2J4XA

Streptococcus dysgalactiae-derived mitogen (sdm)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
196
Chain Sequence
KDAVLVNSELKNIYMKDVINKTNMKITKKIGTQLIFNKVISSNVSPAQERRFKEEEEVDIYALIKSYSVICKEQYNYVDGGLIKTSDREKLDSTIYMNIFGEQIPLKEQSKYKITFQNKFVTFQEIDVRLRKSLMSDNRIKLYEHNSICKKGYWGIHYKDNTTKFTDLFTHPNYTDNETIDMSKVSHFDVYLNEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Streptococcus Dysgalactiae-Derived Mitogen Reveals a Zinc-Binding Site and Alterations in Tcr Binding.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Signaling protein
molecule keywords MITOGEN
total genus 58
structure length 196
sequence length 210
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2j4xA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j4xA01
1L0YB 1RD9D 1ESFA 3R2TA 1FGBD 1XXGA 1B44D 1LTTD 1PTOC 1HQRD 1CHQD 1EFID 1LTBD 1S5CD 1SBBB 1AN8A 4RHSA 1STEA 2CHBD 1V1OA 4RH6A 3EFXD 1BCPD 1BCPB 1SE3A 1EWCA 4ZYSA 5ELCA 1LT5D 4OHJA 2J4XA 1ET9A 1LT3D 1LTSD 2NTTA 5D3IB 1XTCD 1JQYD 3TSSA 1LTID 1PRTF 2R61A 1LTAD 1D6EC 1GOZA 1AW7A 1EU4A 1FD7D 1SXTA 4UDUC 1MD2D 1TS2A 5ELFA 2AQ1B 1BCPC 1ENFA 1RCVD 2XN9C 1LT6D 1CQVA 3KLSX 1PYWD 5FK9C 1YN4A 1CHPD 2IJ0A 4O1NA 3DWQA 3DWAA 1SE2A 1YN5A 1I4HA 2XRQD 3V05A 1V1PB 1LLRD 1G8ZD 1SE4A 2SEBD 3O13A 1JWUD 1HTLD 2QILA 1T5XD 4C56C 1S5BD 3R8BA 1QILA 3EA6A 3R2IA 3W2DA 5I4DA 2RDHA 1CK1A 4BWGB 1SJED 1KTKA 1TS3A 2NTSA 5D3DA 4L63B 1PZKD 2G9HD 2ICIA 1KLUD 3GP7A 2Z8LA 4RGMA 1PRTD 4RGTA 1JCKB 4L6TB 1JWMD 4RCOA 4DXFA 2O2LD 1I4RA 3SEBA 1TS4A 1F77A 2XNAC 1FNWA 1BCPF 1RF2D 1LTGD 2WV6D 1FNVA 2TSSA 1FNUA 1LTRD 1LO5D 1I4QA 1I4PA 3BVMA 1PZID 1JR0D 1UUPA 3BYTB 1HA5A 3MC0B 3DWPA 1S5DD 4K6LA 4RFBA 5ELBA 1SJHD 4NZLB 1PTOB 1SEBD 2AQ2B 3BZDB 5ELDA 1EEFD 1L0XB 2IPKD 5ELEA 1I4GA 1RDPD 2RDGA 1JWSD 4DXGA 1PTOD 3URYA 1EU3A 1S5ED 1B1ZA 1YN3A 3BVZA 1PTOH 1CT1D 1BXTA 1D5ZC 1TS5A 1DYQA 1V1PA 1EEID 1HXYD 4RHRA 1ET6A 3CHBD 4RGOS 1DJRD 2AQ3B 1PRTC 4TSSA 3MFGA 1LT4D 1I4XA 1PRTB 1D5MC 1PZJD 3BVGA 3BYYB 1M4VA 1PTOF 1S5FD 1UNSA 4Z9CB 1KLGD 2XRSD 3OWEB 4RGNA 1TY2A 2QEJC 5FKAC 1TY0A 1D5XC 5TSSA
chains in the Genus database with same CATH superfamily
4OONA 4AQYQ 3TRZA 3BK2A 4JQWC 5C2TB 2K75A 2OQ0A 4YTPB 4C7YA 2A19A 1A3UA 4B3TL 2Q8IB 1PQSA 2V9HA 4TV3A 3QJZA 4XQNA 2IY1B 4IKGA 1PTOC 4JI2L 5EKKA 2K22A 1S5CD 4DUZL 2BF8B 4HEA1 4ZRIA 4ZRKA 3CC2A 4DDGD 2EJMA 4G11A 1CZGA 3D4DA 3AE5B 5C3EB 3GTGH 1QB5D 3J81L 2OEOA 3S1QH 4HAEA 3VAWA 1VQOA 1BBXC 1PH2A 2QMTA 3DBHI 4OIKA 1XPOA 4DA2A 3H0GH 2VQFL 2EY1A 4YT0B 2M0AA 3Q8EA 5HGQA 1ZXIA 4B3TQ 4POGA 3FKYA 3K5OA 3BDLA 2V1YA 4CDFC 3C3LA 1TIID 2AWNA 3CCSA 4FXDA 1W3SA 1ML0D 4ZQ3A 1OQYA 5JAVA 2AYOB 4WAAA 1UGJA 4YSXB 2FJ2A 5J17A 5EGTA 1U4MA 1XMQL 3HOYG 4ANUA 3RN9C 1JICA 1J7CA 4JVZA 1N5XA 4PV1C 2R7FA 3PREA 2ZXPA 2CJNA 1STNA 2WXOA 1V9JA 3O13A 3KBGA 3S1RH 3L17A 4W9JA 3JAML 1L0VB 4QIWE 1WJ4A 5BYSA 4DV6Q 4JI3Q 3RZDH 2R93B 1HRJA 4XX5A 3FDTA 1WD1A 3Q6SA 5D3DA 4YWKA 2CQOA 3RNBC 5JJLA 4DGZA 4MGKE 2A69C 2YU9H 2LHDA 3P7JA 2JA5B 2JF5A 4L5TA 2KLGA 1HA6A 3B9JA 3PT2B 4ITKA 2NBFA 4LLGM 4DHJD 4FO2A 4A3PA 4W9LA 3WA0A 3U58A 1TS4A 3HP3A 3I73A 3S17H 4ANXA 4LF4L 3GS2A 1WM2A 1FFUA 3H6MA 4LK1C 1E8ZA 2EDGA 1RF2D 3SHLA 4BBSG 2GLSA 2K6QA 1K8OA 2LXAA 3DM1A 4QCLA 1EOTA 3NJTA 1YIWA 2YLMA 2F0DA 2ATWA 4MGZE 3VHTC 5IKCM 1B9MA 3N1YC 3NSWA 4KY5A 3A8KE 3KQ4A 1K3RA 1XMQQ 3KH0A 1RL2A 2F0OA 5IP9H 1TWGB 4HKQA 1IPGA 3W1GA 3U50C 1YNNC 4DNIA 3PV1A 1B53A 3I4MH 2N9XA 3GTOB 3VA7A 2WXGA 3NBHA 1VQAA 2B8GA 2HQLA 1AH9A 1KABA 1GUAB 3R66C 3UDGA 1VQLA 1YQ4B 3H9DA 3ML9A 4TMAB 2ZTCA 4KD4A 3TS0A 2EXDA 1FPYA 2ZZPB 4PMCA 4UHVA 1PTOH 3HOYB 1J0GA 1IZ6A 1OQQA 1D5ZC 4HN7A 3NUCA 4JBJA 2IGGA 2OEDA 3NWSA 2VB3X 2NVTB 2G45B 1ZYRD 3FVQA 1VR9A 1JOQA 3T4AC 3TREA 4A3CG 4LFBL 1BO0A 5HI1A 3RZOB 4DAVA 1A8VA 2KQ3A 3F2CA 2R93G 3DVNU 1E2VA 4IPGA 2CHZA 3QO2A 5D94A 3CQZH 1Z5SB 4ULLA 3CQZB 3RCZA 3G48A 1Q86C 3L9AX 3J80i 3TIXA 5A2QE 3PV0A 4HMIA 1U5KA 2NBVB 1Y1VG 3U52E 4AQYL 1V6EA 2H88B 3P63A 2JA8B 3NP8A 1B9RA 3H7PB 2DYOA 1TKYA 4K8JA 4G0NB 1AN8A 4V0BA 4S0RA 5KGUA 3VDYA 3H8HA 4LF7Q 4I7AA 1JOOA 5LHY1 1PHJA 3QIJA 3VUWA 3CCQA 1C3TA 3OLMD 4E3CA 1N60A 4A93B 2PKOA 2KQ7A 4O2DA 4WJPA 4GKJQ 3OTOQ 5K36H 3E0JA 2LZ6A 2LS01 2WS3B 3ZO5B 1SDFA 2PQEA 1ACCA 2IDYA 3JSVB 5C3EH 3PZ8A 2N9PC 5LMNW 1DOLA 2D2QA 2A6HC 4WORA 1VZ6A 4P74A 1WCMH 4QL5A 1TS2A 1Q7YC 2B39A 1JWBD 2IO2B 3KWLA 4ICVA 1UEAB 2IX0A 4X57B 4WQMA 3T3OA 1EWIA 5FK9C 4NAWA 4QUFA 3S17B 4G7ZC 3HRDD 4O1NA 4A3CH 4PS8A 3A0JA 2KXJA 4HR7B 5C4JB 3ULPA 1KF6B 2QW7A 2L11A 1ZEQX 3EECA 3GZNI 2JJQA 1GAQB 3L08A 2NN6G 5I6WA 4ZRQA 4C56C 4MACA 1BR9A 1EIFA 1MIUA 5J39A 2ALYB 2NZ1D 2BE5D 5KHOA 4I6NB 1YHBA 2PMZB 2NCNA 1GB1A 1MG4A 2OJWA 4OZBA 2QDBA 4F8MA 4LTUA 2G9HD 1PDXA 1TIFA 1WXQA 2K4KA 4ILWA 1STBA 2IYDB 2JK8A 3CRKC 1TXYA 1CZPA 3W1BA 3E9HA 1A15A 4CJ2C 1XMOQ 1LV9A 4RG1A 4JYAQ 3HZXA 2PMVA 4OWTB 3TP5A 3A5ZB 3I91A 1R7SA 2WXQA 2UXCL 1MJEA 3AE1B 2XNAC 1F2MA 1P98A 1DONA 5F2DA 2K03A 3BWUD 4DK0A 3QWNA 1WGKA 4AYBE 3A33B 4DWFA 2NYZD 1FNUA 1LTRD 5IP7G 3MXPA 2D3AA 4NKLA 1NR4A 5GAHC 3BVMA 2RDBC 1WX9A 3NVVA 4IOAA 3B2FA 2L32A 1F9RA 3MHBA 5KNDA 1WY8A 1E90A 4UP9A 3RR5A 1A70A 5JVH3 2LGDA 4KGTA 1NY4A 1H9JA 3SVMA 1L7YA 3LWUA 3VR6A 1DGJA 1QUQB 2KKCA 3DHGC 4JWSC 5HGTA 3NUHB 4K14A 1NYQA 4WJNA 3GV3A 2ZTDA 1UH6A 2HIVA 3HHMA 3FC4A 1IL8A 3EJIA 3WAMA 1B8AA 5M3FB 1YHQA 4MDKE 4KX6B 1FO4A 3G6EA 1FL0A 2C5CA 1XQQA 3SE0A 1NUCA 2NVTH 4YCWA 5GQOA 1TY2A 4BKTA 4BOZB 3ONSA 2NUCA 3VTVA 4C3JG 3TEXA 1WZ3A 3UDIA 3J9CA 4IFDG 2JWUA 4K7UA 3S16B 3TN2A 1XNQQ 2GBMA 2UUCL 2LXCA 1E7UA 1CZWA 2Z6KC 4KN4C 2WAQE 1SBBB 4TVAB 3AU4A 1K28A 1SYGA 1GPXA 1F2ZA 1TWGH 3TMPB 2V1CC 4KGSA 5D6JB 2R3ZA 1TKEA 3W1SA 1IXRA 4AYBB 3NZ3A 4QF4A 1BCPD 1HTPA 3I5JC 3RMHA 1C76A 3AYHB 2WU5B 5ELCA 4CHKA 4CBVA 1F2RC 1JQ4A 1QVGA 1XTCD 2M4NA 1STHA 5FR6A 2KOLA 1KH0A 1ZGUB 1C8CA 2CFMA 1UEBA 4OX9L 1T0QC 1QG7A 1TZOA 1S72A 1C4CA 2K5PA 3M62B 3GTLB 5M5YB 2XBBC 2MBHA 4HPPA 2FCSA 4A3DG 1Y14B 4LF8Q 4N9PA 1VQIA 5IWAQ 5IY0A 1N32Q 1F9PA 4DV2Q 1EWYC 3Q8BA 2DZJA 3IAS1 1L1OB 2A68C 4HPMB 2G1EA 3PHWB 1PGXA 1NCVA 3PVLA 1D7QA 4A3KG 1GHKA 3A9JB 2CVRA 4MN3A 3KDFA 1PH4A 2KMAA 3DWMA 4XDXA 1KOTA 1V1PB 1WTVA 1IGDA 4N9TA 2K05A 2D3CA 2A4ZA 2HTHA 3P42A 4B95A 3S1RB 3F2DA 1ISNA 2Q2UA 3KLWA 2MWSB 4ARCA 3DUZA 5LL6X 3S2AA 1QILA 4GN3B 5JZEB 2O2VB 1F1HA 5IOIA 4JI1Q 1SJED 1T3QA 3FPPA 3HKSA 2DUDA 5EBCA 3K5NA 2NR2A 1VQDA 4HCPB 3AEEB 4P1BC 4P6VF 1WX8A 3K57A 1C4QA 3I2ZA 4K0KQ 1SLJA 3MTNB 2QKIC 4RCOA 5DNFA 2E6XA 1BKBA 4LF5Q 4JI1L 4US8A 4R1JA 2PTLA 3KUZA 3FPUB 2B2VC 2JVCA 5EE9A 3MFYA 2IGDA 2SOBA 2JA7B 3N1ZC 1LTGD 1E6EB 2MBEA 2Q2HA 2ZNVB 4ABNA 4IUVA 5JOBA 1I4QA 2FBWB 1E3PA 4NP5A 1K8GA 1R4NI 3BYTB 4DR1L 3CKIB 3S1QB 2L1BA 4HJ9A 3AE6B 3ETRA 2Y0SB 5CV8A 2F0EA 2L76A 1YQBA 3SD5A 1TWFB 4EUTA 4DR2L 2KDBA 4KK7A 2WXNA 3HVDA 2QIEB 4A3FH 4GOPB 3K80C 2OXPA 2HT1A 2DBYA 2NWGA 2GB1A 2RDGA 3HGBA 4IUQA 4DV5Q 4A3JG 3M4OB 3RUIB 4OX9Q 4EZJA 1WD0A 1JWSD 3D31A 2OCEA 2LEKA 3PO0A 1A3VA 4JLCA 4DF7A 1MHHE 5BR8L 4LJZC 4C2MH 2YU9B 1TU2B 1UF0A 1UE1A 1E22A 1VS0A 2FHTA 3EQLC 5M3MH 3EHVA 3PSEB 2NPTA 2NBUA 1RHPA 3ZXVA 2A6HD 3VR2A 2JA8H 2Z0EB 1KLVA 4DV0L 3RZDB 1YNND 1J7BA 1TZ1A 4GDLB 2Y5BB 1WMHB 3TP6A 4NB3A 1N8RC 3VFKA 1SFOH 1Q90A 4CJ0B 2QJLA 2PIAA 1TT2A 3R2TA 3M4QA 1B44D 5G3LF 4GLVB 1EFID 3RUZA 3K9PB 4EGVA 2QC8A 2RCNA 1DOYA 1Z47A 4OVZA 4FULA 1UELA 1R4MB 3NPPA 3PO2H 2UXBL 5JEAG 4LWCA 2ASBA 1ZE3D 3NWTA 1IW7C 3TZDA 3AN1A 1X3QA 1HNWQ 1QVFA 3V61A 2CKHB 1SMYC 3MXUA 1IUEA 2CU3A 2WXHA 1NENB 2QA4A 4P73A 3A55A 4JI7L 4LNNA 5EQ0A 2BVCA 2MEKA 3EROA 2RBMA 1FEHA 3H0GB 2FUG1 2Q5WD 1QOGA 4DR3L 4LCDE 4N58A 4BZAA 5FLXL 4HTHA 5IGEA 4JI6L 3Q6BA 1FGUA 3VRAB 2WDQB 4B3ML 2L55A 1VZ7A 5CV7A 2QCZA 1CQVA 3QOLA 4KMUC 1QZGA 1PYWD 3S15H 1TYGB 2F4VQ 4I7ZC 5M5YH 3GTLH 1VQGA 5DCNA 1A6XA 1G51A 2QDLA 1YN5A 3Q0AA 3SHQA 2IW3A 4HIKA 4IM0A 4N6EB 5HG2A 4LFBQ 4H0LC 3HOZG 1JMLA 3IAM1 4HJGE 1Q1OA 2K50A 3NBIA 3CCRA 4XYOA 2D5DA 2JEBI 3GTPB 1Z6HA 5BYRA 3NHEB 2RDHA 3QG1A 3B0AA 3ZYYX 1KTKA 2B8FA 3NQIA 3GP7A 4JYAL 2R2QA 3DBRI 1U4RA 3K7UC 4K3BA 1GC6A 4FF2A 2KDMA 1NTGA 1WRIA 4WIPA 1SR3A 4DK6C 3SR1A 1D8LA 1QCBD 1MSGA 4IW0A 4WQOB 3U8ZA 4JI8L 3OHXC 2O6VA 1BMLC 1GD7A 4ZLTF 1UZXB 1N9WA 4RAUC 2D11A 4YTNB 2WFWA 4K2KA 3A8JE 3UI3A 2JT4B 4S3SA 2VW9A 2ASQA 3BINA 3PTFC 4X3KA 1IGCA 2JZPA 4Q2JA 3MC0B 3M3JA 4W9DA 1S5DD 3FKIH 1GC7A 2VS1A 5FO8B 4GLXA 1YX5B 3W1YA 4WFN3 2WP9B 1LM0A 4EX5A 1EYAA 4DFAA 1CQFA 1VQHA 4L8JA 4LFAL 2GI9A 2EKEC 4A3EB 1W2BA 4BBNF 5KNCA 1S4ZA 4RMFA 3MP9A 4U673 1E0BA 4EOYA 1HNZQ 4X65L 2JZZA 1EY5A 4K2LA 1IKLA 3U9SA 2Z6KA 5CHWA 3PUYA 2JA7H 3P1MA 4NJCA 2H4OA 3LX0A 3KJOA 2INDC 5JPMC 3CW2C 5KYIA 3E3XA 5KYLA 1PV4A 4C3HG 2XIWA 3F2UA 1VQKA 1D5XC 1PFMA 1MGSA 4EZLA 3MA2B 1IW7D 4PQXA 3HOXB 1AFPA 1NDDA 4XDCA 5JH5C 2ZTEA 2R7DA 2VY3A 4MM3B 4A3EG 2EYJA 4GN1A 1V43A 5IN7A 1HHVA 2D07B 2JUOA 1TQOA 2DZIA 2F52A 2E75C 3A7LA 1U4PA 3NG0A 2HD3A 2Z4IA 4JBMA 3E5SA 2JRIB 2B2WA 4NNJB 4ZYSA 3QK0A 1V1QA 2KN5A 1YZ6A 1JT8A 5BO4B 1G2TA 1QNKA 1KXLA 1WGRA 1LTID 3PQIA 1ZKHA 2KJHB 4IPCA 3HOUG 1TJEA 1HNXQ 1E8WA 2LUMA 4AIMA 2O4XA 3TEWA 3M3YH 2UXDL 1GUWA 1Y1WG 1AW7A 3D0FA 4C2MB 1MD2D 4HLEA 3B2GA 1KDBA 3H15A 3K9OB 1I50H 5JHAA 1U9RA 1WJUA 1N5WA 4NDXA 3NTKA 2D10A 3FKIB 1WZ0A 1KAWA 5JJIA 4BY1G 1KQSA 3KFUA 1K53A 1P3QU 3H1UA 1DOKA 1WYDA 3EBEA 2XTIA 2F0WA 2MGSA 1V86A 2WYQA 2Y3AA 3UE1A 1WTPA 1YJNA 1BUVT 3G71A 1SFOB 2UU9L 3O65B 3E56A 4LF9Q 1PFBA 2EJGC 4I6LB 4X65Q 1V2YA 2AEHA 3QARA 2KTFA 4IQZA 1MVKA 3DEOA 4PT5A 3P4SB 4EQPA 4IALA 2JA6H 5L83A 1VCIA 4J8QA 4NQKE 3TMEA 2JRHA 1XTDA 1QJOA 4DR6Q 3ZIMA 3S14H 2BKRB 3GZNB 4RKBA 4L6TB 1S40A 4CKEA 2KNBA 3FEWX 3MEFA 2ACZB 3BDOA 4JV5Q 3Q3OC 4MEMA 1YJ9A 2KANA 1VMPA 1Y8OB 3GOEA 1WTRA 4A3MG 2H1EA 2R7ZB 1Q5WB 2LFIA 2B63B 3EGRA 3IKJA 1GM5A 1WM3A 1V5TA 2D2CC 2JYOA 3CC7A 2CWAA 2UWQA 4FXCA 2HTME 4I6PA 1WR1A 3RZOH 3JSVA 4KKSA 4B0MA 4MNOA 1EZ8A 4Q5VA 2E8GA 2BH8A 2KFJA 2BA1A 2PNHA 5AZGA 4QB4A 2QCPX 2X38A 5T1IA 1L5PA 4LUVA 4MHEA 1SSNA 3TEZA 2N9KA 1FRDA 1CFMA 1WOCA 4W9EA 2UXDQ 4UY8C 2C9OA 2VQEQ 4B9WA 2LFNA 2KN4A 3GV6A 3A9KA 5LXHA 3WCQA 2AWOA 4C7ZA 1CT1D 1K0RA 3MEHA 2RPVA 5L95C 2MNAA 1EEID 4GGQA 4JX1C 4DK5A 1ET6A 2CCZA 2L9HA 2AQ3B 4UPAA 2BS4B 3ND8A 4KZ0A 2Z59B 2IHEA 2NVQB 2V4LA 4RCNA 1UNSA 3CMEA 2PW5A 2F4VL 1TVXA 2Y0SG 3QHTA 2K1FA 4QQBX 1GB4A 5DAUA 1ICWA 1UE7A 1H8CA 3ALBA 2AMCB 3VQIA 3GTMH 1P7EA 2N4FA 4F1SA 4GLAC 4LUOA 1F0ZA 2UUAL 2MSED 4MSMB 1B70B 3WIMA 1XXGA 1YHAA 1LTTD 4IUPA 3CD6A 1RIPA 4BXXH 2K6DB 4YL8A 1GUOA 3HOYH 3DWGC 3H7SA 3OW7A 3VR5A 4A3LG 4XWTA 3VH3B 5CV4A 1ZDVA 3T1YL 1F2RI 4QJFA 1C4AA 3PZDA 2KEEA 3WOFA 1BT0A 3K58A 2DGYA 1XNRQ 3WALA 5JXVA 3E0EA 1ET9A 5DPWA 3PO3G 4OL7A 1RJTA 1HNZL 2NTTA 4BA1I 1JQYD 2K1BA 2SNMA 1WIAA 5AUKA 4E71A 2K8HA 4HEDA 3TUOA 1UAPA 3SFEB 2J7QB 2WXIA 1GOZA 5T8IA 1EU4A 1MFWA 1RLFA 5IT9L 4US9A 1GJZA 2HHHQ 5GADC 4KY7A 3Q22A 1ENFA 4K8IA 4M8MA 1PH7A 1L0WA 4DR5L 3NBHB 3KLSX 1G6PA 3VYUA 3ZNGC 3D6CA 1YN4A 2WB1B 4RKLA 2LASA 2HUGA 3PLVA 4RM8A 1X3GA 4DV4Q 3L7ZC 5C5LA 3A7AB 5M5XH 1A63A 3KBXA 2JX5A 1ZXHA 3CF6E 1N36L 4C3IH 5HY6A 1ZKOA 2LXJA 4R4OA 1MKHA 1S5BD 4FJVB 4CKCA 2XEWA 3GTJH 4YCUA 3MXNA 3ZW3A 3SK6A 2I5LX 3LGJA 4JI5L 1QF6A 2EY2A 2EELA 2K5HA 3ECIA 4L63B 3J7YW 3HOWG 3IG3A 5AUIA 3HK0A 1D1KA 2A73B 3W5OA 1K8RB 3N3KB 4A3LH 4N59A 4AH6A 1PUTA 1G91A 3CCUA 2MO0A 4TRDA 4GXBA 2KTRB 3Q3NC 4DXFA 3I56A 3DVGY 2A68D 1FVIA 3PO2B 1B50A 4M02A 4PMWA 2ZPYA 1XLPA 1XPUA 4DR1Q 4JL9A 3NZSA 5IE8A 4MIUA 3OYYA 2MW5A 4KZCA 4JPSA 3AM9A 4GDLA 2EVBA 3J80c 3TCAA 3GTOH 2Y0SE 4XQJA 2WU2B 3GTKH 2L4NA 2RKSA 3CAMA 4GSWA 2RQXA 4CDCC 5C0XH 2ZM6Q 1AYFA 3HRZC 4BA2I 1B1ZA 2CR5A 3Q14C 1W6JA 4G57A 1Q81C 1YNXA 2WXPA 1V1PA 2BDOA 1EY9A 4KHPQ 5GAEC 3Q3JA 4JI0L 3I4NB 3HVZA 1HNWL 1T0RC 4TSSA 2D3BA 1FCLA 4OEMB 3KF6A 2FMMA 4JI4L 3D4RA 5EE1A 3BVGA 2KHSA 4WH4A 4ZDVA 3PSIA 2MCNB 1U0LA 1LFDA 2CWPA 1BUIC 4F7XA 5EPKA 2V3PA 4M01A 2L52A 1F2LA 1ESFA 1O7LA 1FCCC 2KAJA 3FAHA 3HOVH 1EQRA 4ZK9B 1VMCA 2K39A 2BCOA 4RH6A 1MI2A 2B2YC 1SE3A 2BS3B 3DHHC 3MWYW 4YY3Q 2JN4A 2BBCA 3GE3C 1H9SB 1LT5D 3R93A 4YHHQ 5BR8Q 5DM73 1WFYA 4PG3A 2LJIA 3QWZB 2XWBB 3W3AA 2E2HB 2F0LA 1T5EA 3L54A 1QNUA 4JBWA 1LTAD 4GKKL 4ZRPA 3SU8X 1C1YB 4B9XA 3NELA 4EE2A 4DXAB 4IUNA 4JIOU 1EY7A 5J3BA 1OEYJ 1RYJA 4AP4C 1VF7A 1T0YA 3R7QA 3P4QB 1ROEA 4KD3A 1HE8A 3AMZA 1K83H 4YCVA 5JPNC 1KL9A 3K59A 1VLBA 1CHPD 2KHIA 5AZFA 2MP1A 2KECA 1SE2A 3NXWA 4M8AA 1KRSA 1VD2A 2CJOA 4OVUA 1KHIA 4LF6Q 2AKWB 2SDFA 1HCZA 4EZKA 4HSPA 4V190 4GZYC 1IBMQ 1JWUD 5CX3A 4KTAA 2WXMA 4KJNA 4KHPL 5C6AA 2WP8J 1KC8C 2FINB 4HIDA 1LQBA 3R2IA 2ZJRA 2C9WB 3ZRCA 3E9SA 4A3GG 2M8SA 5M3MG 4BKGA 4DHZB 3IBEA 1PZKD 1F2YA 4BBNC 3ULJA 4ZAIA 4K0KL 1JJCB 1EF5A 3OMCA 2FCQA 4XWWA 2JA8G 3MHZA 3Q23A 3B1LX 2I1KA 4ME5A 3F8TA 2M00A 2JQRB 3IT6B 4LFCL 5BN4A 1E24A 2EYMA 4OGQC 4NAWB 3RNAC 3STBD 3V96A 3CCMA 1WSPA 2LRUA 1EO6A 3PGZA 4HXDA 4HROA 1TWCH 5EKIA 3KF8B 4B0EA 2I07B 4XIGS 3EFCA 2KVRA 3T53B 4XDDA 3QOJA 2E76C 2YTYA 4GN5A 5FO7B 1JMCA 1WX7A 4II2B 2J53A 2QSDA 4XGAB 1D2BA 4ZHOA 3ICEA 2AWTA 2HCIA 5CBAE 5GXGB 4L5SA 4A8XC 2JPHA 1HUMA 4G50A 1SYDA 3N32A 1QWYA 2LVQA 4A3DB 4MM3A 4K7WA 1RDPD 2L0CA 3U4ZA 3LNNA 1LM8B 1A2TA 5M3FH 4DUYL 2KVMA 2M19A 1K3BC 2WB1G 4I65A 3BZKA 3BVZA 4A3KH 1FXIA 2LGXA 3ZNID 4PMBA 3AEBB 1L1OA 1HXYD 3CCLA 2BGFA 1AE3A 1UBIA 4A93H 2N7EA 3VH4B 3HKZB 3MFGA 4PYUA 2CHXA 1PTOF 1K83B 1VRAB 5JHBA 1YNTE 3WOEA 1IYVA 4BVUC 3I9V1 2MJDA 1TY0A 3ZJUA 4ZKCB 1XLOA 4K81A 1VQ6A 2O2VA 1DOXA 3M4YA 2F3WA 3VR9B 4WJ4A 5C4HA 2E2HH 2MJ8A 4NW2A 2JZ3B 1QOBA 2DAJA 1X55A 4LAAA 1JC7A 3W1SC 4Y7NB 4HCSA 5CORA 1YBYA 5C44G 1GHJA 3I72A 4B3RL 2JA7G 5FR3A 2CHBD 2XSCA 4C4VB 3OTOL 1NEKB 4JI4Q 2WNMA 3EFXD 1KDCA 1V80A 3FP9A 3BU2A 4XT1B 5GAGC 3OW2A 4EQOA 2BYTA 2PMZE 4UP7A 4FLHA 4JI0Q 2IL8A 2F0FA 4KSKC 3RMKC 2J4XA 1Q8KA 3ZTDA 2ICEC 1LTSD 2PVGC 4L2YA 3AECB 2IO3B 3U7ZA 1KRHA 4K5XA 2GBNA 2IO1B 3UF8A 1FJGQ 1J5EL 5BN3A 2A74C 1XF5L 2AQ1B 3GTQB 2WXFA 1RCVD 1K73C 3CU7A 1I6HH 2HQEA 3Q8FA 1CKMA 1BVSA 4F88A 2J7ZA 3J81j 4NY0A 3N9YC 4J1MA 2PZWA 1A2UA 1MJCA 1TWAB 4ZUIA 1K8MA 2XK5A 2R92G 3WANA 5E6PA 1Q46A 1WI5A 5JVG3 3M95A 1XCQL 2VH1A 3ULLA 1I3QH 1VQFA 4JPBW 4LMQD 1B9NA 1SIFA 4KKIA 3X3MA 3X23A 5IYDH 1RRBA 3OPOA 1YVCA 2BB6A 3CSFA 1KIXA 1D1IA 1CKOA 5I4DA 1L2NA 3CC4A 3OMGA 1JWAD 3IFWB 3GTKB 2JP1A 3DHIC 3P20A 4DAMA 2EXZA 2PW7A 2IWHA 4LNFA 5IO9A 3IAYA 4FP5D 4RGMA 3PGEA 2MFIA 4ZRJA 4A3JH 2W3RA 2EY5A 3P4PB 3PCOB 5IIFA 1F9QA 4G3XB 4ACFA 4K1RB 1K0SA 2HJ8A 2BYEA 3S2HB 4A3GH 2HDEA 2NVYB 4R8NA 4A93G 3DBRB 1JB7A 1FNVA 4NJ7A 4WURA 1OEYA 3AE4B 4NQLB 1EQTA 5CBEE 2ONQA 4IDIA 3ZJYC 5C0XI 2KWUB 1QE6A 3SR6A 4FJZA 4DV4L 2K04A 4PYZA 2A5HA 4OO1G 3VUXA 1OFFA 4LJPB 4CGYB 1F9SA 2XWJB 3JAMc 4LF4Q 2MO1A 2R2OA 2SAKA 1SJHD 4AQ7A 4DR5Q 1CTMA 4KV6A 4DKAC 4S17A 2KX3A 3SFDB 4XT3B 5HURA 1C0AA 3I3TB 2M2LA 4F8CB 1VQ5A 3BY4B 1LTLA 2CH4W 5C3XA 1F52A 5D65A 1Q12A 2DENB 3AE3B 3NY5A 1B3AA 3EIVA 4ZOHC 2Z9HA 4KV2A 3VDZA 4HCNB 2NVXH 1GNUA 3HOZB 5G5HA 2K28A 2K5WA 4XYQA 3BYYB 2LWPA 2KC1A 4W9HA 5IGCA 2K5VA 3J7A5 5IYCH 4EQNA 1SN8A 2OTLA 3DPDA 4DU9A 2BDNA 2QEJC 5FKAC 3J7ZC 5I2XA 2N9LA 4IC7B 4KN7C 4KKUA 2Q8RE 4BS9A 2FAZA 2LRWA 3PLUA 3Q2AC 4AJWA 3L4PA 2UUAQ 2DX5B 5G2NA 3N20C 1XT9B 2KA7A 3D3RA 3IRBA 1SE9A 1ESRA 2V0GA 4KGRA 3PO3H 1LTBD 1TWAH 3S1NH 2ZCCA 2J0TD 1R4QB 4B3SL 2KWCA 2WDTB 1I6HB 1YOVB 2B76B 2F0MA 4GNXB 3AEVA 3U30A 5IA7A 1GUNA 1GVPA 5IODA 1EYDA 2O5JC 2V4IB 3R7RA 3KK7A 3MZ5A 2I0QA 1PH3A 2FE8A 4P7IA 3G7LA 1AARA 3V62A 5IOCA 2ZJDA 2L0FA 3DMUA 3PUWA 4DUZQ 2JA6B 2Q2TA 3KYCD 3H3VC 2DNEA 2BQQA 2RMMA 5FLXE 4GOCA 3IXSA 4TKNA 3RD4A 2BWFA 3WAPA 3ZRFA 4Y7NH 3I4NH 2W55A 3S24A 3APCA 3W5UB 2ZT9C 2KCCA 3DXJC 2MQJA 4FADA 2ZXRA 1I4HA 4XXEA 1RFKA 1Q82C 2G3QB 2LKVA 1HZBA 1O78A 3KUPA 4DAYA 2W9NA 1OO9B 1P16A 1PGAA 1HZ5A 3KVFB 1L6UA 2E2DC 3RPFC 4A3FG 1MI0A 3GTJB 1JALA 4ICUA 5BMGA 3GB1A 3ND9A 4MTNA 1K51A 2YEPF 3QAQA 3ZXRA 1SNQA 3DEPA 2ZCBA 2EYOA 4BBSH 4YTMB 3OJ3A 4GS3A 4GN4B 2KUMA 1JWMD 1Y1VH 3KWVA 1J19A 3DCGA 3VRBB 4YSZB 1WJ6A 2Z0DB 1FM0D 1BCPF 1HFGA 1S3OA 2GVAA 1EF1A 3EN2A 2FXQA 2ZVNA 4CYEA 3CMAA 4A3DH 2KMMA 3A4SC 2UU9Q 1J8IA 4X64Q 2B2VA 4HDOA 2KENA 1PZID 4A3BG 2N9EB 2E3TA 2PQAB 3CSTA 3TEYA 4CQNA 4FF1A 4ID6A 1CI3M 4K6DA 3ZVVA 2BH2A 5KEEA 4KKJA 1X6OA 3AB9A 3C1FA 3K8AA 5AFWA 4C3HH 4DBGA 3DVNV 1SNCA 1RAXA 1PTOB 2EIFA 5E7NA 2KK8A 2D0OA 2F03A 2GBKA 5TR5A 1WGGA 1R4NB 3KUDB 3ZTCA 3CCEA 5A2QL 4A3EH 1HNXL 1EU3A 1S5ED 1E2WA 4QMGA 3NZUA 2CW0D 4YXDB 3TBLD 1DYQA 3U9OA 1TBEA 2O6VB 4RHRA 4BOSC 4UP8A 3MTSA 4B9KA 4RM9A 3QJYA 1VQMA 1HTQA 1YD8U 2BYFA 2F0SA 1S3SG 3AEDB 2GMIC 2EE1A 2PE9A 3V2TA 3OG5A 1ILQA 4ZRZA 1E1TA 3BZCA 4RGNA 2JA6G 3PMFA 2L8JA 3LYYA 2Y5CA 4JI2Q 3VXWA 5K5PA 3AQQA 1GXDC 1V49A 2JYEA 2MX2A 4ASWC 4B3MQ 1N33Q 4H2AA 4MTKA 1ZXTA 5CMDA 3H3VH 3V60A 2L00B 2KTRA 4IOCA 1TWHB 4JI6Q 3U4VA 3CP0A 3PF4A 3L13A 2IHFA 2KJ6A 4DR3Q 5E6OA 1CHQD 2B3GA 2D0PA 2PZTA 1C77A 1BDOA 4A3MH 3ZQ4A 3NS8A 1I7HA 1TWCB 4LNOA 1WFQA 3T1HL 2PEAA 3AE2B 5J18A 4OZAA 3BS1A 2B63G 2LVOA 3RLFA 4HJ7A 2NS5A 1C78A 1EOVA 2KEDA 4OVVA 3EFUA 4YWGG 4AS1A 3RZWC 1AZPA 2I1JA 1PLFA 2BTEA 5IP9G 1SMYD 1FR3A 2QF7A 1V5OA 3RNEC 1Y56A 2AHOB 1KDAA 3UQBA 4CO7A 2HCCA 1SXTA 1PA6A 1PH9A 5AJ3L 1XCTL 1X65A 3JYUA 4M0WA 2ZNVC 4N9F4 4HPLB 3ZJTA 1LT6D 1HZ6A 1L4DB 2FCNA 3HM6X 3EC8A 4FA6A 3M7NA 1UGMA 1XEEA 1AE2A 5DEHA 2J0JA 4M1UB 3P4RB 4IPDA 1FMAD 1NVID 1YJIA 1A5RA 2V3SA 4IG7B 3JW0X 1NBWA 1KNAA 4IO9A 3AU7A 3LWEA 3KOJA 1OXTA 3S2DH 3IVFA 4J6HA 4NMZA 1WTWA 1H95A 4JI8Q 2DNFA 4GMVA 2VZKD 1RM6C 2D5GA 3PIP3 1SIJA 1TS3A 3FHWA 3BJUA 3V3XA 1OGWA 3LXFA 4A55A 3A74A 2O5IC 5IGBA 5M5WH 1NI3A 4RGTA 2X8XX 1PDQA 3SDZA 3AB5A 2PZUA 3I90A 4IN3A 2E74C 4DR2Q 3NS1A 1I5FA 2DYBA 1KFYB 1F77A 4A3IH 1FNWA 1MG8A 2R7ZH 1LGRA 3C8YA 1PMRA 3Q24A 2OTJA 3A5UA 3DBLB 1WTHA 3FMCA 5H92C 4ZHPA 4TKOB 2HJ1A 4XTCS 1B4OA 2IZVB 4JWUC 4B6WA 4JOIA 5T1GA 2N8NA 5BMIA 3MHSD 3DBSA 4FF3A 1J7AA 1TKWB 3J81E 1X3EA 2IY0B 4ARIA 1JORA 4R4TA 2PW9A 4LF5L 1IP9A 3GQBA 1YI2A 3PF5A 2CQAA 5C0XJ 2L05A 2R93H 5IP7H 3ZDMC 3HOXG 2AQ2B 4FBJB 4A3BH 4X62Q 3J7AF 4P72A 2AL3A 1J5EQ 1N6ZA 2LMCB 2Q8TA 2D3GA 1J8CA 1YN3A 5CGKA 1PFDA 5CC4A 2R6GA 4R8IA 2BWES 1BXTA 3KYDD 1IBXA 4ANWA 3C19A 4DV1Q 2WDVB 1E9MA 5I9OA 2JY6A 2KQ4X 4C1NI 4KI0A 2L7RA 1GUGA 3A56A 3CIRB 4OZCA 1LT4D 1I4XA 2WINB 5J22A 1ASZA 1I3QB 3S15B 1FXAA 4A3FB 2PI2E 1SF0A 2BOSA 5FO9B 1KLGD 5I2YA 2C7NB 2V3NA 2QEXA 1VQBA 3S2DB 1N32L 4X6AH 4RF1A 3MXNB 2CU1A 1SNMA 1SB3C 1DOMA 4RNAA 1J6QA 2KCMA 1RD9D 3NVYA 4GOPC 3RT3B 3VYSA 2RF4A 4GKKQ 2EPBA 2VNUD 4XQQA 3AH7A 1VF5C 2KHJA 4IUUA 5IT9c 1SGHA 4KLKA 3CRLC 4L1BA 1WGDA 4C3JH 3QIAA 1GO3E 5KHQA 4PZ7A 2B2TC 4K7SA 2MRPA 4R4QA 2OQKA 4UAIA 1L1OC 3HOXH 2L3ZA 2YVCA 1CKNA 3TSSA 2RA4A 2AUKA 2N55A 4YWLA 2K5QA 2R61A 1TT5B 2WXJA 2MP2B 2RPQA 1JROA 4IUTA 4DV5L 4DDID 3GE8C 4HJAA 4QGUA 3ZDTA 5LNK1 3FILA 3H91A 5C0XG 5C4XB 2K0PA 4HWIB 2WKCA 1Y8RC 1O80A 3UQAA 3PO2G 1KM7A 4DAPA 2KDEB 1YNJC 2BS2B 4A3MB 2ZJPA 2R7ZG 1GUSA 2JXTA 2L83A 1ENAA 4PS3A 3I4NG 4LNKA 3STBC 3P1HA 1HR0L 1XLNA 1SNPA 5M5XB 4MZ9A 3I4MB 2PLPA 5M3FG 2KC2A 4LDTB 1I35A 5C5MA 3HFZB 1EUVB 3PUZA 1T5XD 4DV1L 3R8BA 3S1NB 3PS6A 2REXA 4H7BA 1KRTA 3QA8A 1VQEA 4P75A 1OTCA 1DM0B 2KWVB 4WWOA 5G5GA 2VB2X 4R4CA 1RWSA 4NXML 1JB3A 3I3CA 4CDEC 2F0HA 1TR5A 3PRZA 1JCKB 4KJOA 4DPGA 1KD1C 2R92H 4C1NK 4JBKA 3HEJA 4AOFA 1VQCA 3HOVG 4HSVA 1Y8NB 2M9VA 1WRDB 5EE0A 1NMGA 4TQUS 4G7HC 1STYA 2NBWB 5JEAJ 3K7AH 5C44B 1PH1A 1S1QB 3TBIB 1IBML 1Q1BA 3E9IA 4H13C 2DZKA 2ENBA 3S16H 1UUPA 2Z4HA 1DCZA 2YTXA 2J0KA 3NK9A 1PXUA 2OT2A 1XMOL 5IT9E 3I7FA 3C2PA 1IBLL 2C7HA 5ELDA 2FNJB 1Q3LA 2GOWA 1L0XB 3B08A 3N1XC 2XVSA 1VDVA 1U4AA 2NN6I 3Q3FA 4M00A 3H09A 4WJ3M 2BKFA 1IYFA 4FHJA 1C9OA 1NJIC 3CF5A 1WGYA 4DNRB 1V81A 1I94L 3AU5A 2JSVX 2WLBA 2WX0A 4AUQC 3M9BA 3SK4A 4RGOS 1VQ8A 4BBSB 1KJTA 3OSOA 1WCMG 5EE3A 1PZJD 1D5MC 2DY7A 4BBRB 2VUMH 2OHFA 4GIVA 4N8X1 2EKIA 4ZYNA 4GDKB 1X54A 5GROA 2N78A 1EY0A 2IY5B 4KHVA 3U7DA 2JWZA 4ZCKA 4IFDJ 5IAAC 5M3MB 1XNQL 1L0YB 1JW9D 3A4RA 4KIKA 5AJ3Q 2WB1E 4A3OA 4JG2A 3F2BA 1D4BA 1TWHH 2DAFA 1OQRA 3SK8A 1HQRD 2BB5A 2GBJA 2B2UC 1KNEA 1VQJA 4JCVE 4OWWB 2N1VA 3DQVA 4A3KB 3RI7C 4DAYB 3UGBB 2MHJA 5IYCG 3BK1A 4DNTB 1EYGA 3HOWH 1M94A 2DZMA 3CCJA 1K52A 4FF4A 2OF1A 3VVWB 4R3DA 3WWVA 4LF7L 2HD5B 3KF6B 3PUXA 2F0VA 3TP8A 4A76A 2KVZA 3HKZE 5CV9A 5GMVA 4E74A 1OXVA 3SK5A 4A3GB 4R9WA 3KUCB 3S1MB 2LY7A 1D6EC 2ZM6L 1YJJA 4KY6A 1QT9A 3GO5A 4WWPA 4A90A 5KRUA 1UWVA 1BCPC 4A3JB 5EKLA 4BY7H 2BPSA 3MVVA 5J1ZA 1VCBA 3NHHA 3DWAA 2INPE 2KJXA 3L3OC 1WTOA 1YX6B 2JXXA 5A35A 1RKNA 3L2PA 5M9OA 2KX0A 1H9MA 4GLSC 2N49A 3NTHA 4B08A 5IGDA 3MC8A 3M4OH 2QILA 4OELB 5EPLA 4C3IG 2KOXA 3RULA 2Z1CA 3AE9B 1H9SA 2F3VA 5EBDA 3W2DA 2B3AA 4RF0A 4RMAA 1NAPA 1PFSA 1YITA 4BWGB 2UXCQ 5C1ZA 2WXRA 5IGFA 1UWMA 1KLUD 3ZGZA 2JEAI 2NVXB 2WKDA 2AX5A 2KT7A 1PRTD 4AJYB 4Y52H 1EYCA 1X3PA 1Y1VB 2BA0A 3E6ZX 4ALPA 3FRPB 4JI5Q 1CMXB 1VZ8A 4EEWA 4JW0A 1EY8A 2I5HA 2L1AA 2WX1A 1EFWA 2FIFA 2C5LC 4AYBG 1FYCA 2WV6D 4FYDA 1JRPA 3ZKJC 2TSSA 1K8AC 1CM9A 3QQ8B 4C4VA 5C4XH 3AEGB 4X64L 2LI5A 2A69D 1J9OA 5IP4D 1LYLA 4U68A 2JA9A 1DGSA 5AEKB 2YV5A 4BAXA 1V9PA 3T9LA 3L0OA 4ZKBB 3LDZE 3H0GG 4K5VA 4IUMB 3L10B 2VZAA 3BZDB 5IGGA 2CS4A 2I38A 3DHQA 5ELEA 2NVYH 4DR6L 2MPMA 4W9FA 2F0PA 3FKIG 3G4SA 3D6WA 3HOVB 2B2WC 2G4SA 4JI3L 1TS5A 1WXAA 1SRUA 2CW0C 2DWQA 3NTIA 4LF9L 2KZRA 2RSUA 3X0WA 1DJRD 2LVPA 3ZNZB 1QOAA 3IFTA 2RHQB 2WWZA 3VR3A 3A1QB 5E6NA 3KF8A 1S5FD 3KLSA 1X9NA 2OJRA 4HIOA 3CCVA 3T16A 3OWEB 1E0ZA 3KYHC 4ME3A 1YMHE 1UBQA 2NB0A 2DY8A 5BN5A 3HOWB 1ZDXA 4M0WB 4FDBA 1BNZA 1EWHA 1SE8A 2KBNA 2E2IH 2G4DB 2N0SB 1YJ1A 1N33L 2A1AA 3NQTA 4BY7G 1PGBA 2JA5G 1BBWA 1OXUA 3VTWA 1FGBD 3T3NA 3VYRA 3H3VI 1E8XA 2KLCA 2M1MA 4IWOA 5I6YA 2H5XA 3PRMB 1VDZA 1SNDA 4BFRA 5LXIB 3W5VB 2C35B 1MHWC 2HIXA 5CHVC 1EIGA 3OJ4B 2VZKB 3BG3A 5FLMH 3HOUH 1HUNA 5ELOA 1QZHA 2KDFB 1JJ2A 2PQAA 1UD7A 2JU6X 2E2JH 4A3BB 4YIJA 2PI2A 2PYKA 2INCC 4HDQA 3CPFA 2EQSA 4OHJA 1C7YA 1LT3D 5IYBG 1H9RA 4B3SQ 3HOZH 3RLOA 3KW5B 3PPAA 1VQ4A 4D2KA 2LGIA 4G4KA 2K5DA 2YTVA 1HJPA 3TJPA 2MHVA 4W9CA 5ELNA 4URKA 4UDUC 2K14A 2X6LA 1PH8A 4F7ZA 4MELA 4CJ1B 1FXTB 2KCNA 2FMCA 1TGZB 1NMFA 5ISRA 3DOWA 1EQQA 2M56B 3J81i 4REZA 4H02A 1HTOA 3VA5A 2C7MB 2ZPNA 2RSNA 2LUEA 3RLNA 3ABVB 4P16A 4GNXC 5LLIA 2FCMA 2XRQD 3L16A 5CYUA 1I42A 1RTNA 1G8ZD 1SE4A 4X66Q 1NI2A 3H6NA 1LACA 4TUUA 2KHWB 2A8VA 2WACA 1HFNA 2K3UA 1FRRA 1XPRA 2JQOA 3DLLA 3CMMB 4MH8A 2WXLA 2MBQA 1SMXA 3IFDA 2ZVOA 1T0SC 1PVOA 1SYEA 2B29A 2ICIA 1II3A 1VQ7A 1R4PB 2EYPA 4LFAQ 3PIO3 3ERQA 2M17A 3C0RB 2JYTA 4IZ8A 2MJ3A 5FLMG 3H7PA 2EYHA 1A0IA 1WTXA 2KD0A 1OXSC 1ZUD2 2EMTA 3RZFA 3SEBA 1WJNA 2RVLA 3GTGB 2IO0B 4CDDC 4OXPA 4DV6L 2F0UA 4LNIA 2XK5B 3I70A 1N61A 3CXCA 4X66L 4IM2A 1I4PA 4N8FA 4HJ5A 2J52A 2NN6H 1Q1EA 2QGQA 2HE7A 4NAMA 3Q69A 3KJPA 4BKSA 3S9WA 3DWPA 2B63H 1WR6E 5FJ8H 3ZLZA 2JSOA 2RSOA 3C1EA 2A5UA 4DK1A 3GTQH 4IPHA 5LMUL 1GG3A 3GDEA 3SDLC 2D9UA 4APVA 2KJRA 1Q0WB 1R9TB 2DN8A 2JA5H 4HVBA 1ZP0B 3Q8DA 1ZW7A 2NMQA 2KACA 4WAFA 3AFPA 1O7IA 3OIQA 3P75A 4X3UA 2VQFQ 3W9CB 2VXWA 4BY1B 2X69A 4A4IA 1FIQA 4O42A 3CHBD 1XLQA 3UINB 2NVUI 4EKUA 2MH7A 1WXSA 1AP0A 1VQPA 1PRTB 1CKNB 2FFKB 1PFNA 3GTMB 4CKBA 2CHWA 5C3JB 1ZPSA 2MJEA 1EY4A 4W9GA 1TKGA 2HDMA 2XRSD 2F0KA 2ZXOA 2KFKB 3AXCA 2PNRC 1Q8IA 5DM63 1R4MI 3FILB 2NVQH 4OIJA 4DR4Q 1ZYRC 3ERSX 1K9MC 2K8BA 3LB8C 4YWMA 3VTUA 3J80L 1Y8PB 2SNSA 3EVQA 3HS0C 3I8ZA 2MLBA 3DBHB 1FJGL 3NRZA 2Z6BA 2EOTA 4CHTB 4MJSB 3GD7A 2EYFA 1DOIA 3UIOB 2W54A 4P2CB 2CH4A 4WRDA 4JI7Q 4P1CC 4LNQA 5JJKA 5E3FA 2P5ZX 2KO3A 3DDCB 2BW2A 1BOSA 1L6VA 2RCFA 3K81C 4WJWA 5H8YE 4FN2A 1V8CA 3ITPA 4EVOA 3RN5A 2UXBQ 3RNCC 4QIWB 1Z9FA 4WJQA 3ML8A 1M8AA 4A20A 4USAA 4F87A 4B3RQ 5E4XA 2OOBB 4X3SA 2WQYB 3J7AV 2L12A 1DZ1A 3KLRA 4K3CA 1AWDA 5DPTA 4DHZE 1EL0A 5LMNQ 4MH0E 4MT5A 1FD7D 3L0WB 5MPOA 4W9KA 4DR7Q 5D14A 4HKZE 1E2ZA 3D32A 3VUYA 2L5TA 2XN9C 1EM7A 1F9JA 5IYBH 2EJFC 2N7JA 1IBXB 4IJHA 2IJ0A 1N63A 1QOHA 2WIIB 2K52A 5CTRC 2F0GA 5C3WA 2D62A 4TQ1A 2XGTA 3RNFC 1JOKA 3QR8A 3F1ZA 1PH5A 2ES2A 1SYBA 3DM3A 1UE5A 2SEBD 3N6RA 3M85A 5G55A 5BYQA 3K0YA 1R9TH 3PIOA 4GNXA 1I94Q 1D3ZA 3EA6A 4R4IA 2YEPB 1SROA 3AV8A 3UIPB 4KDLB 2IGHA 5H1SE 3HOUB 2A6ED 2NTSA 3OAWA 4LJOB 3DBLI 4GOPA 1XX8A 4KKTA 2K25A 2W3SA 2PO4A 2F4IA 2YYZA 5CR3A 1OTRB 1IBLQ 3HUIA 4FJYA 1XO3A 4IFDH 1AEXA 4BXXG 2DHZA 4IWPA 2O2LD 3IT4B 5DPRA 4QY7A 4HJ8A 2G9DA 2F0QA 4PNYA 1ONLA 4DV3Q 3HIZA 2MA9B 2K32A 1A62A 4HIMA 1WH3A 5C3EG 1C79A 2J0MA 4FHKA 4M8NA 1WE7A 2NPTB 1NSNS 1EZ6A 3A54A 2UUBL 1ASYA 2O6VD 1JE4A 1HA5A 2N88A 5EDSA 1N34L 3U2SC 2V4DA 1WXVA 1BF4A 2BE5C 4OWXB 4K6LA 4KVGB 3APFA 1LABA 1P8LA 4POFA 5JJZA 1ENCA 1P7FA 1QQRA 2LGYA 4GU2A 4KIKB 3RFZB 2WAQB 3TQYA 1PYSB 3I55A 4XZ4A 3GTPH 2RR9A 2KMCA 4DXGA 4II3B 2I46A 4X3TA 2ZW1A 1K50A 2FIDA 3M63B 1RFAA 3G6JB 4RWSC 4DN4M 4OW0A 3PRPB 4DQOC 5KNBA 1WYWB 3ZUNA 1EY6A 2INNE 3JC66 2N7DA 1Y1WH 1L2FA 5M5WB 3HM3A 1G2SA 3Q8AA 1XJVA 2MBOA 1E1OA 4LDTD 1M4VA 3B6YA 2UU7A 4Q0FA 1O7ZA 4JK1C 1HEZE 3EUB2 4XC2A 5CHFA 4AWJA 3QB3A 1IBKQ 4L5RC 2F3IA 3NVZA 4DV7Q 2GVBA 2WHIA 1STGA 4DV2L 3QCAA 4L23A 5I9PA 4PK1A 3MXGA 4MSQB 3V6CB 5HKHA 1T9HA 2K33A 3AE7B 1O7YA 2LXKA 4LUZA 3D8GA 3RYTA 4HJKA 2EYLA 4DV0Q 2E2JB 3I57A 2I2YA 2VL6A 2PPBC 2R92B 4J6IA 3MJ5A 1DXMA 4NXNL 3PZ7A 2E5LL 3V6EB 3AFQA 3M7GA 1STEA 1V1OA 2B2UA 2LGSA 3D4WA 1AZQA 1P9DU 3AEFB 3ENEA 3LJ3A 2QDFA 3T8MA 1BCPB 1QVCA 1WCMB 1EWCA 4ODGA 5NUCA 4IM3A 1WF9A 3Q8CA 1E7PB 4XYCA 1NBFC 1QOFA 2FUHB 2E5LQ 1DD2A 1I6VC 2JXMB 2X6GA 1TTNA 4DUYQ 3BIID 3QC8B 1LXDA 3VR4A 2KQSA 2BT6A 4EQ5A 3APDA 3Q3MC 5L37A 5E4WC 5ELFA 2ZJQA 2WXKA 3TL5A 2LJ5A 2GN5A 4BY7B 4OO1I 1QUQA 3UI2A 3K5MA 1M90C 3RNGC 2AUJD 4JGHB 3S2HH 4HK2A 1IBKL 3AULA 2F0JA 2ON8A 1YQ3B 4IOIE 1YJWA 5C4JH 1OXXK 1U4LA 5FLXc 1HPCA 3DVGX 1MPEA 3T13A 1ILPA 3OWFA 2H89B 4GDKA 1YIJA 2DJFC 1HTLD 4L5QA 2PVOD 3VR8B 3I4OA 4LFCQ 3PO3B 1WWTA 2C60A 4W9IA 2F0TA 2EZVA 1WMHA 1CK1A 4A75A 2GRIA 3AE8B 3QX1A 4LW1A 1WJJA 1BBUA 4EFOA 2IX3A 1WTQA 4A3IB 4C3JB 2WAQG 1B2TA 3UE0A 1NYRA 3R3OA 2G5DA 1G6JA 3K0XA 1I50B 3TEHB 4NXMQ 1IYJB 1JE5A 1QZEA 1HZAA 1SYCA 3PUVA 3TP7A 1EIYB 3JAMi 2L15A 1X56A 1FFVA 2UYZB 1E8YA 4BKSD 3OIPA 1N34Q 1SYFA 2QHOA 2UUBQ 2LHEA 2KYWA 2DYMA 1LO5D 4H44C 1JR0D 4BBRH 4LF6L 3J81c 1HR0Q 4HMJA 2VUMB 1CUKA 1WGHA 5LL6S 2MUYA 3ONAB 1UWXA 4C3IB 1V97A 2N1WA 2CKZB 4FXKC 4DV3L 1X1MA 4C3HB 5ELBA 4KDIC 4MGYE 5CV5A 4IJLA 3X3NA 4KHZA 5IWAL 5FJ8G 1Y1WB 1P0RA 4NZLB 3TDQA 4LF8L 1SEBD 3K5LA 5J2RA 3R3MA 5CV6A 2K7VA 1EEFD 2LSSA 4TQ0A 5G3LD 1G6ZA 1L4ZB 1H9KA 1I4GA 5HFYA 1YNJD 3URYA 1SAPA 3RNUA 5EPJA 1XD3B 3BDCA 1IKMA 4JC0A 3SXHA 3NEMA 4YHHL 3UDXA 1B7YB 4FVMA 3CPWA 1C48A 4YY3L 3S14B 4OO1H 3A9JA 3MC9A 1N36Q 4G7OC 1VQ9A 2KDIA 1XYIA 3P2BA 3TZUA 5DLQE 1T6BX 1X3FA 2K6AA 1EUJA 1MJDA 4NXNQ 3AI5A 4QAYA 2ID0A 3ZNHB 3HG9A 1EQVA 1NR2A 3S1MH 1HZ9A 5C44H 1HZCA 5TSSA 2UUCQ 5EAYA 5AZHA 2DJGC 1ICFB 1YEZA 3OOCA 3N30A 1WI0A 2HHHL 3RD2A 5DPSA 3NENA 1NE3A 3CWIA 1Y69U 3PHXB 4C00A 1PH6A 2B2YA 1HQMC 4A6QA 2WDRB 2IX1A 1NNXA 4DV7L 2JE6I 1HR0W 3I63C 4PS7A 2LMCA 3A8IE 1A3TA 4RHSA 1CSQA 1VQNA 1XNRL 3NVWA 1IL2A 2RD0A 1M1KC 4GKJL 4QUCA 3ZJVA 1V8QA 2PCFB 5K36G 1BQQT 1TWFH 1JJGA 1Z2MA 1Z7TA 5D3IB 3U4EG 2NZOA 3K6OA 1PRTF 1WE6A 1C9FA 1C4PA 2A6EC 2Z0SA 5E1FA 5FOBB 4A3IG 4X62L 1H4RA 5D2MB 2RDFA 4ZUJA 3MJWA 3H94A 1WYGA 5BMHA 1P1AA 5C4ZA 2MQHA 1MBYA 4FNFA 4DR4L 3NOBA 4NJ6A 1CJEA 5E6JA 2NZHA 3WAOA 1HH2P 3ER0A 1G291 2TMPA 3DWQA 1QLBB 4NPNA 2F1MA 3JVZX 2IT1A 1GKHA 2WGSA 4GB9A 5EJWA 3V05A 2PPHA 3A1QA 4YSYB 2PJHA 1LUZA 1LLRD 3TS2A 2VUMG 3HKZG 4BBRG 2RHSB 4IFDI 3VYTA 2MBBB 2K9XA 1WXMA 2DLBA 3UDFA 1E5WA 4DK3C 4FXGC 5KIXA 2W82A 3MAQA 4LK0M 3PIPA 1E7ZA 2VQEL 4KSLC 3C46A 1RODA 4HCEA 1N62A 1CA6A 4NPSA 2Z8LA 3T51B 2MP2A 2EMSA 4PZ8A 4K5WA 2ZW0A 4IWQA 4P71A 4PZ6A 2K5NA 5C4XG 4JOIC 5LMUQ 3A9KB 4WWMA 5HHDG 5JEAH 4JE3B 1GJXA 1I4RA 3AMUA 2AL6A 4A9AA 4WWNA 1IHZA 3JAME 3K7AB 1JRUA 4C80A 2L0TA 3SGIA 3I4MG 3WDNA 1GUTA 3KDFB 2OWOA 2LD9A 2KFKA 1Q10A 2J42A 4HRSA 1WVLA 1SSOA 4E6IA 2KCTA 4O0AA 3N52A 1MHXA 2KWDA 4J15A 1ZOYB 4RFBA 1EIHA 2ZEQA 4JV5L 4J3OD 2HDLA 3IHPC 2E2IB 1FD6A 4DHJB 2RGFA 1CSPA 1MSHA 1E10A 4MJSA 2IPKD 3I4LA 4DR7L 3AEAB 2Q2IA 5LMNL 1W6KA 4RA8A 3IL8A 2VH2A 1SNOA 3M4PA 3NE5B 1RTOA 1PTOD 1CA5A 2IBIB 1VJKA 1E7VA 1IYUA 2F0NA 3RN2A 5D7GA 2N3SA 2PE6B 3M3YB 4BY1H 4WJOA 5C23A 1PYBA 1KAAA 3T56B 2K01A 1XWEA 1PRTC 5IYDG 3T1YQ 2K8CA 1STAA 1QKZA 4MGIE 1B3QA 4XE0A 1UE6A 2DNCA 2EY6A 2B2TA 2F0IA 3T1HQ 2BYVE 5COYA 4Z9CB 2GA4B 4IURA 1X32A 2I5MX 2M0XA 2VRRB 2GBRA 4ANVA 3J80E 2Y5PA
chains in the Genus database with same CATH topology
3BK2A 5C2TB 4YTPB 4C7YA 1A3UA 2Q8IB 4XQNA 4IKGA 1PTOC 5EKKA 2K22A 1S5CD 4HEA1 2EJMA 1CZGA 3D4DA 3AE5B 5C3EB 1QB5D 3J81L 2OEOA 4HAEA 1BBXC 2QMTA 4OIKA 4DA2A 2EY1A 4YT0B 2M0AA 3Q8EA 1ZXIA 3K5OA 3BDLA 3C3LA 1TIID 2AWNA 4FXDA 1ML0D 4ZQ3A 4YSXB 5JAVA 1UGJA 2FJ2A 5EGTA 1U4MA 1JICA 1J7CA 1N5XA 4PV1C 2ZXPA 2CJNA 1STNA 2WXOA 3O13A 3KBGA 3JAML 1L0VB 5BYSA 2R93B 1HRJA 3FDTA 1WD1A 3Q6SA 5D3DA 4DGZA 2A69C 2LHDA 3P7JA 2JA5B 4ITKA 1HA6A 3B9JA 4LLGM 2NBFA 4FO2A 1TS4A 3HP3A 3I73A 3GS2A 1FFUA 3H6MA 4LK1C 2EDGA 1RF2D 3SHLA 1K8OA 3DM1A 4QCLA 1EOTA 2F0DA 1B9MA 3NSWA 4KY5A 3A8KE 3KQ4A 2F0OA 1TWGB 4HKQA 1YNNC 1B53A 3GTOB 3VA7A 2WXGA 3NBHA 2B8GA 1KABA 1YQ4B 4TMAB 4KD4A 4PMCA 3HOYB 1PTOH 1OQQA 1D5ZC 4HN7A 3NUCA 2OEDA 2IGGA 3NWSA 2VB3X 2NVTB 1ZYRD 3FVQA 1VR9A 1JOQA 3T4AC 1BO0A 5HI1A 3RZOB 4DAVA 2KQ3A 1E2VA 3QO2A 4ULLA 3CQZB 3L9AX 5A2QE 3PV0A 4HMIA 3U52E 3P63A 2H88B 2JA8B 3NP8A 1B9RA 2DYOA 1TKYA 4K8JA 1AN8A 4V0BA 5KGUA 3H8HA 1JOOA 5LHY1 1N60A 4A93B 2PKOA 5K36H 3E0JA 2LS01 1SDFA 2PQEA 1ACCA 2IDYA 3PZ8A 1DOLA 2A6HC 4WORA 1VZ6A 1TS2A 2B39A 1JWBD 3KWLA 1UEAB 2IX0A 3T3OA 4WQMA 5FK9C 4QUFA 3S17B 4G7ZC 3HRDD 4O1NA 4HR7B 5C4JB 1KF6B 2L11A 1ZEQX 1GAQB 4ZRQA 2NN6G 5I6WA 4C56C 4MACA 1BR9A 5J39A 2NZ1D 2BE5D 2PMZB 1GB1A 4OZBA 2QDBA 4F8MA 4LTUA 2G9HD 1PDXA 1WXQA 4ILWA 1STBA 3CRKC 1CZPA 4CJ2C 1A15A 1LV9A 3HZXA 2PMVA 3TP5A 3I91A 1R7SA 2WXQA 3AE1B 2XNAC 1F2MA 1DONA 5F2DA 2K03A 3BWUD 4DK0A 3QWNA 1WGKA 2NYZD 1FNUA 1LTRD 3MXPA 4NKLA 1NR4A 3BVMA 3NVVA 3B2FA 2L32A 1F9RA 3MHBA 5KNDA 1A70A 5JVH3 4KGTA 1H9JA 3SVMA 3LWUA 3VR6A 1DGJA 4JWSC 5HGTA 3NUHB 4K14A 1NYQA 3GV3A 3FC4A 1IL8A 3EJIA 5M3FB 4KX6B 1FO4A 2C5CA 3SE0A 1NUCA 1TY2A 2NUCA 4C3JG 3TEXA 3J9CA 4IFDG 2JWUA 3S16B 3TN2A 1CZWA 4KN4C 1SBBB 1SYGA 1GPXA 1F2ZA 4KGSA 2R3ZA 1TKEA 3W1SA 4AYBB 3NZ3A 4QF4A 1BCPD 1HTPA 3RMHA 1C76A 2WU5B 5ELCA 1JQ4A 4CBVA 1F2RC 1XTCD 1STHA 2KOLA 1KH0A 1C8CA 1TZOA 1QG7A 2K5PA 1C4CA 3GTLB 5M5YB 4N9PA 1F9PA 1EWYC 3Q8BA 3IAS1 2A68C 2G1EA 1PGXA 1NCVA 1GHKA 2CVRA 4MN3A 3DWMA 4XDXA 1V1PB 1WTVA 1IGDA 4N9TA 2K05A 3P42A 3S1RB 4ARCA 3DUZA 5LL6X 1QILA 1SJED 1T3QA 3FPPA 5EBCA 3K5NA 3AEEB 4P6VF 3K57A 1C4QA 2QKIC 4RCOA 5DNFA 2E6XA 4US8A 2PTLA 3FPUB 2B2VC 5EE9A 3MFYA 2IGDA 2SOBA 2JA7B 1LTGD 1E6EB 4ABNA 4IUVA 5JOBA 1I4QA 2FBWB 4NP5A 3BYTB 3CKIB 3S1QB 2L1BA 3AE6B 3ETRA 2Y0SB 5CV8A 2F0EA 1TWFB 4KK7A 2WXNA 3HVDA 2QIEB 2DBYA 2OXPA 2GB1A 2NWGA 2RDGA 3HGBA 4IUQA 3M4OB 1WD0A 1JWSD 3D31A 2LEKA 3PO0A 1A3VA 4DF7A 1MHHE 4LJZC 2YU9B 1TU2B 2FHTA 3EQLC 1RHPA 2A6HD 3VR2A 3RZDB 1YNND 1J7BA 4GDLB 3TP6A 1Q90A 4CJ0B 2QJLA 2PIAA 1TT2A 3R2TA 1B44D 5G3LF 1EFID 3RUZA 4EGVA 1DOYA 1Z47A 4OVZA 3NPPA 5JEAG 1ZE3D 3NWTA 1IW7C 3TZDA 3AN1A 1X3QA 1SMYC 3MXUA 1IUEA 2CU3A 2WXHA 1NENB 3A55A 5EQ0A 2MEKA 3EROA 2RBMA 1FEHA 3H0GB 2FUG1 2Q5WD 1QOGA 4N58A 5FLXL 4HTHA 5IGEA 3VRAB 2WDQB 2L55A 1VZ7A 5CV7A 1CQVA 3QOLA 4KMUC 1PYWD 1TYGB 4I7ZC 1A6XA 1YN5A 3Q0AA 2IW3A 4N6EB 5HG2A 4H0LC 1JMLA 3IAM1 4HJGE 3NBIA 4XYOA 2D5DA 2JEBI 3GTPB 1Z6HA 5BYRA 2RDHA 3QG1A 3ZYYX 1KTKA 2B8FA 3NQIA 3GP7A 1U4RA 4FF2A 2KDMA 1WRIA 4WIPA 3SR1A 1QCBD 1MSGA 3OHXC 1BMLC 4ZLTF 4RAUC 4YTNB 3UI3A 4K2KA 3A8JE 4S3SA 4X3KA 1IGCA 2JZPA 4Q2JA 3MC0B 1S5DD 5FO8B 4WFN3 2WP9B 1EYAA 4DFAA 1CQFA 4L8JA 2GI9A 4A3EB 5KNCA 1S4ZA 3MP9A 4U673 1E0BA 1EY5A 4K2LA 1IKLA 3U9SA 3PUYA 3P1MA 4NJCA 2H4OA 3LX0A 5JPMC 5KYIA 5KYLA 4C3HG 2XIWA 3F2UA 1D5XC 1PFMA 1MGSA 3MA2B 1IW7D 4PQXA 3HOXB 1AFPA 4XDCA 4MM3B 2EYJA 1V43A 1HHVA 1TQOA 2E75C 3A7LA 1U4PA 2Z4IA 3E5SA 2B2WA 4ZYSA 1G2TA 1QNKA 2WS3B 1LTID 1TJEA 2LUMA 2O4XA 3TEWA 1GUWA 1AW7A 4C2MB 1MD2D 3B2GA 1KDBA 1U9RA 1N5WA 4NDXA 3NTKA 3FKIB 1K53A 1DOKA 2F0WA 2MGSA 2Y3AA 1WTPA 1BUVT 1SFOB 3E56A 1PFBA 2EJGC 4IQZA 1MVKA 3DEOA 4PT5A 3P4SB 4EQPA 4IALA 1VCIA 4J8QA 3TMEA 1QJOA 4RKBA 4L6TB 4CKEA 3FEWX 2ACZB 3BDOA 1VMPA 1Y8OB 1WTRA 2R7ZB 2H1EA 2LFIA 3EGRA 2B63B 3IKJA 2D2CC 2JYOA 4FXCA 2HTME 4KKSA 4B0MA 1EZ8A 4Q5VA 2BA1A 4QB4A 2QCPX 2X38A 5T1IA 1L5PA 4MHEA 1SSNA 3TEZA 2N9KA 1FRDA 1CFMA 2C9OA 4B9WA 2LFNA 2KN4A 3GV6A 3WCQA 2AWOA 4C7ZA 1CT1D 3MEHA 2RPVA 4JX1C 1EEID 1ET6A 2L9HA 2AQ3B 2BS4B 3ND8A 2NVQB 4RCNA 1UNSA 2PW5A 1TVXA 1GB4A 5DAUA 1ICWA 3VQIA 1P7EA 1F0ZA 1XXGA 1LTTD 4IUPA 1GUOA 3DWGC 3OW7A 3VR5A 4XWTA 5CV4A 1ZDVA 1F2RI 1C4AA 2KEEA 3WOFA 3K58A 5JXVA 1ET9A 4OL7A 1RJTA 4BA1I 2NTTA 1JQYD 2K1BA 2SNMA 5AUKA 4HEDA 3TUOA 1UAPA 3SFEB 2WXIA 1GOZA 5T8IA 1EU4A 5IT9L 4US9A 4KY7A 3Q22A 1ENFA 4K8IA 3KLSX 3VYUA 3D6CA 1YN4A 2WB1B 4RKLA 2HUGA 3L7ZC 5C5LA 3A7AB 3KBXA 2JX5A 1ZXHA 1ZKOA 1S5BD 4CKCA 3MXNA 1QF6A 3SK6A 2EY2A 2EELA 4L63B 3J7YW 5AUIA 1D1KA 2A73B 4N59A 1PUTA 1G91A 4TRDA 4DXFA 2A68D 3PO2B 1B50A 4PMWA 1XLPA 4MIUA 4JPSA 3AM9A 2EVBA 4XQJA 2WU2B 2L4NA 2RKSA 2RQXA 5C0XH 1AYFA 3HRZC 4BA2I 1B1ZA 1W6JA 4G57A 2WXPA 1V1PA 2BDOA 1EY9A 3HVZA 3I4NB 4TSSA 1FCLA 2FMMA 5EE1A 3D4RA 3BVGA 2KHSA 4WH4A 1BUIC 4F7XA 5EPKA 2V3PA 2L52A 1F2LA 1ESFA 1O7LA 1FCCC 2KAJA 3FAHA 4ZK9B 1VMCA 2BCOA 4RH6A 1MI2A 2B2YC 1SE3A 2BS3B 3MWYW 2BBCA 1H9SB 1LT5D 3R93A 5DM73 2LJIA 2XWBB 3W3AA 2E2HB 2F0LA 1T5EA 1QNUA 4JBWA 1LTAD 4ZRPA 4B9XA 4EE2A 4IUNA 1EY7A 1RYJA 1VF7A 3P4QB 1ROEA 4KD3A 3AMZA 5JPNC 3K59A 1VLBA 1CHPD 2MP1A 2KECA 1SE2A 3NXWA 4M8AA 2CJOA 2SDFA 1HCZA 4HSPA 4V190 4GZYC 1JWUD 4KTAA 2WXMA 4KJNA 5C6AA 2WP8J 2FINB 3R2IA 3E9SA 1PZKD 1F2YA 4ZAIA 3OMCA 4XWWA 3MHZA 3Q23A 4ME5A 3IT6B 2M00A 2JQRB 5BN4A 2EYMA 4OGQC 4NAWB 3V96A 1WSPA 4HROA 4B0EA 5EKIA 2I07B 4XIGS 3T53B 4XDDA 3QOJA 2E76C 5FO7B 2J53A 2QSDA 1D2BA 4ZHOA 2HCIA 5CBAE 5GXGB 4A8XC 1HUMA 1SYDA 1QWYA 4A3DB 1RDPD 2L0CA 3LNNA 1A2TA 2KVMA 2M19A 4I65A 3BVZA 1FXIA 4PMBA 3AEBB 1HXYD 3HKZB 3MFGA 1PTOF 1K83B 1VRAB 1YNTE 3WOEA 1IYVA 3I9V1 2MJDA 1TY0A 3ZJUA 4ZKCB 1XLOA 1DOXA 3M4YA 2F3WA 3VR9B 5C4HA 2MJ8A 4NW2A 1QOBA 4LAAA 1JC7A 4Y7NB 4HCSA 5CORA 1GHJA 3I72A 5FR3A 2CHBD 2XSCA 1NEKB 2WNMA 3EFXD 1KDCA 4XT1B 4EQOA 2BYTA 2IL8A 2F0FA 2J4XA 2ICEC 1LTSD 2PVGC 4L2YA 3AECB 3U7ZA 1KRHA 4K5XA 5BN3A 2A74C 1XF5L 2AQ1B 3GTQB 2WXFA 1RCVD 3Q8FA 3CU7A 2HQEA 4F88A 2J7ZA 3N9YC 4J1MA 2PZWA 1A2UA 1TWAB 4ZUIA 1K8MA 5JVG3 1XCQL 4LMQD 1B9NA 4KKIA 3X3MA 3OPOA 2BB6A 1D1IA 5I4DA 1JWAD 3OMGA 3GTKB 2JP1A 3P20A 2EXZA 2PW7A 2IWHA 3IAYA 4FP5D 4RGMA 2W3RA 3P4PB 2EY5A 5IIFA 1F9QA 3S2HB 2HDEA 2NVYB 4R8NA 1FNVA 4WURA 3AE4B 1EQTA 5CBEE 2ONQA 4IDIA 3SR6A 5C0XI 1QE6A 2K04A 2A5HA 4OO1G 1OFFA 4CGYB 1F9SA 2XWJB 4AQ7A 2SAKA 1SJHD 1CTMA 4KV6A 3SFDB 4XT3B 5HURA 2M2LA 5C3XA 4ZOHC 5D65A 1Q12A 3AE3B 1B3AA 3HOZB 5G5HA 2K28A 2K5WA 4XYQA 3BYYB 5IGCA 4EQNA 4DU9A 2BDNA 2QEJC 5FKAC 2N9LA 5I2XA 4KN7C 4KKUA 4BS9A 2Q8RE 3L4PA 2KA7A 3D3RA 1ESRA 2V0GA 4KGRA 1LTBD 2J0TD 1R4QB 1I6HB 2B76B 2F0MA 1GUNA 5IODA 1EYDA 2O5JC 2V4IB 3KK7A 3MZ5A 2FE8A 3G7LA 5IOCA 3DMUA 3PUWA 2JA6B 3H3VC 2DNEA 2RMMA 5FLXE 3IXSA 3RD4A 2W55A 3W5UB 2ZT9C 2KCCA 3DXJC 2ZXRA 1I4HA 4XXEA 1RFKA 2LKVA 1O78A 3KUPA 4DAYA 1OO9B 1PGAA 1HZ5A 3RPFC 1L6UA 2E2DC 1MI0A 3GTJB 1JALA 5BMGA 3GB1A 3ND9A 1K51A 2YEPF 1SNQA 3DEPA 2EYOA 4YTMB 2KUMA 1JWMD 3KWVA 3VRBB 4YSZB 1FM0D 1BCPF 1HFGA 2KMMA 1J8IA 2B2VA 1PZID 4CQNA 2E3TA 3TEYA 4FF1A 4ID6A 1CI3M 4K6DA 5KEEA 4KKJA 3C1FA 3AB9A 5AFWA 1SNCA 1PTOB 2F03A 5A2QL 1EU3A 1S5ED 1E2WA 4QMGA 2CW0D 4YXDB 1DYQA 3U9OA 4RHRA 3MTSA 3QJYA 3AEDB 2F0SA 2EE1A 3V2TA 1ILQA 4ZRZA 4RGNA 3LYYA 3PMFA 2Y5CA 5K5PA 1GXDC 2JYEA 4H2AA 1ZXTA 5CMDA 1TWHB 1CHQD 2PZTA 1C77A 1BDOA 3ZQ4A 1I7HA 1TWCB 3AE2B 4OZAA 3BS1A 3RLFA 1C78A 2KEDA 4YWGG 4AS1A 1AZPA 2BTEA 1PLFA 1SMYD 1FR3A 2QF7A 1Y56A 1KDAA 2HCCA 1SXTA 1XCTL 4M0WA 3ZJTA 1LT6D 1HZ6A 1L4DB 3M7NA 1XEEA 5DEHA 4M1UB 3P4RB 1FMAD 1NVID 1YJIA 1KNAA 3AU7A 3LWEA 1OXTA 4J6HA 4NMZA 1WTWA 2VZKD 1RM6C 2D5GA 3PIP3 1SIJA 1TS3A 3V3XA 3LXFA 4A55A 2O5IC 1NI3A 5IGBA 4RGTA 1PDQA 3SDZA 3AB5A 2PZUA 3I90A 4IN3A 2E74C 3NS1A 1KFYB 1F77A 1FNWA 3C8YA 1PMRA 3Q24A 5H92C 4ZHPA 3FMCA 4TKOB 4XTCS 1B4OA 4JWUC 5T1GA 5BMIA 4FF3A 1J7AA 1TKWB 3J81E 4ARIA 1JORA 2PW9A 3GQBA 2CQAA 5C0XJ 2AQ2B 3J7AF 2LMCB 2Q8TA 1YN3A 5CGKA 1PFDA 5CC4A 2R6GA 4R8IA 1BXTA 1IBXA 2WDVB 1E9MA 5I9OA 2KQ4X 4C1NI 4KI0A 3CIRB 1GUGA 3A56A 4OZCA 1LT4D 1I4XA 2WINB 5J22A 1I3QB 3S15B 1FXAA 4A3FB 1SF0A 2BOSA 5FO9B 1KLGD 5I2YA 2V3NA 3S2DB 4RF1A 1SNMA 1SB3C 1DOMA 4RNAA 1RD9D 3NVYA 3VYSA 2EPBA 2VNUD 4XQQA 3AH7A 1VF5C 4IUUA 4L1BA 3CRLC 3QIAA 2B2TC 4UAIA 3TSSA 2RA4A 2AUKA 2N55A 2WXJA 2K5QA 2R61A 1JROA 4IUTA 5LNK1 3FILA 3H91A 5C0XG 5C4XB 2K0PA 2WKCA 1O80A 4DAPA 1YNJC 2BS2B 4A3MB 2L83A 1GUSA 2JXTA 1ENAA 3P1HA 2PLPA 1XLNA 1SNPA 5M5XB 3I4MB 5C5MA 3PUZA 1T5XD 3R8BA 3S1NB 4H7BA 5G5GA 1DM0B 2VB2X 1RWSA 1JB3A 3I3CA 2F0HA 1TR5A 1JCKB 4KJOA 4C1NK 3HEJA 4HSVA 1Y8NB 2M9VA 5EE0A 4TQUS 4G7HC 1STYA 5JEAJ 5C44B 3TBIB 1Q1BA 4H13C 2ENBA 1UUPA 2Z4HA 1DCZA 3NK9A 1PXUA 2OT2A 5IT9E 3C2PA 5ELDA 1Q3LA 1L0XB 2XVSA 1VDVA 2NN6I 3H09A 4DNRB 2JSVX 2WLBA 3SK4A 4RGOS 4BBSB 3OSOA 5EE3A 1PZJD 1D5MC 2DY7A 4BBRB 2OHFA 2EKIA 4GDKB 1EY0A 4KHVA 4IFDJ 5M3MB 1L0YB 1JW9D 1D4BA 1OQRA 3SK8A 1HQRD 2BB5A 2B2UC 1KNEA 4A3KB 3BK1A 4DNTB 1K52A 4FF4A 2OF1A 4R3DA 3TP8A 2F0VA 3PUXA 5CV9A 1OXVA 3SK5A 4A3GB 4R9WA 3S1MB 2LY7A 1D6EC 1YJJA 4KY6A 1QT9A 3GO5A 4A90A 5KRUA 1BCPC 4A3JB 5EKLA 3MVVA 5J1ZA 3NHHA 3DWAA 2INPE 2KJXA 3L3OC 1WTOA 5A35A 1RKNA 5M9OA 4GLSC 1H9MA 3NTHA 4B08A 5IGDA 2QILA 5EPLA 4C3IG 2Z1CA 3AE9B 1H9SA 2F3VA 5EBDA 3W2DA 4RF0A 1NAPA 4BWGB 2WXRA 5IGFA 1UWMA 1KLUD 3ZGZA 2JEAI 2NVXB 2WKDA 2AX5A 1PRTD 1EYCA 1X3PA 1Y1VB 2BA0A 3E6ZX 3FRPB 1VZ8A 1EY8A 2L1AA 1FYCA 2WV6D 4FYDA 1JRPA 2TSSA 1CM9A 3AEGB 2A69D 1J9OA 4U68A 4ZKBB 4K5VA 3BZDB 5IGGA 2I38A 3DHQA 5ELEA 2MPMA 2F0PA 3D6WA 3HOVB 2B2WC 1TS5A 2CW0C 2DWQA 3NTIA 1DJRD 1QOAA 3IFTA 3VR3A 3KF8A 1S5FD 3KLSA 3T16A 3OWEB 1E0ZA 1YMHE 1ZDXA 2NB0A 3HOWB 5BN5A 2DY8A 1BNZA 1EWHA 2N0SB 3NQTA 3T3NA 1PGBA 1OXUA 1FGBD 3VYRA 5I6YA 1VDZA 1SNDA 3W5VB 1EIGA 2VZKB 3BG3A 1HUNA 2JU6X 4A3BB 4YIJA 2PYKA 4OHJA 1LT3D 1H9RA 4D2KA 2LGIA 4G4KA 2K5DA 2MHVA 4UDUC 2X6LA 4CJ1B 2KCNA 2FMCA 5ISRA 2M56B 4REZA 3VA5A 2RSNA 3ABVB 4P16A 2XRQD 5CYUA 1RTNA 1G8ZD 1SE4A 1LACA 2WACA 1HFNA 2K3UA 1FRRA 4MH8A 2WXLA 3IFDA 1SYEA 2ICIA 1II3A 1R4PB 2EYPA 3PIO3 3ERQA 2JYTA 4IZ8A 2MJ3A 2EYHA 1WTXA 1OXSC 1ZUD2 3SEBA 2RVLA 3GTGB 2F0UA 3I70A 1N61A 1I4PA 2J52A 2NN6H 1Q1EA 4NAMA 3Q69A 3S9WA 3DWPA 2JSOA 2RSOA 3C1EA 4DK1A 2D9UA 1R9TB 2DN8A 1ZP0B 2NMQA 2KACA 4WAFA 3W9CB 3OIQA 3P75A 4X3UA 2VXWA 4BY1B 2X69A 1FIQA 4O42A 3CHBD 1XLQA 2MH7A 1AP0A 1PRTB 2FFKB 3GTMB 1PFNA 4CKBA 5C3JB 1ZPSA 2MJEA 1EY4A 1TKGA 2HDMA 2XRSD 2F0KA 2ZXOA 2PNRC 1Q8IA 5DM63 3FILB 4OIJA 1ZYRC 3LB8C 3J80L 1Y8PB 2SNSA 3EVQA 3HS0C 3I8ZA 3NRZA 2EOTA 4CHTB 3GD7A 2EYFA 1DOIA 2W54A 4P2CB 4WRDA 5E3FA 2BW2A 1BOSA 1L6VA 5H8YE 4WJWA 1V8CA 3ITPA 4EVOA 4QIWB 1M8AA 4USAA 4F87A 5E4XA 2WQYB 4X3SA 3J7AV 2L12A 1DZ1A 3KLRA 1AWDA 1EL0A 4MT5A 1FD7D 5MPOA 5D14A 4HKZE 1E2ZA 2L5TA 2XN9C 1EM7A 2EJFC 1IBXB 2IJ0A 1N63A 1QOHA 2WIIB 2F0GA 5C3WA 2D62A 4TQ1A 1JOKA 1SYBA 2SEBD 3N6RA 3M85A 5BYQA 3K0YA 3EA6A 3AV8A 2YEPB 2IGHA 3HOUB 2A6ED 2NTSA 1XX8A 4KKTA 2W3SA 2PO4A 2F4IA 2YYZA 5CR3A 3HUIA 1XO3A 4IFDH 1AEXA 2O2LD 3IT4B 2G9DA 2F0QA 4PNYA 1ONLA 2K32A 1C79A 1NSNS 1EZ6A 3A54A 1JE4A 1HA5A 2N88A 3U2SC 2V4DA 1BF4A 2BE5C 4K6LA 1LABA 5JJZA 1ENCA 1P7FA 1QQRA 3RFZB 2WAQB 4DXGA 2I46A 4X3TA 2ZW1A 1K50A 3G6JB 4RWSC 4DN4M 4OW0A 4DQOC 5KNBA 1EY6A 2INNE 5M5WB 1G2SA 3Q8AA 1M4VA 3EUB2 4Q0FA 1O7ZA 4JK1C 1HEZE 3QB3A 3NVZA 1STGA 4L23A 5I9PA 3MXGA 2K33A 3AE7B 1O7YA 3D8GA 2EYLA 2E2JB 3I57A 2I2YA 2PPBC 2R92B 3MJ5A 1DXMA 3PZ7A 3M7GA 1STEA 1V1OA 2B2UA 3D4WA 1AZQA 3AEFB 1BCPB 1WCMB 1EWCA 4ODGA 5NUCA 3Q8CA 1E7PB 1QOFA 1DD2A 1I6VC 2JXMB 2X6GA 3BIID 3VR4A 2BT6A 5E4WC 5ELFA 2WXKA 4BY7B 4OO1I 3UI2A 3K5MA 2AUJD 2F0JA 2ON8A 1YQ3B 4IOIE 1OXXK 1U4LA 1HPCA 1MPEA 3T13A 1ILPA 3OWFA 2H89B 1HTLD 2PVOD 3VR8B 3PO3B 1WWTA 2F0TA 2EZVA 3AE8B 1CK1A 2GRIA 2IX3A 1WTQA 4A3IB 4C3JB 1B2TA 1NYRA 3R3OA 1I50B 1SYCA 3PUVA 3TP7A 1FFVA 3OIPA 1SYFA 2LHEA 2DYMA 1LO5D 4H44C 1JR0D 2VUMB 2N7JA 4HMJA 5LL6S 2MUYA 3ONAB 1UWXA 4C3IB 1V97A 4FXKC 4C3HB 5ELBA 5CV5A 3X3NA 1Y1WB 4KHZA 4NZLB 3TDQA 1SEBD 3K5LA 5CV6A 2K7VA 1EEFD 4TQ0A 5G3LD 1G6ZA 1L4ZB 1H9KA 1I4GA 5HFYA 1YNJD 3URYA 1SAPA 5EPJA 3BDCA 1IKMA 3SXHA 4FVMA 1C48A 3S14B 4OO1H 4G7OC 1XYIA 3TZUA 1T6BX 2K6AA 2ID0A 3HG9A 1EQVA 1NR2A 5TSSA 3OOCA 3CWIA 1Y69U 2B2YA 1HQMC 4A6QA 2WDRB 2IX1A 2JE6I 2LMCA 3A8IE 1A3TA 4RHSA 3NVWA 3ZJVA 4QUCA 1V8QA 2PCFB 5K36G 1BQQT 1Z7TA 5D3IB 3U4EG 3K6OA 1PRTF 1C9FA 1C4PA 2A6EC 5E1FA 5FOBB 2RDFA 4ZUJA 3H94A 1WYGA 5BMHA 5C4ZA 4FNFA 1MBYA 1CJEA 5E6JA 1G291 2TMPA 3DWQA 1QLBB 2F1MA 2IT1A 5EJWA 3V05A 4YSYB 1LLRD 4IFDI 3VYTA 2K9XA 2DLBA 4FXGC 5KIXA 2W82A 3MAQA 4LK0M 3C46A 1RODA 4HCEA 1N62A 1CA6A 2Z8LA 3T51B 2ZW0A 4K5WA 4WWMA 5HHDG