4GDKA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdkA00
3IFWB 4ZDVA 4GOCA 3ZDTA 2AWTA 1MG8A 2C7HA 2DYBA 2BGFA 4G11A 2NPTA 4JLCA 4KV2A 5DPRA 3M62B 1I42A 1CMXB 2ZPYA 2LRWA 2ZVNA 5G55A 2KDFB 1PQSA 2NBWB 3U7DA 3DVGX 3KH0A 2DZKA 4G3XB 1WMHB 1KJTA 3DQVA 4LDTB 3AULA 4WQOB 3I3TB 5CTRC 2K8BA 1WYWB 2WX1A 3QWZB 4EKUA 3MJWA 4P7IA 2IYDB 3RT3B 5G2NA 4HPLB 3L17A 3JSVB 2CHWA 5E6PA 4ANUA 2EMSA 2L8JA 2JXXA 4HK2A 3APCA 4EZJA 2HTHA 2MQJA 4TQ1A 1LXDA 2N1WA 2BPSA 3ALBA 4IW0A 3ZRFA 1WGRA 4MGZE 4BOSC 1WY8A 1YIWA 3A9KB 4W9HA 4AOFA 1YX6B 2JRIB 1L2NA 2KQ7A 1WH3A 1OQYA 5J17A 4YL8A 2DAJA 3ZTCA 3UQBA 2GOWA 3ML8A 3ZW3A 5D94A 5E6OA 2JVCA 2KXJA 3SHQA 3ZDMC 1C1YB 2M17A 2D3GA 2NBVB 4IWPA 5DPTA 2O2VB 1WR6E 4RM8A 3TCAA 1GUAB 2Z0DB 4OVUA 1XQQA 2WWZA 1WXVA 5GMVA 3WIMA 4WJQA 2XK5A 1UGMA 2LWPA 1Y8RC 4BKGA 2Y5BB 3PT2B 3VUYA 3DPDA 3ZO5B 1WX8A 4CYEA 1RAXA 2ASQA 1VCBA 2KD0A 4MH0E 3M63B 3VVWB 4TQ0A 2LD9A 4GN1A 3MTNB 1WJ6A 1V6EA 4HLEA 2DENB 3PV1A 3M3JA 2J7QB 1V5OA 3HK0A 4HVBA 4A3PA 3JYUA 4PS3A 4BBNF 2PE6B 3X0WA 1WMHA 4FJYA 5J18A 1E8XA 1QZEA 1AARA 3AXCA 5DPWA 5EDSA 1X1MA 3K9PB 3NS8A 2G4DB 1GNUA 1E8WA 3JSVA 3OJ3A 3OJ4B 2KLGA 3PZDA 3UIOB 3QX1A 1SIFA 1TZ1A 3PPAA 2LASA 3KUDB 4WAAA 4B6WA 4TKNA 2NCNA 3ZVVA 2KC2A 1V80A 1KOTA 1LQBA 3BY4B 3A9KA 3L13A 4MSQB 2KX0A 3HM6X 4OVVA 4GGQA 4KIKB 2KJHB 4FJVB 3VXWA 3TL5A 2DHZA 4W9LA 2YLMA 3NY5A 3V6CB 4IM2A 1G6JA 2MBHA 3U30A 1P98A 2HE7A 2G3QB 2ZCBA 4GDKA 2FNJB 4NJ6A 4DDID 3B08A 2FAZA 1NI2A 3APFA 4BKTA 1WE6A 2MCNB 3V6EB 2L00B 3N32A 3VHTC 1IP9A 4WJOA 4KZCA 2I1JA 5IAAC 2V4LA 1WX7A 2N1VA 5DCNA 2N7DA 3V60A 1IPGA 4N9F4 2PJHA 3DCGA 2FIDA 4MGYE 4WWOA 4B9KA 1V49A 2XK5B 3L0WB 1KM7A 5FR6A 3VQIA 4DHZE 2KHWB 4LJPB 2EMTA 2L7RA 2PPHA 4M8MA 1WR1A 1WI0A 2K6QA 4BKSA 3DDCB 2MW5A 1E7VA 4HXDA 3H7PA 1E5WA 4DHJD 2LVPA 2V3SA 3M95A 4GDLA 2C7NB 3QAQA 3V62A 4IWOA 2MSED 1P0RA 4W9FA 4HDQA 3GZNI 1P9DU 5AZHA 2KFKA 2BF8B 2PEAA 3QK0A 1SE9A 2C9WB 4MM3A 2KTRB 3DVGY 2LVOA 1OTRB 1RLFA 4E74A 2KANA 4I6LB 1TTNA 2D07B 4I6PA 1WXSA 3R7RA 1ZW7A 2BKFA 3Q3FA 4GIVA 4AUQC 2CS4A 2MX2A 5CHWA 3DBLI 2D2QA 1V5TA 2ZZPB 2BKRB 2FCNA 3KYDD 2IO2B 2MBBB 3D32A 2JUOA 3UQAA 3IG3A 4ANXA 2EKEC 3SDLC 1WM3A 2KLCA 4IC7B 4KIKA 2KDBA 2D11A 3LDZE 3DBHI 2O6VA 3VTWA 2K39A 2IZVB 1S1QB 1E8YA 2IY0B 3L08A 3T8MA 3ZUNA 1E8ZA 3UGBB 4WJPA 4E3CA 4FADA 3KYCD 2CHZA 4HJKA 4DHZB 3TMPB 1RRBA 2DZIA 1GG3A 2C7MB 3SD5A 2JPHA 4W9KA 2JZ3B 4GDKB 4TV3A 1UBQA 4A20A 2K6DB 2KMCA 4WWNA 3JVZX 3NHEB 3R3MA 4M8NA 3WAPA 2OOBB 3ENEA 2IO3B 3HIZA 4I6NB 4ICUA 5D7GA 2A4ZA 2FCSA 2FUHB 3CSTA 2CHXA 2M0XA 2UWQA 1WGYA 2NR2A 3UIPB 2R2OA 1WIAA 2W9NA 3RZFA 2M1MA 2NS5A 3P2BA 4W9IA 2KKCA 4HCNB 2WYQA 2CKHB 1OEYA 1OGWA 2C5LC 2YVCA 4ZRKA 3X23A 3ONSA 2AL3A 4E71A 2ZVOA 4K81A 3WAMA 1P1AA 1E90A 3ZNZB 4ANVA 1WZ3A 2Z0EB 2IBIB 3H7PB 3PHXB 2DZMA 2GBJA 3VH4B 4GDLB 3IVFA 2ZEQA 4MSMB 1WRDB 2UYZB 2KTRA 2C60A 4GB9A 2D10A 1WGGA 3H9DA 1J19A 2LGXA 2M4NA 2KFKB 3DBRI 4HPMB 5L83A 4G0NB 3HM3A 4EFOA 2M8SA 4FJZA 1EF1A 5C23A 2N9EB 3A9JA 3DOWA 4NNJB 5L95C 1Q0WB 1WGHA 4AWJA 2K8HA 4FHJA 5HKHA 2KN5A 4ZRIA 3TJPA 2N9XA 3H1UA 1P3QU 1WF9A 1WXAA 1SGHA 2K25A 4LJOB 2GMIC 1J0GA 2K8CA 3L10B 4K7UA 2JWZA 4F7ZA 2CU1A 3R7QA 1E7UA 2O6VB 1EO6A 3RULA 3KUZA 1YD8U 2BYFA 3A33B 2KO3A 3PSEB 4GU2A 2LI5A 4KZ0A 5CHFA 3PREA 2MBEA 2Z59B 2VRRB 3H6NA 5LLIA 4FN2A 3IBEA 3OAWA 1R4MI 1WJ4A 2J0KA 1H8CA 4KSKC 4HDOA 1U4AA 2GBKA 4FHKA 2AYOB 3AI5A 2JY6A 4AP4C 2B3AA 3WANA 3NZSA 3VH3B 4G50A 2WX0A 3TBLD 2REXA 4NAWB 3UINB 2KVRA 4NY0A 2G4SA 3QCAA 2MP2B 2LXCA 3A1QA 4WJNA 2BYEA 3DBSA 2CR5A 1NDDA 2KWVB 2L0TA 4HCPB 3AU5A 2DAFA 5DPSA 2AL6A 4PYUA 3VTVA 2MBQA 5AEKB 3PRPB 4NQLB 4KDIC 4XX5A 4NJ7A 2XBBC 2JZZA 4J6IA 3VUXA 2JT4B 2RD0A 1ZKHA 1ZGUB 4ZRJA 3AU4A 1HE8A 1NBFC 4W9CA 2HD5B 4ANWA 3O65B 1XT9B 1C3TA 2KJ6A 2XEWA 2MBOA 2KDEB 1L7YA 3PRZA 2RR9A 3PGEA 4EOYA 3EHVA 3QHTA 3QARA 4NQKE 3WAOA 1WM2A 2I1KA 2BWFA 2JF5A 2MWSB 2J0JA 3A9JB 2LZ6A 3B0AA 3QA8A 1F9JA 1GC7A 1J8CA 1T0YA 2BWES 3A4RA 5CHVC 2LVQA 5JH5C 3ECIA 4BFRA 2L3ZA 3NOBA 1Z5SB 1TGZB 3RZWC 2FCMA 2K1FA 4KVGB 3RUIB 2LJ5A 3T9LA 3PVLA 3N3KB 2ZPNA 2KDIA 2WDTB 3VUWA 1EUVB 1UH6A 4W9GA 1LM8B 3W1SA 4FBJB 2N4FA 5LXHA 1UZXB 1D3ZA 2DYOA 3VDZA 1UD7A 1IYFA 1LFDA 2LUEA 2KJRA 1FXTB 4GSWA 4W9JA 1WFYA 4DDGD 3QJZA 4DBGA 3DVNV 5JZEB 2RPQA 2V1YA 2KFJA 4JIOU 1YQBA 2KWCA 2KOXA 3B1LX 3IHPC 2RGFA 1V9JA 2HJ8A 2KNBA 3DVNU 3PS6A 5JHAA 3C0RB 2KX3A 3R66C 3PHWB 2KMAA 1GC6A 4GXBA 4NAWA 2GBNA 3ZNHB 1WJUA 4NPNA 3ZTDA 1H4RA 1WX9A 3CMMB 2MP2A 4JL9A 4W9EA 4EZLA 4IG7B 4LDTD 1YJ1A 4ICVA 2A5UA 4URKA 2IO0B 4II3B 3A1QB 3UF8A 4II2B 1V86A 1YX5B 4GMVA 4JGHB 3QIJA 3W1SC 4F1SA 5KHOA 1I35A 2KC1A 4FULA 2ZNVC 3PLVA 4PYZA 4XC2A 1Q1OA 3U8ZA 4EZKA 3KW5B 2PE9A 3SU8X 2IY1B 4LCDE 4X57B 4HWIB 3VTUA 3ZNID 1Q5WB 4K7SA 4PS8A 4IUMB 1XD3B 4RMAA 4B95A 4PS7A 2DZJA 2NBUA 4K7WA 3NZUA 1BT0A 3QC8B 4A3OA 3L54A 3KVFB 4DWFA 5LXIB 2KZRA 1TBEA 4EEWA 4FA6A 2LGDA 3V61A 1A5RA 3RD2A 3BINA 1S3SG 4MJSB 2L0FA 4IWQA 4KDLB 4BVUC 4M0WB 5J2RA 4FLHA 3H7SA 4CO7A 2NPTB 1WXMA 3Q3JA 5JHBA 4CHKA 3CF6E 5KHQA 3ZNGC 2FCQA 3N30A 4KSLC 3ZLZA 4DXAB 4AJYB 4ZYNA 1V2YA 3OLMD 2LXAA 5D6JB 5IA7A 4WWPA 5BO4B 2KK8A 1M94A 3K9OB 4K1RB 4ASWC 3PTFC 2MRPA 3RYTA 5E6NA 1Z2MA 1RFAA 2RSUA 5CX3A 1UELA 2ZCCA 2J0MA 3ZRCA 1V81A 2ZJDA 5D2MB 4RM9A 4DHJB 2ZNVB 2LRUA 4BKSD 4TUUA 4EUTA 4DK5A 2IO1B 2N7EA 1KLVA 1R4NI 1OEYJ 2OJRA 1WZ0A 1ISNA 4JQWC 2L05A 3WALA 3JW0X 2JRHA 3L16A 3A4SC 3RCZA 3EC8A 4MELA 3APDA 1WJNA 4IM0A 5AZGA 3ZIMA 4F8CB 1WE7A 2NVUI 1GJZA 2KWUB 3WA0A 1WGDA 4XZ4A 3PLUA 3VFKA 3ZKJC 3TIXA 1VD2A 2N9PC 3MHSD 4MGIE 2FIFA 2KQSA 2O2VA 3ML9A 3HHMA 1JRUA 2DYMA 2G45B 2L76A 5C1ZA 1EF5A 2MA9B 3PRMB 3VAWA 2QHOA 1K8RB 4MEMA 2GBRA 2LGYA 2MLBA 3S2AA 3EECA 4MGKE 5AZFA 2R2QA 4IM3A 3KUCB 2DX5B 4AJWA 4BOZB 3QQ8B 2O6VD 3CSFA 3W1YA 2GBMA 3GOEA 2KTFA 2AEHA 4BBNC 3LJ3A 4MDKE 1UBIA 2BYVE 4W9DA 4MJSA 3EFUA 5TR5A
chains in the Genus database with same CATH superfamily
3IFWB 4M0WA 4ZDVA 1KLUD 5DPRA 2BS4B 2BGFA 4KV2A 1C9FA 1YQ4B 3U52E 4RF0A 1C78A 2DZKA 1WMHB 3EFCA 1SE3A 3BK2A 3DQVA 3AULA 4WQOB 4P7IA 1ZXIA 4HPLB 3L17A 3JSVB 4LK0M 3E9SA 2L8JA 1SE4A 4EZJA 4TQ1A 1VZ8A 1EWYC 2BPSA 1QKZA 1YX6B 2JRIB 2KQ7A 1WH3A 4YL8A 5E6OA 3TEWA 5H8YE 2M17A 2NBVB 5DPTA 1HQRD 2O2VB 1N62A 5HG2A 3PO0A 1GUAB 4WJQA 4XE0A 4B0MA 2Y5BB 4CYEA 3M63B 1T3QA 1WWTA 4H2AA 4P16A 1XLQA 3M3JA 1JWUD 1WMHA 1DOXA 4R3DA 1AARA 3HVZA 1J7CA 1E8WA 3JSVA 3OJ4B 3UIOB 5I4DA 5IP4D 1SIFA 4P1BC 2CJOA 4OW0A 1JRPA 2LASA 1YN3A 4B6WA 1NEKB 4OVVA 2KVZA 4W9LA 2WU2B 3RN9C 2SAKA 2HE7A 5G5HA 1FXAA 4NJ6A 1QT9A 3RNEC 3AE4B 1ET9A 4BKTA 4KKJA 1MPEA 2M19A 4KZCA 2I1JA 1OFFA 1IPGA 4N9F4 3KWVA 2FIDA 3P63A 2XK5B 1KM7A 3VQIA 1MHHE 4XYCA 2PPHA 1C4AA 2PTLA 3DDCB 2MW5A 1F2RC 4RNAA 3H7PA 1FMAD 4HKZE 4GDLA 3R8BA 4IWOA 2MSED 2G9HD 3GZNI 1P9DU 4BAXA 5BMGA 2BF8B 2KTRB 2WP9B 4I6LB 1TTNA 3R7RA 1JMLA 2BKFA 4ARCA 5CHWA 2BKRB 5BYQA 2IO2B 3Q8EA 2MBBB 3D32A 3UQAA 1WM3A 3MC9A 3DBHI 3FAHA 2K39A 3L08A 3T8MA 1JWBD 1E8ZA 1I4QA 4E3CA 4DHZB 1RRBA 1GG3A 4L2YA 4GDKB 4TV3A 1GB4A 4K3BA 3WAPA 3CWIA 3AM9A 3HIZA 1T6BX 2A4ZA 3CSTA 4YT0B 1L4ZB 2LMCA 3RZFA 3P2BA 2NS5A 4W9IA 4HCNB 1FIQA 2CKHB 2C5LC 3ONSA 2L32A 2AL3A 3BYYB 4ANVA 1STEA 2DZMA 3VH4B 1V1OA 4MSMB 4XDCA 2KTRA 4GB9A 3H9DA 2M4NA 4HPMB 1XCTL 3T3NA 4FJZA 5C23A 3FC4A 5L95C 1OQRA 2K8HA 1PDXA 1D5XC 3H1UA 1WF9A 5EE3A 3IAS1 2K25A 1D4BA 4LTUA 1MFWA 4F7ZA 2WNMA 3R7QA 2TSSA 1EO6A 1YN5A 3NRZA 1L0XB 4XWTA 1YD8U 2BYFA 3A33B 2KO3A 2LI5A 2Y5PA 4KZ0A 4AQ7A 2MBEA 3H6NA 3ABVB 5LLIA 2BW2A 4OZAA 3RPFC 1WJ4A 2WXLA 4KSKC 2XN9C 2WXRA 4FHKA 2JY6A 4AP4C 5HFYA 3QCAA 1FRDA 3DBSA 2KWVB 4CQNA 2L0TA 3AU5A 2AL6A 2MBQA 1YNTE 1E9MA 1IGDA 4LNFA 4NJ7A 2KDMA 5FKAC 3VUXA 1ZKHA 1NBFC 2HD5B 2KJ6A 5TSSA 1L7YA 1MJDA 3BYTB 3PGEA 1XCQL 1EM7A 2WXJA 3EHVA 3QHTA 2BS2B 2IDYA 3QA8A 5AUKA 3AE9B 1GC7A 1FFUA 4Q2JA 1FCCC 3A4RA 2FE8A 3ECIA 1R4NB 1SEBD 3RUIB 3N3KB 2ZPNA 2NTSA 3LB8C 2WDTB 4RH6A 4W9GA 3W1SA 2VZKD 1YJIA 1UZXB 1SE2A 1XLOA 3RNFC 2DYOA 3VDZA 1LFDA 4XDDA 3URYA 4DBGA 2RPQA 2V1YA 1JALA 2KNBA 2HJ8A 3I63C 3DVNU 1JWSD 3HRDD 3AECB 2DNFA 3C0RB 2KX3A 4GXBA 2GBNA 1WXQA 3AB5A 1H4RA 1WX9A 4NPNA 3W9CB 4W9EA 4EZLA 2HDEA 3BK1A 2D3AA 2QEJC 4II3B 1FFVA 3A1QB 1V86A 4JGHB 3W1SC 4F1SA 5KHOA 2KC1A 4FULA 1T5XD 3U8ZA 4EZKA 2PE9A 1FXIA 2IY1B 4X57B 4TMAB 3ZNID 4PS8A 4ZHOA 3GZNB 3AE3B 4B95A 4PS7A 2DZJA 4A3OA 3NZUA 3L54A 3B2FA 2WXIA 1YOVB 4DWFA 5LXIB 3AEAB 4K3CA 2V3PA 3RD2A 4JPSA 4WIPA 1S3SG 4IWQA 4KDLB 1EU3A 4CO7A 2NPTB 3Q3JA 4CHKA 2FCQA 1VRAB 4DXAB 4AJYB 1QOAA 3OLMD 5D6JB 2KACA 1TKGA 1WGKA 3DBHB 1R7SA 5BO4B 4ASWC 4B0EA 2PLPA 2MJEA 3PTFC 5E6NA 2E6XA 4ITKA 1UELA 3MJ5A 2ZJDA 4IDIA 1I4PA 4RM9A 2BVCA 2W3SA 2OJRA 1ISNA 3GE3C 4JQWC 3WALA 3NJTA 3A4SC 1WJNA 4UDUC 3ZIMA 1F2RI 1WE7A 1GJZA 1KTKA 4XZ4A 2JQRB 1YQ3B 1VD2A 5T8IA 4ZYSA 1FO4A 2D5GA 2GRIA 2G45B 5C1ZA 4L1BA 4HROA 5EE9A 1ZPSA 3S2AA 2DX5B 3VR9B 2O6VD 2AEHA 4W9DA 1UBIA 1ZXHA 5TR5A 2C7HA 4G11A 2NPTA 4JLCA 3M62B 1I42A 1CMXB 1MG4A 2ZVNA 5G55A 2NBWB 2Q5WD 3NUHB 3I3TB 5CTRC 1UWXA 3QWZB 3Q8BA 2IYDB 3RT3B 3P4RB 1AN8A 4ANUA 3APCA 1K51A 4YSZB 3ZRFA 2KT7A 3C19A 2AQ2B 2ONQA 4W9HA 1PGAA 2KWDA 4ZHPA 3UQBA 2GOWA 3ML8A 1V1PB 5D94A 3AE8B 2INCC 2JVCA 1FPYA 1RYJA 3T3OA 2D3GA 1FEHA 5D3IB 1MHXA 2H89B 3TCAA 1PUTA 4OVUA 1XQQA 2WWZA 2WXNA 1UGMA 4BKGA 3DPDA 3I5JC 1SBBB 2ASQA 3VVWB 2YEPF 1D5ZC 1TYGB 1V6EA 4HLEA 1NENB 3JYUA 1C4CA 2PE6B 3X0WA 4FJYA 5J18A 3AXCA 1SJED 2G4DB 3R2TA 2KLGA 2N7JA 3PPAA 2NCNA 3ZVVA 1KOTA 1V80A 1LQBA 1ZOYB 4KGTA 1F1HA 2HTME 3L13A 4N59A 4ZRQA 4FJVB 2L1AA 3SFDB 2DHZA 3VXWA 1V1PA 2G3QB 1TIFA 2K3UA 3PZ8A 1WE6A 2MCNB 3V6EB 3VHTC 2WXFA 2LJIA 5IAAC 1WX7A 2N1VA 5DCNA 2OEDA 4WWOA 1V49A 1YMHE 4LJPB 4M8MA 1WR1A 5D3DA 1J7BA 1E5WA 1EU4A 2RDBC 2CJNA 2V3SA 3DHIC 2QIEB 3VRAB 2BYTA 3DWMA 3MC0B 3DVGY 4E74A 2KAJA 1RM6C 1UGJA 3AEEB 4I6PA 1WXSA 4AUQC 2CS4A 2MX2A 2SEBD 2D2QA 1V5TA 2ZZPB 4JWUC 2WHIA 4ANXA 3B2GA 4IC7B 2O6VA 2IZVB 2VH2A 4OVZA 4P6VF 3UGBB 4FADA 3KYCD 3P4PB 3TMPB 1UNSA 1NYQA 2C7MB 4A20A 2K6DB 1T0QC 3JVZX 1ESFA 4ICUA 3AV8A 4P1CC 2R2OA 2FBWB 4ZRKA 4PK1A 4RF1A 4E71A 1P1AA 4M02A 3ZNZB 3RNCC 1WZ3A 2Z0EB 2IBIB 3H7PB 1M4VA 2GBJA 3IT4B 4GDLB 3V3XA 1WRDB 2C60A 3ZXRA 1J19A 3DBRI 5L83A 4G0NB 4RGMA 2M8SA 1TY0A 3KQ4A 3TEXA 1SSNA 1MVKA 1B9RA 2W82A 4LNKA 4FHJA 1HTQA 2JSVX 4RCOA 1J0GA 1PGXA 2CU1A 4BZAA 4XWWA 3TSSA 4GU2A 3PSEB 3NVZA 3PREA 4AS1A 2Z59B 4OZBA 1A70A 4KX6B 3IBEA 3OAWA 3GB1A 4HDOA 3AI5A 3FKYA 2B3AA 3WANA 3VH3B 4G50A 4LNIA 3BVZA 2K5PA 2LXCA 4WJNA 2BYEA 1NDDA 3AH7A 3AE2B 5DPSA 1QQRA 1XXGA 3PRPB 4NQLB 2NTTA 4XX5A 1TJEA 2XBBC 2JZZA 2Z8LA 5EE1A 1ZGUB 4ZRJA 1HE8A 4HPPA 1C76A 2KDEB 1CZPA 2LUMA 1WM2A 2JF5A 2MWSB 2J0JA 2LZ6A 2NMQA 1L4DB 1BXTA 1F9JA 3V05A 1TS5A 4N6EB 2BWES 2L3ZA 1Z5SB 1TGZB 2Y5CA 4KVGB 2LJ5A 2X38A 3W5VB 1KRHA 2N4FA 5LXHA 1D3ZA 1UD7A 2KJRA 1FXTB 2PVOD 4YTNB 1YQBA 4YWGG 2RGFA 3PS6A 1V9JA 1I4HA 5FK9C 2DBYA 2V0GA 2KMAA 1JQ4A 1D6EC 4IG7B 4LDTD 1I7HA 1YJ1A 2WXQA 3RNBC 4ICVA 2IO0B 4GMVA 3AE7B 3QIJA 3PLVA 1YJJA 2LEKA 3KW5B 3SU8X 1Q5WB 1PGBA 2NBUA 3BWUD 4K7WA 1BT0A 3KVFB 4FA6A 2LGDA 3V61A 3GS2A 2N0SB 4FLHA 1JWMD 3H7SA 1WXMA 1K50A 3N30A 4KSLC 2JYEA 2LXAA 5IA7A 4WWPA 1E7PB 3K9OB 4K1RB 2MRPA 1Z2MA 2J0MA 1V81A 4ARIA 2BS3B 3ZJVA 4BKSD 1TZOA 3BIID 2N7EA 1NI3A 2E3TA 3NZ3A 1B1ZA 2L05A 2WU5B 3L16A 4MELA 1T0SC 1GB1A 3FILB 2NVUI 1HZ6A 3VFKA 3TIXA 2N9KA 3MHSD 2FIFA 3HHMA 1JRUA 2DYMA 1FNWA 2QC8A 3PRMB 4O1NA 2QHOA 3VAWA 4REZA 2R2QA 2GB1A 3RFZB 1QOFA 3DBRB 1UF0A 5HI1A 4MDKE 2BYVE 3EFUA 4F8CB 4GOCA 3Q8CA 3V62A 1MG8A 2DYBA 3WCQA 2ZPYA 4WH4A 1L0YB 1PQSA 1KF6B 2M56B 4KGRA 3KH0A 2LFIA 4G3XB 1KJTA 4LDTB 2K8BA 3U7ZA 2RPVA 2L52A 5G2NA 2CHWA 2EMSA 2HTHA 2MQJA 4J3OD 2N1WA 3ALBA 1VDVA 1WGRA 5LNK1 4NZLB 4BOSC 3A9KB 2D3BA 3FILA 3Q2AC 3AN1A 1OQYA 5FR3A 1NVID 3ZW3A 1DOIA 2KXJA 3SHQA 3Q3MC 1FM0D 1C1YB 1FCLA 1WR6E 4RM8A 4C7YA 3WIMA 2IGGA 3VUYA 2M0AA 2PVGC 3ZO5B 1WX8A 3ZGZA 1RAXA 1VCBA 2KD0A 2QSDA 4MH0E 2LD9A 4GN1A 1FRRA 3PV1A 2J7QB 3HK0A 2QJLA 3NG0A 4PS3A 1E8XA 1QZEA 1TKYA 1Y56A 5DPWA 2WXGA 3P4QB 3NS8A 3K9PB 3RNAC 3OJ3A 1TZ1A 3KUDB 1L6VA 2KC2A 3BY4B 3A9KA 4US8A 1K53A 5IOIA 3TL5A 2YLMA 3NY5A 3V6CB 4IM2A 1G6JA 3U30A 1P98A 2WDVB 2FNJB 3W5UB 1UWMA 3APFA 2QMTA 4WAFA 1WSPA 2W55A 4MGYE 3P4SB 3L0WB 5FR6A 1TKEA 2KHWB 2VZKB 2EMTA 2L7RA 1AWDA 1WI0A 2K6QA 4BKSA 4IKGA 1SXTA 3DHGC 3ZJUA 4HXDA 4DHJD 2LVPA 3TEZA 2EELA 3M95A 4EE2A 2C7NB 4WURA 4HDQA 3H8HA 5AZHA 2KFKA 3QK0A 1SE9A 1IBXA 1HEZE 2C9WB 4D2KA 4MM3A 1OTRB 1RLFA 2KANA 1ZW7A 4GIVA 4A55A 3DBLI 2FCNA 3KYDD 3EGRA 5JXVA 3I9V1 2JUOA 3SDLC 2KLCA 3MC8A 2KDBA 2D11A 2J42A 3LDZE 1WYGA 5G5GA 1S1QB 1E8YA 4YSXB 5AUIA 2CHZA 4HJKA 4ACFA 3SR6A 4C4VB 2JPHA 4W9KA 4NAMA 4WWNA 1VLBA 3N1YC 4M8NA 2INNE 4S17A 4I6NB 4QAYA 5D7GA 2FCSA 1NYRA 3ETRA 2M0XA 3RNGC 1KH0A 1DOYA 3P1MA 1XO3A 2W9NA 2M1MA 2HJ1A 2KKCA 1E6EB 3VRBB 1OEYA 3IXSA 3X23A 2ZVOA 3ZQ4A 1D5MC 3WAMA 1E90A 2JU6X 3ZYYX 3IVFA 2ZEQA 2VH1A 2D10A 2LGXA 4RGOS 3HM3A 1HZ5A 1EF1A 3O13A 2N9EB 3A9JA 4NNJB 1JCKB 1Q0WB 4AWJA 1TS2A 1I4GA 3TJPA 1DYQA 2INDC 3DHHC 1WXAA 2WXPA 1SGHA 2GMIC 2OHFA 3L10B 1QILA 2JWZA 4K7UA 3IAM1 3ZXVA 1E7UA 2O6VB 4C4VA 3U2SC 5CHFA 1SF0A 4YSYB 2QCZA 1VJKA 2PIAA 1R4MI 2J0KA 1H8CA 1U4AA 3J9CA 1FD6A 2BB5A 3TBLD 1L0VB 2REXA 2JWUA 3UINB 2G4SA 3OWEB 2MP2B 3Q14C 3E56A 3LYYA 3P42A 4A90A 4HCPB 2DAFA 3VTVA 2JXTA 3CIRB 1ZDVA 4KDIC 3Q8AA 3UI3A 1BUIC 4J6IA 2RD0A 1TY2A 3AU4A 1XT9B 3EA6A 3IT6B 3AE6B 2MBOA 1TS4A 1ROEA 2KMMA 1ET6A 1HTOA 3WAOA 5IKCM 5BMIA 1C4PA 2BWFA 4FXCA 1JWAD 1VZ6A 4XGAB 1J8CA 1T0YA 2LVQA 2H88B 3Q3NC 4BFRA 1LO5D 2EKIA 3NOBA 1P7FA 2FCMA 2K1FA 4MACA 3AE1B 4USAA 3T9LA 1ENFA 2KDIA 2I2YA 4HKQA 1LM8B 3BZDB 4MT5A 1IYFA 2LUEA 4W9JA 4GSWA 1WFYA 3QJZA 1TS3A 2KFJA 3N1ZC 3GP7A 4JIOU 5MPOA 2BT6A 2JYTA 3IHPC 2KOXA 2QDFA 2JZPA 1T0RC 3ZTDA 2MP2A 2IPKD 2V4IB 4A8XC 2A5UA 4URKA 4RGTA 4II2B 1YX5B 1IGCA 2RMMA 1I35A 1SB3C 2ZNVC 4XC2A 1Q1OA 2MHJA 3VTUA 4K7SA 4IUMB 1CQVA 2J52A 1TBEA 5BMHA 3BINA 1AYFA 4MJSB 2N9LA 5J2RA 3DBLB 3PZ7A 5KHQA 3ZNGC 4ZOHC 4ZYNA 1V2YA 4OZCA 2KK8A 1M94A 2LGSA 2WQYB 1RWSA 3ZRCA 2ZCCA 3N20C 1MI0A 2BB6A 1Q10A 4EUTA 2IO1B 1R4NI 1OEYJ 1WZ0A 1F52A 1LGRA 2LGIA 3JW0X 3OG5A 4OHJA 3AMZA 3RCZA 3EC8A 1EWCA 3APDA 2BBCA 2J4XA 4IM0A 3KLSX 2K0PA 1K52A 3PLUA 2N9PC 5HHDG 2KQSA 2O2VA 3ML9A 3W2DA 2L76A 1KLGD 1EF5A 1K8RB 4MEMA 2LGYA 3RMKC 4MGKE 5AZFA 4IM3A 2AX5A 3KUCB 3GE8C 4AJWA 4BOZB 4DXGA 2IGHA 1V97A 3QQ8B 1BMLC 3CSFA 1PYWD 2GBMA 2KTFA 3LXFA 4MJSA 1IUEA 3ZDTA 2AWTA 2LRWA 4RGNA 2KDFB 2INPE 2K9XA 1N60A 3U7DA 4ZRPA 2UU7A 3DVGX 3C8YA 2WXKA 2AQ3B 1WYWB 2WX1A 4EKUA 3MJWA 2W54A 2WXOA 2WLBA 5E6PA 2JXXA 2YEPB 4HK2A 1LXDA 1R4MB 4IW0A 4MGZE 4HRSA 1WY8A 1YIWA 4AOFA 2MH7A 4TSSA 1L2NA 2L83A 3AEDB 1FNUA 5J17A 2DAJA 3ZTCA 4GLSC 1E10A 3ZDMC 3R2IA 4N58A 4IWPA 1QF6A 2V9HA 2WDRB 4L23A 2LHDA 4LNNA 2Z0DB 2WGSA 4YTPB 1WXVA 2GI9A 5GMVA 1XEEA 2XK5A 3B9JA 2LWPA 1Y8RC 4M00A 3PT2B 4YTMB 1HXYD 1UUPA 4TQ0A 3MTNB 1WJ6A 2DENB 1V5OA 4HVBA 4A3PA 4BBNF 2CU3A 2V3NA 1JROA 3BVMA 5EDSA 1X1MA 1N5WA 1GNUA 4WQMA 4C7ZA 3PZDA 3QX1A 3Q8FA 2BTEA 4WAAA 4TKNA 3NVYA 1N61A 2WS3B 4MSQB 2KX0A 3HM6X 3MFGA 4GGQA 4KIKB 2KJHB 3L4PA 1ZP0B 2MBHA 2ZCBA 4GDKA 2JX5A 1KFYB 2ZW0A 5BYSA 1AW7A 4DDID 3B08A 2FAZA 1NI2A 2ON8A 2L00B 3RI7C 3N32A 5C2TB 1IP9A 4WJOA 2RDHA 1CK1A 2V4LA 2WDQB 4LNOA 2N7DA 3V60A 2PJHA 3VR8B 3DCGA 1N6ZA 4B9KA 4DHZE 4HJGE 3NS1A 1I4XA 4IOIE 1XLPA 2K22A 1E7VA 1L5PA 2WXHA 1FNVA 3QAQA 1P0RA 4W9FA 2PEAA 1VR9A 1N63A 2RDGA 2LVOA 2D07B 4RFBA 3Q3FA 1P7EA 1PFDA 4WWMA 4C56C 3BVGA 2IGDA 3KWLA 3IG3A 2EKEC 2KN4A 4KIKA 3VTWA 2IY0B 2XNAC 3ZUNA 1CJEA 4WJPA 1XLNA 2DZIA 3SD5A 2JZ3B 1L6UA 1UBQA 2KMCA 1ZDXA 3MP9A 3NHEB 3R3MA 3N1XC 2OOBB 3ENEA 2IO3B 3Q6BA 2FUHB 2CHXA 4A9AA 5EE0A 2UWQA 1WGYA 2NR2A 3UIPB 5E6JA 1WIAA 2WYQA 1OGWA 2YVCA 4K81A 1YN4A 3PHXB 2MJ3A 3N9YC 2UYZB 1WGGA 2KFKB 2PW9A 1IBXB 4EFOA 4MM3B 3HVDA 3DOWA 3U4EG 1WGHA 1RFKA 5HKHA 2J53A 1J7AA 2KN5A 4ZRIA 4A6QA 2N9XA 2DWQA 1P3QU 4LJOB 3HUIA 2K8CA 3DWGC 3RULA 3KUZA 3AEGB 4YXDB 2VRRB 5IO9A 4FN2A 2GBKA 2AYOB 2Y3AA 3SEBA 3NZSA 2WX0A 4NAWB 4KKIA 2KVRA 4NY0A 3Q69A 3A1QA 2I38A 4US9A 2CR5A 1ZUD2 4HEA1 4DXFA 4PYUA 4C80A 5AEKB 3Q3OC 1QOGA 1N5XA 4C00A 3ZJTA 1C77A 2D3CA 2JT4B 4ANWA 1C3TA 4W9CA 5C3JB 4M01A 3O65B 1GPXA 1DGJA 2XEWA 2BQQA 2X8XX 3PRZA 5IN7A 2RR9A 4JWSC 1SIJA 2IJ0A 4EOYA 3QARA 4NQKE 3NVWA 2I1KA 3A9JB 3B0AA 2B76B 2MEKA 5CHVC 5JH5C 3RZWC 1HA5A 2ICIA 3PVLA 3VUWA 1EUVB 1XF5L 1UH6A 4FBJB 3AE5B 1QLBB 4JE3B 1GAQB 2QILA 4DDGD 3DVNV 1F77A 5JZEB 1ACCA 2KWCA 3B1LX 5JHAA 3R66C 3PHWB 1GC6A 3I57A 4NAWA 3ZNHB 1WJUA 4KGSA 3CMMB 4JL9A 2AQ1B 3EUB2 3MHZA 3UF8A 5H92C 4LLGM 4PT5A 3TEYA 2OJWA 2R61A 4PYZA 3AEBB 4DQOC 4LCDE 4HWIB 1XD3B 3AEFB 4RMAA 3QC8B 1I4RA 3TUOA 2KZRA 3NVVA 4EEWA 2ZW1A 5BYRA 1A5RA 2DLBA 1GOZA 1V8CA 2L0FA 1WRIA 4BVUC 4M0WB 1TT5B 2PKOA 2KYWA 5JHBA 3CF6E 3SFEB 2ACZB 3ZLZA 1OQQA 1VZ7A 2PMVA 1JW9D 3RYTA 1RFAA 2RSUA 5CX3A 5D2MB 4DHJB 2LHEA 2ZNVB 4JX1C 2GLSA 2LRUA 4TUUA 4DK5A 1KLVA 2W3RA 5GXGB 1F0ZA 2JRHA 4MH8A 5AZGA 2KQ4X 2KWUB 3WA0A 1WGDA 3ZKJC 4MGIE 1E0ZA 1C79A 2G1EA 2MA9B 1QOBA 4S0RA 2GBRA 1SJHD 2MLBA 2WXMA 3EECA 2MJDA 2FUG1 3W1YA 1ZE3D 3GOEA 4BBNC 3LJ3A 4NJCA
chains in the Genus database with same CATH topology
3IFWB 4ZDVA 4GOCA 3ZDTA 2AWTA 1MG8A 2C7HA 2DYBA 2BGFA 4G11A 2NPTA 4JLCA 4KV2A 5DPRA 3M62B 1I42A 1CMXB 2ZPYA 2LRWA 2ZVNA 5G55A 2KDFB 1PQSA 2NBWB 3U7DA 3DVGX 3KH0A 2DZKA 4G3XB 1WMHB 1KJTA 3DQVA 4LDTB 3AULA 4WQOB 3I3TB 5CTRC 2K8BA 1WYWB 2WX1A 3QWZB 4EKUA 3MJWA 4P7IA 2IYDB 3RT3B 5G2NA 4HPLB 3L17A 3JSVB 2CHWA 5E6PA 4ANUA 2EMSA 2L8JA 2JXXA 4HK2A 3APCA 4EZJA 2HTHA 2MQJA 4TQ1A 1LXDA 2N1WA 2BPSA 3ALBA 4IW0A 3ZRFA 1WGRA 4MGZE 4BOSC 1WY8A 1YIWA 3A9KB 4W9HA 4AOFA 1YX6B 2JRIB 1L2NA 2KQ7A 1WH3A 1OQYA 5J17A 4YL8A 2DAJA 3ZTCA 3UQBA 2GOWA 3ML8A 3ZW3A 5D94A 5E6OA 2JVCA 2KXJA 3SHQA 3ZDMC 1C1YB 2M17A 2D3GA 2NBVB 4IWPA 5DPTA 2O2VB 1WR6E 4RM8A 3TCAA 1GUAB 2Z0DB 4OVUA 1XQQA 2WWZA 1WXVA 5GMVA 3WIMA 4WJQA 2XK5A 1UGMA 2LWPA 1Y8RC 4BKGA 2Y5BB 3PT2B 3VUYA 3DPDA 3ZO5B 1WX8A 4CYEA 1RAXA 2ASQA 1VCBA 2KD0A 4MH0E 3M63B 3VVWB 4TQ0A 2LD9A 4GN1A 3MTNB 1WJ6A 1V6EA 4HLEA 2DENB 3PV1A 3M3JA 2J7QB 1V5OA 3HK0A 4HVBA 4A3PA 3JYUA 4PS3A 4BBNF 2PE6B 3X0WA 1WMHA 4FJYA 5J18A 1E8XA 1QZEA 1AARA 3AXCA 5DPWA 5EDSA 1X1MA 3K9PB 3NS8A 2G4DB 1GNUA 1E8WA 3JSVA 3OJ3A 3OJ4B 2KLGA 3PZDA 3UIOB 3QX1A 1SIFA 1TZ1A 3PPAA 2LASA 3KUDB 4WAAA 4B6WA 4TKNA 2NCNA 3ZVVA 2KC2A 1V80A 1KOTA 1LQBA 3BY4B 3A9KA 3L13A 4MSQB 2KX0A 3HM6X 4OVVA 4GGQA 4KIKB 2KJHB 4FJVB 3VXWA 3TL5A 2DHZA 4W9LA 2YLMA 3NY5A 3V6CB 4IM2A 1G6JA 2MBHA 3U30A 1P98A 2HE7A 2G3QB 2ZCBA 4GDKA 2FNJB 4NJ6A 4DDID 3B08A 2FAZA 1NI2A 3APFA 4BKTA 1WE6A 2MCNB 3V6EB 2L00B 3N32A 3VHTC 1IP9A 4WJOA 4KZCA 2I1JA 5IAAC 2V4LA 1WX7A 2N1VA 5DCNA 2N7DA 3V60A 1IPGA 4N9F4 2PJHA 3DCGA 2FIDA 4MGYE 4WWOA 4B9KA 1V49A 2XK5B 3L0WB 1KM7A 5FR6A 3VQIA 4DHZE 2KHWB 4LJPB 2EMTA 2L7RA 2PPHA 4M8MA 1WR1A 1WI0A 2K6QA 4BKSA 3DDCB 2MW5A 1E7VA 4HXDA 3H7PA 1E5WA 4DHJD 2LVPA 2V3SA 3M95A 4GDLA 2C7NB 3QAQA 3V62A 4IWOA 2MSED 1P0RA 4W9FA 4HDQA 3GZNI 1P9DU 5AZHA 2KFKA 2BF8B 2PEAA 3QK0A 1SE9A 2C9WB 4MM3A 2KTRB 3DVGY 2LVOA 1OTRB 1RLFA 4E74A 2KANA 4I6LB 1TTNA 2D07B 4I6PA 1WXSA 3R7RA 1ZW7A 2BKFA 3Q3FA 4GIVA 4AUQC 2CS4A 2MX2A 5CHWA 3DBLI 2D2QA 1V5TA 2ZZPB 2BKRB 2FCNA 3KYDD 2IO2B 2MBBB 3D32A 2JUOA 3UQAA 3IG3A 4ANXA 2EKEC 3SDLC 1WM3A 2KLCA 4IC7B 4KIKA 2KDBA 2D11A 3LDZE 3DBHI 2O6VA 3VTWA 2K39A 2IZVB 1S1QB 1E8YA 2IY0B 3L08A 3T8MA 3ZUNA 1E8ZA 3UGBB 4WJPA 4E3CA 4FADA 3KYCD 2CHZA 4HJKA 4DHZB 3TMPB 1RRBA 2DZIA 1GG3A 2C7MB 3SD5A 2JPHA 4W9KA 2JZ3B 4GDKB 4TV3A 1UBQA 4A20A 2K6DB 2KMCA 4WWNA 3JVZX 3NHEB 3R3MA 4M8NA 3WAPA 2OOBB 3ENEA 2IO3B 3HIZA 4I6NB 4ICUA 5D7GA 2A4ZA 2FCSA 2FUHB 3CSTA 2CHXA 2M0XA 2UWQA 1WGYA 2NR2A 3UIPB 2R2OA 1WIAA 2W9NA 3RZFA 2M1MA 2NS5A 3P2BA 4W9IA 2KKCA 4HCNB 2WYQA 2CKHB 1OEYA 1OGWA 2C5LC 2YVCA 4ZRKA 3X23A 3ONSA 2AL3A 4E71A 2ZVOA 4K81A 3WAMA 1P1AA 1E90A 3ZNZB 4ANVA 1WZ3A 2Z0EB 2IBIB 3H7PB 3PHXB 2DZMA 2GBJA 3VH4B 4GDLB 3IVFA 2ZEQA 4MSMB 1WRDB 2UYZB 2KTRA 2C60A 4GB9A 2D10A 1WGGA 3H9DA 1J19A 2LGXA 2M4NA 2KFKB 3DBRI 4HPMB 5L83A 4G0NB 3HM3A 4EFOA 2M8SA 4FJZA 1EF1A 5C23A 2N9EB 3A9JA 3DOWA 4NNJB 5L95C 1Q0WB 1WGHA 4AWJA 2K8HA 4FHJA 5HKHA 2KN5A 4ZRIA 3TJPA 2N9XA 3H1UA 1P3QU 1WF9A 1WXAA 1SGHA 2K25A 4LJOB 2GMIC 1J0GA 2K8CA 3L10B 4K7UA 2JWZA 4F7ZA 2CU1A 3R7QA 1E7UA 2O6VB 1EO6A 3RULA 3KUZA 1YD8U 2BYFA 3A33B 2KO3A 3PSEB 4GU2A 2LI5A 4KZ0A 5CHFA 3PREA 2MBEA 2Z59B 2VRRB 3H6NA 5LLIA 4FN2A 3IBEA 3OAWA 1R4MI 1WJ4A 2J0KA 1H8CA 4KSKC 4HDOA 1U4AA 2GBKA 4FHKA 2AYOB 3AI5A 2JY6A 4AP4C 2B3AA 3WANA 3NZSA 3VH3B 4G50A 2WX0A 3TBLD 2REXA 4NAWB 3UINB 2KVRA 4NY0A 2G4SA 3QCAA 2MP2B 2LXCA 3A1QA 4WJNA 2BYEA 3DBSA 2CR5A 1NDDA 2KWVB 2L0TA 4HCPB 3AU5A 2DAFA 5DPSA 2AL6A 4PYUA 3VTVA 2MBQA 5AEKB 3PRPB 4NQLB 4KDIC 4XX5A 4NJ7A 2XBBC 2JZZA 4J6IA 3VUXA 2JT4B 2RD0A 1ZKHA 1ZGUB 4ZRJA 3AU4A 1HE8A 1NBFC 4W9CA 2HD5B 4ANWA 3O65B 1XT9B 1C3TA 2KJ6A 2XEWA 2MBOA 2KDEB 1L7YA 3PRZA 2RR9A 3PGEA 4EOYA 3EHVA 3QHTA 3QARA 4NQKE 3WAOA 1WM2A 2I1KA 2BWFA 2JF5A 2MWSB 2J0JA 3A9JB 2LZ6A 3B0AA 3QA8A 1F9JA 1GC7A 1J8CA 1T0YA 2BWES 3A4RA 5CHVC 2LVQA 5JH5C 3ECIA 4BFRA 2L3ZA 3NOBA 1Z5SB 1TGZB 3RZWC 2FCMA 2K1FA 4KVGB 3RUIB 2LJ5A 3T9LA 3PVLA 3N3KB 2ZPNA 2KDIA 2WDTB 3VUWA 1EUVB 1UH6A 4W9GA 1LM8B 3W1SA 4FBJB 2N4FA 5LXHA 1UZXB 1D3ZA 2DYOA 3VDZA 1UD7A 1IYFA 1LFDA 2LUEA 2KJRA 1FXTB 4GSWA 4W9JA 1WFYA 4DDGD 3QJZA 4DBGA 3DVNV 5JZEB 2RPQA 2V1YA 2KFJA 4JIOU 1YQBA 2KWCA 2KOXA 3B1LX 3IHPC 2RGFA 1V9JA 2HJ8A 2KNBA 3DVNU 3PS6A 5JHAA 3C0RB 2KX3A 3R66C 3PHWB 2KMAA 1GC6A 4GXBA 4NAWA 2GBNA 3ZNHB 1WJUA 4NPNA 3ZTDA 1H4RA 1WX9A 3CMMB 2MP2A 4JL9A 4W9EA 4EZLA 4IG7B 4LDTD 1YJ1A 4ICVA 2A5UA 4URKA 2IO0B 4II3B 3A1QB 3UF8A 4II2B 1V86A 1YX5B 4GMVA 4JGHB 3QIJA 3W1SC 4F1SA 5KHOA 1I35A 2KC1A 4FULA 2ZNVC 3PLVA 4PYZA 4XC2A 1Q1OA 3U8ZA 4EZKA 3KW5B 2PE9A 3SU8X 2IY1B 4LCDE 4X57B 4HWIB 3VTUA 3ZNID 1Q5WB 4K7SA 4PS8A 4IUMB 1XD3B 4RMAA 4B95A 4PS7A 2DZJA 2NBUA 4K7WA 3NZUA 1BT0A 3QC8B 4A3OA 3L54A 3KVFB 4DWFA 5LXIB 2KZRA 1TBEA 4EEWA 4FA6A 2LGDA 3V61A 1A5RA 3RD2A 3BINA 1S3SG 4MJSB 2L0FA 4IWQA 4KDLB 4BVUC 4M0WB 5J2RA 4FLHA 3H7SA 4CO7A 2NPTB 1WXMA 3Q3JA 5JHBA 4CHKA 3CF6E 5KHQA 3ZNGC 2FCQA 3N30A 4KSLC 3ZLZA 4DXAB 4AJYB 4ZYNA 1V2YA 3OLMD 2LXAA 5D6JB 5IA7A 4WWPA 5BO4B 2KK8A 1M94A 3K9OB 4K1RB 4ASWC 3PTFC 2MRPA 3RYTA 5E6NA 1Z2MA 1RFAA 2RSUA 5CX3A 1UELA 2ZCCA 2J0MA 3ZRCA 1V81A 2ZJDA 5D2MB 4RM9A 4DHJB 2ZNVB 2LRUA 4BKSD 4TUUA 4EUTA 4DK5A 2IO1B 2N7EA 1KLVA 1R4NI 1OEYJ 2OJRA 1WZ0A 1ISNA 4JQWC 2L05A 3WALA 3JW0X 2JRHA 3L16A 3A4SC 3RCZA 3EC8A 4MELA 3APDA 1WJNA 4IM0A 5AZGA 3ZIMA 4F8CB 1WE7A 2NVUI 1GJZA 2KWUB 3WA0A 1WGDA 4XZ4A 3PLUA 3VFKA 3ZKJC 3TIXA 1VD2A 2N9PC 3MHSD 4MGIE 2FIFA 2KQSA 2O2VA 3ML9A 3HHMA 1JRUA 2DYMA 2G45B 2L76A 5C1ZA 1EF5A 2MA9B 3PRMB 3VAWA 2QHOA 1K8RB 4MEMA 2GBRA 2LGYA 2MLBA 3S2AA 3EECA 4MGKE 5AZFA 2R2QA 4IM3A 3KUCB 2DX5B 4AJWA 4BOZB 3QQ8B 2O6VD 3CSFA 3W1YA 2GBMA 3GOEA 2KTFA 2AEHA 4BBNC 3LJ3A 4MDKE 1UBIA 2BYVE 4W9DA 4MJSA 3EFUA 5TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFW B;  4ZDV A;  4GOC A;  3ZDT A;  2AWT A;  1MG8 A;  2C7H A;  2DYB A;  2BGF A;  4G11 A;  2NPT A;  4JLC A;  4KV2 A;  5DPR A;  3M62 B;  1I42 A;  1CMX B;  2ZPY A;  2LRW A;  2ZVN A;  5G55 A;  2KDF B;  1PQS A;  2NBW B;  3U7D A;  3DVG X;  3KH0 A;  2DZK A;  4G3X B;  1WMH B;  1KJT A;  3DQV A;  4LDT B;  3AUL A;  4WQO B;  3I3T B;  5CTR C;  2K8B A;  1WYW B;  2WX1 A;  3QWZ B;  4EKU A;  3MJW A;  4P7I A;  2IYD B;  3RT3 B;  5G2N A;  4HPL B;  3L17 A;  3JSV B;  2CHW A;  5E6P A;  4ANU A;  2EMS A;  2L8J A;  2JXX A;  4HK2 A;  3APC A;  4EZJ A;  2HTH A;  2MQJ A;  4TQ1 A;  1LXD A;  2N1W A;  2BPS A;  3ALB A;  4IW0 A;  3ZRF A;  1WGR A;  4MGZ E;  4BOS C;  1WY8 A;  1YIW A;  3A9K B;  4W9H A;  4AOF A;  1YX6 B;  2JRI B;  1L2N A;  2KQ7 A;  1WH3 A;  1OQY A;  5J17 A;  4YL8 A;  2DAJ A;  3ZTC A;  3UQB A;  2GOW A;  3ML8 A;  3ZW3 A;  5D94 A;  5E6O A;  2JVC A;  2KXJ A;  3SHQ A;  3ZDM C;  1C1Y B;  2M17 A;  2D3G A;  2NBV B;  4IWP A;  5DPT A;  2O2V B;  1WR6 E;  4RM8 A;  3TCA A;  1GUA B;  2Z0D B;  4OVU A;  1XQQ A;  2WWZ A;  1WXV A;  5GMV A;  3WIM A;  4WJQ A;  2XK5 A;  1UGM A;  2LWP A;  1Y8R C;  4BKG A;  2Y5B B;  3PT2 B;  3VUY A;  3DPD A;  3ZO5 B;  1WX8 A;  4CYE A;  1RAX A;  2ASQ A;  1VCB A;  2KD0 A;  4MH0 E;  3M63 B;  3VVW B;  4TQ0 A;  2LD9 A;  4GN1 A;  3MTN B;  1WJ6 A;  1V6E A;  4HLE A;  2DEN B;  3PV1 A;  3M3J A;  2J7Q B;  1V5O A;  3HK0 A;  4HVB A;  4A3P A;  3JYU A;  4PS3 A;  4BBN F;  2PE6 B;  3X0W A;  1WMH A;  4FJY A;  5J18 A;  1E8X A;  1QZE A;  1AAR A;  3AXC A;  5DPW A;  5EDS A;  1X1M A;  3K9P B;  3NS8 A;  2G4D B;  1GNU A;  1E8W A;  3JSV A;  3OJ3 A;  3OJ4 B;  2KLG A;  3PZD A;  3UIO B;  3QX1 A;  1SIF A;  1TZ1 A;  3PPA A;  2LAS A;  3KUD B;  4WAA A;  4B6W A;  4TKN A;  2NCN A;  3ZVV A;  2KC2 A;  1V80 A;  1KOT A;  1LQB A;  3BY4 B;  3A9K A;  3L13 A;  4MSQ B;  2KX0 A;  3HM6 X;  4OVV A;  4GGQ A;  4KIK B;  2KJH B;  4FJV B;  3VXW A;  3TL5 A;  2DHZ A;  4W9L A;  2YLM A;  3NY5 A;  3V6C B;  4IM2 A;  1G6J A;  2MBH A;  3U30 A;  1P98 A;  2HE7 A;  2G3Q B;  2ZCB A;  4GDK A;  2FNJ B;  4NJ6 A;  4DDI D;  3B08 A;  2FAZ A;  1NI2 A;  3APF A;  4BKT A;  1WE6 A;  2MCN B;  3V6E B;  2L00 B;  3N32 A;  3VHT C;  1IP9 A;  4WJO A;  4KZC A;  2I1J A;  5IAA C;  2V4L A;  1WX7 A;  2N1V A;  5DCN A;  2N7D A;  3V60 A;  1IPG A;  4N9F 4;  2PJH A;  3DCG A;  2FID A;  4MGY E;  4WWO A;  4B9K A;  1V49 A;  2XK5 B;  3L0W B;  1KM7 A;  5FR6 A;  3VQI A;  4DHZ E;  2KHW B;  4LJP B;  2EMT A;  2L7R A;  2PPH A;  4M8M A;  1WR1 A;  1WI0 A;  2K6Q A;  4BKS A;  3DDC B;  2MW5 A;  1E7V A;  4HXD A;  3H7P A;  1E5W A;  4DHJ D;  2LVP A;  2V3S A;  3M95 A;  4GDL A;  2C7N B;  3QAQ A;  3V62 A;  4IWO A;  2MSE D;  1P0R A;  4W9F A;  4HDQ A;  3GZN I;  1P9D U;  5AZH A;  2KFK A;  2BF8 B;  2PEA A;  3QK0 A;  1SE9 A;  2C9W B;  4MM3 A;  2KTR B;  3DVG Y;  2LVO A;  1OTR B;  1RLF A;  4E74 A;  2KAN A;  4I6L B;  1TTN A;  2D07 B;  4I6P A;  1WXS A;  3R7R A;  1ZW7 A;  2BKF A;  3Q3F A;  4GIV A;  4AUQ C;  2CS4 A;  2MX2 A;  5CHW A;  3DBL I;  2D2Q A;  1V5T A;  2ZZP B;  2BKR B;  2FCN A;  3KYD D;  2IO2 B;  2MBB B;  3D32 A;  2JUO A;  3UQA A;  3IG3 A;  4ANX A;  2EKE C;  3SDL C;  1WM3 A;  2KLC A;  4IC7 B;  4KIK A;  2KDB A;  2D11 A;  3LDZ E;  3DBH I;  2O6V A;  3VTW A;  2K39 A;  2IZV B;  1S1Q B;  1E8Y A;  2IY0 B;  3L08 A;  3T8M A;  3ZUN A;  1E8Z A;  3UGB B;  4WJP A;  4E3C A;  4FAD A;  3KYC D;  2CHZ A;  4HJK A;  4DHZ B;  3TMP B;  1RRB A;  2DZI A;  1GG3 A;  2C7M B;  3SD5 A;  2JPH A;  4W9K A;  2JZ3 B;  4GDK B;  4TV3 A;  1UBQ A;  4A20 A;  2K6D B;  2KMC A;  4WWN A;  3JVZ X;  3NHE B;  3R3M A;  4M8N A;  3WAP A;  2OOB B;  3ENE A;  2IO3 B;  3HIZ A;  4I6N B;  4ICU A;  5D7G A;  2A4Z A;  2FCS A;  2FUH B;  3CST A;  2CHX A;  2M0X A;  2UWQ A;  1WGY A;  2NR2 A;  3UIP B;  2R2O A;  1WIA A;  2W9N A;  3RZF A;  2M1M A;  2NS5 A;  3P2B A;  4W9I A;  2KKC A;  4HCN B;  2WYQ A;  2CKH B;  1OEY A;  1OGW A;  2C5L C;  2YVC A;  4ZRK A;  3X23 A;  3ONS A;  2AL3 A;  4E71 A;  2ZVO A;  4K81 A;  3WAM A;  1P1A A;  1E90 A;  3ZNZ B;  4ANV A;  1WZ3 A;  2Z0E B;  2IBI B;  3H7P B;  3PHX B;  2DZM A;  2GBJ A;  3VH4 B;  4GDL B;  3IVF A;  2ZEQ A;  4MSM B;  1WRD B;  2UYZ B;  2KTR A;  2C60 A;  4GB9 A;  2D10 A;  1WGG A;  3H9D A;  1J19 A;  2LGX A;  2M4N A;  2KFK B;  3DBR I;  4HPM B;  5L83 A;  4G0N B;  3HM3 A;  4EFO A;  2M8S A;  4FJZ A;  1EF1 A;  5C23 A;  2N9E B;  3A9J A;  3DOW A;  4NNJ B;  5L95 C;  1Q0W B;  1WGH A;  4AWJ A;  2K8H A;  4FHJ A;  5HKH A;  2KN5 A;  4ZRI A;  3TJP A;  2N9X A;  3H1U A;  1P3Q U;  1WF9 A;  1WXA A;  1SGH A;  2K25 A;  4LJO B;  2GMI C;  1J0G A;  2K8C A;  3L10 B;  4K7U A;  2JWZ A;  4F7Z A;  2CU1 A;  3R7Q A;  1E7U A;  2O6V B;  1EO6 A;  3RUL A;  3KUZ A;  1YD8 U;  2BYF A;  3A33 B;  2KO3 A;  3PSE B;  4GU2 A;  2LI5 A;  4KZ0 A;  5CHF A;  3PRE A;  2MBE A;  2Z59 B;  2VRR B;  3H6N A;  5LLI A;  4FN2 A;  3IBE A;  3OAW A;  1R4M I;  1WJ4 A;  2J0K A;  1H8C A;  4KSK C;  4HDO A;  1U4A A;  2GBK A;  4FHK A;  2AYO B;  3AI5 A;  2JY6 A;  4AP4 C;  2B3A A;  3WAN A;  3NZS A;  3VH3 B;  4G50 A;  2WX0 A;  3TBL D;  2REX A;  4NAW B;  3UIN B;  2KVR A;  4NY0 A;  2G4S A;  3QCA A;  2MP2 B;  2LXC A;  3A1Q A;  4WJN A;  2BYE A;  3DBS A;  2CR5 A;  1NDD A;  2KWV B;  2L0T A;  4HCP B;  3AU5 A;  2DAF A;  5DPS A;  2AL6 A;  4PYU A;  3VTV A;  2MBQ A;  5AEK B;  3PRP B;  4NQL B;  4KDI C;  4XX5 A;  4NJ7 A;  2XBB C;  2JZZ A;  4J6I A;  3VUX A;  2JT4 B;  2RD0 A;  1ZKH A;  1ZGU B;  4ZRJ A;  3AU4 A;  1HE8 A;  1NBF C;  4W9C A;  2HD5 B;  4ANW A;  3O65 B;  1XT9 B;  1C3T A;  2KJ6 A;  2XEW A;  2MBO A;  2KDE B;  1L7Y A;  3PRZ A;  2RR9 A;  3PGE A;  4EOY A;  3EHV A;  3QHT A;  3QAR A;  4NQK E;  3WAO A;  1WM2 A;  2I1K A;  2BWF A;  2JF5 A;  2MWS B;  2J0J A;  3A9J B;  2LZ6 A;  3B0A A;  3QA8 A;  1F9J A;  1GC7 A;  1J8C A;  1T0Y A;  2BWE S;  3A4R A;  5CHV C;  2LVQ A;  5JH5 C;  3ECI A;  4BFR A;  2L3Z A;  3NOB A;  1Z5S B;  1TGZ B;  3RZW C;  2FCM A;  2K1F A;  4KVG B;  3RUI B;  2LJ5 A;  3T9L A;  3PVL A;  3N3K B;  2ZPN A;  2KDI A;  2WDT B;  3VUW A;  1EUV B;  1UH6 A;  4W9G A;  1LM8 B;  3W1S A;  4FBJ B;  2N4F A;  5LXH A;  1UZX B;  1D3Z A;  2DYO A;  3VDZ A;  1UD7 A;  1IYF A;  1LFD A;  2LUE A;  2KJR A;  1FXT B;  4GSW A;  4W9J A;  1WFY A;  4DDG D;  3QJZ A;  4DBG A;  3DVN V;  5JZE B;  2RPQ A;  2V1Y A;  2KFJ A;  4JIO U;  1YQB A;  2KWC A;  2KOX A;  3B1L X;  3IHP C;  2RGF A;  1V9J A;  2HJ8 A;  2KNB A;  3DVN U;  3PS6 A;  5JHA A;  3C0R B;  2KX3 A;  3R66 C;  3PHW B;  2KMA A;  1GC6 A;  4GXB A;  4NAW A;  2GBN A;  3ZNH B;  1WJU A;  4NPN A;  3ZTD A;  1H4R A;  1WX9 A;  3CMM B;  2MP2 A;  4JL9 A;  4W9E A;  4EZL A;  4IG7 B;  4LDT D;  1YJ1 A;  4ICV A;  2A5U A;  4URK A;  2IO0 B;  4II3 B;  3A1Q B;  3UF8 A;  4II2 B;  1V86 A;  1YX5 B;  4GMV A;  4JGH B;  3QIJ A;  3W1S C;  4F1S A;  5KHO A;  1I35 A;  2KC1 A;  4FUL A;  2ZNV C;  3PLV A;  4PYZ A;  4XC2 A;  1Q1O A;  3U8Z A;  4EZK A;  3KW5 B;  2PE9 A;  3SU8 X;  2IY1 B;  4LCD E;  4X57 B;  4HWI B;  3VTU A;  3ZNI D;  1Q5W B;  4K7S A;  4PS8 A;  4IUM B;  1XD3 B;  4RMA A;  4B95 A;  4PS7 A;  2DZJ A;  2NBU A;  4K7W A;  3NZU A;  1BT0 A;  3QC8 B;  4A3O A;  3L54 A;  3KVF B;  4DWF A;  5LXI B;  2KZR A;  1TBE A;  4EEW A;  4FA6 A;  2LGD A;  3V61 A;  1A5R A;  3RD2 A;  3BIN A;  1S3S G;  4MJS B;  2L0F A;  4IWQ A;  4KDL B;  4BVU C;  4M0W B;  5J2R A;  4FLH A;  3H7S A;  4CO7 A;  2NPT B;  1WXM A;  3Q3J A;  5JHB A;  4CHK A;  3CF6 E;  5KHQ A;  3ZNG C;  2FCQ A;  3N30 A;  4KSL C;  3ZLZ A;  4DXA B;  4AJY B;  4ZYN A;  1V2Y A;  3OLM D;  2LXA A;  5D6J B;  5IA7 A;  4WWP A;  5BO4 B;  2KK8 A;  1M94 A;  3K9O B;  4K1R B;  4ASW C;  3PTF C;  2MRP A;  3RYT A;  5E6N A;  1Z2M A;  1RFA A;  2RSU A;  5CX3 A;  1UEL A;  2ZCC A;  2J0M A;  3ZRC A;  1V81 A;  2ZJD A;  5D2M B;  4RM9 A;  4DHJ B;  2ZNV B;  2LRU A;  4BKS D;  4TUU A;  4EUT A;  4DK5 A;  2IO1 B;  2N7E A;  1KLV A;  1R4N I;  1OEY J;  2OJR A;  1WZ0 A;  1ISN A;  4JQW C;  2L05 A;  3WAL A;  3JW0 X;  2JRH A;  3L16 A;  3A4S C;  3RCZ A;  3EC8 A;  4MEL A;  3APD A;  1WJN A;  4IM0 A;  5AZG A;  3ZIM A;  4F8C B;  1WE7 A;  2NVU I;  1GJZ A;  2KWU B;  3WA0 A;  1WGD A;  4XZ4 A;  3PLU A;  3VFK A;  3ZKJ C;  3TIX A;  1VD2 A;  2N9P C;  3MHS D;  4MGI E;  2FIF A;  2KQS A;  2O2V A;  3ML9 A;  3HHM A;  1JRU A;  2DYM A;  2G45 B;  2L76 A;  5C1Z A;  1EF5 A;  2MA9 B;  3PRM B;  3VAW A;  2QHO A;  1K8R B;  4MEM A;  2GBR A;  2LGY A;  2MLB A;  3S2A A;  3EEC A;  4MGK E;  5AZF A;  2R2Q A;  4IM3 A;  3KUC B;  2DX5 B;  4AJW A;  4BOZ B;  3QQ8 B;  2O6V D;  3CSF A;  3W1Y A;  2GBM A;  3GOE A;  2KTF A;  2AEH A;  4BBN C;  3LJ3 A;  4MDK E;  1UBI A;  2BYV E;  4W9D A;  4MJS A;  3EFU A;  5TR5 A; 
#chains in the Genus database with same CATH topology
 3IFW B;  4M0W A;  4ZDV A;  1KLU D;  5DPR A;  2BS4 B;  2BGF A;  4KV2 A;  1C9F A;  1YQ4 B;  3U52 E;  4RF0 A;  1C78 A;  2DZK A;  1WMH B;  3EFC A;  1SE3 A;  3BK2 A;  3DQV A;  3AUL A;  4WQO B;  4P7I A;  1ZXI A;  4HPL B;  3L17 A;  3JSV B;  4LK0 M;  3E9S A;  2L8J A;  1SE4 A;  4EZJ A;  4TQ1 A;  1VZ8 A;  1EWY C;  2BPS A;  1QKZ A;  1YX6 B;  2JRI B;  2KQ7 A;  1WH3 A;  4YL8 A;  5E6O A;  3TEW A;  5H8Y E;  2M17 A;  2NBV B;  5DPT A;  1HQR D;  2O2V B;  1N62 A;  5HG2 A;  3PO0 A;  1GUA B;  4WJQ A;  4XE0 A;  4B0M A;  2Y5B B;  4CYE A;  3M63 B;  1T3Q A;  1WWT A;  4H2A A;  4P16 A;  1XLQ A;  3M3J A;  1JWU D;  1WMH A;  1DOX A;  4R3D A;  1AAR A;  3HVZ A;  1J7C A;  1E8W A;  3JSV A;  3OJ4 B;  3UIO B;  5I4D A;  5IP4 D;  1SIF A;  4P1B C;  2CJO A;  4OW0 A;  1JRP A;  2LAS A;  1YN3 A;  4B6W A;  1NEK B;  4OVV A;  2KVZ A;  4W9L A;  2WU2 B;  3RN9 C;  2SAK A;  2HE7 A;  5G5H A;  1FXA A;  4NJ6 A;  1QT9 A;  3RNE C;  3AE4 B;  1ET9 A;  4BKT A;  4KKJ A;  1MPE A;  2M19 A;  4KZC A;  2I1J A;  1OFF A;  1IPG A;  4N9F 4;  3KWV A;  2FID A;  3P63 A;  2XK5 B;  1KM7 A;  3VQI A;  1MHH E;  4XYC A;  2PPH A;  1C4A A;  2PTL A;  3DDC B;  2MW5 A;  1F2R C;  4RNA A;  3H7P A;  1FMA D;  4HKZ E;  4GDL A;  3R8B A;  4IWO A;  2MSE D;  2G9H D;  3GZN I;  1P9D U;  4BAX A;  5BMG A;  2BF8 B;  2KTR B;  2WP9 B;  4I6L B;  1TTN A;  3R7R A;  1JML A;  2BKF A;  4ARC A;  5CHW A;  2BKR B;  5BYQ A;  2IO2 B;  3Q8E A;  2MBB B;  3D32 A;  3UQA A;  1WM3 A;  3MC9 A;  3DBH I;  3FAH A;  2K39 A;  3L08 A;  3T8M A;  1JWB D;  1E8Z A;  1I4Q A;  4E3C A;  4DHZ B;  1RRB A;  1GG3 A;  4L2Y A;  4GDK B;  4TV3 A;  1GB4 A;  4K3B A;  3WAP A;  3CWI A;  3AM9 A;  3HIZ A;  1T6B X;  2A4Z A;  3CST A;  4YT0 B;  1L4Z B;  2LMC A;  3RZF A;  3P2B A;  2NS5 A;  4W9I A;  4HCN B;  1FIQ A;  2CKH B;  2C5L C;  3ONS A;  2L32 A;  2AL3 A;  3BYY B;  4ANV A;  1STE A;  2DZM A;  3VH4 B;  1V1O A;  4MSM B;  4XDC A;  2KTR A;  4GB9 A;  3H9D A;  2M4N A;  4HPM B;  1XCT L;  3T3N A;  4FJZ A;  5C23 A;  3FC4 A;  5L95 C;  1OQR A;  2K8H A;  1PDX A;  1D5X C;  3H1U A;  1WF9 A;  5EE3 A;  3IAS 1;  2K25 A;  1D4B A;  4LTU A;  1MFW A;  4F7Z A;  2WNM A;  3R7Q A;  2TSS A;  1EO6 A;  1YN5 A;  3NRZ A;  1L0X B;  4XWT A;  1YD8 U;  2BYF A;  3A33 B;  2KO3 A;  2LI5 A;  2Y5P A;  4KZ0 A;  4AQ7 A;  2MBE A;  3H6N A;  3ABV B;  5LLI A;  2BW2 A;  4OZA A;  3RPF C;  1WJ4 A;  2WXL A;  4KSK C;  2XN9 C;  2WXR A;  4FHK A;  2JY6 A;  4AP4 C;  5HFY A;  3QCA A;  1FRD A;  3DBS A;  2KWV B;  4CQN A;  2L0T A;  3AU5 A;  2AL6 A;  2MBQ A;  1YNT E;  1E9M A;  1IGD A;  4LNF A;  4NJ7 A;  2KDM A;  5FKA C;  3VUX A;  1ZKH A;  1NBF C;  2HD5 B;  2KJ6 A;  5TSS A;  1L7Y A;  1MJD A;  3BYT B;  3PGE A;  1XCQ L;  1EM7 A;  2WXJ A;  3EHV A;  3QHT A;  2BS2 B;  2IDY A;  3QA8 A;  5AUK A;  3AE9 B;  1GC7 A;  1FFU A;  4Q2J A;  1FCC C;  3A4R A;  2FE8 A;  3ECI A;  1R4N B;  1SEB D;  3RUI B;  3N3K B;  2ZPN A;  2NTS A;  3LB8 C;  2WDT B;  4RH6 A;  4W9G A;  3W1S A;  2VZK D;  1YJI A;  1UZX B;  1SE2 A;  1XLO A;  3RNF C;  2DYO A;  3VDZ A;  1LFD A;  4XDD A;  3URY A;  4DBG A;  2RPQ A;  2V1Y A;  1JAL A;  2KNB A;  2HJ8 A;  3I63 C;  3DVN U;  1JWS D;  3HRD D;  3AEC B;  2DNF A;  3C0R B;  2KX3 A;  4GXB A;  2GBN A;  1WXQ A;  3AB5 A;  1H4R A;  1WX9 A;  4NPN A;  3W9C B;  4W9E A;  4EZL A;  2HDE A;  3BK1 A;  2D3A A;  2QEJ C;  4II3 B;  1FFV A;  3A1Q B;  1V86 A;  4JGH B;  3W1S C;  4F1S A;  5KHO A;  2KC1 A;  4FUL A;  1T5X D;  3U8Z A;  4EZK A;  2PE9 A;  1FXI A;  2IY1 B;  4X57 B;  4TMA B;  3ZNI D;  4PS8 A;  4ZHO A;  3GZN B;  3AE3 B;  4B95 A;  4PS7 A;  2DZJ A;  4A3O A;  3NZU A;  3L54 A;  3B2F A;  2WXI A;  1YOV B;  4DWF A;  5LXI B;  3AEA B;  4K3C A;  2V3P A;  3RD2 A;  4JPS A;  4WIP A;  1S3S G;  4IWQ A;  4KDL B;  1EU3 A;  4CO7 A;  2NPT B;  3Q3J A;  4CHK A;  2FCQ A;  1VRA B;  4DXA B;  4AJY B;  1QOA A;  3OLM D;  5D6J B;  2KAC A;  1TKG A;  1WGK A;  3DBH B;  1R7S A;  5BO4 B;  4ASW C;  4B0E A;  2PLP A;  2MJE A;  3PTF C;  5E6N A;  2E6X A;  4ITK A;  1UEL A;  3MJ5 A;  2ZJD A;  4IDI A;  1I4P A;  4RM9 A;  2BVC A;  2W3S A;  2OJR A;  1ISN A;  3GE3 C;  4JQW C;  3WAL A;  3NJT A;  3A4S C;  1WJN A;  4UDU C;  3ZIM A;  1F2R I;  1WE7 A;  1GJZ A;  1KTK A;  4XZ4 A;  2JQR B;  1YQ3 B;  1VD2 A;  5T8I A;  4ZYS A;  1FO4 A;  2D5G A;  2GRI A;  2G45 B;  5C1Z A;  4L1B A;  4HRO A;  5EE9 A;  1ZPS A;  3S2A A;  2DX5 B;  3VR9 B;  2O6V D;  2AEH A;  4W9D A;  1UBI A;  1ZXH A;  5TR5 A;  2C7H A;  4G11 A;  2NPT A;  4JLC A;  3M62 B;  1I42 A;  1CMX B;  1MG4 A;  2ZVN A;  5G55 A;  2NBW B;  2Q5W D;  3NUH B;  3I3T B;  5CTR C;  1UWX A;  3QWZ B;  3Q8B A;  2IYD B;  3RT3 B;  3P4R B;  1AN8 A;  4ANU A;  3APC A;  1K51 A;  4YSZ B;  3ZRF A;  2KT7 A;  3C19 A;  2AQ2 B;  2ONQ A;  4W9H A;  1PGA A;  2KWD A;  4ZHP A;  3UQB A;  2GOW A;  3ML8 A;  1V1P B;  5D94 A;  3AE8 B;  2INC C;  2JVC A;  1FPY A;  1RYJ A;  3T3O A;  2D3G A;  1FEH A;  5D3I B;  1MHX A;  2H89 B;  3TCA A;  1PUT A;  4OVU A;  1XQQ A;  2WWZ A;  2WXN A;  1UGM A;  4BKG A;  3DPD A;  3I5J C;  1SBB B;  2ASQ A;  3VVW B;  2YEP F;  1D5Z C;  1TYG B;  1V6E A;  4HLE A;  1NEN B;  3JYU A;  1C4C A;  2PE6 B;  3X0W A;  4FJY A;  5J18 A;  3AXC A;  1SJE D;  2G4D B;  3R2T A;  2KLG A;  2N7J A;  3PPA A;  2NCN A;  3ZVV A;  1KOT A;  1V80 A;  1LQB A;  1ZOY B;  4KGT A;  1F1H A;  2HTM E;  3L13 A;  4N59 A;  4ZRQ A;  4FJV B;  2L1A A;  3SFD B;  2DHZ A;  3VXW A;  1V1P A;  2G3Q B;  1TIF A;  2K3U A;  3PZ8 A;  1WE6 A;  2MCN B;  3V6E B;  3VHT C;  2WXF A;  2LJI A;  5IAA C;  1WX7 A;  2N1V A;  5DCN A;  2OED A;  4WWO A;  1V49 A;  1YMH E;  4LJP B;  4M8M A;  1WR1 A;  5D3D A;  1J7B A;  1E5W A;  1EU4 A;  2RDB C;  2CJN A;  2V3S A;  3DHI C;  2QIE B;  3VRA B;  2BYT A;  3DWM A;  3MC0 B;  3DVG Y;  4E74 A;  2KAJ A;  1RM6 C;  1UGJ A;  3AEE B;  4I6P A;  1WXS A;  4AUQ C;  2CS4 A;  2MX2 A;  2SEB D;  2D2Q A;  1V5T A;  2ZZP B;  4JWU C;  2WHI A;  4ANX A;  3B2G A;  4IC7 B;  2O6V A;  2IZV B;  2VH2 A;  4OVZ A;  4P6V F;  3UGB B;  4FAD A;  3KYC D;  3P4P B;  3TMP B;  1UNS A;  1NYQ A;  2C7M B;  4A20 A;  2K6D B;  1T0Q C;  3JVZ X;  1ESF A;  4ICU A;  3AV8 A;  4P1C C;  2R2O A;  2FBW B;  4ZRK A;  4PK1 A;  4RF1 A;  4E71 A;  1P1A A;  4M02 A;  3ZNZ B;  3RNC C;  1WZ3 A;  2Z0E B;  2IBI B;  3H7P B;  1M4V A;  2GBJ A;  3IT4 B;  4GDL B;  3V3X A;  1WRD B;  2C60 A;  3ZXR A;  1J19 A;  3DBR I;  5L83 A;  4G0N B;  4RGM A;  2M8S A;  1TY0 A;  3KQ4 A;  3TEX A;  1SSN A;  1MVK A;  1B9R A;  2W82 A;  4LNK A;  4FHJ A;  1HTQ A;  2JSV X;  4RCO A;  1J0G A;  1PGX A;  2CU1 A;  4BZA A;  4XWW A;  3TSS A;  4GU2 A;  3PSE B;  3NVZ A;  3PRE A;  4AS1 A;  2Z59 B;  4OZB A;  1A70 A;  4KX6 B;  3IBE A;  3OAW A;  3GB1 A;  4HDO A;  3AI5 A;  3FKY A;  2B3A A;  3WAN A;  3VH3 B;  4G50 A;  4LNI A;  3BVZ A;  2K5P A;  2LXC A;  4WJN A;  2BYE A;  1NDD A;  3AH7 A;  3AE2 B;  5DPS A;  1QQR A;  1XXG A;  3PRP B;  4NQL B;  2NTT A;  4XX5 A;  1TJE A;  2XBB C;  2JZZ A;  2Z8L A;  5EE1 A;  1ZGU B;  4ZRJ A;  1HE8 A;  4HPP A;  1C76 A;  2KDE B;  1CZP A;  2LUM A;  1WM2 A;  2JF5 A;  2MWS B;  2J0J A;  2LZ6 A;  2NMQ A;  1L4D B;  1BXT A;  1F9J A;  3V05 A;  1TS5 A;  4N6E B;  2BWE S;  2L3Z A;  1Z5S B;  1TGZ B;  2Y5C A;  4KVG B;  2LJ5 A;  2X38 A;  3W5V B;  1KRH A;  2N4F A;  5LXH A;  1D3Z A;  1UD7 A;  2KJR A;  1FXT B;  2PVO D;  4YTN B;  1YQB A;  4YWG G;  2RGF A;  3PS6 A;  1V9J A;  1I4H A;  5FK9 C;  2DBY A;  2V0G A;  2KMA A;  1JQ4 A;  1D6E C;  4IG7 B;  4LDT D;  1I7H A;  1YJ1 A;  2WXQ A;  3RNB C;  4ICV A;  2IO0 B;  4GMV A;  3AE7 B;  3QIJ A;  3PLV A;  1YJJ A;  2LEK A;  3KW5 B;  3SU8 X;  1Q5W B;  1PGB A;  2NBU A;  3BWU D;  4K7W A;  1BT0 A;  3KVF B;  4FA6 A;  2LGD A;  3V61 A;  3GS2 A;  2N0S B;  4FLH A;  1JWM D;  3H7S A;  1WXM A;  1K50 A;  3N30 A;  4KSL C;  2JYE A;  2LXA A;  5IA7 A;  4WWP A;  1E7P B;  3K9O B;  4K1R B;  2MRP A;  1Z2M A;  2J0M A;  1V81 A;  4ARI A;  2BS3 B;  3ZJV A;  4BKS D;  1TZO A;  3BII D;  2N7E A;  1NI3 A;  2E3T A;  3NZ3 A;  1B1Z A;  2L05 A;  2WU5 B;  3L16 A;  4MEL A;  1T0S C;  1GB1 A;  3FIL B;  2NVU I;  1HZ6 A;  3VFK A;  3TIX A;  2N9K A;  3MHS D;  2FIF A;  3HHM A;  1JRU A;  2DYM A;  1FNW A;  2QC8 A;  3PRM B;  4O1N A;  2QHO A;  3VAW A;  4REZ A;  2R2Q A;  2GB1 A;  3RFZ B;  1QOF A;  3DBR B;  1UF0 A;  5HI1 A;  4MDK E;  2BYV E;  3EFU A;  4F8C B;  4GOC A;  3Q8C A;  3V62 A;  1MG8 A;  2DYB A;  3WCQ A;  2ZPY A;  4WH4 A;  1L0Y B;  1PQS A;  1KF6 B;  2M56 B;  4KGR A;  3KH0 A;  2LFI A;  4G3X B;  1KJT A;  4LDT B;  2K8B A;  3U7Z A;  2RPV A;  2L52 A;  5G2N A;  2CHW A;  2EMS A;  2HTH A;  2MQJ A;  4J3O D;  2N1W A;  3ALB A;  1VDV A;  1WGR A;  5LNK 1;  4NZL B;  4BOS C;  3A9K B;  2D3B A;  3FIL A;  3Q2A C;  3AN1 A;  1OQY A;  5FR3 A;  1NVI D;  3ZW3 A;  1DOI A;  2KXJ A;  3SHQ A;  3Q3M C;  1FM0 D;  1C1Y B;  1FCL A;  1WR6 E;  4RM8 A;  4C7Y A;  3WIM A;  2IGG A;  3VUY A;  2M0A A;  2PVG C;  3ZO5 B;  1WX8 A;  3ZGZ A;  1RAX A;  1VCB A;  2KD0 A;  2QSD A;  4MH0 E;  2LD9 A;  4GN1 A;  1FRR A;  3PV1 A;  2J7Q B;  3HK0 A;  2QJL A;  3NG0 A;  4PS3 A;  1E8X A;  1QZE A;  1TKY A;  1Y56 A;  5DPW A;  2WXG A;  3P4Q B;  3NS8 A;  3K9P B;  3RNA C;  3OJ3 A;  1TZ1 A;  3KUD B;  1L6V A;  2KC2 A;  3BY4 B;  3A9K A;  4US8 A;  1K53 A;  5IOI A;  3TL5 A;  2YLM A;  3NY5 A;  3V6C B;  4IM2 A;  1G6J A;  3U30 A;  1P98 A;  2WDV B;  2FNJ B;  3W5U B;  1UWM A;  3APF A;  2QMT A;  4WAF A;  1WSP A;  2W55 A;  4MGY E;  3P4S B;  3L0W B;  5FR6 A;  1TKE A;  2KHW B;  2VZK B;  2EMT A;  2L7R A;  1AWD A;  1WI0 A;  2K6Q A;  4BKS A;  4IKG A;  1SXT A;  3DHG C;  3ZJU A;  4HXD A;  4DHJ D;  2LVP A;  3TEZ A;  2EEL A;  3M95 A;  4EE2 A;  2C7N B;  4WUR A;  4HDQ A;  3H8H A;  5AZH A;  2KFK A;  3QK0 A;  1SE9 A;  1IBX A;  1HEZ E;  2C9W B;  4D2K A;  4MM3 A;  1OTR B;  1RLF A;  2KAN A;  1ZW7 A;  4GIV A;  4A55 A;  3DBL I;  2FCN A;  3KYD D;  3EGR A;  5JXV A;  3I9V 1;  2JUO A;  3SDL C;  2KLC A;  3MC8 A;  2KDB A;  2D11 A;  2J42 A;  3LDZ E;  1WYG A;  5G5G A;  1S1Q B;  1E8Y A;  4YSX B;  5AUI A;  2CHZ A;  4HJK A;  4ACF A;  3SR6 A;  4C4V B;  2JPH A;  4W9K A;  4NAM A;  4WWN A;  1VLB A;  3N1Y C;  4M8N A;  2INN E;  4S17 A;  4I6N B;  4QAY A;  5D7G A;  2FCS A;  1NYR A;  3ETR A;  2M0X A;  3RNG C;  1KH0 A;  1DOY A;  3P1M A;  1XO3 A;  2W9N A;  2M1M A;  2HJ1 A;  2KKC A;  1E6E B;  3VRB B;  1OEY A;  3IXS A;  3X23 A;  2ZVO A;  3ZQ4 A;  1D5M C;  3WAM A;  1E90 A;  2JU6 X;  3ZYY X;  3IVF A;  2ZEQ A;  2VH1 A;  2D10 A;  2LGX A;  4RGO S;  3HM3 A;  1HZ5 A;  1EF1 A;  3O13 A;  2N9E B;  3A9J A;  4NNJ B;  1JCK B;  1Q0W B;  4AWJ A;  1TS2 A;  1I4G A;  3TJP A;  1DYQ A;  2IND C;  3DHH C;  1WXA A;  2WXP A;  1SGH A;  2GMI C;  2OHF A;  3L10 B;  1QIL A;  2JWZ A;  4K7U A;  3IAM 1;  3ZXV A;  1E7U A;  2O6V B;  4C4V A;  3U2S C;  5CHF A;  1SF0 A;  4YSY B;  2QCZ A;  1VJK A;  2PIA A;  1R4M I;  2J0K A;  1H8C A;  1U4A A;  3J9C A;  1FD6 A;  2BB5 A;  3TBL D;  1L0V B;  2REX A;  2JWU A;  3UIN B;  2G4S A;  3OWE B;  2MP2 B;  3Q14 C;  3E56 A;  3LYY A;  3P42 A;  4A90 A;  4HCP B;  2DAF A;  3VTV A;  2JXT A;  3CIR B;  1ZDV A;  4KDI C;  3Q8A A;  3UI3 A;  1BUI C;  4J6I A;  2RD0 A;  1TY2 A;  3AU4 A;  1XT9 B;  3EA6 A;  3IT6 B;  3AE6 B;  2MBO A;  1TS4 A;  1ROE A;  2KMM A;  1ET6 A;  1HTO A;  3WAO A;  5IKC M;  5BMI A;  1C4P A;  2BWF A;  4FXC A;  1JWA D;  1VZ6 A;  4XGA B;  1J8C A;  1T0Y A;  2LVQ A;  2H88 B;  3Q3N C;  4BFR A;  1LO5 D;  2EKI A;  3NOB A;  1P7F A;  2FCM A;  2K1F A;  4MAC A;  3AE1 B;  4USA A;  3T9L A;  1ENF A;  2KDI A;  2I2Y A;  4HKQ A;  1LM8 B;  3BZD B;  4MT5 A;  1IYF A;  2LUE A;  4W9J A;  4GSW A;  1WFY A;  3QJZ A;  1TS3 A;  2KFJ A;  3N1Z C;  3GP7 A;  4JIO U;  5MPO A;  2BT6 A;  2JYT A;  3IHP C;  2KOX A;  2QDF A;  2JZP A;  1T0R C;  3ZTD A;  2MP2 A;  2IPK D;  2V4I B;  4A8X C;  2A5U A;  4URK A;  4RGT A;  4II2 B;  1YX5 B;  1IGC A;  2RMM A;  1I35 A;  1SB3 C;  2ZNV C;  4XC2 A;  1Q1O A;  2MHJ A;  3VTU A;  4K7S A;  4IUM B;  1CQV A;  2J52 A;  1TBE A;  5BMH A;  3BIN A;  1AYF A;  4MJS B;  2N9L A;  5J2R A;  3DBL B;  3PZ7 A;  5KHQ A;  3ZNG C;  4ZOH C;  4ZYN A;  1V2Y A;  4OZC A;  2KK8 A;  1M94 A;  2LGS A;  2WQY B;  1RWS A;  3ZRC A;  2ZCC A;  3N20 C;  1MI0 A;  2BB6 A;  1Q10 A;  4EUT A;  2IO1 B;  1R4N I;  1OEY J;  1WZ0 A;  1F52 A;  1LGR A;  2LGI A;  3JW0 X;  3OG5 A;  4OHJ A;  3AMZ A;  3RCZ A;  3EC8 A;  1EWC A;  3APD A;  2BBC A;  2J4X A;  4IM0 A;  3KLS X;  2K0P A;  1K52 A;  3PLU A;  2N9P C;  5HHD G;  2KQS A;  2O2V A;  3ML9 A;  3W2D A;  2L76 A;  1KLG D;  1EF5 A;  1K8R B;  4MEM A;  2LGY A;  3RMK C;  4MGK E;  5AZF A;  4IM3 A;  2AX5 A;  3KUC B;  3GE8 C;  4AJW A;  4BOZ B;  4DXG A;  2IGH A;  1V97 A;  3QQ8 B;  1BML C;  3CSF A;  1PYW D;  2GBM A;  2KTF A;  3LXF A;  4MJS A;  1IUE A;  3ZDT A;  2AWT A;  2LRW A;  4RGN A;  2KDF B;  2INP E;  2K9X A;  1N60 A;  3U7D A;  4ZRP A;  2UU7 A;  3DVG X;  3C8Y A;  2WXK A;  2AQ3 B;  1WYW B;  2WX1 A;  4EKU A;  3MJW A;  2W54 A;  2WXO A;  2WLB A;  5E6P A;  2JXX A;  2YEP B;  4HK2 A;  1LXD A;  1R4M B;  4IW0 A;  4MGZ E;  4HRS A;  1WY8 A;  1YIW A;  4AOF A;  2MH7 A;  4TSS A;  1L2N A;  2L83 A;  3AED B;  1FNU A;  5J17 A;  2DAJ A;  3ZTC A;  4GLS C;  1E10 A;  3ZDM C;  3R2I A;  4N58 A;  4IWP A;  1QF6 A;  2V9H A;  2WDR B;  4L23 A;  2LHD A;  4LNN A;  2Z0D B;  2WGS A;  4YTP B;  1WXV A;  2GI9 A;  5GMV A;  1XEE A;  2XK5 A;  3B9J A;  2LWP A;  1Y8R C;  4M00 A;  3PT2 B;  4YTM B;  1HXY D;  1UUP A;  4TQ0 A;  3MTN B;  1WJ6 A;  2DEN B;  1V5O A;  4HVB A;  4A3P A;  4BBN F;  2CU3 A;  2V3N A;  1JRO A;  3BVM A;  5EDS A;  1X1M A;  1N5W A;  1GNU A;  4WQM A;  4C7Z A;  3PZD A;  3QX1 A;  3Q8F A;  2BTE A;  4WAA A;  4TKN A;  3NVY A;  1N61 A;  2WS3 B;  4MSQ B;  2KX0 A;  3HM6 X;  3MFG A;  4GGQ A;  4KIK B;  2KJH B;  3L4P A;  1ZP0 B;  2MBH A;  2ZCB A;  4GDK A;  2JX5 A;  1KFY B;  2ZW0 A;  5BYS A;  1AW7 A;  4DDI D;  3B08 A;  2FAZ A;  1NI2 A;  2ON8 A;  2L00 B;  3RI7 C;  3N32 A;  5C2T B;  1IP9 A;  4WJO A;  2RDH A;  1CK1 A;  2V4L A;  2WDQ B;  4LNO A;  2N7D A;  3V60 A;  2PJH A;  3VR8 B;  3DCG A;  1N6Z A;  4B9K A;  4DHZ E;  4HJG E;  3NS1 A;  1I4X A;  4IOI E;  1XLP A;  2K22 A;  1E7V A;  1L5P A;  2WXH A;  1FNV A;  3QAQ A;  1P0R A;  4W9F A;  2PEA A;  1VR9 A;  1N63 A;  2RDG A;  2LVO A;  2D07 B;  4RFB A;  3Q3F A;  1P7E A;  1PFD A;  4WWM A;  4C56 C;  3BVG A;  2IGD A;  3KWL A;  3IG3 A;  2EKE C;  2KN4 A;  4KIK A;  3VTW A;  2IY0 B;  2XNA C;  3ZUN A;  1CJE A;  4WJP A;  1XLN A;  2DZI A;  3SD5 A;  2JZ3 B;  1L6U A;  1UBQ A;  2KMC A;  1ZDX A;  3MP9 A;  3NHE B;  3R3M A;  3N1X C;  2OOB B;  3ENE A;  2IO3 B;  3Q6B A;  2FUH B;  2CHX A;  4A9A A;  5EE0 A;  2UWQ A;  1WGY A;  2NR2 A;  3UIP B;  5E6J A;  1WIA A;  2WYQ A;  1OGW A;  2YVC A;  4K81 A;  1YN4 A;  3PHX B;  2MJ3 A;  3N9Y C;  2UYZ B;  1WGG A;  2KFK B;  2PW9 A;  1IBX B;  4EFO A;  4MM3 B;  3HVD A;  3DOW A;  3U4E G;  1WGH A;  1RFK A;  5HKH A;  2J53 A;  1J7A A;  2KN5 A;  4ZRI A;  4A6Q A;  2N9X A;  2DWQ A;  1P3Q U;  4LJO B;  3HUI A;  2K8C A;  3DWG C;  3RUL A;  3KUZ A;  3AEG B;  4YXD B;  2VRR B;  5IO9 A;  4FN2 A;  2GBK A;  2AYO B;  2Y3A A;  3SEB A;  3NZS A;  2WX0 A;  4NAW B;  4KKI A;  2KVR A;  4NY0 A;  3Q69 A;  3A1Q A;  2I38 A;  4US9 A;  2CR5 A;  1ZUD 2;  4HEA 1;  4DXF A;  4PYU A;  4C80 A;  5AEK B;  3Q3O C;  1QOG A;  1N5X A;  4C00 A;  3ZJT A;  1C77 A;  2D3C A;  2JT4 B;  4ANW A;  1C3T A;  4W9C A;  5C3J B;  4M01 A;  3O65 B;  1GPX A;  1DGJ A;  2XEW A;  2BQQ A;  2X8X X;  3PRZ A;  5IN7 A;  2RR9 A;  4JWS C;  1SIJ A;  2IJ0 A;  4EOY A;  3QAR A;  4NQK E;  3NVW A;  2I1K A;  3A9J B;  3B0A A;  2B76 B;  2MEK A;  5CHV C;  5JH5 C;  3RZW C;  1HA5 A;  2ICI A;  3PVL A;  3VUW A;  1EUV B;  1XF5 L;  1UH6 A;  4FBJ B;  3AE5 B;  1QLB B;  4JE3 B;  1GAQ B;  2QIL A;  4DDG D;  3DVN V;  1F77 A;  5JZE B;  1ACC A;  2KWC A;  3B1L X;  5JHA A;  3R66 C;  3PHW B;  1GC6 A;  3I57 A;  4NAW A;  3ZNH B;  1WJU A;  4KGS A;  3CMM B;  4JL9 A;  2AQ1 B;  3EUB 2;  3MHZ A;  3UF8 A;  5H92 C;  4LLG M;  4PT5 A;  3TEY A;  2OJW A;  2R61 A;  4PYZ A;  3AEB B;  4DQO C;  4LCD E;  4HWI B;  1XD3 B;  3AEF B;  4RMA A;  3QC8 B;  1I4R A;  3TUO A;  2KZR A;  3NVV A;  4EEW A;  2ZW1 A;  5BYR A;  1A5R A;  2DLB A;  1GOZ A;  1V8C A;  2L0F A;  1WRI A;  4BVU C;  4M0W B;  1TT5 B;  2PKO A;  2KYW A;  5JHB A;  3CF6 E;  3SFE B;  2ACZ B;  3ZLZ A;  1OQQ A;  1VZ7 A;  2PMV A;  1JW9 D;  3RYT A;  1RFA A;  2RSU A;  5CX3 A;  5D2M B;  4DHJ B;  2LHE A;  2ZNV B;  4JX1 C;  2GLS A;  2LRU A;  4TUU A;  4DK5 A;  1KLV A;  2W3R A;  5GXG B;  1F0Z A;  2JRH A;  4MH8 A;  5AZG A;  2KQ4 X;  2KWU B;  3WA0 A;  1WGD A;  3ZKJ C;  4MGI E;  1E0Z A;  1C79 A;  2G1E A;  2MA9 B;  1QOB A;  4S0R A;  2GBR A;  1SJH D;  2MLB A;  2WXM A;  3EEC A;  2MJD A;  2FUG 1;  3W1Y A;  1ZE3 D;  3GOE A;  4BBN C;  3LJ3 A;  4NJC A; 
#chains in the Genus database with same CATH homology
 3IFW B;  4ZDV A;  4GOC A;  3ZDT A;  2AWT A;  1MG8 A;  2C7H A;  2DYB A;  2BGF A;  4G11 A;  2NPT A;  4JLC A;  4KV2 A;  5DPR A;  3M62 B;  1I42 A;  1CMX B;  2ZPY A;  2LRW A;  2ZVN A;  5G55 A;  2KDF B;  1PQS A;  2NBW B;  3U7D A;  3DVG X;  3KH0 A;  2DZK A;  4G3X B;  1WMH B;  1KJT A;  3DQV A;  4LDT B;  3AUL A;  4WQO B;  3I3T B;  5CTR C;  2K8B A;  1WYW B;  2WX1 A;  3QWZ B;  4EKU A;  3MJW A;  4P7I A;  2IYD B;  3RT3 B;  5G2N A;  4HPL B;  3L17 A;  3JSV B;  2CHW A;  5E6P A;  4ANU A;  2EMS A;  2L8J A;  2JXX A;  4HK2 A;  3APC A;  4EZJ A;  2HTH A;  2MQJ A;  4TQ1 A;  1LXD A;  2N1W A;  2BPS A;  3ALB A;  4IW0 A;  3ZRF A;  1WGR A;  4MGZ E;  4BOS C;  1WY8 A;  1YIW A;  3A9K B;  4W9H A;  4AOF A;  1YX6 B;  2JRI B;  1L2N A;  2KQ7 A;  1WH3 A;  1OQY A;  5J17 A;  4YL8 A;  2DAJ A;  3ZTC A;  3UQB A;  2GOW A;  3ML8 A;  3ZW3 A;  5D94 A;  5E6O A;  2JVC A;  2KXJ A;  3SHQ A;  3ZDM C;  1C1Y B;  2M17 A;  2D3G A;  2NBV B;  4IWP A;  5DPT A;  2O2V B;  1WR6 E;  4RM8 A;  3TCA A;  1GUA B;  2Z0D B;  4OVU A;  1XQQ A;  2WWZ A;  1WXV A;  5GMV A;  3WIM A;  4WJQ A;  2XK5 A;  1UGM A;  2LWP A;  1Y8R C;  4BKG A;  2Y5B B;  3PT2 B;  3VUY A;  3DPD A;  3ZO5 B;  1WX8 A;  4CYE A;  1RAX A;  2ASQ A;  1VCB A;  2KD0 A;  4MH0 E;  3M63 B;  3VVW B;  4TQ0 A;  2LD9 A;  4GN1 A;  3MTN B;  1WJ6 A;  1V6E A;  4HLE A;  2DEN B;  3PV1 A;  3M3J A;  2J7Q B;  1V5O A;  3HK0 A;  4HVB A;  4A3P A;  3JYU A;  4PS3 A;  4BBN F;  2PE6 B;  3X0W A;  1WMH A;  4FJY A;  5J18 A;  1E8X A;  1QZE A;  1AAR A;  3AXC A;  5DPW A;  5EDS A;  1X1M A;  3K9P B;  3NS8 A;  2G4D B;  1GNU A;  1E8W A;  3JSV A;  3OJ3 A;  3OJ4 B;  2KLG A;  3PZD A;  3UIO B;  3QX1 A;  1SIF A;  1TZ1 A;  3PPA A;  2LAS A;  3KUD B;  4WAA A;  4B6W A;  4TKN A;  2NCN A;  3ZVV A;  2KC2 A;  1V80 A;  1KOT A;  1LQB A;  3BY4 B;  3A9K A;  3L13 A;  4MSQ B;  2KX0 A;  3HM6 X;  4OVV A;  4GGQ A;  4KIK B;  2KJH B;  4FJV B;  3VXW A;  3TL5 A;  2DHZ A;  4W9L A;  2YLM A;  3NY5 A;  3V6C B;  4IM2 A;  1G6J A;  2MBH A;  3U30 A;  1P98 A;  2HE7 A;  2G3Q B;  2ZCB A;  4GDK A;  2FNJ B;  4NJ6 A;  4DDI D;  3B08 A;  2FAZ A;  1NI2 A;  3APF A;  4BKT A;  1WE6 A;  2MCN B;  3V6E B;  2L00 B;  3N32 A;  3VHT C;  1IP9 A;  4WJO A;  4KZC A;  2I1J A;  5IAA C;  2V4L A;  1WX7 A;  2N1V A;  5DCN A;  2N7D A;  3V60 A;  1IPG A;  4N9F 4;  2PJH A;  3DCG A;  2FID A;  4MGY E;  4WWO A;  4B9K A;  1V49 A;  2XK5 B;  3L0W B;  1KM7 A;  5FR6 A;  3VQI A;  4DHZ E;  2KHW B;  4LJP B;  2EMT A;  2L7R A;  2PPH A;  4M8M A;  1WR1 A;  1WI0 A;  2K6Q A;  4BKS A;  3DDC B;  2MW5 A;  1E7V A;  4HXD A;  3H7P A;  1E5W A;  4DHJ D;  2LVP A;  2V3S A;  3M95 A;  4GDL A;  2C7N B;  3QAQ A;  3V62 A;  4IWO A;  2MSE D;  1P0R A;  4W9F A;  4HDQ A;  3GZN I;  1P9D U;  5AZH A;  2KFK A;  2BF8 B;  2PEA A;  3QK0 A;  1SE9 A;  2C9W B;  4MM3 A;  2KTR B;  3DVG Y;  2LVO A;  1OTR B;  1RLF A;  4E74 A;  2KAN A;  4I6L B;  1TTN A;  2D07 B;  4I6P A;  1WXS A;  3R7R A;  1ZW7 A;  2BKF A;  3Q3F A;  4GIV A;  4AUQ C;  2CS4 A;  2MX2 A;  5CHW A;  3DBL I;  2D2Q A;  1V5T A;  2ZZP B;  2BKR B;  2FCN A;  3KYD D;  2IO2 B;  2MBB B;  3D32 A;  2JUO A;  3UQA A;  3IG3 A;  4ANX A;  2EKE C;  3SDL C;  1WM3 A;  2KLC A;  4IC7 B;  4KIK A;  2KDB A;  2D11 A;  3LDZ E;  3DBH I;  2O6V A;  3VTW A;  2K39 A;  2IZV B;  1S1Q B;  1E8Y A;  2IY0 B;  3L08 A;  3T8M A;  3ZUN A;  1E8Z A;  3UGB B;  4WJP A;  4E3C A;  4FAD A;  3KYC D;  2CHZ A;  4HJK A;  4DHZ B;  3TMP B;  1RRB A;  2DZI A;  1GG3 A;  2C7M B;  3SD5 A;  2JPH A;  4W9K A;  2JZ3 B;  4GDK B;  4TV3 A;  1UBQ A;  4A20 A;  2K6D B;  2KMC A;  4WWN A;  3JVZ X;  3NHE B;  3R3M A;  4M8N A;  3WAP A;  2OOB B;  3ENE A;  2IO3 B;  3HIZ A;  4I6N B;  4ICU A;  5D7G A;  2A4Z A;  2FCS A;  2FUH B;  3CST A;  2CHX A;  2M0X A;  2UWQ A;  1WGY A;  2NR2 A;  3UIP B;  2R2O A;  1WIA A;  2W9N A;  3RZF A;  2M1M A;  2NS5 A;  3P2B A;  4W9I A;  2KKC A;  4HCN B;  2WYQ A;  2CKH B;  1OEY A;  1OGW A;  2C5L C;  2YVC A;  4ZRK A;  3X23 A;  3ONS A;  2AL3 A;  4E71 A;  2ZVO A;  4K81 A;  3WAM A;  1P1A A;  1E90 A;  3ZNZ B;  4ANV A;  1WZ3 A;  2Z0E B;  2IBI B;  3H7P B;  3PHX B;  2DZM A;  2GBJ A;  3VH4 B;  4GDL B;  3IVF A;  2ZEQ A;  4MSM B;  1WRD B;  2UYZ B;  2KTR A;  2C60 A;  4GB9 A;  2D10 A;  1WGG A;  3H9D A;  1J19 A;  2LGX A;  2M4N A;  2KFK B;  3DBR I;  4HPM B;  5L83 A;  4G0N B;  3HM3 A;  4EFO A;  2M8S A;  4FJZ A;  1EF1 A;  5C23 A;  2N9E B;  3A9J A;  3DOW A;  4NNJ B;  5L95 C;  1Q0W B;  1WGH A;  4AWJ A;  2K8H A;  4FHJ A;  5HKH A;  2KN5 A;  4ZRI A;  3TJP A;  2N9X A;  3H1U A;  1P3Q U;  1WF9 A;  1WXA A;  1SGH A;  2K25 A;  4LJO B;  2GMI C;  1J0G A;  2K8C A;  3L10 B;  4K7U A;  2JWZ A;  4F7Z A;  2CU1 A;  3R7Q A;  1E7U A;  2O6V B;  1EO6 A;  3RUL A;  3KUZ A;  1YD8 U;  2BYF A;  3A33 B;  2KO3 A;  3PSE B;  4GU2 A;  2LI5 A;  4KZ0 A;  5CHF A;  3PRE A;  2MBE A;  2Z59 B;  2VRR B;  3H6N A;  5LLI A;  4FN2 A;  3IBE A;  3OAW A;  1R4M I;  1WJ4 A;  2J0K A;  1H8C A;  4KSK C;  4HDO A;  1U4A A;  2GBK A;  4FHK A;  2AYO B;  3AI5 A;  2JY6 A;  4AP4 C;  2B3A A;  3WAN A;  3NZS A;  3VH3 B;  4G50 A;  2WX0 A;  3TBL D;  2REX A;  4NAW B;  3UIN B;  2KVR A;  4NY0 A;  2G4S A;  3QCA A;  2MP2 B;  2LXC A;  3A1Q A;  4WJN A;  2BYE A;  3DBS A;  2CR5 A;  1NDD A;  2KWV B;  2L0T A;  4HCP B;  3AU5 A;  2DAF A;  5DPS A;  2AL6 A;  4PYU A;  3VTV A;  2MBQ A;  5AEK B;  3PRP B;  4NQL B;  4KDI C;  4XX5 A;  4NJ7 A;  2XBB C;  2JZZ A;  4J6I A;  3VUX A;  2JT4 B;  2RD0 A;  1ZKH A;  1ZGU B;  4ZRJ A;  3AU4 A;  1HE8 A;  1NBF C;  4W9C A;  2HD5 B;  4ANW A;  3O65 B;  1XT9 B;  1C3T A;  2KJ6 A;  2XEW A;  2MBO A;  2KDE B;  1L7Y A;  3PRZ A;  2RR9 A;  3PGE A;  4EOY A;  3EHV A;  3QHT A;  3QAR A;  4NQK E;  3WAO A;  1WM2 A;  2I1K A;  2BWF A;  2JF5 A;  2MWS B;  2J0J A;  3A9J B;  2LZ6 A;  3B0A A;  3QA8 A;  1F9J A;  1GC7 A;  1J8C A;  1T0Y A;  2BWE S;  3A4R A;  5CHV C;  2LVQ A;  5JH5 C;  3ECI A;  4BFR A;  2L3Z A;  3NOB A;  1Z5S B;  1TGZ B;  3RZW C;  2FCM A;  2K1F A;  4KVG B;  3RUI B;  2LJ5 A;  3T9L A;  3PVL A;  3N3K B;  2ZPN A;  2KDI A;  2WDT B;  3VUW A;  1EUV B;  1UH6 A;  4W9G A;  1LM8 B;  3W1S A;  4FBJ B;  2N4F A;  5LXH A;  1UZX B;  1D3Z A;  2DYO A;  3VDZ A;  1UD7 A;  1IYF A;  1LFD A;  2LUE A;  2KJR A;  1FXT B;  4GSW A;  4W9J A;  1WFY A;  4DDG D;  3QJZ A;  4DBG A;  3DVN V;  5JZE B;  2RPQ A;  2V1Y A;  2KFJ A;  4JIO U;  1YQB A;  2KWC A;  2KOX A;  3B1L X;  3IHP C;  2RGF A;  1V9J A;  2HJ8 A;  2KNB A;  3DVN U;  3PS6 A;  5JHA A;  3C0R B;  2KX3 A;  3R66 C;  3PHW B;  2KMA A;  1GC6 A;  4GXB A;  4NAW A;  2GBN A;  3ZNH B;  1WJU A;  4NPN A;  3ZTD A;  1H4R A;  1WX9 A;  3CMM B;  2MP2 A;  4JL9 A;  4W9E A;  4EZL A;  4IG7 B;  4LDT D;  1YJ1 A;  4ICV A;  2A5U A;  4URK A;  2IO0 B;  4II3 B;  3A1Q B;  3UF8 A;  4II2 B;  1V86 A;  1YX5 B;  4GMV A;  4JGH B;  3QIJ A;  3W1S C;  4F1S A;  5KHO A;  1I35 A;  2KC1 A;  4FUL A;  2ZNV C;  3PLV A;  4PYZ A;  4XC2 A;  1Q1O A;  3U8Z A;  4EZK A;  3KW5 B;  2PE9 A;  3SU8 X;  2IY1 B;  4LCD E;  4X57 B;  4HWI B;  3VTU A;  3ZNI D;  1Q5W B;  4K7S A;  4PS8 A;  4IUM B;  1XD3 B;  4RMA A;  4B95 A;  4PS7 A;  2DZJ A;  2NBU A;  4K7W A;  3NZU A;  1BT0 A;  3QC8 B;  4A3O A;  3L54 A;  3KVF B;  4DWF A;  5LXI B;  2KZR A;  1TBE A;  4EEW A;  4FA6 A;  2LGD A;  3V61 A;  1A5R A;  3RD2 A;  3BIN A;  1S3S G;  4MJS B;  2L0F A;  4IWQ A;  4KDL B;  4BVU C;  4M0W B;  5J2R A;  4FLH A;  3H7S A;  4CO7 A;  2NPT B;  1WXM A;  3Q3J A;  5JHB A;  4CHK A;  3CF6 E;  5KHQ A;  3ZNG C;  2FCQ A;  3N30 A;  4KSL C;  3ZLZ A;  4DXA B;  4AJY B;  4ZYN A;  1V2Y A;  3OLM D;  2LXA A;  5D6J B;  5IA7 A;  4WWP A;  5BO4 B;  2KK8 A;  1M94 A;  3K9O B;  4K1R B;  4ASW C;  3PTF C;  2MRP A;  3RYT A;  5E6N A;  1Z2M A;  1RFA A;  2RSU A;  5CX3 A;  1UEL A;  2ZCC A;  2J0M A;  3ZRC A;  1V81 A;  2ZJD A;  5D2M B;  4RM9 A;  4DHJ B;  2ZNV B;  2LRU A;  4BKS D;  4TUU A;  4EUT A;  4DK5 A;  2IO1 B;  2N7E A;  1KLV A;  1R4N I;  1OEY J;  2OJR A;  1WZ0 A;  1ISN A;  4JQW C;  2L05 A;  3WAL A;  3JW0 X;  2JRH A;  3L16 A;  3A4S C;  3RCZ A;  3EC8 A;  4MEL A;  3APD A;  1WJN A;  4IM0 A;  5AZG A;  3ZIM A;  4F8C B;  1WE7 A;  2NVU I;  1GJZ A;  2KWU B;  3WA0 A;  1WGD A;  4XZ4 A;  3PLU A;  3VFK A;  3ZKJ C;  3TIX A;  1VD2 A;  2N9P C;  3MHS D;  4MGI E;  2FIF A;  2KQS A;  2O2V A;  3ML9 A;  3HHM A;  1JRU A;  2DYM A;  2G45 B;  2L76 A;  5C1Z A;  1EF5 A;  2MA9 B;  3PRM B;  3VAW A;  2QHO A;  1K8R B;  4MEM A;  2GBR A;  2LGY A;  2MLB A;  3S2A A;  3EEC A;  4MGK E;  5AZF A;  2R2Q A;  4IM3 A;  3KUC B;  2DX5 B;  4AJW A;  4BOZ B;  3QQ8 B;  2O6V D;  3CSF A;  3W1Y A;  2GBM A;  3GOE A;  2KTF A;  2AEH A;  4BBN C;  3LJ3 A;  4MDK E;  1UBI A;  2BYV E;  4W9D A;  4MJS A;  3EFU A;  5TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...