2J4XA

Streptococcus dysgalactiae-derived mitogen (sdm)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
196
Chain Sequence
KDAVLVNSELKNIYMKDVINKTNMKITKKIGTQLIFNKVISSNVSPAQERRFKEEEEVDIYALIKSYSVICKEQYNYVDGGLIKTSDREKLDSTIYMNIFGEQIPLKEQSKYKITFQNKFVTFQEIDVRLRKSLMSDNRIKLYEHNSICKKGYWGIHYKDNTTKFTDLFTHPNYTDNETIDMSKVSHFDVYLNEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords MITOGEN
publication title Crystal Structure of Streptococcus Dysgalactiae-Derived Mitogen Reveals a Zinc-Binding Site and Alterations in Tcr Binding.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
total genus 58
structure length 196
sequence length 210
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2j4xA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j4xA01
3W2DA 1I4GA 1PTOB 4L63B 1CT1D 1EU4A 2AQ2B 1HA5A 4K6LA 1L0YB 1MD2D 1PRTB 1STEA 4RHSA 1BCPF 4BWGB 1LTID 1I4HA 3URYA 1PZKD 2QILA 1JR0D 5FKAC 1FNWA 2Z8LA 2RDHA 5D3IB 1SE2A 5ELEA 1YN3A 1D6EC 1TS2A 2G9HD 1BCPC 1PTOF 5I4DA 2TSSA 2WV6D 2CHBD 3R2TA 1XTCD 3CHBD 1L0XB 5ELDA 3SEBA 1LTRD 2RDGA 3MC0B 1PTOC 2XRQD 1RDPD 3BVZA 1FD7D 1JWSD 1LTBD 1TS4A 1QILA 1FNUA 3BVMA 2NTTA 1YN5A 1EU3A 1FGBD 1I4PA 1LLRD 3BVGA 2ICIA 1LTGD 1LT3D 1S5BD 1HXYD 4NZLB 1BCPD 1EEID 4DXFA 2AQ3B 2J4XA 1AN8A 3R8BA 1XXGA 4UDUC 3KLSX 1TS3A 3DWPA 4RHRA 1S5DD 1LT5D 4RGMA 5D3DA 4DXGA 1PRTF 2IPKD 1LTAD 1CHQD 1PTOD 4C56C 1PZID 1TS5A 1V1OA 4ZYSA 1SEBD 2SEBD 1PYWD 1CHPD 4TSSA 1EEFD 1ENFA 1I4QA 2NTSA 2AQ1B 3DWAA 5ELFA 5ELBA 1PRTC 3O13A 1BXTA 1LTSD 1PTOH 2O2LD 4RGOS 1AW7A 3OWEB 1KTKA 4OHJA 1SBBB 3EFXD 1D5ZC 1KLUD 3BYTB 1EWCA 2XRSD 1HTLD 1CQVA 1FNVA 1YN4A 1SE4A 1JQYD 1PZJD 2XN9C 1JCKB 1UUPA 3TSSA 1EFID 1F77A 1S5FD 1UNSA 5FK9C 1B1ZA 1ET9A 1ESFA 4RH6A 5ELCA 1SXTA 3BZDB 1V1PA 5TSSA 3V05A 1I4RA 3MFGA 1DJRD 1LTTD 1G8ZD 2XNAC 4RFBA 1PRTD 3BYYB 1M4VA 1GOZA 1B44D 1I4XA 4RCOA 4Z9CB 3GP7A 1RD9D 1CK1A 4O1NA 4RGTA 1SJHD 2QEJC 1JWUD 1TY0A 1D5XC 1HQRD 1LT4D 1S5CD 1RCVD 1SE3A 1KLGD 1D5MC 1LO5D 2IJ0A 3DWQA 1TY2A 1BCPB 1RF2D 1LT6D 1JWMD 1T5XD 4L6TB 1S5ED 1V1PB 2R61A 3R2IA 1SJED 1DYQA 4RGNA 1ET6A 3EA6A
chains in the Genus database with same CATH superfamily
3EVQA 4KK7A 1SDFA 2A74C 1CTMA 2CH4W 3GTMB 2N1VA 2PI2E 2Z6KA 4JI7Q 1VQIA 1RKNA 1RM6C 4LUZA 1T0RC 1L0YB 3DBRI 1STEA 3AU5A 1HFGA 4JI4L 1K83B 2CQAA 5KIXA 2O2VA 3DDCB 4DV2Q 5JPMC 5FR6A 4K5VA 1PDQA 4OO1G 4G7OC 1JR0D 2KBNA 2BBCA 1YNND 3HOVG 3V61A 5JXVA 3MXNA 2F0UA 2L0FA 1FD6A 3E0EA 3TQYA 1VMPA 3ERQA 1GG3A 2FMCA 1VD2A 3Q2AC 1GB1A 5DM63 2CHBD 3M4PA 5E7NA 2B63H 3S14B 3Q3NC 4X3TA 1B2TA 1KRTA 1VQCA 1HEZE 1FVIA 3M62B 2R92H 2UWQA 5ELDA 4G11A 1SYCA 4LUVA 3AMUA 1KHIA 2A5HA 4DR6Q 3Q3FA 2HJ8A 1PH5A 2DJGC 1PTOC 5M9OA 3CCJA 1QVFA 3KF8A 4WJ3M 3PRZA 1J9OA 3U30A 2WAQB 1Q8KA 1L2FA 1WJ4A 2ZCCA 2DYMA 2ZEQA 4OZBA 4U673 4I6NB 3I72A 2BTEA 5I9OA 3PIO3 1F2RI 2J42A 5C4XB 3BVGA 4JK1C 1BR9A 1E1TA 1JE5A 4DKAC 1QQRA 2JXTA 2DBYA 3CQZH 1WWTA 1QUQA 4ACFA 4PYUA 2HHHL 4KIKA 3A56A 2IHEA 4FHJA 3VR9B 2EKIA 1GHJA 2L52A 1QNKA 1SRUA 2L1AA 1ZYRD 5K36G 1UAPA 2M17A 3HOZH 2EELA 3T1YL 2DNCA 4DXGA 2K5DA 4AQYL 1LTAD 3PV1A 4A9AA 5M5XH 2AL3A 1QVCA 4C3IH 1KLVA 2CKHB 2M0XA 2PNHA 1WM3A 1G291 1V81A 1EEFD 1U5KA 2I38A 1EL0A 1C8CA 1XCQL 4DV0L 2OOBB 2DN8A 1KAWA 5IYCG 1VLBA 2EJMA 3PIP3 2PQAB 3OW2A 2JA8H 1T3QA 4PYZA 5M3FH 1FM0D 3TEHB 3NZUA 3WOFA 4A3MB 1WTVA 3A74A 4G4KA 5IYBH 2IY5B 3TJPA 1HTLD 2Y3AA 4I6LB 5C4JH 4A93B 2B2TA 2PIAA 2E2DC 2C7NB 3Q0AA 3TSSA 2KDFB 1N60A 5FK9C 1PH2A 4OGQC 4G7HC 1KAAA 2YU9H 2KQ3A 2BA0A 2E76C 2KEEA 4FXGC 3W1BA 2K01A 5FLXL 5C0XI 1IBKL 1HR0Q 1EQQA 4EQ5A 4FYDA 2N9LA 5M5WH 2VQEL 4K2KA 3S1MH 3V62A 2K5HA 3JAML 5CORA 2CU1A 4NJCA 1R4PB 4JC0A 4O1NA 4DR7L 1I35A 1GUAB 2EY5A 2BB5A 2RR9A 2WXQA 3K9OB 3DCGA 2IX3A 1TZOA 4FP5D 2MP2A 1RCVD 2E2HB 1KLGD 2PI2A 5G3LD 2B2VC 2O6VB 3DBHI 3EN2A 2ES2A 1N61A 4IWOA 4F88A 4GLXA 1YQ3B 1W6KA 1S5ED 4KD3A 5C44G 1UWMA 1SNOA 1I3QH 3KWLA 3NY5A 3P4QB 4LFBL 4P6VF 4S17A 2VZAA 5J22A 3CF5A 3NBIA 4UP7A 2SOBA 4LFAL 3DHHC 4DAVA 1RL2A 1MI2A 2D9UA 3I56A 4NXNQ 3HOYH 3GTKB 2OEOA 2NCNA 1EU4A 5IGBA 3Q6SA 3SHLA 3KH0A 4K81A 5IE8A 3ZNGC 4QB4A 5M5YH 3G6EA 1FMAD 1Q5WB 4DNTB 4B3SQ 3N1XC 4MGIE 3FKIH 4IOCA 3VH3B 4FVMA 4QUCA 3VR4A 5ELEA 1XO3A 4OX9Q 2MH7A 3PT2B 1YN3A 2INCC 2BYEA 2KLCA 1J5EQ 2ZZPB 3WAPA 4KKJA 2ZTDA 5GROA 4KY7A 5C4HA 3HOUB 2K28A 2P5ZX 1TTNA 2R3ZA 4UP9A 1QZEA 3PO0A 1L0XB 3T9LA 4JBJA 2KFJA 2WB1B 2M0AA 2ON8A 2F0IA 4DK6C 1BKBA 5E4WC 1D2BA 5IGEA 4U68A 3P7JA 3GTPB 3FILA 4YTNB 3VA5A 2MHVA 5A2QL 2REXA 4JI4Q 1LQBA 1KH0A 5DPSA 4DV3L 1Q0WB 3WAOA 4UAIA 4O2DA 3U50C 2NVYH 2VQFL 5BMHA 5E6JA 1L4DB 2E3TA 2F0JA 4HJ8A 2Z6KC 4OO1I 4HJ7A 4IPHA 2KHSA 3VRAB 1X54A 3APDA 4MEMA 3PO3H 1DOKA 3M4QA 5F2DA 3VVWB 1MSGA 1EZ8A 1GHKA 3ENEA 1Q46A 4KGTA 4DR5L 4DR3L 4LF4L 1HFNA 1JW9D 2KAJA 1I4QA 2AQ1B 3ZQ4A 1M1KC 1FL0A 4MTKA 3L08A 3P4PB 4WJWA 1LTSD 3M7GA 2WXRA 4MH8A 4KD4A 4ODGA 3IXSA 2GBNA 2KQ4X 4J3OD 2D5DA 4JVZA 1SBBB 3STBD 3TZDA 2ZJQA 3EGRA 1EM7A 1WM2A 3I2ZA 1VQ9A 4GNXB 4C3HH 1NR2A 1EWCA 1STBA 2E75C 4LF9L 3TEYA 1N62A 2ICEC 4HCEA 2HHHQ 1CUKA 4ZUIA 4BVUC 3AQQA 2JQRB 2WXMA 2K1BA 2V4DA 4WRDA 1LACA 1F77A 5IYDG 4PK1A 3T1YQ 3RT3B 2K32A 3SDZA 3A9KB 4AQYQ 1BMLC 4TQUS 4XYOA 1Q1BA 4IG7B 1Y1VB 1LV9A 2K5NA 2KCCA 2OXPA 1DJRD 4X3SA 3Q14C 1WTPA 1O80A 4JGHB 3MFYA 3QOLA 5M3MG 4DV0Q 3NK9A 1X9NA 2L05A 2NVXB 2RGFA 4L5SA 3UI3A 2QEJC 4HIKA 3QIAA 3GV3A 1D5XC 4JI5L 2XWJB 2VRRB 3UQBA 2KHWB 1Z2MA 1SYBA 2IJ0A 1XLQA 2GBRA 5CBEE 1I50B 3KYHC 2ZJRA 1HA6A 5C2TB 2ZXOA 4A3EG 3DHQA 3PTFC 1F9SA 1ZXTA 1AE3A 2F0PA 4HEA1 1GVPA 1SJED 4OZAA 3CAMA 4EVOA 4A3BH 3QJZA 3PO2H 4A3DG 2ZT9C 1R4MB 3ZVVA 4BOZB 5IO9A 1WCMH 3D0FA 3DM1A 1IBKQ 3JYUA 2ASQA 1STYA 1WRDB 2E6XA 2KN5A 3EC8A 2AKWB 4GSWA 2VQEQ 4DNRB 1NSNS 2CJOA 1Y14B 5KNBA 5GAGC 1I94L 1XJVA 3K81C 1YD8U 4E3CA 2Y0SB 2GMIC 2EXZA 4DR7Q 1Q81C 2WACA 4IJLA 4G3XB 1LUZA 3R3MA 5HI1A 4CHKA 1WGKA 4BXXH 2J52A 1K9MC 3EHVA 3PVLA 1WMHB 2F0VA 2CHZA 1PH3A 4AQ7A 5FJ8H 2EPBA 2VH1A 3QC8B 3FVQA 3M3JA 2W54A 1SMYC 3KDFB 4BY1G 1E5WA 2F0NA 1YIWA 2VUMG 1Y8OB 2Z1CA 1KC8C 2R93G 3BY4B 3CHBD 5DAUA 4LFBQ 3ABVB 1HTPA 2OTLA 4GIVA 3KOJA 4LFAQ 4AH6A 4JWUC 1B3QA 2JE6I 4LJOB 4DDGD 1FNUA 1JC7A 3MZ5A 3ND9A 4HSVA 1HE8A 4XXEA 2WHIA 3P42A 4WJQA 2JJQA 4YCUA 1J0GA 5C0XH 1K3RA 3I90A 1UEAB 5HGQA 1S5BD 1FR3A 4JI2L 3BS1A 3NPPA 4P71A 1E2ZA 1UWVA 2B63B 4A3GG 4DXFA 4MNOA 1WYWB 3R8BA 4XX5A 2R92B 1HNXL 3QARA 4UDUC 3HM3A 4YTPB 3KLSX 3J7YW 4BFRA 2K03A 2HD3A 4HSPA 1WJNA 4CO7A 3KUPA 2BQQA 5MPOA 1BO0A 4QCLA 3VQIA 5HY6A 4C56C 4HROA 4YY3L 2LXCA 3T1HL 4JX1C 4NMZA 4DUZL 4K14A 1TBEA 3WALA 4BS9A 2PMVA 4HMIA 3CRLC 4HWIB 4IPGA 2PEAA 3CU7A 2QMTA 1UBQA 1AE2A 2B2WA 2FINB 5ELBA 4HPMB 4NXML 1AH9A 2L76A 1GKHA 2L4NA 4P74A 1ZGUB 1X3FA 2INNE 2K14A 3MEHA 1MG4A 1E0BA 2F0QA 2DNFA 2VQFQ 2EYLA 4P7IA 4WWOA 2L12A 4HAEA 3HOZB 3Q8DA 2LMCA 1VF7A 1PYSB 5CV7A 5M5XB 4C3IB 4ALPA 3NSWA 1FEHA 2F3VA 4XQQA 4QGUA 1PH6A 2EDGA 1ISNA 1C4AA 2IGDA 4HJKA 1BDOA 3HOWG 1NAPA 3LDZE 2ALYB 5D65A 1EIHA 4IKGA 4DR5Q 4DR3Q 4LF4Q 2PE6B 4NAWA 1PH8A 4GZYC 5C3EG 3HVDA 4ZRZA 1RRBA 1GOZA 2JA8B 3L0WB 5M3FB 1G6JA 3GP7A 1VQAA 3C1FA 3I73A 3HOXH 1P7FA 4DF7A 4FN2A 3J81E 1LT4D 5C4JB 2X8XX 5FLMG 2H5XA 3OW7A 2A68D 3S2AA 2JVCA 3T4AC 4LF9Q 1J8IA 4W9GA 2J0MA 2QIEB 3VR6A 2YU9B 2PQEA 1SYGA 2HUGA 5M5WB 3S1MB 4MGKE 3ULJA 4BBRG 1IPGA 3TBLD 1ONLA 4BKGA 1Q82C 5G2NA 4OO1H 2E8GA 5EE1A 5IP7H 2N4FA 2LY7A 1UF0A 5E3FA 5CC4A 3PPAA 1D1KA 3CCUA 4QL5A 4B6WA 3VH4B 1WY8A 4URKA 5LHY1 3W1SA 2KC2A 2KJHB 2N9XA 2DZIA 3IAYA 3AU4A 3ZGZA 3RZDB 2LKVA 4XDXA 3TN2A 3UDIA 4JI5Q 3RCZA 1VQBA 1XCTL 1SSNA 2RDHA 1SE2A 2IWHA 3S17B 1I3QB 4GNXC 3MTNB 3CKIB 4IUMB 4A3KG 4MGYE 2Y5BB 3W1GA 3O65B 3ZNID 5AUIA 2YTVA 1YI2A 4QMGA 3HOYB 2FCQA 2DHZA 1X3PA 2JYTA 2KDMA 2KHIA 3NUHB 3E6ZX 2N0SB 4WH4A 1XF5L 1V5OA 4UP8A 1WGRA 4AJWA 4KN7C 2JN4A 2MJEA 2DNEA 1GD7A 2Y5PA 1A3TA 4DK5A 3VR3A 2WWZA 1FRRA 3FKIB 1XPRA 1CKNB 2YTYA 1YN5A 2Y5CA 4MHEA 3AU7A 1I94Q 3DMUA 2K8BA 3OSOA 2WNMA 4BA1I 2OQKA 1EO6A 3AE6B 2TMPA 5K36H 2DYBA 3RULA 4A6QA 1K28A 4R9WA 2X6GA 1MHHE 2K5PA 3I8ZA 2PZWA 3AI5A 3HKZE 3OPOA 3B2FA 1EEID 3Q8AA 2EIFA 1FGUA 4N9PA 1Q86C 1CSQA 2VXWA 3SVMA 1SNCA 3W9CB 1WVLA 1OXSC 2L0CA 3K0XA 4JBMA 5DPRA 3I7FA 4JL9A 4E6IA 1VRAB 1CHQD 2PKOA 5C1ZA 4JQWC 4GDKB 4XWTA 2G3QB 2NBVB 2H88B 3B9JA 1ENFA 1K52A 2NVYB 1YJNA 3S2HB 3F1ZA 4X64L 2O2LD 2CQOA 1AW7A 2ZNVB 4C3JH 1P8LA 2UXDL 3A9JB 4JI2Q 1PFMA 1KLUD 3PO3B 2BGFA 1HNXQ 2M19A 2HCCA 1J7CA 2WGSA 2KMMA 4RMFA 3OG5A 5J2RA 2YV5A 4F8MA 5LMUL 1PA6A 1TJEA 3AM9A 1CKMA 3AXCA 2VY3A 2MX2A 1G2SA 3C3LA 3AE4B 2SAKA 4N8X1 1VQFA 2M4NA 3MJ5A 2EJFC 3EIVA 3VYUA 4DR2L 3T1HQ 3DVGX 4ZKBB 4DUZQ 1QOBA 3CCRA 3B1LX 2LGIA 2BWFA 5IIFA 1HUMA 4MELA 3DBRB 2KCTA 3H8HA 4X57B 4YL8A 4C3HB 1RD9D 4NXMQ 4GKJL 1VCIA 4LK1C 4BBSB 2OHFA 3ZNZB 1C4PA 3W1YA 2K25A 4ME3A 1T9HA 1Y1WH 5CHFA 1XNQL 4O42A 1NY4A 1STNA 3DUZA 3GTLH 3UDFA 3TMEA 1D5MC 2WXFA 4JLCA 2KJXA 4HCSA 2CH4A 3I3CA 1L1OA 1LM8B 3PZ8A 1BBUA 4YCWA 2Q8TA 3NS1A 1D4BA 2LVQA 2XTIA 1B50A 1T0QC 2KC1A 1W2BA 1H9MA 1UE1A 4GLSC 3R7QA 5IKCM 1GUWA 2C5CA 1PTOB 4WWMA 4H0LC 3BG3A 4PMWA 2W3SA 4GMVA 3KF6A 4K6LA 3P20A 2W55A 1HJPA 4NNJB 3DBLI 4YSYB 2NN6G 1X3QA 5BYQA 4C80A 4IDIA 3VA7A 2KLGA 2C7MB 4RG1A 4FJVB 5AUKA 4K7WA 2MGSA 2DUDA 1WGHA 1WD1A 3EECA 3UGBB 4A3BB 5BYRA 2R7DA 1D6EC 5COYA 1BCPC 4G50A 2M56B 2A5UA 3V6CB 4KKIA 1EQRA 1OGWA 2IW3A 2WX1A 3N30A 4MM3A 4YT0B 2KEDA 2BS3B 4BBNC 1DGSA 3ZNHB 4TV3A 2WYQA 4GKKL 5JJKA 4ANWA 5C5LA 5HG2A 3ICEA 3S1RB 3HUIA 4MM3B 3I57A 3ZJUA 2HDLA 2UU9L 3Q8BA 5AJ3L 1TR5A 1IBXB 2FAZA 3RD4A 1LABA 3N9YC 2X69A 2F0LA 1N36L 2R7ZG 5T8IA 2FXQA 1QOHA 4EQNA 2JA5B 1AN8A 5CHWA 4BBNF 1F9QA 2QW7A 3T8MA 5DM73 4A76A 4DXAB 1NVID 3PUYA 1H9SB 5FLXc 2L11A 2PW7A 3MA2B 3WANA 4ANUA 4C00A 1KABA 4AYBG 3PSEB 1PTOD 3TEZA 2KTRB 1JROA 4FF3A 3WOEA 2XSCA 4DV6L 3GTGB 4JG2A 1V80A 3JAMc 3N1YC 2K75A 3U7DA 5JVG3 3SU8X 3I55A 2A69C 1OXUA 1PH1A 3IG3A 3QK0A 2KD0A 3AEBB 1IKMA 1QJOA 1JWAD 1GJXA 3NS8A 3N20C 4N58A 3V6EB 5DPWA 5ELOA 2MJDA 1IP9A 1OXXK 1D5ZC 3DBHB 2QA4A 4HVBA 1M94A 1PFSA 2F0TA 4JPBW 2LD9A 5IAAC 1YITA 3VHTC 1TKEA 3KVFB 3IL8A 2HT1A 1BBXC 3NTIA 1P0RA 3A1QA 2ZVNA 2NR2A 2KHJA 4A3CH 1S5FD 4X62L 2JF5A 4LTUA 1B1ZA 3ONSA 4MJSA 1SE9A 3BZDB 1V1PA 3V05A 4HIMA 3N3KB 4AWJA 4RFBA 2NBUA 3P2BA 3Q3MC 3OJ3A 4YSXB 4X64Q 1B8AA 2OEDA 1XYIA 3RLOA 4ABNA 1VQMA 2UU7A 3V60A 2UXDQ 1XPOA 2HD5B 4WFN3 4A3DH 1LO5D 3DOWA 3C0RB 1TY2A 4I7ZC 2GRIA 1U0LA 2KECA 5ISRA 2IX1A 3HM6X 2F0GA 3MTSA 4L23A 4XE0A 2V0GA 4L6TB 2DYOA 3APFA 5LMUQ 3WDNA 3RUZA 3J81L 1M90C 1DYQA 4RGNA 2DAFA 3PGZA 4GDLA 2KQ7A 3HHMA 1B4OA 1ZOYB 2NBFA 1WE7A 3SE0A 2JX5A 2IT1A 4CHTB 3M4OH 3AECB 3GD7A 2MEKA 2GVAA 2X6LA 2HE7A 2K6AA 4GKJQ 2LEKA 2D3CA 2L55A 1HR0W 4M8NA 1PYBA 4F87A 2LVPA 2EMTA 1XNQQ 2IY1B 2V4IB 3MXUA 2K1FA 4IFDJ 1VQ6A 3RNGC 1MHXA 2MLBA 1EFWA 1B53A 2DGYA 2WV6D 1JRUA 4IWQA 2N9EB 4BKTA 4DAYA 2IO0B 2JY6A 3SEBA 1PFBA 1CZGA 3BDCA 1A15A 2HDEA 2NVTB 2O2VB 3U4ZA 1F2MA 4BY7G 2IO3B 4PZ7A 2K04A 4A3JH 1BUIC 1WZ3A 1YNTE 2RSOA 3A7AB 4A3IH 2WXGA 2M2LA 3T3NA 3M4YA 3H6MA 3MXNB 4FF2A 2JA6B 1SAPA 4QIWB 1WJ6A 1ZUD2 2LVOA 1LLRD 5I6YA 3M9BA 4Y7NH 4PS7A 4DA2A 2EY1A 1FFVA 1LT3D 3Q8FA 3GB1A 3PCOB 3VUYA 1PVOA 1IBMQ 3K7UC 3TL5A 3ZYYX 1K8OA 2CWAA 1H95A 2CFMA 3M7NA 3E9IA 4HRSA 3U8ZA 4IM3A 3BZCA 1C48A 1E8YA 3IAM1 1PV4A 1WFQA 3GTQH 3DBSA 3RUIB 1K0SA 4RA8A 3H0GH 3KF8B 3FAHA 1MG8A 4M8MA 1A0IA 1LT5D 1PRTF 5T1GA 3NBHA 3QB3A 1V1OA 3H7SA 1GUSA 2PZUA 2V3NA 3Q8EA 3UIOB 4GKKQ 1PMRA 3PV0A 3I4NG 3NP8A 2C35B 4R4IA 4RM8A 1QWYA 1ASZA 2UU9Q 1F2RC 1G6PA 4FO2A 3V3XA 2F0WA 5AJ3Q 2C60A 1QUQB 3AFPA 4KIKB 4HLEA 2Q8RE 4LF6L 1JQ4A 3J7AF 2WXHA 1TU2B 3CPFA 2KA7A 1SB3C 3QX1A 4C7YA 1GB4A 1E0ZA 2MWSB 1N36Q 1K8AC 4B9KA 2NBWB 3RZFA 4AUQC 1EY7A 1WE6A 2HJ1A 1QNUA 2IO2B 4JI3L 5C3EH 4B3TL 1XPUA 1TIID 1SE4A 5FO7B 2Q2TA 4WIPA 1JQYD 2PPHA 3VUWA 1C4QA 5IP9G 3G4SA 4JIOU 4JI0L 3VTVA 2I2YA 1X1MA 1O7IA 3HZXA 4RCNA 3VFKA 2VNUD 1DCZA 5ELCA 2LJ5A 5FLMH 1E24A 4DV6Q 4HKQA 3TDQA 2K5WA 4C3JB 1XMQL 3CRKC 4DAMA 1KNAA 4WQMA 3TP8A 1W3SA 3VYSA 3U7ZA 3KBXA 1A2UA 3AE3B 2CW0C 4P73A 2K50A 1PH4A 1UBIA 2K8CA 2N1WA 3QWZB 4WJNA 2D2CC 4CYEA 1DOLA 5EGTA 1WRIA 3ZW3A 3CCVA 1U4LA 3NJTA 2WLBA 4A75A 1YJ9A 1XEEA 1V1QA 2WAQG 3H3VI 2Z4IA 3IRBA 1TKWB 1F0ZA 4X62Q 3D32A 3GE3C 1CSPA 1T0SC 3A8KE 1S72A 4MGZE 4IW0A 3VUXA 2FHTA 5C4XG 1Q12A 1VR9A 3I9V1 4DHZB 3H7PA 1Y1WB 1IYVA 3IVFA 4A3KH 2MP2B 4DWFA 2F0KA 3AEEB 3VTUA 2UUAL 3APCA 3K59A 1ZPSA 1TVXA 3RYTA 1EY9A 5FKAC 2QILA 2MO1A 2LRUA 4MACA 2D62A 2Z8LA 3E9HA 3PUWA 4ZLTF 3IFDA 4AIMA 2LWPA 4IOIE 2JWZA 1LM0A 4K8IA 2G9HD 5HURA 5C23A 1YBYA 2IGGA 2LMCB 3NWSA 3J81j 3K5OA 1RFAA 3NHHA 2UUCL 4LNIA 2L1BA 1E8XA 4XT3B 1X6OA 3B0AA 3BVZA 2JA7H 1FCLA 4IALA 5EKLA 3SK8A 3BVMA 3X3MA 2CCZA 2A19A 3J81i 3ND8A 3TS2A 1N5WA 3PIOA 2K9XA 2MBOA 4A3MG 4J6IA 3PF5A 3N6RA 4A93G 1E6EB 1ILPA 2ZJDA 3E5SA 4LJPB 4C4VA 2G45B 4NZLB 3NG0A 2G5DA 4RKBA 3K5NA 2LUMA 4EZLA 1YJJA 2GBKA 3EQLC 1SMYD 1KJTA 5GMVA 3PQIA 5EKIA 2A4ZA 1S5DD 2H4OA 4R4QA 1TWCH 3HRZC 2MBHA 1NYRA 4K7SA 2EOTA 1EWIA 1CA6A 1VQPA 3RNBC 1PZID 3FILB 2JSVX 3W3AA 1OTCA 4TMAB 4A3LG 2RMMA 3OAWA 2KENA 2VZKB 3QCAA 4OIJA 1XLOA 1H9JA 5LNK1 1BOSA 5EKKA 4JBKA 4IPDA 3KLWA 4M00A 1EY6A 5EPLA 1UE6A 3PIPA 1KTKA 1V8QA 5L83A 1Z6HA 3L7ZC 4KY6A 2O6VD 1VZ6A 2AYOB 4P2CB 3S1QH 3WA0A 3ML8A 1PDXA 3BZKA 1WXQA 3TZUA 3H1UA 1YN4A 3LB8C 2BYVE 1JOKA 3UE1A 4YSZB 5DNFA 1DOYA 3LWEA 1X65A 3OYYA 4EFOA 3L16A 1IZ6A 1SIFA 4FXCA 1XX8A 4NB3A 1WOCA 4W9DA 2MPMA 1NI2A 5IOCA 2LFIA 1GJZA 4JOIA 1M4VA 2RDFA 2QC8A 1B3AA 2DZJA 3FRPB 3CXCA 4KDLB 4CKEA 3SR1A 1T6BX 3HOUG 1STGA 1TY0A 4YHHL 4DV1L 1QLBB 2D2QA 1EIFA 1LTLA 4LF6Q 2B8GA 5KNDA 4HJGE 4KSKC 4X3KA 4RNAA 2G4DB 5GADC 2QCZA 1EWHA 4B0MA 2BDNA 4YTMB 1RIPA 5HFYA 2WB1G 4JI3Q 3V2TA 1U4RA 2B8FA 2R61A 4LW1A 4B3TQ 4L1BA 4US9A 4ASWC 3SXHA 1N34L 1KL9A 1U9RA 1Q10A 4JI0Q 1F1HA 3V96A 1I5FA 5I2XA 2KVRA 4H02A 2BCOA 1FXAA 1OO9B 5DLQE 2VZKD 4MDKE 4BKSD 1XWEA 4E74A 5IGDA 3W2DA 1QOFA 4L63B 1XMQQ 3R7RA 3JVZX 3AV8A 1AZQA 5C6AA 1CT1D 2AQ2B 5KGUA 5D6JB 2A6ED 3L4PA 4W9JA 2OCEA 3A33B 3TCAA 4RM9A 3A54A 3F2BA 3J80E 4ICVA 2QF7A 4IUUA 4MTNA 4OVVA 3DEPA 2A6HD 1V9JA 3RMKC 3WIMA 1Y8PB 3JSVA 4KZ0A 1WTOA 1GUGA 1Z47A 1RFKA 1ICFB 2L00B 1QZHA 5KRUA 2QDFA 2FCMA 2WU2B 3X23A 4KSLC 2GA4B 2LI5A 4NAMA 2JP1A 4US8A 4WAFA 2UXBL 2O4XA 4GB9A 3HIZA 3M4OB 3OHXC 4GOPA 3U9OA 1Q7YC 2KMCA 1G91A 1LTRD 3CC2A 4K3CA 4C1NK 4KI0A 3ULLA 5IT9E 4FBJB 1CZWA 1FD7D 2W82A 4DU9A 1RTOA 1SIJA 1VF5C 2ZCBA 1E7VA 1Q1EA 3QIJA 2MHJA 1FGBD 1I4PA 4K5WA 2V9HA 2WU5B 4MSMB 2UUAQ 4B08A 2Q2UA 1CM9A 1K53A 2QKIC 5JEAJ 5IGCA 3Q6BA 2A73B 2C9WB 3A7LA 2B2TC 2JEBI 2JZPA 3X3NA 1ZW7A 2AQ3B 2DWQA 2WXIA 2MJ8A 2EKEC 1VQ7A 1K8MA 3NHEB 3ALBA 4CJ2C 1X32A 1Y1VG 3JAMi 4NQKE 2MO0A 1PHJA 4PT5A 4A3JB 1VDVA 2UUCQ 4A3IB 1PXUA 1ZXIA 2Z0DB 3X0WA 2JXMB 4I65A 4C2MH 4Y7NB 1P1AA 1UD7A 2BVCA 2KN4A 1B9MA 3D6WA 4P72A 5LXHA 4QAYA 2EY2A 5JPNC 4K1RB 1X56A 1JOOA 1SLJA 2VW9A 3P4RB 3GTQB 4YXDB 4FULA 3H0GB 2DJFC 3KJOA 3C8YA 3J80c 4GLVB 1WTRA 2MCNB 1PFDA 2INPE 4FJYA 4FJZA 1HZAA 2GI9A 2B2UA 4RF0A 1JWBD 1MFWA 2ZNVC 2BDOA 3NZ3A 2XK5A 1C7YA 3MC8A 4MT5A 1WMHA 3D8GA 4C1NI 3CCQA 3I4MH 2JWUA 1UNSA 1ENAA 4DK0A 1TZ1A 4W9LA 4YWKA 4YWMA 3PGEA 3K8AA 1AZPA 2Y0SG 2F1MA 4EZKA 2KJRA 3E9SA 1VJKA 1N9WA 2R2QA 4EZJA 2ATWA 1KF6B 2XEWA 4P1CC 2K05A 2E2IH 1UELA 4N8FA 5IT9c 3GOEA 5IOIA 3UI2A 3A8IE 4HR7B 2MBQA 2F4IA 3FPPA 3CQZB 1QE6A 3CPWA 4RGTA 3NUCA 4XQJA 2FMMA 4F7XA 2GN5A 1EYDA 5C3EB 3DVNV 3EFUA 4HCPB 5E6OA 4EQPA 3MXPA 1OEYJ 4A20A 1V6EA 1BCPB 2WKDA 4YWLA 1LT6D 4A4IA 1V49A 4N6EB 3N32A 2LGDA 4MSQB 4NAWB 4EKUA 1D1IA 1YHAA 1ET6A 3BK1A 1CFMA 2QGQA 2XGTA 1E8ZA 3E0JA 4IURA 3PUVA 5KEEA 2IYDB 2AHOB 2PNRC 5LMNW 2FIDA 5LXIB 5BR8L 2Q2HA 1XLPA 2KOXA 2B63G 3BK2A 3AEFB 2SNSA 4II2B 3QJYA 2R92G 3UINB 4RMAA 3S1NH 2LSSA 1BT0A 1EWYC 2WXLA 3Q8CA 2A6EC 4YHHQ 4DV1Q 2NVUI 1S1QB 2B3AA 1FNWA 3ZLZA 1STHA 5D3IB 4PG3A 5JHBA 3PLVA 4KMUC 2A6HC 5BN5A 1WGGA 1WH3A 2D5GA 1FYCA 2XBBC 2FNJB 4PMCA 5NUCA 3CMAA 4JOIC 3SK5A 1RWSA 5D2MB 1N34Q 2NMQA 1XTCD 3U4VA 3L9AX 2ASBA 1EY4A 2NZHA 1RJTA 3ONAB 2UUBL 1PGAA 4ANVA 3FPUB 2HQLA 3HOVH 1JOQA 1VZ8A 5T1IA 4JI8Q 4XTCS 1VQJA 2JU6X 3HOZG 3K7AH 5D94A 3AN1A 1F9JA 4OELB 4C3IG 4DN4M 2F52A 3KWVA 1BCPD 1P3QU 3C1EA 4DR1L 1K0RA 2C9OA 4S3SA 3Q69A 1UE7A 1SFOH 1WX8A 2RHSB 2JA7B 2PYKA 3ITPA 4POGA 2UXBQ 1C0AA 2DLBA 4HDQA 4AOFA 1AWDA 3RPFC 4XIGS 2R6GA 2JA8G 1KDAA 1I6HH 2BS2B 5M3FG 1SEBD 2SEBD 1AYFA 3FC4A 4B0EA 4TSSA 5M5YB 1DOIA 3U52E 5D14A 4APVA 4QUFA 3MHZA 1R9TH 5AZGA 1PFNA 4PV1C 3O13A 1WD0A 1S3SG 4ZRIA 4HK2A 1E7UA 2K3UA 3K5MA 1YEZA 3NXWA 3CMEA 1EQTA 5IP9H 2F0OA 3LNNA 1OXTA 1K3BC 3ER0A 2N3SA 3ZJVA 1LFDA 1TWCB 4UPAA 1MJCA 4GOPC 1OQQA 1V5TA 1DOXA 3ECIA 2BT6A 3J81c 1FJGL 3M63B 2XRSD 2CR5A 1HRJA 4KV6A 1HTQA 4A3FG 3L2PA 2MA9B 1TXYA 2R2OA 4ZOHC 3QR8A 2WFWA 5EBCA 1EQVA 5CX3A 1E90A 4WWPA 3QA8A 4OZCA 2BS4B 2FCSA 1O7ZA 1BUVT 4AYBE 5IYCH 1WSPA 4NDXA 5TSSA 2D11A 2A69D 1MHWC 1B44D 2N78A 3S1QB 4HMJA 2SNMA 3NOBA 1SYEA 1WYDA 2PO4A 4XDCA 3KLRA 1HHVA 4HIDA 1HNZL 5H8YE 3HOYG 5IGGA 2ZTEA 2IO1B 3AE2B 2F03A 3I4LA 2BF8B 1RF2D 3KW5B 4IUQA 1IW7C 4I6PA 3ZTDA 2AL6A 4TVAB 3FKIG 2LGYA 1ESRA 1H4RA 3ERSX 4PS3A 1OQRA 2JQOA 1CQFA 2F0MA 2FFKB 3NVZA 4NW2A 4M01A 1E8WA 4K3BA 2LXJA 4FXDA 2KZRA 3ZJTA 1Q90A 4YIJA 1G6ZA 4EOYA 4ID6A 1A70A 1MJDA 1PRTB 3BWUD 5I6WA 2M00A 4F7ZA 4M0WA 2B2UC 1O7YA 3KK7A 4DV4L 2JZ3B 5C44H 1PZKD 1EF1A 4B3RL 4X3UA 4OWTB 1KIXA 1HQMC 3VRBB 2F3IA 1HZCA 4HEDA 2L0TA 4YWGG 1G51A 1HH2P 5CTRC 2Z9HA 2MBBB 3OMCA 3J80L 3AULA 4IC7B 4LCDE 3TUOA 2XVSA 4A55A 5JVH3 1U4PA 4N9F4 5G5HA 2MQHA 3KF6B 5CV4A 2B3GA 1A6XA 4PQXA 2B2WC 3K5LA 1R4NI 2KX0A 4N59A 3H6NA 2B76B 1Z9FA 4JPSA 2PPBC 1T5EA 5BR8Q 2B39A 1QOAA 1NJIC 2K5VA 2J0JA 3PO3G 1EU3A 1D3ZA 3AEGB 3TBIB 3NTHA 3ZRFA 4HN7A 4OVZA 1YX5B 3F2UA 3OLMD 4HIOA 1WGYA 2KVMA 2ZXPA 5IT9L 2EVBA 2JRHA 2RPQA 4M8AA 2RKSA 1F52A 3I63C 1JJ2A 2L9HA 1IBML 2NPTA 4II3B 5BN3A 2WKCA 2QSDA 2LGXA 2OT2A 3PO2B 4JCVE 3OOCA 1IYUA 4HTHA 3CCMA 1EYGA 3HKZB 1WCMB 4ZAIA 2MFIA 1TWFH 2D3BA 3K9PB 3CCEA 5D3DA 4ZQ3A 3CSTA 2LFNA 3CCSA 1QG7A 4C3HG 4OWWB 3U2SC 4BBSG 4LF8L 3DPDA 2UUBQ 2WINB 4XZ4A 1FO4A 4IM0A 1F2LA 1Y8NB 2NTSA 2BW2A 3PHXB 2PMZE 4IO9A 3LYYA 2IX0A 2AWOA 3RMHA 1C9OA 1NUCA 2IGHA 5FO8B 5KYIA 2E2JH 4KY5A 2ZPYA 2CKZB 3S2DH 3W5UB 5KHOA 3TEWA 5FR3A 2M8SA 2WXKA 1EUJA 4DR1Q 4KV2A 4DV7L 2DX5B 3HFZB 1B9RA 1CQVA 1RODA 1SSOA 4H44C 5HGTA 4C2MB 1A63A 1HZ5A 2GBMA 3KYDD 3IAS1 4LNOA 1PZJD 1Y56A 2EJGC 4X6AH 2ZXRA 1MGSA 1FFUA 1KFYB 3T51B 5G5GA 2PVOD 1WYGA 3AE1B 4ZUJA 3W1SC 1K8RB 1FIQA 3OIPA 3MFGA 1NENB 3MHBA 1G8ZD 4WJPA 2RF4A 4KKUA 3CWIA 3SD5A 4PMBA 4A3BG 1KM7A 3RNEC 4OIKA 3TEXA 4ZHPA 1NDDA 3KYCD 2F3WA 3R93A 3L54A 5BO4B 1GXDC 2WDQB 4ZHOA 3RI7C 2N88A 5IYDH 3I4MB 4LDTB 1Q8IA 1WTQA 1F2YA 2NWGA 3DWQA 3A1QB 1NE3A 3HEJA 3KLSA 4ZK9B 3KJPA 1TKGA 2KCMA 4RKLA 4DK3C 2WXPA 4WJOA 3LXFA 1FJGQ 5JH5C 2F0EA 1N63A 4MJSB 1JWMD 1JORA 3IFWB 1V1PB 3NTKA 1SR3A 5A2QE 2ID0A 4FDBA 2E2IB 1UWXA 1YMHE 4JWSC 5M3MH 4E71A 3EA6A 3QOJA 4LF7Q 4DR4L 3L13A 4JW0A 4HJ5A 2C7HA 5J18A 4GU2A 4XWWA 3RNUA 3M95A 4A8XC 4DQOC 4IOAA 2CW0D 2JA5G 4M02A 4BWGB 1T0YA 2KWDA 4A3EH 1SNDA 2AWNA 3GS2A 1HNZQ 3AB9A 2GVBA 3AE8B 4ZKCB 2KWCA 3NENA 2RBMA 2I5LX 2FCNA 4GDLB 3TP7A 2K7VA 2OQ0A 2Q2IA 1DGJA 2WDRB 3B2GA 4MIUA 4DGZA 1V97A 3MWYW 2B2VA 5CMDA 1N8RC 4EGVA 3AH7A 1GPXA 1C79A 2WAQE 4CDEC 3SK6A 3K80C 3RLFA 3RLNA 4GN1A 3Q3JA 3HOXB 1SMXA 1VQEA 4WURA 2WIIB 1N33L 1LXDA 4GN4B 3DWGC 4G7ZC 4KZCA 2AUKA 4ANXA 1Y1VH 4IN3A 1QKZA 4KGRA 4LDTD 4BY1H 4DV4Q 5CYUA 3MXGA 1WIAA 2VUMH 2R93H 4DAYB 4B3RQ 2MQJA 4RAUC 2J4XA 1MIUA 3E3XA 1E2VA 2PLPA 1VQNA 2KWVB 2WS3B 4OVUA 4A3PA 2KCNA 4R3DA 5DEHA 1AP0A 2MRPA 4DHJB 3HOVB 1S40A 4CBVA 2FBWB 1J19A 2IPKD 3K7AB 3B6YA 4K7UA 3D3RA 4POFA 1FXTB 5E6PA 3B08A 4LF5L 3GTOH 2BPSA 4A3GH 5I9PA 3DWAA 2KWUB 3J80i 5IY0A 2KFKA 1WR6E 1VDZA 3OMGA 1PRTC 2WP8J 2MNAA 2ZJPA 2EXDA 1NI3A 1L1OC 1L5PA 4EUTA 1V2YA 2G4SA 3DVGY 3PSIA 1VQ8A 1SFOB 1G2TA 2VB2X 2JXXA 3PRMB 4LLGM 4OEMB 3K6OA 1BBWA 2KYWA 5KHQA 3BU2A 1KD1C 2ZPNA 2VL6A 2NN6I 3NBHB 5LL6X 2W9NA 4K8JA 2RDBC 2KXJA 1J6QA 2CHXA 4IFDG 1C4CA 3JW0X 1NBWA 1Y8RC 2L83A 1S3OA 2LXKA 1R9TB 2Z4HA 1ESFA 3SHQA 4LF8Q 3ML9A 2D0PA 3RFZB 2FJ2A 3U9SA 5EAYA 2D07B 1DXMA 3LGJA 2KX3A 4J15A 3VR2A 2D10A 3HRDD 1TGZB 3M3YH 2W3RA 2GOWA 1VQLA 4AP4C 1YHBA 4GN3B 5IP7G 2KK8A 1S4ZA 3HOWH 1JRPA 4XYCA 5EPJA 2VH2A 4DV7Q 2YYZA 4DHJD 4KTAA 4W9HA 2L15A 3KUDB 4JI6Q 2ACZB 3ZIMA 4WWNA 1XTDA 4KHPL 3CD6A 3NVYA 1NR4A 2JT4B 3H9DA 2JA6G 1KNEA 4LNKA 5H1SE 4JV5L 2L32A 1FXIA 3RZOH 1I4GA 3U58A 1MI0A 1UEBA 2I46A 3TP5A 3BDLA 4HJ9A 3D4DA 5A35A 4W9FA 1QCBD 2BKFA 2MUYA 1E7PB 5TR5A 4GS3A 5LL6S 4KGSA 2KUMA 2QCPX 1JICA 4CKCA 2F0SA 4EE2A 4BBRH 1KQSA 2V1YA 1B70B 4J1MA 2DZKA 1WXSA 3HKSA 1N5XA 3GZNI 3HVZA 1PTOF 2KO3A 3QQ8B 3OIQA 2WB1E 2N55A 4B9WA 1ASYA 3H3VC 3RR5A 2NYZD 2DENB 2JYEA 1I6VC 4LNQA 2MBEA 3H7PB 1B9NA 2QEXA 4GLAC 4ZRJA 5C4ZA 3VAWA 2KTFA 4DR4Q 4IZ8A 3UQAA 1ICWA 1HPCA 1CA5A 2XRQD 1RDPD 3N52A 1WJUA 1LTBD 2BH2A 5C44B 4JYAQ 3GTLB 2HIXA 1BNZA 4G57A 4R8NA 2RSNA 1YZ6A 2EYMA 4MN3A 3E56A 2ZVOA 1A3UA 1HXYD 1PH9A 2K8HA 4PS8A 2N8NA 3IT6B 1YQBA 2I07B 3GO5A 1MPEA 2BE5C 1WZ0A 1CKOA 2F4VL 2KOLA 4C3JG 1TS3A 2PQAA 3NQIA 3SGIA 1MVKA 4TUUA 1ZKOA 4ZDVA 1Q1OA 5EDSA 2AMCB 2NS5A 2QHOA 4A3OA 2LXAA 1PLFA 4R4CA 4HPLB 4C4VB 1N33Q 4QY7A 1FPYA 3OTOL 1BXTA 1Z7TA 4TRDA 1EOTA 4A3FH 1TWAH 1XD3B 2GBJA 1UZXB 5EE3A 2IDYA 1SN8A 4OHJA 1JMLA 1TWFB 3PUXA 3FKYA 4JE3B 5CV9A 3S24A 3BYTB 3T13A 4B9XA 4XT1B 1XLNA 4IWPA 3VR8B 1WGDA 3RZDH 2DAJA 2BYTA 3FDTA 1II3A 1YNJC 2YTXA 5HKHA 1A62A 1ILQA 4YCVA 3S17H 1Y1WG 2O6VA 1EFID 3ZRCA 3BINA 1U4AA 3AB5A 5J1ZA 3CC7A 1ET9A 3VYRA 4RH6A 1SYFA 2PW5A 1YJWA 4XQNA 4L5RC 1HNWL 1E7ZA 3P1HA 2EYJA 2KDBA 3AE9B 3UIPB 1A5RA 1JJGA 4LF5Q 1LTTD 1IBLL 4R4TA 2E2JB 4L5QA 2KQSA 4WAAA 3BYYB 3S2DB 2N9KA 2JA9A 3FMCA 4IJHA 4K0KQ 1KOTA 1JB3A 4UY8C 4K6DA 2OJWA 1CK1A 1X3GA 1SJHD 1I7HA 5GXGB 1HQRD 1F9PA 3SDLC 2IHFA 4ITKA 1VQ5A 3H91A 4WQOB 1IL8A 1YNNC 1MJEA 1J7AA 4A90A 4WJ4A 2LHDA 3TIXA 3CC4A 5AEKB 2UYZB 5JHAA 3I91A 3C19A 4J8QA 4Y52H 1JJCB 1BVSA 4CDFC 4TKOB 1NBFC 2O5IC 1E10A 4PNYA 3RNCC 2Y0SE 4IFDI 3GTJH 2B2YA 3A0JA 1HA5A 5CR3A 1C3TA 1L0WA 1J8CA 1IHZA 2I1KA 4BKSA 1QOGA 4TQ0A 1I4HA 5J17A 2M1MA 3UDGA 4ULLA 3S2HH 1EF5A 4XYQA 5M3MB 1YOVB 2KVZA 1TS2A 3NQTA 2BH8A 4ZCKA 4XC2A 2FIFA 3Q24A 4FNFA 2TSSA 4BOSC 1GC6A 2R7FA 1VS0A 3R2TA 1ZE3D 5CGKA 2YEPF 3OJ4B 1EUVB 4KHPQ 3AEAB 1ZYRC 2NN6H 1WTXA 1V8CA 2HDMA 3KBGA 3D31A 2MW5A 4A3EB 1VQKA 4JV5Q 1JWSD 3J7A5 3G6JB 2SDFA 3F8TA 1C78A 3DQVA 4JI8L 3JSVB 2NTTA 4EX5A 1HCZA 4QQBX 4A3DB 1R7SA 4H2AA 1VZ7A 5BMIA 5EE9A 2ICIA 3ZJYC 4ZRPA 5AZHA 1SNQA 2CU3A 3MHSD 1VCBA 1VQDA 1PQSA 4BBSH 4QF4A 1ML0D 3D4RA 3HG9A 4IUPA 5CV8A 4CKBA 4GOPB 4DFAA 1EIYB 1XNRL 3AEVA 2YVCA 4B3ML 3DVNU 1TIFA 1DM0B 3N1ZC 1AFPA 4DUYL 1D7QA 2QDLA 3DWPA 3S15H 1RYJA 4GXBA 4GNXA 3RZWC 3CP0A 1M8AA 4CDCC 4KKTA 2F0DA 4ZYSA 3T16A 4L2YA 1CHPD 1FCCC 4LFCL 4KKSA 4BY1B 4RF1A 3W5VB 3WAMA 2R7ZH 5ELFA 2VUMB 2R93B 1JT8A 3A9KA 4X66L 4A3CG 2WX0A 1QT9A 1WXVA 3A4SC 5FO9B 2EYFA 3SR6A 4OXPA 1PTOH 2XWBB 4ZRQA 3TREA 3NE5B 3J7AV 4HDOA 4N9TA 1EZ6A 5AZFA 3K0YA 1TT5B 3JC66 2Q5WD 2K39A 3PS6A 2B29A 1J7BA 2K4KA 1TQOA 1RAXA 3DWMA 2F4VQ 3BDOA 3GTOB 4A3GB 1IYJB 4C7ZA 3I5JC 5D7GA 1GO3E 1BF4A 1GNUA 3AYHB 2I5MX 4NP5A 4DK1A 2CWPA 4LJZC 1I4RA 4IPCA 1C76A 3CIRB 3TP6A 3H3VH 4R4OA 5GQOA 4JI1L 2JSOA 1I4XA 1NCVA 1YX6B 2KKCA 3OTOQ 5G3LF 2NZ1D 1C77A 3S1RH 2XK5B 1MBYA 2L3ZA 3PRPB 1ZXHA 3Q3OC 2F0FA 1IXRA 2NVQH 5JEAG 5H92C 2NUCA 3DM3A 5FOBB 1CMXB 4CDDC 1T5XD 4BAXA 1STAA 3FHWA 4Q2JA 1L6VA 2JA5H 3SFEB 1EY0A 4DPGA 1VQOA 1EIGA 1RHPA 2IBIB 1EYAA 3M3YB 1R4NB 2WXOA 2AWTA 1HNWQ 3VXWA 3KDFA 5KNCA 1HZ9A 1IBLQ 2LASA 1ROEA 3HOWB 4TKNA 2EYPA 2KDIA 2V3PA 4ME5A 3GTGH 1YJ1A 2CHWA 2WXJA 2YLMA 3DBLB 3QAQA 4LNNA 1P98A 2K5QA 1RTNA 2HQEA 3BIID 1TWGH 4GN5A 2RVLA 5LMNL 4A3JG 1JB7A 2KDEB 5E4XA 4A3IG 2EMSA 2VB3X 4K2LA 1IW7D 1TYGB 5ELNA 2RQXA 3A8JE 3L10B 3TS0A 2WP9B 1L2NA 3RZOB 3UE0A 3P1MA 3W5OA 3S16H 4DV5L 2K6QA 1SE8A 2L8JA 5C3XA 5IODA 4AJYB 4B95A 3Q22A 2X38A 2RCFA 1K8GA 2KACA 2LS01 3MC0B 3LJ3A 4NJ6A 4FF4A 4AS1A 2Z6BA 1GUOA 3LWUA 3H0GG 1OQYA 4NQLB 1SYDA 1WX9A 2QJLA 3RNAC 4BBRB 1OEYA 4DV3Q 1V86A 1XQQA 4KJNA 4L5TA 1WJJA 3IHPC 5BN4A 1H9RA 1NMGA 2GB1A 2MJ3A 1SROA 2OTJA 1NYQA 3VR5A 1P7EA 1ZEQX 3STBC 2PJHA 2L7RA 1LYLA 4NPSA 4DNIA 1XXGA 4BY7H 2OWOA 3C2PA 3UDXA 3KUCB 2KJ6A 5IWAL 3A4RA 1P16A 3CSFA 1C1YB 1QVGA 1IKLA 4DAPA 2BKRB 1TWHH 2B2YC 4RWSC 3K57A 1N32L 2O5JC 2WDTB 1DONA 4W9KA 4A3KB 1EY5A 5J3BA 1HZ6A 3GDEA 2J53A 4CGYB 3IT4B 3EROA 4F1SA 4KVGB 4O0AA 3AE7B 4F8CB 2BA1A 1L4ZB 3I3TB 1SGHA 2KMAA 2OJRA 3KUZA 4RGOS 3PMFA 4HPPA 4IFDH 5IA7A 1QB5D 2INDC 3EFXD 4LMQD 1I42A 3EJIA 2UXCL 3DEOA 2JYOA 1XNRQ 4UHVA 4FF1A 2K6DB 2JPHA 4B3MQ 2FUHB 1FNVA 2I0QA 2MP1A 3QG1A 3I4NH 4DUYQ 3WCQA 3MJWA 1NTGA 2WXNA 1JCKB 1UUPA 1UH6A 1PGXA 1OFFA 4S0RA 2LUEA 5GAEC 3A5ZB 4ZYNA 2RD0A 1H9KA 4ZRKA 5IYBG 4A3FB 1TWAB 1SNMA 4LFCQ 1D8LA 2I5HA 2VS1A 3VDZA 1F9RA 4R8IA 4EQOA 1YNXA 4X66Q 3Q23A 2NVTH 3ZXRA 3WWVA 3GTMH 4KX6B 2FE8A 1IUEA 3J7ZC 4J6HA 1VQHA 4OWXB 1ZDVA 4OL7A 5KYLA 5IGFA 1KDBA 1WTWA 2JA6H 5CV6A 3UF8A 2Z59B 1K83H 4KHZA 1WFYA 2E74C 2ZTCA 1XMOL 3ZDTA 3R66C 3C46A 2D3AA 3VTWA 1WTHA 2V1CC 4HKZE 4OONA 1PH7A 4LF7L 4I7AA 4V0BA 1VQGA 5L37A 1GM5A 1CJEA 3A55A 2AEHA 1UE5A 4BZAA 3ZDMC 2F0HA 2V4LA 5JAVA 4MZ9A 3S14H 1A8VA 4JI1Q 4L8JA 1KRHA 5EE0A 1NNXA 2EE1A 4PZ6A 4RHSA 2PW9A 4CQNA 1LGRA 1LTID 1W6JA 5JOBA 3URYA 2JA7G 1CKNA 4IUTA 4USAA 1V9PA 2QDBA 1U4MA 1JE4A 3MAQA 1E3PA 3TMPB 5C4XH 5DCNA 2N9PC 3NZSA 3QO2A 2RHQB 1HZBA 3P4SB 3GTJB 4BA2I 2IZVB 1WI0A 4TQ1A 1AARA 1TT2A 2RCNA 1R4MI 1V43A 4ICUA 1ZDXA 1ACCA 2L5TA 4D2KA 4W9IA 3NWTA 2BB6A 1P9DU 4HCNB 4LUOA 3L3OC 4M0WB 4LK0M 5JZEB 4IUNA 2G1EA 1YQ4B 4GDKA 1IGDA 1KDCA 2XIWA 2CJNA 3GV6A 1L1OB 1K51A 1NEKB 3RN5A 2HIVA 1DD2A 3EUB2 4NKLA 5LMNQ 2Z0SA 2FUG1 1OXVA 3PHWB 4H7BA 2BYFA 3SFDB 2ZW0A 2AUJD 3D4WA 1MKHA 3VDYA 4KDIC 3A9JA 3MVVA 1H8CA 2HTME 3AEDB 5C3JB 3ZTCA 2ZM6L 5I2YA 3H94A 4RGMA 4DV5Q 3PREA 4YY3Q 4A3MH 4Q5VA 1RLFA 4G0NB 1UGMA 2N7DA 4A93H 2KT7A 3K58A 1YJIA 1WXAA 2H89B 2EY6A 2KANA 2LGSA 3IBEA 1IYFA 2NPTB 1FRDA 4M1UB 1IGCA 2KNBA 1PUTA 5G55A 1Z5SB 3ZUNA 1K50A 2PCFB 1YIJA 1NMFA 3OWEB 4FXKC 5CBAE 1WF9A 1ZKHA 4X65L 2DZMA 5BMGA 2LJIA 3RD2A 2ENBA 3S15B 5FLXE 4P16A 3NELA 1YHQA 2NB0A 4WORA 2E5LL 2A68C 4A3LH 2EQSA 3DLLA 1E9MA 1IL2A 1L7YA 2M9VA 4DDID 3AFQA 2N49A 5IWAQ 2E2HH 1BQQT 3BJUA 2R7ZB 3JAME 2Q8IB 4REZA 3ETRA 1N32Q 3NVWA 1E22A 1WX7A 3U4EG 1SXTA 4R1JA 4JI7L 1TKYA 3P75A 2N7JA 3GE8C 1PGBA 2AX5A 3ZXVA 2XNAC 1GAQB 1R4QB 1PRTD 2Z0EB 3RN2A 4Z9CB 4P1BC 4RCOA 4AYBB 3QHTA 1ZP0B 4GGQA 2EYHA 4DV2L 3HP3A 2C5LC 1JWUD 3GTKH 5DPTA 4ARCA 4ARIA 3ZO5B 1AEXA 2WQYB 2JZZA 1SE3A 4KN4C 1F2ZA 4KLKA 5EQ0A 2G9DA 2UXCQ 3GZNB 5C5MA 2N7EA 1UGJA 3HK0A 3F2CA 1KRSA 5E1FA 2EZVA 3T3OA 2DY8A 1GUNA 3R2IA 2PTLA 4JI6L 2HTHA 2IY0B 4LNFA 3NEMA 1CZPA 3GQBA 1QZGA 1JALA 4MH0E 3QWNA 4XGAB 1X3EA 4DR6L 2DY7A 3PF4A 1E2WA 3HOUH 2K0PA 5IP4D 1VMCA 1MSHA 4IQZA 4FADA 3H15A 3CCLA 1XT9B 1CI3M 1MD2D 5EPKA 2NVQB 1BCPF 4P75A 1C9FA 3MEFA 3PO2G 3TRZA 3G48A 2CS4A 2ONQA 3HKZG 5AFWA 1WCMG 1VQ4A 4IM2A 2LZ6A 4W9EA 5EBDA 3GTPH 4NJ7A 3T53B 5C0XJ 1IBXA 5K5PA 3S9WA 1XMOQ 5I4DA 2RA4A 3T56B 1ENCA 3G71A 3FP9A 4FHKA 4JBWA 1K73C 1GC7A 3MP9A 4BXXG 2J7ZA 2WDVB 3EFCA 3NVVA 2OF1A 2K52A 2RDGA 5E6NA 1JMCA 2RPVA 1DZ1A 3AE5B 4EEWA 1H9SA 4QIWE 5FJ8G 4HJAA 1TS4A 4FLHA 1QILA 2J0TD 5L95C 1TWGB 3HGBA 3ZKJC 1SNPA 4JYAL 2JEAI 2KTRA 2D3GA 3VYTA 4LAAA 3G7LA 5LLIA 2EYOA 1LTGD 2H1EA 1O78A 1O7LA 4XDDA 5JJLA 3MC9A 3S16B 2K22A 2D0OA 3HS0C 2ZW1A 3RN9C 3NRZA 5HHDG 3IFTA 4CJ0B 1A2TA 2JUOA 5C0XG 3L0OA 1KXLA 3I4OA 4RHRA 5C3WA 1YVCA 1L6UA 3RNFC 2RSUA 1EOVA 2LRWA 4DBGA 3PZ7A 3CW2C 4K0KL 4OW0A 2IL8A 1TS5A 1HR0L 1WR1A 2LHEA 2PVGC 3IKJA 3M85A 5BYSA 2BWES 1PYWD 5JJIA 3D6CA 3CMMB 3S1NB 3J9CA 1E1OA 3KFUA 3I4MG 1SF0A 5CHVC 1L0VB 1OTRB 3L17A 3R3OA 4ILWA 5IN7A 2A8VA 2PE9A 3SK4A 4BY7B 4PZ8A 5J39A 2PZTA 1WXMA 2PMZB 3P63A 4W9CA 1N6ZA 5CV5A 2BOSA 3FEWX 3KQ4A 4NY0A 1DOMA 1HUNA 1TWHB 4LWCA 2JK8A 3PLUA 2BE5D 2NVXH 3F2DA 3H09A 5EJWA 1EY8A 2A1AA 4QJFA 5JJZA 2XN9C 1Y69U 3PUZA 2ZM6Q 3I70A 4KJOA 1B7YB 5GAHC 2KFKB 4DR2Q 3PZDA 2GLSA 1I50H 3EBEA 4HXDA 4NXNL 1QF6A 1WI5A 3LX0A 3CF6E 4FA6A 5JEAH 2JRIB 2YEPB 2NZOA 4V190 1EYCA 3DXJC 2CVRA 3ULPA 3DHIC 2V3SA 4GOCA 4B3SL 4X65Q 1S5CD 3I4NB 4K5XA 1Q3LA 2K33A 4CJ1B 2MSED 4OX9L 1HTOA 2HCIA 2J7QB 4NPNA 4IUVA 4KHVA 2E5LQ 1A3VA 3OWFA 1J5EL 1I6HB 1YNJD 4Q0FA 3A5UA 3DHGC 3AMZA 1X55A 2I1JA 4H13C 3HOXG 2J0KA 1GUTA 4DHZE
chains in the Genus database with same CATH topology
3EVQA 4KK7A 1SDFA 2A74C 1CTMA 3GTMB 1RKNA 1RM6C 1L0YB 1STEA 1HFGA 1K83B 2CQAA 5KIXA 5JPMC 4K5VA 1PDQA 4OO1G 4G7OC 1JR0D 2BBCA 1YNND 5JXVA 3MXNA 2F0UA 1FD6A 1GB1A 1VMPA 3ERQA 2FMCA 5DM63 2CHBD 3S14B 4X3TA 1B2TA 1HEZE 5ELDA 1SYCA 3AMUA 2A5HA 1PTOC 5M9OA 3KF8A 1J9OA 2WAQB 2DYMA 4OZBA 4U673 3I72A 2BTEA 5I9OA 3PIO3 1F2RI 2J42A 5C4XB 3BVGA 4JK1C 1BR9A 1QQRA 2JXTA 2DBYA 1WWTA 3A56A 3VR9B 2EKIA 1GHJA 2L52A 1QNKA 2L1AA 1ZYRD 5K36G 1UAPA 2EELA 2DNCA 4DXGA 2K5DA 1LTAD 4A9AA 1G291 1EEFD 2I38A 1EL0A 1C8CA 1XCQL 2DN8A 1VLBA 2EJMA 3PIP3 1T3QA 1FM0D 3WOFA 4A3MB 1WTVA 4G4KA 1HTLD 2Y3AA 4A93B 2B2TA 2PIAA 2E2DC 3Q0AA 3TSSA 1N60A 5FK9C 4OGQC 4G7HC 1KAAA 2KQ3A 2BA0A 2E76C 2KEEA 4FXGC 5FLXL 2K01A 5C0XI 4FYDA 2N9LA 4K2KA 3JAML 5CORA 4NJCA 1R4PB 4O1NA 2EY5A 2BB5A 2WXQA 2IX3A 1TZOA 4FP5D 1RCVD 2E2HB 1KLGD 5G3LD 2B2VC 1N61A 4F88A 1YQ3B 1W6KA 1S5ED 4KD3A 1UWMA 1SNOA 3KWLA 3P4QB 4P6VF 5J22A 3NBIA 2SOBA 4DAVA 1MI2A 2D9UA 3GTKB 2OEOA 1EU4A 5IGBA 3Q6SA 3SHLA 4QB4A 1FMAD 4DNTB 4FVMA 4QUCA 3VR4A 5ELEA 1XO3A 2MH7A 1YN3A 4KKJA 3HOUB 4KY7A 5C4HA 2K28A 2R3ZA 3PO0A 1L0XB 2WB1B 2M0AA 2ON8A 2F0IA 5E4WC 1D2BA 5IGEA 4U68A 3P7JA 3GTPB 3FILA 4YTNB 3VA5A 2MHVA 5A2QL 1KH0A 4UAIA 5BMHA 5E6JA 1L4DB 2E3TA 2F0JA 4OO1I 3VRAB 2KHSA 1DOKA 5F2DA 1MSGA 1EZ8A 1GHKA 4KGTA 1HFNA 2KAJA 1JW9D 1I4QA 2AQ1B 3ZQ4A 3P4PB 4WJWA 1LTSD 3M7GA 2WXRA 4MH8A 4KD4A 4ODGA 3IXSA 2KQ4X 4J3OD 2D5DA 1SBBB 3TZDA 3EGRA 1EM7A 3TEYA 1NR2A 1EWCA 1STBA 2E75C 1N62A 2ICEC 4HCEA 4ZUIA 2JQRB 2WXMA 2K1BA 2V4DA 4WRDA 1LACA 1F77A 2K32A 3SDZA 1BMLC 4TQUS 4XYOA 1Q1BA 1Y1VB 1LV9A 2KCCA 2OXPA 1DJRD 4X3SA 1WTPA 1O80A 3MFYA 3QOLA 3NK9A 3UI3A 2NVXB 2QEJC 3QIAA 3GV3A 1D5XC 2XWJB 1SYBA 2IJ0A 1XLQA 5CBEE 1I50B 1HA6A 5C2TB 2ZXOA 3DHQA 1F9SA 1ZXTA 2F0PA 4HEA1 4OZAA 1SJED 4EVOA 2ZT9C 3DM1A 1STYA 2E6XA 4DNRB 1NSNS 2CJOA 5KNBA 2Y0SB 2EXZA 2WACA 5HI1A 1WGKA 2J52A 2F0VA 4AQ7A 2EPBA 3FVQA 2W54A 1SMYC 2F0NA 1Y8OB 2Z1CA 3CHBD 5DAUA 3ABVB 1HTPA 4JWUC 2JE6I 1FNUA 1JC7A 3MZ5A 3ND9A 4HSVA 4XXEA 3P42A 5C0XH 3I90A 1UEAB 1S5BD 1FR3A 3BS1A 3NPPA 1E2ZA 2B63B 4DXFA 3R8BA 2R92B 4UDUC 4YTPB 3KLSX 3J7YW 2K03A 4HSPA 3KUPA 5MPOA 1BO0A 4QCLA 3VQIA 4C56C 4HROA 4JX1C 4NMZA 4K14A 4BS9A 2PMVA 4HMIA 3CRLC 3CU7A 2QMTA 2B2WA 2FINB 5ELBA 2L4NA 2INNE 3MEHA 1E0BA 2F0QA 2EYLA 2L12A 4HAEA 3HOZB 1VF7A 5CV7A 5M5XB 4C3IB 3NSWA 1FEHA 2F3VA 4XQQA 2IGDA 1C4AA 2EDGA 1BDOA 1NAPA 5D65A 1EIHA 4IKGA 4GZYC 3HVDA 4ZRZA 1GOZA 2JA8B 5M3FB 3GP7A 3C1FA 1P7FA 3I73A 4DF7A 3J81E 1LT4D 5C4JB 3OW7A 2A68D 3T4AC 1J8IA 2QIEB 3VR6A 2YU9B 2PQEA 1SYGA 2HUGA 5M5WB 3S1MB 1ONLA 4OO1H 5EE1A 2LY7A 5E3FA 5CC4A 1D1KA 5LHY1 3W1SA 3IAYA 3ZGZA 3RZDB 2LKVA 4XDXA 3TN2A 1XCTL 1SSNA 2RDHA 1SE2A 2IWHA 3S17B 1I3QB 3CKIB 5AUIA 4QMGA 3HOYB 1X3PA 2JYTA 2KDMA 3NUHB 4WH4A 3E6ZX 2N0SB 1XF5L 4KN7C 2MJEA 2DNEA 2Y5PA 1A3TA 3VR3A 1FRRA 3FKIB 1YN5A 2Y5CA 4MHEA 3AU7A 3DMUA 2WNMA 3OSOA 4BA1I 4A6QA 3AE6B 2TMPA 5K36H 4R9WA 2K5PA 2X6GA 1MHHE 3I8ZA 2PZWA 3OPOA 3B2FA 1EEID 3Q8AA 4N9PA 2VXWA 3SVMA 1SNCA 3W9CB 1WVLA 1OXSC 2L0CA 4E6IA 1VRAB 1CHQD 2PKOA 4GDKB 4XWTA 2H88B 3B9JA 1ENFA 1K52A 2NVYB 3S2HB 2O2LD 1AW7A 1PFMA 1KLUD 3PO3B 2M19A 2HCCA 1J7CA 2KMMA 4F8MA 1TJEA 3AM9A 1G2SA 3C3LA 3AE4B 2SAKA 3MJ5A 2EJFC 3VYUA 4ZKBB 1QOBA 2LGIA 5IIFA 1HUMA 3H8HA 4C3HB 1RD9D 4BBSB 1VCIA 4LK1C 2OHFA 1C4PA 4O42A 1STNA 3DUZA 2WXFA 3TMEA 1D5MC 2KJXA 4HCSA 3I3CA 3PZ8A 2Q8TA 3NS1A 1D4BA 1B50A 1H9MA 4GLSC 1GUWA 2C5CA 1PTOB 4WWMA 4H0LC 3BG3A 4PMWA 2W3SA 4K6LA 3P20A 2W55A 4YSYB 2NN6G 1X3QA 5BYQA 4C80A 4IDIA 3VA7A 5AUKA 2MGSA 1WD1A 4A3BB 5BYRA 1D6EC 5COYA 1BCPC 2M56B 4KKIA 2IW3A 4YT0B 2KEDA 2BS3B 5C5LA 5HG2A 3S1RB 3HUIA 3I57A 3ZJUA 2HDLA 3Q8BA 1TR5A 1IBXB 3RD4A 1LABA 3N9YC 2X69A 2F0LA 5T8IA 1QOHA 4EQNA 2JA5B 1AN8A 1F9QA 5DM73 1NVID 3PUYA 1H9SB 2L11A 2PW7A 3MA2B 1KABA 3TEZA 1PTOD 1JROA 4FF3A 3WOEA 2XSCA 3GTGB 5JVG3 2A69C 1OXUA 3AEBB 1IKMA 1QJOA 1JWAD 1GJXA 4N58A 2MJDA 1OXXK 1D5ZC 2F0TA 1TKEA 3IL8A 1BBXC 3NTIA 1S5FD 4LTUA 1B1ZA 3BZDB 1V1PA 3V05A 4RFBA 4YSXB 2OEDA 1XYIA 4ABNA 4WFN3 1LO5D 1TY2A 4I7ZC 2GRIA 2KECA 5ISRA 2IX1A 2F0GA 3MTSA 4L23A 4XE0A 2V0GA 4L6TB 2DYOA 3WDNA 3RUZA 3J81L 1DYQA 4RGNA 1B4OA 1ZOYB 2NBFA 3SE0A 2JX5A 2IT1A 4CHTB 3AECB 3GD7A 2MEKA 2X6LA 2K6AA 2LEKA 2L55A 4F87A 2V4IB 3MXUA 4IFDJ 1MHXA 1B53A 2WV6D 4DAYA 3SEBA 1PFBA 1CZGA 3BDCA 1A15A 2HDEA 2NVTB 1F2MA 2K04A 1BUIC 1YNTE 2RSOA 3A7AB 2WXGA 3T3NA 2M2LA 3M4YA 3H6MA 4FF2A 2JA6B 1ZUD2 1SAPA 4QIWB 1LLRD 5I6YA 4DA2A 2EY1A 1FFVA 1LT3D 3Q8FA 3GB1A 3ZYYX 1K8OA 3M7NA 4HRSA 1C48A 3IAM1 4RA8A 3FAHA 1LT5D 1PRTF 5T1GA 3NBHA 3QB3A 1V1OA 1GUSA 2PZUA 2V3NA 3Q8EA 1PMRA 3PV0A 3NP8A 1QWYA 1F2RC 4FO2A 3V3XA 2F0WA 2Q8RE 1JQ4A 3J7AF 2WXHA 1TU2B 1GB4A 2KA7A 1SB3C 4C7YA 1E0ZA 1EY7A 1QNUA 1TIID 1SE4A 5FO7B 4WIPA 1JQYD 1C4QA 2I2YA 3HZXA 4RCNA 2VNUD 1DCZA 5ELCA 4HKQA 3TDQA 2K5WA 4C3JB 3CRKC 1KNAA 4WQMA 3TP8A 3VYSA 3U7ZA 3KBXA 1A2UA 3AE3B 2CW0C 2D2CC 1DOLA 5EGTA 1WRIA 1U4LA 2WLBA 1XEEA 2Z4IA 1TKWB 1F0ZA 3A8KE 2FHTA 1Q12A 1VR9A 3I9V1 1Y1WB 1IYVA 2F0KA 3AEEB 3K59A 1ZPSA 1TVXA 1EY9A 5FKAC 2QILA 4MACA 2D62A 2Z8LA 4ZLTF 3PUWA 3IFDA 4IOIE 4K8IA 2G9HD 5HURA 2IGGA 2LMCB 3NWSA 3K5OA 3NHHA 2L1BA 4XT3B 3BVZA 1FCLA 4IALA 5EKLA 3SK8A 3BVMA 3X3MA 3ND8A 2K9XA 1N5WA 3N6RA 1E6EB 1ILPA 3E5SA 4NZLB 4RKBA 3K5NA 2LUMA 1YJJA 3EQLC 1SMYD 5EKIA 1S5DD 2H4OA 3HRZC 1NYRA 2EOTA 1CA6A 1PZID 3FILB 2JSVX 3W3AA 4TMAB 2RMMA 2VZKB 4OIJA 1XLOA 1H9JA 5LNK1 1BOSA 5EKKA 1EY6A 5EPLA 1KTKA 1V8QA 1Z6HA 3L7ZC 4KY6A 1VZ6A 4P2CB 1PDXA 1WXQA 3TZUA 1YN4A 3LB8C 1JOKA 4YSZB 1DOYA 5DNFA 3LWEA 4FXCA 1XX8A 2MPMA 5IOCA 2LFIA 1M4VA 2RDFA 1B3AA 3FRPB 4CKEA 3SR1A 1T6BX 1STGA 1TY0A 1QLBB 3SR6A 4HJGE 4RNAA 2B8GA 5KNDA 4X3KA 4B0MA 1EWHA 2BDNA 4YTMB 5HFYA 3V2TA 1U4RA 2B8FA 2R61A 4L1BA 4US9A 3SXHA 1U9RA 1Q10A 3V96A 5I2XA 1FXAA 2BCOA 1OO9B 2VZKD 1XWEA 5IGDA 3W2DA 1QOFA 4L63B 3AV8A 1AZQA 5C6AA 1CT1D 2AQ2B 5KGUA 2A6ED 3L4PA 3A54A 3J80E 2QF7A 4IUUA 3DEPA 2A6HD 1Y8PB 1WTOA 1GUGA 1Z47A 1RFKA 5KRUA 2WU2B 2GA4B 4NAMA 2JP1A 4US8A 4WAFA 2O4XA 3M4OB 3OHXC 3U9OA 1G91A 1LTRD 4C1NK 4KI0A 5IT9E 1CZWA 1FD7D 2W82A 4DU9A 1RTOA 1SIJA 1VF5C 1Q1EA 1FGBD 1I4PA 4K5WA 2WU5B 4B08A 1CM9A 1K53A 2QKIC 5JEAJ 5IGCA 2A73B 2JZPA 3A7LA 2B2TC 2JEBI 3X3NA 2AQ3B 2DWQA 2WXIA 2MJ8A 1K8MA 4CJ2C 1X32A 4PT5A 4A3JB 1VDVA 4A3IB 1PXUA 1ZXIA 2JXMB 4I65A 4Y7NB 2KN4A 1B9MA 3D6WA 2EY2A 5JPNC 1JOOA 3P4RB 3GTQB 4YXDB 3H0GB 3C8YA 1WTRA 1PFDA 2INPE 2GI9A 2B2UA 4RF0A 1JWBD 2BDOA 3NZ3A 4MT5A 2JWUA 3D8GA 4C1NI 1UNSA 1ENAA 4DK0A 1AZPA 2F1MA 3E9SA 1VJKA 1KF6B 2K05A 3UI2A 3A8IE 4HR7B 2F4IA 3FPPA 3CQZB 1QE6A 4RGTA 3NUCA 4XQJA 2FMMA 4F7XA 5C3EB 1EYDA 4EQPA 3MXPA 1BCPB 2WKDA 4N6EB 1LT6D 4NAWB 1D1IA 1ET6A 3BK1A 1CFMA 3E0JA 4IURA 3PUVA 5KEEA 2PNRC 1XLPA 3BK2A 3AEFB 2SNSA 3QJYA 1EWYC 2WXLA 3Q8CA 2A6EC 1FNWA 1STHA 5D3IB 4KMUC 2A6HC 5BN5A 2D5GA 1FYCA 4PMCA 5NUCA 3SK5A 1RWSA 2NMQA 1XTCD 3L9AX 1EY4A 1RJTA 3ONAB 1PGAA 3FPUB 1VZ8A 1JOQA 5T1IA 4XTCS 2JU6X 3AN1A 4C3IG 4DN4M 3KWVA 1BCPD 3C1EA 2C9OA 4S3SA 3Q69A 2JA7B 2PYKA 3ITPA 2DLBA 1AWDA 3RPFC 4XIGS 2R6GA 2BS2B 1KDAA 1SEBD 2SEBD 1AYFA 3FC4A 4B0EA 4TSSA 5M5YB 1DOIA 3U52E 5D14A 4QUFA 3MHZA 1PFNA 4PV1C 3O13A 1WD0A 2K3UA 3K5MA 3NXWA 1EQTA 2F0OA 3LNNA 1OXTA 3ZJVA 1TWCB 1OQQA 1DOXA 2BT6A 2XRSD 1HRJA 4KV6A 4ZOHC 5EBCA 1EQVA 4OZCA 2BS4B 1O7ZA 1BUVT 1WSPA 4NDXA 5TSSA 2A69D 1B44D 3S1QB 4HMJA 2SNMA 1SYEA 2PO4A 4XDCA 3KLRA 1HHVA 5H8YE 5IGGA 3AE2B 2F03A 3I4LA 1RF2D 4IUQA 1IW7C 1ESRA 1OQRA 1CQFA 2F0MA 2FFKB 3NVZA 4NW2A 4FXDA 3ZJTA 1Q90A 4YIJA 1G6ZA 4ID6A 1A70A 3BWUD 1PRTB 5I6WA 2M00A 4M0WA 2B2UC 1O7YA 3KK7A 1PZKD 4X3UA 1HQMC 3VRBB 4HEDA 4YWGG 3OMCA 3J80L 3TUOA 2XVSA 4A55A 5JVH3 1U4PA 5G5HA 5CV4A 1A6XA 4PQXA 2B2WC 3K5LA 4N59A 2B76B 4JPSA 2PPBC 1T5EA 2B39A 1QOAA 1EU3A 3AEGB 3TBIB 3NTHA 4HN7A 4OVZA 3F2UA 2KVMA 2ZXPA 5IT9L 2EVBA 4M8AA 2RKSA 2L9HA 5BN3A 2WKCA 2QSDA 2OT2A 3PO2B 3OOCA 1IYUA 4HTHA 3HKZB 1WCMB 4ZAIA 5D3DA 4ZQ3A 2LFNA 1QG7A 4C3HG 3U2SC 2WINB 1FO4A 1F2LA 1Y8NB 2NTSA 2BW2A 3LYYA 2IX0A 2AWOA 3RMHA 2IGHA 1NUCA 5FO8B 5KYIA 3W5UB 4KY5A 3TEWA 5FR3A 2WXKA 1B9RA 1CQVA 1RODA 1SSOA 4H44C 5HGTA 4C2MB 1HZ5A 3IAS1 1PZJD 1Y56A 2EJGC 2ZXRA 1MGSA 1FFUA 1KFYB 3T51B 5G5GA 2PVOD 1WYGA 3AE1B 4ZUJA 1FIQA 3MFGA 3OIPA 1NENB 3MHBA 1G8ZD 4KKUA 3CWIA 4PMBA 4OIKA 3TEXA 4ZHPA 2F3WA 3R93A 1GXDC 2WDQB 4ZHOA 2N88A 3I4MB 1Q8IA 1WTQA 1F2YA 2NWGA 3DWQA 3HEJA 3KLSA 4ZK9B 2WXPA 1TKGA 4RKLA 3LXFA 2F0EA 1N63A 1JWMD 1JORA 1V1PB 3NTKA 5A2QE 2ID0A 2E2IB 1UWXA 1YMHE 4JWSC 3EA6A 3QOJA 4XWWA 4A8XC 4DQOC 2CW0D 4BWGB 2KWDA 1SNDA 2AWNA 3GS2A 3AB9A 3AE8B 4ZKCB 2RBMA 4GDLB 3TP7A 2K7VA 1DGJA 3B2GA 2WDRB 4MIUA 4DGZA 1V97A 3MWYW 2B2VA 5CMDA 4EGVA 3AH7A 1GPXA 1C79A 3SK6A 3RLFA 3HOXB 4WURA 2WIIB 3DWGC 4G7ZC 2AUKA 4IN3A 1QKZA 4KGRA 5CYUA 3MXGA 4RAUC 2J4XA 2PLPA 1E2VA 2WS3B 2KCNA 4R3DA 5DEHA 1AP0A 3HOVB 4CBVA 2FBWB 2IPKD 3K7AB 3D3RA 5I9PA 3DWAA 1VDZA 3OMGA 1PRTC 2WP8J 1NI3A 1L5PA 1SFOB 1G2TA 2VB2X 4LLGM 3K6OA 2NN6I 5LL6X 4K8JA 4IFDG 1C4CA 2L83A 1R9TB 2Z4HA 1ESFA 3RFZB 2FJ2A 3U9SA 1DXMA 3VR2A 3HRDD 2W3RA 1S4ZA 1JRPA 5EPJA 2YYZA 4KTAA 2ACZB 3NVYA 1NR4A 1KNEA 2L32A 1FXIA 1I4GA 1MI0A 2I46A 3TP5A 3BDLA 3D4DA 5A35A 1QCBD 2MUYA 1E7PB 5LL6S 4KGSA 2KUMA 2QCPX 1JICA 4CKCA 2F0SA 4EE2A 4J1MA 1N5XA 3HVZA 1PTOF 3OIQA 2N55A 4B9WA 3H3VC 2JYEA 2NYZD 1I6VC 1B9NA 5C4ZA 4IZ8A 1ICWA 1HPCA 1CA5A 2XRQD 1RDPD 3N52A 1LTBD 5C44B 3GTLB 1BNZA 4G57A 4R8NA 2RSNA 2EYMA 4MN3A 3E56A 1A3UA 1HXYD 3IT6B 2I07B 3GO5A 1MPEA 2BE5C 1MVKA 2KOLA 4C3JG 1TS3A 3NQIA 1ZKOA 1PLFA 1BXTA 1Z7TA 4TRDA 1EOTA 5EE3A 2IDYA 4OHJA 1JMLA 1TWFB 3PUXA 4JE3B 5CV9A 3T13A 3BYTB 4B9XA 1XLNA 4XT1B 3VR8B 2BYTA 3FDTA 1II3A 1YNJC 1ILQA 1EFID 3AB5A 5J1ZA 1ET9A 3VYRA 4RH6A 1SYFA 2PW5A 2LMCA 4XQNA 3P1HA 3AE9B 2EYJA 1LTTD 2E2JB 3BYYB 3S2DB 2N9KA 3FMCA 1JB3A 4K6DA 1CK1A 1SJHD 1I7HA 5GXGB 1HQRD 1F9PA 4ITKA 3H91A 1IL8A 1YNNC 1J7AA 4A90A 2LHDA 3I91A 4J8QA 4TKOB 2O5IC 1E10A 4PNYA 4IFDI 2B2YA 1HA5A 5CR3A 1IHZA 4TQ0A 1QOGA 1I4HA 4ULLA 4XYQA 5M3MB 1TS2A 3NQTA 3Q24A 4FNFA 2TSSA 3R2TA 1ZE3D 5CGKA 2YEPF 3AEAB 1ZYRC 2NN6H 1WTXA 1V8CA 2HDMA 3KBGA 3D31A 4A3EB 1JWSD 3G6JB 2SDFA 1C78A 2NTTA 4H2AA 1HCZA 4A3DB 1R7SA 1VZ7A 5BMIA 5EE9A 2ICIA 4ZRPA 1SNQA 2CU3A 4QF4A 1ML0D 3D4RA 3HG9A 4IUPA 5CV8A 4CKBA 4OW0A 4DFAA 1DM0B 1AFPA 3DWPA 1RYJA 1M8AA 4KKTA 2F0DA 4ZYSA 3T16A 4L2YA 1CHPD 1FCCC 3W5VB 4KKSA 4BY1B 4RF1A 5ELFA 2VUMB 2R93B 1QT9A 5FO9B 2EYFA 1PTOH 2XWBB 4ZRQA 3NE5B 3J7AV 4N9TA 1EZ6A 3K0YA 2Q5WD 1J7BA 1TQOA 3DWMA 3BDOA 3GTOB 4A3GB 4C7ZA 5D7GA 1BF4A 4NP5A 4DK1A 4LJZC 1I4RA 1C76A 3CIRB 3TP6A 2JSOA 1I4XA 1NCVA 5G3LF 2NZ1D 1C77A 1MBYA 1ZXHA 2F0FA 5JEAG 5H92C 2NUCA 5FOBB 1T5XD 1STAA 4Q2JA 1L6VA 3SFEB 1EY0A 1EIGA 1RHPA 2WXOA 1EYAA 3M3YB 5KNCA 1ROEA 3HOWB 2EYPA 2V3PA 4ME5A 2WXJA 2K5QA 1RTNA 2HQEA 3BIID 2RVLA 5E4XA 2VB3X 4K2LA 1IW7D 1TYGB 2RQXA 3A8JE 2WP9B 3RZOB 3P1MA 5C3XA 5IODA 3Q22A 2X38A 2KACA 2LS01 3MC0B 4FF4A 4AS1A 1GUOA 3LWUA 1SYDA 2QJLA 4BBRB 4KJNA 5BN4A 1H9RA 2GB1A 2MJ3A 1NYQA 3VR5A 1P7EA 1ZEQX 1XXGA 3C2PA 1IKLA 4DAPA 2B2YC 4RWSC 3K57A 2O5JC 1DONA 4A3KB 1EY5A 1HZ6A 2J53A 4CGYB 3IT4B 3EROA 3AE7B 2BA1A 1L4ZB 4RGOS 3PMFA 4IFDH 1QB5D 3EFXD 4LMQD 3EJIA 3DEOA 2JYOA 4FF1A 1FNVA 2MP1A 3QG1A 3WCQA 2WXNA 1JCKB 1UUPA 1PGXA 1OFFA 1H9KA 4A3FB 1TWAB 1SNMA 1F9RA 4R8IA 4EQOA 3Q23A 4KX6B 2FE8A 1IUEA 4J6HA 1ZDVA 4OL7A 5KYLA 5IGFA 1KDBA 1WTWA 5CV6A 4KHZA 2E74C 3C46A 4HKZE 4V0BA 1CJEA 3A55A 2F0HA 5JAVA 4L8JA 1KRHA 5EE0A 2EE1A 4RHSA 2PW9A 4CQNA 1LTID 1W6JA 5JOBA 3URYA 4IUTA 4USAA 2QDBA 1U4MA 1JE4A 3MAQA 3QO2A 3P4SB 3GTJB 4BA2I 4TQ1A 1TT2A 1V43A 1ZDXA 1ACCA 2L5TA 4D2KA 3NWTA 2BB6A 3L3OC 4LK0M 4IUNA 2G1EA 1YQ4B 1IGDA 1KDCA 2XIWA 2CJNA 3GV6A 1K51A 1NEKB 1DD2A 3EUB2 4NKLA 2FUG1 1OXVA 4H7BA 3SFDB 2ZW0A 2AUJD 3D4WA 3MVVA 2HTME 3AEDB 5C3JB 5I2YA 3H94A 4RGMA 4Q5VA 3K58A 1YJIA 2H89B 2EY6A 1FRDA 4M1UB 1IGCA 1PUTA 1K50A 2PCFB 3OWEB 5CBAE 4FXKC 5BMGA 2LJIA 2ENBA 3S15B 5FLXE 4P16A 2NB0A 4WORA 4MM3B 2A68C 1E9MA 2M9VA 1BQQT 2R7ZB 3JAME 2Q8IB 4REZA 3ETRA 3NVWA 3U4EG 1SXTA 1TKYA 3P75A 2N7JA 1PGBA 2AX5A 2XNAC 1GAQB 1R4QB 1PRTD 4Z9CB 4RCOA 4AYBB 1ZP0B 2EYHA 3HP3A 1JWUD 4ARCA 4ARIA 1AEXA 2WQYB 1SE3A 4KN4C 1F2ZA 5EQ0A 2G9DA 5C5MA 1UGJA 2EZVA 5E1FA 3T3OA 2DY8A 1GUNA 3R2IA 2PTLA 1CZPA 1JALA 3GQBA 3QWNA 2DY7A 1E2WA 2K0PA 1VMCA 1MSHA 4IQZA 1CI3M 1MD2D 5EPKA 2NVQB 1BCPF 1C9FA 2ONQA 5AFWA 5EBDA 3T53B 5C0XJ 1IBXA 5K5PA 3S9WA 5I4DA 2RA4A 3T56B 1ENCA 4JBWA 3MP9A 2J7ZA 2WDVB 3NVVA 2OF1A 2RDGA 2RPVA 1DZ1A 3AE5B 1H9SA 1TS4A 1QILA 2J0TD 1TWGB 3HGBA 1SNPA 2JEAI 3VYTA 4LAAA 3G7LA 2EYOA 1LTGD 2H1EA 1O78A 1O7LA 4XDDA 3S16B 2K22A 2ZW1A 3HS0C 3NRZA 5HHDG 3IFTA 4CJ0B 1A2TA 5C0XG 4RHRA 5C3WA