1X1MA

Solution structure of the n-terminal ubiquitin-like domain in mouse ubiquitin-like protein sb132
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GSSGSSGMSLSDWHLAVKLADQPLAPKSILQLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SB132
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Mouse Ubiquitin-like Protein SB132
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1x1mA00
3X0WA 4B6WA 3VH3B 4AUQC 4ZRKA 4ANXA 3C0RB 2KDEB 3RZWC 2M1MA 5FR6A 3K9PB 2KQSA 2DYMA 4LDTB 1P98A 3QIJA 3ZKJC 4JL9A 1YX5B 3GZNI 1OQYA 2V3SA 3HK0A 5L83A 3IVFA 1E90A 2IO1B 4P7IA 3HM3A 4DBGA 1GG3A 2EKEC 1Q1OA 3PPAA 4NPNA 1WH3A 1YD8U 4E71A 1WF9A 1NBFC 1WGDA 2N7DA 1WXAA 1GC7A 4NJ6A 5AZFA 2G45B 3R7QA 2KKCA 2MW5A 2JPHA 4NQKE 2FCMA 2LGXA 4DXAB 1K8RB 5JH5C 3ALBA 3V62A 3APCA 3PRPB 2JY6A 2CKHB 3DVGY 4GN1A 4FHKA 2CHXA 4A3OA 3K9OB 3U7DA 1IYFA 2HTHA 3HM6X 5J17A 1IP9A 2JZZA 2LVOA 1KJTA 2C5LC 3RZFA 2K6QA 2MSED 3RD2A 5HKHA 1LFDA 2KN5A 1OTRB 3PZDA 4BOSC 2D3GA 2ZCCA 4GDLA 2DYBA 4M0WB 1WYWB 3QARA 5IA7A 2N1VA 1X1MA 2O6VA 4FHJA 4GB9A 3ZTDA 3AI5A 2MCNB 4EEWA 1E8XA 5TR5A 3HHMA 1WJNA 1XQQA 3ONSA 4K81A 3KVFB 1AARA 2L8JA 5IAAC 4XX5A 3JSVA 4GDLB 4PS8A 3RULA 4FULA 1WXVA 3V6EB 2GBJA 3H7PA 5CHFA 2BF8B 4MGZE 1PQSA 4LCDE 2O6VB 3TCAA 5JZEB 4K7WA 2N7EA 2KLGA 2D07B 4E74A 3JYUA 2K8CA 3SD5A 1GNUA 2Y5BB 1SE9A 4IWPA 4AP4C 3TL5A 1YX6B 3QC8B 3VQIA 4BBNC 1WXMA 4XC2A 4HXDA 4GIVA 4AWJA 1J19A 1J0GA 1RFAA 3JSVB 1BT0A 4HCPB 5L95C 4DWFA 4W9HA 4EZKA 4GGQA 3MJWA 3PLUA 3CF6E 4YL8A 2N9PC 2NVUI 3H7PB 2I1JA 3DDCB 3DBRI 4BKSD 3IG3A 2LXCA 3M3JA 4TUUA 2NBVB 1QZEA 4II3B 2CHZA 1LM8B 3VTUA 2MBEA 4ANVA 5D7GA 2KNBA 1G6JA 4NY0A 2KJHB 3UIOB 3QAQA 2LUEA 4GSWA 3X23A 1WX8A 2IO3B 4ZRIA 2RPQA 3L08A 3ZNID 4HVBA 5JHAA 4IUMB 2LI5A 4GOCA 2JUOA 2BKFA 2MQJA 1FXTB 1V5OA 3DCGA 3L54A 2AYOB 4GXBA 2ZNVC 2RR9A 3OLMD 4BKTA 4FJVB 1RAXA 1WX9A 1L2NA 2M4NA 3SU8X 2NPTA 1JRUA 3PRMB 3AULA 4KVGB 2KD0A 2NBUA 4HLEA 3KUCB 4MDKE 4FLHA 4WWNA 1I35A 2EMSA 2MA9B 3JW0X 4PS7A 2BKRB 2K1FA 2ASQA 3A9KA 4X57B 1UD7A 5D94A 2MP2A 2YLMA 2B3AA 2FAZA 3DOWA 2BYFA 3DBLI 3PT2B 2CS4A 4BBNF 2JF5A 3QHTA 5E6PA 3WIMA 2R2QA 1U4AA 2KMAA 2KDBA 4WAAA 2D2QA 4HK2A 3AU5A 4DDID 1WM3A 1V80A 2NPTB 4MSQB 4ASWC 3ZNHB 4WWPA 5KHOA 2LJ5A 2C9WB 2ZJDA 3ECIA 5CX3A 1WY8A 3U30A 3VAWA 3WA0A 4CO7A 5CTRC 3ZLZA 2KXJA 2KDIA 4EOYA 3A9KB 2JT4B 4MSMB 3PLVA 4EFOA 2IO0B 1WJUA 3Q3FA 2MP2B 1VCBA 1V5TA 4ANUA 3B0AA 2L7RA 4ANWA 2AWTA 3HIZA 4TKNA 5DCNA 1LXDA 1Z5SB 2DAFA 4G50A 3SHQA 3N3KB 3JVZX 2G4SA 2ZEQA 3IHPC 4MGYE 3B08A 4NAWA 3QWZB 4J6IA 2W9NA 4N9F4 1YJ1A 4DHJD 2HJ8A 4CYEA 3L10B 3KW5B 2C7MB 3DVNV 5J18A 2AEHA 2KO3A 1WX7A 3R3MA 4FN2A 1WGYA 3WANA 4BVUC 4FA6A 2HE7A 2Z59B 3B1LX 3N32A 1L7YA 4NQLB 2BGFA 4TV3A 1EF1A 3EECA 3UINB 2LVQA 4II2B 3EHVA 4PS3A 1WMHA 3GOEA 3QJZA 4FJYA 2L0FA 3ZNZB 2WDTB 2XK5A 4K7SA 1WI0A 4K1RB 4NAWB 1V49A 2FNJB 1KLVA 1V6EA 2RGFA 3R66C 2KWCA 2FCQA 1E8YA 4JIOU 4E3CA 4HWIB 5LLIA 4ICUA 3APDA 2KLCA 2N9XA 3RT3B 1GUAB 3ML8A 2LWPA 3A33B 2UYZB 4BFRA 2LXAA 5D6JB 4ZRJA 4HPMB 1TTNA 4WJQA 2Z0EB 4B95A 1LQBA 4I6PA 5DPRA 1ZW7A 5C23A 3TJPA 4KDIC 4W9EA 2DENB 4TQ1A 4MEMA 2K6DB 1V81A 2C60A 2IYDB 3V60A 3ZTCA 5BO4B 1V2YA 3ZIMA 4KZCA 1WMHB 2L00B 2MBQA 3PHWB 3KYDD 4FADA 4KIKA 1WGHA 2XK5B 1YIWA 1NI2A 3O65B 3OJ3A 2A5UA 1WIAA 2FCNA 4GDKA 4EZJA 5LXIB 3ZRCA 2UWQA 1H8CA 2K8BA 2KC2A 3UGBB 4RMAA 1NDDA 4IM0A 3RCZA 1WXSA 3ZRFA 5G2NA 2WX0A 2KFKB 1UELA 1YQBA 3EFUA 2GOWA 2NCNA 2J0KA 3N30A 3T9LA 2FUHB 1OEYJ 4AJWA 3BY4B 4M8NA 2RSUA 4AOFA 3MTNB 3VUXA 5EDSA 3I3TB 1ZKHA 3OAWA 4KIKB 3RYTA 3S2AA 3M62B 2ZCBA 2KTFA 4GMVA 3CSTA 4GDKB 4KSKC 2REXA 4EZLA 4IM3A 3QA8A 1OGWA 3WAMA 1V86A 1Q5WB 1WGGA 2ZNVB 5GMVA 3ZDMC 1M94A 2K25A 3SDLC 3MHSD 4K7UA 2N4FA 2IBIB 2M0XA 5DPTA 2ZPYA 1H4RA 2O6VD 4W9KA 2K8HA 2NS5A 3A4SC 3TIXA 3AU4A 5LXHA 3A1QA 5DPWA 2YVCA 1TBEA 1GC6A 1P9DU 2BWFA 4WQOB 2PJHA 1UZXB 2MBOA 4PYZA 1TZ1A 2LRWA 3IBEA 3PRZA 1I42A 3WALA 1TGZB 2KMCA 5JHBA 4W9IA 3ZW3A 3ZO5B 1EUVB 3NY5A 4KDLB 4A20A 3M95A 2RD0A 4NJ7A 3H1UA 2R2OA 4MGIE 4OVVA 1V9JA 4IWOA 3V61A 5D2MB 2DYOA 3VTVA 4AJYB 4IWQA 1XT9B 2DZMA 3PGEA 3VUWA 4DDGD 4EKUA 3NHEB 2V1YA 2ZPNA 2KWVB 3A1QB 3ML9A 5E6OA 4DHJB 4EUTA 2WYQA 3L16A 2QHOA 4XZ4A 1WR1A 1C1YB 4MJSA 1R4MI 1OEYA 3H6NA 4W9CA 1Z2MA 1WM2A 4WJPA 2MLBA 2LRUA 4HJKA 3LJ3A 5CHVC 3IFWB 3PREA 3NZSA 5AEKB 1F9JA 3ZNGC 1GJZA 3PHXB 2DZIA 4JQWC 2V4LA 2M8SA 3QK0A 2XEWA 3CSFA 1R4NI 5KHQA 2CHWA 2L3ZA 2ZZPB 2J0JA 2OJRA 4IG7B 2KX3A 1SIFA 5CHWA 4KZ0A 5C1ZA 2JZ3B 4PYUA 1UH6A 2L0TA 3UIPB 2PPHA 2PE6B 3ZUNA 2PE9A 3KUDB 4BKGA 2LGYA 4LJPB 2LGDA 5E6NA 3CMMB 1WZ3A 2LD9A 4HDQA 4F7ZA 4MJSB 2KZRA 4BOZB 4HPLB 1UBQA 1RLFA 3VVWB 3W1SC 1E5WA 3DBHI 2BWES 2MWSB 4FBJB 2G3QB 4LDTD 4BKSA 4G3XB 3WAOA 1E8ZA 1KM7A 2C7HA 2CR5A 3NS8A 4IM2A 1ISNA 3PTFC 1WE7A 2KHWB 2KJ6A 3LDZE 3ZVVA 1D3ZA 3A9JA 2FCSA 4NNJB 2KC1A 3H7SA 4G11A 1C3TA 1SGHA 2DHZA 4HCNB 1XD3B 4RM9A 2MRPA 3VUYA 1Y8RC 2DZKA 2EMTA 2KFKA 3A4RA 3BINA 2LZ6A 1Q0WB 2N9EB 4W9GA 1UGMA 3RUIB 2FIFA 1CMXB 1VD2A 2KOXA 2JRIB 3VHTC 1S1QB 2ZVNA 1EO6A 2BYVE 3U8ZA 2D11A 2A4ZA 4KV2A 3QQ8B 3QX1A 2MX2A 4URKA 2DX5B 3UQBA 5J2RA 1EF5A 2BYEA 4KSLC 2KWUB 2HD5B 2M17A 5DPSA 4DK5A 4W9DA 4OVUA 3A9JB 2OOBB 3EC8A 3DQVA 4W9FA 2XBBC 2WX1A 1P3QU 1P0RA 2GBMA 2KTRA 1HE8A 2O2VA 2NBWB 3Q3JA 4W9LA 5AZGA 3TBLD 2K39A 3VFKA 1WJ4A 3TMPB 3OJ4B 2Z0DB 4HDOA 4DHZB 2FIDA 3R7RA 1S3SG 4IW0A 2J0MA 4WJOA 2KK8A 1E8WA 2LASA 3NZUA 2GMIC 3QCAA 4IC7B 3VXWA 3KYCD 1E7UA 3DVGX 3PSEB 2BPSA 2AL6A 2JVCA 3ENEA 2KVRA 3ZDTA 1J8CA 2KJRA 3L17A 3T8MA 1WR6E 5G55A 2CU1A 2N1WA 3L13A 2KTRB 2C7NB 2KX0A 2O2VB 2KFJA 4G0NB 1A5RA 1WFYA 3L0WB 4B9KA 1UBIA 2IY1B 4DHZE 4MGKE 4A3PA 2D10A 2GBKA 3PV1A 4ZDVA 4TQ0A 2MBBB 3DVNU 2DZJA 1WJ6A 2KQ7A 4FJZA 4W9JA 2WWZA 3APFA 2NR2A 4WJNA 2KANA 4ZYNA 4F1SA 3H9DA 3PVLA 1IPGA 4LJOB 4F8CB 1WZ0A 1RRBA 2VRRB 1WE6A 3WAPA 4CHKA 3NOBA 2JRHA 4M8MA 4JGHB 1P1AA 3P2BA 1E7VA 1MG8A 2IY0B 2J7QB 4GU2A 4ICVA 3KH0A 4I6NB 3VH4B 2LVPA 3D32A 4JLCA 2IO2B 4I6LB 1KOTA 3W1YA 3PS6A 4MELA 2DAJA 2I1KA 4WWOA 2G4DB 3VDZA 4MM3A 3KUZA 2JWZA 2L76A 2GBRA 5AZHA 1ZGUB 1WGRA 2GBNA 2IZVB 2JXXA 3DPDA 3UQAA 2PEAA 4RM8A 4MH0E 2ZVOA 2KDFB 2MBHA 3W1SA 3M63B 2L05A 1WRDB 3UF8A 2AL3A 1T0YA 3V6CB 3VTWA 3DBSA 3AXCA
chains in the Genus database with same CATH superfamily
4B6WA 3RZWC 3RI7C 3AH7A 1YN4A 3K9PB 2KQSA 3QIJA 2WXJA 4KKJA 2IO1B 3E9SA 4DBGA 1GG3A 1Q1OA 3AE6B 3PZ8A 1WGDA 2KKCA 5JH5C 4NQKE 2FCMA 3MP9A 3ALBA 3V62A 2JY6A 2CKHB 1ZOYB 4A3OA 3U7DA 5J17A 2C5LC 1F52A 1PDXA 4NAMA 3BYTB 2L1AA 3Q2AC 3IXSA 1L4ZB 4M0WB 1WYWB 3ZTDA 1FIQA 5BMIA 2Q5WD 2MCNB 4EEWA 3ZGZA 1E6EB 3ONSA 1AARA 4RFBA 2BS2B 1FM0D 3JSVA 4RGNA 4PS8A 4NZLB 1PFDA 2GBJA 1TT5B 2BF8B 4MGZE 4LK0M 3ABVB 2KQ4X 3TCAA 5G5GA 4E74A 3JYUA 2I2YA 2KYWA 4XWWA 1WXMA 4XC2A 4HXDA 5L95C 3TEWA 4GGQA 3MJWA 2J4XA 2ICIA 2K5PA 3IG3A 2LXCA 4REZA 4J3OD 1FEHA 2M0AA 5D7GA 2WHIA 4NY0A 2KJHB 2RMMA 1TS5A 1WX8A 3ZNID 1T0SC 3L54A 2D3CA 2LHDA 1L2NA 4YTNB 2IGGA 5H92C 2M4NA 3NS1A 3B2FA 3PO0A 4WWNA 3A9KA 4X57B 3AEEB 2YLMA 2BYFA 3PT2B 2CS4A 5E6PA 1JWAD 3WIMA 2KDBA 1D6EC 3AU5A 1V1PB 5KHOA 3URYA 5CX3A 2J53A 1V1OA 2KXJA 2PVOD 2JWUA 2JT4B 4EFOA 1NI3A 3Q3FA 4ANUA 3OWEB 4ANWA 2AWTA 2L52A 3HIZA 3N3KB 2V3PA 2G4SA 3B08A 4JE3B 4YXDB 3AE9B 3VRBB 1YJ1A 2HJ8A 3DVNV 5FK9C 2FUG1 1WGYA 2HE7A 1F0ZA 3N32A 4NQLB 4TV3A 1SJHD 1F1HA 4BZAA 4PS3A 5BYRA 4H2AA 3ZNZB 3SFDB 5HI1A 4K1RB 1KLVA 2FNJB 3R66C 4S0RA 5BMGA 1J7BA 2YEPF 2KLCA 2N9XA 1I4PA 2Z0EB 5IKCM 4B95A 5LNK1 1JQ4A 1N5WA 5DPRA 3RNBC 4TQ1A 4MEMA 2C60A 4L23A 5BO4B 1V2YA 2LUMA 3KYDD 5FR3A 4HEA1 4FADA 2HTME 4GDKA 2KC2A 2JYTA 3CIRB 2WU5B 1MI0A 1DOYA 2W82A 4JWSC 4KKIA 3TEXA 1NVID 4S17A 1ENFA 2Y3AA 1KTKA 1OQQA 4OHJA 4M8NA 2K22A 1JRPA 3MTNB 3I3TB 3OAWA 3RYTA 2ZCBA 3CSTA 1L0VB 4KSKC 4L2YA 1PGAA 1V86A 5GMVA 3LXFA 1M94A 3EA6A 1FO4A 4ZHPA 2N4FA 2KMMA 2M0XA 1FPYA 1TS2A 4IDIA 5LXHA 4ITKA 1FRDA 1HXYD 1TBEA 1GC6A 1P9DU 1UWXA 4WURA 3Q3MC 5HFYA 2LRWA 1I42A 1YNTE 2Z8LA 1HA5A 1D4BA 3AEBB 1V9JA 5D2MB 4IWQA 3VUWA 4LNNA 2V1YA 2ZPNA 2KWVB 3ML9A 1TJEA 1ZPSA 4MJSA 1Z2MA 1I4GA 4XDCA 4OVZA 4HJKA 2KWDA 3FAHA 3IFWB 1F9JA 4FXCA 2AX5A 2XEWA 3CSFA 4M01A 1SE4A 1R4NB 2OJRA 2KX3A 1PUTA 4PYUA 1UH6A 4LNOA 2PE6B 4UDUC 2VZKB 2LGYA 2LGDA 2BW2A 5E6NA 4ZRQA 5AUKA 4BOZB 1FFVA 1RLFA 2BWES 2KAJA 3N1YC 4FBJB 1C9FA 4BKSA 2CR5A 4OZBA 1WE7A 2KHWB 3ZVVA 2KDMA 4NNJB 3H7SA 1QLBB 4JX1C 4RM9A 2MRPA 3VUYA 1Y8RC 2QJLA 2EMTA 3BINA 4W9GA 2N9EB 3RUIB 3AE1B 2BYVE 2MX2A 2PTLA 2MJDA 1FFUA 2M17A 3A9JB 3I9V1 3IT6B 2QC8A 1F77A 2OOBB 2XBBC 1P3QU 1P0RA 2GBMA 1HE8A 3Q3JA 3VFKA 3OJ4B 4DHZB 3R7RA 1C77A 2KK8A 4M02A 3QCAA 3RN9C 1E7UA 1YJJA 2FE8A 2AL6A 3ZDTA 2RDBC 2N1WA 3L13A 2O2VB 2KX0A 4G0NB 2KFJA 3DWGC 1N61A 3L0WB 3V3XA 3MC8A 1UBIA 4R3DA 4DHZE 4ZDVA 1HTOA 2INPE 2OJWA 1WJ6A 4W9JA 4WJNA 3GS2A 1IPGA 1WZ0A 3V05A 3WAPA 2JRHA 3I63C 1E7VA 4I6NB 2KT7A 4JLCA 2IO2B 4I6LB 1KOTA 4MELA 4WWOA 2DAJA 3VDZA 4MM3A 5AZHA 1WGRA 2IZVB 1JCKB 1TYGB 3TEZA 4NJCA 1LGRA 2PEAA 3AN1A 4MH0E 3BIID 3M63B 1WRDB 3O13A 4YT0B 3X0WA 3VH3B 4AUQC 1PGXA 4ZRKA 4ANXA 2KDEB 1NYRA 2DNFA 1B1ZA 1XEEA 4JPSA 3ZKJC 1YX5B 1V8CA 1VR9A 3HK0A 4LNKA 4P7IA 1FRRA 1QF6A 2EKEC 1BXTA 1WH3A 1NYQA 4E71A 1NBFC 2LEKA 5HG2A 1TZOA 2D3BA 1GC7A 4NJ6A 4DXAB 1K8RB 1VDVA 3APCA 1GOZA 3DVGY 2AQ2B 1K50A 3K9OB 1N60A 2JZZA 3AEDB 1KJTA 5D3DA 2MJEA 1E10A 2K6QA 1ZUD2 5HKHA 4DXFA 2KN5A 1OTRB 2GI9A 2ZCCA 4WAFA 5HHDG 1ROEA 1FCLA 2DYBA 2W3RA 1AW7A 2O6VA 4FHJA 4GB9A 1HEZE 1TIFA 2WXHA 3AMZA 2WXLA 2VZKD 4B0MA 4XWTA 2QCZA 1UGJA 3H7PA 2ONQA 2X38A 3BZDB 2ACZB 1VLBA 2WXKA 5JZEB 1L0YB 3L4PA 1GNUA 2Y5BB 4IWPA 2INNE 1BMLC 3TL5A 1YX6B 2JX5A 3ZJUA 4A55A 4AWJA 4C4VB 3JSVB 1L4DB 3R8BA 4DWFA 3CF6E 2NVUI 3DDCB 3TEYA 1QZEA 1LM8B 2IDYA 4TMAB 1G6JA 1QQRA 3QAQA 2LUEA 3X23A 2RPQA 2JUOA 3J9CA 2BKFA 2MQJA 2SEBD 4YSZB 3Q8CA 2BB6A 2AYOB 4GXBA 4A90A 2D5GA 3BWUD 4YSYB 2I38A 5EE3A 3RNEC 1RAXA 2NPTA 4OZCA 3PRMB 4KVGB 4HLEA 2BKRB 1HTQA 2ASQA 2NMQA 3KLSX 3QHTA 1MFWA 2BYTA 1RYJA 3BVGA 1ZP0B 1J7CA 1KFYB 2ZJDA 1WY8A 3WA0A 3VAWA 4CO7A 3ZLZA 4ZYSA 1CK1A 2QSDA 4EOYA 3A9KB 2IO0B 1WJUA 1VCBA 3AE7B 3BVZA 4IOIE 4A9AA 3SHQA 1OQRA 2ZEQA 3IHPC 4J6IA 2JZPA 3KW5B 2X8XX 5J18A 4WQMA 2AEHA 3WANA 1WX7A 2HDEA 4BVUC 1VRAB 4AQ7A 2BGFA 3R2IA 1N5XA 3UINB 2LVQA 1VZ6A 1WMHA 2BBCA 2GLSA 3QJZA 2L0FA 2XK5A 1QOGA 1WI0A 1V49A 4RNAA 3ZJVA 2FCQA 1E8YA 2WXRA 4JIOU 4HWIB 4E3CA 4ZHOA 4ICUA 2BS4B 1GUAB 2WXOA 3A33B 1J7AA 2UYZB 3ML8A 2LXAA 4BFRA 4C4VA 4ZRJA 4HPMB 4WJQA 4N59A 4KDIC 4W9EA 3ZXRA 1C76A 4RGMA 3ZTCA 2IYDB 2WXPA 1E0ZA 2QIEB 1R7SA 1WGHA 1NI2A 3OJ3A 4EZJA 1H8CA 2PLPA 4IM0A 3RCZA 5G2NA 1YQBA 3EFUA 2GOWA 2NCNA 3N30A 3NG0A 1JWBD 1EM7A 4XGAB 3AE3B 4AOFA 5EDSA 3NUHB 2N0SB 5I4DA 4GDKB 4IM3A 1EWCA 1OGWA 1XLOA 3TUOA 2RDGA 2K25A 1LO5D 2W55A 3SDLC 3AE4B 3MHSD 1SJED 2IBIB 5DPTA 2NS5A 3BK1A 3KQ4A 1EU4A 1P7FA 2H88B 1UZXB 2PVGC 3WALA 2MEKA 2G9HD 5JHBA 2V3NA 3ZO5B 4A20A 5E6JA 3H1UA 2R2OA 4OVVA 4IWOA 1YN3A 4AJYB 2WXQA 1XT9B 3NHEB 5E6OA 4DHJB 3MC9A 1AN8A 2QHOA 4XZ4A 3P1MA 1R4MI 3AM9A 5AUIA 4WJPA 2MLBA 2WU2B 2KACA 3PREA 2V4LA 2M8SA 3QK0A 5KHQA 1R4NI 2CHWA 1TKEA 3ZUNA 1WWTA 2LD9A 4HDQA 1CZPA 4JWUC 4MJSB 1M4VA 3AE5B 4G3XB 4IM2A 3PTFC 3FILA 1C78A 1SGHA 3GE8C 3A4RA 1UGMA 2EELA 1V97A 4HRSA 5EE1A 4B0EA 1S1QB 3C19A 3HUIA 1EO6A 2D11A 3AEAB 1RFKA 1T6BX 2BYEA 4KSLC 2KWUB 4DK5A 4W9DA 1CQVA 3W9CB 3DQVA 2KTRA 1UNSA 4W9LA 3AEGB 2K39A 2LGSA 3TMPB 3W5UB 3Q3NC 4C7YA 1QKZA 4K3CA 2FIDA 1S3SG 2NTSA 2LASA 2WDQB 4P6VF 3DVGX 2BPSA 2JVCA 1J8CA 2M19A 1WYGA 3Q8AA 1XLQA 4A3PA 1YMHE 3VR8B 2MBBB 2KQ7A 4FJZA 4F1SA 3H9DA 4LJOB 3MFGA 2JSVX 4CHKA 4M8MA 4JGHB 1MG8A 2J7QB 4GU2A 4ICVA 3FKYA 2LVPA 5IO9A 1L6VA 2I1KA 3KUZA 2JWZA 2L76A 1ZDXA 1ZGUB 2GBNA 1VZ7A 2WNMA 3DPDA 1XCQL 1N63A 3U52E 2ZVOA 2KDFB 3UF8A 1T0YA 1C4AA 1N6ZA 3AXCA 1R4MB 1MPEA 2M1MA 5FR6A 4RF0A 1D5ZC 4LDTB 1FCCC 2WQYB 1EU3A 2OEDA 4MM3B 3IVFA 3GZNB 3HM3A 1YQ3B 3PPAA 3NVWA 1YD8U 1WF9A 1K51A 4HJGE 1WXAA 3R7QA 2G45B 2DBYA 2JYEA 2OHFA 3ZQ4A 2MW5A 5IOIA 2LGXA 1YOVB 3I57A 4FHKA 3AEFB 2CHXA 1IYFA 1IGCA 2HTHA 3T3NA 1LFDA 3PZDA 2D3GA 4GDLA 1SBBB 1IGDA 3Q8BA 5IA7A 2N1VA 3AI5A 1TKYA 3RNCC 1E8XA 5TR5A 2K3UA 3KVFB 1EWYC 4K3BA 1QOAA 4WIPA 3T3OA 1ZE3D 3KWVA 3RULA 3BYYB 3V6EB 5CHFA 1PYWD 2O6VB 4K7WA 1XCTL 1SE9A 3VQIA 4BBNC 1VZ8A 4ZOHC 3SR6A 2LJIA 1J19A 4YTPB 1J0GA 1RFAA 4XYCA 4HCPB 3BK2A 3AE8B 3Q6BA 4W9HA 4EZKA 4XE0A 4YL8A 2N9PC 3H7PB 3DBRI 4BKSD 3M3JA 2NBVB 3VTUA 1KLUD 4ANVA 3AE2B 3UIOB 4GSWA 5JHAA 1ACCA 3L08A 1YN5A 2L83A 2LI5A 4D2KA 2QEJC 3Q69A 4KGTA 3Q8EA 2J52A 3OLMD 1WX9A 3AULA 2KD0A 2NBUA 4MDKE 1I35A 1FNWA 2EMSA 3JW0X 2WLBA 5BYSA 1UD7A 5D94A 2MP2A 3DOWA 4BBNF 3DBLB 2R2QA 3HRDD 2R61A 2KMAA 3C8YA 3SEBA 4ZRPA 4WAAA 1FXIA 2L32A 1WM3A 1WSPA 2N9LA 4PK1A 2NPTB 4MSQB 4ASWC 5MPOA 2VH2A 4XDDA 4WWPA 3W5VB 1C4CA 2BVCA 2WP9B 2WXNA 1IBXA 4P1BC 2PMVA 2V0GA 5DCNA 1LXDA 3CWIA 3GE3C 4G50A 3JVZX 4MGYE 1XO3A 4YSXB 4NAWA 3EGRA 2W9NA 5C2TB 1UWMA 1MVKA 3P4RB 1FNUA 4CYEA 2KO3A 1I4HA 2WXFA 1L7YA 2WXGA 4O1NA 2TSSA 3EECA 3ZJTA 3VRAB 3EHVA 5EE9A 4FJYA 2WDTB 4K7SA 1V6EA 2RGFA 2KWCA 2LWPA 1TTNA 4WH4A 3WCQA 4I6PA 4Q2JA 1V81A 1TY0A 2K6DB 3DHGC 1WMHB 3PHWB 2MBQA 1NEKB 1QOBA 3N9YC 3R2TA 4KIKA 2XK5B 4KGRA 2A5UA 2FCNA 3ZRCA 2UWQA 2K8BA 1NDDA 2KFKB 1GB4A 3T9LA 3P63A 2LMCA 2FUHB 4WWMA 3DBRB 2UU7A 4AJWA 1D5MC 4TSSA 4GMVA 2BS3B 2GRIA 3QA8A 1Q5WB 1WGGA 2V4IB 3EUB2 3H8HA 3KWLA 4K7UA 1WRIA 3MC0B 2ZPYA 1H4RA 2O6VD 4W9KA 3A4SC 3TIXA 5DPWA 3A1QA 3AV8A 2BWFA 2PJHA 2WDRB 1ZDVA 1TZ1A 1TGZB 4W9IA 3ZW3A 2IPKD 3M95A 2RD0A 5GXGB 2J42A 4MGIE 3V61A 2DYOA 3RPFC 2DZMA 3GP7A 3PGEA 4EKUA 1GPXA 4US8A 3P42A 1GAQB 4EUTA 3L16A 3NVZA 1C1YB 3RNGC 1T3QA 1RWSA 2D3AA 3H6NA 4W9CA 4ARIA 1WM2A 1C79A 3NZSA 5AEKB 4LTUA 3B9JA 3PHXB 2DZIA 3RMKC 1F2RI 1FD6A 2L3ZA 1E7PB 2ZZPB 2J0JA 4IG7B 5CHWA 1SIFA 4P1CC 4KZ0A 5C1ZA 1KLGD 2PE9A 4BKGA 1F2RC 4LJPB 3B2GA 1WZ3A 4F7ZA 2KZRA 3VVWB 2N7JA 2IGDA 3DBHB 4US9A 2G3QB 2Y5PA 3NS8A 2C7HA 1ISNA 2KN4A 2KJ6A 4LNFA 1ET9A 1D3ZA 2W54A 2DHZA 1XD3B 1TY2A 4DXGA 2DZKA 2KFKA 2LZ6A 2FIFA 1CMXB 1VD2A 2KOXA 4MT5A 1JW9D 3P4QB 2A4ZA 4KV2A 3QQ8B 3QX1A 4URKA 3UQBA 2LHEA 1K52A 4ARCA 4OVUA 1YQ4B 3FILB 4N6EB 2BTEA 2LGIA 4OW0A 4W9FA 5IAAC 2JQRB 2WX1A 3NZ3A 3TBLD 5AZGA 4HDOA 1YJIA 2G1EA 3GB1A 1IUEA 2JXTA 2J0MA 4IW0A 3AB5A 1E8WA 4IC7B 1I4XA 3VXWA 4YTMB 3KYCD 3PSEB 3ENEA 2KJRA 3MHZA 3N1ZC 4KGSA 5G55A 2CU1A 2KTRB 1DYQA 1JROA 3NRZA 3PV1A 4TQ0A 2W3SA 2DZJA 2QILA 3PVLA 3SFEB 4CQNA 1RRBA 5G5HA 1FXAA 1SB3C 3NOBA 4DQOC 1P1AA 3P2BA 1TKGA 1GB1A 2V9HA 3W1YA 3PS6A 2GB1A 2Y5CA 3U7ZA 5EE0A 2WDVB 1UUPA 2ZW0A 1MHXA 4HROA 2JXXA 3UQAA 4RM8A 3W1SA 2L05A 1SF0A 4HPPA 3VTWA 1JMLA 1XLNA 3C0RB 4LLGM 1VJKA 2DYMA 1P98A 1XLPA 1ZXHA 4JL9A 3PZ7A 3GZNI 1JWMD 1OQYA 2V3SA 5L83A 5T8IA 1E90A 1HQRD 4NPNA 1QOFA 3N1XC 1L5PA 2N7DA 5AZFA 2DLBA 1UF0A 2JPHA 4M0WA 3PRPB 4EE2A 5C3JB 4GN1A 1KF6B 1Q10A 3HM6X 1IP9A 1ET6A 2LVOA 1D5XC 3RZFA 3LYYA 2MSED 3RD2A 4C56C 4BOSC 1XF5L 2VH1A 3FC4A 3IT4B 3RFZB 4HKZE 3QARA 1X1MA 1SXTA 3HHMA 1WJNA 1TS4A 3NVVA 1XQQA 2K0PA 4K81A 3OG5A 1HZ5A 2L8JA 4XX5A 1MJDA 1N62A 4GDLB 5IN7A 4FULA 1WXVA 2CJNA 1PQSA 4LCDE 3DWMA 2N7EA 2KLGA 2D07B 2K8CA 3SD5A 4AP4C 4AS1A 3QC8B 4GIVA 1BT0A 1WXQA 1OFFA 4HKQA 3PLUA 4GLSC 2I1JA 4TUUA 3E56A 4II3B 2CHZA 3HVZA 3AECB 2MBEA 3N20C 2WXIA 1AWDA 2KNBA 2IO3B 4ZRIA 2WXMA 4HVBA 4IUMB 4GOCA 2RDHA 2WS3B 1FXTB 1V5OA 1SE2A 4RH6A 3DCGA 2ZNVC 2RR9A 2QDFA 4BKTA 4FJVB 1V1PA 3SU8X 1JRUA 2HJ1A 1T0QC 2AQ3B 1SSNA 3KUCB 1A70A 1QT9A 4FLHA 2MA9B 4PS7A 3I5JC 2K1FA 1MHHE 1SEBD 2B3AA 2FAZA 3DBLI 2YEPB 2JF5A 2QMTA 1U4AA 1DOIA 2D2QA 4HK2A 2MJ3A 4DDID 4ACFA 1V80A 4MH8A 2SAKA 3ZNHB 2LJ5A 2C9WB 2DWQA 3ECIA 3U30A 5CTRC 1L6UA 2KDIA 3Q8FA 4MSMB 3PLVA 1I7HA 3RNFC 2MP2B 1T0RC 1V5TA 2AQ1B 1L0XB 3B0AA 2L7RA 3ZYYX 4TKNA 1Z5SB 3ZXVA 2DAFA 1ZXIA 2CU3A 3QWZB 1B9RA 4N9F4 4DHJD 1KH0A 2INCC 3L10B 2C7MB 2N9KA 3R3MA 4FN2A 4FA6A 2Z59B 2BQQA 3B1LX 1STEA 5TSSA 1EF1A 1IBXB 4II2B 3GOEA 4MACA 2LFIA 4L1BA 2PKOA 4NAWB 3UI3A 5LLIA 2RPVA 3APDA 3RT3B 1AYFA 5D6JB 3W2DA 1LQBA 1P7EA 1ZW7A 5C23A 3TJPA 5H8YE 3P4PB 2DENB 3V60A 3ZIMA 4KZCA 1CJEA 2L00B 1YIWA 3O65B 1WIAA 5LXIB 5FKAC 3P4SB 3UGBB 4RMAA 3BVMA 3ZRFA 1WXSA 2WX0A 4RGOS 4RGTA 1TS3A 3LB8C 5D3IB 1QILA 2KVZA 1UELA 2J0KA 2EKIA 1OEYJ 2IGHA 2PW9A 3BY4B 2RSUA 3VUXA 1ZKHA 4KIKB 3S2AA 3M62B 4YWGG 2KTFA 4EZLA 2REXA 3WAMA 4IKGA 2ZNVB 3ZDMC 1KRHA 2MH7A 2K8HA 5JXVA 3AU4A 1FNVA 3Q3OC 2YVCA 3EFCA 2ZW1A 4WQOB 2IJ0A 1WGKA 2MBOA 3IAM1 4PYZA 1SE3A 3IBEA 3PRZA 2JU6X 2KMCA 5BMHA 1JALA 3ETRA 1EUVB 3NY5A 2H89B 4KDLB 4NJ7A 2B76B 4KX6B 1T5XD 3VTVA 1I4QA 2BB5A 4DDGD 2WGSA 3A1QB 2WYQA 1WR1A 2M56B 1OEYA 1C4PA 2LRUA 3LJ3A 3MJ5A 2INDC 1I4RA 5CHVC 2ON8A 1GJZA 3ZNGC 4JQWC 3IAS1 2NTTA 4M00A 2JZ3B 2PIAA 4RF1A 3UIPB 2L0TA 2K9XA 2PPHA 4USAA 3KUDB 4N58A 3U4EG 4C7ZA 4QAYA 1SIJA 3CMMB 4HPLB 1UBQA 3NVYA 3W1SC 1E5WA 3DBHI 2MWSB 3DHIC 4C80A 4LDTD 2BT6A 3WAOA 1E8ZA 1KM7A 1ESFA 3LDZE 3A9JA 2FCSA 2KC1A 4G11A 1C3TA 1JWSD 4HCNB 4A8XC 1FMAD 5IP4D 1Q0WB 2JRIB 3NJTA 3VHTC 1HZ6A 2ZVNA 4OZAA 3U8ZA 2DX5B 5J2RA 1EF5A 2HD5B 5DPSA 2CJOA 3EC8A 3TSSA 4P16A 2O2VA 2NBWB 1PGBA 1WJ4A 3Q14C 2Z0DB 2XN9C 1XXGA 2E6XA 4WJOA 3NZUA 2GMIC 1BUIC 2KVRA 4PT5A 3L17A 1NENB 2MHJA 3T8MA 1WR6E 1JWUD 4A6QA 2C7NB 1A5RA 1WFYA 4BAXA 4B9KA 2IY1B 4MGKE 2D10A 2GBKA 3DVNU 1K53A 1DOXA 2WWZA 3APFA 2NR2A 4ZYNA 2KANA 4F8CB 1RM6C 2VRRB 3U2SC 1WE6A 4RCOA 2XNAC 2IY0B 3KH0A 1E9MA 3VH4B 3VR9B 1MG4A 3D32A 4LNIA 4C00A 2G4DB 1Y56A 2GBRA 5BYQA 3DHHC 3RNAC 2E3TA 2MBHA 1DGJA 2AL3A 3HVDA 3V6CB 3DBSA 2FBWB
chains in the Genus database with same CATH topology
3X0WA 4B6WA 3VH3B 4AUQC 4ZRKA 4ANXA 3C0RB 2KDEB 3RZWC 2M1MA 5FR6A 3K9PB 2KQSA 2DYMA 4LDTB 1P98A 3QIJA 3ZKJC 4JL9A 1YX5B 3GZNI 1OQYA 2V3SA 3HK0A 5L83A 3IVFA 1E90A 2IO1B 4P7IA 3HM3A 4DBGA 1GG3A 2EKEC 1Q1OA 3PPAA 4NPNA 1WH3A 1YD8U 4E71A 1WF9A 1NBFC 1WGDA 2N7DA 1WXAA 1GC7A 4NJ6A 5AZFA 2G45B 3R7QA 2KKCA 2MW5A 2JPHA 4NQKE 2FCMA 2LGXA 4DXAB 1K8RB 5JH5C 3ALBA 3V62A 3APCA 3PRPB 2JY6A 2CKHB 3DVGY 4GN1A 4FHKA 2CHXA 4A3OA 3K9OB 3U7DA 1IYFA 2HTHA 3HM6X 5J17A 1IP9A 2JZZA 2LVOA 1KJTA 2C5LC 3RZFA 2K6QA 2MSED 3RD2A 5HKHA 1LFDA 2KN5A 1OTRB 3PZDA 4BOSC 2D3GA 2ZCCA 4GDLA 2DYBA 4M0WB 1WYWB 3QARA 5IA7A 2N1VA 1X1MA 2O6VA 4FHJA 4GB9A 3ZTDA 3AI5A 2MCNB 4EEWA 1E8XA 5TR5A 3HHMA 1WJNA 1XQQA 3ONSA 4K81A 3KVFB 1AARA 2L8JA 5IAAC 4XX5A 3JSVA 4GDLB 4PS8A 3RULA 4FULA 1WXVA 3V6EB 2GBJA 3H7PA 5CHFA 2BF8B 4MGZE 1PQSA 4LCDE 2O6VB 3TCAA 5JZEB 4K7WA 2N7EA 2KLGA 2D07B 4E74A 3JYUA 2K8CA 3SD5A 1GNUA 2Y5BB 1SE9A 4IWPA 4AP4C 3TL5A 1YX6B 3QC8B 3VQIA 4BBNC 1WXMA 4XC2A 4HXDA 4GIVA 4AWJA 1J19A 1J0GA 1RFAA 3JSVB 1BT0A 4HCPB 5L95C 4DWFA 4W9HA 4EZKA 4GGQA 3MJWA 3PLUA 3CF6E 4YL8A 2N9PC 2NVUI 3H7PB 2I1JA 3DDCB 3DBRI 4BKSD 3IG3A 2LXCA 3M3JA 4TUUA 2NBVB 1QZEA 4II3B 2CHZA 1LM8B 3VTUA 2MBEA 4ANVA 5D7GA 2KNBA 1G6JA 4NY0A 2KJHB 3UIOB 3QAQA 2LUEA 4GSWA 3X23A 1WX8A 2IO3B 4ZRIA 2RPQA 3L08A 3ZNID 4HVBA 5JHAA 4IUMB 2LI5A 4GOCA 2JUOA 2BKFA 2MQJA 1FXTB 1V5OA 3DCGA 3L54A 2AYOB 4GXBA 2ZNVC 2RR9A 3OLMD 4BKTA 4FJVB 1RAXA 1WX9A 1L2NA 2M4NA 3SU8X 2NPTA 1JRUA 3PRMB 3AULA 4KVGB 2KD0A 2NBUA 4HLEA 3KUCB 4MDKE 4FLHA 4WWNA 1I35A 2EMSA 2MA9B 3JW0X 4PS7A 2BKRB 2K1FA 2ASQA 3A9KA 4X57B 1UD7A 5D94A 2MP2A 2YLMA 2B3AA 2FAZA 3DOWA 2BYFA 3DBLI 3PT2B 2CS4A 4BBNF 2JF5A 3QHTA 5E6PA 3WIMA 2R2QA 1U4AA 2KMAA 2KDBA 4WAAA 2D2QA 4HK2A 3AU5A 4DDID 1WM3A 1V80A 2NPTB 4MSQB 4ASWC 3ZNHB 4WWPA 5KHOA 2LJ5A 2C9WB 2ZJDA 3ECIA 5CX3A 1WY8A 3U30A 3VAWA 3WA0A 4CO7A 5CTRC 3ZLZA 2KXJA 2KDIA 4EOYA 3A9KB 2JT4B 4MSMB 3PLVA 4EFOA 2IO0B 1WJUA 3Q3FA 2MP2B 1VCBA 1V5TA 4ANUA 3B0AA 2L7RA 4ANWA 2AWTA 3HIZA 4TKNA 5DCNA 1LXDA 1Z5SB 2DAFA 4G50A 3SHQA 3N3KB 3JVZX 2G4SA 2ZEQA 3IHPC 4MGYE 3B08A 4NAWA 3QWZB 4J6IA 2W9NA 4N9F4 1YJ1A 4DHJD 2HJ8A 4CYEA 3L10B 3KW5B 2C7MB 3DVNV 5J18A 2AEHA 2KO3A 1WX7A 3R3MA 4FN2A 1WGYA 3WANA 4BVUC 4FA6A 2HE7A 2Z59B 3B1LX 3N32A 1L7YA 4NQLB 2BGFA 4TV3A 1EF1A 3EECA 3UINB 2LVQA 4II2B 3EHVA 4PS3A 1WMHA 3GOEA 3QJZA 4FJYA 2L0FA 3ZNZB 2WDTB 2XK5A 4K7SA 1WI0A 4K1RB 4NAWB 1V49A 2FNJB 1KLVA 1V6EA 2RGFA 3R66C 2KWCA 2FCQA 1E8YA 4JIOU 4E3CA 4HWIB 5LLIA 4ICUA 3APDA 2KLCA 2N9XA 3RT3B 1GUAB 3ML8A 2LWPA 3A33B 2UYZB 4BFRA 2LXAA 5D6JB 4ZRJA 4HPMB 1TTNA 4WJQA 2Z0EB 4B95A 1LQBA 4I6PA 5DPRA 1ZW7A 5C23A 3TJPA 4KDIC 4W9EA 2DENB 4TQ1A 4MEMA 2K6DB 1V81A 2C60A 2IYDB 3V60A 3ZTCA 5BO4B 1V2YA 3ZIMA 4KZCA 1WMHB 2L00B 2MBQA 3PHWB 3KYDD 4FADA 4KIKA 1WGHA 2XK5B 1YIWA 1NI2A 3O65B 3OJ3A 2A5UA 1WIAA 2FCNA 4GDKA 4EZJA 5LXIB 3ZRCA 2UWQA 1H8CA 2K8BA 2KC2A 3UGBB 4RMAA 1NDDA 4IM0A 3RCZA 1WXSA 3ZRFA 5G2NA 2WX0A 2KFKB 1UELA 1YQBA 3EFUA 2GOWA 2NCNA 2J0KA 3N30A 3T9LA 2FUHB 1OEYJ 4AJWA 3BY4B 4M8NA 2RSUA 4AOFA 3MTNB 3VUXA 5EDSA 3I3TB 1ZKHA 3OAWA 4KIKB 3RYTA 3S2AA 3M62B 2ZCBA 2KTFA 4GMVA 3CSTA 4GDKB 4KSKC 2REXA 4EZLA 4IM3A 3QA8A 1OGWA 3WAMA 1V86A 1Q5WB 1WGGA 2ZNVB 5GMVA 3ZDMC 1M94A 2K25A 3SDLC 3MHSD 4K7UA 2N4FA 2IBIB 2M0XA 5DPTA 2ZPYA 1H4RA 2O6VD 4W9KA 2K8HA 2NS5A 3A4SC 3TIXA 3AU4A 5LXHA 3A1QA 5DPWA 2YVCA 1TBEA 1GC6A 1P9DU 2BWFA 4WQOB 2PJHA 1UZXB 2MBOA 4PYZA 1TZ1A 2LRWA 3IBEA 3PRZA 1I42A 3WALA 1TGZB 2KMCA 5JHBA 4W9IA 3ZW3A 3ZO5B 1EUVB 3NY5A 4KDLB 4A20A 3M95A 2RD0A 4NJ7A 3H1UA 2R2OA 4MGIE 4OVVA 1V9JA 4IWOA 3V61A 5D2MB 2DYOA 3VTVA 4AJYB 4IWQA 1XT9B 2DZMA 3PGEA 3VUWA 4DDGD 4EKUA 3NHEB 2V1YA 2ZPNA 2KWVB 3A1QB 3ML9A 5E6OA 4DHJB 4EUTA 2WYQA 3L16A 2QHOA 4XZ4A 1WR1A 1C1YB 4MJSA 1R4MI 1OEYA 3H6NA 4W9CA 1Z2MA 1WM2A 4WJPA 2MLBA 2LRUA 4HJKA 3LJ3A 5CHVC 3IFWB 3PREA 3NZSA 5AEKB 1F9JA 3ZNGC 1GJZA 3PHXB 2DZIA 4JQWC 2V4LA 2M8SA 3QK0A 2XEWA 3CSFA 1R4NI 5KHQA 2CHWA 2L3ZA 2ZZPB 2J0JA 2OJRA 4IG7B 2KX3A 1SIFA 5CHWA 4KZ0A 5C1ZA 2JZ3B 4PYUA 1UH6A 2L0TA 3UIPB 2PPHA 2PE6B 3ZUNA 2PE9A 3KUDB 4BKGA 2LGYA 4LJPB 2LGDA 5E6NA 3CMMB 1WZ3A 2LD9A 4HDQA 4F7ZA 4MJSB 2KZRA 4BOZB 4HPLB 1UBQA 1RLFA 3VVWB 3W1SC 1E5WA 3DBHI 2BWES 2MWSB 4FBJB 2G3QB 4LDTD 4BKSA 4G3XB 3WAOA 1E8ZA 1KM7A 2C7HA 2CR5A 3NS8A 4IM2A 1ISNA 3PTFC 1WE7A 2KHWB 2KJ6A 3LDZE 3ZVVA 1D3ZA 3A9JA 2FCSA 4NNJB 2KC1A 3H7SA 4G11A 1C3TA 1SGHA 2DHZA 4HCNB 1XD3B 4RM9A 2MRPA 3VUYA 1Y8RC 2DZKA 2EMTA 2KFKA 3A4RA 3BINA 2LZ6A 1Q0WB 2N9EB 4W9GA 1UGMA 3RUIB 2FIFA 1CMXB 1VD2A 2KOXA 2JRIB 3VHTC 1S1QB 2ZVNA 1EO6A 2BYVE 3U8ZA 2D11A 2A4ZA 4KV2A 3QQ8B 3QX1A 2MX2A 4URKA 2DX5B 3UQBA 5J2RA 1EF5A 2BYEA 4KSLC 2KWUB 2HD5B 2M17A 5DPSA 4DK5A 4W9DA 4OVUA 3A9JB 2OOBB 3EC8A 3DQVA 4W9FA 2XBBC 2WX1A 1P3QU 1P0RA 2GBMA 2KTRA 1HE8A 2O2VA 2NBWB 3Q3JA 4W9LA 5AZGA 3TBLD 2K39A 3VFKA 1WJ4A 3TMPB 3OJ4B 2Z0DB 4HDOA 4DHZB 2FIDA 3R7RA 1S3SG 4IW0A 2J0MA 4WJOA 2KK8A 1E8WA 2LASA 3NZUA 2GMIC 3QCAA 4IC7B 3VXWA 3KYCD 1E7UA 3DVGX 3PSEB 2BPSA 2AL6A 2JVCA 3ENEA 2KVRA 3ZDTA 1J8CA 2KJRA 3L17A 3T8MA 1WR6E 5G55A 2CU1A 2N1WA 3L13A 2KTRB 2C7NB 2KX0A 2O2VB 2KFJA 4G0NB 1A5RA 1WFYA 3L0WB 4B9KA 1UBIA 2IY1B 4DHZE 4MGKE 4A3PA 2D10A 2GBKA 3PV1A 4ZDVA 4TQ0A 2MBBB 3DVNU 2DZJA 1WJ6A 2KQ7A 4FJZA 4W9JA 2WWZA 3APFA 2NR2A 4WJNA 2KANA 4ZYNA 4F1SA 3H9DA 3PVLA 1IPGA 4LJOB 4F8CB 1WZ0A 1RRBA 2VRRB 1WE6A 3WAPA 4CHKA 3NOBA 2JRHA 4M8MA 4JGHB 1P1AA 3P2BA 1E7VA 1MG8A 2IY0B 2J7QB 4GU2A 4ICVA 3KH0A 4I6NB 3VH4B 2LVPA 3D32A 4JLCA 2IO2B 4I6LB 1KOTA 3W1YA 3PS6A 4MELA 2DAJA 2I1KA 4WWOA 2G4DB 3VDZA 4MM3A 3KUZA 2JWZA 2L76A 2GBRA 5AZHA 1ZGUB 1WGRA 2GBNA 2IZVB 2JXXA 3DPDA 3UQAA 2PEAA 4RM8A 4MH0E 2ZVOA 2KDFB 2MBHA 3W1SA 3M63B 2L05A 1WRDB 3UF8A 2AL3A 1T0YA 3V6CB 3VTWA 3DBSA 3AXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0W A;  4B6W A;  3VH3 B;  4AUQ C;  4ZRK A;  4ANX A;  3C0R B;  2KDE B;  3RZW C;  2M1M A;  5FR6 A;  3K9P B;  2KQS A;  2DYM A;  4LDT B;  1P98 A;  3QIJ A;  3ZKJ C;  4JL9 A;  1YX5 B;  3GZN I;  1OQY A;  2V3S A;  3HK0 A;  5L83 A;  3IVF A;  1E90 A;  2IO1 B;  4P7I A;  3HM3 A;  4DBG A;  1GG3 A;  2EKE C;  1Q1O A;  3PPA A;  4NPN A;  1WH3 A;  1YD8 U;  4E71 A;  1WF9 A;  1NBF C;  1WGD A;  2N7D A;  1WXA A;  1GC7 A;  4NJ6 A;  5AZF A;  2G45 B;  3R7Q A;  2KKC A;  2MW5 A;  2JPH A;  4NQK E;  2FCM A;  2LGX A;  4DXA B;  1K8R B;  5JH5 C;  3ALB A;  3V62 A;  3APC A;  3PRP B;  2JY6 A;  2CKH B;  3DVG Y;  4GN1 A;  4FHK A;  2CHX A;  4A3O A;  3K9O B;  3U7D A;  1IYF A;  2HTH A;  3HM6 X;  5J17 A;  1IP9 A;  2JZZ A;  2LVO A;  1KJT A;  2C5L C;  3RZF A;  2K6Q A;  2MSE D;  3RD2 A;  5HKH A;  1LFD A;  2KN5 A;  1OTR B;  3PZD A;  4BOS C;  2D3G A;  2ZCC A;  4GDL A;  2DYB A;  4M0W B;  1WYW B;  3QAR A;  5IA7 A;  2N1V A;  1X1M A;  2O6V A;  4FHJ A;  4GB9 A;  3ZTD A;  3AI5 A;  2MCN B;  4EEW A;  1E8X A;  5TR5 A;  3HHM A;  1WJN A;  1XQQ A;  3ONS A;  4K81 A;  3KVF B;  1AAR A;  2L8J A;  5IAA C;  4XX5 A;  3JSV A;  4GDL B;  4PS8 A;  3RUL A;  4FUL A;  1WXV A;  3V6E B;  2GBJ A;  3H7P A;  5CHF A;  2BF8 B;  4MGZ E;  1PQS A;  4LCD E;  2O6V B;  3TCA A;  5JZE B;  4K7W A;  2N7E A;  2KLG A;  2D07 B;  4E74 A;  3JYU A;  2K8C A;  3SD5 A;  1GNU A;  2Y5B B;  1SE9 A;  4IWP A;  4AP4 C;  3TL5 A;  1YX6 B;  3QC8 B;  3VQI A;  4BBN C;  1WXM A;  4XC2 A;  4HXD A;  4GIV A;  4AWJ A;  1J19 A;  1J0G A;  1RFA A;  3JSV B;  1BT0 A;  4HCP B;  5L95 C;  4DWF A;  4W9H A;  4EZK A;  4GGQ A;  3MJW A;  3PLU A;  3CF6 E;  4YL8 A;  2N9P C;  2NVU I;  3H7P B;  2I1J A;  3DDC B;  3DBR I;  4BKS D;  3IG3 A;  2LXC A;  3M3J A;  4TUU A;  2NBV B;  1QZE A;  4II3 B;  2CHZ A;  1LM8 B;  3VTU A;  2MBE A;  4ANV A;  5D7G A;  2KNB A;  1G6J A;  4NY0 A;  2KJH B;  3UIO B;  3QAQ A;  2LUE A;  4GSW A;  3X23 A;  1WX8 A;  2IO3 B;  4ZRI A;  2RPQ A;  3L08 A;  3ZNI D;  4HVB A;  5JHA A;  4IUM B;  2LI5 A;  4GOC A;  2JUO A;  2BKF A;  2MQJ A;  1FXT B;  1V5O A;  3DCG A;  3L54 A;  2AYO B;  4GXB A;  2ZNV C;  2RR9 A;  3OLM D;  4BKT A;  4FJV B;  1RAX A;  1WX9 A;  1L2N A;  2M4N A;  3SU8 X;  2NPT A;  1JRU A;  3PRM B;  3AUL A;  4KVG B;  2KD0 A;  2NBU A;  4HLE A;  3KUC B;  4MDK E;  4FLH A;  4WWN A;  1I35 A;  2EMS A;  2MA9 B;  3JW0 X;  4PS7 A;  2BKR B;  2K1F A;  2ASQ A;  3A9K A;  4X57 B;  1UD7 A;  5D94 A;  2MP2 A;  2YLM A;  2B3A A;  2FAZ A;  3DOW A;  2BYF A;  3DBL I;  3PT2 B;  2CS4 A;  4BBN F;  2JF5 A;  3QHT A;  5E6P A;  3WIM A;  2R2Q A;  1U4A A;  2KMA A;  2KDB A;  4WAA A;  2D2Q A;  4HK2 A;  3AU5 A;  4DDI D;  1WM3 A;  1V80 A;  2NPT B;  4MSQ B;  4ASW C;  3ZNH B;  4WWP A;  5KHO A;  2LJ5 A;  2C9W B;  2ZJD A;  3ECI A;  5CX3 A;  1WY8 A;  3U30 A;  3VAW A;  3WA0 A;  4CO7 A;  5CTR C;  3ZLZ A;  2KXJ A;  2KDI A;  4EOY A;  3A9K B;  2JT4 B;  4MSM B;  3PLV A;  4EFO A;  2IO0 B;  1WJU A;  3Q3F A;  2MP2 B;  1VCB A;  1V5T A;  4ANU A;  3B0A A;  2L7R A;  4ANW A;  2AWT A;  3HIZ A;  4TKN A;  5DCN A;  1LXD A;  1Z5S B;  2DAF A;  4G50 A;  3SHQ A;  3N3K B;  3JVZ X;  2G4S A;  2ZEQ A;  3IHP C;  4MGY E;  3B08 A;  4NAW A;  3QWZ B;  4J6I A;  2W9N A;  4N9F 4;  1YJ1 A;  4DHJ D;  2HJ8 A;  4CYE A;  3L10 B;  3KW5 B;  2C7M B;  3DVN V;  5J18 A;  2AEH A;  2KO3 A;  1WX7 A;  3R3M A;  4FN2 A;  1WGY A;  3WAN A;  4BVU C;  4FA6 A;  2HE7 A;  2Z59 B;  3B1L X;  3N32 A;  1L7Y A;  4NQL B;  2BGF A;  4TV3 A;  1EF1 A;  3EEC A;  3UIN B;  2LVQ A;  4II2 B;  3EHV A;  4PS3 A;  1WMH A;  3GOE A;  3QJZ A;  4FJY A;  2L0F A;  3ZNZ B;  2WDT B;  2XK5 A;  4K7S A;  1WI0 A;  4K1R B;  4NAW B;  1V49 A;  2FNJ B;  1KLV A;  1V6E A;  2RGF A;  3R66 C;  2KWC A;  2FCQ A;  1E8Y A;  4JIO U;  4E3C A;  4HWI B;  5LLI A;  4ICU A;  3APD A;  2KLC A;  2N9X A;  3RT3 B;  1GUA B;  3ML8 A;  2LWP A;  3A33 B;  2UYZ B;  4BFR A;  2LXA A;  5D6J B;  4ZRJ A;  4HPM B;  1TTN A;  4WJQ A;  2Z0E B;  4B95 A;  1LQB A;  4I6P A;  5DPR A;  1ZW7 A;  5C23 A;  3TJP A;  4KDI C;  4W9E A;  2DEN B;  4TQ1 A;  4MEM A;  2K6D B;  1V81 A;  2C60 A;  2IYD B;  3V60 A;  3ZTC A;  5BO4 B;  1V2Y A;  3ZIM A;  4KZC A;  1WMH B;  2L00 B;  2MBQ A;  3PHW B;  3KYD D;  4FAD A;  4KIK A;  1WGH A;  2XK5 B;  1YIW A;  1NI2 A;  3O65 B;  3OJ3 A;  2A5U A;  1WIA A;  2FCN A;  4GDK A;  4EZJ A;  5LXI B;  3ZRC A;  2UWQ A;  1H8C A;  2K8B A;  2KC2 A;  3UGB B;  4RMA A;  1NDD A;  4IM0 A;  3RCZ A;  1WXS A;  3ZRF A;  5G2N A;  2WX0 A;  2KFK B;  1UEL A;  1YQB A;  3EFU A;  2GOW A;  2NCN A;  2J0K A;  3N30 A;  3T9L A;  2FUH B;  1OEY J;  4AJW A;  3BY4 B;  4M8N A;  2RSU A;  4AOF A;  3MTN B;  3VUX A;  5EDS A;  3I3T B;  1ZKH A;  3OAW A;  4KIK B;  3RYT A;  3S2A A;  3M62 B;  2ZCB A;  2KTF A;  4GMV A;  3CST A;  4GDK B;  4KSK C;  2REX A;  4EZL A;  4IM3 A;  3QA8 A;  1OGW A;  3WAM A;  1V86 A;  1Q5W B;  1WGG A;  2ZNV B;  5GMV A;  3ZDM C;  1M94 A;  2K25 A;  3SDL C;  3MHS D;  4K7U A;  2N4F A;  2IBI B;  2M0X A;  5DPT A;  2ZPY A;  1H4R A;  2O6V D;  4W9K A;  2K8H A;  2NS5 A;  3A4S C;  3TIX A;  3AU4 A;  5LXH A;  3A1Q A;  5DPW A;  2YVC A;  1TBE A;  1GC6 A;  1P9D U;  2BWF A;  4WQO B;  2PJH A;  1UZX B;  2MBO A;  4PYZ A;  1TZ1 A;  2LRW A;  3IBE A;  3PRZ A;  1I42 A;  3WAL A;  1TGZ B;  2KMC A;  5JHB A;  4W9I A;  3ZW3 A;  3ZO5 B;  1EUV B;  3NY5 A;  4KDL B;  4A20 A;  3M95 A;  2RD0 A;  4NJ7 A;  3H1U A;  2R2O A;  4MGI E;  4OVV A;  1V9J A;  4IWO A;  3V61 A;  5D2M B;  2DYO A;  3VTV A;  4AJY B;  4IWQ A;  1XT9 B;  2DZM A;  3PGE A;  3VUW A;  4DDG D;  4EKU A;  3NHE B;  2V1Y A;  2ZPN A;  2KWV B;  3A1Q B;  3ML9 A;  5E6O A;  4DHJ B;  4EUT A;  2WYQ A;  3L16 A;  2QHO A;  4XZ4 A;  1WR1 A;  1C1Y B;  4MJS A;  1R4M I;  1OEY A;  3H6N A;  4W9C A;  1Z2M A;  1WM2 A;  4WJP A;  2MLB A;  2LRU A;  4HJK A;  3LJ3 A;  5CHV C;  3IFW B;  3PRE A;  3NZS A;  5AEK B;  1F9J A;  3ZNG C;  1GJZ A;  3PHX B;  2DZI A;  4JQW C;  2V4L A;  2M8S A;  3QK0 A;  2XEW A;  3CSF A;  1R4N I;  5KHQ A;  2CHW A;  2L3Z A;  2ZZP B;  2J0J A;  2OJR A;  4IG7 B;  2KX3 A;  1SIF A;  5CHW A;  4KZ0 A;  5C1Z A;  2JZ3 B;  4PYU A;  1UH6 A;  2L0T A;  3UIP B;  2PPH A;  2PE6 B;  3ZUN A;  2PE9 A;  3KUD B;  4BKG A;  2LGY A;  4LJP B;  2LGD A;  5E6N A;  3CMM B;  1WZ3 A;  2LD9 A;  4HDQ A;  4F7Z A;  4MJS B;  2KZR A;  4BOZ B;  4HPL B;  1UBQ A;  1RLF A;  3VVW B;  3W1S C;  1E5W A;  3DBH I;  2BWE S;  2MWS B;  4FBJ B;  2G3Q B;  4LDT D;  4BKS A;  4G3X B;  3WAO A;  1E8Z A;  1KM7 A;  2C7H A;  2CR5 A;  3NS8 A;  4IM2 A;  1ISN A;  3PTF C;  1WE7 A;  2KHW B;  2KJ6 A;  3LDZ E;  3ZVV A;  1D3Z A;  3A9J A;  2FCS A;  4NNJ B;  2KC1 A;  3H7S A;  4G11 A;  1C3T A;  1SGH A;  2DHZ A;  4HCN B;  1XD3 B;  4RM9 A;  2MRP A;  3VUY A;  1Y8R C;  2DZK A;  2EMT A;  2KFK A;  3A4R A;  3BIN A;  2LZ6 A;  1Q0W B;  2N9E B;  4W9G A;  1UGM A;  3RUI B;  2FIF A;  1CMX B;  1VD2 A;  2KOX A;  2JRI B;  3VHT C;  1S1Q B;  2ZVN A;  1EO6 A;  2BYV E;  3U8Z A;  2D11 A;  2A4Z A;  4KV2 A;  3QQ8 B;  3QX1 A;  2MX2 A;  4URK A;  2DX5 B;  3UQB A;  5J2R A;  1EF5 A;  2BYE A;  4KSL C;  2KWU B;  2HD5 B;  2M17 A;  5DPS A;  4DK5 A;  4W9D A;  4OVU A;  3A9J B;  2OOB B;  3EC8 A;  3DQV A;  4W9F A;  2XBB C;  2WX1 A;  1P3Q U;  1P0R A;  2GBM A;  2KTR A;  1HE8 A;  2O2V A;  2NBW B;  3Q3J A;  4W9L A;  5AZG A;  3TBL D;  2K39 A;  3VFK A;  1WJ4 A;  3TMP B;  3OJ4 B;  2Z0D B;  4HDO A;  4DHZ B;  2FID A;  3R7R A;  1S3S G;  4IW0 A;  2J0M A;  4WJO A;  2KK8 A;  1E8W A;  2LAS A;  3NZU A;  2GMI C;  3QCA A;  4IC7 B;  3VXW A;  3KYC D;  1E7U A;  3DVG X;  3PSE B;  2BPS A;  2AL6 A;  2JVC A;  3ENE A;  2KVR A;  3ZDT A;  1J8C A;  2KJR A;  3L17 A;  3T8M A;  1WR6 E;  5G55 A;  2CU1 A;  2N1W A;  3L13 A;  2KTR B;  2C7N B;  2KX0 A;  2O2V B;  2KFJ A;  4G0N B;  1A5R A;  1WFY A;  3L0W B;  4B9K A;  1UBI A;  2IY1 B;  4DHZ E;  4MGK E;  4A3P A;  2D10 A;  2GBK A;  3PV1 A;  4ZDV A;  4TQ0 A;  2MBB B;  3DVN U;  2DZJ A;  1WJ6 A;  2KQ7 A;  4FJZ A;  4W9J A;  2WWZ A;  3APF A;  2NR2 A;  4WJN A;  2KAN A;  4ZYN A;  4F1S A;  3H9D A;  3PVL A;  1IPG A;  4LJO B;  4F8C B;  1WZ0 A;  1RRB A;  2VRR B;  1WE6 A;  3WAP A;  4CHK A;  3NOB A;  2JRH A;  4M8M A;  4JGH B;  1P1A A;  3P2B A;  1E7V A;  1MG8 A;  2IY0 B;  2J7Q B;  4GU2 A;  4ICV A;  3KH0 A;  4I6N B;  3VH4 B;  2LVP A;  3D32 A;  4JLC A;  2IO2 B;  4I6L B;  1KOT A;  3W1Y A;  3PS6 A;  4MEL A;  2DAJ A;  2I1K A;  4WWO A;  2G4D B;  3VDZ A;  4MM3 A;  3KUZ A;  2JWZ A;  2L76 A;  2GBR A;  5AZH A;  1ZGU B;  1WGR A;  2GBN A;  2IZV B;  2JXX A;  3DPD A;  3UQA A;  2PEA A;  4RM8 A;  4MH0 E;  2ZVO A;  2KDF B;  2MBH A;  3W1S A;  3M63 B;  2L05 A;  1WRD B;  3UF8 A;  2AL3 A;  1T0Y A;  3V6C B;  3VTW A;  3DBS A;  3AXC A; 
#chains in the Genus database with same CATH topology
 4B6W A;  3RZW C;  3RI7 C;  3AH7 A;  1YN4 A;  3K9P B;  2KQS A;  3QIJ A;  2WXJ A;  4KKJ A;  2IO1 B;  3E9S A;  4DBG A;  1GG3 A;  1Q1O A;  3AE6 B;  3PZ8 A;  1WGD A;  2KKC A;  5JH5 C;  4NQK E;  2FCM A;  3MP9 A;  3ALB A;  3V62 A;  2JY6 A;  2CKH B;  1ZOY B;  4A3O A;  3U7D A;  5J17 A;  2C5L C;  1F52 A;  1PDX A;  4NAM A;  3BYT B;  2L1A A;  3Q2A C;  3IXS A;  1L4Z B;  4M0W B;  1WYW B;  3ZTD A;  1FIQ A;  5BMI A;  2Q5W D;  2MCN B;  4EEW A;  3ZGZ A;  1E6E B;  3ONS A;  1AAR A;  4RFB A;  2BS2 B;  1FM0 D;  3JSV A;  4RGN A;  4PS8 A;  4NZL B;  1PFD A;  2GBJ A;  1TT5 B;  2BF8 B;  4MGZ E;  4LK0 M;  3ABV B;  2KQ4 X;  3TCA A;  5G5G A;  4E74 A;  3JYU A;  2I2Y A;  2KYW A;  4XWW A;  1WXM A;  4XC2 A;  4HXD A;  5L95 C;  3TEW A;  4GGQ A;  3MJW A;  2J4X A;  2ICI A;  2K5P A;  3IG3 A;  2LXC A;  4REZ A;  4J3O D;  1FEH A;  2M0A A;  5D7G A;  2WHI A;  4NY0 A;  2KJH B;  2RMM A;  1TS5 A;  1WX8 A;  3ZNI D;  1T0S C;  3L54 A;  2D3C A;  2LHD A;  1L2N A;  4YTN B;  2IGG A;  5H92 C;  2M4N A;  3NS1 A;  3B2F A;  3PO0 A;  4WWN A;  3A9K A;  4X57 B;  3AEE B;  2YLM A;  2BYF A;  3PT2 B;  2CS4 A;  5E6P A;  1JWA D;  3WIM A;  2KDB A;  1D6E C;  3AU5 A;  1V1P B;  5KHO A;  3URY A;  5CX3 A;  2J53 A;  1V1O A;  2KXJ A;  2PVO D;  2JWU A;  2JT4 B;  4EFO A;  1NI3 A;  3Q3F A;  4ANU A;  3OWE B;  4ANW A;  2AWT A;  2L52 A;  3HIZ A;  3N3K B;  2V3P A;  2G4S A;  3B08 A;  4JE3 B;  4YXD B;  3AE9 B;  3VRB B;  1YJ1 A;  2HJ8 A;  3DVN V;  5FK9 C;  2FUG 1;  1WGY A;  2HE7 A;  1F0Z A;  3N32 A;  4NQL B;  4TV3 A;  1SJH D;  1F1H A;  4BZA A;  4PS3 A;  5BYR A;  4H2A A;  3ZNZ B;  3SFD B;  5HI1 A;  4K1R B;  1KLV A;  2FNJ B;  3R66 C;  4S0R A;  5BMG A;  1J7B A;  2YEP F;  2KLC A;  2N9X A;  1I4P A;  2Z0E B;  5IKC M;  4B95 A;  5LNK 1;  1JQ4 A;  1N5W A;  5DPR A;  3RNB C;  4TQ1 A;  4MEM A;  2C60 A;  4L23 A;  5BO4 B;  1V2Y A;  2LUM A;  3KYD D;  5FR3 A;  4HEA 1;  4FAD A;  2HTM E;  4GDK A;  2KC2 A;  2JYT A;  3CIR B;  2WU5 B;  1MI0 A;  1DOY A;  2W82 A;  4JWS C;  4KKI A;  3TEX A;  1NVI D;  4S17 A;  1ENF A;  2Y3A A;  1KTK A;  1OQQ A;  4OHJ A;  4M8N A;  2K22 A;  1JRP A;  3MTN B;  3I3T B;  3OAW A;  3RYT A;  2ZCB A;  3CST A;  1L0V B;  4KSK C;  4L2Y A;  1PGA A;  1V86 A;  5GMV A;  3LXF A;  1M94 A;  3EA6 A;  1FO4 A;  4ZHP A;  2N4F A;  2KMM A;  2M0X A;  1FPY A;  1TS2 A;  4IDI A;  5LXH A;  4ITK A;  1FRD A;  1HXY D;  1TBE A;  1GC6 A;  1P9D U;  1UWX A;  4WUR A;  3Q3M C;  5HFY A;  2LRW A;  1I42 A;  1YNT E;  2Z8L A;  1HA5 A;  1D4B A;  3AEB B;  1V9J A;  5D2M B;  4IWQ A;  3VUW A;  4LNN A;  2V1Y A;  2ZPN A;  2KWV B;  3ML9 A;  1TJE A;  1ZPS A;  4MJS A;  1Z2M A;  1I4G A;  4XDC A;  4OVZ A;  4HJK A;  2KWD A;  3FAH A;  3IFW B;  1F9J A;  4FXC A;  2AX5 A;  2XEW A;  3CSF A;  4M01 A;  1SE4 A;  1R4N B;  2OJR A;  2KX3 A;  1PUT A;  4PYU A;  1UH6 A;  4LNO A;  2PE6 B;  4UDU C;  2VZK B;  2LGY A;  2LGD A;  2BW2 A;  5E6N A;  4ZRQ A;  5AUK A;  4BOZ B;  1FFV A;  1RLF A;  2BWE S;  2KAJ A;  3N1Y C;  4FBJ B;  1C9F A;  4BKS A;  2CR5 A;  4OZB A;  1WE7 A;  2KHW B;  3ZVV A;  2KDM A;  4NNJ B;  3H7S A;  1QLB B;  4JX1 C;  4RM9 A;  2MRP A;  3VUY A;  1Y8R C;  2QJL A;  2EMT A;  3BIN A;  4W9G A;  2N9E B;  3RUI B;  3AE1 B;  2BYV E;  2MX2 A;  2PTL A;  2MJD A;  1FFU A;  2M17 A;  3A9J B;  3I9V 1;  3IT6 B;  2QC8 A;  1F77 A;  2OOB B;  2XBB C;  1P3Q U;  1P0R A;  2GBM A;  1HE8 A;  3Q3J A;  3VFK A;  3OJ4 B;  4DHZ B;  3R7R A;  1C77 A;  2KK8 A;  4M02 A;  3QCA A;  3RN9 C;  1E7U A;  1YJJ A;  2FE8 A;  2AL6 A;  3ZDT A;  2RDB C;  2N1W A;  3L13 A;  2O2V B;  2KX0 A;  4G0N B;  2KFJ A;  3DWG C;  1N61 A;  3L0W B;  3V3X A;  3MC8 A;  1UBI A;  4R3D A;  4DHZ E;  4ZDV A;  1HTO A;  2INP E;  2OJW A;  1WJ6 A;  4W9J A;  4WJN A;  3GS2 A;  1IPG A;  1WZ0 A;  3V05 A;  3WAP A;  2JRH A;  3I63 C;  1E7V A;  4I6N B;  2KT7 A;  4JLC A;  2IO2 B;  4I6L B;  1KOT A;  4MEL A;  4WWO A;  2DAJ A;  3VDZ A;  4MM3 A;  5AZH A;  1WGR A;  2IZV B;  1JCK B;  1TYG B;  3TEZ A;  4NJC A;  1LGR A;  2PEA A;  3AN1 A;  4MH0 E;  3BII D;  3M63 B;  1WRD B;  3O13 A;  4YT0 B;  3X0W A;  3VH3 B;  4AUQ C;  1PGX A;  4ZRK A;  4ANX A;  2KDE B;  1NYR A;  2DNF A;  1B1Z A;  1XEE A;  4JPS A;  3ZKJ C;  1YX5 B;  1V8C A;  1VR9 A;  3HK0 A;  4LNK A;  4P7I A;  1FRR A;  1QF6 A;  2EKE C;  1BXT A;  1WH3 A;  1NYQ A;  4E71 A;  1NBF C;  2LEK A;  5HG2 A;  1TZO A;  2D3B A;  1GC7 A;  4NJ6 A;  4DXA B;  1K8R B;  1VDV A;  3APC A;  1GOZ A;  3DVG Y;  2AQ2 B;  1K50 A;  3K9O B;  1N60 A;  2JZZ A;  3AED B;  1KJT A;  5D3D A;  2MJE A;  1E10 A;  2K6Q A;  1ZUD 2;  5HKH A;  4DXF A;  2KN5 A;  1OTR B;  2GI9 A;  2ZCC A;  4WAF A;  5HHD G;  1ROE A;  1FCL A;  2DYB A;  2W3R A;  1AW7 A;  2O6V A;  4FHJ A;  4GB9 A;  1HEZ E;  1TIF A;  2WXH A;  3AMZ A;  2WXL A;  2VZK D;  4B0M A;  4XWT A;  2QCZ A;  1UGJ A;  3H7P A;  2ONQ A;  2X38 A;  3BZD B;  2ACZ B;  1VLB A;  2WXK A;  5JZE B;  1L0Y B;  3L4P A;  1GNU A;  2Y5B B;  4IWP A;  2INN E;  1BML C;  3TL5 A;  1YX6 B;  2JX5 A;  3ZJU A;  4A55 A;  4AWJ A;  4C4V B;  3JSV B;  1L4D B;  3R8B A;  4DWF A;  3CF6 E;  2NVU I;  3DDC B;  3TEY A;  1QZE A;  1LM8 B;  2IDY A;  4TMA B;  1G6J A;  1QQR A;  3QAQ A;  2LUE A;  3X23 A;  2RPQ A;  2JUO A;  3J9C A;  2BKF A;  2MQJ A;  2SEB D;  4YSZ B;  3Q8C A;  2BB6 A;  2AYO B;  4GXB A;  4A90 A;  2D5G A;  3BWU D;  4YSY B;  2I38 A;  5EE3 A;  3RNE C;  1RAX A;  2NPT A;  4OZC A;  3PRM B;  4KVG B;  4HLE A;  2BKR B;  1HTQ A;  2ASQ A;  2NMQ A;  3KLS X;  3QHT A;  1MFW A;  2BYT A;  1RYJ A;  3BVG A;  1ZP0 B;  1J7C A;  1KFY B;  2ZJD A;  1WY8 A;  3WA0 A;  3VAW A;  4CO7 A;  3ZLZ A;  4ZYS A;  1CK1 A;  2QSD A;  4EOY A;  3A9K B;  2IO0 B;  1WJU A;  1VCB A;  3AE7 B;  3BVZ A;  4IOI E;  4A9A A;  3SHQ A;  1OQR A;  2ZEQ A;  3IHP C;  4J6I A;  2JZP A;  3KW5 B;  2X8X X;  5J18 A;  4WQM A;  2AEH A;  3WAN A;  1WX7 A;  2HDE A;  4BVU C;  1VRA B;  4AQ7 A;  2BGF A;  3R2I A;  1N5X A;  3UIN B;  2LVQ A;  1VZ6 A;  1WMH A;  2BBC A;  2GLS A;  3QJZ A;  2L0F A;  2XK5 A;  1QOG A;  1WI0 A;  1V49 A;  4RNA A;  3ZJV A;  2FCQ A;  1E8Y A;  2WXR A;  4JIO U;  4HWI B;  4E3C A;  4ZHO A;  4ICU A;  2BS4 B;  1GUA B;  2WXO A;  3A33 B;  1J7A A;  2UYZ B;  3ML8 A;  2LXA A;  4BFR A;  4C4V A;  4ZRJ A;  4HPM B;  4WJQ A;  4N59 A;  4KDI C;  4W9E A;  3ZXR A;  1C76 A;  4RGM A;  3ZTC A;  2IYD B;  2WXP A;  1E0Z A;  2QIE B;  1R7S A;  1WGH A;  1NI2 A;  3OJ3 A;  4EZJ A;  1H8C A;  2PLP A;  4IM0 A;  3RCZ A;  5G2N A;  1YQB A;  3EFU A;  2GOW A;  2NCN A;  3N30 A;  3NG0 A;  1JWB D;  1EM7 A;  4XGA B;  3AE3 B;  4AOF A;  5EDS A;  3NUH B;  2N0S B;  5I4D A;  4GDK B;  4IM3 A;  1EWC A;  1OGW A;  1XLO A;  3TUO A;  2RDG A;  2K25 A;  1LO5 D;  2W55 A;  3SDL C;  3AE4 B;  3MHS D;  1SJE D;  2IBI B;  5DPT A;  2NS5 A;  3BK1 A;  3KQ4 A;  1EU4 A;  1P7F A;  2H88 B;  1UZX B;  2PVG C;  3WAL A;  2MEK A;  2G9H D;  5JHB A;  2V3N A;  3ZO5 B;  4A20 A;  5E6J A;  3H1U A;  2R2O A;  4OVV A;  4IWO A;  1YN3 A;  4AJY B;  2WXQ A;  1XT9 B;  3NHE B;  5E6O A;  4DHJ B;  3MC9 A;  1AN8 A;  2QHO A;  4XZ4 A;  3P1M A;  1R4M I;  3AM9 A;  5AUI A;  4WJP A;  2MLB A;  2WU2 B;  2KAC A;  3PRE A;  2V4L A;  2M8S A;  3QK0 A;  5KHQ A;  1R4N I;  2CHW A;  1TKE A;  3ZUN A;  1WWT A;  2LD9 A;  4HDQ A;  1CZP A;  4JWU C;  4MJS B;  1M4V A;  3AE5 B;  4G3X B;  4IM2 A;  3PTF C;  3FIL A;  1C78 A;  1SGH A;  3GE8 C;  3A4R A;  1UGM A;  2EEL A;  1V97 A;  4HRS A;  5EE1 A;  4B0E A;  1S1Q B;  3C19 A;  3HUI A;  1EO6 A;  2D11 A;  3AEA B;  1RFK A;  1T6B X;  2BYE A;  4KSL C;  2KWU B;  4DK5 A;  4W9D A;  1CQV A;  3W9C B;  3DQV A;  2KTR A;  1UNS A;  4W9L A;  3AEG B;  2K39 A;  2LGS A;  3TMP B;  3W5U B;  3Q3N C;  4C7Y A;  1QKZ A;  4K3C A;  2FID A;  1S3S G;  2NTS A;  2LAS A;  2WDQ B;  4P6V F;  3DVG X;  2BPS A;  2JVC A;  1J8C A;  2M19 A;  1WYG A;  3Q8A A;  1XLQ A;  4A3P A;  1YMH E;  3VR8 B;  2MBB B;  2KQ7 A;  4FJZ A;  4F1S A;  3H9D A;  4LJO B;  3MFG A;  2JSV X;  4CHK A;  4M8M A;  4JGH B;  1MG8 A;  2J7Q B;  4GU2 A;  4ICV A;  3FKY A;  2LVP A;  5IO9 A;  1L6V A;  2I1K A;  3KUZ A;  2JWZ A;  2L76 A;  1ZDX A;  1ZGU B;  2GBN A;  1VZ7 A;  2WNM A;  3DPD A;  1XCQ L;  1N63 A;  3U52 E;  2ZVO A;  2KDF B;  3UF8 A;  1T0Y A;  1C4A A;  1N6Z A;  3AXC A;  1R4M B;  1MPE A;  2M1M A;  5FR6 A;  4RF0 A;  1D5Z C;  4LDT B;  1FCC C;  2WQY B;  1EU3 A;  2OED A;  4MM3 B;  3IVF A;  3GZN B;  3HM3 A;  1YQ3 B;  3PPA A;  3NVW A;  1YD8 U;  1WF9 A;  1K51 A;  4HJG E;  1WXA A;  3R7Q A;  2G45 B;  2DBY A;  2JYE A;  2OHF A;  3ZQ4 A;  2MW5 A;  5IOI A;  2LGX A;  1YOV B;  3I57 A;  4FHK A;  3AEF B;  2CHX A;  1IYF A;  1IGC A;  2HTH A;  3T3N A;  1LFD A;  3PZD A;  2D3G A;  4GDL A;  1SBB B;  1IGD A;  3Q8B A;  5IA7 A;  2N1V A;  3AI5 A;  1TKY A;  3RNC C;  1E8X A;  5TR5 A;  2K3U A;  3KVF B;  1EWY C;  4K3B A;  1QOA A;  4WIP A;  3T3O A;  1ZE3 D;  3KWV A;  3RUL A;  3BYY B;  3V6E B;  5CHF A;  1PYW D;  2O6V B;  4K7W A;  1XCT L;  1SE9 A;  3VQI A;  4BBN C;  1VZ8 A;  4ZOH C;  3SR6 A;  2LJI A;  1J19 A;  4YTP B;  1J0G A;  1RFA A;  4XYC A;  4HCP B;  3BK2 A;  3AE8 B;  3Q6B A;  4W9H A;  4EZK A;  4XE0 A;  4YL8 A;  2N9P C;  3H7P B;  3DBR I;  4BKS D;  3M3J A;  2NBV B;  3VTU A;  1KLU D;  4ANV A;  3AE2 B;  3UIO B;  4GSW A;  5JHA A;  1ACC A;  3L08 A;  1YN5 A;  2L83 A;  2LI5 A;  4D2K A;  2QEJ C;  3Q69 A;  4KGT A;  3Q8E A;  2J52 A;  3OLM D;  1WX9 A;  3AUL A;  2KD0 A;  2NBU A;  4MDK E;  1I35 A;  1FNW A;  2EMS A;  3JW0 X;  2WLB A;  5BYS A;  1UD7 A;  5D94 A;  2MP2 A;  3DOW A;  4BBN F;  3DBL B;  2R2Q A;  3HRD D;  2R61 A;  2KMA A;  3C8Y A;  3SEB A;  4ZRP A;  4WAA A;  1FXI A;  2L32 A;  1WM3 A;  1WSP A;  2N9L A;  4PK1 A;  2NPT B;  4MSQ B;  4ASW C;  5MPO A;  2VH2 A;  4XDD A;  4WWP A;  3W5V B;  1C4C A;  2BVC A;  2WP9 B;  2WXN A;  1IBX A;  4P1B C;  2PMV A;  2V0G A;  5DCN A;  1LXD A;  3CWI A;  3GE3 C;  4G50 A;  3JVZ X;  4MGY E;  1XO3 A;  4YSX B;  4NAW A;  3EGR A;  2W9N A;  5C2T B;  1UWM A;  1MVK A;  3P4R B;  1FNU A;  4CYE A;  2KO3 A;  1I4H A;  2WXF A;  1L7Y A;  2WXG A;  4O1N A;  2TSS A;  3EEC A;  3ZJT A;  3VRA B;  3EHV A;  5EE9 A;  4FJY A;  2WDT B;  4K7S A;  1V6E A;  2RGF A;  2KWC A;  2LWP A;  1TTN A;  4WH4 A;  3WCQ A;  4I6P A;  4Q2J A;  1V81 A;  1TY0 A;  2K6D B;  3DHG C;  1WMH B;  3PHW B;  2MBQ A;  1NEK B;  1QOB A;  3N9Y C;  3R2T A;  4KIK A;  2XK5 B;  4KGR A;  2A5U A;  2FCN A;  3ZRC A;  2UWQ A;  2K8B A;  1NDD A;  2KFK B;  1GB4 A;  3T9L A;  3P63 A;  2LMC A;  2FUH B;  4WWM A;  3DBR B;  2UU7 A;  4AJW A;  1D5M C;  4TSS A;  4GMV A;  2BS3 B;  2GRI A;  3QA8 A;  1Q5W B;  1WGG A;  2V4I B;  3EUB 2;  3H8H A;  3KWL A;  4K7U A;  1WRI A;  3MC0 B;  2ZPY A;  1H4R A;  2O6V D;  4W9K A;  3A4S C;  3TIX A;  5DPW A;  3A1Q A;  3AV8 A;  2BWF A;  2PJH A;  2WDR B;  1ZDV A;  1TZ1 A;  1TGZ B;  4W9I A;  3ZW3 A;  2IPK D;  3M95 A;  2RD0 A;  5GXG B;  2J42 A;  4MGI E;  3V61 A;  2DYO A;  3RPF C;  2DZM A;  3GP7 A;  3PGE A;  4EKU A;  1GPX A;  4US8 A;  3P42 A;  1GAQ B;  4EUT A;  3L16 A;  3NVZ A;  1C1Y B;  3RNG C;  1T3Q A;  1RWS A;  2D3A A;  3H6N A;  4W9C A;  4ARI A;  1WM2 A;  1C79 A;  3NZS A;  5AEK B;  4LTU A;  3B9J A;  3PHX B;  2DZI A;  3RMK C;  1F2R I;  1FD6 A;  2L3Z A;  1E7P B;  2ZZP B;  2J0J A;  4IG7 B;  5CHW A;  1SIF A;  4P1C C;  4KZ0 A;  5C1Z A;  1KLG D;  2PE9 A;  4BKG A;  1F2R C;  4LJP B;  3B2G A;  1WZ3 A;  4F7Z A;  2KZR A;  3VVW B;  2N7J A;  2IGD A;  3DBH B;  4US9 A;  2G3Q B;  2Y5P A;  3NS8 A;  2C7H A;  1ISN A;  2KN4 A;  2KJ6 A;  4LNF A;  1ET9 A;  1D3Z A;  2W54 A;  2DHZ A;  1XD3 B;  1TY2 A;  4DXG A;  2DZK A;  2KFK A;  2LZ6 A;  2FIF A;  1CMX B;  1VD2 A;  2KOX A;  4MT5 A;  1JW9 D;  3P4Q B;  2A4Z A;  4KV2 A;  3QQ8 B;  3QX1 A;  4URK A;  3UQB A;  2LHE A;  1K52 A;  4ARC A;  4OVU A;  1YQ4 B;  3FIL B;  4N6E B;  2BTE A;  2LGI A;  4OW0 A;  4W9F A;  5IAA C;  2JQR B;  2WX1 A;  3NZ3 A;  3TBL D;  5AZG A;  4HDO A;  1YJI A;  2G1E A;  3GB1 A;  1IUE A;  2JXT A;  2J0M A;  4IW0 A;  3AB5 A;  1E8W A;  4IC7 B;  1I4X A;  3VXW A;  4YTM B;  3KYC D;  3PSE B;  3ENE A;  2KJR A;  3MHZ A;  3N1Z C;  4KGS A;  5G55 A;  2CU1 A;  2KTR B;  1DYQ A;  1JRO A;  3NRZ A;  3PV1 A;  4TQ0 A;  2W3S A;  2DZJ A;  2QIL A;  3PVL A;  3SFE B;  4CQN A;  1RRB A;  5G5H A;  1FXA A;  1SB3 C;  3NOB A;  4DQO C;  1P1A A;  3P2B A;  1TKG A;  1GB1 A;  2V9H A;  3W1Y A;  3PS6 A;  2GB1 A;  2Y5C A;  3U7Z A;  5EE0 A;  2WDV B;  1UUP A;  2ZW0 A;  1MHX A;  4HRO A;  2JXX A;  3UQA A;  4RM8 A;  3W1S A;  2L05 A;  1SF0 A;  4HPP A;  3VTW A;  1JML A;  1XLN A;  3C0R B;  4LLG M;  1VJK A;  2DYM A;  1P98 A;  1XLP A;  1ZXH A;  4JL9 A;  3PZ7 A;  3GZN I;  1JWM D;  1OQY A;  2V3S A;  5L83 A;  5T8I A;  1E90 A;  1HQR D;  4NPN A;  1QOF A;  3N1X C;  1L5P A;  2N7D A;  5AZF A;  2DLB A;  1UF0 A;  2JPH A;  4M0W A;  3PRP B;  4EE2 A;  5C3J B;  4GN1 A;  1KF6 B;  1Q10 A;  3HM6 X;  1IP9 A;  1ET6 A;  2LVO A;  1D5X C;  3RZF A;  3LYY A;  2MSE D;  3RD2 A;  4C56 C;  4BOS C;  1XF5 L;  2VH1 A;  3FC4 A;  3IT4 B;  3RFZ B;  4HKZ E;  3QAR A;  1X1M A;  1SXT A;  3HHM A;  1WJN A;  1TS4 A;  3NVV A;  1XQQ A;  2K0P A;  4K81 A;  3OG5 A;  1HZ5 A;  2L8J A;  4XX5 A;  1MJD A;  1N62 A;  4GDL B;  5IN7 A;  4FUL A;  1WXV A;  2CJN A;  1PQS A;  4LCD E;  3DWM A;  2N7E A;  2KLG A;  2D07 B;  2K8C A;  3SD5 A;  4AP4 C;  4AS1 A;  3QC8 B;  4GIV A;  1BT0 A;  1WXQ A;  1OFF A;  4HKQ A;  3PLU A;  4GLS C;  2I1J A;  4TUU A;  3E56 A;  4II3 B;  2CHZ A;  3HVZ A;  3AEC B;  2MBE A;  3N20 C;  2WXI A;  1AWD A;  2KNB A;  2IO3 B;  4ZRI A;  2WXM A;  4HVB A;  4IUM B;  4GOC A;  2RDH A;  2WS3 B;  1FXT B;  1V5O A;  1SE2 A;  4RH6 A;  3DCG A;  2ZNV C;  2RR9 A;  2QDF A;  4BKT A;  4FJV B;  1V1P A;  3SU8 X;  1JRU A;  2HJ1 A;  1T0Q C;  2AQ3 B;  1SSN A;  3KUC B;  1A70 A;  1QT9 A;  4FLH A;  2MA9 B;  4PS7 A;  3I5J C;  2K1F A;  1MHH E;  1SEB D;  2B3A A;  2FAZ A;  3DBL I;  2YEP B;  2JF5 A;  2QMT A;  1U4A A;  1DOI A;  2D2Q A;  4HK2 A;  2MJ3 A;  4DDI D;  4ACF A;  1V80 A;  4MH8 A;  2SAK A;  3ZNH B;  2LJ5 A;  2C9W B;  2DWQ A;  3ECI A;  3U30 A;  5CTR C;  1L6U A;  2KDI A;  3Q8F A;  4MSM B;  3PLV A;  1I7H A;  3RNF C;  2MP2 B;  1T0R C;  1V5T A;  2AQ1 B;  1L0X B;  3B0A A;  2L7R A;  3ZYY X;  4TKN A;  1Z5S B;  3ZXV A;  2DAF A;  1ZXI A;  2CU3 A;  3QWZ B;  1B9R A;  4N9F 4;  4DHJ D;  1KH0 A;  2INC C;  3L10 B;  2C7M B;  2N9K A;  3R3M A;  4FN2 A;  4FA6 A;  2Z59 B;  2BQQ A;  3B1L X;  1STE A;  5TSS A;  1EF1 A;  1IBX B;  4II2 B;  3GOE A;  4MAC A;  2LFI A;  4L1B A;  2PKO A;  4NAW B;  3UI3 A;  5LLI A;  2RPV A;  3APD A;  3RT3 B;  1AYF A;  5D6J B;  3W2D A;  1LQB A;  1P7E A;  1ZW7 A;  5C23 A;  3TJP A;  5H8Y E;  3P4P B;  2DEN B;  3V60 A;  3ZIM A;  4KZC A;  1CJE A;  2L00 B;  1YIW A;  3O65 B;  1WIA A;  5LXI B;  5FKA C;  3P4S B;  3UGB B;  4RMA A;  3BVM A;  3ZRF A;  1WXS A;  2WX0 A;  4RGO S;  4RGT A;  1TS3 A;  3LB8 C;  5D3I B;  1QIL A;  2KVZ A;  1UEL A;  2J0K A;  2EKI A;  1OEY J;  2IGH A;  2PW9 A;  3BY4 B;  2RSU A;  3VUX A;  1ZKH A;  4KIK B;  3S2A A;  3M62 B;  4YWG G;  2KTF A;  4EZL A;  2REX A;  3WAM A;  4IKG A;  2ZNV B;  3ZDM C;  1KRH A;  2MH7 A;  2K8H A;  5JXV A;  3AU4 A;  1FNV A;  3Q3O C;  2YVC A;  3EFC A;  2ZW1 A;  4WQO B;  2IJ0 A;  1WGK A;  2MBO A;  3IAM 1;  4PYZ A;  1SE3 A;  3IBE A;  3PRZ A;  2JU6 X;  2KMC A;  5BMH A;  1JAL A;  3ETR A;  1EUV B;  3NY5 A;  2H89 B;  4KDL B;  4NJ7 A;  2B76 B;  4KX6 B;  1T5X D;  3VTV A;  1I4Q A;  2BB5 A;  4DDG D;  2WGS A;  3A1Q B;  2WYQ A;  1WR1 A;  2M56 B;  1OEY A;  1C4P A;  2LRU A;  3LJ3 A;  3MJ5 A;  2IND C;  1I4R A;  5CHV C;  2ON8 A;  1GJZ A;  3ZNG C;  4JQW C;  3IAS 1;  2NTT A;  4M00 A;  2JZ3 B;  2PIA A;  4RF1 A;  3UIP B;  2L0T A;  2K9X A;  2PPH A;  4USA A;  3KUD B;  4N58 A;  3U4E G;  4C7Z A;  4QAY A;  1SIJ A;  3CMM B;  4HPL B;  1UBQ A;  3NVY A;  3W1S C;  1E5W A;  3DBH I;  2MWS B;  3DHI C;  4C80 A;  4LDT D;  2BT6 A;  3WAO A;  1E8Z A;  1KM7 A;  1ESF A;  3LDZ E;  3A9J A;  2FCS A;  2KC1 A;  4G11 A;  1C3T A;  1JWS D;  4HCN B;  4A8X C;  1FMA D;  5IP4 D;  1Q0W B;  2JRI B;  3NJT A;  3VHT C;  1HZ6 A;  2ZVN A;  4OZA A;  3U8Z A;  2DX5 B;  5J2R A;  1EF5 A;  2HD5 B;  5DPS A;  2CJO A;  3EC8 A;  3TSS A;  4P16 A;  2O2V A;  2NBW B;  1PGB A;  1WJ4 A;  3Q14 C;  2Z0D B;  2XN9 C;  1XXG A;  2E6X A;  4WJO A;  3NZU A;  2GMI C;  1BUI C;  2KVR A;  4PT5 A;  3L17 A;  1NEN B;  2MHJ A;  3T8M A;  1WR6 E;  1JWU D;  4A6Q A;  2C7N B;  1A5R A;  1WFY A;  4BAX A;  4B9K A;  2IY1 B;  4MGK E;  2D10 A;  2GBK A;  3DVN U;  1K53 A;  1DOX A;  2WWZ A;  3APF A;  2NR2 A;  4ZYN A;  2KAN A;  4F8C B;  1RM6 C;  2VRR B;  3U2S C;  1WE6 A;  4RCO A;  2XNA C;  2IY0 B;  3KH0 A;  1E9M A;  3VH4 B;  3VR9 B;  1MG4 A;  3D32 A;  4LNI A;  4C00 A;  2G4D B;  1Y56 A;  2GBR A;  5BYQ A;  3DHH C;  3RNA C;  2E3T A;  2MBH A;  1DGJ A;  2AL3 A;  3HVD A;  3V6C B;  3DBS A;  2FBW B; 
#chains in the Genus database with same CATH homology
 3X0W A;  4B6W A;  3VH3 B;  4AUQ C;  4ZRK A;  4ANX A;  3C0R B;  2KDE B;  3RZW C;  2M1M A;  5FR6 A;  3K9P B;  2KQS A;  2DYM A;  4LDT B;  1P98 A;  3QIJ A;  3ZKJ C;  4JL9 A;  1YX5 B;  3GZN I;  1OQY A;  2V3S A;  3HK0 A;  5L83 A;  3IVF A;  1E90 A;  2IO1 B;  4P7I A;  3HM3 A;  4DBG A;  1GG3 A;  2EKE C;  1Q1O A;  3PPA A;  4NPN A;  1WH3 A;  1YD8 U;  4E71 A;  1WF9 A;  1NBF C;  1WGD A;  2N7D A;  1WXA A;  1GC7 A;  4NJ6 A;  5AZF A;  2G45 B;  3R7Q A;  2KKC A;  2MW5 A;  2JPH A;  4NQK E;  2FCM A;  2LGX A;  4DXA B;  1K8R B;  5JH5 C;  3ALB A;  3V62 A;  3APC A;  3PRP B;  2JY6 A;  2CKH B;  3DVG Y;  4GN1 A;  4FHK A;  2CHX A;  4A3O A;  3K9O B;  3U7D A;  1IYF A;  2HTH A;  3HM6 X;  5J17 A;  1IP9 A;  2JZZ A;  2LVO A;  1KJT A;  2C5L C;  3RZF A;  2K6Q A;  2MSE D;  3RD2 A;  5HKH A;  1LFD A;  2KN5 A;  1OTR B;  3PZD A;  4BOS C;  2D3G A;  2ZCC A;  4GDL A;  2DYB A;  4M0W B;  1WYW B;  3QAR A;  5IA7 A;  2N1V A;  1X1M A;  2O6V A;  4FHJ A;  4GB9 A;  3ZTD A;  3AI5 A;  2MCN B;  4EEW A;  1E8X A;  5TR5 A;  3HHM A;  1WJN A;  1XQQ A;  3ONS A;  4K81 A;  3KVF B;  1AAR A;  2L8J A;  5IAA C;  4XX5 A;  3JSV A;  4GDL B;  4PS8 A;  3RUL A;  4FUL A;  1WXV A;  3V6E B;  2GBJ A;  3H7P A;  5CHF A;  2BF8 B;  4MGZ E;  1PQS A;  4LCD E;  2O6V B;  3TCA A;  5JZE B;  4K7W A;  2N7E A;  2KLG A;  2D07 B;  4E74 A;  3JYU A;  2K8C A;  3SD5 A;  1GNU A;  2Y5B B;  1SE9 A;  4IWP A;  4AP4 C;  3TL5 A;  1YX6 B;  3QC8 B;  3VQI A;  4BBN C;  1WXM A;  4XC2 A;  4HXD A;  4GIV A;  4AWJ A;  1J19 A;  1J0G A;  1RFA A;  3JSV B;  1BT0 A;  4HCP B;  5L95 C;  4DWF A;  4W9H A;  4EZK A;  4GGQ A;  3MJW A;  3PLU A;  3CF6 E;  4YL8 A;  2N9P C;  2NVU I;  3H7P B;  2I1J A;  3DDC B;  3DBR I;  4BKS D;  3IG3 A;  2LXC A;  3M3J A;  4TUU A;  2NBV B;  1QZE A;  4II3 B;  2CHZ A;  1LM8 B;  3VTU A;  2MBE A;  4ANV A;  5D7G A;  2KNB A;  1G6J A;  4NY0 A;  2KJH B;  3UIO B;  3QAQ A;  2LUE A;  4GSW A;  3X23 A;  1WX8 A;  2IO3 B;  4ZRI A;  2RPQ A;  3L08 A;  3ZNI D;  4HVB A;  5JHA A;  4IUM B;  2LI5 A;  4GOC A;  2JUO A;  2BKF A;  2MQJ A;  1FXT B;  1V5O A;  3DCG A;  3L54 A;  2AYO B;  4GXB A;  2ZNV C;  2RR9 A;  3OLM D;  4BKT A;  4FJV B;  1RAX A;  1WX9 A;  1L2N A;  2M4N A;  3SU8 X;  2NPT A;  1JRU A;  3PRM B;  3AUL A;  4KVG B;  2KD0 A;  2NBU A;  4HLE A;  3KUC B;  4MDK E;  4FLH A;  4WWN A;  1I35 A;  2EMS A;  2MA9 B;  3JW0 X;  4PS7 A;  2BKR B;  2K1F A;  2ASQ A;  3A9K A;  4X57 B;  1UD7 A;  5D94 A;  2MP2 A;  2YLM A;  2B3A A;  2FAZ A;  3DOW A;  2BYF A;  3DBL I;  3PT2 B;  2CS4 A;  4BBN F;  2JF5 A;  3QHT A;  5E6P A;  3WIM A;  2R2Q A;  1U4A A;  2KMA A;  2KDB A;  4WAA A;  2D2Q A;  4HK2 A;  3AU5 A;  4DDI D;  1WM3 A;  1V80 A;  2NPT B;  4MSQ B;  4ASW C;  3ZNH B;  4WWP A;  5KHO A;  2LJ5 A;  2C9W B;  2ZJD A;  3ECI A;  5CX3 A;  1WY8 A;  3U30 A;  3VAW A;  3WA0 A;  4CO7 A;  5CTR C;  3ZLZ A;  2KXJ A;  2KDI A;  4EOY A;  3A9K B;  2JT4 B;  4MSM B;  3PLV A;  4EFO A;  2IO0 B;  1WJU A;  3Q3F A;  2MP2 B;  1VCB A;  1V5T A;  4ANU A;  3B0A A;  2L7R A;  4ANW A;  2AWT A;  3HIZ A;  4TKN A;  5DCN A;  1LXD A;  1Z5S B;  2DAF A;  4G50 A;  3SHQ A;  3N3K B;  3JVZ X;  2G4S A;  2ZEQ A;  3IHP C;  4MGY E;  3B08 A;  4NAW A;  3QWZ B;  4J6I A;  2W9N A;  4N9F 4;  1YJ1 A;  4DHJ D;  2HJ8 A;  4CYE A;  3L10 B;  3KW5 B;  2C7M B;  3DVN V;  5J18 A;  2AEH A;  2KO3 A;  1WX7 A;  3R3M A;  4FN2 A;  1WGY A;  3WAN A;  4BVU C;  4FA6 A;  2HE7 A;  2Z59 B;  3B1L X;  3N32 A;  1L7Y A;  4NQL B;  2BGF A;  4TV3 A;  1EF1 A;  3EEC A;  3UIN B;  2LVQ A;  4II2 B;  3EHV A;  4PS3 A;  1WMH A;  3GOE A;  3QJZ A;  4FJY A;  2L0F A;  3ZNZ B;  2WDT B;  2XK5 A;  4K7S A;  1WI0 A;  4K1R B;  4NAW B;  1V49 A;  2FNJ B;  1KLV A;  1V6E A;  2RGF A;  3R66 C;  2KWC A;  2FCQ A;  1E8Y A;  4JIO U;  4E3C A;  4HWI B;  5LLI A;  4ICU A;  3APD A;  2KLC A;  2N9X A;  3RT3 B;  1GUA B;  3ML8 A;  2LWP A;  3A33 B;  2UYZ B;  4BFR A;  2LXA A;  5D6J B;  4ZRJ A;  4HPM B;  1TTN A;  4WJQ A;  2Z0E B;  4B95 A;  1LQB A;  4I6P A;  5DPR A;  1ZW7 A;  5C23 A;  3TJP A;  4KDI C;  4W9E A;  2DEN B;  4TQ1 A;  4MEM A;  2K6D B;  1V81 A;  2C60 A;  2IYD B;  3V60 A;  3ZTC A;  5BO4 B;  1V2Y A;  3ZIM A;  4KZC A;  1WMH B;  2L00 B;  2MBQ A;  3PHW B;  3KYD D;  4FAD A;  4KIK A;  1WGH A;  2XK5 B;  1YIW A;  1NI2 A;  3O65 B;  3OJ3 A;  2A5U A;  1WIA A;  2FCN A;  4GDK A;  4EZJ A;  5LXI B;  3ZRC A;  2UWQ A;  1H8C A;  2K8B A;  2KC2 A;  3UGB B;  4RMA A;  1NDD A;  4IM0 A;  3RCZ A;  1WXS A;  3ZRF A;  5G2N A;  2WX0 A;  2KFK B;  1UEL A;  1YQB A;  3EFU A;  2GOW A;  2NCN A;  2J0K A;  3N30 A;  3T9L A;  2FUH B;  1OEY J;  4AJW A;  3BY4 B;  4M8N A;  2RSU A;  4AOF A;  3MTN B;  3VUX A;  5EDS A;  3I3T B;  1ZKH A;  3OAW A;  4KIK B;  3RYT A;  3S2A A;  3M62 B;  2ZCB A;  2KTF A;  4GMV A;  3CST A;  4GDK B;  4KSK C;  2REX A;  4EZL A;  4IM3 A;  3QA8 A;  1OGW A;  3WAM A;  1V86 A;  1Q5W B;  1WGG A;  2ZNV B;  5GMV A;  3ZDM C;  1M94 A;  2K25 A;  3SDL C;  3MHS D;  4K7U A;  2N4F A;  2IBI B;  2M0X A;  5DPT A;  2ZPY A;  1H4R A;  2O6V D;  4W9K A;  2K8H A;  2NS5 A;  3A4S C;  3TIX A;  3AU4 A;  5LXH A;  3A1Q A;  5DPW A;  2YVC A;  1TBE A;  1GC6 A;  1P9D U;  2BWF A;  4WQO B;  2PJH A;  1UZX B;  2MBO A;  4PYZ A;  1TZ1 A;  2LRW A;  3IBE A;  3PRZ A;  1I42 A;  3WAL A;  1TGZ B;  2KMC A;  5JHB A;  4W9I A;  3ZW3 A;  3ZO5 B;  1EUV B;  3NY5 A;  4KDL B;  4A20 A;  3M95 A;  2RD0 A;  4NJ7 A;  3H1U A;  2R2O A;  4MGI E;  4OVV A;  1V9J A;  4IWO A;  3V61 A;  5D2M B;  2DYO A;  3VTV A;  4AJY B;  4IWQ A;  1XT9 B;  2DZM A;  3PGE A;  3VUW A;  4DDG D;  4EKU A;  3NHE B;  2V1Y A;  2ZPN A;  2KWV B;  3A1Q B;  3ML9 A;  5E6O A;  4DHJ B;  4EUT A;  2WYQ A;  3L16 A;  2QHO A;  4XZ4 A;  1WR1 A;  1C1Y B;  4MJS A;  1R4M I;  1OEY A;  3H6N A;  4W9C A;  1Z2M A;  1WM2 A;  4WJP A;  2MLB A;  2LRU A;  4HJK A;  3LJ3 A;  5CHV C;  3IFW B;  3PRE A;  3NZS A;  5AEK B;  1F9J A;  3ZNG C;  1GJZ A;  3PHX B;  2DZI A;  4JQW C;  2V4L A;  2M8S A;  3QK0 A;  2XEW A;  3CSF A;  1R4N I;  5KHQ A;  2CHW A;  2L3Z A;  2ZZP B;  2J0J A;  2OJR A;  4IG7 B;  2KX3 A;  1SIF A;  5CHW A;  4KZ0 A;  5C1Z A;  2JZ3 B;  4PYU A;  1UH6 A;  2L0T A;  3UIP B;  2PPH A;  2PE6 B;  3ZUN A;  2PE9 A;  3KUD B;  4BKG A;  2LGY A;  4LJP B;  2LGD A;  5E6N A;  3CMM B;  1WZ3 A;  2LD9 A;  4HDQ A;  4F7Z A;  4MJS B;  2KZR A;  4BOZ B;  4HPL B;  1UBQ A;  1RLF A;  3VVW B;  3W1S C;  1E5W A;  3DBH I;  2BWE S;  2MWS B;  4FBJ B;  2G3Q B;  4LDT D;  4BKS A;  4G3X B;  3WAO A;  1E8Z A;  1KM7 A;  2C7H A;  2CR5 A;  3NS8 A;  4IM2 A;  1ISN A;  3PTF C;  1WE7 A;  2KHW B;  2KJ6 A;  3LDZ E;  3ZVV A;  1D3Z A;  3A9J A;  2FCS A;  4NNJ B;  2KC1 A;  3H7S A;  4G11 A;  1C3T A;  1SGH A;  2DHZ A;  4HCN B;  1XD3 B;  4RM9 A;  2MRP A;  3VUY A;  1Y8R C;  2DZK A;  2EMT A;  2KFK A;  3A4R A;  3BIN A;  2LZ6 A;  1Q0W B;  2N9E B;  4W9G A;  1UGM A;  3RUI B;  2FIF A;  1CMX B;  1VD2 A;  2KOX A;  2JRI B;  3VHT C;  1S1Q B;  2ZVN A;  1EO6 A;  2BYV E;  3U8Z A;  2D11 A;  2A4Z A;  4KV2 A;  3QQ8 B;  3QX1 A;  2MX2 A;  4URK A;  2DX5 B;  3UQB A;  5J2R A;  1EF5 A;  2BYE A;  4KSL C;  2KWU B;  2HD5 B;  2M17 A;  5DPS A;  4DK5 A;  4W9D A;  4OVU A;  3A9J B;  2OOB B;  3EC8 A;  3DQV A;  4W9F A;  2XBB C;  2WX1 A;  1P3Q U;  1P0R A;  2GBM A;  2KTR A;  1HE8 A;  2O2V A;  2NBW B;  3Q3J A;  4W9L A;  5AZG A;  3TBL D;  2K39 A;  3VFK A;  1WJ4 A;  3TMP B;  3OJ4 B;  2Z0D B;  4HDO A;  4DHZ B;  2FID A;  3R7R A;  1S3S G;  4IW0 A;  2J0M A;  4WJO A;  2KK8 A;  1E8W A;  2LAS A;  3NZU A;  2GMI C;  3QCA A;  4IC7 B;  3VXW A;  3KYC D;  1E7U A;  3DVG X;  3PSE B;  2BPS A;  2AL6 A;  2JVC A;  3ENE A;  2KVR A;  3ZDT A;  1J8C A;  2KJR A;  3L17 A;  3T8M A;  1WR6 E;  5G55 A;  2CU1 A;  2N1W A;  3L13 A;  2KTR B;  2C7N B;  2KX0 A;  2O2V B;  2KFJ A;  4G0N B;  1A5R A;  1WFY A;  3L0W B;  4B9K A;  1UBI A;  2IY1 B;  4DHZ E;  4MGK E;  4A3P A;  2D10 A;  2GBK A;  3PV1 A;  4ZDV A;  4TQ0 A;  2MBB B;  3DVN U;  2DZJ A;  1WJ6 A;  2KQ7 A;  4FJZ A;  4W9J A;  2WWZ A;  3APF A;  2NR2 A;  4WJN A;  2KAN A;  4ZYN A;  4F1S A;  3H9D A;  3PVL A;  1IPG A;  4LJO B;  4F8C B;  1WZ0 A;  1RRB A;  2VRR B;  1WE6 A;  3WAP A;  4CHK A;  3NOB A;  2JRH A;  4M8M A;  4JGH B;  1P1A A;  3P2B A;  1E7V A;  1MG8 A;  2IY0 B;  2J7Q B;  4GU2 A;  4ICV A;  3KH0 A;  4I6N B;  3VH4 B;  2LVP A;  3D32 A;  4JLC A;  2IO2 B;  4I6L B;  1KOT A;  3W1Y A;  3PS6 A;  4MEL A;  2DAJ A;  2I1K A;  4WWO A;  2G4D B;  3VDZ A;  4MM3 A;  3KUZ A;  2JWZ A;  2L76 A;  2GBR A;  5AZH A;  1ZGU B;  1WGR A;  2GBN A;  2IZV B;  2JXX A;  3DPD A;  3UQA A;  2PEA A;  4RM8 A;  4MH0 E;  2ZVO A;  2KDF B;  2MBH A;  3W1S A;  3M63 B;  2L05 A;  1WRD B;  3UF8 A;  2AL3 A;  1T0Y A;  3V6C B;  3VTW A;  3DBS A;  3AXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...