1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
3DWPA 4RGOS 5FKAC 2RDHA 1S5DD 3URYA 1PTOD 2IJ0A 1YN4A 1AN8A 1FNUA 1BCPC 3W2DA 1V1PB 1EEFD 1I4PA 4L6TB 1UNSA 5I4DA 1F77A 1YN3A 1T5XD 1G8ZD 1JR0D 1LT4D 1PZID 3KLSX 1BCPF 4NZLB 3BVZA 5ELEA 1STEA 1PRTD 1LO5D 1SXTA 1S5FD 1LTID 2XRQD 4K6LA 5TSSA 3SEBA 3MC0B 1UUPA 1SE3A 1JWSD 4RHSA 1BCPB 4RHRA 2XNAC 1V1PA 1ESFA 1AW7A 4OHJA 4L63B 1ET9A 1I4HA 4UDUC 2O2LD 3BYYB 1D6EC 1I4GA 1SJHD 1MD2D 1CHQD 1L0XB 1PZKD 2J4XA 4BWGB 1EU3A 1B1ZA 1KLGD 1KLUD 1M4VA 3O13A 3R2TA 1RD9D 3V05A 1EEID 1L0YB 2IPKD 1PTOC 1LTAD 3EFXD 1PTOF 5ELCA 4Z9CB 1D5XC 1CHPD 4RGMA 1PRTC 4RH6A 4DXFA 1JCKB 1SE4A 1JWMD 3GP7A 1LT5D 1D5ZC 1PRTF 2CHBD 2AQ2B 2ICIA 1I4RA 1PTOB 2WV6D 5D3DA 4ZYSA 4O1NA 1BXTA 1HA5A 1TS2A 3BZDB 5ELDA 3R2IA 1FD7D 1GOZA 5ELFA 4RFBA 1TS5A 1QILA 1LTBD 1V1OA 1PRTB 1DJRD 1LTSD 5FK9C 3MFGA 1FNVA 1LTGD 1SJED 4RGNA 4DXGA 1SEBD 1S5CD 4C56C 1S5ED 1HXYD 2QILA 1BCPD 5D3IB 1XTCD 1CK1A 1LT3D 1ET6A 1CQVA 4RGTA 2NTSA 1TY0A 1B44D 2NTTA 3EA6A 3TSSA 1LTRD 1DYQA 1HQRD 1PZJD 1TS3A 1KTKA 3BVMA 1S5BD 3DWAA 3BYTB 1EWCA 1CT1D 1RCVD 2AQ3B 1HTLD 1YN5A 1EU4A 1RDPD 3CHBD 3DWQA 1ENFA 1PYWD 1FGBD 1SBBB 2TSSA 2SEBD 2G9HD 1FNWA 2XN9C 1LT6D 3BVGA 2QEJC 1LTTD 1I4XA 1LLRD 5ELBA 3R8BA 1I4QA 1TY2A 1D5MC 1RF2D 1EFID 2XRSD 1TS4A 2R61A 4RCOA 1JWUD 4TSSA 1PTOH 1SE2A 2RDGA 3OWEB 2AQ1B 1XXGA 2Z8LA 1JQYD
chains in the Genus database with same CATH superfamily
2ZVOA 2ZJDA 1JOOA 1PTOD 1MFWA 1Q5WB 4ZRPA 4MDKE 5C44H 2EZVA 2YYZA 1V1PB 4JI4Q 2R93G 1J19A 1R4QB 4C2MB 2HT1A 5J22A 3AMUA 2JQRB 4EFOA 2B3GA 4K14A 1DOYA 1BCPF 2JX5A 4C3JH 2RDBC 2KQ4X 1PRTD 4DDGD 2JA7H 2E2DC 3W1YA 4TV3A 2LJIA 2VB2X 4KIKA 5D2MB 1HTQA 2PNRC 4HSPA 1F9PA 3EQLC 2I46A 1Y8OB 1SE3A 3JC66 1UE5A 2LMCA 1JWSD 2M9VA 3C46A 3NP8A 3RMHA 4EVOA 4FVMA 4X65L 5HGTA 5FO9B 5JJZA 1E8YA 1SROA 5IP4D 4OHJA 2XBBC 1EF5A 3RYTA 4F7ZA 5IT9c 1J7AA 4A3IB 1I4GA 4S0RA 2J4XA 1MD2D 1FPYA 2VQFL 1CKOA 5JEAH 1KLUD 1M4VA 3V3XA 4DK1A 3ZNZB 3ZVVA 4EKUA 1RD9D 5EE9A 1EYDA 2JSOA 5JEAJ 1YQ3B 4DXAB 2WLBA 3TN2A 1EEID 1ILPA 3BZKA 5G5GA 1E1TA 3OMGA 2PVGC 1IYFA 3CMAA 1SAPA 1E90A 2J7QB 1PTOF 4FXKC 3AV8A 3KUCB 4LF7L 4KGRA 1VD2A 1ZW7A 3S2DH 2FJ2A 2A6HD 1K8OA 2A19A 2EYLA 2LS01 2RQXA 2KZRA 1K50A 4D2KA 3I4MB 3T13A 2JT4B 1QZHA 4HVBA 1PRTF 3L0WB 4N6EB 2ZTDA 4BKSA 2RHSB 2KVMA 3S17H 4C00A 2JXMB 2E75C 3GD7A 5EKIA 5FOBB 1P9DU 3N20C 4ANWA 1MJDA 5T1GA 3SD5A 2DJGC 3QAQA 3NQTA 1BOSA 2EXDA 2M0AA 1ONLA 4F7XA 4G4KA 1RFAA 3P4QB 1EWIA 4MIUA 3RZOB 2AUKA 3MFGA 1G91A 3S1RB 5TR5A 3J80L 2O2VA 5IGEA 4YWKA 3S1MB 3T3OA 4UHVA 3BJUA 2J53A 5KYLA 1NCVA 2LUEA 4IM0A 2DJFC 2K05A 3SFDB 3SR6A 4DV7Q 4G7HC 1J7CA 4X3TA 5I6YA 3VYRA 4B08A 1WXMA 4QGUA 3GTPB 3TIXA 4A3FH 2Q8TA 4ZRIA 4IW0A 3RMKC 4CHKA 2R92G 2GOWA 4PZ7A 3U2SC 5D94A 5A35A 4FF2A 1HPCA 1NI3A 2V1CC 4XDXA 1TS3A 3K0XA 5M5XH 3J81c 3VDYA 2WDVB 1ML0D 2LASA 2Z9HA 3ZW3A 3P4RB 3IAM1 1YNND 1TBEA 5IYCG 1ZUD2 5E7NA 2KANA 1B7YB 1PLFA 3AU7A 2KN5A 1VQOA 1HE8A 3FP9A 1A0IA 1DOKA 4LNQA 4WJQA 4F8CB 4YY3Q 2ZCBA 4NW2A 4K7WA 4GXBA 4DNRB 2CFMA 1G6PA 1PH1A 1EFID 4OELB 5EJWA 4W9IA 1S3SG 3HK0A 4RCOA 2PKOA 3MXPA 5C4ZA 4HCPB 4EEWA 2FHTA 2DYOA 2UU7A 1Z9FA 1U4LA 2JN4A 3UF8A 3DPDA 4K5WA 2J0MA 3KDFA 1KFYB 4US8A 2MQJA 1PFDA 1GHKA 1QQRA 2PQEA 1FJGL 1PH4A 4NZLB 2GVAA 5AZHA 2HQLA 1XJVA 4X62L 2LXAA 1K83B 1KABA 1E7ZA 3GTGB 2QKIC 4KY6A 3W1GA 5CHFA 1UWMA 1JRPA 2JUOA 2MBQA 2G9DA 1CM9A 1E8XA 3PRMB 2Z1CA 2R2OA 2YTYA 1UD7A 2K3UA 2QDFA 5IOIA 2Z0DB 4FJZA 1E0BA 4ULLA 4TQUS 3KH0A 3N30A 4IOIE 3V96A 2WS3B 1Z6HA 2N1VA 2F0UA 1XPRA 2Y5BB 4RAUC 3UINB 3B6YA 3OTOQ 1CHQD 3EN2A 5EPJA 3MEHA 5L37A 1EU3A 1SYBA 3N52A 3UDIA 3R2TA 3ZIMA 2RF4A 5DPTA 4L5RC 1MHHE 3H7PB 2IX0A 4QB4A 1N33Q 1GUTA 1HNZL 4A3GG 1EQRA 3OYYA 3FKIB 5LNK1 4DV1Q 3EUB2 3AE1B 1UGJA 1Z5SB 2WXQA 5AJ3L 2F3IA 4CDDC 3WAPA 3VTUA 4KHPQ 2HQEA 3N32A 1RAXA 1IYJB 1EIHA 3JSVB 2WV6D 3NS8A 1Q8KA 1IW7C 3PCOB 1AARA 3VUYA 3TEWA 2FCSA 4JI6L 1WGGA 4K7UA 4KGSA 2KQ3A 5IAAC 3H7SA 3NZ3A 2HD3A 3G71A 1EY8A 3LWUA 1ZXIA 4XIGS 1MHWC 2K39A 3EECA 2PZWA 2M4NA 4A3EG 3Q24A 4X3KA 1TWGH 4UAIA 1SMYD 1MJEA 2OTJA 3I4MH 1EL0A 2KTRB 3VR8B 4DR6L 1E0ZA 5T1IA 4DV0Q 1C7YA 4Q5VA 2K7VA 1PH6A 3C3LA 4G50A 1I35A 4HXDA 2MPMA 3T1YL 2KHJA 1CQVA 3HKZB 1JMLA 1K9MC 4DR7L 1FRRA 5IP9G 4B3SL 4FBJB 1PZJD 5A2QL 1FM0D 2A5UA 4NAMA 3WAOA 3BZCA 2IY0B 1C76A 1WJ6A 1LXDA 1E2VA 2EKEC 3RZOH 2NBVB 2KHSA 3CHBD 3HOVG 4C3HG 2CW0D 3H09A 2B3AA 2KKCA 1FGBD 3AE2B 3Q3MC 2HCIA 3A4RA 4FXDA 1B3AA 2XN9C 3D6CA 2M19A 4DHZB 2F0TA 4IG7B 5D14A 3CMMB 2IGDA 4URKA 1VZ8A 4X3UA 4ILWA 1GUOA 2DNFA 2R92B 5AUKA 5DCNA 1TWFB 3E9SA 4TKNA 2KNBA 1SE2A 2R7ZG 2Z8LA 2RPQA 4MM3A 1JQYD 2C7HA 1RKNA 4LWCA 4ARIA 2J42A 4X62Q 4BFRA 5KRUA 2FINB 3IKJA 5COYA 3S1QB 1ZDXA 4GOPA 3ZNHB 4JI7L 5JHAA 2XIWA 1WVLA 4M0WB 2D5GA 3K5NA 3Q69A 2EE1A 2YTVA 3UDXA 1EIFA 1RTNA 2Q8RE 1XMOL 5TSSA 3TRZA 3SK5A 3LXFA 3H6MA 1AE2A 5CGKA 3DEOA 4GNXC 4KZ0A 3RULA 1BCPB 2Y3AA 2IHEA 1YHQA 2MRPA 2BF8B 4PS3A 1JJCB 4HIKA 3ZJVA 3VR2A 3M3YH 3A5ZB 1EY0A 2A73B 1R4MB 1KDBA 5EQ0A 4R4OA 4CBVA 5EBDA 3KW5B 3ZKJC 3DM1A 1KDAA 2L83A 3N3KB 4ZHOA 3K80C 4WAFA 3CWIA 1FCLA 2F0JA 4JIOU 4BWGB 3A1QA 1HNZQ 1B1ZA 1RHPA 2PMVA 4HRSA 1V6EA 4JL9A 4QUFA 4LNOA 4FP5D 1J8CA 1K28A 4RNAA 2HDLA 4HMJA 4JPBW 5BR8L 3JAMc 2KFJA 2A8VA 3MHZA 2ID0A 4B3TQ 4ZQ3A 2ZJRA 1E9MA 2ZW1A 3ZXVA 1FXTB 1EY6A 4IFDG 4II2B 5BYQA 2R93H 3VQIA 3EHVA 3ZUNA 3KLSA 1GUGA 1SE4A 3F2CA 1LYLA 1VQ6A 4PS7A 3J80i 5HKHA 1PTOB 1FMAD 1J6QA 5D3DA 1WGDA 4FHKA 1O7LA 4F1SA 2F0IA 3MVVA 3HOUG 3HRZC 4LDTD 4W9CA 1SE9A 3E56A 4DV4L 3AE4B 2AWTA 1PRTB 2WXLA 1DJRD 3KYDD 5LMUQ 4LAAA 4WQMA 4LF5Q 3U8ZA 2Z6BA 4RM9A 4WQOB 1ACCA 1SJED 4M8AA 2AHOB 1HTPA 1XEEA 4PYUA 1OXUA 4L5TA 3STBC 4DR4L 1L7YA 2KVZA 4ALPA 3D32A 2BVCA 2PQAB 1Q46A 1UEBA 2ZVNA 3BDLA 4O2DA 4AQYQ 4FF4A 2NVQB 1XTCD 5EPKA 4BBSB 3J7ZC 2L0FA 2VXWA 1IBLQ 3KJOA 4ACFA 3QCAA 5FR6A 3ZJTA 4E74A 1AZPA 2L4NA 2R2QA 3S24A 3D4DA 1TZ1A 4B3ML 3A74A 2MBBB 3PV0A 1L5PA 2UUCL 4BBNC 3Q8DA 1MI2A 4GU2A 4EZKA 1WYDA 2KJXA 2K75A 4QIWB 4GN3B 4FADA 1BO0A 2E76C 2FCNA 2KX3A 3FDTA 2GI9A 2MH7A 2NBWB 3IAS1 2JQOA 3MXNA 1EQTA 1E7VA 2CWPA 2YLMA 4US9A 2UXCL 3W1BA 2HHHL 3KBXA 3RLNA 3K5OA 4BY1B 1X3QA 4C7ZA 3AULA 1D2BA 1N6ZA 2KT7A 2F0WA 2JY6A 1RF2D 1C8CA 2UU9Q 1ZYRD 2WXKA 4MSMB 2UUBL 4RM8A 5DPSA 2INPE 1OXTA 1XO3A 1TIID 3M4QA 4OZBA 3HOYB 4JI7Q 2X8XX 3ZTCA 3EROA 2EYHA 4IOCA 2K52A 3URYA 5D6JB 2KCNA 4OEMB 3WOEA 1B2TA 1XMOQ 1EYCA 5CTRC 3I4LA 1VS0A 5BYSA 1ILQA 3GTOH 1R4MI 3J9CA 1Q1BA 4A3CG 3CP0A 2PE9A 2KEEA 4O42A 1SSOA 3K5MA 2R92H 3NG0A 3TDQA 1TWFH 3S1NB 1GJZA 2OXPA 5JPNC 1JALA 1X3FA 5CV4A 2ON8A 1DZ1A 1L2FA 2MP2A 3A5UA 3Q22A 1V9JA 1WXAA 1WTVA 2RSNA 2CJOA 3E9IA 3S16B 1XCTL 4TQ0A 1UE6A 1YNTE 4A93B 1AW7A 3K9PB 3AB5A 4ZDVA 1GC7A 5IYCH 2IO1B 2Y0SG 1WYWB 2JP1A 3HS0C 4OIJA 3NENA 3SR1A 2PZUA 3GQBA 2PTLA 5BMIA 1KLVA 3AE6B 3W5OA 2RCNA 3SXHA 3P75A 2GB1A 3HOWG 2N0SB 4W9LA 2WX1A 3KF8B 3QWNA 1IKMA 1QCBD 1NR2A 3GTKB 2QSDA 2PEAA 1S1QB 3FPPA 3KOJA 2F0EA 3U4VA 3VR9B 3ML8A 2GBNA 5JPMC 4B9KA 2ICEC 3SDZA 1U9RA 1JORA 4GKKQ 1P98A 1U4AA 1SB3C 2IX1A 4FDBA 2K5WA 4ID6A 4DR5Q 4KN4C 2L76A 1OO9B 2WXOA 3TMPB 4A3MG 1WJNA 4LF6L 2IT1A 2VH2A 4O1NA 3NVWA 1XX8A 4IALA 1EQQA 1GOZA 2BW2A 1I50H 1I6HB 3M63B 4WWNA 1FGUA 1X56A 2MFIA 3PO3G 1WYGA 2KO3A 2LEKA 2K5HA 3HVZA 4KKUA 1S5ED 1Y56A 2WAQG 1HXYD 2PI2A 4Y52H 1OFFA 2VY3A 4X66Q 2UXBL 3TP7A 4ARCA 1D4BA 4ASWC 3PGEA 3H9DA 4OZCA 1ET6A 2Q8IB 1O7IA 2UUCQ 4AIMA 2DY8A 3HOUB 1ISNA 2LFIA 4OW0A 2A69D 3Q6BA 1RJTA 4RA8A 2GA4B 4DF7A 1HZ9A 2CCZA 1FFVA 3J80E 5M3FG 2L32A 1VLBA 1NI2A 4PZ8A 3X3NA 1RCVD 3L0OA 4A3GH 3RNEC 1DGSA 2KEDA 4DR3Q 1VDVA 1EU4A 4AYBE 1RDPD 1VQLA 1FL0A 1L1OB 1PFBA 2HHHQ 1BBWA 3V6EB 1Q7YC 2BYEA 2F0FA 3DHHC 4L8JA 4PK1A 3IBEA 1A6XA 4C3IB 2ZJPA 4H44C 3OOCA 3M4OB 2L8JA 3RT3B 4EE2A 1BUVT 1D5MC 1C4QA 3V6CB 5FLXL 1P0RA 4HCEA 5KNBA 3SHQA 2WGSA 3FILA 5BMHA 2K50A 2RDHA 5FKAC 2G3QB 2IJ0A 3ZGZA 3GDEA 1FNUA 4A3EH 2C5CA 3ENEA 1PH9A 3NHHA 3VTVA 4KKJA 4U673 3J7A5 1V97A 1Z2MA 1M1KC 4GB9A 1GVPA 3BWUD 2SAKA 2KCCA 1VQFA 4KLKA 3T16A 1VF5C 1ZGUB 1ZOYB 2N8NA 4HPMB 3F1ZA 3APCA 1WRIA 1C9FA 2R7DA 3MC0B 2E8GA 3PO2B 3IXSA 2A6EC 5IP9H 1SYFA 2C7NB 2Z59B 4LNIA 1VQHA 5KYIA 1FD6A 4A75A 4PQXA 2WINB 1V1PA 1WXQA 3GO5A 2UUAL 3U52E 2PIAA 4E3CA 1GB1A 3HOVH 4C3HH 4LF8L 2C7MB 4J8QA 1EY4A 4KMUC 4R1JA 3S2HB 5G3LD 4JV5Q 2JSVX 2C35B 1QF6A 3S14B 4KY7A 3G7LA 1E7UA 1KD1C 4A3IG 1OGWA 4XWTA 1FFUA 1KAWA 3ND8A 1FXAA 2N55A 4ZCKA 1EF1A 1J9OA 2Z4IA 3CCLA 2R7ZH 4JI4L 5AFWA 2PMZB 3OHXC 1BKBA 1F2YA 1EM7A 3UI2A 5IGFA 1Z7TA 1R4NB 2M56B 3C19A 4KHVA 2RVLA 2KVRA 1PHJA 4FF1A 1S72A 4N9TA 4XDCA 2NN6I 4YHHQ 5IY0A 2MHJA 1SNPA 4JVZA 1MBYA 2Q2HA 5CV5A 4LNFA 4P74A 5JVG3 2LVOA 2N49A 4IFDI 4ME3A 2CHBD 2KDMA 1S4ZA 3B1LX 3DHGC 5IKCM 1D3ZA 4KHZA 3RNBC 4AJYB 4WURA 3UQBA 1HZAA 1YNJD 2E74C 1E1OA 4A90A 2BOSA 3NZSA 3U9OA 1JJGA 1O78A 1M8AA 4CDEC 1NJIC 2IO3B 3ZDMC 3T1HQ 2E2HH 4B9XA 4W9JA 3RFZB 4M00A 1VCIA 1S5CD 2L1BA 5FLMG 3VH3B 5G3LF 5I9OA 3GTQH 4WJ3M 2L3ZA 1PVOA 2ZNVB 2K5DA 2L0TA 3GTLB 2WXFA 3CMEA 3H3VI 2IBIB 1WSPA 1HJPA 3F2DA 2XK5B 4ABNA 2W54A 4HPLB 3QJZA 3ULPA 1TY0A 1MPEA 2DENB 4GOPC 5FJ8G 2FNJB 3CD6A 3W1SA 2F0OA 2E2IB 1KTKA 1WTOA 4AH6A 3K59A 4GN4B 1CT1D 1C78A 1CSQA 2WACA 3I72A 3MXUA 3QK0A 1KH0A 2RSOA 4IFDH 2F4VQ 1HZBA 2B2VC 4IFDJ 2MLBA 3J81j 1WR6E 1V80A 2KFKA 3KBGA 2WAQB 3PUZA 3A9KB 1Q8IA 2L55A 3I73A 2BYVE 2L11A 5ELOA 3HOUH 1WR1A 2H5XA 2V3PA 5H8YE 2LZ6A 5HHDG 1SSNA 1XXGA 4DUZL 5EKKA 4K6LA 2WQYB 4MHEA 1UGMA 4DV7L 3E9HA 4A3JB 3DMUA 1AN8A 3W2DA 3J81E 3F2BA 3EBEA 2WNMA 3QC8B 3P1MA 1PZID 2L5TA 2QA4A 3TP8A 2RMMA 1HEZE 2EKIA 3VYSA 2UUAQ 2HUGA 2MX2A 3PGZA 1B70B 1P7FA 2F4IA 4E71A 2JVCA 2KDIA 4YY3L 1JICA 1KJTA 1BDOA 1QVFA 2AWNA 1F9JA 1A8VA 2YU9B 1R4NI 3UDFA 3MTNB 3TEYA 3PZ8A 4IDIA 4LW1A 1ET9A 3A55A 3VAWA 1Z47A 4KTAA 2AWOA 1A63A 1AFPA 3N6RA 3A56A 3U4ZA 4NXNQ 2K28A 1TGZB 4XT1B 4JOIA 4GZYC 2RA4A 2JU6X 3VUWA 4YSYB 3K58A 3DBHB 4OZAA 3A7AB 1E5WA 4R3DA 1Y1VB 2K1FA 2XGTA 1LTAD 1PXUA 1GJXA 1CA5A 3TEZA 1VMCA 1VMPA 4MTNA 2WYQA 1FO4A 3IAYA 1K51A 3G4SA 2RGFA 1CHPD 1KRSA 1XPOA 2Q5WD 1K73C 5KHQA 1F0ZA 3S2HH 3FKIG 3RCZA 4GLSC 3A8IE 2ZTCA 5JOBA 3UDGA 4JWSC 4A3CH 4YWLA 3DWMA 4HROA 2DBYA 5J2RA 2MHVA 3A8JE 3H91A 3G6JB 4LJOB 4TMAB 4GDLB 4YWMA 3FVQA 4HIDA 1YJJA 3N1ZC 1HNWQ 2IL8A 2LSSA 2NZOA 3KWLA 1GHJA 1PH5A 3KYCD 3M62B 2K6DB 4KK7A 3NWSA 4IQZA 3OTOL 4KKTA 4RGNA 4DXGA 1GUSA 3L13A 4ZRQA 1TIFA 3JSVA 4IURA 3OG5A 3R93A 4DFAA 3HHMA 2F0NA 2LI5A 3B0AA 1Y14B 4KSLC 4KX6B 1N33L 3TS2A 1RODA 4HJAA 2AEHA 1JB3A 1IKLA 3HOWH 4BAXA 5F2DA 4DQOC 3C1EA 4GGQA 1Q90A 2R3ZA 1MJCA 1QJOA 2VQEQ 5GAGC 4DV1L 1C4PA 1DYQA 3DXJC 3Q3OC 4NQKE 3G48A 3HKZG 4HCSA 2BQQA 3BYTB 1EWCA 4GLAC 1EFWA 4OO1I 1F1HA 4S3SA 4KHPL 1YX5B 3J7AF 1NBFC 1H8CA 1TJEA 2KTRA 1EYGA 1RTOA 1WF9A 4IUMB 4TRDA 2KDEB 3EVQA 1C3TA 2NBUA 4XGAB 1F9RA 2E3TA 4J15A 4A3MH 2JYOA 3KLWA 4DUZQ 1CZPA 1ROEA 2E5LL 2MCNB 1HZ6A 4FN2A 2H4OA 1WH3A 5EAYA 1GUNA 1SNCA 1SYGA 4RWSC 4Y7NB 1V8CA 1N61A 4W9GA 5C4HA 1JMCA 3VYUA 2H88B 2E2IH 1M94A 1OEYJ 3D6WA 2XWJB 4APVA 2OEDA 4MGIE 3CCVA 4DV0L 2K03A 3SVMA 3PO3H 2ZW0A 5C0XG 1N32Q 3D4WA 3V2TA 4N8X1 2JK8A 3L2PA 4A3LG 5M5WB 1QOFA 2YTXA 3QOLA 4ICVA 1YD8U 2NVTB 1G6ZA 1VR9A 1GXDC 2INNE 1XQQA 2KTFA 1X32A 4RG1A 1HH2P 4A76A 2HTME 4RMAA 2NPTB 3HGBA 1YJ9A 1JWAD 1CJEA 4X3SA 3DBHI 3J7AV 4XE0A 4P71A 5M3FH 2I1JA 1BNZA 5CHWA 3AEEB 4YCVA 3M95A 3OPOA 4P72A 3RNUA 4GKJL 1I5FA 2NBFA 4M0WA 4L2YA 1HCZA 1WMHB 3TJPA 1P8LA 1JRUA 4W9EA 4CO7A 2EYJA 4I6LB 1TU2B 1D6EC 3ZTDA 3RR5A 4ODGA 3KK7A 3NVZA 5MPOA 1L0XB 4NMZA 4PZ6A 4LF4Q 1WD0A 2JA5B 4G7OC 2B76B 2LVQA 5D7GA 1L0YB 1PFMA 2PYKA 4PNYA 2JXXA 3FKYA 5C2TB 3UIPB 4HDOA 2EY5A 1N36L 2WP9B 4K81A 2PZTA 3L08A 1SYCA 1BT0A 4J1MA 2BB5A 4IO9A 1JOKA 4FF3A 4QJFA 1V5OA 1X3GA 1H9KA 1HUMA 3HFZB 4IPDA 1YX6B 2KD0A 3OSOA 2F0GA 4X57B 2QDBA 5IYBG 1UWVA 2MBHA 4JI8Q 4EX5A 4QF4A 3SK8A 3HM6X 1EUJA 4ZYSA 1VZ7A 4C2MH 4Q2JA 1BBUA 2ONQA 3UQAA 1BXTA 3ERQA 1VQBA 2KQSA 3EC8A 3ZNGC 4I65A 4IJLA 4MACA 1NE3A 5L83A 1WE6A 1IL2A 3Q8BA 2ASQA 4RFBA 4UPAA 4IKGA 4ZKCB 5BO4B 2D3GA 1Q81C 3M3JA 2EYOA 2LVPA 5FK9C 4JGHB 4EQOA 3TCAA 2L1AA 3UE0A 4UP9A 5IT9L 2LRUA 3JAME 3VH4B 2FCMA 4C4VB 5FR3A 3Q3NC 4XC2A 4B9WA 4FA6A 1A62A 2CHXA 1HFGA 2IY5B 1I94Q 4BY7G 2KDFB 2G4DB 4JBMA 4A3IH 3NEMA 1ASYA 5H92C 4LUVA 2LMCB 2ZM6Q 4B3TL 1PFNA 1EIGA 2V9HA 2O6VD 4ITKA 1HQRD 3WIMA 2TMPA 4BBSG 3DWAA 2PPHA 4QAYA 3I90A 3CCMA 1A2TA 1JW9D 5C6AA 3RN5A 2JEAI 1A3TA 5IE8A 1QZGA 5HFYA 3I3CA 1KOTA 3DWQA 4ANUA 5IA7A 5E6NA 5JHBA 1NYRA 1OTRB 3NUHB 2PQAA 2E5LQ 3CSTA 2VH1A 2SEBD 3E5SA 3H1UA 1P7EA 4CGYB 1VQNA 3VR5A 4YXDB 1Q1EA 2Y5PA 4P75A 1ICWA 4DHZE 4JQWC 1WM3A 1L6UA 2Y5CA 1I4QA 2LUMA 2LJ5A 4DK0A 2WXRA 3A4SC 5LMUL 1EY7A 4LF5L 3K0YA 1TT5B 1TKYA 2D2QA 4BY1G 3ZXRA 1IL8A 2C9WB 1B3QA 3H94A 1SIJA 2EMSA 2EVBA 2I07B 4Q0FA 2C9OA 1P3QU 3V60A 1PMRA 3VTWA 4RGOS 2UXDL 1DGJA 1EYAA 4EZJA 4H7BA 4AQYL 3HOYG 3I3TB 1EEFD 1YN3A 4OONA 5FLMH 3A0JA 1IBLL 2MW5A 4A20A 3S1RH 4R4QA 2QIEB 3QA8A 5FLXE 5IOCA 3S1MH 1SXTA 1AEXA 1TWCB 1WTQA 4MJSB 3U30A 3O65B 4W9HA 1QUQB 2DNEA 4H2AA 1WIAA 3DWGC 5LMNQ 1LQBA 5G55A 3GTPH 1NMGA 4GKJQ 2NR2A 5FJ8H 3J81L 3ICEA 2VRRB 2A1AA 3I57A 4XYCA 2OQ0A 4YTPB 4LJZC 1HR0Q 2FCQA 2WU2B 4CQNA 2KJHB 3L16A 4KJNA 4L63B 3CQZB 2KJ6A 1ZPSA 4WJPA 4A93G 3P20A 5M3MB 2B63B 3TBLD 2UU9L 2EYMA 2W55A 4EGVA 5EGTA 1A70A 5E6PA 1N36Q 4XX5A 4LTUA 5KNDA 3Q3FA 5LXIB 3H0GB 1YHAA 3U4EG 4PV1C 2M2LA 3W3AA 3L10B 4YWGG 2L15A 2ATWA 4JI2L 4HWIB 1NUCA 3DBLB 5I2YA 2B2VA 4GS3A 2AUJD 2KENA 3HOXB 2A4ZA 2Z0EB 2J0JA 4WIPA 2G45B 4RH6A 2NVXB 4II3B 4DV5L 3BY4B 3W1SC 4UP8A 4KDIC 3MA2B 1D5ZC 3F2UA 1EZ6A 4LLGM 1IBMQ 4N9PA 1XT9B 2CKZB 2XWBB 1QOAA 3GTJB 1B9RA 4WWPA 4NNJB 2VB3X 4DBGA 2BS2B 2ZPYA 5ELFA 1K83H 1V1OA 1LTBD 2KUMA 1UELA 3HOZB 4HK2A 4WJOA 2KX0A 1C48A 4JWUC 3GTGH 2AL3A 2WDRB 2QDLA 4NPNA 3HP3A 1FNVA 4DAYB 4RCNA 2B2WA 2BH2A 2NN6G 1CKNA 1H95A 1WX7A 3T56B 1GC6A 2NVYB 2SDFA 1GD7A 4ZKBB 4LFAQ 3QB3A 1OQYA 1I42A 3F8TA 2WDQB 3EFCA 4OIKA 2KCTA 1HNXQ 3BINA 4WORA 2XVSA 2D3CA 2OTLA 4HPPA 4GKKL 2BWFA 1K8GA 2EY2A 5DLQE 1XYIA 2XEWA 2BE5C 5AEKB 4DR5L 2J52A 4OX9Q 1YN5A 3KUZA 1WY8A 3NPPA 1PGXA 3GZNB 4LUOA 1TKWB 2D3AA 1JE4A 3WALA 3R3MA 4KKSA 4DUYQ 1K8MA 1XMQQ 2K01A 3FKIH 5C4XG 1GM5A 3BVGA 4K3BA 2BGFA 4P1CC 4DV6Q 1EOVA 1I4XA 1WE7A 3P4SB 1C0AA 1TY2A 4HJKA 2UXDQ 2KC1A 2N78A 4BY7B 2XRSD 2B39A 4PMWA 4W9DA 2REXA 1QB5D 3TP6A 1UE1A 4C3IG 1WD1A 2QMTA 2RSUA 3I9V1 1D7QA 2MEKA 3PZDA 2WU5B 2RBMA 1WTHA 1L1OA 2D3BA 5BN3A 3AEFB 1TWAB 3HKSA 4JOIC 5HY6A 1MGSA 1NYQA 2DX5B 4L5QA 4X66L 4IWPA 3CCJA 4KVGB 4K7SA 5CORA 1B53A 1WTWA 4QQBX 1GUWA 3ALBA 1JR0D 1F9SA 1TWHB 3ECIA 1IXRA 3MFYA 1R9TB 1WCMB 5ELEA 3SE0A 4DK3C 5C0XI 3VDZA 1WJJA 3I5JC 2WXMA 3B2FA 3N9YC 3KF6B 4I7AA 2ZT9C 1B9MA 4DR3L 1UUPA 3E6ZX 4M1UB 1VQPA 4XWWA 1IW7D 3A54A 3U9SA 4L23A 2F0LA 4K3CA 4WWOA 2GVBA 1STNA 2XTIA 3R3OA 3PO2G 3PRZA 2K0PA 2N1WA 1G2TA 4CKCA 1UAPA 2K32A 4DPGA 4MGZE 3GV6A 4EQ5A 2PJHA 3DBLI 4MZ9A 2F52A 2X6LA 3WCQA 1QOHA 1HA6A 1F2RI 5HI1A 4FXGC 5HGQA 1VQGA 4B3RQ 3A9JB 3BK2A 3K7AB 3I63C 4JI2Q 3V05A 3L54A 1WI0A 2HDMA 3MJWA 4N9F4 2D9UA 3W9CB 1G51A 5CV6A 2OHFA 1P16A 1CUKA 1PUTA 3RPFC 4DV5Q 1VQ9A 1E3PA 3AI5A 4U68A 3PVLA 4DV3Q 2BB6A 3BK1A 3PSIA 4HJ9A 1GG3A 4JBJA 3AE8B 4MH8A 3ER0A 5C0XH 1J5EL 1IPGA 1M90C 1SDFA 1STAA 4XZ4A 4HTHA 4K2KA 5C0XJ 4A3LH 1HZCA 1V86A 3PF5A 4DNTB 2NYZD 4I7ZC 3S1QH 2AQ2B 1KNEA 2ICIA 1FEHA 1GUAB 3BG3A 2KYWA 4A3KB 5M9OA 4MH0E 3DVNU 1QKZA 2W3SA 4YL8A 5IGBA 3BZDB 5KHOA 5C3EB 1AWDA 1LFDA 1BVSA 4JK1C 2JZ3B 5C5MA 4JV5L 4CKBA 2K1BA 1Q12A 4OWTB 2PPBC 4E6IA 3HM3A 4IUTA 5GQOA 3I4NB 1WJ4A 4A3BB 2NVXH 2NB0A 3DHQA 1RRBA 1YZ6A 2OEOA 2WIIB 2OJWA 1BQQT 3GZNI 4OGQC 4UP7A 3AEDB 3QJYA 1STGA 5D3IB 1A3UA 1NY4A 4JI0Q 1GO3E 2K8HA 5IWAQ 5I2XA 3APFA 2KBNA 2KHWB 1LT3D 3Q14C 4BS9A 3GOEA 3EA6A 3TSSA 1K3RA 2LXKA 1OXSC 4MSQB 3Q6SA 1CTMA 2P5ZX 1SNDA 2I5MX 3BVMA 3JAML 4YHHL 3PV1A 4DHJD 2E2JB 2B2UA 2MUYA 1II3A 1CI3M 2UYZB 2OT2A 2CR5A 4M02A 5LLIA 4MT5A 1KAAA 3RN2A 2ZPNA 3VR3A 5IYBH 3Q8CA 4DNIA 2NVYH 2GBRA 2DY7A 2QHOA 2QEJC 2V4IB 3IFWB 4ZLTF 4K0KQ 2RHQB 2X6GA 1NTGA 4ZHPA 1TZOA 2I1KA 2K9XA 3HUIA 4KD4A 3L17A 3MJ5A 5JZEB 1OEYA 1IYVA 2K8BA 4J3OD 3T1HL 5DNFA 2FIFA 4JI3Q 1PTOH 5L95C 4TVAB 1JWBD 2EQSA 4BKTA 4WRDA 1FR3A 3AE3B 4HJGE 1YJIA 4KV6A 1E10A 2K04A 1F2MA 2NUCA 4DGZA 4JI1L 3AECB 4OO1G 1Q3LA 4DAPA 3VHTC 5C3WA 3J81i 3H6NA 1BCPC 2EJMA 3A9KA 2VZAA 4WJNA 2WX0A 4R8IA 4A3JG 2IGHA 2IYDB 4KKIA 5C4XB 4NXML 2KDBA 4IPGA 1LTID 3RUZA 3JYUA 4BY7H 1K0SA 2CU1A 1EY9A 2NVQH 2D0PA 1SN8A 4IUNA 1CA6A 3DLLA 3CCUA 4BBSH 2F4VL 3QQ8B 1VQ8A 4DV2Q 1U0LA 1FVIA 2N3SA 2BKFA 4R4IA 2JWZA 5BMGA 3S15B 1KDCA 3TS0A 3A7LA 1CSPA 4HMIA 1XLPA 2BA1A 2O6VB 3ZNID 1V81A 3BYYB 2BA0A 2A68C 2KA7A 4IN3A 4AYBB 1PA6A 4HSVA 1RIPA 4LNKA 1TKEA 3A8KE 2ES2A 1TT2A 1K0RA 1VQAA 3M7NA 4P7IA 1YJ1A 3T4AC 4PG3A 4V190 1YBYA 2MWSB 2JRIB 5AZFA 4MGYE 2VL6A 2JA6B 3ONAB 2BKRB 5T8IA 1PTOC 1YNXA 4BY1H 1STBA 1MIUA 2SNMA 3EIVA 1MG8A 2HJ1A 2X69A 1J5EQ 2KMCA 4ICUA 4B0MA 4B95A 4LJPB 1VQIA 1Y1VG 1I3QB 3ZRCA 3PS6A 2QJLA 4BBRB 1PRTC 3ITPA 3HOYH 2VZKD 3DHIC 4K2LA 1N63A 3LDZE 3NE5B 2EJFC 2WKDA 2WB1E 4NDXA 2LXCA 1YOVB 1IP9A 2WXJA 1LT5D 3WWVA 4A4IA 4FYDA 3ZJUA 1I7HA 2RPVA 3E3XA 1UH6A 4XDDA 3HRDD 3RD2A 5CR3A 4M01A 1IZ6A 1SYEA 3R2IA 4G57A 4LUZA 3DQVA 4NJ6A 2F0QA 2QW7A 5C44B 2N4FA 1TS5A 2OJRA 2PLPA 3AXCA 1SR3A 3S1NH 2QGQA 1XF5L 2ZZPB 4P16A 4NXNL 4C3JB 1LTGD 1K8AC 1IGCA 3S16H 1WX9A 2JA7B 4MGKE 1SEBD 1GAQB 1RYJA 4BKGA 3I7FA 4A93H 2GLSA 2HTHA 3FEWX 3UIOB 4I6NB 3FHWA 3P4PB 1N34L 3OW7A 3MC8A 1VQMA 4GDLA 2Y0SE 4XQJA 5IO9A 3TUOA 2NTSA 1YIJA 1V2YA 4EZLA 4HIOA 1QZEA 5LMNW 1XLQA 3AH7A 2KLGA 2DZKA 2A6HC 1FIQA 3RN9C 2BS4B 2H1EA 5IT9E 3MHSD 3D0FA 1BR9A 1A3VA 1HR0W 3GTKH 5CBAE 4NKLA 3ZJYC 3U7DA 4W9FA 4LCDE 1HFNA 1IUEA 4BKSD 2J7ZA 1TQOA 1XWEA 5FO8B 1W6KA 3NBHB 3WDNA 3S9WA 2VUMG 1JOQA 2WWZA 3PPAA 3KUPA 3R8BA 2D0OA 5IP7G 1VQ7A 2KWDA 1Q10A 2L7RA 2MJ3A 1HNWL 3I2ZA 1YIWA 4JI5Q 2RR9A 2IDYA 2KK8A 5C5LA 4TUUA 4JI1Q 1XLOA 1V1QA 3OAWA 4GDKB 1OTCA 1TXYA 1Y8NB 1KXLA 2K5VA 3S2DB 4X6AH 4IC7B 2DZMA 1XNQQ 1RFKA 3W5VB 3WA0A 4ZOHC 1T6BX 3DWPA 5LHY1 4WFN3 1AZQA 3OMCA 4NXMQ 2CWAA 3HEJA 1YN4A 2KOXA 4IUUA 4FJYA 1I4PA 2PI2E 5C3XA 4FJVB 1I6HH 3S17B 3NVVA 3NTKA 2NN6H 1MVKA 3KLSX 4N8FA 3BVZA 2DHZA 2VQEL 3VVWB 4RF1A 4AP4C 1LO5D 4NAWB 2EIFA 3G6EA 1CZGA 2I5HA 5EBCA 5HURA 3Q0AA 3NOBA 5GMVA 3FMCA 2NMQA 3AN1A 3PIP3 1YNNC 3NUCA 5DPWA 4RHRA 1T0SC 4CJ0B 2WXIA 4W9KA 4S17A 3NXWA 5DEHA 4A3PA 1YQBA 1PGBA 3J80c 4A3FB 5CC4A 1JE5A 1S3OA 5GADC 2AYOB 2I5LX 2DUDA 2PW9A 1EWHA 2C60A 3IRBA 1QWYA 2IW3A 5C4XH 1UWXA 3M9BA 5GAEC 2NPTA 4ME5A 2CVRA 3JW0X 2KOLA 5M5XB 4WJ4A 5JAVA 3TL5A 3H3VH 3NK9A 2QC8A 1PH8A 2B2WC 3EJIA 3AM9A 4C3IH 3NVYA 5JH5C 3RUIB 2M8SA 2FMMA 2FAZA 2JA5G 3M4OH 1N32L 2HD5B 2NS5A 3PRPB 5ELCA 1WMHA 4J6IA 3X3MA 2KLCA 4HKZE 3NRZA 1H9JA 4L5SA 2MSED 2MJEA 2GBKA 3Q3JA 2INCC 2G1EA 5EKLA 1KL9A 1XLNA 1YJWA 3VA5A 2MQHA 1L2NA 1BMLC 2RKSA 2CU3A 1PDXA 4AS1A 4TQ1A 2L12A 3PUYA 3PZ7A 1STHA 2K4KA 4POGA 2QEXA 2MNAA 4LFBQ 3AE9B 3GS2A 2LXJA 4LF9Q 1E8ZA 2VW9A 3GE8C 2VS1A 3VR6A 1MSGA 2C5LC 3AU5A 1NDDA 2JRHA 2Z4HA 3PO2H 1FRDA 2IZVB 2DN8A 4H13C 2QF7A 1RL2A 2EXZA 3VYTA 1N34Q 1JROA 2EELA 5CV7A 3AE7B 4NJCA 5DPRA 4ZK9B 3JAMi 4LF4L 1HTOA 3GV3A 1SIFA 2BWES 2LRWA 3APDA 3R7RA 4G3XB 1L1OC 1BBXC 3KUDB 1CK1A 3H3VC 4BA1I 1ICFB 1RWSA 4TKOB 5C4JB 2L05A 1AH9A 4REZA 1XPUA 3S14H 3Q23A 3Q8AA 3CSFA 1S40A 2N7JA 4ANXA 1S5BD 3H7PA 4K8IA 4JI8L 3X0WA 3CPFA 2A6ED 2Z6KA 4KN7C 4C4VA 1ZXHA 1E22A 3SU8X 1NSNS 4USAA 2GN5A 3CC7A 4AJWA 1VRAB 3K57A 1LLRD 2LHEA 4R8NA 2MBEA 1WGKA 2LGXA 1TVXA 1TS4A 4HJ5A 3QIAA 2WKCA 2K8CA 4GSWA 4DU9A 3AFQA 1SMYC 3D31A 1DM0B 5CV9A 2IX3A 2B2TC 2BDNA 2FFKB 3ND9A 3T9LA 3DDCB 1ZXTA 1R4PB 2JEBI 2V0GA 5I4DA 1I94L 4P1BC 3SDLC 1T5XD 1G8ZD 4C1NK 1LT4D 2JA8G 4HN7A 2ZM6L 2PW7A 4K1RB 1E2WA 5JJLA 1WFQA 4OXPA 3UE1A 2VUMB 1OXVA 1PQSA 2Q2IA 2F0SA 5K36G 2CS4A 3CXCA 4IPCA 4I6PA 5EE1A 4KV2A 3BDOA 4POFA 3GTLH 2GBMA 3OW2A 3T53B 3VRAB 5J39A 5E3FA 3CIRB 5BYRA 1JC7A 1VQ5A 1IBXB 2CW0C 1TWGB 1H9SB 4BXXG 4OVUA 1PH2A 3CCEA 4GN5A 2K5NA 1HRJA 4MELA 2CJNA 1N60A 4JYAQ 5IN7A 2D11A 2MP1A 4K6DA 1I4HA 1FXIA 4LFCL 1EY5A 4MJSA 4DHJB 1QUQA 4GNXB 3RD4A 1SLJA 1EQVA 3C8YA 4DWFA 2DWQA 1KLGD 5M3MG 4GLVB 3AB9A 2B63G 2AX5A 5EE0A 4H0LC 2JZZA 2WXGA 1KF6B 1DCZA 4F8MA 2L0CA 4N59A 1YVCA 4DK6C 2BBCA 3H0GG 3ERSX 4HIMA 2Q2TA 2FUG1 4OO1H 3ZO5B 1ENCA 2KFKB 4LMQD 2K5QA 4DXFA 1PH3A 3I4OA 1YMHE 3GP7A 5LMNL 4A3JH 3HOXG 3QG1A 2B2UC 3B2GA 4PT5A 2OWOA 1JQ4A 2WDTB 1EOTA 2DLBA 3RLFA 1ZP0B 1HR0L 2ZNVC 5E6OA 3FC4A 4CJ2C 3CW2C 1AP0A 4XTCS 3NZUA 3KYHC 1MI0A 2WFWA 2RD0A 3DVGY 1ZKOA 3AFPA 2EDGA 2ACZB 3BIID 3DVNV 2DYMA 3N1YC 4FLHA 2M1MA 1LTSD 2BCOA 4A6QA 1VQEA 5LXHA 1DONA 1ZDVA 3IT4B 4FXCA 4RKLA 2D5DA 1GNUA 2EOTA 2FXQA 4RKBA 3H15A 3HOZG 2LKVA 2E6XA 4N58A 5EE3A 4C80A 4MEMA 2QILA 1NNXA 1HQMC 4EQPA 3R66C 2KHIA 1BUIC 2YU9H 5CX3A 3OWFA 5C1ZA 1Y8PB 3JVZX 2CQOA 1WTXA 1D8LA 2JWUA 3S2AA 1G291 2F0KA 4ZRZA 3M3YB 1E8WA 1WZ0A 2W82A 4WWMA 4B6WA 3M4PA 5E4WC 2AQ3B 4DAYA 4WH4A 5J3BA 2CHWA 5I6WA 1DXMA 1V49A 1Y1VH 5DM63 1VF7A 5LL6X 1JJ2A 1IBML 4IM2A 2V1YA 1PYWD 2N9PC 1TR5A 2TSSA 2PW5A 3P7JA 1A2UA 5G2NA 4X65Q 2G9HD 2LGYA 1X55A 5AUIA 3PIOA 1UBIA 4A8XC 2ENBA 3OIQA 2BT6A 1T9HA 4BA2I 4F87A 3U58A 2NWGA 5IGCA 5C4JH 2VZKB 2KMAA 2EY6A 3VFKA 4IUPA 1E2ZA 4H02A 3TMEA 3OWEB 4KIKB 2VQFQ 4HJ8A 1K8RB 4HR7B 2R93B 3IFDA 3IHPC 3CAMA 4QUCA 1PDQA 4LFAL 2M00A 1V43A 3LYYA 3PLVA 1LGRA 3BU2A 4L6TB 3RZWC 3EGRA 1Y1WG 1HNXL 3LNNA 4LF7Q 4ZUJA 5FO7B 2BYFA 1S5FD 4DN4M 4L1BA 2LY7A 4R4TA 3CCRA 3SEBA 1WCMG 4OX9L 2WP8J 3CPWA 2JXTA 2V4LA 4IWQA 5D65A 4OVVA 5BN4A 4DUYL 1XMQL 3B9JA 5GAHC 1ESFA 2EYFA 4LFCQ 2CKHB 4M8MA 4NJ7A 4DV6L 4HCNB 3AEBB 4HAEA 2K14A 4X64L 3GTMB 2N7DA 3HKZE 1UE7A 1ZYRC 2MO0A 2JA8B 1SJHD 3KF6A 2VUMH 1IGDA 1QOBA 1XCQL 2CQAA 5IP7H 3T8MA 1V9PA 2B8GA 1MSHA 5IYDG 1H9MA 1CFMA 2GRIA 2IPKD 3TP5A 1E6EB 1GPXA 1KRTA 1F2LA 5E4XA 3EFXD 2LGDA 1AE3A 3SGIA 5CBEE 1ASZA 3D3RA 5DAUA 4Y7NH 2BPSA 2GMIC 2UWQA 2ZEQA 4DAMA 3KWVA 4DAVA 1SRUA 3I55A 4IZ8A 1NAPA 3DOWA 1W6JA 2O2VB 1JWMD 5EDSA 5KIXA 3A9JA 3MWYW 3HZXA 1DD2A 1WTPA 4QL5A 3ABVB 3K6OA 1HUNA 4JPSA 5M5WH 1TS2A 1SE8A 3DUZA 4KDLB 3PF4A 1FD7D 4KD3A 1U4RA 2NVTH 2GBJA 4A3KG 3PIPA 2VNUD 3LJ3A 4ZRJA 3QHTA 2F0VA 5GROA 1DOIA 1L4ZB 3KQ4A 5C3EG 2LFNA 3TBIB 3GTOB 1Y69U 4JX1C 3CCSA 1F2ZA 1DOLA 5J17A 4P73A 4B3RL 2IWHA 4C56C 2I2YA 4G7ZC 3K81C 1B8AA 4DA2A 1WXSA 1X1MA 4KJOA 2M17A 4AWJA 3KLRA 3K9OB 1T0YA 2I38A 3I4NG 4A3BG 1KNAA 4JW0A 4XYOA 4KI0A 3W5UB 3V62A 1EUVB 3AQQA 1FJGQ 4C1NI 1J0GA 1E24A 4EQNA 4DV3L 1LTRD 3RNCC 3KF8A 5KEEA 3OIPA 2PE6B 2IGGA 2JA5H 4IM3A 3DBSA 3PREA 1PYSB 3P2BA 4LK1C 1VQDA 1ENFA 2MJ8A 3QX1A 3ZRFA 1LACA 4YTNB 3IG3A 1FNWA 1VQ4A 3NHEB 3KDFB 3NS1A 3V61A 1LTTD 4KSKC 4A3DG 3K5LA 1Q86C 1N8RC 4A55A 4K5XA 2I0QA 2IY1B 5KNCA 1RLFA 3PO0A 3LB8C 2AQ1B 3P1HA 4BOZB 1WFYA 1KIXA 1KQSA 2JZPA 4JE3B 3UI3A 1S5DD 4J6HA 1C9OA 1C4AA 3SFEB 4JI0L 5IWAL 4HEA1 1X3EA 5NUCA 5I9PA 2K6AA 3DCGA 1NBWA 4F88A 1V5TA 1ZE3D 4JLCA 3VXWA 1WJUA 1STEA 3KJPA 2BH8A 3PUXA 1FCCC 2A69C 1QVCA 1GB4A 5AJ3Q 5JJKA 2KMMA 5E1FA 1VQCA 2A74C 3IL8A 1I50B 2V3SA 2YEPF 3N1XC 4B0EA 1J7BA 3ULLA 4CJ1B 1Y8RC 3QWZB 4FHJA 1U4PA 3D4RA 1NENB 4R4CA 1L0WA 3MXGA 5DM73 3CF5A 3L7ZC 4RHSA 2PNHA 4XXEA 5H1SE 3SK6A 2AMCB 4X64Q 2XNAC 2DZIA 5E6JA 4JI6Q 1KM7A 4PYZA 1SFOB 3PQIA 4RF0A 3NWTA 4K0KL 1O80A 1Q0WB 1T0QC 2YVCA 1G2SA 1N5WA 3QIJA 2BYTA 2O2LD 3PUVA 1X54A 1X6OA 1Y1WB 3CC4A 2KWUB 1PGAA 4JI3L 5IGGA 1WGYA 3Q8EA 2Z0SA 3NTHA 2B2YC 1VQKA 2EMTA 4XQNA 2JA9A 4AYBG 3I8ZA 4DR6Q 4A3GB 1CKMA 2A5HA 4KY5A 4PMCA 4GLXA 2KJRA 3ZQ4A 1SNQA 2PO4A 3MTSA 2B8FA 4QIWE 1I6VC 1LM0A 3T1YQ 1CZWA 3DVGX 4BVUC 4CKEA 2JA6G 4DR7Q 2N88A 2LWPA 3OJ3A 4Z9CB 2O6VA 3GB1A 1D5XC 2AKWB 4RGMA 4IPHA 1IBKL 4B3SQ 5C23A 1MKHA 1XTDA 2D62A 2ZTEA 4HLEA 1V8QA 3T3NA 3GTMH 5ISRA 1JCKB 2PCFB 5M5YB 3M7GA 4O0AA 2JJQA 1YI2A 1Q1OA 5IGDA 2JA8H 1E7PB 1TTNA 2MBOA 3NJTA 2SOBA 4BBRG 3EFUA 2Z6KC 3L3OC 5K36H 1BF4A 3RZDB 4GOCA 5G5HA 1WOCA 1HA5A 2KXJA 4YTMB 5EPLA 4DV2L 1LM8B 1TYGB 5FLXc 2H89B 3PMFA 1TWCH 3L4PA 4A3EB 5IIFA 2B2TA 4BXXH 1J8IA 2JF5A 1C1YB 5C44G 3KVFB 2L9HA 1IYUA 3PLUA 1K3BC 3MAQA 4DR1L 3VR4A 5IODA 2V3NA 4NY0A 4C3JG 2JYTA 2JA7G 3CQZH 2K6QA 1F9QA 3FRPB 2O4XA 2WB1G 3CRLC 5M3MH 5CYUA 2B63H 1JT8A 2W9NA 2V4DA 4DK5A 4XQQA 4AQ7A 1G6JA 5JVH3 5JJIA 2MO1A 3HOVB 4C3HB 1D1KA 1X3PA 2ASBA 3H0GH 4K8JA 4DDID 2F0HA 1XD3B 4MM3B 3TEXA 4ANVA 4YSZB 4OVZA 3CCQA 4GMVA 3PTFC 3AYHB 4MTKA 2D07B 4GOPB 1WX8A 1YNJC 3HOXH 4QCLA 3HIZA 4KGTA 5JEAG 4OL7A 3FPUB 1WGRA 3WAMA 3LWEA 2R7ZB 2YV5A 4BOSC 1VDZA 3WOFA 1C79A 1NEKB 2HDEA 2CH4A 4RMFA 4TSSA 2RDGA 3GTJH 2ZXPA 2IHFA 3ULJA 1HHVA 3A33B 4GN1A 4XYQA 2K25A 2DAFA 3AE5B 3HG9A 3MP9A 3NBHA 3RNFC 3HOZH 1UNSA 4DKAC 1F77A 5BR8Q 1VQJA 3RLOA 3CU7A 2OF1A 3Q2AC 3ML9A 4A3DB 1ESRA 4GDKA 4IJHA 2XRQD 2KWCA 2XK5A 1PYBA 3A1QB 2E2HB 3CRKC 4HDQA 1RM6C 3TEHB 1T5EA 1YJNA 2KECA 2K5PA 3FAHA 3GTQB 1W3SA 2KC2A 1B50A 4FNFA 2J0TD 5K5PA 1QNKA 1CKNB 4DV4Q 4DR2L 2WXHA 3P63A 1UEAB 2DAJA 1NR4A 4JI5L 4NAWA 2BTEA 3RZFA 1QNUA 4AOFA 4A3FG 3CKIB 3O13A 1XNQL 3QR8A 1ZEQX 2X38A 1ZKHA 1F2RC 4DR4Q 4BZAA 2B29A 3RI7C 1EZ8A 2INDC 2SNSA 1B9NA 1IBKQ 3ZLZA 1GKHA 2JE6I 1YEZA 3AU4A 1PFSA 1SYDA 3OLMD 1SFOH 3TZUA 2IO2B 3ONSA 4XT3B 3ZDTA 1DOMA 2BE5D 4B3MQ 4JG2A 1TWAH 3TZDA 1Y1WH 1W2BA 1DOXA 1YQ4B 2DNCA 2PVOD 4IWOA 1OQQA 5GXGB 2EY1A 4HEDA 1TWHH 1FYCA 1YHBA 2HE7A 2BDOA 1WCMH 2ZXRA 4QY7A 4JC0A 3SHLA 3K8AA 3J7YW 2OQKA 1R9TH 1OXXK 2UXCQ 4YIJA 2G4SA 1KHIA 3TREA 3STBD 2FIDA 3R7QA 3MEFA 2LGIA 4DR1Q 1EO6A 1YITA 2UUBQ 3SK4A 1LV9A 2DYBA 3MC9A 2FUHB 4A9AA 2LGSA 4JBKA 2G5DA 2F3WA 3C0RB 3IFTA 2OOBB 1T3QA 3IVFA 4MNOA 2F1MA 4OWXB 5M5YH 1UBQA 1ENAA 3DEPA 1SNMA 1QE6A 1QVGA 1QT9A 1VJKA 2WXPA 4HKQA 4WJWA 1C4CA 3M85A 3MXNB 2QCZA 1X9NA 3PIO3 3NSWA 3RZDH 1EWYC 4RGTA 3U7ZA 2NTTA 3I91A 3C2PA 5IYDH 1NVID 1SGHA 4PMBA 4P2CB 2F0MA 1LUZA 3K7AH 1XNRL 2HIXA 3IT6B 3DBRB 2EPBA 2KAJA 4EOYA 1C77A 2XSCA 2OCEA 3WANA 2N7EA 1SBBB 2D2CC 4JBWA 4EUTA 5J18A 1LT6D 1QG7A 1QOGA 2HCCA 3PHXB 2QCPX 4LFBL 2EYPA 1CMXB 2N9KA 5ELBA 4LF9L 4ZUIA 3PUWA 4YCUA 1K53A 3Q8FA 2WB1B 2PMZE 1X65A 2R6GA 4YCWA 2R61A 1JWUD 3VUXA 4A3KH 1EIYB 2R7FA 2MP2B 2WHIA 3DM3A 3ZYYX 3UGBB 5C3EH 2CHZA 3P42A 1HZ5A 3CF6E 1Q82C 3B08A 4GIVA 1IHZA 1L4DB 3PHWB 1UF0A 1SMXA 1P1AA 2F3VA 5AZGA 3NBIA 3VRBB 3M4YA 3RNAC 5BN5A 2NVUI 3E0JA 3I4NH 2FBWB 4A3BH 2KQ7A 4G0NB 4BBNF 4QMGA 1SNOA 3RNGC 5HG2A 4YSXB 3CC2A 4NB3A 4G11A 4CYEA 1WZ3A 4CDFC 4K5VA 2NZHA 3U50C 4DR2Q 3NTIA 4LF6Q 5JXVA 2Y0SB 1PV4A 3AEAB 4MN3A 2NZ1D 2DZJA 1SF0A 5LL6S 3BDCA 4NPSA 1KC8C 3HVDA 4V0BA 1WXVA 1O7ZA 2YEPB 1TKGA 3D8GA 1WTRA 2E2JH 3I4MG 2JYEA 4AUQC 3HOWB 1WRDB 4UDUC 1N5XA 4UY8C 2ZJQA 1PZKD 2F03A 4A3DH 1A5RA 2MJDA 3I56A 1O7YA 1IBXA 4YT0B 2RDFA 2KWVB 2UXBQ 1D1IA 1H9SA 3NELA 4OWWB 2LHDA 1PH7A 4LNNA 3QARA 4LK0M 1U4MA 3AEVA 1WM2A 2J0KA 4NQLB 3E0EA 2Q2UA 4PS8A 2WAQE 2FMCA 2RCFA 1UZXB 1VZ6A 2N9EB 4A3MB 5KGUA 2HJ8A 4GNXA 2HIVA 4M8NA 2CH4W 3I70A 2O5JC 1H4RA 3BS1A 4ZAIA 3PSEB 1STYA 1I4RA 1AYFA 2K22A 3AMZA 1H9RA 1U5KA 3K7UC 3GE3C 3PT2B 2EJGC 2K33A 1OQRA 2L00B 5ELDA 1QLBB 3X23A 4A3OA 3H8HA 2F0DA 3ETRA 2D10A 1B4OA 3OJ4B 3MZ5A 4JYAL 1QILA 3PO3B 3AEGB 1F52A 2KCMA 4P6VF 1WWTA 4LDTB 1MG4A 3L9AX 4JCVE 1WI5A 2N9LA 4FO2A 2M0XA 2ZCCA 3DBRI 5C3JB 4CHTB 2KACA 1L0VB 5A2QE 4KZCA 1A15A 1BCPD 4ZRKA 2JPHA 3S15H 1WGHA 2KN4A 4C7YA 4NP5A 3LGJA 1XNRQ 1LABA 5J1ZA 5M3FB 1K52A 1R7SA 2N9XA 1N62A 2BS3B 1LTLA 2IO0B 1B44D 3MHBA 2MA9B 4FULA 1MHXA 2AL6A 2NCNA 4HJ7A 4IUQA 2L52A 1HTLD 2JA6H 3NQIA 4IOAA 4ZYNA 4WAAA 2ALYB 5ELNA 3T51B 2F0PA 3FILB 3KFUA 1JB7A 2LD9A 1CQFA 3NY5A 1I3QH 3TQYA 2DGYA 2FE8A 2B2YA 1NMFA 3LX0A 4BBRH 5CMDA 4R9WA 4LF8Q 4CDCC 3C1FA 1VCBA 3VA7A 2O5IC 2ZXOA 1L6VA 2A68D 3QO2A 4IUVA 1N9WA 5CHVC 5CV8A 3QOJA 1KRHA 2W3RA 1T0RC 2MGSA 2WXNA
chains in the Genus database with same CATH topology
1JOOA 1PTOD 4ZRPA 2EZVA 2YYZA 1V1PB 1R4QB 4C2MB 5J22A 3AMUA 2JQRB 4K14A 1DOYA 1BCPF 2JX5A 2KQ4X 1PRTD 2E2DC 2LJIA 2VB2X 2PNRC 4HSPA 1F9PA 3EQLC 2I46A 1Y8OB 1SE3A 2LMCA 1JWSD 2M9VA 3C46A 3NP8A 3RMHA 4EVOA 4FVMA 5HGTA 5FO9B 5JJZA 4OHJA 1J7AA 4A3IB 1I4GA 2J4XA 1MD2D 5JEAH 1KLUD 1M4VA 3V3XA 4DK1A 1RD9D 5EE9A 1EYDA 2JSOA 5JEAJ 1YQ3B 2WLBA 3TN2A 1EEID 1ILPA 5G5GA 3OMGA 2PVGC 1SAPA 1PTOF 4FXKC 3AV8A 4KGRA 2FJ2A 2A6HD 1K8OA 2LS01 2EYLA 2RQXA 1K50A 4D2KA 3I4MB 3T13A 1PRTF 4N6EB 2KVMA 2JXMB 2E75C 3GD7A 5EKIA 5FOBB 5T1GA 3NQTA 1BOSA 2M0AA 1ONLA 4F7XA 4G4KA 3P4QB 4MIUA 3RZOB 2AUKA 3MFGA 1G91A 3S1RB 3J80L 3T3OA 5IGEA 3S1MB 2J53A 5KYLA 1NCVA 2K05A 3SFDB 3SR6A 4G7HC 1J7CA 4X3TA 5I6YA 3VYRA 4B08A 3GTPB 2Q8TA 3U2SC 5A35A 4FF2A 1HPCA 1NI3A 4XDXA 1TS3A 2WDVB 1ML0D 3P4RB 3IAM1 1YNND 1ZUD2 1PLFA 3AU7A 1DOKA 4NW2A 4DNRB 1EFID 5EJWA 4RCOA 2PKOA 3MXPA 5C4ZA 2FHTA 2DYOA 1U4LA 4K5WA 1KFYB 4US8A 1PFDA 1GHKA 1QQRA 2PQEA 4NZLB 1K83B 1KABA 3GTGB 2QKIC 4KY6A 1UWMA 1JRPA 2G9DA 1CM9A 2Z1CA 2K3UA 1E0BA 4ULLA 4TQUS 4IOIE 3V96A 2WS3B 1Z6HA 2F0UA 4RAUC 1CHQD 5EPJA 3MEHA 1EU3A 1SYBA 3N52A 3R2TA 1MHHE 2IX0A 4QB4A 1GUTA 3FKIB 5LNK1 3EUB2 3AE1B 1UGJA 2WXQA 2HQEA 1EIHA 2WV6D 1IW7C 3TEWA 4KGSA 2KQ3A 3NZ3A 1EY8A 3LWUA 1ZXIA 4XIGS 2PZWA 3Q24A 4X3KA 4UAIA 1SMYD 1EL0A 1E0ZA 3VR8B 5T1IA 3C3LA 4Q5VA 2K7VA 2MPMA 1CQVA 3HKZB 1JMLA 1FRRA 1PZJD 5A2QL 1FM0D 4NAMA 1C76A 1E2VA 2KHSA 3CHBD 4C3HG 2CW0D 3H09A 3AE2B 1FGBD 2HCIA 4FXDA 1B3AA 2XN9C 3D6CA 2M19A 2F0TA 5D14A 2IGDA 1VZ8A 4X3UA 4ILWA 1GUOA 5AUKA 2R92B 1TWFB 3E9SA 1SE2A 2Z8LA 1JQYD 1RKNA 4ARIA 2J42A 5KRUA 2FINB 3IKJA 5COYA 3S1QB 1ZDXA 2XIWA 1WVLA 2D5GA 3K5NA 3Q69A 2EE1A 1RTNA 2Q8RE 5TSSA 3LXFA 3SK5A 3H6MA 5CGKA 3DEOA 1BCPB 2Y3AA 3ZJVA 3VR2A 1EY0A 2A73B 1KDBA 5EQ0A 4CBVA 5EBDA 3DM1A 1KDAA 2L83A 4ZHOA 4WAFA 3CWIA 1FCLA 2F0JA 4BWGB 1B1ZA 1RHPA 2PMVA 4HRSA 4QUFA 4FP5D 4RNAA 2HDLA 4HMJA 3MHZA 2ID0A 4ZQ3A 2ZW1A 1E9MA 1EY6A 4IFDG 5BYQA 3VQIA 3KLSA 1GUGA 1SE4A 1PTOB 1FMAD 5D3DA 1O7LA 2F0IA 3MVVA 3HRZC 3E56A 3AE4B 1PRTB 2WXLA 1DJRD 4LAAA 4WQMA 1ACCA 1SJED 4M8AA 1HTPA 1XEEA 1OXUA 3BDLA 4FF4A 2NVQB 1XTCD 5EPKA 4BBSB 2VXWA 3ZJTA 1AZPA 2L4NA 3D4DA 3PV0A 1L5PA 1MI2A 2KJXA 4QIWB 1BO0A 2E76C 3FDTA 2GI9A 2MH7A 3IAS1 3MXNA 1EQTA 4US9A 3KBXA 3K5OA 4BY1B 1X3QA 4C7ZA 1D2BA 2F0WA 1RF2D 1C8CA 2WXKA 1ZYRD 2INPE 1OXTA 1XO3A 1TIID 4OZBA 3HOYB 3EROA 2EYHA 3URYA 2KCNA 3WOEA 1B2TA 1EYCA 3I4LA 5BYSA 1ILQA 3J9CA 1Q1BA 2KEEA 4O42A 1SSOA 3K5MA 3TDQA 3S1NB 2OXPA 5JPNC 1JALA 5CV4A 2ON8A 1DZ1A 2CJOA 3Q22A 1WTVA 2RSNA 3S16B 1XCTL 4TQ0A 1YNTE 4A93B 1AW7A 3AB5A 2JP1A 3HS0C 4OIJA 2PTLA 3SR1A 2PZUA 3GQBA 5BMIA 3AE6B 3SXHA 3P75A 2GB1A 2N0SB 3QWNA 1IKMA 1QCBD 1NR2A 3GTKB 2QSDA 3FPPA 2F0EA 3VR9B 5JPMC 2ICEC 3SDZA 1U9RA 1JORA 1SB3C 2IX1A 2K5WA 4ID6A 4KN4C 1OO9B 2WXOA 2IT1A 4O1NA 3NVWA 1XX8A 4IALA 1GOZA 2BW2A 1I6HB 1WYGA 2LEKA 3HVZA 4KKUA 1S5ED 1Y56A 1HXYD 1OFFA 1D4BA 3TP7A 4ARCA 4OZCA 1ET6A 2Q8IB 2DY8A 3HOUB 2LFIA 4OW0A 2A69D 1RJTA 4RA8A 2GA4B 4DF7A 1FFVA 2L32A 3J80E 1VLBA 3X3NA 1RCVD 2KEDA 1VDVA 1EU4A 1RDPD 1PFBA 2F0FA 4L8JA 1A6XA 4C3IB 4H44C 3OOCA 3M4OB 1BUVT 1D5MC 1C4QA 5FLXL 4HCEA 5KNBA 3FILA 5BMHA 5FKAC 2RDHA 2IJ0A 3ZGZA 1FNUA 2C5CA 3NHHA 4KKJA 4U673 1V97A 3BWUD 2SAKA 2KCCA 3T16A 1VF5C 1ZOYB 1WRIA 1C9FA 3MC0B 3PO2B 3IXSA 2A6EC 1SYFA 1FD6A 5KYIA 4PQXA 2WINB 1V1PA 1WXQA 3GO5A 3U52E 2PIAA 1GB1A 4J8QA 1EY4A 4KMUC 3S2HB 5G3LD 2JSVX 1QF6A 3S14B 4KY7A 3G7LA 4XWTA 1FFUA 3ND8A 1FXAA 2N55A 1J9OA 2Z4IA 5AFWA 2PMZB 3OHXC 1F2YA 1EM7A 3UI2A 5IGFA 1Z7TA 2M56B 4KHVA 2RVLA 4FF1A 4N9TA 4XDCA 2NN6I 1SNPA 5CV5A 1MBYA 5JVG3 4IFDI 2CHBD 2KDMA 1S4ZA 4KHZA 4WURA 1YNJD 2E74C 4A90A 2BOSA 3U9OA 1O78A 1M8AA 4B9XA 3RFZB 1VCIA 1S5CD 2L1BA 5G3LF 5I9OA 2K5DA 3GTLB 2WXFA 1WSPA 4ABNA 2W54A 1TY0A 1MPEA 3W1SA 2F0OA 2E2IB 1KTKA 1WTOA 3K59A 1CT1D 1C78A 2WACA 3I72A 3MXUA 1KH0A 2RSOA 4IFDH 2B2VC 4IFDJ 3KBGA 2WAQB 3PUZA 1Q8IA 2L55A 3I73A 2L11A 2V3PA 5H8YE 5HHDG 1SSNA 1XXGA 5EKKA 4K6LA 2WQYB 4MHEA 4A3JB 3DMUA 1AN8A 3W2DA 3J81E 2WNMA 3P1MA 1PZID 2L5TA 3TP8A 2RMMA 1HEZE 2EKIA 3VYSA 2HUGA 1P7FA 2F4IA 1JICA 1BDOA 2AWNA 2YU9B 3TEYA 3PZ8A 4IDIA 1ET9A 3A55A 4KTAA 1Z47A 2AWOA 1AFPA 3N6RA 3A56A 2K28A 4XT1B 4GZYC 2RA4A 2JU6X 4YSYB 3K58A 4OZAA 3A7AB 4R3DA 1Y1VB 1LTAD 1PXUA 1GJXA 1CA5A 3TEZA 1VMCA 1VMPA 1FO4A 3IAYA 1K51A 1CHPD 2Q5WD 1F0ZA 4GLSC 3A8IE 5JOBA 4JWSC 3DWMA 4HROA 2DBYA 2MHVA 3A8JE 3H91A 3G6JB 4TMAB 4GDLB 3FVQA 1YJJA 3KWLA 2IL8A 1GHJA 4KK7A 3NWSA 4IQZA 4KKTA 4RGNA 4DXGA 1GUSA 4ZRQA 4IURA 3R93A 4DFAA 2F0NA 4KX6B 1RODA 1JB3A 1IKLA 4DQOC 5F2DA 3C1EA 1Q90A 2R3ZA 1QJOA 1C4PA 1DYQA 3DXJC 4HCSA 3BYTB 1EWCA 4OO1I 4S3SA 3J7AF 1TJEA 1RTOA 4TRDA 3EVQA 1F9RA 2E3TA 1CZPA 2JYOA 1ROEA 1HZ6A 2H4OA 1GUNA 1SNCA 1SYGA 4RWSC 4Y7NB 1V8CA 1N61A 5C4HA 3VYUA 2H88B 3D6WA 2XWJB 2OEDA 2K03A 3SVMA 2ZW0A 5C0XG 3D4WA 3V2TA 5M5WB 1QOFA 3QOLA 2NVTB 1G6ZA 1VR9A 1GXDC 2INNE 1X32A 2HTME 3HGBA 1JWAD 1CJEA 4X3SA 3J7AV 4XE0A 1BNZA 3AEEB 3OPOA 4M0WA 2NBFA 4L2YA 1HCZA 2EYJA 1TU2B 1D6EC 5MPOA 4ODGA 3KK7A 3NVZA 1L0XB 4NMZA 1WD0A 2JA5B 4G7OC 2B76B 5D7GA 1L0YB 1PFMA 2PYKA 4PNYA 5C2TB 2EY5A 2WP9B 2PZTA 1SYCA 4J1MA 2BB5A 1JOKA 4FF3A 1H9KA 1HUMA 3OSOA 2F0GA 2QDBA 4QF4A 3SK8A 4ZYSA 1VZ7A 4Q2JA 2ONQA 1BXTA 3ERQA 4I65A 4MACA 3Q8BA 4IKGA 4RFBA 4ZKCB 2EYOA 5FK9C 4EQOA 2L1AA 5IT9L 3JAME 4B9WA 1HFGA 5H92C 2LMCB 1PFNA 1EIGA 4ITKA 1HQRD 2TMPA 3DWAA 3I90A 1A2TA 1JW9D 5C6AA 2JEAI 1A3TA 5HFYA 3I3CA 3DWQA 1NYRA 3NUHB 2SEBD 3E5SA 1P7EA 4CGYB 3VR5A 4YXDB 1Q1EA 2Y5PA 1ICWA 1L6UA 2Y5CA 1I4QA 2LUMA 4DK0A 2WXRA 1EY7A 3K0YA 1TKYA 1IL8A 1SIJA 3H94A 2EVBA 2I07B 4Q0FA 2C9OA 1PMRA 4RGOS 1DGJA 1EYAA 4H7BA 1EEFD 1YN3A 2QIEB 5FLXE 5IOCA 1SXTA 1AEXA 1TWCB 1WTQA 2DNEA 4H2AA 3DWGC 3I57A 3J81L 4YTPB 4LJZC 2WU2B 4CQNA 4KJNA 4L63B 3CQZB 1ZPSA 3P20A 5M3MB 2B63B 2EYMA 4EGVA 5EGTA 1A70A 4LTUA 5KNDA 3H0GB 3U4EG 4PV1C 2M2LA 3W3AA 4YWGG 1NUCA 5I2YA 2B2VA 2AUJD 3HOXB 4WIPA 4RH6A 2NVXB 3MA2B 1D5ZC 3F2UA 1EZ6A 4LLGM 4N9PA 2XWBB 1QOAA 3GTJB 1B9RA 2VB3X 2BS2B 5ELFA 2KUMA 1V1OA 1LTBD 3HOZB 1C48A 4JWUC 2WDRB 3HP3A 1FNVA 4RCNA 2B2WA 2NN6G 3T56B 2NVYB 2SDFA 4ZKBB 3QB3A 2WDQB 4OIKA 4WORA 2XVSA 2EY2A 1XYIA 2BE5C 2J52A 1YN5A 3NPPA 1PGXA 1TKWB 1JE4A 4KKSA 1K8MA 2K01A 3BVGA 1I4XA 3P4SB 1TY2A 4BY7B 2XRSD 2B39A 4PMWA 1QB5D 3TP6A 4C3IG 1WD1A 3I9V1 2QMTA 2MEKA 2WU5B 2RBMA 5BN3A 3AEFB 1TWAB 1MGSA 1NYQA 5CORA 1B53A 1WTWA 1GUWA 1JR0D 1F9SA 1TWHB 3MFYA 1R9TB 1WCMB 5ELEA 3SE0A 5C0XI 2WXMA 3B2FA 3N9YC 2ZT9C 1B9MA 1UUPA 3E6ZX 4M1UB 4XWWA 1IW7D 3A54A 3U9SA 4L23A 2F0LA 3R3OA 1STNA 2K0PA 1G2TA 4CKCA 1UAPA 2K32A 3GV6A 2X6LA 3WCQA 1QOHA 1HA6A 1F2RI 5HI1A 4FXGC 3BK2A 3K7AB 3V05A 2HDMA 3W9CB 2D9UA 5CV6A 2OHFA 1PUTA 3RPFC 4U68A 2BB6A 3BK1A 3AE8B 4MH8A 5C0XH 1SDFA 1STAA 4HTHA 4K2KA 5C0XJ 4DNTB 2NYZD 4I7ZC 4WWMA 2AQ2B 1KNEA 2ICIA 1FEHA 3BG3A 4A3KB 5M9OA 1QKZA 2W3SA 5IGBA 3BZDB 5C3EB 1AWDA 4JK1C 5C5MA 4CKBA 2K1BA 1Q12A 2PPBC 4E6IA 4IUTA 3I4NB 4A3BB 2NB0A 3DHQA 2WIIB 2OEOA 1BQQT 4OGQC 3AEDB 3QJYA 1STGA 5D3IB 1A3UA 5I2XA 1LT3D 4BS9A 3EA6A 3TSSA 1OXSC 3Q6SA 1CTMA 1SNDA 3BVMA 3JAML 2E2JB 2B2UA 2MUYA 1II3A 1CI3M 2OT2A 4MT5A 1KAAA 3VR3A 3Q8CA 2DY7A 2QEJC 2V4IB 4ZLTF 2X6GA 4ZHPA 1TZOA 2K9XA 3HUIA 4KD4A 3MJ5A 1IYVA 4J3OD 5DNFA 1PTOH 1JWBD 4WRDA 1FR3A 3AE3B 4HJGE 1YJIA 4KV6A 1E10A 2K04A 1F2MA 2NUCA 4DGZA 3AECB 4OO1G 1Q3LA 4DAPA 5C3WA 1BCPC 2EJMA 4R8IA 2IGHA 4KKIA 5C4XB 1LTID 3RUZA 1EY9A 4IUNA 1CA6A 5BMGA 3S15B 1KDCA 3A7LA 4HMIA 1XLPA 2BA1A 4IN3A 2BA0A 4AYBB 2A68C 2KA7A 3BYYB 4HSVA 1TKEA 3A8KE 1TT2A 3M7NA 3T4AC 4V190 2JA6B 3ONAB 5T8IA 1PTOC 1STBA 2SNMA 2X69A 4B0MA 1I3QB 2QJLA 4BBRB 1PRTC 3ITPA 2VZKD 4K2LA 1N63A 3NE5B 2EJFC 2WKDA 4NDXA 2WXJA 1LT5D 4FYDA 3ZJUA 1I7HA 2RPVA 4XDDA 3HRDD 5CR3A 3R2IA 1SYEA 4G57A 2F0QA 2PLPA 5C44B 1TS5A 1XF5L 4P16A 4C3JB 1LTGD 1IGCA 2JA7B 1SEBD 1GAQB 1RYJA 3FEWX 3P4PB 3OW7A 4XQJA 3TUOA 2NTSA 1XLQA 3AH7A 2A6HC 1FIQA 2BS4B 2H1EA 5IT9E 1BR9A 1A3VA 5CBAE 4NKLA 1HFNA 1IUEA 2J7ZA 1TQOA 1XWEA 5FO8B 1W6KA 3WDNA 3S9WA 1JOQA 3KUPA 3R8BA 2KWDA 1Q10A 2MJ3A 2IDYA 5C5LA 1XLOA 4GDKB 1Y8NB 5FR3A 3S2DB 1RFKA 3W5VB 4ZOHC 1T6BX 3DWPA 5LHY1 4WFN3 1AZQA 3OMCA 1YN4A 3HEJA 4IUUA 1I4PA 5C3XA 3NVVA 3S17B 3NTKA 2NN6H 1MVKA 3KLSX 3BVZA 4RF1A 1LO5D 4NAWB 1CZGA 5EBCA 5HURA 3Q0AA 3FMCA 2NMQA 3AN1A 3PIP3 1YNNC 3NUCA 4RHRA 4CJ0B 2WXIA 3NXWA 5DEHA 1PGBA 4A3FB 5CC4A 1EWHA 1QWYA 2IW3A 1UWXA 4ME5A 2CVRA 2KOLA 5M5XB 5JAVA 3NK9A 2B2WC 3EJIA 3AM9A 3NVYA 2FMMA 5ELCA 3X3MA 4HKZE 3NRZA 1H9JA 2MJEA 2G1EA 5EKLA 1XLNA 3VA5A 1BMLC 2RKSA 2CU3A 1PDXA 4AS1A 4TQ1A 2L12A 3PUYA 3PZ7A 1STHA 3AE9B 3GS2A 3VR6A 1MSGA 2Z4HA 1FRDA 2DN8A 4H13C 2QF7A 2EXZA 3VYTA 1JROA 3AE7B 2EELA 5CV7A 4NJCA 4ZK9B 3GV3A 1BBXC 1CK1A 3H3VC 4BA1I 1RWSA 4TKOB 5C4JB 4REZA 3Q8AA 3Q23A 1S5BD 4K8IA 2A6ED 4KN7C 1ZXHA 1NSNS 4USAA 1VRAB 3K57A 1LLRD 2LHEA 4R8NA 1WGKA 1TVXA 1TS4A 3QIAA 2WKCA 4DU9A 1SMYC 3D31A 1DM0B 5CV9A 2IX3A 2B2TC 2BDNA 2FFKB 3ND9A 4EE2A 1ZXTA 1R4PB 2JEBI 2V0GA 5I4DA 1T5XD 1G8ZD 4C1NK 1LT4D 4HN7A 2PW7A 1E2WA 2VUMB 1OXVA 2F0SA 5K36G 5EE1A 3BDOA 3T53B 3VRAB 5J39A 5E3FA 3CIRB 5BYRA 1JC7A 1IBXB 2CW0C 1TWGB 1H9SB 1HRJA 2CJNA 1N60A 2MP1A 4K6DA 1I4HA 1FXIA 1EY5A 3RD4A 1EQVA 3C8YA 2DWQA 1KLGD 2AX5A 3AB9A 5EE0A 4H0LC 2WXGA 1KF6B 1DCZA 4F8MA 2L0CA 4N59A 2BBCA 2FUG1 4OO1H 1ENCA 4LMQD 2K5QA 4DXFA 1YMHE 3GP7A 3QG1A 2B2UC 3B2GA 4PT5A 1JQ4A 1EOTA 2DLBA 3RLFA 1ZP0B 3FC4A 4CJ2C 1AP0A 4XTCS 1MI0A 1ZKOA 2ACZB 2EDGA 3BIID 2DYMA 4A6QA 1LTSD 2BCOA 1DONA 1ZDVA 3IT4B 4FXCA 4RKLA 2D5DA 2EOTA 4RKBA 2E6XA 4N58A 2LKVA 5EE3A 4C80A 2QILA 4EQPA 1HQMC 1BUIC 3OWFA 1Y8PB 1WTXA 2JWUA 1G291 2F0KA 4ZRZA 3M3YB 2W82A 5E4WC 4DAYA 2AQ3B 4WH4A 5I6WA 1DXMA 5DM63 1VF7A 5LL6X 1PYWD 1TR5A 2TSSA 2PW5A 3P7JA 1A2UA 2G9HD 5AUIA 4A8XC 2ENBA 3OIQA 2BT6A 4BA2I 4F87A 2VZKB 2NWGA 5IGCA 2EY6A 4IUPA 1E2ZA 3TMEA 3OWEB 4HR7B 2R93B 3IFDA 4QUCA 1PDQA 2M00A 1V43A 3LYYA 4L6TB 3EGRA 3LNNA 4ZUJA 5FO7B 1S5FD 4DN4M 4L1BA 2LY7A 3SEBA 2WP8J 2JXTA 5D65A 5BN4A 3B9JA 1ESFA 2EYFA 3AEBB 4HAEA 3GTMB 1ZYRC 2JA8B 1QOBA 1SJHD 1IGDA 1XCQL 2CQAA 2B8GA 1MSHA 1H9MA 1CFMA 2GRIA 2IPKD 3TP5A 1E6EB 1GPXA 1F2LA 5E4XA 3EFXD 5CBEE 3D3RA 5DAUA 3KWVA 4DAVA 4IZ8A 1NAPA 1W6JA 1JWMD 5KIXA 3MWYW 3HZXA 1DD2A 1WTPA 3ABVB 3K6OA 1HUNA 4JPSA 1TS2A 3DUZA 1FD7D 4KD3A 1U4RA 2VNUD 2F0VA 1DOIA 1L4ZB 3KQ4A 2LFNA 3TBIB 3GTOB 1Y69U 4JX1C 1F2ZA 1DOLA 2IWHA 4C56C 2I2YA 4G7ZC 4DA2A 4KJOA 3KLRA 2I38A 1KNAA 4XYOA 4KI0A 3W5UB 4C1NI 4EQNA 1LTRD 3KF8A 5KEEA 3OIPA 2IGGA 4LK1C 2MJ8A 1ENFA 1LACA 4YTNB 1FNWA 3NS1A 1LTTD 3K5LA 4A55A 4K5XA 5KNCA 3PO0A 3LB8C 2AQ1B 3P1HA 2JZPA 4JE3B 3UI3A 1S5DD 4J6HA 1C4AA 3SFEB 4HEA1 5NUCA 5I9PA 2K6AA 4F88A 1ZE3D 1STEA 3PUXA 1FCCC 2A69C 1GB4A 2KMMA 5E1FA 2A74C 3IL8A 1I50B 2YEPF 4B0EA 1J7BA 4CJ1B 1U4PA 3D4RA 1NENB 5DM73 3MXGA 2PW9A 3L7ZC 4RHSA 4XXEA 3SK6A 2XNAC 5E6JA 1SFOB 4RF0A 3NWTA 1O80A 1G2SA 1N5WA 2BYTA 2O2LD 3PUVA 1Y1WB 1PGAA 5IGGA 3Q8EA 3NTHA 2B2YC 4XQNA 4A3GB 3I8ZA 2A5HA 4KY5A 4PMCA 3ZQ4A 1SNQA 2PO4A 2B8FA 3MTSA 1I6VC 1CZWA 4CKEA 2N88A 4Z9CB 3GB1A 1D5XC 4RGMA 2D62A 1V8QA 3T3NA 5ISRA 1JCKB 2PCFB 5M5YB 3M7GA 5IGDA 1E7PB 2SOBA 3L3OC 5K36H 1BF4A 3RZDB 5G5HA 1HA5A 4YTMB 5EPLA 1TYGB 2H89B 3L4PA 3PMFA 4A3EB 5IIFA 2B2TA 1J8IA 2L9HA 1IYUA 3MAQA 3VR4A 5IODA 2V3NA 4C3JG 2JYTA 1F9QA 3FRPB 2O4XA 3CRLC 5CYUA 2V4DA 4XQQA 4AQ7A 5JVH3 3HOVB 4C3HB 1D1KA 1X3PA 4K8JA 2F0HA 4MM3B 3TEXA 4YSZB 4OVZA 1YNJC 4KGTA 4QCLA 5JEAG 4OL7A 3FPUB 3LWEA 2R7ZB 1VDZA 3WOFA 1C79A 1NEKB 2HDEA 4TSSA 2RDGA 2ZXPA 1HHVA 4XYQA 3AE5B 3HG9A 3MP9A 3NBHA 1UNSA 1F77A 3CU7A 2OF1A 4A3DB 1ESRA 2XRQD 2E2HB 3CRKC 1RM6C 1T5EA 2KECA 2K5PA 3FAHA 3GTQB 1B50A 4FNFA 2J0TD 5K5PA 1QNKA 2WXHA 3P63A 1UEAB 1NR4A 2BTEA 1QNUA 3CKIB 3O13A 1ZEQX 2X38A 1F2RC 1EZ8A 2SNSA 1B9NA 2JE6I 1SYDA 3TZUA 4XT3B 1DOMA 2BE5D 3TZDA 1DOXA 1YQ4B 2DNCA 2PVOD 1OQQA 5GXGB 2EY1A 4HEDA 1FYCA 2BDOA 2ZXRA 3SHLA 3J7YW 2N7JA 2W55A 1OXXK 4YIJA 2LGIA 3SK4A 1LV9A 4A9AA 2F3WA 3IFTA 1T3QA 2F1MA 1ENAA 3DEPA 1SNMA 1QE6A 1QT9A 1VJKA 4HKQA 2WXPA 4WJWA 1C4CA 3M85A 3PIO3 3NSWA 1EWYC 4RGTA 3U7ZA 2NTTA 3I91A 3C2PA 1NVID 4PMBA 4P2CB 2F0MA 3IT6B 2EPBA 2KAJA 1C77A 2XSCA 1SBBB 2D2CC 4JBWA 1LT6D 1QG7A 1QOGA 2HCCA 2QCPX 2EYPA 2N9KA 5ELBA 4ZUIA 3PUWA 1K53A 3Q8FA 2WB1B 2R6GA 2R61A 1JWUD 3ZYYX 3P42A 1HZ5A 1IHZA 1L4DB 2F3VA 3NBIA 3VRBB 3M4YA 5BN5A 3E0JA 2FBWB 4QMGA 1SNOA 5HG2A 4YSXB 4K5VA 3NTIA 5JXVA 2Y0SB 3AEAB 4MN3A 2NZ1D 1SF0A 5LL6S 3BDCA 3HVDA 4V0BA 1O7ZA 2YEPB 1TKGA 3D8GA 1WTRA 2JYEA 3HOWB 4UDUC 1N5XA 1PZKD 2F03A 2MJDA 1O7YA 1IBXA 4YT0B 2RDFA 1D1IA 1H9SA 2LHDA 4LK0M 1U4MA 2FMCA 1VZ6A 4A3MB 5KGUA 3I70A 2O5JC 3BS1A 4ZAIA 1STYA 1I4RA 1AYFA