3QWZB

Crystal structure of faf1 ubx-p97n-domain complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
79
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 19
structure length 79
sequence length 81
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qwzB00
3HK0A 4MGIE 4W9LA 3ZIMA 4TUUA 1WR1A 3APFA 4CHKA 2K8HA 3V61A 2KJHB 3VQIA 3PREA 5J17A 2FUHB 1WX9A 2L8JA 4KVGB 3ZNID 3ML8A 3ZKJC 1WMHB 2BWES 4FADA 4BKSA 2DENB 3K9OB 2YVCA 1NBFC 4ZRJA 4MGYE 2OJRA 2NBUA 4MJSB 4ZDVA 2M0XA 2KKCA 2NPTB 4RM8A 1R4NI 1WZ3A 1Z5SB 2Y5BB 2JZZA 3MHSD 2NR2A 5CHWA 5IA7A 2KOXA 5G55A 2EMSA 1CMXB 2FCNA 3VTVA 2KZRA 3VXWA 1YD8U 1TBEA 2KN5A 4FA6A 4GSWA 2MBOA 2MP2B 4A3PA 4I6NB 3RCZA 3H7PB 2MQJA 2VRRB 2ZPNA 5KHQA 4TQ0A 2IYDB 4NY0A 4KDIC 2GOWA 3TL5A 2ZVOA 2LGYA 4M0WB 4WWPA 4B95A 5KHOA 1WJ6A 1WX7A 4II2B 2PPHA 3TIXA 4BBNC 1EO6A 2JF5A 3UQBA 4GDLA 2BKFA 1XQQA 2WX1A 3TMPB 3H7SA 3PLUA 2LI5A 1V2YA 2O6VB 4JLCA 4DWFA 1V81A 4WAAA 1V5OA 5GMVA 2FCQA 2HE7A 4GU2A 2DYMA 3A9JA 3QAQA 1EF5A 1GUAB 4JGHB 2UWQA 1OEYJ 2RD0A 3AU5A 3PRZA 5DPSA 3PS6A 5CHFA 1WXSA 2ZJDA 3CSTA 4KSKC 1P1AA 3DVGX 1WIAA 2KO3A 4BBNF 2B3AA 1V6EA 2MBQA 1ZW7A 1KLVA 2CU1A 3KW5B 2A4ZA 1UZXB 1GJZA 2IO1B 4EOYA 4W9HA 3HIZA 5LXIB 1D3ZA 1G6JA 3ONSA 4W9GA 1WE6A 3L16A 1UELA 4W9FA 2JPHA 3LDZE 2LWPA 2LZ6A 4GIVA 4HK2A 3V60A 3P2BA 2G4SA 5L95C 2ZVNA 1YJ1A 1HE8A 2LRUA 1TTNA 4F8CB 3K9PB 3ZVVA 2LXCA 4ANWA 4DHZE 3RUIB 2JRHA 3B08A 3IHPC 2OOBB 1E8XA 3ZNGC 4WWOA 2BYEA 2LVPA 4CYEA 3WAOA 2KQ7A 2ZCCA 3AU4A 3R7RA 2C5LC 2IZVB 2ZCBA 2K1FA 4K7UA 4PS8A 3PPAA 4HCNB 2LVOA 4F1SA 2HTHA 4TKNA 4WJQA 3H1UA 1WM3A 2DZMA 4ICVA 3T9LA 5TR5A 2GBNA 2DHZA 3R3MA 3L17A 1P9DU 1UBIA 3B0AA 4K7SA 1I42A 3A1QA 1WX8A 2L7RA 1YX6B 2BWFA 4GB9A 4LJOB 3VVWB 2K6QA 5C1ZA 1TGZB 3ZLZA 4EKUA 2Z59B 2KX0A 3TBLD 3X23A 2CR5A 4AWJA 3B1LX 2G4DB 2GBRA 2KFKA 2RPQA 1LFDA 2JZ3B 2KLGA 3N32A 3N30A 2IO2B 1Q5WB 2AWTA 2O2VA 1FXTB 1PQSA 4P7IA 4AJWA 4I6PA 2MCNB 1P98A 3VFKA 5DPTA 1OEYA 4KZ0A 3CSFA 4ZRIA 2LXAA 1E5WA 3TJPA 4AUQC 1VD2A 3DBRI 1A5RA 1QZEA 3AULA 2KC2A 4W9IA 4PYZA 2NBVB 4WWNA 3OJ3A 4MELA 1SGHA 4FLHA 2DYOA 4HVBA 4DHJD 3QCAA 2JUOA 3VTUA 3JVZX 3PTFC 5AZHA 4TV3A 4FHKA 3QX1A 5DCNA 3QJZA 2KWVB 1UH6A 1E7UA 2RR9A 2GBJA 2C7NB 1NI2A 1S1QB 4DXAB 2MSED 5BO4B 5D7GA 1P3QU 2C7MB 2DZKA 4NAWB 3ZDMC 2MBEA 1E8ZA 2AEHA 4NPNA 5E6OA 4N9F4 3ZRFA 1RRBA 4J6IA 3SHQA 3OJ4B 2PJHA 3VTWA 2LGDA 4URKA 1XT9B 1OGWA 2KMCA 2MBBB 4HDQA 4PS7A 2KLCA 1E90A 1WJ4A 1UGMA 1KJTA 1YX5B 3UIOB 2W9NA 2N4FA 1V9JA 1EUVB 2LUEA 2Z0DB 3S2AA 4CO7A 4KSLC 2N1VA 1F9JA 2C60A 1WRDB 4WJOA 3UQAA 5LLIA 1YIWA 1BT0A 5EDSA 3U7DA 2LVQA 1V5TA 2G45B 1WF9A 2JRIB 4JIOU 4RM9A 2M8SA 3KUZA 3NZUA 3NY5A 2BPSA 2L3ZA 1WE7A 3A1QB 4IM2A 2D07B 4MH0E 4NJ7A 4ZRKA 3DVNV 2KK8A 3A33B 2JY6A 4W9JA 4IW0A 2KWCA 2IY0B 3W1SC 3QC8B 1WY8A 3TCAA 4MGZE 4EZLA 2D2QA 2KC1A 2WDTB 3L13A 3PRMB 3PSEB 4WQOB 3VUWA 3GZNI 1Y8RC 3RULA 2ZZPB 2O2VB 4MDKE 2J7QB 4WJNA 1AARA 5C23A 2RGFA 5JHAA 3KVFB 3V62A 2IBIB 3IVFA 1LXDA 2K8BA 1ZKHA 3VHTC 2KMAA 3KUDB 4AP4C 3N3KB 3H6NA 4TQ1A 3NOBA 3UF8A 3IG3A 3DVGY 4BOSC 4AOFA 4KDLB 4WJPA 2V1YA 4F7ZA 1WXVA 3ECIA 4IUMB 4XX5A 2O6VD 2XK5A 1Q1OA 2HD5B 3JYUA 2KVRA 2L0TA 3ZNHB 3LJ3A 4GMVA 3VUXA 3PHXB 3M3JA 4ZYNA 4E71A 1E8YA 3MJWA 3APCA 3GOEA 2N9EB 2ASQA 4FHJA 2D10A 4MM3A 2KTRA 3A4RA 5DPRA 3M62B 4LDTB 4LCDE 4IWPA 3PGEA 1NDDA 2GBMA 3APDA 4E3CA 5JH5C 2AYOB 4IC7B 2V4LA 3VH4B 2IY1B 4ICUA 4PYUA 4NNJB 4BKGA 5AEKB 4FJZA 1K8RB 2Z0EB 1OQYA 2J0KA 3ZNZB 5CTRC 5G2NA 4BOZB 3PRPB 5D2MB 2K8CA 3WAPA 3V6CB 1WMHA 1V86A 2AL3A 1WGGA 1H4RA 3L0WB 3KYCD 4MSQB 1KOTA 1EF1A 2KNBA 1SE9A 4M8NA 4DDGD 4KIKA 4IWQA 2ZPYA 3HM6X 4HDOA 2PEAA 4ANVA 2BF8B 2DZIA 1L7YA 3HM3A 4DDID 3PVLA 2NS5A 5CHVC 2L0FA 1LQBA 5L83A 3ZUNA 4XZ4A 4GDLB 2CHWA 4HXDA 3ENEA 4RMAA 3X0WA 5LXHA 1OTRB 3PT2B 2FIFA 5JHBA 2HJ8A 2CKHB 2J0MA 4EUTA 3KH0A 1C3TA 3L08A 3SD5A 2DYBA 2I1KA 4OVUA 1RAXA 1M94A 3DBLI 2MW5A 3A9JB 3KUCB 1JRUA 2QHOA 4M8MA 1T0YA 3DOWA 1P0RA 4HCPB 4B9KA 1WGDA 1S3SG 3AXCA 2MA9B 3DBHI 1XD3B 2WWZA 3L54A 2ZNVB 2L05A 4K1RB 2O6VA 1RLFA 1KM7A 3NZSA 4DBGA 4MGKE 2KDFB 2KJ6A 4PS3A 1WGRA 2IO0B 2CHXA 2N9PC 3WALA 2KANA 3WA0A 2GBKA 4FN2A 3M95A 5HKHA 3DVNU 5JZEB 2MRPA 2G3QB 4NQKE 2KTRB 3QQ8B 3SU8X 4DK5A 1IYFA 1GC7A 1R4MI 4JQWC 3ZDTA 4IG7B 4W9KA 4GDKA 2XEWA 2A5UA 2KDBA 4EEWA 3U30A 1E8WA 5AZGA 1U4AA 1L2NA 4ASWC 2JT4B 3QARA 3QK0A 4AJYB 4XC2A 3R7QA 1WZ0A 2IO3B 4GGQA 4IM0A 2M17A 3L10B 5DPWA 3T8MA 2KHWB 5E6PA 2JWZA 2KDEB 2ZEQA 3EC8A 3JSVA 4FJYA 1GC6A 4G3XB 3MTNB 4KIKB 4GOCA 1Z2MA 2DAFA 4IM3A 2KTFA 2MBHA 3DDCB 4YL8A 3C0RB 4X57B 3JW0X 2AL6A 3WIMA 1VCBA 1WH3A 2LASA 4LJPB 2KFKB 3VUYA 3EHVA 3VDZA 3PV1A 1IPGA 5D94A 1WFYA 3CMMB 2YLMA 3RZFA 3IFWB 2BYVE 3NHEB 1V49A 2UYZB 4A3OA 2CHZA 3W1YA 1YQBA 3ALBA 2DAJA 3QA8A 2N1WA 1V80A 3D32A 3A9KA 2K6DB 3UGBB 3VH3B 2XBBC 5J18A 3WAMA 3SDLC 4NJ6A 3PZDA 4B6WA 4ANUA 4ANXA 3W1SA 1MG8A 5AZFA 1WXMA 1TZ1A 2ZNVC 1ISNA 2FCSA 2FAZA 4IWOA 1J0GA 3QWZB 2RSUA 2N9XA 3I3TB 4GN1A 1UBQA 1E7VA 1UD7A 1WJUA 2D3GA 5E6NA 2LJ5A 4FBJB 5J2RA 1J19A 2K39A 4HPMB 2KFJA 2N7DA 2KD0A 3RYTA 2KJRA 4W9EA 3R66C 1WGHA 1H8CA 2KX3A 4EZKA 1SIFA 4KV2A 2V3SA 3RZWC 3V6EB 3H9DA 2PE9A 2JXXA 2KQSA 3PHWB 3Q3JA 4GDKB 4K7WA 5CX3A 5FR6A 3OAWA 4W9CA 4KZCA 4G0NB 1WYWB 1IP9A 2GMIC 2K25A 3QIJA 1WI0A 4NAWA 2R2OA 3UINB 3ZTCA 2MLBA 4LDTD 3RD2A 1GNUA 4BKSD 2BGFA 2L00B 1J8CA 4E74A 1WM2A 3ZTDA 4MJSA 2NPTA 1LM8B 2M1MA 4DHZB 2C7HA 4K81A 1WGYA 4OVVA 1WR6E 3JSVB 2J0JA 2NCNA 3PLVA 1I35A 4G50A 2WX0A 3DCGA 3U8ZA 4FJVB 4G11A 2C9WB 4MSMB 1GG3A 3ML9A 2EMTA 3WANA 3BINA 2R2QA 2L76A 2FCMA 4EFOA 2MP2A 3IBEA 4I6LB 1WXAA 3H7PA 2CS4A 2LRWA 2KXJA 4NQLB 2D11A 3QHTA 4GXBA 2KDIA 4W9DA 1C1YB 3DPDA 4FULA 2WYQA 2DZJA 4A20A 5D6JB 3HHMA 2DX5B 3NS8A 4JL9A 2BKRB 4HWIB 2FNJB 3DQVA 3DBSA 2BYFA 2EKEC 3A9KB 3RT3B 1ZGUB 1RFAA 3BY4B 3M63B 2MX2A 1X1MA 2PE6B 2M4NA 3A4SC 3ZW3A 3VAWA 4DHJB 4HPLB 3OLMD 4II3B 2NVUI 2NBWB 2XK5B 3ZRCA 3AI5A 2N7EA 3KYDD 4MEMA 4HLEA 3Q3FA 1Q0WB 3EECA 3UIPB 4EZJA 2KWUB 4BKTA 3CF6E 2I1JA 2JVCA 3O65B 4BVUC 4BFRA 2MWSB 4HJKA 2LGXA 2REXA 3EFUA 3ZO5B 5IAAC 2FIDA 2LD9A 1WJNA
chains in the Genus database with same CATH superfamily
4W9LA 1WR1A 1TS4A 3PREA 1WX9A 2DENB 3K9OB 3I63C 4ZRJA 3RN9C 4MJSB 2KKCA 4RM8A 1WRIA 3MHSD 2NR2A 1ZP0B 5G55A 1MHHE 2KZRA 2QIEB 4J3OD 1YD8U 4NJCA 4ZOHC 4GSWA 3RCZA 2ZPNA 4KDIC 4N6EB 1CZPA 4M0WB 1WJ6A 1FFUA 3E9SA 2PPHA 1JWAD 3SFEB 1EO6A 1KLGD 4GDLA 1FXAA 1XQQA 2WX1A 4RGNA 2LI5A 3TSSA 2NTTA 4JLCA 2N7JA 1V5OA 5GMVA 2FCQA 4GU2A 2DYMA 1EF5A 1GUAB 2L1AA 2UWQA 1OEYJ 2RD0A 3PRZA 4KSKC 1ROEA 1WIAA 4BBNF 2MBQA 2IO1B 4W9HA 1K53A 4W9FA 3LDZE 2LWPA 1T0SC 4HK2A 2OHFA 1HE8A 1TTNA 2OOBB 1E8XA 2BYEA 2LVPA 4CYEA 4AQ7A 1FMAD 3PPAA 4IDIA 4CQNA 2DZMA 3V3XA 3Q8EA 5I4DA 1I42A 1EU4A 2BWFA 5TSSA 3ZLZA 3AEFB 4DXGA 2KX0A 3NVYA 2CR5A 2INPE 2V9HA 1QF6A 2KLGA 2AWTA 3KWLA 1FXTB 4I6PA 2MCNB 1OEYA 4ZRIA 3GS2A 2WXPA 4R3DA 2L52A 3AEDB 3ETRA 3FAHA 4P6VF 4WWNA 2NBVB 4HVBA 3VTUA 3PTFC 3B2GA 4TV3A 1UH6A 1CJEA 2GBJA 2C7NB 2ONQA 1NI2A 3MJ5A 4US9A 4XWWA 4DXAB 3ZDMC 3ZGZA 4ZHOA 3SHQA 4URKA 1RYJA 4PS7A 1WJ4A 2WNMA 4N58A 3S2AA 4CO7A 2N1VA 1BT0A 1KRHA 2JXTA 4WH4A 2WXMA 1WF9A 2JRIB 4RM9A 3P4RB 2L3ZA 4IM2A 3A33B 2JY6A 4W9JA 5HHDG 1PUTA 2KWCA 2BQQA 3U4EG 4MGZE 1L4ZB 2KC1A 2WDTB 3PRMB 2WDVB 1AARA 1QOAA 1LXDA 3VHTC 5HI1A 3N3KB 3H6NA 3UF8A 3NOBA 1J7AA 4AOFA 4KDLB 2V1YA 4IUMB 1HXYD 2KVRA 3LJ3A 4GMVA 1ZXHA 4ZYNA 4YSXB 3MJWA 2BVCA 3APCA 3DWGC 4B0EA 2N9EB 2ASQA 3L4PA 5DPRA 1ESFA 5JH5C 4IC7B 2MJ3A 5BYRA 1K8RB 4RCOA 1OQYA 2V3NA 3PRPB 2K8CA 3V6CB 1V86A 1H4RA 4C00A 3ZYYX 4KIKA 4IWQA 4HDOA 3LYYA 3P63A 4HEA1 3IXSA 1N63A 1L7YA 2IJ0A 2VZKD 3PVLA 3ZUNA 2CHWA 4HXDA 2I38A 4TMAB 2B76B 2FIFA 2HJ8A 3SD5A 1TY2A 1RAXA 1M94A 1P0RA 4B9KA 4P16A 2MA9B 3DBHI 1R7SA 1DOIA 2LHEA 3J9CA 4L2YA 4K1RB 2O6VA 4MGKE 2IO0B 3NVZA 2N9PC 1WYGA 1FNWA 2BS4B 4FN2A 5JZEB 2MRPA 4NQKE 1IYFA 2Y5CA 4JQWC 3ZDTA 4IG7B 2XEWA 2A5UA 3U30A 1V1PA 2GB1A 4RGOS 5AZGA 1L2NA 1EM7A 1XO3A 4AJYB 2LHDA 2BS3B 3W5VB 2K5PA 2JSVX 2JWZA 3AEGB 4FJYA 3ZJTA 4GOCA 4A90A 4YL8A 3TEWA 4X57B 4A6QA 1YMHE 5D94A 3NZ3A 3CMMB 2YLMA 1QLBB 4OZBA 2DAJA 2N1WA 3A9KA 3VH3B 4L23A 1MG8A 2E3TA 5AZFA 3KQ4A 1I7HA 2FAZA 3QWZB 3W5UB 1SE3A 3I3TB 3R2IA 2D3GA 5E6NA 2KQ4X 2HTME 1I4PA 2K39A 4HPMB 3R66C 1ACCA 2KX3A 4EZKA 1SIFA 2V3SA 3OWEB 3H9DA 1TKEA 3Q3JA 5CX3A 2RDBC 2GMIC 2K25A 3QIJA 1WI0A 4NAWA 2QMTA 4C56C 3CIRB 1B9RA 4E74A 1WM2A 1WGKA 1N62A 1VDVA 2NPTA 1ZPSA 1LM8B 3VRAB 2HDEA 2LFIA 4K81A 1WR6E 2EMTA 3WANA 1JWSD 1ENFA 1WSPA 2L76A 2FCMA 5EE9A 2KDIA 2DZJA 2J42A 3SEBA 1BXTA 3DBLB 2BKRB 1AW7A 3DBSA 3RT3B 1FPYA 3BY4B 1D4BA 3RNCC 1E10A 2W82A 1NI3A 3A4SC 3VAWA 3OLMD 1D5MC 3P4QB 3AI5A 1VR9A 2BYTA 4DXFA 4HLEA 1Q0WB 4EZJA 1RM6C 3HRDD 3AE5B 2JZPA 3AE4B 2W54A 3O65B 2AX5A 4Q2JA 2REXA 4WIPA 1FCLA 1SEBD 2J52A 2K8HA 1WJNA 1RWSA 3ZIMA 3APFA 3V61A 2KJHB 3VQIA 5J17A 1XXGA 1IGDA 4KVGB 3ML8A 3ZKJC 1WMHB 2GLSA 1YN4A 4MGYE 2OJRA 3EGRA 1L6UA 2WU5B 1R4NI 1WZ3A 1Z5SB 2Y5BB 2WXHA 2WXFA 5CHWA 5IA7A 3OG5A 1STEA 2FCNA 1SB3C 3VTVA 1D5ZC 4US8A 1TS5A 2QC8A 1OQQA 2KN5A 1UUPA 4FA6A 2MBOA 2JX5A 5KHQA 1CK1A 5BYSA 3IT6B 3CWIA 4LNOA 3TL5A 2CU3A 4WWPA 1J7BA 5KHOA 2IPKD 4II2B 1HTQA 1FD6A 3ZXVA 1JCKB 3UQBA 3TMPB 3H7SA 1V2YA 1F2RI 3FILA 1V81A 4WAAA 1TY0A 3A9JA 3AU5A 1I4HA 5DPSA 1WXSA 2ZJDA 2KMMA 1FM0D 2B3AA 1V6EA 3RNGC 1KLVA 1ZW7A 2CU1A 3KW5B 1UZXB 1GJZA 1WXQA 1G6JA 3HIZA 2LGIA 3I9V1 1D3ZA 3ONSA 4W9GA 3EUB2 3L16A 1UELA 4WWMA 2LZ6A 5L95C 2ZVNA 1C4CA 1YJ1A 4F8CB 3K9PB 3BYYB 3ZVVA 3HVZA 4MACA 2LXCA 4ANWA 4DHZE 2KVZA 1HQRD 3MHZA 2WXRA 3AU4A 4K7UA 2K1FA 4PS8A 5IOIA 4F1SA 3T9LA 4ICVA 1IGCA 2XNAC 1VJKA 3A1QA 3PO0A 1WX8A 1YX6B 4LJOB 1DOXA 5C1ZA 1TGZB 3NVVA 3ZXRA 2PIAA 2Z59B 3BK1A 2GBRA 2RPQA 2JZ3B 3TEYA 2IO2B 4ZRPA 3Q8BA 4P1BC 3RNAC 3NS1A 3ABVB 1DGJA 1VD2A 1QKZA 1QZEA 1PGAA 1YQ3B 4OZCA 4PYZA 1JWBD 4MELA 2IGDA 1SGHA 4FLHA 2DYOA 3QCAA 2INNE 4LNIA 2JUOA 3RNEC 5AZHA 4YSZB 1T0QC 2KWVB 1JWMD 5D3IB 4XYCA 1S1QB 2MSED 3U2SC 1P3QU 2C7MB 3AEAB 1E8ZA 2AEHA 2J53A 4NPNA 4N9F4 4ZYSA 4RNAA 3E56A 2PJHA 1JW9D 2LGDA 2MBBB 2OJWA 2K9XA 2KLCA 2AQ1B 3UIOB 2WGSA 4XGAB 2E6XA 5LLIA 1YIWA 4JIOU 1WE7A 2D07B 3H8HA 4IW0A 1GB4A 3L13A 3P4SB 2SAKA 2WXIA 3VUWA 1XLNA 1Y8RC 2ZZPB 3RULA 2ICIA 4WJNA 5C23A 2K0PA 5JHAA 5BMHA 2WLBA 1ZKHA 4LNKA 2KMAA 4AP4C 1BUIC 3DVGY 2IGGA 4WJPA 4F7ZA 2O6VD 1Q1OA 4E71A 2XN9C 1RFKA 4WURA 2GRIA 3AE6B 3GOEA 4MM3A 3A4RA 1VZ7A 4LDTB 4LCDE 3WCQA 3PGEA 1NDDA 4E3CA 2UU7A 1VRAB 5AEKB 1TS3A 1UNSA 5D2MB 1WGGA 3L0WB 1B1ZA 1UGJA 1KOTA 4DDGD 1SE9A 4S0RA 1QQRA 3W9CB 2DZIA 5BMIA 1YQ4B 3AECB 3HM3A 2NS5A 5CHVC 3N9YC 4WAFA 2KWDA 3ENEA 3AE3B 2LUMA 3X0WA 1FCCC 3DBRB 3AM9A 2M19A 1C3TA 1SE2A 2I1KA 1FEHA 1ZE3D 2MW5A 1JRUA 1YNTE 4O1NA 1T0YA 3DOWA 2V4IB 5FK9C 3L54A 2ZNVB 2CHXA 1ZOYB 5HKHA 3DVNU 1MPEA 1TZOA 1EU3A 1R4MI 3T3NA 4GDKA 3PZ8A 1TS2A 2W3SA 4ASWC 3QARA 3AH7A 3U7ZA 1WZ0A 2KAJA 1F77A 4GGQA 2M17A 5EE1A 2INDC 2ON8A 2KHWB 2D5GA 2KDEB 2R61A 1GC6A 4KIKB 1MHXA 1Z2MA 2KTFA 2MBHA 3JW0X 2EKIA 4IOIE 3WIMA 1WH3A 4LJPB 2KFKB 3GZNB 3VUYA 3VDZA 2Q5WD 3PV1A 1IPGA 3RZFA 3NHEB 1V49A 2CHZA 3QA8A 1V80A 3D32A 5IO9A 3UGBB 4L1BA 1E0ZA 2INCC 3Q8FA 2ACZB 1L5PA 1TZ1A 3MC8A 3VR8B 2FCSA 2I2YA 2N9XA 1E7VA 4MH8A 1UD7A 4XWTA 4FBJB 5J2RA 1J19A 2KFJA 5AUIA 1WWTA 2QSDA 3V6EB 1NYRA 4C7YA 2MH7A 2PE9A 4KX6B 5FR6A 4W9CA 4KZCA 1WYWB 2BB5A 1OFFA 2MLBA 2KACA 4HROA 2MEKA 1J8CA 5E6JA 4QAYA 2M1MA 3MFGA 1WGYA 2NCNA 1XLOA 3O13A 1GG3A 1F2RC 2MP2A 4I6LB 3H7PA 2CS4A 1QOFA 2LRWA 3C19A 4FULA 3IAM1 4HKZE 5FR3A 2DX5B 1L0YB 3NS8A 4IKGA 2G1EA 2FNJB 3A9KB 5HFYA 4ZHPA 1ZGUB 3M63B 2M4NA 3N20C 4HPLB 4II3B 3ZRCA 2XK5B 2WXKA 2N7EA 4MEMA 1HZ5A 4YT0B 3CF6E 2I1JA 4BVUC 2MWSB 2LGXA 3ZO5B 2FIDA 2LD9A 3N1ZC 3HK0A 1NENB 1VZ8A 4CHKA 2L8JA 3ZNID 5IN7A 2YVCA 1NBFC 2SEBD 1VLBA 3MC9A 3P1MA 4ZDVA 2M0XA 2NPTB 2WQYB 2KT7A 1AN8A 1ZDXA 2W3RA 2KOXA 1UF0A 1XEEA 1TBEA 2ZW1A 3AE2B 3TEXA 4A3PA 4I6NB 4TQ0A 2LEKA 2GOWA 2LGYA 4B95A 1WX7A 3Q3NC 3DHIC 3TIXA 1M4VA 2RDHA 4BBNC 2QJLA 2JF5A 2CJOA 4S17A 2BKFA 2H88B 3PLUA 2GI9A 4AS1A 1KLUD 3QAQA 4JGHB 2JQRB 5CHFA 3AB5A 2WDQB 2AQ3B 1YOVB 3Q6BA 4XE0A 3RMKC 4GIVA 3P2BA 5IKCM 2EELA 1T6BX 1K51A 3WAOA 2KQ7A 2C5LC 2IZVB 2PVGC 1A70A 3PZ7A 2VZKB 4HCNB 2LVOA 1GPXA 4WJQA 3H1UA 1WM3A 5TR5A 2GBNA 2DHZA 3Q3MC 3R3MA 1P9DU 2L83A 1LO5D 1L0VB 3B0AA 1JQ4A 1C78A 3P4PB 3VVWB 1V8CA 1PDXA 3NJTA 1I4RA 4AWJA 3B1LX 2G4DB 4C4VA 3N30A 2O2VA 4P7IA 1HZ6A 2LJIA 4AJWA 1N5WA 5DPTA 2V0GA 4KZ0A 2LXAA 4AUQC 3FILB 3T3OA 3BVZA 3AULA 2FE8A 3OJ3A 1YN3A 2MJDA 3RFZB 4DHJD 1FIQA 4FHKA 5JXVA 1E7UA 1JMLA 4YTMB 1EWCA 5BO4B 5D7GA 2DZKA 1PGXA 2MBEA 3DHGC 2D3CA 4YWGG 1YJIA 3ZRFA 1RRBA 3VTWA 3ZJVA 1XT9B 1OGWA 4HDQA 1E90A 1UGMA 4BAXA 3B2FA 2LUEA 1EUVB 4KSLC 1F9JA 2C60A 1WRDB 4WJOA 3UQAA 2LVQA 1V5TA 2M8SA 3KUZA 3NZUA 3NY5A 3AE7B 3A1QB 4ZRKA 3Q2AC 5C2TB 3DVNV 2KK8A 4BZAA 1ZXIA 1GB1A 3W1SC 4EZLA 2D2QA 3PSEB 3I5JC 4MDKE 4KGSA 1FRRA 2RGFA 3KVFB 3V62A 2IBIB 1JWUD 3IVFA 4TQ1A 3BWUD 4BOSC 2WU2B 4KGRA 4ARIA 3JYUA 2L0TA 4RH6A 3VUXA 1TKGA 3PHXB 4FXCA 2ZW0A 3URYA 2KTRA 2GBMA 2IDYA 5H8YE 2JU6X 4ICUA 4PYUA 3VRBB 3BYTB 4BKGA 3ZJUA 2Z0EB 4A8XC 2MJEA 4RF1A 5G2NA 1I4QA 1WMHA 2KDMA 4RF0A 4USAA 3TEZA 1QOBA 1V1OA 2PLPA 1FRDA 2ZPYA 2PEAA 3IT4B 2BTEA 2BF8B 4DDID 3Q14C 1SXTA 1LQBA 4TSSA 5L83A 3NRZA 4GDLB 1MVKA 1GAQB 4HRSA 4RMAA 3W2DA 4NZLB 3NUHB 2N9KA 4RFBA 3KH0A 2DYBA 2N9LA 4OVUA 3DBLI 4HCPB 1WGDA 3AXCA 1IBXA 3NZSA 1RLFA 2KDFB 1K52A 1KTKA 2KJ6A 2WP9B 2BT6A 4LNFA 1N60A 3WALA 2KANA 4YSYB 1MFWA 4MM3B 4DK5A 3NG0A 1PFDA 5C3JB 4W9KA 1PYWD 2KDBA 1UWMA 2G9HD 3R7QA 2IO3B 1Q10A 4IM0A 3L10B 5DPWA 3T8MA 1SJHD 1HA5A 5E6PA 2ZEQA 3EC8A 3JSVA 1FO4A 2DAFA 1C4PA 3DDCB 3C0RB 2AL6A 3RNFC 1VCBA 3RNBC 3Q8AA 3GE3C 4YXDB 3HVDA 1WFYA 2OEDA 2RMMA 2BYVE 3TUOA 2UYZB 2WHIA 4A3OA 3W1YA 1YQBA 3ALBA 1YN5A 2K6DB 4C7ZA 5J18A 2WDRB 3PZDA 4B6WA 4ANUA 1L6VA 3W1SA 1WXMA 2ZNVC 1ISNA 4K3CA 1J0GA 1ET9A 2RSUA 1CQVA 1WJUA 1FNUA 1T0RC 1JRPA 1TT5B 4W9EA 1WGHA 1H8CA 3V05A 4KV2A 3RZWC 2JXXA 2MHJA 3PHWB 4GDKB 1Y56A 4ACFA 3OAWA 4KGTA 3AMZA 3UINB 4LTUA 3RD2A 1GOZA 4EE2A 2W55A 2Y5PA 3ZTDA 3AEEB 4MJSA 4DHZB 2KN4A 2C7HA 3PLVA 1PGBA 3DCGA 4FJVB 4G11A 1JALA 2D3AA 2NTSA 2RDGA 2R2QA 3AEBB 1WXAA 1SJED 4NQLB 4W9DA 3C8YA 3MC0B 1NEKB 5D6JB 4M0WA 2LMCA 2JYEA 2WXNA 3DQVA 4DQOC 2BYFA 2EKEC 2QEJC 3VR9B 2WXGA 1RFAA 1TIFA 2PKOA 3DBHB 2WS3B 2PE6B 2VH1A 1SE4A 4PK1A 3AE8B 3KYDD 2J4XA 3Q3FA 5T8IA 3EECA 3HUIA 3UIPB 1DOYA 2KWUB 2VH2A 4BKTA 5MPOA 4HJKA 1P7EA 2WXOA 5IAAC 1XCTL 4OZAA 4MGIE 1ZUD2 4TUUA 4M00A 4UDUC 2FUHB 2PTLA 2BWES 4FADA 4BKSA 3DWMA 3BK2A 3UI3A 2NBUA 2BBCA 2JZZA 1TYGB 3AV8A 2EMSA 4YTPB 1CMXB 4PT5A 3VXWA 1XLPA 2M0AA 2WXJA 4K3BA 2MP2B 1JROA 3H7PB 2MQJA 2VRRB 3KWVA 2IYDB 1SSNA 4NY0A 1C4AA 2ZVOA 2RPVA 3P42A 2QDFA 4M01A 1N6ZA 1I4XA 1E9MA 2QILA 1DYQA 4HJGE 2O6VB 4RGTA 4DWFA 4C80A 1F52A 2HE7A 1XF5L 3PS6A 3CSTA 1P1AA 3DVGX 2KO3A 4A9AA 1C9FA 1ET6A 2A4ZA 1V1PB 4EOYA 5LXIB 2PMVA 3R2TA 2M56B 4JPSA 1WE6A 4XDDA 2JPHA 4JWSC 3V60A 2G4SA 2LRUA 1KF6B 1YJJA 2V3PA 4OVZA 3RUIB 2JRHA 3B08A 3IHPC 3ZNGC 4OHJA 4WWOA 2KYWA 3BVMA 2ZCCA 3R7RA 2ZCBA 1N61A 2X38A 4NAMA 2HTHA 4TKNA 3BVGA 1BMLC 1FXIA 3RPFC 5D3DA 3EFCA 3FC4A 3L17A 1UBIA 4K7SA 5EE0A 2L7RA 4GB9A 2FBWB 2K6QA 2CJNA 4EKUA 3GE8C 4M02A 4H2AA 3TBLD 3X23A 1VZ6A 2KFKA 5LNK1 1LFDA 3N32A 1AWDA 1Q5WB 1PQSA 1P98A 3VFKA 3CSFA 4JWUC 1E5WA 3TJPA 3DBRI 1A5RA 1IUEA 1HTOA 3U52E 2KC2A 4W9IA 1E6EB 4GLSC 3JVZX 5BMGA 5DCNA 3QX1A 3QJZA 2RR9A 1KH0A 4N59A 4NAWB 2YEPB 1ZDVA 3BZDB 1D5XC 3SR6A 5E6OA 4J6IA 1HEZE 3OJ4B 1R4NB 2KMCA 3IAS1 3N1XC 1YX5B 1KJTA 3Q8CA 2W9NA 2N4FA 1V9JA 2Z0DB 4JE3B 3FKYA 5EDSA 3U7DA 2G45B 4KKIA 1SBBB 2X8XX 2BPSA 4NJ7A 4MH0E 1V97A 3I57A 2K22A 2IY0B 2WXLA 3QC8B 4LK0M 4OW0A 1WY8A 3TCAA 4C4VB 4WQOB 3GZNI 2IGHA 2O2VB 2J7QB 4LNNA 1QOGA 2K8BA 1E7PB 3KUDB 1J7CA 3IG3A 3BIID 3RI7C 1FFVA 1N5XA 2H89B 1WXVA 3ECIA 4XX5A 2XK5A 2HD5B 3ZNHB 3M3JA 3ZQ4A 1E8YA 2N0SB 4FHJA 1KFYB 2D10A 2LGSA 3M62B 4IWPA 3APDA 2AYOB 4LLGM 2V4LA 3VH4B 2IY1B 2L32A 4NNJB 1XLQA 2WXQA 4FJZA 2J0KA 3SFDB 3ZNZB 5CTRC 4BOZB 1C77A 3WAPA 3EA6A 2AL3A 1T5XD 3KYCD 4MSQB 1EF1A 2KNBA 4M8NA 4MT5A 3R8BA 3HM6X 4ANVA 1K50A 4KKJA 1NVID 3GP7A 1MG4A 2L0FA 2NMQA 3KLSX 4XZ4A 1F0ZA 5LXHA 5G5HA 1OTRB 3PT2B 1MI0A 3DHHC 1SIJA 1L0XB 5JHBA 4EUTA 2CKHB 2J0MA 3L08A 4HPPA 1SF0A 5GXGB 1XCQL 3A9JB 3KUCB 2Y3AA 2QHOA 4M8MA 1S3SG 1XD3B 2WWZA 5IP4D 1TJEA 2L05A 4DBGA 1KM7A 4PS3A 1WGRA 4WQMA 3WA0A 2GBKA 3M95A 1NYQA 4P1CC 2G3QB 5EE3A 2KTRB 3QQ8B 3SU8X 4A55A 1GC7A 4EEWA 1TKYA 1E8WA 1U4AA 1C79A 2JT4B 5G5GA 3QK0A 4XC2A 5H92C 1I4GA 3LXFA 5AUKA 1P7FA 2DWQA 4REZA 4G3XB 3MTNB 4D2KA 4IM3A 2PW9A 2LASA 3EHVA 1UWXA 1F1HA 3N1YC 2D3BA 3GB1A 4ZRQA 3IFWB 1EWYC 3LB8C 1C76A 2JWUA 3AE1B 5FKAC 1T3QA 2DBYA 2XBBC 3WAMA 3SDLC 1AYFA 4NJ6A 4ANXA 1MJDA 2AQ2B 1IBXB 5BYQA 4IWOA 1D6EC 2BS2B 4GN1A 2K3UA 1UBQA 1QILA 2LJ5A 2N7DA 5HG2A 2KD0A 3RYTA 2KJRA 2FUG1 3B9JA 2KQSA 1LGRA 4ITKA 4B0MA 4K7WA 4G0NB 1IP9A 3AN1A 2YEPF 2QCZA 3AE9B 2R2OA 3ZTCA 4LDTD 1GNUA 4BKSD 2BW2A 2BGFA 2L00B 2HJ1A 3MP9A 4OVVA 3JSVB 2J0JA 1I35A 4G50A 2WX0A 4HKQA 1L4DB 3U8ZA 4MSMB 2C9WB 2DNFA 3ML9A 4ARCA 3BINA 1FNVA 4EFOA 3IBEA 2KXJA 2D11A 3QHTA 4GXBA 2TSSA 1C1YB 3DPDA 2WYQA 4A20A 2Z8LA 3Q3OC 3HHMA 4JL9A 4HWIB 4XDCA 2BB6A 2MX2A 1X1MA 1OQRA 3ZW3A 4DHJB 3NVWA 2PVOD 2NVUI 2NBWB 1QT9A 4JX1C 2JVCA 4YTNB 4BFRA 1R4MB 3EFUA 3Q69A 4RGMA 2DLBA 2JYTA
chains in the Genus database with same CATH topology
3HK0A 4MGIE 4W9LA 3ZIMA 4TUUA 1WR1A 3APFA 4CHKA 2K8HA 3V61A 2KJHB 3VQIA 3PREA 5J17A 2FUHB 1WX9A 2L8JA 4KVGB 3ZNID 3ML8A 3ZKJC 1WMHB 2BWES 4FADA 4BKSA 2DENB 3K9OB 2YVCA 1NBFC 4ZRJA 4MGYE 2OJRA 2NBUA 4MJSB 4ZDVA 2M0XA 2KKCA 2NPTB 4RM8A 1R4NI 1WZ3A 1Z5SB 2Y5BB 2JZZA 3MHSD 2NR2A 5CHWA 5IA7A 2KOXA 5G55A 2EMSA 1CMXB 2FCNA 3VTVA 2KZRA 3VXWA 1YD8U 1TBEA 2KN5A 4FA6A 4GSWA 2MBOA 2MP2B 4A3PA 4I6NB 3RCZA 3H7PB 2MQJA 2VRRB 2ZPNA 5KHQA 4TQ0A 2IYDB 4NY0A 4KDIC 2GOWA 3TL5A 2ZVOA 2LGYA 4M0WB 4WWPA 4B95A 5KHOA 1WJ6A 1WX7A 4II2B 2PPHA 3TIXA 4BBNC 1EO6A 2JF5A 3UQBA 4GDLA 2BKFA 1XQQA 2WX1A 3TMPB 3H7SA 3PLUA 2LI5A 1V2YA 2O6VB 4JLCA 4DWFA 1V81A 4WAAA 1V5OA 5GMVA 2FCQA 2HE7A 4GU2A 2DYMA 3A9JA 3QAQA 1EF5A 1GUAB 4JGHB 2UWQA 1OEYJ 2RD0A 3AU5A 3PRZA 5DPSA 3PS6A 5CHFA 1WXSA 2ZJDA 3CSTA 4KSKC 1P1AA 3DVGX 1WIAA 2KO3A 4BBNF 2B3AA 1V6EA 2MBQA 1ZW7A 1KLVA 2CU1A 3KW5B 2A4ZA 1UZXB 1GJZA 2IO1B 4EOYA 4W9HA 3HIZA 5LXIB 1D3ZA 1G6JA 3ONSA 4W9GA 1WE6A 3L16A 1UELA 4W9FA 2JPHA 3LDZE 2LWPA 2LZ6A 4GIVA 4HK2A 3V60A 3P2BA 2G4SA 5L95C 2ZVNA 1YJ1A 1HE8A 2LRUA 1TTNA 4F8CB 3K9PB 3ZVVA 2LXCA 4ANWA 4DHZE 3RUIB 2JRHA 3B08A 3IHPC 2OOBB 1E8XA 3ZNGC 4WWOA 2BYEA 2LVPA 4CYEA 3WAOA 2KQ7A 2ZCCA 3AU4A 3R7RA 2C5LC 2IZVB 2ZCBA 2K1FA 4K7UA 4PS8A 3PPAA 4HCNB 2LVOA 4F1SA 2HTHA 4TKNA 4WJQA 3H1UA 1WM3A 2DZMA 4ICVA 3T9LA 5TR5A 2GBNA 2DHZA 3R3MA 3L17A 1P9DU 1UBIA 3B0AA 4K7SA 1I42A 3A1QA 1WX8A 2L7RA 1YX6B 2BWFA 4GB9A 4LJOB 3VVWB 2K6QA 5C1ZA 1TGZB 3ZLZA 4EKUA 2Z59B 2KX0A 3TBLD 3X23A 2CR5A 4AWJA 3B1LX 2G4DB 2GBRA 2KFKA 2RPQA 1LFDA 2JZ3B 2KLGA 3N32A 3N30A 2IO2B 1Q5WB 2AWTA 2O2VA 1FXTB 1PQSA 4P7IA 4AJWA 4I6PA 2MCNB 1P98A 3VFKA 5DPTA 1OEYA 4KZ0A 3CSFA 4ZRIA 2LXAA 1E5WA 3TJPA 4AUQC 1VD2A 3DBRI 1A5RA 1QZEA 3AULA 2KC2A 4W9IA 4PYZA 2NBVB 4WWNA 3OJ3A 4MELA 1SGHA 4FLHA 2DYOA 4HVBA 4DHJD 3QCAA 2JUOA 3VTUA 3JVZX 3PTFC 5AZHA 4TV3A 4FHKA 3QX1A 5DCNA 3QJZA 2KWVB 1UH6A 1E7UA 2RR9A 2GBJA 2C7NB 1NI2A 1S1QB 4DXAB 2MSED 5BO4B 5D7GA 1P3QU 2C7MB 2DZKA 4NAWB 3ZDMC 2MBEA 1E8ZA 2AEHA 4NPNA 5E6OA 4N9F4 3ZRFA 1RRBA 4J6IA 3SHQA 3OJ4B 2PJHA 3VTWA 2LGDA 4URKA 1XT9B 1OGWA 2KMCA 2MBBB 4HDQA 4PS7A 2KLCA 1E90A 1WJ4A 1UGMA 1KJTA 1YX5B 3UIOB 2W9NA 2N4FA 1V9JA 1EUVB 2LUEA 2Z0DB 3S2AA 4CO7A 4KSLC 2N1VA 1F9JA 2C60A 1WRDB 4WJOA 3UQAA 5LLIA 1YIWA 1BT0A 5EDSA 3U7DA 2LVQA 1V5TA 2G45B 1WF9A 2JRIB 4JIOU 4RM9A 2M8SA 3KUZA 3NZUA 3NY5A 2BPSA 2L3ZA 1WE7A 3A1QB 4IM2A 2D07B 4MH0E 4NJ7A 4ZRKA 3DVNV 2KK8A 3A33B 2JY6A 4W9JA 4IW0A 2KWCA 2IY0B 3W1SC 3QC8B 1WY8A 3TCAA 4MGZE 4EZLA 2D2QA 2KC1A 2WDTB 3L13A 3PRMB 3PSEB 4WQOB 3VUWA 3GZNI 1Y8RC 3RULA 2ZZPB 2O2VB 4MDKE 2J7QB 4WJNA 1AARA 5C23A 2RGFA 5JHAA 3KVFB 3V62A 2IBIB 3IVFA 1LXDA 2K8BA 1ZKHA 3VHTC 2KMAA 3KUDB 4AP4C 3N3KB 3H6NA 4TQ1A 3NOBA 3UF8A 3IG3A 3DVGY 4BOSC 4AOFA 4KDLB 4WJPA 2V1YA 4F7ZA 1WXVA 3ECIA 4IUMB 4XX5A 2O6VD 2XK5A 1Q1OA 2HD5B 3JYUA 2KVRA 2L0TA 3ZNHB 3LJ3A 4GMVA 3VUXA 3PHXB 3M3JA 4ZYNA 4E71A 1E8YA 3MJWA 3APCA 3GOEA 2N9EB 2ASQA 4FHJA 2D10A 4MM3A 2KTRA 3A4RA 5DPRA 3M62B 4LDTB 4LCDE 4IWPA 3PGEA 1NDDA 2GBMA 3APDA 4E3CA 5JH5C 2AYOB 4IC7B 2V4LA 3VH4B 2IY1B 4ICUA 4PYUA 4NNJB 4BKGA 5AEKB 4FJZA 1K8RB 2Z0EB 1OQYA 2J0KA 3ZNZB 5CTRC 5G2NA 4BOZB 3PRPB 5D2MB 2K8CA 3WAPA 3V6CB 1WMHA 1V86A 2AL3A 1WGGA 1H4RA 3L0WB 3KYCD 4MSQB 1KOTA 1EF1A 2KNBA 1SE9A 4M8NA 4DDGD 4KIKA 4IWQA 2ZPYA 3HM6X 4HDOA 2PEAA 4ANVA 2BF8B 2DZIA 1L7YA 3HM3A 4DDID 3PVLA 2NS5A 5CHVC 2L0FA 1LQBA 5L83A 3ZUNA 4XZ4A 4GDLB 2CHWA 4HXDA 3ENEA 4RMAA 3X0WA 5LXHA 1OTRB 3PT2B 2FIFA 5JHBA 2HJ8A 2CKHB 2J0MA 4EUTA 3KH0A 1C3TA 3L08A 3SD5A 2DYBA 2I1KA 4OVUA 1RAXA 1M94A 3DBLI 2MW5A 3A9JB 3KUCB 1JRUA 2QHOA 4M8MA 1T0YA 3DOWA 1P0RA 4HCPB 4B9KA 1WGDA 1S3SG 3AXCA 2MA9B 3DBHI 1XD3B 2WWZA 3L54A 2ZNVB 2L05A 4K1RB 2O6VA 1RLFA 1KM7A 3NZSA 4DBGA 4MGKE 2KDFB 2KJ6A 4PS3A 1WGRA 2IO0B 2CHXA 2N9PC 3WALA 2KANA 3WA0A 2GBKA 4FN2A 3M95A 5HKHA 3DVNU 5JZEB 2MRPA 2G3QB 4NQKE 2KTRB 3QQ8B 3SU8X 4DK5A 1IYFA 1GC7A 1R4MI 4JQWC 3ZDTA 4IG7B 4W9KA 4GDKA 2XEWA 2A5UA 2KDBA 4EEWA 3U30A 1E8WA 5AZGA 1U4AA 1L2NA 4ASWC 2JT4B 3QARA 3QK0A 4AJYB 4XC2A 3R7QA 1WZ0A 2IO3B 4GGQA 4IM0A 2M17A 3L10B 5DPWA 3T8MA 2KHWB 5E6PA 2JWZA 2KDEB 2ZEQA 3EC8A 3JSVA 4FJYA 1GC6A 4G3XB 3MTNB 4KIKB 4GOCA 1Z2MA 2DAFA 4IM3A 2KTFA 2MBHA 3DDCB 4YL8A 3C0RB 4X57B 3JW0X 2AL6A 3WIMA 1VCBA 1WH3A 2LASA 4LJPB 2KFKB 3VUYA 3EHVA 3VDZA 3PV1A 1IPGA 5D94A 1WFYA 3CMMB 2YLMA 3RZFA 3IFWB 2BYVE 3NHEB 1V49A 2UYZB 4A3OA 2CHZA 3W1YA 1YQBA 3ALBA 2DAJA 3QA8A 2N1WA 1V80A 3D32A 3A9KA 2K6DB 3UGBB 3VH3B 2XBBC 5J18A 3WAMA 3SDLC 4NJ6A 3PZDA 4B6WA 4ANUA 4ANXA 3W1SA 1MG8A 5AZFA 1WXMA 1TZ1A 2ZNVC 1ISNA 2FCSA 2FAZA 4IWOA 1J0GA 3QWZB 2RSUA 2N9XA 3I3TB 4GN1A 1UBQA 1E7VA 1UD7A 1WJUA 2D3GA 5E6NA 2LJ5A 4FBJB 5J2RA 1J19A 2K39A 4HPMB 2KFJA 2N7DA 2KD0A 3RYTA 2KJRA 4W9EA 3R66C 1WGHA 1H8CA 2KX3A 4EZKA 1SIFA 4KV2A 2V3SA 3RZWC 3V6EB 3H9DA 2PE9A 2JXXA 2KQSA 3PHWB 3Q3JA 4GDKB 4K7WA 5CX3A 5FR6A 3OAWA 4W9CA 4KZCA 4G0NB 1WYWB 1IP9A 2GMIC 2K25A 3QIJA 1WI0A 4NAWA 2R2OA 3UINB 3ZTCA 2MLBA 4LDTD 3RD2A 1GNUA 4BKSD 2BGFA 2L00B 1J8CA 4E74A 1WM2A 3ZTDA 4MJSA 2NPTA 1LM8B 2M1MA 4DHZB 2C7HA 4K81A 1WGYA 4OVVA 1WR6E 3JSVB 2J0JA 2NCNA 3PLVA 1I35A 4G50A 2WX0A 3DCGA 3U8ZA 4FJVB 4G11A 2C9WB 4MSMB 1GG3A 3ML9A 2EMTA 3WANA 3BINA 2R2QA 2L76A 2FCMA 4EFOA 2MP2A 3IBEA 4I6LB 1WXAA 3H7PA 2CS4A 2LRWA 2KXJA 4NQLB 2D11A 3QHTA 4GXBA 2KDIA 4W9DA 1C1YB 3DPDA 4FULA 2WYQA 2DZJA 4A20A 5D6JB 3HHMA 2DX5B 3NS8A 4JL9A 2BKRB 4HWIB 2FNJB 3DQVA 3DBSA 2BYFA 2EKEC 3A9KB 3RT3B 1ZGUB 1RFAA 3BY4B 3M63B 2MX2A 1X1MA 2PE6B 2M4NA 3A4SC 3ZW3A 3VAWA 4DHJB 4HPLB 3OLMD 4II3B 2NVUI 2NBWB 2XK5B 3ZRCA 3AI5A 2N7EA 3KYDD 4MEMA 4HLEA 3Q3FA 1Q0WB 3EECA 3UIPB 4EZJA 2KWUB 4BKTA 3CF6E 2I1JA 2JVCA 3O65B 4BVUC 4BFRA 2MWSB 4HJKA 2LGXA 2REXA 3EFUA 3ZO5B 5IAAC 2FIDA 2LD9A 1WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK0 A;  4MGI E;  4W9L A;  3ZIM A;  4TUU A;  1WR1 A;  3APF A;  4CHK A;  2K8H A;  3V61 A;  2KJH B;  3VQI A;  3PRE A;  5J17 A;  2FUH B;  1WX9 A;  2L8J A;  4KVG B;  3ZNI D;  3ML8 A;  3ZKJ C;  1WMH B;  2BWE S;  4FAD A;  4BKS A;  2DEN B;  3K9O B;  2YVC A;  1NBF C;  4ZRJ A;  4MGY E;  2OJR A;  2NBU A;  4MJS B;  4ZDV A;  2M0X A;  2KKC A;  2NPT B;  4RM8 A;  1R4N I;  1WZ3 A;  1Z5S B;  2Y5B B;  2JZZ A;  3MHS D;  2NR2 A;  5CHW A;  5IA7 A;  2KOX A;  5G55 A;  2EMS A;  1CMX B;  2FCN A;  3VTV A;  2KZR A;  3VXW A;  1YD8 U;  1TBE A;  2KN5 A;  4FA6 A;  4GSW A;  2MBO A;  2MP2 B;  4A3P A;  4I6N B;  3RCZ A;  3H7P B;  2MQJ A;  2VRR B;  2ZPN A;  5KHQ A;  4TQ0 A;  2IYD B;  4NY0 A;  4KDI C;  2GOW A;  3TL5 A;  2ZVO A;  2LGY A;  4M0W B;  4WWP A;  4B95 A;  5KHO A;  1WJ6 A;  1WX7 A;  4II2 B;  2PPH A;  3TIX A;  4BBN C;  1EO6 A;  2JF5 A;  3UQB A;  4GDL A;  2BKF A;  1XQQ A;  2WX1 A;  3TMP B;  3H7S A;  3PLU A;  2LI5 A;  1V2Y A;  2O6V B;  4JLC A;  4DWF A;  1V81 A;  4WAA A;  1V5O A;  5GMV A;  2FCQ A;  2HE7 A;  4GU2 A;  2DYM A;  3A9J A;  3QAQ A;  1EF5 A;  1GUA B;  4JGH B;  2UWQ A;  1OEY J;  2RD0 A;  3AU5 A;  3PRZ A;  5DPS A;  3PS6 A;  5CHF A;  1WXS A;  2ZJD A;  3CST A;  4KSK C;  1P1A A;  3DVG X;  1WIA A;  2KO3 A;  4BBN F;  2B3A A;  1V6E A;  2MBQ A;  1ZW7 A;  1KLV A;  2CU1 A;  3KW5 B;  2A4Z A;  1UZX B;  1GJZ A;  2IO1 B;  4EOY A;  4W9H A;  3HIZ A;  5LXI B;  1D3Z A;  1G6J A;  3ONS A;  4W9G A;  1WE6 A;  3L16 A;  1UEL A;  4W9F A;  2JPH A;  3LDZ E;  2LWP A;  2LZ6 A;  4GIV A;  4HK2 A;  3V60 A;  3P2B A;  2G4S A;  5L95 C;  2ZVN A;  1YJ1 A;  1HE8 A;  2LRU A;  1TTN A;  4F8C B;  3K9P B;  3ZVV A;  2LXC A;  4ANW A;  4DHZ E;  3RUI B;  2JRH A;  3B08 A;  3IHP C;  2OOB B;  1E8X A;  3ZNG C;  4WWO A;  2BYE A;  2LVP A;  4CYE A;  3WAO A;  2KQ7 A;  2ZCC A;  3AU4 A;  3R7R A;  2C5L C;  2IZV B;  2ZCB A;  2K1F A;  4K7U A;  4PS8 A;  3PPA A;  4HCN B;  2LVO A;  4F1S A;  2HTH A;  4TKN A;  4WJQ A;  3H1U A;  1WM3 A;  2DZM A;  4ICV A;  3T9L A;  5TR5 A;  2GBN A;  2DHZ A;  3R3M A;  3L17 A;  1P9D U;  1UBI A;  3B0A A;  4K7S A;  1I42 A;  3A1Q A;  1WX8 A;  2L7R A;  1YX6 B;  2BWF A;  4GB9 A;  4LJO B;  3VVW B;  2K6Q A;  5C1Z A;  1TGZ B;  3ZLZ A;  4EKU A;  2Z59 B;  2KX0 A;  3TBL D;  3X23 A;  2CR5 A;  4AWJ A;  3B1L X;  2G4D B;  2GBR A;  2KFK A;  2RPQ A;  1LFD A;  2JZ3 B;  2KLG A;  3N32 A;  3N30 A;  2IO2 B;  1Q5W B;  2AWT A;  2O2V A;  1FXT B;  1PQS A;  4P7I A;  4AJW A;  4I6P A;  2MCN B;  1P98 A;  3VFK A;  5DPT A;  1OEY A;  4KZ0 A;  3CSF A;  4ZRI A;  2LXA A;  1E5W A;  3TJP A;  4AUQ C;  1VD2 A;  3DBR I;  1A5R A;  1QZE A;  3AUL A;  2KC2 A;  4W9I A;  4PYZ A;  2NBV B;  4WWN A;  3OJ3 A;  4MEL A;  1SGH A;  4FLH A;  2DYO A;  4HVB A;  4DHJ D;  3QCA A;  2JUO A;  3VTU A;  3JVZ X;  3PTF C;  5AZH A;  4TV3 A;  4FHK A;  3QX1 A;  5DCN A;  3QJZ A;  2KWV B;  1UH6 A;  1E7U A;  2RR9 A;  2GBJ A;  2C7N B;  1NI2 A;  1S1Q B;  4DXA B;  2MSE D;  5BO4 B;  5D7G A;  1P3Q U;  2C7M B;  2DZK A;  4NAW B;  3ZDM C;  2MBE A;  1E8Z A;  2AEH A;  4NPN A;  5E6O A;  4N9F 4;  3ZRF A;  1RRB A;  4J6I A;  3SHQ A;  3OJ4 B;  2PJH A;  3VTW A;  2LGD A;  4URK A;  1XT9 B;  1OGW A;  2KMC A;  2MBB B;  4HDQ A;  4PS7 A;  2KLC A;  1E90 A;  1WJ4 A;  1UGM A;  1KJT A;  1YX5 B;  3UIO B;  2W9N A;  2N4F A;  1V9J A;  1EUV B;  2LUE A;  2Z0D B;  3S2A A;  4CO7 A;  4KSL C;  2N1V A;  1F9J A;  2C60 A;  1WRD B;  4WJO A;  3UQA A;  5LLI A;  1YIW A;  1BT0 A;  5EDS A;  3U7D A;  2LVQ A;  1V5T A;  2G45 B;  1WF9 A;  2JRI B;  4JIO U;  4RM9 A;  2M8S A;  3KUZ A;  3NZU A;  3NY5 A;  2BPS A;  2L3Z A;  1WE7 A;  3A1Q B;  4IM2 A;  2D07 B;  4MH0 E;  4NJ7 A;  4ZRK A;  3DVN V;  2KK8 A;  3A33 B;  2JY6 A;  4W9J A;  4IW0 A;  2KWC A;  2IY0 B;  3W1S C;  3QC8 B;  1WY8 A;  3TCA A;  4MGZ E;  4EZL A;  2D2Q A;  2KC1 A;  2WDT B;  3L13 A;  3PRM B;  3PSE B;  4WQO B;  3VUW A;  3GZN I;  1Y8R C;  3RUL A;  2ZZP B;  2O2V B;  4MDK E;  2J7Q B;  4WJN A;  1AAR A;  5C23 A;  2RGF A;  5JHA A;  3KVF B;  3V62 A;  2IBI B;  3IVF A;  1LXD A;  2K8B A;  1ZKH A;  3VHT C;  2KMA A;  3KUD B;  4AP4 C;  3N3K B;  3H6N A;  4TQ1 A;  3NOB A;  3UF8 A;  3IG3 A;  3DVG Y;  4BOS C;  4AOF A;  4KDL B;  4WJP A;  2V1Y A;  4F7Z A;  1WXV A;  3ECI A;  4IUM B;  4XX5 A;  2O6V D;  2XK5 A;  1Q1O A;  2HD5 B;  3JYU A;  2KVR A;  2L0T A;  3ZNH B;  3LJ3 A;  4GMV A;  3VUX A;  3PHX B;  3M3J A;  4ZYN A;  4E71 A;  1E8Y A;  3MJW A;  3APC A;  3GOE A;  2N9E B;  2ASQ A;  4FHJ A;  2D10 A;  4MM3 A;  2KTR A;  3A4R A;  5DPR A;  3M62 B;  4LDT B;  4LCD E;  4IWP A;  3PGE A;  1NDD A;  2GBM A;  3APD A;  4E3C A;  5JH5 C;  2AYO B;  4IC7 B;  2V4L A;  3VH4 B;  2IY1 B;  4ICU A;  4PYU A;  4NNJ B;  4BKG A;  5AEK B;  4FJZ A;  1K8R B;  2Z0E B;  1OQY A;  2J0K A;  3ZNZ B;  5CTR C;  5G2N A;  4BOZ B;  3PRP B;  5D2M B;  2K8C A;  3WAP A;  3V6C B;  1WMH A;  1V86 A;  2AL3 A;  1WGG A;  1H4R A;  3L0W B;  3KYC D;  4MSQ B;  1KOT A;  1EF1 A;  2KNB A;  1SE9 A;  4M8N A;  4DDG D;  4KIK A;  4IWQ A;  2ZPY A;  3HM6 X;  4HDO A;  2PEA A;  4ANV A;  2BF8 B;  2DZI A;  1L7Y A;  3HM3 A;  4DDI D;  3PVL A;  2NS5 A;  5CHV C;  2L0F A;  1LQB A;  5L83 A;  3ZUN A;  4XZ4 A;  4GDL B;  2CHW A;  4HXD A;  3ENE A;  4RMA A;  3X0W A;  5LXH A;  1OTR B;  3PT2 B;  2FIF A;  5JHB A;  2HJ8 A;  2CKH B;  2J0M A;  4EUT A;  3KH0 A;  1C3T A;  3L08 A;  3SD5 A;  2DYB A;  2I1K A;  4OVU A;  1RAX A;  1M94 A;  3DBL I;  2MW5 A;  3A9J B;  3KUC B;  1JRU A;  2QHO A;  4M8M A;  1T0Y A;  3DOW A;  1P0R A;  4HCP B;  4B9K A;  1WGD A;  1S3S G;  3AXC A;  2MA9 B;  3DBH I;  1XD3 B;  2WWZ A;  3L54 A;  2ZNV B;  2L05 A;  4K1R B;  2O6V A;  1RLF A;  1KM7 A;  3NZS A;  4DBG A;  4MGK E;  2KDF B;  2KJ6 A;  4PS3 A;  1WGR A;  2IO0 B;  2CHX A;  2N9P C;  3WAL A;  2KAN A;  3WA0 A;  2GBK A;  4FN2 A;  3M95 A;  5HKH A;  3DVN U;  5JZE B;  2MRP A;  2G3Q B;  4NQK E;  2KTR B;  3QQ8 B;  3SU8 X;  4DK5 A;  1IYF A;  1GC7 A;  1R4M I;  4JQW C;  3ZDT A;  4IG7 B;  4W9K A;  4GDK A;  2XEW A;  2A5U A;  2KDB A;  4EEW A;  3U30 A;  1E8W A;  5AZG A;  1U4A A;  1L2N A;  4ASW C;  2JT4 B;  3QAR A;  3QK0 A;  4AJY B;  4XC2 A;  3R7Q A;  1WZ0 A;  2IO3 B;  4GGQ A;  4IM0 A;  2M17 A;  3L10 B;  5DPW A;  3T8M A;  2KHW B;  5E6P A;  2JWZ A;  2KDE B;  2ZEQ A;  3EC8 A;  3JSV A;  4FJY A;  1GC6 A;  4G3X B;  3MTN B;  4KIK B;  4GOC A;  1Z2M A;  2DAF A;  4IM3 A;  2KTF A;  2MBH A;  3DDC B;  4YL8 A;  3C0R B;  4X57 B;  3JW0 X;  2AL6 A;  3WIM A;  1VCB A;  1WH3 A;  2LAS A;  4LJP B;  2KFK B;  3VUY A;  3EHV A;  3VDZ A;  3PV1 A;  1IPG A;  5D94 A;  1WFY A;  3CMM B;  2YLM A;  3RZF A;  3IFW B;  2BYV E;  3NHE B;  1V49 A;  2UYZ B;  4A3O A;  2CHZ A;  3W1Y A;  1YQB A;  3ALB A;  2DAJ A;  3QA8 A;  2N1W A;  1V80 A;  3D32 A;  3A9K A;  2K6D B;  3UGB B;  3VH3 B;  2XBB C;  5J18 A;  3WAM A;  3SDL C;  4NJ6 A;  3PZD A;  4B6W A;  4ANU A;  4ANX A;  3W1S A;  1MG8 A;  5AZF A;  1WXM A;  1TZ1 A;  2ZNV C;  1ISN A;  2FCS A;  2FAZ A;  4IWO A;  1J0G A;  3QWZ B;  2RSU A;  2N9X A;  3I3T B;  4GN1 A;  1UBQ A;  1E7V A;  1UD7 A;  1WJU A;  2D3G A;  5E6N A;  2LJ5 A;  4FBJ B;  5J2R A;  1J19 A;  2K39 A;  4HPM B;  2KFJ A;  2N7D A;  2KD0 A;  3RYT A;  2KJR A;  4W9E A;  3R66 C;  1WGH A;  1H8C A;  2KX3 A;  4EZK A;  1SIF A;  4KV2 A;  2V3S A;  3RZW C;  3V6E B;  3H9D A;  2PE9 A;  2JXX A;  2KQS A;  3PHW B;  3Q3J A;  4GDK B;  4K7W A;  5CX3 A;  5FR6 A;  3OAW A;  4W9C A;  4KZC A;  4G0N B;  1WYW B;  1IP9 A;  2GMI C;  2K25 A;  3QIJ A;  1WI0 A;  4NAW A;  2R2O A;  3UIN B;  3ZTC A;  2MLB A;  4LDT D;  3RD2 A;  1GNU A;  4BKS D;  2BGF A;  2L00 B;  1J8C A;  4E74 A;  1WM2 A;  3ZTD A;  4MJS A;  2NPT A;  1LM8 B;  2M1M A;  4DHZ B;  2C7H A;  4K81 A;  1WGY A;  4OVV A;  1WR6 E;  3JSV B;  2J0J A;  2NCN A;  3PLV A;  1I35 A;  4G50 A;  2WX0 A;  3DCG A;  3U8Z A;  4FJV B;  4G11 A;  2C9W B;  4MSM B;  1GG3 A;  3ML9 A;  2EMT A;  3WAN A;  3BIN A;  2R2Q A;  2L76 A;  2FCM A;  4EFO A;  2MP2 A;  3IBE A;  4I6L B;  1WXA A;  3H7P A;  2CS4 A;  2LRW A;  2KXJ A;  4NQL B;  2D11 A;  3QHT A;  4GXB A;  2KDI A;  4W9D A;  1C1Y B;  3DPD A;  4FUL A;  2WYQ A;  2DZJ A;  4A20 A;  5D6J B;  3HHM A;  2DX5 B;  3NS8 A;  4JL9 A;  2BKR B;  4HWI B;  2FNJ B;  3DQV A;  3DBS A;  2BYF A;  2EKE C;  3A9K B;  3RT3 B;  1ZGU B;  1RFA A;  3BY4 B;  3M63 B;  2MX2 A;  1X1M A;  2PE6 B;  2M4N A;  3A4S C;  3ZW3 A;  3VAW A;  4DHJ B;  4HPL B;  3OLM D;  4II3 B;  2NVU I;  2NBW B;  2XK5 B;  3ZRC A;  3AI5 A;  2N7E A;  3KYD D;  4MEM A;  4HLE A;  3Q3F A;  1Q0W B;  3EEC A;  3UIP B;  4EZJ A;  2KWU B;  4BKT A;  3CF6 E;  2I1J A;  2JVC A;  3O65 B;  4BVU C;  4BFR A;  2MWS B;  4HJK A;  2LGX A;  2REX A;  3EFU A;  3ZO5 B;  5IAA C;  2FID A;  2LD9 A;  1WJN A; 
#chains in the Genus database with same CATH topology
 4W9L A;  1WR1 A;  1TS4 A;  3PRE A;  1WX9 A;  2DEN B;  3K9O B;  3I63 C;  4ZRJ A;  3RN9 C;  4MJS B;  2KKC A;  4RM8 A;  1WRI A;  3MHS D;  2NR2 A;  1ZP0 B;  5G55 A;  1MHH E;  2KZR A;  2QIE B;  4J3O D;  1YD8 U;  4NJC A;  4ZOH C;  4GSW A;  3RCZ A;  2ZPN A;  4KDI C;  4N6E B;  1CZP A;  4M0W B;  1WJ6 A;  1FFU A;  3E9S A;  2PPH A;  1JWA D;  3SFE B;  1EO6 A;  1KLG D;  4GDL A;  1FXA A;  1XQQ A;  2WX1 A;  4RGN A;  2LI5 A;  3TSS A;  2NTT A;  4JLC A;  2N7J A;  1V5O A;  5GMV A;  2FCQ A;  4GU2 A;  2DYM A;  1EF5 A;  1GUA B;  2L1A A;  2UWQ A;  1OEY J;  2RD0 A;  3PRZ A;  4KSK C;  1ROE A;  1WIA A;  4BBN F;  2MBQ A;  2IO1 B;  4W9H A;  1K53 A;  4W9F A;  3LDZ E;  2LWP A;  1T0S C;  4HK2 A;  2OHF A;  1HE8 A;  1TTN A;  2OOB B;  1E8X A;  2BYE A;  2LVP A;  4CYE A;  4AQ7 A;  1FMA D;  3PPA A;  4IDI A;  4CQN A;  2DZM A;  3V3X A;  3Q8E A;  5I4D A;  1I42 A;  1EU4 A;  2BWF A;  5TSS A;  3ZLZ A;  3AEF B;  4DXG A;  2KX0 A;  3NVY A;  2CR5 A;  2INP E;  2V9H A;  1QF6 A;  2KLG A;  2AWT A;  3KWL A;  1FXT B;  4I6P A;  2MCN B;  1OEY A;  4ZRI A;  3GS2 A;  2WXP A;  4R3D A;  2L52 A;  3AED B;  3ETR A;  3FAH A;  4P6V F;  4WWN A;  2NBV B;  4HVB A;  3VTU A;  3PTF C;  3B2G A;  4TV3 A;  1UH6 A;  1CJE A;  2GBJ A;  2C7N B;  2ONQ A;  1NI2 A;  3MJ5 A;  4US9 A;  4XWW A;  4DXA B;  3ZDM C;  3ZGZ A;  4ZHO A;  3SHQ A;  4URK A;  1RYJ A;  4PS7 A;  1WJ4 A;  2WNM A;  4N58 A;  3S2A A;  4CO7 A;  2N1V A;  1BT0 A;  1KRH A;  2JXT A;  4WH4 A;  2WXM A;  1WF9 A;  2JRI B;  4RM9 A;  3P4R B;  2L3Z A;  4IM2 A;  3A33 B;  2JY6 A;  4W9J A;  5HHD G;  1PUT A;  2KWC A;  2BQQ A;  3U4E G;  4MGZ E;  1L4Z B;  2KC1 A;  2WDT B;  3PRM B;  2WDV B;  1AAR A;  1QOA A;  1LXD A;  3VHT C;  5HI1 A;  3N3K B;  3H6N A;  3UF8 A;  3NOB A;  1J7A A;  4AOF A;  4KDL B;  2V1Y A;  4IUM B;  1HXY D;  2KVR A;  3LJ3 A;  4GMV A;  1ZXH A;  4ZYN A;  4YSX B;  3MJW A;  2BVC A;  3APC A;  3DWG C;  4B0E A;  2N9E B;  2ASQ A;  3L4P A;  5DPR A;  1ESF A;  5JH5 C;  4IC7 B;  2MJ3 A;  5BYR A;  1K8R B;  4RCO A;  1OQY A;  2V3N A;  3PRP B;  2K8C A;  3V6C B;  1V86 A;  1H4R A;  4C00 A;  3ZYY X;  4KIK A;  4IWQ A;  4HDO A;  3LYY A;  3P63 A;  4HEA 1;  3IXS A;  1N63 A;  1L7Y A;  2IJ0 A;  2VZK D;  3PVL A;  3ZUN A;  2CHW A;  4HXD A;  2I38 A;  4TMA B;  2B76 B;  2FIF A;  2HJ8 A;  3SD5 A;  1TY2 A;  1RAX A;  1M94 A;  1P0R A;  4B9K A;  4P16 A;  2MA9 B;  3DBH I;  1R7S A;  1DOI A;  2LHE A;  3J9C A;  4L2Y A;  4K1R B;  2O6V A;  4MGK E;  2IO0 B;  3NVZ A;  2N9P C;  1WYG A;  1FNW A;  2BS4 B;  4FN2 A;  5JZE B;  2MRP A;  4NQK E;  1IYF A;  2Y5C A;  4JQW C;  3ZDT A;  4IG7 B;  2XEW A;  2A5U A;  3U30 A;  1V1P A;  2GB1 A;  4RGO S;  5AZG A;  1L2N A;  1EM7 A;  1XO3 A;  4AJY B;  2LHD A;  2BS3 B;  3W5V B;  2K5P A;  2JSV X;  2JWZ A;  3AEG B;  4FJY A;  3ZJT A;  4GOC A;  4A90 A;  4YL8 A;  3TEW A;  4X57 B;  4A6Q A;  1YMH E;  5D94 A;  3NZ3 A;  3CMM B;  2YLM A;  1QLB B;  4OZB A;  2DAJ A;  2N1W A;  3A9K A;  3VH3 B;  4L23 A;  1MG8 A;  2E3T A;  5AZF A;  3KQ4 A;  1I7H A;  2FAZ A;  3QWZ B;  3W5U B;  1SE3 A;  3I3T B;  3R2I A;  2D3G A;  5E6N A;  2KQ4 X;  2HTM E;  1I4P A;  2K39 A;  4HPM B;  3R66 C;  1ACC A;  2KX3 A;  4EZK A;  1SIF A;  2V3S A;  3OWE B;  3H9D A;  1TKE A;  3Q3J A;  5CX3 A;  2RDB C;  2GMI C;  2K25 A;  3QIJ A;  1WI0 A;  4NAW A;  2QMT A;  4C56 C;  3CIR B;  1B9R A;  4E74 A;  1WM2 A;  1WGK A;  1N62 A;  1VDV A;  2NPT A;  1ZPS A;  1LM8 B;  3VRA B;  2HDE A;  2LFI A;  4K81 A;  1WR6 E;  2EMT A;  3WAN A;  1JWS D;  1ENF A;  1WSP A;  2L76 A;  2FCM A;  5EE9 A;  2KDI A;  2DZJ A;  2J42 A;  3SEB A;  1BXT A;  3DBL B;  2BKR B;  1AW7 A;  3DBS A;  3RT3 B;  1FPY A;  3BY4 B;  1D4B A;  3RNC C;  1E10 A;  2W82 A;  1NI3 A;  3A4S C;  3VAW A;  3OLM D;  1D5M C;  3P4Q B;  3AI5 A;  1VR9 A;  2BYT A;  4DXF A;  4HLE A;  1Q0W B;  4EZJ A;  1RM6 C;  3HRD D;  3AE5 B;  2JZP A;  3AE4 B;  2W54 A;  3O65 B;  2AX5 A;  4Q2J A;  2REX A;  4WIP A;  1FCL A;  1SEB D;  2J52 A;  2K8H A;  1WJN A;  1RWS A;  3ZIM A;  3APF A;  3V61 A;  2KJH B;  3VQI A;  5J17 A;  1XXG A;  1IGD A;  4KVG B;  3ML8 A;  3ZKJ C;  1WMH B;  2GLS A;  1YN4 A;  4MGY E;  2OJR A;  3EGR A;  1L6U A;  2WU5 B;  1R4N I;  1WZ3 A;  1Z5S B;  2Y5B B;  2WXH A;  2WXF A;  5CHW A;  5IA7 A;  3OG5 A;  1STE A;  2FCN A;  1SB3 C;  3VTV A;  1D5Z C;  4US8 A;  1TS5 A;  2QC8 A;  1OQQ A;  2KN5 A;  1UUP A;  4FA6 A;  2MBO A;  2JX5 A;  5KHQ A;  1CK1 A;  5BYS A;  3IT6 B;  3CWI A;  4LNO A;  3TL5 A;  2CU3 A;  4WWP A;  1J7B A;  5KHO A;  2IPK D;  4II2 B;  1HTQ A;  1FD6 A;  3ZXV A;  1JCK B;  3UQB A;  3TMP B;  3H7S A;  1V2Y A;  1F2R I;  3FIL A;  1V81 A;  4WAA A;  1TY0 A;  3A9J A;  3AU5 A;  1I4H A;  5DPS A;  1WXS A;  2ZJD A;  2KMM A;  1FM0 D;  2B3A A;  1V6E A;  3RNG C;  1KLV A;  1ZW7 A;  2CU1 A;  3KW5 B;  1UZX B;  1GJZ A;  1WXQ A;  1G6J A;  3HIZ A;  2LGI A;  3I9V 1;  1D3Z A;  3ONS A;  4W9G A;  3EUB 2;  3L16 A;  1UEL A;  4WWM A;  2LZ6 A;  5L95 C;  2ZVN A;  1C4C A;  1YJ1 A;  4F8C B;  3K9P B;  3BYY B;  3ZVV A;  3HVZ A;  4MAC A;  2LXC A;  4ANW A;  4DHZ E;  2KVZ A;  1HQR D;  3MHZ A;  2WXR A;  3AU4 A;  4K7U A;  2K1F A;  4PS8 A;  5IOI A;  4F1S A;  3T9L A;  4ICV A;  1IGC A;  2XNA C;  1VJK A;  3A1Q A;  3PO0 A;  1WX8 A;  1YX6 B;  4LJO B;  1DOX A;  5C1Z A;  1TGZ B;  3NVV A;  3ZXR A;  2PIA A;  2Z59 B;  3BK1 A;  2GBR A;  2RPQ A;  2JZ3 B;  3TEY A;  2IO2 B;  4ZRP A;  3Q8B A;  4P1B C;  3RNA C;  3NS1 A;  3ABV B;  1DGJ A;  1VD2 A;  1QKZ A;  1QZE A;  1PGA A;  1YQ3 B;  4OZC A;  4PYZ A;  1JWB D;  4MEL A;  2IGD A;  1SGH A;  4FLH A;  2DYO A;  3QCA A;  2INN E;  4LNI A;  2JUO A;  3RNE C;  5AZH A;  4YSZ B;  1T0Q C;  2KWV B;  1JWM D;  5D3I B;  4XYC A;  1S1Q B;  2MSE D;  3U2S C;  1P3Q U;  2C7M B;  3AEA B;  1E8Z A;  2AEH A;  2J53 A;  4NPN A;  4N9F 4;  4ZYS A;  4RNA A;  3E56 A;  2PJH A;  1JW9 D;  2LGD A;  2MBB B;  2OJW A;  2K9X A;  2KLC A;  2AQ1 B;  3UIO B;  2WGS A;  4XGA B;  2E6X A;  5LLI A;  1YIW A;  4JIO U;  1WE7 A;  2D07 B;  3H8H A;  4IW0 A;  1GB4 A;  3L13 A;  3P4S B;  2SAK A;  2WXI A;  3VUW A;  1XLN A;  1Y8R C;  2ZZP B;  3RUL A;  2ICI A;  4WJN A;  5C23 A;  2K0P A;  5JHA A;  5BMH A;  2WLB A;  1ZKH A;  4LNK A;  2KMA A;  4AP4 C;  1BUI C;  3DVG Y;  2IGG A;  4WJP A;  4F7Z A;  2O6V D;  1Q1O A;  4E71 A;  2XN9 C;  1RFK A;  4WUR A;  2GRI A;  3AE6 B;  3GOE A;  4MM3 A;  3A4R A;  1VZ7 A;  4LDT B;  4LCD E;  3WCQ A;  3PGE A;  1NDD A;  4E3C A;  2UU7 A;  1VRA B;  5AEK B;  1TS3 A;  1UNS A;  5D2M B;  1WGG A;  3L0W B;  1B1Z A;  1UGJ A;  1KOT A;  4DDG D;  1SE9 A;  4S0R A;  1QQR A;  3W9C B;  2DZI A;  5BMI A;  1YQ4 B;  3AEC B;  3HM3 A;  2NS5 A;  5CHV C;  3N9Y C;  4WAF A;  2KWD A;  3ENE A;  3AE3 B;  2LUM A;  3X0W A;  1FCC C;  3DBR B;  3AM9 A;  2M19 A;  1C3T A;  1SE2 A;  2I1K A;  1FEH A;  1ZE3 D;  2MW5 A;  1JRU A;  1YNT E;  4O1N A;  1T0Y A;  3DOW A;  2V4I B;  5FK9 C;  3L54 A;  2ZNV B;  2CHX A;  1ZOY B;  5HKH A;  3DVN U;  1MPE A;  1TZO A;  1EU3 A;  1R4M I;  3T3N A;  4GDK A;  3PZ8 A;  1TS2 A;  2W3S A;  4ASW C;  3QAR A;  3AH7 A;  3U7Z A;  1WZ0 A;  2KAJ A;  1F77 A;  4GGQ A;  2M17 A;  5EE1 A;  2IND C;  2ON8 A;  2KHW B;  2D5G A;  2KDE B;  2R61 A;  1GC6 A;  4KIK B;  1MHX A;  1Z2M A;  2KTF A;  2MBH A;  3JW0 X;  2EKI A;  4IOI E;  3WIM A;  1WH3 A;  4LJP B;  2KFK B;  3GZN B;  3VUY A;  3VDZ A;  2Q5W D;  3PV1 A;  1IPG A;  3RZF A;  3NHE B;  1V49 A;  2CHZ A;  3QA8 A;  1V80 A;  3D32 A;  5IO9 A;  3UGB B;  4L1B A;  1E0Z A;  2INC C;  3Q8F A;  2ACZ B;  1L5P A;  1TZ1 A;  3MC8 A;  3VR8 B;  2FCS A;  2I2Y A;  2N9X A;  1E7V A;  4MH8 A;  1UD7 A;  4XWT A;  4FBJ B;  5J2R A;  1J19 A;  2KFJ A;  5AUI A;  1WWT A;  2QSD A;  3V6E B;  1NYR A;  4C7Y A;  2MH7 A;  2PE9 A;  4KX6 B;  5FR6 A;  4W9C A;  4KZC A;  1WYW B;  2BB5 A;  1OFF A;  2MLB A;  2KAC A;  4HRO A;  2MEK A;  1J8C A;  5E6J A;  4QAY A;  2M1M A;  3MFG A;  1WGY A;  2NCN A;  1XLO A;  3O13 A;  1GG3 A;  1F2R C;  2MP2 A;  4I6L B;  3H7P A;  2CS4 A;  1QOF A;  2LRW A;  3C19 A;  4FUL A;  3IAM 1;  4HKZ E;  5FR3 A;  2DX5 B;  1L0Y B;  3NS8 A;  4IKG A;  2G1E A;  2FNJ B;  3A9K B;  5HFY A;  4ZHP A;  1ZGU B;  3M63 B;  2M4N A;  3N20 C;  4HPL B;  4II3 B;  3ZRC A;  2XK5 B;  2WXK A;  2N7E A;  4MEM A;  1HZ5 A;  4YT0 B;  3CF6 E;  2I1J A;  4BVU C;  2MWS B;  2LGX A;  3ZO5 B;  2FID A;  2LD9 A;  3N1Z C;  3HK0 A;  1NEN B;  1VZ8 A;  4CHK A;  2L8J A;  3ZNI D;  5IN7 A;  2YVC A;  1NBF C;  2SEB D;  1VLB A;  3MC9 A;  3P1M A;  4ZDV A;  2M0X A;  2NPT B;  2WQY B;  2KT7 A;  1AN8 A;  1ZDX A;  2W3R A;  2KOX A;  1UF0 A;  1XEE A;  1TBE A;  2ZW1 A;  3AE2 B;  3TEX A;  4A3P A;  4I6N B;  4TQ0 A;  2LEK A;  2GOW A;  2LGY A;  4B95 A;  1WX7 A;  3Q3N C;  3DHI C;  3TIX A;  1M4V A;  2RDH A;  4BBN C;  2QJL A;  2JF5 A;  2CJO A;  4S17 A;  2BKF A;  2H88 B;  3PLU A;  2GI9 A;  4AS1 A;  1KLU D;  3QAQ A;  4JGH B;  2JQR B;  5CHF A;  3AB5 A;  2WDQ B;  2AQ3 B;  1YOV B;  3Q6B A;  4XE0 A;  3RMK C;  4GIV A;  3P2B A;  5IKC M;  2EEL A;  1T6B X;  1K51 A;  3WAO A;  2KQ7 A;  2C5L C;  2IZV B;  2PVG C;  1A70 A;  3PZ7 A;  2VZK B;  4HCN B;  2LVO A;  1GPX A;  4WJQ A;  3H1U A;  1WM3 A;  5TR5 A;  2GBN A;  2DHZ A;  3Q3M C;  3R3M A;  1P9D U;  2L83 A;  1LO5 D;  1L0V B;  3B0A A;  1JQ4 A;  1C78 A;  3P4P B;  3VVW B;  1V8C A;  1PDX A;  3NJT A;  1I4R A;  4AWJ A;  3B1L X;  2G4D B;  4C4V A;  3N30 A;  2O2V A;  4P7I A;  1HZ6 A;  2LJI A;  4AJW A;  1N5W A;  5DPT A;  2V0G A;  4KZ0 A;  2LXA A;  4AUQ C;  3FIL B;  3T3O A;  3BVZ A;  3AUL A;  2FE8 A;  3OJ3 A;  1YN3 A;  2MJD A;  3RFZ B;  4DHJ D;  1FIQ A;  4FHK A;  5JXV A;  1E7U A;  1JML A;  4YTM B;  1EWC A;  5BO4 B;  5D7G A;  2DZK A;  1PGX A;  2MBE A;  3DHG C;  2D3C A;  4YWG G;  1YJI A;  3ZRF A;  1RRB A;  3VTW A;  3ZJV A;  1XT9 B;  1OGW A;  4HDQ A;  1E90 A;  1UGM A;  4BAX A;  3B2F A;  2LUE A;  1EUV B;  4KSL C;  1F9J A;  2C60 A;  1WRD B;  4WJO A;  3UQA A;  2LVQ A;  1V5T A;  2M8S A;  3KUZ A;  3NZU A;  3NY5 A;  3AE7 B;  3A1Q B;  4ZRK A;  3Q2A C;  5C2T B;  3DVN V;  2KK8 A;  4BZA A;  1ZXI A;  1GB1 A;  3W1S C;  4EZL A;  2D2Q A;  3PSE B;  3I5J C;  4MDK E;  4KGS A;  1FRR A;  2RGF A;  3KVF B;  3V62 A;  2IBI B;  1JWU D;  3IVF A;  4TQ1 A;  3BWU D;  4BOS C;  2WU2 B;  4KGR A;  4ARI A;  3JYU A;  2L0T A;  4RH6 A;  3VUX A;  1TKG A;  3PHX B;  4FXC A;  2ZW0 A;  3URY A;  2KTR A;  2GBM A;  2IDY A;  5H8Y E;  2JU6 X;  4ICU A;  4PYU A;  3VRB B;  3BYT B;  4BKG A;  3ZJU A;  2Z0E B;  4A8X C;  2MJE A;  4RF1 A;  5G2N A;  1I4Q A;  1WMH A;  2KDM A;  4RF0 A;  4USA A;  3TEZ A;  1QOB A;  1V1O A;  2PLP A;  1FRD A;  2ZPY A;  2PEA A;  3IT4 B;  2BTE A;  2BF8 B;  4DDI D;  3Q14 C;  1SXT A;  1LQB A;  4TSS A;  5L83 A;  3NRZ A;  4GDL B;  1MVK A;  1GAQ B;  4HRS A;  4RMA A;  3W2D A;  4NZL B;  3NUH B;  2N9K A;  4RFB A;  3KH0 A;  2DYB A;  2N9L A;  4OVU A;  3DBL I;  4HCP B;  1WGD A;  3AXC A;  1IBX A;  3NZS A;  1RLF A;  2KDF B;  1K52 A;  1KTK A;  2KJ6 A;  2WP9 B;  2BT6 A;  4LNF A;  1N60 A;  3WAL A;  2KAN A;  4YSY B;  1MFW A;  4MM3 B;  4DK5 A;  3NG0 A;  1PFD A;  5C3J B;  4W9K A;  1PYW D;  2KDB A;  1UWM A;  2G9H D;  3R7Q A;  2IO3 B;  1Q10 A;  4IM0 A;  3L10 B;  5DPW A;  3T8M A;  1SJH D;  1HA5 A;  5E6P A;  2ZEQ A;  3EC8 A;  3JSV A;  1FO4 A;  2DAF A;  1C4P A;  3DDC B;  3C0R B;  2AL6 A;  3RNF C;  1VCB A;  3RNB C;  3Q8A A;  3GE3 C;  4YXD B;  3HVD A;  1WFY A;  2OED A;  2RMM A;  2BYV E;  3TUO A;  2UYZ B;  2WHI A;  4A3O A;  3W1Y A;  1YQB A;  3ALB A;  1YN5 A;  2K6D B;  4C7Z A;  5J18 A;  2WDR B;  3PZD A;  4B6W A;  4ANU A;  1L6V A;  3W1S A;  1WXM A;  2ZNV C;  1ISN A;  4K3C A;  1J0G A;  1ET9 A;  2RSU A;  1CQV A;  1WJU A;  1FNU A;  1T0R C;  1JRP A;  1TT5 B;  4W9E A;  1WGH A;  1H8C A;  3V05 A;  4KV2 A;  3RZW C;  2JXX A;  2MHJ A;  3PHW B;  4GDK B;  1Y56 A;  4ACF A;  3OAW A;  4KGT A;  3AMZ A;  3UIN B;  4LTU A;  3RD2 A;  1GOZ A;  4EE2 A;  2W55 A;  2Y5P A;  3ZTD A;  3AEE B;  4MJS A;  4DHZ B;  2KN4 A;  2C7H A;  3PLV A;  1PGB A;  3DCG A;  4FJV B;  4G11 A;  1JAL A;  2D3A A;  2NTS A;  2RDG A;  2R2Q A;  3AEB B;  1WXA A;  1SJE D;  4NQL B;  4W9D A;  3C8Y A;  3MC0 B;  1NEK B;  5D6J B;  4M0W A;  2LMC A;  2JYE A;  2WXN A;  3DQV A;  4DQO C;  2BYF A;  2EKE C;  2QEJ C;  3VR9 B;  2WXG A;  1RFA A;  1TIF A;  2PKO A;  3DBH B;  2WS3 B;  2PE6 B;  2VH1 A;  1SE4 A;  4PK1 A;  3AE8 B;  3KYD D;  2J4X A;  3Q3F A;  5T8I A;  3EEC A;  3HUI A;  3UIP B;  1DOY A;  2KWU B;  2VH2 A;  4BKT A;  5MPO A;  4HJK A;  1P7E A;  2WXO A;  5IAA C;  1XCT L;  4OZA A;  4MGI E;  1ZUD 2;  4TUU A;  4M00 A;  4UDU C;  2FUH B;  2PTL A;  2BWE S;  4FAD A;  4BKS A;  3DWM A;  3BK2 A;  3UI3 A;  2NBU A;  2BBC A;  2JZZ A;  1TYG B;  3AV8 A;  2EMS A;  4YTP B;  1CMX B;  4PT5 A;  3VXW A;  1XLP A;  2M0A A;  2WXJ A;  4K3B A;  2MP2 B;  1JRO A;  3H7P B;  2MQJ A;  2VRR B;  3KWV A;  2IYD B;  1SSN A;  4NY0 A;  1C4A A;  2ZVO A;  2RPV A;  3P42 A;  2QDF A;  4M01 A;  1N6Z A;  1I4X A;  1E9M A;  2QIL A;  1DYQ A;  4HJG E;  2O6V B;  4RGT A;  4DWF A;  4C80 A;  1F52 A;  2HE7 A;  1XF5 L;  3PS6 A;  3CST A;  1P1A A;  3DVG X;  2KO3 A;  4A9A A;  1C9F A;  1ET6 A;  2A4Z A;  1V1P B;  4EOY A;  5LXI B;  2PMV A;  3R2T A;  2M56 B;  4JPS A;  1WE6 A;  4XDD A;  2JPH A;  4JWS C;  3V60 A;  2G4S A;  2LRU A;  1KF6 B;  1YJJ A;  2V3P A;  4OVZ A;  3RUI B;  2JRH A;  3B08 A;  3IHP C;  3ZNG C;  4OHJ A;  4WWO A;  2KYW A;  3BVM A;  2ZCC A;  3R7R A;  2ZCB A;  1N61 A;  2X38 A;  4NAM A;  2HTH A;  4TKN A;  3BVG A;  1BML C;  1FXI A;  3RPF C;  5D3D A;  3EFC A;  3FC4 A;  3L17 A;  1UBI A;  4K7S A;  5EE0 A;  2L7R A;  4GB9 A;  2FBW B;  2K6Q A;  2CJN A;  4EKU A;  3GE8 C;  4M02 A;  4H2A A;  3TBL D;  3X23 A;  1VZ6 A;  2KFK A;  5LNK 1;  1LFD A;  3N32 A;  1AWD A;  1Q5W B;  1PQS A;  1P98 A;  3VFK A;  3CSF A;  4JWU C;  1E5W A;  3TJP A;  3DBR I;  1A5R A;  1IUE A;  1HTO A;  3U52 E;  2KC2 A;  4W9I A;  1E6E B;  4GLS C;  3JVZ X;  5BMG A;  5DCN A;  3QX1 A;  3QJZ A;  2RR9 A;  1KH0 A;  4N59 A;  4NAW B;  2YEP B;  1ZDV A;  3BZD B;  1D5X C;  3SR6 A;  5E6O A;  4J6I A;  1HEZ E;  3OJ4 B;  1R4N B;  2KMC A;  3IAS 1;  3N1X C;  1YX5 B;  1KJT A;  3Q8C A;  2W9N A;  2N4F A;  1V9J A;  2Z0D B;  4JE3 B;  3FKY A;  5EDS A;  3U7D A;  2G45 B;  4KKI A;  1SBB B;  2X8X X;  2BPS A;  4NJ7 A;  4MH0 E;  1V97 A;  3I57 A;  2K22 A;  2IY0 B;  2WXL A;  3QC8 B;  4LK0 M;  4OW0 A;  1WY8 A;  3TCA A;  4C4V B;  4WQO B;  3GZN I;  2IGH A;  2O2V B;  2J7Q B;  4LNN A;  1QOG A;  2K8B A;  1E7P B;  3KUD B;  1J7C A;  3IG3 A;  3BII D;  3RI7 C;  1FFV A;  1N5X A;  2H89 B;  1WXV A;  3ECI A;  4XX5 A;  2XK5 A;  2HD5 B;  3ZNH B;  3M3J A;  3ZQ4 A;  1E8Y A;  2N0S B;  4FHJ A;  1KFY B;  2D10 A;  2LGS A;  3M62 B;  4IWP A;  3APD A;  2AYO B;  4LLG M;  2V4L A;  3VH4 B;  2IY1 B;  2L32 A;  4NNJ B;  1XLQ A;  2WXQ A;  4FJZ A;  2J0K A;  3SFD B;  3ZNZ B;  5CTR C;  4BOZ B;  1C77 A;  3WAP A;  3EA6 A;  2AL3 A;  1T5X D;  3KYC D;  4MSQ B;  1EF1 A;  2KNB A;  4M8N A;  4MT5 A;  3R8B A;  3HM6 X;  4ANV A;  1K50 A;  4KKJ A;  1NVI D;  3GP7 A;  1MG4 A;  2L0F A;  2NMQ A;  3KLS X;  4XZ4 A;  1F0Z A;  5LXH A;  5G5H A;  1OTR B;  3PT2 B;  1MI0 A;  3DHH C;  1SIJ A;  1L0X B;  5JHB A;  4EUT A;  2CKH B;  2J0M A;  3L08 A;  4HPP A;  1SF0 A;  5GXG B;  1XCQ L;  3A9J B;  3KUC B;  2Y3A A;  2QHO A;  4M8M A;  1S3S G;  1XD3 B;  2WWZ A;  5IP4 D;  1TJE A;  2L05 A;  4DBG A;  1KM7 A;  4PS3 A;  1WGR A;  4WQM A;  3WA0 A;  2GBK A;  3M95 A;  1NYQ A;  4P1C C;  2G3Q B;  5EE3 A;  2KTR B;  3QQ8 B;  3SU8 X;  4A55 A;  1GC7 A;  4EEW A;  1TKY A;  1E8W A;  1U4A A;  1C79 A;  2JT4 B;  5G5G A;  3QK0 A;  4XC2 A;  5H92 C;  1I4G A;  3LXF A;  5AUK A;  1P7F A;  2DWQ A;  4REZ A;  4G3X B;  3MTN B;  4D2K A;  4IM3 A;  2PW9 A;  2LAS A;  3EHV A;  1UWX A;  1F1H A;  3N1Y C;  2D3B A;  3GB1 A;  4ZRQ A;  3IFW B;  1EWY C;  3LB8 C;  1C76 A;  2JWU A;  3AE1 B;  5FKA C;  1T3Q A;  2DBY A;  2XBB C;  3WAM A;  3SDL C;  1AYF A;  4NJ6 A;  4ANX A;  1MJD A;  2AQ2 B;  1IBX B;  5BYQ A;  4IWO A;  1D6E C;  2BS2 B;  4GN1 A;  2K3U A;  1UBQ A;  1QIL A;  2LJ5 A;  2N7D A;  5HG2 A;  2KD0 A;  3RYT A;  2KJR A;  2FUG 1;  3B9J A;  2KQS A;  1LGR A;  4ITK A;  4B0M A;  4K7W A;  4G0N B;  1IP9 A;  3AN1 A;  2YEP F;  2QCZ A;  3AE9 B;  2R2O A;  3ZTC A;  4LDT D;  1GNU A;  4BKS D;  2BW2 A;  2BGF A;  2L00 B;  2HJ1 A;  3MP9 A;  4OVV A;  3JSV B;  2J0J A;  1I35 A;  4G50 A;  2WX0 A;  4HKQ A;  1L4D B;  3U8Z A;  4MSM B;  2C9W B;  2DNF A;  3ML9 A;  4ARC A;  3BIN A;  1FNV A;  4EFO A;  3IBE A;  2KXJ A;  2D11 A;  3QHT A;  4GXB A;  2TSS A;  1C1Y B;  3DPD A;  2WYQ A;  4A20 A;  2Z8L A;  3Q3O C;  3HHM A;  4JL9 A;  4HWI B;  4XDC A;  2BB6 A;  2MX2 A;  1X1M A;  1OQR A;  3ZW3 A;  4DHJ B;  3NVW A;  2PVO D;  2NVU I;  2NBW B;  1QT9 A;  4JX1 C;  2JVC A;  4YTN B;  4BFR A;  1R4M B;  3EFU A;  3Q69 A;  4RGM A;  2DLB A;  2JYT A; 
#chains in the Genus database with same CATH homology
 3HK0 A;  4MGI E;  4W9L A;  3ZIM A;  4TUU A;  1WR1 A;  3APF A;  4CHK A;  2K8H A;  3V61 A;  2KJH B;  3VQI A;  3PRE A;  5J17 A;  2FUH B;  1WX9 A;  2L8J A;  4KVG B;  3ZNI D;  3ML8 A;  3ZKJ C;  1WMH B;  2BWE S;  4FAD A;  4BKS A;  2DEN B;  3K9O B;  2YVC A;  1NBF C;  4ZRJ A;  4MGY E;  2OJR A;  2NBU A;  4MJS B;  4ZDV A;  2M0X A;  2KKC A;  2NPT B;  4RM8 A;  1R4N I;  1WZ3 A;  1Z5S B;  2Y5B B;  2JZZ A;  3MHS D;  2NR2 A;  5CHW A;  5IA7 A;  2KOX A;  5G55 A;  2EMS A;  1CMX B;  2FCN A;  3VTV A;  2KZR A;  3VXW A;  1YD8 U;  1TBE A;  2KN5 A;  4FA6 A;  4GSW A;  2MBO A;  2MP2 B;  4A3P A;  4I6N B;  3RCZ A;  3H7P B;  2MQJ A;  2VRR B;  2ZPN A;  5KHQ A;  4TQ0 A;  2IYD B;  4NY0 A;  4KDI C;  2GOW A;  3TL5 A;  2ZVO A;  2LGY A;  4M0W B;  4WWP A;  4B95 A;  5KHO A;  1WJ6 A;  1WX7 A;  4II2 B;  2PPH A;  3TIX A;  4BBN C;  1EO6 A;  2JF5 A;  3UQB A;  4GDL A;  2BKF A;  1XQQ A;  2WX1 A;  3TMP B;  3H7S A;  3PLU A;  2LI5 A;  1V2Y A;  2O6V B;  4JLC A;  4DWF A;  1V81 A;  4WAA A;  1V5O A;  5GMV A;  2FCQ A;  2HE7 A;  4GU2 A;  2DYM A;  3A9J A;  3QAQ A;  1EF5 A;  1GUA B;  4JGH B;  2UWQ A;  1OEY J;  2RD0 A;  3AU5 A;  3PRZ A;  5DPS A;  3PS6 A;  5CHF A;  1WXS A;  2ZJD A;  3CST A;  4KSK C;  1P1A A;  3DVG X;  1WIA A;  2KO3 A;  4BBN F;  2B3A A;  1V6E A;  2MBQ A;  1ZW7 A;  1KLV A;  2CU1 A;  3KW5 B;  2A4Z A;  1UZX B;  1GJZ A;  2IO1 B;  4EOY A;  4W9H A;  3HIZ A;  5LXI B;  1D3Z A;  1G6J A;  3ONS A;  4W9G A;  1WE6 A;  3L16 A;  1UEL A;  4W9F A;  2JPH A;  3LDZ E;  2LWP A;  2LZ6 A;  4GIV A;  4HK2 A;  3V60 A;  3P2B A;  2G4S A;  5L95 C;  2ZVN A;  1YJ1 A;  1HE8 A;  2LRU A;  1TTN A;  4F8C B;  3K9P B;  3ZVV A;  2LXC A;  4ANW A;  4DHZ E;  3RUI B;  2JRH A;  3B08 A;  3IHP C;  2OOB B;  1E8X A;  3ZNG C;  4WWO A;  2BYE A;  2LVP A;  4CYE A;  3WAO A;  2KQ7 A;  2ZCC A;  3AU4 A;  3R7R A;  2C5L C;  2IZV B;  2ZCB A;  2K1F A;  4K7U A;  4PS8 A;  3PPA A;  4HCN B;  2LVO A;  4F1S A;  2HTH A;  4TKN A;  4WJQ A;  3H1U A;  1WM3 A;  2DZM A;  4ICV A;  3T9L A;  5TR5 A;  2GBN A;  2DHZ A;  3R3M A;  3L17 A;  1P9D U;  1UBI A;  3B0A A;  4K7S A;  1I42 A;  3A1Q A;  1WX8 A;  2L7R A;  1YX6 B;  2BWF A;  4GB9 A;  4LJO B;  3VVW B;  2K6Q A;  5C1Z A;  1TGZ B;  3ZLZ A;  4EKU A;  2Z59 B;  2KX0 A;  3TBL D;  3X23 A;  2CR5 A;  4AWJ A;  3B1L X;  2G4D B;  2GBR A;  2KFK A;  2RPQ A;  1LFD A;  2JZ3 B;  2KLG A;  3N32 A;  3N30 A;  2IO2 B;  1Q5W B;  2AWT A;  2O2V A;  1FXT B;  1PQS A;  4P7I A;  4AJW A;  4I6P A;  2MCN B;  1P98 A;  3VFK A;  5DPT A;  1OEY A;  4KZ0 A;  3CSF A;  4ZRI A;  2LXA A;  1E5W A;  3TJP A;  4AUQ C;  1VD2 A;  3DBR I;  1A5R A;  1QZE A;  3AUL A;  2KC2 A;  4W9I A;  4PYZ A;  2NBV B;  4WWN A;  3OJ3 A;  4MEL A;  1SGH A;  4FLH A;  2DYO A;  4HVB A;  4DHJ D;  3QCA A;  2JUO A;  3VTU A;  3JVZ X;  3PTF C;  5AZH A;  4TV3 A;  4FHK A;  3QX1 A;  5DCN A;  3QJZ A;  2KWV B;  1UH6 A;  1E7U A;  2RR9 A;  2GBJ A;  2C7N B;  1NI2 A;  1S1Q B;  4DXA B;  2MSE D;  5BO4 B;  5D7G A;  1P3Q U;  2C7M B;  2DZK A;  4NAW B;  3ZDM C;  2MBE A;  1E8Z A;  2AEH A;  4NPN A;  5E6O A;  4N9F 4;  3ZRF A;  1RRB A;  4J6I A;  3SHQ A;  3OJ4 B;  2PJH A;  3VTW A;  2LGD A;  4URK A;  1XT9 B;  1OGW A;  2KMC A;  2MBB B;  4HDQ A;  4PS7 A;  2KLC A;  1E90 A;  1WJ4 A;  1UGM A;  1KJT A;  1YX5 B;  3UIO B;  2W9N A;  2N4F A;  1V9J A;  1EUV B;  2LUE A;  2Z0D B;  3S2A A;  4CO7 A;  4KSL C;  2N1V A;  1F9J A;  2C60 A;  1WRD B;  4WJO A;  3UQA A;  5LLI A;  1YIW A;  1BT0 A;  5EDS A;  3U7D A;  2LVQ A;  1V5T A;  2G45 B;  1WF9 A;  2JRI B;  4JIO U;  4RM9 A;  2M8S A;  3KUZ A;  3NZU A;  3NY5 A;  2BPS A;  2L3Z A;  1WE7 A;  3A1Q B;  4IM2 A;  2D07 B;  4MH0 E;  4NJ7 A;  4ZRK A;  3DVN V;  2KK8 A;  3A33 B;  2JY6 A;  4W9J A;  4IW0 A;  2KWC A;  2IY0 B;  3W1S C;  3QC8 B;  1WY8 A;  3TCA A;  4MGZ E;  4EZL A;  2D2Q A;  2KC1 A;  2WDT B;  3L13 A;  3PRM B;  3PSE B;  4WQO B;  3VUW A;  3GZN I;  1Y8R C;  3RUL A;  2ZZP B;  2O2V B;  4MDK E;  2J7Q B;  4WJN A;  1AAR A;  5C23 A;  2RGF A;  5JHA A;  3KVF B;  3V62 A;  2IBI B;  3IVF A;  1LXD A;  2K8B A;  1ZKH A;  3VHT C;  2KMA A;  3KUD B;  4AP4 C;  3N3K B;  3H6N A;  4TQ1 A;  3NOB A;  3UF8 A;  3IG3 A;  3DVG Y;  4BOS C;  4AOF A;  4KDL B;  4WJP A;  2V1Y A;  4F7Z A;  1WXV A;  3ECI A;  4IUM B;  4XX5 A;  2O6V D;  2XK5 A;  1Q1O A;  2HD5 B;  3JYU A;  2KVR A;  2L0T A;  3ZNH B;  3LJ3 A;  4GMV A;  3VUX A;  3PHX B;  3M3J A;  4ZYN A;  4E71 A;  1E8Y A;  3MJW A;  3APC A;  3GOE A;  2N9E B;  2ASQ A;  4FHJ A;  2D10 A;  4MM3 A;  2KTR A;  3A4R A;  5DPR A;  3M62 B;  4LDT B;  4LCD E;  4IWP A;  3PGE A;  1NDD A;  2GBM A;  3APD A;  4E3C A;  5JH5 C;  2AYO B;  4IC7 B;  2V4L A;  3VH4 B;  2IY1 B;  4ICU A;  4PYU A;  4NNJ B;  4BKG A;  5AEK B;  4FJZ A;  1K8R B;  2Z0E B;  1OQY A;  2J0K A;  3ZNZ B;  5CTR C;  5G2N A;  4BOZ B;  3PRP B;  5D2M B;  2K8C A;  3WAP A;  3V6C B;  1WMH A;  1V86 A;  2AL3 A;  1WGG A;  1H4R A;  3L0W B;  3KYC D;  4MSQ B;  1KOT A;  1EF1 A;  2KNB A;  1SE9 A;  4M8N A;  4DDG D;  4KIK A;  4IWQ A;  2ZPY A;  3HM6 X;  4HDO A;  2PEA A;  4ANV A;  2BF8 B;  2DZI A;  1L7Y A;  3HM3 A;  4DDI D;  3PVL A;  2NS5 A;  5CHV C;  2L0F A;  1LQB A;  5L83 A;  3ZUN A;  4XZ4 A;  4GDL B;  2CHW A;  4HXD A;  3ENE A;  4RMA A;  3X0W A;  5LXH A;  1OTR B;  3PT2 B;  2FIF A;  5JHB A;  2HJ8 A;  2CKH B;  2J0M A;  4EUT A;  3KH0 A;  1C3T A;  3L08 A;  3SD5 A;  2DYB A;  2I1K A;  4OVU A;  1RAX A;  1M94 A;  3DBL I;  2MW5 A;  3A9J B;  3KUC B;  1JRU A;  2QHO A;  4M8M A;  1T0Y A;  3DOW A;  1P0R A;  4HCP B;  4B9K A;  1WGD A;  1S3S G;  3AXC A;  2MA9 B;  3DBH I;  1XD3 B;  2WWZ A;  3L54 A;  2ZNV B;  2L05 A;  4K1R B;  2O6V A;  1RLF A;  1KM7 A;  3NZS A;  4DBG A;  4MGK E;  2KDF B;  2KJ6 A;  4PS3 A;  1WGR A;  2IO0 B;  2CHX A;  2N9P C;  3WAL A;  2KAN A;  3WA0 A;  2GBK A;  4FN2 A;  3M95 A;  5HKH A;  3DVN U;  5JZE B;  2MRP A;  2G3Q B;  4NQK E;  2KTR B;  3QQ8 B;  3SU8 X;  4DK5 A;  1IYF A;  1GC7 A;  1R4M I;  4JQW C;  3ZDT A;  4IG7 B;  4W9K A;  4GDK A;  2XEW A;  2A5U A;  2KDB A;  4EEW A;  3U30 A;  1E8W A;  5AZG A;  1U4A A;  1L2N A;  4ASW C;  2JT4 B;  3QAR A;  3QK0 A;  4AJY B;  4XC2 A;  3R7Q A;  1WZ0 A;  2IO3 B;  4GGQ A;  4IM0 A;  2M17 A;  3L10 B;  5DPW A;  3T8M A;  2KHW B;  5E6P A;  2JWZ A;  2KDE B;  2ZEQ A;  3EC8 A;  3JSV A;  4FJY A;  1GC6 A;  4G3X B;  3MTN B;  4KIK B;  4GOC A;  1Z2M A;  2DAF A;  4IM3 A;  2KTF A;  2MBH A;  3DDC B;  4YL8 A;  3C0R B;  4X57 B;  3JW0 X;  2AL6 A;  3WIM A;  1VCB A;  1WH3 A;  2LAS A;  4LJP B;  2KFK B;  3VUY A;  3EHV A;  3VDZ A;  3PV1 A;  1IPG A;  5D94 A;  1WFY A;  3CMM B;  2YLM A;  3RZF A;  3IFW B;  2BYV E;  3NHE B;  1V49 A;  2UYZ B;  4A3O A;  2CHZ A;  3W1Y A;  1YQB A;  3ALB A;  2DAJ A;  3QA8 A;  2N1W A;  1V80 A;  3D32 A;  3A9K A;  2K6D B;  3UGB B;  3VH3 B;  2XBB C;  5J18 A;  3WAM A;  3SDL C;  4NJ6 A;  3PZD A;  4B6W A;  4ANU A;  4ANX A;  3W1S A;  1MG8 A;  5AZF A;  1WXM A;  1TZ1 A;  2ZNV C;  1ISN A;  2FCS A;  2FAZ A;  4IWO A;  1J0G A;  3QWZ B;  2RSU A;  2N9X A;  3I3T B;  4GN1 A;  1UBQ A;  1E7V A;  1UD7 A;  1WJU A;  2D3G A;  5E6N A;  2LJ5 A;  4FBJ B;  5J2R A;  1J19 A;  2K39 A;  4HPM B;  2KFJ A;  2N7D A;  2KD0 A;  3RYT A;  2KJR A;  4W9E A;  3R66 C;  1WGH A;  1H8C A;  2KX3 A;  4EZK A;  1SIF A;  4KV2 A;  2V3S A;  3RZW C;  3V6E B;  3H9D A;  2PE9 A;  2JXX A;  2KQS A;  3PHW B;  3Q3J A;  4GDK B;  4K7W A;  5CX3 A;  5FR6 A;  3OAW A;  4W9C A;  4KZC A;  4G0N B;  1WYW B;  1IP9 A;  2GMI C;  2K25 A;  3QIJ A;  1WI0 A;  4NAW A;  2R2O A;  3UIN B;  3ZTC A;  2MLB A;  4LDT D;  3RD2 A;  1GNU A;  4BKS D;  2BGF A;  2L00 B;  1J8C A;  4E74 A;  1WM2 A;  3ZTD A;  4MJS A;  2NPT A;  1LM8 B;  2M1M A;  4DHZ B;  2C7H A;  4K81 A;  1WGY A;  4OVV A;  1WR6 E;  3JSV B;  2J0J A;  2NCN A;  3PLV A;  1I35 A;  4G50 A;  2WX0 A;  3DCG A;  3U8Z A;  4FJV B;  4G11 A;  2C9W B;  4MSM B;  1GG3 A;  3ML9 A;  2EMT A;  3WAN A;  3BIN A;  2R2Q A;  2L76 A;  2FCM A;  4EFO A;  2MP2 A;  3IBE A;  4I6L B;  1WXA A;  3H7P A;  2CS4 A;  2LRW A;  2KXJ A;  4NQL B;  2D11 A;  3QHT A;  4GXB A;  2KDI A;  4W9D A;  1C1Y B;  3DPD A;  4FUL A;  2WYQ A;  2DZJ A;  4A20 A;  5D6J B;  3HHM A;  2DX5 B;  3NS8 A;  4JL9 A;  2BKR B;  4HWI B;  2FNJ B;  3DQV A;  3DBS A;  2BYF A;  2EKE C;  3A9K B;  3RT3 B;  1ZGU B;  1RFA A;  3BY4 B;  3M63 B;  2MX2 A;  1X1M A;  2PE6 B;  2M4N A;  3A4S C;  3ZW3 A;  3VAW A;  4DHJ B;  4HPL B;  3OLM D;  4II3 B;  2NVU I;  2NBW B;  2XK5 B;  3ZRC A;  3AI5 A;  2N7E A;  3KYD D;  4MEM A;  4HLE A;  3Q3F A;  1Q0W B;  3EEC A;  3UIP B;  4EZJ A;  2KWU B;  4BKT A;  3CF6 E;  2I1J A;  2JVC A;  3O65 B;  4BVU C;  4BFR A;  2MWS B;  4HJK A;  2LGX A;  2REX A;  3EFU A;  3ZO5 B;  5IAA C;  2FID A;  2LD9 A;  1WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...