1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
1PTOH 1PZID 1HTLD 1CQVA 1S5BD 1T5XD 1EU3A 4RH6A 2AQ1B 2O2LD 1HA5A 5ELBA 1LTRD 4L63B 1TS3A 4TSSA 1JCKB 3TSSA 4OHJA 1BXTA 1PTOB 1B1ZA 3MFGA 1S5ED 4RGMA 3BVZA 4L6TB 1FNVA 1CT1D 4Z9CB 1JWMD 1I4PA 1LTID 1TS4A 1RF2D 5FK9C 3KLSX 1LLRD 1ESFA 1TS5A 1UNSA 1LTSD 1B44D 4NZLB 1PRTF 1RCVD 1LTGD 1MD2D 3BVGA 1GOZA 3R2TA 1D5MC 1L0XB 2NTSA 3W2DA 4DXGA 1DYQA 1FGBD 3R8BA 2ICIA 2WV6D 3DWQA 1PTOC 2Z8LA 5ELCA 1L0YB 2QILA 1LTBD 2XRQD 1PTOF 3EA6A 1BCPC 3URYA 3V05A 1RDPD 5ELDA 2QEJC 1BCPD 1ET9A 3BYYB 1TY2A 1PRTC 1DJRD 2XNAC 2NTTA 2IPKD 1V1PB 3SEBA 1CK1A 5FKAC 1LT6D 1S5FD 1TY0A 4BWGB 1JWUD 2AQ3B 1LTTD 1KTKA 1I4RA 5ELFA 1ENFA 2XN9C 4O1NA 5I4DA 5ELEA 1FD7D 4RCOA 2RDHA 1FNWA 1JQYD 2AQ2B 1LT5D 1EEID 3OWEB 1LTAD 1QILA 1BCPB 4RHSA 4UDUC 1CHQD 1I4GA 1SJHD 4DXFA 1SE2A 1EEFD 4RGNA 1CHPD 1EWCA 5D3DA 2IJ0A 1SXTA 1SE3A 1I4HA 3CHBD 2TSSA 2G9HD 4K6LA 1G8ZD 1SE4A 1V1OA 1D6EC 1S5DD 1D5ZC 2XRSD 1F77A 3BYTB 3BZDB 2SEBD 1JR0D 1PRTD 1I4QA 1EFID 1I4XA 1XXGA 1HQRD 1FNUA 3BVMA 1AW7A 2CHBD 1AN8A 1UUPA 1EU4A 1KLGD 2R61A 1RD9D 4C56C 1KLUD 1BCPF 1SBBB 1XTCD 3DWPA 3EFXD 1PTOD 1LT3D 1M4VA 4RFBA 1PZKD 3DWAA 4RGOS 1PZJD 1YN3A 5D3IB 1TS2A 3O13A 1YN4A 1LO5D 1HXYD 1JWSD 1SJED 1STEA 1SEBD 1S5CD 1V1PA 2RDGA 4RGTA 1ET6A 5TSSA 4RHRA 4ZYSA 1LT4D 2J4XA 3MC0B 1PRTB 3R2IA 1D5XC 3GP7A 1PYWD 1YN5A
chains in the Genus database with same CATH superfamily
3RR5A 4OX9L 1HZBA 1SYEA 1R4NI 4WJOA 4EZLA 3HOYB 4LF9Q 1ICWA 1MIUA 1JWBD 2WGSA 4FHKA 1TS3A 5F2DA 1ZOYB 3RN9C 5L83A 4MH8A 3T13A 4WWPA 2NUCA 5GAEC 3TEWA 3ERQA 2B2WA 5C4XG 2MH7A 5M5YB 1X65A 2JA7H 3BK2A 4GN1A 1VQEA 1BT0A 2EY5A 2LHDA 1RF2D 3N3KB 3KLSX 1LLRD 4FXKC 1K8MA 1FPYA 4H13C 1Y8NB 4W9EA 1VQKA 1VDZA 2L1BA 4YWKA 2HHHL 3S1QB 2YTVA 2D5DA 3ZRCA 1KRTA 3ICEA 2N49A 2GA4B 3S1NH 3ZNHB 1XT9B 1L0XB 2KEDA 4ZYNA 3CPFA 5C4XB 2ZEQA 1FGBD 3NZ3A 2IL8A 5DNFA 3ZDMC 3T56B 4NAWA 4KKSA 1PTOC 3MZ5A 4LFCQ 2DYMA 2DUDA 3OG5A 1AEXA 2PZTA 4A3DG 3OIQA 2H5XA 1YJNA 1PDQA 2KFJA 2MJ3A 2XVSA 1BCPD 2EVBA 3HM3A 3ZQ4A 5FLMH 3I70A 4ITKA 1SYFA 2DYOA 5KHQA 5IKCM 2JX5A 2WXHA 4PMWA 3SDLC 3PV0A 1TWHH 3GQBA 2XNAC 3LNNA 4ZLTF 2JYTA 3Q8EA 5HFYA 3SEBA 3CXCA 2G4DB 1BNZA 2YVCA 2Z4HA 1WCMH 4P16A 1IW7C 3NK9A 2FFKB 2JA7G 1F9QA 4A3GH 1HA6A 2IO3B 4M8MA 3LDZE 2E8GA 4RAUC 2HDMA 1P8LA 2Q8IB 5M3FB 2UXBL 1WTPA 3CSTA 2MQHA 4M1UB 4NJ7A 2LASA 3K80C 1A70A 4IQZA 2UUAQ 3DBRI 1VQ7A 1QILA 4JG2A 2O2VB 3S24A 2OTJA 3EECA 4BXXG 1RFKA 5DCNA 4LNQA 3A55A 1ZE3D 3M9BA 2A5HA 2D3BA 4HCEA 3OIPA 3MXUA 4PMBA 3E6ZX 3FDTA 4ARIA 2OJWA 1SE3A 2LJIA 1X6OA 5IP7G 3U4EG 4A9AA 5KEEA 2E5LQ 3DBHI 3ZJTA 2DWQA 1VQIA 1AWDA 3TRZA 1SYDA 1SYBA 3DHGC 3NJTA 5IGEA 4R4QA 1ZKHA 1Y8RC 2A69D 3OMCA 1E7VA 2V4LA 3HHMA 1NY4A 1XMOL 3A54A 2B76B 1E6EB 3UINB 1G2SA 2CHBD 4KI0A 1N6ZA 2NZ1D 3P7JA 1HR0W 2KCCA 4C56C 4QY7A 1L5PA 1KLUD 1X3FA 2K33A 4BA1I 4AYBG 4LK1C 4EQNA 4A93H 2E3TA 3QA8A 4B6WA 1H4RA 2X8XX 5C3EG 4A90A 1WXSA 3N1YC 1W3SA 2VQEQ 1WTRA 1JALA 4C7YA 2N88A 2B2VC 2WP9B 3H3VC 3HOUH 1XPUA 1E8ZA 4M0WA 1TS2A 4BKGA 3HP3A 1J0GA 1JWSD 1F2RI 1UWXA 1XLOA 1Q8KA 4X3SA 4JIOU 2K6DB 4FJZA 1ENCA 3RD4A 1L2NA 4R3DA 1CKMA 4RHRA 2J4XA 4G50A 4H02A 1N61A 2INDC 2KMMA 3GP7A 3IFWB 2EDGA 3AU7A 3PSEB 4LF8Q 2L1AA 1E5WA 3HOXH 3FILB 3U52E 2M17A 4YY3Q 2KC1A 4LFBL 4FJVB 4JI0Q 1WXQA 2I1JA 2WXKA 3R7QA 1S1QB 3MXNA 1FIQA 3OOCA 4L63B 1RYJA 1JCKB 3TSSA 3RT3B 3PHWB 4URKA 2E6XA 4WH4A 2E2IB 3B2FA 4M0WB 2R92B 3VDYA 3N32A 1YVCA 2F0SA 5CBAE 4NXML 1P0RA 1PGBA 3I72A 1WXAA 1O7LA 5C3EB 3CC7A 1A2TA 4IOCA 2A1AA 2EE1A 3I4LA 4FF2A 5ELNA 4AYBB 1LTSD 3ND9A 4XYQA 3C1FA 5C44B 2EMTA 5EJWA 1D3ZA 1C48A 1E7PB 2YEPF 2L32A 3Q6SA 3KWVA 2R6GA 4IOIE 2WXRA 2I5HA 3AE9B 1K8AC 1HNXQ 1K73C 2Z6KA 3L10B 4IJLA 2M1MA 2Z8LA 1YQ4B 3D6CA 2HHHQ 2Z0DB 3Q69A 1VQGA 4ZUIA 1WGHA 2WXJA 2ZNVB 1LTBD 4NAMA 1Q81C 2NVQB 1EY7A 5FR6A 4KZCA 4CJ1B 1ZGUB 1RDPD 1I94L 2B63G 3TEZA 1WCMG 2KHSA 2DJFC 1NMGA 4BBRH 2KX0A 3QQ8B 4N59A 1TT2A 5IT9L 2KN4A 1WJJA 2QKIC 2LVPA 2Z0SA 1TIFA 1V97A 4I7AA 3CMMB 4G57A 1OEYA 3DUZA 1RLFA 4DF7A 5LLIA 2X38A 4K2KA 3H8HA 4NPNA 2EELA 1PYBA 1YNTE 4WWMA 1TT5B 5JEAJ 3J81c 4GKKL 2MBEA 3VYUA 2UXDQ 2EQSA 1V86A 4OVVA 1N33L 3P20A 1LM0A 2JA7B 1PMRA 3GTMH 1I3QB 3IXSA 2K4KA 1PXUA 4RHSA 1C4PA 4C4VA 1WZ0A 2KDEB 2KCMA 4OO1H 1IYFA 2JQOA 1CHQD 4GDKB 2VB3X 4XQNA 2CJNA 5FJ8G 2KQ4X 1SE2A 2LUMA 1X1MA 1B53A 1YJWA 3HM6X 2K22A 5EPLA 3VR4A 3CD6A 4POFA 1WGDA 1EIFA 3IFDA 2BBCA 4RA8A 3MHSD 3C3LA 1Y1WG 1SB3C 5C4XH 2VUMH 2SNMA 5CYUA 2A6HD 5IGCA 2BH2A 1VS0A 3HOVH 3DWGC 3PGEA 4U673 3BZDB 2K28A 3IKJA 5M5XB 1B8AA 1R4MB 4FULA 5FO7B 3FPUB 3UDGA 5IE8A 1XNRQ 4LUZA 5M3MG 5EDSA 4DV5Q 1STBA 2CVRA 4QCLA 1DOIA 4IWQA 3CCEA 3PPAA 4TQ1A 4GN3B 1VQAA 1Y69U 1PH2A 3QJYA 4UY8C 4B3SL 1KLVA 1LV9A 1CA5A 4DHJB 1PLFA 1J6QA 2LFIA 3GS2A 1C9OA 3PUXA 2BS2B 4HSVA 1GUAB 3Q24A 1RFAA 2KYWA 4KHVA 3R93A 1TWGB 1K50A 3UIPB 3G48A 4W9FA 1PZKD 4NMZA 2WXPA 5IYBG 1YN4A 1GAQB 1PQSA 3CCSA 4HMIA 4DHZE 1OGWA 4LFAQ 4PYUA 1MGSA 3PUYA 3TQYA 2ID0A 4PQXA 4TQUS 1NYQA 3S15B 2ZVNA 1GM5A 4ZYSA 4HPMB 2M2LA 2WB1B 3DBHB 2N1VA 3ONSA 2AMCB 3AE5B 2LSSA 2WWZA 4YWGG 3LWEA 3AEGB 5GAGC 2XTIA 3CCRA 4MJSB 2JA5G 3D31A 4LTUA 4XXEA 1MI0A 2UUBL 1PTOB 1WM3A 1WTWA 4KD4A 4RGMA 2UUAL 2GRIA 1EQTA 3TZUA 2ZCBA 2I2YA 1CT1D 4UHVA 5BR8Q 4HK2A 2F0LA 2LMCA 1M90C 3HOZB 5AZFA 2RCFA 4AWJA 3RNAC 3J7ZC 1ZKOA 3I55A 1TS5A 3MXPA 3V61A 3IVFA 2G3QB 3JC66 1Q7YC 3AE7B 5E1FA 3U7ZA 4R4TA 3AM9A 1GOZA 4MHEA 4NXNQ 4KIKB 3TS2A 3K5LA 2IYDB 2L8JA 3HGBA 4B3RL 1YMHE 4PS7A 3X23A 2RA4A 1W6KA 5IY0A 3J7AF 3AN1A 1K0RA 3PIO3 4FLHA 4HMJA 1K51A 3PGZA 4ZRPA 2F0FA 2NVYH 2MA9B 3JAMc 1EZ8A 3CQZH 4B08A 1WTQA 4A3BG 3HOUB 3W3AA 3Q6BA 2QEJC 4EOYA 1Y14B 4L2YA 4HKQA 3BYYB 1VMPA 5CHFA 3L7ZC 2HDEA 2E76C 2AKWB 2EZVA 3SK4A 2F4VL 2IPKD 3KFUA 1QT9A 3NVZA 3U8ZA 1IKMA 1WE6A 4DR4L 2JUOA 2K03A 1MI2A 2AQ3B 3E9SA 3I4MG 3RLOA 1ZDXA 1VQBA 2OOBB 1FFVA 1T5EA 1DOXA 1EL0A 2PMZE 2L7RA 4S17A 1KL9A 1V6EA 1TZ1A 1QVCA 4RCOA 1FNWA 3HFZB 5E6PA 4E74A 2R92H 1DOLA 4X64L 5HKHA 1R4MI 4ZUJA 1QZGA 1A3TA 3N1XC 1CKNA 3NSWA 4BKSA 2NWGA 2DJGC 4FXDA 2B29A 1WM2A 3IT6B 1Y8PB 1OXVA 2ACZB 1JE4A 4X6AH 3RMKC 5JPNC 3VH3B 3M62B 1EWCA 3DEOA 3J9CA 2UXCQ 3WA0A 2F0NA 1GUSA 1HTPA 2AWNA 1J7BA 4A3FH 3HOUG 3NQIA 1I4HA 1RTOA 4LF8L 3PV1A 3BU2A 3J7A5 1N32L 4DGZA 2DZMA 2X6LA 1G8ZD 1K8RB 4HLEA 1SE4A 1V1OA 1S5DD 2Q5WD 1IL8A 1GO3E 2LEKA 4A93G 1UELA 3KUPA 1JR0D 4IUVA 3TMEA 1HQRD 1QOFA 4R8IA 1S3SG 2E2DC 5JPMC 2N0SB 3TEXA 1B4OA 4RKLA 3STBD 4AP4C 4B0MA 1YJIA 3A7LA 3ITPA 4JBMA 2CR5A 3JSVB 3V3XA 3DWPA 1ILQA 3L0OA 4C3JG 2BS4B 4FN2A 4US9A 1VF7A 1VJKA 2JYEA 3PQIA 5CV6A 3U4ZA 2Q8RE 2PTLA 5IP7H 2I38A 2K5WA 3U9OA 2NPTB 1JB3A 2JA9A 4B3SQ 5T8IA 1H9SB 2BWFA 2O6VA 3EFUA 1C1YB 2XGTA 2FCNA 2RMMA 2FMCA 4YY3L 1F2YA 1V1PA 3PIPA 3S1MB 1I50H 2MP2B 3UI3A 3E9HA 1B70B 2KEEA 3KUZA 5J17A 3HOYH 1PYWD 4BXXH 4MIUA 4JYAQ 4XDXA 2DHZA 1WSPA 4H7BA 2YLMA 3KJOA 1SSNA 2EKEC 3DVGX 4OZCA 5M5YH 1HA5A 1NR2A 3HS0C 3A0JA 4TSSA 2NVTH 3NELA 3J81E 3MFYA 1G291 2BA0A 1EY0A 3J80E 2VQEL 2LGDA 2ZNVC 4JWUC 4WAFA 2PIAA 3VUWA 4NKLA 4OONA 2NBWB 2B39A 5DLQE 4B9WA 4PS3A 1SFOH 5CHWA 1I4PA 3TBLD 1TS4A 1L0WA 2D0PA 1AP0A 1E1TA 1ESFA 2YTXA 1K53A 1SF0A 1B44D 2EYHA 1GHKA 1WI0A 4GNXC 5E6OA 3X3NA 1FFUA 3UDXA 2JXMB 2E2JB 1LQBA 3BVGA 1YNJD 5CC4A 2E75C 3NHEB 4S0RA 4DR4Q 4CJ0B 1NENB 3Q8FA 3MA2B 4MSMB 3GV6A 2MBBB 3MEFA 3AE1B 4IPDA 1QG7A 2V0GA 5JJLA 1SIJA 4PK1A 3K9PB 2DY8A 3GTLB 5GAHC 3BG3A 4QB4A 1F9PA 1XYIA 2ZW1A 3Q3FA 2I5MX 1L4ZB 3LB8C 2RSOA 1BCPC 2L83A 2EJGC 2JSOA 1I35A 2UYZB 2ZXOA 3TP6A 4EGVA 2IO2B 1K0SA 2XIWA 4JV5L 2CW0D 3EQLC 3MHBA 1PVOA 4UPAA 1PDXA 4AH6A 1PRTC 3IAS1 2F0HA 1S72A 4WJQA 1ZXHA 1CKNB 2KO3A 2MW5A 3QC8B 1YHBA 2OXPA 2KANA 2RCNA 3SR6A 2N3SA 3T1HL 1BF4A 1DGSA 1F9SA 2NPTA 1I4RA 2H1EA 4KX6B 4YTNB 4O1NA 1ZPSA 2BDOA 5C0XI 3WAPA 4AQ7A 2KMCA 3J80c 3CWIA 3KF8B 3ULLA 2DBYA 1VQMA 1WX9A 1NMFA 4B9KA 3QR8A 3VDZA 5KIXA 4FF3A 4QAYA 1EZ6A 2DGYA 5IT9c 2FIDA 2JA5B 2YEPB 3GZNB 3UE1A 1KNAA 1F2RC 2PYKA 5TR5A 1JORA 1WR6E 1DM0B 5C0XH 3CC2A 2R93H 2LUEA 3H0GH 1HHVA 3EGRA 1XTDA 1OO9B 3TREA 3I4NG 3KLSA 1NTGA 3KBXA 1HFGA 1GG3A 4WJ3M 1RM6C 1A3UA 1QUQA 3NP8A 1OEYJ 1Z6HA 5DPSA 3AB5A 3NZUA 5M9OA 4GLVB 2FNJB 5CV8A 4IKGA 2L0TA 3SR1A 2LKVA 1LTLA 4JW0A 5CV5A 4DAVA 4MDKE 1VF5C 1BOSA 4E3CA 3CCQA 2LI5A 4KN4C 2LHEA 5FO8B 3PIP3 4KHPL 1HFNA 4MACA 1XWEA 4C3IG 4XE0A 3KYDD 3F2BA 4DNRB 3JW0X 2AX5A 5D3IB 3N9YC 1UZXB 3ECIA 4IC7B 1HXYD 4LJZC 4QIWE 2DZIA 2QDFA 3PRMB 1S5CD 3CPWA 4FF1A 3L2PA 1X9NA 5KNCA 4A3KH 3ZNID 2G9DA 2XK5B 3G6EA 1D5XC 1GNUA 3OPOA 1BVSA 4LF6L 2BYTA 1EF5A 1YN5A 1N8RC 2J0JA 3ZKJC 1RIPA 5GQOA 4DV2Q 1E7UA 1VQOA 3W1SA 4DR5L 3EC8A 3RMHA 3E5SA 3PO2G 3RNUA 1HRJA 3KH0A 3BDCA 1GB1A 2KQ7A 3GZNI 4HSPA 3T1YL 1CA6A 3NBHA 2BYFA 1V2YA 1TWFB 2B2TA 3VR8B 3CW2C 4GKJQ 3VFKA 3CF5A 5C44H 1QF6A 3T8MA 1S40A 4C80A 5A2QL 4OWWB 1FXAA 3SHQA 4OWXB 3PO3B 4GN4B 3DHIC 3ZJYC 2O5JC 2NBUA 4F8CB 1JOOA 4OXPA 4JI5L 4W9LA 4ZOHC 2JP1A 1GHJA 1B3AA 2LXAA 1WTVA 3H6NA 2F0IA 1MSHA 1YEZA 3UDIA 1NEKB 1U4PA 2YYZA 5JJZA 1C76A 1XEEA 3PZDA 1YJ1A 4QF4A 2WKDA 5LMUL 3I8ZA 1L0YB 2O4XA 3UF8A 5C5MA 3TP7A 3K57A 3VH4B 3PMFA 2ZW0A 4XGAB 2B2WC 1UH6A 4A8XC 5CV7A 1Z5SB 2A5UA 4AIMA 1WVLA 4DV1Q 4DFAA 1Q46A 1TY2A 2JEAI 1KRSA 2INCC 4DAPA 5IA7A 4HKZE 1OQRA 1CZWA 2HJ8A 3M3JA 2N9KA 1F9RA 4W9HA 3ZLZA 1V1PB 4OZAA 2JA6H 2WNMA 3SVMA 2B2UC 1TWAB 3PLVA 5C44G 3RZFA 1K83H 5AUKA 1LT6D 2HT1A 4BWGB 2HQLA 2L11A 2ZPNA 2W55A 4ID6A 2XN9C 3QJZA 4IG7B 1BR9A 5I4DA 2IGDA 1STAA 1OXXK 2F0VA 2NYZD 2ZT9C 3AU5A 2NCNA 2HD5B 4NQLB 4FF4A 1BCPB 1WFYA 3E3XA 1Q1OA 2KFKB 1H9KA 1UE5A 4LUVA 5D94A 3KQ4A 5LXIB 4BY7G 2ZVOA 1FRRA 5D3DA 1NI2A 2VUMB 2FCMA 2V4DA 3F1ZA 2PPHA 3M4OH 2A6HC 1XCQL 3A56A 2ZPYA 4NJCA 1T0RC 3AE4B 2KDBA 1P1AA 1F9JA 1N36L 3GTLH 1YX6B 5CORA 2CHWA 2KD0A 3DDCB 4YSZB 4IPCA 1WYGA 2YU9B 1I4XA 4JI3Q 2CHXA 2C9WB 1ZEQX 2G4SA 2LZ6A 4WURA 2A6ED 2JA8H 4YCWA 4NQKE 1YIWA 2KUMA 2M00A 4E71A 4NW2A 4HJKA 4A3JH 4GS3A 2JK8A 1MKHA 5G2NA 3K81C 3J81L 4D2KA 4DR7L 2NVXH 1FL0A 3DQVA 5H92C 2WYQA 1YQBA 4DR1L 4JOIC 4RGTA 2ZTEA 1YHAA 1OQQA 2UU7A 5JAVA 1MJDA 2XBBC 3MHZA 4PYZA 2C60A 2ZJPA 1YOVB 2KAJA 1PH4A 4CDCC 3GTOB 3H3VH 2KZRA 4DWFA 2KHJA 2OQ0A 4J6HA 5IYCG 1SIFA 2EYLA 2GMIC 2KACA 4ACFA 2F0MA 4WRDA 3QO2A 4DV6Q 2K9XA 2E2HH 3H0GB 3S9WA 4NAWB 4W9CA 3BS1A 3F8TA 2Q8TA 1XCTL 2WXFA 1FM0D 1TIID 4JI6Q 1Y1VG 4P7IA 4OGQC 3EVQA 3U30A 5NUCA 3CIRB 4MM3A 2LJ5A 3VR6A 1SNPA 1IKLA 3U9SA 3NOBA 4BY7H 3JSVA 5J2RA 1PRTF 1MHHE 4TKNA 1IYVA 4MGIE 3ZXRA 1QOAA 1LTGD 1E1OA 1MD2D 2PQAB 4ZK9B 1CTMA 4A3MB 2KKCA 2R7FA 4RWSC 4XYOA 2NVYB 2MLBA 2QMTA 1HJPA 3WOFA 5IP9H 3S16B 3VA7A 1EF1A 2EJMA 3TL5A 3S1QH 4RM8A 4AUQC 5C2TB 3VTVA 1EOVA 1VQFA 4KY5A 1SNDA 1IGCA 3HRZC 3EA6A 4KV6A 3URYA 5BMIA 1Z2MA 2R7DA 1SNOA 4JE3B 3KJPA 4RM9A 3NY5A 2G1EA 4EQOA 2JA6G 4W9GA 1FMAD 4XC2A 3C1EA 3S17H 1QNKA 1SMXA 3W1GA 4A3KB 1EWHA 2WU5B 4HROA 1E3PA 1Z47A 1YNJC 2ASQA 3WWVA 5E4XA 2WXIA 2Y5CA 3G7LA 1UGJA 3HK0A 4WAAA 1UEAB 1TTNA 1QWYA 4ZRJA 2MCNB 1TWHB 3ERSX 4R9WA 3PRZA 3FC4A 1U4MA 1OXUA 4PZ7A 1ZP0B 1DGJA 2LFNA 4WJ4A 1V1QA 3I4OA 1SE8A 2F0GA 1G51A 1FD7D 3OJ4B 3SK6A 4A3GB 1J7CA 1EUJA 2RDHA 5HI1A 1PA6A 1TWFH 2WDVB 1C4CA 1VRAB 3GTQH 1U0LA 2IGGA 1VCBA 1EOTA 4QUFA 2WLBA 3AECB 1TXYA 4OW0A 3HKSA 1L2FA 2WDTB 2K1BA 4DBGA 3HOYG 4C1NI 3GTGH 1P16A 2EXDA 1PGAA 3GE3C 3FAHA 4DU9A 1EYDA 4MEMA 1EEFD 2Z6BA 3IT4B 2PW5A 1I6HH 2L4NA 1UE7A 1V80A 4HR7B 3Q3MC 4KKJA 1VZ8A 4G4KA 3A9JA 2KVZA 3DCGA 3CHBD 3BJUA 3RNGC 4KKUA 3V2TA 3A9JB 2QDLA 2MQJA 4IUQA 4BKTA 1XJVA 4IUUA 2L0CA 3AI5A 2K1FA 4IO9A 4EE2A 1KFYB 2SNSA 2D07B 1J8CA 4F7XA 3QHTA 1EFID 1HEZE 2ZJQA 1WFQA 2MHJA 2PQAA 2B63B 2D3CA 3IFTA 5IWAL 5K36G 3PF4A 2CKHB 3VTWA 1KLGD 5E3FA 4G7HC 4Y7NB 1BCPF 4DAYA 1GVPA 1WTHA 3CAMA 3EFXD 4MM3B 4A3KG 1EY9A 3W1BA 1LFDA 1VQDA 4O0AA 4C3HB 2QA4A 4J6IA 1LT3D 1GB4A 3VRBB 1R9TB 3S1RH 1UBQA 1I50B 3I3CA 1X3PA 1TKYA 1PFBA 4M00A 1IYUA 1P9DU 5D14A 1XNQL 1VZ6A 3DVGY 2EOTA 3MXNB 4J8QA 2K50A 2ZTCA 3WIMA 4DR5Q 2MSED 4B3MQ 2L5TA 1F2LA 3K59A 3BZKA 1WX8A 3E0EA 1HTQA 2WDQB 4XDDA 4ZHPA 4RH6A 1PV4A 1J19A 4TRDA 2NMQA 1VD2A 3SK8A 5I2YA 2K8HA 2BA1A 2MJ8A 5BMGA 4YSXB 4QJFA 1BDOA 5FLXE 1NVID 4A3EG 4Z9CB 1JWMD 1GD7A 1R7SA 1HZ9A 3T4AC 4HDOA 3H0GG 4DV4L 4DV6L 3SFEB 3NHHA 3T51B 3K5OA 4JOIA 4ZQ3A 3RNBC 1Q86C 1E7ZA 1C8CA 1RCVD 2JZ3B 1BO0A 5M5WH 1VQ5A 4MTNA 3UI2A 1UE1A 2RQXA 1IBXB 2PI2A 4KJOA 4DXGA 2ENBA 2M0AA 3R8BA 1OFFA 3MXGA 2V3SA 1E24A 1HH2P 1D4BA 1SDFA 5IYDG 2Z4IA 3RN2A 5I2XA 3TEYA 2QCZA 1IHZA 5CHVC 1GUOA 1KNEA 3HOWG 2HD3A 3K0XA 4X64Q 2INNE 4F1SA 2D2CC 1VQNA 3OW2A 2NVQH 3S14B 1FXTB 4EKUA 2BCOA 1LYLA 5BN5A 3O65B 2VZAA 1K52A 4K5XA 1Q3LA 3BDOA 1JT8A 1J7AA 2J42A 2JXXA 3FP9A 3DHQA 4JI4Q 3GE8C 2QEXA 4X3TA 3NS1A 5G3LD 4JI3L 3OWFA 3MWYW 2N7JA 3I63C 4IUTA 1JQ4A 4FADA 1EYGA 2WXQA 2JA5H 4K0KQ 3EN2A 4K3CA 3WAMA 5HY6A 2MWSB 4WJWA 2P5ZX 4CDFC 2W3SA 3FKIB 3VHTC 4NY0A 1GXDC 4K8JA 3IG3A 3STBC 3BY4B 4WIPA 4IDIA 4JPSA 4IPHA 4BY7B 1V5OA 4W9JA 2N8NA 1UE6A 3GDEA 2B8GA 1QOHA 2GVBA 1N36Q 3RZOH 3NWSA 1NAPA 4BA2I 3NTKA 4HIMA 3DBLI 3H1UA 4PMCA 3T1HQ 2PVOD 4A3EH 1XMQQ 2B8FA 2IO1B 1NBFC 4O42A 5GXGB 3D4RA 4A3IB 3RUZA 1D5ZC 1F2MA 3FHWA 3BINA 4JWSC 4KZ0A 5HG2A 5D2MB 5J18A 3DVNV 2SEBD 1BQQT 2WXOA 1WXVA 4XT3B 4B3ML 2M0XA 5C4JB 2PZWA 4N58A 2PO4A 3M4QA 4CDDC 2K5HA 5C4HA 2JN4A 5DM63 4GKJL 1JJGA 2ZZPB 3RNFC 4BZAA 3KOJA 4JI6L 4X3UA 2KWCA 3P75A 2Y5PA 4DQOC 3HOVG 2O6VD 3N20C 3PCOB 5M3MB 3Q8AA 4YSYB 4B95A 2I5LX 3ZTCA 1X3EA 2LD9A 3VAWA 2NBVB 3PSIA 1K3RA 3RPFC 4AQYQ 2B2VA 4HEDA 5EKKA 1LO5D 2KNBA 1Y1WB 1ACCA 1TKEA 4IUNA 1D2BA 4E6IA 4C3JH 2R2OA 2JE6I 5FJ8H 3TJPA 2K6AA 2F4IA 4K5VA 1ONLA 4GIVA 2DNCA 4OO1G 5BYRA 4K7UA 4GOPA 3PUWA 1V9PA 3A8KE 1PZID 3S15H 1T3QA 4JI5Q 2OF1A 2RBMA 2IWHA 3Q23A 5EPKA 3PREA 1ESRA 1EYCA 2IX3A 4LNKA 2N7DA 5C3JB 1CSQA 2ZM6Q 3HKZE 3PO3H 1HUNA 4JCVE 2WXLA 3K5NA 3H7SA 3A33B 1ICFB 3QCAA 4N9PA 2Q2UA 3DVNU 4X66Q 3G4SA 2VH2A 1ZUD2 1EQQA 1MBYA 4B3RQ 5JEAH 1XPOA 3VR5A 4K81A 4BBRG 2V4IB 2RHQB 3HOZH 1BBWA 4PT5A 4KSLC 3AMUA 2D11A 2Z9HA 1SYCA 2D9UA 1D5MC 4BS9A 3CMAA 2NTSA 1A63A 2JT4B 2IGHA 4DV3Q 2AEHA 3VTUA 4ANVA 3QK0A 1EY5A 4XWWA 4C3HH 1K9MC 3RLNA 1RRBA 2WP8J 1FD6A 1GJZA 4MJSA 4DR6Q 1ROEA 1R4PB 2MBHA 2JA6B 2V1CC 5LNK1 2MHVA 3CCUA 4A93B 4MT5A 3TUOA 2VQFQ 4C2MH 5IIFA 1IBLQ 4YL8A 1H9RA 2J0KA 2O2VA 5C23A 2I07B 1UBIA 3NVWA 1S5FD 1SROA 2GVAA 1XNRL 3CF6E 4DNIA 1KTKA 4BY1G 1IZ6A 4LFAL 2BB5A 2KQSA 1TBEA 3KF6A 4A6QA 2B3AA 4K14A 4DDID 2WS3B 4HJGE 5L95C 4FO2A 4EVOA 1Q8IA 2IW3A 2X6GA 1QQRA 1FXIA 3N52A 3HOXG 4P72A 2N1WA 1QCBD 4N9F4 2KJ6A 1Q5WB 2WFWA 1IL2A 2M19A 2UUBQ 1QZEA 3NZSA 4RGNA 2CFMA 1S4ZA 2IJ0A 2N7EA 2L76A 2CQOA 2E2IH 1B50A 4GLSC 3APFA 2RSUA 4KHPQ 2EYJA 3ZJVA 1WOCA 2TSSA 2G9HD 5IT9E 4W9DA 1NUCA 3HG9A 2BS3B 3FKYA 5C3EH 2UU9L 3VVWB 5EPJA 2Y0SG 2ICEC 4UP7A 2JA8B 4A3FB 3W1YA 3QB3A 3HKZG 5IYCH 4JI2L 1IP9A 3EJIA 4NXNL 5KGUA 4DR1Q 5FO9B 1VQ8A 2HCIA 4WWOA 1ML0D 1B3QA 2LRUA 1IBKL 4YCUA 3B6YA 2JQRB 1C4AA 1IBMQ 3W5OA 4GZYC 1N5WA 1Q1BA 2EY2A 4GLAC 4V0BA 3BZCA 3DWAA 4LJOB 2AYOB 2KWDA 1DCZA 2PW7A 4IUPA 3ZO5B 4EFOA 4ZCKA 4ZKCB 3AFPA 2F0KA 4I65A 4CJ2C 1ZYRC 4UP8A 3R2IA 4YTMB 3T53B 5E6JA 1KDBA 2WX0A 5CBEE 4A75A 2JA8G 4P74A 1TU2B 1E10A 2SDFA 2IX0A 3MAQA 3S1MH 2JXTA 5D6JB 2XK5A 3PIOA 1ASYA 1X3GA 1HNZQ 1FRDA 4F7ZA 2W82A 1RJTA 2IHEA 1WGRA 2HTHA 1P7EA 2C5CA 3MC8A 2NN6H 2HJ1A 1S5ED 1SNMA 1XLNA 3F2DA 4LLGM 2MO0A 1MJEA 1EFWA 4A3EB 3OW7A 4GOPC 5DAUA 4FYDA 2NVTB 3E0JA 1YQ3B 1WRIA 2J0MA 4KIKA 3OSOA 1D7QA 2K75A 5FK9C 1SAPA 2BYEA 3A1QB 4OVUA 4GNXB 5CR3A 3S16H 3KBGA 3NQTA 4OVZA 4CDEC 3ND8A 1A2UA 4JC0A 1I5FA 2HUGA 2KLCA 3DLLA 1QLBB 2NR2A 3PRPB 2VL6A 3ZXVA 5IGDA 5ISRA 2E2JH 1WYWB 1BUIC 4ZKBB 1Q1EA 4RNAA 5C3XA 1QUQB 3C2PA 2KTRB 2OEDA 1KOTA 1XX8A 1PTOF 4JBJA 4A3DB 4KDLB 2RD0A 4OIKA 2BOSA 1B9RA 3R66C 4DHZB 3NG0A 1E0ZA 4JQWC 1XO3A 4C3JB 3ML8A 4DR3L 3SGIA 2WKCA 2KHWB 5A35A 2LXCA 4RF1A 3ZTDA 3RFZB 1TWGH 2CH4W 4K2LA 4KY6A 5FKAC 3SHLA 4X65L 4DUYL 2DZKA 4C00A 1EIGA 1U4RA 2KQ3A 2WAQE 1ZDVA 1JQYD 1N32Q 4ULLA 4KK7A 3T16A 3KK7A 3AEVA 3MP9A 4KN7C 2IZVB 5IOCA 3RZDH 1PH3A 4DA2A 4HCSA 2W9NA 1M94A 1EYAA 1XF5L 2ALYB 2ONQA 3AE6B 4PNYA 1L0VB 3GTKB 1QKZA 3AE8B 4M01A 4DR2L 3SD5A 4KTAA 2QJLA 3ZW3A 1BBUA 4N9TA 2KECA 2ZXRA 2R93B 2EYOA 4KV2A 1TKWB 3P4QB 4YWMA 4TMAB 2KWUB 3I90A 3PO2H 2N9PC 4W9IA 1N9WA 3L9AX 1WMHA 1R4NB 1I4QA 1OQYA 1TQOA 2R7ZB 1A3VA 5JH5C 1AN8A 4QL5A 2KFKA 1EU4A 3W5UB 1WE7A 2M56B 4NB3A 3WAOA 3I5JC 1KH0A 1KIXA 1ZXIA 2M8SA 3A1QA 4LFBQ 5E7NA 1FYCA 1PH8A 1DONA 1Z7TA 2Z6KC 3RNEC 1WXMA 2C7MB 2KDMA 2WDRB 1SJED 3TP8A 3J81j 4C3IH 1PH5A 4ZRKA 4MZ9A 1KRHA 2R2QA 2V3NA 1T9HA 2LGIA 4QGUA 2ON8A 3U58A 3MC0B 3APCA 3M63B 3TZDA 4JI1L 4JI4L 3DM3A 3K6OA 3C8YA 3UQBA 4IFDJ 3Q3JA 3A7AB 3D6WA 3J80L 2CU1A 1HTLD 2F52A 1L1OA 4A3CH 2WXGA 4Q0FA 4JI8L 2PNRC 4X66L 3VR2A 1G2TA 5C0XJ 5KHOA 2G5DA 3CC4A 3I4NB 1ISNA 2RDBC 5EE9A 2KWVB 5LHY1 4L6TB 1DXMA 1FNVA 1HTOA 1N60A 3Q14C 3ZDTA 3U2SC 1JMLA 4K1RB 3KVFB 2HDLA 2JY6A 3CP0A 3ZYYX 4X62L 4OL7A 5C0XG 2FIFA 3NTIA 1YJ9A 4Q2JA 4IM2A 1EY6A 4UAIA 2K7VA 3QOJA 2ATWA 1G6PA 3KDFB 1VDVA 2BT6A 1WD1A 1HZ6A 4X65Q 1JB7A 2JRHA 1KJTA 3P63A 3NBHB 3AU4A 1NBWA 1UWVA 2RDFA 3VXWA 3U50C 2PLPA 5ELDA 2B2YC 4A3GG 1WZ3A 3L08A 3KLRA 4GOPB 4ANWA 1T0QC 1IBKQ 5JEAG 2NZHA 4LW1A 3NS8A 1L6VA 1GUNA 1N34L 1RAXA 2QCPX 1ENAA 5FLMG 4CKCA 3SE0A 5J3BA 4JI2Q 1S3OA 3CKIB 4G7ZC 4M02A 2GBRA 5G5GA 3HZXA 2UXCL 1FO4A 1IBLL 1E9MA 1K83B 3HUIA 3FKIH 1PGXA 3DXJC 1HUMA 2K5DA 2AQ2B 2M9VA 1LT5D 1AE3A 2FUG1 1SNCA 4DR6L 1U4AA 2KXJA 4AJYB 2L05A 3FRPB 3QARA 4UDUC 2EY6A 5AJ3L 5I9PA 3K8AA 5IWAQ 2BGFA 1CHPD 3VYTA 5C1ZA 4A3IH 1SXTA 2F0QA 1UF0A 4L1BA 3OJ3A 1C79A 1UEBA 2DX5B 2F0EA 2D2QA 2GBKA 1HZ5A 2FUHB 1AH9A 1I7HA 5CMDA 3BWUD 1SFOB 1DOYA 3FPPA 3SFDB 5C4JH 3RUIB 3L13A 2INPE 4POGA 2F0PA 2LVOA 2RF4A 4AQYL 3I3TB 1NSNS 2HCCA 4HJ8A 3S2HH 2QHOA 3I9V1 4FNFA 1B9NA 4L5QA 5H8YE 4DXAB 5IGFA 1YZ6A 3J81i 2UU9Q 4W9KA 4KD3A 4QIWB 5M3MH 3OLMD 1G6ZA 1V8QA 4TVAB 1A5RA 4LFCL 4OX9Q 3UDFA 3T9LA 3CCJA 2WX1A 1Y1WH 1I94Q 4WQOB 4CHKA 3L16A 1HNWL 1GKHA 3O13A 2N78A 4LUOA 3LWUA 1E90A 1GC6A 2EKIA 3IAM1 2EPBA 2JWZA 4TV3A 2RPQA 2K39A 4G11A 1KABA 5DM73 3A8JE 1EY8A 3A8IE 2VZKB 4AS1A 4J1MA 3QAQA 2J52A 1WD0A 1OTRB 4K7WA 3H7PA 1KM7A 2B3GA 1FVIA 5A2QE 1T6BX 4XZ4A 2AQ1B 1X54A 3D0FA 1V5TA 3Q0AA 1BXTA 2O6VB 3MFGA 2VS1A 4B0EA 4MTKA 1WJ6A 3SU8X 1WYDA 4JBWA 1P3QU 2QF7A 3AULA 1LTID 2GLSA 3AV8A 2GBJA 4DN4M 2PMZB 1SE9A 3ER0A 4DV3L 2D62A 1GJXA 2UWQA 1Y8OB 3Q8BA 1C3TA 1E2ZA 1AFPA 2VZKD 4TUUA 3NUHB 4DV0L 4L5RC 4YT0B 1O7IA 2KCTA 3LXFA 2KBNA 4H0LC 1RKNA 4JVZA 4A4IA 1IUEA 1DYQA 3Q3NC 3K0YA 4P2CB 1EUVB 3KLWA 3ZGZA 2WV6D 3EIVA 1D1KA 4MGKE 2F0TA 3ZVVA 5FLXL 1EIHA 2XRQD 3L4PA 4GLXA 1R4QB 3GD7A 2EY1A 2L12A 2Q2IA 4DR3Q 3I4MH 1L1OB 4DK3C 1HCZA 1MFWA 4GOCA 2KA7A 3SDZA 1X3QA 1KF6B 2VY3A 4BY1B 2K32A 4IWPA 1MVKA 2VRRB 4NJ6A 1C78A 1WI5A 2GBMA 2CU3A 3MC9A 4MELA 1C9FA 2BDNA 2F3WA 5KRUA 2L52A 2HIXA 4XX5A 1EO6A 3GTJH 4A3BH 2K52A 1WY8A 4OWTB 4Q5VA 2YTYA 4C3HG 5ELEA 1RODA 4HVBA 1CQFA 3MVVA 1CM9A 1YX5B 2ES2A 4AOFA 1EEID 3LYYA 1E22A 4HAEA 3A74A 5EQ0A 4DK0A 4ZRQA 1F2ZA 1WTOA 4ME3A 2CWPA 1CZGA 3MTNB 1Q90A 3SXHA 3HOZG 3VYSA 4LF7L 3GTQB 2OT2A 2K3UA 5AZHA 3OYYA 1NNXA 3E9IA 5CX3A 2Z1CA 1EIYB 1BMLC 4EZKA 2I1KA 5FLXc 1HQMC 1B9MA 1JJ2A 2AHOB 1CI3M 1WRDB 2WAQB 1D6EC 1VQLA 3G6JB 3R3OA 4HJAA 2WQYB 2F03A 3PUVA 5JVH3 3ZJUA 1FNUA 4EX5A 2LXJA 5BN4A 1Q82C 2CKZB 5AZGA 2WXMA 5JHBA 1IYJB 4YWLA 3T3OA 4XWTA 2QGQA 3TDQA 3WCQA 1YNXA 4ZRZA 4DR2Q 1WJ4A 5HHDG 2LMCB 4LF9L 4RFBA 2LGSA 3EHVA 4Y7NH 5I6WA 4HN7A 4JI1Q 1FCLA 3RI7C 5AFWA 4DPGA 3L0WB 2SAKA 4GDLB 5IN7A 5CV9A 3PT2B 3S1RB 1CUKA 2F0DA 3V96A 4DV5L 4MN3A 3VYRA 2W54A 1X56A 3H6MA 4ABNA 4BVUC 1LXDA 2H4OA 2D0OA 3EROA 3OTOQ 5IODA 2EYPA 2FCSA 2FHTA 1WGKA 3VR9B 4GMVA 5CGKA 4GGQA 2MUYA 3FVQA 4DKAC 3TS0A 1EU3A 1X55A 4JGHB 5E4WC 1LTRD 2VB2X 4DHJD 4IFDI 4OHJA 2VH1A 4C1NK 3AXCA 4KDIC 2L0FA 2VUMG 3IAYA 4HCNB 2KLGA 4JI0L 3RCZA 5H1SE 4CKBA 2LWPA 4QQBX 2C5LC 4XTCS 3HOVB 3GB1A 4A3IG 4OIJA 4U68A 3CCLA 2IDYA 1AARA 4NZLB 4RCNA 5BO4B 2JZZA 5JHAA 3P4SB 2B2YA 3WANA 2VQFL 3HRDD 3W2DA 1SGHA 3I91A 4A3DH 3CRLC 1K8GA 4FVMA 3IL8A 2BQQA 1C7YA 1L6UA 5ELCA 1LACA 4IWOA 2OQKA 2QILA 2A69C 4BBSB 1VQPA 1Q10A 2K0PA 2YU9H 1F1HA 4G0NB 3NVYA 3GV3A 1DZ1A 1WIAA 2MX2A 1ASZA 2C7NB 2OCEA 4KSKC 2C9OA 4H2AA 1NDDA 2M4NA 1A0IA 2H89B 5EE1A 1K28A 1PH6A 4M8AA 1IPGA 3I56A 1V81A 4A3JB 1Y56A 1QVGA 5M3FH 4A3PA 3D3RA 3CMEA 3S14H 1PH9A 4K0KL 1K8OA 4KGSA 2PCFB 3ONAB 2NN6G 4CYEA 4IM0A 3ZNZB 4CBVA 1L4DB 4RG1A 1CFMA 3A5UA 5C5LA 1B2TA 1STGA 3CCVA 1O78A 3P4RB 2WINB 2MNAA 1VLBA 4I6PA 3U7DA 5BYSA 1SMYD 2WB1E 4DUZL 5KNBA 3SK5A 2NVUI 2CW0C 1A8VA 5HURA 4WJPA 1DOKA 3MEHA 4DXFA 4WJNA 3H94A 3DEPA 4FBJB 1MHWC 4BBNF 1N33Q 2L00B 5KYIA 3QIJA 1STHA 3PTFC 3F2UA 3PUZA 3M7GA 4HIDA 4MH0E 2TMPA 2EIFA 1HZCA 4DUYQ 4BFRA 1BKBA 1II3A 5I6YA 3PHXB 1IXRA 1TWCB 3RZOB 2GBNA 4A3JG 4M8NA 3BYTB 3DBRB 1C0AA 4LDTB 3HKZB 4DV0Q 4A3CG 1XNQQ 2E5LL 2JPHA 2AL3A 3KDFA 1QB5D 1XXGA 5J22A 3DMUA 2KENA 1J5EL 1GC7A 1JW9D 2D10A 3AFQA 2PVGC 3T3NA 2UXDL 3TN2A 2PPBC 4NP5A 4TQ0A 4C3IB 2H88B 1H9JA 2ZCCA 4B9XA 5C3WA 2MPMA 2EMSA 1WGGA 3HVDA 1U4LA 2JEBI 1K3BC 3T1YQ 1Q0WB 4MNOA 1STEA 4YHHL 5JXVA 2JZPA 3NTHA 1V43A 2IY1B 2ZJDA 3ULPA 4LDTD 2W3RA 2AUJD 1PRTB 3B1LX 3H7PB 2OEOA 1YNNC 1C77A 5CTRC 4DV4Q 4CKEA 5JZEB 1I42A 5GMVA 2BW2A 3QWNA 1CQVA 3K7AB 3DBLB 4NDXA 1XPRA 1V9JA 3AEDB 3VQIA 5ELBA 1AE2A 4I7ZC 1KXLA 2FMMA 2MJDA 2DAFA 1XLPA 1GUTA 2PKOA 5LXHA 2SOBA 2JVCA 1A15A 3BVZA 5IGBA 1F0ZA 5E6NA 2MRPA 1RL2A 1EQVA 3M4YA 3GOEA 3R3MA 1IBXA 4XQJA 1L7YA 3GTGB 2MJEA 4JYAL 1E8WA 2EYMA 4X3KA 4ZDVA 2WIIB 3PLUA 1LM8B 4A3LG 4ICUA 2PJHA 1QJOA 2XWJB 3PO0A 1RTNA 1JICA 1XMQL 3DPDA 4RMFA 3H9DA 3M3YB 2WB1G 1QE6A 1E8YA 4EQPA 4IUMB 4ZAIA 1TVXA 2ICIA 2LXKA 5FOBB 1V49A 1PH1A 4P75A 4LNNA 2A4ZA 3WOEA 4IALA 1YITA 2QIEB 3UE0A 4KJNA 2K01A 4OZBA 5K5PA 3ZUNA 5IOIA 4KKIA 2F0UA 1AZQA 1MPEA 1YD8U 1RWSA 3VUXA 4B3TL 3D4WA 3M85A 4BBNC 2CH4A 4K3BA 4R4IA 1M1KC 3OHXC 2OJRA 3FILA 5LMNW 1EWYC 3TIXA 4ARCA 4LF5L 1GPXA 3RULA 4GDKA 3A9KB 2WAQG 2Y5BB 2VXWA 1CK1A 4L5TA 4IZ8A 4IURA 4PV1C 1R9TH 5DPRA 5BYQA 1KAWA 1JWUD 1STNA 2Q2HA 2L3ZA 3NPPA 1SYGA 1KHIA 3CSFA 2K5QA 4C2MB 1PFMA 4KY7A 4DK1A 1JROA 4GU2A 3PZ7A 1FCCC 2FXQA 4DK6C 1I3QH 1H9MA 2N9LA 3BK1A 2L55A 3JAME 2WU2B 3CRKC 1CKOA 1ZYRD 1DD2A 4I6LB 1YJJA 4APVA 2ZXPA 5HGQA 2EJFC 3AE3B 2VW9A 2J53A 1PFSA 1SJHD 1MHXA 4WFN3 3S2DH 4F87A 3ZRFA 2PW9A 3UIOB 3V6EB 4A76A 2PZUA 1WJUA 1EY4A 4DUZQ 2ZJRA 3DHHC 1IW7D 1HR0Q 1CMXB 1D8LA 2DN8A 1DOMA 3EFCA 5AUIA 3OTOL 2A8VA 3S2HB 3PS6A 2EYFA 4Y52H 4HPLB 3W5VB 3MJ5A 2R3ZA 3KYHC 4CGYB 2KTFA 1G6JA 4YTPB 5JVG3 5EBDA 4P71A 1LGRA 4LNFA 2ZM6L 2IHFA 2KCNA 1QVFA 1AW7A 2RKSA 1SR3A 3TBIB 5KYLA 3KUDB 2R61A 2C35B 5EAYA 4LF4Q 3KF8A 2KVRA 1WWTA 2K04A 2PMVA 2OWOA 2RR9A 2DNEA 1SN8A 4US8A 3ULJA 1PZJD 1QOGA 1I6VC 1NCVA 3R7RA 2LVQA 1MG4A 2I46A 1PFNA 3J7YW 3DOWA 1XMOQ 5IGGA 4LK0M 3PVLA 3P1HA 5DPTA 4QMGA 1TZOA 1U5KA 2DYBA 4P1CC 3GTPH 4KGTA 2JU6X 2JWUA 1ZXTA 4KKTA 1PTOH 2BTEA 2JSVX 1QZHA 2CQAA 1BUVT 2O2LD 2Q2TA 5CV4A 1XLQA 2HTME 3FEWX 1RHPA 2PE6B 4CQNA 2K25A 3LX0A 1B1ZA 1J8IA 2N9XA 3EUB2 3U4VA 3NENA 4N8FA 4QUCA 2FAZA 2J7QB 4IFDG 3RLFA 2L15A 1TJEA 3Q8DA 2GI9A 4GDLA 4DK5A 5LMNL 4LWCA 2LGYA 3IRBA 5DPWA 2F0JA 4DAYB 2A19A 4ODGA 2K14A 2MGSA 4JBKA 1TGZB 4FXGC 1JJCB 3S2AA 1BBXC 1KC8C 3HOWH 4NPSA 1JC7A 3AYHB 4HWIB 2DY7A 1GUGA 4IN3A 5EE3A 1VQ6A 2IX1A 3OAWA 5IYDH 2O5IC 4R8NA 2VNUD 3I4MB 5JOBA 3BDLA 1VQJA 2Y0SB 3H15A 4R4OA 2UUCQ 2PE9A 3APDA 3QX1A 4JL9A 2BYVE 4P1BC 4BBSG 4XDCA 4BY1H 2PEAA 1C4QA 4MSQB 4ILWA 2HQEA 4ICVA 4AJWA 3NXWA 2A6EC 1ET9A 2JYOA 5T1IA 1FJGL 1LABA 1YI2A 3L54A 3QG1A 2V3PA 4DV7L 4CHTB 1DJRD 1FR3A 2FINB 4YCVA 2MBQA 4A3OA 2XWBB 1LUZA 2GB1A 2PNHA 4L23A 3A4SC 3K7AH 4LNOA 1J9OA 5ELFA 4YHHQ 4F8MA 3HEJA 1ENFA 3N30A 1JRUA 2A68D 2BE5D 1WCMB 4II2B 4ZHOA 1YIJA 1E2WA 3WDNA 2Z0EB 2PQEA 2IBIB 3RNCC 1X32A 3ABVB 2L9HA 3KW5B 5BR8L 2D5GA 2CHZA 1VQHA 1PYSB 4LNIA 2XSCA 2XEWA 3I7FA 1HNZL 2Y0SE 2FJ2A 4LF4L 4GXBA 4R1JA 4K5WA 3M4PA 4FA6A 1VCIA 3J80i 2RHSB 3V62A 2K5NA 1AZPA 2UXBQ 1EQRA 4YIJA 3GTKH 3B08A 3H91A 3PO3G 4REZA 1PH7A 4HXDA 4RKBA 4TKOB 2R7ZG 5LMUQ 3TP5A 2K05A 4KGRA 5G55A 4IJHA 4JX1C 2RVLA 2K8CA 2NN6I 1WTXA 5KNDA 3M7NA 2BF8B 4BOZB 3B2GA 3RYTA 3BVMA 3IHPC 2WXNA 1NI3A 3PO2B 4EQ5A 1UUPA 1N62A 4C4VB 4OEMB 1ILPA 3ZNGC 3P4PB 3H3VI 2C7HA 5LL6X 3DWMA 4JV5Q 2R7ZH 3NBIA 3AQQA 1T0SC 3AEEB 1TWAH 3CU7A 3KF6B 1ZW7A 1CZPA 4RGOS 3X3MA 2IY5B 1YN3A 4A3FG 2KMAA 2Z59B 4K8IA 1TKGA 1PUTA 2BPSA 4CO7A 3E56A 1KAAA 1HPCA 5EBCA 4OO1I 1KDCA 3AMZA 2RDGA 1Q12A 2BKRB 4ASWC 2V9HA 1ET6A 4PG3A 5TSSA 4IOAA 4EZJA 2AUKA 2CS4A 1N34Q 1XD3B 2KJRA 2BH8A 1QNUA 3VA5A 2NB0A 2DAJA 1JOQA 1P98A 1S5BD 1N5XA 2KVMA 3S2DB 1OTCA 2AWTA 4LMQD 2MP2A 5COYA 3K7UC 3AEBB 4LJPB 4PS8A 5J1ZA 1JMCA 2IY0B 3DBSA 2NZOA 1WR1A 3AB9A 3M4OB 3I4NH 3KYCD 1OXTA 1UAPA 2KN5A 1P7FA 3C0RB 1WX7A 4A3MG 2KOXA 3D32A 4FHJA 2F3VA 1YHQA 1OXSC 1NJIC 4FXCA 1UNSA 1NYRA 3I73A 2DLBA 1YNND 2E74C 2X69A 4UP9A 2F3IA 5IO9A 4GN5A 1JRPA 4KMUC 1Z9FA 3R2TA 5EKLA 4JPBW 5LMNQ 2ASBA 3NE5B 2FCQA 3P1MA 4ALPA 4BBSH 4RF0A 3ML9A 3MTSA 1MJCA 2RSNA 5I9OA 4ANUA 1N63A 4BOSC 3DM1A 1FJGQ 2MEKA 3W1SC 2QW7A 4FDBA 4O2DA 3NWTA 3AEFB 2AWOA 5M3FG 3B9JA 4F88A 1VR9A 3GO5A 5L37A 1E8XA 1HE8A 2RPVA 3HIZA 4G3XB 2FBWB 2EXZA 5MPOA 1SLJA 4A55A 1CSPA 2OTLA 4KVGB 1HNXL 2GOWA 1Y1VH 4BBRB 1WF9A 1TY0A 4LF6Q 1LTTD 1G91A 3B0AA 2REXA 4DV7Q 1UWMA 2MFIA 4JLCA 4MGYE 3EBEA 1XQQA 4EEWA 4JI7Q 4LCDE 2E2HB 1SMYC 4DV1L 1F52A 4ME5A 3Q22A 1LTAD 5HGTA 4B3TQ 1A62A 5DEHA 4KHZA 4NXMQ 3D8GA 4XQQA 2UUCL 2FE8A 1I4GA 1AYFA 3IBEA 1UD7A 2Y3AA 2F0WA 5JJIA 3GTMB 3NEMA 1IGDA 1TWCH 5ELOA 1H8CA 2PI2E 4A3MH 3HOWB 4EUTA 3F2CA 4GKKQ 4GSWA 1NE3A 2MBOA 2KTRA 3ETRA 4DAMA 4K6LA 3P42A 1PFDA 2DENB 1O7ZA 3VUYA 1F77A 2N9EB 5EKIA 2A74C 1D1IA 1MSGA 5G3LF 3RN5A 4RMAA 3A5ZB 5J39A 1PRTD 2BVCA 5G5HA 5IAAC 2RGFA 1E0BA 3PF5A 3C46A 3S1NB 5M5XH 2BB6A 2JRIB 2KJHB 2N55A 3HVZA 3S17B 4HEA1 3OMGA 2D3AA 4WORA 1XTCD 3AEAB 4HJ5A 3VRAB 4MGZE 4PZ6A 4X62Q 5LL6S 1PTOD 3JYUA 2J7ZA 3NRZA 3TCAA 5IP4D 1M4VA 4S3SA 2A73B 4JK1C 1JWAD 3C19A 2MO1A 2DNFA 4K7SA 4ZRIA 3W9CB 3FMCA 4FJYA 4IPGA 1SEBD 2V1YA 3ZIMA 1UGMA 2N4FA 3A9KA 2OHFA 5AEKB 1LT4D 4AYBE 4DR7Q 2JJQA 4PZ8A 1H95A 4K6DA 2WHIA 2J0TD 5BN3A 1KQSA 1CJEA 5K36H 3Q2AC 1NR4A 3QOLA 1TR5A 1T5XD 2LS01 4I6NB 3FKIG 2IO0B 2DZJA 3QWZB 4USAA 1B7YB 4L8JA 1I6HB 1HZAA 1V8CA 4DDGD 1VZ7A 4YXDB 2KHIA 4J3OD 2JF5A 5D65A 3BIID 3N1ZC 4WWNA 3K5MA 3RZDB 3PZ8A 2KC2A 3NUCA 2LY7A 4XT1B 3UGBB 5EE0A 2K5VA 4XYCA 4P73A 3M3YH 2KDIA 4KLKA 2KK8A 4BKSD 5GADC 3CCMA 1HR0L 1WH3A 4N8X1 5T1GA 2G45B 3M95A 2B63H 1EM7A 4BAXA 4XIGS 2R92G 3MJWA 2LGXA 1JE5A 3DWQA 3JAML 3K9OB 3Q3OC 3UQAA 4LF5Q 2A68C 2BE5C 3G71A 5AJ3Q 4C7ZA 3N6RA 1IBML 2CWAA 3V05A 1WJNA 1SSOA 2NS5A 3AE2B 4P6VF 2F0OA 4J15A 4R4CA 2KOLA 4A3LH 1YBYA 3CQZB 3JAMi 5C6AA 2YV5A 2NTTA 3J7AV 4GB9A 4JI7L 1MG8A 1EWIA 2WACA 4L5SA 3NVVA 1H9SA 3D4DA 3L3OC 2K6QA 4II3B 4NNJB 3V6CB 4DV2L 2ZTDA 5GROA 2KX3A 2HIVA 1W6JA 2KJXA 1W2BA 2BKFA 4IM3A 4HTHA 3AH7A 3X0WA 1STYA 2IT1A 5EGTA 1VMCA 3GTJB 4A3BB 4LF7Q 2AL6A 1JOKA 2I0QA 5IP9G 3VR3A 1SRUA 3OWEB 2K5PA 1FEHA 4HDQA 3HOXB 3KUCB 1QOBA 5BMHA 2GN5A 3KWLA 3K58A 1O7YA 1J5EQ 1HNWQ 2QC8A 3QIAA 1WGYA 4HJ7A 1WMHB 2KT7A 4A20A 5M5WB 4DNTB 4G7OC 1TYGB 4HIOA 2QDBA 4OELB 4HIKA 3I2ZA 2CCZA 4IFDH 5JJKA 3ENEA 1SNQA 1A6XA 4HCPB 4ANXA 2KDFB 1M8AA 2F4VQ 2XRSD 1PHJA 2MP1A 1FGUA 1KD1C 2QSDA 3JVZX 3P2BA 3TMPB 1VQ9A 1T0YA 4LAAA 2CJOA 3LJ3A 3RD2A 5D7GA 4H44C 1E2VA 1U9RA 2HE7A 3TEHB 1RD9D 4GNXA 1VQCA 3Q8CA 3ALBA 4WQMA 1SBBB 2NVXB 1O80A 2F1MA 3A4RA 4HJ9A 2K8BA 4HRSA 5FR3A 3I57A 4JI8Q 2B2TC 1Y1VB 4FP5D 3H09A 4N6EB 3RZWC 5IYBH 1L1OC 1VQ4A 4IW0A 3WALA 2B2UA 3GTPB 4X57B 4HPPA 4V190 1KDAA 2R93G 2BWES 3GTOH 5C4ZA 2LRWA 2NBFA 2D3GA 1GUWA 3L17A 3V60A 3LGJA
chains in the Genus database with same CATH topology
1SYEA 3HOYB 1ICWA 1JWBD 1TS3A 5F2DA 1ZOYB 4MH8A 3T13A 2NUCA 3TEWA 3ERQA 2B2WA 2MH7A 5M5YB 3BK2A 2EY5A 2LHDA 1RF2D 3KLSX 1LLRD 4FXKC 1K8MA 4H13C 1Y8NB 1VDZA 2L1BA 3S1QB 2D5DA 2GA4B 1L0XB 2KEDA 5C4XB 1FGBD 3NZ3A 2IL8A 5DNFA 3T56B 4KKSA 1PTOC 3MZ5A 2DYMA 1AEXA 2PZTA 3OIQA 1PDQA 2MJ3A 2XVSA 1BCPD 2EVBA 3ZQ4A 3I70A 4ITKA 1SYFA 2DYOA 2JX5A 2WXHA 4PMWA 3PV0A 3GQBA 2XNAC 3LNNA 4ZLTF 2JYTA 3Q8EA 5HFYA 3SEBA 1BNZA 2Z4HA 4P16A 1IW7C 3NK9A 2FFKB 1F9QA 1HA6A 4RAUC 2HDMA 2Q8IB 5M3FB 1WTPA 4M1UB 1A70A 4IQZA 1QILA 1RFKA 3A55A 1ZE3D 2A5HA 4HCEA 3OIPA 3MXUA 4PMBA 3E6ZX 3FDTA 4ARIA 1SE3A 2LJIA 3U4EG 4A9AA 5KEEA 3ZJTA 2DWQA 1AWDA 1SYDA 1SYBA 5IGEA 2A69D 3OMCA 3A54A 2B76B 1E6EB 1G2SA 2CHBD 4KI0A 2NZ1D 3P7JA 2KCCA 4C56C 1L5PA 1KLUD 2K33A 4BA1I 4EQNA 4LK1C 2E3TA 4A90A 1WTRA 1JALA 4C7YA 2N88A 2B2VC 2WP9B 3H3VC 4M0WA 1TS2A 3HP3A 1JWSD 1F2RI 1UWXA 1XLOA 4X3SA 1ENCA 3RD4A 4R3DA 4RHRA 2J4XA 1N61A 2KMMA 3GP7A 2EDGA 3AU7A 2L1AA 3FILB 3U52E 1WXQA 2WXKA 3MXNA 1FIQA 3OOCA 4L63B 1RYJA 1JCKB 3TSSA 2E6XA 4WH4A 2E2IB 3B2FA 2R92B 2F0SA 5CBAE 1PGBA 3I72A 1O7LA 5C3EB 4FF2A 1A2TA 2EE1A 3I4LA 4AYBB 1LTSD 3ND9A 4XYQA 3C1FA 5C44B 5EJWA 1C48A 1E7PB 2YEPF 2L32A 3Q6SA 3KWVA 2R6GA 4IOIE 2WXRA 3AE9B 2Z8LA 1YQ4B 3D6CA 3Q69A 4ZUIA 2WXJA 4NAMA 1LTBD 2NVQB 1EY7A 4CJ1B 1RDPD 3TEZA 2KHSA 4N59A 1TT2A 5IT9L 2KN4A 2QKIC 1V97A 4G57A 3DUZA 4DF7A 2X38A 4K2KA 3H8HA 2EELA 1YNTE 4WWMA 5JEAJ 3VYUA 3P20A 2JA7B 1PMRA 3IXSA 1I3QB 1PXUA 4RHSA 1C4PA 4OO1H 1CHQD 4GDKB 2VB3X 4XQNA 2CJNA 2LUMA 2KQ4X 1SE2A 1B53A 2K22A 5EPLA 3VR4A 3IFDA 2BBCA 4RA8A 3C3LA 1SB3C 2SNMA 5CYUA 2A6HD 5IGCA 3DWGC 4U673 3BZDB 2K28A 3IKJA 5M5XB 5FO7B 3FPUB 4QCLA 1STBA 2CVRA 1DOIA 4TQ1A 1Y69U 3QJYA 1LV9A 1CA5A 1PLFA 2LFIA 3GS2A 2BS2B 3PUXA 4HSVA 3Q24A 4KHVA 3R93A 1TWGB 1K50A 1PZKD 4NMZA 2WXPA 1YN4A 1GAQB 4HMIA 1MGSA 3PUYA 2ID0A 4PQXA 4TQUS 1NYQA 3S15B 4ZYSA 2M2LA 2WB1B 3AE5B 4YWGG 3LWEA 3AEGB 3D31A 4LTUA 4XXEA 1MI0A 1PTOB 1WTWA 4KD4A 4RGMA 2GRIA 1EQTA 3TZUA 2I2YA 1CT1D 2F0LA 2LMCA 3HOZB 1ZKOA 1TS5A 3MXPA 3AE7B 5E1FA 3U7ZA 3AM9A 1GOZA 4MHEA 3K5LA 3HGBA 1YMHE 2RA4A 1W6KA 3J7AF 3AN1A 3PIO3 4HMJA 1K51A 4ZRPA 2F0FA 1EZ8A 4B08A 1WTQA 3HOUB 3W3AA 2QEJC 4L2YA 4HKQA 3BYYB 1VMPA 3L7ZC 2HDEA 2E76C 2EZVA 3SK4A 2IPKD 1QT9A 3NVZA 1IKMA 2K03A 1MI2A 2AQ3B 3E9SA 1ZDXA 1FFVA 1T5EA 1DOXA 1EL0A 4RCOA 1FNWA 1DOLA 4ZUJA 1A3TA 3NSWA 2NWGA 4FXDA 3IT6B 1Y8PB 1OXVA 2ACZB 1JE4A 5JPNC 1EWCA 3DEOA 3J9CA 2F0NA 1GUSA 1HTPA 2AWNA 1J7BA 3NQIA 1I4HA 1RTOA 4DGZA 2X6LA 1G8ZD 1SE4A 1V1OA 1S5DD 2Q5WD 1IL8A 2LEKA 3KUPA 1JR0D 4IUVA 3TMEA 1HQRD 1QOFA 4R8IA 2N0SB 2E2DC 5JPMC 3TEXA 1B4OA 4RKLA 4B0MA 1YJIA 3A7LA 3ITPA 3V3XA 3DWPA 1ILQA 4C3JG 2BS4B 4US9A 1VF7A 1VJKA 2JYEA 5CV6A 2Q8RE 2PTLA 2I38A 2K5WA 3U9OA 1JB3A 5T8IA 1H9SB 2RMMA 2FMCA 3UI3A 1F2YA 1V1PA 3S1MB 2KEEA 1PYWD 4MIUA 4XDXA 1WSPA 4H7BA 1SSNA 4OZCA 1HA5A 1NR2A 3HS0C 4TSSA 3J81E 3MFYA 1G291 2BA0A 1EY0A 3J80E 4JWUC 4WAFA 2PIAA 4NKLA 2B39A 4B9WA 1I4PA 1TS4A 1AP0A 1ESFA 1K53A 1SF0A 1B44D 2EYHA 1GHKA 3X3NA 1FFUA 2E2JB 2JXMB 3BVGA 1YNJD 5CC4A 2E75C 4CJ0B 1NENB 3Q8FA 3MA2B 3GV6A 3AE1B 1QG7A 2V0GA 1SIJA 2DY8A 3GTLB 2ZW1A 3BG3A 4QB4A 1F9PA 1XYIA 1L4ZB 3LB8C 2RSOA 1BCPC 2L83A 2EJGC 2JSOA 2ZXOA 3TP6A 4EGVA 2XIWA 2CW0D 3EQLC 3MHBA 1PDXA 3IAS1 1PRTC 2F0HA 1ZXHA 2OXPA 3SR6A 1BF4A 1F9SA 1I4RA 2H1EA 4KX6B 4YTNB 4O1NA 1ZPSA 2BDOA 5C0XI 4AQ7A 3CWIA 2DBYA 5KIXA 4FF3A 1EZ6A 2YEPB 2JA5B 1KNAA 1F2RC 2PYKA 1JORA 1DM0B 5C0XH 1HHVA 3EGRA 1OO9B 3KLSA 3KBXA 1RM6C 1HFGA 1A3UA 3NP8A 1Z6HA 3AB5A 5M9OA 4IKGA 5CV8A 3SR1A 2LKVA 5CV5A 4DAVA 1VF5C 1BOSA 4KN4C 2LHEA 5FO8B 3PIP3 1HFNA 1XWEA 4C3IG 4XE0A 4DNRB 2AX5A 5D3IB 3N9YC 1HXYD 4LJZC 1S5CD 4FF1A 5KNCA 2G9DA 1D5XC 3OPOA 2BYTA 1YN5A 3W1SA 3RMHA 3E5SA 1HRJA 3BDCA 1GB1A 4HSPA 1CA6A 3VR8B 3NBHA 1TWFB 2B2TA 1QF6A 4C80A 5A2QL 1FXAA 3PO3B 2O5JC 1JOOA 4ZOHC 2JP1A 1GHJA 1B3AA 1WTVA 2F0IA 1MSHA 1NEKB 1U4PA 2YYZA 5JJZA 1C76A 1XEEA 4QF4A 2WKDA 3I8ZA 1L0YB 2O4XA 5C5MA 3TP7A 3K57A 3PMFA 2ZW0A 2B2WC 4A8XC 5CV7A 1WVLA 4DFAA 1TY2A 2JEAI 4DAPA 4HKZE 1OQRA 1CZWA 2N9KA 1F9RA 1V1PB 4OZAA 2WNMA 3SVMA 2B2UC 1TWAB 5AUKA 1LT6D 4BWGB 2L11A 2W55A 4ID6A 2XN9C 1BR9A 5I4DA 2IGDA 1STAA 1OXXK 2F0VA 2NYZD 2ZT9C 4FF4A 1BCPB 1H9KA 3KQ4A 1FRRA 5D3DA 2VUMB 2V4DA 4NJCA 2A6HC 1XCQL 3A56A 3AE4B 5CORA 4YSZB 1WYGA 2YU9B 1I4XA 1ZEQX 4WURA 2A6ED 2KUMA 2M00A 4NW2A 3J81L 4D2KA 5H92C 4RGTA 1OQQA 5JAVA 3MHZA 2KAJA 3GTOB 4J6HA 2EYLA 2KACA 2F0MA 4WRDA 3QO2A 2K9XA 3H0GB 3S9WA 4NAWB 3BS1A 1XCTL 2Q8TA 2WXFA 1FM0D 1TIID 4OGQC 3EVQA 5NUCA 3CIRB 3VR6A 1SNPA 1IKLA 3U9SA 1PRTF 1MHHE 1IYVA 1QOAA 1LTGD 1MD2D 4A3MB 4ZK9B 1CTMA 4RWSC 4XYOA 2NVYB 2QMTA 3WOFA 3S16B 3VA7A 2EJMA 5C2TB 4KY5A 1SNDA 1IGCA 3HRZC 3EA6A 4KV6A 3URYA 5BMIA 1SNOA 4JE3B 2G1EA 4EQOA 1FMAD 3C1EA 1QNKA 4A3KB 1EWHA 2WU5B 4HROA 1Z47A 2Y5CA 1YNJC 5E4XA 2WXIA 3G7LA 1UGJA 1UEAB 1QWYA 1TWHB 4R9WA 3FC4A 1U4MA 1OXUA 1ZP0B 1DGJA 2LFNA 2F0GA 1FD7D 3SK6A 4A3GB 1J7CA 2RDHA 5HI1A 2WDVB 1C4CA 1VRAB 2IGGA 1EOTA 4QUFA 2WLBA 3AECB 4OW0A 2K1BA 4C1NI 1PGAA 3FAHA 4DU9A 1EYDA 1EEFD 3IT4B 2PW5A 2L4NA 4HR7B 4KKJA 1VZ8A 4G4KA 3CHBD 4KKUA 3V2TA 4IUQA 4IUUA 2L0CA 4EE2A 1KFYB 2SNSA 4F7XA 1EFID 1HEZE 2B63B 3IFTA 5K36G 1KLGD 5E3FA 4G7HC 4Y7NB 1BCPF 4DAYA 3EFXD 4MM3B 1EY9A 4C3HB 1LT3D 1GB4A 1R9TB 1I50B 3I3CA 1X3PA 1TKYA 1PFBA 1IYUA 5D14A 1VZ6A 2EOTA 4J8QA 2L5TA 1F2LA 3K59A 2WDQB 4XDDA 4ZHPA 4RH6A 4TRDA 2NMQA 3SK8A 5I2YA 2BA1A 2MJ8A 5BMGA 4YSXB 1BDOA 5FLXE 1NVID 4Z9CB 1JWMD 1R7SA 3T4AC 3SFEB 3T51B 3NHHA 3K5OA 4ZQ3A 1C8CA 1RCVD 1BO0A 3UI2A 2RQXA 1IBXB 4KJOA 4DXGA 2ENBA 2M0AA 3R8BA 1OFFA 3MXGA 1D4BA 1SDFA 2Z4IA 5I2XA 3TEYA 1IHZA 1GUOA 1KNEA 2INNE 2D2CC 3S14B 2BCOA 5BN5A 1K52A 4K5XA 1Q3LA 3BDOA 1J7AA 2J42A 3DHQA 4X3TA 3NS1A 5G3LD 3OWFA 3MWYW 2N7JA 4IUTA 1JQ4A 2WXQA 4WJWA 2W3SA 3FKIB 1GXDC 4K8JA 4WIPA 4IDIA 4JPSA 4BY7B 2B8GA 1QOHA 3NWSA 1NAPA 4BA2I 3NTKA 4PMCA 2PVOD 2B8FA 5GXGB 4O42A 3D4RA 4A3IB 3RUZA 1D5ZC 1F2MA 4JWSC 5HG2A 2SEBD 1BQQT 2WXOA 4XT3B 5C4JB 2PZWA 4N58A 2PO4A 5DM63 5C4HA 4X3UA 2Y5PA 3P75A 4DQOC 5M3MB 3Q8AA 4YSYB 3RPFC 2B2VA 4HEDA 5EKKA 1LO5D 1Y1WB 1ACCA 1TKEA 4IUNA 1D2BA 4E6IA 2JE6I 2K6AA 2F4IA 4K5VA 1ONLA 2DNCA 4OO1G 5BYRA 3PUWA 3A8KE 1PZID 1T3QA 2OF1A 2RBMA 2IWHA 3Q23A 5EPKA 1ESRA 1EYCA 2IX3A 5C3JB 1HUNA 2WXLA 3K5NA 4N9PA 1ZUD2 1MBYA 5JEAH 3VR5A 2V4IB 4PT5A 3AMUA 1SYCA 2D9UA 1D5MC 4BS9A 2NTSA 2IGHA 1EY5A 4XWWA 2WP8J 1FD6A 1ROEA 1R4PB 2JA6B 5LNK1 2MHVA 4A93B 4MT5A 3TUOA 5IIFA 1H9RA 2I07B 3NVWA 1S5FD 1KTKA 2BB5A 4A6QA 4K14A 2WS3B 4HJGE 4FO2A 4EVOA 1Q8IA 2IW3A 2X6GA 1QQRA 1FXIA 3N52A 1QCBD 2M19A 4RGNA 1S4ZA 2IJ0A 4GLSC 1B50A 2EYJA 3ZJVA 2TSSA 2G9HD 5IT9E 1NUCA 3HG9A 2BS3B 5EPJA 2ICEC 2JA8B 4A3FB 3QB3A 3EJIA 5KGUA 5FO9B 2HCIA 1ML0D 2JQRB 1C4AA 1N5WA 4GZYC 1Q1BA 2EY2A 4V0BA 3DWAA 2KWDA 1DCZA 2PW7A 4IUPA 4ZKCB 2F0KA 4I65A 4CJ2C 1ZYRC 3R2IA 4YTMB 3T53B 5E6JA 1KDBA 5CBEE 1E10A 1TU2B 2SDFA 2IX0A 3MAQA 2JXTA 1FRDA 2W82A 1RJTA 1P7EA 2C5CA 2NN6H 1S5ED 1SNMA 1XLNA 4LLGM 4A3EB 3OW7A 5DAUA 4FYDA 2NVTB 3E0JA 1YQ3B 1WRIA 3OSOA 5FK9C 1SAPA 5CR3A 3KBGA 3NQTA 4OVZA 3ND8A 1A2UA 2HUGA 1QLBB 5IGDA 5ISRA 4RNAA 1BUIC 4ZKBB 1Q1EA 5C3XA 3C2PA 2OEDA 1XX8A 1PTOF 4A3DB 4OIKA 2BOSA 1B9RA 1E0ZA 1XO3A 4C3JB 2WKCA 5A35A 4RF1A 3RFZB 4K2LA 4KY6A 5FKAC 3SHLA 1EIGA 1U4RA 2KQ3A 1ZDVA 1JQYD 4ULLA 4KK7A 3T16A 3KK7A 3MP9A 4KN7C 5IOCA 4DA2A 4HCSA 1EYAA 1XF5L 2ONQA 3AE6B 4PNYA 1L0VB 3GTKB 1QKZA 3AE8B 4KTAA 2QJLA 4N9TA 2KECA 2ZXRA 2R93B 2EYOA 1TKWB 3P4QB 4TMAB 3I90A 3L9AX 1I4QA 1TQOA 2R7ZB 1A3VA 1AN8A 1EU4A 3W5UB 2M56B 1KH0A 1ZXIA 1FYCA 1DONA 1Z7TA 2KDMA 2WDRB 1SJED 3TP8A 1KRHA 2V3NA 2LGIA 2ON8A 3MC0B 3TZDA 3C8YA 3K6OA 4IFDJ 3A7AB 3D6WA 3J80L 1HTLD 2WXGA 4Q0FA 2PNRC 1G2TA 3VR2A 5C0XJ 3I4NB 5EE9A 5LHY1 4L6TB 1DXMA 1FNVA 1N60A 3U2SC 1JMLA 2HDLA 3ZYYX 4OL7A 5C0XG 4Q2JA 3NTIA 1EY6A 4UAIA 2K7VA 3QOJA 1VDVA 2BT6A 1WD1A 1HZ6A 3P63A 2RDFA 2PLPA 5ELDA 2B2YC 3KLRA 5JEAG 1L6VA 1GUNA 2QCPX 1ENAA 4CKCA 3SE0A 3CKIB 4G7ZC 5G5GA 3HZXA 1FO4A 1E9MA 1K83B 3HUIA 1PGXA 3DXJC 1HUMA 2K5DA 2AQ2B 2M9VA 1LT5D 2FUG1 1SNCA 3FRPB 4UDUC 2EY6A 5I9PA 1CHPD 3VYTA 4L1BA 1SXTA 2F0QA 1C79A 2F0EA 1HZ5A 3BWUD 1I7HA 5CMDA 1SFOB 1DOYA 3FPPA 3SFDB 2INPE 2F0PA 1NSNS 2HCCA 3I9V1 4FNFA 1B9NA 5H8YE 5IGFA 4KD3A 4QIWB 1G6ZA 1V8QA 2EKIA 3O13A 3LWUA 3IAM1 2EPBA 1KABA 5DM73 3A8JE 1EY8A 3A8IE 2VZKB 4AS1A 4J1MA 2J52A 1WD0A 5A2QE 1T6BX 2AQ1B 3Q0AA 1BXTA 3MFGA 4B0EA 4JBWA 2QF7A 1LTID 3AV8A 4DN4M 2PMZB 2D62A 1GJXA 1Y8OB 3Q8BA 1E2ZA 1AFPA 2VZKD 3NUHB 4YT0B 3LXFA 4H0LC 1RKNA 1IUEA 1DYQA 3K0YA 4P2CB 3ZGZA 2WV6D 1D1KA 2F0TA 5FLXL 1EIHA 2XRQD 3L4PA 1R4QB 3GD7A 2EY1A 2L12A 1HCZA 2KA7A 3SDZA 1X3QA 1KF6B 4BY1B 2K32A 1MVKA 1C78A 2CU3A 1C9FA 2BDNA 2F3WA 5KRUA 2L52A 4Q5VA 4C3HG 5ELEA 1RODA 1CQFA 3MVVA 1CM9A 1EEID 3LYYA 4HAEA 5EQ0A 4DK0A 4ZRQA 1F2ZA 1WTOA 1CZGA 1Q90A 3SXHA 3VYSA 3GTQB 2OT2A 2K3UA 2Z1CA 1BMLC 1HQMC 1B9MA 1CI3M 2WAQB 1D6EC 3G6JB 3R3OA 2WQYB 2F03A 3PUVA 5JVH3 3ZJUA 1FNUA 5BN4A 2WXMA 3T3OA 4XWTA 3TDQA 3WCQA 4ZRZA 5HHDG 2LMCB 4RFBA 5I6WA 4HN7A 1FCLA 5AFWA 2SAKA 4GDLB 5CV9A 3S1RB 2F0DA 3V96A 4MN3A 3VYRA 2W54A 3H6MA 4ABNA 2H4OA 3EROA 3VR9B 5IODA 2EYPA 2FHTA 1WGKA 5CGKA 2MUYA 3FVQA 1EU3A 5E4WC 1LTRD 2VB2X 4IFDI 4OHJA 4C1NK 3IAYA 4CKBA 4XTCS 3HOVB 3GB1A 4OIJA 4U68A 2IDYA 4NZLB 4RCNA 3P4SB 2B2YA 3HRDD 3W2DA 3I91A 3CRLC 4FVMA 3IL8A 1L6UA 5ELCA 1LACA 2QILA 2A69C 4BBSB 1Q10A 2K0PA 3NVYA 3GV3A 1DZ1A 2C9OA 4H2AA 2H89B 5EE1A 4M8AA 4A3JB 1Y56A 3D3RA 1K8OA 4KGSA 2PCFB 3ONAB 2NN6G 4CBVA 1L4DB 1CFMA 5C5LA 1B2TA 1STGA 1O78A 3P4RB 2WINB 1VLBA 5BYSA 1SMYD 5KNBA 3SK5A 2CW0C 5HURA 1DOKA 3MEHA 4DXFA 3H94A 3DEPA 5KYIA 1STHA 3F2UA 3PUZA 3M7GA 2TMPA 1II3A 5I6YA 1TWCB 3RZOB 3BYTB 3HKZB 3ETRA 5J22A 1QB5D 1XXGA 1JW9D 3DMUA 2PVGC 3T3NA 3TN2A 2PPBC 4NP5A 4TQ0A 4C3IB 2H88B 1H9JA 4B9XA 5C3WA 2MPMA 3HVDA 1U4LA 2JEBI 1STEA 5JXVA 2JZPA 3NTHA 1V43A 2W3RA 2AUJD 1PRTB 2OEOA 1YNNC 1C77A 4CKEA 2BW2A 3QWNA 1CQVA 3K7AB 4NDXA 3VQIA 3AEDB 5ELBA 4I7ZC 2FMMA 2MJDA 1XLPA 1GUTA 2PKOA 2SOBA 1A15A 3BVZA 5IGBA 1F0ZA 1EQVA 3M4YA 1IBXA 4XQJA 3GTGB 2MJEA 2EYMA 4X3KA 2WIIB 1QJOA 2XWJB 3PO0A 1RTNA 1JICA 3M3YB 1QE6A 4EQPA 4ZAIA 1TVXA 2ICIA 5FOBB 3WOEA 4IALA 2QIEB 4KJNA 2K01A 4OZBA 5K5PA 4KKIA 2F0UA 1AZQA 1MPEA 1RWSA 3D4WA 3M85A 3OHXC 3FILA 4ARCA 1EWYC 1GPXA 2VXWA 1CK1A 4IZ8A 4IURA 4PV1C 5BYQA 1JWUD 1STNA 3NPPA 1SYGA 2K5QA 4C2MB 1PFMA 4KY7A 4DK1A 1JROA 3PZ7A 1FCCC 2N9LA 1H9MA 3BK1A 2L55A 3JAME 2WU2B 3CRKC 1ZYRD 1DD2A 1YJJA 2ZXPA 3AE3B 2EJFC 2J53A 1SJHD 1MHXA 4WFN3 4F87A 2PW9A 2PZUA 1EY4A 1IW7D 2DN8A 1DOMA 5AUIA 3S2HB 2EYFA 3W5VB 3MJ5A 2R3ZA 4CGYB 4YTPB 5JVG3 5EBDA 2KCNA 1AW7A 2RKSA 3TBIB 5KYLA 2R61A 3KF8A 1WWTA 2K04A 2PMVA 2DNEA 4US8A 1PZJD 1QOGA 1I6VC 1NCVA 2I46A 1PFNA 3J7YW 5IGGA 4LK0M 3P1HA 4QMGA 1TZOA 4KGTA 2JU6X 2JWUA 1ZXTA 4KKTA 1PTOH 2BTEA 2JSVX 2CQAA 1BUVT 2O2LD 1XLQA 5CV4A 2HTME 4CQNA 3FEWX 1RHPA 3LX0A 1B1ZA 1J8IA 3EUB2 4QUCA 4IFDG 3RLFA 1TJEA 2GI9A 2F0JA 4ODGA 2MGSA 4FXGC 1BBXC 1JC7A 2DY7A 1GUGA 4IN3A 5EE3A 2IX1A 2O5IC 4R8NA 2VNUD 3I4MB 5JOBA 3BDLA 2Y0SB 4XDCA 1C4QA 4ILWA 2HQEA 3NXWA 2A6EC 1ET9A 2JYOA 5T1IA 1LABA 3QG1A 2V3PA 4CHTB 1DJRD 1FR3A 2FINB 2XWBB 2GB1A 4L23A 1J9OA 5ELFA 4F8MA 3HEJA 1ENFA 2A68D 2BE5D 1WCMB 4ZHOA 1E2WA 3WDNA 2PQEA 1X32A 3ABVB 2L9HA 2D5GA 2XSCA 2FJ2A 4K5WA 1VCIA 1AZPA 4YIJA 3H91A 4REZA 4RKBA 4TKOB 3TP5A 2K05A 4KGRA 4JX1C 2RVLA 2NN6I 1WTXA 5KNDA 3M7NA 3B2GA 3BVMA 2WXNA 1NI3A 3PO2B 1UUPA 1N62A 1ILPA 3P4PB 5LL6X 3DWMA 3NBIA 3AEEB 3CU7A 1CZPA 4RGOS 3X3MA 1YN3A 4MACA 4K8IA 1TKGA 1PUTA 3E56A 1KAAA 1HPCA 5EBCA 4OO1I 1KDCA 3AMZA 2RDGA 1Q12A 1ET6A 5TSSA 2AUKA 1QNUA 3VA5A 2NB0A 1JOQA 1S5BD 1N5XA 2KVMA 3S2DB 4LMQD 5COYA 3AEBB 5J1ZA 3AB9A 3M4OB 1OXTA 1UAPA 1P7FA 2F3VA 1OXSC 4FXCA 1UNSA 1NYRA 3I73A 2DLBA 1YNND 2E74C 2X69A 1JRPA 4KMUC 5EKLA 3R2TA 3NE5B 3P1MA 4RF0A 3MTSA 5I9OA 2RSNA 1N63A 3DM1A 2MEKA 3NWTA 3AEFB 2AWOA 3B9JA 4F88A 1VR9A 3GO5A 2RPVA 2FBWB 2EXZA 5MPOA 4A55A 4BBRB 1TY0A 1LTTD 1G91A 1UWMA 2E2HB 1SMYC 4ME5A 3Q22A 1LTAD 5HGTA 5DEHA 4KHZA 3D8GA 4XQQA 2FE8A 1I4GA 1AYFA 2Y3AA 2F0WA 3GTMB 1IGDA 3HOWB 4K6LA 3P42A 1PFDA 1O7ZA 1F77A 5EKIA 2A74C 1D1IA 1MSGA 5G3LF 5J39A 1PRTD 5G5HA 1E0BA 3C46A 3S1NB 2BB6A 2N55A 3HVZA 3S17B 4HEA1 3OMGA 4WORA 1XTCD 3AEAB 3VRAB 5LL6S 1PTOD 2J7ZA 3NRZA 1M4VA 4S3SA 2A73B 4JK1C 1JWAD 3W9CB 3FMCA 1SEBD 2OHFA 1LT4D 3VRBB 4K6DA 2J0TD 5BN3A 1CJEA 5K36H 1NR4A 3QOLA 1TR5A 1T5XD 2LS01 4USAA 1I6HB 4L8JA 1V8CA 1VZ7A 4YXDB 4J3OD 5D65A 3BIID 3K5MA 3RZDB 3PZ8A 3NUCA 2LY7A 4XT1B 5EE0A 5T1GA 1EM7A 4XIGS 3DWQA 3JAML 2A68C 2BE5C 4C7ZA 3N6RA 3V05A 3AE2B 1SSOA 4P6VF 2F0OA 2KOLA 3CQZB 5C6AA 2NTTA