4GDKA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
b'KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdkA00
2IY1B 1MG8A 3R7RA 3PHWB 3QA8A 3WIMA 4BKGA 2M17A 3SD5A 1K8RB 2QHOA 1NBFC 3R66C 3RULA 2N4FA 2Y5BB 4FHKA 3NY5A 3HHMA 2CKHB 2G3QB 1IPGA 2KLGA 2ZVOA 3A1QB 4BBNC 2K8CA 3M62B 1HE8A 1WMHA 1C1YB 2KWUB 1LFDA 1E7VA 1OTRB 1WE6A 1Z2MA 4FJZA 4LJPB 4B6WA 5J17A 2DYOA 4IW0A 1S3SG 4AJYB 2PPHA 2K39A 4HDQA 3U7DA 4W9JA 2KMCA 3ZDMC 1WYWB 3APCA 2KWCA 3RZWC 2ZCCA 2AWTA 4A20A 2JPHA 5FR6A 2CR5A 3SU8X 2RPQA 4BKTA 4MSMB 4BVUC 3SHQA 2D07B 5D94A 2DENB 1WM2A 5LXHA 1Q5WB 1JRUA 5E6OA 2DHZA 1V2YA 2KJRA 3Q3JA 4FLHA 2MQJA 4WAAA 2LD9A 2KN5A 5DPTA 3V6EB 2B3AA 3V62A 4HPMB 4FA6A 1KLVA 2PEAA 1LXDA 4CYEA 1H8CA 4IUMB 4IM2A 4FULA 4PS7A 4KIKA 2Z0DB 4WWPA 2KVRA 3K9OB 1R4NI 3KUDB 2JZZA 3ZVVA 1GC6A 2WDTB 3VH4B 2LASA 4AP4C 4W9FA 4E74A 1EF1A 2DZMA 3HM3A 4MGYE 2DZKA 3ZLZA 2K25A 3ONSA 3CSFA 2FNJB 3KUZA 3UQBA 1LQBA 2BWFA 2CHZA 2LRWA 4G3XB 4TUUA 2KTRB 4EZJA 2C5LC 4JQWC 3A33B 3GZNI 1WGGA 2GBRA 2KX3A 5EDSA 5JZEB 1WI0A 3JVZX 1AARA 1P3QU 3ZNZB 2IZVB 3TBLD 2KQ7A 1P9DU 1XT9B 3X23A 4W9GA 2IO2B 2YLMA 2CS4A 2NBWB 1EF5A 2N1WA 1A5RA 2GBMA 4MSQB 2EMTA 4GMVA 4W9CA 3UF8A 5CHFA 3L10B 3T8MA 2XK5A 2GBKA 4MH0E 3ZRCA 4BBNF 1G6JA 1UH6A 4E71A 1GG3A 3PZDA 2RSUA 1TZ1A 1RFAA 4YL8A 5BO4B 1UBIA 1P0RA 4HK2A 2MSED 3VAWA 2M4NA 4IM3A 1QZEA 1SGHA 3PS6A 2BWES 2FCNA 2C7HA 2ZNVC 4K7UA 5CHWA 4GXBA 4F1SA 2BKRB 5D7GA 4I6LB 2BKFA 1V5OA 1WXMA 4MJSB 3W1YA 5KHQA 3KW5B 2KHWB 4RM9A 1S1QB 3H7PA 5AZFA 4AJWA 2KTFA 4BKSD 1P98A 5C23A 2CU1A 3VUYA 3DBHI 2HTHA 1WF9A 2JWZA 1NDDA 2C60A 4KDIC 4A3OA 2ASQA 3DQVA 3P2BA 3V60A 4I6PA 2ZCBA 4TQ1A 3QJZA 4X57B 3VDZA 2ZPYA 3AU5A 4ASWC 4GDKA 2N9PC 2KFKA 2LXAA 2L0TA 3ZNGC 4EEWA 3EECA 1WXSA 3JSVA 5E6NA 5GMVA 5CTRC 2KD0A 4DDID 4DBGA 2GMIC 2A4ZA 3QAQA 3ZTCA 1OEYA 2LGDA 1UGMA 1E8YA 4TKNA 3QWZB 3PTFC 2WX0A 3QK0A 2O6VB 1U4AA 5G55A 2WWZA 3KYDD 1F9JA 4J6IA 2JF5A 2RR9A 1TTNA 4EZKA 3MHSD 2J0MA 2MA9B 1KOTA 4K7WA 2O6VD 1V81A 2J0KA 3KYCD 4NJ7A 2MW5A 2LVQA 2M1MA 5AEKB 4GB9A 2DYBA 1SE9A 4FJYA 4M8MA 3RT3B 3M63B 3VHTC 3QHTA 3ZTDA 4EUTA 2AYOB 1M94A 3ML9A 4W9HA 3A9JB 2JRIB 3A1QA 1WFYA 2L05A 2FAZA 5CX3A 3W1SA 4W9IA 5L83A 2V4LA 4GDLB 4ANVA 2L7RA 2C7NB 4LDTB 2KKCA 3QX1A 4NAWB 4PS8A 2AEHA 5TR5A 3ML8A 3DVGX 3JYUA 4I6NB 5JHAA 3A4RA 5IAAC 4F7ZA 3H9DA 2G4SA 1WXAA 1YD8U 3EC8A 2L3ZA 3ZIMA 3TL5A 4DDGD 2JUOA 2L8JA 3CSTA 1UBQA 4LDTD 3APDA 3DCGA 3WAPA 1WRDB 2JXXA 2LVPA 4W9LA 2DX5B 4KDLB 2OJRA 2LI5A 4G11A 4RMAA 3O65B 4WWOA 1WJUA 4ANXA 3M95A 3OAWA 1WX8A 3B08A 1FXTB 5AZGA 4HXDA 2LVOA 1ZKHA 2K6QA 3PREA 4K7SA 1WJ4A 2ZNVB 1V80A 4EOYA 4WWNA 4TQ0A 3R3MA 3ZNHB 4FHJA 1VD2A 2MBHA 4MDKE 3VQIA 5IA7A 4HCNB 2N9XA 4MGIE 4ANUA 3H6NA 2ZZPB 2G45B 3QQ8B 2BPSA 2V1YA 2J0JA 4KVGB 2V3SA 2K1FA 2D3GA 4GSWA 2O2VB 3APFA 4KSLC 1V86A 2DZJA 3AULA 1SIFA 3DVNV 2N1VA 3N30A 2KTRA 1OEYJ 4NPNA 2ZEQA 4G50A 1WH3A 4IC7B 3DPDA 4JIOU 1WR1A 3ENEA 5DPRA 1PQSA 1WJNA 2R2QA 3DBRI 1WGRA 2LWPA 4NY0A 3PT2B 4MGZE 3T9LA 2KO3A 3PLUA 2J7QB 2KQSA 2PE9A 4IG7B 4EKUA 1TGZB 2LXCA 3ECIA 2WX1A 2C9WB 1L2NA 3NZUA 2UWQA 3U8ZA 1IYFA 3X0WA 2MP2B 2NPTB 4NQLB 2KX0A 3DOWA 3IBEA 1ISNA 2ZJDA 2HD5B 2RD0A 3NOBA 3L0WB 4NQKE 3IHPC 3L13A 4KZCA 5JH5C 2MBEA 3V61A 4BKSA 2NVUI 3A9KB 2KDEB 4MM3A 2MBQA 4II2B 4WJPA 4ANWA 2D10A 4IWOA 4KZ0A 2DZIA 2KDFB 1J8CA 1WXVA 4MJSA 2IO1B 1RAXA 3S2AA 3I3TB 2W9NA 2MCNB 4B95A 4DHJB 2HE7A 4DWFA 2KFJA 3PRZA 2K8BA 5DPWA 3Q3FA 3LJ3A 3TCAA 2MWSB 4N9F4 4WJQA 4GU2A 4WJOA 3TMPB 3TJPA 4F8CB 2CHWA 4OVVA 2N9EB 3RUIB 4GOCA 2RGFA 3PRPB 4XC2A 3EHVA 4DHJD 2NS5A 4ICUA 5E6PA 3CF6E 1Q0WB 2MRPA 3UIOB 4HVBA 4DK5A 2LUEA 4HJKA 1UZXB 3PRMB 4K81A 1YQBA 3HM6X 5D6JB 4AOFA 4DHZE 1Y8RC 3PHXB 3OJ4B 5LXIB 2O6VA 3WA0A 2NR2A 3L16A 1RRBA 2L0FA 3B1LX 2FIFA 3H1UA 4ZRJA 4ZYNA 5C1ZA 3K9PB 4M8NA 3RD2A 1C3TA 2IYDB 2KZRA 2MBOA 3VFKA 2K8HA 4BFRA 4WJNA 3ZUNA 3GOEA 3PVLA 1EO6A 3HIZA 1E5WA 2C7MB 2BYVE 3L08A 4GGQA 2Z59B 3WAMA 1I35A 3UIPB 5L95C 2JT4B 3IG3A 3A9JA 3BINA 1H4RA 1E90A 2PJHA 1WGYA 5LLIA 2A5UA 2KXJA 2BYEA 4GDLA 2JVCA 4W9DA 4HDOA 4IWPA 2YVCA 4JGHB 4NAWA 1OQYA 2KOXA 3NZSA 1GUAB 4XX5A 4BOZB 2ZVNA 2ZPNA 3QCAA 1WMHB 1YJ1A 3CMMB 1YX5B 2KDBA 2FCMA 3DDCB 3DBSA 1V6EA 1WX7A 2KNBA 1WR6E 1UD7A 5CHVC 3VTVA 1V5TA 4CHKA 1D3ZA 2LRUA 2VRRB 3R7QA 3VUWA 1I42A 2DAJA 2OOBB 3QIJA 1E7UA 5DPSA 1VCBA 1P1AA 4KSKC 4LJOB 3WALA 1V9JA 2M0XA 3QC8B 5D2MB 3VH3B 3UQAA 1OGWA 2HJ8A 2K6DB 3EFUA 2KWVB 1T0YA 2NBUA 3RZFA 1Z5SB 2NCNA 1LM8B 1WGDA 2FUHB 2IO3B 4FN2A 4W9KA 2NBVB 4GN1A 1WM3A 3MJWA 2M8SA 3H7SA 2R2OA 2D11A 2DYMA 3UGBB 1WZ0A 5AZHA 3MTNB 3DVNU 4BOSC 3IVFA 2KANA 2I1JA 3JW0X 4KIKB 2GBJA 2KJ6A 2LJ5A 1YX6B 3N3KB 2GBNA 2AL6A 2PE6B 3LDZE 4P7IA 3VUXA 1EUVB 2KDIA 4TV3A 2O2VA 2BF8B 1X1MA 3PGEA 2XBBC 4HWIB 4PYUA 3B0AA 2XEWA 4ZRIA 2D2QA 4JLCA 1ZW7A 4FBJB 4NJ6A 2N7DA 4PYZA 4ZRKA 4W9EA 4HLEA 2L76A 3BY4B 3W1SC 5JHBA 4CO7A 4HPLB 3VTUA 2AL3A 5HKHA 5J18A 4DXAB 2EMSA 1XD3B 2L00B 3PPAA 4HCPB 2BYFA 3N32A 3L17A 1J19A 2KC1A 2MLBA 1GNUA 3AXCA 1KM7A 3PLVA 4RM8A 2N7EA 2DAFA 3KUCB 1WZ3A 3KH0A 2LGYA 3ZRFA 1UELA 2EKEC 3M3JA 3WAOA 5DCNA 3RYTA 1E8XA 1WX9A 2JZ3B 4ZDVA 2MP2A 2NPTA 4II3B 4DHZB 4GIVA 3A4SC 1GC7A 2REXA 3OLMD 1Q1OA 4JL9A 4XZ4A 2JY6A 1WY8A 2XK5B 3RCZA 4FADA 3ZKJC 2G4DB 3V6CB 2IY0B 1XQQA 2LGXA 3AI5A 3VTWA 4B9KA 3A9KA 1E8WA 3VXWA 1RLFA 4AUQC 4ICVA 2KLCA 3NS8A 3ALBA 1J0GA 3ZW3A 1GJZA 3IFWB 4EFOA 3U30A 3L54A 1NI2A 3WANA 1V49A 1E8ZA 2GOWA 4EZLA 2FCSA 2KC2A 4MELA 4FJVB 3H7PB 2MBBB 2CHXA 1TBEA 1ZGUB 3PSEB 4LCDE 4OVUA 4URKA 1WJ6A 3OJ3A 2IBIB 4K1RB 3D32A 1CMXB 4MGKE 2FCQA 3SDLC 3ZO5B 2FIDA 2UYZB 2I1KA 4AWJA 4E3CA 2MX2A 3QARA 2KJHB 4GDKB 2KFKB 1WIAA 1BT0A 1WGHA 5G2NA 2JRHA 3ZDTA 1R4MI 2LZ6A 4PS3A 3JSVB 3TIXA 2IO0B 3KVFB 3NHEB 1KJTA 3DVGY 1YIWA 3HK0A 4G0NB 2KMAA 1L7YA 3PV1A 4NNJB 4A3PA 3UINB 3ZNID 3AU4A 2WYQA 5KHOA 4MEMA 2BGFA 3DBLI 1IP9A 1WE7A 2KK8A 4IM0A 3VVWB 4KV2A 2Z0EB 4IWQA 5J2RA 3C0RB 4M0WB 4WQOB
chains in the Genus database with same CATH superfamily
1N5XA 3PHWB 1JCKB 2M17A 3SD5A 2QIEB 1K8RB 3C19A 2Y5BB 3BVMA 4A9AA 4BBNC 2WGSA 2EKIA 4P6VF 3M62B 5LNK1 2MH7A 1C1YB 1JRPA 1LFDA 2KWUB 4DXFA 1FFUA 1Z2MA 4LJPB 1XLNA 2MEKA 1SBBB 2DYOA 2K39A 3AN1A 4HDQA 2KMCA 2KWCA 1TS2A 3B9JA 1XF5L 3ZJUA 3SU8X 3SHQA 1HTOA 5D94A 1P7EA 5EE3A 1FIQA 5LXHA 1TJEA 4M00A 2LD9A 4D2KA 1KLVA 2B3AA 4HPMB 2NTTA 1LXDA 4CYEA 4IUMB 4PS7A 2Z0DB 2KVRA 1VR9A 2H89B 3RMKC 1GC6A 1AYFA 4RGNA 5BYSA 3VH4B 4W9FA 4E74A 2DZMA 3ZLZA 3ONSA 3I57A 3KUZA 3IT4B 1YQ4B 1C76A 2LRWA 4J3OD 2KTRB 1ZXIA 1QOGA 2J53A 2Z8LA 3P4PB 1FNVA 1N5WA 1WI0A 3I63C 2QSDA 1P3QU 4XDDA 2IZVB 3X23A 2YLMA 2K3UA 2NBWB 1OQQA 1TKGA 3T8MA 2GBKA 1JROA 4MH0E 3ZRCA 4BBNF 4E71A 5BO4B 1SE3A 2MSED 4ZYSA 3PS6A 2BWES 3GB1A 2FCNA 3Q8BA 3ZYYX 3IAM1 2DNFA 4I6LB 4C4VB 3DBLB 3BWUD 3Q2AC 2N9LA 1I4GA 2VH2A 4KDIC 1L6VA 5BYRA 3QJZA 3VDZA 2ZPYA 2LXAA 3ZNGC 4EEWA 3TEZA 1JWUD 5E6NA 4DDID 1V8CA 2VH1A 1QOBA 4TKNA 2WX0A 1F2RC 1U4AA 4YSXB 1F9JA 4EZKA 2JSVX 1KOTA 2J0KA 1K50A 4XWTA 3M63B 3ZTDA 1SEBD 2AYOB 3A9JB 1DOYA 3W1SA 1FCCC 1NENB 3W2DA 4ANVA 3DVGX 5IAAC 3EC8A 3TL5A 2JUOA 3B2GA 3NUHB 3APDA 3WAPA 3GZNB 3FC4A 2DX5B 2OJRA 4G11A 1YN5A 3GE8C 2JXTA 2MJ3A 1V80A 1DOIA 4K3CA 4HCNB 4MGIE 3ZQ4A 4CQNA 4KVGB 3APFA 2N1VA 1C79A 3LB8C 1I4RA 2KTRA 1OEYJ 2ZEQA 3O13A 4A6QA 2FE8A 2R2QA 1MI0A 3PLUA 2WXOA 2KQSA 4IG7B 2C9WB 3NVVA 1L2NA 2IGDA 2JZPA 1IYFA 1JQ4A 3FAHA 3X0WA 2AQ1B 4HRSA 4NQLB 2KX0A 2LJIA 4ZHPA 1JWAD 3IBEA 4NQKE 2WDQB 1NYRA 3V61A 2NVUI 1SB3C 4IWOA 2DZIA 2KDFB 4C4VA 1WXVA 1RAXA 3W5VB 2IDYA 3S2AA 2XNAC 2W9NA 3LXFA 4KGRA 3TCAA 4GU2A 3TJPA 4F8CB 2QEJC 4OVVA 1F2RI 4JX1C 2NS5A 5T8IA 3U52E 2MRPA 4TMAB 2QILA 2LUEA 5IKCM 2DWQA 1YQBA 2WXRA 2NR2A 2Y5CA 3B1LX 3H1UA 2INNE 4M8NA 5G5GA 5BYQA 5JXVA 2GLSA 1I4QA 3P4RB 3UI3A 3VFKA 3PVLA 2L1AA 1E10A 1EO6A 1D4BA 2KWDA 4BAXA 2W55A 2QDFA 3ETRA 3A9JA 3BINA 1H4RA 2PJHA 4LNIA 1QOFA 1WGYA 1DYQA 4RFBA 4W9DA 4HEA1 2WLBA 1C4PA 2YVCA 1TS4A 2KOXA 3NZSA 1GOZA 5BMIA 2K9XA 2ZPNA 1TS3A 3QCAA 2KDBA 3DDCB 2KNBA 4WWMA 1YOVB 1UD7A 5CHVC 1D3ZA 1TZOA 4CHKA 3P4QB 3VUWA 2DAJA 3E9SA 3QIJA 1VCBA 3DBRB 3RI7C 1V9JA 2HJ8A 3EFUA 2KWVB 3SEBA 1F52A 2IPKD 1CZPA 1WGDA 2NBVB 2R61A 3AEFB 2JX5A 1WZ0A 5AZHA 1NVID 4A8XC 3IVFA 2KANA 2M19A 4KIKB 5IOIA 3RNCC 1EUVB 1SE4A 4YTNB 2XBBC 4HWIB 2D2QA 4M01A 1FFVA 5JHBA 1OFFA 2KDMA 4L23A 3Q14C 3N20C 5J18A 2BYFA 2PVGC 3AEGB 3NRZA 3TEYA 3AXCA 3PLVA 4RM8A 2DAFA 1WZ3A 2LGYA 1UELA 2WHIA 2RDHA 3R2IA 4MH8A 3AE6B 2M56B 3OLMD 4FXCA 3HVZA 4JL9A 4FADA 4REZA 1EU3A 2IY0B 1XQQA 3AI5A 2HDEA 3NS8A 4ZRPA 1GJZA 1VDVA 1NI2A 1E8ZA 4EZLA 3PZ8A 4HJGE 4FJVB 2W82A 2E3TA 3AEEB 3OJ3A 2FBWB 4E3CA 4N58A 2OHFA 2QMTA 2WXGA 4RNAA 3SR6A 1TKEA 1XEEA 1KJTA 3DVGY 4G0NB 2KMAA 1L7YA 2WXJA 4NNJB 1EWYC 4A3PA 2H88B 1FM0D 1QOAA 1YJJA 3DBLI 1IP9A 1WE7A 4KV2A 2EELA 2Z0EB 2QHOA 1TS5A 1NBFC 3RULA 3NY5A 3A1QB 1HXYD 3Q69A 1WE6A 4B6WA 3N1YC 4IW0A 4ZOHC 2PPHA 3U7DA 4L2YA 1WYWB 3APCA 2AWTA 1IGDA 2WXPA 4A20A 2CR5A 3FKYA 4BVUC 3AE8B 2DENB 3NG0A 1WM2A 5HI1A 1T0SC 5E6OA 2DHZA 3Q3JA 2LEKA 4ZRQA 2MQJA 5DPTA 3V6EB 2Q5WD 2IJ0A 3V62A 2PEAA 3CIRB 4KIKA 1JWBD 1KF6B 1ZE3D 2WXQA 1FCLA 2LASA 2K25A 2Y3AA 3UQBA 4K3BA 2BWFA 4EZJA 2K5PA 2C5LC 3DHGC 3GZNI 1WGGA 1TIFA 1NEKB 1F77A 5EDSA 2JQRB 3GS2A 2K22A 2I2YA 2IO2B 1V97A 2CS4A 1EF5A 2GBMA 4MSQB 4W9CA 2YEPB 3AE7B 1KRHA 1ZXHA 1R4MB 1DOXA 2RSUA 1TZ1A 1UBIA 1P0RA 3VAWA 1T6BX 2BYTA 1VJKA 3RPFC 2ZNVC 5CHWA 4GXBA 4MJSB 3BIID 3W1YA 4RM9A 2KHWB 4RCOA 5C23A 1RYJA 2WXIA 3VUYA 4JE3B 2C60A 2ASQA 3PZ7A 4TQ1A 5EE0A 4XGAB 1PGAA 2L0TA 1YQ3B 4XE0A 5CTRC 1FNWA 3P4SB 2A4ZA 1DGJA 1OEYA 2LGDA 3QWZB 3QK0A 2O6VB 3RNGC 1M4VA 1I4HA 1YN4A 4LNKA 3PO0A 1RWSA 4J6IA 2RR9A 3MHSD 2J0MA 2BS2B 2O6VD 1V81A 4NJ7A 5AEKB 4LK0M 3HVDA 4C00A 3VHTC 3QHTA 1KFYB 3ML9A 2JRIB 3A1QA 2CJOA 1MHXA 4W9IA 5L83A 2V4LA 4GDLB 2X38A 4DQOC 2C7NB 2KKCA 4PS8A 5TR5A 3JYUA 4I6NB 3H9DA 1FD6A 1JMLA 2G4SA 1WXAA 3ZIMA 4DDGD 2L8JA 4RGMA 4USAA 2RDGA 1N63A 4N59A 4W9LA 4KDLB 2KMMA 4RMAA 4ANXA 3M95A 3OAWA 1WX8A 2W3SA 3B08A 1FXTB 4HXDA 2LVOA 1ZKHA 4K7SA 2IGGA 4HROA 3AH7A 4EOYA 4TQ0A 4YXDB 3R3MA 1L0VB 3VQIA 5IA7A 2N9XA 2V1YA 2V9HA 3P1MA 1HZ6A 2D3GA 4GSWA 2O2VB 3VR9B 4KSLC 1V86A 3N1ZC 2DZJA 3AULA 2V0GA 2SEBD 4WH4A 4IC7B 3ENEA 3MHZA 2MHJA 3DBRI 4NY0A 1HA5A 1YJIA 2KACA 2PE9A 1TGZB 3ECIA 1L4ZB 3LYYA 3NZUA 5FKAC 2UWQA 2V4IB 2DLBA 3DOWA 1ISNA 2HD5B 3L0WB 1WYGA 4KZCA 2MBEA 2LHEA 3ZXVA 4C7ZA 4WJPA 2D10A 2NMQA 3Q8CA 4MJSA 2IO1B 2PMVA 2D3AA 3I3TB 1PUTA 3AEBB 3RNBC 2HE7A 3PRZA 5H92C 2CJNA 4WJQA 1QLBB 1QQRA 4WJOA 3HUIA 3TMPB 1TYGB 2J4XA 2RGFA 1E9MA 4XC2A 1ESFA 1Q0WB 4JWUC 4HJKA 2W54A 1UZXB 3PRMB 2JU6X 3OJ4B 5LXIB 2O6VA 2JWUA 1RRBA 2L0FA 1EM7A 3KLSX 5C1ZA 1K51A 1WSPA 2D3BA 4NJCA 2K8HA 3ZUNA 3GOEA 1E0ZA 3HIZA 1E5WA 2C7MB 2Z59B 2WP9B 1PFDA 3GE3C 2BT6A 4S0RA 1VLBA 2BYEA 1Y56A 4GDLA 3MC9A 4MT5A 2E6XA 1MFWA 2WXHA 4BOZB 1GUAB 1F0ZA 1SF0A 3RNAC 1ZDVA 3CMMB 1YX5B 3VTVA 3NZ3A 3RNEC 1ZUD2 5DPSA 4LJOB 1E6EB 2M0XA 3VRBB 1ZP0B 5C2TB 3UQAA 1XLOA 2G1EA 1Z5SB 4W9KA 2D3CA 4YSYB 2WXKA 3H7SA 2D11A 4R3DA 2DYMA 1D5MC 2PLPA 2I1JA 2W3RA 1ENFA 3N3KB 3ZGZA 3VUXA 4KGTA 4TV3A 2O2VA 2BF8B 1C77A 3B0AA 4ZRIA 4JLCA 3AE1B 4HLEA 4W9EA 3W1SC 2L32A 3NVWA 2EMSA 1JW9D 3U4EG 2MLBA 1GNUA 4IOIE 3M3JA 1CK1A 2D5GA 1R7SA 3RYTA 1YNTE 4GIVA 1FMAD 1Q1OA 2G4DB 1UNSA 2LGXA 1E8WA 4ICVA 2KLCA 1BMLC 3ZW3A 2PKOA 1SJED 3IFWB 4EFOA 4HKQA 3WANA 2N9KA 3NJTA 4Q2JA 1I4PA 2GOWA 2FCSA 3ZJVA 1TBEA 1ZGUB 4LCDE 1WJ6A 4K1RB 2AQ3B 2FCQA 3SDLC 3ZO5B 1ET6A 2MX2A 4GDKB 1WGHA 1UGJA 3AMZA 3RFZB 5G2NA 4MACA 1R4MI 3KVFB 3NHEB 4LNOA 3AE9B 4LLGM 4B0EA 3N9YC 3AU4A 1MVKA 3Q3NC 4O1NA 1SXTA 3AEAB 2KAJA 5J2RA 1HEZE 3C0RB 4WQOB 3WIMA 4HPPA 3MP9A 4BKGA 1Q10A 3R66C 2N4FA 3Q3OC 3HHMA 2CKHB 1IGCA 2ZVOA 3Q8FA 1E7VA 1OTRB 5J17A 3ZDMC 1NI3A 2ZCCA 4RF0A 2JPHA 5FR6A 1KLGD 1XCTL 2RPQA 2D07B 1Q5WB 1JRUA 5IN7A 2KJRA 2WS3B 4FLHA 1XLPA 4EE2A 3I9V1 3ZJTA 1ROEA 4WWPA 5D3DA 1L4DB 2L52A 3K9OB 5BMGA 2ZW1A 3TEXA 3KUDB 2JZZA 3ZVVA 2WDTB 1I7HA 2IGHA 4MGYE 3HM3A 2DZKA 5C3JB 1AWDA 2FNJB 1VZ6A 3CSFA 1LQBA 1UUPA 4G3XB 4TUUA 4JQWC 3A33B 5JZEB 3JVZX 3ZNZB 3TBLD 2KQ7A 3L4PA 4W9GA 2N1WA 4UDUC 2EMTA 3UF8A 3L10B 1V1OA 1G6JA 1UH6A 3PZDA 1RFAA 1WXQA 4BZAA 2J52A 2V3NA 4K7UA 4A55A 2V3PA 2BKRB 5D7GA 1TY2A 1S1QB 2KQ4X 5HFYA 2KTFA 1P98A 5BMHA 1WF9A 2HTHA 4HKZE 4A3OA 3V60A 2ZCBA 3AU5A 4GDKA 2N9PC 2GB1A 1CQVA 3GP7A 2K0PA 1QILA 5GMVA 2BVCA 4JPSA 2HJ1A 3PTFC 5G55A 2WWZA 3KYDD 2Y5PA 2JF5A 1TTNA 3NS1A 1YN3A 4K7WA 1PGBA 2KVZA 4YSZB 2LVQA 2DYBA 4FJYA 4M8MA 4EUTA 1M94A 4YT0B 2LUMA 4W9HA 5HHDG 1WFYA 3AE4B 2FAZA 5CX3A 1R4NB 2L7RA 2OEDA 3BK1A 5JHAA 3Q8AA 4YTMB 3BYYB 1A70A 1C4AA 1FO4A 2L3ZA 2WXFA 1L0YB 2KYWA 1WRDB 2JXXA 2LI5A 4WWOA 3CWIA 1JWMD 1KH0A 3W9CB 2PTLA 3PREA 1WJ4A 5D3IB 2QJLA 3TUOA 3ZNHB 1VD2A 2MBHA 3P42A 4MDKE 2GI9A 2L83A 3QQ8B 2BTEA 5EE9A 3AECB 2J0JA 3H8HA 1SIFA 3DVNV 2BW2A 3N30A 4WQMA 1N61A 4JIOU 1WR1A 1WJNA 2BQQA 2LWPA 3DBHB 3T9LA 4MGZE 2KO3A 2PIAA 2J7QB 4XWWA 2LXCA 4L1BA 2OJWA 2WX1A 1EU4A 2NPTB 4C80A 2RD0A 3BZDB 1STEA 2LMCA 3V05A 3IHPC 3L13A 5JH5C 1JWSD 3A9KB 2ONQA 4II2B 3BYTB 1N62A 3KWLA 4WIPA 1J8CA 1J7AA 5I4DA 1QT9A 4DHJB 4DWFA 3R2TA 5DPWA 3U2SC 3LJ3A 3VRAB 2MWSB 1VZ8A 2N9EB 4OW0A 3EHVA 4DHJD 1EWCA 3SFEB 4ICUA 5E6PA 3J9CA 3UIOB 4DK5A 4K81A 4N6EB 1RM6C 3EGRA 1Y8RC 3PHXB 3R8BA 1T5XD 1KTKA 3L16A 2FIFA 4ZYNA 4ITKA 2KZRA 4BFRA 4WJNA 2BYVE 4LTUA 4GGQA 4OVZA 1I35A 5AUKA 3UIPB 5L95C 4P16A 1WGKA 1ACCA 1E90A 3DWGC 5LLIA 2BS3B 2A5UA 2KXJA 2AQ2B 2JVCA 4HDOA 3BVZA 4JGHB 1OQYA 4IDIA 1WMHB 1YJ1A 2FCMA 1V6EA 3DWMA 4XDCA 1V5TA 3R7QA 2VRRB 1FNUA 3T3NA 1E7UA 4QAYA 4KSKC 1P1AA 3WALA 1OGWA 2K6DB 1T0YA 3RZFA 2NCNA 1LM8B 2IO3B 4GN1A 1OQRA 2M8SA 2R2OA 1FXAA 3EA6A 3DVNU 4BOSC 2HTME 1CJEA 4OZBA 4RH6A 4AS1A 2GBNA 2KDIA 1X1MA 3PGEA 4YWGG 1GAQB 4P1BC 1ZW7A 2WQYB 4NJ6A 2N7DA 4PYZA 4WURA 1JALA 3BY4B 4CO7A 4HPLB 5HKHA 4DXAB 4HCPB 2QCZA 2RMMA 3IXSA 2KC1A 3IAS1 2N7EA 3KUCB 3ZRFA 3KH0A 2EKEC 1E8XA 1WX9A 4ZDVA 2NPTA 4II3B 2LGIA 4KGSA 3RCZA 2JY6A 1WY8A 2XK5B 3ZXRA 3V6CB 5IP4D 1IBXB 3VTWA 4B9KA 2NTSA 3A9KA 1L5PA 3ALBA 1AN8A 3L54A 2LFIA 1MJDA 3H7PB 1K53A 2CHXA 3DHHC 1FRRA 5HG2A 1CMXB 4LNNA 2G9HD 2FIDA 2UYZB 2I1KA 1XXGA 1FEHA 4KX6B 2WXMA 2KFKB 1BT0A 2WNMA 4PS3A 3JSVB 5IO9A 4RGOS 2GRIA 1YIWA 2KN4A 1XO3A 4AQ7A 3ZNID 2RPVA 2WYQA 4IM0A 2DBYA 4M0WB 2IY1B 1MG8A 3R7RA 3QA8A 1I4XA 3I5JC 1SJHD 4FHKA 2UU7A 2B76B 3BK2A 2INCC 2G3QB 1IPGA 2ACZB 2KLGA 2K8CA 3B2FA 1HE8A 1WMHA 4FJZA 1S3SG 4AJYB 4W9JA 3RZWC 1L6UA 2WXLA 3NVYA 4BKTA 4MSMB 2PVOD 4ARCA 3KQ4A 1V2YA 1QF6A 4WAAA 2KN5A 1BUIC 4FA6A 4H2AA 4S17A 1IUEA 1H8CA 4IM2A 4FULA 1V1PB 1RFKA 1R4NI 2WDRB 3DHIC 1MHHE 4IKGA 4AP4C 2YEPF 3TEWA 1EF1A 4DXGA 2WU2B 2CHZA 2WDVB 3U7ZA 1P7FA 3ABVB 2GBRA 2J42A 2KX3A 3OG5A 1AARA 1N60A 1P9DU 1XT9B 1A5RA 3FILB 2JYEA 4GMVA 5CHFA 2FUG1 2XK5A 5G5HA 1GG3A 1IBXA 4YL8A 4HK2A 2M4NA 4IM3A 1QZEA 1SGHA 4MM3B 2C7HA 1XLQA 4F1SA 5TSSA 2BKFA 1V5OA 1WXMA 4GLSC 5KHQA 3KW5B 2I38A 3H7PA 5AZFA 1B9RA 4LNFA 4AJWA 4BKSD 2BBCA 2CU1A 3DBHI 2JWZA 1NDDA 3SFDB 3AE3B 3DQVA 3P2BA 4P1CC 4I6PA 4ZHOA 4X57B 1PGXA 4ASWC 2KFKA 2SAKA 3EECA 1WXSA 3JSVA 1ET9A 2KD0A 4DBGA 2GMIC 1FPYA 5GXGB 3QAQA 3ZTCA 1UGMA 1T3QA 3WCQA 1E8YA 1SIJA 1YMHE 4RF1A 4US8A 1PYWD 1UF0A 1FRDA 1L0XB 3MC8A 2MA9B 4M0WA 2RDBC 1TT5B 3KYCD 2MW5A 1C4CA 2M1MA 4GB9A 1SE9A 3RT3B 2MJDA 1T0RC 1GB1A 2L05A 3AEDB 4US9A 4ACFA 1WRIA 4LDTB 3QX1A 4NAWB 2AEHA 3ML8A 3Q6BA 3A4RA 4F7ZA 2VZKB 3P63A 1YD8U 1ZOYB 2KT7A 3CSTA 3RN9C 1UBQA 4YTPB 4LDTD 3DCGA 3RNFC 1VZ7A 2LVPA 4A90A 2VZKD 3O65B 1KLUD 1WJUA 4RGTA 1UWMA 5AZGA 2K6QA 2ZNVB 1VRAB 3AE2B 4WWNA 1V1PA 4FHJA 4C56C 4ANUA 3H6NA 2ZZPB 2G45B 3AE5B 2BPSA 2V3SA 2K1FA 3MFGA 2PW9A 4NPNA 4G50A 1WH3A 4OHJA 3DPDA 5DPRA 2BB5A 1PQSA 2BB6A 1WGRA 3PT2B 4EKUA 3FILA 3U8ZA 4KKIA 1MPEA 3AV8A 2MP2B 4NAMA 2INPE 1SSNA 2N0SB 2ZJDA 4NZLB 1HTQA 1D6EC 3NOBA 4BKSA 3Q8EA 4MM3A 2KDEB 2MBQA 5EE1A 3V3XA 4ANWA 1LO5D 4KZ0A 1C78A 1J7CA 1B1ZA 2X8XX 3TSSA 1LGRA 3VR8B 2MCNB 4B95A 1TY0A 3EFCA 1D5XC 2KFJA 2K8BA 3Q3FA 1GB4A 4OZCA 4ARIA 1D5ZC 3IT6B 4N9F4 2CHWA 3MJ5A 3RUIB 4GOCA 3PRPB 1J7BA 2ON8A 5AUIA 3AB5A 1MG4A 5FK9C 3CF6E 4HVBA 1K52A 5E6JA 3HM6X 5D6JB 4AOFA 4DHZE 3WA0A 1XCQL 1F1HA 4ZRJA 3K9PB 1HZ5A 3RD2A 1TKYA 1C3TA 2IYDB 2JYTA 2MBOA 1NYQA 3OWEB 4OZAA 3L08A 3WAMA 2JT4B 3IG3A 2TSSA 3N1XC 4IWPA 4NAWA 4XX5A 2ZVNA 3DBSA 1WX7A 1WR6E 1I42A 2LRUA 1SE2A 2OOBB 5H8YE 2AX5A 3QC8B 5D2MB 3VH3B 2NBUA 1ZPSA 2FUHB 4FN2A 1WM3A 3MJWA 1ZDXA 4XYCA 1BXTA 3UGBB 3MTNB 4B0MA 3T3OA 3W5UB 3JW0X 3KWVA 2GBJA 2KJ6A 2LJ5A 1YX6B 1AW7A 2AL6A 2PE6B 3EUB2 3LDZE 4P7IA 4PYUA 2XEWA 4FBJB 1WWTA 4ZRKA 2MJEA 2L76A 2N7JA 1PDXA 2M0AA 3VTUA 2AL3A 1C9FA 1XD3B 2L00B 3PPAA 3N32A 3L17A 1J19A 1KM7A 1UWXA 2QC8A 3WAOA 5DCNA 2JZ3B 2MP2A 4DHZB 4WAFA 3A4SC 1GC7A 2REXA 4TSSA 4XZ4A 5MPOA 3ZKJC 3Q3MC 5FR3A 3VXWA 1RLFA 4AUQC 1HQRD 1J0GA 4KKJA 4PK1A 2ICIA 3U30A 1N6ZA 1E7PB 1V49A 1FXIA 2KC2A 4MELA 3URYA 3BVGA 3NVZA 2MBBB 1T0QC 2XN9C 4C7YA 3PSEB 4URKA 4OVUA 3AM9A 2IBIB 2INDC 3D32A 3MC0B 4MGKE 3C8YA 2ZW0A 2BS4B 4AWJA 2LHDA 3E56A 3QARA 4PT5A 2KJHB 1QKZA 4JWSC 1WIAA 2WU5B 3ZDTA 2JRHA 2LZ6A 3HRDD 4M02A 2IO0B 3TIXA 2CU3A 1GPXA 2WXNA 3HK0A 3PV1A 3UINB 2LGSA 5KHOA 4MEMA 2BGFA 3VVWB 2KK8A 4IWQA
chains in the Genus database with same CATH topology
2IY1B 1MG8A 3R7RA 3PHWB 3QA8A 3WIMA 4BKGA 2M17A 3SD5A 1K8RB 2QHOA 1NBFC 3R66C 3RULA 2N4FA 2Y5BB 4FHKA 3NY5A 3HHMA 2CKHB 2G3QB 1IPGA 2KLGA 2ZVOA 3A1QB 4BBNC 2K8CA 3M62B 1HE8A 1WMHA 1C1YB 2KWUB 1LFDA 1E7VA 1OTRB 1WE6A 1Z2MA 4FJZA 4LJPB 4B6WA 5J17A 2DYOA 4IW0A 1S3SG 4AJYB 2PPHA 2K39A 4HDQA 3U7DA 4W9JA 2KMCA 3ZDMC 1WYWB 3APCA 2KWCA 3RZWC 2ZCCA 2AWTA 4A20A 2JPHA 5FR6A 2CR5A 3SU8X 2RPQA 4BKTA 4MSMB 4BVUC 3SHQA 2D07B 5D94A 2DENB 1WM2A 5LXHA 1Q5WB 1JRUA 5E6OA 2DHZA 1V2YA 2KJRA 3Q3JA 4FLHA 2MQJA 4WAAA 2LD9A 2KN5A 5DPTA 3V6EB 2B3AA 3V62A 4HPMB 4FA6A 1KLVA 2PEAA 1LXDA 4CYEA 1H8CA 4IUMB 4IM2A 4FULA 4PS7A 4KIKA 2Z0DB 4WWPA 2KVRA 3K9OB 1R4NI 3KUDB 2JZZA 3ZVVA 1GC6A 2WDTB 3VH4B 2LASA 4AP4C 4W9FA 4E74A 1EF1A 2DZMA 3HM3A 4MGYE 2DZKA 3ZLZA 2K25A 3ONSA 3CSFA 2FNJB 3KUZA 3UQBA 1LQBA 2BWFA 2CHZA 2LRWA 4G3XB 4TUUA 2KTRB 4EZJA 2C5LC 4JQWC 3A33B 3GZNI 1WGGA 2GBRA 2KX3A 5EDSA 5JZEB 1WI0A 3JVZX 1AARA 1P3QU 3ZNZB 2IZVB 3TBLD 2KQ7A 1P9DU 1XT9B 3X23A 4W9GA 2IO2B 2YLMA 2CS4A 2NBWB 1EF5A 2N1WA 1A5RA 2GBMA 4MSQB 2EMTA 4GMVA 4W9CA 3UF8A 5CHFA 3L10B 3T8MA 2XK5A 2GBKA 4MH0E 3ZRCA 4BBNF 1G6JA 1UH6A 4E71A 1GG3A 3PZDA 2RSUA 1TZ1A 1RFAA 4YL8A 5BO4B 1UBIA 1P0RA 4HK2A 2MSED 3VAWA 2M4NA 4IM3A 1QZEA 1SGHA 3PS6A 2BWES 2FCNA 2C7HA 2ZNVC 4K7UA 5CHWA 4GXBA 4F1SA 2BKRB 5D7GA 4I6LB 2BKFA 1V5OA 1WXMA 4MJSB 3W1YA 5KHQA 3KW5B 2KHWB 4RM9A 1S1QB 3H7PA 5AZFA 4AJWA 2KTFA 4BKSD 1P98A 5C23A 2CU1A 3VUYA 3DBHI 2HTHA 1WF9A 2JWZA 1NDDA 2C60A 4KDIC 4A3OA 2ASQA 3DQVA 3P2BA 3V60A 4I6PA 2ZCBA 4TQ1A 3QJZA 4X57B 3VDZA 2ZPYA 3AU5A 4ASWC 4GDKA 2N9PC 2KFKA 2LXAA 2L0TA 3ZNGC 4EEWA 3EECA 1WXSA 3JSVA 5E6NA 5GMVA 5CTRC 2KD0A 4DDID 4DBGA 2GMIC 2A4ZA 3QAQA 3ZTCA 1OEYA 2LGDA 1UGMA 1E8YA 4TKNA 3QWZB 3PTFC 2WX0A 3QK0A 2O6VB 1U4AA 5G55A 2WWZA 3KYDD 1F9JA 4J6IA 2JF5A 2RR9A 1TTNA 4EZKA 3MHSD 2J0MA 2MA9B 1KOTA 4K7WA 2O6VD 1V81A 2J0KA 3KYCD 4NJ7A 2MW5A 2LVQA 2M1MA 5AEKB 4GB9A 2DYBA 1SE9A 4FJYA 4M8MA 3RT3B 3M63B 3VHTC 3QHTA 3ZTDA 4EUTA 2AYOB 1M94A 3ML9A 4W9HA 3A9JB 2JRIB 3A1QA 1WFYA 2L05A 2FAZA 5CX3A 3W1SA 4W9IA 5L83A 2V4LA 4GDLB 4ANVA 2L7RA 2C7NB 4LDTB 2KKCA 3QX1A 4NAWB 4PS8A 2AEHA 5TR5A 3ML8A 3DVGX 3JYUA 4I6NB 5JHAA 3A4RA 5IAAC 4F7ZA 3H9DA 2G4SA 1WXAA 1YD8U 3EC8A 2L3ZA 3ZIMA 3TL5A 4DDGD 2JUOA 2L8JA 3CSTA 1UBQA 4LDTD 3APDA 3DCGA 3WAPA 1WRDB 2JXXA 2LVPA 4W9LA 2DX5B 4KDLB 2OJRA 2LI5A 4G11A 4RMAA 3O65B 4WWOA 1WJUA 4ANXA 3M95A 3OAWA 1WX8A 3B08A 1FXTB 5AZGA 4HXDA 2LVOA 1ZKHA 2K6QA 3PREA 4K7SA 1WJ4A 2ZNVB 1V80A 4EOYA 4WWNA 4TQ0A 3R3MA 3ZNHB 4FHJA 1VD2A 2MBHA 4MDKE 3VQIA 5IA7A 4HCNB 2N9XA 4MGIE 4ANUA 3H6NA 2ZZPB 2G45B 3QQ8B 2BPSA 2V1YA 2J0JA 4KVGB 2V3SA 2K1FA 2D3GA 4GSWA 2O2VB 3APFA 4KSLC 1V86A 2DZJA 3AULA 1SIFA 3DVNV 2N1VA 3N30A 2KTRA 1OEYJ 4NPNA 2ZEQA 4G50A 1WH3A 4IC7B 3DPDA 4JIOU 1WR1A 3ENEA 5DPRA 1PQSA 1WJNA 2R2QA 3DBRI 1WGRA 2LWPA 4NY0A 3PT2B 4MGZE 3T9LA 2KO3A 3PLUA 2J7QB 2KQSA 2PE9A 4IG7B 4EKUA 1TGZB 2LXCA 3ECIA 2WX1A 2C9WB 1L2NA 3NZUA 2UWQA 3U8ZA 1IYFA 3X0WA 2MP2B 2NPTB 4NQLB 2KX0A 3DOWA 3IBEA 1ISNA 2ZJDA 2HD5B 2RD0A 3NOBA 3L0WB 4NQKE 3IHPC 3L13A 4KZCA 5JH5C 2MBEA 3V61A 4BKSA 2NVUI 3A9KB 2KDEB 4MM3A 2MBQA 4II2B 4WJPA 4ANWA 2D10A 4IWOA 4KZ0A 2DZIA 2KDFB 1J8CA 1WXVA 4MJSA 2IO1B 1RAXA 3S2AA 3I3TB 2W9NA 2MCNB 4B95A 4DHJB 2HE7A 4DWFA 2KFJA 3PRZA 2K8BA 5DPWA 3Q3FA 3LJ3A 3TCAA 2MWSB 4N9F4 4WJQA 4GU2A 4WJOA 3TMPB 3TJPA 4F8CB 2CHWA 4OVVA 2N9EB 3RUIB 4GOCA 2RGFA 3PRPB 4XC2A 3EHVA 4DHJD 2NS5A 4ICUA 5E6PA 3CF6E 1Q0WB 2MRPA 3UIOB 4HVBA 4DK5A 2LUEA 4HJKA 1UZXB 3PRMB 4K81A 1YQBA 3HM6X 5D6JB 4AOFA 4DHZE 1Y8RC 3PHXB 3OJ4B 5LXIB 2O6VA 3WA0A 2NR2A 3L16A 1RRBA 2L0FA 3B1LX 2FIFA 3H1UA 4ZRJA 4ZYNA 5C1ZA 3K9PB 4M8NA 3RD2A 1C3TA 2IYDB 2KZRA 2MBOA 3VFKA 2K8HA 4BFRA 4WJNA 3ZUNA 3GOEA 3PVLA 1EO6A 3HIZA 1E5WA 2C7MB 2BYVE 3L08A 4GGQA 2Z59B 3WAMA 1I35A 3UIPB 5L95C 2JT4B 3IG3A 3A9JA 3BINA 1H4RA 1E90A 2PJHA 1WGYA 5LLIA 2A5UA 2KXJA 2BYEA 4GDLA 2JVCA 4W9DA 4HDOA 4IWPA 2YVCA 4JGHB 4NAWA 1OQYA 2KOXA 3NZSA 1GUAB 4XX5A 4BOZB 2ZVNA 2ZPNA 3QCAA 1WMHB 1YJ1A 3CMMB 1YX5B 2KDBA 2FCMA 3DDCB 3DBSA 1V6EA 1WX7A 2KNBA 1WR6E 1UD7A 5CHVC 3VTVA 1V5TA 4CHKA 1D3ZA 2LRUA 2VRRB 3R7QA 3VUWA 1I42A 2DAJA 2OOBB 3QIJA 1E7UA 5DPSA 1VCBA 1P1AA 4KSKC 4LJOB 3WALA 1V9JA 2M0XA 3QC8B 5D2MB 3VH3B 3UQAA 1OGWA 2HJ8A 2K6DB 3EFUA 2KWVB 1T0YA 2NBUA 3RZFA 1Z5SB 2NCNA 1LM8B 1WGDA 2FUHB 2IO3B 4FN2A 4W9KA 2NBVB 4GN1A 1WM3A 3MJWA 2M8SA 3H7SA 2R2OA 2D11A 2DYMA 3UGBB 1WZ0A 5AZHA 3MTNB 3DVNU 4BOSC 3IVFA 2KANA 2I1JA 3JW0X 4KIKB 2GBJA 2KJ6A 2LJ5A 1YX6B 3N3KB 2GBNA 2AL6A 2PE6B 3LDZE 4P7IA 3VUXA 1EUVB 2KDIA 4TV3A 2O2VA 2BF8B 1X1MA 3PGEA 2XBBC 4HWIB 4PYUA 3B0AA 2XEWA 4ZRIA 2D2QA 4JLCA 1ZW7A 4FBJB 4NJ6A 2N7DA 4PYZA 4ZRKA 4W9EA 4HLEA 2L76A 3BY4B 3W1SC 5JHBA 4CO7A 4HPLB 3VTUA 2AL3A 5HKHA 5J18A 4DXAB 2EMSA 1XD3B 2L00B 3PPAA 4HCPB 2BYFA 3N32A 3L17A 1J19A 2KC1A 2MLBA 1GNUA 3AXCA 1KM7A 3PLVA 4RM8A 2N7EA 2DAFA 3KUCB 1WZ3A 3KH0A 2LGYA 3ZRFA 1UELA 2EKEC 3M3JA 3WAOA 5DCNA 3RYTA 1E8XA 1WX9A 2JZ3B 4ZDVA 2MP2A 2NPTA 4II3B 4DHZB 4GIVA 3A4SC 1GC7A 2REXA 3OLMD 1Q1OA 4JL9A 4XZ4A 2JY6A 1WY8A 2XK5B 3RCZA 4FADA 3ZKJC 2G4DB 3V6CB 2IY0B 1XQQA 2LGXA 3AI5A 3VTWA 4B9KA 3A9KA 1E8WA 3VXWA 1RLFA 4AUQC 4ICVA 2KLCA 3NS8A 3ALBA 1J0GA 3ZW3A 1GJZA 3IFWB 4EFOA 3U30A 3L54A 1NI2A 3WANA 1V49A 1E8ZA 2GOWA 4EZLA 2FCSA 2KC2A 4MELA 4FJVB 3H7PB 2MBBB 2CHXA 1TBEA 1ZGUB 3PSEB 4LCDE 4OVUA 4URKA 1WJ6A 3OJ3A 2IBIB 4K1RB 3D32A 1CMXB 4MGKE 2FCQA 3SDLC 3ZO5B 2FIDA 2UYZB 2I1KA 4AWJA 4E3CA 2MX2A 3QARA 2KJHB 4GDKB 2KFKB 1WIAA 1BT0A 1WGHA 5G2NA 2JRHA 3ZDTA 1R4MI 2LZ6A 4PS3A 3JSVB 3TIXA 2IO0B 3KVFB 3NHEB 1KJTA 3DVGY 1YIWA 3HK0A 4G0NB 2KMAA 1L7YA 3PV1A 4NNJB 4A3PA 3UINB 3ZNID 3AU4A 2WYQA 5KHOA 4MEMA 2BGFA 3DBLI 1IP9A 1WE7A 2KK8A 4IM0A 3VVWB 4KV2A 2Z0EB 4IWQA 5J2RA 3C0RB 4M0WB 4WQOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY1 B;  1MG8 A;  3R7R A;  3PHW B;  3QA8 A;  3WIM A;  4BKG A;  2M17 A;  3SD5 A;  1K8R B;  2QHO A;  1NBF C;  3R66 C;  3RUL A;  2N4F A;  2Y5B B;  4FHK A;  3NY5 A;  3HHM A;  2CKH B;  2G3Q B;  1IPG A;  2KLG A;  2ZVO A;  3A1Q B;  4BBN C;  2K8C A;  3M62 B;  1HE8 A;  1WMH A;  1C1Y B;  2KWU B;  1LFD A;  1E7V A;  1OTR B;  1WE6 A;  1Z2M A;  4FJZ A;  4LJP B;  4B6W A;  5J17 A;  2DYO A;  4IW0 A;  1S3S G;  4AJY B;  2PPH A;  2K39 A;  4HDQ A;  3U7D A;  4W9J A;  2KMC A;  3ZDM C;  1WYW B;  3APC A;  2KWC A;  3RZW C;  2ZCC A;  2AWT A;  4A20 A;  2JPH A;  5FR6 A;  2CR5 A;  3SU8 X;  2RPQ A;  4BKT A;  4MSM B;  4BVU C;  3SHQ A;  2D07 B;  5D94 A;  2DEN B;  1WM2 A;  5LXH A;  1Q5W B;  1JRU A;  5E6O A;  2DHZ A;  1V2Y A;  2KJR A;  3Q3J A;  4FLH A;  2MQJ A;  4WAA A;  2LD9 A;  2KN5 A;  5DPT A;  3V6E B;  2B3A A;  3V62 A;  4HPM B;  4FA6 A;  1KLV A;  2PEA A;  1LXD A;  4CYE A;  1H8C A;  4IUM B;  4IM2 A;  4FUL A;  4PS7 A;  4KIK A;  2Z0D B;  4WWP A;  2KVR A;  3K9O B;  1R4N I;  3KUD B;  2JZZ A;  3ZVV A;  1GC6 A;  2WDT B;  3VH4 B;  2LAS A;  4AP4 C;  4W9F A;  4E74 A;  1EF1 A;  2DZM A;  3HM3 A;  4MGY E;  2DZK A;  3ZLZ A;  2K25 A;  3ONS A;  3CSF A;  2FNJ B;  3KUZ A;  3UQB A;  1LQB A;  2BWF A;  2CHZ A;  2LRW A;  4G3X B;  4TUU A;  2KTR B;  4EZJ A;  2C5L C;  4JQW C;  3A33 B;  3GZN I;  1WGG A;  2GBR A;  2KX3 A;  5EDS A;  5JZE B;  1WI0 A;  3JVZ X;  1AAR A;  1P3Q U;  3ZNZ B;  2IZV B;  3TBL D;  2KQ7 A;  1P9D U;  1XT9 B;  3X23 A;  4W9G A;  2IO2 B;  2YLM A;  2CS4 A;  2NBW B;  1EF5 A;  2N1W A;  1A5R A;  2GBM A;  4MSQ B;  2EMT A;  4GMV A;  4W9C A;  3UF8 A;  5CHF A;  3L10 B;  3T8M A;  2XK5 A;  2GBK A;  4MH0 E;  3ZRC A;  4BBN F;  1G6J A;  1UH6 A;  4E71 A;  1GG3 A;  3PZD A;  2RSU A;  1TZ1 A;  1RFA A;  4YL8 A;  5BO4 B;  1UBI A;  1P0R A;  4HK2 A;  2MSE D;  3VAW A;  2M4N A;  4IM3 A;  1QZE A;  1SGH A;  3PS6 A;  2BWE S;  2FCN A;  2C7H A;  2ZNV C;  4K7U A;  5CHW A;  4GXB A;  4F1S A;  2BKR B;  5D7G A;  4I6L B;  2BKF A;  1V5O A;  1WXM A;  4MJS B;  3W1Y A;  5KHQ A;  3KW5 B;  2KHW B;  4RM9 A;  1S1Q B;  3H7P A;  5AZF A;  4AJW A;  2KTF A;  4BKS D;  1P98 A;  5C23 A;  2CU1 A;  3VUY A;  3DBH I;  2HTH A;  1WF9 A;  2JWZ A;  1NDD A;  2C60 A;  4KDI C;  4A3O A;  2ASQ A;  3DQV A;  3P2B A;  3V60 A;  4I6P A;  2ZCB A;  4TQ1 A;  3QJZ A;  4X57 B;  3VDZ A;  2ZPY A;  3AU5 A;  4ASW C;  4GDK A;  2N9P C;  2KFK A;  2LXA A;  2L0T A;  3ZNG C;  4EEW A;  3EEC A;  1WXS A;  3JSV A;  5E6N A;  5GMV A;  5CTR C;  2KD0 A;  4DDI D;  4DBG A;  2GMI C;  2A4Z A;  3QAQ A;  3ZTC A;  1OEY A;  2LGD A;  1UGM A;  1E8Y A;  4TKN A;  3QWZ B;  3PTF C;  2WX0 A;  3QK0 A;  2O6V B;  1U4A A;  5G55 A;  2WWZ A;  3KYD D;  1F9J A;  4J6I A;  2JF5 A;  2RR9 A;  1TTN A;  4EZK A;  3MHS D;  2J0M A;  2MA9 B;  1KOT A;  4K7W A;  2O6V D;  1V81 A;  2J0K A;  3KYC D;  4NJ7 A;  2MW5 A;  2LVQ A;  2M1M A;  5AEK B;  4GB9 A;  2DYB A;  1SE9 A;  4FJY A;  4M8M A;  3RT3 B;  3M63 B;  3VHT C;  3QHT A;  3ZTD A;  4EUT A;  2AYO B;  1M94 A;  3ML9 A;  4W9H A;  3A9J B;  2JRI B;  3A1Q A;  1WFY A;  2L05 A;  2FAZ A;  5CX3 A;  3W1S A;  4W9I A;  5L83 A;  2V4L A;  4GDL B;  4ANV A;  2L7R A;  2C7N B;  4LDT B;  2KKC A;  3QX1 A;  4NAW B;  4PS8 A;  2AEH A;  5TR5 A;  3ML8 A;  3DVG X;  3JYU A;  4I6N B;  5JHA A;  3A4R A;  5IAA C;  4F7Z A;  3H9D A;  2G4S A;  1WXA A;  1YD8 U;  3EC8 A;  2L3Z A;  3ZIM A;  3TL5 A;  4DDG D;  2JUO A;  2L8J A;  3CST A;  1UBQ A;  4LDT D;  3APD A;  3DCG A;  3WAP A;  1WRD B;  2JXX A;  2LVP A;  4W9L A;  2DX5 B;  4KDL B;  2OJR A;  2LI5 A;  4G11 A;  4RMA A;  3O65 B;  4WWO A;  1WJU A;  4ANX A;  3M95 A;  3OAW A;  1WX8 A;  3B08 A;  1FXT B;  5AZG A;  4HXD A;  2LVO A;  1ZKH A;  2K6Q A;  3PRE A;  4K7S A;  1WJ4 A;  2ZNV B;  1V80 A;  4EOY A;  4WWN A;  4TQ0 A;  3R3M A;  3ZNH B;  4FHJ A;  1VD2 A;  2MBH A;  4MDK E;  3VQI A;  5IA7 A;  4HCN B;  2N9X A;  4MGI E;  4ANU A;  3H6N A;  2ZZP B;  2G45 B;  3QQ8 B;  2BPS A;  2V1Y A;  2J0J A;  4KVG B;  2V3S A;  2K1F A;  2D3G A;  4GSW A;  2O2V B;  3APF A;  4KSL C;  1V86 A;  2DZJ A;  3AUL A;  1SIF A;  3DVN V;  2N1V A;  3N30 A;  2KTR A;  1OEY J;  4NPN A;  2ZEQ A;  4G50 A;  1WH3 A;  4IC7 B;  3DPD A;  4JIO U;  1WR1 A;  3ENE A;  5DPR A;  1PQS A;  1WJN A;  2R2Q A;  3DBR I;  1WGR A;  2LWP A;  4NY0 A;  3PT2 B;  4MGZ E;  3T9L A;  2KO3 A;  3PLU A;  2J7Q B;  2KQS A;  2PE9 A;  4IG7 B;  4EKU A;  1TGZ B;  2LXC A;  3ECI A;  2WX1 A;  2C9W B;  1L2N A;  3NZU A;  2UWQ A;  3U8Z A;  1IYF A;  3X0W A;  2MP2 B;  2NPT B;  4NQL B;  2KX0 A;  3DOW A;  3IBE A;  1ISN A;  2ZJD A;  2HD5 B;  2RD0 A;  3NOB A;  3L0W B;  4NQK E;  3IHP C;  3L13 A;  4KZC A;  5JH5 C;  2MBE A;  3V61 A;  4BKS A;  2NVU I;  3A9K B;  2KDE B;  4MM3 A;  2MBQ A;  4II2 B;  4WJP A;  4ANW A;  2D10 A;  4IWO A;  4KZ0 A;  2DZI A;  2KDF B;  1J8C A;  1WXV A;  4MJS A;  2IO1 B;  1RAX A;  3S2A A;  3I3T B;  2W9N A;  2MCN B;  4B95 A;  4DHJ B;  2HE7 A;  4DWF A;  2KFJ A;  3PRZ A;  2K8B A;  5DPW A;  3Q3F A;  3LJ3 A;  3TCA A;  2MWS B;  4N9F 4;  4WJQ A;  4GU2 A;  4WJO A;  3TMP B;  3TJP A;  4F8C B;  2CHW A;  4OVV A;  2N9E B;  3RUI B;  4GOC A;  2RGF A;  3PRP B;  4XC2 A;  3EHV A;  4DHJ D;  2NS5 A;  4ICU A;  5E6P A;  3CF6 E;  1Q0W B;  2MRP A;  3UIO B;  4HVB A;  4DK5 A;  2LUE A;  4HJK A;  1UZX B;  3PRM B;  4K81 A;  1YQB A;  3HM6 X;  5D6J B;  4AOF A;  4DHZ E;  1Y8R C;  3PHX B;  3OJ4 B;  5LXI B;  2O6V A;  3WA0 A;  2NR2 A;  3L16 A;  1RRB A;  2L0F A;  3B1L X;  2FIF A;  3H1U A;  4ZRJ A;  4ZYN A;  5C1Z A;  3K9P B;  4M8N A;  3RD2 A;  1C3T A;  2IYD B;  2KZR A;  2MBO A;  3VFK A;  2K8H A;  4BFR A;  4WJN A;  3ZUN A;  3GOE A;  3PVL A;  1EO6 A;  3HIZ A;  1E5W A;  2C7M B;  2BYV E;  3L08 A;  4GGQ A;  2Z59 B;  3WAM A;  1I35 A;  3UIP B;  5L95 C;  2JT4 B;  3IG3 A;  3A9J A;  3BIN A;  1H4R A;  1E90 A;  2PJH A;  1WGY A;  5LLI A;  2A5U A;  2KXJ A;  2BYE A;  4GDL A;  2JVC A;  4W9D A;  4HDO A;  4IWP A;  2YVC A;  4JGH B;  4NAW A;  1OQY A;  2KOX A;  3NZS A;  1GUA B;  4XX5 A;  4BOZ B;  2ZVN A;  2ZPN A;  3QCA A;  1WMH B;  1YJ1 A;  3CMM B;  1YX5 B;  2KDB A;  2FCM A;  3DDC B;  3DBS A;  1V6E A;  1WX7 A;  2KNB A;  1WR6 E;  1UD7 A;  5CHV C;  3VTV A;  1V5T A;  4CHK A;  1D3Z A;  2LRU A;  2VRR B;  3R7Q A;  3VUW A;  1I42 A;  2DAJ A;  2OOB B;  3QIJ A;  1E7U A;  5DPS A;  1VCB A;  1P1A A;  4KSK C;  4LJO B;  3WAL A;  1V9J A;  2M0X A;  3QC8 B;  5D2M B;  3VH3 B;  3UQA A;  1OGW A;  2HJ8 A;  2K6D B;  3EFU A;  2KWV B;  1T0Y A;  2NBU A;  3RZF A;  1Z5S B;  2NCN A;  1LM8 B;  1WGD A;  2FUH B;  2IO3 B;  4FN2 A;  4W9K A;  2NBV B;  4GN1 A;  1WM3 A;  3MJW A;  2M8S A;  3H7S A;  2R2O A;  2D11 A;  2DYM A;  3UGB B;  1WZ0 A;  5AZH A;  3MTN B;  3DVN U;  4BOS C;  3IVF A;  2KAN A;  2I1J A;  3JW0 X;  4KIK B;  2GBJ A;  2KJ6 A;  2LJ5 A;  1YX6 B;  3N3K B;  2GBN A;  2AL6 A;  2PE6 B;  3LDZ E;  4P7I A;  3VUX A;  1EUV B;  2KDI A;  4TV3 A;  2O2V A;  2BF8 B;  1X1M A;  3PGE A;  2XBB C;  4HWI B;  4PYU A;  3B0A A;  2XEW A;  4ZRI A;  2D2Q A;  4JLC A;  1ZW7 A;  4FBJ B;  4NJ6 A;  2N7D A;  4PYZ A;  4ZRK A;  4W9E A;  4HLE A;  2L76 A;  3BY4 B;  3W1S C;  5JHB A;  4CO7 A;  4HPL B;  3VTU A;  2AL3 A;  5HKH A;  5J18 A;  4DXA B;  2EMS A;  1XD3 B;  2L00 B;  3PPA A;  4HCP B;  2BYF A;  3N32 A;  3L17 A;  1J19 A;  2KC1 A;  2MLB A;  1GNU A;  3AXC A;  1KM7 A;  3PLV A;  4RM8 A;  2N7E A;  2DAF A;  3KUC B;  1WZ3 A;  3KH0 A;  2LGY A;  3ZRF A;  1UEL A;  2EKE C;  3M3J A;  3WAO A;  5DCN A;  3RYT A;  1E8X A;  1WX9 A;  2JZ3 B;  4ZDV A;  2MP2 A;  2NPT A;  4II3 B;  4DHZ B;  4GIV A;  3A4S C;  1GC7 A;  2REX A;  3OLM D;  1Q1O A;  4JL9 A;  4XZ4 A;  2JY6 A;  1WY8 A;  2XK5 B;  3RCZ A;  4FAD A;  3ZKJ C;  2G4D B;  3V6C B;  2IY0 B;  1XQQ A;  2LGX A;  3AI5 A;  3VTW A;  4B9K A;  3A9K A;  1E8W A;  3VXW A;  1RLF A;  4AUQ C;  4ICV A;  2KLC A;  3NS8 A;  3ALB A;  1J0G A;  3ZW3 A;  1GJZ A;  3IFW B;  4EFO A;  3U30 A;  3L54 A;  1NI2 A;  3WAN A;  1V49 A;  1E8Z A;  2GOW A;  4EZL A;  2FCS A;  2KC2 A;  4MEL A;  4FJV B;  3H7P B;  2MBB B;  2CHX A;  1TBE A;  1ZGU B;  3PSE B;  4LCD E;  4OVU A;  4URK A;  1WJ6 A;  3OJ3 A;  2IBI B;  4K1R B;  3D32 A;  1CMX B;  4MGK E;  2FCQ A;  3SDL C;  3ZO5 B;  2FID A;  2UYZ B;  2I1K A;  4AWJ A;  4E3C A;  2MX2 A;  3QAR A;  2KJH B;  4GDK B;  2KFK B;  1WIA A;  1BT0 A;  1WGH A;  5G2N A;  2JRH A;  3ZDT A;  1R4M I;  2LZ6 A;  4PS3 A;  3JSV B;  3TIX A;  2IO0 B;  3KVF B;  3NHE B;  1KJT A;  3DVG Y;  1YIW A;  3HK0 A;  4G0N B;  2KMA A;  1L7Y A;  3PV1 A;  4NNJ B;  4A3P A;  3UIN B;  3ZNI D;  3AU4 A;  2WYQ A;  5KHO A;  4MEM A;  2BGF A;  3DBL I;  1IP9 A;  1WE7 A;  2KK8 A;  4IM0 A;  3VVW B;  4KV2 A;  2Z0E B;  4IWQ A;  5J2R A;  3C0R B;  4M0W B;  4WQO B; 
#chains in the Genus database with same CATH topology
 1N5X A;  3PHW B;  1JCK B;  2M17 A;  3SD5 A;  2QIE B;  1K8R B;  3C19 A;  2Y5B B;  3BVM A;  4A9A A;  4BBN C;  2WGS A;  2EKI A;  4P6V F;  3M62 B;  5LNK 1;  2MH7 A;  1C1Y B;  1JRP A;  1LFD A;  2KWU B;  4DXF A;  1FFU A;  1Z2M A;  4LJP B;  1XLN A;  2MEK A;  1SBB B;  2DYO A;  2K39 A;  3AN1 A;  4HDQ A;  2KMC A;  2KWC A;  1TS2 A;  3B9J A;  1XF5 L;  3ZJU A;  3SU8 X;  3SHQ A;  1HTO A;  5D94 A;  1P7E A;  5EE3 A;  1FIQ A;  5LXH A;  1TJE A;  4M00 A;  2LD9 A;  4D2K A;  1KLV A;  2B3A A;  4HPM B;  2NTT A;  1LXD A;  4CYE A;  4IUM B;  4PS7 A;  2Z0D B;  2KVR A;  1VR9 A;  2H89 B;  3RMK C;  1GC6 A;  1AYF A;  4RGN A;  5BYS A;  3VH4 B;  4W9F A;  4E74 A;  2DZM A;  3ZLZ A;  3ONS A;  3I57 A;  3KUZ A;  3IT4 B;  1YQ4 B;  1C76 A;  2LRW A;  4J3O D;  2KTR B;  1ZXI A;  1QOG A;  2J53 A;  2Z8L A;  3P4P B;  1FNV A;  1N5W A;  1WI0 A;  3I63 C;  2QSD A;  1P3Q U;  4XDD A;  2IZV B;  3X23 A;  2YLM A;  2K3U A;  2NBW B;  1OQQ A;  1TKG A;  3T8M A;  2GBK A;  1JRO A;  4MH0 E;  3ZRC A;  4BBN F;  4E71 A;  5BO4 B;  1SE3 A;  2MSE D;  4ZYS A;  3PS6 A;  2BWE S;  3GB1 A;  2FCN A;  3Q8B A;  3ZYY X;  3IAM 1;  2DNF A;  4I6L B;  4C4V B;  3DBL B;  3BWU D;  3Q2A C;  2N9L A;  1I4G A;  2VH2 A;  4KDI C;  1L6V A;  5BYR A;  3QJZ A;  3VDZ A;  2ZPY A;  2LXA A;  3ZNG C;  4EEW A;  3TEZ A;  1JWU D;  5E6N A;  4DDI D;  1V8C A;  2VH1 A;  1QOB A;  4TKN A;  2WX0 A;  1F2R C;  1U4A A;  4YSX B;  1F9J A;  4EZK A;  2JSV X;  1KOT A;  2J0K A;  1K50 A;  4XWT A;  3M63 B;  3ZTD A;  1SEB D;  2AYO B;  3A9J B;  1DOY A;  3W1S A;  1FCC C;  1NEN B;  3W2D A;  4ANV A;  3DVG X;  5IAA C;  3EC8 A;  3TL5 A;  2JUO A;  3B2G A;  3NUH B;  3APD A;  3WAP A;  3GZN B;  3FC4 A;  2DX5 B;  2OJR A;  4G11 A;  1YN5 A;  3GE8 C;  2JXT A;  2MJ3 A;  1V80 A;  1DOI A;  4K3C A;  4HCN B;  4MGI E;  3ZQ4 A;  4CQN A;  4KVG B;  3APF A;  2N1V A;  1C79 A;  3LB8 C;  1I4R A;  2KTR A;  1OEY J;  2ZEQ A;  3O13 A;  4A6Q A;  2FE8 A;  2R2Q A;  1MI0 A;  3PLU A;  2WXO A;  2KQS A;  4IG7 B;  2C9W B;  3NVV A;  1L2N A;  2IGD A;  2JZP A;  1IYF A;  1JQ4 A;  3FAH A;  3X0W A;  2AQ1 B;  4HRS A;  4NQL B;  2KX0 A;  2LJI A;  4ZHP A;  1JWA D;  3IBE A;  4NQK E;  2WDQ B;  1NYR A;  3V61 A;  2NVU I;  1SB3 C;  4IWO A;  2DZI A;  2KDF B;  4C4V A;  1WXV A;  1RAX A;  3W5V B;  2IDY A;  3S2A A;  2XNA C;  2W9N A;  3LXF A;  4KGR A;  3TCA A;  4GU2 A;  3TJP A;  4F8C B;  2QEJ C;  4OVV A;  1F2R I;  4JX1 C;  2NS5 A;  5T8I A;  3U52 E;  2MRP A;  4TMA B;  2QIL A;  2LUE A;  5IKC M;  2DWQ A;  1YQB A;  2WXR A;  2NR2 A;  2Y5C A;  3B1L X;  3H1U A;  2INN E;  4M8N A;  5G5G A;  5BYQ A;  5JXV A;  2GLS A;  1I4Q A;  3P4R B;  3UI3 A;  3VFK A;  3PVL A;  2L1A A;  1E10 A;  1EO6 A;  1D4B A;  2KWD A;  4BAX A;  2W55 A;  2QDF A;  3ETR A;  3A9J A;  3BIN A;  1H4R A;  2PJH A;  4LNI A;  1QOF A;  1WGY A;  1DYQ A;  4RFB A;  4W9D A;  4HEA 1;  2WLB A;  1C4P A;  2YVC A;  1TS4 A;  2KOX A;  3NZS A;  1GOZ A;  5BMI A;  2K9X A;  2ZPN A;  1TS3 A;  3QCA A;  2KDB A;  3DDC B;  2KNB A;  4WWM A;  1YOV B;  1UD7 A;  5CHV C;  1D3Z A;  1TZO A;  4CHK A;  3P4Q B;  3VUW A;  2DAJ A;  3E9S A;  3QIJ A;  1VCB A;  3DBR B;  3RI7 C;  1V9J A;  2HJ8 A;  3EFU A;  2KWV B;  3SEB A;  1F52 A;  2IPK D;  1CZP A;  1WGD A;  2NBV B;  2R61 A;  3AEF B;  2JX5 A;  1WZ0 A;  5AZH A;  1NVI D;  4A8X C;  3IVF A;  2KAN A;  2M19 A;  4KIK B;  5IOI A;  3RNC C;  1EUV B;  1SE4 A;  4YTN B;  2XBB C;  4HWI B;  2D2Q A;  4M01 A;  1FFV A;  5JHB A;  1OFF A;  2KDM A;  4L23 A;  3Q14 C;  3N20 C;  5J18 A;  2BYF A;  2PVG C;  3AEG B;  3NRZ A;  3TEY A;  3AXC A;  3PLV A;  4RM8 A;  2DAF A;  1WZ3 A;  2LGY A;  1UEL A;  2WHI A;  2RDH A;  3R2I A;  4MH8 A;  3AE6 B;  2M56 B;  3OLM D;  4FXC A;  3HVZ A;  4JL9 A;  4FAD A;  4REZ A;  1EU3 A;  2IY0 B;  1XQQ A;  3AI5 A;  2HDE A;  3NS8 A;  4ZRP A;  1GJZ A;  1VDV A;  1NI2 A;  1E8Z A;  4EZL A;  3PZ8 A;  4HJG E;  4FJV B;  2W82 A;  2E3T A;  3AEE B;  3OJ3 A;  2FBW B;  4E3C A;  4N58 A;  2OHF A;  2QMT A;  2WXG A;  4RNA A;  3SR6 A;  1TKE A;  1XEE A;  1KJT A;  3DVG Y;  4G0N B;  2KMA A;  1L7Y A;  2WXJ A;  4NNJ B;  1EWY C;  4A3P A;  2H88 B;  1FM0 D;  1QOA A;  1YJJ A;  3DBL I;  1IP9 A;  1WE7 A;  4KV2 A;  2EEL A;  2Z0E B;  2QHO A;  1TS5 A;  1NBF C;  3RUL A;  3NY5 A;  3A1Q B;  1HXY D;  3Q69 A;  1WE6 A;  4B6W A;  3N1Y C;  4IW0 A;  4ZOH C;  2PPH A;  3U7D A;  4L2Y A;  1WYW B;  3APC A;  2AWT A;  1IGD A;  2WXP A;  4A20 A;  2CR5 A;  3FKY A;  4BVU C;  3AE8 B;  2DEN B;  3NG0 A;  1WM2 A;  5HI1 A;  1T0S C;  5E6O A;  2DHZ A;  3Q3J A;  2LEK A;  4ZRQ A;  2MQJ A;  5DPT A;  3V6E B;  2Q5W D;  2IJ0 A;  3V62 A;  2PEA A;  3CIR B;  4KIK A;  1JWB D;  1KF6 B;  1ZE3 D;  2WXQ A;  1FCL A;  2LAS A;  2K25 A;  2Y3A A;  3UQB A;  4K3B A;  2BWF A;  4EZJ A;  2K5P A;  2C5L C;  3DHG C;  3GZN I;  1WGG A;  1TIF A;  1NEK B;  1F77 A;  5EDS A;  2JQR B;  3GS2 A;  2K22 A;  2I2Y A;  2IO2 B;  1V97 A;  2CS4 A;  1EF5 A;  2GBM A;  4MSQ B;  4W9C A;  2YEP B;  3AE7 B;  1KRH A;  1ZXH A;  1R4M B;  1DOX A;  2RSU A;  1TZ1 A;  1UBI A;  1P0R A;  3VAW A;  1T6B X;  2BYT A;  1VJK A;  3RPF C;  2ZNV C;  5CHW A;  4GXB A;  4MJS B;  3BII D;  3W1Y A;  4RM9 A;  2KHW B;  4RCO A;  5C23 A;  1RYJ A;  2WXI A;  3VUY A;  4JE3 B;  2C60 A;  2ASQ A;  3PZ7 A;  4TQ1 A;  5EE0 A;  4XGA B;  1PGA A;  2L0T A;  1YQ3 B;  4XE0 A;  5CTR C;  1FNW A;  3P4S B;  2A4Z A;  1DGJ A;  1OEY A;  2LGD A;  3QWZ B;  3QK0 A;  2O6V B;  3RNG C;  1M4V A;  1I4H A;  1YN4 A;  4LNK A;  3PO0 A;  1RWS A;  4J6I A;  2RR9 A;  3MHS D;  2J0M A;  2BS2 B;  2O6V D;  1V81 A;  4NJ7 A;  5AEK B;  4LK0 M;  3HVD A;  4C00 A;  3VHT C;  3QHT A;  1KFY B;  3ML9 A;  2JRI B;  3A1Q A;  2CJO A;  1MHX A;  4W9I A;  5L83 A;  2V4L A;  4GDL B;  2X38 A;  4DQO C;  2C7N B;  2KKC A;  4PS8 A;  5TR5 A;  3JYU A;  4I6N B;  3H9D A;  1FD6 A;  1JML A;  2G4S A;  1WXA A;  3ZIM A;  4DDG D;  2L8J A;  4RGM A;  4USA A;  2RDG A;  1N63 A;  4N59 A;  4W9L A;  4KDL B;  2KMM A;  4RMA A;  4ANX A;  3M95 A;  3OAW A;  1WX8 A;  2W3S A;  3B08 A;  1FXT B;  4HXD A;  2LVO A;  1ZKH A;  4K7S A;  2IGG A;  4HRO A;  3AH7 A;  4EOY A;  4TQ0 A;  4YXD B;  3R3M A;  1L0V B;  3VQI A;  5IA7 A;  2N9X A;  2V1Y A;  2V9H A;  3P1M A;  1HZ6 A;  2D3G A;  4GSW A;  2O2V B;  3VR9 B;  4KSL C;  1V86 A;  3N1Z C;  2DZJ A;  3AUL A;  2V0G A;  2SEB D;  4WH4 A;  4IC7 B;  3ENE A;  3MHZ A;  2MHJ A;  3DBR I;  4NY0 A;  1HA5 A;  1YJI A;  2KAC A;  2PE9 A;  1TGZ B;  3ECI A;  1L4Z B;  3LYY A;  3NZU A;  5FKA C;  2UWQ A;  2V4I B;  2DLB A;  3DOW A;  1ISN A;  2HD5 B;  3L0W B;  1WYG A;  4KZC A;  2MBE A;  2LHE A;  3ZXV A;  4C7Z A;  4WJP A;  2D10 A;  2NMQ A;  3Q8C A;  4MJS A;  2IO1 B;  2PMV A;  2D3A A;  3I3T B;  1PUT A;  3AEB B;  3RNB C;  2HE7 A;  3PRZ A;  5H92 C;  2CJN A;  4WJQ A;  1QLB B;  1QQR A;  4WJO A;  3HUI A;  3TMP B;  1TYG B;  2J4X A;  2RGF A;  1E9M A;  4XC2 A;  1ESF A;  1Q0W B;  4JWU C;  4HJK A;  2W54 A;  1UZX B;  3PRM B;  2JU6 X;  3OJ4 B;  5LXI B;  2O6V A;  2JWU A;  1RRB A;  2L0F A;  1EM7 A;  3KLS X;  5C1Z A;  1K51 A;  1WSP A;  2D3B A;  4NJC A;  2K8H A;  3ZUN A;  3GOE A;  1E0Z A;  3HIZ A;  1E5W A;  2C7M B;  2Z59 B;  2WP9 B;  1PFD A;  3GE3 C;  2BT6 A;  4S0R A;  1VLB A;  2BYE A;  1Y56 A;  4GDL A;  3MC9 A;  4MT5 A;  2E6X A;  1MFW A;  2WXH A;  4BOZ B;  1GUA B;  1F0Z A;  1SF0 A;  3RNA C;  1ZDV A;  3CMM B;  1YX5 B;  3VTV A;  3NZ3 A;  3RNE C;  1ZUD 2;  5DPS A;  4LJO B;  1E6E B;  2M0X A;  3VRB B;  1ZP0 B;  5C2T B;  3UQA A;  1XLO A;  2G1E A;  1Z5S B;  4W9K A;  2D3C A;  4YSY B;  2WXK A;  3H7S A;  2D11 A;  4R3D A;  2DYM A;  1D5M C;  2PLP A;  2I1J A;  2W3R A;  1ENF A;  3N3K B;  3ZGZ A;  3VUX A;  4KGT A;  4TV3 A;  2O2V A;  2BF8 B;  1C77 A;  3B0A A;  4ZRI A;  4JLC A;  3AE1 B;  4HLE A;  4W9E A;  3W1S C;  2L32 A;  3NVW A;  2EMS A;  1JW9 D;  3U4E G;  2MLB A;  1GNU A;  4IOI E;  3M3J A;  1CK1 A;  2D5G A;  1R7S A;  3RYT A;  1YNT E;  4GIV A;  1FMA D;  1Q1O A;  2G4D B;  1UNS A;  2LGX A;  1E8W A;  4ICV A;  2KLC A;  1BML C;  3ZW3 A;  2PKO A;  1SJE D;  3IFW B;  4EFO A;  4HKQ A;  3WAN A;  2N9K A;  3NJT A;  4Q2J A;  1I4P A;  2GOW A;  2FCS A;  3ZJV A;  1TBE A;  1ZGU B;  4LCD E;  1WJ6 A;  4K1R B;  2AQ3 B;  2FCQ A;  3SDL C;  3ZO5 B;  1ET6 A;  2MX2 A;  4GDK B;  1WGH A;  1UGJ A;  3AMZ A;  3RFZ B;  5G2N A;  4MAC A;  1R4M I;  3KVF B;  3NHE B;  4LNO A;  3AE9 B;  4LLG M;  4B0E A;  3N9Y C;  3AU4 A;  1MVK A;  3Q3N C;  4O1N A;  1SXT A;  3AEA B;  2KAJ A;  5J2R A;  1HEZ E;  3C0R B;  4WQO B;  3WIM A;  4HPP A;  3MP9 A;  4BKG A;  1Q10 A;  3R66 C;  2N4F A;  3Q3O C;  3HHM A;  2CKH B;  1IGC A;  2ZVO A;  3Q8F A;  1E7V A;  1OTR B;  5J17 A;  3ZDM C;  1NI3 A;  2ZCC A;  4RF0 A;  2JPH A;  5FR6 A;  1KLG D;  1XCT L;  2RPQ A;  2D07 B;  1Q5W B;  1JRU A;  5IN7 A;  2KJR A;  2WS3 B;  4FLH A;  1XLP A;  4EE2 A;  3I9V 1;  3ZJT A;  1ROE A;  4WWP A;  5D3D A;  1L4D B;  2L52 A;  3K9O B;  5BMG A;  2ZW1 A;  3TEX A;  3KUD B;  2JZZ A;  3ZVV A;  2WDT B;  1I7H A;  2IGH A;  4MGY E;  3HM3 A;  2DZK A;  5C3J B;  1AWD A;  2FNJ B;  1VZ6 A;  3CSF A;  1LQB A;  1UUP A;  4G3X B;  4TUU A;  4JQW C;  3A33 B;  5JZE B;  3JVZ X;  3ZNZ B;  3TBL D;  2KQ7 A;  3L4P A;  4W9G A;  2N1W A;  4UDU C;  2EMT A;  3UF8 A;  3L10 B;  1V1O A;  1G6J A;  1UH6 A;  3PZD A;  1RFA A;  1WXQ A;  4BZA A;  2J52 A;  2V3N A;  4K7U A;  4A55 A;  2V3P A;  2BKR B;  5D7G A;  1TY2 A;  1S1Q B;  2KQ4 X;  5HFY A;  2KTF A;  1P98 A;  5BMH A;  1WF9 A;  2HTH A;  4HKZ E;  4A3O A;  3V60 A;  2ZCB A;  3AU5 A;  4GDK A;  2N9P C;  2GB1 A;  1CQV A;  3GP7 A;  2K0P A;  1QIL A;  5GMV A;  2BVC A;  4JPS A;  2HJ1 A;  3PTF C;  5G55 A;  2WWZ A;  3KYD D;  2Y5P A;  2JF5 A;  1TTN A;  3NS1 A;  1YN3 A;  4K7W A;  1PGB A;  2KVZ A;  4YSZ B;  2LVQ A;  2DYB A;  4FJY A;  4M8M A;  4EUT A;  1M94 A;  4YT0 B;  2LUM A;  4W9H A;  5HHD G;  1WFY A;  3AE4 B;  2FAZ A;  5CX3 A;  1R4N B;  2L7R A;  2OED A;  3BK1 A;  5JHA A;  3Q8A A;  4YTM B;  3BYY B;  1A70 A;  1C4A A;  1FO4 A;  2L3Z A;  2WXF A;  1L0Y B;  2KYW A;  1WRD B;  2JXX A;  2LI5 A;  4WWO A;  3CWI A;  1JWM D;  1KH0 A;  3W9C B;  2PTL A;  3PRE A;  1WJ4 A;  5D3I B;  2QJL A;  3TUO A;  3ZNH B;  1VD2 A;  2MBH A;  3P42 A;  4MDK E;  2GI9 A;  2L83 A;  3QQ8 B;  2BTE A;  5EE9 A;  3AEC B;  2J0J A;  3H8H A;  1SIF A;  3DVN V;  2BW2 A;  3N30 A;  4WQM A;  1N61 A;  4JIO U;  1WR1 A;  1WJN A;  2BQQ A;  2LWP A;  3DBH B;  3T9L A;  4MGZ E;  2KO3 A;  2PIA A;  2J7Q B;  4XWW A;  2LXC A;  4L1B A;  2OJW A;  2WX1 A;  1EU4 A;  2NPT B;  4C80 A;  2RD0 A;  3BZD B;  1STE A;  2LMC A;  3V05 A;  3IHP C;  3L13 A;  5JH5 C;  1JWS D;  3A9K B;  2ONQ A;  4II2 B;  3BYT B;  1N62 A;  3KWL A;  4WIP A;  1J8C A;  1J7A A;  5I4D A;  1QT9 A;  4DHJ B;  4DWF A;  3R2T A;  5DPW A;  3U2S C;  3LJ3 A;  3VRA B;  2MWS B;  1VZ8 A;  2N9E B;  4OW0 A;  3EHV A;  4DHJ D;  1EWC A;  3SFE B;  4ICU A;  5E6P A;  3J9C A;  3UIO B;  4DK5 A;  4K81 A;  4N6E B;  1RM6 C;  3EGR A;  1Y8R C;  3PHX B;  3R8B A;  1T5X D;  1KTK A;  3L16 A;  2FIF A;  4ZYN A;  4ITK A;  2KZR A;  4BFR A;  4WJN A;  2BYV E;  4LTU A;  4GGQ A;  4OVZ A;  1I35 A;  5AUK A;  3UIP B;  5L95 C;  4P16 A;  1WGK A;  1ACC A;  1E90 A;  3DWG C;  5LLI A;  2BS3 B;  2A5U A;  2KXJ A;  2AQ2 B;  2JVC A;  4HDO A;  3BVZ A;  4JGH B;  1OQY A;  4IDI A;  1WMH B;  1YJ1 A;  2FCM A;  1V6E A;  3DWM A;  4XDC A;  1V5T A;  3R7Q A;  2VRR B;  1FNU A;  3T3N A;  1E7U A;  4QAY A;  4KSK C;  1P1A A;  3WAL A;  1OGW A;  2K6D B;  1T0Y A;  3RZF A;  2NCN A;  1LM8 B;  2IO3 B;  4GN1 A;  1OQR A;  2M8S A;  2R2O A;  1FXA A;  3EA6 A;  3DVN U;  4BOS C;  2HTM E;  1CJE A;  4OZB A;  4RH6 A;  4AS1 A;  2GBN A;  2KDI A;  1X1M A;  3PGE A;  4YWG G;  1GAQ B;  4P1B C;  1ZW7 A;  2WQY B;  4NJ6 A;  2N7D A;  4PYZ A;  4WUR A;  1JAL A;  3BY4 B;  4CO7 A;  4HPL B;  5HKH A;  4DXA B;  4HCP B;  2QCZ A;  2RMM A;  3IXS A;  2KC1 A;  3IAS 1;  2N7E A;  3KUC B;  3ZRF A;  3KH0 A;  2EKE C;  1E8X A;  1WX9 A;  4ZDV A;  2NPT A;  4II3 B;  2LGI A;  4KGS A;  3RCZ A;  2JY6 A;  1WY8 A;  2XK5 B;  3ZXR A;  3V6C B;  5IP4 D;  1IBX B;  3VTW A;  4B9K A;  2NTS A;  3A9K A;  1L5P A;  3ALB A;  1AN8 A;  3L54 A;  2LFI A;  1MJD A;  3H7P B;  1K53 A;  2CHX A;  3DHH C;  1FRR A;  5HG2 A;  1CMX B;  4LNN A;  2G9H D;  2FID A;  2UYZ B;  2I1K A;  1XXG A;  1FEH A;  4KX6 B;  2WXM A;  2KFK B;  1BT0 A;  2WNM A;  4PS3 A;  3JSV B;  5IO9 A;  4RGO S;  2GRI A;  1YIW A;  2KN4 A;  1XO3 A;  4AQ7 A;  3ZNI D;  2RPV A;  2WYQ A;  4IM0 A;  2DBY A;  4M0W B;  2IY1 B;  1MG8 A;  3R7R A;  3QA8 A;  1I4X A;  3I5J C;  1SJH D;  4FHK A;  2UU7 A;  2B76 B;  3BK2 A;  2INC C;  2G3Q B;  1IPG A;  2ACZ B;  2KLG A;  2K8C A;  3B2F A;  1HE8 A;  1WMH A;  4FJZ A;  1S3S G;  4AJY B;  4W9J A;  3RZW C;  1L6U A;  2WXL A;  3NVY A;  4BKT A;  4MSM B;  2PVO D;  4ARC A;  3KQ4 A;  1V2Y A;  1QF6 A;  4WAA A;  2KN5 A;  1BUI C;  4FA6 A;  4H2A A;  4S17 A;  1IUE A;  1H8C A;  4IM2 A;  4FUL A;  1V1P B;  1RFK A;  1R4N I;  2WDR B;  3DHI C;  1MHH E;  4IKG A;  4AP4 C;  2YEP F;  3TEW A;  1EF1 A;  4DXG A;  2WU2 B;  2CHZ A;  2WDV B;  3U7Z A;  1P7F A;  3ABV B;  2GBR A;  2J42 A;  2KX3 A;  3OG5 A;  1AAR A;  1N60 A;  1P9D U;  1XT9 B;  1A5R A;  3FIL B;  2JYE A;  4GMV A;  5CHF A;  2FUG 1;  2XK5 A;  5G5H A;  1GG3 A;  1IBX A;  4YL8 A;  4HK2 A;  2M4N A;  4IM3 A;  1QZE A;  1SGH A;  4MM3 B;  2C7H A;  1XLQ A;  4F1S A;  5TSS A;  2BKF A;  1V5O A;  1WXM A;  4GLS C;  5KHQ A;  3KW5 B;  2I38 A;  3H7P A;  5AZF A;  1B9R A;  4LNF A;  4AJW A;  4BKS D;  2BBC A;  2CU1 A;  3DBH I;  2JWZ A;  1NDD A;  3SFD B;  3AE3 B;  3DQV A;  3P2B A;  4P1C C;  4I6P A;  4ZHO A;  4X57 B;  1PGX A;  4ASW C;  2KFK A;  2SAK A;  3EEC A;  1WXS A;  3JSV A;  1ET9 A;  2KD0 A;  4DBG A;  2GMI C;  1FPY A;  5GXG B;  3QAQ A;  3ZTC A;  1UGM A;  1T3Q A;  3WCQ A;  1E8Y A;  1SIJ A;  1YMH E;  4RF1 A;  4US8 A;  1PYW D;  1UF0 A;  1FRD A;  1L0X B;  3MC8 A;  2MA9 B;  4M0W A;  2RDB C;  1TT5 B;  3KYC D;  2MW5 A;  1C4C A;  2M1M A;  4GB9 A;  1SE9 A;  3RT3 B;  2MJD A;  1T0R C;  1GB1 A;  2L05 A;  3AED B;  4US9 A;  4ACF A;  1WRI A;  4LDT B;  3QX1 A;  4NAW B;  2AEH A;  3ML8 A;  3Q6B A;  3A4R A;  4F7Z A;  2VZK B;  3P63 A;  1YD8 U;  1ZOY B;  2KT7 A;  3CST A;  3RN9 C;  1UBQ A;  4YTP B;  4LDT D;  3DCG A;  3RNF C;  1VZ7 A;  2LVP A;  4A90 A;  2VZK D;  3O65 B;  1KLU D;  1WJU A;  4RGT A;  1UWM A;  5AZG A;  2K6Q A;  2ZNV B;  1VRA B;  3AE2 B;  4WWN A;  1V1P A;  4FHJ A;  4C56 C;  4ANU A;  3H6N A;  2ZZP B;  2G45 B;  3AE5 B;  2BPS A;  2V3S A;  2K1F A;  3MFG A;  2PW9 A;  4NPN A;  4G50 A;  1WH3 A;  4OHJ A;  3DPD A;  5DPR A;  2BB5 A;  1PQS A;  2BB6 A;  1WGR A;  3PT2 B;  4EKU A;  3FIL A;  3U8Z A;  4KKI A;  1MPE A;  3AV8 A;  2MP2 B;  4NAM A;  2INP E;  1SSN A;  2N0S B;  2ZJD A;  4NZL B;  1HTQ A;  1D6E C;  3NOB A;  4BKS A;  3Q8E A;  4MM3 A;  2KDE B;  2MBQ A;  5EE1 A;  3V3X A;  4ANW A;  1LO5 D;  4KZ0 A;  1C78 A;  1J7C A;  1B1Z A;  2X8X X;  3TSS A;  1LGR A;  3VR8 B;  2MCN B;  4B95 A;  1TY0 A;  3EFC A;  1D5X C;  2KFJ A;  2K8B A;  3Q3F A;  1GB4 A;  4OZC A;  4ARI A;  1D5Z C;  3IT6 B;  4N9F 4;  2CHW A;  3MJ5 A;  3RUI B;  4GOC A;  3PRP B;  1J7B A;  2ON8 A;  5AUI A;  3AB5 A;  1MG4 A;  5FK9 C;  3CF6 E;  4HVB A;  1K52 A;  5E6J A;  3HM6 X;  5D6J B;  4AOF A;  4DHZ E;  3WA0 A;  1XCQ L;  1F1H A;  4ZRJ A;  3K9P B;  1HZ5 A;  3RD2 A;  1TKY A;  1C3T A;  2IYD B;  2JYT A;  2MBO A;  1NYQ A;  3OWE B;  4OZA A;  3L08 A;  3WAM A;  2JT4 B;  3IG3 A;  2TSS A;  3N1X C;  4IWP A;  4NAW A;  4XX5 A;  2ZVN A;  3DBS A;  1WX7 A;  1WR6 E;  1I42 A;  2LRU A;  1SE2 A;  2OOB B;  5H8Y E;  2AX5 A;  3QC8 B;  5D2M B;  3VH3 B;  2NBU A;  1ZPS A;  2FUH B;  4FN2 A;  1WM3 A;  3MJW A;  1ZDX A;  4XYC A;  1BXT A;  3UGB B;  3MTN B;  4B0M A;  3T3O A;  3W5U B;  3JW0 X;  3KWV A;  2GBJ A;  2KJ6 A;  2LJ5 A;  1YX6 B;  1AW7 A;  2AL6 A;  2PE6 B;  3EUB 2;  3LDZ E;  4P7I A;  4PYU A;  2XEW A;  4FBJ B;  1WWT A;  4ZRK A;  2MJE A;  2L76 A;  2N7J A;  1PDX A;  2M0A A;  3VTU A;  2AL3 A;  1C9F A;  1XD3 B;  2L00 B;  3PPA A;  3N32 A;  3L17 A;  1J19 A;  1KM7 A;  1UWX A;  2QC8 A;  3WAO A;  5DCN A;  2JZ3 B;  2MP2 A;  4DHZ B;  4WAF A;  3A4S C;  1GC7 A;  2REX A;  4TSS A;  4XZ4 A;  5MPO A;  3ZKJ C;  3Q3M C;  5FR3 A;  3VXW A;  1RLF A;  4AUQ C;  1HQR D;  1J0G A;  4KKJ A;  4PK1 A;  2ICI A;  3U30 A;  1N6Z A;  1E7P B;  1V49 A;  1FXI A;  2KC2 A;  4MEL A;  3URY A;  3BVG A;  3NVZ A;  2MBB B;  1T0Q C;  2XN9 C;  4C7Y A;  3PSE B;  4URK A;  4OVU A;  3AM9 A;  2IBI B;  2IND C;  3D32 A;  3MC0 B;  4MGK E;  3C8Y A;  2ZW0 A;  2BS4 B;  4AWJ A;  2LHD A;  3E56 A;  3QAR A;  4PT5 A;  2KJH B;  1QKZ A;  4JWS C;  1WIA A;  2WU5 B;  3ZDT A;  2JRH A;  2LZ6 A;  3HRD D;  4M02 A;  2IO0 B;  3TIX A;  2CU3 A;  1GPX A;  2WXN A;  3HK0 A;  3PV1 A;  3UIN B;  2LGS A;  5KHO A;  4MEM A;  2BGF A;  3VVW B;  2KK8 A;  4IWQ A; 
#chains in the Genus database with same CATH homology
 2IY1 B;  1MG8 A;  3R7R A;  3PHW B;  3QA8 A;  3WIM A;  4BKG A;  2M17 A;  3SD5 A;  1K8R B;  2QHO A;  1NBF C;  3R66 C;  3RUL A;  2N4F A;  2Y5B B;  4FHK A;  3NY5 A;  3HHM A;  2CKH B;  2G3Q B;  1IPG A;  2KLG A;  2ZVO A;  3A1Q B;  4BBN C;  2K8C A;  3M62 B;  1HE8 A;  1WMH A;  1C1Y B;  2KWU B;  1LFD A;  1E7V A;  1OTR B;  1WE6 A;  1Z2M A;  4FJZ A;  4LJP B;  4B6W A;  5J17 A;  2DYO A;  4IW0 A;  1S3S G;  4AJY B;  2PPH A;  2K39 A;  4HDQ A;  3U7D A;  4W9J A;  2KMC A;  3ZDM C;  1WYW B;  3APC A;  2KWC A;  3RZW C;  2ZCC A;  2AWT A;  4A20 A;  2JPH A;  5FR6 A;  2CR5 A;  3SU8 X;  2RPQ A;  4BKT A;  4MSM B;  4BVU C;  3SHQ A;  2D07 B;  5D94 A;  2DEN B;  1WM2 A;  5LXH A;  1Q5W B;  1JRU A;  5E6O A;  2DHZ A;  1V2Y A;  2KJR A;  3Q3J A;  4FLH A;  2MQJ A;  4WAA A;  2LD9 A;  2KN5 A;  5DPT A;  3V6E B;  2B3A A;  3V62 A;  4HPM B;  4FA6 A;  1KLV A;  2PEA A;  1LXD A;  4CYE A;  1H8C A;  4IUM B;  4IM2 A;  4FUL A;  4PS7 A;  4KIK A;  2Z0D B;  4WWP A;  2KVR A;  3K9O B;  1R4N I;  3KUD B;  2JZZ A;  3ZVV A;  1GC6 A;  2WDT B;  3VH4 B;  2LAS A;  4AP4 C;  4W9F A;  4E74 A;  1EF1 A;  2DZM A;  3HM3 A;  4MGY E;  2DZK A;  3ZLZ A;  2K25 A;  3ONS A;  3CSF A;  2FNJ B;  3KUZ A;  3UQB A;  1LQB A;  2BWF A;  2CHZ A;  2LRW A;  4G3X B;  4TUU A;  2KTR B;  4EZJ A;  2C5L C;  4JQW C;  3A33 B;  3GZN I;  1WGG A;  2GBR A;  2KX3 A;  5EDS A;  5JZE B;  1WI0 A;  3JVZ X;  1AAR A;  1P3Q U;  3ZNZ B;  2IZV B;  3TBL D;  2KQ7 A;  1P9D U;  1XT9 B;  3X23 A;  4W9G A;  2IO2 B;  2YLM A;  2CS4 A;  2NBW B;  1EF5 A;  2N1W A;  1A5R A;  2GBM A;  4MSQ B;  2EMT A;  4GMV A;  4W9C A;  3UF8 A;  5CHF A;  3L10 B;  3T8M A;  2XK5 A;  2GBK A;  4MH0 E;  3ZRC A;  4BBN F;  1G6J A;  1UH6 A;  4E71 A;  1GG3 A;  3PZD A;  2RSU A;  1TZ1 A;  1RFA A;  4YL8 A;  5BO4 B;  1UBI A;  1P0R A;  4HK2 A;  2MSE D;  3VAW A;  2M4N A;  4IM3 A;  1QZE A;  1SGH A;  3PS6 A;  2BWE S;  2FCN A;  2C7H A;  2ZNV C;  4K7U A;  5CHW A;  4GXB A;  4F1S A;  2BKR B;  5D7G A;  4I6L B;  2BKF A;  1V5O A;  1WXM A;  4MJS B;  3W1Y A;  5KHQ A;  3KW5 B;  2KHW B;  4RM9 A;  1S1Q B;  3H7P A;  5AZF A;  4AJW A;  2KTF A;  4BKS D;  1P98 A;  5C23 A;  2CU1 A;  3VUY A;  3DBH I;  2HTH A;  1WF9 A;  2JWZ A;  1NDD A;  2C60 A;  4KDI C;  4A3O A;  2ASQ A;  3DQV A;  3P2B A;  3V60 A;  4I6P A;  2ZCB A;  4TQ1 A;  3QJZ A;  4X57 B;  3VDZ A;  2ZPY A;  3AU5 A;  4ASW C;  4GDK A;  2N9P C;  2KFK A;  2LXA A;  2L0T A;  3ZNG C;  4EEW A;  3EEC A;  1WXS A;  3JSV A;  5E6N A;  5GMV A;  5CTR C;  2KD0 A;  4DDI D;  4DBG A;  2GMI C;  2A4Z A;  3QAQ A;  3ZTC A;  1OEY A;  2LGD A;  1UGM A;  1E8Y A;  4TKN A;  3QWZ B;  3PTF C;  2WX0 A;  3QK0 A;  2O6V B;  1U4A A;  5G55 A;  2WWZ A;  3KYD D;  1F9J A;  4J6I A;  2JF5 A;  2RR9 A;  1TTN A;  4EZK A;  3MHS D;  2J0M A;  2MA9 B;  1KOT A;  4K7W A;  2O6V D;  1V81 A;  2J0K A;  3KYC D;  4NJ7 A;  2MW5 A;  2LVQ A;  2M1M A;  5AEK B;  4GB9 A;  2DYB A;  1SE9 A;  4FJY A;  4M8M A;  3RT3 B;  3M63 B;  3VHT C;  3QHT A;  3ZTD A;  4EUT A;  2AYO B;  1M94 A;  3ML9 A;  4W9H A;  3A9J B;  2JRI B;  3A1Q A;  1WFY A;  2L05 A;  2FAZ A;  5CX3 A;  3W1S A;  4W9I A;  5L83 A;  2V4L A;  4GDL B;  4ANV A;  2L7R A;  2C7N B;  4LDT B;  2KKC A;  3QX1 A;  4NAW B;  4PS8 A;  2AEH A;  5TR5 A;  3ML8 A;  3DVG X;  3JYU A;  4I6N B;  5JHA A;  3A4R A;  5IAA C;  4F7Z A;  3H9D A;  2G4S A;  1WXA A;  1YD8 U;  3EC8 A;  2L3Z A;  3ZIM A;  3TL5 A;  4DDG D;  2JUO A;  2L8J A;  3CST A;  1UBQ A;  4LDT D;  3APD A;  3DCG A;  3WAP A;  1WRD B;  2JXX A;  2LVP A;  4W9L A;  2DX5 B;  4KDL B;  2OJR A;  2LI5 A;  4G11 A;  4RMA A;  3O65 B;  4WWO A;  1WJU A;  4ANX A;  3M95 A;  3OAW A;  1WX8 A;  3B08 A;  1FXT B;  5AZG A;  4HXD A;  2LVO A;  1ZKH A;  2K6Q A;  3PRE A;  4K7S A;  1WJ4 A;  2ZNV B;  1V80 A;  4EOY A;  4WWN A;  4TQ0 A;  3R3M A;  3ZNH B;  4FHJ A;  1VD2 A;  2MBH A;  4MDK E;  3VQI A;  5IA7 A;  4HCN B;  2N9X A;  4MGI E;  4ANU A;  3H6N A;  2ZZP B;  2G45 B;  3QQ8 B;  2BPS A;  2V1Y A;  2J0J A;  4KVG B;  2V3S A;  2K1F A;  2D3G A;  4GSW A;  2O2V B;  3APF A;  4KSL C;  1V86 A;  2DZJ A;  3AUL A;  1SIF A;  3DVN V;  2N1V A;  3N30 A;  2KTR A;  1OEY J;  4NPN A;  2ZEQ A;  4G50 A;  1WH3 A;  4IC7 B;  3DPD A;  4JIO U;  1WR1 A;  3ENE A;  5DPR A;  1PQS A;  1WJN A;  2R2Q A;  3DBR I;  1WGR A;  2LWP A;  4NY0 A;  3PT2 B;  4MGZ E;  3T9L A;  2KO3 A;  3PLU A;  2J7Q B;  2KQS A;  2PE9 A;  4IG7 B;  4EKU A;  1TGZ B;  2LXC A;  3ECI A;  2WX1 A;  2C9W B;  1L2N A;  3NZU A;  2UWQ A;  3U8Z A;  1IYF A;  3X0W A;  2MP2 B;  2NPT B;  4NQL B;  2KX0 A;  3DOW A;  3IBE A;  1ISN A;  2ZJD A;  2HD5 B;  2RD0 A;  3NOB A;  3L0W B;  4NQK E;  3IHP C;  3L13 A;  4KZC A;  5JH5 C;  2MBE A;  3V61 A;  4BKS A;  2NVU I;  3A9K B;  2KDE B;  4MM3 A;  2MBQ A;  4II2 B;  4WJP A;  4ANW A;  2D10 A;  4IWO A;  4KZ0 A;  2DZI A;  2KDF B;  1J8C A;  1WXV A;  4MJS A;  2IO1 B;  1RAX A;  3S2A A;  3I3T B;  2W9N A;  2MCN B;  4B95 A;  4DHJ B;  2HE7 A;  4DWF A;  2KFJ A;  3PRZ A;  2K8B A;  5DPW A;  3Q3F A;  3LJ3 A;  3TCA A;  2MWS B;  4N9F 4;  4WJQ A;  4GU2 A;  4WJO A;  3TMP B;  3TJP A;  4F8C B;  2CHW A;  4OVV A;  2N9E B;  3RUI B;  4GOC A;  2RGF A;  3PRP B;  4XC2 A;  3EHV A;  4DHJ D;  2NS5 A;  4ICU A;  5E6P A;  3CF6 E;  1Q0W B;  2MRP A;  3UIO B;  4HVB A;  4DK5 A;  2LUE A;  4HJK A;  1UZX B;  3PRM B;  4K81 A;  1YQB A;  3HM6 X;  5D6J B;  4AOF A;  4DHZ E;  1Y8R C;  3PHX B;  3OJ4 B;  5LXI B;  2O6V A;  3WA0 A;  2NR2 A;  3L16 A;  1RRB A;  2L0F A;  3B1L X;  2FIF A;  3H1U A;  4ZRJ A;  4ZYN A;  5C1Z A;  3K9P B;  4M8N A;  3RD2 A;  1C3T A;  2IYD B;  2KZR A;  2MBO A;  3VFK A;  2K8H A;  4BFR A;  4WJN A;  3ZUN A;  3GOE A;  3PVL A;  1EO6 A;  3HIZ A;  1E5W A;  2C7M B;  2BYV E;  3L08 A;  4GGQ A;  2Z59 B;  3WAM A;  1I35 A;  3UIP B;  5L95 C;  2JT4 B;  3IG3 A;  3A9J A;  3BIN A;  1H4R A;  1E90 A;  2PJH A;  1WGY A;  5LLI A;  2A5U A;  2KXJ A;  2BYE A;  4GDL A;  2JVC A;  4W9D A;  4HDO A;  4IWP A;  2YVC A;  4JGH B;  4NAW A;  1OQY A;  2KOX A;  3NZS A;  1GUA B;  4XX5 A;  4BOZ B;  2ZVN A;  2ZPN A;  3QCA A;  1WMH B;  1YJ1 A;  3CMM B;  1YX5 B;  2KDB A;  2FCM A;  3DDC B;  3DBS A;  1V6E A;  1WX7 A;  2KNB A;  1WR6 E;  1UD7 A;  5CHV C;  3VTV A;  1V5T A;  4CHK A;  1D3Z A;  2LRU A;  2VRR B;  3R7Q A;  3VUW A;  1I42 A;  2DAJ A;  2OOB B;  3QIJ A;  1E7U A;  5DPS A;  1VCB A;  1P1A A;  4KSK C;  4LJO B;  3WAL A;  1V9J A;  2M0X A;  3QC8 B;  5D2M B;  3VH3 B;  3UQA A;  1OGW A;  2HJ8 A;  2K6D B;  3EFU A;  2KWV B;  1T0Y A;  2NBU A;  3RZF A;  1Z5S B;  2NCN A;  1LM8 B;  1WGD A;  2FUH B;  2IO3 B;  4FN2 A;  4W9K A;  2NBV B;  4GN1 A;  1WM3 A;  3MJW A;  2M8S A;  3H7S A;  2R2O A;  2D11 A;  2DYM A;  3UGB B;  1WZ0 A;  5AZH A;  3MTN B;  3DVN U;  4BOS C;  3IVF A;  2KAN A;  2I1J A;  3JW0 X;  4KIK B;  2GBJ A;  2KJ6 A;  2LJ5 A;  1YX6 B;  3N3K B;  2GBN A;  2AL6 A;  2PE6 B;  3LDZ E;  4P7I A;  3VUX A;  1EUV B;  2KDI A;  4TV3 A;  2O2V A;  2BF8 B;  1X1M A;  3PGE A;  2XBB C;  4HWI B;  4PYU A;  3B0A A;  2XEW A;  4ZRI A;  2D2Q A;  4JLC A;  1ZW7 A;  4FBJ B;  4NJ6 A;  2N7D A;  4PYZ A;  4ZRK A;  4W9E A;  4HLE A;  2L76 A;  3BY4 B;  3W1S C;  5JHB A;  4CO7 A;  4HPL B;  3VTU A;  2AL3 A;  5HKH A;  5J18 A;  4DXA B;  2EMS A;  1XD3 B;  2L00 B;  3PPA A;  4HCP B;  2BYF A;  3N32 A;  3L17 A;  1J19 A;  2KC1 A;  2MLB A;  1GNU A;  3AXC A;  1KM7 A;  3PLV A;  4RM8 A;  2N7E A;  2DAF A;  3KUC B;  1WZ3 A;  3KH0 A;  2LGY A;  3ZRF A;  1UEL A;  2EKE C;  3M3J A;  3WAO A;  5DCN A;  3RYT A;  1E8X A;  1WX9 A;  2JZ3 B;  4ZDV A;  2MP2 A;  2NPT A;  4II3 B;  4DHZ B;  4GIV A;  3A4S C;  1GC7 A;  2REX A;  3OLM D;  1Q1O A;  4JL9 A;  4XZ4 A;  2JY6 A;  1WY8 A;  2XK5 B;  3RCZ A;  4FAD A;  3ZKJ C;  2G4D B;  3V6C B;  2IY0 B;  1XQQ A;  2LGX A;  3AI5 A;  3VTW A;  4B9K A;  3A9K A;  1E8W A;  3VXW A;  1RLF A;  4AUQ C;  4ICV A;  2KLC A;  3NS8 A;  3ALB A;  1J0G A;  3ZW3 A;  1GJZ A;  3IFW B;  4EFO A;  3U30 A;  3L54 A;  1NI2 A;  3WAN A;  1V49 A;  1E8Z A;  2GOW A;  4EZL A;  2FCS A;  2KC2 A;  4MEL A;  4FJV B;  3H7P B;  2MBB B;  2CHX A;  1TBE A;  1ZGU B;  3PSE B;  4LCD E;  4OVU A;  4URK A;  1WJ6 A;  3OJ3 A;  2IBI B;  4K1R B;  3D32 A;  1CMX B;  4MGK E;  2FCQ A;  3SDL C;  3ZO5 B;  2FID A;  2UYZ B;  2I1K A;  4AWJ A;  4E3C A;  2MX2 A;  3QAR A;  2KJH B;  4GDK B;  2KFK B;  1WIA A;  1BT0 A;  1WGH A;  5G2N A;  2JRH A;  3ZDT A;  1R4M I;  2LZ6 A;  4PS3 A;  3JSV B;  3TIX A;  2IO0 B;  3KVF B;  3NHE B;  1KJT A;  3DVG Y;  1YIW A;  3HK0 A;  4G0N B;  2KMA A;  1L7Y A;  3PV1 A;  4NNJ B;  4A3P A;  3UIN B;  3ZNI D;  3AU4 A;  2WYQ A;  5KHO A;  4MEM A;  2BGF A;  3DBL I;  1IP9 A;  1WE7 A;  2KK8 A;  4IM0 A;  3VVW B;  4KV2 A;  2Z0E B;  4IWQ A;  5J2R A;  3C0R B;  4M0W B;  4WQO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...