1I35A

Solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEEEFKQICFNSSSPERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE BYR2
publication title Solution structure of the Ras binding domain of the protein kinase Byr2 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 15
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1i35A00
2O6VD 3W1YA 5L83A 2LZ6A 2RSUA 3L08A 3ZNGC 2C9WB 3DVNV 3ZRFA 1WM2A 5JHAA 3VH3B 2JF5A 2KDIA 1ZGUB 3ZUNA 1WXVA 2FNJB 2N9XA 1V49A 2DZIA 4BBNF 5HKHA 1M94A 2AYOB 2V1YA 2GBNA 2K25A 2DYBA 3RYTA 2C60A 4MM3A 1UZXB 2Z0DB 1T0YA 1OEYA 1YIWA 1V81A 3QAQA 4RM9A 4W9KA 2WX1A 1NBFC 1Z5SB 3JSVA 4W9LA 3DVGX 1E90A 2KQ7A 4KSKC 3IHPC 1L2NA 3VH4B 4EFOA 4URKA 3VHTC 1V5TA 3JYUA 1Q1OA 1Y8RC 5LXHA 1NI2A 1WGYA 4II3B 4IC7B 3A4RA 3QC8B 2WYQA 5E6NA 4ANVA 4CO7A 4DDID 5TR5A 2CR5A 2NVUI 5KHOA 2LVOA 4GDLA 2KHWB 2KWUB 2K6DB 2M4NA 4BKSA 3RUIB 4ZRJA 2DYOA 4NPNA 3N32A 2L0TA 3PPAA 1UBIA 3QWZB 3NY5A 1UBQA 3A1QB 3V6EB 4A3OA 4MEMA 4IM0A 1WGHA 4LDTD 3UQBA 4DHJD 2A4ZA 1WFYA 4PYUA 3NZUA 4NQKE 2MBQA 1E5WA 1CMXB 1LQBA 3NHEB 4GDKA 5DPSA 5AZHA 4EUTA 3PZDA 1C3TA 5AZFA 2B3AA 2GMIC 1Q0WB 2NR2A 3A4SC 4AOFA 4NJ6A 4AP4C 2KX3A 1WYWB 2IO3B 4MJSB 2MBOA 3WALA 1RAXA 1YD8U 3IBEA 1Q5WB 4XX5A 2IZVB 3H7SA 2KC2A 5J18A 4DXAB 1E8YA 3K9PB 2CS4A 2KVRA 1E7VA 3MTNB 4HWIB 2D11A 4CYEA 2DZMA 2G4SA 3L16A 2N4FA 2I1KA 4EZKA 4G50A 1GNUA 1EF5A 4OVVA 2KNBA 1WF9A 4MGZE 2C7HA 1WZ0A 1EUVB 1ISNA 3QHTA 3PHXB 1R4MI 2DX5B 2EMTA 2XBBC 4HDOA 2KZRA 4M8NA 2N1WA 2JRHA 1TGZB 1VD2A 3Q3JA 3DQVA 3SU8X 3ZNHB 2C5LC 3M95A 3H6NA 3PREA 2J0MA 4K81A 3PVLA 2O2VA 2G3QB 4G11A 2MX2A 1KLVA 1NDDA 3AI5A 3KUZA 5DCNA 4DWFA 4P7IA 4ZRIA 4NJ7A 4A20A 4WJQA 1TTNA 2ZCBA 5FR6A 5DPWA 1QZEA 3T9LA 3OJ4B 1WGDA 4J6IA 3VVWB 3KW5B 1WGRA 2D07B 1GC6A 1WR1A 1WX8A 2KDEB 4TQ0A 4BBNC 2K6QA 2V3SA 1G6JA 2KQSA 1WXAA 3VTWA 1ZW7A 2ZPNA 4AJYB 4F1SA 4IM3A 5IA7A 1TBEA 4G0NB 5CTRC 3OJ3A 3RT3B 4YL8A 4I6LB 3PRMB 3QCAA 1P9DU 2NBWB 3AULA 3VUXA 1AARA 1WZ3A 2LGXA 3LDZE 4XC2A 1WXSA 2WDTB 4X57B 3TBLD 3TL5A 2IO2B 1WH3A 2BWES 2R2OA 3QX1A 2MW5A 2ZVOA 3R3MA 1YJ1A 4DHZB 3VFKA 4AWJA 2AWTA 4M0WB 2ZJDA 2BYVE 3N30A 2Z59B 4EZJA 3RD2A 3ZW3A 2BPSA 4GU2A 4GIVA 2FUHB 2KLGA 4LJOB 2J0JA 2MBHA 4HLEA 3SHQA 2HJ8A 1WIAA 2KTFA 5D94A 4ICUA 3NS8A 4K1RB 2IO0B 4K7SA 2N7DA 4BKTA 1K8RB 2MLBA 2PE6B 4WAAA 3IG3A 5LXIB 1H4RA 1OQYA 3DPDA 3MJWA 4LJPB 3U30A 2JZ3B 2BKFA 2KXJA 2YVCA 1WX9A 1P0RA 4W9FA 3B1LX 4IM2A 3MHSD 4BKSD 4II2B 4MGIE 1TZ1A 3U8ZA 3ZDTA 4E74A 1A5RA 1OGWA 2KD0A 2KDBA 1WX7A 2JT4B 3PS6A 4GN1A 3DBHI 3L54A 2KFKB 5JHBA 3H9DA 1P1AA 1X1MA 2LASA 3ZDMC 3ZNZB 1U4AA 3ZRCA 3VUYA 2LGDA 4WWOA 5GMVA 4ANWA 1RLFA 1C1YB 2DAJA 3APDA 3S2AA 2CKHB 2BF8B 1MG8A 1IPGA 5KHQA 3HM6X 2KJRA 5D6JB 2N7EA 3W1SA 2M8SA 2O6VB 2KN5A 2L05A 3DBSA 2L00B 4TV3A 1WJNA 1RFAA 1EF1A 3A1QA 3L10B 4KZ0A 3QJZA 4HJKA 2D3GA 2KC1A 3WAMA 2J7QB 2LD9A 3L17A 3V60A 1D3ZA 2LJ5A 4NNJB 4KDLB 4DHZE 2RPQA 1GC7A 4B95A 4PS8A 1I42A 2N9EB 2DAFA 2KKCA 2FAZA 3UINB 3V6CB 3H7PB 4PS3A 4HDQA 5E6OA 4MH0E 2RGFA 5JH5C 2HD5B 4W9EA 2ZNVB 2MWSB 2K1FA 3DDCB 3PRZA 2LUEA 4MJSA 4W9IA 4IW0A 3ZKJC 2N9PC 2XEWA 3IVFA 3ZO5B 1I35A 3VQIA 3A9JB 2ZEQA 3ENEA 1WJ6A 1E8XA 3V62A 2N1VA 4FA6A 3C0RB 4MELA 4TQ1A 1WRDB 4EEWA 2AEHA 1BT0A 3RCZA 4PS7A 1V2YA 4JQWC 4W9DA 4FULA 3TIXA 2FIDA 2LGYA 1RRBA 4MSMB 2IO1B 2NBVB 2K8CA 3AU4A 1WXMA 4ZDVA 4W9GA 1SE9A 2GBRA 2OJRA 1JRUA 2MP2A 1WMHB 3V61A 4AJWA 5AEKB 2VRRB 2MP2B 5LLIA 4WQOB 4ZRKA 1WM3A 3P2BA 3QA8A 4FJVB 4DK5A 1J8CA 4LDTB 3HIZA 3DVGY 4DHJB 4FJZA 4FBJB 4G3XB 2JXXA 2KLCA 2Y5BB 2BKRB 2XK5A 3WANA 4ANXA 1YX6B 2GBMA 3HK0A 2MA9B 5AZGA 3WIMA 2XK5B 2KFJA 3CSTA 2DZKA 1L7YA 4MGKE 4FN2A 2MBBB 3VXWA 4PYZA 3M62B 4I6NB 3PTFC 1WJ4A 2GBKA 3U7DA 1HE8A 1XD3B 1PQSA 2L8JA 3NZSA 3D32A 2JUOA 2KWVB 3DBRI 4IG7B 1E8ZA 3T8MA 2GOWA 2EMSA 3L0WB 5CHWA 3X0WA 4BOZB 4DBGA 4EZLA 2JPHA 3BINA 4W9HA 2NPTB 1UH6A 3ZLZA 3WAPA 2D2QA 3CSFA 4GGQA 3SDLC 3TJPA 2K8HA 4A3PA 1FXTB 5J2RA 3UF8A 2UWQA 1V5OA 3KYDD 3DVNU 2MQJA 4IWOA 3ZTDA 1E8WA 3W1SC 4HXDA 4KV2A 2JWZA 3A9KA 2MCNB 2BYEA 1LFDA 2BGFA 4WJOA 3RZFA 1S3SG 1YQBA 3HM3A 1WI0A 3A9KB 1UD7A 2G45B 4ANUA 1EO6A 4LCDE 4JLCA 3I3TB 4JGHB 3EECA 3APFA 3QARA 4KIKB 4NAWB 1UELA 1WR6E 3BY4B 5CHVC 2ZCCA 3ZIMA 4DDGD 3VUWA 2OOBB 4N9F4 2KDFB 1V9JA 3KH0A 2WX0A 2AL6A 2LXCA 2KTRB 2LRUA 4NY0A 1GJZA 2RR9A 3R7QA 4KVGB 2KJHB 5J17A 2CHWA 4JL9A 3PHWB 1Z2MA 3M63B 4ICVA 5DPRA 3UIOB 3WAOA 4OVUA 3PGEA 3QK0A 3PV1A 4W9CA 2KFKA 3EC8A 2RD0A 4WJNA 5E6PA 4IWQA 4HPLB 2NS5A 2QHOA 2IBIB 2C7MB 2LXAA 3B08A 3PLUA 2M0XA 2PE9A 4WJPA 1GUAB 3VTUA 2L0FA 1V80A 2BWFA 4GSWA 3ML9A 3ONSA 4FJYA 3CF6E 2PJHA 2G4DB 2R2QA 3KUCB 4F8CB 2K8BA 3OAWA 2JRIB 2O6VA 2ZPYA 1R4NI 3ZVVA 4W9JA 2NCNA 1WE6A 2V4LA 2JZZA 1LM8B 1XT9B 4EOYA 2JVCA 2KK8A 3JSVB 3H1UA 3TMPB 2DHZA 3VDZA 2I1JA 4ZYNA 1IYFA 2L76A 2DZJA 5D7GA 4MSQB 3JW0X 3WA0A 2KMAA 3PT2B 2FCMA 4KDIC 3ZTCA 3O65B 3AXCA 4TKNA 3PLVA 2PPHA 5CHFA 1E7UA 4BVUC 3H7PA 2KANA 5C23A 4GOCA 4BFRA 3IFWB 3DOWA 4GDLB 4GMVA 4TUUA 3QQ8B 3RULA 2DYMA 2DENB 5C1ZA 1P3QU 3A9JA 3NOBA 2M1MA 4FHKA 3UQAA 3AU5A 5G2NA 4FADA 1XQQA 1KM7A 2L7RA 2L3ZA 4ASWC 1YX5B 3KUDB 2LRWA 2EKEC 1SGHA 3RZWC 2Z0EB 1KJTA 2W9NA 4HCPB 4WWNA 2YLMA 4HCNB 2KO3A 4FHJA 1F9JA 4WWPA 3Q3FA 4M8MA 1OEYJ 4GDKB 1WMHA 4E3CA 5IAAC 5L95C 2IY0B 4K7WA 3R7RA 2FIFA 5G55A 1UGMA 2LI5A 3R66C 1J0GA 2IY1B 4GB9A 3CMMB 2IYDB 3X23A 3TCAA 3L13A 3GOEA 5CX3A 4B6WA 1GG3A 1IP9A 2KJ6A 3ZNID 3APCA 5BO4B 2ASQA 2KOXA 1WE7A 2HE7A 2MSED 4XZ4A 4KZCA 1VCBA 1ZKHA 2PEAA 3B0AA 3GZNI 1KOTA 4RM8A 3OLMD 4FLHA 4F7ZA 5JZEB 3PRPB 4HK2A 1J19A 2C7NB 3K9OB 4RMAA 1P98A 2KWCA 3HHMA 4IWPA 4I6PA 2ZZPB 2CHZA 1V6EA 1OTRB 2BYFA 2M17A 2NPTA 4HPMB 4HVBA 4EKUA 1S1QB 4MGYE 4AUQC 2GBJA 4K7UA 3SD5A 3VTVA 3N3KB 1WJUA 4CHKA 3ML8A 3EFUA 4B9KA 2CHXA 2MRPA 1SIFA 2AL3A 2O2VB 3PSEB 3KYCD 4MDKE 2LWPA 2FCQA 3KVFB 5D2MB 2LVQA 4BOSC 2HTHA 2FCNA 3JVZX 3ALBA 4KIKA 4NAWA 4GXBA 1WGGA 2FCSA 3LJ3A 3M3JA 5DPTA 4BKGA 2KX0A 2LVPA 2CU1A 2WWZA 4IUMB 3QIJA 1H8CA 4JIOU 2NBUA 3EHVA 2J0KA 2UYZB 4NQLB 2JY6A 2KTRA 2ZVNA 3ECIA 4E71A 1V86A 1WY8A 5EDSA 1LXDA 3UIPB 2KMCA 3UGBB 2ZNVC 2MBEA 3A33B 4KSLC 3DBLI 3DCGA 2K39A 2A5UA 3VAWA 2REXA 2D10A
chains in the Genus database with same CATH superfamily
2GRIA 2LZ6A 3ZNGC 3KWVA 3DVNV 3VH3B 2JF5A 1IUEA 2KDIA 3ZUNA 1WXVA 2K25A 2DYBA 2C60A 2WX1A 4A9AA 2J52A 4MACA 1N6ZA 3IHPC 1L2NA 2W55A 3RN9C 3NUHB 1NI2A 3I5JC 1GOZA 3QC8B 2CR5A 1FMAD 2KHWB 2M4NA 1ZDVA 4OZCA 3Q69A 3U4EG 3AE3B 3A1QB 3SFDB 4A3OA 2MJDA 1TJEA 4HEA1 4DHJD 1FNVA 1WFYA 3NZUA 4R3DA 2MBQA 5AZHA 5AZFA 2WXOA 2NR2A 1RM6C 4NJ6A 1TKEA 3WALA 1RAXA 2PKOA 4LNKA 2V3PA 3H7SA 3EA6A 1E8YA 3K9PB 2CS4A 3N9YC 4HWIB 2KDMA 3MC0B 1DYQA 1WWTA 2JXTA 2AQ2B 4NAMA 2N4FA 1GNUA 2Y5PA 2SAKA 4XDDA 1PUTA 1R4MI 1SEBD 5BMGA 1TGZB 3DQVA 1YMHE 2WXHA 1N62A 2DNFA 5BYRA 3H6NA 3O13A 2O2VA 2G3QB 3PVLA 4G11A 1K52A 1NDDA 5DCNA 1WGKA 3TSSA 5DPWA 3OJ4B 3Q8BA 2D07B 3OWEB 4TQ0A 4BBNC 1G6JA 1DOIA 3VTWA 1YN5A 1YOVB 4AJYB 4F1SA 3RT3B 3GE3C 3QCAA 1P9DU 2NBWB 1HA5A 2LGXA 3U7ZA 3LDZE 1KLGD 2WDTB 2MW5A 1YJ1A 4OVZA 3VFKA 4M0WB 4XWTA 1B9RA 3ZW3A 2BPSA 2FUHB 4HLEA 4K7SA 1I4GA 4O1NA 3DPDA 3MJWA 1L0YB 3U30A 2JZ3B 4LNNA 4RCOA 3H8HA 3B1LX 4C56C 4II2B 4MGIE 3ZDTA 2I38A 5EE0A 2LASA 3ZRCA 3VUYA 2LGDA 1LO5D 1JMLA 2IPKD 2BF8B 1MG8A 1K50A 5KHQA 3HM6X 5D6JB 2M8SA 3TEYA 2LHEA 3BK1A 1C79A 3QJZA 1SE3A 1JALA 2J7QB 1KTKA 1D3ZA 5I4DA 3UINB 3V6CB 3H7PB 4PS3A 1F2RI 4MH0E 5JH5C 4W9EA 1VZ7A 2MWSB 2K1FA 4W9IA 2N9PC 2XEWA 2J42A 2ICIA 1WJ6A 2WHIA 3FC4A 1WRDB 4EEWA 2BVCA 1DGJA 4PS7A 3AE4B 2IO1B 1J7AA 2K8CA 1WXMA 1SE9A 2MP2A 1WMHB 1ZPSA 1ET9A 1BUIC 2PVGC 3RNFC 3TEWA 4DXGA 5LLIA 3DWMA 1WM3A 1J7BA 3HIZA 4DHJB 3BZDB 2BS2B 1YJIA 4ANXA 3WIMA 2XK5B 3CSTA 4HKZE 3E56A 1L7YA 2PMVA 3PTFC 2CJNA 1XD3B 3NZSA 2JUOA 3T3OA 3R2TA 4IG7B 1E8ZA 1E0ZA 2GOWA 3ZGZA 4EZLA 4W9HA 1UH6A 2BTEA 3WAPA 3CSFA 1IGCA 2K8HA 1I4RA 3ZTDA 2JWZA 4ZRQA 2MCNB 3AN1A 4N58A 3HM3A 3A9KB 1UD7A 3AM9A 1SJHD 1F1HA 4C00A 1BXTA 4YSZB 1FM0D 3FKYA 4N9F4 1V9JA 3KH0A 1D5ZC 2GLSA 2RR9A 3Q8FA 2KWDA 5DPRA 3PHWB 3IAS1 2BB6A 3CWIA 1KH0A 2OEDA 2AX5A 1TS4A 3NVVA 4MH8A 1K53A 3PLUA 2PE9A 1EWYC 2MHJA 1SJED 2R2QA 3OAWA 2O6VA 2WXNA 1LM8B 3AB5A 3Q3NC 3OG5A 4ZHPA 2JVCA 2KK8A 4D2KA 3VDZA 2DZJA 4MSQB 3WA0A 2FCMA 3I57A 3PLVA 4C4VB 1VJKA 3R2IA 5C23A 1T0RC 4XWWA 4GDLB 3NS1A 4K3BA 2WXMA 1P3QU 4TSSA 3AU5A 4FADA 5EE1A 2YEPB 1FPYA 1C4AA 1YX5B 5AUKA 1C9FA 2W9NA 4WWNA 4KGTA 1OEYJ 5L95C 1L4ZB 1N5WA 1TS3A 3CIRB 2IY0B 1XCTL 1J0GA 3AEDB 3CMMB 2IYDB 5C2TB 2D3CA 3AMZA 3ZJUA 3ZNID 1FIQA 2MSED 4XZ4A 4RM8A 3RPFC 1Q10A 1XLPA 4YSXB 3Q8EA 3PRPB 1HQRD 2C7NB 4RMAA 4YTNB 1P98A 1J7CA 3DWGC 4ARIA 3AV8A 4I6PA 4DQOC 4KKIA 1OTRB 2NPTA 1CK1A 3Q3OC 4AUQC 2GBJA 5E6JA 1PGXA 2AL3A 3PSEB 3KYCD 3KVFB 3NG0A 3JVZX 3ALBA 4KIKA 4NAWA 1D6EC 3Q14C 4GXBA 1WGGA 5IN7A 2LVPA 1OQQA 4JIOU 1AN8A 2KTRA 3ECIA 4E71A 3ZJVA 1V1PA 1V86A 5EDSA 3UIPB 3RNEC 3DBLI 3DCGA 1VZ6A 3VAWA 2LEKA 1JWSD 2RSUA 3ZRFA 3SR6A 2N9XA 2FNJB 1A70A 2MJEA 3NVYA 4BBNF 2V1YA 1HTOA 4MM3A 4YSYB 4YWGG 3QAQA 1YIWA 4RM9A 4W9KA 1NBFC 4KSKC 2W3SA 2WXJA 4ARCA 2RPVA 1ZE3D 1YQ4B 2WYQA 1QLBB 4CO7A 4DDID 3AEEB 2LVOA 3IT6B 2K6DB 1CQVA 4ZYSA 2Q5WD 3RUIB 1JRPA 2DYOA 4NPNA 2L0TA 3PPAA 1JCKB 2RMMA 2OHFA 1CZPA 4MEMA 4IM0A 5G5GA 3TEXA 1E5WA 1CMXB 3NHEB 2KQ4X 4GDKA 3PZDA 3URYA 3U2SC 2B3AA 5IO9A 3ETRA 3A4SC 3RNBC 1MHXA 2G9HD 2KX3A 2LUMA 4N6EB 2BW2A 4XX5A 2IZVB 2KC2A 5J18A 4DXAB 2KVRA 4KX6B 2AQ3B 3L16A 1IBXA 2I1KA 4G50A 3N1YC 1WZ0A 1ISNA 2XBBC 3GP7A 4RGOS 4M8NA 2N1WA 2TSSA 3AEAB 1PYWD 2E3TA 2X8XX 2HTME 4PT5A 2MX2A 2WDVB 3AE7B 4NZLB 5FR6A 1QZEA 1C4CA 1WGDA 3KW5B 1WGRA 3TEZA 1GC6A 1WR1A 2N0SB 1C76A 2K6QA 2D5GA 2KQSA 4KGSA 4JX1C 1ZW7A 2ZPNA 1TY2A 2QEJC 4IM3A 4G0NB 3OJ3A 4YL8A 4I6LB 3PRMB 2PIAA 3AULA 3VUXA 1AARA 1WZ3A 5GXGB 3TL5A 4LLGM 4M0WA 1WH3A 2BWES 2ZVOA 2JYTA 2V0GA 2BYVE 3AEFB 3N30A 2Z59B 4GU2A 2KLGA 4LJOB 2KTFA 2IO0B 2HJ1A 2N7DA 4BKTA 2FE8A 2MLBA 5LXIB 4LJPB 5HI1A 2YVCA 4W9FA 4IM2A 4E74A 2KDBA 2D3BA 3DBHI 4WQMA 1MI0A 3L54A 2NTTA 2LGSA 4WWOA 4OZAA 2DAJA 3S2AA 2CKHB 1IPGA 2W3RA 2KJRA 3B2FA 1AYFA 2N7EA 2KN5A 2L05A 3DBSA 1C4PA 3L10B 4KZ0A 1TKYA 2IGGA 4Q2JA 1V97A 4PS8A 2WDRB 2N9EB 2DAFA 3AECB 2FAZA 2ZW1A 2JZPA 5E6OA 2HD5B 1XXGA 3ZKJC 3DDCB 2LUEA 4MJSA 3AE5B 4IW0A 1VRAB 3ZO5B 5HG2A 3VQIA 3A9JB 3MC9A 3V62A 1F52A 4FA6A 3IXSA 4OHJA 1BT0A 3DBHB 1BMLC 1V2YA 4P6VF 1C77A 4FULA 2FIDA 2X38A 2UU7A 1D4BA 4IDIA 2GB1A 4W9GA 2GBRA 5H92C 4AJWA 5AEKB 1T0SC 2VRRB 4ZRKA 3QA8A 2N7JA 3DVGY 4FJZA 2JXXA 2KLCA 2Y5BB 3DHHC 2BKRB 2XK5A 3WANA 3P4SB 2GI9A 2GBMA 2INPE 2MA9B 4WURA 2RDBC 1TZOA 4M02A 4PYZA 3MC8A 2KWVB 3V05A 2V3NA 3L0WB 3X0WA 3FILB 3ZLZA 4A3PA 1ZXIA 2ACZB 2BS3B 4S0RA 1V5OA 3UF8A 4IWOA 4XYCA 4BAXA 1JWUD 4HXDA 4L2YA 3A9KA 1NYRA 1LFDA 1JW9D 3RZFA 5G5HA 2INCC 4ANUA 1EO6A 4FXCA 4JWSC 3EECA 2JX5A 1KFYB 3IAM1 3BY4B 2OOBB 2KDFB 4NY0A 4KVGB 2KJHB 4WIPA 3M63B 2KT7A 4N59A 2QCZA 3P1MA 3WAOA 3PGEA 4W9CA 2KFKA 1XLQA 1XEEA 4HPLB 2NS5A 2QHOA 3B08A 2C7MB 4LNOA 5H8YE 4WJPA 1GUAB 1V80A 1RWSA 3CF6E 4F8CB 2K8BA 5MPOA 4CQNA 2V4LA 1XT9B 4EOYA 3H1UA 2LMCA 4ZYNA 4A8XC 3JW0X 3PT2B 5TSSA 3ZTCA 1C78A 1I4HA 1E7UA 3N20C 4BVUC 3RNCC 4IOIE 4BFRA 3IFWB 3DOWA 1F2RC 5LNK1 1NENB 3RULA 1ROEA 1DOYA 2WQYB 5G2NA 1XQQA 3EGRA 1KM7A 2N9LA 1N5XA 4ASWC 2LRWA 2EKEC 1SGHA 2L83A 2Z0EB 3RZWC 1KJTA 2ON8A 4HCNB 2KO3A 4FHJA 3Q3FA 4M8MA 3BVMA 4E3CA 1FFVA 3R7RA 1SF0A 1UGMA 4HPPA 4GB9A 5CX3A 1JWMD 3N1XC 4B6WA 1STEA 2KJ6A 3APCA 5BO4B 2KOXA 2HE7A 1CJEA 4KZCA 1ZKHA 2BB5A 2PEAA 3B0AA 1ZUD2 4FLHA 1FRRA 4J3OD 3RNAC 4HK2A 1J19A 3K9OB 4YXDB 2H88B 4A90A 4IWPA 2CHZA 1V6EA 1NI3A 2PW9A 2WXFA 4CHKA 4B9KA 2CHXA 2K22A 2O2VB 1TKGA 3IT4B 1M4VA 5D2MB 2LVQA 2WXGA 2HTHA 3HUIA 4LK0M 4B0EA 1SXTA 2WWZA 2NBUA 4NQLB 2JY6A 2QJLA 1LXDA 2KMCA 2ZNVC 4KSLC 3A33B 1J8CA 2D10A 2O6VD 2SEBD 3WCQA 5L83A 1SBBB 1ET6A 1KLUD 5JHAA 1ZGUB 1V49A 2DZIA 1PDXA 1QOGA 2AYOB 2GBNA 2K5PA 1UZXB 4BZAA 1OEYA 4AS1A 4DXFA 1Z5SB 3JSVA 2DBYA 3DVGX 2KQ7A 1T3QA 2JSVX 4NJCA 3VH4B 4URKA 3VHTC 1V5TA 1ACCA 5EE3A 1Q1OA 5LXHA 4II3B 4IC7B 5IP4D 3DHGC 5E6NA 3PO0A 3BVZA 4BKSA 1EWCA 2IGHA 3N32A 2PTLA 1UBIA 3V6EB 1WGHA 4LDTD 2KACA 4PYUA 4NQKE 2LFIA 1L4DB 1LQBA 5AUIA 4EUTA 3LB8C 1C3TA 2GMIC 1Q0WB 1XLNA 1V8CA 3Q2AC 2MBOA 1QT9A 1XO3A 2EELA 1UF0A 1YD8U 2OJWA 4ACFA 4L23A 4GLSC 1VZ8A 2V9HA 4EZKA 2KNBA 4RGMA 1EUVB 3PHXB 2KZRA 1Y56A 4USAA 1VD2A 3ZNHB 2INNE 3M95A 3PREA 1WRIA 2INDC 1VR9A 1KLVA 1D5MC 1TTNA 2ZCBA 3T9LA 4ZHOA 2KDEB 1TS2A 2V3SA 1WXAA 2WDQB 1FNWA 2MEKA 2IDYA 3MP9A 3W2DA 1WXSA 3FAHA 4X57B 3R3MA 1B1ZA 4AWJA 2AWTA 1L0VB 1E9MA 3RD2A 1WXQA 2MBHA 3SHQA 1WIAA 5D94A 2MJ3A 3NS8A 1K8RB 4WAAA 1H4RA 1WX9A 2H89B 2BT6A 2KMMA 2Y3AA 1OGWA 3R8BA 3ZYYX 2KD0A 1WX7A 4GN1A 3GB1A 1XCQL 3B9JA 2M19A 5JHBA 1F77A 1P1AA 1X1MA 1U4AA 3U52E 5GMVA 4JE3B 4M01A 2O6VB 3Q3MC 1WJNA 1RFAA 3A1QA 2Y5CA 4HJKA 2KC1A 2LD9A 3V60A 1SSNA 2LJ5A 3NRZA 4KDLB 1FEHA 4B95A 1HZ5A 4LNIA 3E9SA 1XF5L 1MFWA 3PZ7A 2RGFA 4RFBA 3DHIC 3PRZA 3IVFA 1I35A 3BVGA 2ZEQA 3ENEA 2N1VA 2WXIA 5HHDG 2QDFA 4TQ1A 2AEHA 2R61A 3RCZA 4JPSA 4JQWC 4W9DA 1MPEA 2BYTA 3TIXA 2L52A 3MHZA 2LGYA 4RNAA 1QILA 2XNAC 3W5VB 2XN9C 2CJOA 4ZDVA 1P7EA 1FO4A 3HVZA 3BWUD 2WXKA 3P2BA 2ZW0A 4LDTB 4FBJB 1PFDA 5IKCM 4HRSA 1RFKA 1MVKA 1YX6B 4RH6A 5AZGA 3B2GA 5BYSA 1PQSA 2L8JA 3DBRI 3FILA 3UI3A 2EMSA 2CU3A 4BOZB 4DBGA 1YN3A 1QQRA 2JPHA 3BINA 2NPTB 2RDGA 2D2QA 2KAJA 5JXVA 3SDLC 3KYDD 3DVNU 2MQJA 1E8WA 2BGFA 4WJOA 1S3SG 1YQBA 4IKGA 1WI0A 2G45B 3RI7C 4JLCA 1LGRA 3AEBB 3I3TB 1SIJA 3NVZA 4JGHB 4WAFA 2K9XA 2BS4B 4KIKB 4NAWB 1QF6A 1WR6E 3AH7A 2W54A 5CHVC 5IOIA 4DDGD 2J4XA 1N63A 3VUWA 3SFEB 1TIFA 1GJZA 2WX0A 2LXCA 2NMQA 2KTRB 2LRUA 3KWLA 3KLSX 1N61A 1E7PB 3GZNB 1YJJA 2VZKD 3UIOB 5EE9A 1I7HA 3QK0A 3PV1A 5FKAC 4EE2A 4IWQA 3P4PB 2IBIB 3DBRB 1UGJA 3VTUA 2L0FA 2BWFA 4GSWA 3ML9A 3KUCB 2JRIB 4MM3B 1UNSA 2G1EA 2ZPYA 1R4NI 1OQRA 1I4PA 2MH7A 2YEPF 3NJTA 1OFFA 4KDIC 3W9CB 3O65B 1IGDA 2PPHA 4JWUC 5CHFA 2W82A 3H7PA 3ZJTA 2KANA 4GOCA 4AQ7A 2PVOD 1VLBA 3QQ8B 2DYMA 1GAQB 2DENB 3HVDA 2E6XA 4MT5A 3NOBA 1T5XD 3LXFA 4C7YA 2L3ZA 3KUDB 1HTQA 4HCPB 2BQQA 4WH4A 1JWAD 4WWPA 2LJIA 4GDKB 1WMHA 5IAAC 2DLBA 1R4NB 2LHDA 4K7WA 3BK2A 5G55A 2LI5A 3R66C 3TCAA 3GOEA 1NYQA 1GG3A 1IP9A 2ASQA 4QAYA 1WE7A 1QKZA 3LYYA 3VR8B 1VCBA 4YTMB 1KOTA 1PGAA 1AW7A 5JZEB 2KWCA 1ZDXA 3HHMA 1IBXB 1QOAA 3HRDD 2FUG1 2ZZPB 2BYFA 4HPMB 4HVBA 4EKUA 1TS5A 4XGAB 3SD5A 3N3KB 1SIFA 2N9KA 4HKQA 2IJ0A 2FCQA 4BOSC 2FCNA 3P63A 3SEBA 2FCSA 5DPTA 4P1BC 3I9V1 3MJ5A 2MBEA 3EUB2 2K39A 2A5UA 1L6VA 4P16A 3W1YA 4HJGE 3NZ3A 3L08A 2C9WB 1WM2A 1R4MB 1YNTE 3V3XA 5HKHA 1M94A 5FR3A 3RYTA 2Z0DB 1T0YA 1V81A 2WU2B 2ONQA 2L1AA 1KF6B 4W9LA 1UWXA 1E90A 4REZA 1XLOA 4EFOA 3JYUA 1Y8RC 3ZXRA 1WGYA 4C4VA 3A4RA 4RGTA 4ANVA 5TR5A 2NVUI 5KHOA 4GDLA 2KWUB 4PK1A 1GB1A 1SE4A 2KVZA 2VZKB 4ZRPA 5FK9C 4ZRJA 3KQ4A 3QWZB 3NY5A 1FXAA 1UBQA 4KGRA 5C3JB 1HXYD 3UQBA 1FD6A 2A4ZA 3Q6BA 3W5UB 5DPSA 2LGIA 2V4IB 4RF1A 4AOFA 4AP4C 4ZOHC 2QILA 1WYWB 2IGDA 2IO3B 1D5XC 4MJSB 3J9CA 1L0XB 3IBEA 1Q5WB 1E7VA 2QMTA 3MTNB 5T8IA 3AE8B 2D11A 4CYEA 2DZMA 2G4SA 5D3IB 1EF5A 4OVVA 1FFUA 1WF9A 4MGZE 2C7HA 3QHTA 2DX5B 2EMTA 4HDOA 1I4QA 2JRHA 3RMKC 3Q3JA 1FNUA 1ZXHA 3SU8X 4L1BA 2C5LC 4K81A 2J0MA 1F0ZA 4S17A 3AI5A 3KUZA 4DWFA 4P7IA 4ZRIA 4NJ7A 4A20A 4WJQA 4UDUC 1NEKB 2PLPA 1QOBA 4J6IA 4OZBA 3VVWB 1WX8A 1YQ3B 1ZOYB 4K3CA 4P1CC 5IA7A 1TBEA 5CTRC 1K51A 2M0AA 4XC2A 3TBLD 2IO2B 4XDCA 2R2OA 3QX1A 2JWUA 3EFCA 3AE1B 3C19A 4OW0A 4DHZB 4C7ZA 2ZJDA 3L4PA 1JROA 4EZJA 2WS3B 4GIVA 2J0JA 2HJ8A 3BIID 1SB3C 4ICUA 4K1RB 3RFZB 3Q8AA 4A6QA 2PE6B 3IG3A 1OQYA 2JQRB 2WNMA 3AE2B 2BKFA 2KXJA 1FXIA 1P0RA 3AE6B 3MHSD 4BKSD 3U8ZA 1A5RA 1TZ1A 4XE0A 4LNFA 5BMIA 2HDEA 2JT4B 3PS6A 5HFYA 2KFKB 1MHHE 3H9DA 2AQ1B 3ZDMC 3ZNZB 1RYJA 1E10A 4ANWA 1RLFA 3Q8CA 1DOXA 1C1YB 3APDA 2DWQA 3W1SA 2Z8LA 2L00B 4TV3A 1EF1A 5BMHA 2D3GA 1TYGB 3I63C 3WAMA 1JQ4A 2WXQA 3L17A 3RNGC 4NNJB 4DHZE 2RPQA 1GC7A 1I42A 2KKCA 3ZXVA 1NVID 1SE2A 4HDQA 1HEZE 4H2AA 2ZNVB 4LTUA 4WWMA 1E8XA 3C0RB 4MELA 2M56B 1V1OA 1JWBD 1R7SA 1RRBA 4MSMB 1HZ6A 2NBVB 1FRDA 4B0MA 3AU4A 2OJRA 1JRUA 3V61A 2MP2B 2WXPA 4WQOB 4DK5A 1EU4A 4FJVB 4G3XB 1GPXA 2EKIA 3GS2A 3HK0A 3P4RB 1L5PA 2KFJA 2DZKA 4MGKE 2WU5B 4FN2A 2MBBB 3VXWA 3M62B 4I6NB 3TUOA 1WJ4A 2GBKA 3U7DA 1HE8A 3D32A 3T8MA 5CHWA 2WGSA 3C8YA 4GGQA 2JYEA 1FCLA 3TJPA 4YT0B 1FXTB 3ABVB 3ZQ4A 5J2RA 1GB4A 2UWQA 3W1SC 3AEGB 4KV2A 3BYTB 2BYEA 1EM7A 4LCDE 3APFA 3QARA 4US8A 1UELA 3VRBB 2ZCCA 3ZIMA 1MG4A 2AL6A 1QOFA 1TY0A 5D3DA 3R7QA 2K3UA 1WYGA 1P7FA 2D3AA 3BYYB 3P4QB 5J17A 2CHWA 4JL9A 4ICVA 1Z2MA 4OVUA 2RDHA 2L32A 3EC8A 2RD0A 4WJNA 5E6PA 1L6UA 2LXAA 2B76B 2M0XA 1ENFA 3ONSA 4FJYA 2PJHA 2G4DB 2VH2A 2FBWB 3ZVVA 4W9JA 2NCNA 1WE6A 1UWMA 2NTSA 2JZZA 3JSVB 3TMPB 2DHZA 2I1JA 1IYFA 2L76A 5D7GA 4HROA 1PGBA 2KMAA 3AXCA 4TKNA 2JU6X 3MFGA 4A55A 2VH1A 4GMVA 4TUUA 3NVWA 3DBLB 5C1ZA 3A9JA 4US9A 2J53A 2KYWA 3VRAB 2QC8A 2M1MA 4FHKA 3UQAA 4TMAB 1E6EB 2L7RA 1FCCC 4M00A 3GE8C 2KN4A 2WLBA 1T6BX 2YLMA 4YTPB 1F9JA 3N1ZC 1EU3A 1AWDA 2FIFA 2IY1B 3X23A 3L13A 2WP9B 1TT5B 4C80A 3AE9B 3GZNI 1MJDA 3OLMD 4F7ZA 1T0QC 2WXRA 1ESFA 1N60A 1YN4A 2M17A 1S1QB 4MGYE 1KRHA 4K7UA 3VTVA 1WJUA 1ZP0B 5BYQA 3T3NA 1I4XA 3ML8A 3EFUA 2MRPA 2BBCA 4MDKE 4RGNA 2LWPA 2QSDA 3P42A 4ITKA 1WSPA 2WXLA 2QIEB 3PZ8A 3LJ3A 2K0PA 3M3JA 4BKGA 2KX0A 2CU1A 4IUMB 1H8CA 3QIJA 3VR9B 3EHVA 1UUPA 2J0KA 2UYZB 2ZVNA 1WY8A 1VDVA 3UGBB 1V1PB 4RF0A 4KKJA 2REXA 2I2YA
chains in the Genus database with same CATH topology
2O6VD 3W1YA 5L83A 2LZ6A 2RSUA 3L08A 3ZNGC 2C9WB 3DVNV 3ZRFA 1WM2A 5JHAA 3VH3B 2JF5A 2KDIA 1ZGUB 3ZUNA 1WXVA 2FNJB 2N9XA 1V49A 2DZIA 4BBNF 5HKHA 1M94A 2AYOB 2V1YA 2GBNA 2K25A 2DYBA 3RYTA 2C60A 4MM3A 1UZXB 2Z0DB 1T0YA 1OEYA 1YIWA 1V81A 3QAQA 4RM9A 4W9KA 2WX1A 1NBFC 1Z5SB 3JSVA 4W9LA 3DVGX 1E90A 2KQ7A 4KSKC 3IHPC 1L2NA 3VH4B 4EFOA 4URKA 3VHTC 1V5TA 3JYUA 1Q1OA 1Y8RC 5LXHA 1NI2A 1WGYA 4II3B 4IC7B 3A4RA 3QC8B 2WYQA 5E6NA 4ANVA 4CO7A 4DDID 5TR5A 2CR5A 2NVUI 5KHOA 2LVOA 4GDLA 2KHWB 2KWUB 2K6DB 2M4NA 4BKSA 3RUIB 4ZRJA 2DYOA 4NPNA 3N32A 2L0TA 3PPAA 1UBIA 3QWZB 3NY5A 1UBQA 3A1QB 3V6EB 4A3OA 4MEMA 4IM0A 1WGHA 4LDTD 3UQBA 4DHJD 2A4ZA 1WFYA 4PYUA 3NZUA 4NQKE 2MBQA 1E5WA 1CMXB 1LQBA 3NHEB 4GDKA 5DPSA 5AZHA 4EUTA 3PZDA 1C3TA 5AZFA 2B3AA 2GMIC 1Q0WB 2NR2A 3A4SC 4AOFA 4NJ6A 4AP4C 2KX3A 1WYWB 2IO3B 4MJSB 2MBOA 3WALA 1RAXA 1YD8U 3IBEA 1Q5WB 4XX5A 2IZVB 3H7SA 2KC2A 5J18A 4DXAB 1E8YA 3K9PB 2CS4A 2KVRA 1E7VA 3MTNB 4HWIB 2D11A 4CYEA 2DZMA 2G4SA 3L16A 2N4FA 2I1KA 4EZKA 4G50A 1GNUA 1EF5A 4OVVA 2KNBA 1WF9A 4MGZE 2C7HA 1WZ0A 1EUVB 1ISNA 3QHTA 3PHXB 1R4MI 2DX5B 2EMTA 2XBBC 4HDOA 2KZRA 4M8NA 2N1WA 2JRHA 1TGZB 1VD2A 3Q3JA 3DQVA 3SU8X 3ZNHB 2C5LC 3M95A 3H6NA 3PREA 2J0MA 4K81A 3PVLA 2O2VA 2G3QB 4G11A 2MX2A 1KLVA 1NDDA 3AI5A 3KUZA 5DCNA 4DWFA 4P7IA 4ZRIA 4NJ7A 4A20A 4WJQA 1TTNA 2ZCBA 5FR6A 5DPWA 1QZEA 3T9LA 3OJ4B 1WGDA 4J6IA 3VVWB 3KW5B 1WGRA 2D07B 1GC6A 1WR1A 1WX8A 2KDEB 4TQ0A 4BBNC 2K6QA 2V3SA 1G6JA 2KQSA 1WXAA 3VTWA 1ZW7A 2ZPNA 4AJYB 4F1SA 4IM3A 5IA7A 1TBEA 4G0NB 5CTRC 3OJ3A 3RT3B 4YL8A 4I6LB 3PRMB 3QCAA 1P9DU 2NBWB 3AULA 3VUXA 1AARA 1WZ3A 2LGXA 3LDZE 4XC2A 1WXSA 2WDTB 4X57B 3TBLD 3TL5A 2IO2B 1WH3A 2BWES 2R2OA 3QX1A 2MW5A 2ZVOA 3R3MA 1YJ1A 4DHZB 3VFKA 4AWJA 2AWTA 4M0WB 2ZJDA 2BYVE 3N30A 2Z59B 4EZJA 3RD2A 3ZW3A 2BPSA 4GU2A 4GIVA 2FUHB 2KLGA 4LJOB 2J0JA 2MBHA 4HLEA 3SHQA 2HJ8A 1WIAA 2KTFA 5D94A 4ICUA 3NS8A 4K1RB 2IO0B 4K7SA 2N7DA 4BKTA 1K8RB 2MLBA 2PE6B 4WAAA 3IG3A 5LXIB 1H4RA 1OQYA 3DPDA 3MJWA 4LJPB 3U30A 2JZ3B 2BKFA 2KXJA 2YVCA 1WX9A 1P0RA 4W9FA 3B1LX 4IM2A 3MHSD 4BKSD 4II2B 4MGIE 1TZ1A 3U8ZA 3ZDTA 4E74A 1A5RA 1OGWA 2KD0A 2KDBA 1WX7A 2JT4B 3PS6A 4GN1A 3DBHI 3L54A 2KFKB 5JHBA 3H9DA 1P1AA 1X1MA 2LASA 3ZDMC 3ZNZB 1U4AA 3ZRCA 3VUYA 2LGDA 4WWOA 5GMVA 4ANWA 1RLFA 1C1YB 2DAJA 3APDA 3S2AA 2CKHB 2BF8B 1MG8A 1IPGA 5KHQA 3HM6X 2KJRA 5D6JB 2N7EA 3W1SA 2M8SA 2O6VB 2KN5A 2L05A 3DBSA 2L00B 4TV3A 1WJNA 1RFAA 1EF1A 3A1QA 3L10B 4KZ0A 3QJZA 4HJKA 2D3GA 2KC1A 3WAMA 2J7QB 2LD9A 3L17A 3V60A 1D3ZA 2LJ5A 4NNJB 4KDLB 4DHZE 2RPQA 1GC7A 4B95A 4PS8A 1I42A 2N9EB 2DAFA 2KKCA 2FAZA 3UINB 3V6CB 3H7PB 4PS3A 4HDQA 5E6OA 4MH0E 2RGFA 5JH5C 2HD5B 4W9EA 2ZNVB 2MWSB 2K1FA 3DDCB 3PRZA 2LUEA 4MJSA 4W9IA 4IW0A 3ZKJC 2N9PC 2XEWA 3IVFA 3ZO5B 1I35A 3VQIA 3A9JB 2ZEQA 3ENEA 1WJ6A 1E8XA 3V62A 2N1VA 4FA6A 3C0RB 4MELA 4TQ1A 1WRDB 4EEWA 2AEHA 1BT0A 3RCZA 4PS7A 1V2YA 4JQWC 4W9DA 4FULA 3TIXA 2FIDA 2LGYA 1RRBA 4MSMB 2IO1B 2NBVB 2K8CA 3AU4A 1WXMA 4ZDVA 4W9GA 1SE9A 2GBRA 2OJRA 1JRUA 2MP2A 1WMHB 3V61A 4AJWA 5AEKB 2VRRB 2MP2B 5LLIA 4WQOB 4ZRKA 1WM3A 3P2BA 3QA8A 4FJVB 4DK5A 1J8CA 4LDTB 3HIZA 3DVGY 4DHJB 4FJZA 4FBJB 4G3XB 2JXXA 2KLCA 2Y5BB 2BKRB 2XK5A 3WANA 4ANXA 1YX6B 2GBMA 3HK0A 2MA9B 5AZGA 3WIMA 2XK5B 2KFJA 3CSTA 2DZKA 1L7YA 4MGKE 4FN2A 2MBBB 3VXWA 4PYZA 3M62B 4I6NB 3PTFC 1WJ4A 2GBKA 3U7DA 1HE8A 1XD3B 1PQSA 2L8JA 3NZSA 3D32A 2JUOA 2KWVB 3DBRI 4IG7B 1E8ZA 3T8MA 2GOWA 2EMSA 3L0WB 5CHWA 3X0WA 4BOZB 4DBGA 4EZLA 2JPHA 3BINA 4W9HA 2NPTB 1UH6A 3ZLZA 3WAPA 2D2QA 3CSFA 4GGQA 3SDLC 3TJPA 2K8HA 4A3PA 1FXTB 5J2RA 3UF8A 2UWQA 1V5OA 3KYDD 3DVNU 2MQJA 4IWOA 3ZTDA 1E8WA 3W1SC 4HXDA 4KV2A 2JWZA 3A9KA 2MCNB 2BYEA 1LFDA 2BGFA 4WJOA 3RZFA 1S3SG 1YQBA 3HM3A 1WI0A 3A9KB 1UD7A 2G45B 4ANUA 1EO6A 4LCDE 4JLCA 3I3TB 4JGHB 3EECA 3APFA 3QARA 4KIKB 4NAWB 1UELA 1WR6E 3BY4B 5CHVC 2ZCCA 3ZIMA 4DDGD 3VUWA 2OOBB 4N9F4 2KDFB 1V9JA 3KH0A 2WX0A 2AL6A 2LXCA 2KTRB 2LRUA 4NY0A 1GJZA 2RR9A 3R7QA 4KVGB 2KJHB 5J17A 2CHWA 4JL9A 3PHWB 1Z2MA 3M63B 4ICVA 5DPRA 3UIOB 3WAOA 4OVUA 3PGEA 3QK0A 3PV1A 4W9CA 2KFKA 3EC8A 2RD0A 4WJNA 5E6PA 4IWQA 4HPLB 2NS5A 2QHOA 2IBIB 2C7MB 2LXAA 3B08A 3PLUA 2M0XA 2PE9A 4WJPA 1GUAB 3VTUA 2L0FA 1V80A 2BWFA 4GSWA 3ML9A 3ONSA 4FJYA 3CF6E 2PJHA 2G4DB 2R2QA 3KUCB 4F8CB 2K8BA 3OAWA 2JRIB 2O6VA 2ZPYA 1R4NI 3ZVVA 4W9JA 2NCNA 1WE6A 2V4LA 2JZZA 1LM8B 1XT9B 4EOYA 2JVCA 2KK8A 3JSVB 3H1UA 3TMPB 2DHZA 3VDZA 2I1JA 4ZYNA 1IYFA 2L76A 2DZJA 5D7GA 4MSQB 3JW0X 3WA0A 2KMAA 3PT2B 2FCMA 4KDIC 3ZTCA 3O65B 3AXCA 4TKNA 3PLVA 2PPHA 5CHFA 1E7UA 4BVUC 3H7PA 2KANA 5C23A 4GOCA 4BFRA 3IFWB 3DOWA 4GDLB 4GMVA 4TUUA 3QQ8B 3RULA 2DYMA 2DENB 5C1ZA 1P3QU 3A9JA 3NOBA 2M1MA 4FHKA 3UQAA 3AU5A 5G2NA 4FADA 1XQQA 1KM7A 2L7RA 2L3ZA 4ASWC 1YX5B 3KUDB 2LRWA 2EKEC 1SGHA 3RZWC 2Z0EB 1KJTA 2W9NA 4HCPB 4WWNA 2YLMA 4HCNB 2KO3A 4FHJA 1F9JA 4WWPA 3Q3FA 4M8MA 1OEYJ 4GDKB 1WMHA 4E3CA 5IAAC 5L95C 2IY0B 4K7WA 3R7RA 2FIFA 5G55A 1UGMA 2LI5A 3R66C 1J0GA 2IY1B 4GB9A 3CMMB 2IYDB 3X23A 3TCAA 3L13A 3GOEA 5CX3A 4B6WA 1GG3A 1IP9A 2KJ6A 3ZNID 3APCA 5BO4B 2ASQA 2KOXA 1WE7A 2HE7A 2MSED 4XZ4A 4KZCA 1VCBA 1ZKHA 2PEAA 3B0AA 3GZNI 1KOTA 4RM8A 3OLMD 4FLHA 4F7ZA 5JZEB 3PRPB 4HK2A 1J19A 2C7NB 3K9OB 4RMAA 1P98A 2KWCA 3HHMA 4IWPA 4I6PA 2ZZPB 2CHZA 1V6EA 1OTRB 2BYFA 2M17A 2NPTA 4HPMB 4HVBA 4EKUA 1S1QB 4MGYE 4AUQC 2GBJA 4K7UA 3SD5A 3VTVA 3N3KB 1WJUA 4CHKA 3ML8A 3EFUA 4B9KA 2CHXA 2MRPA 1SIFA 2AL3A 2O2VB 3PSEB 3KYCD 4MDKE 2LWPA 2FCQA 3KVFB 5D2MB 2LVQA 4BOSC 2HTHA 2FCNA 3JVZX 3ALBA 4KIKA 4NAWA 4GXBA 1WGGA 2FCSA 3LJ3A 3M3JA 5DPTA 4BKGA 2KX0A 2LVPA 2CU1A 2WWZA 4IUMB 3QIJA 1H8CA 4JIOU 2NBUA 3EHVA 2J0KA 2UYZB 4NQLB 2JY6A 2KTRA 2ZVNA 3ECIA 4E71A 1V86A 1WY8A 5EDSA 1LXDA 3UIPB 2KMCA 3UGBB 2ZNVC 2MBEA 3A33B 4KSLC 3DBLI 3DCGA 2K39A 2A5UA 3VAWA 2REXA 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V D;  3W1Y A;  5L83 A;  2LZ6 A;  2RSU A;  3L08 A;  3ZNG C;  2C9W B;  3DVN V;  3ZRF A;  1WM2 A;  5JHA A;  3VH3 B;  2JF5 A;  2KDI A;  1ZGU B;  3ZUN A;  1WXV A;  2FNJ B;  2N9X A;  1V49 A;  2DZI A;  4BBN F;  5HKH A;  1M94 A;  2AYO B;  2V1Y A;  2GBN A;  2K25 A;  2DYB A;  3RYT A;  2C60 A;  4MM3 A;  1UZX B;  2Z0D B;  1T0Y A;  1OEY A;  1YIW A;  1V81 A;  3QAQ A;  4RM9 A;  4W9K A;  2WX1 A;  1NBF C;  1Z5S B;  3JSV A;  4W9L A;  3DVG X;  1E90 A;  2KQ7 A;  4KSK C;  3IHP C;  1L2N A;  3VH4 B;  4EFO A;  4URK A;  3VHT C;  1V5T A;  3JYU A;  1Q1O A;  1Y8R C;  5LXH A;  1NI2 A;  1WGY A;  4II3 B;  4IC7 B;  3A4R A;  3QC8 B;  2WYQ A;  5E6N A;  4ANV A;  4CO7 A;  4DDI D;  5TR5 A;  2CR5 A;  2NVU I;  5KHO A;  2LVO A;  4GDL A;  2KHW B;  2KWU B;  2K6D B;  2M4N A;  4BKS A;  3RUI B;  4ZRJ A;  2DYO A;  4NPN A;  3N32 A;  2L0T A;  3PPA A;  1UBI A;  3QWZ B;  3NY5 A;  1UBQ A;  3A1Q B;  3V6E B;  4A3O A;  4MEM A;  4IM0 A;  1WGH A;  4LDT D;  3UQB A;  4DHJ D;  2A4Z A;  1WFY A;  4PYU A;  3NZU A;  4NQK E;  2MBQ A;  1E5W A;  1CMX B;  1LQB A;  3NHE B;  4GDK A;  5DPS A;  5AZH A;  4EUT A;  3PZD A;  1C3T A;  5AZF A;  2B3A A;  2GMI C;  1Q0W B;  2NR2 A;  3A4S C;  4AOF A;  4NJ6 A;  4AP4 C;  2KX3 A;  1WYW B;  2IO3 B;  4MJS B;  2MBO A;  3WAL A;  1RAX A;  1YD8 U;  3IBE A;  1Q5W B;  4XX5 A;  2IZV B;  3H7S A;  2KC2 A;  5J18 A;  4DXA B;  1E8Y A;  3K9P B;  2CS4 A;  2KVR A;  1E7V A;  3MTN B;  4HWI B;  2D11 A;  4CYE A;  2DZM A;  2G4S A;  3L16 A;  2N4F A;  2I1K A;  4EZK A;  4G50 A;  1GNU A;  1EF5 A;  4OVV A;  2KNB A;  1WF9 A;  4MGZ E;  2C7H A;  1WZ0 A;  1EUV B;  1ISN A;  3QHT A;  3PHX B;  1R4M I;  2DX5 B;  2EMT A;  2XBB C;  4HDO A;  2KZR A;  4M8N A;  2N1W A;  2JRH A;  1TGZ B;  1VD2 A;  3Q3J A;  3DQV A;  3SU8 X;  3ZNH B;  2C5L C;  3M95 A;  3H6N A;  3PRE A;  2J0M A;  4K81 A;  3PVL A;  2O2V A;  2G3Q B;  4G11 A;  2MX2 A;  1KLV A;  1NDD A;  3AI5 A;  3KUZ A;  5DCN A;  4DWF A;  4P7I A;  4ZRI A;  4NJ7 A;  4A20 A;  4WJQ A;  1TTN A;  2ZCB A;  5FR6 A;  5DPW A;  1QZE A;  3T9L A;  3OJ4 B;  1WGD A;  4J6I A;  3VVW B;  3KW5 B;  1WGR A;  2D07 B;  1GC6 A;  1WR1 A;  1WX8 A;  2KDE B;  4TQ0 A;  4BBN C;  2K6Q A;  2V3S A;  1G6J A;  2KQS A;  1WXA A;  3VTW A;  1ZW7 A;  2ZPN A;  4AJY B;  4F1S A;  4IM3 A;  5IA7 A;  1TBE A;  4G0N B;  5CTR C;  3OJ3 A;  3RT3 B;  4YL8 A;  4I6L B;  3PRM B;  3QCA A;  1P9D U;  2NBW B;  3AUL A;  3VUX A;  1AAR A;  1WZ3 A;  2LGX A;  3LDZ E;  4XC2 A;  1WXS A;  2WDT B;  4X57 B;  3TBL D;  3TL5 A;  2IO2 B;  1WH3 A;  2BWE S;  2R2O A;  3QX1 A;  2MW5 A;  2ZVO A;  3R3M A;  1YJ1 A;  4DHZ B;  3VFK A;  4AWJ A;  2AWT A;  4M0W B;  2ZJD A;  2BYV E;  3N30 A;  2Z59 B;  4EZJ A;  3RD2 A;  3ZW3 A;  2BPS A;  4GU2 A;  4GIV A;  2FUH B;  2KLG A;  4LJO B;  2J0J A;  2MBH A;  4HLE A;  3SHQ A;  2HJ8 A;  1WIA A;  2KTF A;  5D94 A;  4ICU A;  3NS8 A;  4K1R B;  2IO0 B;  4K7S A;  2N7D A;  4BKT A;  1K8R B;  2MLB A;  2PE6 B;  4WAA A;  3IG3 A;  5LXI B;  1H4R A;  1OQY A;  3DPD A;  3MJW A;  4LJP B;  3U30 A;  2JZ3 B;  2BKF A;  2KXJ A;  2YVC A;  1WX9 A;  1P0R A;  4W9F A;  3B1L X;  4IM2 A;  3MHS D;  4BKS D;  4II2 B;  4MGI E;  1TZ1 A;  3U8Z A;  3ZDT A;  4E74 A;  1A5R A;  1OGW A;  2KD0 A;  2KDB A;  1WX7 A;  2JT4 B;  3PS6 A;  4GN1 A;  3DBH I;  3L54 A;  2KFK B;  5JHB A;  3H9D A;  1P1A A;  1X1M A;  2LAS A;  3ZDM C;  3ZNZ B;  1U4A A;  3ZRC A;  3VUY A;  2LGD A;  4WWO A;  5GMV A;  4ANW A;  1RLF A;  1C1Y B;  2DAJ A;  3APD A;  3S2A A;  2CKH B;  2BF8 B;  1MG8 A;  1IPG A;  5KHQ A;  3HM6 X;  2KJR A;  5D6J B;  2N7E A;  3W1S A;  2M8S A;  2O6V B;  2KN5 A;  2L05 A;  3DBS A;  2L00 B;  4TV3 A;  1WJN A;  1RFA A;  1EF1 A;  3A1Q A;  3L10 B;  4KZ0 A;  3QJZ A;  4HJK A;  2D3G A;  2KC1 A;  3WAM A;  2J7Q B;  2LD9 A;  3L17 A;  3V60 A;  1D3Z A;  2LJ5 A;  4NNJ B;  4KDL B;  4DHZ E;  2RPQ A;  1GC7 A;  4B95 A;  4PS8 A;  1I42 A;  2N9E B;  2DAF A;  2KKC A;  2FAZ A;  3UIN B;  3V6C B;  3H7P B;  4PS3 A;  4HDQ A;  5E6O A;  4MH0 E;  2RGF A;  5JH5 C;  2HD5 B;  4W9E A;  2ZNV B;  2MWS B;  2K1F A;  3DDC B;  3PRZ A;  2LUE A;  4MJS A;  4W9I A;  4IW0 A;  3ZKJ C;  2N9P C;  2XEW A;  3IVF A;  3ZO5 B;  1I35 A;  3VQI A;  3A9J B;  2ZEQ A;  3ENE A;  1WJ6 A;  1E8X A;  3V62 A;  2N1V A;  4FA6 A;  3C0R B;  4MEL A;  4TQ1 A;  1WRD B;  4EEW A;  2AEH A;  1BT0 A;  3RCZ A;  4PS7 A;  1V2Y A;  4JQW C;  4W9D A;  4FUL A;  3TIX A;  2FID A;  2LGY A;  1RRB A;  4MSM B;  2IO1 B;  2NBV B;  2K8C A;  3AU4 A;  1WXM A;  4ZDV A;  4W9G A;  1SE9 A;  2GBR A;  2OJR A;  1JRU A;  2MP2 A;  1WMH B;  3V61 A;  4AJW A;  5AEK B;  2VRR B;  2MP2 B;  5LLI A;  4WQO B;  4ZRK A;  1WM3 A;  3P2B A;  3QA8 A;  4FJV B;  4DK5 A;  1J8C A;  4LDT B;  3HIZ A;  3DVG Y;  4DHJ B;  4FJZ A;  4FBJ B;  4G3X B;  2JXX A;  2KLC A;  2Y5B B;  2BKR B;  2XK5 A;  3WAN A;  4ANX A;  1YX6 B;  2GBM A;  3HK0 A;  2MA9 B;  5AZG A;  3WIM A;  2XK5 B;  2KFJ A;  3CST A;  2DZK A;  1L7Y A;  4MGK E;  4FN2 A;  2MBB B;  3VXW A;  4PYZ A;  3M62 B;  4I6N B;  3PTF C;  1WJ4 A;  2GBK A;  3U7D A;  1HE8 A;  1XD3 B;  1PQS A;  2L8J A;  3NZS A;  3D32 A;  2JUO A;  2KWV B;  3DBR I;  4IG7 B;  1E8Z A;  3T8M A;  2GOW A;  2EMS A;  3L0W B;  5CHW A;  3X0W A;  4BOZ B;  4DBG A;  4EZL A;  2JPH A;  3BIN A;  4W9H A;  2NPT B;  1UH6 A;  3ZLZ A;  3WAP A;  2D2Q A;  3CSF A;  4GGQ A;  3SDL C;  3TJP A;  2K8H A;  4A3P A;  1FXT B;  5J2R A;  3UF8 A;  2UWQ A;  1V5O A;  3KYD D;  3DVN U;  2MQJ A;  4IWO A;  3ZTD A;  1E8W A;  3W1S C;  4HXD A;  4KV2 A;  2JWZ A;  3A9K A;  2MCN B;  2BYE A;  1LFD A;  2BGF A;  4WJO A;  3RZF A;  1S3S G;  1YQB A;  3HM3 A;  1WI0 A;  3A9K B;  1UD7 A;  2G45 B;  4ANU A;  1EO6 A;  4LCD E;  4JLC A;  3I3T B;  4JGH B;  3EEC A;  3APF A;  3QAR A;  4KIK B;  4NAW B;  1UEL A;  1WR6 E;  3BY4 B;  5CHV C;  2ZCC A;  3ZIM A;  4DDG D;  3VUW A;  2OOB B;  4N9F 4;  2KDF B;  1V9J A;  3KH0 A;  2WX0 A;  2AL6 A;  2LXC A;  2KTR B;  2LRU A;  4NY0 A;  1GJZ A;  2RR9 A;  3R7Q A;  4KVG B;  2KJH B;  5J17 A;  2CHW A;  4JL9 A;  3PHW B;  1Z2M A;  3M63 B;  4ICV A;  5DPR A;  3UIO B;  3WAO A;  4OVU A;  3PGE A;  3QK0 A;  3PV1 A;  4W9C A;  2KFK A;  3EC8 A;  2RD0 A;  4WJN A;  5E6P A;  4IWQ A;  4HPL B;  2NS5 A;  2QHO A;  2IBI B;  2C7M B;  2LXA A;  3B08 A;  3PLU A;  2M0X A;  2PE9 A;  4WJP A;  1GUA B;  3VTU A;  2L0F A;  1V80 A;  2BWF A;  4GSW A;  3ML9 A;  3ONS A;  4FJY A;  3CF6 E;  2PJH A;  2G4D B;  2R2Q A;  3KUC B;  4F8C B;  2K8B A;  3OAW A;  2JRI B;  2O6V A;  2ZPY A;  1R4N I;  3ZVV A;  4W9J A;  2NCN A;  1WE6 A;  2V4L A;  2JZZ A;  1LM8 B;  1XT9 B;  4EOY A;  2JVC A;  2KK8 A;  3JSV B;  3H1U A;  3TMP B;  2DHZ A;  3VDZ A;  2I1J A;  4ZYN A;  1IYF A;  2L76 A;  2DZJ A;  5D7G A;  4MSQ B;  3JW0 X;  3WA0 A;  2KMA A;  3PT2 B;  2FCM A;  4KDI C;  3ZTC A;  3O65 B;  3AXC A;  4TKN A;  3PLV A;  2PPH A;  5CHF A;  1E7U A;  4BVU C;  3H7P A;  2KAN A;  5C23 A;  4GOC A;  4BFR A;  3IFW B;  3DOW A;  4GDL B;  4GMV A;  4TUU A;  3QQ8 B;  3RUL A;  2DYM A;  2DEN B;  5C1Z A;  1P3Q U;  3A9J A;  3NOB A;  2M1M A;  4FHK A;  3UQA A;  3AU5 A;  5G2N A;  4FAD A;  1XQQ A;  1KM7 A;  2L7R A;  2L3Z A;  4ASW C;  1YX5 B;  3KUD B;  2LRW A;  2EKE C;  1SGH A;  3RZW C;  2Z0E B;  1KJT A;  2W9N A;  4HCP B;  4WWN A;  2YLM A;  4HCN B;  2KO3 A;  4FHJ A;  1F9J A;  4WWP A;  3Q3F A;  4M8M A;  1OEY J;  4GDK B;  1WMH A;  4E3C A;  5IAA C;  5L95 C;  2IY0 B;  4K7W A;  3R7R A;  2FIF A;  5G55 A;  1UGM A;  2LI5 A;  3R66 C;  1J0G A;  2IY1 B;  4GB9 A;  3CMM B;  2IYD B;  3X23 A;  3TCA A;  3L13 A;  3GOE A;  5CX3 A;  4B6W A;  1GG3 A;  1IP9 A;  2KJ6 A;  3ZNI D;  3APC A;  5BO4 B;  2ASQ A;  2KOX A;  1WE7 A;  2HE7 A;  2MSE D;  4XZ4 A;  4KZC A;  1VCB A;  1ZKH A;  2PEA A;  3B0A A;  3GZN I;  1KOT A;  4RM8 A;  3OLM D;  4FLH A;  4F7Z A;  5JZE B;  3PRP B;  4HK2 A;  1J19 A;  2C7N B;  3K9O B;  4RMA A;  1P98 A;  2KWC A;  3HHM A;  4IWP A;  4I6P A;  2ZZP B;  2CHZ A;  1V6E A;  1OTR B;  2BYF A;  2M17 A;  2NPT A;  4HPM B;  4HVB A;  4EKU A;  1S1Q B;  4MGY E;  4AUQ C;  2GBJ A;  4K7U A;  3SD5 A;  3VTV A;  3N3K B;  1WJU A;  4CHK A;  3ML8 A;  3EFU A;  4B9K A;  2CHX A;  2MRP A;  1SIF A;  2AL3 A;  2O2V B;  3PSE B;  3KYC D;  4MDK E;  2LWP A;  2FCQ A;  3KVF B;  5D2M B;  2LVQ A;  4BOS C;  2HTH A;  2FCN A;  3JVZ X;  3ALB A;  4KIK A;  4NAW A;  4GXB A;  1WGG A;  2FCS A;  3LJ3 A;  3M3J A;  5DPT A;  4BKG A;  2KX0 A;  2LVP A;  2CU1 A;  2WWZ A;  4IUM B;  3QIJ A;  1H8C A;  4JIO U;  2NBU A;  3EHV A;  2J0K A;  2UYZ B;  4NQL B;  2JY6 A;  2KTR A;  2ZVN A;  3ECI A;  4E71 A;  1V86 A;  1WY8 A;  5EDS A;  1LXD A;  3UIP B;  2KMC A;  3UGB B;  2ZNV C;  2MBE A;  3A33 B;  4KSL C;  3DBL I;  3DCG A;  2K39 A;  2A5U A;  3VAW A;  2REX A;  2D10 A; 
#chains in the Genus database with same CATH topology
 2GRI A;  2LZ6 A;  3ZNG C;  3KWV A;  3DVN V;  3VH3 B;  2JF5 A;  1IUE A;  2KDI A;  3ZUN A;  1WXV A;  2K25 A;  2DYB A;  2C60 A;  2WX1 A;  4A9A A;  2J52 A;  4MAC A;  1N6Z A;  3IHP C;  1L2N A;  2W55 A;  3RN9 C;  3NUH B;  1NI2 A;  3I5J C;  1GOZ A;  3QC8 B;  2CR5 A;  1FMA D;  2KHW B;  2M4N A;  1ZDV A;  4OZC A;  3Q69 A;  3U4E G;  3AE3 B;  3A1Q B;  3SFD B;  4A3O A;  2MJD A;  1TJE A;  4HEA 1;  4DHJ D;  1FNV A;  1WFY A;  3NZU A;  4R3D A;  2MBQ A;  5AZH A;  5AZF A;  2WXO A;  2NR2 A;  1RM6 C;  4NJ6 A;  1TKE A;  3WAL A;  1RAX A;  2PKO A;  4LNK A;  2V3P A;  3H7S A;  3EA6 A;  1E8Y A;  3K9P B;  2CS4 A;  3N9Y C;  4HWI B;  2KDM A;  3MC0 B;  1DYQ A;  1WWT A;  2JXT A;  2AQ2 B;  4NAM A;  2N4F A;  1GNU A;  2Y5P A;  2SAK A;  4XDD A;  1PUT A;  1R4M I;  1SEB D;  5BMG A;  1TGZ B;  3DQV A;  1YMH E;  2WXH A;  1N62 A;  2DNF A;  5BYR A;  3H6N A;  3O13 A;  2O2V A;  2G3Q B;  3PVL A;  4G11 A;  1K52 A;  1NDD A;  5DCN A;  1WGK A;  3TSS A;  5DPW A;  3OJ4 B;  3Q8B A;  2D07 B;  3OWE B;  4TQ0 A;  4BBN C;  1G6J A;  1DOI A;  3VTW A;  1YN5 A;  1YOV B;  4AJY B;  4F1S A;  3RT3 B;  3GE3 C;  3QCA A;  1P9D U;  2NBW B;  1HA5 A;  2LGX A;  3U7Z A;  3LDZ E;  1KLG D;  2WDT B;  2MW5 A;  1YJ1 A;  4OVZ A;  3VFK A;  4M0W B;  4XWT A;  1B9R A;  3ZW3 A;  2BPS A;  2FUH B;  4HLE A;  4K7S A;  1I4G A;  4O1N A;  3DPD A;  3MJW A;  1L0Y B;  3U30 A;  2JZ3 B;  4LNN A;  4RCO A;  3H8H A;  3B1L X;  4C56 C;  4II2 B;  4MGI E;  3ZDT A;  2I38 A;  5EE0 A;  2LAS A;  3ZRC A;  3VUY A;  2LGD A;  1LO5 D;  1JML A;  2IPK D;  2BF8 B;  1MG8 A;  1K50 A;  5KHQ A;  3HM6 X;  5D6J B;  2M8S A;  3TEY A;  2LHE A;  3BK1 A;  1C79 A;  3QJZ A;  1SE3 A;  1JAL A;  2J7Q B;  1KTK A;  1D3Z A;  5I4D A;  3UIN B;  3V6C B;  3H7P B;  4PS3 A;  1F2R I;  4MH0 E;  5JH5 C;  4W9E A;  1VZ7 A;  2MWS B;  2K1F A;  4W9I A;  2N9P C;  2XEW A;  2J42 A;  2ICI A;  1WJ6 A;  2WHI A;  3FC4 A;  1WRD B;  4EEW A;  2BVC A;  1DGJ A;  4PS7 A;  3AE4 B;  2IO1 B;  1J7A A;  2K8C A;  1WXM A;  1SE9 A;  2MP2 A;  1WMH B;  1ZPS A;  1ET9 A;  1BUI C;  2PVG C;  3RNF C;  3TEW A;  4DXG A;  5LLI A;  3DWM A;  1WM3 A;  1J7B A;  3HIZ A;  4DHJ B;  3BZD B;  2BS2 B;  1YJI A;  4ANX A;  3WIM A;  2XK5 B;  3CST A;  4HKZ E;  3E56 A;  1L7Y A;  2PMV A;  3PTF C;  2CJN A;  1XD3 B;  3NZS A;  2JUO A;  3T3O A;  3R2T A;  4IG7 B;  1E8Z A;  1E0Z A;  2GOW A;  3ZGZ A;  4EZL A;  4W9H A;  1UH6 A;  2BTE A;  3WAP A;  3CSF A;  1IGC A;  2K8H A;  1I4R A;  3ZTD A;  2JWZ A;  4ZRQ A;  2MCN B;  3AN1 A;  4N58 A;  3HM3 A;  3A9K B;  1UD7 A;  3AM9 A;  1SJH D;  1F1H A;  4C00 A;  1BXT A;  4YSZ B;  1FM0 D;  3FKY A;  4N9F 4;  1V9J A;  3KH0 A;  1D5Z C;  2GLS A;  2RR9 A;  3Q8F A;  2KWD A;  5DPR A;  3PHW B;  3IAS 1;  2BB6 A;  3CWI A;  1KH0 A;  2OED A;  2AX5 A;  1TS4 A;  3NVV A;  4MH8 A;  1K53 A;  3PLU A;  2PE9 A;  1EWY C;  2MHJ A;  1SJE D;  2R2Q A;  3OAW A;  2O6V A;  2WXN A;  1LM8 B;  3AB5 A;  3Q3N C;  3OG5 A;  4ZHP A;  2JVC A;  2KK8 A;  4D2K A;  3VDZ A;  2DZJ A;  4MSQ B;  3WA0 A;  2FCM A;  3I57 A;  3PLV A;  4C4V B;  1VJK A;  3R2I A;  5C23 A;  1T0R C;  4XWW A;  4GDL B;  3NS1 A;  4K3B A;  2WXM A;  1P3Q U;  4TSS A;  3AU5 A;  4FAD A;  5EE1 A;  2YEP B;  1FPY A;  1C4A A;  1YX5 B;  5AUK A;  1C9F A;  2W9N A;  4WWN A;  4KGT A;  1OEY J;  5L95 C;  1L4Z B;  1N5W A;  1TS3 A;  3CIR B;  2IY0 B;  1XCT L;  1J0G A;  3AED B;  3CMM B;  2IYD B;  5C2T B;  2D3C A;  3AMZ A;  3ZJU A;  3ZNI D;  1FIQ A;  2MSE D;  4XZ4 A;  4RM8 A;  3RPF C;  1Q10 A;  1XLP A;  4YSX B;  3Q8E A;  3PRP B;  1HQR D;  2C7N B;  4RMA A;  4YTN B;  1P98 A;  1J7C A;  3DWG C;  4ARI A;  3AV8 A;  4I6P A;  4DQO C;  4KKI A;  1OTR B;  2NPT A;  1CK1 A;  3Q3O C;  4AUQ C;  2GBJ A;  5E6J A;  1PGX A;  2AL3 A;  3PSE B;  3KYC D;  3KVF B;  3NG0 A;  3JVZ X;  3ALB A;  4KIK A;  4NAW A;  1D6E C;  3Q14 C;  4GXB A;  1WGG A;  5IN7 A;  2LVP A;  1OQQ A;  4JIO U;  1AN8 A;  2KTR A;  3ECI A;  4E71 A;  3ZJV A;  1V1P A;  1V86 A;  5EDS A;  3UIP B;  3RNE C;  3DBL I;  3DCG A;  1VZ6 A;  3VAW A;  2LEK A;  1JWS D;  2RSU A;  3ZRF A;  3SR6 A;  2N9X A;  2FNJ B;  1A70 A;  2MJE A;  3NVY A;  4BBN F;  2V1Y A;  1HTO A;  4MM3 A;  4YSY B;  4YWG G;  3QAQ A;  1YIW A;  4RM9 A;  4W9K A;  1NBF C;  4KSK C;  2W3S A;  2WXJ A;  4ARC A;  2RPV A;  1ZE3 D;  1YQ4 B;  2WYQ A;  1QLB B;  4CO7 A;  4DDI D;  3AEE B;  2LVO A;  3IT6 B;  2K6D B;  1CQV A;  4ZYS A;  2Q5W D;  3RUI B;  1JRP A;  2DYO A;  4NPN A;  2L0T A;  3PPA A;  1JCK B;  2RMM A;  2OHF A;  1CZP A;  4MEM A;  4IM0 A;  5G5G A;  3TEX A;  1E5W A;  1CMX B;  3NHE B;  2KQ4 X;  4GDK A;  3PZD A;  3URY A;  3U2S C;  2B3A A;  5IO9 A;  3ETR A;  3A4S C;  3RNB C;  1MHX A;  2G9H D;  2KX3 A;  2LUM A;  4N6E B;  2BW2 A;  4XX5 A;  2IZV B;  2KC2 A;  5J18 A;  4DXA B;  2KVR A;  4KX6 B;  2AQ3 B;  3L16 A;  1IBX A;  2I1K A;  4G50 A;  3N1Y C;  1WZ0 A;  1ISN A;  2XBB C;  3GP7 A;  4RGO S;  4M8N A;  2N1W A;  2TSS A;  3AEA B;  1PYW D;  2E3T A;  2X8X X;  2HTM E;  4PT5 A;  2MX2 A;  2WDV B;  3AE7 B;  4NZL B;  5FR6 A;  1QZE A;  1C4C A;  1WGD A;  3KW5 B;  1WGR A;  3TEZ A;  1GC6 A;  1WR1 A;  2N0S B;  1C76 A;  2K6Q A;  2D5G A;  2KQS A;  4KGS A;  4JX1 C;  1ZW7 A;  2ZPN A;  1TY2 A;  2QEJ C;  4IM3 A;  4G0N B;  3OJ3 A;  4YL8 A;  4I6L B;  3PRM B;  2PIA A;  3AUL A;  3VUX A;  1AAR A;  1WZ3 A;  5GXG B;  3TL5 A;  4LLG M;  4M0W A;  1WH3 A;  2BWE S;  2ZVO A;  2JYT A;  2V0G A;  2BYV E;  3AEF B;  3N30 A;  2Z59 B;  4GU2 A;  2KLG A;  4LJO B;  2KTF A;  2IO0 B;  2HJ1 A;  2N7D A;  4BKT A;  2FE8 A;  2MLB A;  5LXI B;  4LJP B;  5HI1 A;  2YVC A;  4W9F A;  4IM2 A;  4E74 A;  2KDB A;  2D3B A;  3DBH I;  4WQM A;  1MI0 A;  3L54 A;  2NTT A;  2LGS A;  4WWO A;  4OZA A;  2DAJ A;  3S2A A;  2CKH B;  1IPG A;  2W3R A;  2KJR A;  3B2F A;  1AYF A;  2N7E A;  2KN5 A;  2L05 A;  3DBS A;  1C4P A;  3L10 B;  4KZ0 A;  1TKY A;  2IGG A;  4Q2J A;  1V97 A;  4PS8 A;  2WDR B;  2N9E B;  2DAF A;  3AEC B;  2FAZ A;  2ZW1 A;  2JZP A;  5E6O A;  2HD5 B;  1XXG A;  3ZKJ C;  3DDC B;  2LUE A;  4MJS A;  3AE5 B;  4IW0 A;  1VRA B;  3ZO5 B;  5HG2 A;  3VQI A;  3A9J B;  3MC9 A;  3V62 A;  1F52 A;  4FA6 A;  3IXS A;  4OHJ A;  1BT0 A;  3DBH B;  1BML C;  1V2Y A;  4P6V F;  1C77 A;  4FUL A;  2FID A;  2X38 A;  2UU7 A;  1D4B A;  4IDI A;  2GB1 A;  4W9G A;  2GBR A;  5H92 C;  4AJW A;  5AEK B;  1T0S C;  2VRR B;  4ZRK A;  3QA8 A;  2N7J A;  3DVG Y;  4FJZ A;  2JXX A;  2KLC A;  2Y5B B;  3DHH C;  2BKR B;  2XK5 A;  3WAN A;  3P4S B;  2GI9 A;  2GBM A;  2INP E;  2MA9 B;  4WUR A;  2RDB C;  1TZO A;  4M02 A;  4PYZ A;  3MC8 A;  2KWV B;  3V05 A;  2V3N A;  3L0W B;  3X0W A;  3FIL B;  3ZLZ A;  4A3P A;  1ZXI A;  2ACZ B;  2BS3 B;  4S0R A;  1V5O A;  3UF8 A;  4IWO A;  4XYC A;  4BAX A;  1JWU D;  4HXD A;  4L2Y A;  3A9K A;  1NYR A;  1LFD A;  1JW9 D;  3RZF A;  5G5H A;  2INC C;  4ANU A;  1EO6 A;  4FXC A;  4JWS C;  3EEC A;  2JX5 A;  1KFY B;  3IAM 1;  3BY4 B;  2OOB B;  2KDF B;  4NY0 A;  4KVG B;  2KJH B;  4WIP A;  3M63 B;  2KT7 A;  4N59 A;  2QCZ A;  3P1M A;  3WAO A;  3PGE A;  4W9C A;  2KFK A;  1XLQ A;  1XEE A;  4HPL B;  2NS5 A;  2QHO A;  3B08 A;  2C7M B;  4LNO A;  5H8Y E;  4WJP A;  1GUA B;  1V80 A;  1RWS A;  3CF6 E;  4F8C B;  2K8B A;  5MPO A;  4CQN A;  2V4L A;  1XT9 B;  4EOY A;  3H1U A;  2LMC A;  4ZYN A;  4A8X C;  3JW0 X;  3PT2 B;  5TSS A;  3ZTC A;  1C78 A;  1I4H A;  1E7U A;  3N20 C;  4BVU C;  3RNC C;  4IOI E;  4BFR A;  3IFW B;  3DOW A;  1F2R C;  5LNK 1;  1NEN B;  3RUL A;  1ROE A;  1DOY A;  2WQY B;  5G2N A;  1XQQ A;  3EGR A;  1KM7 A;  2N9L A;  1N5X A;  4ASW C;  2LRW A;  2EKE C;  1SGH A;  2L83 A;  2Z0E B;  3RZW C;  1KJT A;  2ON8 A;  4HCN B;  2KO3 A;  4FHJ A;  3Q3F A;  4M8M A;  3BVM A;  4E3C A;  1FFV A;  3R7R A;  1SF0 A;  1UGM A;  4HPP A;  4GB9 A;  5CX3 A;  1JWM D;  3N1X C;  4B6W A;  1STE A;  2KJ6 A;  3APC A;  5BO4 B;  2KOX A;  2HE7 A;  1CJE A;  4KZC A;  1ZKH A;  2BB5 A;  2PEA A;  3B0A A;  1ZUD 2;  4FLH A;  1FRR A;  4J3O D;  3RNA C;  4HK2 A;  1J19 A;  3K9O B;  4YXD B;  2H88 B;  4A90 A;  4IWP A;  2CHZ A;  1V6E A;  1NI3 A;  2PW9 A;  2WXF A;  4CHK A;  4B9K A;  2CHX A;  2K22 A;  2O2V B;  1TKG A;  3IT4 B;  1M4V A;  5D2M B;  2LVQ A;  2WXG A;  2HTH A;  3HUI A;  4LK0 M;  4B0E A;  1SXT A;  2WWZ A;  2NBU A;  4NQL B;  2JY6 A;  2QJL A;  1LXD A;  2KMC A;  2ZNV C;  4KSL C;  3A33 B;  1J8C A;  2D10 A;  2O6V D;  2SEB D;  3WCQ A;  5L83 A;  1SBB B;  1ET6 A;  1KLU D;  5JHA A;  1ZGU B;  1V49 A;  2DZI A;  1PDX A;  1QOG A;  2AYO B;  2GBN A;  2K5P A;  1UZX B;  4BZA A;  1OEY A;  4AS1 A;  4DXF A;  1Z5S B;  3JSV A;  2DBY A;  3DVG X;  2KQ7 A;  1T3Q A;  2JSV X;  4NJC A;  3VH4 B;  4URK A;  3VHT C;  1V5T A;  1ACC A;  5EE3 A;  1Q1O A;  5LXH A;  4II3 B;  4IC7 B;  5IP4 D;  3DHG C;  5E6N A;  3PO0 A;  3BVZ A;  4BKS A;  1EWC A;  2IGH A;  3N32 A;  2PTL A;  1UBI A;  3V6E B;  1WGH A;  4LDT D;  2KAC A;  4PYU A;  4NQK E;  2LFI A;  1L4D B;  1LQB A;  5AUI A;  4EUT A;  3LB8 C;  1C3T A;  2GMI C;  1Q0W B;  1XLN A;  1V8C A;  3Q2A C;  2MBO A;  1QT9 A;  1XO3 A;  2EEL A;  1UF0 A;  1YD8 U;  2OJW A;  4ACF A;  4L23 A;  4GLS C;  1VZ8 A;  2V9H A;  4EZK A;  2KNB A;  4RGM A;  1EUV B;  3PHX B;  2KZR A;  1Y56 A;  4USA A;  1VD2 A;  3ZNH B;  2INN E;  3M95 A;  3PRE A;  1WRI A;  2IND C;  1VR9 A;  1KLV A;  1D5M C;  1TTN A;  2ZCB A;  3T9L A;  4ZHO A;  2KDE B;  1TS2 A;  2V3S A;  1WXA A;  2WDQ B;  1FNW A;  2MEK A;  2IDY A;  3MP9 A;  3W2D A;  1WXS A;  3FAH A;  4X57 B;  3R3M A;  1B1Z A;  4AWJ A;  2AWT A;  1L0V B;  1E9M A;  3RD2 A;  1WXQ A;  2MBH A;  3SHQ A;  1WIA A;  5D94 A;  2MJ3 A;  3NS8 A;  1K8R B;  4WAA A;  1H4R A;  1WX9 A;  2H89 B;  2BT6 A;  2KMM A;  2Y3A A;  1OGW A;  3R8B A;  3ZYY X;  2KD0 A;  1WX7 A;  4GN1 A;  3GB1 A;  1XCQ L;  3B9J A;  2M19 A;  5JHB A;  1F77 A;  1P1A A;  1X1M A;  1U4A A;  3U52 E;  5GMV A;  4JE3 B;  4M01 A;  2O6V B;  3Q3M C;  1WJN A;  1RFA A;  3A1Q A;  2Y5C A;  4HJK A;  2KC1 A;  2LD9 A;  3V60 A;  1SSN A;  2LJ5 A;  3NRZ A;  4KDL B;  1FEH A;  4B95 A;  1HZ5 A;  4LNI A;  3E9S A;  1XF5 L;  1MFW A;  3PZ7 A;  2RGF A;  4RFB A;  3DHI C;  3PRZ A;  3IVF A;  1I35 A;  3BVG A;  2ZEQ A;  3ENE A;  2N1V A;  2WXI A;  5HHD G;  2QDF A;  4TQ1 A;  2AEH A;  2R61 A;  3RCZ A;  4JPS A;  4JQW C;  4W9D A;  1MPE A;  2BYT A;  3TIX A;  2L52 A;  3MHZ A;  2LGY A;  4RNA A;  1QIL A;  2XNA C;  3W5V B;  2XN9 C;  2CJO A;  4ZDV A;  1P7E A;  1FO4 A;  3HVZ A;  3BWU D;  2WXK A;  3P2B A;  2ZW0 A;  4LDT B;  4FBJ B;  1PFD A;  5IKC M;  4HRS A;  1RFK A;  1MVK A;  1YX6 B;  4RH6 A;  5AZG A;  3B2G A;  5BYS A;  1PQS A;  2L8J A;  3DBR I;  3FIL A;  3UI3 A;  2EMS A;  2CU3 A;  4BOZ B;  4DBG A;  1YN3 A;  1QQR A;  2JPH A;  3BIN A;  2NPT B;  2RDG A;  2D2Q A;  2KAJ A;  5JXV A;  3SDL C;  3KYD D;  3DVN U;  2MQJ A;  1E8W A;  2BGF A;  4WJO A;  1S3S G;  1YQB A;  4IKG A;  1WI0 A;  2G45 B;  3RI7 C;  4JLC A;  1LGR A;  3AEB B;  3I3T B;  1SIJ A;  3NVZ A;  4JGH B;  4WAF A;  2K9X A;  2BS4 B;  4KIK B;  4NAW B;  1QF6 A;  1WR6 E;  3AH7 A;  2W54 A;  5CHV C;  5IOI A;  4DDG D;  2J4X A;  1N63 A;  3VUW A;  3SFE B;  1TIF A;  1GJZ A;  2WX0 A;  2LXC A;  2NMQ A;  2KTR B;  2LRU A;  3KWL A;  3KLS X;  1N61 A;  1E7P B;  3GZN B;  1YJJ A;  2VZK D;  3UIO B;  5EE9 A;  1I7H A;  3QK0 A;  3PV1 A;  5FKA C;  4EE2 A;  4IWQ A;  3P4P B;  2IBI B;  3DBR B;  1UGJ A;  3VTU A;  2L0F A;  2BWF A;  4GSW A;  3ML9 A;  3KUC B;  2JRI B;  4MM3 B;  1UNS A;  2G1E A;  2ZPY A;  1R4N I;  1OQR A;  1I4P A;  2MH7 A;  2YEP F;  3NJT A;  1OFF A;  4KDI C;  3W9C B;  3O65 B;  1IGD A;  2PPH A;  4JWU C;  5CHF A;  2W82 A;  3H7P A;  3ZJT A;  2KAN A;  4GOC A;  4AQ7 A;  2PVO D;  1VLB A;  3QQ8 B;  2DYM A;  1GAQ B;  2DEN B;  3HVD A;  2E6X A;  4MT5 A;  3NOB A;  1T5X D;  3LXF A;  4C7Y A;  2L3Z A;  3KUD B;  1HTQ A;  4HCP B;  2BQQ A;  4WH4 A;  1JWA D;  4WWP A;  2LJI A;  4GDK B;  1WMH A;  5IAA C;  2DLB A;  1R4N B;  2LHD A;  4K7W A;  3BK2 A;  5G55 A;  2LI5 A;  3R66 C;  3TCA A;  3GOE A;  1NYQ A;  1GG3 A;  1IP9 A;  2ASQ A;  4QAY A;  1WE7 A;  1QKZ A;  3LYY A;  3VR8 B;  1VCB A;  4YTM B;  1KOT A;  1PGA A;  1AW7 A;  5JZE B;  2KWC A;  1ZDX A;  3HHM A;  1IBX B;  1QOA A;  3HRD D;  2FUG 1;  2ZZP B;  2BYF A;  4HPM B;  4HVB A;  4EKU A;  1TS5 A;  4XGA B;  3SD5 A;  3N3K B;  1SIF A;  2N9K A;  4HKQ A;  2IJ0 A;  2FCQ A;  4BOS C;  2FCN A;  3P63 A;  3SEB A;  2FCS A;  5DPT A;  4P1B C;  3I9V 1;  3MJ5 A;  2MBE A;  3EUB 2;  2K39 A;  2A5U A;  1L6V A;  4P16 A;  3W1Y A;  4HJG E;  3NZ3 A;  3L08 A;  2C9W B;  1WM2 A;  1R4M B;  1YNT E;  3V3X A;  5HKH A;  1M94 A;  5FR3 A;  3RYT A;  2Z0D B;  1T0Y A;  1V81 A;  2WU2 B;  2ONQ A;  2L1A A;  1KF6 B;  4W9L A;  1UWX A;  1E90 A;  4REZ A;  1XLO A;  4EFO A;  3JYU A;  1Y8R C;  3ZXR A;  1WGY A;  4C4V A;  3A4R A;  4RGT A;  4ANV A;  5TR5 A;  2NVU I;  5KHO A;  4GDL A;  2KWU B;  4PK1 A;  1GB1 A;  1SE4 A;  2KVZ A;  2VZK B;  4ZRP A;  5FK9 C;  4ZRJ A;  3KQ4 A;  3QWZ B;  3NY5 A;  1FXA A;  1UBQ A;  4KGR A;  5C3J B;  1HXY D;  3UQB A;  1FD6 A;  2A4Z A;  3Q6B A;  3W5U B;  5DPS A;  2LGI A;  2V4I B;  4RF1 A;  4AOF A;  4AP4 C;  4ZOH C;  2QIL A;  1WYW B;  2IGD A;  2IO3 B;  1D5X C;  4MJS B;  3J9C A;  1L0X B;  3IBE A;  1Q5W B;  1E7V A;  2QMT A;  3MTN B;  5T8I A;  3AE8 B;  2D11 A;  4CYE A;  2DZM A;  2G4S A;  5D3I B;  1EF5 A;  4OVV A;  1FFU A;  1WF9 A;  4MGZ E;  2C7H A;  3QHT A;  2DX5 B;  2EMT A;  4HDO A;  1I4Q A;  2JRH A;  3RMK C;  3Q3J A;  1FNU A;  1ZXH A;  3SU8 X;  4L1B A;  2C5L C;  4K81 A;  2J0M A;  1F0Z A;  4S17 A;  3AI5 A;  3KUZ A;  4DWF A;  4P7I A;  4ZRI A;  4NJ7 A;  4A20 A;  4WJQ A;  4UDU C;  1NEK B;  2PLP A;  1QOB A;  4J6I A;  4OZB A;  3VVW B;  1WX8 A;  1YQ3 B;  1ZOY B;  4K3C A;  4P1C C;  5IA7 A;  1TBE A;  5CTR C;  1K51 A;  2M0A A;  4XC2 A;  3TBL D;  2IO2 B;  4XDC A;  2R2O A;  3QX1 A;  2JWU A;  3EFC A;  3AE1 B;  3C19 A;  4OW0 A;  4DHZ B;  4C7Z A;  2ZJD A;  3L4P A;  1JRO A;  4EZJ A;  2WS3 B;  4GIV A;  2J0J A;  2HJ8 A;  3BII D;  1SB3 C;  4ICU A;  4K1R B;  3RFZ B;  3Q8A A;  4A6Q A;  2PE6 B;  3IG3 A;  1OQY A;  2JQR B;  2WNM A;  3AE2 B;  2BKF A;  2KXJ A;  1FXI A;  1P0R A;  3AE6 B;  3MHS D;  4BKS D;  3U8Z A;  1A5R A;  1TZ1 A;  4XE0 A;  4LNF A;  5BMI A;  2HDE A;  2JT4 B;  3PS6 A;  5HFY A;  2KFK B;  1MHH E;  3H9D A;  2AQ1 B;  3ZDM C;  3ZNZ B;  1RYJ A;  1E10 A;  4ANW A;  1RLF A;  3Q8C A;  1DOX A;  1C1Y B;  3APD A;  2DWQ A;  3W1S A;  2Z8L A;  2L00 B;  4TV3 A;  1EF1 A;  5BMH A;  2D3G A;  1TYG B;  3I63 C;  3WAM A;  1JQ4 A;  2WXQ A;  3L17 A;  3RNG C;  4NNJ B;  4DHZ E;  2RPQ A;  1GC7 A;  1I42 A;  2KKC A;  3ZXV A;  1NVI D;  1SE2 A;  4HDQ A;  1HEZ E;  4H2A A;  2ZNV B;  4LTU A;  4WWM A;  1E8X A;  3C0R B;  4MEL A;  2M56 B;  1V1O A;  1JWB D;  1R7S A;  1RRB A;  4MSM B;  1HZ6 A;  2NBV B;  1FRD A;  4B0M A;  3AU4 A;  2OJR A;  1JRU A;  3V61 A;  2MP2 B;  2WXP A;  4WQO B;  4DK5 A;  1EU4 A;  4FJV B;  4G3X B;  1GPX A;  2EKI A;  3GS2 A;  3HK0 A;  3P4R B;  1L5P A;  2KFJ A;  2DZK A;  4MGK E;  2WU5 B;  4FN2 A;  2MBB B;  3VXW A;  3M62 B;  4I6N B;  3TUO A;  1WJ4 A;  2GBK A;  3U7D A;  1HE8 A;  3D32 A;  3T8M A;  5CHW A;  2WGS A;  3C8Y A;  4GGQ A;  2JYE A;  1FCL A;  3TJP A;  4YT0 B;  1FXT B;  3ABV B;  3ZQ4 A;  5J2R A;  1GB4 A;  2UWQ A;  3W1S C;  3AEG B;  4KV2 A;  3BYT B;  2BYE A;  1EM7 A;  4LCD E;  3APF A;  3QAR A;  4US8 A;  1UEL A;  3VRB B;  2ZCC A;  3ZIM A;  1MG4 A;  2AL6 A;  1QOF A;  1TY0 A;  5D3D A;  3R7Q A;  2K3U A;  1WYG A;  1P7F A;  2D3A A;  3BYY B;  3P4Q B;  5J17 A;  2CHW A;  4JL9 A;  4ICV A;  1Z2M A;  4OVU A;  2RDH A;  2L32 A;  3EC8 A;  2RD0 A;  4WJN A;  5E6P A;  1L6U A;  2LXA A;  2B76 B;  2M0X A;  1ENF A;  3ONS A;  4FJY A;  2PJH A;  2G4D B;  2VH2 A;  2FBW B;  3ZVV A;  4W9J A;  2NCN A;  1WE6 A;  1UWM A;  2NTS A;  2JZZ A;  3JSV B;  3TMP B;  2DHZ A;  2I1J A;  1IYF A;  2L76 A;  5D7G A;  4HRO A;  1PGB A;  2KMA A;  3AXC A;  4TKN A;  2JU6 X;  3MFG A;  4A55 A;  2VH1 A;  4GMV A;  4TUU A;  3NVW A;  3DBL B;  5C1Z A;  3A9J A;  4US9 A;  2J53 A;  2KYW A;  3VRA B;  2QC8 A;  2M1M A;  4FHK A;  3UQA A;  4TMA B;  1E6E B;  2L7R A;  1FCC C;  4M00 A;  3GE8 C;  2KN4 A;  2WLB A;  1T6B X;  2YLM A;  4YTP B;  1F9J A;  3N1Z C;  1EU3 A;  1AWD A;  2FIF A;  2IY1 B;  3X23 A;  3L13 A;  2WP9 B;  1TT5 B;  4C80 A;  3AE9 B;  3GZN I;  1MJD A;  3OLM D;  4F7Z A;  1T0Q C;  2WXR A;  1ESF A;  1N60 A;  1YN4 A;  2M17 A;  1S1Q B;  4MGY E;  1KRH A;  4K7U A;  3VTV A;  1WJU A;  1ZP0 B;  5BYQ A;  3T3N A;  1I4X A;  3ML8 A;  3EFU A;  2MRP A;  2BBC A;  4MDK E;  4RGN A;  2LWP A;  2QSD A;  3P42 A;  4ITK A;  1WSP A;  2WXL A;  2QIE B;  3PZ8 A;  3LJ3 A;  2K0P A;  3M3J A;  4BKG A;  2KX0 A;  2CU1 A;  4IUM B;  1H8C A;  3QIJ A;  3VR9 B;  3EHV A;  1UUP A;  2J0K A;  2UYZ B;  2ZVN A;  1WY8 A;  1VDV A;  3UGB B;  1V1P B;  4RF0 A;  4KKJ A;  2REX A;  2I2Y A; 
#chains in the Genus database with same CATH homology
 2O6V D;  3W1Y A;  5L83 A;  2LZ6 A;  2RSU A;  3L08 A;  3ZNG C;  2C9W B;  3DVN V;  3ZRF A;  1WM2 A;  5JHA A;  3VH3 B;  2JF5 A;  2KDI A;  1ZGU B;  3ZUN A;  1WXV A;  2FNJ B;  2N9X A;  1V49 A;  2DZI A;  4BBN F;  5HKH A;  1M94 A;  2AYO B;  2V1Y A;  2GBN A;  2K25 A;  2DYB A;  3RYT A;  2C60 A;  4MM3 A;  1UZX B;  2Z0D B;  1T0Y A;  1OEY A;  1YIW A;  1V81 A;  3QAQ A;  4RM9 A;  4W9K A;  2WX1 A;  1NBF C;  1Z5S B;  3JSV A;  4W9L A;  3DVG X;  1E90 A;  2KQ7 A;  4KSK C;  3IHP C;  1L2N A;  3VH4 B;  4EFO A;  4URK A;  3VHT C;  1V5T A;  3JYU A;  1Q1O A;  1Y8R C;  5LXH A;  1NI2 A;  1WGY A;  4II3 B;  4IC7 B;  3A4R A;  3QC8 B;  2WYQ A;  5E6N A;  4ANV A;  4CO7 A;  4DDI D;  5TR5 A;  2CR5 A;  2NVU I;  5KHO A;  2LVO A;  4GDL A;  2KHW B;  2KWU B;  2K6D B;  2M4N A;  4BKS A;  3RUI B;  4ZRJ A;  2DYO A;  4NPN A;  3N32 A;  2L0T A;  3PPA A;  1UBI A;  3QWZ B;  3NY5 A;  1UBQ A;  3A1Q B;  3V6E B;  4A3O A;  4MEM A;  4IM0 A;  1WGH A;  4LDT D;  3UQB A;  4DHJ D;  2A4Z A;  1WFY A;  4PYU A;  3NZU A;  4NQK E;  2MBQ A;  1E5W A;  1CMX B;  1LQB A;  3NHE B;  4GDK A;  5DPS A;  5AZH A;  4EUT A;  3PZD A;  1C3T A;  5AZF A;  2B3A A;  2GMI C;  1Q0W B;  2NR2 A;  3A4S C;  4AOF A;  4NJ6 A;  4AP4 C;  2KX3 A;  1WYW B;  2IO3 B;  4MJS B;  2MBO A;  3WAL A;  1RAX A;  1YD8 U;  3IBE A;  1Q5W B;  4XX5 A;  2IZV B;  3H7S A;  2KC2 A;  5J18 A;  4DXA B;  1E8Y A;  3K9P B;  2CS4 A;  2KVR A;  1E7V A;  3MTN B;  4HWI B;  2D11 A;  4CYE A;  2DZM A;  2G4S A;  3L16 A;  2N4F A;  2I1K A;  4EZK A;  4G50 A;  1GNU A;  1EF5 A;  4OVV A;  2KNB A;  1WF9 A;  4MGZ E;  2C7H A;  1WZ0 A;  1EUV B;  1ISN A;  3QHT A;  3PHX B;  1R4M I;  2DX5 B;  2EMT A;  2XBB C;  4HDO A;  2KZR A;  4M8N A;  2N1W A;  2JRH A;  1TGZ B;  1VD2 A;  3Q3J A;  3DQV A;  3SU8 X;  3ZNH B;  2C5L C;  3M95 A;  3H6N A;  3PRE A;  2J0M A;  4K81 A;  3PVL A;  2O2V A;  2G3Q B;  4G11 A;  2MX2 A;  1KLV A;  1NDD A;  3AI5 A;  3KUZ A;  5DCN A;  4DWF A;  4P7I A;  4ZRI A;  4NJ7 A;  4A20 A;  4WJQ A;  1TTN A;  2ZCB A;  5FR6 A;  5DPW A;  1QZE A;  3T9L A;  3OJ4 B;  1WGD A;  4J6I A;  3VVW B;  3KW5 B;  1WGR A;  2D07 B;  1GC6 A;  1WR1 A;  1WX8 A;  2KDE B;  4TQ0 A;  4BBN C;  2K6Q A;  2V3S A;  1G6J A;  2KQS A;  1WXA A;  3VTW A;  1ZW7 A;  2ZPN A;  4AJY B;  4F1S A;  4IM3 A;  5IA7 A;  1TBE A;  4G0N B;  5CTR C;  3OJ3 A;  3RT3 B;  4YL8 A;  4I6L B;  3PRM B;  3QCA A;  1P9D U;  2NBW B;  3AUL A;  3VUX A;  1AAR A;  1WZ3 A;  2LGX A;  3LDZ E;  4XC2 A;  1WXS A;  2WDT B;  4X57 B;  3TBL D;  3TL5 A;  2IO2 B;  1WH3 A;  2BWE S;  2R2O A;  3QX1 A;  2MW5 A;  2ZVO A;  3R3M A;  1YJ1 A;  4DHZ B;  3VFK A;  4AWJ A;  2AWT A;  4M0W B;  2ZJD A;  2BYV E;  3N30 A;  2Z59 B;  4EZJ A;  3RD2 A;  3ZW3 A;  2BPS A;  4GU2 A;  4GIV A;  2FUH B;  2KLG A;  4LJO B;  2J0J A;  2MBH A;  4HLE A;  3SHQ A;  2HJ8 A;  1WIA A;  2KTF A;  5D94 A;  4ICU A;  3NS8 A;  4K1R B;  2IO0 B;  4K7S A;  2N7D A;  4BKT A;  1K8R B;  2MLB A;  2PE6 B;  4WAA A;  3IG3 A;  5LXI B;  1H4R A;  1OQY A;  3DPD A;  3MJW A;  4LJP B;  3U30 A;  2JZ3 B;  2BKF A;  2KXJ A;  2YVC A;  1WX9 A;  1P0R A;  4W9F A;  3B1L X;  4IM2 A;  3MHS D;  4BKS D;  4II2 B;  4MGI E;  1TZ1 A;  3U8Z A;  3ZDT A;  4E74 A;  1A5R A;  1OGW A;  2KD0 A;  2KDB A;  1WX7 A;  2JT4 B;  3PS6 A;  4GN1 A;  3DBH I;  3L54 A;  2KFK B;  5JHB A;  3H9D A;  1P1A A;  1X1M A;  2LAS A;  3ZDM C;  3ZNZ B;  1U4A A;  3ZRC A;  3VUY A;  2LGD A;  4WWO A;  5GMV A;  4ANW A;  1RLF A;  1C1Y B;  2DAJ A;  3APD A;  3S2A A;  2CKH B;  2BF8 B;  1MG8 A;  1IPG A;  5KHQ A;  3HM6 X;  2KJR A;  5D6J B;  2N7E A;  3W1S A;  2M8S A;  2O6V B;  2KN5 A;  2L05 A;  3DBS A;  2L00 B;  4TV3 A;  1WJN A;  1RFA A;  1EF1 A;  3A1Q A;  3L10 B;  4KZ0 A;  3QJZ A;  4HJK A;  2D3G A;  2KC1 A;  3WAM A;  2J7Q B;  2LD9 A;  3L17 A;  3V60 A;  1D3Z A;  2LJ5 A;  4NNJ B;  4KDL B;  4DHZ E;  2RPQ A;  1GC7 A;  4B95 A;  4PS8 A;  1I42 A;  2N9E B;  2DAF A;  2KKC A;  2FAZ A;  3UIN B;  3V6C B;  3H7P B;  4PS3 A;  4HDQ A;  5E6O A;  4MH0 E;  2RGF A;  5JH5 C;  2HD5 B;  4W9E A;  2ZNV B;  2MWS B;  2K1F A;  3DDC B;  3PRZ A;  2LUE A;  4MJS A;  4W9I A;  4IW0 A;  3ZKJ C;  2N9P C;  2XEW A;  3IVF A;  3ZO5 B;  1I35 A;  3VQI A;  3A9J B;  2ZEQ A;  3ENE A;  1WJ6 A;  1E8X A;  3V62 A;  2N1V A;  4FA6 A;  3C0R B;  4MEL A;  4TQ1 A;  1WRD B;  4EEW A;  2AEH A;  1BT0 A;  3RCZ A;  4PS7 A;  1V2Y A;  4JQW C;  4W9D A;  4FUL A;  3TIX A;  2FID A;  2LGY A;  1RRB A;  4MSM B;  2IO1 B;  2NBV B;  2K8C A;  3AU4 A;  1WXM A;  4ZDV A;  4W9G A;  1SE9 A;  2GBR A;  2OJR A;  1JRU A;  2MP2 A;  1WMH B;  3V61 A;  4AJW A;  5AEK B;  2VRR B;  2MP2 B;  5LLI A;  4WQO B;  4ZRK A;  1WM3 A;  3P2B A;  3QA8 A;  4FJV B;  4DK5 A;  1J8C A;  4LDT B;  3HIZ A;  3DVG Y;  4DHJ B;  4FJZ A;  4FBJ B;  4G3X B;  2JXX A;  2KLC A;  2Y5B B;  2BKR B;  2XK5 A;  3WAN A;  4ANX A;  1YX6 B;  2GBM A;  3HK0 A;  2MA9 B;  5AZG A;  3WIM A;  2XK5 B;  2KFJ A;  3CST A;  2DZK A;  1L7Y A;  4MGK E;  4FN2 A;  2MBB B;  3VXW A;  4PYZ A;  3M62 B;  4I6N B;  3PTF C;  1WJ4 A;  2GBK A;  3U7D A;  1HE8 A;  1XD3 B;  1PQS A;  2L8J A;  3NZS A;  3D32 A;  2JUO A;  2KWV B;  3DBR I;  4IG7 B;  1E8Z A;  3T8M A;  2GOW A;  2EMS A;  3L0W B;  5CHW A;  3X0W A;  4BOZ B;  4DBG A;  4EZL A;  2JPH A;  3BIN A;  4W9H A;  2NPT B;  1UH6 A;  3ZLZ A;  3WAP A;  2D2Q A;  3CSF A;  4GGQ A;  3SDL C;  3TJP A;  2K8H A;  4A3P A;  1FXT B;  5J2R A;  3UF8 A;  2UWQ A;  1V5O A;  3KYD D;  3DVN U;  2MQJ A;  4IWO A;  3ZTD A;  1E8W A;  3W1S C;  4HXD A;  4KV2 A;  2JWZ A;  3A9K A;  2MCN B;  2BYE A;  1LFD A;  2BGF A;  4WJO A;  3RZF A;  1S3S G;  1YQB A;  3HM3 A;  1WI0 A;  3A9K B;  1UD7 A;  2G45 B;  4ANU A;  1EO6 A;  4LCD E;  4JLC A;  3I3T B;  4JGH B;  3EEC A;  3APF A;  3QAR A;  4KIK B;  4NAW B;  1UEL A;  1WR6 E;  3BY4 B;  5CHV C;  2ZCC A;  3ZIM A;  4DDG D;  3VUW A;  2OOB B;  4N9F 4;  2KDF B;  1V9J A;  3KH0 A;  2WX0 A;  2AL6 A;  2LXC A;  2KTR B;  2LRU A;  4NY0 A;  1GJZ A;  2RR9 A;  3R7Q A;  4KVG B;  2KJH B;  5J17 A;  2CHW A;  4JL9 A;  3PHW B;  1Z2M A;  3M63 B;  4ICV A;  5DPR A;  3UIO B;  3WAO A;  4OVU A;  3PGE A;  3QK0 A;  3PV1 A;  4W9C A;  2KFK A;  3EC8 A;  2RD0 A;  4WJN A;  5E6P A;  4IWQ A;  4HPL B;  2NS5 A;  2QHO A;  2IBI B;  2C7M B;  2LXA A;  3B08 A;  3PLU A;  2M0X A;  2PE9 A;  4WJP A;  1GUA B;  3VTU A;  2L0F A;  1V80 A;  2BWF A;  4GSW A;  3ML9 A;  3ONS A;  4FJY A;  3CF6 E;  2PJH A;  2G4D B;  2R2Q A;  3KUC B;  4F8C B;  2K8B A;  3OAW A;  2JRI B;  2O6V A;  2ZPY A;  1R4N I;  3ZVV A;  4W9J A;  2NCN A;  1WE6 A;  2V4L A;  2JZZ A;  1LM8 B;  1XT9 B;  4EOY A;  2JVC A;  2KK8 A;  3JSV B;  3H1U A;  3TMP B;  2DHZ A;  3VDZ A;  2I1J A;  4ZYN A;  1IYF A;  2L76 A;  2DZJ A;  5D7G A;  4MSQ B;  3JW0 X;  3WA0 A;  2KMA A;  3PT2 B;  2FCM A;  4KDI C;  3ZTC A;  3O65 B;  3AXC A;  4TKN A;  3PLV A;  2PPH A;  5CHF A;  1E7U A;  4BVU C;  3H7P A;  2KAN A;  5C23 A;  4GOC A;  4BFR A;  3IFW B;  3DOW A;  4GDL B;  4GMV A;  4TUU A;  3QQ8 B;  3RUL A;  2DYM A;  2DEN B;  5C1Z A;  1P3Q U;  3A9J A;  3NOB A;  2M1M A;  4FHK A;  3UQA A;  3AU5 A;  5G2N A;  4FAD A;  1XQQ A;  1KM7 A;  2L7R A;  2L3Z A;  4ASW C;  1YX5 B;  3KUD B;  2LRW A;  2EKE C;  1SGH A;  3RZW C;  2Z0E B;  1KJT A;  2W9N A;  4HCP B;  4WWN A;  2YLM A;  4HCN B;  2KO3 A;  4FHJ A;  1F9J A;  4WWP A;  3Q3F A;  4M8M A;  1OEY J;  4GDK B;  1WMH A;  4E3C A;  5IAA C;  5L95 C;  2IY0 B;  4K7W A;  3R7R A;  2FIF A;  5G55 A;  1UGM A;  2LI5 A;  3R66 C;  1J0G A;  2IY1 B;  4GB9 A;  3CMM B;  2IYD B;  3X23 A;  3TCA A;  3L13 A;  3GOE A;  5CX3 A;  4B6W A;  1GG3 A;  1IP9 A;  2KJ6 A;  3ZNI D;  3APC A;  5BO4 B;  2ASQ A;  2KOX A;  1WE7 A;  2HE7 A;  2MSE D;  4XZ4 A;  4KZC A;  1VCB A;  1ZKH A;  2PEA A;  3B0A A;  3GZN I;  1KOT A;  4RM8 A;  3OLM D;  4FLH A;  4F7Z A;  5JZE B;  3PRP B;  4HK2 A;  1J19 A;  2C7N B;  3K9O B;  4RMA A;  1P98 A;  2KWC A;  3HHM A;  4IWP A;  4I6P A;  2ZZP B;  2CHZ A;  1V6E A;  1OTR B;  2BYF A;  2M17 A;  2NPT A;  4HPM B;  4HVB A;  4EKU A;  1S1Q B;  4MGY E;  4AUQ C;  2GBJ A;  4K7U A;  3SD5 A;  3VTV A;  3N3K B;  1WJU A;  4CHK A;  3ML8 A;  3EFU A;  4B9K A;  2CHX A;  2MRP A;  1SIF A;  2AL3 A;  2O2V B;  3PSE B;  3KYC D;  4MDK E;  2LWP A;  2FCQ A;  3KVF B;  5D2M B;  2LVQ A;  4BOS C;  2HTH A;  2FCN A;  3JVZ X;  3ALB A;  4KIK A;  4NAW A;  4GXB A;  1WGG A;  2FCS A;  3LJ3 A;  3M3J A;  5DPT A;  4BKG A;  2KX0 A;  2LVP A;  2CU1 A;  2WWZ A;  4IUM B;  3QIJ A;  1H8C A;  4JIO U;  2NBU A;  3EHV A;  2J0K A;  2UYZ B;  4NQL B;  2JY6 A;  2KTR A;  2ZVN A;  3ECI A;  4E71 A;  1V86 A;  1WY8 A;  5EDS A;  1LXD A;  3UIP B;  2KMC A;  3UGB B;  2ZNV C;  2MBE A;  3A33 B;  4KSL C;  3DBL I;  3DCG A;  2K39 A;  2A5U A;  3VAW A;  2REX A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...