1I35A

Solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEEEFKQICFNSSSPERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN KINASE BYR2
publication title Solution structure of the Ras binding domain of the protein kinase Byr2 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 15
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1i35A00
4KSKC 4ZRJA 4OVUA 4CO7A 4MDKE 3AXCA 3HM6X 4I6NB 4TQ0A 2Z0DB 3H7SA 3ML9A 2KFKA 4G50A 5G55A 3W1SC 4NJ6A 2DYOA 5D6JB 2ZZPB 1R4NI 2M1MA 3NOBA 2ZVNA 2I1KA 3T9LA 1PQSA 2FCMA 2IYDB 3R3MA 1ZGUB 4KIKB 2RGFA 4IUMB 3DPDA 3QX1A 2IO1B 2JRHA 3H7PA 3RUIB 4BOSC 4W9IA 2L3ZA 2KZRA 4ANXA 4ANVA 1P98A 4B95A 4GOCA 5D94A 2Z0EB 1V86A 2N1WA 1WI0A 1WGGA 3KH0A 3SD5A 4DHZE 1CMXB 1WXVA 1QZEA 2FAZA 4ZDVA 4AJYB 4GN1A 2JRIB 3RD2A 2O2VA 3EFUA 3UINB 2C7MB 2IBIB 3AU5A 1WYWB 1WJNA 2W9NA 3VH3B 1ISNA 4GB9A 1V5OA 3GZNI 3PS6A 3LDZE 4FJVB 4ASWC 1OEYA 1SGHA 1WR6E 4WWPA 2O6VB 2D3GA 1P3QU 1WY8A 3ZDMC 3UF8A 1FXTB 2KMAA 4MJSA 3H6NA 2K1FA 3CMMB 4I6PA 4KDIC 4NY0A 2K25A 4NJ7A 1VD2A 2IY1B 2L05A 2J7QB 2GOWA 2LGXA 1UZXB 5D7GA 4RM8A 4WWNA 4X57B 4GDKA 1P1AA 2GBJA 4FHJA 4MGZE 2R2OA 2DENB 2RD0A 5DPRA 4IM0A 5C1ZA 3H7PB 3CSFA 2XEWA 3VFKA 1V6EA 2AEHA 2KDBA 2PEAA 4EEWA 3RZWC 4E3CA 4WWOA 5EDSA 2EMTA 3VUWA 4NNJB 5G2NA 3WAOA 4IW0A 3ZKJC 1V81A 3OAWA 2XBBC 4MM3A 2LD9A 4BOZB 4FJYA 2HJ8A 2KO3A 4PS8A 2N7DA 3WANA 4J6IA 3ZVVA 5CHFA 2LUEA 1UBQA 4LDTD 4P7IA 1E7VA 3PLUA 2PE9A 5CTRC 2O2VB 2CHWA 3DVNV 2KJHB 1WRDB 4DDGD 3AI5A 1WJUA 4MGIE 3T8MA 3A1QA 2GBRA 2RPQA 1WGRA 2NVUI 3N30A 4II2B 5E6OA 2RR9A 3PHXB 4WJNA 4G11A 2BWES 2MBBB 2LVQA 3L10B 4IWQA 4DHJB 1BT0A 1WGYA 1YX5B 1E5WA 4HPMB 3SDLC 2LGDA 5L95C 4MJSB 3QA8A 4W9KA 2N4FA 1WMHA 2ZPYA 3PRZA 1Q1OA 3K9PB 4KIKA 2CKHB 1IP9A 2ZEQA 1WF9A 4W9JA 2MWSB 2KWCA 2ZCCA 2FNJB 4FHKA 3V61A 3HHMA 5JH5C 4GDKB 1WX9A 3TJPA 2MRPA 3ZW3A 2LZ6A 1RRBA 4GGQA 4EKUA 5J2RA 2V4LA 2FUHB 3DVGX 5JZEB 3DBSA 3VAWA 3ZRCA 2KDFB 2GBKA 3DBRI 4PYUA 2MBHA 2IO3B 2K8HA 1EF1A 4AUQC 2L8JA 1GC7A 5DPTA 3EECA 1SE9A 1YD8U 3NZSA 5GMVA 1WJ4A 2JPHA 2I1JA 3TBLD 4F7ZA 3VTUA 2KLCA 4IWPA 4ZYNA 1Z2MA 4E71A 1L2NA 3A33B 4W9HA 5DPWA 3DVGY 1UH6A 3PVLA 2KTFA 4F1SA 1WE6A 3TL5A 2KWUB 2M8SA 2O6VA 3KUCB 4K81A 4OVVA 3SHQA 2KWVB 3V6EB 4BKGA 3APCA 5LXHA 3JW0X 4NAWB 2MX2A 2ZPNA 3TMPB 2GMIC 3KYDD 1EO6A 1V2YA 3MHSD 3WA0A 1OEYJ 2DYBA 2LXCA 1AARA 1JRUA 2BWFA 2MCNB 4DHJD 2DAJA 1WMHB 4IG7B 2KKCA 1E8YA 3ALBA 1WZ3A 4GU2A 2BPSA 4MH0E 3ZLZA 2N9PC 4W9EA 1S1QB 3VDZA 2WWZA 2UWQA 2L0FA 1U4AA 2KC2A 4WAAA 2KJRA 4XC2A 3QWZB 4GDLA 2MP2A 2EMSA 4HWIB 2JXXA 3QIJA 2KVRA 1V9JA 4FA6A 2QHOA 3PREA 2CS4A 4GXBA 1EUVB 2KMCA 1MG8A 3ZIMA 4E74A 3X0WA 4FJZA 1C3TA 4IC7B 2JZZA 3LJ3A 4FULA 4WJOA 4GSWA 4ANUA 4K1RB 3NS8A 2LGYA 3BINA 3RCZA 2BYEA 4FLHA 3UIOB 1GG3A 2XK5B 2LVPA 1V5TA 1LFDA 2G4DB 2L76A 1T0YA 2A5UA 5AZGA 1YQBA 1E8WA 4ZRIA 4CHKA 1TZ1A 2EKEC 3QQ8B 3ECIA 4G3XB 1OQYA 2LJ5A 2M4NA 2G3QB 3UGBB 2Y5BB 5DCNA 4K7WA 3R7QA 3PPAA 1C1YB 2DHZA 4IM3A 1WE7A 2BYFA 2KANA 2JUOA 3D32A 3QAQA 3PT2B 3CSTA 2K8CA 2KQ7A 4A3PA 1I42A 3CF6E 4W9CA 2KK8A 4BVUC 4K7SA 4LCDE 4GDLB 2MP2B 3VH4B 1R4MI 3W1SA 2D07B 2KJ6A 3ML8A 1P9DU 1WXMA 1WGHA 1WH3A 2BF8B 4W9GA 3ZTDA 2ZVOA 1WIAA 3RULA 4W9DA 3W1YA 1L7YA 3S2AA 2KLGA 4JL9A 1UBIA 1LM8B 2KX0A 3HK0A 3MJWA 2N1VA 1A5RA 4MSMB 4IWOA 3AU4A 2DAFA 4KZCA 1YJ1A 2PPHA 3HM3A 2DZMA 3EC8A 3M95A 3O65B 4NAWA 2LVOA 1RFAA 2IO0B 3WAMA 2WX0A 2LI5A 2J0JA 3APDA 3VHTC 4FN2A 2C7HA 2MSED 1RAXA 1NDDA 1LQBA 5E6PA 3R7RA 4DK5A 2O6VD 4TQ1A 1WR1A 2JWZA 1TGZB 5AZFA 3DVNU 3H1UA 5LXIB 2CHXA 4HDQA 2NPTB 2AYOB 2ZNVC 4RM9A 2KDEB 3QCAA 4DDID 3VUXA 2ZCBA 2AWTA 3L54A 2JY6A 4BFRA 4CYEA 2KTRA 3OLMD 1GNUA 1M94A 3KVFB 2C7NB 2KX3A 1I35A 1HE8A 4NPNA 3KYCD 4TKNA 4GMVA 3DBHI 3L16A 5BO4B 3ZO5B 3ZDTA 2DZJA 1YIWA 3KUZA 4I6LB 4BBNF 3EHVA 1XT9B 1WM3A 2K39A 2K6QA 2G45B 3C0RB 3M3JA 4BKSA 1WXAA 3TCAA 3PSEB 2YVCA 3ZTCA 1H4RA 2GBMA 2XK5A 3OJ3A 1ZKHA 3V60A 3GOEA 4M8NA 4MGYE 1OTRB 3DBLI 2NBVB 1Z5SB 3NY5A 1K8RB 1WX7A 2CR5A 3A9KA 2D11A 2N9EB 4TV3A 3VUYA 5FR6A 1E8XA 4F8CB 4LJPB 2LRUA 3PGEA 4PYZA 2NBWB 1KOTA 2UYZB 2DYMA 2L00B 3U8ZA 3IBEA 1Q0WB 3B0AA 1ZW7A 2MLBA 3QHTA 1Y8RC 4M8MA 1X1MA 3ZNID 1WX8A 5AEKB 3WIMA 4HJKA 2IY0B 2BGFA 2GBNA 3JSVB 4HDOA 2DX5B 4B9KA 2OJRA 4EZKA 3M62B 3N32A 3QJZA 4W9LA 5IA7A 1UELA 2G4SA 2KTRB 3N3KB 5CHVC 3TIXA 2OOBB 3ENEA 2N7EA 2DZKA 4AJWA 3K9OB 3A4RA 4ZRKA 4DBGA 4G0NB 4HK2A 2K6DB 4B6WA 3AULA 2LWPA 4BKTA 1EF5A 5D2MB 2IO2B 3V6CB 1XQQA 4JGHB 1WJ6A 4DXAB 4EFOA 3KW5B 4MSQB 4IM2A 4AOFA 2YLMA 2KD0A 4KVGB 2D10A 3RZFA 3SU8X 2BYVE 4M0WB 1YX6B 3A9JB 3UQAA 4WJQA 3RT3B 2KQSA 5L83A 5TR5A 3B08A 1G6JA 2BKFA 1GJZA 4N9F4 3VXWA 2C60A 3A9KB 3ONSA 1E7UA 1WXSA 4LDTB 3ZRFA 4WQOB 4AP4C 4EOYA 5IAAC 4PS3A 1Q5WB 2AL3A 4BBNC 3APFA 3ZNGC 2NPTA 3QC8B 2FCNA 4HCNB 4XZ4A 2WDTB 3R66C 4JIOU 2IZVB 4ICUA 4XX5A 2K8BA 4KDLB 3ZNZB 1KM7A 2HD5B 3IHPC 2WYQA 3L13A 4EZLA 5J17A 3QK0A 1SIFA 3DQVA 3L0WB 3QARA 3JYUA 1OGWA 3PZDA 3HIZA 3RYTA 2R2QA 3UQBA 3U30A 1NBFC 2CHZA 4KSLC 5JHBA 3A4SC 2KFKB 1E8ZA 1WM2A 2LRWA 2LASA 3VVWB 4HPLB 1J0GA 3I3TB 2WX1A 3JVZX 5CX3A 3Q3FA 2KDIA 3NZUA 2CU1A 2ZNVB 4K7UA 2KN5A 3IFWB 5CHWA 2KFJA 4HLEA 4A3OA 3KUDB 1UD7A 2JF5A 4II3B 1LXDA 2ASQA 3DDCB 3DOWA 3OJ4B 1GC6A 3VTVA 1IPGA 4LJOB 4BKSD 2PJHA 5LLIA 3VTWA 2ZJDA 2L0TA 4TUUA 3IVFA 5KHOA 3H9DA 2A4ZA 3L17A 2M0XA 1H8CA 4NQKE 2JT4B 2REXA 4EUTA 2DZIA 2NS5A 3VQIA 4HXDA 3B1LX 3JSVA 2L7RA 2FIFA 5AZHA 1NI2A 3V62A 1WGDA 4KV2A 4YL8A 1TBEA 1V49A 3L08A 4DWFA 5HKHA 4HCPB 4MEMA 3UIPB 4AWJA 3PRPB 2MBOA 2MW5A 4NQLB 5C23A 3P2BA 2AL6A 1J19A 3Q3JA 2PE6B 2FCQA 4ICVA 1WFYA 3PLVA 4MELA 2V3SA 2MBEA 3DCGA 2KOXA 2HE7A 2C5LC 2V1YA 1VCBA 2M17A 3M63B 4FADA 4JLCA 2JVCA 2KC1A 4DHZB 1D3ZA 1F9JA 2KNBA 2B3AA 2J0MA 2MBQA 4W9FA 1KJTA 3X23A 4A20A 3A9JA 3MTNB 3U7DA 3IG3A 1V80A 5KHQA 2RSUA 3ZUNA 5J18A 2LXAA 2FCSA 4HVBA 1XD3B 2KHWB 1E90A 2VRRB 3NHEB 2NBUA 3WALA 3PV1A 1S3SG 2D2QA 1GUAB 2NCNA 1J8CA 4URKA 1KLVA 5DPSA 2NR2A 2HTHA 3BY4B 4EZJA 2N9XA 4KZ0A 2MA9B 4WJPA 1RLFA 2BKRB 4FBJB 1TTNA 4ANWA 4GIVA 1P0RA 3PRMB 2MQJA 4JQWC 4MGKE 4PS7A 1IYFA 4RMAA 2J0KA 3PTFC 3WAPA 1WZ0A 5E6NA 5JHAA 3PHWB 2Z59B 2JZ3B 2KXJA 3A1QB 1UGMA 2C9WB 2FIDA 3ZNHB
chains in the Genus database with same CATH superfamily
4KSKC 4OVUA 1JWMD 4TQ0A 3H7SA 3ML9A 2KFKA 1I4GA 3ZXRA 2NTSA 4US9A 1HQRD 3R3MA 4KIKB 5D3DA 1F2RC 3R2IA 3U52E 3H7PA 4W9IA 2KZRA 4ANXA 2PLPA 4GOCA 4RGMA 2N1WA 1WGGA 4DHZE 4AJYB 4BAXA 2ICIA 3UINB 3BK1A 1DOIA 1YOVB 4ARIA 1PYWD 1WYGA 3GZNI 4FJVB 1P3QU 4N6EB 1QOBA 1E9MA 2WXHA 3Q8EA 3ZDMC 4NZLB 3H6NA 3BK2A 4HKQA 1VD2A 2J7QB 1R7SA 2LGXA 3VR8B 1QQRA 4X57B 2LHEA 2JX5A 4GLSC 2QC8A 2ONQA 3CSFA 2PEAA 2KDBA 4OVZA 1NYRA 3WAOA 5G2NA 4IW0A 3ZKJC 3OAWA 1FEHA 4PK1A 2KO3A 2N7DA 3ZVVA 2LUEA 1D6EC 2O2VB 3AEAB 1ACCA 2QMTA 2NVUI 5E6OA 1EM7A 2AX5A 2LFIA 2MBBB 2V9HA 1YX5B 4MJSB 2ZPYA 3PRZA 1Q1OA 2LEKA 3K9PB 2CKHB 2ZEQA 2KWCA 3V61A 3HHMA 5JH5C 4GDKB 3ZW3A 4GGQA 3VAWA 2KDFB 2K8HA 2VZKB 3P63A 4AUQC 1GC7A 5DPTA 4KX6B 3AE1B 3EECA 4KKIA 3NZSA 4FXCA 1JQ4A 3RNEC 2AQ3B 3A33B 1V1OA 1UH6A 3DWGC 3PVLA 2LUMA 4N59A 3VRBB 1HZ6A 1ROEA 3TL5A 3KUCB 4BKGA 3V6EB 4K81A 3GE8C 2MX2A 2ZPNA 3TMPB 1ZPSA 2JWUA 1V2YA 5AUIA 2LXCA 1AARA 2BWFA 1L6UA 1NI3A 2DAJA 4NJCA 4P6VF 1E8YA 1WRIA 1T0RC 1WWTA 2BPSA 1D4BA 1YN4A 4US8A 5MPOA 4HWIB 2V3PA 2BYTA 2CS4A 4GXBA 5HFYA 4E74A 1C3TA 4IC7B 3LJ3A 2INDC 3KWLA 3ZGZA 3AEFB 2D3BA 2VH1A 2XK5B 3I57A 1XLQA 2L76A 2QIEB 2NMQA 4YSXB 1IBXB 5G5GA 3UGBB 3RNFC 3NS1A 3PPAA 2KANA 3D32A 5I4DA 3Q8FA 3H8HA 4K7SA 2DLBA 2D07B 3ML8A 1WIAA 3W1YA 1HTOA 2J4XA 1A5RA 2BS2B 1JMLA 3R2TA 3V05A 2JQRB 1RFAA 2CU3A 1SE2A 3WAMA 1ZOYB 4RF0A 1AYFA 4FN2A 4EE2A 1LQBA 1QT9A 4TQ1A 2JWZA 1TGZB 3ZJTA 3Q8BA 3Q8CA 5E6JA 4WIPA 5LXIB 2CHXA 2AYOB 4RM9A 2KDEB 2KACA 1EWYC 3RNCC 2AWTA 1L0VB 2JY6A 3L54A 1TYGB 2PTLA 2C7NB 2KX3A 1HE8A 3KYCD 3DBHI 1YIWA 4BBNF 3Q6BA 3EHVA 2K6QA 2G45B 1FNVA 3PSEB 3RMKC 4UDUC 2YVCA 1YQ3B 1SXTA 2NTTA 3DBLI 1P7EA 3P4QB 3A9KA 4TV3A 2N9EB 3VUYA 2DYMA 3U8ZA 1Q0WB 2MLBA 1HZ5A 2AQ2B 1GPXA 1WX8A 5FK9C 2K5PA 4CQNA 3WIMA 4HJKA 4ZRQA 1SE4A 1E6EB 5IA7A 2KTRB 2OOBB 1D5ZC 2D5GA 4AJWA 1JWAD 3K9OB 2ACZB 3BVMA 4G0NB 2INPE 4B6WA 5IOIA 1EF5A 4BKTA 1XQQA 1WJ6A 1N61A 1DOXA 1N63A 2YLMA 2KD0A 3SU8X 3A9JB 1IUEA 3B08A 3ABVB 4J3OD 2WXLA 2WXRA 3AH7A 4AP4C 2NPTA 3QC8B 3EGRA 2QDFA 4ICUA 2IGDA 4KDLB 1KM7A 2HD5B 3L13A 2WYQA 4EZLA 4YSZB 5J17A 1NVID 3ZQ4A 3DQVA 2R2QA 3ZYYX 3UQBA 4KSLC 1ZP0B 3I3TB 1FFVA 2KN5A 5CHWA 5G5HA 2JF5A 3I63C 1LXDA 3DDCB 2FBWB 4LJOB 4RCOA 5LLIA 2ZJDA 3IVFA 5KHOA 2A4ZA 2M0XA 1H8CA 1TY0A 2H88B 2NS5A 3B9JA 3AE8B 2L7RA 4YTNB 5AZHA 4HROA 1TJEA 1R4MB 1XF5L 4XE0A 5HKHA 1UWMA 4MEMA 3UIPB 2MW5A 5C23A 1MPEA 1F52A 1ZDXA 2V3NA 3Q3JA 2PE6B 2BT6A 2V3SA 2MBEA 2G9HD 3M63B 1VCBA 1B9RA 4DHZB 1F9JA 2H89B 4W9FA 2MBQA 3AEBB 1TS4A 4A20A 1D5XC 2PMVA 1EU4A 3ZUNA 3BYYB 1UGJA 3N9YC 4YXDB 3PV1A 2RDHA 1GUAB 4URKA 1KLVA 5DPSA 4KGSA 2BKRB 4FBJB 1TTNA 4JQWC 4PS7A 1C4PA 4RMAA 2N9KA 3DBRB 1C9FA 1M4VA 2JZ3B 1VLBA 2FIDA 4ZRJA 3I5JC 3AXCA 4I6NB 4ARCA 2DYOA 2ZZPB 1R4NI 2L32A 2M1MA 1V1PB 3BIID 2ZVNA 2I1KA 1PQSA 3AE6B 1ZGUB 2RGFA 1YN5A 5FKAC 4IOIE 1PGXA 3PO0A 4ANVA 2WLBA 4HKZE 1F0ZA 1TIFA 2BBCA 5D3IB 2M19A 1QZEA 2FAZA 2HJ1A 2O2VA 2C7MB 2DWQA 3AU5A 3VH3B 1V5OA 2WQYB 1E10A 4WWPA 2DBYA 2O6VB 2D3GA 5HHDG 3UF8A 2KMAA 1FRRA 2BVCA 4MJSA 2K1FA 3CMMB 4I6PA 4MT5A 1NENB 1QOFA 2OHFA 1UZXB 4GDKA 4IM0A 1ENFA 3P4SB 2BS3B 2MJEA 3BVZA 5C1ZA 2WNMA 3VFKA 4EEWA 1VZ6A 2EMTA 3VUWA 4C80A 4BOZB 4FJYA 2HJ8A 5CHFA 1UBQA 4P7IA 3PLUA 4MGIE 1A70A 1WJUA 2KQ4X 2RPQA 1WGRA 4XGAB 4JX1C 5BYRA 3PHXB 4S0RA 3L10B 4HPMB 3SDLC 4OHJA 2L1AA 4M02A 2IPKD 2ZCCA 3BZDB 4FHKA 2L52A 1WX9A 2MRPA 1RRBA 2V4LA 2PVOD 4ITKA 4L2YA 3DVGX 3DBSA 2MBHA 1EF1A 1CZPA 2CJOA 1SE9A 5GMVA 2JPHA 3AEEB 3TBLD 4F7ZA 4IWPA 1Z2MA 4XWWA 4F1SA 4JPSA 1WE6A 2KWUB 2M8SA 5LXHA 2KWVB 2RDBC 1YMHE 3KYDD 1IBXA 5JXVA 3MHSD 3IXSA 3GB1A 3ZJUA 2DYBA 1AW7A 3KWVA 4DHJD 1WMHB 4GU2A 4LTUA 2QSDA 1S1QB 5EE9A 3VDZA 2UWQA 2WXJA 2W3SA 2JXXA 4FA6A 2QHOA 3MP9A 3PREA 3X0WA 1MFWA 2XNAC 4LK0M 1LGRA 3B2GA 2R61A 3L4PA 1FPYA 1SJHD 4K1RB 2BYEA 4FLHA 1GG3A 1FXIA 3W5VB 1T0YA 2KN4A 1E8WA 1RFKA 1XLPA 4LNKA 2Y5PA 3QQ8B 4G3XB 2M4NA 2Y5BB 5DCNA 1C1YB 3NVVA 4RF1A 4IM3A 2LGIA 1WE7A 2BYFA 2JUOA 3QAQA 2E3TA 3CSTA 3MC9A 1YQ4B 2KK8A 4BVUC 4HJGE 3AB5A 4LCDE 3AE7B 2MP2B 4GDLB 3W1SA 5IO9A 2E6XA 3NG0A 5BYSA 1L7YA 3S2AA 2KLGA 4JL9A 3GZNB 2DAFA 1P7FA 4NAWA 2LVOA 2IO0B 4ZHOA 2WX0A 2LI5A 2PIAA 2J0JA 3DWMA 2N0SB 2C7HA 4ACFA 1NDDA 5E6PA 3R7RA 4DK5A 2O6VD 1XLNA 4ZRPA 3DVNU 4HDQA 3AECB 4HRSA 1STEA 1PFDA 4DDID 3VUXA 2K3UA 2KTRA 3ETRA 5EE3A 1F2RI 3N1XC 3B2FA 3ZO5B 2MJDA 2DZJA 3KUZA 4I6LB 2Q5WD 2IGHA 1K52A 4WURA 2M56B 1WM3A 1I4RA 1K51A 3ZTCA 1KF6B 2GB1A 1N5WA 3V60A 3GOEA 4M8NA 3GE3C 4A8XC 2NBVB 1Z5SB 2CR5A 2D11A 4PT5A 4LJPB 2BW2A 2NBWB 4HPPA 1YN3A 1KOTA 3W5UB 1Y8RC 4LNOA 3P4RB 4B0EA 2GBNA 4HDOA 3JSVB 1XO3A 4W9LA 4DXGA 4P16A 5BYQA 4ZRKA 2K6DB 5D2MB 2JYEA 2IO2B 2MJ3A 3N1ZC 4EFOA 4MSQB 4AOFA 1BUIC 2ZW0A 1C78A 4JE3B 2D10A 3RZFA 2BQQA 1NYQA 1DGJA 1SSNA 1T0QC 1T3QA 2BKFA 4N9F4 3VXWA 2JXTA 1WXSA 4WQOB 4EOYA 5IAAC 4PS3A 3U7ZA 3APFA 3ZNGC 2WDTB 4OZAA 1SEBD 1JROA 4XX5A 3KQ4A 1TKYA 3IHPC 2WDQB 3QK0A 1C4CA 1SIFA 3L0WB 3JYUA 3SFDB 3VR9B 2KFKB 3NRZA 2LASA 3SEBA 1J0GA 2WX1A 5CX3A 3Q3FA 4A3OA 4II3B 3RI7C 4BKSD 2PJHA 3IT4B 3VTWA 2V0GA 2EKIA 3L17A 4NQKE 2JT4B 3FILB 3NVWA 1NI2A 1WGDA 4KV2A 1QF6A 3FAHA 4AWJA 1CK1A 1BXTA 3P2BA 2AL6A 1J19A 3ZXVA 1E7PB 1WSPA 3PLVA 1V1PA 3DCGA 2KOXA 2HE7A 2V1YA 2M17A 3AV8A 2N7JA 2JVCA 2KC1A 2KNBA 2J0MA 1KJTA 2V4IB 4M0WA 3U7DA 3IG3A 1V80A 3NJTA 3IT6B 1KLUD 5J18A 4HVBA 2FCSA 3WALA 2NBUA 2Z8LA 2NR2A 1T0SC 1ESFA 4EZJA 1ET6A 4C7ZA 2WXPA 1GB1A 4MGKE 3TEZA 2J0KA 1KFYB 5IKCM 3WAPA 1WZ0A 1C76A 3PHWB 1QILA 4OW0A 4CO7A 4MDKE 3HM6X 1LO5D 2Z0DB 4NJ6A 3T9LA 1Y56A 3EFCA 3QX1A 2IO1B 2JRHA 3RUIB 3TEWA 5EE0A 1P98A 4B95A 5D94A 3DHIC 1WI0A 3KH0A 1CMXB 2YEPB 3LYYA 4ZDVA 5BMGA 4GN1A 1YJJA 3Q14C 2IBIB 1WJNA 4XYCA 2W9NA 1GOZA 4LNFA 4XDDA 3RNAC 3LDZE 2KWDA 4ASWC 1WY8A 2I38A 4USAA 1K50A 4A9AA 4KDIC 1JCKB 1RYJA 2K25A 4NJ7A 1WXQA 4S17A 2WDVB 3P4PB 4P1CC 1TS5A 4WH4A 2G1EA 5D7GA 4WWNA 1T6BX 2GBJA 4MGZE 2R2OA 2RD0A 2J52A 2W82A 2XEWA 1V6EA 2AEHA 4L23A 3W9CB 1I4XA 3RZWC 4WWOA 4NNJB 4AS1A 1V81A 2SAKA 1N62A 4PS8A 3WANA 4J6IA 1E7VA 3URYA 5CTRC 2CHWA 3DVNV 3AI5A 3T8MA 3A1QA 2GBRA 3GP7A 3PZ8A 4WJNA 1FCCC 2BWES 4DHJB 4IWQA 1WGYA 3Q2AC 2LGDA 5L95C 3QA8A 1WMHA 4KIKA 1WF9A 1XLOA 2MWSB 2FNJB 2LZ6A 5JZEB 3DBRI 4RGNA 4PYUA 2IO3B 2L8JA 2EELA 4AQ7A 3J9CA 4DXFA 4MM3B 2KLCA 4ZYNA 1FFUA 1L2NA 4TMAB 4W9HA 3DVGY 2L83A 4RNAA 1HA5A 4KKJA 4OVVA 4ZYSA 1F1HA 3APCA 3JW0X 2MH7A 2GMIC 1EO6A 2WGSA 2VH2A 3WA0A 2LJIA 1OEYJ 3DHGC 1JRUA 2MCNB 1QOAA 2KKCA 3ZLZA 4W9EA 2WWZA 2L0FA 2WP9B 4JWSC 1U4AA 4WAAA 1TKGA 2MP2A 4GDLA 4K3BA 3VRAB 1JWSD 1MG8A 2JZZA 3OG5A 4ANUA 2CJNA 5BMHA 1CQVA 5C2TB 3UIOB 2WXFA 1FO4A 2LVPA 1V5TA 1LFDA 3AE3B 3MC0B 3NVZA 4MACA 1YQBA 2BB6A 1YJIA 1TZ1A 2EKEC 2WXQA 3ECIA 2LJ5A 4K7WA 2JZPA 1HEZE 3R7QA 2DHZA 4KGRA 5EE1A 1IGCA 1SJED 3PT2B 2K8CA 4A3PA 3CF6E 4W9CA 1EU3A 3ZJVA 3EUB2 1P9DU 3TEYA 1WGHA 2BF8B 3FC4A 1E0ZA 3RULA 4W9DA 1SF0A 1QKZA 1LM8B 1MHXA 3MJWA 2ON8A 2N1VA 2BTEA 4MSMB 2PPHA 3HM3A 1L0XB 2DZMA 3O65B 4LNNA 1L5PA 1GB4A 3APDA 2TSSA 1RAXA 4HEA1 1L6VA 3RFZB 1GAQB 4P1BC 4QAYA 2NPTB 2ZNVC 4WWMA 2ZCBA 3RN9C 4BFRA 1M94A 1TZOA 1I35A 3L16A 3C8YA 5IN7A 3Q3MC 1N5XA 3TSSA 1XT9B 2K39A 3M3JA 3TCAA 5H92C 1H4RA 1RM6C 2XK5A 3OJ3A 2X8XX 1SIJA 1K8RB 4F8CB 2YEPF 3PGEA 2UYZB 1ZW7A 3QHTA 4M8MA 1X1MA 4JWUC 5AEKB 2FE8A 1VRAB 2OJWA 4EZKA 3M62B 3HRDD 2G4SA 3TIXA 3T3OA 2N7EA 2DZKA 4L1BA 3DHHC 3A4RA 2IDYA 4DBGA 4HK2A 3AULA 4OZCA 1DYQA 4WQMA 4DXAB 5FR3A 3KW5B 4KVGB 2JU6X 3UQAA 4C4VB 3RT3B 3SFEB 2KQSA 5L83A 1G6JA 1I4HA 3I9V1 1GJZA 3AE5B 3ONSA 2WXOA 4LDTB 3ZRFA 1FNWA 2AL3A 2FCNA 2GRIA 4HCNB 3FILA 2D3CA 2UU7A 4XZ4A 5AUKA 2BS4B 1TS2A 2IZVB 2K8BA 1J7AA 1V97A 1MJDA 3TUOA 3WCQA 4REZA 3QARA 2X38A 1OGWA 3PZDA 3RYTA 3U30A 1NBFC 2J42A 3VVWB 1E8ZA 4RFBA 2K22A 1VZ7A 3JVZX 3NZUA 2CU1A 2ZNVB 3AMZA 2IGGA 3AEDB 1JALA 3KUDB 3P1MA 2ASQA 4RGOS 1IPGA 2XN9C 3RNBC 2WHIA 3H9DA 1HTQA 1EWCA 1UF0A 4EUTA 1K53A 3VQIA 4HXDA 3B1LX 1SE3A 4YL8A 4DWFA 1V49A 4HCPB 2MBOA 2WXNA 1IGDA 1I4QA 3CIRB 4ICVA 4MELA 1C79A 2C5LC 1FIQA 4MH8A 3R8BA 4JLCA 2B76B 5H8YE 3PZ7A 3X23A 2LHDA 2I2YA 4M01A 3A9JA 3MTNB 5KHQA 1QLBB 4LLGM 1XD3B 2K9XA 2KHWB 2VRRB 3NHEB 5LNK1 1S3SG 2D2QA 2OEDA 1J8CA 2MEKA 3BY4B 2N9XA 4RGTA 2MA9B 4WJPA 1RLFA 4KGTA 4O1NA 4N58A 3HVZA 2MQJA 5E6NA 1AWDA 2KXJA 3CWIA 1UGMA 3ZNHB 2GI9A 4G50A 3W2DA 5G55A 3W1SC 3BWUD 5D6JB 3LXFA 4R3DA 1PGAA 3NOBA 2FCMA 2IYDB 1SB3C 4IUMB 1XEEA 3DPDA 3HVDA 4BOSC 1NEKB 2L3ZA 1OFFA 2Z0EB 1V86A 3SD5A 1WXVA 4RH6A 2JRIB 3RD2A 1PDXA 4ZOHC 3EFUA 3FKYA 1WYWB 4YT0B 1ISNA 2WXIA 4GB9A 4XWTA 3PS6A 1OEYA 1SGHA 1WR6E 4DQOC 1FXTB 4NY0A 3MJ5A 1AN8A 1ET9A 1MG4A 2IY1B 2L05A 4C00A 2GOWA 1UUPA 4RM8A 1CJEA 1P1AA 4FHJA 5DPRA 2DENB 2QEJC 1J7BA 5HG2A 2WU5B 3H7PB 1YNTE 4E3CA 4M00A 5EDSA 5HI1A 1DOYA 3KLSX 1FNUA 2KDMA 3T3NA 2XBBC 1ZE3D 3C19A 2LD9A 4MM3A 1C4AA 4OZBA 3Q69A 1KLGD 4LDTD 2PE9A 2WXKA 3Q8AA 1ZXHA 2KJHB 1WRDB 1ZXIA 4DDGD 1WGKA 1PUTA 5GXGB 2JYTA 3AEGB 3N30A 4II2B 1N60A 3LB8C 2RR9A 3E9SA 4G11A 1TY2A 1B1ZA 2LVQA 1BT0A 1V8CA 1E5WA 1JRPA 4W9KA 2N4FA 2MHJA 1FXAA 2W54A 1IP9A 4W9JA 1KTKA 1JWBD 1XCTL 3TJPA 4EKUA 5J2RA 2PKOA 4YSYB 2FUHB 1TS3A 3ZRCA 1TKEA 2GBKA 1VDVA 2KYWA 4YTMB 1YD8U 2K0PA 3EA6A 1WJ4A 5T8IA 2I1JA 2Y3AA 3VTUA 3N20C 4E71A 5DPWA 2KTFA 3DBHB 1RWSA 2O6VA 3NUHB 3SHQA 2PVGC 4NAWB 3MFGA 3OWEB 2D3AA 2LMCA 4IG7B 1XCQL 3U4EG 3ALBA 1WZ3A 3DBLB 4MH0E 2N9PC 1T5XD 2KC2A 4XC2A 2KJRA 3QWZB 2EMSA 1FM0D 3QIJA 4YWGG 2KVRA 1V9JA 1MVKA 1EUVB 2KMCA 3ZIMA 4FJZA 1PGBA 4FULA 4WJOA 2VZKD 4C56C 4GSWA 3AN1A 3NS8A 2LGYA 3BINA 2KT7A 3RCZA 2G4DB 5AZGA 2A5UA 4WAFA 2GLSA 4ZRIA 4CHKA 2AQ1B 1OQYA 2G3QB 1HXYD 5BMIA 2KQ7A 3U2SC 1I42A 2RPVA 1FRDA 1XXGA 3VH4B 1JW9D 1R4MI 1FD6A 2KJ6A 1WXMA 3AE9B 4W9GA 1WH3A 4A6QA 3ZTDA 2ZVOA 1UBIA 2KX0A 3HK0A 1L4DB 4IWOA 3AU4A 3IAM1 4KZCA 1YJ1A 2IJ0A 1I4PA 3EC8A 3M95A 4B0MA 2LGSA 3AM9A 2QILA 3VHTC 2MSED 2WDRB 2INCC 4A55A 3HUIA 1WR1A 5AZFA 3H1UA 2M0AA 1ZUD2 3QCAA 1VR9A 4CYEA 3OLMD 1BMLC 1GNUA 3KVFB 1TT5B 4NPNA 3RNGC 4TKNA 4GMVA 5BO4B 3ZDTA 2DNFA 2J53A 3GS2A 1F77A 1L0YB 3AE2B 1ZDVA 1VZ8A 3C0RB 4BKSA 1WXAA 1KRHA 2BB5A 1MI0A 2PW9A 1L4ZB 2WXMA 2WXGA 2GBMA 2QJLA 1ZKHA 4C4VA 5C3JB 4MGYE 1OTRB 3IAS1 3NY5A 1WX7A 5FR6A 1E8XA 2KVZA 2LRUA 4PYZA 3TEXA 2L00B 3IBEA 3B0AA 3UI3A 3ZNID 4NAMA 3RPFC 4H2AA 2IY0B 2BGFA 2DX5B 4B9KA 2OJRA 3N32A 3QJZA 1UELA 3N3KB 5CHVC 3ENEA 2N9LA 2RDGA 1OQQA 2LWPA 2W55A 3AE4B 1KH0A 3V6CB 4JGHB 2WS3B 2HDEA 4IM2A 3NZ3A 2BYVE 4M0WB 1YX6B 4WJQA 5TR5A 1R4NB 2C60A 3A9KB 1E7UA 4ZHPA 1Q5WB 4BBNC 1JWUD 4LNIA 4YTPB 1I7HA 2Y5CA 3R66C 4JIOU 1MHHE 3ZNZB 2JSVX 1D5MC 2SEBD 3P42A 2W3RA 3BVGA 4K3CA 1SBBB 3HIZA 1FMAD 2CHZA 4TSSA 5JHBA 3A4SC 2LRWA 1WM2A 3SR6A 4HPLB 2INNE 2KDIA 4XDCA 3MC8A 4K7UA 2ZW1A 3IFWB 3N1YC 2KFJA 4HLEA 1UD7A 3DOWA 3OJ4B 1GC6A 3VTVA 2L0TA 4TUUA 1QOGA 2HTME 4D2KA 4IDIA 2REXA 2RMMA 5IP4D 1N6ZA 2DZIA 3JSVA 2FIFA 5TSSA 1OQRA 3V62A 1TBEA 3L08A 3Q3NC 3PRPB 4NQLB 1VJKA 1FCLA 2FCQA 1WFYA 2KMMA 3BYTB 2QCZA 4FADA 3O13A 1D3ZA 1UNSA 2B3AA 3E56A 2FUG1 1UWXA 2RSUA 4BZAA 2LXAA 3Q3OC 1E90A 3MHZA 3NVYA 2NCNA 1Q10A 4A90A 2HTHA 1C77A 4KZ0A 4ANWA 4Q2JA 4GIVA 1P0RA 3PRMB 1IYFA 3V3XA 4C7YA 4IKGA 3PTFC 2KAJA 5JHAA 2Z59B 3A1QB 1J7CA 2WU2B 2C9WB
chains in the Genus database with same CATH topology
4KSKC 4ZRJA 4OVUA 4CO7A 4MDKE 3AXCA 3HM6X 4I6NB 4TQ0A 2Z0DB 3H7SA 3ML9A 2KFKA 4G50A 5G55A 3W1SC 4NJ6A 2DYOA 5D6JB 2ZZPB 1R4NI 2M1MA 3NOBA 2ZVNA 2I1KA 3T9LA 1PQSA 2FCMA 2IYDB 3R3MA 1ZGUB 4KIKB 2RGFA 4IUMB 3DPDA 3QX1A 2IO1B 2JRHA 3H7PA 3RUIB 4BOSC 4W9IA 2L3ZA 2KZRA 4ANXA 4ANVA 1P98A 4B95A 4GOCA 5D94A 2Z0EB 1V86A 2N1WA 1WI0A 1WGGA 3KH0A 3SD5A 4DHZE 1CMXB 1WXVA 1QZEA 2FAZA 4ZDVA 4AJYB 4GN1A 2JRIB 3RD2A 2O2VA 3EFUA 3UINB 2C7MB 2IBIB 3AU5A 1WYWB 1WJNA 2W9NA 3VH3B 1ISNA 4GB9A 1V5OA 3GZNI 3PS6A 3LDZE 4FJVB 4ASWC 1OEYA 1SGHA 1WR6E 4WWPA 2O6VB 2D3GA 1P3QU 1WY8A 3ZDMC 3UF8A 1FXTB 2KMAA 4MJSA 3H6NA 2K1FA 3CMMB 4I6PA 4KDIC 4NY0A 2K25A 4NJ7A 1VD2A 2IY1B 2L05A 2J7QB 2GOWA 2LGXA 1UZXB 5D7GA 4RM8A 4WWNA 4X57B 4GDKA 1P1AA 2GBJA 4FHJA 4MGZE 2R2OA 2DENB 2RD0A 5DPRA 4IM0A 5C1ZA 3H7PB 3CSFA 2XEWA 3VFKA 1V6EA 2AEHA 2KDBA 2PEAA 4EEWA 3RZWC 4E3CA 4WWOA 5EDSA 2EMTA 3VUWA 4NNJB 5G2NA 3WAOA 4IW0A 3ZKJC 1V81A 3OAWA 2XBBC 4MM3A 2LD9A 4BOZB 4FJYA 2HJ8A 2KO3A 4PS8A 2N7DA 3WANA 4J6IA 3ZVVA 5CHFA 2LUEA 1UBQA 4LDTD 4P7IA 1E7VA 3PLUA 2PE9A 5CTRC 2O2VB 2CHWA 3DVNV 2KJHB 1WRDB 4DDGD 3AI5A 1WJUA 4MGIE 3T8MA 3A1QA 2GBRA 2RPQA 1WGRA 2NVUI 3N30A 4II2B 5E6OA 2RR9A 3PHXB 4WJNA 4G11A 2BWES 2MBBB 2LVQA 3L10B 4IWQA 4DHJB 1BT0A 1WGYA 1YX5B 1E5WA 4HPMB 3SDLC 2LGDA 5L95C 4MJSB 3QA8A 4W9KA 2N4FA 1WMHA 2ZPYA 3PRZA 1Q1OA 3K9PB 4KIKA 2CKHB 1IP9A 2ZEQA 1WF9A 4W9JA 2MWSB 2KWCA 2ZCCA 2FNJB 4FHKA 3V61A 3HHMA 5JH5C 4GDKB 1WX9A 3TJPA 2MRPA 3ZW3A 2LZ6A 1RRBA 4GGQA 4EKUA 5J2RA 2V4LA 2FUHB 3DVGX 5JZEB 3DBSA 3VAWA 3ZRCA 2KDFB 2GBKA 3DBRI 4PYUA 2MBHA 2IO3B 2K8HA 1EF1A 4AUQC 2L8JA 1GC7A 5DPTA 3EECA 1SE9A 1YD8U 3NZSA 5GMVA 1WJ4A 2JPHA 2I1JA 3TBLD 4F7ZA 3VTUA 2KLCA 4IWPA 4ZYNA 1Z2MA 4E71A 1L2NA 3A33B 4W9HA 5DPWA 3DVGY 1UH6A 3PVLA 2KTFA 4F1SA 1WE6A 3TL5A 2KWUB 2M8SA 2O6VA 3KUCB 4K81A 4OVVA 3SHQA 2KWVB 3V6EB 4BKGA 3APCA 5LXHA 3JW0X 4NAWB 2MX2A 2ZPNA 3TMPB 2GMIC 3KYDD 1EO6A 1V2YA 3MHSD 3WA0A 1OEYJ 2DYBA 2LXCA 1AARA 1JRUA 2BWFA 2MCNB 4DHJD 2DAJA 1WMHB 4IG7B 2KKCA 1E8YA 3ALBA 1WZ3A 4GU2A 2BPSA 4MH0E 3ZLZA 2N9PC 4W9EA 1S1QB 3VDZA 2WWZA 2UWQA 2L0FA 1U4AA 2KC2A 4WAAA 2KJRA 4XC2A 3QWZB 4GDLA 2MP2A 2EMSA 4HWIB 2JXXA 3QIJA 2KVRA 1V9JA 4FA6A 2QHOA 3PREA 2CS4A 4GXBA 1EUVB 2KMCA 1MG8A 3ZIMA 4E74A 3X0WA 4FJZA 1C3TA 4IC7B 2JZZA 3LJ3A 4FULA 4WJOA 4GSWA 4ANUA 4K1RB 3NS8A 2LGYA 3BINA 3RCZA 2BYEA 4FLHA 3UIOB 1GG3A 2XK5B 2LVPA 1V5TA 1LFDA 2G4DB 2L76A 1T0YA 2A5UA 5AZGA 1YQBA 1E8WA 4ZRIA 4CHKA 1TZ1A 2EKEC 3QQ8B 3ECIA 4G3XB 1OQYA 2LJ5A 2M4NA 2G3QB 3UGBB 2Y5BB 5DCNA 4K7WA 3R7QA 3PPAA 1C1YB 2DHZA 4IM3A 1WE7A 2BYFA 2KANA 2JUOA 3D32A 3QAQA 3PT2B 3CSTA 2K8CA 2KQ7A 4A3PA 1I42A 3CF6E 4W9CA 2KK8A 4BVUC 4K7SA 4LCDE 4GDLB 2MP2B 3VH4B 1R4MI 3W1SA 2D07B 2KJ6A 3ML8A 1P9DU 1WXMA 1WGHA 1WH3A 2BF8B 4W9GA 3ZTDA 2ZVOA 1WIAA 3RULA 4W9DA 3W1YA 1L7YA 3S2AA 2KLGA 4JL9A 1UBIA 1LM8B 2KX0A 3HK0A 3MJWA 2N1VA 1A5RA 4MSMB 4IWOA 3AU4A 2DAFA 4KZCA 1YJ1A 2PPHA 3HM3A 2DZMA 3EC8A 3M95A 3O65B 4NAWA 2LVOA 1RFAA 2IO0B 3WAMA 2WX0A 2LI5A 2J0JA 3APDA 3VHTC 4FN2A 2C7HA 2MSED 1RAXA 1NDDA 1LQBA 5E6PA 3R7RA 4DK5A 2O6VD 4TQ1A 1WR1A 2JWZA 1TGZB 5AZFA 3DVNU 3H1UA 5LXIB 2CHXA 4HDQA 2NPTB 2AYOB 2ZNVC 4RM9A 2KDEB 3QCAA 4DDID 3VUXA 2ZCBA 2AWTA 3L54A 2JY6A 4BFRA 4CYEA 2KTRA 3OLMD 1GNUA 1M94A 3KVFB 2C7NB 2KX3A 1I35A 1HE8A 4NPNA 3KYCD 4TKNA 4GMVA 3DBHI 3L16A 5BO4B 3ZO5B 3ZDTA 2DZJA 1YIWA 3KUZA 4I6LB 4BBNF 3EHVA 1XT9B 1WM3A 2K39A 2K6QA 2G45B 3C0RB 3M3JA 4BKSA 1WXAA 3TCAA 3PSEB 2YVCA 3ZTCA 1H4RA 2GBMA 2XK5A 3OJ3A 1ZKHA 3V60A 3GOEA 4M8NA 4MGYE 1OTRB 3DBLI 2NBVB 1Z5SB 3NY5A 1K8RB 1WX7A 2CR5A 3A9KA 2D11A 2N9EB 4TV3A 3VUYA 5FR6A 1E8XA 4F8CB 4LJPB 2LRUA 3PGEA 4PYZA 2NBWB 1KOTA 2UYZB 2DYMA 2L00B 3U8ZA 3IBEA 1Q0WB 3B0AA 1ZW7A 2MLBA 3QHTA 1Y8RC 4M8MA 1X1MA 3ZNID 1WX8A 5AEKB 3WIMA 4HJKA 2IY0B 2BGFA 2GBNA 3JSVB 4HDOA 2DX5B 4B9KA 2OJRA 4EZKA 3M62B 3N32A 3QJZA 4W9LA 5IA7A 1UELA 2G4SA 2KTRB 3N3KB 5CHVC 3TIXA 2OOBB 3ENEA 2N7EA 2DZKA 4AJWA 3K9OB 3A4RA 4ZRKA 4DBGA 4G0NB 4HK2A 2K6DB 4B6WA 3AULA 2LWPA 4BKTA 1EF5A 5D2MB 2IO2B 3V6CB 1XQQA 4JGHB 1WJ6A 4DXAB 4EFOA 3KW5B 4MSQB 4IM2A 4AOFA 2YLMA 2KD0A 4KVGB 2D10A 3RZFA 3SU8X 2BYVE 4M0WB 1YX6B 3A9JB 3UQAA 4WJQA 3RT3B 2KQSA 5L83A 5TR5A 3B08A 1G6JA 2BKFA 1GJZA 4N9F4 3VXWA 2C60A 3A9KB 3ONSA 1E7UA 1WXSA 4LDTB 3ZRFA 4WQOB 4AP4C 4EOYA 5IAAC 4PS3A 1Q5WB 2AL3A 4BBNC 3APFA 3ZNGC 2NPTA 3QC8B 2FCNA 4HCNB 4XZ4A 2WDTB 3R66C 4JIOU 2IZVB 4ICUA 4XX5A 2K8BA 4KDLB 3ZNZB 1KM7A 2HD5B 3IHPC 2WYQA 3L13A 4EZLA 5J17A 3QK0A 1SIFA 3DQVA 3L0WB 3QARA 3JYUA 1OGWA 3PZDA 3HIZA 3RYTA 2R2QA 3UQBA 3U30A 1NBFC 2CHZA 4KSLC 5JHBA 3A4SC 2KFKB 1E8ZA 1WM2A 2LRWA 2LASA 3VVWB 4HPLB 1J0GA 3I3TB 2WX1A 3JVZX 5CX3A 3Q3FA 2KDIA 3NZUA 2CU1A 2ZNVB 4K7UA 2KN5A 3IFWB 5CHWA 2KFJA 4HLEA 4A3OA 3KUDB 1UD7A 2JF5A 4II3B 1LXDA 2ASQA 3DDCB 3DOWA 3OJ4B 1GC6A 3VTVA 1IPGA 4LJOB 4BKSD 2PJHA 5LLIA 3VTWA 2ZJDA 2L0TA 4TUUA 3IVFA 5KHOA 3H9DA 2A4ZA 3L17A 2M0XA 1H8CA 4NQKE 2JT4B 2REXA 4EUTA 2DZIA 2NS5A 3VQIA 4HXDA 3B1LX 3JSVA 2L7RA 2FIFA 5AZHA 1NI2A 3V62A 1WGDA 4KV2A 4YL8A 1TBEA 1V49A 3L08A 4DWFA 5HKHA 4HCPB 4MEMA 3UIPB 4AWJA 3PRPB 2MBOA 2MW5A 4NQLB 5C23A 3P2BA 2AL6A 1J19A 3Q3JA 2PE6B 2FCQA 4ICVA 1WFYA 3PLVA 4MELA 2V3SA 2MBEA 3DCGA 2KOXA 2HE7A 2C5LC 2V1YA 1VCBA 2M17A 3M63B 4FADA 4JLCA 2JVCA 2KC1A 4DHZB 1D3ZA 1F9JA 2KNBA 2B3AA 2J0MA 2MBQA 4W9FA 1KJTA 3X23A 4A20A 3A9JA 3MTNB 3U7DA 3IG3A 1V80A 5KHQA 2RSUA 3ZUNA 5J18A 2LXAA 2FCSA 4HVBA 1XD3B 2KHWB 1E90A 2VRRB 3NHEB 2NBUA 3WALA 3PV1A 1S3SG 2D2QA 1GUAB 2NCNA 1J8CA 4URKA 1KLVA 5DPSA 2NR2A 2HTHA 3BY4B 4EZJA 2N9XA 4KZ0A 2MA9B 4WJPA 1RLFA 2BKRB 4FBJB 1TTNA 4ANWA 4GIVA 1P0RA 3PRMB 2MQJA 4JQWC 4MGKE 4PS7A 1IYFA 4RMAA 2J0KA 3PTFC 3WAPA 1WZ0A 5E6NA 5JHAA 3PHWB 2Z59B 2JZ3B 2KXJA 3A1QB 1UGMA 2C9WB 2FIDA 3ZNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSK C;  4ZRJ A;  4OVU A;  4CO7 A;  4MDK E;  3AXC A;  3HM6 X;  4I6N B;  4TQ0 A;  2Z0D B;  3H7S A;  3ML9 A;  2KFK A;  4G50 A;  5G55 A;  3W1S C;  4NJ6 A;  2DYO A;  5D6J B;  2ZZP B;  1R4N I;  2M1M A;  3NOB A;  2ZVN A;  2I1K A;  3T9L A;  1PQS A;  2FCM A;  2IYD B;  3R3M A;  1ZGU B;  4KIK B;  2RGF A;  4IUM B;  3DPD A;  3QX1 A;  2IO1 B;  2JRH A;  3H7P A;  3RUI B;  4BOS C;  4W9I A;  2L3Z A;  2KZR A;  4ANX A;  4ANV A;  1P98 A;  4B95 A;  4GOC A;  5D94 A;  2Z0E B;  1V86 A;  2N1W A;  1WI0 A;  1WGG A;  3KH0 A;  3SD5 A;  4DHZ E;  1CMX B;  1WXV A;  1QZE A;  2FAZ A;  4ZDV A;  4AJY B;  4GN1 A;  2JRI B;  3RD2 A;  2O2V A;  3EFU A;  3UIN B;  2C7M B;  2IBI B;  3AU5 A;  1WYW B;  1WJN A;  2W9N A;  3VH3 B;  1ISN A;  4GB9 A;  1V5O A;  3GZN I;  3PS6 A;  3LDZ E;  4FJV B;  4ASW C;  1OEY A;  1SGH A;  1WR6 E;  4WWP A;  2O6V B;  2D3G A;  1P3Q U;  1WY8 A;  3ZDM C;  3UF8 A;  1FXT B;  2KMA A;  4MJS A;  3H6N A;  2K1F A;  3CMM B;  4I6P A;  4KDI C;  4NY0 A;  2K25 A;  4NJ7 A;  1VD2 A;  2IY1 B;  2L05 A;  2J7Q B;  2GOW A;  2LGX A;  1UZX B;  5D7G A;  4RM8 A;  4WWN A;  4X57 B;  4GDK A;  1P1A A;  2GBJ A;  4FHJ A;  4MGZ E;  2R2O A;  2DEN B;  2RD0 A;  5DPR A;  4IM0 A;  5C1Z A;  3H7P B;  3CSF A;  2XEW A;  3VFK A;  1V6E A;  2AEH A;  2KDB A;  2PEA A;  4EEW A;  3RZW C;  4E3C A;  4WWO A;  5EDS A;  2EMT A;  3VUW A;  4NNJ B;  5G2N A;  3WAO A;  4IW0 A;  3ZKJ C;  1V81 A;  3OAW A;  2XBB C;  4MM3 A;  2LD9 A;  4BOZ B;  4FJY A;  2HJ8 A;  2KO3 A;  4PS8 A;  2N7D A;  3WAN A;  4J6I A;  3ZVV A;  5CHF A;  2LUE A;  1UBQ A;  4LDT D;  4P7I A;  1E7V A;  3PLU A;  2PE9 A;  5CTR C;  2O2V B;  2CHW A;  3DVN V;  2KJH B;  1WRD B;  4DDG D;  3AI5 A;  1WJU A;  4MGI E;  3T8M A;  3A1Q A;  2GBR A;  2RPQ A;  1WGR A;  2NVU I;  3N30 A;  4II2 B;  5E6O A;  2RR9 A;  3PHX B;  4WJN A;  4G11 A;  2BWE S;  2MBB B;  2LVQ A;  3L10 B;  4IWQ A;  4DHJ B;  1BT0 A;  1WGY A;  1YX5 B;  1E5W A;  4HPM B;  3SDL C;  2LGD A;  5L95 C;  4MJS B;  3QA8 A;  4W9K A;  2N4F A;  1WMH A;  2ZPY A;  3PRZ A;  1Q1O A;  3K9P B;  4KIK A;  2CKH B;  1IP9 A;  2ZEQ A;  1WF9 A;  4W9J A;  2MWS B;  2KWC A;  2ZCC A;  2FNJ B;  4FHK A;  3V61 A;  3HHM A;  5JH5 C;  4GDK B;  1WX9 A;  3TJP A;  2MRP A;  3ZW3 A;  2LZ6 A;  1RRB A;  4GGQ A;  4EKU A;  5J2R A;  2V4L A;  2FUH B;  3DVG X;  5JZE B;  3DBS A;  3VAW A;  3ZRC A;  2KDF B;  2GBK A;  3DBR I;  4PYU A;  2MBH A;  2IO3 B;  2K8H A;  1EF1 A;  4AUQ C;  2L8J A;  1GC7 A;  5DPT A;  3EEC A;  1SE9 A;  1YD8 U;  3NZS A;  5GMV A;  1WJ4 A;  2JPH A;  2I1J A;  3TBL D;  4F7Z A;  3VTU A;  2KLC A;  4IWP A;  4ZYN A;  1Z2M A;  4E71 A;  1L2N A;  3A33 B;  4W9H A;  5DPW A;  3DVG Y;  1UH6 A;  3PVL A;  2KTF A;  4F1S A;  1WE6 A;  3TL5 A;  2KWU B;  2M8S A;  2O6V A;  3KUC B;  4K81 A;  4OVV A;  3SHQ A;  2KWV B;  3V6E B;  4BKG A;  3APC A;  5LXH A;  3JW0 X;  4NAW B;  2MX2 A;  2ZPN A;  3TMP B;  2GMI C;  3KYD D;  1EO6 A;  1V2Y A;  3MHS D;  3WA0 A;  1OEY J;  2DYB A;  2LXC A;  1AAR A;  1JRU A;  2BWF A;  2MCN B;  4DHJ D;  2DAJ A;  1WMH B;  4IG7 B;  2KKC A;  1E8Y A;  3ALB A;  1WZ3 A;  4GU2 A;  2BPS A;  4MH0 E;  3ZLZ A;  2N9P C;  4W9E A;  1S1Q B;  3VDZ A;  2WWZ A;  2UWQ A;  2L0F A;  1U4A A;  2KC2 A;  4WAA A;  2KJR A;  4XC2 A;  3QWZ B;  4GDL A;  2MP2 A;  2EMS A;  4HWI B;  2JXX A;  3QIJ A;  2KVR A;  1V9J A;  4FA6 A;  2QHO A;  3PRE A;  2CS4 A;  4GXB A;  1EUV B;  2KMC A;  1MG8 A;  3ZIM A;  4E74 A;  3X0W A;  4FJZ A;  1C3T A;  4IC7 B;  2JZZ A;  3LJ3 A;  4FUL A;  4WJO A;  4GSW A;  4ANU A;  4K1R B;  3NS8 A;  2LGY A;  3BIN A;  3RCZ A;  2BYE A;  4FLH A;  3UIO B;  1GG3 A;  2XK5 B;  2LVP A;  1V5T A;  1LFD A;  2G4D B;  2L76 A;  1T0Y A;  2A5U A;  5AZG A;  1YQB A;  1E8W A;  4ZRI A;  4CHK A;  1TZ1 A;  2EKE C;  3QQ8 B;  3ECI A;  4G3X B;  1OQY A;  2LJ5 A;  2M4N A;  2G3Q B;  3UGB B;  2Y5B B;  5DCN A;  4K7W A;  3R7Q A;  3PPA A;  1C1Y B;  2DHZ A;  4IM3 A;  1WE7 A;  2BYF A;  2KAN A;  2JUO A;  3D32 A;  3QAQ A;  3PT2 B;  3CST A;  2K8C A;  2KQ7 A;  4A3P A;  1I42 A;  3CF6 E;  4W9C A;  2KK8 A;  4BVU C;  4K7S A;  4LCD E;  4GDL B;  2MP2 B;  3VH4 B;  1R4M I;  3W1S A;  2D07 B;  2KJ6 A;  3ML8 A;  1P9D U;  1WXM A;  1WGH A;  1WH3 A;  2BF8 B;  4W9G A;  3ZTD A;  2ZVO A;  1WIA A;  3RUL A;  4W9D A;  3W1Y A;  1L7Y A;  3S2A A;  2KLG A;  4JL9 A;  1UBI A;  1LM8 B;  2KX0 A;  3HK0 A;  3MJW A;  2N1V A;  1A5R A;  4MSM B;  4IWO A;  3AU4 A;  2DAF A;  4KZC A;  1YJ1 A;  2PPH A;  3HM3 A;  2DZM A;  3EC8 A;  3M95 A;  3O65 B;  4NAW A;  2LVO A;  1RFA A;  2IO0 B;  3WAM A;  2WX0 A;  2LI5 A;  2J0J A;  3APD A;  3VHT C;  4FN2 A;  2C7H A;  2MSE D;  1RAX A;  1NDD A;  1LQB A;  5E6P A;  3R7R A;  4DK5 A;  2O6V D;  4TQ1 A;  1WR1 A;  2JWZ A;  1TGZ B;  5AZF A;  3DVN U;  3H1U A;  5LXI B;  2CHX A;  4HDQ A;  2NPT B;  2AYO B;  2ZNV C;  4RM9 A;  2KDE B;  3QCA A;  4DDI D;  3VUX A;  2ZCB A;  2AWT A;  3L54 A;  2JY6 A;  4BFR A;  4CYE A;  2KTR A;  3OLM D;  1GNU A;  1M94 A;  3KVF B;  2C7N B;  2KX3 A;  1I35 A;  1HE8 A;  4NPN A;  3KYC D;  4TKN A;  4GMV A;  3DBH I;  3L16 A;  5BO4 B;  3ZO5 B;  3ZDT A;  2DZJ A;  1YIW A;  3KUZ A;  4I6L B;  4BBN F;  3EHV A;  1XT9 B;  1WM3 A;  2K39 A;  2K6Q A;  2G45 B;  3C0R B;  3M3J A;  4BKS A;  1WXA A;  3TCA A;  3PSE B;  2YVC A;  3ZTC A;  1H4R A;  2GBM A;  2XK5 A;  3OJ3 A;  1ZKH A;  3V60 A;  3GOE A;  4M8N A;  4MGY E;  1OTR B;  3DBL I;  2NBV B;  1Z5S B;  3NY5 A;  1K8R B;  1WX7 A;  2CR5 A;  3A9K A;  2D11 A;  2N9E B;  4TV3 A;  3VUY A;  5FR6 A;  1E8X A;  4F8C B;  4LJP B;  2LRU A;  3PGE A;  4PYZ A;  2NBW B;  1KOT A;  2UYZ B;  2DYM A;  2L00 B;  3U8Z A;  3IBE A;  1Q0W B;  3B0A A;  1ZW7 A;  2MLB A;  3QHT A;  1Y8R C;  4M8M A;  1X1M A;  3ZNI D;  1WX8 A;  5AEK B;  3WIM A;  4HJK A;  2IY0 B;  2BGF A;  2GBN A;  3JSV B;  4HDO A;  2DX5 B;  4B9K A;  2OJR A;  4EZK A;  3M62 B;  3N32 A;  3QJZ A;  4W9L A;  5IA7 A;  1UEL A;  2G4S A;  2KTR B;  3N3K B;  5CHV C;  3TIX A;  2OOB B;  3ENE A;  2N7E A;  2DZK A;  4AJW A;  3K9O B;  3A4R A;  4ZRK A;  4DBG A;  4G0N B;  4HK2 A;  2K6D B;  4B6W A;  3AUL A;  2LWP A;  4BKT A;  1EF5 A;  5D2M B;  2IO2 B;  3V6C B;  1XQQ A;  4JGH B;  1WJ6 A;  4DXA B;  4EFO A;  3KW5 B;  4MSQ B;  4IM2 A;  4AOF A;  2YLM A;  2KD0 A;  4KVG B;  2D10 A;  3RZF A;  3SU8 X;  2BYV E;  4M0W B;  1YX6 B;  3A9J B;  3UQA A;  4WJQ A;  3RT3 B;  2KQS A;  5L83 A;  5TR5 A;  3B08 A;  1G6J A;  2BKF A;  1GJZ A;  4N9F 4;  3VXW A;  2C60 A;  3A9K B;  3ONS A;  1E7U A;  1WXS A;  4LDT B;  3ZRF A;  4WQO B;  4AP4 C;  4EOY A;  5IAA C;  4PS3 A;  1Q5W B;  2AL3 A;  4BBN C;  3APF A;  3ZNG C;  2NPT A;  3QC8 B;  2FCN A;  4HCN B;  4XZ4 A;  2WDT B;  3R66 C;  4JIO U;  2IZV B;  4ICU A;  4XX5 A;  2K8B A;  4KDL B;  3ZNZ B;  1KM7 A;  2HD5 B;  3IHP C;  2WYQ A;  3L13 A;  4EZL A;  5J17 A;  3QK0 A;  1SIF A;  3DQV A;  3L0W B;  3QAR A;  3JYU A;  1OGW A;  3PZD A;  3HIZ A;  3RYT A;  2R2Q A;  3UQB A;  3U30 A;  1NBF C;  2CHZ A;  4KSL C;  5JHB A;  3A4S C;  2KFK B;  1E8Z A;  1WM2 A;  2LRW A;  2LAS A;  3VVW B;  4HPL B;  1J0G A;  3I3T B;  2WX1 A;  3JVZ X;  5CX3 A;  3Q3F A;  2KDI A;  3NZU A;  2CU1 A;  2ZNV B;  4K7U A;  2KN5 A;  3IFW B;  5CHW A;  2KFJ A;  4HLE A;  4A3O A;  3KUD B;  1UD7 A;  2JF5 A;  4II3 B;  1LXD A;  2ASQ A;  3DDC B;  3DOW A;  3OJ4 B;  1GC6 A;  3VTV A;  1IPG A;  4LJO B;  4BKS D;  2PJH A;  5LLI A;  3VTW A;  2ZJD A;  2L0T A;  4TUU A;  3IVF A;  5KHO A;  3H9D A;  2A4Z A;  3L17 A;  2M0X A;  1H8C A;  4NQK E;  2JT4 B;  2REX A;  4EUT A;  2DZI A;  2NS5 A;  3VQI A;  4HXD A;  3B1L X;  3JSV A;  2L7R A;  2FIF A;  5AZH A;  1NI2 A;  3V62 A;  1WGD A;  4KV2 A;  4YL8 A;  1TBE A;  1V49 A;  3L08 A;  4DWF A;  5HKH A;  4HCP B;  4MEM A;  3UIP B;  4AWJ A;  3PRP B;  2MBO A;  2MW5 A;  4NQL B;  5C23 A;  3P2B A;  2AL6 A;  1J19 A;  3Q3J A;  2PE6 B;  2FCQ A;  4ICV A;  1WFY A;  3PLV A;  4MEL A;  2V3S A;  2MBE A;  3DCG A;  2KOX A;  2HE7 A;  2C5L C;  2V1Y A;  1VCB A;  2M17 A;  3M63 B;  4FAD A;  4JLC A;  2JVC A;  2KC1 A;  4DHZ B;  1D3Z A;  1F9J A;  2KNB A;  2B3A A;  2J0M A;  2MBQ A;  4W9F A;  1KJT A;  3X23 A;  4A20 A;  3A9J A;  3MTN B;  3U7D A;  3IG3 A;  1V80 A;  5KHQ A;  2RSU A;  3ZUN A;  5J18 A;  2LXA A;  2FCS A;  4HVB A;  1XD3 B;  2KHW B;  1E90 A;  2VRR B;  3NHE B;  2NBU A;  3WAL A;  3PV1 A;  1S3S G;  2D2Q A;  1GUA B;  2NCN A;  1J8C A;  4URK A;  1KLV A;  5DPS A;  2NR2 A;  2HTH A;  3BY4 B;  4EZJ A;  2N9X A;  4KZ0 A;  2MA9 B;  4WJP A;  1RLF A;  2BKR B;  4FBJ B;  1TTN A;  4ANW A;  4GIV A;  1P0R A;  3PRM B;  2MQJ A;  4JQW C;  4MGK E;  4PS7 A;  1IYF A;  4RMA A;  2J0K A;  3PTF C;  3WAP A;  1WZ0 A;  5E6N A;  5JHA A;  3PHW B;  2Z59 B;  2JZ3 B;  2KXJ A;  3A1Q B;  1UGM A;  2C9W B;  2FID A;  3ZNH B; 
#chains in the Genus database with same CATH topology
 4KSK C;  4OVU A;  1JWM D;  4TQ0 A;  3H7S A;  3ML9 A;  2KFK A;  1I4G A;  3ZXR A;  2NTS A;  4US9 A;  1HQR D;  3R3M A;  4KIK B;  5D3D A;  1F2R C;  3R2I A;  3U52 E;  3H7P A;  4W9I A;  2KZR A;  4ANX A;  2PLP A;  4GOC A;  4RGM A;  2N1W A;  1WGG A;  4DHZ E;  4AJY B;  4BAX A;  2ICI A;  3UIN B;  3BK1 A;  1DOI A;  1YOV B;  4ARI A;  1PYW D;  1WYG A;  3GZN I;  4FJV B;  1P3Q U;  4N6E B;  1QOB A;  1E9M A;  2WXH A;  3Q8E A;  3ZDM C;  4NZL B;  3H6N A;  3BK2 A;  4HKQ A;  1VD2 A;  2J7Q B;  1R7S A;  2LGX A;  3VR8 B;  1QQR A;  4X57 B;  2LHE A;  2JX5 A;  4GLS C;  2QC8 A;  2ONQ A;  3CSF A;  2PEA A;  2KDB A;  4OVZ A;  1NYR A;  3WAO A;  5G2N A;  4IW0 A;  3ZKJ C;  3OAW A;  1FEH A;  4PK1 A;  2KO3 A;  2N7D A;  3ZVV A;  2LUE A;  1D6E C;  2O2V B;  3AEA B;  1ACC A;  2QMT A;  2NVU I;  5E6O A;  1EM7 A;  2AX5 A;  2LFI A;  2MBB B;  2V9H A;  1YX5 B;  4MJS B;  2ZPY A;  3PRZ A;  1Q1O A;  2LEK A;  3K9P B;  2CKH B;  2ZEQ A;  2KWC A;  3V61 A;  3HHM A;  5JH5 C;  4GDK B;  3ZW3 A;  4GGQ A;  3VAW A;  2KDF B;  2K8H A;  2VZK B;  3P63 A;  4AUQ C;  1GC7 A;  5DPT A;  4KX6 B;  3AE1 B;  3EEC A;  4KKI A;  3NZS A;  4FXC A;  1JQ4 A;  3RNE C;  2AQ3 B;  3A33 B;  1V1O A;  1UH6 A;  3DWG C;  3PVL A;  2LUM A;  4N59 A;  3VRB B;  1HZ6 A;  1ROE A;  3TL5 A;  3KUC B;  4BKG A;  3V6E B;  4K81 A;  3GE8 C;  2MX2 A;  2ZPN A;  3TMP B;  1ZPS A;  2JWU A;  1V2Y A;  5AUI A;  2LXC A;  1AAR A;  2BWF A;  1L6U A;  1NI3 A;  2DAJ A;  4NJC A;  4P6V F;  1E8Y A;  1WRI A;  1T0R C;  1WWT A;  2BPS A;  1D4B A;  1YN4 A;  4US8 A;  5MPO A;  4HWI B;  2V3P A;  2BYT A;  2CS4 A;  4GXB A;  5HFY A;  4E74 A;  1C3T A;  4IC7 B;  3LJ3 A;  2IND C;  3KWL A;  3ZGZ A;  3AEF B;  2D3B A;  2VH1 A;  2XK5 B;  3I57 A;  1XLQ A;  2L76 A;  2QIE B;  2NMQ A;  4YSX B;  1IBX B;  5G5G A;  3UGB B;  3RNF C;  3NS1 A;  3PPA A;  2KAN A;  3D32 A;  5I4D A;  3Q8F A;  3H8H A;  4K7S A;  2DLB A;  2D07 B;  3ML8 A;  1WIA A;  3W1Y A;  1HTO A;  2J4X A;  1A5R A;  2BS2 B;  1JML A;  3R2T A;  3V05 A;  2JQR B;  1RFA A;  2CU3 A;  1SE2 A;  3WAM A;  1ZOY B;  4RF0 A;  1AYF A;  4FN2 A;  4EE2 A;  1LQB A;  1QT9 A;  4TQ1 A;  2JWZ A;  1TGZ B;  3ZJT A;  3Q8B A;  3Q8C A;  5E6J A;  4WIP A;  5LXI B;  2CHX A;  2AYO B;  4RM9 A;  2KDE B;  2KAC A;  1EWY C;  3RNC C;  2AWT A;  1L0V B;  2JY6 A;  3L54 A;  1TYG B;  2PTL A;  2C7N B;  2KX3 A;  1HE8 A;  3KYC D;  3DBH I;  1YIW A;  4BBN F;  3Q6B A;  3EHV A;  2K6Q A;  2G45 B;  1FNV A;  3PSE B;  3RMK C;  4UDU C;  2YVC A;  1YQ3 B;  1SXT A;  2NTT A;  3DBL I;  1P7E A;  3P4Q B;  3A9K A;  4TV3 A;  2N9E B;  3VUY A;  2DYM A;  3U8Z A;  1Q0W B;  2MLB A;  1HZ5 A;  2AQ2 B;  1GPX A;  1WX8 A;  5FK9 C;  2K5P A;  4CQN A;  3WIM A;  4HJK A;  4ZRQ A;  1SE4 A;  1E6E B;  5IA7 A;  2KTR B;  2OOB B;  1D5Z C;  2D5G A;  4AJW A;  1JWA D;  3K9O B;  2ACZ B;  3BVM A;  4G0N B;  2INP E;  4B6W A;  5IOI A;  1EF5 A;  4BKT A;  1XQQ A;  1WJ6 A;  1N61 A;  1DOX A;  1N63 A;  2YLM A;  2KD0 A;  3SU8 X;  3A9J B;  1IUE A;  3B08 A;  3ABV B;  4J3O D;  2WXL A;  2WXR A;  3AH7 A;  4AP4 C;  2NPT A;  3QC8 B;  3EGR A;  2QDF A;  4ICU A;  2IGD A;  4KDL B;  1KM7 A;  2HD5 B;  3L13 A;  2WYQ A;  4EZL A;  4YSZ B;  5J17 A;  1NVI D;  3ZQ4 A;  3DQV A;  2R2Q A;  3ZYY X;  3UQB A;  4KSL C;  1ZP0 B;  3I3T B;  1FFV A;  2KN5 A;  5CHW A;  5G5H A;  2JF5 A;  3I63 C;  1LXD A;  3DDC B;  2FBW B;  4LJO B;  4RCO A;  5LLI A;  2ZJD A;  3IVF A;  5KHO A;  2A4Z A;  2M0X A;  1H8C A;  1TY0 A;  2H88 B;  2NS5 A;  3B9J A;  3AE8 B;  2L7R A;  4YTN B;  5AZH A;  4HRO A;  1TJE A;  1R4M B;  1XF5 L;  4XE0 A;  5HKH A;  1UWM A;  4MEM A;  3UIP B;  2MW5 A;  5C23 A;  1MPE A;  1F52 A;  1ZDX A;  2V3N A;  3Q3J A;  2PE6 B;  2BT6 A;  2V3S A;  2MBE A;  2G9H D;  3M63 B;  1VCB A;  1B9R A;  4DHZ B;  1F9J A;  2H89 B;  4W9F A;  2MBQ A;  3AEB B;  1TS4 A;  4A20 A;  1D5X C;  2PMV A;  1EU4 A;  3ZUN A;  3BYY B;  1UGJ A;  3N9Y C;  4YXD B;  3PV1 A;  2RDH A;  1GUA B;  4URK A;  1KLV A;  5DPS A;  4KGS A;  2BKR B;  4FBJ B;  1TTN A;  4JQW C;  4PS7 A;  1C4P A;  4RMA A;  2N9K A;  3DBR B;  1C9F A;  1M4V A;  2JZ3 B;  1VLB A;  2FID A;  4ZRJ A;  3I5J C;  3AXC A;  4I6N B;  4ARC A;  2DYO A;  2ZZP B;  1R4N I;  2L32 A;  2M1M A;  1V1P B;  3BII D;  2ZVN A;  2I1K A;  1PQS A;  3AE6 B;  1ZGU B;  2RGF A;  1YN5 A;  5FKA C;  4IOI E;  1PGX A;  3PO0 A;  4ANV A;  2WLB A;  4HKZ E;  1F0Z A;  1TIF A;  2BBC A;  5D3I B;  2M19 A;  1QZE A;  2FAZ A;  2HJ1 A;  2O2V A;  2C7M B;  2DWQ A;  3AU5 A;  3VH3 B;  1V5O A;  2WQY B;  1E10 A;  4WWP A;  2DBY A;  2O6V B;  2D3G A;  5HHD G;  3UF8 A;  2KMA A;  1FRR A;  2BVC A;  4MJS A;  2K1F A;  3CMM B;  4I6P A;  4MT5 A;  1NEN B;  1QOF A;  2OHF A;  1UZX B;  4GDK A;  4IM0 A;  1ENF A;  3P4S B;  2BS3 B;  2MJE A;  3BVZ A;  5C1Z A;  2WNM A;  3VFK A;  4EEW A;  1VZ6 A;  2EMT A;  3VUW A;  4C80 A;  4BOZ B;  4FJY A;  2HJ8 A;  5CHF A;  1UBQ A;  4P7I A;  3PLU A;  4MGI E;  1A70 A;  1WJU A;  2KQ4 X;  2RPQ A;  1WGR A;  4XGA B;  4JX1 C;  5BYR A;  3PHX B;  4S0R A;  3L10 B;  4HPM B;  3SDL C;  4OHJ A;  2L1A A;  4M02 A;  2IPK D;  2ZCC A;  3BZD B;  4FHK A;  2L52 A;  1WX9 A;  2MRP A;  1RRB A;  2V4L A;  2PVO D;  4ITK A;  4L2Y A;  3DVG X;  3DBS A;  2MBH A;  1EF1 A;  1CZP A;  2CJO A;  1SE9 A;  5GMV A;  2JPH A;  3AEE B;  3TBL D;  4F7Z A;  4IWP A;  1Z2M A;  4XWW A;  4F1S A;  4JPS A;  1WE6 A;  2KWU B;  2M8S A;  5LXH A;  2KWV B;  2RDB C;  1YMH E;  3KYD D;  1IBX A;  5JXV A;  3MHS D;  3IXS A;  3GB1 A;  3ZJU A;  2DYB A;  1AW7 A;  3KWV A;  4DHJ D;  1WMH B;  4GU2 A;  4LTU A;  2QSD A;  1S1Q B;  5EE9 A;  3VDZ A;  2UWQ A;  2WXJ A;  2W3S A;  2JXX A;  4FA6 A;  2QHO A;  3MP9 A;  3PRE A;  3X0W A;  1MFW A;  2XNA C;  4LK0 M;  1LGR A;  3B2G A;  2R61 A;  3L4P A;  1FPY A;  1SJH D;  4K1R B;  2BYE A;  4FLH A;  1GG3 A;  1FXI A;  3W5V B;  1T0Y A;  2KN4 A;  1E8W A;  1RFK A;  1XLP A;  4LNK A;  2Y5P A;  3QQ8 B;  4G3X B;  2M4N A;  2Y5B B;  5DCN A;  1C1Y B;  3NVV A;  4RF1 A;  4IM3 A;  2LGI A;  1WE7 A;  2BYF A;  2JUO A;  3QAQ A;  2E3T A;  3CST A;  3MC9 A;  1YQ4 B;  2KK8 A;  4BVU C;  4HJG E;  3AB5 A;  4LCD E;  3AE7 B;  2MP2 B;  4GDL B;  3W1S A;  5IO9 A;  2E6X A;  3NG0 A;  5BYS A;  1L7Y A;  3S2A A;  2KLG A;  4JL9 A;  3GZN B;  2DAF A;  1P7F A;  4NAW A;  2LVO A;  2IO0 B;  4ZHO A;  2WX0 A;  2LI5 A;  2PIA A;  2J0J A;  3DWM A;  2N0S B;  2C7H A;  4ACF A;  1NDD A;  5E6P A;  3R7R A;  4DK5 A;  2O6V D;  1XLN A;  4ZRP A;  3DVN U;  4HDQ A;  3AEC B;  4HRS A;  1STE A;  1PFD A;  4DDI D;  3VUX A;  2K3U A;  2KTR A;  3ETR A;  5EE3 A;  1F2R I;  3N1X C;  3B2F A;  3ZO5 B;  2MJD A;  2DZJ A;  3KUZ A;  4I6L B;  2Q5W D;  2IGH A;  1K52 A;  4WUR A;  2M56 B;  1WM3 A;  1I4R A;  1K51 A;  3ZTC A;  1KF6 B;  2GB1 A;  1N5W A;  3V60 A;  3GOE A;  4M8N A;  3GE3 C;  4A8X C;  2NBV B;  1Z5S B;  2CR5 A;  2D11 A;  4PT5 A;  4LJP B;  2BW2 A;  2NBW B;  4HPP A;  1YN3 A;  1KOT A;  3W5U B;  1Y8R C;  4LNO A;  3P4R B;  4B0E A;  2GBN A;  4HDO A;  3JSV B;  1XO3 A;  4W9L A;  4DXG A;  4P16 A;  5BYQ A;  4ZRK A;  2K6D B;  5D2M B;  2JYE A;  2IO2 B;  2MJ3 A;  3N1Z C;  4EFO A;  4MSQ B;  4AOF A;  1BUI C;  2ZW0 A;  1C78 A;  4JE3 B;  2D10 A;  3RZF A;  2BQQ A;  1NYQ A;  1DGJ A;  1SSN A;  1T0Q C;  1T3Q A;  2BKF A;  4N9F 4;  3VXW A;  2JXT A;  1WXS A;  4WQO B;  4EOY A;  5IAA C;  4PS3 A;  3U7Z A;  3APF A;  3ZNG C;  2WDT B;  4OZA A;  1SEB D;  1JRO A;  4XX5 A;  3KQ4 A;  1TKY A;  3IHP C;  2WDQ B;  3QK0 A;  1C4C A;  1SIF A;  3L0W B;  3JYU A;  3SFD B;  3VR9 B;  2KFK B;  3NRZ A;  2LAS A;  3SEB A;  1J0G A;  2WX1 A;  5CX3 A;  3Q3F A;  4A3O A;  4II3 B;  3RI7 C;  4BKS D;  2PJH A;  3IT4 B;  3VTW A;  2V0G A;  2EKI A;  3L17 A;  4NQK E;  2JT4 B;  3FIL B;  3NVW A;  1NI2 A;  1WGD A;  4KV2 A;  1QF6 A;  3FAH A;  4AWJ A;  1CK1 A;  1BXT A;  3P2B A;  2AL6 A;  1J19 A;  3ZXV A;  1E7P B;  1WSP A;  3PLV A;  1V1P A;  3DCG A;  2KOX A;  2HE7 A;  2V1Y A;  2M17 A;  3AV8 A;  2N7J A;  2JVC A;  2KC1 A;  2KNB A;  2J0M A;  1KJT A;  2V4I B;  4M0W A;  3U7D A;  3IG3 A;  1V80 A;  3NJT A;  3IT6 B;  1KLU D;  5J18 A;  4HVB A;  2FCS A;  3WAL A;  2NBU A;  2Z8L A;  2NR2 A;  1T0S C;  1ESF A;  4EZJ A;  1ET6 A;  4C7Z A;  2WXP A;  1GB1 A;  4MGK E;  3TEZ A;  2J0K A;  1KFY B;  5IKC M;  3WAP A;  1WZ0 A;  1C76 A;  3PHW B;  1QIL A;  4OW0 A;  4CO7 A;  4MDK E;  3HM6 X;  1LO5 D;  2Z0D B;  4NJ6 A;  3T9L A;  1Y56 A;  3EFC A;  3QX1 A;  2IO1 B;  2JRH A;  3RUI B;  3TEW A;  5EE0 A;  1P98 A;  4B95 A;  5D94 A;  3DHI C;  1WI0 A;  3KH0 A;  1CMX B;  2YEP B;  3LYY A;  4ZDV A;  5BMG A;  4GN1 A;  1YJJ A;  3Q14 C;  2IBI B;  1WJN A;  4XYC A;  2W9N A;  1GOZ A;  4LNF A;  4XDD A;  3RNA C;  3LDZ E;  2KWD A;  4ASW C;  1WY8 A;  2I38 A;  4USA A;  1K50 A;  4A9A A;  4KDI C;  1JCK B;  1RYJ A;  2K25 A;  4NJ7 A;  1WXQ A;  4S17 A;  2WDV B;  3P4P B;  4P1C C;  1TS5 A;  4WH4 A;  2G1E A;  5D7G A;  4WWN A;  1T6B X;  2GBJ A;  4MGZ E;  2R2O A;  2RD0 A;  2J52 A;  2W82 A;  2XEW A;  1V6E A;  2AEH A;  4L23 A;  3W9C B;  1I4X A;  3RZW C;  4WWO A;  4NNJ B;  4AS1 A;  1V81 A;  2SAK A;  1N62 A;  4PS8 A;  3WAN A;  4J6I A;  1E7V A;  3URY A;  5CTR C;  2CHW A;  3DVN V;  3AI5 A;  3T8M A;  3A1Q A;  2GBR A;  3GP7 A;  3PZ8 A;  4WJN A;  1FCC C;  2BWE S;  4DHJ B;  4IWQ A;  1WGY A;  3Q2A C;  2LGD A;  5L95 C;  3QA8 A;  1WMH A;  4KIK A;  1WF9 A;  1XLO A;  2MWS B;  2FNJ B;  2LZ6 A;  5JZE B;  3DBR I;  4RGN A;  4PYU A;  2IO3 B;  2L8J A;  2EEL A;  4AQ7 A;  3J9C A;  4DXF A;  4MM3 B;  2KLC A;  4ZYN A;  1FFU A;  1L2N A;  4TMA B;  4W9H A;  3DVG Y;  2L83 A;  4RNA A;  1HA5 A;  4KKJ A;  4OVV A;  4ZYS A;  1F1H A;  3APC A;  3JW0 X;  2MH7 A;  2GMI C;  1EO6 A;  2WGS A;  2VH2 A;  3WA0 A;  2LJI A;  1OEY J;  3DHG C;  1JRU A;  2MCN B;  1QOA A;  2KKC A;  3ZLZ A;  4W9E A;  2WWZ A;  2L0F A;  2WP9 B;  4JWS C;  1U4A A;  4WAA A;  1TKG A;  2MP2 A;  4GDL A;  4K3B A;  3VRA B;  1JWS D;  1MG8 A;  2JZZ A;  3OG5 A;  4ANU A;  2CJN A;  5BMH A;  1CQV A;  5C2T B;  3UIO B;  2WXF A;  1FO4 A;  2LVP A;  1V5T A;  1LFD A;  3AE3 B;  3MC0 B;  3NVZ A;  4MAC A;  1YQB A;  2BB6 A;  1YJI A;  1TZ1 A;  2EKE C;  2WXQ A;  3ECI A;  2LJ5 A;  4K7W A;  2JZP A;  1HEZ E;  3R7Q A;  2DHZ A;  4KGR A;  5EE1 A;  1IGC A;  1SJE D;  3PT2 B;  2K8C A;  4A3P A;  3CF6 E;  4W9C A;  1EU3 A;  3ZJV A;  3EUB 2;  1P9D U;  3TEY A;  1WGH A;  2BF8 B;  3FC4 A;  1E0Z A;  3RUL A;  4W9D A;  1SF0 A;  1QKZ A;  1LM8 B;  1MHX A;  3MJW A;  2ON8 A;  2N1V A;  2BTE A;  4MSM B;  2PPH A;  3HM3 A;  1L0X B;  2DZM A;  3O65 B;  4LNN A;  1L5P A;  1GB4 A;  3APD A;  2TSS A;  1RAX A;  4HEA 1;  1L6V A;  3RFZ B;  1GAQ B;  4P1B C;  4QAY A;  2NPT B;  2ZNV C;  4WWM A;  2ZCB A;  3RN9 C;  4BFR A;  1M94 A;  1TZO A;  1I35 A;  3L16 A;  3C8Y A;  5IN7 A;  3Q3M C;  1N5X A;  3TSS A;  1XT9 B;  2K39 A;  3M3J A;  3TCA A;  5H92 C;  1H4R A;  1RM6 C;  2XK5 A;  3OJ3 A;  2X8X X;  1SIJ A;  1K8R B;  4F8C B;  2YEP F;  3PGE A;  2UYZ B;  1ZW7 A;  3QHT A;  4M8M A;  1X1M A;  4JWU C;  5AEK B;  2FE8 A;  1VRA B;  2OJW A;  4EZK A;  3M62 B;  3HRD D;  2G4S A;  3TIX A;  3T3O A;  2N7E A;  2DZK A;  4L1B A;  3DHH C;  3A4R A;  2IDY A;  4DBG A;  4HK2 A;  3AUL A;  4OZC A;  1DYQ A;  4WQM A;  4DXA B;  5FR3 A;  3KW5 B;  4KVG B;  2JU6 X;  3UQA A;  4C4V B;  3RT3 B;  3SFE B;  2KQS A;  5L83 A;  1G6J A;  1I4H A;  3I9V 1;  1GJZ A;  3AE5 B;  3ONS A;  2WXO A;  4LDT B;  3ZRF A;  1FNW A;  2AL3 A;  2FCN A;  2GRI A;  4HCN B;  3FIL A;  2D3C A;  2UU7 A;  4XZ4 A;  5AUK A;  2BS4 B;  1TS2 A;  2IZV B;  2K8B A;  1J7A A;  1V97 A;  1MJD A;  3TUO A;  3WCQ A;  4REZ A;  3QAR A;  2X38 A;  1OGW A;  3PZD A;  3RYT A;  3U30 A;  1NBF C;  2J42 A;  3VVW B;  1E8Z A;  4RFB A;  2K22 A;  1VZ7 A;  3JVZ X;  3NZU A;  2CU1 A;  2ZNV B;  3AMZ A;  2IGG A;  3AED B;  1JAL A;  3KUD B;  3P1M A;  2ASQ A;  4RGO S;  1IPG A;  2XN9 C;  3RNB C;  2WHI A;  3H9D A;  1HTQ A;  1EWC A;  1UF0 A;  4EUT A;  1K53 A;  3VQI A;  4HXD A;  3B1L X;  1SE3 A;  4YL8 A;  4DWF A;  1V49 A;  4HCP B;  2MBO A;  2WXN A;  1IGD A;  1I4Q A;  3CIR B;  4ICV A;  4MEL A;  1C79 A;  2C5L C;  1FIQ A;  4MH8 A;  3R8B A;  4JLC A;  2B76 B;  5H8Y E;  3PZ7 A;  3X23 A;  2LHD A;  2I2Y A;  4M01 A;  3A9J A;  3MTN B;  5KHQ A;  1QLB B;  4LLG M;  1XD3 B;  2K9X A;  2KHW B;  2VRR B;  3NHE B;  5LNK 1;  1S3S G;  2D2Q A;  2OED A;  1J8C A;  2MEK A;  3BY4 B;  2N9X A;  4RGT A;  2MA9 B;  4WJP A;  1RLF A;  4KGT A;  4O1N A;  4N58 A;  3HVZ A;  2MQJ A;  5E6N A;  1AWD A;  2KXJ A;  3CWI A;  1UGM A;  3ZNH B;  2GI9 A;  4G50 A;  3W2D A;  5G55 A;  3W1S C;  3BWU D;  5D6J B;  3LXF A;  4R3D A;  1PGA A;  3NOB A;  2FCM A;  2IYD B;  1SB3 C;  4IUM B;  1XEE A;  3DPD A;  3HVD A;  4BOS C;  1NEK B;  2L3Z A;  1OFF A;  2Z0E B;  1V86 A;  3SD5 A;  1WXV A;  4RH6 A;  2JRI B;  3RD2 A;  1PDX A;  4ZOH C;  3EFU A;  3FKY A;  1WYW B;  4YT0 B;  1ISN A;  2WXI A;  4GB9 A;  4XWT A;  3PS6 A;  1OEY A;  1SGH A;  1WR6 E;  4DQO C;  1FXT B;  4NY0 A;  3MJ5 A;  1AN8 A;  1ET9 A;  1MG4 A;  2IY1 B;  2L05 A;  4C00 A;  2GOW A;  1UUP A;  4RM8 A;  1CJE A;  1P1A A;  4FHJ A;  5DPR A;  2DEN B;  2QEJ C;  1J7B A;  5HG2 A;  2WU5 B;  3H7P B;  1YNT E;  4E3C A;  4M00 A;  5EDS A;  5HI1 A;  1DOY A;  3KLS X;  1FNU A;  2KDM A;  3T3N A;  2XBB C;  1ZE3 D;  3C19 A;  2LD9 A;  4MM3 A;  1C4A A;  4OZB A;  3Q69 A;  1KLG D;  4LDT D;  2PE9 A;  2WXK A;  3Q8A A;  1ZXH A;  2KJH B;  1WRD B;  1ZXI A;  4DDG D;  1WGK A;  1PUT A;  5GXG B;  2JYT A;  3AEG B;  3N30 A;  4II2 B;  1N60 A;  3LB8 C;  2RR9 A;  3E9S A;  4G11 A;  1TY2 A;  1B1Z A;  2LVQ A;  1BT0 A;  1V8C A;  1E5W A;  1JRP A;  4W9K A;  2N4F A;  2MHJ A;  1FXA A;  2W54 A;  1IP9 A;  4W9J A;  1KTK A;  1JWB D;  1XCT L;  3TJP A;  4EKU A;  5J2R A;  2PKO A;  4YSY B;  2FUH B;  1TS3 A;  3ZRC A;  1TKE A;  2GBK A;  1VDV A;  2KYW A;  4YTM B;  1YD8 U;  2K0P A;  3EA6 A;  1WJ4 A;  5T8I A;  2I1J A;  2Y3A A;  3VTU A;  3N20 C;  4E71 A;  5DPW A;  2KTF A;  3DBH B;  1RWS A;  2O6V A;  3NUH B;  3SHQ A;  2PVG C;  4NAW B;  3MFG A;  3OWE B;  2D3A A;  2LMC A;  4IG7 B;  1XCQ L;  3U4E G;  3ALB A;  1WZ3 A;  3DBL B;  4MH0 E;  2N9P C;  1T5X D;  2KC2 A;  4XC2 A;  2KJR A;  3QWZ B;  2EMS A;  1FM0 D;  3QIJ A;  4YWG G;  2KVR A;  1V9J A;  1MVK A;  1EUV B;  2KMC A;  3ZIM A;  4FJZ A;  1PGB A;  4FUL A;  4WJO A;  2VZK D;  4C56 C;  4GSW A;  3AN1 A;  3NS8 A;  2LGY A;  3BIN A;  2KT7 A;  3RCZ A;  2G4D B;  5AZG A;  2A5U A;  4WAF A;  2GLS A;  4ZRI A;  4CHK A;  2AQ1 B;  1OQY A;  2G3Q B;  1HXY D;  5BMI A;  2KQ7 A;  3U2S C;  1I42 A;  2RPV A;  1FRD A;  1XXG A;  3VH4 B;  1JW9 D;  1R4M I;  1FD6 A;  2KJ6 A;  1WXM A;  3AE9 B;  4W9G A;  1WH3 A;  4A6Q A;  3ZTD A;  2ZVO A;  1UBI A;  2KX0 A;  3HK0 A;  1L4D B;  4IWO A;  3AU4 A;  3IAM 1;  4KZC A;  1YJ1 A;  2IJ0 A;  1I4P A;  3EC8 A;  3M95 A;  4B0M A;  2LGS A;  3AM9 A;  2QIL A;  3VHT C;  2MSE D;  2WDR B;  2INC C;  4A55 A;  3HUI A;  1WR1 A;  5AZF A;  3H1U A;  2M0A A;  1ZUD 2;  3QCA A;  1VR9 A;  4CYE A;  3OLM D;  1BML C;  1GNU A;  3KVF B;  1TT5 B;  4NPN A;  3RNG C;  4TKN A;  4GMV A;  5BO4 B;  3ZDT A;  2DNF A;  2J53 A;  3GS2 A;  1F77 A;  1L0Y B;  3AE2 B;  1ZDV A;  1VZ8 A;  3C0R B;  4BKS A;  1WXA A;  1KRH A;  2BB5 A;  1MI0 A;  2PW9 A;  1L4Z B;  2WXM A;  2WXG A;  2GBM A;  2QJL A;  1ZKH A;  4C4V A;  5C3J B;  4MGY E;  1OTR B;  3IAS 1;  3NY5 A;  1WX7 A;  5FR6 A;  1E8X A;  2KVZ A;  2LRU A;  4PYZ A;  3TEX A;  2L00 B;  3IBE A;  3B0A A;  3UI3 A;  3ZNI D;  4NAM A;  3RPF C;  4H2A A;  2IY0 B;  2BGF A;  2DX5 B;  4B9K A;  2OJR A;  3N32 A;  3QJZ A;  1UEL A;  3N3K B;  5CHV C;  3ENE A;  2N9L A;  2RDG A;  1OQQ A;  2LWP A;  2W55 A;  3AE4 B;  1KH0 A;  3V6C B;  4JGH B;  2WS3 B;  2HDE A;  4IM2 A;  3NZ3 A;  2BYV E;  4M0W B;  1YX6 B;  4WJQ A;  5TR5 A;  1R4N B;  2C60 A;  3A9K B;  1E7U A;  4ZHP A;  1Q5W B;  4BBN C;  1JWU D;  4LNI A;  4YTP B;  1I7H A;  2Y5C A;  3R66 C;  4JIO U;  1MHH E;  3ZNZ B;  2JSV X;  1D5M C;  2SEB D;  3P42 A;  2W3R A;  3BVG A;  4K3C A;  1SBB B;  3HIZ A;  1FMA D;  2CHZ A;  4TSS A;  5JHB A;  3A4S C;  2LRW A;  1WM2 A;  3SR6 A;  4HPL B;  2INN E;  2KDI A;  4XDC A;  3MC8 A;  4K7U A;  2ZW1 A;  3IFW B;  3N1Y C;  2KFJ A;  4HLE A;  1UD7 A;  3DOW A;  3OJ4 B;  1GC6 A;  3VTV A;  2L0T A;  4TUU A;  1QOG A;  2HTM E;  4D2K A;  4IDI A;  2REX A;  2RMM A;  5IP4 D;  1N6Z A;  2DZI A;  3JSV A;  2FIF A;  5TSS A;  1OQR A;  3V62 A;  1TBE A;  3L08 A;  3Q3N C;  3PRP B;  4NQL B;  1VJK A;  1FCL A;  2FCQ A;  1WFY A;  2KMM A;  3BYT B;  2QCZ A;  4FAD A;  3O13 A;  1D3Z A;  1UNS A;  2B3A A;  3E56 A;  2FUG 1;  1UWX A;  2RSU A;  4BZA A;  2LXA A;  3Q3O C;  1E90 A;  3MHZ A;  3NVY A;  2NCN A;  1Q10 A;  4A90 A;  2HTH A;  1C77 A;  4KZ0 A;  4ANW A;  4Q2J A;  4GIV A;  1P0R A;  3PRM B;  1IYF A;  3V3X A;  4C7Y A;  4IKG A;  3PTF C;  2KAJ A;  5JHA A;  2Z59 B;  3A1Q B;  1J7C A;  2WU2 B;  2C9W B; 
#chains in the Genus database with same CATH homology
 4KSK C;  4ZRJ A;  4OVU A;  4CO7 A;  4MDK E;  3AXC A;  3HM6 X;  4I6N B;  4TQ0 A;  2Z0D B;  3H7S A;  3ML9 A;  2KFK A;  4G50 A;  5G55 A;  3W1S C;  4NJ6 A;  2DYO A;  5D6J B;  2ZZP B;  1R4N I;  2M1M A;  3NOB A;  2ZVN A;  2I1K A;  3T9L A;  1PQS A;  2FCM A;  2IYD B;  3R3M A;  1ZGU B;  4KIK B;  2RGF A;  4IUM B;  3DPD A;  3QX1 A;  2IO1 B;  2JRH A;  3H7P A;  3RUI B;  4BOS C;  4W9I A;  2L3Z A;  2KZR A;  4ANX A;  4ANV A;  1P98 A;  4B95 A;  4GOC A;  5D94 A;  2Z0E B;  1V86 A;  2N1W A;  1WI0 A;  1WGG A;  3KH0 A;  3SD5 A;  4DHZ E;  1CMX B;  1WXV A;  1QZE A;  2FAZ A;  4ZDV A;  4AJY B;  4GN1 A;  2JRI B;  3RD2 A;  2O2V A;  3EFU A;  3UIN B;  2C7M B;  2IBI B;  3AU5 A;  1WYW B;  1WJN A;  2W9N A;  3VH3 B;  1ISN A;  4GB9 A;  1V5O A;  3GZN I;  3PS6 A;  3LDZ E;  4FJV B;  4ASW C;  1OEY A;  1SGH A;  1WR6 E;  4WWP A;  2O6V B;  2D3G A;  1P3Q U;  1WY8 A;  3ZDM C;  3UF8 A;  1FXT B;  2KMA A;  4MJS A;  3H6N A;  2K1F A;  3CMM B;  4I6P A;  4KDI C;  4NY0 A;  2K25 A;  4NJ7 A;  1VD2 A;  2IY1 B;  2L05 A;  2J7Q B;  2GOW A;  2LGX A;  1UZX B;  5D7G A;  4RM8 A;  4WWN A;  4X57 B;  4GDK A;  1P1A A;  2GBJ A;  4FHJ A;  4MGZ E;  2R2O A;  2DEN B;  2RD0 A;  5DPR A;  4IM0 A;  5C1Z A;  3H7P B;  3CSF A;  2XEW A;  3VFK A;  1V6E A;  2AEH A;  2KDB A;  2PEA A;  4EEW A;  3RZW C;  4E3C A;  4WWO A;  5EDS A;  2EMT A;  3VUW A;  4NNJ B;  5G2N A;  3WAO A;  4IW0 A;  3ZKJ C;  1V81 A;  3OAW A;  2XBB C;  4MM3 A;  2LD9 A;  4BOZ B;  4FJY A;  2HJ8 A;  2KO3 A;  4PS8 A;  2N7D A;  3WAN A;  4J6I A;  3ZVV A;  5CHF A;  2LUE A;  1UBQ A;  4LDT D;  4P7I A;  1E7V A;  3PLU A;  2PE9 A;  5CTR C;  2O2V B;  2CHW A;  3DVN V;  2KJH B;  1WRD B;  4DDG D;  3AI5 A;  1WJU A;  4MGI E;  3T8M A;  3A1Q A;  2GBR A;  2RPQ A;  1WGR A;  2NVU I;  3N30 A;  4II2 B;  5E6O A;  2RR9 A;  3PHX B;  4WJN A;  4G11 A;  2BWE S;  2MBB B;  2LVQ A;  3L10 B;  4IWQ A;  4DHJ B;  1BT0 A;  1WGY A;  1YX5 B;  1E5W A;  4HPM B;  3SDL C;  2LGD A;  5L95 C;  4MJS B;  3QA8 A;  4W9K A;  2N4F A;  1WMH A;  2ZPY A;  3PRZ A;  1Q1O A;  3K9P B;  4KIK A;  2CKH B;  1IP9 A;  2ZEQ A;  1WF9 A;  4W9J A;  2MWS B;  2KWC A;  2ZCC A;  2FNJ B;  4FHK A;  3V61 A;  3HHM A;  5JH5 C;  4GDK B;  1WX9 A;  3TJP A;  2MRP A;  3ZW3 A;  2LZ6 A;  1RRB A;  4GGQ A;  4EKU A;  5J2R A;  2V4L A;  2FUH B;  3DVG X;  5JZE B;  3DBS A;  3VAW A;  3ZRC A;  2KDF B;  2GBK A;  3DBR I;  4PYU A;  2MBH A;  2IO3 B;  2K8H A;  1EF1 A;  4AUQ C;  2L8J A;  1GC7 A;  5DPT A;  3EEC A;  1SE9 A;  1YD8 U;  3NZS A;  5GMV A;  1WJ4 A;  2JPH A;  2I1J A;  3TBL D;  4F7Z A;  3VTU A;  2KLC A;  4IWP A;  4ZYN A;  1Z2M A;  4E71 A;  1L2N A;  3A33 B;  4W9H A;  5DPW A;  3DVG Y;  1UH6 A;  3PVL A;  2KTF A;  4F1S A;  1WE6 A;  3TL5 A;  2KWU B;  2M8S A;  2O6V A;  3KUC B;  4K81 A;  4OVV A;  3SHQ A;  2KWV B;  3V6E B;  4BKG A;  3APC A;  5LXH A;  3JW0 X;  4NAW B;  2MX2 A;  2ZPN A;  3TMP B;  2GMI C;  3KYD D;  1EO6 A;  1V2Y A;  3MHS D;  3WA0 A;  1OEY J;  2DYB A;  2LXC A;  1AAR A;  1JRU A;  2BWF A;  2MCN B;  4DHJ D;  2DAJ A;  1WMH B;  4IG7 B;  2KKC A;  1E8Y A;  3ALB A;  1WZ3 A;  4GU2 A;  2BPS A;  4MH0 E;  3ZLZ A;  2N9P C;  4W9E A;  1S1Q B;  3VDZ A;  2WWZ A;  2UWQ A;  2L0F A;  1U4A A;  2KC2 A;  4WAA A;  2KJR A;  4XC2 A;  3QWZ B;  4GDL A;  2MP2 A;  2EMS A;  4HWI B;  2JXX A;  3QIJ A;  2KVR A;  1V9J A;  4FA6 A;  2QHO A;  3PRE A;  2CS4 A;  4GXB A;  1EUV B;  2KMC A;  1MG8 A;  3ZIM A;  4E74 A;  3X0W A;  4FJZ A;  1C3T A;  4IC7 B;  2JZZ A;  3LJ3 A;  4FUL A;  4WJO A;  4GSW A;  4ANU A;  4K1R B;  3NS8 A;  2LGY A;  3BIN A;  3RCZ A;  2BYE A;  4FLH A;  3UIO B;  1GG3 A;  2XK5 B;  2LVP A;  1V5T A;  1LFD A;  2G4D B;  2L76 A;  1T0Y A;  2A5U A;  5AZG A;  1YQB A;  1E8W A;  4ZRI A;  4CHK A;  1TZ1 A;  2EKE C;  3QQ8 B;  3ECI A;  4G3X B;  1OQY A;  2LJ5 A;  2M4N A;  2G3Q B;  3UGB B;  2Y5B B;  5DCN A;  4K7W A;  3R7Q A;  3PPA A;  1C1Y B;  2DHZ A;  4IM3 A;  1WE7 A;  2BYF A;  2KAN A;  2JUO A;  3D32 A;  3QAQ A;  3PT2 B;  3CST A;  2K8C A;  2KQ7 A;  4A3P A;  1I42 A;  3CF6 E;  4W9C A;  2KK8 A;  4BVU C;  4K7S A;  4LCD E;  4GDL B;  2MP2 B;  3VH4 B;  1R4M I;  3W1S A;  2D07 B;  2KJ6 A;  3ML8 A;  1P9D U;  1WXM A;  1WGH A;  1WH3 A;  2BF8 B;  4W9G A;  3ZTD A;  2ZVO A;  1WIA A;  3RUL A;  4W9D A;  3W1Y A;  1L7Y A;  3S2A A;  2KLG A;  4JL9 A;  1UBI A;  1LM8 B;  2KX0 A;  3HK0 A;  3MJW A;  2N1V A;  1A5R A;  4MSM B;  4IWO A;  3AU4 A;  2DAF A;  4KZC A;  1YJ1 A;  2PPH A;  3HM3 A;  2DZM A;  3EC8 A;  3M95 A;  3O65 B;  4NAW A;  2LVO A;  1RFA A;  2IO0 B;  3WAM A;  2WX0 A;  2LI5 A;  2J0J A;  3APD A;  3VHT C;  4FN2 A;  2C7H A;  2MSE D;  1RAX A;  1NDD A;  1LQB A;  5E6P A;  3R7R A;  4DK5 A;  2O6V D;  4TQ1 A;  1WR1 A;  2JWZ A;  1TGZ B;  5AZF A;  3DVN U;  3H1U A;  5LXI B;  2CHX A;  4HDQ A;  2NPT B;  2AYO B;  2ZNV C;  4RM9 A;  2KDE B;  3QCA A;  4DDI D;  3VUX A;  2ZCB A;  2AWT A;  3L54 A;  2JY6 A;  4BFR A;  4CYE A;  2KTR A;  3OLM D;  1GNU A;  1M94 A;  3KVF B;  2C7N B;  2KX3 A;  1I35 A;  1HE8 A;  4NPN A;  3KYC D;  4TKN A;  4GMV A;  3DBH I;  3L16 A;  5BO4 B;  3ZO5 B;  3ZDT A;  2DZJ A;  1YIW A;  3KUZ A;  4I6L B;  4BBN F;  3EHV A;  1XT9 B;  1WM3 A;  2K39 A;  2K6Q A;  2G45 B;  3C0R B;  3M3J A;  4BKS A;  1WXA A;  3TCA A;  3PSE B;  2YVC A;  3ZTC A;  1H4R A;  2GBM A;  2XK5 A;  3OJ3 A;  1ZKH A;  3V60 A;  3GOE A;  4M8N A;  4MGY E;  1OTR B;  3DBL I;  2NBV B;  1Z5S B;  3NY5 A;  1K8R B;  1WX7 A;  2CR5 A;  3A9K A;  2D11 A;  2N9E B;  4TV3 A;  3VUY A;  5FR6 A;  1E8X A;  4F8C B;  4LJP B;  2LRU A;  3PGE A;  4PYZ A;  2NBW B;  1KOT A;  2UYZ B;  2DYM A;  2L00 B;  3U8Z A;  3IBE A;  1Q0W B;  3B0A A;  1ZW7 A;  2MLB A;  3QHT A;  1Y8R C;  4M8M A;  1X1M A;  3ZNI D;  1WX8 A;  5AEK B;  3WIM A;  4HJK A;  2IY0 B;  2BGF A;  2GBN A;  3JSV B;  4HDO A;  2DX5 B;  4B9K A;  2OJR A;  4EZK A;  3M62 B;  3N32 A;  3QJZ A;  4W9L A;  5IA7 A;  1UEL A;  2G4S A;  2KTR B;  3N3K B;  5CHV C;  3TIX A;  2OOB B;  3ENE A;  2N7E A;  2DZK A;  4AJW A;  3K9O B;  3A4R A;  4ZRK A;  4DBG A;  4G0N B;  4HK2 A;  2K6D B;  4B6W A;  3AUL A;  2LWP A;  4BKT A;  1EF5 A;  5D2M B;  2IO2 B;  3V6C B;  1XQQ A;  4JGH B;  1WJ6 A;  4DXA B;  4EFO A;  3KW5 B;  4MSQ B;  4IM2 A;  4AOF A;  2YLM A;  2KD0 A;  4KVG B;  2D10 A;  3RZF A;  3SU8 X;  2BYV E;  4M0W B;  1YX6 B;  3A9J B;  3UQA A;  4WJQ A;  3RT3 B;  2KQS A;  5L83 A;  5TR5 A;  3B08 A;  1G6J A;  2BKF A;  1GJZ A;  4N9F 4;  3VXW A;  2C60 A;  3A9K B;  3ONS A;  1E7U A;  1WXS A;  4LDT B;  3ZRF A;  4WQO B;  4AP4 C;  4EOY A;  5IAA C;  4PS3 A;  1Q5W B;  2AL3 A;  4BBN C;  3APF A;  3ZNG C;  2NPT A;  3QC8 B;  2FCN A;  4HCN B;  4XZ4 A;  2WDT B;  3R66 C;  4JIO U;  2IZV B;  4ICU A;  4XX5 A;  2K8B A;  4KDL B;  3ZNZ B;  1KM7 A;  2HD5 B;  3IHP C;  2WYQ A;  3L13 A;  4EZL A;  5J17 A;  3QK0 A;  1SIF A;  3DQV A;  3L0W B;  3QAR A;  3JYU A;  1OGW A;  3PZD A;  3HIZ A;  3RYT A;  2R2Q A;  3UQB A;  3U30 A;  1NBF C;  2CHZ A;  4KSL C;  5JHB A;  3A4S C;  2KFK B;  1E8Z A;  1WM2 A;  2LRW A;  2LAS A;  3VVW B;  4HPL B;  1J0G A;  3I3T B;  2WX1 A;  3JVZ X;  5CX3 A;  3Q3F A;  2KDI A;  3NZU A;  2CU1 A;  2ZNV B;  4K7U A;  2KN5 A;  3IFW B;  5CHW A;  2KFJ A;  4HLE A;  4A3O A;  3KUD B;  1UD7 A;  2JF5 A;  4II3 B;  1LXD A;  2ASQ A;  3DDC B;  3DOW A;  3OJ4 B;  1GC6 A;  3VTV A;  1IPG A;  4LJO B;  4BKS D;  2PJH A;  5LLI A;  3VTW A;  2ZJD A;  2L0T A;  4TUU A;  3IVF A;  5KHO A;  3H9D A;  2A4Z A;  3L17 A;  2M0X A;  1H8C A;  4NQK E;  2JT4 B;  2REX A;  4EUT A;  2DZI A;  2NS5 A;  3VQI A;  4HXD A;  3B1L X;  3JSV A;  2L7R A;  2FIF A;  5AZH A;  1NI2 A;  3V62 A;  1WGD A;  4KV2 A;  4YL8 A;  1TBE A;  1V49 A;  3L08 A;  4DWF A;  5HKH A;  4HCP B;  4MEM A;  3UIP B;  4AWJ A;  3PRP B;  2MBO A;  2MW5 A;  4NQL B;  5C23 A;  3P2B A;  2AL6 A;  1J19 A;  3Q3J A;  2PE6 B;  2FCQ A;  4ICV A;  1WFY A;  3PLV A;  4MEL A;  2V3S A;  2MBE A;  3DCG A;  2KOX A;  2HE7 A;  2C5L C;  2V1Y A;  1VCB A;  2M17 A;  3M63 B;  4FAD A;  4JLC A;  2JVC A;  2KC1 A;  4DHZ B;  1D3Z A;  1F9J A;  2KNB A;  2B3A A;  2J0M A;  2MBQ A;  4W9F A;  1KJT A;  3X23 A;  4A20 A;  3A9J A;  3MTN B;  3U7D A;  3IG3 A;  1V80 A;  5KHQ A;  2RSU A;  3ZUN A;  5J18 A;  2LXA A;  2FCS A;  4HVB A;  1XD3 B;  2KHW B;  1E90 A;  2VRR B;  3NHE B;  2NBU A;  3WAL A;  3PV1 A;  1S3S G;  2D2Q A;  1GUA B;  2NCN A;  1J8C A;  4URK A;  1KLV A;  5DPS A;  2NR2 A;  2HTH A;  3BY4 B;  4EZJ A;  2N9X A;  4KZ0 A;  2MA9 B;  4WJP A;  1RLF A;  2BKR B;  4FBJ B;  1TTN A;  4ANW A;  4GIV A;  1P0R A;  3PRM B;  2MQJ A;  4JQW C;  4MGK E;  4PS7 A;  1IYF A;  4RMA A;  2J0K A;  3PTF C;  3WAP A;  1WZ0 A;  5E6N A;  5JHA A;  3PHW B;  2Z59 B;  2JZ3 B;  2KXJ A;  3A1Q B;  1UGM A;  2C9W B;  2FID A;  3ZNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...