1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
4BWGB 1JWSD 1EWCA 1AW7A 5I4DA 3BYYB 2AQ3B 3GP7A 1YN3A 2XRQD 1SXTA 1RF2D 2AQ1B 4DXGA 1BXTA 1L0YB 1SJED 2QEJC 5ELDA 3URYA 1JWUD 3BZDB 4RGTA 1STEA 1M4VA 3DWPA 4RHSA 3R2IA 1EU4A 1LT3D 5ELCA 1S5DD 1TY0A 1YN4A 4C56C 1TS4A 2IJ0A 2R61A 1T5XD 1S5BD 1S5CD 1HXYD 3O13A 1I4GA 5D3DA 3SEBA 1AN8A 5FKAC 5TSSA 1PZKD 4L63B 1B1ZA 1LTRD 4K6LA 4OHJA 4O1NA 1SEBD 3CHBD 1MD2D 1JCKB 1TY2A 3DWQA 3BVZA 4TSSA 1LTBD 1LTID 1JWMD 2AQ2B 3R2TA 3V05A 4NZLB 1V1PA 2O2LD 2ICIA 1HA5A 3EA6A 1ENFA 1PZID 2WV6D 4L6TB 1EEID 3BVMA 1KLUD 1PRTB 1RDPD 3BYTB 1EEFD 1CT1D 1LTAD 1JQYD 1PRTC 4Z9CB 1SE2A 1D6EC 1LT5D 1UNSA 1V1OA 1I4RA 2RDHA 1D5ZC 1FNUA 1RCVD 3MFGA 1CQVA 1SBBB 3W2DA 2CHBD 1EU3A 1PRTF 3MC0B 1LT6D 4RGOS 1PZJD 1ET6A 2NTSA 1FNWA 1ET9A 2XNAC 2TSSA 1FGBD 1LTSD 3KLSX 1L0XB 1KLGD 4RGMA 1EFID 1LO5D 1DJRD 1I4HA 2NTTA 2XRSD 3TSSA 1PTOB 3EFXD 3DWAA 1PRTD 4RGNA 1CK1A 1LLRD 1XTCD 1F77A 1PTOC 5FK9C 4RCOA 1BCPB 1LT4D 1YN5A 1G8ZD 1CHPD 1D5XC 1BCPC 1S5FD 1UUPA 2G9HD 5ELEA 1PTOH 1S5ED 1SE4A 1PTOF 1TS3A 1XXGA 2J4XA 3OWEB 4RFBA 5ELBA 5ELFA 1CHQD 2RDGA 5D3IB 1SE3A 1I4PA 1BCPF 4RH6A 1PYWD 1TS5A 1B44D 1ESFA 1KTKA 1TS2A 4ZYSA 1LTGD 1JR0D 1LTTD 1RD9D 4UDUC 4DXFA 1HQRD 4RHRA 1PTOD 1V1PB 2SEBD 2Z8LA 1FD7D 1FNVA 1I4XA 3R8BA 1HTLD 1BCPD 1D5MC 2IPKD 3BVGA 1GOZA 1DYQA 1I4QA 1QILA 1SJHD 2XN9C 2QILA
chains in the Genus database with same CATH superfamily
3UE0A 1VD2A 1JWSD 1BF4A 2B63G 4CJ0B 1V5OA 1MKHA 4ZHPA 1B8AA 1GKHA 1SXTA 3KUDB 2MHJA 2EXDA 2NN6G 3URYA 4DR3Q 2MBOA 2K50A 1ROEA 4XQNA 2HDEA 3FRPB 5DPWA 2LRUA 5J3BA 2ON8A 1N32L 1WXVA 3AE7B 1MBYA 2KDFB 2PVGC 2X6GA 4L8JA 1ZXIA 4XYCA 2F1MA 2KECA 5C4XG 3Q8DA 2GI9A 1YQBA 4DF7A 4OZCA 3LX0A 1KRHA 3RLNA 2D3CA 5D3DA 5FO9B 1Q1OA 4ME3A 2INNE 1L4ZB 5HGQA 3BU2A 3FDTA 1XCQL 1Y8PB 4PYZA 2B2WA 1J7AA 3AE2B 4F87A 4OWTB 3NXWA 3A74A 1SFOH 1OTCA 3AEDB 4EQPA 4ZRZA 4KY7A 2K0PA 1SMYD 3AEVA 4HJGE 1TWGB 1EQQA 3T8MA 2L3ZA 3P4RB 3IRBA 1IBLQ 1WM2A 2F4VQ 3NP8A 1F2YA 1LTAD 4OGQC 1IBKQ 4CKEA 3PO2G 2UXCL 2PW7A 2JQRB 1SSOA 1BBWA 3J80i 3MVVA 4C3HG 1PYBA 1OQRA 2JSVX 4I6LB 3DBHB 3QQ8B 2L76A 4QQBX 3QO2A 1TWHH 4KMUC 4AQYQ 1PFBA 1WFYA 3J81j 1TWCB 3BG3A 4MDKE 3ZDMC 2Y0SG 4C3IG 2E2JH 1E5WA 4XIGS 4ZCKA 4YL8A 5BYSA 2B2YA 3RMHA 1JALA 3R93A 1LTSD 1AFPA 1K28A 1NTGA 4KJOA 4A3JG 2LEKA 1SRUA 1R4NB 4FXKC 3U50C 3TSSA 1N34Q 2NR2A 3EFXD 2N1WA 2CWAA 1IBML 1CK1A 4MACA 1FYCA 4A3KG 2LHDA 3VVWB 2J42A 2JEBI 3Q24A 3IAS1 4A3IH 4HR7B 3RD4A 2KN4A 2MUYA 4O0AA 3A5ZB 1WWTA 2N7EA 5ELEA 2PO4A 3X3MA 3NVZA 1PTOF 2WU2B 3I55A 1Q12A 2A6ED 5ELFA 1I6HB 4DV4Q 4Y52H 5D3IB 3CCLA 1NYQA 2H89B 2JU6X 4DUYQ 3DHHC 5BMGA 4BZAA 2B2WC 3Q3OC 4YSXB 1UWMA 1TS5A 1VQJA 3K7AH 3I4MG 4BBSH 5KGUA 3FKIG 3P4SB 1SROA 4N59A 3SR1A 4UP7A 1QVFA 3E9IA 4II2B 1PDQA 3RZWC 4PK1A 1M8AA 1QQRA 4K8JA 2A68D 2KWVB 1EYAA 4N9TA 4A3FB 4C2MH 1GO3E 1R4MI 2NVYH 1JRPA 4DR4Q 4KD4A 2D3BA 4MSMB 4XX5A 3FP9A 3L08A 3TREA 1AW7A 4CBVA 2RMMA 4LW1A 3MEFA 3ULPA 4LFAL 3B1LX 2DNEA 1PH9A 2M0XA 3I91A 3TJPA 3DHGC 4DV6L 2OTLA 1IXRA 2X69A 3OG5A 4RKLA 1VQ4A 3UGBB 1H9MA 4OIKA 4A93B 3I70A 2B39A 1WX8A 3VDZA 4DQOC 1KIXA 2KJRA 4G3XB 1K3RA 1B7YB 2K52A 1IBKL 1EIYB 4MJSA 2B2YC 3RZDB 4A20A 4X64Q 2F0KA 1C77A 2I1JA 2KFJA 2J0KA 1I3QH 1E10A 3NRZA 2C9OA 4DV0Q 4J6HA 1XQQA 5JVH3 5K36H 3A0JA 4ZKBB 2CVRA 2MLBA 3Q69A 4L63B 3PREA 5EE1A 3ONSA 4A3LG 5IP7H 2LUMA 2B3GA 4X3UA 3Q8AA 1XPOA 4K0KQ 2F03A 3PUWA 2QSDA 2F0MA 1EY9A 2CWPA 2INDC 2W3RA 4IUMB 2MW5A 2V3SA 3H0GG 1JRUA 4RNAA 5M5XB 3F2UA 4B3ML 4A9AA 1DOLA 2WXNA 3AQQA 3ZDTA 4IWQA 1SN8A 3A55A 2DAJA 3DBLI 1F2RI 4OVUA 2GN5A 4X62L 4GNXB 4OO1G 2LGIA 3GTLH 2CHZA 2DZKA 1KRSA 2JJQA 5M3MG 3A8KE 3ULJA 1WJ4A 2D5GA 1EUVB 4ZYNA 1QWYA 2RDFA 1UNSA 1WOCA 1I4RA 1CA6A 3HOZH 4A3GG 4HKZE 4LLGM 4W9JA 4WWOA 2ZJQA 1ZP0B 4IFDH 5LXIB 3BDOA 1PRTF 5A2QL 2UUBL 1DXMA 4FJYA 4LDTD 1RRBA 1E7ZA 4DU9A 4EQOA 2H88B 2NTSA 3GO5A 2MP1A 3PO3H 1C78A 4ARCA 3J81L 4KV2A 5D7GA 5L83A 4NW2A 1FM0D 2ES2A 1T5EA 1IZ6A 4ZQ3A 2NUCA 4KI0A 2KEDA 1VCBA 4QB4A 2WDTB 1N62A 3TCAA 3OIQA 4B9KA 2DY7A 4NJ7A 4JYAL 2VXWA 3ERQA 2KJHB 2DAFA 3KLWA 3E3XA 1YN5A 3R3OA 4FF1A 1CSQA 1J8IA 3QOJA 1SYGA 2KN5A 3HOVH 3CCVA 1LTLA 3GTKB 2JPHA 3JAMc 2L1AA 4PZ6A 3MP9A 4JI3Q 1Q90A 2D0PA 1I94L 5C3JB 2O6VA 1EWHA 2FUHB 4RWSC 4BY1H 4FHKA 4POFA 3KYHC 2L8JA 3NY5A 3J80L 4DV0L 4A75A 4JI7L 1V5TA 5C3EH 3A9KA 3I57A 5I2XA 2Q2TA 2Y5BB 2GBJA 4J3OD 5CV7A 3W5UB 1D4BA 2BVCA 1V1PB 2G4DB 5FO8B 1Q46A 3J7AV 2AKWB 4K0KL 1D5MC 3UE1A 3CSFA 4KV6A 4A3BH 3UIPB 1E8YA 2Z6BA 3ZGZA 1J0GA 3EROA 2F3IA 3KFUA 1ZW7A 2ZTCA 1F2ZA 1SYBA 4KN4C 3J7A5 2K4KA 3IVFA 3EIVA 4EVOA 2C9WB 3LWEA 5JEAG 3BZDB 1F0ZA 1NBWA 1TWAB 4R4TA 5IWAQ 4MNOA 1VQCA 4G0NB 4YXDB 2LXKA 4B3SL 1MG8A 4NDXA 1PDXA 3S1RB 5CHWA 5CV4A 1K8AC 3GTJH 3EFCA 5IO9A 2IO3B 2KQ7A 4OIJA 2F0IA 3A5UA 2QHOA 4BOSC 3DBRB 2I5HA 1JWBD 5TSSA 2B63B 4H02A 1L4DB 3HM3A 2DNFA 2OCEA 2LMCB 3Q6SA 4WORA 1DONA 2OXPA 1GD7A 1TY2A 3GTGH 4IUVA 2PPBC 4BY7H 3M4YA 3GDEA 4GOCA 4GLVB 3JC66 3QWNA 4DNIA 4LDTB 2BKRB 3TIXA 1WTPA 4WQMA 1M90C 4KLKA 2M19A 3TUOA 1PGXA 4UP9A 3ZYYX 4B3RL 2M8SA 3TBLD 1JQ4A 3TEXA 1KL9A 4NMZA 1EWIA 5C4XB 1GG3A 1HA5A 4KIKB 4IPCA 4L6TB 1E7PB 1V49A 3P42A 2UU9Q 2NBWB 3Q8CA 3HKSA 1CTMA 1LUZA 1P16A 3PGZA 1EYGA 4JI5Q 2NVQH 2RHQB 2ZXPA 4C3JB 5AJ3L 3F2CA 4K1RB 2SNMA 1YITA 3H91A 4RA8A 4ARIA 4DA2A 1T0RC 1JT8A 2EYJA 5M3FH 3NTHA 4Y7NB 5IT9E 2G45B 1VQAA 1QJOA 2KCNA 1QG7A 3W2DA 4IFDJ 2FUG1 5IIFA 1O78A 2DNCA 2MBQA 4RGOS 3G71A 4KKUA 1WD1A 1ET6A 3L7ZC 1XLNA 2IL8A 2L00B 2XNAC 2MBEA 4FO2A 3BZCA 5C6AA 2REXA 4EX5A 4HIOA 3I7FA 4HWIB 4BKSD 3KUPA 3PUYA 4IN3A 4ULLA 4KKJA 3VR9B 2KWDA 2PE6B 5CMDA 4LF9Q 4G11A 1SGHA 1C0AA 2PW9A 2L5TA 4TKOB 4DV7Q 4GDLB 1OXVA 3HOXG 4QJFA 1SSNA 1SYEA 1A0IA 3T3OA 3ETRA 2BDNA 4ID6A 1K51A 1LM0A 3DEPA 2JA9A 2N7JA 4C3HB 2FMCA 2UXDL 2JE6I 4DAPA 2ZEQA 2CW0D 3SDZA 4BBRB 2ZNVB 2H4OA 1XLQA 5DAUA 1L1OB 1H9SB 1Y1WH 4B9XA 4JI6Q 4A3DG 1SE3A 3K5MA 3FHWA 4H13C 2E2HH 3U4VA 4JL9A 3SFEB 3AB5A 4PS7A 3CC7A 1SNPA 2GVAA 2UUCL 3W9CB 2FCQA 2KQSA 2SEBD 1K3BC 1R4NI 3ZJVA 1ML0D 3NPPA 2VUMB 5CV5A 3H09A 2R7ZB 4WH4A 5JAVA 1SE8A 2KMAA 3WOFA 5E6PA 1G6JA 3S2AA 3ERSX 2M2LA 3K7UC 2B2UA 5DNFA 2PZUA 4UPAA 4DR6L 3DPDA 2CQAA 1O7YA 2NWGA 3BDCA 4LUOA 1W6JA 3AE9B 4JV5L 3TS0A 2C7HA 4WWNA 1UGMA 4LF5Q 2WU5B 4XQJA 4F7ZA 3T1HL 2CHXA 2ZCCA 2M17A 4FLHA 3MEHA 3FKIB 5C5MA 1YHQA 1LT3D 4ZRJA 3WCQA 3ZRFA 2DZMA 2V1YA 4JI0L 1WYGA 1QUQB 1CUKA 3CF5A 2WP9B 1K8OA 2V4LA 1RTOA 5IYBH 4LFCL 2EYMA 3AE4B 5I6YA 4KZ0A 1E0ZA 2K03A 1AN8A 2RA4A 4DHZE 3H6MA 3V61A 1ZXTA 3I4NH 1GM5A 3L4PA 3QC8B 2F4IA 3CHBD 4USAA 3U52E 2MEKA 1GUOA 4C00A 2XK5A 4KDIC 5FO7B 2WLBA 4JI4Q 3CD6A 5DLQE 1PGAA 1TVXA 4HROA 4DWFA 2EY6A 4LNNA 1Y8NB 2R7DA 1Y14B 2E2DC 4CHTB 1R4PB 1SNDA 1XO3A 2Z0DB 2HD3A 2FCSA 4URKA 2GMIC 4CKBA 1NY4A 3BVMA 4FADA 4NPNA 4JI6L 3C3LA 2EYHA 1FCCC 1WE6A 1FIQA 3QR8A 5C2TB 2R3ZA 3CCUA 3ABVB 1ESRA 1D5ZC 3KJOA 5IP9G 3MFYA 4GKJL 1HRJA 1EWYC 3G6JB 1YEZA 2B2UC 1EIHA 4JVZA 2ZNVC 1ZEQX 2LI5A 2UUAL 3PLUA 1GB4A 5KNDA 3PT2B 2YV5A 3TMEA 2B8GA 4YWGG 2F0TA 1P7EA 5CC4A 5AFWA 2DWQA 4ODGA 1A63A 1KH0A 2JA8B 1HNXQ 3AEBB 3S1MB 2VQEL 1EFID 1HCZA 2N78A 2NTTA 3K8AA 3EGRA 2AUKA 3SK5A 1B70B 4RGNA 1N5XA 1T0YA 1R9TH 1LLRD 4LF5L 4UP8A 4ANWA 2CCZA 2PEAA 4LF6L 3P2BA 4A3GB 2RDBC 2JA5H 4FP5D 3STBD 5H92C 2HUGA 1XMQQ 4JI8Q 1AEXA 1PTOH 1EOTA 5CBAE 5LXHA 2JSOA 4NAWB 5DM73 5KYLA 2SOBA 4GOPA 1XT9B 3H8HA 1E0BA 3NBHA 1T0SC 5LNK1 3S2HB 1DOMA 2NVXB 4DAVA 1P98A 3W1YA 1YNJC 1ZE3D 2VRRB 2KHIA 3NELA 2NBFA 1E1OA 3KF8B 4IOIE 1WYDA 5JJZA 3CWIA 4HCNB 4XDXA 1QOAA 1YIWA 1ENAA 1OXSC 1CZPA 3N30A 4IM2A 1VZ7A 3QCAA 1UE1A 3QARA 2AQ3B 5FLXE 3I3CA 1X56A 1WJ6A 2QILA 2BE5D 2VQFQ 1GJZA 1S3OA 1HTPA 1L5PA 2W54A 2JA6G 5ISRA 2YVCA 3SU8X 3WAPA 2D3GA 2V4IB 3UQAA 1DOYA 4YHHQ 4MTKA 4DR2L 1HR0Q 2RBMA 2BF8B 2QDFA 4WJPA 1VQDA 1MI0A 3ZXVA 2R92H 4RGTA 3VYTA 2CS4A 4GGQA 1HH2P 2QDLA 3KF8A 1UE7A 4AUQC 3R2IA 4A93G 2BA0A 1BKBA 5E6NA 1A8VA 2L4NA 2WDRB 2R7FA 3WAOA 1RTNA 2RSNA 4NAMA 2G3QB 4HJ7A 2R61A 1T5XD 2KLCA 3IL8A 3L9AX 3DWMA 4P6VF 2KBNA 2KOLA 3NK9A 3P1MA 4JG2A 1D8LA 2D11A 3S17B 2GBRA 4W9LA 1B3AA 4N9PA 4UAIA 5T8IA 4KHPQ 4FBJB 3DWQA 1F9QA 1UELA 4AS1A 2I38A 2Y5CA 4B08A 5BYRA 2L32A 2ZJDA 2E5LQ 3HOYH 2K25A 1V80A 4CGYB 3PSEB 1V9PA 4GOPC 2FIDA 1WYWB 3QHTA 3GTOH 4QMGA 1YQ3B 2KDEB 4IPGA 3GTPB 3M3YB 1GUWA 2IO1B 3O65B 1BO0A 3UINB 1OGWA 1Z6HA 4AQ7A 5IOCA 1C9OA 2FFKB 2K5DA 4HXDA 3Q8FA 3TEYA 3M3JA 3K57A 1QVCA 3PHXB 4DR5L 3VDYA 1H9KA 3HG9A 4LNOA 2Q8RE 4MIUA 4FA6A 1K83B 2WDQB 1XD3B 1TXYA 3PSIA 1NJIC 1QZEA 2NN6I 1FJGL 4YSYB 2A5HA 5IGCA 2Y0SE 1DZ1A 5HKHA 3T16A 3RNEC 2EY5A 1WCMH 2J0JA 3L0OA 2DJGC 3VR6A 2PMZB 1GC6A 1XX8A 2FXQA 3KK7A 4BA1I 4EUTA 2WKCA 1UWVA 4HDQA 3M9BA 4EOYA 2VQFL 1BUVT 4DAYA 3KDFA 3KLSA 1K73C 2K5WA 2B2TA 2XRSD 1E8WA 2ZM6L 3WIMA 3H15A 3S16B 1Q5WB 3ZQ4A 2LS01 1KXLA 3D4RA 2H5XA 2VL6A 3OSOA 1WX7A 2ZVNA 4PMBA 3BY4B 5LLIA 1G8ZD 5D2MB 1CI3M 1HZAA 2I5LX 1UD7A 4RCNA 2EXZA 2PCFB 3VUYA 4OONA 3LYYA 5GXGB 2K6AA 4AJWA 4KGRA 4XYQA 1B9NA 1GAQB 4UHVA 3S14H 2QGQA 3D8GA 1TZ1A 1UGJA 2E76C 1ESFA 3KJPA 2L55A 4ACFA 2JXTA 3AE6B 4JPSA 2KTRA 2L0CA 3F2DA 3CCEA 4P71A 1IW7D 1VZ8A 5I9OA 1A6XA 5IA7A 2LGXA 4ZLTF 3VXWA 3CRLC 3BINA 3HOXB 1IPGA 2WHIA 3JSVA 2Q2UA 3AE5B 1JMCA 1EF5A 1D7QA 1R4QB 3KVFB 2D0OA 2HCCA 2PZWA 4LCDE 2O2VA 4B3TL 1VQ9A 4DKAC 1NE3A 4A3EG 2WXFA 2PIAA 2ID0A 2VZKD 4JC0A 3BYYB 3HZXA 1YN3A 4AP4C 1PV4A 3J9CA 3CIRB 1L0YB 1UZXB 2QEJC 1Q8IA 1IKLA 2JVCA 2KACA 4P7IA 1J6QA 3D3RA 1MSGA 3S1NH 3RN9C 3DVNU 3CQZB 2N3SA 4BBNC 4HKQA 1IYVA 2PYKA 1XNQQ 1HEZE 3OLMD 4MM3A 3HUIA 2RCNA 4TVAB 3W1SA 3E6ZX 5FJ8G 3HOWH 3K9PB 4BKTA 2MCNB 1YN4A 3CF6E 2WKDA 1K9MC 4PV1C 2M4NA 5FOBB 3VH3B 2PQAA 1S5BD 1KDAA 2B2TC 2PZTA 2PJHA 2HDLA 4HJ9A 3AXCA 4LNFA 4DR1L 4REZA 3V3XA 1N9WA 3EFUA 3ALBA 3T53B 5GMVA 1O7IA 1PZKD 4IOAA 1T6BX 5FR6A 2Z0SA 4ITKA 2JA7G 2WDVB 1F9SA 1ZKOA 4DV3Q 2E2IB 1MHXA 5J2RA 3H1UA 5GROA 1LTID 2IHEA 3FILA 5EE9A 1NR2A 3UF8A 2KUMA 4IPHA 5J39A 1D2BA 3ZNZB 1HQMC 1AYFA 4CO7A 4R3DA 4WJQA 3EBEA 3BDLA 3VTUA 5BMIA 1J7BA 3AV8A 4BFRA 5AZFA 2ASQA 2M1MA 1TWHB 1MGSA 2OF1A 4P72A 4A3MG 3RNBC 3KF6A 3VR2A 4MZ9A 4NPSA 3TL5A 1JJ2A 2I2YA 1X3PA 2G5DA 3RNAC 1V1OA 3VR3A 4C3JG 1V97A 1B50A 3D4DA 3KH0A 1G2SA 2BE5C 2IHFA 4JBJA 1C4PA 1FXIA 2KA7A 5I6WA 1VZ6A 3B2GA 1Y1VG 1PYSB 1YNNC 4ZRKA 1HPCA 3RFZB 1WTHA 1XJVA 3IHPC 4X3KA 2KQ4X 5JOBA 2OHFA 2F0JA 2LKVA 4IO9A 1QCBD 1SNOA 1OEYJ 3SDLC 3CMEA 4WAAA 4WURA 2MJEA 2N7DA 1TTNA 1XF5L 3DBSA 2HDMA 1EFWA 1S72A 2BQQA 3PUVA 1V8QA 4LJOB 1FCLA 4IURA 3OAWA 4QIWB 4JI1L 3OTOL 1QLBB 1TYGB 4Q2JA 4BBSB 1BCPC 4K5WA 4BVUC 5IT9c 1VQ8A 4MSQB 2VZKB 3M7GA 4XT1B 1WX9A 3S2DB 3VA5A 1I6VC 1IYJB 4BBRG 5EKLA 1I4PA 3CMAA 1IGDA 4M01A 2N49A 2JZ3B 2F0WA 3I4OA 5JHAA 4MGKE 4C2MB 4R4QA 1BNZA 3CCJA 2QCPX 3C46A 2K1FA 4RF0A 4XGAB 2L7RA 2E3TA 3CP0A 1Y8RC 2J52A 3HOUG 4L23A 4JWUC 5IYDH 4AYBB 2RD0A 1TWFB 3NENA 2YU9B 1V2YA 2K8BA 4LFBQ 1WM3A 4GS3A 1PMRA 4ANXA 4D2KA 4DR3L 2VUMG 3H3VC 1I4QA 5K5PA 3ECIA 3VH4B 1SJHD 2R7ZG 2DBYA 1EQRA 2F52A 2NMQA 3KOJA 4BWGB 3EECA 4FULA 4C7YA 2AWTA 1E7UA 5GADC 4MH0E 3DUZA 1HZCA 2C60A 2KVZA 4TQUS 2N9XA 2KANA 2Q8TA 2WB1B 5EPLA 3AU7A 1STEA 3CAMA 5HGTA 2OEDA 1U4PA 3CC2A 1CZWA 3GV6A 2BGFA 3ND9A 1BBXC 4IPDA 3HKZG 1M1KC 4BXXG 1A70A 1PFSA 2VW9A 2G1EA 2JX5A 4FXGC 5F2DA 2WNMA 2Q5WD 3C2PA 4QY7A 1EY8A 2K22A 2EE1A 3HS0C 2XTIA 3PV1A 1C3TA 4K5VA 2LHEA 2JA6B 1SNMA 3NHEB 1TWGH 3QIJA 4AOFA 1OXXK 3Q23A 2A69C 4K7WA 5IYCH 3NBIA 3KYCD 3WANA 1IBXB 5EPJA 2QMTA 4AIMA 2WFWA 2TMPA 1LTBD 4TSSA 1TR5A 1QE6A 4Q5VA 1IBLL 4QAYA 1ACCA 3GTLB 2F4VL 1ZYRD 4IOCA 5HFYA 3ICEA 3HRDD 1JB7A 2ICIA 3HOZB 1Y56A 1PZID 4PMCA 3JAML 2HHHQ 5LMNQ 3DXJC 5IGGA 1XMOQ 1HTOA 3PRMB 4NB3A 2MH7A 2EMSA 4HJ5A 4AQYL 1FL0A 2RF4A 2KAJA 4HPMB 3LWUA 5C0XH 1XNRQ 1K8MA 2XEWA 4A3CH 4GN1A 2EKEC 5IE8A 1IBXA 1TT5B 4WJ4A 2E6XA 4C1NI 2RDHA 2B2VA 1NBFC 1MI2A 3GB1A 4J1MA 3H7SA 5ELNA 1SBBB 3VFKA 1EIFA 2A6HC 1O7LA 3MC0B 1FD6A 3AEEB 5FLMG 4FNFA 1N34L 3P20A 3SK4A 4BS9A 1TBEA 1B4OA 2AYOB 2CJOA 1L0XB 2F0HA 2FCNA 2HT1A 4EZJA 4JBMA 1I6HH 3EQLC 4DK1A 2JA8G 3RNGC 5G3LF 3RYTA 5G55A 1JE4A 3DWAA 1PH6A 1VQEA 5C44G 1K8RB 2DZJA 3CCSA 4DV4L 4DUZQ 4BY1B 2JZZA 4DUYL 3VRBB 2IBIB 3SGIA 5C3EB 3ZNGC 3LNNA 4A3FH 5ELOA 4A8XC 3IFDA 2MWSB 2PKOA 2MJ8A 2IGGA 2NPTB 4J15A 2LD9A 4HAEA 1JR0D 1NVID 1E3PA 2D07B 2HTHA 4DR4L 1RYJA 1ILQA 5CHVC 3VUXA 3I5JC 5AEKB 2A4ZA 4K7UA 4GNXA 3K80C 2WAQE 2JF5A 1W3SA 4HCSA 4A90A 1SIJA 1A5RA 2H1EA 4G57A 5C3XA 3RZDH 3FVQA 4M8NA 4QGUA 3UDXA 4I65A 3PF5A 1Q82C 2W9NA 2JEAI 4IWOA 1VQ6A 3NWTA 4LWCA 2NVTH 1Q0WB 4GDKB 1BQQT 1ICFB 1GUAB 5EE3A 2I46A 3GTMB 2KOXA 4X64L 3FMCA 1YNXA 2B2VC 2K14A 3GTQH 1AH9A 1JOQA 1C4AA 2RPVA 5BR8Q 3RD2A 3I72A 2MX2A 2BBCA 4LF8Q 3I73A 4HPLB 5GAEC 3SXHA 5M5WH 4BA2I 1JJGA 4BBNF 2A73B 1P3QU 3N1YC 1FMAD 1SMYC 3KBXA 3PUZA 4F7XA 3M4PA 2N9KA 1LGRA 2IJ0A 3GTGB 3GOEA 4R1JA 5FLXc 4NY0A 1UBIA 1WGGA 1QNKA 3O13A 4A3EB 3MZ5A 1L2NA 2K5NA 4CJ2C 1TKGA 2FNJB 5GAHC 3VR8B 4HCEA 4RMAA 1SEBD 4NQLB 5J18A 4WAFA 2MFIA 3SHLA 3J7AF 1FEHA 3BVZA 1ASZA 2WXGA 1TZOA 4M00A 5IOIA 3QJZA 3R2TA 2NVQB 3TS2A 1S4ZA 1J19A 4UY8C 3QOLA 3APFA 4K2LA 4H7BA 2CJNA 4TV3A 1DCZA 1V1PA 1RL2A 4KKIA 3NWSA 3SK8A 5M3FB 4G7OC 3L54A 2E75C 2K8HA 5HI1A 5C4ZA 3H3VI 3PVLA 4ZRQA 4KN7C 2IGDA 4GNXC 1BT0A 5BN4A 5C0XJ 4HJAA 3H7PB 3LXFA 2O4XA 2YYZA 4LF4Q 2JA7B 1VQHA 3GS2A 1WI5A 2SDFA 3MFGA 2R93G 1C79A 1DD2A 2SNSA 2VY3A 2ZW1A 2WXKA 2ZTEA 1BOSA 3C19A 1PZJD 4WRDA 2TSSA 2A6EC 4IUTA 3M4QA 2F0UA 3GTKH 4GKKQ 2WQYB 3SK6A 4C1NK 3HK0A 1PLFA 3T56B 1KOTA 1WGHA 4P73A 3TDQA 3QAQA 3C1FA 2KHSA 4A3MB 1C8CA 3GZNB 4JI3L 4GIVA 2LJIA 4IW0A 1G6PA 4PS3A 3PO0A 2FE8A 3DHQA 4I7ZC 1MPEA 2L83A 1PH4A 2A68C 2LFNA 2LMCA 1X3EA 1N33Q 5C5LA 3MHZA 1S5FD 5CX3A 2K5VA 2NB0A 2BDOA 2KENA 1F9PA 3OIPA 4EGVA 4FVMA 5LL6X 3UDGA 1N63A 1YNTE 1Y1VB 4QUFA 2MRPA 1BCPF 3WALA 4CJ1B 4RM8A 1B44D 5HY6A 3CCQA 3D0FA 1YJNA 4KIKA 1FFVA 4APVA 1STNA 3AE1B 3MHSD 1PTOD 3IAM1 5DPRA 1XWEA 1F2MA 2ZW0A 3D6CA 2YEPF 2EKIA 1QF6A 1EY4A 4FXDA 3ZNID 2VS1A 5A35A 1DYQA 4NXNQ 4HJKA 5G2NA 1TIFA 1NNXA 2XN9C 3TP6A 5IWAL 2MBBB 4DAMA 4DDGD 3TP7A 1MFWA 2C7NB 2RGFA 1WRIA 4CHKA 2VH1A 2JK8A 4TUUA 3DBHI 5L37A 1S40A 1OXTA 3IFTA 1UEAB 2B63H 3D32A 1IYUA 1OQQA 3L2PA 2ZPNA 2ZJRA 2NN6H 3AMUA 1ZUD2 4J6IA 3ZXRA 3ML9A 3HOUB 2QC8A 1TY0A 5C0XI 3CCRA 1EF1A 2QIEB 2RR9A 3T13A 1N61A 2VH2A 4GDLA 1Q1EA 1W6KA 4ZKCB 3K9OB 2F0DA 3P4PB 1SMXA 2DHZA 3Q22A 2PMVA 1H4RA 2N8NA 2WINB 3SEBA 1J5EQ 1HR0W 5C4XH 2WXIA 4KY6A 2HJ8A 1EY5A 1B1ZA 2BOSA 5CYUA 2KWUB 2LVQA 1YHAA 1L1OA 3A1QB 1H9SA 1Z9FA 3AFPA 2KQ3A 2FIFA 2KZRA 4DV2Q 1MD2D 4DV1Q 2HCIA 4IWPA 2JUOA 4TKNA 4W9FA 4E71A 1U4LA 1WTVA 1TU2B 5BMHA 2UU9L 4JI5L 1F1HA 1N60A 4XDDA 5C1ZA 3HKZB 3ND8A 4POGA 1I50H 3Q3NC 4KGSA 2Z9HA 1WGYA 3OMCA 2ZT9C 1PVOA 4X57B 5GQOA 3UDIA 4LNIA 2A1AA 1KD1C 2UXBQ 2KC1A 1H95A 2G9DA 1GHJA 3IAYA 5J22A 4FF2A 1VQNA 2DYOA 4JQWC 2KD0A 4PYUA 3G6EA 3AE8B 4X66Q 3BWUD 4NQKE 3ZJUA 3UQBA 2MO1A 3S1QB 3OWFA 1RCVD 2N0SB 2N9EB 2L0TA 3AU4A 3T51B 3QJYA 4RKBA 1I7HA 1Z7TA 3PO2H 3U9OA 3NOBA 3Q6BA 4XC2A 1PH2A 4X65Q 4LF9L 1R9TB 4C3HH 2PI2A 1DGJA 1UE6A 4DV7L 4KGTA 4IM0A 4NXNL 3KLSX 2KDMA 2XGTA 1U4RA 1DOKA 3OHXC 2JA5B 3ZW3A 1TGZB 4C3IH 2LWPA 1LO5D 1QUQA 4A3IG 3W5VB 1KNEA 1PTOB 2XBBC 3PTFC 1EYDA 1TIID 1PRTD 1QZGA 3OW2A 3IT6B 2KHJA 2V0GA 4HEDA 2MQHA 1BR9A 5FK9C 1UEBA 2NZ1D 5EKKA 4MELA 4A3JH 3ITPA 2DENB 5CHFA 3PF4A 2MP2B 4XYOA 4GLSC 2C5LC 3LGJA 2IY0B 4A3KH 2J4XA 4NP5A 1VQPA 4BBSG 3N3KB 2YTYA 4W9IA 4I6NB 1J8CA 2RDGA 1EZ8A 1VF5C 1IKMA 1E24A 1ZPSA 5BO4B 3G7LA 2RVLA 3K5NA 1L1OC 3VYRA 1F9RA 3UDFA 1DOIA 5BN5A 4GZYC 1XLOA 4W9EA 2DYBA 2I0QA 1JW9D 4B95A 1LTTD 1G51A 3QX1A 1VQ7A 2W82A 1CKNB 4BKSA 2FINB 1V1QA 1QOGA 2EVBA 2BYEA 3C1EA 2PLPA 4WJ3M 3PUXA 1FD7D 3E5SA 1JE5A 5C44B 1PH1A 1I4XA 5EAYA 4DV2L 4YCVA 5NUCA 3I4MH 3FKIH 3S15B 1PH5A 2VNUD 5D65A 4AYBG 1GOZA 2FAZA 3D6WA 2D3AA 2AL6A 3VHTC 5LHY1 3IT4B 4FJZA 1WTRA 4E74A 3GQBA 3KQ4A 4FXCA 4EFOA 1B9RA 3T1YQ 1DOXA 4NJCA 4XQQA 3BK2A 4KTAA 5HHDG 1VQKA 1IGCA 4KJNA 4RAUC 3DVGY 3M4OB 3TN2A 4F88A 2WB1G 4Q0FA 1NAPA 3DMUA 5IP4D 3A9JB 4LNQA 1EO6A 5KHOA 4B6WA 4YTMB 2IZVB 4GMVA 1U0LA 2C35B 3HRZC 5K36G 1Q10A 2JRHA 5CBEE 1YOVB 4EEWA 4E3CA 2B29A 1MIUA 2BS3B 2BS2B 1NR4A 1E22A 1B9MA 4B0EA 5D6JB 1RODA 5IP7G 2LXCA 3MTSA 2GOWA 5D94A 1G6ZA 4JI4L 1P0RA 1K50A 3QB3A 1GVPA 1LTRD 2MGSA 4OHJA 4LJZC 3GTOB 3K6OA 1WH3A 3J7YW 4DV5Q 2C7MB 3ENEA 4NAWA 3SR6A 3ULLA 1ZOYB 4EZLA 3DOWA 1Q8KA 5EQ0A 1EOVA 2ZJPA 2FHTA 1JWMD 1RFAA 4A3LH 3B0AA 4JX1C 3RT3B 3MXGA 3R3MA 1RLFA 1O80A 1CJEA 1GXDC 3BS1A 2GBNA 3IBEA 3V05A 4GN3B 1VQIA 1HFGA 4NZLB 4YWKA 3ZNHB 2IY5B 2D10A 4IUPA 3IKJA 4AH6A 2OWOA 3H0GH 3HOZG 1B3QA 5EE0A 1PRTB 3K0YA 1RM6C 5IGEA 2KHWB 2QW7A 4IFDG 3DCGA 1E2VA 4HTHA 1JQYD 3H9DA 4WQOB 2EYLA 4OX9Q 2IWHA 1NDDA 2J0TD 3MJ5A 3PO3G 4OO1H 1FNUA 1HNXL 1YI2A 3NVYA 5KIXA 2W3SA 3P1HA 5M3MH 4HJ8A 1FPYA 4AWJA 1LT6D 4A3GH 4TRDA 2CW0C 1ICWA 5KHQA 2CH4W 2PQEA 2KCTA 1ET9A 3X3NA 1ONLA 4HK2A 1KLGD 4LK0M 3VR4A 1N36Q 2UYZB 4YWMA 5JJLA 1UF0A 3RZOH 3S2HH 1XMQL 4JI8L 2GA4B 4C4VB 3V96A 5A2QE 3HOVG 2IO2B 3WDNA 4YY3Q 2HTME 2Q2HA 3NEMA 3MXNB 2DUDA 5KEEA 4HEA1 4W9HA 1IP9A 3J81E 3DBRI 4KX6B 4P1BC 4BY1G 3ZRCA 3DQVA 1CKMA 2R93B 1AP0A 5C3EG 2MNAA 1EQTA 4ZDVA 5JH5C 2JYTA 4YCWA 5AZGA 4HLEA 2BTEA 1LM8B 4KVGB 1JICA 1KTKA 2HIVA 4L5SA 3NJTA 3OJ4B 2JP1A 3D31A 4UDUC 3S24A 4A3BG 3DBLB 1HQRD 4HPPA 2CFMA 4IKGA 2ATWA 1II3A 1GUTA 1XTDA 4WJWA 4S3SA 3MXNA 4KK7A 4PS8A 4YHHL 1HR0L 1JJCB 1WZ3A 1R7SA 3R66C 4M0WB 2QEXA 1HJPA 3A8IE 1GHKA 2DX5B 3GE8C 3AH7A 1QVGA 2ONQA 3SD5A 3EJIA 2KKCA 4JOIA 1U4AA 4KY5A 3S9WA 3CXCA 1YX5B 2LVOA 1MSHA 5ELDA 2DYMA 2KCMA 4P75A 3CPFA 5CTRC 2NBUA 3GE3C 1KAWA 3QIAA 2BH2A 1V86A 2YTVA 1E2ZA 5E6JA 5JXVA 3S17H 4RHSA 2G4SA 2GVBA 1MJEA 1C4CA 2LXAA 2OJRA 5G5HA 2V9HA 1EU4A 1PFNA 4EE2A 2Y5PA 5JEAH 2RCFA 2D2CC 1YHBA 3A56A 3WOEA 3V6EB 4MHEA 1VQMA 4U673 3MAQA 1TS4A 2LVPA 2F3VA 4A4IA 4KHPL 3PPAA 1LXDA 3E9SA 4II3B 4MGYE 2BYTA 1N32Q 4BY7G 2RHSB 2JWUA 2ZXRA 3M3YH 2E5LL 4MGZE 2K04A 3U7ZA 1E7VA 4K6LA 1N36L 3PIO3 1KABA 2BCOA 4G50A 4X6AH 4WJOA 1FXAA 3CC4A 2AQ2B 2NZHA 1HNWQ 1FR3A 4QUCA 1JORA 1K83H 3NS8A 1PFDA 5E7NA 3HHMA 5IT9L 1H8CA 1WRDB 3EA6A 2NBVB 3PZ8A 1I42A 2K33A 1X9NA 3L10B 5M3FG 4FF4A 1NMFA 1NI3A 4JLCA 2ZXOA 1A2UA 3A7AB 1SFOB 1UWXA 3PHWB 3BJUA 3MWYW 2R6GA 3S16H 4K8IA 4CKCA 1C9FA 4F8MA 5M5YH 3DLLA 1SF0A 5KNCA 1EYCA 3KUCB 4YTPB 1EU3A 4JOIC 1T9HA 2CKZB 3NTKA 4JK1C 5CV6A 5T1GA 3STBC 3TEHB 2CHWA 4N58A 3AB9A 2UXCQ 3AE3B 1JC7A 1FNWA 2BW2A 2GRIA 3MTNB 2AX5A 4ASWC 1SE9A 5LMNW 4DN4M 4RGMA 3F2BA 3EC8A 1A15A 1CSPA 1P7FA 5IGFA 1F2RC 1WE7A 2BH8A 4O42A 3W1BA 3B08A 3P75A 1EQVA 2B3AA 2WP8J 3HFZB 4L5TA 3HM6X 3NVVA 4IQZA 4N6EB 2K6QA 2KYWA 1LT4D 1Y1WG 1D3ZA 4PG3A 2QA4A 2E2JB 1UUPA 2G9HD 2L12A 2ZVOA 4K2KA 3WAMA 3HOXH 1IBMQ 1FXTB 1STGA 2LZ6A 3LB8C 1VQGA 4JBWA 4RH6A 4QF4A 1HZ5A 4PZ8A 4KZCA 2QCZA 2JXMB 1MG4A 5C4JH 4GSWA 2HD5B 1U4MA 4A3DH 3M63B 2IYDB 2KWCA 4GLXA 1J7CA 4A3IB 1JROA 4JW0A 1CQFA 1UBQA 2HIXA 3L13A 4JIOU 3CQZH 4M1UB 4DGZA 1QZHA 1XEEA 2W55A 4X3SA 1HA6A 2YTXA 1WGDA 4N9F4 3KLRA 3TP5A 2ACZB 3QA8A 4B0MA 3F1ZA 1QOFA 2B8FA 1HNWL 2JZPA 2UU7A 1XNQL 5EBDA 3K7AB 3J81i 2L1BA 2L9HA 1LYLA 3L16A 3AULA 3H3VH 1YQ4B 3VA7A 1YIJA 3FPUB 1RIPA 3NS1A 1JWUD 1JOOA 3RLOA 3TRZA 1PGBA 4AJYB 1QOHA 4K6DA 4YIJA 1FVIA 1UAPA 3ZTDA 4DDID 3DWPA 2OQKA 4HMJA 3T4AC 3AM9A 4DXAB 1CA5A 4LFAQ 3SVMA 4HVBA 5IAAC 3V62A 2NVYB 3AFQA 5IYBG 2E2IH 4DV6Q 4EZKA 1B53A 5J1ZA 5JEAJ 2IO0B 2WYQA 1XPUA 1RAXA 4R9WA 3I4NG 1X6OA 1I5FA 2ASBA 1TKWB 2B76B 5EJWA 2K5PA 4DV3L 2ALYB 4OO1I 1F52A 4HMIA 1I4GA 3RPFC 3UIOB 5E4XA 1GUGA 3F8TA 3AU5A 5JZEB 3RNCC 2KO3A 2BB6A 1WXSA 1V43A 3N20C 5C4HA 3KW5B 4X3TA 2WXPA 3RNFC 5JJKA 2J0MA 1GJXA 4C7ZA 1E8XA 3DEOA 2KLGA 3TZDA 4JI2Q 3VQIA 1I3QB 1H9JA 4ZHOA 3E56A 1TT2A 3CCMA 1TQOA 2MA9B 4OELB 3NHHA 1S1QB 4TQ1A 1N8RC 4O2DA 2J53A 1Q3LA 2F0OA 2AEHA 2QJLA 3VUWA 1SR3A 3VYSA 2IY1B 4IC7B 4OL7A 1DM0B 3L3OC 3EUB2 2M00A 3DM3A 5J17A 1LACA 2PTLA 4B3MQ 4L2YA 5FR3A 5LMUQ 4XZ4A 1K53A 2L0FA 1SE2A 4EKUA 2WX1A 4MTNA 1NYRA 4MH8A 1YVCA 4X62Q 4H2AA 1NMGA 1GUNA 2X6LA 3MC9A 4ZRPA 3LDZE 2RSUA 1CQVA 3QK0A 4ANUA 5IKCM 2O5IC 2CHBD 1PH7A 2K9XA 2O6VD 1E9MA 4HDOA 4IUNA 2M0AA 3P4QB 2OT2A 4K7SA 3M62B 1WTWA 1WTXA 3HP3A 3EHVA 4FDBA 3M95A 5COYA 5IP9H 2N1VA 2PMZE 2ZTDA 3OW7A 1L6UA 2JXXA 2KTFA 4JGHB 4OZBA 4GN5A 3APDA 2K32A 3S2DH 1GPXA 1GUSA 4MJSB 5TR5A 2UUBQ 4HRSA 1C48A 1TWCH 2JA5G 2AL3A 3APCA 4MGIE 4OZAA 3G48A 5E4WC 2EYPA 3VRAB 1P1AA 1IW7C 4H0LC 4CDCC 1CHPD 2KFKB 3Q0AA 3PO3B 3IXSA 1TWFH 2YU9H 5IODA 1VDVA 2KVMA 3HEJA 4TQ0A 1PHJA 4JYAQ 4DK3C 4FYDA 1LABA 4G7ZC 4MT5A 1HNZQ 4DK0A 4LK1C 2NS5A 4OEMB 3JYUA 1Y8OB 4A76A 3MC8A 1TS2A 5FLXL 1WIAA 1SLJA 4A3PA 4LFBL 3B9JA 3NZSA 1RD9D 3RUZA 5IN7A 1I94Q 3CMMB 2J7ZA 4DR7Q 3Q3MC 4NNJB 5C23A 2BT6A 4LF7Q 3HOVB 2NVTB 3MXUA 4OXPA 3C0RB 4JI7Q 3U9SA 4HN7A 4A55A 1VJKA 4FF3A 4C80A 4H44C 2KFKA 3GTQB 5AUKA 4JI2L 1C76A 3NG0A 2IW3A 3Q3FA 4DK5A 4P1CC 1L2FA 2R92G 1V6EA 1PH3A 1RJTA 2K1BA 3Q3JA 3ZIMA 5C3WA 5I4DA 4HIKA 5IGDA 1WJUA 3IFWB 3NSWA 3Q14C 3RMKC 1RF2D 2A74C 1EY6A 4IUQA 1SJED 1KNAA 2AWOA 5M5WB 3BIID 3N1ZC 4NJ6A 3AI5A 1PUTA 3PIPA 1TKYA 1NSNS 4P16A 2JA6H 3NTIA 2D2QA 1Z47A 3RZFA 1V81A 1EZ6A 2E8GA 1M4VA 4A3BB 5LMUL 1A3TA 1WD0A 5ELCA 4HSVA 3RI7C 4CQNA 4ZUIA 2QDBA 1MHWC 4YWLA 5E1FA 3BK1A 4M8MA 2O5JC 1JOKA 2MJDA 1Q1BA 4L1BA 3AEAB 2HQLA 4B3SQ 4A93H 2X38A 3PS6A 1HXYD 2BKFA 4DHZB 4P74A 5FKAC 1QNUA 2JN4A 3I63C 2K05A 2GLSA 3HOYG 5I9PA 1RHPA 3DM1A 4KSLC 1KM7A 3N32A 4P2CB 4CDDC 4ZOHC 4KKSA 4PNYA 3KYDD 2DY8A 3G4SA 2O6VB 2NPTA 2HHHL 3GTJB 1ZDXA 5LMNL 1X32A 1XMOL 1SIFA 3NQTA 3P7JA 4KHZA 3H94A 4L5QA 2Z0EB 4ZAIA 5M9OA 1E6EB 3A9KB 1CFMA 1XNRL 1GB1A 4ANVA 1X1MA 2WXMA 3R7RA 3DVNV 4OWWB 5IY0A 1QOBA 2PE9A 4IJHA 3K5OA 4PZ7A 1RFKA 5L95C 1VDZA 3BYTB 1EEFD 4BY7B 4K14A 1HNZL 2LGSA 4B3RQ 5M5XH 4IUUA 4WFN3 4XWTA 1N6ZA 4OWXB 4XXEA 1WCMG 4GDKA 4IM3A 3SFDB 1VRAB 1HZ9A 3GD7A 3I90A 2DLBA 3QG1A 4DR7L 4JBKA 2K39A 4DFAA 4R8NA 5GAGC 4LF7L 3HVDA 5AJ3Q 3K81C 4N8FA 1KLVA 2XWBB 4L5RC 1FGBD 3MA2B 2EY1A 2WXQA 2CH4A 2FMMA 4DUZL 2Q8IB 2EJGC 4CYEA 2RKSA 3CU7A 3RULA 3LJ3A 1Y69U 3L17A 2XIWA 1VF7A 3PCOB 1HHVA 1XYIA 3T3NA 1VR9A 2KEEA 1QKZA 2QKIC 3NQIA 5AUIA 1VQOA 3HGBA 1EM7A 1T0QC 3ZVVA 3TBIB 1C4QA 4DNRB 3DHIC 4IALA 4QIWE 1VQ5A 4PQXA 4YCUA 1KHIA 3W1GA 1XXGA 3OWEB 1X3QA 2ZZPB 1NCVA 3UI3A 3CW2C 1CHQD 2GBKA 2EY2A 2OJWA 3PQIA 1PYWD 4HIMA 3RN5A 4J8QA 4ZYSA 3I56A 2UXDQ 2EELA 4MEMA 3A4RA 5E3FA 1VMPA 3E0EA 3W5OA 2VZAA 2N9LA 4XDCA 3ZUNA 3H6NA 4OVVA 1HUMA 1D1IA 3GTMH 4KKTA 1ZKHA 5BYQA 1CKOA 4K3CA 2Z8LA 1HZ6A 3R8BA 1HTLD 1YMHE 2BWFA 2K01A 4AYBE 4E6IA 2F0SA 2F3WA 5KYIA 1X3GA 3J81c 1Y1WB 1VLBA 3K58A 3H7PA 1QILA 1QB5D 2CQOA 4U68A 2UUCQ 1WXQA 2A8VA 1PFMA 3TZUA 2K8CA 5BR8L 3V60A 2E2HB 3AECB 3I8ZA 2OQ0A 4R4OA 5JPMC 3DDCB 4LF8L 1A3UA 1LFDA 2Z1CA 3NVWA 2Z4IA 4WWMA 4DXGA 3RUIB 1BXTA 3RLFA 2F0PA 1YNJD 2E74C 2IX1A 3B2FA 4ICVA 3HOWG 2WB1E 2NZOA 4A3EH 3I9V1 4DR6Q 3W1SC 3Q2AC 1Q81C 2WWZA 1L7YA 4JV5Q 1WTQA 1CZGA 3HIZA 4OW0A 1JWAD 3RR5A 1WGRA 4ZRIA 1Z5SB 3T1HQ 1TWAH 1ZYRC 4C56C 5CGKA 1P8LA 3I3TB 2ENBA 3J80c 2F0VA 1MHHE 2IGHA 3EVQA 1KDBA 5FJ8H 2AWNA 5T1IA 2V3NA 1OQYA 2CU1A 4GLAC 3S1RH 4JI0Q 4FHJA 3J7ZC 1YBYA 2HQEA 5JVG3 5H8YE 3TEZA 1WJJA 1JCKB 3VYUA 1I50B 1Q86C 4PMWA 4LFCQ 1E8ZA 2AMCB 1KQSA 2IX0A 2K5QA 1BUIC 2R2QA 1F9JA 3R7QA 1I35A 2RSOA 2JA7H 2BYVE 3SHQA 2WXJA 1CMXB 3K0XA 1G291 4K3BA 3TMPB 4US9A 3TP8A 1Z2MA 3I4NB 2KJ6A 5G5GA 4LF4L 4KDLB 1KLUD 1STHA 3JW0X 1STAA 2DJFC 1UE5A 3PO2B 2V4DA 1CT1D 2OEOA 3PMFA 2EPBA 1WJNA 1NEKB 5JPNC 1P9DU 1D6EC 1LT5D 4DBGA 1W2BA 5D14A 1IL8A 4A3MH 4GKKL 2INCC 4F1SA 4YSZB 2Y0SB 4C3IB 5JJIA 2KT7A 3ZJYC 3U7DA 4IDIA 1H9RA 2L52A 3A54A 4C3JH 2VB3X 5KNBA 4ZUJA 3AMZA 2F0QA 4A3JB 4GKJQ 3DWGC 2EIFA 4HSPA 3U8ZA 2R2OA 2Y3AA 1XLPA 4Y7NH 2LXJA 3GV3A 1Y1VH 1I4HA 2UUAQ 1WI0A 1N33L 1ZGUB 4A3KB 1RKNA 2INPE 3ZLZA 2WAQG 1YJIA 3CRKC 1XTCD 2MO0A 1F77A 1UH6A 5CR3A 1VMCA 3RN2A 3FKYA 1IL2A 1G2TA 3PIP3 1EY0A 2VQEQ 1VCIA 1D5XC 1YJ1A 4TMAB 1FO4A 1KC8C 3A1QA 4KHVA 1BMLC 2WACA 1AWDA 3A33B 4LTUA 1OXUA 4RFBA 1SE4A 5DPTA 5G3LD 3SE0A 4G4KA 2RPQA 4RF1A 1ISNA 1KF6B 4LF6Q 2MPMA 2D5DA 1BVSA 3I4MB 2UWQA 1X55A 2P5ZX 3E9HA 5DEHA 2WXLA 1T3QA 3VAWA 2XK5B 5IYDG 1LTGD 4S17A 4YTNB 5E6OA 3N6RA 1RWSA 1YJ9A 1CM9A 2I5MX 4BBRH 5HG2A 1VQLA 3FC4A 4V0BA 1LV9A 3PIOA 4S0RA 2IDYA 3MXPA 4WIPA 3NZUA 4LUZA 3ML8A 4DPGA 1FNVA 3PV0A 1E2WA 2Z6KA 2BYFA 2N55A 3AEGB 4ME5A 4IFDI 2EZVA 4A6QA 1OO9B 3HOUH 2EJMA 1HTQA 3PRZA 1B2TA 1M94A 2V1CC 1HUNA 1A3VA 2BWES 1O7ZA 1SNCA 4EQ5A 2AQ1B 3EN2A 4K5XA 2VUMH 4HCPB 2R7ZH 5H1SE 2ICEC 2MQJA 1FRRA 1STBA 4K81A 2RQXA 1VQFA 2LASA 4MN3A 4DR2Q 1YJWA 1FFUA 3PZ7A 4QL5A 5LL6S 1AARA 5DM63 1S5DD 1J5EL 1OTRB 2CU3A 1K0SA 1EIGA 5AZHA 3OPOA 4QCLA 3ZJTA 2AHOB 4W9CA 3N52A 1E1TA 5IYCG 4DV1L 1S5CD 1PQSA 2KMCA 4XT3B 1AZPA 2MP2A 4BXXH 3I4LA 2R92B 2OTJA 2KDBA 4I6PA 3I2ZA 1NUCA 3NE5B 4A3OA 4W9KA 4O1NA 1D1KA 2CKHB 3PZDA 2BS4B 3U2SC 2ZPYA 3H0GB 4GOPB 3VTWA 3NBHB 1ENCA 5BN3A 3CSTA 1CKNA 2EOTA 2JYEA 3S1QH 2UXBL 3L0WB 1MJDA 2WGSA 2F0NA 1WVLA 2EMTA 3ER0A 5C0XG 2JY6A 2JRIB 2O2LD 1WTOA 4A3CG 3HVZA 3JVZX 1STYA 4X66L 4W9DA 4N8X1 1K52A 2KXJA 2OOBB 3N9YC 1RDPD 5M3MB 2L05A 4ICUA 2KJXA 1WR1A 3AEFB 1X65A 1WMHB 1KDCA 2Z6KC 1BBUA 4X65L 3Q8BA 1HZBA 3HOYB 3FPPA 1LQBA 2D9UA 1EUJA 4YT0B 2LGYA 1WR6E 3JAME 3RZOB 4IJLA 3K59A 3PLVA 4R4CA 3UI2A 1SB3C 3A9JA 4DR5Q 2PW5A 2F0FA 3A8JE 3KBGA 4WJNA 3ZO5B 3IG3A 1ILPA 4JE3B 1TKEA 1FJGQ 4XWWA 5FLMH 3NZ3A 2WXRA 1PXUA 2MHVA 3AYHB 2YLMA 4I7AA 4RG1A 2MSED 2KX3A 1PH8A 1R4MB 3ZTCA 3W3AA 1WMHA 1MVKA 1PTOC 2NCNA 4RCOA 4HIDA 1U5KA 1K0RA 3N1XC 3NUCA 4A3FG 2JA8H 2KK8A 3S1MH 1WXMA 1WCMB 5EPKA 4WWPA 5MPOA 2ZM6Q 1NENB 4G7HC 5C44H 2EQSA 4PT5A 1YNND 3S15H 1JB3A 5EBCA 5ELBA 5EGTA 4CDFC 2LY7A 2K3UA 3CKIB 1X54A 2WS3B 4IG7B 4NKLA 4DK6C 3Q8EA 4DNTB 4V190 1QT9A 3CPWA 4M02A 4KSKC 2KDIA 3M7NA 4BAXA 1JMLA 4DHJD 1BDOA 1EL0A 2LSSA 1IYFA 1WF9A 2SAKA 3M4OH 2LJ5A 2KC2A 1MJCA 2LGDA 3T1YL 2L11A 3E0JA 5DPSA 1KFYB 1BCPD 2EJFC 2NVXH 4JCVE 2BB5A 3S14B 2NVUI 1L0VB 4GN4B 3OJ3A 1HFNA 1EWCA 1IUEA 2N9PC 1J9OA 1OFFA 4B9WA 3P63A 1OEYA 2KCCA 3GP7A 2XRQD 3OOCA 2V3PA 4FN2A 4F8CB 1SYFA 4XE0A 1KAAA 3QWZB 2LRWA 1PA6A 3X0WA 2DZIA 4B3TQ 3BZKA 4ZK9B 1WZ0A 3DVGX 1YZ6A 4NXMQ 2WXHA 2JWZA 1ASYA 3AN1A 1TJEA 4LMQD 3PRPB 2IT1A 4R8IA 1V9JA 2K28A 2HJ1A 2PVOD 3KWLA 4RMFA 3MJWA 4DAYB 2MJ3A 3KDFB 1C7YA 4C4VA 2A19A 1HE8A 1SAPA 2LFIA 1G91A 4BOZB 2A5UA 2K5HA 4XTCS 4DV5L 3MHBA 4GB9A 3GZNI 2MBHA 3S1NB 5JHBA 4OVZA 1FGUA 4R4IA 3J80E 4US8A 4GU2A 3A7LA 1C1YB 2F0GA 1AZQA 1SYDA 3TQYA 2XWJB 1XCTL 3RNUA 2PPHA 2JT4B 2BA1A 3U58A 5EKIA 1F2LA 2Q2IA 2VB2X 3HOWB 1NI2A 4DR1Q 2PNHA 3PGEA 4LJPB 3V6CB 4IZ8A 1WY8A 2FCMA 1WFQA 2N88A 4LUVA 4M8AA 1L0WA 1YX6B 2DN8A 2J7QB 2EYFA 2K7VA 2F0LA 2KVRA 2LUEA 2ZCBA 2PI2E 3ONAB 1FRDA 4OX9L 3FEWX 2CR5A 2KTRB 2L15A 3HKZE 3OMGA 3A4SC 1ENFA 2WV6D 3KWVA 3RCZA 5M5YB 4M0WA 1EEID 2NYZD 3WWVA 2KMMA 2FJ2A 5CORA 1A2TA 1WXAA 3JSVB 3U30A 1SDFA 2A69D 2AUJD 1ZDVA 3WA0A 1PRTC 5EDSA 4Z9CB 2O2VB 1AE2A 2WX0A 3D4WA 1A62A 3GTPH 1WSPA 4W9GA 2HE7A 5KRUA 4GXBA 4EQNA 2GB1A 2N4FA 4ALPA 2X8XX 1YJJA 4JWSC 2Z4HA 5HURA 2K6DB 3B6YA 1VS0A 3FAHA 4LAAA 1L6VA 4YY3L 2R93H 2PNRC 4ABNA 4MM3B 1SNQA 2I07B 4DHJB 1DJRD 1GNUA 3T9LA 1ZXHA 2M56B 3ZKJC 3U4EG 1DGSA 1AE3A 1EY7A 1YD8U 3TEWA 1U9RA 2PQAB 1BCPB 2WIIB 1K8GA 4NXML 1N5WA 2A6HD 3KUZA 3M85A 5DCNA 4KD3A 5C4JB 1KJTA 2XSCA 1Q7YC 1S5ED 1XPRA 2FBWB 1TS3A 4A3DB 4FJVB 3V2TA 3U4ZA 2KX0A 2I1KA 1V8CA 2IX3A 2GBMA 2EDGA 3K5LA 3NUHB 2C5CA 2JQOA 3OYYA 4JI1Q 3JAMi 3OTOQ 2YEPB 2Z59B 3FILB 2F0EA 4JPBW 5IGBA 1S3SG 4CDEC 3X23A 4DXFA 4RM9A 2K75A 2WXOA 4BKGA 4RHRA 1GC7A 1IHZA 2JYOA 1E90A 1KRTA 1SYCA 3C8YA 2D62A 1X3FA 2WAQB 4ILWA 2BPSA 4LNKA 1VQBA 5CV9A 5I2YA 2EYOA 3VTVA 2DGYA 2KNBA 2IPKD 2M9VA 2QF7A 2XVSA 3BVGA 3VR5A 1WGKA 5CV8A 3KF6B
chains in the Genus database with same CATH topology
1JWSD 1BF4A 4CJ0B 4ZHPA 1SXTA 3URYA 2NN6G 1ROEA 4XQNA 2HDEA 3FRPB 2ON8A 3AE7B 1MBYA 2PVGC 2X6GA 4L8JA 1ZXIA 2F1MA 2KECA 2GI9A 4DF7A 4OZCA 3LX0A 1KRHA 5D3DA 5FO9B 2INNE 1L4ZB 3FDTA 1XCQL 1Y8PB 2B2WA 1J7AA 3AE2B 4F87A 3NXWA 3AEDB 4EQPA 4ZRZA 4KY7A 2K0PA 1SMYD 4HJGE 1TWGB 3P4RB 3NP8A 1F2YA 1LTAD 4OGQC 4CKEA 2PW7A 2JQRB 1SSOA 3MVVA 4C3HG 1OQRA 2JSVX 3QO2A 4KMUC 1PFBA 1TWCB 3BG3A 5BYSA 4C3IG 4XIGS 2B2YA 3RMHA 1JALA 3R93A 1LTSD 1AFPA 4KJOA 2LEKA 4FXKC 3TSSA 3EFXD 1CK1A 4MACA 1FYCA 2LHDA 2J42A 2JEBI 3Q24A 3IAS1 4HR7B 3RD4A 2KN4A 2MUYA 1WWTA 5ELEA 2PO4A 3X3MA 3NVZA 1PTOF 2WU2B 1Q12A 2A6ED 5ELFA 1I6HB 1NYQA 4DQOC 5D3IB 2JU6X 2H89B 5BMGA 4YSXB 2B2WC 1UWMA 1TS5A 5KGUA 3P4SB 4N59A 3SR1A 1PDQA 1M8AA 1QQRA 4K8JA 2A68D 1EYAA 4N9TA 4A3FB 1JRPA 4KD4A 1AW7A 4CBVA 2RMMA 2DNEA 3I91A 2X69A 4RKLA 1H9MA 4OIKA 4A93B 3I70A 2B39A 2B2YC 3RZDB 2F0KA 1C77A 1E10A 3NRZA 2C9OA 4J6HA 5JVH3 5K36H 4ZKBB 2CVRA 3Q69A 4L63B 5EE1A 2LUMA 4X3UA 3Q8AA 2F03A 3PUWA 2QSDA 2F0MA 1EY9A 2W3RA 4RNAA 5M5XB 3F2UA 4A9AA 1DOLA 2WXNA 3A55A 1F2RI 4OO1G 2LGIA 2D5GA 3A8KE 1QWYA 2RDFA 1UNSA 1CA6A 1I4RA 4HKZE 4LLGM 1ZP0B 4IFDH 3BDOA 1PRTF 5A2QL 1DXMA 2H88B 4DU9A 4EQOA 2NTSA 3GO5A 2MP1A 1C78A 4ARCA 3J81L 5D7GA 4NW2A 1FM0D 1T5EA 4ZQ3A 2NUCA 4KI0A 2KEDA 4QB4A 1N62A 3OIQA 2DY7A 2VXWA 3ERQA 1YN5A 3R3OA 4FF1A 1J8IA 3QOJA 1SYGA 3GTKB 2L1AA 3MP9A 1Q90A 5C3JB 1EWHA 4RWSC 3J80L 3I57A 5I2XA 4J3OD 5CV7A 3W5UB 1D4BA 1V1PB 5FO8B 3J7AV 1D5MC 4KV6A 3ZGZA 3EROA 1F2ZA 1SYBA 4KN4C 4EVOA 3LWEA 5JEAG 3BZDB 1F0ZA 1TWAB 4YXDB 4NDXA 1PDXA 3S1RB 5CV4A 4OIJA 2F0IA 1JWBD 5TSSA 2B63B 1L4DB 2LMCB 3Q6SA 4WORA 1DONA 2OXPA 1TY2A 4IUVA 2PPBC 3M4YA 3QWNA 1WTPA 4WQMA 2M19A 3TUOA 1PGXA 3ZYYX 1JQ4A 3TEXA 4NMZA 5C4XB 1HA5A 4L6TB 1E7PB 3P42A 3Q8CA 1CTMA 2ZXPA 4C3JB 2SNMA 3H91A 4RA8A 4ARIA 4DA2A 2EYJA 5IT9E 3NTHA 4Y7NB 1QJOA 2KCNA 1QG7A 3W2DA 4IFDJ 2FUG1 5IIFA 1O78A 2DNCA 4RGOS 4KKUA 1WD1A 1ET6A 3L7ZC 1XLNA 2IL8A 2XNAC 4FO2A 5C6AA 3KUPA 3PUYA 4IN3A 4ULLA 4KKJA 3VR9B 2KWDA 5CMDA 2PW9A 2L5TA 4TKOB 4GDLB 1OXVA 3T3OA 1SSNA 1SYEA 3ETRA 2BDNA 4ID6A 1K51A 3DEPA 2N7JA 4C3HB 2FMCA 2JE6I 4DAPA 2CW0D 3SDZA 4BBRB 2H4OA 1XLQA 5DAUA 1H9SB 4B9XA 1SE3A 3K5MA 4H13C 3SFEB 3AB5A 1SNPA 3W9CB 2SEBD 3ZJVA 1ML0D 3NPPA 2VUMB 5CV5A 3H09A 2R7ZB 4WH4A 5JAVA 3WOFA 2M2LA 2B2UA 5DNFA 2PZUA 2CQAA 1O7YA 2NWGA 3BDCA 3AE9B 1W6JA 2WU5B 4XQJA 3MEHA 3FKIB 5C5MA 1LT3D 3WCQA 1WYGA 2WP9B 1K8OA 1RTOA 2EYMA 3AE4B 5I6YA 1E0ZA 2K03A 1AN8A 2RA4A 3H6MA 1ZXTA 3L4PA 2F4IA 3CHBD 4USAA 3U52E 2MEKA 1GUOA 5FO7B 2WLBA 1PGAA 1TVXA 4HROA 2EY6A 1Y8NB 2E2DC 4CHTB 1R4PB 1SNDA 1XO3A 4CKBA 3BVMA 3C3LA 2EYHA 1FCCC 1FIQA 5C2TB 2R3ZA 3ABVB 1ESRA 1D5ZC 3MFYA 1HRJA 1EWYC 3G6JB 2B2UC 1EIHA 1ZEQX 1GB4A 5KNDA 3TMEA 2B8GA 4YWGG 2F0TA 1P7EA 5CC4A 5AFWA 2DWQA 4ODGA 1KH0A 3AEBB 2JA8B 3P4PB 3S1MB 1EFID 1HCZA 3EGRA 2NTTA 2AUKA 3SK5A 4RGNA 1N5XA 1LLRD 4A3GB 4FP5D 5H92C 2HUGA 1AEXA 5CBAE 1PTOH 1EOTA 2JSOA 4NAWB 5DM73 5KYLA 2SOBA 3H8HA 5LNK1 1E0BA 3NBHA 3S2HB 1DOMA 2NVXB 4DAVA 1YNJC 1ZE3D 2NBFA 4IOIE 5JJZA 3CWIA 4XDXA 1QOAA 1ENAA 1OXSC 1CZPA 1VZ7A 2AQ3B 5FLXE 3I3CA 2QILA 2BE5D 1HTPA 1L5PA 2W54A 1DOYA 5ISRA 2V4IB 2RBMA 1MI0A 4RGTA 3VYTA 3KF8A 3R2IA 2BA0A 2L4NA 2WDRB 1RTNA 2RSNA 4NAMA 2R61A 1T5XD 3IL8A 3L9AX 3DWMA 4P6VF 2KOLA 3NK9A 3P1MA 3S17B 1B3AA 4N9PA 4UAIA 5T8IA 3DWQA 1F9QA 4AS1A 2I38A 2Y5CA 4B08A 5BYRA 2L32A 4CGYB 1YQ3B 4QMGA 3GTPB 3M3YB 1GUWA 1BO0A 1Z6HA 4AQ7A 5IOCA 2FFKB 3TEYA 2K5DA 3Q8FA 3K57A 1H9KA 3HG9A 2Q8RE 4MIUA 1K83B 2WDQB 2NN6I 4YSYB 2A5HA 5IGCA 1DZ1A 3T16A 2EY5A 3VR6A 2PMZB 1XX8A 4BA1I 3KK7A 2WKCA 1BUVT 4DAYA 3KLSA 2K5WA 2B2TA 2XRSD 3S16B 3ZQ4A 2LS01 3D4RA 3OSOA 4PMBA 1G8ZD 1CI3M 4RCNA 2EXZA 2PCFB 3LYYA 5GXGB 2K6AA 4KGRA 4XYQA 1B9NA 1GAQB 3D8GA 1UGJA 2E76C 1ESFA 2L55A 2JXTA 3AE6B 4JPSA 2L0CA 1IW7D 1VZ8A 5I9OA 1A6XA 4ZLTF 3CRLC 3HOXB 3AE5B 1R4QB 2PZWA 2HCCA 2WXFA 2PIAA 2ID0A 2VZKD 3BYYB 3HZXA 1YN3A 3J9CA 3CIRB 1L0YB 2QEJC 1Q8IA 1IKLA 2KACA 3D3RA 1MSGA 3CQZB 4HKQA 1IYVA 2PYKA 1HEZE 3HUIA 3E6ZX 1YN4A 2WKDA 4PV1C 5FOBB 1S5BD 1KDAA 2B2TC 2PZTA 2HDLA 4REZA 3V3XA 3T53B 1PZKD 1T6BX 4ITKA 2WDVB 1F9SA 1ZKOA 2E2IB 1MHXA 1LTID 3FILA 5EE9A 1NR2A 2KUMA 5J39A 1D2BA 1HQMC 1AYFA 4R3DA 3BDLA 5BMIA 1J7BA 3AV8A 1TWHB 1MGSA 2OF1A 3VR2A 2I2YA 1X3PA 1V1OA 3VR3A 4C3JG 1V97A 1B50A 3D4DA 1G2SA 2BE5C 1C4PA 1FXIA 2KA7A 5I6WA 1VZ6A 3B2GA 1YNNC 1HPCA 3RFZB 4X3KA 2KQ4X 5JOBA 2OHFA 2F0JA 2LKVA 1QCBD 1SNOA 4WURA 2MJEA 1XF5L 2HDMA 3PUVA 1V8QA 1FCLA 4IURA 4QIWB 4Q2JA 1QLBB 1TYGB 4BBSB 1BCPC 4K5WA 2VZKB 3M7GA 4XT1B 3S2DB 3VA5A 1I6VC 5EKLA 1I4PA 1IGDA 2F0WA 4C2MB 1BNZA 2QCPX 3C46A 4RF0A 2E3TA 2J52A 4L23A 4JWUC 4AYBB 1TWFB 2YU9B 4D2KA 1PMRA 3H3VC 1I4QA 5K5PA 1SJHD 2DBYA 2NMQA 4C7YA 4BWGB 3DUZA 4TQUS 2Q8TA 2WB1B 5EPLA 3AU7A 1STEA 5HGTA 2OEDA 1U4PA 1CZWA 3GV6A 3ND9A 1BBXC 1A70A 2G1EA 2JX5A 4FXGC 5F2DA 2WNMA 2Q5WD 3C2PA 1EY8A 2K22A 2EE1A 3HS0C 4K5VA 2LHEA 2JA6B 1SNMA 1OXXK 3Q23A 2A69C 1IBXB 3NBIA 5EPJA 2QMTA 2TMPA 1LTBD 4TSSA 1TR5A 1QE6A 4Q5VA 1ACCA 3GTLB 1ZYRD 5HFYA 3HRDD 2ICIA 3HOZB 1Y56A 1PZID 4PMCA 3JAML 3DXJC 5IGGA 2MH7A 2KAJA 3LWUA 5C0XH 1K8MA 1IBXA 2E6XA 4C1NI 2RDHA 2B2VA 3GB1A 1MI2A 4J1MA 1SBBB 2A6HC 3MC0B 1O7LA 1FD6A 3AEEB 4FNFA 3P20A 3SK4A 4BS9A 1B4OA 2CJOA 1L0XB 2F0HA 3EQLC 4DK1A 5G3LF 1JE4A 3DWAA 4BY1B 3VRBB 5C3EB 3LNNA 4A8XC 3IFDA 2PKOA 2MJ8A 2IGGA 4HAEA 1JR0D 1NVID 1RYJA 1ILQA 4HCSA 4A90A 1SIJA 2H1EA 4G57A 5C3XA 3FVQA 4I65A 4XDCA 2JEAI 3NWTA 4GDKB 1BQQT 5EE3A 2I46A 3GTMB 3FMCA 2RPVA 2B2VC 1JOQA 1C4AA 3I72A 2BBCA 3I73A 3SXHA 4BA2I 2A73B 1FMAD 1SMYC 3KBXA 3PUZA 4F7XA 2N9KA 2IJ0A 3GTGB 1QNKA 3O13A 4A3EB 3MZ5A 4CJ2C 1TKGA 3VR8B 4HCEA 1SEBD 4WAFA 3SHLA 3J7AF 1FEHA 3BVZA 2WXGA 1TZOA 3R2TA 2NVQB 1S4ZA 3QOLA 4K2LA 4H7BA 2CJNA 1DCZA 1V1PA 4KKIA 3NWSA 3SK8A 5M3FB 4G7OC 2E75C 5HI1A 5C4ZA 4ZRQA 4KN7C 2IGDA 5BN4A 5C0XJ 3LXFA 2O4XA 2YYZA 2JA7B 3GS2A 2SDFA 3MFGA 1C79A 1DD2A 2SNSA 2ZW1A 2WXKA 1BOSA 1PZJD 4WRDA 2TSSA 2A6EC 4IUTA 2WQYB 2F0UA 3SK6A 4C1NK 1PLFA 3T56B 3TDQA 3C1FA 2KHSA 4A3MB 1C8CA 2LJIA 3PO0A 2FE8A 3DHQA 4I7ZC 1MPEA 2L83A 2A68C 2LFNA 2LMCA 3MHZA 5C5LA 1S5FD 2NB0A 2BDOA 5LL6X 1F9PA 3OIPA 4EGVA 4FVMA 1N63A 1YNTE 1Y1VB 4QUFA 1BCPF 4CJ1B 1B44D 1FFVA 1STNA 3AE1B 1PTOD 3IAM1 1XWEA 1F2MA 2ZW0A 3D6CA 2YEPF 2EKIA 1QF6A 1EY4A 4FXDA 5A35A 1DYQA 2XN9C 3TP6A 3TP7A 1WRIA 1OXTA 3IFTA 1UEAB 1IYUA 1OQQA 2NN6H 3AMUA 1ZUD2 3HOUB 1TY0A 5C0XI 2QIEB 3T13A 1N61A 1Q1EA 1W6KA 4ZKCB 2F0DA 3Q22A 2PMVA 2WINB 3SEBA 2WXIA 4KY6A 1EY5A 1B1ZA 2BOSA 5CYUA 1H9SA 2KQ3A 1MD2D 2HCIA 1U4LA 1WTVA 1TU2B 5BMHA 4XDDA 1N60A 3HKZB 3ND8A 4KGSA 3OMCA 2ZT9C 2G9DA 1GHJA 3IAYA 5J22A 4FF2A 2DYOA 3AE8B 3BWUD 3ZJUA 3S1QB 3OWFA 1RCVD 2N0SB 3T51B 3QJYA 4RKBA 1I7HA 1Z7TA 3U9OA 1R9TB 1DGJA 4KGTA 3KLSX 2KDMA 1U4RA 1DOKA 3OHXC 2JA5B 1LO5D 3W5VB 1KNEA 1PTOB 1EYDA 1TIID 1PRTD 3IT6B 2V0GA 4HEDA 1BR9A 5FK9C 2NZ1D 5EKKA 3ITPA 4XYOA 4GLSC 2J4XA 4NP5A 2RDGA 1EZ8A 1VF5C 1IKMA 1ZPSA 3G7LA 2RVLA 3K5NA 3VYRA 1F9RA 1DOIA 5BN5A 4GZYC 1XLOA 1JW9D 1LTTD 2W82A 2FINB 1QOGA 2EVBA 3C1EA 2PLPA 3PUXA 1FD7D 3E5SA 5C44B 1I4XA 3S15B 5NUCA 2VNUD 5D65A 1GOZA 3D6WA 5LHY1 3IT4B 1WTRA 3GQBA 3KQ4A 4FXCA 1B9RA 1DOXA 4NJCA 4XQQA 3BK2A 4KTAA 5HHDG 1IGCA 4KJNA 4RAUC 3M4OB 3TN2A 4F88A 4Q0FA 1NAPA 3DMUA 4YTMB 3HRZC 5K36G 1Q10A 5CBEE 2BS2B 2BS3B 1NR4A 1B9MA 4B0EA 1RODA 3MTSA 1G6ZA 1K50A 3QB3A 1LTRD 4OHJA 2MGSA 4LJZC 3GTOB 3K6OA 3SR6A 3J7YW 1ZOYB 5EQ0A 2FHTA 1JWMD 4JX1C 3MXGA 1O80A 1CJEA 1GXDC 3BS1A 3V05A 4NZLB 1HFGA 4IUPA 3IKJA 5EE0A 1PRTB 3K0YA 1RM6C 5IGEA 4IFDG 1E2VA 4HTHA 1JQYD 2EYLA 2IWHA 2J0TD 3MJ5A 4OO1H 1FNUA 3NVYA 5KIXA 2W3SA 3P1HA 1LT6D 4TRDA 2CW0C 1ICWA 2PQEA 1ET9A 3X3NA 1ONLA 4LK0M 1KLGD 3VR4A 2GA4B 3V96A 5A2QE 3WDNA 2HTME 5KEEA 4HEA1 3J81E 4KX6B 2R93B 1AP0A 1EQTA 2JYTA 2BTEA 1JICA 1KTKA 2JP1A 3D31A 4UDUC 1HQRD 4IKGA 1II3A 1GUTA 4WJWA 4S3SA 3MXNA 4KK7A 1R7SA 3A8IE 1GHKA 3AH7A 2ONQA 3EJIA 4KY5A 3S9WA 1MSHA 5ELDA 2DYMA 3QIAA 1E2ZA 5E6JA 5JXVA 4RHSA 1C4CA 5G5HA 1EU4A 1PFNA 4EE2A 2Y5PA 5JEAH 2D2CC 3A56A 3WOEA 4MHEA 4U673 3MAQA 1TS4A 2F3VA 2BYTA 3E9SA 2JWUA 2ZXRA 2K04A 3U7ZA 4K6LA 3PIO3 1KABA 2BCOA 1FXAA 2AQ2B 1JORA 1FR3A 4QUCA 1PFDA 5IT9L 3EA6A 3PZ8A 2K33A 4FF4A 1NI3A 2ZXOA 1A2UA 3A7AB 1SFOB 1UWXA 3MWYW 2R6GA 1C9FA 4K8IA 4CKCA 4F8MA 1SF0A 5KNCA 1EYCA 4YTPB 1EU3A 3NTKA 4JK1C 5CV6A 5T1GA 4N58A 3AB9A 3AE3B 1JC7A 1FNWA 2BW2A 2GRIA 2AX5A 4DN4M 4RGMA 1A15A 1P7FA 5IGFA 1F2RC 4O42A 3P75A 1EQVA 3NVVA 2WP8J 4IQZA 4N6EB 1LT4D 2E2JB 1UUPA 2G9HD 2L12A 4K2KA 1STGA 3LB8C 4JBWA 4RH6A 4QF4A 1HZ5A 2JXMB 1U4MA 1J7CA 4A3IB 1JROA 1CQFA 4DGZA 4M1UB 1XEEA 2W55A 4X3SA 1HA6A 3KLRA 3TP5A 2ACZB 4B0MA 1QOFA 2B8FA 2JZPA 5EBDA 3K7AB 2L1BA 2L9HA 1YQ4B 3VA7A 3FPUB 3NS1A 1JWUD 1JOOA 1PGBA 1QOHA 4K6DA 4YIJA 1UAPA 3DWPA 4HMJA 3T4AC 3AM9A 1CA5A 3SVMA 2NVYB 1B53A 5J1ZA 5JEAJ 4R9WA 1TKWB 2B76B 5EJWA 2K5PA 4OO1I 4HMIA 1I4GA 3RPFC 5E4XA 1GUGA 2BB6A 1V43A 5C4HA 4X3TA 2WXPA 1GJXA 4C7ZA 3VQIA 3DEOA 3TZDA 1I3QB 1H9JA 4ZHOA 3E56A 1TT2A 1TQOA 3NHHA 4TQ1A 2J53A 1Q3LA 2F0OA 2QJLA 3VYSA 4OL7A 1DM0B 3L3OC 3EUB2 2M00A 1LACA 2PTLA 4L2YA 5FR3A 1K53A 1SE2A 1NYRA 4MH8A 4H2AA 4ZRPA 1GUNA 2X6LA 1CQVA 2O5IC 2CHBD 2K9XA 1E9MA 4IUNA 2M0AA 3P4QB 2OT2A 1WTWA 1WTXA 3HP3A 5COYA 3OW7A 1L6UA 4OZBA 2K32A 1GPXA 1GUSA 4HRSA 1C48A 4OZAA 5E4WC 2EYPA 3VRAB 1IW7C 4H0LC 1CHPD 3Q0AA 3PO3B 3IXSA 5IODA 1VDVA 2KVMA 3HEJA 4TQ0A 4FYDA 1LABA 4G7ZC 4MT5A 4DK0A 4LK1C 1Y8OB 1TS2A 5FLXL 3B9JA 1RD9D 3RUZA 2J7ZA 2BT6A 3HOVB 2NVTB 3MXUA 3U9SA 4HN7A 4A55A 1VJKA 4FF3A 4C80A 4H44C 3GTQB 5AUKA 1C76A 2IW3A 1RJTA 2K1BA 5C3WA 5I4DA 5IGDA 3NSWA 1RF2D 2A74C 1EY6A 4IUQA 1SJED 1KNAA 2AWOA 5M5WB 3BIID 1PUTA 1TKYA 4P16A 1NSNS 3NTIA 1Z47A 1EZ6A 1M4VA 4A3BB 4CQNA 1A3TA 1WD0A 5ELCA 4HSVA 4ZUIA 2QDBA 3BK1A 5E1FA 2O5JC 1JOKA 2MJDA 1Q1BA 4L1BA 3AEAB 2X38A 1HXYD 5FKAC 1QNUA 2K05A 5I9PA 1RHPA 3DM1A 4P2CB 4ZOHC 4KKSA 4PNYA 2DY8A 3GTJB 1ZDXA 1X32A 3NQTA 3P7JA 4KHZA 3H94A 4ZAIA 5M9OA 1E6EB 1CFMA 1GB1A 2WXMA 1QOBA 3K5OA 1RFKA 1VDZA 3BYTB 1EEFD 4BY7B 4K14A 4IUUA 4WFN3 4XWTA 4XXEA 3SFDB 1VRAB 3I90A 3GD7A 2DLBA 2Y3AA 3QG1A 3W1SA 4DFAA 4R8NA 3HVDA 2XWBB 1FGBD 3MA2B 2EY1A 2WXQA 2FMMA 2Q8IB 2EJGC 2RKSA 3CU7A 1Y69U 2XIWA 1VF7A 1HHVA 1XYIA 3T3NA 1VR9A 2KEEA 1QKZA 2QKIC 3NQIA 5AUIA 3HGBA 1EM7A 3TBIB 1C4QA 4DNRB 4IALA 4PQXA 1XXGA 3OWEB 1X3QA 1NCVA 3UI3A 1CHQD 2EY2A 1PYWD 4J8QA 4ZYSA 2EELA 5E3FA 1VMPA 2N9LA 1HUMA 1D1IA 4KKTA 5BYQA 2Z8LA 1HZ6A 3R8BA 1HTLD 1YMHE 2K01A 4E6IA 2F0SA 2F3WA 5KYIA 1Y1WB 1VLBA 3K58A 1QILA 1QB5D 4U68A 1WXQA 1PFMA 3TZUA 2E2HB 3AECB 3I8ZA 5JPMC 4WWMA 1A3UA 3NVWA 2Z1CA 2Z4IA 4DXGA 1BXTA 3RLFA 2F0PA 1YNJD 2E74C 2IX1A 3B2FA 3I9V1 1WTQA 1CZGA 4OW0A 1JWAD 1ZYRC 4C56C 5CGKA 2ENBA 2F0VA 1MHHE 2IGHA 3EVQA 1KDBA 2AWNA 5T1IA 2V3NA 2HQEA 5JVG3 5H8YE 3TEZA 1JCKB 3VYUA 1I50B 4PMWA 2IX0A 2K5QA 1BUIC 2RSOA 2WXJA 1G291 4US9A 3TP8A 3I4NB 5G5GA 1KLUD 1STHA 1STAA 3PO2B 2V4DA 1CT1D 2OEOA 3PMFA 2EPBA 1NEKB 5JPNC 1D6EC 1LT5D 5D14A 1IL8A 4YSZB 2Y0SB 4C3IB 4IDIA 1H9RA 2L52A 3A54A 2VB3X 5KNBA 4ZUJA 3AMZA 2F0QA 4A3JB 3DWGC 4HSPA 1XLPA 3GV3A 1I4HA 4A3KB 1RKNA 2INPE 1YJIA 3CRKC 1XTCD 1F77A 5CR3A 1VMCA 1G2TA 3PIP3 1EY0A 1VCIA 1D5XC 1FO4A 4TMAB 4KHVA 1BMLC 2WACA 1AWDA 4LTUA 1OXUA 4RFBA 1SE4A 5G3LD 3SE0A 4G4KA 4RF1A 1KF6B 2MPMA 2D5DA 2WXLA 3I4MB 5DEHA 1T3QA 1LTGD 4YTNB 3N6RA 1RWSA 5HG2A 1CM9A 3FC4A 4V0BA 1LV9A 2IDYA 3MXPA 4WIPA 1FNVA 3PV0A 1E2WA 2N55A 3AEGB 4ME5A 4IFDI 2EZVA 4A6QA 1OO9B 2EJMA 1B2TA 1HUNA 1A3VA 1O7ZA 1SNCA 2AQ1B 4K5XA 2ICEC 1FRRA 1STBA 2RQXA 4MN3A 1FFUA 3PZ7A 5LL6S 5DM63 1S5DD 2CU3A 1EIGA 3OPOA 4QCLA 3ZJTA 3N52A 1S5CD 4XT3B 1AZPA 3I4LA 2R92B 3NE5B 1NUCA 4O1NA 1D1KA 2BS4B 3U2SC 3H0GB 5BN3A 1ENCA 2EOTA 2JYEA 2F0NA 1WVLA 3HVZA 5C0XG 2O2LD 1WTOA 1STYA 1K52A 3N9YC 1RDPD 5M3MB 2KJXA 3AEFB 1KDCA 3Q8BA 3HOYB 3FPPA 2D9UA 4YT0B 3JAME 3RZOB 3K59A 3UI2A 1SB3C 2PW5A 2F0FA 3A8JE 3KBGA 4JE3B 1ILPA 1TKEA 4XWWA 3NZ3A 2WXRA 1PXUA 2MHVA 3W3AA 1MVKA 1PTOC 4RCOA 3NUCA 1WCMB 5EPKA 5MPOA 1NENB 4G7HC 4PT5A 1YNND 1JB3A 5EBCA 5ELBA 5EGTA 2LY7A 2K3UA 3CKIB 2WS3B 4NKLA 3Q8EA 4DNTB 4V190 1QT9A 3M7NA 1JMLA 1BDOA 1EL0A 2SAKA 2L11A 3E0JA 1KFYB 1BCPD 2EJFC 2BB5A 3S14B 1L0VB 1HFNA 1EWCA 1IUEA 1J9OA 1OFFA 4B9WA 3P63A 2KCCA 3GP7A 2XRQD 3OOCA 2V3PA 1SYFA 4XE0A 1KAAA 4ZK9B 2WXHA 3AN1A 1TJEA 4LMQD 2IT1A 4R8IA 2K28A 2PVOD 3KWLA 2MJ3A 1SAPA 2LFIA 1G91A 4XTCS 3MHBA 3S1NB 4OVZA 3J80E 4US8A 3A7LA 2F0GA 1AZQA 1SYDA 2XWJB 1XCTL 2BA1A 5EKIA 1F2LA 2VB2X 3HOWB 4IZ8A 2N88A 4M8AA 2DN8A 2EYFA 2K7VA 2F0LA 1FRDA 3ONAB 3FEWX 3OMGA 1ENFA 2WV6D 3KWVA 5M5YB 4M0WA 1EEID 2NYZD 2KMMA 2FJ2A 5CORA 1A2TA 1SDFA 2A69D 2AUJD 1ZDVA 1PRTC 4Z9CB