1I35A

Solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEEEFKQICFNSSSPERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE BYR2
publication title Solution structure of the Ras binding domain of the protein kinase Byr2 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 15
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1i35A00
2LGDA 4BOSC 2K6DB 1GC7A 2JVCA 2YVCA 3ZNHB 3PZDA 1IP9A 1SE9A 1GG3A 3QC8B 2JZZA 4MSQB 2N9PC 4KZCA 2DYBA 2FUHB 2K25A 2Z0EB 3A4SC 3A9KA 5D94A 4KZ0A 4B6WA 1WXMA 1JRUA 2MBQA 3U8ZA 3RULA 3VUYA 4FBJB 4BBNF 2MW5A 1YIWA 1WY8A 3ENEA 4X57B 4NAWA 2GBRA 2MA9B 1VD2A 2L8JA 4KV2A 4CO7A 5CTRC 5HKHA 4GDLB 4ASWC 2IO3B 2KJ6A 2VRRB 1C1YB 3ZVVA 4DHJD 2C7HA 2KDBA 5E6OA 3EFUA 1P0RA 1HE8A 3T8MA 4W9GA 2V3SA 4LJOB 4ZRJA 1V5TA 1WXSA 2L3ZA 3HK0A 1WGRA 2GMIC 2IBIB 1WX7A 3MHSD 4RM9A 4NQLB 2JUOA 1NDDA 4MH0E 4HDQA 4HXDA 3SU8X 1GNUA 2LVPA 3UQBA 2KNBA 3VTUA 2ASQA 4F7ZA 4N9F4 2PEAA 1EF5A 3VQIA 2DYMA 3AU5A 4MSMB 2KQ7A 1RLFA 3DOWA 3OJ4B 2IO1B 4CHKA 4IM0A 1P3QU 2D10A 1RRBA 2NS5A 4MEMA 3W1YA 3WANA 4FN2A 4M0WB 4A3OA 5C23A 1WR6E 1WIAA 1YD8U 2M4NA 3GOEA 3A1QB 1WJUA 3CMMB 1ZKHA 2BWES 2DZMA 3DQVA 3L13A 2KFJA 2N4FA 3PLUA 4LCDE 1Q5WB 2DZKA 1WGYA 2PE9A 1Z5SB 4MGYE 3ZNZB 3PTFC 3L0WB 4YL8A 2I1KA 4TV3A 2IO0B 1MG8A 2KK8A 3NS8A 4NNJB 3WAPA 2L05A 3TIXA 4AUQC 4GDLA 3PPAA 4AOFA 3R66C 4A3PA 2R2OA 3DBRI 3NZSA 2D11A 1WGGA 4GU2A 4LJPB 4HLEA 4GXBA 2O6VB 4XX5A 1E5WA 4GSWA 3QIJA 2ZCCA 4RM8A 4FA6A 2MBEA 2N7DA 3HIZA 4W9IA 2L00B 2DYOA 2HD5B 2Z0DB 4ICUA 3VHTC 2MBOA 2G45B 1V9JA 3ZW3A 3PT2B 2XBBC 3ALBA 4BBNC 5G2NA 2N9XA 3DBLI 5DPSA 3VUXA 3A9KB 3N30A 2KD0A 2DZIA 1WZ3A 5D6JB 2AYOB 4LDTB 2PPHA 3TCAA 4WAAA 2LZ6A 2ZEQA 2AL6A 4HCPB 3RT3B 3KYCD 4FJZA 2REXA 4MGIE 1WX8A 4NY0A 1WI0A 5CHWA 1RAXA 2N1WA 3PHWB 4J6IA 2CS4A 2NR2A 4W9DA 1Z2MA 2RGFA 3DVNV 4JIOU 1OTRB 3QARA 3WA0A 3NZUA 5D7GA 3QAQA 4WJNA 5JH5C 3MJWA 4FHJA 3B0AA 3RYTA 2RD0A 1UELA 2M17A 4RMAA 2NCNA 2K39A 2WX0A 2FCQA 2N9EB 3KH0A 5AZFA 3C0RB 1RFAA 3OAWA 5DCNA 4NJ7A 2OOBB 4M8NA 3UQAA 1OEYA 2LI5A 4KDLB 3W1SA 3ZDMC 2CHZA 2K8CA 5JZEB 1XQQA 4W9JA 1WE7A 3HM3A 3QCAA 2KMAA 4ZYNA 3APFA 3EECA 4K7WA 3O65B 4XZ4A 1WJ4A 2K1FA 4AJYB 1R4MI 4MDKE 2FCMA 5E6PA 4GMVA 4DDID 2KMCA 4F8CB 3QQ8B 3SHQA 2L7RA 3ZRCA 3M62B 2IO2B 2KO3A 2ZJDA 2DZJA 2ZNVB 4WWOA 1GC6A 2KXJA 3ZDTA 5LXIB 3QA8A 2G4DB 4W9HA 4G0NB 3N3KB 1WF9A 2PJHA 4BKGA 4DDGD 1T0YA 3VUWA 4JGHB 1FXTB 4HPMB 2MBBB 3KUDB 3IBEA 2FNJB 4K1RB 2KWCA 5CHVC 4HDOA 4PYUA 1P98A 2MQJA 4WWNA 1S1QB 2A5UA 3RZWC 2LVOA 2GBKA 3DVGX 3R7RA 2JPHA 3P2BA 2A4ZA 1TTNA 4GOCA 1TBEA 2KTFA 2LXCA 1U4AA 3VTWA 2MP2B 3DCGA 3H6NA 3ZKJC 4MGKE 2KX0A 2G3QB 4MGZE 4KIKA 1ZW7A 3PGEA 4ANUA 2K8HA 2CHWA 1E7VA 1E8YA 2CR5A 2FIFA 3Q3JA 1XT9B 1G6JA 2JZ3B 2J0KA 3ZRFA 1V2YA 2KTRA 3ZNGC 5CX3A 5TR5A 2BF8B 3ECIA 4WQOB 2KWVB 3RCZA 3W1SC 4ANWA 3ZTDA 1LM8B 1R4NI 3LJ3A 2MLBA 1V49A 4FJYA 4DHJB 3EHVA 1LFDA 3JSVA 2V1YA 4JLCA 4WWPA 1UD7A 5J17A 2LVQA 3WALA 3K9OB 3RUIB 3BY4B 2ZPNA 3L08A 1M94A 2L0TA 4II3B 3PREA 1YQBA 5KHOA 3WAOA 5CHFA 3L10B 2AL3A 2EKEC 5AZHA 3PS6A 2KJHB 2ZZPB 2KJRA 1WX9A 2XEWA 3T9LA 4B95A 5C1ZA 4KSKC 2ZPYA 2LXAA 5J2RA 5FR6A 5J18A 2C60A 3PLVA 1V5OA 1WH3A 3PRZA 4BVUC 4DK5A 4HPLB 3EC8A 4PS8A 2IZVB 3OLMD 1Q0WB 2MP2A 1YX5B 2KQSA 3L16A 2HE7A 3V60A 3H7PB 2ZVOA 2DENB 2BWFA 3IVFA 4I6LB 2L0FA 2K6QA 1H8CA 1EO6A 1NI2A 3VH3B 2KC2A 1Q1OA 2MWSB 5KHQA 1UBQA 1SIFA 2NBWB 4NQKE 3AI5A 4ZRKA 1D3ZA 2HJ8A 4BFRA 4W9LA 1L7YA 3VVWB 3PSEB 2FIDA 2AEHA 3K9PB 5AEKB 3ZNID 3V6EB 2RR9A 3A4RA 2LWPA 3KYDD 4ZRIA 1WM2A 2LGXA 2N7EA 1E8WA 4PS7A 2Y5BB 3VTVA 1IYFA 2D3GA 2GBJA 3L54A 4G11A 1KJTA 2GBNA 3V6CB 3I3TB 3ZLZA 5DPTA 2KDIA 1S3SG 4I6PA 1OEYJ 4E74A 2JRHA 2WX1A 4ANXA 1WMHB 2ZNVC 2KFKB 1V6EA 2B3AA 1GUAB 2I1JA 2Z59B 3A33B 2G4SA 4FJVB 3M95A 3VAWA 2KKCA 4JL9A 4IM3A 2WYQA 4KIKB 1AARA 5IAAC 4TUUA 3LDZE 4DHZE 4HCNB 4K81A 2BYVE 4DBGA 1E7UA 2EMTA 4M8MA 3H7PA 4GB9A 4HWIB 3A9JA 3UGBB 3ZIMA 2N1VA 3KUZA 2DAJA 2KTRB 4EFOA 2BPSA 2CKHB 5GMVA 1UZXB 2DX5B 2JT4B 4BKSD 2KN5A 1P1AA 3PRPB 4EKUA 2IYDB 2KDFB 4HVBA 2C9WB 4ANVA 2IY1B 1J19A 4JQWC 3JSVB 4FULA 3NHEB 4II2B 2NBUA 4EZKA 3WAMA 3MTNB 3V62A 4K7UA 3CSTA 4W9EA 1H4RA 4E71A 2BKRB 1UBIA 3M63B 2WWZA 4EEWA 1ZGUB 1WM3A 3X23A 1KOTA 4EUTA 4ICVA 2LUEA 3KUCB 2MCNB 5LXHA 2XK5B 3S2AA 2KDEB 3JVZX 3IHPC 1F9JA 1E8XA 3JYUA 3KVFB 4AP4C 4BOZB 2J0MA 3U7DA 3Q3FA 4GGQA 2KANA 2C7MB 3VDZA 2FAZA 1WMHA 2L76A 3RD2A 2KFKA 5G55A 2D2QA 3PHXB 2AWTA 3X0WA 1I42A 3SD5A 3PV1A 4E3CA 4ZDVA 2MBHA 3UF8A 3SDLC 2C7NB 1KM7A 4IG7B 1YJ1A 3BINA 2JF5A 2GOWA 1P9DU 1TGZB 3VH4B 4EZLA 3V61A 3UINB 2MSED 2KLCA 1UGMA 1V81A 5DPWA 2YLMA 2KC1A 2KWUB 1A5RA 3DDCB 1GJZA 3HHMA 2LD9A 1E90A 1OGWA 3D32A 3UIOB 3QHTA 1WZ0A 2LRUA 2ZVNA 1WYWB 3HM6X 3ZUNA 3R7QA 3AULA 2O2VB 2BKFA 1CMXB 4P7IA 3QJZA 2J0JA 4XC2A 3DPDA 2IY0B 3ZTCA 2LJ5A 4MJSB 4FADA 2BYEA 1WGDA 2C5LC 3AU4A 3VXWA 3ML8A 3IFWB 4CYEA 2DAFA 4TQ0A 2BYFA 2XK5A 2O6VD 2V4LA 3IG3A 4WJPA 2LRWA 4BKTA 2CU1A 1L2NA 1LXDA 4IC7B 4IWPA 2FCSA 3OJ3A 4KSLC 2RPQA 5AZGA 3R3MA 4TKNA 3WIMA 4DWFA 3QK0A 2FCNA 1SGHA 1WXVA 4IWQA 4PYZA 2NBVB 2NPTB 3B1LX 3TJPA 2CHXA 5L83A 4KDIC 1EF1A 3GZNI 4BKSA 2D07B 4A20A 2JWZA 3A9JB 4IUMB 2JXXA 3ML9A 4HJKA 4G50A 4LDTD 1WRDB 5BO4B 4GDKB 3NY5A 3H1UA 1LQBA 1EUVB 4G3XB 4MELA 1KLVA 2JY6A 4GIVA 4FHKA 5JHAA 1V80A 4NJ6A 4EZJA 3B08A 3CF6E 1E8ZA 2LGYA 2OJRA 3M3JA 4WJQA 4TQ1A 2JRIB 2KOXA 2RSUA 3ONSA 2O2VA 4NPNA 3TL5A 4F1SA 2GBMA 1J8CA 1BT0A 1V86A 2KHWB 4MJSA 3AXCA 1PQSA 2K8BA 1TZ1A 2J7QB 2MX2A 3RZFA 4IWOA 2NVUI 2ZCBA 4HK2A 2KVRA 4MM3A 1XD3B 4W9FA 4W9CA 3L17A 1WJ6A 2UWQA 3DVNU 2W9NA 4IW0A 5D2MB 1J0GA 4EOYA 4AWJA 5JHBA 5EDSA 1WJNA 2UYZB 3QWZB 2HTHA 1WFYA 2DHZA 3A1QA 3UIPB 4DHZB 4K7SA 5DPRA 4I6NB 4NAWB 3APDA 2R2QA 4URKA 3NOBA 1Y8RC 2NPTA 2QHOA 4B9KA 1WR1A 4IM2A 5IA7A 4GN1A 2KZRA 1QZEA 3DBHI 4FLHA 4OVUA 2PE6B 5LLIA 3ZO5B 2LASA 3DBSA 1I35A 5E6NA 4AJWA 2M0XA 2KLGA 3APCA 3VFKA 1X1MA 1OQYA 4GDKA 1C3TA 1YX6B 3DVGY 3H9DA 2WDTB 3TMPB 3N32A 1NBFC 3JW0X 4OVVA 2KX3A 1ISNA 3TBLD 2BGFA 3PRMB 2O6VA 2M8SA 3H7SA 1WE6A 1K8RB 4W9KA 2MRPA 1VCBA 5L95C 2EMSA 2M1MA 3KW5B 1UH6A 1WGHA 3PVLA 4KVGB 1IPGA 3CSFA 4DXAB 3U30A 3QX1A 4WJOA 1WXAA 4PS3A
chains in the Genus database with same CATH superfamily
4BOSC 2SAKA 4MSQB 2WXQA 4KZCA 2DYBA 3BZDB 5AUKA 4B6WA 2WXHA 1AYFA 3VUYA 4BBNF 1YIWA 4IKGA 4X57B 4ZHOA 5CTRC 4GDLB 3AH7A 3B2GA 2IO3B 3VR8B 4DHJD 2KDBA 4HROA 1HTOA 5E6OA 1V5TA 1WXSA 3Q8CA 2RMMA 1GNUA 1FFVA 2KNBA 3VTUA 2PW9A 2KQ7A 1RFKA 1P3QU 1RRBA 4MEMA 4LNNA 5BMGA 2BBCA 5C23A 1WR6E 2M4NA 1TS2A 2WLBA 3GOEA 3A1QB 4US8A 3CMMB 1ZKHA 2BWES 3ZYYX 2BVCA 1RYJA 4L23A 3RNAC 1XXGA 1FEHA 2KK8A 3PPAA 3R66C 1WYGA 3DBRI 1WGGA 4P16A 4GXBA 4OVZA 4YSXB 1L0YB 4XX5A 1KTKA 1OQRA 4FA6A 1FIQA 2Y5CA 2N7DA 2Y5PA 3AEEB 2HD5B 1ZDVA 3ZW3A 3DWMA 3AB5A 1N6ZA 5MPOA 2N9LA 1C4AA 5G2NA 1YJIA 2YEPB 1MPEA 2Q5WD 3DBLI 5DPSA 1C76A 1N5XA 1FNWA 2KD0A 2L83A 3TCAA 4KGTA 2ZEQA 1DOYA 4HJGE 2AL6A 3RT3B 3KYCD 2WU2B 4MGIE 1WI0A 3PHWB 4J6IA 2NR2A 4LNKA 3QARA 1B9RA 3NZUA 3V05A 1XF5L 2RD0A 4RMAA 2K39A 2FCQA 2N9EB 2JSVX 2QILA 1NYRA 3C0RB 4NJ7A 1F1HA 4RCOA 2PTLA 4LLGM 2QC8A 1LGRA 1TIFA 4KDLB 3W1SA 1XQQA 4W9JA 1STEA 4XZ4A 3O65B 1WJ4A 1QQRA 4F8CB 3SHQA 1N61A 3ZRCA 3M62B 2IO2B 2ZJDA 1HEZE 4BKGA 3N3KB 3VUWA 1FXTB 4CQNA 3DBRB 1MHXA 2MQJA 3ZJTA 4JPSA 1V1OA 1AW7A 1ZXHA 5AUIA 1SBBB 1SJED 3VTWA 2MP2B 3DCGA 3H6NA 2KX0A 1ZW7A 4ANUA 2GB1A 2K8HA 3DBLB 1T3QA 2FIFA 2QIEB 1G6JA 3ETRA 5TR5A 3CWIA 3W1SC 4ANWA 3W5VB 3EHVA 1LFDA 5KHOA 3PREA 3WAOA 2BTEA 4XYCA 2ZZPB 2KJRA 1D5MC 4KSKC 2KYWA 2LXAA 5C1ZA 2C60A 2INPE 2OJWA 4BVUC 1D6EC 4HPLB 2MH7A 3OLMD 2BW2A 1YX5B 2KQSA 3L16A 3V60A 2DENB 3KWLA 5GXGB 3DHHC 1Q1OA 5KHQA 1V1PB 1SIFA 4NQKE 2W54A 3FKYA 2MEKA 2WXPA 3V6EB 2HJ1A 5G5GA 4PS7A 2KAJA 4K3BA 2GBJA 1IYFA 3ZLZA 3AE8B 2KDIA 1OEYJ 1WMHB 2KFKB 2B3AA 2Z59B 2VZKB 3GP7A 3M95A 1GB4A 1HXYD 4TUUA 3LDZE 2BYVE 3I9V1 4OZBA 4GB9A 1KLGD 2D3BA 3U52E 2DAJA 2CKHB 4OHJA 3NJTA 2BS2B 3PRPB 1P1AA 2IJ0A 2YEPF 2IYDB 4ANVA 1TS3A 2IY1B 4FULA 3NHEB 4EZKA 2NBUA 4H2AA 3WAMA 4AS1A 2GRIA 4LTUA 3V62A 2W82A 1QF6A 1UBIA 2WWZA 1ZGUB 1WM3A 1KOTA 4ICVA 3KUCB 5LXHA 2WXKA 2KDEB 1QT9A 3JVZX 3NVYA 1XLOA 4GGQA 3VDZA 4E3CA 3PV1A 2MBHA 2SEBD 3SDLC 3RNCC 3BINA 1PGXA 1D4BA 1XCQL 3UINB 2JYTA 1V81A 2GI9A 2YLMA 1CK1A 2PKOA 2ACZB 2KWUB 3FAHA 1GJZA 3HHMA 2J52A 3UIOB 3NVZA 2ZVNA 1ROEA 2JU6X 1WYWB 3HM6X 3KWVA 3R2IA 2O2VB 3QJZA 4R3DA 4WH4A 2IY0B 4MJSB 2BYEA 2LHDA 2K0PA 2L1AA 4TQ0A 1ZOYB 2BYFA 4MT5A 2V4LA 3IG3A 2CU1A 2JXTA 4IWPA 4TKNA 2FUG1 4AQ7A 3TJPA 1SXTA 4M00A 4BKSA 2D07B 2JWZA 4IUMB 2JXXA 1JQ4A 1WSPA 3ABVB 4HJKA 1N60A 2IGDA 1EUVB 1UF0A 2NTTA 2JY6A 4Q2JA 1ET6A 1TKYA 2BS3B 2OJRA 2LGYA 4L1BA 1ZE3D 4YWGG 2MJDA 2EELA 1I4QA 4C7ZA 3AXCA 5IP4D 2J7QB 2MX2A 4YXDB 2Y3AA 4W9FA 2CU3A 1WJ6A 3MP9A 1C79A 2W9NA 4DXGA 3MC0B 5D2MB 5JHBA 1WJNA 3QWZB 1JW9D 5E6JA 2AQ3B 3UIPB 4DHZB 1BMLC 4NAWB 3APDA 3EGRA 2NPTA 4B9KA 3AEFB 2IGGA 4GN1A 2UU7A 1FCLA 3DBHI 1AN8A 2M0XA 1X1MA 4GDKA 3H9DA 1MJDA 2DWQA 2WDTB 4RH6A 4LNOA 1CQVA 2XNAC 2O6VA 3H7SA 3OG5A 3KW5B 3B9JA 1QOBA 3CSFA 1P7EA 1I7HA 2WXJA 4WJOA 2LGDA 3CIRB 4IDIA 2K6DB 1GC7A 3TEYA 2RDBC 1IP9A 3QC8B 2K25A 2Z0EB 3Q3NC 1TYGB 1WXMA 3U8ZA 1TS5A 4FBJB 4NJCA 2MW5A 3RNGC 3ENEA 2EKIA 2GBRA 2MA9B 1VD2A 4KV2A 4CO7A 5HKHA 1JWSD 2C7HA 1RM6C 3EFUA 1P0RA 3T8MA 1EM7A 3KQ4A 5T8IA 3MJ5A 2V3SA 1VZ6A 3VRAB 1P7FA 3MHSD 2JUOA 1NDDA 4HXDA 3SU8X 1SF0A 1UWMA 3AU5A 4MSMB 2V3PA 2ZW0A 4US9A 1C9FA 2IO1B 4IM0A 1VRAB 1FCCC 2NS5A 3WANA 3UI3A 2D3AA 1WIAA 1YD8U 1UNSA 1WJUA 3NRZA 4YSZB 1YNTE 2V9HA 3PLUA 3DBHB 3U4EG 1Z5SB 1JWAD 4S0RA 2BB5A 1XEEA 2KT7A 3TIXA 3Q69A 4GDLA 4AOFA 2LGSA 1LO5D 4LJPB 5EE1A 4HLEA 2O6VB 1T6BX 1E5WA 4RM8A 2ZCCA 2MBEA 2LFIA 1KH0A 2V4IB 2Z0DB 1FRRA 2G45B 3GE3C 3ALBA 5D6JB 2AYOB 3TEXA 1F2RI 1FM0D 1NEKB 4WAAA 1NYQA 2R61A 3N1ZC 3IXSA 1WX8A 4C7YA 3EFCA 4W9DA 1Z2MA 4PT5A 4JIOU 3LYYA 3NG0A 5JH5C 1SEBD 3P63A 1I4GA 4A55A 2IGHA 1UGJA 1TT5B 5AZFA 1JROA 2VH2A 4M8NA 3UQAA 2PLPA 1SE3A 3QCAA 2AQ2B 2L32A 1R4NB 4AJYB 3ZXRA 1R4MI 5E6PA 4GMVA 4DDID 2KMCA 3QQ8B 2L7RA 3FILB 5C2TB 2KO3A 3P4QB 4YSYB 2RDGA 2ZNVB 2WXRA 1F2RC 1I4XA 4DDGD 4JGHB 2I38A 3IBEA 2FNJB 4KKIA 4WWNA 2A5UA 3RZWC 1QILA 2LVOA 3AE9B 2IPKD 4XGAB 2KTFA 4N6EB 3ZKJC 1V8CA 2WXGA 2HTME 1E8YA 1V2YA 2KTRA 3BYTB 3ZNGC 5CX3A 5C3JB 2BF8B 1V49A 3JSVA 2INCC 2I2YA 3WALA 3NS1A 3RUIB 3ZGZA 2ZPNA 3L08A 4II3B 1YQBA 3L10B 2AL3A 5AZHA 1FXAA 2KJHB 5J2RA 5FR6A 3AN1A 3PLVA 4DK5A 1DGJA 3EC8A 4PS8A 1Q0WB 2MP2A 1PDXA 5IKCM 1HA5A 2HE7A 3H7PB 1E9MA 2E3TA 1R4MB 1XCTL 2NBWB 1D3ZA 4BFRA 4W9LA 1L7YA 2W55A 3VVWB 1TS4A 2AEHA 3K9PB 1F0ZA 2RR9A 1WM2A 1D5ZC 2LGXA 3VTVA 3L54A 4G11A 2K22A 3I3TB 5DPTA 2W3RA 3Q6BA 4I6PA 2WX1A 1IGCA 4ANXA 2MHJA 4RGNA 1JRPA 5FKAC 4FJVB 2KKCA 4JL9A 2WYQA 2ONQA 3PZ7A 3A9JA 3UGBB 2N1VA 3KUZA 1DOIA 2KTRB 1FNUA 5GMVA 3MFGA 1UZXB 3I63C 1V1PA 1MVKA 1TKEA 3DHIC 3URYA 2C9WB 3PZ8A 1J19A 3JSVB 4II2B 3TSSA 4W9EA 1H4RA 3R8BA 4RGTA 2BKRB 2Z8LA 2LUEA 1ZDXA 2MCNB 2XK5B 3S2AA 3IHPC 3JYUA 1FFUA 1FRDA 2KANA 2C7MB 1WMHA 5BYRA 2KFKA 5G55A 3PHXB 2AWTA 3SD5A 2PVOD 1SIJA 2BT6A 2JF5A 1TGZB 2MJ3A 3V61A 2BQQA 1EU3A 2QSDA 2KC1A 4S17A 4KKJA 1A5RA 1WGKA 2LD9A 1NENB 5G5HA 1OGWA 2H88B 3QHTA 3Q8AA 3ZUNA 3AULA 4XC2A 4FADA 1C78A 2C5LC 2DAFA 4TSSA 2WXFA 2D3CA 1A70A 4IC7B 3OJ3A 4KSLC 3WIMA 3QK0A 4PYZA 4RGOS 4IWQA 2NBVB 1EF1A 3GZNI 3A9JB 1ET9A 1GB1A 1L6VA 4DXFA 1QKZA 4B0EA 1KLVA 4KGSA 3AE1B 5HI1A 3CF6E 1E8ZA 2FE8A 3M3JA 1N63A 2WDRB 4WJQA 4TQ1A 2KOXA 1JWUD 4XDDA 2O2VA 4NPNA 4P1BC 3TL5A 4F1SA 4C4VA 3P4PB 3RPFC 2KHWB 4MJSA 1TZ1A 2K8BA 2NVUI 2ZCBA 3RNBC 3P1MA 3P42A 4W9CA 2UWQA 2OHFA 3AE4B 3BYYB 4M0WA 3EA6A 5EDSA 1SSNA 1WFYA 2LUMA 4K7SA 1PGBA 3BK1A 2JZPA 2R2QA 2JQRB 3NOBA 5TSSA 4A90A 1WR1A 4IM2A 4ARCA 3N1XC 1QZEA 1R7SA 4FLHA 2PE6B 5LLIA 4AJWA 3APCA 2IDYA 1OQYA 3FC4A 3AMZA 2PIAA 1L0VB 3JW0X 2KX3A 3AE7B 3TBLD 2LGIA 1WE6A 4W9KA 2MRPA 1VCBA 4NAMA 4HKQA 1M4VA 1OFFA 1L6UA 3ZNHB 3AE3B 4N59A 1EWCA 1GG3A 2N9PC 3A9KA 3GZNB 4RF1A 4JE3B 3RULA 1WY8A 2WXIA 4LNFA 4NAWA 2L8JA 2DBYA 2D5GA 4ASWC 2KJ6A 2VRRB 1C1YB 1BXTA 2PMVA 3ZVVA 1PUTA 4YT0B 3HK0A 2GMIC 2IBIB 4NQLB 2H89B 4C4VB 3UQBA 2LVPA 4F7ZA 2ASQA 1ACCA 2PEAA 4N9F4 1EF5A 2XN9C 3VQIA 2DYMA 5HG2A 4YTMB 5D3IB 3DOWA 3OJ4B 4JX1C 2D10A 4M0WB 3Q14C 4EE2A 3KLSX 5I4DA 3P4SB 4ZRQA 2N4FA 1Q5WB 4MGYE 1ZXIA 3ZNZB 2I1KA 4TV3A 2IO0B 3RNFC 4M01A 2TSSA 3NS8A 2L05A 1DYQA 2BS4B 1UUPA 1QOAA 2R2OA 4GU2A 1V97A 1QLBB 3EUB2 4WURA 2DYOA 3NUHB 4ICUA 3VHTC 1SB3C 3PT2B 2XBBC 4BBNC 2N9XA 2V3NA 3VUXA 3A9KB 1WZ3A 4WAFA 4OZCA 4LDTB 2PPHA 2LZ6A 2QMTA 4HCPB 1RAXA 1JALA 4J3OD 2CS4A 1I4PA 1VJKA 3O13A 4BZAA 2KN4A 3WA0A 4WIPA 3QAQA 4WJNA 1NI3A 4ZRPA 3RYTA 1PYWD 4RFBA 1UELA 2M17A 3KH0A 1RFAA 1OEYA 1KLUD 1JMLA 3RI7C 3ZDMC 2CHZA 3NVVA 1WE7A 1FD6A 2KMAA 1TKGA 3APFA 1D5XC 1MHHE 2DNFA 2K1FA 4IOIE 3SFEB 4MDKE 3VRBB 1GPXA 1E7PB 4WWMA 4WWOA 1GC6A 2KXJA 4D2KA 5LXIB 3QA8A 2G4DB 3HUIA 4G0NB 4FXCA 2QJLA 1T0YA 3IT4B 4ZYSA 3KUDB 4K1RB 5CHVC 3Q2AC 1P98A 4PYUA 5EE3A 1MI0A 1YMHE 2GBKA 3R7RA 5H92C 2JPHA 3P2BA 5IOIA 1TTNA 4GOCA 3MHZA 1FXIA 3RMKC 4MGKE 2AQ1B 4TMAB 4XWWA 2WGSA 1E7VA 2CR5A 5D3DA 5BYSA 1XT9B 2J0KA 4ARIA 3ZRFA 2G9HD 2RPVA 2CJOA 3ECIA 4WQOB 2BB6A 1LM8B 1R4NI 2J42A 2MLBA 3LJ3A 4FJYA 4DHJB 1YN5A 1YOVB 4JLCA 4WWPA 3FILA 3K9OB 1QOGA 3BY4B 1M94A 4YTNB 5CHFA 1B1ZA 3PS6A 1K53A 3T9LA 2XEWA 4B95A 2ZPYA 3SR6A 5J18A 1V5OA 1WH3A 4JWUC 2ICIA 5HHDG 4XWTA 3T3NA 1FPYA 4I6LB 1WWTA 1K52A 2L0FA 2K6QA 1H8CA 1EO6A 1NI2A 3VH3B 2KC2A 1UBQA 4MH8A 5H8YE 4ZRKA 3RFZB 4K3CA 3MC9A 4O1NA 2X38A 3KYDD 1YJJA 4ZRIA 1E8WA 2Y5BB 3N20C 2D3GA 3V6CB 4A8XC 1S3SG 4E74A 2VH1A 1L4DB 3BIID 1XO3A 2ZNVC 2I1JA 2G4SA 3VAWA 2M0AA 2RDHA 3NZ3A 1AARA 1TZOA 2E6XA 4ZHPA 5IAAC 2WU5B 4HCNB 4DHZE 4DBGA 3H7PA 1ENFA 4EFOA 2JT4B 5EE0A 4PK1A 4BKSD 1J7BA 2KDFB 4REZA 3OWEB 1HZ5A 4JQWC 1E6EB 1GAQB 3MTNB 3CSTA 1F52A 4E71A 3Q8EA 1JWBD 3M63B 4EUTA 4DQOC 5HFYA 4BOZB 2J0MA 3U7DA 2KACA 4HKZE 3RD2A 2D2QA 3X0WA 1I42A 1T0QC 4ZDVA 2X8XX 3E9SA 4XDCA 5EE9A 4MACA 2GOWA 3IAS1 1FO4A 1P9DU 3VH4B 1T0SC 2MSED 1UGMA 2J4XA 1XLPA 4P6VF 1E0ZA 1WZ0A 1TY0A 3I57A 4B0MA 2J0JA 3ZTCA 3AE5B 2QEJC 1WGDA 3AU4A 3VXWA 3ML8A 3IFWB 4CYEA 3PO0A 4MM3B 1TJEA 2XK5A 2O6VD 2WXNA 4BKTA 2N0SB 1L2NA 1LXDA 1ESFA 2FCSA 1HTQA 5AZGA 4P1CC 1YQ4B 1SGHA 1OQQA 4LNIA 2CHXA 4KDIC 2M19A 3ML9A 2JX5A 4G50A 5BO4B 1Y56A 3NY5A 2WS3B 2OEDA 1VZ8A 1LQBA 4G3XB 1C4CA 4GIVA 4FHKA 5JHAA 1V80A 4EZJA 3B08A 3HVDA 1CZPA 3TEZA 3E56A 5FR3A 1V86A 1PQSA 5BMHA 4IWOA 2LJIA 4HK2A 1XD3B 3L17A 4AWJA 2UYZB 2HTHA 2KQ4X 3I5JC 4URKA 1YQ3B 1N5WA 1Y8RC 1ZPSA 2QHOA 3SFDB 2KZRA 3W5UB 2LMCA 4OVUA 3BVMA 3ZO5B 1I35A 2INNE 3AV8A 2KLGA 3VFKA 1CJEA 1C3TA 3V3XA 3AE6B 3TMPB 4OVVA 1NBFC 1ISNA 3MC8A 2BGFA 3PRMB 3GS2A 2JYEA 2WXOA 2K5PA 1IGDA 2EMSA 5L95C 2M1MA 4HRSA 4KVGB 3ZQ4A 4DXAB 3QX1A 2QDFA 3Q3OC 2JVCA 2YVCA 3PZDA 1PGAA 1SE9A 2JZZA 2FUHB 2GLSA 3A4SC 3H8HA 3TEWA 5D94A 4KZ0A 2MBQA 1JRUA 1VLBA 1K50A 2WXLA 3U2SC 1SE4A 3DHGC 1ZUD2 3AEAB 1C4PA 1HZ6A 1HE8A 4UDUC 4W9GA 4LJOB 4ZRJA 3AEDB 2L3ZA 1WGRA 1WX7A 3GE8C 4RM9A 2LHEA 4MH0E 4HDQA 4NZLB 3C8YA 1RLFA 3SEBA 2B76B 4CHKA 3W1YA 4FN2A 4A3OA 3L4PA 2ON8A 1L4ZB 2DZMA 1WXQA 3DQVA 3L13A 2KFJA 3Q8BA 4LCDE 2DZKA 2PE9A 1WGYA 1FMAD 2WDVB 3PTFC 3L0WB 1YN4A 3AEBB 4YL8A 3U7ZA 1EU4A 1MFWA 1MG8A 5JXVA 3WAPA 4NNJB 4AUQC 2WP9B 1XLQA 4OZAA 4A3PA 3AECB 1VR9A 3RNEC 1AWDA 3NZSA 2D11A 1GOZA 2K9XA 3QIJA 4GSWA 4ACFA 4XE0A 3HIZA 4W9IA 2L00B 1QOFA 2MBOA 1V9JA 3VR9B 2L52A 4C00A 4YTPB 3W9CB 1L5PA 3N30A 1JWMD 2DZIA 3AE2B 5FK9C 1KF6B 4FJZA 2REXA 4NY0A 4L2YA 1IUEA 5CHWA 2N1WA 3AEGB 2RGFA 3DVNV 1OTRB 5D7GA 1SE2A 3Q3MC 3MJWA 4FHJA 3B0AA 3N1YC 2ZW1A 1E10A 2WHIA 2NCNA 2WX0A 4M02A 1J7AA 3OAWA 5DCNA 2PVGC 2OOBB 5LNK1 1KRHA 2JWUA 2LI5A 4C56C 2K8CA 5JZEB 3HM3A 4ZYNA 2KVZA 3EECA 4K7WA 4WQMA 3IT6B 2FCMA 2KMMA 2V0GA 4A9AA 3HVZA 2M56B 3T3OA 2DZJA 3ZDTA 4W9HA 3Q8FA 1WF9A 2PJHA 1FNVA 1I4RA 4HPMB 2MBBB 1TY2A 2KWCA 4HDOA 4ZOHC 1S1QB 3C19A 5IO9A 3DVGX 2A4ZA 1PFDA 1ZP0B 1J7CA 1TBEA 3RN9C 2LXCA 1U4AA 4GLSC 4OW0A 2G3QB 3BVGA 4MGZE 4KIKA 3PGEA 3J9CA 2CHWA 3Q3JA 2JZ3B 2LEKA 4LK0M 4RGMA 2KWVB 3RCZA 3ZTDA 3BWUD 4KX6B 2V1YA 5J17A 1UD7A 2LVQA 2J53A 1T5XD 2L0TA 3P4RB 1JCKB 2EKEC 4HEA1 1C77A 1WX9A 2NTSA 3PRZA 2WQYB 2IZVB 3NVWA 2ZVOA 2BWFA 3IVFA 2VZKD 2MWSB 1EWYC 3AI5A 2HJ8A 3PSEB 1YN3A 2FIDA 3ZJVA 1KFYB 5AEKB 3ZNID 3A4RA 2LWPA 3GB1A 4RNAA 1IBXA 2N7EA 2N7JA 1KJTA 2GBNA 3BVZA 1N62A 2JRHA 1NVID 1DOXA 1SJHD 1V6EA 1GUAB 3A33B 3AM9A 4IM3A 4KIKB 4K81A 1E7UA 1Q10A 2EMTA 2KDMA 4M8MA 3ZIMA 4HWIB 5IN7A 3BK2A 2WXMA 2BPSA 3HRDD 2DX5B 1XLNA 5BYQA 2KN5A 4EKUA 4HVBA 1VDVA 2NMQA 4A6QA 4K7UA 4EEWA 3X23A 1F9JA 1E8XA 3KVFB 4AP4C 3Q3FA 2DLBA 2FAZA 2L76A 2AX5A 1L0XB 2QCZA 3ZJUA 3UF8A 2C7NB 3N9YC 1KM7A 4IG7B 1YJ1A 2FBWB 4EZLA 2KWDA 2KLCA 1HQRD 5DPWA 3DDCB 1E90A 2BYTA 3D32A 3W2DA 4KGRA 2LRUA 3LB8C 3R7QA 2BKFA 1CMXB 4P7IA 1IBXB 3DPDA 2LJ5A 4HPPA 3B2FA 2G1EA 1K51A 4WJPA 2LRWA 1F77A 3WCQA 4ITKA 2RPQA 3R3MA 4DWFA 5BMIA 1VZ7A 2FCNA 1WXVA 2K3UA 2NPTB 3B1LX 2MJEA 5L83A 2CJNA 4A20A 4BAXA 1I4HA 1UWXA 4LDTD 1WRDB 4GDKB 2WNMA 3H1UA 4MELA 4C80A 4NJ6A 2JRIB 3ONSA 2RSUA 2INDC 3TUOA 2GBMA 1J8CA 1BT0A 1BUIC 4N58A 2W3SA 1MG4A 3RZFA 2KVRA 4MM3A 3ZXVA 3DVNU 4IW0A 1J0GA 4EOYA 2DHZA 3A1QA 5DPRA 4I6NB 1RWSA 4JWSC 5IA7A 1T0RC 3LXFA 2LASA 3DBSA 4QAYA 5E6NA 3R2TA 2HDEA 1YX6B 3DVGY 3N32A 1WRIA 3IAM1 4RF0A 2M8SA 1K8RB 2N9KA 3DWGC 3PVLA 1UH6A 1WGHA 1IPGA 2WDQB 3U30A 1WXAA 4USAA 4PS3A
chains in the Genus database with same CATH topology
2LGDA 4BOSC 2K6DB 1GC7A 2JVCA 2YVCA 3ZNHB 3PZDA 1IP9A 1SE9A 1GG3A 3QC8B 2JZZA 4MSQB 2N9PC 4KZCA 2DYBA 2FUHB 2K25A 2Z0EB 3A4SC 3A9KA 5D94A 4KZ0A 4B6WA 1WXMA 1JRUA 2MBQA 3U8ZA 3RULA 3VUYA 4FBJB 4BBNF 2MW5A 1YIWA 1WY8A 3ENEA 4X57B 4NAWA 2GBRA 2MA9B 1VD2A 2L8JA 4KV2A 4CO7A 5CTRC 5HKHA 4GDLB 4ASWC 2IO3B 2KJ6A 2VRRB 1C1YB 3ZVVA 4DHJD 2C7HA 2KDBA 5E6OA 3EFUA 1P0RA 1HE8A 3T8MA 4W9GA 2V3SA 4LJOB 4ZRJA 1V5TA 1WXSA 2L3ZA 3HK0A 1WGRA 2GMIC 2IBIB 1WX7A 3MHSD 4RM9A 4NQLB 2JUOA 1NDDA 4MH0E 4HDQA 4HXDA 3SU8X 1GNUA 2LVPA 3UQBA 2KNBA 3VTUA 2ASQA 4F7ZA 4N9F4 2PEAA 1EF5A 3VQIA 2DYMA 3AU5A 4MSMB 2KQ7A 1RLFA 3DOWA 3OJ4B 2IO1B 4CHKA 4IM0A 1P3QU 2D10A 1RRBA 2NS5A 4MEMA 3W1YA 3WANA 4FN2A 4M0WB 4A3OA 5C23A 1WR6E 1WIAA 1YD8U 2M4NA 3GOEA 3A1QB 1WJUA 3CMMB 1ZKHA 2BWES 2DZMA 3DQVA 3L13A 2KFJA 2N4FA 3PLUA 4LCDE 1Q5WB 2DZKA 1WGYA 2PE9A 1Z5SB 4MGYE 3ZNZB 3PTFC 3L0WB 4YL8A 2I1KA 4TV3A 2IO0B 1MG8A 2KK8A 3NS8A 4NNJB 3WAPA 2L05A 3TIXA 4AUQC 4GDLA 3PPAA 4AOFA 3R66C 4A3PA 2R2OA 3DBRI 3NZSA 2D11A 1WGGA 4GU2A 4LJPB 4HLEA 4GXBA 2O6VB 4XX5A 1E5WA 4GSWA 3QIJA 2ZCCA 4RM8A 4FA6A 2MBEA 2N7DA 3HIZA 4W9IA 2L00B 2DYOA 2HD5B 2Z0DB 4ICUA 3VHTC 2MBOA 2G45B 1V9JA 3ZW3A 3PT2B 2XBBC 3ALBA 4BBNC 5G2NA 2N9XA 3DBLI 5DPSA 3VUXA 3A9KB 3N30A 2KD0A 2DZIA 1WZ3A 5D6JB 2AYOB 4LDTB 2PPHA 3TCAA 4WAAA 2LZ6A 2ZEQA 2AL6A 4HCPB 3RT3B 3KYCD 4FJZA 2REXA 4MGIE 1WX8A 4NY0A 1WI0A 5CHWA 1RAXA 2N1WA 3PHWB 4J6IA 2CS4A 2NR2A 4W9DA 1Z2MA 2RGFA 3DVNV 4JIOU 1OTRB 3QARA 3WA0A 3NZUA 5D7GA 3QAQA 4WJNA 5JH5C 3MJWA 4FHJA 3B0AA 3RYTA 2RD0A 1UELA 2M17A 4RMAA 2NCNA 2K39A 2WX0A 2FCQA 2N9EB 3KH0A 5AZFA 3C0RB 1RFAA 3OAWA 5DCNA 4NJ7A 2OOBB 4M8NA 3UQAA 1OEYA 2LI5A 4KDLB 3W1SA 3ZDMC 2CHZA 2K8CA 5JZEB 1XQQA 4W9JA 1WE7A 3HM3A 3QCAA 2KMAA 4ZYNA 3APFA 3EECA 4K7WA 3O65B 4XZ4A 1WJ4A 2K1FA 4AJYB 1R4MI 4MDKE 2FCMA 5E6PA 4GMVA 4DDID 2KMCA 4F8CB 3QQ8B 3SHQA 2L7RA 3ZRCA 3M62B 2IO2B 2KO3A 2ZJDA 2DZJA 2ZNVB 4WWOA 1GC6A 2KXJA 3ZDTA 5LXIB 3QA8A 2G4DB 4W9HA 4G0NB 3N3KB 1WF9A 2PJHA 4BKGA 4DDGD 1T0YA 3VUWA 4JGHB 1FXTB 4HPMB 2MBBB 3KUDB 3IBEA 2FNJB 4K1RB 2KWCA 5CHVC 4HDOA 4PYUA 1P98A 2MQJA 4WWNA 1S1QB 2A5UA 3RZWC 2LVOA 2GBKA 3DVGX 3R7RA 2JPHA 3P2BA 2A4ZA 1TTNA 4GOCA 1TBEA 2KTFA 2LXCA 1U4AA 3VTWA 2MP2B 3DCGA 3H6NA 3ZKJC 4MGKE 2KX0A 2G3QB 4MGZE 4KIKA 1ZW7A 3PGEA 4ANUA 2K8HA 2CHWA 1E7VA 1E8YA 2CR5A 2FIFA 3Q3JA 1XT9B 1G6JA 2JZ3B 2J0KA 3ZRFA 1V2YA 2KTRA 3ZNGC 5CX3A 5TR5A 2BF8B 3ECIA 4WQOB 2KWVB 3RCZA 3W1SC 4ANWA 3ZTDA 1LM8B 1R4NI 3LJ3A 2MLBA 1V49A 4FJYA 4DHJB 3EHVA 1LFDA 3JSVA 2V1YA 4JLCA 4WWPA 1UD7A 5J17A 2LVQA 3WALA 3K9OB 3RUIB 3BY4B 2ZPNA 3L08A 1M94A 2L0TA 4II3B 3PREA 1YQBA 5KHOA 3WAOA 5CHFA 3L10B 2AL3A 2EKEC 5AZHA 3PS6A 2KJHB 2ZZPB 2KJRA 1WX9A 2XEWA 3T9LA 4B95A 5C1ZA 4KSKC 2ZPYA 2LXAA 5J2RA 5FR6A 5J18A 2C60A 3PLVA 1V5OA 1WH3A 3PRZA 4BVUC 4DK5A 4HPLB 3EC8A 4PS8A 2IZVB 3OLMD 1Q0WB 2MP2A 1YX5B 2KQSA 3L16A 2HE7A 3V60A 3H7PB 2ZVOA 2DENB 2BWFA 3IVFA 4I6LB 2L0FA 2K6QA 1H8CA 1EO6A 1NI2A 3VH3B 2KC2A 1Q1OA 2MWSB 5KHQA 1UBQA 1SIFA 2NBWB 4NQKE 3AI5A 4ZRKA 1D3ZA 2HJ8A 4BFRA 4W9LA 1L7YA 3VVWB 3PSEB 2FIDA 2AEHA 3K9PB 5AEKB 3ZNID 3V6EB 2RR9A 3A4RA 2LWPA 3KYDD 4ZRIA 1WM2A 2LGXA 2N7EA 1E8WA 4PS7A 2Y5BB 3VTVA 1IYFA 2D3GA 2GBJA 3L54A 4G11A 1KJTA 2GBNA 3V6CB 3I3TB 3ZLZA 5DPTA 2KDIA 1S3SG 4I6PA 1OEYJ 4E74A 2JRHA 2WX1A 4ANXA 1WMHB 2ZNVC 2KFKB 1V6EA 2B3AA 1GUAB 2I1JA 2Z59B 3A33B 2G4SA 4FJVB 3M95A 3VAWA 2KKCA 4JL9A 4IM3A 2WYQA 4KIKB 1AARA 5IAAC 4TUUA 3LDZE 4DHZE 4HCNB 4K81A 2BYVE 4DBGA 1E7UA 2EMTA 4M8MA 3H7PA 4GB9A 4HWIB 3A9JA 3UGBB 3ZIMA 2N1VA 3KUZA 2DAJA 2KTRB 4EFOA 2BPSA 2CKHB 5GMVA 1UZXB 2DX5B 2JT4B 4BKSD 2KN5A 1P1AA 3PRPB 4EKUA 2IYDB 2KDFB 4HVBA 2C9WB 4ANVA 2IY1B 1J19A 4JQWC 3JSVB 4FULA 3NHEB 4II2B 2NBUA 4EZKA 3WAMA 3MTNB 3V62A 4K7UA 3CSTA 4W9EA 1H4RA 4E71A 2BKRB 1UBIA 3M63B 2WWZA 4EEWA 1ZGUB 1WM3A 3X23A 1KOTA 4EUTA 4ICVA 2LUEA 3KUCB 2MCNB 5LXHA 2XK5B 3S2AA 2KDEB 3JVZX 3IHPC 1F9JA 1E8XA 3JYUA 3KVFB 4AP4C 4BOZB 2J0MA 3U7DA 3Q3FA 4GGQA 2KANA 2C7MB 3VDZA 2FAZA 1WMHA 2L76A 3RD2A 2KFKA 5G55A 2D2QA 3PHXB 2AWTA 3X0WA 1I42A 3SD5A 3PV1A 4E3CA 4ZDVA 2MBHA 3UF8A 3SDLC 2C7NB 1KM7A 4IG7B 1YJ1A 3BINA 2JF5A 2GOWA 1P9DU 1TGZB 3VH4B 4EZLA 3V61A 3UINB 2MSED 2KLCA 1UGMA 1V81A 5DPWA 2YLMA 2KC1A 2KWUB 1A5RA 3DDCB 1GJZA 3HHMA 2LD9A 1E90A 1OGWA 3D32A 3UIOB 3QHTA 1WZ0A 2LRUA 2ZVNA 1WYWB 3HM6X 3ZUNA 3R7QA 3AULA 2O2VB 2BKFA 1CMXB 4P7IA 3QJZA 2J0JA 4XC2A 3DPDA 2IY0B 3ZTCA 2LJ5A 4MJSB 4FADA 2BYEA 1WGDA 2C5LC 3AU4A 3VXWA 3ML8A 3IFWB 4CYEA 2DAFA 4TQ0A 2BYFA 2XK5A 2O6VD 2V4LA 3IG3A 4WJPA 2LRWA 4BKTA 2CU1A 1L2NA 1LXDA 4IC7B 4IWPA 2FCSA 3OJ3A 4KSLC 2RPQA 5AZGA 3R3MA 4TKNA 3WIMA 4DWFA 3QK0A 2FCNA 1SGHA 1WXVA 4IWQA 4PYZA 2NBVB 2NPTB 3B1LX 3TJPA 2CHXA 5L83A 4KDIC 1EF1A 3GZNI 4BKSA 2D07B 4A20A 2JWZA 3A9JB 4IUMB 2JXXA 3ML9A 4HJKA 4G50A 4LDTD 1WRDB 5BO4B 4GDKB 3NY5A 3H1UA 1LQBA 1EUVB 4G3XB 4MELA 1KLVA 2JY6A 4GIVA 4FHKA 5JHAA 1V80A 4NJ6A 4EZJA 3B08A 3CF6E 1E8ZA 2LGYA 2OJRA 3M3JA 4WJQA 4TQ1A 2JRIB 2KOXA 2RSUA 3ONSA 2O2VA 4NPNA 3TL5A 4F1SA 2GBMA 1J8CA 1BT0A 1V86A 2KHWB 4MJSA 3AXCA 1PQSA 2K8BA 1TZ1A 2J7QB 2MX2A 3RZFA 4IWOA 2NVUI 2ZCBA 4HK2A 2KVRA 4MM3A 1XD3B 4W9FA 4W9CA 3L17A 1WJ6A 2UWQA 3DVNU 2W9NA 4IW0A 5D2MB 1J0GA 4EOYA 4AWJA 5JHBA 5EDSA 1WJNA 2UYZB 3QWZB 2HTHA 1WFYA 2DHZA 3A1QA 3UIPB 4DHZB 4K7SA 5DPRA 4I6NB 4NAWB 3APDA 2R2QA 4URKA 3NOBA 1Y8RC 2NPTA 2QHOA 4B9KA 1WR1A 4IM2A 5IA7A 4GN1A 2KZRA 1QZEA 3DBHI 4FLHA 4OVUA 2PE6B 5LLIA 3ZO5B 2LASA 3DBSA 1I35A 5E6NA 4AJWA 2M0XA 2KLGA 3APCA 3VFKA 1X1MA 1OQYA 4GDKA 1C3TA 1YX6B 3DVGY 3H9DA 2WDTB 3TMPB 3N32A 1NBFC 3JW0X 4OVVA 2KX3A 1ISNA 3TBLD 2BGFA 3PRMB 2O6VA 2M8SA 3H7SA 1WE6A 1K8RB 4W9KA 2MRPA 1VCBA 5L95C 2EMSA 2M1MA 3KW5B 1UH6A 1WGHA 3PVLA 4KVGB 1IPGA 3CSFA 4DXAB 3U30A 3QX1A 4WJOA 1WXAA 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGD A;  4BOS C;  2K6D B;  1GC7 A;  2JVC A;  2YVC A;  3ZNH B;  3PZD A;  1IP9 A;  1SE9 A;  1GG3 A;  3QC8 B;  2JZZ A;  4MSQ B;  2N9P C;  4KZC A;  2DYB A;  2FUH B;  2K25 A;  2Z0E B;  3A4S C;  3A9K A;  5D94 A;  4KZ0 A;  4B6W A;  1WXM A;  1JRU A;  2MBQ A;  3U8Z A;  3RUL A;  3VUY A;  4FBJ B;  4BBN F;  2MW5 A;  1YIW A;  1WY8 A;  3ENE A;  4X57 B;  4NAW A;  2GBR A;  2MA9 B;  1VD2 A;  2L8J A;  4KV2 A;  4CO7 A;  5CTR C;  5HKH A;  4GDL B;  4ASW C;  2IO3 B;  2KJ6 A;  2VRR B;  1C1Y B;  3ZVV A;  4DHJ D;  2C7H A;  2KDB A;  5E6O A;  3EFU A;  1P0R A;  1HE8 A;  3T8M A;  4W9G A;  2V3S A;  4LJO B;  4ZRJ A;  1V5T A;  1WXS A;  2L3Z A;  3HK0 A;  1WGR A;  2GMI C;  2IBI B;  1WX7 A;  3MHS D;  4RM9 A;  4NQL B;  2JUO A;  1NDD A;  4MH0 E;  4HDQ A;  4HXD A;  3SU8 X;  1GNU A;  2LVP A;  3UQB A;  2KNB A;  3VTU A;  2ASQ A;  4F7Z A;  4N9F 4;  2PEA A;  1EF5 A;  3VQI A;  2DYM A;  3AU5 A;  4MSM B;  2KQ7 A;  1RLF A;  3DOW A;  3OJ4 B;  2IO1 B;  4CHK A;  4IM0 A;  1P3Q U;  2D10 A;  1RRB A;  2NS5 A;  4MEM A;  3W1Y A;  3WAN A;  4FN2 A;  4M0W B;  4A3O A;  5C23 A;  1WR6 E;  1WIA A;  1YD8 U;  2M4N A;  3GOE A;  3A1Q B;  1WJU A;  3CMM B;  1ZKH A;  2BWE S;  2DZM A;  3DQV A;  3L13 A;  2KFJ A;  2N4F A;  3PLU A;  4LCD E;  1Q5W B;  2DZK A;  1WGY A;  2PE9 A;  1Z5S B;  4MGY E;  3ZNZ B;  3PTF C;  3L0W B;  4YL8 A;  2I1K A;  4TV3 A;  2IO0 B;  1MG8 A;  2KK8 A;  3NS8 A;  4NNJ B;  3WAP A;  2L05 A;  3TIX A;  4AUQ C;  4GDL A;  3PPA A;  4AOF A;  3R66 C;  4A3P A;  2R2O A;  3DBR I;  3NZS A;  2D11 A;  1WGG A;  4GU2 A;  4LJP B;  4HLE A;  4GXB A;  2O6V B;  4XX5 A;  1E5W A;  4GSW A;  3QIJ A;  2ZCC A;  4RM8 A;  4FA6 A;  2MBE A;  2N7D A;  3HIZ A;  4W9I A;  2L00 B;  2DYO A;  2HD5 B;  2Z0D B;  4ICU A;  3VHT C;  2MBO A;  2G45 B;  1V9J A;  3ZW3 A;  3PT2 B;  2XBB C;  3ALB A;  4BBN C;  5G2N A;  2N9X A;  3DBL I;  5DPS A;  3VUX A;  3A9K B;  3N30 A;  2KD0 A;  2DZI A;  1WZ3 A;  5D6J B;  2AYO B;  4LDT B;  2PPH A;  3TCA A;  4WAA A;  2LZ6 A;  2ZEQ A;  2AL6 A;  4HCP B;  3RT3 B;  3KYC D;  4FJZ A;  2REX A;  4MGI E;  1WX8 A;  4NY0 A;  1WI0 A;  5CHW A;  1RAX A;  2N1W A;  3PHW B;  4J6I A;  2CS4 A;  2NR2 A;  4W9D A;  1Z2M A;  2RGF A;  3DVN V;  4JIO U;  1OTR B;  3QAR A;  3WA0 A;  3NZU A;  5D7G A;  3QAQ A;  4WJN A;  5JH5 C;  3MJW A;  4FHJ A;  3B0A A;  3RYT A;  2RD0 A;  1UEL A;  2M17 A;  4RMA A;  2NCN A;  2K39 A;  2WX0 A;  2FCQ A;  2N9E B;  3KH0 A;  5AZF A;  3C0R B;  1RFA A;  3OAW A;  5DCN A;  4NJ7 A;  2OOB B;  4M8N A;  3UQA A;  1OEY A;  2LI5 A;  4KDL B;  3W1S A;  3ZDM C;  2CHZ A;  2K8C A;  5JZE B;  1XQQ A;  4W9J A;  1WE7 A;  3HM3 A;  3QCA A;  2KMA A;  4ZYN A;  3APF A;  3EEC A;  4K7W A;  3O65 B;  4XZ4 A;  1WJ4 A;  2K1F A;  4AJY B;  1R4M I;  4MDK E;  2FCM A;  5E6P A;  4GMV A;  4DDI D;  2KMC A;  4F8C B;  3QQ8 B;  3SHQ A;  2L7R A;  3ZRC A;  3M62 B;  2IO2 B;  2KO3 A;  2ZJD A;  2DZJ A;  2ZNV B;  4WWO A;  1GC6 A;  2KXJ A;  3ZDT A;  5LXI B;  3QA8 A;  2G4D B;  4W9H A;  4G0N B;  3N3K B;  1WF9 A;  2PJH A;  4BKG A;  4DDG D;  1T0Y A;  3VUW A;  4JGH B;  1FXT B;  4HPM B;  2MBB B;  3KUD B;  3IBE A;  2FNJ B;  4K1R B;  2KWC A;  5CHV C;  4HDO A;  4PYU A;  1P98 A;  2MQJ A;  4WWN A;  1S1Q B;  2A5U A;  3RZW C;  2LVO A;  2GBK A;  3DVG X;  3R7R A;  2JPH A;  3P2B A;  2A4Z A;  1TTN A;  4GOC A;  1TBE A;  2KTF A;  2LXC A;  1U4A A;  3VTW A;  2MP2 B;  3DCG A;  3H6N A;  3ZKJ C;  4MGK E;  2KX0 A;  2G3Q B;  4MGZ E;  4KIK A;  1ZW7 A;  3PGE A;  4ANU A;  2K8H A;  2CHW A;  1E7V A;  1E8Y A;  2CR5 A;  2FIF A;  3Q3J A;  1XT9 B;  1G6J A;  2JZ3 B;  2J0K A;  3ZRF A;  1V2Y A;  2KTR A;  3ZNG C;  5CX3 A;  5TR5 A;  2BF8 B;  3ECI A;  4WQO B;  2KWV B;  3RCZ A;  3W1S C;  4ANW A;  3ZTD A;  1LM8 B;  1R4N I;  3LJ3 A;  2MLB A;  1V49 A;  4FJY A;  4DHJ B;  3EHV A;  1LFD A;  3JSV A;  2V1Y A;  4JLC A;  4WWP A;  1UD7 A;  5J17 A;  2LVQ A;  3WAL A;  3K9O B;  3RUI B;  3BY4 B;  2ZPN A;  3L08 A;  1M94 A;  2L0T A;  4II3 B;  3PRE A;  1YQB A;  5KHO A;  3WAO A;  5CHF A;  3L10 B;  2AL3 A;  2EKE C;  5AZH A;  3PS6 A;  2KJH B;  2ZZP B;  2KJR A;  1WX9 A;  2XEW A;  3T9L A;  4B95 A;  5C1Z A;  4KSK C;  2ZPY A;  2LXA A;  5J2R A;  5FR6 A;  5J18 A;  2C60 A;  3PLV A;  1V5O A;  1WH3 A;  3PRZ A;  4BVU C;  4DK5 A;  4HPL B;  3EC8 A;  4PS8 A;  2IZV B;  3OLM D;  1Q0W B;  2MP2 A;  1YX5 B;  2KQS A;  3L16 A;  2HE7 A;  3V60 A;  3H7P B;  2ZVO A;  2DEN B;  2BWF A;  3IVF A;  4I6L B;  2L0F A;  2K6Q A;  1H8C A;  1EO6 A;  1NI2 A;  3VH3 B;  2KC2 A;  1Q1O A;  2MWS B;  5KHQ A;  1UBQ A;  1SIF A;  2NBW B;  4NQK E;  3AI5 A;  4ZRK A;  1D3Z A;  2HJ8 A;  4BFR A;  4W9L A;  1L7Y A;  3VVW B;  3PSE B;  2FID A;  2AEH A;  3K9P B;  5AEK B;  3ZNI D;  3V6E B;  2RR9 A;  3A4R A;  2LWP A;  3KYD D;  4ZRI A;  1WM2 A;  2LGX A;  2N7E A;  1E8W A;  4PS7 A;  2Y5B B;  3VTV A;  1IYF A;  2D3G A;  2GBJ A;  3L54 A;  4G11 A;  1KJT A;  2GBN A;  3V6C B;  3I3T B;  3ZLZ A;  5DPT A;  2KDI A;  1S3S G;  4I6P A;  1OEY J;  4E74 A;  2JRH A;  2WX1 A;  4ANX A;  1WMH B;  2ZNV C;  2KFK B;  1V6E A;  2B3A A;  1GUA B;  2I1J A;  2Z59 B;  3A33 B;  2G4S A;  4FJV B;  3M95 A;  3VAW A;  2KKC A;  4JL9 A;  4IM3 A;  2WYQ A;  4KIK B;  1AAR A;  5IAA C;  4TUU A;  3LDZ E;  4DHZ E;  4HCN B;  4K81 A;  2BYV E;  4DBG A;  1E7U A;  2EMT A;  4M8M A;  3H7P A;  4GB9 A;  4HWI B;  3A9J A;  3UGB B;  3ZIM A;  2N1V A;  3KUZ A;  2DAJ A;  2KTR B;  4EFO A;  2BPS A;  2CKH B;  5GMV A;  1UZX B;  2DX5 B;  2JT4 B;  4BKS D;  2KN5 A;  1P1A A;  3PRP B;  4EKU A;  2IYD B;  2KDF B;  4HVB A;  2C9W B;  4ANV A;  2IY1 B;  1J19 A;  4JQW C;  3JSV B;  4FUL A;  3NHE B;  4II2 B;  2NBU A;  4EZK A;  3WAM A;  3MTN B;  3V62 A;  4K7U A;  3CST A;  4W9E A;  1H4R A;  4E71 A;  2BKR B;  1UBI A;  3M63 B;  2WWZ A;  4EEW A;  1ZGU B;  1WM3 A;  3X23 A;  1KOT A;  4EUT A;  4ICV A;  2LUE A;  3KUC B;  2MCN B;  5LXH A;  2XK5 B;  3S2A A;  2KDE B;  3JVZ X;  3IHP C;  1F9J A;  1E8X A;  3JYU A;  3KVF B;  4AP4 C;  4BOZ B;  2J0M A;  3U7D A;  3Q3F A;  4GGQ A;  2KAN A;  2C7M B;  3VDZ A;  2FAZ A;  1WMH A;  2L76 A;  3RD2 A;  2KFK A;  5G55 A;  2D2Q A;  3PHX B;  2AWT A;  3X0W A;  1I42 A;  3SD5 A;  3PV1 A;  4E3C A;  4ZDV A;  2MBH A;  3UF8 A;  3SDL C;  2C7N B;  1KM7 A;  4IG7 B;  1YJ1 A;  3BIN A;  2JF5 A;  2GOW A;  1P9D U;  1TGZ B;  3VH4 B;  4EZL A;  3V61 A;  3UIN B;  2MSE D;  2KLC A;  1UGM A;  1V81 A;  5DPW A;  2YLM A;  2KC1 A;  2KWU B;  1A5R A;  3DDC B;  1GJZ A;  3HHM A;  2LD9 A;  1E90 A;  1OGW A;  3D32 A;  3UIO B;  3QHT A;  1WZ0 A;  2LRU A;  2ZVN A;  1WYW B;  3HM6 X;  3ZUN A;  3R7Q A;  3AUL A;  2O2V B;  2BKF A;  1CMX B;  4P7I A;  3QJZ A;  2J0J A;  4XC2 A;  3DPD A;  2IY0 B;  3ZTC A;  2LJ5 A;  4MJS B;  4FAD A;  2BYE A;  1WGD A;  2C5L C;  3AU4 A;  3VXW A;  3ML8 A;  3IFW B;  4CYE A;  2DAF A;  4TQ0 A;  2BYF A;  2XK5 A;  2O6V D;  2V4L A;  3IG3 A;  4WJP A;  2LRW A;  4BKT A;  2CU1 A;  1L2N A;  1LXD A;  4IC7 B;  4IWP A;  2FCS A;  3OJ3 A;  4KSL C;  2RPQ A;  5AZG A;  3R3M A;  4TKN A;  3WIM A;  4DWF A;  3QK0 A;  2FCN A;  1SGH A;  1WXV A;  4IWQ A;  4PYZ A;  2NBV B;  2NPT B;  3B1L X;  3TJP A;  2CHX A;  5L83 A;  4KDI C;  1EF1 A;  3GZN I;  4BKS A;  2D07 B;  4A20 A;  2JWZ A;  3A9J B;  4IUM B;  2JXX A;  3ML9 A;  4HJK A;  4G50 A;  4LDT D;  1WRD B;  5BO4 B;  4GDK B;  3NY5 A;  3H1U A;  1LQB A;  1EUV B;  4G3X B;  4MEL A;  1KLV A;  2JY6 A;  4GIV A;  4FHK A;  5JHA A;  1V80 A;  4NJ6 A;  4EZJ A;  3B08 A;  3CF6 E;  1E8Z A;  2LGY A;  2OJR A;  3M3J A;  4WJQ A;  4TQ1 A;  2JRI B;  2KOX A;  2RSU A;  3ONS A;  2O2V A;  4NPN A;  3TL5 A;  4F1S A;  2GBM A;  1J8C A;  1BT0 A;  1V86 A;  2KHW B;  4MJS A;  3AXC A;  1PQS A;  2K8B A;  1TZ1 A;  2J7Q B;  2MX2 A;  3RZF A;  4IWO A;  2NVU I;  2ZCB A;  4HK2 A;  2KVR A;  4MM3 A;  1XD3 B;  4W9F A;  4W9C A;  3L17 A;  1WJ6 A;  2UWQ A;  3DVN U;  2W9N A;  4IW0 A;  5D2M B;  1J0G A;  4EOY A;  4AWJ A;  5JHB A;  5EDS A;  1WJN A;  2UYZ B;  3QWZ B;  2HTH A;  1WFY A;  2DHZ A;  3A1Q A;  3UIP B;  4DHZ B;  4K7S A;  5DPR A;  4I6N B;  4NAW B;  3APD A;  2R2Q A;  4URK A;  3NOB A;  1Y8R C;  2NPT A;  2QHO A;  4B9K A;  1WR1 A;  4IM2 A;  5IA7 A;  4GN1 A;  2KZR A;  1QZE A;  3DBH I;  4FLH A;  4OVU A;  2PE6 B;  5LLI A;  3ZO5 B;  2LAS A;  3DBS A;  1I35 A;  5E6N A;  4AJW A;  2M0X A;  2KLG A;  3APC A;  3VFK A;  1X1M A;  1OQY A;  4GDK A;  1C3T A;  1YX6 B;  3DVG Y;  3H9D A;  2WDT B;  3TMP B;  3N32 A;  1NBF C;  3JW0 X;  4OVV A;  2KX3 A;  1ISN A;  3TBL D;  2BGF A;  3PRM B;  2O6V A;  2M8S A;  3H7S A;  1WE6 A;  1K8R B;  4W9K A;  2MRP A;  1VCB A;  5L95 C;  2EMS A;  2M1M A;  3KW5 B;  1UH6 A;  1WGH A;  3PVL A;  4KVG B;  1IPG A;  3CSF A;  4DXA B;  3U30 A;  3QX1 A;  4WJO A;  1WXA A;  4PS3 A; 
#chains in the Genus database with same CATH topology
 4BOS C;  2SAK A;  4MSQ B;  2WXQ A;  4KZC A;  2DYB A;  3BZD B;  5AUK A;  4B6W A;  2WXH A;  1AYF A;  3VUY A;  4BBN F;  1YIW A;  4IKG A;  4X57 B;  4ZHO A;  5CTR C;  4GDL B;  3AH7 A;  3B2G A;  2IO3 B;  3VR8 B;  4DHJ D;  2KDB A;  4HRO A;  1HTO A;  5E6O A;  1V5T A;  1WXS A;  3Q8C A;  2RMM A;  1GNU A;  1FFV A;  2KNB A;  3VTU A;  2PW9 A;  2KQ7 A;  1RFK A;  1P3Q U;  1RRB A;  4MEM A;  4LNN A;  5BMG A;  2BBC A;  5C23 A;  1WR6 E;  2M4N A;  1TS2 A;  2WLB A;  3GOE A;  3A1Q B;  4US8 A;  3CMM B;  1ZKH A;  2BWE S;  3ZYY X;  2BVC A;  1RYJ A;  4L23 A;  3RNA C;  1XXG A;  1FEH A;  2KK8 A;  3PPA A;  3R66 C;  1WYG A;  3DBR I;  1WGG A;  4P16 A;  4GXB A;  4OVZ A;  4YSX B;  1L0Y B;  4XX5 A;  1KTK A;  1OQR A;  4FA6 A;  1FIQ A;  2Y5C A;  2N7D A;  2Y5P A;  3AEE B;  2HD5 B;  1ZDV A;  3ZW3 A;  3DWM A;  3AB5 A;  1N6Z A;  5MPO A;  2N9L A;  1C4A A;  5G2N A;  1YJI A;  2YEP B;  1MPE A;  2Q5W D;  3DBL I;  5DPS A;  1C76 A;  1N5X A;  1FNW A;  2KD0 A;  2L83 A;  3TCA A;  4KGT A;  2ZEQ A;  1DOY A;  4HJG E;  2AL6 A;  3RT3 B;  3KYC D;  2WU2 B;  4MGI E;  1WI0 A;  3PHW B;  4J6I A;  2NR2 A;  4LNK A;  3QAR A;  1B9R A;  3NZU A;  3V05 A;  1XF5 L;  2RD0 A;  4RMA A;  2K39 A;  2FCQ A;  2N9E B;  2JSV X;  2QIL A;  1NYR A;  3C0R B;  4NJ7 A;  1F1H A;  4RCO A;  2PTL A;  4LLG M;  2QC8 A;  1LGR A;  1TIF A;  4KDL B;  3W1S A;  1XQQ A;  4W9J A;  1STE A;  4XZ4 A;  3O65 B;  1WJ4 A;  1QQR A;  4F8C B;  3SHQ A;  1N61 A;  3ZRC A;  3M62 B;  2IO2 B;  2ZJD A;  1HEZ E;  4BKG A;  3N3K B;  3VUW A;  1FXT B;  4CQN A;  3DBR B;  1MHX A;  2MQJ A;  3ZJT A;  4JPS A;  1V1O A;  1AW7 A;  1ZXH A;  5AUI A;  1SBB B;  1SJE D;  3VTW A;  2MP2 B;  3DCG A;  3H6N A;  2KX0 A;  1ZW7 A;  4ANU A;  2GB1 A;  2K8H A;  3DBL B;  1T3Q A;  2FIF A;  2QIE B;  1G6J A;  3ETR A;  5TR5 A;  3CWI A;  3W1S C;  4ANW A;  3W5V B;  3EHV A;  1LFD A;  5KHO A;  3PRE A;  3WAO A;  2BTE A;  4XYC A;  2ZZP B;  2KJR A;  1D5M C;  4KSK C;  2KYW A;  2LXA A;  5C1Z A;  2C60 A;  2INP E;  2OJW A;  4BVU C;  1D6E C;  4HPL B;  2MH7 A;  3OLM D;  2BW2 A;  1YX5 B;  2KQS A;  3L16 A;  3V60 A;  2DEN B;  3KWL A;  5GXG B;  3DHH C;  1Q1O A;  5KHQ A;  1V1P B;  1SIF A;  4NQK E;  2W54 A;  3FKY A;  2MEK A;  2WXP A;  3V6E B;  2HJ1 A;  5G5G A;  4PS7 A;  2KAJ A;  4K3B A;  2GBJ A;  1IYF A;  3ZLZ A;  3AE8 B;  2KDI A;  1OEY J;  1WMH B;  2KFK B;  2B3A A;  2Z59 B;  2VZK B;  3GP7 A;  3M95 A;  1GB4 A;  1HXY D;  4TUU A;  3LDZ E;  2BYV E;  3I9V 1;  4OZB A;  4GB9 A;  1KLG D;  2D3B A;  3U52 E;  2DAJ A;  2CKH B;  4OHJ A;  3NJT A;  2BS2 B;  3PRP B;  1P1A A;  2IJ0 A;  2YEP F;  2IYD B;  4ANV A;  1TS3 A;  2IY1 B;  4FUL A;  3NHE B;  4EZK A;  2NBU A;  4H2A A;  3WAM A;  4AS1 A;  2GRI A;  4LTU A;  3V62 A;  2W82 A;  1QF6 A;  1UBI A;  2WWZ A;  1ZGU B;  1WM3 A;  1KOT A;  4ICV A;  3KUC B;  5LXH A;  2WXK A;  2KDE B;  1QT9 A;  3JVZ X;  3NVY A;  1XLO A;  4GGQ A;  3VDZ A;  4E3C A;  3PV1 A;  2MBH A;  2SEB D;  3SDL C;  3RNC C;  3BIN A;  1PGX A;  1D4B A;  1XCQ L;  3UIN B;  2JYT A;  1V81 A;  2GI9 A;  2YLM A;  1CK1 A;  2PKO A;  2ACZ B;  2KWU B;  3FAH A;  1GJZ A;  3HHM A;  2J52 A;  3UIO B;  3NVZ A;  2ZVN A;  1ROE A;  2JU6 X;  1WYW B;  3HM6 X;  3KWV A;  3R2I A;  2O2V B;  3QJZ A;  4R3D A;  4WH4 A;  2IY0 B;  4MJS B;  2BYE A;  2LHD A;  2K0P A;  2L1A A;  4TQ0 A;  1ZOY B;  2BYF A;  4MT5 A;  2V4L A;  3IG3 A;  2CU1 A;  2JXT A;  4IWP A;  4TKN A;  2FUG 1;  4AQ7 A;  3TJP A;  1SXT A;  4M00 A;  4BKS A;  2D07 B;  2JWZ A;  4IUM B;  2JXX A;  1JQ4 A;  1WSP A;  3ABV B;  4HJK A;  1N60 A;  2IGD A;  1EUV B;  1UF0 A;  2NTT A;  2JY6 A;  4Q2J A;  1ET6 A;  1TKY A;  2BS3 B;  2OJR A;  2LGY A;  4L1B A;  1ZE3 D;  4YWG G;  2MJD A;  2EEL A;  1I4Q A;  4C7Z A;  3AXC A;  5IP4 D;  2J7Q B;  2MX2 A;  4YXD B;  2Y3A A;  4W9F A;  2CU3 A;  1WJ6 A;  3MP9 A;  1C79 A;  2W9N A;  4DXG A;  3MC0 B;  5D2M B;  5JHB A;  1WJN A;  3QWZ B;  1JW9 D;  5E6J A;  2AQ3 B;  3UIP B;  4DHZ B;  1BML C;  4NAW B;  3APD A;  3EGR A;  2NPT A;  4B9K A;  3AEF B;  2IGG A;  4GN1 A;  2UU7 A;  1FCL A;  3DBH I;  1AN8 A;  2M0X A;  1X1M A;  4GDK A;  3H9D A;  1MJD A;  2DWQ A;  2WDT B;  4RH6 A;  4LNO A;  1CQV A;  2XNA C;  2O6V A;  3H7S A;  3OG5 A;  3KW5 B;  3B9J A;  1QOB A;  3CSF A;  1P7E A;  1I7H A;  2WXJ A;  4WJO A;  2LGD A;  3CIR B;  4IDI A;  2K6D B;  1GC7 A;  3TEY A;  2RDB C;  1IP9 A;  3QC8 B;  2K25 A;  2Z0E B;  3Q3N C;  1TYG B;  1WXM A;  3U8Z A;  1TS5 A;  4FBJ B;  4NJC A;  2MW5 A;  3RNG C;  3ENE A;  2EKI A;  2GBR A;  2MA9 B;  1VD2 A;  4KV2 A;  4CO7 A;  5HKH A;  1JWS D;  2C7H A;  1RM6 C;  3EFU A;  1P0R A;  3T8M A;  1EM7 A;  3KQ4 A;  5T8I A;  3MJ5 A;  2V3S A;  1VZ6 A;  3VRA B;  1P7F A;  3MHS D;  2JUO A;  1NDD A;  4HXD A;  3SU8 X;  1SF0 A;  1UWM A;  3AU5 A;  4MSM B;  2V3P A;  2ZW0 A;  4US9 A;  1C9F A;  2IO1 B;  4IM0 A;  1VRA B;  1FCC C;  2NS5 A;  3WAN A;  3UI3 A;  2D3A A;  1WIA A;  1YD8 U;  1UNS A;  1WJU A;  3NRZ A;  4YSZ B;  1YNT E;  2V9H A;  3PLU A;  3DBH B;  3U4E G;  1Z5S B;  1JWA D;  4S0R A;  2BB5 A;  1XEE A;  2KT7 A;  3TIX A;  3Q69 A;  4GDL A;  4AOF A;  2LGS A;  1LO5 D;  4LJP B;  5EE1 A;  4HLE A;  2O6V B;  1T6B X;  1E5W A;  4RM8 A;  2ZCC A;  2MBE A;  2LFI A;  1KH0 A;  2V4I B;  2Z0D B;  1FRR A;  2G45 B;  3GE3 C;  3ALB A;  5D6J B;  2AYO B;  3TEX A;  1F2R I;  1FM0 D;  1NEK B;  4WAA A;  1NYQ A;  2R61 A;  3N1Z C;  3IXS A;  1WX8 A;  4C7Y A;  3EFC A;  4W9D A;  1Z2M A;  4PT5 A;  4JIO U;  3LYY A;  3NG0 A;  5JH5 C;  1SEB D;  3P63 A;  1I4G A;  4A55 A;  2IGH A;  1UGJ A;  1TT5 B;  5AZF A;  1JRO A;  2VH2 A;  4M8N A;  3UQA A;  2PLP A;  1SE3 A;  3QCA A;  2AQ2 B;  2L32 A;  1R4N B;  4AJY B;  3ZXR A;  1R4M I;  5E6P A;  4GMV A;  4DDI D;  2KMC A;  3QQ8 B;  2L7R A;  3FIL B;  5C2T B;  2KO3 A;  3P4Q B;  4YSY B;  2RDG A;  2ZNV B;  2WXR A;  1F2R C;  1I4X A;  4DDG D;  4JGH B;  2I38 A;  3IBE A;  2FNJ B;  4KKI A;  4WWN A;  2A5U A;  3RZW C;  1QIL A;  2LVO A;  3AE9 B;  2IPK D;  4XGA B;  2KTF A;  4N6E B;  3ZKJ C;  1V8C A;  2WXG A;  2HTM E;  1E8Y A;  1V2Y A;  2KTR A;  3BYT B;  3ZNG C;  5CX3 A;  5C3J B;  2BF8 B;  1V49 A;  3JSV A;  2INC C;  2I2Y A;  3WAL A;  3NS1 A;  3RUI B;  3ZGZ A;  2ZPN A;  3L08 A;  4II3 B;  1YQB A;  3L10 B;  2AL3 A;  5AZH A;  1FXA A;  2KJH B;  5J2R A;  5FR6 A;  3AN1 A;  3PLV A;  4DK5 A;  1DGJ A;  3EC8 A;  4PS8 A;  1Q0W B;  2MP2 A;  1PDX A;  5IKC M;  1HA5 A;  2HE7 A;  3H7P B;  1E9M A;  2E3T A;  1R4M B;  1XCT L;  2NBW B;  1D3Z A;  4BFR A;  4W9L A;  1L7Y A;  2W55 A;  3VVW B;  1TS4 A;  2AEH A;  3K9P B;  1F0Z A;  2RR9 A;  1WM2 A;  1D5Z C;  2LGX A;  3VTV A;  3L54 A;  4G11 A;  2K22 A;  3I3T B;  5DPT A;  2W3R A;  3Q6B A;  4I6P A;  2WX1 A;  1IGC A;  4ANX A;  2MHJ A;  4RGN A;  1JRP A;  5FKA C;  4FJV B;  2KKC A;  4JL9 A;  2WYQ A;  2ONQ A;  3PZ7 A;  3A9J A;  3UGB B;  2N1V A;  3KUZ A;  1DOI A;  2KTR B;  1FNU A;  5GMV A;  3MFG A;  1UZX B;  3I63 C;  1V1P A;  1MVK A;  1TKE A;  3DHI C;  3URY A;  2C9W B;  3PZ8 A;  1J19 A;  3JSV B;  4II2 B;  3TSS A;  4W9E A;  1H4R A;  3R8B A;  4RGT A;  2BKR B;  2Z8L A;  2LUE A;  1ZDX A;  2MCN B;  2XK5 B;  3S2A A;  3IHP C;  3JYU A;  1FFU A;  1FRD A;  2KAN A;  2C7M B;  1WMH A;  5BYR A;  2KFK A;  5G55 A;  3PHX B;  2AWT A;  3SD5 A;  2PVO D;  1SIJ A;  2BT6 A;  2JF5 A;  1TGZ B;  2MJ3 A;  3V61 A;  2BQQ A;  1EU3 A;  2QSD A;  2KC1 A;  4S17 A;  4KKJ A;  1A5R A;  1WGK A;  2LD9 A;  1NEN B;  5G5H A;  1OGW A;  2H88 B;  3QHT A;  3Q8A A;  3ZUN A;  3AUL A;  4XC2 A;  4FAD A;  1C78 A;  2C5L C;  2DAF A;  4TSS A;  2WXF A;  2D3C A;  1A70 A;  4IC7 B;  3OJ3 A;  4KSL C;  3WIM A;  3QK0 A;  4PYZ A;  4RGO S;  4IWQ A;  2NBV B;  1EF1 A;  3GZN I;  3A9J B;  1ET9 A;  1GB1 A;  1L6V A;  4DXF A;  1QKZ A;  4B0E A;  1KLV A;  4KGS A;  3AE1 B;  5HI1 A;  3CF6 E;  1E8Z A;  2FE8 A;  3M3J A;  1N63 A;  2WDR B;  4WJQ A;  4TQ1 A;  2KOX A;  1JWU D;  4XDD A;  2O2V A;  4NPN A;  4P1B C;  3TL5 A;  4F1S A;  4C4V A;  3P4P B;  3RPF C;  2KHW B;  4MJS A;  1TZ1 A;  2K8B A;  2NVU I;  2ZCB A;  3RNB C;  3P1M A;  3P42 A;  4W9C A;  2UWQ A;  2OHF A;  3AE4 B;  3BYY B;  4M0W A;  3EA6 A;  5EDS A;  1SSN A;  1WFY A;  2LUM A;  4K7S A;  1PGB A;  3BK1 A;  2JZP A;  2R2Q A;  2JQR B;  3NOB A;  5TSS A;  4A90 A;  1WR1 A;  4IM2 A;  4ARC A;  3N1X C;  1QZE A;  1R7S A;  4FLH A;  2PE6 B;  5LLI A;  4AJW A;  3APC A;  2IDY A;  1OQY A;  3FC4 A;  3AMZ A;  2PIA A;  1L0V B;  3JW0 X;  2KX3 A;  3AE7 B;  3TBL D;  2LGI A;  1WE6 A;  4W9K A;  2MRP A;  1VCB A;  4NAM A;  4HKQ A;  1M4V A;  1OFF A;  1L6U A;  3ZNH B;  3AE3 B;  4N59 A;  1EWC A;  1GG3 A;  2N9P C;  3A9K A;  3GZN B;  4RF1 A;  4JE3 B;  3RUL A;  1WY8 A;  2WXI A;  4LNF A;  4NAW A;  2L8J A;  2DBY A;  2D5G A;  4ASW C;  2KJ6 A;  2VRR B;  1C1Y B;  1BXT A;  2PMV A;  3ZVV A;  1PUT A;  4YT0 B;  3HK0 A;  2GMI C;  2IBI B;  4NQL B;  2H89 B;  4C4V B;  3UQB A;  2LVP A;  4F7Z A;  2ASQ A;  1ACC A;  2PEA A;  4N9F 4;  1EF5 A;  2XN9 C;  3VQI A;  2DYM A;  5HG2 A;  4YTM B;  5D3I B;  3DOW A;  3OJ4 B;  4JX1 C;  2D10 A;  4M0W B;  3Q14 C;  4EE2 A;  3KLS X;  5I4D A;  3P4S B;  4ZRQ A;  2N4F A;  1Q5W B;  4MGY E;  1ZXI A;  3ZNZ B;  2I1K A;  4TV3 A;  2IO0 B;  3RNF C;  4M01 A;  2TSS A;  3NS8 A;  2L05 A;  1DYQ A;  2BS4 B;  1UUP A;  1QOA A;  2R2O A;  4GU2 A;  1V97 A;  1QLB B;  3EUB 2;  4WUR A;  2DYO A;  3NUH B;  4ICU A;  3VHT C;  1SB3 C;  3PT2 B;  2XBB C;  4BBN C;  2N9X A;  2V3N A;  3VUX A;  3A9K B;  1WZ3 A;  4WAF A;  4OZC A;  4LDT B;  2PPH A;  2LZ6 A;  2QMT A;  4HCP B;  1RAX A;  1JAL A;  4J3O D;  2CS4 A;  1I4P A;  1VJK A;  3O13 A;  4BZA A;  2KN4 A;  3WA0 A;  4WIP A;  3QAQ A;  4WJN A;  1NI3 A;  4ZRP A;  3RYT A;  1PYW D;  4RFB A;  1UEL A;  2M17 A;  3KH0 A;  1RFA A;  1OEY A;  1KLU D;  1JML A;  3RI7 C;  3ZDM C;  2CHZ A;  3NVV A;  1WE7 A;  1FD6 A;  2KMA A;  1TKG A;  3APF A;  1D5X C;  1MHH E;  2DNF A;  2K1F A;  4IOI E;  3SFE B;  4MDK E;  3VRB B;  1GPX A;  1E7P B;  4WWM A;  4WWO A;  1GC6 A;  2KXJ A;  4D2K A;  5LXI B;  3QA8 A;  2G4D B;  3HUI A;  4G0N B;  4FXC A;  2QJL A;  1T0Y A;  3IT4 B;  4ZYS A;  3KUD B;  4K1R B;  5CHV C;  3Q2A C;  1P98 A;  4PYU A;  5EE3 A;  1MI0 A;  1YMH E;  2GBK A;  3R7R A;  5H92 C;  2JPH A;  3P2B A;  5IOI A;  1TTN A;  4GOC A;  3MHZ A;  1FXI A;  3RMK C;  4MGK E;  2AQ1 B;  4TMA B;  4XWW A;  2WGS A;  1E7V A;  2CR5 A;  5D3D A;  5BYS A;  1XT9 B;  2J0K A;  4ARI A;  3ZRF A;  2G9H D;  2RPV A;  2CJO A;  3ECI A;  4WQO B;  2BB6 A;  1LM8 B;  1R4N I;  2J42 A;  2MLB A;  3LJ3 A;  4FJY A;  4DHJ B;  1YN5 A;  1YOV B;  4JLC A;  4WWP A;  3FIL A;  3K9O B;  1QOG A;  3BY4 B;  1M94 A;  4YTN B;  5CHF A;  1B1Z A;  3PS6 A;  1K53 A;  3T9L A;  2XEW A;  4B95 A;  2ZPY A;  3SR6 A;  5J18 A;  1V5O A;  1WH3 A;  4JWU C;  2ICI A;  5HHD G;  4XWT A;  3T3N A;  1FPY A;  4I6L B;  1WWT A;  1K52 A;  2L0F A;  2K6Q A;  1H8C A;  1EO6 A;  1NI2 A;  3VH3 B;  2KC2 A;  1UBQ A;  4MH8 A;  5H8Y E;  4ZRK A;  3RFZ B;  4K3C A;  3MC9 A;  4O1N A;  2X38 A;  3KYD D;  1YJJ A;  4ZRI A;  1E8W A;  2Y5B B;  3N20 C;  2D3G A;  3V6C B;  4A8X C;  1S3S G;  4E74 A;  2VH1 A;  1L4D B;  3BII D;  1XO3 A;  2ZNV C;  2I1J A;  2G4S A;  3VAW A;  2M0A A;  2RDH A;  3NZ3 A;  1AAR A;  1TZO A;  2E6X A;  4ZHP A;  5IAA C;  2WU5 B;  4HCN B;  4DHZ E;  4DBG A;  3H7P A;  1ENF A;  4EFO A;  2JT4 B;  5EE0 A;  4PK1 A;  4BKS D;  1J7B A;  2KDF B;  4REZ A;  3OWE B;  1HZ5 A;  4JQW C;  1E6E B;  1GAQ B;  3MTN B;  3CST A;  1F52 A;  4E71 A;  3Q8E A;  1JWB D;  3M63 B;  4EUT A;  4DQO C;  5HFY A;  4BOZ B;  2J0M A;  3U7D A;  2KAC A;  4HKZ E;  3RD2 A;  2D2Q A;  3X0W A;  1I42 A;  1T0Q C;  4ZDV A;  2X8X X;  3E9S A;  4XDC A;  5EE9 A;  4MAC A;  2GOW A;  3IAS 1;  1FO4 A;  1P9D U;  3VH4 B;  1T0S C;  2MSE D;  1UGM A;  2J4X A;  1XLP A;  4P6V F;  1E0Z A;  1WZ0 A;  1TY0 A;  3I57 A;  4B0M A;  2J0J A;  3ZTC A;  3AE5 B;  2QEJ C;  1WGD A;  3AU4 A;  3VXW A;  3ML8 A;  3IFW B;  4CYE A;  3PO0 A;  4MM3 B;  1TJE A;  2XK5 A;  2O6V D;  2WXN A;  4BKT A;  2N0S B;  1L2N A;  1LXD A;  1ESF A;  2FCS A;  1HTQ A;  5AZG A;  4P1C C;  1YQ4 B;  1SGH A;  1OQQ A;  4LNI A;  2CHX A;  4KDI C;  2M19 A;  3ML9 A;  2JX5 A;  4G50 A;  5BO4 B;  1Y56 A;  3NY5 A;  2WS3 B;  2OED A;  1VZ8 A;  1LQB A;  4G3X B;  1C4C A;  4GIV A;  4FHK A;  5JHA A;  1V80 A;  4EZJ A;  3B08 A;  3HVD A;  1CZP A;  3TEZ A;  3E56 A;  5FR3 A;  1V86 A;  1PQS A;  5BMH A;  4IWO A;  2LJI A;  4HK2 A;  1XD3 B;  3L17 A;  4AWJ A;  2UYZ B;  2HTH A;  2KQ4 X;  3I5J C;  4URK A;  1YQ3 B;  1N5W A;  1Y8R C;  1ZPS A;  2QHO A;  3SFD B;  2KZR A;  3W5U B;  2LMC A;  4OVU A;  3BVM A;  3ZO5 B;  1I35 A;  2INN E;  3AV8 A;  2KLG A;  3VFK A;  1CJE A;  1C3T A;  3V3X A;  3AE6 B;  3TMP B;  4OVV A;  1NBF C;  1ISN A;  3MC8 A;  2BGF A;  3PRM B;  3GS2 A;  2JYE A;  2WXO A;  2K5P A;  1IGD A;  2EMS A;  5L95 C;  2M1M A;  4HRS A;  4KVG B;  3ZQ4 A;  4DXA B;  3QX1 A;  2QDF A;  3Q3O C;  2JVC A;  2YVC A;  3PZD A;  1PGA A;  1SE9 A;  2JZZ A;  2FUH B;  2GLS A;  3A4S C;  3H8H A;  3TEW A;  5D94 A;  4KZ0 A;  2MBQ A;  1JRU A;  1VLB A;  1K50 A;  2WXL A;  3U2S C;  1SE4 A;  3DHG C;  1ZUD 2;  3AEA B;  1C4P A;  1HZ6 A;  1HE8 A;  4UDU C;  4W9G A;  4LJO B;  4ZRJ A;  3AED B;  2L3Z A;  1WGR A;  1WX7 A;  3GE8 C;  4RM9 A;  2LHE A;  4MH0 E;  4HDQ A;  4NZL B;  3C8Y A;  1RLF A;  3SEB A;  2B76 B;  4CHK A;  3W1Y A;  4FN2 A;  4A3O A;  3L4P A;  2ON8 A;  1L4Z B;  2DZM A;  1WXQ A;  3DQV A;  3L13 A;  2KFJ A;  3Q8B A;  4LCD E;  2DZK A;  2PE9 A;  1WGY A;  1FMA D;  2WDV B;  3PTF C;  3L0W B;  1YN4 A;  3AEB B;  4YL8 A;  3U7Z A;  1EU4 A;  1MFW A;  1MG8 A;  5JXV A;  3WAP A;  4NNJ B;  4AUQ C;  2WP9 B;  1XLQ A;  4OZA A;  4A3P A;  3AEC B;  1VR9 A;  3RNE C;  1AWD A;  3NZS A;  2D11 A;  1GOZ A;  2K9X A;  3QIJ A;  4GSW A;  4ACF A;  4XE0 A;  3HIZ A;  4W9I A;  2L00 B;  1QOF A;  2MBO A;  1V9J A;  3VR9 B;  2L52 A;  4C00 A;  4YTP B;  3W9C B;  1L5P A;  3N30 A;  1JWM D;  2DZI A;  3AE2 B;  5FK9 C;  1KF6 B;  4FJZ A;  2REX A;  4NY0 A;  4L2Y A;  1IUE A;  5CHW A;  2N1W A;  3AEG B;  2RGF A;  3DVN V;  1OTR B;  5D7G A;  1SE2 A;  3Q3M C;  3MJW A;  4FHJ A;  3B0A A;  3N1Y C;  2ZW1 A;  1E10 A;  2WHI A;  2NCN A;  2WX0 A;  4M02 A;  1J7A A;  3OAW A;  5DCN A;  2PVG C;  2OOB B;  5LNK 1;  1KRH A;  2JWU A;  2LI5 A;  4C56 C;  2K8C A;  5JZE B;  3HM3 A;  4ZYN A;  2KVZ A;  3EEC A;  4K7W A;  4WQM A;  3IT6 B;  2FCM A;  2KMM A;  2V0G A;  4A9A A;  3HVZ A;  2M56 B;  3T3O A;  2DZJ A;  3ZDT A;  4W9H A;  3Q8F A;  1WF9 A;  2PJH A;  1FNV A;  1I4R A;  4HPM B;  2MBB B;  1TY2 A;  2KWC A;  4HDO A;  4ZOH C;  1S1Q B;  3C19 A;  5IO9 A;  3DVG X;  2A4Z A;  1PFD A;  1ZP0 B;  1J7C A;  1TBE A;  3RN9 C;  2LXC A;  1U4A A;  4GLS C;  4OW0 A;  2G3Q B;  3BVG A;  4MGZ E;  4KIK A;  3PGE A;  3J9C A;  2CHW A;  3Q3J A;  2JZ3 B;  2LEK A;  4LK0 M;  4RGM A;  2KWV B;  3RCZ A;  3ZTD A;  3BWU D;  4KX6 B;  2V1Y A;  5J17 A;  1UD7 A;  2LVQ A;  2J53 A;  1T5X D;  2L0T A;  3P4R B;  1JCK B;  2EKE C;  4HEA 1;  1C77 A;  1WX9 A;  2NTS A;  3PRZ A;  2WQY B;  2IZV B;  3NVW A;  2ZVO A;  2BWF A;  3IVF A;  2VZK D;  2MWS B;  1EWY C;  3AI5 A;  2HJ8 A;  3PSE B;  1YN3 A;  2FID A;  3ZJV A;  1KFY B;  5AEK B;  3ZNI D;  3A4R A;  2LWP A;  3GB1 A;  4RNA A;  1IBX A;  2N7E A;  2N7J A;  1KJT A;  2GBN A;  3BVZ A;  1N62 A;  2JRH A;  1NVI D;  1DOX A;  1SJH D;  1V6E A;  1GUA B;  3A33 B;  3AM9 A;  4IM3 A;  4KIK B;  4K81 A;  1E7U A;  1Q10 A;  2EMT A;  2KDM A;  4M8M A;  3ZIM A;  4HWI B;  5IN7 A;  3BK2 A;  2WXM A;  2BPS A;  3HRD D;  2DX5 B;  1XLN A;  5BYQ A;  2KN5 A;  4EKU A;  4HVB A;  1VDV A;  2NMQ A;  4A6Q A;  4K7U A;  4EEW A;  3X23 A;  1F9J A;  1E8X A;  3KVF B;  4AP4 C;  3Q3F A;  2DLB A;  2FAZ A;  2L76 A;  2AX5 A;  1L0X B;  2QCZ A;  3ZJU A;  3UF8 A;  2C7N B;  3N9Y C;  1KM7 A;  4IG7 B;  1YJ1 A;  2FBW B;  4EZL A;  2KWD A;  2KLC A;  1HQR D;  5DPW A;  3DDC B;  1E90 A;  2BYT A;  3D32 A;  3W2D A;  4KGR A;  2LRU A;  3LB8 C;  3R7Q A;  2BKF A;  1CMX B;  4P7I A;  1IBX B;  3DPD A;  2LJ5 A;  4HPP A;  3B2F A;  2G1E A;  1K51 A;  4WJP A;  2LRW A;  1F77 A;  3WCQ A;  4ITK A;  2RPQ A;  3R3M A;  4DWF A;  5BMI A;  1VZ7 A;  2FCN A;  1WXV A;  2K3U A;  2NPT B;  3B1L X;  2MJE A;  5L83 A;  2CJN A;  4A20 A;  4BAX A;  1I4H A;  1UWX A;  4LDT D;  1WRD B;  4GDK B;  2WNM A;  3H1U A;  4MEL A;  4C80 A;  4NJ6 A;  2JRI B;  3ONS A;  2RSU A;  2IND C;  3TUO A;  2GBM A;  1J8C A;  1BT0 A;  1BUI C;  4N58 A;  2W3S A;  1MG4 A;  3RZF A;  2KVR A;  4MM3 A;  3ZXV A;  3DVN U;  4IW0 A;  1J0G A;  4EOY A;  2DHZ A;  3A1Q A;  5DPR A;  4I6N B;  1RWS A;  4JWS C;  5IA7 A;  1T0R C;  3LXF A;  2LAS A;  3DBS A;  4QAY A;  5E6N A;  3R2T A;  2HDE A;  1YX6 B;  3DVG Y;  3N32 A;  1WRI A;  3IAM 1;  4RF0 A;  2M8S A;  1K8R B;  2N9K A;  3DWG C;  3PVL A;  1UH6 A;  1WGH A;  1IPG A;  2WDQ B;  3U30 A;  1WXA A;  4USA A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 2LGD A;  4BOS C;  2K6D B;  1GC7 A;  2JVC A;  2YVC A;  3ZNH B;  3PZD A;  1IP9 A;  1SE9 A;  1GG3 A;  3QC8 B;  2JZZ A;  4MSQ B;  2N9P C;  4KZC A;  2DYB A;  2FUH B;  2K25 A;  2Z0E B;  3A4S C;  3A9K A;  5D94 A;  4KZ0 A;  4B6W A;  1WXM A;  1JRU A;  2MBQ A;  3U8Z A;  3RUL A;  3VUY A;  4FBJ B;  4BBN F;  2MW5 A;  1YIW A;  1WY8 A;  3ENE A;  4X57 B;  4NAW A;  2GBR A;  2MA9 B;  1VD2 A;  2L8J A;  4KV2 A;  4CO7 A;  5CTR C;  5HKH A;  4GDL B;  4ASW C;  2IO3 B;  2KJ6 A;  2VRR B;  1C1Y B;  3ZVV A;  4DHJ D;  2C7H A;  2KDB A;  5E6O A;  3EFU A;  1P0R A;  1HE8 A;  3T8M A;  4W9G A;  2V3S A;  4LJO B;  4ZRJ A;  1V5T A;  1WXS A;  2L3Z A;  3HK0 A;  1WGR A;  2GMI C;  2IBI B;  1WX7 A;  3MHS D;  4RM9 A;  4NQL B;  2JUO A;  1NDD A;  4MH0 E;  4HDQ A;  4HXD A;  3SU8 X;  1GNU A;  2LVP A;  3UQB A;  2KNB A;  3VTU A;  2ASQ A;  4F7Z A;  4N9F 4;  2PEA A;  1EF5 A;  3VQI A;  2DYM A;  3AU5 A;  4MSM B;  2KQ7 A;  1RLF A;  3DOW A;  3OJ4 B;  2IO1 B;  4CHK A;  4IM0 A;  1P3Q U;  2D10 A;  1RRB A;  2NS5 A;  4MEM A;  3W1Y A;  3WAN A;  4FN2 A;  4M0W B;  4A3O A;  5C23 A;  1WR6 E;  1WIA A;  1YD8 U;  2M4N A;  3GOE A;  3A1Q B;  1WJU A;  3CMM B;  1ZKH A;  2BWE S;  2DZM A;  3DQV A;  3L13 A;  2KFJ A;  2N4F A;  3PLU A;  4LCD E;  1Q5W B;  2DZK A;  1WGY A;  2PE9 A;  1Z5S B;  4MGY E;  3ZNZ B;  3PTF C;  3L0W B;  4YL8 A;  2I1K A;  4TV3 A;  2IO0 B;  1MG8 A;  2KK8 A;  3NS8 A;  4NNJ B;  3WAP A;  2L05 A;  3TIX A;  4AUQ C;  4GDL A;  3PPA A;  4AOF A;  3R66 C;  4A3P A;  2R2O A;  3DBR I;  3NZS A;  2D11 A;  1WGG A;  4GU2 A;  4LJP B;  4HLE A;  4GXB A;  2O6V B;  4XX5 A;  1E5W A;  4GSW A;  3QIJ A;  2ZCC A;  4RM8 A;  4FA6 A;  2MBE A;  2N7D A;  3HIZ A;  4W9I A;  2L00 B;  2DYO A;  2HD5 B;  2Z0D B;  4ICU A;  3VHT C;  2MBO A;  2G45 B;  1V9J A;  3ZW3 A;  3PT2 B;  2XBB C;  3ALB A;  4BBN C;  5G2N A;  2N9X A;  3DBL I;  5DPS A;  3VUX A;  3A9K B;  3N30 A;  2KD0 A;  2DZI A;  1WZ3 A;  5D6J B;  2AYO B;  4LDT B;  2PPH A;  3TCA A;  4WAA A;  2LZ6 A;  2ZEQ A;  2AL6 A;  4HCP B;  3RT3 B;  3KYC D;  4FJZ A;  2REX A;  4MGI E;  1WX8 A;  4NY0 A;  1WI0 A;  5CHW A;  1RAX A;  2N1W A;  3PHW B;  4J6I A;  2CS4 A;  2NR2 A;  4W9D A;  1Z2M A;  2RGF A;  3DVN V;  4JIO U;  1OTR B;  3QAR A;  3WA0 A;  3NZU A;  5D7G A;  3QAQ A;  4WJN A;  5JH5 C;  3MJW A;  4FHJ A;  3B0A A;  3RYT A;  2RD0 A;  1UEL A;  2M17 A;  4RMA A;  2NCN A;  2K39 A;  2WX0 A;  2FCQ A;  2N9E B;  3KH0 A;  5AZF A;  3C0R B;  1RFA A;  3OAW A;  5DCN A;  4NJ7 A;  2OOB B;  4M8N A;  3UQA A;  1OEY A;  2LI5 A;  4KDL B;  3W1S A;  3ZDM C;  2CHZ A;  2K8C A;  5JZE B;  1XQQ A;  4W9J A;  1WE7 A;  3HM3 A;  3QCA A;  2KMA A;  4ZYN A;  3APF A;  3EEC A;  4K7W A;  3O65 B;  4XZ4 A;  1WJ4 A;  2K1F A;  4AJY B;  1R4M I;  4MDK E;  2FCM A;  5E6P A;  4GMV A;  4DDI D;  2KMC A;  4F8C B;  3QQ8 B;  3SHQ A;  2L7R A;  3ZRC A;  3M62 B;  2IO2 B;  2KO3 A;  2ZJD A;  2DZJ A;  2ZNV B;  4WWO A;  1GC6 A;  2KXJ A;  3ZDT A;  5LXI B;  3QA8 A;  2G4D B;  4W9H A;  4G0N B;  3N3K B;  1WF9 A;  2PJH A;  4BKG A;  4DDG D;  1T0Y A;  3VUW A;  4JGH B;  1FXT B;  4HPM B;  2MBB B;  3KUD B;  3IBE A;  2FNJ B;  4K1R B;  2KWC A;  5CHV C;  4HDO A;  4PYU A;  1P98 A;  2MQJ A;  4WWN A;  1S1Q B;  2A5U A;  3RZW C;  2LVO A;  2GBK A;  3DVG X;  3R7R A;  2JPH A;  3P2B A;  2A4Z A;  1TTN A;  4GOC A;  1TBE A;  2KTF A;  2LXC A;  1U4A A;  3VTW A;  2MP2 B;  3DCG A;  3H6N A;  3ZKJ C;  4MGK E;  2KX0 A;  2G3Q B;  4MGZ E;  4KIK A;  1ZW7 A;  3PGE A;  4ANU A;  2K8H A;  2CHW A;  1E7V A;  1E8Y A;  2CR5 A;  2FIF A;  3Q3J A;  1XT9 B;  1G6J A;  2JZ3 B;  2J0K A;  3ZRF A;  1V2Y A;  2KTR A;  3ZNG C;  5CX3 A;  5TR5 A;  2BF8 B;  3ECI A;  4WQO B;  2KWV B;  3RCZ A;  3W1S C;  4ANW A;  3ZTD A;  1LM8 B;  1R4N I;  3LJ3 A;  2MLB A;  1V49 A;  4FJY A;  4DHJ B;  3EHV A;  1LFD A;  3JSV A;  2V1Y A;  4JLC A;  4WWP A;  1UD7 A;  5J17 A;  2LVQ A;  3WAL A;  3K9O B;  3RUI B;  3BY4 B;  2ZPN A;  3L08 A;  1M94 A;  2L0T A;  4II3 B;  3PRE A;  1YQB A;  5KHO A;  3WAO A;  5CHF A;  3L10 B;  2AL3 A;  2EKE C;  5AZH A;  3PS6 A;  2KJH B;  2ZZP B;  2KJR A;  1WX9 A;  2XEW A;  3T9L A;  4B95 A;  5C1Z A;  4KSK C;  2ZPY A;  2LXA A;  5J2R A;  5FR6 A;  5J18 A;  2C60 A;  3PLV A;  1V5O A;  1WH3 A;  3PRZ A;  4BVU C;  4DK5 A;  4HPL B;  3EC8 A;  4PS8 A;  2IZV B;  3OLM D;  1Q0W B;  2MP2 A;  1YX5 B;  2KQS A;  3L16 A;  2HE7 A;  3V60 A;  3H7P B;  2ZVO A;  2DEN B;  2BWF A;  3IVF A;  4I6L B;  2L0F A;  2K6Q A;  1H8C A;  1EO6 A;  1NI2 A;  3VH3 B;  2KC2 A;  1Q1O A;  2MWS B;  5KHQ A;  1UBQ A;  1SIF A;  2NBW B;  4NQK E;  3AI5 A;  4ZRK A;  1D3Z A;  2HJ8 A;  4BFR A;  4W9L A;  1L7Y A;  3VVW B;  3PSE B;  2FID A;  2AEH A;  3K9P B;  5AEK B;  3ZNI D;  3V6E B;  2RR9 A;  3A4R A;  2LWP A;  3KYD D;  4ZRI A;  1WM2 A;  2LGX A;  2N7E A;  1E8W A;  4PS7 A;  2Y5B B;  3VTV A;  1IYF A;  2D3G A;  2GBJ A;  3L54 A;  4G11 A;  1KJT A;  2GBN A;  3V6C B;  3I3T B;  3ZLZ A;  5DPT A;  2KDI A;  1S3S G;  4I6P A;  1OEY J;  4E74 A;  2JRH A;  2WX1 A;  4ANX A;  1WMH B;  2ZNV C;  2KFK B;  1V6E A;  2B3A A;  1GUA B;  2I1J A;  2Z59 B;  3A33 B;  2G4S A;  4FJV B;  3M95 A;  3VAW A;  2KKC A;  4JL9 A;  4IM3 A;  2WYQ A;  4KIK B;  1AAR A;  5IAA C;  4TUU A;  3LDZ E;  4DHZ E;  4HCN B;  4K81 A;  2BYV E;  4DBG A;  1E7U A;  2EMT A;  4M8M A;  3H7P A;  4GB9 A;  4HWI B;  3A9J A;  3UGB B;  3ZIM A;  2N1V A;  3KUZ A;  2DAJ A;  2KTR B;  4EFO A;  2BPS A;  2CKH B;  5GMV A;  1UZX B;  2DX5 B;  2JT4 B;  4BKS D;  2KN5 A;  1P1A A;  3PRP B;  4EKU A;  2IYD B;  2KDF B;  4HVB A;  2C9W B;  4ANV A;  2IY1 B;  1J19 A;  4JQW C;  3JSV B;  4FUL A;  3NHE B;  4II2 B;  2NBU A;  4EZK A;  3WAM A;  3MTN B;  3V62 A;  4K7U A;  3CST A;  4W9E A;  1H4R A;  4E71 A;  2BKR B;  1UBI A;  3M63 B;  2WWZ A;  4EEW A;  1ZGU B;  1WM3 A;  3X23 A;  1KOT A;  4EUT A;  4ICV A;  2LUE A;  3KUC B;  2MCN B;  5LXH A;  2XK5 B;  3S2A A;  2KDE B;  3JVZ X;  3IHP C;  1F9J A;  1E8X A;  3JYU A;  3KVF B;  4AP4 C;  4BOZ B;  2J0M A;  3U7D A;  3Q3F A;  4GGQ A;  2KAN A;  2C7M B;  3VDZ A;  2FAZ A;  1WMH A;  2L76 A;  3RD2 A;  2KFK A;  5G55 A;  2D2Q A;  3PHX B;  2AWT A;  3X0W A;  1I42 A;  3SD5 A;  3PV1 A;  4E3C A;  4ZDV A;  2MBH A;  3UF8 A;  3SDL C;  2C7N B;  1KM7 A;  4IG7 B;  1YJ1 A;  3BIN A;  2JF5 A;  2GOW A;  1P9D U;  1TGZ B;  3VH4 B;  4EZL A;  3V61 A;  3UIN B;  2MSE D;  2KLC A;  1UGM A;  1V81 A;  5DPW A;  2YLM A;  2KC1 A;  2KWU B;  1A5R A;  3DDC B;  1GJZ A;  3HHM A;  2LD9 A;  1E90 A;  1OGW A;  3D32 A;  3UIO B;  3QHT A;  1WZ0 A;  2LRU A;  2ZVN A;  1WYW B;  3HM6 X;  3ZUN A;  3R7Q A;  3AUL A;  2O2V B;  2BKF A;  1CMX B;  4P7I A;  3QJZ A;  2J0J A;  4XC2 A;  3DPD A;  2IY0 B;  3ZTC A;  2LJ5 A;  4MJS B;  4FAD A;  2BYE A;  1WGD A;  2C5L C;  3AU4 A;  3VXW A;  3ML8 A;  3IFW B;  4CYE A;  2DAF A;  4TQ0 A;  2BYF A;  2XK5 A;  2O6V D;  2V4L A;  3IG3 A;  4WJP A;  2LRW A;  4BKT A;  2CU1 A;  1L2N A;  1LXD A;  4IC7 B;  4IWP A;  2FCS A;  3OJ3 A;  4KSL C;  2RPQ A;  5AZG A;  3R3M A;  4TKN A;  3WIM A;  4DWF A;  3QK0 A;  2FCN A;  1SGH A;  1WXV A;  4IWQ A;  4PYZ A;  2NBV B;  2NPT B;  3B1L X;  3TJP A;  2CHX A;  5L83 A;  4KDI C;  1EF1 A;  3GZN I;  4BKS A;  2D07 B;  4A20 A;  2JWZ A;  3A9J B;  4IUM B;  2JXX A;  3ML9 A;  4HJK A;  4G50 A;  4LDT D;  1WRD B;  5BO4 B;  4GDK B;  3NY5 A;  3H1U A;  1LQB A;  1EUV B;  4G3X B;  4MEL A;  1KLV A;  2JY6 A;  4GIV A;  4FHK A;  5JHA A;  1V80 A;  4NJ6 A;  4EZJ A;  3B08 A;  3CF6 E;  1E8Z A;  2LGY A;  2OJR A;  3M3J A;  4WJQ A;  4TQ1 A;  2JRI B;  2KOX A;  2RSU A;  3ONS A;  2O2V A;  4NPN A;  3TL5 A;  4F1S A;  2GBM A;  1J8C A;  1BT0 A;  1V86 A;  2KHW B;  4MJS A;  3AXC A;  1PQS A;  2K8B A;  1TZ1 A;  2J7Q B;  2MX2 A;  3RZF A;  4IWO A;  2NVU I;  2ZCB A;  4HK2 A;  2KVR A;  4MM3 A;  1XD3 B;  4W9F A;  4W9C A;  3L17 A;  1WJ6 A;  2UWQ A;  3DVN U;  2W9N A;  4IW0 A;  5D2M B;  1J0G A;  4EOY A;  4AWJ A;  5JHB A;  5EDS A;  1WJN A;  2UYZ B;  3QWZ B;  2HTH A;  1WFY A;  2DHZ A;  3A1Q A;  3UIP B;  4DHZ B;  4K7S A;  5DPR A;  4I6N B;  4NAW B;  3APD A;  2R2Q A;  4URK A;  3NOB A;  1Y8R C;  2NPT A;  2QHO A;  4B9K A;  1WR1 A;  4IM2 A;  5IA7 A;  4GN1 A;  2KZR A;  1QZE A;  3DBH I;  4FLH A;  4OVU A;  2PE6 B;  5LLI A;  3ZO5 B;  2LAS A;  3DBS A;  1I35 A;  5E6N A;  4AJW A;  2M0X A;  2KLG A;  3APC A;  3VFK A;  1X1M A;  1OQY A;  4GDK A;  1C3T A;  1YX6 B;  3DVG Y;  3H9D A;  2WDT B;  3TMP B;  3N32 A;  1NBF C;  3JW0 X;  4OVV A;  2KX3 A;  1ISN A;  3TBL D;  2BGF A;  3PRM B;  2O6V A;  2M8S A;  3H7S A;  1WE6 A;  1K8R B;  4W9K A;  2MRP A;  1VCB A;  5L95 C;  2EMS A;  2M1M A;  3KW5 B;  1UH6 A;  1WGH A;  3PVL A;  4KVG B;  1IPG A;  3CSF A;  4DXA B;  3U30 A;  3QX1 A;  4WJO A;  1WXA A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...