4MELA

Crystal structure of the human usp11 dusp-ubl domains
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
LPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
total genus 44
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4melA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4melA01
3TL5A 2N1WA 1WXAA 1R4NI 1WJUA 1UH6A 2AL6A 4B95A 3ZDTA 2VRRB 2KDFB 2O2VA 3PLVA 4NQKE 3K9PB 2W9NA 2IO2B 1BT0A 2KTRA 4TV3A 1EUVB 1JRUA 1YD8U 3QHTA 3M63B 3A9KB 3QAQA 5GMVA 2KJHB 3JW0X 2JVCA 2DZMA 2FNJB 3ZNGC 3DVGX 4BOZB 3B1LX 4RM9A 2GBKA 4OVUA 1WX8A 3H7PA 4PS3A 5G55A 2K6DB 2NVUI 4FULA 3UIPB 3ML9A 3ZLZA 3QC8B 4DHZB 3UGBB 2C7NB 2KK8A 4J6IA 1V80A 2G45B 4MJSA 4GN1A 4JL9A 2AYOB 2I1KA 2WX1A 3NZSA 1WJ6A 1V86A 3DBLI 1P0RA 2KTRB 2BPSA 3VTWA 3L16A 3W1SA 2G4SA 5EDSA 2NBVB 2KN5A 1WM3A 2AWTA 2KFKB 4FN2A 2BWFA 2N7DA 3AXCA 2NCNA 4DDGD 1KOTA 3ECIA 4PYZA 3H7PB 4NAWA 2FAZA 4NAWB 4W9JA 1LFDA 4EEWA 3QIJA 1UBQA 1WMHA 1WH3A 2KDEB 2NR2A 4EZJA 4HVBA 2N9EB 3A4SC 4W9GA 1TBEA 1XD3B 3U8ZA 4EUTA 2BKFA 2DHZA 3EHVA 1MG8A 3PREA 2HD5B 2L00B 2DAJA 2M4NA 2LJ5A 3HM6X 4GMVA 4KDIC 3WA0A 3X0WA 1WR1A 2IO1B 1WXSA 1Q5WB 2ASQA 3IFWB 3ZTDA 2BYEA 2D11A 4MGIE 4AJWA 3ZRCA 2BKRB 3IHPC 2KHWB 1PQSA 2BGFA 3U30A 2MBEA 3CSTA 4EZKA 4GGQA 1EO6A 5J18A 1QZEA 4WAAA 1Z5SB 4GDKB 2LD9A 3WAMA 3QARA 3ZW3A 2JUOA 2DZIA 2CU1A 2KJ6A 2GBNA 4BKSA 5KHQA 4K7SA 2IYDB 4FJZA 2I1JA 1KM7A 3QCAA 3X23A 4MM3A 1Z2MA 4II2B 2AEHA 4MGZE 5DPRA 3NZUA 3WIMA 2MBBB 1UD7A 2KKCA 4HXDA 4BVUC 3PSEB 1WIAA 4E74A 1TGZB 2KOXA 2UWQA 4AOFA 2KFJA 2EMTA 3AULA 4M8NA 4NJ6A 2ZCBA 4BKTA 5JHBA 5C1ZA 1I42A 2DYBA 1OEYJ 2MP2A 3HIZA 3VFKA 3PRPB 4PYUA 3KUCB 4NQLB 1E90A 2C7HA 3TCAA 1EF5A 2M17A 3DQVA 4FJVB 4JLCA 2DYMA 3ML8A 2MCNB 4URKA 2L7RA 5JZEB 1RRBA 2CHXA 3RCZA 2LVQA 1E8ZA 2REXA 3ZKJC 2ZCCA 1WR6E 1WE7A 4KDLB 3K9OB 3Q3FA 2V3SA 2KX0A 4RMAA 4GDLB 1RAXA 3ZVVA 4GSWA 3ZNHB 4FHJA 3U7DA 4KV2A 4DK5A 1UELA 3A9JB 3IVFA 4GXBA 5E6OA 2L76A 3TJPA 4W9EA 2KMCA 2LGYA 4FBJB 2KZRA 3APCA 2GBJA 4DWFA 3PT2B 1NI2A 3QWZB 3A9KA 5CHWA 4ZRJA 3S2AA 4BBNF 3R7RA 1WJNA 4TUUA 2IBIB 2N7EA 3UIOB 1TTNA 2EKEC 4G0NB 4W9IA 2MA9B 4XZ4A 4WJNA 5FR6A 2L05A 4GU2A 4MGYE 4IC7B 4TQ1A 2LVOA 1WM2A 3T9LA 5J17A 3HHMA 4LJPB 4JQWC 3H6NA 2PE6B 2XBBC 4FHKA 4BKSD 3ZNID 4W9CA 2CKHB 3H1UA 4ANXA 5KHOA 4NY0A 1WX9A 2PPHA 2RD0A 5DPTA 2N9XA 4YL8A 5AEKB 1GNUA 1WGRA 2O2VB 5LXHA 1V6EA 1WY8A 3ZO5B 5DPSA 2KDIA 4GDKA 2O6VB 3A9JA 2DYOA 2LASA 4NNJB 3RYTA 3UQAA 2FUHB 2M8SA 3DBRI 2ZNVC 3CSFA 4KSKC 4HPLB 1U4AA 4B6WA 4I6NB 2J0MA 2L0FA 3KH0A 2RSUA 4NPNA 4W9KA 4MSMB 4EOYA 4ICUA 1TZ1A 1Q1OA 3UQBA 2DAFA 2KQSA 3VVWB 2FIFA 4FA6A 1Q0WB 3A1QB 4KZCA 3AI5A 2JZ3B 3APFA 3KW5B 4IW0A 1E8WA 4HJKA 2JXXA 2NBUA 5DCNA 3MHSD 2WDTB 3JSVA 1WZ3A 1P3QU 4I6PA 3PLUA 4K81A 4PS7A 2RR9A 2AL3A 3I3TB 5CTRC 3BINA 4CHKA 2R2OA 4DHZE 5DPWA 4DHJD 1H8CA 4HWIB 2K25A 3TBLD 1WGDA 2Y5BB 3B08A 3GOEA 4GIVA 5BO4B 1YX5B 2KDBA 3BY4B 1OTRB 4AJYB 1V5TA 3V6EB 3CMMB 1E7UA 1P9DU 3GZNI 2MBOA 4LDTB 2MW5A 4TKNA 4LJOB 4IUMB 3L13A 2JRIB 2KWVB 3VUYA 4X57B 4WQOB 3RT3B 3D32A 3DBHI 1P1AA 3QA8A 4KIKB 5G2NA 3T8MA 4ANWA 5HKHA 3M3JA 2N9PC 5LXIB 1NDDA 1P98A 3KVFB 4MSQB 2IY0B 2OJRA 4DDID 1CMXB 1R4MI 2KVRA 3PVLA 1GC6A 2KANA 5D6JB 3DOWA 2PE9A 2BYVE 4FJYA 4CO7A 2NS5A 4AWJA 1W6VA 2L3ZA 2N1VA 3ONSA 1OEYA 5CX3A 3MTNB 2KX3A 3NHEB 5CHFA 1L7YA 1OQYA 2LWPA 2Z0EB 4IM3A 3SU8X 3VXWA 2M0XA 3ZUNA 4P7IA 2K8BA 4WJPA 3PZDA 4KSLC 3VH4B 2XK5B 2KLCA 4MJSB 2MBQA 3KYCD 2KXJA 3P2BA 3PS6A 3B0AA 4IWOA 1D3ZA 3DBSA 1C3TA 2O6VA 1V2YA 3DDCB 2L8JA 2DENB 2LUEA 1SIFA 1E8YA 3PTFC 4WWOA 2C60A 2MQJA 4BBNC 1IP9A 2R2QA 3A1QA 3KUDB 1GJZA 2MRPA 3ALBA 1HE8A 1S3SG 3RD2A 2LRWA 4WWPA 2ZNVB 5AZHA 4M0WB 3DVNU 1WGYA 2QHOA 3JSVB 3NOBA 3VHTC 2K8HA 2RGFA 4KIKA 2FCNA 1FXTB 5L83A 2M1MA 4ZDVA 1WZ0A 4G50A 4IWPA 4NJ7A 4A3PA 2BYFA 1I35A 4G11A 4HDQA 4MELA 4M8MA 2D3GA 2C5LC 2XK5A 4E3CA 2LXAA 4I6LB 5AZFA 4HK2A 2WWZA 1WXVA 1WF9A 3VDZA 3VAWA 2J7QB 2KC2A 1E5WA 5JHAA 2V4LA 1YJ1A 2WX0A 1UGMA 5AZGA 2D07B 4BOSC 4E71A 5JH5C 4JGHB 2UYZB 1G6JA 3ZNZB 2G3QB 2PEAA 1V9JA 3OJ3A 2C9WB 4IWQA 3AU5A 3H7SA 2LZ6A 2JWZA 3DPDA 3RZWC 2FCQA 3WALA 5C23A 3VTVA 4EFOA 1SE9A 2LGXA 2XEWA 4XX5A 3ZRFA 4B9KA 1VD2A 4IM0A 2GBRA 1GC7A 4CYEA 3MJWA 2OOBB 3WANA 2LXCA 3EC8A 4MEMA 4HDOA 2ZEQA 1LXDA 1H4RA 3JYUA 2N4FA 1LQBA 1C1YB 1ZW7A 2EMSA 2ZPNA 2IO0B 3W1SC 2ZVNA 3ZTCA 4DXAB 2JPHA 1WXMA 4ANUA 2KLGA 2JT4B 1GUAB 4WWNA 2LVPA 2HTHA 2NPTB 1GG3A 4K1RB 2KTFA 2LGDA 1LM8B 4AUQC 3RUIB 3N30A 4ANVA 1A5RA 2GOWA 3DCGA 2BWES 3ENEA 2V1YA 1EF1A 2FIDA 1J0GA 2DX5B 3Q3JA 4K7UA 4OVVA 3VQIA 3R7QA 3OJ4B 2CHWA 3R66C 3QK0A 3SD5A 3NS8A 3OLMD 3QQ8B 4BFRA 3QJZA 2FCMA 1WI0A 1K8RB 1UBIA 1E7VA 3PRMB 3HM3A 2JF5A 2MBHA 3L08A 3WAOA 3JVZX 4DHJB 5IAAC 5CHVC 3NY5A 5J2RA 1L2NA 3V61A 3A33B 4MDKE 1T0YA 2BF8B 2DZKA 1V5OA 5L95C 3IBEA 3EECA 3SHQA 3QX1A 2KFKA 2ZJDA 1XQQA 2GBMA 2WYQA 2IO3B 2JY6A 3EFUA 2LRUA 2GMIC 2HJ8A 2D10A 3KUZA 3M95A 3ZDMC 4EKUA 5IA7A 4KZ0A 2Z0DB 1ZKHA 2J0KA 2FCSA 1WFYA 2MX2A 3H9DA 2ZVOA 2K8CA 3TIXA 3VUXA 1YQBA 3AU4A 3PHXB 4FLHA 1RLFA 2O6VD 1NBFC 3C0RB 3PV1A 4DBGA 2MSED 1ISNA 3CF6E 2D2QA 3LMNA 2CR5A 3V6CB 2YLMA 4BKGA 4FADA 2C7MB 1WGHA 3ZIMA 2ZPYA 1J19A 4GOCA 1IPGA 2CS4A 4LCDE 1XT9B 3HK0A 1V81A 3L10B 4IM2A 3UINB 3KYDD 3M62B 3V62A 1WRDB 2KJRA 3W1YA 4ASWC 2MLBA 3V60A 3R3MA 1RFAA 3OAWA 2KO3A 1KJTA 4KVGB 3UF8A 3RZFA 1VCBA 3L0WB 2A4ZA 4W9HA 2PJHA 4JIOU 4ZRKA 3VTUA 3LDZE 4F1SA 4A3OA 4PS8A 1IYFA 4XC2A 1X1MA 4HCNB 4ICVA 4F8CB 4A20A 4LDTD 1UZXB 2K39A 3PGEA 4II3B 2KNBA 3A4RA 4F7ZA 3VUWA 3L54A 1M94A 2J0JA 4W9LA 1YX6B 3PPAA 5D2MB 2NPTA 4ZYNA 2KWCA 5TR5A 4HCPB 4WJOA 1YIWA 2LI5A 3PRZA 2CHZA 3DVNV 1SGHA 2Z59B 4W9FA 3O65B 3PHWB 5LLIA 4RM8A 1J8CA 5D94A 2HE7A 3VH3B 2KD0A 1WJ4A 4AP4C 2L0TA 4MGKE 3DVGY 3L17A 5E6NA 1AARA 3N32A 2MWSB 1OGWA 1Y8RC 1WMHB 2MP2B 5E6PA 3RULA 2NBWB 1E8XA 3LJ3A 4K7WA 2DZJA 2G4DB 2K1FA 2KWUB 1WYWB 4GB9A 4HPMB 3WAPA 4IG7B 1F9JA 2YVCA 5D7GA 4MH0E 2RPQA 2JRHA 2KMAA 4WJQA 3TMPB 1KLVA 4HLEA 2KQ7A 4TQ0A 2A5UA 2KC1A 4ZRIA 4G3XB 2JZZA 2ZZPB 2IZVB 1ZGUB 2K6QA 1WGGA 1WE6A 4N9F4 1WX7A 3IG3A 1S1QB 3APDA 3N3KB 4W9DA 3SDLC 1V49A 4GDLA 4EZLA 2IY1B 2B3AA
chains in the Genus database with same CATH superfamily
3TL5A 2KAJA 5GXGB 3DBHB 4IKGA 2DBYA 2PTLA 2VRRB 2KDFB 4NQKE 2W9NA 2KTRA 3HUIA 1EUVB 1PDXA 3M63B 1UWXA 3QAQA 2MJEA 3DVGX 1E10A 4RM9A 2GBKA 2BYTA 3UIPB 1VZ8A 4FULA 3QC8B 3U4EG 2M56B 1SF0A 2MEKA 1V80A 4MJSA 3LB8C 1UNSA 2WX1A 2WP9B 2PVGC 5IKCM 4H2AA 5EDSA 3W1SA 1C4AA 2NBVB 1EU3A 4OZBA 3FILA 4DDGD 3DWMA 3ECIA 4PYZA 5BMIA 1LFDA 4EEWA 2KDEB 2NR2A 4EZJA 4LNFA 4RGMA 1I4QA 3Q14C 3EHVA 3QJZA 3PREA 2HD5B 2AX5A 2EELA 3X0WA 1UWMA 2IO1B 1L5PA 1Q5WB 4MGIE 2OEDA 1XLNA 2KHWB 2TSSA 2JU6X 3CSTA 2LUMA 4GGQA 3URYA 3AE6B 4GDKB 3WAMA 2DZIA 2RMMA 3AE7B 4K7SA 3B2FA 2I1JA 3QCAA 4LNNA 4MGZE 5DPRA 2J52A 3NZUA 4E74A 5E6JA 2KFJA 2EMTA 4M8NA 4NJ6A 1RM6C 5C1ZA 5JHBA 1D5XC 4M02A 1MG4A 1OEYJ 4FXCA 3FC4A 2FUG1 2Q5WD 2ZW1A 5JZEB 1RRBA 2KDMA 3BZDB 1ESFA 4GSWA 3ZNHB 4FHJA 4DK5A 1UELA 1HXYD 5E6OA 4Q2JA 4W9EA 1NI2A 4ZRJA 1L0XB 1PGAA 1SIJA 2N7EA 3AEGB 4EE2A 3IAS1 3TEZA 1QOBA 4WJNA 5FR6A 1NENB 4GU2A 4MGYE 2D3CA 4IC7B 2LVOA 5J17A 4LJPB 4HEA1 2PE6B 3KWLA 4BKSD 5AEKB 2H88B 3RNEC 2J53A 4GDKA 4NNJB 3RYTA 3UQAA 1XEEA 1U4AA 5EE0A 2PKOA 2ON8A 3KH0A 4YWGG 1AN8A 3ZXVA 2I38A 1Q1OA 3UQBA 2KQSA 4FA6A 5HFYA 3A1QB 3AI5A 3DHIC 5FK9C 5DCNA 2WDTB 3JSVA 1WZ3A 3I3TB 3BINA 2R2OA 3ZXRA 2JZPA 2Y5BB 3B08A 4GIVA 4XWWA 5BO4B 1FEHA 2KWDA 1V5TA 3V6EB 4TKNA 4YXDB 1N63A 2JRIB 1IUEA 1N62A 2KWVB 4P6VF 4X57B 3D32A 1P1AA 4JX1C 3T8MA 4ANWA 5LXIB 1P98A 4KGRA 1R4MI 2BB6A 3AEFB 2KANA 3B2GA 4XDCA 4CO7A 5H8YE 2NS5A 3ONSA 2KX3A 5CHFA 1D4BA 1ACCA 1T0QC 2Z0EB 2M0XA 3ZUNA 4P7IA 1F1HA 3PZDA 3VH4B 1V1OA 3DHHC 2BVCA 5FR3A 3PS6A 1V2YA 1T3QA 4BBNC 3Q8EA 1J7AA 2JYEA 4YTNB 1S3SG 1C79A 2HTME 2KACA 5AZHA 3NOBA 2QIEB 2K8HA 2RGFA 4KIKA 1FXTB 5L83A 1ZDXA 3RNGC 4IWPA 4A3PA 1I35A 4HDQA 2D3GA 2R61A 3BWUD 5AZFA 2VZKB 2WWZA 1WF9A 3VDZA 3VAWA 2J7QB 1OQQA 5JHAA 2D07B 3PO0A 1KFYB 1D5ZC 2ZW0A 3W5UB 3ZNZB 2G3QB 1V9JA 3H7SA 3WALA 5C23A 5JXVA 4XX5A 3ZRFA 4B9KA 4IM0A 2GBRA 3P63A 4K3CA 4CYEA 2LXCA 3EC8A 2V3NA 3KLSX 2BS4B 2ZPNA 2EMSA 2IO0B 1KF6B 4DXAB 3DWGC 2KLGA 1FRRA 1K53A 3ZGZA 1QOFA 1LM8B 1HEZE 3N30A 1A5RA 2GOWA 2FE8A 4TSSA 2FIDA 2DX5B 3SD5A 1QOAA 3OLMD 3QQ8B 4BFRA 1K8RB 3GE8C 1E7VA 2JF5A 3NY5A 1QF6A 3N20C 3P4QB 4HJGE 1YQ3B 3W9CB 1PFDA 1K51A 4TMAB 2WYQA 1QOGA 1SEBD 2GMIC 1ZXHA 3KUZA 1TZOA 1TKEA 4ZHOA 1KLGD 2Z0DB 2J0KA 2M19A 2INPE 1FIQA 1QILA 3AU4A 3PHXB 2Y5CA 3C19A 4DBGA 3LMNA 4BKGA 2LHEA 1WGHA 1MHHE 1IPGA 2WXKA 1XT9B 3V62A 2HDEA 1EU4A 1CZPA 4S17A 1K50A 3OAWA 1TKGA 4W9HA 3ZYYX 3LYYA 1Y56A 2FBWB 3VTUA 4A3OA 4PS8A 4B0MA 4HCNB 4F8CB 1MPEA 4LDTD 3PGEA 4L23A 4II3B 4KGSA 1JWBD 2N9KA 4W9LA 5D2MB 2NPTA 5TR5A 3PRZA 1UF0A 2WXMA 3O65B 4RM8A 5D94A 2KD0A 3UI3A 1GAQB 4K3BA 3BVZA 4DXGA 4OVZA 1R7SA 4RGOS 3LJ3A 2DZJA 2K1FA 4A6QA 4ITKA 3GE3C 1F9JA 1ZUD2 2WDRB 4XWTA 5D7GA 2LHDA 1KLVA 4HLEA 3HVDA 2WHIA 4ZRIA 3MHZA 2D3BA 1JCKB 2QSDA 1WE6A 1WX7A 4M00A 1NYQA 2WU5B 2N1WA 1E7PB 1WXAA 2Y3AA 3ZDTA 2O2VA 3PLVA 3CWIA 3FILB 3K9PB 1VR9A 2IO2B 2DWQA 3P1MA 5LNK1 1NEKB 1BT0A 2YEPF 4N59A 5IP4D 1JRUA 1YD8U 3QHTA 3IAM1 2KJHB 3BK2A 2DZMA 3ZNGC 4J3OD 1T6BX 4OVUA 1WX8A 4PS3A 4DHZB 2C7NB 2KK8A 2AYOB 3NZSA 1TIFA 2KTRB 4PT5A 4A90A 2KN5A 1WM3A 1JWSD 3AXCA 1KOTA 1VZ7A 4W9JA 2DNFA 2INDC 1UBQA 1WH3A 2L1AA 2QJLA 1XXGA 1CQVA 3A4SC 1XD3B 4W9GA 1MG8A 4KDIC 2LJ5A 3HM6X 1WR1A 1WXSA 1JQ4A 2D11A 3ZRCA 1PQSA 2L32A 1ROEA 4JWUC 5J18A 4WAAA 2M0AA 2CU1A 5D3DA 2GBNA 5KHQA 2IYDB 2NTTA 4II2B 2MBBB 4C00A 4BVUC 4AOFA 2ONQA 1ZE3D 2ZCBA 4BKTA 2DYBA 3VFKA 3PRPB 4MACA 4PYUA 1E90A 5MPOA 4FJVB 2DYMA 3AEEB 2MCNB 2L7RA 2NTSA 3RCZA 1FNVA 2AQ3B 3NVZA 1E6EB 3K9OB 3Q3FA 2KX0A 4GDLB 1RAXA 3ZVVA 3U7DA 3IVFA 2L76A 1ZP0B 2QCZA 3TJPA 2KMCA 2INCC 4URKA 2BS3B 2WS3B 3QWZB 5CHWA 3RNAC 3S2AA 1WJNA 2BBCA 4ZRPA 1SB3C 1QKZA 4NAMA 1NI3A 1WM2A 3T9LA 4FHKA 3ZNID 4W9CA 4ANXA 5KHOA 4NY0A 2PPHA 4BAXA 2N9XA 1V6EA 4HROA 2O6VB 3A9JA 2DYOA 3DBRI 2W54A 3CSFA 4HPLB 3I5JC 4B6WA 1GOZA 2L0FA 4W9KA 4NPNA 4MSMB 1TZ1A 2FIFA 3RMKC 4KZCA 2JZ3B 4IW0A 1E8WA 1ZDVA 1P3QU 2IPKD 4PS7A 2N9LA 1I4HA 4DHJD 3TBLD 1WGDA 1F77A 1YX5B 2KDBA 2INNE 2QMTA 4LK0M 1JW9D 3I57A 3DBHI 1FRDA 3QA8A 4KIKB 5G2NA 3EA6A 5HKHA 3V3XA 3KVFB 4MSQB 2OJRA 4DDID 1L0YB 3PVLA 3DOWA 2PE9A 1L0VB 3P4RB 2N1VA 1OEYA 2WGSA 1SE4A 4M01A 4US9A 2QEJC 1VDVA 2B76B 3GS2A 3U7ZA 4KSLC 2G1EA 2KLCA 2MBQA 3P2BA 1CK1A 4RGNA 4R3DA 3RNBC 1E8YA 4A8XC 4YTMB 3KUDB 4WAFA 1HE8A 2K3UA 2OJWA 1TS5A 3TEXA 4M0WB 5EE1A 2M1MA 4ZDVA 3T3NA 4NJ7A 3MJ5A 4E3CA 3LXFA 2ACZB 1V97A 3ZJTA 3ZJVA 2KC2A 2K22A 1UGMA 1L6VA 1I4XA 2RDHA 4JGHB 3Q3NC 3AE3B 2PEAA 4AJYB 2C9WB 1IBXB 3DPDA 2FCQA 3RNCC 3EFCA 1VD2A 3ETRA 3MJWA 3WANA 1D5MC 1TT5B 4MEMA 2ZEQA 3PZ7A 1LQBA 2N4FA 1ZW7A 1YJIA 4RH6A 1JWMD 3FKYA 2JPHA 1GUAB 2RDGA 2LVPA 2HTHA 1MHXA 2KTFA 1SSNA 3EUB2 3RUIB 2BWES 1J0GA 1EF1A 1IBXA 3AE1B 3Q3JA 4K7UA 2V0GA 2WXQA 2JX5A 2FCMA 3DBLB 2K0PA 1UBIA 2AQ1B 2MJ3A 3PRMB 3HM3A 3WAOA 2MBHA 3L08A 5IAAC 4S0RA 5CHVC 4MDKE 2DZKA 3MC8A 1C78A 1V5OA 2Y5PA 2Z8LA 5L95C 4MH8A 2KFKA 2ZJDA 3NVWA 2IO3B 2JY6A 4C56C 3PZ8A 1TKYA 2JXTA 1PUTA 3AH7A 1J7BA 5IA7A 2W3SA 2IGGA 1ZKHA 2MX2A 2K8CA 1ET9A 2J42A 3WCQA 1YQBA 1SJED 1QQRA 2LGIA 4FLHA 1J7CA 3C0RB 4YSZB 4CQNA 3CF6E 2D2QA 3ZQ4A 3V6CB 3P42A 4FADA 4HRSA 5HG2A 3HK0A 1WRDB 2KJRA 2WXJA 3V60A 3T3OA 2UU7A 2KO3A 1I7HA 3KQ4A 3L0WB 1SE3A 4JIOU 1X1MA 2X8XX 4ICVA 1DGJA 1SE2A 2KNBA 3HRDD 3L54A 4WWMA 1C4CA 1T0SC 3TUOA 2LI5A 2CHZA 4REZA 3DVNV 1HTQA 1SGHA 4W9FA 1J8CA 2HE7A 4N6EB 2BB5A 4AP4C 2L0TA 4AS1A 3L17A 2E3TA 4IDIA 1FM0D 2BW2A 1A70A 1VJKA 1Y8RC 2ICIA 2MP2B 1V1PA 3AE2B 3BVMA 4GB9A 2JWUA 3WAPA 4IG7B 5BYSA 4WIPA 2YVCA 4MH0E 2RPQA 3TMPB 2KQ7A 2JSVX 4TQ0A 5AUIA 2A5UA 2KC1A 4KKJA 3R2TA 3AEDB 2IZVB 4C7ZA 4N9F4 4W9DA 2MH7A 1HQRD 3SDLC 1FNWA 4LLGM 4EZLA 1XLQA 3RN9C 1R4NI 1WJUA 2AL6A 4B95A 3J9CA 3W5VB 3IXSA 1UUPA 2PVOD 3V05A 1E9MA 5GMVA 3JW0X 2FNJB 1XLPA 1C9FA 3B1LX 4ZHPA 1FD6A 4P16A 1STEA 1JROA 4MM3B 3UGBB 3ZJUA 4J6IA 4LTUA 4MT5A 2G45B 1FO4A 2I1KA 2J4XA 1WJ6A 1V86A 3VTWA 3L16A 2G4SA 1KRHA 2AWTA 2BWFA 2N7DA 3H7PB 4NAWA 2FAZA 4NAWB 3Q3MC 3QIJA 4HVBA 2WQYB 4EUTA 1TBEA 2DAJA 4GMVA 3WA0A 2LEKA 1C77A 4P1CC 3IFWB 1NYRA 2MBEA 3MP9A 1EO6A 1QZEA 1FCCC 2LD9A 2RDBC 3N1ZC 2KVZA 1YN5A 4BKSA 3X23A 1KM7A 3NJTA 4MM3A 2V9HA 2AEHA 2I2YA 3AE8B 4HXDA 5IN7A 1TS4A 1B1ZA 1WIAA 1YQ4B 2KOXA 3PSEB 3AULA 1I42A 3MFGA 3MC9A 3HIZA 1BMLC 1L4ZB 4NQLB 2C7HA 3DQVA 1DYQA 3ML8A 4BZAA 2CHXA 5TSSA 3Q2AC 2LVQA 2ZCCA 1WR6E 1WE7A 2YEPB 2XN9C 2X38A 3NZ3A 2JQRB 4KV2A 1IGCA 3A9JB 2KN4A 3H8HA 2LGYA 4FBJB 3NUHB 2KZRA 3APCA 4C7YA 3PT2B 3R8BA 4BBNF 2PLPA 2NMQA 3R7RA 4TUUA 2IBIB 1XF5L 2EKEC 4G0NB 4W9IA 3TEYA 4RCOA 4XZ4A 2L05A 1F0ZA 1GB1A 4JQWC 3H6NA 1FFVA 1IGDA 3H1UA 1WX9A 2RD0A 5DPTA 1WGRA 2BTEA 2O2VB 1FFUA 3AEAB 5DPSA 2KDIA 2WXHA 2WLBA 2LASA 2PW9A 3GP7A 2M8SA 1ZOYB 2ZNVC 4KSKC 1M4VA 2WU2B 2J0MA 3Q3OC 1AWDA 4YSYB 4ICUA 2KQ4X 3TSSA 2AQ2B 1Q0WB 3APFA 4JPSA 4HJKA 2JXXA 1TJEA 3MHSD 2WXRA 3PLUA 1KH0A 4K81A 3IT4B 2RR9A 2AL3A 5BMHA 4CHKA 4DHZE 5DPWA 1H8CA 2N7JA 4HWIB 1I4PA 3GOEA 3BY4B 1HTOA 3CMMB 1E7UA 3GZNI 2MW5A 4LJOB 4IUMB 4L2YA 4HKZE 3M3JA 2N0SB 1NDDA 2IY0B 2KVRA 5D6JB 2BYVE 1DOIA 4AWJA 2W3RA 3Q8AA 3MTNB 4KX6B 1L7YA 1OQYA 2CU3A 1BXTA 1SBBB 3VXWA 2XK5B 3KYCD 4USAA 1OQRA 4IWOA 1D3ZA 3DBSA 1C3TA 3DDCB 2L8JA 2DENB 2V3PA 3AMZA 1YN4A 2IGHA 4WWOA 2C60A 2MQJA 2R2QA 3A1QA 4US8A 3ALBA 2LRWA 3VR8B 3TEWA 3R2IA 4DWFA 4JE3B 2QHOA 1Q10A 1SJHD 4G50A 2WXFA 4G11A 4MELA 4M8MA 3DBRB 2XK5A 2LXAA 2CJOA 4QAYA 1TY2A 1E5WA 2PMVA 2V4LA 4KGTA 1YJ1A 2WX0A 3CIRB 5AZGA 2LMCA 4E71A 1KTKA 2UYZB 3OJ3A 2MJDA 3AU5A 2LZ6A 3RZWC 3VTVA 1SE9A 2LGXA 2XEWA 4A9AA 3AV8A 3VRBB 4HDOA 1SXTA 1C1YB 3W1SC 4RNAA 1FPYA 1WXMA 4WWNA 3U2SC 2NPTB 3BVGA 4K1RB 2LGDA 4AUQC 3DCGA 3ENEA 2V1YA 3R7QA 3OJ4B 3QK0A 3U52E 3NS8A 2H89B 1WI0A 5BYQA 4DHJB 2WDVB 3JVZX 1C76A 3RI7C 2VH2A 1L2NA 1NVID 1QLBB 3V61A 3A33B 2V4IB 2BF8B 4D2KA 3EECA 2WXNA 1XQQA 2LRUA 1RFKA 2HJ8A 2D10A 3M95A 3ZDMC 3AB5A 4KZ0A 4YT0B 1WFYA 2ZVOA 3N1YC 3VUXA 3Q8FA 4A55A 3I9V1 4RFBA 2O6VD 4KKIA 3PV1A 1ENFA 2KT7A 2YLMA 3ZIMA 1J19A 4GOCA 2CS4A 4LCDE 3UINB 1V81A 3M62B 2JYTA 1VRAB 2MLBA 3P4PB 4ACFA 4KVGB 1T0RC 1VCBA 2WXLA 2A4ZA 2PJHA 4ZRKA 3LDZE 4F1SA 1IYFA 4DQOC 1ET6A 1JMLA 1UZXB 2K39A 3E56A 3NG0A 3A4RA 2G9HD 3VUWA 1RWSA 2J0JA 5G5HA 5C2TB 1YX6B 1E0ZA 1YJJA 1MI0A 4WJOA 3SEBA 5IOIA 2Z59B 5LLIA 1V1PB 3VH3B 5BMGA 5E6NA 1XCTL 1AARA 1OGWA 4ZYSA 3Q69A 5E6PA 3RULA 2NBWB 1E8XA 4K7WA 1XCQL 2G4DB 2KWUB 1WYGA 2DLBA 5BYRA 4HPMB 1F2RI 3N1XC 2JRHA 3C8YA 4WJQA 1VLBA 4G3XB 5FKAC 2JZZA 2K6QA 1WGGA 3OWEB 1N5XA 1S1QB 3APDA 3N3KB 1V49A 4GDLA 2EKIA 1UH6A 4P1BC 1VZ6A 1RYJA 3HVZA 4TV3A 3GZNB 3SR6A 2CJNA 3A9KB 2BT6A 2JVCA 4RF1A 4ARIA 4BOZB 3H7PA 5G55A 2K6DB 2NVUI 3ZLZA 3ML9A 1P7FA 4NJCA 4WURA 3AECB 4GN1A 4JL9A 3DBLI 1P0RA 1GB4A 2BPSA 2L52A 1V8CA 2WXIA 4FN2A 1HZ5A 2KFKB 1FNUA 2NCNA 1P7EA 3N9YC 1WMHA 2N9EB 3U8ZA 2BKFA 2DHZA 2L00B 2M4NA 3ABVB 4C4VB 1MVKA 3ZTDA 2ASQA 2BYEA 4AJWA 4UDUC 2BS2B 2BKRB 3IHPC 2BGFA 2K5PA 3U30A 4XE0A 4EZKA 4YSXB 1Z5SB 3ZW3A 3QARA 1JWAD 3SFDB 2JUOA 5T8IA 2KJ6A 4FJZA 4HPPA 1Z2MA 4YTPB 1F52A 3NRZA 3WIMA 1UD7A 2KKCA 2LJIA 1TGZB 2UWQA 4O1NA 1QT9A 1JALA 5C3JB 2MP2A 3TCAA 3KUCB 5HHDG 1LGRA 1EF5A 2M17A 4JLCA 3BK1A 4ZRQA 5EE9A 3ZKJC 1E8ZA 2REXA 1WSPA 4LNOA 4KDLB 1AYFA 4RGTA 2V3SA 4RMAA 5I4DA 4GXBA 2KYWA 1WRIA 2GBJA 3A9KA 3BYYB 2L83A 1N61A 2W55A 1TTNA 3UIOB 2MA9B 1TS3A 3RNFC 4TQ1A 2LGSA 3BYTB 4C4VA 1TY0A 3HHMA 2WDQB 2XBBC 4ZOHC 2CKHB 4YL8A 1GNUA 2WXOA 5LXHA 1WY8A 3ZO5B 2GLSA 1OFFA 2QILA 2FUHB 3AEBB 4I6NB 1EWCA 2RSUA 4EOYA 3IT6B 1LO5D 2RPVA 2DAFA 3VVWB 3L4PA 2WXGA 3KW5B 1I4GA 2NBUA 1EM7A 4XYCA 3GB1A 4I6PA 1FCLA 5CTRC 4AQ7A 3P4SB 2K25A 3EGRA 1R4NB 3KWVA 5EE3A 1YOVB 1OTRB 3Q8BA 4OZAA 1P9DU 2MBOA 4LDTB 1UGJA 3L13A 3SFEB 1HZ6A 3VUYA 4N58A 1R4MB 4WQOB 3RT3B 1XLOA 1AW7A 2N9PC 1CMXB 1GC6A 2SAKA 2IGDA 4NZLB 4FJYA 2LFIA 1PGBA 1W6VA 2L3ZA 5CX3A 5H92C 3NHEB 2LWPA 4IM3A 1WGKA 3SU8X 1N5WA 2QDFA 2K8BA 4WJPA 5G5GA 1DOYA 3E9SA 1TS2A 4MJSB 4XGAB 2KXJA 1FXAA 3B0AA 1D6EC 4RF0A 2O6VA 1N60A 2LUEA 1GPXA 1SIFA 1FXIA 3Q8CA 3PTFC 4OW0A 4IOIE 4OZCA 2VZKD 5IO9A 1IP9A 1GJZA 2MRPA 3RD2A 3NVYA 3O13A 4WWPA 2ZNVB 3DVNU 1WGYA 3VHTC 3JSVB 2FCNA 1WZ0A 1XO3A 2BYFA 4GLSC 3B9JA 2C5LC 3FAHA 2WNMA 4M0WA 4I6LB 1PGXA 1FMAD 4HK2A 2IJ0A 1WXVA 1L6UA 4BOSC 5JH5C 3VRAB 1G6JA 4LNIA 4IWQA 2D5GA 3W2DA 3I63C 4B0EA 2JWZA 4XDDA 2W82A 5D3IB 4EFOA 2WXPA 1GC7A 3VR9B 2VH1A 2OOBB 1TYGB 2QC8A 1C4PA 3NS1A 2BQQA 1LXDA 1H4RA 3JYUA 2ZVNA 3ZTCA 3AE4B 4ANUA 2JT4B 3AE9B 4LNKA 1GG3A 2HJ1A 4ANVA 3Q6BA 4OVVA 3VQIA 2CHWA 1MJDA 3R66C 4WH4A 1DOXA 1L4DB 3AE5B 2PIAA 2GI9A 2K9XA 1MFWA 1PYWD 5J2RA 2XNAC 1T0YA 1EWYC 1HA5A 3IBEA 3SHQA 3QX1A 2GB1A 2GBMA 1JWUD 3EFUA 4EKUA 2OHFA 4C80A 2D3AA 2FCSA 3H9DA 1F2RC 3TIXA 3AM9A 3AN1A 1RLFA 1NBFC 2MSED 1ISNA 1YNTE 2CR5A 1YN3A 2C7MB 1B9RA 2ZPYA 2SEBD 1YMHE 3NVVA 3DHGC 3L10B 4IM2A 4JWSC 3W1YA 3KYDD 4ASWC 1WXQA 2KMMA 3R3MA 1RFAA 1BUIC 1KJTA 3UF8A 1WWTA 3RZFA 4PK1A 3BIID 2IDYA 4XC2A 2E6XA 2GRIA 4A20A 4WQMA 4F7ZA 1ZPSA 1M94A 1CJEA 4HKQA 3PPAA 4ZYNA 2KWCA 4HCPB 1YIWA 4DXFA 4OHJA 1K52A 3RPFC 3OG5A 1N6ZA 3PHWB 1T5XD 5AUKA 1WJ4A 4MGKE 1JRPA 3DVGY 5HI1A 3N32A 2MWSB 1WMHB 2MHJA 1ZXIA 3MC0B 1WYWB 2KMAA 2ZZPB 3RFZB 1ZGUB 4ARCA 3IG3A 1KLUD 2IY1B 2B3AA 4L1BA 1I4RA
chains in the Genus database with same CATH topology
3TL5A 2N1WA 1WXAA 1R4NI 1WJUA 1UH6A 2AL6A 4B95A 3ZDTA 2VRRB 2KDFB 2O2VA 3PLVA 4NQKE 3K9PB 2W9NA 2IO2B 1BT0A 2KTRA 4TV3A 1EUVB 1JRUA 1YD8U 3QHTA 3M63B 3A9KB 3QAQA 5GMVA 2KJHB 3JW0X 2JVCA 2DZMA 2FNJB 3ZNGC 3DVGX 4BOZB 3B1LX 4RM9A 2GBKA 4OVUA 1WX8A 3H7PA 4PS3A 5G55A 2K6DB 2NVUI 4FULA 3UIPB 3ML9A 3ZLZA 3QC8B 4DHZB 3UGBB 2C7NB 2KK8A 4J6IA 1V80A 2G45B 4MJSA 4GN1A 4JL9A 2AYOB 2I1KA 2WX1A 3NZSA 1WJ6A 1V86A 3DBLI 1P0RA 2KTRB 2BPSA 3VTWA 3L16A 3W1SA 2G4SA 5EDSA 2NBVB 2KN5A 1WM3A 2AWTA 2KFKB 4FN2A 2BWFA 2N7DA 3AXCA 2NCNA 4DDGD 1KOTA 3ECIA 4PYZA 3H7PB 4NAWA 2FAZA 4NAWB 4W9JA 1LFDA 4EEWA 3QIJA 1UBQA 1WMHA 1WH3A 2KDEB 2NR2A 4EZJA 4HVBA 2N9EB 3A4SC 4W9GA 1TBEA 1XD3B 3U8ZA 4EUTA 2BKFA 2DHZA 3EHVA 1MG8A 3PREA 2HD5B 2L00B 2DAJA 2M4NA 2LJ5A 3HM6X 4GMVA 4KDIC 3WA0A 3X0WA 1WR1A 2IO1B 1WXSA 1Q5WB 2ASQA 3IFWB 3ZTDA 2BYEA 2D11A 4MGIE 4AJWA 3ZRCA 2BKRB 3IHPC 2KHWB 1PQSA 2BGFA 3U30A 2MBEA 3CSTA 4EZKA 4GGQA 1EO6A 5J18A 1QZEA 4WAAA 1Z5SB 4GDKB 2LD9A 3WAMA 3QARA 3ZW3A 2JUOA 2DZIA 2CU1A 2KJ6A 2GBNA 4BKSA 5KHQA 4K7SA 2IYDB 4FJZA 2I1JA 1KM7A 3QCAA 3X23A 4MM3A 1Z2MA 4II2B 2AEHA 4MGZE 5DPRA 3NZUA 3WIMA 2MBBB 1UD7A 2KKCA 4HXDA 4BVUC 3PSEB 1WIAA 4E74A 1TGZB 2KOXA 2UWQA 4AOFA 2KFJA 2EMTA 3AULA 4M8NA 4NJ6A 2ZCBA 4BKTA 5JHBA 5C1ZA 1I42A 2DYBA 1OEYJ 2MP2A 3HIZA 3VFKA 3PRPB 4PYUA 3KUCB 4NQLB 1E90A 2C7HA 3TCAA 1EF5A 2M17A 3DQVA 4FJVB 4JLCA 2DYMA 3ML8A 2MCNB 4URKA 2L7RA 5JZEB 1RRBA 2CHXA 3RCZA 2LVQA 1E8ZA 2REXA 3ZKJC 2ZCCA 1WR6E 1WE7A 4KDLB 3K9OB 3Q3FA 2V3SA 2KX0A 4RMAA 4GDLB 1RAXA 3ZVVA 4GSWA 3ZNHB 4FHJA 3U7DA 4KV2A 4DK5A 1UELA 3A9JB 3IVFA 4GXBA 5E6OA 2L76A 3TJPA 4W9EA 2KMCA 2LGYA 4FBJB 2KZRA 3APCA 2GBJA 4DWFA 3PT2B 1NI2A 3QWZB 3A9KA 5CHWA 4ZRJA 3S2AA 4BBNF 3R7RA 1WJNA 4TUUA 2IBIB 2N7EA 3UIOB 1TTNA 2EKEC 4G0NB 4W9IA 2MA9B 4XZ4A 4WJNA 5FR6A 2L05A 4GU2A 4MGYE 4IC7B 4TQ1A 2LVOA 1WM2A 3T9LA 5J17A 3HHMA 4LJPB 4JQWC 3H6NA 2PE6B 2XBBC 4FHKA 4BKSD 3ZNID 4W9CA 2CKHB 3H1UA 4ANXA 5KHOA 4NY0A 1WX9A 2PPHA 2RD0A 5DPTA 2N9XA 4YL8A 5AEKB 1GNUA 1WGRA 2O2VB 5LXHA 1V6EA 1WY8A 3ZO5B 5DPSA 2KDIA 4GDKA 2O6VB 3A9JA 2DYOA 2LASA 4NNJB 3RYTA 3UQAA 2FUHB 2M8SA 3DBRI 2ZNVC 3CSFA 4KSKC 4HPLB 1U4AA 4B6WA 4I6NB 2J0MA 2L0FA 3KH0A 2RSUA 4NPNA 4W9KA 4MSMB 4EOYA 4ICUA 1TZ1A 1Q1OA 3UQBA 2DAFA 2KQSA 3VVWB 2FIFA 4FA6A 1Q0WB 3A1QB 4KZCA 3AI5A 2JZ3B 3APFA 3KW5B 4IW0A 1E8WA 4HJKA 2JXXA 2NBUA 5DCNA 3MHSD 2WDTB 3JSVA 1WZ3A 1P3QU 4I6PA 3PLUA 4K81A 4PS7A 2RR9A 2AL3A 3I3TB 5CTRC 3BINA 4CHKA 2R2OA 4DHZE 5DPWA 4DHJD 1H8CA 4HWIB 2K25A 3TBLD 1WGDA 2Y5BB 3B08A 3GOEA 4GIVA 5BO4B 1YX5B 2KDBA 3BY4B 1OTRB 4AJYB 1V5TA 3V6EB 3CMMB 1E7UA 1P9DU 3GZNI 2MBOA 4LDTB 2MW5A 4TKNA 4LJOB 4IUMB 3L13A 2JRIB 2KWVB 3VUYA 4X57B 4WQOB 3RT3B 3D32A 3DBHI 1P1AA 3QA8A 4KIKB 5G2NA 3T8MA 4ANWA 5HKHA 3M3JA 2N9PC 5LXIB 1NDDA 1P98A 3KVFB 4MSQB 2IY0B 2OJRA 4DDID 1CMXB 1R4MI 2KVRA 3PVLA 1GC6A 2KANA 5D6JB 3DOWA 2PE9A 2BYVE 4FJYA 4CO7A 2NS5A 4AWJA 1W6VA 2L3ZA 2N1VA 3ONSA 1OEYA 5CX3A 3MTNB 2KX3A 3NHEB 5CHFA 1L7YA 1OQYA 2LWPA 2Z0EB 4IM3A 3SU8X 3VXWA 2M0XA 3ZUNA 4P7IA 2K8BA 4WJPA 3PZDA 4KSLC 3VH4B 2XK5B 2KLCA 4MJSB 2MBQA 3KYCD 2KXJA 3P2BA 3PS6A 3B0AA 4IWOA 1D3ZA 3DBSA 1C3TA 2O6VA 1V2YA 3DDCB 2L8JA 2DENB 2LUEA 1SIFA 1E8YA 3PTFC 4WWOA 2C60A 2MQJA 4BBNC 1IP9A 2R2QA 3A1QA 3KUDB 1GJZA 2MRPA 3ALBA 1HE8A 1S3SG 3RD2A 2LRWA 4WWPA 2ZNVB 5AZHA 4M0WB 3DVNU 1WGYA 2QHOA 3JSVB 3NOBA 3VHTC 2K8HA 2RGFA 4KIKA 2FCNA 1FXTB 5L83A 2M1MA 4ZDVA 1WZ0A 4G50A 4IWPA 4NJ7A 4A3PA 2BYFA 1I35A 4G11A 4HDQA 4MELA 4M8MA 2D3GA 2C5LC 2XK5A 4E3CA 2LXAA 4I6LB 5AZFA 4HK2A 2WWZA 1WXVA 1WF9A 3VDZA 3VAWA 2J7QB 2KC2A 1E5WA 5JHAA 2V4LA 1YJ1A 2WX0A 1UGMA 5AZGA 2D07B 4BOSC 4E71A 5JH5C 4JGHB 2UYZB 1G6JA 3ZNZB 2G3QB 2PEAA 1V9JA 3OJ3A 2C9WB 4IWQA 3AU5A 3H7SA 2LZ6A 2JWZA 3DPDA 3RZWC 2FCQA 3WALA 5C23A 3VTVA 4EFOA 1SE9A 2LGXA 2XEWA 4XX5A 3ZRFA 4B9KA 1VD2A 4IM0A 2GBRA 1GC7A 4CYEA 3MJWA 2OOBB 3WANA 2LXCA 3EC8A 4MEMA 4HDOA 2ZEQA 1LXDA 1H4RA 3JYUA 2N4FA 1LQBA 1C1YB 1ZW7A 2EMSA 2ZPNA 2IO0B 3W1SC 2ZVNA 3ZTCA 4DXAB 2JPHA 1WXMA 4ANUA 2KLGA 2JT4B 1GUAB 4WWNA 2LVPA 2HTHA 2NPTB 1GG3A 4K1RB 2KTFA 2LGDA 1LM8B 4AUQC 3RUIB 3N30A 4ANVA 1A5RA 2GOWA 3DCGA 2BWES 3ENEA 2V1YA 1EF1A 2FIDA 1J0GA 2DX5B 3Q3JA 4K7UA 4OVVA 3VQIA 3R7QA 3OJ4B 2CHWA 3R66C 3QK0A 3SD5A 3NS8A 3OLMD 3QQ8B 4BFRA 3QJZA 2FCMA 1WI0A 1K8RB 1UBIA 1E7VA 3PRMB 3HM3A 2JF5A 2MBHA 3L08A 3WAOA 3JVZX 4DHJB 5IAAC 5CHVC 3NY5A 5J2RA 1L2NA 3V61A 3A33B 4MDKE 1T0YA 2BF8B 2DZKA 1V5OA 5L95C 3IBEA 3EECA 3SHQA 3QX1A 2KFKA 2ZJDA 1XQQA 2GBMA 2WYQA 2IO3B 2JY6A 3EFUA 2LRUA 2GMIC 2HJ8A 2D10A 3KUZA 3M95A 3ZDMC 4EKUA 5IA7A 4KZ0A 2Z0DB 1ZKHA 2J0KA 2FCSA 1WFYA 2MX2A 3H9DA 2ZVOA 2K8CA 3TIXA 3VUXA 1YQBA 3AU4A 3PHXB 4FLHA 1RLFA 2O6VD 1NBFC 3C0RB 3PV1A 4DBGA 2MSED 1ISNA 3CF6E 2D2QA 3LMNA 2CR5A 3V6CB 2YLMA 4BKGA 4FADA 2C7MB 1WGHA 3ZIMA 2ZPYA 1J19A 4GOCA 1IPGA 2CS4A 4LCDE 1XT9B 3HK0A 1V81A 3L10B 4IM2A 3UINB 3KYDD 3M62B 3V62A 1WRDB 2KJRA 3W1YA 4ASWC 2MLBA 3V60A 3R3MA 1RFAA 3OAWA 2KO3A 1KJTA 4KVGB 3UF8A 3RZFA 1VCBA 3L0WB 2A4ZA 4W9HA 2PJHA 4JIOU 4ZRKA 3VTUA 3LDZE 4F1SA 4A3OA 4PS8A 1IYFA 4XC2A 1X1MA 4HCNB 4ICVA 4F8CB 4A20A 4LDTD 1UZXB 2K39A 3PGEA 4II3B 2KNBA 3A4RA 4F7ZA 3VUWA 3L54A 1M94A 2J0JA 4W9LA 1YX6B 3PPAA 5D2MB 2NPTA 4ZYNA 2KWCA 5TR5A 4HCPB 4WJOA 1YIWA 2LI5A 3PRZA 2CHZA 3DVNV 1SGHA 2Z59B 4W9FA 3O65B 3PHWB 5LLIA 4RM8A 1J8CA 5D94A 2HE7A 3VH3B 2KD0A 1WJ4A 4AP4C 2L0TA 4MGKE 3DVGY 3L17A 5E6NA 1AARA 3N32A 2MWSB 1OGWA 1Y8RC 1WMHB 2MP2B 5E6PA 3RULA 2NBWB 1E8XA 3LJ3A 4K7WA 2DZJA 2G4DB 2K1FA 2KWUB 1WYWB 4GB9A 4HPMB 3WAPA 4IG7B 1F9JA 2YVCA 5D7GA 4MH0E 2RPQA 2JRHA 2KMAA 4WJQA 3TMPB 1KLVA 4HLEA 2KQ7A 4TQ0A 2A5UA 2KC1A 4ZRIA 4G3XB 2JZZA 2ZZPB 2IZVB 1ZGUB 2K6QA 1WGGA 1WE6A 4N9F4 1WX7A 3IG3A 1S1QB 3APDA 3N3KB 4W9DA 3SDLC 1V49A 4GDLA 4EZLA 2IY1B 2B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL5 A;  2N1W A;  1WXA A;  1R4N I;  1WJU A;  1UH6 A;  2AL6 A;  4B95 A;  3ZDT A;  2VRR B;  2KDF B;  2O2V A;  3PLV A;  4NQK E;  3K9P B;  2W9N A;  2IO2 B;  1BT0 A;  2KTR A;  4TV3 A;  1EUV B;  1JRU A;  1YD8 U;  3QHT A;  3M63 B;  3A9K B;  3QAQ A;  5GMV A;  2KJH B;  3JW0 X;  2JVC A;  2DZM A;  2FNJ B;  3ZNG C;  3DVG X;  4BOZ B;  3B1L X;  4RM9 A;  2GBK A;  4OVU A;  1WX8 A;  3H7P A;  4PS3 A;  5G55 A;  2K6D B;  2NVU I;  4FUL A;  3UIP B;  3ML9 A;  3ZLZ A;  3QC8 B;  4DHZ B;  3UGB B;  2C7N B;  2KK8 A;  4J6I A;  1V80 A;  2G45 B;  4MJS A;  4GN1 A;  4JL9 A;  2AYO B;  2I1K A;  2WX1 A;  3NZS A;  1WJ6 A;  1V86 A;  3DBL I;  1P0R A;  2KTR B;  2BPS A;  3VTW A;  3L16 A;  3W1S A;  2G4S A;  5EDS A;  2NBV B;  2KN5 A;  1WM3 A;  2AWT A;  2KFK B;  4FN2 A;  2BWF A;  2N7D A;  3AXC A;  2NCN A;  4DDG D;  1KOT A;  3ECI A;  4PYZ A;  3H7P B;  4NAW A;  2FAZ A;  4NAW B;  4W9J A;  1LFD A;  4EEW A;  3QIJ A;  1UBQ A;  1WMH A;  1WH3 A;  2KDE B;  2NR2 A;  4EZJ A;  4HVB A;  2N9E B;  3A4S C;  4W9G A;  1TBE A;  1XD3 B;  3U8Z A;  4EUT A;  2BKF A;  2DHZ A;  3EHV A;  1MG8 A;  3PRE A;  2HD5 B;  2L00 B;  2DAJ A;  2M4N A;  2LJ5 A;  3HM6 X;  4GMV A;  4KDI C;  3WA0 A;  3X0W A;  1WR1 A;  2IO1 B;  1WXS A;  1Q5W B;  2ASQ A;  3IFW B;  3ZTD A;  2BYE A;  2D11 A;  4MGI E;  4AJW A;  3ZRC A;  2BKR B;  3IHP C;  2KHW B;  1PQS A;  2BGF A;  3U30 A;  2MBE A;  3CST A;  4EZK A;  4GGQ A;  1EO6 A;  5J18 A;  1QZE A;  4WAA A;  1Z5S B;  4GDK B;  2LD9 A;  3WAM A;  3QAR A;  3ZW3 A;  2JUO A;  2DZI A;  2CU1 A;  2KJ6 A;  2GBN A;  4BKS A;  5KHQ A;  4K7S A;  2IYD B;  4FJZ A;  2I1J A;  1KM7 A;  3QCA A;  3X23 A;  4MM3 A;  1Z2M A;  4II2 B;  2AEH A;  4MGZ E;  5DPR A;  3NZU A;  3WIM A;  2MBB B;  1UD7 A;  2KKC A;  4HXD A;  4BVU C;  3PSE B;  1WIA A;  4E74 A;  1TGZ B;  2KOX A;  2UWQ A;  4AOF A;  2KFJ A;  2EMT A;  3AUL A;  4M8N A;  4NJ6 A;  2ZCB A;  4BKT A;  5JHB A;  5C1Z A;  1I42 A;  2DYB A;  1OEY J;  2MP2 A;  3HIZ A;  3VFK A;  3PRP B;  4PYU A;  3KUC B;  4NQL B;  1E90 A;  2C7H A;  3TCA A;  1EF5 A;  2M17 A;  3DQV A;  4FJV B;  4JLC A;  2DYM A;  3ML8 A;  2MCN B;  4URK A;  2L7R A;  5JZE B;  1RRB A;  2CHX A;  3RCZ A;  2LVQ A;  1E8Z A;  2REX A;  3ZKJ C;  2ZCC A;  1WR6 E;  1WE7 A;  4KDL B;  3K9O B;  3Q3F A;  2V3S A;  2KX0 A;  4RMA A;  4GDL B;  1RAX A;  3ZVV A;  4GSW A;  3ZNH B;  4FHJ A;  3U7D A;  4KV2 A;  4DK5 A;  1UEL A;  3A9J B;  3IVF A;  4GXB A;  5E6O A;  2L76 A;  3TJP A;  4W9E A;  2KMC A;  2LGY A;  4FBJ B;  2KZR A;  3APC A;  2GBJ A;  4DWF A;  3PT2 B;  1NI2 A;  3QWZ B;  3A9K A;  5CHW A;  4ZRJ A;  3S2A A;  4BBN F;  3R7R A;  1WJN A;  4TUU A;  2IBI B;  2N7E A;  3UIO B;  1TTN A;  2EKE C;  4G0N B;  4W9I A;  2MA9 B;  4XZ4 A;  4WJN A;  5FR6 A;  2L05 A;  4GU2 A;  4MGY E;  4IC7 B;  4TQ1 A;  2LVO A;  1WM2 A;  3T9L A;  5J17 A;  3HHM A;  4LJP B;  4JQW C;  3H6N A;  2PE6 B;  2XBB C;  4FHK A;  4BKS D;  3ZNI D;  4W9C A;  2CKH B;  3H1U A;  4ANX A;  5KHO A;  4NY0 A;  1WX9 A;  2PPH A;  2RD0 A;  5DPT A;  2N9X A;  4YL8 A;  5AEK B;  1GNU A;  1WGR A;  2O2V B;  5LXH A;  1V6E A;  1WY8 A;  3ZO5 B;  5DPS A;  2KDI A;  4GDK A;  2O6V B;  3A9J A;  2DYO A;  2LAS A;  4NNJ B;  3RYT A;  3UQA A;  2FUH B;  2M8S A;  3DBR I;  2ZNV C;  3CSF A;  4KSK C;  4HPL B;  1U4A A;  4B6W A;  4I6N B;  2J0M A;  2L0F A;  3KH0 A;  2RSU A;  4NPN A;  4W9K A;  4MSM B;  4EOY A;  4ICU A;  1TZ1 A;  1Q1O A;  3UQB A;  2DAF A;  2KQS A;  3VVW B;  2FIF A;  4FA6 A;  1Q0W B;  3A1Q B;  4KZC A;  3AI5 A;  2JZ3 B;  3APF A;  3KW5 B;  4IW0 A;  1E8W A;  4HJK A;  2JXX A;  2NBU A;  5DCN A;  3MHS D;  2WDT B;  3JSV A;  1WZ3 A;  1P3Q U;  4I6P A;  3PLU A;  4K81 A;  4PS7 A;  2RR9 A;  2AL3 A;  3I3T B;  5CTR C;  3BIN A;  4CHK A;  2R2O A;  4DHZ E;  5DPW A;  4DHJ D;  1H8C A;  4HWI B;  2K25 A;  3TBL D;  1WGD A;  2Y5B B;  3B08 A;  3GOE A;  4GIV A;  5BO4 B;  1YX5 B;  2KDB A;  3BY4 B;  1OTR B;  4AJY B;  1V5T A;  3V6E B;  3CMM B;  1E7U A;  1P9D U;  3GZN I;  2MBO A;  4LDT B;  2MW5 A;  4TKN A;  4LJO B;  4IUM B;  3L13 A;  2JRI B;  2KWV B;  3VUY A;  4X57 B;  4WQO B;  3RT3 B;  3D32 A;  3DBH I;  1P1A A;  3QA8 A;  4KIK B;  5G2N A;  3T8M A;  4ANW A;  5HKH A;  3M3J A;  2N9P C;  5LXI B;  1NDD A;  1P98 A;  3KVF B;  4MSQ B;  2IY0 B;  2OJR A;  4DDI D;  1CMX B;  1R4M I;  2KVR A;  3PVL A;  1GC6 A;  2KAN A;  5D6J B;  3DOW A;  2PE9 A;  2BYV E;  4FJY A;  4CO7 A;  2NS5 A;  4AWJ A;  1W6V A;  2L3Z A;  2N1V A;  3ONS A;  1OEY A;  5CX3 A;  3MTN B;  2KX3 A;  3NHE B;  5CHF A;  1L7Y A;  1OQY A;  2LWP A;  2Z0E B;  4IM3 A;  3SU8 X;  3VXW A;  2M0X A;  3ZUN A;  4P7I A;  2K8B A;  4WJP A;  3PZD A;  4KSL C;  3VH4 B;  2XK5 B;  2KLC A;  4MJS B;  2MBQ A;  3KYC D;  2KXJ A;  3P2B A;  3PS6 A;  3B0A A;  4IWO A;  1D3Z A;  3DBS A;  1C3T A;  2O6V A;  1V2Y A;  3DDC B;  2L8J A;  2DEN B;  2LUE A;  1SIF A;  1E8Y A;  3PTF C;  4WWO A;  2C60 A;  2MQJ A;  4BBN C;  1IP9 A;  2R2Q A;  3A1Q A;  3KUD B;  1GJZ A;  2MRP A;  3ALB A;  1HE8 A;  1S3S G;  3RD2 A;  2LRW A;  4WWP A;  2ZNV B;  5AZH A;  4M0W B;  3DVN U;  1WGY A;  2QHO A;  3JSV B;  3NOB A;  3VHT C;  2K8H A;  2RGF A;  4KIK A;  2FCN A;  1FXT B;  5L83 A;  2M1M A;  4ZDV A;  1WZ0 A;  4G50 A;  4IWP A;  4NJ7 A;  4A3P A;  2BYF A;  1I35 A;  4G11 A;  4HDQ A;  4MEL A;  4M8M A;  2D3G A;  2C5L C;  2XK5 A;  4E3C A;  2LXA A;  4I6L B;  5AZF A;  4HK2 A;  2WWZ A;  1WXV A;  1WF9 A;  3VDZ A;  3VAW A;  2J7Q B;  2KC2 A;  1E5W A;  5JHA A;  2V4L A;  1YJ1 A;  2WX0 A;  1UGM A;  5AZG A;  2D07 B;  4BOS C;  4E71 A;  5JH5 C;  4JGH B;  2UYZ B;  1G6J A;  3ZNZ B;  2G3Q B;  2PEA A;  1V9J A;  3OJ3 A;  2C9W B;  4IWQ A;  3AU5 A;  3H7S A;  2LZ6 A;  2JWZ A;  3DPD A;  3RZW C;  2FCQ A;  3WAL A;  5C23 A;  3VTV A;  4EFO A;  1SE9 A;  2LGX A;  2XEW A;  4XX5 A;  3ZRF A;  4B9K A;  1VD2 A;  4IM0 A;  2GBR A;  1GC7 A;  4CYE A;  3MJW A;  2OOB B;  3WAN A;  2LXC A;  3EC8 A;  4MEM A;  4HDO A;  2ZEQ A;  1LXD A;  1H4R A;  3JYU A;  2N4F A;  1LQB A;  1C1Y B;  1ZW7 A;  2EMS A;  2ZPN A;  2IO0 B;  3W1S C;  2ZVN A;  3ZTC A;  4DXA B;  2JPH A;  1WXM A;  4ANU A;  2KLG A;  2JT4 B;  1GUA B;  4WWN A;  2LVP A;  2HTH A;  2NPT B;  1GG3 A;  4K1R B;  2KTF A;  2LGD A;  1LM8 B;  4AUQ C;  3RUI B;  3N30 A;  4ANV A;  1A5R A;  2GOW A;  3DCG A;  2BWE S;  3ENE A;  2V1Y A;  1EF1 A;  2FID A;  1J0G A;  2DX5 B;  3Q3J A;  4K7U A;  4OVV A;  3VQI A;  3R7Q A;  3OJ4 B;  2CHW A;  3R66 C;  3QK0 A;  3SD5 A;  3NS8 A;  3OLM D;  3QQ8 B;  4BFR A;  3QJZ A;  2FCM A;  1WI0 A;  1K8R B;  1UBI A;  1E7V A;  3PRM B;  3HM3 A;  2JF5 A;  2MBH A;  3L08 A;  3WAO A;  3JVZ X;  4DHJ B;  5IAA C;  5CHV C;  3NY5 A;  5J2R A;  1L2N A;  3V61 A;  3A33 B;  4MDK E;  1T0Y A;  2BF8 B;  2DZK A;  1V5O A;  5L95 C;  3IBE A;  3EEC A;  3SHQ A;  3QX1 A;  2KFK A;  2ZJD A;  1XQQ A;  2GBM A;  2WYQ A;  2IO3 B;  2JY6 A;  3EFU A;  2LRU A;  2GMI C;  2HJ8 A;  2D10 A;  3KUZ A;  3M95 A;  3ZDM C;  4EKU A;  5IA7 A;  4KZ0 A;  2Z0D B;  1ZKH A;  2J0K A;  2FCS A;  1WFY A;  2MX2 A;  3H9D A;  2ZVO A;  2K8C A;  3TIX A;  3VUX A;  1YQB A;  3AU4 A;  3PHX B;  4FLH A;  1RLF A;  2O6V D;  1NBF C;  3C0R B;  3PV1 A;  4DBG A;  2MSE D;  1ISN A;  3CF6 E;  2D2Q A;  3LMN A;  2CR5 A;  3V6C B;  2YLM A;  4BKG A;  4FAD A;  2C7M B;  1WGH A;  3ZIM A;  2ZPY A;  1J19 A;  4GOC A;  1IPG A;  2CS4 A;  4LCD E;  1XT9 B;  3HK0 A;  1V81 A;  3L10 B;  4IM2 A;  3UIN B;  3KYD D;  3M62 B;  3V62 A;  1WRD B;  2KJR A;  3W1Y A;  4ASW C;  2MLB A;  3V60 A;  3R3M A;  1RFA A;  3OAW A;  2KO3 A;  1KJT A;  4KVG B;  3UF8 A;  3RZF A;  1VCB A;  3L0W B;  2A4Z A;  4W9H A;  2PJH A;  4JIO U;  4ZRK A;  3VTU A;  3LDZ E;  4F1S A;  4A3O A;  4PS8 A;  1IYF A;  4XC2 A;  1X1M A;  4HCN B;  4ICV A;  4F8C B;  4A20 A;  4LDT D;  1UZX B;  2K39 A;  3PGE A;  4II3 B;  2KNB A;  3A4R A;  4F7Z A;  3VUW A;  3L54 A;  1M94 A;  2J0J A;  4W9L A;  1YX6 B;  3PPA A;  5D2M B;  2NPT A;  4ZYN A;  2KWC A;  5TR5 A;  4HCP B;  4WJO A;  1YIW A;  2LI5 A;  3PRZ A;  2CHZ A;  3DVN V;  1SGH A;  2Z59 B;  4W9F A;  3O65 B;  3PHW B;  5LLI A;  4RM8 A;  1J8C A;  5D94 A;  2HE7 A;  3VH3 B;  2KD0 A;  1WJ4 A;  4AP4 C;  2L0T A;  4MGK E;  3DVG Y;  3L17 A;  5E6N A;  1AAR A;  3N32 A;  2MWS B;  1OGW A;  1Y8R C;  1WMH B;  2MP2 B;  5E6P A;  3RUL A;  2NBW B;  1E8X A;  3LJ3 A;  4K7W A;  2DZJ A;  2G4D B;  2K1F A;  2KWU B;  1WYW B;  4GB9 A;  4HPM B;  3WAP A;  4IG7 B;  1F9J A;  2YVC A;  5D7G A;  4MH0 E;  2RPQ A;  2JRH A;  2KMA A;  4WJQ A;  3TMP B;  1KLV A;  4HLE A;  2KQ7 A;  4TQ0 A;  2A5U A;  2KC1 A;  4ZRI A;  4G3X B;  2JZZ A;  2ZZP B;  2IZV B;  1ZGU B;  2K6Q A;  1WGG A;  1WE6 A;  4N9F 4;  1WX7 A;  3IG3 A;  1S1Q B;  3APD A;  3N3K B;  4W9D A;  3SDL C;  1V49 A;  4GDL A;  4EZL A;  2IY1 B;  2B3A A; 
#chains in the Genus database with same CATH topology
 3TL5 A;  2KAJ A;  5GXG B;  3DBH B;  4IKG A;  2DBY A;  2PTL A;  2VRR B;  2KDF B;  4NQK E;  2W9N A;  2KTR A;  3HUI A;  1EUV B;  1PDX A;  3M63 B;  1UWX A;  3QAQ A;  2MJE A;  3DVG X;  1E10 A;  4RM9 A;  2GBK A;  2BYT A;  3UIP B;  1VZ8 A;  4FUL A;  3QC8 B;  3U4E G;  2M56 B;  1SF0 A;  2MEK A;  1V80 A;  4MJS A;  3LB8 C;  1UNS A;  2WX1 A;  2WP9 B;  2PVG C;  5IKC M;  4H2A A;  5EDS A;  3W1S A;  1C4A A;  2NBV B;  1EU3 A;  4OZB A;  3FIL A;  4DDG D;  3DWM A;  3ECI A;  4PYZ A;  5BMI A;  1LFD A;  4EEW A;  2KDE B;  2NR2 A;  4EZJ A;  4LNF A;  4RGM A;  1I4Q A;  3Q14 C;  3EHV A;  3QJZ A;  3PRE A;  2HD5 B;  2AX5 A;  2EEL A;  3X0W A;  1UWM A;  2IO1 B;  1L5P A;  1Q5W B;  4MGI E;  2OED A;  1XLN A;  2KHW B;  2TSS A;  2JU6 X;  3CST A;  2LUM A;  4GGQ A;  3URY A;  3AE6 B;  4GDK B;  3WAM A;  2DZI A;  2RMM A;  3AE7 B;  4K7S A;  3B2F A;  2I1J A;  3QCA A;  4LNN A;  4MGZ E;  5DPR A;  2J52 A;  3NZU A;  4E74 A;  5E6J A;  2KFJ A;  2EMT A;  4M8N A;  4NJ6 A;  1RM6 C;  5C1Z A;  5JHB A;  1D5X C;  4M02 A;  1MG4 A;  1OEY J;  4FXC A;  3FC4 A;  2FUG 1;  2Q5W D;  2ZW1 A;  5JZE B;  1RRB A;  2KDM A;  3BZD B;  1ESF A;  4GSW A;  3ZNH B;  4FHJ A;  4DK5 A;  1UEL A;  1HXY D;  5E6O A;  4Q2J A;  4W9E A;  1NI2 A;  4ZRJ A;  1L0X B;  1PGA A;  1SIJ A;  2N7E A;  3AEG B;  4EE2 A;  3IAS 1;  3TEZ A;  1QOB A;  4WJN A;  5FR6 A;  1NEN B;  4GU2 A;  4MGY E;  2D3C A;  4IC7 B;  2LVO A;  5J17 A;  4LJP B;  4HEA 1;  2PE6 B;  3KWL A;  4BKS D;  5AEK B;  2H88 B;  3RNE C;  2J53 A;  4GDK A;  4NNJ B;  3RYT A;  3UQA A;  1XEE A;  1U4A A;  5EE0 A;  2PKO A;  2ON8 A;  3KH0 A;  4YWG G;  1AN8 A;  3ZXV A;  2I38 A;  1Q1O A;  3UQB A;  2KQS A;  4FA6 A;  5HFY A;  3A1Q B;  3AI5 A;  3DHI C;  5FK9 C;  5DCN A;  2WDT B;  3JSV A;  1WZ3 A;  3I3T B;  3BIN A;  2R2O A;  3ZXR A;  2JZP A;  2Y5B B;  3B08 A;  4GIV A;  4XWW A;  5BO4 B;  1FEH A;  2KWD A;  1V5T A;  3V6E B;  4TKN A;  4YXD B;  1N63 A;  2JRI B;  1IUE A;  1N62 A;  2KWV B;  4P6V F;  4X57 B;  3D32 A;  1P1A A;  4JX1 C;  3T8M A;  4ANW A;  5LXI B;  1P98 A;  4KGR A;  1R4M I;  2BB6 A;  3AEF B;  2KAN A;  3B2G A;  4XDC A;  4CO7 A;  5H8Y E;  2NS5 A;  3ONS A;  2KX3 A;  5CHF A;  1D4B A;  1ACC A;  1T0Q C;  2Z0E B;  2M0X A;  3ZUN A;  4P7I A;  1F1H A;  3PZD A;  3VH4 B;  1V1O A;  3DHH C;  2BVC A;  5FR3 A;  3PS6 A;  1V2Y A;  1T3Q A;  4BBN C;  3Q8E A;  1J7A A;  2JYE A;  4YTN B;  1S3S G;  1C79 A;  2HTM E;  2KAC A;  5AZH A;  3NOB A;  2QIE B;  2K8H A;  2RGF A;  4KIK A;  1FXT B;  5L83 A;  1ZDX A;  3RNG C;  4IWP A;  4A3P A;  1I35 A;  4HDQ A;  2D3G A;  2R61 A;  3BWU D;  5AZF A;  2VZK B;  2WWZ A;  1WF9 A;  3VDZ A;  3VAW A;  2J7Q B;  1OQQ A;  5JHA A;  2D07 B;  3PO0 A;  1KFY B;  1D5Z C;  2ZW0 A;  3W5U B;  3ZNZ B;  2G3Q B;  1V9J A;  3H7S A;  3WAL A;  5C23 A;  5JXV A;  4XX5 A;  3ZRF A;  4B9K A;  4IM0 A;  2GBR A;  3P63 A;  4K3C A;  4CYE A;  2LXC A;  3EC8 A;  2V3N A;  3KLS X;  2BS4 B;  2ZPN A;  2EMS A;  2IO0 B;  1KF6 B;  4DXA B;  3DWG C;  2KLG A;  1FRR A;  1K53 A;  3ZGZ A;  1QOF A;  1LM8 B;  1HEZ E;  3N30 A;  1A5R A;  2GOW A;  2FE8 A;  4TSS A;  2FID A;  2DX5 B;  3SD5 A;  1QOA A;  3OLM D;  3QQ8 B;  4BFR A;  1K8R B;  3GE8 C;  1E7V A;  2JF5 A;  3NY5 A;  1QF6 A;  3N20 C;  3P4Q B;  4HJG E;  1YQ3 B;  3W9C B;  1PFD A;  1K51 A;  4TMA B;  2WYQ A;  1QOG A;  1SEB D;  2GMI C;  1ZXH A;  3KUZ A;  1TZO A;  1TKE A;  4ZHO A;  1KLG D;  2Z0D B;  2J0K A;  2M19 A;  2INP E;  1FIQ A;  1QIL A;  3AU4 A;  3PHX B;  2Y5C A;  3C19 A;  4DBG A;  3LMN A;  4BKG A;  2LHE A;  1WGH A;  1MHH E;  1IPG A;  2WXK A;  1XT9 B;  3V62 A;  2HDE A;  1EU4 A;  1CZP A;  4S17 A;  1K50 A;  3OAW A;  1TKG A;  4W9H A;  3ZYY X;  3LYY A;  1Y56 A;  2FBW B;  3VTU A;  4A3O A;  4PS8 A;  4B0M A;  4HCN B;  4F8C B;  1MPE A;  4LDT D;  3PGE A;  4L23 A;  4II3 B;  4KGS A;  1JWB D;  2N9K A;  4W9L A;  5D2M B;  2NPT A;  5TR5 A;  3PRZ A;  1UF0 A;  2WXM A;  3O65 B;  4RM8 A;  5D94 A;  2KD0 A;  3UI3 A;  1GAQ B;  4K3B A;  3BVZ A;  4DXG A;  4OVZ A;  1R7S A;  4RGO S;  3LJ3 A;  2DZJ A;  2K1F A;  4A6Q A;  4ITK A;  3GE3 C;  1F9J A;  1ZUD 2;  2WDR B;  4XWT A;  5D7G A;  2LHD A;  1KLV A;  4HLE A;  3HVD A;  2WHI A;  4ZRI A;  3MHZ A;  2D3B A;  1JCK B;  2QSD A;  1WE6 A;  1WX7 A;  4M00 A;  1NYQ A;  2WU5 B;  2N1W A;  1E7P B;  1WXA A;  2Y3A A;  3ZDT A;  2O2V A;  3PLV A;  3CWI A;  3FIL B;  3K9P B;  1VR9 A;  2IO2 B;  2DWQ A;  3P1M A;  5LNK 1;  1NEK B;  1BT0 A;  2YEP F;  4N59 A;  5IP4 D;  1JRU A;  1YD8 U;  3QHT A;  3IAM 1;  2KJH B;  3BK2 A;  2DZM A;  3ZNG C;  4J3O D;  1T6B X;  4OVU A;  1WX8 A;  4PS3 A;  4DHZ B;  2C7N B;  2KK8 A;  2AYO B;  3NZS A;  1TIF A;  2KTR B;  4PT5 A;  4A90 A;  2KN5 A;  1WM3 A;  1JWS D;  3AXC A;  1KOT A;  1VZ7 A;  4W9J A;  2DNF A;  2IND C;  1UBQ A;  1WH3 A;  2L1A A;  2QJL A;  1XXG A;  1CQV A;  3A4S C;  1XD3 B;  4W9G A;  1MG8 A;  4KDI C;  2LJ5 A;  3HM6 X;  1WR1 A;  1WXS A;  1JQ4 A;  2D11 A;  3ZRC A;  1PQS A;  2L32 A;  1ROE A;  4JWU C;  5J18 A;  4WAA A;  2M0A A;  2CU1 A;  5D3D A;  2GBN A;  5KHQ A;  2IYD B;  2NTT A;  4II2 B;  2MBB B;  4C00 A;  4BVU C;  4AOF A;  2ONQ A;  1ZE3 D;  2ZCB A;  4BKT A;  2DYB A;  3VFK A;  3PRP B;  4MAC A;  4PYU A;  1E90 A;  5MPO A;  4FJV B;  2DYM A;  3AEE B;  2MCN B;  2L7R A;  2NTS A;  3RCZ A;  1FNV A;  2AQ3 B;  3NVZ A;  1E6E B;  3K9O B;  3Q3F A;  2KX0 A;  4GDL B;  1RAX A;  3ZVV A;  3U7D A;  3IVF A;  2L76 A;  1ZP0 B;  2QCZ A;  3TJP A;  2KMC A;  2INC C;  4URK A;  2BS3 B;  2WS3 B;  3QWZ B;  5CHW A;  3RNA C;  3S2A A;  1WJN A;  2BBC A;  4ZRP A;  1SB3 C;  1QKZ A;  4NAM A;  1NI3 A;  1WM2 A;  3T9L A;  4FHK A;  3ZNI D;  4W9C A;  4ANX A;  5KHO A;  4NY0 A;  2PPH A;  4BAX A;  2N9X A;  1V6E A;  4HRO A;  2O6V B;  3A9J A;  2DYO A;  3DBR I;  2W54 A;  3CSF A;  4HPL B;  3I5J C;  4B6W A;  1GOZ A;  2L0F A;  4W9K A;  4NPN A;  4MSM B;  1TZ1 A;  2FIF A;  3RMK C;  4KZC A;  2JZ3 B;  4IW0 A;  1E8W A;  1ZDV A;  1P3Q U;  2IPK D;  4PS7 A;  2N9L A;  1I4H A;  4DHJ D;  3TBL D;  1WGD A;  1F77 A;  1YX5 B;  2KDB A;  2INN E;  2QMT A;  4LK0 M;  1JW9 D;  3I57 A;  3DBH I;  1FRD A;  3QA8 A;  4KIK B;  5G2N A;  3EA6 A;  5HKH A;  3V3X A;  3KVF B;  4MSQ B;  2OJR A;  4DDI D;  1L0Y B;  3PVL A;  3DOW A;  2PE9 A;  1L0V B;  3P4R B;  2N1V A;  1OEY A;  2WGS A;  1SE4 A;  4M01 A;  4US9 A;  2QEJ C;  1VDV A;  2B76 B;  3GS2 A;  3U7Z A;  4KSL C;  2G1E A;  2KLC A;  2MBQ A;  3P2B A;  1CK1 A;  4RGN A;  4R3D A;  3RNB C;  1E8Y A;  4A8X C;  4YTM B;  3KUD B;  4WAF A;  1HE8 A;  2K3U A;  2OJW A;  1TS5 A;  3TEX A;  4M0W B;  5EE1 A;  2M1M A;  4ZDV A;  3T3N A;  4NJ7 A;  3MJ5 A;  4E3C A;  3LXF A;  2ACZ B;  1V97 A;  3ZJT A;  3ZJV A;  2KC2 A;  2K22 A;  1UGM A;  1L6V A;  1I4X A;  2RDH A;  4JGH B;  3Q3N C;  3AE3 B;  2PEA A;  4AJY B;  2C9W B;  1IBX B;  3DPD A;  2FCQ A;  3RNC C;  3EFC A;  1VD2 A;  3ETR A;  3MJW A;  3WAN A;  1D5M C;  1TT5 B;  4MEM A;  2ZEQ A;  3PZ7 A;  1LQB A;  2N4F A;  1ZW7 A;  1YJI A;  4RH6 A;  1JWM D;  3FKY A;  2JPH A;  1GUA B;  2RDG A;  2LVP A;  2HTH A;  1MHX A;  2KTF A;  1SSN A;  3EUB 2;  3RUI B;  2BWE S;  1J0G A;  1EF1 A;  1IBX A;  3AE1 B;  3Q3J A;  4K7U A;  2V0G A;  2WXQ A;  2JX5 A;  2FCM A;  3DBL B;  2K0P A;  1UBI A;  2AQ1 B;  2MJ3 A;  3PRM B;  3HM3 A;  3WAO A;  2MBH A;  3L08 A;  5IAA C;  4S0R A;  5CHV C;  4MDK E;  2DZK A;  3MC8 A;  1C78 A;  1V5O A;  2Y5P A;  2Z8L A;  5L95 C;  4MH8 A;  2KFK A;  2ZJD A;  3NVW A;  2IO3 B;  2JY6 A;  4C56 C;  3PZ8 A;  1TKY A;  2JXT A;  1PUT A;  3AH7 A;  1J7B A;  5IA7 A;  2W3S A;  2IGG A;  1ZKH A;  2MX2 A;  2K8C A;  1ET9 A;  2J42 A;  3WCQ A;  1YQB A;  1SJE D;  1QQR A;  2LGI A;  4FLH A;  1J7C A;  3C0R B;  4YSZ B;  4CQN A;  3CF6 E;  2D2Q A;  3ZQ4 A;  3V6C B;  3P42 A;  4FAD A;  4HRS A;  5HG2 A;  3HK0 A;  1WRD B;  2KJR A;  2WXJ A;  3V60 A;  3T3O A;  2UU7 A;  2KO3 A;  1I7H A;  3KQ4 A;  3L0W B;  1SE3 A;  4JIO U;  1X1M A;  2X8X X;  4ICV A;  1DGJ A;  1SE2 A;  2KNB A;  3HRD D;  3L54 A;  4WWM A;  1C4C A;  1T0S C;  3TUO A;  2LI5 A;  2CHZ A;  4REZ A;  3DVN V;  1HTQ A;  1SGH A;  4W9F A;  1J8C A;  2HE7 A;  4N6E B;  2BB5 A;  4AP4 C;  2L0T A;  4AS1 A;  3L17 A;  2E3T A;  4IDI A;  1FM0 D;  2BW2 A;  1A70 A;  1VJK A;  1Y8R C;  2ICI A;  2MP2 B;  1V1P A;  3AE2 B;  3BVM A;  4GB9 A;  2JWU A;  3WAP A;  4IG7 B;  5BYS A;  4WIP A;  2YVC A;  4MH0 E;  2RPQ A;  3TMP B;  2KQ7 A;  2JSV X;  4TQ0 A;  5AUI A;  2A5U A;  2KC1 A;  4KKJ A;  3R2T A;  3AED B;  2IZV B;  4C7Z A;  4N9F 4;  4W9D A;  2MH7 A;  1HQR D;  3SDL C;  1FNW A;  4LLG M;  4EZL A;  1XLQ A;  3RN9 C;  1R4N I;  1WJU A;  2AL6 A;  4B95 A;  3J9C A;  3W5V B;  3IXS A;  1UUP A;  2PVO D;  3V05 A;  1E9M A;  5GMV A;  3JW0 X;  2FNJ B;  1XLP A;  1C9F A;  3B1L X;  4ZHP A;  1FD6 A;  4P16 A;  1STE A;  1JRO A;  4MM3 B;  3UGB B;  3ZJU A;  4J6I A;  4LTU A;  4MT5 A;  2G45 B;  1FO4 A;  2I1K A;  2J4X A;  1WJ6 A;  1V86 A;  3VTW A;  3L16 A;  2G4S A;  1KRH A;  2AWT A;  2BWF A;  2N7D A;  3H7P B;  4NAW A;  2FAZ A;  4NAW B;  3Q3M C;  3QIJ A;  4HVB A;  2WQY B;  4EUT A;  1TBE A;  2DAJ A;  4GMV A;  3WA0 A;  2LEK A;  1C77 A;  4P1C C;  3IFW B;  1NYR A;  2MBE A;  3MP9 A;  1EO6 A;  1QZE A;  1FCC C;  2LD9 A;  2RDB C;  3N1Z C;  2KVZ A;  1YN5 A;  4BKS A;  3X23 A;  1KM7 A;  3NJT A;  4MM3 A;  2V9H A;  2AEH A;  2I2Y A;  3AE8 B;  4HXD A;  5IN7 A;  1TS4 A;  1B1Z A;  1WIA A;  1YQ4 B;  2KOX A;  3PSE B;  3AUL A;  1I42 A;  3MFG A;  3MC9 A;  3HIZ A;  1BML C;  1L4Z B;  4NQL B;  2C7H A;  3DQV A;  1DYQ A;  3ML8 A;  4BZA A;  2CHX A;  5TSS A;  3Q2A C;  2LVQ A;  2ZCC A;  1WR6 E;  1WE7 A;  2YEP B;  2XN9 C;  2X38 A;  3NZ3 A;  2JQR B;  4KV2 A;  1IGC A;  3A9J B;  2KN4 A;  3H8H A;  2LGY A;  4FBJ B;  3NUH B;  2KZR A;  3APC A;  4C7Y A;  3PT2 B;  3R8B A;  4BBN F;  2PLP A;  2NMQ A;  3R7R A;  4TUU A;  2IBI B;  1XF5 L;  2EKE C;  4G0N B;  4W9I A;  3TEY A;  4RCO A;  4XZ4 A;  2L05 A;  1F0Z A;  1GB1 A;  4JQW C;  3H6N A;  1FFV A;  1IGD A;  3H1U A;  1WX9 A;  2RD0 A;  5DPT A;  1WGR A;  2BTE A;  2O2V B;  1FFU A;  3AEA B;  5DPS A;  2KDI A;  2WXH A;  2WLB A;  2LAS A;  2PW9 A;  3GP7 A;  2M8S A;  1ZOY B;  2ZNV C;  4KSK C;  1M4V A;  2WU2 B;  2J0M A;  3Q3O C;  1AWD A;  4YSY B;  4ICU A;  2KQ4 X;  3TSS A;  2AQ2 B;  1Q0W B;  3APF A;  4JPS A;  4HJK A;  2JXX A;  1TJE A;  3MHS D;  2WXR A;  3PLU A;  1KH0 A;  4K81 A;  3IT4 B;  2RR9 A;  2AL3 A;  5BMH A;  4CHK A;  4DHZ E;  5DPW A;  1H8C A;  2N7J A;  4HWI B;  1I4P A;  3GOE A;  3BY4 B;  1HTO A;  3CMM B;  1E7U A;  3GZN I;  2MW5 A;  4LJO B;  4IUM B;  4L2Y A;  4HKZ E;  3M3J A;  2N0S B;  1NDD A;  2IY0 B;  2KVR A;  5D6J B;  2BYV E;  1DOI A;  4AWJ A;  2W3R A;  3Q8A A;  3MTN B;  4KX6 B;  1L7Y A;  1OQY A;  2CU3 A;  1BXT A;  1SBB B;  3VXW A;  2XK5 B;  3KYC D;  4USA A;  1OQR A;  4IWO A;  1D3Z A;  3DBS A;  1C3T A;  3DDC B;  2L8J A;  2DEN B;  2V3P A;  3AMZ A;  1YN4 A;  2IGH A;  4WWO A;  2C60 A;  2MQJ A;  2R2Q A;  3A1Q A;  4US8 A;  3ALB A;  2LRW A;  3VR8 B;  3TEW A;  3R2I A;  4DWF A;  4JE3 B;  2QHO A;  1Q10 A;  1SJH D;  4G50 A;  2WXF A;  4G11 A;  4MEL A;  4M8M A;  3DBR B;  2XK5 A;  2LXA A;  2CJO A;  4QAY A;  1TY2 A;  1E5W A;  2PMV A;  2V4L A;  4KGT A;  1YJ1 A;  2WX0 A;  3CIR B;  5AZG A;  2LMC A;  4E71 A;  1KTK A;  2UYZ B;  3OJ3 A;  2MJD A;  3AU5 A;  2LZ6 A;  3RZW C;  3VTV A;  1SE9 A;  2LGX A;  2XEW A;  4A9A A;  3AV8 A;  3VRB B;  4HDO A;  1SXT A;  1C1Y B;  3W1S C;  4RNA A;  1FPY A;  1WXM A;  4WWN A;  3U2S C;  2NPT B;  3BVG A;  4K1R B;  2LGD A;  4AUQ C;  3DCG A;  3ENE A;  2V1Y A;  3R7Q A;  3OJ4 B;  3QK0 A;  3U52 E;  3NS8 A;  2H89 B;  1WI0 A;  5BYQ A;  4DHJ B;  2WDV B;  3JVZ X;  1C76 A;  3RI7 C;  2VH2 A;  1L2N A;  1NVI D;  1QLB B;  3V61 A;  3A33 B;  2V4I B;  2BF8 B;  4D2K A;  3EEC A;  2WXN A;  1XQQ A;  2LRU A;  1RFK A;  2HJ8 A;  2D10 A;  3M95 A;  3ZDM C;  3AB5 A;  4KZ0 A;  4YT0 B;  1WFY A;  2ZVO A;  3N1Y C;  3VUX A;  3Q8F A;  4A55 A;  3I9V 1;  4RFB A;  2O6V D;  4KKI A;  3PV1 A;  1ENF A;  2KT7 A;  2YLM A;  3ZIM A;  1J19 A;  4GOC A;  2CS4 A;  4LCD E;  3UIN B;  1V81 A;  3M62 B;  2JYT A;  1VRA B;  2MLB A;  3P4P B;  4ACF A;  4KVG B;  1T0R C;  1VCB A;  2WXL A;  2A4Z A;  2PJH A;  4ZRK A;  3LDZ E;  4F1S A;  1IYF A;  4DQO C;  1ET6 A;  1JML A;  1UZX B;  2K39 A;  3E56 A;  3NG0 A;  3A4R A;  2G9H D;  3VUW A;  1RWS A;  2J0J A;  5G5H A;  5C2T B;  1YX6 B;  1E0Z A;  1YJJ A;  1MI0 A;  4WJO A;  3SEB A;  5IOI A;  2Z59 B;  5LLI A;  1V1P B;  3VH3 B;  5BMG A;  5E6N A;  1XCT L;  1AAR A;  1OGW A;  4ZYS A;  3Q69 A;  5E6P A;  3RUL A;  2NBW B;  1E8X A;  4K7W A;  1XCQ L;  2G4D B;  2KWU B;  1WYG A;  2DLB A;  5BYR A;  4HPM B;  1F2R I;  3N1X C;  2JRH A;  3C8Y A;  4WJQ A;  1VLB A;  4G3X B;  5FKA C;  2JZZ A;  2K6Q A;  1WGG A;  3OWE B;  1N5X A;  1S1Q B;  3APD A;  3N3K B;  1V49 A;  4GDL A;  2EKI A;  1UH6 A;  4P1B C;  1VZ6 A;  1RYJ A;  3HVZ A;  4TV3 A;  3GZN B;  3SR6 A;  2CJN A;  3A9K B;  2BT6 A;  2JVC A;  4RF1 A;  4ARI A;  4BOZ B;  3H7P A;  5G55 A;  2K6D B;  2NVU I;  3ZLZ A;  3ML9 A;  1P7F A;  4NJC A;  4WUR A;  3AEC B;  4GN1 A;  4JL9 A;  3DBL I;  1P0R A;  1GB4 A;  2BPS A;  2L52 A;  1V8C A;  2WXI A;  4FN2 A;  1HZ5 A;  2KFK B;  1FNU A;  2NCN A;  1P7E A;  3N9Y C;  1WMH A;  2N9E B;  3U8Z A;  2BKF A;  2DHZ A;  2L00 B;  2M4N A;  3ABV B;  4C4V B;  1MVK A;  3ZTD A;  2ASQ A;  2BYE A;  4AJW A;  4UDU C;  2BS2 B;  2BKR B;  3IHP C;  2BGF A;  2K5P A;  3U30 A;  4XE0 A;  4EZK A;  4YSX B;  1Z5S B;  3ZW3 A;  3QAR A;  1JWA D;  3SFD B;  2JUO A;  5T8I A;  2KJ6 A;  4FJZ A;  4HPP A;  1Z2M A;  4YTP B;  1F52 A;  3NRZ A;  3WIM A;  1UD7 A;  2KKC A;  2LJI A;  1TGZ B;  2UWQ A;  4O1N A;  1QT9 A;  1JAL A;  5C3J B;  2MP2 A;  3TCA A;  3KUC B;  5HHD G;  1LGR A;  1EF5 A;  2M17 A;  4JLC A;  3BK1 A;  4ZRQ A;  5EE9 A;  3ZKJ C;  1E8Z A;  2REX A;  1WSP A;  4LNO A;  4KDL B;  1AYF A;  4RGT A;  2V3S A;  4RMA A;  5I4D A;  4GXB A;  2KYW A;  1WRI A;  2GBJ A;  3A9K A;  3BYY B;  2L83 A;  1N61 A;  2W55 A;  1TTN A;  3UIO B;  2MA9 B;  1TS3 A;  3RNF C;  4TQ1 A;  2LGS A;  3BYT B;  4C4V A;  1TY0 A;  3HHM A;  2WDQ B;  2XBB C;  4ZOH C;  2CKH B;  4YL8 A;  1GNU A;  2WXO A;  5LXH A;  1WY8 A;  3ZO5 B;  2GLS A;  1OFF A;  2QIL A;  2FUH B;  3AEB B;  4I6N B;  1EWC A;  2RSU A;  4EOY A;  3IT6 B;  1LO5 D;  2RPV A;  2DAF A;  3VVW B;  3L4P A;  2WXG A;  3KW5 B;  1I4G A;  2NBU A;  1EM7 A;  4XYC A;  3GB1 A;  4I6P A;  1FCL A;  5CTR C;  4AQ7 A;  3P4S B;  2K25 A;  3EGR A;  1R4N B;  3KWV A;  5EE3 A;  1YOV B;  1OTR B;  3Q8B A;  4OZA A;  1P9D U;  2MBO A;  4LDT B;  1UGJ A;  3L13 A;  3SFE B;  1HZ6 A;  3VUY A;  4N58 A;  1R4M B;  4WQO B;  3RT3 B;  1XLO A;  1AW7 A;  2N9P C;  1CMX B;  1GC6 A;  2SAK A;  2IGD A;  4NZL B;  4FJY A;  2LFI A;  1PGB A;  1W6V A;  2L3Z A;  5CX3 A;  5H92 C;  3NHE B;  2LWP A;  4IM3 A;  1WGK A;  3SU8 X;  1N5W A;  2QDF A;  2K8B A;  4WJP A;  5G5G A;  1DOY A;  3E9S A;  1TS2 A;  4MJS B;  4XGA B;  2KXJ A;  1FXA A;  3B0A A;  1D6E C;  4RF0 A;  2O6V A;  1N60 A;  2LUE A;  1GPX A;  1SIF A;  1FXI A;  3Q8C A;  3PTF C;  4OW0 A;  4IOI E;  4OZC A;  2VZK D;  5IO9 A;  1IP9 A;  1GJZ A;  2MRP A;  3RD2 A;  3NVY A;  3O13 A;  4WWP A;  2ZNV B;  3DVN U;  1WGY A;  3VHT C;  3JSV B;  2FCN A;  1WZ0 A;  1XO3 A;  2BYF A;  4GLS C;  3B9J A;  2C5L C;  3FAH A;  2WNM A;  4M0W A;  4I6L B;  1PGX A;  1FMA D;  4HK2 A;  2IJ0 A;  1WXV A;  1L6U A;  4BOS C;  5JH5 C;  3VRA B;  1G6J A;  4LNI A;  4IWQ A;  2D5G A;  3W2D A;  3I63 C;  4B0E A;  2JWZ A;  4XDD A;  2W82 A;  5D3I B;  4EFO A;  2WXP A;  1GC7 A;  3VR9 B;  2VH1 A;  2OOB B;  1TYG B;  2QC8 A;  1C4P A;  3NS1 A;  2BQQ A;  1LXD A;  1H4R A;  3JYU A;  2ZVN A;  3ZTC A;  3AE4 B;  4ANU A;  2JT4 B;  3AE9 B;  4LNK A;  1GG3 A;  2HJ1 A;  4ANV A;  3Q6B A;  4OVV A;  3VQI A;  2CHW A;  1MJD A;  3R66 C;  4WH4 A;  1DOX A;  1L4D B;  3AE5 B;  2PIA A;  2GI9 A;  2K9X A;  1MFW A;  1PYW D;  5J2R A;  2XNA C;  1T0Y A;  1EWY C;  1HA5 A;  3IBE A;  3SHQ A;  3QX1 A;  2GB1 A;  2GBM A;  1JWU D;  3EFU A;  4EKU A;  2OHF A;  4C80 A;  2D3A A;  2FCS A;  3H9D A;  1F2R C;  3TIX A;  3AM9 A;  3AN1 A;  1RLF A;  1NBF C;  2MSE D;  1ISN A;  1YNT E;  2CR5 A;  1YN3 A;  2C7M B;  1B9R A;  2ZPY A;  2SEB D;  1YMH E;  3NVV A;  3DHG C;  3L10 B;  4IM2 A;  4JWS C;  3W1Y A;  3KYD D;  4ASW C;  1WXQ A;  2KMM A;  3R3M A;  1RFA A;  1BUI C;  1KJT A;  3UF8 A;  1WWT A;  3RZF A;  4PK1 A;  3BII D;  2IDY A;  4XC2 A;  2E6X A;  2GRI A;  4A20 A;  4WQM A;  4F7Z A;  1ZPS A;  1M94 A;  1CJE A;  4HKQ A;  3PPA A;  4ZYN A;  2KWC A;  4HCP B;  1YIW A;  4DXF A;  4OHJ A;  1K52 A;  3RPF C;  3OG5 A;  1N6Z A;  3PHW B;  1T5X D;  5AUK A;  1WJ4 A;  4MGK E;  1JRP A;  3DVG Y;  5HI1 A;  3N32 A;  2MWS B;  1WMH B;  2MHJ A;  1ZXI A;  3MC0 B;  1WYW B;  2KMA A;  2ZZP B;  3RFZ B;  1ZGU B;  4ARC A;  3IG3 A;  1KLU D;  2IY1 B;  2B3A A;  4L1B A;  1I4R A; 
#chains in the Genus database with same CATH homology
 3TL5 A;  2N1W A;  1WXA A;  1R4N I;  1WJU A;  1UH6 A;  2AL6 A;  4B95 A;  3ZDT A;  2VRR B;  2KDF B;  2O2V A;  3PLV A;  4NQK E;  3K9P B;  2W9N A;  2IO2 B;  1BT0 A;  2KTR A;  4TV3 A;  1EUV B;  1JRU A;  1YD8 U;  3QHT A;  3M63 B;  3A9K B;  3QAQ A;  5GMV A;  2KJH B;  3JW0 X;  2JVC A;  2DZM A;  2FNJ B;  3ZNG C;  3DVG X;  4BOZ B;  3B1L X;  4RM9 A;  2GBK A;  4OVU A;  1WX8 A;  3H7P A;  4PS3 A;  5G55 A;  2K6D B;  2NVU I;  4FUL A;  3UIP B;  3ML9 A;  3ZLZ A;  3QC8 B;  4DHZ B;  3UGB B;  2C7N B;  2KK8 A;  4J6I A;  1V80 A;  2G45 B;  4MJS A;  4GN1 A;  4JL9 A;  2AYO B;  2I1K A;  2WX1 A;  3NZS A;  1WJ6 A;  1V86 A;  3DBL I;  1P0R A;  2KTR B;  2BPS A;  3VTW A;  3L16 A;  3W1S A;  2G4S A;  5EDS A;  2NBV B;  2KN5 A;  1WM3 A;  2AWT A;  2KFK B;  4FN2 A;  2BWF A;  2N7D A;  3AXC A;  2NCN A;  4DDG D;  1KOT A;  3ECI A;  4PYZ A;  3H7P B;  4NAW A;  2FAZ A;  4NAW B;  4W9J A;  1LFD A;  4EEW A;  3QIJ A;  1UBQ A;  1WMH A;  1WH3 A;  2KDE B;  2NR2 A;  4EZJ A;  4HVB A;  2N9E B;  3A4S C;  4W9G A;  1TBE A;  1XD3 B;  3U8Z A;  4EUT A;  2BKF A;  2DHZ A;  3EHV A;  1MG8 A;  3PRE A;  2HD5 B;  2L00 B;  2DAJ A;  2M4N A;  2LJ5 A;  3HM6 X;  4GMV A;  4KDI C;  3WA0 A;  3X0W A;  1WR1 A;  2IO1 B;  1WXS A;  1Q5W B;  2ASQ A;  3IFW B;  3ZTD A;  2BYE A;  2D11 A;  4MGI E;  4AJW A;  3ZRC A;  2BKR B;  3IHP C;  2KHW B;  1PQS A;  2BGF A;  3U30 A;  2MBE A;  3CST A;  4EZK A;  4GGQ A;  1EO6 A;  5J18 A;  1QZE A;  4WAA A;  1Z5S B;  4GDK B;  2LD9 A;  3WAM A;  3QAR A;  3ZW3 A;  2JUO A;  2DZI A;  2CU1 A;  2KJ6 A;  2GBN A;  4BKS A;  5KHQ A;  4K7S A;  2IYD B;  4FJZ A;  2I1J A;  1KM7 A;  3QCA A;  3X23 A;  4MM3 A;  1Z2M A;  4II2 B;  2AEH A;  4MGZ E;  5DPR A;  3NZU A;  3WIM A;  2MBB B;  1UD7 A;  2KKC A;  4HXD A;  4BVU C;  3PSE B;  1WIA A;  4E74 A;  1TGZ B;  2KOX A;  2UWQ A;  4AOF A;  2KFJ A;  2EMT A;  3AUL A;  4M8N A;  4NJ6 A;  2ZCB A;  4BKT A;  5JHB A;  5C1Z A;  1I42 A;  2DYB A;  1OEY J;  2MP2 A;  3HIZ A;  3VFK A;  3PRP B;  4PYU A;  3KUC B;  4NQL B;  1E90 A;  2C7H A;  3TCA A;  1EF5 A;  2M17 A;  3DQV A;  4FJV B;  4JLC A;  2DYM A;  3ML8 A;  2MCN B;  4URK A;  2L7R A;  5JZE B;  1RRB A;  2CHX A;  3RCZ A;  2LVQ A;  1E8Z A;  2REX A;  3ZKJ C;  2ZCC A;  1WR6 E;  1WE7 A;  4KDL B;  3K9O B;  3Q3F A;  2V3S A;  2KX0 A;  4RMA A;  4GDL B;  1RAX A;  3ZVV A;  4GSW A;  3ZNH B;  4FHJ A;  3U7D A;  4KV2 A;  4DK5 A;  1UEL A;  3A9J B;  3IVF A;  4GXB A;  5E6O A;  2L76 A;  3TJP A;  4W9E A;  2KMC A;  2LGY A;  4FBJ B;  2KZR A;  3APC A;  2GBJ A;  4DWF A;  3PT2 B;  1NI2 A;  3QWZ B;  3A9K A;  5CHW A;  4ZRJ A;  3S2A A;  4BBN F;  3R7R A;  1WJN A;  4TUU A;  2IBI B;  2N7E A;  3UIO B;  1TTN A;  2EKE C;  4G0N B;  4W9I A;  2MA9 B;  4XZ4 A;  4WJN A;  5FR6 A;  2L05 A;  4GU2 A;  4MGY E;  4IC7 B;  4TQ1 A;  2LVO A;  1WM2 A;  3T9L A;  5J17 A;  3HHM A;  4LJP B;  4JQW C;  3H6N A;  2PE6 B;  2XBB C;  4FHK A;  4BKS D;  3ZNI D;  4W9C A;  2CKH B;  3H1U A;  4ANX A;  5KHO A;  4NY0 A;  1WX9 A;  2PPH A;  2RD0 A;  5DPT A;  2N9X A;  4YL8 A;  5AEK B;  1GNU A;  1WGR A;  2O2V B;  5LXH A;  1V6E A;  1WY8 A;  3ZO5 B;  5DPS A;  2KDI A;  4GDK A;  2O6V B;  3A9J A;  2DYO A;  2LAS A;  4NNJ B;  3RYT A;  3UQA A;  2FUH B;  2M8S A;  3DBR I;  2ZNV C;  3CSF A;  4KSK C;  4HPL B;  1U4A A;  4B6W A;  4I6N B;  2J0M A;  2L0F A;  3KH0 A;  2RSU A;  4NPN A;  4W9K A;  4MSM B;  4EOY A;  4ICU A;  1TZ1 A;  1Q1O A;  3UQB A;  2DAF A;  2KQS A;  3VVW B;  2FIF A;  4FA6 A;  1Q0W B;  3A1Q B;  4KZC A;  3AI5 A;  2JZ3 B;  3APF A;  3KW5 B;  4IW0 A;  1E8W A;  4HJK A;  2JXX A;  2NBU A;  5DCN A;  3MHS D;  2WDT B;  3JSV A;  1WZ3 A;  1P3Q U;  4I6P A;  3PLU A;  4K81 A;  4PS7 A;  2RR9 A;  2AL3 A;  3I3T B;  5CTR C;  3BIN A;  4CHK A;  2R2O A;  4DHZ E;  5DPW A;  4DHJ D;  1H8C A;  4HWI B;  2K25 A;  3TBL D;  1WGD A;  2Y5B B;  3B08 A;  3GOE A;  4GIV A;  5BO4 B;  1YX5 B;  2KDB A;  3BY4 B;  1OTR B;  4AJY B;  1V5T A;  3V6E B;  3CMM B;  1E7U A;  1P9D U;  3GZN I;  2MBO A;  4LDT B;  2MW5 A;  4TKN A;  4LJO B;  4IUM B;  3L13 A;  2JRI B;  2KWV B;  3VUY A;  4X57 B;  4WQO B;  3RT3 B;  3D32 A;  3DBH I;  1P1A A;  3QA8 A;  4KIK B;  5G2N A;  3T8M A;  4ANW A;  5HKH A;  3M3J A;  2N9P C;  5LXI B;  1NDD A;  1P98 A;  3KVF B;  4MSQ B;  2IY0 B;  2OJR A;  4DDI D;  1CMX B;  1R4M I;  2KVR A;  3PVL A;  1GC6 A;  2KAN A;  5D6J B;  3DOW A;  2PE9 A;  2BYV E;  4FJY A;  4CO7 A;  2NS5 A;  4AWJ A;  1W6V A;  2L3Z A;  2N1V A;  3ONS A;  1OEY A;  5CX3 A;  3MTN B;  2KX3 A;  3NHE B;  5CHF A;  1L7Y A;  1OQY A;  2LWP A;  2Z0E B;  4IM3 A;  3SU8 X;  3VXW A;  2M0X A;  3ZUN A;  4P7I A;  2K8B A;  4WJP A;  3PZD A;  4KSL C;  3VH4 B;  2XK5 B;  2KLC A;  4MJS B;  2MBQ A;  3KYC D;  2KXJ A;  3P2B A;  3PS6 A;  3B0A A;  4IWO A;  1D3Z A;  3DBS A;  1C3T A;  2O6V A;  1V2Y A;  3DDC B;  2L8J A;  2DEN B;  2LUE A;  1SIF A;  1E8Y A;  3PTF C;  4WWO A;  2C60 A;  2MQJ A;  4BBN C;  1IP9 A;  2R2Q A;  3A1Q A;  3KUD B;  1GJZ A;  2MRP A;  3ALB A;  1HE8 A;  1S3S G;  3RD2 A;  2LRW A;  4WWP A;  2ZNV B;  5AZH A;  4M0W B;  3DVN U;  1WGY A;  2QHO A;  3JSV B;  3NOB A;  3VHT C;  2K8H A;  2RGF A;  4KIK A;  2FCN A;  1FXT B;  5L83 A;  2M1M A;  4ZDV A;  1WZ0 A;  4G50 A;  4IWP A;  4NJ7 A;  4A3P A;  2BYF A;  1I35 A;  4G11 A;  4HDQ A;  4MEL A;  4M8M A;  2D3G A;  2C5L C;  2XK5 A;  4E3C A;  2LXA A;  4I6L B;  5AZF A;  4HK2 A;  2WWZ A;  1WXV A;  1WF9 A;  3VDZ A;  3VAW A;  2J7Q B;  2KC2 A;  1E5W A;  5JHA A;  2V4L A;  1YJ1 A;  2WX0 A;  1UGM A;  5AZG A;  2D07 B;  4BOS C;  4E71 A;  5JH5 C;  4JGH B;  2UYZ B;  1G6J A;  3ZNZ B;  2G3Q B;  2PEA A;  1V9J A;  3OJ3 A;  2C9W B;  4IWQ A;  3AU5 A;  3H7S A;  2LZ6 A;  2JWZ A;  3DPD A;  3RZW C;  2FCQ A;  3WAL A;  5C23 A;  3VTV A;  4EFO A;  1SE9 A;  2LGX A;  2XEW A;  4XX5 A;  3ZRF A;  4B9K A;  1VD2 A;  4IM0 A;  2GBR A;  1GC7 A;  4CYE A;  3MJW A;  2OOB B;  3WAN A;  2LXC A;  3EC8 A;  4MEM A;  4HDO A;  2ZEQ A;  1LXD A;  1H4R A;  3JYU A;  2N4F A;  1LQB A;  1C1Y B;  1ZW7 A;  2EMS A;  2ZPN A;  2IO0 B;  3W1S C;  2ZVN A;  3ZTC A;  4DXA B;  2JPH A;  1WXM A;  4ANU A;  2KLG A;  2JT4 B;  1GUA B;  4WWN A;  2LVP A;  2HTH A;  2NPT B;  1GG3 A;  4K1R B;  2KTF A;  2LGD A;  1LM8 B;  4AUQ C;  3RUI B;  3N30 A;  4ANV A;  1A5R A;  2GOW A;  3DCG A;  2BWE S;  3ENE A;  2V1Y A;  1EF1 A;  2FID A;  1J0G A;  2DX5 B;  3Q3J A;  4K7U A;  4OVV A;  3VQI A;  3R7Q A;  3OJ4 B;  2CHW A;  3R66 C;  3QK0 A;  3SD5 A;  3NS8 A;  3OLM D;  3QQ8 B;  4BFR A;  3QJZ A;  2FCM A;  1WI0 A;  1K8R B;  1UBI A;  1E7V A;  3PRM B;  3HM3 A;  2JF5 A;  2MBH A;  3L08 A;  3WAO A;  3JVZ X;  4DHJ B;  5IAA C;  5CHV C;  3NY5 A;  5J2R A;  1L2N A;  3V61 A;  3A33 B;  4MDK E;  1T0Y A;  2BF8 B;  2DZK A;  1V5O A;  5L95 C;  3IBE A;  3EEC A;  3SHQ A;  3QX1 A;  2KFK A;  2ZJD A;  1XQQ A;  2GBM A;  2WYQ A;  2IO3 B;  2JY6 A;  3EFU A;  2LRU A;  2GMI C;  2HJ8 A;  2D10 A;  3KUZ A;  3M95 A;  3ZDM C;  4EKU A;  5IA7 A;  4KZ0 A;  2Z0D B;  1ZKH A;  2J0K A;  2FCS A;  1WFY A;  2MX2 A;  3H9D A;  2ZVO A;  2K8C A;  3TIX A;  3VUX A;  1YQB A;  3AU4 A;  3PHX B;  4FLH A;  1RLF A;  2O6V D;  1NBF C;  3C0R B;  3PV1 A;  4DBG A;  2MSE D;  1ISN A;  3CF6 E;  2D2Q A;  3LMN A;  2CR5 A;  3V6C B;  2YLM A;  4BKG A;  4FAD A;  2C7M B;  1WGH A;  3ZIM A;  2ZPY A;  1J19 A;  4GOC A;  1IPG A;  2CS4 A;  4LCD E;  1XT9 B;  3HK0 A;  1V81 A;  3L10 B;  4IM2 A;  3UIN B;  3KYD D;  3M62 B;  3V62 A;  1WRD B;  2KJR A;  3W1Y A;  4ASW C;  2MLB A;  3V60 A;  3R3M A;  1RFA A;  3OAW A;  2KO3 A;  1KJT A;  4KVG B;  3UF8 A;  3RZF A;  1VCB A;  3L0W B;  2A4Z A;  4W9H A;  2PJH A;  4JIO U;  4ZRK A;  3VTU A;  3LDZ E;  4F1S A;  4A3O A;  4PS8 A;  1IYF A;  4XC2 A;  1X1M A;  4HCN B;  4ICV A;  4F8C B;  4A20 A;  4LDT D;  1UZX B;  2K39 A;  3PGE A;  4II3 B;  2KNB A;  3A4R A;  4F7Z A;  3VUW A;  3L54 A;  1M94 A;  2J0J A;  4W9L A;  1YX6 B;  3PPA A;  5D2M B;  2NPT A;  4ZYN A;  2KWC A;  5TR5 A;  4HCP B;  4WJO A;  1YIW A;  2LI5 A;  3PRZ A;  2CHZ A;  3DVN V;  1SGH A;  2Z59 B;  4W9F A;  3O65 B;  3PHW B;  5LLI A;  4RM8 A;  1J8C A;  5D94 A;  2HE7 A;  3VH3 B;  2KD0 A;  1WJ4 A;  4AP4 C;  2L0T A;  4MGK E;  3DVG Y;  3L17 A;  5E6N A;  1AAR A;  3N32 A;  2MWS B;  1OGW A;  1Y8R C;  1WMH B;  2MP2 B;  5E6P A;  3RUL A;  2NBW B;  1E8X A;  3LJ3 A;  4K7W A;  2DZJ A;  2G4D B;  2K1F A;  2KWU B;  1WYW B;  4GB9 A;  4HPM B;  3WAP A;  4IG7 B;  1F9J A;  2YVC A;  5D7G A;  4MH0 E;  2RPQ A;  2JRH A;  2KMA A;  4WJQ A;  3TMP B;  1KLV A;  4HLE A;  2KQ7 A;  4TQ0 A;  2A5U A;  2KC1 A;  4ZRI A;  4G3X B;  2JZZ A;  2ZZP B;  2IZV B;  1ZGU B;  2K6Q A;  1WGG A;  1WE6 A;  4N9F 4;  1WX7 A;  3IG3 A;  1S1Q B;  3APD A;  3N3K B;  4W9D A;  3SDL C;  1V49 A;  4GDL A;  4EZL A;  2IY1 B;  2B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...