1X1MA

Solution structure of the n-terminal ubiquitin-like domain in mouse ubiquitin-like protein sb132
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GSSGSSGMSLSDWHLAVKLADQPLAPKSILQLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein SB132
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in Mouse Ubiquitin-like Protein SB132
rcsb
source organism Mus musculus
total genus 12
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1x1mA00
2K6DB 2D3GA 2GBMA 4DDID 4B95A 4HLEA 4K81A 1A5RA 1UGMA 1RFAA 1WX7A 2KN5A 2YVCA 4MGKE 3A4RA 2DZKA 2LVPA 1I35A 2REXA 2RSUA 3TJPA 2KFKA 2O2VB 3A9JB 4AUQC 3RZWC 2L05A 2RPQA 4IM0A 3RCZA 2GBNA 4M8NA 2KK8A 2MBEA 3L0WB 4KVGB 2DZIA 3A33B 3L10B 4FA6A 2FNJB 2NCNA 3JSVB 2C60A 4WAAA 3T9LA 3U7DA 2MLBA 1AARA 4PYUA 3MTNB 2ASQA 1XD3B 4RMAA 4KZCA 5BO4B 2N7EA 1SE9A 4WJPA 2PEAA 4OVVA 4NJ7A 4FBJB 2KWVB 1NBFC 3ZLZA 2C7HA 4FJYA 2IY1B 4GN1A 3VUWA 3WANA 2IYDB 2AYOB 1WR6E 3OJ4B 2KJHB 4N9F4 1YJ1A 1GG3A 2G45B 1Q5WB 3L54A 1EF5A 4IC7B 2ZPNA 3M95A 3H9DA 1WGRA 3QCAA 4DHZB 2IZVB 3TBLD 2KLCA 1H8CA 4E74A 2GBRA 1K8RB 2CU1A 2G3QB 3A9JA 4K7SA 2LVQA 3TL5A 3R3MA 4B9KA 2QHOA 4W9EA 1WJUA 2BWES 4MSMB 4AWJA 1GNUA 1OGWA 3QWZB 2WYQA 4JLCA 4AJYB 1LXDA 4HPLB 3ZVVA 3EECA 2DZJA 2BF8B 1P98A 3A4SC 3L17A 2WX1A 1NDDA 2LGYA 2FIDA 2ZCBA 4LDTD 4GU2A 1E8WA 1WM3A 3RD2A 1XT9B 2KJRA 4IWOA 3DVNV 3QX1A 5D6JB 4GDLA 1IPGA 1J19A 3PREA 2KFJA 3DBHI 2PPHA 4XX5A 2MBHA 3VFKA 3PGEA 4E3CA 4W9CA 2LXCA 4AJWA 2C7NB 3DVGY 2BGFA 2EMSA 3M3JA 4KIKB 5KHOA 3X23A 2OOBB 2CR5A 3IHPC 2N1VA 2NPTB 3JVZX 4K7UA 1P9DU 3ZUNA 4WJOA 3V60A 3V61A 2O6VB 2MP2A 1WXAA 4II2B 3LJ3A 4MSQB 3DDCB 4FLHA 4GDKB 1Q0WB 3BINA 1C3TA 3HK0A 4G0NB 1SGHA 2GMIC 3APDA 3CF6E 3LDZE 3ZTDA 5J17A 4P7IA 3L08A 2K8CA 3W1YA 1WX8A 4FADA 3ZIMA 4MJSB 2JZZA 4RM8A 1LFDA 3KUZA 2LJ5A 4II3B 5AEKB 2C7MB 3ZNGC 1C1YB 1KJTA 3QIJA 3BY4B 1WZ0A 2Z0EB 5DPSA 1WR1A 4HXDA 1PQSA 3NZUA 3VH4B 3DBLI 3ZNID 2N4FA 3VH3B 2UYZB 2KNBA 4W9GA 4DK5A 5FR6A 4KIKA 1SIFA 2KVRA 2LXAA 2KC1A 1WMHB 4KV2A 2DX5B 1WJ4A 3VVWB 3MJWA 5CHWA 4PS3A 4ANVA 4BBNC 2O6VA 2WWZA 4OVUA 3ALBA 4JL9A 4NY0A 3AI5A 4G50A 5TR5A 1VCBA 3UINB 4GIVA 2PE6B 1P1AA 4TKNA 4W9IA 4WJNA 4W9KA 1NI2A 1GC7A 3PRMB 1L7YA 2Z0DB 3RUIB 2KXJA 4MGIE 4F7ZA 2LUEA 3TCAA 1OEYA 1RLFA 3DOWA 3PT2B 4W9HA 2N7DA 3V6EB 4HDOA 2KWCA 2OJRA 2KQ7A 3VTUA 4XZ4A 4IUMB 4NPNA 4HPMB 1WM2A 3IG3A 4X57B 4LJOB 2BPSA 3ONSA 1WXVA 4CHKA 2L8JA 4BOZB 2KDIA 3V62A 1KOTA 3SHQA 2KOXA 2N1WA 1WZ3A 2ZNVB 3PV1A 2KHWB 4NNJB 3VAWA 2KLGA 1WMHA 1E7VA 1UZXB 3EC8A 3ENEA 3TMPB 3KW5B 4KDIC 1X1MA 2LGDA 3DVGX 3N32A 5CTRC 2FCNA 4EKUA 1WF9A 1WJNA 4J6IA 2LRUA 3SDLC 4M8MA 5JHAA 3DPDA 3ZRFA 1V5TA 2R2OA 1UBQA 3D32A 3QK0A 3QAQA 5DPRA 4A20A 3HM3A 4IWPA 2N9EB 2M1MA 4PYZA 1WGHA 1V81A 2I1KA 2NBUA 3HM6X 3WALA 2IO2B 4FHJA 4NAWA 2JWZA 2K8HA 3VTWA 4EEWA 4FJZA 2DYBA 1UBIA 3T8MA 2CHWA 1GUAB 2LRWA 2IBIB 2A4ZA 3C0RB 4LJPB 3VUXA 1WFYA 2W9NA 4M0WB 4W9DA 3WAOA 2CHXA 4W9JA 4F1SA 2Y5BB 3ZNZB 4WWPA 4AP4C 2N9XA 4GB9A 5GMVA 2ZCCA 1LQBA 1UH6A 2KKCA 4WQOB 3RYTA 1T0YA 3S2AA 2O2VA 4K7WA 4ANWA 3UIPB 2L76A 1YIWA 5C1ZA 2DAFA 2LASA 5IAAC 2LVOA 1YX5B 1I42A 3JYUA 2UWQA 1V5OA 3JSVA 1KM7A 5DCNA 5L95C 3KUDB 4BKSA 1V80A 2LZ6A 3HIZA 4ICUA 2ZJDA 3A1QB 2V4LA 2KANA 2EKEC 2ZVOA 1LM8B 2DYOA 2KWUB 3EFUA 2KJ6A 1S3SG 4KDLB 4IG7B 3H1UA 1HE8A 3R7RA 3A9KB 4ICVA 3WA0A 4MGZE 1Z2MA 4NJ6A 5LXIB 2AL6A 3H6NA 1WGYA 2C9WB 4MGYE 2LD9A 1WGDA 1TBEA 3CMMB 2WDTB 3KYDD 2NVUI 4HJKA 1ZKHA 2KDFB 4DDGD 3DQVA 1Y8RC 4HWIB 2XBBC 2MWSB 4ZRJA 1VD2A 3UF8A 1OTRB 1ZGUB 2C5LC 3RULA 5CX3A 3L16A 2IO3B 4RM9A 2HE7A 4A3PA 5KHQA 2DENB 2KTRB 3VUYA 4BKSD 5CHVC 1P0RA 4MELA 2K39A 2KDEB 2ZNVC 4TQ1A 2XK5B 1ISNA 1UELA 1FXTB 2RR9A 3N3KB 2DAJA 2JY6A 5AZHA 3H7PB 3R66C 2ZPYA 3TIXA 3ML8A 2AL3A 3VHTC 3I3TB 1JRUA 4BVUC 5LLIA 2M4NA 4YL8A 3NS8A 3N30A 4IW0A 4EUTA 1WI0A 1TGZB 2NPTA 1E8ZA 2A5UA 1WGGA 2J0KA 2JVCA 3ZRCA 4W9LA 4ZRIA 4GDKA 2ZVNA 4FULA 2HTHA 4GGQA 1YQBA 4IM3A 4TUUA 1WH3A 3AU5A 4IWQA 1YX6B 2MW5A 4MJSA 1OEYJ 2D11A 4KSKC 4WJQA 2KMAA 2KQSA 3SD5A 5E6NA 4HK2A 2D2QA 2R2QA 1L2NA 4IM2A 1V2YA 4WWNA 2G4DB 1WX9A 1G6JA 3UQBA 1WRDB 2JUOA 3NHEB 4DXAB 2D07B 2NS5A 4A3OA 2MRPA 1E5WA 1RAXA 4CO7A 4EZKA 4G3XB 5JH5C 1M94A 3WAMA 3JW0X 2CS4A 2MBBB 3KH0A 4EZLA 1GJZA 2O6VD 2GOWA 2IO1B 4HDQA 5D7GA 4TQ0A 2K8BA 2CKHB 3DBRI 4MEMA 2KO3A 1V9JA 3GZNI 4FJVB 2MX2A 2YLMA 4CYEA 2WX0A 4LDTB 3PRZA 2KC2A 2LI5A 1WXMA 3X0WA 1V49A 3B08A 2JPHA 5DPTA 1WIAA 3L13A 1CMXB 1E8XA 1XQQA 2K1FA 3P2BA 1P3QU 3QHTA 3DBSA 2N9PC 2NR2A 2MA9B 4FN2A 4ZRKA 4DHJD 1Q1OA 4BKTA 4PS7A 1J8CA 3VDZA 2NBWB 2M0XA 3ECIA 1QZEA 4AOFA 1J0GA 3NZSA 2J0JA 2MCNB 4HCPB 2K25A 2FAZA 2LGXA 4ZDVA 3QJZA 4W9FA 2Z59B 3W1SC 3V6CB 4JIOU 4NQLB 3KYCD 2FIFA 2KX0A 2ZZPB 1R4NI 4K1RB 5DPWA 4TV3A 1H4RA 2GBJA 3U8ZA 4NQKE 2KDBA 3DVNU 1V86A 4MH0E 4ZYNA 1KLVA 2MBOA 3QQ8B 1WXSA 4GDLB 2JXXA 3GOEA 1MG8A 2MBQA 2FCMA 4BBNF 1RRBA 3ZKJC 3U30A 5CHFA 3IVFA 3QARA 4ANUA 1E7UA 5J2RA 1UD7A 2KZRA 4BFRA 1EO6A 2IY0B 2V3SA 3NOBA 3PRPB 4B6WA 1EF1A 1BT0A 3ZTCA 1OQYA 2AWTA 2MSED 2MP2B 2BYEA 4I6PA 4ANXA 2M8SA 3ZDTA 3KUCB 4KSLC 2BKFA 4WWOA 4E71A 2AEHA 2M17A 4JQWC 3K9PB 4PS8A 4GOCA 2IO0B 4EZJA 2JF5A 2K6QA 1IYFA 2XEWA 1WY8A 3ZDMC 2KMCA 5IA7A 4URKA 2DYMA 3ML9A 3PSEB 3WIMA 4DHZE 3KVFB 3MHSD 3OJ3A 3APFA 2L7RA 2KTFA 2CHZA 1GC6A 2BWFA 2PJHA 5LXHA 3M63B 2BYVE 1IP9A 1F9JA 2LWPA 5AZFA 3CSFA 2JRIB 4I6NB 4FHKA 3UGBB 3IBEA 3ZO5B 3A1QA 1S1QB 5C23A 3VTVA 2L00B 2DZMA 3EHVA 3RZFA 3M62B 3HHMA 2KX3A 3PLVA 5JZEB 3AU4A 5D2MB 3A9KA 3AXCA 5AZGA 2I1JA 2MQJA 3Q3JA 5L83A 3SU8X 2GBKA 5HKHA 3IFWB 1V6EA 1ZW7A 2VRRB 3PS6A 1WE7A 1E90A 1E8YA 2JZ3B 5G55A 4G11A 5J18A 3O65B 2EMTA 2FCQA 2G4SA 2J0MA 3OLMD 3PHXB 2BYFA 4BOSC 1YD8U 3PZDA 1WYWB 3QA8A 2B3AA 3H7SA 2BKRB 4LCDE 4XC2A 5G2NA 2J7QB 2JRHA 3AULA 4DHJB 2DHZA 3W1SA 2KTRA 3Q3FA 4I6LB 3RT3B 4GXBA 3OAWA 2L0TA 3B0AA 2XK5A 3NY5A 2FCSA 3QC8B 4ASWC 4HVBA 3PVLA 4EFOA 4DBGA 5D94A 4BKGA 3H7PA 2KD0A 3ZW3A 3UQAA 3CSTA 2KFKB 3PLUA 4MDKE 3R7QA 2L3ZA 2HD5B 4DWFA 2JT4B 4MM3A 1R4MI 1WE6A 3VXWA 1TZ1A 2V1YA 3WAPA 1Z5SB 3UIOB 3PHWB 3PTFC 5E6OA 2HJ8A 2PE9A 4JGHB 2ZEQA 4KZ0A 3DCGA 5EDSA 3B1LX 3K9OB 4NAWB 2D10A 2RGFA 4HCNB 1D3ZA 1EUVB 3APCA 4EOYA 4GSWA 5E6PA 3VQIA 2L0FA 2NBVB 3PPAA 1TTNA 1WJ6A 2RD0A 1U4AA 5JHBA 4GMVA 3ZNHB 2FUHB 4F8CB
chains in the Genus database with same CATH superfamily
2GBMA 5H92C 4K81A 1A5RA 2W54A 2KAJA 3A4RA 3WCQA 1CK1A 2KFKA 3A9JB 2L83A 4IM0A 3SEBA 4M8NA 3L0WB 3AH7A 4A8XC 2NCNA 4WAAA 3U7DA 4PYUA 1XD3B 2M19A 2N7EA 4WJPA 2PEAA 3ZLZA 3RN9C 3RNCC 1YQ4B 3GE3C 4ITKA 5TSSA 1D5XC 2E3TA 3RNFC 3OJ4B 3B2GA 1JWSD 4N9F4 1YJ1A 1GG3A 4YTMB 4LLGM 1EF5A 2ZPNA 3AV8A 1WGRA 2KLCA 4C56C 1H8CA 3LB8C 1IUEA 3A9JA 1I4XA 2LVQA 4B9KA 4W9EA 1WJUA 4AWJA 1GNUA 2PIAA 2H88B 1FCCC 3DHGC 2J4XA 3MP9A 2WX1A 2LGYA 3ABVB 3AM9A 4DQOC 2LHDA 1XT9B 3DVNV 5D6JB 2WDVB 2Y5CA 2B76B 2PPHA 2MBHA 3PGEA 4W9CA 4TSSA 2N1VA 4K7UA 2OEDA 4WJNA 4II2B 4L2YA 3DDCB 1C3TA 1Q0WB 1SGHA 4HRSA 3LDZE 3ZTDA 5J17A 1FNUA 4P7IA 4BZAA 4EE2A 1WX8A 3AEAB 1HQRD 1LFDA 3KUZA 4RFBA 2LJ5A 4II3B 5AEKB 1C1YB 2WXLA 3QIJA 1F77A 4HXDA 5FKAC 4ARCA 3DBLI 2BVCA 1T0RC 1JROA 2KNBA 1XLQA 1DOXA 4KV2A 1RWSA 4BBNC 2WWZA 1J7BA 4G50A 4GIVA 1P1AA 4W9IA 4W9KA 1RM6C 1GC7A 4M00A 3RUIB 2XNAC 2LUEA 2N7DA 4YT0B 2KWCA 2QILA 1N63A 1T0QC 4IUMB 3TEYA 1KOTA 2RDBC 3RNBC 1DOIA 1WXQA 3DHHC 3TMPB 2QEJC 2Q5WD 1X1MA 2FCNA 2KWDA 1WF9A 1AN8A 2BQQA 3DPDA 4C7ZA 4JWUC 3QAQA 1CJEA 5E6JA 4IWPA 2N9EB 1WGHA 1FPYA 3HM6X 2NBUA 1HTOA 1XCTL 2K8HA 4FJZA 3T8MA 2CHWA 3VUXA 4M0WB 3Q6BA 4WURA 3MFGA 3I5JC 2WGSA 4WWMA 1YN4A 3S2AA 3MC0B 4ACFA 5IAAC 3AEDB 1YQ3B 1VLBA 1SE3A 1KM7A 3U4EG 4BKSA 2LZ6A 2QJLA 2ZJDA 1M4VA 2WXGA 2K22A 1T6BX 1C76A 3WA0A 5IKCM 2LD9A 2N9KA 1N5XA 1WGDA 2WHIA 3CMMB 1WGKA 2WDTB 3KYDD 1PUTA 4HJKA 1TS4A 2KDFB 1Y8RC 2UU7A 1VD2A 1ZGUB 2INPE 1LGRA 2HE7A 2KTRB 1SBBB 2Z8LA 2WXFA 2K39A 3HUIA 3FILA 2ZNVC 1K53A 3ETRA 3N3KB 2QMTA 2L52A 5IOIA 4M01A 4BVUC 5LLIA 2D5GA 3AE5B 4IW0A 1L6VA 1NI3A 1TGZB 2A5UA 1TKGA 1WGGA 4C4VA 4GDKA 1YOVB 4TUUA 3AU5A 1D6EC 2D11A 4KSKC 4WJQA 5E6NA 1XF5L 4IM2A 3Q3NC 1V2YA 1WX9A 1JWAD 3NHEB 1E5WA 2ONQA 1RAXA 4KGTA 3WAMA 4EZLA 4TQ0A 1KFYB 3DBRI 3P42A 5D3DA 2KQ4X 3ZXVA 4MACA 4A90A 2BTEA 1NVID 2WU5B 1WXMA 4Q2JA 3ZJVA 4RGMA 1E8XA 1XQQA 1JQ4A 2MA9B 4BKTA 2M0XA 1QKZA 4LNOA 4A9AA 4S0RA 2K25A 2FAZA 3V6CB 3KYCD 2ZZPB 5DPWA 3U8ZA 4YXDB 4A55A 4N58A 4NQKE 4ZYNA 1V86A 4MH0E 2MBOA 1UWMA 2NTTA 2MBQA 3NVZA 4ANUA 1I4HA 1IGDA 1NYQA 2G1EA 3NZ3A 2MSED 2MP2B 4I6PA 1SJHD 3GE8C 2GRIA 4KX6B 3KUCB 1C4PA 1XLPA 2AEHA 3K9PB 1F2RC 1HXYD 2RPVA 4GOCA 4RH6A 2XEWA 5HG2A 1DOYA 3ZDMC 3TEZA 2KMCA 1IGCA 1AW7A 3DBHB 1ZDXA 1UUPA 2KTFA 2BYVE 4I6NB 3NS1A 2V0GA 3A1QA 5C23A 3M62B 2KX3A 5JZEB 5G5GA 5D2MB 1L0VB 5AZGA 5HKHA 1V6EA 2VRRB 3PS6A 2EMTA 2FCQA 2J0MA 3OLMD 2BYFA 3BWUD 1QLBB 1YD8U 3QA8A 3H7SA 4LCDE 4XC2A 5G2NA 4YSYB 3W5VB 1JW9D 3RT3B 2L0TA 2WXIA 1VZ8A 4US8A 3ZJTA 3QC8B 4ASWC 3PVLA 4EFOA 4DBGA 4XYCA 3H7PA 1J7AA 1ZPSA 4C7YA 1WE6A 2V3NA 3AEEB 2V1YA 1Z5SB 3UIOB 3PHWB 5E6OA 1SE2A 5AUIA 2PE9A 3FAHA 4JGHB 4JE3B 3PZ7A 1D3ZA 5GXGB 2QSDA 4GSWA 3VQIA 1U4AA 3RPFC 4PT5A 3EGRA 5T8IA 4DDID 1ACCA 4B95A 1UGMA 1XXGA 3FKYA 4AUQC 1CZPA 2RPQA 2ZW0A 2TSSA 4LNIA 3MC9A 3BZDB 2FNJB 3NVYA 2VZKB 2ASQA 3V3XA 2AQ1B 4NJ7A 2C7HA 2IY1B 4GN1A 3VUWA 2AYOB 2N9LA 4LNKA 1Q5WB 3M95A 4DHZB 2IZVB 3TBLD 4E74A 2GBRA 1K8RB 2BS4B 3R3MA 4TMAB 2WYQA 4JLCA 1D5ZC 3EECA 2DZJA 4BOZB 3L17A 2PLPA 2FIDA 2ZCBA 1E8WA 3EA6A 3RD2A 1DGJA 3QX1A 1L0YB 1J19A 2KFJA 3DBHI 2N7JA 5G5HA 2C7NB 2L1AA 3DVGY 4KIKB 5KHOA 3W2DA 2CR5A 3IHPC 2NPTB 3ZUNA 3V60A 1ROEA 2N0SB 3BIID 3LJ3A 4G0NB 3CF6E 1C4CA 2YEPF 1YMHE 3L08A 2K8CA 3W1YA 1L4ZB 4FADA 4C00A 3PZ8A 3N20C 3AECB 4RM8A 2C7MB 4DXGA 1KJTA 5BMGA 4HEA1 5DPSA 3VH4B 2M0AA 3ZNID 1NYRA 1T5XD 1F2RI 2ICIA 1P7EA 4KIKA 1SIFA 3ZGZA 2KVRA 4M02A 2KC1A 3KWLA 3MJWA 5CHWA 4PS3A 1JWBD 3TEXA 4OVUA 4JL9A 4NY0A 3HRDD 4YTNB 4P1CC 5TR5A 3UINB 4NZLB 4TKNA 4ZOHC 1NI2A 1QQRA 1ET6A 4W9HA 2K3UA 2XN9C 3AE8B 2KQ7A 1GB1A 1WM2A 4X57B 3ONSA 2L8JA 1ENFA 2KDIA 4RGNA 2N1WA 2HTME 1FO4A 1SEBD 4WIPA 1UZXB 3L4PA 2FE8A 3KW5B 1ZOYB 1STEA 2LGDA 3VRAB 2LRUA 1JRPA 3ZRFA 3AE3B 1V5TA 2R2OA 1UBQA 3D32A 4J3OD 4A20A 3HM3A 2IO2B 4FHJA 4LNFA 1IBXA 4HJGE 4RGOS 3ZXRA 1UBIA 1JWUD 1GUAB 2ON8A 2IBIB 4LJPB 4LK0M 3RNAC 4A6QA 2W9NA 4F1SA 1UWXA 4WQOB 2I38A 3RYTA 4ANWA 3UIPB 1YIWA 5C1ZA 1I42A 5DCNA 5L95C 1V80A 3AE2B 3HIZA 1TS3A 4ICUA 1E0ZA 3V05A 2ZVOA 1LM8B 2DYOA 2KWUB 3EFUA 2WU2B 4C80A 1Z2MA 1C79A 4NJ6A 2AL6A 4MGYE 2C9WB 3N1YC 2YEPB 1PGXA 1Q10A 4DDGD 4HWIB 2XBBC 2MWSB 1MJDA 1OTRB 5CX3A 1B9RA 2IO3B 3VUYA 5CHVC 4MELA 4JPSA 4TQ1A 2XK5B 1FXTB 4FXCA 2RR9A 1CQVA 1QILA 3TIXA 3DHIC 1BMLC 1N6ZA 4YL8A 3N30A 4EUTA 1OFFA 1WI0A 1E8ZA 2PMVA 2J0KA 1K51A 2ZVNA 4HKZE 2K9XA 4REZA 4O1NA 3J9CA 2RDGA 1OEYJ 2KMAA 2LGSA 2D2QA 1FEHA 1E10A 1WRDB 4DXAB 4A3OA 2K5PA 4G3XB 1EU4A 5JH5C 2KT7A 2MBBB 3KH0A 2LEKA 2IO1B 5D7GA 2GLSA 4XE0A 4MEMA 3IT4B 4FJVB 1V1PB 2BT6A 4IDIA 4LDTB 3PRZA 3GP7A 4ZRPA 1CMXB 4ZYSA 2MJ3A 2MEKA 3DWMA 2N9PC 2Y5PA 3AB5A 4PS7A 3RMKC 1C77A 1K52A 4LTUA 3ECIA 1NENB 3NZSA 2J0JA 4W9FA 3W1SC 2JQRB 1YJIA 1K50A 2KDBA 2WXQA 1WXSA 4GDLB 3GOEA 2FCMA 1WWTA 2MJEA 2IGDA 1SF0A 1TS2A 1E7UA 1UD7A 4BFRA 2IY0B 4WQMA 4YSZB 2WXOA 2G9HD 1BT0A 3ZTCA 3NRZA 2BYEA 1F0ZA 3ZDTA 4M0WA 4E71A 1B1ZA 2BKFA 2M17A 4JQWC 2IO0B 4EZJA 2JF5A 2K6QA 2CJOA 1C4AA 5IA7A 2R61A 3APFA 2CHZA 4OW0A 2BWFA 2DLBA 3AMZA 4YSXB 1IP9A 4N6EB 2LWPA 5AZFA 3CSFA 1VR9A 2JRIB 1PYWD 3EUB2 1S1QB 3VTVA 3RZFA 5BMIA 4OZAA 1RFKA 3Q3JA 3SU8X 2GBKA 3IFWB 3SFEB 5G55A 5J18A 1TKYA 3RI7C 2D3CA 2J7QB 3AULA 4DHJB 2DHZA 3W1SA 2KTRA 1TS5A 4I6LB 2JU6X 3OAWA 1GAQB 3NY5A 2FCSA 1EM7A 2PVGC 4HVBA 3W5UB 2JSVX 4B0EA 3ZW3A 3I57A 3UQAA 3CSTA 2GB1A 4MDKE 4NJCA 2JT4B 1PGBA 1TZ1A 2NTSA 4N59A 2WXJA 2ZEQA 3B1LX 4NAWB 3U7ZA 2D10A 2RGFA 2VH1A 4HCNB 3P4SB 4XWTA 3APCA 2K0PA 2L0FA 3PPAA 3RFZB 2RD0A 4RGTA 1MFWA 3X0WA 3Q8FA 5EE1A 4HLEA 1ZDVA 1SE4A 4LNNA 1WX7A 2KN5A 4MGKE 2LVPA 1I35A 3P4PB 2REXA 1I7HA 2RSUA 3TJPA 2O2VB 3RZWC 2Y3AA 2IGHA 3RCZA 2GBNA 1UNSA 2MBEA 4KGRA 2SEBD 3A33B 3JSVB 2C60A 3T9LA 1AARA 4GLSC 4RMAA 4KZCA 1NEKB 3IXSA 1SE9A 4OVVA 2KWVB 4FJYA 2FBWB 1WR6E 3P4RB 3NUHB 3HVDA 2EELA 3VR8B 4IC7B 3H9DA 4HKQA 5C3JB 2G3QB 4K7SA 3SR6A 3TL5A 3ZJUA 1QOAA 5BYQA 1F52A 2J42A 2BF8B 4LDTD 4GU2A 4IWOA 2V9HA 3P1MA 3IAS1 3W9CB 3VFKA 4D2KA 2WDQB 1EWYC 1TY2A 4AJWA 2EMSA 3NVWA 2WS3B 2OOBB 3JVZX 1P9DU 4H2AA 2O6VB 2MP2A 1WXAA 2WP9B 4MSQB 4YTPB 3BINA 4S17A 3HK0A 2DWQA 1KF6B 3ZIMA 4MJSB 2JZZA 3LYYA 3HVZA 3BY4B 1WR1A 1PQSA 1WSPA 5AUKA 2N4FA 2UYZB 1JWMD 4W9GA 2ZW1A 2LXAA 4KKJA 2DX5B 2INNE 2WNMA 3BYTB 2O6VA 2QDFA 3ALBA 2D3BA 2PE6B 3Q2AC 1L7YA 4MGIE 3I9V1 3TCAA 1D5MC 3V6EB 3DOWA 2W55A 2OJRA 2CJNA 4XZ4A 1L0XB 4LJOB 1FFUA 4CHKA 1XEEA 3V62A 3SHQA 2KOXA 3AE7B 4P1BC 1C9FA 1VJKA 3VAWA 5IP4D 1E7VA 4P16A 4EKUA 5CTRC 3Q8EA 1WJNA 3CIRB 4J6IA 3SDLC 4M8MA 5HI1A 1I4GA 2LGIA 3MJ5A 4OHJA 5FR3A 3NJTA 3BK1A 1WYGA 3WALA 4KKIA 2JWZA 4IOIE 4PK1A 4EEWA 2DYBA 2A4ZA 3C19A 4W9DA 2CHXA 2Y5BB 3ZNZB 2N9XA 4GB9A 5GMVA 3Q14C 4AS1A 2KKCA 2WXPA 1DYQA 3SFDB 1C78A 4K7WA 1KRHA 2WDRB 2DAFA 1N5WA 3AEBB 2I2YA 1YX5B 4DXFA 1V5OA 1KLUD 2WXRA 4WAFA 3KUDB 1I4QA 2KANA 2V4LA 2EKEC 2PTLA 2WQYB 5LNK1 3H1UA 2KDMA 3EFCA 1FMAD 3A9KB 2JYEA 4MH8A 5LXIB 3VR9B 3T3NA 1A70A 3TUOA 2NVUI 3RNEC 1ZKHA 3DQVA 1GB4A 3RULA 1SB3C 4R3DA 3L16A 3IAM1 4RM9A 3KLSX 2DENB 1P0RA 4BAXA 2KDEB 1QF6A 1ISNA 1MHHE 1UELA 3P4QB 2WXKA 5AZHA 4ARIA 3ML8A 3RNGC 3VHTC 1LO5D 3H8HA 5H8YE 3I3TB 1OQQA 3R8BA 3ZQ4A 2M4NA 2WXHA 3NS8A 3Q69A 1HZ5A 1PGAA 4MM3B 2NPTA 3ZRCA 3N1ZC 2AQ2B 2HTHA 4GGQA 1VDVA 1WH3A 1JMLA 4B0MA 2MW5A 1AYFA 2KQSA 3SD5A 1T3QA 4HK2A 3R2TA 1L2NA 3N9YC 3OG5A 4WWNA 2G4DB 1G6JA 3UQBA 1MPEA 3GB1A 2D07B 2NS5A 1UF0A 4EZKA 2EKIA 3JW0X 2O6VD 2K8BA 2X8XX 1RYJA 3OWEB 3E9SA 2KO3A 1V9JA 1FM0D 2MX2A 2LHEA 4OVZA 2WX0A 2KC2A 3U2SC 1V49A 3B08A 3I63C 3MHZA 3P2BA 1P3QU 3QHTA 3DBSA 4ZRKA 4FN2A 4WH4A 3LXFA 1TYGB 2JZPA 4AQ7A 2NBWB 5EE0A 4CQNA 4AOFA 1J0GA 2MCNB 5BYSA 2LGXA 4ZDVA 3QJZA 2Z59B 2KX0A 1I4PA 1H4RA 1PDXA 1KLVA 1PFDA 1MG8A 4BBNF 3URYA 1RRBA 3FC4A 3ZKJC 3QARA 5J2RA 2KZRA 3Q8AA 1EO6A 2V3SA 3NOBA 3PRPB 1EF1A 2M8SA 4KSLC 4RNAA 2IDYA 1WY8A 2X38A 4US9A 4URKA 2DYMA 3PSEB 4DHZE 3OJ3A 2L7RA 2KACA 1GC6A 2VZKD 4XGAB 2PVOD 1KTKA 4FHKA 1QOGA 3UGBB 4USAA 3TEWA 5I4DA 1T0SC 2BB6A 1XO3A 2DZMA 3EHVA 2D3AA 1ET9A 3PLVA 3AU4A 5L83A 1HA5A 1WE7A 1AWDA 1E90A 2JZ3B 4G11A 3O65B 2G4SA 4KGSA 4BOSC 3PZDA 3BVGA 4K3CA 3T3OA 3N1XC 1XCQL 2INDC 4UDUC 2HJ1A 3Q3FA 3B0AA 2HDEA 2XK5A 3PO0A 2PW9A 1MHXA 5D94A 1BUIC 2RMMA 3R7QA 2HD5B 4DWFA 2LUMA 3VXWA 1XLOA 1KH0A 4KZ0A 5EDSA 3K9OB 2QCZA 1EUVB 1TZOA 4EOYA 5E6PA 1ZXHA 1WJ6A 5JHBA 3ZNHB 2FUHB 2K6DB 2D3GA 3AN1A 3DBRB 3Q8CA 1RFAA 2YVCA 1KLGD 2DZKA 4MT5A 3ZYYX 2KMMA 1ZUD2 2GI9A 2L05A 2KK8A 4KVGB 2DZIA 3L10B 4FA6A 3U52E 2MLBA 3MTNB 2RDHA 1SIJA 5BO4B 2JWUA 1V1PA 1FNWA 3O13A 4FBJB 1NBFC 1R7SA 3WANA 2IYDB 2CU3A 2BS2B 3E56A 3AEFB 2KJHB 1TIFA 2G45B 2JXTA 3L54A 3QCAA 5IO9A 1E7PB 1FNVA 2CU1A 1VZ6A 4HPPA 2QHOA 1UGJA 2BWES 4MSMB 1OGWA 3QWZB 4AJYB 1LXDA 4HPLB 3ZVVA 1TJEA 1V8CA 3FILB 1P98A 3A4SC 3VTWA 1NDDA 1WM3A 1FFVA 2KJRA 2W82A 1IPGA 4GDLA 3PREA 3CWIA 4E3CA 4XX5A 4IKGA 2QC8A 2LXCA 2BGFA 3M3JA 3X23A 4WJOA 3V61A 4C4VB 4FLHA 4GDKB 2GMIC 3APDA 1OQRA 2J52A 1V97A 2J53A 4RF0A 2JX5A 1I4RA 3ZNGC 4K3BA 3Q8BA 1WZ0A 2Z0EB 3NVVA 2JYTA 3NZUA 5HHDG 3VH3B 2MH7A 4DK5A 5FR6A 2BW2A 1WMHB 1WJ4A 3VVWB 5C2TB 4ANVA 2W3RA 3AI5A 1VCBA 3KWVA 5BMHA 3PRMB 2Z0DB 4F7ZA 4NAMA 2KXJA 3AE9B 1OEYA 1RLFA 2BBCA 3PT2B 2H89B 4HDOA 2SAKA 3VTUA 4NPNA 1TT5B 4HPMB 3IG3A 1GOZA 2BPSA 1WXVA 2WXNA 4OZCA 2E6XA 2ZNVB 1WZ3A 3PV1A 2KHWB 4NNJB 2AX5A 2KLGA 1WMHA 3GZNB 3EC8A 1E9MA 3ENEA 1QOBA 5HFYA 4KDIC 3DVGX 2KYWA 3N32A 5JXVA 3IT6B 5JHAA 3QK0A 5DPRA 4PYZA 2M1MA 1V81A 2I1KA 1YNTE 2QIEB 4NAWA 2LRWA 3C0RB 2IJ0A 1WFYA 3WAOA 4W9JA 1R4NB 4JWSC 4WWPA 4AP4C 1E6EB 3VRBB 2ZCCA 1LQBA 1UH6A 1L6UA 5FK9C 1T0YA 3MC8A 2O2VA 2L76A 2LASA 2LVOA 3JYUA 2UWQA 3JSVA 3Q3MC 2INCC 3A1QB 1FD6A 2IPKD 2W3SA 2KJ6A 1S3SG 4KDLB 4IG7B 2FUG1 1HE8A 3R7RA 4ICVA 4MGZE 3H6NA 1WGYA 2MHJA 1TBEA 3KQ4A 5BYRA 1N60A 2LFIA 1FCLA 4ZRJA 3UF8A 4L23A 2C5LC 3BK2A 4A3PA 5KHQA 2M56B 4BKSD 1BXTA 3R2IA 3AE6B 1FXAA 1VRAB 2DAJA 2JY6A 3H7PB 3R66C 2ZPYA 1FRRA 2AL3A 1JRUA 4RCOA 1ZP0B 3DWGC 2JVCA 4W9LA 4ZRIA 3AE1B 3B2FA 2LJIA 4FULA 4XDDA 1YQBA 1QT9A 4IM3A 1P7FA 4IWQA 1YX6B 4P6VF 1HEZE 4MJSA 1HZ6A 1QOFA 1Y56A 2R2QA 3BVMA 1ZE3D 1L4DB 1FRDA 1XLNA 2JUOA 1R4MB 2MRPA 1F1HA 4CO7A 1N62A 4HROA 3AEGB 1M94A 2BS3B 2CS4A 1GJZA 2L32A 2GOWA 4HDQA 1YN5A 1MI0A 2CKHB 1ESFA 3GZNI 2OHFA 2YLMA 1HTQA 2AQ3B 4CYEA 1FXIA 2LI5A 5DPTA 2JPHA 1WIAA 2ACZB 3L13A 2K1FA 5EE3A 2NR2A 4DHJD 1Q1OA 5EE9A 1J8CA 3VDZA 1VZ7A 1QZEA 4HCPB 3B9JA 4L1BA 4JIOU 4NQLB 1D4BA 2FIFA 2V4IB 1EU3A 1R4NI 4K1RB 4TV3A 2OJWA 2GBJA 2NMQA 3DVNU 1YJJA 3QQ8B 3P63A 3GS2A 3Q3OC 2JXXA 1FIQA 1SJED 3U30A 5CHFA 3IVFA 4B6WA 1N61A 1EWCA 1OQYA 2AWTA 1ZXIA 4ANXA 4RF1A 4WWOA 4ZRQA 1MG4A 4PS8A 5MPOA 4XDCA 3BYYB 4ZHOA 4ZHPA 1IYFA 1YN3A 3TSSA 3ML9A 3WIMA 3KVFB 3MHSD 1JALA 2KN4A 2PJHA 5LXHA 3M63B 1F9JA 2WXMA 1MVKA 3IBEA 3ZO5B 1L5PA 2L00B 3UI3A 3HHMA 1WRIA 3A9KA 3AXCA 2I1JA 2MQJA 1ZW7A 1E8YA 5IN7A 3PHXB 1J7CA 3DBLB 1WYWB 2B3AA 2BKRB 2WLBA 2JRHA 3BVZA 1V1OA 4GXBA 1SSNA 4YWGG 2LMCA 3C8YA 2BB5A 4QAYA 4BKGA 4XWWA 2KD0A 2PKOA 1TKEA 2MJDA 2BYTA 2KFKB 3AE4B 3PLUA 2L3ZA 5D3IB 4MM3A 1R4MI 3NG0A 4OZBA 3WAPA 1GPXA 3PTFC 2DBYA 4JX1C 2HJ8A 2V3PA 2IGGA 3DCGA 1IBXB 2VH2A 1JCKB 2DNFA 1TY0A 2KVZA 2NBVB 1TTNA 1SXTA 4GMVA 4F8CB
chains in the Genus database with same CATH topology
2K6DB 2D3GA 2GBMA 4DDID 4B95A 4HLEA 4K81A 1A5RA 1UGMA 1RFAA 1WX7A 2KN5A 2YVCA 4MGKE 3A4RA 2DZKA 2LVPA 1I35A 2REXA 2RSUA 3TJPA 2KFKA 2O2VB 3A9JB 4AUQC 3RZWC 2L05A 2RPQA 4IM0A 3RCZA 2GBNA 4M8NA 2KK8A 2MBEA 3L0WB 4KVGB 2DZIA 3A33B 3L10B 4FA6A 2FNJB 2NCNA 3JSVB 2C60A 4WAAA 3T9LA 3U7DA 2MLBA 1AARA 4PYUA 3MTNB 2ASQA 1XD3B 4RMAA 4KZCA 5BO4B 2N7EA 1SE9A 4WJPA 2PEAA 4OVVA 4NJ7A 4FBJB 2KWVB 1NBFC 3ZLZA 2C7HA 4FJYA 2IY1B 4GN1A 3VUWA 3WANA 2IYDB 2AYOB 1WR6E 3OJ4B 2KJHB 4N9F4 1YJ1A 1GG3A 2G45B 1Q5WB 3L54A 1EF5A 4IC7B 2ZPNA 3M95A 3H9DA 1WGRA 3QCAA 4DHZB 2IZVB 3TBLD 2KLCA 1H8CA 4E74A 2GBRA 1K8RB 2CU1A 2G3QB 3A9JA 4K7SA 2LVQA 3TL5A 3R3MA 4B9KA 2QHOA 4W9EA 1WJUA 2BWES 4MSMB 4AWJA 1GNUA 1OGWA 3QWZB 2WYQA 4JLCA 4AJYB 1LXDA 4HPLB 3ZVVA 3EECA 2DZJA 2BF8B 1P98A 3A4SC 3L17A 2WX1A 1NDDA 2LGYA 2FIDA 2ZCBA 4LDTD 4GU2A 1E8WA 1WM3A 3RD2A 1XT9B 2KJRA 4IWOA 3DVNV 3QX1A 5D6JB 4GDLA 1IPGA 1J19A 3PREA 2KFJA 3DBHI 2PPHA 4XX5A 2MBHA 3VFKA 3PGEA 4E3CA 4W9CA 2LXCA 4AJWA 2C7NB 3DVGY 2BGFA 2EMSA 3M3JA 4KIKB 5KHOA 3X23A 2OOBB 2CR5A 3IHPC 2N1VA 2NPTB 3JVZX 4K7UA 1P9DU 3ZUNA 4WJOA 3V60A 3V61A 2O6VB 2MP2A 1WXAA 4II2B 3LJ3A 4MSQB 3DDCB 4FLHA 4GDKB 1Q0WB 3BINA 1C3TA 3HK0A 4G0NB 1SGHA 2GMIC 3APDA 3CF6E 3LDZE 3ZTDA 5J17A 4P7IA 3L08A 2K8CA 3W1YA 1WX8A 4FADA 3ZIMA 4MJSB 2JZZA 4RM8A 1LFDA 3KUZA 2LJ5A 4II3B 5AEKB 2C7MB 3ZNGC 1C1YB 1KJTA 3QIJA 3BY4B 1WZ0A 2Z0EB 5DPSA 1WR1A 4HXDA 1PQSA 3NZUA 3VH4B 3DBLI 3ZNID 2N4FA 3VH3B 2UYZB 2KNBA 4W9GA 4DK5A 5FR6A 4KIKA 1SIFA 2KVRA 2LXAA 2KC1A 1WMHB 4KV2A 2DX5B 1WJ4A 3VVWB 3MJWA 5CHWA 4PS3A 4ANVA 4BBNC 2O6VA 2WWZA 4OVUA 3ALBA 4JL9A 4NY0A 3AI5A 4G50A 5TR5A 1VCBA 3UINB 4GIVA 2PE6B 1P1AA 4TKNA 4W9IA 4WJNA 4W9KA 1NI2A 1GC7A 3PRMB 1L7YA 2Z0DB 3RUIB 2KXJA 4MGIE 4F7ZA 2LUEA 3TCAA 1OEYA 1RLFA 3DOWA 3PT2B 4W9HA 2N7DA 3V6EB 4HDOA 2KWCA 2OJRA 2KQ7A 3VTUA 4XZ4A 4IUMB 4NPNA 4HPMB 1WM2A 3IG3A 4X57B 4LJOB 2BPSA 3ONSA 1WXVA 4CHKA 2L8JA 4BOZB 2KDIA 3V62A 1KOTA 3SHQA 2KOXA 2N1WA 1WZ3A 2ZNVB 3PV1A 2KHWB 4NNJB 3VAWA 2KLGA 1WMHA 1E7VA 1UZXB 3EC8A 3ENEA 3TMPB 3KW5B 4KDIC 1X1MA 2LGDA 3DVGX 3N32A 5CTRC 2FCNA 4EKUA 1WF9A 1WJNA 4J6IA 2LRUA 3SDLC 4M8MA 5JHAA 3DPDA 3ZRFA 1V5TA 2R2OA 1UBQA 3D32A 3QK0A 3QAQA 5DPRA 4A20A 3HM3A 4IWPA 2N9EB 2M1MA 4PYZA 1WGHA 1V81A 2I1KA 2NBUA 3HM6X 3WALA 2IO2B 4FHJA 4NAWA 2JWZA 2K8HA 3VTWA 4EEWA 4FJZA 2DYBA 1UBIA 3T8MA 2CHWA 1GUAB 2LRWA 2IBIB 2A4ZA 3C0RB 4LJPB 3VUXA 1WFYA 2W9NA 4M0WB 4W9DA 3WAOA 2CHXA 4W9JA 4F1SA 2Y5BB 3ZNZB 4WWPA 4AP4C 2N9XA 4GB9A 5GMVA 2ZCCA 1LQBA 1UH6A 2KKCA 4WQOB 3RYTA 1T0YA 3S2AA 2O2VA 4K7WA 4ANWA 3UIPB 2L76A 1YIWA 5C1ZA 2DAFA 2LASA 5IAAC 2LVOA 1YX5B 1I42A 3JYUA 2UWQA 1V5OA 3JSVA 1KM7A 5DCNA 5L95C 3KUDB 4BKSA 1V80A 2LZ6A 3HIZA 4ICUA 2ZJDA 3A1QB 2V4LA 2KANA 2EKEC 2ZVOA 1LM8B 2DYOA 2KWUB 3EFUA 2KJ6A 1S3SG 4KDLB 4IG7B 3H1UA 1HE8A 3R7RA 3A9KB 4ICVA 3WA0A 4MGZE 1Z2MA 4NJ6A 5LXIB 2AL6A 3H6NA 1WGYA 2C9WB 4MGYE 2LD9A 1WGDA 1TBEA 3CMMB 2WDTB 3KYDD 2NVUI 4HJKA 1ZKHA 2KDFB 4DDGD 3DQVA 1Y8RC 4HWIB 2XBBC 2MWSB 4ZRJA 1VD2A 3UF8A 1OTRB 1ZGUB 2C5LC 3RULA 5CX3A 3L16A 2IO3B 4RM9A 2HE7A 4A3PA 5KHQA 2DENB 2KTRB 3VUYA 4BKSD 5CHVC 1P0RA 4MELA 2K39A 2KDEB 2ZNVC 4TQ1A 2XK5B 1ISNA 1UELA 1FXTB 2RR9A 3N3KB 2DAJA 2JY6A 5AZHA 3H7PB 3R66C 2ZPYA 3TIXA 3ML8A 2AL3A 3VHTC 3I3TB 1JRUA 4BVUC 5LLIA 2M4NA 4YL8A 3NS8A 3N30A 4IW0A 4EUTA 1WI0A 1TGZB 2NPTA 1E8ZA 2A5UA 1WGGA 2J0KA 2JVCA 3ZRCA 4W9LA 4ZRIA 4GDKA 2ZVNA 4FULA 2HTHA 4GGQA 1YQBA 4IM3A 4TUUA 1WH3A 3AU5A 4IWQA 1YX6B 2MW5A 4MJSA 1OEYJ 2D11A 4KSKC 4WJQA 2KMAA 2KQSA 3SD5A 5E6NA 4HK2A 2D2QA 2R2QA 1L2NA 4IM2A 1V2YA 4WWNA 2G4DB 1WX9A 1G6JA 3UQBA 1WRDB 2JUOA 3NHEB 4DXAB 2D07B 2NS5A 4A3OA 2MRPA 1E5WA 1RAXA 4CO7A 4EZKA 4G3XB 5JH5C 1M94A 3WAMA 3JW0X 2CS4A 2MBBB 3KH0A 4EZLA 1GJZA 2O6VD 2GOWA 2IO1B 4HDQA 5D7GA 4TQ0A 2K8BA 2CKHB 3DBRI 4MEMA 2KO3A 1V9JA 3GZNI 4FJVB 2MX2A 2YLMA 4CYEA 2WX0A 4LDTB 3PRZA 2KC2A 2LI5A 1WXMA 3X0WA 1V49A 3B08A 2JPHA 5DPTA 1WIAA 3L13A 1CMXB 1E8XA 1XQQA 2K1FA 3P2BA 1P3QU 3QHTA 3DBSA 2N9PC 2NR2A 2MA9B 4FN2A 4ZRKA 4DHJD 1Q1OA 4BKTA 4PS7A 1J8CA 3VDZA 2NBWB 2M0XA 3ECIA 1QZEA 4AOFA 1J0GA 3NZSA 2J0JA 2MCNB 4HCPB 2K25A 2FAZA 2LGXA 4ZDVA 3QJZA 4W9FA 2Z59B 3W1SC 3V6CB 4JIOU 4NQLB 3KYCD 2FIFA 2KX0A 2ZZPB 1R4NI 4K1RB 5DPWA 4TV3A 1H4RA 2GBJA 3U8ZA 4NQKE 2KDBA 3DVNU 1V86A 4MH0E 4ZYNA 1KLVA 2MBOA 3QQ8B 1WXSA 4GDLB 2JXXA 3GOEA 1MG8A 2MBQA 2FCMA 4BBNF 1RRBA 3ZKJC 3U30A 5CHFA 3IVFA 3QARA 4ANUA 1E7UA 5J2RA 1UD7A 2KZRA 4BFRA 1EO6A 2IY0B 2V3SA 3NOBA 3PRPB 4B6WA 1EF1A 1BT0A 3ZTCA 1OQYA 2AWTA 2MSED 2MP2B 2BYEA 4I6PA 4ANXA 2M8SA 3ZDTA 3KUCB 4KSLC 2BKFA 4WWOA 4E71A 2AEHA 2M17A 4JQWC 3K9PB 4PS8A 4GOCA 2IO0B 4EZJA 2JF5A 2K6QA 1IYFA 2XEWA 1WY8A 3ZDMC 2KMCA 5IA7A 4URKA 2DYMA 3ML9A 3PSEB 3WIMA 4DHZE 3KVFB 3MHSD 3OJ3A 3APFA 2L7RA 2KTFA 2CHZA 1GC6A 2BWFA 2PJHA 5LXHA 3M63B 2BYVE 1IP9A 1F9JA 2LWPA 5AZFA 3CSFA 2JRIB 4I6NB 4FHKA 3UGBB 3IBEA 3ZO5B 3A1QA 1S1QB 5C23A 3VTVA 2L00B 2DZMA 3EHVA 3RZFA 3M62B 3HHMA 2KX3A 3PLVA 5JZEB 3AU4A 5D2MB 3A9KA 3AXCA 5AZGA 2I1JA 2MQJA 3Q3JA 5L83A 3SU8X 2GBKA 5HKHA 3IFWB 1V6EA 1ZW7A 2VRRB 3PS6A 1WE7A 1E90A 1E8YA 2JZ3B 5G55A 4G11A 5J18A 3O65B 2EMTA 2FCQA 2G4SA 2J0MA 3OLMD 3PHXB 2BYFA 4BOSC 1YD8U 3PZDA 1WYWB 3QA8A 2B3AA 3H7SA 2BKRB 4LCDE 4XC2A 5G2NA 2J7QB 2JRHA 3AULA 4DHJB 2DHZA 3W1SA 2KTRA 3Q3FA 4I6LB 3RT3B 4GXBA 3OAWA 2L0TA 3B0AA 2XK5A 3NY5A 2FCSA 3QC8B 4ASWC 4HVBA 3PVLA 4EFOA 4DBGA 5D94A 4BKGA 3H7PA 2KD0A 3ZW3A 3UQAA 3CSTA 2KFKB 3PLUA 4MDKE 3R7QA 2L3ZA 2HD5B 4DWFA 2JT4B 4MM3A 1R4MI 1WE6A 3VXWA 1TZ1A 2V1YA 3WAPA 1Z5SB 3UIOB 3PHWB 3PTFC 5E6OA 2HJ8A 2PE9A 4JGHB 2ZEQA 4KZ0A 3DCGA 5EDSA 3B1LX 3K9OB 4NAWB 2D10A 2RGFA 4HCNB 1D3ZA 1EUVB 3APCA 4EOYA 4GSWA 5E6PA 3VQIA 2L0FA 2NBVB 3PPAA 1TTNA 1WJ6A 2RD0A 1U4AA 5JHBA 4GMVA 3ZNHB 2FUHB 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6D B;  2D3G A;  2GBM A;  4DDI D;  4B95 A;  4HLE A;  4K81 A;  1A5R A;  1UGM A;  1RFA A;  1WX7 A;  2KN5 A;  2YVC A;  4MGK E;  3A4R A;  2DZK A;  2LVP A;  1I35 A;  2REX A;  2RSU A;  3TJP A;  2KFK A;  2O2V B;  3A9J B;  4AUQ C;  3RZW C;  2L05 A;  2RPQ A;  4IM0 A;  3RCZ A;  2GBN A;  4M8N A;  2KK8 A;  2MBE A;  3L0W B;  4KVG B;  2DZI A;  3A33 B;  3L10 B;  4FA6 A;  2FNJ B;  2NCN A;  3JSV B;  2C60 A;  4WAA A;  3T9L A;  3U7D A;  2MLB A;  1AAR A;  4PYU A;  3MTN B;  2ASQ A;  1XD3 B;  4RMA A;  4KZC A;  5BO4 B;  2N7E A;  1SE9 A;  4WJP A;  2PEA A;  4OVV A;  4NJ7 A;  4FBJ B;  2KWV B;  1NBF C;  3ZLZ A;  2C7H A;  4FJY A;  2IY1 B;  4GN1 A;  3VUW A;  3WAN A;  2IYD B;  2AYO B;  1WR6 E;  3OJ4 B;  2KJH B;  4N9F 4;  1YJ1 A;  1GG3 A;  2G45 B;  1Q5W B;  3L54 A;  1EF5 A;  4IC7 B;  2ZPN A;  3M95 A;  3H9D A;  1WGR A;  3QCA A;  4DHZ B;  2IZV B;  3TBL D;  2KLC A;  1H8C A;  4E74 A;  2GBR A;  1K8R B;  2CU1 A;  2G3Q B;  3A9J A;  4K7S A;  2LVQ A;  3TL5 A;  3R3M A;  4B9K A;  2QHO A;  4W9E A;  1WJU A;  2BWE S;  4MSM B;  4AWJ A;  1GNU A;  1OGW A;  3QWZ B;  2WYQ A;  4JLC A;  4AJY B;  1LXD A;  4HPL B;  3ZVV A;  3EEC A;  2DZJ A;  2BF8 B;  1P98 A;  3A4S C;  3L17 A;  2WX1 A;  1NDD A;  2LGY A;  2FID A;  2ZCB A;  4LDT D;  4GU2 A;  1E8W A;  1WM3 A;  3RD2 A;  1XT9 B;  2KJR A;  4IWO A;  3DVN V;  3QX1 A;  5D6J B;  4GDL A;  1IPG A;  1J19 A;  3PRE A;  2KFJ A;  3DBH I;  2PPH A;  4XX5 A;  2MBH A;  3VFK A;  3PGE A;  4E3C A;  4W9C A;  2LXC A;  4AJW A;  2C7N B;  3DVG Y;  2BGF A;  2EMS A;  3M3J A;  4KIK B;  5KHO A;  3X23 A;  2OOB B;  2CR5 A;  3IHP C;  2N1V A;  2NPT B;  3JVZ X;  4K7U A;  1P9D U;  3ZUN A;  4WJO A;  3V60 A;  3V61 A;  2O6V B;  2MP2 A;  1WXA A;  4II2 B;  3LJ3 A;  4MSQ B;  3DDC B;  4FLH A;  4GDK B;  1Q0W B;  3BIN A;  1C3T A;  3HK0 A;  4G0N B;  1SGH A;  2GMI C;  3APD A;  3CF6 E;  3LDZ E;  3ZTD A;  5J17 A;  4P7I A;  3L08 A;  2K8C A;  3W1Y A;  1WX8 A;  4FAD A;  3ZIM A;  4MJS B;  2JZZ A;  4RM8 A;  1LFD A;  3KUZ A;  2LJ5 A;  4II3 B;  5AEK B;  2C7M B;  3ZNG C;  1C1Y B;  1KJT A;  3QIJ A;  3BY4 B;  1WZ0 A;  2Z0E B;  5DPS A;  1WR1 A;  4HXD A;  1PQS A;  3NZU A;  3VH4 B;  3DBL I;  3ZNI D;  2N4F A;  3VH3 B;  2UYZ B;  2KNB A;  4W9G A;  4DK5 A;  5FR6 A;  4KIK A;  1SIF A;  2KVR A;  2LXA A;  2KC1 A;  1WMH B;  4KV2 A;  2DX5 B;  1WJ4 A;  3VVW B;  3MJW A;  5CHW A;  4PS3 A;  4ANV A;  4BBN C;  2O6V A;  2WWZ A;  4OVU A;  3ALB A;  4JL9 A;  4NY0 A;  3AI5 A;  4G50 A;  5TR5 A;  1VCB A;  3UIN B;  4GIV A;  2PE6 B;  1P1A A;  4TKN A;  4W9I A;  4WJN A;  4W9K A;  1NI2 A;  1GC7 A;  3PRM B;  1L7Y A;  2Z0D B;  3RUI B;  2KXJ A;  4MGI E;  4F7Z A;  2LUE A;  3TCA A;  1OEY A;  1RLF A;  3DOW A;  3PT2 B;  4W9H A;  2N7D A;  3V6E B;  4HDO A;  2KWC A;  2OJR A;  2KQ7 A;  3VTU A;  4XZ4 A;  4IUM B;  4NPN A;  4HPM B;  1WM2 A;  3IG3 A;  4X57 B;  4LJO B;  2BPS A;  3ONS A;  1WXV A;  4CHK A;  2L8J A;  4BOZ B;  2KDI A;  3V62 A;  1KOT A;  3SHQ A;  2KOX A;  2N1W A;  1WZ3 A;  2ZNV B;  3PV1 A;  2KHW B;  4NNJ B;  3VAW A;  2KLG A;  1WMH A;  1E7V A;  1UZX B;  3EC8 A;  3ENE A;  3TMP B;  3KW5 B;  4KDI C;  1X1M A;  2LGD A;  3DVG X;  3N32 A;  5CTR C;  2FCN A;  4EKU A;  1WF9 A;  1WJN A;  4J6I A;  2LRU A;  3SDL C;  4M8M A;  5JHA A;  3DPD A;  3ZRF A;  1V5T A;  2R2O A;  1UBQ A;  3D32 A;  3QK0 A;  3QAQ A;  5DPR A;  4A20 A;  3HM3 A;  4IWP A;  2N9E B;  2M1M A;  4PYZ A;  1WGH A;  1V81 A;  2I1K A;  2NBU A;  3HM6 X;  3WAL A;  2IO2 B;  4FHJ A;  4NAW A;  2JWZ A;  2K8H A;  3VTW A;  4EEW A;  4FJZ A;  2DYB A;  1UBI A;  3T8M A;  2CHW A;  1GUA B;  2LRW A;  2IBI B;  2A4Z A;  3C0R B;  4LJP B;  3VUX A;  1WFY A;  2W9N A;  4M0W B;  4W9D A;  3WAO A;  2CHX A;  4W9J A;  4F1S A;  2Y5B B;  3ZNZ B;  4WWP A;  4AP4 C;  2N9X A;  4GB9 A;  5GMV A;  2ZCC A;  1LQB A;  1UH6 A;  2KKC A;  4WQO B;  3RYT A;  1T0Y A;  3S2A A;  2O2V A;  4K7W A;  4ANW A;  3UIP B;  2L76 A;  1YIW A;  5C1Z A;  2DAF A;  2LAS A;  5IAA C;  2LVO A;  1YX5 B;  1I42 A;  3JYU A;  2UWQ A;  1V5O A;  3JSV A;  1KM7 A;  5DCN A;  5L95 C;  3KUD B;  4BKS A;  1V80 A;  2LZ6 A;  3HIZ A;  4ICU A;  2ZJD A;  3A1Q B;  2V4L A;  2KAN A;  2EKE C;  2ZVO A;  1LM8 B;  2DYO A;  2KWU B;  3EFU A;  2KJ6 A;  1S3S G;  4KDL B;  4IG7 B;  3H1U A;  1HE8 A;  3R7R A;  3A9K B;  4ICV A;  3WA0 A;  4MGZ E;  1Z2M A;  4NJ6 A;  5LXI B;  2AL6 A;  3H6N A;  1WGY A;  2C9W B;  4MGY E;  2LD9 A;  1WGD A;  1TBE A;  3CMM B;  2WDT B;  3KYD D;  2NVU I;  4HJK A;  1ZKH A;  2KDF B;  4DDG D;  3DQV A;  1Y8R C;  4HWI B;  2XBB C;  2MWS B;  4ZRJ A;  1VD2 A;  3UF8 A;  1OTR B;  1ZGU B;  2C5L C;  3RUL A;  5CX3 A;  3L16 A;  2IO3 B;  4RM9 A;  2HE7 A;  4A3P A;  5KHQ A;  2DEN B;  2KTR B;  3VUY A;  4BKS D;  5CHV C;  1P0R A;  4MEL A;  2K39 A;  2KDE B;  2ZNV C;  4TQ1 A;  2XK5 B;  1ISN A;  1UEL A;  1FXT B;  2RR9 A;  3N3K B;  2DAJ A;  2JY6 A;  5AZH A;  3H7P B;  3R66 C;  2ZPY A;  3TIX A;  3ML8 A;  2AL3 A;  3VHT C;  3I3T B;  1JRU A;  4BVU C;  5LLI A;  2M4N A;  4YL8 A;  3NS8 A;  3N30 A;  4IW0 A;  4EUT A;  1WI0 A;  1TGZ B;  2NPT A;  1E8Z A;  2A5U A;  1WGG A;  2J0K A;  2JVC A;  3ZRC A;  4W9L A;  4ZRI A;  4GDK A;  2ZVN A;  4FUL A;  2HTH A;  4GGQ A;  1YQB A;  4IM3 A;  4TUU A;  1WH3 A;  3AU5 A;  4IWQ A;  1YX6 B;  2MW5 A;  4MJS A;  1OEY J;  2D11 A;  4KSK C;  4WJQ A;  2KMA A;  2KQS A;  3SD5 A;  5E6N A;  4HK2 A;  2D2Q A;  2R2Q A;  1L2N A;  4IM2 A;  1V2Y A;  4WWN A;  2G4D B;  1WX9 A;  1G6J A;  3UQB A;  1WRD B;  2JUO A;  3NHE B;  4DXA B;  2D07 B;  2NS5 A;  4A3O A;  2MRP A;  1E5W A;  1RAX A;  4CO7 A;  4EZK A;  4G3X B;  5JH5 C;  1M94 A;  3WAM A;  3JW0 X;  2CS4 A;  2MBB B;  3KH0 A;  4EZL A;  1GJZ A;  2O6V D;  2GOW A;  2IO1 B;  4HDQ A;  5D7G A;  4TQ0 A;  2K8B A;  2CKH B;  3DBR I;  4MEM A;  2KO3 A;  1V9J A;  3GZN I;  4FJV B;  2MX2 A;  2YLM A;  4CYE A;  2WX0 A;  4LDT B;  3PRZ A;  2KC2 A;  2LI5 A;  1WXM A;  3X0W A;  1V49 A;  3B08 A;  2JPH A;  5DPT A;  1WIA A;  3L13 A;  1CMX B;  1E8X A;  1XQQ A;  2K1F A;  3P2B A;  1P3Q U;  3QHT A;  3DBS A;  2N9P C;  2NR2 A;  2MA9 B;  4FN2 A;  4ZRK A;  4DHJ D;  1Q1O A;  4BKT A;  4PS7 A;  1J8C A;  3VDZ A;  2NBW B;  2M0X A;  3ECI A;  1QZE A;  4AOF A;  1J0G A;  3NZS A;  2J0J A;  2MCN B;  4HCP B;  2K25 A;  2FAZ A;  2LGX A;  4ZDV A;  3QJZ A;  4W9F A;  2Z59 B;  3W1S C;  3V6C B;  4JIO U;  4NQL B;  3KYC D;  2FIF A;  2KX0 A;  2ZZP B;  1R4N I;  4K1R B;  5DPW A;  4TV3 A;  1H4R A;  2GBJ A;  3U8Z A;  4NQK E;  2KDB A;  3DVN U;  1V86 A;  4MH0 E;  4ZYN A;  1KLV A;  2MBO A;  3QQ8 B;  1WXS A;  4GDL B;  2JXX A;  3GOE A;  1MG8 A;  2MBQ A;  2FCM A;  4BBN F;  1RRB A;  3ZKJ C;  3U30 A;  5CHF A;  3IVF A;  3QAR A;  4ANU A;  1E7U A;  5J2R A;  1UD7 A;  2KZR A;  4BFR A;  1EO6 A;  2IY0 B;  2V3S A;  3NOB A;  3PRP B;  4B6W A;  1EF1 A;  1BT0 A;  3ZTC A;  1OQY A;  2AWT A;  2MSE D;  2MP2 B;  2BYE A;  4I6P A;  4ANX A;  2M8S A;  3ZDT A;  3KUC B;  4KSL C;  2BKF A;  4WWO A;  4E71 A;  2AEH A;  2M17 A;  4JQW C;  3K9P B;  4PS8 A;  4GOC A;  2IO0 B;  4EZJ A;  2JF5 A;  2K6Q A;  1IYF A;  2XEW A;  1WY8 A;  3ZDM C;  2KMC A;  5IA7 A;  4URK A;  2DYM A;  3ML9 A;  3PSE B;  3WIM A;  4DHZ E;  3KVF B;  3MHS D;  3OJ3 A;  3APF A;  2L7R A;  2KTF A;  2CHZ A;  1GC6 A;  2BWF A;  2PJH A;  5LXH A;  3M63 B;  2BYV E;  1IP9 A;  1F9J A;  2LWP A;  5AZF A;  3CSF A;  2JRI B;  4I6N B;  4FHK A;  3UGB B;  3IBE A;  3ZO5 B;  3A1Q A;  1S1Q B;  5C23 A;  3VTV A;  2L00 B;  2DZM A;  3EHV A;  3RZF A;  3M62 B;  3HHM A;  2KX3 A;  3PLV A;  5JZE B;  3AU4 A;  5D2M B;  3A9K A;  3AXC A;  5AZG A;  2I1J A;  2MQJ A;  3Q3J A;  5L83 A;  3SU8 X;  2GBK A;  5HKH A;  3IFW B;  1V6E A;  1ZW7 A;  2VRR B;  3PS6 A;  1WE7 A;  1E90 A;  1E8Y A;  2JZ3 B;  5G55 A;  4G11 A;  5J18 A;  3O65 B;  2EMT A;  2FCQ A;  2G4S A;  2J0M A;  3OLM D;  3PHX B;  2BYF A;  4BOS C;  1YD8 U;  3PZD A;  1WYW B;  3QA8 A;  2B3A A;  3H7S A;  2BKR B;  4LCD E;  4XC2 A;  5G2N A;  2J7Q B;  2JRH A;  3AUL A;  4DHJ B;  2DHZ A;  3W1S A;  2KTR A;  3Q3F A;  4I6L B;  3RT3 B;  4GXB A;  3OAW A;  2L0T A;  3B0A A;  2XK5 A;  3NY5 A;  2FCS A;  3QC8 B;  4ASW C;  4HVB A;  3PVL A;  4EFO A;  4DBG A;  5D94 A;  4BKG A;  3H7P A;  2KD0 A;  3ZW3 A;  3UQA A;  3CST A;  2KFK B;  3PLU A;  4MDK E;  3R7Q A;  2L3Z A;  2HD5 B;  4DWF A;  2JT4 B;  4MM3 A;  1R4M I;  1WE6 A;  3VXW A;  1TZ1 A;  2V1Y A;  3WAP A;  1Z5S B;  3UIO B;  3PHW B;  3PTF C;  5E6O A;  2HJ8 A;  2PE9 A;  4JGH B;  2ZEQ A;  4KZ0 A;  3DCG A;  5EDS A;  3B1L X;  3K9O B;  4NAW B;  2D10 A;  2RGF A;  4HCN B;  1D3Z A;  1EUV B;  3APC A;  4EOY A;  4GSW A;  5E6P A;  3VQI A;  2L0F A;  2NBV B;  3PPA A;  1TTN A;  1WJ6 A;  2RD0 A;  1U4A A;  5JHB A;  4GMV A;  3ZNH B;  2FUH B;  4F8C B; 
#chains in the Genus database with same CATH topology
 2GBM A;  5H92 C;  4K81 A;  1A5R A;  2W54 A;  2KAJ A;  3A4R A;  3WCQ A;  1CK1 A;  2KFK A;  3A9J B;  2L83 A;  4IM0 A;  3SEB A;  4M8N A;  3L0W B;  3AH7 A;  4A8X C;  2NCN A;  4WAA A;  3U7D A;  4PYU A;  1XD3 B;  2M19 A;  2N7E A;  4WJP A;  2PEA A;  3ZLZ A;  3RN9 C;  3RNC C;  1YQ4 B;  3GE3 C;  4ITK A;  5TSS A;  1D5X C;  2E3T A;  3RNF C;  3OJ4 B;  3B2G A;  1JWS D;  4N9F 4;  1YJ1 A;  1GG3 A;  4YTM B;  4LLG M;  1EF5 A;  2ZPN A;  3AV8 A;  1WGR A;  2KLC A;  4C56 C;  1H8C A;  3LB8 C;  1IUE A;  3A9J A;  1I4X A;  2LVQ A;  4B9K A;  4W9E A;  1WJU A;  4AWJ A;  1GNU A;  2PIA A;  2H88 B;  1FCC C;  3DHG C;  2J4X A;  3MP9 A;  2WX1 A;  2LGY A;  3ABV B;  3AM9 A;  4DQO C;  2LHD A;  1XT9 B;  3DVN V;  5D6J B;  2WDV B;  2Y5C A;  2B76 B;  2PPH A;  2MBH A;  3PGE A;  4W9C A;  4TSS A;  2N1V A;  4K7U A;  2OED A;  4WJN A;  4II2 B;  4L2Y A;  3DDC B;  1C3T A;  1Q0W B;  1SGH A;  4HRS A;  3LDZ E;  3ZTD A;  5J17 A;  1FNU A;  4P7I A;  4BZA A;  4EE2 A;  1WX8 A;  3AEA B;  1HQR D;  1LFD A;  3KUZ A;  4RFB A;  2LJ5 A;  4II3 B;  5AEK B;  1C1Y B;  2WXL A;  3QIJ A;  1F77 A;  4HXD A;  5FKA C;  4ARC A;  3DBL I;  2BVC A;  1T0R C;  1JRO A;  2KNB A;  1XLQ A;  1DOX A;  4KV2 A;  1RWS A;  4BBN C;  2WWZ A;  1J7B A;  4G50 A;  4GIV A;  1P1A A;  4W9I A;  4W9K A;  1RM6 C;  1GC7 A;  4M00 A;  3RUI B;  2XNA C;  2LUE A;  2N7D A;  4YT0 B;  2KWC A;  2QIL A;  1N63 A;  1T0Q C;  4IUM B;  3TEY A;  1KOT A;  2RDB C;  3RNB C;  1DOI A;  1WXQ A;  3DHH C;  3TMP B;  2QEJ C;  2Q5W D;  1X1M A;  2FCN A;  2KWD A;  1WF9 A;  1AN8 A;  2BQQ A;  3DPD A;  4C7Z A;  4JWU C;  3QAQ A;  1CJE A;  5E6J A;  4IWP A;  2N9E B;  1WGH A;  1FPY A;  3HM6 X;  2NBU A;  1HTO A;  1XCT L;  2K8H A;  4FJZ A;  3T8M A;  2CHW A;  3VUX A;  4M0W B;  3Q6B A;  4WUR A;  3MFG A;  3I5J C;  2WGS A;  4WWM A;  1YN4 A;  3S2A A;  3MC0 B;  4ACF A;  5IAA C;  3AED B;  1YQ3 B;  1VLB A;  1SE3 A;  1KM7 A;  3U4E G;  4BKS A;  2LZ6 A;  2QJL A;  2ZJD A;  1M4V A;  2WXG A;  2K22 A;  1T6B X;  1C76 A;  3WA0 A;  5IKC M;  2LD9 A;  2N9K A;  1N5X A;  1WGD A;  2WHI A;  3CMM B;  1WGK A;  2WDT B;  3KYD D;  1PUT A;  4HJK A;  1TS4 A;  2KDF B;  1Y8R C;  2UU7 A;  1VD2 A;  1ZGU B;  2INP E;  1LGR A;  2HE7 A;  2KTR B;  1SBB B;  2Z8L A;  2WXF A;  2K39 A;  3HUI A;  3FIL A;  2ZNV C;  1K53 A;  3ETR A;  3N3K B;  2QMT A;  2L52 A;  5IOI A;  4M01 A;  4BVU C;  5LLI A;  2D5G A;  3AE5 B;  4IW0 A;  1L6V A;  1NI3 A;  1TGZ B;  2A5U A;  1TKG A;  1WGG A;  4C4V A;  4GDK A;  1YOV B;  4TUU A;  3AU5 A;  1D6E C;  2D11 A;  4KSK C;  4WJQ A;  5E6N A;  1XF5 L;  4IM2 A;  3Q3N C;  1V2Y A;  1WX9 A;  1JWA D;  3NHE B;  1E5W A;  2ONQ A;  1RAX A;  4KGT A;  3WAM A;  4EZL A;  4TQ0 A;  1KFY B;  3DBR I;  3P42 A;  5D3D A;  2KQ4 X;  3ZXV A;  4MAC A;  4A90 A;  2BTE A;  1NVI D;  2WU5 B;  1WXM A;  4Q2J A;  3ZJV A;  4RGM A;  1E8X A;  1XQQ A;  1JQ4 A;  2MA9 B;  4BKT A;  2M0X A;  1QKZ A;  4LNO A;  4A9A A;  4S0R A;  2K25 A;  2FAZ A;  3V6C B;  3KYC D;  2ZZP B;  5DPW A;  3U8Z A;  4YXD B;  4A55 A;  4N58 A;  4NQK E;  4ZYN A;  1V86 A;  4MH0 E;  2MBO A;  1UWM A;  2NTT A;  2MBQ A;  3NVZ A;  4ANU A;  1I4H A;  1IGD A;  1NYQ A;  2G1E A;  3NZ3 A;  2MSE D;  2MP2 B;  4I6P A;  1SJH D;  3GE8 C;  2GRI A;  4KX6 B;  3KUC B;  1C4P A;  1XLP A;  2AEH A;  3K9P B;  1F2R C;  1HXY D;  2RPV A;  4GOC A;  4RH6 A;  2XEW A;  5HG2 A;  1DOY A;  3ZDM C;  3TEZ A;  2KMC A;  1IGC A;  1AW7 A;  3DBH B;  1ZDX A;  1UUP A;  2KTF A;  2BYV E;  4I6N B;  3NS1 A;  2V0G A;  3A1Q A;  5C23 A;  3M62 B;  2KX3 A;  5JZE B;  5G5G A;  5D2M B;  1L0V B;  5AZG A;  5HKH A;  1V6E A;  2VRR B;  3PS6 A;  2EMT A;  2FCQ A;  2J0M A;  3OLM D;  2BYF A;  3BWU D;  1QLB B;  1YD8 U;  3QA8 A;  3H7S A;  4LCD E;  4XC2 A;  5G2N A;  4YSY B;  3W5V B;  1JW9 D;  3RT3 B;  2L0T A;  2WXI A;  1VZ8 A;  4US8 A;  3ZJT A;  3QC8 B;  4ASW C;  3PVL A;  4EFO A;  4DBG A;  4XYC A;  3H7P A;  1J7A A;  1ZPS A;  4C7Y A;  1WE6 A;  2V3N A;  3AEE B;  2V1Y A;  1Z5S B;  3UIO B;  3PHW B;  5E6O A;  1SE2 A;  5AUI A;  2PE9 A;  3FAH A;  4JGH B;  4JE3 B;  3PZ7 A;  1D3Z A;  5GXG B;  2QSD A;  4GSW A;  3VQI A;  1U4A A;  3RPF C;  4PT5 A;  3EGR A;  5T8I A;  4DDI D;  1ACC A;  4B95 A;  1UGM A;  1XXG A;  3FKY A;  4AUQ C;  1CZP A;  2RPQ A;  2ZW0 A;  2TSS A;  4LNI A;  3MC9 A;  3BZD B;  2FNJ B;  3NVY A;  2VZK B;  2ASQ A;  3V3X A;  2AQ1 B;  4NJ7 A;  2C7H A;  2IY1 B;  4GN1 A;  3VUW A;  2AYO B;  2N9L A;  4LNK A;  1Q5W B;  3M95 A;  4DHZ B;  2IZV B;  3TBL D;  4E74 A;  2GBR A;  1K8R B;  2BS4 B;  3R3M A;  4TMA B;  2WYQ A;  4JLC A;  1D5Z C;  3EEC A;  2DZJ A;  4BOZ B;  3L17 A;  2PLP A;  2FID A;  2ZCB A;  1E8W A;  3EA6 A;  3RD2 A;  1DGJ A;  3QX1 A;  1L0Y B;  1J19 A;  2KFJ A;  3DBH I;  2N7J A;  5G5H A;  2C7N B;  2L1A A;  3DVG Y;  4KIK B;  5KHO A;  3W2D A;  2CR5 A;  3IHP C;  2NPT B;  3ZUN A;  3V60 A;  1ROE A;  2N0S B;  3BII D;  3LJ3 A;  4G0N B;  3CF6 E;  1C4C A;  2YEP F;  1YMH E;  3L08 A;  2K8C A;  3W1Y A;  1L4Z B;  4FAD A;  4C00 A;  3PZ8 A;  3N20 C;  3AEC B;  4RM8 A;  2C7M B;  4DXG A;  1KJT A;  5BMG A;  4HEA 1;  5DPS A;  3VH4 B;  2M0A A;  3ZNI D;  1NYR A;  1T5X D;  1F2R I;  2ICI A;  1P7E A;  4KIK A;  1SIF A;  3ZGZ A;  2KVR A;  4M02 A;  2KC1 A;  3KWL A;  3MJW A;  5CHW A;  4PS3 A;  1JWB D;  3TEX A;  4OVU A;  4JL9 A;  4NY0 A;  3HRD D;  4YTN B;  4P1C C;  5TR5 A;  3UIN B;  4NZL B;  4TKN A;  4ZOH C;  1NI2 A;  1QQR A;  1ET6 A;  4W9H A;  2K3U A;  2XN9 C;  3AE8 B;  2KQ7 A;  1GB1 A;  1WM2 A;  4X57 B;  3ONS A;  2L8J A;  1ENF A;  2KDI A;  4RGN A;  2N1W A;  2HTM E;  1FO4 A;  1SEB D;  4WIP A;  1UZX B;  3L4P A;  2FE8 A;  3KW5 B;  1ZOY B;  1STE A;  2LGD A;  3VRA B;  2LRU A;  1JRP A;  3ZRF A;  3AE3 B;  1V5T A;  2R2O A;  1UBQ A;  3D32 A;  4J3O D;  4A20 A;  3HM3 A;  2IO2 B;  4FHJ A;  4LNF A;  1IBX A;  4HJG E;  4RGO S;  3ZXR A;  1UBI A;  1JWU D;  1GUA B;  2ON8 A;  2IBI B;  4LJP B;  4LK0 M;  3RNA C;  4A6Q A;  2W9N A;  4F1S A;  1UWX A;  4WQO B;  2I38 A;  3RYT A;  4ANW A;  3UIP B;  1YIW A;  5C1Z A;  1I42 A;  5DCN A;  5L95 C;  1V80 A;  3AE2 B;  3HIZ A;  1TS3 A;  4ICU A;  1E0Z A;  3V05 A;  2ZVO A;  1LM8 B;  2DYO A;  2KWU B;  3EFU A;  2WU2 B;  4C80 A;  1Z2M A;  1C79 A;  4NJ6 A;  2AL6 A;  4MGY E;  2C9W B;  3N1Y C;  2YEP B;  1PGX A;  1Q10 A;  4DDG D;  4HWI B;  2XBB C;  2MWS B;  1MJD A;  1OTR B;  5CX3 A;  1B9R A;  2IO3 B;  3VUY A;  5CHV C;  4MEL A;  4JPS A;  4TQ1 A;  2XK5 B;  1FXT B;  4FXC A;  2RR9 A;  1CQV A;  1QIL A;  3TIX A;  3DHI C;  1BML C;  1N6Z A;  4YL8 A;  3N30 A;  4EUT A;  1OFF A;  1WI0 A;  1E8Z A;  2PMV A;  2J0K A;  1K51 A;  2ZVN A;  4HKZ E;  2K9X A;  4REZ A;  4O1N A;  3J9C A;  2RDG A;  1OEY J;  2KMA A;  2LGS A;  2D2Q A;  1FEH A;  1E10 A;  1WRD B;  4DXA B;  4A3O A;  2K5P A;  4G3X B;  1EU4 A;  5JH5 C;  2KT7 A;  2MBB B;  3KH0 A;  2LEK A;  2IO1 B;  5D7G A;  2GLS A;  4XE0 A;  4MEM A;  3IT4 B;  4FJV B;  1V1P B;  2BT6 A;  4IDI A;  4LDT B;  3PRZ A;  3GP7 A;  4ZRP A;  1CMX B;  4ZYS A;  2MJ3 A;  2MEK A;  3DWM A;  2N9P C;  2Y5P A;  3AB5 A;  4PS7 A;  3RMK C;  1C77 A;  1K52 A;  4LTU A;  3ECI A;  1NEN B;  3NZS A;  2J0J A;  4W9F A;  3W1S C;  2JQR B;  1YJI A;  1K50 A;  2KDB A;  2WXQ A;  1WXS A;  4GDL B;  3GOE A;  2FCM A;  1WWT A;  2MJE A;  2IGD A;  1SF0 A;  1TS2 A;  1E7U A;  1UD7 A;  4BFR A;  2IY0 B;  4WQM A;  4YSZ B;  2WXO A;  2G9H D;  1BT0 A;  3ZTC A;  3NRZ A;  2BYE A;  1F0Z A;  3ZDT A;  4M0W A;  4E71 A;  1B1Z A;  2BKF A;  2M17 A;  4JQW C;  2IO0 B;  4EZJ A;  2JF5 A;  2K6Q A;  2CJO A;  1C4A A;  5IA7 A;  2R61 A;  3APF A;  2CHZ A;  4OW0 A;  2BWF A;  2DLB A;  3AMZ A;  4YSX B;  1IP9 A;  4N6E B;  2LWP A;  5AZF A;  3CSF A;  1VR9 A;  2JRI B;  1PYW D;  3EUB 2;  1S1Q B;  3VTV A;  3RZF A;  5BMI A;  4OZA A;  1RFK A;  3Q3J A;  3SU8 X;  2GBK A;  3IFW B;  3SFE B;  5G55 A;  5J18 A;  1TKY A;  3RI7 C;  2D3C A;  2J7Q B;  3AUL A;  4DHJ B;  2DHZ A;  3W1S A;  2KTR A;  1TS5 A;  4I6L B;  2JU6 X;  3OAW A;  1GAQ B;  3NY5 A;  2FCS A;  1EM7 A;  2PVG C;  4HVB A;  3W5U B;  2JSV X;  4B0E A;  3ZW3 A;  3I57 A;  3UQA A;  3CST A;  2GB1 A;  4MDK E;  4NJC A;  2JT4 B;  1PGB A;  1TZ1 A;  2NTS A;  4N59 A;  2WXJ A;  2ZEQ A;  3B1L X;  4NAW B;  3U7Z A;  2D10 A;  2RGF A;  2VH1 A;  4HCN B;  3P4S B;  4XWT A;  3APC A;  2K0P A;  2L0F A;  3PPA A;  3RFZ B;  2RD0 A;  4RGT A;  1MFW A;  3X0W A;  3Q8F A;  5EE1 A;  4HLE A;  1ZDV A;  1SE4 A;  4LNN A;  1WX7 A;  2KN5 A;  4MGK E;  2LVP A;  1I35 A;  3P4P B;  2REX A;  1I7H A;  2RSU A;  3TJP A;  2O2V B;  3RZW C;  2Y3A A;  2IGH A;  3RCZ A;  2GBN A;  1UNS A;  2MBE A;  4KGR A;  2SEB D;  3A33 B;  3JSV B;  2C60 A;  3T9L A;  1AAR A;  4GLS C;  4RMA A;  4KZC A;  1NEK B;  3IXS A;  1SE9 A;  4OVV A;  2KWV B;  4FJY A;  2FBW B;  1WR6 E;  3P4R B;  3NUH B;  3HVD A;  2EEL A;  3VR8 B;  4IC7 B;  3H9D A;  4HKQ A;  5C3J B;  2G3Q B;  4K7S A;  3SR6 A;  3TL5 A;  3ZJU A;  1QOA A;  5BYQ A;  1F52 A;  2J42 A;  2BF8 B;  4LDT D;  4GU2 A;  4IWO A;  2V9H A;  3P1M A;  3IAS 1;  3W9C B;  3VFK A;  4D2K A;  2WDQ B;  1EWY C;  1TY2 A;  4AJW A;  2EMS A;  3NVW A;  2WS3 B;  2OOB B;  3JVZ X;  1P9D U;  4H2A A;  2O6V B;  2MP2 A;  1WXA A;  2WP9 B;  4MSQ B;  4YTP B;  3BIN A;  4S17 A;  3HK0 A;  2DWQ A;  1KF6 B;  3ZIM A;  4MJS B;  2JZZ A;  3LYY A;  3HVZ A;  3BY4 B;  1WR1 A;  1PQS A;  1WSP A;  5AUK A;  2N4F A;  2UYZ B;  1JWM D;  4W9G A;  2ZW1 A;  2LXA A;  4KKJ A;  2DX5 B;  2INN E;  2WNM A;  3BYT B;  2O6V A;  2QDF A;  3ALB A;  2D3B A;  2PE6 B;  3Q2A C;  1L7Y A;  4MGI E;  3I9V 1;  3TCA A;  1D5M C;  3V6E B;  3DOW A;  2W55 A;  2OJR A;  2CJN A;  4XZ4 A;  1L0X B;  4LJO B;  1FFU A;  4CHK A;  1XEE A;  3V62 A;  3SHQ A;  2KOX A;  3AE7 B;  4P1B C;  1C9F A;  1VJK A;  3VAW A;  5IP4 D;  1E7V A;  4P16 A;  4EKU A;  5CTR C;  3Q8E A;  1WJN A;  3CIR B;  4J6I A;  3SDL C;  4M8M A;  5HI1 A;  1I4G A;  2LGI A;  3MJ5 A;  4OHJ A;  5FR3 A;  3NJT A;  3BK1 A;  1WYG A;  3WAL A;  4KKI A;  2JWZ A;  4IOI E;  4PK1 A;  4EEW A;  2DYB A;  2A4Z A;  3C19 A;  4W9D A;  2CHX A;  2Y5B B;  3ZNZ B;  2N9X A;  4GB9 A;  5GMV A;  3Q14 C;  4AS1 A;  2KKC A;  2WXP A;  1DYQ A;  3SFD B;  1C78 A;  4K7W A;  1KRH A;  2WDR B;  2DAF A;  1N5W A;  3AEB B;  2I2Y A;  1YX5 B;  4DXF A;  1V5O A;  1KLU D;  2WXR A;  4WAF A;  3KUD B;  1I4Q A;  2KAN A;  2V4L A;  2EKE C;  2PTL A;  2WQY B;  5LNK 1;  3H1U A;  2KDM A;  3EFC A;  1FMA D;  3A9K B;  2JYE A;  4MH8 A;  5LXI B;  3VR9 B;  3T3N A;  1A70 A;  3TUO A;  2NVU I;  3RNE C;  1ZKH A;  3DQV A;  1GB4 A;  3RUL A;  1SB3 C;  4R3D A;  3L16 A;  3IAM 1;  4RM9 A;  3KLS X;  2DEN B;  1P0R A;  4BAX A;  2KDE B;  1QF6 A;  1ISN A;  1MHH E;  1UEL A;  3P4Q B;  2WXK A;  5AZH A;  4ARI A;  3ML8 A;  3RNG C;  3VHT C;  1LO5 D;  3H8H A;  5H8Y E;  3I3T B;  1OQQ A;  3R8B A;  3ZQ4 A;  2M4N A;  2WXH A;  3NS8 A;  3Q69 A;  1HZ5 A;  1PGA A;  4MM3 B;  2NPT A;  3ZRC A;  3N1Z C;  2AQ2 B;  2HTH A;  4GGQ A;  1VDV A;  1WH3 A;  1JML A;  4B0M A;  2MW5 A;  1AYF A;  2KQS A;  3SD5 A;  1T3Q A;  4HK2 A;  3R2T A;  1L2N A;  3N9Y C;  3OG5 A;  4WWN A;  2G4D B;  1G6J A;  3UQB A;  1MPE A;  3GB1 A;  2D07 B;  2NS5 A;  1UF0 A;  4EZK A;  2EKI A;  3JW0 X;  2O6V D;  2K8B A;  2X8X X;  1RYJ A;  3OWE B;  3E9S A;  2KO3 A;  1V9J A;  1FM0 D;  2MX2 A;  2LHE A;  4OVZ A;  2WX0 A;  2KC2 A;  3U2S C;  1V49 A;  3B08 A;  3I63 C;  3MHZ A;  3P2B A;  1P3Q U;  3QHT A;  3DBS A;  4ZRK A;  4FN2 A;  4WH4 A;  3LXF A;  1TYG B;  2JZP A;  4AQ7 A;  2NBW B;  5EE0 A;  4CQN A;  4AOF A;  1J0G A;  2MCN B;  5BYS A;  2LGX A;  4ZDV A;  3QJZ A;  2Z59 B;  2KX0 A;  1I4P A;  1H4R A;  1PDX A;  1KLV A;  1PFD A;  1MG8 A;  4BBN F;  3URY A;  1RRB A;  3FC4 A;  3ZKJ C;  3QAR A;  5J2R A;  2KZR A;  3Q8A A;  1EO6 A;  2V3S A;  3NOB A;  3PRP B;  1EF1 A;  2M8S A;  4KSL C;  4RNA A;  2IDY A;  1WY8 A;  2X38 A;  4US9 A;  4URK A;  2DYM A;  3PSE B;  4DHZ E;  3OJ3 A;  2L7R A;  2KAC A;  1GC6 A;  2VZK D;  4XGA B;  2PVO D;  1KTK A;  4FHK A;  1QOG A;  3UGB B;  4USA A;  3TEW A;  5I4D A;  1T0S C;  2BB6 A;  1XO3 A;  2DZM A;  3EHV A;  2D3A A;  1ET9 A;  3PLV A;  3AU4 A;  5L83 A;  1HA5 A;  1WE7 A;  1AWD A;  1E90 A;  2JZ3 B;  4G11 A;  3O65 B;  2G4S A;  4KGS A;  4BOS C;  3PZD A;  3BVG A;  4K3C A;  3T3O A;  3N1X C;  1XCQ L;  2IND C;  4UDU C;  2HJ1 A;  3Q3F A;  3B0A A;  2HDE A;  2XK5 A;  3PO0 A;  2PW9 A;  1MHX A;  5D94 A;  1BUI C;  2RMM A;  3R7Q A;  2HD5 B;  4DWF A;  2LUM A;  3VXW A;  1XLO A;  1KH0 A;  4KZ0 A;  5EDS A;  3K9O B;  2QCZ A;  1EUV B;  1TZO A;  4EOY A;  5E6P A;  1ZXH A;  1WJ6 A;  5JHB A;  3ZNH B;  2FUH B;  2K6D B;  2D3G A;  3AN1 A;  3DBR B;  3Q8C A;  1RFA A;  2YVC A;  1KLG D;  2DZK A;  4MT5 A;  3ZYY X;  2KMM A;  1ZUD 2;  2GI9 A;  2L05 A;  2KK8 A;  4KVG B;  2DZI A;  3L10 B;  4FA6 A;  3U52 E;  2MLB A;  3MTN B;  2RDH A;  1SIJ A;  5BO4 B;  2JWU A;  1V1P A;  1FNW A;  3O13 A;  4FBJ B;  1NBF C;  1R7S A;  3WAN A;  2IYD B;  2CU3 A;  2BS2 B;  3E56 A;  3AEF B;  2KJH B;  1TIF A;  2G45 B;  2JXT A;  3L54 A;  3QCA A;  5IO9 A;  1E7P B;  1FNV A;  2CU1 A;  1VZ6 A;  4HPP A;  2QHO A;  1UGJ A;  2BWE S;  4MSM B;  1OGW A;  3QWZ B;  4AJY B;  1LXD A;  4HPL B;  3ZVV A;  1TJE A;  1V8C A;  3FIL B;  1P98 A;  3A4S C;  3VTW A;  1NDD A;  1WM3 A;  1FFV A;  2KJR A;  2W82 A;  1IPG A;  4GDL A;  3PRE A;  3CWI A;  4E3C A;  4XX5 A;  4IKG A;  2QC8 A;  2LXC A;  2BGF A;  3M3J A;  3X23 A;  4WJO A;  3V61 A;  4C4V B;  4FLH A;  4GDK B;  2GMI C;  3APD A;  1OQR A;  2J52 A;  1V97 A;  2J53 A;  4RF0 A;  2JX5 A;  1I4R A;  3ZNG C;  4K3B A;  3Q8B A;  1WZ0 A;  2Z0E B;  3NVV A;  2JYT A;  3NZU A;  5HHD G;  3VH3 B;  2MH7 A;  4DK5 A;  5FR6 A;  2BW2 A;  1WMH B;  1WJ4 A;  3VVW B;  5C2T B;  4ANV A;  2W3R A;  3AI5 A;  1VCB A;  3KWV A;  5BMH A;  3PRM B;  2Z0D B;  4F7Z A;  4NAM A;  2KXJ A;  3AE9 B;  1OEY A;  1RLF A;  2BBC A;  3PT2 B;  2H89 B;  4HDO A;  2SAK A;  3VTU A;  4NPN A;  1TT5 B;  4HPM B;  3IG3 A;  1GOZ A;  2BPS A;  1WXV A;  2WXN A;  4OZC A;  2E6X A;  2ZNV B;  1WZ3 A;  3PV1 A;  2KHW B;  4NNJ B;  2AX5 A;  2KLG A;  1WMH A;  3GZN B;  3EC8 A;  1E9M A;  3ENE A;  1QOB A;  5HFY A;  4KDI C;  3DVG X;  2KYW A;  3N32 A;  5JXV A;  3IT6 B;  5JHA A;  3QK0 A;  5DPR A;  4PYZ A;  2M1M A;  1V81 A;  2I1K A;  1YNT E;  2QIE B;  4NAW A;  2LRW A;  3C0R B;  2IJ0 A;  1WFY A;  3WAO A;  4W9J A;  1R4N B;  4JWS C;  4WWP A;  4AP4 C;  1E6E B;  3VRB B;  2ZCC A;  1LQB A;  1UH6 A;  1L6U A;  5FK9 C;  1T0Y A;  3MC8 A;  2O2V A;  2L76 A;  2LAS A;  2LVO A;  3JYU A;  2UWQ A;  3JSV A;  3Q3M C;  2INC C;  3A1Q B;  1FD6 A;  2IPK D;  2W3S A;  2KJ6 A;  1S3S G;  4KDL B;  4IG7 B;  2FUG 1;  1HE8 A;  3R7R A;  4ICV A;  4MGZ E;  3H6N A;  1WGY A;  2MHJ A;  1TBE A;  3KQ4 A;  5BYR A;  1N60 A;  2LFI A;  1FCL A;  4ZRJ A;  3UF8 A;  4L23 A;  2C5L C;  3BK2 A;  4A3P A;  5KHQ A;  2M56 B;  4BKS D;  1BXT A;  3R2I A;  3AE6 B;  1FXA A;  1VRA B;  2DAJ A;  2JY6 A;  3H7P B;  3R66 C;  2ZPY A;  1FRR A;  2AL3 A;  1JRU A;  4RCO A;  1ZP0 B;  3DWG C;  2JVC A;  4W9L A;  4ZRI A;  3AE1 B;  3B2F A;  2LJI A;  4FUL A;  4XDD A;  1YQB A;  1QT9 A;  4IM3 A;  1P7F A;  4IWQ A;  1YX6 B;  4P6V F;  1HEZ E;  4MJS A;  1HZ6 A;  1QOF A;  1Y56 A;  2R2Q A;  3BVM A;  1ZE3 D;  1L4D B;  1FRD A;  1XLN A;  2JUO A;  1R4M B;  2MRP A;  1F1H A;  4CO7 A;  1N62 A;  4HRO A;  3AEG B;  1M94 A;  2BS3 B;  2CS4 A;  1GJZ A;  2L32 A;  2GOW A;  4HDQ A;  1YN5 A;  1MI0 A;  2CKH B;  1ESF A;  3GZN I;  2OHF A;  2YLM A;  1HTQ A;  2AQ3 B;  4CYE A;  1FXI A;  2LI5 A;  5DPT A;  2JPH A;  1WIA A;  2ACZ B;  3L13 A;  2K1F A;  5EE3 A;  2NR2 A;  4DHJ D;  1Q1O A;  5EE9 A;  1J8C A;  3VDZ A;  1VZ7 A;  1QZE A;  4HCP B;  3B9J A;  4L1B A;  4JIO U;  4NQL B;  1D4B A;  2FIF A;  2V4I B;  1EU3 A;  1R4N I;  4K1R B;  4TV3 A;  2OJW A;  2GBJ A;  2NMQ A;  3DVN U;  1YJJ A;  3QQ8 B;  3P63 A;  3GS2 A;  3Q3O C;  2JXX A;  1FIQ A;  1SJE D;  3U30 A;  5CHF A;  3IVF A;  4B6W A;  1N61 A;  1EWC A;  1OQY A;  2AWT A;  1ZXI A;  4ANX A;  4RF1 A;  4WWO A;  4ZRQ A;  1MG4 A;  4PS8 A;  5MPO A;  4XDC A;  3BYY B;  4ZHO A;  4ZHP A;  1IYF A;  1YN3 A;  3TSS A;  3ML9 A;  3WIM A;  3KVF B;  3MHS D;  1JAL A;  2KN4 A;  2PJH A;  5LXH A;  3M63 B;  1F9J A;  2WXM A;  1MVK A;  3IBE A;  3ZO5 B;  1L5P A;  2L00 B;  3UI3 A;  3HHM A;  1WRI A;  3A9K A;  3AXC A;  2I1J A;  2MQJ A;  1ZW7 A;  1E8Y A;  5IN7 A;  3PHX B;  1J7C A;  3DBL B;  1WYW B;  2B3A A;  2BKR B;  2WLB A;  2JRH A;  3BVZ A;  1V1O A;  4GXB A;  1SSN A;  4YWG G;  2LMC A;  3C8Y A;  2BB5 A;  4QAY A;  4BKG A;  4XWW A;  2KD0 A;  2PKO A;  1TKE A;  2MJD A;  2BYT A;  2KFK B;  3AE4 B;  3PLU A;  2L3Z A;  5D3I B;  4MM3 A;  1R4M I;  3NG0 A;  4OZB A;  3WAP A;  1GPX A;  3PTF C;  2DBY A;  4JX1 C;  2HJ8 A;  2V3P A;  2IGG A;  3DCG A;  1IBX B;  2VH2 A;  1JCK B;  2DNF A;  1TY0 A;  2KVZ A;  2NBV B;  1TTN A;  1SXT A;  4GMV A;  4F8C B; 
#chains in the Genus database with same CATH homology
 2K6D B;  2D3G A;  2GBM A;  4DDI D;  4B95 A;  4HLE A;  4K81 A;  1A5R A;  1UGM A;  1RFA A;  1WX7 A;  2KN5 A;  2YVC A;  4MGK E;  3A4R A;  2DZK A;  2LVP A;  1I35 A;  2REX A;  2RSU A;  3TJP A;  2KFK A;  2O2V B;  3A9J B;  4AUQ C;  3RZW C;  2L05 A;  2RPQ A;  4IM0 A;  3RCZ A;  2GBN A;  4M8N A;  2KK8 A;  2MBE A;  3L0W B;  4KVG B;  2DZI A;  3A33 B;  3L10 B;  4FA6 A;  2FNJ B;  2NCN A;  3JSV B;  2C60 A;  4WAA A;  3T9L A;  3U7D A;  2MLB A;  1AAR A;  4PYU A;  3MTN B;  2ASQ A;  1XD3 B;  4RMA A;  4KZC A;  5BO4 B;  2N7E A;  1SE9 A;  4WJP A;  2PEA A;  4OVV A;  4NJ7 A;  4FBJ B;  2KWV B;  1NBF C;  3ZLZ A;  2C7H A;  4FJY A;  2IY1 B;  4GN1 A;  3VUW A;  3WAN A;  2IYD B;  2AYO B;  1WR6 E;  3OJ4 B;  2KJH B;  4N9F 4;  1YJ1 A;  1GG3 A;  2G45 B;  1Q5W B;  3L54 A;  1EF5 A;  4IC7 B;  2ZPN A;  3M95 A;  3H9D A;  1WGR A;  3QCA A;  4DHZ B;  2IZV B;  3TBL D;  2KLC A;  1H8C A;  4E74 A;  2GBR A;  1K8R B;  2CU1 A;  2G3Q B;  3A9J A;  4K7S A;  2LVQ A;  3TL5 A;  3R3M A;  4B9K A;  2QHO A;  4W9E A;  1WJU A;  2BWE S;  4MSM B;  4AWJ A;  1GNU A;  1OGW A;  3QWZ B;  2WYQ A;  4JLC A;  4AJY B;  1LXD A;  4HPL B;  3ZVV A;  3EEC A;  2DZJ A;  2BF8 B;  1P98 A;  3A4S C;  3L17 A;  2WX1 A;  1NDD A;  2LGY A;  2FID A;  2ZCB A;  4LDT D;  4GU2 A;  1E8W A;  1WM3 A;  3RD2 A;  1XT9 B;  2KJR A;  4IWO A;  3DVN V;  3QX1 A;  5D6J B;  4GDL A;  1IPG A;  1J19 A;  3PRE A;  2KFJ A;  3DBH I;  2PPH A;  4XX5 A;  2MBH A;  3VFK A;  3PGE A;  4E3C A;  4W9C A;  2LXC A;  4AJW A;  2C7N B;  3DVG Y;  2BGF A;  2EMS A;  3M3J A;  4KIK B;  5KHO A;  3X23 A;  2OOB B;  2CR5 A;  3IHP C;  2N1V A;  2NPT B;  3JVZ X;  4K7U A;  1P9D U;  3ZUN A;  4WJO A;  3V60 A;  3V61 A;  2O6V B;  2MP2 A;  1WXA A;  4II2 B;  3LJ3 A;  4MSQ B;  3DDC B;  4FLH A;  4GDK B;  1Q0W B;  3BIN A;  1C3T A;  3HK0 A;  4G0N B;  1SGH A;  2GMI C;  3APD A;  3CF6 E;  3LDZ E;  3ZTD A;  5J17 A;  4P7I A;  3L08 A;  2K8C A;  3W1Y A;  1WX8 A;  4FAD A;  3ZIM A;  4MJS B;  2JZZ A;  4RM8 A;  1LFD A;  3KUZ A;  2LJ5 A;  4II3 B;  5AEK B;  2C7M B;  3ZNG C;  1C1Y B;  1KJT A;  3QIJ A;  3BY4 B;  1WZ0 A;  2Z0E B;  5DPS A;  1WR1 A;  4HXD A;  1PQS A;  3NZU A;  3VH4 B;  3DBL I;  3ZNI D;  2N4F A;  3VH3 B;  2UYZ B;  2KNB A;  4W9G A;  4DK5 A;  5FR6 A;  4KIK A;  1SIF A;  2KVR A;  2LXA A;  2KC1 A;  1WMH B;  4KV2 A;  2DX5 B;  1WJ4 A;  3VVW B;  3MJW A;  5CHW A;  4PS3 A;  4ANV A;  4BBN C;  2O6V A;  2WWZ A;  4OVU A;  3ALB A;  4JL9 A;  4NY0 A;  3AI5 A;  4G50 A;  5TR5 A;  1VCB A;  3UIN B;  4GIV A;  2PE6 B;  1P1A A;  4TKN A;  4W9I A;  4WJN A;  4W9K A;  1NI2 A;  1GC7 A;  3PRM B;  1L7Y A;  2Z0D B;  3RUI B;  2KXJ A;  4MGI E;  4F7Z A;  2LUE A;  3TCA A;  1OEY A;  1RLF A;  3DOW A;  3PT2 B;  4W9H A;  2N7D A;  3V6E B;  4HDO A;  2KWC A;  2OJR A;  2KQ7 A;  3VTU A;  4XZ4 A;  4IUM B;  4NPN A;  4HPM B;  1WM2 A;  3IG3 A;  4X57 B;  4LJO B;  2BPS A;  3ONS A;  1WXV A;  4CHK A;  2L8J A;  4BOZ B;  2KDI A;  3V62 A;  1KOT A;  3SHQ A;  2KOX A;  2N1W A;  1WZ3 A;  2ZNV B;  3PV1 A;  2KHW B;  4NNJ B;  3VAW A;  2KLG A;  1WMH A;  1E7V A;  1UZX B;  3EC8 A;  3ENE A;  3TMP B;  3KW5 B;  4KDI C;  1X1M A;  2LGD A;  3DVG X;  3N32 A;  5CTR C;  2FCN A;  4EKU A;  1WF9 A;  1WJN A;  4J6I A;  2LRU A;  3SDL C;  4M8M A;  5JHA A;  3DPD A;  3ZRF A;  1V5T A;  2R2O A;  1UBQ A;  3D32 A;  3QK0 A;  3QAQ A;  5DPR A;  4A20 A;  3HM3 A;  4IWP A;  2N9E B;  2M1M A;  4PYZ A;  1WGH A;  1V81 A;  2I1K A;  2NBU A;  3HM6 X;  3WAL A;  2IO2 B;  4FHJ A;  4NAW A;  2JWZ A;  2K8H A;  3VTW A;  4EEW A;  4FJZ A;  2DYB A;  1UBI A;  3T8M A;  2CHW A;  1GUA B;  2LRW A;  2IBI B;  2A4Z A;  3C0R B;  4LJP B;  3VUX A;  1WFY A;  2W9N A;  4M0W B;  4W9D A;  3WAO A;  2CHX A;  4W9J A;  4F1S A;  2Y5B B;  3ZNZ B;  4WWP A;  4AP4 C;  2N9X A;  4GB9 A;  5GMV A;  2ZCC A;  1LQB A;  1UH6 A;  2KKC A;  4WQO B;  3RYT A;  1T0Y A;  3S2A A;  2O2V A;  4K7W A;  4ANW A;  3UIP B;  2L76 A;  1YIW A;  5C1Z A;  2DAF A;  2LAS A;  5IAA C;  2LVO A;  1YX5 B;  1I42 A;  3JYU A;  2UWQ A;  1V5O A;  3JSV A;  1KM7 A;  5DCN A;  5L95 C;  3KUD B;  4BKS A;  1V80 A;  2LZ6 A;  3HIZ A;  4ICU A;  2ZJD A;  3A1Q B;  2V4L A;  2KAN A;  2EKE C;  2ZVO A;  1LM8 B;  2DYO A;  2KWU B;  3EFU A;  2KJ6 A;  1S3S G;  4KDL B;  4IG7 B;  3H1U A;  1HE8 A;  3R7R A;  3A9K B;  4ICV A;  3WA0 A;  4MGZ E;  1Z2M A;  4NJ6 A;  5LXI B;  2AL6 A;  3H6N A;  1WGY A;  2C9W B;  4MGY E;  2LD9 A;  1WGD A;  1TBE A;  3CMM B;  2WDT B;  3KYD D;  2NVU I;  4HJK A;  1ZKH A;  2KDF B;  4DDG D;  3DQV A;  1Y8R C;  4HWI B;  2XBB C;  2MWS B;  4ZRJ A;  1VD2 A;  3UF8 A;  1OTR B;  1ZGU B;  2C5L C;  3RUL A;  5CX3 A;  3L16 A;  2IO3 B;  4RM9 A;  2HE7 A;  4A3P A;  5KHQ A;  2DEN B;  2KTR B;  3VUY A;  4BKS D;  5CHV C;  1P0R A;  4MEL A;  2K39 A;  2KDE B;  2ZNV C;  4TQ1 A;  2XK5 B;  1ISN A;  1UEL A;  1FXT B;  2RR9 A;  3N3K B;  2DAJ A;  2JY6 A;  5AZH A;  3H7P B;  3R66 C;  2ZPY A;  3TIX A;  3ML8 A;  2AL3 A;  3VHT C;  3I3T B;  1JRU A;  4BVU C;  5LLI A;  2M4N A;  4YL8 A;  3NS8 A;  3N30 A;  4IW0 A;  4EUT A;  1WI0 A;  1TGZ B;  2NPT A;  1E8Z A;  2A5U A;  1WGG A;  2J0K A;  2JVC A;  3ZRC A;  4W9L A;  4ZRI A;  4GDK A;  2ZVN A;  4FUL A;  2HTH A;  4GGQ A;  1YQB A;  4IM3 A;  4TUU A;  1WH3 A;  3AU5 A;  4IWQ A;  1YX6 B;  2MW5 A;  4MJS A;  1OEY J;  2D11 A;  4KSK C;  4WJQ A;  2KMA A;  2KQS A;  3SD5 A;  5E6N A;  4HK2 A;  2D2Q A;  2R2Q A;  1L2N A;  4IM2 A;  1V2Y A;  4WWN A;  2G4D B;  1WX9 A;  1G6J A;  3UQB A;  1WRD B;  2JUO A;  3NHE B;  4DXA B;  2D07 B;  2NS5 A;  4A3O A;  2MRP A;  1E5W A;  1RAX A;  4CO7 A;  4EZK A;  4G3X B;  5JH5 C;  1M94 A;  3WAM A;  3JW0 X;  2CS4 A;  2MBB B;  3KH0 A;  4EZL A;  1GJZ A;  2O6V D;  2GOW A;  2IO1 B;  4HDQ A;  5D7G A;  4TQ0 A;  2K8B A;  2CKH B;  3DBR I;  4MEM A;  2KO3 A;  1V9J A;  3GZN I;  4FJV B;  2MX2 A;  2YLM A;  4CYE A;  2WX0 A;  4LDT B;  3PRZ A;  2KC2 A;  2LI5 A;  1WXM A;  3X0W A;  1V49 A;  3B08 A;  2JPH A;  5DPT A;  1WIA A;  3L13 A;  1CMX B;  1E8X A;  1XQQ A;  2K1F A;  3P2B A;  1P3Q U;  3QHT A;  3DBS A;  2N9P C;  2NR2 A;  2MA9 B;  4FN2 A;  4ZRK A;  4DHJ D;  1Q1O A;  4BKT A;  4PS7 A;  1J8C A;  3VDZ A;  2NBW B;  2M0X A;  3ECI A;  1QZE A;  4AOF A;  1J0G A;  3NZS A;  2J0J A;  2MCN B;  4HCP B;  2K25 A;  2FAZ A;  2LGX A;  4ZDV A;  3QJZ A;  4W9F A;  2Z59 B;  3W1S C;  3V6C B;  4JIO U;  4NQL B;  3KYC D;  2FIF A;  2KX0 A;  2ZZP B;  1R4N I;  4K1R B;  5DPW A;  4TV3 A;  1H4R A;  2GBJ A;  3U8Z A;  4NQK E;  2KDB A;  3DVN U;  1V86 A;  4MH0 E;  4ZYN A;  1KLV A;  2MBO A;  3QQ8 B;  1WXS A;  4GDL B;  2JXX A;  3GOE A;  1MG8 A;  2MBQ A;  2FCM A;  4BBN F;  1RRB A;  3ZKJ C;  3U30 A;  5CHF A;  3IVF A;  3QAR A;  4ANU A;  1E7U A;  5J2R A;  1UD7 A;  2KZR A;  4BFR A;  1EO6 A;  2IY0 B;  2V3S A;  3NOB A;  3PRP B;  4B6W A;  1EF1 A;  1BT0 A;  3ZTC A;  1OQY A;  2AWT A;  2MSE D;  2MP2 B;  2BYE A;  4I6P A;  4ANX A;  2M8S A;  3ZDT A;  3KUC B;  4KSL C;  2BKF A;  4WWO A;  4E71 A;  2AEH A;  2M17 A;  4JQW C;  3K9P B;  4PS8 A;  4GOC A;  2IO0 B;  4EZJ A;  2JF5 A;  2K6Q A;  1IYF A;  2XEW A;  1WY8 A;  3ZDM C;  2KMC A;  5IA7 A;  4URK A;  2DYM A;  3ML9 A;  3PSE B;  3WIM A;  4DHZ E;  3KVF B;  3MHS D;  3OJ3 A;  3APF A;  2L7R A;  2KTF A;  2CHZ A;  1GC6 A;  2BWF A;  2PJH A;  5LXH A;  3M63 B;  2BYV E;  1IP9 A;  1F9J A;  2LWP A;  5AZF A;  3CSF A;  2JRI B;  4I6N B;  4FHK A;  3UGB B;  3IBE A;  3ZO5 B;  3A1Q A;  1S1Q B;  5C23 A;  3VTV A;  2L00 B;  2DZM A;  3EHV A;  3RZF A;  3M62 B;  3HHM A;  2KX3 A;  3PLV A;  5JZE B;  3AU4 A;  5D2M B;  3A9K A;  3AXC A;  5AZG A;  2I1J A;  2MQJ A;  3Q3J A;  5L83 A;  3SU8 X;  2GBK A;  5HKH A;  3IFW B;  1V6E A;  1ZW7 A;  2VRR B;  3PS6 A;  1WE7 A;  1E90 A;  1E8Y A;  2JZ3 B;  5G55 A;  4G11 A;  5J18 A;  3O65 B;  2EMT A;  2FCQ A;  2G4S A;  2J0M A;  3OLM D;  3PHX B;  2BYF A;  4BOS C;  1YD8 U;  3PZD A;  1WYW B;  3QA8 A;  2B3A A;  3H7S A;  2BKR B;  4LCD E;  4XC2 A;  5G2N A;  2J7Q B;  2JRH A;  3AUL A;  4DHJ B;  2DHZ A;  3W1S A;  2KTR A;  3Q3F A;  4I6L B;  3RT3 B;  4GXB A;  3OAW A;  2L0T A;  3B0A A;  2XK5 A;  3NY5 A;  2FCS A;  3QC8 B;  4ASW C;  4HVB A;  3PVL A;  4EFO A;  4DBG A;  5D94 A;  4BKG A;  3H7P A;  2KD0 A;  3ZW3 A;  3UQA A;  3CST A;  2KFK B;  3PLU A;  4MDK E;  3R7Q A;  2L3Z A;  2HD5 B;  4DWF A;  2JT4 B;  4MM3 A;  1R4M I;  1WE6 A;  3VXW A;  1TZ1 A;  2V1Y A;  3WAP A;  1Z5S B;  3UIO B;  3PHW B;  3PTF C;  5E6O A;  2HJ8 A;  2PE9 A;  4JGH B;  2ZEQ A;  4KZ0 A;  3DCG A;  5EDS A;  3B1L X;  3K9O B;  4NAW B;  2D10 A;  2RGF A;  4HCN B;  1D3Z A;  1EUV B;  3APC A;  4EOY A;  4GSW A;  5E6P A;  3VQI A;  2L0F A;  2NBV B;  3PPA A;  1TTN A;  1WJ6 A;  2RD0 A;  1U4A A;  5JHB A;  4GMV A;  3ZNH B;  2FUH B;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...