4MELA

Crystal structure of the human usp11 dusp-ubl domains
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
LPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4melA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4melA01
4HK2A 2FCQA 3L16A 3DBSA 3JSVA 2CHZA 2KD0A 2R2QA 2NS5A 3ZRFA 2BGFA 2KQSA 4RMAA 2MLBA 3SHQA 2N1WA 1V9JA 4IM3A 5JZEB 4W9JA 3DQVA 4LDTD 2A5UA 4K7SA 4W9LA 2N9PC 2FUHB 2BKRB 2K6QA 2I1KA 3A4SC 2CU1A 2LGYA 3ML8A 2KQ7A 3H7PA 4I6LB 2Y5BB 1UELA 2W9NA 2J0JA 4W9KA 2J7QB 3MTNB 4WWOA 1WZ0A 3EC8A 4W9HA 2KWUB 1P9DU 3PLUA 1H4RA 1E8WA 4B95A 4IC7B 3KW5B 3L0WB 2LGXA 3ZDTA 4GDLB 4PS8A 5D94A 2DAJA 4MEMA 2IY0B 2IYDB 3DVNU 4K81A 3ZRCA 1GUAB 2V1YA 2HE7A 4ZRIA 3ONSA 2JPHA 3V61A 4MGYE 2AL6A 4EZLA 2NCNA 3TJPA 2MSED 2N1VA 1ZKHA 4IWQA 2PE6B 3ECIA 1EF5A 2BF8B 1Z2MA 1S1QB 4ZRJA 1Q5WB 3L17A 4FLHA 4GOCA 4AOFA 4N9F4 4EKUA 4NPNA 4EZJA 3AU4A 3PHXB 3PS6A 3KUZA 1V80A 3GOEA 2JVCA 3A1QB 2K39A 4CHKA 3QK0A 3V6CB 3D32A 3M62B 3N3KB 3ZTCA 2HTHA 3DOWA 2BYVE 4AP4C 1WR6E 3C0RB 1NI2A 2ZVOA 2R2OA 4KV2A 4BOZB 2DX5B 2EKEC 3AXCA 3VH3B 1SIFA 2DYMA 4NAWA 5C23A 3ALBA 3QA8A 1RRBA 2DZJA 2AL3A 4TQ1A 4BBNF 2WDTB 2MQJA 2G4SA 3HK0A 2MCNB 4KSLC 4HWIB 2KTRB 4II2B 2M1MA 3IBEA 3PHWB 1J19A 1V2YA 2FCMA 1LQBA 2RGFA 1E8XA 2UYZB 2XBBC 3B1LX 3Q3FA 4WWNA 2KOXA 4MGIE 3VUWA 1JRUA 3PV1A 2JWZA 2LVQA 2LXCA 3SDLC 2DZMA 4GDKB 2D2QA 3VAWA 3ZNGC 5AEKB 4NY0A 1WGDA 2HD5B 1WXVA 2L00B 4HXDA 4KDLB 4M0WB 1A5RA 3VTVA 3KYCD 2LRWA 3OJ4B 2KFKA 1TTNA 4MJSB 4GIVA 4DBGA 4EUTA 3X23A 3T8MA 3R66C 1TZ1A 1TBEA 4DK5A 5DPSA 3RZFA 3QCAA 3QC8B 2KJ6A 3M3JA 3PRMB 4HVBA 2XK5B 3O65B 1LFDA 2LWPA 5KHOA 4FJYA 1SGHA 2KN5A 3ZNHB 2ZEQA 5CHFA 3ZW3A 5BO4B 1WM3A 2ZCCA 3RT3B 3VTWA 3DVGY 3TCAA 2GBRA 3DPDA 3UQBA 1Q0WB 5LLIA 2Z0EB 1V6EA 3WA0A 2OJRA 1C1YB 4HJKA 2BYFA 1WYWB 2RR9A 2KO3A 5AZGA 4BBNC 3IHPC 3WAOA 4DWFA 2L7RA 1E7UA 4LJPB 4E3CA 3I3TB 4I6PA 3EHVA 2BKFA 4XC2A 5D2MB 2WX0A 2KDEB 4GSWA 2KLCA 4LJOB 4CYEA 2N4FA 5GMVA 2LVOA 2REXA 2PJHA 2YVCA 1Z5SB 3BY4B 3IVFA 4KZ0A 2L3ZA 5CHVC 2DENB 2NPTB 4DHJB 3V62A 5LXIB 3WAPA 1OGWA 5DPWA 3CMMB 3APCA 2FNJB 2KDBA 1WJ6A 2L8JA 4ANWA 5G2NA 5JHAA 4ZRKA 3RUIB 3PT2B 3U7DA 1WMHB 2C9WB 2BWES 2GBNA 2HJ8A 2KTFA 2M0XA 5JHBA 4FADA 3DVGX 4P7IA 4ANUA 1OTRB 2GOWA 1KJTA 1P3QU 2JZ3B 2LRUA 2UWQA 3CSTA 3H6NA 4BKSA 3ZDMC 4FHJA 4A3OA 3B08A 3TMPB 2DZIA 2CS4A 3V60A 1P1AA 3R7QA 1SE9A 2AYOB 2GBKA 2MX2A 4GDLA 4ICVA 4LCDE 5CX3A 3UINB 2K8CA 2KJHB 4EZKA 2O6VB 1G6JA 5L95C 2FAZA 3L13A 4FULA 2LUEA 3JVZX 1E5WA 3ZKJC 4BKSD 2MP2B 1P0RA 1IP9A 3MHSD 4DDID 2C60A 3RYTA 3KUCB 2WWZA 1EO6A 2ZCBA 4IG7B 4TQ0A 2KNBA 4FBJB 2DHZA 2KWCA 2DZKA 1IPGA 4W9FA 4PS3A 3OJ3A 4KZCA 4W9IA 2IY1B 1NBFC 3VUXA 3NHEB 1Q1OA 2MRPA 2MWSB 3LDZE 3L08A 4II3B 4B6WA 2ZVNA 3ZNID 1OQYA 2QHOA 1XD3B 2JT4B 3AULA 3A9KB 2MA9B 2YLMA 1H8CA 3KH0A 4MSMB 2IO3B 2MBOA 3R7RA 1WM2A 1WZ3A 4WAAA 3KUDB 1GJZA 3L10B 3RULA 4E74A 3DVNV 4PYZA 4I6NB 5CTRC 2J0KA 3A1QA 3HHMA 1WJUA 2CHXA 2PE9A 3K9OB 5FR6A 3MJWA 4X57B 4F8CB 1XT9B 2PEAA 4NQKE 1UBIA 2L0FA 2C7MB 4G0NB 3PGEA 2D07B 3RCZA 1V5OA 3WIMA 3EFUA 3PRPB 2M17A 3KVFB 4ZYNA 4XX5A 4IUMB 1UZXB 4HDQA 1T0YA 2LJ5A 2KWVB 4MGZE 4TKNA 2WX1A 3ENEA 4K1RB 3CSFA 3UGBB 4IWPA 5L83A 3W1SC 4ANXA 2GBMA 1WGRA 3DBLI 2MBEA 4NJ7A 3WANA 2LD9A 2D10A 3SD5A 2KTRA 3QQ8B 4PS7A 4BVUC 2N7DA 3VVWB 1BT0A 2VRRB 5D6JB 1I42A 1E90A 4WJPA 1WGHA 2JZZA 4W9CA 3PZDA 4FJZA 2MBQA 4JGHB 2KDFB 2L76A 3PSEB 4HPMB 3P2BA 1C3TA 4DXAB 1I35A 1ZGUB 1ISNA 1WX8A 3IG3A 4GDKA 3PPAA 4XZ4A 4W9DA 3TIXA 2KFJA 4ZDVA 2KHWB 2KMCA 1R4NI 4IM2A 3ML9A 4MJSA 3VXWA 1YQBA 2IBIB 3U30A 3AU5A 3NOBA 2AWTA 4KVGB 4OVUA 2JY6A 4B9KA 3A9JB 4ICUA 1QZEA 3DDCB 1L2NA 2ZNVC 2BWFA 2XK5A 3APDA 2RSUA 2C7NB 4GN1A 3RZWC 3X0WA 3RD2A 2EMTA 3VH4B 3NY5A 4CO7A 2JRHA 4AJYB 4A20A 1V49A 3PVLA 4F7ZA 2ZJDA 2OOBB 1WRDB 3QHTA 5CHWA 2LXAA 1ZW7A 2KC1A 2MBHA 4WJOA 2XEWA 1R4MI 1KOTA 1WJNA 4G50A 2WYQA 5J2RA 4PYUA 1WIAA 3QX1A 2O2VB 2NR2A 4RM8A 5EDSA 1OEYA 2NBVB 1RFAA 4KDIC 2KDIA 3M63B 3DBRI 2ZPYA 1U4AA 1HE8A 4MH0E 3UF8A 1KM7A 4GGQA 3VDZA 3ZNZB 1WX7A 5HKHA 5E6PA 1RLFA 1M94A 4J6IA 1X1MA 4W9EA 3A4RA 3R3MA 3M95A 4AWJA 4LDTB 1UH6A 3JSVB 1E8YA 1E7VA 2N9EB 2NPTA 3QIJA 4DDGD 4URKA 2KXJA 3QAQA 4DHZB 2K25A 5DCNA 3N30A 2A4ZA 4FN2A 4MSQB 1WR1A 4M8NA 3UIPB 1KLVA 1GC6A 1EUVB 1IYFA 4BFRA 1WMHA 5LXHA 3PRZA 4DHJD 3LMNA 3PLVA 3H7PB 2K1FA 1AARA 1GC7A 2FIFA 2KZRA 3AI5A 2AEHA 2RPQA 1VCBA 1WX9A 2KKCA 2V4LA 1Y8RC 3B0AA 4JIOU 3ZLZA 2LASA 2PPHA 2LI5A 2CR5A 1W6VA 5IAAC 2ZNVB 3A33B 4TV3A 5AZHA 1WGYA 2Z59B 2ZZPB 4NNJB 1UD7A 1E8ZA 2O6VA 2NVUI 2ZPNA 4KIKB 3U8ZA 1WF9A 2JUOA 2MBBB 2KANA 2MP2A 1V86A 1WXSA 4JQWC 4G3XB 4K7UA 2BYEA 1YJ1A 4NJ6A 4BKGA 4KIKA 5DPTA 5J17A 3VUYA 2O6VD 4FA6A 2KX3A 3GZNI 3UQAA 1YX6B 4WWPA 2M8SA 2IO0B 2KJRA 3APFA 1GNUA 1OEYJ 2C7HA 3A9KA 3LJ3A 5IA7A 2MW5A 2KC2A 3H9DA 4DHZE 1L7YA 3OLMD 1XQQA 1EF1A 2KMAA 4MM3A 1WE6A 4HLEA 1TGZB 1WJ4A 2D11A 4AUQC 1WE7A 3ZO5B 5JH5C 2K8HA 5E6NA 4NQLB 4BOSC 2M4NA 2JRIB 2FCNA 3L54A 1PQSA 3V6EB 1YIWA 3CF6E 3QJZA 3S2AA 1V81A 1WGGA 4GXBA 3QWZB 3VFKA 3IFWB 3HM3A 1P98A 5DPRA 2L05A 4GMVA 2CKHB 3ZUNA 2N9XA 2G3QB 3WALA 3NZUA 3BINA 4F1SA 1GG3A 4GU2A 3PREA 3TL5A 5D7GA 4NAWB 5G55A 3DCGA 3Q3JA 2B3AA 4WJQA 1D3ZA 4BKTA 4G11A 3ZIMA 2FIDA 4EFOA 2K8BA 4MELA 5E6OA 5J18A 3H1UA 2KK8A 4HDOA 3TBLD 1CMXB 1WH3A 3VTUA 2FCSA 2JXXA 3H7SA 2DYBA 4IW0A 3OAWA 2N7EA 1UBQA 3W1YA 3ZTDA 2J0MA 2I1JA 1LXDA 1RAXA 2GMIC 2IO2B 3HIZA 2Z0DB 1WFYA 3T9LA 1NDDA 2DAFA 4GB9A 2GBJA 2D3GA 4TUUA 4AJWA 4ANVA 4HCPB 2KFKB 3JW0X 1UGMA 4K7WA 2IZVB 2EMSA 2LVPA 4EOYA 2KX0A 3A9JA 3VHTC 2DYOA 5TR5A 5C1ZA 2KLGA 4FHKA 4YL8A 5AZFA 3DBHI 1WY8A 4KSKC 1VD2A 4HPLB 2CHWA 4OVVA 3ZVVA 4HCNB 1J8CA 2ASQA 2C5LC 2JF5A 1S3SG 3UIOB 3WAMA 1FXTB 3NS8A 1K8RB 3QARA 4A3PA 4JL9A 2IO1B 3K9PB 2LZ6A 3SU8X 4M8MA 2KVRA 2O2VA 3JYUA 3KYDD 1LM8B 3EECA 4EEWA 1WI0A 4ASWC 2BPSA 1V5TA 3N32A 1WXMA 2L0TA 3PTFC 3HM6X 4W9GA 1YX5B 3NZSA 4WJNA 2NBWB 4WQOB 3VQIA 1WXAA 1MG8A 2NBUA 1F9JA 4RM9A 2G45B 2G4DB 4MDKE 3W1SA 1J0GA 4IM0A 4MGKE 4FJVB 2RD0A 5KHQA 1YD8U 2K6DB 4E71A 4IWOA 4JLCA 2LGDA 2V3SA
chains in the Genus database with same CATH superfamily
3L16A 3DBSA 3JSVA 3P4PB 3ZRFA 4RMAA 1EWCA 4IM3A 5JZEB 1K50A 3DQVA 2FUHB 2JXTA 2VH2A 2KQ7A 2Y5BB 2W9NA 4RNAA 4WWOA 5HI1A 3EC8A 3PLUA 5AUKA 1H4RA 2PTLA 1AN8A 4IC7B 2LGXA 2ZW0A 1VRAB 4M01A 2DAJA 1TZOA 2R61A 3R2TA 2V1YA 2HDEA 2KWDA 3NVZA 2JPHA 4EZLA 4ARIA 2NCNA 4DXFA 4ACFA 4IWQA 2I38A 2RDBC 1Q5WB 3L17A 3RPFC 1JRPA 4LNIA 3PS6A 1D4BA 3KUZA 3GOEA 3D32A 3M62B 2V9HA 3W9CB 5BYSA 3ZTCA 2L32A 2SEBD 3N20C 3C0RB 1NI2A 5AUIA 2DX5B 3AXCA 2PIAA 1JWMD 3VH3B 1HZ5A 3NVWA 1RRBA 1I4QA 2G4SA 1M4VA 4HWIB 3I9V1 2M1MA 1J19A 3KWLA 2WGSA 2WXPA 3I63C 2VZKB 1BUIC 5AEKB 1OQRA 1WGDA 2L00B 1WXVA 4HXDA 4M0WB 4KDLB 1A5RA 2KFKA 1TTNA 4DBGA 3T8MA 1VJKA 1FD6A 3RZFA 3QC8B 3M3JA 5KHOA 1SBBB 4FJYA 2ZEQA 1P7FA 2LEKA 3VRAB 1LO5D 2ZCCA 2KDMA 3ZXVA 3TEWA 3IAS1 3WA0A 1UUPA 2LGSA 4KGSA 4E3CA 5D2MB 2WX0A 1XCTL 1PYWD 4GSWA 2KLCA 2LVOA 5FK9C 1ZXHA 4ZRPA 2L3ZA 2NPTB 4IOIE 1SJHD 4DHJB 1WWTA 2AQ1B 3WAPA 4P16A 2KDBA 3DWMA 4ANWA 2NTSA 1C4PA 3N9YC 4XDCA 2C9WB 5LNK1 4RH6A 4P7IA 2GOWA 1P3QU 1HA5A 3ZDMC 4A3OA 3TMPB 1I4HA 3ETRA 2DZIA 1YNTE 1P1AA 2AYOB 3BIID 4GDLA 4ICVA 5CX3A 2N9LA 3UINB 4BKSD 3JVZX 1E5WA 3P1MA 1EO6A 4IG7B 1IPGA 4W9FA 4PS3A 3KLSX 1TS3A 2IY1B 2MRPA 4YTPB 4B6WA 2ZVNA 3AM9A 3AULA 3A9KB 2YLMA 3ZJUA 1E10A 4P1CC 2IO3B 1ZOYB 3AE3B 1WZ3A 4QAYA 3RULA 2LFIA 5CTRC 1E7PB 3HHMA 2YEPB 4HKQA 2W3SA 2WXMA 1XT9B 2PEAA 2QMTA 3FILB 2IPKD 1HTQA 2D07B 3GP7A 3RNGC 4P1BC 1SXTA 4ZYNA 3PZ8A 1JWSD 4TSSA 2LD9A 2DNFA 2D10A 3SD5A 2KTRA 3QQ8B 4PS7A 4HKZE 2WXLA 4LK0M 4L23A 5D6JB 1I42A 1E90A 4JX1C 3AE8B 1MHXA 1BXTA 2G1EA 2MH7A 2JQRB 1ZGUB 3AECB 4XGAB 3TIXA 1R4NI 3ML9A 2OHFA 3VXWA 4YSXB 1YQBA 2IBIB 1GB1A 4A8XC 1NYRA 2JY6A 2XK5A 4JE3B 2C7NB 3RZWC 2EMTA 2M56B 2WXFA 3NY5A 3VH4B 2WXOA 4CO7A 4YTMB 2OOBB 3BWUD 1ZW7A 4RF0A 2WDRB 1WJNA 1N63A 2NR2A 2MJDA 5IKCM 1RFAA 1NYQA 3DBRI 1KM7A 3VDZA 3ZNZB 3H8HA 1D5MC 2JYEA 1K52A 1PGBA 3IAM1 1TKGA 5DCNA 4K3CA 2FBWB 1FPYA 5HHDG 3LMNA 2BB5A 4HROA 1NEKB 3H7PB 1TS2A 1AARA 2FIFA 4XDDA 2AEHA 1WX9A 1Y8RC 2LASA 2LI5A 4TV3A 5AZHA 1N62A 2ZW1A 2ZPNA 4KIKB 1WF9A 2JUOA 2MBBB 2KANA 2MHJA 4G3XB 1YJ1A 2BYEA 4BKGA 4KIKA 5H92C 1TIFA 3VUYA 4FA6A 2D5GA 3GZNI 3UQAA 2QC8A 4GLSC 3APFA 2IGGA 1GNUA 1XXGA 3RNCC 3OLMD 1MI0A 2KMAA 4C7ZA 3DWGC 4AUQC 4NAMA 2K8HA 5E6NA 3ZJTA 2JRIB 5BMHA 2B76B 3CF6E 3S2AA 1V81A 1WGGA 4GXBA 3QWZB 3HM3A 3ZUNA 2N9XA 4F1SA 3ZQ4A 2MEKA 2B3AA 4WJQA 3EA6A 4OZBA 4G11A 3ZIMA 4WH4A 4BZAA 5JXVA 3VTUA 3U2SC 4IW0A 2KVZA 3EUB2 1LXDA 3HIZA 2Z0DB 2J4XA 4DXGA 2D3GA 4TUUA 2Y5PA 2KX0A 1GAQB 2WQYB 2KLGA 4XWWA 5AZFA 4HRSA 1FNWA 1J8CA 2ASQA 2JF5A 3RMKC 3WAMA 5IP4D 1FXTB 1K8RB 1XF5L 3HVDA 1KLGD 1LM8B 1V5TA 3VR9B 3NVVA 3NZSA 4WQOB 2NBUA 2G45B 1ET6A 4MGKE 1HQRD 5G5GA 1YD8U 2K6DB 1JWUD 3RNBC 4RGOS 4IWOA 2L83A 3V6CB 2BS3B 2DWQA 1F0ZA 1K51A 2BVCA 5T8IA 4ITKA 1VDVA 4LDTD 2A5UA 4ZHPA 5FR3A 2BKRB 2K6QA 2I1KA 1ENFA 4O1NA 2WXNA 4LTUA 1HTOA 2J0JA 1WZ0A 1UNSA 4W9HA 2KWUB 2WU2B 1DGJA 4YSZB 1PGAA 4KGRA 1I7HA 5D94A 2G9HD 1E6EB 1Y56A 2IY0B 2K0PA 3B9JA 3DVNU 4K81A 1GUAB 2KQ4X 3ONSA 3V61A 4MGYE 2AL6A 2N1VA 1ZKHA 2JU6X 1EF5A 1Z2MA 1D5ZC 4N9F4 4EZJA 1FNVA 3BK1A 1V80A 2KACA 3V05A 2K39A 3Q8EA 4XYCA 2HTHA 3DOWA 4AP4C 2BYTA 4MT5A 3HUIA 3B2GA 1JMLA 2K22A 1SIFA 2DYMA 3QA8A 2AL3A 3DBRB 1YMHE 4RGTA 2ON8A 2MCNB 3HK0A 1FXAA 3IBEA 3SR6A 4LNOA 2BBCA 1LQBA 1E8XA 2GI9A 3VUWA 3Q3FA 4MGIE 2LVQA 1L4DB 1WRIA 2YEPF 2CJNA 2Y5CA 4GDKB 3ZNGC 4LNFA 3TSSA 1XO3A 5C2TB 2LRWA 3OJ4B 4MJSB 4EUTA 4YWGG 4ZHOA 1ZUD2 1RWSA 1TBEA 3C19A 3VR8B 2WXJA 3PRMB 4HVBA 2PMVA 3O65B 1YJJA 3MFGA 1SJED 5BO4B 4YXDB 2L52A 3DVGY 2GBRA 3DPDA 3ZYYX 1V6EA 1C1YB 2RR9A 3GZNB 2KO3A 5E6JA 5AZGA 3IHPC 4DWFA 1RFKA 1QKZA 1E7UA 1YN5A 3EHVA 2INPE 4L2YA 2KDEB 2GB1A 5EE1A 2N4FA 1MG4A 3BY4B 4KZ0A 5CHVC 3AEBB 5LXIB 3Q3OC 2W55A 1UGJA 2L8JA 5G2NA 2Z8LA 3PT2B 3U7DA 1WMHB 2GBNA 4P6VF 2KTFA 3B2FA 5JHBA 4N6EB 3CSTA 1EWYC 2RPVA 3R7QA 2MX2A 2QIEB 2K8CA 5L95C 3L13A 2FAZA 4FULA 2LUEA 3NG0A 2MP2B 1P0RA 4OHJA 3RYTA 2WWZA 4FBJB 1FMAD 3VUXA 2MWSB 3L08A 1OQYA 2JX5A 2QHOA 3BYYB 5EE9A 3DHHC 2INNE 3R7RA 1WM2A 3KUDB 4MM3B 5HG2A 2CHXA 3K9OB 3MJWA 4X57B 4F8CB 5MPOA 2C7MB 1D5XC 2BQQA 3RCZA 2QSDA 3PRPB 2M17A 1I4PA 4XX5A 1UZXB 2LJ5A 2KWVB 4MGZE 2LGIA 3DHGC 3W5UB 2WX1A 4IWPA 3AE9B 3W1SC 4XE0A 1WGRA 1AWDA 4RCOA 1RM6C 2N7DA 3VVWB 2JZZA 3PZDA 1K53A 4FJZA 2XN9C 2KDFB 2L76A 4HPPA 3P2BA 1ISNA 4LNNA 4M0WA 1HEZE 4W9DA 1SF0A 4UDUC 1SIJA 3U30A 3AU5A 3NOBA 4C56C 3ABVB 2AWTA 2BW2A 3MJ5A 4ICUA 1IUEA 3APDA 3AV8A 4PT5A 4A20A 1V49A 3PVLA 2ZJDA 1ROEA 4WURA 1MHHE 2XEWA 3SFDB 3P4SB 2IJ0A 1KOTA 2WYQA 3NS1A 4A6QA 5EDSA 3AE1B 1WXQA 4KDIC 1YN3A 2K9XA 2KDIA 3P4RB 4ZRQA 2ZPYA 4MH0E 3GE3C 1WX7A 5HKHA 2WHIA 4J6IA 4W9EA 1C4CA 4LDTB 1UH6A 3Q2AC 1ZE3D 2NPTA 2KXJA 2K25A 3LB8C 3R2IA 1LGRA 3N30A 4MSQB 2WXRA 3UIPB 1KLVA 1EUVB 2V3NA 3AE6B 1IYFA 4JPSA 3PRZA 1CQVA 1QILA 4KGTA 2K1FA 3RN9C 2RPQA 2KKCA 4JIOU 3ZLZA 2LUMA 1W6VA 3E9SA 5IAAC 2J52A 1TY2A 1KTKA 3U8ZA 2BTEA 1V86A 1WXSA 4JQWC 1L6UA 1SE3A 2M0AA 4M02A 2O6VD 2Q5WD 1YX6B 4USAA 3ZJVA 2DLBA 3AEEB 3A9KA 3LJ3A 2PVOD 5IA7A 2MW5A 2KC2A 1XQQA 1EF1A 1J7CA 1IBXB 1V1PB 1N5WA 1TGZB 5JH5C 2W3RA 4BOSC 3FILA 2FCNA 3V6EB 1MJDA 3VFKA 3IFWB 4US8A 3NVYA 2EELA 1TKYA 1XLQA 1ET9A 3PREA 4NAWB 3DCGA 1OQQA 3R8BA 2FIDA 2K8BA 1XLNA 5E6OA 1E9MA 1ZP0B 3H1UA 5J18A 4HDOA 1QLBB 3TBLD 1CMXB 1WH3A 2KT7A 4OZAA 1A70A 3U4EG 1UBQA 1AYFA 2I1JA 1IGCA 1RAXA 3OG5A 2DAFA 4GB9A 3U7ZA 1UGMA 2DBYA 2EMSA 2LVPA 4OVZA 3Q8AA 3DBHI 4KSKC 4TMAB 4US9A 3TEYA 1VD2A 2WXKA 5H8YE 4OVVA 3AB5A 1EU3A 1VLBA 2J53A 1TJEA 1VZ7A 4R3DA 3EFCA 3NS8A 4A3PA 1ACCA 2IO1B 1QT9A 3W5VB 2LZ6A 3SU8X 1YOVB 4EEWA 1WI0A 4ASWC 2BPSA 2L0TA 2NBWB 3Q8FA 1F9JA 4RM9A 2G4DB 1AW7A 1QQRA 4E71A 1L0YB 4JLCA 4HK2A 2FCQA 2CHZA 2R2QA 2BGFA 2HTME 3SHQA 1V9JA 3I57A 3P63A 1QOFA 5BMIA 4NZLB 2RDHA 3ML8A 3H7PA 4I6LB 1UELA 5TSSA 3MTNB 5BYQA 1YQ3B 1E8WA 1TYGB 3KW5B 3L0WB 1PFDA 4PS8A 4RGNA 4MEMA 4PK1A 4IDIA 2IYDB 2X8XX 3BVMA 2HE7A 3CWIA 4A90A 3VRBB 1XCQL 2MSED 3FAHA 1DOYA 2PE6B 3ECIA 2BF8B 4KKIA 4ZRJA 4AOFA 4WAFA 3AU4A 3CIRB 3A1QB 3NRZA 3N3KB 2WDVB 2BYVE 1D6EC 1Q10A 2R2OA 4KV2A 3MC8A 2M19A 1F2RI 3ALBA 2GRIA 2WDTB 2MQJA 3GS2A 2FCMA 1T5XD 2XBBC 2KOXA 1JRUA 4H2AA 3VAWA 2D2QA 2HD5B 3VTVA 3TEZA 3X23A 3R66C 4A9AA 1TZ1A 3Q6BA 3TEXA 3FKYA 4DK5A 4YTNB 2OJWA 5EE0A 2KN5A 3ZW3A 3V3XA 3VTWA 1SB3C 2Z0EB 3RNAC 2OJRA 4HJKA 4BBNC 3AEDB 2L7RA 2WNMA 3I3TB 2BKFA 4XC2A 1YN4A 1P7EA 2REXA 1Z5SB 1VZ6A 2DENB 3RNFC 5D3DA 3V62A 1OGWA 5DPWA 4RF1A 1TKEA 2FNJB 4JWUC 1WJ6A 4HJGE 3RUIB 3SFEB 2BWES 5BYRA 2HJ8A 4FADA 4ANUA 1OTRB 3ZGZA 3AEAB 3H6NA 4BKSA 5JHAA 2CS4A 1SE9A 1MFWA 2GBKA 1T6BX 1G6JA 4EZKA 2O6VB 2WDQB 3GB1A 3BYTB 3AE4B 3ZKJC 1C76A 1JWBD 2KAJA 1IP9A 3KUCB 2ZCBA 2KNBA 3HRDD 5BMGA 2KWCA 2DZKA 3IT4B 3OJ3A 4KZCA 1NBFC 4C00A 1Q1OA 2W82A 3LDZE 4II3B 2CJOA 1FO4A 3AH7A 5IO9A 3AE2B 1B1ZA 2MA9B 2K3UA 4MSMB 2MBOA 1EU4A 1GJZA 3L10B 4E74A 1FM0D 3DVNV 4I6NB 3DBHB 1WJUA 2PE9A 3KWVA 2QJLA 4FXCA 1N5XA 1UBIA 3J9CA 2L0FA 4G0NB 3PGEA 3WIMA 3EGRA 3KVFB 4IUMB 2CU3A 3Q3NC 4REZA 3CSFA 3WCQA 3MC0B 2GBMA 1FEHA 3WANA 4BVUC 2VRRB 1WGHA 2IDYA 4W9CA 3KQ4A 1EM7A 4N59A 1FCCC 5C3JB 4MACA 3PSEB 1V1OA 2KN4A 3IG3A 4GDKA 2BS2B 1CK1A 3PPAA 2KFJA 2KMCA 4IM2A 4MJSA 4C4VB 3N1XC 3Q3MC 4KVGB 4EE2A 1KFYB 3A9JB 1F2RC 1QZEA 1JCKB 1L2NA 2ZNVC 2BWFA 4GN1A 2RSUA 3RD2A 1FFVA 1WSPA 2JRHA 4F7ZA 1WRDB 1C79A 3QHTA 5CHWA 1DOIA 1SE2A 2MBHA 4WJOA 1TT5B 1TS4A 1R4MI 4PYUA 1XLOA 2O2VB 1OEYA 2NBVB 3M63B 1HE8A 1FXIA 1U4AA 4GGQA 2XNAC 2N7JA 2V0GA 2KMMA 5E6PA 1ESFA 1RLFA 1M94A 2BT6A 1X1MA 2MJ3A 2V4IB 3R3MA 1KLUD 3M95A 4AWJA 2AQ2B 3JSVB 1E7VA 2WU5B 3QIJA 2W54A 2A4ZA 4FN2A 4M8NA 1QOAA 1DYQA 1WMHA 5LXHA 1QF6A 3PLVA 1GC7A 4C80A 2PW9A 1L6VA 2V4LA 1JQ4A 1YJIA 2WP9B 2ZNVB 3A33B 1WGYA 1QOGA 2Z59B 4NNJB 1E8ZA 2NVUI 2N9KA 2MP2A 3DBLB 4K7UA 1L5PA 5DPTA 3AE7B 2GLSA 4WWPA 1N6ZA 2M8SA 2KJRA 3HVZA 2C7HA 4MM3A 1WE6A 4HLEA 1WJ4A 1WE7A 2ONQA 4NQLB 2SAKA 3P42A 1F52A 2J42A 1P98A 5DPRA 2CKHB 2G3QB 3WALA 2BS4B 3NZUA 4GU2A 1I4XA 5G55A 1D3ZA 4BKTA 5GXGB 4EFOA 2NTTA 2RMMA 2KK8A 2FCSA 3H7SA 2DYBA 4B0EA 2K5PA 2RDGA 4RGMA 3OAWA 2INCC 2N7EA 1SEBD 2LJIA 2PVGC 3Q14C 1WFYA 2LHEA 2X38A 1T3QA 3I5JC 3IT6B 3T9LA 1B9RA 4AJWA 2KFKB 3JW0X 4LLGM 4EOYA 4WWMA 4YL8A 1JROA 4KX6B 4NJCA 1WY8A 1OFFA 4IKGA 3ZVVA 1S3SG 3UIOB 2D3BA 3QARA 4JL9A 2ACZB 4M8MA 1I4GA 3W2DA 3KYDD 1KF6B 3P4QB 3N32A 1WXMA 3HM6X 1YX5B 3VQIA 2IGHA 1MG8A 3W1SA 1XLPA 4MDKE 4FJVB 4S17A 2RD0A 5KHQA 2INDC 3MC9A 2LGDA 2V3SA 1T0SC 2KD0A 3NZ3A 2NS5A 2KQSA 2MLBA 2N1WA 4LNKA 4W9JA 4K7SA 4W9LA 2N9PC 3RNEC 4ZOHC 3A4SC 2CU1A 2LGYA 4HEA1 4WQMA 4W9KA 2J7QB 1P9DU 3RI7C 3FC4A 3ZDTA 1R7SA 3N1YC 4GDLB 3N1ZC 4A55A 1KRHA 1UF0A 2JZPA 1C9FA 5HFYA 3ZRCA 4ZRIA 3AMZA 3TJPA 1S1QB 4FLHA 4GOCA 1IBXA 4EKUA 4NPNA 1V1PA 3PHXB 4YSYB 2BB6A 2JVCA 4CHKA 3QK0A 2QCZA 3AEFB 1FCLA 2IGDA 3BVZA 1WR6E 1R4MB 2ZVOA 2QEJC 5IN7A 4BOZB 2EKEC 1XEEA 4NAWA 5C23A 2DZJA 2LHDA 4TQ1A 4BBNF 1ZXIA 4AS1A 1HXYD 2UU7A 4JWSC 1C77A 1N60A 1YQ4B 4KSLC 2KTRB 4II2B 3PHWB 4C7YA 1V2YA 1J7AA 2RGFA 2N0SB 2UYZB 3B1LX 4WWNA 3PV1A 3MHZA 2JWZA 2LXCA 3SDLC 2DZMA 4NY0A 3KYCD 3BVGA 1F1HA 4GIVA 5DPSA 3QCAA 2KJ6A 4DQOC 1HZ6A 2XK5B 1LFDA 2LWPA 1SGHA 3ZNHB 1NI3A 1BMLC 5CHFA 1SSNA 1WM3A 4CQNA 3RT3B 2FUG1 2PKOA 3TCAA 3UQBA 1Q0WB 5LLIA 2H88B 4K3BA 4D2KA 4OW0A 2BYFA 1WYWB 2E6XA 3WAOA 4LJPB 4I6PA 3TUOA 2WLBA 2D3AA 1L0VB 4LJOB 4CYEA 5GMVA 1IGDA 2PJHA 2YVCA 3IVFA 3CMMB 4B0MA 2ICIA 3APCA 4ARCA 2H89B 4ZRKA 1ZDVA 1C4AA 2MJEA 1QOBA 2M0XA 3DVGX 1DOXA 1MPEA 1KJTA 2JZ3B 2LRUA 2UWQA 1JWAD 4FHJA 3B08A 4KKJA 3V60A 3C8YA 3BZDB 4LCDE 2KJHB 2WXIA 1TY0A 3MHSD 4DDID 2C60A 4YT0B 4TQ0A 3DHIC 1FFUA 1FRDA 2WXQA 2DHZA 1NVID 4W9IA 3NHEB 1T0QC 3NJTA 2EKIA 3ZNID 1XD3B 2JT4B 2VH1A 1H8CA 3KH0A 4BAXA 2WXHA 3MP9A 3OWEB 4WAAA 4PYZA 2J0KA 3A1QA 5FR6A 4NQKE 2NMQA 1V5OA 2V3PA 3EFUA 3E56A 1SE4A 1L4ZB 4HDQA 1T0YA 4TKNA 2KYWA 1PDXA 4Q2JA 3ENEA 4K1RB 3UGBB 5L83A 4ANXA 3DBLI 2MBEA 4NJ7A 3AEGB 1V8CA 2FE8A 2LMCA 1BT0A 4WJPA 3RFZB 2HJ1A 4M00A 1FRRA 4JGHB 2MBQA 3LYYA 4HPMB 1C3TA 4DXAB 1UWMA 1I35A 2JSVX 1WX8A 1L0XB 4XZ4A 4S0RA 1FNUA 2KHWB 3Q8CA 4ZDVA 2VZKD 1J7BA 4OVUA 4B9KA 3DDCB 1FIQA 3O13A 3X0WA 1C78A 3ZXRA 1JALA 4AJYB 1UWXA 2LXAA 2KC1A 3LXFA 4AQ7A 1N61A 4G50A 5J2RA 1F77A 4ZYSA 1WIAA 3QX1A 3SEBA 4RM8A 1RYJA 4OZCA 5EE3A 3U52E 1JW9D 3UF8A 3BK2A 3A4RA 1KH0A 1E8YA 2N9EB 4DDGD 4URKA 5G5HA 3QAQA 4DHZB 2WS3B 1WR1A 1GOZA 1GC6A 3L4PA 2WXGA 4BFRA 2I2YA 4DHJD 1VR9A 1MVKA 2KZRA 3AI5A 2AX5A 4B95A 2OEDA 1VCBA 3T3OA 3B0AA 2PPHA 2CR5A 2AQ3B 4MH8A 2ZZPB 1UD7A 3AN1A 2O6VA 5IOIA 4RFBA 4NJ6A 3PO0A 5J17A 2KX3A 1TS5A 3Q8BA 2IO0B 4N58A 1OEYJ 2QILA 3NUHB 1PGXA 3H9DA 4DHZE 1L7YA 1VZ8A 1R4NB 2D11A 3ZO5B 1T0RC 1E0ZA 5D3IB 2M4NA 3L54A 1PQSA 1YIWA 3QJZA 2E3TA 2L05A 4GMVA 3BINA 3Q69A 1GG3A 1I4RA 1ZPSA 3AE5B 5D7GA 3Q3JA 4WIPA 4MELA 1PUTA 1V97A 2JXXA 3PZ7A 3UI3A 3W1YA 3ZTDA 2QDFA 2J0MA 2JWUA 2GMIC 2IO2B 1NDDA 2GBJA 4C4VA 4ANVA 1CZPA 4HCPB 1STEA 4K7WA 2IZVB 1WYGA 4XWTA 3URYA 1GB4A 1GPXA 3A9JA 3VHTC 3T3NA 2DYOA 1WGKA 5TR5A 5FKAC 5C1ZA 2JYTA 4FHKA 1NENB 2L1AA 4HPLB 2CHWA 2TSSA 4HCNB 4L1BA 2C5LC 3GE8C 2PLPA 3K9PB 1CJEA 2KVRA 2O2VA 3JYUA 3EECA 4WJNA 3TL5A 3PTFC 4W9GA 5I4DA 4J3OD 1WXAA 1J0GA 1ZDXA 4IM0A 2D3CA 3IXSA 2Y3AA
chains in the Genus database with same CATH topology
4HK2A 2FCQA 3L16A 3DBSA 3JSVA 2CHZA 2KD0A 2R2QA 2NS5A 3ZRFA 2BGFA 2KQSA 4RMAA 2MLBA 3SHQA 2N1WA 1V9JA 4IM3A 5JZEB 4W9JA 3DQVA 4LDTD 2A5UA 4K7SA 4W9LA 2N9PC 2FUHB 2BKRB 2K6QA 2I1KA 3A4SC 2CU1A 2LGYA 3ML8A 2KQ7A 3H7PA 4I6LB 2Y5BB 1UELA 2W9NA 2J0JA 4W9KA 2J7QB 3MTNB 4WWOA 1WZ0A 3EC8A 4W9HA 2KWUB 1P9DU 3PLUA 1H4RA 1E8WA 4B95A 4IC7B 3KW5B 3L0WB 2LGXA 3ZDTA 4GDLB 4PS8A 5D94A 2DAJA 4MEMA 2IY0B 2IYDB 3DVNU 4K81A 3ZRCA 1GUAB 2V1YA 2HE7A 4ZRIA 3ONSA 2JPHA 3V61A 4MGYE 2AL6A 4EZLA 2NCNA 3TJPA 2MSED 2N1VA 1ZKHA 4IWQA 2PE6B 3ECIA 1EF5A 2BF8B 1Z2MA 1S1QB 4ZRJA 1Q5WB 3L17A 4FLHA 4GOCA 4AOFA 4N9F4 4EKUA 4NPNA 4EZJA 3AU4A 3PHXB 3PS6A 3KUZA 1V80A 3GOEA 2JVCA 3A1QB 2K39A 4CHKA 3QK0A 3V6CB 3D32A 3M62B 3N3KB 3ZTCA 2HTHA 3DOWA 2BYVE 4AP4C 1WR6E 3C0RB 1NI2A 2ZVOA 2R2OA 4KV2A 4BOZB 2DX5B 2EKEC 3AXCA 3VH3B 1SIFA 2DYMA 4NAWA 5C23A 3ALBA 3QA8A 1RRBA 2DZJA 2AL3A 4TQ1A 4BBNF 2WDTB 2MQJA 2G4SA 3HK0A 2MCNB 4KSLC 4HWIB 2KTRB 4II2B 2M1MA 3IBEA 3PHWB 1J19A 1V2YA 2FCMA 1LQBA 2RGFA 1E8XA 2UYZB 2XBBC 3B1LX 3Q3FA 4WWNA 2KOXA 4MGIE 3VUWA 1JRUA 3PV1A 2JWZA 2LVQA 2LXCA 3SDLC 2DZMA 4GDKB 2D2QA 3VAWA 3ZNGC 5AEKB 4NY0A 1WGDA 2HD5B 1WXVA 2L00B 4HXDA 4KDLB 4M0WB 1A5RA 3VTVA 3KYCD 2LRWA 3OJ4B 2KFKA 1TTNA 4MJSB 4GIVA 4DBGA 4EUTA 3X23A 3T8MA 3R66C 1TZ1A 1TBEA 4DK5A 5DPSA 3RZFA 3QCAA 3QC8B 2KJ6A 3M3JA 3PRMB 4HVBA 2XK5B 3O65B 1LFDA 2LWPA 5KHOA 4FJYA 1SGHA 2KN5A 3ZNHB 2ZEQA 5CHFA 3ZW3A 5BO4B 1WM3A 2ZCCA 3RT3B 3VTWA 3DVGY 3TCAA 2GBRA 3DPDA 3UQBA 1Q0WB 5LLIA 2Z0EB 1V6EA 3WA0A 2OJRA 1C1YB 4HJKA 2BYFA 1WYWB 2RR9A 2KO3A 5AZGA 4BBNC 3IHPC 3WAOA 4DWFA 2L7RA 1E7UA 4LJPB 4E3CA 3I3TB 4I6PA 3EHVA 2BKFA 4XC2A 5D2MB 2WX0A 2KDEB 4GSWA 2KLCA 4LJOB 4CYEA 2N4FA 5GMVA 2LVOA 2REXA 2PJHA 2YVCA 1Z5SB 3BY4B 3IVFA 4KZ0A 2L3ZA 5CHVC 2DENB 2NPTB 4DHJB 3V62A 5LXIB 3WAPA 1OGWA 5DPWA 3CMMB 3APCA 2FNJB 2KDBA 1WJ6A 2L8JA 4ANWA 5G2NA 5JHAA 4ZRKA 3RUIB 3PT2B 3U7DA 1WMHB 2C9WB 2BWES 2GBNA 2HJ8A 2KTFA 2M0XA 5JHBA 4FADA 3DVGX 4P7IA 4ANUA 1OTRB 2GOWA 1KJTA 1P3QU 2JZ3B 2LRUA 2UWQA 3CSTA 3H6NA 4BKSA 3ZDMC 4FHJA 4A3OA 3B08A 3TMPB 2DZIA 2CS4A 3V60A 1P1AA 3R7QA 1SE9A 2AYOB 2GBKA 2MX2A 4GDLA 4ICVA 4LCDE 5CX3A 3UINB 2K8CA 2KJHB 4EZKA 2O6VB 1G6JA 5L95C 2FAZA 3L13A 4FULA 2LUEA 3JVZX 1E5WA 3ZKJC 4BKSD 2MP2B 1P0RA 1IP9A 3MHSD 4DDID 2C60A 3RYTA 3KUCB 2WWZA 1EO6A 2ZCBA 4IG7B 4TQ0A 2KNBA 4FBJB 2DHZA 2KWCA 2DZKA 1IPGA 4W9FA 4PS3A 3OJ3A 4KZCA 4W9IA 2IY1B 1NBFC 3VUXA 3NHEB 1Q1OA 2MRPA 2MWSB 3LDZE 3L08A 4II3B 4B6WA 2ZVNA 3ZNID 1OQYA 2QHOA 1XD3B 2JT4B 3AULA 3A9KB 2MA9B 2YLMA 1H8CA 3KH0A 4MSMB 2IO3B 2MBOA 3R7RA 1WM2A 1WZ3A 4WAAA 3KUDB 1GJZA 3L10B 3RULA 4E74A 3DVNV 4PYZA 4I6NB 5CTRC 2J0KA 3A1QA 3HHMA 1WJUA 2CHXA 2PE9A 3K9OB 5FR6A 3MJWA 4X57B 4F8CB 1XT9B 2PEAA 4NQKE 1UBIA 2L0FA 2C7MB 4G0NB 3PGEA 2D07B 3RCZA 1V5OA 3WIMA 3EFUA 3PRPB 2M17A 3KVFB 4ZYNA 4XX5A 4IUMB 1UZXB 4HDQA 1T0YA 2LJ5A 2KWVB 4MGZE 4TKNA 2WX1A 3ENEA 4K1RB 3CSFA 3UGBB 4IWPA 5L83A 3W1SC 4ANXA 2GBMA 1WGRA 3DBLI 2MBEA 4NJ7A 3WANA 2LD9A 2D10A 3SD5A 2KTRA 3QQ8B 4PS7A 4BVUC 2N7DA 3VVWB 1BT0A 2VRRB 5D6JB 1I42A 1E90A 4WJPA 1WGHA 2JZZA 4W9CA 3PZDA 4FJZA 2MBQA 4JGHB 2KDFB 2L76A 3PSEB 4HPMB 3P2BA 1C3TA 4DXAB 1I35A 1ZGUB 1ISNA 1WX8A 3IG3A 4GDKA 3PPAA 4XZ4A 4W9DA 3TIXA 2KFJA 4ZDVA 2KHWB 2KMCA 1R4NI 4IM2A 3ML9A 4MJSA 3VXWA 1YQBA 2IBIB 3U30A 3AU5A 3NOBA 2AWTA 4KVGB 4OVUA 2JY6A 4B9KA 3A9JB 4ICUA 1QZEA 3DDCB 1L2NA 2ZNVC 2BWFA 2XK5A 3APDA 2RSUA 2C7NB 4GN1A 3RZWC 3X0WA 3RD2A 2EMTA 3VH4B 3NY5A 4CO7A 2JRHA 4AJYB 4A20A 1V49A 3PVLA 4F7ZA 2ZJDA 2OOBB 1WRDB 3QHTA 5CHWA 2LXAA 1ZW7A 2KC1A 2MBHA 4WJOA 2XEWA 1R4MI 1KOTA 1WJNA 4G50A 2WYQA 5J2RA 4PYUA 1WIAA 3QX1A 2O2VB 2NR2A 4RM8A 5EDSA 1OEYA 2NBVB 1RFAA 4KDIC 2KDIA 3M63B 3DBRI 2ZPYA 1U4AA 1HE8A 4MH0E 3UF8A 1KM7A 4GGQA 3VDZA 3ZNZB 1WX7A 5HKHA 5E6PA 1RLFA 1M94A 4J6IA 1X1MA 4W9EA 3A4RA 3R3MA 3M95A 4AWJA 4LDTB 1UH6A 3JSVB 1E8YA 1E7VA 2N9EB 2NPTA 3QIJA 4DDGD 4URKA 2KXJA 3QAQA 4DHZB 2K25A 5DCNA 3N30A 2A4ZA 4FN2A 4MSQB 1WR1A 4M8NA 3UIPB 1KLVA 1GC6A 1EUVB 1IYFA 4BFRA 1WMHA 5LXHA 3PRZA 4DHJD 3LMNA 3PLVA 3H7PB 2K1FA 1AARA 1GC7A 2FIFA 2KZRA 3AI5A 2AEHA 2RPQA 1VCBA 1WX9A 2KKCA 2V4LA 1Y8RC 3B0AA 4JIOU 3ZLZA 2LASA 2PPHA 2LI5A 2CR5A 1W6VA 5IAAC 2ZNVB 3A33B 4TV3A 5AZHA 1WGYA 2Z59B 2ZZPB 4NNJB 1UD7A 1E8ZA 2O6VA 2NVUI 2ZPNA 4KIKB 3U8ZA 1WF9A 2JUOA 2MBBB 2KANA 2MP2A 1V86A 1WXSA 4JQWC 4G3XB 4K7UA 2BYEA 1YJ1A 4NJ6A 4BKGA 4KIKA 5DPTA 5J17A 3VUYA 2O6VD 4FA6A 2KX3A 3GZNI 3UQAA 1YX6B 4WWPA 2M8SA 2IO0B 2KJRA 3APFA 1GNUA 1OEYJ 2C7HA 3A9KA 3LJ3A 5IA7A 2MW5A 2KC2A 3H9DA 4DHZE 1L7YA 3OLMD 1XQQA 1EF1A 2KMAA 4MM3A 1WE6A 4HLEA 1TGZB 1WJ4A 2D11A 4AUQC 1WE7A 3ZO5B 5JH5C 2K8HA 5E6NA 4NQLB 4BOSC 2M4NA 2JRIB 2FCNA 3L54A 1PQSA 3V6EB 1YIWA 3CF6E 3QJZA 3S2AA 1V81A 1WGGA 4GXBA 3QWZB 3VFKA 3IFWB 3HM3A 1P98A 5DPRA 2L05A 4GMVA 2CKHB 3ZUNA 2N9XA 2G3QB 3WALA 3NZUA 3BINA 4F1SA 1GG3A 4GU2A 3PREA 3TL5A 5D7GA 4NAWB 5G55A 3DCGA 3Q3JA 2B3AA 4WJQA 1D3ZA 4BKTA 4G11A 3ZIMA 2FIDA 4EFOA 2K8BA 4MELA 5E6OA 5J18A 3H1UA 2KK8A 4HDOA 3TBLD 1CMXB 1WH3A 3VTUA 2FCSA 2JXXA 3H7SA 2DYBA 4IW0A 3OAWA 2N7EA 1UBQA 3W1YA 3ZTDA 2J0MA 2I1JA 1LXDA 1RAXA 2GMIC 2IO2B 3HIZA 2Z0DB 1WFYA 3T9LA 1NDDA 2DAFA 4GB9A 2GBJA 2D3GA 4TUUA 4AJWA 4ANVA 4HCPB 2KFKB 3JW0X 1UGMA 4K7WA 2IZVB 2EMSA 2LVPA 4EOYA 2KX0A 3A9JA 3VHTC 2DYOA 5TR5A 5C1ZA 2KLGA 4FHKA 4YL8A 5AZFA 3DBHI 1WY8A 4KSKC 1VD2A 4HPLB 2CHWA 4OVVA 3ZVVA 4HCNB 1J8CA 2ASQA 2C5LC 2JF5A 1S3SG 3UIOB 3WAMA 1FXTB 3NS8A 1K8RB 3QARA 4A3PA 4JL9A 2IO1B 3K9PB 2LZ6A 3SU8X 4M8MA 2KVRA 2O2VA 3JYUA 3KYDD 1LM8B 3EECA 4EEWA 1WI0A 4ASWC 2BPSA 1V5TA 3N32A 1WXMA 2L0TA 3PTFC 3HM6X 4W9GA 1YX5B 3NZSA 4WJNA 2NBWB 4WQOB 3VQIA 1WXAA 1MG8A 2NBUA 1F9JA 4RM9A 2G45B 2G4DB 4MDKE 3W1SA 1J0GA 4IM0A 4MGKE 4FJVB 2RD0A 5KHQA 1YD8U 2K6DB 4E71A 4IWOA 4JLCA 2LGDA 2V3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HK2 A;  2FCQ A;  3L16 A;  3DBS A;  3JSV A;  2CHZ A;  2KD0 A;  2R2Q A;  2NS5 A;  3ZRF A;  2BGF A;  2KQS A;  4RMA A;  2MLB A;  3SHQ A;  2N1W A;  1V9J A;  4IM3 A;  5JZE B;  4W9J A;  3DQV A;  4LDT D;  2A5U A;  4K7S A;  4W9L A;  2N9P C;  2FUH B;  2BKR B;  2K6Q A;  2I1K A;  3A4S C;  2CU1 A;  2LGY A;  3ML8 A;  2KQ7 A;  3H7P A;  4I6L B;  2Y5B B;  1UEL A;  2W9N A;  2J0J A;  4W9K A;  2J7Q B;  3MTN B;  4WWO A;  1WZ0 A;  3EC8 A;  4W9H A;  2KWU B;  1P9D U;  3PLU A;  1H4R A;  1E8W A;  4B95 A;  4IC7 B;  3KW5 B;  3L0W B;  2LGX A;  3ZDT A;  4GDL B;  4PS8 A;  5D94 A;  2DAJ A;  4MEM A;  2IY0 B;  2IYD B;  3DVN U;  4K81 A;  3ZRC A;  1GUA B;  2V1Y A;  2HE7 A;  4ZRI A;  3ONS A;  2JPH A;  3V61 A;  4MGY E;  2AL6 A;  4EZL A;  2NCN A;  3TJP A;  2MSE D;  2N1V A;  1ZKH A;  4IWQ A;  2PE6 B;  3ECI A;  1EF5 A;  2BF8 B;  1Z2M A;  1S1Q B;  4ZRJ A;  1Q5W B;  3L17 A;  4FLH A;  4GOC A;  4AOF A;  4N9F 4;  4EKU A;  4NPN A;  4EZJ A;  3AU4 A;  3PHX B;  3PS6 A;  3KUZ A;  1V80 A;  3GOE A;  2JVC A;  3A1Q B;  2K39 A;  4CHK A;  3QK0 A;  3V6C B;  3D32 A;  3M62 B;  3N3K B;  3ZTC A;  2HTH A;  3DOW A;  2BYV E;  4AP4 C;  1WR6 E;  3C0R B;  1NI2 A;  2ZVO A;  2R2O A;  4KV2 A;  4BOZ B;  2DX5 B;  2EKE C;  3AXC A;  3VH3 B;  1SIF A;  2DYM A;  4NAW A;  5C23 A;  3ALB A;  3QA8 A;  1RRB A;  2DZJ A;  2AL3 A;  4TQ1 A;  4BBN F;  2WDT B;  2MQJ A;  2G4S A;  3HK0 A;  2MCN B;  4KSL C;  4HWI B;  2KTR B;  4II2 B;  2M1M A;  3IBE A;  3PHW B;  1J19 A;  1V2Y A;  2FCM A;  1LQB A;  2RGF A;  1E8X A;  2UYZ B;  2XBB C;  3B1L X;  3Q3F A;  4WWN A;  2KOX A;  4MGI E;  3VUW A;  1JRU A;  3PV1 A;  2JWZ A;  2LVQ A;  2LXC A;  3SDL C;  2DZM A;  4GDK B;  2D2Q A;  3VAW A;  3ZNG C;  5AEK B;  4NY0 A;  1WGD A;  2HD5 B;  1WXV A;  2L00 B;  4HXD A;  4KDL B;  4M0W B;  1A5R A;  3VTV A;  3KYC D;  2LRW A;  3OJ4 B;  2KFK A;  1TTN A;  4MJS B;  4GIV A;  4DBG A;  4EUT A;  3X23 A;  3T8M A;  3R66 C;  1TZ1 A;  1TBE A;  4DK5 A;  5DPS A;  3RZF A;  3QCA A;  3QC8 B;  2KJ6 A;  3M3J A;  3PRM B;  4HVB A;  2XK5 B;  3O65 B;  1LFD A;  2LWP A;  5KHO A;  4FJY A;  1SGH A;  2KN5 A;  3ZNH B;  2ZEQ A;  5CHF A;  3ZW3 A;  5BO4 B;  1WM3 A;  2ZCC A;  3RT3 B;  3VTW A;  3DVG Y;  3TCA A;  2GBR A;  3DPD A;  3UQB A;  1Q0W B;  5LLI A;  2Z0E B;  1V6E A;  3WA0 A;  2OJR A;  1C1Y B;  4HJK A;  2BYF A;  1WYW B;  2RR9 A;  2KO3 A;  5AZG A;  4BBN C;  3IHP C;  3WAO A;  4DWF A;  2L7R A;  1E7U A;  4LJP B;  4E3C A;  3I3T B;  4I6P A;  3EHV A;  2BKF A;  4XC2 A;  5D2M B;  2WX0 A;  2KDE B;  4GSW A;  2KLC A;  4LJO B;  4CYE A;  2N4F A;  5GMV A;  2LVO A;  2REX A;  2PJH A;  2YVC A;  1Z5S B;  3BY4 B;  3IVF A;  4KZ0 A;  2L3Z A;  5CHV C;  2DEN B;  2NPT B;  4DHJ B;  3V62 A;  5LXI B;  3WAP A;  1OGW A;  5DPW A;  3CMM B;  3APC A;  2FNJ B;  2KDB A;  1WJ6 A;  2L8J A;  4ANW A;  5G2N A;  5JHA A;  4ZRK A;  3RUI B;  3PT2 B;  3U7D A;  1WMH B;  2C9W B;  2BWE S;  2GBN A;  2HJ8 A;  2KTF A;  2M0X A;  5JHB A;  4FAD A;  3DVG X;  4P7I A;  4ANU A;  1OTR B;  2GOW A;  1KJT A;  1P3Q U;  2JZ3 B;  2LRU A;  2UWQ A;  3CST A;  3H6N A;  4BKS A;  3ZDM C;  4FHJ A;  4A3O A;  3B08 A;  3TMP B;  2DZI A;  2CS4 A;  3V60 A;  1P1A A;  3R7Q A;  1SE9 A;  2AYO B;  2GBK A;  2MX2 A;  4GDL A;  4ICV A;  4LCD E;  5CX3 A;  3UIN B;  2K8C A;  2KJH B;  4EZK A;  2O6V B;  1G6J A;  5L95 C;  2FAZ A;  3L13 A;  4FUL A;  2LUE A;  3JVZ X;  1E5W A;  3ZKJ C;  4BKS D;  2MP2 B;  1P0R A;  1IP9 A;  3MHS D;  4DDI D;  2C60 A;  3RYT A;  3KUC B;  2WWZ A;  1EO6 A;  2ZCB A;  4IG7 B;  4TQ0 A;  2KNB A;  4FBJ B;  2DHZ A;  2KWC A;  2DZK A;  1IPG A;  4W9F A;  4PS3 A;  3OJ3 A;  4KZC A;  4W9I A;  2IY1 B;  1NBF C;  3VUX A;  3NHE B;  1Q1O A;  2MRP A;  2MWS B;  3LDZ E;  3L08 A;  4II3 B;  4B6W A;  2ZVN A;  3ZNI D;  1OQY A;  2QHO A;  1XD3 B;  2JT4 B;  3AUL A;  3A9K B;  2MA9 B;  2YLM A;  1H8C A;  3KH0 A;  4MSM B;  2IO3 B;  2MBO A;  3R7R A;  1WM2 A;  1WZ3 A;  4WAA A;  3KUD B;  1GJZ A;  3L10 B;  3RUL A;  4E74 A;  3DVN V;  4PYZ A;  4I6N B;  5CTR C;  2J0K A;  3A1Q A;  3HHM A;  1WJU A;  2CHX A;  2PE9 A;  3K9O B;  5FR6 A;  3MJW A;  4X57 B;  4F8C B;  1XT9 B;  2PEA A;  4NQK E;  1UBI A;  2L0F A;  2C7M B;  4G0N B;  3PGE A;  2D07 B;  3RCZ A;  1V5O A;  3WIM A;  3EFU A;  3PRP B;  2M17 A;  3KVF B;  4ZYN A;  4XX5 A;  4IUM B;  1UZX B;  4HDQ A;  1T0Y A;  2LJ5 A;  2KWV B;  4MGZ E;  4TKN A;  2WX1 A;  3ENE A;  4K1R B;  3CSF A;  3UGB B;  4IWP A;  5L83 A;  3W1S C;  4ANX A;  2GBM A;  1WGR A;  3DBL I;  2MBE A;  4NJ7 A;  3WAN A;  2LD9 A;  2D10 A;  3SD5 A;  2KTR A;  3QQ8 B;  4PS7 A;  4BVU C;  2N7D A;  3VVW B;  1BT0 A;  2VRR B;  5D6J B;  1I42 A;  1E90 A;  4WJP A;  1WGH A;  2JZZ A;  4W9C A;  3PZD A;  4FJZ A;  2MBQ A;  4JGH B;  2KDF B;  2L76 A;  3PSE B;  4HPM B;  3P2B A;  1C3T A;  4DXA B;  1I35 A;  1ZGU B;  1ISN A;  1WX8 A;  3IG3 A;  4GDK A;  3PPA A;  4XZ4 A;  4W9D A;  3TIX A;  2KFJ A;  4ZDV A;  2KHW B;  2KMC A;  1R4N I;  4IM2 A;  3ML9 A;  4MJS A;  3VXW A;  1YQB A;  2IBI B;  3U30 A;  3AU5 A;  3NOB A;  2AWT A;  4KVG B;  4OVU A;  2JY6 A;  4B9K A;  3A9J B;  4ICU A;  1QZE A;  3DDC B;  1L2N A;  2ZNV C;  2BWF A;  2XK5 A;  3APD A;  2RSU A;  2C7N B;  4GN1 A;  3RZW C;  3X0W A;  3RD2 A;  2EMT A;  3VH4 B;  3NY5 A;  4CO7 A;  2JRH A;  4AJY B;  4A20 A;  1V49 A;  3PVL A;  4F7Z A;  2ZJD A;  2OOB B;  1WRD B;  3QHT A;  5CHW A;  2LXA A;  1ZW7 A;  2KC1 A;  2MBH A;  4WJO A;  2XEW A;  1R4M I;  1KOT A;  1WJN A;  4G50 A;  2WYQ A;  5J2R A;  4PYU A;  1WIA A;  3QX1 A;  2O2V B;  2NR2 A;  4RM8 A;  5EDS A;  1OEY A;  2NBV B;  1RFA A;  4KDI C;  2KDI A;  3M63 B;  3DBR I;  2ZPY A;  1U4A A;  1HE8 A;  4MH0 E;  3UF8 A;  1KM7 A;  4GGQ A;  3VDZ A;  3ZNZ B;  1WX7 A;  5HKH A;  5E6P A;  1RLF A;  1M94 A;  4J6I A;  1X1M A;  4W9E A;  3A4R A;  3R3M A;  3M95 A;  4AWJ A;  4LDT B;  1UH6 A;  3JSV B;  1E8Y A;  1E7V A;  2N9E B;  2NPT A;  3QIJ A;  4DDG D;  4URK A;  2KXJ A;  3QAQ A;  4DHZ B;  2K25 A;  5DCN A;  3N30 A;  2A4Z A;  4FN2 A;  4MSQ B;  1WR1 A;  4M8N A;  3UIP B;  1KLV A;  1GC6 A;  1EUV B;  1IYF A;  4BFR A;  1WMH A;  5LXH A;  3PRZ A;  4DHJ D;  3LMN A;  3PLV A;  3H7P B;  2K1F A;  1AAR A;  1GC7 A;  2FIF A;  2KZR A;  3AI5 A;  2AEH A;  2RPQ A;  1VCB A;  1WX9 A;  2KKC A;  2V4L A;  1Y8R C;  3B0A A;  4JIO U;  3ZLZ A;  2LAS A;  2PPH A;  2LI5 A;  2CR5 A;  1W6V A;  5IAA C;  2ZNV B;  3A33 B;  4TV3 A;  5AZH A;  1WGY A;  2Z59 B;  2ZZP B;  4NNJ B;  1UD7 A;  1E8Z A;  2O6V A;  2NVU I;  2ZPN A;  4KIK B;  3U8Z A;  1WF9 A;  2JUO A;  2MBB B;  2KAN A;  2MP2 A;  1V86 A;  1WXS A;  4JQW C;  4G3X B;  4K7U A;  2BYE A;  1YJ1 A;  4NJ6 A;  4BKG A;  4KIK A;  5DPT A;  5J17 A;  3VUY A;  2O6V D;  4FA6 A;  2KX3 A;  3GZN I;  3UQA A;  1YX6 B;  4WWP A;  2M8S A;  2IO0 B;  2KJR A;  3APF A;  1GNU A;  1OEY J;  2C7H A;  3A9K A;  3LJ3 A;  5IA7 A;  2MW5 A;  2KC2 A;  3H9D A;  4DHZ E;  1L7Y A;  3OLM D;  1XQQ A;  1EF1 A;  2KMA A;  4MM3 A;  1WE6 A;  4HLE A;  1TGZ B;  1WJ4 A;  2D11 A;  4AUQ C;  1WE7 A;  3ZO5 B;  5JH5 C;  2K8H A;  5E6N A;  4NQL B;  4BOS C;  2M4N A;  2JRI B;  2FCN A;  3L54 A;  1PQS A;  3V6E B;  1YIW A;  3CF6 E;  3QJZ A;  3S2A A;  1V81 A;  1WGG A;  4GXB A;  3QWZ B;  3VFK A;  3IFW B;  3HM3 A;  1P98 A;  5DPR A;  2L05 A;  4GMV A;  2CKH B;  3ZUN A;  2N9X A;  2G3Q B;  3WAL A;  3NZU A;  3BIN A;  4F1S A;  1GG3 A;  4GU2 A;  3PRE A;  3TL5 A;  5D7G A;  4NAW B;  5G55 A;  3DCG A;  3Q3J A;  2B3A A;  4WJQ A;  1D3Z A;  4BKT A;  4G11 A;  3ZIM A;  2FID A;  4EFO A;  2K8B A;  4MEL A;  5E6O A;  5J18 A;  3H1U A;  2KK8 A;  4HDO A;  3TBL D;  1CMX B;  1WH3 A;  3VTU A;  2FCS A;  2JXX A;  3H7S A;  2DYB A;  4IW0 A;  3OAW A;  2N7E A;  1UBQ A;  3W1Y A;  3ZTD A;  2J0M A;  2I1J A;  1LXD A;  1RAX A;  2GMI C;  2IO2 B;  3HIZ A;  2Z0D B;  1WFY A;  3T9L A;  1NDD A;  2DAF A;  4GB9 A;  2GBJ A;  2D3G A;  4TUU A;  4AJW A;  4ANV A;  4HCP B;  2KFK B;  3JW0 X;  1UGM A;  4K7W A;  2IZV B;  2EMS A;  2LVP A;  4EOY A;  2KX0 A;  3A9J A;  3VHT C;  2DYO A;  5TR5 A;  5C1Z A;  2KLG A;  4FHK A;  4YL8 A;  5AZF A;  3DBH I;  1WY8 A;  4KSK C;  1VD2 A;  4HPL B;  2CHW A;  4OVV A;  3ZVV A;  4HCN B;  1J8C A;  2ASQ A;  2C5L C;  2JF5 A;  1S3S G;  3UIO B;  3WAM A;  1FXT B;  3NS8 A;  1K8R B;  3QAR A;  4A3P A;  4JL9 A;  2IO1 B;  3K9P B;  2LZ6 A;  3SU8 X;  4M8M A;  2KVR A;  2O2V A;  3JYU A;  3KYD D;  1LM8 B;  3EEC A;  4EEW A;  1WI0 A;  4ASW C;  2BPS A;  1V5T A;  3N32 A;  1WXM A;  2L0T A;  3PTF C;  3HM6 X;  4W9G A;  1YX5 B;  3NZS A;  4WJN A;  2NBW B;  4WQO B;  3VQI A;  1WXA A;  1MG8 A;  2NBU A;  1F9J A;  4RM9 A;  2G45 B;  2G4D B;  4MDK E;  3W1S A;  1J0G A;  4IM0 A;  4MGK E;  4FJV B;  2RD0 A;  5KHQ A;  1YD8 U;  2K6D B;  4E71 A;  4IWO A;  4JLC A;  2LGD A;  2V3S A; 
#chains in the Genus database with same CATH topology
 3L16 A;  3DBS A;  3JSV A;  3P4P B;  3ZRF A;  4RMA A;  1EWC A;  4IM3 A;  5JZE B;  1K50 A;  3DQV A;  2FUH B;  2JXT A;  2VH2 A;  2KQ7 A;  2Y5B B;  2W9N A;  4RNA A;  4WWO A;  5HI1 A;  3EC8 A;  3PLU A;  5AUK A;  1H4R A;  2PTL A;  1AN8 A;  4IC7 B;  2LGX A;  2ZW0 A;  1VRA B;  4M01 A;  2DAJ A;  1TZO A;  2R61 A;  3R2T A;  2V1Y A;  2HDE A;  2KWD A;  3NVZ A;  2JPH A;  4EZL A;  4ARI A;  2NCN A;  4DXF A;  4ACF A;  4IWQ A;  2I38 A;  2RDB C;  1Q5W B;  3L17 A;  3RPF C;  1JRP A;  4LNI A;  3PS6 A;  1D4B A;  3KUZ A;  3GOE A;  3D32 A;  3M62 B;  2V9H A;  3W9C B;  5BYS A;  3ZTC A;  2L32 A;  2SEB D;  3N20 C;  3C0R B;  1NI2 A;  5AUI A;  2DX5 B;  3AXC A;  2PIA A;  1JWM D;  3VH3 B;  1HZ5 A;  3NVW A;  1RRB A;  1I4Q A;  2G4S A;  1M4V A;  4HWI B;  3I9V 1;  2M1M A;  1J19 A;  3KWL A;  2WGS A;  2WXP A;  3I63 C;  2VZK B;  1BUI C;  5AEK B;  1OQR A;  1WGD A;  2L00 B;  1WXV A;  4HXD A;  4M0W B;  4KDL B;  1A5R A;  2KFK A;  1TTN A;  4DBG A;  3T8M A;  1VJK A;  1FD6 A;  3RZF A;  3QC8 B;  3M3J A;  5KHO A;  1SBB B;  4FJY A;  2ZEQ A;  1P7F A;  2LEK A;  3VRA B;  1LO5 D;  2ZCC A;  2KDM A;  3ZXV A;  3TEW A;  3IAS 1;  3WA0 A;  1UUP A;  2LGS A;  4KGS A;  4E3C A;  5D2M B;  2WX0 A;  1XCT L;  1PYW D;  4GSW A;  2KLC A;  2LVO A;  5FK9 C;  1ZXH A;  4ZRP A;  2L3Z A;  2NPT B;  4IOI E;  1SJH D;  4DHJ B;  1WWT A;  2AQ1 B;  3WAP A;  4P16 A;  2KDB A;  3DWM A;  4ANW A;  2NTS A;  1C4P A;  3N9Y C;  4XDC A;  2C9W B;  5LNK 1;  4RH6 A;  4P7I A;  2GOW A;  1P3Q U;  1HA5 A;  3ZDM C;  4A3O A;  3TMP B;  1I4H A;  3ETR A;  2DZI A;  1YNT E;  1P1A A;  2AYO B;  3BII D;  4GDL A;  4ICV A;  5CX3 A;  2N9L A;  3UIN B;  4BKS D;  3JVZ X;  1E5W A;  3P1M A;  1EO6 A;  4IG7 B;  1IPG A;  4W9F A;  4PS3 A;  3KLS X;  1TS3 A;  2IY1 B;  2MRP A;  4YTP B;  4B6W A;  2ZVN A;  3AM9 A;  3AUL A;  3A9K B;  2YLM A;  3ZJU A;  1E10 A;  4P1C C;  2IO3 B;  1ZOY B;  3AE3 B;  1WZ3 A;  4QAY A;  3RUL A;  2LFI A;  5CTR C;  1E7P B;  3HHM A;  2YEP B;  4HKQ A;  2W3S A;  2WXM A;  1XT9 B;  2PEA A;  2QMT A;  3FIL B;  2IPK D;  1HTQ A;  2D07 B;  3GP7 A;  3RNG C;  4P1B C;  1SXT A;  4ZYN A;  3PZ8 A;  1JWS D;  4TSS A;  2LD9 A;  2DNF A;  2D10 A;  3SD5 A;  2KTR A;  3QQ8 B;  4PS7 A;  4HKZ E;  2WXL A;  4LK0 M;  4L23 A;  5D6J B;  1I42 A;  1E90 A;  4JX1 C;  3AE8 B;  1MHX A;  1BXT A;  2G1E A;  2MH7 A;  2JQR B;  1ZGU B;  3AEC B;  4XGA B;  3TIX A;  1R4N I;  3ML9 A;  2OHF A;  3VXW A;  4YSX B;  1YQB A;  2IBI B;  1GB1 A;  4A8X C;  1NYR A;  2JY6 A;  2XK5 A;  4JE3 B;  2C7N B;  3RZW C;  2EMT A;  2M56 B;  2WXF A;  3NY5 A;  3VH4 B;  2WXO A;  4CO7 A;  4YTM B;  2OOB B;  3BWU D;  1ZW7 A;  4RF0 A;  2WDR B;  1WJN A;  1N63 A;  2NR2 A;  2MJD A;  5IKC M;  1RFA A;  1NYQ A;  3DBR I;  1KM7 A;  3VDZ A;  3ZNZ B;  3H8H A;  1D5M C;  2JYE A;  1K52 A;  1PGB A;  3IAM 1;  1TKG A;  5DCN A;  4K3C A;  2FBW B;  1FPY A;  5HHD G;  3LMN A;  2BB5 A;  4HRO A;  1NEK B;  3H7P B;  1TS2 A;  1AAR A;  2FIF A;  4XDD A;  2AEH A;  1WX9 A;  1Y8R C;  2LAS A;  2LI5 A;  4TV3 A;  5AZH A;  1N62 A;  2ZW1 A;  2ZPN A;  4KIK B;  1WF9 A;  2JUO A;  2MBB B;  2KAN A;  2MHJ A;  4G3X B;  1YJ1 A;  2BYE A;  4BKG A;  4KIK A;  5H92 C;  1TIF A;  3VUY A;  4FA6 A;  2D5G A;  3GZN I;  3UQA A;  2QC8 A;  4GLS C;  3APF A;  2IGG A;  1GNU A;  1XXG A;  3RNC C;  3OLM D;  1MI0 A;  2KMA A;  4C7Z A;  3DWG C;  4AUQ C;  4NAM A;  2K8H A;  5E6N A;  3ZJT A;  2JRI B;  5BMH A;  2B76 B;  3CF6 E;  3S2A A;  1V81 A;  1WGG A;  4GXB A;  3QWZ B;  3HM3 A;  3ZUN A;  2N9X A;  4F1S A;  3ZQ4 A;  2MEK A;  2B3A A;  4WJQ A;  3EA6 A;  4OZB A;  4G11 A;  3ZIM A;  4WH4 A;  4BZA A;  5JXV A;  3VTU A;  3U2S C;  4IW0 A;  2KVZ A;  3EUB 2;  1LXD A;  3HIZ A;  2Z0D B;  2J4X A;  4DXG A;  2D3G A;  4TUU A;  2Y5P A;  2KX0 A;  1GAQ B;  2WQY B;  2KLG A;  4XWW A;  5AZF A;  4HRS A;  1FNW A;  1J8C A;  2ASQ A;  2JF5 A;  3RMK C;  3WAM A;  5IP4 D;  1FXT B;  1K8R B;  1XF5 L;  3HVD A;  1KLG D;  1LM8 B;  1V5T A;  3VR9 B;  3NVV A;  3NZS A;  4WQO B;  2NBU A;  2G45 B;  1ET6 A;  4MGK E;  1HQR D;  5G5G A;  1YD8 U;  2K6D B;  1JWU D;  3RNB C;  4RGO S;  4IWO A;  2L83 A;  3V6C B;  2BS3 B;  2DWQ A;  1F0Z A;  1K51 A;  2BVC A;  5T8I A;  4ITK A;  1VDV A;  4LDT D;  2A5U A;  4ZHP A;  5FR3 A;  2BKR B;  2K6Q A;  2I1K A;  1ENF A;  4O1N A;  2WXN A;  4LTU A;  1HTO A;  2J0J A;  1WZ0 A;  1UNS A;  4W9H A;  2KWU B;  2WU2 B;  1DGJ A;  4YSZ B;  1PGA A;  4KGR A;  1I7H A;  5D94 A;  2G9H D;  1E6E B;  1Y56 A;  2IY0 B;  2K0P A;  3B9J A;  3DVN U;  4K81 A;  1GUA B;  2KQ4 X;  3ONS A;  3V61 A;  4MGY E;  2AL6 A;  2N1V A;  1ZKH A;  2JU6 X;  1EF5 A;  1Z2M A;  1D5Z C;  4N9F 4;  4EZJ A;  1FNV A;  3BK1 A;  1V80 A;  2KAC A;  3V05 A;  2K39 A;  3Q8E A;  4XYC A;  2HTH A;  3DOW A;  4AP4 C;  2BYT A;  4MT5 A;  3HUI A;  3B2G A;  1JML A;  2K22 A;  1SIF A;  2DYM A;  3QA8 A;  2AL3 A;  3DBR B;  1YMH E;  4RGT A;  2ON8 A;  2MCN B;  3HK0 A;  1FXA A;  3IBE A;  3SR6 A;  4LNO A;  2BBC A;  1LQB A;  1E8X A;  2GI9 A;  3VUW A;  3Q3F A;  4MGI E;  2LVQ A;  1L4D B;  1WRI A;  2YEP F;  2CJN A;  2Y5C A;  4GDK B;  3ZNG C;  4LNF A;  3TSS A;  1XO3 A;  5C2T B;  2LRW A;  3OJ4 B;  4MJS B;  4EUT A;  4YWG G;  4ZHO A;  1ZUD 2;  1RWS A;  1TBE A;  3C19 A;  3VR8 B;  2WXJ A;  3PRM B;  4HVB A;  2PMV A;  3O65 B;  1YJJ A;  3MFG A;  1SJE D;  5BO4 B;  4YXD B;  2L52 A;  3DVG Y;  2GBR A;  3DPD A;  3ZYY X;  1V6E A;  1C1Y B;  2RR9 A;  3GZN B;  2KO3 A;  5E6J A;  5AZG A;  3IHP C;  4DWF A;  1RFK A;  1QKZ A;  1E7U A;  1YN5 A;  3EHV A;  2INP E;  4L2Y A;  2KDE B;  2GB1 A;  5EE1 A;  2N4F A;  1MG4 A;  3BY4 B;  4KZ0 A;  5CHV C;  3AEB B;  5LXI B;  3Q3O C;  2W55 A;  1UGJ A;  2L8J A;  5G2N A;  2Z8L A;  3PT2 B;  3U7D A;  1WMH B;  2GBN A;  4P6V F;  2KTF A;  3B2F A;  5JHB A;  4N6E B;  3CST A;  1EWY C;  2RPV A;  3R7Q A;  2MX2 A;  2QIE B;  2K8C A;  5L95 C;  3L13 A;  2FAZ A;  4FUL A;  2LUE A;  3NG0 A;  2MP2 B;  1P0R A;  4OHJ A;  3RYT A;  2WWZ A;  4FBJ B;  1FMA D;  3VUX A;  2MWS B;  3L08 A;  1OQY A;  2JX5 A;  2QHO A;  3BYY B;  5EE9 A;  3DHH C;  2INN E;  3R7R A;  1WM2 A;  3KUD B;  4MM3 B;  5HG2 A;  2CHX A;  3K9O B;  3MJW A;  4X57 B;  4F8C B;  5MPO A;  2C7M B;  1D5X C;  2BQQ A;  3RCZ A;  2QSD A;  3PRP B;  2M17 A;  1I4P A;  4XX5 A;  1UZX B;  2LJ5 A;  2KWV B;  4MGZ E;  2LGI A;  3DHG C;  3W5U B;  2WX1 A;  4IWP A;  3AE9 B;  3W1S C;  4XE0 A;  1WGR A;  1AWD A;  4RCO A;  1RM6 C;  2N7D A;  3VVW B;  2JZZ A;  3PZD A;  1K53 A;  4FJZ A;  2XN9 C;  2KDF B;  2L76 A;  4HPP A;  3P2B A;  1ISN A;  4LNN A;  4M0W A;  1HEZ E;  4W9D A;  1SF0 A;  4UDU C;  1SIJ A;  3U30 A;  3AU5 A;  3NOB A;  4C56 C;  3ABV B;  2AWT A;  2BW2 A;  3MJ5 A;  4ICU A;  1IUE A;  3APD A;  3AV8 A;  4PT5 A;  4A20 A;  1V49 A;  3PVL A;  2ZJD A;  1ROE A;  4WUR A;  1MHH E;  2XEW A;  3SFD B;  3P4S B;  2IJ0 A;  1KOT A;  2WYQ A;  3NS1 A;  4A6Q A;  5EDS A;  3AE1 B;  1WXQ A;  4KDI C;  1YN3 A;  2K9X A;  2KDI A;  3P4R B;  4ZRQ A;  2ZPY A;  4MH0 E;  3GE3 C;  1WX7 A;  5HKH A;  2WHI A;  4J6I A;  4W9E A;  1C4C A;  4LDT B;  1UH6 A;  3Q2A C;  1ZE3 D;  2NPT A;  2KXJ A;  2K25 A;  3LB8 C;  3R2I A;  1LGR A;  3N30 A;  4MSQ B;  2WXR A;  3UIP B;  1KLV A;  1EUV B;  2V3N A;  3AE6 B;  1IYF A;  4JPS A;  3PRZ A;  1CQV A;  1QIL A;  4KGT A;  2K1F A;  3RN9 C;  2RPQ A;  2KKC A;  4JIO U;  3ZLZ A;  2LUM A;  1W6V A;  3E9S A;  5IAA C;  2J52 A;  1TY2 A;  1KTK A;  3U8Z A;  2BTE A;  1V86 A;  1WXS A;  4JQW C;  1L6U A;  1SE3 A;  2M0A A;  4M02 A;  2O6V D;  2Q5W D;  1YX6 B;  4USA A;  3ZJV A;  2DLB A;  3AEE B;  3A9K A;  3LJ3 A;  2PVO D;  5IA7 A;  2MW5 A;  2KC2 A;  1XQQ A;  1EF1 A;  1J7C A;  1IBX B;  1V1P B;  1N5W A;  1TGZ B;  5JH5 C;  2W3R A;  4BOS C;  3FIL A;  2FCN A;  3V6E B;  1MJD A;  3VFK A;  3IFW B;  4US8 A;  3NVY A;  2EEL A;  1TKY A;  1XLQ A;  1ET9 A;  3PRE A;  4NAW B;  3DCG A;  1OQQ A;  3R8B A;  2FID A;  2K8B A;  1XLN A;  5E6O A;  1E9M A;  1ZP0 B;  3H1U A;  5J18 A;  4HDO A;  1QLB B;  3TBL D;  1CMX B;  1WH3 A;  2KT7 A;  4OZA A;  1A70 A;  3U4E G;  1UBQ A;  1AYF A;  2I1J A;  1IGC A;  1RAX A;  3OG5 A;  2DAF A;  4GB9 A;  3U7Z A;  1UGM A;  2DBY A;  2EMS A;  2LVP A;  4OVZ A;  3Q8A A;  3DBH I;  4KSK C;  4TMA B;  4US9 A;  3TEY A;  1VD2 A;  2WXK A;  5H8Y E;  4OVV A;  3AB5 A;  1EU3 A;  1VLB A;  2J53 A;  1TJE A;  1VZ7 A;  4R3D A;  3EFC A;  3NS8 A;  4A3P A;  1ACC A;  2IO1 B;  1QT9 A;  3W5V B;  2LZ6 A;  3SU8 X;  1YOV B;  4EEW A;  1WI0 A;  4ASW C;  2BPS A;  2L0T A;  2NBW B;  3Q8F A;  1F9J A;  4RM9 A;  2G4D B;  1AW7 A;  1QQR A;  4E71 A;  1L0Y B;  4JLC A;  4HK2 A;  2FCQ A;  2CHZ A;  2R2Q A;  2BGF A;  2HTM E;  3SHQ A;  1V9J A;  3I57 A;  3P63 A;  1QOF A;  5BMI A;  4NZL B;  2RDH A;  3ML8 A;  3H7P A;  4I6L B;  1UEL A;  5TSS A;  3MTN B;  5BYQ A;  1YQ3 B;  1E8W A;  1TYG B;  3KW5 B;  3L0W B;  1PFD A;  4PS8 A;  4RGN A;  4MEM A;  4PK1 A;  4IDI A;  2IYD B;  2X8X X;  3BVM A;  2HE7 A;  3CWI A;  4A90 A;  3VRB B;  1XCQ L;  2MSE D;  3FAH A;  1DOY A;  2PE6 B;  3ECI A;  2BF8 B;  4KKI A;  4ZRJ A;  4AOF A;  4WAF A;  3AU4 A;  3CIR B;  3A1Q B;  3NRZ A;  3N3K B;  2WDV B;  2BYV E;  1D6E C;  1Q10 A;  2R2O A;  4KV2 A;  3MC8 A;  2M19 A;  1F2R I;  3ALB A;  2GRI A;  2WDT B;  2MQJ A;  3GS2 A;  2FCM A;  1T5X D;  2XBB C;  2KOX A;  1JRU A;  4H2A A;  3VAW A;  2D2Q A;  2HD5 B;  3VTV A;  3TEZ A;  3X23 A;  3R66 C;  4A9A A;  1TZ1 A;  3Q6B A;  3TEX A;  3FKY A;  4DK5 A;  4YTN B;  2OJW A;  5EE0 A;  2KN5 A;  3ZW3 A;  3V3X A;  3VTW A;  1SB3 C;  2Z0E B;  3RNA C;  2OJR A;  4HJK A;  4BBN C;  3AED B;  2L7R A;  2WNM A;  3I3T B;  2BKF A;  4XC2 A;  1YN4 A;  1P7E A;  2REX A;  1Z5S B;  1VZ6 A;  2DEN B;  3RNF C;  5D3D A;  3V62 A;  1OGW A;  5DPW A;  4RF1 A;  1TKE A;  2FNJ B;  4JWU C;  1WJ6 A;  4HJG E;  3RUI B;  3SFE B;  2BWE S;  5BYR A;  2HJ8 A;  4FAD A;  4ANU A;  1OTR B;  3ZGZ A;  3AEA B;  3H6N A;  4BKS A;  5JHA A;  2CS4 A;  1SE9 A;  1MFW A;  2GBK A;  1T6B X;  1G6J A;  4EZK A;  2O6V B;  2WDQ B;  3GB1 A;  3BYT B;  3AE4 B;  3ZKJ C;  1C76 A;  1JWB D;  2KAJ A;  1IP9 A;  3KUC B;  2ZCB A;  2KNB A;  3HRD D;  5BMG A;  2KWC A;  2DZK A;  3IT4 B;  3OJ3 A;  4KZC A;  1NBF C;  4C00 A;  1Q1O A;  2W82 A;  3LDZ E;  4II3 B;  2CJO A;  1FO4 A;  3AH7 A;  5IO9 A;  3AE2 B;  1B1Z A;  2MA9 B;  2K3U A;  4MSM B;  2MBO A;  1EU4 A;  1GJZ A;  3L10 B;  4E74 A;  1FM0 D;  3DVN V;  4I6N B;  3DBH B;  1WJU A;  2PE9 A;  3KWV A;  2QJL A;  4FXC A;  1N5X A;  1UBI A;  3J9C A;  2L0F A;  4G0N B;  3PGE A;  3WIM A;  3EGR A;  3KVF B;  4IUM B;  2CU3 A;  3Q3N C;  4REZ A;  3CSF A;  3WCQ A;  3MC0 B;  2GBM A;  1FEH A;  3WAN A;  4BVU C;  2VRR B;  1WGH A;  2IDY A;  4W9C A;  3KQ4 A;  1EM7 A;  4N59 A;  1FCC C;  5C3J B;  4MAC A;  3PSE B;  1V1O A;  2KN4 A;  3IG3 A;  4GDK A;  2BS2 B;  1CK1 A;  3PPA A;  2KFJ A;  2KMC A;  4IM2 A;  4MJS A;  4C4V B;  3N1X C;  3Q3M C;  4KVG B;  4EE2 A;  1KFY B;  3A9J B;  1F2R C;  1QZE A;  1JCK B;  1L2N A;  2ZNV C;  2BWF A;  4GN1 A;  2RSU A;  3RD2 A;  1FFV A;  1WSP A;  2JRH A;  4F7Z A;  1WRD B;  1C79 A;  3QHT A;  5CHW A;  1DOI A;  1SE2 A;  2MBH A;  4WJO A;  1TT5 B;  1TS4 A;  1R4M I;  4PYU A;  1XLO A;  2O2V B;  1OEY A;  2NBV B;  3M63 B;  1HE8 A;  1FXI A;  1U4A A;  4GGQ A;  2XNA C;  2N7J A;  2V0G A;  2KMM A;  5E6P A;  1ESF A;  1RLF A;  1M94 A;  2BT6 A;  1X1M A;  2MJ3 A;  2V4I B;  3R3M A;  1KLU D;  3M95 A;  4AWJ A;  2AQ2 B;  3JSV B;  1E7V A;  2WU5 B;  3QIJ A;  2W54 A;  2A4Z A;  4FN2 A;  4M8N A;  1QOA A;  1DYQ A;  1WMH A;  5LXH A;  1QF6 A;  3PLV A;  1GC7 A;  4C80 A;  2PW9 A;  1L6V A;  2V4L A;  1JQ4 A;  1YJI A;  2WP9 B;  2ZNV B;  3A33 B;  1WGY A;  1QOG A;  2Z59 B;  4NNJ B;  1E8Z A;  2NVU I;  2N9K A;  2MP2 A;  3DBL B;  4K7U A;  1L5P A;  5DPT A;  3AE7 B;  2GLS A;  4WWP A;  1N6Z A;  2M8S A;  2KJR A;  3HVZ A;  2C7H A;  4MM3 A;  1WE6 A;  4HLE A;  1WJ4 A;  1WE7 A;  2ONQ A;  4NQL B;  2SAK A;  3P42 A;  1F52 A;  2J42 A;  1P98 A;  5DPR A;  2CKH B;  2G3Q B;  3WAL A;  2BS4 B;  3NZU A;  4GU2 A;  1I4X A;  5G55 A;  1D3Z A;  4BKT A;  5GXG B;  4EFO A;  2NTT A;  2RMM A;  2KK8 A;  2FCS A;  3H7S A;  2DYB A;  4B0E A;  2K5P A;  2RDG A;  4RGM A;  3OAW A;  2INC C;  2N7E A;  1SEB D;  2LJI A;  2PVG C;  3Q14 C;  1WFY A;  2LHE A;  2X38 A;  1T3Q A;  3I5J C;  3IT6 B;  3T9L A;  1B9R A;  4AJW A;  2KFK B;  3JW0 X;  4LLG M;  4EOY A;  4WWM A;  4YL8 A;  1JRO A;  4KX6 B;  4NJC A;  1WY8 A;  1OFF A;  4IKG A;  3ZVV A;  1S3S G;  3UIO B;  2D3B A;  3QAR A;  4JL9 A;  2ACZ B;  4M8M A;  1I4G A;  3W2D A;  3KYD D;  1KF6 B;  3P4Q B;  3N32 A;  1WXM A;  3HM6 X;  1YX5 B;  3VQI A;  2IGH A;  1MG8 A;  3W1S A;  1XLP A;  4MDK E;  4FJV B;  4S17 A;  2RD0 A;  5KHQ A;  2IND C;  3MC9 A;  2LGD A;  2V3S A;  1T0S C;  2KD0 A;  3NZ3 A;  2NS5 A;  2KQS A;  2MLB A;  2N1W A;  4LNK A;  4W9J A;  4K7S A;  4W9L A;  2N9P C;  3RNE C;  4ZOH C;  3A4S C;  2CU1 A;  2LGY A;  4HEA 1;  4WQM A;  4W9K A;  2J7Q B;  1P9D U;  3RI7 C;  3FC4 A;  3ZDT A;  1R7S A;  3N1Y C;  4GDL B;  3N1Z C;  4A55 A;  1KRH A;  1UF0 A;  2JZP A;  1C9F A;  5HFY A;  3ZRC A;  4ZRI A;  3AMZ A;  3TJP A;  1S1Q B;  4FLH A;  4GOC A;  1IBX A;  4EKU A;  4NPN A;  1V1P A;  3PHX B;  4YSY B;  2BB6 A;  2JVC A;  4CHK A;  3QK0 A;  2QCZ A;  3AEF B;  1FCL A;  2IGD A;  3BVZ A;  1WR6 E;  1R4M B;  2ZVO A;  2QEJ C;  5IN7 A;  4BOZ B;  2EKE C;  1XEE A;  4NAW A;  5C23 A;  2DZJ A;  2LHD A;  4TQ1 A;  4BBN F;  1ZXI A;  4AS1 A;  1HXY D;  2UU7 A;  4JWS C;  1C77 A;  1N60 A;  1YQ4 B;  4KSL C;  2KTR B;  4II2 B;  3PHW B;  4C7Y A;  1V2Y A;  1J7A A;  2RGF A;  2N0S B;  2UYZ B;  3B1L X;  4WWN A;  3PV1 A;  3MHZ A;  2JWZ A;  2LXC A;  3SDL C;  2DZM A;  4NY0 A;  3KYC D;  3BVG A;  1F1H A;  4GIV A;  5DPS A;  3QCA A;  2KJ6 A;  4DQO C;  1HZ6 A;  2XK5 B;  1LFD A;  2LWP A;  1SGH A;  3ZNH B;  1NI3 A;  1BML C;  5CHF A;  1SSN A;  1WM3 A;  4CQN A;  3RT3 B;  2FUG 1;  2PKO A;  3TCA A;  3UQB A;  1Q0W B;  5LLI A;  2H88 B;  4K3B A;  4D2K A;  4OW0 A;  2BYF A;  1WYW B;  2E6X A;  3WAO A;  4LJP B;  4I6P A;  3TUO A;  2WLB A;  2D3A A;  1L0V B;  4LJO B;  4CYE A;  5GMV A;  1IGD A;  2PJH A;  2YVC A;  3IVF A;  3CMM B;  4B0M A;  2ICI A;  3APC A;  4ARC A;  2H89 B;  4ZRK A;  1ZDV A;  1C4A A;  2MJE A;  1QOB A;  2M0X A;  3DVG X;  1DOX A;  1MPE A;  1KJT A;  2JZ3 B;  2LRU A;  2UWQ A;  1JWA D;  4FHJ A;  3B08 A;  4KKJ A;  3V60 A;  3C8Y A;  3BZD B;  4LCD E;  2KJH B;  2WXI A;  1TY0 A;  3MHS D;  4DDI D;  2C60 A;  4YT0 B;  4TQ0 A;  3DHI C;  1FFU A;  1FRD A;  2WXQ A;  2DHZ A;  1NVI D;  4W9I A;  3NHE B;  1T0Q C;  3NJT A;  2EKI A;  3ZNI D;  1XD3 B;  2JT4 B;  2VH1 A;  1H8C A;  3KH0 A;  4BAX A;  2WXH A;  3MP9 A;  3OWE B;  4WAA A;  4PYZ A;  2J0K A;  3A1Q A;  5FR6 A;  4NQK E;  2NMQ A;  1V5O A;  2V3P A;  3EFU A;  3E56 A;  1SE4 A;  1L4Z B;  4HDQ A;  1T0Y A;  4TKN A;  2KYW A;  1PDX A;  4Q2J A;  3ENE A;  4K1R B;  3UGB B;  5L83 A;  4ANX A;  3DBL I;  2MBE A;  4NJ7 A;  3AEG B;  1V8C A;  2FE8 A;  2LMC A;  1BT0 A;  4WJP A;  3RFZ B;  2HJ1 A;  4M00 A;  1FRR A;  4JGH B;  2MBQ A;  3LYY A;  4HPM B;  1C3T A;  4DXA B;  1UWM A;  1I35 A;  2JSV X;  1WX8 A;  1L0X B;  4XZ4 A;  4S0R A;  1FNU A;  2KHW B;  3Q8C A;  4ZDV A;  2VZK D;  1J7B A;  4OVU A;  4B9K A;  3DDC B;  1FIQ A;  3O13 A;  3X0W A;  1C78 A;  3ZXR A;  1JAL A;  4AJY B;  1UWX A;  2LXA A;  2KC1 A;  3LXF A;  4AQ7 A;  1N61 A;  4G50 A;  5J2R A;  1F77 A;  4ZYS A;  1WIA A;  3QX1 A;  3SEB A;  4RM8 A;  1RYJ A;  4OZC A;  5EE3 A;  3U52 E;  1JW9 D;  3UF8 A;  3BK2 A;  3A4R A;  1KH0 A;  1E8Y A;  2N9E B;  4DDG D;  4URK A;  5G5H A;  3QAQ A;  4DHZ B;  2WS3 B;  1WR1 A;  1GOZ A;  1GC6 A;  3L4P A;  2WXG A;  4BFR A;  2I2Y A;  4DHJ D;  1VR9 A;  1MVK A;  2KZR A;  3AI5 A;  2AX5 A;  4B95 A;  2OED A;  1VCB A;  3T3O A;  3B0A A;  2PPH A;  2CR5 A;  2AQ3 B;  4MH8 A;  2ZZP B;  1UD7 A;  3AN1 A;  2O6V A;  5IOI A;  4RFB A;  4NJ6 A;  3PO0 A;  5J17 A;  2KX3 A;  1TS5 A;  3Q8B A;  2IO0 B;  4N58 A;  1OEY J;  2QIL A;  3NUH B;  1PGX A;  3H9D A;  4DHZ E;  1L7Y A;  1VZ8 A;  1R4N B;  2D11 A;  3ZO5 B;  1T0R C;  1E0Z A;  5D3I B;  2M4N A;  3L54 A;  1PQS A;  1YIW A;  3QJZ A;  2E3T A;  2L05 A;  4GMV A;  3BIN A;  3Q69 A;  1GG3 A;  1I4R A;  1ZPS A;  3AE5 B;  5D7G A;  3Q3J A;  4WIP A;  4MEL A;  1PUT A;  1V97 A;  2JXX A;  3PZ7 A;  3UI3 A;  3W1Y A;  3ZTD A;  2QDF A;  2J0M A;  2JWU A;  2GMI C;  2IO2 B;  1NDD A;  2GBJ A;  4C4V A;  4ANV A;  1CZP A;  4HCP B;  1STE A;  4K7W A;  2IZV B;  1WYG A;  4XWT A;  3URY A;  1GB4 A;  1GPX A;  3A9J A;  3VHT C;  3T3N A;  2DYO A;  1WGK A;  5TR5 A;  5FKA C;  5C1Z A;  2JYT A;  4FHK A;  1NEN B;  2L1A A;  4HPL B;  2CHW A;  2TSS A;  4HCN B;  4L1B A;  2C5L C;  3GE8 C;  2PLP A;  3K9P B;  1CJE A;  2KVR A;  2O2V A;  3JYU A;  3EEC A;  4WJN A;  3TL5 A;  3PTF C;  4W9G A;  5I4D A;  4J3O D;  1WXA A;  1J0G A;  1ZDX A;  4IM0 A;  2D3C A;  3IXS A;  2Y3A A; 
#chains in the Genus database with same CATH homology
 4HK2 A;  2FCQ A;  3L16 A;  3DBS A;  3JSV A;  2CHZ A;  2KD0 A;  2R2Q A;  2NS5 A;  3ZRF A;  2BGF A;  2KQS A;  4RMA A;  2MLB A;  3SHQ A;  2N1W A;  1V9J A;  4IM3 A;  5JZE B;  4W9J A;  3DQV A;  4LDT D;  2A5U A;  4K7S A;  4W9L A;  2N9P C;  2FUH B;  2BKR B;  2K6Q A;  2I1K A;  3A4S C;  2CU1 A;  2LGY A;  3ML8 A;  2KQ7 A;  3H7P A;  4I6L B;  2Y5B B;  1UEL A;  2W9N A;  2J0J A;  4W9K A;  2J7Q B;  3MTN B;  4WWO A;  1WZ0 A;  3EC8 A;  4W9H A;  2KWU B;  1P9D U;  3PLU A;  1H4R A;  1E8W A;  4B95 A;  4IC7 B;  3KW5 B;  3L0W B;  2LGX A;  3ZDT A;  4GDL B;  4PS8 A;  5D94 A;  2DAJ A;  4MEM A;  2IY0 B;  2IYD B;  3DVN U;  4K81 A;  3ZRC A;  1GUA B;  2V1Y A;  2HE7 A;  4ZRI A;  3ONS A;  2JPH A;  3V61 A;  4MGY E;  2AL6 A;  4EZL A;  2NCN A;  3TJP A;  2MSE D;  2N1V A;  1ZKH A;  4IWQ A;  2PE6 B;  3ECI A;  1EF5 A;  2BF8 B;  1Z2M A;  1S1Q B;  4ZRJ A;  1Q5W B;  3L17 A;  4FLH A;  4GOC A;  4AOF A;  4N9F 4;  4EKU A;  4NPN A;  4EZJ A;  3AU4 A;  3PHX B;  3PS6 A;  3KUZ A;  1V80 A;  3GOE A;  2JVC A;  3A1Q B;  2K39 A;  4CHK A;  3QK0 A;  3V6C B;  3D32 A;  3M62 B;  3N3K B;  3ZTC A;  2HTH A;  3DOW A;  2BYV E;  4AP4 C;  1WR6 E;  3C0R B;  1NI2 A;  2ZVO A;  2R2O A;  4KV2 A;  4BOZ B;  2DX5 B;  2EKE C;  3AXC A;  3VH3 B;  1SIF A;  2DYM A;  4NAW A;  5C23 A;  3ALB A;  3QA8 A;  1RRB A;  2DZJ A;  2AL3 A;  4TQ1 A;  4BBN F;  2WDT B;  2MQJ A;  2G4S A;  3HK0 A;  2MCN B;  4KSL C;  4HWI B;  2KTR B;  4II2 B;  2M1M A;  3IBE A;  3PHW B;  1J19 A;  1V2Y A;  2FCM A;  1LQB A;  2RGF A;  1E8X A;  2UYZ B;  2XBB C;  3B1L X;  3Q3F A;  4WWN A;  2KOX A;  4MGI E;  3VUW A;  1JRU A;  3PV1 A;  2JWZ A;  2LVQ A;  2LXC A;  3SDL C;  2DZM A;  4GDK B;  2D2Q A;  3VAW A;  3ZNG C;  5AEK B;  4NY0 A;  1WGD A;  2HD5 B;  1WXV A;  2L00 B;  4HXD A;  4KDL B;  4M0W B;  1A5R A;  3VTV A;  3KYC D;  2LRW A;  3OJ4 B;  2KFK A;  1TTN A;  4MJS B;  4GIV A;  4DBG A;  4EUT A;  3X23 A;  3T8M A;  3R66 C;  1TZ1 A;  1TBE A;  4DK5 A;  5DPS A;  3RZF A;  3QCA A;  3QC8 B;  2KJ6 A;  3M3J A;  3PRM B;  4HVB A;  2XK5 B;  3O65 B;  1LFD A;  2LWP A;  5KHO A;  4FJY A;  1SGH A;  2KN5 A;  3ZNH B;  2ZEQ A;  5CHF A;  3ZW3 A;  5BO4 B;  1WM3 A;  2ZCC A;  3RT3 B;  3VTW A;  3DVG Y;  3TCA A;  2GBR A;  3DPD A;  3UQB A;  1Q0W B;  5LLI A;  2Z0E B;  1V6E A;  3WA0 A;  2OJR A;  1C1Y B;  4HJK A;  2BYF A;  1WYW B;  2RR9 A;  2KO3 A;  5AZG A;  4BBN C;  3IHP C;  3WAO A;  4DWF A;  2L7R A;  1E7U A;  4LJP B;  4E3C A;  3I3T B;  4I6P A;  3EHV A;  2BKF A;  4XC2 A;  5D2M B;  2WX0 A;  2KDE B;  4GSW A;  2KLC A;  4LJO B;  4CYE A;  2N4F A;  5GMV A;  2LVO A;  2REX A;  2PJH A;  2YVC A;  1Z5S B;  3BY4 B;  3IVF A;  4KZ0 A;  2L3Z A;  5CHV C;  2DEN B;  2NPT B;  4DHJ B;  3V62 A;  5LXI B;  3WAP A;  1OGW A;  5DPW A;  3CMM B;  3APC A;  2FNJ B;  2KDB A;  1WJ6 A;  2L8J A;  4ANW A;  5G2N A;  5JHA A;  4ZRK A;  3RUI B;  3PT2 B;  3U7D A;  1WMH B;  2C9W B;  2BWE S;  2GBN A;  2HJ8 A;  2KTF A;  2M0X A;  5JHB A;  4FAD A;  3DVG X;  4P7I A;  4ANU A;  1OTR B;  2GOW A;  1KJT A;  1P3Q U;  2JZ3 B;  2LRU A;  2UWQ A;  3CST A;  3H6N A;  4BKS A;  3ZDM C;  4FHJ A;  4A3O A;  3B08 A;  3TMP B;  2DZI A;  2CS4 A;  3V60 A;  1P1A A;  3R7Q A;  1SE9 A;  2AYO B;  2GBK A;  2MX2 A;  4GDL A;  4ICV A;  4LCD E;  5CX3 A;  3UIN B;  2K8C A;  2KJH B;  4EZK A;  2O6V B;  1G6J A;  5L95 C;  2FAZ A;  3L13 A;  4FUL A;  2LUE A;  3JVZ X;  1E5W A;  3ZKJ C;  4BKS D;  2MP2 B;  1P0R A;  1IP9 A;  3MHS D;  4DDI D;  2C60 A;  3RYT A;  3KUC B;  2WWZ A;  1EO6 A;  2ZCB A;  4IG7 B;  4TQ0 A;  2KNB A;  4FBJ B;  2DHZ A;  2KWC A;  2DZK A;  1IPG A;  4W9F A;  4PS3 A;  3OJ3 A;  4KZC A;  4W9I A;  2IY1 B;  1NBF C;  3VUX A;  3NHE B;  1Q1O A;  2MRP A;  2MWS B;  3LDZ E;  3L08 A;  4II3 B;  4B6W A;  2ZVN A;  3ZNI D;  1OQY A;  2QHO A;  1XD3 B;  2JT4 B;  3AUL A;  3A9K B;  2MA9 B;  2YLM A;  1H8C A;  3KH0 A;  4MSM B;  2IO3 B;  2MBO A;  3R7R A;  1WM2 A;  1WZ3 A;  4WAA A;  3KUD B;  1GJZ A;  3L10 B;  3RUL A;  4E74 A;  3DVN V;  4PYZ A;  4I6N B;  5CTR C;  2J0K A;  3A1Q A;  3HHM A;  1WJU A;  2CHX A;  2PE9 A;  3K9O B;  5FR6 A;  3MJW A;  4X57 B;  4F8C B;  1XT9 B;  2PEA A;  4NQK E;  1UBI A;  2L0F A;  2C7M B;  4G0N B;  3PGE A;  2D07 B;  3RCZ A;  1V5O A;  3WIM A;  3EFU A;  3PRP B;  2M17 A;  3KVF B;  4ZYN A;  4XX5 A;  4IUM B;  1UZX B;  4HDQ A;  1T0Y A;  2LJ5 A;  2KWV B;  4MGZ E;  4TKN A;  2WX1 A;  3ENE A;  4K1R B;  3CSF A;  3UGB B;  4IWP A;  5L83 A;  3W1S C;  4ANX A;  2GBM A;  1WGR A;  3DBL I;  2MBE A;  4NJ7 A;  3WAN A;  2LD9 A;  2D10 A;  3SD5 A;  2KTR A;  3QQ8 B;  4PS7 A;  4BVU C;  2N7D A;  3VVW B;  1BT0 A;  2VRR B;  5D6J B;  1I42 A;  1E90 A;  4WJP A;  1WGH A;  2JZZ A;  4W9C A;  3PZD A;  4FJZ A;  2MBQ A;  4JGH B;  2KDF B;  2L76 A;  3PSE B;  4HPM B;  3P2B A;  1C3T A;  4DXA B;  1I35 A;  1ZGU B;  1ISN A;  1WX8 A;  3IG3 A;  4GDK A;  3PPA A;  4XZ4 A;  4W9D A;  3TIX A;  2KFJ A;  4ZDV A;  2KHW B;  2KMC A;  1R4N I;  4IM2 A;  3ML9 A;  4MJS A;  3VXW A;  1YQB A;  2IBI B;  3U30 A;  3AU5 A;  3NOB A;  2AWT A;  4KVG B;  4OVU A;  2JY6 A;  4B9K A;  3A9J B;  4ICU A;  1QZE A;  3DDC B;  1L2N A;  2ZNV C;  2BWF A;  2XK5 A;  3APD A;  2RSU A;  2C7N B;  4GN1 A;  3RZW C;  3X0W A;  3RD2 A;  2EMT A;  3VH4 B;  3NY5 A;  4CO7 A;  2JRH A;  4AJY B;  4A20 A;  1V49 A;  3PVL A;  4F7Z A;  2ZJD A;  2OOB B;  1WRD B;  3QHT A;  5CHW A;  2LXA A;  1ZW7 A;  2KC1 A;  2MBH A;  4WJO A;  2XEW A;  1R4M I;  1KOT A;  1WJN A;  4G50 A;  2WYQ A;  5J2R A;  4PYU A;  1WIA A;  3QX1 A;  2O2V B;  2NR2 A;  4RM8 A;  5EDS A;  1OEY A;  2NBV B;  1RFA A;  4KDI C;  2KDI A;  3M63 B;  3DBR I;  2ZPY A;  1U4A A;  1HE8 A;  4MH0 E;  3UF8 A;  1KM7 A;  4GGQ A;  3VDZ A;  3ZNZ B;  1WX7 A;  5HKH A;  5E6P A;  1RLF A;  1M94 A;  4J6I A;  1X1M A;  4W9E A;  3A4R A;  3R3M A;  3M95 A;  4AWJ A;  4LDT B;  1UH6 A;  3JSV B;  1E8Y A;  1E7V A;  2N9E B;  2NPT A;  3QIJ A;  4DDG D;  4URK A;  2KXJ A;  3QAQ A;  4DHZ B;  2K25 A;  5DCN A;  3N30 A;  2A4Z A;  4FN2 A;  4MSQ B;  1WR1 A;  4M8N A;  3UIP B;  1KLV A;  1GC6 A;  1EUV B;  1IYF A;  4BFR A;  1WMH A;  5LXH A;  3PRZ A;  4DHJ D;  3LMN A;  3PLV A;  3H7P B;  2K1F A;  1AAR A;  1GC7 A;  2FIF A;  2KZR A;  3AI5 A;  2AEH A;  2RPQ A;  1VCB A;  1WX9 A;  2KKC A;  2V4L A;  1Y8R C;  3B0A A;  4JIO U;  3ZLZ A;  2LAS A;  2PPH A;  2LI5 A;  2CR5 A;  1W6V A;  5IAA C;  2ZNV B;  3A33 B;  4TV3 A;  5AZH A;  1WGY A;  2Z59 B;  2ZZP B;  4NNJ B;  1UD7 A;  1E8Z A;  2O6V A;  2NVU I;  2ZPN A;  4KIK B;  3U8Z A;  1WF9 A;  2JUO A;  2MBB B;  2KAN A;  2MP2 A;  1V86 A;  1WXS A;  4JQW C;  4G3X B;  4K7U A;  2BYE A;  1YJ1 A;  4NJ6 A;  4BKG A;  4KIK A;  5DPT A;  5J17 A;  3VUY A;  2O6V D;  4FA6 A;  2KX3 A;  3GZN I;  3UQA A;  1YX6 B;  4WWP A;  2M8S A;  2IO0 B;  2KJR A;  3APF A;  1GNU A;  1OEY J;  2C7H A;  3A9K A;  3LJ3 A;  5IA7 A;  2MW5 A;  2KC2 A;  3H9D A;  4DHZ E;  1L7Y A;  3OLM D;  1XQQ A;  1EF1 A;  2KMA A;  4MM3 A;  1WE6 A;  4HLE A;  1TGZ B;  1WJ4 A;  2D11 A;  4AUQ C;  1WE7 A;  3ZO5 B;  5JH5 C;  2K8H A;  5E6N A;  4NQL B;  4BOS C;  2M4N A;  2JRI B;  2FCN A;  3L54 A;  1PQS A;  3V6E B;  1YIW A;  3CF6 E;  3QJZ A;  3S2A A;  1V81 A;  1WGG A;  4GXB A;  3QWZ B;  3VFK A;  3IFW B;  3HM3 A;  1P98 A;  5DPR A;  2L05 A;  4GMV A;  2CKH B;  3ZUN A;  2N9X A;  2G3Q B;  3WAL A;  3NZU A;  3BIN A;  4F1S A;  1GG3 A;  4GU2 A;  3PRE A;  3TL5 A;  5D7G A;  4NAW B;  5G55 A;  3DCG A;  3Q3J A;  2B3A A;  4WJQ A;  1D3Z A;  4BKT A;  4G11 A;  3ZIM A;  2FID A;  4EFO A;  2K8B A;  4MEL A;  5E6O A;  5J18 A;  3H1U A;  2KK8 A;  4HDO A;  3TBL D;  1CMX B;  1WH3 A;  3VTU A;  2FCS A;  2JXX A;  3H7S A;  2DYB A;  4IW0 A;  3OAW A;  2N7E A;  1UBQ A;  3W1Y A;  3ZTD A;  2J0M A;  2I1J A;  1LXD A;  1RAX A;  2GMI C;  2IO2 B;  3HIZ A;  2Z0D B;  1WFY A;  3T9L A;  1NDD A;  2DAF A;  4GB9 A;  2GBJ A;  2D3G A;  4TUU A;  4AJW A;  4ANV A;  4HCP B;  2KFK B;  3JW0 X;  1UGM A;  4K7W A;  2IZV B;  2EMS A;  2LVP A;  4EOY A;  2KX0 A;  3A9J A;  3VHT C;  2DYO A;  5TR5 A;  5C1Z A;  2KLG A;  4FHK A;  4YL8 A;  5AZF A;  3DBH I;  1WY8 A;  4KSK C;  1VD2 A;  4HPL B;  2CHW A;  4OVV A;  3ZVV A;  4HCN B;  1J8C A;  2ASQ A;  2C5L C;  2JF5 A;  1S3S G;  3UIO B;  3WAM A;  1FXT B;  3NS8 A;  1K8R B;  3QAR A;  4A3P A;  4JL9 A;  2IO1 B;  3K9P B;  2LZ6 A;  3SU8 X;  4M8M A;  2KVR A;  2O2V A;  3JYU A;  3KYD D;  1LM8 B;  3EEC A;  4EEW A;  1WI0 A;  4ASW C;  2BPS A;  1V5T A;  3N32 A;  1WXM A;  2L0T A;  3PTF C;  3HM6 X;  4W9G A;  1YX5 B;  3NZS A;  4WJN A;  2NBW B;  4WQO B;  3VQI A;  1WXA A;  1MG8 A;  2NBU A;  1F9J A;  4RM9 A;  2G45 B;  2G4D B;  4MDK E;  3W1S A;  1J0G A;  4IM0 A;  4MGK E;  4FJV B;  2RD0 A;  5KHQ A;  1YD8 U;  2K6D B;  4E71 A;  4IWO A;  4JLC A;  2LGD A;  2V3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...