PTF C;  4BKG A;  3B1L X;  2B3A A;  3NS8 A;  1WGR A;  3N32 A;  4JGH B;  4B6W A;  2RGF A;  4HK2 A;  2Z0E B;  1GJZ A;  4KVG B;  4TV3 A;  1V9J A;  5DPS A;  2L00 B;  3M62 B;  1I35 A;  2NBV B;  3WAM A;  4TQ0 A;  4G0N B;  4EFO A;  4AWJ A;  1UGM A;  2C5L C;  2O6V B;  3RYT A;  1WZ3 A;  4KSK C;  2MBH A;  3QX1 A;  4MM3 A;  1Z2M A;  4E71 A;  2CU1 A;  4GN1 A;  4MSM B;  3PRE A;  5CX3 A;  3ENE A;  3D32 A;  3T8M A;  4M0W B;  2IYD B;  4WWO A;  3JW0 X;  2D3G A;  1L7Y A;  2J0J A;  4MDK E;  2Z0D B;  1GC6 A;  3RUI B;  4W9F A;  3IHP C;  3UQA A;  2HJ8 A;  3QHT A;  3DVN U;  4PS8 A;  4ZRJ A;  2D11 A;  3EHV A;  4WJP A;  1IPG A;  3PVL A;  1WYW B;  3TIX A;  3VUX A;  1G6J A;  3TJP A;  2MBO A;  2JRH A;  1XT9 B;  3A4R A;  5JH5 C;  2G4S A;  2ZJD A;  1UEL A;  2FNJ B;  2D07 B;  2MW5 A;  4HWI B;  4JIO U;  2KJH B;  2NCN A;  1WH3 A;  5CHV C;  3PS6 A;  2I1J A;  3N30 A;  4II2 B;  3ML9 A;  2FCQ A;  1WX7 A;  2NBU A;  4PS7 A;  2XEW A;  4I6N B;  1WRD B;  4TQ1 A;  1J8C A;  3OLM D;  2KNB A;  1SE9 A;  5G2N A;  4A20 A;  2DYB A;  3L17 A;  4X57 B;  4FN2 A;  3VVW B;  2KX3 A;  2LVQ A;  4EKU A;  3VAW A;  5AZF A;  2N9X A;  4HDQ A;  3A9K B;  1RLF A;  3KVF B;  5DCN A;  5KHO A;  3ALB A;  4DK5 A;  3DBR I;  2KDI A;  2JWZ A;  1OEY A;  3HIZ A;  1WMH A;  3QAR A;  4JL9 A;  1RFA A;  1P98 A;  2YVC A;  4EZK A;  1WF9 A;  1SIF A;  2UWQ A;  4EUT A;  1VCB A;  2K8B A;  1EO6 A;  3A9J A;  1PQS A;  4FLH A;  4HVB A;  3ZDT A;  3DBL I;  4AJY B;  4GSW A;  2PEA A;  3DOW A;  1KM7 A;  2WX1 A;  1NDD A;  1R4M I;  1WXV A;  3RT3 B;  2KJ6 A;  1WE7 A;  2MQJ A;  1ZKH A;  4GOC A;  4TKN A;  2FAZ A;  3TCA A;  4FHJ A;  4DXA B;  3WAN A;  1H8C A;  4G3X B;  2MBB B;  4W9E A;  2DX5 B;  1E7V A;  2JF5 A;  3V60 A;  2G45 B;  4XC2 A;  2NPT A;  3U30 A;  2L8J A;  3W1S A;  1IYF A;  3ZNG C;  3A1Q B;  3DDC B;  2LGY A;  3KH0 A;  3U7D A;  3L10 B;  4FUL A;  1HE8 A;  1V81 A;  2LZ6 A;  1P3Q U;  3IG3 A;  3KUZ A;  5L95 C;  1NI2 A;  3SU8 X;  4NY0 A;  2KFK A;  3VTW A;  2AYO B;  4BBN F;  2EMS A;  3H7P A;  4IWP A;  3UQB A;  1KLV A;  5D94 A;  1V86 A;  3IFW B;  4K81 A;  2AWT A;  1WXS A;  3APD A;  2K25 A;  3ZTD A;  2RSU A;  2L05 A;  2DEN B;  2KX0 A;  1WGD A;  2O6V A;  1YD8 U;  4IM2 A;  2L3Z A;  2V4L A;  4ICU A;  2D10 A;  1E8X A;  3UIP B;  2D2Q A;  1OEY J;  4F1S A;  3DVG X;  1WXA A;  4KZ0 A;  1AAR A;  2C7M B;  2DAJ A;  4CYE A;  3DCG A;  3PLV A;  2JXX A;  3M95 A;  3ZRC A;  4OVV A;  4BOS C;  4LDT D;  4RM8 A;  2KK8 A;  2LAS A;  3A4S C;  2MBE A;  2KLC A;  1RAX A;  4BKS A;  4GU2 A;  4GDK A;  3A33 B;  4K7W A;  1F9J A;  3R66 C;  3H1U A;  2L0T A;  3X0W A;  5FR6 A;  1TGZ B;  2Z59 B;  2ASQ A;  1S3S G;  3VTV A;  4BOZ B;  3VUY A;  2N7D A;  4EZL A;  1LFD A;  5L83 A;  1QZE A;  1E8Z A;  1WJ6 A;  1E7U A;  2DZJ A;  1M94 A;  4NAW A;  2CS4 A;  2NBW B;  4GGQ A;  5D6J B;  4B9K A;  2PPH A;  3RZF A;  3KUC B;  4W9C A;  3RCZ A;  3GZN I;  1WJN A;  4W9G A;  3OJ3 A;  3K9O B;  2YLM A;  2W9N A;  3SDL C;  5LXI B;  2VRR B;  2FCM A;  1R4N I;  2G3Q B;  2KFJ A;  3VH4 B;  3WA0 A;  5CHF A;  2KDF B;  2FCS A;  2LUE A;  1JRU A;  4ZRK A;  1YX5 B;  3ZIM A;  1EF5 A;  2J7Q B;  1WX9 A;  5CTR C;  2ZNV C;  4IUM B;  2GBM A;  3MHS D;  3JYU A;  3QIJ A;  3ZLZ A;  5E6N A;  1WR6 E;  1NBF C;  2LVP A;  2ZPN A;  3PRP B;  2KC1 A;  3PSE B;  4GDK B;  4WJQ A;  3TMP B;  2K39 A;  3AXC A;  3WIM A;  3ZVV A;  4NQL B;  5AZG A;  2REX A;  2V1Y A;  2BKR B;  1Q0W B;  4WAA A;  2K1F A;  2MP2 A;  4WJO A;  1EF1 A;  4IWQ A;  4DHZ B;  4MGZ E;  1U4A A;  4AJW A;  1RRB A;  4MH0 E;  4KV2 A;  4K7U A;  3TL5 A;  4LDT B;  3ZRF A;  3QC8 B;  1UH6 A;  2M8S A;  1WI0 A;  3WAP A;  1P0R A;  4ZYN A;  3R7Q A;  4ICV A;  2AEH A;  1ISN A;  1WGY A;  2N9P C;  2ZVO A;  2L76 A;  3O65 B;  2N9E B;  4K7S A;  2KO3 A;  2CR5 A;  4FA6 A;  4MGY E;  4XX5 A;  2BWF A;  2MRP A;  2IY1 B;  1T0Y A;  2NPT B;  3B0A A;  4HJK A;  2LWP A;  3UIO B;  1WX8 A;  3C0R B;  4A3O A;  3A1Q A;  2M4N A;  1XQQ A;  2KHW B;  3V61 A;  2BYF A;  1L2N A;  3AU5 A;  2JRI B;  3IVF A;  4HPM B;  1V5O A;  4BFR A;  2UYZ B;  3RZW C;  2HE7 A;  1UBI A;  2HD5 B;  4NNJ B;  3UF8 A;  2BYE A;  2ZCC A;  4HCN B;  1A5R A;  4IM0 A;  1KOT A;  2JPH A;  3HM6 X;  1WM3 A;  3ML8 A;  2GBN A;  5CHW A;  5EDS A;  5D2M B;  3ZNZ B;  4ZRI A;  5JHA A;  3HM3 A;  3V6C B;  5J17 A;  2L7R A;  2JUO A;  4WQO B;  2WWZ A;  2JZ3 B;  2BPS A;  2LGX A;  3M63 B;  1K8R B;  5LXH A;  3H9D A;  1E5W A;  4WWN A;  4W9D A;  3T9L A;  1X1M A;  1Y8R C;  3NY5 A;  4IWO A;  4W9H A;  4DDG D;  4AUQ C;  1Z5S B;  2KQ7 A;  2GBR A;  2L0F A;  3ECI A;  2KKC A;  3ZDM C;  3ZKJ C;  3R3M A;  2KXJ A;  3DBS A;  4MEL A;  5KHQ A;  4I6L B;  2JT4 B;  2RD0 A;  4KZC A;  2C9W B;  4DHJ D;  2QHO A;  2DYO A;  5GMV A;  2J0M A;  3APC A;  2WYQ A;  3NHE B;  1TZ1 A;  3VQI A;  5J2R A;  3A9J B;  3QQ8 B;  4I6P A;  2C7H A;  2AL3 A;  2IO0 B;  2O6V D;  2R2Q A;  4KDI C;  2IO2 B;  3PLU A;  3UIN B;  3ZNH B;  2KWC A;  2ZCB A;  3HK0 A;  1UBQ A;  5LLI A;  2IBI B;  3PV1 A;  2OOB B;  2KWU B;  3M3J A;  3N3K B;  1UZX B;  4NPN A;  2A5U A;  3GOE A;  4RM9 A;  2K6Q A;  4LCD E;  4URK A;  1EUV B;  4BBN C;  2PE6 B;  2FID A;  2MA9 B;  2RR9 A;  1GUA B;  3KYD D;  3B08 A;  4DHZ E;  3PHW B;  3VHT C;  1C1Y B;  2BWE S;  4GDL B;  1VD2 A;  4BKT A;  4MJS B;  3JSV B;  2FUH B;  3IBE A;  1V5T A;  4JQW C;  2DZM A;  4FHK A;  2MCN B;  4IM3 A;  4M8M A;  2LJ5 A;  2KN5 A;  2N1V A;  4FBJ B;  3P2B A;  2ZEQ A;  5AZH A;  4RMA A;  4ANU A;  1YX6 B;  2LGD A;  4NJ6 A;  4DBG A;  3ZW3 A;  3PRZ A;  4LJP B;  4JLC A;  3NOB A;  2LRW A;  4HDO A;  4PS3 A;  3WAO A;  1WM2 A;  4KSL C;  4W9I A;  2GOW A;  1Q1O A;  1YJ1 A;  2KTR B;  3JVZ X;  1TTN A;  3VFK A;  1V80 A;  4CHK A;  2OJR A;  4A3P A;  1OTR B;  4P7I A;  1UD7 A;  1WIA A;  3AI5 A;  3PRM B;  3SD5 A;  4ANV A;  5G55 A;  1GNU A;  2KC2 A;  1WR1 A;  4HLE A;  2LXA A;  3QCA A;  4IW0 A;  2KZR A;  5J18 A;  3MJW A;  2BYV E;  2C7N B;  4HPL B;  2GBJ A;  4K1R B;  2EKE C;  1C3T A;  4EZJ A;  3S2A A;  2V3S A;  3PZD A;  5D7G A;  2ZNV B;  3ZNI D;  4AP4 C;  2M1M A;  1CMX B;  2G4D B;  4KIK A;  2PE9 A;  1H4R A;  2LRU A;  3DPD A;  2C60 A;  3DBH I;  2N4F A;  4AOF A;  2MBQ A;  3PHX B;  4DHJ B;  3W1S C;  2LXC A;  2FIF A;  1V6E A;  2KLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...