1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
1DJRD 1PRTD 1XTCD 5ELBA 4RH6A 1SBBB 5ELFA 1FNVA 1PTOB 5FK9C 1ET6A 3BYTB 1LTID 3O13A 4RFBA 1LTAD 1FNUA 1TY2A 1SXTA 1G8ZD 4BWGB 2Z8LA 1BXTA 2AQ1B 1SE3A 1PZID 1KLUD 2CHBD 3MFGA 1S5CD 1LTRD 3BZDB 1HA5A 1QILA 1I4XA 1EFID 5TSSA 1S5ED 1TS2A 2NTTA 1BCPB 1LT4D 3DWAA 1M4VA 2RDHA 1EU4A 1TS5A 1YN4A 1JR0D 2R61A 1CQVA 1LTGD 1SJED 1SE2A 2XNAC 1PTOC 2XN9C 1D6EC 1YN3A 3BVGA 3TSSA 1L0YB 1PTOF 4DXFA 1LTTD 3GP7A 2ICIA 3V05A 1D5MC 2QILA 1STEA 2IJ0A 1V1OA 3SEBA 1JWSD 1UNSA 1XXGA 3W2DA 1V1PB 1LO5D 4RHSA 4RGOS 1L0XB 1LT3D 4OHJA 3CHBD 1LT5D 4C56C 5I4DA 1YN5A 1JWUD 1I4PA 3EA6A 4DXGA 1PTOH 5ELDA 1I4RA 4ZYSA 1JQYD 1CT1D 1RCVD 1TS3A 1PTOD 1PZKD 1AW7A 1AN8A 1RD9D 4TSSA 1SJHD 4NZLB 1ET9A 1EEID 1B44D 1F77A 1I4HA 1BCPC 4RCOA 1JWMD 3BVZA 2XRQD 4O1NA 1CK1A 1SE4A 3OWEB 1D5ZC 1JCKB 1CHQD 1EWCA 1PRTC 1S5BD 2QEJC 1S5FD 1RDPD 4L6TB 4Z9CB 1PYWD 1FD7D 2G9HD 1DYQA 2IPKD 5FKAC 5D3IB 1EU3A 1HXYD 1LLRD 3EFXD 1FGBD 1GOZA 1TS4A 3KLSX 1EEFD 3MC0B 1LTSD 2XRSD 1S5DD 1BCPD 4RHRA 1FNWA 1UUPA 2NTSA 2SEBD 1CHPD 1D5XC 3BYYB 3DWQA 1LTBD 1MD2D 5ELEA 1T5XD 1SEBD 1HQRD 3BVMA 1PRTF 1HTLD 2TSSA 4RGNA 5ELCA 1ESFA 1V1PA 3R2IA 3DWPA 1I4QA 1RF2D 4L63B 2RDGA 4RGMA 3R8BA 1ENFA 2WV6D 2AQ2B 3R2TA 2O2LD 1LT6D 2AQ3B 1BCPF 1KTKA 1PZJD 4K6LA 1B1ZA 1I4GA 1TY0A 3URYA 4UDUC 1KLGD 2J4XA 4RGTA 1PRTB 5D3DA
chains in the Genus database with same CATH superfamily
2YU9H 5ELBA 3IKJA 3P4PB 1B3QA 5C4ZA 4BBRH 2JA5H 4JI7L 5M5WB 1SB3C 4NJ6A 3ZUNA 2F0JA 1CZPA 4X62L 2E5LL 1SXTA 4PV1C 5K36G 1H9KA 3RZFA 1XYIA 1Z5SB 3PIOA 1SNCA 3VQIA 2WB1G 1YJ1A 3E56A 2QIEB 2LGDA 3FKIG 2N7EA 3NBIA 4BFRA 5IWAQ 3EIVA 2X69A 3DHQA 4NB3A 2PE6B 3L3OC 4A3IG 4F7XA 1G2SA 4DR1L 2K7VA 1TQOA 1GAQB 4EKUA 1I5FA 2N8NA 5K5PA 4C3IB 3HOUB 3W5OA 1EU4A 1JR0D 1CA6A 4KVGB 4DUZL 2R61A 2F52A 3FMCA 2G45B 4A3JH 1HNXQ 3CC4A 4NPNA 1SJED 1KC8C 4KD4A 4K7UA 1EUVB 2JA6B 2KQSA 3JSVA 3CCUA 3V05A 4HIDA 2ZZPB 4GLSC 1X9NA 1A70A 1D1IA 1OXVA 3MEHA 5IYCG 3PUZA 2JA8B 5KYLA 1L0XB 4QGUA 4GNXC 2K33A 4ZDVA 3CXCA 2F3VA 1S3SG 2F4VL 3S9WA 3H09A 4WWMA 3VTUA 4S3SA 5E4XA 5CBEE 5JVG3 2JA5B 4XQJA 2DZKA 2UUCQ 3I4NB 1A5RA 3MFYA 2V0GA 1FD6A 1WJ6A 4DR7L 3OOCA 1RCVD 3TP6A 3KOJA 3KBXA 2RHSB 2EXDA 2OF1A 1HR0W 2LZ6A 3U7DA 2HDLA 1EEID 2XIWA 1EZ6A 1I6HH 3NUCA 3IFTA 3JW0X 3RUZA 2CCZA 1BCPC 2IHFA 2IX0A 2NVQH 2K5DA 2LMCA 4BY1H 1QLBB 3T1YQ 1PFDA 5JOBA 1S5BD 3RNUA 1E8WA 5JXVA 1S5FD 1S72A 3DWMA 3L7ZC 4A3FB 5CV7A 5G5HA 3M3JA 4DV5Q 4YTPB 3DBLB 4HEA1 3UGBB 1NYQA 3PZ8A 3KK7A 2FBWB 1SDFA 3KBGA 2WAQG 2ZPNA 3PO0A 3W9CB 4J3OD 3CRKC 1VQEA 2PCFB 1EYGA 1ESRA 2VH2A 5C0XG 5I2YA 3NEMA 4JI3Q 3AM9A 5F2DA 3A1QB 3R3OA 4NP5A 2GBMA 3BVMA 5M3FG 2F0EA 1NMFA 4JOIC 1TWAB 2KAJA 5JEAJ 3SK8A 3CCVA 1Y69U 1PHJA 1ACCA 3ZGZA 1U5KA 1V1PA 5M5XB 4GN4B 1KAWA 2Z9HA 3IFWB 2I2YA 3PRZA 1JE5A 1WTPA 3IRBA 3KFUA 1MJCA 1AH9A 2LFIA 4YCVA 5JHBA 3ALBA 2LXAA 1E8YA 2NVYH 3H6MA 4DUYL 5FLXc 3WAOA 2AYOB 1UD7A 1HFGA 1BQQT 1PRTB 4C4VB 2JE6I 2KFJA 1UE5A 1O78A 2CH4W 3M9BA 2NUCA 4L5TA 5D2MB 1EYDA 5NUCA 4YSYB 3K81C 3VUXA 1T0RC 1GUSA 4CDDC 3CCJA 4LF5L 4OZCA 2KCMA 3CCMA 2D3GA 1Q8IA 1NR4A 1ZKOA 3MXNA 4DV7Q 3VXWA 4OVVA 3ZRCA 3OW7A 2F0QA 3U4VA 3PIP3 2CHXA 3AE4B 1KDCA 3D6CA 5IAAC 1TZOA 3HM6X 3S1NB 2ZTCA 5AUKA 1N8RC 4WJ3M 2I5MX 3I91A 1PZID 1JWBD 1E0ZA 2H89B 4FN2A 2MBEA 3P4QB 2KFKB 4RKBA 2IGHA 4JI2Q 4LFBL 1STBA 1QILA 2PMZE 3WCQA 5L95C 1HNWQ 3S24A 4O2DA 3W1YA 4HJKA 4DNTB 2MW5A 4XWTA 1X55A 4HN7A 3MTSA 2MGSA 1G291 1VQKA 1SFOH 4N59A 4XTCS 1R4QB 3DBRB 3HOWB 3RZDH 2N3SA 5EPKA 2KK8A 4IM0A 4LNIA 2EQSA 3SK5A 4OZAA 1CKOA 2RPQA 1IGCA 1X1MA 2WXQA 4JI4L 4ILWA 3SU8X 1D1KA 3VYUA 2EYOA 2L0TA 4EEWA 2J0MA 2Z0EB 2DNCA 1I94Q 2NN6G 4OHJA 3QOJA 5C3JB 1RRBA 1UE7A 3S2DH 4G7OC 1P8LA 1P16A 2CHWA 3PO3B 2B2VA 3QIAA 4UHVA 1T0YA 1PZKD 3U9SA 5M5XH 2E2IH 3I3CA 2K5PA 1L5PA 1MPEA 4MGZE 5J1ZA 1F77A 1F0ZA 2WXHA 1AZPA 1SYGA 3LJ3A 3PUVA 1G91A 1PH6A 4ACFA 1EUJA 1V5TA 2CKHB 3UE1A 1B53A 5FJ8G 3CRLC 1PDXA 4KGTA 2Y3AA 2WKDA 5FJ8H 4OVUA 1C8CA 3QARA 5IWAL 5JEAG 3GTGH 1Y8RC 4ME3A 5FKAC 2W82A 1VZ6A 3GTKB 3U50C 2MWSB 1CFMA 1IHZA 2R92G 2KNBA 2QHOA 3DCGA 2SAKA 2VZKD 4IFDH 4DV4Q 2NR2A 3X0WA 3G6JB 4XE0A 2O5IC 5BR8L 4DNRB 1PH3A 3APDA 5M3MG 1UE1A 3T13A 2IGDA 2EYFA 1PRTF 2BYFA 2LWPA 3EHVA 4MM3A 1VQLA 2OXPA 1XEEA 3ZJYC 2BE5D 1IPGA 1XX8A 3T56B 4CJ0B 3ITPA 4JYAL 2RHQB 2BBCA 3ZJUA 3PCOB 1KRTA 2G4DB 4ICVA 1LFDA 4BA2I 2K03A 4DU9A 3TEZA 3SR1A 4FXCA 1WTQA 4XYCA 3T53B 3NZSA 3MTNB 1MIUA 2K8CA 5LMUL 1C4CA 4WORA 1LQBA 1ILQA 4JBMA 3FKIB 4CDCC 2NVYB 3CW2C 4ZRIA 3SDLC 4GMVA 1NDDA 1PH5A 3BYTB 2XK5B 3QHTA 4JPSA 2NVXB 4HLEA 2O6VB 3PO3H 1SF0A 4K3BA 4DN4M 3ZJTA 1WGDA 1WVLA 4UPAA 5BR8Q 2Q5WD 1NR2A 2E3TA 1O7LA 4C00A 1V1QA 1H9RA 3BJUA 5CORA 1I42A 4XYOA 2AL6A 2MUYA 2K6AA 2N1VA 3H9DA 3U52E 2JA7B 1T0QC 2EPBA 2B2WA 1BBUA 4A3EB 1E7VA 1SNDA 1TS2A 1B8AA 2GN5A 5DM63 4DV2Q 3FP9A 1QB5D 1EYCA 2BVCA 1M4VA 2ZNVC 4PS8A 1U4PA 1R4MI 3BDLA 3S1MB 1B4OA 1TIID 2N7JA 3QQ8B 3GE8C 4RMFA 4JI3L 4KZCA 1CM9A 2AWTA 1B70B 4TQ1A 4BBNC 1SE2A 4X66L 2PNRC 5LMUQ 2K25A 4L5SA 3J80E 5J2RA 4B3SQ 3TSSA 1XNQQ 4A3GG 1WYWB 3V62A 4IUNA 1EO6A 2X8XX 5FO8B 2IJ0A 1T3QA 2EMTA 1ASZA 2RSOA 1TWFB 3NQTA 3I56A 4FJVB 4R4CA 1Y1VB 2OTJA 2OHFA 3AEGB 2OQ0A 4F88A 4C56C 4BAXA 1FCLA 4H02A 1ZXHA 3FILB 3VR6A 4A3BH 1OEYJ 4CHTB 3G48A 5IOCA 3G4SA 1UE6A 1KXLA 1IBKL 2EJFC 3ML9A 1QNKA 1MSGA 5BYRA 4B3TQ 4LJPB 3D6WA 1A3VA 3TCAA 3UE0A 3M4QA 1JOKA 2EYLA 4LFAQ 3EVQA 2Q8IB 4P75A 1PGBA 3J81c 2LHDA 1AZQA 2WNMA 3GZNB 4KI0A 3Q3JA 1CA5A 5A2QE 3VR2A 5IGEA 3GTGB 3KYHC 2IL8A 2QKIC 1WH3A 1WGGA 5C4XG 2IO2B 2D3CA 4X57B 2IZVB 3ZRFA 1QOGA 4K3CA 3AE2B 1D5ZC 4DV6L 2V9HA 2EYPA 3AE7B 1TWHB 3GTLH 3DOWA 4OO1I 3FRPB 1DGJA 1WXSA 4DHJB 4A93B 2RF4A 2I0QA 1TJEA 2BW2A 3P1HA 3VR5A 3V6EB 3GDEA 1RIPA 5J17A 2K8HA 5KIXA 3GD7A 3BY4B 1K53A 1R4PB 5CHFA 1EEFD 2NVQB 4KJOA 3CC2A 2AX5A 3U30A 2KJXA 1YI2A 2KTRA 2LHEA 3PHXB 3U2SC 1WM3A 2KQ3A 2NTSA 1AWDA 2K1BA 4HCSA 1RWSA 1D5XC 1V8CA 1M90C 3BIID 5CTRC 3CCEA 5IT9L 4W9KA 3S1NH 4LDTB 2E2DC 3G71A 4B3TL 1IYUA 1KABA 2E2JH 3QOLA 3A9KB 1IGDA 4CO7A 4DR5Q 1HTLD 3T1HQ 4CKCA 4HPMB 3TUOA 4EQNA 2JYTA 1PUTA 2A6HC 2AQ2B 4MEMA 2A69C 2K5WA 5LL6X 1LT6D 2AQ3B 2PW7A 2K01A 4QF4A 2V3PA 4M02A 1VD2A 3VR8B 4DBGA 5LLIA 4DV6Q 4TQ0A 4IUVA 4DFAA 3AU5A 2EY2A 1UH6A 1EQQA 2DHZA 3RD4A 2F0KA 2PVOD 2WXGA 2LY7A 1K8GA 1SSNA 3S16B 2PI2E 2O5JC 1P7FA 5LXIB 2KCNA 3DUZA 1TIFA 1NI2A 1YNND 3APFA 4NQLB 1MI0A 3RNEC 4B9WA 4LF6Q 5C44G 1DCZA 3ZXRA 2M19A 1EL0A 4OEMB 4PQXA 3NXWA 3ULJA 2PE9A 1DOMA 4JVZA 2YEPB 1C4PA 2JF5A 2F0NA 2Q2TA 3AEVA 1SGHA 1IKLA 4XT1B 2MHJA 5EKKA 1W3SA 2LKVA 4LFCL 1SYEA 2D62A 5BN4A 3RYTA 2MRPA 1NBFC 4N9F4 4IFDJ 5GQOA 3TREA 4NNJB 4MELA 3U7ZA 4BKTA 3M63B 1QOFA 5H8YE 4R4IA 4C7YA 1OFFA 3WA0A 1HZCA 4X3KA 1O7ZA 2RDHA 2XGTA 3S15H 4DK6C 2RSNA 1YJNA 1E9MA 2WXOA 4DQOC 1MFWA 4K8JA 1CQVA 2FHTA 2D2CC 1HTOA 1GPXA 1MHWC 2VQEL 1YD8U 3BVGA 4IO9A 2C7MB 4ARIA 4DXFA 3TEYA 3D3RA 4MZ9A 4FVMA 2R92H 1HTPA 1E0BA 3NTHA 2WP9B 4LUVA 2WGSA 1V1OA 1L0VB 1RAXA 4RHSA 2DGYA 2A69D 1C48A 3CHBD 3M4OH 1EIGA 3EUB2 4BXXH 2JA7G 3PREA 3HKSA 2KC1A 4DXGA 1PGXA 2DY7A 3PRMB 3JAMc 2ICEC 2K4KA 5JJLA 4ODGA 2BS3B 2KJHB 3GB1A 2D10A 3KDFA 3BS1A 5CV4A 1OQQA 5GROA 3L4PA 4HRSA 1NI3A 4WJNA 2EY5A 4A3DG 1U4LA 3IXSA 1IBLQ 2PQAB 3Q3OC 4PS3A 3MXPA 2HD3A 3E0JA 4N8FA 3PV0A 2YTXA 4KDLB 1H9JA 2BKFA 3WAMA 1HH2P 3K0YA 1KAAA 2E2HB 3TMEA 3KH0A 1IL8A 3NBHB 4L6TB 4EOYA 3Q3MC 2JN4A 4A3DB 3M7GA 3DHGC 2VQFQ 2JY6A 2IPKD 4LF8Q 1N32L 1UGMA 5GMVA 4RF1A 3K8AA 1HR0L 3TS0A 3SVMA 1LTSD 5JVH3 1OQYA 1NCVA 2KMMA 4XIGS 3ECIA 3HHMA 2ID0A 1QZGA 1HQMC 3RN2A 4K0KQ 1QWYA 4KV2A 4FHKA 2KHJA 2MSED 1U9RA 4FJYA 4XWWA 3C1FA 2OEDA 1RHPA 3Q14C 4J6IA 3CMMB 2GVBA 3TZUA 2PZWA 3UINB 4C3JH 4HK2A 1G2TA 4DV1L 3T3NA 3HK0A 3KF6A 1ZUD2 4IJHA 4GKKQ 3W5UB 3UIOB 2HIXA 4P6VF 3Q8EA 3UF8A 1ROEA 4E3CA 3RCZA 1B1ZA 2G5DA 5FLXL 4NPSA 4A3LH 5EDSA 1RFAA 1BMLC 3NWSA 1RFKA 1V5OA 3K5OA 2ES2A 5K36H 5LHY1 3ETRA 1WGHA 4PK1A 2OJRA 1DJRD 5I2XA 3B0AA 1XTCD 1N32Q 5AJ3Q 2B8FA 2Q8TA 3HOUG 1BR9A 1UBQA 3IAM1 3LGJA 4EFOA 4XYQA 3S2DB 4Y52H 2IO1B 2WXNA 5IE8A 3PMFA 3SGIA 2RVLA 1EIYB 1WCMH 3O13A 3CMAA 2ACZB 2WXFA 4RFBA 3PTFC 3JVZX 4BZAA 3L9AX 2R6GA 3PPAA 1GD7A 5FLMH 1VS0A 2Z6KC 5JPMC 1K50A 2JXTA 1DGSA 1PA6A 2K52A 4HPPA 3CQZH 1K0SA 2DN8A 2CHBD 2HJ8A 1LV9A 1U4AA 4ASWC 1AARA 1N61A 2BDOA 4ZKCB 2BS4B 3RMKC 4N9TA 2HTHA 3IG3A 4J15A 1QZHA 1BCPB 1N63A 2JWZA 1WYDA 2JWUA 4KKIA 5KGUA 2J0TD 1K51A 5M3FH 2MO0A 2A5UA 4REZA 4AH6A 3N1XC 3TEWA 4US8A 1DOIA 4EUTA 1VQJA 3I90A 1WGYA 5IT9E 3CQZB 4DR5L 3T1HL 3I73A 2TMPA 2XBBC 2D11A 3QJZA 4HJAA 4K7SA 3NRZA 2NYZD 1RYJA 3TMPB 1WI5A 1XXGA 3GTQH 2F3IA 1WJ4A 4QCLA 2ZW0A 5AZGA 1W6KA 2EYMA 1F1HA 1WX7A 4NDXA 3B2GA 3J9CA 4IPHA 1IXRA 5HKHA 3P75A 2GI9A 2PTLA 2B2WC 2F0MA 4N9PA 3OTOL 4GS3A 1KLVA 5C0XJ 1KM7A 3N6RA 2KTRB 1L4ZB 1AW7A 1WOCA 4JL9A 4ZOHC 3HOWG 4PZ7A 3C19A 3VH4B 1BT0A 1J7AA 4A3DH 4FJZA 3D4RA 2H88B 1RODA 2BYEA 4KMUC 4C7ZA 3CIRB 1MSHA 2L8JA 4KKTA 3N20C 1YBYA 3J81j 3PO3G 3PSIA 1SLJA 3VFKA 1SROA 2ZEQA 3HUIA 1H9SA 2XTIA 4IUTA 3S17H 1FYCA 1D8LA 1WR1A 2ZXPA 2VS1A 2KN5A 3RLNA 1C9FA 3HOXB 2UXCQ 3KLSX 2HHHQ 5BYQA 2KECA 1DOKA 4RHRA 1S5DD 2J53A 5AUIA 2YTYA 1WXAA 4P1BC 3K9OB 2AKWB 4RNAA 1A2TA 1XPRA 4TVAB 1B50A 2IWHA 5IP7H 3BZCA 4A3CG 1VMPA 3NVYA 1VQOA 4KY6A 3NHHA 3RZOH 4IWPA 3J7YW 2C9WB 3ZNID 1M8AA 2REXA 3A4RA 3MC9A 1EOVA 2W3SA 2KMAA 2NMQA 4GOCA 1P9DU 2UUBL 1ZGUB 1VQPA 5D65A 2RDGA 3R2TA 3M3YH 3NVVA 4A3GH 2LMCB 1TWAH 2O4XA 1EF1A 4JWSC 4A55A 2KDMA 2AUJD 4HCEA 1H4RA 4IG7B 4JK1C 3VYTA 3K7UC 3PLUA 2BDNA 3P20A 4GN3B 4MGKE 5I6YA 4IWQA 4P1CC 1MGSA 4AQYL 3CSFA 3IFDA 4KN4C 2M1MA 3PUWA 3UI3A 2BH8A 3X3MA 1A8VA 4DGZA 3L0OA 3IBEA 4O0AA 3NELA 5GAEC 5EPLA 3J81E 3M4OB 4GZYC 1CQFA 3F1ZA 2R93G 1C77A 2RSUA 2NZ1D 2YU9B 1UAPA 2EOTA 1OO9B 1HZ5A 1Q1OA 4AJYB 2ALYB 5E6OA 4LF6L 1TWGB 2D5DA 4FYDA 5BMGA 3I8ZA 3BZDB 4JI1Q 2IHEA 2VUMG 2IYDB 4KY7A 1S5ED 2EXZA 3UQBA 1I6HB 5ELOA 2IW3A 3A7AB 3KLWA 1KNAA 3HVDA 4M8NA 2CWPA 2C35B 2FCQA 3EFUA 2JA9A 1NMGA 4EVOA 4BOZB 1B7YB 5JAVA 1LTGD 4CJ1B 3N3KB 3N1ZC 4NW2A 3QG1A 4JI4Q 4GDLB 4W9JA 5JHAA 3H8HA 1W2BA 5J22A 1QKZA 5AZFA 1WTHA 1L0YB 3I4NG 3V3XA 2F0UA 1GB1A 2QSDA 2KVRA 2BCOA 1D5MC 3UI2A 3MHBA 1VR9A 4ANUA 1EOTA 1SNQA 1N34L 4KTAA 4EQ5A 1WRDB 4RGOS 2WXMA 1OTRB 4BS9A 2DAFA 2FUG1 5I4DA 2RR9A 3GV6A 4KIKA 1VZ7A 4RKLA 1XCQL 1PH4A 4OO1H 5GADC 1GHKA 3OPOA 2V4IB 1TXYA 3MXNB 3E9SA 5G5GA 2CJOA 1P1AA 4ZRKA 2LUMA 3I63C 3NVWA 2A1AA 2KUMA 4YCWA 4MHEA 2J7QB 2GBJA 3N30A 4OELB 4TKNA 4Q5VA 4GU2A 2WAQB 3UQAA 4HEDA 1FJGQ 2XRQD 5EE3A 1F9SA 1SE4A 1HA6A 2WDTB 1SAPA 4OWTB 5FO9B 4KLKA 1N33Q 3G7LA 1XLNA 2GOWA 3Q6BA 5C3WA 1RTNA 3QX1A 2HJ1A 2PIAA 1JALA 2V1CC 4J1MA 4GDKA 1ICWA 5CYUA 4BBRG 3SDZA 1YNJD 3NQIA 2WLBA 2ZJDA 4FLHA 2UXBL 1PGAA 5D94A 1QVCA 1TR5A 4ZKBB 3EFXD 1IBXA 2Z4IA 1OTCA 2D5GA 1WZ0A 1GOZA 4YHHQ 2XK5A 4FHJA 4RCNA 4POGA 3H1UA 4KDIC 4HKZE 3W1GA 1XNRL 2L83A 4PMCA 2CQOA 1FNWA 1UWXA 4K5VA 1ZXTA 4BBSB 4IWOA 1EIFA 1TWGH 2PYKA 3DWQA 2W55A 2ZPYA 4AOFA 2N4FA 1YNXA 1JJGA 3VUWA 4ANWA 3I70A 1L2FA 3JSVB 3ZDMC 1NE3A 4C3JG 3P63A 4IKGA 2KQ4X 3DVGX 2QF7A 2JZPA 1VZ8A 2JQOA 1YHBA 2O2LD 3K0XA 5FO7B 1WZ3A 4JI0L 1H95A 3DHHC 1TY0A 3BG3A 4O42A 4IDIA 4HJ7A 4XX5A 4HVBA 1Q3LA 1OXXK 5DM73 4HR7B 1V43A 2ZJRA 2R3ZA 4A3JG 1EF5A 1XJVA 2IX3A 3NS8A 4JI8L 2K04A 4G50A 3EGRA 3APCA 3DBHB 3X23A 3H0GB 1CKNB 3H91A 1JWAD 4GKKL 5ELFA 1FNVA 1FXTB 3QWNA 1Q1BA 3VR9B 4DAPA 2Y5BB 4EQPA 3QR8A 1LTAD 1A15A 1AP0A 1OXUA 3AXCA 2Q2HA 2HCIA 2PI2A 3BK1A 4PYZA 1Q1EA 1XMQL 2I1JA 2R7ZG 1NSNS 1NY4A 3NG0A 1KLUD 2BF8B 4JIOU 3NBHA 1BBXC 1SNMA 2B2TC 4KN7C 2BA1A 5CR3A 1GUGA 2HHHL 1F2ZA 4IURA 4RA8A 4A3MG 4MM3B 2ZXOA 1MI2A 3RNAC 2BH2A 2JA7H 1WFQA 4H0LC 1G6ZA 4A3EH 3H6NA 4DR3Q 3NJTA 1Y1WG 1PH8A 5E6JA 3HOVH 1PTOC 3UDIA 3OWFA 4H13C 4DF7A 3HOVG 2UUCL 1GUOA 3K7AH 1OEYA 3I72A 3J81L 3AB5A 4B9XA 1V6EA 4YSXB 5C1ZA 2QILA 4IOAA 2JU6X 2KX3A 2MH7A 4MH0E 3SFDB 5H1SE 1QF6A 3DDCB 2JEAI 4PT5A 3ZTCA 1LT3D 3RLFA 3SHLA 2F3WA 3UDGA 3H7SA 3PT2B 2Z0DB 1YN5A 2DYBA 1Q90A 1JWUD 2DNEA 5CV6A 3Q22A 2R7FA 1PTOH 5ELDA 1FM0D 1JJCB 1JMLA 2PNHA 2CHZA 2JPHA 4FADA 4LW1A 1EWIA 4ZYSA 2FCSA 1TWFH 2Z0SA 1TYGB 1JQYD 2NPTA 4POFA 3RZOB 1Z6HA 4M0WB 4L8JA 2M2LA 1KQSA 3DBRI 3UDFA 4PZ6A 1PV4A 1PMRA 3D4DA 4K5XA 3E9IA 2GLSA 4M8MA 1Q82C 1F9RA 2R7DA 2MP1A 1TKYA 4Y7NB 1WX8A 2IY0B 1RL2A 2WU5B 3C0RB 3Q8CA 3HG9A 1NTGA 2WINB 3DEOA 2F1MA 2KEDA 3ERSX 3NY5A 4B3RL 1MKHA 2MBBB 2KHIA 3S14H 3S1QH 1YQ3B 2GBRA 2PZTA 5C4JB 4KZ0A 4B3MQ 3E9HA 1FD7D 2G9HD 4IN3A 1U4RA 3N1YC 1DYQA 3PUYA 2FMCA 4CYEA 1ZP0B 2F4IA 1IYVA 3QA8A 3AE6B 1SIJA 2KMCA 3WIMA 1BUIC 1KRHA 5EPJA 2NBFA 4AYBE 3QK0A 5C23A 4DK0A 2DYMA 2EKEC 4CBVA 3SR6A 4UAIA 4DUZQ 5GAGC 4K6DA 1SR3A 5C44B 2JUOA 3HOYG 3RI7C 4NAWB 5CHWA 4YY3Q 2R2QA 3R7QA 2EELA 1ZXIA 3W3AA 1YX6B 5IP7G 2JX5A 5D6JB 4A3PA 1EY4A 4I6NB 2FFKB 2KWDA 3J7AV 2V4DA 1WR6E 3A8KE 2GRIA 5AZHA 4LNNA 2WP8J 3H94A 3RR5A 2F0WA 1E7UA 1KTKA 4PMWA 2UU7A 2L76A 4R9WA 2L12A 1II3A 3RNBC 4YWLA 4RWSC 3URYA 4UDUC 3J80L 3AU4A 4U673 2WIIB 2F0PA 2SDFA 5GAHC 4WJ4A 3T51B 3HP3A 2XVSA 1PRTD 1XPUA 4DXAB 4RH6A 1VMCA 1QOAA 3W1SA 3V60A 1MG4A 3AE1B 1LTID 3N9YC 4YT0B 3HOZH 1YEZA 3H3VI 1Y1VH 3HOUH 4HJ5A 1PH1A 1FJGL 1S1QB 2D07B 4GDLA 3A0JA 3H0GH 1TY2A 3MA2B 4BBSH 3FKIH 4RAUC 2YVCA 2GA4B 1HPCA 4QUCA 1BXTA 3NVZA 2AQ1B 2KLGA 2HQEA 3GV3A 3STBC 3KUCB 2WXKA 2N55A 1HNZL 2DAJA 4NXNQ 5HI1A 1VQIA 5G2NA 3DXJC 1E3PA 4EZLA 2E6XA 1WF9A 5C44H 4DK5A 4WJWA 2KHWB 5LMNW 1LT4D 3T3OA 1E8XA 4WWPA 5M5YB 1R4NI 1HHVA 3NTKA 5KNCA 3S17B 2B3AA 2JZZA 2WDVB 4NXMQ 4B0EA 2ZTDA 3MEFA 2BB6A 4W9LA 2KX0A 5J39A 2QW7A 1ASYA 2WAQE 4JI1L 1PVOA 5EE1A 3PRPB 3BDOA 4C1NI 3CU7A 1RJTA 2F0FA 3DMUA 1ZYRD 4GNXA 2KTFA 2R7ZB 3C8YA 1L1OB 2CR5A 2KN4A 1F2LA 2KJRA 2ZVNA 2Z59B 1SMXA 2M00A 4YWMA 2KXJA 2ZCCA 3RZWC 4YL8A 2INDC 3V96A 3EQLC 2MNAA 4DUYQ 3S1RH 1B9NA 5EGTA 5BN3A 2EJMA 2K6QA 4JGHB 1HNZQ 5L37A 3MC8A 4NXNL 1NBWA 1PTOD 5CV8A 4AS1A 4NMZA 2VB3X 3WOEA 1Q0WB 1Y14B 5BN5A 3RT3B 3GTQB 2WWZA 4A3BB 5C6AA 2EIFA 2DYOA 1IP9A 3PUXA 4WRDA 2E76C 2B76B 4CDEC 4DV7L 1GUTA 1JWMD 4N58A 4WFN3 1EQVA 1WJNA 1IBLL 3RN5A 1GHJA 3T16A 4OWXB 4IPGA 1STNA 2JJQA 1UBIA 4YXDB 2SNMA 1Y8PB 2CQAA 1TKEA 3ZJVA 1ML0D 2IX1A 3J80i 4JI7Q 2MFIA 3CPFA 4HCNB 4LF8L 4A93H 2AWNA 2UU9L 3PGZA 2KVZA 4JV5L 2C5CA 5IYBG 4UP9A 4P7IA 2X6GA 3GZNI 2DX5B 4WQOB 4RM9A 3PHWB 1I6VC 3K5LA 3QIJA 4QJFA 1FCCC 2WQYB 4DV0L 4B9KA 2PPBC 1BKBA 4M01A 3AN1A 1DD2A 1WMHB 4WURA 4LK1C 4RGNA 4YHHL 3SHQA 3STBD 2KDEB 4HSVA 1RF2D 4HIMA 1ENFA 2FE8A 4A3CH 2RCNA 4MTNA 2LXJA 2D9UA 1DM0B 5LXHA 1BVSA 3VYSA 3WAPA 1A6XA 3PSEB 3GTOB 2KD0A 3NENA 1J6QA 2B39A 1PFSA 2SOBA 3MZ5A 2HQLA 3AYHB 5CV9A 2QMTA 2WDRB 4JBJA 3VUYA 1I50B 3D32A 5KHQA 4W9HA 5JEAH 3RFZB 4KD3A 5HURA 4A3IB 4DR4L 1N5WA 3DHIC 5AJ3L 4G0NB 3FPPA 5DEHA 3D8GA 5DPWA 1V9PA 4M00A 2O6VD 1F9JA 4PG3A 1HUNA 4WQMA 3V61A 5EBCA 1G51A 1GJZA 4UP8A 1MBYA 3ND9A 4C2MB 1UEAB 4FDBA 3I9V1 3K9PB 4JBKA 3KWVA 4DR7Q 2X6LA 2K6DB 3OJ3A 4K7WA 1S5CD 1LTRD 5M5WH 4B3SL 2CJNA 4U68A 2LJ5A 1EY9A 2K50A 5IT9c 2LXKA 2UUAQ 3GE3C 4OXPA 2EMSA 3LDZE 1TKWB 2MLBA 2A19A 1Q81C 2OOBB 1L4DB 2KOXA 4BY1B 4DV4L 1C76A 5CBAE 1SYFA 2QDBA 3A8JE 2QEXA 1XMQQ 3HOYH 2MBQA 3CSTA 4A20A 2KWCA 2XNAC 4G7ZC 3MHZA 2K22A 3RNGC 1BBWA 3ER0A 3MXGA 4A76A 2WYQA 5C2TB 2VUMB 3H3VC 1WJJA 3I4LA 4A3EG 3CCLA 4DR6Q 2EYHA 4LCDE 2ZJQA 4JYAQ 1KL9A 4FXDA 3AEBB 2M17A 2VXWA 4FO2A 3F2CA 1L2NA 4IOIE 1IYFA 2K5VA 1I50H 1TVXA 3L2PA 2J0KA 1X54A 1DZ1A 1E10A 3VH3B 5IGGA 2F03A 1EQRA 1QT9A 1UF0A 3FEWX 3F8TA 2KC2A 2R92B 1GUWA 3A74A 5C4XH 3IT4B 1ZE3D 3AE9B 2ZJPA 1J5EL 4LAAA 3B08A 3P42A 4WJOA 4EZKA 3JC66 3PO2G 1WY8A 1NEKB 1F2MA 4A3GB 1B9MA 1JROA 3S16H 5GXGB 2FUHB 2K3UA 5D7GA 1T5EA 2JA5G 5G3LD 1VQ5A 3CP0A 4CDFC 1AE3A 1BOSA 1EWCA 5KHOA 1WCMG 2QEJC 5L83A 1V9JA 5CMDA 4DR2L 2M0XA 5IKCM 3ZLZA 2KKCA 4FP5D 3LNNA 4DR6L 4W9EA 2QJLA 1JRPA 1HXYD 2CW0D 4ALPA 3C1EA 5C4HA 3A56A 3HOWH 3TS2A 3AEEB 4MJSB 2HE7A 2LD9A 3GS2A 2KEEA 5G55A 4F87A 1NVID 1UUPA 1VLBA 2L32A 1VQCA 4HJGE 1PQSA 3PQIA 1VCBA 1V49A 2JT4B 2JRIB 1JMCA 4L5RC 1C3TA 3WOFA 1MVKA 2WX0A 1XPOA 4A3FH 5CC4A 4IPCA 3KUDB 4FNFA 1KDBA 1XNQL 2O6VA 1DOYA 2MPMA 1YNJC 3LWEA 1WIAA 5DCNA 4DV3L 1SIFA 4QY7A 1V86A 2F0IA 4ZK9B 3PZ7A 3R2IA 2J42A 2CU1A 2BPSA 3R93A 4RGMA 1GB4A 1EY6A 2EKIA 5TR5A 2D0OA 1UWMA 4AYBG 1BCPF 3GTJH 1TWCH 1WTOA 2PKOA 2JEBI 2D3BA 2UXDL 3HOXG 1Z9FA 3Q6SA 1J0GA 1PXUA 1Z7TA 4ZYNA 2L3ZA 2F0VA 4XQQA 1TT2A 4C3JB 3CD6A 4PZ8A 4KHPQ 2RMMA 3A55A 1TBEA 2KWVB 3AEDB 1PYSB 2A73B 3TBLD 2QA4A 2RPVA 1I35A 1GO3E 3Q8FA 2LGXA 3AE3B 3S1MH 4LNOA 1JORA 4XC2A 4OX9Q 1VRAB 1E8ZA 3KW5B 1YNNC 2Z8LA 4AUQC 4UP7A 1JQ4A 1J9OA 1ENAA 1KH0A 3CKIB 4JG2A 3LYYA 1L1OA 3H0GG 2J52A 3AQQA 5A2QL 5EBDA 2B2YC 2RA4A 2RDFA 4A75A 4A3JB 4MACA 4H7BA 1N36Q 3KVFB 5C4JH 1F2YA 2KJ6A 3NHEB 4US9A 2BT6A 2Y0SG 4OONA 3J81i 4YTNB 2RGFA 4C2MH 1BO0A 4IALA 3A54A 4BA1I 2HD5B 2ON8A 1QNUA 1G6JA 3UDXA 2WXLA 1NENB 1J8CA 2FMMA 5EJWA 5EAYA 1EQTA 4KV6A 4NAWA 1CKMA 2HTME 2B2UA 3TN2A 4LNKA 3KF6B 3AFQA 1F9PA 2KZRA 4K81A 2KENA 4A3MB 1LO5D 4W9CA 3IVFA 2BGFA 2EYJA 3ENEA 2CW0C 3Q3NC 2LGSA 3FAHA 1KRSA 4PMBA 1I4PA 2K5NA 5BO4B 1TTNA 4C4VA 2JP1A 3GOEA 2IO0B 4FULA 1FO4A 1FFVA 2R7ZH 4XGAB 1S3OA 4HIOA 4W9FA 2G4SA 3K7AB 1F2RC 1NJIC 3FDTA 4TUUA 4JC0A 3K80C 5C0XI 1SJHD 4LMQD 2F0GA 2LI5A 3ZW3A 2WB1E 4ZUJA 3KF8B 3CPWA 1N62A 3T4AC 2E5LQ 3M95A 3NK9A 1JT8A 4I6LB 4IOCA 1FL0A 1PH9A 2MJDA 2NBWB 3VA7A 1R4MB 2AHOB 5M5YH 1ZDXA 1K28A 2DJFC 1RDPD 2E2JB 4IZ8A 4OIKA 2V4LA 3H7PB 4LF7L 1VQNA 1LM0A 1IW7D 1XNRQ 1QG7A 1L6UA 1NAPA 2PMZB 4GOPA 1P7EA 2G3QB 5ELNA 2RDBC 1YIJA 2UUAL 2G9DA 1YMHE 2LRWA 3ZKJC 1GJXA 3DLLA 3R66C 2L52A 2XRSD 4OZBA 3U4EG 2G1EA 5J18A 2BA0A 4APVA 3KYCD 1UELA 1CHPD 4BY7B 5KRUA 2BWES 2UWQA 1MD2D 2LSSA 2LRUA 1SEBD 5HGQA 4YIJA 1FGUA 1U4MA 4Q0FA 1N6ZA 2WDQB 2A6ED 2Z1CA 2BYTA 2BTEA 3S15B 4R4TA 1WD1A 1TGZB 2UYZB 1FXAA 2NN6I 4K8IA 3AV8A 3M4YA 3R8BA 4JV5Q 3AE5B 1X56A 2WV6D 3IT6B 2QGQA 1GUAB 1PZJD 1MHXA 3ZNGC 2VL6A 2OCEA 4JI8Q 2B2VC 2A74C 4GN5A 1VDVA 2R93B 2B2YA 2NZOA 1LM8B 2M8SA 4KSLC 3OAWA 3NWTA 3AMZA 5IP9G 3EBEA 2KDIA 1WE7A 2L7RA 1P3QU 3NS1A 1TWCB 2Z6BA 4HDQA 5KYIA 1J8IA 2FCMA 5FK9C 1WXMA 1YIWA 1E22A 4DHZB 1VQHA 4V0BA 1ZOYB 3TP5A 2DZMA 3BDCA 1WTVA 3PZDA 1KD1C 5KNDA 2JA6G 3K57A 1JICA 5ISRA 3IL8A 2J0JA 1S40A 1KF6B 1EFWA 2OJWA 3EN2A 4I6PA 3TEXA 4ZHPA 3OG5A 1KFYB 1N5XA 1SE3A 2RCFA 4AYBB 4L23A 2N9LA 2D3AA 4DHJD 1X3FA 1EYAA 4A3KH 1WD0A 2WX1A 1QJOA 3F2UA 1PFBA 5LL6S 2IBIB 1HA5A 5IODA 1X65A 5IGBA 1E7PB 2M0AA 4LLGM 2FIDA 1HR0Q 3DWAA 2VZKB 2M56B 3I5JC 4HSPA 3TIXA 3OW2A 3DVNU 1AEXA 1XF5L 3A4SC 1TS5A 3L54A 3KDFB 2AMCB 3AH7A 4I7ZC 5T1IA 2M4NA 3GTMB 1D6EC 3I4MB 3AB9A 1MJEA 4MDKE 1CSQA 4EQOA 3AMUA 1PTOF 3KUPA 2ASQA 3NUHB 5JH5C 1LTTD 3GP7A 4B6WA 4DR1Q 5CGKA 1XMOL 2K9XA 2INPE 2VB2X 2BYVE 3P2BA 5AFWA 2JK8A 2ZM6L 1YJ9A 2MJ8A 3RNFC 1QQRA 2D2QA 4HDOA 5C4XB 4A3FG 4ITKA 1FPYA 4KKJA 1QZEA 2INNE 4MSMB 2KVMA 3OSOA 1SMYC 2E8GA 1D2BA 3R3MA 1K3BC 1QUQA 1STYA 3Q3FA 1TWHH 1VQGA 3K5NA 3GTLB 3NOBA 4KKUA 4GGQA 2INCC 5FLMG 2F0HA 3ND8A 2XWJB 1AN8A 1LABA 2Z4HA 4BBSG 2K32A 1LUZA 2R93H 1I4HA 3KUZA 2K0PA 3ZNHB 2CKZB 4KY5A 2PPHA 4IW0A 5HHDG 4ID6A 2UXCL 1K8OA 4NJ7A 5IGFA 3TQYA 1P98A 3DM3A 2KQ7A 2WHIA 4AJWA 4MH8A 3VRAB 4X66Q 1P0RA 2KOLA 3AULA 2FCNA 1Q5WB 2L05A 3D0FA 5E7NA 4DA2A 4XDDA 3V6CB 4BY7H 1VQBA 1FRRA 2N7DA 3AEAB 4TKOB 1HNWL 4CGYB 2E2IB 4A90A 1YVCA 2L5TA 1N36L 4XZ4A 1FGBD 4DDGD 4DAYA 4GN1A 4X64Q 2N9EB 4OGQC 4P73A 5D14A 2NBVB 1KDAA 3G6EA 1R9TB 2L1BA 2IY1B 4FXKC 3RNCC 4E74A 1H9MA 4C3HB 3CCQA 1PLFA 3PS6A 3RD2A 4MNOA 4TRDA 4EZJA 2MX2A 3QC8B 1IW7C 2VNUD 3Q2AC 3Q8AA 1D4BA 2M9VA 1V8QA 4L5QA 2A4ZA 1HCZA 1ILPA 1RKNA 1SYDA 1SE8A 1GC6A 1I94L 3P7JA 3AFPA 2O2VA 1VQMA 1I7HA 1HRJA 4LUZA 4EX5A 2D0PA 4GOPB 4II2B 4DAVA 2I1KA 4K14A 1LXDA 4P16A 3QB3A 4WH4A 3RPFC 1DOXA 4I65A 3CCRA 2HIVA 2VQEQ 4S0RA 1EWYC 1AE2A 3OMCA 4ZRQA 2ZCBA 1ZEQX 1PH7A 2LEKA 1XLQA 1WWTA 3A8IE 5EKIA 4FF3A 2WU2B 3I3TB 3MP9A 4XDCA 1YX5B 3I57A 1FNUA 4ABNA 3OLMD 4ZHOA 2WXJA 2WFWA 5IP4D 1VF5C 4JBWA 4KHPL 4LK0M 3OJ4B 1WTXA 1Q7YC 4L2YA 3A9JB 1LGRA 4YSZB 5DPTA 3NPPA 3LX0A 1EFID 4X3TA 4A4IA 3CC7A 1HEZE 2MP2B 2ONQA 2PO4A 4C3HH 5A35A 2JSVX 2F0LA 3FKYA 4ZRPA 3ERQA 5IYDG 1YN4A 2QC8A 2CFMA 1KJTA 4G7HC 1EIHA 4L1BA 3GO5A 2ZT9C 3DVGY 4P74A 3J80c 1IYJB 5CHVC 1SN8A 4HMIA 4JI2L 4LFBQ 2JVCA 5E6NA 5LNK1 3VYRA 3EECA 4IUPA 2L0CA 1B9RA 2Y5CA 4ICUA 4LF9L 2OTLA 1WRIA 1UNSA 2UUBQ 4JW0A 4KHZA 1V1PB 4ULLA 1A62A 4JI5L 5I9OA 1K8RB 3KYDD 2HT1A 1CZGA 4XQNA 3Q69A 4WJQA 1WMHA 2BQQA 1YJJA 1SNPA 2PEAA 1FXIA 1IBMQ 4E71A 5IYDH 4JX1C 4R8NA 4FF2A 2I5HA 3BZKA 5E4WC 4IC7B 1K3RA 1SE9A 3H3VH 3Q24A 2DZIA 3ZTDA 1WFYA 3RLOA 5IIFA 2PMVA 4NAMA 5EQ0A 1G6PA 4BKSD 2EY6A 5E1FA 2NWGA 3M3YB 1E2WA 2B8GA 2BS2B 3ONAB 4DDID 2DZJA 1I3QH 1BUVT 4JI6L 2B2UC 2A6HD 3A33B 2F0SA 3SFEB 1YJIA 1SMYD 1Z2MA 5M3MB 4CKBA 4LF9Q 4FA6A 5D3IB 1NUCA 2N88A 2PZUA 1EU3A 1LLRD 4QUFA 4DPGA 1QUQB 3D4WA 4DV2L 2NVXH 2DENB 4HROA 4QAYA 4LUOA 3A5ZB 1T9HA 4D2KA 3L08A 4RMAA 1BCPD 4WAAA 4MGYE 3S1QB 3S14B 4IPDA 4WWNA 3AEFB 1B3AA 3BYYB 3MJWA 1RM6C 3MXUA 1VQ4A 2UU9Q 4WAFA 4N6EB 2JSOA 5KNBA 1OGWA 3FHWA 3FPUB 2B63B 2CH4A 4BOSC 4A3KB 1OXTA 2LVQA 2FAZA 3M85A 2W3RA 2W54A 4GDKB 3J7A5 4QB4A 4L63B 3DQVA 3QO2A 1XO3A 4GKJL 4K6LA 3L16A 3ZVVA 2EZVA 1I4GA 2RKSA 1Z47A 2E74C 3F2BA 4HWIB 1L0WA 3VTWA 3TEHB 2DJGC 4LJZC 2F0OA 2GMIC 3NSWA 2KT7A 3WWVA 2LUEA 2VQFL 2KCCA 3SXHA 4LFAL 2C7HA 3WALA 4HXDA 4BY1G 4IM2A 1J7BA 4ZRJA 1XQQA 2MEKA 2K28A 2N9PC 4P2CB 4JE3B 3VDYA 1E2ZA 2DUDA 3MVVA 4DR4Q 1K8MA 2PW5A 1E1TA 3OYYA 1N33L 2ZW1A 3AI5A 3ZIMA 3OTOQ 3MFGA 1Y1VG 3I4MG 1E7ZA 3A5UA 1XLOA 1WX9A 3VTVA 4DV1Q 4ANVA 3RMHA 2KO3A 2EY1A 2E2HH 1E90A 1HNXL 4F8CB 4J6HA 1Q8KA 4GKJQ 4BKGA 2F0TA 1CKNA 1I3QB 4G4KA 5IYCH 4M8AA 1R7SA 2KBNA 2MCNB 1TU2B 3TZDA 5FR6A 3VDZA 2ASBA 4OVZA 5M9OA 2A8VA 2IY5B 2MBHA 2FINB 4ZAIA 2DBYA 3P4SB 4KK7A 5IYBH 3W1BA 2MBOA 2RD0A 3ULLA 2MO1A 2ICIA 1UGJA 2Q2UA 2BKRB 2C5LC 5AEKB 1IBXB 5C3EG 3FVQA 1GG3A 3VHTC 1WCMB 1FMAD 1QOHA 1F2RI 3TJPA 3ZQ4A 1HZAA 1LT5D 1XCTL 1VDZA 4BBRB 4DNIA 3FC4A 2BB5A 1A3TA 1E2VA 4IQZA 1IZ6A 4YCUA 4ME5A 1E1OA 5E3FA 3OIPA 2MP2A 3SK4A 2Y0SB 4MT5A 4XDXA 2K39A 2F4VQ 4J8QA 1FR3A 3DVNV 2ENBA 1TS3A 4B3ML 3UIPB 2EVBA 4JLCA 4HPLB 4Q2JA 3HIZA 2ZM6Q 5C3EB 2NS5A 4NZLB 2WACA 1NYRA 4IUMB 3HVZA 4YTMB 1ISNA 1B44D 1J7CA 3GTJB 1C4QA 1Q10A 1SYCA 4O1NA 1SNOA 4C3IH 1IBKQ 3OWEB 2VW9A 1CHQD 1R4NB 1YNTE 2KLCA 1PRTC 3HFZB 2MHVA 4EE2A 2AUKA 1EY8A 4Z9CB 4WWOA 3K5MA 3QJYA 1PFNA 3JAML 1JRUA 1WI0A 2BWFA 2CVRA 3V2TA 4CQNA 1K83H 1ONLA 2NZHA 4YY3L 2YEPF 2OT2A 5JPNC 3QCAA 2N78A 1TS4A 3PIPA 4QIWB 1C79A 1HE8A 1PYBA 4DV5L 4P71A 2H1EA 5MPOA 4GIVA 4LDTD 3C2PA 4DV3Q 3VVWB 5C5MA 3C3LA 1O7YA 1YJWA 2YTVA 3Q23A 2SNSA 1EY5A 3IAS1 1TT5B 4KIKB 1C9OA 3U4ZA 1ESFA 3RN9C 4IFDG 1FVIA 3Q8DA 1ZKHA 3TP8A 2Y5PA 2OQKA 1AYFA 1V2YA 3DBLI 1WXQA 1BF4A 4GLXA 5DLQE 2C9OA 1KLGD 2J4XA 2NVTB 2A6EC 3A7LA 2PJHA 3B9JA 4A6QA 2V3SA 4A3MH 1N9WA 2NCNA 3C46A 2CU3A 4HAEA 2I5LX 3S2AA 1KOTA 2DY8A 2ATWA 5I9PA 1ET6A 4X3SA 4DK3C 4OX9L 2LGYA 1N34Q 4KX6B 2LFNA 3ICEA 4A3KG 5HY6A 4B08A 1Q12A 3JAMi 3R7RA 4C3IG 1VQDA 3NZ3A 4LF5Q 2BOSA 1KIXA 2ZNVB 3B2FA 3GTOH 4W9IA 4NXML 3LXFA 2JA6H 3L17A 1R9TH 1Y8OB 3VR4A 1HZBA 2Z6KA 1D7QA 2N49A 1I4XA 2A5HA 3WANA 3A1QA 2NN6H 1QVGA 3D31A 4PNYA 2L55A 3KF8A 2XWBB 4CJ2C 2KCTA 5KEEA 1WSPA 2RBMA 3SK6A 2R2OA 2VZAA 2WS3B 2L4NA 3PF5A 2W9NA 1VQ9A 4ZQ3A 1XWEA 3HOXH 2GBNA 3I4NH 4DKAC 1UEBA 1KNEA 2QCPX 3HZXA 3MWYW 1F52A 1YN3A 1EY0A 2XSCA 1K83B 3TDQA 2K1FA 3ABVB 2ZTEA 1L6VA 4QL5A 4IFDI 1EZ8A 3TP7A 2K8BA 1O7IA 3ZO5B 3DEPA 3W2DA 1A0IA 3J7AF 3HOZB 1JB7A 2C7NB 2L11A 2WXPA 3M62B 2VUMH 1WYGA 1JB3A 2K05A 2P5ZX 1I4RA 1QCBD 1ZYRC 5FOBB 2B3GA 4X65L 1CTMA 1M1KC 3GTPB 1JW9D 1VQ6A 4LNFA 4CKEA 1CT1D 1OQRA 5LMNQ 3Q0AA 1MG8A 4GLVB 1A3UA 2A68C 4RCOA 3U58A 1C78A 5DNFA 2WXIA 5EE0A 2KDBA 4GB9A 1X32A 1JCKB 1HZ6A 3DBSA 1YOVB 3HKZG 1WGKA 4FXGC 4A3OA 3I55A 3S1RB 4HJ8A 1PYWD 4K5WA 1CZWA 2LS01 2V1YA 2GVAA 4B0MA 1IUEA 2B63G 5I6WA 3L13A 1PFMA 3VR3A 4R4QA 3M7NA 4KJNA 4MIUA 3I4OA 4LTUA 4W9DA 4LF7Q 4LWCA 2B2TA 4UY8C 2AL3A 1FEHA 4HJ9A 4LF4Q 3T9LA 2KYWA 2WKCA 3ML8A 4GSWA 3PF4A 2AEHA 1Y1WH 4A3BG 4HMJA 2CS4A 1DOLA 1MJDA 4CHKA 1AFPA 4NJCA 5IGCA 5C3XA 3NZUA 5ELCA 4XXEA 1YZ6A 5C3EH 1CJEA 4AP4C 5FR3A 4DK1A 1KHIA 2EJGC 2LASA 2PW9A 4OL7A 3GTMH 4C1NK 3PGEA 4K2KA 3ULPA 1WTWA 1DONA 1GKHA 2LJIA 2B63H 2N0SB 4M0WA 3W1SC 3CAMA 3U9OA 4X62Q 2K75A 3MJ5A 2HDEA 5D3DA 3WDNA 2C60A 1Q46A 1H9SB 4JOIA 3K58A 1Y56A 2JYEA 3H7PA 2JA8H 1SYBA 1JJ2A 2MJ3A 5EKLA 1Y8NB 2UXBQ 4MSQB 2Q2IA 4NY0A 4WJPA 4USAA 4BY7G 1SBBB 4HKQA 4HTHA 2PLPA 1WGRA 3AE8B 1K9MC 3S2HB 2IGGA 4GOPC 3MAQA 2KHSA 1TKGA 3AECB 4LF4L 3MHSD 5BMIA 4GXBA 2JXXA 2PQAA 1D3ZA 4TMAB 1GM5A 1V97A 4M1UB 1G8ZD 3TRZA 1STHA 2FNJB 2VH1A 2K5QA 4I7AA 4AIMA 2WXRA 3DWGC 2LXCA 2LVOA 4H2AA 4BVUC 5T8IA 4B95A 4QIWE 2K5HA 4C80A 4DWFA 2HUGA 2KWUB 4H44C 4F7ZA 2MQHA 5TSSA 3ZYYX 1N60A 1SRUA 2NTTA 4IM3A 4FBJB 3CF6E 5COYA 3I2ZA 4JI0Q 3VRBB 3NP8A 3X3NA 4BBNF 2BE5C 2MQJA 1VQ8A 4B3RQ 4OIJA 3NE5B 1UZXB 1XMOQ 1L7YA 2I38A 1VQAA 2XN9C 3EFCA 1H8CA 4XT3B 4DV0Q 4RG1A 1X3PA 3VA5A 1FIQA 3RUIB 1GNUA 1GXDC 2VRRB 3B6YA 3B1LX 5BYSA 3ZNZB 2LVPA 4KKSA 1STEA 4X6AH 3GTPH 1T6BX 2FIFA 1JWSD 3BU2A 1FFUA 4F8MA 3HEJA 1K52A 1RLFA 1J5EQ 4NQKE 4DHZE 2KANA 4K2LA 1STAA 1ICFB 2Y0SE 5JJKA 1Y1WB 1XTDA 3EA6A 3H15A 2JQRB 2X38A 3KQ4A 1HUMA 2V3NA 3T1YL 4HIKA 3E6ZX 3LWUA 1K73C 1WXVA 3A9KA 3PLVA 4RF0A 3EROA 1LYLA 2F0DA 3I7FA 4G57A 5G3LF 1RD9D 4TSSA 4AQYQ 1WTRA 2L00B 3Q8BA 3QWZB 5DAUA 1X3GA 4R8IA 4A8XC 1ET9A 4E6IA 1EM7A 2QDLA 3HOZG 5FLXE 2Q8RE 2VY3A 2B29A 1JOQA 1YQBA 1YQ4B 1JC7A 5DPSA 1CK1A 4X3UA 5IGDA 1L1OC 2H4OA 3HRZC 3DBHI 3N32A 2YYZA 4JCVE 4EGVA 3VAWA 4BKSA 4JPBW 1LTLA 2L9HA 2DLBA 5E6PA 5BMHA 1A2UA 4R4OA 4MGIE 1CSPA 1QOBA 2NBUA 4QMGA 3HRDD 1RTOA 1EY7A 3PO2H 5IP9H 1DXMA 2N9KA 2HDMA 4R1JA 2MJEA 3BINA 2E75C 3ZXVA 5IA7A 3KLSA 3E0EA 3MC0B 4KGRA 4RM8A 3IHPC 4S17A 5CV5A 3HKZB 5J3BA 4A3LG 4OO1G 2SEBD 4X64L 4GNXB 3OMGA 1J19A 1LTBD 4IJLA 5ELEA 1T5XD 2UXDQ 1X3QA 2PQEA 1HQRD 4NKLA 1XD3B 1NNXA 1VQFA 2IDYA 1V81A 1W6JA 3J7ZC 1WM2A 2YLMA 3A9JA 1O80A 3FILA 5JZEB 4AWJA 3DWPA 1I4QA 2NVTH 4A3IH 1XT9B 2WB1B 2PVGC 4Y7NH 3TBIB 3KJPA 1GC7A 4ZLTF 5C0XH 3CMEA 4HCPB 5H92C 1X3EA 1HFNA 4YWGG 5IOIA 4MJSA 3JYUA 4X65Q 5IO9A 3P4RB 2H5XA 3AU7A 1GVPA 3LB8C 3L0WB 1GUNA 1X6OA 2EDGA 1PH2A 3DPDA 4K1RB 4WIPA 1M94A 2I07B 3RULA 5LMNL 5EE9A 3DM1A 3P1MA 4A9AA 1PTOB 4C3HG 4DAYB 1HJPA 2KA7A 1ZDVA 2NPTB 3JAME 1YITA 1CMXB 3O65B 2GB1A 1C4AA 2RQXA 4TV3A 3KJOA 5IY0A 2JYOA 3HGBA 2FXQA 4G3XB 2AWOA 4LFCQ 3BWUD 4R3DA 4BWGB 4PYUA 3OIQA 3GTKH 1OXSC 1CUKA 1C7YA 1JE4A 1SSOA 3T8MA 4DR2Q 4IUUA 3L10B 2JZ3B 3PVLA 3RZDB 1STGA 1S4ZA 1VQ7A 4QQBX 5DPRA 3F2DA 2O2VB 5CX3A 2N1WA 3TL5A 5HGTA 2JA8G 4DAMA 3EJIA 4ZUIA 4LNQA 2EE1A 5M3MH 5T1GA 1WE6A 4F1SA 1YHAA 2ZXRA 4JQWC 3BK2A 5HFYA 2YV5A 4TQUS 1UWVA 3PO2B 1WJUA 2IO3B 3SD5A 3GQBA 3K59A 2QCZA 1VF7A 1EWHA 3U8ZA 3IAYA 4GLAC 3SEBA 3HS0C 2KDFB 4N8X1 1QVFA 5HG2A 2L15A 1E24A 1U0LA 1VCIA 2KFKA 2DWQA 3ZDTA 3CCSA 4JI5Q 1HZ9A 2A68D 3I4MH 2JXMB 4ANXA 3HOVB 1MHHE 1IKMA 2N9XA 1QE6A 2JRHA 3E3XA 1IBML 3CWIA 4A93G 4LJOB 4ZCKA 1F9QA 4P72A 3KWLA 1A63A 3N52A 1B2TA 2ZVOA 4KSKC 4JI6Q 4PS7A 4OW0A 3W5VB 2OEOA 1K0RA 3KLRA 4ZRZA 2NVUI 3CF5A 2NB0A 5M3FB 3BVZA 1XLPA 3EC8A 1SFOB 4KHVA 4W9GA 2HCCA 5JJZA 2L0FA 4IUQA 3OHXC 2FJ2A 3HKZE 2XEWA 4ARCA 1ZW7A 2KACA 5JJIA 1Q86C 2OWOA 1HTQA 4K0KL 3PV1A 2K14A 4II3B 2MA9B 4MN3A 3NTIA 1T0SC 1TZ1A 4FF4A 1K8AC 2J7ZA 3SE0A 1BNZA 4URKA 4DR3L 1YHQA 1ENCA 1E5WA 1CI3M 1C1YB 4AQ7A 4YWKA 1FRDA 3E5SA 1BDOA 4BXXG 2LGIA 2TSSA 3ONSA 1LACA 3HM3A 5C5LA 4FF1A 2CWAA 1JOOA 2IT1A 2I46A 1E6EB 4V190 4G11A 1IL2A 3PIO3 1V80A 1C0AA 2GBKA 1PDQA 2L1AA 4JWUC 2QDFA 2DNFA 1ZPSA 3HOYB 5IN7A 3K6OA 3QAQA 4OWWB 3M4PA 3S2HH 1VJKA 4RGTA 4KGSA 4MTKA
chains in the Genus database with same CATH topology
5ELBA 3IKJA 3P4PB 5C4ZA 1SB3C 5M5WB 2F0JA 1CZPA 1SXTA 4PV1C 5K36G 1H9KA 1XYIA 1SNCA 3VQIA 3E56A 2QIEB 3NBIA 2X69A 3DHQA 3L3OC 4F7XA 1G2SA 2K7VA 1TQOA 1GAQB 5K5PA 4C3IB 3HOUB 1EU4A 1JR0D 1CA6A 2R61A 3FMCA 1SJED 4KD4A 2JA6B 3V05A 4GLSC 1A70A 1D1IA 1OXVA 3MEHA 3PUZA 2JA8B 5KYLA 1L0XB 2K33A 2F3VA 3S9WA 3H09A 4WWMA 4S3SA 5E4XA 5CBEE 5JVG3 2JA5B 4XQJA 3I4NB 3MFYA 2V0GA 1FD6A 3OOCA 1RCVD 3TP6A 3KBXA 2OF1A 2HDLA 1EEID 2XIWA 1EZ6A 3NUCA 3IFTA 3RUZA 1BCPC 2IX0A 2K5DA 2LMCA 1QLBB 1PFDA 5JOBA 1S5BD 5JXVA 1S5FD 3DWMA 3L7ZC 4A3FB 5CV7A 5G5HA 4YTPB 4HEA1 1NYQA 3PZ8A 3KK7A 2FBWB 1SDFA 3KBGA 3PO0A 3W9CB 4J3OD 3CRKC 2PCFB 1ESRA 5C0XG 5I2YA 3AM9A 5F2DA 3R3OA 4NP5A 3BVMA 2F0EA 1TWAB 2KAJA 5JEAJ 3SK8A 1Y69U 3ZGZA 1ACCA 5M5XB 1V1PA 2I2YA 1WTPA 2LFIA 3H6MA 1HFGA 1BQQT 1PRTB 2JE6I 1O78A 2NUCA 1EYDA 5NUCA 4YSYB 1GUSA 4OZCA 1Q8IA 1NR4A 1ZKOA 3MXNA 3OW7A 2F0QA 3PIP3 3AE4B 1KDCA 3D6CA 3SFEB 1TZOA 3S1NB 5AUKA 3I91A 1JWBD 1PZID 1E0ZA 2H89B 3P4QB 4RKBA 2IGHA 3WCQA 1STBA 1QILA 4DNTB 4XWTA 4HN7A 3MTSA 2MGSA 1G291 4N59A 4XTCS 1R4QB 3HOWB 5EPKA 3SK5A 4OZAA 1IGCA 2WXQA 4ILWA 1D1KA 3VYUA 2EYOA 2DNCA 2NN6G 4OHJA 3QOJA 5C3JB 4G7OC 3PO3B 2B2VA 3QIAA 1PZKD 3U9SA 3I3CA 2K5PA 1L5PA 1MPEA 5J1ZA 1F77A 1F0ZA 2WXHA 1AZPA 1SYGA 3PUVA 1G91A 1B53A 3CRLC 1PDXA 4KGTA 2Y3AA 2WKDA 1C8CA 5JEAG 5FKAC 2W82A 1VZ6A 3GTKB 1CFMA 1IHZA 2SAKA 2VZKD 4IFDH 3G6JB 4XE0A 2O5IC 4DNRB 3T13A 2IGDA 2EYFA 1PRTF 2OXPA 1XEEA 2BE5D 1XX8A 3T56B 4CJ0B 3ITPA 2BBCA 3ZJUA 4BA2I 2K03A 4DU9A 3TEZA 3SR1A 4FXCA 1WTQA 3T53B 1C4CA 4WORA 1ILQA 3FKIB 2NVYB 3BYTB 4JPSA 2NVXB 1SF0A 4DN4M 3ZJTA 1WVLA 2Q5WD 1NR2A 2E3TA 1O7LA 1H9RA 5CORA 4XYOA 2MUYA 2K6AA 3U52E 2JA7B 2EPBA 2B2WA 4A3EB 1SNDA 1TS2A 5DM63 1QB5D 1EYCA 1M4VA 1U4PA 3BDLA 3S1MB 1B4OA 1TIID 2N7JA 4TQ1A 1CM9A 1SE2A 2PNRC 3J80E 3TSSA 4IUNA 5FO8B 2IJ0A 1T3QA 2RSOA 1TWFB 3NQTA 1Y1VB 2OHFA 3AEGB 4F88A 4C56C 1FCLA 1ZXHA 3FILB 3VR6A 4CHTB 5IOCA 2EJFC 1QNKA 1MSGA 5BYRA 3D6WA 1A3VA 1JOKA 2EYLA 2Q8IB 3EVQA 2LHDA 1PGBA 2WNMA 1AZQA 4KI0A 1CA5A 5A2QE 3VR2A 5IGEA 3GTGB 2IL8A 2QKIC 1QOGA 3AE2B 1D5ZC 2EYPA 1TWHB 4OO1I 3FRPB 1DGJA 4A93B 1TJEA 2BW2A 3P1HA 3VR5A 5KIXA 3GD7A 1K53A 1R4PB 1EEFD 2NVQB 4KJOA 2AX5A 3U2SC 1GPXA 2KJXA 2LHEA 2KQ3A 2NTSA 1AWDA 2K1BA 4HCSA 1RWSA 1D5XC 1V8CA 3BIID 5IT9L 2E2DC 1IYUA 1KABA 3QOLA 1IGDA 1HTLD 4CKCA 3TUOA 4EQNA 2JYTA 1PUTA 2A6HC 2AQ2B 5LL6X 2A69C 2K5WA 1LT6D 2AQ3B 2PW7A 2K01A 4QF4A 2V3PA 5T8IA 3VR8B 4TQ0A 4IUVA 4DFAA 2EY2A 2PVOD 3RD4A 2F0KA 2WXGA 2LY7A 1SSNA 3S16B 2O5JC 1P7FA 2KCNA 3DUZA 1YNND 1MI0A 4B9WA 1DCZA 2M19A 1EL0A 4PQXA 3NXWA 1DOMA 2YEPB 1C4PA 2F0NA 1IKLA 4XT1B 5EKKA 2LKVA 1SYEA 2D62A 5BN4A 4IFDJ 3U7ZA 1QOFA 5H8YE 4C7YA 1OFFA 4X3KA 1O7ZA 2RDHA 4DQOC 1E9MA 2RSNA 2WXOA 4K8JA 1CQVA 2FHTA 2D2CC 3BVGA 4ARIA 4DXFA 3TEYA 3D3RA 4FVMA 1HTPA 1E0BA 3NTHA 2WP9B 1V1OA 1L0VB 4RHSA 2A69D 1C48A 3CHBD 3EUB2 1EIGA 4DXGA 1PGXA 2DY7A 2ICEC 4ODGA 2BS3B 3GB1A 3L4PA 3BS1A 1OQQA 5CV4A 4HRSA 1NI3A 2EY5A 1U4LA 3IXSA 3MXPA 3E0JA 3PV0A 1H9JA 3K0YA 1KAAA 2E2HB 3TMEA 1IL8A 4L6TB 4A3DB 3M7GA 2IPKD 4RF1A 3SVMA 1LTSD 5JVH3 1NCVA 2KMMA 4XIGS 2ID0A 1HQMC 1QWYA 4XWWA 1U9RA 3C1FA 2OEDA 1RHPA 3TZUA 2PZWA 1G2TA 3T3NA 1ZUD2 3W5UB 4P6VF 3Q8EA 1ROEA 1B1ZA 5FLXL 1BMLC 3NWSA 1RFKA 3K5OA 5K36H 5LHY1 3ETRA 1DJRD 5I2XA 1XTCD 2B8FA 2Q8TA 3IAM1 1BR9A 4XYQA 3S2DB 2WXNA 3PMFA 2RVLA 3O13A 2ACZB 2WXFA 4RFBA 3L9AX 2R6GA 1K50A 5JPMC 2JXTA 2DN8A 2CHBD 1LV9A 1N61A 2BDOA 4ZKCB 2BS4B 4N9TA 1N63A 1BCPB 2JWUA 4KKIA 5KGUA 2J0TD 1K51A 4REZA 3TEWA 4US8A 1DOIA 3I90A 5IT9E 3CQZB 3I73A 2TMPA 3NRZA 2NYZD 1RYJA 1XXGA 4QCLA 2ZW0A 1W6KA 2EYMA 4NDXA 3B2GA 3J9CA 3P75A 2GI9A 2PTLA 2B2WC 2F0MA 4N9PA 5C0XJ 3N6RA 1L4ZB 1AW7A 4ZOHC 1J7AA 3D4RA 2H88B 1RODA 4C7ZA 4KMUC 3CIRB 1MSHA 4KKTA 3HUIA 1H9SA 4IUTA 1FYCA 2ZXPA 1C9FA 3HOXB 3KLSX 5BYQA 2KECA 1DOKA 4RHRA 1S5DD 2J53A 5AUIA 4RNAA 1A2TA 1B50A 2IWHA 1VMPA 3NVYA 4KY6A 3NHHA 3J7YW 1M8AA 2W3SA 2NMQA 5D65A 2RDGA 3R2TA 3NVVA 2LMCB 2O4XA 4JWSC 4A55A 2KDMA 2AUJD 4HCEA 4JK1C 3VYTA 2BDNA 3P20A 5I6YA 1MGSA 3IFDA 4KN4C 3PUWA 3UI3A 3X3MA 4DGZA 3J81E 3M4OB 5EPLA 4GZYC 1CQFA 1C77A 2NZ1D 2YU9B 1UAPA 2EOTA 1OO9B 1HZ5A 1TWGB 2D5DA 4FYDA 5BMGA 3I8ZA 3BZDB 4KY7A 1S5ED 2EXZA 1I6HB 2IW3A 3A7AB 3HVDA 1KNAA 4EVOA 5JAVA 1LTGD 4CJ1B 4NW2A 3QG1A 4GDLB 3H8HA 1QKZA 5J22A 1L0YB 3V3XA 2F0UA 1GB1A 2QSDA 2BCOA 1D5MC 3UI2A 3MHBA 1VR9A 1EOTA 1SNQA 4KTAA 4RGOS 2WXMA 4BS9A 2FUG1 5I4DA 3GV6A 1VZ7A 4RKLA 1XCQL 4OO1H 1GHKA 3OPOA 2V4IB 3E9SA 5G5GA 2CJOA 2LUMA 3NVWA 2KUMA 4MHEA 4Q5VA 2WAQB 4HEDA 2XRQD 5EE3A 1F9SA 1SE4A 1HA6A 1SAPA 5FO9B 1XLNA 3G7LA 5C3WA 1RTNA 2PIAA 1JALA 4J1MA 1ICWA 5CYUA 3SDZA 1YNJD 3NQIA 2WLBA 1PGAA 4ZKBB 1TR5A 3EFXD 1IBXA 2Z4IA 2D5GA 1GOZA 4RCNA 4HKZE 2L83A 4PMCA 1FNWA 1UWXA 4K5VA 1ZXTA 4BBSB 2PYKA 3DWQA 2W55A 3I70A 4C3JG 3P63A 4IKGA 2KQ4X 2QF7A 2JZPA 1VZ8A 2O2LD 5FO7B 1TY0A 3BG3A 4O42A 4IDIA 1Q3LA 1OXXK 5DM73 4HR7B 1V43A 2R3ZA 2IX3A 2K04A 3EGRA 3H0GB 3H91A 1JWAD 5ELFA 1FNVA 3QWNA 1Q1BA 3VR9B 4DAPA 4EQPA 1LTAD 1A15A 1AP0A 1OXUA 2HCIA 3BK1A 1Q1EA 1NSNS 1KLUD 3NBHA 1BBXC 1SNMA 2B2TC 4KN7C 2BA1A 5CR3A 1GUGA 1F2ZA 4IURA 4RA8A 4MM3B 2ZXOA 1MI2A 4H0LC 1G6ZA 5E6JA 1PTOC 3OWFA 4H13C 4DF7A 1GUOA 3I72A 3J81L 3AB5A 4B9XA 4YSXB 2QILA 2MH7A 2JU6X 1QF6A 3SFDB 2JEAI 4PT5A 1LT3D 3RLFA 3SHLA 2F3WA 1YN5A 1Q90A 1JWUD 2DNEA 5CV6A 3Q22A 1FM0D 1PTOH 5ELDA 1JMLA 4ZYSA 1TYGB 1JQYD 3RZOB 1Z6HA 4L8JA 2M2LA 1PMRA 3D4DA 4K5XA 1F9RA 1TKYA 2MP1A 2WU5B 4Y7NB 3Q8CA 3HG9A 2WINB 3DEOA 2F1MA 2KEDA 1YQ3B 2PZTA 5C4JB 1FD7D 2G9HD 4IN3A 1U4RA 1DYQA 3PUYA 2FMCA 1ZP0B 2F4IA 1IYVA 3AE6B 1SIJA 1BUIC 1KRHA 5EPJA 2NBFA 4DK0A 2DYMA 4CBVA 3SR6A 4UAIA 4K6DA 5C44B 4NAWB 2EELA 1ZXIA 3W3AA 2JX5A 1EY4A 2FFKB 2KWDA 3J7AV 2V4DA 3A8KE 2GRIA 2WP8J 3H94A 2F0WA 1KTKA 4PMWA 4R9WA 2L12A 1II3A 4RWSC 3URYA 4UDUC 3J80L 4U673 2WIIB 2F0PA 2SDFA 3T51B 3HP3A 2XVSA 1PRTD 4RH6A 1VMCA 1QOAA 3W1SA 3AE1B 1LTID 3N9YC 1TY2A 3MA2B 4RAUC 2GA4B 1HPCA 4QUCA 1BXTA 3NVZA 2AQ1B 2HQEA 3GV3A 2WXKA 2N55A 5HI1A 3DXJC 2E6XA 4WJWA 1LT4D 3T3OA 5M5YB 1HHVA 3NTKA 5KNCA 3S17B 2WDVB 4B0EA 2BB6A 5J39A 5EE1A 3BDOA 4C1NI 3CU7A 1RJTA 2F0FA 3DMUA 1ZYRD 2R7ZB 3C8YA 2KN4A 1F2LA 2M00A 3V96A 3EQLC 4YT0B 1B9NA 5EGTA 5BN3A 2EJMA 1PTOD 5CV8A 4AS1A 4NMZA 2VB3X 3WOEA 5BN5A 3GTQB 4A3BB 5C6AA 2DYOA 3PUXA 4WRDA 2E76C 2B76B 4N58A 1GUTA 1JWMD 4WFN3 1EQVA 1GHJA 3T16A 1STNA 4YXDB 2SNMA 1Y8PB 2CQAA 1TKEA 3ZJVA 1ML0D 2IX1A 2AWNA 2C5CA 2X6GA 1I6VC 3K5LA 1FCCC 2WQYB 2PPBC 3AN1A 1DD2A 4WURA 4LK1C 4RGNA 4HSVA 1RF2D 1ENFA 2FE8A 2D9UA 1DM0B 3VYSA 1A6XA 3GTOB 2B39A 2SOBA 3MZ5A 5CV9A 2QMTA 2WDRB 1I50B 5JEAH 3RFZB 4KD3A 5HURA 4A3IB 1N5WA 3FPPA 5DEHA 3D8GA 1HUNA 4WQMA 5EBCA 3KWVA 1MBYA 3ND9A 4C2MB 1UEAB 3I9V1 2X6LA 1S5CD 1LTRD 2CJNA 4U68A 1EY9A 1TKWB 1L4DB 4BY1B 1C76A 3AE7B 5CBAE 1SYFA 2QDBA 3A8JE 2XNAC 4G7ZC 3MHZA 2K22A 3MXGA 5C2TB 2VUMB 3H3VC 3I4LA 2EYHA 4FXDA 3AEBB 2VXWA 4FO2A 4IOIE 1TVXA 1E10A 1DZ1A 5IGGA 2F03A 1QT9A 3FEWX 2R92B 1GUWA 3IT4B 1ZE3D 3AE9B 4LAAA 3P42A 1NEKB 1F2MA 4A3GB 1B9MA 1JROA 5GXGB 2K3UA 5D7GA 1T5EA 5G3LD 1BOSA 1EWCA 2QEJC 5CMDA 4FP5D 3LNNA 2QJLA 1JRPA 1HXYD 2CW0D 3C1EA 5C4HA 3A56A 3AEEB 3GS2A 2KEEA 4F87A 1NVID 1UUPA 1VLBA 2L32A 4HJGE 3WOFA 1MVKA 5CC4A 4FNFA 1KDBA 1DOYA 2MPMA 1YNJC 3LWEA 2F0IA 4ZK9B 3PZ7A 3R2IA 2J42A 3R93A 4RGMA 1GB4A 1EY6A 2EKIA 1UWMA 1BCPF 1WTOA 2PKOA 2JEBI 3Q6SA 1PXUA 1Z7TA 2F0VA 4XQQA 1TT2A 4C3JB 2RMMA 3A55A 3AEDB 2A73B 2RPVA 3Q8FA 3AE3B 1JORA 1VRAB 1YNNC 2Z8LA 1JQ4A 1J9OA 1ENAA 1KH0A 3CKIB 3LYYA 2J52A 5A2QL 5EBDA 2B2YC 2RA4A 2RDFA 4A3JB 4MACA 4H7BA 1F2YA 4US9A 2BT6A 4YTNB 1BO0A 3A54A 4IALA 4BA1I 2ON8A 1QNUA 2WXLA 1NENB 2FMMA 5EJWA 1EQTA 4KV6A 2HTME 2B2UA 3TN2A 1F9PA 4A3MB 1LO5D 2EYJA 2CW0C 3FAHA 4PMBA 1I4PA 2JP1A 1FO4A 1FFVA 3K7AB 1F2RC 3FDTA 5C0XI 1SJHD 4LMQD 2F0GA 4ZUJA 1N62A 3T4AC 3NK9A 2MJDA 3VA7A 1ZDXA 1RDPD 2E2JB 4IZ8A 4OIKA 1IW7D 1P7EA 1QG7A 1L6UA 1NAPA 2PMZB 2G9DA 1YMHE 1GJXA 4OZBA 3U4EG 2L52A 2XRSD 2G1EA 2BA0A 1CHPD 4BY7B 5KRUA 1MD2D 1SEBD 4YIJA 1U4MA 4Q0FA 2WDQB 2A6ED 2Z1CA 2BYTA 2BTEA 3S15B 1WD1A 1FXAA 2NN6I 4K8IA 3AV8A 3M4YA 3R8BA 3AE5B 2WV6D 3IT6B 1PZJD 1MHXA 3LB8C 2B2VC 2A74C 1VDVA 2R93B 2B2YA 3NWTA 3AMZA 3NS1A 1TWCB 5KYIA 1J8IA 5FK9C 4V0BA 1ZOYB 3TP5A 3BDCA 1WTVA 5KNDA 3K57A 1JICA 5ISRA 3IL8A 1KF6B 3TEXA 4ZHPA 1KFYB 1N5XA 1SE3A 4AYBB 4L23A 2N9LA 1EYAA 1WD0A 1QJOA 3F2UA 1PFBA 5LL6S 1HA5A 5IODA 5IGBA 1E7PB 2M0AA 4LLGM 2VZKB 3DWAA 2M56B 4HSPA 1AEXA 1XF5L 1TS5A 3AH7A 4I7ZC 5T1IA 3GTMB 3I4MB 1D6EC 3AB9A 3AMUA 4EQOA 1PTOF 3KUPA 3NUHB 1LTTD 3GP7A 5CGKA 2K9XA 2INPE 2VB2X 5AFWA 2MJ8A 1QQRA 5C4XB 4ITKA 4KKJA 2INNE 2KVMA 3OSOA 1SMYC 1D2BA 1STYA 3K5NA 3GTLB 4KKUA 2F0HA 3ND8A 2XWJB 1AN8A 1LABA 2Z4HA 2K32A 1I4HA 2K0PA 4KY5A 5HHDG 4ID6A 1K8OA 5IGFA 4MH8A 3VRAB 2KOLA 4DA2A 4XDDA 1FRRA 3AEAB 4TKOB 4CGYB 2E2IB 4A90A 2L5TA 1FGBD 4DAYA 4OGQC 5D14A 1KDAA 1R9TB 2L1BA 4FXKC 1H9MA 4C3HB 1PLFA 4TRDA 1IW7C 2VNUD 3Q8AA 1D4BA 2M9VA 1V8QA 1HCZA 1ILPA 1RKNA 1SYDA 3P7JA 1I7HA 1HRJA 4DAVA 4K14A 4P16A 3QB3A 4WH4A 3RPFC 1DOXA 4I65A 1EWYC 4ZRQA 3OMCA 1ZEQX 2LEKA 1XLQA 1WWTA 3A8IE 5EKIA 4FF3A 2WU2B 3MP9A 4XDCA 3I57A 1FNUA 4ABNA 4ZHOA 2WXJA 1VF5C 4JBWA 4LK0M 1WTXA 4L2YA 4YSZB 3NPPA 3LX0A 1EFID 4X3TA 2ONQA 1HEZE 2PO4A 5A35A 2JSVX 2F0LA 4ZRPA 3ERQA 1YN4A 4G7HC 1EIHA 4L1BA 3GO5A 2ZT9C 4HMIA 5LNK1 3VYRA 4IUPA 2L0CA 1B9RA 2Y5CA 1WRIA 1UNSA 4KHZA 1V1PB 4ULLA 3Q69A 5I9OA 1CZGA 4XQNA 1YJJA 1SNPA 1FXIA 4JX1C 4R8NA 4FF2A 5E4WC 3Q24A 5IIFA 2PMVA 4NAMA 5EQ0A 2EY6A 5E1FA 2NWGA 3M3YB 1E2WA 2B8GA 2BS2B 3ONAB 1BUVT 2B2UC 2A6HD 2F0SA 1YJIA 1SMYD 5M3MB 4CKBA 5D3IB 1NUCA 2N88A 2PZUA 1EU3A 1LLRD 4QUFA 4HROA 3D4WA 4D2KA 1BCPD 3S1QB 3S14B 3AEFB 1B3AA 3BYYB 1RM6C 3MXUA 4WAFA 4N6EB 2JSOA 5KNBA 3FPUB 2B63B 4A3KB 1OXTA 3M85A 2W3RA 2W54A 4GDKB 4QB4A 4L63B 3QO2A 1XO3A 4K6LA 2EZVA 1I4GA 2RKSA 1Z47A 2E74C 4LJZC 2F0OA 3NSWA 2KCCA 3SXHA 1J7BA 2MEKA 2K28A 4JE3B 4P2CB 1E2ZA 3MVVA 1K8MA 2PW5A 2ZW1A 3MFGA 1XLOA 3RMHA 2EY1A 4J6HA 2F0TA 1I3QB 4G4KA 4M8AA 1R7SA 1TU2B 3TZDA 4OVZA 5M9OA 2FINB 4ZAIA 2DBYA 3P4SB 4KK7A 2ICIA 1UGJA 1IBXB 3FVQA 1WCMB 1FMAD 1QOHA 1F2RI 3ZQ4A 1LT5D 1XCTL 1VDZA 4BBRB 3FC4A 2BB5A 1A3TA 1E2VA 4IQZA 4MT5A 4ME5A 5E3FA 3OIPA 3SK4A 2Y0SB 4XDXA 4J8QA 1FR3A 2ENBA 1TS3A 2EVBA 4Q2JA 5C3EB 4NZLB 2WACA 1NYRA 3HVZA 4YTMB 1B44D 1J7CA 3GTJB 1C4QA 1Q10A 1SYCA 4O1NA 1SNOA 3OWEB 1CHQD 1YNTE 1PRTC 2MHVA 4EE2A 2AUKA 1EY8A 4Z9CB 3K5MA 3QJYA 1PFNA 3JAML 2CVRA 3V2TA 4CQNA 1ONLA 2YEPF 2OT2A 5JPNC 1TS4A 4QIWB 1C79A 2H1EA 5MPOA 3C2PA 5C5MA 3C3LA 1O7YA 3Q23A 2SNSA 1EY5A 3IAS1 1ESFA 4IFDG 2Y5PA 3TP8A 1AYFA 1WXQA 1BF4A 2C9OA 1KLGD 2J4XA 2NVTB 2A6EC 3A7LA 3B9JA 4A6QA 3C46A 2CU3A 4HAEA 2DY8A 5I9PA 1ET6A 4X3SA 4KX6B 2LFNA 4B08A 1Q12A 4C3IG 3NZ3A 2BOSA 3B2FA 3LXFA 1Y8OB 3VR4A 1I4XA 2A5HA 2NN6H 3D31A 4PNYA 2L55A 3KF8A 2XWBB 4CJ2C 5KEEA 1WSPA 2WS3B 2RBMA 3SK6A 2L4NA 4ZQ3A 1XWEA 3MWYW 1KNEA 2QCPX 3HZXA 1YN3A 1EY0A 2XSCA 1K83B 3TDQA 3ABVB 1L6VA 4IFDI 1EZ8A 3TP7A 3DEPA 3W2DA 3J7AF 3HOZB 2L11A 2WXPA 1WYGA 1JB3A 2K05A 1I4RA 1QCBD 1ZYRC 5FOBB 1CTMA 3GTPB 1JW9D 4CKEA 1CT1D 1OQRA 3Q0AA 1A3UA 2A68C 4RCOA 1C78A 5DNFA 2WXIA 5EE0A 1X32A 1JCKB 1HZ6A 1WGKA 4FXGC 3S1RB 1PYWD 4K5WA 1CZWA 2LS01 4B0MA 1IUEA 5I6WA 1PFMA 3VR3A 3M7NA 4KJNA 4MIUA 4LTUA 2B2TA 1FEHA 2WKCA 4HMJA 1DOLA 1AFPA 4NJCA 5IGCA 5C3XA 5ELCA 4XXEA 1CJEA 5FR3A 4DK1A 2EJGC 2PW9A 4OL7A 4C1NK 4K2KA 1WTWA 1DONA 2LJIA 2N0SB 4M0WA 3U9OA 3MJ5A 2HDEA 5D3DA 3WDNA 2JYEA 1H9SB 3K58A 1Y56A 1SYBA 2MJ3A 5EKLA 1Y8NB 4USAA 4HKQA 1SBBB 4HTHA 2PLPA 3AE8B 3S2HB 2IGGA 3MAQA 2KHSA 1TKGA 3AECB 5BMIA 4TMAB 1V97A 4M1UB 1G8ZD 3DWGC 1STHA 2WXRA 2K5QA 4H2AA 4C80A 2HUGA 4H44C 5TSSA 3ZYYX 1N60A 2NTTA 5COYA 3VRBB 3NP8A 3X3NA 2BE5C 4OIJA 3NE5B 2I38A 2XN9C 4XT3B 1FIQA 1X3PA 3VA5A 1GXDC 5BYSA 4KKSA 1STEA 1T6BX 1JWSD 1FFUA 4F8MA 3HEJA 1K52A 4K2LA 1STAA 1Y1WB 3EA6A 2JQRB 2X38A 3KQ4A 1HUMA 2V3NA 3E6ZX 3LWUA 4RF0A 3EROA 2F0DA 4G57A 5G3LF 1RD9D 4TSSA 1WTRA 4A8XC 3Q8BA 5DAUA 4R8IA 1ET9A 4E6IA 1EM7A 5FLXE 2Q8RE 1JOQA 1YQ4B 1JC7A 1CK1A 4X3UA 5IGDA 2H4OA 3HRZC 2YYZA 4EGVA 2DLBA 2L9HA 5BMHA 1A2UA 1QOBA 3HRDD 4QMGA 1RTOA 1EY7A 2N9KA 1DXMA 2HDMA 2MJEA 2E75C 3KLSA 3MC0B 4KGRA 5CV5A 3HKZB 4OO1G 2SEBD 3OMGA 1LTBD 5ELEA 1T5XD 1X3QA 2PQEA 1HQRD 4NKLA 2IDYA 1W6JA 1O80A 3FILA 3DWPA 1I4QA 2WB1B 2PVGC 3TBIB 4ZLTF 5C0XH 5H92C 1HFNA 4YWGG 3P4RB 3AU7A 1GUNA 2EDGA 4WIPA 2I07B 5EE9A 3DM1A 3P1MA 4A9AA 1PTOB 4C3HG 2KA7A 1ZDVA 3JAME 2GB1A 1C4AA 2RQXA 2JYOA 3HGBA 2AWOA 3BWUD 4R3DA 4BWGB 3OIQA 1OXSC 1JE4A 1SSOA 4IUUA 3RZDB 1STGA 1S4ZA 5HGTA 3EJIA 4ZUIA 2EE1A 5T1GA 2ZXRA 3BK2A 5HFYA 4TQUS 3PO2B 3GQBA 3K59A 1VF7A