3QWZB

Crystal structure of faf1 ubx-p97n-domain complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
79
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
total genus 19
structure length 79
sequence length 81
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qwzB00
4A20A 2GBNA 4LDTB 2KX0A 2KQ7A 2IO0B 4GIVA 3B08A 3MTNB 2BYFA 2KWCA 3VAWA 3VFKA 3TJPA 3EECA 2BF8B 2KQSA 2LUEA 2Y5BB 1OEYJ 1WE7A 4MSQB 2WYQA 2JXXA 5GMVA 4IWPA 5JH5C 4EOYA 4DWFA 5KHQA 2WX1A 3PHWB 3PPAA 3SDLC 4K7SA 1OQYA 3GOEA 3M95A 3UGBB 3A9KB 1S1QB 3TMPB 2KN5A 3BY4B 2LXAA 3NZSA 2R2OA 4ANXA 2MA9B 3QHTA 2PE9A 2JZ3B 1WI0A 1WR1A 4PYZA 4K81A 4GGQA 1H8CA 1WE6A 3ZNID 1X1MA 2L0FA 4I6LB 4JQWC 4LCDE 1H4RA 2JT4B 1IP9A 3K9OB 3H9DA 3HM3A 5TR5A 3ECIA 2KJ6A 3DPDA 1V80A 2QHOA 3QC8B 4HLEA 2G4SA 2KTRB 2HD5B 3H7SA 2KNBA 2KXJA 3OLMD 4W9FA 2DENB 1WX9A 1WJUA 4DHZB 3ZNZB 3ZTDA 3IHPC 1ISNA 2L7RA 3A4SC 4HWIB 1WXVA 2KDBA 2Z59B 4DDGD 4AJYB 4BBNC 3JSVB 2AL3A 3CF6E 3U7DA 2AWTA 4JIOU 4CHKA 2REXA 5JHAA 4AUQC 2K8CA 3RZFA 1F9JA 4E3CA 2KFKB 4GN1A 5IA7A 2IZVB 4BVUC 4WJPA 2JRHA 4W9IA 1FXTB 4TQ0A 1Y8RC 4G11A 3N30A 2KJHB 3PS6A 3KYCD 2MBHA 4MDKE 2VRRB 3ML8A 1WM2A 3PRZA 2C9WB 1YX5B 4XZ4A 2IO2B 4DDID 2KMCA 4MM3A 1YX6B 3PLUA 1PQSA 4GDLA 3ZRFA 1WGYA 4AWJA 4BOSC 1XD3B 3KUZA 2A4ZA 3UIPB 4HPMB 3ONSA 3T8MA 1E7VA 5AZFA 4FJVB 1UD7A 3A9JB 3RCZA 4EZJA 2LXCA 3QQ8B 2N7EA 2MP2A 5G55A 4G0NB 4KZ0A 1S3SG 2KVRA 1LM8B 1WMHA 1OGWA 1TTNA 1HE8A 3ZO5B 1E90A 4I6PA 2R2QA 2NVUI 3R66C 4G3XB 4HCPB 4M8NA 2DYMA 1J8CA 2N7DA 2K6QA 1E8YA 2C60A 2JUOA 4BBNF 3OJ4B 4NAWB 2L76A 3RD2A 4EZLA 2GMIC 2AEHA 5IAAC 4ANVA 2FIFA 1E8ZA 3CMMB 4B6WA 4FHKA 4HXDA 3OJ3A 3IFWB 3O65B 4NJ6A 4LDTD 4WWNA 4EFOA 1UBQA 2JPHA 4YL8A 4JLCA 2IYDB 2Z0DB 3P2BA 3VTUA 4FA6A 2WX0A 1VD2A 5EDSA 3ENEA 1WFYA 4WWPA 4ZRKA 4ASWC 2DYBA 4GDKA 3C0RB 4E71A 3RT3B 5CHVC 3R7QA 2CS4A 4A3OA 1M94A 2LGYA 1U4AA 1EF5A 2BKFA 2PE6B 2Z0EB 3L16A 4KSKC 1Q0WB 3PLVA 3RZWC 3A1QB 3KH0A 4KSLC 2G45B 2M8SA 1WX7A 3EC8A 3L54A 2K6DB 3DVNV 3IBEA 1IPGA 4HDOA 4IM3A 4MJSB 4MSMB 1WZ0A 1YD8U 2G3QB 2XBBC 3DBHI 4JL9A 2JY6A 2LRUA 3NOBA 2D10A 2LD9A 3QJZA 2N9EB 1WGHA 4W9EA 2V4LA 2XK5B 1Q1OA 2KDFB 3AULA 3ZDMC 2KMAA 3PZDA 2DAFA 3HIZA 1NI2A 4EKUA 3AU5A 5JHBA 4MH0E 1BT0A 3B0AA 2JZZA 2M0XA 1WR6E 2MBEA 5G2NA 3L17A 3W1SC 2NBWB 2C7MB 3L0WB 1WJNA 4KIKA 4HCNB 1XT9B 2NPTA 2UYZB 1E7UA 4II2B 4W9GA 3VH4B 4NY0A 1GC7A 2ZJDA 1R4MI 4XX5A 3DVGY 3CSFA 4BKTA 4N9F4 4E74A 5CX3A 1RAXA 3UIOB 3N32A 3QAQA 1R4NI 3K9PB 1GG3A 2EMTA 1UGMA 3W1YA 5AZGA 2FNJB 2J7QB 4TUUA 4EZKA 2PPHA 3BINA 3HK0A 1YIWA 1KOTA 1UBIA 2MBQA 2MQJA 3UF8A 4J6IA 2BYEA 2FCSA 3PHXB 2OJRA 2K8BA 2CHWA 2KWVB 4RM8A 5AZHA 2XEWA 4KDLB 2RGFA 3ZUNA 3NS8A 4CO7A 3CSTA 1C1YB 2LGDA 4I6NB 5D7GA 1WJ6A 2KJRA 4A3PA 3ZLZA 2RD0A 3NY5A 2GBJA 1VCBA 1WJ4A 1GJZA 2YVCA 2M17A 3JSVA 2LVQA 1P98A 1ZGUB 3WAMA 2DAJA 4EEWA 5JZEB 4BKGA 1EF1A 3LDZE 3QX1A 3QWZB 3PRPB 2BGFA 1LXDA 3WAOA 2GBKA 4TV3A 2DZJA 1ZW7A 2LWPA 3DBLI 3HHMA 3PRMB 4ICVA 5E6NA 3X23A 3QA8A 3DVNU 3V6CB 2BWES 3R7RA 2K39A 3PV1A 4K1RB 2L0TA 4W9JA 3N3KB 2O2VA 3H6NA 2IBIB 1SIFA 4KVGB 1G6JA 3AI5A 2LGXA 3IVFA 3JVZX 4DXAB 3MJWA 4W9HA 3H7PA 4B9KA 1UH6A 2KLCA 2CHZA 4JGHB 4GU2A 3DDCB 5DPSA 2CU1A 2G4DB 2KX3A 4BKSD 4CYEA 2KHWB 2ZVNA 4ZRIA 3ZNHB 1MG8A 5CHWA 1Q5WB 3WAPA 4WJNA 1V49A 4B95A 2IO3B 4DK5A 2FCQA 1UELA 4ANUA 5L83A 5J18A 3WIMA 3M3JA 4WWOA 4FN2A 1CMXB 3U8ZA 3V6EB 2BWFA 3M62B 5LXIB 2IY0B 1K8RB 4MELA 3VH3B 4FJZA 1EO6A 2LJ5A 3RYTA 1E8WA 2JVCA 2J0JA 1GC6A 4IWOA 4AP4C 4DBGA 5LLIA 2JF5A 2WDTB 3AU4A 4ANWA 1P3QU 4PS3A 3AXCA 2D3GA 3B1LX 3VUXA 1WYWB 5KHOA 2BPSA 1WIAA 2HJ8A 3PGEA 4W9KA 3UQBA 1ZKHA 2LI5A 2ZNVB 4F7ZA 1SE9A 4NQKE 4M8MA 4GB9A 4IM2A 2ZPNA 3ZTCA 4IWQA 3QARA 3TL5A 1WGGA 2HTHA 4MEMA 4PYUA 3ZNGC 4HJKA 3APFA 4RMAA 4W9LA 3EHVA 5D6JB 2NBVB 2MP2B 3RUIB 3ZRCA 1KLVA 3SHQA 4HDQA 2N9PC 2BYVE 1WMHB 2CHXA 5E6PA 3NHEB 2O6VB 3IG3A 2GBMA 2DYOA 4FJYA 4II3B 2NS5A 2MBBB 2NBUA 4PS8A 3M63B 2IO1B 3VVWB 5LXHA 2K8HA 2WWZA 2XK5A 4W9DA 1WRDB 3APDA 1WGDA 3ZDTA 3L13A 4K7UA 2MW5A 2KLGA 1T0YA 3SU8X 4DHZE 3NZUA 4WAAA 2UWQA 2ZPYA 1TBEA 1Z2MA 5L95C 1AARA 4RM9A 3A33B 2L05A 2EMSA 3EFUA 2RR9A 3VQIA 4F1SA 3T9LA 2KDEB 3A4RA 4GOCA 4DHJB 5J2RA 4NPNA 5CHFA 3A9KA 4X57B 2PEAA 2KKCA 3L08A 2C7HA 2ZVOA 3VHTC 2RPQA 4KV2A 4AJWA 1WM3A 4IW0A 5DCNA 1J0GA 1E5WA 5DPWA 4BOZB 3JYUA 1TZ1A 2B3AA 4TQ1A 2A5UA 4KZCA 1L2NA 3QK0A 1V81A 4IC7B 4WQOB 2JWZA 2N1WA 1I35A 2DZMA 3PT2B 5C23A 2N1VA 3KUCB 3QCAA 2KD0A 2J0MA 3VXWA 1OEYA 2NR2A 2M4NA 5AEKB 4NJ7A 4ZDVA 1NBFC 3VTWA 3W1SA 2KTRA 4OVVA 2JRIB 1WH3A 3QIJA 4MGKE 2M1MA 1D3ZA 4IG7B 1Z5SB 2J0KA 1TGZB 2FCNA 3DBSA 2KDIA 2KC1A 2NPTB 4KIKB 4MGZE 2L3ZA 4LJOB 5J17A 2KC2A 4FBJB 1GNUA 2C7NB 2KK8A 3KUDB 1P1AA 4NQLB 5CTRC 3TCAA 2KANA 4P7IA 3VTVA 2KFKA 2KTFA 1V5TA 3APCA 1IYFA 1XQQA 3VUYA 1JRUA 1QZEA 3OAWA 3SD5A 1LQBA 2BKRB 4WJOA 1WXAA 2KWUB 4GXBA 5E6OA 2DHZA 1NDDA 3DQVA 1WGRA 2MX2A 4FULA 3GZNI 2L00B 2KZRA 3TBLD 4IUMB 4MGIE 2DZKA 4WJQA 2KFJA 1KJTA 3I3TB 3MHSD 4ICUA 3U30A 2LASA 2LZ6A 1WXMA 3DBRI 1EUVB 5FR6A 1LFDA 2ZNVC 4BFRA 3KYDD 1WX8A 2ZEQA 3PSEB 4FHJA 2NCNA 3A9JA 2EKEC 2FUHB 3KVFB 3UINB 4TKNA 4URKA 4NNJB 2D11A 4F8CB 3L10B 1I42A 1P0RA 3VUWA 3Q3JA 4HPLB 2ZZPB 3ALBA 5D2MB 1UZXB 3D32A 3Q3FA 4MGYE 4AOFA 4XC2A 1WY8A 2AL6A 2AYOB 2CR5A 2O6VD 3ML9A 4NAWA 3H1UA 2MCNB 2D2QA 1RLFA 2O2VB 1V86A 2N9XA 3WALA 2MLBA 4BKSA 4PS7A 1YJ1A 4IM0A 2PJHA 2C5LC 3H7PB 1OTRB 1YQBA 3UQAA 4GDLB 2MSED 3V62A 1WF9A 4M0WB 5DPRA 2OOBB 4ZRJA 1KM7A 2ASQA 2LRWA 3HM6X 2IY1B 3PVLA 5DPTA 3V61A 2V3SA 2KO3A 4W9CA 1SGHA 1L7YA 2I1JA 2O6VA 4KDIC 3A1QA 3DOWA 3V60A 2DX5B 4DHJD 1V2YA 2L8JA 4MJSA 3PREA 3JW0X 5C1ZA 2FIDA 3RULA 4HVBA 3VDZA 1WXSA 3DVGX 1WZ3A 2W9NA 2YLMA 2GOWA 4ZYNA 4FADA 3TIXA 3ZW3A 2LVPA 3WA0A 1RRBA 5HKHA 2I1KA 4K7WA 2ZCCA 3S2AA 3X0WA 4EUTA 5BO4B 2K1FA 1GUAB 2ZCBA 1V6EA 2HE7A 3ZIMA 1A5RA 4GSWA 3ZVVA 1RFAA 1C3TA 1P9DU 3WANA 2FAZA 2MRPA 1V5OA 2DZIA 2N4FA 2KOXA 2MWSB 2RSUA 3ZKJC 4HK2A 1E8XA 2V1YA 4GDKB 3KW5B 2LVOA 3LJ3A 4G50A 3PTFC 4LJPB 2K25A 3R3MA 2D07B 2FCMA 4OVUA 3DCGA 1V9JA 5D94A 2MBOA 1J19A 2CKHB 4FLHA 2GBRA 4GMVA
chains in the Genus database with same CATH superfamily
1QQRA 5IO9A 4B0MA 1UNSA 2E6XA 3TJPA 2PMVA 4C00A 2LUEA 2Y5BB 1WE7A 3P4PB 1SXTA 4DWFA 2V4IB 2WX1A 3PPAA 3SDLC 2IPKD 4K7SA 2LGIA 5BMIA 3TMPB 1FXAA 2LXAA 2WXHA 3N20C 4P1BC 1TKGA 1WI0A 2JZPA 3ZNID 2WXIA 2BYTA 3B9JA 4JQWC 2KACA 2LGSA 1J7AA 3DPDA 2QHOA 3QC8B 2KTRB 5I4DA 2V3PA 2QIEB 2KNBA 3OLMD 1E0ZA 1WX9A 1WJUA 3IHPC 4BBNC 4Q2JA 2AL3A 3CF6E 1SSNA 3U7DA 3FAHA 1F1HA 3KWVA 1TT5B 5JHAA 3RZFA 1YN5A 3BWUD 4GN1A 4W9IA 1FXTB 5FKAC 2KJHB 1N6ZA 3KYCD 1KFYB 2IO2B 4DDID 2KMCA 2GRIA 3DBRB 1YX6B 3ZRFA 2RMMA 1E7VA 2XN9C 3MC8A 5AZFA 2AQ1B 2L83A 3A9JB 1F0ZA 4EZJA 2LXCA 1L6VA 3QQ8B 4RGMA 2MP2A 4G0NB 1S3SG 1LM8B 1WMHA 1HZ6A 2DYMA 1HEZE 2C60A 4BBNF 3RD2A 1JWAD 1SJHD 3V3XA 2GMIC 1E8ZA 1UBQA 3AMZA 3IAM1 4REZA 2IYDB 3P2BA 4FA6A 2WX0A 4OW0A 5EDSA 3ENEA 3TEWA 3SFEB 3AEGB 3SR6A 4GDKA 1SEBD 4E71A 3R7QA 4A3OA 1U4AA 4KSKC 2PE6B 3L16A 4C4VA 3A1QB 4KSLC 2G45B 1QLBB 4N58A 2TSSA 4MJSB 1WZ0A 4BAXA 2WXNA 1YD8U 1D4BA 2LRUA 2G1EA 1QOFA 3U52E 1NENB 2LD9A 1WGHA 3SEBA 2XK5B 2KDFB 2KMAA 5D3IB 1XEEA 2JZZA 1WSPA 5G2NA 3NJTA 3RNAC 4KX6B 2JYTA 3CIRB 3VH4B 1GC7A 1R4MI 2CJOA 4N9F4 2N9KA 3ABVB 3UIOB 3NUHB 1R4NI 1GG3A 1KOTA 1AYFA 4YWGG 2MQJA 2N7JA 1T6BX 1NI3A 4RM8A 1UGJA 3ZXRA 3NS8A 1C1YB 2J52A 1HZ5A 1XCQL 1WJ4A 3Q69A 3WAMA 5JZEB 2AX5A 1EF1A 3LDZE 3QX1A 4LNOA 2I2YA 1I4PA 2BGFA 1MPEA 1QKZA 4RF1A 4ICVA 3QA8A 3V6CB 5AUKA 3W2DA 2WDQB 4UDUC 2PW9A 1SIFA 1G6JA 4NJCA 4JGHB 3PZ8A 4LTUA 2W55A 3DDCB 2KX3A 1VZ8A 1QOAA 4ZRIA 4H2AA 4FN2A 2JXTA 1PUTA 5LXIB 1K8RB 3RYTA 3FILB 1E8WA 2J0JA 2JF5A 3AU4A 4OHJA 1WWTA 1JALA 1I4HA 2INCC 2E3TA 4PK1A 4XYCA 3U7ZA 1NYRA 1XF5L 4W9KA 2ZNVB 4C80A 4LK0M 2LMCA 4IM2A 3ZTCA 1KH0A 2RDHA 1WGGA 2ZW1A 2MP2B 2KVZA 1L0YB 1WMHB 2ON8A 2O6VB 3BK2A 4K7UA 2MW5A 1T0YA 2ZPYA 1Z2MA 3Q2AC 3A33B 4DXFA 5EE0A 3C8YA 3A4RA 4RF0A 2J42A 3ZGZA 4TMAB 2HJ1A 2PEAA 1XLPA 3R2TA 3RNEC 1NVID 3MP9A 4IW0A 2KYWA 3JYUA 4TQ1A 1TYGB 2DZMA 3P1MA 3VRAB 2J0MA 1D5XC 5JXVA 3R8BA 2M4NA 3W1SA 3VTWA 1WH3A 5G5GA 2FCNA 3Q14C 4ZHPA 4LJOB 1GNUA 2C7NB 3KUDB 5CTRC 3VTVA 1IYFA 4N59A 4P1CC 1YNTE 3SD5A 1N62A 4WJOA 1WXAA 2KWUB 2MX2A 4S17A 2KZRA 3TBLD 1MI0A 2DZKA 2KDMA 3RMKC 2LASA 3DBRI 4BFRA 2PLPA 2ZEQA 2EKEC 2CJNA 4AS1A 2Q5WD 4TKNA 3DBLB 1L5PA 1Q10A 3HVZA 2D11A 4URKA 3L10B 1JQ4A 3VUWA 1C9FA 3Q3JA 3R2IA 3ALBA 4M00A 4FXCA 2O6VD 2MJ3A 1RLFA 2QILA 3UQAA 3BYYB 1DGJA 2LRWA 3PVLA 4W9CA 4KDIC 2QJLA 4OZCA 2DX5B 5C1ZA 3RULA 2ONQA 2LJIA 1WZ3A 1MG4A 4ZYNA 3ZW3A 2I1KA 2PVGC 2ZCCA 1ZP0B 4YTMB 1OQRA 1V6EA 2HE7A 3BVMA 1SBBB 3VR8B 3DHIC 4XGAB 1V5OA 2RSUA 2DWQA 2MWSB 3ZKJC 2D5GA 3AEEB 4HK2A 4G50A 3GP7A 3DWMA 3PTFC 1QT9A 2K25A 2D07B 4OVUA 1J19A 1VZ7A 2KX0A 2KQ7A 1V8CA 3VAWA 4IKGA 1I4XA 1ZDVA 3EECA 1V97A 1C77A 4MSQB 4IWPA 4EOYA 3PHWB 1VDVA 3GOEA 1TKYA 2W3RA 1S1QB 3BY4B 3NZSA 2R2OA 4ANXA 4RGOS 1WRIA 3QHTA 4US8A 4PYZA 4K81A 4GGQA 1H8CA 1X1MA 2PTLA 1DOXA 4I6LB 4LCDE 1ROEA 5HI1A 3E9SA 3ECIA 3P4QB 4HLEA 2MJEA 3OG5A 1N60A 4HKZE 2KXJA 4ZHOA 1LGRA 2MHJA 5EE1A 4HWIB 4ITKA 4LNFA 2REXA 2BT6A 4BZAA 4E3CA 1F9JA 5IA7A 1EU3A 3KQ4A 3AEBB 3GZNB 1ZDXA 3PS6A 3RNGC 1UF0A 4MDKE 3ML8A 1WM2A 2C9WB 1YX5B 4XZ4A 3N1XC 4AWJA 4BOSC 1A70A 4XDCA 3UIPB 3O13A 3ONSA 4KKJA 4FJVB 1C4CA 4JE3B 3ZQ4A 1C76A 4I6PA 3R66C 4HCPB 5HHDG 2N7DA 1EWCA 2JUOA 1KTKA 1TS2A 4M01A 3MHZA 3CMMB 1N61A 5FR3A 3IFWB 3O65B 4EFOA 1YJJA 4JLCA 2Z0DB 2YEPF 1VD2A 1ET9A 4ASWC 2CS4A 1IBXA 1EF5A 2BKFA 2IGDA 3KH0A 3Q3NC 1SF0A 1WX7A 4HDOA 3L54A 4KGSA 3DVNV 4IM3A 4MACA 2G3QB 2LHEA 2JY6A 2AQ2B 3NOBA 2D10A 3QJZA 1Q1OA 3ZDMC 3PZDA 3KWLA 1GPXA 1C78A 2FE8A 1UUPA 1AWDA 3L17A 1ESFA 3L0WB 1T3QA 4KIKA 4HCNB 1XT9B 4II2B 4M02A 1J7CA 4BKTA 4NAMA 2DNFA 4E74A 1K50A 3QAQA 2KAJA 1SB3C 5AZGA 2VH2A 2J7QB 2MBQA 3GS2A 1M4VA 3UF8A 1FCLA 2BS4B 1PDXA 2FCSA 4KGRA 4KDLB 3ZUNA 4R3DA 2LGDA 4I6NB 5D7GA 4YSZB 1WJ6A 2KJRA 1PGAA 2W3SA 2RD0A 3EUB2 2M19A 3MC0B 3JSVA 1JCKB 2DAJA 1F52A 1ZW7A 3DBLI 3HHMA 5E6NA 2ICIA 3RN9C 3ZJTA 2L1AA 2K39A 3NVZA 2L0TA 2V9HA 1JWUD 1KLUD 4W9JA 3N3KB 2VZKB 1YJIA 2IBIB 3NZ3A 3AH7A 3IVFA 4W9HA 3Q8EA 4B9KA 5G5HA 1K52A 1HQRD 4GU2A 2VH1A 1N5XA 2CU1A 4CYEA 1MG8A 3WAPA 2OEDA 1UELA 5J18A 3WIMA 3M3JA 2LFIA 1CMXB 1CQVA 4MT5A 2BWFA 1FNWA 3Q8AA 1FXIA 2WXFA 3AEFB 2WDRB 1KF6B 2JVCA 2Z8LA 4IWOA 4DBGA 4YSXB 4ZYSA 2KN4A 1PFDA 2D3GA 4P6VF 1I4RA 4OZBA 2QMTA 1KLGD 1WYWB 1IUEA 1TS3A 5T8IA 4RH6A 3LB8C 1P7EA 1ACCA 4NQKE 5EE9A 4GB9A 2ZPNA 3ZNGC 1KRHA 3ZRCA 4AQ7A 1KLVA 1GOZA 3SHQA 2CHXA 3NHEB 2GBMA 2WXKA 3AEAB 1SE2A 2WXOA 3IXSA 3M63B 4W9DA 1WRDB 3APDA 5BYRA 3NZUA 4KGTA 1AARA 1CK1A 2INPE 1FCCC 3EFUA 3T9LA 4GOCA 4DHJB 5CHFA 3A9KA 1IBXB 1V1OA 2KKCA 4ZRQA 1ZOYB 2C7HA 4KV2A 3DBHB 1WM3A 2PVOD 4BOZB 1TZ1A 2WGSA 4KZCA 1XO3A 4WURA 1MJDA 4LLGM 1I35A 4LNIA 3KUCB 3QCAA 1BUIC 2ZW0A 3VXWA 3W9CB 1FRDA 2WXLA 1ENFA 1GB1A 2JRIB 1P7FA 3QIJA 2VZKD 3NG0A 1NEKB 2M1MA 4MGKE 1QF6A 1SJED 3P63A 2DBYA 4IG7B 3NVYA 3DBSA 4KIKB 2KC1A 5TSSA 2L3ZA 3Q6BA 4NQLB 1P1AA 4QAYA 3TCAA 1V5TA 1XQQA 1MHXA 2JU6X 1LQBA 2BKRB 3DQVA 1VRAB 4FULA 3GZNI 4J3OD 4MGIE 4KKIA 4WJQA 1KJTA 3RPFC 3U30A 2WS3B 1WXMA 1EUVB 1LFDA 2ZNVC 1WX8A 4FHJA 4YT0B 3UINB 4NNJB 1I42A 1F2RI 1P0RA 2UU7A 1FNUA 5H92C 5IKCM 2ZZPB 5D2MB 5EE3A 1V1PA 3D32A 1FFVA 4MGYE 4RGNA 5BMGA 2CR5A 4NAWA 2MCNB 2B76B 3AE4B 1V86A 4WQMA 2N9XA 1XCTL 2MLBA 1FPYA 4IM0A 2PJHA 5DPRA 5MPOA 2OOBB 2ASQA 3HM6X 1SGHA 1L7YA 1T5XD 3BZDB 3UI3A 3DOWA 4DHJD 1JWBD 3JW0X 3NS1A 3KLSX 1DOIA 4ARIA 3EGRA 1WXSA 1FM0D 2W9NA 2YLMA 4LNNA 1ZE3D 3URYA 1T0SC 2LVPA 3WA0A 1RRBA 5D3DA 2MJDA 3S2AA 3X0WA 2D3AA 3AE5B 3LXFA 4EUTA 2ZCBA 1FNVA 3ZVVA 2FAZA 2KOXA 2D3CA 4RGTA 2AQ3B 4GDKB 3LJ3A 3ZYYX 4C4VB 2HDEA 1HTOA 1Y56A 1YOVB 4FLHA 2GBRA 4ANWA 2H89B 4LDTB 2V3NA 2IO0B 2KT7A 4GIVA 3MTNB 2KWCA 2W54A 3VFKA 1C79A 2BF8B 2KQSA 1OEYJ 3BVGA 2WNMA 1IGCA 3Q8FA 2WYQA 2JXXA 5GMVA 5JH5C 3M95A 3UGBB 2OJWA 3A9KB 1WR1A 1WE6A 2N9LA 2LEKA 1XXGA 2JT4B 3HM3A 5TR5A 1EWYC 3U2SC 3PZ7A 1GB4A 2HD5B 2R61A 4W9FA 4DHZB 2WXPA 3ZNZB 3ZTDA 1ISNA 1WXVA 2KDBA 2Z59B 2AWTA 2KMMA 3ZJUA 2EKIA 2INNE 4AUQC 2K8CA 2J53A 2IZVB 2JRHA 4TQ0A 1Y8RC 3N30A 3BYTB 2MBHA 1RFKA 1VR9A 4MM3A 3PLUA 1PQSA 4GDLA 1HTQA 2A4ZA 1MVKA 3AE3B 4HPMB 4LNKA 1VJKA 1EM7A 2IJ0A 1C4AA 1UD7A 3RCZA 2JWUA 2N7EA 2BQQA 1QOBA 1TTNA 1HE8A 2QDFA 3ZO5B 2R2QA 4M8NA 1V1PB 1J8CA 2KQ4X 4NAWB 2OHFA 4HRSA 4EZLA 5IAAC 2AEHA 4ZOHC 4ANVA 2FIFA 4B6WA 4FHKA 4HXDA 4LDTD 4WWNA 1C4PA 3VTUA 3BVZA 1AN8A 4WWPA 2DYBA 3RNFC 3C0RB 3RT3B 5CHVC 2Z0EB 4IOIE 1Q0WB 3EFCA 2K6DB 2X38A 3IBEA 4MSMB 3Q8BA 3HUIA 1TY0A 4WIPA 1AW7A 2BVCA 3DBHI 2N9EB 3Q3OC 1FD6A 1TY2A 3RFZB 1NI2A 4EKUA 3AU5A 2JX5A 3B0AA 2XNAC 2M0XA 1JMLA 1WR6E 2MBEA 2WHIA 2EELA 3GE8C 3W1SC 2C7MB 1WJNA 3AM9A 2UYZB 1E7UA 4W9GA 1WYGA 2ZJDA 4XX5A 3DVGY 1ZPSA 5CX3A 3HRDD 3N1ZC 1TS4A 2NTSA 1VZ6A 1YQ3B 4RNAA 1UGMA 3W1YA 2FNJB 5HFYA 1IGDA 4EZKA 2PPHA 3HK0A 4USAA 1UBIA 2BYEA 3PHXB 2OJRA 2K8BA 2CHWA 2KWVB 5AZHA 3CSTA 1YMHE 1L6UA 4A3PA 4YTPB 3ZLZA 1D6EC 2GBJA 5H8YE 4RFBA 2M17A 2LVQA 1XLQA 1P98A 4L23A 1ZXHA 3WAOA 2DZJA 1MHHE 3X23A 2LUMA 3R7RA 3T3OA 3PV1A 4K1RB 3H6NA 5BYSA 3TEYA 4KVGB 3JVZX 3RNBC 4DXAB 1UH6A 5DPSA 4M0WA 2G4DB 1PGBA 2KHWB 3ZNHB 4B95A 1Q5WB 4DK5A 2FCQA 4ANUA 5L83A 2IGHA 4WWOA 2GB1A 3U8ZA 3NVWA 2Y3AA 2IY0B 1EO6A 2LJ5A 2WDTB 1P3QU 3TEXA 3VUXA 5KHOA 4MM3B 2HJ8A 4B0EA 3AE8B 1ZKHA 1HXYD 4S0RA 4IWQA 3TL5A 3CWIA 4PYUA 4HJKA 3APFA 4W9LA 2Y5PA 3EHVA 1N5WA 3RUIB 2YEPB 4K3CA 4HDQA 2DLBA 3PO0A 2BYVE 5E6PA 3VRBB 1EU4A 4ZRPA 2NS5A 3HVDA 2MBBB 2NBUA 2WWZA 2XK5A 1N63A 3C19A 4WAAA 1TBEA 3OWEB 2RR9A 4JWUC 4F1SA 2KDEB 5J2RA 1JWMD 1OFFA 2ZVOA 2RPQA 4HROA 2PIAA 3B2GA 2B3AA 4WQOB 4C7ZA 3WCQA 2KD0A 4DXGA 2W82A 2NR2A 2WXMA 3TSSA 1YN3A 2BS3B 4ACFA 3GB1A 4DQOC 1Z5SB 1TGZB 4MGZE 4CQNA 2KC2A 4FBJB 1F77A 3W5VB 1K53A 3E56A 4P7IA 2KFKA 4A9AA 2BTEA 3APCA 1LO5D 3VUYA 2GI9A 1JRUA 2L32A 1QZEA 3OAWA 5E6OA 1NDDA 1WGRA 2L00B 4IUMB 2QEJC 2M0AA 3I3TB 4ICUA 1STEA 2LZ6A 5FR6A 3PSEB 4P16A 2NCNA 2MH7A 5IOIA 2WQYB 3P42A 3FILA 4XE0A 1YQ4B 4XC2A 1WY8A 3Q8CA 2AL6A 2WLBA 2AYOB 3ML9A 1B1ZA 3DWGC 4BKSA 4PS7A 4WH4A 2C5LC 3N9YC 4C56C 1YQBA 2MSED 4M0WB 1I4QA 2IY1B 2V0GA 3V61A 2V3SA 2I38A 2O6VA 3V60A 4D2KA 2L8JA 3PREA 4GLSC 2FIDA 2JQRB 3FKYA 3DVGX 2GOWA 4FADA 1T0QC 1E6EB 2RDGA 4YTNB 1T0RC 5BO4B 2BBCA 2WP9B 1GUAB 4NZLB 1CZPA 3ZIMA 1A5RA 1E7PB 4GSWA 1P9DU 2MRPA 2SAKA 2DZIA 1SIJA 1E8XA 1TJEA 2V1YA 3AE6B 1TZOA 1L4ZB 1TKEA 3R3MA 4L2YA 2K0PA 2FCMA 3DCGA 2SEBD 1V9JA 5D94A 1XLNA 2MBOA 2CKHB 4MH8A 1BXTA 4IDIA 1D5ZC 2GBNA 4A20A 3B08A 2Y5CA 3DHHC 2BYFA 1RM6C 1NYQA 4HEA1 2WDVB 3DHGC 2WXQA 5KHQA 1OQYA 2KN5A 1YN4A 2MA9B 3MC9A 2K3UA 2PE9A 2JZ3B 4YSYB 3GE3C 5FK9C 2L0FA 3NRZA 1H4RA 1IP9A 3K9OB 3H9DA 3AE9B 1B9RA 2KJ6A 3BIID 3NVVA 3IT6B 1V80A 2G4SA 3H7SA 4A8XC 4XWTA 3J9CA 2RPVA 2DENB 2L7RA 3A4SC 4JX1C 5GXGB 4DDGD 4AJYB 3JSVB 1JROA 4JIOU 4CHKA 2KFKB 3SFDB 1FFUA 1FMAD 1JWSD 3ETRA 4BVUC 4WJPA 2J4XA 1I7HA 4G11A 4K3BA 2VRRB 3VR9B 3AE7B 3PRZA 2WXJA 1WGYA 1XD3B 2INDC 3I57A 3KUZA 3L4PA 3T8MA 2WXGA 2FUG1 4HKQA 5G55A 4KZ0A 2KVRA 1OGWA 1E90A 2BB5A 2MEKA 2NVUI 4G3XB 4HJGE 2K6QA 5LNK1 1E8YA 3EA6A 3OJ4B 2L76A 2WXRA 2RDBC 3OJ3A 3TUOA 4NJ6A 2JPHA 4YL8A 3I9V1 2N0SB 1GAQB 1I4GA 3AEDB 3AV8A 5BMHA 1J7BA 1WFYA 4ZRKA 3TEZA 3U4EG 5C2TB 1M94A 2LGYA 3RZWC 3W5UB 5HG2A 3PLVA 2M8SA 3EC8A 1IPGA 1CJEA 2JSVX 2XBBC 4JL9A 4W9EA 2V4LA 2BW2A 1DOYA 4L1BA 3AULA 2DAFA 3HIZA 1BMLC 5JHBA 1HA5A 4MH0E 1BT0A 4OVZA 2NBWB 2IDYA 5C3JB 2NPTA 4N6EB 4NY0A 2WU5B 3CSFA 1ZUD2 4ARCA 2WU2B 1DYQA 1RAXA 3N32A 3K9PB 2EMTA 1UWMA 1JRPA 4RCOA 4TUUA 3BINA 1YIWA 2BS2B 1L0XB 1QILA 2ACZB 4J6IA 2LHDA 1JW9D 3I5JC 2XEWA 2RGFA 4CO7A 1K51A 4TSSA 3NY5A 1VCBA 3MFGA 1GJZA 2YVCA 1E9MA 1ZGUB 4EEWA 4BKGA 3QWZB 3PRPB 1LXDA 2GBKA 4TV3A 2LWPA 4XWWA 3BK1A 3PRMB 1FO4A 3DVNU 3IT4B 4HPPA 2BWES 4JWSC 1ET6A 2O2VA 4C7YA 3AI5A 2LGXA 3MJWA 3H7PA 2KLCA 2CHZA 4BKSD 4WAFA 2ZVNA 5CHWA 4WJNA 1V49A 2IO3B 3V6EB 3M62B 3VH3B 4MELA 4FJZA 3AE2B 3RI7C 4AP4C 1GC6A 2CU3A 5E6JA 5LLIA 4PS3A 3AXCA 3B1LX 3AE1B 2BPSA 2NMQA 1WIAA 3PGEA 3UQBA 2LI5A 2BB6A 4F7ZA 1SE9A 4M8MA 2L52A 2NTTA 3QARA 2HTHA 2PKOA 4MEMA 1FRRA 1E10A 1L0VB 2QSDA 4RMAA 5D6JB 2NBVB 2N9PC 3IG3A 2DYOA 3MJ5A 4FJYA 4II3B 4PS8A 3VVWB 2IO1B 5LXHA 2K8HA 3ZDTA 1WGDA 4OZAA 2G9HD 3L13A 2KLGA 3B2FA 3SU8X 4DHZE 2KWDA 2UWQA 4A55A 1WGKA 5L95C 4RM9A 2L05A 2EMSA 3VQIA 2GLSA 4NPNA 4X57B 2QCZA 3L08A 3VHTC 2IGGA 3ZJVA 5AUIA 4AJWA 1J0GA 5DCNA 1E5WA 5DPWA 1L2NA 2A5UA 1MFWA 3QK0A 1V81A 4IC7B 1PGXA 3H8HA 2JWZA 2N1WA 3AB5A 3PT2B 5C23A 3V05A 2N1VA 3I63C 3RNCC 1OEYA 5AEKB 3FC4A 4NJ7A 4ZDVA 1NBFC 2KTRA 1TIFA 4OVVA 2H88B 3P4SB 2HTME 1D3ZA 1R4MB 2J0KA 2KDIA 2NPTB 5J17A 1R4NB 2KK8A 1QOGA 1F2RC 2X8XX 2KANA 2KTFA 3IAS1 2D3BA 3N1YC 4GXBA 2DHZA 1SE3A 2K9XA 2KFJA 3MHSD 1L4DB 1OQQA 1UWXA 3KYDD 3A9JA 4WWMA 2FUHB 3P4RB 3KVFB 4F8CB 1PYWD 1XLOA 4HPLB 1FEHA 3T3NA 1UZXB 1RWSA 4YXDB 4A6QA 2JYEA 3Q3FA 4AOFA 5BYQA 3H1UA 3AECB 2D2QA 2O2VB 1ZXIA 1RYJA 3WALA 4A90A 1YJ1A 3H7PB 1OTRB 4GDLB 4O1NA 3V62A 1WF9A 3LYYA 2K22A 4XDDA 4ZRJA 1KM7A 1VLBA 2FBWB 1SE4A 5DPTA 2KO3A 5IN7A 2K5PA 2I1JA 3Q3MC 3A1QA 1D5MC 1V2YA 4JPSA 4MJSA 4PT5A 4HVBA 3VDZA 3TIXA 5HKHA 1R7SA 4K7WA 1TS5A 1WXQA 2K1FA 2M56B 1C3TA 1RFAA 4US9A 3WANA 2N4FA 4EE2A 3KW5B 2LVOA 3ZXVA 5IP4D 4LJPB 2QC8A 1FIQA 3AN1A 4GMVA
chains in the Genus database with same CATH topology
4A20A 2GBNA 4LDTB 2KX0A 2KQ7A 2IO0B 4GIVA 3B08A 3MTNB 2BYFA 2KWCA 3VAWA 3VFKA 3TJPA 3EECA 2BF8B 2KQSA 2LUEA 2Y5BB 1OEYJ 1WE7A 4MSQB 2WYQA 2JXXA 5GMVA 4IWPA 5JH5C 4EOYA 4DWFA 5KHQA 2WX1A 3PHWB 3PPAA 3SDLC 4K7SA 1OQYA 3GOEA 3M95A 3UGBB 3A9KB 1S1QB 3TMPB 2KN5A 3BY4B 2LXAA 3NZSA 2R2OA 4ANXA 2MA9B 3QHTA 2PE9A 2JZ3B 1WI0A 1WR1A 4PYZA 4K81A 4GGQA 1H8CA 1WE6A 3ZNID 1X1MA 2L0FA 4I6LB 4JQWC 4LCDE 1H4RA 2JT4B 1IP9A 3K9OB 3H9DA 3HM3A 5TR5A 3ECIA 2KJ6A 3DPDA 1V80A 2QHOA 3QC8B 4HLEA 2G4SA 2KTRB 2HD5B 3H7SA 2KNBA 2KXJA 3OLMD 4W9FA 2DENB 1WX9A 1WJUA 4DHZB 3ZNZB 3ZTDA 3IHPC 1ISNA 2L7RA 3A4SC 4HWIB 1WXVA 2KDBA 2Z59B 4DDGD 4AJYB 4BBNC 3JSVB 2AL3A 3CF6E 3U7DA 2AWTA 4JIOU 4CHKA 2REXA 5JHAA 4AUQC 2K8CA 3RZFA 1F9JA 4E3CA 2KFKB 4GN1A 5IA7A 2IZVB 4BVUC 4WJPA 2JRHA 4W9IA 1FXTB 4TQ0A 1Y8RC 4G11A 3N30A 2KJHB 3PS6A 3KYCD 2MBHA 4MDKE 2VRRB 3ML8A 1WM2A 3PRZA 2C9WB 1YX5B 4XZ4A 2IO2B 4DDID 2KMCA 4MM3A 1YX6B 3PLUA 1PQSA 4GDLA 3ZRFA 1WGYA 4AWJA 4BOSC 1XD3B 3KUZA 2A4ZA 3UIPB 4HPMB 3ONSA 3T8MA 1E7VA 5AZFA 4FJVB 1UD7A 3A9JB 3RCZA 4EZJA 2LXCA 3QQ8B 2N7EA 2MP2A 5G55A 4G0NB 4KZ0A 1S3SG 2KVRA 1LM8B 1WMHA 1OGWA 1TTNA 1HE8A 3ZO5B 1E90A 4I6PA 2R2QA 2NVUI 3R66C 4G3XB 4HCPB 4M8NA 2DYMA 1J8CA 2N7DA 2K6QA 1E8YA 2C60A 2JUOA 4BBNF 3OJ4B 4NAWB 2L76A 3RD2A 4EZLA 2GMIC 2AEHA 5IAAC 4ANVA 2FIFA 1E8ZA 3CMMB 4B6WA 4FHKA 4HXDA 3OJ3A 3IFWB 3O65B 4NJ6A 4LDTD 4WWNA 4EFOA 1UBQA 2JPHA 4YL8A 4JLCA 2IYDB 2Z0DB 3P2BA 3VTUA 4FA6A 2WX0A 1VD2A 5EDSA 3ENEA 1WFYA 4WWPA 4ZRKA 4ASWC 2DYBA 4GDKA 3C0RB 4E71A 3RT3B 5CHVC 3R7QA 2CS4A 4A3OA 1M94A 2LGYA 1U4AA 1EF5A 2BKFA 2PE6B 2Z0EB 3L16A 4KSKC 1Q0WB 3PLVA 3RZWC 3A1QB 3KH0A 4KSLC 2G45B 2M8SA 1WX7A 3EC8A 3L54A 2K6DB 3DVNV 3IBEA 1IPGA 4HDOA 4IM3A 4MJSB 4MSMB 1WZ0A 1YD8U 2G3QB 2XBBC 3DBHI 4JL9A 2JY6A 2LRUA 3NOBA 2D10A 2LD9A 3QJZA 2N9EB 1WGHA 4W9EA 2V4LA 2XK5B 1Q1OA 2KDFB 3AULA 3ZDMC 2KMAA 3PZDA 2DAFA 3HIZA 1NI2A 4EKUA 3AU5A 5JHBA 4MH0E 1BT0A 3B0AA 2JZZA 2M0XA 1WR6E 2MBEA 5G2NA 3L17A 3W1SC 2NBWB 2C7MB 3L0WB 1WJNA 4KIKA 4HCNB 1XT9B 2NPTA 2UYZB 1E7UA 4II2B 4W9GA 3VH4B 4NY0A 1GC7A 2ZJDA 1R4MI 4XX5A 3DVGY 3CSFA 4BKTA 4N9F4 4E74A 5CX3A 1RAXA 3UIOB 3N32A 3QAQA 1R4NI 3K9PB 1GG3A 2EMTA 1UGMA 3W1YA 5AZGA 2FNJB 2J7QB 4TUUA 4EZKA 2PPHA 3BINA 3HK0A 1YIWA 1KOTA 1UBIA 2MBQA 2MQJA 3UF8A 4J6IA 2BYEA 2FCSA 3PHXB 2OJRA 2K8BA 2CHWA 2KWVB 4RM8A 5AZHA 2XEWA 4KDLB 2RGFA 3ZUNA 3NS8A 4CO7A 3CSTA 1C1YB 2LGDA 4I6NB 5D7GA 1WJ6A 2KJRA 4A3PA 3ZLZA 2RD0A 3NY5A 2GBJA 1VCBA 1WJ4A 1GJZA 2YVCA 2M17A 3JSVA 2LVQA 1P98A 1ZGUB 3WAMA 2DAJA 4EEWA 5JZEB 4BKGA 1EF1A 3LDZE 3QX1A 3QWZB 3PRPB 2BGFA 1LXDA 3WAOA 2GBKA 4TV3A 2DZJA 1ZW7A 2LWPA 3DBLI 3HHMA 3PRMB 4ICVA 5E6NA 3X23A 3QA8A 3DVNU 3V6CB 2BWES 3R7RA 2K39A 3PV1A 4K1RB 2L0TA 4W9JA 3N3KB 2O2VA 3H6NA 2IBIB 1SIFA 4KVGB 1G6JA 3AI5A 2LGXA 3IVFA 3JVZX 4DXAB 3MJWA 4W9HA 3H7PA 4B9KA 1UH6A 2KLCA 2CHZA 4JGHB 4GU2A 3DDCB 5DPSA 2CU1A 2G4DB 2KX3A 4BKSD 4CYEA 2KHWB 2ZVNA 4ZRIA 3ZNHB 1MG8A 5CHWA 1Q5WB 3WAPA 4WJNA 1V49A 4B95A 2IO3B 4DK5A 2FCQA 1UELA 4ANUA 5L83A 5J18A 3WIMA 3M3JA 4WWOA 4FN2A 1CMXB 3U8ZA 3V6EB 2BWFA 3M62B 5LXIB 2IY0B 1K8RB 4MELA 3VH3B 4FJZA 1EO6A 2LJ5A 3RYTA 1E8WA 2JVCA 2J0JA 1GC6A 4IWOA 4AP4C 4DBGA 5LLIA 2JF5A 2WDTB 3AU4A 4ANWA 1P3QU 4PS3A 3AXCA 2D3GA 3B1LX 3VUXA 1WYWB 5KHOA 2BPSA 1WIAA 2HJ8A 3PGEA 4W9KA 3UQBA 1ZKHA 2LI5A 2ZNVB 4F7ZA 1SE9A 4NQKE 4M8MA 4GB9A 4IM2A 2ZPNA 3ZTCA 4IWQA 3QARA 3TL5A 1WGGA 2HTHA 4MEMA 4PYUA 3ZNGC 4HJKA 3APFA 4RMAA 4W9LA 3EHVA 5D6JB 2NBVB 2MP2B 3RUIB 3ZRCA 1KLVA 3SHQA 4HDQA 2N9PC 2BYVE 1WMHB 2CHXA 5E6PA 3NHEB 2O6VB 3IG3A 2GBMA 2DYOA 4FJYA 4II3B 2NS5A 2MBBB 2NBUA 4PS8A 3M63B 2IO1B 3VVWB 5LXHA 2K8HA 2WWZA 2XK5A 4W9DA 1WRDB 3APDA 1WGDA 3ZDTA 3L13A 4K7UA 2MW5A 2KLGA 1T0YA 3SU8X 4DHZE 3NZUA 4WAAA 2UWQA 2ZPYA 1TBEA 1Z2MA 5L95C 1AARA 4RM9A 3A33B 2L05A 2EMSA 3EFUA 2RR9A 3VQIA 4F1SA 3T9LA 2KDEB 3A4RA 4GOCA 4DHJB 5J2RA 4NPNA 5CHFA 3A9KA 4X57B 2PEAA 2KKCA 3L08A 2C7HA 2ZVOA 3VHTC 2RPQA 4KV2A 4AJWA 1WM3A 4IW0A 5DCNA 1J0GA 1E5WA 5DPWA 4BOZB 3JYUA 1TZ1A 2B3AA 4TQ1A 2A5UA 4KZCA 1L2NA 3QK0A 1V81A 4IC7B 4WQOB 2JWZA 2N1WA 1I35A 2DZMA 3PT2B 5C23A 2N1VA 3KUCB 3QCAA 2KD0A 2J0MA 3VXWA 1OEYA 2NR2A 2M4NA 5AEKB 4NJ7A 4ZDVA 1NBFC 3VTWA 3W1SA 2KTRA 4OVVA 2JRIB 1WH3A 3QIJA 4MGKE 2M1MA 1D3ZA 4IG7B 1Z5SB 2J0KA 1TGZB 2FCNA 3DBSA 2KDIA 2KC1A 2NPTB 4KIKB 4MGZE 2L3ZA 4LJOB 5J17A 2KC2A 4FBJB 1GNUA 2C7NB 2KK8A 3KUDB 1P1AA 4NQLB 5CTRC 3TCAA 2KANA 4P7IA 3VTVA 2KFKA 2KTFA 1V5TA 3APCA 1IYFA 1XQQA 3VUYA 1JRUA 1QZEA 3OAWA 3SD5A 1LQBA 2BKRB 4WJOA 1WXAA 2KWUB 4GXBA 5E6OA 2DHZA 1NDDA 3DQVA 1WGRA 2MX2A 4FULA 3GZNI 2L00B 2KZRA 3TBLD 4IUMB 4MGIE 2DZKA 4WJQA 2KFJA 1KJTA 3I3TB 3MHSD 4ICUA 3U30A 2LASA 2LZ6A 1WXMA 3DBRI 1EUVB 5FR6A 1LFDA 2ZNVC 4BFRA 3KYDD 1WX8A 2ZEQA 3PSEB 4FHJA 2NCNA 3A9JA 2EKEC 2FUHB 3KVFB 3UINB 4TKNA 4URKA 4NNJB 2D11A 4F8CB 3L10B 1I42A 1P0RA 3VUWA 3Q3JA 4HPLB 2ZZPB 3ALBA 5D2MB 1UZXB 3D32A 3Q3FA 4MGYE 4AOFA 4XC2A 1WY8A 2AL6A 2AYOB 2CR5A 2O6VD 3ML9A 4NAWA 3H1UA 2MCNB 2D2QA 1RLFA 2O2VB 1V86A 2N9XA 3WALA 2MLBA 4BKSA 4PS7A 1YJ1A 4IM0A 2PJHA 2C5LC 3H7PB 1OTRB 1YQBA 3UQAA 4GDLB 2MSED 3V62A 1WF9A 4M0WB 5DPRA 2OOBB 4ZRJA 1KM7A 2ASQA 2LRWA 3HM6X 2IY1B 3PVLA 5DPTA 3V61A 2V3SA 2KO3A 4W9CA 1SGHA 1L7YA 2I1JA 2O6VA 4KDIC 3A1QA 3DOWA 3V60A 2DX5B 4DHJD 1V2YA 2L8JA 4MJSA 3PREA 3JW0X 5C1ZA 2FIDA 3RULA 4HVBA 3VDZA 1WXSA 3DVGX 1WZ3A 2W9NA 2YLMA 2GOWA 4ZYNA 4FADA 3TIXA 3ZW3A 2LVPA 3WA0A 1RRBA 5HKHA 2I1KA 4K7WA 2ZCCA 3S2AA 3X0WA 4EUTA 5BO4B 2K1FA 1GUAB 2ZCBA 1V6EA 2HE7A 3ZIMA 1A5RA 4GSWA 3ZVVA 1RFAA 1C3TA 1P9DU 3WANA 2FAZA 2MRPA 1V5OA 2DZIA 2N4FA 2KOXA 2MWSB 2RSUA 3ZKJC 4HK2A 1E8XA 2V1YA 4GDKB 3KW5B 2LVOA 3LJ3A 4G50A 3PTFC 4LJPB 2K25A 3R3MA 2D07B 2FCMA 4OVUA 3DCGA 1V9JA 5D94A 2MBOA 1J19A 2CKHB 4FLHA 2GBRA 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A20 A;  2GBN A;  4LDT B;  2KX0 A;  2KQ7 A;  2IO0 B;  4GIV A;  3B08 A;  3MTN B;  2BYF A;  2KWC A;  3VAW A;  3VFK A;  3TJP A;  3EEC A;  2BF8 B;  2KQS A;  2LUE A;  2Y5B B;  1OEY J;  1WE7 A;  4MSQ B;  2WYQ A;  2JXX A;  5GMV A;  4IWP A;  5JH5 C;  4EOY A;  4DWF A;  5KHQ A;  2WX1 A;  3PHW B;  3PPA A;  3SDL C;  4K7S A;  1OQY A;  3GOE A;  3M95 A;  3UGB B;  3A9K B;  1S1Q B;  3TMP B;  2KN5 A;  3BY4 B;  2LXA A;  3NZS A;  2R2O A;  4ANX A;  2MA9 B;  3QHT A;  2PE9 A;  2JZ3 B;  1WI0 A;  1WR1 A;  4PYZ A;  4K81 A;  4GGQ A;  1H8C A;  1WE6 A;  3ZNI D;  1X1M A;  2L0F A;  4I6L B;  4JQW C;  4LCD E;  1H4R A;  2JT4 B;  1IP9 A;  3K9O B;  3H9D A;  3HM3 A;  5TR5 A;  3ECI A;  2KJ6 A;  3DPD A;  1V80 A;  2QHO A;  3QC8 B;  4HLE A;  2G4S A;  2KTR B;  2HD5 B;  3H7S A;  2KNB A;  2KXJ A;  3OLM D;  4W9F A;  2DEN B;  1WX9 A;  1WJU A;  4DHZ B;  3ZNZ B;  3ZTD A;  3IHP C;  1ISN A;  2L7R A;  3A4S C;  4HWI B;  1WXV A;  2KDB A;  2Z59 B;  4DDG D;  4AJY B;  4BBN C;  3JSV B;  2AL3 A;  3CF6 E;  3U7D A;  2AWT A;  4JIO U;  4CHK A;  2REX A;  5JHA A;  4AUQ C;  2K8C A;  3RZF A;  1F9J A;  4E3C A;  2KFK B;  4GN1 A;  5IA7 A;  2IZV B;  4BVU C;  4WJP A;  2JRH A;  4W9I A;  1FXT B;  4TQ0 A;  1Y8R C;  4G11 A;  3N30 A;  2KJH B;  3PS6 A;  3KYC D;  2MBH A;  4MDK E;  2VRR B;  3ML8 A;  1WM2 A;  3PRZ A;  2C9W B;  1YX5 B;  4XZ4 A;  2IO2 B;  4DDI D;  2KMC A;  4MM3 A;  1YX6 B;  3PLU A;  1PQS A;  4GDL A;  3ZRF A;  1WGY A;  4AWJ A;  4BOS C;  1XD3 B;  3KUZ A;  2A4Z A;  3UIP B;  4HPM B;  3ONS A;  3T8M A;  1E7V A;  5AZF A;  4FJV B;  1UD7 A;  3A9J B;  3RCZ A;  4EZJ A;  2LXC A;  3QQ8 B;  2N7E A;  2MP2 A;  5G55 A;  4G0N B;  4KZ0 A;  1S3S G;  2KVR A;  1LM8 B;  1WMH A;  1OGW A;  1TTN A;  1HE8 A;  3ZO5 B;  1E90 A;  4I6P A;  2R2Q A;  2NVU I;  3R66 C;  4G3X B;  4HCP B;  4M8N A;  2DYM A;  1J8C A;  2N7D A;  2K6Q A;  1E8Y A;  2C60 A;  2JUO A;  4BBN F;  3OJ4 B;  4NAW B;  2L76 A;  3RD2 A;  4EZL A;  2GMI C;  2AEH A;  5IAA C;  4ANV A;  2FIF A;  1E8Z A;  3CMM B;  4B6W A;  4FHK A;  4HXD A;  3OJ3 A;  3IFW B;  3O65 B;  4NJ6 A;  4LDT D;  4WWN A;  4EFO A;  1UBQ A;  2JPH A;  4YL8 A;  4JLC A;  2IYD B;  2Z0D B;  3P2B A;  3VTU A;  4FA6 A;  2WX0 A;  1VD2 A;  5EDS A;  3ENE A;  1WFY A;  4WWP A;  4ZRK A;  4ASW C;  2DYB A;  4GDK A;  3C0R B;  4E71 A;  3RT3 B;  5CHV C;  3R7Q A;  2CS4 A;  4A3O A;  1M94 A;  2LGY A;  1U4A A;  1EF5 A;  2BKF A;  2PE6 B;  2Z0E B;  3L16 A;  4KSK C;  1Q0W B;  3PLV A;  3RZW C;  3A1Q B;  3KH0 A;  4KSL C;  2G45 B;  2M8S A;  1WX7 A;  3EC8 A;  3L54 A;  2K6D B;  3DVN V;  3IBE A;  1IPG A;  4HDO A;  4IM3 A;  4MJS B;  4MSM B;  1WZ0 A;  1YD8 U;  2G3Q B;  2XBB C;  3DBH I;  4JL9 A;  2JY6 A;  2LRU A;  3NOB A;  2D10 A;  2LD9 A;  3QJZ A;  2N9E B;  1WGH A;  4W9E A;  2V4L A;  2XK5 B;  1Q1O A;  2KDF B;  3AUL A;  3ZDM C;  2KMA A;  3PZD A;  2DAF A;  3HIZ A;  1NI2 A;  4EKU A;  3AU5 A;  5JHB A;  4MH0 E;  1BT0 A;  3B0A A;  2JZZ A;  2M0X A;  1WR6 E;  2MBE A;  5G2N A;  3L17 A;  3W1S C;  2NBW B;  2C7M B;  3L0W B;  1WJN A;  4KIK A;  4HCN B;  1XT9 B;  2NPT A;  2UYZ B;  1E7U A;  4II2 B;  4W9G A;  3VH4 B;  4NY0 A;  1GC7 A;  2ZJD A;  1R4M I;  4XX5 A;  3DVG Y;  3CSF A;  4BKT A;  4N9F 4;  4E74 A;  5CX3 A;  1RAX A;  3UIO B;  3N32 A;  3QAQ A;  1R4N I;  3K9P B;  1GG3 A;  2EMT A;  1UGM A;  3W1Y A;  5AZG A;  2FNJ B;  2J7Q B;  4TUU A;  4EZK A;  2PPH A;  3BIN A;  3HK0 A;  1YIW A;  1KOT A;  1UBI A;  2MBQ A;  2MQJ A;  3UF8 A;  4J6I A;  2BYE A;  2FCS A;  3PHX B;  2OJR A;  2K8B A;  2CHW A;  2KWV B;  4RM8 A;  5AZH A;  2XEW A;  4KDL B;  2RGF A;  3ZUN A;  3NS8 A;  4CO7 A;  3CST A;  1C1Y B;  2LGD A;  4I6N B;  5D7G A;  1WJ6 A;  2KJR A;  4A3P A;  3ZLZ A;  2RD0 A;  3NY5 A;  2GBJ A;  1VCB A;  1WJ4 A;  1GJZ A;  2YVC A;  2M17 A;  3JSV A;  2LVQ A;  1P98 A;  1ZGU B;  3WAM A;  2DAJ A;  4EEW A;  5JZE B;  4BKG A;  1EF1 A;  3LDZ E;  3QX1 A;  3QWZ B;  3PRP B;  2BGF A;  1LXD A;  3WAO A;  2GBK A;  4TV3 A;  2DZJ A;  1ZW7 A;  2LWP A;  3DBL I;  3HHM A;  3PRM B;  4ICV A;  5E6N A;  3X23 A;  3QA8 A;  3DVN U;  3V6C B;  2BWE S;  3R7R A;  2K39 A;  3PV1 A;  4K1R B;  2L0T A;  4W9J A;  3N3K B;  2O2V A;  3H6N A;  2IBI B;  1SIF A;  4KVG B;  1G6J A;  3AI5 A;  2LGX A;  3IVF A;  3JVZ X;  4DXA B;  3MJW A;  4W9H A;  3H7P A;  4B9K A;  1UH6 A;  2KLC A;  2CHZ A;  4JGH B;  4GU2 A;  3DDC B;  5DPS A;  2CU1 A;  2G4D B;  2KX3 A;  4BKS D;  4CYE A;  2KHW B;  2ZVN A;  4ZRI A;  3ZNH B;  1MG8 A;  5CHW A;  1Q5W B;  3WAP A;  4WJN A;  1V49 A;  4B95 A;  2IO3 B;  4DK5 A;  2FCQ A;  1UEL A;  4ANU A;  5L83 A;  5J18 A;  3WIM A;  3M3J A;  4WWO A;  4FN2 A;  1CMX B;  3U8Z A;  3V6E B;  2BWF A;  3M62 B;  5LXI B;  2IY0 B;  1K8R B;  4MEL A;  3VH3 B;  4FJZ A;  1EO6 A;  2LJ5 A;  3RYT A;  1E8W A;  2JVC A;  2J0J A;  1GC6 A;  4IWO A;  4AP4 C;  4DBG A;  5LLI A;  2JF5 A;  2WDT B;  3AU4 A;  4ANW A;  1P3Q U;  4PS3 A;  3AXC A;  2D3G A;  3B1L X;  3VUX A;  1WYW B;  5KHO A;  2BPS A;  1WIA A;  2HJ8 A;  3PGE A;  4W9K A;  3UQB A;  1ZKH A;  2LI5 A;  2ZNV B;  4F7Z A;  1SE9 A;  4NQK E;  4M8M A;  4GB9 A;  4IM2 A;  2ZPN A;  3ZTC A;  4IWQ A;  3QAR A;  3TL5 A;  1WGG A;  2HTH A;  4MEM A;  4PYU A;  3ZNG C;  4HJK A;  3APF A;  4RMA A;  4W9L A;  3EHV A;  5D6J B;  2NBV B;  2MP2 B;  3RUI B;  3ZRC A;  1KLV A;  3SHQ A;  4HDQ A;  2N9P C;  2BYV E;  1WMH B;  2CHX A;  5E6P A;  3NHE B;  2O6V B;  3IG3 A;  2GBM A;  2DYO A;  4FJY A;  4II3 B;  2NS5 A;  2MBB B;  2NBU A;  4PS8 A;  3M63 B;  2IO1 B;  3VVW B;  5LXH A;  2K8H A;  2WWZ A;  2XK5 A;  4W9D A;  1WRD B;  3APD A;  1WGD A;  3ZDT A;  3L13 A;  4K7U A;  2MW5 A;  2KLG A;  1T0Y A;  3SU8 X;  4DHZ E;  3NZU A;  4WAA A;  2UWQ A;  2ZPY A;  1TBE A;  1Z2M A;  5L95 C;  1AAR A;  4RM9 A;  3A33 B;  2L05 A;  2EMS A;  3EFU A;  2RR9 A;  3VQI A;  4F1S A;  3T9L A;  2KDE B;  3A4R A;  4GOC A;  4DHJ B;  5J2R A;  4NPN A;  5CHF A;  3A9K A;  4X57 B;  2PEA A;  2KKC A;  3L08 A;  2C7H A;  2ZVO A;  3VHT C;  2RPQ A;  4KV2 A;  4AJW A;  1WM3 A;  4IW0 A;  5DCN A;  1J0G A;  1E5W A;  5DPW A;  4BOZ B;  3JYU A;  1TZ1 A;  2B3A A;  4TQ1 A;  2A5U A;  4KZC A;  1L2N A;  3QK0 A;  1V81 A;  4IC7 B;  4WQO B;  2JWZ A;  2N1W A;  1I35 A;  2DZM A;  3PT2 B;  5C23 A;  2N1V A;  3KUC B;  3QCA A;  2KD0 A;  2J0M A;  3VXW A;  1OEY A;  2NR2 A;  2M4N A;  5AEK B;  4NJ7 A;  4ZDV A;  1NBF C;  3VTW A;  3W1S A;  2KTR A;  4OVV A;  2JRI B;  1WH3 A;  3QIJ A;  4MGK E;  2M1M A;  1D3Z A;  4IG7 B;  1Z5S B;  2J0K A;  1TGZ B;  2FCN A;  3DBS A;  2KDI A;  2KC1 A;  2NPT B;  4KIK B;  4MGZ E;  2L3Z A;  4LJO B;  5J17 A;  2KC2 A;  4FBJ B;  1GNU A;  2C7N B;  2KK8 A;  3KUD B;  1P1A A;  4NQL B;  5CTR C;  3TCA A;  2KAN A;  4P7I A;  3VTV A;  2KFK A;  2KTF A;  1V5T A;  3APC A;  1IYF A;  1XQQ A;  3VUY A;  1JRU A;  1QZE A;  3OAW A;  3SD5 A;  1LQB A;  2BKR B;  4WJO A;  1WXA A;  2KWU B;  4GXB A;  5E6O A;  2DHZ A;  1NDD A;  3DQV A;  1WGR A;  2MX2 A;  4FUL A;  3GZN I;  2L00 B;  2KZR A;  3TBL D;  4IUM B;  4MGI E;  2DZK A;  4WJQ A;  2KFJ A;  1KJT A;  3I3T B;  3MHS D;  4ICU A;  3U30 A;  2LAS A;  2LZ6 A;  1WXM A;  3DBR I;  1EUV B;  5FR6 A;  1LFD A;  2ZNV C;  4BFR A;  3KYD D;  1WX8 A;  2ZEQ A;  3PSE B;  4FHJ A;  2NCN A;  3A9J A;  2EKE C;  2FUH B;  3KVF B;  3UIN B;  4TKN A;  4URK A;  4NNJ B;  2D11 A;  4F8C B;  3L10 B;  1I42 A;  1P0R A;  3VUW A;  3Q3J A;  4HPL B;  2ZZP B;  3ALB A;  5D2M B;  1UZX B;  3D32 A;  3Q3F A;  4MGY E;  4AOF A;  4XC2 A;  1WY8 A;  2AL6 A;  2AYO B;  2CR5 A;  2O6V D;  3ML9 A;  4NAW A;  3H1U A;  2MCN B;  2D2Q A;  1RLF A;  2O2V B;  1V86 A;  2N9X A;  3WAL A;  2MLB A;  4BKS A;  4PS7 A;  1YJ1 A;  4IM0 A;  2PJH A;  2C5L C;  3H7P B;  1OTR B;  1YQB A;  3UQA A;  4GDL B;  2MSE D;  3V62 A;  1WF9 A;  4M0W B;  5DPR A;  2OOB B;  4ZRJ A;  1KM7 A;  2ASQ A;  2LRW A;  3HM6 X;  2IY1 B;  3PVL A;  5DPT A;  3V61 A;  2V3S A;  2KO3 A;  4W9C A;  1SGH A;  1L7Y A;  2I1J A;  2O6V A;  4KDI C;  3A1Q A;  3DOW A;  3V60 A;  2DX5 B;  4DHJ D;  1V2Y A;  2L8J A;  4MJS A;  3PRE A;  3JW0 X;  5C1Z A;  2FID A;  3RUL A;  4HVB A;  3VDZ A;  1WXS A;  3DVG X;  1WZ3 A;  2W9N A;  2YLM A;  2GOW A;  4ZYN A;  4FAD A;  3TIX A;  3ZW3 A;  2LVP A;  3WA0 A;  1RRB A;  5HKH A;  2I1K A;  4K7W A;  2ZCC A;  3S2A A;  3X0W A;  4EUT A;  5BO4 B;  2K1F A;  1GUA B;  2ZCB A;  1V6E A;  2HE7 A;  3ZIM A;  1A5R A;  4GSW A;  3ZVV A;  1RFA A;  1C3T A;  1P9D U;  3WAN A;  2FAZ A;  2MRP A;  1V5O A;  2DZI A;  2N4F A;  2KOX A;  2MWS B;  2RSU A;  3ZKJ C;  4HK2 A;  1E8X A;  2V1Y A;  4GDK B;  3KW5 B;  2LVO A;  3LJ3 A;  4G50 A;  3PTF C;  4LJP B;  2K25 A;  3R3M A;  2D07 B;  2FCM A;  4OVU A;  3DCG A;  1V9J A;  5D94 A;  2MBO A;  1J19 A;  2CKH B;  4FLH A;  2GBR A;  4GMV A; 
#chains in the Genus database with same CATH topology
 1QQR A;  5IO9 A;  4B0M A;  1UNS A;  2E6X A;  3TJP A;  2PMV A;  4C00 A;  2LUE A;  2Y5B B;  1WE7 A;  3P4P B;  1SXT A;  4DWF A;  2V4I B;  2WX1 A;  3PPA A;  3SDL C;  2IPK D;  4K7S A;  2LGI A;  5BMI A;  3TMP B;  1FXA A;  2LXA A;  2WXH A;  3N20 C;  4P1B C;  1TKG A;  1WI0 A;  2JZP A;  3ZNI D;  2WXI A;  2BYT A;  3B9J A;  4JQW C;  2KAC A;  2LGS A;  1J7A A;  3DPD A;  2QHO A;  3QC8 B;  2KTR B;  5I4D A;  2V3P A;  2QIE B;  2KNB A;  3OLM D;  1E0Z A;  1WX9 A;  1WJU A;  3IHP C;  4BBN C;  4Q2J A;  2AL3 A;  3CF6 E;  1SSN A;  3U7D A;  3FAH A;  1F1H A;  3KWV A;  1TT5 B;  5JHA A;  3RZF A;  1YN5 A;  3BWU D;  4GN1 A;  4W9I A;  1FXT B;  5FKA C;  2KJH B;  1N6Z A;  3KYC D;  1KFY B;  2IO2 B;  4DDI D;  2KMC A;  2GRI A;  3DBR B;  1YX6 B;  3ZRF A;  2RMM A;  1E7V A;  2XN9 C;  3MC8 A;  5AZF A;  2AQ1 B;  2L83 A;  3A9J B;  1F0Z A;  4EZJ A;  2LXC A;  1L6V A;  3QQ8 B;  4RGM A;  2MP2 A;  4G0N B;  1S3S G;  1LM8 B;  1WMH A;  1HZ6 A;  2DYM A;  1HEZ E;  2C60 A;  4BBN F;  3RD2 A;  1JWA D;  1SJH D;  3V3X A;  2GMI C;  1E8Z A;  1UBQ A;  3AMZ A;  3IAM 1;  4REZ A;  2IYD B;  3P2B A;  4FA6 A;  2WX0 A;  4OW0 A;  5EDS A;  3ENE A;  3TEW A;  3SFE B;  3AEG B;  3SR6 A;  4GDK A;  1SEB D;  4E71 A;  3R7Q A;  4A3O A;  1U4A A;  4KSK C;  2PE6 B;  3L16 A;  4C4V A;  3A1Q B;  4KSL C;  2G45 B;  1QLB B;  4N58 A;  2TSS A;  4MJS B;  1WZ0 A;  4BAX A;  2WXN A;  1YD8 U;  1D4B A;  2LRU A;  2G1E A;  1QOF A;  3U52 E;  1NEN B;  2LD9 A;  1WGH A;  3SEB A;  2XK5 B;  2KDF B;  2KMA A;  5D3I B;  1XEE A;  2JZZ A;  1WSP A;  5G2N A;  3NJT A;  3RNA C;  4KX6 B;  2JYT A;  3CIR B;  3VH4 B;  1GC7 A;  1R4M I;  2CJO A;  4N9F 4;  2N9K A;  3ABV B;  3UIO B;  3NUH B;  1R4N I;  1GG3 A;  1KOT A;  1AYF A;  4YWG G;  2MQJ A;  2N7J A;  1T6B X;  1NI3 A;  4RM8 A;  1UGJ A;  3ZXR A;  3NS8 A;  1C1Y B;  2J52 A;  1HZ5 A;  1XCQ L;  1WJ4 A;  3Q69 A;  3WAM A;  5JZE B;  2AX5 A;  1EF1 A;  3LDZ E;  3QX1 A;  4LNO A;  2I2Y A;  1I4P A;  2BGF A;  1MPE A;  1QKZ A;  4RF1 A;  4ICV A;  3QA8 A;  3V6C B;  5AUK A;  3W2D A;  2WDQ B;  4UDU C;  2PW9 A;  1SIF A;  1G6J A;  4NJC A;  4JGH B;  3PZ8 A;  4LTU A;  2W55 A;  3DDC B;  2KX3 A;  1VZ8 A;  1QOA A;  4ZRI A;  4H2A A;  4FN2 A;  2JXT A;  1PUT A;  5LXI B;  1K8R B;  3RYT A;  3FIL B;  1E8W A;  2J0J A;  2JF5 A;  3AU4 A;  4OHJ A;  1WWT A;  1JAL A;  1I4H A;  2INC C;  2E3T A;  4PK1 A;  4XYC A;  3U7Z A;  1NYR A;  1XF5 L;  4W9K A;  2ZNV B;  4C80 A;  4LK0 M;  2LMC A;  4IM2 A;  3ZTC A;  1KH0 A;  2RDH A;  1WGG A;  2ZW1 A;  2MP2 B;  2KVZ A;  1L0Y B;  1WMH B;  2ON8 A;  2O6V B;  3BK2 A;  4K7U A;  2MW5 A;  1T0Y A;  2ZPY A;  1Z2M A;  3Q2A C;  3A33 B;  4DXF A;  5EE0 A;  3C8Y A;  3A4R A;  4RF0 A;  2J42 A;  3ZGZ A;  4TMA B;  2HJ1 A;  2PEA A;  1XLP A;  3R2T A;  3RNE C;  1NVI D;  3MP9 A;  4IW0 A;  2KYW A;  3JYU A;  4TQ1 A;  1TYG B;  2DZM A;  3P1M A;  3VRA B;  2J0M A;  1D5X C;  5JXV A;  3R8B A;  2M4N A;  3W1S A;  3VTW A;  1WH3 A;  5G5G A;  2FCN A;  3Q14 C;  4ZHP A;  4LJO B;  1GNU A;  2C7N B;  3KUD B;  5CTR C;  3VTV A;  1IYF A;  4N59 A;  4P1C C;  1YNT E;  3SD5 A;  1N62 A;  4WJO A;  1WXA A;  2KWU B;  2MX2 A;  4S17 A;  2KZR A;  3TBL D;  1MI0 A;  2DZK A;  2KDM A;  3RMK C;  2LAS A;  3DBR I;  4BFR A;  2PLP A;  2ZEQ A;  2EKE C;  2CJN A;  4AS1 A;  2Q5W D;  4TKN A;  3DBL B;  1L5P A;  1Q10 A;  3HVZ A;  2D11 A;  4URK A;  3L10 B;  1JQ4 A;  3VUW A;  1C9F A;  3Q3J A;  3R2I A;  3ALB A;  4M00 A;  4FXC A;  2O6V D;  2MJ3 A;  1RLF A;  2QIL A;  3UQA A;  3BYY B;  1DGJ A;  2LRW A;  3PVL A;  4W9C A;  4KDI C;  2QJL A;  4OZC A;  2DX5 B;  5C1Z A;  3RUL A;  2ONQ A;  2LJI A;  1WZ3 A;  1MG4 A;  4ZYN A;  3ZW3 A;  2I1K A;  2PVG C;  2ZCC A;  1ZP0 B;  4YTM B;  1OQR A;  1V6E A;  2HE7 A;  3BVM A;  1SBB B;  3VR8 B;  3DHI C;  4XGA B;  1V5O A;  2RSU A;  2DWQ A;  2MWS B;  3ZKJ C;  2D5G A;  3AEE B;  4HK2 A;  4G50 A;  3GP7 A;  3DWM A;  3PTF C;  1QT9 A;  2K25 A;  2D07 B;  4OVU A;  1J19 A;  1VZ7 A;  2KX0 A;  2KQ7 A;  1V8C A;  3VAW A;  4IKG A;  1I4X A;  1ZDV A;  3EEC A;  1V97 A;  1C77 A;  4MSQ B;  4IWP A;  4EOY A;  3PHW B;  1VDV A;  3GOE A;  1TKY A;  2W3R A;  1S1Q B;  3BY4 B;  3NZS A;  2R2O A;  4ANX A;  4RGO S;  1WRI A;  3QHT A;  4US8 A;  4PYZ A;  4K81 A;  4GGQ A;  1H8C A;  1X1M A;  2PTL A;  1DOX A;  4I6L B;  4LCD E;  1ROE A;  5HI1 A;  3E9S A;  3ECI A;  3P4Q B;  4HLE A;  2MJE A;  3OG5 A;  1N60 A;  4HKZ E;  2KXJ A;  4ZHO A;  1LGR A;  2MHJ A;  5EE1 A;  4HWI B;  4ITK A;  4LNF A;  2REX A;  2BT6 A;  4BZA A;  4E3C A;  1F9J A;  5IA7 A;  1EU3 A;  3KQ4 A;  3AEB B;  3GZN B;  1ZDX A;  3PS6 A;  3RNG C;  1UF0 A;  4MDK E;  3ML8 A;  1WM2 A;  2C9W B;  1YX5 B;  4XZ4 A;  3N1X C;  4AWJ A;  4BOS C;  1A70 A;  4XDC A;  3UIP B;  3O13 A;  3ONS A;  4KKJ A;  4FJV B;  1C4C A;  4JE3 B;  3ZQ4 A;  1C76 A;  4I6P A;  3R66 C;  4HCP B;  5HHD G;  2N7D A;  1EWC A;  2JUO A;  1KTK A;  1TS2 A;  4M01 A;  3MHZ A;  3CMM B;  1N61 A;  5FR3 A;  3IFW B;  3O65 B;  4EFO A;  1YJJ A;  4JLC A;  2Z0D B;  2YEP F;  1VD2 A;  1ET9 A;  4ASW C;  2CS4 A;  1IBX A;  1EF5 A;  2BKF A;  2IGD A;  3KH0 A;  3Q3N C;  1SF0 A;  1WX7 A;  4HDO A;  3L54 A;  4KGS A;  3DVN V;  4IM3 A;  4MAC A;  2G3Q B;  2LHE A;  2JY6 A;  2AQ2 B;  3NOB A;  2D10 A;  3QJZ A;  1Q1O A;  3ZDM C;  3PZD A;  3KWL A;  1GPX A;  1C78 A;  2FE8 A;  1UUP A;  1AWD A;  3L17 A;  1ESF A;  3L0W B;  1T3Q A;  4KIK A;  4HCN B;  1XT9 B;  4II2 B;  4M02 A;  1J7C A;  4BKT A;  4NAM A;  2DNF A;  4E74 A;  1K50 A;  3QAQ A;  2KAJ A;  1SB3 C;  5AZG A;  2VH2 A;  2J7Q B;  2MBQ A;  3GS2 A;  1M4V A;  3UF8 A;  1FCL A;  2BS4 B;  1PDX A;  2FCS A;  4KGR A;  4KDL B;  3ZUN A;  4R3D A;  2LGD A;  4I6N B;  5D7G A;  4YSZ B;  1WJ6 A;  2KJR A;  1PGA A;  2W3S A;  2RD0 A;  3EUB 2;  2M19 A;  3MC0 B;  3JSV A;  1JCK B;  2DAJ A;  1F52 A;  1ZW7 A;  3DBL I;  3HHM A;  5E6N A;  2ICI A;  3RN9 C;  3ZJT A;  2L1A A;  2K39 A;  3NVZ A;  2L0T A;  2V9H A;  1JWU D;  1KLU D;  4W9J A;  3N3K B;  2VZK B;  1YJI A;  2IBI B;  3NZ3 A;  3AH7 A;  3IVF A;  4W9H A;  3Q8E A;  4B9K A;  5G5H A;  1K52 A;  1HQR D;  4GU2 A;  2VH1 A;  1N5X A;  2CU1 A;  4CYE A;  1MG8 A;  3WAP A;  2OED A;  1UEL A;  5J18 A;  3WIM A;  3M3J A;  2LFI A;  1CMX B;  1CQV A;  4MT5 A;  2BWF A;  1FNW A;  3Q8A A;  1FXI A;  2WXF A;  3AEF B;  2WDR B;  1KF6 B;  2JVC A;  2Z8L A;  4IWO A;  4DBG A;  4YSX B;  4ZYS A;  2KN4 A;  1PFD A;  2D3G A;  4P6V F;  1I4R A;  4OZB A;  2QMT A;  1KLG D;  1WYW B;  1IUE A;  1TS3 A;  5T8I A;  4RH6 A;  3LB8 C;  1P7E A;  1ACC A;  4NQK E;  5EE9 A;  4GB9 A;  2ZPN A;  3ZNG C;  1KRH A;  3ZRC A;  4AQ7 A;  1KLV A;  1GOZ A;  3SHQ A;  2CHX A;  3NHE B;  2GBM A;  2WXK A;  3AEA B;  1SE2 A;  2WXO A;  3IXS A;  3M63 B;  4W9D A;  1WRD B;  3APD A;  5BYR A;  3NZU A;  4KGT A;  1AAR A;  1CK1 A;  2INP E;  1FCC C;  3EFU A;  3T9L A;  4GOC A;  4DHJ B;  5CHF A;  3A9K A;  1IBX B;  1V1O A;  2KKC A;  4ZRQ A;  1ZOY B;  2C7H A;  4KV2 A;  3DBH B;  1WM3 A;  2PVO D;  4BOZ B;  1TZ1 A;  2WGS A;  4KZC A;  1XO3 A;  4WUR A;  1MJD A;  4LLG M;  1I35 A;  4LNI A;  3KUC B;  3QCA A;  1BUI C;  2ZW0 A;  3VXW A;  3W9C B;  1FRD A;  2WXL A;  1ENF A;  1GB1 A;  2JRI B;  1P7F A;  3QIJ A;  2VZK D;  3NG0 A;  1NEK B;  2M1M A;  4MGK E;  1QF6 A;  1SJE D;  3P63 A;  2DBY A;  4IG7 B;  3NVY A;  3DBS A;  4KIK B;  2KC1 A;  5TSS A;  2L3Z A;  3Q6B A;  4NQL B;  1P1A A;  4QAY A;  3TCA A;  1V5T A;  1XQQ A;  1MHX A;  2JU6 X;  1LQB A;  2BKR B;  3DQV A;  1VRA B;  4FUL A;  3GZN I;  4J3O D;  4MGI E;  4KKI A;  4WJQ A;  1KJT A;  3RPF C;  3U30 A;  2WS3 B;  1WXM A;  1EUV B;  1LFD A;  2ZNV C;  1WX8 A;  4FHJ A;  4YT0 B;  3UIN B;  4NNJ B;  1I42 A;  1F2R I;  1P0R A;  2UU7 A;  1FNU A;  5H92 C;  5IKC M;  2ZZP B;  5D2M B;  5EE3 A;  1V1P A;  3D32 A;  1FFV A;  4MGY E;  4RGN A;  5BMG A;  2CR5 A;  4NAW A;  2MCN B;  2B76 B;  3AE4 B;  1V86 A;  4WQM A;  2N9X A;  1XCT L;  2MLB A;  1FPY A;  4IM0 A;  2PJH A;  5DPR A;  5MPO A;  2OOB B;  2ASQ A;  3HM6 X;  1SGH A;  1L7Y A;  1T5X D;  3BZD B;  3UI3 A;  3DOW A;  4DHJ D;  1JWB D;  3JW0 X;  3NS1 A;  3KLS X;  1DOI A;  4ARI A;  3EGR A;  1WXS A;  1FM0 D;  2W9N A;  2YLM A;  4LNN A;  1ZE3 D;  3URY A;  1T0S C;  2LVP A;  3WA0 A;  1RRB A;  5D3D A;  2MJD A;  3S2A A;  3X0W A;  2D3A A;  3AE5 B;  3LXF A;  4EUT A;  2ZCB A;  1FNV A;  3ZVV A;  2FAZ A;  2KOX A;  2D3C A;  4RGT A;  2AQ3 B;  4GDK B;  3LJ3 A;  3ZYY X;  4C4V B;  2HDE A;  1HTO A;  1Y56 A;  1YOV B;  4FLH A;  2GBR A;  4ANW A;  2H89 B;  4LDT B;  2V3N A;  2IO0 B;  2KT7 A;  4GIV A;  3MTN B;  2KWC A;  2W54 A;  3VFK A;  1C79 A;  2BF8 B;  2KQS A;  1OEY J;  3BVG A;  2WNM A;  1IGC A;  3Q8F A;  2WYQ A;  2JXX A;  5GMV A;  5JH5 C;  3M95 A;  3UGB B;  2OJW A;  3A9K B;  1WR1 A;  1WE6 A;  2N9L A;  2LEK A;  1XXG A;  2JT4 B;  3HM3 A;  5TR5 A;  1EWY C;  3U2S C;  3PZ7 A;  1GB4 A;  2HD5 B;  2R61 A;  4W9F A;  4DHZ B;  2WXP A;  3ZNZ B;  3ZTD A;  1ISN A;  1WXV A;  2KDB A;  2Z59 B;  2AWT A;  2KMM A;  3ZJU A;  2EKI A;  2INN E;  4AUQ C;  2K8C A;  2J53 A;  2IZV B;  2JRH A;  4TQ0 A;  1Y8R C;  3N30 A;  3BYT B;  2MBH A;  1RFK A;  1VR9 A;  4MM3 A;  3PLU A;  1PQS A;  4GDL A;  1HTQ A;  2A4Z A;  1MVK A;  3AE3 B;  4HPM B;  4LNK A;  1VJK A;  1EM7 A;  2IJ0 A;  1C4A A;  1UD7 A;  3RCZ A;  2JWU A;  2N7E A;  2BQQ A;  1QOB A;  1TTN A;  1HE8 A;  2QDF A;  3ZO5 B;  2R2Q A;  4M8N A;  1V1P B;  1J8C A;  2KQ4 X;  4NAW B;  2OHF A;  4HRS A;  4EZL A;  5IAA C;  2AEH A;  4ZOH C;  4ANV A;  2FIF A;  4B6W A;  4FHK A;  4HXD A;  4LDT D;  4WWN A;  1C4P A;  3VTU A;  3BVZ A;  1AN8 A;  4WWP A;  2DYB A;  3RNF C;  3C0R B;  3RT3 B;  5CHV C;  2Z0E B;  4IOI E;  1Q0W B;  3EFC A;  2K6D B;  2X38 A;  3IBE A;  4MSM B;  3Q8B A;  3HUI A;  1TY0 A;  4WIP A;  1AW7 A;  2BVC A;  3DBH I;  2N9E B;  3Q3O C;  1FD6 A;  1TY2 A;  3RFZ B;  1NI2 A;  4EKU A;  3AU5 A;  2JX5 A;  3B0A A;  2XNA C;  2M0X A;  1JML A;  1WR6 E;  2MBE A;  2WHI A;  2EEL A;  3GE8 C;  3W1S C;  2C7M B;  1WJN A;  3AM9 A;  2UYZ B;  1E7U A;  4W9G A;  1WYG A;  2ZJD A;  4XX5 A;  3DVG Y;  1ZPS A;  5CX3 A;  3HRD D;  3N1Z C;  1TS4 A;  2NTS A;  1VZ6 A;  1YQ3 B;  4RNA A;  1UGM A;  3W1Y A;  2FNJ B;  5HFY A;  1IGD A;  4EZK A;  2PPH A;  3HK0 A;  4USA A;  1UBI A;  2BYE A;  3PHX B;  2OJR A;  2K8B A;  2CHW A;  2KWV B;  5AZH A;  3CST A;  1YMH E;  1L6U A;  4A3P A;  4YTP B;  3ZLZ A;  1D6E C;  2GBJ A;  5H8Y E;  4RFB A;  2M17 A;  2LVQ A;  1XLQ A;  1P98 A;  4L23 A;  1ZXH A;  3WAO A;  2DZJ A;  1MHH E;  3X23 A;  2LUM A;  3R7R A;  3T3O A;  3PV1 A;  4K1R B;  3H6N A;  5BYS A;  3TEY A;  4KVG B;  3JVZ X;  3RNB C;  4DXA B;  1UH6 A;  5DPS A;  4M0W A;  2G4D B;  1PGB A;  2KHW B;  3ZNH B;  4B95 A;  1Q5W B;  4DK5 A;  2FCQ A;  4ANU A;  5L83 A;  2IGH A;  4WWO A;  2GB1 A;  3U8Z A;  3NVW A;  2Y3A A;  2IY0 B;  1EO6 A;  2LJ5 A;  2WDT B;  1P3Q U;  3TEX A;  3VUX A;  5KHO A;  4MM3 B;  2HJ8 A;  4B0E A;  3AE8 B;  1ZKH A;  1HXY D;  4S0R A;  4IWQ A;  3TL5 A;  3CWI A;  4PYU A;  4HJK A;  3APF A;  4W9L A;  2Y5P A;  3EHV A;  1N5W A;  3RUI B;  2YEP B;  4K3C A;  4HDQ A;  2DLB A;  3PO0 A;  2BYV E;  5E6P A;  3VRB B;  1EU4 A;  4ZRP A;  2NS5 A;  3HVD A;  2MBB B;  2NBU A;  2WWZ A;  2XK5 A;  1N63 A;  3C19 A;  4WAA A;  1TBE A;  3OWE B;  2RR9 A;  4JWU C;  4F1S A;  2KDE B;  5J2R A;  1JWM D;  1OFF A;  2ZVO A;  2RPQ A;  4HRO A;  2PIA A;  3B2G A;  2B3A A;  4WQO B;  4C7Z A;  3WCQ A;  2KD0 A;  4DXG A;  2W82 A;  2NR2 A;  2WXM A;  3TSS A;  1YN3 A;  2BS3 B;  4ACF A;  3GB1 A;  4DQO C;  1Z5S B;  1TGZ B;  4MGZ E;  4CQN A;  2KC2 A;  4FBJ B;  1F77 A;  3W5V B;  1K53 A;  3E56 A;  4P7I A;  2KFK A;  4A9A A;  2BTE A;  3APC A;  1LO5 D;  3VUY A;  2GI9 A;  1JRU A;  2L32 A;  1QZE A;  3OAW A;  5E6O A;  1NDD A;  1WGR A;  2L00 B;  4IUM B;  2QEJ C;  2M0A A;  3I3T B;  4ICU A;  1STE A;  2LZ6 A;  5FR6 A;  3PSE B;  4P16 A;  2NCN A;  2MH7 A;  5IOI A;  2WQY B;  3P42 A;  3FIL A;  4XE0 A;  1YQ4 B;  4XC2 A;  1WY8 A;  3Q8C A;  2AL6 A;  2WLB A;  2AYO B;  3ML9 A;  1B1Z A;  3DWG C;  4BKS A;  4PS7 A;  4WH4 A;  2C5L C;  3N9Y C;  4C56 C;  1YQB A;  2MSE D;  4M0W B;  1I4Q A;  2IY1 B;  2V0G A;  3V61 A;  2V3S A;  2I38 A;  2O6V A;  3V60 A;  4D2K A;  2L8J A;  3PRE A;  4GLS C;  2FID A;  2JQR B;  3FKY A;  3DVG X;  2GOW A;  4FAD A;  1T0Q C;  1E6E B;  2RDG A;  4YTN B;  1T0R C;  5BO4 B;  2BBC A;  2WP9 B;  1GUA B;  4NZL B;  1CZP A;  3ZIM A;  1A5R A;  1E7P B;  4GSW A;  1P9D U;  2MRP A;  2SAK A;  2DZI A;  1SIJ A;  1E8X A;  1TJE A;  2V1Y A;  3AE6 B;  1TZO A;  1L4Z B;  1TKE A;  3R3M A;  4L2Y A;  2K0P A;  2FCM A;  3DCG A;  2SEB D;  1V9J A;  5D94 A;  1XLN A;  2MBO A;  2CKH B;  4MH8 A;  1BXT A;  4IDI A;  1D5Z C;  2GBN A;  4A20 A;  3B08 A;  2Y5C A;  3DHH C;  2BYF A;  1RM6 C;  1NYQ A;  4HEA 1;  2WDV B;  3DHG C;  2WXQ A;  5KHQ A;  1OQY A;  2KN5 A;  1YN4 A;  2MA9 B;  3MC9 A;  2K3U A;  2PE9 A;  2JZ3 B;  4YSY B;  3GE3 C;  5FK9 C;  2L0F A;  3NRZ A;  1H4R A;  1IP9 A;  3K9O B;  3H9D A;  3AE9 B;  1B9R A;  2KJ6 A;  3BII D;  3NVV A;  3IT6 B;  1V80 A;  2G4S A;  3H7S A;  4A8X C;  4XWT A;  3J9C A;  2RPV A;  2DEN B;  2L7R A;  3A4S C;  4JX1 C;  5GXG B;  4DDG D;  4AJY B;  3JSV B;  1JRO A;  4JIO U;  4CHK A;  2KFK B;  3SFD B;  1FFU A;  1FMA D;  1JWS D;  3ETR A;  4BVU C;  4WJP A;  2J4X A;  1I7H A;  4G11 A;  4K3B A;  2VRR B;  3VR9 B;  3AE7 B;  3PRZ A;  2WXJ A;  1WGY A;  1XD3 B;  2IND C;  3I57 A;  3KUZ A;  3L4P A;  3T8M A;  2WXG A;  2FUG 1;  4HKQ A;  5G55 A;  4KZ0 A;  2KVR A;  1OGW A;  1E90 A;  2BB5 A;  2MEK A;  2NVU I;  4G3X B;  4HJG E;  2K6Q A;  5LNK 1;  1E8Y A;  3EA6 A;  3OJ4 B;  2L76 A;  2WXR A;  2RDB C;  3OJ3 A;  3TUO A;  4NJ6 A;  2JPH A;  4YL8 A;  3I9V 1;  2N0S B;  1GAQ B;  1I4G A;  3AED B;  3AV8 A;  5BMH A;  1J7B A;  1WFY A;  4ZRK A;  3TEZ A;  3U4E G;  5C2T B;  1M94 A;  2LGY A;  3RZW C;  3W5U B;  5HG2 A;  3PLV A;  2M8S A;  3EC8 A;  1IPG A;  1CJE A;  2JSV X;  2XBB C;  4JL9 A;  4W9E A;  2V4L A;  2BW2 A;  1DOY A;  4L1B A;  3AUL A;  2DAF A;  3HIZ A;  1BML C;  5JHB A;  1HA5 A;  4MH0 E;  1BT0 A;  4OVZ A;  2NBW B;  2IDY A;  5C3J B;  2NPT A;  4N6E B;  4NY0 A;  2WU5 B;  3CSF A;  1ZUD 2;  4ARC A;  2WU2 B;  1DYQ A;  1RAX A;  3N32 A;  3K9P B;  2EMT A;  1UWM A;  1JRP A;  4RCO A;  4TUU A;  3BIN A;  1YIW A;  2BS2 B;  1L0X B;  1QIL A;  2ACZ B;  4J6I A;  2LHD A;  1JW9 D;  3I5J C;  2XEW A;  2RGF A;  4CO7 A;  1K51 A;  4TSS A;  3NY5 A;  1VCB A;  3MFG A;  1GJZ A;  2YVC A;  1E9M A;  1ZGU B;  4EEW A;  4BKG A;  3QWZ B;  3PRP B;  1LXD A;  2GBK A;  4TV3 A;  2LWP A;  4XWW A;  3BK1 A;  3PRM B;  1FO4 A;  3DVN U;  3IT4 B;  4HPP A;  2BWE S;  4JWS C;  1ET6 A;  2O2V A;  4C7Y A;  3AI5 A;  2LGX A;  3MJW A;  3H7P A;  2KLC A;  2CHZ A;  4BKS D;  4WAF A;  2ZVN A;  5CHW A;  4WJN A;  1V49 A;  2IO3 B;  3V6E B;  3M62 B;  3VH3 B;  4MEL A;  4FJZ A;  3AE2 B;  3RI7 C;  4AP4 C;  1GC6 A;  2CU3 A;  5E6J A;  5LLI A;  4PS3 A;  3AXC A;  3B1L X;  3AE1 B;  2BPS A;  2NMQ A;  1WIA A;  3PGE A;  3UQB A;  2LI5 A;  2BB6 A;  4F7Z A;  1SE9 A;  4M8M A;  2L52 A;  2NTT A;  3QAR A;  2HTH A;  2PKO A;  4MEM A;  1FRR A;  1E10 A;  1L0V B;  2QSD A;  4RMA A;  5D6J B;  2NBV B;  2N9P C;  3IG3 A;  2DYO A;  3MJ5 A;  4FJY A;  4II3 B;  4PS8 A;  3VVW B;  2IO1 B;  5LXH A;  2K8H A;  3ZDT A;  1WGD A;  4OZA A;  2G9H D;  3L13 A;  2KLG A;  3B2F A;  3SU8 X;  4DHZ E;  2KWD A;  2UWQ A;  4A55 A;  1WGK A;  5L95 C;  4RM9 A;  2L05 A;  2EMS A;  3VQI A;  2GLS A;  4NPN A;  4X57 B;  2QCZ A;  3L08 A;  3VHT C;  2IGG A;  3ZJV A;  5AUI A;  4AJW A;  1J0G A;  5DCN A;  1E5W A;  5DPW A;  1L2N A;  2A5U A;  1MFW A;  3QK0 A;  1V81 A;  4IC7 B;  1PGX A;  3H8H A;  2JWZ A;  2N1W A;  3AB5 A;  3PT2 B;  5C23 A;  3V05 A;  2N1V A;  3I63 C;  3RNC C;  1OEY A;  5AEK B;  3FC4 A;  4NJ7 A;  4ZDV A;  1NBF C;  2KTR A;  1TIF A;  4OVV A;  2H88 B;  3P4S B;  2HTM E;  1D3Z A;  1R4M B;  2J0K A;  2KDI A;  2NPT B;  5J17 A;  1R4N B;  2KK8 A;  1QOG A;  1F2R C;  2X8X X;  2KAN A;  2KTF A;  3IAS 1;  2D3B A;  3N1Y C;  4GXB A;  2DHZ A;  1SE3 A;  2K9X A;  2KFJ A;  3MHS D;  1L4D B;  1OQQ A;  1UWX A;  3KYD D;  3A9J A;  4WWM A;  2FUH B;  3P4R B;  3KVF B;  4F8C B;  1PYW D;  1XLO A;  4HPL B;  1FEH A;  3T3N A;  1UZX B;  1RWS A;  4YXD B;  4A6Q A;  2JYE A;  3Q3F A;  4AOF A;  5BYQ A;  3H1U A;  3AEC B;  2D2Q A;  2O2V B;  1ZXI A;  1RYJ A;  3WAL A;  4A90 A;  1YJ1 A;  3H7P B;  1OTR B;  4GDL B;  4O1N A;  3V62 A;  1WF9 A;  3LYY A;  2K22 A;  4XDD A;  4ZRJ A;  1KM7 A;  1VLB A;  2FBW B;  1SE4 A;  5DPT A;  2KO3 A;  5IN7 A;  2K5P A;  2I1J A;  3Q3M C;  3A1Q A;  1D5M C;  1V2Y A;  4JPS A;  4MJS A;  4PT5 A;  4HVB A;  3VDZ A;  3TIX A;  5HKH A;  1R7S A;  4K7W A;  1TS5 A;  1WXQ A;  2K1F A;  2M56 B;  1C3T A;  1RFA A;  4US9 A;  3WAN A;  2N4F A;  4EE2 A;  3KW5 B;  2LVO A;  3ZXV A;  5IP4 D;  4LJP B;  2QC8 A;  1FIQ A;  3AN1 A;  4GMV A; 
#chains in the Genus database with same CATH homology
 4A20 A;  2GBN A;  4LDT B;  2KX0 A;  2KQ7 A;  2IO0 B;  4GIV A;  3B08 A;  3MTN B;  2BYF A;  2KWC A;  3VAW A;  3VFK A;  3TJP A;  3EEC A;  2BF8 B;  2KQS A;  2LUE A;  2Y5B B;  1OEY J;  1WE7 A;  4MSQ B;  2WYQ A;  2JXX A;  5GMV A;  4IWP A;  5JH5 C;  4EOY A;  4DWF A;  5KHQ A;  2WX1 A;  3PHW B;  3PPA A;  3SDL C;  4K7S A;  1OQY A;  3GOE A;  3M95 A;  3UGB B;  3A9K B;  1S1Q B;  3TMP B;  2KN5 A;  3BY4 B;  2LXA A;  3NZS A;  2R2O A;  4ANX A;  2MA9 B;  3QHT A;  2PE9 A;  2JZ3 B;  1WI0 A;  1WR1 A;  4PYZ A;  4K81 A;  4GGQ A;  1H8C A;  1WE6 A;  3ZNI D;  1X1M A;  2L0F A;  4I6L B;  4JQW C;  4LCD E;  1H4R A;  2JT4 B;  1IP9 A;  3K9O B;  3H9D A;  3HM3 A;  5TR5 A;  3ECI A;  2KJ6 A;  3DPD A;  1V80 A;  2QHO A;  3QC8 B;  4HLE A;  2G4S A;  2KTR B;  2HD5 B;  3H7S A;  2KNB A;  2KXJ A;  3OLM D;  4W9F A;  2DEN B;  1WX9 A;  1WJU A;  4DHZ B;  3ZNZ B;  3ZTD A;  3IHP C;  1ISN A;  2L7R A;  3A4S C;  4HWI B;  1WXV A;  2KDB A;  2Z59 B;  4DDG D;  4AJY B;  4BBN C;  3JSV B;  2AL3 A;  3CF6 E;  3U7D A;  2AWT A;  4JIO U;  4CHK A;  2REX A;  5JHA A;  4AUQ C;  2K8C A;  3RZF A;  1F9J A;  4E3C A;  2KFK B;  4GN1 A;  5IA7 A;  2IZV B;  4BVU C;  4WJP A;  2JRH A;  4W9I A;  1FXT B;  4TQ0 A;  1Y8R C;  4G11 A;  3N30 A;  2KJH B;  3PS6 A;  3KYC D;  2MBH A;  4MDK E;  2VRR B;  3ML8 A;  1WM2 A;  3PRZ A;  2C9W B;  1YX5 B;  4XZ4 A;  2IO2 B;  4DDI D;  2KMC A;  4MM3 A;  1YX6 B;  3PLU A;  1PQS A;  4GDL A;  3ZRF A;  1WGY A;  4AWJ A;  4BOS C;  1XD3 B;  3KUZ A;  2A4Z A;  3UIP B;  4HPM B;  3ONS A;  3T8M A;  1E7V A;  5AZF A;  4FJV B;  1UD7 A;  3A9J B;  3RCZ A;  4EZJ A;  2LXC A;  3QQ8 B;  2N7E A;  2MP2 A;  5G55 A;  4G0N B;  4KZ0 A;  1S3S G;  2KVR A;  1LM8 B;  1WMH A;  1OGW A;  1TTN A;  1HE8 A;  3ZO5 B;  1E90 A;  4I6P A;  2R2Q A;  2NVU I;  3R66 C;  4G3X B;  4HCP B;  4M8N A;  2DYM A;  1J8C A;  2N7D A;  2K6Q A;  1E8Y A;  2C60 A;  2JUO A;  4BBN F;  3OJ4 B;  4NAW B;  2L76 A;  3RD2 A;  4EZL A;  2GMI C;  2AEH A;  5IAA C;  4ANV A;  2FIF A;  1E8Z A;  3CMM B;  4B6W A;  4FHK A;  4HXD A;  3OJ3 A;  3IFW B;  3O65 B;  4NJ6 A;  4LDT D;  4WWN A;  4EFO A;  1UBQ A;  2JPH A;  4YL8 A;  4JLC A;  2IYD B;  2Z0D B;  3P2B A;  3VTU A;  4FA6 A;  2WX0 A;  1VD2 A;  5EDS A;  3ENE A;  1WFY A;  4WWP A;  4ZRK A;  4ASW C;  2DYB A;  4GDK A;  3C0R B;  4E71 A;  3RT3 B;  5CHV C;  3R7Q A;  2CS4 A;  4A3O A;  1M94 A;  2LGY A;  1U4A A;  1EF5 A;  2BKF A;  2PE6 B;  2Z0E B;  3L16 A;  4KSK C;  1Q0W B;  3PLV A;  3RZW C;  3A1Q B;  3KH0 A;  4KSL C;  2G45 B;  2M8S A;  1WX7 A;  3EC8 A;  3L54 A;  2K6D B;  3DVN V;  3IBE A;  1IPG A;  4HDO A;  4IM3 A;  4MJS B;  4MSM B;  1WZ0 A;  1YD8 U;  2G3Q B;  2XBB C;  3DBH I;  4JL9 A;  2JY6 A;  2LRU A;  3NOB A;  2D10 A;  2LD9 A;  3QJZ A;  2N9E B;  1WGH A;  4W9E A;  2V4L A;  2XK5 B;  1Q1O A;  2KDF B;  3AUL A;  3ZDM C;  2KMA A;  3PZD A;  2DAF A;  3HIZ A;  1NI2 A;  4EKU A;  3AU5 A;  5JHB A;  4MH0 E;  1BT0 A;  3B0A A;  2JZZ A;  2M0X A;  1WR6 E;  2MBE A;  5G2N A;  3L17 A;  3W1S C;  2NBW B;  2C7M B;  3L0W B;  1WJN A;  4KIK A;  4HCN B;  1XT9 B;  2NPT A;  2UYZ B;  1E7U A;  4II2 B;  4W9G A;  3VH4 B;  4NY0 A;  1GC7 A;  2ZJD A;  1R4M I;  4XX5 A;  3DVG Y;  3CSF A;  4BKT A;  4N9F 4;  4E74 A;  5CX3 A;  1RAX A;  3UIO B;  3N32 A;  3QAQ A;  1R4N I;  3K9P B;  1GG3 A;  2EMT A;  1UGM A;  3W1Y A;  5AZG A;  2FNJ B;  2J7Q B;  4TUU A;  4EZK A;  2PPH A;  3BIN A;  3HK0 A;  1YIW A;  1KOT A;  1UBI A;  2MBQ A;  2MQJ A;  3UF8 A;  4J6I A;  2BYE A;  2FCS A;  3PHX B;  2OJR A;  2K8B A;  2CHW A;  2KWV B;  4RM8 A;  5AZH A;  2XEW A;  4KDL B;  2RGF A;  3ZUN A;  3NS8 A;  4CO7 A;  3CST A;  1C1Y B;  2LGD A;  4I6N B;  5D7G A;  1WJ6 A;  2KJR A;  4A3P A;  3ZLZ A;  2RD0 A;  3NY5 A;  2GBJ A;  1VCB A;  1WJ4 A;  1GJZ A;  2YVC A;  2M17 A;  3JSV A;  2LVQ A;  1P98 A;  1ZGU B;  3WAM A;  2DAJ A;  4EEW A;  5JZE B;  4BKG A;  1EF1 A;  3LDZ E;  3QX1 A;  3QWZ B;  3PRP B;  2BGF A;  1LXD A;  3WAO A;  2GBK A;  4TV3 A;  2DZJ A;  1ZW7 A;  2LWP A;  3DBL I;  3HHM A;  3PRM B;  4ICV A;  5E6N A;  3X23 A;  3QA8 A;  3DVN U;  3V6C B;  2BWE S;  3R7R A;  2K39 A;  3PV1 A;  4K1R B;  2L0T A;  4W9J A;  3N3K B;  2O2V A;  3H6N A;  2IBI B;  1SIF A;  4KVG B;  1G6J A;  3AI5 A;  2LGX A;  3IVF A;  3JVZ X;  4DXA B;  3MJW A;  4W9H A;  3H7P A;  4B9K A;  1UH6 A;  2KLC A;  2CHZ A;  4JGH B;  4GU2 A;  3DDC B;  5DPS A;  2CU1 A;  2G4D B;  2KX3 A;  4BKS D;  4CYE A;  2KHW B;  2ZVN A;  4ZRI A;  3ZNH B;  1MG8 A;  5CHW A;  1Q5W B;  3WAP A;  4WJN A;  1V49 A;  4B95 A;  2IO3 B;  4DK5 A;  2FCQ A;  1UEL A;  4ANU A;  5L83 A;  5J18 A;  3WIM A;  3M3J A;  4WWO A;  4FN2 A;  1CMX B;  3U8Z A;  3V6E B;  2BWF A;  3M62 B;  5LXI B;  2IY0 B;  1K8R B;  4MEL A;  3VH3 B;  4FJZ A;  1EO6 A;  2LJ5 A;  3RYT A;  1E8W A;  2JVC A;  2J0J A;  1GC6 A;  4IWO A;  4AP4 C;  4DBG A;  5LLI A;  2JF5 A;  2WDT B;  3AU4 A;  4ANW A;  1P3Q U;  4PS3 A;  3AXC A;  2D3G A;  3B1L X;  3VUX A;  1WYW B;  5KHO A;  2BPS A;  1WIA A;  2HJ8 A;  3PGE A;  4W9K A;  3UQB A;  1ZKH A;  2LI5 A;  2ZNV B;  4F7Z A;  1SE9 A;  4NQK E;  4M8M A;  4GB9 A;  4IM2 A;  2ZPN A;  3ZTC A;  4IWQ A;  3QAR A;  3TL5 A;  1WGG A;  2HTH A;  4MEM A;  4PYU A;  3ZNG C;  4HJK A;  3APF A;  4RMA A;  4W9L A;  3EHV A;  5D6J B;  2NBV B;  2MP2 B;  3RUI B;  3ZRC A;  1KLV A;  3SHQ A;  4HDQ A;  2N9P C;  2BYV E;  1WMH B;  2CHX A;  5E6P A;  3NHE B;  2O6V B;  3IG3 A;  2GBM A;  2DYO A;  4FJY A;  4II3 B;  2NS5 A;  2MBB B;  2NBU A;  4PS8 A;  3M63 B;  2IO1 B;  3VVW B;  5LXH A;  2K8H A;  2WWZ A;  2XK5 A;  4W9D A;  1WRD B;  3APD A;  1WGD A;  3ZDT A;  3L13 A;  4K7U A;  2MW5 A;  2KLG A;  1T0Y A;  3SU8 X;  4DHZ E;  3NZU A;  4WAA A;  2UWQ A;  2ZPY A;  1TBE A;  1Z2M A;  5L95 C;  1AAR A;  4RM9 A;  3A33 B;  2L05 A;  2EMS A;  3EFU A;  2RR9 A;  3VQI A;  4F1S A;  3T9L A;  2KDE B;  3A4R A;  4GOC A;  4DHJ B;  5J2R A;  4NPN A;  5CHF A;  3A9K A;  4X57 B;  2PEA A;  2KKC A;  3L08 A;  2C7H A;  2ZVO A;  3VHT C;  2RPQ A;  4KV2 A;  4AJW A;  1WM3 A;  4IW0 A;  5DCN A;  1J0G A;  1E5W A;  5DPW A;  4BOZ B;  3JYU A;  1TZ1 A;  2B3A A;  4TQ1 A;  2A5U A;  4KZC A;  1L2N A;  3QK0 A;  1V81 A;  4IC7 B;  4WQO B;  2JWZ A;  2N1W A;  1I35 A;  2DZM A;  3PT2 B;  5C23 A;  2N1V A;  3KUC B;  3QCA A;  2KD0 A;  2J0M A;  3VXW A;  1OEY A;  2NR2 A;  2M4N A;  5AEK B;  4NJ7 A;  4ZDV A;  1NBF C;  3VTW A;  3W1S A;  2KTR A;  4OVV A;  2JRI B;  1WH3 A;  3QIJ A;  4MGK E;  2M1M A;  1D3Z A;  4IG7 B;  1Z5S B;  2J0K A;  1TGZ B;  2FCN A;  3DBS A;  2KDI A;  2KC1 A;  2NPT B;  4KIK B;  4MGZ E;  2L3Z A;  4LJO B;  5J17 A;  2KC2 A;  4FBJ B;  1GNU A;  2C7N B;  2KK8 A;  3KUD B;  1P1A A;  4NQL B;  5CTR C;  3TCA A;  2KAN A;  4P7I A;  3VTV A;  2KFK A;  2KTF A;  1V5T A;  3APC A;  1IYF A;  1XQQ A;  3VUY A;  1JRU A;  1QZE A;  3OAW A;  3SD5 A;  1LQB A;  2BKR B;  4WJO A;  1WXA A;  2KWU B;  4GXB A;  5E6O A;  2DHZ A;  1NDD A;  3DQV A;  1WGR A;  2MX2 A;  4FUL A;  3GZN I;  2L00 B;  2KZR A;  3TBL D;  4IUM B;  4MGI E;  2DZK A;  4WJQ A;  2KFJ A;  1KJT A;  3I3T B;  3MHS D;  4ICU A;  3U30 A;  2LAS A;  2LZ6 A;  1WXM A;  3DBR I;  1EUV B;  5FR6 A;  1LFD A;  2ZNV C;  4BFR A;  3KYD D;  1WX8 A;  2ZEQ A;  3PSE B;  4FHJ A;  2NCN A;  3A9J A;  2EKE C;  2FUH B;  3KVF B;  3UIN B;  4TKN A;  4URK A;  4NNJ B;  2D11 A;  4F8C B;  3L10 B;  1I42 A;  1P0R A;  3VUW A;  3Q3J A;  4HPL B;  2ZZP B;  3ALB A;  5D2M B;  1UZX B;  3D32 A;  3Q3F A;  4MGY E;  4AOF A;  4XC2 A;  1WY8 A;  2AL6 A;  2AYO B;  2CR5 A;  2O6V D;  3ML9 A;  4NAW A;  3H1U A;  2MCN B;  2D2Q A;  1RLF A;  2O2V B;  1V86 A;  2N9X A;  3WAL A;  2MLB A;  4BKS A;  4PS7 A;  1YJ1 A;  4IM0 A;  2PJH A;  2C5L C;  3H7P B;  1OTR B;  1YQB A;  3UQA A;  4GDL B;  2MSE D;  3V62 A;  1WF9 A;  4M0W B;  5DPR A;  2OOB B;  4ZRJ A;  1KM7 A;  2ASQ A;  2LRW A;  3HM6 X;  2IY1 B;  3PVL A;  5DPT A;  3V61 A;  2V3S A;  2KO3 A;  4W9C A;  1SGH A;  1L7Y A;  2I1J A;  2O6V A;  4KDI C;  3A1Q A;  3DOW A;  3V60 A;  2DX5 B;  4DHJ D;  1V2Y A;  2L8J A;  4MJS A;  3PRE A;  3JW0 X;  5C1Z A;  2FID A;  3RUL A;  4HVB A;  3VDZ A;  1WXS A;  3DVG X;  1WZ3 A;  2W9N A;  2YLM A;  2GOW A;  4ZYN A;  4FAD A;  3TIX A;  3ZW3 A;  2LVP A;  3WA0 A;  1RRB A;  5HKH A;  2I1K A;  4K7W A;  2ZCC A;  3S2A A;  3X0W A;  4EUT A;  5BO4 B;  2K1F A;  1GUA B;  2ZCB A;  1V6E A;  2HE7 A;  3ZIM A;  1A5R A;  4GSW A;  3ZVV A;  1RFA A;  1C3T A;  1P9D U;  3WAN A;  2FAZ A;  2MRP A;  1V5O A;  2DZI A;  2N4F A;  2KOX A;  2MWS B;  2RSU A;  3ZKJ C;  4HK2 A;  1E8X A;  2V1Y A;  4GDK B;  3KW5 B;  2LVO A;  3LJ3 A;  4G50 A;  3PTF C;  4LJP B;  2K25 A;  3R3M A;  2D07 B;  2FCM A;  4OVU A;  3DCG A;  1V9J A;  5D94 A;  2MBO A;  1J19 A;  2CKH B;  4FLH A;  2GBR A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...