4GDKA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdkA00
4HCNB 5D2MB 3VUWA 1XT9B 4DK5A 1V80A 2ZZPB 4CYEA 4GXBA 2MP2A 4GDLB 4ZYNA 2D07B 2LXAA 5JHAA 4II2B 1LXDA 2C7HA 4PYZA 1A5RA 2K8BA 3AXCA 3VH3B 2G3QB 3VTVA 2C5LC 1EUVB 2FIDA 2LZ6A 3MJWA 3N32A 3K9OB 1WGHA 2MSED 4MSQB 3IHPC 2FCQA 3RD2A 2ZVOA 4K1RB 1KM7A 2CU1A 2K39A 3ALBA 3CF6E 3JW0X 4FN2A 4I6LB 3ZNID 3ML8A 5TR5A 2MLBA 3QC8B 2A5UA 1IPGA 1WF9A 3ECIA 3QARA 3AULA 2KWUB 2N9PC 2K1FA 2GBRA 2NPTA 4NAWB 3H7PA 2C7NB 2JF5A 4FJZA 2LUEA 1RRBA 5L95C 4GOCA 3M3JA 1S1QB 1UBQA 1Q0WB 4WQOB 3PRPB 4AOFA 4ANXA 3LJ3A 2EMTA 2RGFA 4IW0A 1P98A 4M8NA 3ZIMA 3DCGA 4W9HA 5CHFA 2MX2A 4DHJB 2FIFA 5JH5C 4HWIB 2KDEB 3QQ8B 4WWPA 2KMAA 3PREA 4NPNA 2KJRA 3W1SC 3EECA 1Y8RC 1Q1OA 4DDGD 2KDFB 1VD2A 2WDTB 2IBIB 4HXDA 2L0TA 3L10B 2AWTA 4FHJA 1WXMA 3ZLZA 1TBEA 3CSFA 3ZNGC 1E8WA 4ZRKA 2BKFA 1E8ZA 4I6PA 2MA9B 2KX3A 3H1UA 3PT2B 1M94A 2IO0B 5CTRC 3VVWB 2LVQA 3UQAA 2DZIA 2JXXA 1KLVA 4GMVA 2DENB 4W9EA 3QX1A 2REXA 2CHZA 1P9DU 4IC7B 4NJ6A 5J2RA 3QHTA 3LDZE 4J6IA 3VHTC 4F8CB 4CO7A 4K7WA 1WR6E 4A3PA 4BKSD 1J8CA 2BGFA 4HDQA 5GMVA 2UYZB 3KUCB 3T9LA 2O6VB 4W9CA 4GDLA 1OQYA 3S2AA 2M4NA 1WGDA 3KUZA 4BVUC 3NHEB 4W9JA 2ASQA 4RMAA 2ZPNA 1G6JA 1YJ1A 4NQKE 2XBBC 4WWNA 3SD5A 3ZVVA 2M1MA 2C7MB 2PPHA 4W9DA 2BF8B 1ZW7A 4I6NB 3PZDA 3ZRCA 3DVGX 1WJNA 2M17A 2KFKB 5C23A 1CMXB 3ZTDA 4BOSC 3ML9A 1GUAB 1WE6A 3HIZA 4FJYA 3WALA 1V9JA 4W9IA 1V81A 2DZKA 1J19A 3W1YA 4MSMB 1AARA 1IYFA 1LQBA 1V2YA 4HLEA 4HVBA 3UINB 3TL5A 5KHOA 2CR5A 4ZRIA 1EO6A 3NY5A 4MGZE 2OJRA 2DX5B 2KOXA 3JVZX 3L54A 3QK0A 4OVVA 5E6NA 3WANA 4ICUA 3B0AA 3OAWA 3R7RA 3L08A 4F1SA 1RAXA 2N1WA 2MW5A 1V86A 4G11A 3U8ZA 1E8XA 3BINA 3ENEA 3KW5B 4ICVA 5D6JB 2AYOB 2PE9A 4DXAB 2IZVB 2L8JA 3QA8A 4GU2A 4TKNA 3PV1A 4P7IA 4TUUA 4KDLB 1WY8A 3PTFC 2W9NA 4W9LA 2DZMA 5DPTA 4GGQA 2CKHB 2WX1A 3APFA 4HJKA 3RUIB 3UIOB 3X23A 4BBNF 3QWZB 2LVOA 4MDKE 2IY1B 4M8MA 3B08A 3H9DA 3WA0A 1UD7A 2KK8A 1NI2A 3KUDB 3PS6A 4URKA 1X1MA 3PVLA 3PPAA 1LM8B 2O6VA 1P1AA 4G3XB 1GC6A 3VTUA 3DVNU 4IM3A 2D2QA 4EOYA 4F7ZA 3M63B 2G4DB 4IG7B 4G0NB 2DHZA 1WI0A 5L83A 3DOWA 4E74A 3AU4A 1WYWB 4DWFA 4OVUA 4W9GA 3TMPB 4FBJB 3P2BA 2MBEA 3B1LX 1L7YA 1WM2A 3N30A 1IP9A 2R2OA 3PLUA 3IBEA 2N4FA 3TJPA 3ZDMC 4FULA 4WWOA 2Y5BB 1UELA 2DYOA 2FUHB 2LVPA 2L00B 4XC2A 4KV2A 3RZWC 1GJZA 1EF1A 1ZKHA 2KQSA 3PHXB 3DDCB 1WJ6A 3A9KA 3EFUA 2IO1B 2FCNA 3WAMA 4KSKC 3ZTCA 1V49A 2ZPYA 4MJSA 5AZGA 2M0XA 2KXJA 3JSVB 3ONSA 4AWJA 5HKHA 3BY4B 2PEAA 4LJOB 5AZFA 2MCNB 2JY6A 1UH6A 3VFKA 2J0MA 1YIWA 3R66C 4GSWA 4MGYE 4LDTB 4MGIE 1GC7A 2BWES 2I1JA 5CHWA 4II3B 1P3QU 2D3GA 2KDIA 2V1YA 2AL6A 2LI5A 5IAAC 4AJWA 2K8CA 4BBNC 2FNJB 2LGXA 3A9JB 2IO3B 2NR2A 1WGYA 4MEMA 4B6WA 1TGZB 4AP4C 4KVGB 4EFOA 3OJ4B 3L16A 5EDSA 3DBRI 2GOWA 3HHMA 4GDKA 2PJHA 3Q3JA 2LGYA 3VDZA 2J0JA 4M0WB 5JZEB 2NS5A 3DBHI 1TZ1A 4FLHA 4EZKA 3KVFB 1MG8A 3PHWB 2KWCA 5AZHA 3RYTA 3W1SA 4ZDVA 2LD9A 4MM3A 2KD0A 2EMSA 3DVNV 2KANA 4BKGA 2ZNVB 1WIAA 1E7UA 3KYCD 4AJYB 5FR6A 3A1QB 2BWFA 3X0WA 3C0RB 1C1YB 2J7QB 1E8YA 2JVCA 2DYBA 4GIVA 4LDTD 1GG3A 5E6OA 1YX6B 2VRRB 4KZCA 2O2VB 5J17A 2KJHB 1RLFA 1YD8U 2CHXA 2L3ZA 1T0YA 4EKUA 3PSEB 4KDIC 2L0FA 2KDBA 3OLMD 1OEYA 4NAWA 5JHBA 2LRWA 4BKSA 3PLVA 2MRPA 1WXAA 4AUQC 3IG3A 3M62B 3DVGY 3UIPB 4G50A 2BYFA 3TBLD 3IVFA 2GBJA 4HPMB 1WGGA 3CSTA 3VQIA 3ZW3A 3A33B 2M8SA 2KX0A 1KJTA 3NZSA 4FA6A 1I42A 1UZXB 2ZVNA 2DAJA 3VH4B 3D32A 1E90A 1V5TA 5KHQA 2ZCCA 5DPRA 1PQSA 3L13A 2ZNVC 3PGEA 2V3SA 4BOZB 3A9JA 4DHZB 1OTRB 4PS7A 2LXCA 4CHKA 1F9JA 5LXHA 2KJ6A 1ISNA 4IM0A 3H6NA 4PYUA 5AEKB 1EF5A 2UWQA 4K81A 1SIFA 4ANUA 2BYVE 4KIKB 3RULA 3WAPA 2HJ8A 3HM3A 4RM9A 1P0RA 2WX0A 2K25A 2NPTB 2KLCA 2XEWA 2FCSA 3H7PB 4JIOU 3SDLC 2N9EB 4HDOA 1GNUA 2MBBB 1V5OA 3VUXA 4LCDE 3DQVA 3APDA 3H7SA 3ZNHB 1WZ0A 2AEHA 2AL3A 4MGKE 3MTNB 3R7QA 3APCA 3NZUA 2JT4B 4RM8A 2DYMA 2KC2A 3RZFA 1D3ZA 3V60A 4HCPB 1RFAA 4B95A 3VTWA 1UGMA 1WZ3A 1S3SG 2JUOA 4DDID 4KZ0A 4MELA 5J18A 3V6CB 1NBFC 1WRDB 4FADA 2RPQA 2Z0EB 3PRMB 1Z2MA 2GBNA 1V6EA 4JL9A 5LLIA 1NDDA 4JLCA 1XD3B 2KFKA 4W9FA 3UGBB 3ZDTA 4WJOA 1WFYA 3WIMA 2MBQA 2KFJA 3A4RA 3CMMB 5C1ZA 3K9PB 5DCNA 4IUMB 4ASWC 2NBWB 1OEYJ 2GBKA 4XX5A 1WMHB 3NOBA 5BO4B 3ZO5B 2KN5A 2CS4A 2ZEQA 1WXVA 2KKCA 2KHWB 2FCMA 3N3KB 4TQ1A 4EEWA 2GMIC 4HK2A 3U7DA 1E5WA 3KYDD 2WWZA 4JGHB 5D7GA 2KTRB 2BYEA 3A4SC 3RCZA 3VXWA 2N9XA 5DPWA 2DAFA 2BKRB 2R2QA 1WX7A 2RR9A 2KTFA 4XZ4A 2NBVB 3HM6X 2A4ZA 3ZKJC 3O65B 4KIKA 1U4AA 2KWVB 3SHQA 3VUYA 4EUTA 4DHZE 1ZGUB 4X57B 3U30A 2L76A 4TV3A 4K7SA 2C9WB 1WJ4A 4N9F4 3V6EB 1WGRA 4B9KA 2YVCA 3JYUA 3GOEA 3R3MA 3UQBA 1WJUA 2RD0A 1XQQA 4A20A 4FJVB 4NY0A 4GN1A 1QZEA 5G2NA 3NS8A 2FAZA 2N7EA 2MBHA 4A3OA 1I35A 3RT3B 2N1VA 2XK5B 1VCBA 1YX5B 2B3AA 4DBGA 3ZRFA 3L17A 3GZNI 3T8MA 4EZJA 4EZLA 1R4NI 1WE7A 2RSUA 5E6PA 2V4LA 2WYQA 4IWPA 2NBUA 1HE8A 2NCNA 1C3TA 1SGHA 3AU5A 2KC1A 2JZ3B 4W9KA 4KSLC 1SE9A 2D11A 1H4RA 1R4MI 2J0KA 2Z0DB 3QAQA 1WMHA 4WAAA 2L7RA 3V62A 2KVRA 4WJQA 4YL8A 1OGWA 2HE7A 1Q5WB 4WJNA 2G4SA 3JSVA 4PS3A 2I1KA 2HD5B 1JRUA 3HK0A 2K8HA 2KTRA 4NJ7A 2CHWA 2IYDB 4DHJD 5IA7A 1J0GA 5CX3A 2D10A 2PE6B 2MP2B 3IFWB 2LRUA 1UBIA 2DZJA 4NNJB 4E3CA 1KOTA 2G45B 4NQLB 4ANVA 1YQBA 3I3TB 1WH3A 1K8RB 2QHOA 2ZJDA 2JRHA 3SU8X 3TIXA 4K7UA 4JQWC 2KO3A 2LJ5A 4ANWA 2KNBA 3TCAA 2L05A 2N7DA 2GBMA 3DBLI 1L2NA 1FXTB 2BPSA 3L0WB 3A9KB 2JRIB 4PS8A 3V61A 1WX9A 2EKEC 1WXSA 3EHVA 3MHSD 4MJSB 3QJZA 3WAOA 2OOBB 4HPLB 4BKTA 4E71A 3VAWA 3AI5A 3QCAA 2O6VD 2MWSB 2XK5A 3DBSA 1TTNA 4FHKA 4IWQA 1BT0A 3OJ3A 2NVUI 2YLMA 4ZRJA 1WM3A 2MBOA 4MH0E 3M95A 4TQ0A 1WR1A 1E7VA 3A1QA 2KQ7A 5DPSA 3DPDA 2MQJA 3UF8A 2JZZA 2JWZA 2KMCA 2O2VA 3QIJA 5LXIB 2K6QA 2LGDA 5D94A 2LASA 3Q3FA 4IM2A 2JPHA 3KH0A 2LWPA 4LJPB 3EC8A 1Z5SB 2KZRA 4IWOA 5CHVC 2Z59B 3ZNZB 4GDKB 1WX8A 2C60A 4BFRA 2IY0B 2HTHA 3ZUNA 1H8CA 2ZCBA 4WJPA 1LFDA 5G55A 3PRZA 4GB9A 2K6DB 2IO2B 2KLGA
chains in the Genus database with same CATH superfamily
3VUWA 1XT9B 3AEDB 2WXKA 4GDLB 3VH3B 1FCCC 2LZ6A 2QILA 1WGHA 4MSQB 4R3DA 1SSNA 2FCQA 3NG0A 3UI3A 3RD2A 1KM7A 3JW0X 3ZNID 3ML8A 3P63A 4XE0A 4P1CC 3AE2B 3QC8B 3RNBC 3DWGC 4OW0A 2JSVX 2INCC 2N9PC 2K1FA 2DNFA 2NPTA 3H7PA 2C7NB 5L95C 5FR3A 4WWMA 2INPE 2EMTA 4IW0A 3ZIMA 4DHJB 1N62A 4LNOA 4HWIB 2KDEB 2KMAA 1Q1OA 1VD2A 2BKFA 1PYWD 2MA9B 2KX3A 2RDBC 3DBLB 1M94A 2WXIA 3H1UA 1JWBD 3ZXRA 4KX6B 2DENB 3BZDB 4IOIE 1FNUA 2REXA 1WSPA 1P9DU 4J6IA 4F8CB 4CO7A 5LNK1 4BKSD 2UYZB 3KUCB 3T9LA 4W9CA 2IGDA 3S2AA 1WGDA 3NHEB 3VR8B 3TEYA 3U4EG 2PPHA 1QOFA 2WQYB 3DHGC 1ROEA 3ZRCA 3AE6B 1CMXB 4BOSC 3HIZA 2PVGC 4LNNA 3WALA 3ETRA 1J19A 2KQ4X 1XLPA 1IYFA 1AARA 1LQBA 4ZRIA 2OJRA 2KOXA 2WXHA 1ZUD2 3QK0A 3WANA 4ICUA 4RCOA 1FNVA 1RAXA 2MH7A 2PE9A 1HA5A 1V97A 2EELA 3PV1A 3Q8BA 2CU3A 1SJHD 3UIOB 1TY2A 1QOAA 3QWZB 2LVOA 4MDKE 2K5PA 4M8MA 3PS6A 1LM8B 4IM3A 2JYEA 4NAMA 4EOYA 1E9MA 4IG7B 2DHZA 5BMIA 1WYWB 4DWFA 4OVUA 4W9GA 4FBJB 2NMQA 1R4NB 1L7YA 2R2OA 2WXPA 3TJPA 1PGXA 4WWOA 4PK1A 1UELA 3BYTB 4UDUC 2N9LA 4KV2A 1EF1A 3PHXB 1Q10A 3PZ8A 4RGTA 3U52E 4ZHOA 1HZ6A 4AWJA 5IKCM 2MCNB 2JY6A 1I4QA 1UH6A 2I38A 2J0MA 4JX1C 4GSWA 4MGIE 2BT6A 2G9HD 2DLBA 1R7SA 5MPOA 2SEBD 2LGXA 3BK1A 2E6XA 3E56A 4AP4C 3AM9A 4KVGB 1QOBA 5EDSA 4GDKA 3W5UB 3VDZA 4OVZA 3NJTA 4RNAA 3B2FA 2RMMA 2W3RA 1TYGB 1MG8A 2KWCA 1N61A 2EMSA 2ZNVB 4LNKA 3RFZB 4M02A 3J9CA 1C1YB 2J7QB 1E8YA 1P7FA 1GG3A 5E6OA 1YX6B 4KZCA 3O13A 2KJHB 1TS2A 4LNFA 2KDBA 4NAWA 2LRWA 2MRPA 1JMLA 4G50A 3IVFA 2JQRB 4HPMB 3CSTA 3BIID 3A33B 3NZSA 4ZYSA 1I42A 1UZXB 3D32A 1E90A 1ESFA 1V5TA 3AN1A 3MFGA 4N59A 1PQSA 2ZNVC 3PGEA 2V3SA 4BOZB 1L6UA 3RNFC 1RYJA 3H6NA 2W82A 1KRHA 2UWQA 4ANUA 3V05A 2BYVE 4KIKB 3RULA 4RM9A 3NRZA 2D3BA 1WGKA 2XEWA 2MBBB 3VUXA 4LCDE 4RF1A 2WHIA 3ZNHB 5D3IB 1YOVB 3MTNB 1D3ZA 2KC2A 3IAS1 2BS3B 4RGNA 1RFAA 1DGJA 3VTWA 4B95A 1FO4A 1NBFC 4L1BA 2RPQA 1Z2MA 4PT5A 3DBRB 4JL9A 2BTEA 5LLIA 3ZDTA 4W9FA 4WQMA 4WJOA 4WAFA 1P7EA 4ASWC 1YNTE 1OEYJ 2GBKA 1JCKB 4XX5A 2ZEQA 1WXVA 2KKCA 2BQQA 1YMHE 4EEWA 1VZ8A 2WWZA 1CZPA 4ZHPA 4A8XC 3RCZA 1JWMD 2H89B 2RR9A 2K3UA 3KWLA 3R2IA 2BS2B 3VUYA 1YN4A 2IGGA 2Q5WD 3RNEC 4TV3A 1YN3A 1T3QA 1WJ4A 2FE8A 1VZ6A 1JWSD 2M56B 2V3PA 3V6EB 2LHEA 3R3MA 1SXTA 2N7EA 2MBHA 5H92C 3L17A 3GZNI 4EZJA 3HRDD 2XN9C 5E6PA 4IWPA 4HKZE 3FILB 3AU5A 2KC1A 2JZ3B 3EFCA 2D11A 2J0KA 1TY0A 2V3NA 3V62A 4WJQA 1Q5WB 3LB8C 2Y5PA 4PS3A 2I1KA 2HD5B 2QC8A 1J0GA 2PE6B 4S17A 3IFWB 3N9YC 2B76B 4CQNA 3AE3B 1WH3A 2ZJDA 2Z8LA 2LJ5A 4JPSA 4ANWA 3DBLI 2GBMA 3I5JC 2BPSA 3L0WB 3NVWA 1SJED 1EU4A 2EKEC 3MHSD 4M0WA 4MJSB 1RFKA 1MJDA 4BKTA 3AE1B 3QCAA 2JZPA 2XK5A 1JWUD 2LMCA 2NVUI 5HHDG 2K0PA 4MH0E 1V8CA 1E7VA 2HJ1A 2JZZA 1PUTA 2JWZA 2O2VA 5LXIB 5D94A 3W5VB 4YTMB 1FXAA 4IWOA 5CHVC 2KVZA 4N58A 2HTHA 2DWQA 1V1PA 2MSED 4HCNB 1KLGD 2KLGA 4M00A 2ZZPB 5C2TB 3GS2A 4GXBA 1QQRA 1JROA 4ZYNA 2LXAA 4MM3B 2INDC 1LXDA 4PYZA 2G3QB 2FIDA 2W55A 1NENB 3IHPC 1C4AA 1FNWA 2YEPB 1R4MB 1V1OA 3ECIA 3QARA 1B9RA 3AULA 1NVID 2LUEA 4GOCA 1S1QB 3PRPB 4ANXA 1T0RC 1CK1A 1T0QC 4C4VA 2QSDA 4W9HA 5JH5C 3GP7A 3W1SC 2KJRA 3EECA 4DDGD 4HXDA 3SFDB 2L83A 4FHJA 1WXMA 1TBEA 3CSFA 3R2TA 4ZRKA 4I6PA 2X8XX 2IO0B 4W9EA 2AQ1B 3QX1A 3H8HA 2CHZA 4K7WA 5GMVA 4HDQA 4YSXB 2O6VB 4US8A 4GDLA 2M4NA 4J3OD 3KUZA 3NVVA 2ACZB 4W9JA 2ASQA 3OG5A 4RMAA 4NZLB 4NQKE 2XBBC 1FFUA 3ZVVA 1L4ZB 3PZDA 3DVGX 2M17A 2KFKB 2ICIA 1OQQA 1F0ZA 4FJYA 1V9JA 4ARCA 3W1YA 1M4VA 1V2YA 4HVBA 5KHOA 4ARIA 4MGZE 3B0AA 1C4CA 1TZOA 3R7RA 4F1SA 1ZXIA 2VH2A 2N1WA 1E8XA 3Q69A 2JX5A 1GPXA 5D6JB 3KLSX 2AYOB 2L52A 2LUMA 1WY8A 3CWIA 3PTFC 4W9LA 4HJKA 4BBNF 3RI7C 2OJWA 3WA0A 1UD7A 1NI2A 3DHHC 1GC6A 3VTUA 2D2QA 3M63B 2G4DB 1WI0A 4M01A 3DOWA 3GZNB 1HTQA 3EGRA 1NEKB 1WM2A 3BK2A 4RFBA 3AE7B 3IBEA 2N4FA 4OZBA 1JW9D 2Y5BB 3PZ7A 2DYOA 1ZKHA 3DDCB 3A9KA 3EFUA 2IO1B 1DOXA 1PGBA 1RM6C 3RNAC 2ZPYA 2M0XA 2KXJA 3JSVB 1SE4A 2PEAA 4LJOB 4YT0B 2NTSA 2WLBA 5CHWA 3RNGC 2PW9A 1P3QU 2V1YA 2MHJA 4BBNC 2FNJB 3A9JB 3TEXA 2NR2A 4B6WA 3MHZA 3DBRI 2GOWA 2MJDA 1JWAD 2K22A 5JZEB 2AX5A 3PHWB 4WURA 5AZHA 4ZDVA 2KD0A 3DVNV 2KANA 4BKGA 3T3OA 1E7UA 3KYCD 3A1QB 3V3XA 3Q3MC 3P42A 1E6EB 2DYBA 1ZE3D 2VRRB 1ZPSA 4A6QA 4OHJA 1RLFA 1HQRD 2CHXA 2L3ZA 3LXFA 4P16A 4EKUA 3PSEB 3M62B 3DVGY 3UIPB 1XXGA 2MJEA 1KTKA 1L0YB 2GBJA 2M8SA 2KX0A 4TMAB 3AEEB 5FKAC 1L0VB 2ZCCA 1MI0A 1D5XC 4PS7A 5LXHA 4CHKA 1N6ZA 2AQ2B 3AE9B 2VZKD 4IDIA 1I4HA 1P0RA 2WX0A 2NPTB 3H7PB 2FCSA 4JIOU 1NYQA 1V5OA 3DQVA 3H7SA 4HRSA 3NZUA 4B0MA 4RM8A 3RZFA 2QIEB 4HCPB 1QT9A 1UGMA 1WZ3A 1S3SG 2VH1A 4KZ0A 5J18A 3V6CB 1WRDB 1VZ7A 4A90A 3IT6B 2GBNA 1XD3B 2N0SB 1KH0A 3RPFC 3WIMA 5C1ZA 1IBXA 5DCNA 2IPKD 2NBWB 3DBHB 1WMHB 3B2GA 2KHWB 1ZOYB 2FCMA 3TUOA 4HK2A 3U7DA 1E5WA 3GE3C 4C56C 4JGHB 1HXYD 1L4DB 1QOGA 2BKRB 1WX7A 2FBWB 3DHIC 1FRDA 4XZ4A 2NBVB 4KIKA 2JXTA 1ZGUB 4X57B 3NUHB 3L4PA 4JWUC 1GB4A 3ZJTA 4AQ7A 4OZCA 3GOEA 1PFDA 4GN1A 1TKEA 5G2NA 1XLNA 4A3OA 3MC8A 3RT3B 1VCBA 1YX5B 4DBGA 1TKGA 4C00A 4EZLA 2QEJC 1N5WA 4ZOHC 4AS1A 2LHDA 1SE9A 1R4MI 1NI3A 4WAAA 2L7RA 4RH6A 2KVRA 1F2RI 1ACCA 1OGWA 2J52A 2G4SA 2MEKA 3AMZA 2E3TA 1EWCA 3HK0A 4DHJD 2CHWA 2IYDB 2D10A 2MP2B 2LRUA 2L32A 1ZDVA 4ANVA 2WDRB 3I3TB 1L0XB 1GOZA 3R8BA 4JQWC 1LO5D 2D5GA 1EWYC 1VJKA 2L05A 1L2NA 4HEA1 2JRIB 3B9JA 4REZA 1JRPA 5AUKA 2OOBB 1EM7A 3AI5A 3DBSA 1TTNA 4KGRA 4FXCA 1J7BA 4BZAA 2YLMA 4ZRJA 1WM3A 4TQ0A 4JWSC 5DPSA 4GLSC 3LYYA 2PKOA 2MQJA 2PMVA 1MFWA 4XDDA 2LASA 2JPHA 4D2KA 3EC8A 1Z5SB 3ZNZB 4GDKB 1WX8A 2IDYA 4BFRA 5IN7A 3ZUNA 1TS5A 2ZCBA 5G55A 3PRZA 2PVOD 4GB9A 2IO2B 5D2MB 5EE0A 4DK5A 1V80A 4CYEA 1MHXA 5JHAA 2KN4A 4II2B 2C7HA 1D5MC 3VTVA 2C5LC 1EUVB 2LGSA 3K9OB 3AEAB 4K3BA 2K39A 2CU1A 3CF6E 1SE3A 5AUIA 5TR5A 2MLBA 1IPGA 1WF9A 2KWUB 4NAWB 4FJZA 2JF5A 1RRBA 2WXMA 3M3JA 1BMLC 1VRAB 4WQOB 2RGFA 1XEEA 4XDCA 1FPYA 1P98A 4M8NA 2J42A 3DCGA 5CHFA 2MX2A 2FIFA 3IAM1 3QQ8B 4P1BC 1GB1A 3PREA 1FXIA 5EE1A 1WRIA 1Y8RC 2IBIB 2LEKA 3L10B 1D5ZC 3ZLZA 1QILA 3ZNGC 4KGTA 1ZP0B 3PT2B 1E7PB 5GXGB 2WDVB 2LVQA 3UQAA 2DZIA 2JXXA 4GMVA 2KMMA 2WP9B 2ON8A 4C7YA 2ONQA 4NJ6A 5J2RA 3QHTA 3VHTC 1IUEA 1HEZE 1J8CA 2BGFA 1FM0D 1D6EC 4JE3B 4BVUC 4LLGM 2ZPNA 4P6VF 1G6JA 4DXFA 5D3DA 3BWUD 3SD5A 5G5GA 2M1MA 2C7MB 3VR9B 3ZXVA 4W9DA 4I6NB 1ZW7A 5C23A 4IKGA 1GUAB 1QKZA 4W9IA 1V81A 2DZKA 4MSMB 2WXGA 4HLEA 1EO6A 1K50A 2N9KA 3L08A 3OAWA 4LNIA 2WXFA 3P4RB 4G11A 1C76A 1SE2A 4ACFA 4ICVA 5E6JA 3P4SB 4N6EB 4DXAB 2IZVB 3QA8A 4GU2A 4TKNA 1I7HA 4TUUA 4KDLB 2W9NA 5DPTA 2DZMA 4GGQA 2CKHB 3APFA 1KF6B 2H88B 1FRRA 3H9DA 2KK8A 3SEBA 4URKA 1X1MA 3PVLA 3PPAA 2YEPF 2O6VA 1P1AA 4G3XB 3DVNU 3BVGA 4F7ZA 4G0NB 4E74A 3AU4A 3HVZA 3TMPB 1AWDA 2G1EA 3ZDMC 3GE8C 2GI9A 2WS3B 2FUHB 3BVZA 2QJLA 4XC2A 3RZWC 1Y56A 2LJIA 3WAMA 1V49A 5AZGA 3Q6BA 3ONSA 3E9SA 4L23A 4RF0A 4US9A 3VFKA 1YIWA 1MPEA 2K9XA 4MGYE 1GC7A 3Q8CA 2BBCA 4AJWA 2LI5A 2AQ3B 5IAAC 2K8CA 3Q3NC 2IO3B 1WGYA 1TGZB 4A9AA 4EFOA 3L16A 3HHMA 1WXQA 2LGYA 1IGDA 1F52A 3NS1A 3URYA 3I63C 1F2RC 4M0WB 3DBHI 1MVKA 4XGAB 1TZ1A 4EZKA 3ZYYX 3KVFB 1XF5L 2LD9A 1UUPA 1XCQL 4AJYB 1QF6A 2BWFA 3C0RB 4GIVA 4LDTD 3GB1A 2JU6X 2O2VB 1YD8U 1T0YA 4H2AA 4KDIC 2L0FA 1C9FA 1WXAA 3IG3A 1FMAD 3TBLD 1PGAA 1V1PB 2SAKA 2ZVNA 3VH4B 5DPRA 3L13A 3A9JA 4DHZB 1HTOA 1F9JA 1CJEA 2KJ6A 2WGSA 1IGCA 4QAYA 5I4DA 3FAHA 1EF5A 4K81A 3HM3A 4RGOS 3WCQA 3KWVA 2V4IB 2K25A 2KLCA 1GNUA 2L1AA 2WXJA 3ZGZA 3APDA 3IXSA 1WZ0A 4MGKE 3APCA 3C8YA 3AB5A 2DYMA 2W3SA 1DOYA 1VLBA 4FADA 3PRMB 1FEHA 4JLCA 3UGBB 4C80A 5BYQA 3U7ZA 1KFYB 4HJGE 1WFYA 2KACA 4TSSA 3A4RA 3CMMB 3Q8AA 1SEBD 3NOBA 1BXTA 4TQ1A 3N3KB 2GMIC 3CIRB 5IO9A 4WIPA 2KTRB 2BB5A 2BYEA 3VXWA 2N9XA 5DPWA 2DAFA 2HDEA 1FFVA 3ZKJC 2QDFA 5BMGA 5IP4D 1U4AA 2KWVB 1NYRA 4XWTA 3U30A 1JALA 4MACA 2C9WB 4N9F4 2XNAC 2UU7A 4XYCA 4B9KA 2YVCA 3UQBA 4YTNB 1WJUA 1XQQA 4FJVB 2RDGA 1QZEA 3NS8A 2N1VA 2PIAA 1ENFA 3T8MA 1ET6A 1WE7A 2RSUA 2V4LA 2WYQA 2NBUA 1HE8A 2NCNA 1YQ4B 4W9KA 4KSLC 1H4RA 1J7AA 2Z0DB 1WMHA 4MT5A 4DQOC 2HE7A 3BVMA 2W54A 1KLUD 3P4PB 2RDHA 1JRUA 2WXNA 4NJ7A 5H8YE 2Y3AA 2DZJA 4NNJB 1KOTA 2G45B 1YQBA 1K8RB 3TIXA 2JRHA 3MC9A 3T3NA 3ABVB 2N7DA 3VRAB 1RWSA 3N1ZC 3A9KB 3RMKC 4C7ZA 4PS8A 5BYSA 3EHVA 1WXSA 3QJZA 4HPLB 4E71A 3VAWA 5TSSA 2O6VD 4IWQA 3U2SC 1BT0A 3OJ3A 3IT4B 3SR6A 2OHFA 2MBOA 3M95A 1WR1A 2KQ7A 3DPDA 1XLOA 3UF8A 3MJ5A 3QIJA 2LGDA 3ZJVA 3KH0A 2LWPA 4RGMA 2KZRA 2BYTA 2Z59B 4LTUA 4WH4A 2WXQA 1AW7A 1H8CA 4KGSA 2WXRA 1LFDA 1UWMA 4A55A 4Q2JA 2I2YA 2PLPA 3P1MA 1ZDXA 2MP2A 2D07B 1A5RA 2K8BA 3AXCA 3N32A 3MJWA 2ZVOA 4K1RB 3ALBA 4FN2A 3HUIA 4I6LB 2A5UA 2M0AA 1EU3A 2TSSA 2GBRA 3AE4B 5JXVA 2KAJA 2LFIA 1UBQA 1Q0WB 4AOFA 3AV8A 3LJ3A 3W2DA 2WXLA 1A70A 4HKQA 4O1NA 3OWEB 4WWPA 1DYQA 4NPNA 2KDFB 4K3CA 2WDTB 2L0TA 2AWTA 1B1ZA 1E8WA 3AECB 1E8ZA 3C19A 5CTRC 3VVWB 3FC4A 2FUG1 1T6BX 2WDQB 1KLVA 1L5PA 1T5XD 4IC7B 3EA6A 3N1YC 3LDZE 3AE5B 1YQ3B 1K52A 1WR6E 4A3PA 5EE9A 1OQYA 2IGHA 4LK0M 1SIJA 2J53A 1YJ1A 1C79A 4WWNA 2BF8B 1QLBB 1WJNA 3ZTDA 3ML9A 1WE6A 3W9CB 5EE3A 2BS4B 1IBXB 2MJ3A 3UINB 3TL5A 2CR5A 3NY5A 1YJIA 2DX5B 3JVZX 3L54A 2Y5CA 4OVVA 5E6NA 3I9V1 2LGIA 4YSYB 1GAQB 2MW5A 1V86A 3U8ZA 3BINA 3ENEA 3KW5B 2QCZA 2L8JA 4P7IA 1JQ4A 2KT7A 3FILA 1GJZA 2WX1A 3RUIB 3X23A 2IY1B 4S0RA 1STEA 1C77A 3B08A 4YWGG 4KKIA 3KUDB 3MC0B 5C3JB 2WU5B 4OZAA 2R61A 5HG2A 2D3CA 5L83A 4MH8A 1C4PA 1T0SC 1XO3A 3EUB2 3P2BA 3KQ4A 4KKJA 2MBEA 4ITKA 3B1LX 3N30A 1IP9A 3PLUA 1ET9A 5IOIA 1L6VA 4FULA 2V9HA 3AH7A 3TEZA 2LVPA 2L00B 1F1HA 2KQSA 1WJ6A 1E10A 3NZ3A 4KSKC 3ZTCA 2NTTA 4MJSA 5HFYA 5HKHA 3BY4B 4XWWA 5AZFA 1I4GA 3RN9C 3ZQ4A 3R66C 1I4XA 3MP9A 4LDTB 1YJJA 2BWES 2WNMA 2I1JA 1SBBB 2OEDA 4II3B 2D3GA 2KDIA 2AL6A 1DOIA 5G5HA 4MEMA 2BVCA 1ZXHA 3OJ4B 2CJOA 2PJHA 3Q3JA 2DBYA 2HTME 2J0JA 2KDMA 3AEFB 2J4XA 4NJCA 4ZRPA 2NS5A 4FLHA 3RYTA 3W1SA 4MM3A 1WIAA 5FR6A 3AEBB 3X0WA 2JVCA 3P4QB 1WWTA 1BUIC 5J17A 3BYYB 3OLMD 1OEYA 5JHBA 4BKSA 3PLVA 4AUQC 4DXGA 5BMHA 2EKIA 2QMTA 1N60A 2BYFA 1UWXA 1WGGA 3ZW3A 3VQIA 1KJTA 1F77A 4FA6A 2DAJA 5KHQA 2N7JA 1N5XA 1C78A 1MHHE 1UF0A 2BW2A 2BB6A 1OTRB 2LXCA 1ISNA 1SB3C 4IM0A 4PYUA 5AEKB 3I57A 2D3AA 1SIFA 3WAPA 2HJ8A 1I4PA 4EE2A 3SDLC 2N9EB 1J7CA 4HDOA 3ZJUA 2AL3A 2AEHA 3R7QA 2JT4B 1VDVA 3V60A 1XLQA 3TEWA 3N1XC 1OFFA 2JUOA 4DDID 1AN8A 4MELA 2Z0EB 1N63A 1V6EA 1I4RA 1NDDA 2CJNA 2KFKA 3N20C 2GLSA 1D4BA 2MBQA 2KFJA 3K9PB 4IUMB 1K51A 1HZ5A 2JWUA 5BO4B 3ZO5B 2KN5A 2CS4A 2KWDA 4YTPB 3KYDD 5D7GA 3A4SC 1MG4A 2R2QA 4B0EA 2KTFA 3HVDA 1TJEA 3HM6X 2A4ZA 3Q8FA 3O65B 3SHQA 4EUTA 1TS4A 4DHZE 1VR9A 1PDXA 2M19A 2L76A 4K7SA 1FIQA 3SFEB 4HROA 4HPPA 1K53A 1WGRA 2V0GA 3AE8B 3JYUA 2RD0A 3DWMA 4A20A 2ZW1A 4NY0A 2GRIA 3RNCC 2FAZA 1I35A 2XK5B 1TS3A 2B3AA 3ZRFA 3TSSA 2IJ0A 3NVYA 2KYWA 1R4NI 1C3TA 1CQVA 1SGHA 4ZRQA 2VZKB 3AEGB 1AYFA 3QAQA 2ZW0A 2RPVA 4YL8A 4YSZB 4WJNA 3JSVA 3Q8EA 1XCTL 1SF0A 2K8HA 2KTRA 5IA7A 2INNE 5CX3A 4YXDB 1E0ZA 1UBIA 4E3CA 1WYGA 4NQLB 1YN5A 1UGJA 2QHOA 3SU8X 4BAXA 4K7UA 3Q14C 2KO3A 2WU2B 2KNBA 3TCAA 1FXTB 3VRBB 3V61A 1WX9A 5BYRA 1FD6A 3WAOA 1LGRA 3FKYA 2MWSB 2GB1A 4C4VB 5FK9C 4FHKA 2PTLA 1FCLA 3NVZA 3A1QA 1UNSA 3Q3OC 1TT5B 2KMCA 3PO0A 1TKYA 4USAA 2K6QA 3Q2AC 2X38A 4L2YA 3Q3FA 4IM2A 4LJPB 1OQRA 5HI1A 2C60A 2WXOA 2IY0B 1TIFA 5T8IA 4WJPA 2JYTA 2K6DB 2FCNA
chains in the Genus database with same CATH topology
4HCNB 5D2MB 3VUWA 1XT9B 4DK5A 1V80A 2ZZPB 4CYEA 4GXBA 2MP2A 4GDLB 4ZYNA 2D07B 2LXAA 5JHAA 4II2B 1LXDA 2C7HA 4PYZA 1A5RA 2K8BA 3AXCA 3VH3B 2G3QB 3VTVA 2C5LC 1EUVB 2FIDA 2LZ6A 3MJWA 3N32A 3K9OB 1WGHA 2MSED 4MSQB 3IHPC 2FCQA 3RD2A 2ZVOA 4K1RB 1KM7A 2CU1A 2K39A 3ALBA 3CF6E 3JW0X 4FN2A 4I6LB 3ZNID 3ML8A 5TR5A 2MLBA 3QC8B 2A5UA 1IPGA 1WF9A 3ECIA 3QARA 3AULA 2KWUB 2N9PC 2K1FA 2GBRA 2NPTA 4NAWB 3H7PA 2C7NB 2JF5A 4FJZA 2LUEA 1RRBA 5L95C 4GOCA 3M3JA 1S1QB 1UBQA 1Q0WB 4WQOB 3PRPB 4AOFA 4ANXA 3LJ3A 2EMTA 2RGFA 4IW0A 1P98A 4M8NA 3ZIMA 3DCGA 4W9HA 5CHFA 2MX2A 4DHJB 2FIFA 5JH5C 4HWIB 2KDEB 3QQ8B 4WWPA 2KMAA 3PREA 4NPNA 2KJRA 3W1SC 3EECA 1Y8RC 1Q1OA 4DDGD 2KDFB 1VD2A 2WDTB 2IBIB 4HXDA 2L0TA 3L10B 2AWTA 4FHJA 1WXMA 3ZLZA 1TBEA 3CSFA 3ZNGC 1E8WA 4ZRKA 2BKFA 1E8ZA 4I6PA 2MA9B 2KX3A 3H1UA 3PT2B 1M94A 2IO0B 5CTRC 3VVWB 2LVQA 3UQAA 2DZIA 2JXXA 1KLVA 4GMVA 2DENB 4W9EA 3QX1A 2REXA 2CHZA 1P9DU 4IC7B 4NJ6A 5J2RA 3QHTA 3LDZE 4J6IA 3VHTC 4F8CB 4CO7A 4K7WA 1WR6E 4A3PA 4BKSD 1J8CA 2BGFA 4HDQA 5GMVA 2UYZB 3KUCB 3T9LA 2O6VB 4W9CA 4GDLA 1OQYA 3S2AA 2M4NA 1WGDA 3KUZA 4BVUC 3NHEB 4W9JA 2ASQA 4RMAA 2ZPNA 1G6JA 1YJ1A 4NQKE 2XBBC 4WWNA 3SD5A 3ZVVA 2M1MA 2C7MB 2PPHA 4W9DA 2BF8B 1ZW7A 4I6NB 3PZDA 3ZRCA 3DVGX 1WJNA 2M17A 2KFKB 5C23A 1CMXB 3ZTDA 4BOSC 3ML9A 1GUAB 1WE6A 3HIZA 4FJYA 3WALA 1V9JA 4W9IA 1V81A 2DZKA 1J19A 3W1YA 4MSMB 1AARA 1IYFA 1LQBA 1V2YA 4HLEA 4HVBA 3UINB 3TL5A 5KHOA 2CR5A 4ZRIA 1EO6A 3NY5A 4MGZE 2OJRA 2DX5B 2KOXA 3JVZX 3L54A 3QK0A 4OVVA 5E6NA 3WANA 4ICUA 3B0AA 3OAWA 3R7RA 3L08A 4F1SA 1RAXA 2N1WA 2MW5A 1V86A 4G11A 3U8ZA 1E8XA 3BINA 3ENEA 3KW5B 4ICVA 5D6JB 2AYOB 2PE9A 4DXAB 2IZVB 2L8JA 3QA8A 4GU2A 4TKNA 3PV1A 4P7IA 4TUUA 4KDLB 1WY8A 3PTFC 2W9NA 4W9LA 2DZMA 5DPTA 4GGQA 2CKHB 2WX1A 3APFA 4HJKA 3RUIB 3UIOB 3X23A 4BBNF 3QWZB 2LVOA 4MDKE 2IY1B 4M8MA 3B08A 3H9DA 3WA0A 1UD7A 2KK8A 1NI2A 3KUDB 3PS6A 4URKA 1X1MA 3PVLA 3PPAA 1LM8B 2O6VA 1P1AA 4G3XB 1GC6A 3VTUA 3DVNU 4IM3A 2D2QA 4EOYA 4F7ZA 3M63B 2G4DB 4IG7B 4G0NB 2DHZA 1WI0A 5L83A 3DOWA 4E74A 3AU4A 1WYWB 4DWFA 4OVUA 4W9GA 3TMPB 4FBJB 3P2BA 2MBEA 3B1LX 1L7YA 1WM2A 3N30A 1IP9A 2R2OA 3PLUA 3IBEA 2N4FA 3TJPA 3ZDMC 4FULA 4WWOA 2Y5BB 1UELA 2DYOA 2FUHB 2LVPA 2L00B 4XC2A 4KV2A 3RZWC 1GJZA 1EF1A 1ZKHA 2KQSA 3PHXB 3DDCB 1WJ6A 3A9KA 3EFUA 2IO1B 2FCNA 3WAMA 4KSKC 3ZTCA 1V49A 2ZPYA 4MJSA 5AZGA 2M0XA 2KXJA 3JSVB 3ONSA 4AWJA 5HKHA 3BY4B 2PEAA 4LJOB 5AZFA 2MCNB 2JY6A 1UH6A 3VFKA 2J0MA 1YIWA 3R66C 4GSWA 4MGYE 4LDTB 4MGIE 1GC7A 2BWES 2I1JA 5CHWA 4II3B 1P3QU 2D3GA 2KDIA 2V1YA 2AL6A 2LI5A 5IAAC 4AJWA 2K8CA 4BBNC 2FNJB 2LGXA 3A9JB 2IO3B 2NR2A 1WGYA 4MEMA 4B6WA 1TGZB 4AP4C 4KVGB 4EFOA 3OJ4B 3L16A 5EDSA 3DBRI 2GOWA 3HHMA 4GDKA 2PJHA 3Q3JA 2LGYA 3VDZA 2J0JA 4M0WB 5JZEB 2NS5A 3DBHI 1TZ1A 4FLHA 4EZKA 3KVFB 1MG8A 3PHWB 2KWCA 5AZHA 3RYTA 3W1SA 4ZDVA 2LD9A 4MM3A 2KD0A 2EMSA 3DVNV 2KANA 4BKGA 2ZNVB 1WIAA 1E7UA 3KYCD 4AJYB 5FR6A 3A1QB 2BWFA 3X0WA 3C0RB 1C1YB 2J7QB 1E8YA 2JVCA 2DYBA 4GIVA 4LDTD 1GG3A 5E6OA 1YX6B 2VRRB 4KZCA 2O2VB 5J17A 2KJHB 1RLFA 1YD8U 2CHXA 2L3ZA 1T0YA 4EKUA 3PSEB 4KDIC 2L0FA 2KDBA 3OLMD 1OEYA 4NAWA 5JHBA 2LRWA 4BKSA 3PLVA 2MRPA 1WXAA 4AUQC 3IG3A 3M62B 3DVGY 3UIPB 4G50A 2BYFA 3TBLD 3IVFA 2GBJA 4HPMB 1WGGA 3CSTA 3VQIA 3ZW3A 3A33B 2M8SA 2KX0A 1KJTA 3NZSA 4FA6A 1I42A 1UZXB 2ZVNA 2DAJA 3VH4B 3D32A 1E90A 1V5TA 5KHQA 2ZCCA 5DPRA 1PQSA 3L13A 2ZNVC 3PGEA 2V3SA 4BOZB 3A9JA 4DHZB 1OTRB 4PS7A 2LXCA 4CHKA 1F9JA 5LXHA 2KJ6A 1ISNA 4IM0A 3H6NA 4PYUA 5AEKB 1EF5A 2UWQA 4K81A 1SIFA 4ANUA 2BYVE 4KIKB 3RULA 3WAPA 2HJ8A 3HM3A 4RM9A 1P0RA 2WX0A 2K25A 2NPTB 2KLCA 2XEWA 2FCSA 3H7PB 4JIOU 3SDLC 2N9EB 4HDOA 1GNUA 2MBBB 1V5OA 3VUXA 4LCDE 3DQVA 3APDA 3H7SA 3ZNHB 1WZ0A 2AEHA 2AL3A 4MGKE 3MTNB 3R7QA 3APCA 3NZUA 2JT4B 4RM8A 2DYMA 2KC2A 3RZFA 1D3ZA 3V60A 4HCPB 1RFAA 4B95A 3VTWA 1UGMA 1WZ3A 1S3SG 2JUOA 4DDID 4KZ0A 4MELA 5J18A 3V6CB 1NBFC 1WRDB 4FADA 2RPQA 2Z0EB 3PRMB 1Z2MA 2GBNA 1V6EA 4JL9A 5LLIA 1NDDA 4JLCA 1XD3B 2KFKA 4W9FA 3UGBB 3ZDTA 4WJOA 1WFYA 3WIMA 2MBQA 2KFJA 3A4RA 3CMMB 5C1ZA 3K9PB 5DCNA 4IUMB 4ASWC 2NBWB 1OEYJ 2GBKA 4XX5A 1WMHB 3NOBA 5BO4B 3ZO5B 2KN5A 2CS4A 2ZEQA 1WXVA 2KKCA 2KHWB 2FCMA 3N3KB 4TQ1A 4EEWA 2GMIC 4HK2A 3U7DA 1E5WA 3KYDD 2WWZA 4JGHB 5D7GA 2KTRB 2BYEA 3A4SC 3RCZA 3VXWA 2N9XA 5DPWA 2DAFA 2BKRB 2R2QA 1WX7A 2RR9A 2KTFA 4XZ4A 2NBVB 3HM6X 2A4ZA 3ZKJC 3O65B 4KIKA 1U4AA 2KWVB 3SHQA 3VUYA 4EUTA 4DHZE 1ZGUB 4X57B 3U30A 2L76A 4TV3A 4K7SA 2C9WB 1WJ4A 4N9F4 3V6EB 1WGRA 4B9KA 2YVCA 3JYUA 3GOEA 3R3MA 3UQBA 1WJUA 2RD0A 1XQQA 4A20A 4FJVB 4NY0A 4GN1A 1QZEA 5G2NA 3NS8A 2FAZA 2N7EA 2MBHA 4A3OA 1I35A 3RT3B 2N1VA 2XK5B 1VCBA 1YX5B 2B3AA 4DBGA 3ZRFA 3L17A 3GZNI 3T8MA 4EZJA 4EZLA 1R4NI 1WE7A 2RSUA 5E6PA 2V4LA 2WYQA 4IWPA 2NBUA 1HE8A 2NCNA 1C3TA 1SGHA 3AU5A 2KC1A 2JZ3B 4W9KA 4KSLC 1SE9A 2D11A 1H4RA 1R4MI 2J0KA 2Z0DB 3QAQA 1WMHA 4WAAA 2L7RA 3V62A 2KVRA 4WJQA 4YL8A 1OGWA 2HE7A 1Q5WB 4WJNA 2G4SA 3JSVA 4PS3A 2I1KA 2HD5B 1JRUA 3HK0A 2K8HA 2KTRA 4NJ7A 2CHWA 2IYDB 4DHJD 5IA7A 1J0GA 5CX3A 2D10A 2PE6B 2MP2B 3IFWB 2LRUA 1UBIA 2DZJA 4NNJB 4E3CA 1KOTA 2G45B 4NQLB 4ANVA 1YQBA 3I3TB 1WH3A 1K8RB 2QHOA 2ZJDA 2JRHA 3SU8X 3TIXA 4K7UA 4JQWC 2KO3A 2LJ5A 4ANWA 2KNBA 3TCAA 2L05A 2N7DA 2GBMA 3DBLI 1L2NA 1FXTB 2BPSA 3L0WB 3A9KB 2JRIB 4PS8A 3V61A 1WX9A 2EKEC 1WXSA 3EHVA 3MHSD 4MJSB 3QJZA 3WAOA 2OOBB 4HPLB 4BKTA 4E71A 3VAWA 3AI5A 3QCAA 2O6VD 2MWSB 2XK5A 3DBSA 1TTNA 4FHKA 4IWQA 1BT0A 3OJ3A 2NVUI 2YLMA 4ZRJA 1WM3A 2MBOA 4MH0E 3M95A 4TQ0A 1WR1A 1E7VA 3A1QA 2KQ7A 5DPSA 3DPDA 2MQJA 3UF8A 2JZZA 2JWZA 2KMCA 2O2VA 3QIJA 5LXIB 2K6QA 2LGDA 5D94A 2LASA 3Q3FA 4IM2A 2JPHA 3KH0A 2LWPA 4LJPB 3EC8A 1Z5SB 2KZRA 4IWOA 5CHVC 2Z59B 3ZNZB 4GDKB 1WX8A 2C60A 4BFRA 2IY0B 2HTHA 3ZUNA 1H8CA 2ZCBA 4WJPA 1LFDA 5G55A 3PRZA 4GB9A 2K6DB 2IO2B 2KLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCN B;  5D2M B;  3VUW A;  1XT9 B;  4DK5 A;  1V80 A;  2ZZP B;  4CYE A;  4GXB A;  2MP2 A;  4GDL B;  4ZYN A;  2D07 B;  2LXA A;  5JHA A;  4II2 B;  1LXD A;  2C7H A;  4PYZ A;  1A5R A;  2K8B A;  3AXC A;  3VH3 B;  2G3Q B;  3VTV A;  2C5L C;  1EUV B;  2FID A;  2LZ6 A;  3MJW A;  3N32 A;  3K9O B;  1WGH A;  2MSE D;  4MSQ B;  3IHP C;  2FCQ A;  3RD2 A;  2ZVO A;  4K1R B;  1KM7 A;  2CU1 A;  2K39 A;  3ALB A;  3CF6 E;  3JW0 X;  4FN2 A;  4I6L B;  3ZNI D;  3ML8 A;  5TR5 A;  2MLB A;  3QC8 B;  2A5U A;  1IPG A;  1WF9 A;  3ECI A;  3QAR A;  3AUL A;  2KWU B;  2N9P C;  2K1F A;  2GBR A;  2NPT A;  4NAW B;  3H7P A;  2C7N B;  2JF5 A;  4FJZ A;  2LUE A;  1RRB A;  5L95 C;  4GOC A;  3M3J A;  1S1Q B;  1UBQ A;  1Q0W B;  4WQO B;  3PRP B;  4AOF A;  4ANX A;  3LJ3 A;  2EMT A;  2RGF A;  4IW0 A;  1P98 A;  4M8N A;  3ZIM A;  3DCG A;  4W9H A;  5CHF A;  2MX2 A;  4DHJ B;  2FIF A;  5JH5 C;  4HWI B;  2KDE B;  3QQ8 B;  4WWP A;  2KMA A;  3PRE A;  4NPN A;  2KJR A;  3W1S C;  3EEC A;  1Y8R C;  1Q1O A;  4DDG D;  2KDF B;  1VD2 A;  2WDT B;  2IBI B;  4HXD A;  2L0T A;  3L10 B;  2AWT A;  4FHJ A;  1WXM A;  3ZLZ A;  1TBE A;  3CSF A;  3ZNG C;  1E8W A;  4ZRK A;  2BKF A;  1E8Z A;  4I6P A;  2MA9 B;  2KX3 A;  3H1U A;  3PT2 B;  1M94 A;  2IO0 B;  5CTR C;  3VVW B;  2LVQ A;  3UQA A;  2DZI A;  2JXX A;  1KLV A;  4GMV A;  2DEN B;  4W9E A;  3QX1 A;  2REX A;  2CHZ A;  1P9D U;  4IC7 B;  4NJ6 A;  5J2R A;  3QHT A;  3LDZ E;  4J6I A;  3VHT C;  4F8C B;  4CO7 A;  4K7W A;  1WR6 E;  4A3P A;  4BKS D;  1J8C A;  2BGF A;  4HDQ A;  5GMV A;  2UYZ B;  3KUC B;  3T9L A;  2O6V B;  4W9C A;  4GDL A;  1OQY A;  3S2A A;  2M4N A;  1WGD A;  3KUZ A;  4BVU C;  3NHE B;  4W9J A;  2ASQ A;  4RMA A;  2ZPN A;  1G6J A;  1YJ1 A;  4NQK E;  2XBB C;  4WWN A;  3SD5 A;  3ZVV A;  2M1M A;  2C7M B;  2PPH A;  4W9D A;  2BF8 B;  1ZW7 A;  4I6N B;  3PZD A;  3ZRC A;  3DVG X;  1WJN A;  2M17 A;  2KFK B;  5C23 A;  1CMX B;  3ZTD A;  4BOS C;  3ML9 A;  1GUA B;  1WE6 A;  3HIZ A;  4FJY A;  3WAL A;  1V9J A;  4W9I A;  1V81 A;  2DZK A;  1J19 A;  3W1Y A;  4MSM B;  1AAR A;  1IYF A;  1LQB A;  1V2Y A;  4HLE A;  4HVB A;  3UIN B;  3TL5 A;  5KHO A;  2CR5 A;  4ZRI A;  1EO6 A;  3NY5 A;  4MGZ E;  2OJR A;  2DX5 B;  2KOX A;  3JVZ X;  3L54 A;  3QK0 A;  4OVV A;  5E6N A;  3WAN A;  4ICU A;  3B0A A;  3OAW A;  3R7R A;  3L08 A;  4F1S A;  1RAX A;  2N1W A;  2MW5 A;  1V86 A;  4G11 A;  3U8Z A;  1E8X A;  3BIN A;  3ENE A;  3KW5 B;  4ICV A;  5D6J B;  2AYO B;  2PE9 A;  4DXA B;  2IZV B;  2L8J A;  3QA8 A;  4GU2 A;  4TKN A;  3PV1 A;  4P7I A;  4TUU A;  4KDL B;  1WY8 A;  3PTF C;  2W9N A;  4W9L A;  2DZM A;  5DPT A;  4GGQ A;  2CKH B;  2WX1 A;  3APF A;  4HJK A;  3RUI B;  3UIO B;  3X23 A;  4BBN F;  3QWZ B;  2LVO A;  4MDK E;  2IY1 B;  4M8M A;  3B08 A;  3H9D A;  3WA0 A;  1UD7 A;  2KK8 A;  1NI2 A;  3KUD B;  3PS6 A;  4URK A;  1X1M A;  3PVL A;  3PPA A;  1LM8 B;  2O6V A;  1P1A A;  4G3X B;  1GC6 A;  3VTU A;  3DVN U;  4IM3 A;  2D2Q A;  4EOY A;  4F7Z A;  3M63 B;  2G4D B;  4IG7 B;  4G0N B;  2DHZ A;  1WI0 A;  5L83 A;  3DOW A;  4E74 A;  3AU4 A;  1WYW B;  4DWF A;  4OVU A;  4W9G A;  3TMP B;  4FBJ B;  3P2B A;  2MBE A;  3B1L X;  1L7Y A;  1WM2 A;  3N30 A;  1IP9 A;  2R2O A;  3PLU A;  3IBE A;  2N4F A;  3TJP A;  3ZDM C;  4FUL A;  4WWO A;  2Y5B B;  1UEL A;  2DYO A;  2FUH B;  2LVP A;  2L00 B;  4XC2 A;  4KV2 A;  3RZW C;  1GJZ A;  1EF1 A;  1ZKH A;  2KQS A;  3PHX B;  3DDC B;  1WJ6 A;  3A9K A;  3EFU A;  2IO1 B;  2FCN A;  3WAM A;  4KSK C;  3ZTC A;  1V49 A;  2ZPY A;  4MJS A;  5AZG A;  2M0X A;  2KXJ A;  3JSV B;  3ONS A;  4AWJ A;  5HKH A;  3BY4 B;  2PEA A;  4LJO B;  5AZF A;  2MCN B;  2JY6 A;  1UH6 A;  3VFK A;  2J0M A;  1YIW A;  3R66 C;  4GSW A;  4MGY E;  4LDT B;  4MGI E;  1GC7 A;  2BWE S;  2I1J A;  5CHW A;  4II3 B;  1P3Q U;  2D3G A;  2KDI A;  2V1Y A;  2AL6 A;  2LI5 A;  5IAA C;  4AJW A;  2K8C A;  4BBN C;  2FNJ B;  2LGX A;  3A9J B;  2IO3 B;  2NR2 A;  1WGY A;  4MEM A;  4B6W A;  1TGZ B;  4AP4 C;  4KVG B;  4EFO A;  3OJ4 B;  3L16 A;  5EDS A;  3DBR I;  2GOW A;  3HHM A;  4GDK A;  2PJH A;  3Q3J A;  2LGY A;  3VDZ A;  2J0J A;  4M0W B;  5JZE B;  2NS5 A;  3DBH I;  1TZ1 A;  4FLH A;  4EZK A;  3KVF B;  1MG8 A;  3PHW B;  2KWC A;  5AZH A;  3RYT A;  3W1S A;  4ZDV A;  2LD9 A;  4MM3 A;  2KD0 A;  2EMS A;  3DVN V;  2KAN A;  4BKG A;  2ZNV B;  1WIA A;  1E7U A;  3KYC D;  4AJY B;  5FR6 A;  3A1Q B;  2BWF A;  3X0W A;  3C0R B;  1C1Y B;  2J7Q B;  1E8Y A;  2JVC A;  2DYB A;  4GIV A;  4LDT D;  1GG3 A;  5E6O A;  1YX6 B;  2VRR B;  4KZC A;  2O2V B;  5J17 A;  2KJH B;  1RLF A;  1YD8 U;  2CHX A;  2L3Z A;  1T0Y A;  4EKU A;  3PSE B;  4KDI C;  2L0F A;  2KDB A;  3OLM D;  1OEY A;  4NAW A;  5JHB A;  2LRW A;  4BKS A;  3PLV A;  2MRP A;  1WXA A;  4AUQ C;  3IG3 A;  3M62 B;  3DVG Y;  3UIP B;  4G50 A;  2BYF A;  3TBL D;  3IVF A;  2GBJ A;  4HPM B;  1WGG A;  3CST A;  3VQI A;  3ZW3 A;  3A33 B;  2M8S A;  2KX0 A;  1KJT A;  3NZS A;  4FA6 A;  1I42 A;  1UZX B;  2ZVN A;  2DAJ A;  3VH4 B;  3D32 A;  1E90 A;  1V5T A;  5KHQ A;  2ZCC A;  5DPR A;  1PQS A;  3L13 A;  2ZNV C;  3PGE A;  2V3S A;  4BOZ B;  3A9J A;  4DHZ B;  1OTR B;  4PS7 A;  2LXC A;  4CHK A;  1F9J A;  5LXH A;  2KJ6 A;  1ISN A;  4IM0 A;  3H6N A;  4PYU A;  5AEK B;  1EF5 A;  2UWQ A;  4K81 A;  1SIF A;  4ANU A;  2BYV E;  4KIK B;  3RUL A;  3WAP A;  2HJ8 A;  3HM3 A;  4RM9 A;  1P0R A;  2WX0 A;  2K25 A;  2NPT B;  2KLC A;  2XEW A;  2FCS A;  3H7P B;  4JIO U;  3SDL C;  2N9E B;  4HDO A;  1GNU A;  2MBB B;  1V5O A;  3VUX A;  4LCD E;  3DQV A;  3APD A;  3H7S A;  3ZNH B;  1WZ0 A;  2AEH A;  2AL3 A;  4MGK E;  3MTN B;  3R7Q A;  3APC A;  3NZU A;  2JT4 B;  4RM8 A;  2DYM A;  2KC2 A;  3RZF A;  1D3Z A;  3V60 A;  4HCP B;  1RFA A;  4B95 A;  3VTW A;  1UGM A;  1WZ3 A;  1S3S G;  2JUO A;  4DDI D;  4KZ0 A;  4MEL A;  5J18 A;  3V6C B;  1NBF C;  1WRD B;  4FAD A;  2RPQ A;  2Z0E B;  3PRM B;  1Z2M A;  2GBN A;  1V6E A;  4JL9 A;  5LLI A;  1NDD A;  4JLC A;  1XD3 B;  2KFK A;  4W9F A;  3UGB B;  3ZDT A;  4WJO A;  1WFY A;  3WIM A;  2MBQ A;  2KFJ A;  3A4R A;  3CMM B;  5C1Z A;  3K9P B;  5DCN A;  4IUM B;  4ASW C;  2NBW B;  1OEY J;  2GBK A;  4XX5 A;  1WMH B;  3NOB A;  5BO4 B;  3ZO5 B;  2KN5 A;  2CS4 A;  2ZEQ A;  1WXV A;  2KKC A;  2KHW B;  2FCM A;  3N3K B;  4TQ1 A;  4EEW A;  2GMI C;  4HK2 A;  3U7D A;  1E5W A;  3KYD D;  2WWZ A;  4JGH B;  5D7G A;  2KTR B;  2BYE A;  3A4S C;  3RCZ A;  3VXW A;  2N9X A;  5DPW A;  2DAF A;  2BKR B;  2R2Q A;  1WX7 A;  2RR9 A;  2KTF A;  4XZ4 A;  2NBV B;  3HM6 X;  2A4Z A;  3ZKJ C;  3O65 B;  4KIK A;  1U4A A;  2KWV B;  3SHQ A;  3VUY A;  4EUT A;  4DHZ E;  1ZGU B;  4X57 B;  3U30 A;  2L76 A;  4TV3 A;  4K7S A;  2C9W B;  1WJ4 A;  4N9F 4;  3V6E B;  1WGR A;  4B9K A;  2YVC A;  3JYU A;  3GOE A;  3R3M A;  3UQB A;  1WJU A;  2RD0 A;  1XQQ A;  4A20 A;  4FJV B;  4NY0 A;  4GN1 A;  1QZE A;  5G2N A;  3NS8 A;  2FAZ A;  2N7E A;  2MBH A;  4A3O A;  1I35 A;  3RT3 B;  2N1V A;  2XK5 B;  1VCB A;  1YX5 B;  2B3A A;  4DBG A;  3ZRF A;  3L17 A;  3GZN I;  3T8M A;  4EZJ A;  4EZL A;  1R4N I;  1WE7 A;  2RSU A;  5E6P A;  2V4L A;  2WYQ A;  4IWP A;  2NBU A;  1HE8 A;  2NCN A;  1C3T A;  1SGH A;  3AU5 A;  2KC1 A;  2JZ3 B;  4W9K A;  4KSL C;  1SE9 A;  2D11 A;  1H4R A;  1R4M I;  2J0K A;  2Z0D B;  3QAQ A;  1WMH A;  4WAA A;  2L7R A;  3V62 A;  2KVR A;  4WJQ A;  4YL8 A;  1OGW A;  2HE7 A;  1Q5W B;  4WJN A;  2G4S A;  3JSV A;  4PS3 A;  2I1K A;  2HD5 B;  1JRU A;  3HK0 A;  2K8H A;  2KTR A;  4NJ7 A;  2CHW A;  2IYD B;  4DHJ D;  5IA7 A;  1J0G A;  5CX3 A;  2D10 A;  2PE6 B;  2MP2 B;  3IFW B;  2LRU A;  1UBI A;  2DZJ A;  4NNJ B;  4E3C A;  1KOT A;  2G45 B;  4NQL B;  4ANV A;  1YQB A;  3I3T B;  1WH3 A;  1K8R B;  2QHO A;  2ZJD A;  2JRH A;  3SU8 X;  3TIX A;  4K7U A;  4JQW C;  2KO3 A;  2LJ5 A;  4ANW A;  2KNB A;  3TCA A;  2L05 A;  2N7D A;  2GBM A;  3DBL I;  1L2N A;  1FXT B;  2BPS A;  3L0W B;  3A9K B;  2JRI B;  4PS8 A;  3V61 A;  1WX9 A;  2EKE C;  1WXS A;  3EHV A;  3MHS D;  4MJS B;  3QJZ A;  3WAO A;  2OOB B;  4HPL B;  4BKT A;  4E71 A;  3VAW A;  3AI5 A;  3QCA A;  2O6V D;  2MWS B;  2XK5 A;  3DBS A;  1TTN A;  4FHK A;  4IWQ A;  1BT0 A;  3OJ3 A;  2NVU I;  2YLM A;  4ZRJ A;  1WM3 A;  2MBO A;  4MH0 E;  3M95 A;  4TQ0 A;  1WR1 A;  1E7V A;  3A1Q A;  2KQ7 A;  5DPS A;  3DPD A;  2MQJ A;  3UF8 A;  2JZZ A;  2JWZ A;  2KMC A;  2O2V A;  3QIJ A;  5LXI B;  2K6Q A;  2LGD A;  5D94 A;  2LAS A;  3Q3F A;  4IM2 A;  2JPH A;  3KH0 A;  2LWP A;  4LJP B;  3EC8 A;  1Z5S B;  2KZR A;  4IWO A;  5CHV C;  2Z59 B;  3ZNZ B;  4GDK B;  1WX8 A;  2C60 A;  4BFR A;  2IY0 B;  2HTH A;  3ZUN A;  1H8C A;  2ZCB A;  4WJP A;  1LFD A;  5G55 A;  3PRZ A;  4GB9 A;  2K6D B;  2IO2 B;  2KLG A; 
#chains in the Genus database with same CATH topology
 3VUW A;  1XT9 B;  3AED B;  2WXK A;  4GDL B;  3VH3 B;  1FCC C;  2LZ6 A;  2QIL A;  1WGH A;  4MSQ B;  4R3D A;  1SSN A;  2FCQ A;  3NG0 A;  3UI3 A;  3RD2 A;  1KM7 A;  3JW0 X;  3ZNI D;  3ML8 A;  3P63 A;  4XE0 A;  4P1C C;  3AE2 B;  3QC8 B;  3RNB C;  3DWG C;  4OW0 A;  2JSV X;  2INC C;  2N9P C;  2K1F A;  2DNF A;  2NPT A;  3H7P A;  2C7N B;  5L95 C;  5FR3 A;  4WWM A;  2INP E;  2EMT A;  4IW0 A;  3ZIM A;  4DHJ B;  1N62 A;  4LNO A;  4HWI B;  2KDE B;  2KMA A;  1Q1O A;  1VD2 A;  2BKF A;  1PYW D;  2MA9 B;  2KX3 A;  2RDB C;  3DBL B;  1M94 A;  2WXI A;  3H1U A;  1JWB D;  3ZXR A;  4KX6 B;  2DEN B;  3BZD B;  4IOI E;  1FNU A;  2REX A;  1WSP A;  1P9D U;  4J6I A;  4F8C B;  4CO7 A;  5LNK 1;  4BKS D;  2UYZ B;  3KUC B;  3T9L A;  4W9C A;  2IGD A;  3S2A A;  1WGD A;  3NHE B;  3VR8 B;  3TEY A;  3U4E G;  2PPH A;  1QOF A;  2WQY B;  3DHG C;  1ROE A;  3ZRC A;  3AE6 B;  1CMX B;  4BOS C;  3HIZ A;  2PVG C;  4LNN A;  3WAL A;  3ETR A;  1J19 A;  2KQ4 X;  1XLP A;  1IYF A;  1AAR A;  1LQB A;  4ZRI A;  2OJR A;  2KOX A;  2WXH A;  1ZUD 2;  3QK0 A;  3WAN A;  4ICU A;  4RCO A;  1FNV A;  1RAX A;  2MH7 A;  2PE9 A;  1HA5 A;  1V97 A;  2EEL A;  3PV1 A;  3Q8B A;  2CU3 A;  1SJH D;  3UIO B;  1TY2 A;  1QOA A;  3QWZ B;  2LVO A;  4MDK E;  2K5P A;  4M8M A;  3PS6 A;  1LM8 B;  4IM3 A;  2JYE A;  4NAM A;  4EOY A;  1E9M A;  4IG7 B;  2DHZ A;  5BMI A;  1WYW B;  4DWF A;  4OVU A;  4W9G A;  4FBJ B;  2NMQ A;  1R4N B;  1L7Y A;  2R2O A;  2WXP A;  3TJP A;  1PGX A;  4WWO A;  4PK1 A;  1UEL A;  3BYT B;  4UDU C;  2N9L A;  4KV2 A;  1EF1 A;  3PHX B;  1Q10 A;  3PZ8 A;  4RGT A;  3U52 E;  4ZHO A;  1HZ6 A;  4AWJ A;  5IKC M;  2MCN B;  2JY6 A;  1I4Q A;  1UH6 A;  2I38 A;  2J0M A;  4JX1 C;  4GSW A;  4MGI E;  2BT6 A;  2G9H D;  2DLB A;  1R7S A;  5MPO A;  2SEB D;  2LGX A;  3BK1 A;  2E6X A;  3E56 A;  4AP4 C;  3AM9 A;  4KVG B;  1QOB A;  5EDS A;  4GDK A;  3W5U B;  3VDZ A;  4OVZ A;  3NJT A;  4RNA A;  3B2F A;  2RMM A;  2W3R A;  1TYG B;  1MG8 A;  2KWC A;  1N61 A;  2EMS A;  2ZNV B;  4LNK A;  3RFZ B;  4M02 A;  3J9C A;  1C1Y B;  2J7Q B;  1E8Y A;  1P7F A;  1GG3 A;  5E6O A;  1YX6 B;  4KZC A;  3O13 A;  2KJH B;  1TS2 A;  4LNF A;  2KDB A;  4NAW A;  2LRW A;  2MRP A;  1JML A;  4G50 A;  3IVF A;  2JQR B;  4HPM B;  3CST A;  3BII D;  3A33 B;  3NZS A;  4ZYS A;  1I42 A;  1UZX B;  3D32 A;  1E90 A;  1ESF A;  1V5T A;  3AN1 A;  3MFG A;  4N59 A;  1PQS A;  2ZNV C;  3PGE A;  2V3S A;  4BOZ B;  1L6U A;  3RNF C;  1RYJ A;  3H6N A;  2W82 A;  1KRH A;  2UWQ A;  4ANU A;  3V05 A;  2BYV E;  4KIK B;  3RUL A;  4RM9 A;  3NRZ A;  2D3B A;  1WGK A;  2XEW A;  2MBB B;  3VUX A;  4LCD E;  4RF1 A;  2WHI A;  3ZNH B;  5D3I B;  1YOV B;  3MTN B;  1D3Z A;  2KC2 A;  3IAS 1;  2BS3 B;  4RGN A;  1RFA A;  1DGJ A;  3VTW A;  4B95 A;  1FO4 A;  1NBF C;  4L1B A;  2RPQ A;  1Z2M A;  4PT5 A;  3DBR B;  4JL9 A;  2BTE A;  5LLI A;  3ZDT A;  4W9F A;  4WQM A;  4WJO A;  4WAF A;  1P7E A;  4ASW C;  1YNT E;  1OEY J;  2GBK A;  1JCK B;  4XX5 A;  2ZEQ A;  1WXV A;  2KKC A;  2BQQ A;  1YMH E;  4EEW A;  1VZ8 A;  2WWZ A;  1CZP A;  4ZHP A;  4A8X C;  3RCZ A;  1JWM D;  2H89 B;  2RR9 A;  2K3U A;  3KWL A;  3R2I A;  2BS2 B;  3VUY A;  1YN4 A;  2IGG A;  2Q5W D;  3RNE C;  4TV3 A;  1YN3 A;  1T3Q A;  1WJ4 A;  2FE8 A;  1VZ6 A;  1JWS D;  2M56 B;  2V3P A;  3V6E B;  2LHE A;  3R3M A;  1SXT A;  2N7E A;  2MBH A;  5H92 C;  3L17 A;  3GZN I;  4EZJ A;  3HRD D;  2XN9 C;  5E6P A;  4IWP A;  4HKZ E;  3FIL B;  3AU5 A;  2KC1 A;  2JZ3 B;  3EFC A;  2D11 A;  2J0K A;  1TY0 A;  2V3N A;  3V62 A;  4WJQ A;  1Q5W B;  3LB8 C;  2Y5P A;  4PS3 A;  2I1K A;  2HD5 B;  2QC8 A;  1J0G A;  2PE6 B;  4S17 A;  3IFW B;  3N9Y C;  2B76 B;  4CQN A;  3AE3 B;  1WH3 A;  2ZJD A;  2Z8L A;  2LJ5 A;  4JPS A;  4ANW A;  3DBL I;  2GBM A;  3I5J C;  2BPS A;  3L0W B;  3NVW A;  1SJE D;  1EU4 A;  2EKE C;  3MHS D;  4M0W A;  4MJS B;  1RFK A;  1MJD A;  4BKT A;  3AE1 B;  3QCA A;  2JZP A;  2XK5 A;  1JWU D;  2LMC A;  2NVU I;  5HHD G;  2K0P A;  4MH0 E;  1V8C A;  1E7V A;  2HJ1 A;  2JZZ A;  1PUT A;  2JWZ A;  2O2V A;  5LXI B;  5D94 A;  3W5V B;  4YTM B;  1FXA A;  4IWO A;  5CHV C;  2KVZ A;  4N58 A;  2HTH A;  2DWQ A;  1V1P A;  2MSE D;  4HCN B;  1KLG D;  2KLG A;  4M00 A;  2ZZP B;  5C2T B;  3GS2 A;  4GXB A;  1QQR A;  1JRO A;  4ZYN A;  2LXA A;  4MM3 B;  2IND C;  1LXD A;  4PYZ A;  2G3Q B;  2FID A;  2W55 A;  1NEN B;  3IHP C;  1C4A A;  1FNW A;  2YEP B;  1R4M B;  1V1O A;  3ECI A;  3QAR A;  1B9R A;  3AUL A;  1NVI D;  2LUE A;  4GOC A;  1S1Q B;  3PRP B;  4ANX A;  1T0R C;  1CK1 A;  1T0Q C;  4C4V A;  2QSD A;  4W9H A;  5JH5 C;  3GP7 A;  3W1S C;  2KJR A;  3EEC A;  4DDG D;  4HXD A;  3SFD B;  2L83 A;  4FHJ A;  1WXM A;  1TBE A;  3CSF A;  3R2T A;  4ZRK A;  4I6P A;  2X8X X;  2IO0 B;  4W9E A;  2AQ1 B;  3QX1 A;  3H8H A;  2CHZ A;  4K7W A;  5GMV A;  4HDQ A;  4YSX B;  2O6V B;  4US8 A;  4GDL A;  2M4N A;  4J3O D;  3KUZ A;  3NVV A;  2ACZ B;  4W9J A;  2ASQ A;  3OG5 A;  4RMA A;  4NZL B;  4NQK E;  2XBB C;  1FFU A;  3ZVV A;  1L4Z B;  3PZD A;  3DVG X;  2M17 A;  2KFK B;  2ICI A;  1OQQ A;  1F0Z A;  4FJY A;  1V9J A;  4ARC A;  3W1Y A;  1M4V A;  1V2Y A;  4HVB A;  5KHO A;  4ARI A;  4MGZ E;  3B0A A;  1C4C A;  1TZO A;  3R7R A;  4F1S A;  1ZXI A;  2VH2 A;  2N1W A;  1E8X A;  3Q69 A;  2JX5 A;  1GPX A;  5D6J B;  3KLS X;  2AYO B;  2L52 A;  2LUM A;  1WY8 A;  3CWI A;  3PTF C;  4W9L A;  4HJK A;  4BBN F;  3RI7 C;  2OJW A;  3WA0 A;  1UD7 A;  1NI2 A;  3DHH C;  1GC6 A;  3VTU A;  2D2Q A;  3M63 B;  2G4D B;  1WI0 A;  4M01 A;  3DOW A;  3GZN B;  1HTQ A;  3EGR A;  1NEK B;  1WM2 A;  3BK2 A;  4RFB A;  3AE7 B;  3IBE A;  2N4F A;  4OZB A;  1JW9 D;  2Y5B B;  3PZ7 A;  2DYO A;  1ZKH A;  3DDC B;  3A9K A;  3EFU A;  2IO1 B;  1DOX A;  1PGB A;  1RM6 C;  3RNA C;  2ZPY A;  2M0X A;  2KXJ A;  3JSV B;  1SE4 A;  2PEA A;  4LJO B;  4YT0 B;  2NTS A;  2WLB A;  5CHW A;  3RNG C;  2PW9 A;  1P3Q U;  2V1Y A;  2MHJ A;  4BBN C;  2FNJ B;  3A9J B;  3TEX A;  2NR2 A;  4B6W A;  3MHZ A;  3DBR I;  2GOW A;  2MJD A;  1JWA D;  2K22 A;  5JZE B;  2AX5 A;  3PHW B;  4WUR A;  5AZH A;  4ZDV A;  2KD0 A;  3DVN V;  2KAN A;  4BKG A;  3T3O A;  1E7U A;  3KYC D;  3A1Q B;  3V3X A;  3Q3M C;  3P42 A;  1E6E B;  2DYB A;  1ZE3 D;  2VRR B;  1ZPS A;  4A6Q A;  4OHJ A;  1RLF A;  1HQR D;  2CHX A;  2L3Z A;  3LXF A;  4P16 A;  4EKU A;  3PSE B;  3M62 B;  3DVG Y;  3UIP B;  1XXG A;  2MJE A;  1KTK A;  1L0Y B;  2GBJ A;  2M8S A;  2KX0 A;  4TMA B;  3AEE B;  5FKA C;  1L0V B;  2ZCC A;  1MI0 A;  1D5X C;  4PS7 A;  5LXH A;  4CHK A;  1N6Z A;  2AQ2 B;  3AE9 B;  2VZK D;  4IDI A;  1I4H A;  1P0R A;  2WX0 A;  2NPT B;  3H7P B;  2FCS A;  4JIO U;  1NYQ A;  1V5O A;  3DQV A;  3H7S A;  4HRS A;  3NZU A;  4B0M A;  4RM8 A;  3RZF A;  2QIE B;  4HCP B;  1QT9 A;  1UGM A;  1WZ3 A;  1S3S G;  2VH1 A;  4KZ0 A;  5J18 A;  3V6C B;  1WRD B;  1VZ7 A;  4A90 A;  3IT6 B;  2GBN A;  1XD3 B;  2N0S B;  1KH0 A;  3RPF C;  3WIM A;  5C1Z A;  1IBX A;  5DCN A;  2IPK D;  2NBW B;  3DBH B;  1WMH B;  3B2G A;  2KHW B;  1ZOY B;  2FCM A;  3TUO A;  4HK2 A;  3U7D A;  1E5W A;  3GE3 C;  4C56 C;  4JGH B;  1HXY D;  1L4D B;  1QOG A;  2BKR B;  1WX7 A;  2FBW B;  3DHI C;  1FRD A;  4XZ4 A;  2NBV B;  4KIK A;  2JXT A;  1ZGU B;  4X57 B;  3NUH B;  3L4P A;  4JWU C;  1GB4 A;  3ZJT A;  4AQ7 A;  4OZC A;  3GOE A;  1PFD A;  4GN1 A;  1TKE A;  5G2N A;  1XLN A;  4A3O A;  3MC8 A;  3RT3 B;  1VCB A;  1YX5 B;  4DBG A;  1TKG A;  4C00 A;  4EZL A;  2QEJ C;  1N5W A;  4ZOH C;  4AS1 A;  2LHD A;  1SE9 A;  1R4M I;  1NI3 A;  4WAA A;  2L7R A;  4RH6 A;  2KVR A;  1F2R I;  1ACC A;  1OGW A;  2J52 A;  2G4S A;  2MEK A;  3AMZ A;  2E3T A;  1EWC A;  3HK0 A;  4DHJ D;  2CHW A;  2IYD B;  2D10 A;  2MP2 B;  2LRU A;  2L32 A;  1ZDV A;  4ANV A;  2WDR B;  3I3T B;  1L0X B;  1GOZ A;  3R8B A;  4JQW C;  1LO5 D;  2D5G A;  1EWY C;  1VJK A;  2L05 A;  1L2N A;  4HEA 1;  2JRI B;  3B9J A;  4REZ A;  1JRP A;  5AUK A;  2OOB B;  1EM7 A;  3AI5 A;  3DBS A;  1TTN A;  4KGR A;  4FXC A;  1J7B A;  4BZA A;  2YLM A;  4ZRJ A;  1WM3 A;  4TQ0 A;  4JWS C;  5DPS A;  4GLS C;  3LYY A;  2PKO A;  2MQJ A;  2PMV A;  1MFW A;  4XDD A;  2LAS A;  2JPH A;  4D2K A;  3EC8 A;  1Z5S B;  3ZNZ B;  4GDK B;  1WX8 A;  2IDY A;  4BFR A;  5IN7 A;  3ZUN A;  1TS5 A;  2ZCB A;  5G55 A;  3PRZ A;  2PVO D;  4GB9 A;  2IO2 B;  5D2M B;  5EE0 A;  4DK5 A;  1V80 A;  4CYE A;  1MHX A;  5JHA A;  2KN4 A;  4II2 B;  2C7H A;  1D5M C;  3VTV A;  2C5L C;  1EUV B;  2LGS A;  3K9O B;  3AEA B;  4K3B A;  2K39 A;  2CU1 A;  3CF6 E;  1SE3 A;  5AUI A;  5TR5 A;  2MLB A;  1IPG A;  1WF9 A;  2KWU B;  4NAW B;  4FJZ A;  2JF5 A;  1RRB A;  2WXM A;  3M3J A;  1BML C;  1VRA B;  4WQO B;  2RGF A;  1XEE A;  4XDC A;  1FPY A;  1P98 A;  4M8N A;  2J42 A;  3DCG A;  5CHF A;  2MX2 A;  2FIF A;  3IAM 1;  3QQ8 B;  4P1B C;  1GB1 A;  3PRE A;  1FXI A;  5EE1 A;  1WRI A;  1Y8R C;  2IBI B;  2LEK A;  3L10 B;  1D5Z C;  3ZLZ A;  1QIL A;  3ZNG C;  4KGT A;  1ZP0 B;  3PT2 B;  1E7P B;  5GXG B;  2WDV B;  2LVQ A;  3UQA A;  2DZI A;  2JXX A;  4GMV A;  2KMM A;  2WP9 B;  2ON8 A;  4C7Y A;  2ONQ A;  4NJ6 A;  5J2R A;  3QHT A;  3VHT C;  1IUE A;  1HEZ E;  1J8C A;  2BGF A;  1FM0 D;  1D6E C;  4JE3 B;  4BVU C;  4LLG M;  2ZPN A;  4P6V F;  1G6J A;  4DXF A;  5D3D A;  3BWU D;  3SD5 A;  5G5G A;  2M1M A;  2C7M B;  3VR9 B;  3ZXV A;  4W9D A;  4I6N B;  1ZW7 A;  5C23 A;  4IKG A;  1GUA B;  1QKZ A;  4W9I A;  1V81 A;  2DZK A;  4MSM B;  2WXG A;  4HLE A;  1EO6 A;  1K50 A;  2N9K A;  3L08 A;  3OAW A;  4LNI A;  2WXF A;  3P4R B;  4G11 A;  1C76 A;  1SE2 A;  4ACF A;  4ICV A;  5E6J A;  3P4S B;  4N6E B;  4DXA B;  2IZV B;  3QA8 A;  4GU2 A;  4TKN A;  1I7H A;  4TUU A;  4KDL B;  2W9N A;  5DPT A;  2DZM A;  4GGQ A;  2CKH B;  3APF A;  1KF6 B;  2H88 B;  1FRR A;  3H9D A;  2KK8 A;  3SEB A;  4URK A;  1X1M A;  3PVL A;  3PPA A;  2YEP F;  2O6V A;  1P1A A;  4G3X B;  3DVN U;  3BVG A;  4F7Z A;  4G0N B;  4E74 A;  3AU4 A;  3HVZ A;  3TMP B;  1AWD A;  2G1E A;  3ZDM C;  3GE8 C;  2GI9 A;  2WS3 B;  2FUH B;  3BVZ A;  2QJL A;  4XC2 A;  3RZW C;  1Y56 A;  2LJI A;  3WAM A;  1V49 A;  5AZG A;  3Q6B A;  3ONS A;  3E9S A;  4L23 A;  4RF0 A;  4US9 A;  3VFK A;  1YIW A;  1MPE A;  2K9X A;  4MGY E;  1GC7 A;  3Q8C A;  2BBC A;  4AJW A;  2LI5 A;  2AQ3 B;  5IAA C;  2K8C A;  3Q3N C;  2IO3 B;  1WGY A;  1TGZ B;  4A9A A;  4EFO A;  3L16 A;  3HHM A;  1WXQ A;  2LGY A;  1IGD A;  1F52 A;  3NS1 A;  3URY A;  3I63 C;  1F2R C;  4M0W B;  3DBH I;  1MVK A;  4XGA B;  1TZ1 A;  4EZK A;  3ZYY X;  3KVF B;  1XF5 L;  2LD9 A;  1UUP A;  1XCQ L;  4AJY B;  1QF6 A;  2BWF A;  3C0R B;  4GIV A;  4LDT D;  3GB1 A;  2JU6 X;  2O2V B;  1YD8 U;  1T0Y A;  4H2A A;  4KDI C;  2L0F A;  1C9F A;  1WXA A;  3IG3 A;  1FMA D;  3TBL D;  1PGA A;  1V1P B;  2SAK A;  2ZVN A;  3VH4 B;  5DPR A;  3L13 A;  3A9J A;  4DHZ B;  1HTO A;  1F9J A;  1CJE A;  2KJ6 A;  2WGS A;  1IGC A;  4QAY A;  5I4D A;  3FAH A;  1EF5 A;  4K81 A;  3HM3 A;  4RGO S;  3WCQ A;  3KWV A;  2V4I B;  2K25 A;  2KLC A;  1GNU A;  2L1A A;  2WXJ A;  3ZGZ A;  3APD A;  3IXS A;  1WZ0 A;  4MGK E;  3APC A;  3C8Y A;  3AB5 A;  2DYM A;  2W3S A;  1DOY A;  1VLB A;  4FAD A;  3PRM B;  1FEH A;  4JLC A;  3UGB B;  4C80 A;  5BYQ A;  3U7Z A;  1KFY B;  4HJG E;  1WFY A;  2KAC A;  4TSS A;  3A4R A;  3CMM B;  3Q8A A;  1SEB D;  3NOB A;  1BXT A;  4TQ1 A;  3N3K B;  2GMI C;  3CIR B;  5IO9 A;  4WIP A;  2KTR B;  2BB5 A;  2BYE A;  3VXW A;  2N9X A;  5DPW A;  2DAF A;  2HDE A;  1FFV A;  3ZKJ C;  2QDF A;  5BMG A;  5IP4 D;  1U4A A;  2KWV B;  1NYR A;  4XWT A;  3U30 A;  1JAL A;  4MAC A;  2C9W B;  4N9F 4;  2XNA C;  2UU7 A;  4XYC A;  4B9K A;  2YVC A;  3UQB A;  4YTN B;  1WJU A;  1XQQ A;  4FJV B;  2RDG A;  1QZE A;  3NS8 A;  2N1V A;  2PIA A;  1ENF A;  3T8M A;  1ET6 A;  1WE7 A;  2RSU A;  2V4L A;  2WYQ A;  2NBU A;  1HE8 A;  2NCN A;  1YQ4 B;  4W9K A;  4KSL C;  1H4R A;  1J7A A;  2Z0D B;  1WMH A;  4MT5 A;  4DQO C;  2HE7 A;  3BVM A;  2W54 A;  1KLU D;  3P4P B;  2RDH A;  1JRU A;  2WXN A;  4NJ7 A;  5H8Y E;  2Y3A A;  2DZJ A;  4NNJ B;  1KOT A;  2G45 B;  1YQB A;  1K8R B;  3TIX A;  2JRH A;  3MC9 A;  3T3N A;  3ABV B;  2N7D A;  3VRA B;  1RWS A;  3N1Z C;  3A9K B;  3RMK C;  4C7Z A;  4PS8 A;  5BYS A;  3EHV A;  1WXS A;  3QJZ A;  4HPL B;  4E71 A;  3VAW A;  5TSS A;  2O6V D;  4IWQ A;  3U2S C;  1BT0 A;  3OJ3 A;  3IT4 B;  3SR6 A;  2OHF A;  2MBO A;  3M95 A;  1WR1 A;  2KQ7 A;  3DPD A;  1XLO A;  3UF8 A;  3MJ5 A;  3QIJ A;  2LGD A;  3ZJV A;  3KH0 A;  2LWP A;  4RGM A;  2KZR A;  2BYT A;  2Z59 B;  4LTU A;  4WH4 A;  2WXQ A;  1AW7 A;  1H8C A;  4KGS A;  2WXR A;  1LFD A;  1UWM A;  4A55 A;  4Q2J A;  2I2Y A;  2PLP A;  3P1M A;  1ZDX A;  2MP2 A;  2D07 B;  1A5R A;  2K8B A;  3AXC A;  3N32 A;  3MJW A;  2ZVO A;  4K1R B;  3ALB A;  4FN2 A;  3HUI A;  4I6L B;  2A5U A;  2M0A A;  1EU3 A;  2TSS A;  2GBR A;  3AE4 B;  5JXV A;  2KAJ A;  2LFI A;  1UBQ A;  1Q0W B;  4AOF A;  3AV8 A;  3LJ3 A;  3W2D A;  2WXL A;  1A70 A;  4HKQ A;  4O1N A;  3OWE B;  4WWP A;  1DYQ A;  4NPN A;  2KDF B;  4K3C A;  2WDT B;  2L0T A;  2AWT A;  1B1Z A;  1E8W A;  3AEC B;  1E8Z A;  3C19 A;  5CTR C;  3VVW B;  3FC4 A;  2FUG 1;  1T6B X;  2WDQ B;  1KLV A;  1L5P A;  1T5X D;  4IC7 B;  3EA6 A;  3N1Y C;  3LDZ E;  3AE5 B;  1YQ3 B;  1K52 A;  1WR6 E;  4A3P A;  5EE9 A;  1OQY A;  2IGH A;  4LK0 M;  1SIJ A;  2J53 A;  1YJ1 A;  1C79 A;  4WWN A;  2BF8 B;  1QLB B;  1WJN A;  3ZTD A;  3ML9 A;  1WE6 A;  3W9C B;  5EE3 A;  2BS4 B;  1IBX B;  2MJ3 A;  3UIN B;  3TL5 A;  2CR5 A;  3NY5 A;  1YJI A;  2DX5 B;  3JVZ X;  3L54 A;  2Y5C A;  4OVV A;  5E6N A;  3I9V 1;  2LGI A;  4YSY B;  1GAQ B;  2MW5 A;  1V86 A;  3U8Z A;  3BIN A;  3ENE A;  3KW5 B;  2QCZ A;  2L8J A;  4P7I A;  1JQ4 A;  2KT7 A;  3FIL A;  1GJZ A;  2WX1 A;  3RUI B;  3X23 A;  2IY1 B;  4S0R A;  1STE A;  1C77 A;  3B08 A;  4YWG G;  4KKI A;  3KUD B;  3MC0 B;  5C3J B;  2WU5 B;  4OZA A;  2R61 A;  5HG2 A;  2D3C A;  5L83 A;  4MH8 A;  1C4P A;  1T0S C;  1XO3 A;  3EUB 2;  3P2B A;  3KQ4 A;  4KKJ A;  2MBE A;  4ITK A;  3B1L X;  3N30 A;  1IP9 A;  3PLU A;  1ET9 A;  5IOI A;  1L6V A;  4FUL A;  2V9H A;  3AH7 A;  3TEZ A;  2LVP A;  2L00 B;  1F1H A;  2KQS A;  1WJ6 A;  1E10 A;  3NZ3 A;  4KSK C;  3ZTC A;  2NTT A;  4MJS A;  5HFY A;  5HKH A;  3BY4 B;  4XWW A;  5AZF A;  1I4G A;  3RN9 C;  3ZQ4 A;  3R66 C;  1I4X A;  3MP9 A;  4LDT B;  1YJJ A;  2BWE S;  2WNM A;  2I1J A;  1SBB B;  2OED A;  4II3 B;  2D3G A;  2KDI A;  2AL6 A;  1DOI A;  5G5H A;  4MEM A;  2BVC A;  1ZXH A;  3OJ4 B;  2CJO A;  2PJH A;  3Q3J A;  2DBY A;  2HTM E;  2J0J A;  2KDM A;  3AEF B;  2J4X A;  4NJC A;  4ZRP A;  2NS5 A;  4FLH A;  3RYT A;  3W1S A;  4MM3 A;  1WIA A;  5FR6 A;  3AEB B;  3X0W A;  2JVC A;  3P4Q B;  1WWT A;  1BUI C;  5J17 A;  3BYY B;  3OLM D;  1OEY A;  5JHB A;  4BKS A;  3PLV A;  4AUQ C;  4DXG A;  5BMH A;  2EKI A;  2QMT A;  1N60 A;  2BYF A;  1UWX A;  1WGG A;  3ZW3 A;  3VQI A;  1KJT A;  1F77 A;  4FA6 A;  2DAJ A;  5KHQ A;  2N7J A;  1N5X A;  1C78 A;  1MHH E;  1UF0 A;  2BW2 A;  2BB6 A;  1OTR B;  2LXC A;  1ISN A;  1SB3 C;  4IM0 A;  4PYU A;  5AEK B;  3I57 A;  2D3A A;  1SIF A;  3WAP A;  2HJ8 A;  1I4P A;  4EE2 A;  3SDL C;  2N9E B;  1J7C A;  4HDO A;  3ZJU A;  2AL3 A;  2AEH A;  3R7Q A;  2JT4 B;  1VDV A;  3V60 A;  1XLQ A;  3TEW A;  3N1X C;  1OFF A;  2JUO A;  4DDI D;  1AN8 A;  4MEL A;  2Z0E B;  1N63 A;  1V6E A;  1I4R A;  1NDD A;  2CJN A;  2KFK A;  3N20 C;  2GLS A;  1D4B A;  2MBQ A;  2KFJ A;  3K9P B;  4IUM B;  1K51 A;  1HZ5 A;  2JWU A;  5BO4 B;  3ZO5 B;  2KN5 A;  2CS4 A;  2KWD A;  4YTP B;  3KYD D;  5D7G A;  3A4S C;  1MG4 A;  2R2Q A;  4B0E A;  2KTF A;  3HVD A;  1TJE A;  3HM6 X;  2A4Z A;  3Q8F A;  3O65 B;  3SHQ A;  4EUT A;  1TS4 A;  4DHZ E;  1VR9 A;  1PDX A;  2M19 A;  2L76 A;  4K7S A;  1FIQ A;  3SFE B;  4HRO A;  4HPP A;  1K53 A;  1WGR A;  2V0G A;  3AE8 B;  3JYU A;  2RD0 A;  3DWM A;  4A20 A;  2ZW1 A;  4NY0 A;  2GRI A;  3RNC C;  2FAZ A;  1I35 A;  2XK5 B;  1TS3 A;  2B3A A;  3ZRF A;  3TSS A;  2IJ0 A;  3NVY A;  2KYW A;  1R4N I;  1C3T A;  1CQV A;  1SGH A;  4ZRQ A;  2VZK B;  3AEG B;  1AYF A;  3QAQ A;  2ZW0 A;  2RPV A;  4YL8 A;  4YSZ B;  4WJN A;  3JSV A;  3Q8E A;  1XCT L;  1SF0 A;  2K8H A;  2KTR A;  5IA7 A;  2INN E;  5CX3 A;  4YXD B;  1E0Z A;  1UBI A;  4E3C A;  1WYG A;  4NQL B;  1YN5 A;  1UGJ A;  2QHO A;  3SU8 X;  4BAX A;  4K7U A;  3Q14 C;  2KO3 A;  2WU2 B;  2KNB A;  3TCA A;  1FXT B;  3VRB B;  3V61 A;  1WX9 A;  5BYR A;  1FD6 A;  3WAO A;  1LGR A;  3FKY A;  2MWS B;  2GB1 A;  4C4V B;  5FK9 C;  4FHK A;  2PTL A;  1FCL A;  3NVZ A;  3A1Q A;  1UNS A;  3Q3O C;  1TT5 B;  2KMC A;  3PO0 A;  1TKY A;  4USA A;  2K6Q A;  3Q2A C;  2X38 A;  4L2Y A;  3Q3F A;  4IM2 A;  4LJP B;  1OQR A;  5HI1 A;  2C60 A;  2WXO A;  2IY0 B;  1TIF A;  5T8I A;  4WJP A;  2JYT A;  2K6D B;  2FCN A; 
#chains in the Genus database with same CATH homology
 4HCN B;  5D2M B;  3VUW A;  1XT9 B;  4DK5 A;  1V80 A;  2ZZP B;  4CYE A;  4GXB A;  2MP2 A;  4GDL B;  4ZYN A;  2D07 B;  2LXA A;  5JHA A;  4II2 B;  1LXD A;  2C7H A;  4PYZ A;  1A5R A;  2K8B A;  3AXC A;  3VH3 B;  2G3Q B;  3VTV A;  2C5L C;  1EUV B;  2FID A;  2LZ6 A;  3MJW A;  3N32 A;  3K9O B;  1WGH A;  2MSE D;  4MSQ B;  3IHP C;  2FCQ A;  3RD2 A;  2ZVO A;  4K1R B;  1KM7 A;  2CU1 A;  2K39 A;  3ALB A;  3CF6 E;  3JW0 X;  4FN2 A;  4I6L B;  3ZNI D;  3ML8 A;  5TR5 A;  2MLB A;  3QC8 B;  2A5U A;  1IPG A;  1WF9 A;  3ECI A;  3QAR A;  3AUL A;  2KWU B;  2N9P C;  2K1F A;  2GBR A;  2NPT A;  4NAW B;  3H7P A;  2C7N B;  2JF5 A;  4FJZ A;  2LUE A;  1RRB A;  5L95 C;  4GOC A;  3M3J A;  1S1Q B;  1UBQ A;  1Q0W B;  4WQO B;  3PRP B;  4AOF A;  4ANX A;  3LJ3 A;  2EMT A;  2RGF A;  4IW0 A;  1P98 A;  4M8N A;  3ZIM A;  3DCG A;  4W9H A;  5CHF A;  2MX2 A;  4DHJ B;  2FIF A;  5JH5 C;  4HWI B;  2KDE B;  3QQ8 B;  4WWP A;  2KMA A;  3PRE A;  4NPN A;  2KJR A;  3W1S C;  3EEC A;  1Y8R C;  1Q1O A;  4DDG D;  2KDF B;  1VD2 A;  2WDT B;  2IBI B;  4HXD A;  2L0T A;  3L10 B;  2AWT A;  4FHJ A;  1WXM A;  3ZLZ A;  1TBE A;  3CSF A;  3ZNG C;  1E8W A;  4ZRK A;  2BKF A;  1E8Z A;  4I6P A;  2MA9 B;  2KX3 A;  3H1U A;  3PT2 B;  1M94 A;  2IO0 B;  5CTR C;  3VVW B;  2LVQ A;  3UQA A;  2DZI A;  2JXX A;  1KLV A;  4GMV A;  2DEN B;  4W9E A;  3QX1 A;  2REX A;  2CHZ A;  1P9D U;  4IC7 B;  4NJ6 A;  5J2R A;  3QHT A;  3LDZ E;  4J6I A;  3VHT C;  4F8C B;  4CO7 A;  4K7W A;  1WR6 E;  4A3P A;  4BKS D;  1J8C A;  2BGF A;  4HDQ A;  5GMV A;  2UYZ B;  3KUC B;  3T9L A;  2O6V B;  4W9C A;  4GDL A;  1OQY A;  3S2A A;  2M4N A;  1WGD A;  3KUZ A;  4BVU C;  3NHE B;  4W9J A;  2ASQ A;  4RMA A;  2ZPN A;  1G6J A;  1YJ1 A;  4NQK E;  2XBB C;  4WWN A;  3SD5 A;  3ZVV A;  2M1M A;  2C7M B;  2PPH A;  4W9D A;  2BF8 B;  1ZW7 A;  4I6N B;  3PZD A;  3ZRC A;  3DVG X;  1WJN A;  2M17 A;  2KFK B;  5C23 A;  1CMX B;  3ZTD A;  4BOS C;  3ML9 A;  1GUA B;  1WE6 A;  3HIZ A;  4FJY A;  3WAL A;  1V9J A;  4W9I A;  1V81 A;  2DZK A;  1J19 A;  3W1Y A;  4MSM B;  1AAR A;  1IYF A;  1LQB A;  1V2Y A;  4HLE A;  4HVB A;  3UIN B;  3TL5 A;  5KHO A;  2CR5 A;  4ZRI A;  1EO6 A;  3NY5 A;  4MGZ E;  2OJR A;  2DX5 B;  2KOX A;  3JVZ X;  3L54 A;  3QK0 A;  4OVV A;  5E6N A;  3WAN A;  4ICU A;  3B0A A;  3OAW A;  3R7R A;  3L08 A;  4F1S A;  1RAX A;  2N1W A;  2MW5 A;  1V86 A;  4G11 A;  3U8Z A;  1E8X A;  3BIN A;  3ENE A;  3KW5 B;  4ICV A;  5D6J B;  2AYO B;  2PE9 A;  4DXA B;  2IZV B;  2L8J A;  3QA8 A;  4GU2 A;  4TKN A;  3PV1 A;  4P7I A;  4TUU A;  4KDL B;  1WY8 A;  3PTF C;  2W9N A;  4W9L A;  2DZM A;  5DPT A;  4GGQ A;  2CKH B;  2WX1 A;  3APF A;  4HJK A;  3RUI B;  3UIO B;  3X23 A;  4BBN F;  3QWZ B;  2LVO A;  4MDK E;  2IY1 B;  4M8M A;  3B08 A;  3H9D A;  3WA0 A;  1UD7 A;  2KK8 A;  1NI2 A;  3KUD B;  3PS6 A;  4URK A;  1X1M A;  3PVL A;  3PPA A;  1LM8 B;  2O6V A;  1P1A A;  4G3X B;  1GC6 A;  3VTU A;  3DVN U;  4IM3 A;  2D2Q A;  4EOY A;  4F7Z A;  3M63 B;  2G4D B;  4IG7 B;  4G0N B;  2DHZ A;  1WI0 A;  5L83 A;  3DOW A;  4E74 A;  3AU4 A;  1WYW B;  4DWF A;  4OVU A;  4W9G A;  3TMP B;  4FBJ B;  3P2B A;  2MBE A;  3B1L X;  1L7Y A;  1WM2 A;  3N30 A;  1IP9 A;  2R2O A;  3PLU A;  3IBE A;  2N4F A;  3TJP A;  3ZDM C;  4FUL A;  4WWO A;  2Y5B B;  1UEL A;  2DYO A;  2FUH B;  2LVP A;  2L00 B;  4XC2 A;  4KV2 A;  3RZW C;  1GJZ A;  1EF1 A;  1ZKH A;  2KQS A;  3PHX B;  3DDC B;  1WJ6 A;  3A9K A;  3EFU A;  2IO1 B;  2FCN A;  3WAM A;  4KSK C;  3ZTC A;  1V49 A;  2ZPY A;  4MJS A;  5AZG A;  2M0X A;  2KXJ A;  3JSV B;  3ONS A;  4AWJ A;  5HKH A;  3BY4 B;  2PEA A;  4LJO B;  5AZF A;  2MCN B;  2JY6 A;  1UH6 A;  3VFK A;  2J0M A;  1YIW A;  3R66 C;  4GSW A;  4MGY E;  4LDT B;  4MGI E;  1GC7 A;  2BWE S;  2I1J A;  5CHW A;  4II3 B;  1P3Q U;  2D3G A;  2KDI A;  2V1Y A;  2AL6 A;  2LI5 A;  5IAA C;  4AJW A;  2K8C A;  4BBN C;  2FNJ B;  2LGX A;  3A9J B;  2IO3 B;  2NR2 A;  1WGY A;  4MEM A;  4B6W A;  1TGZ B;  4AP4 C;  4KVG B;  4EFO A;  3OJ4 B;  3L16 A;  5EDS A;  3DBR I;  2GOW A;  3HHM A;  4GDK A;  2PJH A;  3Q3J A;  2LGY A;  3VDZ A;  2J0J A;  4M0W B;  5JZE B;  2NS5 A;  3DBH I;  1TZ1 A;  4FLH A;  4EZK A;  3KVF B;  1MG8 A;  3PHW B;  2KWC A;  5AZH A;  3RYT A;  3W1S A;  4ZDV A;  2LD9 A;  4MM3 A;  2KD0 A;  2EMS A;  3DVN V;  2KAN A;  4BKG A;  2ZNV B;  1WIA A;  1E7U A;  3KYC D;  4AJY B;  5FR6 A;  3A1Q B;  2BWF A;  3X0W A;  3C0R B;  1C1Y B;  2J7Q B;  1E8Y A;  2JVC A;  2DYB A;  4GIV A;  4LDT D;  1GG3 A;  5E6O A;  1YX6 B;  2VRR B;  4KZC A;  2O2V B;  5J17 A;  2KJH B;  1RLF A;  1YD8 U;  2CHX A;  2L3Z A;  1T0Y A;  4EKU A;  3PSE B;  4KDI C;  2L0F A;  2KDB A;  3OLM D;  1OEY A;  4NAW A;  5JHB A;  2LRW A;  4BKS A;  3PLV A;  2MRP A;  1WXA A;  4AUQ C;  3IG3 A;  3M62 B;  3DVG Y;  3UIP B;  4G50 A;  2BYF A;  3TBL D;  3IVF A;  2GBJ A;  4HPM B;  1WGG A;  3CST A;  3VQI A;  3ZW3 A;  3A33 B;  2M8S A;  2KX0 A;  1KJT A;  3NZS A;  4FA6 A;  1I42 A;  1UZX B;  2ZVN A;  2DAJ A;  3VH4 B;  3D32 A;  1E90 A;  1V5T A;  5KHQ A;  2ZCC A;  5DPR A;  1PQS A;  3L13 A;  2ZNV C;  3PGE A;  2V3S A;  4BOZ B;  3A9J A;  4DHZ B;  1OTR B;  4PS7 A;  2LXC A;  4CHK A;  1F9J A;  5LXH A;  2KJ6 A;  1ISN A;  4IM0 A;  3H6N A;  4PYU A;  5AEK B;  1EF5 A;  2UWQ A;  4K81 A;  1SIF A;  4ANU A;  2BYV E;  4KIK B;  3RUL A;  3WAP A;  2HJ8 A;  3HM3 A;  4RM9 A;  1P0R A;  2WX0 A;  2K25 A;  2NPT B;  2KLC A;  2XEW A;  2FCS A;  3H7P B;  4JIO U;  3SDL C;  2N9E B;  4HDO A;  1GNU A;  2MBB B;  1V5O A;  3VUX A;  4LCD E;  3DQV A;  3APD A;  3H7S A;  3ZNH B;  1WZ0 A;  2AEH A;  2AL3 A;  4MGK E;  3MTN B;  3R7Q A;  3APC A;  3NZU A;  2JT4 B;  4RM8 A;  2DYM A;  2KC2 A;  3RZF A;  1D3Z A;  3V60 A;  4HCP B;  1RFA A;  4B95 A;  3VTW A;  1UGM A;  1WZ3 A;  1S3S G;  2JUO A;  4DDI D;  4KZ0 A;  4MEL A;  5J18 A;  3V6C B;  1NBF C;  1WRD B;  4FAD A;  2RPQ A;  2Z0E B;  3PRM B;  1Z2M A;  2GBN A;  1V6E A;  4JL9 A;  5LLI A;  1NDD A;  4JLC A;  1XD3 B;  2KFK A;  4W9F A;  3UGB B;  3ZDT A;  4WJO A;  1WFY A;  3WIM A;  2MBQ A;  2KFJ A;  3A4R A;  3CMM B;  5C1Z A;  3K9P B;  5DCN A;  4IUM B;  4ASW C;  2NBW B;  1OEY J;  2GBK A;  4XX5 A;  1WMH B;  3NOB A;  5BO4 B;  3ZO5 B;  2KN5 A;  2CS4 A;  2ZEQ A;  1WXV A;  2KKC A;  2KHW B;  2FCM A;  3N3K B;  4TQ1 A;  4EEW A;  2GMI C;  4HK2 A;  3U7D A;  1E5W A;  3KYD D;  2WWZ A;  4JGH B;  5D7G A;  2KTR B;  2BYE A;  3A4S C;  3RCZ A;  3VXW A;  2N9X A;  5DPW A;  2DAF A;  2BKR B;  2R2Q A;  1WX7 A;  2RR9 A;  2KTF A;  4XZ4 A;  2NBV B;  3HM6 X;  2A4Z A;  3ZKJ C;  3O65 B;  4KIK A;  1U4A A;  2KWV B;  3SHQ A;  3VUY A;  4EUT A;  4DHZ E;  1ZGU B;  4X57 B;  3U30 A;  2L76 A;  4TV3 A;  4K7S A;  2C9W B;  1WJ4 A;  4N9F 4;  3V6E B;  1WGR A;  4B9K A;  2YVC A;  3JYU A;  3GOE A;  3R3M A;  3UQB A;  1WJU A;  2RD0 A;  1XQQ A;  4A20 A;  4FJV B;  4NY0 A;  4GN1 A;  1QZE A;  5G2N A;  3NS8 A;  2FAZ A;  2N7E A;  2MBH A;  4A3O A;  1I35 A;  3RT3 B;  2N1V A;  2XK5 B;  1VCB A;  1YX5 B;  2B3A A;  4DBG A;  3ZRF A;  3L17 A;  3GZN I;  3T8M A;  4EZJ A;  4EZL A;  1R4N I;  1WE7 A;  2RSU A;  5E6P A;  2V4L A;  2WYQ A;  4IWP A;  2NBU A;  1HE8 A;  2NCN A;  1C3T A;  1SGH A;  3AU5 A;  2KC1 A;  2JZ3 B;  4W9K A;  4KSL C;  1SE9 A;  2D11 A;  1H4R A;  1R4M I;  2J0K A;  2Z0D B;  3QAQ A;  1WMH A;  4WAA A;  2L7R A;  3V62 A;  2KVR A;  4WJQ A;  4YL8 A;  1OGW A;  2HE7 A;  1Q5W B;  4WJN A;  2G4S A;  3JSV A;  4PS3 A;  2I1K A;  2HD5 B;  1JRU A;  3HK0 A;  2K8H A;  2KTR A;  4NJ7 A;  2CHW A;  2IYD B;  4DHJ D;  5IA7 A;  1J0G A;  5CX3 A;  2D10 A;  2PE6 B;  2MP2 B;  3IFW B;  2LRU A;  1UBI A;  2DZJ A;  4NNJ B;  4E3C A;  1KOT A;  2G45 B;  4NQL B;  4ANV A;  1YQB A;  3I3T B;  1WH3 A;  1K8R B;  2QHO A;  2ZJD A;  2JRH A;  3SU8 X;  3TIX A;  4K7U A;  4JQW C;  2KO3 A;  2LJ5 A;  4ANW A;  2KNB A;  3TCA A;  2L05 A;  2N7D A;  2GBM A;  3DBL I;  1L2N A;  1FXT B;  2BPS A;  3L0W B;  3A9K B;  2JRI B;  4PS8 A;  3V61 A;  1WX9 A;  2EKE C;  1WXS A;  3EHV A;  3MHS D;  4MJS B;  3QJZ A;  3WAO A;  2OOB B;  4HPL B;  4BKT A;  4E71 A;  3VAW A;  3AI5 A;  3QCA A;  2O6V D;  2MWS B;  2XK5 A;  3DBS A;  1TTN A;  4FHK A;  4IWQ A;  1BT0 A;  3OJ3 A;  2NVU I;  2YLM A;  4ZRJ A;  1WM3 A;  2MBO A;  4MH0 E;  3M95 A;  4TQ0 A;  1WR1 A;  1E7V A;  3A1Q A;  2KQ7 A;  5DPS A;  3DPD A;  2MQJ A;  3UF8 A;  2JZZ A;  2JWZ A;  2KMC A;  2O2V A;  3QIJ A;  5LXI B;  2K6Q A;  2LGD A;  5D94 A;  2LAS A;  3Q3F A;  4IM2 A;  2JPH A;  3KH0 A;  2LWP A;  4LJP B;  3EC8 A;  1Z5S B;  2KZR A;  4IWO A;  5CHV C;  2Z59 B;  3ZNZ B;  4GDK B;  1WX8 A;  2C60 A;  4BFR A;  2IY0 B;  2HTH A;  3ZUN A;  1H8C A;  2ZCB A;  4WJP A;  1LFD A;  5G55 A;  3PRZ A;  4GB9 A;  2K6D B;  2IO2 B;  2KLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...