4MELA

Crystal structure of the human usp11 dusp-ubl domains
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
LPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4melA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4melA01
3VXWA 5JHAA 2M1MA 5DPWA 1NI2A 2DENB 5LXIB 3ZLZA 1WXSA 1E7UA 2KQ7A 2LVOA 2KWCA 4OVVA 3ZNID 4MJSA 1EO6A 3NS8A 5J18A 1TZ1A 4I6PA 2K6DB 4FA6A 3U8ZA 2LVQA 2L8JA 2NVUI 1WZ3A 2MX2A 4KZ0A 4NPNA 3QARA 3PS6A 1IYFA 1OGWA 1Z2MA 2FCSA 1WJNA 3V62A 1FXTB 2L0TA 4PS7A 3V61A 4BVUC 2O6VD 2KX0A 1YD8U 1UH6A 5AZHA 3SU8X 2Z0DB 1NBFC 2DAJA 2CR5A 3DBRI 4II2B 3VTWA 4GB9A 2XK5A 3VQIA 2NBWB 2KLCA 4IWPA 3VTUA 1LFDA 2WX0A 1IPGA 2LASA 2C5LC 2MLBA 2ZJDA 4B9KA 2KDFB 1WJ6A 1Q5WB 4DHJB 1V81A 4E71A 2C7HA 2MP2A 2KQSA 3V6CB 3A9JA 3M3JA 2KLGA 2RSUA 4KSKC 4MEMA 3UGBB 2GBJA 2KZRA 3EC8A 5EDSA 2O6VA 1C3TA 1W6VA 1E8YA 4LDTD 2LXAA 2FNJB 4MH0E 4ICUA 3IG3A 4TQ1A 5JZEB 2EMSA 4JGHB 2PE6B 2DHZA 2BYFA 4M0WB 1SE9A 3JSVB 2GBNA 3MTNB 4NAWA 3ZDTA 1C1YB 2DZMA 2V3SA 4ANXA 4E3CA 4CHKA 1WJUA 2AL6A 3W1SA 2C7NB 3B0AA 3DVNV 3MJWA 3ZNZB 1WXVA 3IFWB 3KUDB 1LXDA 3TBLD 2CHXA 3PLUA 4W9LA 2O2VB 3EFUA 2MBQA 1V5OA 4BBNF 1RLFA 2JZ3B 1KLVA 1NDDA 3X23A 4WWNA 3DBHI 1KM7A 1YIWA 3ZW3A 3JW0X 4WJNA 2Y5BB 1KJTA 2WDTB 3VTVA 1SGHA 2LGXA 2BYVE 1WX9A 2NPTB 3NZSA 4HXDA 3WANA 3APFA 3ZKJC 1AARA 5KHOA 4MGIE 1V9JA 5D6JB 2DYBA 3NY5A 1VD2A 2YVCA 2FCQA 2LD9A 1YQBA 4MELA 5G2NA 4FADA 1D3ZA 4YL8A 2KOXA 3LMNA 2KTRB 4KDIC 1V80A 1MG8A 2KFKA 2BGFA 4F1SA 4W9EA 1WYWB 2KD0A 2OJRA 3VUWA 5E6NA 4GDLA 3IBEA 2Z59B 1XD3B 1WJ4A 2BWES 2EMTA 3PHWB 4G3XB 2MCNB 1E7VA 2OOBB 4RMAA 4BKGA 1TTNA 3DCGA 4GIVA 2GBKA 3R66C 2KC2A 5IA7A 2ZZPB 2CHWA 1J8CA 2RGFA 2ZNVB 1E8XA 3L08A 3NOBA 4WQOB 2KJHB 2PJHA 4KDLB 1J0GA 3BINA 4MM3A 3DBSA 4W9HA 1LQBA 3ZO5B 1M94A 1E8WA 2NR2A 2NBUA 4ANUA 2NS5A 4I6LB 4MDKE 3X0WA 3UIPB 4KVGB 2D3GA 1TGZB 1WGYA 4BOSC 2FUHB 3ML8A 2BKRB 2KKCA 3H7SA 5KHQA 2KTFA 3NZUA 4CYEA 1UELA 3RULA 4ZYNA 1XT9B 2AYOB 2L7RA 2G4SA 2IO3B 2LVPA 1WI0A 1RRBA 3GOEA 4KV2A 5AZGA 4FBJB 2DZKA 3R7QA 3ECIA 1EF5A 3KUZA 4IM0A 2I1KA 3ZIMA 2KX3A 4E74A 4ICVA 1P1AA 5DCNA 2LI5A 4I6NB 4K1RB 4WWOA 3VDZA 2IO0B 2KDIA 3KW5B 2BPSA 3LDZE 3KYDD 4XC2A 3TL5A 3ZTDA 4X57B 2A4ZA 2KVRA 4PS3A 4BKSA 2VRRB 1WR6E 4IWQA 4ZRJA 3L10B 3ZNHB 4MJSB 4F8CB 3A4SC 3RZWC 3CSTA 3HM3A 2Z0EB 5DPTA 2PPHA 3SDLC 3KH0A 2JXXA 1WRDB 2D2QA 2L3ZA 3WAOA 4W9DA 3A4RA 2JUOA 4GDKA 3PT2B 2IBIB 1OQYA 3A33B 2J0KA 2LWPA 3PRZA 4A3PA 2DYOA 4DDID 3CMMB 5CHWA 2JT4B 5CX3A 4BOZB 3WA0A 1J19A 2KK8A 1G6JA 3T9LA 4B95A 1UGMA 2MRPA 3ONSA 3OJ4B 2XK5B 1P9DU 2C60A 3PZDA 1WH3A 2JWZA 4TUUA 4WWPA 4II3B 3DVNU 3M63B 2CS4A 2N1WA 4ZRKA 3PVLA 3AXCA 3UF8A 4HCPB 4EOYA 3DPDA 3AU4A 2QHOA 1WX8A 1UZXB 2JRHA 3PRPB 3DDCB 2KO3A 3WALA 4EZKA 5C1ZA 4URKA 2N4FA 4MGYE 3RUIB 5JHBA 2DZJA 1PQSA 2MP2B 1YX6B 2FCMA 4HDOA 2KANA 2WWZA 5GMVA 3A9JB 2JRIB 4TV3A 4AUQC 3IHPC 2O6VB 2CU1A 2MQJA 2DYMA 1WY8A 2NCNA 3K9OB 3M95A 3VFKA 5G55A 2ZVOA 3ZVVA 4EZLA 3PV1A 2N9XA 2ZCCA 1OTRB 2RR9A 4DHZB 4AOFA 4KIKA 5JH5C 4PYZA 4N9F4 3QQ8B 4MSQB 2DZIA 4NAWB 3ZRFA 3DBLI 4IWOA 3QJZA 1WM3A 3QIJA 4G50A 1T0YA 3W1YA 4M8NA 3A9KA 2MBOA 3KUCB 3H6NA 3N30A 4WJOA 3RT3B 3SHQA 3TIXA 3NHEB 4F7ZA 4EFOA 2M17A 4XX5A 2LUEA 2M0XA 3U30A 4DXAB 2FCNA 4W9IA 1UBIA 4LJPB 2GBMA 4NJ6A 2KWVB 4ANVA 3QHTA 1IP9A 1EUVB 3PHXB 1I35A 1X1MA 4FN2A 2FAZA 2G4DB 1TBEA 2R2OA 5J2RA 2LZ6A 2IY0B 3L13A 4JIOU 3R7RA 3ZNGC 3N3KB 4LDTB 1WGRA 3WAPA 3SD5A 5HKHA 4TQ0A 3U7DA 2M8SA 1A5RA 2M4NA 2N9PC 1BT0A 5CHVC 1L7YA 2CKHB 5DPSA 2ASQA 2IO2B 3ZRCA 2N7DA 1SIFA 2K8HA 2J0MA 2KFKB 3HIZA 3VH3B 1WIAA 4LJOB 3RD2A 1E5WA 1ZGUB 1WMHA 3CSFA 2K8CA 4JL9A 2GMIC 2ZNVC 4GDLB 4LCDE 2LJ5A 4CO7A 3RYTA 2DX5B 4DHZE 3K9PB 2WYQA 4ZDVA 2RD0A 2IO1B 4BKSD 1LM8B 1CMXB 1WR1A 2MBEA 2WX1A 1GC7A 3OLMD 3QA8A 1S3SG 1WZ0A 1GUAB 1ZKHA 2KNBA 4BKTA 1WF9A 3VAWA 3EHVA 1U4AA 3A1QA 4MSMB 2A5UA 2V1YA 3PTFC 3PSEB 1I42A 2L00B 4IM3A 4XZ4A 2KFJA 4GSWA 4EKUA 2LGDA 4HCNB 3DVGY 2L05A 2PE9A 4B6WA 3AULA 2NBVB 1KOTA 2HTHA 4J6IA 3V60A 4AP4C 4GXBA 4EUTA 1GG3A 2FIDA 3WIMA 1Z5SB 1GNUA 2KHWB 1RFAA 2K1FA 2K8BA 4OVUA 4W9CA 4AJYB 5TR5A 4ASWC 4BBNC 1K8RB 4FJZA 4HWIB 3H7PA 2K39A 2IYDB 1V6EA 1WX7A 3HK0A 1WXMA 3JYUA 2W9NA 3L16A 4HK2A 1ZW7A 2UYZB 1QZEA 2KC1A 1WGHA 4GGQA 4PS8A 2MBBB 4NJ7A 3L17A 4MGKE 4BFRA 3H1UA 4DK5A 1YJ1A 2CHZA 5E6OA 2BWFA 1XQQA 3QWZB 2LRUA 1E90A 4FJYA 2JY6A 5E6PA 1R4NI 2K6QA 2IZVB 5FR6A 3CF6E 1WGGA 2J0JA 3APDA 2JPHA 4GN1A 2D10A 4G11A 4W9JA 2MWSB 5L83A 3VVWB 3DVGX 5D7GA 4DBGA 4IUMB 1ISNA 2V4LA 4HJKA 3RCZA 4GDKB 3TJPA 1V49A 4FLHA 1RAXA 3UIOB 2LXCA 2D11A 3BY4B 3QCAA 4HPMB 2XEWA 4RM9A 2UWQA 4NQLB 3P2BA 1WM2A 1WGDA 5J17A 2AEHA 2YLMA 2L0FA 4JLCA 3ZDMC 4ANWA 3DOWA 3R3MA 2JF5A 4WAAA 3T8MA 1L2NA 4PYUA 1R4MI 1P3QU 1Y8RC 2I1JA 4HVBA 3QC8B 4AJWA 3L0WB 4K7SA 1HE8A 1P0RA 3PPAA 4W9KA 2HJ8A 4HPLB 2KMCA 3QX1A 4GU2A 2ZPNA 2KXJA 2HD5B 1JRUA 1WE6A 4AWJA 1OEYJ 3JSVA 4W9GA 3MHSD 3N32A 4TKNA 5LXHA 4W9FA 1Q0WB 4NQKE 5AZFA 2FIFA 2ZEQA 3W1SC 4K7UA 5D2MB 4NY0A 3UINB 2AL3A 2JVCA 2GOWA 3HM6X 2ZCBA 4KIKB 4MGZE 3JVZX 3QK0A 4WJPA 2RPQA 5IAAC 1OEYA 4G0NB 2O2VA 2N7EA 3A9KB 2B3AA 3AI5A 4IW0A 3ENEA 1V86A 3KVFB 3S2AA 3VUXA 1WE7A 2KWUB 1Q1OA 3IVFA 5CHFA 4FHJA 4IC7B 3QAQA 4A3OA 2L76A 1VCBA 1S1QB 2LGYA 3H9DA 2NPTA 2KDEB 4IM2A 3L54A 1EF1A 1YX5B 1H8CA 2JZZA 3D32A 3AU5A 2ZPYA 3OAWA 5DPRA 2BF8B 2MSED 3OJ3A 3TCAA 2KDBA 3EECA 2BKFA 5C23A 2J7QB 2ZVNA 2KTRA 4FHKA 2D07B 3O65B 3PLVA 4IG7B 3UQAA 3WAMA 2EKEC 3Q3FA 4GOCA 2BYEA 2KJRA 4EEWA 2KN5A 3VUYA 1F9JA 3PGEA 1UBQA 3PRMB 2MW5A 4JQWC 4DWFA 4M8MA 1P98A 1WMHB 2REXA 3APCA 4KSLC 2IY1B 4KZCA 4FULA 3DQVA 3UQBA 4EZJA 2MBHA 3ML9A 4HLEA 2N9EB 2C9WB 1V5TA 2K25A 3I3TB 2GBRA 4DDGD 2R2QA 1GJZA 3M62B 1H4RA 2AWTA 3PREA 4P7IA 3GZNI 5LLIA 3Q3JA 4A20A 3A1QB 2KMAA 1WFYA 3HHMA 2G3QB 4GMVA 3VH4B 5L95C 3B08A 4RM8A 2XBBC 1WXAA 2LRWA 1E8ZA 5AEKB 3V6EB 1UD7A 5D94A 3C0RB 1V2YA 4ZRIA 3ZTCA 4FJVB 2DAFA 2KJ6A 5CTRC 2C7MB 3KYCD 3LJ3A 2HE7A 3TMPB 2MA9B 2N1VA 5BO4B 4K7WA 4HDQA 4NNJB 4K81A 1GC6A 3B1LX 2G45B 3H7PB 4WJQA 3VHTC 3RZFA 3ZUNA 2PEAA 3ALBA 4DHJD
chains in the Genus database with same CATH superfamily
3AE1B 1NI2A 1C9FA 1T0RC 2K6DB 1TKGA 3U8ZA 2NVUI 1ZXHA 2X8XX 3IXSA 2WLBA 1IYFA 1FFUA 1AYFA 2YEPB 3V62A 3IAS1 1P7EA 1UH6A 5AZHA 4RGMA 1D4BA 2Z0DB 1OQRA 5BMHA 4K3CA 4FXCA 3CWIA 2I2YA 1VLBA 3VQIA 3T3NA 2KLCA 1LFDA 5T8IA 2MLBA 2VZKB 2KDFB 4ZRPA 4C4VB 4KSKC 4Q2JA 4MEMA 3UGBB 2KZRA 5EDSA 1W6VA 1E8YA 4JGHB 2RMMA 3JSVB 4NAWA 2MEKA 2DZMA 4E3CA 1WXQA 5HHDG 2C7NB 3FAHA 3B0AA 3MJWA 1WXVA 2WDVB 5H92C 3TBLD 3GE8C 3Q3MC 3EFUA 1JWAD 1V5OA 1RLFA 2BS4B 3X23A 2WXOA 1YIWA 3VTVA 3ZJTA 2NPTB 3T3OA 4MGIE 3NY5A 4JX1C 1YQBA 1FMAD 4MELA 2KOXA 2KTRB 3IAM1 1V80A 2BGFA 4W9EA 5EE9A 1K51A 1KLGD 4G3XB 2D3BA 1L6VA 1E7VA 3DBHB 1XLPA 2GBKA 2D5GA 4O1NA 4YTNB 1FXIA 1DYQA 1I4XA 1CZPA 2RGFA 4WQOB 2PJHA 1J0GA 3BINA 3DBSA 1LQBA 3AE6B 5FK9C 3AEAB 1TGZB 1WGYA 5KHQA 1XT9B 2L7RA 2QDFA 2IO3B 2LVPA 4KV2A 3GOEA 1VZ7A 1EF5A 3KUZA 4IM0A 2G1EA 4I6NB 4K1RB 1TJEA 2BPSA 3NVWA 1FRRA 3J9CA 3I57A 1WR6E 2D3AA 4F8CB 3RZWC 1XLQA 3HM3A 5DPTA 2PPHA 3SDLC 3KH0A 2Z8LA 3PZ8A 2JUOA 2IBIB 1OQYA 2Y3AA 2QSDA 2JT4B 2E3TA 3WA0A 1D5XC 2WXFA 3T9LA 2MRPA 2JSVX 3DVNU 2CS4A 4ZRKA 3AE2B 3PVLA 2W82A 2M19A 3AU4A 4PT5A 1T5XD 1WX8A 4URKA 3WALA 3DDCB 1PYWD 2N4FA 4MGYE 5JHBA 1R4NB 2DZJA 4OVZA 2MP2B 1YX6B 4HDOA 2KANA 5GMVA 3A9JB 2INNE 1C4AA 3SR6A 4AUQC 2WXJA 2PVGC 2MQJA 2DYMA 3DWGC 1WY8A 3VFKA 3RNFC 3PV1A 2GLSA 4AOFA 4KIKA 3QQ8B 3DBLI 3PZ7A 3H6NA 1XLOA 3Q6BA 1C4PA 2LUEA 3HVDA 3SEBA 1R4MB 1VDVA 2FCNA 3NG0A 1EUVB 1YQ3B 3ZGZA 1VJKA 1X1MA 3EA6A 2FAZA 2G4DB 1TBEA 1ZUD2 2JYEA 1WGKA 2BS2B 2LZ6A 4JIOU 3R7RA 1V8CA 1N60A 5HFYA 1BT0A 3NVYA 2ASQA 3ZQ4A 2QIEB 3ZRCA 1SIFA 2K8HA 3Q14C 1N62A 3Q8AA 4LCDE 2RD0A 2IO1B 4BKSD 1LM8B 2V0GA 2W54A 4OZBA 1SB3C 1WZ0A 4MSMB 2A5UA 2V1YA 3PSEB 2VH2A 2JQRB 4P1CC 3P42A 4GSWA 3MHZA 4EKUA 3DVGY 2AX5A 2PE9A 2LHEA 3U4EG 4KKIA 4J6IA 4EUTA 1GG3A 3WIMA 5BYQA 2KHWB 1RFAA 4W9CA 1AW7A 4WQMA 2IYDB 1QQRA 1SIJA 1WX7A 3L16A 4AQ7A 1QZEA 2MBBB 1L0VB 4YSXB 1ZP0B 3H1UA 4DK5A 1JALA 3AE4B 1YQ4B 4L2YA 4RFBA 1E9MA 3NVVA 1PGXA 5FR6A 4A9AA 3C19A 2D10A 1MJDA 4G11A 4W9JA 2MWSB 5FR3A 5L83A 2LFIA 4DBGA 3AEBB 4HJKA 5D3DA 2LXCA 1SJED 3QCAA 3ZDMC 2L0FA 1ZE3D 3P4PB 1SSNA 4LNOA 4C4VA 3L4PA 4NZLB 2I1JA 3ABVB 3QC8B 1HE8A 1P0RA 3PPAA 4W9KA 2KMCA 1ZDVA 1TS4A 1EWCA 1WE6A 3O13A 2PW9A 3JSVA 3MHSD 4NQKE 5AZFA 2LHDA 2ZEQA 4K7UA 2JYTA 3QK0A 4WJPA 2RPQA 1TKYA 1E0ZA 2N7EA 4IW0A 2B3AA 3A9KB 1BUIC 3GB1A 5BMGA 1Q1OA 4FHJA 2JZPA 2LGYA 2NPTA 2RDGA 1FNUA 1DOXA 1FEHA 1YX5B 2MSED 3EECA 2BKFA 3RNGC 1L5PA 2KTRA 4FHKA 3O65B 2KYWA 3PLVA 4IG7B 3UQAA 2L83A 2IGHA 2EKEC 1HXYD 3VUYA 2YEPF 2J42A 1HZ6A 4DWFA 3AM9A 1QF6A 4NJCA 1P98A 3FC4A 3MC9A 1KFYB 1EU4A 2UU7A 3DQVA 1V5TA 3M62B 3GZNI 3Q69A 3Q3JA 4A20A 2G9HD 1WFYA 4GMVA 2BQQA 1J7AA 1PFDA 3V6EB 1UD7A 1V97A 2IGGA 3N20C 4P1BC 2DAFA 3H8HA 1ENFA 4K81A 2W3RA 4WJQA 2RPVA 4DHJD 3RNAC 3P4QB 3VXWA 5DPWA 2DENB 1LO5D 4WWMA 2QEJC 1STEA 4BZAA 2KQ7A 2LVOA 2QMTA 3ZNID 1K53A 1TYGB 4I6PA 1PGAA 4FA6A 3BK1A 2L8JA 4NPNA 1WZ3A 2MX2A 4KZ0A 1XO3A 4RGOS 2FCSA 1FXTB 2L0TA 4PS7A 3V61A 4DXFA 1YD8U 1XF5L 3SU8X 1NBFC 2CJNA 4II2B 4NAMA 3AE9B 1VR9A 2KACA 2WX0A 3N9YC 1IBXB 2ZJDA 3FKYA 1QKZA 1SEBD 1B1ZA 2MP2A 2KQSA 4C00A 1VRAB 3TUOA 5E6JA 3A9JA 1JW9D 2GBJA 2PLPA 1C3TA 4JWUC 4LDTD 4IDIA 3TSSA 2N9LA 4TQ1A 2BYFA 3MTNB 5I4DA 2V3SA 4CHKA 4BAXA 3B2FA 1VZ8A 1FM0D 1RFKA 4US8A 3Q2AC 2CHXA 4JWSC 3URYA 2O2VB 3MC0B 1NDDA 3DBHI 2N0SB 5HI1A 1KJTA 2Y5CA 1HZ5A 5GXGB 3NZSA 4HXDA 3WANA 3APFA 1AARA 5KHOA 1V9JA 3DHIC 3RPFC 2YVCA 3IT4B 1D6EC 5G2NA 4FADA 2BW2A 3WCQA 1WYWB 2KD0A 4YSYB 3VUWA 3TEYA 3PHWB 1XD3B 4RH6A 3BVMA 2OOBB 1TTNA 2FUG1 1NYQA 2WXNA 3AECB 3BZDB 1UF0A 2ZNVB 3L08A 1L0YB 3X0WA 4KVGB 4BOSC 2KKCA 4J3OD 3DHHC 5EE0A 3C8YA 3AB5A 1SXTA 2WXRA 1NEKB 1RRBA 3VR8B 4FBJB 2DZKA 3ECIA 2LUMA 2Q5WD 3BWUD 2KX3A 4E74A 2LI5A 3VDZA 3TL5A 3KYDD 4XC2A 4LNNA 3ZTDA 2MJ3A 4PS3A 3L10B 4JE3B 4MJSB 2RDBC 2Z0EB 2JXXA 1WRDB 4LLGM 2L3ZA 1MHHE 4W9DA 3A4RA 3PT2B 2LWPA 1FIQA 5CHWA 1J19A 1G6JA 4B95A 4XWWA 1P9DU 1WH3A 1F0ZA 4S0RA 4RF1A 3P63A 4ACFA 3W9CB 4HCPB 2QHOA 3PRPB 4H2AA 1C78A 4EZKA 5C1ZA 5H8YE 1E10A 2FCMA 3Q3NC 2V3PA 4TV3A 3UI3A 3IHPC 2O6VB 1YN4A 4GLSC 1BMLC 4R3DA 2NCNA 3BIID 5G55A 3TEXA 3ZVVA 4EZLA 4DHZB 1C77A 2ZW1A 1MFWA 5JH5C 4N9F4 1N6ZA 2J4XA 1HQRD 3ZRFA 4IWOA 3QJZA 1WM3A 1T0YA 3A9KA 3SHQA 3N30A 1FNWA 3V3XA 3U30A 1L0XB 3AEFB 2JU6X 4NJ6A 3W5VB 4K3BA 1I35A 4FN2A 2WDQB 2AQ2B 1RM6C 2R2OA 2H88B 5J2RA 1C79A 5BYSA 3ZNGC 3NRZA 4TQ0A 1BXTA 2M4NA 1J7BA 2IO2B 3BK2A 2KFKB 4JL9A 3AE8B 2LJ5A 4ZDVA 1FCCC 1WR1A 1AN8A 1GC7A 4P6VF 2DNFA 1GUAB 3VAWA 3PTFC 1RYJA 4IM3A 4XZ4A 3HUIA 2KFJA 3I9V1 2PIAA 2XN9C 1HA5A 4HCNB 2PMVA 2HTHA 1Z5SB 1ACCA 1V1PB 2K1FA 5TR5A 4FJZA 2INDC 3ZXVA 4IKGA 3HK0A 1WXMA 1I4PA 1ZW7A 2KC1A 2VZKD 4MGKE 4BFRA 3V05A 2ONQA 4C80A 1SF0A 5E6OA 1JCKB 1XQQA 2WU2B 1GAQB 3QWZB 1MG4A 4US9A 2WP9B 2KMMA 2K6QA 3ZYYX 1WGGA 3U52E 3DVGX 3E56A 1IGCA 4JPSA 2V4LA 4GDKB 3TJPA 1RAXA 2M56B 4UDUC 4HRSA 5C3JB 4HPMB 2EELA 1IBXA 2UWQA 4NQLB 3P2BA 1WM2A 2YLMA 1YJIA 1HTQA 3DOWA 2JF5A 4WAAA 1L2NA 4PYUA 1QILA 1FO4A 1Y8RC 2XNAC 4HVBA 2DBYA 2HJ8A 1C76A 2KXJA 4AWJA 1D5MC 2WXGA 3LB8C 3N32A 5LXHA 5BYRA 4NY0A 2BB5A 2IPKD 4G0NB 1OEYA 2O2VA 2WQYB 4C7YA 1V86A 2KWUB 3IVFA 4DXGA 5CHFA 3RFZB 1K52A 2J52A 1VCBA 1S1QB 3H9DA 2KDEB 1T0SC 1JWSD 2BT6A 3L54A 1H8CA 2JZZA 5DPRA 3OJ3A 3TCAA 2KDBA 2QCZA 3DWMA 4RF0A 3WAMA 4GOCA 2BYEA 2WXKA 2KN5A 1T3QA 3PGEA 3PRMB 3AN1A 1JMLA 2REXA 3APCA 4YSZB 2IY1B 4FULA 3UQBA 2N9EB 2C9WB 2WXIA 2W55A 1H4RA 3PREA 2SEBD 4P7IA 5LLIA 3HHMA 5L95C 3VH4B 3B08A 1E8ZA 5AEKB 5D94A 2K3UA 1KRHA 3ZTCA 4RGNA 1YOVB 2HE7A 3AV8A 2N1VA 3VR9B 3BVZA 4HDQA 2CU3A 4NNJB 2G45B 3VHTC 4II3B 3GE3C 3ALBA 2HDEA 2M1MA 2TSSA 1V1OA 1YJJA 4HEA1 5LXIB 2ON8A 3ZLZA 1WXSA 1E7UA 4MJSA 1EO6A 1TZ1A 2LVQA 1JROA 2MJEA 1F52A 1Z2MA 4LNIA 4BVUC 2WS3B 3NZ3A 4TMAB 1I4HA 3DBRI 4YXDB 3VTWA 4N59A 1TS5A 4IWPA 1IPGA 2LASA 2C5LC 4B9KA 2LJIA 1Q5WB 1QOFA 1R7SA 4DHJB 1V81A 3PO0A 4E71A 2C7HA 4L23A 5BMIA 3V6CB 3M3JA 2KLGA 2RSUA 2KN4A 2O6VA 5C2TB 3AE7B 2LXAA 3R2IA 2FNJB 4MH0E 3IG3A 1TT5B 5JZEB 2EMSA 2BYTA 2W3SA 5HG2A 1WSPA 3Q8CA 1C1YB 4CQNA 1ESFA 1GB1A 3DVNV 1LXDA 3PLUA 2MBQA 1K50A 4YTPB 1KLVA 4WWNA 1KM7A 4WJNA 2Y5BB 1SGHA 2LGXA 2ACZB 1QT9A 1WX9A 2BYVE 2INCC 2HJ1A 4ZOHC 4RCOA 4M00A 5D6JB 4HKQA 3LYYA 4REZA 1D3ZA 4YL8A 3LMNA 2KFKA 1PUTA 3DBLB 2WXPA 2OJRA 3EGRA 1WWTA 3IBEA 2Z59B 1WJ4A 2BWES 3P4SB 2MCNB 4RMAA 1XLNA 3DCGA 1N61A 2KC2A 2CHWA 1J8CA 1E8XA 2KJHB 2WXQA 3I63C 3MFGA 3W5UB 1RWSA 2NBUA 2NS5A 1KTKA 3UIPB 2IDYA 2KQ4X 1V1PA 2FUHB 2BKRB 3ML8A 4ITKA 4QAYA 2AQ3B 3NZUA 4CYEA 3RULA 4ZYNA 2AYOB 1NENB 2I1KA 3ZIMA 3EFCA 4HJGE 4KX6B 4ICVA 5DCNA 1WYGA 3R2TA 4WWOA 4A8XC 1UNSA 1XXGA 4BKSA 1DOYA 1SE3A 2VRRB 4MT5A 4ZRJA 3RNEC 1MPEA 3KWVA 1QOAA 3CSTA 1P7FA 3N1ZC 3HRDD 1GB4A 3WAOA 1EU3A 4GDKA 1ZDXA 2J0KA 2V3NA 2DYOA 2AQ1B 3CMMB 5IO9A 3ZJUA 5CX3A 3AE5B 2CJOA 3ONSA 2XK5B 2C60A 3PZDA 1YMHE 2JWZA 4TUUA 5AUIA 4AS1A 3UF8A 4KGTA 1YN3A 3DPDA 2KO3A 2GB1A 3RUIB 3GS2A 3BYYB 3NS1A 3BVGA 2JRIB 4KGRA 1MVKA 1JQ4A 1GOZA 3CIRB 3M95A 2ZVOA 1CK1A 2N9XA 3RNCC 1OTRB 4PYZA 1L4ZB 3NVZA 4A90A 3W1YA 3QIJA 2R61A 2MBOA 3RT3B 3TIXA 2M0AA 1OFFA 2JX5A 2M0XA 4W9IA 1UBIA 4LJPB 3IT6B 2NTTA 2GBMA 4ANVA 2QC8A 1KLUD 2Y5PA 3MJ5A 2IY0B 3L13A 3WAPA 2KVZA 3U7DA 4WURA 4YTMB 1A5RA 2N9PC 5DPSA 2CKHB 2J0MA 1ROEA 3HIZA 1WIAA 2JXTA 4ZYSA 1E5WA 1ZGUB 1E6EB 3CSFA 2K8CA 4GDLB 2ZNVC 2PVOD 2DX5B 4DHZE 3K9PB 2WYQA 2BTEA 3HVZA 1CMXB 2MBEA 1ZPSA 2WX1A 3OLMD 3QA8A 2KNBA 4BKTA 1WF9A 3SFDB 3EHVA 1U4AA 1MHXA 1I42A 1JRPA 4MM3B 5D3IB 2L05A 1YNTE 3AULA 2NBVB 1N5WA 1KOTA 3V60A 2J53A 1GNUA 2K8BA 2DLBA 4ASWC 1ET9A 3TEWA 4HK2A 2UYZB 4ARIA 4ZHOA 4NJ7A 3EUB2 3MP9A 1FCLA 1YJ1A 4XGAB 2CHZA 4HKZE 2BWFA 3GZNB 5LNK1 2JY6A 5E6PA 1R4NI 3CF6E 1QLBB 3VVWB 1XCQL 2IJ0A 2L32A 2K0PA 1ISNA 3RCZA 3U7ZA 4FLHA 3UIOB 5EE1A 3KWLA 2XEWA 5IP4D 5J17A 2AEHA 3N1XC 1Q10A 1HTOA 1R4MI 1FRDA 4LK0M 3L0WB 4HPLB 3FILB 2VH1A 2V4IB 2I38A 2V9HA 2ZPNA 2HD5B 1JRUA 2GRIA 4W9GA 1SE4A 4W9FA 1Q0WB 2H89B 3MC8A 5D2MB 3UINB 2AL3A 2JVCA 1ET6A 3HM6X 2QJLA 2E6XA 1L6UA 2L1AA 3Q8EA 2K9XA 3ENEA 3KVFB 1A70A 2EKIA 2N9KA 1CJEA 4A3OA 1FD6A 2L76A 2HTME 1TS2A 3AU5A 3OAWA 4XWTA 2J7QB 5G5GA 1E7PB 2D07B 2K5PA 3Q3FA 3Q3OC 4EEWA 4M8MA 4B0EA 4LNKA 1PDXA 1WMHB 2BVCA 1EWYC 4EZJA 2MBHA 3ML9A 1GJZA 4XDDA 2AWTA 1TS3A 3A1QB 2KMAA 1WXAA 3OG5A 2LRWA 1TIFA 2IGDA 3C0RB 1V2YA 3NJTA 4ZRIA 3KYCD 3LJ3A 3TMPB 5AUKA 5BO4B 1AWDA 4K7WA 1GC6A 3B1LX 3OWEB 3H7PB 2PEAA 4EE2A 4A55A 5JHAA 3B2GA 1VZ6A 2LMCA 4OVVA 2KWCA 4MACA 3NS8A 5J18A 2X38A 1N63A 3VRBB 3QARA 3PS6A 1OGWA 1WJNA 2O6VD 4KKJA 2KX0A 1I4RA 2L52A 2DAJA 2BB6A 1FXAA 2CR5A 4LTUA 4GB9A 2XK5A 5G5HA 2NBWB 3VTUA 4OZCA 1WJ6A 4WIPA 2GI9A 1J7CA 3EC8A 3ETRA 4ICUA 2PE6B 2DHZA 3DHGC 4M0WB 1SE9A 5EE3A 2GBNA 3ZDTA 4ANXA 1WJUA 2AL6A 4IOIE 3W1SA 3U2SC 3ZNZB 1I4GA 3IFWB 3KUDB 1HEZE 2WXLA 4W9LA 2KT7A 4BBNF 2JZ3B 1TKEA 3ZW3A 1JWUD 3JW0X 4HPPA 2WDTB 2N7JA 1FNVA 3ZKJC 4RGTA 2MH7A 1F77A 2DYBA 1VD2A 2FCQA 2LD9A 2B76B 1ZOYB 4KDIC 1MG8A 4F1SA 3LXFA 4DQOC 2LEKA 2WXMA 5E6NA 4GDLA 2EMTA 4BKGA 4GIVA 3R66C 5IA7A 2K22A 2ZZPB 3NOBA 3NUHB 2NTSA 4KDLB 4C56C 3RN9C 1FPYA 4MM3A 4W9HA 3ZO5B 1M94A 1E8WA 2NR2A 4ANUA 4I6LB 4MDKE 2WNMA 2D3GA 5MPOA 5IKCM 3RMKC 3E9SA 3H7SA 4YT0B 2BS3B 2KTFA 1UELA 1JWMD 2G4SA 1WI0A 5AZGA 2MHJA 3R7QA 1WRIA 1I4QA 3KQ4A 2SAKA 1P1AA 4RNAA 1EM7A 2IO0B 2KDIA 3KW5B 3LDZE 4X57B 2A4ZA 2KVRA 4TSSA 4N6EB 4IWQA 3ZNHB 1XCTL 1PGBA 1MI0A 3A4SC 4XE0A 3TEZA 2D2QA 1Y56A 4M02A 1F2RI 1L4DB 3A33B 3PRZA 4A3PA 4DDID 1C4CA 2MJDA 5IOIA 4BOZB 2KDMA 2KK8A 3BYTB 2LGIA 1UGMA 3OJ4B 1UGJA 1QOGA 2FE8A 4WWPA 1FFVA 3M63B 1ZXIA 2RDHA 2N1WA 3AXCA 4EOYA 2DWQA 1UZXB 2JRHA 1NVID 1LGRA 1PQSA 3FILA 1IUEA 1D5ZC 2WWZA 3N1YC 2QILA 2PKOA 2CU1A 4OW0A 3K9OB 2INPE 2ZCCA 2RR9A 3ZXRA 3AH7A 4MSQB 2DZIA 4NAWB 4G50A 4M8NA 3KUCB 4ZRQA 4WJOA 3KLSX 3SFEB 3NHEB 4F7ZA 4EFOA 2M17A 4XX5A 4WH4A 4DXAB 3RNBC 2KWVB 1IP9A 3QHTA 1YN5A 3PHXB 1T0QC 3RI7C 5JXVA 4KGSA 4ARCA 2BBCA 3N3KB 4LDTB 1I7HA 1WGRA 3AEEB 5FKAC 3SD5A 5HKHA 2M8SA 5CHVC 1L7YA 2N7DA 3Q8BA 3VH3B 4LJOB 3RD2A 1WMHA 2GMIC 2PTLA 4CO7A 3RYTA 1TY0A 2ICIA 1S3SG 4XDCA 1ZKHA 3Q8FA 3A1QA 2KAJA 2L00B 2FBWB 2LGDA 3AE3B 4L1BA 4B6WA 4D2KA 4XYCA 4AP4C 4GXBA 2FIDA 4OVUA 4AJYB 4BBNC 1K8RB 4B0MA 4HWIB 3H7PA 1JWBD 2K39A 1V6EA 3JYUA 2W9NA 3B9JA 3AMZA 1WGHA 4GGQA 4PS8A 3W2DA 5TSSA 5IN7A 3L17A 1NI3A 1UWXA 2LRUA 1E90A 1TY2A 4FJYA 4A6QA 2IZVB 2NMQA 4GN1A 2J0JA 3APDA 2JPHA 1GPXA 5D7GA 1KH0A 4IUMB 4M01A 1V49A 3VRAB 4C7ZA 1SE2A 2D11A 4WAFA 3BY4B 1XEEA 4RM9A 4P16A 1WGDA 1SBBB 3P1MA 4JLCA 4ZHPA 4ANWA 1F2RC 3R3MA 3T8MA 3GP7A 1P3QU 4OZAA 2OJWA 2WU5B 4AJWA 4K7SA 1NYRA 4USAA 1DOIA 3QX1A 4GU2A 1B9RA 1KF6B 4M0WA 1OEYJ 4TKNA 3DBRB 1OQQA 2WXHA 2FIFA 4N58A 3W1SC 4OHJA 1IGDA 1QOBA 2JWUA 1T6BX 2GOWA 2LGSA 2ZCBA 4KIKB 3JVZX 4MGZE 1UWMA 5IAAC 1DGJA 3AI5A 2D3CA 3S2AA 3VUXA 1WE7A 4IC7B 3QAQA 3R8BA 4IM2A 1EF1A 3I5JC 4HROA 3D32A 2ZPYA 3ZJVA 2BF8B 1M4VA 2KWDA 2WGSA 5C23A 2ZVNA 4S17A 1UUPA 4PK1A 2ZW0A 3AEDB 2KJRA 1CQVA 1F9JA 4MH8A 1UBQA 2MW5A 4JQWC 1F1HA 1N5XA 1TZOA 4KSLC 4KZCA 4HLEA 2K25A 3I3TB 4DDGD 2GBRA 4LNFA 2R2QA 2OEDA 2WHIA 1SJHD 2OHFA 2G3QB 4RM8A 2XBBC 3P4RB 2WDRB 4YWGG 4FJVB 3AEGB 2KJ6A 5CTRC 2C7MB 2MA9B 3RZFA 3ZUNA
chains in the Genus database with same CATH topology
3VXWA 5JHAA 2M1MA 5DPWA 1NI2A 2DENB 5LXIB 3ZLZA 1WXSA 1E7UA 2KQ7A 2LVOA 2KWCA 4OVVA 3ZNID 4MJSA 1EO6A 3NS8A 5J18A 1TZ1A 4I6PA 2K6DB 4FA6A 3U8ZA 2LVQA 2L8JA 2NVUI 1WZ3A 2MX2A 4KZ0A 4NPNA 3QARA 3PS6A 1IYFA 1OGWA 1Z2MA 2FCSA 1WJNA 3V62A 1FXTB 2L0TA 4PS7A 3V61A 4BVUC 2O6VD 2KX0A 1YD8U 1UH6A 5AZHA 3SU8X 2Z0DB 1NBFC 2DAJA 2CR5A 3DBRI 4II2B 3VTWA 4GB9A 2XK5A 3VQIA 2NBWB 2KLCA 4IWPA 3VTUA 1LFDA 2WX0A 1IPGA 2LASA 2C5LC 2MLBA 2ZJDA 4B9KA 2KDFB 1WJ6A 1Q5WB 4DHJB 1V81A 4E71A 2C7HA 2MP2A 2KQSA 3V6CB 3A9JA 3M3JA 2KLGA 2RSUA 4KSKC 4MEMA 3UGBB 2GBJA 2KZRA 3EC8A 5EDSA 2O6VA 1C3TA 1W6VA 1E8YA 4LDTD 2LXAA 2FNJB 4MH0E 4ICUA 3IG3A 4TQ1A 5JZEB 2EMSA 4JGHB 2PE6B 2DHZA 2BYFA 4M0WB 1SE9A 3JSVB 2GBNA 3MTNB 4NAWA 3ZDTA 1C1YB 2DZMA 2V3SA 4ANXA 4E3CA 4CHKA 1WJUA 2AL6A 3W1SA 2C7NB 3B0AA 3DVNV 3MJWA 3ZNZB 1WXVA 3IFWB 3KUDB 1LXDA 3TBLD 2CHXA 3PLUA 4W9LA 2O2VB 3EFUA 2MBQA 1V5OA 4BBNF 1RLFA 2JZ3B 1KLVA 1NDDA 3X23A 4WWNA 3DBHI 1KM7A 1YIWA 3ZW3A 3JW0X 4WJNA 2Y5BB 1KJTA 2WDTB 3VTVA 1SGHA 2LGXA 2BYVE 1WX9A 2NPTB 3NZSA 4HXDA 3WANA 3APFA 3ZKJC 1AARA 5KHOA 4MGIE 1V9JA 5D6JB 2DYBA 3NY5A 1VD2A 2YVCA 2FCQA 2LD9A 1YQBA 4MELA 5G2NA 4FADA 1D3ZA 4YL8A 2KOXA 3LMNA 2KTRB 4KDIC 1V80A 1MG8A 2KFKA 2BGFA 4F1SA 4W9EA 1WYWB 2KD0A 2OJRA 3VUWA 5E6NA 4GDLA 3IBEA 2Z59B 1XD3B 1WJ4A 2BWES 2EMTA 3PHWB 4G3XB 2MCNB 1E7VA 2OOBB 4RMAA 4BKGA 1TTNA 3DCGA 4GIVA 2GBKA 3R66C 2KC2A 5IA7A 2ZZPB 2CHWA 1J8CA 2RGFA 2ZNVB 1E8XA 3L08A 3NOBA 4WQOB 2KJHB 2PJHA 4KDLB 1J0GA 3BINA 4MM3A 3DBSA 4W9HA 1LQBA 3ZO5B 1M94A 1E8WA 2NR2A 2NBUA 4ANUA 2NS5A 4I6LB 4MDKE 3X0WA 3UIPB 4KVGB 2D3GA 1TGZB 1WGYA 4BOSC 2FUHB 3ML8A 2BKRB 2KKCA 3H7SA 5KHQA 2KTFA 3NZUA 4CYEA 1UELA 3RULA 4ZYNA 1XT9B 2AYOB 2L7RA 2G4SA 2IO3B 2LVPA 1WI0A 1RRBA 3GOEA 4KV2A 5AZGA 4FBJB 2DZKA 3R7QA 3ECIA 1EF5A 3KUZA 4IM0A 2I1KA 3ZIMA 2KX3A 4E74A 4ICVA 1P1AA 5DCNA 2LI5A 4I6NB 4K1RB 4WWOA 3VDZA 2IO0B 2KDIA 3KW5B 2BPSA 3LDZE 3KYDD 4XC2A 3TL5A 3ZTDA 4X57B 2A4ZA 2KVRA 4PS3A 4BKSA 2VRRB 1WR6E 4IWQA 4ZRJA 3L10B 3ZNHB 4MJSB 4F8CB 3A4SC 3RZWC 3CSTA 3HM3A 2Z0EB 5DPTA 2PPHA 3SDLC 3KH0A 2JXXA 1WRDB 2D2QA 2L3ZA 3WAOA 4W9DA 3A4RA 2JUOA 4GDKA 3PT2B 2IBIB 1OQYA 3A33B 2J0KA 2LWPA 3PRZA 4A3PA 2DYOA 4DDID 3CMMB 5CHWA 2JT4B 5CX3A 4BOZB 3WA0A 1J19A 2KK8A 1G6JA 3T9LA 4B95A 1UGMA 2MRPA 3ONSA 3OJ4B 2XK5B 1P9DU 2C60A 3PZDA 1WH3A 2JWZA 4TUUA 4WWPA 4II3B 3DVNU 3M63B 2CS4A 2N1WA 4ZRKA 3PVLA 3AXCA 3UF8A 4HCPB 4EOYA 3DPDA 3AU4A 2QHOA 1WX8A 1UZXB 2JRHA 3PRPB 3DDCB 2KO3A 3WALA 4EZKA 5C1ZA 4URKA 2N4FA 4MGYE 3RUIB 5JHBA 2DZJA 1PQSA 2MP2B 1YX6B 2FCMA 4HDOA 2KANA 2WWZA 5GMVA 3A9JB 2JRIB 4TV3A 4AUQC 3IHPC 2O6VB 2CU1A 2MQJA 2DYMA 1WY8A 2NCNA 3K9OB 3M95A 3VFKA 5G55A 2ZVOA 3ZVVA 4EZLA 3PV1A 2N9XA 2ZCCA 1OTRB 2RR9A 4DHZB 4AOFA 4KIKA 5JH5C 4PYZA 4N9F4 3QQ8B 4MSQB 2DZIA 4NAWB 3ZRFA 3DBLI 4IWOA 3QJZA 1WM3A 3QIJA 4G50A 1T0YA 3W1YA 4M8NA 3A9KA 2MBOA 3KUCB 3H6NA 3N30A 4WJOA 3RT3B 3SHQA 3TIXA 3NHEB 4F7ZA 4EFOA 2M17A 4XX5A 2LUEA 2M0XA 3U30A 4DXAB 2FCNA 4W9IA 1UBIA 4LJPB 2GBMA 4NJ6A 2KWVB 4ANVA 3QHTA 1IP9A 1EUVB 3PHXB 1I35A 1X1MA 4FN2A 2FAZA 2G4DB 1TBEA 2R2OA 5J2RA 2LZ6A 2IY0B 3L13A 4JIOU 3R7RA 3ZNGC 3N3KB 4LDTB 1WGRA 3WAPA 3SD5A 5HKHA 4TQ0A 3U7DA 2M8SA 1A5RA 2M4NA 2N9PC 1BT0A 5CHVC 1L7YA 2CKHB 5DPSA 2ASQA 2IO2B 3ZRCA 2N7DA 1SIFA 2K8HA 2J0MA 2KFKB 3HIZA 3VH3B 1WIAA 4LJOB 3RD2A 1E5WA 1ZGUB 1WMHA 3CSFA 2K8CA 4JL9A 2GMIC 2ZNVC 4GDLB 4LCDE 2LJ5A 4CO7A 3RYTA 2DX5B 4DHZE 3K9PB 2WYQA 4ZDVA 2RD0A 2IO1B 4BKSD 1LM8B 1CMXB 1WR1A 2MBEA 2WX1A 1GC7A 3OLMD 3QA8A 1S3SG 1WZ0A 1GUAB 1ZKHA 2KNBA 4BKTA 1WF9A 3VAWA 3EHVA 1U4AA 3A1QA 4MSMB 2A5UA 2V1YA 3PTFC 3PSEB 1I42A 2L00B 4IM3A 4XZ4A 2KFJA 4GSWA 4EKUA 2LGDA 4HCNB 3DVGY 2L05A 2PE9A 4B6WA 3AULA 2NBVB 1KOTA 2HTHA 4J6IA 3V60A 4AP4C 4GXBA 4EUTA 1GG3A 2FIDA 3WIMA 1Z5SB 1GNUA 2KHWB 1RFAA 2K1FA 2K8BA 4OVUA 4W9CA 4AJYB 5TR5A 4ASWC 4BBNC 1K8RB 4FJZA 4HWIB 3H7PA 2K39A 2IYDB 1V6EA 1WX7A 3HK0A 1WXMA 3JYUA 2W9NA 3L16A 4HK2A 1ZW7A 2UYZB 1QZEA 2KC1A 1WGHA 4GGQA 4PS8A 2MBBB 4NJ7A 3L17A 4MGKE 4BFRA 3H1UA 4DK5A 1YJ1A 2CHZA 5E6OA 2BWFA 1XQQA 3QWZB 2LRUA 1E90A 4FJYA 2JY6A 5E6PA 1R4NI 2K6QA 2IZVB 5FR6A 3CF6E 1WGGA 2J0JA 3APDA 2JPHA 4GN1A 2D10A 4G11A 4W9JA 2MWSB 5L83A 3VVWB 3DVGX 5D7GA 4DBGA 4IUMB 1ISNA 2V4LA 4HJKA 3RCZA 4GDKB 3TJPA 1V49A 4FLHA 1RAXA 3UIOB 2LXCA 2D11A 3BY4B 3QCAA 4HPMB 2XEWA 4RM9A 2UWQA 4NQLB 3P2BA 1WM2A 1WGDA 5J17A 2AEHA 2YLMA 2L0FA 4JLCA 3ZDMC 4ANWA 3DOWA 3R3MA 2JF5A 4WAAA 3T8MA 1L2NA 4PYUA 1R4MI 1P3QU 1Y8RC 2I1JA 4HVBA 3QC8B 4AJWA 3L0WB 4K7SA 1HE8A 1P0RA 3PPAA 4W9KA 2HJ8A 4HPLB 2KMCA 3QX1A 4GU2A 2ZPNA 2KXJA 2HD5B 1JRUA 1WE6A 4AWJA 1OEYJ 3JSVA 4W9GA 3MHSD 3N32A 4TKNA 5LXHA 4W9FA 1Q0WB 4NQKE 5AZFA 2FIFA 2ZEQA 3W1SC 4K7UA 5D2MB 4NY0A 3UINB 2AL3A 2JVCA 2GOWA 3HM6X 2ZCBA 4KIKB 4MGZE 3JVZX 3QK0A 4WJPA 2RPQA 5IAAC 1OEYA 4G0NB 2O2VA 2N7EA 3A9KB 2B3AA 3AI5A 4IW0A 3ENEA 1V86A 3KVFB 3S2AA 3VUXA 1WE7A 2KWUB 1Q1OA 3IVFA 5CHFA 4FHJA 4IC7B 3QAQA 4A3OA 2L76A 1VCBA 1S1QB 2LGYA 3H9DA 2NPTA 2KDEB 4IM2A 3L54A 1EF1A 1YX5B 1H8CA 2JZZA 3D32A 3AU5A 2ZPYA 3OAWA 5DPRA 2BF8B 2MSED 3OJ3A 3TCAA 2KDBA 3EECA 2BKFA 5C23A 2J7QB 2ZVNA 2KTRA 4FHKA 2D07B 3O65B 3PLVA 4IG7B 3UQAA 3WAMA 2EKEC 3Q3FA 4GOCA 2BYEA 2KJRA 4EEWA 2KN5A 3VUYA 1F9JA 3PGEA 1UBQA 3PRMB 2MW5A 4JQWC 4DWFA 4M8MA 1P98A 1WMHB 2REXA 3APCA 4KSLC 2IY1B 4KZCA 4FULA 3DQVA 3UQBA 4EZJA 2MBHA 3ML9A 4HLEA 2N9EB 2C9WB 1V5TA 2K25A 3I3TB 2GBRA 4DDGD 2R2QA 1GJZA 3M62B 1H4RA 2AWTA 3PREA 4P7IA 3GZNI 5LLIA 3Q3JA 4A20A 3A1QB 2KMAA 1WFYA 3HHMA 2G3QB 4GMVA 3VH4B 5L95C 3B08A 4RM8A 2XBBC 1WXAA 2LRWA 1E8ZA 5AEKB 3V6EB 1UD7A 5D94A 3C0RB 1V2YA 4ZRIA 3ZTCA 4FJVB 2DAFA 2KJ6A 5CTRC 2C7MB 3KYCD 3LJ3A 2HE7A 3TMPB 2MA9B 2N1VA 5BO4B 4K7WA 4HDQA 4NNJB 4K81A 1GC6A 3B1LX 2G45B 3H7PB 4WJQA 3VHTC 3RZFA 3ZUNA 2PEAA 3ALBA 4DHJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VXW A;  5JHA A;  2M1M A;  5DPW A;  1NI2 A;  2DEN B;  5LXI B;  3ZLZ A;  1WXS A;  1E7U A;  2KQ7 A;  2LVO A;  2KWC A;  4OVV A;  3ZNI D;  4MJS A;  1EO6 A;  3NS8 A;  5J18 A;  1TZ1 A;  4I6P A;  2K6D B;  4FA6 A;  3U8Z A;  2LVQ A;  2L8J A;  2NVU I;  1WZ3 A;  2MX2 A;  4KZ0 A;  4NPN A;  3QAR A;  3PS6 A;  1IYF A;  1OGW A;  1Z2M A;  2FCS A;  1WJN A;  3V62 A;  1FXT B;  2L0T A;  4PS7 A;  3V61 A;  4BVU C;  2O6V D;  2KX0 A;  1YD8 U;  1UH6 A;  5AZH A;  3SU8 X;  2Z0D B;  1NBF C;  2DAJ A;  2CR5 A;  3DBR I;  4II2 B;  3VTW A;  4GB9 A;  2XK5 A;  3VQI A;  2NBW B;  2KLC A;  4IWP A;  3VTU A;  1LFD A;  2WX0 A;  1IPG A;  2LAS A;  2C5L C;  2MLB A;  2ZJD A;  4B9K A;  2KDF B;  1WJ6 A;  1Q5W B;  4DHJ B;  1V81 A;  4E71 A;  2C7H A;  2MP2 A;  2KQS A;  3V6C B;  3A9J A;  3M3J A;  2KLG A;  2RSU A;  4KSK C;  4MEM A;  3UGB B;  2GBJ A;  2KZR A;  3EC8 A;  5EDS A;  2O6V A;  1C3T A;  1W6V A;  1E8Y A;  4LDT D;  2LXA A;  2FNJ B;  4MH0 E;  4ICU A;  3IG3 A;  4TQ1 A;  5JZE B;  2EMS A;  4JGH B;  2PE6 B;  2DHZ A;  2BYF A;  4M0W B;  1SE9 A;  3JSV B;  2GBN A;  3MTN B;  4NAW A;  3ZDT A;  1C1Y B;  2DZM A;  2V3S A;  4ANX A;  4E3C A;  4CHK A;  1WJU A;  2AL6 A;  3W1S A;  2C7N B;  3B0A A;  3DVN V;  3MJW A;  3ZNZ B;  1WXV A;  3IFW B;  3KUD B;  1LXD A;  3TBL D;  2CHX A;  3PLU A;  4W9L A;  2O2V B;  3EFU A;  2MBQ A;  1V5O A;  4BBN F;  1RLF A;  2JZ3 B;  1KLV A;  1NDD A;  3X23 A;  4WWN A;  3DBH I;  1KM7 A;  1YIW A;  3ZW3 A;  3JW0 X;  4WJN A;  2Y5B B;  1KJT A;  2WDT B;  3VTV A;  1SGH A;  2LGX A;  2BYV E;  1WX9 A;  2NPT B;  3NZS A;  4HXD A;  3WAN A;  3APF A;  3ZKJ C;  1AAR A;  5KHO A;  4MGI E;  1V9J A;  5D6J B;  2DYB A;  3NY5 A;  1VD2 A;  2YVC A;  2FCQ A;  2LD9 A;  1YQB A;  4MEL A;  5G2N A;  4FAD A;  1D3Z A;  4YL8 A;  2KOX A;  3LMN A;  2KTR B;  4KDI C;  1V80 A;  1MG8 A;  2KFK A;  2BGF A;  4F1S A;  4W9E A;  1WYW B;  2KD0 A;  2OJR A;  3VUW A;  5E6N A;  4GDL A;  3IBE A;  2Z59 B;  1XD3 B;  1WJ4 A;  2BWE S;  2EMT A;  3PHW B;  4G3X B;  2MCN B;  1E7V A;  2OOB B;  4RMA A;  4BKG A;  1TTN A;  3DCG A;  4GIV A;  2GBK A;  3R66 C;  2KC2 A;  5IA7 A;  2ZZP B;  2CHW A;  1J8C A;  2RGF A;  2ZNV B;  1E8X A;  3L08 A;  3NOB A;  4WQO B;  2KJH B;  2PJH A;  4KDL B;  1J0G A;  3BIN A;  4MM3 A;  3DBS A;  4W9H A;  1LQB A;  3ZO5 B;  1M94 A;  1E8W A;  2NR2 A;  2NBU A;  4ANU A;  2NS5 A;  4I6L B;  4MDK E;  3X0W A;  3UIP B;  4KVG B;  2D3G A;  1TGZ B;  1WGY A;  4BOS C;  2FUH B;  3ML8 A;  2BKR B;  2KKC A;  3H7S A;  5KHQ A;  2KTF A;  3NZU A;  4CYE A;  1UEL A;  3RUL A;  4ZYN A;  1XT9 B;  2AYO B;  2L7R A;  2G4S A;  2IO3 B;  2LVP A;  1WI0 A;  1RRB A;  3GOE A;  4KV2 A;  5AZG A;  4FBJ B;  2DZK A;  3R7Q A;  3ECI A;  1EF5 A;  3KUZ A;  4IM0 A;  2I1K A;  3ZIM A;  2KX3 A;  4E74 A;  4ICV A;  1P1A A;  5DCN A;  2LI5 A;  4I6N B;  4K1R B;  4WWO A;  3VDZ A;  2IO0 B;  2KDI A;  3KW5 B;  2BPS A;  3LDZ E;  3KYD D;  4XC2 A;  3TL5 A;  3ZTD A;  4X57 B;  2A4Z A;  2KVR A;  4PS3 A;  4BKS A;  2VRR B;  1WR6 E;  4IWQ A;  4ZRJ A;  3L10 B;  3ZNH B;  4MJS B;  4F8C B;  3A4S C;  3RZW C;  3CST A;  3HM3 A;  2Z0E B;  5DPT A;  2PPH A;  3SDL C;  3KH0 A;  2JXX A;  1WRD B;  2D2Q A;  2L3Z A;  3WAO A;  4W9D A;  3A4R A;  2JUO A;  4GDK A;  3PT2 B;  2IBI B;  1OQY A;  3A33 B;  2J0K A;  2LWP A;  3PRZ A;  4A3P A;  2DYO A;  4DDI D;  3CMM B;  5CHW A;  2JT4 B;  5CX3 A;  4BOZ B;  3WA0 A;  1J19 A;  2KK8 A;  1G6J A;  3T9L A;  4B95 A;  1UGM A;  2MRP A;  3ONS A;  3OJ4 B;  2XK5 B;  1P9D U;  2C60 A;  3PZD A;  1WH3 A;  2JWZ A;  4TUU A;  4WWP A;  4II3 B;  3DVN U;  3M63 B;  2CS4 A;  2N1W A;  4ZRK A;  3PVL A;  3AXC A;  3UF8 A;  4HCP B;  4EOY A;  3DPD A;  3AU4 A;  2QHO A;  1WX8 A;  1UZX B;  2JRH A;  3PRP B;  3DDC B;  2KO3 A;  3WAL A;  4EZK A;  5C1Z A;  4URK A;  2N4F A;  4MGY E;  3RUI B;  5JHB A;  2DZJ A;  1PQS A;  2MP2 B;  1YX6 B;  2FCM A;  4HDO A;  2KAN A;  2WWZ A;  5GMV A;  3A9J B;  2JRI B;  4TV3 A;  4AUQ C;  3IHP C;  2O6V B;  2CU1 A;  2MQJ A;  2DYM A;  1WY8 A;  2NCN A;  3K9O B;  3M95 A;  3VFK A;  5G55 A;  2ZVO A;  3ZVV A;  4EZL A;  3PV1 A;  2N9X A;  2ZCC A;  1OTR B;  2RR9 A;  4DHZ B;  4AOF A;  4KIK A;  5JH5 C;  4PYZ A;  4N9F 4;  3QQ8 B;  4MSQ B;  2DZI A;  4NAW B;  3ZRF A;  3DBL I;  4IWO A;  3QJZ A;  1WM3 A;  3QIJ A;  4G50 A;  1T0Y A;  3W1Y A;  4M8N A;  3A9K A;  2MBO A;  3KUC B;  3H6N A;  3N30 A;  4WJO A;  3RT3 B;  3SHQ A;  3TIX A;  3NHE B;  4F7Z A;  4EFO A;  2M17 A;  4XX5 A;  2LUE A;  2M0X A;  3U30 A;  4DXA B;  2FCN A;  4W9I A;  1UBI A;  4LJP B;  2GBM A;  4NJ6 A;  2KWV B;  4ANV A;  3QHT A;  1IP9 A;  1EUV B;  3PHX B;  1I35 A;  1X1M A;  4FN2 A;  2FAZ A;  2G4D B;  1TBE A;  2R2O A;  5J2R A;  2LZ6 A;  2IY0 B;  3L13 A;  4JIO U;  3R7R A;  3ZNG C;  3N3K B;  4LDT B;  1WGR A;  3WAP A;  3SD5 A;  5HKH A;  4TQ0 A;  3U7D A;  2M8S A;  1A5R A;  2M4N A;  2N9P C;  1BT0 A;  5CHV C;  1L7Y A;  2CKH B;  5DPS A;  2ASQ A;  2IO2 B;  3ZRC A;  2N7D A;  1SIF A;  2K8H A;  2J0M A;  2KFK B;  3HIZ A;  3VH3 B;  1WIA A;  4LJO B;  3RD2 A;  1E5W A;  1ZGU B;  1WMH A;  3CSF A;  2K8C A;  4JL9 A;  2GMI C;  2ZNV C;  4GDL B;  4LCD E;  2LJ5 A;  4CO7 A;  3RYT A;  2DX5 B;  4DHZ E;  3K9P B;  2WYQ A;  4ZDV A;  2RD0 A;  2IO1 B;  4BKS D;  1LM8 B;  1CMX B;  1WR1 A;  2MBE A;  2WX1 A;  1GC7 A;  3OLM D;  3QA8 A;  1S3S G;  1WZ0 A;  1GUA B;  1ZKH A;  2KNB A;  4BKT A;  1WF9 A;  3VAW A;  3EHV A;  1U4A A;  3A1Q A;  4MSM B;  2A5U A;  2V1Y A;  3PTF C;  3PSE B;  1I42 A;  2L00 B;  4IM3 A;  4XZ4 A;  2KFJ A;  4GSW A;  4EKU A;  2LGD A;  4HCN B;  3DVG Y;  2L05 A;  2PE9 A;  4B6W A;  3AUL A;  2NBV B;  1KOT A;  2HTH A;  4J6I A;  3V60 A;  4AP4 C;  4GXB A;  4EUT A;  1GG3 A;  2FID A;  3WIM A;  1Z5S B;  1GNU A;  2KHW B;  1RFA A;  2K1F A;  2K8B A;  4OVU A;  4W9C A;  4AJY B;  5TR5 A;  4ASW C;  4BBN C;  1K8R B;  4FJZ A;  4HWI B;  3H7P A;  2K39 A;  2IYD B;  1V6E A;  1WX7 A;  3HK0 A;  1WXM A;  3JYU A;  2W9N A;  3L16 A;  4HK2 A;  1ZW7 A;  2UYZ B;  1QZE A;  2KC1 A;  1WGH A;  4GGQ A;  4PS8 A;  2MBB B;  4NJ7 A;  3L17 A;  4MGK E;  4BFR A;  3H1U A;  4DK5 A;  1YJ1 A;  2CHZ A;  5E6O A;  2BWF A;  1XQQ A;  3QWZ B;  2LRU A;  1E90 A;  4FJY A;  2JY6 A;  5E6P A;  1R4N I;  2K6Q A;  2IZV B;  5FR6 A;  3CF6 E;  1WGG A;  2J0J A;  3APD A;  2JPH A;  4GN1 A;  2D10 A;  4G11 A;  4W9J A;  2MWS B;  5L83 A;  3VVW B;  3DVG X;  5D7G A;  4DBG A;  4IUM B;  1ISN A;  2V4L A;  4HJK A;  3RCZ A;  4GDK B;  3TJP A;  1V49 A;  4FLH A;  1RAX A;  3UIO B;  2LXC A;  2D11 A;  3BY4 B;  3QCA A;  4HPM B;  2XEW A;  4RM9 A;  2UWQ A;  4NQL B;  3P2B A;  1WM2 A;  1WGD A;  5J17 A;  2AEH A;  2YLM A;  2L0F A;  4JLC A;  3ZDM C;  4ANW A;  3DOW A;  3R3M A;  2JF5 A;  4WAA A;  3T8M A;  1L2N A;  4PYU A;  1R4M I;  1P3Q U;  1Y8R C;  2I1J A;  4HVB A;  3QC8 B;  4AJW A;  3L0W B;  4K7S A;  1HE8 A;  1P0R A;  3PPA A;  4W9K A;  2HJ8 A;  4HPL B;  2KMC A;  3QX1 A;  4GU2 A;  2ZPN A;  2KXJ A;  2HD5 B;  1JRU A;  1WE6 A;  4AWJ A;  1OEY J;  3JSV A;  4W9G A;  3MHS D;  3N32 A;  4TKN A;  5LXH A;  4W9F A;  1Q0W B;  4NQK E;  5AZF A;  2FIF A;  2ZEQ A;  3W1S C;  4K7U A;  5D2M B;  4NY0 A;  3UIN B;  2AL3 A;  2JVC A;  2GOW A;  3HM6 X;  2ZCB A;  4KIK B;  4MGZ E;  3JVZ X;  3QK0 A;  4WJP A;  2RPQ A;  5IAA C;  1OEY A;  4G0N B;  2O2V A;  2N7E A;  3A9K B;  2B3A A;  3AI5 A;  4IW0 A;  3ENE A;  1V86 A;  3KVF B;  3S2A A;  3VUX A;  1WE7 A;  2KWU B;  1Q1O A;  3IVF A;  5CHF A;  4FHJ A;  4IC7 B;  3QAQ A;  4A3O A;  2L76 A;  1VCB A;  1S1Q B;  2LGY A;  3H9D A;  2NPT A;  2KDE B;  4IM2 A;  3L54 A;  1EF1 A;  1YX5 B;  1H8C A;  2JZZ A;  3D32 A;  3AU5 A;  2ZPY A;  3OAW A;  5DPR A;  2BF8 B;  2MSE D;  3OJ3 A;  3TCA A;  2KDB A;  3EEC A;  2BKF A;  5C23 A;  2J7Q B;  2ZVN A;  2KTR A;  4FHK A;  2D07 B;  3O65 B;  3PLV A;  4IG7 B;  3UQA A;  3WAM A;  2EKE C;  3Q3F A;  4GOC A;  2BYE A;  2KJR A;  4EEW A;  2KN5 A;  3VUY A;  1F9J A;  3PGE A;  1UBQ A;  3PRM B;  2MW5 A;  4JQW C;  4DWF A;  4M8M A;  1P98 A;  1WMH B;  2REX A;  3APC A;  4KSL C;  2IY1 B;  4KZC A;  4FUL A;  3DQV A;  3UQB A;  4EZJ A;  2MBH A;  3ML9 A;  4HLE A;  2N9E B;  2C9W B;  1V5T A;  2K25 A;  3I3T B;  2GBR A;  4DDG D;  2R2Q A;  1GJZ A;  3M62 B;  1H4R A;  2AWT A;  3PRE A;  4P7I A;  3GZN I;  5LLI A;  3Q3J A;  4A20 A;  3A1Q B;  2KMA A;  1WFY A;  3HHM A;  2G3Q B;  4GMV A;  3VH4 B;  5L95 C;  3B08 A;  4RM8 A;  2XBB C;  1WXA A;  2LRW A;  1E8Z A;  5AEK B;  3V6E B;  1UD7 A;  5D94 A;  3C0R B;  1V2Y A;  4ZRI A;  3ZTC A;  4FJV B;  2DAF A;  2KJ6 A;  5CTR C;  2C7M B;  3KYC D;  3LJ3 A;  2HE7 A;  3TMP B;  2MA9 B;  2N1V A;  5BO4 B;  4K7W A;  4HDQ A;  4NNJ B;  4K81 A;  1GC6 A;  3B1L X;  2G45 B;  3H7P B;  4WJQ A;  3VHT C;  3RZF A;  3ZUN A;  2PEA A;  3ALB A;  4DHJ D; 
#chains in the Genus database with same CATH topology
 3AE1 B;  1NI2 A;  1C9F A;  1T0R C;  2K6D B;  1TKG A;  3U8Z A;  2NVU I;  1ZXH A;  2X8X X;  3IXS A;  2WLB A;  1IYF A;  1FFU A;  1AYF A;  2YEP B;  3V62 A;  3IAS 1;  1P7E A;  1UH6 A;  5AZH A;  4RGM A;  1D4B A;  2Z0D B;  1OQR A;  5BMH A;  4K3C A;  4FXC A;  3CWI A;  2I2Y A;  1VLB A;  3VQI A;  3T3N A;  2KLC A;  1LFD A;  5T8I A;  2MLB A;  2VZK B;  2KDF B;  4ZRP A;  4C4V B;  4KSK C;  4Q2J A;  4MEM A;  3UGB B;  2KZR A;  5EDS A;  1W6V A;  1E8Y A;  4JGH B;  2RMM A;  3JSV B;  4NAW A;  2MEK A;  2DZM A;  4E3C A;  1WXQ A;  5HHD G;  2C7N B;  3FAH A;  3B0A A;  3MJW A;  1WXV A;  2WDV B;  5H92 C;  3TBL D;  3GE8 C;  3Q3M C;  3EFU A;  1JWA D;  1V5O A;  1RLF A;  2BS4 B;  3X23 A;  2WXO A;  1YIW A;  3VTV A;  3ZJT A;  2NPT B;  3T3O A;  4MGI E;  3NY5 A;  4JX1 C;  1YQB A;  1FMA D;  4MEL A;  2KOX A;  2KTR B;  3IAM 1;  1V80 A;  2BGF A;  4W9E A;  5EE9 A;  1K51 A;  1KLG D;  4G3X B;  2D3B A;  1L6V A;  1E7V A;  3DBH B;  1XLP A;  2GBK A;  2D5G A;  4O1N A;  4YTN B;  1FXI A;  1DYQ A;  1I4X A;  1CZP A;  2RGF A;  4WQO B;  2PJH A;  1J0G A;  3BIN A;  3DBS A;  1LQB A;  3AE6 B;  5FK9 C;  3AEA B;  1TGZ B;  1WGY A;  5KHQ A;  1XT9 B;  2L7R A;  2QDF A;  2IO3 B;  2LVP A;  4KV2 A;  3GOE A;  1VZ7 A;  1EF5 A;  3KUZ A;  4IM0 A;  2G1E A;  4I6N B;  4K1R B;  1TJE A;  2BPS A;  3NVW A;  1FRR A;  3J9C A;  3I57 A;  1WR6 E;  2D3A A;  4F8C B;  3RZW C;  1XLQ A;  3HM3 A;  5DPT A;  2PPH A;  3SDL C;  3KH0 A;  2Z8L A;  3PZ8 A;  2JUO A;  2IBI B;  1OQY A;  2Y3A A;  2QSD A;  2JT4 B;  2E3T A;  3WA0 A;  1D5X C;  2WXF A;  3T9L A;  2MRP A;  2JSV X;  3DVN U;  2CS4 A;  4ZRK A;  3AE2 B;  3PVL A;  2W82 A;  2M19 A;  3AU4 A;  4PT5 A;  1T5X D;  1WX8 A;  4URK A;  3WAL A;  3DDC B;  1PYW D;  2N4F A;  4MGY E;  5JHB A;  1R4N B;  2DZJ A;  4OVZ A;  2MP2 B;  1YX6 B;  4HDO A;  2KAN A;  5GMV A;  3A9J B;  2INN E;  1C4A A;  3SR6 A;  4AUQ C;  2WXJ A;  2PVG C;  2MQJ A;  2DYM A;  3DWG C;  1WY8 A;  3VFK A;  3RNF C;  3PV1 A;  2GLS A;  4AOF A;  4KIK A;  3QQ8 B;  3DBL I;  3PZ7 A;  3H6N A;  1XLO A;  3Q6B A;  1C4P A;  2LUE A;  3HVD A;  3SEB A;  1R4M B;  1VDV A;  2FCN A;  3NG0 A;  1EUV B;  1YQ3 B;  3ZGZ A;  1VJK A;  1X1M A;  3EA6 A;  2FAZ A;  2G4D B;  1TBE A;  1ZUD 2;  2JYE A;  1WGK A;  2BS2 B;  2LZ6 A;  4JIO U;  3R7R A;  1V8C A;  1N60 A;  5HFY A;  1BT0 A;  3NVY A;  2ASQ A;  3ZQ4 A;  2QIE B;  3ZRC A;  1SIF A;  2K8H A;  3Q14 C;  1N62 A;  3Q8A A;  4LCD E;  2RD0 A;  2IO1 B;  4BKS D;  1LM8 B;  2V0G A;  2W54 A;  4OZB A;  1SB3 C;  1WZ0 A;  4MSM B;  2A5U A;  2V1Y A;  3PSE B;  2VH2 A;  2JQR B;  4P1C C;  3P42 A;  4GSW A;  3MHZ A;  4EKU A;  3DVG Y;  2AX5 A;  2PE9 A;  2LHE A;  3U4E G;  4KKI A;  4J6I A;  4EUT A;  1GG3 A;  3WIM A;  5BYQ A;  2KHW B;  1RFA A;  4W9C A;  1AW7 A;  4WQM A;  2IYD B;  1QQR A;  1SIJ A;  1WX7 A;  3L16 A;  4AQ7 A;  1QZE A;  2MBB B;  1L0V B;  4YSX B;  1ZP0 B;  3H1U A;  4DK5 A;  1JAL A;  3AE4 B;  1YQ4 B;  4L2Y A;  4RFB A;  1E9M A;  3NVV A;  1PGX A;  5FR6 A;  4A9A A;  3C19 A;  2D10 A;  1MJD A;  4G11 A;  4W9J A;  2MWS B;  5FR3 A;  5L83 A;  2LFI A;  4DBG A;  3AEB B;  4HJK A;  5D3D A;  2LXC A;  1SJE D;  3QCA A;  3ZDM C;  2L0F A;  1ZE3 D;  3P4P B;  1SSN A;  4LNO A;  4C4V A;  3L4P A;  4NZL B;  2I1J A;  3ABV B;  3QC8 B;  1HE8 A;  1P0R A;  3PPA A;  4W9K A;  2KMC A;  1ZDV A;  1TS4 A;  1EWC A;  1WE6 A;  3O13 A;  2PW9 A;  3JSV A;  3MHS D;  4NQK E;  5AZF A;  2LHD A;  2ZEQ A;  4K7U A;  2JYT A;  3QK0 A;  4WJP A;  2RPQ A;  1TKY A;  1E0Z A;  2N7E A;  4IW0 A;  2B3A A;  3A9K B;  1BUI C;  3GB1 A;  5BMG A;  1Q1O A;  4FHJ A;  2JZP A;  2LGY A;  2NPT A;  2RDG A;  1FNU A;  1DOX A;  1FEH A;  1YX5 B;  2MSE D;  3EEC A;  2BKF A;  3RNG C;  1L5P A;  2KTR A;  4FHK A;  3O65 B;  2KYW A;  3PLV A;  4IG7 B;  3UQA A;  2L83 A;  2IGH A;  2EKE C;  1HXY D;  3VUY A;  2YEP F;  2J42 A;  1HZ6 A;  4DWF A;  3AM9 A;  1QF6 A;  4NJC A;  1P98 A;  3FC4 A;  3MC9 A;  1KFY B;  1EU4 A;  2UU7 A;  3DQV A;  1V5T A;  3M62 B;  3GZN I;  3Q69 A;  3Q3J A;  4A20 A;  2G9H D;  1WFY A;  4GMV A;  2BQQ A;  1J7A A;  1PFD A;  3V6E B;  1UD7 A;  1V97 A;  2IGG A;  3N20 C;  4P1B C;  2DAF A;  3H8H A;  1ENF A;  4K81 A;  2W3R A;  4WJQ A;  2RPV A;  4DHJ D;  3RNA C;  3P4Q B;  3VXW A;  5DPW A;  2DEN B;  1LO5 D;  4WWM A;  2QEJ C;  1STE A;  4BZA A;  2KQ7 A;  2LVO A;  2QMT A;  3ZNI D;  1K53 A;  1TYG B;  4I6P A;  1PGA A;  4FA6 A;  3BK1 A;  2L8J A;  4NPN A;  1WZ3 A;  2MX2 A;  4KZ0 A;  1XO3 A;  4RGO S;  2FCS A;  1FXT B;  2L0T A;  4PS7 A;  3V61 A;  4DXF A;  1YD8 U;  1XF5 L;  3SU8 X;  1NBF C;  2CJN A;  4II2 B;  4NAM A;  3AE9 B;  1VR9 A;  2KAC A;  2WX0 A;  3N9Y C;  1IBX B;  2ZJD A;  3FKY A;  1QKZ A;  1SEB D;  1B1Z A;  2MP2 A;  2KQS A;  4C00 A;  1VRA B;  3TUO A;  5E6J A;  3A9J A;  1JW9 D;  2GBJ A;  2PLP A;  1C3T A;  4JWU C;  4LDT D;  4IDI A;  3TSS A;  2N9L A;  4TQ1 A;  2BYF A;  3MTN B;  5I4D A;  2V3S A;  4CHK A;  4BAX A;  3B2F A;  1VZ8 A;  1FM0 D;  1RFK A;  4US8 A;  3Q2A C;  2CHX A;  4JWS C;  3URY A;  2O2V B;  3MC0 B;  1NDD A;  3DBH I;  2N0S B;  5HI1 A;  1KJT A;  2Y5C A;  1HZ5 A;  5GXG B;  3NZS A;  4HXD A;  3WAN A;  3APF A;  1AAR A;  5KHO A;  1V9J A;  3DHI C;  3RPF C;  2YVC A;  3IT4 B;  1D6E C;  5G2N A;  4FAD A;  2BW2 A;  3WCQ A;  1WYW B;  2KD0 A;  4YSY B;  3VUW A;  3TEY A;  3PHW B;  1XD3 B;  4RH6 A;  3BVM A;  2OOB B;  1TTN A;  2FUG 1;  1NYQ A;  2WXN A;  3AEC B;  3BZD B;  1UF0 A;  2ZNV B;  3L08 A;  1L0Y B;  3X0W A;  4KVG B;  4BOS C;  2KKC A;  4J3O D;  3DHH C;  5EE0 A;  3C8Y A;  3AB5 A;  1SXT A;  2WXR A;  1NEK B;  1RRB A;  3VR8 B;  4FBJ B;  2DZK A;  3ECI A;  2LUM A;  2Q5W D;  3BWU D;  2KX3 A;  4E74 A;  2LI5 A;  3VDZ A;  3TL5 A;  3KYD D;  4XC2 A;  4LNN A;  3ZTD A;  2MJ3 A;  4PS3 A;  3L10 B;  4JE3 B;  4MJS B;  2RDB C;  2Z0E B;  2JXX A;  1WRD B;  4LLG M;  2L3Z A;  1MHH E;  4W9D A;  3A4R A;  3PT2 B;  2LWP A;  1FIQ A;  5CHW A;  1J19 A;  1G6J A;  4B95 A;  4XWW A;  1P9D U;  1WH3 A;  1F0Z A;  4S0R A;  4RF1 A;  3P63 A;  4ACF A;  3W9C B;  4HCP B;  2QHO A;  3PRP B;  4H2A A;  1C78 A;  4EZK A;  5C1Z A;  5H8Y E;  1E10 A;  2FCM A;  3Q3N C;  2V3P A;  4TV3 A;  3UI3 A;  3IHP C;  2O6V B;  1YN4 A;  4GLS C;  1BML C;  4R3D A;  2NCN A;  3BII D;  5G55 A;  3TEX A;  3ZVV A;  4EZL A;  4DHZ B;  1C77 A;  2ZW1 A;  1MFW A;  5JH5 C;  4N9F 4;  1N6Z A;  2J4X A;  1HQR D;  3ZRF A;  4IWO A;  3QJZ A;  1WM3 A;  1T0Y A;  3A9K A;  3SHQ A;  3N30 A;  1FNW A;  3V3X A;  3U30 A;  1L0X B;  3AEF B;  2JU6 X;  4NJ6 A;  3W5V B;  4K3B A;  1I35 A;  4FN2 A;  2WDQ B;  2AQ2 B;  1RM6 C;  2R2O A;  2H88 B;  5J2R A;  1C79 A;  5BYS A;  3ZNG C;  3NRZ A;  4TQ0 A;  1BXT A;  2M4N A;  1J7B A;  2IO2 B;  3BK2 A;  2KFK B;  4JL9 A;  3AE8 B;  2LJ5 A;  4ZDV A;  1FCC C;  1WR1 A;  1AN8 A;  1GC7 A;  4P6V F;  2DNF A;  1GUA B;  3VAW A;  3PTF C;  1RYJ A;  4IM3 A;  4XZ4 A;  3HUI A;  2KFJ A;  3I9V 1;  2PIA A;  2XN9 C;  1HA5 A;  4HCN B;  2PMV A;  2HTH A;  1Z5S B;  1ACC A;  1V1P B;  2K1F A;  5TR5 A;  4FJZ A;  2IND C;  3ZXV A;  4IKG A;  3HK0 A;  1WXM A;  1I4P A;  1ZW7 A;  2KC1 A;  2VZK D;  4MGK E;  4BFR A;  3V05 A;  2ONQ A;  4C80 A;  1SF0 A;  5E6O A;  1JCK B;  1XQQ A;  2WU2 B;  1GAQ B;  3QWZ B;  1MG4 A;  4US9 A;  2WP9 B;  2KMM A;  2K6Q A;  3ZYY X;  1WGG A;  3U52 E;  3DVG X;  3E56 A;  1IGC A;  4JPS A;  2V4L A;  4GDK B;  3TJP A;  1RAX A;  2M56 B;  4UDU C;  4HRS A;  5C3J B;  4HPM B;  2EEL A;  1IBX A;  2UWQ A;  4NQL B;  3P2B A;  1WM2 A;  2YLM A;  1YJI A;  1HTQ A;  3DOW A;  2JF5 A;  4WAA A;  1L2N A;  4PYU A;  1QIL A;  1FO4 A;  1Y8R C;  2XNA C;  4HVB A;  2DBY A;  2HJ8 A;  1C76 A;  2KXJ A;  4AWJ A;  1D5M C;  2WXG A;  3LB8 C;  3N32 A;  5LXH A;  5BYR A;  4NY0 A;  2BB5 A;  2IPK D;  4G0N B;  1OEY A;  2O2V A;  2WQY B;  4C7Y A;  1V86 A;  2KWU B;  3IVF A;  4DXG A;  5CHF A;  3RFZ B;  1K52 A;  2J52 A;  1VCB A;  1S1Q B;  3H9D A;  2KDE B;  1T0S C;  1JWS D;  2BT6 A;  3L54 A;  1H8C A;  2JZZ A;  5DPR A;  3OJ3 A;  3TCA A;  2KDB A;  2QCZ A;  3DWM A;  4RF0 A;  3WAM A;  4GOC A;  2BYE A;  2WXK A;  2KN5 A;  1T3Q A;  3PGE A;  3PRM B;  3AN1 A;  1JML A;  2REX A;  3APC A;  4YSZ B;  2IY1 B;  4FUL A;  3UQB A;  2N9E B;  2C9W B;  2WXI A;  2W55 A;  1H4R A;  3PRE A;  2SEB D;  4P7I A;  5LLI A;  3HHM A;  5L95 C;  3VH4 B;  3B08 A;  1E8Z A;  5AEK B;  5D94 A;  2K3U A;  1KRH A;  3ZTC A;  4RGN A;  1YOV B;  2HE7 A;  3AV8 A;  2N1V A;  3VR9 B;  3BVZ A;  4HDQ A;  2CU3 A;  4NNJ B;  2G45 B;  3VHT C;  4II3 B;  3GE3 C;  3ALB A;  2HDE A;  2M1M A;  2TSS A;  1V1O A;  1YJJ A;  4HEA 1;  5LXI B;  2ON8 A;  3ZLZ A;  1WXS A;  1E7U A;  4MJS A;  1EO6 A;  1TZ1 A;  2LVQ A;  1JRO A;  2MJE A;  1F52 A;  1Z2M A;  4LNI A;  4BVU C;  2WS3 B;  3NZ3 A;  4TMA B;  1I4H A;  3DBR I;  4YXD B;  3VTW A;  4N59 A;  1TS5 A;  4IWP A;  1IPG A;  2LAS A;  2C5L C;  4B9K A;  2LJI A;  1Q5W B;  1QOF A;  1R7S A;  4DHJ B;  1V81 A;  3PO0 A;  4E71 A;  2C7H A;  4L23 A;  5BMI A;  3V6C B;  3M3J A;  2KLG A;  2RSU A;  2KN4 A;  2O6V A;  5C2T B;  3AE7 B;  2LXA A;  3R2I A;  2FNJ B;  4MH0 E;  3IG3 A;  1TT5 B;  5JZE B;  2EMS A;  2BYT A;  2W3S A;  5HG2 A;  1WSP A;  3Q8C A;  1C1Y B;  4CQN A;  1ESF A;  1GB1 A;  3DVN V;  1LXD A;  3PLU A;  2MBQ A;  1K50 A;  4YTP B;  1KLV A;  4WWN A;  1KM7 A;  4WJN A;  2Y5B B;  1SGH A;  2LGX A;  2ACZ B;  1QT9 A;  1WX9 A;  2BYV E;  2INC C;  2HJ1 A;  4ZOH C;  4RCO A;  4M00 A;  5D6J B;  4HKQ A;  3LYY A;  4REZ A;  1D3Z A;  4YL8 A;  3LMN A;  2KFK A;  1PUT A;  3DBL B;  2WXP A;  2OJR A;  3EGR A;  1WWT A;  3IBE A;  2Z59 B;  1WJ4 A;  2BWE S;  3P4S B;  2MCN B;  4RMA A;  1XLN A;  3DCG A;  1N61 A;  2KC2 A;  2CHW A;  1J8C A;  1E8X A;  2KJH B;  2WXQ A;  3I63 C;  3MFG A;  3W5U B;  1RWS A;  2NBU A;  2NS5 A;  1KTK A;  3UIP B;  2IDY A;  2KQ4 X;  1V1P A;  2FUH B;  2BKR B;  3ML8 A;  4ITK A;  4QAY A;  2AQ3 B;  3NZU A;  4CYE A;  3RUL A;  4ZYN A;  2AYO B;  1NEN B;  2I1K A;  3ZIM A;  3EFC A;  4HJG E;  4KX6 B;  4ICV A;  5DCN A;  1WYG A;  3R2T A;  4WWO A;  4A8X C;  1UNS A;  1XXG A;  4BKS A;  1DOY A;  1SE3 A;  2VRR B;  4MT5 A;  4ZRJ A;  3RNE C;  1MPE A;  3KWV A;  1QOA A;  3CST A;  1P7F A;  3N1Z C;  3HRD D;  1GB4 A;  3WAO A;  1EU3 A;  4GDK A;  1ZDX A;  2J0K A;  2V3N A;  2DYO A;  2AQ1 B;  3CMM B;  5IO9 A;  3ZJU A;  5CX3 A;  3AE5 B;  2CJO A;  3ONS A;  2XK5 B;  2C60 A;  3PZD A;  1YMH E;  2JWZ A;  4TUU A;  5AUI A;  4AS1 A;  3UF8 A;  4KGT A;  1YN3 A;  3DPD A;  2KO3 A;  2GB1 A;  3RUI B;  3GS2 A;  3BYY B;  3NS1 A;  3BVG A;  2JRI B;  4KGR A;  1MVK A;  1JQ4 A;  1GOZ A;  3CIR B;  3M95 A;  2ZVO A;  1CK1 A;  2N9X A;  3RNC C;  1OTR B;  4PYZ A;  1L4Z B;  3NVZ A;  4A90 A;  3W1Y A;  3QIJ A;  2R61 A;  2MBO A;  3RT3 B;  3TIX A;  2M0A A;  1OFF A;  2JX5 A;  2M0X A;  4W9I A;  1UBI A;  4LJP B;  3IT6 B;  2NTT A;  2GBM A;  4ANV A;  2QC8 A;  1KLU D;  2Y5P A;  3MJ5 A;  2IY0 B;  3L13 A;  3WAP A;  2KVZ A;  3U7D A;  4WUR A;  4YTM B;  1A5R A;  2N9P C;  5DPS A;  2CKH B;  2J0M A;  1ROE A;  3HIZ A;  1WIA A;  2JXT A;  4ZYS A;  1E5W A;  1ZGU B;  1E6E B;  3CSF A;  2K8C A;  4GDL B;  2ZNV C;  2PVO D;  2DX5 B;  4DHZ E;  3K9P B;  2WYQ A;  2BTE A;  3HVZ A;  1CMX B;  2MBE A;  1ZPS A;  2WX1 A;  3OLM D;  3QA8 A;  2KNB A;  4BKT A;  1WF9 A;  3SFD B;  3EHV A;  1U4A A;  1MHX A;  1I42 A;  1JRP A;  4MM3 B;  5D3I B;  2L05 A;  1YNT E;  3AUL A;  2NBV B;  1N5W A;  1KOT A;  3V60 A;  2J53 A;  1GNU A;  2K8B A;  2DLB A;  4ASW C;  1ET9 A;  3TEW A;  4HK2 A;  2UYZ B;  4ARI A;  4ZHO A;  4NJ7 A;  3EUB 2;  3MP9 A;  1FCL A;  1YJ1 A;  4XGA B;  2CHZ A;  4HKZ E;  2BWF A;  3GZN B;  5LNK 1;  2JY6 A;  5E6P A;  1R4N I;  3CF6 E;  1QLB B;  3VVW B;  1XCQ L;  2IJ0 A;  2L32 A;  2K0P A;  1ISN A;  3RCZ A;  3U7Z A;  4FLH A;  3UIO B;  5EE1 A;  3KWL A;  2XEW A;  5IP4 D;  5J17 A;  2AEH A;  3N1X C;  1Q10 A;  1HTO A;  1R4M I;  1FRD A;  4LK0 M;  3L0W B;  4HPL B;  3FIL B;  2VH1 A;  2V4I B;  2I38 A;  2V9H A;  2ZPN A;  2HD5 B;  1JRU A;  2GRI A;  4W9G A;  1SE4 A;  4W9F A;  1Q0W B;  2H89 B;  3MC8 A;  5D2M B;  3UIN B;  2AL3 A;  2JVC A;  1ET6 A;  3HM6 X;  2QJL A;  2E6X A;  1L6U A;  2L1A A;  3Q8E A;  2K9X A;  3ENE A;  3KVF B;  1A70 A;  2EKI A;  2N9K A;  1CJE A;  4A3O A;  1FD6 A;  2L76 A;  2HTM E;  1TS2 A;  3AU5 A;  3OAW A;  4XWT A;  2J7Q B;  5G5G A;  1E7P B;  2D07 B;  2K5P A;  3Q3F A;  3Q3O C;  4EEW A;  4M8M A;  4B0E A;  4LNK A;  1PDX A;  1WMH B;  2BVC A;  1EWY C;  4EZJ A;  2MBH A;  3ML9 A;  1GJZ A;  4XDD A;  2AWT A;  1TS3 A;  3A1Q B;  2KMA A;  1WXA A;  3OG5 A;  2LRW A;  1TIF A;  2IGD A;  3C0R B;  1V2Y A;  3NJT A;  4ZRI A;  3KYC D;  3LJ3 A;  3TMP B;  5AUK A;  5BO4 B;  1AWD A;  4K7W A;  1GC6 A;  3B1L X;  3OWE B;  3H7P B;  2PEA A;  4EE2 A;  4A55 A;  5JHA A;  3B2G A;  1VZ6 A;  2LMC A;  4OVV A;  2KWC A;  4MAC A;  3NS8 A;  5J18 A;  2X38 A;  1N63 A;  3VRB B;  3QAR A;  3PS6 A;  1OGW A;  1WJN A;  2O6V D;  4KKJ A;  2KX0 A;  1I4R A;  2L52 A;  2DAJ A;  2BB6 A;  1FXA A;  2CR5 A;  4LTU A;  4GB9 A;  2XK5 A;  5G5H A;  2NBW B;  3VTU A;  4OZC A;  1WJ6 A;  4WIP A;  2GI9 A;  1J7C A;  3EC8 A;  3ETR A;  4ICU A;  2PE6 B;  2DHZ A;  3DHG C;  4M0W B;  1SE9 A;  5EE3 A;  2GBN A;  3ZDT A;  4ANX A;  1WJU A;  2AL6 A;  4IOI E;  3W1S A;  3U2S C;  3ZNZ B;  1I4G A;  3IFW B;  3KUD B;  1HEZ E;  2WXL A;  4W9L A;  2KT7 A;  4BBN F;  2JZ3 B;  1TKE A;  3ZW3 A;  1JWU D;  3JW0 X;  4HPP A;  2WDT B;  2N7J A;  1FNV A;  3ZKJ C;  4RGT A;  2MH7 A;  1F77 A;  2DYB A;  1VD2 A;  2FCQ A;  2LD9 A;  2B76 B;  1ZOY B;  4KDI C;  1MG8 A;  4F1S A;  3LXF A;  4DQO C;  2LEK A;  2WXM A;  5E6N A;  4GDL A;  2EMT A;  4BKG A;  4GIV A;  3R66 C;  5IA7 A;  2K22 A;  2ZZP B;  3NOB A;  3NUH B;  2NTS A;  4KDL B;  4C56 C;  3RN9 C;  1FPY A;  4MM3 A;  4W9H A;  3ZO5 B;  1M94 A;  1E8W A;  2NR2 A;  4ANU A;  4I6L B;  4MDK E;  2WNM A;  2D3G A;  5MPO A;  5IKC M;  3RMK C;  3E9S A;  3H7S A;  4YT0 B;  2BS3 B;  2KTF A;  1UEL A;  1JWM D;  2G4S A;  1WI0 A;  5AZG A;  2MHJ A;  3R7Q A;  1WRI A;  1I4Q A;  3KQ4 A;  2SAK A;  1P1A A;  4RNA A;  1EM7 A;  2IO0 B;  2KDI A;  3KW5 B;  3LDZ E;  4X57 B;  2A4Z A;  2KVR A;  4TSS A;  4N6E B;  4IWQ A;  3ZNH B;  1XCT L;  1PGB A;  1MI0 A;  3A4S C;  4XE0 A;  3TEZ A;  2D2Q A;  1Y56 A;  4M02 A;  1F2R I;  1L4D B;  3A33 B;  3PRZ A;  4A3P A;  4DDI D;  1C4C A;  2MJD A;  5IOI A;  4BOZ B;  2KDM A;  2KK8 A;  3BYT B;  2LGI A;  1UGM A;  3OJ4 B;  1UGJ A;  1QOG A;  2FE8 A;  4WWP A;  1FFV A;  3M63 B;  1ZXI A;  2RDH A;  2N1W A;  3AXC A;  4EOY A;  2DWQ A;  1UZX B;  2JRH A;  1NVI D;  1LGR A;  1PQS A;  3FIL A;  1IUE A;  1D5Z C;  2WWZ A;  3N1Y C;  2QIL A;  2PKO A;  2CU1 A;  4OW0 A;  3K9O B;  2INP E;  2ZCC A;  2RR9 A;  3ZXR A;  3AH7 A;  4MSQ B;  2DZI A;  4NAW B;  4G50 A;  4M8N A;  3KUC B;  4ZRQ A;  4WJO A;  3KLS X;  3SFE B;  3NHE B;  4F7Z A;  4EFO A;  2M17 A;  4XX5 A;  4WH4 A;  4DXA B;  3RNB C;  2KWV B;  1IP9 A;  3QHT A;  1YN5 A;  3PHX B;  1T0Q C;  3RI7 C;  5JXV A;  4KGS A;  4ARC A;  2BBC A;  3N3K B;  4LDT B;  1I7H A;  1WGR A;  3AEE B;  5FKA C;  3SD5 A;  5HKH A;  2M8S A;  5CHV C;  1L7Y A;  2N7D A;  3Q8B A;  3VH3 B;  4LJO B;  3RD2 A;  1WMH A;  2GMI C;  2PTL A;  4CO7 A;  3RYT A;  1TY0 A;  2ICI A;  1S3S G;  4XDC A;  1ZKH A;  3Q8F A;  3A1Q A;  2KAJ A;  2L00 B;  2FBW B;  2LGD A;  3AE3 B;  4L1B A;  4B6W A;  4D2K A;  4XYC A;  4AP4 C;  4GXB A;  2FID A;  4OVU A;  4AJY B;  4BBN C;  1K8R B;  4B0M A;  4HWI B;  3H7P A;  1JWB D;  2K39 A;  1V6E A;  3JYU A;  2W9N A;  3B9J A;  3AMZ A;  1WGH A;  4GGQ A;  4PS8 A;  3W2D A;  5TSS A;  5IN7 A;  3L17 A;  1NI3 A;  1UWX A;  2LRU A;  1E90 A;  1TY2 A;  4FJY A;  4A6Q A;  2IZV B;  2NMQ A;  4GN1 A;  2J0J A;  3APD A;  2JPH A;  1GPX A;  5D7G A;  1KH0 A;  4IUM B;  4M01 A;  1V49 A;  3VRA B;  4C7Z A;  1SE2 A;  2D11 A;  4WAF A;  3BY4 B;  1XEE A;  4RM9 A;  4P16 A;  1WGD A;  1SBB B;  3P1M A;  4JLC A;  4ZHP A;  4ANW A;  1F2R C;  3R3M A;  3T8M A;  3GP7 A;  1P3Q U;  4OZA A;  2OJW A;  2WU5 B;  4AJW A;  4K7S A;  1NYR A;  4USA A;  1DOI A;  3QX1 A;  4GU2 A;  1B9R A;  1KF6 B;  4M0W A;  1OEY J;  4TKN A;  3DBR B;  1OQQ A;  2WXH A;  2FIF A;  4N58 A;  3W1S C;  4OHJ A;  1IGD A;  1QOB A;  2JWU A;  1T6B X;  2GOW A;  2LGS A;  2ZCB A;  4KIK B;  3JVZ X;  4MGZ E;  1UWM A;  5IAA C;  1DGJ A;  3AI5 A;  2D3C A;  3S2A A;  3VUX A;  1WE7 A;  4IC7 B;  3QAQ A;  3R8B A;  4IM2 A;  1EF1 A;  3I5J C;  4HRO A;  3D32 A;  2ZPY A;  3ZJV A;  2BF8 B;  1M4V A;  2KWD A;  2WGS A;  5C23 A;  2ZVN A;  4S17 A;  1UUP A;  4PK1 A;  2ZW0 A;  3AED B;  2KJR A;  1CQV A;  1F9J A;  4MH8 A;  1UBQ A;  2MW5 A;  4JQW C;  1F1H A;  1N5X A;  1TZO A;  4KSL C;  4KZC A;  4HLE A;  2K25 A;  3I3T B;  4DDG D;  2GBR A;  4LNF A;  2R2Q A;  2OED A;  2WHI A;  1SJH D;  2OHF A;  2G3Q B;  4RM8 A;  2XBB C;  3P4R B;  2WDR B;  4YWG G;  4FJV B;  3AEG B;  2KJ6 A;  5CTR C;  2C7M B;  2MA9 B;  3RZF A;  3ZUN A; 
#chains in the Genus database with same CATH homology
 3VXW A;  5JHA A;  2M1M A;  5DPW A;  1NI2 A;  2DEN B;  5LXI B;  3ZLZ A;  1WXS A;  1E7U A;  2KQ7 A;  2LVO A;  2KWC A;  4OVV A;  3ZNI D;  4MJS A;  1EO6 A;  3NS8 A;  5J18 A;  1TZ1 A;  4I6P A;  2K6D B;  4FA6 A;  3U8Z A;  2LVQ A;  2L8J A;  2NVU I;  1WZ3 A;  2MX2 A;  4KZ0 A;  4NPN A;  3QAR A;  3PS6 A;  1IYF A;  1OGW A;  1Z2M A;  2FCS A;  1WJN A;  3V62 A;  1FXT B;  2L0T A;  4PS7 A;  3V61 A;  4BVU C;  2O6V D;  2KX0 A;  1YD8 U;  1UH6 A;  5AZH A;  3SU8 X;  2Z0D B;  1NBF C;  2DAJ A;  2CR5 A;  3DBR I;  4II2 B;  3VTW A;  4GB9 A;  2XK5 A;  3VQI A;  2NBW B;  2KLC A;  4IWP A;  3VTU A;  1LFD A;  2WX0 A;  1IPG A;  2LAS A;  2C5L C;  2MLB A;  2ZJD A;  4B9K A;  2KDF B;  1WJ6 A;  1Q5W B;  4DHJ B;  1V81 A;  4E71 A;  2C7H A;  2MP2 A;  2KQS A;  3V6C B;  3A9J A;  3M3J A;  2KLG A;  2RSU A;  4KSK C;  4MEM A;  3UGB B;  2GBJ A;  2KZR A;  3EC8 A;  5EDS A;  2O6V A;  1C3T A;  1W6V A;  1E8Y A;  4LDT D;  2LXA A;  2FNJ B;  4MH0 E;  4ICU A;  3IG3 A;  4TQ1 A;  5JZE B;  2EMS A;  4JGH B;  2PE6 B;  2DHZ A;  2BYF A;  4M0W B;  1SE9 A;  3JSV B;  2GBN A;  3MTN B;  4NAW A;  3ZDT A;  1C1Y B;  2DZM A;  2V3S A;  4ANX A;  4E3C A;  4CHK A;  1WJU A;  2AL6 A;  3W1S A;  2C7N B;  3B0A A;  3DVN V;  3MJW A;  3ZNZ B;  1WXV A;  3IFW B;  3KUD B;  1LXD A;  3TBL D;  2CHX A;  3PLU A;  4W9L A;  2O2V B;  3EFU A;  2MBQ A;  1V5O A;  4BBN F;  1RLF A;  2JZ3 B;  1KLV A;  1NDD A;  3X23 A;  4WWN A;  3DBH I;  1KM7 A;  1YIW A;  3ZW3 A;  3JW0 X;  4WJN A;  2Y5B B;  1KJT A;  2WDT B;  3VTV A;  1SGH A;  2LGX A;  2BYV E;  1WX9 A;  2NPT B;  3NZS A;  4HXD A;  3WAN A;  3APF A;  3ZKJ C;  1AAR A;  5KHO A;  4MGI E;  1V9J A;  5D6J B;  2DYB A;  3NY5 A;  1VD2 A;  2YVC A;  2FCQ A;  2LD9 A;  1YQB A;  4MEL A;  5G2N A;  4FAD A;  1D3Z A;  4YL8 A;  2KOX A;  3LMN A;  2KTR B;  4KDI C;  1V80 A;  1MG8 A;  2KFK A;  2BGF A;  4F1S A;  4W9E A;  1WYW B;  2KD0 A;  2OJR A;  3VUW A;  5E6N A;  4GDL A;  3IBE A;  2Z59 B;  1XD3 B;  1WJ4 A;  2BWE S;  2EMT A;  3PHW B;  4G3X B;  2MCN B;  1E7V A;  2OOB B;  4RMA A;  4BKG A;  1TTN A;  3DCG A;  4GIV A;  2GBK A;  3R66 C;  2KC2 A;  5IA7 A;  2ZZP B;  2CHW A;  1J8C A;  2RGF A;  2ZNV B;  1E8X A;  3L08 A;  3NOB A;  4WQO B;  2KJH B;  2PJH A;  4KDL B;  1J0G A;  3BIN A;  4MM3 A;  3DBS A;  4W9H A;  1LQB A;  3ZO5 B;  1M94 A;  1E8W A;  2NR2 A;  2NBU A;  4ANU A;  2NS5 A;  4I6L B;  4MDK E;  3X0W A;  3UIP B;  4KVG B;  2D3G A;  1TGZ B;  1WGY A;  4BOS C;  2FUH B;  3ML8 A;  2BKR B;  2KKC A;  3H7S A;  5KHQ A;  2KTF A;  3NZU A;  4CYE A;  1UEL A;  3RUL A;  4ZYN A;  1XT9 B;  2AYO B;  2L7R A;  2G4S A;  2IO3 B;  2LVP A;  1WI0 A;  1RRB A;  3GOE A;  4KV2 A;  5AZG A;  4FBJ B;  2DZK A;  3R7Q A;  3ECI A;  1EF5 A;  3KUZ A;  4IM0 A;  2I1K A;  3ZIM A;  2KX3 A;  4E74 A;  4ICV A;  1P1A A;  5DCN A;  2LI5 A;  4I6N B;  4K1R B;  4WWO A;  3VDZ A;  2IO0 B;  2KDI A;  3KW5 B;  2BPS A;  3LDZ E;  3KYD D;  4XC2 A;  3TL5 A;  3ZTD A;  4X57 B;  2A4Z A;  2KVR A;  4PS3 A;  4BKS A;  2VRR B;  1WR6 E;  4IWQ A;  4ZRJ A;  3L10 B;  3ZNH B;  4MJS B;  4F8C B;  3A4S C;  3RZW C;  3CST A;  3HM3 A;  2Z0E B;  5DPT A;  2PPH A;  3SDL C;  3KH0 A;  2JXX A;  1WRD B;  2D2Q A;  2L3Z A;  3WAO A;  4W9D A;  3A4R A;  2JUO A;  4GDK A;  3PT2 B;  2IBI B;  1OQY A;  3A33 B;  2J0K A;  2LWP A;  3PRZ A;  4A3P A;  2DYO A;  4DDI D;  3CMM B;  5CHW A;  2JT4 B;  5CX3 A;  4BOZ B;  3WA0 A;  1J19 A;  2KK8 A;  1G6J A;  3T9L A;  4B95 A;  1UGM A;  2MRP A;  3ONS A;  3OJ4 B;  2XK5 B;  1P9D U;  2C60 A;  3PZD A;  1WH3 A;  2JWZ A;  4TUU A;  4WWP A;  4II3 B;  3DVN U;  3M63 B;  2CS4 A;  2N1W A;  4ZRK A;  3PVL A;  3AXC A;  3UF8 A;  4HCP B;  4EOY A;  3DPD A;  3AU4 A;  2QHO A;  1WX8 A;  1UZX B;  2JRH A;  3PRP B;  3DDC B;  2KO3 A;  3WAL A;  4EZK A;  5C1Z A;  4URK A;  2N4F A;  4MGY E;  3RUI B;  5JHB A;  2DZJ A;  1PQS A;  2MP2 B;  1YX6 B;  2FCM A;  4HDO A;  2KAN A;  2WWZ A;  5GMV A;  3A9J B;  2JRI B;  4TV3 A;  4AUQ C;  3IHP C;  2O6V B;  2CU1 A;  2MQJ A;  2DYM A;  1WY8 A;  2NCN A;  3K9O B;  3M95 A;  3VFK A;  5G55 A;  2ZVO A;  3ZVV A;  4EZL A;  3PV1 A;  2N9X A;  2ZCC A;  1OTR B;  2RR9 A;  4DHZ B;  4AOF A;  4KIK A;  5JH5 C;  4PYZ A;  4N9F 4;  3QQ8 B;  4MSQ B;  2DZI A;  4NAW B;  3ZRF A;  3DBL I;  4IWO A;  3QJZ A;  1WM3 A;  3QIJ A;  4G50 A;  1T0Y A;  3W1Y A;  4M8N A;  3A9K A;  2MBO A;  3KUC B;  3H6N A;  3N30 A;  4WJO A;  3RT3 B;  3SHQ A;  3TIX A;  3NHE B;  4F7Z A;  4EFO A;  2M17 A;  4XX5 A;  2LUE A;  2M0X A;  3U30 A;  4DXA B;  2FCN A;  4W9I A;  1UBI A;  4LJP B;  2GBM A;  4NJ6 A;  2KWV B;  4ANV A;  3QHT A;  1IP9 A;  1EUV B;  3PHX B;  1I35 A;  1X1M A;  4FN2 A;  2FAZ A;  2G4D B;  1TBE A;  2R2O A;  5J2R A;  2LZ6 A;  2IY0 B;  3L13 A;  4JIO U;  3R7R A;  3ZNG C;  3N3K B;  4LDT B;  1WGR A;  3WAP A;  3SD5 A;  5HKH A;  4TQ0 A;  3U7D A;  2M8S A;  1A5R A;  2M4N A;  2N9P C;  1BT0 A;  5CHV C;  1L7Y A;  2CKH B;  5DPS A;  2ASQ A;  2IO2 B;  3ZRC A;  2N7D A;  1SIF A;  2K8H A;  2J0M A;  2KFK B;  3HIZ A;  3VH3 B;  1WIA A;  4LJO B;  3RD2 A;  1E5W A;  1ZGU B;  1WMH A;  3CSF A;  2K8C A;  4JL9 A;  2GMI C;  2ZNV C;  4GDL B;  4LCD E;  2LJ5 A;  4CO7 A;  3RYT A;  2DX5 B;  4DHZ E;  3K9P B;  2WYQ A;  4ZDV A;  2RD0 A;  2IO1 B;  4BKS D;  1LM8 B;  1CMX B;  1WR1 A;  2MBE A;  2WX1 A;  1GC7 A;  3OLM D;  3QA8 A;  1S3S G;  1WZ0 A;  1GUA B;  1ZKH A;  2KNB A;  4BKT A;  1WF9 A;  3VAW A;  3EHV A;  1U4A A;  3A1Q A;  4MSM B;  2A5U A;  2V1Y A;  3PTF C;  3PSE B;  1I42 A;  2L00 B;  4IM3 A;  4XZ4 A;  2KFJ A;  4GSW A;  4EKU A;  2LGD A;  4HCN B;  3DVG Y;  2L05 A;  2PE9 A;  4B6W A;  3AUL A;  2NBV B;  1KOT A;  2HTH A;  4J6I A;  3V60 A;  4AP4 C;  4GXB A;  4EUT A;  1GG3 A;  2FID A;  3WIM A;  1Z5S B;  1GNU A;  2KHW B;  1RFA A;  2K1F A;  2K8B A;  4OVU A;  4W9C A;  4AJY B;  5TR5 A;  4ASW C;  4BBN C;  1K8R B;  4FJZ A;  4HWI B;  3H7P A;  2K39 A;  2IYD B;  1V6E A;  1WX7 A;  3HK0 A;  1WXM A;  3JYU A;  2W9N A;  3L16 A;  4HK2 A;  1ZW7 A;  2UYZ B;  1QZE A;  2KC1 A;  1WGH A;  4GGQ A;  4PS8 A;  2MBB B;  4NJ7 A;  3L17 A;  4MGK E;  4BFR A;  3H1U A;  4DK5 A;  1YJ1 A;  2CHZ A;  5E6O A;  2BWF A;  1XQQ A;  3QWZ B;  2LRU A;  1E90 A;  4FJY A;  2JY6 A;  5E6P A;  1R4N I;  2K6Q A;  2IZV B;  5FR6 A;  3CF6 E;  1WGG A;  2J0J A;  3APD A;  2JPH A;  4GN1 A;  2D10 A;  4G11 A;  4W9J A;  2MWS B;  5L83 A;  3VVW B;  3DVG X;  5D7G A;  4DBG A;  4IUM B;  1ISN A;  2V4L A;  4HJK A;  3RCZ A;  4GDK B;  3TJP A;  1V49 A;  4FLH A;  1RAX A;  3UIO B;  2LXC A;  2D11 A;  3BY4 B;  3QCA A;  4HPM B;  2XEW A;  4RM9 A;  2UWQ A;  4NQL B;  3P2B A;  1WM2 A;  1WGD A;  5J17 A;  2AEH A;  2YLM A;  2L0F A;  4JLC A;  3ZDM C;  4ANW A;  3DOW A;  3R3M A;  2JF5 A;  4WAA A;  3T8M A;  1L2N A;  4PYU A;  1R4M I;  1P3Q U;  1Y8R C;  2I1J A;  4HVB A;  3QC8 B;  4AJW A;  3L0W B;  4K7S A;  1HE8 A;  1P0R A;  3PPA A;  4W9K A;  2HJ8 A;  4HPL B;  2KMC A;  3QX1 A;  4GU2 A;  2ZPN A;  2KXJ A;  2HD5 B;  1JRU A;  1WE6 A;  4AWJ A;  1OEY J;  3JSV A;  4W9G A;  3MHS D;  3N32 A;  4TKN A;  5LXH A;  4W9F A;  1Q0W B;  4NQK E;  5AZF A;  2FIF A;  2ZEQ A;  3W1S C;  4K7U A;  5D2M B;  4NY0 A;  3UIN B;  2AL3 A;  2JVC A;  2GOW A;  3HM6 X;  2ZCB A;  4KIK B;  4MGZ E;  3JVZ X;  3QK0 A;  4WJP A;  2RPQ A;  5IAA C;  1OEY A;  4G0N B;  2O2V A;  2N7E A;  3A9K B;  2B3A A;  3AI5 A;  4IW0 A;  3ENE A;  1V86 A;  3KVF B;  3S2A A;  3VUX A;  1WE7 A;  2KWU B;  1Q1O A;  3IVF A;  5CHF A;  4FHJ A;  4IC7 B;  3QAQ A;  4A3O A;  2L76 A;  1VCB A;  1S1Q B;  2LGY A;  3H9D A;  2NPT A;  2KDE B;  4IM2 A;  3L54 A;  1EF1 A;  1YX5 B;  1H8C A;  2JZZ A;  3D32 A;  3AU5 A;  2ZPY A;  3OAW A;  5DPR A;  2BF8 B;  2MSE D;  3OJ3 A;  3TCA A;  2KDB A;  3EEC A;  2BKF A;  5C23 A;  2J7Q B;  2ZVN A;  2KTR A;  4FHK A;  2D07 B;  3O65 B;  3PLV A;  4IG7 B;  3UQA A;  3WAM A;  2EKE C;  3Q3F A;  4GOC A;  2BYE A;  2KJR A;  4EEW A;  2KN5 A;  3VUY A;  1F9J A;  3PGE A;  1UBQ A;  3PRM B;  2MW5 A;  4JQW C;  4DWF A;  4M8M A;  1P98 A;  1WMH B;  2REX A;  3APC A;  4KSL C;  2IY1 B;  4KZC A;  4FUL A;  3DQV A;  3UQB A;  4EZJ A;  2MBH A;  3ML9 A;  4HLE A;  2N9E B;  2C9W B;  1V5T A;  2K25 A;  3I3T B;  2GBR A;  4DDG D;  2R2Q A;  1GJZ A;  3M62 B;  1H4R A;  2AWT A;  3PRE A;  4P7I A;  3GZN I;  5LLI A;  3Q3J A;  4A20 A;  3A1Q B;  2KMA A;  1WFY A;  3HHM A;  2G3Q B;  4GMV A;  3VH4 B;  5L95 C;  3B08 A;  4RM8 A;  2XBB C;  1WXA A;  2LRW A;  1E8Z A;  5AEK B;  3V6E B;  1UD7 A;  5D94 A;  3C0R B;  1V2Y A;  4ZRI A;  3ZTC A;  4FJV B;  2DAF A;  2KJ6 A;  5CTR C;  2C7M B;  3KYC D;  3LJ3 A;  2HE7 A;  3TMP B;  2MA9 B;  2N1V A;  5BO4 B;  4K7W A;  4HDQ A;  4NNJ B;  4K81 A;  1GC6 A;  3B1L X;  2G45 B;  3H7P B;  4WJQ A;  3VHT C;  3RZF A;  3ZUN A;  2PEA A;  3ALB A;  4DHJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...