1X1MA

Solution structure of the n-terminal ubiquitin-like domain in mouse ubiquitin-like protein sb132
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GSSGSSGMSLSDWHLAVKLADQPLAPKSILQLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Mouse Ubiquitin-like Protein SB132
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein SB132
total genus 12
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1x1mA00
1WXSA 1C1YB 1PQSA 1WR6E 2EMSA 3H9DA 4GU2A 3QAQA 4IM2A 5G2NA 2NS5A 4ZYNA 4EFOA 2MBQA 4CYEA 3ZW3A 3DVGX 1I42A 2ZCCA 1UGMA 2NCNA 4HWIB 1GNUA 2LGXA 2KTFA 4MJSA 2K39A 5C1ZA 1WR1A 3ZDMC 1V2YA 3MTNB 5D2MB 3APCA 1P1AA 3BINA 5JHBA 4MSQB 1WGRA 3W1SC 3H7PB 1E8ZA 2JPHA 3UQBA 3QA8A 4W9JA 3UIOB 1UBQA 3LDZE 3PLUA 2JUOA 4KIKA 4ZDVA 2J0JA 4I6PA 4MGYE 2GMIC 4KSLC 3VUWA 2GBKA 3PV1A 2N4FA 2BYVE 2NVUI 2ZZPB 2FIFA 4GIVA 2BYEA 5CTRC 1GJZA 4NNJB 1WM2A 2DZKA 3ZRFA 3ZVVA 5HKHA 2GBRA 3KYCD 1UD7A 1LFDA 1YD8U 2AEHA 3PTFC 5KHOA 2DENB 2MSED 1V81A 2KLGA 2RGFA 5CHWA 3A9KB 4HLEA 2KQSA 2KLCA 2LGDA 2KDEB 4F1SA 5D94A 5IA7A 1KM7A 2LRUA 2IY1B 3L0WB 1K8RB 2O2VB 3OAWA 1UBIA 3A4SC 2KANA 1WI0A 2JT4B 4I6LB 2KFJA 2C60A 4ANWA 2K6DB 4W9CA 3ZKJC 1YIWA 3DBLI 1YJ1A 1D3ZA 4HCNB 3H6NA 3RCZA 4FJZA 3A9JB 2BWES 2JVCA 3DPDA 2KTRA 1WF9A 4IC7B 5E6NA 2MW5A 2L7RA 3V62A 1GC6A 4PS7A 3WA0A 3AU4A 2MBEA 1KJTA 3JSVB 5LXHA 2JRIB 2CS4A 1LQBA 2Z59B 3WAOA 3ZNID 1TBEA 2JF5A 5J17A 2M17A 3SD5A 3O65B 4RMAA 1TTNA 2N7EA 5E6OA 1AARA 3V60A 4URKA 2EKEC 1OEYJ 1WFYA 2JZ3B 3QK0A 2WDTB 1H8CA 4NJ6A 1WGYA 2FUHB 1KLVA 5J18A 1GUAB 4ANXA 3MJWA 3KH0A 1IPGA 1WGDA 2MBOA 3NOBA 4FLHA 1WMHB 2KO3A 2G4DB 4DHJB 4CO7A 2A4ZA 4FHKA 4GDKA 1OQYA 4A20A 3PSEB 4IWOA 3TIXA 3QC8B 4AUQC 3A9KA 1CMXB 1NDDA 4MGKE 3A4RA 4JGHB 1YX5B 1ZKHA 4W9DA 1WMHA 2LVPA 3CSTA 3UF8A 2O2VA 2KMCA 4GDKB 2NBVB 1WXVA 2LVQA 3UQAA 1EO6A 3RT3B 4OVVA 3R66C 5DCNA 4EOYA 2LUEA 3N30A 4YL8A 1H4RA 2G3QB 3QJZA 4GN1A 3B0AA 2BF8B 5L83A 2G45B 2DZIA 3PREA 1HE8A 3A9JA 4DDGD 3A33B 4JL9A 2D3GA 3DVNU 2BPSA 5LLIA 4BOSC 1M94A 2LASA 2MLBA 4BOZB 2J0KA 3RZFA 3W1SA 3JW0X 2FIDA 1S3SG 4EKUA 1E7UA 4K81A 4CHKA 2I1KA 2PE6B 3PHXB 4J6IA 5AZGA 4F7ZA 3DVNV 2NBUA 4KVGB 4K1RB 4N9F4 2DZMA 1P98A 2L0FA 3ZNGC 2MX2A 4W9LA 1VCBA 3QARA 4I6NB 3R7QA 2M0XA 2ZPYA 3Q3FA 2KFKA 4BVUC 2AL6A 2C7HA 3ZNHB 2LWPA 3C0RB 4G50A 4DXAB 1WGHA 3VDZA 2DAFA 1TZ1A 2M4NA 4HJKA 3H7SA 2ZVOA 3KVFB 4LJOB 2KFKB 4EZLA 4RM8A 1OTRB 1EF1A 3KUCB 2WX0A 2PEAA 2BKRB 5G55A 4FADA 1WJNA 2KWCA 3ZUNA 2Y5BB 1YX6B 2LD9A 2AYOB 2Z0EB 3EHVA 3SDLC 3B1LX 5DPTA 2LZ6A 2R2OA 3IHPC 1Y8RC 1Q5WB 2LVOA 1Q0WB 3R7RA 3WAMA 2V1YA 1WY8A 2FNJB 4NJ7A 4ANUA 2KOXA 4NAWB 3UGBB 4BKSD 4IM0A 4B95A 1WZ3A 4FHJA 4FBJB 4II2B 2HTHA 4TQ0A 4K7WA 3PT2B 2RD0A 4ZRIA 3TCAA 3WAPA 2J7QB 3B08A 2MRPA 3V6EB 2NBWB 4WQOB 1KOTA 3VTVA 1WJUA 2NR2A 4HPMB 4ZRKA 4MGIE 4GDLB 4KZCA 3ZNZB 4B6WA 2IO2B 1JRUA 3IBEA 2RSUA 3NHEB 1V86A 1WX7A 1WX8A 3EECA 2CHXA 3D32A 3U8ZA 5FR6A 4KZ0A 5AZFA 3RD2A 3DBSA 3N3KB 3WANA 4AJWA 4GB9A 4GDLA 3K9OB 2MBBB 3A1QB 2PPHA 5JZEB 2KVRA 2KX0A 3JVZX 3TL5A 2M8SA 2VRRB 3APFA 5AEKB 3HK0A 2IZVB 2C9WB 4IUMB 4WJQA 1U4AA 3M62B 5CX3A 5BO4B 1IYFA 3CSFA 3VH4B 4RM9A 2KKCA 4G11A 2XK5B 4WAAA 2MQJA 3JYUA 2C7MB 1WM3A 4ANVA 4EZJA 3QWZB 2GOWA 3PHWB 2K1FA 2KWUB 3A1QA 1RFAA 1R4MI 2KXJA 2LGYA 4W9HA 2ZEQA 2ASQA 2J0MA 2XEWA 4WWOA 3TBLD 3T9LA 4KIKB 4DHJD 4E3CA 4NPNA 2K8BA 1J19A 3APDA 2XK5A 5C23A 3RULA 3VVWB 2RPQA 2ZPNA 4IWPA 1A5RA 3VUYA 3HM6X 2EMTA 2KC1A 4TKNA 2DYOA 2K8CA 4BKTA 1J0GA 2G4SA 5D7GA 3S2AA 2LRWA 4IWQA 3DOWA 4E71A 2MWSB 4NQKE 3UINB 4LDTD 4AOFA 1XQQA 3ZO5B 4WJPA 4LJPB 4GOCA 5DPWA 4AP4C 3Q3JA 4W9FA 2MCNB 3TJPA 4DWFA 3VHTC 3SHQA 2D10A 4M8NA 3HHMA 2DYBA 1Z2MA 3EFUA 3WIMA 1I35A 2N1VA 3VQIA 4PS3A 2KDBA 2FCQA 1EF5A 4MDKE 1WGGA 2JWZA 3ENEA 3IFWB 3ZDTA 1WJ6A 2I1JA 4HCPB 4HXDA 2UWQA 1WYWB 4DK5A 4MEMA 2KMAA 4JQWC 4MSMB 1SGHA 1WRDB 1WE6A 4K7UA 3CMMB 4LCDE 3TMPB 2PE9A 2UYZB 3SU8X 2IO0B 2WYQA 3R3MA 5E6PA 4HK2A 3PVLA 1V49A 4JLCA 3PPAA 3GZNI 4FJVB 2KX3A 2N9XA 3U30A 1Z5SB 2L8JA 3L17A 4IW0A 4DBGA 3RYTA 1SIFA 1WZ0A 1TGZB 2BGFA 2BYFA 3DBRI 2KZRA 3H7PA 1BT0A 2DAJA 2N9PC 2BWFA 3L10B 4MGZE 4ASWC 1E8YA 4DHZB 1S1QB 2KJ6A 3EC8A 2LXCA 3HIZA 4PYUA 2DHZA 3GOEA 2V4LA 3I3TB 4FJYA 4LDTB 1WJ4A 2MP2A 3AULA 3HM3A 3PGEA 3X23A 4HPLB 2KHWB 2WWZA 2D2QA 2CKHB 2A5UA 4XC2A 2XBBC 3AU5A 1FXTB 4W9GA 4GGQA 3VH3B 2C5LC 4E74A 2FCMA 2FCNA 4NY0A 3ZRCA 4B9KA 1UZXB 3ML9A 3PRMB 2KJRA 2KJHB 3M3JA 4BBNC 4PYZA 2YLMA 1ISNA 1UH6A 1WIAA 2V3SA 4MJSB 2AL3A 3LJ3A 1WXMA 3OLMD 4DDID 2ZJDA 1V6EA 2HJ8A 2ZVNA 4II3B 4GMVA 4AJYB 4G3XB 3QX1A 2CR5A 2JZZA 3ONSA 1WH3A 3X0WA 4F8CB 1IP9A 3UIPB 2Z0DB 5AZHA 2AWTA 2C7NB 2O6VD 4NAWA 4MM3A 4BKSA 2IO1B 4W9KA 3JSVA 3QHTA 2FCSA 3M63B 4OVUA 4KSKC 3PZDA 4TQ1A 3QIJA 4DHZE 3KYDD 2IY0B 3VTWA 1P3QU 4X57B 4HDOA 3H1UA 3L16A 1ZW7A 2NPTA 4W9EA 1LM8B 4BKGA 2HD5B 5GMVA 2GBNA 3K9PB 5LXIB 3VTUA 5EDSA 2K6QA 3VXWA 2KQ7A 3DBHI 1GC7A 2D11A 2KDIA 3L13A 3M95A 4EEWA 5D6JB 4EUTA 4W9IA 2N7DA 5CHVC 4KV2A 2GBMA 1E7VA 2DYMA 2B3AA 2FAZA 2HE7A 3ZLZA 2OOBB 1ZGUB 2JY6A 4IG7B 4EZKA 4ICUA 2LXAA 4M0WB 4ICVA 5DPRA 1L2NA 3QCAA 4HVBA 2LJ5A 2CHZA 2IO3B 3PLVA 2L3ZA 2JRHA 4WJOA 3DCGA 2DX5B 2IBIB 3BY4B 4GSWA 1SE9A 1V80A 2KTRB 3W1YA 2OJRA 3RZWC 2KWVB 4TUUA 3KUDB 2D07B 1OGWA 4JIOU 3IVFA 4PS8A 5KHQA 3V6CB 3ZIMA 2CU1A 4G0NB 1V5OA 2R2QA 2DZJA 3L08A 4KDIC 3DVGY 1E8WA 4FN2A 1WE7A 1L7YA 2MA9B 3DDCB 2L76A 4BBNF 1P0RA 3MHSD 2KNBA 3WALA 2KD0A 4NQLB 1WX9A 3T8MA 3ML8A 1WXAA 1Q1OA 3IG3A 2L00B 2NPTB 3CF6E 5J2RA 3NY5A 1F9JA 1LXDA 1GG3A 1X1MA 4BFRA 4K7SA 4FA6A 1G6JA 3AI5A 3OJ3A 1XT9B 1YQBA 4XZ4A 3AXCA 1V9JA 2K25A 2RR9A 3NZSA 4HDQA 3QQ8B 4A3OA 2GBJA 2QHOA 3ZTCA 5JHAA 2CHWA 1UELA 2KK8A 3PS6A 1QZEA 3VFKA 3NZUA 2L05A 4WJNA 3KUZA 2BKFA 1VD2A 1RAXA 2IYDB 2KDFB 3KW5B 4TV3A 3V61A 1RLFA 2N9EB 2ZNVC 4A3PA 1P9DU 4XX5A 4WWNA 4KDLB 1RRBA 5JH5C 1NBFC 4ZRJA 2ZCBA 2KC2A 1MG8A 2O6VB 2W9NA 2YVCA 2L0TA 4MH0E 3N32A 1E90A 1OEYA 1XD3B 2M1MA 4GXBA 4IM3A 5L95C 2N1WA 1R4NI 2ZNVB 2PJHA 4M8MA 3ZTDA 3L54A 3P2BA 4P7IA 3PRPB 3RUIB 3U7DA 3NS8A 2O6VA 1V5TA 2LI5A 1C3TA 1E5WA 5CHFA 3OJ4B 4FULA 5TR5A 1T0YA 3VUXA 1NI2A 3VAWA 4AWJA 2KN5A 3ALBA 5DPSA 1EUVB 2K8HA 3ECIA 2MBHA 2WX1A 2MP2B 4MELA 1J8CA 1E8XA 3DQVA 2REXA 5IAAC 4WWPA 2JXXA 3PRZA
chains in the Genus database with same CATH superfamily
2J4XA 2W3SA 1WXSA 1C1YB 3AV8A 1WR6E 3KQ4A 1FCLA 3PO0A 3H9DA 4GU2A 4IM2A 4US9A 3B2FA 1BUIC 4ZYNA 4M01A 1ZXIA 4CYEA 3ZW3A 2ZCCA 4HWIB 4MJSA 2RDHA 1R7SA 5C1ZA 3BVGA 5BYQA 4MSQB 1DOXA 1WGRA 1V8CA 3IXSA 1UBQA 3LDZE 3PLUA 2JUOA 1KOTA 4ZDVA 2J0JA 3PV1A 3MJ5A 2FIFA 1TS3A 5CTRC 5HKHA 2GBRA 2JYTA 2DENB 2KLGA 1Q10A 2KQSA 2KLCA 3AEBB 4F1SA 2WHIA 4RGOS 5IA7A 1C79A 3L0WB 1UBIA 2KANA 3ZJVA 3ZXVA 2C60A 1DOYA 3DBLI 4WIPA 1D3ZA 4FJZA 3A9JB 2BWES 4PS7A 5FKAC 2AQ1B 2MBEA 2GLSA 5LXHA 4YTPB 1KLGD 2M17A 4RMAA 4URKA 2N7EA 1OEYJ 2HDEA 2JZ3B 4NJ6A 1XO3A 2FUHB 4ANXA 4FLHA 1WGDA 1I4QA 4DHJB 4CO7A 1OQYA 4YTNB 3TEXA 4AUQC 1QILA 2WU5B 3RNEC 4JGHB 4JWUC 4W9DA 3CSTA 3UF8A 1VLBA 3UQAA 2VZKB 1EO6A 3RT3B 2DWQA 5DCNA 2LUEA 1N5XA 4JPSA 4YL8A 3RFZB 3QJZA 5T8IA 3PREA 1HE8A 1JW9D 1OQRA 1SEBD 3A9JA 1UNSA 3DVNU 3B2GA 1TJEA 1M94A 4BOZB 1R4NB 4LNNA 3RZFA 2I38A 3J9CA 3ZJUA 1E7UA 4CHKA 2I1KA 2E6XA 2PE6B 4J6IA 5AZGA 2LUMA 2QJLA 2KFKA 3ZNHB 4G50A 2QSDA 4PT5A 1JWUD 4HJKA 3TEZA 2H89B 1ZXHA 1V1PA 1BXTA 2Y5PA 1WJNA 2Y5BB 1JWMD 2LD9A 2AYOB 2Z0EB 4HJGE 3EHVA 1ENFA 3LYYA 2R2OA 2X8XX 1Q5WB 2LVOA 1WY8A 1K53A 4NAWB 3UGBB 1HZ5A 2W55A 1WZ3A 4II2B 3GZNB 4B0MA 3PT2B 2RD0A 1TKGA 3WAPA 4DXFA 3AEFB 3B08A 2MRPA 3V6EB 4WQOB 1WJUA 1DOIA 3IBEA 1WX7A 4US8A 1NYRA 5FR6A 1SXTA 5AZFA 2I2YA 3AE7B 4GDLA 3NZ3A 1D5ZC 2PPHA 2KX0A 1WRIA 2NMQA 3TL5A 5AEKB 1E6EB 1KFYB 5E6JA 5BO4B 1IYFA 2KKCA 2XK5B 3L4PA 1JRPA 3JYUA 4ANVA 4NJCA 2GOWA 2BT6A 2K1FA 2KWUB 4W9HA 3TBLD 2J0MA 3GS2A 3T9LA 2BS2B 2J53A 3RI7C 4IWPA 1A5RA 3VUYA 3BK1A 4TKNA 2DYOA 4IWQA 4E71A 4NQKE 5HG2A 2WXGA 2ONQA 3AE1B 4WJPA 1ZOYB 3TJPA 1XCQL 4AQ7A 3SHQA 1WGKA 1I35A 4PS3A 4MDKE 1WGGA 2JWZA 3MP9A 2I1JA 2UWQA 1WYWB 3CIRB 2KMAA 4JQWC 1WE6A 3CMMB 3SU8X 2KMMA 2WYQA 4P6VF 4RF1A 5E6PA 2MJEA 2MJDA 3PVLA 4JLCA 3PPAA 1NVID 4C80A 1B1ZA 2BB5A 3L17A 1WZ0A 2BGFA 2N9PC 2W3RA 3W5VB 1S1QB 2KJ6A 1J7BA 3EC8A 4PYUA 1CZPA 2DHZA 4OZCA 2N0SB 3PGEA 3X23A 4HPLB 2WWZA 2D2QA 3C8YA 2CKHB 2XBBC 5BMGA 4GGQA 3VR9B 2WDRB 3ZRCA 2KJRA 2KJHB 4PYZA 1TS2A 1T3QA 2YLMA 4MJSB 1UWXA 3LJ3A 1WXMA 4P1CC 1L6VA 4WWMA 2ZJDA 3NVWA 4LLGM 4G3XB 1QF6A 4F8CB 1WH3A 2Z0DB 3I9V1 1J7CA 2VH2A 4W9KA 4OVUA 1FXIA 4KSKC 3VTWA 4JX1C 2L32A 4HDOA 1LM8B 4BKGA 2HD5B 1FIQA 3DBHI 2KDIA 5D6JB 5CHVC 2INPE 3ZJTA 1E7VA 2DYMA 2FAZA 2JY6A 4ZRPA 2WXQA 5DPRA 3NUHB 1MVKA 2CHZA 2IBIB 1SE9A 3P1MA 2KTRB 2OJRA 4WURA 2KWVB 4JIOU 1I7HA 3IVFA 4PS8A 3RNGC 5KHQA 1YN3A 3U2SC 4HRSA 3L08A 1WE7A 3E9SA 1KF6B 5C3JB 3CF6E 4BFRA 3BYTB 3OJ3A 3AXCA 4YSXB 1QQRA 4HDQA 2WXFA 3W2DA 2QMTA 3RMKC 3PS6A 1IBXA 5JXVA 1CK1A 1VD2A 2KDFB 1XLPA 1NENB 2PIAA 3U52E 4OZBA 3NRZA 1P9DU 3E56A 1T5XD 1E7PB 4KGSA 5HHDG 1NBFC 2WXPA 1LGRA 2N1WA 1R4NI 2PJHA 4P7IA 3RUIB 3U7DA 2O6VA 5TR5A 1T0YA 2MJ3A 1ZDVA 1PGXA 3ECIA 3Q6BA 2MBHA 2MP2B 4XDDA 2KACA 1D5XC 2RPVA 4D2KA 1UGMA 1FNVA 2LHEA 2KTFA 1CJEA 4OW0A 1FM0D 5D2MB 1P1AA 3ZXRA 2X38A 1E8ZA 3EUB2 4MGYE 1YQ3B 2GMIC 2N4FA 3LB8C 4NNJB 1WM2A 3NG0A 3AM9A 3Q8AA 3KYCD 2AEHA 1VZ7A 1V81A 3A9KB 2B76B 5D94A 1KM7A 2O2VB 2VH1A 3AEDB 1WI0A 1ZE3D 2K6DB 3H8HA 3ZKJC 5MPOA 4ZYSA 1R4MB 3DPDA 2MW5A 2L7RA 1GC6A 3WA0A 3AU4A 1T0RC 1VZ6A 2HTME 1SF0A 2WXLA 1LQBA 2Z59B 3ZNID 3SD5A 1TTNA 2EKEC 2WXNA 1XLOA 1H8CA 3DBHB 3IT6B 3MJWA 1TKYA 2MBOA 1DGJA 2G4DB 4GDKA 5EE1A 3PSEB 3A9KA 4XDCA 1NDDA 4MGKE 3A4RA 1C4AA 3GB1A 1ZKHA 2O2VA 2KMCA 2QCZA 3Q69A 3R66C 4EOYA 3AECB 4OHJA 1H4RA 4DDGD 3A33B 4JL9A 3AE5B 1F52A 4BOSC 2LASA 4C4VA 2J0KA 4L2YA 3JW0X 1SE3A 4EKUA 1S3SG 1YJIA 3DVNV 2DZMA 4W9LA 1VCBA 2M56B 1OFFA 4I6NB 3R7QA 5FR3A 3Q3FA 4BVUC 4ITKA 2C7HA 1WGHA 3VDZA 3MC8A 3IT4B 2ZVOA 4LJOB 2KFKB 3KUCB 2WX0A 1SIJA 5G5GA 1B9RA 2KWCA 4H2AA 3SDLC 4LNOA 3IHPC 1SB3C 1FRRA 1UWMA 3R7RA 3WAMA 1K50A 2V1YA 4LTUA 4ANUA 4MACA 4IM0A 1OQQA 2HTHA 3AEGB 2J7QB 2NR2A 4HPMB 1TS5A 1VZ8A 1N62A 3P4QB 1V86A 1WX8A 1XEEA 2PTLA 3D32A 2J52A 3U8ZA 2PMVA 4KZ0A 1FNUA 2UU7A 3Q8EA 3N3KB 4R3DA 3AN1A 4GB9A 3WANA 1IUEA 2VRRB 3APFA 1I4HA 3HK0A 1U4AA 2HJ1A 4RM9A 4YT0B 4EZJA 2LFIA 1RFAA 1QOBA 1R4MI 4N58A 2L1AA 2ASQA 2ZEQA 2K22A 4KIKB 4E3CA 5C23A 2XK5A 3RULA 3VVWB 2RPQA 2ZPNA 1NYQA 4MH8A 5BMIA 2KC1A 1PYWD 4WAFA 5HI1A 5D7GA 2BYTA 1TY2A 4XGAB 3DOWA 2MWSB 1FRDA 3W9CB 4GOCA 5DPWA 1ZUD2 4GLSC 3I63C 1A70A 2D10A 2DYBA 5EE3A 3VRAB 2FCQA 3AH7A 1C78A 3IFWB 3ZDTA 2LMCA 4HXDA 1VJKA 4HCPB 4MSMB 3RNAC 4A90A 3TMPB 2UYZB 1SJHD 1ESFA 1GB1A 3IAS1 3P4RB 3GZNI 2KX3A 2GB1A 2L8JA 4DBGA 2IDYA 3RYTA 1SIFA 1AW7A 2DAJA 4ASWC 5I4DA 3R8BA 1FPYA 4DHZB 3N1ZC 1L5PA 1FXAA 5HFYA 3ZYYX 1FCCC 1TT5B 5IO9A 1WJ4A 3V05A 3AULA 2KHWB 4XC2A 2IGDA 3AU5A 1XLNA 3Q2AC 4NY0A 1L0YB 3EGRA 1PGBA 1UZXB 1E10A 5H92C 3ML9A 4BBNC 3M3JA 2E3TA 3FC4A 1ISNA 3NVZA 3PZ8A 4DDID 2H88B 2ZVNA 3DBLB 4II3B 2XN9C 4GMVA 1E0ZA 3X0WA 3QX1A 1XLQA 1IP9A 3NVYA 2N7JA 3UIPB 5AZHA 4WH4A 2C7NB 2O6VD 4BKSA 4MM3A 4TQ1A 4KGRA 4RNAA 3QIJA 2KDMA 3KYDD 2EKIA 2IY0B 1P3QU 4X57B 4W9EA 2NPTA 4WQMA 4N59A 3DBRB 2GBNA 3W5UB 4A55A 3VTUA 2K6QA 3I5JC 2D3CA 3M95A 1D6EC 2MH7A 2WXIA 2N7DA 3ZLZA 4KV2A 1GOZA 2HE7A 2OOBB 1ZGUB 1IBXB 4ICUA 2LXAA 3QCAA 4HVBA 2OJWA 1F2RC 1QKZA 3PLVA 2L3ZA 1YOVB 3BY4B 4GSWA 3W1YA 2WQYB 3RZWC 3KUDB 2D07B 1PDXA 3AB5A 3GE3C 2K5PA 2DZJA 4KDIC 4FN2A 4ARCA 4A6QA 1XF5L 3DDCB 4BBNF 2WU2B 3MHSD 4KKIA 2KNBA 5IP4D 1WX9A 1ZP0B 3ML8A 1WXAA 4YTMB 1V97A 2L00B 2NPTB 3IAM1 1GG3A 1X1MA 4USAA 4K7SA 1HQRD 4ZRQA 1G6JA 1V9JA 1P7EA 1RWSA 3ZTCA 2LHDA 2JYEA 1JWBD 1UELA 2M0AA 1QZEA 1HZ6A 3NZUA 4WJNA 3KUZA 2BKFA 2IYDB 1RAXA 4TV3A 3ABVB 4XX5A 1I4XA 3Q3MC 5JH5C 4NZLB 2W9NA 4MH0E 3N32A 1E90A 1XD3B 2M1MA 2WXKA 5L95C 2EELA 3Q8FA 2RDBC 3NS8A 4LNIA 2LI5A 1C3TA 3N1YC 4FXCA 3OJ4B 3VAWA 5DPSA 1C76A 2WX1A 5IN7A 3Q8BA 1ACCA 2JWUA 4K3CA 4M00A 1J8CA 3DQVA 2REXA 2JXXA 2BQQA 1IGDA 1PQSA 1V1PB 4IKGA 1FEHA 1HTQA 3DVGX 3NVVA 2NCNA 1GNUA 2LGXA 2K39A 3ZDMC 1L0XB 1V2YA 3MTNB 3P63A 3APCA 5JHBA 1KRHA 3W1SC 3H7PB 2JPHA 4XYCA 4P16A 3UQBA 2PLPA 3QA8A 3Q14C 3UIOB 2JXTA 2K9XA 4I6PA 5GXGB 4KSLC 2IPKD 2GBKA 3BYYB 2BYVE 2ZZPB 4J3OD 4LNKA 2DZKA 2WS3B 3ZRFA 1VR9A 3ZVVA 3GP7A 1UD7A 3NS1A 1V1OA 2MSED 2RGFA 5CHWA 4HLEA 3MHZA 2LGDA 2KDEB 2GRIA 2IY1B 3OAWA 3A4SC 1JCKB 1FMAD 1QOFA 1YIWA 5BYRA 4HCNB 2BB6A 3RCZA 2JVCA 2M19A 1WF9A 2BS4B 1GB4A 2IJ0A 2RMMA 1KJTA 3JSVB 1TBEA 1F2RI 3O65B 1AARA 2MHJA 1ZDXA 1WFYA 3KLSX 3P4SB 1TIFA 1WGYA 5J18A 1GUAB 3EFCA 1IPGA 2KO3A 4A20A 4IWOA 3TIXA 3QC8B 4L1BA 1YX5B 2PVGC 1D4BA 4C7YA 1D5MC 4PK1A 1I4RA 4GDKB 4HKZE 2LVQA 4OVVA 1WWTA 1Y56A 3N20C 2G3QB 4GN1A 2D3AA 3B0AA 5L83A 2G45B 3BWUD 2BPSA 1L6UA 2Q5WD 1FD6A 2YEPF 1QLBB 2FUG1 2LGSA 3N1XC 2JX5A 4K81A 1HEZE 4HROA 4BAXA 4KVGB 2K3UA 1C77A 4N9F4 2JSVX 2L0FA 4MT5A 1XXGA 3QARA 2M0XA 2AL6A 1QT9A 1TKEA 2JU6X 1HXYD 5IKCM 4XWTA 4RM8A 1OTRB 2PEAA 5G55A 4FADA 3ZUNA 2ZW0A 1YX6B 3HVZA 1KTKA 2V4IB 1YN5A 3FILB 3B1LX 3GE8C 4REZA 5DPTA 3VRBB 2LZ6A 1Y8RC 3Q3OC 4JE3B 1Q0WB 2IGGA 4NJ7A 4XE0A 3FILA 4FHJA 4FBJB 4TQ0A 4K7WA 3DWGC 2WXJA 2NBWB 3VTVA 3N9YC 4ZRKA 4MGIE 3ZNZB 4B6WA 1JRUA 3DHIC 3RD2A 4AJWA 2MBBB 1KLUD 2KVRA 3JVZX 2M8SA 2IZVB 2C9WB 4IUMB 4WJQA 1FNWA 4G11A 2MQJA 2C7MB 1WM3A 2BTEA 3PHWB 1WXQA 2KXJA 2LGYA 3I57A 1XCTL 2Y5CA 2K8BA 3P4PB 2INNE 3HM6X 2EMTA 1MI0A 2PVOD 4TMAB 2G4SA 2LRWA 2FE8A 3AE9B 1EWCA 2L83A 1HA5A 4LDTD 3ZO5B 1SSNA 4LJPB 3Q3JA 2VZKD 4W9FA 4HPPA 1PFDA 2MCNB 3HHMA 1Z2MA 3ETRA 3WIMA 2KDBA 3U4EG 4RCOA 3FAHA 3TSSA 4DK5A 2WDVB 1CQVA 1SGHA 1WRDB 2CJOA 4K7UA 4LCDE 3AMZA 1MHHE 3WCQA 1ET6A 1L0VB 4HK2A 1V49A 4FJVB 4KX6B 1Z5SB 2PW9A 1TGZB 2YEPB 2W54A 4MGZE 3P42A 4NAMA 3PZ7A 2DBYA 1JQ4A 2L52A 2V4LA 3I3TB 4FJYA 2FBWB 2DLBA 2MP2A 3URYA 1FXTB 1LO5D 1RFKA 4LNFA 4Q2JA 1VDVA 2AQ2B 4E74A 1I4PA 2FCNA 1IGCA 4B9KA 1SE2A 1UH6A 2V3SA 2AL3A 3OLMD 2Y3AA 2V9HA 3BZDB 3HUIA 3KWVA 3RPFC 2JZZA 3ONSA 3SFDB 1MHXA 4NAWA 3RNBC 2N9KA 3QHTA 3RNFC 2FCSA 3PZDA 1ET9A 1TYGB 4YXDB 3L16A 3MC9A 3ZGZA 4RGMA 4MM3B 5GMVA 3K9PB 3Q3NC 5LXIB 5EDSA 4RH6A 2D11A 1F77A 3L13A 2GBMA 4IG7B 2ICIA 3BVMA 1MFWA 4L23A 4WJOA 2DX5B 1V80A 3RNCC 4HKQA 4TUUA 1OGWA 2INDC 3V6CB 3TEYA 3OWEB 3ZIMA 4G0NB 4EE2A 3DVGY 2ZW1A 2MA9B 3SEBA 2RDGA 1I4GA 1P0RA 3WALA 2KD0A 1DYQA 3T8MA 1PGAA 3R2TA 3NY5A 1F9JA 5FK9C 1LXDA 2KT7A 4FA6A 3AI5A 1RYJA 2ACZB 4IOIE 2K25A 3MFGA 3NZSA 1J7AA 3QQ8B 5JHAA 2CHWA 3VR8B 5D3IB 3VFKA 2L05A 3UI3A 3AE2B 4ZHOA 1FFUA 1EU4A 4KDLB 1RRBA 2V0GA 1PUTA 4ZRJA 2ZCBA 3FKYA 1N5WA 2NTSA 1MG8A 1WSPA 2L0TA 4RF0A 4C4VB 1SJED 4GXBA 2Z8LA 1NEKB 3EA6A 4M8MA 3ZTDA 3Q8CA 4OZAA 3PRPB 1P7FA 1V5TA 1E5WA 1NI3A 3ALBA 1ROEA 1EUVB 2K8HA 4IDIA 1E8XA 1K51A 1MPEA 1N63A 4WWPA 3PRZA 3ZQ4A 2WXHA 2EMSA 3QAQA 5G2NA 1K52A 2NS5A 4EFOA 3BK2A 1JWAD 2MBQA 2WDQB 3DWMA 3V3XA 1I42A 3T3OA 1WR1A 1JROA 2G9HD 3HVDA 5BMHA 3BINA 3BVZA 3TEWA 4W9JA 4KIKA 3VUWA 3DHHC 2NVUI 1T0SC 3C19A 2OEDA 4GIVA 2BYEA 1GJZA 5TSSA 2IGHA 1YD8U 1LFDA 5KHOA 3PTFC 2KQ4X 1M4VA 2D3BA 2PKOA 2K0PA 2KVZA 2LRUA 2N9LA 1K8RB 2JT4B 2KWDA 1C4CA 4I6LB 1HTOA 2KFJA 1JALA 3AEEB 2BVCA 4W9CA 1VRAB 4ZOHC 1YJ1A 4S17A 2WP9B 4XWWA 2QIEB 3H6NA 1QOAA 1YQ4B 2KTRA 4IC7B 5E6NA 4YWGG 3V62A 4HEA1 1F0ZA 2JRIB 2CS4A 4B0EA 1F1HA 3WAOA 1WYGA 3DHGC 2JF5A 5J17A 5G5HA 4AS1A 5E6OA 3V60A 3O13A 3QK0A 1TS4A 2WDTB 1KLVA 1AWDA 1YMHE 3KH0A 3NOBA 1WMHB 4ZHPA 2A4ZA 4FHKA 1EU3A 1CMXB 1WMHA 2LVPA 2NBVB 1WXVA 4ACFA 3N30A 2BW2A 2BF8B 3AE4B 2DZIA 2W82A 2D5GA 5AUKA 2D3GA 5LLIA 2MLBA 2BBCA 3W1SA 2MEKA 1T0QC 2FIDA 2SAKA 4K3BA 3PHXB 4N6EB 4F7ZA 2NBUA 4K1RB 1P98A 3ZNGC 2MX2A 3U7ZA 2ZPYA 1L4DB 2LWPA 3C0RB 3KWLA 4DXAB 1C4PA 1GAQB 1UGJA 2DAFA 1TZ1A 2M4NA 3H7SA 3KVFB 4S0RA 4EZLA 1EF1A 2WNMA 2BKRB 1JWSD 1JMLA 1SE4A 4ARIA 2JZPA 4RFBA 1FFVA 1ZPSA 2FNJB 2KOXA 1E9MA 4BKSD 1EWYC 4B95A 5C2TB 3TUOA 2V3NA 5D3DA 4ZRIA 3TCAA 2ON8A 4RGTA 4GDLB 4KZCA 1RM6C 1N61A 2IO2B 3LXFA 2RSUA 3NHEB 2XNAC 3EECA 2CHXA 2INCC 3DBSA 3K9OB 1FO4A 3A1QB 5JZEB 5CX3A 3M62B 3CSFA 3VH4B 4WAAA 5EE9A 2KYWA 3QWZB 3A1QA 4RGNA 2XEWA 4WWOA 4DHJD 4NPNA 1J19A 1MG4A 3APDA 1KH0A 4QAYA 5LNK1 1UUPA 2K8CA 4BKTA 4DXGA 3SR6A 1J0GA 4CQNA 3S2AA 3SFEB 2CU3A 1GPXA 3UINB 2GI9A 4AOFA 1XQQA 2V3PA 4JWSC 4AP4C 4DWFA 3VHTC 4M8NA 1QOGA 3EFUA 3OG5A 2N1VA 3VQIA 1EF5A 2QEJC 3ENEA 2WXMA 1WJ6A 4MEMA 1YNTE 2QILA 2PE9A 2IO0B 1AN8A 3R3MA 2AX5A 2KAJA 3U30A 2N9XA 4IW0A 3RN9C 2BYFA 2G1EA 3DBRI 2KZRA 3H7PA 1BT0A 3L10B 2BWFA 1E8YA 2NTTA 3R2IA 2LXCA 3HIZA 4BZAA 3AE8B 1YJJA 3GOEA 3HRDD 4LDTB 1C9FA 3HM3A 5IOIA 2A5UA 1UF0A 3AE3B 4M0WA 4W9GA 2WGSA 3VH3B 2C5LC 2FCMA 1BMLC 4C7ZA 3PRMB 1WIAA 4O1NA 1SBBB 1V6EA 2HJ8A 2LGIA 3AEAB 4AJYB 2CR5A 4A9AA 3T3NA 2AWTA 2IO1B 3JSVA 3M63B 5BYSA 4DHZE 3H1UA 1ZW7A 4TSSA 4C00A 4LK0M 4A8XC 3VXWA 1STEA 2KQ7A 2TSSA 1GC7A 1L4ZB 2WXRA 4EEWA 1N60A 4EUTA 4C56C 2KN4A 4W9IA 4ANWA 2WLBA 2B3AA 2WXOA 4M02A 5AUIA 4EZKA 4M0WB 4ICVA 3B9JA 1L2NA 2J42A 2LJ5A 2IO3B 2JRHA 3DCGA 1TY0A 1N6ZA 3NJTA 5EE0A 1T6BX 2AQ3B 2QDFA 2CU1A 1V5OA 2R2QA 1E8WA 2SEBD 1L7YA 3BIID 2L76A 4NQLB 1Q1OA 4OVZA 2CJNA 3IG3A 5J2RA 2DNFA 4XZ4A 1XT9B 1YQBA 2RR9A 2JQRB 4A3OA 2GBJA 2QHOA 2KK8A 2QC8A 3KW5B 3V61A 1RLFA 2N9EB 2ZNVC 4A3PA 2BS3B 4YSYB 3MC0B 1TZOA 4WWNA 2LEKA 2LJIA 1EM7A 2KC2A 1AYFA 2O6VB 2YVCA 4P1BC 1OEYA 3CWIA 4IM3A 5H8YE 2ZNVB 4KGTA 3L54A 3P2BA 4KKJA 1MJDA 5CHFA 4FULA 4UDUC 3AE6B 4DQOC 3VUXA 1NI2A 4AWJA 2KN5A 2OHFA 1YN4A 2R61A 4MELA 4YSZB 5IAAC
chains in the Genus database with same CATH topology
1WXSA 1C1YB 1PQSA 1WR6E 2EMSA 3H9DA 4GU2A 3QAQA 4IM2A 5G2NA 2NS5A 4ZYNA 4EFOA 2MBQA 4CYEA 3ZW3A 3DVGX 1I42A 2ZCCA 1UGMA 2NCNA 4HWIB 1GNUA 2LGXA 2KTFA 4MJSA 2K39A 5C1ZA 1WR1A 3ZDMC 1V2YA 3MTNB 5D2MB 3APCA 1P1AA 3BINA 5JHBA 4MSQB 1WGRA 3W1SC 3H7PB 1E8ZA 2JPHA 3UQBA 3QA8A 4W9JA 3UIOB 1UBQA 3LDZE 3PLUA 2JUOA 4KIKA 4ZDVA 2J0JA 4I6PA 4MGYE 2GMIC 4KSLC 3VUWA 2GBKA 3PV1A 2N4FA 2BYVE 2NVUI 2ZZPB 2FIFA 4GIVA 2BYEA 5CTRC 1GJZA 4NNJB 1WM2A 2DZKA 3ZRFA 3ZVVA 5HKHA 2GBRA 3KYCD 1UD7A 1LFDA 1YD8U 2AEHA 3PTFC 5KHOA 2DENB 2MSED 1V81A 2KLGA 2RGFA 5CHWA 3A9KB 4HLEA 2KQSA 2KLCA 2LGDA 2KDEB 4F1SA 5D94A 5IA7A 1KM7A 2LRUA 2IY1B 3L0WB 1K8RB 2O2VB 3OAWA 1UBIA 3A4SC 2KANA 1WI0A 2JT4B 4I6LB 2KFJA 2C60A 4ANWA 2K6DB 4W9CA 3ZKJC 1YIWA 3DBLI 1YJ1A 1D3ZA 4HCNB 3H6NA 3RCZA 4FJZA 3A9JB 2BWES 2JVCA 3DPDA 2KTRA 1WF9A 4IC7B 5E6NA 2MW5A 2L7RA 3V62A 1GC6A 4PS7A 3WA0A 3AU4A 2MBEA 1KJTA 3JSVB 5LXHA 2JRIB 2CS4A 1LQBA 2Z59B 3WAOA 3ZNID 1TBEA 2JF5A 5J17A 2M17A 3SD5A 3O65B 4RMAA 1TTNA 2N7EA 5E6OA 1AARA 3V60A 4URKA 2EKEC 1OEYJ 1WFYA 2JZ3B 3QK0A 2WDTB 1H8CA 4NJ6A 1WGYA 2FUHB 1KLVA 5J18A 1GUAB 4ANXA 3MJWA 3KH0A 1IPGA 1WGDA 2MBOA 3NOBA 4FLHA 1WMHB 2KO3A 2G4DB 4DHJB 4CO7A 2A4ZA 4FHKA 4GDKA 1OQYA 4A20A 3PSEB 4IWOA 3TIXA 3QC8B 4AUQC 3A9KA 1CMXB 1NDDA 4MGKE 3A4RA 4JGHB 1YX5B 1ZKHA 4W9DA 1WMHA 2LVPA 3CSTA 3UF8A 2O2VA 2KMCA 4GDKB 2NBVB 1WXVA 2LVQA 3UQAA 1EO6A 3RT3B 4OVVA 3R66C 5DCNA 4EOYA 2LUEA 3N30A 4YL8A 1H4RA 2G3QB 3QJZA 4GN1A 3B0AA 2BF8B 5L83A 2G45B 2DZIA 3PREA 1HE8A 3A9JA 4DDGD 3A33B 4JL9A 2D3GA 3DVNU 2BPSA 5LLIA 4BOSC 1M94A 2LASA 2MLBA 4BOZB 2J0KA 3RZFA 3W1SA 3JW0X 2FIDA 1S3SG 4EKUA 1E7UA 4K81A 4CHKA 2I1KA 2PE6B 3PHXB 4J6IA 5AZGA 4F7ZA 3DVNV 2NBUA 4KVGB 4K1RB 4N9F4 2DZMA 1P98A 2L0FA 3ZNGC 2MX2A 4W9LA 1VCBA 3QARA 4I6NB 3R7QA 2M0XA 2ZPYA 3Q3FA 2KFKA 4BVUC 2AL6A 2C7HA 3ZNHB 2LWPA 3C0RB 4G50A 4DXAB 1WGHA 3VDZA 2DAFA 1TZ1A 2M4NA 4HJKA 3H7SA 2ZVOA 3KVFB 4LJOB 2KFKB 4EZLA 4RM8A 1OTRB 1EF1A 3KUCB 2WX0A 2PEAA 2BKRB 5G55A 4FADA 1WJNA 2KWCA 3ZUNA 2Y5BB 1YX6B 2LD9A 2AYOB 2Z0EB 3EHVA 3SDLC 3B1LX 5DPTA 2LZ6A 2R2OA 3IHPC 1Y8RC 1Q5WB 2LVOA 1Q0WB 3R7RA 3WAMA 2V1YA 1WY8A 2FNJB 4NJ7A 4ANUA 2KOXA 4NAWB 3UGBB 4BKSD 4IM0A 4B95A 1WZ3A 4FHJA 4FBJB 4II2B 2HTHA 4TQ0A 4K7WA 3PT2B 2RD0A 4ZRIA 3TCAA 3WAPA 2J7QB 3B08A 2MRPA 3V6EB 2NBWB 4WQOB 1KOTA 3VTVA 1WJUA 2NR2A 4HPMB 4ZRKA 4MGIE 4GDLB 4KZCA 3ZNZB 4B6WA 2IO2B 1JRUA 3IBEA 2RSUA 3NHEB 1V86A 1WX7A 1WX8A 3EECA 2CHXA 3D32A 3U8ZA 5FR6A 4KZ0A 5AZFA 3RD2A 3DBSA 3N3KB 3WANA 4AJWA 4GB9A 4GDLA 3K9OB 2MBBB 3A1QB 2PPHA 5JZEB 2KVRA 2KX0A 3JVZX 3TL5A 2M8SA 2VRRB 3APFA 5AEKB 3HK0A 2IZVB 2C9WB 4IUMB 4WJQA 1U4AA 3M62B 5CX3A 5BO4B 1IYFA 3CSFA 3VH4B 4RM9A 2KKCA 4G11A 2XK5B 4WAAA 2MQJA 3JYUA 2C7MB 1WM3A 4ANVA 4EZJA 3QWZB 2GOWA 3PHWB 2K1FA 2KWUB 3A1QA 1RFAA 1R4MI 2KXJA 2LGYA 4W9HA 2ZEQA 2ASQA 2J0MA 2XEWA 4WWOA 3TBLD 3T9LA 4KIKB 4DHJD 4E3CA 4NPNA 2K8BA 1J19A 3APDA 2XK5A 5C23A 3RULA 3VVWB 2RPQA 2ZPNA 4IWPA 1A5RA 3VUYA 3HM6X 2EMTA 2KC1A 4TKNA 2DYOA 2K8CA 4BKTA 1J0GA 2G4SA 5D7GA 3S2AA 2LRWA 4IWQA 3DOWA 4E71A 2MWSB 4NQKE 3UINB 4LDTD 4AOFA 1XQQA 3ZO5B 4WJPA 4LJPB 4GOCA 5DPWA 4AP4C 3Q3JA 4W9FA 2MCNB 3TJPA 4DWFA 3VHTC 3SHQA 2D10A 4M8NA 3HHMA 2DYBA 1Z2MA 3EFUA 3WIMA 1I35A 2N1VA 3VQIA 4PS3A 2KDBA 2FCQA 1EF5A 4MDKE 1WGGA 2JWZA 3ENEA 3IFWB 3ZDTA 1WJ6A 2I1JA 4HCPB 4HXDA 2UWQA 1WYWB 4DK5A 4MEMA 2KMAA 4JQWC 4MSMB 1SGHA 1WRDB 1WE6A 4K7UA 3CMMB 4LCDE 3TMPB 2PE9A 2UYZB 3SU8X 2IO0B 2WYQA 3R3MA 5E6PA 4HK2A 3PVLA 1V49A 4JLCA 3PPAA 3GZNI 4FJVB 2KX3A 2N9XA 3U30A 1Z5SB 2L8JA 3L17A 4IW0A 4DBGA 3RYTA 1SIFA 1WZ0A 1TGZB 2BGFA 2BYFA 3DBRI 2KZRA 3H7PA 1BT0A 2DAJA 2N9PC 2BWFA 3L10B 4MGZE 4ASWC 1E8YA 4DHZB 1S1QB 2KJ6A 3EC8A 2LXCA 3HIZA 4PYUA 2DHZA 3GOEA 2V4LA 3I3TB 4FJYA 4LDTB 1WJ4A 2MP2A 3AULA 3HM3A 3PGEA 3X23A 4HPLB 2KHWB 2WWZA 2D2QA 2CKHB 2A5UA 4XC2A 2XBBC 3AU5A 1FXTB 4W9GA 4GGQA 3VH3B 2C5LC 4E74A 2FCMA 2FCNA 4NY0A 3ZRCA 4B9KA 1UZXB 3ML9A 3PRMB 2KJRA 2KJHB 3M3JA 4BBNC 4PYZA 2YLMA 1ISNA 1UH6A 1WIAA 2V3SA 4MJSB 2AL3A 3LJ3A 1WXMA 3OLMD 4DDID 2ZJDA 1V6EA 2HJ8A 2ZVNA 4II3B 4GMVA 4AJYB 4G3XB 3QX1A 2CR5A 2JZZA 3ONSA 1WH3A 3X0WA 4F8CB 1IP9A 3UIPB 2Z0DB 5AZHA 2AWTA 2C7NB 2O6VD 4NAWA 4MM3A 4BKSA 2IO1B 4W9KA 3JSVA 3QHTA 2FCSA 3M63B 4OVUA 4KSKC 3PZDA 4TQ1A 3QIJA 4DHZE 3KYDD 2IY0B 3VTWA 1P3QU 4X57B 4HDOA 3H1UA 3L16A 1ZW7A 2NPTA 4W9EA 1LM8B 4BKGA 2HD5B 5GMVA 2GBNA 3K9PB 5LXIB 3VTUA 5EDSA 2K6QA 3VXWA 2KQ7A 3DBHI 1GC7A 2D11A 2KDIA 3L13A 3M95A 4EEWA 5D6JB 4EUTA 4W9IA 2N7DA 5CHVC 4KV2A 2GBMA 1E7VA 2DYMA 2B3AA 2FAZA 2HE7A 3ZLZA 2OOBB 1ZGUB 2JY6A 4IG7B 4EZKA 4ICUA 2LXAA 4M0WB 4ICVA 5DPRA 1L2NA 3QCAA 4HVBA 2LJ5A 2CHZA 2IO3B 3PLVA 2L3ZA 2JRHA 4WJOA 3DCGA 2DX5B 2IBIB 3BY4B 4GSWA 1SE9A 1V80A 2KTRB 3W1YA 2OJRA 3RZWC 2KWVB 4TUUA 3KUDB 2D07B 1OGWA 4JIOU 3IVFA 4PS8A 5KHQA 3V6CB 3ZIMA 2CU1A 4G0NB 1V5OA 2R2QA 2DZJA 3L08A 4KDIC 3DVGY 1E8WA 4FN2A 1WE7A 1L7YA 2MA9B 3DDCB 2L76A 4BBNF 1P0RA 3MHSD 2KNBA 3WALA 2KD0A 4NQLB 1WX9A 3T8MA 3ML8A 1WXAA 1Q1OA 3IG3A 2L00B 2NPTB 3CF6E 5J2RA 3NY5A 1F9JA 1LXDA 1GG3A 1X1MA 4BFRA 4K7SA 4FA6A 1G6JA 3AI5A 3OJ3A 1XT9B 1YQBA 4XZ4A 3AXCA 1V9JA 2K25A 2RR9A 3NZSA 4HDQA 3QQ8B 4A3OA 2GBJA 2QHOA 3ZTCA 5JHAA 2CHWA 1UELA 2KK8A 3PS6A 1QZEA 3VFKA 3NZUA 2L05A 4WJNA 3KUZA 2BKFA 1VD2A 1RAXA 2IYDB 2KDFB 3KW5B 4TV3A 3V61A 1RLFA 2N9EB 2ZNVC 4A3PA 1P9DU 4XX5A 4WWNA 4KDLB 1RRBA 5JH5C 1NBFC 4ZRJA 2ZCBA 2KC2A 1MG8A 2O6VB 2W9NA 2YVCA 2L0TA 4MH0E 3N32A 1E90A 1OEYA 1XD3B 2M1MA 4GXBA 4IM3A 5L95C 2N1WA 1R4NI 2ZNVB 2PJHA 4M8MA 3ZTDA 3L54A 3P2BA 4P7IA 3PRPB 3RUIB 3U7DA 3NS8A 2O6VA 1V5TA 2LI5A 1C3TA 1E5WA 5CHFA 3OJ4B 4FULA 5TR5A 1T0YA 3VUXA 1NI2A 3VAWA 4AWJA 2KN5A 3ALBA 5DPSA 1EUVB 2K8HA 3ECIA 2MBHA 2WX1A 2MP2B 4MELA 1J8CA 1E8XA 3DQVA 2REXA 5IAAC 4WWPA 2JXXA 3PRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXS A;  1C1Y B;  1PQS A;  1WR6 E;  2EMS A;  3H9D A;  4GU2 A;  3QAQ A;  4IM2 A;  5G2N A;  2NS5 A;  4ZYN A;  4EFO A;  2MBQ A;  4CYE A;  3ZW3 A;  3DVG X;  1I42 A;  2ZCC A;  1UGM A;  2NCN A;  4HWI B;  1GNU A;  2LGX A;  2KTF A;  4MJS A;  2K39 A;  5C1Z A;  1WR1 A;  3ZDM C;  1V2Y A;  3MTN B;  5D2M B;  3APC A;  1P1A A;  3BIN A;  5JHB A;  4MSQ B;  1WGR A;  3W1S C;  3H7P B;  1E8Z A;  2JPH A;  3UQB A;  3QA8 A;  4W9J A;  3UIO B;  1UBQ A;  3LDZ E;  3PLU A;  2JUO A;  4KIK A;  4ZDV A;  2J0J A;  4I6P A;  4MGY E;  2GMI C;  4KSL C;  3VUW A;  2GBK A;  3PV1 A;  2N4F A;  2BYV E;  2NVU I;  2ZZP B;  2FIF A;  4GIV A;  2BYE A;  5CTR C;  1GJZ A;  4NNJ B;  1WM2 A;  2DZK A;  3ZRF A;  3ZVV A;  5HKH A;  2GBR A;  3KYC D;  1UD7 A;  1LFD A;  1YD8 U;  2AEH A;  3PTF C;  5KHO A;  2DEN B;  2MSE D;  1V81 A;  2KLG A;  2RGF A;  5CHW A;  3A9K B;  4HLE A;  2KQS A;  2KLC A;  2LGD A;  2KDE B;  4F1S A;  5D94 A;  5IA7 A;  1KM7 A;  2LRU A;  2IY1 B;  3L0W B;  1K8R B;  2O2V B;  3OAW A;  1UBI A;  3A4S C;  2KAN A;  1WI0 A;  2JT4 B;  4I6L B;  2KFJ A;  2C60 A;  4ANW A;  2K6D B;  4W9C A;  3ZKJ C;  1YIW A;  3DBL I;  1YJ1 A;  1D3Z A;  4HCN B;  3H6N A;  3RCZ A;  4FJZ A;  3A9J B;  2BWE S;  2JVC A;  3DPD A;  2KTR A;  1WF9 A;  4IC7 B;  5E6N A;  2MW5 A;  2L7R A;  3V62 A;  1GC6 A;  4PS7 A;  3WA0 A;  3AU4 A;  2MBE A;  1KJT A;  3JSV B;  5LXH A;  2JRI B;  2CS4 A;  1LQB A;  2Z59 B;  3WAO A;  3ZNI D;  1TBE A;  2JF5 A;  5J17 A;  2M17 A;  3SD5 A;  3O65 B;  4RMA A;  1TTN A;  2N7E A;  5E6O A;  1AAR A;  3V60 A;  4URK A;  2EKE C;  1OEY J;  1WFY A;  2JZ3 B;  3QK0 A;  2WDT B;  1H8C A;  4NJ6 A;  1WGY A;  2FUH B;  1KLV A;  5J18 A;  1GUA B;  4ANX A;  3MJW A;  3KH0 A;  1IPG A;  1WGD A;  2MBO A;  3NOB A;  4FLH A;  1WMH B;  2KO3 A;  2G4D B;  4DHJ B;  4CO7 A;  2A4Z A;  4FHK A;  4GDK A;  1OQY A;  4A20 A;  3PSE B;  4IWO A;  3TIX A;  3QC8 B;  4AUQ C;  3A9K A;  1CMX B;  1NDD A;  4MGK E;  3A4R A;  4JGH B;  1YX5 B;  1ZKH A;  4W9D A;  1WMH A;  2LVP A;  3CST A;  3UF8 A;  2O2V A;  2KMC A;  4GDK B;  2NBV B;  1WXV A;  2LVQ A;  3UQA A;  1EO6 A;  3RT3 B;  4OVV A;  3R66 C;  5DCN A;  4EOY A;  2LUE A;  3N30 A;  4YL8 A;  1H4R A;  2G3Q B;  3QJZ A;  4GN1 A;  3B0A A;  2BF8 B;  5L83 A;  2G45 B;  2DZI A;  3PRE A;  1HE8 A;  3A9J A;  4DDG D;  3A33 B;  4JL9 A;  2D3G A;  3DVN U;  2BPS A;  5LLI A;  4BOS C;  1M94 A;  2LAS A;  2MLB A;  4BOZ B;  2J0K A;  3RZF A;  3W1S A;  3JW0 X;  2FID A;  1S3S G;  4EKU A;  1E7U A;  4K81 A;  4CHK A;  2I1K A;  2PE6 B;  3PHX B;  4J6I A;  5AZG A;  4F7Z A;  3DVN V;  2NBU A;  4KVG B;  4K1R B;  4N9F 4;  2DZM A;  1P98 A;  2L0F A;  3ZNG C;  2MX2 A;  4W9L A;  1VCB A;  3QAR A;  4I6N B;  3R7Q A;  2M0X A;  2ZPY A;  3Q3F A;  2KFK A;  4BVU C;  2AL6 A;  2C7H A;  3ZNH B;  2LWP A;  3C0R B;  4G50 A;  4DXA B;  1WGH A;  3VDZ A;  2DAF A;  1TZ1 A;  2M4N A;  4HJK A;  3H7S A;  2ZVO A;  3KVF B;  4LJO B;  2KFK B;  4EZL A;  4RM8 A;  1OTR B;  1EF1 A;  3KUC B;  2WX0 A;  2PEA A;  2BKR B;  5G55 A;  4FAD A;  1WJN A;  2KWC A;  3ZUN A;  2Y5B B;  1YX6 B;  2LD9 A;  2AYO B;  2Z0E B;  3EHV A;  3SDL C;  3B1L X;  5DPT A;  2LZ6 A;  2R2O A;  3IHP C;  1Y8R C;  1Q5W B;  2LVO A;  1Q0W B;  3R7R A;  3WAM A;  2V1Y A;  1WY8 A;  2FNJ B;  4NJ7 A;  4ANU A;  2KOX A;  4NAW B;  3UGB B;  4BKS D;  4IM0 A;  4B95 A;  1WZ3 A;  4FHJ A;  4FBJ B;  4II2 B;  2HTH A;  4TQ0 A;  4K7W A;  3PT2 B;  2RD0 A;  4ZRI A;  3TCA A;  3WAP A;  2J7Q B;  3B08 A;  2MRP A;  3V6E B;  2NBW B;  4WQO B;  1KOT A;  3VTV A;  1WJU A;  2NR2 A;  4HPM B;  4ZRK A;  4MGI E;  4GDL B;  4KZC A;  3ZNZ B;  4B6W A;  2IO2 B;  1JRU A;  3IBE A;  2RSU A;  3NHE B;  1V86 A;  1WX7 A;  1WX8 A;  3EEC A;  2CHX A;  3D32 A;  3U8Z A;  5FR6 A;  4KZ0 A;  5AZF A;  3RD2 A;  3DBS A;  3N3K B;  3WAN A;  4AJW A;  4GB9 A;  4GDL A;  3K9O B;  2MBB B;  3A1Q B;  2PPH A;  5JZE B;  2KVR A;  2KX0 A;  3JVZ X;  3TL5 A;  2M8S A;  2VRR B;  3APF A;  5AEK B;  3HK0 A;  2IZV B;  2C9W B;  4IUM B;  4WJQ A;  1U4A A;  3M62 B;  5CX3 A;  5BO4 B;  1IYF A;  3CSF A;  3VH4 B;  4RM9 A;  2KKC A;  4G11 A;  2XK5 B;  4WAA A;  2MQJ A;  3JYU A;  2C7M B;  1WM3 A;  4ANV A;  4EZJ A;  3QWZ B;  2GOW A;  3PHW B;  2K1F A;  2KWU B;  3A1Q A;  1RFA A;  1R4M I;  2KXJ A;  2LGY A;  4W9H A;  2ZEQ A;  2ASQ A;  2J0M A;  2XEW A;  4WWO A;  3TBL D;  3T9L A;  4KIK B;  4DHJ D;  4E3C A;  4NPN A;  2K8B A;  1J19 A;  3APD A;  2XK5 A;  5C23 A;  3RUL A;  3VVW B;  2RPQ A;  2ZPN A;  4IWP A;  1A5R A;  3VUY A;  3HM6 X;  2EMT A;  2KC1 A;  4TKN A;  2DYO A;  2K8C A;  4BKT A;  1J0G A;  2G4S A;  5D7G A;  3S2A A;  2LRW A;  4IWQ A;  3DOW A;  4E71 A;  2MWS B;  4NQK E;  3UIN B;  4LDT D;  4AOF A;  1XQQ A;  3ZO5 B;  4WJP A;  4LJP B;  4GOC A;  5DPW A;  4AP4 C;  3Q3J A;  4W9F A;  2MCN B;  3TJP A;  4DWF A;  3VHT C;  3SHQ A;  2D10 A;  4M8N A;  3HHM A;  2DYB A;  1Z2M A;  3EFU A;  3WIM A;  1I35 A;  2N1V A;  3VQI A;  4PS3 A;  2KDB A;  2FCQ A;  1EF5 A;  4MDK E;  1WGG A;  2JWZ A;  3ENE A;  3IFW B;  3ZDT A;  1WJ6 A;  2I1J A;  4HCP B;  4HXD A;  2UWQ A;  1WYW B;  4DK5 A;  4MEM A;  2KMA A;  4JQW C;  4MSM B;  1SGH A;  1WRD B;  1WE6 A;  4K7U A;  3CMM B;  4LCD E;  3TMP B;  2PE9 A;  2UYZ B;  3SU8 X;  2IO0 B;  2WYQ A;  3R3M A;  5E6P A;  4HK2 A;  3PVL A;  1V49 A;  4JLC A;  3PPA A;  3GZN I;  4FJV B;  2KX3 A;  2N9X A;  3U30 A;  1Z5S B;  2L8J A;  3L17 A;  4IW0 A;  4DBG A;  3RYT A;  1SIF A;  1WZ0 A;  1TGZ B;  2BGF A;  2BYF A;  3DBR I;  2KZR A;  3H7P A;  1BT0 A;  2DAJ A;  2N9P C;  2BWF A;  3L10 B;  4MGZ E;  4ASW C;  1E8Y A;  4DHZ B;  1S1Q B;  2KJ6 A;  3EC8 A;  2LXC A;  3HIZ A;  4PYU A;  2DHZ A;  3GOE A;  2V4L A;  3I3T B;  4FJY A;  4LDT B;  1WJ4 A;  2MP2 A;  3AUL A;  3HM3 A;  3PGE A;  3X23 A;  4HPL B;  2KHW B;  2WWZ A;  2D2Q A;  2CKH B;  2A5U A;  4XC2 A;  2XBB C;  3AU5 A;  1FXT B;  4W9G A;  4GGQ A;  3VH3 B;  2C5L C;  4E74 A;  2FCM A;  2FCN A;  4NY0 A;  3ZRC A;  4B9K A;  1UZX B;  3ML9 A;  3PRM B;  2KJR A;  2KJH B;  3M3J A;  4BBN C;  4PYZ A;  2YLM A;  1ISN A;  1UH6 A;  1WIA A;  2V3S A;  4MJS B;  2AL3 A;  3LJ3 A;  1WXM A;  3OLM D;  4DDI D;  2ZJD A;  1V6E A;  2HJ8 A;  2ZVN A;  4II3 B;  4GMV A;  4AJY B;  4G3X B;  3QX1 A;  2CR5 A;  2JZZ A;  3ONS A;  1WH3 A;  3X0W A;  4F8C B;  1IP9 A;  3UIP B;  2Z0D B;  5AZH A;  2AWT A;  2C7N B;  2O6V D;  4NAW A;  4MM3 A;  4BKS A;  2IO1 B;  4W9K A;  3JSV A;  3QHT A;  2FCS A;  3M63 B;  4OVU A;  4KSK C;  3PZD A;  4TQ1 A;  3QIJ A;  4DHZ E;  3KYD D;  2IY0 B;  3VTW A;  1P3Q U;  4X57 B;  4HDO A;  3H1U A;  3L16 A;  1ZW7 A;  2NPT A;  4W9E A;  1LM8 B;  4BKG A;  2HD5 B;  5GMV A;  2GBN A;  3K9P B;  5LXI B;  3VTU A;  5EDS A;  2K6Q A;  3VXW A;  2KQ7 A;  3DBH I;  1GC7 A;  2D11 A;  2KDI A;  3L13 A;  3M95 A;  4EEW A;  5D6J B;  4EUT A;  4W9I A;  2N7D A;  5CHV C;  4KV2 A;  2GBM A;  1E7V A;  2DYM A;  2B3A A;  2FAZ A;  2HE7 A;  3ZLZ A;  2OOB B;  1ZGU B;  2JY6 A;  4IG7 B;  4EZK A;  4ICU A;  2LXA A;  4M0W B;  4ICV A;  5DPR A;  1L2N A;  3QCA A;  4HVB A;  2LJ5 A;  2CHZ A;  2IO3 B;  3PLV A;  2L3Z A;  2JRH A;  4WJO A;  3DCG A;  2DX5 B;  2IBI B;  3BY4 B;  4GSW A;  1SE9 A;  1V80 A;  2KTR B;  3W1Y A;  2OJR A;  3RZW C;  2KWV B;  4TUU A;  3KUD B;  2D07 B;  1OGW A;  4JIO U;  3IVF A;  4PS8 A;  5KHQ A;  3V6C B;  3ZIM A;  2CU1 A;  4G0N B;  1V5O A;  2R2Q A;  2DZJ A;  3L08 A;  4KDI C;  3DVG Y;  1E8W A;  4FN2 A;  1WE7 A;  1L7Y A;  2MA9 B;  3DDC B;  2L76 A;  4BBN F;  1P0R A;  3MHS D;  2KNB A;  3WAL A;  2KD0 A;  4NQL B;  1WX9 A;  3T8M A;  3ML8 A;  1WXA A;  1Q1O A;  3IG3 A;  2L00 B;  2NPT B;  3CF6 E;  5J2R A;  3NY5 A;  1F9J A;  1LXD A;  1GG3 A;  1X1M A;  4BFR A;  4K7S A;  4FA6 A;  1G6J A;  3AI5 A;  3OJ3 A;  1XT9 B;  1YQB A;  4XZ4 A;  3AXC A;  1V9J A;  2K25 A;  2RR9 A;  3NZS A;  4HDQ A;  3QQ8 B;  4A3O A;  2GBJ A;  2QHO A;  3ZTC A;  5JHA A;  2CHW A;  1UEL A;  2KK8 A;  3PS6 A;  1QZE A;  3VFK A;  3NZU A;  2L05 A;  4WJN A;  3KUZ A;  2BKF A;  1VD2 A;  1RAX A;  2IYD B;  2KDF B;  3KW5 B;  4TV3 A;  3V61 A;  1RLF A;  2N9E B;  2ZNV C;  4A3P A;  1P9D U;  4XX5 A;  4WWN A;  4KDL B;  1RRB A;  5JH5 C;  1NBF C;  4ZRJ A;  2ZCB A;  2KC2 A;  1MG8 A;  2O6V B;  2W9N A;  2YVC A;  2L0T A;  4MH0 E;  3N32 A;  1E90 A;  1OEY A;  1XD3 B;  2M1M A;  4GXB A;  4IM3 A;  5L95 C;  2N1W A;  1R4N I;  2ZNV B;  2PJH A;  4M8M A;  3ZTD A;  3L54 A;  3P2B A;  4P7I A;  3PRP B;  3RUI B;  3U7D A;  3NS8 A;  2O6V A;  1V5T A;  2LI5 A;  1C3T A;  1E5W A;  5CHF A;  3OJ4 B;  4FUL A;  5TR5 A;  1T0Y A;  3VUX A;  1NI2 A;  3VAW A;  4AWJ A;  2KN5 A;  3ALB A;  5DPS A;  1EUV B;  2K8H A;  3ECI A;  2MBH A;  2WX1 A;  2MP2 B;  4MEL A;  1J8C A;  1E8X A;  3DQV A;  2REX A;  5IAA C;  4WWP A;  2JXX A;  3PRZ A; 
#chains in the Genus database with same CATH topology
 2J4X A;  2W3S A;  1WXS A;  1C1Y B;  3AV8 A;  1WR6 E;  3KQ4 A;  1FCL A;  3PO0 A;  3H9D A;  4GU2 A;  4IM2 A;  4US9 A;  3B2F A;  1BUI C;  4ZYN A;  4M01 A;  1ZXI A;  4CYE A;  3ZW3 A;  2ZCC A;  4HWI B;  4MJS A;  2RDH A;  1R7S A;  5C1Z A;  3BVG A;  5BYQ A;  4MSQ B;  1DOX A;  1WGR A;  1V8C A;  3IXS A;  1UBQ A;  3LDZ E;  3PLU A;  2JUO A;  1KOT A;  4ZDV A;  2J0J A;  3PV1 A;  3MJ5 A;  2FIF A;  1TS3 A;  5CTR C;  5HKH A;  2GBR A;  2JYT A;  2DEN B;  2KLG A;  1Q10 A;  2KQS A;  2KLC A;  3AEB B;  4F1S A;  2WHI A;  4RGO S;  5IA7 A;  1C79 A;  3L0W B;  1UBI A;  2KAN A;  3ZJV A;  3ZXV A;  2C60 A;  1DOY A;  3DBL I;  4WIP A;  1D3Z A;  4FJZ A;  3A9J B;  2BWE S;  4PS7 A;  5FKA C;  2AQ1 B;  2MBE A;  2GLS A;  5LXH A;  4YTP B;  1KLG D;  2M17 A;  4RMA A;  4URK A;  2N7E A;  1OEY J;  2HDE A;  2JZ3 B;  4NJ6 A;  1XO3 A;  2FUH B;  4ANX A;  4FLH A;  1WGD A;  1I4Q A;  4DHJ B;  4CO7 A;  1OQY A;  4YTN B;  3TEX A;  4AUQ C;  1QIL A;  2WU5 B;  3RNE C;  4JGH B;  4JWU C;  4W9D A;  3CST A;  3UF8 A;  1VLB A;  3UQA A;  2VZK B;  1EO6 A;  3RT3 B;  2DWQ A;  5DCN A;  2LUE A;  1N5X A;  4JPS A;  4YL8 A;  3RFZ B;  3QJZ A;  5T8I A;  3PRE A;  1HE8 A;  1JW9 D;  1OQR A;  1SEB D;  3A9J A;  1UNS A;  3DVN U;  3B2G A;  1TJE A;  1M94 A;  4BOZ B;  1R4N B;  4LNN A;  3RZF A;  2I38 A;  3J9C A;  3ZJU A;  1E7U A;  4CHK A;  2I1K A;  2E6X A;  2PE6 B;  4J6I A;  5AZG A;  2LUM A;  2QJL A;  2KFK A;  3ZNH B;  4G50 A;  2QSD A;  4PT5 A;  1JWU D;  4HJK A;  3TEZ A;  2H89 B;  1ZXH A;  1V1P A;  1BXT A;  2Y5P A;  1WJN A;  2Y5B B;  1JWM D;  2LD9 A;  2AYO B;  2Z0E B;  4HJG E;  3EHV A;  1ENF A;  3LYY A;  2R2O A;  2X8X X;  1Q5W B;  2LVO A;  1WY8 A;  1K53 A;  4NAW B;  3UGB B;  1HZ5 A;  2W55 A;  1WZ3 A;  4II2 B;  3GZN B;  4B0M A;  3PT2 B;  2RD0 A;  1TKG A;  3WAP A;  4DXF A;  3AEF B;  3B08 A;  2MRP A;  3V6E B;  4WQO B;  1WJU A;  1DOI A;  3IBE A;  1WX7 A;  4US8 A;  1NYR A;  5FR6 A;  1SXT A;  5AZF A;  2I2Y A;  3AE7 B;  4GDL A;  3NZ3 A;  1D5Z C;  2PPH A;  2KX0 A;  1WRI A;  2NMQ A;  3TL5 A;  5AEK B;  1E6E B;  1KFY B;  5E6J A;  5BO4 B;  1IYF A;  2KKC A;  2XK5 B;  3L4P A;  1JRP A;  3JYU A;  4ANV A;  4NJC A;  2GOW A;  2BT6 A;  2K1F A;  2KWU B;  4W9H A;  3TBL D;  2J0M A;  3GS2 A;  3T9L A;  2BS2 B;  2J53 A;  3RI7 C;  4IWP A;  1A5R A;  3VUY A;  3BK1 A;  4TKN A;  2DYO A;  4IWQ A;  4E71 A;  4NQK E;  5HG2 A;  2WXG A;  2ONQ A;  3AE1 B;  4WJP A;  1ZOY B;  3TJP A;  1XCQ L;  4AQ7 A;  3SHQ A;  1WGK A;  1I35 A;  4PS3 A;  4MDK E;  1WGG A;  2JWZ A;  3MP9 A;  2I1J A;  2UWQ A;  1WYW B;  3CIR B;  2KMA A;  4JQW C;  1WE6 A;  3CMM B;  3SU8 X;  2KMM A;  2WYQ A;  4P6V F;  4RF1 A;  5E6P A;  2MJE A;  2MJD A;  3PVL A;  4JLC A;  3PPA A;  1NVI D;  4C80 A;  1B1Z A;  2BB5 A;  3L17 A;  1WZ0 A;  2BGF A;  2N9P C;  2W3R A;  3W5V B;  1S1Q B;  2KJ6 A;  1J7B A;  3EC8 A;  4PYU A;  1CZP A;  2DHZ A;  4OZC A;  2N0S B;  3PGE A;  3X23 A;  4HPL B;  2WWZ A;  2D2Q A;  3C8Y A;  2CKH B;  2XBB C;  5BMG A;  4GGQ A;  3VR9 B;  2WDR B;  3ZRC A;  2KJR A;  2KJH B;  4PYZ A;  1TS2 A;  1T3Q A;  2YLM A;  4MJS B;  1UWX A;  3LJ3 A;  1WXM A;  4P1C C;  1L6V A;  4WWM A;  2ZJD A;  3NVW A;  4LLG M;  4G3X B;  1QF6 A;  4F8C B;  1WH3 A;  2Z0D B;  3I9V 1;  1J7C A;  2VH2 A;  4W9K A;  4OVU A;  1FXI A;  4KSK C;  3VTW A;  4JX1 C;  2L32 A;  4HDO A;  1LM8 B;  4BKG A;  2HD5 B;  1FIQ A;  3DBH I;  2KDI A;  5D6J B;  5CHV C;  2INP E;  3ZJT A;  1E7V A;  2DYM A;  2FAZ A;  2JY6 A;  4ZRP A;  2WXQ A;  5DPR A;  3NUH B;  1MVK A;  2CHZ A;  2IBI B;  1SE9 A;  3P1M A;  2KTR B;  2OJR A;  4WUR A;  2KWV B;  4JIO U;  1I7H A;  3IVF A;  4PS8 A;  3RNG C;  5KHQ A;  1YN3 A;  3U2S C;  4HRS A;  3L08 A;  1WE7 A;  3E9S A;  1KF6 B;  5C3J B;  3CF6 E;  4BFR A;  3BYT B;  3OJ3 A;  3AXC A;  4YSX B;  1QQR A;  4HDQ A;  2WXF A;  3W2D A;  2QMT A;  3RMK C;  3PS6 A;  1IBX A;  5JXV A;  1CK1 A;  1VD2 A;  2KDF B;  1XLP A;  1NEN B;  2PIA A;  3U52 E;  4OZB A;  3NRZ A;  1P9D U;  3E56 A;  1T5X D;  1E7P B;  4KGS A;  5HHD G;  1NBF C;  2WXP A;  1LGR A;  2N1W A;  1R4N I;  2PJH A;  4P7I A;  3RUI B;  3U7D A;  2O6V A;  5TR5 A;  1T0Y A;  2MJ3 A;  1ZDV A;  1PGX A;  3ECI A;  3Q6B A;  2MBH A;  2MP2 B;  4XDD A;  2KAC A;  1D5X C;  2RPV A;  4D2K A;  1UGM A;  1FNV A;  2LHE A;  2KTF A;  1CJE A;  4OW0 A;  1FM0 D;  5D2M B;  1P1A A;  3ZXR A;  2X38 A;  1E8Z A;  3EUB 2;  4MGY E;  1YQ3 B;  2GMI C;  2N4F A;  3LB8 C;  4NNJ B;  1WM2 A;  3NG0 A;  3AM9 A;  3Q8A A;  3KYC D;  2AEH A;  1VZ7 A;  1V81 A;  3A9K B;  2B76 B;  5D94 A;  1KM7 A;  2O2V B;  2VH1 A;  3AED B;  1WI0 A;  1ZE3 D;  2K6D B;  3H8H A;  3ZKJ C;  5MPO A;  4ZYS A;  1R4M B;  3DPD A;  2MW5 A;  2L7R A;  1GC6 A;  3WA0 A;  3AU4 A;  1T0R C;  1VZ6 A;  2HTM E;  1SF0 A;  2WXL A;  1LQB A;  2Z59 B;  3ZNI D;  3SD5 A;  1TTN A;  2EKE C;  2WXN A;  1XLO A;  1H8C A;  3DBH B;  3IT6 B;  3MJW A;  1TKY A;  2MBO A;  1DGJ A;  2G4D B;  4GDK A;  5EE1 A;  3PSE B;  3A9K A;  4XDC A;  1NDD A;  4MGK E;  3A4R A;  1C4A A;  3GB1 A;  1ZKH A;  2O2V A;  2KMC A;  2QCZ A;  3Q69 A;  3R66 C;  4EOY A;  3AEC B;  4OHJ A;  1H4R A;  4DDG D;  3A33 B;  4JL9 A;  3AE5 B;  1F52 A;  4BOS C;  2LAS A;  4C4V A;  2J0K A;  4L2Y A;  3JW0 X;  1SE3 A;  4EKU A;  1S3S G;  1YJI A;  3DVN V;  2DZM A;  4W9L A;  1VCB A;  2M56 B;  1OFF A;  4I6N B;  3R7Q A;  5FR3 A;  3Q3F A;  4BVU C;  4ITK A;  2C7H A;  1WGH A;  3VDZ A;  3MC8 A;  3IT4 B;  2ZVO A;  4LJO B;  2KFK B;  3KUC B;  2WX0 A;  1SIJ A;  5G5G A;  1B9R A;  2KWC A;  4H2A A;  3SDL C;  4LNO A;  3IHP C;  1SB3 C;  1FRR A;  1UWM A;  3R7R A;  3WAM A;  1K50 A;  2V1Y A;  4LTU A;  4ANU A;  4MAC A;  4IM0 A;  1OQQ A;  2HTH A;  3AEG B;  2J7Q B;  2NR2 A;  4HPM B;  1TS5 A;  1VZ8 A;  1N62 A;  3P4Q B;  1V86 A;  1WX8 A;  1XEE A;  2PTL A;  3D32 A;  2J52 A;  3U8Z A;  2PMV A;  4KZ0 A;  1FNU A;  2UU7 A;  3Q8E A;  3N3K B;  4R3D A;  3AN1 A;  4GB9 A;  3WAN A;  1IUE A;  2VRR B;  3APF A;  1I4H A;  3HK0 A;  1U4A A;  2HJ1 A;  4RM9 A;  4YT0 B;  4EZJ A;  2LFI A;  1RFA A;  1QOB A;  1R4M I;  4N58 A;  2L1A A;  2ASQ A;  2ZEQ A;  2K22 A;  4KIK B;  4E3C A;  5C23 A;  2XK5 A;  3RUL A;  3VVW B;  2RPQ A;  2ZPN A;  1NYQ A;  4MH8 A;  5BMI A;  2KC1 A;  1PYW D;  4WAF A;  5HI1 A;  5D7G A;  2BYT A;  1TY2 A;  4XGA B;  3DOW A;  2MWS B;  1FRD A;  3W9C B;  4GOC A;  5DPW A;  1ZUD 2;  4GLS C;  3I63 C;  1A70 A;  2D10 A;  2DYB A;  5EE3 A;  3VRA B;  2FCQ A;  3AH7 A;  1C78 A;  3IFW B;  3ZDT A;  2LMC A;  4HXD A;  1VJK A;  4HCP B;  4MSM B;  3RNA C;  4A90 A;  3TMP B;  2UYZ B;  1SJH D;  1ESF A;  1GB1 A;  3IAS 1;  3P4R B;  3GZN I;  2KX3 A;  2GB1 A;  2L8J A;  4DBG A;  2IDY A;  3RYT A;  1SIF A;  1AW7 A;  2DAJ A;  4ASW C;  5I4D A;  3R8B A;  1FPY A;  4DHZ B;  3N1Z C;  1L5P A;  1FXA A;  5HFY A;  3ZYY X;  1FCC C;  1TT5 B;  5IO9 A;  1WJ4 A;  3V05 A;  3AUL A;  2KHW B;  4XC2 A;  2IGD A;  3AU5 A;  1XLN A;  3Q2A C;  4NY0 A;  1L0Y B;  3EGR A;  1PGB A;  1UZX B;  1E10 A;  5H92 C;  3ML9 A;  4BBN C;  3M3J A;  2E3T A;  3FC4 A;  1ISN A;  3NVZ A;  3PZ8 A;  4DDI D;  2H88 B;  2ZVN A;  3DBL B;  4II3 B;  2XN9 C;  4GMV A;  1E0Z A;  3X0W A;  3QX1 A;  1XLQ A;  1IP9 A;  3NVY A;  2N7J A;  3UIP B;  5AZH A;  4WH4 A;  2C7N B;  2O6V D;  4BKS A;  4MM3 A;  4TQ1 A;  4KGR A;  4RNA A;  3QIJ A;  2KDM A;  3KYD D;  2EKI A;  2IY0 B;  1P3Q U;  4X57 B;  4W9E A;  2NPT A;  4WQM A;  4N59 A;  3DBR B;  2GBN A;  3W5U B;  4A55 A;  3VTU A;  2K6Q A;  3I5J C;  2D3C A;  3M95 A;  1D6E C;  2MH7 A;  2WXI A;  2N7D A;  3ZLZ A;  4KV2 A;  1GOZ A;  2HE7 A;  2OOB B;  1ZGU B;  1IBX B;  4ICU A;  2LXA A;  3QCA A;  4HVB A;  2OJW A;  1F2R C;  1QKZ A;  3PLV A;  2L3Z A;  1YOV B;  3BY4 B;  4GSW A;  3W1Y A;  2WQY B;  3RZW C;  3KUD B;  2D07 B;  1PDX A;  3AB5 A;  3GE3 C;  2K5P A;  2DZJ A;  4KDI C;  4FN2 A;  4ARC A;  4A6Q A;  1XF5 L;  3DDC B;  4BBN F;  2WU2 B;  3MHS D;  4KKI A;  2KNB A;  5IP4 D;  1WX9 A;  1ZP0 B;  3ML8 A;  1WXA A;  4YTM B;  1V97 A;  2L00 B;  2NPT B;  3IAM 1;  1GG3 A;  1X1M A;  4USA A;  4K7S A;  1HQR D;  4ZRQ A;  1G6J A;  1V9J A;  1P7E A;  1RWS A;  3ZTC A;  2LHD A;  2JYE A;  1JWB D;  1UEL A;  2M0A A;  1QZE A;  1HZ6 A;  3NZU A;  4WJN A;  3KUZ A;  2BKF A;  2IYD B;  1RAX A;  4TV3 A;  3ABV B;  4XX5 A;  1I4X A;  3Q3M C;  5JH5 C;  4NZL B;  2W9N A;  4MH0 E;  3N32 A;  1E90 A;  1XD3 B;  2M1M A;  2WXK A;  5L95 C;  2EEL A;  3Q8F A;  2RDB C;  3NS8 A;  4LNI A;  2LI5 A;  1C3T A;  3N1Y C;  4FXC A;  3OJ4 B;  3VAW A;  5DPS A;  1C76 A;  2WX1 A;  5IN7 A;  3Q8B A;  1ACC A;  2JWU A;  4K3C A;  4M00 A;  1J8C A;  3DQV A;  2REX A;  2JXX A;  2BQQ A;  1IGD A;  1PQS A;  1V1P B;  4IKG A;  1FEH A;  1HTQ A;  3DVG X;  3NVV A;  2NCN A;  1GNU A;  2LGX A;  2K39 A;  3ZDM C;  1L0X B;  1V2Y A;  3MTN B;  3P63 A;  3APC A;  5JHB A;  1KRH A;  3W1S C;  3H7P B;  2JPH A;  4XYC A;  4P16 A;  3UQB A;  2PLP A;  3QA8 A;  3Q14 C;  3UIO B;  2JXT A;  2K9X A;  4I6P A;  5GXG B;  4KSL C;  2IPK D;  2GBK A;  3BYY B;  2BYV E;  2ZZP B;  4J3O D;  4LNK A;  2DZK A;  2WS3 B;  3ZRF A;  1VR9 A;  3ZVV A;  3GP7 A;  1UD7 A;  3NS1 A;  1V1O A;  2MSE D;  2RGF A;  5CHW A;  4HLE A;  3MHZ A;  2LGD A;  2KDE B;  2GRI A;  2IY1 B;  3OAW A;  3A4S C;  1JCK B;  1FMA D;  1QOF A;  1YIW A;  5BYR A;  4HCN B;  2BB6 A;  3RCZ A;  2JVC A;  2M19 A;  1WF9 A;  2BS4 B;  1GB4 A;  2IJ0 A;  2RMM A;  1KJT A;  3JSV B;  1TBE A;  1F2R I;  3O65 B;  1AAR A;  2MHJ A;  1ZDX A;  1WFY A;  3KLS X;  3P4S B;  1TIF A;  1WGY A;  5J18 A;  1GUA B;  3EFC A;  1IPG A;  2KO3 A;  4A20 A;  4IWO A;  3TIX A;  3QC8 B;  4L1B A;  1YX5 B;  2PVG C;  1D4B A;  4C7Y A;  1D5M C;  4PK1 A;  1I4R A;  4GDK B;  4HKZ E;  2LVQ A;  4OVV A;  1WWT A;  1Y56 A;  3N20 C;  2G3Q B;  4GN1 A;  2D3A A;  3B0A A;  5L83 A;  2G45 B;  3BWU D;  2BPS A;  1L6U A;  2Q5W D;  1FD6 A;  2YEP F;  1QLB B;  2FUG 1;  2LGS A;  3N1X C;  2JX5 A;  4K81 A;  1HEZ E;  4HRO A;  4BAX A;  4KVG B;  2K3U A;  1C77 A;  4N9F 4;  2JSV X;  2L0F A;  4MT5 A;  1XXG A;  3QAR A;  2M0X A;  2AL6 A;  1QT9 A;  1TKE A;  2JU6 X;  1HXY D;  5IKC M;  4XWT A;  4RM8 A;  1OTR B;  2PEA A;  5G55 A;  4FAD A;  3ZUN A;  2ZW0 A;  1YX6 B;  3HVZ A;  1KTK A;  2V4I B;  1YN5 A;  3FIL B;  3B1L X;  3GE8 C;  4REZ A;  5DPT A;  3VRB B;  2LZ6 A;  1Y8R C;  3Q3O C;  4JE3 B;  1Q0W B;  2IGG A;  4NJ7 A;  4XE0 A;  3FIL A;  4FHJ A;  4FBJ B;  4TQ0 A;  4K7W A;  3DWG C;  2WXJ A;  2NBW B;  3VTV A;  3N9Y C;  4ZRK A;  4MGI E;  3ZNZ B;  4B6W A;  1JRU A;  3DHI C;  3RD2 A;  4AJW A;  2MBB B;  1KLU D;  2KVR A;  3JVZ X;  2M8S A;  2IZV B;  2C9W B;  4IUM B;  4WJQ A;  1FNW A;  4G11 A;  2MQJ A;  2C7M B;  1WM3 A;  2BTE A;  3PHW B;  1WXQ A;  2KXJ A;  2LGY A;  3I57 A;  1XCT L;  2Y5C A;  2K8B A;  3P4P B;  2INN E;  3HM6 X;  2EMT A;  1MI0 A;  2PVO D;  4TMA B;  2G4S A;  2LRW A;  2FE8 A;  3AE9 B;  1EWC A;  2L83 A;  1HA5 A;  4LDT D;  3ZO5 B;  1SSN A;  4LJP B;  3Q3J A;  2VZK D;  4W9F A;  4HPP A;  1PFD A;  2MCN B;  3HHM A;  1Z2M A;  3ETR A;  3WIM A;  2KDB A;  3U4E G;  4RCO A;  3FAH A;  3TSS A;  4DK5 A;  2WDV B;  1CQV A;  1SGH A;  1WRD B;  2CJO A;  4K7U A;  4LCD E;  3AMZ A;  1MHH E;  3WCQ A;  1ET6 A;  1L0V B;  4HK2 A;  1V49 A;  4FJV B;  4KX6 B;  1Z5S B;  2PW9 A;  1TGZ B;  2YEP B;  2W54 A;  4MGZ E;  3P42 A;  4NAM A;  3PZ7 A;  2DBY A;  1JQ4 A;  2L52 A;  2V4L A;  3I3T B;  4FJY A;  2FBW B;  2DLB A;  2MP2 A;  3URY A;  1FXT B;  1LO5 D;  1RFK A;  4LNF A;  4Q2J A;  1VDV A;  2AQ2 B;  4E74 A;  1I4P A;  2FCN A;  1IGC A;  4B9K A;  1SE2 A;  1UH6 A;  2V3S A;  2AL3 A;  3OLM D;  2Y3A A;  2V9H A;  3BZD B;  3HUI A;  3KWV A;  3RPF C;  2JZZ A;  3ONS A;  3SFD B;  1MHX A;  4NAW A;  3RNB C;  2N9K A;  3QHT A;  3RNF C;  2FCS A;  3PZD A;  1ET9 A;  1TYG B;  4YXD B;  3L16 A;  3MC9 A;  3ZGZ A;  4RGM A;  4MM3 B;  5GMV A;  3K9P B;  3Q3N C;  5LXI B;  5EDS A;  4RH6 A;  2D11 A;  1F77 A;  3L13 A;  2GBM A;  4IG7 B;  2ICI A;  3BVM A;  1MFW A;  4L23 A;  4WJO A;  2DX5 B;  1V80 A;  3RNC C;  4HKQ A;  4TUU A;  1OGW A;  2IND C;  3V6C B;  3TEY A;  3OWE B;  3ZIM A;  4G0N B;  4EE2 A;  3DVG Y;  2ZW1 A;  2MA9 B;  3SEB A;  2RDG A;  1I4G A;  1P0R A;  3WAL A;  2KD0 A;  1DYQ A;  3T8M A;  1PGA A;  3R2T A;  3NY5 A;  1F9J A;  5FK9 C;  1LXD A;  2KT7 A;  4FA6 A;  3AI5 A;  1RYJ A;  2ACZ B;  4IOI E;  2K25 A;  3MFG A;  3NZS A;  1J7A A;  3QQ8 B;  5JHA A;  2CHW A;  3VR8 B;  5D3I B;  3VFK A;  2L05 A;  3UI3 A;  3AE2 B;  4ZHO A;  1FFU A;  1EU4 A;  4KDL B;  1RRB A;  2V0G A;  1PUT A;  4ZRJ A;  2ZCB A;  3FKY A;  1N5W A;  2NTS A;  1MG8 A;  1WSP A;  2L0T A;  4RF0 A;  4C4V B;  1SJE D;  4GXB A;  2Z8L A;  1NEK B;  3EA6 A;  4M8M A;  3ZTD A;  3Q8C A;  4OZA A;  3PRP B;  1P7F A;  1V5T A;  1E5W A;  1NI3 A;  3ALB A;  1ROE A;  1EUV B;  2K8H A;  4IDI A;  1E8X A;  1K51 A;  1MPE A;  1N63 A;  4WWP A;  3PRZ A;  3ZQ4 A;  2WXH A;  2EMS A;  3QAQ A;  5G2N A;  1K52 A;  2NS5 A;  4EFO A;  3BK2 A;  1JWA D;  2MBQ A;  2WDQ B;  3DWM A;  3V3X A;  1I42 A;  3T3O A;  1WR1 A;  1JRO A;  2G9H D;  3HVD A;  5BMH A;  3BIN A;  3BVZ A;  3TEW A;  4W9J A;  4KIK A;  3VUW A;  3DHH C;  2NVU I;  1T0S C;  3C19 A;  2OED A;  4GIV A;  2BYE A;  1GJZ A;  5TSS A;  2IGH A;  1YD8 U;  1LFD A;  5KHO A;  3PTF C;  2KQ4 X;  1M4V A;  2D3B A;  2PKO A;  2K0P A;  2KVZ A;  2LRU A;  2N9L A;  1K8R B;  2JT4 B;  2KWD A;  1C4C A;  4I6L B;  1HTO A;  2KFJ A;  1JAL A;  3AEE B;  2BVC A;  4W9C A;  1VRA B;  4ZOH C;  1YJ1 A;  4S17 A;  2WP9 B;  4XWW A;  2QIE B;  3H6N A;  1QOA A;  1YQ4 B;  2KTR A;  4IC7 B;  5E6N A;  4YWG G;  3V62 A;  4HEA 1;  1F0Z A;  2JRI B;  2CS4 A;  4B0E A;  1F1H A;  3WAO A;  1WYG A;  3DHG C;  2JF5 A;  5J17 A;  5G5H A;  4AS1 A;  5E6O A;  3V60 A;  3O13 A;  3QK0 A;  1TS4 A;  2WDT B;  1KLV A;  1AWD A;  1YMH E;  3KH0 A;  3NOB A;  1WMH B;  4ZHP A;  2A4Z A;  4FHK A;  1EU3 A;  1CMX B;  1WMH A;  2LVP A;  2NBV B;  1WXV A;  4ACF A;  3N30 A;  2BW2 A;  2BF8 B;  3AE4 B;  2DZI A;  2W82 A;  2D5G A;  5AUK A;  2D3G A;  5LLI A;  2MLB A;  2BBC A;  3W1S A;  2MEK A;  1T0Q C;  2FID A;  2SAK A;  4K3B A;  3PHX B;  4N6E B;  4F7Z A;  2NBU A;  4K1R B;  1P98 A;  3ZNG C;  2MX2 A;  3U7Z A;  2ZPY A;  1L4D B;  2LWP A;  3C0R B;  3KWL A;  4DXA B;  1C4P A;  1GAQ B;  1UGJ A;  2DAF A;  1TZ1 A;  2M4N A;  3H7S A;  3KVF B;  4S0R A;  4EZL A;  1EF1 A;  2WNM A;  2BKR B;  1JWS D;  1JML A;  1SE4 A;  4ARI A;  2JZP A;  4RFB A;  1FFV A;  1ZPS A;  2FNJ B;  2KOX A;  1E9M A;  4BKS D;  1EWY C;  4B95 A;  5C2T B;  3TUO A;  2V3N A;  5D3D A;  4ZRI A;  3TCA A;  2ON8 A;  4RGT A;  4GDL B;  4KZC A;  1RM6 C;  1N61 A;  2IO2 B;  3LXF A;  2RSU A;  3NHE B;  2XNA C;  3EEC A;  2CHX A;  2INC C;  3DBS A;  3K9O B;  1FO4 A;  3A1Q B;  5JZE B;  5CX3 A;  3M62 B;  3CSF A;  3VH4 B;  4WAA A;  5EE9 A;  2KYW A;  3QWZ B;  3A1Q A;  4RGN A;  2XEW A;  4WWO A;  4DHJ D;  4NPN A;  1J19 A;  1MG4 A;  3APD A;  1KH0 A;  4QAY A;  5LNK 1;  1UUP A;  2K8C A;  4BKT A;  4DXG A;  3SR6 A;  1J0G A;  4CQN A;  3S2A A;  3SFE B;  2CU3 A;  1GPX A;  3UIN B;  2GI9 A;  4AOF A;  1XQQ A;  2V3P A;  4JWS C;  4AP4 C;  4DWF A;  3VHT C;  4M8N A;  1QOG A;  3EFU A;  3OG5 A;  2N1V A;  3VQI A;  1EF5 A;  2QEJ C;  3ENE A;  2WXM A;  1WJ6 A;  4MEM A;  1YNT E;  2QIL A;  2PE9 A;  2IO0 B;  1AN8 A;  3R3M A;  2AX5 A;  2KAJ A;  3U30 A;  2N9X A;  4IW0 A;  3RN9 C;  2BYF A;  2G1E A;  3DBR I;  2KZR A;  3H7P A;  1BT0 A;  3L10 B;  2BWF A;  1E8Y A;  2NTT A;  3R2I A;  2LXC A;  3HIZ A;  4BZA A;  3AE8 B;  1YJJ A;  3GOE A;  3HRD D;  4LDT B;  1C9F A;  3HM3 A;  5IOI A;  2A5U A;  1UF0 A;  3AE3 B;  4M0W A;  4W9G A;  2WGS A;  3VH3 B;  2C5L C;  2FCM A;  1BML C;  4C7Z A;  3PRM B;  1WIA A;  4O1N A;  1SBB B;  1V6E A;  2HJ8 A;  2LGI A;  3AEA B;  4AJY B;  2CR5 A;  4A9A A;  3T3N A;  2AWT A;  2IO1 B;  3JSV A;  3M63 B;  5BYS A;  4DHZ E;  3H1U A;  1ZW7 A;  4TSS A;  4C00 A;  4LK0 M;  4A8X C;  3VXW A;  1STE A;  2KQ7 A;  2TSS A;  1GC7 A;  1L4Z B;  2WXR A;  4EEW A;  1N60 A;  4EUT A;  4C56 C;  2KN4 A;  4W9I A;  4ANW A;  2WLB A;  2B3A A;  2WXO A;  4M02 A;  5AUI A;  4EZK A;  4M0W B;  4ICV A;  3B9J A;  1L2N A;  2J42 A;  2LJ5 A;  2IO3 B;  2JRH A;  3DCG A;  1TY0 A;  1N6Z A;  3NJT A;  5EE0 A;  1T6B X;  2AQ3 B;  2QDF A;  2CU1 A;  1V5O A;  2R2Q A;  1E8W A;  2SEB D;  1L7Y A;  3BII D;  2L76 A;  4NQL B;  1Q1O A;  4OVZ A;  2CJN A;  3IG3 A;  5J2R A;  2DNF A;  4XZ4 A;  1XT9 B;  1YQB A;  2RR9 A;  2JQR B;  4A3O A;  2GBJ A;  2QHO A;  2KK8 A;  2QC8 A;  3KW5 B;  3V61 A;  1RLF A;  2N9E B;  2ZNV C;  4A3P A;  2BS3 B;  4YSY B;  3MC0 B;  1TZO A;  4WWN A;  2LEK A;  2LJI A;  1EM7 A;  2KC2 A;  1AYF A;  2O6V B;  2YVC A;  4P1B C;  1OEY A;  3CWI A;  4IM3 A;  5H8Y E;  2ZNV B;  4KGT A;  3L54 A;  3P2B A;  4KKJ A;  1MJD A;  5CHF A;  4FUL A;  4UDU C;  3AE6 B;  4DQO C;  3VUX A;  1NI2 A;  4AWJ A;  2KN5 A;  2OHF A;  1YN4 A;  2R61 A;  4MEL A;  4YSZ B;  5IAA C; 
#chains in the Genus database with same CATH homology
 1WXS A;  1C1Y B;  1PQS A;  1WR6 E;  2EMS A;  3H9D A;  4GU2 A;  3QAQ A;  4IM2 A;  5G2N A;  2NS5 A;  4ZYN A;  4EFO A;  2MBQ A;  4CYE A;  3ZW3 A;  3DVG X;  1I42 A;  2ZCC A;  1UGM A;  2NCN A;  4HWI B;  1GNU A;  2LGX A;  2KTF A;  4MJS A;  2K39 A;  5C1Z A;  1WR1 A;  3ZDM C;  1V2Y A;  3MTN B;  5D2M B;  3APC A;  1P1A A;  3BIN A;  5JHB A;  4MSQ B;  1WGR A;  3W1S C;  3H7P B;  1E8Z A;  2JPH A;  3UQB A;  3QA8 A;  4W9J A;  3UIO B;  1UBQ A;  3LDZ E;  3PLU A;  2JUO A;  4KIK A;  4ZDV A;  2J0J A;  4I6P A;  4MGY E;  2GMI C;  4KSL C;  3VUW A;  2GBK A;  3PV1 A;  2N4F A;  2BYV E;  2NVU I;  2ZZP B;  2FIF A;  4GIV A;  2BYE A;  5CTR C;  1GJZ A;  4NNJ B;  1WM2 A;  2DZK A;  3ZRF A;  3ZVV A;  5HKH A;  2GBR A;  3KYC D;  1UD7 A;  1LFD A;  1YD8 U;  2AEH A;  3PTF C;  5KHO A;  2DEN B;  2MSE D;  1V81 A;  2KLG A;  2RGF A;  5CHW A;  3A9K B;  4HLE A;  2KQS A;  2KLC A;  2LGD A;  2KDE B;  4F1S A;  5D94 A;  5IA7 A;  1KM7 A;  2LRU A;  2IY1 B;  3L0W B;  1K8R B;  2O2V B;  3OAW A;  1UBI A;  3A4S C;  2KAN A;  1WI0 A;  2JT4 B;  4I6L B;  2KFJ A;  2C60 A;  4ANW A;  2K6D B;  4W9C A;  3ZKJ C;  1YIW A;  3DBL I;  1YJ1 A;  1D3Z A;  4HCN B;  3H6N A;  3RCZ A;  4FJZ A;  3A9J B;  2BWE S;  2JVC A;  3DPD A;  2KTR A;  1WF9 A;  4IC7 B;  5E6N A;  2MW5 A;  2L7R A;  3V62 A;  1GC6 A;  4PS7 A;  3WA0 A;  3AU4 A;  2MBE A;  1KJT A;  3JSV B;  5LXH A;  2JRI B;  2CS4 A;  1LQB A;  2Z59 B;  3WAO A;  3ZNI D;  1TBE A;  2JF5 A;  5J17 A;  2M17 A;  3SD5 A;  3O65 B;  4RMA A;  1TTN A;  2N7E A;  5E6O A;  1AAR A;  3V60 A;  4URK A;  2EKE C;  1OEY J;  1WFY A;  2JZ3 B;  3QK0 A;  2WDT B;  1H8C A;  4NJ6 A;  1WGY A;  2FUH B;  1KLV A;  5J18 A;  1GUA B;  4ANX A;  3MJW A;  3KH0 A;  1IPG A;  1WGD A;  2MBO A;  3NOB A;  4FLH A;  1WMH B;  2KO3 A;  2G4D B;  4DHJ B;  4CO7 A;  2A4Z A;  4FHK A;  4GDK A;  1OQY A;  4A20 A;  3PSE B;  4IWO A;  3TIX A;  3QC8 B;  4AUQ C;  3A9K A;  1CMX B;  1NDD A;  4MGK E;  3A4R A;  4JGH B;  1YX5 B;  1ZKH A;  4W9D A;  1WMH A;  2LVP A;  3CST A;  3UF8 A;  2O2V A;  2KMC A;  4GDK B;  2NBV B;  1WXV A;  2LVQ A;  3UQA A;  1EO6 A;  3RT3 B;  4OVV A;  3R66 C;  5DCN A;  4EOY A;  2LUE A;  3N30 A;  4YL8 A;  1H4R A;  2G3Q B;  3QJZ A;  4GN1 A;  3B0A A;  2BF8 B;  5L83 A;  2G45 B;  2DZI A;  3PRE A;  1HE8 A;  3A9J A;  4DDG D;  3A33 B;  4JL9 A;  2D3G A;  3DVN U;  2BPS A;  5LLI A;  4BOS C;  1M94 A;  2LAS A;  2MLB A;  4BOZ B;  2J0K A;  3RZF A;  3W1S A;  3JW0 X;  2FID A;  1S3S G;  4EKU A;  1E7U A;  4K81 A;  4CHK A;  2I1K A;  2PE6 B;  3PHX B;  4J6I A;  5AZG A;  4F7Z A;  3DVN V;  2NBU A;  4KVG B;  4K1R B;  4N9F 4;  2DZM A;  1P98 A;  2L0F A;  3ZNG C;  2MX2 A;  4W9L A;  1VCB A;  3QAR A;  4I6N B;  3R7Q A;  2M0X A;  2ZPY A;  3Q3F A;  2KFK A;  4BVU C;  2AL6 A;  2C7H A;  3ZNH B;  2LWP A;  3C0R B;  4G50 A;  4DXA B;  1WGH A;  3VDZ A;  2DAF A;  1TZ1 A;  2M4N A;  4HJK A;  3H7S A;  2ZVO A;  3KVF B;  4LJO B;  2KFK B;  4EZL A;  4RM8 A;  1OTR B;  1EF1 A;  3KUC B;  2WX0 A;  2PEA A;  2BKR B;  5G55 A;  4FAD A;  1WJN A;  2KWC A;  3ZUN A;  2Y5B B;  1YX6 B;  2LD9 A;  2AYO B;  2Z0E B;  3EHV A;  3SDL C;  3B1L X;  5DPT A;  2LZ6 A;  2R2O A;  3IHP C;  1Y8R C;  1Q5W B;  2LVO A;  1Q0W B;  3R7R A;  3WAM A;  2V1Y A;  1WY8 A;  2FNJ B;  4NJ7 A;  4ANU A;  2KOX A;  4NAW B;  3UGB B;  4BKS D;  4IM0 A;  4B95 A;  1WZ3 A;  4FHJ A;  4FBJ B;  4II2 B;  2HTH A;  4TQ0 A;  4K7W A;  3PT2 B;  2RD0 A;  4ZRI A;  3TCA A;  3WAP A;  2J7Q B;  3B08 A;  2MRP A;  3V6E B;  2NBW B;  4WQO B;  1KOT A;  3VTV A;  1WJU A;  2NR2 A;  4HPM B;  4ZRK A;  4MGI E;  4GDL B;  4KZC A;  3ZNZ B;  4B6W A;  2IO2 B;  1JRU A;  3IBE A;  2RSU A;  3NHE B;  1V86 A;  1WX7 A;  1WX8 A;  3EEC A;  2CHX A;  3D32 A;  3U8Z A;  5FR6 A;  4KZ0 A;  5AZF A;  3RD2 A;  3DBS A;  3N3K B;  3WAN A;  4AJW A;  4GB9 A;  4GDL A;  3K9O B;  2MBB B;  3A1Q B;  2PPH A;  5JZE B;  2KVR A;  2KX0 A;  3JVZ X;  3TL5 A;  2M8S A;  2VRR B;  3APF A;  5AEK B;  3HK0 A;  2IZV B;  2C9W B;  4IUM B;  4WJQ A;  1U4A A;  3M62 B;  5CX3 A;  5BO4 B;  1IYF A;  3CSF A;  3VH4 B;  4RM9 A;  2KKC A;  4G11 A;  2XK5 B;  4WAA A;  2MQJ A;  3JYU A;  2C7M B;  1WM3 A;  4ANV A;  4EZJ A;  3QWZ B;  2GOW A;  3PHW B;  2K1F A;  2KWU B;  3A1Q A;  1RFA A;  1R4M I;  2KXJ A;  2LGY A;  4W9H A;  2ZEQ A;  2ASQ A;  2J0M A;  2XEW A;  4WWO A;  3TBL D;  3T9L A;  4KIK B;  4DHJ D;  4E3C A;  4NPN A;  2K8B A;  1J19 A;  3APD A;  2XK5 A;  5C23 A;  3RUL A;  3VVW B;  2RPQ A;  2ZPN A;  4IWP A;  1A5R A;  3VUY A;  3HM6 X;  2EMT A;  2KC1 A;  4TKN A;  2DYO A;  2K8C A;  4BKT A;  1J0G A;  2G4S A;  5D7G A;  3S2A A;  2LRW A;  4IWQ A;  3DOW A;  4E71 A;  2MWS B;  4NQK E;  3UIN B;  4LDT D;  4AOF A;  1XQQ A;  3ZO5 B;  4WJP A;  4LJP B;  4GOC A;  5DPW A;  4AP4 C;  3Q3J A;  4W9F A;  2MCN B;  3TJP A;  4DWF A;  3VHT C;  3SHQ A;  2D10 A;  4M8N A;  3HHM A;  2DYB A;  1Z2M A;  3EFU A;  3WIM A;  1I35 A;  2N1V A;  3VQI A;  4PS3 A;  2KDB A;  2FCQ A;  1EF5 A;  4MDK E;  1WGG A;  2JWZ A;  3ENE A;  3IFW B;  3ZDT A;  1WJ6 A;  2I1J A;  4HCP B;  4HXD A;  2UWQ A;  1WYW B;  4DK5 A;  4MEM A;  2KMA A;  4JQW C;  4MSM B;  1SGH A;  1WRD B;  1WE6 A;  4K7U A;  3CMM B;  4LCD E;  3TMP B;  2PE9 A;  2UYZ B;  3SU8 X;  2IO0 B;  2WYQ A;  3R3M A;  5E6P A;  4HK2 A;  3PVL A;  1V49 A;  4JLC A;  3PPA A;  3GZN I;  4FJV B;  2KX3 A;  2N9X A;  3U30 A;  1Z5S B;  2L8J A;  3L17 A;  4IW0 A;  4DBG A;  3RYT A;  1SIF A;  1WZ0 A;  1TGZ B;  2BGF A;  2BYF A;  3DBR I;  2KZR A;  3H7P A;  1BT0 A;  2DAJ A;  2N9P C;  2BWF A;  3L10 B;  4MGZ E;  4ASW C;  1E8Y A;  4DHZ B;  1S1Q B;  2KJ6 A;  3EC8 A;  2LXC A;  3HIZ A;  4PYU A;  2DHZ A;  3GOE A;  2V4L A;  3I3T B;  4FJY A;  4LDT B;  1WJ4 A;  2MP2 A;  3AUL A;  3HM3 A;  3PGE A;  3X23 A;  4HPL B;  2KHW B;  2WWZ A;  2D2Q A;  2CKH B;  2A5U A;  4XC2 A;  2XBB C;  3AU5 A;  1FXT B;  4W9G A;  4GGQ A;  3VH3 B;  2C5L C;  4E74 A;  2FCM A;  2FCN A;  4NY0 A;  3ZRC A;  4B9K A;  1UZX B;  3ML9 A;  3PRM B;  2KJR A;  2KJH B;  3M3J A;  4BBN C;  4PYZ A;  2YLM A;  1ISN A;  1UH6 A;  1WIA A;  2V3S A;  4MJS B;  2AL3 A;  3LJ3 A;  1WXM A;  3OLM D;  4DDI D;  2ZJD A;  1V6E A;  2HJ8 A;  2ZVN A;  4II3 B;  4GMV A;  4AJY B;  4G3X B;  3QX1 A;  2CR5 A;  2JZZ A;  3ONS A;  1WH3 A;  3X0W A;  4F8C B;  1IP9 A;  3UIP B;  2Z0D B;  5AZH A;  2AWT A;  2C7N B;  2O6V D;  4NAW A;  4MM3 A;  4BKS A;  2IO1 B;  4W9K A;  3JSV A;  3QHT A;  2FCS A;  3M63 B;  4OVU A;  4KSK C;  3PZD A;  4TQ1 A;  3QIJ A;  4DHZ E;  3KYD D;  2IY0 B;  3VTW A;  1P3Q U;  4X57 B;  4HDO A;  3H1U A;  3L16 A;  1ZW7 A;  2NPT A;  4W9E A;  1LM8 B;  4BKG A;  2HD5 B;  5GMV A;  2GBN A;  3K9P B;  5LXI B;  3VTU A;  5EDS A;  2K6Q A;  3VXW A;  2KQ7 A;  3DBH I;  1GC7 A;  2D11 A;  2KDI A;  3L13 A;  3M95 A;  4EEW A;  5D6J B;  4EUT A;  4W9I A;  2N7D A;  5CHV C;  4KV2 A;  2GBM A;  1E7V A;  2DYM A;  2B3A A;  2FAZ A;  2HE7 A;  3ZLZ A;  2OOB B;  1ZGU B;  2JY6 A;  4IG7 B;  4EZK A;  4ICU A;  2LXA A;  4M0W B;  4ICV A;  5DPR A;  1L2N A;  3QCA A;  4HVB A;  2LJ5 A;  2CHZ A;  2IO3 B;  3PLV A;  2L3Z A;  2JRH A;  4WJO A;  3DCG A;  2DX5 B;  2IBI B;  3BY4 B;  4GSW A;  1SE9 A;  1V80 A;  2KTR B;  3W1Y A;  2OJR A;  3RZW C;  2KWV B;  4TUU A;  3KUD B;  2D07 B;  1OGW A;  4JIO U;  3IVF A;  4PS8 A;  5KHQ A;  3V6C B;  3ZIM A;  2CU1 A;  4G0N B;  1V5O A;  2R2Q A;  2DZJ A;  3L08 A;  4KDI C;  3DVG Y;  1E8W A;  4FN2 A;  1WE7 A;  1L7Y A;  2MA9 B;  3DDC B;  2L76 A;  4BBN F;  1P0R A;  3MHS D;  2KNB A;  3WAL A;  2KD0 A;  4NQL B;  1WX9 A;  3T8M A;  3ML8 A;  1WXA A;  1Q1O A;  3IG3 A;  2L00 B;  2NPT B;  3CF6 E;  5J2R A;  3NY5 A;  1F9J A;  1LXD A;  1GG3 A;  1X1M A;  4BFR A;  4K7S A;  4FA6 A;  1G6J A;  3AI5 A;  3OJ3 A;  1XT9 B;  1YQB A;  4XZ4 A;  3AXC A;  1V9J A;  2K25 A;  2RR9 A;  3NZS A;  4HDQ A;  3QQ8 B;  4A3O A;  2GBJ A;  2QHO A;  3ZTC A;  5JHA A;  2CHW A;  1UEL A;  2KK8 A;  3PS6 A;  1QZE A;  3VFK A;  3NZU A;  2L05 A;  4WJN A;  3KUZ A;  2BKF A;  1VD2 A;  1RAX A;  2IYD B;  2KDF B;  3KW5 B;  4TV3 A;  3V61 A;  1RLF A;  2N9E B;  2ZNV C;  4A3P A;  1P9D U;  4XX5 A;  4WWN A;  4KDL B;  1RRB A;  5JH5 C;  1NBF C;  4ZRJ A;  2ZCB A;  2KC2 A;  1MG8 A;  2O6V B;  2W9N A;  2YVC A;  2L0T A;  4MH0 E;  3N32 A;  1E90 A;  1OEY A;  1XD3 B;  2M1M A;  4GXB A;  4IM3 A;  5L95 C;  2N1W A;  1R4N I;  2ZNV B;  2PJH A;  4M8M A;  3ZTD A;  3L54 A;  3P2B A;  4P7I A;  3PRP B;  3RUI B;  3U7D A;  3NS8 A;  2O6V A;  1V5T A;  2LI5 A;  1C3T A;  1E5W A;  5CHF A;  3OJ4 B;  4FUL A;  5TR5 A;  1T0Y A;  3VUX A;  1NI2 A;  3VAW A;  4AWJ A;  2KN5 A;  3ALB A;  5DPS A;  1EUV B;  2K8H A;  3ECI A;  2MBH A;  2WX1 A;  2MP2 B;  4MEL A;  1J8C A;  1E8X A;  3DQV A;  2REX A;  5IAA C;  4WWP A;  2JXX A;  3PRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...