4MELA

Crystal structure of the human usp11 dusp-ubl domains
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
b'LPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4melA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4melA01
4NPNA 4BKGA 1NDDA 3L17A 3RCZA 2K39A 3AU5A 3QX1A 4MELA 1EF1A 4W9DA 3ZW3A 3VTWA 1V5OA 2WX1A 2I1JA 2RPQA 3M62B 1YQBA 4FJZA 3L13A 1WGGA 1YJ1A 1WF9A 3PHXB 3H6NA 1WX9A 2BKFA 4IWPA 4MGIE 3V62A 5CTRC 4BOSC 2BYVE 1RFAA 3UF8A 4DDGD 2DYOA 3Q3JA 3VVWB 1LM8B 2FCSA 3PPAA 4M0WB 1E90A 3EHVA 1AARA 2MBHA 2NBVB 3B08A 2IO2B 4B9KA 4CO7A 1MG8A 2C7HA 1G6JA 4W9FA 5G2NA 2ZPNA 4ANWA 2KANA 4IM0A 2YLMA 4W9IA 4KSKC 2L0FA 1UD7A 2ZNVC 4KSLC 3KYDD 1GUAB 5IA7A 3L0WB 2C5LC 3PTFC 4MJSB 1ISNA 2NBWB 3MTNB 4K7UA 4PS7A 3WIMA 1EO6A 4W9KA 3PRMB 2LGXA 1WRDB 2FIDA 5JZEB 2Z0DB 1WE6A 2KO3A 2J0KA 3DQVA 2KQ7A 2MSED 2O2VB 1QZEA 2J0JA 2KHWB 4W9LA 3N3KB 1WJ4A 3JVZX 4WJNA 2V3SA 3PREA 4MH0E 2NPTA 3KUDB 4W9HA 3UINB 5EDSA 2PJHA 4DWFA 4G50A 1CMXB 2O6VA 3VUXA 2KFKA 2KDEB 4EZLA 2HE7A 1XT9B 2LI5A 3QHTA 2N4FA 2ZVNA 2L0TA 3APDA 4WWNA 3VTVA 2K8CA 2D10A 3ZTDA 2KD0A 1SE9A 2KDFB 3NHEB 3QQ8B 1WYWB 4KZCA 5DPWA 2C9WB 3PZDA 3VDZA 1U4AA 4HLEA 1KJTA 4HPLB 4TKNA 2O6VD 4ANVA 3PT2B 5L83A 4WJOA 4BBNF 2BYEA 4IW0A 4FLHA 2RSUA 1OEYA 2OJRA 2C7MB 4CHKA 1D3ZA 5DPSA 3WANA 1NBFC 1WIAA 1WY8A 1VD2A 2D3GA 4GXBA 4AJYB 5L95C 5J18A 2JXXA 1I35A 2N7DA 2L8JA 1V80A 4WAAA 2CHXA 2IO3B 5TR5A 1WZ3A 2M17A 3APCA 2MW5A 4CYEA 3DVGY 1Z2MA 3UIPB 2GMIC 2KC2A 4HXDA 4EFOA 3ML9A 4ZRJA 4BKSA 4FBJB 1V2YA 3JYUA 1L2NA 1V86A 4ZRIA 3DBRI 3RULA 2FUHB 4A3PA 4FN2A 3RT3B 2L76A 2V1YA 2KMAA 4I6PA 1P9DU 1WGHA 3QWZB 1E7VA 4HK2A 4FJYA 2AWTA 2LVPA 1P1AA 3C0RB 3NZUA 3ZRFA 1WGRA 2JUOA 2KVRA 2JF5A 2JWZA 3K9OB 3N32A 4PS8A 2WYQA 2RR9A 4II3B 4BKSD 1WR6E 2KMCA 4KVGB 3SU8X 2KQSA 3L16A 4J6IA 4NY0A 4ANXA 4E71A 3ZNID 2M4NA 2IY1B 4LDTB 4GOCA 3RD2A 2FCMA 2LZ6A 5GMVA 1TGZB 1Z5SB 2Z0EB 4MSQB 4NJ6A 4HDQA 2CS4A 5CHVC 2N9XA 3A4RA 5J17A 1W6VA 2L00B 1HE8A 3KVFB 4HDOA 4NQKE 3BY4B 3VFKA 4B95A 5LXHA 2N1WA 2WDTB 3H9DA 4MJSA 2DYMA 3QCAA 3A33B 3JW0X 3TBLD 3PLUA 3D32A 3PHWB 2IY0B 4ANUA 4GDKB 3UQBA 1OQYA 4RM9A 3VQIA 4TQ0A 4FHJA 4MDKE 2K8BA 2O2VA 3VUYA 2LJ5A 3NOBA 1TZ1A 4GN1A 3VTUA 4PYUA 1V49A 4FHKA 1Q0WB 2GOWA 2K6QA 3QC8B 1LXDA 2XBBC 2ASQA 3H1UA 5AZHA 5AZGA 1F9JA 2NR2A 3ZDMC 2PE9A 3M95A 2WX0A 4ZYNA 2VRRB 3A9JB 5LLIA 2KKCA 2K25A 4AUQC 1YX5B 2REXA 1E8WA 2CHWA 3AI5A 2BWFA 1RAXA 3CMMB 1WH3A 2JZ3B 3NZSA 1UELA 4DK5A 5JHAA 4ZDVA 1C3TA 3PVLA 3MJWA 4PS3A 4LJPB 4N9F4 4A20A 5E6OA 2KWUB 1T0YA 2JZZA 4X57B 4URKA 3U30A 4ICVA 5BO4B 4I6LB 3RZFA 4AP4C 3W1SC 1E7UA 3LDZE 1Y8RC 1IYFA 2KN5A 3A1QB 4F1SA 3V6EB 2BF8B 3L54A 4I6NB 2CR5A 3S2AA 1RRBA 2MRPA 3MHSD 3EECA 2KZRA 1WMHB 4G11A 1OEYJ 2KWCA 2BGFA 2M8SA 4XC2A 3VH4B 1A5RA 2NS5A 2GBNA 3ZRCA 1WGDA 4GMVA 4W9CA 4MEMA 2DAFA 4IUMB 4JQWC 3R66C 4KDIC 5C23A 5IAAC 3TJPA 3DBLI 2N9PC 2IZVB 3SDLC 3V60A 5J2RA 3H7PB 2BYFA 5E6PA 5KHOA 1BT0A 2KDIA 4XZ4A 3QIJA 2QHOA 2RD0A 4NAWB 1R4MI 2ZPYA 2KOXA 2DZKA 2DHZA 3IFWB 1V5TA 2MP2B 4AWJA 2LVOA 2J0MA 4NJ7A 1I42A 3HK0A 4TQ1A 1ZW7A 3ZKJC 3ZO5B 5CX3A 1WGYA 3M3JA 3SHQA 3VUWA 4WWOA 1WE7A 4BKTA 1RLFA 4MSMB 3TL5A 2M1MA 5HKHA 2R2OA 2ZVOA 2LD9A 3DVGX 3GOEA 3V61A 3DCGA 4KIKB 1GC6A 3APFA 4LDTD 2DZJA 3ENEA 2I1KA 4MGZE 4RMAA 2FIFA 3WALA 4GDKA 5JH5C 4DHZE 1XQQA 4BVUC 4LJOB 4W9GA 2KTRB 2C60A 2N7EA 3OLMD 2AL3A 4MGYE 2L7RA 1SGHA 3ECIA 2LUEA 3K9PB 3VAWA 4EEWA 4HCNB 2LRWA 3VXWA 4GB9A 3R7RA 3UIOB 5KHQA 3DBSA 1UBIA 2KDBA 4XX5A 3B0AA 3W1SA 2N1VA 2MBOA 3A9JA 1V6EA 2FNJB 2MQJA 4KV2A 1UZXB 2KLCA 3L10B 1XD3B 2NBUA 4GDLB 1J0GA 2DZIA 1EUVB 2PPHA 3L08A 1GG3A 3PGEA 3WAMA 1UBQA 3QAQA 2ZJDA 3A9KB 1WJ6A 3A4SC 4K81A 2FAZA 3RUIB 1UH6A 4BOZB 2KX3A 4DHJB 3H7SA 1KLVA 2ZCCA 4IC7B 4W9JA 2BWES 1K8RB 1M94A 1V9JA 3X0WA 4GGQA 1WR1A 1OGWA 2JRIB 3VHTC 4WWPA 4DXAB 1UGMA 2AYOB 4W9EA 3U7DA 2G4SA 2KTFA 3M63B 2K1FA 2IO0B 3T8MA 2PE6B 4HJKA 4YL8A 3ZVVA 3A1QA 4HVBA 3SD5A 4EOYA 3DPDA 4IWQA 5AEKB 3UGBB 3P2BA 4FADA 4TV3A 1WMHA 4RM8A 1OTRB 1TTNA 1WXVA 1NI2A 4JIOU 2JVCA 4EZKA 5CHWA 5JHBA 1ZGUB 3IVFA 2N9EB 3PS6A 3ZIMA 3R7QA 4IWOA 3JSVB 1S1QB 2IBIB 5DPTA 4EUTA 2G3QB 4FA6A 2UWQA 4IG7B 1WX7A 1KM7A 2MBQA 2XK5B 3PV1A 1TBEA 3AULA 1YD8U 4JLCA 2AL6A 2ZNVB 3H7PA 1J8CA 1YX6B 3PRPB 3B1LX 2MA9B 3WAOA 2LGDA 2L05A 2LGYA 2JT4B 3UQAA 1JRUA 2BKRB 4NAWA 4HWIB 2FCQA 2MP2A 4FULA 4HPMB 2AEHA 4DBGA 2L3ZA 2D2QA 3EC8A 2HTHA 3KUZA 3DVNU 3ONSA 2J7QB 1LFDA 1Q5WB 2WWZA 1P3QU 1KOTA 2UYZB 4DHZB 3I3TB 2OOBB 2DZMA 2B3AA 2EMTA 2Y5BB 1GJZA 4EZJA 3IG3A 2JPHA 3KW5B 4KIKA 1ZKHA 3GZNI 3IHPC 2IYDB 5DCNA 2LVQA 3HM6X 3ML8A 3OJ3A 4A3OA 2A4ZA 1GNUA 3HM3A 4WJQA 4BFRA 1WXAA 2A5UA 3U8ZA 2MX2A 2HD5B 2KLGA 2KFJA 2MCNB 3WAPA 3ZDTA 1EF5A 3DVNV 1E5WA 4IM3A 1E8XA 2KTRA 3ZLZA 1J19A 2KJ6A 2LWPA 4NQLB 1PQSA 4OVUA 1WI0A 4AOFA 1WJUA 3QK0A 4ICUA 4K7WA 1V81A 3QA8A 4PYZA 1C1YB 1L7YA 2MBEA 3NY5A 2D07B 1SIFA 2DYBA 3KYCD 3DBHI 2IO1B 2GBJA 3LJ3A 4EKUA 4E3CA 3KH0A 4KZ0A 3BINA 2BPSA 3QARA 4GDLA 2LXAA 3PLVA 1IP9A 2LRUA 3KUCB 4G0NB 3CSTA 3DDCB 5D6JB 1WM2A 2MLBA 3A9KA 4P7IA 1WFYA 5D2MB 2RGFA 3ZNZB 2R2QA 2V4LA 4IM2A 2YVCA 3HIZA 4F8CB 3V6CB 2KWVB 5CHFA 1E8ZA 4GU2A 1VCBA 4MM3A 1WZ0A 3TMPB 5AZFA 1GC7A 4B6WA 3N30A 4OVVA 3T9LA 3VH3B 4MGKE 4DHJD 2EMSA 3AXCA 2KNBA 3O65B 4AJWA 2G4DB 3NS8A 3W1YA 2EKEC 3PSEB 1Q1OA 2LASA 5E6NA 5G55A 2GBRA 4JL9A 2FCNA 2KJRA 2PEAA 2GBKA 4HCPB 5DPRA 5LXIB 4E74A 4WQOB 3WA0A 3X23A 2NPTB 4G3XB 3JSVA 2JRHA 3R3MA 4GSWA 3LMNA 4K7SA 1R4NI 2MWSB 2DENB 2O6VB 4K1RB 2XK5A 3TCAA 2KFKB 1IPGA 3OAWA 4GIVA 4ZRKA 1WJNA 2GBMA 2XEWA 3CSFA 2ZZPB 2NCNA 1WXSA 3ZNGC 2Z59B 4NNJB 1P98A 2DAJA 4WJPA 1YIWA 2KXJA 2CKHB 5C1ZA 4LCDE 1WM3A 2HJ8A 2M0XA 2C7NB 1S3SG 2ZCBA 1WX8A 3PRZA 5D7GA 3TIXA 4M8NA 2W9NA 2ZEQA 4TUUA 4II2B 3Q3FA 3ZTCA 2K8HA 2CU1A 2KX0A 2LXCA 4DDID 2KC1A 2D11A 3EFUA 3ALBA 2DX5B 2MBBB 2NVUI 4JGHB 3AU4A 4ASWC 3ZNHB 3DOWA 4FJVB 5FR6A 1FXTB 3RZWC 1LQBA 3OJ4B 1H8CA 3IBEA 1WXMA 2CHZA 3QJZA 2JY6A 3HHMA 4M8MA 2KJHB 1P0RA 2KK8A 1H4RA 3RYTA 1X1MA 2G45B 5D94A 4F7ZA 1E8YA 2K6DB 4BBNC 3CF6E 4KDLB 3ZUNA
chains in the Genus database with same CATH superfamily
4OZAA 4BKGA 1F2RI 3RCZA 1EF1A 2AX5A 1KLGD 2RPQA 3M62B 2KDMA 3H6NA 1XF5L 2M19A 3UF8A 3VVWB 1LM8B 2FCSA 3EHVA 3B08A 1SBBB 2IO2B 1FCLA 2LJIA 2ZPNA 1UD7A 2H89B 3AE6B 4IDIA 2EELA 3L0WB 2C5LC 4K7UA 1EO6A 3HRDD 4W9KA 2FIDA 1WWTA 2J0KA 2J0JA 1CZPA 4WH4A 4C4VB 5HI1A 2DBYA 2V3SA 1OQQA 3R2TA 2G9HD 3KUDB 4W9HA 3UINB 4DXFA 4LNIA 4IKGA 2KDEB 2HE7A 3APDA 2K8CA 2KD0A 3BIID 1TKEA 3EA6A 2JZPA 3BYYB 5L83A 2BYEA 2WHIA 4ITKA 1OEYA 2C7MB 4CHKA 3U2SC 3E9SA 3WANA 1WIAA 2D3GA 4OZCA 1V80A 2IO3B 2L83A 2CU3A 2VH2A 3DVGY 4YT0B 2D3AA 4HXDA 5BYRA 1V86A 2V1YA 2WXQA 2W82A 5HHDG 1P1AA 1FIQA 1L0VB 1SF0A 3C0RB 3NZUA 1WGRA 4LLGM 2JWZA 2XN9C 1WR6E 1XEEA 2KMCA 1T6BX 2KQSA 4J6IA 3EGRA 4JPSA 1MFWA 4GOCA 2FCMA 1TGZB 1Z5SB 4NJ6A 4KKIA 1FFUA 2N9XA 2L00B 1IGCA 1N5WA 4NQKE 2HJ1A 4B0EA 5LXHA 4M00A 4WWMA 2WDTB 3H9DA 2JQRB 2DYMA 3TBLD 3PHWB 2IY0B 2VZKB 4GDKB 3UQBA 2K8BA 2M56B 4C4VA 4PYUA 4M02A 1I4PA 3N1XC 3Q3MC 3QC8B 2LHDA 2XBBC 3NUHB 1L0XB 2PE9A 3M95A 4C56C 1GB1A 3OWEB 4ZYNA 3A9JB 1NYRA 1L6UA 2REXA 4C7YA 4J3OD 1WH3A 1UELA 2D5GA 4LJPB 1D4BA 5E6OA 4URKA 1SE4A 3SEBA 3W5VB 4RF0A 3ZJUA 3AEFB 3Q14C 1IYFA 1GAQB 2KN5A 5EE1A 1RRBA 1WMHB 2JX5A 3VH4B 2GBNA 1ZPSA 1ZDVA 4IUMB 4JQWC 3RNAC 5IAAC 3TJPA 4TMAB 2N9PC 3V60A 2FE8A 2JU6X 2LMCA 2V3PA 4KGTA 5J2RA 1EU3A 5KHOA 1RM6C 4US9A 2RD0A 2KOXA 1VJKA 1N63A 3ZO5B 1WGYA 3SHQA 3MC0B 2BVCA 2R2OA 3GOEA 2LGIA 4CQNA 3FAHA 4ZHPA 1ZDXA 2DZJA 3ENEA 3WALA 4GDKA 5JH5C 1AYFA 2WNMA 4LJOB 2BS2B 2KTRB 2N7EA 1VR9A 1VLBA 2L7RA 2LUEA 5KHQA 2LRWA 1ZE3D 3W1SA 2N1VA 1K53A 3A9JA 2MQJA 1UZXB 3L10B 3PZ8A 1XD3B 3WAMA 1TY2A 2KX3A 1KRHA 1K8RB 3Q8AA 1OGWA 2JRIB 4WWPA 3RNGC 1UGMA 4NJCA 1JWMD 1YOVB 2KVZA 1LO5D 4IWQA 1JMLA 3UGBB 4FADA 1WMHA 4JIOU 5CHWA 4N58A 3ZIMA 3BVMA 3JSVB 1S1QB 2G3QB 2UWQA 2WXHA 1D5MC 2XK5B 2Y5PA 2AL6A 2OEDA 2L05A 2LGYA 3UQAA 1JWAD 4ZRQA 4FULA 4HPMB 3N1ZC 3KUZA 1K52A 1PDXA 3KWLA 1SXTA 5JXVA 4DQOC 2G1EA 1V1PB 3GZNI 1J7BA 2IYDB 1GNUA 2BS4B 1WXAA 2HD5B 4AS1A 2MCNB 1FD6A 3DVNV 1E5WA 2Y5CA 1E8XA 2KTRA 3ZLZA 5HG2A 1PQSA 2RMMA 2D07B 3AEGB 2GBJA 1JRPA 2BQQA 3ZJTA 5BMHA 3GE8C 2LXAA 3PLVA 3NG0A 2LRUA 4G0NB 3CSTA 1WFYA 1MHXA 2RGFA 2R2QA 2V4LA 2YVCA 2LEKA 2ZW1A 3MJ5A 3Q8BA 5CHFA 3U4EG 1VCBA 2XNAC 1GC7A 4B6WA 3N30A 2K9XA 3T9LA 2K5PA 3VH3B 2EMSA 2G4DB 3PZ7A 1FRRA 1KTKA 4WQMA 4HCPB 5DPRA 3VRBB 1JW9D 1HTOA 4EE2A 3AH7A 4S17A 3WA0A 1NYQA 1GOZA 3JSVA 3AB5A 2JRHA 1TY0A 3O13A 4K7SA 2PVGC 2KACA 2MWSB 3NVWA 2DENB 4K1RB 2XK5A 1WJNA 5BMIA 2NCNA 3N20C 3ZNGC 5D3DA 1YN3A 2DAJA 1C4PA 4KX6B 1WM3A 1S3SG 2WDVB 3GZNB 3RPFC 2W9NA 4II2B 2KC1A 4RCOA 4ASWC 2NVUI 2TSSA 3AU4A 1V1PA 3RZWC 1I4XA 2BYTA 3DBLB 1OQRA 1WXMA 2QMTA 1P0RA 1CQVA 2KK8A 3RYTA 4JX1C 1E8YA 3AE3B 2J52A 1R4MB 1NDDA 2M0AA 1AW7A 1R7SA 3V62A 2IGHA 1UGJA 2BYVE 2JYTA 4XDCA 2MBHA 4K3BA 2NBVB 2C7HA 3W9CB 5G2NA 3RN9C 2KANA 3RNBC 2ZNVC 4HJGE 3KYDD 1GUAB 3MC8A 2GB1A 2L1AA 1PYWD 1TYGB 3MTNB 3R8BA 3URYA 1VZ7A 1WRDB 5JZEB 2Z0DB 3DQVA 2MSED 2BW2A 2O2VB 1UNSA 1VDVA 2WU2B 1WJ4A 3BWUD 4WJNA 1HEZE 1C77A 5EDSA 1KFYB 3VUXA 1FEHA 1XT9B 2LI5A 1SJHD 2N4FA 3VTVA 2D10A 5DPWA 1SE9A 4KZCA 3VDZA 1U4AA 4KGRA 4DXGA 3DHIC 1WXQA 2O6VD 4RGTA 4ANVA 4BBNF 4IW0A 4FLHA 1D3ZA 2AQ3B 4PK1A 5L95C 2CHXA 4YXDB 1OFFA 4C7ZA 3APCA 2MW5A 2GMIC 2KC2A 3ML9A 4ZRJA 4BKSA 3JYUA 3RULA 2L76A 4HRSA 1P9DU 1E7VA 4HK2A 2LVPA 1UF0A 4ARCA 3L4PA 2KVRA 4LNOA 3UI3A 3K9OB 4A55A 1WYGA 4PS8A 4KVGB 3DWGC 2JYEA 4ANXA 4N59A 2QSDA 3AEEB 4HKQA 3RD2A 4HROA 3TEXA 4MSQB 1F0ZA 4HDQA 3WCQA 4RH6A 3Q2AC 3A4RA 1W6VA 3BYTB 3BY4B 2WXRA 3A33B 1IBXB 3PLUA 3D32A 4ANUA 1OQYA 4RM9A 4TSSA 4TQ0A 4MDKE 2O2VA 2LJ5A 1TZOA 1TZ1A 3VTUA 4FHKA 1SSNA 2GOWA 2K6QA 1LXDA 1ET9A 3J9CA 3ZDMC 1I4RA 2VRRB 1ZOYB 5IOIA 2GI9A 2CHWA 3I63C 3AN1A 2QIEB 2BWFA 1RAXA 3CMMB 2JZ3B 4DK5A 2FBWB 5JHAA 4PT5A 4ZDVA 1FNVA 4PS3A 3AM9A 1ZXHA 4A20A 2KWUB 1T0YA 4X57B 4ICVA 5FK9C 4I6LB 5BO4B 5AUKA 3FILB 3W1SC 4M01A 4YWGG 5G5HA 2WXIA 4F1SA 2MJDA 1R4NB 2MJEA 3AV8A 1OEYJ 2KWCA 1A5RA 1I4HA 2WXGA 2NS5A 4KGSA 4MEMA 4XDDA 5C2TB 3R66C 5C23A 1PFDA 2PKOA 2WS3B 1K50A 5E6PA 2KDIA 4XZ4A 3QIJA 2QHOA 1N62A 2DHZA 2MP2B 3W5UB 3HK0A 4TQ1A 1P7FA 3C19A 5CX3A 1JROA 3M3JA 3VUWA 4P1BC 4BKTA 1RLFA 4MSMB 2ZVOA 3DVGX 3W2DA 1JCKB 4KIKB 1GC6A 3APFA 4LDTD 2I1KA 3ABVB 1IBXA 4XWTA 4RMAA 3P4QB 3AE8B 1TJEA 4DHZE 4HPPA 3ZXVA 2C60A 3U7ZA 4EEWA 1RWSA 1UBIA 2KDBA 2MBOA 2JXTA 3ZXRA 1V6EA 2FNJB 4KV2A 1EUVB 1GG3A 3PGEA 3NVZA 3QAQA 2ZJDA 1QOGA 2FAZA 4BOZB 3X0WA 4GGQA 3VHTC 2ACZB 4DXAB 2AYOB 1MPEA 3U7DA 3FILA 4XE0A 3BK1A 2K1FA 1M4VA 2PE6B 4YL8A 2FUG1 3SD5A 1GB4A 3P2BA 4TV3A 4EZKA 1TTNA 1WXVA 1NI2A 2K3UA 2NMQA 1MI0A 5DPTA 4EUTA 5IP4D 4IG7B 3TUOA 3IT6B 1KM7A 2MBQA 3AULA 3BZDB 5GXGB 3WAOA 2ZW0A 2JT4B 1JRUA 2BKRB 4O1NA 1C4AA 1VZ6A 2FCQA 2MP2A 1ET6A 4DBGA 3BVGA 3GE3C 3V3XA 4US8A 1ACCA 2WWZA 1P3QU 1C76A 2UYZB 3P4SB 4DHZB 3TEWA 4EZJA 3KW5B 4KIKA 2W3SA 1FM0D 3U8ZA 4HKZE 4ZHOA 1YN4A 3GS2A 4OVUA 4P6VF 1NI3A 3QK0A 1V81A 4PYZA 2NTTA 3LXFA 3DBHI 4KZ0A 3BINA 2BPSA 5AUIA 3KUCB 2CJOA 1WM2A 4C00A 5D2MB 3ZNZB 2V9HA 3HIZA 3SFEB 4P16A 2AQ2B 3HUIA 2X38A 5HFYA 1STEA 4DHJD 2KN4A 1T5XD 3RFZB 3NS8A 4R3DA 3RNCC 3T3OA 3AE5B 1V1OA 4BZAA 3PSEB 3Q3NC 5G55A 2GBRA 4JL9A 2KJRA 5LXIB 2GBKA 2HTME 3CIRB 2RPVA 4XGAB 3GP7A 2OHFA 2NPTB 3R3MA 3TCAA 4ZOHC 1D5XC 2D3CA 4NNJB 1P98A 5C1ZA 2X8XX 3LB8C 3RNEC 2Z8LA 3PRZA 1F1HA 4M8NA 2ZEQA 1JQ4A 4TUUA 3ZTCA 2K8HA 2CU1A 2LXCA 2KAJA 3U52E 2GRIA 1XO3A 2K0PA 3ALBA 4RFBA 3DOWA 4FJVB 4RGOS 1FXTB 3OJ4B 1H8CA 2PVOD 3IBEA 1NVID 3HHMA 3PO0A 1T0SC 4N6EB 1V97A 4FXCA 3CF6E 4WURA 4KDLB 4NPNA 2NTSA 1L4DB 3E56A 4MT5A 2K39A 4JWSC 3AE1B 1V5OA 2WX1A 2I1JA 4FJZA 1WGGA 1YJ1A 1WF9A 3NJTA 1WX9A 4IWPA 4MGIE 4USAA 1RFAA 2BBCA 1FXAA 4M0WB 1E90A 1DYQA 1L4ZB 1AARA 4LNKA 4L1BA 4CO7A 4L23A 3OG5A 2YLMA 4KSKC 2OJWA 1RYJA 4KSLC 4YSYB 3TSSA 5IA7A 2V0GA 1LGRA 3PTFC 4MJSB 1ISNA 1TKGA 2LGXA 1E0ZA 4W9LA 3JVZX 2INCC 2QEJC 3PREA 1SEBD 3EUB2 4MH0E 2NPTA 3NRZA 1DOXA 4LNFA 2I2YA 2MH7A 2PJHA 4DWFA 4G50A 1CMXB 2Y3AA 1EWCA 2WXMA 3QHTA 2ZVNA 2DWQA 2L0TA 3ZTDA 3QQ8B 1WYWB 2W3RA 1JALA 3PZDA 4A9AA 4HLEA 4HPLB 1I4QA 4A90A 3PT2B 1E6EB 2OJRA 1SB3C 5DPSA 1NBFC 1WY8A 4GXBA 1VD2A 4AJYB 2JXXA 5TR5A 1WZ3A 2M17A 4CYEA 1Z2MA 3UIPB 4EFOA 3DBRI 4FN2A 2KMAA 3ZJVA 1J7AA 1QLBB 1HTQA 1B9RA 2N0SB 3ZRFA 2JUOA 3N32A 2WYQA 2RR9A 2PIAA 1L6VA 1FCCC 1XCQL 4NY0A 3SU8X 4E71A 5E6JA 4M0WA 2J53A 5GMVA 2LZ6A 2IJ0A 2Z0EB 1PGBA 2PTLA 1JWUD 2R61A 1KLUD 3DHGC 1FNWA 3P4RB 1HE8A 4HDOA 2N1WA 1HXYD 2LUMA 4MJSA 3QCAA 2K22A 2UU7A 1WRIA 1JWBD 1FXIA 4FHJA 3NVVA 1V49A 5IKCM 1Q0WB 3VRAB 2ASQA 5AZHA 1YJJA 3SFDB 2H88B 2NR2A 4WAFA 2WX0A 1P7EA 1TS5A 2K25A 1YX5B 2ICIA 1PUTA 5BMGA 1E8WA 1PGXA 4RNAA 1WSPA 2WXOA 4N9F4 4REZA 3U30A 3FC4A 4AP4C 1E7UA 1Y8RC 1AWDA 1QT9A 3DBRB 3AECB 2BF8B 4I6NB 2CR5A 5H8YE 2MRPA 2E3TA 3EECA 3MHSD 2I38A 2KT7A 2M8SA 4NZLB 2BGFA 4XC2A 3ZRCA 2DAFA 3BVZA 3T3NA 1QOBA 4GLSC 3DHHC 2BYFA 5H92C 4NAWB 2ZPYA 1SE2A 1XLQA 2LVOA 1NENB 1I42A 3ZKJC 1DOYA 1IGDA 2M1MA 4OZBA 2LD9A 2ON8A 3DCGA 1ZXIA 5TSSA 2AQ1B 1HZ6A 4D2KA 2FIFA 3ZQ4A 1XQQA 3Q8FA 4W9GA 3OLMD 2AL3A 1BMLC 3ECIA 4B0MA 3VXWA 1QQRA 3R7RA 2BB5A 3DBSA 1C79A 2VZKD 4XX5A 1FNUA 1L0YB 1F2RC 2KLCA 2YEPB 4GDLB 1J0GA 1CJEA 1UBQA 3RI7C 1L5PA 4XWWA 3RUIB 3H7SA 1T0RC 5EE3A 4MM3B 2CJNA 1Q10A 2G4SA 3M63B 2QC8A 2IO0B 3T8MA 4HVBA 5AEKB 1ZGUB 3IVFA 3ZGZA 3CWIA 3R7QA 4IWOA 2IBIB 2MHJA 4FA6A 2ONQA 1TBEA 1YD8U 2WXLA 2ZNVB 3DWMA 2WXJA 5EE0A 1J8CA 3B1LX 2LGDA 2PMVA 3Q8EA 4NAWA 3C8YA 4Q2JA 1MVKA 3Q6BA 4HWIB 1PGAA 2AEHA 2D2QA 2HTHA 3ONSA 2J7QB 2BS3B 1LFDA 4WIPA 3I3TB 2B3AA 1GJZA 3AMZA 2JPHA 2LVQA 3ML8A 3OJ3A 1TS4A 4A3OA 2A4ZA 4BFRA 3NVYA 1E7PB 2KFJA 3WAPA 1QF6A 1EF5A 4IM3A 2LWPA 4NQLB 4K7WA 1C1YB 1L7YA 3NY5A 1DOIA 3IAM1 1SIFA 4ZYSA 2DYBA 3KYCD 4E3CA 4GDLA 3GB1A 5D6JB 2WDRB 5FKAC 3RMKC 3RNFC 1SIJA 1QOAA 3MP9A 1E8ZA 4GU2A 4MM3A 1WZ0A 3HVDA 1SJED 1ENFA 5LNK1 4MGKE 2KMMA 3AXCA 5IN7A 3W1YA 2RDBC 2QCZA 1KH0A 2LASA 3FKYA 5E6NA 2PEAA 1EU4A 1T3QA 4WQOB 4RF1A 1HZ5A 3LMNA 2WXPA 3I9V1 2O6VB 4KKJA 2KFKB 3OAWA 4ZRKA 2GBMA 2XEWA 2ZZPB 1WXSA 5T8IA 4WJPA 3AE4B 2CKHB 1VRAB 4LCDE 2HJ8A 2M0XA 4P1CC 1WX8A 5D7GA 1FPYA 2E6XA 4JE3B 1KF6B 2INPE 4DDID 3AE7B 3TEZA 4H2AA 2DX5B 3P63A 3ZNHB 2KYWA 3I5JC 4YTNB 1C9FA 3P42A 1YQ3B 2SAKA 3QJZA 2CHZA 1QILA 4BAXA 3I57A 1TIFA 2V4IB 3HVZA 1X1MA 2G45B 5D94A 4F7ZA 2K6DB 4BBNC 1XLOA 3L17A 3B2GA 3QX1A 3AU5A 4MELA 3B9JA 4W9DA 3ZW3A 3VR8B 3BK2A 3VTWA 1YQBA 3L13A 3PHXB 2BKFA 2WGSA 4OHJA 4BOSC 5CTRC 4DDGD 1YMHE 2DYOA 3Q3JA 1N5XA 1QOFA 3PPAA 4B9KA 1MG8A 1G6JA 4W9FA 4ANWA 2WDQB 4IM0A 1TT5B 4W9IA 2L0FA 1T0QC 4MH8A 3IAS1 2NBWB 4PS7A 4UDUC 3WIMA 5D3IB 3PRMB 1JWSD 1WE6A 2KO3A 2KQ7A 1QZEA 2KHWB 1IUEA 3N3KB 3NS1A 1N61A 1V8CA 3KWVA 2KWDA 2VH1A 2O6VA 2YEPF 2KFKA 1D6EC 4EZLA 4AQ7A 4WWNA 3NHEB 2KDFB 2C9WB 3LYYA 2INNE 1Y56A 1KJTA 1D5ZC 4C80A 4TKNA 3R2IA 2RDHA 4WJOA 2RSUA 1A70A 2KQ4X 3VR9B 5J18A 3H8HA 4LK0M 2N7DA 1I35A 2L8JA 4WAAA 2INDC 2SEBD 4ARIA 4YTPB 4FBJB 1V2YA 1L2NA 4ZRIA 2DLBA 4A3PA 2FUHB 3RT3B 2V3NA 4I6PA 1WGHA 3Q69A 3QWZB 1CK1A 3AEBB 4FJYA 2AWTA 4K3CA 2W54A 3IT4B 2JF5A 1N60A 1ZUD2 4II3B 4BKSD 3L16A 4S0RA 3ZNID 2M4NA 2IY1B 4LDTB 1TKYA 4LNNA 4A8XC 2CS4A 1I4GA 5CHVC 5J17A 3AE2B 2WU5B 3KVFB 4B95A 3VFKA 2IGDA 1B1ZA 1F52A 1XLNA 3JW0X 3SR6A 3TEYA 5I4DA 3DBHB 1UWXA 3VQIA 3VUYA 3NOBA 4GN1A 2LGSA 5G5GA 3KLSX 2RDGA 3B2FA 2BTEA 3H1UA 1XXGA 5AZGA 1F9JA 2LFIA 3Q8CA 4MACA 5LLIA 2IPKD 2KKCA 2WXNA 4AUQC 1FRDA 1K51A 3AI5A 1BUIC 3KQ4A 3P4PB 3NZSA 4IOIE 1C3TA 1ZP0B 3PVLA 2WXKA 3MJWA 5EE9A 2JZZA 1YN5A 3RZFA 1C4CA 5IO9A 3LDZE 3N1YC 4RGMA 3A1QB 3V6EB 3L54A 3S2AA 2KZRA 4G11A 1VZ8A 5BYSA 1WGDA 4GMVA 4W9CA 4KDIC 1SE3A 3DBLI 3SDLC 2IZVB 3H7PB 2WLBA 1BT0A 3ZYYX 1R4MI 2DZKA 3IFWB 4NAMA 1V5TA 3EFCA 4JWUC 4AWJA 4NJ7A 2J0MA 1RFKA 1ZW7A 1FMAD 1N6ZA 4WWOA 1WE7A 3TL5A 5HKHA 3V61A 2EKIA 4L2YA 5C3JB 4MGZE 2LHEA 3MHZA 1YNTE 3NZ3A 2W55A 4BVUC 4OVZA 1DGJA 4MGYE 3IXSA 1SGHA 3K9PB 3VAWA 4HCNB 4GB9A 3UIOB 2JWUA 3B0AA 4OW0A 2NBUA 4LTUA 2DZIA 3V05A 1F77A 2PPHA 3L08A 2N9LA 3A9KB 1WJ6A 1WGKA 3A4SC 2DNFA 2B76B 2PW9A 1EM7A 1UH6A 4K81A 4RGNA 4DHJB 1KLVA 2ZCCA 4IC7B 4W9JA 2BWES 1M94A 1V9JA 4YTMB 1WR1A 2QILA 2D3BA 3AE9B 4W9EA 4XYCA 1C78A 4YSXB 2KTFA 2IGGA 2BT6A 4HJKA 3ZVVA 3A1QA 3ETRA 5FR3A 4EOYA 3DPDA 1YQ4B 3Q3OC 4RM8A 1OTRB 5JHBA 2JVCA 3PS6A 2N9EB 1XLPA 2L32A 1NEKB 1WX7A 3PV1A 1TS2A 5MPOA 4JLCA 3H7PA 1YX6B 3PRPB 2MA9B 2Q5WD 2L3ZA 3N9YC 1ESFA 2IDYA 3EC8A 2GLSA 3DVNU 1Q5WB 1KOTA 2OOBB 1I7HA 2DZMA 1UUPA 2EMTA 2Y5BB 1BXTA 3IG3A 1ROEA 3MFGA 1ZKHA 3IHPC 5DCNA 3HM6X 3HM3A 4WJQA 3MC9A 2A5UA 2MX2A 1E9MA 2KLGA 3ZDTA 4ACFA 2BB6A 4HEA1 4QAYA 1J19A 2KJ6A 5BYQA 3AEAB 1WI0A 4AOFA 1WJUA 4ICUA 3QA8A 2L52A 2MBEA 2IO1B 3AEDB 4A6QA 3LJ3A 1J7CA 4EKUA 3KH0A 1TS3A 3QARA 1IP9A 1GPXA 2MJ3A 3DDCB 1AN8A 2MLBA 3A9KA 4P7IA 4IM2A 4F8CB 3V6CB 2KWVB 3TMPB 2WXFA 2WP9B 5AZFA 4OVVA 1FFVA 2QDFA 2HDEA 2KNBA 3O65B 4AJWA 1HQRD 2PLPA 2EKEC 1MHHE 2JSVX 1Q1OA 2FCNA 2J42A 2QJLA 4E74A 1QKZA 4YSZB 3X23A 2MEKA 4G3XB 4GSWA 2N9KA 1MG4A 1R4NI 1EWYC 1HA5A 1IPGA 4GIVA 1YJIA 3CSFA 2J4XA 2Z59B 1YIWA 1FO4A 2KXJA 1UWMA 2C7NB 2ZCBA 1MJDA 3TIXA 3Q3FA 2KX0A 3P1MA 1E10A 2D11A 3EFUA 2MBBB 4JGHB 1XCTL 5FR6A 1LQBA 2WQYB 2N7JA 2JY6A 4M8MA 2KJHB 1H4RA 4ZRPA 3ZUNA
chains in the Genus database with same CATH topology
4NPNA 4BKGA 1NDDA 3L17A 3RCZA 2K39A 3AU5A 3QX1A 4MELA 1EF1A 4W9DA 3ZW3A 3VTWA 1V5OA 2WX1A 2I1JA 2RPQA 3M62B 1YQBA 4FJZA 3L13A 1WGGA 1YJ1A 1WF9A 3PHXB 3H6NA 1WX9A 2BKFA 4IWPA 4MGIE 3V62A 5CTRC 4BOSC 2BYVE 1RFAA 3UF8A 4DDGD 2DYOA 3Q3JA 3VVWB 1LM8B 2FCSA 3PPAA 4M0WB 1E90A 3EHVA 1AARA 2MBHA 2NBVB 3B08A 2IO2B 4B9KA 4CO7A 1MG8A 2C7HA 1G6JA 4W9FA 5G2NA 2ZPNA 4ANWA 2KANA 4IM0A 2YLMA 4W9IA 4KSKC 2L0FA 1UD7A 2ZNVC 4KSLC 3KYDD 1GUAB 5IA7A 3L0WB 2C5LC 3PTFC 4MJSB 1ISNA 2NBWB 3MTNB 4K7UA 4PS7A 3WIMA 1EO6A 4W9KA 3PRMB 2LGXA 1WRDB 2FIDA 5JZEB 2Z0DB 1WE6A 2KO3A 2J0KA 3DQVA 2KQ7A 2MSED 2O2VB 1QZEA 2J0JA 2KHWB 4W9LA 3N3KB 1WJ4A 3JVZX 4WJNA 2V3SA 3PREA 4MH0E 2NPTA 3KUDB 4W9HA 3UINB 5EDSA 2PJHA 4DWFA 4G50A 1CMXB 2O6VA 3VUXA 2KFKA 2KDEB 4EZLA 2HE7A 1XT9B 2LI5A 3QHTA 2N4FA 2ZVNA 2L0TA 3APDA 4WWNA 3VTVA 2K8CA 2D10A 3ZTDA 2KD0A 1SE9A 2KDFB 3NHEB 3QQ8B 1WYWB 4KZCA 5DPWA 2C9WB 3PZDA 3VDZA 1U4AA 4HLEA 1KJTA 4HPLB 4TKNA 2O6VD 4ANVA 3PT2B 5L83A 4WJOA 4BBNF 2BYEA 4IW0A 4FLHA 2RSUA 1OEYA 2OJRA 2C7MB 4CHKA 1D3ZA 5DPSA 3WANA 1NBFC 1WIAA 1WY8A 1VD2A 2D3GA 4GXBA 4AJYB 5L95C 5J18A 2JXXA 1I35A 2N7DA 2L8JA 1V80A 4WAAA 2CHXA 2IO3B 5TR5A 1WZ3A 2M17A 3APCA 2MW5A 4CYEA 3DVGY 1Z2MA 3UIPB 2GMIC 2KC2A 4HXDA 4EFOA 3ML9A 4ZRJA 4BKSA 4FBJB 1V2YA 3JYUA 1L2NA 1V86A 4ZRIA 3DBRI 3RULA 2FUHB 4A3PA 4FN2A 3RT3B 2L76A 2V1YA 2KMAA 4I6PA 1P9DU 1WGHA 3QWZB 1E7VA 4HK2A 4FJYA 2AWTA 2LVPA 1P1AA 3C0RB 3NZUA 3ZRFA 1WGRA 2JUOA 2KVRA 2JF5A 2JWZA 3K9OB 3N32A 4PS8A 2WYQA 2RR9A 4II3B 4BKSD 1WR6E 2KMCA 4KVGB 3SU8X 2KQSA 3L16A 4J6IA 4NY0A 4ANXA 4E71A 3ZNID 2M4NA 2IY1B 4LDTB 4GOCA 3RD2A 2FCMA 2LZ6A 5GMVA 1TGZB 1Z5SB 2Z0EB 4MSQB 4NJ6A 4HDQA 2CS4A 5CHVC 2N9XA 3A4RA 5J17A 1W6VA 2L00B 1HE8A 3KVFB 4HDOA 4NQKE 3BY4B 3VFKA 4B95A 5LXHA 2N1WA 2WDTB 3H9DA 4MJSA 2DYMA 3QCAA 3A33B 3JW0X 3TBLD 3PLUA 3D32A 3PHWB 2IY0B 4ANUA 4GDKB 3UQBA 1OQYA 4RM9A 3VQIA 4TQ0A 4FHJA 4MDKE 2K8BA 2O2VA 3VUYA 2LJ5A 3NOBA 1TZ1A 4GN1A 3VTUA 4PYUA 1V49A 4FHKA 1Q0WB 2GOWA 2K6QA 3QC8B 1LXDA 2XBBC 2ASQA 3H1UA 5AZHA 5AZGA 1F9JA 2NR2A 3ZDMC 2PE9A 3M95A 2WX0A 4ZYNA 2VRRB 3A9JB 5LLIA 2KKCA 2K25A 4AUQC 1YX5B 2REXA 1E8WA 2CHWA 3AI5A 2BWFA 1RAXA 3CMMB 1WH3A 2JZ3B 3NZSA 1UELA 4DK5A 5JHAA 4ZDVA 1C3TA 3PVLA 3MJWA 4PS3A 4LJPB 4N9F4 4A20A 5E6OA 2KWUB 1T0YA 2JZZA 4X57B 4URKA 3U30A 4ICVA 5BO4B 4I6LB 3RZFA 4AP4C 3W1SC 1E7UA 3LDZE 1Y8RC 1IYFA 2KN5A 3A1QB 4F1SA 3V6EB 2BF8B 3L54A 4I6NB 2CR5A 3S2AA 1RRBA 2MRPA 3MHSD 3EECA 2KZRA 1WMHB 4G11A 1OEYJ 2KWCA 2BGFA 2M8SA 4XC2A 3VH4B 1A5RA 2NS5A 2GBNA 3ZRCA 1WGDA 4GMVA 4W9CA 4MEMA 2DAFA 4IUMB 4JQWC 3R66C 4KDIC 5C23A 5IAAC 3TJPA 3DBLI 2N9PC 2IZVB 3SDLC 3V60A 5J2RA 3H7PB 2BYFA 5E6PA 5KHOA 1BT0A 2KDIA 4XZ4A 3QIJA 2QHOA 2RD0A 4NAWB 1R4MI 2ZPYA 2KOXA 2DZKA 2DHZA 3IFWB 1V5TA 2MP2B 4AWJA 2LVOA 2J0MA 4NJ7A 1I42A 3HK0A 4TQ1A 1ZW7A 3ZKJC 3ZO5B 5CX3A 1WGYA 3M3JA 3SHQA 3VUWA 4WWOA 1WE7A 4BKTA 1RLFA 4MSMB 3TL5A 2M1MA 5HKHA 2R2OA 2ZVOA 2LD9A 3DVGX 3GOEA 3V61A 3DCGA 4KIKB 1GC6A 3APFA 4LDTD 2DZJA 3ENEA 2I1KA 4MGZE 4RMAA 2FIFA 3WALA 4GDKA 5JH5C 4DHZE 1XQQA 4BVUC 4LJOB 4W9GA 2KTRB 2C60A 2N7EA 3OLMD 2AL3A 4MGYE 2L7RA 1SGHA 3ECIA 2LUEA 3K9PB 3VAWA 4EEWA 4HCNB 2LRWA 3VXWA 4GB9A 3R7RA 3UIOB 5KHQA 3DBSA 1UBIA 2KDBA 4XX5A 3B0AA 3W1SA 2N1VA 2MBOA 3A9JA 1V6EA 2FNJB 2MQJA 4KV2A 1UZXB 2KLCA 3L10B 1XD3B 2NBUA 4GDLB 1J0GA 2DZIA 1EUVB 2PPHA 3L08A 1GG3A 3PGEA 3WAMA 1UBQA 3QAQA 2ZJDA 3A9KB 1WJ6A 3A4SC 4K81A 2FAZA 3RUIB 1UH6A 4BOZB 2KX3A 4DHJB 3H7SA 1KLVA 2ZCCA 4IC7B 4W9JA 2BWES 1K8RB 1M94A 1V9JA 3X0WA 4GGQA 1WR1A 1OGWA 2JRIB 3VHTC 4WWPA 4DXAB 1UGMA 2AYOB 4W9EA 3U7DA 2G4SA 2KTFA 3M63B 2K1FA 2IO0B 3T8MA 2PE6B 4HJKA 4YL8A 3ZVVA 3A1QA 4HVBA 3SD5A 4EOYA 3DPDA 4IWQA 5AEKB 3UGBB 3P2BA 4FADA 4TV3A 1WMHA 4RM8A 1OTRB 1TTNA 1WXVA 1NI2A 4JIOU 2JVCA 4EZKA 5CHWA 5JHBA 1ZGUB 3IVFA 2N9EB 3PS6A 3ZIMA 3R7QA 4IWOA 3JSVB 1S1QB 2IBIB 5DPTA 4EUTA 2G3QB 4FA6A 2UWQA 4IG7B 1WX7A 1KM7A 2MBQA 2XK5B 3PV1A 1TBEA 3AULA 1YD8U 4JLCA 2AL6A 2ZNVB 3H7PA 1J8CA 1YX6B 3PRPB 3B1LX 2MA9B 3WAOA 2LGDA 2L05A 2LGYA 2JT4B 3UQAA 1JRUA 2BKRB 4NAWA 4HWIB 2FCQA 2MP2A 4FULA 4HPMB 2AEHA 4DBGA 2L3ZA 2D2QA 3EC8A 2HTHA 3KUZA 3DVNU 3ONSA 2J7QB 1LFDA 1Q5WB 2WWZA 1P3QU 1KOTA 2UYZB 4DHZB 3I3TB 2OOBB 2DZMA 2B3AA 2EMTA 2Y5BB 1GJZA 4EZJA 3IG3A 2JPHA 3KW5B 4KIKA 1ZKHA 3GZNI 3IHPC 2IYDB 5DCNA 2LVQA 3HM6X 3ML8A 3OJ3A 4A3OA 2A4ZA 1GNUA 3HM3A 4WJQA 4BFRA 1WXAA 2A5UA 3U8ZA 2MX2A 2HD5B 2KLGA 2KFJA 2MCNB 3WAPA 3ZDTA 1EF5A 3DVNV 1E5WA 4IM3A 1E8XA 2KTRA 3ZLZA 1J19A 2KJ6A 2LWPA 4NQLB 1PQSA 4OVUA 1WI0A 4AOFA 1WJUA 3QK0A 4ICUA 4K7WA 1V81A 3QA8A 4PYZA 1C1YB 1L7YA 2MBEA 3NY5A 2D07B 1SIFA 2DYBA 3KYCD 3DBHI 2IO1B 2GBJA 3LJ3A 4EKUA 4E3CA 3KH0A 4KZ0A 3BINA 2BPSA 3QARA 4GDLA 2LXAA 3PLVA 1IP9A 2LRUA 3KUCB 4G0NB 3CSTA 3DDCB 5D6JB 1WM2A 2MLBA 3A9KA 4P7IA 1WFYA 5D2MB 2RGFA 3ZNZB 2R2QA 2V4LA 4IM2A 2YVCA 3HIZA 4F8CB 3V6CB 2KWVB 5CHFA 1E8ZA 4GU2A 1VCBA 4MM3A 1WZ0A 3TMPB 5AZFA 1GC7A 4B6WA 3N30A 4OVVA 3T9LA 3VH3B 4MGKE 4DHJD 2EMSA 3AXCA 2KNBA 3O65B 4AJWA 2G4DB 3NS8A 3W1YA 2EKEC 3PSEB 1Q1OA 2LASA 5E6NA 5G55A 2GBRA 4JL9A 2FCNA 2KJRA 2PEAA 2GBKA 4HCPB 5DPRA 5LXIB 4E74A 4WQOB 3WA0A 3X23A 2NPTB 4G3XB 3JSVA 2JRHA 3R3MA 4GSWA 3LMNA 4K7SA 1R4NI 2MWSB 2DENB 2O6VB 4K1RB 2XK5A 3TCAA 2KFKB 1IPGA 3OAWA 4GIVA 4ZRKA 1WJNA 2GBMA 2XEWA 3CSFA 2ZZPB 2NCNA 1WXSA 3ZNGC 2Z59B 4NNJB 1P98A 2DAJA 4WJPA 1YIWA 2KXJA 2CKHB 5C1ZA 4LCDE 1WM3A 2HJ8A 2M0XA 2C7NB 1S3SG 2ZCBA 1WX8A 3PRZA 5D7GA 3TIXA 4M8NA 2W9NA 2ZEQA 4TUUA 4II2B 3Q3FA 3ZTCA 2K8HA 2CU1A 2KX0A 2LXCA 4DDID 2KC1A 2D11A 3EFUA 3ALBA 2DX5B 2MBBB 2NVUI 4JGHB 3AU4A 4ASWC 3ZNHB 3DOWA 4FJVB 5FR6A 1FXTB 3RZWC 1LQBA 3OJ4B 1H8CA 3IBEA 1WXMA 2CHZA 3QJZA 2JY6A 3HHMA 4M8MA 2KJHB 1P0RA 2KK8A 1H4RA 3RYTA 1X1MA 2G45B 5D94A 4F7ZA 1E8YA 2K6DB 4BBNC 3CF6E 4KDLB 3ZUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPN A;  4BKG A;  1NDD A;  3L17 A;  3RCZ A;  2K39 A;  3AU5 A;  3QX1 A;  4MEL A;  1EF1 A;  4W9D A;  3ZW3 A;  3VTW A;  1V5O A;  2WX1 A;  2I1J A;  2RPQ A;  3M62 B;  1YQB A;  4FJZ A;  3L13 A;  1WGG A;  1YJ1 A;  1WF9 A;  3PHX B;  3H6N A;  1WX9 A;  2BKF A;  4IWP A;  4MGI E;  3V62 A;  5CTR C;  4BOS C;  2BYV E;  1RFA A;  3UF8 A;  4DDG D;  2DYO A;  3Q3J A;  3VVW B;  1LM8 B;  2FCS A;  3PPA A;  4M0W B;  1E90 A;  3EHV A;  1AAR A;  2MBH A;  2NBV B;  3B08 A;  2IO2 B;  4B9K A;  4CO7 A;  1MG8 A;  2C7H A;  1G6J A;  4W9F A;  5G2N A;  2ZPN A;  4ANW A;  2KAN A;  4IM0 A;  2YLM A;  4W9I A;  4KSK C;  2L0F A;  1UD7 A;  2ZNV C;  4KSL C;  3KYD D;  1GUA B;  5IA7 A;  3L0W B;  2C5L C;  3PTF C;  4MJS B;  1ISN A;  2NBW B;  3MTN B;  4K7U A;  4PS7 A;  3WIM A;  1EO6 A;  4W9K A;  3PRM B;  2LGX A;  1WRD B;  2FID A;  5JZE B;  2Z0D B;  1WE6 A;  2KO3 A;  2J0K A;  3DQV A;  2KQ7 A;  2MSE D;  2O2V B;  1QZE A;  2J0J A;  2KHW B;  4W9L A;  3N3K B;  1WJ4 A;  3JVZ X;  4WJN A;  2V3S A;  3PRE A;  4MH0 E;  2NPT A;  3KUD B;  4W9H A;  3UIN B;  5EDS A;  2PJH A;  4DWF A;  4G50 A;  1CMX B;  2O6V A;  3VUX A;  2KFK A;  2KDE B;  4EZL A;  2HE7 A;  1XT9 B;  2LI5 A;  3QHT A;  2N4F A;  2ZVN A;  2L0T A;  3APD A;  4WWN A;  3VTV A;  2K8C A;  2D10 A;  3ZTD A;  2KD0 A;  1SE9 A;  2KDF B;  3NHE B;  3QQ8 B;  1WYW B;  4KZC A;  5DPW A;  2C9W B;  3PZD A;  3VDZ A;  1U4A A;  4HLE A;  1KJT A;  4HPL B;  4TKN A;  2O6V D;  4ANV A;  3PT2 B;  5L83 A;  4WJO A;  4BBN F;  2BYE A;  4IW0 A;  4FLH A;  2RSU A;  1OEY A;  2OJR A;  2C7M B;  4CHK A;  1D3Z A;  5DPS A;  3WAN A;  1NBF C;  1WIA A;  1WY8 A;  1VD2 A;  2D3G A;  4GXB A;  4AJY B;  5L95 C;  5J18 A;  2JXX A;  1I35 A;  2N7D A;  2L8J A;  1V80 A;  4WAA A;  2CHX A;  2IO3 B;  5TR5 A;  1WZ3 A;  2M17 A;  3APC A;  2MW5 A;  4CYE A;  3DVG Y;  1Z2M A;  3UIP B;  2GMI C;  2KC2 A;  4HXD A;  4EFO A;  3ML9 A;  4ZRJ A;  4BKS A;  4FBJ B;  1V2Y A;  3JYU A;  1L2N A;  1V86 A;  4ZRI A;  3DBR I;  3RUL A;  2FUH B;  4A3P A;  4FN2 A;  3RT3 B;  2L76 A;  2V1Y A;  2KMA A;  4I6P A;  1P9D U;  1WGH A;  3QWZ B;  1E7V A;  4HK2 A;  4FJY A;  2AWT A;  2LVP A;  1P1A A;  3C0R B;  3NZU A;  3ZRF A;  1WGR A;  2JUO A;  2KVR A;  2JF5 A;  2JWZ A;  3K9O B;  3N32 A;  4PS8 A;  2WYQ A;  2RR9 A;  4II3 B;  4BKS D;  1WR6 E;  2KMC A;  4KVG B;  3SU8 X;  2KQS A;  3L16 A;  4J6I A;  4NY0 A;  4ANX A;  4E71 A;  3ZNI D;  2M4N A;  2IY1 B;  4LDT B;  4GOC A;  3RD2 A;  2FCM A;  2LZ6 A;  5GMV A;  1TGZ B;  1Z5S B;  2Z0E B;  4MSQ B;  4NJ6 A;  4HDQ A;  2CS4 A;  5CHV C;  2N9X A;  3A4R A;  5J17 A;  1W6V A;  2L00 B;  1HE8 A;  3KVF B;  4HDO A;  4NQK E;  3BY4 B;  3VFK A;  4B95 A;  5LXH A;  2N1W A;  2WDT B;  3H9D A;  4MJS A;  2DYM A;  3QCA A;  3A33 B;  3JW0 X;  3TBL D;  3PLU A;  3D32 A;  3PHW B;  2IY0 B;  4ANU A;  4GDK B;  3UQB A;  1OQY A;  4RM9 A;  3VQI A;  4TQ0 A;  4FHJ A;  4MDK E;  2K8B A;  2O2V A;  3VUY A;  2LJ5 A;  3NOB A;  1TZ1 A;  4GN1 A;  3VTU A;  4PYU A;  1V49 A;  4FHK A;  1Q0W B;  2GOW A;  2K6Q A;  3QC8 B;  1LXD A;  2XBB C;  2ASQ A;  3H1U A;  5AZH A;  5AZG A;  1F9J A;  2NR2 A;  3ZDM C;  2PE9 A;  3M95 A;  2WX0 A;  4ZYN A;  2VRR B;  3A9J B;  5LLI A;  2KKC A;  2K25 A;  4AUQ C;  1YX5 B;  2REX A;  1E8W A;  2CHW A;  3AI5 A;  2BWF A;  1RAX A;  3CMM B;  1WH3 A;  2JZ3 B;  3NZS A;  1UEL A;  4DK5 A;  5JHA A;  4ZDV A;  1C3T A;  3PVL A;  3MJW A;  4PS3 A;  4LJP B;  4N9F 4;  4A20 A;  5E6O A;  2KWU B;  1T0Y A;  2JZZ A;  4X57 B;  4URK A;  3U30 A;  4ICV A;  5BO4 B;  4I6L B;  3RZF A;  4AP4 C;  3W1S C;  1E7U A;  3LDZ E;  1Y8R C;  1IYF A;  2KN5 A;  3A1Q B;  4F1S A;  3V6E B;  2BF8 B;  3L54 A;  4I6N B;  2CR5 A;  3S2A A;  1RRB A;  2MRP A;  3MHS D;  3EEC A;  2KZR A;  1WMH B;  4G11 A;  1OEY J;  2KWC A;  2BGF A;  2M8S A;  4XC2 A;  3VH4 B;  1A5R A;  2NS5 A;  2GBN A;  3ZRC A;  1WGD A;  4GMV A;  4W9C A;  4MEM A;  2DAF A;  4IUM B;  4JQW C;  3R66 C;  4KDI C;  5C23 A;  5IAA C;  3TJP A;  3DBL I;  2N9P C;  2IZV B;  3SDL C;  3V60 A;  5J2R A;  3H7P B;  2BYF A;  5E6P A;  5KHO A;  1BT0 A;  2KDI A;  4XZ4 A;  3QIJ A;  2QHO A;  2RD0 A;  4NAW B;  1R4M I;  2ZPY A;  2KOX A;  2DZK A;  2DHZ A;  3IFW B;  1V5T A;  2MP2 B;  4AWJ A;  2LVO A;  2J0M A;  4NJ7 A;  1I42 A;  3HK0 A;  4TQ1 A;  1ZW7 A;  3ZKJ C;  3ZO5 B;  5CX3 A;  1WGY A;  3M3J A;  3SHQ A;  3VUW A;  4WWO A;  1WE7 A;  4BKT A;  1RLF A;  4MSM B;  3TL5 A;  2M1M A;  5HKH A;  2R2O A;  2ZVO A;  2LD9 A;  3DVG X;  3GOE A;  3V61 A;  3DCG A;  4KIK B;  1GC6 A;  3APF A;  4LDT D;  2DZJ A;  3ENE A;  2I1K A;  4MGZ E;  4RMA A;  2FIF A;  3WAL A;  4GDK A;  5JH5 C;  4DHZ E;  1XQQ A;  4BVU C;  4LJO B;  4W9G A;  2KTR B;  2C60 A;  2N7E A;  3OLM D;  2AL3 A;  4MGY E;  2L7R A;  1SGH A;  3ECI A;  2LUE A;  3K9P B;  3VAW A;  4EEW A;  4HCN B;  2LRW A;  3VXW A;  4GB9 A;  3R7R A;  3UIO B;  5KHQ A;  3DBS A;  1UBI A;  2KDB A;  4XX5 A;  3B0A A;  3W1S A;  2N1V A;  2MBO A;  3A9J A;  1V6E A;  2FNJ B;  2MQJ A;  4KV2 A;  1UZX B;  2KLC A;  3L10 B;  1XD3 B;  2NBU A;  4GDL B;  1J0G A;  2DZI A;  1EUV B;  2PPH A;  3L08 A;  1GG3 A;  3PGE A;  3WAM A;  1UBQ A;  3QAQ A;  2ZJD A;  3A9K B;  1WJ6 A;  3A4S C;  4K81 A;  2FAZ A;  3RUI B;  1UH6 A;  4BOZ B;  2KX3 A;  4DHJ B;  3H7S A;  1KLV A;  2ZCC A;  4IC7 B;  4W9J A;  2BWE S;  1K8R B;  1M94 A;  1V9J A;  3X0W A;  4GGQ A;  1WR1 A;  1OGW A;  2JRI B;  3VHT C;  4WWP A;  4DXA B;  1UGM A;  2AYO B;  4W9E A;  3U7D A;  2G4S A;  2KTF A;  3M63 B;  2K1F A;  2IO0 B;  3T8M A;  2PE6 B;  4HJK A;  4YL8 A;  3ZVV A;  3A1Q A;  4HVB A;  3SD5 A;  4EOY A;  3DPD A;  4IWQ A;  5AEK B;  3UGB B;  3P2B A;  4FAD A;  4TV3 A;  1WMH A;  4RM8 A;  1OTR B;  1TTN A;  1WXV A;  1NI2 A;  4JIO U;  2JVC A;  4EZK A;  5CHW A;  5JHB A;  1ZGU B;  3IVF A;  2N9E B;  3PS6 A;  3ZIM A;  3R7Q A;  4IWO A;  3JSV B;  1S1Q B;  2IBI B;  5DPT A;  4EUT A;  2G3Q B;  4FA6 A;  2UWQ A;  4IG7 B;  1WX7 A;  1KM7 A;  2MBQ A;  2XK5 B;  3PV1 A;  1TBE A;  3AUL A;  1YD8 U;  4JLC A;  2AL6 A;  2ZNV B;  3H7P A;  1J8C A;  1YX6 B;  3PRP B;  3B1L X;  2MA9 B;  3WAO A;  2LGD A;  2L05 A;  2LGY A;  2JT4 B;  3UQA A;  1JRU A;  2BKR B;  4NAW A;  4HWI B;  2FCQ A;  2MP2 A;  4FUL A;  4HPM B;  2AEH A;  4DBG A;  2L3Z A;  2D2Q A;  3EC8 A;  2HTH A;  3KUZ A;  3DVN U;  3ONS A;  2J7Q B;  1LFD A;  1Q5W B;  2WWZ A;  1P3Q U;  1KOT A;  2UYZ B;  4DHZ B;  3I3T B;  2OOB B;  2DZM A;  2B3A A;  2EMT A;  2Y5B B;  1GJZ A;  4EZJ A;  3IG3 A;  2JPH A;  3KW5 B;  4KIK A;  1ZKH A;  3GZN I;  3IHP C;  2IYD B;  5DCN A;  2LVQ A;  3HM6 X;  3ML8 A;  3OJ3 A;  4A3O A;  2A4Z A;  1GNU A;  3HM3 A;  4WJQ A;  4BFR A;  1WXA A;  2A5U A;  3U8Z A;  2MX2 A;  2HD5 B;  2KLG A;  2KFJ A;  2MCN B;  3WAP A;  3ZDT A;  1EF5 A;  3DVN V;  1E5W A;  4IM3 A;  1E8X A;  2KTR A;  3ZLZ A;  1J19 A;  2KJ6 A;  2LWP A;  4NQL B;  1PQS A;  4OVU A;  1WI0 A;  4AOF A;  1WJU A;  3QK0 A;  4ICU A;  4K7W A;  1V81 A;  3QA8 A;  4PYZ A;  1C1Y B;  1L7Y A;  2MBE A;  3NY5 A;  2D07 B;  1SIF A;  2DYB A;  3KYC D;  3DBH I;  2IO1 B;  2GBJ A;  3LJ3 A;  4EKU A;  4E3C A;  3KH0 A;  4KZ0 A;  3BIN A;  2BPS A;  3QAR A;  4GDL A;  2LXA A;  3PLV A;  1IP9 A;  2LRU A;  3KUC B;  4G0N B;  3CST A;  3DDC B;  5D6J B;  1WM2 A;  2MLB A;  3A9K A;  4P7I A;  1WFY A;  5D2M B;  2RGF A;  3ZNZ B;  2R2Q A;  2V4L A;  4IM2 A;  2YVC A;  3HIZ A;  4F8C B;  3V6C B;  2KWV B;  5CHF A;  1E8Z A;  4GU2 A;  1VCB A;  4MM3 A;  1WZ0 A;  3TMP B;  5AZF A;  1GC7 A;  4B6W A;  3N30 A;  4OVV A;  3T9L A;  3VH3 B;  4MGK E;  4DHJ D;  2EMS A;  3AXC A;  2KNB A;  3O65 B;  4AJW A;  2G4D B;  3NS8 A;  3W1Y A;  2EKE C;  3PSE B;  1Q1O A;  2LAS A;  5E6N A;  5G55 A;  2GBR A;  4JL9 A;  2FCN A;  2KJR A;  2PEA A;  2GBK A;  4HCP B;  5DPR A;  5LXI B;  4E74 A;  4WQO B;  3WA0 A;  3X23 A;  2NPT B;  4G3X B;  3JSV A;  2JRH A;  3R3M A;  4GSW A;  3LMN A;  4K7S A;  1R4N I;  2MWS B;  2DEN B;  2O6V B;  4K1R B;  2XK5 A;  3TCA A;  2KFK B;  1IPG A;  3OAW A;  4GIV A;  4ZRK A;  1WJN A;  2GBM A;  2XEW A;  3CSF A;  2ZZP B;  2NCN A;  1WXS A;  3ZNG C;  2Z59 B;  4NNJ B;  1P98 A;  2DAJ A;  4WJP A;  1YIW A;  2KXJ A;  2CKH B;  5C1Z A;  4LCD E;  1WM3 A;  2HJ8 A;  2M0X A;  2C7N B;  1S3S G;  2ZCB A;  1WX8 A;  3PRZ A;  5D7G A;  3TIX A;  4M8N A;  2W9N A;  2ZEQ A;  4TUU A;  4II2 B;  3Q3F A;  3ZTC A;  2K8H A;  2CU1 A;  2KX0 A;  2LXC A;  4DDI D;  2KC1 A;  2D11 A;  3EFU A;  3ALB A;  2DX5 B;  2MBB B;  2NVU I;  4JGH B;  3AU4 A;  4ASW C;  3ZNH B;  3DOW A;  4FJV B;  5FR6 A;  1FXT B;  3RZW C;  1LQB A;  3OJ4 B;  1H8C A;  3IBE A;  1WXM A;  2CHZ A;  3QJZ A;  2JY6 A;  3HHM A;  4M8M A;  2KJH B;  1P0R A;  2KK8 A;  1H4R A;  3RYT A;  1X1M A;  2G45 B;  5D94 A;  4F7Z A;  1E8Y A;  2K6D B;  4BBN C;  3CF6 E;  4KDL B;  3ZUN A; 
#chains in the Genus database with same CATH topology
 4OZA A;  4BKG A;  1F2R I;  3RCZ A;  1EF1 A;  2AX5 A;  1KLG D;  2RPQ A;  3M62 B;  2KDM A;  3H6N A;  1XF5 L;  2M19 A;  3UF8 A;  3VVW B;  1LM8 B;  2FCS A;  3EHV A;  3B08 A;  1SBB B;  2IO2 B;  1FCL A;  2LJI A;  2ZPN A;  1UD7 A;  2H89 B;  3AE6 B;  4IDI A;  2EEL A;  3L0W B;  2C5L C;  4K7U A;  1EO6 A;  3HRD D;  4W9K A;  2FID A;  1WWT A;  2J0K A;  2J0J A;  1CZP A;  4WH4 A;  4C4V B;  5HI1 A;  2DBY A;  2V3S A;  1OQQ A;  3R2T A;  2G9H D;  3KUD B;  4W9H A;  3UIN B;  4DXF A;  4LNI A;  4IKG A;  2KDE B;  2HE7 A;  3APD A;  2K8C A;  2KD0 A;  3BII D;  1TKE A;  3EA6 A;  2JZP A;  3BYY B;  5L83 A;  2BYE A;  2WHI A;  4ITK A;  1OEY A;  2C7M B;  4CHK A;  3U2S C;  3E9S A;  3WAN A;  1WIA A;  2D3G A;  4OZC A;  1V80 A;  2IO3 B;  2L83 A;  2CU3 A;  2VH2 A;  3DVG Y;  4YT0 B;  2D3A A;  4HXD A;  5BYR A;  1V86 A;  2V1Y A;  2WXQ A;  2W82 A;  5HHD G;  1P1A A;  1FIQ A;  1L0V B;  1SF0 A;  3C0R B;  3NZU A;  1WGR A;  4LLG M;  2JWZ A;  2XN9 C;  1WR6 E;  1XEE A;  2KMC A;  1T6B X;  2KQS A;  4J6I A;  3EGR A;  4JPS A;  1MFW A;  4GOC A;  2FCM A;  1TGZ B;  1Z5S B;  4NJ6 A;  4KKI A;  1FFU A;  2N9X A;  2L00 B;  1IGC A;  1N5W A;  4NQK E;  2HJ1 A;  4B0E A;  5LXH A;  4M00 A;  4WWM A;  2WDT B;  3H9D A;  2JQR B;  2DYM A;  3TBL D;  3PHW B;  2IY0 B;  2VZK B;  4GDK B;  3UQB A;  2K8B A;  2M56 B;  4C4V A;  4PYU A;  4M02 A;  1I4P A;  3N1X C;  3Q3M C;  3QC8 B;  2LHD A;  2XBB C;  3NUH B;  1L0X B;  2PE9 A;  3M95 A;  4C56 C;  1GB1 A;  3OWE B;  4ZYN A;  3A9J B;  1NYR A;  1L6U A;  2REX A;  4C7Y A;  4J3O D;  1WH3 A;  1UEL A;  2D5G A;  4LJP B;  1D4B A;  5E6O A;  4URK A;  1SE4 A;  3SEB A;  3W5V B;  4RF0 A;  3ZJU A;  3AEF B;  3Q14 C;  1IYF A;  1GAQ B;  2KN5 A;  5EE1 A;  1RRB A;  1WMH B;  2JX5 A;  3VH4 B;  2GBN A;  1ZPS A;  1ZDV A;  4IUM B;  4JQW C;  3RNA C;  5IAA C;  3TJP A;  4TMA B;  2N9P C;  3V60 A;  2FE8 A;  2JU6 X;  2LMC A;  2V3P A;  4KGT A;  5J2R A;  1EU3 A;  5KHO A;  1RM6 C;  4US9 A;  2RD0 A;  2KOX A;  1VJK A;  1N63 A;  3ZO5 B;  1WGY A;  3SHQ A;  3MC0 B;  2BVC A;  2R2O A;  3GOE A;  2LGI A;  4CQN A;  3FAH A;  4ZHP A;  1ZDX A;  2DZJ A;  3ENE A;  3WAL A;  4GDK A;  5JH5 C;  1AYF A;  2WNM A;  4LJO B;  2BS2 B;  2KTR B;  2N7E A;  1VR9 A;  1VLB A;  2L7R A;  2LUE A;  5KHQ A;  2LRW A;  1ZE3 D;  3W1S A;  2N1V A;  1K53 A;  3A9J A;  2MQJ A;  1UZX B;  3L10 B;  3PZ8 A;  1XD3 B;  3WAM A;  1TY2 A;  2KX3 A;  1KRH A;  1K8R B;  3Q8A A;  1OGW A;  2JRI B;  4WWP A;  3RNG C;  1UGM A;  4NJC A;  1JWM D;  1YOV B;  2KVZ A;  1LO5 D;  4IWQ A;  1JML A;  3UGB B;  4FAD A;  1WMH A;  4JIO U;  5CHW A;  4N58 A;  3ZIM A;  3BVM A;  3JSV B;  1S1Q B;  2G3Q B;  2UWQ A;  2WXH A;  1D5M C;  2XK5 B;  2Y5P A;  2AL6 A;  2OED A;  2L05 A;  2LGY A;  3UQA A;  1JWA D;  4ZRQ A;  4FUL A;  4HPM B;  3N1Z C;  3KUZ A;  1K52 A;  1PDX A;  3KWL A;  1SXT A;  5JXV A;  4DQO C;  2G1E A;  1V1P B;  3GZN I;  1J7B A;  2IYD B;  1GNU A;  2BS4 B;  1WXA A;  2HD5 B;  4AS1 A;  2MCN B;  1FD6 A;  3DVN V;  1E5W A;  2Y5C A;  1E8X A;  2KTR A;  3ZLZ A;  5HG2 A;  1PQS A;  2RMM A;  2D07 B;  3AEG B;  2GBJ A;  1JRP A;  2BQQ A;  3ZJT A;  5BMH A;  3GE8 C;  2LXA A;  3PLV A;  3NG0 A;  2LRU A;  4G0N B;  3CST A;  1WFY A;  1MHX A;  2RGF A;  2R2Q A;  2V4L A;  2YVC A;  2LEK A;  2ZW1 A;  3MJ5 A;  3Q8B A;  5CHF A;  3U4E G;  1VCB A;  2XNA C;  1GC7 A;  4B6W A;  3N30 A;  2K9X A;  3T9L A;  2K5P A;  3VH3 B;  2EMS A;  2G4D B;  3PZ7 A;  1FRR A;  1KTK A;  4WQM A;  4HCP B;  5DPR A;  3VRB B;  1JW9 D;  1HTO A;  4EE2 A;  3AH7 A;  4S17 A;  3WA0 A;  1NYQ A;  1GOZ A;  3JSV A;  3AB5 A;  2JRH A;  1TY0 A;  3O13 A;  4K7S A;  2PVG C;  2KAC A;  2MWS B;  3NVW A;  2DEN B;  4K1R B;  2XK5 A;  1WJN A;  5BMI A;  2NCN A;  3N20 C;  3ZNG C;  5D3D A;  1YN3 A;  2DAJ A;  1C4P A;  4KX6 B;  1WM3 A;  1S3S G;  2WDV B;  3GZN B;  3RPF C;  2W9N A;  4II2 B;  2KC1 A;  4RCO A;  4ASW C;  2NVU I;  2TSS A;  3AU4 A;  1V1P A;  3RZW C;  1I4X A;  2BYT A;  3DBL B;  1OQR A;  1WXM A;  2QMT A;  1P0R A;  1CQV A;  2KK8 A;  3RYT A;  4JX1 C;  1E8Y A;  3AE3 B;  2J52 A;  1R4M B;  1NDD A;  2M0A A;  1AW7 A;  1R7S A;  3V62 A;  2IGH A;  1UGJ A;  2BYV E;  2JYT A;  4XDC A;  2MBH A;  4K3B A;  2NBV B;  2C7H A;  3W9C B;  5G2N A;  3RN9 C;  2KAN A;  3RNB C;  2ZNV C;  4HJG E;  3KYD D;  1GUA B;  3MC8 A;  2GB1 A;  2L1A A;  1PYW D;  1TYG B;  3MTN B;  3R8B A;  3URY A;  1VZ7 A;  1WRD B;  5JZE B;  2Z0D B;  3DQV A;  2MSE D;  2BW2 A;  2O2V B;  1UNS A;  1VDV A;  2WU2 B;  1WJ4 A;  3BWU D;  4WJN A;  1HEZ E;  1C77 A;  5EDS A;  1KFY B;  3VUX A;  1FEH A;  1XT9 B;  2LI5 A;  1SJH D;  2N4F A;  3VTV A;  2D10 A;  5DPW A;  1SE9 A;  4KZC A;  3VDZ A;  1U4A A;  4KGR A;  4DXG A;  3DHI C;  1WXQ A;  2O6V D;  4RGT A;  4ANV A;  4BBN F;  4IW0 A;  4FLH A;  1D3Z A;  2AQ3 B;  4PK1 A;  5L95 C;  2CHX A;  4YXD B;  1OFF A;  4C7Z A;  3APC A;  2MW5 A;  2GMI C;  2KC2 A;  3ML9 A;  4ZRJ A;  4BKS A;  3JYU A;  3RUL A;  2L76 A;  4HRS A;  1P9D U;  1E7V A;  4HK2 A;  2LVP A;  1UF0 A;  4ARC A;  3L4P A;  2KVR A;  4LNO A;  3UI3 A;  3K9O B;  4A55 A;  1WYG A;  4PS8 A;  4KVG B;  3DWG C;  2JYE A;  4ANX A;  4N59 A;  2QSD A;  3AEE B;  4HKQ A;  3RD2 A;  4HRO A;  3TEX A;  4MSQ B;  1F0Z A;  4HDQ A;  3WCQ A;  4RH6 A;  3Q2A C;  3A4R A;  1W6V A;  3BYT B;  3BY4 B;  2WXR A;  3A33 B;  1IBX B;  3PLU A;  3D32 A;  4ANU A;  1OQY A;  4RM9 A;  4TSS A;  4TQ0 A;  4MDK E;  2O2V A;  2LJ5 A;  1TZO A;  1TZ1 A;  3VTU A;  4FHK A;  1SSN A;  2GOW A;  2K6Q A;  1LXD A;  1ET9 A;  3J9C A;  3ZDM C;  1I4R A;  2VRR B;  1ZOY B;  5IOI A;  2GI9 A;  2CHW A;  3I63 C;  3AN1 A;  2QIE B;  2BWF A;  1RAX A;  3CMM B;  2JZ3 B;  4DK5 A;  2FBW B;  5JHA A;  4PT5 A;  4ZDV A;  1FNV A;  4PS3 A;  3AM9 A;  1ZXH A;  4A20 A;  2KWU B;  1T0Y A;  4X57 B;  4ICV A;  5FK9 C;  4I6L B;  5BO4 B;  5AUK A;  3FIL B;  3W1S C;  4M01 A;  4YWG G;  5G5H A;  2WXI A;  4F1S A;  2MJD A;  1R4N B;  2MJE A;  3AV8 A;  1OEY J;  2KWC A;  1A5R A;  1I4H A;  2WXG A;  2NS5 A;  4KGS A;  4MEM A;  4XDD A;  5C2T B;  3R66 C;  5C23 A;  1PFD A;  2PKO A;  2WS3 B;  1K50 A;  5E6P A;  2KDI A;  4XZ4 A;  3QIJ A;  2QHO A;  1N62 A;  2DHZ A;  2MP2 B;  3W5U B;  3HK0 A;  4TQ1 A;  1P7F A;  3C19 A;  5CX3 A;  1JRO A;  3M3J A;  3VUW A;  4P1B C;  4BKT A;  1RLF A;  4MSM B;  2ZVO A;  3DVG X;  3W2D A;  1JCK B;  4KIK B;  1GC6 A;  3APF A;  4LDT D;  2I1K A;  3ABV B;  1IBX A;  4XWT A;  4RMA A;  3P4Q B;  3AE8 B;  1TJE A;  4DHZ E;  4HPP A;  3ZXV A;  2C60 A;  3U7Z A;  4EEW A;  1RWS A;  1UBI A;  2KDB A;  2MBO A;  2JXT A;  3ZXR A;  1V6E A;  2FNJ B;  4KV2 A;  1EUV B;  1GG3 A;  3PGE A;  3NVZ A;  3QAQ A;  2ZJD A;  1QOG A;  2FAZ A;  4BOZ B;  3X0W A;  4GGQ A;  3VHT C;  2ACZ B;  4DXA B;  2AYO B;  1MPE A;  3U7D A;  3FIL A;  4XE0 A;  3BK1 A;  2K1F A;  1M4V A;  2PE6 B;  4YL8 A;  2FUG 1;  3SD5 A;  1GB4 A;  3P2B A;  4TV3 A;  4EZK A;  1TTN A;  1WXV A;  1NI2 A;  2K3U A;  2NMQ A;  1MI0 A;  5DPT A;  4EUT A;  5IP4 D;  4IG7 B;  3TUO A;  3IT6 B;  1KM7 A;  2MBQ A;  3AUL A;  3BZD B;  5GXG B;  3WAO A;  2ZW0 A;  2JT4 B;  1JRU A;  2BKR B;  4O1N A;  1C4A A;  1VZ6 A;  2FCQ A;  2MP2 A;  1ET6 A;  4DBG A;  3BVG A;  3GE3 C;  3V3X A;  4US8 A;  1ACC A;  2WWZ A;  1P3Q U;  1C76 A;  2UYZ B;  3P4S B;  4DHZ B;  3TEW A;  4EZJ A;  3KW5 B;  4KIK A;  2W3S A;  1FM0 D;  3U8Z A;  4HKZ E;  4ZHO A;  1YN4 A;  3GS2 A;  4OVU A;  4P6V F;  1NI3 A;  3QK0 A;  1V81 A;  4PYZ A;  2NTT A;  3LXF A;  3DBH I;  4KZ0 A;  3BIN A;  2BPS A;  5AUI A;  3KUC B;  2CJO A;  1WM2 A;  4C00 A;  5D2M B;  3ZNZ B;  2V9H A;  3HIZ A;  3SFE B;  4P16 A;  2AQ2 B;  3HUI A;  2X38 A;  5HFY A;  1STE A;  4DHJ D;  2KN4 A;  1T5X D;  3RFZ B;  3NS8 A;  4R3D A;  3RNC C;  3T3O A;  3AE5 B;  1V1O A;  4BZA A;  3PSE B;  3Q3N C;  5G55 A;  2GBR A;  4JL9 A;  2KJR A;  5LXI B;  2GBK A;  2HTM E;  3CIR B;  2RPV A;  4XGA B;  3GP7 A;  2OHF A;  2NPT B;  3R3M A;  3TCA A;  4ZOH C;  1D5X C;  2D3C A;  4NNJ B;  1P98 A;  5C1Z A;  2X8X X;  3LB8 C;  3RNE C;  2Z8L A;  3PRZ A;  1F1H A;  4M8N A;  2ZEQ A;  1JQ4 A;  4TUU A;  3ZTC A;  2K8H A;  2CU1 A;  2LXC A;  2KAJ A;  3U52 E;  2GRI A;  1XO3 A;  2K0P A;  3ALB A;  4RFB A;  3DOW A;  4FJV B;  4RGO S;  1FXT B;  3OJ4 B;  1H8C A;  2PVO D;  3IBE A;  1NVI D;  3HHM A;  3PO0 A;  1T0S C;  4N6E B;  1V97 A;  4FXC A;  3CF6 E;  4WUR A;  4KDL B;  4NPN A;  2NTS A;  1L4D B;  3E56 A;  4MT5 A;  2K39 A;  4JWS C;  3AE1 B;  1V5O A;  2WX1 A;  2I1J A;  4FJZ A;  1WGG A;  1YJ1 A;  1WF9 A;  3NJT A;  1WX9 A;  4IWP A;  4MGI E;  4USA A;  1RFA A;  2BBC A;  1FXA A;  4M0W B;  1E90 A;  1DYQ A;  1L4Z B;  1AAR A;  4LNK A;  4L1B A;  4CO7 A;  4L23 A;  3OG5 A;  2YLM A;  4KSK C;  2OJW A;  1RYJ A;  4KSL C;  4YSY B;  3TSS A;  5IA7 A;  2V0G A;  1LGR A;  3PTF C;  4MJS B;  1ISN A;  1TKG A;  2LGX A;  1E0Z A;  4W9L A;  3JVZ X;  2INC C;  2QEJ C;  3PRE A;  1SEB D;  3EUB 2;  4MH0 E;  2NPT A;  3NRZ A;  1DOX A;  4LNF A;  2I2Y A;  2MH7 A;  2PJH A;  4DWF A;  4G50 A;  1CMX B;  2Y3A A;  1EWC A;  2WXM A;  3QHT A;  2ZVN A;  2DWQ A;  2L0T A;  3ZTD A;  3QQ8 B;  1WYW B;  2W3R A;  1JAL A;  3PZD A;  4A9A A;  4HLE A;  4HPL B;  1I4Q A;  4A90 A;  3PT2 B;  1E6E B;  2OJR A;  1SB3 C;  5DPS A;  1NBF C;  1WY8 A;  4GXB A;  1VD2 A;  4AJY B;  2JXX A;  5TR5 A;  1WZ3 A;  2M17 A;  4CYE A;  1Z2M A;  3UIP B;  4EFO A;  3DBR I;  4FN2 A;  2KMA A;  3ZJV A;  1J7A A;  1QLB B;  1HTQ A;  1B9R A;  2N0S B;  3ZRF A;  2JUO A;  3N32 A;  2WYQ A;  2RR9 A;  2PIA A;  1L6V A;  1FCC C;  1XCQ L;  4NY0 A;  3SU8 X;  4E71 A;  5E6J A;  4M0W A;  2J53 A;  5GMV A;  2LZ6 A;  2IJ0 A;  2Z0E B;  1PGB A;  2PTL A;  1JWU D;  2R61 A;  1KLU D;  3DHG C;  1FNW A;  3P4R B;  1HE8 A;  4HDO A;  2N1W A;  1HXY D;  2LUM A;  4MJS A;  3QCA A;  2K22 A;  2UU7 A;  1WRI A;  1JWB D;  1FXI A;  4FHJ A;  3NVV A;  1V49 A;  5IKC M;  1Q0W B;  3VRA B;  2ASQ A;  5AZH A;  1YJJ A;  3SFD B;  2H88 B;  2NR2 A;  4WAF A;  2WX0 A;  1P7E A;  1TS5 A;  2K25 A;  1YX5 B;  2ICI A;  1PUT A;  5BMG A;  1E8W A;  1PGX A;  4RNA A;  1WSP A;  2WXO A;  4N9F 4;  4REZ A;  3U30 A;  3FC4 A;  4AP4 C;  1E7U A;  1Y8R C;  1AWD A;  1QT9 A;  3DBR B;  3AEC B;  2BF8 B;  4I6N B;  2CR5 A;  5H8Y E;  2MRP A;  2E3T A;  3EEC A;  3MHS D;  2I38 A;  2KT7 A;  2M8S A;  4NZL B;  2BGF A;  4XC2 A;  3ZRC A;  2DAF A;  3BVZ A;  3T3N A;  1QOB A;  4GLS C;  3DHH C;  2BYF A;  5H92 C;  4NAW B;  2ZPY A;  1SE2 A;  1XLQ A;  2LVO A;  1NEN B;  1I42 A;  3ZKJ C;  1DOY A;  1IGD A;  2M1M A;  4OZB A;  2LD9 A;  2ON8 A;  3DCG A;  1ZXI A;  5TSS A;  2AQ1 B;  1HZ6 A;  4D2K A;  2FIF A;  3ZQ4 A;  1XQQ A;  3Q8F A;  4W9G A;  3OLM D;  2AL3 A;  1BML C;  3ECI A;  4B0M A;  3VXW A;  1QQR A;  3R7R A;  2BB5 A;  3DBS A;  1C79 A;  2VZK D;  4XX5 A;  1FNU A;  1L0Y B;  1F2R C;  2KLC A;  2YEP B;  4GDL B;  1J0G A;  1CJE A;  1UBQ A;  3RI7 C;  1L5P A;  4XWW A;  3RUI B;  3H7S A;  1T0R C;  5EE3 A;  4MM3 B;  2CJN A;  1Q10 A;  2G4S A;  3M63 B;  2QC8 A;  2IO0 B;  3T8M A;  4HVB A;  5AEK B;  1ZGU B;  3IVF A;  3ZGZ A;  3CWI A;  3R7Q A;  4IWO A;  2IBI B;  2MHJ A;  4FA6 A;  2ONQ A;  1TBE A;  1YD8 U;  2WXL A;  2ZNV B;  3DWM A;  2WXJ A;  5EE0 A;  1J8C A;  3B1L X;  2LGD A;  2PMV A;  3Q8E A;  4NAW A;  3C8Y A;  4Q2J A;  1MVK A;  3Q6B A;  4HWI B;  1PGA A;  2AEH A;  2D2Q A;  2HTH A;  3ONS A;  2J7Q B;  2BS3 B;  1LFD A;  4WIP A;  3I3T B;  2B3A A;  1GJZ A;  3AMZ A;  2JPH A;  2LVQ A;  3ML8 A;  3OJ3 A;  1TS4 A;  4A3O A;  2A4Z A;  4BFR A;  3NVY A;  1E7P B;  2KFJ A;  3WAP A;  1QF6 A;  1EF5 A;  4IM3 A;  2LWP A;  4NQL B;  4K7W A;  1C1Y B;  1L7Y A;  3NY5 A;  1DOI A;  3IAM 1;  1SIF A;  4ZYS A;  2DYB A;  3KYC D;  4E3C A;  4GDL A;  3GB1 A;  5D6J B;  2WDR B;  5FKA C;  3RMK C;  3RNF C;  1SIJ A;  1QOA A;  3MP9 A;  1E8Z A;  4GU2 A;  4MM3 A;  1WZ0 A;  3HVD A;  1SJE D;  1ENF A;  5LNK 1;  4MGK E;  2KMM A;  3AXC A;  5IN7 A;  3W1Y A;  2RDB C;  2QCZ A;  1KH0 A;  2LAS A;  3FKY A;  5E6N A;  2PEA A;  1EU4 A;  1T3Q A;  4WQO B;  4RF1 A;  1HZ5 A;  3LMN A;  2WXP A;  3I9V 1;  2O6V B;  4KKJ A;  2KFK B;  3OAW A;  4ZRK A;  2GBM A;  2XEW A;  2ZZP B;  1WXS A;  5T8I A;  4WJP A;  3AE4 B;  2CKH B;  1VRA B;  4LCD E;  2HJ8 A;  2M0X A;  4P1C C;  1WX8 A;  5D7G A;  1FPY A;  2E6X A;  4JE3 B;  1KF6 B;  2INP E;  4DDI D;  3AE7 B;  3TEZ A;  4H2A A;  2DX5 B;  3P63 A;  3ZNH B;  2KYW A;  3I5J C;  4YTN B;  1C9F A;  3P42 A;  1YQ3 B;  2SAK A;  3QJZ A;  2CHZ A;  1QIL A;  4BAX A;  3I57 A;  1TIF A;  2V4I B;  3HVZ A;  1X1M A;  2G45 B;  5D94 A;  4F7Z A;  2K6D B;  4BBN C;  1XLO A;  3L17 A;  3B2G A;  3QX1 A;  3AU5 A;  4MEL A;  3B9J A;  4W9D A;  3ZW3 A;  3VR8 B;  3BK2 A;  3VTW A;  1YQB A;  3L13 A;  3PHX B;  2BKF A;  2WGS A;  4OHJ A;  4BOS C;  5CTR C;  4DDG D;  1YMH E;  2DYO A;  3Q3J A;  1N5X A;  1QOF A;  3PPA A;  4B9K A;  1MG8 A;  1G6J A;  4W9F A;  4ANW A;  2WDQ B;  4IM0 A;  1TT5 B;  4W9I A;  2L0F A;  1T0Q C;  4MH8 A;  3IAS 1;  2NBW B;  4PS7 A;  4UDU C;  3WIM A;  5D3I B;  3PRM B;  1JWS D;  1WE6 A;  2KO3 A;  2KQ7 A;  1QZE A;  2KHW B;  1IUE A;  3N3K B;  3NS1 A;  1N61 A;  1V8C A;  3KWV A;  2KWD A;  2VH1 A;  2O6V A;  2YEP F;  2KFK A;  1D6E C;  4EZL A;  4AQ7 A;  4WWN A;  3NHE B;  2KDF B;  2C9W B;  3LYY A;  2INN E;  1Y56 A;  1KJT A;  1D5Z C;  4C80 A;  4TKN A;  3R2I A;  2RDH A;  4WJO A;  2RSU A;  1A70 A;  2KQ4 X;  3VR9 B;  5J18 A;  3H8H A;  4LK0 M;  2N7D A;  1I35 A;  2L8J A;  4WAA A;  2IND C;  2SEB D;  4ARI A;  4YTP B;  4FBJ B;  1V2Y A;  1L2N A;  4ZRI A;  2DLB A;  4A3P A;  2FUH B;  3RT3 B;  2V3N A;  4I6P A;  1WGH A;  3Q69 A;  3QWZ B;  1CK1 A;  3AEB B;  4FJY A;  2AWT A;  4K3C A;  2W54 A;  3IT4 B;  2JF5 A;  1N60 A;  1ZUD 2;  4II3 B;  4BKS D;  3L16 A;  4S0R A;  3ZNI D;  2M4N A;  2IY1 B;  4LDT B;  1TKY A;  4LNN A;  4A8X C;  2CS4 A;  1I4G A;  5CHV C;  5J17 A;  3AE2 B;  2WU5 B;  3KVF B;  4B95 A;  3VFK A;  2IGD A;  1B1Z A;  1F52 A;  1XLN A;  3JW0 X;  3SR6 A;  3TEY A;  5I4D A;  3DBH B;  1UWX A;  3VQI A;  3VUY A;  3NOB A;  4GN1 A;  2LGS A;  5G5G A;  3KLS X;  2RDG A;  3B2F A;  2BTE A;  3H1U A;  1XXG A;  5AZG A;  1F9J A;  2LFI A;  3Q8C A;  4MAC A;  5LLI A;  2IPK D;  2KKC A;  2WXN A;  4AUQ C;  1FRD A;  1K51 A;  3AI5 A;  1BUI C;  3KQ4 A;  3P4P B;  3NZS A;  4IOI E;  1C3T A;  1ZP0 B;  3PVL A;  2WXK A;  3MJW A;  5EE9 A;  2JZZ A;  1YN5 A;  3RZF A;  1C4C A;  5IO9 A;  3LDZ E;  3N1Y C;  4RGM A;  3A1Q B;  3V6E B;  3L54 A;  3S2A A;  2KZR A;  4G11 A;  1VZ8 A;  5BYS A;  1WGD A;  4GMV A;  4W9C A;  4KDI C;  1SE3 A;  3DBL I;  3SDL C;  2IZV B;  3H7P B;  2WLB A;  1BT0 A;  3ZYY X;  1R4M I;  2DZK A;  3IFW B;  4NAM A;  1V5T A;  3EFC A;  4JWU C;  4AWJ A;  4NJ7 A;  2J0M A;  1RFK A;  1ZW7 A;  1FMA D;  1N6Z A;  4WWO A;  1WE7 A;  3TL5 A;  5HKH A;  3V61 A;  2EKI A;  4L2Y A;  5C3J B;  4MGZ E;  2LHE A;  3MHZ A;  1YNT E;  3NZ3 A;  2W55 A;  4BVU C;  4OVZ A;  1DGJ A;  4MGY E;  3IXS A;  1SGH A;  3K9P B;  3VAW A;  4HCN B;  4GB9 A;  3UIO B;  2JWU A;  3B0A A;  4OW0 A;  2NBU A;  4LTU A;  2DZI A;  3V05 A;  1F77 A;  2PPH A;  3L08 A;  2N9L A;  3A9K B;  1WJ6 A;  1WGK A;  3A4S C;  2DNF A;  2B76 B;  2PW9 A;  1EM7 A;  1UH6 A;  4K81 A;  4RGN A;  4DHJ B;  1KLV A;  2ZCC A;  4IC7 B;  4W9J A;  2BWE S;  1M94 A;  1V9J A;  4YTM B;  1WR1 A;  2QIL A;  2D3B A;  3AE9 B;  4W9E A;  4XYC A;  1C78 A;  4YSX B;  2KTF A;  2IGG A;  2BT6 A;  4HJK A;  3ZVV A;  3A1Q A;  3ETR A;  5FR3 A;  4EOY A;  3DPD A;  1YQ4 B;  3Q3O C;  4RM8 A;  1OTR B;  5JHB A;  2JVC A;  3PS6 A;  2N9E B;  1XLP A;  2L32 A;  1NEK B;  1WX7 A;  3PV1 A;  1TS2 A;  5MPO A;  4JLC A;  3H7P A;  1YX6 B;  3PRP B;  2MA9 B;  2Q5W D;  2L3Z A;  3N9Y C;  1ESF A;  2IDY A;  3EC8 A;  2GLS A;  3DVN U;  1Q5W B;  1KOT A;  2OOB B;  1I7H A;  2DZM A;  1UUP A;  2EMT A;  2Y5B B;  1BXT A;  3IG3 A;  1ROE A;  3MFG A;  1ZKH A;  3IHP C;  5DCN A;  3HM6 X;  3HM3 A;  4WJQ A;  3MC9 A;  2A5U A;  2MX2 A;  1E9M A;  2KLG A;  3ZDT A;  4ACF A;  2BB6 A;  4HEA 1;  4QAY A;  1J19 A;  2KJ6 A;  5BYQ A;  3AEA B;  1WI0 A;  4AOF A;  1WJU A;  4ICU A;  3QA8 A;  2L52 A;  2MBE A;  2IO1 B;  3AED B;  4A6Q A;  3LJ3 A;  1J7C A;  4EKU A;  3KH0 A;  1TS3 A;  3QAR A;  1IP9 A;  1GPX A;  2MJ3 A;  3DDC B;  1AN8 A;  2MLB A;  3A9K A;  4P7I A;  4IM2 A;  4F8C B;  3V6C B;  2KWV B;  3TMP B;  2WXF A;  2WP9 B;  5AZF A;  4OVV A;  1FFV A;  2QDF A;  2HDE A;  2KNB A;  3O65 B;  4AJW A;  1HQR D;  2PLP A;  2EKE C;  1MHH E;  2JSV X;  1Q1O A;  2FCN A;  2J42 A;  2QJL A;  4E74 A;  1QKZ A;  4YSZ B;  3X23 A;  2MEK A;  4G3X B;  4GSW A;  2N9K A;  1MG4 A;  1R4N I;  1EWY C;  1HA5 A;  1IPG A;  4GIV A;  1YJI A;  3CSF A;  2J4X A;  2Z59 B;  1YIW A;  1FO4 A;  2KXJ A;  1UWM A;  2C7N B;  2ZCB A;  1MJD A;  3TIX A;  3Q3F A;  2KX0 A;  3P1M A;  1E10 A;  2D11 A;  3EFU A;  2MBB B;  4JGH B;  1XCT L;  5FR6 A;  1LQB A;  2WQY B;  2N7J A;  2JY6 A;  4M8M A;  2KJH B;  1H4R A;  4ZRP A;  3ZUN A; 
#chains in the Genus database with same CATH homology
 4NPN A;  4BKG A;  1NDD A;  3L17 A;  3RCZ A;  2K39 A;  3AU5 A;  3QX1 A;  4MEL A;  1EF1 A;  4W9D A;  3ZW3 A;  3VTW A;  1V5O A;  2WX1 A;  2I1J A;  2RPQ A;  3M62 B;  1YQB A;  4FJZ A;  3L13 A;  1WGG A;  1YJ1 A;  1WF9 A;  3PHX B;  3H6N A;  1WX9 A;  2BKF A;  4IWP A;  4MGI E;  3V62 A;  5CTR C;  4BOS C;  2BYV E;  1RFA A;  3UF8 A;  4DDG D;  2DYO A;  3Q3J A;  3VVW B;  1LM8 B;  2FCS A;  3PPA A;  4M0W B;  1E90 A;  3EHV A;  1AAR A;  2MBH A;  2NBV B;  3B08 A;  2IO2 B;  4B9K A;  4CO7 A;  1MG8 A;  2C7H A;  1G6J A;  4W9F A;  5G2N A;  2ZPN A;  4ANW A;  2KAN A;  4IM0 A;  2YLM A;  4W9I A;  4KSK C;  2L0F A;  1UD7 A;  2ZNV C;  4KSL C;  3KYD D;  1GUA B;  5IA7 A;  3L0W B;  2C5L C;  3PTF C;  4MJS B;  1ISN A;  2NBW B;  3MTN B;  4K7U A;  4PS7 A;  3WIM A;  1EO6 A;  4W9K A;  3PRM B;  2LGX A;  1WRD B;  2FID A;  5JZE B;  2Z0D B;  1WE6 A;  2KO3 A;  2J0K A;  3DQV A;  2KQ7 A;  2MSE D;  2O2V B;  1QZE A;  2J0J A;  2KHW B;  4W9L A;  3N3K B;  1WJ4 A;  3JVZ X;  4WJN A;  2V3S A;  3PRE A;  4MH0 E;  2NPT A;  3KUD B;  4W9H A;  3UIN B;  5EDS A;  2PJH A;  4DWF A;  4G50 A;  1CMX B;  2O6V A;  3VUX A;  2KFK A;  2KDE B;  4EZL A;  2HE7 A;  1XT9 B;  2LI5 A;  3QHT A;  2N4F A;  2ZVN A;  2L0T A;  3APD A;  4WWN A;  3VTV A;  2K8C A;  2D10 A;  3ZTD A;  2KD0 A;  1SE9 A;  2KDF B;  3NHE B;  3QQ8 B;  1WYW B;  4KZC A;  5DPW A;  2C9W B;  3PZD A;  3VDZ A;  1U4A A;  4HLE A;  1KJT A;  4HPL B;  4TKN A;  2O6V D;  4ANV A;  3PT2 B;  5L83 A;  4WJO A;  4BBN F;  2BYE A;  4IW0 A;  4FLH A;  2RSU A;  1OEY A;  2OJR A;  2C7M B;  4CHK A;  1D3Z A;  5DPS A;  3WAN A;  1NBF C;  1WIA A;  1WY8 A;  1VD2 A;  2D3G A;  4GXB A;  4AJY B;  5L95 C;  5J18 A;  2JXX A;  1I35 A;  2N7D A;  2L8J A;  1V80 A;  4WAA A;  2CHX A;  2IO3 B;  5TR5 A;  1WZ3 A;  2M17 A;  3APC A;  2MW5 A;  4CYE A;  3DVG Y;  1Z2M A;  3UIP B;  2GMI C;  2KC2 A;  4HXD A;  4EFO A;  3ML9 A;  4ZRJ A;  4BKS A;  4FBJ B;  1V2Y A;  3JYU A;  1L2N A;  1V86 A;  4ZRI A;  3DBR I;  3RUL A;  2FUH B;  4A3P A;  4FN2 A;  3RT3 B;  2L76 A;  2V1Y A;  2KMA A;  4I6P A;  1P9D U;  1WGH A;  3QWZ B;  1E7V A;  4HK2 A;  4FJY A;  2AWT A;  2LVP A;  1P1A A;  3C0R B;  3NZU A;  3ZRF A;  1WGR A;  2JUO A;  2KVR A;  2JF5 A;  2JWZ A;  3K9O B;  3N32 A;  4PS8 A;  2WYQ A;  2RR9 A;  4II3 B;  4BKS D;  1WR6 E;  2KMC A;  4KVG B;  3SU8 X;  2KQS A;  3L16 A;  4J6I A;  4NY0 A;  4ANX A;  4E71 A;  3ZNI D;  2M4N A;  2IY1 B;  4LDT B;  4GOC A;  3RD2 A;  2FCM A;  2LZ6 A;  5GMV A;  1TGZ B;  1Z5S B;  2Z0E B;  4MSQ B;  4NJ6 A;  4HDQ A;  2CS4 A;  5CHV C;  2N9X A;  3A4R A;  5J17 A;  1W6V A;  2L00 B;  1HE8 A;  3KVF B;  4HDO A;  4NQK E;  3BY4 B;  3VFK A;  4B95 A;  5LXH A;  2N1W A;  2WDT B;  3H9D A;  4MJS A;  2DYM A;  3QCA A;  3A33 B;  3JW0 X;  3TBL D;  3PLU A;  3D32 A;  3PHW B;  2IY0 B;  4ANU A;  4GDK B;  3UQB A;  1OQY A;  4RM9 A;  3VQI A;  4TQ0 A;  4FHJ A;  4MDK E;  2K8B A;  2O2V A;  3VUY A;  2LJ5 A;  3NOB A;  1TZ1 A;  4GN1 A;  3VTU A;  4PYU A;  1V49 A;  4FHK A;  1Q0W B;  2GOW A;  2K6Q A;  3QC8 B;  1LXD A;  2XBB C;  2ASQ A;  3H1U A;  5AZH A;  5AZG A;  1F9J A;  2NR2 A;  3ZDM C;  2PE9 A;  3M95 A;  2WX0 A;  4ZYN A;  2VRR B;  3A9J B;  5LLI A;  2KKC A;  2K25 A;  4AUQ C;  1YX5 B;  2REX A;  1E8W A;  2CHW A;  3AI5 A;  2BWF A;  1RAX A;  3CMM B;  1WH3 A;  2JZ3 B;  3NZS A;  1UEL A;  4DK5 A;  5JHA A;  4ZDV A;  1C3T A;  3PVL A;  3MJW A;  4PS3 A;  4LJP B;  4N9F 4;  4A20 A;  5E6O A;  2KWU B;  1T0Y A;  2JZZ A;  4X57 B;  4URK A;  3U30 A;  4ICV A;  5BO4 B;  4I6L B;  3RZF A;  4AP4 C;  3W1S C;  1E7U A;  3LDZ E;  1Y8R C;  1IYF A;  2KN5 A;  3A1Q B;  4F1S A;  3V6E B;  2BF8 B;  3L54 A;  4I6N B;  2CR5 A;  3S2A A;  1RRB A;  2MRP A;  3MHS D;  3EEC A;  2KZR A;  1WMH B;  4G11 A;  1OEY J;  2KWC A;  2BGF A;  2M8S A;  4XC2 A;  3VH4 B;  1A5R A;  2NS5 A;  2GBN A;  3ZRC A;  1WGD A;  4GMV A;  4W9C A;  4MEM A;  2DAF A;  4IUM B;  4JQW C;  3R66 C;  4KDI C;  5C23 A;  5IAA C;  3TJP A;  3DBL I;  2N9P C;  2IZV B;  3SDL C;  3V60 A;  5J2R A;  3H7P B;  2BYF A;  5E6P A;  5KHO A;  1BT0 A;  2KDI A;  4XZ4 A;  3QIJ A;  2QHO A;  2RD0 A;  4NAW B;  1R4M I;  2ZPY A;  2KOX A;  2DZK A;  2DHZ A;  3IFW B;  1V5T A;  2MP2 B;  4AWJ A;  2LVO A;  2J0M A;  4NJ7 A;  1I42 A;  3HK0 A;  4TQ1 A;  1ZW7 A;  3ZKJ C;  3ZO5 B;  5CX3 A;  1WGY A;  3M3J A;  3SHQ A;  3VUW A;  4WWO A;  1WE7 A;  4BKT A;  1RLF A;  4MSM B;  3TL5 A;  2M1M A;  5HKH A;  2R2O A;  2ZVO A;  2LD9 A;  3DVG X;  3GOE A;  3V61 A;  3DCG A;  4KIK B;  1GC6 A;  3APF A;  4LDT D;  2DZJ A;  3ENE A;  2I1K A;  4MGZ E;  4RMA A;  2FIF A;  3WAL A;  4GDK A;  5JH5 C;  4DHZ E;  1XQQ A;  4BVU C;  4LJO B;  4W9G A;  2KTR B;  2C60 A;  2N7E A;  3OLM D;  2AL3 A;  4MGY E;  2L7R A;  1SGH A;  3ECI A;  2LUE A;  3K9P B;  3VAW A;  4EEW A;  4HCN B;  2LRW A;  3VXW A;  4GB9 A;  3R7R A;  3UIO B;  5KHQ A;  3DBS A;  1UBI A;  2KDB A;  4XX5 A;  3B0A A;  3W1S A;  2N1V A;  2MBO A;  3A9J A;  1V6E A;  2FNJ B;  2MQJ A;  4KV2 A;  1UZX B;  2KLC A;  3L10 B;  1XD3 B;  2NBU A;  4GDL B;  1J0G A;  2DZI A;  1EUV B;  2PPH A;  3L08 A;  1GG3 A;  3PGE A;  3WAM A;  1UBQ A;  3QAQ A;  2ZJD A;  3A9K B;  1WJ6 A;  3A4S C;  4K81 A;  2FAZ A;  3RUI B;  1UH6 A;  4BOZ B;  2KX3 A;  4DHJ B;  3H7S A;  1KLV A;  2ZCC A;  4IC7 B;  4W9J A;  2BWE S;  1K8R B;  1M94 A;  1V9J A;  3X0W A;  4GGQ A;  1WR1 A;  1OGW A;  2JRI B;  3VHT C;  4WWP A;  4DXA B;  1UGM A;  2AYO B;  4W9E A;  3U7D A;  2G4S A;  2KTF A;  3M63 B;  2K1F A;  2IO0 B;  3T8M A;  2PE6 B;  4HJK A;  4YL8 A;  3ZVV A;  3A1Q A;  4HVB A;  3SD5 A;  4EOY A;  3DPD A;  4IWQ A;  5AEK B;  3UGB B;  3P2B A;  4FAD A;  4TV3 A;  1WMH A;  4RM8 A;  1OTR B;  1TTN A;  1WXV A;  1NI2 A;  4JIO U;  2JVC A;  4EZK A;  5CHW A;  5JHB A;  1ZGU B;  3IVF A;  2N9E B;  3PS6 A;  3ZIM A;  3R7Q A;  4IWO A;  3JSV B;  1S1Q B;  2IBI B;  5DPT A;  4EUT A;  2G3Q B;  4FA6 A;  2UWQ A;  4IG7 B;  1WX7 A;  1KM7 A;  2MBQ A;  2XK5 B;  3PV1 A;  1TBE A;  3AUL A;  1YD8 U;  4JLC A;  2AL6 A;  2ZNV B;  3H7P A;  1J8C A;  1YX6 B;  3PRP B;  3B1L X;  2MA9 B;  3WAO A;  2LGD A;  2L05 A;  2LGY A;  2JT4 B;  3UQA A;  1JRU A;  2BKR B;  4NAW A;  4HWI B;  2FCQ A;  2MP2 A;  4FUL A;  4HPM B;  2AEH A;  4DBG A;  2L3Z A;  2D2Q A;  3EC8 A;  2HTH A;  3KUZ A;  3DVN U;  3ONS A;  2J7Q B;  1LFD A;  1Q5W B;  2WWZ A;  1P3Q U;  1KOT A;  2UYZ B;  4DHZ B;  3I3T B;  2OOB B;  2DZM A;  2B3A A;  2EMT A;  2Y5B B;  1GJZ A;  4EZJ A;  3IG3 A;  2JPH A;  3KW5 B;  4KIK A;  1ZKH A;  3GZN I;  3IHP C;  2IYD B;  5DCN A;  2LVQ A;  3HM6 X;  3ML8 A;  3OJ3 A;  4A3O A;  2A4Z A;  1GNU A;  3HM3 A;  4WJQ A;  4BFR A;  1WXA A;  2A5U A;  3U8Z A;  2MX2 A;  2HD5 B;  2KLG A;  2KFJ A;  2MCN B;  3WAP A;  3ZDT A;  1EF5 A;  3DVN V;  1E5W A;  4IM3 A;  1E8X A;  2KTR A;  3ZLZ A;  1J19 A;  2KJ6 A;  2LWP A;  4NQL B;  1PQS A;  4OVU A;  1WI0 A;  4AOF A;  1WJU A;  3QK0 A;  4ICU A;  4K7W A;  1V81 A;  3QA8 A;  4PYZ A;  1C1Y B;  1L7Y A;  2MBE A;  3NY5 A;  2D07 B;  1SIF A;  2DYB A;  3KYC D;  3DBH I;  2IO1 B;  2GBJ A;  3LJ3 A;  4EKU A;  4E3C A;  3KH0 A;  4KZ0 A;  3BIN A;  2BPS A;  3QAR A;  4GDL A;  2LXA A;  3PLV A;  1IP9 A;  2LRU A;  3KUC B;  4G0N B;  3CST A;  3DDC B;  5D6J B;  1WM2 A;  2MLB A;  3A9K A;  4P7I A;  1WFY A;  5D2M B;  2RGF A;  3ZNZ B;  2R2Q A;  2V4L A;  4IM2 A;  2YVC A;  3HIZ A;  4F8C B;  3V6C B;  2KWV B;  5CHF A;  1E8Z A;  4GU2 A;  1VCB A;  4MM3 A;  1WZ0 A;  3TMP B;  5AZF A;  1GC7 A;  4B6W A;  3N30 A;  4OVV A;  3T9L A;  3VH3 B;  4MGK E;  4DHJ D;  2EMS A;  3AXC A;  2KNB A;  3O65 B;  4AJW A;  2G4D B;  3NS8 A;  3W1Y A;  2EKE C;  3PSE B;  1Q1O A;  2LAS A;  5E6N A;  5G55 A;  2GBR A;  4JL9 A;  2FCN A;  2KJR A;  2PEA A;  2GBK A;  4HCP B;  5DPR A;  5LXI B;  4E74 A;  4WQO B;  3WA0 A;  3X23 A;  2NPT B;  4G3X B;  3JSV A;  2JRH A;  3R3M A;  4GSW A;  3LMN A;  4K7S A;  1R4N I;  2MWS B;  2DEN B;  2O6V B;  4K1R B;  2XK5 A;  3TCA A;  2KFK B;  1IPG A;  3OAW A;  4GIV A;  4ZRK A;  1WJN A;  2GBM A;  2XEW A;  3CSF A;  2ZZP B;  2NCN A;  1WXS A;  3ZNG C;  2Z59 B;  4NNJ B;  1P98 A;  2DAJ A;  4WJP A;  1YIW A;  2KXJ A;  2CKH B;  5C1Z A;  4LCD E;  1WM3 A;  2HJ8 A;  2M0X A;  2C7N B;  1S3S G;  2ZCB A;  1WX8 A;  3PRZ A;  5D7G A;  3TIX A;  4M8N A;  2W9N A;  2ZEQ A;  4TUU A;  4II2 B;  3Q3F A;  3ZTC A;  2K8H A;  2CU1 A;  2KX0 A;  2LXC A;  4DDI D;  2KC1 A;  2D11 A;  3EFU A;  3ALB A;  2DX5 B;  2MBB B;  2NVU I;  4JGH B;  3AU4 A;  4ASW C;  3ZNH B;  3DOW A;  4FJV B;  5FR6 A;  1FXT B;  3RZW C;  1LQB A;  3OJ4 B;  1H8C A;  3IBE A;  1WXM A;  2CHZ A;  3QJZ A;  2JY6 A;  3HHM A;  4M8M A;  2KJH B;  1P0R A;  2KK8 A;  1H4R A;  3RYT A;  1X1M A;  2G45 B;  5D94 A;  4F7Z A;  1E8Y A;  2K6D B;  4BBN C;  3CF6 E;  4KDL B;  3ZUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...