1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
4RGOS 1LTAD 1B1ZA 1ET6A 4RCOA 2NTSA 1DYQA 1PTOB 1M4VA 1PRTF 1STEA 2XRQD 4RHRA 2Z8LA 1TS2A 1LTTD 1SEBD 1V1OA 3DWPA 1YN3A 4ZYSA 2G9HD 1KTKA 1D5XC 3URYA 1UNSA 1BCPD 1EU4A 1JR0D 1KLGD 1G8ZD 1SJED 1D5ZC 2XNAC 1PRTB 1BCPC 1LT5D 1EFID 1CQVA 1I4PA 3R8BA 1XXGA 3GP7A 1LT6D 1CHQD 3EA6A 2O2LD 3R2TA 3SEBA 1KLUD 1EU3A 1F77A 5ELEA 5ELFA 1JWMD 4RGTA 1HA5A 1PTOD 1TY2A 1ESFA 1RF2D 2WV6D 1MD2D 1FNWA 3DWQA 1HQRD 2AQ3B 1I4RA 1FNVA 1TS4A 1UUPA 1LT3D 1SE3A 4RHSA 1EWCA 1BXTA 1T5XD 1AN8A 1V1PB 1S5FD 2IPKD 2SEBD 1SE2A 2RDHA 1ET9A 3BVZA 1L0XB 2QILA 1HXYD 2J4XA 1LO5D 2NTTA 3MC0B 5D3IB 2QEJC 1PYWD 1PTOH 1XTCD 1EEFD 1TY0A 3O13A 3BZDB 4RGNA 1L0YB 1BCPF 1LTSD 1V1PA 1ENFA 3CHBD 4L63B 4L6TB 1I4QA 2AQ2B 4RGMA 1LTBD 1YN4A 5ELCA 3R2IA 4O1NA 2XN9C 3TSSA 1JWSD 1LTRD 1PZJD 1LTGD 1YN5A 2XRSD 5D3DA 4Z9CB 4TSSA 4RH6A 1S5DD 3OWEB 5I4DA 1JCKB 1I4XA 1SJHD 1EEID 5TSSA 1D6EC 1PTOC 3EFXD 1PZKD 2TSSA 1S5BD 4DXGA 5FKAC 1BCPB 1JWUD 3W2DA 4RFBA 2ICIA 1GOZA 3MFGA 4DXFA 1S5CD 1RCVD 1LTID 4OHJA 4BWGB 1SE4A 1SBBB 1RDPD 1LT4D 2AQ1B 1PRTD 2R61A 4NZLB 1B44D 3KLSX 3BVGA 1S5ED 1FGBD 1I4GA 3DWAA 1SXTA 1TS5A 1CK1A 1PRTC 1PZID 1LLRD 3BYYB 1D5MC 2CHBD 5FK9C 5ELDA 1PTOF 3V05A 1TS3A 1FD7D 4UDUC 5ELBA 1RD9D 4C56C 1HTLD 1AW7A 4K6LA 1CT1D 1CHPD 1JQYD 3BVMA 3BYTB 2RDGA 2IJ0A 1FNUA 1QILA 1DJRD 1I4HA
chains in the Genus database with same CATH superfamily
4X3KA 4RCNA 2EKEC 1YJ1A 2E2JB 4KKTA 5CYUA 1I94L 4DAMA 1WTRA 2RKSA 4A3DG 1PH1A 3I4NH 1SDFA 4OX9Q 3I4MH 1NE3A 3PO2G 3EN2A 3I72A 2KWUB 4ZYNA 3GTJH 1Z9FA 4NNJB 1L0WA 2D2CC 2MP1A 1U4LA 4EGVA 1E0BA 1JMLA 1Q1BA 1VQFA 1K0RA 1DOKA 3W9CB 4JBJA 3UE1A 3QARA 5ISRA 4DHZB 4HWIB 1OXUA 1MJCA 1FPYA 4PK1A 1SE8A 1RLFA 5IA7A 2WHIA 1WCMG 2F0UA 3I9V1 4DNTB 4DFAA 2R93G 4PQXA 4KGRA 4XC2A 5DCNA 4C4VB 2ZVOA 1CQVA 1OEYJ 4ZLTF 2PYKA 3RUIB 1K53A 2WAQB 5C3EH 4KKUA 4JI5Q 1RFAA 3RN9C 2DZJA 2H4OA 3N30A 1XX8A 1TWAH 1LM0A 4X62Q 2H88B 2AHOB 1F2RI 4IZ8A 4K2LA 2NN6H 4KD3A 3GTPB 3DM3A 1C48A 4DK0A 5IYDH 4M1UB 4MZ9A 3GB1A 4DV2Q 1BXTA 2IPKD 5IP4D 4LFBL 4BZAA 2I5HA 3HEJA 4PV1C 3I4LA 2BPSA 4PYZA 3KUCB 2E2JH 4OWWB 2IY0B 2WS3B 3ULJA 2JPHA 3DBHB 1J8CA 2IWHA 1BBUA 3ZKJC 4AJWA 3UDIA 1BMLC 3QHTA 1GJXA 1EOVA 3KBXA 4LJZC 1WMHA 3J80i 2RSUA 4M00A 5EKIA 2IX0A 3C0RB 3PLVA 3QJZA 1JWSD 3NJTA 4OVZA 2KJRA 4MSMB 5IYDG 3RNUA 4LF7L 2PO4A 3VYSA 2JE6I 5AFWA 2B3GA 3Q8AA 3EQLC 1XMOL 1BF4A 4HROA 1GUOA 1BCPB 3AU7A 5C4ZA 5FLXL 5IT9c 1MHHE 2R7DA 3OLMD 1PDXA 4RM8A 2VQFQ 2N7DA 2HIVA 3I8ZA 1HR0Q 2HQLA 2DY8A 2PMZB 4MHEA 3QB3A 4MJSA 3CU7A 4W9JA 2IX1A 3GTPH 1I4GA 3C3LA 1E6EB 1TTNA 2AWTA 3JSVB 2IO3B 4YL8A 1WGRA 4BA2I 5DM73 3KWLA 5AJ3L 4YY3Q 2XEWA 2KWVB 1RIPA 4LF5Q 1J5EL 3VR5A 5KGUA 1Q3LA 4YSZB 2LZ6A 4HK2A 4A90A 1GG3A 2VY3A 4ZCKA 1CI3M 2WAQG 1UEBA 1SSNA 4M8MA 4TUUA 1NYRA 5E4XA 5ELBA 4F88A 1BNZA 4DR5L 4EZJA 3UQBA 4HJ5A 1DD2A 3UIOB 2BA0A 3O65B 2K04A 3MC9A 2N9KA 2WU5B 4JI8L 1BBXC 4O2DA 2IJ0A 4V0BA 3STBD 4CDDC 1QOHA 4IFDH 3I3TB 5C2TB 2F3IA 4C7ZA 2KK8A 1TWGH 2F0GA 1C4PA 3M95A 2OQ0A 4OO1G 1HQMC 2CHZA 4C3HB 3H0GB 3MFYA 2KXJA 4BBNF 1C4QA 1XNRL 4IM2A 3H94A 2OJRA 2DWQA 3S24A 3GS2A 4V190 3J7A5 3F2DA 5HGTA 2IW3A 2MBHA 1TS2A 2DAFA 3CQZB 2CQAA 4YIJA 1XPUA 2OT2A 2BT6A 2SNSA 2OWOA 1YD8U 2FAZA 3AEGB 2A6ED 3MXNA 4A3CG 2EE1A 5GROA 5IGFA 5C44H 2QMTA 3HKZB 3JSVA 4P1BC 3ABVB 4BOSC 1D5XC 4G4KA 2R7ZB 2WXRA 4DV6L 1NTGA 3K59A 3FKIB 4KY7A 3P20A 3QA8A 2EMSA 3K5MA 4KLKA 3BK2A 3T1YQ 3Q24A 1VZ6A 1K73C 2NCNA 3A7AB 2RDBC 1F77A 3CF6E 3T53B 2MPMA 2VB3X 2WINB 2JXXA 2O5JC 4QB4A 4N9TA 2LJIA 2E3TA 4HAEA 4LMQD 3RUZA 4LAAA 4OZCA 2K33A 1WJNA 1C0AA 1TS4A 2NMQA 1OXXK 2RHSB 3G71A 4IOCA 1Q7YC 1M90C 1DOIA 1WXVA 2WX0A 3H6NA 1WF9A 3AYHB 2UWQA 3PUWA 2VH1A 2HHHL 4W9GA 2BS4B 3HOXH 1ET9A 3BVZA 4U68A 4CKCA 3DQVA 5DPRA 4FULA 1JICA 1TT2A 4DK6C 2ZXOA 2F0LA 2WFWA 3FHWA 1QB5D 4C3HH 5E6PA 1C9FA 4IPCA 3O13A 4A55A 3FEWX 3CHBD 4IO9A 1ENFA 2D2QA 4K6DA 1U0LA 4I6NB 3HVZA 4HEDA 5EKLA 3CQZH 3QIJA 3CP0A 4JYAL 4RM9A 1NR4A 4C3JG 5HG2A 3VR8B 2QDBA 4HCEA 4DNRB 2R7ZH 5I4DA 4YXDB 1WGKA 1EY6A 2RQXA 4X57B 4HMIA 4ANWA 5IYCG 4EQ5A 1MKHA 2MJ3A 3H0GG 2JYOA 2EMTA 4FP5D 1MPEA 1AARA 3PZ8A 1C4AA 1XD3B 1QE6A 3ML9A 5DPWA 1YMHE 4EZKA 3T3OA 4J3OD 4ACFA 2B3AA 1IYUA 2EIFA 4MIUA 2FJ2A 2UUBL 4US8A 1EZ8A 2F3VA 3HKZG 3G4SA 4A3LH 2R7ZG 1YQ4B 2K5VA 3NP8A 4Y7NB 1AFPA 4CBVA 1VJKA 2N9EB 2KCNA 3FKIG 3VH3B 4DDGD 1R4MB 4HTHA 2MHVA 2PIAA 1D4BA 4XIGS 3X3NA 4PYUA 1T9HA 1DOMA 3JAME 1EYCA 5E6JA 4BBSB 5DNFA 1PH9A 1DOYA 4EQNA 3DVGX 4YWLA 4A3FG 2K1FA 1F2RC 4H7BA 1WFYA 4JE3B 1HZ6A 2JY6A 2VUMB 2XGTA 3FP9A 1PUTA 2GLSA 2OCEA 2AUKA 1B4OA 4W9CA 1H9RA 1RTOA 2WIIB 2ASQA 3T56B 1CMXB 1VQ4A 1YBYA 2LASA 1I4HA 1A0IA 1LTAD 3NTIA 1B1ZA 1H95A 2WXFA 2EKIA 3EECA 4B9WA 1YITA 1E10A 1KOTA 4OVVA 1IZ6A 2PZTA 1M8AA 3AFQA 1WM2A 3K7AH 1PRTF 3OSOA 1EIFA 4B3RL 1STEA 1PGXA 2WQYB 1SNPA 1BR9A 4J6HA 5EBDA 5AUKA 2Z8LA 4AS1A 2LEKA 2J53A 2KC2A 2VRRB 1CKNB 2E74C 1TWCH 3CAMA 1J6QA 3NSWA 4TVAB 3Q8FA 4OW0A 2JYTA 4KHZA 1GHJA 3M3YB 4P6VF 1QQRA 2BYEA 1TGZB 3MXUA 2KCTA 5FJ8H 3DUZA 4X3SA 4XT1B 2KEEA 2XNAC 4RAUC 2CVRA 1BT0A 3BWUD 2W3SA 2KDIA 5CHFA 1WGGA 1V97A 2K50A 5GXGB 2G5DA 2AWOA 4JC0A 4PG3A 2UXDL 1N5XA 2W55A 5E6NA 4NB3A 3K8AA 5GAHC 2UU7A 2VXWA 3VA5A 4AYBB 1SYFA 1PGAA 3NHHA 4NXNL 3DOWA 2WV6D 3BDCA 2HD5B 5LMNL 3DEPA 1P7EA 3DMUA 1A15A 2JSVX 4DAYA 1GUTA 5D65A 3MEHA 3V62A 3A0JA 1VQ8A 1Y1VH 2KDMA 5DPSA 5J2RA 2NZOA 1UEAB 4BY1B 1S5FD 2DUDA 1S72A 1QNKA 5AJ3Q 4OIJA 5LXIB 4JI6L 1HXYD 2HD3A 4KTAA 2NTTA 2K52A 5D3IB 4A4IA 1JE5A 2Q2UA 2JU6X 2M17A 3ALBA 1TZOA 1VCBA 2DNCA 1J5EQ 1MJEA 1E8ZA 2RPVA 4XQJA 1QF6A 1OTRB 1CKNA 3N6RA 3NOBA 2CHXA 4YSXB 1MFWA 2RF4A 4BBSG 4GN5A 4AH6A 4CDCC 1WD0A 1HFNA 2V1CC 4DR5Q 4QQBX 1SIJA 4JI7L 2KOXA 3ZGZA 1FL0A 2VUMG 4JI8Q 1WVLA 4TSSA 1YOVB 1PFSA 3J7AF 1XNQL 3M3YH 1V43A 1STGA 2QDFA 5EGTA 2ZNVB 3A9KB 4JWUC 2C7NB 5J3BA 3LXFA 1EY5A 4GXBA 2MA9B 3AB9A 4KMUC 2N1WA 2AKWB 3F2UA 1XNRQ 2O4XA 2KN5A 1HCZA 1FVIA 4H13C 3S15B 1JJGA 2RPQA 3I57A 3IFDA 1PVOA 2L5TA 2Z59B 3P42A 5L95C 3NVWA 3MFGA 2BYTA 1IBXA 3A1QA 1RCVD 4HSVA 4BWGB 3RD2A 3BDOA 3U7ZA 5HI1A 3MAQA 2L4NA 3Q3FA 4FF1A 4DV6Q 2EXZA 2GN5A 4K5WA 1K52A 1BKBA 3RZDB 2DENB 4CQNA 5CTRC 2HJ8A 1LLRD 3BYYB 2KVZA 1B70B 2FNJB 1TIID 1TQOA 2K5WA 4HPLB 2ONQA 3NBHB 1VQPA 5KHQA 1I5FA 2KDFB 4HR7B 5CR3A 1WXMA 3WAOA 1YHQA 3HOVH 4A3IB 4AYBE 3Q0AA 3TS2A 1WX7A 2WXQA 3Q2AC 3R7QA 2F0HA 1CM9A 3RMHA 2CH4W 2EVBA 1HTLD 3A7LA 4KSKC 5KHOA 3SD5A 1KAWA 5M5XB 4ABNA 5IODA 5L83A 3NQIA 3ZLZA 4R4TA 2B2TA 2FMCA 5JPNC 2CJNA 4F7ZA 2YTVA 3OMGA 2A69C 1MSHA 3SDLC 5ELNA 2ZXPA 1ET6A 1H4RA 1KH0A 2ZJDA 4BY1G 5I6WA 4ANVA 2CW0D 1L0VB 3E0JA 2WXGA 3GTLB 3CPFA 1VQBA 1VF7A 5K36G 2ZVNA 5IWAL 3HOUG 4FYDA 5CV6A 2M4NA 4WWPA 2CS4A 5DPTA 1G6PA 3N52A 3I90A 2F0KA 5BN5A 2JRIB 5FLMH 1NDDA 1V1OA 4G0NB 4MTKA 2BE5C 2L76A 2F0PA 2K8CA 4JYAQ 1BVSA 3ONAB 5EPLA 3MHBA 3RD4A 2JA7H 4JV5L 2INDC 4ZHPA 1BCPD 4FDBA 2LXJA 1Y8PB 1ZEQX 4YTMB 2BKFA 2B2VC 1II3A 3RZDH 1Q5WB 2Q8IB 1EFID 4DV7L 4FXGC 1DOLA 4E6IA 4I7ZC 3AFPA 4XQQA 1KLUD 4FXKC 4RGTA 5BMGA 1WWTA 4A3IH 2KVMA 2F0NA 4JGHB 5FLMG 1EUJA 1X3FA 1MD2D 1C3TA 4ZUIA 3SXHA 4YCWA 3K57A 5FO9B 2NPTB 1YJNA 3JAML 3KF6B 1W3SA 2UUBQ 1GUWA 1U4AA 3NK9A 1QNUA 2JEBI 1ZOYB 3ECIA 3RNCC 3AH7A 2KLGA 2PI2A 5CV8A 4L8JA 4GDLB 4NDXA 3FC4A 3VTWA 1F9PA 1YNNC 1QOBA 5JVG3 4F8MA 3CMMB 2F0FA 1LACA 4CO7A 2B2TC 3P7JA 2XWJB 4UP7A 4LK1C 3GTLH 1HHVA 2ZTCA 4L63B 2VS1A 3FAHA 4DV4L 2V4DA 2XK5B 1TJEA 2NVTH 4MNOA 1EFWA 1FMAD 3NUHB 1LTRD 2EZVA 1SROA 1Q0WB 3HGBA 1PGBA 1I6HB 1QVCA 1S5DD 3PV0A 4P7IA 2M00A 5BYQA 2QW7A 5J17A 1WTXA 3KLSA 1SMYD 1FRDA 1PTOC 4ZRZA 5EPJA 1S5BD 2JQOA 2J52A 2N49A 2PCFB 4FNFA 1KD1C 1K8OA 3AULA 5C5LA 1X32A 5IP9H 1X55A 4B3RQ 2KCCA 4C7YA 3E6ZX 2JA6B 2MLBA 2NPTA 3NY5A 1S5CD 3VUWA 3ND9A 4DV3L 3WOEA 4LUZA 1IBKL 4IM3A 3VFKA 2F0MA 1JRUA 1RM6C 2EYHA 5EDSA 2R61A 1TIFA 3HOZB 1A2TA 3L0WB 3AE4B 3RZOH 2V4LA 3HUIA 3PZ7A 5IO9A 2BBCA 2JN4A 2Y0SB 1L1OB 1PZID 3UDFA 2LXAA 2KECA 2KKCA 3M85A 5FO8B 2K1BA 2RSNA 1Z47A 3C1FA 3I4OA 2UXDQ 2XK5A 3M62B 2V3SA 1JB7A 4CYEA 4W9HA 3SVMA 5IOIA 1DZ1A 1XQQA 2L0FA 3BIID 4A20A 4NXNQ 3AB5A 1Z2MA 1A2UA 1LYLA 5IGGA 1STHA 5IGCA 5C0XI 4A3BB 1Y56A 2L05A 1IYFA 3AEFB 4O42A 4JI4Q 1FNUA 3GTQB 3BZKA 3ULLA 1I6HH 3H7SA 2OJWA 4DWFA 2D5DA 4IFDJ 4W9DA 4RKLA 1A70A 5C4XB 3DXJC 4QGUA 3Q6SA 1E22A 1WM3A 1K83H 3K0YA 1QZHA 1PH8A 2D10A 2MUYA 3SHQA 1TR5A 3VRBB 1GB1A 2JA6H 4A9AA 1KRSA 2HCIA 1EY8A 1OXVA 1X56A 1IYJB 3HOWB 2C7HA 5CV4A 1YNTE 2I1KA 2GVAA 3ZJYC 1OQRA 4G3XB 3KH0A 2KBNA 2OXPA 2ZM6Q 1GAQB 4K1RB 3HOZH 3V61A 2G4DB 4JBKA 3RZWC 1SJED 4K8IA 4A75A 2Q5WD 3CC7A 3L4PA 2AMCB 1WTPA 2E6XA 3NQTA 3R8BA 2YV5A 1JWAD 4A76A 2IGGA 2JT4B 3GP7A 3BJUA 3T1HL 3H9DA 1G291 5JVH3 1CFMA 1AE3A 4TKNA 3SFEB 3TZDA 1UH6A 2B29A 2HUGA 2JA6G 2EYFA 2GVBA 4MGKE 3DWQA 4GOPC 3AN1A 3Q22A 1B3QA 3HM6X 3GTOB 4KK7A 5M3MH 2ATWA 3GTGB 1UELA 2SEBD 4DUZL 1HUMA 1YZ6A 3GTQH 5JJLA 5T1GA 1QOGA 3S1QB 3Q3JA 2Y0SG 1SNCA 2C7MB 4KJNA 2QEJC 4PMCA 5C4XH 5IP7H 1KDBA 3P1HA 1WTOA 1D2BA 2F0OA 2K6AA 5H1SE 4FXDA 2A6HC 4RGMA 1HUNA 1I35A 5BYRA 1E5WA 3AE1B 1YNJC 3E9SA 3HOWH 2HJ1A 2BS2B 3AU5A 4LNIA 4A3BG 2JQRB 1H9SB 2Z6BA 4B9KA 3PMFA 2LGSA 4GLSC 3VHTC 3CCUA 1GUGA 3ETRA 1HTOA 3MXPA 4W9EA 4LF8L 3W2DA 5JPMC 5K5PA 5C4XG 4K8JA 4KN7C 5IWAQ 1J7BA 3IT6B 2EYMA 3ZRFA 1ONLA 2A69D 1GOZA 4A3DB 1FR3A 4MEMA 4GLAC 4KIKB 3KK7A 1N33Q 4KKJA 3OJ4B 2MSED 4KKIA 5CHWA 1GB4A 2ZCCA 4XQNA 4PZ7A 1RDPD 1ZUD2 1SNDA 2KLCA 2F0IA 3HOWG 4JV5Q 2G45B 2MH7A 2QSDA 4YTNB 1STBA 3BVGA 1S5ED 1SIFA 3RULA 4LF4Q 3GTOH 1WYDA 1F9QA 3DDCB 2JP1A 3R93A 1ISNA 4J1MA 2NB0A 4DV0L 2WXMA 5IKCM 2A5HA 2WB1B 2BE5D 3AMZA 3W1GA 3I56A 2KO3A 4DV7Q 3IBEA 3GZNI 3KYHC 2PVGC 4NKLA 4LFCL 4A93G 1WZ0A 3NVVA 4H02A 4FA6A 3AM9A 1F9RA 3UDXA 2BB6A 1BO0A 1KM7A 3IL8A 1Y8OB 5ELOA 2DYOA 4HKQA 3RN2A 1NJIC 1ZP0B 1CT1D 4JI2L 2KANA 1QVGA 1ASYA 3Q3OC 2UXCL 2D3GA 4IUTA 3PIO3 4D2KA 5BMHA 3AI5A 2B2WA 4DR4L 2MW5A 1FEHA 1NI3A 4EKUA 2VZKD 2DY7A 2AL3A 3ML8A 1IP9A 1M4VA 2GOWA 2LWPA 1ROEA 2ZPYA 2QCPX 2M2LA 4KVGB 4KIKA 1JROA 5GQOA 4B3TL 1H9JA 3HS0C 1EF1A 1N36L 1KQSA 4DR2L 2QHOA 4DV4Q 4A3DH 2VQEL 1EWIA 1YNND 3DPDA 1SAPA 2R92G 4DR1Q 4GKJQ 5JJKA 1SMXA 2YU9B 2LSSA 2DLBA 3NEMA 3VR9B 2KTFA 1IXRA 5LXHA 3OIQA 3J7YW 1GPXA 1WI0A 1L6VA 1RWSA 1C1YB 1MJDA 4ITKA 5FR3A 4H0LC 5EPKA 2K25A 4R3DA 5FO7B 2JWZA 3TIXA 2FBWB 2WXHA 4LWCA 1VQLA 2UYZB 5T8IA 3PCOB 3RNBC 5IIFA 3S1NB 3SEBA 2WDTB 3N9YC 1AEXA 1P3QU 1SYEA 1JE4A 1WCMH 4WAFA 2R93H 4XZ4A 5ELFA 5C0XG 3ZNGC 1PTOD 1Y1WG 2LRWA 1ESFA 5EQ0A 1EZ6A 3QG1A 4DV3Q 4BVUC 1Q90A 1IBKQ 2BA1A 3TEHB 3J81E 4AQYL 2Y5PA 2ENBA 1FNVA 1LFDA 4MELA 4ILWA 3PO0A 4A3JG 3C19A 1H9MA 4H44C 1N62A 2L00B 2V4IB 3OTOL 3AV8A 2K05A 2L15A 3A4SC 1WMHB 4LJPB 4DDID 2WB1G 1HNXL 3D4WA 1AH9A 1YQ3B 4W9KA 4ZKCB 4WJOA 1J7AA 4N58A 3RLFA 1NUCA 2VL6A 3M7NA 2CHWA 3QWNA 4PT5A 2B2WC 4CHKA 1SE9A 5ELCA 2CU1A 4HKZE 3TEXA 3TP6A 2RSOA 4M01A 2XN9C 3KBGA 1OGWA 1V49A 3DHGC 2F0SA 5EE3A 1IPGA 3GZNB 4J6IA 2A73B 4RH6A 2MX2A 1V8QA 2OQKA 3JVZX 2LMCA 5AZGA 4US9A 2PLPA 2OEOA 4URKA 4NMZA 1FYCA 3VTUA 4PZ8A 2LVQA 1LQBA 2N7JA 1KNEA 3S14B 2Z0EB 4MJSB 1PDQA 2JA5B 2DNEA 2WXPA 1Z5SB 3S1NH 1RJTA 1GC6A 1QCBD 2B76B 1VCIA 3AE2B 2V3NA 1SBBB 2ID0A 4C3IG 1LT4D 2I46A 1P9DU 2LS01 4PZ6A 4R4CA 2O6VB 1B44D 3MTNB 4K7SA 3RFZB 2ZEQA 3BY4B 1UGMA 1U4RA 1Q8IA 2L9HA 1IUEA 1K51A 3WA0A 1CZWA 4ZKBB 1GHKA 4RA8A 4C1NI 3IT4B 2IY5B 2F0JA 2M8SA 3WCQA 3G48A 3NPPA 2NVUI 2KQ4X 3IRBA 1QLBB 3DWGC 3HFZB 4NPSA 3ZYYX 2MNAA 1V5TA 4MH0E 3RMKC 1X65A 2KC1A 4II3B 1GVPA 2F0WA 3S1RB 4X64L 1LM8B 4ZQ3A 1T0QC 2J0KA 3CCVA 3IG3A 2EJFC 4XDCA 3SU8X 5LMUL 4GKKL 4AWJA 4C56C 1X3PA 4JCVE 5I6YA 4YCVA 2ZJPA 2K3UA 3QQ8B 4AJYB 1W6JA 4HDQA 1JJCB 3BVMA 4L5SA 1ZDVA 2I38A 2FMMA 4EUTA 4DUZQ 2CKHB 1FD6A 1UAPA 4QCLA 2KD0A 1PH5A 4DHZE 1EY7A 3MXNB 1J8IA 1ENAA 4GLVB 4IUUA 4OO1H 4AIMA 2GBMA 4YHHL 2MJDA 1N5WA 5CBAE 2N4FA 3U52E 3NENA 2O6VA 1EYDA 3T3NA 3PT2B 1J0GA 1CA5A 3LGJA 2JXMB 3TEZA 2WAQE 1CQFA 1UWXA 1UNSA 3APDA 4B3SL 1OTCA 3OW2A 1N32L 2IGDA 2NYZD 4C3JB 4A3CH 3D6CA 1PFNA 1YNJD 5EE1A 4LTUA 3APFA 3HK0A 4LF8Q 4PNYA 2JA8B 3QC8B 4GDKB 4TQ1A 4XDXA 5ELEA 4QJFA 2FUHB 2JA5G 4GZYC 3P4QB 3S1RH 1VZ7A 1WIAA 2CWAA 1I7HA 1HE8A 1SGHA 1JQ4A 4DK5A 4AQ7A 1WJUA 5E1FA 3J7AV 4JI0Q 1HPCA 4NAWB 4HVBA 2C9WB 4WJ3M 3A5UA 4DV0Q 4JVZA 1QOFA 4UY8C 5LL6S 1T0SC 2L8JA 1HEZE 5E6OA 4NW2A 3Q8EA 4LFCQ 3H3VC 1YHBA 2NVXB 1XTCD 3NUCA 2G3QB 1V1PA 1BCPF 4WAAA 5HFYA 3HZXA 3Q8CA 1KXLA 5IT9E 3HP3A 3LWUA 3QJYA 4A3FB 1WXSA 1K3RA 3BK1A 5BN4A 4ODGA 2KDEB 2KX0A 2KUMA 4Z9CB 2L12A 4B0MA 3PO3B 1ILQA 2PMZE 3NWTA 3KJOA 1F1HA 4DR4Q 1JMCA 1EEID 1P98A 4HJGE 1D6EC 4C3JH 4GDKA 1ZGUB 4FADA 3CCMA 1WGYA 2K28A 3B2FA 1FXIA 2LUEA 3GD7A 3ICEA 5HGQA 1Q1EA 3WWVA 4B3TQ 3NVZA 4ZRIA 3RNGC 3T4AC 1XLQA 5IYCH 4S0RA 4BFRA 1VS0A 4XE0A 3H0GH 2VQEQ 3RPFC 1PH6A 1GD7A 4NAWA 3MJ5A 3M4YA 2FFKB 2LI5A 3MP9A 4WWOA 3FVQA 4BBNC 4DAVA 1FGUA 1R4QB 1E7PB 2MRPA 3Q69A 4HLEA 2KT7A 4B95A 2G9DA 2E2IB 1KJTA 2LGIA 5LNK1 2ALYB 4HPPA 1PHJA 5KRUA 1NYQA 4IOIE 1VQNA 3J81L 3S1MB 1L6UA 4ZRQA 2EYPA 3D6WA 1EIHA 1T6BX 1FM0D 4CJ0B 3S17B 3FKIH 3VVWB 2JA8G 1A63A 4II2B 1I94Q 3ULPA 4WH4A 2JWUA 1E2VA 3R66C 3ERQA 3CKIB 3IAYA 3MA2B 3D3RA 4A3FH 4AUQC 4WWNA 4DR3L 2E75C 1EIYB 4IURA 3AE3B 3L3OC 3SK5A 5IOCA 3OIPA 2LFNA 2ZTEA 1G8ZD 3WAPA 4DQOC 3HKZE 5NUCA 3OTOQ 4Y52H 3ZNHB 2R6GA 4FJVB 2H5XA 2L0TA 2O2VB 5G3LD 3W1BA 1WYWB 1HNXQ 1Q81C 4N6EB 4MTNA 3EFCA 2WU2B 1GUNA 2BF8B 2KEDA 3AE9B 3VA7A 4R8IA 2VZAA 4EEWA 3UE0A 3U58A 1WTWA 3HIZA 3P4SB 4KY5A 5BN3A 4WFN3 4K0KL 1XLNA 2GRIA 3Q8BA 2EY2A 4LNQA 3GOEA 1X3EA 2RMMA 4ICVA 4KX6B 1C79A 2F03A 1JR0D 3OHXC 1HNZL 1VQ7A 3P75A 1KC8C 3PO3G 1W6KA 2F0VA 1VQGA 1LT5D 2YEPF 4DAYB 1B3AA 2O2LD 3S1MH 4LFBQ 2R2QA 1WH3A 1EQVA 3HM3A 5F2DA 1T0RC 3S17H 2WXLA 4XXEA 5JEAG 2K5QA 2PMVA 2KHWB 4WJWA 1CSQA 2ASBA 4LDTD 3IHPC 1LT3D 2PW5A 4RHSA 5D7GA 2M56B 1BBWA 2O2VA 1T5XD 5KNCA 2K8HA 3TEYA 1SE2A 1JOOA 3CWIA 4PS8A 4LF7Q 1E3PA 3A8IE 3DVNU 2BS3B 2K32A 4Y7NH 4DAPA 5CV7A 1XMOQ 4X64Q 3M7GA 1I4QA 3QCAA 5LMUQ 4NAMA 3R2IA 4GKKQ 2BYVE 2F4IA 4O1NA 1K8MA 2LVPA 4XDDA 4DF7A 4BBSH 1PH7A 4N9F4 5D3DA 1PYSB 1VD2A 3NZUA 1E2ZA 3DHHC 1I3QB 2ZCBA 1E9MA 1F2LA 2VUMH 1IBXB 3LB8C 3A1QB 2TSSA 1XCTL 4IQZA 1PFDA 2INCC 1NI2A 3B2GA 1TWHB 2GI9A 4BOZB 1DGJA 2I5MX 3U50C 4IM0A 1H8CA 1T5EA 3SK6A 2D3BA 4A6QA 3G6JB 3HOUB 3PUVA 1YJIA 1SNOA 1CA6A 1RL2A 4TV3A 1WYGA 1SE4A 1EQTA 2NBVB 5EBCA 4MGYE 4X6AH 3PF4A 4B3SQ 2VZKB 1WFQA 3DWAA 3Q3NC 2P5ZX 3X3MA 1ZYRC 2WKCA 4I65A 4WRDA 1RRBA 1UZXB 3OJ3A 1PRTC 2EY5A 4DV5L 5CV5A 4HDOA 4JPSA 1SYBA 2EXDA 3AXCA 4YT0B 2BWES 1D5MC 5HHDG 2GA4B 2CHBD 4HCNB 2JZ3B 1P1AA 1X54A 2PQAB 1V2YA 5ELDA 2PE9A 4OXPA 1WXQA 4MACA 4NQLB 4Q2JA 1R4PB 4EZLA 3CCQA 1VZ8A 3QR8A 2N3SA 4OEMB 1ZXHA 1E1TA 3V96A 3F2BA 1DXMA 4YWMA 1OXSC 3H09A 4K3BA 5CMDA 1M1KC 2L11A 1N34L 1AWDA 2B2VA 2K4KA 4RWSC 1Q8KA 5BR8L 5M3FG 1HRJA 3BDLA 3OWFA 5IT9L 1I3QH 5KIXA 2FIDA 1GO3E 2OTLA 3DBLI 1PTOB 1N9WA 1E8WA 5H92C 3VR2A 4XWWA 1ZE3D 3PUXA 1TWHH 3M9BA 4GN4B 3H7PB 4BY1H 3PRZA 1A3VA 4WJ4A 1HZ5A 3E3XA 3EVQA 4JQWC 3H6MA 4ZK9B 3VAWA 4DXAB 5K36H 3KYCD 3K0XA 5C0XJ 3ER0A 3HOUH 2PW7A 3B0AA 4KHPL 2E8GA 3MWYW 2Z9HA 4JBMA 4OVUA 1L7YA 1O7YA 2RVLA 2IDYA 4A8XC 2K5HA 2INPE 1X6OA 2MQHA 1UE5A 2PQAA 1F0ZA 2I1JA 1B9NA 4S3SA 4EFOA 1ZXIA 2MP2B 5TR5A 2AUJD 2HHHQ 3U4ZA 2NZ1D 5M5YB 3DVNV 3S16B 2JZPA 2O6VD 3MEFA 1XPRA 2VW9A 5EJWA 1HA5A 4E74A 4CJ2C 2FCSA 1E90A 3R7RA 4IKGA 3QO2A 2Q2HA 3WAMA 1HQRD 1VQ5A 1I4RA 3S15H 5BO4B 1SE3A 2W9NA 3MHZA 3EFUA 4G50A 3PZDA 3H7PA 2J4XA 3CIRB 1E2WA 3WDNA 2LY7A 2IYDB 3BINA 3KF8A 1PQSA 4GSWA 1PTOH 1Y14B 1VQIA 1TY0A 3U9OA 2A5UA 2LFIA 4WJQA 3L17A 1HTQA 4ZRPA 3CCEA 1YN4A 4RNAA 1ILPA 5IYBG 4IPDA 4G11A 2FCNA 3H8HA 3FPPA 2KDBA 1STNA 2LKVA 1YJ9A 1B9RA 4DR3Q 4LFAL 1IKMA 2QDLA 3T13A 4FJYA 2LXCA 4IN3A 4Q5VA 3OWEB 2MP2A 4QIWB 5TSSA 2VNUD 2OTJA 2UU9L 1PZKD 5C5MA 3UDGA 5M5XH 1HH2P 1R9TB 3CC4A 1HZCA 4F8CB 4EE2A 1G6ZA 2NBWB 3EIVA 4DV1L 3DHQA 3SDZA 2JA9A 3DLLA 3CC2A 3S16H 1E7VA 1SR3A 4K0KQ 4MGIE 3SR1A 4WWMA 4LNFA 4P71A 1V9PA 2A74C 2MEKA 3DBLB 2EY6A 4GOPB 4BAXA 4X3TA 3J80c 2I2YA 1KABA 1OO9B 4LUVA 3M4QA 3VRAB 1YIWA 2FCMA 3IAM1 4X3UA 4WQMA 1EWHA 2A68C 1TVXA 3ZJTA 1B9MA 1UBIA 4QAYA 4W9LA 3NBIA 3B9JA 1VQEA 3V3XA 2Q2IA 1L4DB 4ASWC 1HJPA 4A3KG 1EY4A 4GMVA 3AEBB 1CTMA 2PI2E 3V60A 2Z4IA 2KX3A 1JQYD 4JLCA 4QUCA 2ZJRA 1XYIA 3DEOA 5JJZA 3ZRCA 4XGAB 3JAMi 1AZPA 3EROA 3RLOA 1V80A 1NY4A 1WTVA 3NG0A 2UUAL 1Y8RC 4W9IA 1Q46A 1EQQA 3DBRI 3V2TA 4G7OC 4KGSA 5CX3A 3CCRA 1G91A 2LJ5A 1VQAA 4RMAA 4LJOB 2F0DA 2Z1CA 4GOPA 5KNBA 3I73A 1UD7A 4OWXB 4R4IA 3JC66 1E7UA 1O7IA 4BKTA 1KNAA 3ZTDA 4K3CA 2J7QB 4EX5A 5LMNQ 1R7SA 3I3CA 4DK1A 2AYOB 3KWVA 3KOJA 3CPWA 3TP5A 2BB5A 4NP5A 3NELA 2K22A 4K81A 4WIPA 1I4PA 5C1ZA 3Q23A 2V3PA 5JZEB 4IUQA 4UAIA 1X9NA 4GS3A 1T3QA 5C4JB 1WD1A 1FJGL 4JI6Q 5FLXc 3PIP3 1EO6A 2X6GA 2C60A 2B63B 1QUQB 1VRAB 2GBJA 1A62A 1RTNA 5LL6X 3AU4A 2MQJA 4A3GB 3FILA 5BYSA 3PHWB 1C77A 1AN8A 2CFMA 4JI7Q 4DV5Q 4R4OA 4K7UA 2K5NA 2PTLA 2L7RA 1LO5D 1YEZA 2NWGA 4KKSA 1Y8NB 1XNQQ 2IY1B 1WY8A 1EYAA 2UUCL 1ZYRD 1NVID 1EEFD 2DX5B 1SSOA 3BZDB 3PIOA 1L0YB 1EL0A 4FHKA 2PPBC 4A93B 4DV2L 3MTSA 1UWMA 1PXUA 2BKRB 2GBKA 2CQOA 3V6CB 2AWNA 4CGYB 3TUOA 1CJEA 2LHEA 3A9JB 3PGZA 1ZKHA 3P1MA 1XCQL 1TWFB 2WXNA 2RCFA 1N34Q 4XYOA 4MDKE 4E71A 5HKHA 1BUVT 5BR8Q 4FF2A 1HZBA 5G5HA 3QK0A 4IW0A 5I2YA 1YJWA 3K5OA 1VQ9A 2DZKA 3LX0A 2KHSA 4A3BH 4L5QA 5EKKA 2K6DB 4NJ6A 1O80A 3CCJA 2HDEA 3W5UB 1K3BC 4L5TA 4RFBA 2Y0SE 2FE8A 3DVGY 5DLQE 1QUQA 2HE7A 3GTKB 4BXXH 2E2DC 3SGIA 2ZTDA 4KN4C 1U5KA 5C4JH 4DXFA 3LWEA 3TQYA 1IL2A 2BH2A 3MVVA 1V1QA 4A3EB 3NTKA 4IC7B 1YJJA 1Z7TA 3KQ4A 4KHPQ 2WXJA 1A3TA 2AQ1B 3I91A 3G6EA 3DBSA 4IWPA 1WJJA 2IHFA 2R92B 4XYCA 4FXCA 3DBRB 3K58A 3TJPA 4PMBA 4JW0A 1CK1A 1RHPA 2KA7A 2R3ZA 4F87A 1C9OA 1U4MA 4JI3L 1AYFA 1MHXA 4EQOA 2MHJA 1PLFA 2PZWA 2PKOA 2MO0A 5FK9C 4UPAA 4TRDA 3I63C 3N32A 2PZUA 3L08A 3A9JA 1PFMA 4BXXG 4F1SA 5I2XA 2MBQA 4UDUC 4TQ0A 1GXDC 1Q1OA 4A93H 2MFIA 2K6QA 2NN6I 1Y1WB 4K6LA 3RR5A 2B63G 3S2DB 1EUVB 2YTYA 4GGQA 4YY3L 3AE8B 3Q3MC 4FVMA 3KUPA 2Y3AA 3R3MA 4C80A 1QG7A 1GC7A 2JJQA 1TWFH 1TKEA 2LD9A 3MC8A 4A3GG 2BTEA 2CR5A 4PS7A 4A3JB 3PRMB 1EIGA 1A5RA 4TMAB 5D94A 4AP4C 1IKLA 2XRQD 4IUPA 3GTGH 1STAA 4LDTB 1KLVA 3CXCA 3S1QH 1KAAA 3GTKH 4LNOA 1G51A 4N8X1 1TZ1A 1SEBD 3UI2A 1YQBA 3VTVA 3UQAA 4S17A 1MGSA 1KTKA 2N78A 4UP9A 4LFAQ 3URYA 3H3VI 1UF0A 4HRSA 2R92H 2A6EC 4N9PA 1QT9A 4ANXA 2D11A 4KSLC 3BS1A 2UU9Q 3ZO5B 1FCCC 4BBRG 3W5OA 4DN4M 1N8RC 1NSNS 1VQDA 3OYYA 3PSIA 1GM5A 1EYGA 1N6ZA 3TDQA 4DR7L 4M0WA 3EA6A 1GKHA 1HNWL 1WGDA 3NVYA 4HN7A 4DV1Q 2KQSA 4WURA 4DHJB 3KYDD 2KOLA 2WACA 1ENCA 4G7HC 1GNUA 1G2SA 1WJ6A 4LNKA 5EE9A 2YYZA 5C0XH 4BY7G 1O78A 4A3EG 3I4NB 4ME5A 1Y1WH 4UHVA 3T1YL 3I4MB 3NE5B 3S2DH 1RODA 4C3IB 4KJOA 3L16A 3TP7A 1F2MA 3PLUA 3I7FA 3K7UC 5AEKB 4LUOA 5CHVC 2QILA 5H8YE 1WE7A 4A3JH 3APCA 5C23A 1XT9B 1PYWD 2A19A 4QL5A 2B2UA 3DBHI 2M1MA 4L2YA 4MSQB 1CZGA 1L2NA 2LMCB 2JF5A 1IYVA 4OL7A 2A68D 3K9OB 1WTHA 3B08A 1IBLL 4POFA 4HJ8A 3TL5A 5COYA 3HVDA 4CKBA 4IDIA 1YN5A 2XRSD 4IFDI 4OGQC 5D2MB 3WALA 4YWGG 4DA2A 3KUZA 3W3AA 3ITPA 1XMQL 3EFXD 1X3QA 3PUZA 1WJ4A 1A8VA 1TWAB 5DEHA 1JWUD 2UUAQ 2WB1E 2G1EA 3N1XC 2MBOA 2BH8A 4KZCA 3ONSA 3VXWA 3UIPB 4GN1A 4L5RC 2K01A 2MBBB 4I6PA 3PTFC 1LTID 4OHJA 2REXA 4W9FA 3ZUNA 2RCNA 1BOSA 2WGSA 3M63B 3H91A 3RCZA 4NZLB 1CSPA 1HTPA 3U2SC 3R3OA 3IVFA 2K5DA 1TS5A 1UWVA 2F52A 3ND8A 4C3IH 1NAPA 2CU3A 2D3AA 2KYWA 2N9LA 2YU9H 4P73A 1SRUA 1QVFA 2IX3A 3KDFA 1TKGA 2I07B 2C5LC 2WKDA 1XTDA 5HY6A 2M0AA 3NS1A 1V81A 3J80L 1PH3A 2MWSB 4GB9A 3TMPB 1J7CA 1FJGQ 4HIMA 3HRZC 2ES2A 3OAWA 3NWSA 3KUDB 4R8NA 1CKOA 2XBBC 4LNNA 1IHZA 4HMJA 5D6JB 3BYTB 1EF5A 2B2UC 1EQRA 5D14A 2SNMA 4YSYB 1TYGB 2L1AA 3TBIB 3I4NG 4HXDA 3I4MG 4RF1A 2QA4A 3N1YC 2L1BA 2HT1A 1ACCA 4JPBW 4DBGA 1W2BA 3T16A 4QY7A 4KZ0A 4P1CC 1JB3A 2NTSA 1DYQA 1SF0A 4HEA1 1IW7C 2UUCQ 4QF4A 2OEDA 1YVCA 1X3GA 4ZHOA 4LF9L 3FPUB 3HG9A 3I55A 2LUMA 2Z0DB 3T1HQ 5M9OA 3GO5A 1CZPA 4KV6A 2K14A 4CJ1B 3DHIC 3RNAC 2MJEA 1WR6E 4A3MB 5LLIA 4ZAIA 2ZJQA 4JOIC 5C3EG 3P4PB 1B7YB 2M19A 3L10B 1XXGA 3A5ZB 2L0CA 3R2TA 3L0OA 4F7XA 5GADC 2NN6G 1TXYA 1RYJA 1EOTA 3ERSX 2BDOA 1TY2A 1TWGB 1NCVA 2ZXRA 3H15A 3H3VH 1B2TA 1OQQA 2FIFA 2G4SA 4IOAA 4NJ7A 4C4VA 3S14H 1GUAB 4EVOA 2WDQB 2KWDA 4BKSA 2NVYB 2AQ3B 5I9PA 2JA5H 2CJOA 3A4RA 2IO2B 3QOLA 1VQOA 1WI5A 1EWCA 1PH2A 4IWQA 1V1PB 1F9JA 1E8YA 3K5NA 3SE0A 1E1OA 2DZMA 2BW2A 2Q2TA 4JI3Q 3MZ5A 4HIDA 1ZW7A 1D7QA 5GAGC 3L13A 2F3WA 3GQBA 2A6HD 1PH4A 5C44B 2J0TD 4KDIC 1MI2A 2KMCA 4BKGA 3RLNA 4FHJA 1LTSD 2WDRB 3U9SA 4CDFC 1V6EA 2W82A 3X23A 1CKMA 2DAJA 4NXML 1LTBD 1SFOB 2INNE 2IBIB 3TSSA 1V5OA 3EGRA 3T8MA 2EOTA 1HR0W 3ZDTA 2J0JA 4XTCS 3AMUA 4KHVA 2AL6A 2A4ZA 4CHTB 4LF6L 2J0MA 2FCQA 3PHXB 1F9SA 1SYDA 4A3MH 2B8FA 3OOCA 2Z0SA 2WP8J 5FKAC 3A55A 3TRZA 3WOFA 2Q8RE 3L7ZC 2ICIA 2MJ8A 3VDYA 1Q86C 2NUCA 2KZRA 3ENEA 2RHQB 1ZXTA 2HTHA 3SFDB 3U4VA 3HOXB 3Q6BA 3IAS1 1KL9A 2BCOA 3N1ZC 1KDAA 4POGA 3KLSX 2NVYH 2WXIA 5EAYA 1LV9A 2PNHA 3B6YA 1G2TA 2NVQB 2FUG1 3KVFB 5JHAA 2F1MA 3QOJA 2FHTA 5AZHA 2FXQA 1PFBA 3SHLA 4A3MG 2X38A 3AQQA 4JI2Q 1FFVA 2UXCQ 1WX9A 3UGBB 4WORA 3TZUA 5IGEA 1R4MI 4XX5A 5CC4A 4DR7Q 1HNWQ 4G57A 4KY6A 4B08A 4HIOA 2AEHA 4KD4A 2Q8TA 4QMGA 4JL9A 4IFDG 2BQQA 3HKSA 3IFTA 1LUZA 1SNQA 1SFOH 4FBJB 1WTQA 2JA8H 1N36Q 4DR2Q 2RDGA 4EQPA 3VUXA 4ZOHC 5AUIA 3AEEB 3JAMc 4WQOB 4RGOS 4GOCA 2N88A 3MJWA 3BU2A 5G5GA 4GN3B 3SK8A 1JORA 2KACA 1GUSA 4NY0A 4RHRA 5C44G 2CW0C 4B3ML 5FR6A 1KFYB 2QCZA 3KLWA 2F0EA 4BS9A 4IUNA 1XO3A 2IO1B 1IBLQ 1WE6A 4PS3A 1C7YA 3N20C 2D62A 2YEPB 2NVXH 4M8NA 1NNXA 1DCZA 3CCLA 2BGFA 2CKZB 1EU4A 3M4PA 1M94A 3LJ3A 3VYRA 1KLGD 2NVQH 4OELB 3ZXRA 4AQYQ 2N55A 3SR6A 1XMQQ 1PRTB 4GU2A 1BCPC 1NEKB 2B39A 2RBMA 1O7ZA 1U9RA 3G7LA 1WX8A 5C3XA 5E7NA 2ACZB 3E9IA 1VQ6A 3PO3H 2EELA 3GE8C 2X69A 3Q8DA 2UXBL 3NXWA 2GBRA 1HFGA 4MT5A 2GBNA 3TEWA 2ZPNA 1O7LA 3C2PA 3K9PB 3F8TA 1JJ2A 1JW9D 4ZDVA 3CW2C 1V86A 5GAEC 1DGSA 2DYMA 3LYYA 2K0PA 4RG1A 3HOXG 3EHVA 3K7AB 4JIOU 2KQ7A 5JEAH 4K5VA 4C3HG 2SDFA 2D0OA 2F4VL 5BMIA 1Z6HA 2K03A 3CSTA 5C3JB 1PA6A 1SYGA 1IGCA 3K5LA 2JX5A 1T0YA 4HJKA 1P16A 1TWCB 1NENB 3VH4B 1VQJA 4U673 5G55A 1WOCA 3A8JE 2KJ6A 3CRLC 3V6EB 2I5LX 2XIWA 3CMEA 2E2IH 3J81i 1I6VC 3OMCA 2PW9A 2E2HB 1NR2A 3A56A 3F2CA 2KFKB 2DN8A 4DU9A 1YI2A 2D5GA 3EUB2 1CUKA 2DBYA 3QX1A 4KV2A 3T9LA 1ICWA 1I4XA 5JJIA 3DCGA 1FXTB 2KENA 1ESRA 3IFWB 2LGDA 5M3FB 1UE1A 1E24A 2DGYA 1SMYC 2YLMA 4LF9Q 1S1QB 1Y1VB 3PGEA 3U8ZA 2WLBA 4DKAC 4A3LG 2WWZA 1IW7D 5T1IA 5KNDA 2WNMA 1WRDB 1AE2A 1SYCA 1ZKOA 4MN3A 3OW7A 3E0EA 1JC7A 3TS0A 1EY9A 3S2AA 2YTXA 1KF6B 2SAKA 4DHJD 2ON8A 4I6LB 4XYQA 3CRKC 4HJAA 3D4DA 1C8CA 3M4OB 4ANUA 3JW0X 5A35A 4JI1L 2L3ZA 1FXAA 1KIXA 1C4CA 1MBYA 1BQQT 5LHY1 4K14A 3W1SA 2KFKA 5J39A 3D4RA 4OONA 1MG4A 2XWBB 5IAAC 2E5LL 2IT1A 4YHHQ 1AW7A 3A33B 2E2HH 1XJVA 3KW5B 4JG2A 5L37A 5IGDA 4J8QA 1HZ9A 5IN7A 2RR9A 1QILA 2MGSA 5C4HA 1BDOA 1QKZA 4UP8A 5CORA 1K8GA 3TCAA 2X8XX 1N32Q 1H9KA 1E8XA 1C76A 2PQEA 3RNFC 2Z4HA 5M3FH 2HDMA 1LXDA 1K8AC 2VH2A 2KCMA 3P63A 3WIMA 5C6AA 1A3UA 3VR3A 3ZNID 2ZZPB 3DWMA 4NXMQ 1N61A 1Q82C 4JI4L 1UGJA 1QJOA 3DWPA 1OEYA 3VR6A 5CBEE 3PPAA 5FJ8G 2B2YA 3RNEC 4B0EA 3TN2A 2F0TA 4JK1C 5A2QE 3FKYA 1VLBA 3PRPB 2MO1A 4OZAA 3CMAA 4LF6Q 3HOVB 1EWYC 3B1LX 5CGKA 5M5WB 1D5ZC 2TMPA 2XVSA 1KRTA 3K80C 4HJ9A 4IJHA 4PMWA 2EYLA 4DK3C 1WXAA 3MXGA 1J9OA 1NBWA 1Q12A 1VQKA 2KVRA 3LNNA 3M4OH 1EU3A 4GIVA 2A8VA 3W5VB 4DNIA 1JWMD 2ZM6L 4ALPA 3L2PA 3IXSA 3N3KB 5MPOA 2KTRB 3ZJUA 4LLGM 3HHMA 4MM3B 2B8GA 1Y1VG 2HDLA 2EJMA 1FNWA 1K50A 2BDNA 4DUYL 5JHBA 4DPGA 2DNFA 4KDLB 2ZW1A 3KF8B 1JRPA 1X1MA 3W1SC 2BYFA 1SN8A 1RAXA 2AX5A 1FRRA 3KJPA 1N63A 1L2FA 1WZ3A 4ZRKA 1L4ZB 1SLJA 2HQEA 3MC0B 2KHJA 3S9WA 1UBQA 2Z6KA 2N1VA 2OHFA 2DJGC 3QWZB 3S2HB 4YCUA 3OPOA 2JA7B 2M0XA 2RD0A 1NMGA 4FN2A 3NTHA 5G2NA 2MCNB 2V1YA 1K9MC 2QGQA 4M8AA 2OOBB 4IUVA 4BKSD 4FLHA 1XPOA 2FINB 2K5PA 2D0PA 4A3KB 2V9HA 3ZDMC 1WRIA 1LTGD 2LRUA 3EBEA 3U30A 5IYBH 2LHDA 3VYTA 4Q0FA 2JEAI 2B2YC 2E76C 4DXGA 5M5WH 1QOAA 2IZVB 5KYLA 4GNXB 4AYBG 4IPGA 3TMEA 1OQYA 2JRHA 2KJHB 2KTRA 4MM3A 2EYOA 2HCCA 4B3MQ 3A9KA 5EE0A 2IGHA 3PSEB 1DM0B 4WJPA 2XTIA 1P0RA 1XWEA 1F52A 2EYJA 4DR6L 2LGXA 1FGBD 2N8NA 2QKIC 3D0FA 3PIPA 3GTMB 1IBML 4YWKA 2L32A 3D8GA 3K6OA 2A1AA 1VQHA 3HOVG 4USAA 2NVTB 2KWCA 4QUFA 2GB1A 4P75A 1R4NI 1N33L 3OG5A 2BOSA 1ML0D 2BWFA 1D1KA 1PTOF 2UXBQ 2H1EA 1P8LA 3S2HH 4XWTA 5GMVA 1TS3A 4ZRJA 4LF4L 1XEEA 4DGZA 3NBHA 2Z6KC 4K5XA 4HPMB 5M5YH 4L23A 3NZ3A 1VQMA 3PREA 1SNMA 4A3KH 3PF5A 5AZFA 2F4VQ 4GNXA 2JYEA 1C78A 3HOYB 4G7ZC 2MBEA 1FCLA 4KGTA 3FMCA 2V0GA 3I2ZA 2GMIC 1K28A 1HNZQ 2JXTA 3AEDB 1WR1A 1S3SG 3RZOB 1F2ZA 3AECB 4ID6A 2XSCA 1S3OA 1Y69U 2JA7G 1VQCA 2H89B 4X65L 2OF1A 3H1UA 3E56A 4CDEC 1TKYA 3A54A 3FDTA 3X0WA 2G9HD 4HSPA 2NBFA 2ZNVC 3D32A 1Q10A 5DAUA 2JK8A 5E3FA 3JYUA 4E3CA 2EQSA 1YNXA 4LCDE 4REZA 4YTPB 3GTMH 4L1BA 4NQKE 1FO4A 2QF7A 4A3IG 4X66L 3TREA 1LT6D 1CHQD 4DR1L 4GKJL 2IHEA 1AP0A 3FILB 5KEEA 1P7FA 4H2AA 1J19A 1EM7A 1D8LA 1RF2D 4LW1A 1R9TH 1OFFA 1ICFB 2IO0B 3AEAB 4NJCA 3PVLA 3I70A 2R7FA 3UF8A 3PQIA 4HIKA 4FF4A 4A3PA 1K83B 2KMAA 4J15A 3U7DA 1LABA 3ZNZB 1MG8A 1DONA 1L0XB 2PJHA 4ICUA 5JXVA 2VB2X 3HOYH 1F2YA 3KF6A 3AE7B 4OX9L 2L83A 4BA1I 4QIWE 2DYBA 4JI1Q 3I5JC 4RGNA 4ULLA 4I7AA 4JWSC 4MGZE 3RN5A 4GNXC 3BG3A 4GDLA 2WDVB 3VDZA 2AQ2B 4N8FA 1LTLA 1TBEA 5KYIA 2E5LQ 2KJXA 2EY1A 3AEVA 3SK4A 2QIEB 3BZCA 1S4ZA 1PZJD 1BUIC 1R4NB 4XT3B 2HIXA 2PPHA 3TBLD 2Y5BB 2M9VA 1ASZA 2K7VA 1JCKB 5IP9G 3RI7C 1SJHD 5IY0A 1IL8A 2RDFA 3J80E 1KHIA 2KHIA 2RGFA 4IWOA 4RF0A 3HOYG 1DOXA 4N59A 1LGRA 3W1YA 1YHAA 5A2QL 3WANA 3F1ZA 4AOFA 5M3MB 1HA6A 4JI5L 3ZW3A 3GDEA 2KAJA 1MI0A 3Q14C 4ARIA 3RYTA 1YIJA 3VYUA 1XF5L 4X62L 1PYBA 1MVKA 2YVCA 2J7ZA 1V8CA 5LMNW 1PRTD 2CCZA 1E7ZA 1TKWB 1B50A 1AZQA 4HCSA 1VR9A 2DZIA 2C9OA 2N0SB 4P72A 3J81j 1A6XA 3GV6A 1QZEA 3P4RB 2PNRC 2WP9B 2NR2A 2WYQA 3VUYA 1MSGA 5JOBA 4K2KA 4TQUS 4P74A 4BBRB 4HJ7A 3V05A 3UINB 1L1OA 3MHSD 2SOBA 3NS8A 4IUMB 2D07B 3LDZE 1XLOA 4LK0M 4DUYQ 3PUYA 2DJFC 5JH5C 4IPHA 4IALA 4JX1C 2KQ3A 4BY7B 3J9CA 2N9XA 2B63H 3P2BA 2J42A 3CSFA 3RZFA 1KRHA 4ARCA 4RCOA 2EDGA 1YX5B 2O5IC 4RKBA 3M3JA 4A3GH 4OIKA 2L55A 3ZIMA 2VQFL 4OWTB 2WXKA 2N9PC 2F0QA 2IL8A 4M02A 3HOZG 1NBFC 1LTTD 1HR0L 3GE3C 2JZZA 4WJNA 3ZTCA 1YN3A 1I42A 4EOYA 2C35B 4ZYSA 1UE6A 1QZGA 5FLXE 2W3RA 3EC8A 1S40A 4A3OA 1STYA 5J1ZA 4FO2A 4M0WB 3U4EG 3ZJVA 3A74A 2K75A 3DM1A 2D3CA 4R4QA 1ZDXA 2LGYA 2KN4A 3D31A 3PS6A 2PVOD 1NMFA 3E9HA 3CF5A 4HCPB 1WGHA 1JT8A 4ZUJA 2K9XA 4LF5L 4RMFA 2WX1A 1JOQA 3NZSA 4IG7B 1FIQA 4JBWA 3STBC 4BBRH 4K7WA 1I50B 5I9OA 5M3MG 3RT3B 1PMRA 2QEXA 1D1IA 3E5SA 3ZQ4A 2NBUA 2Y5CA 3AE5B 2EPBA 5CV9A 1MIUA 1UUPA 1WSPA 4DR6Q 3KLRA 3NRZA 1L5PA 1KDCA 2R2OA 1L1OC 1IBMQ 5DM63 2EJGC 4C2MB 4APVA 5IP7G 2RDHA 4TKOB 4A3EH 4BY7H 5C3WA 5JEAJ 1IGDA 3PO2B 4B9XA 2ZW0A 5J22A 3PV1A 2DHZA 2D9UA 3C8YA 4KI0A 2BVCA 4NPNA 3C1EA 2JVCA 2CH4A 3J81c 4L6TB 1ZPSA 5E4WC 1EY0A 3HRDD 4JI0L 1PV4A 1TT5B 2L52A 2LVOA 2QC8A 1VF5C 3K81C 1D3ZA 1MHWC 3A8KE 4R1JA 5FOBB 5HURA 4FJZA 1FFUA 2W54A 1VMCA 3ZXVA 2C5CA 3KFUA 3VQIA 5IE8A 5JAVA 3CCSA 2NZHA 1WCMB 3VR4A 3QIAA 2R93B 4ME3A 2ZT9C 5G3LF 1OXTA 1RFKA 3J7ZC 2I0QA 2PEAA 4MH8A 3AE6B 4FF3A 3CD6A 2KFJA 4OO1I 2PE6B 3GTJB 1H9SA 2ICEC 3EJIA 4P16A 1V9JA 1QWYA 1U4PA 4X65Q 1I50H 2NS5A 3FRPB 2CWPA 1HZAA 2HTME 1TU2B 3KDFB 4P2CB 2JSOA 5IGBA 1RKNA 1SXTA 1VDZA 1XLPA 3GV3A 4OZBA 3UI3A 4C1NK 1JALA 2LXKA 4IJLA 4C2MH 1GJZA 1K0SA 4R9WA 2QJLA 2KNBA 4O0AA 3TP8A 4X66Q 3NHEB 3PO2H 5C3EB 1B8AA 2K39A 3QAQA 3T51B 4CKEA 1YX6B 4B6WA 4C00A 3L9AX 2RA4A 2N7EA 1K8RB 1FD7D 1VMPA 4GLXA 2K8BA 5J18A 3C46A 1RD9D 2JUOA 2KMMA 3L54A 1E0ZA 1SB3C 3IKJA 1G6JA 1CHPD 1JOKA 1B53A 2X6LA 1JWBD 3ZVVA 1UE7A 4JOIA 1N60A 2WXOA 1DJRD 1VDVA
chains in the Genus database with same CATH topology
4X3KA 4RCNA 2E2JB 4KKTA 5CYUA 1WTRA 2RKSA 1SDFA 3I72A 2D2CC 2MP1A 1U4LA 4EGVA 1E0BA 1JMLA 1Q1BA 1DOKA 3W9CB 5ISRA 1OXUA 2F0UA 3I9V1 4KGRA 4DNTB 4DFAA 4PQXA 1CQVA 4ZLTF 2PYKA 1K53A 2WAQB 4KKUA 2H4OA 1XX8A 2H88B 1F2RI 4IZ8A 4K2LA 2NN6H 4KD3A 3GTPB 1C48A 4DK0A 3GB1A 4M1UB 1BXTA 2IPKD 3HEJA 4PV1C 3I4LA 2WS3B 2IWHA 1BMLC 1GJXA 3KBXA 4LJZC 5EKIA 2IX0A 1JWSD 4OVZA 2PO4A 3VYSA 2JE6I 5AFWA 3Q8AA 3EQLC 1BF4A 4HROA 1GUOA 1BCPB 3AU7A 5C4ZA 5FLXL 1MHHE 1PDXA 3I8ZA 2DY8A 2PMZB 4MHEA 3QB3A 3CU7A 2IX1A 1E6EB 1I4GA 3C3LA 4BA2I 5DM73 3KWLA 3VR5A 5KGUA 1Q3LA 4YSZB 4A90A 1SSNA 1CI3M 1NYRA 5E4XA 5ELBA 4F88A 1BNZA 1DD2A 2BA0A 2K04A 2N9KA 2WU5B 1BBXC 2IJ0A 4V0BA 4IFDH 5C2TB 1QOHA 4C7ZA 2F0GA 1C4PA 4OO1G 1HQMC 4C3HB 3H0GB 3MFYA 1C4QA 3H94A 2DWQA 3GS2A 4V190 5HGTA 2IW3A 1TS2A 3CQZB 2CQAA 4YIJA 2OT2A 2BT6A 2SNSA 3AEGB 2A6ED 3MXNA 2EE1A 2QMTA 5IGFA 3HKZB 3ABVB 1D5XC 4G4KA 2R7ZB 2WXRA 3K59A 3FKIB 4KY7A 3P20A 3K5MA 3BK2A 3Q24A 1VZ6A 3A7AB 1F77A 3T53B 2MPMA 2VB3X 2WINB 2O5JC 4QB4A 4N9TA 2LJIA 2E3TA 4HAEA 4LMQD 3RUZA 4LAAA 4OZCA 2K33A 2NMQA 1TS4A 1OXXK 1DOIA 3PUWA 2BS4B 1ET9A 3BVZA 4U68A 4CKCA 1JICA 1TT2A 2ZXOA 2F0LA 1QB5D 1C9FA 3O13A 4A55A 3FEWX 3CHBD 1ENFA 4K6DA 3HVZA 4HEDA 5EKLA 1NR4A 4C3JG 5HG2A 3VR8B 2QDBA 4HCEA 4DNRB 5I4DA 4YXDB 1WGKA 1EY6A 2RQXA 4HMIA 2MJ3A 2JYOA 4FP5D 1MPEA 3PZ8A 1C4AA 1QE6A 1YMHE 3T3OA 4J3OD 1IYUA 4MIUA 2FJ2A 4US8A 1EZ8A 2F3VA 1YQ4B 3NP8A 4Y7NB 1AFPA 4CBVA 1VJKA 2KCNA 4HTHA 2MHVA 2PIAA 1D4BA 4XIGS 3X3NA 3JAME 1DOMA 1EYCA 5E6JA 4BBSB 5DNFA 1DOYA 4EQNA 4JE3B 1F2RC 4H7BA 1HZ6A 2VUMB 1PUTA 2AUKA 1B4OA 1H9RA 1RTOA 2WIIB 3T56B 1I4HA 3NTIA 1LTAD 2WXFA 1B1ZA 2EKIA 4B9WA 1E10A 2PZTA 1M8AA 1PRTF 3OSOA 2WQYB 1STEA 1PGXA 1SNPA 1BR9A 4J6HA 5EBDA 5AUKA 2Z8LA 4AS1A 2LEKA 2J53A 2E74C 3NSWA 3Q8FA 4OW0A 2JYTA 4KHZA 1GHJA 3M3YB 4P6VF 1QQRA 3MXUA 3DUZA 4X3SA 4XT1B 2KEEA 2XNAC 4RAUC 2CVRA 3BWUD 2W3SA 1V97A 5GXGB 2AWOA 1N5XA 2W55A 2VXWA 3VA5A 4AYBB 1SYFA 1PGAA 3NHHA 2WV6D 3BDCA 3DEPA 1P7EA 3DMUA 1A15A 2JSVX 4DAYA 1GUTA 5D65A 3MEHA 2KDMA 1UEAB 4BY1B 1S5FD 1QNKA 4OIJA 1HXYD 2JU6X 4KTAA 2NTTA 5D3IB 1TZOA 2DNCA 2RPVA 4XQJA 1QF6A 3N6RA 4YSXB 1WD0A 1HFNA 1SIJA 1WVLA 4TSSA 3J7AF 1V43A 1STGA 5EGTA 4JWUC 3LXFA 1EY5A 3AB9A 4KMUC 3F2UA 2O4XA 1HCZA 4H13C 3S15B 3I57A 3IFDA 2L5TA 3P42A 3NVWA 3MFGA 2BYTA 1IBXA 1RCVD 4HSVA 4BWGB 3BDOA 3U7ZA 5HI1A 3MAQA 2L4NA 4FF1A 2EXZA 1K52A 4K5WA 3RZDB 4CQNA 1LLRD 3BYYB 1TIID 1TQOA 2K5WA 4HR7B 5CR3A 4A3IB 3Q0AA 2WXQA 2F0HA 1CM9A 3RMHA 2EVBA 1HTLD 3A7LA 5M5XB 4ABNA 5IODA 3NQIA 5JPNC 2B2TA 2FMCA 2CJNA 3OMGA 2A69C 1MSHA 2ZXPA 1ET6A 1KH0A 5I6WA 2CW0D 1L0VB 3E0JA 2WXGA 3GTLB 5K36G 1VF7A 4FYDA 5CV6A 3N52A 3I90A 2F0KA 5BN5A 1V1OA 2BE5C 2F0PA 3ONAB 5EPLA 3MHBA 3RD4A 4ZHPA 1BCPD 1Y8PB 1ZEQX 4YTMB 2B2VC 1II3A 2Q8IB 1EFID 4FXGC 1DOLA 4E6IA 4I7ZC 4XQQA 1KLUD 4FXKC 4RGTA 5BMGA 1WWTA 2KVMA 2F0NA 1MD2D 4ZUIA 3SXHA 3K57A 5FO9B 3JAML 1GUWA 3NK9A 1QNUA 2JEBI 1ZOYB 3AH7A 4GDLB 5CV8A 4L8JA 4NDXA 3FC4A 1F9PA 1YNNC 1QOBA 5JVG3 4F8MA 2F0FA 1LACA 2B2TC 3P7JA 2XWJB 1HHVA 4LK1C 4L63B 3FAHA 2V4DA 1TJEA 1FMAD 3NUHB 1LTRD 2EZVA 3HGBA 1PGBA 1I6HB 1S5DD 3PV0A 5BYQA 2M00A 1WTXA 3KLSA 1SMYD 1FRDA 1PTOC 4ZRZA 5EPJA 1S5BD 2J52A 2PCFB 4FNFA 1K8OA 5C5LA 1X32A 2KCCA 4C7YA 3E6ZX 2JA6B 1S5CD 3ND9A 3WOEA 2F0MA 1RM6C 2EYHA 2R61A 3HOZB 1A2TA 3AE4B 3HUIA 3PZ7A 2BBCA 2Y0SB 1PZID 2KECA 3M85A 5FO8B 2K1BA 2RSNA 1Z47A 3C1FA 3SVMA 1DZ1A 3BIID 3AB5A 1A2UA 5IGGA 1STHA 5IGCA 5C0XI 4A3BB 1Y56A 3AEFB 4O42A 1FNUA 3GTQB 2D5DA 4IFDJ 4RKLA 1A70A 5C4XB 3DXJC 3Q6SA 3K0YA 2MUYA 1TR5A 3VRBB 1GB1A 4A9AA 2HCIA 1EY8A 1OXVA 3HOWB 5CV4A 1YNTE 1OQRA 2OXPA 1GAQB 1SJED 4K8IA 2Q5WD 3L4PA 1WTPA 2E6XA 3NQTA 3R8BA 1JWAD 3IT4B 2IGGA 3GP7A 1G291 5JVH3 1CFMA 3SFEB 3TZDA 2HUGA 2EYFA 3DWQA 3AN1A 3Q22A 3GTOB 4KK7A 3GTGB 2SEBD 1HUMA 5T1GA 1QOGA 3S1QB 1SNCA 4KJNA 2QEJC 4PMCA 1KDBA 3P1HA 1WTOA 1D2BA 2F0OA 2K6AA 4FXDA 2A6HC 4RGMA 1HUNA 5BYRA 3AE1B 1YNJC 3E9SA 2BS2B 2JQRB 1H9SB 3PMFA 4GLSC 1GUGA 3ETRA 3MXPA 3W2DA 5JPMC 5K5PA 4K8JA 4KN7C 1J7BA 3IT6B 2EYMA 1ONLA 2A69D 1GOZA 4A3DB 1FR3A 3KK7A 4KKJA 4KKIA 1GB4A 4XQNA 1ZUD2 1RDPD 2ONQA 1SNDA 2F0IA 2MH7A 2QSDA 4YTNB 1STBA 3BVGA 1S5ED 1F9QA 2JP1A 3R93A 2WXMA 4J1MA 2NB0A 2A5HA 2WB1B 2BE5D 3AMZA 2PVGC 4NKLA 3NVVA 3AM9A 1F9RA 2BB6A 1BO0A 3IL8A 1Y8OB 2DYOA 4HKQA 1ZP0B 1CT1D 4IUTA 3PIO3 5BMHA 2B2WA 1FEHA 1NI3A 2VZKD 2DY7A 1M4VA 1ROEA 2QCPX 2M2LA 1JROA 1H9JA 3HS0C 1YNND 1SAPA 2YU9B 2DLBA 3VR9B 3OIQA 3J7YW 1GPXA 1L6VA 1RWSA 4ITKA 5FR3A 4H0LC 5EPKA 4R3DA 5FO7B 2FBWB 2WXHA 5T8IA 5IIFA 3S1NB 3SEBA 3N9YC 4WAFA 1AEXA 1SYEA 1JE4A 5ELFA 5C0XG 1PTOD 1ESFA 5EQ0A 1EZ6A 3QG1A 1Q90A 2BA1A 3J81E 2Y5PA 2ENBA 1FNVA 4ILWA 3PO0A 1H9MA 4H44C 1N62A 2V4IB 3AV8A 2K05A 3D4WA 1YQ3B 4ZKCB 1J7AA 3RLFA 1NUCA 3M7NA 3QWNA 4PT5A 2B2WC 5ELCA 3TEXA 4HKZE 3TP6A 2RSOA 2XN9C 3KBGA 2F0SA 5EE3A 2A73B 4RH6A 1V8QA 2LMCA 4US9A 2PLPA 2OEOA 4NMZA 1FYCA 2N7JA 1KNEA 3S14B 1PDQA 2JA5B 2DNEA 2WXPA 1RJTA 1QCBD 2B76B 1VCIA 3AE2B 2V3NA 1SBBB 2ID0A 4C3IG 1LT4D 2I46A 2LS01 1B44D 3RFZB 1U4RA 1Q8IA 2L9HA 1IUEA 1K51A 1CZWA 4ZKBB 1GHKA 4RA8A 4C1NI 2F0JA 3WCQA 3NPPA 2KQ4X 1QLBB 3DWGC 3ZYYX 3S1RB 2F0WA 4ZQ3A 2EJFC 4XDCA 4C56C 1X3PA 2K3UA 5I6YA 1W6JA 3BVMA 1ZDVA 2I38A 2FMMA 1FD6A 1UAPA 4QCLA 1EY7A 1J8IA 1ENAA 4IUUA 4OO1H 2MJDA 1N5WA 5CBAE 3U52E 1EYDA 3T3NA 1CA5A 2JXMB 3TEZA 1CQFA 1UWXA 1UNSA 2IGDA 2NYZD 4C3JB 3D6CA 1PFNA 1YNJD 5EE1A 4LTUA 4PNYA 2JA8B 4GDKB 4TQ1A 4XDXA 5ELEA 4GZYC 3P4QB 1VZ7A 1I7HA 1JQ4A 4AQ7A 5E1FA 3J7AV 4NAWB 1HPCA 1QOFA 5LL6S 1HEZE 4NW2A 3Q8EA 3H3VC 2NVXB 1XTCD 3NUCA 1V1PA 1BCPF 5HFYA 3HZXA 3Q8CA 5IT9E 3HP3A 3LWUA 3QJYA 4A3FB 3BK1A 5BN4A 4ODGA 2KUMA 4Z9CB 2L12A 4B0MA 3PO3B 1ILQA 3NWTA 1EEID 4HJGE 1D6EC 2K28A 3B2FA 1FXIA 3GD7A 1Q1EA 3NVZA 3T4AC 1XLQA 4XE0A 3RPFC 3MJ5A 3M4YA 2FFKB 3MP9A 3FVQA 4DAVA 1R4QB 1E7PB 3Q69A 2G9DA 2E2IB 2LGIA 5LNK1 4IOIE 1NYQA 5KRUA 4ZRQA 3J81L 3S1MB 1L6UA 2EYPA 3D6WA 1EIHA 1T6BX 1FM0D 4CJ0B 3S17B 4WH4A 2JWUA 1E2VA 3ERQA 3CKIB 3IAYA 3MA2B 3D3RA 2E75C 3AE3B 4IURA 3L3OC 3SK5A 5IOCA 3OIPA 2LFNA 4DQOC 1G8ZD 5NUCA 2R6GA 5G3LD 4N6EB 2WU2B 1GUNA 2KEDA 3AE9B 3VA7A 4R8IA 1WTWA 3P4SB 4KY5A 5BN3A 4WFN3 3Q8BA 1XLNA 2GRIA 2EY2A 2RMMA 4KX6B 1C79A 2F03A 1JR0D 3OHXC 3P75A 1W6KA 2F0VA 1LT5D 2YEPF 1B3AA 2O2LD 1EQVA 5F2DA 2WXLA 4XXEA 5JEAG 2K5QA 2PMVA 4WJWA 1LT3D 2PW5A 4RHSA 5D7GA 2M56B 1T5XD 5KNCA 3TEYA 1SE2A 1JOOA 3CWIA 3A8IE 2BS3B 2K32A 4DAPA 5CV7A 3M7GA 1I4QA 4NAMA 3R2IA 2F4IA 4O1NA 1K8MA 4XDDA 4DF7A 5D3DA 1E2ZA 1I3QB 1E9MA 1F2LA 1IBXB 3LB8C 2TSSA 1XCTL 4IQZA 1PFDA 3B2GA 1TWHB 2GI9A 1DGJA 1T5EA 3SK6A 4A6QA 3G6JB 3HOUB 3PUVA 1YJIA 1SNOA 1CA6A 1WYGA 1SE4A 1EQTA 5EBCA 2VZKB 3DWAA 3X3MA 1ZYRC 2WKCA 4I65A 4WRDA 1PRTC 2EY5A 4JPSA 5CV5A 1SYBA 4YT0B 5HHDG 1D5MC 2GA4B 2CHBD 3ZGZA 4Q2JA 5ELDA 4MACA 1WXQA 1R4PB 1VZ8A 1ZXHA 3V96A 1DXMA 1OXSC 3H09A 5CMDA 2L11A 1AWDA 2B2VA 4RWSC 1HRJA 3BDLA 3OWFA 5IT9L 5KIXA 1PTOB 5H92C 3VR2A 4XWWA 1ZE3D 3PUXA 1A3VA 1HZ5A 3EVQA 3H6MA 4ZK9B 5K36H 5C0XJ 2PW7A 3MWYW 1O7YA 2RVLA 2IDYA 4A8XC 2INPE 1F0ZA 1B9NA 4S3SA 1ZXIA 2AUJD 5M5YB 2NZ1D 3S16B 2JZPA 5EJWA 1HA5A 4CJ2C 4IKGA 3QO2A 1HQRD 1I4RA 1SE3A 3MHZA 2J4XA 3CIRB 1E2WA 3WDNA 2LY7A 3KF8A 1PTOH 1TY0A 3U9OA 2LFIA 4ZRPA 1YN4A 4RNAA 1ILPA 3H8HA 3FPPA 1B9RA 1STNA 2LKVA 1IKMA 3T13A 4IN3A 4Q5VA 3OWEB 4QIWB 5TSSA 2VNUD 1PZKD 5C5MA 1R9TB 4EE2A 1G6ZA 3DHQA 3SDZA 4WWMA 3SR1A 2A74C 2MEKA 2EY6A 4X3TA 2I2YA 1KABA 1OO9B 3VRAB 3IAM1 4X3UA 4WQMA 1EWHA 2A68C 1TVXA 3ZJTA 1B9MA 3NBIA 3B9JA 3V3XA 1L4DB 1EY4A 3AEBB 1CTMA 2Z4IA 1JQYD 4QUCA 1XYIA 3DEOA 5JJZA 1AZPA 3EROA 1WTVA 3V2TA 4G7OC 4KGSA 1G91A 2F0DA 2Z1CA 5KNBA 3I73A 1KNAA 1R7SA 3I3CA 4DK1A 3KWVA 2BB5A 3TP5A 4WIPA 4NP5A 2K22A 1I4PA 3Q23A 2V3PA 4IUQA 4UAIA 1T3QA 5C4JB 1WD1A 3PIP3 2X6GA 2B63B 1VRAB 1RTNA 5LL6X 4A3GB 3FILA 5BYSA 1C77A 1AN8A 2PTLA 1LO5D 2NWGA 4KKSA 1Y8NB 1EYAA 1ZYRD 1NVID 1EEFD 1SSOA 3BZDB 1EL0A 1L0YB 2PPBC 4A93B 1UWMA 3MTSA 1PXUA 2AWNA 4CGYB 3TUOA 1CJEA 2LHEA 3P1MA 1XCQL 1TWFB 2WXNA 4XYOA 1BUVT 4FF2A 5G5HA 5I2YA 3K5OA 3LX0A 2KHSA 5EKKA 1O80A 2HDEA 3W5UB 4RFBA 2FE8A 3GTKB 2E2DC 4KN4C 4DXFA 3LWEA 3MVVA 4A3EB 3NTKA 1YJJA 1Z7TA 3KQ4A 2WXJA 4D2KA 1A3TA 2AQ1B 3I91A 2R92B 4FXCA 3K58A 4PMBA 1CK1A 1RHPA 2KA7A 2R3ZA 4F87A 1U4MA 1AYFA 1MHXA 4EQOA 1PLFA 2PZWA 2PKOA 5FK9C 4TRDA 2PZUA 1PFMA 5I2XA 4UDUC 4TQ0A 1GXDC 2NN6I 1Y1WB 4K6LA 3S2DB 3AE8B 4FVMA 3KUPA 2Y3AA 4C80A 1QG7A 1TKEA 2BTEA 4A3JB 1EIGA 4TMAB 1IKLA 2XRQD 4IUPA 1STAA 1KAAA 1SEBD 3UI2A 1MGSA 1KTKA 3URYA 4HRSA 2A6EC 4N9PA 1QT9A 3BS1A 1FCCC 4DN4M 4N58A 1NSNS 3TDQA 4M0WA 3EA6A 3NVYA 4HN7A 4WURA 2KOLA 2WACA 1ENCA 4G7HC 1G2SA 5EE9A 2YYZA 5C0XH 1O78A 3I4NB 4ME5A 3I4MB 3NE5B 1RODA 4C3IB 4KJOA 3TP7A 1F2MA 2QILA 5H8YE 1PYWD 2B2UA 4L2YA 1CZGA 2LMCB 1IYVA 4OL7A 2A68D 5COYA 3HVDA 4CKBA 4IDIA 1YN5A 2XRSD 4IFDI 4OGQC 4YWGG 4DA2A 3W3AA 3ITPA 3EFXD 1X3QA 3PUZA 1TWAB 5DEHA 1JWUD 2G1EA 2K01A 1LTID 4OHJA 1BOSA 3H91A 4NZLB 1HTPA 3U2SC 3R3OA 2K5DA 1TS5A 3ND8A 2CU3A 1NAPA 2N9LA 2IX3A 1TKGA 2I07B 2WKDA 2M0AA 3NS1A 3J80L 1J7CA 3HRZC 3NWSA 4R8NA 1IHZA 4HMJA 3BYTB 2B2UC 5D14A 2SNMA 4YSYB 1TYGB 2L1AA 3TBIB 4RF1A 2L1BA 1ACCA 3T16A 1JB3A 2NTSA 1DYQA 1SF0A 4HEA1 1IW7C 4QF4A 2OEDA 4ZHOA 3FPUB 3HG9A 2LUMA 5M9OA 3GO5A 1CZPA 4KV6A 4CJ1B 2MJEA 4A3MB 4ZAIA 3P4PB 2M19A 1XXGA 2L0CA 3R2TA 4F7XA 2NN6G 1RYJA 1EOTA 2BDOA 1TY2A 1TWGB 1NCVA 2ZXRA 1B2TA 1OQQA 2WDQB 4EVOA 2KWDA 2NVYB 2AQ3B 5I9PA 2CJOA 3QOLA 1EWCA 1V1PB 3K5NA 3SE0A 2BW2A 3MZ5A 2F3WA 3GQBA 2A6HD 5C44B 2J0TD 1MI2A 1LTSD 2WDRB 3U9SA 2W82A 1LTBD 1SFOB 2INNE 3TSSA 3EGRA 2EOTA 4XTCS 3AMUA 4KHVA 4CHTB 1F9SA 1SYDA 2B8FA 3OOCA 2WP8J 5FKAC 3A55A 3WOFA 2Q8RE 3L7ZC 2ICIA 2MJ8A 2NUCA 1ZXTA 3SFDB 3HOXB 3IAS1 2BCOA 1KDAA 3KLSX 2WXIA 1G2TA 1LV9A 2FUG1 2NVQB 2F1MA 3QOJA 2FHTA 1PFBA 3SHLA 2X38A 1FFVA 4WORA 3TZUA 5IGEA 5CC4A 4G57A 4KY6A 4B08A 4KD4A 2Q8TA 4QMGA 4IFDG 3IFTA 1SNQA 1WTQA 2RDGA 4EQPA 4ZOHC 5AUIA 3AEEB 4RGOS 2N88A 5G5GA 3SK8A 1JORA 2KACA 1GUSA 4RHRA 2CW0C 1KFYB 2F0EA 4BS9A 4IUNA 1XO3A 2D62A 2YEPB 1DCZA 1EU4A 3VYRA 1KLGD 2N55A 3SR6A 1PRTB 1BCPC 1NEKB 2B39A 2RBMA 1O7ZA 1U9RA 3G7LA 5C3XA 2ACZB 2EELA 2X69A 3NXWA 4MT5A 1HFGA 3TEWA 1O7LA 3C2PA 1JW9D 3LYYA 2DYMA 2K0PA 3K7AB 5JEAH 4K5VA 4C3HG 2SDFA 5BMIA 1Z6HA 2K03A 5C3JB 1SYGA 1IGCA 3K5LA 2JX5A 1TWCB 1NENB 4U673 3A8JE 3CRLC 2XIWA 2PW9A 1I6VC 3OMCA 2E2HB 1NR2A 3A56A 2DN8A 4DU9A 2D5GA 3EUB2 2DBYA 1ICWA 1I4XA 1ESRA 5M3FB 1SMYC 1Y1VB 2WLBA 1IW7D 5T1IA 5KNDA 2WNMA 1SYCA 1ZKOA 4MN3A 3OW7A 1JC7A 1EY9A 1KF6B 2SAKA 2ON8A 4XYQA 3CRKC 3D4DA 1C8CA 3M4OB 5A35A 1FXAA 1C4CA 1MBYA 1BQQT 5LHY1 4K14A 3W1SA 5J39A 3D4RA 2XWBB 2IT1A 1AW7A 5IGDA 4J8QA 1QILA 2MGSA 5C4HA 1BDOA 1QKZA 5CORA 1H9KA 1C76A 2PQEA 2Z4HA 2HDMA 3P63A 5C6AA 1A3UA 3VR3A 3DWMA 1N61A 1UGJA 1QJOA 3DWPA 3VR6A 5CBEE 2B2YA 4B0EA 3TN2A 2F0TA 4JK1C 5A2QE 1VLBA 4OZAA 3HOVB 1EWYC 5CGKA 5M5WB 1D5ZC 2TMPA 2XVSA 4PMWA 2EYLA 3MXGA 1J9OA 1Q12A 3LNNA 1EU3A 3W5VB 1JWMD 3IXSA 5MPOA 3ZJUA 4LLGM 4MM3B 2B8GA 2HDLA 2EJMA 1FNWA 1K50A 2BDNA 2ZW1A 1JRPA 2AX5A 1FRRA 1N63A 1L4ZB 2HQEA 3MC0B 3S9WA 2OHFA 3S2HB 2JA7B 3OPOA 3NTHA 4M8AA 4IUVA 2FINB 2K5PA 4A3KB 1WRIA 1LTGD 2LHDA 3VYTA 4Q0FA 2JEAI 2B2YC 2E76C 4DXGA 1QOAA 5KYLA 3TMEA 2EYOA 2HCCA 5EE0A 2IGHA 1DM0B 1XWEA 2EYJA 1FGBD 2QKIC 3GTMB 2L32A 3D8GA 3K6OA 4USAA 2NVTB 4QUFA 2GB1A 2BOSA 1ML0D 1D1KA 1PTOF 2H1EA 4XWTA 1TS3A 1XEEA 4DGZA 3NBHA 4K5XA 4L23A 3NZ3A 1SNMA 2JYEA 1C78A 3HOYB 4G7ZC 1FCLA 4KGTA 3FMCA 2V0GA 2JXTA 3AEDB 3RZOB 1F2ZA 3AECB 4ID6A 2XSCA 2H89B 1Y69U 2OF1A 3E56A 1TKYA 3A54A 3FDTA 2G9HD 4HSPA 2NBFA 1Q10A 5DAUA 5E3FA 4REZA 4YTPB 4L1BA 1FO4A 2QF7A 1LT6D 1CHQD 1AP0A 3FILB 5KEEA 1P7FA 4H2AA 1OFFA 1EM7A 1RF2D 3AEAB 4NJCA 3I70A 4FF4A 1K83B 1LABA 1DONA 1L0XB 5JXVA 2VB2X 1F2YA 3AE7B 2L83A 4BA1I 4RGNA 4ULLA 4JWSC 3BG3A 2WDVB 2AQ2B 5KYIA 2KJXA 2EY1A 3SK4A 2QIEB 1S4ZA 1PZJD 1BUIC 4XT3B 2M9VA 2K7VA 1JCKB 1SJHD 1IL8A 2RDFA 3J80E 4RF0A 1DOXA 4N59A 5A2QL 5M3MB 1HA6A 2KAJA 1MI0A 4ARIA 1XF5L 3VYUA 1MVKA 2J7ZA 1V8CA 1PRTD 1TKWB 1B50A 1AZQA 4HCSA 1VR9A 2C9OA 2N0SB 1A6XA 3GV6A 3P4RB 2PNRC 2WP9B 1MSGA 5JOBA 4K2KA 4TQUS 4BBRB 3V05A 2SOBA 1XLOA 4LK0M 3PUYA 4IALA 4JX1C 2KQ3A 4BY7B 3J9CA 2J42A 1KRHA 4ARCA 4RCOA 2EDGA 2O5IC 4RKBA 4OIKA 2L55A 2WXKA 2F0QA 2IL8A 1LTTD 1YN3A 4ZYSA 5FLXE 2W3RA 1STYA 5J1ZA 4FO2A 3U4EG 3ZJVA 3DM1A 1ZDXA 2KN4A 3D31A 2PVOD 4ZUJA 2K9XA 1JOQA 1FIQA 4JBWA 5I9OA 1I50B 1PMRA 1D1IA 3E5SA 3ZQ4A 2Y5CA 3AE5B 2EPBA 5CV9A 1WSPA 1UUPA 3KLRA 3NRZA 1L5PA 1KDCA 5DM63 2EJGC 4C2MB 2RDHA 4TKOB 5C3WA 5JEAJ 1IGDA 3PO2B 4B9XA 2ZW0A 5J22A 2D9UA 3C8YA 4KI0A 3C1EA 1ZPSA 4L6TB 5E4WC 1EY0A 3HRDD 2L52A 1VF5C