4MELA

Crystal structure of the human usp11 dusp-ubl domains
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
LPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4melA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4melA01
2IO1B 2KN5A 4WJQA 4B95A 2LRWA 4EKUA 1WX7A 2IO2B 3UIPB 1WJ6A 2BKFA 2IBIB 1E8ZA 2YVCA 3V62A 2MW5A 1IP9A 1RAXA 4AWJA 2N9XA 3OJ4B 1OGWA 3QX1A 2MWSB 2J0KA 1UBQA 3WAPA 1WF9A 2K25A 2KLCA 4PS3A 3U8ZA 3PZDA 1YJ1A 2V1YA 2LVPA 2MBBB 1WJUA 2PEAA 1E8WA 1QZEA 2KX3A 3QK0A 2CR5A 4FJVB 1WI0A 4EZKA 3DQVA 4KZCA 1F9JA 2G4SA 4LDTB 4KDIC 1J0GA 2M17A 1OEYJ 2C7NB 2NPTB 3HM6X 3NZSA 5JHAA 4EUTA 2DYMA 1Q1OA 1P9DU 1JRUA 2FCMA 2N9PC 4NAWB 1HE8A 3MJWA 1S3SG 3CSTA 4OVUA 3EFUA 2KWCA 3ECIA 1GG3A 2N7DA 2IO0B 2MSED 3AU5A 3PPAA 2Z59B 2R2QA 5KHQA 2LWPA 4CO7A 2PE9A 4BBNC 5G55A 2J0MA 1V49A 1P3QU 1VD2A 1Z5SB 2GBJA 4KIKB 2KTFA 3PLUA 4XC2A 3RULA 2M0XA 3Q3JA 4NQKE 4TQ1A 4W9FA 3BY4B 2EMTA 4E3CA 3O65B 2AWTA 1WJ4A 2FCNA 2JPHA 3ZDMC 4PS8A 1WGHA 2O6VB 1Y8RC 5LLIA 4FULA 3IBEA 2DX5B 1WGDA 4N9F4 1ISNA 5D94A 2CKHB 3VTWA 3APCA 2KANA 3H9DA 4IG7B 3VH4B 3DBRI 1UZXB 3UIOB 3ZLZA 3A9JA 1P1AA 2Y5BB 2ZVOA 1R4MI 1WGGA 3VQIA 2EKEC 1H4RA 1V80A 3B1LX 2N9EB 2GBKA 3MTNB 4I6PA 1X1MA 3N32A 4LJPB 4BOSC 3RD2A 2OOBB 3QAQA 4HPMB 3D32A 2JVCA 1E7VA 3VHTC 2REXA 1TTNA 3R7RA 3VDZA 1E8XA 4NQLB 1OEYA 1T0YA 1YX5B 3PSEB 5HKHA 4URKA 3H6NA 1E90A 1WY8A 2MBHA 2CHZA 2FUHB 3PRPB 3A9KB 4NAWA 3ZW3A 2C5LC 2MRPA 4OVVA 2VRRB 3W1YA 3WALA 4HDOA 2KMAA 5DPWA 2GBRA 4IW0A 1E5WA 1FXTB 3PTFC 5CX3A 3RYTA 1V86A 2DZIA 3ZNZB 2FNJB 3GOEA 3PHXB 1EF1A 2R2OA 3QCAA 2DYBA 4P7IA 4TUUA 5GMVA 1MG8A 1L7YA 2I1JA 2LGYA 2KTRA 2MP2A 5JHBA 4PYZA 2PPHA 2ZJDA 1TBEA 2NR2A 2KK8A 4KDLB 1TZ1A 1EUVB 3PHWB 2KJHB 3KYDD 1XT9B 3ML8A 3ZUNA 4FBJB 2KKCA 3M62B 2O6VA 3CSFA 1LXDA 1SE9A 4FJYA 3R3MA 4A3OA 1WIAA 4ZRJA 3RUIB 4DHJD 2RPQA 1WXSA 2FCSA 1V81A 4HXDA 4W9JA 4ZRIA 4HJKA 1S1QB 3VTVA 3WANA 1GC6A 1YQBA 3PVLA 3HHMA 3PRZA 2LZ6A 1WRDB 2DAFA 3DOWA 4RM9A 4I6LB 1WXMA 4FLHA 4KSKC 4MEMA 2FIDA 2LUEA 4FHKA 4M8MA 2BWFA 4BKTA 3CF6E 2KC2A 3A4RA 2ZCBA 3ZO5B 2A4ZA 1YD8U 2MBOA 3ZNHB 2UYZB 5AZGA 1V2YA 3UGBB 1I35A 3A9KA 2G45B 3KH0A 3ML9A 2MBQA 4ZRKA 3RZFA 2LI5A 3H1UA 3VTUA 3ZVVA 2KOXA 3A1QB 2G4DB 2CS4A 1OTRB 1UD7A 2AL6A 4WJOA 1V5TA 4BBNF 2KMCA 2WX1A 2KVRA 4NJ7A 2L00B 2L0FA 4PYUA 5C23A 2GMIC 3RT3B 4MDKE 2JRHA 3QA8A 2KNBA 3TBLD 4LDTD 4ANWA 1BT0A 2XK5B 4GSWA 3VFKA 4KZ0A 2JUOA 4W9HA 3QWZB 2LGXA 1WJNA 2N4FA 2QHOA 1RFAA 5J17A 3PT2B 4LJOB 3HK0A 4B9KA 4M8NA 3PS6A 4GDKB 4X57B 5JZEB 5JH5C 1A5RA 2ZVNA 3ENEA 1WFYA 2D07B 3B08A 3NZUA 2ZZPB 2L0TA 4GDLB 3SDLC 1WMHB 3X23A 4MGYE 2LVOA 2DENB 3H7PB 2WDTB 4GXBA 3QARA 1ZGUB 4IM0A 1P98A 2KZRA 2LD9A 4GOCA 4WWNA 4IM3A 3DBSA 4FADA 2D10A 4M0WB 3IFWB 5L95C 3TCAA 2KWVB 3T8MA 5IA7A 3DVNU 4E74A 1WE6A 3M63B 1Z2MA 3U30A 5AZFA 1J8CA 3OJ3A 2HTHA 2JY6A 2D2QA 2HE7A 4K81A 1EF5A 3TIXA 4EZLA 2O6VD 4KVGB 2KHWB 1WH3A 2IY0B 2O2VB 1GC7A 4W9KA 5TR5A 2KLGA 2KXJA 2BYVE 2DZKA 3EC8A 4IC7B 2M4NA 3VUWA 2J7QB 1E8YA 1OQYA 2K6QA 2JT4B 3ZDTA 2BPSA 4BVUC 4K7UA 3JVZX 4HWIB 3VUYA 1IYFA 3LMNA 3L10B 3L08A 3QJZA 2LRUA 3TMPB 1WX8A 2L7RA 1WXVA 2MQJA 1LQBA 2NVUI 2KFJA 2K39A 4W9GA 3DDCB 3V6CB 4EFOA 4GU2A 1WGRA 4ZYNA 2NCNA 1U4AA 2OJRA 3HIZA 4GN1A 4WWOA 5CHVC 3ZRFA 1GUAB 2PE6B 1Q5WB 4MSMB 1KJTA 3K9OB 4JIOU 4JL9A 4NY0A 2N7EA 2NPTA 2K8HA 4XZ4A 5LXIB 3JSVB 3QC8B 2GBMA 3ZRCA 4F1SA 4WJPA 4GDKA 2BYFA 4DBGA 4HK2A 2L8JA 4HCPB 4W9LA 1XQQA 3EHVA 2JZZA 1WR6E 3KVFB 3APDA 2UWQA 3N30A 4W9IA 3V61A 1WMHA 4GMVA 3AULA 1E7UA 3JYUA 3W1SA 4IWPA 3IG3A 5IAAC 3UQAA 4KIKA 3K9PB 4G11A 2LJ5A 1R4NI 2MCNB 2ZNVC 4TV3A 4MELA 5D7GA 3C0RB 3WA0A 4G0NB 3S2AA 3A33B 3TL5A 5KHOA 5EDSA 3SD5A 4CYEA 5CHWA 2W9NA 4F8CB 1IPGA 2DYOA 4AJYB 1GJZA 3PREA 2KJ6A 1CMXB 2DHZA 2HJ8A 3AI5A 4YL8A 3DBLI 4AUQC 1UBIA 2NBWB 5J2RA 1PQSA 4IM2A 5FR6A 5LXHA 1ZW7A 2YLMA 4DK5A 3DBHI 1W6VA 2V4LA 3ZKJC 4ANUA 2ZPNA 5AEKB 1V5OA 2EMSA 4HPLB 4EEWA 4BKSD 2LGDA 2NBVB 4F7ZA 3NY5A 4ANVA 5DPSA 2RD0A 3A4SC 5D2MB 3U7DA 3VH3B 1LFDA 4I6NB 4K1RB 3QQ8B 2XBBC 2C60A 3DVNV 4RM8A 3L0WB 4II3B 3M3JA 2RGFA 3NHEB 2PJHA 5E6NA 1WM3A 3R66C 3ALBA 4ICVA 4HCNB 2BGFA 4DHZE 2MLBA 4K7WA 3UQBA 1UGMA 3UINB 3RZWC 4WWPA 2JWZA 4NNJB 3CMMB 4ANXA 5D6JB 3DCGA 2MA9B 5CHFA 2FAZA 4A20A 1WM2A 3RCZA 2FCQA 2CU1A 2HD5B 4ZDVA 1TGZB 5C1ZA 4B6WA 1WZ3A 1AARA 3A9JB 2GOWA 1V9JA 2WX0A 2M1MA 3KUDB 3L54A 2AEHA 2IO3B 3APFA 1C1YB 2RSUA 3DVGX 2WYQA 4CHKA 2BWES 2N1VA 4KV2A 2KWUB 1M94A 2ASQA 4AOFA 4MM3A 2K8BA 4DXAB 3T9LA 1C3TA 1SIFA 2CHWA 2KJRA 3PRMB 1WYWB 4XX5A 5E6PA 2NBUA 2J0JA 2M8SA 2KQSA 4JGHB 4GB9A 1WR1A 4IUMB 1RRBA 3Q3FA 4G3XB 2JZ3B 2MBEA 5CTRC 3NOBA 4BKSA 2BYEA 1H8CA 2AL3A 4IWQA 2Z0EB 3LDZE 3GZNI 1YX6B 4J6IA 3SU8X 2FIFA 2RR9A 2IYDB 4MGIE 4BFRA 4II2B 3KW5B 2KO3A 1KOTA 2KQ7A 2KTRB 2L05A 2MP2B 1NBFC 2JF5A 3PGEA 4AJWA 3HM3A 2CHXA 3W1SC 4TQ0A 1LM8B 4HDQA 4GGQA 4W9DA 5J18A 3L17A 2KX0A 2Z0DB 4KSLC 1ZKHA 1WE7A 4MH0E 4FHJA 1WXAA 4DDID 3A1QA 3V60A 4GIVA 3AU4A 4ASWC 3IHPC 3QIJA 5E6OA 1KM7A 2ZEQA 4PS7A 2JXXA 1EO6A 3KUZA 4WQOB 3WAOA 2KFKB 3KYCD 4MGZE 4MJSB 1G6JA 1RLFA 3ZNGC 4WAAA 2IY1B 3I3TB 4ICUA 2KD0A 2XK5A 1XD3B 5DCNA 1SGHA 5BO4B 1I42A 4DDGD 2C7MB 4BOZB 3L13A 2K8CA 2DZMA 1NDDA 4E71A 1VCBA 3WIMA 3KUCB 1KLVA 2KDEB 4DHZB 3VVWB 1WGYA 4GDLA 3ZTDA 4G50A 3X0WA 4A3PA 3TJPA 1J19A 3VAWA 1Q0WB 2C7HA 2ZNVB 3H7PA 4K7SA 3V6EB 2KC1A 1D3ZA 3LJ3A 3R7QA 3QHTA 1YIWA 2V3SA 2LVQA 3DVGY 2BKRB 2IZVB 1NI2A 4FJZA 3N3KB 3MHSD 2BF8B 2GBNA 2WWZA 4NPNA 3P2BA 2A5UA 3M95A 2I1KA 2DAJA 3JW0X 3WAMA 3ZTCA 3ZIMA 3OAWA 5L83A 1L2NA 2DZJA 3NS8A 3EECA 2KDBA 5AZHA 4LCDE 2C9WB 3VXWA 3OLMD 2O2VA 1V6EA 2KDIA 4HLEA 3DPDA 2G3QB 1WX9A 2JRIB 4W9EA 4W9CA 2AYOB 2MX2A 2KDFB 2XEWA 3L16A 2K1FA 1K8RB 2L76A 3VUXA 3PLVA 4DWFA 4HVBA 4FN2A 5DPRA 4IWOA 4NJ6A 2ZCCA 2L3ZA 1WZ0A 4RMAA 5G2NA 4JLCA 3SHQA 2K6DB 4BKGA 1P0RA 1UELA 4MGKE 4FA6A 2ZPYA 3B0AA 3ONSA 4JQWC 5DPTA 4EOYA 1UH6A 2KFKA 2NS5A 4MJSA 3UF8A 4DHJB 3H7SA 2LXCA 2D3GA 2LXAA 3JSVA 1GNUA 3BINA 2D11A 4TKNA 2N1WA 3AXCA 3IVFA 2B3AA 4WJNA 3ZNID 4AP4C 3PV1A 4MSQB 4EZJA 2LASA
chains in the Genus database with same CATH superfamily
1FRRA 4B95A 2LRWA 3TEYA 1WX7A 3I57A 2MJEA 2IBIB 1E8ZA 1IP9A 4AWJA 1PGXA 2MH7A 2MWSB 3AM9A 1UBQA 2I38A 4OZCA 2KLCA 1SF0A 2DBYA 3AEGB 1E8WA 1RYJA 2AX5A 3DQVA 3BK1A 1F1HA 1T0SC 2DLBA 3TEZA 1XCQL 3DBRB 2VZKD 3NZSA 4EUTA 3KWVA 4NAWB 1HE8A 1YOVB 1C9FA 3ECIA 1EU4A 2MSED 3AU5A 5KHQA 2WNMA 5G55A 2J0MA 1V49A 2GBJA 3P63A 5E6JA 2KTFA 1TIFA 1FCLA 1E9MA 2N9KA 1RWSA 3RULA 4NQKE 4W9FA 3BY4B 1IGCA 3O13A 1ESFA 1L6VA 2K22A 2JPHA 3ZDMC 1TS3A 1Y8RC 3E9SA 4FULA 3IBEA 1YQ4B 1ISNA 3H9DA 1JCKB 4IG7B 2KT7A 3RNBC 1ZUD2 1P1AA 2ZVOA 1FFUA 1H4RA 1SSNA 3EGRA 2N9EB 4BOSC 3RD2A 2E3TA 1D5XC 3R7RA 1YX5B 5FKAC 4URKA 3EA6A 4WWMA 2MBHA 1N5XA 1YMHE 3A9KB 4TSSA 2GBRA 2QMTA 4IW0A 3I9V1 3RYTA 2DZIA 2FNJB 5IN7A 1EF1A 2R2OA 3AE3B 4L2YA 5C2TB 4YTMB 2KTRA 2KYWA 3W5VB 2ZW1A 2NR2A 1EUVB 5G5GA 3P42A 2HDEA 3ZUNA 2KKCA 3FAHA 3M62B 2O6VA 3Q8BA 1LXDA 1J7CA 4OZBA 4A3OA 1WIAA 3L4PA 2FCSA 4ZRIA 3VTVA 4P1BC 2PMVA 1YQBA 3PVLA 3HHMA 2D5GA 4O1NA 1CZPA 3PRZA 3E56A 1F77A 4FLHA 3ZXVA 1MHHE 2LUEA 3V05A 3CF6E 1FNVA 1QT9A 1D4BA 2LUMA 3AB5A 3NG0A 4YSYB 3W9CB 1ZP0B 3UGBB 3KH0A 3RZFA 2MBQA 2KOXA 3BIID 1GAQB 3A1QB 1UD7A 1IGDA 4PYUA 5C23A 2GMIC 4MDKE 2JRHA 1OQQA 1K52A 2J53A 1BT0A 2JUOA 4W9HA 3QWZB 2QHOA 2N4FA 4B9KA 4M8NA 2D07B 3AEDB 2ZZPB 3SFEB 3SDLC 1XXGA 3VRBB 4MGYE 3N1YC 2D3BA 2WDTB 3QARA 4KGTA 2LD9A 4GOCA 3DBSA 2D10A 1B9RA 3MFGA 4E74A 1JRPA 2KWDA 3OJ3A 2WXFA 2JY6A 2D2QA 4K81A 1EF5A 1GB4A 1WH3A 4ACFA 2IY0B 3PZ8A 1V8CA 1R4NB 2KXJA 4IC7B 2I2YA 3HVDA 2K6QA 3ZDTA 2BPSA 4HEA1 3JVZX 4HWIB 3L10B 3QJZA 5AUIA 2L7RA 5H92C 2NVUI 2KFJA 2K39A 3DDCB 1WGRA 3P4PB 4ZYNA 4GN1A 2FE8A 1GUAB 4MT5A 1N62A 2NPTA 2K8HA 1I4HA 3DBHB 3NUHB 3QC8B 3ZRCA 4IDIA 4XWWA 4DBGA 1WWTA 2L8JA 4HCPB 4W9LA 1XQQA 2JZZA 1KF6B 1PDXA 1D5ZC 5C3JB 1JALA 1E7UA 2JYEA 3W1SA 4IWPA 3K9PB 4G11A 4ARIA 2ZNVC 1UNSA 3WA0A 3A33B 2PLPA 5EE9A 4LTUA 5KHOA 5EDSA 3SD5A 4F8CB 1C4AA 2L32A 2DYOA 4AUQC 3UI3A 4IM2A 3Q3OC 3WCQA 3ZKJC 1JWSD 4ANUA 1EWYC 4EEWA 4BKSD 2LGDA 4F7ZA 3U7DA 5TSSA 3AV8A 4K1RB 4REZA 3NHEB 1KLUD 5E6NA 2FUG1 4XWTA 5JXVA 4RFBA 1UGMA 3UINB 2J4XA 4WWPA 1K51A 3P4RB 2FAZA 4YWGG 3HUIA 3AE5B 2HD5B 4ZDVA 1TGZB 3A9JB 2GOWA 3L54A 2AEHA 1C1YB 3DVGX 1C4CA 2BWES 4CHKA 4KV2A 3BVGA 2DWQA 2WXPA 4MM3A 3P4SB 2V3PA 1WYWB 1F52A 5E6PA 1LGRA 4K3BA 1FNUA 2J0JA 2M8SA 4JGHB 4GB9A 1QLBB 2MJ3A 2ON8A 2N9LA 1E10A 2JZ3B 3LYYA 3NOBA 4BKSA 1PGAA 3GZNI 1YX6B 2FIFA 2ONQA 2RR9A 4BFRA 1KOTA 2CU3A 1T6BX 2L05A 3HM3A 2CHXA 4GGQA 5J18A 1ZKHA 2BYTA 4Q2JA 4M01A 5IP4D 3AU4A 2ZEQA 3ZYYX 4WQOB 2KFKB 3KYCD 1RLFA 1TKGA 2QDFA 1QOGA 4A55A 1I4XA 1TZOA 1NDDA 2V3NA 1VCBA 3WIMA 4GDLA 3ZTDA 1N60A 4G50A 5IO9A 4RGNA 4TMAB 2C7HA 2ZNVB 3H7PA 4K7SA 3V6EB 3QHTA 2LVQA 2BKRB 3HVZA 1NI2A 4FJZA 2WWZA 1HXYD 3P2BA 3M95A 2DAJA 3ZTCA 3VR8B 2QC8A 3EECA 3AE2B 1F2RC 3R8BA 1VJKA 4HLEA 1DOIA 1CK1A 3DPDA 1JW9D 2J42A 3IT4B 2MX2A 2KDFB 2XEWA 4DXFA 4XE0A 3VUXA 4DWFA 1YN5A 1FFVA 5DPRA 4NJ6A 3FKYA 2K5PA 5G2NA 1P0RA 1UELA 4MGKE 3B0AA 2NS5A 2QILA 1JWUD 3UF8A 5D3IB 1MG4A 1E0ZA 2LXAA 1XCTL 3JSVA 1GNUA 3Q8CA 2D11A 4TKNA 2N1WA 5DPSA 4JX1C 2WXMA 2KN5A 2WS3B 4EKUA 3UIPB 1WJ6A 2YVCA 2H88B 2N9XA 3OJ4B 1GPXA 1TS2A 3QX1A 2J0KA 1UUPA 2K25A 1J7BA 3U4EG 2MBBB 2PEAA 2RDGA 1F9JA 4LNOA 2MEKA 4LDTB 4DQOC 1OEYJ 3HM6X 2OEDA 1VR9A 4HKZE 2KWCA 2NTTA 1XLPA 1SIJA 4BBNC 4A6QA 2QJLA 3BWUD 2G9HD 1VD2A 2D3AA 1ET6A 4TQ1A 2GLSA 3RMKC 1PFDA 4KKJA 2FCNA 3EFCA 1OFFA 1L0VB 1YNTE 1P7EA 2R61A 4NZLB 1HA5A 3UIOB 2MHJA 2LJIA 2Y5BB 1R4MI 1V80A 2GBKA 1SB3C 4I6PA 1WXQA 3N32A 2WXHA 4HPMB 2KDMA 1E7VA 1V1PA 2REXA 1FEHA 1TTNA 3VDZA 4NQLB 5HKHA 3H6NA 1E90A 2Y3AA 3ZW3A 1SE3A 2FUHB 4NAWA 2C5LC 4OVVA 3W1YA 1EM7A 1E5WA 1FXTB 3ZNZB 1TKYA 5IKCM 5GMVA 1L7YA 2K3UA 4ZHOA 2ICIA 1K53A 5JHBA 2PPHA 3LXFA 1LO5D 1BMLC 1DGJA 3H8HA 4YTPB 2BS4B 3C8YA 3KYDD 3J9CA 1SE9A 4YTNB 2UU7A 4DHJD 2RPQA 3Q8FA 2LFIA 4HJKA 1WRDB 3IT6B 3NRZA 3DOWA 4LNIA 1QOBA 1WXMA 4MEMA 2FIDA 4M8MA 2A4ZA 3NJTA 1I35A 3A9KA 2G45B 1T0RC 2LI5A 1ZXHA 3GP7A 1TS4A 3HRDD 2CS4A 3ABVB 4BBNF 3DHHC 2LMCA 1PYWD 1C4PA 2BVCA 3TBLD 4ANWA 3VFKA 2ZW0A 1RFAA 3PT2B 3PZ7A 3HK0A 4LJOB 4GDKB 4X57B 1A5RA 5JH5C 3ENEA 1FIQA 1WFYA 4A8XC 3NZUA 4AS1A 2L0TA 1WMHB 2PIAA 5MPOA 2LVOA 2IGHA 4GXBA 2Y5CA 1L0XB 1D5MC 4WWNA 4M0WB 3ZJUA 2IPKD 3RFZB 1WE6A 1QILA 2HE7A 2O6VD 2W3SA 1MJDA 2O2VB 2J7QB 1E8YA 1IYFA 3L08A 3TMPB 1WX8A 2GRIA 4C4VA 2INDC 5CHVC 2INPE 3DHIC 3K9OB 4NY0A 2N7EA 4XZ4A 5LXIB 4F1SA 4JWUC 2WHIA 3T3OA 3RPFC 1WR6E 3KVFB 1QOAA 2QEJC 2Q5WD 3UQAA 4KIKA 3AEBB 2LJ5A 1ZDVA 4G0NB 4UDUC 3S2AA 3TL5A 3U52E 2PW9A 3PREA 2KJ6A 5EE0A 4YL8A 3VR9B 2RPVA 2LGSA 3DBLI 1PQSA 5EE1A 1WRIA 2RDBC 2KQ4X 1W6VA 2JZPA 1V5OA 2X38A 4YSZB 1JWAD 2WXIA 1XF5L 4ITKA 5D2MB 2JYTA 3W5UB 2XBBC 2C60A 3DVNV 4II3B 2RGFA 2PJHA 3ALBA 1SXTA 4ICVA 3DHGC 4HCNB 2BGFA 2PKOA 2RMMA 4K7WA 3Q69A 2JWZA 3CMMB 1UGJA 5D6JB 2QSDA 2WLBA 1WM2A 2CU1A 5C1ZA 1AARA 3EUB2 2WX0A 2RSUA 2WYQA 2N1VA 1M94A 2K8BA 1QKZA 1MFWA 4DXAB 2LHDA 1SIFA 4JPSA 2CHWA 1VZ7A 1QQRA 2NBUA 2VZKB 2WGSA 2DNFA 3AH7A 3FILA 4BAXA 4WIPA 2KQSA 1SE2A 2WDQB 1WR1A 2JQRB 2FBWB 4G3XB 5CTRC 2BYEA 1A70A 3LDZE 4J6IA 4MGIE 3KW5B 3BK2A 2KTRB 1QF6A 3PGEA 4AJWA 3W1SC 3AEAB 4NAMA 4HDQA 4W9DA 3RNFC 3L17A 4KSLC 1WXAA 3V60A 4GIVA 4D2KA 3QIJA 5E6OA 3WAOA 1YJJA 4MGZE 4B0MA 2IY1B 3I3TB 4C56C 1HZ5A 2XK5A 1XD3B 1TY2A 5DCNA 3KQ4A 2C7MB 2G1EA 2DZMA 1L6UA 3VVWB 1WGYA 4A3PA 3TJPA 1WGKA 4B0EA 3ZQ4A 1KFYB 1D3ZA 3LJ3A 2WXRA 2BS3B 3ZGZA 3N3KB 3MHSD 2BF8B 2Z8LA 2JWUA 2I1KA 3JW0X 1C78A 1L2NA 3BVMA 2JU6X 4LCDE 2C9WB 4S0RA 3VXWA 2KDIA 2JRIB 4W9CA 5BYRA 2L76A 3PLVA 2W54A 4FN2A 2TSSA 1WZ0A 2L3ZA 1FCCC 2K0PA 3KWLA 4JLCA 3SHQA 4BKGA 1YJIA 2XN9C 3ONSA 1C76A 4JQWC 4EOYA 1RM6C 2KFKA 4ZRQA 4K3CA 3H7SA 3BINA 1T0QC 3AXCA 3IVFA 3PV1A 2IO1B 2IO2B 2IDYA 4N58A 5HI1A 1DOXA 1BUIC 1ZOYB 2IGGA 5BMGA 1WF9A 4PS3A 3U8ZA 3PZDA 1VZ8A 2V1YA 2LVPA 1NEKB 3QK0A 1WI0A 4EZKA 4KZCA 1SJHD 2G4SA 1IBXA 1C79A 1MVKA 1TJEA 3AN1A 2C7NB 2NPTB 5JHAA 1Q1OA 1P9DU 1AYFA 4KKIA 3MJWA 4YSXB 2AQ3B 4RGOS 1GG3A 2IJ0A 3P4QB 2R2QA 2JX5A 1J7AA 4CO7A 2PE9A 3IXSA 2WP9B 1N5WA 4MACA 2IGDA 4RGMA 3PLUA 2M0XA 3Q3JA 1I4QA 2D3CA 4DXGA 1AWDA 2L52A 1ZE3D 1WGHA 3R2IA 2DX5B 1WGDA 4N9F4 1SBBB 3VTWA 3AMZA 3DBRI 1UZXB 2WXJA 1WGGA 3VQIA 2N0SB 2EKEC 3RI7C 5BYSA 3MTNB 3U7ZA 4LJPB 3RN9C 1TKEA 2OOBB 3QAQA 3D32A 4A90A 2LHEA 4L23A 3VHTC 4PK1A 3B9JA 1E8XA 1OEYA 1T0YA 1FPYA 3PO0A 2CHZA 5HFYA 3WALA 3DWMA 2EELA 2KMAA 1MI0A 3PTFC 5CX3A 3GE8C 4MH8A 2CJOA 1MG8A 2I1JA 2MP2A 4PYZA 3OG5A 2ZJDA 4WURA 1KTKA 5LNK1 2KK8A 4KDLB 1TZ1A 5AUKA 4M00A 2KVZA 2KJHB 5FR3A 2V0GA 1XT9B 3ML8A 4FBJB 4MM3B 3CSFA 4HROA 1V97A 1JROA 2BBCA 2K9XA 2EKIA 1YN3A 4N6EB 4ZRJA 3RUIB 4HXDA 3VRAB 5H8YE 3WANA 2LZ6A 2DAFA 1ZXIA 4I6LB 1C77A 2GI9A 3SR6A 4FHKA 2BWFA 2ZCBA 3ZO5B 1YD8U 2MBOA 3ZNHB 2UYZB 1HQRD 5AZGA 1V2YA 3NVWA 3ML9A 2WXNA 3ZVVA 1OTRB 4WJOA 2KMCA 2WX1A 2KVRA 2WU5B 4NJ7A 3RT3B 2WXGA 2ACZB 4XDDA 4GSWA 2VH1A 2LGXA 3AE6B 4KGRA 5J17A 3NS1A 2LGIA 5JZEB 2BW2A 4GDLB 4P6VF 2DENB 3H7PB 1P7FA 1FXAA 1P98A 2KZRA 2WDRB 1VZ6A 4IM3A 1JMLA 3IFWB 5L95C 3T8MA 4RH6A 3M63B 1Z2MA 5AZFA 1J8CA 4KVGB 4US9A 1GC7A 1ZDXA 2DZKA 2BYVE 3EC8A 3VUWA 3AE7B 1OQYA 4BVUC 2JT4B 4K7UA 2VH2A 3LMNA 1WXVA 2MQJA 4HKQA 3V6CB 1XO3A 1WSPA 1U4AA 2OJRA 1HTQA 2PE6B 1Q5WB 1NENB 1KJTA 4USAA 4P16A 3JSVB 2GBMA 1JQ4A 2L83A 2WXQA 4HPPA 4WJPA 1N61A 4GDKA 2GB1A 2BYFA 1PGBA 4P1CC 3EHVA 3MJ5A 3APDA 2UWQA 3N30A 3V61A 1WMHA 4GMVA 2AQ1B 5IAAC 1R7SA 1R4NI 2KACA 3CIRB 1NYRA 3C0RB 1FO4A 2W9NA 2KMMA 4AJYB 1ENFA 3AI5A 1UBIA 1GOZA 4OW0A 5FR6A 5LXHA 3DBHI 3AE8B 4YT0B 4LNFA 5AEKB 4HPLB 4IKGA 4XYCA 3NY5A 2RD0A 3A4SC 3VH3B 3N9YC 3QQ8B 4RM8A 4ZOHC 3MC8A 1WM3A 3R66C 5EE3A 2MLBA 4NJCA 3UQBA 3GZNB 2FCQA 4B6WA 1WZ3A 1YN4A 3FC4A 3APFA 2M0AA 2KWUB 1I4GA 4AOFA 5GXGB 3T9LA 2V9HA 2KJRA 4XX5A 1V1PB 1ACCA 4IUMB 1RRBA 3N1XC 2MBEA 2NMQA 1Y56A 1E6EB 2AL3A 2M56B 3Q14C 3SU8X 2IYDB 1VRAB 4II2B 1FMAD 2KO3A 1XLNA 3AE4B 4RCOA 3GS2A 2OHFA 2KX0A 2Z0DB 5BYQA 1WE7A 4MH0E 4FHJA 3A1QA 3SEBA 4ASWC 2WQYB 2B76B 4PS7A 2JXXA 1EO6A 5IOIA 4JWSC 1RFKA 1TT5B 4MJSB 5G5HA 5HHDG 3ZNGC 2H89B 4ICUA 2KD0A 3Q6BA 4XDCA 5BO4B 4DDGD 3L13A 3GE3C 2K8CA 1XLOA 2BTEA 4LNNA 4E71A 2KDEB 3X0WA 1J19A 3IAS1 3VAWA 1Q0WB 1K50A 2KC1A 5BMIA 2V3SA 3DVGY 1I4PA 3TEXA 2YEPF 1ROEA 3CWIA 3P1MA 2AQ2B 5L83A 3AE9B 2DZJA 3NS8A 1I4RA 1V6EA 2YEPB 3T3NA 1STEA 1VDVA 2G3QB 1WX9A 3TSSA 2WDVB 2K1FA 3I63C 2BT6A 2CJNA 4DHJB 1PUTA 3BVZA 3RNEC 4LK0M 4ZRPA 3NVYA 2B3AA 4OHJA 4AP4C 4EZJA 2LASA 4S17A 4WJQA 1UF0A 2BKFA 1SEBD 3V62A 2MW5A 1RAXA 1OGWA 3WAPA 3OWEB 1YJ1A 1XEEA 1N63A 1WJUA 2PTLA 2OJWA 4C4VB 1QZEA 2N7JA 2KX3A 2CR5A 4FJVB 3N20C 3NVZA 1L5PA 4KDIC 1J0GA 2M17A 2DYMA 1JWMD 1R4MB 1JRUA 2FCMA 1KH0A 2N9PC 4OZAA 4ARCA 1S3SG 3CSTA 4OVUA 3EFUA 3W2DA 2N7DA 2IO0B 3PPAA 2Z59B 2LWPA 3N1ZC 3ZXRA 4CQNA 1P3QU 1Z5SB 4KIKB 2BQQA 3MP9A 4XC2A 1ET9A 4LNKA 2EMTA 3BYTB 4ZHPA 4E3CA 3O65B 2AWTA 1WJ4A 3NVVA 3AE1B 4PS8A 2O6VB 5LLIA 3LB8C 3KLSX 5D94A 2CKHB 4N59A 3Q2AC 3APCA 2KANA 3VH4B 3ZLZA 2HTME 3A9JA 1NVID 2NTSA 3B1LX 1X1MA 2W3RA 2Y5PA 4RF1A 2JVCA 3PSEB 2PVOD 1WY8A 3PRPB 2MRPA 2VRRB 2J52A 4HDOA 4C00A 5DPWA 2JXTA 1UWMA 1V86A 2W55A 3GOEA 3PHXB 3QCAA 4RF0A 2DYBA 4P7IA 4TUUA 2LGYA 4WH4A 3AEEB 1TBEA 1YQ3B 3PHWB 3V3XA 1DOYA 4YXDB 2WU2B 4FJYA 3R3MA 4RGTA 3FILB 1WXSA 4W9JA 1V81A 1S1QB 2XNAC 3ETRA 1GC6A 2M19A 1F2RI 3C19A 4RM9A 2MJDA 3U2SC 4KSKC 2PVGC 4BKTA 1DYQA 1L4DB 2KC2A 3A4RA 2BS2B 4ZRKA 3VTUA 3Q3NC 3H1UA 1ZPSA 2G4DB 2AL6A 2E6XA 4WAFA 1V5TA 2L00B 2L0FA 4C7YA 1F0ZA 3QA8A 2KNBA 4LDTD 3RNCC 2XK5B 4KZ0A 1WJNA 5HG2A 3PS6A 1GB1A 2ZVNA 4US8A 1SE4A 3B08A 1NYQA 3X23A 1AN8A 1N6ZA 4PT5A 1ZGUB 4IM0A 4EE2A 4FADA 1EU3A 5D3DA 3DWGC 3TCAA 2KWVB 5IA7A 4IOIE 2BB5A 1CQVA 3AEFB 3DVNU 1FNWA 3U30A 5BMHA 3ZJTA 2HTHA 4EZLA 3Q8AA 2WXLA 3TIXA 2KHWB 1HTOA 4W9KA 5TR5A 2KLGA 1E7PB 2M4NA 4R3DA 3VUYA 3TEWA 2LRUA 5FK9C 1LQBA 3ZJVA 4W9GA 4EFOA 4GU2A 2HJ1A 2NCNA 3HIZA 4WWOA 3DBLB 3ZRFA 4MSMB 4JIOU 4JL9A 3BYYB 1FM0D 3RNAC 3Q8EA 4HK2A 2WXOA 4W9IA 3AULA 3JYUA 3NZ3A 3TUOA 3IG3A 1MPEA 4L1BA 2MCNB 4TV3A 4MELA 5D7GA 2WXKA 3AECB 1FD6A 2W82A 4CYEA 5CHWA 1QOFA 2L1AA 4ZYSA 1FXIA 1IPGA 1GJZA 4M02A 1CMXB 2DHZA 2HJ8A 4OVZA 4HRSA 3MC9A 1T5XD 1IBXB 2NBWB 5J2RA 1KRHA 1T3QA 1ZW7A 2YLMA 4DK5A 1V1OA 2V4LA 1HEZE 1TS5A 2ZPNA 2EMSA 1JWBD 2NBVB 2X8XX 4ANVA 1SJED 2LEKA 1LFDA 4I6NB 3L0WB 4C7ZA 2BB6A 3M3JA 1OQRA 4DHZE 1XLQA 5I4DA 1L0YB 4FXCA 2V4IB 3RZWC 3URYA 4NNJB 4KGSA 4ANXA 1WYGA 3DCGA 2MA9B 5CHFA 4A20A 3RCZA 4RNAA 1FRDA 2SAKA 1V9JA 3KUDB 2M1MA 1VLBA 2IO3B 2QCZA 2INNE 2ASQA 1MHXA 3Q3MC 1C3TA 3B2FA 3PRMB 4GLSC 3I5JC 2JSVX 4BZAA 2RDHA 3Q3FA 1NI3A 3IAM1 4H2AA 3R2TA 1H8CA 4IWQA 2Z0EB 5T8IA 2SEBD 4KX6B 2KQ7A 2MP2B 1NBFC 2JF5A 4LLGM 4TQ0A 1LM8B 1TY0A 1UWXA 4DDID 3GB1A 1AW7A 4A9AA 1CJEA 3BZDB 3IHPC 1KM7A 1EWCA 2KN4A 3KUZA 1G6JA 1Q10A 4WAAA 1I7HA 1SGHA 1I42A 2KAJA 4BOZB 3KUCB 1KLVA 4DHZB 1TYGB 1IUEA 4J3OD 3B2GA 3R7QA 1YIWA 2IZVB 4M0WA 2INCC 4QAYA 1L4ZB 2GBNA 4NPNA 2A5UA 4WQMA 3WAMA 3MHZA 3ZIMA 3OAWA 1KLGD 2KDBA 4JE3B 5AZHA 3OLMD 4HJGE 2O2VA 4XGAB 1D6EC 4AQ7A 1HZ6A 3MC0B 4W9EA 1B1ZA 2AYOB 3L16A 1K8RB 4HVBA 4IWOA 4C80A 2ZCCA 3RNGC 4RMAA 2K6DB 4FA6A 2ZPYA 5DPTA 1UH6A 4MJSA 3SFDB 2LXCA 2D3GA 1M4VA 1BXTA 4WJNA 3ZNID 4MSQB 2QIEB
chains in the Genus database with same CATH topology
2IO1B 2KN5A 4WJQA 4B95A 2LRWA 4EKUA 1WX7A 2IO2B 3UIPB 1WJ6A 2BKFA 2IBIB 1E8ZA 2YVCA 3V62A 2MW5A 1IP9A 1RAXA 4AWJA 2N9XA 3OJ4B 1OGWA 3QX1A 2MWSB 2J0KA 1UBQA 3WAPA 1WF9A 2K25A 2KLCA 4PS3A 3U8ZA 3PZDA 1YJ1A 2V1YA 2LVPA 2MBBB 1WJUA 2PEAA 1E8WA 1QZEA 2KX3A 3QK0A 2CR5A 4FJVB 1WI0A 4EZKA 3DQVA 4KZCA 1F9JA 2G4SA 4LDTB 4KDIC 1J0GA 2M17A 1OEYJ 2C7NB 2NPTB 3HM6X 3NZSA 5JHAA 4EUTA 2DYMA 1Q1OA 1P9DU 1JRUA 2FCMA 2N9PC 4NAWB 1HE8A 3MJWA 1S3SG 3CSTA 4OVUA 3EFUA 2KWCA 3ECIA 1GG3A 2N7DA 2IO0B 2MSED 3AU5A 3PPAA 2Z59B 2R2QA 5KHQA 2LWPA 4CO7A 2PE9A 4BBNC 5G55A 2J0MA 1V49A 1P3QU 1VD2A 1Z5SB 2GBJA 4KIKB 2KTFA 3PLUA 4XC2A 3RULA 2M0XA 3Q3JA 4NQKE 4TQ1A 4W9FA 3BY4B 2EMTA 4E3CA 3O65B 2AWTA 1WJ4A 2FCNA 2JPHA 3ZDMC 4PS8A 1WGHA 2O6VB 1Y8RC 5LLIA 4FULA 3IBEA 2DX5B 1WGDA 4N9F4 1ISNA 5D94A 2CKHB 3VTWA 3APCA 2KANA 3H9DA 4IG7B 3VH4B 3DBRI 1UZXB 3UIOB 3ZLZA 3A9JA 1P1AA 2Y5BB 2ZVOA 1R4MI 1WGGA 3VQIA 2EKEC 1H4RA 1V80A 3B1LX 2N9EB 2GBKA 3MTNB 4I6PA 1X1MA 3N32A 4LJPB 4BOSC 3RD2A 2OOBB 3QAQA 4HPMB 3D32A 2JVCA 1E7VA 3VHTC 2REXA 1TTNA 3R7RA 3VDZA 1E8XA 4NQLB 1OEYA 1T0YA 1YX5B 3PSEB 5HKHA 4URKA 3H6NA 1E90A 1WY8A 2MBHA 2CHZA 2FUHB 3PRPB 3A9KB 4NAWA 3ZW3A 2C5LC 2MRPA 4OVVA 2VRRB 3W1YA 3WALA 4HDOA 2KMAA 5DPWA 2GBRA 4IW0A 1E5WA 1FXTB 3PTFC 5CX3A 3RYTA 1V86A 2DZIA 3ZNZB 2FNJB 3GOEA 3PHXB 1EF1A 2R2OA 3QCAA 2DYBA 4P7IA 4TUUA 5GMVA 1MG8A 1L7YA 2I1JA 2LGYA 2KTRA 2MP2A 5JHBA 4PYZA 2PPHA 2ZJDA 1TBEA 2NR2A 2KK8A 4KDLB 1TZ1A 1EUVB 3PHWB 2KJHB 3KYDD 1XT9B 3ML8A 3ZUNA 4FBJB 2KKCA 3M62B 2O6VA 3CSFA 1LXDA 1SE9A 4FJYA 3R3MA 4A3OA 1WIAA 4ZRJA 3RUIB 4DHJD 2RPQA 1WXSA 2FCSA 1V81A 4HXDA 4W9JA 4ZRIA 4HJKA 1S1QB 3VTVA 3WANA 1GC6A 1YQBA 3PVLA 3HHMA 3PRZA 2LZ6A 1WRDB 2DAFA 3DOWA 4RM9A 4I6LB 1WXMA 4FLHA 4KSKC 4MEMA 2FIDA 2LUEA 4FHKA 4M8MA 2BWFA 4BKTA 3CF6E 2KC2A 3A4RA 2ZCBA 3ZO5B 2A4ZA 1YD8U 2MBOA 3ZNHB 2UYZB 5AZGA 1V2YA 3UGBB 1I35A 3A9KA 2G45B 3KH0A 3ML9A 2MBQA 4ZRKA 3RZFA 2LI5A 3H1UA 3VTUA 3ZVVA 2KOXA 3A1QB 2G4DB 2CS4A 1OTRB 1UD7A 2AL6A 4WJOA 1V5TA 4BBNF 2KMCA 2WX1A 2KVRA 4NJ7A 2L00B 2L0FA 4PYUA 5C23A 2GMIC 3RT3B 4MDKE 2JRHA 3QA8A 2KNBA 3TBLD 4LDTD 4ANWA 1BT0A 2XK5B 4GSWA 3VFKA 4KZ0A 2JUOA 4W9HA 3QWZB 2LGXA 1WJNA 2N4FA 2QHOA 1RFAA 5J17A 3PT2B 4LJOB 3HK0A 4B9KA 4M8NA 3PS6A 4GDKB 4X57B 5JZEB 5JH5C 1A5RA 2ZVNA 3ENEA 1WFYA 2D07B 3B08A 3NZUA 2ZZPB 2L0TA 4GDLB 3SDLC 1WMHB 3X23A 4MGYE 2LVOA 2DENB 3H7PB 2WDTB 4GXBA 3QARA 1ZGUB 4IM0A 1P98A 2KZRA 2LD9A 4GOCA 4WWNA 4IM3A 3DBSA 4FADA 2D10A 4M0WB 3IFWB 5L95C 3TCAA 2KWVB 3T8MA 5IA7A 3DVNU 4E74A 1WE6A 3M63B 1Z2MA 3U30A 5AZFA 1J8CA 3OJ3A 2HTHA 2JY6A 2D2QA 2HE7A 4K81A 1EF5A 3TIXA 4EZLA 2O6VD 4KVGB 2KHWB 1WH3A 2IY0B 2O2VB 1GC7A 4W9KA 5TR5A 2KLGA 2KXJA 2BYVE 2DZKA 3EC8A 4IC7B 2M4NA 3VUWA 2J7QB 1E8YA 1OQYA 2K6QA 2JT4B 3ZDTA 2BPSA 4BVUC 4K7UA 3JVZX 4HWIB 3VUYA 1IYFA 3LMNA 3L10B 3L08A 3QJZA 2LRUA 3TMPB 1WX8A 2L7RA 1WXVA 2MQJA 1LQBA 2NVUI 2KFJA 2K39A 4W9GA 3DDCB 3V6CB 4EFOA 4GU2A 1WGRA 4ZYNA 2NCNA 1U4AA 2OJRA 3HIZA 4GN1A 4WWOA 5CHVC 3ZRFA 1GUAB 2PE6B 1Q5WB 4MSMB 1KJTA 3K9OB 4JIOU 4JL9A 4NY0A 2N7EA 2NPTA 2K8HA 4XZ4A 5LXIB 3JSVB 3QC8B 2GBMA 3ZRCA 4F1SA 4WJPA 4GDKA 2BYFA 4DBGA 4HK2A 2L8JA 4HCPB 4W9LA 1XQQA 3EHVA 2JZZA 1WR6E 3KVFB 3APDA 2UWQA 3N30A 4W9IA 3V61A 1WMHA 4GMVA 3AULA 1E7UA 3JYUA 3W1SA 4IWPA 3IG3A 5IAAC 3UQAA 4KIKA 3K9PB 4G11A 2LJ5A 1R4NI 2MCNB 2ZNVC 4TV3A 4MELA 5D7GA 3C0RB 3WA0A 4G0NB 3S2AA 3A33B 3TL5A 5KHOA 5EDSA 3SD5A 4CYEA 5CHWA 2W9NA 4F8CB 1IPGA 2DYOA 4AJYB 1GJZA 3PREA 2KJ6A 1CMXB 2DHZA 2HJ8A 3AI5A 4YL8A 3DBLI 4AUQC 1UBIA 2NBWB 5J2RA 1PQSA 4IM2A 5FR6A 5LXHA 1ZW7A 2YLMA 4DK5A 3DBHI 1W6VA 2V4LA 3ZKJC 4ANUA 2ZPNA 5AEKB 1V5OA 2EMSA 4HPLB 4EEWA 4BKSD 2LGDA 2NBVB 4F7ZA 3NY5A 4ANVA 5DPSA 2RD0A 3A4SC 5D2MB 3U7DA 3VH3B 1LFDA 4I6NB 4K1RB 3QQ8B 2XBBC 2C60A 3DVNV 4RM8A 3L0WB 4II3B 3M3JA 2RGFA 3NHEB 2PJHA 5E6NA 1WM3A 3R66C 3ALBA 4ICVA 4HCNB 2BGFA 4DHZE 2MLBA 4K7WA 3UQBA 1UGMA 3UINB 3RZWC 4WWPA 2JWZA 4NNJB 3CMMB 4ANXA 5D6JB 3DCGA 2MA9B 5CHFA 2FAZA 4A20A 1WM2A 3RCZA 2FCQA 2CU1A 2HD5B 4ZDVA 1TGZB 5C1ZA 4B6WA 1WZ3A 1AARA 3A9JB 2GOWA 1V9JA 2WX0A 2M1MA 3KUDB 3L54A 2AEHA 2IO3B 3APFA 1C1YB 2RSUA 3DVGX 2WYQA 4CHKA 2BWES 2N1VA 4KV2A 2KWUB 1M94A 2ASQA 4AOFA 4MM3A 2K8BA 4DXAB 3T9LA 1C3TA 1SIFA 2CHWA 2KJRA 3PRMB 1WYWB 4XX5A 5E6PA 2NBUA 2J0JA 2M8SA 2KQSA 4JGHB 4GB9A 1WR1A 4IUMB 1RRBA 3Q3FA 4G3XB 2JZ3B 2MBEA 5CTRC 3NOBA 4BKSA 2BYEA 1H8CA 2AL3A 4IWQA 2Z0EB 3LDZE 3GZNI 1YX6B 4J6IA 3SU8X 2FIFA 2RR9A 2IYDB 4MGIE 4BFRA 4II2B 3KW5B 2KO3A 1KOTA 2KQ7A 2KTRB 2L05A 2MP2B 1NBFC 2JF5A 3PGEA 4AJWA 3HM3A 2CHXA 3W1SC 4TQ0A 1LM8B 4HDQA 4GGQA 4W9DA 5J18A 3L17A 2KX0A 2Z0DB 4KSLC 1ZKHA 1WE7A 4MH0E 4FHJA 1WXAA 4DDID 3A1QA 3V60A 4GIVA 3AU4A 4ASWC 3IHPC 3QIJA 5E6OA 1KM7A 2ZEQA 4PS7A 2JXXA 1EO6A 3KUZA 4WQOB 3WAOA 2KFKB 3KYCD 4MGZE 4MJSB 1G6JA 1RLFA 3ZNGC 4WAAA 2IY1B 3I3TB 4ICUA 2KD0A 2XK5A 1XD3B 5DCNA 1SGHA 5BO4B 1I42A 4DDGD 2C7MB 4BOZB 3L13A 2K8CA 2DZMA 1NDDA 4E71A 1VCBA 3WIMA 3KUCB 1KLVA 2KDEB 4DHZB 3VVWB 1WGYA 4GDLA 3ZTDA 4G50A 3X0WA 4A3PA 3TJPA 1J19A 3VAWA 1Q0WB 2C7HA 2ZNVB 3H7PA 4K7SA 3V6EB 2KC1A 1D3ZA 3LJ3A 3R7QA 3QHTA 1YIWA 2V3SA 2LVQA 3DVGY 2BKRB 2IZVB 1NI2A 4FJZA 3N3KB 3MHSD 2BF8B 2GBNA 2WWZA 4NPNA 3P2BA 2A5UA 3M95A 2I1KA 2DAJA 3JW0X 3WAMA 3ZTCA 3ZIMA 3OAWA 5L83A 1L2NA 2DZJA 3NS8A 3EECA 2KDBA 5AZHA 4LCDE 2C9WB 3VXWA 3OLMD 2O2VA 1V6EA 2KDIA 4HLEA 3DPDA 2G3QB 1WX9A 2JRIB 4W9EA 4W9CA 2AYOB 2MX2A 2KDFB 2XEWA 3L16A 2K1FA 1K8RB 2L76A 3VUXA 3PLVA 4DWFA 4HVBA 4FN2A 5DPRA 4IWOA 4NJ6A 2ZCCA 2L3ZA 1WZ0A 4RMAA 5G2NA 4JLCA 3SHQA 2K6DB 4BKGA 1P0RA 1UELA 4MGKE 4FA6A 2ZPYA 3B0AA 3ONSA 4JQWC 5DPTA 4EOYA 1UH6A 2KFKA 2NS5A 4MJSA 3UF8A 4DHJB 3H7SA 2LXCA 2D3GA 2LXAA 3JSVA 1GNUA 3BINA 2D11A 4TKNA 2N1WA 3AXCA 3IVFA 2B3AA 4WJNA 3ZNID 4AP4C 3PV1A 4MSQB 4EZJA 2LASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO1 B;  2KN5 A;  4WJQ A;  4B95 A;  2LRW A;  4EKU A;  1WX7 A;  2IO2 B;  3UIP B;  1WJ6 A;  2BKF A;  2IBI B;  1E8Z A;  2YVC A;  3V62 A;  2MW5 A;  1IP9 A;  1RAX A;  4AWJ A;  2N9X A;  3OJ4 B;  1OGW A;  3QX1 A;  2MWS B;  2J0K A;  1UBQ A;  3WAP A;  1WF9 A;  2K25 A;  2KLC A;  4PS3 A;  3U8Z A;  3PZD A;  1YJ1 A;  2V1Y A;  2LVP A;  2MBB B;  1WJU A;  2PEA A;  1E8W A;  1QZE A;  2KX3 A;  3QK0 A;  2CR5 A;  4FJV B;  1WI0 A;  4EZK A;  3DQV A;  4KZC A;  1F9J A;  2G4S A;  4LDT B;  4KDI C;  1J0G A;  2M17 A;  1OEY J;  2C7N B;  2NPT B;  3HM6 X;  3NZS A;  5JHA A;  4EUT A;  2DYM A;  1Q1O A;  1P9D U;  1JRU A;  2FCM A;  2N9P C;  4NAW B;  1HE8 A;  3MJW A;  1S3S G;  3CST A;  4OVU A;  3EFU A;  2KWC A;  3ECI A;  1GG3 A;  2N7D A;  2IO0 B;  2MSE D;  3AU5 A;  3PPA A;  2Z59 B;  2R2Q A;  5KHQ A;  2LWP A;  4CO7 A;  2PE9 A;  4BBN C;  5G55 A;  2J0M A;  1V49 A;  1P3Q U;  1VD2 A;  1Z5S B;  2GBJ A;  4KIK B;  2KTF A;  3PLU A;  4XC2 A;  3RUL A;  2M0X A;  3Q3J A;  4NQK E;  4TQ1 A;  4W9F A;  3BY4 B;  2EMT A;  4E3C A;  3O65 B;  2AWT A;  1WJ4 A;  2FCN A;  2JPH A;  3ZDM C;  4PS8 A;  1WGH A;  2O6V B;  1Y8R C;  5LLI A;  4FUL A;  3IBE A;  2DX5 B;  1WGD A;  4N9F 4;  1ISN A;  5D94 A;  2CKH B;  3VTW A;  3APC A;  2KAN A;  3H9D A;  4IG7 B;  3VH4 B;  3DBR I;  1UZX B;  3UIO B;  3ZLZ A;  3A9J A;  1P1A A;  2Y5B B;  2ZVO A;  1R4M I;  1WGG A;  3VQI A;  2EKE C;  1H4R A;  1V80 A;  3B1L X;  2N9E B;  2GBK A;  3MTN B;  4I6P A;  1X1M A;  3N32 A;  4LJP B;  4BOS C;  3RD2 A;  2OOB B;  3QAQ A;  4HPM B;  3D32 A;  2JVC A;  1E7V A;  3VHT C;  2REX A;  1TTN A;  3R7R A;  3VDZ A;  1E8X A;  4NQL B;  1OEY A;  1T0Y A;  1YX5 B;  3PSE B;  5HKH A;  4URK A;  3H6N A;  1E90 A;  1WY8 A;  2MBH A;  2CHZ A;  2FUH B;  3PRP B;  3A9K B;  4NAW A;  3ZW3 A;  2C5L C;  2MRP A;  4OVV A;  2VRR B;  3W1Y A;  3WAL A;  4HDO A;  2KMA A;  5DPW A;  2GBR A;  4IW0 A;  1E5W A;  1FXT B;  3PTF C;  5CX3 A;  3RYT A;  1V86 A;  2DZI A;  3ZNZ B;  2FNJ B;  3GOE A;  3PHX B;  1EF1 A;  2R2O A;  3QCA A;  2DYB A;  4P7I A;  4TUU A;  5GMV A;  1MG8 A;  1L7Y A;  2I1J A;  2LGY A;  2KTR A;  2MP2 A;  5JHB A;  4PYZ A;  2PPH A;  2ZJD A;  1TBE A;  2NR2 A;  2KK8 A;  4KDL B;  1TZ1 A;  1EUV B;  3PHW B;  2KJH B;  3KYD D;  1XT9 B;  3ML8 A;  3ZUN A;  4FBJ B;  2KKC A;  3M62 B;  2O6V A;  3CSF A;  1LXD A;  1SE9 A;  4FJY A;  3R3M A;  4A3O A;  1WIA A;  4ZRJ A;  3RUI B;  4DHJ D;  2RPQ A;  1WXS A;  2FCS A;  1V81 A;  4HXD A;  4W9J A;  4ZRI A;  4HJK A;  1S1Q B;  3VTV A;  3WAN A;  1GC6 A;  1YQB A;  3PVL A;  3HHM A;  3PRZ A;  2LZ6 A;  1WRD B;  2DAF A;  3DOW A;  4RM9 A;  4I6L B;  1WXM A;  4FLH A;  4KSK C;  4MEM A;  2FID A;  2LUE A;  4FHK A;  4M8M A;  2BWF A;  4BKT A;  3CF6 E;  2KC2 A;  3A4R A;  2ZCB A;  3ZO5 B;  2A4Z A;  1YD8 U;  2MBO A;  3ZNH B;  2UYZ B;  5AZG A;  1V2Y A;  3UGB B;  1I35 A;  3A9K A;  2G45 B;  3KH0 A;  3ML9 A;  2MBQ A;  4ZRK A;  3RZF A;  2LI5 A;  3H1U A;  3VTU A;  3ZVV A;  2KOX A;  3A1Q B;  2G4D B;  2CS4 A;  1OTR B;  1UD7 A;  2AL6 A;  4WJO A;  1V5T A;  4BBN F;  2KMC A;  2WX1 A;  2KVR A;  4NJ7 A;  2L00 B;  2L0F A;  4PYU A;  5C23 A;  2GMI C;  3RT3 B;  4MDK E;  2JRH A;  3QA8 A;  2KNB A;  3TBL D;  4LDT D;  4ANW A;  1BT0 A;  2XK5 B;  4GSW A;  3VFK A;  4KZ0 A;  2JUO A;  4W9H A;  3QWZ B;  2LGX A;  1WJN A;  2N4F A;  2QHO A;  1RFA A;  5J17 A;  3PT2 B;  4LJO B;  3HK0 A;  4B9K A;  4M8N A;  3PS6 A;  4GDK B;  4X57 B;  5JZE B;  5JH5 C;  1A5R A;  2ZVN A;  3ENE A;  1WFY A;  2D07 B;  3B08 A;  3NZU A;  2ZZP B;  2L0T A;  4GDL B;  3SDL C;  1WMH B;  3X23 A;  4MGY E;  2LVO A;  2DEN B;  3H7P B;  2WDT B;  4GXB A;  3QAR A;  1ZGU B;  4IM0 A;  1P98 A;  2KZR A;  2LD9 A;  4GOC A;  4WWN A;  4IM3 A;  3DBS A;  4FAD A;  2D10 A;  4M0W B;  3IFW B;  5L95 C;  3TCA A;  2KWV B;  3T8M A;  5IA7 A;  3DVN U;  4E74 A;  1WE6 A;  3M63 B;  1Z2M A;  3U30 A;  5AZF A;  1J8C A;  3OJ3 A;  2HTH A;  2JY6 A;  2D2Q A;  2HE7 A;  4K81 A;  1EF5 A;  3TIX A;  4EZL A;  2O6V D;  4KVG B;  2KHW B;  1WH3 A;  2IY0 B;  2O2V B;  1GC7 A;  4W9K A;  5TR5 A;  2KLG A;  2KXJ A;  2BYV E;  2DZK A;  3EC8 A;  4IC7 B;  2M4N A;  3VUW A;  2J7Q B;  1E8Y A;  1OQY A;  2K6Q A;  2JT4 B;  3ZDT A;  2BPS A;  4BVU C;  4K7U A;  3JVZ X;  4HWI B;  3VUY A;  1IYF A;  3LMN A;  3L10 B;  3L08 A;  3QJZ A;  2LRU A;  3TMP B;  1WX8 A;  2L7R A;  1WXV A;  2MQJ A;  1LQB A;  2NVU I;  2KFJ A;  2K39 A;  4W9G A;  3DDC B;  3V6C B;  4EFO A;  4GU2 A;  1WGR A;  4ZYN A;  2NCN A;  1U4A A;  2OJR A;  3HIZ A;  4GN1 A;  4WWO A;  5CHV C;  3ZRF A;  1GUA B;  2PE6 B;  1Q5W B;  4MSM B;  1KJT A;  3K9O B;  4JIO U;  4JL9 A;  4NY0 A;  2N7E A;  2NPT A;  2K8H A;  4XZ4 A;  5LXI B;  3JSV B;  3QC8 B;  2GBM A;  3ZRC A;  4F1S A;  4WJP A;  4GDK A;  2BYF A;  4DBG A;  4HK2 A;  2L8J A;  4HCP B;  4W9L A;  1XQQ A;  3EHV A;  2JZZ A;  1WR6 E;  3KVF B;  3APD A;  2UWQ A;  3N30 A;  4W9I A;  3V61 A;  1WMH A;  4GMV A;  3AUL A;  1E7U A;  3JYU A;  3W1S A;  4IWP A;  3IG3 A;  5IAA C;  3UQA A;  4KIK A;  3K9P B;  4G11 A;  2LJ5 A;  1R4N I;  2MCN B;  2ZNV C;  4TV3 A;  4MEL A;  5D7G A;  3C0R B;  3WA0 A;  4G0N B;  3S2A A;  3A33 B;  3TL5 A;  5KHO A;  5EDS A;  3SD5 A;  4CYE A;  5CHW A;  2W9N A;  4F8C B;  1IPG A;  2DYO A;  4AJY B;  1GJZ A;  3PRE A;  2KJ6 A;  1CMX B;  2DHZ A;  2HJ8 A;  3AI5 A;  4YL8 A;  3DBL I;  4AUQ C;  1UBI A;  2NBW B;  5J2R A;  1PQS A;  4IM2 A;  5FR6 A;  5LXH A;  1ZW7 A;  2YLM A;  4DK5 A;  3DBH I;  1W6V A;  2V4L A;  3ZKJ C;  4ANU A;  2ZPN A;  5AEK B;  1V5O A;  2EMS A;  4HPL B;  4EEW A;  4BKS D;  2LGD A;  2NBV B;  4F7Z A;  3NY5 A;  4ANV A;  5DPS A;  2RD0 A;  3A4S C;  5D2M B;  3U7D A;  3VH3 B;  1LFD A;  4I6N B;  4K1R B;  3QQ8 B;  2XBB C;  2C60 A;  3DVN V;  4RM8 A;  3L0W B;  4II3 B;  3M3J A;  2RGF A;  3NHE B;  2PJH A;  5E6N A;  1WM3 A;  3R66 C;  3ALB A;  4ICV A;  4HCN B;  2BGF A;  4DHZ E;  2MLB A;  4K7W A;  3UQB A;  1UGM A;  3UIN B;  3RZW C;  4WWP A;  2JWZ A;  4NNJ B;  3CMM B;  4ANX A;  5D6J B;  3DCG A;  2MA9 B;  5CHF A;  2FAZ A;  4A20 A;  1WM2 A;  3RCZ A;  2FCQ A;  2CU1 A;  2HD5 B;  4ZDV A;  1TGZ B;  5C1Z A;  4B6W A;  1WZ3 A;  1AAR A;  3A9J B;  2GOW A;  1V9J A;  2WX0 A;  2M1M A;  3KUD B;  3L54 A;  2AEH A;  2IO3 B;  3APF A;  1C1Y B;  2RSU A;  3DVG X;  2WYQ A;  4CHK A;  2BWE S;  2N1V A;  4KV2 A;  2KWU B;  1M94 A;  2ASQ A;  4AOF A;  4MM3 A;  2K8B A;  4DXA B;  3T9L A;  1C3T A;  1SIF A;  2CHW A;  2KJR A;  3PRM B;  1WYW B;  4XX5 A;  5E6P A;  2NBU A;  2J0J A;  2M8S A;  2KQS A;  4JGH B;  4GB9 A;  1WR1 A;  4IUM B;  1RRB A;  3Q3F A;  4G3X B;  2JZ3 B;  2MBE A;  5CTR C;  3NOB A;  4BKS A;  2BYE A;  1H8C A;  2AL3 A;  4IWQ A;  2Z0E B;  3LDZ E;  3GZN I;  1YX6 B;  4J6I A;  3SU8 X;  2FIF A;  2RR9 A;  2IYD B;  4MGI E;  4BFR A;  4II2 B;  3KW5 B;  2KO3 A;  1KOT A;  2KQ7 A;  2KTR B;  2L05 A;  2MP2 B;  1NBF C;  2JF5 A;  3PGE A;  4AJW A;  3HM3 A;  2CHX A;  3W1S C;  4TQ0 A;  1LM8 B;  4HDQ A;  4GGQ A;  4W9D A;  5J18 A;  3L17 A;  2KX0 A;  2Z0D B;  4KSL C;  1ZKH A;  1WE7 A;  4MH0 E;  4FHJ A;  1WXA A;  4DDI D;  3A1Q A;  3V60 A;  4GIV A;  3AU4 A;  4ASW C;  3IHP C;  3QIJ A;  5E6O A;  1KM7 A;  2ZEQ A;  4PS7 A;  2JXX A;  1EO6 A;  3KUZ A;  4WQO B;  3WAO A;  2KFK B;  3KYC D;  4MGZ E;  4MJS B;  1G6J A;  1RLF A;  3ZNG C;  4WAA A;  2IY1 B;  3I3T B;  4ICU A;  2KD0 A;  2XK5 A;  1XD3 B;  5DCN A;  1SGH A;  5BO4 B;  1I42 A;  4DDG D;  2C7M B;  4BOZ B;  3L13 A;  2K8C A;  2DZM A;  1NDD A;  4E71 A;  1VCB A;  3WIM A;  3KUC B;  1KLV A;  2KDE B;  4DHZ B;  3VVW B;  1WGY A;  4GDL A;  3ZTD A;  4G50 A;  3X0W A;  4A3P A;  3TJP A;  1J19 A;  3VAW A;  1Q0W B;  2C7H A;  2ZNV B;  3H7P A;  4K7S A;  3V6E B;  2KC1 A;  1D3Z A;  3LJ3 A;  3R7Q A;  3QHT A;  1YIW A;  2V3S A;  2LVQ A;  3DVG Y;  2BKR B;  2IZV B;  1NI2 A;  4FJZ A;  3N3K B;  3MHS D;  2BF8 B;  2GBN A;  2WWZ A;  4NPN A;  3P2B A;  2A5U A;  3M95 A;  2I1K A;  2DAJ A;  3JW0 X;  3WAM A;  3ZTC A;  3ZIM A;  3OAW A;  5L83 A;  1L2N A;  2DZJ A;  3NS8 A;  3EEC A;  2KDB A;  5AZH A;  4LCD E;  2C9W B;  3VXW A;  3OLM D;  2O2V A;  1V6E A;  2KDI A;  4HLE A;  3DPD A;  2G3Q B;  1WX9 A;  2JRI B;  4W9E A;  4W9C A;  2AYO B;  2MX2 A;  2KDF B;  2XEW A;  3L16 A;  2K1F A;  1K8R B;  2L76 A;  3VUX A;  3PLV A;  4DWF A;  4HVB A;  4FN2 A;  5DPR A;  4IWO A;  4NJ6 A;  2ZCC A;  2L3Z A;  1WZ0 A;  4RMA A;  5G2N A;  4JLC A;  3SHQ A;  2K6D B;  4BKG A;  1P0R A;  1UEL A;  4MGK E;  4FA6 A;  2ZPY A;  3B0A A;  3ONS A;  4JQW C;  5DPT A;  4EOY A;  1UH6 A;  2KFK A;  2NS5 A;  4MJS A;  3UF8 A;  4DHJ B;  3H7S A;  2LXC A;  2D3G A;  2LXA A;  3JSV A;  1GNU A;  3BIN A;  2D11 A;  4TKN A;  2N1W A;  3AXC A;  3IVF A;  2B3A A;  4WJN A;  3ZNI D;  4AP4 C;  3PV1 A;  4MSQ B;  4EZJ A;  2LAS A; 
#chains in the Genus database with same CATH topology
 1FRR A;  4B95 A;  2LRW A;  3TEY A;  1WX7 A;  3I57 A;  2MJE A;  2IBI B;  1E8Z A;  1IP9 A;  4AWJ A;  1PGX A;  2MH7 A;  2MWS B;  3AM9 A;  1UBQ A;  2I38 A;  4OZC A;  2KLC A;  1SF0 A;  2DBY A;  3AEG B;  1E8W A;  1RYJ A;  2AX5 A;  3DQV A;  3BK1 A;  1F1H A;  1T0S C;  2DLB A;  3TEZ A;  1XCQ L;  3DBR B;  2VZK D;  3NZS A;  4EUT A;  3KWV A;  4NAW B;  1HE8 A;  1YOV B;  1C9F A;  3ECI A;  1EU4 A;  2MSE D;  3AU5 A;  5KHQ A;  2WNM A;  5G55 A;  2J0M A;  1V49 A;  2GBJ A;  3P63 A;  5E6J A;  2KTF A;  1TIF A;  1FCL A;  1E9M A;  2N9K A;  1RWS A;  3RUL A;  4NQK E;  4W9F A;  3BY4 B;  1IGC A;  3O13 A;  1ESF A;  1L6V A;  2K22 A;  2JPH A;  3ZDM C;  1TS3 A;  1Y8R C;  3E9S A;  4FUL A;  3IBE A;  1YQ4 B;  1ISN A;  3H9D A;  1JCK B;  4IG7 B;  2KT7 A;  3RNB C;  1ZUD 2;  1P1A A;  2ZVO A;  1FFU A;  1H4R A;  1SSN A;  3EGR A;  2N9E B;  4BOS C;  3RD2 A;  2E3T A;  1D5X C;  3R7R A;  1YX5 B;  5FKA C;  4URK A;  3EA6 A;  4WWM A;  2MBH A;  1N5X A;  1YMH E;  3A9K B;  4TSS A;  2GBR A;  2QMT A;  4IW0 A;  3I9V 1;  3RYT A;  2DZI A;  2FNJ B;  5IN7 A;  1EF1 A;  2R2O A;  3AE3 B;  4L2Y A;  5C2T B;  4YTM B;  2KTR A;  2KYW A;  3W5V B;  2ZW1 A;  2NR2 A;  1EUV B;  5G5G A;  3P42 A;  2HDE A;  3ZUN A;  2KKC A;  3FAH A;  3M62 B;  2O6V A;  3Q8B A;  1LXD A;  1J7C A;  4OZB A;  4A3O A;  1WIA A;  3L4P A;  2FCS A;  4ZRI A;  3VTV A;  4P1B C;  2PMV A;  1YQB A;  3PVL A;  3HHM A;  2D5G A;  4O1N A;  1CZP A;  3PRZ A;  3E56 A;  1F77 A;  4FLH A;  3ZXV A;  1MHH E;  2LUE A;  3V05 A;  3CF6 E;  1FNV A;  1QT9 A;  1D4B A;  2LUM A;  3AB5 A;  3NG0 A;  4YSY B;  3W9C B;  1ZP0 B;  3UGB B;  3KH0 A;  3RZF A;  2MBQ A;  2KOX A;  3BII D;  1GAQ B;  3A1Q B;  1UD7 A;  1IGD A;  4PYU A;  5C23 A;  2GMI C;  4MDK E;  2JRH A;  1OQQ A;  1K52 A;  2J53 A;  1BT0 A;  2JUO A;  4W9H A;  3QWZ B;  2QHO A;  2N4F A;  4B9K A;  4M8N A;  2D07 B;  3AED B;  2ZZP B;  3SFE B;  3SDL C;  1XXG A;  3VRB B;  4MGY E;  3N1Y C;  2D3B A;  2WDT B;  3QAR A;  4KGT A;  2LD9 A;  4GOC A;  3DBS A;  2D10 A;  1B9R A;  3MFG A;  4E74 A;  1JRP A;  2KWD A;  3OJ3 A;  2WXF A;  2JY6 A;  2D2Q A;  4K81 A;  1EF5 A;  1GB4 A;  1WH3 A;  4ACF A;  2IY0 B;  3PZ8 A;  1V8C A;  1R4N B;  2KXJ A;  4IC7 B;  2I2Y A;  3HVD A;  2K6Q A;  3ZDT A;  2BPS A;  4HEA 1;  3JVZ X;  4HWI B;  3L10 B;  3QJZ A;  5AUI A;  2L7R A;  5H92 C;  2NVU I;  2KFJ A;  2K39 A;  3DDC B;  1WGR A;  3P4P B;  4ZYN A;  4GN1 A;  2FE8 A;  1GUA B;  4MT5 A;  1N62 A;  2NPT A;  2K8H A;  1I4H A;  3DBH B;  3NUH B;  3QC8 B;  3ZRC A;  4IDI A;  4XWW A;  4DBG A;  1WWT A;  2L8J A;  4HCP B;  4W9L A;  1XQQ A;  2JZZ A;  1KF6 B;  1PDX A;  1D5Z C;  5C3J B;  1JAL A;  1E7U A;  2JYE A;  3W1S A;  4IWP A;  3K9P B;  4G11 A;  4ARI A;  2ZNV C;  1UNS A;  3WA0 A;  3A33 B;  2PLP A;  5EE9 A;  4LTU A;  5KHO A;  5EDS A;  3SD5 A;  4F8C B;  1C4A A;  2L32 A;  2DYO A;  4AUQ C;  3UI3 A;  4IM2 A;  3Q3O C;  3WCQ A;  3ZKJ C;  1JWS D;  4ANU A;  1EWY C;  4EEW A;  4BKS D;  2LGD A;  4F7Z A;  3U7D A;  5TSS A;  3AV8 A;  4K1R B;  4REZ A;  3NHE B;  1KLU D;  5E6N A;  2FUG 1;  4XWT A;  5JXV A;  4RFB A;  1UGM A;  3UIN B;  2J4X A;  4WWP A;  1K51 A;  3P4R B;  2FAZ A;  4YWG G;  3HUI A;  3AE5 B;  2HD5 B;  4ZDV A;  1TGZ B;  3A9J B;  2GOW A;  3L54 A;  2AEH A;  1C1Y B;  3DVG X;  1C4C A;  2BWE S;  4CHK A;  4KV2 A;  3BVG A;  2DWQ A;  2WXP A;  4MM3 A;  3P4S B;  2V3P A;  1WYW B;  1F52 A;  5E6P A;  1LGR A;  4K3B A;  1FNU A;  2J0J A;  2M8S A;  4JGH B;  4GB9 A;  1QLB B;  2MJ3 A;  2ON8 A;  2N9L A;  1E10 A;  2JZ3 B;  3LYY A;  3NOB A;  4BKS A;  1PGA A;  3GZN I;  1YX6 B;  2FIF A;  2ONQ A;  2RR9 A;  4BFR A;  1KOT A;  2CU3 A;  1T6B X;  2L05 A;  3HM3 A;  2CHX A;  4GGQ A;  5J18 A;  1ZKH A;  2BYT A;  4Q2J A;  4M01 A;  5IP4 D;  3AU4 A;  2ZEQ A;  3ZYY X;  4WQO B;  2KFK B;  3KYC D;  1RLF A;  1TKG A;  2QDF A;  1QOG A;  4A55 A;  1I4X A;  1TZO A;  1NDD A;  2V3N A;  1VCB A;  3WIM A;  4GDL A;  3ZTD A;  1N60 A;  4G50 A;  5IO9 A;  4RGN A;  4TMA B;  2C7H A;  2ZNV B;  3H7P A;  4K7S A;  3V6E B;  3QHT A;  2LVQ A;  2BKR B;  3HVZ A;  1NI2 A;  4FJZ A;  2WWZ A;  1HXY D;  3P2B A;  3M95 A;  2DAJ A;  3ZTC A;  3VR8 B;  2QC8 A;  3EEC A;  3AE2 B;  1F2R C;  3R8B A;  1VJK A;  4HLE A;  1DOI A;  1CK1 A;  3DPD A;  1JW9 D;  2J42 A;  3IT4 B;  2MX2 A;  2KDF B;  2XEW A;  4DXF A;  4XE0 A;  3VUX A;  4DWF A;  1YN5 A;  1FFV A;  5DPR A;  4NJ6 A;  3FKY A;  2K5P A;  5G2N A;  1P0R A;  1UEL A;  4MGK E;  3B0A A;  2NS5 A;  2QIL A;  1JWU D;  3UF8 A;  5D3I B;  1MG4 A;  1E0Z A;  2LXA A;  1XCT L;  3JSV A;  1GNU A;  3Q8C A;  2D11 A;  4TKN A;  2N1W A;  5DPS A;  4JX1 C;  2WXM A;  2KN5 A;  2WS3 B;  4EKU A;  3UIP B;  1WJ6 A;  2YVC A;  2H88 B;  2N9X A;  3OJ4 B;  1GPX A;  1TS2 A;  3QX1 A;  2J0K A;  1UUP A;  2K25 A;  1J7B A;  3U4E G;  2MBB B;  2PEA A;  2RDG A;  1F9J A;  4LNO A;  2MEK A;  4LDT B;  4DQO C;  1OEY J;  3HM6 X;  2OED A;  1VR9 A;  4HKZ E;  2KWC A;  2NTT A;  1XLP A;  1SIJ A;  4BBN C;  4A6Q A;  2QJL A;  3BWU D;  2G9H D;  1VD2 A;  2D3A A;  1ET6 A;  4TQ1 A;  2GLS A;  3RMK C;  1PFD A;  4KKJ A;  2FCN A;  3EFC A;  1OFF A;  1L0V B;  1YNT E;  1P7E A;  2R61 A;  4NZL B;  1HA5 A;  3UIO B;  2MHJ A;  2LJI A;  2Y5B B;  1R4M I;  1V80 A;  2GBK A;  1SB3 C;  4I6P A;  1WXQ A;  3N32 A;  2WXH A;  4HPM B;  2KDM A;  1E7V A;  1V1P A;  2REX A;  1FEH A;  1TTN A;  3VDZ A;  4NQL B;  5HKH A;  3H6N A;  1E90 A;  2Y3A A;  3ZW3 A;  1SE3 A;  2FUH B;  4NAW A;  2C5L C;  4OVV A;  3W1Y A;  1EM7 A;  1E5W A;  1FXT B;  3ZNZ B;  1TKY A;  5IKC M;  5GMV A;  1L7Y A;  2K3U A;  4ZHO A;  2ICI A;  1K53 A;  5JHB A;  2PPH A;  3LXF A;  1LO5 D;  1BML C;  1DGJ A;  3H8H A;  4YTP B;  2BS4 B;  3C8Y A;  3KYD D;  3J9C A;  1SE9 A;  4YTN B;  2UU7 A;  4DHJ D;  2RPQ A;  3Q8F A;  2LFI A;  4HJK A;  1WRD B;  3IT6 B;  3NRZ A;  3DOW A;  4LNI A;  1QOB A;  1WXM A;  4MEM A;  2FID A;  4M8M A;  2A4Z A;  3NJT A;  1I35 A;  3A9K A;  2G45 B;  1T0R C;  2LI5 A;  1ZXH A;  3GP7 A;  1TS4 A;  3HRD D;  2CS4 A;  3ABV B;  4BBN F;  3DHH C;  2LMC A;  1PYW D;  1C4P A;  2BVC A;  3TBL D;  4ANW A;  3VFK A;  2ZW0 A;  1RFA A;  3PT2 B;  3PZ7 A;  3HK0 A;  4LJO B;  4GDK B;  4X57 B;  1A5R A;  5JH5 C;  3ENE A;  1FIQ A;  1WFY A;  4A8X C;  3NZU A;  4AS1 A;  2L0T A;  1WMH B;  2PIA A;  5MPO A;  2LVO A;  2IGH A;  4GXB A;  2Y5C A;  1L0X B;  1D5M C;  4WWN A;  4M0W B;  3ZJU A;  2IPK D;  3RFZ B;  1WE6 A;  1QIL A;  2HE7 A;  2O6V D;  2W3S A;  1MJD A;  2O2V B;  2J7Q B;  1E8Y A;  1IYF A;  3L08 A;  3TMP B;  1WX8 A;  2GRI A;  4C4V A;  2IND C;  5CHV C;  2INP E;  3DHI C;  3K9O B;  4NY0 A;  2N7E A;  4XZ4 A;  5LXI B;  4F1S A;  4JWU C;  2WHI A;  3T3O A;  3RPF C;  1WR6 E;  3KVF B;  1QOA A;  2QEJ C;  2Q5W D;  3UQA A;  4KIK A;  3AEB B;  2LJ5 A;  1ZDV A;  4G0N B;  4UDU C;  3S2A A;  3TL5 A;  3U52 E;  2PW9 A;  3PRE A;  2KJ6 A;  5EE0 A;  4YL8 A;  3VR9 B;  2RPV A;  2LGS A;  3DBL I;  1PQS A;  5EE1 A;  1WRI A;  2RDB C;  2KQ4 X;  1W6V A;  2JZP A;  1V5O A;  2X38 A;  4YSZ B;  1JWA D;  2WXI A;  1XF5 L;  4ITK A;  5D2M B;  2JYT A;  3W5U B;  2XBB C;  2C60 A;  3DVN V;  4II3 B;  2RGF A;  2PJH A;  3ALB A;  1SXT A;  4ICV A;  3DHG C;  4HCN B;  2BGF A;  2PKO A;  2RMM A;  4K7W A;  3Q69 A;  2JWZ A;  3CMM B;  1UGJ A;  5D6J B;  2QSD A;  2WLB A;  1WM2 A;  2CU1 A;  5C1Z A;  1AAR A;  3EUB 2;  2WX0 A;  2RSU A;  2WYQ A;  2N1V A;  1M94 A;  2K8B A;  1QKZ A;  1MFW A;  4DXA B;  2LHD A;  1SIF A;  4JPS A;  2CHW A;  1VZ7 A;  1QQR A;  2NBU A;  2VZK B;  2WGS A;  2DNF A;  3AH7 A;  3FIL A;  4BAX A;  4WIP A;  2KQS A;  1SE2 A;  2WDQ B;  1WR1 A;  2JQR B;  2FBW B;  4G3X B;  5CTR C;  2BYE A;  1A70 A;  3LDZ E;  4J6I A;  4MGI E;  3KW5 B;  3BK2 A;  2KTR B;  1QF6 A;  3PGE A;  4AJW A;  3W1S C;  3AEA B;  4NAM A;  4HDQ A;  4W9D A;  3RNF C;  3L17 A;  4KSL C;  1WXA A;  3V60 A;  4GIV A;  4D2K A;  3QIJ A;  5E6O A;  3WAO A;  1YJJ A;  4MGZ E;  4B0M A;  2IY1 B;  3I3T B;  4C56 C;  1HZ5 A;  2XK5 A;  1XD3 B;  1TY2 A;  5DCN A;  3KQ4 A;  2C7M B;  2G1E A;  2DZM A;  1L6U A;  3VVW B;  1WGY A;  4A3P A;  3TJP A;  1WGK A;  4B0E A;  3ZQ4 A;  1KFY B;  1D3Z A;  3LJ3 A;  2WXR A;  2BS3 B;  3ZGZ A;  3N3K B;  3MHS D;  2BF8 B;  2Z8L A;  2JWU A;  2I1K A;  3JW0 X;  1C78 A;  1L2N A;  3BVM A;  2JU6 X;  4LCD E;  2C9W B;  4S0R A;  3VXW A;  2KDI A;  2JRI B;  4W9C A;  5BYR A;  2L76 A;  3PLV A;  2W54 A;  4FN2 A;  2TSS A;  1WZ0 A;  2L3Z A;  1FCC C;  2K0P A;  3KWL A;  4JLC A;  3SHQ A;  4BKG A;  1YJI A;  2XN9 C;  3ONS A;  1C76 A;  4JQW C;  4EOY A;  1RM6 C;  2KFK A;  4ZRQ A;  4K3C A;  3H7S A;  3BIN A;  1T0Q C;  3AXC A;  3IVF A;  3PV1 A;  2IO1 B;  2IO2 B;  2IDY A;  4N58 A;  5HI1 A;  1DOX A;  1BUI C;  1ZOY B;  2IGG A;  5BMG A;  1WF9 A;  4PS3 A;  3U8Z A;  3PZD A;  1VZ8 A;  2V1Y A;  2LVP A;  1NEK B;  3QK0 A;  1WI0 A;  4EZK A;  4KZC A;  1SJH D;  2G4S A;  1IBX A;  1C79 A;  1MVK A;  1TJE A;  3AN1 A;  2C7N B;  2NPT B;  5JHA A;  1Q1O A;  1P9D U;  1AYF A;  4KKI A;  3MJW A;  4YSX B;  2AQ3 B;  4RGO S;  1GG3 A;  2IJ0 A;  3P4Q B;  2R2Q A;  2JX5 A;  1J7A A;  4CO7 A;  2PE9 A;  3IXS A;  2WP9 B;  1N5W A;  4MAC A;  2IGD A;  4RGM A;  3PLU A;  2M0X A;  3Q3J A;  1I4Q A;  2D3C A;  4DXG A;  1AWD A;  2L52 A;  1ZE3 D;  1WGH A;  3R2I A;  2DX5 B;  1WGD A;  4N9F 4;  1SBB B;  3VTW A;  3AMZ A;  3DBR I;  1UZX B;  2WXJ A;  1WGG A;  3VQI A;  2N0S B;  2EKE C;  3RI7 C;  5BYS A;  3MTN B;  3U7Z A;  4LJP B;  3RN9 C;  1TKE A;  2OOB B;  3QAQ A;  3D32 A;  4A90 A;  2LHE A;  4L23 A;  3VHT C;  4PK1 A;  3B9J A;  1E8X A;  1OEY A;  1T0Y A;  1FPY A;  3PO0 A;  2CHZ A;  5HFY A;  3WAL A;  3DWM A;  2EEL A;  2KMA A;  1MI0 A;  3PTF C;  5CX3 A;  3GE8 C;  4MH8 A;  2CJO A;  1MG8 A;  2I1J A;  2MP2 A;  4PYZ A;  3OG5 A;  2ZJD A;  4WUR A;  1KTK A;  5LNK 1;  2KK8 A;  4KDL B;  1TZ1 A;  5AUK A;  4M00 A;  2KVZ A;  2KJH B;  5FR3 A;  2V0G A;  1XT9 B;  3ML8 A;  4FBJ B;  4MM3 B;  3CSF A;  4HRO A;  1V97 A;  1JRO A;  2BBC A;  2K9X A;  2EKI A;  1YN3 A;  4N6E B;  4ZRJ A;  3RUI B;  4HXD A;  3VRA B;  5H8Y E;  3WAN A;  2LZ6 A;  2DAF A;  1ZXI A;  4I6L B;  1C77 A;  2GI9 A;  3SR6 A;  4FHK A;  2BWF A;  2ZCB A;  3ZO5 B;  1YD8 U;  2MBO A;  3ZNH B;  2UYZ B;  1HQR D;  5AZG A;  1V2Y A;  3NVW A;  3ML9 A;  2WXN A;  3ZVV A;  1OTR B;  4WJO A;  2KMC A;  2WX1 A;  2KVR A;  2WU5 B;  4NJ7 A;  3RT3 B;  2WXG A;  2ACZ B;  4XDD A;  4GSW A;  2VH1 A;  2LGX A;  3AE6 B;  4KGR A;  5J17 A;  3NS1 A;  2LGI A;  5JZE B;  2BW2 A;  4GDL B;  4P6V F;  2DEN B;  3H7P B;  1P7F A;  1FXA A;  1P98 A;  2KZR A;  2WDR B;  1VZ6 A;  4IM3 A;  1JML A;  3IFW B;  5L95 C;  3T8M A;  4RH6 A;  3M63 B;  1Z2M A;  5AZF A;  1J8C A;  4KVG B;  4US9 A;  1GC7 A;  1ZDX A;  2DZK A;  2BYV E;  3EC8 A;  3VUW A;  3AE7 B;  1OQY A;  4BVU C;  2JT4 B;  4K7U A;  2VH2 A;  3LMN A;  1WXV A;  2MQJ A;  4HKQ A;  3V6C B;  1XO3 A;  1WSP A;  1U4A A;  2OJR A;  1HTQ A;  2PE6 B;  1Q5W B;  1NEN B;  1KJT A;  4USA A;  4P16 A;  3JSV B;  2GBM A;  1JQ4 A;  2L83 A;  2WXQ A;  4HPP A;  4WJP A;  1N61 A;  4GDK A;  2GB1 A;  2BYF A;  1PGB A;  4P1C C;  3EHV A;  3MJ5 A;  3APD A;  2UWQ A;  3N30 A;  3V61 A;  1WMH A;  4GMV A;  2AQ1 B;  5IAA C;  1R7S A;  1R4N I;  2KAC A;  3CIR B;  1NYR A;  3C0R B;  1FO4 A;  2W9N A;  2KMM A;  4AJY B;  1ENF A;  3AI5 A;  1UBI A;  1GOZ A;  4OW0 A;  5FR6 A;  5LXH A;  3DBH I;  3AE8 B;  4YT0 B;  4LNF A;  5AEK B;  4HPL B;  4IKG A;  4XYC A;  3NY5 A;  2RD0 A;  3A4S C;  3VH3 B;  3N9Y C;  3QQ8 B;  4RM8 A;  4ZOH C;  3MC8 A;  1WM3 A;  3R66 C;  5EE3 A;  2MLB A;  4NJC A;  3UQB A;  3GZN B;  2FCQ A;  4B6W A;  1WZ3 A;  1YN4 A;  3FC4 A;  3APF A;  2M0A A;  2KWU B;  1I4G A;  4AOF A;  5GXG B;  3T9L A;  2V9H A;  2KJR A;  4XX5 A;  1V1P B;  1ACC A;  4IUM B;  1RRB A;  3N1X C;  2MBE A;  2NMQ A;  1Y56 A;  1E6E B;  2AL3 A;  2M56 B;  3Q14 C;  3SU8 X;  2IYD B;  1VRA B;  4II2 B;  1FMA D;  2KO3 A;  1XLN A;  3AE4 B;  4RCO A;  3GS2 A;  2OHF A;  2KX0 A;  2Z0D B;  5BYQ A;  1WE7 A;  4MH0 E;  4FHJ A;  3A1Q A;  3SEB A;  4ASW C;  2WQY B;  2B76 B;  4PS7 A;  2JXX A;  1EO6 A;  5IOI A;  4JWS C;  1RFK A;  1TT5 B;  4MJS B;  5G5H A;  5HHD G;  3ZNG C;  2H89 B;  4ICU A;  2KD0 A;  3Q6B A;  4XDC A;  5BO4 B;  4DDG D;  3L13 A;  3GE3 C;  2K8C A;  1XLO A;  2BTE A;  4LNN A;  4E71 A;  2KDE B;  3X0W A;  1J19 A;  3IAS 1;  3VAW A;  1Q0W B;  1K50 A;  2KC1 A;  5BMI A;  2V3S A;  3DVG Y;  1I4P A;  3TEX A;  2YEP F;  1ROE A;  3CWI A;  3P1M A;  2AQ2 B;  5L83 A;  3AE9 B;  2DZJ A;  3NS8 A;  1I4R A;  1V6E A;  2YEP B;  3T3N A;  1STE A;  1VDV A;  2G3Q B;  1WX9 A;  3TSS A;  2WDV B;  2K1F A;  3I63 C;  2BT6 A;  2CJN A;  4DHJ B;  1PUT A;  3BVZ A;  3RNE C;  4LK0 M;  4ZRP A;  3NVY A;  2B3A A;  4OHJ A;  4AP4 C;  4EZJ A;  2LAS A;  4S17 A;  4WJQ A;  1UF0 A;  2BKF A;  1SEB D;  3V62 A;  2MW5 A;  1RAX A;  1OGW A;  3WAP A;  3OWE B;  1YJ1 A;  1XEE A;  1N63 A;  1WJU A;  2PTL A;  2OJW A;  4C4V B;  1QZE A;  2N7J A;  2KX3 A;  2CR5 A;  4FJV B;  3N20 C;  3NVZ A;  1L5P A;  4KDI C;  1J0G A;  2M17 A;  2DYM A;  1JWM D;  1R4M B;  1JRU A;  2FCM A;  1KH0 A;  2N9P C;  4OZA A;  4ARC A;  1S3S G;  3CST A;  4OVU A;  3EFU A;  3W2D A;  2N7D A;  2IO0 B;  3PPA A;  2Z59 B;  2LWP A;  3N1Z C;  3ZXR A;  4CQN A;  1P3Q U;  1Z5S B;  4KIK B;  2BQQ A;  3MP9 A;  4XC2 A;  1ET9 A;  4LNK A;  2EMT A;  3BYT B;  4ZHP A;  4E3C A;  3O65 B;  2AWT A;  1WJ4 A;  3NVV A;  3AE1 B;  4PS8 A;  2O6V B;  5LLI A;  3LB8 C;  3KLS X;  5D94 A;  2CKH B;  4N59 A;  3Q2A C;  3APC A;  2KAN A;  3VH4 B;  3ZLZ A;  2HTM E;  3A9J A;  1NVI D;  2NTS A;  3B1L X;  1X1M A;  2W3R A;  2Y5P A;  4RF1 A;  2JVC A;  3PSE B;  2PVO D;  1WY8 A;  3PRP B;  2MRP A;  2VRR B;  2J52 A;  4HDO A;  4C00 A;  5DPW A;  2JXT A;  1UWM A;  1V86 A;  2W55 A;  3GOE A;  3PHX B;  3QCA A;  4RF0 A;  2DYB A;  4P7I A;  4TUU A;  2LGY A;  4WH4 A;  3AEE B;  1TBE A;  1YQ3 B;  3PHW B;  3V3X A;  1DOY A;  4YXD B;  2WU2 B;  4FJY A;  3R3M A;  4RGT A;  3FIL B;  1WXS A;  4W9J A;  1V81 A;  1S1Q B;  2XNA C;  3ETR A;  1GC6 A;  2M19 A;  1F2R I;  3C19 A;  4RM9 A;  2MJD A;  3U2S C;  4KSK C;  2PVG C;  4BKT A;  1DYQ A;  1L4D B;  2KC2 A;  3A4R A;  2BS2 B;  4ZRK A;  3VTU A;  3Q3N C;  3H1U A;  1ZPS A;  2G4D B;  2AL6 A;  2E6X A;  4WAF A;  1V5T A;  2L00 B;  2L0F A;  4C7Y A;  1F0Z A;  3QA8 A;  2KNB A;  4LDT D;  3RNC C;  2XK5 B;  4KZ0 A;  1WJN A;  5HG2 A;  3PS6 A;  1GB1 A;  2ZVN A;  4US8 A;  1SE4 A;  3B08 A;  1NYQ A;  3X23 A;  1AN8 A;  1N6Z A;  4PT5 A;  1ZGU B;  4IM0 A;  4EE2 A;  4FAD A;  1EU3 A;  5D3D A;  3DWG C;  3TCA A;  2KWV B;  5IA7 A;  4IOI E;  2BB5 A;  1CQV A;  3AEF B;  3DVN U;  1FNW A;  3U30 A;  5BMH A;  3ZJT A;  2HTH A;  4EZL A;  3Q8A A;  2WXL A;  3TIX A;  2KHW B;  1HTO A;  4W9K A;  5TR5 A;  2KLG A;  1E7P B;  2M4N A;  4R3D A;  3VUY A;  3TEW A;  2LRU A;  5FK9 C;  1LQB A;  3ZJV A;  4W9G A;  4EFO A;  4GU2 A;  2HJ1 A;  2NCN A;  3HIZ A;  4WWO A;  3DBL B;  3ZRF A;  4MSM B;  4JIO U;  4JL9 A;  3BYY B;  1FM0 D;  3RNA C;  3Q8E A;  4HK2 A;  2WXO A;  4W9I A;  3AUL A;  3JYU A;  3NZ3 A;  3TUO A;  3IG3 A;  1MPE A;  4L1B A;  2MCN B;  4TV3 A;  4MEL A;  5D7G A;  2WXK A;  3AEC B;  1FD6 A;  2W82 A;  4CYE A;  5CHW A;  1QOF A;  2L1A A;  4ZYS A;  1FXI A;  1IPG A;  1GJZ A;  4M02 A;  1CMX B;  2DHZ A;  2HJ8 A;  4OVZ A;  4HRS A;  3MC9 A;  1T5X D;  1IBX B;  2NBW B;  5J2R A;  1KRH A;  1T3Q A;  1ZW7 A;  2YLM A;  4DK5 A;  1V1O A;  2V4L A;  1HEZ E;  1TS5 A;  2ZPN A;  2EMS A;  1JWB D;  2NBV B;  2X8X X;  4ANV A;  1SJE D;  2LEK A;  1LFD A;  4I6N B;  3L0W B;  4C7Z A;  2BB6 A;  3M3J A;  1OQR A;  4DHZ E;  1XLQ A;  5I4D A;  1L0Y B;  4FXC A;  2V4I B;  3RZW C;  3URY A;  4NNJ B;  4KGS A;  4ANX A;  1WYG A;  3DCG A;  2MA9 B;  5CHF A;  4A20 A;  3RCZ A;  4RNA A;  1FRD A;  2SAK A;  1V9J A;  3KUD B;  2M1M A;  1VLB A;  2IO3 B;  2QCZ A;  2INN E;  2ASQ A;  1MHX A;  3Q3M C;  1C3T A;  3B2F A;  3PRM B;  4GLS C;  3I5J C;  2JSV X;  4BZA A;  2RDH A;  3Q3F A;  1NI3 A;  3IAM 1;  4H2A A;  3R2T A;  1H8C A;  4IWQ A;  2Z0E B;  5T8I A;  2SEB D;  4KX6 B;  2KQ7 A;  2MP2 B;  1NBF C;  2JF5 A;  4LLG M;  4TQ0 A;  1LM8 B;  1TY0 A;  1UWX A;  4DDI D;  3GB1 A;  1AW7 A;  4A9A A;  1CJE A;  3BZD B;  3IHP C;  1KM7 A;  1EWC A;  2KN4 A;  3KUZ A;  1G6J A;  1Q10 A;  4WAA A;  1I7H A;  1SGH A;  1I42 A;  2KAJ A;  4BOZ B;  3KUC B;  1KLV A;  4DHZ B;  1TYG B;  1IUE A;  4J3O D;  3B2G A;  3R7Q A;  1YIW A;  2IZV B;  4M0W A;  2INC C;  4QAY A;  1L4Z B;  2GBN A;  4NPN A;  2A5U A;  4WQM A;  3WAM A;  3MHZ A;  3ZIM A;  3OAW A;  1KLG D;  2KDB A;  4JE3 B;  5AZH A;  3OLM D;  4HJG E;  2O2V A;  4XGA B;  1D6E C;  4AQ7 A;  1HZ6 A;  3MC0 B;  4W9E A;  1B1Z A;  2AYO B;  3L16 A;  1K8R B;  4HVB A;  4IWO A;  4C80 A;  2ZCC A;  3RNG C;  4RMA A;  2K6D B;  4FA6 A;  2ZPY A;  5DPT A;  1UH6 A;  4MJS A;  3SFD B;  2LXC A;  2D3G A;  1M4V A;  1BXT A;  4WJN A;  3ZNI D;  4MSQ B;  2QIE B; 
#chains in the Genus database with same CATH homology
 2IO1 B;  2KN5 A;  4WJQ A;  4B95 A;  2LRW A;  4EKU A;  1WX7 A;  2IO2 B;  3UIP B;  1WJ6 A;  2BKF A;  2IBI B;  1E8Z A;  2YVC A;  3V62 A;  2MW5 A;  1IP9 A;  1RAX A;  4AWJ A;  2N9X A;  3OJ4 B;  1OGW A;  3QX1 A;  2MWS B;  2J0K A;  1UBQ A;  3WAP A;  1WF9 A;  2K25 A;  2KLC A;  4PS3 A;  3U8Z A;  3PZD A;  1YJ1 A;  2V1Y A;  2LVP A;  2MBB B;  1WJU A;  2PEA A;  1E8W A;  1QZE A;  2KX3 A;  3QK0 A;  2CR5 A;  4FJV B;  1WI0 A;  4EZK A;  3DQV A;  4KZC A;  1F9J A;  2G4S A;  4LDT B;  4KDI C;  1J0G A;  2M17 A;  1OEY J;  2C7N B;  2NPT B;  3HM6 X;  3NZS A;  5JHA A;  4EUT A;  2DYM A;  1Q1O A;  1P9D U;  1JRU A;  2FCM A;  2N9P C;  4NAW B;  1HE8 A;  3MJW A;  1S3S G;  3CST A;  4OVU A;  3EFU A;  2KWC A;  3ECI A;  1GG3 A;  2N7D A;  2IO0 B;  2MSE D;  3AU5 A;  3PPA A;  2Z59 B;  2R2Q A;  5KHQ A;  2LWP A;  4CO7 A;  2PE9 A;  4BBN C;  5G55 A;  2J0M A;  1V49 A;  1P3Q U;  1VD2 A;  1Z5S B;  2GBJ A;  4KIK B;  2KTF A;  3PLU A;  4XC2 A;  3RUL A;  2M0X A;  3Q3J A;  4NQK E;  4TQ1 A;  4W9F A;  3BY4 B;  2EMT A;  4E3C A;  3O65 B;  2AWT A;  1WJ4 A;  2FCN A;  2JPH A;  3ZDM C;  4PS8 A;  1WGH A;  2O6V B;  1Y8R C;  5LLI A;  4FUL A;  3IBE A;  2DX5 B;  1WGD A;  4N9F 4;  1ISN A;  5D94 A;  2CKH B;  3VTW A;  3APC A;  2KAN A;  3H9D A;  4IG7 B;  3VH4 B;  3DBR I;  1UZX B;  3UIO B;  3ZLZ A;  3A9J A;  1P1A A;  2Y5B B;  2ZVO A;  1R4M I;  1WGG A;  3VQI A;  2EKE C;  1H4R A;  1V80 A;  3B1L X;  2N9E B;  2GBK A;  3MTN B;  4I6P A;  1X1M A;  3N32 A;  4LJP B;  4BOS C;  3RD2 A;  2OOB B;  3QAQ A;  4HPM B;  3D32 A;  2JVC A;  1E7V A;  3VHT C;  2REX A;  1TTN A;  3R7R A;  3VDZ A;  1E8X A;  4NQL B;  1OEY A;  1T0Y A;  1YX5 B;  3PSE B;  5HKH A;  4URK A;  3H6N A;  1E90 A;  1WY8 A;  2MBH A;  2CHZ A;  2FUH B;  3PRP B;  3A9K B;  4NAW A;  3ZW3 A;  2C5L C;  2MRP A;  4OVV A;  2VRR B;  3W1Y A;  3WAL A;  4HDO A;  2KMA A;  5DPW A;  2GBR A;  4IW0 A;  1E5W A;  1FXT B;  3PTF C;  5CX3 A;  3RYT A;  1V86 A;  2DZI A;  3ZNZ B;  2FNJ B;  3GOE A;  3PHX B;  1EF1 A;  2R2O A;  3QCA A;  2DYB A;  4P7I A;  4TUU A;  5GMV A;  1MG8 A;  1L7Y A;  2I1J A;  2LGY A;  2KTR A;  2MP2 A;  5JHB A;  4PYZ A;  2PPH A;  2ZJD A;  1TBE A;  2NR2 A;  2KK8 A;  4KDL B;  1TZ1 A;  1EUV B;  3PHW B;  2KJH B;  3KYD D;  1XT9 B;  3ML8 A;  3ZUN A;  4FBJ B;  2KKC A;  3M62 B;  2O6V A;  3CSF A;  1LXD A;  1SE9 A;  4FJY A;  3R3M A;  4A3O A;  1WIA A;  4ZRJ A;  3RUI B;  4DHJ D;  2RPQ A;  1WXS A;  2FCS A;  1V81 A;  4HXD A;  4W9J A;  4ZRI A;  4HJK A;  1S1Q B;  3VTV A;  3WAN A;  1GC6 A;  1YQB A;  3PVL A;  3HHM A;  3PRZ A;  2LZ6 A;  1WRD B;  2DAF A;  3DOW A;  4RM9 A;  4I6L B;  1WXM A;  4FLH A;  4KSK C;  4MEM A;  2FID A;  2LUE A;  4FHK A;  4M8M A;  2BWF A;  4BKT A;  3CF6 E;  2KC2 A;  3A4R A;  2ZCB A;  3ZO5 B;  2A4Z A;  1YD8 U;  2MBO A;  3ZNH B;  2UYZ B;  5AZG A;  1V2Y A;  3UGB B;  1I35 A;  3A9K A;  2G45 B;  3KH0 A;  3ML9 A;  2MBQ A;  4ZRK A;  3RZF A;  2LI5 A;  3H1U A;  3VTU A;  3ZVV A;  2KOX A;  3A1Q B;  2G4D B;  2CS4 A;  1OTR B;  1UD7 A;  2AL6 A;  4WJO A;  1V5T A;  4BBN F;  2KMC A;  2WX1 A;  2KVR A;  4NJ7 A;  2L00 B;  2L0F A;  4PYU A;  5C23 A;  2GMI C;  3RT3 B;  4MDK E;  2JRH A;  3QA8 A;  2KNB A;  3TBL D;  4LDT D;  4ANW A;  1BT0 A;  2XK5 B;  4GSW A;  3VFK A;  4KZ0 A;  2JUO A;  4W9H A;  3QWZ B;  2LGX A;  1WJN A;  2N4F A;  2QHO A;  1RFA A;  5J17 A;  3PT2 B;  4LJO B;  3HK0 A;  4B9K A;  4M8N A;  3PS6 A;  4GDK B;  4X57 B;  5JZE B;  5JH5 C;  1A5R A;  2ZVN A;  3ENE A;  1WFY A;  2D07 B;  3B08 A;  3NZU A;  2ZZP B;  2L0T A;  4GDL B;  3SDL C;  1WMH B;  3X23 A;  4MGY E;  2LVO A;  2DEN B;  3H7P B;  2WDT B;  4GXB A;  3QAR A;  1ZGU B;  4IM0 A;  1P98 A;  2KZR A;  2LD9 A;  4GOC A;  4WWN A;  4IM3 A;  3DBS A;  4FAD A;  2D10 A;  4M0W B;  3IFW B;  5L95 C;  3TCA A;  2KWV B;  3T8M A;  5IA7 A;  3DVN U;  4E74 A;  1WE6 A;  3M63 B;  1Z2M A;  3U30 A;  5AZF A;  1J8C A;  3OJ3 A;  2HTH A;  2JY6 A;  2D2Q A;  2HE7 A;  4K81 A;  1EF5 A;  3TIX A;  4EZL A;  2O6V D;  4KVG B;  2KHW B;  1WH3 A;  2IY0 B;  2O2V B;  1GC7 A;  4W9K A;  5TR5 A;  2KLG A;  2KXJ A;  2BYV E;  2DZK A;  3EC8 A;  4IC7 B;  2M4N A;  3VUW A;  2J7Q B;  1E8Y A;  1OQY A;  2K6Q A;  2JT4 B;  3ZDT A;  2BPS A;  4BVU C;  4K7U A;  3JVZ X;  4HWI B;  3VUY A;  1IYF A;  3LMN A;  3L10 B;  3L08 A;  3QJZ A;  2LRU A;  3TMP B;  1WX8 A;  2L7R A;  1WXV A;  2MQJ A;  1LQB A;  2NVU I;  2KFJ A;  2K39 A;  4W9G A;  3DDC B;  3V6C B;  4EFO A;  4GU2 A;  1WGR A;  4ZYN A;  2NCN A;  1U4A A;  2OJR A;  3HIZ A;  4GN1 A;  4WWO A;  5CHV C;  3ZRF A;  1GUA B;  2PE6 B;  1Q5W B;  4MSM B;  1KJT A;  3K9O B;  4JIO U;  4JL9 A;  4NY0 A;  2N7E A;  2NPT A;  2K8H A;  4XZ4 A;  5LXI B;  3JSV B;  3QC8 B;  2GBM A;  3ZRC A;  4F1S A;  4WJP A;  4GDK A;  2BYF A;  4DBG A;  4HK2 A;  2L8J A;  4HCP B;  4W9L A;  1XQQ A;  3EHV A;  2JZZ A;  1WR6 E;  3KVF B;  3APD A;  2UWQ A;  3N30 A;  4W9I A;  3V61 A;  1WMH A;  4GMV A;  3AUL A;  1E7U A;  3JYU A;  3W1S A;  4IWP A;  3IG3 A;  5IAA C;  3UQA A;  4KIK A;  3K9P B;  4G11 A;  2LJ5 A;  1R4N I;  2MCN B;  2ZNV C;  4TV3 A;  4MEL A;  5D7G A;  3C0R B;  3WA0 A;  4G0N B;  3S2A A;  3A33 B;  3TL5 A;  5KHO A;  5EDS A;  3SD5 A;  4CYE A;  5CHW A;  2W9N A;  4F8C B;  1IPG A;  2DYO A;  4AJY B;  1GJZ A;  3PRE A;  2KJ6 A;  1CMX B;  2DHZ A;  2HJ8 A;  3AI5 A;  4YL8 A;  3DBL I;  4AUQ C;  1UBI A;  2NBW B;  5J2R A;  1PQS A;  4IM2 A;  5FR6 A;  5LXH A;  1ZW7 A;  2YLM A;  4DK5 A;  3DBH I;  1W6V A;  2V4L A;  3ZKJ C;  4ANU A;  2ZPN A;  5AEK B;  1V5O A;  2EMS A;  4HPL B;  4EEW A;  4BKS D;  2LGD A;  2NBV B;  4F7Z A;  3NY5 A;  4ANV A;  5DPS A;  2RD0 A;  3A4S C;  5D2M B;  3U7D A;  3VH3 B;  1LFD A;  4I6N B;  4K1R B;  3QQ8 B;  2XBB C;  2C60 A;  3DVN V;  4RM8 A;  3L0W B;  4II3 B;  3M3J A;  2RGF A;  3NHE B;  2PJH A;  5E6N A;  1WM3 A;  3R66 C;  3ALB A;  4ICV A;  4HCN B;  2BGF A;  4DHZ E;  2MLB A;  4K7W A;  3UQB A;  1UGM A;  3UIN B;  3RZW C;  4WWP A;  2JWZ A;  4NNJ B;  3CMM B;  4ANX A;  5D6J B;  3DCG A;  2MA9 B;  5CHF A;  2FAZ A;  4A20 A;  1WM2 A;  3RCZ A;  2FCQ A;  2CU1 A;  2HD5 B;  4ZDV A;  1TGZ B;  5C1Z A;  4B6W A;  1WZ3 A;  1AAR A;  3A9J B;  2GOW A;  1V9J A;  2WX0 A;  2M1M A;  3KUD B;  3L54 A;  2AEH A;  2IO3 B;  3APF A;  1C1Y B;  2RSU A;  3DVG X;  2WYQ A;  4CHK A;  2BWE S;  2N1V A;  4KV2 A;  2KWU B;  1M94 A;  2ASQ A;  4AOF A;  4MM3 A;  2K8B A;  4DXA B;  3T9L A;  1C3T A;  1SIF A;  2CHW A;  2KJR A;  3PRM B;  1WYW B;  4XX5 A;  5E6P A;  2NBU A;  2J0J A;  2M8S A;  2KQS A;  4JGH B;  4GB9 A;  1WR1 A;  4IUM B;  1RRB A;  3Q3F A;  4G3X B;  2JZ3 B;  2MBE A;  5CTR C;  3NOB A;  4BKS A;  2BYE A;  1H8C A;  2AL3 A;  4IWQ A;  2Z0E B;  3LDZ E;  3GZN I;  1YX6 B;  4J6I A;  3SU8 X;  2FIF A;  2RR9 A;  2IYD B;  4MGI E;  4BFR A;  4II2 B;  3KW5 B;  2KO3 A;  1KOT A;  2KQ7 A;  2KTR B;  2L05 A;  2MP2 B;  1NBF C;  2JF5 A;  3PGE A;  4AJW A;  3HM3 A;  2CHX A;  3W1S C;  4TQ0 A;  1LM8 B;  4HDQ A;  4GGQ A;  4W9D A;  5J18 A;  3L17 A;  2KX0 A;  2Z0D B;  4KSL C;  1ZKH A;  1WE7 A;  4MH0 E;  4FHJ A;  1WXA A;  4DDI D;  3A1Q A;  3V60 A;  4GIV A;  3AU4 A;  4ASW C;  3IHP C;  3QIJ A;  5E6O A;  1KM7 A;  2ZEQ A;  4PS7 A;  2JXX A;  1EO6 A;  3KUZ A;  4WQO B;  3WAO A;  2KFK B;  3KYC D;  4MGZ E;  4MJS B;  1G6J A;  1RLF A;  3ZNG C;  4WAA A;  2IY1 B;  3I3T B;  4ICU A;  2KD0 A;  2XK5 A;  1XD3 B;  5DCN A;  1SGH A;  5BO4 B;  1I42 A;  4DDG D;  2C7M B;  4BOZ B;  3L13 A;  2K8C A;  2DZM A;  1NDD A;  4E71 A;  1VCB A;  3WIM A;  3KUC B;  1KLV A;  2KDE B;  4DHZ B;  3VVW B;  1WGY A;  4GDL A;  3ZTD A;  4G50 A;  3X0W A;  4A3P A;  3TJP A;  1J19 A;  3VAW A;  1Q0W B;  2C7H A;  2ZNV B;  3H7P A;  4K7S A;  3V6E B;  2KC1 A;  1D3Z A;  3LJ3 A;  3R7Q A;  3QHT A;  1YIW A;  2V3S A;  2LVQ A;  3DVG Y;  2BKR B;  2IZV B;  1NI2 A;  4FJZ A;  3N3K B;  3MHS D;  2BF8 B;  2GBN A;  2WWZ A;  4NPN A;  3P2B A;  2A5U A;  3M95 A;  2I1K A;  2DAJ A;  3JW0 X;  3WAM A;  3ZTC A;  3ZIM A;  3OAW A;  5L83 A;  1L2N A;  2DZJ A;  3NS8 A;  3EEC A;  2KDB A;  5AZH A;  4LCD E;  2C9W B;  3VXW A;  3OLM D;  2O2V A;  1V6E A;  2KDI A;  4HLE A;  3DPD A;  2G3Q B;  1WX9 A;  2JRI B;  4W9E A;  4W9C A;  2AYO B;  2MX2 A;  2KDF B;  2XEW A;  3L16 A;  2K1F A;  1K8R B;  2L76 A;  3VUX A;  3PLV A;  4DWF A;  4HVB A;  4FN2 A;  5DPR A;  4IWO A;  4NJ6 A;  2ZCC A;  2L3Z A;  1WZ0 A;  4RMA A;  5G2N A;  4JLC A;  3SHQ A;  2K6D B;  4BKG A;  1P0R A;  1UEL A;  4MGK E;  4FA6 A;  2ZPY A;  3B0A A;  3ONS A;  4JQW C;  5DPT A;  4EOY A;  1UH6 A;  2KFK A;  2NS5 A;  4MJS A;  3UF8 A;  4DHJ B;  3H7S A;  2LXC A;  2D3G A;  2LXA A;  3JSV A;  1GNU A;  3BIN A;  2D11 A;  4TKN A;  2N1W A;  3AXC A;  3IVF A;  2B3A A;  4WJN A;  3ZNI D;  4AP4 C;  3PV1 A;  4MSQ B;  4EZJ A;  2LAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...