1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
5I4DA 1YN5A 2NTSA 3BYYB 4RH6A 1S5CD 2QEJC 2IPKD 2R61A 1T5XD 1V1OA 1AW7A 2NTTA 1L0YB 1TS2A 4TSSA 1JWMD 1ENFA 1I4RA 3BVGA 2J4XA 1V1PB 1I4HA 1PYWD 1EEID 4NZLB 4DXFA 2Z8LA 1STEA 3MFGA 5ELFA 1HTLD 3EA6A 4UDUC 1CHQD 1RCVD 1CT1D 1SE2A 2SEBD 1LLRD 3DWAA 3GP7A 1D5XC 1UUPA 1SJED 1ESFA 4DXGA 4ZYSA 1LTAD 1TS5A 4RGTA 1PRTC 1DYQA 1HQRD 1BCPB 2XRQD 1BCPC 1LT6D 3EFXD 1PTOC 4RHRA 1FNUA 5TSSA 1YN4A 2XRSD 1SEBD 1FNVA 3KLSX 5ELBA 1B1ZA 1JWUD 3BVZA 3O13A 1PTOH 1LO5D 3DWPA 1EU3A 1S5FD 3URYA 1TY0A 2ICIA 5ELCA 1D5MC 1FD7D 1L0XB 3CHBD 5ELDA 2WV6D 1RD9D 1LTID 5ELEA 2AQ3B 1JWSD 1BCPD 2AQ2B 2CHBD 5FKAC 2XNAC 1B44D 1SJHD 2RDGA 4K6LA 1BXTA 1TY2A 5FK9C 4RHSA 4RFBA 1BCPF 1TS4A 5D3IB 1MD2D 1YN3A 1KLUD 1F77A 2G9HD 2RDHA 1LT4D 1SXTA 1ET6A 1I4PA 5D3DA 1KTKA 3V05A 1JCKB 4O1NA 1RF2D 1G8ZD 1LTTD 1FGBD 1TS3A 1JR0D 1PTOB 1RDPD 1LTGD 1PRTD 3R8BA 1PZKD 1D6EC 1KLGD 3W2DA 1PRTF 3BYTB 3SEBA 4RGOS 1LT3D 4C56C 1CHPD 1SE4A 1XXGA 1S5ED 4L63B 3BZDB 1SBBB 3BVMA 1I4GA 3DWQA 4RCOA 4Z9CB 1M4VA 3R2IA 3OWEB 4BWGB 1UNSA 2QILA 1FNWA 1JQYD 1XTCD 2XN9C 1PZJD 1LTBD 1PZID 1PTOD 1EFID 1EEFD 1GOZA 2O2LD 1I4QA 4L6TB 1LT5D 3TSSA 1EWCA 1CK1A 1CQVA 3R2TA 1PTOF 1S5BD 1HA5A 4OHJA 1D5ZC 1DJRD 1EU4A 1I4XA 1QILA 1V1PA 3MC0B 1HXYD 1AN8A 1LTSD 2TSSA 1SE3A 4RGNA 1PRTB 1ET9A 2AQ1B 1LTRD 2IJ0A 1S5DD 4RGMA
chains in the Genus database with same CATH superfamily
3PHXB 1ENCA 3ZXRA 1TKGA 1NDDA 2N9XA 1JB3A 2RPQA 3RMKC 2ZCBA 2MO1A 4G57A 3ZRFA 5NUCA 2X69A 4ZAIA 4HJGE 1A15A 2MWSB 3M9BA 4B3RL 4A3FB 1J5EQ 3VRAB 2YV5A 2AWTA 1PV4A 2DZIA 3J81i 1FCCC 3A8IE 2BBCA 2MBHA 5HHDG 1HTLD 1M94A 2XK5A 3OW2A 2KN5A 1MJEA 1HR0Q 1WIAA 4L8JA 4DAYB 3OWFA 1N9WA 5KGUA 1K52A 3R3MA 4LK1C 2A68C 2Q8IB 5BMHA 5IP7G 4KHZA 4OIKA 3S1QB 5BMIA 1Q1OA 2AUKA 3K80C 1O78A 4XGAB 3VQIA 2N9LA 3RNBC 4YT0B 4RCNA 1QUQA 4KN4C 2BF8B 4HCNB 2MHJA 4HXDA 1J7BA 4PYZA 2KVRA 2GLSA 4GOPB 4WQMA 4DK0A 1VQ5A 1L7YA 1IUEA 3UQBA 4DHJB 1QCBD 2EJGC 5GROA 1HNXL 3H1UA 3D4DA 1GC6A 1B7YB 4XTCS 2KMCA 3LX0A 4ZK9B 5M3MB 2IHFA 1XMOQ 3IBEA 1P1AA 2K5VA 1NBFC 2VQEL 4GNXB 3J80E 1RD9D 3NBHB 1JB7A 1RJTA 4KX6B 2XNAC 1IGCA 2PO4A 2NVXH 2N9KA 3I73A 4BY1B 3STBD 4KD3A 1WI5A 2XEWA 4AJWA 1WH3A 3EROA 1TS4A 5D3IB 1MD2D 1YN3A 4TQUS 4C3JB 3SE0A 3RLFA 4B3TQ 4HJ7A 1VQOA 1XX8A 2E8GA 3K6OA 4X3UA 2V9HA 3S15B 1ML0D 5D3DA 3WAOA 2DUDA 4DR4L 4A3IB 4K3CA 5E6PA 1AWDA 4ZRJA 1BUIC 2NZ1D 4YY3Q 2ZNVB 4GB9A 3GTQH 5HI1A 3J80L 3CPFA 2HHHQ 4I7ZC 3VAWA 3J7AF 3Q3OC 4ZUJA 1J0GA 4E71A 3LYYA 4GMVA 1HE8A 3EFCA 3LWUA 2K1BA 2OT2A 5KYIA 3ERQA 3CC7A 4HKZE 1E2ZA 4MNOA 1B3QA 4ZRQA 4JGHB 4LF5L 4L23A 4DV6L 3W5OA 1IBMQ 5ISRA 1D8LA 3IVFA 2VZKD 1IKLA 3WOFA 4D2KA 2F0MA 4NAWA 1UNSA 3RNGC 4GSWA 1Q1BA 1SE8A 2IZVB 1ISNA 1YX6B 3N30A 5DM73 1LABA 2NR2A 5IOIA 4BOSC 1LTBD 3D0FA 4KTAA 4A3EH 1NJIC 2WU2B 2UUAL 4J6HA 3TSSA 2LHEA 1CQFA 2HCIA 4HJ8A 3QB3A 2NVQB 1ZPSA 2BKFA 2NZHA 2BB5A 2IX1A 3K0XA 4AYBE 3OW7A 1DJRD 4PMWA 1V1PA 4EEWA 4IDIA 3H0GG 3N52A 2KMAA 4OONA 2LEKA 2Y5CA 4NPSA 1L6UA 4JBKA 4W9FA 2RDBC 3H15A 4ZRPA 5IGGA 3OJ4B 2F0QA 2EYJA 5IE8A 3P2BA 2QEJC 2EYLA 2LI5A 4DU9A 3NENA 1BDOA 4JI2Q 1T5XD 3VYSA 1UBQA 2DENB 2FNJB 3ONSA 3S2AA 5EBCA 4J15A 2IY5B 4JE3B 1UAPA 3A9JA 3MTSA 3RN2A 3NRZA 4A3LG 1UE6A 1E24A 1WTHA 3H0GH 1HR0L 1MFWA 2KX0A 3H7SA 2LJIA 5FLXE 3QAQA 4PK1A 3G4SA 1EEID 4W9GA 1HZ9A 1TR5A 4UDUC 2D2QA 2B63H 3CP0A 4A3BH 3QOJA 5C4XH 3MHSD 4IQZA 3RZOH 4FVMA 2KJXA 3A56A 4MDKE 1E10A 4IUVA 4C7ZA 1GUOA 2C7NB 3UF8A 1WRDB 4MEMA 1SSNA 4GDKA 3L13A 1QT9A 2F0NA 4A3FG 1GAQB 2KJ6A 4OVUA 2R7ZG 1BCPB 1H9JA 5CC4A 5DAUA 3KK7A 3RMHA 3G6EA 5G2NA 2K9XA 2V4DA 4PQXA 5IA7A 3J81E 1B9MA 1C48A 4O0AA 3NE5B 1NYRA 4JVZA 3L2PA 3KJPA 1V49A 1EYGA 3O13A 1XLOA 3OHXC 4FLHA 2DN8A 4JI3L 2YTVA 3GE3C 4JI7Q 2UU9L 2WNMA 4DDGD 3I57A 5C3WA 2IY1B 5IP7H 4A9AA 4XT3B 4QB4A 4C1NK 4HCSA 2HIVA 3I7FA 5AJ3Q 3GTLH 3SVMA 5HFYA 4F87A 1E8WA 3HOVB 1WGHA 1X3FA 4DPGA 3CF5A 2L05A 3KUDB 2MCNB 3S1RH 1WE6A 2MPMA 3HKZE 4YWLA 1PHJA 2CU3A 2V1CC 2KWCA 4JIOU 3RUIB 1YNTE 3PS6A 4DWFA 2CH4A 4DA2A 5LL6S 3NVWA 2BYTA 1I3QH 4PG3A 4P71A 1IL2A 1BBUA 2V3NA 5FO8B 4RNAA 4BZAA 4DFAA 2HD5B 4K0KL 3CRLC 3A1QB 4MSMB 4JX1C 3ZKJC 3DDCB 3GOEA 4RGOS 2HJ1A 3JAMc 1R9TB 2EQSA 3DEPA 2LHDA 2NMQA 3KUCB 1VQDA 1C7YA 3ZYYX 4TUUA 1S5ED 1C79A 3BZDB 4RM8A 5IP4D 2I2YA 4R4IA 4B9XA 3MAQA 2KVZA 3Q8FA 2R93B 4HSVA 1IZ6A 1M4VA 1WGGA 3OWEB 1VQAA 4BWGB 3J9CA 1EWIA 3I56A 1K8MA 3GTMH 1IYVA 5EE3A 1WCMH 4LWCA 2CVRA 2K5DA 2RVLA 5FLMG 3Q23A 1Y1WH 4I6LB 1KJTA 1EFID 3DVNU 2QDFA 4DHZB 3CCJA 5IT9c 3S2HB 2B2UA 2GN5A 3KWLA 1QILA 2B2VA 5LMNL 1N33Q 3S1QH 4FF1A 3GTOB 2X8XX 4HROA 2A6ED 4IFDI 2EELA 2AQ1B 3NQIA 3I4MG 1Q1EA 2Y5PA 2LUEA 1FO4A 4DV4L 1Y1VB 2KT7A 4R3DA 1JICA 4JQWC 5M5WB 1SMYC 4X65Q 5K36H 2HTHA 3WOEA 4NAMA 1X65A 1T0RC 2KHIA 3P7JA 4LNNA 2OEOA 2AL6A 2K5PA 4HR7B 2IO0B 3C46A 3SFEB 1Z7TA 4G7ZC 3GZNB 1KIXA 1I4RA 1CTMA 3UE0A 2NVUI 2ZJQA 2R92B 1HR0W 1II3A 3PO3G 1CUKA 4NZLB 2B2WA 5EPJA 4KSKC 2F0HA 4A93G 1L4ZB 2LZ6A 3PUWA 5C2TB 3PSIA 4LUVA 2IX3A 3T56B 2EKEC 2IGHA 1Y8NB 1YHAA 2I38A 2LVOA 1YNJC 1HUNA 3FMCA 4DXGA 4LF7Q 1GJZA 4BY1H 4JI6Q 2J7QB 2WGSA 3U2SC 4P1BC 1FJGL 2IL8A 3W5VB 4C3JH 1UGJA 4IUUA 4RHRA 2K3UA 1NENB 2CS4A 1SR3A 4A3MH 4UP7A 1GHKA 2DJFC 4IPCA 2XRSD 4BAXA 5GAGC 5E3FA 2C9OA 1B1ZA 1WR6E 2E2DC 2VNUD 4R8NA 5IGEA 2R7ZH 2QSDA 4LNFA 4JI0Q 1VF5C 3RZDH 2XGTA 1UBIA 2BYEA 2NVXB 2C7HA 4CYEA 2HTME 3QQ8B 2LWPA 5ELCA 1WYWB 2L1AA 3G71A 1GNUA 3HKSA 1QWYA 2EYMA 2PJHA 5C0XJ 2QA4A 2YEPB 2F0WA 2CQAA 3SFDB 2AQ3B 2AQ2B 3AE3B 3P1HA 2PW7A 3D8GA 5CV6A 2OJRA 2PMZB 4JI5L 4A3IH 1E8XA 3CCEA 3ULJA 4IM3A 4MACA 1HNWL 2MQJA 1U4AA 1WTQA 1WJNA 3Q2AC 4R8IA 3J7YW 3BWUD 2K0PA 2A5HA 5JAVA 2KDEB 2B2YA 2J52A 4W9EA 1IPGA 2XK5B 2M00A 1K53A 4LFAL 5CX3A 1T9HA 2D0PA 1B9RA 2Q2IA 1LTTD 3AM9A 3K81C 4JYAQ 1V86A 3V62A 1PTOB 4HPLB 4NXMQ 2FCSA 4Q5VA 5JPNC 4GZYC 4YWGG 4BKGA 3M62B 5DPSA 2WDVB 2F0GA 4K7WA 1T6BX 1U4RA 2VB2X 2F4IA 4G0NB 3UI3A 1GO3E 2Y0SB 2JY6A 4IKGA 2B2TA 2AWOA 1SROA 1G91A 1C4PA 5LMUL 1V6EA 3I9V1 3TP6A 2PQAB 1Y69U 1ZXTA 1I4GA 4JI5Q 4DV3Q 3UDFA 4C3JG 1I6VC 1O7IA 2RA4A 4NDXA 2NBVB 3TDQA 5DEHA 5JH5C 1PZJD 5CYUA 1I94L 2LJ5A 3DBLI 4MGIE 1Z2MA 3NP8A 2O2LD 3AQQA 2KO3A 3M4QA 3SD5A 4FJYA 2EYHA 2I1JA 4WORA 2D10A 3RNFC 4NJ6A 3R2TA 1ZDVA 2F0FA 3A4RA 3NBHA 3KBXA 1VD2A 4EGVA 1HH2P 4DV0L 2QJLA 4HWIB 3QIAA 1HZBA 3GV6A 3PO2G 2I1KA 1JOOA 1F2LA 2XWBB 5M3MG 2WXLA 1L1OC 1WXQA 3BZCA 1ET9A 5FO7B 1VQLA 3J81c 4IWQA 2KKCA 1U4PA 1E1OA 5D6JB 3PO2B 2WHIA 5JHAA 1YJ1A 3DOWA 4QMGA 4KHPQ 2KFKA 2W55A 1F52A 3APDA 3FILB 1D3ZA 4LF7L 1AE2A 4FYDA 1MPEA 3U52E 2BVCA 1Z6HA 1PYWD 4A3LH 4DXFA 2AMCB 2C35B 3IT6B 4YCWA 3VA7A 2HT1A 3X23A 3GTGB 4JPSA 2DJGC 1KF6B 1PQSA 4A93B 3CSTA 1D5XC 4X57B 4C80A 3NXWA 4XXEA 1IBXB 1TXYA 3PO3B 3FKIH 2D3BA 2O2VA 3U7DA 2L0TA 4DGZA 4AWJA 3VVWB 2C5CA 4OXPA 3KF6A 3FAHA 3I4NH 4BBRG 1WR1A 3QOLA 3HG9A 2KWDA 4HIOA 1BCPC 4DV6Q 1FFVA 2G1EA 4JI1Q 2M56B 3QG1A 1FNUA 2K6DB 3SK6A 2F1MA 1XNRL 3PLUA 4QQBX 3L08A 1CZGA 1VR9A 1ZKOA 4JG2A 2KEEA 3ZO5B 3ERSX 3PPAA 2F0KA 2QF7A 4NQLB 4CDCC 2WP9B 1TT2A 1WTWA 4H44C 1R4MB 5EKIA 2KWVB 4US8A 1FD7D 3VDYA 1QOGA 1PH3A 5COYA 1ZXIA 5JVG3 4CDEC 1JJGA 3AN1A 2KK8A 1SJHD 3C2PA 2VUMB 1WE7A 3RFZB 4RHSA 1K51A 2BE5C 3GTJB 3WCQA 3NBIA 4WJNA 1PFBA 3L10B 3N6RA 2R93G 3KDFB 3D32A 3S24A 1DOMA 1AP0A 4GN5A 4TQ1A 4WJPA 2E2JH 1ZYRC 3K9OB 3I3TB 1SFOB 5DPTA 3P4RB 3CIRB 3J81j 1N63A 2N7DA 2K22A 1BR9A 3OYYA 4IUNA 2LXJA 1NE3A 1R9TH 3T4AC 1E1TA 1YI2A 1KDAA 4O2DA 2K5WA 4MTKA 1G2SA 1VQ7A 2YU9H 3LB8C 5EPKA 2W54A 5IP9H 2KQSA 1K3BC 4PS8A 4F7ZA 3RNAC 1RIPA 3VHTC 3PUYA 1RM6C 2PMZE 4M0WA 1KDCA 1SBBB 4OEMB 3TMPB 4YTMB 1QNKA 3ZW3A 5A35A 2KC1A 1HPCA 2MP1A 2UU9Q 1YIJA 1XPUA 3GE8C 1DOYA 2CHXA 2JXXA 1EUVB 4LTUA 2CFMA 1K0SA 1F9JA 1WTVA 1I4QA 4JI3Q 1IBKL 1SNPA 2H4OA 1CKNA 3CCUA 2CJNA 4MZ9A 4APVA 4CBVA 2Z0SA 1Y1VH 4V190 5L83A 3HOZG 1VZ7A 3PCOB 4CJ1B 1CM9A 5IO9A 3MHBA 3FHWA 4FXGC 4WAFA 2AWNA 5CMDA 3CQZB 3E3XA 1UE7A 4TKOB 2B76B 2Z6KA 4JBWA 2R92H 4H0LC 2ZZPB 5HGTA 2RSOA 3IKJA 2N1VA 1FCLA 2R7ZB 1TIFA 2FFKB 2WDRB 4AQ7A 4EQPA 4DF7A 1JWMD 1VZ6A 3AEEB 4CQNA 1TQOA 2J4XA 2D3GA 3KDFA 4NJCA 4H13C 1YMHE 3H6NA 5I9PA 1AZQA 4JI4L 3KW5B 1GUTA 1O7LA 4NKLA 5GADC 2PE6B 2R2OA 1CHQD 1ZKHA 2Q2UA 3AB5A 5CHFA 3WA0A 3F2UA 2K32A 2D3AA 4FF2A 3ZNGC 1HQRD 3HKZB 4GXBA 1Z47A 3BS1A 2BH2A 2L5TA 2R2QA 3M3YB 3PIO3 1YN4A 3FILA 2AX5A 3WWVA 1JWUD 3M7NA 3E0EA 1MKHA 4BBSG 1SYFA 2BH8A 5HKHA 2Q8RE 2K28A 3DWPA 4RF0A 4DUZL 1WXSA 5CORA 1MHWC 4FDBA 3FKIG 4QY7A 2LD9A 4ZOHC 3WIMA 2K5QA 1OQQA 4IOCA 5IGFA 4A20A 3DVGX 4GOPC 3MJ5A 2QGQA 3PUXA 3K9PB 1JOQA 1ZXHA 3OAWA 2YTYA 2ZXPA 3MEFA 1HFNA 5C3XA 3RNUA 1KL9A 3TRZA 4LCDE 3TEXA 2INPE 4EUTA 3AB9A 4NMZA 1WXMA 3AE5B 1TY2A 2A6EC 1T0SC 4G4KA 3GTPB 1SAPA 4LAAA 1B2TA 3FPUB 2RDFA 4WIPA 3Q8CA 4ME3A 3DEOA 4R4TA 3A0JA 3NWSA 1AYFA 4OWTB 5HY6A 4KJNA 1KD1C 1Q0WB 1N32L 1ZUD2 4B3SL 2WDTB 1ET6A 1O80A 2BE5D 3QK0A 2PMVA 3CW2C 3TMEA 2FUHB 1TWGH 2LY7A 4HLEA 3UGBB 2HHHL 1N36L 4DR6L 1TKYA 1PYBA 1SRUA 4YL8A 2ZXRA 4YY3L 4BVUC 2RHQB 2FE8A 4U673 2B3GA 3Q8DA 2M19A 4A4IA 4A90A 2KANA 4UP8A 3J7A5 1JQ4A 1IW7D 5M3MH 1WJ6A 5KNCA 5J17A 4KJOA 3Q8EA 1PRTF 2NYZD 5IYCH 3J7AV 1WYDA 4LF4L 3QO2A 4R4CA 2BW2A 1H4RA 2BTEA 2ENBA 1LXDA 4LLGM 1VLBA 3DBLB 4DK3C 2MJ3A 1OGWA 4OWXB 2F4VQ 3P42A 4EE2A 5IOCA 1HZAA 5C5MA 1S3SG 3SGIA 2XN9C 3S1NH 2KQ4X 3HS0C 2Z0DB 4EKUA 1LUZA 4KY5A 2JSVX 5FJ8G 1EEFD 3S15H 3JAMi 2J0JA 1MIUA 2UYZB 1EWCA 1S4ZA 1UF0A 4WWPA 3RN9C 2KOLA 1WYGA 1HA5A 2F0UA 1D5ZC 3EBEA 2EPBA 5C4HA 3ZTCA 2JUOA 1EIHA 3CCLA 3PVLA 3F1ZA 3NS8A 3I4NB 4ID6A 4X64Q 1MI0A 3PV1A 1TZOA 4DNIA 1NUCA 3W1BA 3PIOA 1KC8C 3I4NG 3MTNB 1VMCA 4B0EA 3DLLA 1U5KA 2KOXA 1L5PA 2EXDA 5LMNW 3AE2B 1XTDA 1Y14B 1K3RA 1SYDA 2R61A 5BO4B 1QJOA 1V2YA 4M8AA 2ZTDA 3A8JE 2A74C 3HKZG 2HDEA 1VQBA 1TS2A 5KYLA 2K8CA 4BXXH 3NOBA 2QDLA 5IAAC 2KEDA 5GXGB 3PO3H 3GO5A 2KN4A 1I4HA 3CSFA 1STEA 5AZHA 3D3RA 1FYCA 3RD4A 3ZRCA 2KJHB 4YHHQ 3NTIA 3J7ZC 1K8OA 1W3SA 1XMQL 4ZYSA 4A3OA 1LTAD 3A54A 2F4VL 2WYQA 1ZGUB 4FULA 5C4JH 3VR8B 2LMCB 1VQ6A 2F0IA 1KRHA 4QGUA 3KOJA 3DWGC 2MQHA 4I6PA 3BY4B 2KFKB 1YQBA 3AYHB 5EPLA 2ZW0A 1D7QA 4FJVB 5IKCM 2DY8A 1SYGA 1C1YB 3VYTA 3QHTA 2DZKA 4AYBB 2JJQA 2LGXA 5EE0A 2UUCQ 4BBNF 2EYPA 1CZWA 1QB5D 5IGCA 2WXOA 4EX5A 4RA8A 2MRPA 3U4VA 4FNFA 1B9NA 2YU9B 2YYZA 4LUOA 4DR5L 4DR3Q 3GTJH 2BGFA 2FINB 2EDGA 3CHBD 3EJIA 3ZLZA 2B39A 3H3VH 1LTID 2AUJD 3FP9A 3DHGC 3N3KB 1JWSD 1L2NA 3AE6B 1QLBB 2ON8A 3DVNV 1EY0A 1Q7YC 2E2JB 1P9DU 1BXTA 5JVH3 2VL6A 1JRUA 5M3FG 4MT5A 1RRBA 1XYIA 1JW9D 5FR6A 5ELOA 3ZDTA 2NN6I 4RKLA 2UXBQ 2VQFL 4FXDA 4CDFC 2OCEA 3S2DB 3RNCC 5I6WA 1BBWA 1PGAA 1XPRA 3PQIA 4A3CH 4BY7G 4F1SA 5JJZA 1SYCA 3C1FA 1N8RC 1FM0D 2ASQA 2LGYA 4HPMB 4LK0M 4DUZQ 2CKHB 3RI7C 5H92C 1TKWB 4Y52H 3AU5A 4A3CG 1E0ZA 4ICVA 2GBMA 2GVBA 2IWHA 1WMHA 4DR1Q 2L76A 5CV9A 1FEHA 3RCZA 4YXDB 2N7JA 5C1ZA 2B8GA 1FRDA 5IGBA 4AJYB 5EKKA 1WX7A 4EZLA 5LXIB 1DONA 2YTXA 2DAJA 3E6ZX 2L3ZA 1E7UA 2XVSA 4WWOA 2JU6X 4UY8C 2WIIB 2BS4B 4P16A 1CZPA 2KC2A 1F2ZA 1TVXA 2AKWB 3UDIA 4IG7B 2JRHA 1OXVA 2JT4B 2MHVA 4DR7Q 1EQVA 2HD3A 2CWPA 1WOCA 4DR3L 4DR5Q 1R7SA 1HZCA 4JI4Q 3K7AB 3S16H 3MJWA 3AEBB 2JZ3B 1PTOF 1DM0B 1VS0A 2J7ZA 5JEAG 1I4XA 3MC0B 2F0VA 4C3HH 1KH0A 3Q14C 4IPDA 3HK0A 2TSSA 1VRAB 3APCA 1B8AA 4PMBA 2VZKB 1ICWA 2K52A 2KHSA 1NYQA 3AE4B 2WFWA 1O7ZA 5C0XH 4IM0A 3TBLD 3VA5A 2A69C 4X66L 2NTSA 5GMVA 3TP7A 3T13A 4BKSD 4HCPB 4WH4A 1PH6A 3OLMD 1B50A 1JT8A 1WJ4A 3GZNI 4YHHL 3I90A 3MEHA 2PPBC 1WCMB 3FC4A 3CCSA 5EE9A 1EYCA 4L1BA 3FPPA 2BDOA 1YHQA 4M00A 4HRSA 3DHQA 1ZYRD 1HTOA 4I7AA 1Q8IA 1WGRA 3EHVA 2JF5A 1WXAA 3LNNA 4DNRB 4E6IA 1QVCA 1ZEQX 3W3AA 3I55A 3S14H 2RPVA 3CMMB 4URKA 1TZ1A 5J18A 1J6QA 2LRUA 4JI2L 1P16A 1DGSA 4GDKB 2Y5BB 3ND9A 3AE1B 3ABVB 4J3OD 1NMFA 2ZXOA 1I50B 2ZPYA 5G5GA 2EKIA 2BWFA 2RBMA 2KTRB 1B70B 4AQYQ 4EVOA 5LXHA 1ZE3D 2YLMA 4LFBQ 2E2HB 3NZ3A 4LF8Q 4KKUA 2GB1A 3NPPA 2KZRA 3KLWA 3A9KB 4NNJB 1GUWA 2EMSA 2N4FA 4IPGA 4FA6A 3HEJA 1IYUA 5J39A 1N60A 1S1QB 5AZFA 1F2YA 1X32A 2XTIA 1E7VA 4BFRA 3S1MH 3M63B 1EO6A 3NG0A 4OZCA 1KABA 1CA5A 3H3VI 4RWSC 2JA6B 2NVYH 2NPTB 1B44D 3VH4B 1WX8A 2BT6A 4GOCA 3W1SA 3GB1A 1DOKA 4KKJA 3K58A 2K5NA 1IBML 2JZPA 2KTFA 2JWUA 3MZ5A 5CV4A 2G9HD 5KIXA 4LF4Q 3S1NB 1LT4D 2KCNA 3MA2B 1XNQQ 4QAYA 1RL2A 3M7GA 5HG2A 1KLVA 4P72A 1V5TA 2KQ7A 3NEMA 3CPWA 5E4WC 1TU2B 2GRIA 3L16A 1SF0A 4RAUC 4AOFA 3CMEA 4WJ3M 1G8ZD 2WB1E 4XC2A 2L52A 4C7YA 3NQTA 3HIZA 4WJQA 1MBYA 4USAA 1V8QA 5BN4A 5M5XB 1EIFA 5BYSA 3GTKH 1K8GA 4ACFA 1J8CA 2MLBA 2MO0A 1H9SA 1MJCA 4LDTB 3RYTA 3ZNHB 2JQRB 1CHPD 3L54A 1T5EA 4MM3A 2WB1G 2ZJPA 1CA6A 3EN2A 4BXXG 3BVMA 2A1AA 1DOLA 3TS2A 1WWTA 3F2CA 4BBRH 3MP9A 2PZUA 3R3OA 4S0RA 3VR3A 5AUKA 2QKIC 1WSPA 1XMOL 1QOAA 5DPRA 2MGSA 1HZ6A 3A4SC 3MXUA 1WTOA 3CWIA 1Z9FA 3VR9B 1HNXQ 4Q0FA 1F2MA 5EQ0A 3QC8B 1UEAB 1YHBA 4GIVA 3NTKA 3BZKA 2QIEB 2BA1A 1WRIA 2KLCA 2L4NA 1Y56A 2WS3B 3BYYB 5FO9B 1WJJA 2B2UC 2DY7A 1P7FA 2K39A 3M4OB 2B8FA 1V1OA 3UIPB 5C0XG 5J1ZA 1PH8A 4XDCA 4NXNQ 3KF8B 2RGFA 1ENFA 3M4PA 1I6HB 3T1HQ 4RM9A 1JALA 3E9IA 1V1PB 4A3JH 2PI2E 4POGA 2WXHA 4GN1A 5DNFA 3V61A 3ND8A 2L12A 1GB1A 2ZVNA 1ASYA 4Q2JA 4M8NA 1J5EL 4J1MA 1I94Q 3Q69A 2B2TC 4MM3B 3GP7A 1UUPA 3DPDA 2EOTA 3OIQA 1TGZB 3JYUA 4K81A 2DNFA 3EUB2 1ILPA 4JC0A 3S17H 1YQ4B 3PUVA 1LV9A 2L0FA 3FDTA 2WXFA 3S9WA 3JW0X 3Q22A 2RR9A 1NTGA 1BT0A 2A6HD 2JA9A 1L0WA 1TYGB 1OXUA 2H89B 3KLSX 4K5VA 1KAAA 1CFMA 4KZCA 2QW7A 3WANA 2V3SA 1A70A 4NXML 2WXGA 3KH0A 3H7PA 3KVFB 2QCPX 2VY3A 2R7FA 1DZ1A 3H8HA 2UXDL 2NZOA 2M1MA 1X54A 3HOZB 1GUGA 3HOYH 4LFCL 4IO9A 2D5GA 5D94A 4OVZA 4MTNA 1PFDA 4A3GH 4C3IH 1HUMA 1STAA 1XNQL 5E6NA 4K1RB 1E0BA 2K5HA 3S2DH 1HEZE 3AI5A 5E1FA 2ZPNA 1YNXA 2LGDA 4K6LA 5FK9C 1HNWQ 1VQJA 4RFBA 2F52A 2WXJA 4A75A 3OTOQ 1WGYA 4RMAA 2KDBA 4IJLA 3HVDA 4L5QA 3SU8X 1V1QA 1QVFA 1SXTA 2JK8A 4JPBW 1NI2A 1QQRA 1RFAA 4O1NA 2B2WC 3IFWB 1RF2D 1E2VA 1LM8B 1PFSA 1TBEA 1EYDA 3IG3A 2NBUA 1VQCA 1PA6A 4GDLB 1QF6A 1VQ4A 5EJWA 5I6YA 1EQTA 3A74A 1S40A 1W6JA 2MW5A 4DK5A 3T51B 4WRDA 1PMRA 4JBMA 2J0MA 2LMCA 4G7OC 2AHOB 4AUQC 4JI8Q 3QA8A 2N78A 4L5TA 1TTNA 2BYFA 4GLSC 4K5XA 4ZUIA 4FHJA 2JZZA 2BYVE 4DK1A 1AARA 1PLFA 2WP8J 3HFZB 3ZNZB 2VUMH 2W3RA 1STNA 3KQ4A 5EE1A 2OJWA 2OOBB 2DGYA 1XTCD 1KNAA 3SK4A 3U4ZA 5M3FB 2VUMG 3HRDD 1GM5A 3KFUA 4MSQB 4MGZE 5BMGA 5JJIA 1F2RI 2G45B 4KHVA 4GNXA 3TP8A 1RAXA 2WXMA 4IOIE 1Y8PB 4W9CA 1X3GA 2MP2B 3DHHC 4AIMA 4HMJA 1DOIA 1LTSD 3A5UA 4IC7B 1SE3A 1XCTL 1VQ9A 1PRTB 1HQMC 1CKMA 2K7VA 1XNRQ 3M95A 2CW0C 4BKTA 4JI1L 4V0BA 4JV5L 3BK1A 1OTRB 4CHTB 4DV1L 5AFWA 1Q86C 4OX9L 5K36G 3H6MA 1UELA 3MXNB 3D4RA 4JV5Q 1S5CD 3DMUA 3CXCA 1C0AA 2ACZB 3NTHA 1F2RC 4QCLA 4A3KG 1V97A 3C1EA 1G291 2RQXA 5LMNQ 2Q8TA 1TWCH 2BCOA 2VZAA 4RKBA 2JSOA 4LJPB 1WZ3A 1Y8OB 3FEWX 4ME5A 2JEAI 3F8TA 3LXFA 2C60A 1WMHB 5ELFA 2BS3B 1UE1A 3S1MB 4DV5Q 2D3CA 2JWZA 2O6VA 4JL9A 5HGQA 4XX5A 3R7RA 2NBFA 3N1XC 3E0JA 2SEBD 3IFDA 1Q46A 3IL8A 4A3FH 4LNOA 1ESFA 2A4ZA 1PH9A 2JP1A 4HSPA 4X62L 5JHBA 1KXLA 3VYRA 5C4XG 2K03A 2PNRC 1E90A 1QVGA 2NPTA 3HOXG 5BR8Q 2W82A 2WX0A 4M01A 5KHOA 4JI8L 3B9JA 4ULLA 1IYFA 3UDGA 1WI0A 4DUYL 4BA1I 1T0QC 2WDQB 3WDNA 3ML8A 2EE1A 5CBEE 2A6HC 3TJPA 2F0PA 5FLXL 1J9OA 2KHWB 3U4EG 3A9KA 4FJZA 1L4DB 1S5FD 3A8KE 3BIID 3Q0AA 3V60A 4HVBA 1RYJA 1CKOA 1YJJA 1PH5A 3CMAA 1OXXK 4R1JA 1C77A 3AECB 3R66C 1A2UA 1XCQL 3OSOA 3UI2A 1AEXA 1A3UA 3KJOA 5FKAC 3TBIB 2INCC 5ELNA 5IT9L 2PTLA 3AE8B 4IUPA 1CI3M 3BDCA 3OTOL 1VQNA 1N6ZA 4XYCA 5JEAJ 2OHFA 2BB6A 1BO0A 3CF6E 2JA8B 2KCMA 2G3QB 2LSSA 2XWJB 1T3QA 1G51A 5CR3A 3PF5A 4CHKA 4H7BA 4WFN3 1AH9A 1YNND 1QOFA 3VUYA 1F9SA 3AH7A 2OQ0A 4HK2A 2A69D 2IX0A 2TMPA 3M3YH 2KDMA 5C23A 1K0RA 4LFCQ 2QC8A 3I5JC 2M2LA 4G50A 4CGYB 3R7QA 1KFYB 5JJLA 3SHLA 3ALBA 3ZTDA 3T9LA 1NMGA 1JR0D 1VDZA 2HQLA 4LFAQ 2MP2A 3PSEB 3WALA 2GBNA 1LYLA 1C76A 4XWWA 2WAQG 2JA5G 1QOBA 3U7ZA 4C4VB 1QUQB 5G3LF 2VH2A 1U9RA 4UHVA 1Q10A 2D5DA 2O5JC 5E7NA 3CC4A 3B6YA 4GN4B 3CU7A 3GTQB 3RPFC 4A3IG 3NUHB 3I70A 1XXGA 4M02A 4KV6A 3SK8A 2AYOB 1IBXA 3MXPA 2K04A 2LGSA 2QILA 2KLGA 4LNKA 3T8MA 4N6EB 5IYBH 3NS1A 4K8IA 4B0MA 1L1OB 5C0XI 2CH4W 2BOSA 2X6GA 2HE7A 3JSVA 1LT5D 2L55A 1YVCA 1EZ6A 2RCFA 3EQLC 1EY7A 2JA7G 2ID0A 4JI0L 3T1HL 4K7SA 5L95C 1UWVA 4K2KA 4EQOA 2ZJRA 3B0AA 3A55A 4RGNA 3NK9A 2PNHA 4OGQC 2D2CC 1S5DD 2H5XA 3MXGA 2NCNA 1XQQA 1XF5L 3Q3MC 2BKRB 1YD8U 3IXSA 1C4QA 1XLNA 3Q3JA 3H0GB 2N0SB 5IWAL 4QF4A 4XZ4A 2CW0D 3PUZA 4DAMA 4GNXC 1SE9A 3VTWA 5G3LD 1P3QU 2ZCCA 4US9A 1G6JA 5J3BA 2LXKA 1Q81C 1X55A 5EAYA 3JAME 4BBSH 5C4XB 1Q5WB 2GBRA 3RZOB 2O6VD 2W3SA 1OO9B 2OTJA 2ZVOA 3A9JB 1IL8A 1SMXA 4YCVA 3A1QA 1KDBA 1VCIA 3HOZH 5EBDA 1ASZA 3S17B 4ZLTF 1WD1A 2UUAQ 2L15A 1X6OA 3TZUA 1UGMA 2Y3AA 3RT3B 1FR3A 2LXCA 3VTUA 4WURA 4MHEA 2VH1A 1U4LA 2GI9A 3I72A 2F0TA 1NBWA 4ALPA 1BBXC 1XEEA 4C4VA 3KUPA 4JCVE 2OEDA 4H02A 1TJEA 3UINB 4A6QA 5J2RA 1EY6A 2PIAA 3EFXD 2QCZA 4HIDA 2XBBC 2O4XA 1RKNA 2A5UA 1K83B 2R6GA 5JOBA 5KNBA 2EY1A 2A19A 4ZRZA 1C9OA 2E6XA 5H8YE 1Q12A 1FD6A 4GKKL 3NHHA 1N33L 3CRKC 4MJSA 2KENA 3DUZA 2L0CA 2FCMA 1NEKB 1P8LA 2HDLA 1CSQA 2LXAA 3D6WA 5M5YB 3DHIC 4FF3A 3URYA 5T8IA 2ICIA 3BDOA 3GTLB 3DXJC 1L0XB 2MFIA 3RLNA 5DPWA 3D31A 2WV6D 4DV2Q 4A3DB 2I46A 3OPOA 1PH4A 4B3SQ 1EL0A 1YIWA 2J42A 2NVTB 2LVQA 4JWUC 1BCPD 1RFKA 3S1RB 4KDIC 2KA7A 2BDNA 1VMPA 4ITKA 2I5HA 2EYFA 2MA9B 4BA2I 1JROA 3I8ZA 3B2GA 4KIKB 1JMCA 1OFFA 3N32A 4MN3A 1TWFH 2OQKA 4KSLC 1FXTB 2MBEA 2PQAA 4UAIA 4DAPA 1MG4A 2K25A 5MPOA 2QDBA 1STGA 1L1OA 3JSVB 1EIGA 2KCCA 2N88A 4GGQA 2KDFB 1GUNA 2RKSA 3PMFA 4K3BA 1RDPD 2HIXA 1L6VA 2CWAA 2JRIB 2E3TA 3V3XA 3TEYA 3ECIA 4B3MQ 1KLGD 5JZEB 3W1YA 5JEAH 3PRMB 3BYTB 3GTMB 2JVCA 1ZDXA 1LT3D 5KNDA 3DVGY 2L11A 4OO1H 1QZEA 3IHPC 2O5IC 1DD2A 4RMFA 5AJ3L 3U8ZA 2E2IB 1JJCB 4TV3A 2I07B 3VDZA 1TWCB 4JI7L 4DR2Q 4FXCA 3GTOH 4ZRKA 1GOZA 2V4LA 4L6TB 2PLPA 3SHQA 2F0DA 1MHXA 1VZ8A 1CK1A 1NCVA 1PYSB 4ZQ3A 3NHEB 1EY9A 1CSPA 2UXCL 1NVID 1HFGA 2K6AA 1Y1WB 3HOUH 4REZA 1MSGA 4B3RQ 4MIUA 1KHIA 4IUQA 1SIFA 3TEZA 1WM3A 5IP9G 2VW9A 2DYOA 1M1KC 5A2QL 1OEYJ 3S2HH 2DBYA 3L4PA 2K14A 2ICEC 4A3KH 3C8YA 4DXAB 5I4DA 4K8JA 3CKIB 4X66Q 4AYBG 2PI2A 1HNZL 3Q8AA 3TEHB 1XJVA 1VQIA 2R3ZA 3ER0A 4DKAC 4JW0A 1D1IA 1FPYA 1EWHA 3HOWB 1OEYA 1SSOA 1FFUA 1IYJB 4EZKA 1L0YB 4W9JA 4NQKE 1WD0A 2XSCA 1N5XA 1B3AA 3KYDD 2JXMB 3FRPB 3T3NA 1EZ8A 1TIID 3MFGA 3NJTA 3SDLC 4XQQA 3K7AH 3S16B 1WGDA 1AZPA 1SE2A 4NXNL 1STYA 2K33A 3PF4A 1I7HA 2MJDA 1LLRD 3DWAA 2BQQA 4WQOB 3ZUNA 1DCZA 1SJED 4C3HB 3DBHI 4XIGS 1A8VA 2ZM6Q 3VUXA 1TS5A 1SGHA 4AS1A 2NN6G 5KEEA 3T53B 4KKTA 3SR6A 2UUBL 3IT4B 4K5WA 4ZKCB 3RZDB 4DV7L 1XT9B 2N8NA 2D07B 3STBC 1SEBD 1F9RA 3H91A 3RZFA 4L2YA 2WKCA 1QZHA 1JORA 5ELBA 1YOVB 4B3ML 2OTLA 2CQOA 3P1MA 1H9KA 5IYDG 3Q6BA 3IFTA 3BK2A 4ODGA 4P7IA 4KKIA 1EU3A 1EY5A 4A3MB 4KMUC 2KUMA 3EC8A 4N9TA 5IIFA 4L5SA 1TY0A 1WZ0A 2JXTA 1LGRA 3V6CB 2M9VA 3L9AX 1GB4A 5TR5A 3B1LX 3TL5A 3ZJVA 2FXQA 5JPMC 3TS0A 2REXA 1MI2A 2FCQA 1GVPA 1Q8KA 2HQEA 3VR4A 1A63A 2CHBD 2WXQA 4F88A 2WLBA 4NW2A 3S14B 3N9YC 5IT9E 2VQFQ 4M0WB 4IUMB 2Z4HA 1X1MA 1DGJA 3U58A 2K4KA 1WFYA 1H9RA 1RHPA 1K50A 1EF5A 2MX2A 3AEDB 4W9LA 3ML9A 1EUJA 3TREA 4DK6C 2KDIA 1TKEA 1I4PA 3EGRA 3RLOA 2Z59B 5I9OA 3ZJTA 2MNAA 2NBWB 4K2LA 4HEDA 2DWQA 5E6OA 2PVGC 4CJ0B 1FGBD 5CGKA 2L7RA 3AULA 3BG3A 2WAQB 2JA5B 5BYQA 2KQ3A 5F2DA 2M4NA 3HRZC 2KHJA 2IHEA 1JJ2A 2M17A 2MBOA 1EY4A 5CV7A 3TZDA 3MC8A 1V43A 4HTHA 4B3TL 1QE6A 1A3TA 5KRUA 3ULPA 2NVYB 3IRBA 4CKEA 3W1GA 1FXAA 2F0EA 4K7UA 3H3VC 1WY8A 4FHKA 4C1NI 3JAML 4A3EG 4ARIA 4MGKE 1G6PA 4ZKBB 4HMIA 5C3EB 2SAKA 4XDDA 1N5WA 4YTPB 3T1YL 4DAVA 4WJ4A 4XE0A 2F03A 1GXDC 3L17A 4LNIA 2B29A 4DN4M 5I2XA 1EWYC 3GS2A 1IW7C 1QKZA 3G7LA 1CQVA 2N3SA 3OG5A 4HJ9A 2IO3B 4P75A 1N61A 3FVQA 1C78A 1HJPA 4OHJA 3TP5A 1HHVA 2JYTA 2R7DA 3PLVA 1YJNA 3WAMA 4ANVA 4DQOC 4EZJA 1LTLA 1WTRA 1E8YA 4LFBL 3HP3A 4TKNA 4P74A 3GTKB 4KLKA 2EMTA 4RGMA 2V0GA 4KHPL 5BYRA 4BBSB 2CJOA 4FBJB 2ALYB 2L00B 1KQSA 2WKDA 4RH6A 1GC7A 5CHWA 3MXNA 5IYBG 2KVMA 1NNXA 4NB3A 3ZDMC 4HDOA 1IXRA 1P0RA 1XLPA 3GTGH 2KCTA 2NTTA 4QIWB 1BNZA 5L37A 2LFIA 4TSSA 3Q8BA 3NSWA 4HEA1 3TCAA 3SR1A 2RF4A 2IO1B 2V4IB 2VRRB 1YX5B 2Z1CA 4KGTA 4C3HG 4KZ0A 3IAYA 3W5UB 1UWXA 4O42A 4QIWE 4JBJA 2RD0A 4YWKA 3TQYA 2ZNVC 3A7LA 1CT1D 2JPHA 1KM7A 4N9F4 1FL0A 3VTVA 4KVGB 1R4MI 2R92G 5LLIA 4BOZB 2O2VB 2Y0SE 1PH2A 1D4BA 1TWAH 4OL7A 3P75A 4GLAC 4F8MA 4MELA 1HNZQ 2GA4B 4HAEA 3VXWA 1BVSA 1LT6D 1V80A 3C19A 5M5YH 2PVOD 5D2MB 1JWBD 2DYMA 4P6VF 3C3LA 5JJKA 1F9QA 3M4OH 2CHWA 1FXIA 3H94A 3KF8A 4KD4A 1MHHE 2N1WA 3NWTA 2NVTH 3ZVVA 5FJ8H 2KJRA 3HZXA 2WXKA 1N36Q 1MGSA 4N8X1 4X3TA 1JRPA 5JXVA 4X6AH 2ZJDA 2ONQA 1DXMA 4N8FA 3LWEA 3ULLA 1K73C 5CV5A 4HN7A 1IHZA 1IBLL 5E6JA 2E2IH 2QHOA 2JA6G 3A33B 3ZQ4A 2LUMA 2A68D 3K5MA 2HJ8A 4Y7NB 4OIJA 1LACA 3E9HA 3X3MA 1O7YA 4ARCA 1M90C 4CDDC 2WX1A 5EKLA 1ZOYB 3AE9B 4XDXA 1JE5A 3GQBA 1KAWA 2WAQE 3PZDA 5J22A 4LF9L 1K28A 3ZJYC 1A3VA 3VR2A 4W9IA 4ANXA 3CAMA 1RWSA 3HOXB 4PT5A 1RLFA 4DUYQ 1D6EC 2F0JA 4A8XC 5FR3A 2L1BA 4UP9A 3SEBA 4ZDVA 1LQBA 5BR8L 2EZVA 4I6NB 3SXHA 3AE7B 2F0LA 1AE3A 4WJOA 2KWUB 3DWQA 3B2FA 2L83A 2RMMA 1FJGQ 1X3PA 5D65A 3R2IA 1IBLQ 3CC2A 3DCGA 3VYUA 3UDXA 3M3JA 4UPAA 3HOVG 4MH8A 1U4MA 3KUZA 1VCBA 4W9KA 2LGIA 1XPOA 4DV2L 2LS01 4BY7H 5FLMH 3CCVA 4FP5D 4RG1A 1WM2A 1R4NI 4A3KB 3HOWG 2LRWA 2K1FA 4S3SA 1S5BD 2D0OA 2N9PC 2WACA 1Y1VG 3GDEA 4XQNA 3HOWH 1BOSA 3F2BA 4W9DA 4B6WA 5AUIA 4ZCKA 1D2BA 3OOCA 3I4MB 3IAM1 3ZJUA 2F3WA 4QUCA 3U9SA 4OX9Q 1SYEA 4DV1Q 2XIWA 3ONAB 4LJZC 3NVYA 2FCNA 3APFA 2GMIC 4HPPA 2IPKD 4PYUA 3QWNA 1J8IA 1XMQQ 3VR5A 1AW7A 1UZXB 2EY5A 5D7GA 1RTNA 3G48A 1VQMA 4GN3B 1V8CA 1ILQA 2EY2A 4DBGA 2Z8LA 5FOBB 1LFDA 1RODA 1IBKQ 3CCMA 1GKHA 2H1EA 5I2YA 2LFNA 4IJHA 4P1CC 2UWQA 4LMQD 1SIJA 4PZ7A 2EJFC 2NWGA 1E22A 4J8QA 1UEBA 4RGTA 1EQRA 1GG3A 3ICEA 4ZHOA 3PGZA 1T0YA 1A6XA 3QR8A 1SNOA 1IGDA 3UIOB 4HKQA 2JYOA 2WXRA 4X64L 1BMLC 2C5LC 3PT2B 4WJWA 1YQ3B 2IDYA 2MH7A 4KDLB 2IT1A 3W9CB 3P63A 3E5SA 3T3OA 1WFQA 4BS9A 3ZXVA 3BVZA 4XYOA 1EM7A 3QIJA 2LVPA 5GAHC 5IODA 2JYEA 1PUTA 4A3GG 2EXZA 3K59A 3F2DA 4GS3A 5K5PA 3GTPH 2A73B 2JA7B 2KYWA 3W1SC 5AZGA 5IGDA 4X3SA 1C8CA 3V6EB 5ELEA 2KTRA 1WF9A 1X3QA 5C44H 1FRRA 2RDGA 4OW0A 5EDSA 1QG7A 3AMUA 3N1ZC 2HUGA 5HURA 2ES2A 3K7UC 4LF6Q 1BCPF 4NAWB 3G6JB 1WVLA 1A62A 4A3EB 4X3KA 1GJXA 3L0OA 1WX9A 3EFUA 1KTKA 3OMCA 3DBRB 2NVQH 4XT1B 4JOIA 2UXDQ 2KXJA 4RF1A 4ILWA 3Q3NC 4KV2A 3ITPA 2VB3X 3L7ZC 4DR6Q 5IN7A 3PIPA 1PRTD 2G5DA 3AU7A 1TWGB 2FUG1 3E9SA 3W2DA 3HM6X 5LNK1 3MVVA 3VR6A 1EQQA 3ZGZA 2C7MB 4OWWB 2KMMA 1PFNA 3AEGB 5M9OA 5FLXc 1M8AA 3UE1A 4RCOA 4Z9CB 4NPNA 1IP9A 5D14A 1STHA 3D4WA 3X3NA 2JA8H 1G2TA 4LW1A 4IFDH 3A5ZB 5C4ZA 1OXTA 4GKJQ 4JK1C 4II3B 3JC66 1V9PA 5DCNA 1S72A 5C3JB 1C3TA 1XWEA 1N34L 4I65A 1U0LA 2F0SA 4ZHPA 1Q3LA 3UQAA 2Z6KC 1JC7A 2DAFA 3PRPB 3VH3B 1FMAD 1AN8A 4KN7C 4L5RC 2KBNA 4IN3A 2MBBB 3HGBA 2D9UA 2I5LX 4PMCA 3RUZA 2G4DB 1PH1A 2NN6H 2L32A 3VRBB 5E4XA 4XQJA 2Z4IA 1YN5A 3AEFB 4PS7A 4CO7A 5AEKB 2AEHA 4P73A 3QCAA 2K8BA 2INNE 2ZM6L 2FMCA 1J7CA 3P20A 2PPHA 1B4OA 3H09A 2KD0A 1FIQA 3NY5A 1EOVA 3R93A 3BJUA 4DV5L 1E6EB 3QJYA 3SDZA 1UH6A 2DNCA 1H8CA 3OIPA 1X3EA 3EA6A 4YSZB 5C3EG 3SK5A 5KHQA 3PGEA 1NY4A 2KECA 4GKJL 1K8RB 3KWVA 4DHZE 4N9PA 2AL3A 3E56A 3N1YC 3TEWA 2PQEA 2MJ8A 1JOKA 2Y0SG 4IFDG 3K5OA 3OMGA 4TRDA 4IALA 4DV3L 4IM2A 4U68A 2DZMA 4WWMA 3O65B 1E7PB 2CKZB 3U9OA 3AXCA 1KNEA 1PTOC 3MFYA 4A76A 1E8ZA 2EJMA 2HDMA 2RCNA 3OJ3A 4KY6A 4GOPA 2J0KA 5G5HA 3PZ7A 1L0VB 2BA0A 2C9WB 5C4JB 2VS1A 4FF4A 1XLQA 2FIDA 3Q3FA 1XO3A 2UXCQ 2ZW1A 1Q82C 1J19A 4KY7A 3PZ8A 5GQOA 1EOTA 1SDFA 3M4YA 3DBHB 3N20C 1TWHH 1SLJA 4Y7NH 1VJKA 1SNQA 2J0TD 4DR2L 3KYHC 3RD2A 4FN2A 4XYQA 2KNBA 1PFMA 4E3CA 4EOYA 4HDQA 2R93H 1R4PB 1C4AA 4KGRA 4OZBA 1YNJD 4IUTA 1DOXA 1BQQT 2M0AA 2EVBA 2EY6A 1OQRA 2JX5A 2E74C 1RTOA 2D62A 1D1KA 1CJEA 2JQOA 3H9DA 3QWZB 4A3MG 5C44G 5CTRC 3NVZA 5CHVC 1K83H 3BDLA 3KLSA 3K5NA 3RZWC 1JCKB 4TVAB 3VFKA 3A7AB 4KKSA 1Y8RC 5EGTA 3RR5A 3NELA 2IBIB 3BINA 4NP5A 2UU7A 3PV0A 1ESRA 4OO1I 4FADA 1E7ZA 2F0OA 2K50A 2PYKA 1IKMA 1V5OA 1V81A 4HIMA 4LF8L 2MSED 1ROEA 3TN2A 2EYOA 3MHZA 4GLXA 2O6VB 4B95A 3BU2A 4R9WA 2DLBA 4A3DH 4AQYL 5M5WH 4BY7B 1H9MA 1X56A 2SDFA 3AFPA 4BKSA 4G7HC 1R4NB 3I4OA 2B2YC 3EECA 3K8AA 1FNWA 2QEXA 3U30A 1JQYD 3AU4A 1TWFB 4OELB 2Z0EB 1VDVA 4BBNC 1PZID 2CR5A 1YJ9A 3ENEA 4C2MB 2DHZA 4M8MA 4IWPA 3LGJA 3WAPA 2EIFA 3HHMA 2IGGA 5IYDH 3I4MH 2ZT9C 1W2BA 4A3DG 3ETRA 4N59A 5DM63 1XD3B 2K01A 4TMAB 1MG8A 1EU4A 2IW3A 1KOTA 1JWAD 3HUIA 4GKKQ 2M0XA 3AFQA 3GV3A 4KK7A 2DX5B 2GOWA 4HIKA 1A5RA 2IJ0A 2LASA 4C3IG 1WXVA 4MGYE 1YEZA 3U50C 2IGDA 1I42A 5BN5A 3MWYW 4H2AA 3Q24A 4YSXB 2SOBA 4JWSC 1VQPA 1Y1WG 1MVKA 1ENAA 2KX3A 4OZAA 3GD7A 2PE9A 1HTQA 1QZGA 1C4CA 2QMTA 3DBRI 2Z6BA 1ZP0B 2Q2HA 2SNSA 2GBJA 2X6LA 3BVGA 3AEVA 4K6DA 1A2TA 4JOIC 2H88B 2F3VA 2MBQA 2PW9A 4MH0E 2YVCA 2WXIA 4DHJD 4B08A 4LJOB 1RCVD 3TIXA 5LHY1 3QJZA 4KGSA 4A55A 1YJWA 1WTPA 4S17A 3D6CA 2Q2TA 3HOUB 1ACCA 1SN8A 1Z5SB 1LM0A 2DNEA 2Z9HA 3I2ZA 3EIVA 2E2HH 2MEKA 1DYQA 1ICFB 1PGBA 4QL5A 1MSHA 5IWAQ 3KYCD 2BPSA 3AV8A 5GAEC 2NUCA 4POFA 2XRQD 2GVAA 4GLVB 5TSSA 4CKCA 1P7EA 3I63C 4A3JG 1H95A 1FNVA 4A3PA 1NSNS 4K0KQ 2WWZA 1CKNB 1UD7A 4MJSB 2JA7H 4YTNB 1I50H 4YIJA 4DV0Q 3V96A 4KI0A 1GUAB 1PTOH 1LO5D 1N62A 5C44B 4LF9Q 3HVZA 4M1UB 2J53A 1LTRD 4XWTA 2I5MX 1N34Q 3B08A 1TT5B 5H1SE 1W6KA 4G3XB 2B2VC 4ANWA 3PRZA 4P2CB 5T1GA 3TUOA 1VF7A 1VQHA 1GPXA 1MJDA 4OO1G 3LJ3A 2JE6I 2UXBL 3ZIMA 4E74A 2LKVA 1QOHA 1VQEA 5LMUQ 4LDTD 4KIKA 3RNEC 2KAJA 5IYCG 1OQYA 3LDZE 2G9DA 4IFDJ 2RDHA 2JA6H 1PVOA 4II2B 2K05A 3PHWB 4CKBA 2E5LQ 5M5XH 2HCCA 1JE4A 2Q5WD 3V05A 2FHTA 4IURA 1AFPA 4TQ0A 2A8VA 3HOYG 4JYAL 3DWMA 2FBWB 2WXPA 4IW0A 4OVVA 4DNTB 2SNMA 1SNDA 1TS3A 1NAPA 2ZEQA 4FXKC 1B53A 2UUCL 3R8BA 2X38A 1PDXA 1OXSC 3HM3A 1BF4A 4BBRB 1G6ZA 3DM3A 1PGXA 3P4QB 1HTPA 2CU1A 2DZJA 2P5ZX 1YNNC 1KRTA 4C56C 1GUSA 1SE4A 4LF6L 5DLQE 3PO2H 1UWMA 2G4SA 4F8CB 1R4QB 2W9NA 5LL6X 1NI3A 1WTXA 1EY8A 3AEAB 3PTFC 4G11A 2JA8G 4NY0A 2PZWA 2OF1A 3K57A 1SB3C 5G55A 3K0YA 1BKBA 1S3OA 2CCZA 2OXPA 4HJ5A 1A0IA 3VUWA 3FKYA 1YITA 4A93H 4DAYA 2JA5H 3FKIB 5CV8A 1NR4A 3P4PB 4YCUA 5T1IA 4DDID 1J7AA 1UE5A 3Q6SA 2VXWA 2WINB 2FJ2A 3KF6B 2I0QA 4WAAA 3J80i 4NJ7A 3PIP3 1PH7A 1VQKA 2BWES 4A3JB 4JLCA 1HA6A 4W9HA 4YWMA 4X62Q 1WGKA 4JI6L 2E75C 1V9JA 1VQ8A 5C3EH 2M8SA 2KACA 2IYDB 2MJEA 2RSUA 3NZSA 1KRSA 1TWHB 2JN4A 3HOUG 3QX1A 2V1YA 1NR2A 4HJKA 4IOAA 4ICUA 1CMXB 1VQGA 4HCEA 5BN3A 3H7PB 1PDQA 4GU2A 2YEPF 4J6IA 2WB1B 1I6HH 4GDLA 3EVQA 1WJUA 1E2WA 3I91A 3T1YQ 3MC9A 1YJIA 1PRTC 1WCMG 2JEBI 1E3PA 3P4SB 4X65L 2NS5A 2PKOA 2N9EB 4DV4Q 3L3OC 4ZYNA 3V2TA 1HZ5A 4LF5Q 2N7EA 3DM1A 2CHZA 1VQFA 4EQ5A 2PZTA 4YSYB 1JMLA 1SFOH 4AP4C 2WXNA 1FVIA 4CJ2C 3HOYB 1I35A 1STBA 3AMZA 1Q90A 1EYAA 1EIYB 1YZ6A 4C3IB 4EFOA 4R4OA 5C5LA 2B3AA 4IPHA 4K14A 1OTCA 1D5MC 3QARA 3CD6A 5CBAE 4DR4Q 4IZ8A 5ELDA 4DR7L 2B63B 4A3BB 2E5LL 1F9PA 1N32Q 4BY1G 2K8HA 1H9SB 1SMYD 3X0WA 1E5WA 2K75A 4EQNA 4IWOA 3M85A 2GBKA 4F7XA 1K9MC 2DYBA 4ANUA 4LUZA 4FO2A 5A2QE 4ABNA 1TWAB 3J81L 2V3PA 2ATWA 1KLUD 1F77A 4LNQA 4A3GB 4HJAA 3C0RB 2F3IA 4DR1L 2VQEQ 4PV1C 1GHJA 4C2MH 3PREA 3T16A 2FMMA 1EFWA 1GD7A 1EF1A 2INDC 1P98A 2IO2B 1PXUA 3KLRA 3NZUA 1ONLA 1F1HA 3IAS1 4ZRIA 2E76C 1LTGD 3JVZX 2D11A 3K5LA 2BS2B 1PZKD 4WWNA 2WU5B 2ZTCA 4ASWC 2N55A 4C00A 2N49A 2L9HA 2NB0A 1I3QB 1HCZA 2RSNA 3CQZH 3I4LA 2FIFA 2IY0B 3DBSA 3RULA 3ZNID 4DV7Q 2KFJA 1BUVT 4L63B 3PO0A 4N58A 2UUBQ 3CCRA 2ASBA 1QNUA 4QJFA 2OWOA 1X9NA 1SNCA 2K6QA 1SNMA 2PW5A 4AH6A 2L8JA 2WQYB 4B9WA 1K8AC 3HOVH 1HRJA 3KBGA 4PZ6A 1L2FA 2MUYA 3NVVA 1PTOD 3I3CA 4B9KA 2ZTEA 4PNYA 3J80c 3DQVA 1C9FA 1I5FA 2PEAA 4QUFA 2RHSB 2B63G 4A3BG 2FAZA 4PS3A 3NUCA 1F0ZA 3L0WB 5M3FH 5C6AA 3CCQA 1E9MA 1SYBA 1HXYD 5IY0A 1ZW7A 4R4QA 1FGUA 4PZ8A 1YBYA 3HOXH 2PCFB 3RN5A
chains in the Genus database with same CATH topology
1ENCA 1TKGA 1JB3A 4G57A 5NUCA 2X69A 4ZAIA 4HJGE 1A15A 4A3FB 3VRAB 1FCCC 3A8IE 2BBCA 5HHDG 1HTLD 4L8JA 3OWFA 5KGUA 1K52A 4LK1C 2A68C 2Q8IB 5BMHA 4KHZA 4OIKA 3S1QB 5BMIA 2AUKA 3VQIA 1O78A 2N9LA 4YT0B 4RCNA 4KN4C 1J7BA 4WQMA 4DK0A 1IUEA 1QCBD 2EJGC 3D4DA 4XTCS 3LX0A 4ZK9B 5M3MB 3J80E 1RD9D 1RJTA 4KX6B 2XNAC 1IGCA 2PO4A 2N9KA 3I73A 4BY1B 4KD3A 3EROA 1TS4A 5D3IB 1MD2D 1YN3A 4TQUS 4C3JB 3SE0A 3RLFA 1XX8A 3K6OA 4X3UA 3S15B 1ML0D 5D3DA 4A3IB 1AWDA 1BUIC 2NZ1D 5HI1A 3J80L 4I7ZC 3J7AF 4ZUJA 3LYYA 3LWUA 2K1BA 2OT2A 5KYIA 3ERQA 4HKZE 1E2ZA 4ZRQA 4L23A 5ISRA 2VZKD 1IKLA 3WOFA 4D2KA 2F0MA 1UNSA 1Q1BA 5DM73 1LABA 1LTBD 4KTAA 2WU2B 4J6HA 3TSSA 2LHEA 1CQFA 2HCIA 3QB3A 2NVQB 1ZPSA 2BB5A 2IX1A 3OW7A 1DJRD 4PMWA 1V1PA 4IDIA 3N52A 2LEKA 2Y5CA 1L6UA 4ZRPA 5IGGA 2F0QA 2EYJA 2QEJC 2EYLA 4DU9A 1BDOA 1T5XD 3VYSA 5EBCA 4JE3B 1UAPA 3MTSA 3NRZA 5D7GA 2LJIA 5FLXE 1EEID 1TR5A 4UDUC 3QOJA 4IQZA 4FVMA 2KJXA 3A56A 1E10A 4IUVA 4C7ZA 1GUOA 1SSNA 1QT9A 2F0NA 1GAQB 1BCPB 1H9JA 5CC4A 5DAUA 3KK7A 3RMHA 2K9XA 2V4DA 4PQXA 3J81E 1B9MA 1C48A 3NE5B 1NYRA 1XLOA 3O13A 3OHXC 2DN8A 2WNMA 3I57A 5C3WA 4A9AA 4XT3B 4QB4A 4C1NK 4HCSA 5HFYA 3SVMA 4F87A 3HOVB 2MPMA 2CU3A 1YNTE 4DA2A 5LL6S 3NVWA 2BYTA 2V3NA 5FO8B 4RNAA 4DFAA 3CRLC 4JX1C 4RGOS 2LHDA 1R9TB 2NMQA 3DEPA 2I2YA 3ZYYX 1S5ED 1C79A 3BZDB 4B9XA 3MAQA 3Q8FA 2R93B 4HSVA 1M4VA 3OWEB 3J9CA 4BWGB 1K8MA 1IYVA 5EE3A 3Q23A 2CVRA 2K5DA 2RVLA 1EFID 3S2HB 2B2UA 3KWLA 1QILA 2B2VA 4FF1A 3GTOB 4HROA 2A6ED 4IFDI 2EELA 2AQ1B 3NQIA 1Q1EA 2Y5PA 1FO4A 4R3DA 1Y1VB 1JICA 5M5WB 1SMYC 5K36H 3WOEA 4NAMA 3P7JA 2OEOA 2K5PA 4HR7B 3C46A 3SFEB 1Z7TA 4G7ZC 1I4RA 1CTMA 2R92B 1II3A 4NZLB 2B2WA 5EPJA 2F0HA 1L4ZB 3PUWA 5C2TB 2IX3A 3T56B 2IGHA 1Y8NB 2I38A 1YNJC 1HUNA 3FMCA 4DXGA 3U2SC 2IL8A 3W5VB 1UGJA 4IUUA 4RHRA 2K3UA 1NENB 1GHKA 2XRSD 5E3FA 2C9OA 1B1ZA 2E2DC 2VNUD 4R8NA 5IGEA 2QSDA 1VF5C 2NVXB 2HTME 5ELCA 2L1AA 1QWYA 2EYMA 5C0XJ 2YEPB 2F0WA 2CQAA 3SFDB 2AQ3B 2AQ2B 3AE3B 3P1HA 2PW7A 3D8GA 5CV6A 2PMZB 4MACA 1WTQA 4R8IA 3J7YW 3BWUD 2K0PA 2A5HA 5JAVA 2B2YA 2J52A 2M00A 1K53A 1B9RA 1LTTD 3AM9A 1PTOB 4Q5VA 5JPNC 4GZYC 4YWGG 2WDVB 2F0GA 1T6BX 1U4RA 2VB2X 2F4IA 3UI3A 2Y0SB 4IKGA 2B2TA 2AWOA 1C4PA 1G91A 3I9V1 3TP6A 1Y69U 1ZXTA 1I4GA 4C3JG 1I6VC 2RA4A 4NDXA 3TDQA 5DEHA 1PZJD 5CYUA 3NP8A 2O2LD 2EYHA 4WORA 3R2TA 1ZDVA 2F0FA 3NBHA 3KBXA 4EGVA 2QJLA 3QIAA 3GV6A 1JOOA 1F2LA 2XWBB 2WXLA 1WXQA 1ET9A 5FO7B 1U4PA 3PO2B 4QMGA 2W55A 3FILB 4FYDA 3U52E 1MPEA 1Z6HA 1PYWD 4DXFA 3IT6B 3VA7A 3GTGB 4JPSA 1KF6B 4A93B 1D5XC 4C80A 3NXWA 4XXEA 1IBXB 3PO3B 4DGZA 2C5CA 3FAHA 3QOLA 3HG9A 2KWDA 1BCPC 1FFVA 2M56B 2G1EA 3QG1A 1FNUA 3SK6A 2F1MA 1CZGA 1VR9A 1ZKOA 2KEEA 2F0KA 2QF7A 2WP9B 1TT2A 1WTWA 4H44C 5EKIA 4US8A 1FD7D 1QOGA 5COYA 1ZXIA 5JVG3 3AN1A 1SJHD 3C2PA 2VUMB 3RFZB 4RHSA 1K51A 2BE5C 3GTJB 3WCQA 3NBIA 1PFBA 3N6RA 1DOMA 1AP0A 4TQ1A 1ZYRC 1SFOB 3P4RB 3CIRB 1N63A 2K22A 1BR9A 4IUNA 3T4AC 1KDAA 2K5WA 1G2SA 3LB8C 5EPKA 2W54A 3PUYA 1RM6C 4M0WA 1KDCA 1SBBB 4YTMB 1QNKA 5A35A 1HPCA 2MP1A 1DOYA 4LTUA 1WTVA 1I4QA 1SNPA 2H4OA 2CJNA 4CBVA 4V190 1VZ7A 4CJ1B 1CM9A 3MHBA 4FXGC 4WAFA 2AWNA 5CMDA 3CQZB 4TKOB 2B76B 4JBWA 4H0LC 5HGTA 2RSOA 3IKJA 1FCLA 2R7ZB 2FFKB 2WDRB 4AQ7A 4EQPA 4DF7A 1JWMD 1VZ6A 3AEEB 4CQNA 1TQOA 2J4XA 4NJCA 4H13C 1YMHE 5I9PA 1AZQA 1GUTA 1O7LA 4NKLA 1CHQD 3AB5A 3F2UA 2K32A 4FF2A 1HQRD 3HKZB 1Z47A 3BS1A 2L5TA 3M3YB 3PIO3 1YN4A 3FILA 2AX5A 1JWUD 3M7NA 1SYFA 2Q8RE 2K28A 3DWPA 4RF0A 5CORA 4ZOHC 2K5QA 1OQQA 5IGFA 3MJ5A 3PUXA 1JOQA 1ZXHA 2ZXPA 1HFNA 5C3XA 3TEXA 2INPE 3AB9A 4NMZA 3AE5B 1TY2A 2A6EC 4G4KA 3GTPB 1SAPA 4LAAA 1B2TA 3FPUB 2RDFA 4WIPA 3Q8CA 3U4EG 3DEOA 1AYFA 3NWSA 4KJNA 1ZUD2 1ET6A 1O80A 2BE5D 2PMVA 3TMEA 2LY7A 1TKYA 2ZXRA 2FE8A 4U673 2M19A 4A90A 1JQ4A 1IW7D 5KNCA 4KJOA 3Q8EA 1PRTF 2NYZD 3J7AV 3QO2A 2BW2A 2BTEA 2ENBA 4LLGM 1VLBA 2MJ3A 4EE2A 3P42A 5IOCA 5C5MA 2XN9C 2KQ4X 3HS0C 4KY5A 2JSVX 1EEFD 1EWCA 1S4ZA 2KOLA 1WYGA 1HA5A 2F0UA 1D5ZC 5C4HA 2EPBA 1EIHA 3I4NB 4ID6A 1MI0A 1TZOA 1NUCA 1VMCA 1L5PA 3AE2B 2R61A 1SYDA 1QJOA 4M8AA 3A8JE 2A74C 2HDEA 5KYLA 1TS2A 2KEDA 5GXGB 3GO5A 2KN4A 1I4HA 1STEA 3D3RA 1FYCA 3RD4A 3NTIA 1K8OA 4ZYSA 1LTAD 3A54A 3VR8B 2LMCB 2F0IA 1KRHA 3DWGC 5EPLA 2ZW0A 2DY8A 1SYGA 3VYTA 4AYBB 5EE0A 2EYPA 1CZWA 1QB5D 5IGCA 2WXOA 4RA8A 2YU9B 4FNFA 1B9NA 2YYZA 2FINB 2EDGA 3CHBD 3EJIA 2B39A 1LTID 2AUJD 1JWSD 3AE6B 1QLBB 2ON8A 1EY0A 2E2JB 1BXTA 5JVH3 4MT5A 1XYIA 1JW9D 2NN6I 4RKLA 4FXDA 3S2DB 5I6WA 1PGAA 5JJZA 1SYCA 3C1FA 1FM0D 4LK0M 5H92C 1TKWB 1E0ZA 2IWHA 5CV9A 1FEHA 4YXDB 2N7JA 2B8GA 1FRDA 5IGBA 5EKKA 1DONA 3E6ZX 2XVSA 2JU6X 2WIIB 2BS4B 4P16A 1CZPA 1F2ZA 1TVXA 1OXVA 2MHVA 1EQVA 1R7SA 3K7AB 3AEBB 1PTOF 1DM0B 2J7ZA 5JEAG 1I4XA 3MC0B 2F0VA 1KH0A 2TSSA 1VRAB 4PMBA 2VZKB 1ICWA 2KHSA 1NYQA 3AE4B 1O7ZA 5C0XH 3VA5A 2A69C 2NTSA 3TP7A 3T13A 4WH4A 1B50A 2PPBC 3I90A 3MEHA 1WCMB 3FC4A 5EE9A 1EYCA 4L1BA 3FPPA 2BDOA 4HRSA 3DHQA 1ZYRD 1Q8IA 3LNNA 4DNRB 4E6IA 2RPVA 1ZEQX 3W3AA 4GDKB 3ND9A 3AE1B 3ABVB 4J3OD 2ZXOA 1I50B 5G5GA 2EKIA 2RBMA 4EVOA 1ZE3D 2E2HB 3NZ3A 4KKUA 2GB1A 3NPPA 1GUWA 3HEJA 1IYUA 5J39A 1N60A 1F2YA 1X32A 4OZCA 1KABA 1CA5A 4RWSC 2JA6B 1B44D 2BT6A 3W1SA 3GB1A 1DOKA 4KKJA 3K58A 2JZPA 2JWUA 3MZ5A 5CV4A 2G9HD 5KIXA 3S1NB 1LT4D 2KCNA 3MA2B 3M7GA 5HG2A 5E4WC 1TU2B 2GRIA 1SF0A 4RAUC 1G8ZD 4C7YA 2L52A 3NQTA 1MBYA 4USAA 1V8QA 5BN4A 5M5XB 5BYSA 1H9SA 2JQRB 1CHPD 1T5EA 1CA6A 3BVMA 1WWTA 1DOLA 3MP9A 2PZUA 3R3OA 3VR3A 5AUKA 2QKIC 1WSPA 1QOAA 2MGSA 1HZ6A 3MXUA 1WTOA 3CWIA 3VR9B 4Q0FA 1F2MA 5EQ0A 1UEAB 3NTKA 2QIEB 2BA1A 1WRIA 2L4NA 1Y56A 2WS3B 3BYYB 5FO9B 2B2UC 1P7FA 2DY7A 3M4OB 2B8FA 1V1OA 5C0XG 5J1ZA 4XDCA 1ENFA 1I6HB 1JALA 1V1PB 2WXHA 5DNFA 3ND8A 2L12A 1GB1A 4Q2JA 4J1MA 3Q69A 2B2TC 4MM3B 3GP7A 1UUPA 2EOTA 3OIQA 3EUB2 1ILPA 1YQ4B 3PUVA 1LV9A 2WXFA 3FDTA 3S9WA 3Q22A 2A6HD 1TYGB 1OXUA 2H89B 3KLSX 4K5VA 1KAAA 1CFMA 1A70A 2WXGA 2QCPX 1DZ1A 3H8HA 3HOZB 1GUGA 2D5GA 4OVZA 1PFDA 1HUMA 1STAA 1E0BA 1HEZE 5E1FA 4K6LA 5FK9C 4RFBA 2WXJA 3HVDA 1SXTA 1QQRA 4O1NA 2B2WC 1RF2D 1E2VA 1EYDA 4GDLB 1QF6A 5EJWA 5I6YA 1EQTA 1W6JA 3T51B 4WRDA 1PMRA 2LMCA 4G7OC 4GLSC 4K5XA 4ZUIA 4DK1A 1PLFA 2WP8J 2W3RA 1STNA 3KQ4A 5EE1A 1XTCD 1KNAA 3SK4A 5M3FB 3HRDD 5BMGA 1F2RI 4KHVA 2WXMA 3TP8A 4IOIE 1Y8PB 4HMJA 1DOIA 1LTSD 1SE3A 1XCTL 1PRTB 1HQMC 2K7VA 2CW0C 4V0BA 3BK1A 4CHTB 5AFWA 5K36G 3H6MA 3D4RA 1S5CD 3DMUA 2ACZB 3NTHA 1F2RC 4QCLA 1V97A 3C1EA 1G291 2RQXA 2Q8TA 2BCOA 4RKBA 2JSOA 1Y8OB 3FEWX 4ME5A 2JEAI 3LXFA 4B0EA 2BS3B 5ELFA 3S1MB 2NBFA 3E0JA 2SEBD 3IFDA 3IL8A 1ESFA 2JP1A 4HSPA 3VYRA 2K03A 2PNRC 2W82A 3B9JA 4ULLA 4BA1I 2WDQB 3WDNA 2EE1A 5CBEE 2A6HC 2F0PA 5FLXL 1J9OA 1L4DB 1S5FD 3A8KE 3BIID 3Q0AA 1RYJA 1YJJA 1OXXK 1C77A 3AECB 1A2UA 1XCQL 3OSOA 3UI2A 1AEXA 1A3UA 5FKAC 3TBIB 2PTLA 5IT9L 3AE8B 4IUPA 1CI3M 3BDCA 5JEAJ 2OHFA 2BB6A 1BO0A 2JA8B 2XWJB 1T3QA 5CR3A 4H7BA 4WFN3 1QOFA 1YNND 1F9SA 3AH7A 2A69D 2IX0A 2TMPA 2KDMA 2M2LA 4CGYB 1KFYB 3SHLA 1JR0D 1VDZA 1C76A 4XWWA 3U7ZA 1QOBA 5G3LF 1U9RA 1Q10A 2D5DA 2O5JC 3CU7A 3GTQB 3RPFC 3NUHB 3I70A 1XXGA 4KV6A 3SK8A 1IBXA 3MXPA 2K04A 2QILA 4N6EB 3NS1A 4K8IA 4B0MA 5C0XI 2BOSA 2X6GA 1LT5D 2L55A 1EZ6A 3EQLC 1EY7A 2ID0A 4K2KA 4EQOA 3A55A 4RGNA 3NK9A 4OGQC 2D2CC 1S5DD 3MXGA 1XF5L 3IXSA 1C4QA 1XLNA 3H0GB 2N0SB 4QF4A 2CW0D 3PUZA 5G3LD 4US9A 5C4XB 3JAME 2W3SA 3RZOB 1OO9B 1IL8A 1KDBA 1VCIA 5EBDA 3S17B 4ZLTF 1WD1A 3TZUA 2Y3AA 1FR3A 4WURA 4MHEA 1U4LA 2GI9A 3I72A 2F0TA 1BBXC 1XEEA 3KUPA 2OEDA 4A6QA 1TJEA 1EY6A 2PIAA 3EFXD 2O4XA 1RKNA 1K83B 2R6GA 5JOBA 5KNBA 2EY1A 2E6XA 4ZRZA 5H8YE 1FD6A 1Q12A 3NHHA 3CRKC 3DUZA 2L0CA 1NEKB 2HDLA 3D6WA 5M5YB 4FF3A 3URYA 5T8IA 2ICIA 3BDOA 3GTLB 3DXJC 1L0XB 3D31A 2WV6D 2J42A 4A3DB 2I46A 3OPOA 1EL0A 4JWUC 2NVTB 1BCPD 1RFKA 3S1RB 2KA7A 2BDNA 1VMPA 4ITKA 2EYFA 4BA2I 1JROA 3I8ZA 3B2GA 1OFFA 4MN3A 4UAIA 4DAPA 5MPOA 2QDBA 1STGA 1EIGA 2KCCA 2N88A 1GUNA 2RKSA 3PMFA 1RDPD 3V3XA 1L6VA 2E3TA 3TEYA 1KLGD 5JEAH 3BYTB 3GTMB 1ZDXA 1LT3D 5KNDA 2L11A 4OO1H 2O5IC 1DD2A 2E2IB 2I07B 1TWCB 4FXCA 1GOZA 4L6TB 2PLPA 2F0DA 1MHXA 1VZ8A 1CK1A 1NCVA 4ZQ3A 1EY9A 1NVID 1HFGA 2K6AA 1Y1WB 4REZA 1MSGA 4MIUA 3TEZA 4IUQA 2DYOA 5A2QL 2DBYA 3L4PA 2ICEC 3C8YA 5I4DA 4K8JA 3CKIB 3Q8AA 2R3ZA 1D1IA 1EWHA 3HOWB 1SSOA 1FFUA 1L0YB 1WD0A 2XSCA 1N5XA 1B3AA 2JXMB 3FRPB 3T3NA 1EZ8A 1TIID 3MFGA 4XQQA 3S16B 1AZPA 1SE2A 1STYA 2K33A 1I7HA 2MJDA 1LLRD 3DWAA 1DCZA 1SJED 4C3HB 4XIGS 1TS5A 4AS1A 2NN6G 5KEEA 3T53B 4KKTA 3SR6A 3IT4B 4K5WA 4ZKCB 3RZDB 1SEBD 1F9RA 3H91A 4L2YA 2WKCA 1JORA 5ELBA 3P1MA 1H9KA 3IFTA 3BK2A 4ODGA 4KKIA 1EU3A 1EY5A 4A3MB 4KMUC 2KUMA 4N9TA 5IIFA 2JXTA 1TY0A 1GB4A 2M9VA 3L9AX 3ZJVA 5JPMC 1MI2A 2HQEA 3VR4A 2WXQA 2CHBD 4F88A 2WLBA 4NW2A 3S14B 3N9YC 5IT9E 2Z4HA 1DGJA 1H9RA 1RHPA 1K50A 3AEDB 1TKEA 1I4PA 3EGRA 5I9OA 3ZJTA 4K2LA 4HEDA 2DWQA 2PVGC 4CJ0B 1FGBD 5CGKA 3BG3A 2WAQB 2JA5B 5BYQA 2KQ3A 5F2DA 3HRZC 1EY4A 5CV7A 3TZDA 1V43A 4HTHA 1QE6A 1A3TA 5KRUA 2NVYB 4CKEA 1FXAA 2F0EA 3H3VC 4C1NI 3JAML 4ARIA 4ZKBB 4HMIA 5C3EB 2SAKA 4XDDA 1N5WA 4YTPB 4DAVA 4XE0A 2F03A 1GXDC 4DN4M 5I2XA 1EWYC 3GS2A 1IW7C 1QKZA 3G7LA 1CQVA 1N61A 3FVQA 1C78A 4OHJA 1HHVA 3TP5A 4DQOC 2JYTA 1WTRA 3HP3A 3GTKB 2V0GA 4RGMA 5BYRA 4BBSB 2CJOA 2WKDA 4RH6A 3MXNA 2KVMA 1XLPA 2NTTA 4QIWB 1BNZA 2LFIA 4TSSA 3Q8BA 3NSWA 4HEA1 3SR1A 2V4IB 2Z1CA 4KGTA 4C3HG 3IAYA 3W5UB 1UWXA 4O42A 3A7LA 1CT1D 1D4BA 4OL7A 3P75A 4F8MA 2GA4B 4HAEA 1LT6D 2PVOD 1JWBD 2DYMA 4P6VF 3C3LA 1F9QA 1FXIA 3H94A 3KF8A 4KD4A 1MHHE 3NWTA 3HZXA 2WXKA 1MGSA 4X3TA 1JRPA 5JXVA 2ONQA 1DXMA 3LWEA 5CV5A 4HN7A 1IHZA 5E6JA 3ZQ4A 2LUMA 3K5MA 2A68D 4Y7NB 4OIJA 1LACA 3X3MA 1O7YA 4ARCA 5EKLA 1ZOYB 3AE9B 4XDXA 3GQBA 5J22A 1A3VA 3VR2A 1RWSA 4PT5A 3HOXB 1D6EC 2F0JA 4A8XC 5FR3A 2L1BA 3SEBA 2EZVA 3SXHA 3AE7B 2F0LA 3DWQA 3B2FA 2L83A 2RMMA 1X3PA 5D65A 3R2IA 3VYUA 4MH8A 1U4MA 2LGIA 2LS01 4FP5D 4A3KB 4S3SA 1S5BD 2WACA 4XQNA 1BOSA 5AUIA 3ZJUA 1D2BA 3OOCA 3I4MB 3IAM1 2F3WA 4QUCA 3U9SA 1SYEA 2XIWA 3ONAB 4LJZC 3NVYA 2IPKD 3QWNA 1J8IA 3VR5A 1AW7A 2EY5A 1RTNA 1V8CA 1ILQA 2EY2A 2Z8LA 5FOBB 1RODA 2H1EA 5I2YA 2LFNA 4LMQD 1SIJA 2EJFC 2NWGA 4J8QA 4RGTA 4ZHOA 1A6XA 1SNOA 1IGDA 4HKQA 2JYOA 2WXRA 1BMLC 4WJWA 1YQ3B 2IDYA 2MH7A 3W9CB 2IT1A 3P63A 3E5SA 3T3OA 4BS9A 3BVZA 4XYOA 1EM7A 5IODA 2JYEA 1PUTA 2EXZA 3K59A 5K5PA 2A73B 2JA7B 5IGDA 4X3SA 1C8CA 5ELEA 1X3QA 1FRRA 2RDGA 4OW0A 1QG7A 3AMUA 2HUGA 5HURA 1BCPF 4NAWB 3G6JB 1WVLA 4A3EB 4X3KA 1GJXA 1KTKA 3OMCA 4XT1B 4RF1A 4ILWA 3ITPA 2VB3X 3L7ZC 1PRTD 3AU7A 1TWGB 2FUG1 3E9SA 3W2DA 5LNK1 3MVVA 3VR6A 3ZGZA 2KMMA 1PFNA 3AEGB 5M9OA 1M8AA 4RCOA 4Z9CB 5D14A 1STHA 3D4WA 3X3NA 1G2TA 4IFDH 5C4ZA 1OXTA 4JK1C 5C3JB 1XWEA 4I65A 2F0SA 4ZHPA 1Q3LA 1JC7A 1FMAD 1AN8A 4KN7C 4IN3A 3HGBA 2D9UA 4PMCA 3RUZA 3VRBB 2NN6H 2L32A 5E4XA 4XQJA 2Z4IA 1YN5A 3AEFB 2INNE 2FMCA 1J7CA 3P20A 1B4OA 3H09A 1FIQA 3R93A 1E6EB 3QJYA 3SDZA 2DNCA 3OIPA 4YSZB 3EA6A 3SK5A 2KECA 3KWVA 4N9PA 3E56A 3TEWA 2PQEA 2MJ8A 1JOKA 4IFDG 3K5OA 3OMGA 4TRDA 4IALA 4U68A 4WWMA 1E7PB 3U9OA 1KNEA 1PTOC 3MFYA 2EJMA 2HDMA 4KY6A 5G5HA 3PZ7A 1L0VB 2BA0A 5C4JB 4FF4A 1XLQA 1XO3A 2ZW1A 4KY7A 3PZ8A 1EOTA 1SDFA 3M4YA 1VJKA 1SNQA 2J0TD 4XYQA 1PFMA 4KGRA 1R4PB 1C4AA 4OZBA 1DOXA 1YNJD 4IUTA 1BQQT 2M0AA 2EVBA 2EY6A 1OQRA 2JX5A 2E74C 1RTOA 2D62A 1D1KA 1CJEA 3NVZA 3BDLA 3KLSA 3K5NA 1JCKB 3A7AB 4KKSA 5EGTA 4NP5A 3PV0A 1ESRA 4OO1I 2F0OA 2PYKA 1IKMA 1ROEA 3TN2A 2EYOA 3MHZA 2DLBA 4R9WA 4BY7B 1H9MA 2SDFA 4G7HC 2B2YC 1FNWA 1JQYD 1TWFB 1VDVA 1PZID 4C2MB 2IGGA 2ZT9C 3ETRA 4N59A 5DM63 2K01A 4TMAB 1EU4A 2IW3A 1JWAD 3HUIA 3GV3A 4KK7A 2IJ0A 4C3IG 2IGDA 5BN5A 3MWYW 4H2AA 3Q24A 4YSXB 2SOBA 4JWSC 1MVKA 1ENAA 4OZAA 3GD7A 1C4CA 2QMTA 1ZP0B 2SNSA 2X6LA 3BVGA 4K6DA 1A2TA 2H88B 2F3VA 2PW9A 2WXIA 4B08A 1RCVD 5LHY1 4KGSA 4A55A 1WTPA 3D6CA 3HOUB 1ACCA 2DNEA 2MEKA 1DYQA 1PGBA 1MSHA 3AV8A 2NUCA 2XRQD 5TSSA 1P7EA 4CKCA 1FNVA 1NSNS 4YTNB 4YIJA 3V96A 4KI0A 1PTOH 1LO5D 1N62A 5C44B 3HVZA 4XWTA 4M1UB 2J53A 1LTRD 1W6KA 2B2VC 4P2CB 5T1GA 3TUOA 1VF7A 1GPXA 4OO1G 2JE6I 2LKVA 1QOHA 2KAJA 2G9DA 4IFDJ 2RDHA 2K05A 4CKBA 2HCCA 1JE4A 2Q5WD 3V05A 2FHTA 4IURA 1AFPA 4TQ0A 3DWMA 2FBWB 2WXPA 4DNTB 2SNMA 1TS3A 1SNDA 1NAPA 4FXKC 1B53A 3R8BA 2X38A 1PDXA 1OXSC 1BF4A 4BBRB 1G6ZA 1PGXA 3P4QB 1HTPA 1YNNC 4C56C 1GUSA 1SE4A 1UWMA 1R4QB 5LL6X 1NI3A 1WTXA 1EY8A 3AEAB 2PZWA 2OF1A 3K57A 1SB3C 3K0YA 2OXPA 4DAYA 3FKIB 5CV8A 1NR4A 3P4PB 5T1IA 1J7AA 3Q6SA 2VXWA 2WINB 2FJ2A 3PIP3 4A3JB 1HA6A 1WGKA 2E75C 2KACA 2MJEA 1TWHB 1NR2A 4HCEA 5BN3A 1PDQA 2YEPF 2WB1B 3EVQA 1E2WA 3I91A 1YJIA 1PRTC 2JEBI 3P4SB 2PKOA 3L3OC 3V2TA 1HZ5A 3DM1A 2PZTA 4YSYB 1JMLA 2WXNA 4CJ2C 3HOYB 1STBA 3AMZA 1Q90A 1EYAA 4C3IB 5C5LA 4K14A