1D5MC

X-ray crystal structure of hla-dr4 complexed with peptide and seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 66
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5mC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5mC02
5D3DA 4O1NA 3SEBA 1JQYD 2Z8LA 1TS3A 2XRSD 1JR0D 1FNUA 1PYWD 2XRQD 2IPKD 1BCPC 1TS4A 2AQ3B 1AW7A 1LTID 1FGBD 1PRTF 3MFGA 3W2DA 1CK1A 1V1PB 1YN5A 1PRTD 5ELFA 1JWMD 5FK9C 1CHPD 1LLRD 1RD9D 5ELCA 1KLGD 1G8ZD 3KLSX 1SXTA 1HA5A 5ELDA 2G9HD 1BCPD 1M4VA 1SEBD 1I4GA 1L0XB 1I4RA 3EFXD 1ESFA 4TSSA 1ET6A 1AN8A 1YN4A 4DXFA 2RDHA 1S5ED 5FKAC 1I4PA 1SE4A 1V1PA 2NTSA 2WV6D 1BXTA 5ELBA 1DJRD 3BVMA 2SEBD 1LTTD 1SJED 2AQ2B 2R61A 3BZDB 4RH6A 1UNSA 1CT1D 2XN9C 1KLUD 3BVZA 4ZYSA 4RGTA 1EFID 1BCPF 1PRTB 4BWGB 1HQRD 1LTGD 1PTOC 1LTSD 3CHBD 1CHQD 2RDGA 1TS5A 1SJHD 5D3IB 5TSSA 4C56C 5ELEA 1XXGA 3OWEB 1TY2A 3MC0B 1S5CD 1JWUD 1SBBB 2O2LD 4RFBA 1SE2A 3URYA 1STEA 1PTOH 1PZKD 2ICIA 2TSSA 1CQVA 1FNVA 4DXGA 1PTOD 1B1ZA 4Z9CB 4RGOS 1RF2D 1UUPA 4UDUC 2AQ1B 1FD7D 1YN3A 1TY0A 2J4XA 1F77A 3V05A 1LT6D 1HTLD 1LTAD 4K6LA 1L0YB 1PRTC 4L63B 1S5FD 2QEJC 1EU4A 1D5MC 1D5XC 1HXYD 1QILA 1ENFA 3DWAA 3BYTB 1SE3A 3R2TA 3DWPA 3R8BA 1S5DD 1MD2D 4RGMA 5I4DA 3O13A 2XNAC 3BYYB 1LTBD 1B44D 3GP7A 4RHSA 1I4HA 1I4QA 1BCPB 1EWCA 4L6TB 2CHBD 3R2IA 1EU3A 1LO5D 4RCOA 1PTOF 1V1OA 1D6EC 1KTKA 1RCVD 1LT4D 1PZID 3TSSA 2QILA 1FNWA 1DYQA 1GOZA 2NTTA 3EA6A 1T5XD 4RHRA 1PZJD 1XTCD 1I4XA 3BVGA 1LT3D 1TS2A 1EEFD 1JCKB 3DWQA 1ET9A 1PTOB 4NZLB 1D5ZC 2IJ0A 1RDPD 1S5BD 1LT5D 4OHJA 1EEID 1LTRD 1JWSD 4RGNA
chains in the Genus database with same CATH superfamily
1T6BX 3I4NG 2DX5B 4KGRA 4W9GA 1K0RA 3WDNA 1WXMA 2RMMA 1YJ1A 4M01A 2I38A 3BJUA 3APCA 4CO7A 1AW7A 1PDXA 1KNEA 1E7VA 2K52A 1HQMC 1TU2B 1GC7A 1ENAA 3E0JA 3V62A 3FKIH 3TZDA 4JI0Q 2CHXA 3L9AX 1MVKA 1M94A 4NDXA 1EY7A 2E5LL 3H9DA 3S1NH 2BBCA 2V9HA 4E6IA 4R3DA 4ZRJA 4FHJA 2X69A 2Z6KC 2PO4A 5FLXc 2D9UA 5G2NA 1VDZA 3S1MH 4GGQA 1IP9A 4YTMB 4Q2JA 4A90A 1DJRD 4GLAC 3GTQB 1WYWB 3TRZA 5M5YH 3H7PA 1LTTD 2AQ2B 5CV8A 2YU9H 3RI7C 2EYLA 2Y0SB 1WXAA 2J7QB 3CAMA 3AI5A 1N32Q 4RWSC 4NXMQ 4IUTA 1DXMA 1MI2A 2F0SA 3U4VA 4IO9A 4DF7A 1PFNA 1Y69U 1IBKL 2JA5H 1Q10A 2G1EA 4LCDE 4JC0A 2FIFA 4M0WB 1IGDA 4JI8Q 5CBAE 1BBUA 2EXDA 4E3CA 4WIPA 3K6OA 4QUCA 2B63B 5M5WH 4YSXB 4XDDA 5C5MA 4HIDA 3PIP3 2NVXH 4BBSH 4JI5Q 3ECIA 1R4MI 2J7ZA 4DFAA 2VH1A 3PLVA 2KANA 2KJ6A 2O2LD 1ZEQX 3KUCB 1STEA 3SFEB 4C4VA 4M8MA 4N8FA 4DK1A 2OT2A 3VVWB 4B0EA 4I6LB 2KWUB 1AEXA 3FHWA 5DNFA 2BYTA 4KKUA 4K3CA 3A1QA 4F8CB 1DM0B 2JSOA 2JA6H 1FXAA 2WXJA 4MGZE 4G7ZC 4G7HC 1N34Q 1MG4A 2KHJA 4RMAA 1E0ZA 4X3TA 1GUAB 3SR6A 5H1SE 5FJ8H 4K7UA 2K1BA 4XDXA 3E6ZX 2KMCA 2HHHL 4OWWB 3M9BA 1N36Q 4DAVA 2KENA 3PO2G 1F2LA 3ZLZA 1VQDA 2RBMA 4TUUA 3KK7A 4DR2Q 1TT5B 3A9KA 3KF8A 1QQRA 3PZ7A 1XYIA 2KQ3A 3F1ZA 2QF7A 2JX5A 1BCPB 3MFYA 2HTME 2WB1E 3SR1A 2UUAQ 3NS8A 1U0LA 5IOCA 4B3TL 3GTPH 1KAWA 2ALYB 4ZCKA 1SMYD 2B3GA 5M3MB 1YNTE 1VQBA 1KNAA 1XPOA 4A3JH 3BVGA 1GUSA 5IA7A 4KZCA 2UU9Q 2C9WB 5KHOA 5EJWA 1D5ZC 4OZAA 3ZJYC 1SR3A 3I72A 4RGNA 1EM7A 3TP6A 4IDIA 3BU2A 3DVGY 3Q8BA 2HD3A 2JY6A 2L76A 1V49A 4HCPB 1OQRA 1N5XA 3HHMA 1WTOA 2KLGA 3G71A 3DEOA 4P73A 3PHWB 5COYA 3LWUA 1G6ZA 4OW0A 5C4ZA 4CYEA 1QWYA 3I2ZA 4QIWB 4PK1A 4DR4L 2KLCA 4G57A 2WP8J 2JPHA 3ML9A 4K6DA 2OHFA 4HCEA 2FCMA 1TQOA 1NEKB 1B3QA 2SNSA 4A3BH 2D0PA 2LWPA 3B9JA 5L37A 3RMKC 4II3B 4XE0A 4IUQA 3VR8B 4JVZA 1TJEA 2LJ5A 3VRAB 1XMOL 4JI3L 3P4QB 3DVNV 2BTEA 4H44C 2CH4W 3FILB 3KF6A 2QIEB 2GN5A 5C4JB 5CV4A 1VF7A 2H1EA 2RR9A 3WAPA 4CKEA 1E90A 3CD6A 5H8YE 2JUOA 1EUVB 4ZUJA 1K28A 4BY7G 3M3YB 4XDCA 1SE9A 1TKWB 3S16H 3S1RB 3NZUA 3T1YQ 3CWIA 3VDZA 4N59A 5LXHA 3Q3FA 3AEAB 4FXCA 2Q8IB 4OIJA 1I50B 3EIVA 1FXIA 4MJSA 4H7BA 3Q22A 4KN7C 2PZTA 4A3PA 3DM1A 3D4RA 5G3LD 1QNKA 2XTIA 4DV1L 1SE2A 2KCMA 1X3FA 3AN1A 3FKYA 2R92H 5KYIA 2O2VB 4FXDA 1PQSA 2F0FA 3NHHA 2L3ZA 3OTOL 2ZNVC 3HOZG 4IWPA 5EPLA 2QA4A 4J1MA 5AZGA 4RGOS 2FMCA 3NENA 2K5WA 3H7SA 1HZ6A 3FPUB 1WOCA 3PRPB 4JI2Q 3HOXH 3GTKH 4EQ5A 3S2DB 1V9PA 2FAZA 4DHZE 2PJHA 4X66L 4C1NK 2MQHA 4OELB 3RFZB 2BYFA 4CDEC 1WJ4A 1SE3A 1RWSA 1QVCA 2MO1A 5BYQA 3MEHA 4C3JH 2L52A 4BKTA 3GE3C 1GUNA 4WJ3M 2ZXRA 1J7BA 4RHSA 3I4MH 2Z0EB 2M56B 4BKSD 4ZHPA 3H8HA 2OJWA 4DKAC 3A8JE 4ZUIA 2JVCA 3FRPB 5IP9G 4GLSC 4MGKE 4MSMB 2UXDQ 3KW5B 4JIOU 4DU9A 1TIFA 3TEXA 1YQ3B 5EKIA 4DAPA 2EELA 4LF9Q 1V8QA 4MNOA 4YL8A 2WAQE 1SSOA 2JU6X 3JSVB 4I6PA 4OX9L 3GV6A 4K5VA 5G5HA 4KD4A 2WFWA 4NZLB 3S14B 1WCMB 3L16A 1C78A 5K5PA 3KUPA 4X62Q 2EJGC 1Q12A 1G91A 1LTRD 2KC1A 4BY1G 2OTLA 2JA8H 1LXDA 3VR9B 4HLEA 2VZAA 4WWOA 4O1NA 2OF1A 3K9PB 3MVVA 1YJ9A 3F2CA 4LDTD 2E2IH 1EYDA 2VB2X 4ZQ3A 2N55A 4FF4A 4DR6L 4ICUA 1TS4A 4X57B 5IAAC 2WXLA 3K59A 5D2MB 1VQJA 3K8AA 2HE7A 5FK9C 3CMEA 1RD9D 1YJNA 2KVRA 2J52A 4LWCA 4F1SA 2MQJA 5LHY1 4A3IG 2MJ8A 2WIIB 3DUZA 2TMPA 3MWYW 1HNXQ 1YX5B 3PO3H 4BBRB 1Z5SB 1IL8A 1J8CA 1VQGA 4W9CA 1GC6A 5I9OA 1O7IA 4MM3B 3RUIB 4V0BA 4DXFA 1NAPA 3ZNHB 2MUYA 4K8IA 1NCVA 3NTKA 4KHVA 4D2KA 4JCVE 3LXFA 2EY1A 5ELBA 3ERSX 3I4NB 3NSWA 3NTHA 4JI7Q 2CHZA 1A2TA 2KX3A 2A68D 1SYFA 1QZHA 2L4NA 2G5DA 4JI1L 2MRPA 1W3SA 2NVTB 3DQVA 4W9IA 1AWDA 2BF8B 1LABA 1SYGA 1C76A 5LMNL 3RN5A 5FLMG 2F0MA 2HJ8A 2MX2A 3TBLD 3TL5A 1H9KA 3CW2C 1XO3A 1JB7A 4ITKA 2WXPA 4KZ0A 5BMIA 4YWKA 2CU1A 1HZCA 4GIVA 4BWGB 4WORA 4IQZA 2R7FA 2KJXA 2UUBL 4OONA 2NZ1D 2KQ7A 1KAAA 2WHIA 4QUFA 4IM2A 2VNUD 5EE1A 1BUVT 3PSIA 2LXJA 4RNAA 4NB3A 4RM9A 4KHZA 1RL2A 5C3EH 2N49A 1JWUD 1FRDA 2M4NA 3DDCB 5AEKB 5J39A 3BZKA 2K0PA 1I94Q 2ZPYA 1PZKD 3K58A 1KRHA 4KKJA 2NUCA 4B0MA 2F0IA 2IO2B 1MHWC 4MGYE 4EQOA 2L15A 1WXSA 4XIGS 3OJ3A 4DNRB 3P7JA 2JYEA 3HOWG 3EC8A 4M0WA 5JVG3 3UINB 1JQ4A 2HIXA 5IGEA 1LM0A 4LFCQ 1HNWQ 1TKEA 2BPSA 2LVPA 4PS3A 1DOYA 5DAUA 1TY0A 3NQIA 2Z0DB 1STYA 4KIKB 1KDAA 2F3IA 4LK1C 3J81i 1PH6A 2JRIB 4UP8A 1T3QA 2E8GA 2F0KA 1LGRA 4DR3Q 3OAWA 2DLBA 1FCLA 4LF8L 1SRUA 2K7VA 4WAFA 3NZSA 1X65A 4RGMA 2L0CA 5K36G 1N60A 5J22A 1V8CA 5I4DA 1X9NA 1WGHA 1GB4A 3U50C 1UBQA 3QHTA 4O0AA 3VA7A 4HPPA 4O42A 3KQ4A 2HJ1A 3PPAA 2INDC 1F52A 3R2IA 2BE5D 3W1GA 1EU3A 3VYTA 4ME5A 4YY3L 1S40A 1D6EC 1KTKA 2GBRA 4RF1A 4IM0A 2GBJA 3VR4A 3NVVA 3R3MA 4M02A 3EA6A 4AIMA 4U673 2QHOA 2VL6A 1PTOB 3GTQH 5KNDA 4BOZB 4X65L 1RDPD 5M5YB 5FR6A 1SNCA 1GUOA 1CFMA 1E3PA 1LM8B 4FN2A 3APDA 4KSLC 3U7ZA 3QARA 4ASWC 3BK1A 3CCMA 3PO2B 4GKJQ 1PYWD 3HKZG 4CHTB 1FFVA 2NVUI 5LL6S 2XVSA 1LFDA 3NBIA 1AZPA 2V3NA 3T9LA 4DDGD 4KJNA 5JHBA 4LAAA 4HIKA 2JXMB 2XBBC 2RA4A 2XEWA 3QC8B 2WXIA 2I5LX 3E56A 4C3HG 1YN5A 1Y8RC 1GVPA 2B63H 4KDIC 3RLNA 1BVSA 5M5WB 5ELCA 4IOIE 4BBSB 1NVID 3L4PA 4GXBA 3VUYA 1G8ZD 1RIPA 4DV5Q 1K3BC 5IWAL 1YJJA 1HA5A 4HDOA 2NWGA 4LUVA 3X3NA 4K5WA 2EMTA 3I57A 3RN9C 4MT5A 2DY8A 1L0XB 1ONLA 2KUMA 2PMVA 1ESFA 1ET6A 4ZKBB 4YWGG 1S5ED 1IXRA 4DGZA 4X64L 1XMQL 4LF4L 1SIJA 2LVOA 2RDBC 1R4MB 1T9HA 3PQIA 3JVZX 2INPE 1DOXA 1PMRA 2KKCA 2WNMA 3KUZA 2MBOA 5BYSA 2LGXA 3N3KB 4GOCA 3BZDB 2AUKA 5NUCA 3NE5B 1JOQA 2QKIC 2LZ6A 1CZWA 5GAGC 2LGIA 1UWXA 3WCQA 2BVCA 2GI9A 1FO4A 1SNMA 1MJCA 1SDFA 2NBFA 3B1LX 3IT6B 4XGAB 1S1QB 3SK4A 4G11A 4L8JA 4YSZB 1SYCA 1PRTB 3BDLA 4R8NA 1D1KA 2CH4A 3RUZA 1CQFA 2F3WA 1K8GA 1QLBB 1V2YA 2OOBB 3FILA 1JB3A 1LTGD 1ZOYB 4NJ6A 5D7GA 4NXNQ 4JYAL 3U7DA 3ZTDA 3A5ZB 5JVH3 5D3IB 4GKKL 2IO3B 5M3MH 3VTVA 1XXGA 2KHWB 4A75A 2MWSB 2DYMA 4A3JB 1P1AA 2PMZE 2W54A 3FPPA 3DBSA 3MHZA 4K14A 2D3BA 2B2YA 4LNOA 2D10A 2GBKA 5C0XJ 4DV2L 3R66C 3IL8A 1HA6A 1PFDA 1OFFA 4LK0M 3UF8A 5HFYA 4NQLB 4H13C 1HFNA 4M1UB 3OOCA 1GM5A 1KDBA 1C1YB 5AJ3Q 2J0KA 1TWHB 2YEPB 4II2B 1ROEA 3A7AB 4IFDJ 2NZOA 2EY2A 2A4ZA 3ZJTA 3WWVA 1B9NA 4FXGC 1G51A 4BY7B 4HROA 2ZXPA 1VDVA 1D5XC 3ZRCA 1S4ZA 3F2UA 2O2VA 1EF5A 4ANVA 1KJTA 2Y5CA 1A6XA 1H4RA 3L08A 4AJWA 1WI0A 2ZW1A 3QK0A 5TR5A 1I4QA 2M8SA 2HDLA 3KLWA 3IFWB 1GPXA 1UGMA 3OG5A 5IYBH 3CCUA 4MEMA 1TR5A 4LF5Q 2BKFA 1VQKA 1Q81C 1U4MA 1V1OA 2KVMA 4RG1A 2GLSA 5HGTA 3DMUA 3EHVA 3TSSA 1QOHA 3Q8AA 1WM3A 3TN2A 5KRUA 1BDOA 3HOZB 1AE3A 2NTTA 2PE6B 3U9OA 1J5EL 2KDBA 2FJ2A 1JCKB 3DWQA 4ARIA 2BA1A 3RULA 3FEWX 1S5BD 3GTMB 5G5GA 5C4JH 1PFSA 3U52E 4DR1L 2F52A 3ER0A 2HUGA 1CI3M 4PQXA 1WMHB 2K22A 5JAVA 1I42A 4K0KL 5BYRA 2NYZD 3UIOB 4I6NB 2Z8LA 1KDCA 3NS1A 4QJFA 4HIOA 1IBLQ 1C0AA 3KVFB 4GN1A 3IKJA 1N33L 2D2QA 3VYSA 4B9WA 5C44G 4UHVA 3M3YH 1BCPC 4GOPB 1SNPA 2BOSA 2HDEA 2PQEA 3JSVA 3JAMc 3PZDA 3J80c 3S1RH 3RNUA 4AQYL 1WRDB 2G9DA 1NUCA 2B8GA 4TQ1A 1Q1EA 1I50H 1ZUD2 1LLRD 2FXQA 1AYFA 4ZRKA 1S3OA 2C7HA 2NB0A 4ABNA 4G7OC 3S17B 1DCZA 2FMMA 3GDEA 4BXXG 1Z9FA 1EQQA 2BS3B 3T53B 3PV1A 4L5QA 4W9LA 3ULJA 1JW9D 1EQVA 1BCPD 1H9MA 2K75A 2NVYB 2R92B 3KYCD 3A9JB 1EZ6A 4HMIA 3D31A 4EZKA 1ESRA 3ZJUA 2EYJA 4GB9A 1N5WA 2DGYA 2F4VQ 1TWFB 4KY7A 2CKZB 5C6AA 4BY1B 2KDMA 2KTRB 1YBYA 3PV0A 2L12A 3HS0C 1HR0Q 1NYQA 4KMUC 4LF7Q 3DWGC 3S2DH 1B8AA 5DLQE 3MTNB 4QMGA 4A3EG 1VQIA 2K04A 1EY6A 3PUWA 1UNSA 2BQQA 1N61A 3PO0A 4A3GG 4IJHA 2CHWA 2DWQA 2D3CA 3KWLA 1LTLA 1IW7C 4IPCA 4C2MB 1VMPA 1L6UA 3W5OA 4C3JB 4DV3L 3H3VI 4MM3A 1YNND 3EBEA 4NQKE 1GO3E 3B6YA 2ZJRA 3MXUA 4JE3B 2K8HA 3HVDA 2G4SA 3HOYG 1HUNA 4A6QA 5JJLA 3QJZA 4J6IA 2LRUA 3STBC 1EIGA 1CZGA 4GN5A 1W2BA 5J2RA 5DCNA 3OWEB 3MC0B 1E2VA 2AWNA 3P4PB 2FCSA 3J80i 4RFBA 3DPDA 3CCSA 1IUEA 1XNQL 3S14H 3MXGA 1BT0A 1WCMH 2NN6I 1SIFA 3K5MA 2KMMA 3B2FA 3PHXB 2I1KA 1VR9A 3PTFC 2VQFL 3K57A 2OWOA 1AH9A 1B1ZA 1D7QA 2JA8B 2LGSA 3STBD 3SK6A 4HJAA 2V4LA 2WX0A 4DBGA 4LMQD 3ZJVA 2O4XA 1OTCA 1HTOA 2B2YC 1WGYA 1LT6D 1IYJB 1HE8A 3W5VB 3H15A 3G6JB 3KLSA 3MZ5A 4AJYB 3E5SA 3UI2A 1FIQA 3E9IA 1ENFA 2F0NA 1YNJC 3V60A 5BR8L 1PFMA 1L5PA 4EOYA 1ML0D 1OXUA 3SDZA 4Q0FA 4LFBQ 1WJNA 2JWUA 3AFQA 2F0DA 4IPHA 4KIKA 1HZBA 4BBRH 1RLFA 4NPSA 5EGTA 1AE2A 1K8MA 4WH4A 2BDNA 1UE6A 1CTMA 5A2QL 3RNBC 1FNWA 4MTKA 2WU2B 2VQEQ 5J18A 2LY7A 1YNJD 4QB4A 5IT9c 4B3SL 1FR3A 2C5CA 5KEEA 3DM3A 3HOWB 1MFWA 1R4QB 3CCQA 4YT0B 2J53A 2PI2A 3MXNB 1HNZL 1NR2A 3I4NH 5M5XB 1P16A 1Q7YC 1EWHA 1JORA 3Q8CA 3I4LA 4IUNA 2N9LA 2CFMA 3A8IE 2A6HC 5E3FA 1JWSD 1YMHE 3L54A 2NVTH 5CV9A 2MPMA 4JI6Q 1HRJA 2PNRC 1VQAA 1V5TA 2FCQA 1Q82C 3A55A 1KD1C 2L00B 2IGDA 5A2QE 2K5NA 3K5LA 2NN6G 1E10A 1ASZA 1P9DU 1FGBD 1TWCB 3MFGA 1PA6A 2ON8A 1FVIA 5ELFA 2K8CA 5DM63 2WU5B 3ZW3A 1KLGD 4JBKA 5FLXL 2CQAA 5C3EB 2YV5A 1TKGA 2I46A 2NBVB 1WRIA 3N1YC 2QCPX 2L5TA 4EGVA 5CHVC 4RCNA 1IHZA 3I55A 1GHJA 1A62A 5A35A 4E71A 2HQLA 2D5GA 4CJ1B 1Y8OB 1STNA 1T0SC 2MGSA 3PMFA 3KBXA 2IY1B 1OXTA 1K52A 2REXA 4FA6A 4US9A 2AMCB 3NWTA 4GMVA 2KOXA 2IZVB 1U4RA 3HKZB 2Z59B 1U4AA 2UUCL 5FLXE 2INCC 2O6VD 4US8A 4S17A 4H2AA 3ABVB 3GQBA 3BDOA 3MEFA 5JEAG 3AECB 2F0LA 4C3HB 1Q90A 1K83B 4RKBA 4TKOB 2VY3A 1Y1WG 1WJUA 1WJJA 3I70A 2DJGC 2FCNA 2L8JA 4WQMA 3J81j 4JX1C 4O2DA 1WR1A 1BKBA 2WYQA 1VQPA 3H0GG 1WI5A 4IUVA 2KC2A 2KN5A 1K73C 1STHA 1QE6A 2OCEA 2M17A 2W3RA 2LRWA 4LNIA 3T3OA 1JE4A 2CWPA 4LF6L 3UI3A 3AEDB 3AQQA 3JYUA 3L0OA 1TVXA 3IBEA 1QT9A 3MC9A 4A3LG 1F2RI 1TY2A 1GG3A 2Y0SE 1P0RA 3I5JC 4MELA 3T1HL 5EE3A 3G6EA 4DV6L 5JJKA 2KQ4X 4GLVB 1SNQA 1PTOH 2ZW0A 2A73B 1E1TA 1I5FA 1PLFA 5ISRA 3HK0A 1FNVA 1J19A 3NVWA 3C19A 1H9JA 3QR8A 3DLLA 2R7ZG 1Y1VG 2K5QA 1WFQA 1RF2D 3QOLA 2QMTA 3VH4B 4IZ8A 4A3FG 3PO2H 1X3GA 2KBNA 2HHHQ 3PIOA 1XLOA 2DYBA 5BN5A 3HM3A 1L0YB 3P42A 4P2CB 1QJOA 5KYLA 4JI4L 4FHKA 1VQEA 1G6JA 3UDIA 3VUWA 3CQZB 1VMCA 4XYCA 4X3UA 2ZCBA 4B3TQ 2C35B 4AUQC 2RD0A 2V3PA 1X3EA 3GTOH 1P7EA 5D14A 3RN2A 2JWZA 2QW7A 2PW9A 1ICWA 3AU7A 2P5ZX 1XQQA 2Y5PA 3TP5A 2QILA 2ZTDA 3GTJB 3E9HA 3LDZE 2KECA 3MC8A 4DN4M 5BMHA 5MPOA 4KDLB 5BMGA 2RSOA 4UP7A 2K05A 2ATWA 3VAWA 2CW0C 1XD3B 3OYYA 2DNCA 2QSDA 2ZEQA 3PSEB 3RYTA 1HFGA 3D3RA 3X23A 1GKHA 3VYUA 4LNFA 4PMWA 1GJZA 3NVZA 3ERQA 1L1OA 2JRHA 4B9XA 4RM8A 3A4SC 1NNXA 1SYDA 4IPGA 3TS2A 4DUYQ 4LUZA 4DR4Q 3RNGC 1F2MA 3FVQA 1VQ8A 1PVOA 1V80A 3CCRA 1P7FA 2ZJDA 3WAOA 1V1QA 4JOIA 2DZJA 3ZGZA 3U4ZA 2L7RA 1WMHA 4EKUA 2R3ZA 3APFA 2R6GA 5CV5A 1DD2A 4ZRZA 2WP9B 3BINA 4KY5A 1BF4A 1Q8IA 2G9HD 3N1XC 3QJYA 2O5IC 2LFIA 1TT2A 3ML8A 4GDKB 3PF4A 1XMOQ 4JI3Q 2BA0A 4GOPA 3DBLI 1I4RA 2B3AA 1A0IA 4JI8L 1KXLA 4XYOA 3VUXA 1I4PA 1PH3A 4A20A 3R3OA 4G50A 1EWIA 2MHVA 1TWHH 4QIWE 3SU8X 5HURA 3GB1A 3X0WA 1IPGA 3ZDTA 1E22A 5C44B 4BY7H 4YCWA 2LXAA 1GHKA 4EZJA 1F9JA 2N3SA 1EF1A 3QAQA 2WX1A 2CWAA 1KLUD 3OPOA 3A9JA 3RLFA 2UXBL 4DK5A 2CKHB 1QG7A 5I2XA 4ZYSA 3UE0A 4Y7NB 1QZEA 1BBWA 5C0XI 1BCPF 1L4DB 2VRRB 3VFKA 2KTRA 1N34L 1HQRD 1TZOA 4PG3A 3G7LA 3I91A 2MNAA 2K5PA 3GE8C 2M2LA 4WURA 1WXQA 3H09A 2RDGA 2K03A 3TP7A 2B8FA 4DV1Q 1N36L 4FF3A 3HOZH 3ULPA 1O7LA 1YHQA 4IFDI 4IALA 1BMLC 2K1FA 3P2BA 3KOJA 5FO8B 1FEHA 4DR2L 1TZ1A 1V6EA 2MJEA 1W6KA 2K3UA 4DHJB 3DWMA 3KDFB 2M1MA 2VZKD 4F7XA 1HEZE 3GTMH 2GVAA 2ICIA 4X3KA 2UUAL 1UAPA 1Z7TA 4FNFA 1UWVA 1E8YA 3BS1A 2KFKB 4IC7B 4GNXB 4A3EB 2EZVA 1OXXK 3CSFA 4A3GB 1ISNA 1XPUA 4X66Q 1QF6A 2ZVOA 3PLUA 3B2GA 3DEPA 1PXUA 1SNDA 2B29A 1GUWA 1K0SA 1PRTC 3LB8C 3PVLA 2KN4A 2EYOA 2UU9L 3J7A5 1ZXTA 5DM73 3DOWA 3OHXC 3R8BA 5IP9H 2H88B 3HOYB 2YVCA 4REZA 2WXKA 4BVUC 1PYBA 1YJIA 3NBHB 3ZKJC 4MDKE 3FC4A 4FBJB 2W3SA 3BYYB 2JA7G 3U8ZA 3IRBA 5DEHA 3S17H 3H94A 1E1OA 2KJHB 1EWCA 4W9KA 2KXJA 1T5EA 1QOBA 2XWJB 4MTNA 1BO0A 3GS2A 2NVYH 1EYAA 2Q2UA 3CCLA 3D32A 4IOCA 1PZID 4OX9Q 5EPJA 3KYDD 3CPFA 3P63A 1TWFH 4BY1H 4X3SA 2IO0B 1QNUA 2PPHA 1X56A 2BS2B 5C0XG 3IVFA 5AFWA 3QIAA 1R4PB 3C8YA 3V6CB 3ZNGC 2Q2HA 3EVQA 2MCNB 2PZUA 4DR5Q 2LI5A 5FO7B 4IFDG 3FAHA 1A3VA 4C2MH 3TJPA 4F87A 1FNUA 3IFDA 4MZ9A 2C60A 2LJIA 2ASBA 3VH3B 1ZPSA 4C80A 2WXHA 4FLHA 5JJIA 1VZ6A 1I3QH 1STAA 3MXNA 1YHBA 3TMEA 1XNRQ 3TZUA 2E3TA 3VDYA 1JWMD 1S72A 3P4SB 3VTWA 1HZ9A 1CHPD 3J81L 2YLMA 4NJ7A 3L13A 1L1OC 2DJFC 4KJOA 3AMZA 4J3OD 4WJQA 5CYUA 1CMXB 1SXTA 2LXCA 4TRDA 4IWOA 2MW5A 1D4BA 2FUHB 3E0EA 4AP4C 3ONAB 1SEBD 4JOIC 1I4GA 3TDQA 3A74A 4PZ6A 3EFXD 2K33A 4YCVA 4HJGE 1HZ5A 4CQNA 1BOSA 3WOFA 4NNJB 3Q6SA 2E2HB 3Q6BA 4E74A 4EZLA 4CKBA 4B3MQ 1MJDA 1Q1OA 2JYTA 1TGZB 4JI1Q 5FLMH 3J81E 4GOPC 3W9CB 4JLCA 2MA9B 5G55A 5J1ZA 1B9MA 5LMNQ 1JMLA 3SVMA 4HCNB 2MBBB 1O7ZA 1SAPA 1RJTA 1VF5C 5F2DA 1F9SA 1NYRA 5AUIA 1K53A 1QOGA 1D3ZA 2Z9HA 1VQOA 2V1YA 1L2NA 2NBUA 3QA8A 2BH8A 4ANXA 3B08A 3L7ZC 1Q5WB 3IAYA 1N62A 2OQKA 1WTHA 2Z6BA 2BCOA 3J81c 3Q0AA 3W1YA 4OGQC 3IG3A 3HUIA 2JXTA 2K8BA 1JOOA 2EYFA 3U4EG 1L0WA 1WF9A 2KWVB 3TEYA 1A2UA 2D2CC 4AYBG 3HOWH 3VRBB 4FDBA 3URYA 2MJ3A 2IWHA 2ZTCA 3ALBA 2JE6I 4FXKC 1XX8A 5M5XH 2N9PC 4LLGM 4A55A 3PUXA 4PNYA 2CS4A 2PE9A 4IKGA 1A8VA 4DXGA 5CBEE 4DV7Q 2UXDL 1Z2MA 4CBVA 4OVUA 1ZDXA 2L05A 2H5XA 2BWFA 1O78A 4LF9L 5CORA 4LF8Q 5K36H 2EE1A 1Y1WB 2AL3A 3AU4A 3ICEA 1TWCH 1R9TB 2V4DA 3CXCA 1CA6A 3H0GB 1WTVA 1QILA 3R2TA 3CKIB 1PH9A 1XWEA 1MJEA 1UD7A 3AXCA 1TTNA 4A3DG 2SOBA 1YI2A 3ZNID 2IDYA 4DK0A 2Z4HA 2PZWA 4TKNA 1IBML 2WINB 2GRIA 1XCTL 4R9WA 4DNTB 3V96A 1E8XA 1RCVD 1U4LA 1Q1BA 3D8GA 3I7FA 5T1GA 3UDFA 3PGEA 1QUQB 1J9OA 2EPBA 2BB5A 2A6EC 2X38A 4CGYB 2R7ZB 1FRRA 5IE8A 1Y1VB 3QCAA 3HOUG 2L11A 4HXDA 1JALA 3SGIA 1TBEA 4S0RA 2PI2E 5E6JA 1SMXA 4OHJA 5KGUA 3DBRI 4OZBA 2A5HA 1WGDA 2D07B 2AUJD 5IP7G 3QQ8B 4AS1A 2K6AA 2E2JH 2KZRA 4NKLA 1C9FA 4LUOA 2GVBA 1CUKA 4M8AA 4V190 4C3HH 2DYOA 3LNNA 4A3MG 1K83H 4I7ZC 2XRQD 2RSUA 2WXFA 2A6ED 4PMBA 2EY5A 3W1SA 2E6XA 1E2WA 2AKWB 3W2DA 2EQSA 1V1PB 2PPBC 2IGHA 2K32A 4KKTA 2MH7A 2IX0A 2E75C 5IWAQ 2KTFA 1KHIA 3AE6B 1HUMA 2EOTA 3HOVG 4A9AA 1BUIC 1DGSA 1FJGQ 2JF5A 2ZPNA 4OO1I 3EECA 4M00A 4NAWB 5BO4B 3Q2AC 3ND8A 1VQCA 1M8AA 2WWZA 4I7AA 2F0HA 3RZOB 4NPNA 5IODA 3KJOA 4YWLA 1XMQQ 4LTUA 1UE7A 3VYRA 4YHHQ 1DOMA 2C7MB 2RGFA 2MP1A 2F4IA 4ZDVA 1B9RA 3L2PA 3BZCA 4WWNA 3M4OH 4P71A 1C79A 1CKMA 4UPAA 1KABA 3CC7A 1BXTA 1CKNB 1O7YA 5I6WA 2PCFB 1N63A 2IX1A 1ZKOA 3GTLH 4KHPL 4WJPA 4ID6A 1I94L 1STBA 2BW2A 2OTJA 4GDKA 3CQZH 4GDLB 1VD2A 3CSTA 2YTXA 3AEBB 4DUZQ 1EYCA 4HWIB 4RGTA 4QAYA 4LFCL 1EFID 4POFA 3G48A 2MSED 3GTOB 4GKKQ 2VS1A 4P1BC 2NVQB 2CCZA 1EO6A 1FGUA 3ZDMC 3BIID 1TWAB 4KGSA 4XQJA 3GTJH 2WKDA 1NJIC 5GAHC 1GJXA 4ZK9B 1GAQB 1SBBB 3DHGC 4G3XB 1CSQA 3A54A 3RNAC 1R7SA 4J15A 2F0UA 1JJCB 1WD1A 5C4HA 1PH4A 2ZVNA 1ZGUB 1V43A 2LMCB 4F88A 2F0WA 4KTAA 1WR6E 4A76A 4OO1G 4A4IA 1QZGA 4F7ZA 3V05A 1ZE3D 2AWOA 2E76C 4P7IA 2B2VA 2KJRA 2G3QB 1PH8A 2QEJC 4MHEA 3CCEA 3CCJA 3KDFA 2KCTA 1VQ6A 3DWAA 2WXGA 3NZ3A 4PS8A 1VQFA 4HJ8A 2MBHA 4XX5A 4HKZE 3CRLC 1IKLA 1XT9B 2KCCA 2K5DA 4HN7A 4PZ8A 2KFKA 3MHSD 1G291 4GNXA 1I6HB 1YX6B 5EE0A 2BB6A 4HVBA 3A7LA 1F9PA 1GUTA 1PGAA 2FBWB 2KWDA 2XIWA 2N88A 3S2AA 3BDCA 3DCGA 1NBWA 4IWQA 2B39A 1DGJA 2DNFA 1BQQT 1DYQA 4UAIA 1DOLA 4CDCC 4DR7Q 4RHRA 4WJWA 1QOFA 3AB9A 3ETRA 3AEVA 1LT3D 4XWTA 4DR1Q 4TMAB 3SDLC 3VQIA 3NBHA 5CHFA 4DV5L 3N6RA 1ILQA 1JWBD 2CQOA 4B3RL 2DZIA 3K5NA 5C44H 5C2TB 2QEXA 3QIJA 3JAML 2A5UA 3J80L 5IGBA 2J42A 1N33Q 4R4TA 3DBLB 5HI1A 5BN4A 1VZ8A 4LFAQ 1PH1A 4AQYQ 3UDGA 4Y7NH 2M0AA 4EUTA 2JA7B 4K7WA 1XLPA 3AM9A 3NUHB 1MKHA 1PRTF 1NBFC 4BXXH 4A3OA 4AOFA 1WE7A 3CC4A 5IIFA 2LS01 3ZUNA 2KT7A 3LGJA 3S2HH 4DV0L 1ENCA 4KI0A 4GLXA 1WE6A 1NE3A 2YYZA 4PMCA 2LSSA 2SDFA 4WRDA 3CF5A 1E7UA 1IGCA 2K25A 4LNNA 3W1SC 1SFOH 3JAME 3J80E 2I1JA 2KQSA 5DPSA 4TVAB 1SROA 3K7AH 4BBNC 5EAYA 2LHDA 5IKCM 4A3EH 1N9WA 1SE4A 2BYVE 1G6PA 4A3GH 3MXPA 2MP2B 4L5TA 4QF4A 4ZRPA 2WV6D 2PIAA 2KDEB 2YEPF 3DBHI 2W9NA 1VQ9A 1QB5D 2CVRA 5J3BA 2WB1G 4B08A 4FYDA 4DV3Q 1SNOA 3TEHB 1C4PA 1E6EB 1WX8A 4K3BA 4BAXA 4HR7B 3HOYH 2VUMG 2HQEA 1NI2A 2ZJPA 1KF6B 1UH6A 1MSHA 2Z1CA 5IP4D 5DPTA 5AJ3L 1HTQA 4IUPA 5C1ZA 1LTSD 2PVOD 3M85A 2KEDA 3CHBD 5JJZA 1WX7A 3GZNI 1CHQD 5LMUL 5AZFA 1B50A 3C1FA 3Q3JA 4YCUA 4P72A 1OO9B 3KYHC 5JPMC 1ZXHA 2KDFB 4GSWA 1S5CD 4OVVA 4DAYB 4DWFA 2BT6A 3AE3B 1A70A 3E3XA 1EIFA 4FJVB 1KFYB 1C4QA 2J0JA 1CA5A 4WJNA 1J6QA 4LF5L 2AYOB 3BG3A 2R93G 2MEKA 5I9PA 4IJLA 1B7YB 5IYBG 2D11A 2QC8A 2DHZA 2V4IB 3TQYA 1PGBA 2Q8TA 3C3LA 4MH8A 2JP1A 3TUOA 3D0FA 3AEEB 1LTAD 3OMCA 4R8IA 4A3KG 4FP5D 3GO5A 4L5SA 1WJ6A 4A3IB 1I3QB 2BKRB 4YWMA 4YXDB 3CP0A 3SHQA 3R93A 2UXCL 3ULLA 1BBXC 3WALA 3EROA 4HMJA 4OWXB 1NDDA 2DAJA 4A93G 3FDTA 1VQMA 1IW7D 1XPRA 2WQYB 1F9QA 2B2VC 1JRUA 1RRBA 3I3CA 3H3VH 3DHQA 2X6GA 5IT9L 2PKOA 3BY4B 3KUDB 4ICVA 1PFBA 3HFZB 1O80A 2CHBD 4AYBB 1PV4A 1LO5D 2DAFA 3A33B 5H92C 5D94A 4B6WA 3VA5A 1E7PB 1RTOA 1WYGA 4DV4L 2ID0A 5ELOA 4GNXC 4LJOB 3QB3A 1HNZQ 2IT1A 3NEMA 4ZRIA 2E2HH 4FJZA 3Q8FA 4XC2A 3EUB2 1EY0A 4C7ZA 1BNZA 4JK1C 3EGRA 4URKA 4H0LC 1X3QA 2Z0SA 4Q5VA 1IBXB 2GBNA 3NWSA 4DNIA 4MSQB 3AV8A 1JE5A 3AE8B 2NN6H 2KVZA 5C23A 5T8IA 5IT9E 3HP3A 5LNK1 2N7DA 3SE0A 2N8NA 5E6PA 1QUQA 2F4VL 4A3CG 4A3DB 5IYCG 1QOAA 4LF7L 5EDSA 1Q86C 3LJ3A 3S15B 4KV2A 3CU7A 4K7SA 4JV5L 4K81A 2WGSA 4N8X1 2UYZB 2J0TD 1V5OA 4KN4C 3HOUB 1WTRA 3RPFC 5GADC 3J7YW 2HT1A 3M63B 5D6JB 3ZXVA 1YN4A 3HM6X 1CZPA 2RDHA 2M0XA 1V1PA 3P1HA 2EKEC 1T0RC 4EFOA 2L1AA 3GTGB 5JEAH 3TEZA 1X55A 4XTCS 2UUCQ 2CJOA 5HG2A 4A3MB 1NTGA 1KOTA 1Y1WH 5E7NA 2SEBD 3BK2A 4NAWA 2Y3AA 3AULA 3RCZA 4RH6A 1R9TH 1SLJA 4C3IG 1CT1D 1YNXA 3HZXA 1HR0W 3H0GH 2O5JC 1E2ZA 2E5LQ 1TWGB 1OQYA 2A6HD 3T3NA 3KH0A 5C5LA 1FXTB 4CHKA 2ZM6L 4BKGA 4HSVA 3HOVB 3J7AV 2WAQG 3H3VC 4A3LH 4XQNA 4LF6Q 1DOIA 3Q3MC 1UWMA 1EIHA 3KJPA 1HHVA 1CKNA 3SXHA 4OWTB 4GN4B 1JICA 3K7UC 3N32A 4P6VF 1SJHD 3HKZE 3T1HQ 2PTLA 3GV3A 2EDGA 1A3UA 4DV6Q 4BA1I 2F0TA 2NMQA 3OWFA 3VXWA 2R7ZH 1Y1VH 3SK8A 1JMCA 1VQHA 2JJQA 4GDLA 4N6EB 4A3FH 2H89B 2RKSA 4HAEA 5IYDG 4LFBL 1UEAB 1F2ZA 3PUYA 1CQVA 3PT2B 1FYCA 3JW0X 2F0GA 1IBKQ 2E2JB 2OEDA 2IW3A 4Z9CB 5C3XA 1Y56A 2QCZA 2WDVB 4GU2A 4HIMA 2EJFC 4ZHOA 3V6EB 5E4WC 3QG1A 2J4XA 2VQEL 2RPVA 3CF6E 3MP9A 3BWUD 2IX3A 4XZ4A 3QO2A 5HHDG 1HTLD 2K14A 4HJKA 1IZ6A 1VS0A 1OEYA 2MBQA 1C4CA 3BYTB 2WLBA 2K6QA 4KX6B 2WACA 1K8RB 1ILPA 2LMCA 3AE5B 1IYVA 3N20C 3PGZA 4JI6L 5C4XG 3RZOH 3HEJA 2WDRB 2F1MA 2FNJB 3IXSA 3K0YA 3IFTA 5EKLA 5GQOA 1KL9A 2F0VA 2Q2TA 4EEWA 4YTNB 1WX9A 3M4OB 1E9MA 4MH0E 2LASA 4XT1B 1G2SA 4DK3C 2F03A 1AFPA 1ZYRC 1H95A 1H9RA 3IAM1 4KKSA 3Q8DA 3M4YA 2AX5A 4JBJA 3GTLB 3UQBA 1Q3LA 1X3PA 5EPKA 5IGDA 4AH6A 2FHTA 2N9KA 1Y14B 1YEZA 4MN3A 3A4RA 2JK8A 1TS3A 3S9WA 4DQOC 3I73A 5M3FG 3RZWC 3D4DA 4RKLA 4WWMA 2DZKA 1FL0A 1KLVA 3PIO3 4I65A 1C7YA 1SE8A 4MIUA 1PH7A 1ZYRD 2NVQH 5E1FA 5L95C 3MJWA 3P4RB 1C48A 4ACFA 3QWNA 3PIPA 1TWAH 4QQBX 4K8JA 1K50A 1Y8NB 2NBWB 1FD6A 2RSNA 2IY0B 1CM9A 1VQNA 1RYJA 3M62B 3WANA 1L0VB 4JI0L 1IYUA 2KCNA 4ODGA 1N8RC 4EE2A 2F3VA 4PT5A 2WDTB 1M4VA 1MIUA 3FKIG 1EY8A 1WTXA 1EUJA 2SNMA 2AL6A 1AN8A 2NR2A 3Q23A 1D1IA 4IUMB 3ZIMA 3LWEA 4BKSA 1H8CA 2C9OA 4ANUA 4R4CA 1MGSA 1BR9A 1EY4A 1SGHA 1K9MC 2BYEA 1YZ6A 3C1EA 5HGQA 1DOKA 2HD5B 5LLIA 2GBMA 3U2SC 2R61A 1YD8U 3ENEA 5C3JB 3S1QB 2UXBQ 2NS5A 3IAS1 2CW0D 4YSYB 2JEBI 2L9HA 2LUMA 1QCBD 1OQQA 2K50A 2K28A 2N1WA 1N32L 2ACZB 1I6HH 4NXML 5CV6A 3J7ZC 1SMYC 2PEAA 1UGJA 2MP2A 2N7EA 3P1MA 4YTPB 2R2QA 4JPSA 4N9F4 1PTOC 5EBDA 4HRSA 2K9XA 3NELA 4RA8A 2JA5G 2JZ3B 1CKOA 3WIMA 3RNCC 4WFN3 1F2RC 4IUUA 4JI5L 3MJ5A 3H91A 2N9XA 3Q69A 4UP9A 4USAA 1YIJA 4BBSG 2EJMA 2LXKA 1PTOD 5EQ0A 1JJGA 4BBNF 2KHIA 2N1VA 1RAXA 1XCQL 4UDUC 2WB1B 3NTIA 4BS9A 3RNEC 3I9V1 2VUMB 5HY6A 2IYDB 4ME3A 2JZZA 4K6LA 2JA7H 2KMAA 2PQAB 4DAYA 1B2TA 2KNBA 1GNUA 2Q2IA 2JA6G 4JWSC 1NMGA 2ZJQA 3HG9A 1R4NI 3S2HB 1MPEA 4ZYNA 5FJ8G 3GP7A 2EYMA 1VCBA 2EIFA 1SFOB 3W3AA 5IGCA 3MHBA 3L3OC 3OTOQ 3DHHC 4EQPA 4ILWA 1WY8A 2MHJA 3DHIC 4JW0A 1NSNS 5C0XH 3K7AB 3UQAA 2QDBA 4DUYL 2JEAI 3M7NA 2BWES 2C5LC 3DVGX 3RNFC 2RHSB 4WJOA 1LUZA 2EYPA 3OIPA 4A8XC 2R93B 1XTCD 3S24A 4IFDH 2E74C 2A19A 1FMAD 5E6NA 1RFKA 1RKNA 3H6MA 1K51A 2EMSA 1JOKA 1TYGB 4A3KB 4A3JG 1XEEA 3PRZA 1KRTA 3SD5A 2JZPA 1JQYD 2ICEC 1KH0A 4APVA 4ZKCB 4HKQA 1YOVB 3OJ4B 5AZHA 2PYKA 4A93B 3I90A 2AQ3B 3NY5A 3HVZA 3EFCA 1MSGA 3EN2A 2JYOA 5CHWA 1LTID 4IG7B 1WGKA 3DBHB 1E0BA 1EQRA 1PRTD 3ZYYX 3M4QA 3CCVA 3UDXA 1EZ8A 1HPCA 1IBXA 4DK6C 1U9RA 4ZLTF 1SF0A 4XXEA 4NAMA 3QOJA 1ICFB 2L32A 4RAUC 1WZ3A 1P8LA 3SFDB 3Q24A 1QKZA 4R4OA 1RTNA 3TP8A 3P20A 5JPNC 1WD0A 3B0AA 3OMGA 3Q14C 4BZAA 3GZNB 1GD7A 1WXVA 4JL9A 2M9VA 2MJDA 5CTRC 5ELNA 1P3QU 4DR6Q 4A3BG 4FADA 1UEBA 2I5MX 5EKKA 4OZCA 2XWBB 1PHJA 4BA2I 3NJTA 1VQ4A 4EVOA 4HPLB 5AUKA 3R7QA 3VR3A 1SJED 3ND9A 4A3IH 2A8VA 5DPRA 4HEDA 1J7CA 2OEOA 2WXNA 3I56A 3K81C 4KLKA 1YITA 3AE1B 3AU5A 4PS7A 3I3TB 3UE1A 2K01A 2RCFA 2K5VA 1XF5L 3W1BA 3VR2A 1NENB 2NPTB 2WXQA 3PZ8A 5IOIA 1DZ1A 2LKVA 3T1YL 3AH7A 3PS6A 4DHZB 4P16A 3RR5A 1S3SG 3UIPB 3K5OA 2IO1B 4BFRA 4TQUS 1HZAA 2NZHA 2TSSA 2PW7A 1F1HA 2ONQA 4GN3B 2LUEA 1A15A 4C3IB 4NP5A 1A5RA 4OIKA 2R92G 1D8LA 4ZAIA 4A3DH 2O6VB 5EBCA 1J0GA 2FE8A 2UUBQ 1C8CA 1YQBA 3LYYA 1X54A 4FF2A 2WAQB 4JI2L 4OXPA 1EU4A 3S15H 2DN8A 2Z4IA 4IM3A 2MFIA 1E7ZA 1S5DD 1VJKA 3HOXG 2RVLA 2V3SA 5IGGA 3H6NA 4DR5L 3ZQ4A 1L2FA 4R1JA 1IBMQ 1EOVA 3NQTA 1OGWA 4ALPA 5JEAJ 4QCLA 1LQBA 1QVFA 4KY6A 4JBWA 1K3RA 3F2DA 2I0QA 4RCOA 3HOUH 4DA2A 2H4OA 4JG2A 1YQ4B 4C3JG 2G45B 5FOBB 2RQXA 3X3MA 3I4MG 2R2OA 5IP7H 1XNRL 1VQLA 2WS3B 1T5XD 1PZJD 2LFNA 1K8OA 5C3WA 3GTGH 2L0TA 4WJ4A 2A68C 1MBYA 2XK5B 5L83A 3SHLA 3T51B 4W9JA 5IN7A 4A3MH 1JROA 1LT5D 1GB1A 3CIRB 5CGKA 1EEID 2KDIA 2PVGC 3M4PA 1X1MA 4C1NI 4N58A 4P1CC 1V86A 3RZDB 1PDQA 5D3DA 4L1BA 1GXDC 1TWGH 2YTVA 4X62L 1L7YA 2D5DA 3ZVVA 2CR5A 2L83A 3C0RB 3T56B 1H9SB 1I7HA 2J0MA 1F9RA 3A8KE 3HOVH 2FINB 3MAQA 3KFUA 4YY3Q 4IOAA 2JA8G 1E5WA 2K39A 4B3ML 4JWUC 4PYUA 4TV3A 3PREA 4XT3B 5C4XB 2JSVX 4GZYC 1FFUA 4KKIA 2KHSA 3F8TA 2HDMA 2RCNA 4K2LA 1WH3A 1AARA 2L55A 4X65Q 3NHEB 2F0PA 1RM6C 2EVBA 3GD7A 4A3FB 1WYDA 3OW2A 4OL7A 1A63A 1WSPA 3M3JA 2YTYA 4TSSA 1ZKHA 1HNXL 4WWPA 2XSCA 3K0XA 5CMDA 2WXMA 2HCIA 1WTPA 2IY5B 2NTSA 4ANWA 3PO3G 1EOTA 1IL2A 2W82A 4ULLA 4KHPQ 1RHPA 3PF5A 4IW0A 4GS3A 3M7GA 3Q3NC 5I6YA 4FVMA 5M3FB 4EQNA 1E8ZA 1B70B 2PLPA 2MO0A 2RHQB 4KD3A 1SB3C 1FPYA 4JI7L 1ACCA 3AMUA 1EY5A 1WIAA 1TKYA 4DV7L 4W9HA 1LV9A 4G4KA 2ZT9C 5LMNW 4NJCA 3TCAA 3NXWA 3K80C 2ZTEA 2BE5C 5E4XA 3PUZA 3EFUA 4HSPA 2F0QA 2C7NB 4HJ9A 1V81A 3ZO5B 1RODA 2FIDA 4HK2A 3UGBB 1W6JA 2NCNA 4X64Q 4LF4Q 3FKIB 3VHTC 1X32A 4JBMA 1V97A 4C7YA 4KV6A 3S1NB 1EYGA 2JQRB 4OO1H 5J17A 3A5UA 5HKHA 2M19A 2EXZA 5GMVA 3CC2A 1ZP0B 5C3EG 2Y5BB 3ZXRA 3CMMB 1VQ5A 2INNE 3L17A 2AQ1B 3S1MB 1FD7D 1JRPA 1Q0WB 4XQQA 1YN3A 2V0GA 1HTPA 2JQOA 1OEYJ 1F77A 5IY0A 3R7RA 2ZXOA 2CU3A 2MLBA 3AYHB 4U68A 5IGFA 4JYAQ 1HNWL 1VRAB 5GAEC 2Q5WD 1WM2A 2WXOA 2X6LA 1HCZA 2EYHA 2YU9B 4KVGB 1D5MC 4XWWA 3KBGA 5CR3A 4CKCA 2MBEA 3MTSA 3NPPA 4DR3L 1MD2D 1SYEA 1PUTA 2JA5B 4J8QA 2ES2A 4BOSC 2QDLA 3F2BA 4JGHB 3VTUA 2PW5A 3QX1A 4HJ7A 4DV2Q 1E24A 3FMCA 4F8MA 3M95A 1PTOF 2N0SB 1CSPA 2QGQA 3TREA 2PQAA 1Q46A 2NVXB 4CJ0B 2IBIB 3U58A 1XLQA 2I2YA 1GOZA 1I6VC 2AHOB 2VZKB 1I4XA 4B3RQ 2UWQA 1N6ZA 4DDID 4PZ7A 4FJYA 1FJGL 2WXRA 4PYZA 4X6AH 3A0JA 1YVCA 1VZ7A 1U5KA 4CJ2C 3S1QH 2BH2A 1C3TA 2LHEA 2N78A 3SEBA 5KNBA 1ASYA 4FF1A 2JA6B 2HTHA 2KAJA 4N9TA 1EY9A 1JR0D 4YHHL 3VR6A 3AB5A 2KD0A 1IKMA 4R4IA 1IYFA 2IPKD 2WKCA 4LW1A 4KGTA 1WGGA 2Y0SG 4S3SA 4GKJL 3T8MA 2A74C 4DV0Q 1JC7A 1P98A 4LJZC 2D3GA 1CK1A 1JJ2A 2N4FA 5CX3A 3V2TA 1J5EQ 1EL0A 2QDFA 5LL6X 5FR3A 2Q8RE 1UF0A 1STGA 1M90C 3D4WA 4MGIE 2N9EB 2I5HA 3ZRFA 3H7PB 4JQWC 5ELDA 3VR5A 2KWCA 1KRSA 4MACA 3RD2A 2B63G 4DUZL 1LYLA 2GMIC 1AP0A 3GTPB 4K0KQ 1Y8PB 3D6WA 3V61A 5GROA 2A69C 4HPMB 4IPDA 4ZOHC 1WWTA 2D0OA 3TIXA 3NVYA 3NK9A 2VUMH 4R4QA 1QVGA 4QL5A 2KACA 4EX5A 2FUG1 2ZNVB 2B2TA 1E8WA 1RFAA 3FP9A 3DVNU 2PMZB 2LVQA 2LEKA 2A69D 5BN3A 2L1BA 1UE1A 2KOLA 3BVZA 1B53A 2BS4B 2D3AA 3AE7B 4C4VB 1FCCC 3WA0A 5JZEB 5LMUQ 3AEFB 3OLMD 5JXVA 3HKSA 5CC4A 3A1QB 1EIYB 3OSOA 1TS5A 1KQSA 4POGA 1PGXA 2W55A 4C56C 5ELEA 3Q8EA 1R4NB 5G3LF 4NXNL 2JXXA 2LGYA 2R93H 2E2DC 3TS0A 2K5HA 2KK8A 4B95A 1HJPA 2B2UA 2V1CC 4A3BB 3DXJC 4ARCA 4M8NA 4XYQA 5I2YA 5M3MG 1OXSC 3TEWA 3A9KB 2JA9A 3KF8B 1L1OB 1II3A 3N52A 4A3KH 4LDTB 4HDQA 4NY0A 5GXGB 3C46A 2LD9A 4WQOB 2OXPA 1MI0A 2NPTA 1KC8C 2JT4B 1YJWA 4IURA 4DR7L 4A93H 3PRMB 2UXCQ 2RPQA 2ZCCA 4L63B 5D65A 3H1UA 4AWJA 2KYWA 4C00A 1WFYA 4HCSA 4JPBW 4QY7A 1HXYD 4FO2A 1V9JA 2L0FA 1F2YA 3AE4B 1UZXB 3KWVA 3Q3OC 3I8ZA 2IGGA 3HGBA 2DNEA 3HRZC 1EQTA 1B44D 3MA2B 1I4HA 1XNQQ 4LFAL 2B2WA 4L6TB 3S16B 4DV4Q 2VQFQ 1OTRB 3L10B 4KK7A 2A1AA 4NMZA 4AQ7A 4WAAA 2DUDA 1AZQA 2O6VA 4K1RB 1LT4D 2K4KA 1PH5A 3CPWA 2DENB 1OXVA 2VW9A 1TXYA 4K2KA 1L6VA 1X6OA 1EEFD 3CRKC 1ZW7A 1UBIA 1CJEA 3P75A 4K5XA 2AWTA 2KX0A 1XLNA 2F0EA 2IJ0A 1C77A 2G4DB 2GOWA 4A3CH 5BR8Q 2BGFA 2VB3X 4P75A 5IO9A 1C4AA 5IYCH 3O65B 1TIID 4AYBE 1YNNC 3GOEA 3EQLC 3JC66 4HTHA 2M00A 3N30A 2FFKB 3ZNZB 2XRSD 1YHAA 2ZZPB 4LNQA 5KNCA 5JHAA 3HOXB 5JOBA 3GTKB 3AE9B 1K8AC 3EJIA 1M1KC 1IBLL 2VH2A 3K9OB 1WTQA 1U4PA 2XK5A 2ASQA 2Z6KA 1J7AA 4JV5Q 1NI3A 3A56A 4B3SQ 3KF6B 2K6DB 2RDFA 4L23A 1WZ0A 3KLSX 3I4MB 1T0QC 2EKIA 3NRZA 2DBYA 1PYSB 4HJ5A 3E9SA 4YIJA 1HH2P 1NR4A 2R7DA 1UE5A 4OVZA 2KA7A 1MHXA 3NP8A 1H9SA 2IHFA 1SN8A 1LACA 2QJLA 3I63C 4DHJD 5T1IA 3T4AC 4OEMB 1ZXIA 3NOBA 5FKAC 4DXAB 4C3IH 3RLOA 3ZTCA 4W9DA 3AEGB 3JAMi 3NG0A 1GUGA 1C9OA 4RF0A 4H02A 3D6CA 1Q8KA 3BVMA 3V3XA 4MJSB 1VCIA 3RMHA 2VXWA 1VQ7A 1Z6HA 1HR0L 1FM0D 1UELA 2DY7A 2N7JA 4HEA1 2KEEA 2ZM6Q 3PCOB 2XN9C 3CMAA 4L5RC 2DZMA 3T16A 1XJVA 3N1ZC 2E2IB 1MG8A 2KO3A 2OJRA 3HIZA 4FULA 3T13A 4G0NB 3WAMA 2KFJA 2B2TC 2PNHA 5DPWA 4TQ0A 4QGUA 5LXIB 4NW2A 4RMFA 4LNKA 4ZRQA 1YIWA 1Z47A 3W5UB 2F0OA 2JN4A 5IYDH 5TSSA 2GB1A 5KHQA 3OIQA 2AEHA 2EY6A 1J8IA 3J9CA 4P74A 1JT8A 2HIVA 3PUVA 2SAKA 2WDQB 3G4SA 1F0ZA 1JWAD 2OQ0A 5EE9A 4J6HA 3PO3B 2RF4A 3I4OA 5JH5C 1KIXA 1NY4A 2XGTA 4PV1C 4B9KA 3TMPB 1WTWA 4IN3A 2IL8A 3AE2B 3RZDH 2HCCA 1B4OA 1UUPA 2IHEA 2GA4B 3RT3B 2B2UC 1A3TA 1WCMG 3WOEA 2UU7A 2F0JA 3LX0A 2BDOA 3AFPA 3KLRA 2D62A 1WGRA 3ITPA 1S5FD 4DPGA 5C4XH 3OW7A 4UY8C 3C2PA 1EWYC 2I07B 4LJPB 3IT4B 2X8XX 2LGDA 3DWPA 1ZDVA 1B3AA 5KIXA 3NUCA 1SYBA 2XNAC 3O13A 1LTBD 5M9OA 1WVLA 5E6OA 3L0WB 4KSKC 1NMFA 3ONSA 1XTDA 1L4ZB 4DAMA 1T0YA 3TBIB 1KM7A 3HRDD 1SSNA 4CDFC 1PH2A 2CJNA 1EFWA 1G2TA 3IHPC 1VLBA 5FO9B 3QWZB 3SK5A 1D2BA 3N9YC 4Y52H 2B2WC 3RD4A 4N9PA 5CV7A 1I35A 1TS2A 4BBRG 4JI4Q 1ET9A 4W9EA 4CDDC 5M3FH 2B76B 1MHHE 3J7AF 4L2YA 3RZFA 3U30A 4W9FA 3DBRB 1DONA 3U9SA 2ENBA
chains in the Genus database with same CATH topology
1T6BX 4KGRA 3WDNA 2RMMA 2I38A 1AW7A 1PDXA 1KNEA 1HQMC 1TU2B 1ENAA 3E0JA 3TZDA 3L9AX 1MVKA 4NDXA 1EY7A 2BBCA 4R3DA 4E6IA 2X69A 2PO4A 2D9UA 1VDZA 4YTMB 4Q2JA 4A90A 1DJRD 3GTQB 1LTTD 2AQ2B 5CV8A 2EYLA 2Y0SB 4RWSC 4IUTA 1DXMA 1MI2A 2F0SA 1Y69U 4DF7A 1PFNA 1Q10A 2G1EA 1IGDA 5CBAE 4WIPA 3K6OA 4QUCA 2B63B 4YSXB 4XDDA 5C5MA 3PIP3 2J7ZA 4DFAA 2O2LD 1ZEQX 1STEA 3SFEB 4DK1A 2OT2A 4B0EA 1AEXA 5DNFA 2BYTA 4KKUA 1DM0B 2JSOA 1FXAA 2WXJA 4G7ZC 4G7HC 1E0ZA 4X3TA 3SR6A 2K1BA 4XDXA 3E6ZX 4DAVA 1F2LA 2RBMA 3KK7A 3KF8A 1QQRA 3PZ7A 1XYIA 2KQ3A 2JX5A 2QF7A 1BCPB 3MFYA 2HTME 3SR1A 5IOCA 1SMYD 5M3MB 1YNTE 1KNAA 3BVGA 1GUSA 5EJWA 1D5ZC 4OZAA 3I72A 4RGNA 1EM7A 3TP6A 4IDIA 3Q8BA 1OQRA 1N5XA 1WTOA 3DEOA 4OW0A 5COYA 3LWUA 1G6ZA 5C4ZA 1QWYA 4QIWB 4G57A 2WP8J 4K6DA 2OHFA 4HCEA 1TQOA 1NEKB 2SNSA 3B9JA 4XE0A 4IUQA 3VR8B 1TJEA 3VRAB 3P4QB 2BTEA 4H44C 3FILB 2QIEB 5C4JB 5CV4A 1VF7A 2H1EA 4CKEA 5H8YE 4ZUJA 3M3YB 4XDCA 1TKWB 3S1RB 3CWIA 4N59A 4FXCA 3AEAB 2Q8IB 4OIJA 1I50B 1FXIA 4H7BA 3Q22A 4KN7C 2PZTA 3DM1A 3D4RA 5G3LD 1QNKA 3AN1A 1SE2A 5KYIA 4FXDA 2F0FA 3NHHA 5EPLA 4J1MA 4RGOS 2FMCA 2K5WA 1HZ6A 3FPUB 3S2DB 4C1NK 3RFZB 1SE3A 1RWSA 3MEHA 2L52A 1GUNA 1J7BA 2ZXRA 4ZHPA 4RHSA 2M56B 3H8HA 3A8JE 4ZUIA 3FRPB 4GLSC 3TEXA 4DU9A 1YQ3B 5EKIA 4DAPA 2EELA 1V8QA 1SSOA 2JU6X 3GV6A 4K5VA 5G5HA 4KD4A 4NZLB 3S14B 1WCMB 1C78A 5K5PA 3KUPA 2EJGC 1Q12A 1G91A 1LTRD 3VR9B 4O1NA 2OF1A 3MVVA 1EYDA 2VB2X 4ZQ3A 2N55A 4FF4A 1TS4A 2WXLA 3K59A 5FK9C 1RD9D 2J52A 5LHY1 2MJ8A 2WIIB 3DUZA 2TMPA 3MWYW 4BBRB 1IL8A 5I9OA 4MM3B 4V0BA 4DXFA 1NAPA 2MUYA 4K8IA 1NCVA 3NTKA 4KHVA 4D2KA 3LXFA 2EY1A 5ELBA 3I4NB 3NSWA 3NTHA 1A2TA 2A68D 1SYFA 2L4NA 2NVTB 1AWDA 1SYGA 1LABA 1C76A 2F0MA 1H9KA 4ITKA 1XO3A 2WXPA 5BMIA 4BWGB 4WORA 4IQZA 2KJXA 2NZ1D 1KAAA 4QUFA 2VNUD 5EE1A 1BUVT 4RNAA 4KHZA 1JWUD 1FRDA 5J39A 2K0PA 4KKJA 1PZKD 3K58A 1KRHA 4B0MA 2NUCA 2F0IA 4EQOA 4XIGS 4M0WA 4DNRB 3P7JA 2JYEA 5JVG3 1JQ4A 5IGEA 1TKEA 1DOYA 5DAUA 1TY0A 3NQIA 1STYA 1KDAA 4LK1C 1T3QA 2F0KA 1FCLA 2DLBA 2K7VA 4WAFA 4RGMA 2L0CA 5K36G 1N60A 5J22A 1V8CA 5I4DA 1GB4A 3VA7A 4O42A 3KQ4A 3R2IA 2BE5D 1EU3A 3VYTA 4ME5A 1D6EC 1KTKA 4RF1A 3VR4A 3NVVA 3EA6A 4U673 1PTOB 5KNDA 1RDPD 5M5YB 1SNCA 1GUOA 1CFMA 3U7ZA 3BK1A 3PO2B 1PYWD 4CHTB 1FFVA 5LL6S 2XVSA 3NBIA 1AZPA 2V3NA 4KJNA 4LAAA 2JXMB 2RA4A 2WXIA 3E56A 4C3HG 1YN5A 5M5WB 5ELCA 4IOIE 4BBSB 1NVID 3L4PA 1G8ZD 1YJJA 1HA5A 2NWGA 3X3NA 4K5WA 3I57A 4MT5A 2DY8A 1L0XB 1ONLA 2KUMA 2PMVA 1ESFA 1ET6A 4ZKBB 4YWGG 1S5ED 4DGZA 1SIJA 2INPE 1DOXA 1PMRA 2WNMA 5BYSA 3BZDB 2AUKA 5NUCA 3NE5B 1JOQA 2QKIC 1CZWA 2LGIA 1UWXA 3WCQA 2GI9A 1SNMA 1SDFA 3IT6B 2NBFA 3SK4A 4L8JA 4YSZB 1SYCA 1PRTB 3BDLA 4R8NA 1D1KA 1QLBB 3RUZA 1CQFA 2F3WA 3FILA 5D7GA 1JB3A 1LTGD 1ZOYB 5JVH3 5D3IB 1XXGA 2DYMA 4A3JB 2W54A 3FPPA 3MHZA 4K14A 2B2YA 5C0XJ 3IL8A 1HA6A 1PFDA 1OFFA 4LK0M 5HFYA 4H13C 1HFNA 4M1UB 3OOCA 1KDBA 1TWHB 2YEPB 1ROEA 3A7AB 4IFDJ 2EY2A 3ZJTA 1B9NA 4FXGC 4BY7B 4HROA 2ZXPA 1VDVA 1D5XC 1S4ZA 3F2UA 2Y5CA 1A6XA 2ZW1A 1I4QA 2HDLA 1GPXA 1TR5A 1U4MA 1V1OA 2KVMA 5HGTA 3DMUA 3TSSA 1QOHA 3Q8AA 3TN2A 5KRUA 1BDOA 3HOZB 2NTTA 3U9OA 2FJ2A 1JCKB 3DWQA 4ARIA 2BA1A 3FEWX 1S5BD 3GTMB 5G5GA 3U52E 4PQXA 2HUGA 1CI3M 2K22A 5JAVA 5BYRA 2NYZD 2Z8LA 1KDCA 3NS1A 3IKJA 3VYSA 4B9WA 2HDEA 1BCPC 1SNPA 2BOSA 2PQEA 2G9DA 1NUCA 2B8GA 4TQ1A 1Q1EA 1ZUD2 1LLRD 1AYFA 2NB0A 4ABNA 4G7OC 3S17B 1DCZA 2FMMA 2BS3B 3T53B 1JW9D 1EQVA 1BCPD 1H9MA 2R92B 2NVYB 1EZ6A 4HMIA 3D31A 1ESRA 3ZJUA 2EYJA 1N5WA 1TWFB 4KY7A 5C6AA 4BY1B 2KDMA 3PV0A 2L12A 3HS0C 1NYQA 4KMUC 3DWGC 4QMGA 2K04A 1EY6A 3PUWA 1UNSA 3PO0A 1N61A 2DWQA 3KWLA 1IW7C 4C2MB 1VMPA 1L6UA 4C3JB 1YNND 3MXUA 4JE3B 3HVDA 1HUNA 4A6QA 1EIGA 1CZGA 3OWEB 3MC0B 1E2VA 2AWNA 3P4PB 4RFBA 1IUEA 3MXGA 2KMMA 2NN6I 3K5MA 3B2FA 1VR9A 3K57A 1B1ZA 2JA8B 3SK6A 4LMQD 3ZJVA 2O4XA 2B2YC 1LT6D 3W5VB 3G6JB 3KLSA 3MZ5A 3E5SA 3UI2A 1FIQA 1ENFA 2F0NA 1YNJC 1PFMA 1L5PA 1ML0D 1OXUA 3SDZA 4Q0FA 2JWUA 2F0DA 5EGTA 1K8MA 4WH4A 2BDNA 1CTMA 5A2QL 1FNWA 2WU2B 2LY7A 1YNJD 4QB4A 1FR3A 2C5CA 5KEEA 3HOWB 1R4QB 4YT0B 2J53A 1JORA 1NR2A 5M5XB 3Q8CA 1EWHA 3I4LA 4IUNA 2N9LA 3A8IE 2A6HC 5E3FA 1JWSD 1YMHE 5CV9A 2MPMA 1HRJA 2PNRC 3A55A 2IGDA 5A2QE 3K5LA 2NN6G 1E10A 1FGBD 1TWCB 3MFGA 2ON8A 5ELFA 5DM63 2WU5B 1KLGD 5FLXL 2CQAA 5C3EB 1TKGA 2I46A 1WRIA 2QCPX 2L5TA 4EGVA 4RCNA 1IHZA 1GHJA 5A35A 2D5GA 4CJ1B 1Y8OB 1STNA 2MGSA 3PMFA 3KBXA 1OXTA 1K52A 4US9A 3NWTA 1U4RA 3HKZB 5FLXE 4US8A 4H2AA 3ABVB 3GQBA 3BDOA 5JEAG 3AECB 2F0LA 4C3HB 1Q90A 1K83B 4RKBA 4TKOB 3I70A 4WQMA 4JX1C 4IUVA 1STHA 1QE6A 2W3RA 3T3OA 1JE4A 3UI3A 3AEDB 1TVXA 1QT9A 1F2RI 1TY2A 5EE3A 2KQ4X 1SNQA 1PTOH 2ZW0A 2A73B 5ISRA 1PLFA 1FNVA 3NVWA 1H9JA 2K5QA 3QOLA 2QMTA 1RF2D 4IZ8A 5BN5A 1L0YB 3P42A 4P2CB 1QJOA 5KYLA 3CQZB 1VMCA 4X3UA 2V3PA 1P7EA 5D14A 2PW9A 1ICWA 3AU7A 2Y5PA 3TP5A 2QILA 3GTJB 2KECA 4DN4M 5BMHA 5MPOA 5BMGA 2RSOA 2K05A 2CW0C 2DNCA 2QSDA 1HFGA 3D3RA 3VYUA 4PMWA 3NVZA 3ERQA 4B9XA 1SYDA 1F2MA 3FVQA 1P7FA 3ZGZA 2R3ZA 2R6GA 5CV5A 1DD2A 4ZRZA 2WP9B 4KY5A 1BF4A 1Q8IA 2G9HD 3QJYA 2O5IC 2LFIA 1TT2A 4GDKB 2BA0A 1I4RA 4XYOA 1I4PA 3R3OA 2MHVA 5HURA 3GB1A 5C44B 1GHKA 1KLUD 3OPOA 3RLFA 1QG7A 5I2XA 4ZYSA 4Y7NB 5C0XI 1BCPF 1L4DB 1HQRD 1TZOA 2K5PA 3G7LA 3I91A 2M2LA 4WURA 1WXQA 3H09A 2RDGA 2K03A 3TP7A 2B8FA 4FF3A 4IFDI 1BMLC 5BYQA 1O7LA 4IALA 5FO8B 1FEHA 2MJEA 1W6KA 2K3UA 3DWMA 2VZKD 4F7XA 1HEZE 2ICIA 4X3KA 1UAPA 1Z7TA 4FNFA 3BS1A 4A3EB 2EZVA 1OXXK 4A3GB 1QF6A 3B2GA 3DEPA 1PXUA 1SNDA 1GUWA 1PRTC 3LB8C 2KN4A 2EYOA 1ZXTA 5DM73 3OHXC 3R8BA 2H88B 3HOYB 4REZA 2WXKA 1YJIA 3FC4A 2W3SA 3BYYB 5DEHA 3H94A 1EWCA 1T5EA 1QOBA 2XWJB 1BO0A 3GS2A 1EYAA 1PZID 5EPJA 3P63A 4X3SA 1QNUA 2BS2B 5C0XG 5AFWA 3QIAA 1R4PB 3C8YA 3EVQA 2PZUA 5FO7B 4IFDG 3FAHA 1A3VA 4F87A 1FNUA 3IFDA 2LJIA 1ZPSA 4C80A 2WXHA 1VZ6A 1STAA 3MXNA 3TMEA 2E3TA 3TZUA 1JWMD 3P4SB 3J81L 1CHPD 4KJOA 3AMZA 4J3OD 5CYUA 1SXTA 4TRDA 1D4BA 3ONAB 1SEBD 3TDQA 1I4GA 4HJGE 3EFXD 2K33A 1HZ5A 4CQNA 1BOSA 3WOFA 3Q6SA 2E2HB 4CKBA 2JYTA 3J81E 3W9CB 5J1ZA 1B9MA 1JMLA 3SVMA 1O7ZA 1SAPA 1RJTA 1VF5C 5F2DA 1F9SA 1NYRA 5AUIA 1K53A 1QOGA 3L7ZC 3IAYA 1N62A 2BCOA 3Q0AA 4OGQC 3HUIA 2JXTA 1JOOA 2EYFA 3U4EG 3TEYA 1A2UA 2D2CC 3VRBB 3URYA 2MJ3A 2IWHA 4A55A 2JE6I 4FXKC 1XX8A 4LLGM 3PUXA 4PNYA 4IKGA 4DXGA 5CBEE 4CBVA 1ZDXA 1O78A 5CORA 5K36H 2EE1A 1Y1WB 1R9TB 2V4DA 1CA6A 3H0GB 1WTVA 1QILA 3R2TA 3CKIB 1XWEA 2SOBA 2IDYA 4DK0A 2Z4HA 2PZWA 2WINB 2GRIA 1XCTL 4R9WA 4DNTB 3V96A 1RCVD 1U4LA 1Q1BA 3D8GA 5T1GA 1J9OA 2EPBA 2BB5A 2A6EC 2X38A 4CGYB 2R7ZB 1FRRA 1Y1VB 2L11A 5E6JA 1JALA 4OHJA 5KGUA 4OZBA 2A5HA 2AUJD 4AS1A 2K6AA 4NKLA 1C9FA 4M8AA 4V190 2DYOA 3LNNA 4I7ZC 2XRQD 2WXFA 2A6ED 4PMBA 2EY5A 3W1SA 2E6XA 1E2WA 3W2DA 1V1PB 2PPBC 2IGHA 2K32A 4KKTA 2MH7A 2IX0A 2E75C 3AE6B 4A9AA 1HUMA 2EOTA 1BUIC 4OO1I 4NAWB 3ND8A 1M8AA 2F0HA 3RZOB 5IODA 4LTUA 3VYRA 1DOMA 2MP1A 2F4IA 1B9RA 1C79A 1XLOA 1KABA 1BXTA 1O7YA 5I6WA 2PCFB 1N63A 2IX1A 1ZKOA 4ID6A 1STBA 2BW2A 4GDLB 3AEBB 1EYCA 4RGTA 1EFID 3GTOB 2NVQB 3BIID 1TWAB 4KGSA 4XQJA 2WKDA 1GJXA 4ZK9B 1GAQB 1SBBB 3A54A 1R7SA 2F0UA 1WD1A 5C4HA 1V43A 2LMCB 4F88A 2F0WA 4KTAA 4OO1G 3V05A 1ZE3D 2AWOA 2E76C 2B2VA 2QEJC 4MHEA 2WXGA 3NZ3A 1FO4A 3DWAA 4HKZE 3CRLC 1IKLA 2KCCA 2K5DA 4HN7A 5EE0A 1G291 1I6HB 2BB6A 3A7LA 1F9PA 1GUTA 1PGAA 2FBWB 2KWDA 2XIWA 2N88A 3BDCA 2B39A 1DGJA 1BQQT 1DYQA 4UAIA 1DOLA 3ETRA 4RHRA 4WJWA 1QOFA 3AB9A 3VQIA 1LT3D 4XWTA 4TMAB 3NBHA 3N6RA 1ILQA 1JWBD 3K5NA 5C2TB 3JAML 2J42A 3J80L 5IGBA 5HI1A 5BN4A 1VZ8A 2M0AA 2JA7B 1XLPA 3AM9A 3NUHB 1PRTF 5IIFA 2LS01 1ENCA 4KI0A 2YYZA 4PMCA 4WRDA 2SDFA 1IGCA 3JAME 3J80E 2LHDA 1SE4A 3MXPA 4QF4A 4ZRPA 2WV6D 2PIAA 2YEPF 1QB5D 2CVRA 4B08A 4FYDA 1SNOA 1E6EB 1C4PA 4HR7B 2HQEA 1KF6B 1MSHA 2Z1CA 4IUPA 1LTSD 2PVOD 3M85A 2KEDA 3CHBD 5JJZA 1CHQD 1B50A 3C1FA 1OO9B 5JPMC 1ZXHA 1S5CD 2BT6A 3AE3B 1A70A 1KFYB 1C4QA 1CA5A 3BG3A 2MEKA 5I9PA 2V4IB 1PGBA 2Q8TA 3C3LA 4MH8A 2JP1A 3TUOA 3AEEB 1LTAD 3OMCA 4R8IA 4FP5D 3GO5A 4A3IB 1I3QB 4YXDB 3R93A 1BBXC 3EROA 4HMJA 3FDTA 1IW7D 2WQYB 1F9QA 2B2VC 3I3CA 3DHQA 2X6GA 5IT9L 2PKOA 1PFBA 1O80A 2CHBD 4AYBB 1LO5D 5H92C 3VA5A 1E7PB 1RTOA 1WYGA 2ID0A 3QB3A 2IT1A 3Q8FA 3EUB2 1EY0A 4C7ZA 1BNZA 4JK1C 3EGRA 1IBXB 4H0LC 1X3QA 4Q5VA 3NWSA 3AV8A 3AE8B 2NN6H 5T8IA 5IT9E 3HP3A 5LNK1 3SE0A 4A3DB 1QOAA 3S15B 3CU7A 2J0TD 4KN4C 3HOUB 1WTRA 3RPFC 3J7YW 1YN4A 1CZPA 2RDHA 1V1PA 3P1HA 2L1AA 3GTGB 5JEAH 3TEZA 4XTCS 2CJOA 5HG2A 4A3MB 2SEBD 3BK2A 2Y3AA 4RH6A 4C3IG 1CT1D 3HZXA 2O5JC 1E2ZA 1TWGB 2A6HD 3T3NA 5C5LA 4HSVA 3HOVB 3J7AV 3H3VC 4XQNA 1DOIA 1UWMA 1EIHA 1HHVA 3SXHA 1JICA 4P6VF 1SJHD 2PTLA 3GV3A 2EDGA 1A3UA 4BA1I 2F0TA 2NMQA 3OWFA 3SK8A 4N6EB 2H89B 2RKSA 4HAEA 1UEAB 1F2ZA 3PUYA 1CQVA 1FYCA 2F0GA 2E2JB 2OEDA 2WDVB 2IW3A 4Z9CB 5C3XA 1Y56A 2EJFC 4ZHOA 5E4WC 3QG1A 2J4XA 2RPVA 3MP9A 5HHDG 3BWUD 2IX3A 3QO2A 1HTLD 1C4CA 3BYTB 2WLBA 4KX6B 2WACA 1ILPA 2LMCA 3AE5B 1IYVA 3HEJA 2WDRB 2F1MA 3IXSA 3K0YA 3IFTA 5EKLA 2F0VA 4YTNB 3M4OB 1E9MA 4XT1B 1G2SA 2F03A 1AFPA 1ZYRC 1H9RA 3IAM1 4KKSA 3M4YA 2AX5A 3GTLB 1Q3LA 1X3PA 5EPKA 5IGDA 2FHTA 2N9KA 4MN3A 1TS3A 3S9WA 4DQOC 3I73A 3D4DA 4RKLA 4WWMA 3PIO3 4I65A 4MIUA 1ZYRD 5E1FA 3P4RB 1C48A 3QWNA 1K50A 4K8JA 1Y8NB 1FD6A 2RSNA 1CM9A 1RYJA 1L0VB 1IYUA 2KCNA 4ODGA 4EE2A 2F3VA 4PT5A 1M4VA 1EY8A 1WTXA 2SNMA 1AN8A 3Q23A 1D1IA 3LWEA 2C9OA 1MGSA 1BR9A 1EY4A 3C1EA 1DOKA 3U2SC 2R61A 5C3JB 3S1QB 3IAS1 2CW0D 4YSYB 2JEBI 2L9HA 2LUMA 1QCBD 1OQQA 2K28A 2ACZB 5CV6A 1SMYC 1UGJA 3P1MA 4YTPB 4JPSA 1PTOC 5EBDA 4HRSA 2K9XA 4RA8A 4WFN3 1F2RC 4IUUA 3MJ5A 3H91A 4USAA 3Q69A 2EJMA 1PTOD 5EQ0A 1XCQL 4UDUC 2WB1B 3NTIA 4BS9A 3I9V1 2VUMB 4K6LA 4DAYA 1B2TA 4JWSC 3HG9A 3S2HB 1MPEA 3GP7A 2EYMA 1SFOB 3W3AA 5IGCA 3MHBA 3L3OC 4EQPA 4ILWA 1NSNS 5C0XH 3K7AB 2QDBA 2JEAI 3M7NA 2EYPA 3OIPA 4A8XC 2R93B 1XTCD 4IFDH 2E74C 1FMAD 1RFKA 1RKNA 3H6MA 1K51A 1JOKA 1TYGB 4A3KB 1XEEA 2JZPA 1JQYD 2ICEC 1KH0A 4ZKCB 4HKQA 2PYKA 4A93B 3I90A 2AQ3B 3HVZA 1MSGA 2JYOA 1LTID 1WGKA 1E0BA 1PRTD 3ZYYX 1IBXA 1EZ8A 1HPCA 1U9RA 4ZLTF 1SF0A 4XXEA 4NAMA 3QOJA 2L32A 4RAUC 3SFDB 3Q24A 1QKZA 1RTNA 3TP8A 3P20A 5JPNC 1WD0A 3OMGA 2M9VA 2MJDA 5EKKA 4OZCA 2XWBB 4BA2I 5AUKA 4EVOA 3VR3A 1SJED 3ND9A 4HEDA 1J7CA 2OEOA 2WXNA 3AE1B 2K01A 1XF5L 3VR2A 1NENB 2WXQA 3PZ8A 1DZ1A 2LKVA 3AH7A 4P16A 3K5OA 4TQUS 2TSSA 2PW7A 2ONQA 1A15A 4C3IB 4NP5A 4OIKA 4ZAIA 5EBCA 2FE8A 1C8CA 3LYYA 4FF2A 2WAQB 1EU4A 2DN8A 2Z4IA 1VJKA 1S5DD 3ZQ4A 2RVLA 5IGGA 3NQTA 4QCLA 5JEAJ 4KY6A 4JBWA 4RCOA 4DA2A 2H4OA 1YQ4B 4C3JG 5FOBB 2RQXA 3X3MA 2WS3B 1T5XD 1PZJD 2LFNA 1K8OA 5C3WA 2A68C 1MBYA 3SHLA 3T51B 1JROA 1LT5D 1GB1A 3CIRB 5CGKA 1EEID 4N58A 2PVGC 4C1NI 3RZDB 1PDQA 5D3DA 4L1BA 1GXDC 2D5DA 2L83A 3T56B 1H9SB 1I7HA 1F9RA 3A8KE 2FINB 3MAQA 4JWUC 4XT3B 5C4XB 2JSVX 4GZYC 1FFUA 4KKIA 2KHSA 2HDMA 4K2LA 2L55A 2F0PA 1RM6C 2EVBA 3GD7A 4A3FB 4OL7A 1WSPA 4TSSA 2XSCA 5CMDA 2WXMA 2HCIA 1WTPA 2NTSA 2W82A 1EOTA 4ULLA 1RHPA 3M7GA 5I6YA 4FVMA 5M3FB 4EQNA 2PLPA 4KD3A 1SB3C 1ACCA 3AMUA 1EY5A 1TKYA 1LV9A 4G4KA 2ZT9C 4NJCA 3NXWA 2BE5C 5E4XA 3PUZA 4HSPA 2F0QA 1RODA 1W6JA 3FKIB 1X32A 1V97A 4C7YA 4KV6A 3S1NB 2JQRB 4OO1H 2M19A 2EXZA 1ZP0B 2INNE 2AQ1B 3S1MB 1FD7D 1JRPA 4XQQA 1YN3A 2V0GA 1HTPA 1F77A 2ZXOA 2CU3A 4U68A 5IGFA 1VRAB 2Q5WD 2WXOA 2X6LA 1HCZA 2EYHA 2YU9B 1D5MC 4XWWA 3KBGA 5CR3A 4CKCA 3MTSA 3NPPA 1MD2D 1SYEA 1PUTA 2JA5B 4J8QA 2PW5A 3FMCA 4F8MA 1PTOF 2N0SB 2NVXB 2I2YA 4CJ0B 1XLQA 1GOZA 1I6VC 2VZKB 1I4XA 2WXRA 1VZ7A 4CJ2C 2LHEA 3SEBA 5KNBA 4FF1A 2JA6B 2KAJA 4N9TA 1EY9A 1JR0D 3VR6A 3AB5A 1IKMA 2IPKD 2WKCA 4KGTA 4S3SA 2A74C 1JC7A 4LJZC 1CK1A 3V2TA 1EL0A 5LL6X 5FR3A 2Q8RE 1STGA 3D4WA 5ELDA 3VR5A 4MACA 1AP0A 3GTPB 1Y8PB 3D6WA 2A69C 4ZOHC 1WWTA 3NVYA 3NK9A 2KACA 2FUG1 2B2TA 2PMZB 2LEKA 2A69D 5BN3A 2L1BA 2KOLA 3BVZA 1B53A 2BS4B 3AE7B 1FCCC 3AEFB 5JXVA 5CC4A 3OSOA 1TS5A 2W55A 1PGXA 4C56C 5ELEA 3Q8EA 5G3LF 2E2DC 2B2UA 4A3BB 3DXJC 4ARCA 5I2YA 4XYQA 3TEWA 1OXSC 5GXGB 1II3A 3N52A 3C46A 2OXPA 1MI0A 4IURA 4L63B 5D65A 4HCSA 3KWVA 1HXYD 4FO2A 3AE4B 1F2YA 3I8ZA 2IGGA 3HGBA 2DNEA 3HRZC 1EQTA 1B44D 3MA2B 1I4HA 2B2WA 4L6TB 3S16B 4KK7A 4NMZA 4AQ7A 1AZQA 1LT4D 1OXVA 4K2KA 1L6VA 1EEFD 3CRKC 1CJEA 3P75A 4K5XA 1XLNA 2F0EA 2IJ0A 1C77A 2VB3X 1C4AA 1TIID 1YNNC 3EQLC 4HTHA 2M00A 2FFKB 2XRSD 5KNCA 3HOXB 5JOBA 3GTKB 3AE9B 3EJIA 1WTQA 1U4PA 1J7AA 1NI3A 3A56A 2RDFA 4L23A 3KLSX 3I4MB 2EKIA 3NRZA 2DBYA 3E9SA 4YIJA 1NR4A 4OVZA 2KA7A 1MHXA 3NP8A 1H9SA 2QJLA 1LACA 5T1IA 3T4AC 1ZXIA 5FKAC 3AEGB 1GUGA 4RF0A 3D6CA 3BVMA 3V3XA 1VCIA 3RMHA 2VXWA 1FM0D 1Z6HA 2N7JA 2DY7A 4HEA1 2KEEA 2XN9C 3T16A 2E2IB 3T13A 2B2TC 4TQ0A 4NW2A 4ZRQA 1Z47A 3W5UB 2F0OA 5TSSA 2GB1A 3OIQA 2EY6A 1J8IA