4GDKA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin-like protein ATG12
total genus 18
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdkA00
2MBEA 2CHXA 4G11A 4K7WA 2NBWB 1WGYA 2AL6A 3H9DA 3PVLA 4ANWA 4DBGA 4LDTB 1G6JA 4MELA 2O6VB 3DDCB 4NQKE 4FN2A 2YVCA 2LZ6A 2KFKB 2HTHA 2KKCA 1E8XA 4W9FA 4EZKA 2DX5B 4FBJB 4RM8A 3MJWA 1KOTA 3RZWC 2BYEA 2K25A 2MBBB 3R3MA 2J0MA 2G4DB 2AEHA 3AU5A 4EZLA 1NBFC 1P9DU 2NCNA 4W9GA 3CF6E 2LGYA 2N1WA 3HM6X 2NBUA 3PSEB 1WIAA 4GDLA 4PS7A 2FCNA 4DHJB 3VDZA 4EOYA 3H7SA 2KTRB 4WJPA 2L8JA 2JY6A 4AJYB 3RCZA 4W9HA 1V6EA 2OOBB 3UINB 4BOZB 1E7UA 4FA6A 4DK5A 3ML8A 2NVUI 2MBOA 2XK5A 1V5TA 4GGQA 4HWIB 1WX9A 4W9KA 3WAOA 2KANA 1WH3A 1YQBA 1V86A 1UD7A 2DYOA 2NPTA 3BINA 2LI5A 3TBLD 1C1YB 1WM3A 2GOWA 4MDKE 2K8HA 2WX0A 2O2VA 4ZRKA 3VUYA 1WE6A 4F7ZA 3HHMA 1YJ1A 4HPMB 3UF8A 2ZJDA 2VRRB 3W1SA 4F8CB 2XK5B 3PS6A 5E6OA 3R66C 1EUVB 3OJ3A 3KUZA 2AYOB 2B3AA 5D94A 3ZW3A 3CSTA 2J7QB 2LRWA 2MA9B 1IYFA 3PREA 3HIZA 2KJ6A 4JQWC 1LM8B 2MSED 4XZ4A 5LLIA 3ZDTA 1PQSA 1OGWA 5D2MB 1EF1A 2L3ZA 2PEAA 1WZ3A 4BBNF 4KVGB 1UELA 1C3TA 3PZDA 3H6NA 3PT2B 3QCAA 4NJ6A 2XEWA 4E74A 3DQVA 3A9JB 4YL8A 2MW5A 4LJPB 2QHOA 4P7IA 5BO4B 3WIMA 1V5OA 2LVQA 3IFWB 5DCNA 2HE7A 2K1FA 1ZW7A 2KTFA 3VH4B 2YLMA 4KDIC 1K8RB 4X57B 4CYEA 2JPHA 2CU1A 2ZNVB 2KFKA 4BKSD 1WJUA 2FCSA 2IY0B 3APCA 3P2BA 4JGHB 3TJPA 1WXAA 3AXCA 3N32A 2GBNA 4ZRIA 3UIOB 1TZ1A 5J2RA 3PRPB 4DWFA 5IA7A 3QX1A 2JRHA 3N30A 4HDQA 1TBEA 2LUEA 1WY8A 2MBQA 3ECIA 1TTNA 2JVCA 4BKSA 3DPDA 3N3KB 2MQJA 4GN1A 4E3CA 2KOXA 5E6NA 1WXVA 2ZPYA 1UGMA 2LVOA 3K9PB 2N9PC 1E7VA 1RLFA 2G4SA 4K7SA 4IUMB 2V1YA 2IY1B 3CSFA 1RRBA 1WMHB 3JW0X 3QARA 4HPLB 3ZNGC 1WR6E 3ZLZA 2WYQA 2PPHA 2JF5A 2KDIA 2L7RA 3A4RA 4EEWA 2NS5A 3B1LX 5CTRC 3ZRCA 4GU2A 4IWQA 3QJZA 2KDEB 2Z0EB 1V81A 2R2OA 4AUQC 2C9WB 1WMHA 2Z59B 3WAMA 4ANVA 2JRIB 3L54A 3IHPC 1IP9A 2DZJA 4MH0E 2WWZA 2KMAA 4HDOA 3T8MA 3R7RA 4ASWC 3PRMB 3T9LA 2G45B 5L95C 4BOSC 4JL9A 3SU8X 3VH3B 2M0XA 2RPQA 1VD2A 3U7DA 2K6DB 4WAAA 4WWOA 4XX5A 3ZO5B 1ISNA 2FIDA 3PV1A 3A9KB 3AULA 2KN5A 2CR5A 3NS8A 3ML9A 5DPWA 2I1KA 4G50A 3DCGA 2D3GA 1XD3B 3NZSA 2BWES 2D11A 2L00B 1WRDB 1FXTB 3QHTA 2RSUA 3ZNID 2D2QA 4FADA 3B0AA 1T0YA 1P3QU 5J18A 3A9KA 4IW0A 3SHQA 2N4FA 3V6EB 1UZXB 3R7QA 3VQIA 5CHFA 1RFAA 5E6PA 4MGKE 1S1QB 4DHJD 2KXJA 2KLCA 3VAWA 2MLBA 5JHAA 4DDID 2JWZA 4GXBA 2IO2B 1L7YA 4E71A 4GDKA 3DOWA 4B9KA 2M1MA 5KHOA 2EKEC 5LXIB 4LCDE 3DVGX 1Z5SB 3EECA 2HJ8A 3K9OB 5AZFA 4GOCA 1V9JA 1WM2A 3H1UA 5AZHA 2KDBA 4BFRA 4GIVA 2FAZA 5EDSA 2DZIA 4KDLB 4M8NA 2AWTA 2IO1B 3ZDMC 1R4NI 2M17A 2FIFA 5HKHA 1D3ZA 4I6LB 2M4NA 4WQOB 4FJZA 3RZFA 3QWZB 5CX3A 4NAWA 2BPSA 3UQBA 3VFKA 3ZNZB 1NDDA 4TKNA 4W9IA 3U8ZA 2CHZA 2ZCCA 3APDA 3Q3FA 3HM3A 3QQ8B 4ICVA 1V80A 1GJZA 1H8CA 1WXSA 1WGGA 2KFJA 1WJ6A 2JUOA 4RMAA 3C0RB 1I35A 3SD5A 3UIPB 1LXDA 4A3OA 2C5LC 1U4AA 1KM7A 2FCMA 2LD9A 4MM3A 3QK0A 2JZZA 3PHWB 2K8CA 4IM0A 2L05A 4KZ0A 1OEYJ 4W9EA 1P0RA 3TCAA 2L0TA 4IM3A 1SGHA 3DBRI 2RGFA 2C7HA 4KZCA 3VTVA 5DPSA 1S3SG 1SE9A 2ZZPB 2KWVB 2BF8B 2NR2A 3ZIMA 3IVFA 5AZGA 3A33B 2LWPA 4BVUC 3DVNU 4MSQB 3TIXA 1LFDA 1GC6A 1EF5A 3AU4A 4GDKB 5JH5C 4NJ7A 2OJRA 2N1VA 3ENEA 2L0FA 3WALA 3ZRFA 2CS4A 1HE8A 4KV2A 5LXHA 4JIOU 3IG3A 3ZVVA 4GMVA 3S2AA 3PHXB 4ICUA 2DZMA 4KSLC 1KJTA 3KYCD 2ZVOA 4FHKA 2EMSA 4MJSB 3LJ3A 5C23A 1XQQA 4FULA 3LDZE 2J0KA 4OVVA 3DBLI 4ZYNA 4EKUA 4B95A 3ONSA 4ZDVA 1WYWB 2M8SA 3OJ4B 4KIKA 2KDFB 1P1AA 3ZTDA 4AP4C 3AI5A 1RAXA 4PS8A 2KQ7A 3X23A 1GUAB 4JLCA 1TGZB 2N9XA 4A3PA 1M94A 4WWNA 2BYFA 4MJSA 5G55A 2HD5B 1GNUA 1MG8A 1SIFA 4LJOB 4K1RB 5CHVC 4DHZE 1E8ZA 4WJOA 3BY4B 2KNBA 4DXAB 3W1SC 2K8BA 2G3QB 3GZNI 1WR1A 2KWCA 1XT9B 3PLUA 3JYUA 4WWPA 5DPRA 1F9JA 3PTFC 4W9JA 2ZVNA 5TR5A 1H4RA 2GBMA 5D7GA 3L10B 4HJKA 3MHSD 2KMCA 2UYZB 1UBQA 4N9F4 2KD0A 1AARA 2O2VB 4CO7A 3WAPA 2DHZA 2DYMA 4W9LA 3GOEA 3M63B 4TQ1A 1Y8RC 2KHWB 4KSKC 2CHWA 2MX2A 2N7DA 1V2YA 2DAFA 2IYDB 2ASQA 1WJNA 4J6IA 2JXXA 3ALBA 3VUXA 2C7NB 3TL5A 4EZJA 4WJQA 2O6VA 2C7MB 3L13A 1GG3A 1WI0A 1IPGA 2UWQA 3ZNHB 1X1MA 2A5UA 1GC7A 1WFYA 3PPAA 1YX5B 4PYZA 3VVWB 2XBBC 3RULA 5AEKB 5JZEB 2BKFA 4HCNB 5D6JB 2N7EA 3O65B 3KW5B 4GSWA 1Q0WB 4I6NB 2KQSA 3L08A 3KUDB 1WX7A 3KUCB 3KH0A 4GDLB 4NQLB 2LJ5A 3RYTA 2MRPA 1UBIA 4EFOA 3M95A 1VCBA 1YIWA 3DVNV 4M8MA 3VTUA 2WX1A 3W1YA 2V3SA 2LASA 3RD2A 3UGBB 2KK8A 4FLHA 4KIKB 2KJRA 5FR6A 2KO3A 2MBHA 3I3TB 1UH6A 3JSVA 4FJVB 3QC8B 1ZKHA 1LQBA 4IM2A 4NPNA 3WANA 1WZ0A 4RM9A 2A4ZA 1WXMA 2KX3A 4G0NB 4F1SA 2KWUB 3DVGY 2C60A 2AL3A 4GB9A 1V49A 2EMTA 4WJNA 4ZRJA 2JZ3B 2DENB 4MSMB 2Y5BB 4B6WA 2ZEQA 3JSVB 2LXCA 3EFUA 4NAWB 4HXDA 2IO0B 4HLEA 1E90A 4W9DA 3ZUNA 1Q1OA 3A4SC 2GMIC 1OEYA 2K39A 1P98A 3MTNB 3OLMD 2LGXA 2N9EB 3PGEA 4IC7B 3NOBA 2D07B 2BGFA 1EO6A 3B08A 2REXA 4OVUA 3M62B 4MGZE 2ZCBA 4IWPA 1CMXB 4BKTA 2MP2A 4EUTA 1ZGUB 2GBJA 3DBHI 2GBRA 2BWFA 3M3JA 2PE6B 5J17A 3A9JA 3EC8A 4II2B 2LGDA 4A20A 2LRUA 3EHVA 2KX0A 1QZEA 4FHJA 1JRUA 2O6VD 2PJHA 2R2QA 2W9NA 4MGYE 3WA0A 4TQ0A 1E8YA 2NBVB 3APFA 2DZKA 3ZTCA 3D32A 3IBEA 1WGRA 4NNJB 3TMPB 2DYBA 4MEMA 5CHWA 1WX8A 4FJYA 3SDLC 2K6QA 5L83A 3NHEB 3VHTC 1OQYA 2IBIB 4IWOA 5DPTA 4BBNC 2LXAA 2MCNB 4K7UA 3CMMB 1WE7A 2KC1A 2JT4B 2MWSB 3A1QA 3PLVA 2FNJB 4K81A 4URKA 1WGDA 4ANXA 4II3B 2IO3B 2L76A 1I42A 3HK0A 4NY0A 1Z2MA 2CKHB 2DAJA 2IZVB 4G3XB 4HVBA 3RT3B 3V62A 2BKRB 2KC2A 2KLGA 3KVFB 4IG7B 1L2NA 3VXWA 3L16A 3KYDD 4ANUA 4DHZB 5C1ZA 3ZKJC 3A1QB 2KTRA 3V60A 3VUWA 1R4MI 4AOFA 2BYVE 4CHKA 1WF9A 3QAQA 1BT0A 4LDTD 2I1JA 3NY5A 1A5RA 3QIJA 2FCQA 4W9CA 5KHQA 4HCPB 2KJHB 4MGIE 2D10A 4AWJA 1NI2A 1YX6B 2RR9A 3JVZX 3U30A 2NPTB 2RD0A 3RUIB 5IAAC 2FUHB 1E5WA 3VTWA 2KVRA 2PE9A 4PS3A 1J0GA 2LVPA 2WDTB 3L0WB 1E8WA 3OAWA 5GMVA 1WJ4A 4M0WB 3DBSA 2V4LA 4I6PA 3NZUA 2MP2B 1OTRB 3Q3JA 4PYUA 3V61A 3H7PA 1Q5WB 2J0JA 3X0WA 4BKGA 4AJWA 3UQAA 5JHBA 1WGHA 4XC2A 3V6CB 5G2NA 1J19A 2ZNVC 2GBKA 3L17A 4TUUA 4DDGD 4TV3A 3QA8A 2Z0DB 2KZRA 3PRZA 1J8CA 1YD8U 3H7PB 1KLVA 2ZPNA 4HK2A
chains in the Genus database with same CATH superfamily
2CHXA 4K7WA 2MJ3A 3AE7B 3PVLA 1D5ZC 1G6JA 4MELA 3I63C 4MM3B 2INNE 4NQKE 4FN2A 2KFKB 4W9FA 1PFDA 3BK2A 4RM8A 3MJWA 2H88B 2MBBB 2KDMA 2G4DB 2AEHA 2INDC 2LGYA 1WIAA 4XDCA 1WRIA 2FCNA 3BK1A 4WJPA 2JWUA 4AJYB 3RCZA 1E7UA 1ENFA 4XGAB 3C8YA 5H92C 4GGQA 3Q8BA 3V3XA 2KANA 1UD7A 3CIRB 2WX0A 2O2VA 1YJ1A 4HPMB 3W1SA 4F8CB 2XK5B 3BVGA 1ZOYB 3EA6A 3URYA 4LNOA 2J7QB 4JQWC 1VZ7A 2IPKD 1OGWA 5D2MB 1EF1A 4LNKA 1WZ3A 4IDIA 4L23A 3WIMA 2PVGC 3IFWB 2HE7A 2K1FA 2DLBA 2FBWB 1KTKA 3GS2A 1K8RB 3WCQA 2Z8LA 3TJPA 1TS4A 3TEZA 2K5PA 3N32A 1TZ1A 5J2RA 1TBEA 4ZRQA 2LUEA 1WY8A 4BKSA 2MQJA 5EE0A 4E3CA 2KOXA 1WXVA 3ABVB 4HPPA 3AEAB 4KGSA 1YNTE 1RLFA 4WIPA 1WXQA 1E0ZA 1WMHB 3QARA 1SE2A 4HPLB 3MHZA 1UWXA 4ARCA 2JF5A 2KDIA 3A4RA 4O1NA 4QAYA 1DOIA 4GU2A 3QJZA 2Z0EB 2Z59B 3L54A 3IHPC 2KMAA 4M02A 4YTNB 5EE9A 3PRMB 1V1PB 5L95C 4BOSC 2OJWA 1EWYC 3VH3B 2M0XA 3U7DA 2LHEA 2XN9C 2CR5A 4XWTA 2LEKA 1XD3B 2L00B 1K52A 2W3SA 3MFGA 3QHTA 3B0AA 1P3QU 2ZW0A 3AV8A 4DQOC 4K3CA 5CHFA 5E6PA 1YN5A 1C4CA 3I57A 3ETRA 1E7PB 2KXJA 2JWZA 2JQRB 4YWGG 2M1MA 1XCQL 4YSYB 5AZFA 3MP9A 1WM2A 2KDBA 2KVZA 2FAZA 1ZP0B 2AWTA 4C4VA 3MJ5A 2FIFA 1HTOA 2KN4A 5FR3A 2WXPA 4M0WA 1MI0A 4RF0A 5CX3A 4NAWA 1JWAD 2BPSA 3RNGC 3VFKA 1TKYA 3HM3A 2Y5CA 2QJLA 3P4QB 2FCMA 2LD9A 4MM3A 3QK0A 3PHWB 2K8CA 4KZ0A 2L05A 3BWUD 1OEYJ 1UNSA 3W5VB 3DWGC 3DBRI 3VR9B 1SE9A 2ZZPB 4BAXA 1F77A 3HRDD 2NR2A 2YEPF 3IVFA 5AZGA 2RDHA 2GLSA 1XCTL 2LUMA 1EF5A 2WQYB 4NJ7A 3ZRFA 4ZHPA 1N62A 4JIOU 5FKAC 1AN8A 4LLGM 2DBYA 3KYCD 5C23A 2EMSA 3LJ3A 1XXGA 4B95A 2M8SA 3OJ4B 5IP4D 3RFZB 3ZJTA 3ZGZA 2BS3B 3P63A 4WWNA 5C3JB 5G55A 1T6BX 4OHJA 4WJOA 1T0SC 1TIFA 4DXAB 1JROA 1YOVB 4OW0A 1WR1A 1XT9B 4WWPA 3JYUA 3PTFC 2L1AA 1ET9A 2WS3B 1H4RA 2GBMA 1L6VA 1R7SA 4HJKA 1UBQA 2H89B 2KD0A 1AARA 1SBBB 4N59A 4US8A 1Y8RC 2QSDA 1D5XC 4KSKC 1EWCA 2J53A 3VUXA 2BS4B 2C7NB 1M4VA 4EZJA 2R61A 4YSZB 2UWQA 5BMHA 2A5UA 5AEKB 1WFYA 2MJDA 5JZEB 4BZAA 2N7EA 3O65B 3KW5B 4GSWA 3L08A 4EFOA 2QDFA 2LJ5A 2MRPA 1UBIA 1YIWA 2V3SA 1SSNA 3UGBB 2KK8A 5FR6A 2KO3A 2BB6A 3JSVA 2M19A 1ZKHA 4NPNA 1L4ZB 4WAFA 4KKJA 4F1SA 4GB9A 2AL3A 2EMTA 2VH2A 1TKEA 1ZPSA 3AB5A 4ZRJA 2JZ3B 2ZEQA 4HXDA 1E90A 3H8HA 3VRBB 1D5MC 2K39A 2Y5PA 4HKQA 2N9EB 3RNCC 3PGEA 3NOBA 3N1YC 2BGFA 2VZKB 2PW9A 2BWFA 3M3JA 4MT5A 3B9JA 4II2B 1KH0A 2LGDA 4A20A 2BVCA 4FHJA 3BYYB 2NBVB 1WGRA 5CHWA 5BMGA 2K6QA 2WLBA 2IBIB 1N6ZA 4DXFA 1FCLA 1WE7A 2J52A 2JT4B 3NVYA 2MWSB 1FPYA 3A1QA 2FNJB 2RMMA 4ZHOA 1WGDA 2L76A 1NENB 2HDEA 2QIEB 3RNAC 2L83A 4G3XB 1I4XA 3GB1A 3KVFB 1L2NA 4IG7B 1P7EA 2KTRA 3VUWA 1YQ3B 2SAKA 3LYYA 2RR9A 1YN4A 3ZJUA 4HRSA 2LVPA 3L0WB 1TS2A 3OAWA 3MC8A 2V4LA 1JWBD 2MP2B 4K3BA 2J0JA 3X0WA 4BKGA 1CQVA 1WGHA 1GB4A 3AE4B 1ZE3D 3P42A 3Q6BA 3QA8A 1RWSA 5JXVA 1YD8U 2LHDA 3R2TA 4DBGA 2YVCA 2CJOA 2HTHA 4EZKA 1C77A 2DX5B 1KOTA 2KMMA 3RZWC 2K25A 2BTEA 2J0MA 4EZLA 1N61A 1P9DU 2N1WA 3HM6X 3PSEB 2NBUA 4EOYA 3OG5A 2QCZA 2HJ1A 1L4DB 1LGRA 3Q8AA 3R8BA 1V6EA 3UINB 4J3OD 5HI1A 1IGDA 4DK5A 3ML8A 2NVUI 2MBOA 2K3UA 2XK5A 3SFDB 2K22A 3GE3C 3WAOA 2DYOA 2V0GA 2NPTA 2LI5A 4ZOHC 1T0QC 3BVMA 4MDKE 4ZRKA 3UF8A 2VRRB 2TSSA 1I4RA 4IOIE 2B3AA 3ZW3A 4S0RA 2KJ6A 1BXTA 2MSED 4XZ4A 5LLIA 3ZDTA 3NRZA 1YQ4B 4BBNF 1C3TA 3PZDA 3PT2B 2XEWA 2LGSA 5BO4B 4US9A 5DCNA 2KTFA 2YLMA 4KDIC 3GZNB 4X57B 2CU1A 3DHIC 3P2BA 2IY0B 4S17A 4JGHB 4PK1A 1IBXB 1GB1A 3PRPB 4DWFA 3QX1A 4HDQA 2MH7A 1UGJA 2WNMA 3ECIA 2JVCA 4OZCA 3FILA 5E6NA 3N20C 2ZPYA 3VR8B 1UGMA 1Q10A 2N9PC 2PKOA 4K7SA 4IUMB 3JW0X 3ZNGC 3C19A 4RNAA 1WR6E 2WYQA 3B1LX 2KDEB 2DWQA 2R2OA 1WMHA 4PT5A 1IP9A 1K51A 4MH0E 2WWZA 4OZAA 2L32A 3T8MA 5GXGB 1SIJA 3LB8C 2G45B 1HEZE 1HZ5A 3AEGB 3ZQ4A 1J7CA 2RDBC 1VD2A 4WWOA 2KN5A 1VLBA 1YJJA 3ML9A 5DPWA 3W2DA 2PIAA 2BWES 1WRDB 4USAA 4FADA 2JXTA 1JWMD 5J18A 3SHQA 2N4FA 1UF0A 1RFAA 4MGKE 4DHJD 2CU3A 1I4HA 5JHAA 4DDID 4GXBA 3DOWA 4B9KA 4N58A 5KHOA 3DWMA 2IGDA 1Z5SB 3K9OB 4GOCA 1FFVA 4GIVA 2DZIA 2BW2A 4M8NA 1R4NI 5LNK1 1FXIA 1XLOA 1QOBA 4A8XC 3HUIA 4FJZA 1PDXA 2W3RA 4AS1A 4C4VB 4WQMA 3DBHB 4C80A 3SR6A 4RGTA 3E56A 1C4AA 4TKNA 2X38A 1L0XB 2CHZA 2ZCCA 4REZA 3Q3FA 4P16A 3QQ8B 4NAMA 1H8CA 1WXSA 4WH4A 2KFJA 4A55A 4D2KA 3UIPB 2D3CA 1TZOA 4AQ7A 2L0TA 4IM3A 2RGFA 5DPSA 2V9HA 3AN1A 3ZIMA 2M56B 2LWPA 4BVUC 1FXAA 4MSQB 3TIXA 1GC6A 1NI3A 1SB3C 4GDKB 2N1VA 2L0FA 2MEKA 3WALA 4KV2A 4OVZA 3N1ZC 3IG3A 3ZVVA 3S2AA 3PO0A 4KSLC 3L4PA 3AM9A 2ACZB 2ZVOA 4MJSB 1F52A 2YEPB 4FULA 3Q2AC 4LNNA 3DBLI 2EKIA 3ONSA 4ZDVA 1N5XA 4KIKA 2JYTA 3ZTDA 3AI5A 1SE3A 3X23A 1TGZB 4A3PA 1GNUA 2BT6A 4K1RB 5CHVC 2INCC 3BY4B 1QT9A 4ACFA 1HZ6A 3W1SC 4WURA 2K8BA 2QC8A 3GZNI 2KWCA 4LNIA 5DPRA 1F9JA 3U7ZA 5EE1A 2ZVNA 5TR5A 5BYSA 1CJEA 3L10B 3MHSD 2KMCA 2UYZB 4CO7A 3WAPA 3GOEA 2KHWB 2N7DA 2ASQA 1L0VB 3L13A 5HG2A 3FILB 1GG3A 4P1BC 1TKGA 3VVWB 2XBBC 5IOIA 2WU5B 4C7YA 5HFYA 3KUCB 4A6QA 3M95A 4M8MA 3W1YA 3RD2A 2QMTA 1XO3A 4RGMA 3RMKC 3Q69A 2N0SB 3I3TB 3WANA 2A4ZA 2E3TA 1J7AA 3DVGY 2C60A 3HVZA 1V49A 1MVKA 1TS5A 4NAWB 2IO0B 1C4PA 2GMIC 1XLPA 3HVDA 3OLMD 1FNVA 1QILA 4IC7B 4IKGA 4DXGA 2G9HD 2WXOA 2REXA 4OVUA 3M62B 5G5GA 4MGZE 1CMXB 4BKTA 4EUTA 4EE2A 2PTLA 2GBRA 5BYQA 3A9JA 4WWMA 4W9DA 2LRUA 1JRUA 3AE1B 4YTPB 4TQ0A 2DZKA 3D32A 4NNJB 3ZXVA 4KX6B 5L83A 3Q14C 3VHTC 1OQYA 2AQ3B 4IWOA 2SEBD 5DPTA 4BBNC 2MCNB 3CMMB 2KC1A 2GI9A 2J4XA 3AE3B 3AH7A 4K81A 3Q3OC 4URKA 4ANXA 1I42A 4OZBA 3FKYA 4NY0A 2CKHB 1V1OA 3RT3B 4DHZB 3W5UB 3A1QB 2WXMA 3ZKJC 3V60A 4AOFA 1R4MI 2KT7A 3GE8C 1WF9A 3QAQA 1BT0A 2GB1A 2I1JA 1JWSD 1A5RA 3QIJA 1TY2A 5KHQA 3SEBA 4KKIA 2KJHB 1QOGA 1C76A 3JVZX 1OQRA 3U30A 2NPTB 2RD0A 3AEBB 5IAAC 3VTWA 1E5WA 1HTQA 2KVRA 4PS3A 1J0GA 2LGIA 1WJ4A 4M0WB 1ET6A 2G1EA 4I6PA 3NZUA 3V61A 4AJWA 2INPE 2Z0DB 2KZRA 3PRZA 1KLVA 2ZPNA 3IAM1 4G11A 3R2IA 4M00A 2AL6A 2O6VB 3DDCB 2AQ1B 2LZ6A 2KKCA 4FBJB 1XLQA 3KLSX 3P1MA 2WXKA 1HA5A 2BYEA 3R3MA 4ITKA 3RNEC 1GPXA 3W9CB 3AU5A 2JSVX 2NCNA 3B2FA 4GDLA 2BBCA 4DHJB 3VDZA 2KTRB 2LFIA 1F2RC 3RNFC 2JY6A 2OOBB 4Q2JA 3Q3NC 1C79A 1XLNA 4FA6A 2ONQA 1DOXA 4HWIB 3I9V1 1L0YB 1WH3A 1ZUD2 3CWIA 1PGXA 1RYJA 3FAHA 3TBLD 1C1YB 1WM3A 2GOWA 2K8HA 3VUYA 3N9YC 1WE6A 4F7ZA 3HHMA 3N1XC 3U4EG 2ZJDA 3PS6A 3R66C 1EUVB 1QF6A 3CSTA 2LRWA 3PREA 3HIZA 1LM8B 2AQ2B 3GP7A 2L3ZA 3DHGC 4KVGB 1UELA 2J42A 3H6NA 4NJ6A 2OHFA 4E74A 3DQVA 4JWSC 2FUG1 2HTME 2MW5A 2QHOA 1V5OA 3IXSA 2PVOD 1SEBD 1GAQB 1WJUA 2FCSA 1GOZA 3AXCA 2GBNA 2JRHA 3N30A 1EU3A 3KWVA 2MBQA 1TTNA 1FNWA 3DPDA 3N3KB 1KF6B 1E9MA 4GN1A 2LVOA 2UU7A 2V3PA 2KYWA 4ZYSA 1JRPA 2V1YA 1RRBA 1ZXIA 2N9LA 2WDRB 1VZ8A 3ZLZA 2PPHA 3AEDB 2L7RA 4EEWA 1NEKB 2NS5A 4IWQA 1V81A 1FRRA 4ANVA 3WAMA 3NUHB 4XYCA 2DZJA 4HDOA 3R7RA 4ASWC 4P1CC 3AE9B 2RPQA 4ZRPA 2K6DB 4WAAA 4HJGE 4XX5A 3ZO5B 1WGKA 1IGCA 3PV1A 3A9KB 1RM6C 3NS8A 2I1KA 4G50A 3DCGA 3NZSA 1STEA 2D11A 1FXTB 3ZNID 2D2QA 2OEDA 4RGOS 3AECB 4IW0A 1F1HA 2WXRA 3R7QA 3VQIA 4C00A 1S1QB 2LJIA 3VAWA 5FK9C 2ICIA 2WXFA 1L7YA 4GDKA 1L6UA 3IT4B 2EKEC 3NZ3A 2HJ8A 3ZJVA 1CK1A 4BFRA 2WXQA 2QILA 5EDSA 3RPFC 2D5GA 2IO1B 3ZDMC 3P4SB 1D3ZA 4I6LB 3OWEB 3T3NA 1MFWA 3QWZB 2JU6X 3BYTB 3ZNZB 1NDDA 3APDA 3MC0B 2IGGA 2QEJC 4RMAA 4UDUC 3C0RB 1I35A 4L2YA 4KGRA 1U4AA 3NS1A 2JZZA 4IM0A 3NVWA 4W9EA 1P0RA 5G5HA 1R4MB 4KZCA 3VTVA 1CZPA 2BF8B 4RGNA 2DNFA 1JW9D 3AU4A 3ENEA 2CS4A 1HE8A 1SE4A 3PHXB 4ICUA 1KLGD 1TS3A 4LK0M 1FMAD 1KJTA 2IJ0A 3LXFA 1XF5L 4C56C 4N6EB 4ZYNA 2J0KA 4EKUA 1DGJA 3Q8CA 1WYWB 2KDFB 1P1AA 1RAXA 3P4RB 2KQ7A 4JLCA 3DHHC 2N9XA 1M94A 4MJSA 1MG8A 1VDVA 1E8ZA 4H2AA 3TEWA 2KNBA 3TSSA 3PLUA 1N5WA 1MPEA 4W9JA 1YMHE 5D7GA 3T3OA 2WXJA 4N9F4 2DYMA 4TQ1A 2RDGA 2CHWA 2MX2A 1V2YA 2IYDB 4NZLB 1SJHD 4J6IA 2JXXA 1D4BA 2N7JA 2O6VA 1IPGA 3BZDB 1GC7A 3PPAA 1YX5B 4PYZA 3RULA 2BKFA 1OQQA 4HCNB 2WXGA 2BB5A 1E6EB 1Q0WB 2KQSA 4TSSA 1EM7A 3KUDB 1WX7A 4GDLB 3KH0A 4NQLB 1VCBA 3RNBC 3VTUA 2LASA 4FLHA 4KIKB 4C7ZA 2KJRA 2MBHA 1UH6A 5BYRA 3QC8B 1LQBA 1I4GA 4IM2A 2BS2B 1QLBB 4G0NB 1F2RI 1TT5B 2Y5BB 3EFUA 3AE6B 4HLEA 3ZUNA 2K0PA 4CQNA 5IKCM 1OEYA 3MTNB 1P98A 2W55A 2LGXA 1FCCC 1EO6A 3B08A 2ZCBA 2GBJA 3DBHI 3VRAB 3EC8A 1NYRA 3EHVA 1QZEA 2PJHA 2O6VD 2R2QA 3WA0A 2W9NA 1FM0D 3ZTCA 1BUIC 2DYBA 4MEMA 1WX8A 4FJYA 3NHEB 3KWLA 2PMVA 1IUEA 4YXDB 4M01A 2LXAA 1E10A 4K7UA 1ZXHA 2JX5A 3PLVA 3FC4A 1PYWD 4XE0A 4II3B 5D3IB 3HK0A 2IZVB 3V62A 1V97A 3VXWA 3KYDD 4YT0B 1T0RC 3BVZA 2BYVE 1NYQA 3UI3A 3AE5B 4LDTD 3NY5A 4RH6A 4HCPB 1MHHE 4MGIE 4AWJA 1NI2A 2KACA 2V4IB 1SXTA 2FUHB 2PE9A 1E8WA 5GMVA 2B76B 3DBSA 2Q5WD 4PYUA 1L5PA 2FE8A 2ZW1A 1ZDXA 2WDVB 5JHBA 4NJCA 2WXNA 2ZNVC 2GBKA 1FIQA 3L17A 4DDGD 5IN7A 1J7BA 1J8CA 5HHDG 3H7PB 2MBEA 3AE2B 2I38A 1WGYA 2NBWB 3H9DA 4ANWA 2WXHA 4LDTB 1VRAB 1E8XA 1UUPA 1V8CA 2L52A 4JWUC 1NBFC 1PUTA 4W9GA 2D3AA 3CF6E 2WHIA 1SF0A 4PS7A 4JE3B 3H7SA 4YSXB 1TY0A 5D3DA 2L8JA 4W9HA 4BOZB 4RFBA 2GRIA 1V5TA 1WX9A 4W9KA 2ON8A 1YQBA 1V86A 3BINA 3NJTA 1JALA 2BYTA 1K50A 1JWUD 2WGSA 5E6OA 3NVVA 3P4PB 3OJ3A 3KUZA 2AYOB 5D94A 2MA9B 1IYFA 1PQSA 3ZYYX 2PEAA 1R4NB 2VZKD 3QCAA 3A9JB 4YL8A 1I4PA 4LJPB 5TSSA 1AW7A 2NMQA 4P7IA 1I4QA 2LVQA 1ZW7A 3VH4B 4CYEA 2JPHA 2ZNVB 2KFKA 4BKSD 3APCA 5E6JA 1WXAA 1FD6A 4ZRIA 3UIOB 2K9XA 5IA7A 1FNUA 5EE3A 4JPSA 5IO9A 3PZ8A 3K9PB 1F0ZA 1E7VA 2G4SA 1A70A 2IY1B 3CSFA 1XEEA 4MACA 3TUOA 4KGTA 4B0MA 1OFFA 5CTRC 3ZRCA 1V1PA 4AUQC 2C9WB 1I7HA 2JRIB 1WYGA 5AUKA 1UWMA 1Y56A 4A90A 3T9LA 4JL9A 3SU8X 3EGRA 1ISNA 2FIDA 3AULA 5I4DA 2WDQB 2D3GA 5C2TB 2RSUA 2W82A 1T0YA 4B0EA 3A9KA 3V6EB 1UZXB 5H8YE 2KLCA 3RI7C 2MLBA 2IO2B 4E71A 3PZ7A 1P7FA 3DBRB 1JQ4A 5LXIB 4LCDE 3DVGX 3EECA 1V9JA 3H1UA 5AZHA 2KWDA 4HEA1 4KDLB 3KQ4A 1N63A 4LTUA 1JMLA 2M17A 2WP9B 1YN3A 5HKHA 2M4NA 4WQOB 2PLPA 3RZFA 1K53A 5AUIA 4JX1C 3UQBA 1HXYD 3Q3MC 2LMCA 2NTSA 4W9IA 3U8ZA 1SJED 2W54A 4ICVA 1V80A 1GJZA 1PGBA 1WGGA 1WJ6A 1KLUD 2JUOA 3SD5A 3TEXA 1LXDA 1WWTA 2M0AA 2C5LC 4A3OA 1KM7A 2KAJA 3TCAA 3RN9C 1SGHA 2C7HA 1S3SG 2KWVB 3Q8FA 3NVZA 3A33B 1VR9A 1QQRA 3DVNU 1ZDVA 1LFDA 5JH5C 3E9SA 4R3DA 1QOAA 2KQ4X 2OJRA 4XDDA 4RF1A 1VZ6A 5LXHA 4GMVA 2DZMA 2I2YA 4FHKA 1XQQA 4GLSC 2JZPA 3LDZE 4OVVA 2E6XA 4A9AA 5T8IA 4AP4C 4PS8A 1GUAB 1NVID 2BYFA 2HD5B 1PGAA 2V3NA 1SIFA 3DBLB 4LJOB 1ACCA 3ZXRA 4DHZE 3Q8EA 2WXLA 1MHXA 1TYGB 2G3QB 2WXIA 2MJEA 2XNAC 1YJIA 1WSPA 2O2VB 2CJNA 2DHZA 4W9LA 3M63B 2X8XX 1ESFA 1N60A 1IBXA 3TEYA 2DAFA 1B1ZA 1WJNA 3J9CA 3ALBA 3TL5A 4TMAB 4WJQA 1QOFA 2C7MB 1BMLC 1JCKB 1WI0A 3ZNHB 1X1MA 4XWWA 3AMZA 5D6JB 4I6NB 1RFKA 3RYTA 3AEEB 3I5JC 1AYFA 3IAS1 1HQRD 3DVNV 2WX1A 1LO5D 4FXCA 3NG0A 1TJEA 4FJVB 2BQQA 1WZ0A 1C78A 4RM9A 1VJKA 3IT6B 2N9KA 1WXMA 1FRDA 4P6VF 2KX3A 1T3QA 2KWUB 4WJNA 3EFCA 2DENB 2IDYA 4MSMB 4B6WA 3JSVB 2LXCA 2RPVA 4YTMB 4LNFA 4RCOA 1Q1OA 3A4SC 3B2GA 1EU4A 3U2SC 2D07B 2AX5A 2NTTA 1FEHA 4ARIA 4IWPA 2MP2A 1ZGUB 3AEFB 2PE6B 5J17A 1C9FA 2WU2B 2KX0A 4MGYE 1MG4A 1E8YA 3APFA 1KRHA 3IBEA 2Y3AA 1KFYB 3TMPB 1DOYA 4HKZE 3SDLC 5BMIA 1FO4A 1D6EC 1FFUA 1MJDA 3SFEB 3BIID 2EELA 2IO3B 1Z2MA 2DAJA 4HVBA 2VH1A 2BKRB 2KC2A 2KLGA 1T5XD 3L16A 4ANUA 5C1ZA 4CHKA 1AWDA 3U52E 4HROA 2JYEA 3AE8B 2FCQA 4W9CA 4MH8A 2D10A 1YX6B 1QKZA 3RUIB 3EUB2 2IGHA 2WDTB 1DYQA 3Q3JA 1OTRB 2D3BA 3H7PA 1Q5WB 3MC9A 3V05A 1ROEA 5MPOA 3UQAA 4XC2A 3V6CB 5G2NA 1B9RA 1J19A 4TUUA 4TV3A 3O13A 4L1BA 2MHJA 4HK2A
chains in the Genus database with same CATH topology
2MBEA 2CHXA 4G11A 4K7WA 2NBWB 1WGYA 2AL6A 3H9DA 3PVLA 4ANWA 4DBGA 4LDTB 1G6JA 4MELA 2O6VB 3DDCB 4NQKE 4FN2A 2YVCA 2LZ6A 2KFKB 2HTHA 2KKCA 1E8XA 4W9FA 4EZKA 2DX5B 4FBJB 4RM8A 3MJWA 1KOTA 3RZWC 2BYEA 2K25A 2MBBB 3R3MA 2J0MA 2G4DB 2AEHA 3AU5A 4EZLA 1NBFC 1P9DU 2NCNA 4W9GA 3CF6E 2LGYA 2N1WA 3HM6X 2NBUA 3PSEB 1WIAA 4GDLA 4PS7A 2FCNA 4DHJB 3VDZA 4EOYA 3H7SA 2KTRB 4WJPA 2L8JA 2JY6A 4AJYB 3RCZA 4W9HA 1V6EA 2OOBB 3UINB 4BOZB 1E7UA 4FA6A 4DK5A 3ML8A 2NVUI 2MBOA 2XK5A 1V5TA 4GGQA 4HWIB 1WX9A 4W9KA 3WAOA 2KANA 1WH3A 1YQBA 1V86A 1UD7A 2DYOA 2NPTA 3BINA 2LI5A 3TBLD 1C1YB 1WM3A 2GOWA 4MDKE 2K8HA 2WX0A 2O2VA 4ZRKA 3VUYA 1WE6A 4F7ZA 3HHMA 1YJ1A 4HPMB 3UF8A 2ZJDA 2VRRB 3W1SA 4F8CB 2XK5B 3PS6A 5E6OA 3R66C 1EUVB 3OJ3A 3KUZA 2AYOB 2B3AA 5D94A 3ZW3A 3CSTA 2J7QB 2LRWA 2MA9B 1IYFA 3PREA 3HIZA 2KJ6A 4JQWC 1LM8B 2MSED 4XZ4A 5LLIA 3ZDTA 1PQSA 1OGWA 5D2MB 1EF1A 2L3ZA 2PEAA 1WZ3A 4BBNF 4KVGB 1UELA 1C3TA 3PZDA 3H6NA 3PT2B 3QCAA 4NJ6A 2XEWA 4E74A 3DQVA 3A9JB 4YL8A 2MW5A 4LJPB 2QHOA 4P7IA 5BO4B 3WIMA 1V5OA 2LVQA 3IFWB 5DCNA 2HE7A 2K1FA 1ZW7A 2KTFA 3VH4B 2YLMA 4KDIC 1K8RB 4X57B 4CYEA 2JPHA 2CU1A 2ZNVB 2KFKA 4BKSD 1WJUA 2FCSA 2IY0B 3APCA 3P2BA 4JGHB 3TJPA 1WXAA 3AXCA 3N32A 2GBNA 4ZRIA 3UIOB 1TZ1A 5J2RA 3PRPB 4DWFA 5IA7A 3QX1A 2JRHA 3N30A 4HDQA 1TBEA 2LUEA 1WY8A 2MBQA 3ECIA 1TTNA 2JVCA 4BKSA 3DPDA 3N3KB 2MQJA 4GN1A 4E3CA 2KOXA 5E6NA 1WXVA 2ZPYA 1UGMA 2LVOA 3K9PB 2N9PC 1E7VA 1RLFA 2G4SA 4K7SA 4IUMB 2V1YA 2IY1B 3CSFA 1RRBA 1WMHB 3JW0X 3QARA 4HPLB 3ZNGC 1WR6E 3ZLZA 2WYQA 2PPHA 2JF5A 2KDIA 2L7RA 3A4RA 4EEWA 2NS5A 3B1LX 5CTRC 3ZRCA 4GU2A 4IWQA 3QJZA 2KDEB 2Z0EB 1V81A 2R2OA 4AUQC 2C9WB 1WMHA 2Z59B 3WAMA 4ANVA 2JRIB 3L54A 3IHPC 1IP9A 2DZJA 4MH0E 2WWZA 2KMAA 4HDOA 3T8MA 3R7RA 4ASWC 3PRMB 3T9LA 2G45B 5L95C 4BOSC 4JL9A 3SU8X 3VH3B 2M0XA 2RPQA 1VD2A 3U7DA 2K6DB 4WAAA 4WWOA 4XX5A 3ZO5B 1ISNA 2FIDA 3PV1A 3A9KB 3AULA 2KN5A 2CR5A 3NS8A 3ML9A 5DPWA 2I1KA 4G50A 3DCGA 2D3GA 1XD3B 3NZSA 2BWES 2D11A 2L00B 1WRDB 1FXTB 3QHTA 2RSUA 3ZNID 2D2QA 4FADA 3B0AA 1T0YA 1P3QU 5J18A 3A9KA 4IW0A 3SHQA 2N4FA 3V6EB 1UZXB 3R7QA 3VQIA 5CHFA 1RFAA 5E6PA 4MGKE 1S1QB 4DHJD 2KXJA 2KLCA 3VAWA 2MLBA 5JHAA 4DDID 2JWZA 4GXBA 2IO2B 1L7YA 4E71A 4GDKA 3DOWA 4B9KA 2M1MA 5KHOA 2EKEC 5LXIB 4LCDE 3DVGX 1Z5SB 3EECA 2HJ8A 3K9OB 5AZFA 4GOCA 1V9JA 1WM2A 3H1UA 5AZHA 2KDBA 4BFRA 4GIVA 2FAZA 5EDSA 2DZIA 4KDLB 4M8NA 2AWTA 2IO1B 3ZDMC 1R4NI 2M17A 2FIFA 5HKHA 1D3ZA 4I6LB 2M4NA 4WQOB 4FJZA 3RZFA 3QWZB 5CX3A 4NAWA 2BPSA 3UQBA 3VFKA 3ZNZB 1NDDA 4TKNA 4W9IA 3U8ZA 2CHZA 2ZCCA 3APDA 3Q3FA 3HM3A 3QQ8B 4ICVA 1V80A 1GJZA 1H8CA 1WXSA 1WGGA 2KFJA 1WJ6A 2JUOA 4RMAA 3C0RB 1I35A 3SD5A 3UIPB 1LXDA 4A3OA 2C5LC 1U4AA 1KM7A 2FCMA 2LD9A 4MM3A 3QK0A 2JZZA 3PHWB 2K8CA 4IM0A 2L05A 4KZ0A 1OEYJ 4W9EA 1P0RA 3TCAA 2L0TA 4IM3A 1SGHA 3DBRI 2RGFA 2C7HA 4KZCA 3VTVA 5DPSA 1S3SG 1SE9A 2ZZPB 2KWVB 2BF8B 2NR2A 3ZIMA 3IVFA 5AZGA 3A33B 2LWPA 4BVUC 3DVNU 4MSQB 3TIXA 1LFDA 1GC6A 1EF5A 3AU4A 4GDKB 5JH5C 4NJ7A 2OJRA 2N1VA 3ENEA 2L0FA 3WALA 3ZRFA 2CS4A 1HE8A 4KV2A 5LXHA 4JIOU 3IG3A 3ZVVA 4GMVA 3S2AA 3PHXB 4ICUA 2DZMA 4KSLC 1KJTA 3KYCD 2ZVOA 4FHKA 2EMSA 4MJSB 3LJ3A 5C23A 1XQQA 4FULA 3LDZE 2J0KA 4OVVA 3DBLI 4ZYNA 4EKUA 4B95A 3ONSA 4ZDVA 1WYWB 2M8SA 3OJ4B 4KIKA 2KDFB 1P1AA 3ZTDA 4AP4C 3AI5A 1RAXA 4PS8A 2KQ7A 3X23A 1GUAB 4JLCA 1TGZB 2N9XA 4A3PA 1M94A 4WWNA 2BYFA 4MJSA 5G55A 2HD5B 1GNUA 1MG8A 1SIFA 4LJOB 4K1RB 5CHVC 4DHZE 1E8ZA 4WJOA 3BY4B 2KNBA 4DXAB 3W1SC 2K8BA 2G3QB 3GZNI 1WR1A 2KWCA 1XT9B 3PLUA 3JYUA 4WWPA 5DPRA 1F9JA 3PTFC 4W9JA 2ZVNA 5TR5A 1H4RA 2GBMA 5D7GA 3L10B 4HJKA 3MHSD 2KMCA 2UYZB 1UBQA 4N9F4 2KD0A 1AARA 2O2VB 4CO7A 3WAPA 2DHZA 2DYMA 4W9LA 3GOEA 3M63B 4TQ1A 1Y8RC 2KHWB 4KSKC 2CHWA 2MX2A 2N7DA 1V2YA 2DAFA 2IYDB 2ASQA 1WJNA 4J6IA 2JXXA 3ALBA 3VUXA 2C7NB 3TL5A 4EZJA 4WJQA 2O6VA 2C7MB 3L13A 1GG3A 1WI0A 1IPGA 2UWQA 3ZNHB 1X1MA 2A5UA 1GC7A 1WFYA 3PPAA 1YX5B 4PYZA 3VVWB 2XBBC 3RULA 5AEKB 5JZEB 2BKFA 4HCNB 5D6JB 2N7EA 3O65B 3KW5B 4GSWA 1Q0WB 4I6NB 2KQSA 3L08A 3KUDB 1WX7A 3KUCB 3KH0A 4GDLB 4NQLB 2LJ5A 3RYTA 2MRPA 1UBIA 4EFOA 3M95A 1VCBA 1YIWA 3DVNV 4M8MA 3VTUA 2WX1A 3W1YA 2V3SA 2LASA 3RD2A 3UGBB 2KK8A 4FLHA 4KIKB 2KJRA 5FR6A 2KO3A 2MBHA 3I3TB 1UH6A 3JSVA 4FJVB 3QC8B 1ZKHA 1LQBA 4IM2A 4NPNA 3WANA 1WZ0A 4RM9A 2A4ZA 1WXMA 2KX3A 4G0NB 4F1SA 2KWUB 3DVGY 2C60A 2AL3A 4GB9A 1V49A 2EMTA 4WJNA 4ZRJA 2JZ3B 2DENB 4MSMB 2Y5BB 4B6WA 2ZEQA 3JSVB 2LXCA 3EFUA 4NAWB 4HXDA 2IO0B 4HLEA 1E90A 4W9DA 3ZUNA 1Q1OA 3A4SC 2GMIC 1OEYA 2K39A 1P98A 3MTNB 3OLMD 2LGXA 2N9EB 3PGEA 4IC7B 3NOBA 2D07B 2BGFA 1EO6A 3B08A 2REXA 4OVUA 3M62B 4MGZE 2ZCBA 4IWPA 1CMXB 4BKTA 2MP2A 4EUTA 1ZGUB 2GBJA 3DBHI 2GBRA 2BWFA 3M3JA 2PE6B 5J17A 3A9JA 3EC8A 4II2B 2LGDA 4A20A 2LRUA 3EHVA 2KX0A 1QZEA 4FHJA 1JRUA 2O6VD 2PJHA 2R2QA 2W9NA 4MGYE 3WA0A 4TQ0A 1E8YA 2NBVB 3APFA 2DZKA 3ZTCA 3D32A 3IBEA 1WGRA 4NNJB 3TMPB 2DYBA 4MEMA 5CHWA 1WX8A 4FJYA 3SDLC 2K6QA 5L83A 3NHEB 3VHTC 1OQYA 2IBIB 4IWOA 5DPTA 4BBNC 2LXAA 2MCNB 4K7UA 3CMMB 1WE7A 2KC1A 2JT4B 2MWSB 3A1QA 3PLVA 2FNJB 4K81A 4URKA 1WGDA 4ANXA 4II3B 2IO3B 2L76A 1I42A 3HK0A 4NY0A 1Z2MA 2CKHB 2DAJA 2IZVB 4G3XB 4HVBA 3RT3B 3V62A 2BKRB 2KC2A 2KLGA 3KVFB 4IG7B 1L2NA 3VXWA 3L16A 3KYDD 4ANUA 4DHZB 5C1ZA 3ZKJC 3A1QB 2KTRA 3V60A 3VUWA 1R4MI 4AOFA 2BYVE 4CHKA 1WF9A 3QAQA 1BT0A 4LDTD 2I1JA 3NY5A 1A5RA 3QIJA 2FCQA 4W9CA 5KHQA 4HCPB 2KJHB 4MGIE 2D10A 4AWJA 1NI2A 1YX6B 2RR9A 3JVZX 3U30A 2NPTB 2RD0A 3RUIB 5IAAC 2FUHB 1E5WA 3VTWA 2KVRA 2PE9A 4PS3A 1J0GA 2LVPA 2WDTB 3L0WB 1E8WA 3OAWA 5GMVA 1WJ4A 4M0WB 3DBSA 2V4LA 4I6PA 3NZUA 2MP2B 1OTRB 3Q3JA 4PYUA 3V61A 3H7PA 1Q5WB 2J0JA 3X0WA 4BKGA 4AJWA 3UQAA 5JHBA 1WGHA 4XC2A 3V6CB 5G2NA 1J19A 2ZNVC 2GBKA 3L17A 4TUUA 4DDGD 4TV3A 3QA8A 2Z0DB 2KZRA 3PRZA 1J8CA 1YD8U 3H7PB 1KLVA 2ZPNA 4HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBE A;  2CHX A;  4G11 A;  4K7W A;  2NBW B;  1WGY A;  2AL6 A;  3H9D A;  3PVL A;  4ANW A;  4DBG A;  4LDT B;  1G6J A;  4MEL A;  2O6V B;  3DDC B;  4NQK E;  4FN2 A;  2YVC A;  2LZ6 A;  2KFK B;  2HTH A;  2KKC A;  1E8X A;  4W9F A;  4EZK A;  2DX5 B;  4FBJ B;  4RM8 A;  3MJW A;  1KOT A;  3RZW C;  2BYE A;  2K25 A;  2MBB B;  3R3M A;  2J0M A;  2G4D B;  2AEH A;  3AU5 A;  4EZL A;  1NBF C;  1P9D U;  2NCN A;  4W9G A;  3CF6 E;  2LGY A;  2N1W A;  3HM6 X;  2NBU A;  3PSE B;  1WIA A;  4GDL A;  4PS7 A;  2FCN A;  4DHJ B;  3VDZ A;  4EOY A;  3H7S A;  2KTR B;  4WJP A;  2L8J A;  2JY6 A;  4AJY B;  3RCZ A;  4W9H A;  1V6E A;  2OOB B;  3UIN B;  4BOZ B;  1E7U A;  4FA6 A;  4DK5 A;  3ML8 A;  2NVU I;  2MBO A;  2XK5 A;  1V5T A;  4GGQ A;  4HWI B;  1WX9 A;  4W9K A;  3WAO A;  2KAN A;  1WH3 A;  1YQB A;  1V86 A;  1UD7 A;  2DYO A;  2NPT A;  3BIN A;  2LI5 A;  3TBL D;  1C1Y B;  1WM3 A;  2GOW A;  4MDK E;  2K8H A;  2WX0 A;  2O2V A;  4ZRK A;  3VUY A;  1WE6 A;  4F7Z A;  3HHM A;  1YJ1 A;  4HPM B;  3UF8 A;  2ZJD A;  2VRR B;  3W1S A;  4F8C B;  2XK5 B;  3PS6 A;  5E6O A;  3R66 C;  1EUV B;  3OJ3 A;  3KUZ A;  2AYO B;  2B3A A;  5D94 A;  3ZW3 A;  3CST A;  2J7Q B;  2LRW A;  2MA9 B;  1IYF A;  3PRE A;  3HIZ A;  2KJ6 A;  4JQW C;  1LM8 B;  2MSE D;  4XZ4 A;  5LLI A;  3ZDT A;  1PQS A;  1OGW A;  5D2M B;  1EF1 A;  2L3Z A;  2PEA A;  1WZ3 A;  4BBN F;  4KVG B;  1UEL A;  1C3T A;  3PZD A;  3H6N A;  3PT2 B;  3QCA A;  4NJ6 A;  2XEW A;  4E74 A;  3DQV A;  3A9J B;  4YL8 A;  2MW5 A;  4LJP B;  2QHO A;  4P7I A;  5BO4 B;  3WIM A;  1V5O A;  2LVQ A;  3IFW B;  5DCN A;  2HE7 A;  2K1F A;  1ZW7 A;  2KTF A;  3VH4 B;  2YLM A;  4KDI C;  1K8R B;  4X57 B;  4CYE A;  2JPH A;  2CU1 A;  2ZNV B;  2KFK A;  4BKS D;  1WJU A;  2FCS A;  2IY0 B;  3APC A;  3P2B A;  4JGH B;  3TJP A;  1WXA A;  3AXC A;  3N32 A;  2GBN A;  4ZRI A;  3UIO B;  1TZ1 A;  5J2R A;  3PRP B;  4DWF A;  5IA7 A;  3QX1 A;  2JRH A;  3N30 A;  4HDQ A;  1TBE A;  2LUE A;  1WY8 A;  2MBQ A;  3ECI A;  1TTN A;  2JVC A;  4BKS A;  3DPD A;  3N3K B;  2MQJ A;  4GN1 A;  4E3C A;  2KOX A;  5E6N A;  1WXV A;  2ZPY A;  1UGM A;  2LVO A;  3K9P B;  2N9P C;  1E7V A;  1RLF A;  2G4S A;  4K7S A;  4IUM B;  2V1Y A;  2IY1 B;  3CSF A;  1RRB A;  1WMH B;  3JW0 X;  3QAR A;  4HPL B;  3ZNG C;  1WR6 E;  3ZLZ A;  2WYQ A;  2PPH A;  2JF5 A;  2KDI A;  2L7R A;  3A4R A;  4EEW A;  2NS5 A;  3B1L X;  5CTR C;  3ZRC A;  4GU2 A;  4IWQ A;  3QJZ A;  2KDE B;  2Z0E B;  1V81 A;  2R2O A;  4AUQ C;  2C9W B;  1WMH A;  2Z59 B;  3WAM A;  4ANV A;  2JRI B;  3L54 A;  3IHP C;  1IP9 A;  2DZJ A;  4MH0 E;  2WWZ A;  2KMA A;  4HDO A;  3T8M A;  3R7R A;  4ASW C;  3PRM B;  3T9L A;  2G45 B;  5L95 C;  4BOS C;  4JL9 A;  3SU8 X;  3VH3 B;  2M0X A;  2RPQ A;  1VD2 A;  3U7D A;  2K6D B;  4WAA A;  4WWO A;  4XX5 A;  3ZO5 B;  1ISN A;  2FID A;  3PV1 A;  3A9K B;  3AUL A;  2KN5 A;  2CR5 A;  3NS8 A;  3ML9 A;  5DPW A;  2I1K A;  4G50 A;  3DCG A;  2D3G A;  1XD3 B;  3NZS A;  2BWE S;  2D11 A;  2L00 B;  1WRD B;  1FXT B;  3QHT A;  2RSU A;  3ZNI D;  2D2Q A;  4FAD A;  3B0A A;  1T0Y A;  1P3Q U;  5J18 A;  3A9K A;  4IW0 A;  3SHQ A;  2N4F A;  3V6E B;  1UZX B;  3R7Q A;  3VQI A;  5CHF A;  1RFA A;  5E6P A;  4MGK E;  1S1Q B;  4DHJ D;  2KXJ A;  2KLC A;  3VAW A;  2MLB A;  5JHA A;  4DDI D;  2JWZ A;  4GXB A;  2IO2 B;  1L7Y A;  4E71 A;  4GDK A;  3DOW A;  4B9K A;  2M1M A;  5KHO A;  2EKE C;  5LXI B;  4LCD E;  3DVG X;  1Z5S B;  3EEC A;  2HJ8 A;  3K9O B;  5AZF A;  4GOC A;  1V9J A;  1WM2 A;  3H1U A;  5AZH A;  2KDB A;  4BFR A;  4GIV A;  2FAZ A;  5EDS A;  2DZI A;  4KDL B;  4M8N A;  2AWT A;  2IO1 B;  3ZDM C;  1R4N I;  2M17 A;  2FIF A;  5HKH A;  1D3Z A;  4I6L B;  2M4N A;  4WQO B;  4FJZ A;  3RZF A;  3QWZ B;  5CX3 A;  4NAW A;  2BPS A;  3UQB A;  3VFK A;  3ZNZ B;  1NDD A;  4TKN A;  4W9I A;  3U8Z A;  2CHZ A;  2ZCC A;  3APD A;  3Q3F A;  3HM3 A;  3QQ8 B;  4ICV A;  1V80 A;  1GJZ A;  1H8C A;  1WXS A;  1WGG A;  2KFJ A;  1WJ6 A;  2JUO A;  4RMA A;  3C0R B;  1I35 A;  3SD5 A;  3UIP B;  1LXD A;  4A3O A;  2C5L C;  1U4A A;  1KM7 A;  2FCM A;  2LD9 A;  4MM3 A;  3QK0 A;  2JZZ A;  3PHW B;  2K8C A;  4IM0 A;  2L05 A;  4KZ0 A;  1OEY J;  4W9E A;  1P0R A;  3TCA A;  2L0T A;  4IM3 A;  1SGH A;  3DBR I;  2RGF A;  2C7H A;  4KZC A;  3VTV A;  5DPS A;  1S3S G;  1SE9 A;  2ZZP B;  2KWV B;  2BF8 B;  2NR2 A;  3ZIM A;  3IVF A;  5AZG A;  3A33 B;  2LWP A;  4BVU C;  3DVN U;  4MSQ B;  3TIX A;  1LFD A;  1GC6 A;  1EF5 A;  3AU4 A;  4GDK B;  5JH5 C;  4NJ7 A;  2OJR A;  2N1V A;  3ENE A;  2L0F A;  3WAL A;  3ZRF A;  2CS4 A;  1HE8 A;  4KV2 A;  5LXH A;  4JIO U;  3IG3 A;  3ZVV A;  4GMV A;  3S2A A;  3PHX B;  4ICU A;  2DZM A;  4KSL C;  1KJT A;  3KYC D;  2ZVO A;  4FHK A;  2EMS A;  4MJS B;  3LJ3 A;  5C23 A;  1XQQ A;  4FUL A;  3LDZ E;  2J0K A;  4OVV A;  3DBL I;  4ZYN A;  4EKU A;  4B95 A;  3ONS A;  4ZDV A;  1WYW B;  2M8S A;  3OJ4 B;  4KIK A;  2KDF B;  1P1A A;  3ZTD A;  4AP4 C;  3AI5 A;  1RAX A;  4PS8 A;  2KQ7 A;  3X23 A;  1GUA B;  4JLC A;  1TGZ B;  2N9X A;  4A3P A;  1M94 A;  4WWN A;  2BYF A;  4MJS A;  5G55 A;  2HD5 B;  1GNU A;  1MG8 A;  1SIF A;  4LJO B;  4K1R B;  5CHV C;  4DHZ E;  1E8Z A;  4WJO A;  3BY4 B;  2KNB A;  4DXA B;  3W1S C;  2K8B A;  2G3Q B;  3GZN I;  1WR1 A;  2KWC A;  1XT9 B;  3PLU A;  3JYU A;  4WWP A;  5DPR A;  1F9J A;  3PTF C;  4W9J A;  2ZVN A;  5TR5 A;  1H4R A;  2GBM A;  5D7G A;  3L10 B;  4HJK A;  3MHS D;  2KMC A;  2UYZ B;  1UBQ A;  4N9F 4;  2KD0 A;  1AAR A;  2O2V B;  4CO7 A;  3WAP A;  2DHZ A;  2DYM A;  4W9L A;  3GOE A;  3M63 B;  4TQ1 A;  1Y8R C;  2KHW B;  4KSK C;  2CHW A;  2MX2 A;  2N7D A;  1V2Y A;  2DAF A;  2IYD B;  2ASQ A;  1WJN A;  4J6I A;  2JXX A;  3ALB A;  3VUX A;  2C7N B;  3TL5 A;  4EZJ A;  4WJQ A;  2O6V A;  2C7M B;  3L13 A;  1GG3 A;  1WI0 A;  1IPG A;  2UWQ A;  3ZNH B;  1X1M A;  2A5U A;  1GC7 A;  1WFY A;  3PPA A;  1YX5 B;  4PYZ A;  3VVW B;  2XBB C;  3RUL A;  5AEK B;  5JZE B;  2BKF A;  4HCN B;  5D6J B;  2N7E A;  3O65 B;  3KW5 B;  4GSW A;  1Q0W B;  4I6N B;  2KQS A;  3L08 A;  3KUD B;  1WX7 A;  3KUC B;  3KH0 A;  4GDL B;  4NQL B;  2LJ5 A;  3RYT A;  2MRP A;  1UBI A;  4EFO A;  3M95 A;  1VCB A;  1YIW A;  3DVN V;  4M8M A;  3VTU A;  2WX1 A;  3W1Y A;  2V3S A;  2LAS A;  3RD2 A;  3UGB B;  2KK8 A;  4FLH A;  4KIK B;  2KJR A;  5FR6 A;  2KO3 A;  2MBH A;  3I3T B;  1UH6 A;  3JSV A;  4FJV B;  3QC8 B;  1ZKH A;  1LQB A;  4IM2 A;  4NPN A;  3WAN A;  1WZ0 A;  4RM9 A;  2A4Z A;  1WXM A;  2KX3 A;  4G0N B;  4F1S A;  2KWU B;  3DVG Y;  2C60 A;  2AL3 A;  4GB9 A;  1V49 A;  2EMT A;  4WJN A;  4ZRJ A;  2JZ3 B;  2DEN B;  4MSM B;  2Y5B B;  4B6W A;  2ZEQ A;  3JSV B;  2LXC A;  3EFU A;  4NAW B;  4HXD A;  2IO0 B;  4HLE A;  1E90 A;  4W9D A;  3ZUN A;  1Q1O A;  3A4S C;  2GMI C;  1OEY A;  2K39 A;  1P98 A;  3MTN B;  3OLM D;  2LGX A;  2N9E B;  3PGE A;  4IC7 B;  3NOB A;  2D07 B;  2BGF A;  1EO6 A;  3B08 A;  2REX A;  4OVU A;  3M62 B;  4MGZ E;  2ZCB A;  4IWP A;  1CMX B;  4BKT A;  2MP2 A;  4EUT A;  1ZGU B;  2GBJ A;  3DBH I;  2GBR A;  2BWF A;  3M3J A;  2PE6 B;  5J17 A;  3A9J A;  3EC8 A;  4II2 B;  2LGD A;  4A20 A;  2LRU A;  3EHV A;  2KX0 A;  1QZE A;  4FHJ A;  1JRU A;  2O6V D;  2PJH A;  2R2Q A;  2W9N A;  4MGY E;  3WA0 A;  4TQ0 A;  1E8Y A;  2NBV B;  3APF A;  2DZK A;  3ZTC A;  3D32 A;  3IBE A;  1WGR A;  4NNJ B;  3TMP B;  2DYB A;  4MEM A;  5CHW A;  1WX8 A;  4FJY A;  3SDL C;  2K6Q A;  5L83 A;  3NHE B;  3VHT C;  1OQY A;  2IBI B;  4IWO A;  5DPT A;  4BBN C;  2LXA A;  2MCN B;  4K7U A;  3CMM B;  1WE7 A;  2KC1 A;  2JT4 B;  2MWS B;  3A1Q A;  3PLV A;  2FNJ B;  4K81 A;  4URK A;  1WGD A;  4ANX A;  4II3 B;  2IO3 B;  2L76 A;  1I42 A;  3HK0 A;  4NY0 A;  1Z2M A;  2CKH B;  2DAJ A;  2IZV B;  4G3X B;  4HVB A;  3RT3 B;  3V62 A;  2BKR B;  2KC2 A;  2KLG A;  3KVF B;  4IG7 B;  1L2N A;  3VXW A;  3L16 A;  3KYD D;  4ANU A;  4DHZ B;  5C1Z A;  3ZKJ C;  3A1Q B;  2KTR A;  3V60 A;  3VUW A;  1R4M I;  4AOF A;  2BYV E;  4CHK A;  1WF9 A;  3QAQ A;  1BT0 A;  4LDT D;  2I1J A;  3NY5 A;  1A5R A;  3QIJ A;  2FCQ A;  4W9C A;  5KHQ A;  4HCP B;  2KJH B;  4MGI E;  2D10 A;  4AWJ A;  1NI2 A;  1YX6 B;  2RR9 A;  3JVZ X;  3U30 A;  2NPT B;  2RD0 A;  3RUI B;  5IAA C;  2FUH B;  1E5W A;  3VTW A;  2KVR A;  2PE9 A;  4PS3 A;  1J0G A;  2LVP A;  2WDT B;  3L0W B;  1E8W A;  3OAW A;  5GMV A;  1WJ4 A;  4M0W B;  3DBS A;  2V4L A;  4I6P A;  3NZU A;  2MP2 B;  1OTR B;  3Q3J A;  4PYU A;  3V61 A;  3H7P A;  1Q5W B;  2J0J A;  3X0W A;  4BKG A;  4AJW A;  3UQA A;  5JHB A;  1WGH A;  4XC2 A;  3V6C B;  5G2N A;  1J19 A;  2ZNV C;  2GBK A;  3L17 A;  4TUU A;  4DDG D;  4TV3 A;  3QA8 A;  2Z0D B;  2KZR A;  3PRZ A;  1J8C A;  1YD8 U;  3H7P B;  1KLV A;  2ZPN A;  4HK2 A; 
#chains in the Genus database with same CATH topology
 2CHX A;  4K7W A;  2MJ3 A;  3AE7 B;  3PVL A;  1D5Z C;  1G6J A;  4MEL A;  3I63 C;  4MM3 B;  2INN E;  4NQK E;  4FN2 A;  2KFK B;  4W9F A;  1PFD A;  3BK2 A;  4RM8 A;  3MJW A;  2H88 B;  2MBB B;  2KDM A;  2G4D B;  2AEH A;  2IND C;  2LGY A;  1WIA A;  4XDC A;  1WRI A;  2FCN A;  3BK1 A;  4WJP A;  2JWU A;  4AJY B;  3RCZ A;  1E7U A;  1ENF A;  4XGA B;  3C8Y A;  5H92 C;  4GGQ A;  3Q8B A;  3V3X A;  2KAN A;  1UD7 A;  3CIR B;  2WX0 A;  2O2V A;  1YJ1 A;  4HPM B;  3W1S A;  4F8C B;  2XK5 B;  3BVG A;  1ZOY B;  3EA6 A;  3URY A;  4LNO A;  2J7Q B;  4JQW C;  1VZ7 A;  2IPK D;  1OGW A;  5D2M B;  1EF1 A;  4LNK A;  1WZ3 A;  4IDI A;  4L23 A;  3WIM A;  2PVG C;  3IFW B;  2HE7 A;  2K1F A;  2DLB A;  2FBW B;  1KTK A;  3GS2 A;  1K8R B;  3WCQ A;  2Z8L A;  3TJP A;  1TS4 A;  3TEZ A;  2K5P A;  3N32 A;  1TZ1 A;  5J2R A;  1TBE A;  4ZRQ A;  2LUE A;  1WY8 A;  4BKS A;  2MQJ A;  5EE0 A;  4E3C A;  2KOX A;  1WXV A;  3ABV B;  4HPP A;  3AEA B;  4KGS A;  1YNT E;  1RLF A;  4WIP A;  1WXQ A;  1E0Z A;  1WMH B;  3QAR A;  1SE2 A;  4HPL B;  3MHZ A;  1UWX A;  4ARC A;  2JF5 A;  2KDI A;  3A4R A;  4O1N A;  4QAY A;  1DOI A;  4GU2 A;  3QJZ A;  2Z0E B;  2Z59 B;  3L54 A;  3IHP C;  2KMA A;  4M02 A;  4YTN B;  5EE9 A;  3PRM B;  1V1P B;  5L95 C;  4BOS C;  2OJW A;  1EWY C;  3VH3 B;  2M0X A;  3U7D A;  2LHE A;  2XN9 C;  2CR5 A;  4XWT A;  2LEK A;  1XD3 B;  2L00 B;  1K52 A;  2W3S A;  3MFG A;  3QHT A;  3B0A A;  1P3Q U;  2ZW0 A;  3AV8 A;  4DQO C;  4K3C A;  5CHF A;  5E6P A;  1YN5 A;  1C4C A;  3I57 A;  3ETR A;  1E7P B;  2KXJ A;  2JWZ A;  2JQR B;  4YWG G;  2M1M A;  1XCQ L;  4YSY B;  5AZF A;  3MP9 A;  1WM2 A;  2KDB A;  2KVZ A;  2FAZ A;  1ZP0 B;  2AWT A;  4C4V A;  3MJ5 A;  2FIF A;  1HTO A;  2KN4 A;  5FR3 A;  2WXP A;  4M0W A;  1MI0 A;  4RF0 A;  5CX3 A;  4NAW A;  1JWA D;  2BPS A;  3RNG C;  3VFK A;  1TKY A;  3HM3 A;  2Y5C A;  2QJL A;  3P4Q B;  2FCM A;  2LD9 A;  4MM3 A;  3QK0 A;  3PHW B;  2K8C A;  4KZ0 A;  2L05 A;  3BWU D;  1OEY J;  1UNS A;  3W5V B;  3DWG C;  3DBR I;  3VR9 B;  1SE9 A;  2ZZP B;  4BAX A;  1F77 A;  3HRD D;  2NR2 A;  2YEP F;  3IVF A;  5AZG A;  2RDH A;  2GLS A;  1XCT L;  2LUM A;  1EF5 A;  2WQY B;  4NJ7 A;  3ZRF A;  4ZHP A;  1N62 A;  4JIO U;  5FKA C;  1AN8 A;  4LLG M;  2DBY A;  3KYC D;  5C23 A;  2EMS A;  3LJ3 A;  1XXG A;  4B95 A;  2M8S A;  3OJ4 B;  5IP4 D;  3RFZ B;  3ZJT A;  3ZGZ A;  2BS3 B;  3P63 A;  4WWN A;  5C3J B;  5G55 A;  1T6B X;  4OHJ A;  4WJO A;  1T0S C;  1TIF A;  4DXA B;  1JRO A;  1YOV B;  4OW0 A;  1WR1 A;  1XT9 B;  4WWP A;  3JYU A;  3PTF C;  2L1A A;  1ET9 A;  2WS3 B;  1H4R A;  2GBM A;  1L6V A;  1R7S A;  4HJK A;  1UBQ A;  2H89 B;  2KD0 A;  1AAR A;  1SBB B;  4N59 A;  4US8 A;  1Y8R C;  2QSD A;  1D5X C;  4KSK C;  1EWC A;  2J53 A;  3VUX A;  2BS4 B;  2C7N B;  1M4V A;  4EZJ A;  2R61 A;  4YSZ B;  2UWQ A;  5BMH A;  2A5U A;  5AEK B;  1WFY A;  2MJD A;  5JZE B;  4BZA A;  2N7E A;  3O65 B;  3KW5 B;  4GSW A;  3L08 A;  4EFO A;  2QDF A;  2LJ5 A;  2MRP A;  1UBI A;  1YIW A;  2V3S A;  1SSN A;  3UGB B;  2KK8 A;  5FR6 A;  2KO3 A;  2BB6 A;  3JSV A;  2M19 A;  1ZKH A;  4NPN A;  1L4Z B;  4WAF A;  4KKJ A;  4F1S A;  4GB9 A;  2AL3 A;  2EMT A;  2VH2 A;  1TKE A;  1ZPS A;  3AB5 A;  4ZRJ A;  2JZ3 B;  2ZEQ A;  4HXD A;  1E90 A;  3H8H A;  3VRB B;  1D5M C;  2K39 A;  2Y5P A;  4HKQ A;  2N9E B;  3RNC C;  3PGE A;  3NOB A;  3N1Y C;  2BGF A;  2VZK B;  2PW9 A;  2BWF A;  3M3J A;  4MT5 A;  3B9J A;  4II2 B;  1KH0 A;  2LGD A;  4A20 A;  2BVC A;  4FHJ A;  3BYY B;  2NBV B;  1WGR A;  5CHW A;  5BMG A;  2K6Q A;  2WLB A;  2IBI B;  1N6Z A;  4DXF A;  1FCL A;  1WE7 A;  2J52 A;  2JT4 B;  3NVY A;  2MWS B;  1FPY A;  3A1Q A;  2FNJ B;  2RMM A;  4ZHO A;  1WGD A;  2L76 A;  1NEN B;  2HDE A;  2QIE B;  3RNA C;  2L83 A;  4G3X B;  1I4X A;  3GB1 A;  3KVF B;  1L2N A;  4IG7 B;  1P7E A;  2KTR A;  3VUW A;  1YQ3 B;  2SAK A;  3LYY A;  2RR9 A;  1YN4 A;  3ZJU A;  4HRS A;  2LVP A;  3L0W B;  1TS2 A;  3OAW A;  3MC8 A;  2V4L A;  1JWB D;  2MP2 B;  4K3B A;  2J0J A;  3X0W A;  4BKG A;  1CQV A;  1WGH A;  1GB4 A;  3AE4 B;  1ZE3 D;  3P42 A;  3Q6B A;  3QA8 A;  1RWS A;  5JXV A;  1YD8 U;  2LHD A;  3R2T A;  4DBG A;  2YVC A;  2CJO A;  2HTH A;  4EZK A;  1C77 A;  2DX5 B;  1KOT A;  2KMM A;  3RZW C;  2K25 A;  2BTE A;  2J0M A;  4EZL A;  1N61 A;  1P9D U;  2N1W A;  3HM6 X;  3PSE B;  2NBU A;  4EOY A;  3OG5 A;  2QCZ A;  2HJ1 A;  1L4D B;  1LGR A;  3Q8A A;  3R8B A;  1V6E A;  3UIN B;  4J3O D;  5HI1 A;  1IGD A;  4DK5 A;  3ML8 A;  2NVU I;  2MBO A;  2K3U A;  2XK5 A;  3SFD B;  2K22 A;  3GE3 C;  3WAO A;  2DYO A;  2V0G A;  2NPT A;  2LI5 A;  4ZOH C;  1T0Q C;  3BVM A;  4MDK E;  4ZRK A;  3UF8 A;  2VRR B;  2TSS A;  1I4R A;  4IOI E;  2B3A A;  3ZW3 A;  4S0R A;  2KJ6 A;  1BXT A;  2MSE D;  4XZ4 A;  5LLI A;  3ZDT A;  3NRZ A;  1YQ4 B;  4BBN F;  1C3T A;  3PZD A;  3PT2 B;  2XEW A;  2LGS A;  5BO4 B;  4US9 A;  5DCN A;  2KTF A;  2YLM A;  4KDI C;  3GZN B;  4X57 B;  2CU1 A;  3DHI C;  3P2B A;  2IY0 B;  4S17 A;  4JGH B;  4PK1 A;  1IBX B;  1GB1 A;  3PRP B;  4DWF A;  3QX1 A;  4HDQ A;  2MH7 A;  1UGJ A;  2WNM A;  3ECI A;  2JVC A;  4OZC A;  3FIL A;  5E6N A;  3N20 C;  2ZPY A;  3VR8 B;  1UGM A;  1Q10 A;  2N9P C;  2PKO A;  4K7S A;  4IUM B;  3JW0 X;  3ZNG C;  3C19 A;  4RNA A;  1WR6 E;  2WYQ A;  3B1L X;  2KDE B;  2DWQ A;  2R2O A;  1WMH A;  4PT5 A;  1IP9 A;  1K51 A;  4MH0 E;  2WWZ A;  4OZA A;  2L32 A;  3T8M A;  5GXG B;  1SIJ A;  3LB8 C;  2G45 B;  1HEZ E;  1HZ5 A;  3AEG B;  3ZQ4 A;  1J7C A;  2RDB C;  1VD2 A;  4WWO A;  2KN5 A;  1VLB A;  1YJJ A;  3ML9 A;  5DPW A;  3W2D A;  2PIA A;  2BWE S;  1WRD B;  4USA A;  4FAD A;  2JXT A;  1JWM D;  5J18 A;  3SHQ A;  2N4F A;  1UF0 A;  1RFA A;  4MGK E;  4DHJ D;  2CU3 A;  1I4H A;  5JHA A;  4DDI D;  4GXB A;  3DOW A;  4B9K A;  4N58 A;  5KHO A;  3DWM A;  2IGD A;  1Z5S B;  3K9O B;  4GOC A;  1FFV A;  4GIV A;  2DZI A;  2BW2 A;  4M8N A;  1R4N I;  5LNK 1;  1FXI A;  1XLO A;  1QOB A;  4A8X C;  3HUI A;  4FJZ A;  1PDX A;  2W3R A;  4AS1 A;  4C4V B;  4WQM A;  3DBH B;  4C80 A;  3SR6 A;  4RGT A;  3E56 A;  1C4A A;  4TKN A;  2X38 A;  1L0X B;  2CHZ A;  2ZCC A;  4REZ A;  3Q3F A;  4P16 A;  3QQ8 B;  4NAM A;  1H8C A;  1WXS A;  4WH4 A;  2KFJ A;  4A55 A;  4D2K A;  3UIP B;  2D3C A;  1TZO A;  4AQ7 A;  2L0T A;  4IM3 A;  2RGF A;  5DPS A;  2V9H A;  3AN1 A;  3ZIM A;  2M56 B;  2LWP A;  4BVU C;  1FXA A;  4MSQ B;  3TIX A;  1GC6 A;  1NI3 A;  1SB3 C;  4GDK B;  2N1V A;  2L0F A;  2MEK A;  3WAL A;  4KV2 A;  4OVZ A;  3N1Z C;  3IG3 A;  3ZVV A;  3S2A A;  3PO0 A;  4KSL C;  3L4P A;  3AM9 A;  2ACZ B;  2ZVO A;  4MJS B;  1F52 A;  2YEP B;  4FUL A;  3Q2A C;  4LNN A;  3DBL I;  2EKI A;  3ONS A;  4ZDV A;  1N5X A;  4KIK A;  2JYT A;  3ZTD A;  3AI5 A;  1SE3 A;  3X23 A;  1TGZ B;  4A3P A;  1GNU A;  2BT6 A;  4K1R B;  5CHV C;  2INC C;  3BY4 B;  1QT9 A;  4ACF A;  1HZ6 A;  3W1S C;  4WUR A;  2K8B A;  2QC8 A;  3GZN I;  2KWC A;  4LNI A;  5DPR A;  1F9J A;  3U7Z A;  5EE1 A;  2ZVN A;  5TR5 A;  5BYS A;  1CJE A;  3L10 B;  3MHS D;  2KMC A;  2UYZ B;  4CO7 A;  3WAP A;  3GOE A;  2KHW B;  2N7D A;  2ASQ A;  1L0V B;  3L13 A;  5HG2 A;  3FIL B;  1GG3 A;  4P1B C;  1TKG A;  3VVW B;  2XBB C;  5IOI A;  2WU5 B;  4C7Y A;  5HFY A;  3KUC B;  4A6Q A;  3M95 A;  4M8M A;  3W1Y A;  3RD2 A;  2QMT A;  1XO3 A;  4RGM A;  3RMK C;  3Q69 A;  2N0S B;  3I3T B;  3WAN A;  2A4Z A;  2E3T A;  1J7A A;  3DVG Y;  2C60 A;  3HVZ A;  1V49 A;  1MVK A;  1TS5 A;  4NAW B;  2IO0 B;  1C4P A;  2GMI C;  1XLP A;  3HVD A;  3OLM D;  1FNV A;  1QIL A;  4IC7 B;  4IKG A;  4DXG A;  2G9H D;  2WXO A;  2REX A;  4OVU A;  3M62 B;  5G5G A;  4MGZ E;  1CMX B;  4BKT A;  4EUT A;  4EE2 A;  2PTL A;  2GBR A;  5BYQ A;  3A9J A;  4WWM A;  4W9D A;  2LRU A;  1JRU A;  3AE1 B;  4YTP B;  4TQ0 A;  2DZK A;  3D32 A;  4NNJ B;  3ZXV A;  4KX6 B;  5L83 A;  3Q14 C;  3VHT C;  1OQY A;  2AQ3 B;  4IWO A;  2SEB D;  5DPT A;  4BBN C;  2MCN B;  3CMM B;  2KC1 A;  2GI9 A;  2J4X A;  3AE3 B;  3AH7 A;  4K81 A;  3Q3O C;  4URK A;  4ANX A;  1I42 A;  4OZB A;  3FKY A;  4NY0 A;  2CKH B;  1V1O A;  3RT3 B;  4DHZ B;  3W5U B;  3A1Q B;  2WXM A;  3ZKJ C;  3V60 A;  4AOF A;  1R4M I;  2KT7 A;  3GE8 C;  1WF9 A;  3QAQ A;  1BT0 A;  2GB1 A;  2I1J A;  1JWS D;  1A5R A;  3QIJ A;  1TY2 A;  5KHQ A;  3SEB A;  4KKI A;  2KJH B;  1QOG A;  1C76 A;  3JVZ X;  1OQR A;  3U30 A;  2NPT B;  2RD0 A;  3AEB B;  5IAA C;  3VTW A;  1E5W A;  1HTQ A;  2KVR A;  4PS3 A;  1J0G A;  2LGI A;  1WJ4 A;  4M0W B;  1ET6 A;  2G1E A;  4I6P A;  3NZU A;  3V61 A;  4AJW A;  2INP E;  2Z0D B;  2KZR A;  3PRZ A;  1KLV A;  2ZPN A;  3IAM 1;  4G11 A;  3R2I A;  4M00 A;  2AL6 A;  2O6V B;  3DDC B;  2AQ1 B;  2LZ6 A;  2KKC A;  4FBJ B;  1XLQ A;  3KLS X;  3P1M A;  2WXK A;  1HA5 A;  2BYE A;  3R3M A;  4ITK A;  3RNE C;  1GPX A;  3W9C B;  3AU5 A;  2JSV X;  2NCN A;  3B2F A;  4GDL A;  2BBC A;  4DHJ B;  3VDZ A;  2KTR B;  2LFI A;  1F2R C;  3RNF C;  2JY6 A;  2OOB B;  4Q2J A;  3Q3N C;  1C79 A;  1XLN A;  4FA6 A;  2ONQ A;  1DOX A;  4HWI B;  3I9V 1;  1L0Y B;  1WH3 A;  1ZUD 2;  3CWI A;  1PGX A;  1RYJ A;  3FAH A;  3TBL D;  1C1Y B;  1WM3 A;  2GOW A;  2K8H A;  3VUY A;  3N9Y C;  1WE6 A;  4F7Z A;  3HHM A;  3N1X C;  3U4E G;  2ZJD A;  3PS6 A;  3R66 C;  1EUV B;  1QF6 A;  3CST A;  2LRW A;  3PRE A;  3HIZ A;  1LM8 B;  2AQ2 B;  3GP7 A;  2L3Z A;  3DHG C;  4KVG B;  1UEL A;  2J42 A;  3H6N A;  4NJ6 A;  2OHF A;  4E74 A;  3DQV A;  4JWS C;  2FUG 1;  2HTM E;  2MW5 A;  2QHO A;  1V5O A;  3IXS A;  2PVO D;  1SEB D;  1GAQ B;  1WJU A;  2FCS A;  1GOZ A;  3AXC A;  2GBN A;  2JRH A;  3N30 A;  1EU3 A;  3KWV A;  2MBQ A;  1TTN A;  1FNW A;  3DPD A;  3N3K B;  1KF6 B;  1E9M A;  4GN1 A;  2LVO A;  2UU7 A;  2V3P A;  2KYW A;  4ZYS A;  1JRP A;  2V1Y A;  1RRB A;  1ZXI A;  2N9L A;  2WDR B;  1VZ8 A;  3ZLZ A;  2PPH A;  3AED B;  2L7R A;  4EEW A;  1NEK B;  2NS5 A;  4IWQ A;  1V81 A;  1FRR A;  4ANV A;  3WAM A;  3NUH B;  4XYC A;  2DZJ A;  4HDO A;  3R7R A;  4ASW C;  4P1C C;  3AE9 B;  2RPQ A;  4ZRP A;  2K6D B;  4WAA A;  4HJG E;  4XX5 A;  3ZO5 B;  1WGK A;  1IGC A;  3PV1 A;  3A9K B;  1RM6 C;  3NS8 A;  2I1K A;  4G50 A;  3DCG A;  3NZS A;  1STE A;  2D11 A;  1FXT B;  3ZNI D;  2D2Q A;  2OED A;  4RGO S;  3AEC B;  4IW0 A;  1F1H A;  2WXR A;  3R7Q A;  3VQI A;  4C00 A;  1S1Q B;  2LJI A;  3VAW A;  5FK9 C;  2ICI A;  2WXF A;  1L7Y A;  4GDK A;  1L6U A;  3IT4 B;  2EKE C;  3NZ3 A;  2HJ8 A;  3ZJV A;  1CK1 A;  4BFR A;  2WXQ A;  2QIL A;  5EDS A;  3RPF C;  2D5G A;  2IO1 B;  3ZDM C;  3P4S B;  1D3Z A;  4I6L B;  3OWE B;  3T3N A;  1MFW A;  3QWZ B;  2JU6 X;  3BYT B;  3ZNZ B;  1NDD A;  3APD A;  3MC0 B;  2IGG A;  2QEJ C;  4RMA A;  4UDU C;  3C0R B;  1I35 A;  4L2Y A;  4KGR A;  1U4A A;  3NS1 A;  2JZZ A;  4IM0 A;  3NVW A;  4W9E A;  1P0R A;  5G5H A;  1R4M B;  4KZC A;  3VTV A;  1CZP A;  2BF8 B;  4RGN A;  2DNF A;  1JW9 D;  3AU4 A;  3ENE A;  2CS4 A;  1HE8 A;  1SE4 A;  3PHX B;  4ICU A;  1KLG D;  1TS3 A;  4LK0 M;  1FMA D;  1KJT A;  2IJ0 A;  3LXF A;  1XF5 L;  4C56 C;  4N6E B;  4ZYN A;  2J0K A;  4EKU A;  1DGJ A;  3Q8C A;  1WYW B;  2KDF B;  1P1A A;  1RAX A;  3P4R B;  2KQ7 A;  4JLC A;  3DHH C;  2N9X A;  1M94 A;  4MJS A;  1MG8 A;  1VDV A;  1E8Z A;  4H2A A;  3TEW A;  2KNB A;  3TSS A;  3PLU A;  1N5W A;  1MPE A;  4W9J A;  1YMH E;  5D7G A;  3T3O A;  2WXJ A;  4N9F 4;  2DYM A;  4TQ1 A;  2RDG A;  2CHW A;  2MX2 A;  1V2Y A;  2IYD B;  4NZL B;  1SJH D;  4J6I A;  2JXX A;  1D4B A;  2N7J A;  2O6V A;  1IPG A;  3BZD B;  1GC7 A;  3PPA A;  1YX5 B;  4PYZ A;  3RUL A;  2BKF A;  1OQQ A;  4HCN B;  2WXG A;  2BB5 A;  1E6E B;  1Q0W B;  2KQS A;  4TSS A;  1EM7 A;  3KUD B;  1WX7 A;  4GDL B;  3KH0 A;  4NQL B;  1VCB A;  3RNB C;  3VTU A;  2LAS A;  4FLH A;  4KIK B;  4C7Z A;  2KJR A;  2MBH A;  1UH6 A;  5BYR A;  3QC8 B;  1LQB A;  1I4G A;  4IM2 A;  2BS2 B;  1QLB B;  4G0N B;  1F2R I;  1TT5 B;  2Y5B B;  3EFU A;  3AE6 B;  4HLE A;  3ZUN A;  2K0P A;  4CQN A;  5IKC M;  1OEY A;  3MTN B;  1P98 A;  2W55 A;  2LGX A;  1FCC C;  1EO6 A;  3B08 A;  2ZCB A;  2GBJ A;  3DBH I;  3VRA B;  3EC8 A;  1NYR A;  3EHV A;  1QZE A;  2PJH A;  2O6V D;  2R2Q A;  3WA0 A;  2W9N A;  1FM0 D;  3ZTC A;  1BUI C;  2DYB A;  4MEM A;  1WX8 A;  4FJY A;  3NHE B;  3KWL A;  2PMV A;  1IUE A;  4YXD B;  4M01 A;  2LXA A;  1E10 A;  4K7U A;  1ZXH A;  2JX5 A;  3PLV A;  3FC4 A;  1PYW D;  4XE0 A;  4II3 B;  5D3I B;  3HK0 A;  2IZV B;  3V62 A;  1V97 A;  3VXW A;  3KYD D;  4YT0 B;  1T0R C;  3BVZ A;  2BYV E;  1NYQ A;  3UI3 A;  3AE5 B;  4LDT D;  3NY5 A;  4RH6 A;  4HCP B;  1MHH E;  4MGI E;  4AWJ A;  1NI2 A;  2KAC A;  2V4I B;  1SXT A;  2FUH B;  2PE9 A;  1E8W A;  5GMV A;  2B76 B;  3DBS A;  2Q5W D;  4PYU A;  1L5P A;  2FE8 A;  2ZW1 A;  1ZDX A;  2WDV B;  5JHB A;  4NJC A;  2WXN A;  2ZNV C;  2GBK A;  1FIQ A;  3L17 A;  4DDG D;  5IN7 A;  1J7B A;  1J8C A;  5HHD G;  3H7P B;  2MBE A;  3AE2 B;  2I38 A;  1WGY A;  2NBW B;  3H9D A;  4ANW A;  2WXH A;  4LDT B;  1VRA B;  1E8X A;  1UUP A;  1V8C A;  2L52 A;  4JWU C;  1NBF C;  1PUT A;  4W9G A;  2D3A A;  3CF6 E;  2WHI A;  1SF0 A;  4PS7 A;  4JE3 B;  3H7S A;  4YSX B;  1TY0 A;  5D3D A;  2L8J A;  4W9H A;  4BOZ B;  4RFB A;  2GRI A;  1V5T A;  1WX9 A;  4W9K A;  2ON8 A;  1YQB A;  1V86 A;  3BIN A;  3NJT A;  1JAL A;  2BYT A;  1K50 A;  1JWU D;  2WGS A;  5E6O A;  3NVV A;  3P4P B;  3OJ3 A;  3KUZ A;  2AYO B;  5D94 A;  2MA9 B;  1IYF A;  1PQS A;  3ZYY X;  2PEA A;  1R4N B;  2VZK D;  3QCA A;  3A9J B;  4YL8 A;  1I4P A;  4LJP B;  5TSS A;  1AW7 A;  2NMQ A;  4P7I A;  1I4Q A;  2LVQ A;  1ZW7 A;  3VH4 B;  4CYE A;  2JPH A;  2ZNV B;  2KFK A;  4BKS D;  3APC A;  5E6J A;  1WXA A;  1FD6 A;  4ZRI A;  3UIO B;  2K9X A;  5IA7 A;  1FNU A;  5EE3 A;  4JPS A;  5IO9 A;  3PZ8 A;  3K9P B;  1F0Z A;  1E7V A;  2G4S A;  1A70 A;  2IY1 B;  3CSF A;  1XEE A;  4MAC A;  3TUO A;  4KGT A;  4B0M A;  1OFF A;  5CTR C;  3ZRC A;  1V1P A;  4AUQ C;  2C9W B;  1I7H A;  2JRI B;  1WYG A;  5AUK A;  1UWM A;  1Y56 A;  4A90 A;  3T9L A;  4JL9 A;  3SU8 X;  3EGR A;  1ISN A;  2FID A;  3AUL A;  5I4D A;  2WDQ B;  2D3G A;  5C2T B;  2RSU A;  2W82 A;  1T0Y A;  4B0E A;  3A9K A;  3V6E B;  1UZX B;  5H8Y E;  2KLC A;  3RI7 C;  2MLB A;  2IO2 B;  4E71 A;  3PZ7 A;  1P7F A;  3DBR B;  1JQ4 A;  5LXI B;  4LCD E;  3DVG X;  3EEC A;  1V9J A;  3H1U A;  5AZH A;  2KWD A;  4HEA 1;  4KDL B;  3KQ4 A;  1N63 A;  4LTU A;  1JML A;  2M17 A;  2WP9 B;  1YN3 A;  5HKH A;  2M4N A;  4WQO B;  2PLP A;  3RZF A;  1K53 A;  5AUI A;  4JX1 C;  3UQB A;  1HXY D;  3Q3M C;  2LMC A;  2NTS A;  4W9I A;  3U8Z A;  1SJE D;  2W54 A;  4ICV A;  1V80 A;  1GJZ A;  1PGB A;  1WGG A;  1WJ6 A;  1KLU D;  2JUO A;  3SD5 A;  3TEX A;  1LXD A;  1WWT A;  2M0A A;  2C5L C;  4A3O A;  1KM7 A;  2KAJ A;  3TCA A;  3RN9 C;  1SGH A;  2C7H A;  1S3S G;  2KWV B;  3Q8F A;  3NVZ A;  3A33 B;  1VR9 A;  1QQR A;  3DVN U;  1ZDV A;  1LFD A;  5JH5 C;  3E9S A;  4R3D A;  1QOA A;  2KQ4 X;  2OJR A;  4XDD A;  4RF1 A;  1VZ6 A;  5LXH A;  4GMV A;  2DZM A;  2I2Y A;  4FHK A;  1XQQ A;  4GLS C;  2JZP A;  3LDZ E;  4OVV A;  2E6X A;  4A9A A;  5T8I A;  4AP4 C;  4PS8 A;  1GUA B;  1NVI D;  2BYF A;  2HD5 B;  1PGA A;  2V3N A;  1SIF A;  3DBL B;  4LJO B;  1ACC A;  3ZXR A;  4DHZ E;  3Q8E A;  2WXL A;  1MHX A;  1TYG B;  2G3Q B;  2WXI A;  2MJE A;  2XNA C;  1YJI A;  1WSP A;  2O2V B;  2CJN A;  2DHZ A;  4W9L A;  3M63 B;  2X8X X;  1ESF A;  1N60 A;  1IBX A;  3TEY A;  2DAF A;  1B1Z A;  1WJN A;  3J9C A;  3ALB A;  3TL5 A;  4TMA B;  4WJQ A;  1QOF A;  2C7M B;  1BML C;  1JCK B;  1WI0 A;  3ZNH B;  1X1M A;  4XWW A;  3AMZ A;  5D6J B;  4I6N B;  1RFK A;  3RYT A;  3AEE B;  3I5J C;  1AYF A;  3IAS 1;  1HQR D;  3DVN V;  2WX1 A;  1LO5 D;  4FXC A;  3NG0 A;  1TJE A;  4FJV B;  2BQQ A;  1WZ0 A;  1C78 A;  4RM9 A;  1VJK A;  3IT6 B;  2N9K A;  1WXM A;  1FRD A;  4P6V F;  2KX3 A;  1T3Q A;  2KWU B;  4WJN A;  3EFC A;  2DEN B;  2IDY A;  4MSM B;  4B6W A;  3JSV B;  2LXC A;  2RPV A;  4YTM B;  4LNF A;  4RCO A;  1Q1O A;  3A4S C;  3B2G A;  1EU4 A;  3U2S C;  2D07 B;  2AX5 A;  2NTT A;  1FEH A;  4ARI A;  4IWP A;  2MP2 A;  1ZGU B;  3AEF B;  2PE6 B;  5J17 A;  1C9F A;  2WU2 B;  2KX0 A;  4MGY E;  1MG4 A;  1E8Y A;  3APF A;  1KRH A;  3IBE A;  2Y3A A;  1KFY B;  3TMP B;  1DOY A;  4HKZ E;  3SDL C;  5BMI A;  1FO4 A;  1D6E C;  1FFU A;  1MJD A;  3SFE B;  3BII D;  2EEL A;  2IO3 B;  1Z2M A;  2DAJ A;  4HVB A;  2VH1 A;  2BKR B;  2KC2 A;  2KLG A;  1T5X D;  3L16 A;  4ANU A;  5C1Z A;  4CHK A;  1AWD A;  3U52 E;  4HRO A;  2JYE A;  3AE8 B;  2FCQ A;  4W9C A;  4MH8 A;  2D10 A;  1YX6 B;  1QKZ A;  3RUI B;  3EUB 2;  2IGH A;  2WDT B;  1DYQ A;  3Q3J A;  1OTR B;  2D3B A;  3H7P A;  1Q5W B;  3MC9 A;  3V05 A;  1ROE A;  5MPO A;  3UQA A;  4XC2 A;  3V6C B;  5G2N A;  1B9R A;  1J19 A;  4TUU A;  4TV3 A;  3O13 A;  4L1B A;  2MHJ A;  4HK2 A; 
#chains in the Genus database with same CATH homology
 2MBE A;  2CHX A;  4G11 A;  4K7W A;  2NBW B;  1WGY A;  2AL6 A;  3H9D A;  3PVL A;  4ANW A;  4DBG A;  4LDT B;  1G6J A;  4MEL A;  2O6V B;  3DDC B;  4NQK E;  4FN2 A;  2YVC A;  2LZ6 A;  2KFK B;  2HTH A;  2KKC A;  1E8X A;  4W9F A;  4EZK A;  2DX5 B;  4FBJ B;  4RM8 A;  3MJW A;  1KOT A;  3RZW C;  2BYE A;  2K25 A;  2MBB B;  3R3M A;  2J0M A;  2G4D B;  2AEH A;  3AU5 A;  4EZL A;  1NBF C;  1P9D U;  2NCN A;  4W9G A;  3CF6 E;  2LGY A;  2N1W A;  3HM6 X;  2NBU A;  3PSE B;  1WIA A;  4GDL A;  4PS7 A;  2FCN A;  4DHJ B;  3VDZ A;  4EOY A;  3H7S A;  2KTR B;  4WJP A;  2L8J A;  2JY6 A;  4AJY B;  3RCZ A;  4W9H A;  1V6E A;  2OOB B;  3UIN B;  4BOZ B;  1E7U A;  4FA6 A;  4DK5 A;  3ML8 A;  2NVU I;  2MBO A;  2XK5 A;  1V5T A;  4GGQ A;  4HWI B;  1WX9 A;  4W9K A;  3WAO A;  2KAN A;  1WH3 A;  1YQB A;  1V86 A;  1UD7 A;  2DYO A;  2NPT A;  3BIN A;  2LI5 A;  3TBL D;  1C1Y B;  1WM3 A;  2GOW A;  4MDK E;  2K8H A;  2WX0 A;  2O2V A;  4ZRK A;  3VUY A;  1WE6 A;  4F7Z A;  3HHM A;  1YJ1 A;  4HPM B;  3UF8 A;  2ZJD A;  2VRR B;  3W1S A;  4F8C B;  2XK5 B;  3PS6 A;  5E6O A;  3R66 C;  1EUV B;  3OJ3 A;  3KUZ A;  2AYO B;  2B3A A;  5D94 A;  3ZW3 A;  3CST A;  2J7Q B;  2LRW A;  2MA9 B;  1IYF A;  3PRE A;  3HIZ A;  2KJ6 A;  4JQW C;  1LM8 B;  2MSE D;  4XZ4 A;  5LLI A;  3ZDT A;  1PQS A;  1OGW A;  5D2M B;  1EF1 A;  2L3Z A;  2PEA A;  1WZ3 A;  4BBN F;  4KVG B;  1UEL A;  1C3T A;  3PZD A;  3H6N A;  3PT2 B;  3QCA A;  4NJ6 A;  2XEW A;  4E74 A;  3DQV A;  3A9J B;  4YL8 A;  2MW5 A;  4LJP B;  2QHO A;  4P7I A;  5BO4 B;  3WIM A;  1V5O A;  2LVQ A;  3IFW B;  5DCN A;  2HE7 A;  2K1F A;  1ZW7 A;  2KTF A;  3VH4 B;  2YLM A;  4KDI C;  1K8R B;  4X57 B;  4CYE A;  2JPH A;  2CU1 A;  2ZNV B;  2KFK A;  4BKS D;  1WJU A;  2FCS A;  2IY0 B;  3APC A;  3P2B A;  4JGH B;  3TJP A;  1WXA A;  3AXC A;  3N32 A;  2GBN A;  4ZRI A;  3UIO B;  1TZ1 A;  5J2R A;  3PRP B;  4DWF A;  5IA7 A;  3QX1 A;  2JRH A;  3N30 A;  4HDQ A;  1TBE A;  2LUE A;  1WY8 A;  2MBQ A;  3ECI A;  1TTN A;  2JVC A;  4BKS A;  3DPD A;  3N3K B;  2MQJ A;  4GN1 A;  4E3C A;  2KOX A;  5E6N A;  1WXV A;  2ZPY A;  1UGM A;  2LVO A;  3K9P B;  2N9P C;  1E7V A;  1RLF A;  2G4S A;  4K7S A;  4IUM B;  2V1Y A;  2IY1 B;  3CSF A;  1RRB A;  1WMH B;  3JW0 X;  3QAR A;  4HPL B;  3ZNG C;  1WR6 E;  3ZLZ A;  2WYQ A;  2PPH A;  2JF5 A;  2KDI A;  2L7R A;  3A4R A;  4EEW A;  2NS5 A;  3B1L X;  5CTR C;  3ZRC A;  4GU2 A;  4IWQ A;  3QJZ A;  2KDE B;  2Z0E B;  1V81 A;  2R2O A;  4AUQ C;  2C9W B;  1WMH A;  2Z59 B;  3WAM A;  4ANV A;  2JRI B;  3L54 A;  3IHP C;  1IP9 A;  2DZJ A;  4MH0 E;  2WWZ A;  2KMA A;  4HDO A;  3T8M A;  3R7R A;  4ASW C;  3PRM B;  3T9L A;  2G45 B;  5L95 C;  4BOS C;  4JL9 A;  3SU8 X;  3VH3 B;  2M0X A;  2RPQ A;  1VD2 A;  3U7D A;  2K6D B;  4WAA A;  4WWO A;  4XX5 A;  3ZO5 B;  1ISN A;  2FID A;  3PV1 A;  3A9K B;  3AUL A;  2KN5 A;  2CR5 A;  3NS8 A;  3ML9 A;  5DPW A;  2I1K A;  4G50 A;  3DCG A;  2D3G A;  1XD3 B;  3NZS A;  2BWE S;  2D11 A;  2L00 B;  1WRD B;  1FXT B;  3QHT A;  2RSU A;  3ZNI D;  2D2Q A;  4FAD A;  3B0A A;  1T0Y A;  1P3Q U;  5J18 A;  3A9K A;  4IW0 A;  3SHQ A;  2N4F A;  3V6E B;  1UZX B;  3R7Q A;  3VQI A;  5CHF A;  1RFA A;  5E6P A;  4MGK E;  1S1Q B;  4DHJ D;  2KXJ A;  2KLC A;  3VAW A;  2MLB A;  5JHA A;  4DDI D;  2JWZ A;  4GXB A;  2IO2 B;  1L7Y A;  4E71 A;  4GDK A;  3DOW A;  4B9K A;  2M1M A;  5KHO A;  2EKE C;  5LXI B;  4LCD E;  3DVG X;  1Z5S B;  3EEC A;  2HJ8 A;  3K9O B;  5AZF A;  4GOC A;  1V9J A;  1WM2 A;  3H1U A;  5AZH A;  2KDB A;  4BFR A;  4GIV A;  2FAZ A;  5EDS A;  2DZI A;  4KDL B;  4M8N A;  2AWT A;  2IO1 B;  3ZDM C;  1R4N I;  2M17 A;  2FIF A;  5HKH A;  1D3Z A;  4I6L B;  2M4N A;  4WQO B;  4FJZ A;  3RZF A;  3QWZ B;  5CX3 A;  4NAW A;  2BPS A;  3UQB A;  3VFK A;  3ZNZ B;  1NDD A;  4TKN A;  4W9I A;  3U8Z A;  2CHZ A;  2ZCC A;  3APD A;  3Q3F A;  3HM3 A;  3QQ8 B;  4ICV A;  1V80 A;  1GJZ A;  1H8C A;  1WXS A;  1WGG A;  2KFJ A;  1WJ6 A;  2JUO A;  4RMA A;  3C0R B;  1I35 A;  3SD5 A;  3UIP B;  1LXD A;  4A3O A;  2C5L C;  1U4A A;  1KM7 A;  2FCM A;  2LD9 A;  4MM3 A;  3QK0 A;  2JZZ A;  3PHW B;  2K8C A;  4IM0 A;  2L05 A;  4KZ0 A;  1OEY J;  4W9E A;  1P0R A;  3TCA A;  2L0T A;  4IM3 A;  1SGH A;  3DBR I;  2RGF A;  2C7H A;  4KZC A;  3VTV A;  5DPS A;  1S3S G;  1SE9 A;  2ZZP B;  2KWV B;  2BF8 B;  2NR2 A;  3ZIM A;  3IVF A;  5AZG A;  3A33 B;  2LWP A;  4BVU C;  3DVN U;  4MSQ B;  3TIX A;  1LFD A;  1GC6 A;  1EF5 A;  3AU4 A;  4GDK B;  5JH5 C;  4NJ7 A;  2OJR A;  2N1V A;  3ENE A;  2L0F A;  3WAL A;  3ZRF A;  2CS4 A;  1HE8 A;  4KV2 A;  5LXH A;  4JIO U;  3IG3 A;  3ZVV A;  4GMV A;  3S2A A;  3PHX B;  4ICU A;  2DZM A;  4KSL C;  1KJT A;  3KYC D;  2ZVO A;  4FHK A;  2EMS A;  4MJS B;  3LJ3 A;  5C23 A;  1XQQ A;  4FUL A;  3LDZ E;  2J0K A;  4OVV A;  3DBL I;  4ZYN A;  4EKU A;  4B95 A;  3ONS A;  4ZDV A;  1WYW B;  2M8S A;  3OJ4 B;  4KIK A;  2KDF B;  1P1A A;  3ZTD A;  4AP4 C;  3AI5 A;  1RAX A;  4PS8 A;  2KQ7 A;  3X23 A;  1GUA B;  4JLC A;  1TGZ B;  2N9X A;  4A3P A;  1M94 A;  4WWN A;  2BYF A;  4MJS A;  5G55 A;  2HD5 B;  1GNU A;  1MG8 A;  1SIF A;  4LJO B;  4K1R B;  5CHV C;  4DHZ E;  1E8Z A;  4WJO A;  3BY4 B;  2KNB A;  4DXA B;  3W1S C;  2K8B A;  2G3Q B;  3GZN I;  1WR1 A;  2KWC A;  1XT9 B;  3PLU A;  3JYU A;  4WWP A;  5DPR A;  1F9J A;  3PTF C;  4W9J A;  2ZVN A;  5TR5 A;  1H4R A;  2GBM A;  5D7G A;  3L10 B;  4HJK A;  3MHS D;  2KMC A;  2UYZ B;  1UBQ A;  4N9F 4;  2KD0 A;  1AAR A;  2O2V B;  4CO7 A;  3WAP A;  2DHZ A;  2DYM A;  4W9L A;  3GOE A;  3M63 B;  4TQ1 A;  1Y8R C;  2KHW B;  4KSK C;  2CHW A;  2MX2 A;  2N7D A;  1V2Y A;  2DAF A;  2IYD B;  2ASQ A;  1WJN A;  4J6I A;  2JXX A;  3ALB A;  3VUX A;  2C7N B;  3TL5 A;  4EZJ A;  4WJQ A;  2O6V A;  2C7M B;  3L13 A;  1GG3 A;  1WI0 A;  1IPG A;  2UWQ A;  3ZNH B;  1X1M A;  2A5U A;  1GC7 A;  1WFY A;  3PPA A;  1YX5 B;  4PYZ A;  3VVW B;  2XBB C;  3RUL A;  5AEK B;  5JZE B;  2BKF A;  4HCN B;  5D6J B;  2N7E A;  3O65 B;  3KW5 B;  4GSW A;  1Q0W B;  4I6N B;  2KQS A;  3L08 A;  3KUD B;  1WX7 A;  3KUC B;  3KH0 A;  4GDL B;  4NQL B;  2LJ5 A;  3RYT A;  2MRP A;  1UBI A;  4EFO A;  3M95 A;  1VCB A;  1YIW A;  3DVN V;  4M8M A;  3VTU A;  2WX1 A;  3W1Y A;  2V3S A;  2LAS A;  3RD2 A;  3UGB B;  2KK8 A;  4FLH A;  4KIK B;  2KJR A;  5FR6 A;  2KO3 A;  2MBH A;  3I3T B;  1UH6 A;  3JSV A;  4FJV B;  3QC8 B;  1ZKH A;  1LQB A;  4IM2 A;  4NPN A;  3WAN A;  1WZ0 A;  4RM9 A;  2A4Z A;  1WXM A;  2KX3 A;  4G0N B;  4F1S A;  2KWU B;  3DVG Y;  2C60 A;  2AL3 A;  4GB9 A;  1V49 A;  2EMT A;  4WJN A;  4ZRJ A;  2JZ3 B;  2DEN B;  4MSM B;  2Y5B B;  4B6W A;  2ZEQ A;  3JSV B;  2LXC A;  3EFU A;  4NAW B;  4HXD A;  2IO0 B;  4HLE A;  1E90 A;  4W9D A;  3ZUN A;  1Q1O A;  3A4S C;  2GMI C;  1OEY A;  2K39 A;  1P98 A;  3MTN B;  3OLM D;  2LGX A;  2N9E B;  3PGE A;  4IC7 B;  3NOB A;  2D07 B;  2BGF A;  1EO6 A;  3B08 A;  2REX A;  4OVU A;  3M62 B;  4MGZ E;  2ZCB A;  4IWP A;  1CMX B;  4BKT A;  2MP2 A;  4EUT A;  1ZGU B;  2GBJ A;  3DBH I;  2GBR A;  2BWF A;  3M3J A;  2PE6 B;  5J17 A;  3A9J A;  3EC8 A;  4II2 B;  2LGD A;  4A20 A;  2LRU A;  3EHV A;  2KX0 A;  1QZE A;  4FHJ A;  1JRU A;  2O6V D;  2PJH A;  2R2Q A;  2W9N A;  4MGY E;  3WA0 A;  4TQ0 A;  1E8Y A;  2NBV B;  3APF A;  2DZK A;  3ZTC A;  3D32 A;  3IBE A;  1WGR A;  4NNJ B;  3TMP B;  2DYB A;  4MEM A;  5CHW A;  1WX8 A;  4FJY A;  3SDL C;  2K6Q A;  5L83 A;  3NHE B;  3VHT C;  1OQY A;  2IBI B;  4IWO A;  5DPT A;  4BBN C;  2LXA A;  2MCN B;  4K7U A;  3CMM B;  1WE7 A;  2KC1 A;  2JT4 B;  2MWS B;  3A1Q A;  3PLV A;  2FNJ B;  4K81 A;  4URK A;  1WGD A;  4ANX A;  4II3 B;  2IO3 B;  2L76 A;  1I42 A;  3HK0 A;  4NY0 A;  1Z2M A;  2CKH B;  2DAJ A;  2IZV B;  4G3X B;  4HVB A;  3RT3 B;  3V62 A;  2BKR B;  2KC2 A;  2KLG A;  3KVF B;  4IG7 B;  1L2N A;  3VXW A;  3L16 A;  3KYD D;  4ANU A;  4DHZ B;  5C1Z A;  3ZKJ C;  3A1Q B;  2KTR A;  3V60 A;  3VUW A;  1R4M I;  4AOF A;  2BYV E;  4CHK A;  1WF9 A;  3QAQ A;  1BT0 A;  4LDT D;  2I1J A;  3NY5 A;  1A5R A;  3QIJ A;  2FCQ A;  4W9C A;  5KHQ A;  4HCP B;  2KJH B;  4MGI E;  2D10 A;  4AWJ A;  1NI2 A;  1YX6 B;  2RR9 A;  3JVZ X;  3U30 A;  2NPT B;  2RD0 A;  3RUI B;  5IAA C;  2FUH B;  1E5W A;  3VTW A;  2KVR A;  2PE9 A;  4PS3 A;  1J0G A;  2LVP A;  2WDT B;  3L0W B;  1E8W A;  3OAW A;  5GMV A;  1WJ4 A;  4M0W B;  3DBS A;  2V4L A;  4I6P A;  3NZU A;  2MP2 B;  1OTR B;  3Q3J A;  4PYU A;  3V61 A;  3H7P A;  1Q5W B;  2J0J A;  3X0W A;  4BKG A;  4AJW A;  3UQA A;  5JHB A;  1WGH A;  4XC2 A;  3V6C B;  5G2N A;  1J19 A;  2ZNV C;  2GBK A;  3L17 A;  4TUU A;  4DDG D;  4TV3 A;  3QA8 A;  2Z0D B;  2KZR A;  3PRZ A;  1J8C A;  1YD8 U;  3H7P B;  1KLV A;  2ZPN A;  4HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...