2J4XA

Streptococcus dysgalactiae-derived mitogen (sdm)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
196
Chain Sequence
KDAVLVNSELKNIYMKDVINKTNMKITKKIGTQLIFNKVISSNVSPAQERRFKEEEEVDIYALIKSYSVICKEQYNYVDGGLIKTSDREKLDSTIYMNIFGEQIPLKEQSKYKITFQNKFVTFQEIDVRLRKSLMSDNRIKLYEHNSICKKGYWGIHYKDNTTKFTDLFTHPNYTDNETIDMSKVSHFDVYLNEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Streptococcus Dysgalactiae-Derived Mitogen Reveals a Zinc-Binding Site and Alterations in Tcr Binding.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Signaling protein
molecule keywords MITOGEN
total genus 58
structure length 196
sequence length 210
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2j4xA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j4xA01
1V1OA 1PRTB 5FKAC 1LTTD 4RH6A 3OWEB 3SEBA 3EFXD 1SE2A 2IJ0A 1JWMD 1KTKA 2XRSD 3DWQA 4RFBA 1I4PA 3BVMA 4RHRA 1CT1D 1I4HA 1LT5D 1PRTC 1RDPD 1I4XA 1GOZA 4TSSA 5ELFA 1PZJD 2AQ2B 3BYTB 3BZDB 4OHJA 1LLRD 1FD7D 2NTSA 4RGTA 2CHBD 5I4DA 2XN9C 1KLUD 1JWUD 5D3DA 1BCPB 3DWPA 2Z8LA 3BVZA 1SEBD 1L0YB 1S5DD 1FNWA 3W2DA 4ZYSA 1M4VA 1RD9D 2WV6D 1PRTD 2QEJC 4BWGB 1HA5A 4DXGA 3GP7A 1D5MC 1MD2D 3R2IA 1I4GA 1CQVA 1RCVD 1L0XB 1PTOD 3DWAA 1YN4A 1PZID 3MC0B 5ELEA 1EWCA 1JQYD 1LTAD 1B44D 1SJED 1FGBD 1LT6D 1TY0A 2RDHA 1EU4A 3R8BA 1KLGD 1TS2A 1FNVA 2IPKD 3BYYB 2SEBD 1D5ZC 1YN3A 2ICIA 1S5ED 1ET9A 4L63B 3URYA 1TS5A 1D6EC 1XXGA 1UUPA 1AN8A 3BVGA 2AQ3B 1ESFA 4Z9CB 1XTCD 4C56C 1PTOB 4L6TB 1AW7A 1PYWD 4DXFA 4RGNA 1SBBB 1G8ZD 1PTOH 1ENFA 1PTOF 1PZKD 2XNAC 1D5XC 5ELDA 1LT4D 1BXTA 1HXYD 3MFGA 1CK1A 2G9HD 2XRQD 1DYQA 1LTSD 1PTOC 1PRTF 1BCPD 2AQ1B 4NZLB 4K6LA 1I4RA 1HQRD 1HTLD 1SE3A 1EFID 1S5FD 2O2LD 4RGOS 2NTTA 5ELBA 1BCPF 1S5CD 1DJRD 1FNUA 1JR0D 1RF2D 4RGMA 5D3IB 1S5BD 1V1PA 1STEA 1BCPC 1TY2A 1SE4A 1V1PB 2RDGA 3V05A 1ET6A 1SJHD 1B1ZA 1LTBD 3O13A 1JCKB 1EEID 4RCOA 3KLSX 4UDUC 1EEFD 1CHPD 1JWSD 2J4XA 3CHBD 5FK9C 3EA6A 5ELCA 1LTRD 1LT3D 1I4QA 1LTGD 1SXTA 1YN5A 1LTID 3R2TA 1EU3A 2R61A 1TS4A 2QILA 1TS3A 1F77A 2TSSA 4RHSA 1UNSA 3TSSA 1QILA 1LO5D 1CHQD 4O1NA 5TSSA 1T5XD
chains in the Genus database with same CATH superfamily
1UEAB 1Z6HA 3CQZB 4K5VA 1MG8A 3A8JE 1Q1EA 1S4ZA 3AYHB 2LJ5A 1GC7A 4P74A 1H4RA 2AL3A 2NR2A 2EQSA 1WGRA 2RDFA 3EJIA 4AJWA 3EFXD 3H0GH 4PMCA 1EWYC 1MKHA 3KBXA 1NYQA 3RN5A 2CQAA 3CCJA 1VQLA 2PIAA 4R4IA 1PRTC 3GQBA 3PRPB 3AE1B 4GLSC 1SYGA 1NYRA 1YJ1A 2D11A 2VQEQ 1E3PA 1VQKA 3BZDB 2VL6A 2Z0EB 2NTSA 2WAQE 1YNJD 4WFN3 1KIXA 1WXMA 3MP9A 4LNKA 4P1CC 2L15A 1TKWB 4DR4Q 3ZDMC 3F1ZA 2G9DA 3ULJA 3WDNA 2HQLA 4BBSG 1L0YB 1ZDXA 3HOWH 4P7IA 2PPHA 4DAPA 3I4LA 4QJFA 5JOBA 4DU9A 3PO3H 4KGTA 4LF4L 1SLJA 4BBRH 5G5GA 1V5TA 3SFDB 1CI3M 4BA2I 1QOBA 5IGCA 1R4QB 3A74A 3AV8A 4ZRQA 1L0XB 2MQJA 1B4OA 2NVQH 3D31A 4KKTA 2ATWA 1LGRA 2RMMA 2PMZB 4K5XA 2OCEA 4U673 4A3OA 4ACFA 5G3LD 3H7PA 4PS3A 4I65A 1SSNA 1TY0A 4LF4Q 4C4VB 1PFSA 1V2YA 1HUMA 2F3VA 2PO4A 2E6XA 2HHHQ 3PLVA 1DOIA 1N34Q 1SNQA 1A63A 2F0IA 5M5XH 1TWHB 1L4ZB 4DAVA 2CKHB 2MSED 4JI8Q 4KDIC 3SR6A 2B2VC 4JI6Q 2LGSA 4JGHB 5IP4D 4HN7A 2M1MA 1UEBA 4UP9A 1FJGQ 5AUKA 3PGZA 2M19A 2LJIA 1XPOA 3PUWA 1EY7A 2G4SA 5EPJA 3MJ5A 3AMUA 1DOXA 5EKLA 4DUZQ 2IL8A 1CKNA 2JYTA 1NUCA 2LS01 2KTRA 2REXA 5CHFA 5E6OA 2WXPA 4IUMB 3MXGA 2X69A 2A6HD 3TDQA 4IC7B 1LTSD 1PTOC 3GTQH 1EF5A 1O78A 1NTGA 2DAJA 2IX0A 1DM0B 3BDCA 5IGDA 1QWYA 1HTPA 3MA2B 3PF4A 1S5CD 2WIIB 2G3QB 1E1OA 3QOLA 2AX5A 3BWUD 3NG0A 4A3KB 2MBBB 2HIVA 4AH6A 5E3FA 5IT9c 4A3MG 2NMQA 2JA5B 1BCPC 1TY2A 4H7BA 4A3EH 2BGFA 1MBYA 2RDGA 4FLHA 5FOBB 1EL0A 1O7YA 1FIQA 2QSDA 3M62B 4OIJA 3ZNID 1TWFB 3VR2A 4CBVA 2KANA 2QF7A 3RULA 1X3PA 4ULLA 4YIJA 3QAQA 2K03A 3HVDA 3CHBD 1UBQA 4ZCKA 1XLPA 5EAYA 4A3MB 1D1KA 5BR8Q 3PIO3 5ELCA 4K14A 5C2TB 5LMUL 2C7HA 4WWPA 4MTKA 2CWAA 1ZXIA 2Z0DB 2K5NA 4ODGA 5CORA 3F2CA 2JA7H 3N1XC 3UDFA 3DDCB 4QIWE 1QOHA 3M3JA 4NAWB 4KV6A 3NXWA 2UXCQ 5DPSA 3TEWA 1OGWA 3A4RA 1B9RA 3RNEC 4QL5A 2IZVB 4JBMA 1WMHB 2MJ8A 2F3IA 1Q81C 4QCLA 1HFNA 3MJWA 1PH2A 4MHEA 2RHSB 1HZ9A 5C4ZA 2JP1A 4HMJA 5C0XJ 1PV4A 4DR7Q 3VDZA 4FO2A 5JJIA 2WNMA 4ZKBB 1IL2A 4DR6L 2IX1A 5G2NA 1LT5D 4N6EB 1IBML 1V86A 2L8JA 3RZWC 1SAPA 3IL8A 1PVOA 5IYCH 4NY0A 1Y1WB 4LUOA 2CHXA 4B3TL 2Y5BB 4E74A 1FO4A 1CKMA 3AULA 1L1OB 1D1IA 4NJCA 1WYDA 1DCZA 1YZ6A 2ZJRA 4DV5Q 1XNRQ 2BW2A 2GRIA 1MGSA 2M4NA 2K5PA 2HD3A 3LYYA 2BOSA 3VR5A 2XBBC 4DR2L 1ZPSA 3K0XA 4X3KA 3HM6X 3NQIA 2R7ZG 4G7HC 3LDZE 2EJGC 1Q82C 4MELA 4JI1Q 2K04A 3GP7A 4G7ZC 1I4GA 2A1AA 4GLVB 1N33L 2JA8H 3S2DH 1FRRA 1G6PA 4JI0L 3VTWA 1EFWA 3HIZA 1Z9FA 2ICEC 3ENEA 3QIJA 2N1WA 4Q2JA 2EE1A 1XMOQ 4KLKA 1S1QB 3GS2A 2WP9B 2F4VL 2D3BA 3GTPH 1C4CA 3AMZA 4DXAB 4KX6B 2F0TA 1A15A 3NTIA 2NPTA 2R7DA 5CHVC 1SNOA 4X57B 5DPWA 4HAEA 4OEMB 3MTSA 2LFIA 1D6EC 1CQFA 2G5DA 1Z7TA 3TMEA 5BR8L 3H6MA 3T51B 2LEKA 3HUIA 4FJVB 2WP8J 1D3ZA 3UQAA 1RWSA 2JEBI 2C5CA 1ILQA 1WH3A 4Q5VA 4RKBA 4RGNA 3U9SA 5K36G 1VCBA 2IX3A 2MO1A 2XTIA 1PTOH 4ITKA 4K7WA 4GDKA 3W5UB 1XMQQ 4RCNA 4KD4A 3IFWB 1TZ1A 2IT1A 4WWMA 4XE0A 2AWNA 1RJTA 4JI5Q 4IPCA 3N3KB 3E56A 4GN5A 2BE5D 1AE2A 5G55A 1GJZA 1FMAD 3PMFA 2K5DA 1DJRD 4KY7A 1TWAB 1VQNA 2K6DB 1QVCA 4L2YA 1GVPA 2R93G 4A4IA 4LAAA 4LF6Q 4ZOHC 4BXXH 3QWZB 3HOYH 2D5GA 2ON8A 4OVZA 2WDVB 1JJGA 4I6NB 1J6QA 4MGZE 1STBA 4JBKA 2DZJA 2K7VA 1JCKB 1EEID 1WI5A 5DAUA 4XXEA 2IWHA 4DNIA 3ETRA 2B8FA 3RCZA 5EPLA 1CHPD 4IUTA 3EN2A 1WGYA 4JBJA 3HOUH 5I9OA 4ZHOA 4A93H 2JU6X 1LTGD 1MSGA 1X65A 3DM1A 4QGUA 3A0JA 4IZ8A 1UGMA 3H7PB 1Q1OA 4LK1C 1TS4A 4EKUA 1CKOA 2EIFA 2KN4A 2MBEA 2ACZB 4WRDA 2K1BA 3U52E 5LMNL 4KHZA 4X62L 1QILA 1WM3A 3HFZB 4DR3Q 1D8LA 1WTRA 3IXSA 4DAMA 1BT0A 2E2DC 3CC7A 1OXVA 3RNUA 3PSEB 5BYSA 2WQYB 2JF5A 1LTTD 4A3EB 3NZUA 3L7ZC 1WI0A 1X1MA 4LF8Q 2R2QA 3A56A 3SEBA 4MH8A 5EE9A 4PMWA 2VQFL 4B3SQ 1SE2A 1X32A 1PH7A 2KQ7A 3GB1A 3HOWG 4DQOC 3NZ3A 2RSOA 3EGRA 1GUAB 4CJ0B 1I4XA 3U30A 4KD3A 1HR0Q 2WB1G 3VRAB 2V3SA 2NVXB 4FBJB 2DGYA 5KHQA 4RGTA 2VZKB 3A4SC 4LNIA 3H3VC 4C2MB 3M7NA 1TWCB 4H13C 1RLFA 5FO8B 3J80L 3GO5A 1HZCA 2ZCBA 2XWBB 3PTFC 4HJGE 4DK1A 2WU2B 2K05A 2JA7B 2J7ZA 4YTPB 3GTMB 1FVIA 4DV0L 2N4FA 2KXJA 5AJ3L 3U50C 2ZM6Q 1PGAA 4KGRA 2I0QA 3VH3B 2F0GA 4L8JA 1VMCA 1VQHA 2D07B 4XGAB 1GB1A 3AE4B 4HWIB 3DBHB 1MHWC 2KBNA 3QWNA 2JVCA 4JW0A 1A2UA 2IGHA 3P2BA 1WR1A 1SNMA 4AS1A 1IYFA 1J0GA 1K50A 4HMIA 2SEBD 3X3MA 1FL0A 2F0QA 1QUQA 4US9A 2JA8B 3H8HA 5IIFA 3ZRFA 1EYGA 3JAME 2QHOA 3URYA 4W9HA 1VQOA 1YNND 3IT4B 4YWMA 1N36Q 3J80c 4BBNF 3NELA 5C3EG 5KHOA 2E75C 2C7MB 4Z9CB 3HOWB 3QR8A 4PV1C 3A7AB 2L7RA 1WMHA 1E10A 3OIPA 1GHKA 3OG5A 5FR6A 3PUXA 1CFMA 2MPMA 1E7PB 1RAXA 2ZPYA 3NK9A 1ENFA 2PMVA 2YEPB 3BJUA 5F2DA 2V0GA 2EYOA 3U4ZA 4GS3A 1JORA 5BMHA 2N88A 1PRTF 5JVG3 1WYGA 1JMLA 4EQPA 4NXML 1S5FD 1L1OA 4DR1L 5J3BA 1NSNS 4MEMA 4OVUA 3HK0A 4RGMA 2W54A 2DX5B 4W9CA 4WQMA 1I94L 4GN1A 3UDIA 5E6PA 2KDFB 3GE3C 1KOTA 1ASZA 1RFKA 4TUUA 2EZVA 3TIXA 4KMUC 2CJOA 1C78A 1PFDA 4DDGD 4DV5L 2N8NA 3FDTA 4BY7H 3PZDA 5T1GA 2BT6A 2KTFA 3DWMA 4KDLB 3I8ZA 3RMKC 1WCMG 4C4VA 1I6HB 4KN4C 3X3NA 2A68C 1JB3A 2DJFC 3K0YA 3RZOB 1FXTB 2RSNA 3S2AA 2VXWA 4JQWC 4UAIA 5GAHC 4C3IH 3BU2A 5IYDH 3S17H 3NUHB 1TYGB 4E3CA 3MEFA 5L95C 3DVGX 2F0KA 4EE2A 2NPTB 4A3DG 4MGYE 2KC2A 3SK6A 2D5DA 3JAMc 3I3TB 3Q3JA 2ES2A 1XMOL 3GTKB 3C1EA 3OWEB 2QEXA 1L2FA 4IO9A 3OYYA 2Z9HA 2FUG1 5LHY1 3DVGY 5HI1A 2WB1B 1U0LA 2X38A 2SNMA 3F2BA 1JE4A 2H89B 2E2HH 4A3FG 2R7ZH 3OLMD 3NPPA 5M9OA 1BUIC 3PHXB 1OEYA 2BTEA 1H9KA 3KF6A 4TSSA 1SSOA 2B2TA 3TZDA 4YY3Q 1KNAA 2C5LC 5CHWA 4DK5A 4A55A 1C7YA 2BDNA 2XN9C 4P2CB 1HNXQ 1SF0A 3M95A 4ICVA 1DD2A 3Q3OC 1QZGA 4EQ5A 3KQ4A 3WCQA 2G4DB 5LL6S 4YCVA 1IGCA 2MO0A 4XTCS 3R66C 1KC8C 4NJ7A 2A4ZA 1K53A 3PIP3 2KMMA 1HA5A 4RF0A 3VFKA 2M17A 4LK0M 4LFCL 4K7SA 3P4RB 3QHTA 4IW0A 4JC0A 1T0YA 1C76A 1D2BA 5FLMG 1EY5A 1SFOB 3OOCA 5ELEA 4PS7A 3N9YC 3RNBC 3RT3B 4YCUA 3QIAA 1JOOA 2E2JH 3A8KE 2IDYA 3K81C 1EU4A 4AIMA 1GUOA 2NVXH 1QZEA 4DHJD 4J6HA 3ZJVA 4PK1A 5I2YA 3BIID 1D5ZC 1WXVA 4OVVA 2EYJA 3J7ZC 2JWZA 2D10A 3ERQA 4ID6A 1ET9A 4OWTB 4J8QA 1QG7A 1VDZA 5M5YH 2RGFA 4R9WA 1VQJA 2EY1A 3J81L 1JOKA 1Q3LA 4C7ZA 5HGQA 1EUJA 1YMHE 3ZNGC 5AZGA 3W5OA 1WTHA 1E7VA 3CKIB 5LXHA 5C5LA 2PCFB 3MHSD 1RTOA 1AW7A 2E3TA 2LXKA 5M3MB 2JXMB 5EDSA 4E6IA 1L0VB 1XT9B 5E1FA 2PKOA 3E9IA 2NB0A 3S1MB 1N61A 3UIOB 1TQOA 3MXUA 2R6GA 4HIDA 3S2DB 1R4MB 1L2NA 2O5JC 2MWSB 1EOTA 5C3XA 1DYQA 4HXDA 2CKZB 2ZW0A 2QDLA 2GOWA 4NZLB 4UPAA 3CCQA 1LXDA 1HQRD 2LFNA 2QCPX 2L11A 4R4CA 2KX0A 3K5NA 2OJWA 4HTHA 1JR0D 2EKEC 2JQOA 4A3IG 1WOCA 1Y8RC 1FR3A 3H0GG 1VQ6A 3M4OH 2FFKB 4QAYA 3AN1A 1YJIA 1WJ4A 1QVFA 1NCVA 4L23A 4ZYNA 3MVVA 2KKCA 3T4AC 1LTBD 5BN5A 1QZHA 3ECIA 3ZRCA 1E2ZA 3LJ3A 1X3FA 5KEEA 5HG2A 3CSFA 1IW7C 4YSZB 2UXDL 5FK9C 5BYRA 5E6JA 1I42A 4JWUC 1SIJA 4MSMB 3TCAA 2MRPA 3E3XA 2L4NA 2QILA 2RCFA 5JJKA 3AE6B 3IBEA 1KAWA 2FIDA 1HE8A 1HRJA 3TSSA 2IO3B 1BBXC 5IT9L 3DVNU 4FF2A 4RG1A 3B2GA 2BB6A 4NJ6A 1WE7A 1WY8A 3VA7A 4A75A 4LFBL 2FNJB 4FF1A 2KK8A 4LF9Q 4JOIA 4NXNQ 2DZMA 4BOSC 1I6VC 1LFDA 2JY6A 5C4JH 3QA8A 3FP9A 3PZ7A 3WAPA 3RZDH 2L5TA 3SDZA 1WXQA 3QG1A 2LI5A 1JJCB 1DGJA 2K0PA 2X6GA 2OEOA 3PO3B 1XNQQ 3OTOL 5CV7A 1FXIA 4OHJA 3M3YB 2MBOA 3Q2AC 2L1BA 1QE6A 5IYDG 2WFWA 4HDOA 4ZHPA 1EZ6A 1KLUD 3PRZA 1P9DU 4A3PA 3NUCA 3VYSA 1WWTA 3OHXC 5CV9A 4YHHL 1P1AA 4LJPB 2LRWA 2H4OA 4AJYB 1YNTE 4C3IB 3UI3A 1M4VA 4MTNA 1WX8A 2IY1B 1XNQL 2PNRC 2PZWA 4M02A 4FHKA 3I91A 3R2IA 4KKSA 1I6HH 2KMCA 3DBRI 3TRZA 2K75A 2J53A 1PFBA 3DWAA 3KWLA 3MC0B 1Y8PB 2E2HB 2E2IB 1I7HA 3IFDA 4GOPC 2M0XA 4UY8C 3C19A 1OTRB 5AUIA 1ONLA 4BAXA 4B3MQ 3ERSX 2WACA 2Q8IB 1O7ZA 1VQCA 4NP5A 1JT8A 2N49A 3LX0A 1MJDA 2NYZD 2WYQA 1Y8NB 1Q90A 4PZ7A 3APDA 1SN8A 2JRIB 2HDLA 3H09A 1WM2A 3ULLA 3I4NG 2IYDB 2YTYA 3EHVA 3NVWA 1R4PB 2JK8A 4Y52H 4TRDA 1XLQA 2BS2B 3Q8DA 2V4DA 2PLPA 4HJ9A 3D6CA 1L4DB 2MJDA 1H9JA 4A3LG 4BBNC 3MZ5A 3OJ3A 5IE8A 2BA0A 3N6RA 1VDVA 3E0JA 4DXFA 4KIKA 3STBC 1XEEA 2HTME 2KTRB 1FCCC 4KIKB 1F1HA 4HEA1 1A3UA 5KGUA 4F87A 3I72A 2M2LA 2ZT9C 4DUYL 5K36H 1SYCA 1WTVA 3G6JB 4DPGA 3RNAC 4O42A 4BY7G 1HTLD 2M00A 4JI5L 3ITPA 1FYCA 4DV4L 2PQAA 2UXDQ 2UUCL 4C1NI 2AWTA 2PQAB 3HOVH 2I5LX 3VR3A 2KJXA 1STEA 2K33A 1AZPA 5IYBH 4BKSD 4LMQD 1JMCA 1SE4A 3OTOQ 4HJ8A 1YHAA 1YJWA 4ZUIA 1SR3A 1XTDA 2NUCA 3S2HB 2PNHA 1JE5A 1IP9A 5TR5A 2FCNA 4I6LB 1GPXA 4CKBA 1JWSD 2J4XA 2Z6KC 3PUVA 3PV0A 4QMGA 3NOBA 2QJLA 5C5MA 2HTHA 1PYSB 3ONAB 3ZLZA 3B1LX 4LF9L 1XWEA 3MWYW 1YN5A 1LTID 2JYOA 3RFZB 1J8CA 4CGYB 4JI4L 5DEHA 2B3AA 3MHBA 1RTNA 2KVMA 2K4KA 2F52A 2ONQA 1ZOYB 4EEWA 4QIWB 2JEAI 2R2OA 4KI0A 3CQZH 1HZ5A 4A3FH 2PE9A 1CHQD 1U4LA 2E76C 3S24A 3EVQA 1V1OA 1JRPA 3ZJTA 3HKZG 3T13A 2N0SB 1QLBB 4RMFA 3RN2A 3PHWB 4B3ML 4ZDVA 1GUSA 1STGA 2YYZA 1Y1WH 1KFYB 4URKA 5IKCM 4DV6L 2DYOA 3AM9A 1N33Q 2QC8A 3APCA 2IJ0A 3DWQA 4K2KA 1XX8A 3SE0A 3S1QB 1I4PA 1HCZA 3M7GA 4RHRA 2R3ZA 3S1NH 1I4HA 4KJNA 5FJ8G 4R8NA 4F8MA 2H88B 4R4TA 1E0BA 4P16A 2WS3B 4GN4B 2K32A 3NJTA 3A5ZB 1E7ZA 4KY6A 2E74C 4P73A 3H6NA 3JYUA 4JLCA 1PFMA 3KVFB 4HCSA 1IXRA 1QNKA 1SEBD 1I3QH 2INNE 3QJYA 5C1ZA 2DY7A 1XD3B 4A3CG 4ZYSA 4FXCA 2JPHA 4HKQA 5COYA 3SVMA 5BN3A 1WD1A 2KMAA 3BK1A 3GTOH 1I50B 3AI5A 3NZSA 2NBUA 3A1QA 3L0WB 2A5UA 2LGIA 4J1MA 2ZNVB 2NVTH 2UUAQ 3GZNI 3BDOA 1ZKOA 3DEOA 1ZKHA 1U4PA 1PH8A 4FJYA 5GADC 4CHTB 5IP7H 4Y7NH 4A8XC 3DMUA 4GNXC 1XMQL 4HIMA 3NBIA 4ZRZA 3I4NB 4KTAA 4W9DA 1VQBA 4YSYB 3VR8B 4HLEA 2BS3B 3WOEA 1RYJA 3DBRB 4DDID 4M01A 4GOCA 2GBRA 2KLGA 3QC8B 1X6OA 1FCLA 1XXGA 5JPMC 4USAA 1UWVA 1SGHA 2BPSA 3TREA 1N62A 1K9MC 3I4MB 3VVWB 2PMZE 1EY6A 3I56A 3ML8A 2KDMA 5E4WC 1XPRA 1YJNA 1YD8U 1QQRA 2CJNA 4GDKB 4RKLA 1AH9A 3I9V1 3V3XA 1E8XA 4IUPA 1S72A 3ZIMA 2Z4HA 5CX3A 1NMFA 1WF9A 1WGHA 2KN5A 2JZPA 4ABNA 3QO2A 3I2ZA 2WAQG 1E7UA 4C3IG 3RLFA 1F2MA 1SE3A 1IBLL 4A3GB 2RSUA 2J7QB 1RKNA 4ICUA 1M90C 4B0MA 2WAQB 4NXMQ 2J0JA 4WWNA 2K52A 3HP3A 4IFDI 1G6JA 5CR3A 5IGBA 4GKKL 4YT0B 4XDXA 5D3IB 1Q12A 2IY0B 1E0ZA 2K50A 2B39A 4C3HB 4OL7A 4DF7A 4ZRKA 3VR9B 4XZ4A 5CBEE 3DEPA 3HEJA 1V49A 2MHVA 5JEAG 3DXJC 1YOVB 3KLSX 2DN8A 5JVH3 2AKWB 1L7YA 1D7QA 3N1ZC 4J6IA 1GHJA 3ZO5B 1G2TA 3G7LA 4QY7A 3OW7A 3AE5B 1RIPA 3X23A 3EA6A 5I2XA 1KH0A 4R4OA 1XJVA 1EQVA 3R2TA 4DV6Q 3R3OA 4XDDA 3A55A 2K8CA 3RUIB 4F7XA 3E9HA 2GBNA 2AUKA 4JOIC 5EBDA 2TSSA 2A68D 1KF6B 3AEDB 2JQRB 3KWVA 2V1CC 2VB2X 1S3OA 3GD7A 2HCIA 1LO5D 1EQRA 4UP7A 3QARA 1QJOA 4DR2Q 2MBHA 4M1UB 2NVUI 4IDIA 4M0WB 4N58A 1OQQA 4KVGB 5KRUA 4CDFC 2MP1A 2KHSA 1BNZA 2Y5PA 3M85A 2EYFA 3ZKJC 3HOZH 3AB9A 2INPE 4LLGM 3KFUA 4KV2A 3TP6A 2EVBA 1STYA 3SK4A 1GG3A 1WX9A 5J18A 3S1RB 5D94A 2WLBA 1U4RA 4IPDA 5FLXc 2ZVOA 5AEKB 4RFBA 4AOFA 2N7JA 1P3QU 4W9EA 3J7A5 3L10B 4QUFA 3LB8C 2BH8A 2HJ1A 2ZTDA 4YL8A 3H94A 1NAPA 4A3IB 1UE7A 3VYRA 5C3EH 3A9KA 3H0GB 3C8YA 3VTUA 1MI2A 1BCPB 3DWPA 3UQBA 2VB3X 4PQXA 1IYVA 2KWUB 4DR5Q 2I1JA 1Y56A 5HKHA 1EQTA 2KUMA 3RLOA 5L37A 3ZDTA 4PS8A 4JIOU 1IBMQ 2JRHA 2WV6D 1OO9B 1PRTD 2QEJC 2CU3A 2VH1A 5AZHA 1T6BX 3VR4A 3VYTA 3AEBB 2DWQA 2L1AA 1XYIA 1SNPA 4O2DA 3UDGA 2D2CC 3S1NB 1SRUA 1YNNC 2WXRA 3P42A 1ZP0B 2QDBA 2D62A 1FPYA 2VUMH 1LT6D 4A90A 4PG3A 3STBD 5LNK1 3SFEB 2KDEB 1WTPA 3TZUA 4OWWB 2DY8A 2A73B 3KOJA 1F2ZA 2BB5A 5C3JB 2JZZA 2WKDA 2F0OA 3S16B 5M5WB 4JK1C 1IW7D 2TMPA 2W55A 1HHVA 3B6YA 4DHZB 5BMIA 1X3EA 4DFAA 4J3OD 3MC9A 2E5LL 4YXDB 2ZJQA 2M8SA 1V81A 2MFIA 4F7ZA 4NMZA 2GBMA 2OTJA 2KHJA 3AEAB 4C3JH 3DHIC 3EECA 4DAYA 1HZAA 4KY5A 1N5XA 2X8XX 3NRZA 4NKLA 2KJHB 4DAYB 1TWGH 3B0AA 3WA0A 2M0AA 1N8RC 4BBSB 1PQSA 3V62A 3P7JA 3ZTCA 3GTJB 1EFID 2HT1A 5LMNQ 2LGDA 4WAAA 2HUGA 2KD0A 4BZAA 1Y8OB 4BY7B 1C77A 1YJJA 2VUMG 2EYMA 3HOXG 4X65L 3K5OA 5JEAH 1YQ3B 5EQ0A 4G4KA 1MIUA 4JI3L 3J81i 1EIHA 3PPAA 2V1YA 2LWPA 3VQIA 3NP8A 2RBMA 1ZYRD 5C6AA 2JYEA 4EZLA 1NDDA 1P7EA 2K9XA 3CSTA 1IKLA 5HHDG 1U4AA 5EJWA 5DNFA 1NMGA 4WJPA 4ANXA 3U9OA 1HJPA 5CV8A 2EJFC 4ZLTF 1F9QA 2MX2A 1HNXL 5GROA 4DNTB 5IGGA 3GTGB 3M4QA 3N1YC 3PV1A 1Y1VB 2N7DA 1TKYA 3D32A 3I7FA 1HNZL 5IYCG 2KVZA 3GV3A 3GTMH 3EC8A 2ZTCA 3WOFA 3PO2H 2K01A 1SDFA 4O0AA 3T3NA 2LSSA 5IO9A 2OXPA 2BYTA 4GKJQ 1R9TB 1P7FA 4ARCA 4LWCA 3K57A 4DK6C 3G4SA 3HOUG 3DHGC 2EXZA 1CSPA 1JC7A 1C1YB 2OTLA 2DNEA 1G2SA 2WINB 1HNZQ 2KNBA 3NE5B 4P6VF 2GVBA 1PXUA 2BE5C 4OWXB 4F8CB 1TT2A 2PI2A 2KZRA 3L16A 3VTVA 2L0CA 2ZZPB 4HSPA 3F2DA 1P8LA 3A54A 4G0NB 2FJ2A 1KLVA 3RNFC 2Z8LA 1EY9A 3S1RH 1X9NA 2A6HC 4HCNB 3L17A 2AYOB 2VY3A 1MPEA 3CP0A 3T53B 5CV4A 3ZYYX 5M3FG 1XQQA 3W1SC 2WDTB 2YV5A 4K2LA 4DXGA 2B63B 2LXCA 1OXTA 2JA6G 2DBYA 4XDCA 1RCVD 1JJ2A 3AE8B 4FHJA 1WX7A 1D4BA 4DV3Q 2KQ4X 4CO7A 2N1VA 1WJUA 1UELA 1PLFA 1TKEA 2I5MX 4QQBX 4K5WA 1J5EL 1X56A 4A3IH 1RHPA 2KEEA 3FEWX 2L52A 1BQQT 1E2VA 5I9PA 4JI3Q 5FLXE 2CHZA 2LD9A 4OW0A 2ICIA 1E22A 2JE6I 2C9WB 3PT2B 2P5ZX 1NR2A 1YVCA 3T1YQ 5IGFA 4CDCC 2FCQA 1T0SC 1AN8A 2PW7A 3U2SC 2DUDA 2GB1A 4M0WA 2PW5A 3APFA 3ZVVA 2WWZA 2OT2A 1EIGA 2I1KA 3H15A 1C48A 3L3OC 2Y0SE 1T5EA 2DYMA 1Y69U 2KQ3A 3WALA 3Q8BA 1VJKA 3M4OB 4RA8A 1N32Q 1A70A 4P1BC 2HCCA 5H92C 5HY6A 3KLRA 3UIPB 3D8GA 2QIEB 1CSQA 3F8TA 4NB3A 1ZXHA 4IFDG 2LASA 4CJ2C 5D7GA 2JA7G 2O2LD 1C4QA 3N20C 3I73A 4L5RC 4A93G 2BYFA 2LGYA 5T8IA 1V8CA 4DR5L 2IO1B 3CRKC 4Q0FA 4AQYL 1JALA 4HIOA 2ASBA 3A1QB 2IW3A 1STNA 2CCZA 2I5HA 1RRBA 3NS8A 1TWGB 3RYTA 1VF5C 3AU7A 4H0LC 1GUWA 1BF4A 3AEFB 4LJOB 4L1BA 2CR5A 2N9PC 3JVZX 4IG7B 2RDBC 1ENAA 1UBIA 1BBUA 2O6VA 2EXDA 3UI2A 1IPGA 4OZCA 4YY3L 1C9OA 3HOYB 4G50A 4JPBW 3IAS1 5JJLA 4TMAB 1E24A 1ESRA 2N55A 1TS3A 4DWFA 3TMPB 4BBRG 2SDFA 5JZEB 4POFA 3TS0A 3ICEA 2ZXOA 4JI0Q 1IKMA 3E9SA 1G51A 4N8X1 4KSLC 1PRTB 4OX9Q 2EY2A 2OQ0A 1YI2A 2QW7A 3T9LA 2JJQA 3QB3A 4JI2Q 2O4XA 4IURA 3AE3B 4OELB 4CJ1B 5IY0A 3O65B 4R1JA 5CV6A 4GLXA 2IHFA 3C1FA 3E0EA 2IGDA 1ZYRC 2DYBA 3GDEA 2OEDA 1TWFH 4WIPA 3KJPA 2AQ2B 4HPLB 3W1BA 1VQ4A 4A3JH 3U4VA 2DLBA 2CHBD 5DPTA 1V8QA 4A3GH 4HJ7A 1JWUD 2KX3A 2CVRA 5M3FH 4DBGA 1F9RA 3EROA 1WJJA 3SXHA 4DR3L 1HTOA 2KJ6A 4W9LA 2O5IC 4A76A 3SHLA 1PHJA 1PDQA 4BWGB 4X6AH 5C44G 1MJCA 5FLMH 4LF8L 4W9KA 5KIXA 2ASQA 3CMMB 4MGIE 2VQFQ 4B3SL 1H95A 3HKZE 1YEZA 4HCEA 1T3QA 1RM6C 1IBKL 1EWCA 4X66L 4X65Q 3CMEA 1VR9A 4MJSB 2RDHA 2ZW1A 4AP4C 4FDBA 3KUCB 2Q8TA 5HFYA 1NJIC 4A3DB 3BYYB 1FD6A 1OQRA 2XSCA 2F0UA 2F0NA 3OMCA 4DV7Q 1IYUA 5DM63 3MXPA 4MGKE 2L83A 4JI7L 4ZAIA 1PDXA 4PT5A 3J7AF 2UUCQ 1DZ1A 3NVYA 3RNCC 2ZJPA 1F9SA 1WJNA 3T16A 4DNRB 2XK5B 2EYLA 2VQEL 1KXLA 2HQEA 2PVOD 2K5HA 1WJ6A 4ZQ3A 4XIGS 3VUWA 2HIXA 4IOIE 3BG3A 3M4PA 4HEDA 1N5WA 4LF7Q 1A2TA 1BR9A 3UE1A 1PYWD 4EGVA 3BS1A 4GKJL 3B2FA 4DGZA 1FM0D 1X3QA 3CWIA 4AQ7A 1W6KA 2VW9A 5C44H 2L05A 4LF5L 3H9DA 4JYAQ 1D5XC 4EFOA 1LT4D 1H9RA 1VQ9A 4BKGA 1CK1A 1XPUA 4JCVE 1WXAA 4RMAA 4C3HG 2JXXA 1I4RA 5H1SE 5FR3A 4AYBB 1WGKA 1EYAA 1DOLA 1TJEA 3J81c 3M4YA 2F03A 3GTPB 2VNUD 4JV5L 3C3LA 2PTLA 1XLNA 3Q8EA 3PIOA 4BBRB 2INCC 1ENCA 1DGSA 4B3TQ 4KHVA 3HOZG 3GZNB 1C9FA 4RCOA 3K8AA 2DNCA 2EMTA 2JA6B 3HOYG 3J80i 5E6NA 1K51A 1B2TA 1K8GA 4BY1B 2UU9Q 3JC66 1Z47A 2IY5B 1E6EB 4S17A 5C4XH 3H3VH 4WORA 1L6UA 2WX1A 1LTRD 4RM8A 1F2RC 2DJGC 2F0HA 1AZQA 4AYBG 1UH6A 1EU3A 3ND9A 2R61A 2OF1A 1I3QB 3K5MA 1HUNA 1QF6A 3P20A 2BBCA 3KW5B 4GSWA 3VH4B 2VRRB 1ILPA 2F0LA 3ML9A 4K3BA 3I5JC 2PQEA 1IL8A 1I50H 4CKEA 2UXBL 2WXOA 3TL5A 2K14A 5C4JB 3VDYA 2A74C 3R3MA 2F4IA 1I94Q 3H91A 4IPHA 3J81j 4JE3B 2I46A 2ZXPA 1J5EQ 2F0WA 3Q3FA 4L5TA 1TWAH 2EOTA 2PZUA 4XC2A 2LVQA 2NCNA 3Q6BA 1KTKA 5GAEC 2FCSA 1AP0A 3PF5A 3VXWA 2V9HA 4KKUA 3NS1A 2CWPA 1QVGA 2B2WC 1R7SA 4HKZE 3TUOA 3P1HA 4KGSA 4IUVA 3W1SA 5J1ZA 5GMVA 4X3SA 3QK0A 3VA5A 2KCCA 1CTMA 3BZCA 3SDLC 2O2VB 2BQQA 1RD9D 1OTCA 1IYJB 2HDEA 2QCZA 2F0VA 4ZUJA 3ULPA 5ISRA 1H9MA 1BOSA 1WZ0A 4JWSC 1SROA 1B9MA 1VS0A 4UP8A 2K6QA 4ZRIA 3UINB 5LL6X 2FXQA 5KYLA 1YN4A 4HCPB 1CZWA 3P75A 2KA7A 2Y0SG 2RKSA 3FHWA 1TGZB 3QQ8B 3C0RB 1V6EA 4II3B 4C3JG 1OXUA 4IKGA 5EKIA 4BS9A 2GMIC 1WFQA 3KJOA 1Q0WB 1CJEA 2UUBL 5M3FB 2QKIC 1S5ED 2LHEA 4FXGC 3V60A 1PFNA 3OJ4B 2FE8A 2W3RA 4B6WA 1FEHA 2D0OA 2OQKA 5EKKA 1K83H 1A8VA 4H2AA 3UDXA 2KOLA 1B9NA 2D0PA 3K5LA 2YEPF 2Q2IA 2KAJA 2AHOB 3NWTA 4XT1B 3ZJYC 2UUBQ 2KQSA 4TQ0A 5M5YB 3UGBB 1ASYA 4A3CH 3U7ZA 4EVOA 4A3BB 2CU1A 1VQFA 2F0PA 3P1MA 3TJPA 1VQEA 1LM0A 1HNWQ 4HSVA 1BXTA 4ME5A 3ER0A 2FCMA 4HROA 5CYUA 5LXIB 1UWMA 3KBGA 1CMXB 2NS5A 1GB4A 4HR7B 1QOAA 3DLLA 1KHIA 4IFDJ 2L0TA 3JAML 3L54A 2NZ1D 2KWCA 2K28A 4A3DH 4TVAB 1YX6B 2C9OA 4MZ9A 3MAQA 4ARIA 4N9PA 1B8AA 1QT9A 4IUUA 3NENA 3V05A 1ET6A 1SJHD 3QOJA 3HRZC 5CC4A 1VQ8A 1WRDB 2KOXA 1NENB 3O13A 5IAAC 3OPOA 4ANUA 3T3OA 2EYHA 3QX1A 4A3FB 4PZ6A 2EKIA 5IA7A 2V3PA 1J19A 4OO1I 5IP9H 4W9FA 1EWIA 3W1YA 5BYQA 3NQTA 1UF0A 1LT3D 1SXTA 1E2WA 1I4QA 1Y14B 1W6JA 2A5HA 4MNOA 3DBLB 1OFFA 3RD2A 4DK3C 1IZ6A 2LZ6A 5C44B 4XYQA 2GLSA 2J52A 1B70B 1ICFB 2K8HA 1TR5A 3S1QH 4R8IA 2BA1A 5EGTA 2LVOA 3N30A 5TSSA 2NN6I 3Q3NC 2KT7A 3BZKA 2WGSA 2OOBB 4FJZA 3G48A 5E4XA 3V6CB 3IHPC 3NSWA 1Z2MA 2L32A 2JA6H 5AZFA 4LNNA 1WCMB 1YQBA 2YLMA 1FXAA 1JWMD 1YHQA 2WXFA 2X6LA 2SNSA 2YVCA 5A35A 4UHVA 2V4IB 2HJ8A 3KLSA 2M56B 2EYPA 5DLQE 3EQLC 3EFCA 1IBXA 1AEXA 2FINB 4HRSA 1F9PA 1KNEA 2K5WA 3WWVA 2MEKA 3A9KB 3K9OB 1IBXB 4FNFA 2PZTA 5M5WH 1E8YA 2DZKA 2K25A 3DPDA 3RPFC 1HPCA 1DOKA 1Q8KA 3RZDB 5C4XB 1TIFA 5D3DA 4GN3B 5JAVA 3GOEA 3EIVA 2B2UA 3BVZA 2BKFA 1KJTA 4EOYA 3JW0X 2KWDA 1J9OA 1FNWA 4LF5Q 4FF4A 1K8RB 3U4EG 5C0XH 4FN2A 1E9MA 3AXCA 3J81E 4NXNL 4LNQA 1G91A 2NBWB 3FAHA 1IHZA 2NZOA 3FMCA 4Y7NB 1WD0A 4YWGG 4C3JB 4K6DA 1PTOD 2LXJA 3E6ZX 4I7ZC 4DV3L 1P98A 3IVFA 3KUDB 4XYCA 4QB4A 4BBSH 1BO0A 2F0DA 4JV5Q 1VQAA 1YBYA 3DUZA 3R8BA 3TBIB 2IBIB 2JT4B 1FNVA 2RVLA 1WTOA 4N8FA 1IBLQ 1K8OA 1KRHA 1YN3A 2R7FA 3VR6A 2RPQA 3N32A 2QMTA 2F0SA 3SD5A 3ZXRA 3CXCA 3T1YL 1UUPA 4IJHA 3JSVB 1TZOA 1WR6E 1A3VA 2JWUA 1AWDA 1ESFA 4C3HH 3HOUB 4LCDE 4LDTB 2RF4A 4EX5A 3AU5A 3R7QA 3JAMi 1E5WA 4LNFA 4A9AA 5BMGA 4TV3A 1R4NI 4YTNB 1VD2A 4GDLB 3IAM1 4L5QA 3DWGC 1T0QC 1WE6A 1UD7A 2C60A 3MFGA 4IWPA 3TP8A 4DV0Q 3CCUA 2JA5G 3KLWA 3MEHA 4LFAL 1N60A 2AQ1B 2NVYB 1QNUA 4IN3A 4K6LA 4MACA 3FKIH 2NN6H 2VZKD 3Q23A 4LUZA 5ELBA 3VHTC 2XWJB 3A7LA 4DV1L 2GBJA 3CW2C 2KYWA 3DBLI 1VLBA 1FGUA 4AWJA 2O2VA 2MLBA 1LV9A 1EZ8A 1VZ8A 1L1OC 2CW0C 2NZHA 3K7AH 4IUQA 2Y5CA 3AEEB 2KJRA 3FILB 3S15B 4EZJA 2L9HA 4B9XA 3FILA 1SFOH 1K83B 4CDDC 4FF3A 1C4AA 2MH7A 2CQOA 1ZGUB 2IGGA 4MJSA 1WXSA 3LNNA 1JRUA 3CAMA 1TT5B 2E2JB 2KDIA 4MT5A 4WQOB 4C80A 2Q2HA 1VQ5A 3HOZB 3U8ZA 3PO2B 4LFCQ 4A3EG 1QOGA 2AL6A 1SYFA 4ZK9B 3ZNHB 1RODA 3FVQA 3I4OA 1UNSA 3CC2A 4JL9A 2KLCA 1Q1BA 2ZXRA 3D4DA 3K58A 1YIWA 1T5XD 1NNXA 2XK5A 5M3MH 1OQYA 1UE6A 1II3A 1HA6A 4OX9L 5C4XG 4BKSA 2LHDA 1SB3C 5G3LF 4RH6A 2B2WA 4GB9A 2AMCB 2J42A 3VUYA 4OONA 2K39A 3NVVA 1WZ3A 2XRSD 1B7YB 2LVPA 1SMYD 1VF7A 4BA1I 5K5PA 2A69D 4NPNA 5JHAA 2VH2A 3HKZB 1VZ7A 3L08A 5GQOA 1VRAB 2HE7A 2ID0A 3Q14C 4GIVA 3DVNV 1ZUD2 3J9CA 1KABA 5A2QE 4EZKA 2WXKA 1OEYJ 2G1EA 4H44C 3RD4A 2YTXA 2B63H 2Z59B 1FD7D 3I4MG 2KFJA 4HJAA 1WCMH 5C0XG 1CUKA 1Z5SB 4I6PA 3I63C 2BYEA 1V5OA 2B2TC 3I57A 3AECB 3TS2A 2F3WA 5ELOA 2EDGA 4R4QA 2B3GA 1SMYC 1B3AA 4IPGA 4B3RQ 1EO6A 4WJOA 3AEGB 2GI9A 1HZ6A 3TEHB 1YHBA 2YTVA 2GBKA 2WU5B 1GUGA 1HH2P 1PZID 4GZYC 3Q69A 2Y3AA 3RI7C 3CCMA 1G6ZA 1MHHE 4JI6L 1JQYD 1ACCA 3PIPA 4XQNA 2KWVB 3PREA 4DHZE 3RZOH 1A3TA 1B44D 1N9WA 4X3UA 3S9WA 2KFKA 5FO7B 2CH4A 3ZUNA 2YU9H 4RF1A 5A2QL 2C7NB 3FPUB 2IO0B 4JI7Q 5J2RA 2F1MA 3NHHA 2NVQB 2KHWB 2D9UA 2SOBA 3HGBA 2D3GA 4IJLA 2N3SA 1X3GA 3S17B 2AQ3B 5I6WA 2B29A 3BINA 3H7SA 3I4NH 3K80C 1FFUA 4OZBA 4WURA 4DK0A 1BKBA 1XO3A 2JUOA 3WIMA 3TEZA 4LF7L 3P4SB 1PMRA 1VMPA 2CH4W 1KD1C 2JZ3B 4F1SA 3AFQA 1AYFA 2E8GA 1UGJA 1GXDC 3AB5A 3GTQB 2XNAC 2L3ZA 1L0WA 1HXYD 3A8IE 2RPVA 4BVUC 3FKIG 5DM73 1EWHA 2BKRB 1PH6A 2ZM6L 1CA6A 5CV5A 1OXXK 5EE1A 3KUPA 2R7ZB 1F2RI 2QDFA 1YJ9A 1WGGA 1H8CA 2NTTA 2NBFA 1T9HA 5JPNC 1PH9A 4X62Q 1BCPF 1TXYA 1C8CA 2PW9A 5DCNA 1ZW7A 4B9KA 4K1RB 1WSPA 1VCIA 1S5BD 2UU7A 1V1PB 2D2QA 1Y1WG 4MN3A 1B1ZA 2GN5A 3CCVA 4A3MH 2MJ3A 1BVSA 4M8NA 2K22A 4NAMA 2PJHA 4DR6Q 3TQYA 2O6VB 3DHQA 4YTMB 2Y0SB 2FHTA 2SAKA 4IM2A 4JG2A 1R4NB 1Q46A 1VZ6A 1LACA 3P4PB 3K59A 3AE7B 4OIKA 2ZNVC 2JA5H 5J22A 2JX5A 3VRBB 1E1TA 2KEDA 2NN6G 3OW2A 3NHEB 5LMNW 4NQLB 1U9RA 4RHSA 2KDBA 5EPKA 2JA9A 1RL2A 5IOCA 3OMGA 3HOXH 2UUAL 3PO2G 1EIFA 2ZCCA 5KNCA 5IP9G 1SYDA 4KK7A 1KM7A 1S40A 4ANWA 4JI1L 3F2UA 2N9KA 2L12A 2L55A 4F88A 4HJKA 3S15H 1EQQA 1JWAD 3H1UA 4K7UA 4WWOA 2A6ED 1KDCA 1ZEQX 2WX0A 2KENA 1EOVA 1P0RA 4GDLA 1EY8A 2B2UC 3EBEA 1KAAA 3W3AA 1EIYB 1BMLC 1V9PA 3OAWA 2KCTA 5ELFA 1LM8B 1Y1VG 2F0EA 4TKOB 3D3RA 1LLRD 3MTNB 3S1MH 2V3NA 1XCQL 2IO2B 2XIWA 4LFAQ 3CC4A 4NW2A 1GUTA 3L0OA 1N6ZA 3RN9C 3LXFA 3SR1A 3LWEA 2BWES 2RCNA 1ROEA 1LTLA 5D6JB 3RLNA 1CZGA 4GOPB 1X55A 4ALPA 1NE3A 3AH7A 2EMSA 2PI2E 4GOPA 3CF5A 2F4VQ 3M63B 4DUYQ 1PH3A 4KKIA 1KQSA 1D5MC 5BN4A 4KZCA 1NI3A 1YNJC 1Q5WB 1TU2B 4N9TA 1SNCA 1Q8IA 3C46A 1K0SA 1EM7A 2FIFA 2KVRA 3EFUA 4FADA 4KZ0A 2KHIA 3I90A 2KCMA 1WTWA 1L6VA 1EY0A 4BY1G 1N36L 3S14H 2K5QA 1N32L 2N7EA 1SJED 1EYDA 1LUZA 1GD7A 1NI2A 3BY4B 1LABA 1TS2A 5LMUQ 2IPKD 3DBHI 3I55A 5H8YE 1NVID 1ZXTA 2L76A 2JSVX 5CTRC 1VQIA 4L63B 2MQHA 1ISNA 1TS5A 1F2YA 4BFRA 3I3CA 4FXKC 3K7UC 3ZNZB 3OIQA 2GVAA 3KF8B 4ME3A 4P71A 4DA2A 4WJQA 4ZRPA 2L00B 5FLXL 2CS4A 3CRLC 3KF8A 1PH5A 1F9JA 3U58A 2DNFA 1PTOB 3X0WA 3L9AX 3P63A 3CD6A 4MH0E 3ONSA 1TWHH 1SIFA 1K3BC 3S16H 1KDBA 3ALBA 2RA4A 3GTOB 1HNWL 2W3SA 1PZKD 3G6EA 2O6VD 3MHZA 2Q2UA 4RM9A 4WJNA 1KDAA 5ELDA 2Z4IA 1XCTL 4TKNA 4ASWC 1GJXA 2G9HD 3HKSA 4L5SA 4U68A 3UF8A 2WDQB 4II2B 1EY4A 1BCPD 1V9JA 4B0EA 3T56B 1B3QA 2R93B 1VQDA 4IALA 5NUCA 1Q86C 2I2YA 1PH1A 2JN4A 5E7NA 1BBWA 4I7AA 2XVSA 1RF2D 2R92B 1V80A 3TEXA 2Z6KA 1YIJA 3A9JB 1FJGL 5LLIA 1QB5D 1TKGA 2LGXA 3DOWA 1F0ZA 4YWKA 2LUMA 1MJEA 2F0JA 3WAMA 3LWUA 1FRDA 3IKJA 5CBAE 2NVTB 4NPSA 2B2YC 1UZXB 4W9IA 1TBEA 4E71A 2W9NA 1JICA 4FYDA 4A3LH 3PS6A 2Z6BA 1G291 4A93B 4IFDH 4K81A 2E2IH 1YX5B 2WXNA 4M00A 2J0KA 3FRPB 5JEAJ 1DXMA 4NNJB 2EY5A 3JSVA 2MCNB 2XEWA 4G11A 3KDFB 3UE0A 2NVYH 1HR0L 1MHXA 3KDFA 3D4WA 4AQYQ 4DV2L 4US8A 1SYBA 2HD5B 3I4MH 2LXAA 3HHMA 1O80A 2CFMA 5JXVA 2N9XA 2B76B 1WYWB 5D65A 5MPOA 1MI0A 1O7IA 3GTGH 2KC1A 2CW0D 4KJOA 3J7YW 2Q8RE 3BVMA 3NEMA 4LJZC 3CIRB 4A3JB 1RDPD 1J7AA 3ABVB 3RZFA 3Q22A 1ML0D 4OXPA 5M3MG 1PZJD 1I5FA 5GAGC 4WJ3M 3BYTB 1MG4A 3QJZA 4AUQC 4AYBE 2LUEA 4G7OC 2R92G 5KYIA 3DBSA 3KYCD 2UXCL 4PMBA 3ND8A 4MM3A 3EUB2 3VYUA 1TWCH 3W2DA 4K3CA 4R3DA 3ZQ4A 2RQXA 1M94A 1EF1A 4OO1H 4FVMA 3IT6B 2W82A 2Z1CA 1UWXA 2PYKA 1ZE3D 2WXGA 2I38A 5HGTA 4NQKE 4BOZB 2F0FA 1TTNA 4GKKQ 2H5XA 4EUTA 4LFBQ 2NWGA 1F52A 3PUZA 1X54A 4HJ5A 3HOVB 1B53A 4A3GG 5GXGB 2K8BA 4HDQA 2HDMA 4IM0A 1GC6A 1ICWA 1TIID 4J15A 4JI8L 4GNXA 4XX5A 1TVXA 1I35A 5IOIA 3PO3G 1SMXA 1XLOA 4GNXB 2WXIA 3MC8A 3P4QB 3WANA 3NBHB 4PZ8A 1RFAA 3L4PA 1K73C 4RAUC 1XTCD 2L0FA 4G3XB 4X64Q 3D6WA 2LY7A 1V43A 4L6TB 4S3SA 1PH4A 1MVKA 1HQMC 2AEHA 3OSOA 4B95A 3T1HQ 1WIAA 1SBBB 2N9LA 4ZKCB 2XGTA 3CCRA 1IBKQ 5C3EB 4BY1H 2MW5A 5EBCA 1WRIA 4ANVA 1C3TA 2XRQD 1GO3E 5EE3A 2MP2A 1P16A 3NTKA 4PNYA 4XQJA 4X64L 2BVCA 4B08A 2DHZA 2MP2B 3ZW3A 2WXHA 2Q2TA 1R4MI 3NY5A 4OGQC 1NBFC 4CYEA 5C4HA 2AWOA 2M9VA 3NTHA 1Q10A 2MBQA 2JXTA 1J8IA 4KKJA 4RNAA 3PSIA 3ZXVA 4CKCA 3DQVA 3S14B 1PGBA 3L13A 3RNGC 3PUYA 2ALYB 3KYHC 2OHFA 3L2PA 3I70A 1JWBD 2ZVNA 3HVZA 3CCSA 2KFKB 4BKTA 4K0KL 1A5RA 2VUMB 2AUJD 4A20A 1EYCA 1KRTA 5CMDA 2B63G 4X3TA 2EELA 2I07B 1F77A 4TQUS 3CPWA 4MSQB 4IQZA 4DR1Q 1YQ4B 1K3RA 2B8GA 3HOVG 3Q8AA 3V96A 2J0MA 1WGDA 2GA4B 4LF6L 1A6XA 2BS4B 2ZTEA 3A33B 3AE2B 1VQ7A 4WJ4A 2INDC 3N52A 4OZAA 3J7AV 4DR7L 2V4LA 3GV6A 1JB7A 2K3UA 4DN4M 4FXDA 5FJ8H 5FO9B 3HM3A 3PLUA 3SHQA 3V6EB 4YHHQ 5D2MB 4BXXG 3ZJUA 2UU9L 2N78A 1C79A 1IUEA 3B08A 3Q3MC 4GU2A 4XWWA 2UXBQ 1AFPA 1S3SG 1L5PA 4IWOA 3CMAA 5IGEA 4LUVA 4KSKC 1BDOA 4JI2L 4CDEC 5I4DA 1XNRL 2C35B 4RWSC 3PZ8A 3ZGZA 4XQQA 5JHBA 4K8JA 4M8MA 2DZIA 1QCBD 4POGA 4B3RL 1JW9D 4FULA 4A6QA 4C7YA 1Y1VH 1W2BA 2MA9B 2DAFA 1HFGA 1CQVA 4ILWA 2KACA 4A3JG 2BF8B 2RHQB 3NWSA 5G5HA 1YNXA 3IFTA 4B9WA 5IWAL 4DKAC 3SK8A 1LTAD 4HVBA 3GTLB 1NY4A 2K5VA 5C0XI 2FUHB 4JX1C 1KLGD 2MGSA 4K8IA 5IT9E 4A3KH 1M8AA 5J39A 2BH2A 2A19A 1LQBA 3CF6E 3FKYA 3VAWA 2PE6B 1MFWA 4A3BH 2WHIA 4HPMB 3HOXB 2BDOA 2PVGC 4NAWA 4IUNA 1E8ZA 3K7AB 3WAOA 3GE8C 3SK5A 4LDTD 1GKHA 5BO4B 2ZPNA 1FFVA 2KCNA 2EJMA 4C56C 2H1EA 1AE3A 1H9SB 3J80E 2MUYA 3OWFA 1GAQB 1H9SA 1PA6A 4DV7L 3PVLA 1R9TH 2DENB 1UE1A 2B2VA 2WKCA 2RD0A 4X66Q 5IP7G 1VQPA 2EY6A 1C4PA 3Q8FA 3FC4A 1JQ4A 2KECA 3W1GA 1WFYA 1CA5A 2EPBA 3NVZA 4YWLA 1DOMA 5ELNA 4DV2Q 2RR9A 1C0AA 1M1KC 2K6AA 1UE5A 3BDLA 3HRDD 4IOAA 4FA6A 3PO0A 3T8MA 5AFWA 3U7DA 4RGOS 4GGQA 4XT3B 1U5KA 2OWOA 4C1NK 1FNUA 1EUVB 3VUXA 1J7CA 1ZDVA 2QA4A 2WXLA 2FAZA 2KO3A 4JYAL 2B2YA 4KHPQ 3SGIA 4HPPA 2BWFA 2LRUA 4MM3B 1N63A 4A3BG 2WDRB 2MNAA 1QOFA 4C00A 1KL9A 3R93A 2VS1A 1STHA 2WB1E 4XYOA 1HEZE 5JH5C 1EEFD 3A5UA 3TP5A 1NBWA 5HURA 1T0RC 4DHJB 4IWQA 3ZTDA 1NR4A 2FMMA 1Q7YC 1J7BA 4NDXA 2IHEA 4YSXB 2A6EC 1BUVT 1N34L 3AE9B 1E8WA 3LGJA 4TQ1A 3HZXA 4GMVA 1VQGA 3RUZA 4O1NA 3B9JA 3CPFA 5JJZA 2R93H 3Q0AA 5FKAC 3Q24A 2UWQA 1HTQA 2D3CA 3KUZA 3NBHA 3RMHA 3IG3A 2FBWB 2CHWA 2LMCA 1HR0W 2R92H 1UAPA 3KK7A 2LMCB 4V0BA 5D14A 1GUNA 1CKNB 3G71A 4DUZL 4N9F4 3DM3A 4HK2A 3T1HL 1K28A 1HZBA 2ENBA 2J0TD 1CM9A 3IRBA 1WVLA 3W9CB 1CT1D 4YCWA 2YU9B 2G45B 2F0MA 4EQNA 1GOZA 1VQMA 5L83A 3GTKH 4ZRJA 3KF6B 2JA8G 3Q8CA 1NEKB 3GTJH 5C3WA 3PCOB 2PEAA 5M5XB 2BCOA 3M3YH 1E90A 1K52A 3M9BA 1S5DD 4HIKA 2A69C 5CGKA 3DCGA 3RR5A 3IAYA 3PQIA 3PRMB 3A9JA 3AQQA 5AJ3Q 1LYLA 2N9EB 2LKVA 3CCLA 3BK2A 1MD2D 4M8AA 1SNDA 1JROA 4D2KA 2Z0SA 3K9PB 2WXQA 1DONA 3AFPA 3MFYA 1PUTA 4A3KG 1FGBD 4JPSA 4APVA 4IM3A 1QKZA 2MHJA 1U4MA 1OXSC 4CQNA 1V1QA 3AEVA 3MXNA 4GLAC 4OO1G 4QF4A 4QUCA 1O7LA 5J17A 3MXNB 4WJWA 1SE9A 2A8VA 3KH0A 4DV1Q 1K8AC 1CZPA 3V61A 4PYUA 4MIUA 4MDKE 3GTLH 3E5SA 3BVGA 4K0KQ 2WXMA 4KN7C 5IODA 4LW1A 2UYZB 1MSHA 2WXJA 4DR4L 3HG9A 3D0FA 2HHHL 1SYEA 3K6OA 3SU8X 1G8ZD 5I6YA 1PTOF 2OJRA 4KHPL 1K0RA 4H02A 4P72A 1JOQA 3TEYA 4JI4Q 3CCEA 1PYBA 3PGEA 3Q6SA 3FPPA 4C2MH 2NBVB 4W9JA 2BYVE 5IN7A 1XF5L 2K1FA 4LTUA 3TP7A 5T1IA 1PGXA 2ZJDA 3FKIB 2ZEQA 4FP5D 1V1PA 1KRSA 1W3SA 5C23A 5DPRA 4IOCA 3H3VI 1AARA 2D3AA 4LNOA 4REZA 4S0RA 1YITA 3HS0C 4JBWA 1A62A 3DHHC 4W9GA 5IYBG 3CU7A 4P75A 1B50A 4UDUC 3KYDD 3QCAA 4XWTA 3D4RA 4WAFA 3R7RA 4V190 3AU4A 3S2HH 2MJEA 3TBLD 1STAA 4EQOA 4CHKA 1DOYA 2PPBC 1IGDA 4WH4A 5KNBA 4JVZA 3TN2A 2Q5WD 2JSOA 1WTQA 1K8MA 2E5LQ 4N59A 1F2LA 1SE8A 1V97A 4PYZA 2QGQA 1GM5A 5EE0A 3V2TA 3C2PA 3W5VB 4DV4Q 5KNDA 4GXBA 1QUQB 2FMCA 5IWAQ 2VZAA 1A0IA 4G57A 1WTXA 1GNUA
chains in the Genus database with same CATH topology
1UEAB 1Z6HA 3CQZB 4K5VA 3A8JE 1Q1EA 1S4ZA 2RDFA 3EJIA 3EFXD 4PMCA 1EWYC 1NYQA 3KBXA 2CQAA 2PIAA 1PRTC 3GQBA 3AE1B 4GLSC 1SYGA 1NYRA 3BZDB 2NTSA 1YNJD 4WFN3 3MP9A 1TKWB 2G9DA 3WDNA 1L0YB 1ZDXA 4DAPA 3I4LA 5JOBA 4DU9A 4KGTA 5G5GA 3SFDB 1CI3M 4BA2I 1QOBA 5IGCA 1R4QB 3AV8A 4ZRQA 1L0XB 1B4OA 3D31A 4KKTA 2RMMA 2PMZB 4K5XA 4U673 5G3LD 4I65A 1SSNA 1TY0A 1HUMA 2F3VA 2PO4A 2E6XA 1DOIA 1SNQA 2F0IA 1TWHB 1L4ZB 4DAVA 3SR6A 2B2VC 4HN7A 5AUKA 2M19A 2LJIA 3PUWA 1EY7A 5EPJA 3MJ5A 3AMUA 1DOXA 5EKLA 2IL8A 2JYTA 1NUCA 2LS01 2WXPA 3MXGA 2X69A 2A6HD 3TDQA 1LTSD 1PTOC 1O78A 2IX0A 1DM0B 5IGDA 3BDCA 1QWYA 1HTPA 3MA2B 1S5CD 2WIIB 3QOLA 2AX5A 3BWUD 4A3KB 5E3FA 2NMQA 2JA5B 1BCPC 1TY2A 4H7BA 1MBYA 2RDGA 5FOBB 1EL0A 1O7YA 1FIQA 2QSDA 4OIJA 1TWFB 3VR2A 4CBVA 2QF7A 1X3PA 4ULLA 4YIJA 2K03A 3HVDA 3CHBD 1XLPA 4A3MB 1D1KA 3PIO3 5ELCA 4K14A 5C2TB 1ZXIA 5CORA 4ODGA 1QOHA 4NAWB 4KV6A 3NXWA 3TEWA 1B9RA 2MJ8A 1HFNA 4QCLA 4MHEA 5C4ZA 5C0XJ 2JP1A 4HMJA 4FO2A 2WNMA 4ZKBB 2IX1A 1LT5D 4N6EB 1SAPA 3IL8A 1Y1WB 1FO4A 4NJCA 1D1IA 1DCZA 2BW2A 2GRIA 1MGSA 2K5PA 3LYYA 2BOSA 3VR5A 1ZPSA 4X3KA 3NQIA 4G7HC 2EJGC 2K04A 3GP7A 4G7ZC 1I4GA 1FRRA 2ICEC 4Q2JA 2EE1A 3GS2A 2WP9B 1C4CA 3AMZA 4KX6B 2F0TA 1A15A 3NTIA 1SNOA 4HAEA 3MTSA 2LFIA 1D6EC 1CQFA 1Z7TA 3TMEA 3H6MA 3T51B 2LEKA 3HUIA 2WP8J 1RWSA 2JEBI 2C5CA 1ILQA 4Q5VA 4RKBA 4RGNA 3U9SA 5K36G 4ITKA 2IX3A 1PTOH 3W5UB 4RCNA 4KD4A 2IT1A 4WWMA 4XE0A 2AWNA 1RJTA 3E56A 2BE5D 1FMAD 3PMFA 2K5DA 1DJRD 4KY7A 1TWAB 4L2YA 4LAAA 4ZOHC 2D5GA 2ON8A 4OVZA 2WDVB 1STBA 2K7VA 1JCKB 1EEID 5DAUA 4XXEA 3ETRA 2IWHA 2B8FA 5EPLA 1CHPD 4IUTA 5I9OA 4ZHOA 2JU6X 1LTGD 1MSGA 3DM1A 4IZ8A 4LK1C 1TS4A 2KN4A 2ACZB 4WRDA 2K1BA 3U52E 4KHZA 1QILA 1WTRA 3IXSA 2E2DC 5BYSA 1OXVA 2WQYB 1LTTD 4A3EB 3L7ZC 3A56A 3SEBA 4MH8A 5EE9A 4PMWA 1SE2A 1X32A 3GB1A 4DQOC 3NZ3A 2RSOA 3EGRA 4CJ0B 1I4XA 4KD3A 3VRAB 2NVXB 4RGTA 2VZKB 3H3VC 4C2MB 3M7NA 1TWCB 4H13C 5FO8B 3J80L 3GO5A 2XWBB 4HJGE 4DK1A 2WU2B 2K05A 2JA7B 2J7ZA 4YTPB 3GTMB 1PGAA 4KGRA 2F0GA 4L8JA 1VMCA 1GB1A 3AE4B 3QWNA 1A2UA 2IGHA 1SNMA 4AS1A 1K50A 4HMIA 2SEBD 3X3MA 2F0QA 4US9A 2JA8B 3H8HA 5IIFA 3JAME 3URYA 1YNND 3IT4B 2E75C 4Z9CB 3HOWB 4PV1C 3A7AB 1E10A 3OIPA 1GHKA 3PUXA 1CFMA 2MPMA 1E7PB 3NK9A 1ENFA 2PMVA 2YEPB 5F2DA 2V0GA 2EYOA 1JORA 5BMHA 2N88A 1PRTF 5JVG3 1WYGA 1JMLA 4EQPA 1S5FD 1NSNS 4RGMA 2W54A 4WQMA 1RFKA 2EZVA 4KMUC 2CJOA 1C78A 1PFDA 3FDTA 5T1GA 2BT6A 3DWMA 3I8ZA 1I6HB 4KN4C 3X3NA 2A68C 1JB3A 3RZOB 3K0YA 2RSNA 2VXWA 4UAIA 3NUHB 1TYGB 2F0KA 4EE2A 3SK6A 2D5DA 3GTKB 3C1EA 3OWEB 2FUG1 5LHY1 5HI1A 2WB1B 2X38A 2SNMA 2H89B 1JE4A 3NPPA 5M9OA 1BUIC 2BTEA 1E0ZA 1H9KA 4TSSA 1SSOA 2B2TA 3TZDA 1KNAA 4A55A 2BDNA 2XN9C 4P2CB 1SF0A 1DD2A 3KQ4A 3WCQA 5LL6S 1IGCA 4XTCS 1K53A 3PIP3 2KMMA 1HA5A 4RF0A 4LK0M 3P4RB 1C76A 1D2BA 1SFOB 1EY5A 3OOCA 5ELEA 3N9YC 3QIAA 1JOOA 3A8KE 2IDYA 1EU4A 1GUOA 4J6HA 3ZJVA 5I2YA 3BIID 1D5ZC 2EYJA 3ERQA 4ID6A 1ET9A 4J8QA 1QG7A 1VDZA 4R9WA 2EY1A 3J81L 1JOKA 1Q3LA 4C7ZA 1YMHE 3CKIB 5C5LA 2PCFB 1RTOA 1AW7A 2E3TA 5M3MB 2JXMB 4E6IA 1L0VB 2PKOA 5E1FA 2NB0A 3S1MB 1N61A 1TQOA 3MXUA 2R6GA 3S2DB 2O5JC 1EOTA 5C3XA 1DYQA 2ZW0A 4NZLB 1HQRD 2LFNA 2QCPX 2L11A 3K5NA 4HTHA 1JR0D 1FR3A 2FFKB 3AN1A 1YJIA 4L23A 1NCVA 3MVVA 3T4AC 1LTBD 5BN5A 1E2ZA 5KEEA 5HG2A 1IW7C 4YSZB 5FK9C 5BYRA 5E6JA 4JWUC 1SIJA 2L4NA 2QILA 3AE6B 1HRJA 3TSSA 1BBXC 5IT9L 4FF2A 3B2GA 2BB6A 3VA7A 4FF1A 1I6VC 3PZ7A 2L5TA 3SDZA 1WXQA 3QG1A 1DGJA 2K0PA 2X6GA 2OEOA 3PO3B 5CV7A 1FXIA 4OHJA 3M3YB 2L1BA 1QE6A 4ZHPA 1EZ6A 1KLUD 3NUCA 3VYSA 1WWTA 3OHXC 5CV9A 2H4OA 1YNTE 4C3IB 3UI3A 1M4VA 2PNRC 2PZWA 3I91A 3R2IA 4KKSA 2J53A 1PFBA 3DWAA 3KWLA 3MC0B 1Y8PB 2E2HB 2E2IB 1I7HA 3IFDA 5AUIA 1ONLA 2WACA 2Q8IB 1O7ZA 4NP5A 3LX0A 2NYZD 1Y8NB 1Q90A 2HDLA 3H09A 3NVWA 1R4PB 1XLQA 4TRDA 2BS2B 2V4DA 2PLPA 3D6CA 1L4DB 2MJDA 1H9JA 3MZ5A 2BA0A 3N6RA 1VDVA 3E0JA 4DXFA 1XEEA 2HTME 1FCCC 4HEA1 1A3UA 5KGUA 4F87A 3I72A 2M2LA 2ZT9C 5K36H 1SYCA 1WTVA 3G6JB 4O42A 1HTLD 2M00A 3ITPA 1FYCA 4C1NI 3VR3A 2KJXA 1STEA 2K33A 1AZPA 4LMQD 1SE4A 4ZUIA 3S2HB 2NUCA 1GPXA 4CKBA 1JWSD 2J4XA 3PUVA 3PV0A 4QMGA 2QJLA 5C5MA 3ONAB 1XWEA 3MWYW 1YN5A 1LTID 2JYOA 3RFZB 4CGYB 5DEHA 3MHBA 1RTNA 2KVMA 2ONQA 1ZOYB 4QIWB 2JEAI 4KI0A 1HZ5A 1CHQD 1U4LA 2E76C 3EVQA 1V1OA 1JRPA 3ZJTA 3T13A 2N0SB 1QLBB 1GUSA 1STGA 2YYZA 1KFYB 2DYOA 3AM9A 2IJ0A 3DWQA 4K2KA 1XX8A 3SE0A 3S1QB 1I4PA 1HCZA 3M7GA 4RHRA 2R3ZA 1I4HA 4KJNA 4R8NA 4F8MA 2H88B 1E0BA 4P16A 2WS3B 2K32A 4KY6A 2E74C 1PFMA 4HCSA 1QNKA 1SEBD 2INNE 3QJYA 2DY7A 4ZYSA 4FXCA 4HKQA 5COYA 3SVMA 5BN3A 1WD1A 3BK1A 1I50B 2LGIA 4J1MA 3BDOA 1ZKOA 3DEOA 1U4PA 4CHTB 4A8XC 3DMUA 3NBIA 4ZRZA 3I4NB 4KTAA 4YSYB 3VR8B 2BS3B 3WOEA 1RYJA 1FCLA 1XXGA 5JPMC 4USAA 1N62A 3I4MB 1EY6A 2KDMA 5E4WC 1QQRA 2CJNA 4GDKB 4RKLA 3I9V1 3V3XA 4IUPA 2Z4HA 2JZPA 4ABNA 3QO2A 4C3IG 3RLFA 1F2MA 1SE3A 4A3GB 2I2YA 4B0MA 1RKNA 2WAQB 3HP3A 4IFDI 5CR3A 5IGBA 4YT0B 4XDXA 5D3IB 1Q12A 2B39A 4C3HB 4OL7A 4DF7A 3VR9B 5CBEE 3DEPA 3HEJA 2MHVA 5JEAG 3DXJC 3ZQ4A 3KLSX 5JVH3 2DN8A 1GHJA 1G2TA 3G7LA 3OW7A 3AE5B 3EA6A 5I2XA 1KH0A 1EQVA 3R2TA 4XDDA 3R3OA 3A55A 4F7XA 2AUKA 3AEDB 5EBDA 2TSSA 2A68D 1KF6B 3KWVA 2JQRB 2VB2X 3GD7A 2HCIA 1LO5D 1QJOA 4IDIA 4M1UB 4N58A 1OQQA 5KRUA 1BNZA 2MP1A 2KHSA 2Y5PA 3M85A 2EYFA 3AB9A 2INPE 4LLGM 3TP6A 2EVBA 1STYA 3SK4A 3S1RB 2WLBA 1U4RA 4RFBA 2N7JA 4QUFA 3LB8C 3H94A 1NAPA 4A3IB 3VYRA 3H0GB 3C8YA 1MI2A 1BCPB 3DWPA 2VB3X 4PQXA 1IYVA 1Y56A 1EQTA 2KUMA 2WV6D 1OO9B 1PRTD 2QEJC 2CU3A 1T6BX 3VR4A 3VYTA 3AEBB 2DWQA 2L1AA 1XYIA 1SNPA 2D2CC 3S1NB 1YNNC 2WXRA 3P42A 1ZP0B 2QDBA 2D62A 4A90A 1LT6D 5LNK1 3SFEB 1WTPA 3TZUA 2DY8A 2A73B 1F2ZA 2BB5A 5C3JB 2WKDA 2F0OA 3S16B 5M5WB 4JK1C 1IW7D 2TMPA 2W55A 1HHVA 5BMIA 4DFAA 4J3OD 4YXDB 4NMZA 3AEAB 4DAYA 4KY5A 1N5XA 3NRZA 4NKLA 2M0AA 4BBSB 3P7JA 3GTJB 1EFID 2HUGA 1Y8OB 4BY7B 1C77A 1YJJA 2EYMA 3K5OA 5JEAH 1YQ3B 5EQ0A 4G4KA 1EIHA 3VQIA 3NP8A 2RBMA 1ZYRD 5C6AA 2JYEA 1P7EA 2K9XA 1IKLA 5HHDG 5EJWA 5DNFA 3U9OA 5CV8A 2EJFC 4ZLTF 1F9QA 4DNTB 5IGGA 3GTGB 1Y1VB 1TKYA 3GV3A 3WOFA 2K01A 1SDFA 3T3NA 2OXPA 2BYTA 1R9TB 1P7FA 4ARCA 3K57A 2EXZA 1JC7A 2DNEA 1G2SA 2WINB 4P6VF 3NE5B 1PXUA 2BE5C 1TT2A 2L0CA 4HSPA 3A54A 2FJ2A 2Z8LA 1EY9A 2A6HC 1MPEA 3ZYYX 3T53B 5CV4A 4K2LA 4DXGA 2B63B 1OXTA 2DBYA 4XDCA 1RCVD 3AE8B 1D4BA 2KQ4X 1PLFA 1TKEA 4K5WA 1RHPA 2KEEA 3FEWX 2L52A 1BQQT 1E2VA 5I9PA 5FLXE 4OW0A 2ICIA 2JE6I 1NR2A 5IGFA 1AN8A 2PW7A 3U2SC 2GB1A 4M0WA 2PW5A 2OT2A 1EIGA 1C48A 3L3OC 1T5EA 2DYMA 1Y69U 2KQ3A 3Q8BA 1VJKA 3M4OB 4RA8A 1A70A 2HCCA 5H92C 3KLRA 3D8GA 2QIEB 1ZXHA 4IFDG 4CJ2C 5D7GA 2O2LD 1C4QA 3I73A 5T8IA 1V8CA 3CRKC 4Q0FA 1JALA 2IW3A 1STNA 1TWGB 1VF5C 3AU7A 4H0LC 1GUWA 1BF4A 3AEFB 4L1BA 1ENAA 3UI2A 4OZCA 3HOYB 3IAS1 4TMAB 1ESRA 2N55A 1TS3A 2SDFA 2ZXOA 1IKMA 3E9SA 1PRTB 2EY2A 3QB3A 2O4XA 4IURA 3AE3B 4CJ1B 5CV6A 3C1FA 2IGDA 1ZYRC 2OEDA 4WIPA 2AQ2B 2DLBA 2CHBD 1V8QA 1JWUD 2CVRA 1F9RA 3EROA 3SXHA 2O5IC 3SHLA 1PDQA 4BWGB 5KIXA 4HCEA 1T3QA 1RM6C 1EWCA 1VR9A 2RDHA 2ZW1A 2Q8TA 5HFYA 4A3DB 3BYYB 1FD6A 1OQRA 2XSCA 2F0UA 2F0NA 3OMCA 1IYUA 5DM63 3MXPA 2L83A 1PDXA 4ZAIA 4PT5A 3J7AF 1DZ1A 3NVYA 1F9SA 3T16A 4DNRB 2EYLA 2HQEA 2PVOD 4ZQ3A 4XIGS 4IOIE 3BG3A 1N5WA 4HEDA 1A2TA 1BR9A 1PYWD 4EGVA 3BS1A 3B2FA 3CWIA 4DGZA 1FM0D 1X3QA 4AQ7A 1W6KA 1D5XC 1LT4D 1H9RA 1CK1A 4C3HG 1I4RA 5FR3A 4AYBB 1WGKA 1EYAA 1DOLA 1TJEA 3GTPB 3M4YA 2F03A 2PTLA 2VNUD 3C3LA 1XLNA 3Q8EA 4BBRB 1ENCA 4KHVA 1C9FA 4RCOA 2DNCA 2JA6B 1K51A 1B2TA 4BY1B 1Z47A 1E6EB 4WORA 1L6UA 1LTRD 1F2RC 1AZQA 2F0HA 1EU3A 3ND9A 2R61A 2OF1A 1I3QB 3K5MA 1HUNA 1QF6A 3P20A 2BBCA 1ILPA 2F0LA 2PQEA 1IL8A 4CKEA 2WXOA 5C4JB 2A74C 2F4IA 3H91A 4JE3B 2I46A 2ZXPA 2F0WA 2EOTA 2PZUA 1KTKA 1AP0A 4KKUA 3NS1A 2B2WC 1R7SA 4HKZE 3TUOA 3P1HA 4KGSA 4IUVA 3W1SA 5J1ZA 4X3SA 3VA5A 2KCCA 1CTMA 1RD9D 2HDEA 2F0VA 4ZUJA 5ISRA 1H9MA 1BOSA 4JWSC 1B9MA 5LL6X 5KYLA 1YN4A 1CZWA 3P75A 2KA7A 2RKSA 4C3JG 1OXUA 4IKGA 5EKIA 4BS9A 1CJEA 5M3FB 2QKIC 1S5ED 2LHEA 4FXGC 1PFNA 2FE8A 2W3RA 1FEHA 5EKKA 4H2AA 2KOLA 1B9NA 3K5LA 2YEPF 2KAJA 4TQ0A 3NWTA 4XT1B 5M5YB 3U7ZA 4EVOA 4A3BB 3P1MA 2F0PA 4HSVA 1BXTA 4ME5A 4HROA 5CYUA 1UWMA 3KBGA 1GB4A 4HR7B 1QOAA 4IFDJ 3JAML 2NZ1D 2K28A 2C9OA 3MAQA 4ARIA 4N9PA 1QT9A 4IUUA 3V05A 1ET6A 1SJHD 3QOJA 3HRZC 5CC4A 1NENB 3O13A 3T3OA 3OPOA 2EYHA 4A3FB 2EKIA 2V3PA 4OO1I 5BYQA 3NQTA 1LT3D 1SXTA 1E2WA 1I4QA 2A5HA 1W6JA 1OFFA 5C44B 4XYQA 2J52A 1TR5A 4R8IA 2BA1A 5EGTA 5TSSA 2NN6I 5E4XA 3NSWA 2L32A 1WCMB 1FXAA 1JWMD 2WXFA 2X6LA 2SNSA 5A35A 2V4IB 3KLSA 2M56B 2EYPA 3EQLC 1IBXA 1AEXA 2FINB 4HRSA 1F9PA 1KNEA 2K5WA 2MEKA 1IBXB 4FNFA 2PZTA 3RPFC 1HPCA 1DOKA 5C4XB 3RZDB 5D3DA 5JAVA 2B2UA 3BVZA 2KWDA 1J9OA 1FNWA 4FF4A 3U4EG 5C0XH 1E9MA 3J81E 3FAHA 1G91A 1IHZA 1WD0A 3FMCA 4Y7NB 4YWGG 4C3JB 4K6DA 1PTOD 3E6ZX 4I7ZC 4QB4A 1BO0A 2F0DA 3DUZA 3R8BA 3TBIB 1FNVA 2RVLA 1WTOA 1K8OA 1YN3A 1KRHA 3VR6A 2QMTA 2F0SA 1UUPA 1TZOA 1A3VA 2JWUA 1AWDA 1ESFA 3HOUB 4A9AA 5BMGA 4YTNB 4GDLB 3IAM1 3DWGC 3MFGA 3TP8A 3MEHA 1N60A 2AQ1B 2NVYB 1QNUA 4IN3A 4K6LA 4MACA 2NN6H 2VZKD 3Q23A 5ELBA 2XWJB 3A7LA 1VLBA 1LV9A 1EZ8A 1VZ8A 3AEEB 2CW0C 4IUQA 2Y5CA 3FILB 3S15B 2L9HA 4B9XA 3FILA 1K83B 4FF3A 1C4AA 2MH7A 2IGGA 3LNNA 4MT5A 2E2JB 4C80A 3HOZB 3PO2B 1QOGA 1SYFA 4ZK9B 1RODA 3FVQA 1UNSA 1Q1BA 2ZXRA 3D4DA 3K58A 1T5XD 1II3A 1HA6A 2LHDA 1SB3C 5G3LF 4RH6A 2B2WA 2J42A 3NVVA 2XRSD 1SMYD 1VF7A 4BA1I 5K5PA 2A69D 3HKZB 1VZ7A 1VRAB 2ID0A 1ZUD2 3J9CA 1KABA 5A2QE 2WXKA 2G1EA 4H44C 3RD4A 1FD7D 5C0XG 2B2TC 3I57A 3AECB 2F3WA 2EDGA 1SMYC 1B3AA 3AEGB 2GI9A 1HZ6A 2WU5B 1GUGA 1PZID 4GZYC 3Q69A 2Y3AA 1G6ZA 1MHHE 1JQYD 1ACCA 4XQNA 1A3TA 1B44D 4X3UA 3S9WA 5FO7B 4RF1A 5A2QL 3FPUB 2F1MA 3NHHA 2NVQB 2D9UA 2SOBA 3HGBA 3S17B 2AQ3B 5I6WA 1FFUA 4WURA 3TEZA 4OZBA 4DK0A 1XO3A 3P4SB 1PMRA 1VMPA 1AYFA 1UGJA 1GXDC 3AB5A 3GTQB 2XNAC 1HXYD 3A8IE 2RPVA 5DM73 1EWHA 1CA6A 5CV5A 1OXXK 5EE1A 3KUPA 2R7ZB 1F2RI 2NTTA 2NBFA 5JPNC 1C8CA 2PW9A 1BCPF 1WSPA 1VCIA 1S5BD 1V1PB 4MN3A 1B1ZA 2MJ3A 2K22A 4NAMA 4YTMB 3DHQA 2Y0SB 2FHTA 2SAKA 1VZ6A 1LACA 3P4PB 3K59A 3AE7B 4OIKA 3VRBB 5J22A 2JX5A 2KEDA 2NN6G 1U9RA 4RHSA 5EPKA 5IOCA 3OMGA 5KNCA 1SYDA 4KK7A 3F2UA 2N9KA 2L12A 2L55A 4F88A 1JWAD 2A6ED 1KDCA 1ZEQX 1EY8A 2B2UC 3W3AA 1KAAA 1BMLC 5ELFA 2F0EA 4TKOB 3D3RA 1LLRD 2V3NA 1XCQL 2XIWA 4NW2A 1GUTA 3LXFA 3SR1A 3LWEA 1ROEA 1CZGA 3AH7A 4KKIA 1D5MC 5BN4A 1NI3A 1YNJC 1TU2B 4N9TA 1SNCA 1Q8IA 3C46A 1EM7A 3I90A 1WTWA 1L6VA 1EY0A 2K5QA 1SJED 1EYDA 1LABA 1TS2A 2IPKD 5H8YE 1NVID 1ZXTA 2JSVX 4L63B 1TS5A 1F2YA 3I3CA 4FXKC 3OIQA 4DA2A 4ZRPA 5FLXL 3CRLC 3KF8A 1PTOB 3L9AX 3P63A 1KDBA 2RA4A 3GTOB 2W3SA 1PZKD 3MHZA 1KDAA 5ELDA 2Z4IA 1XCTL 1GJXA 2G9HD 4U68A 2WDQB 4B0EA 1EY4A 1BCPD 3T56B 2R93B 4IALA 5NUCA 2XVSA 1RF2D 2R92B 3TEXA 1QB5D 1TKGA 1F0ZA 2LUMA 2F0JA 3LWUA 1FRDA 3IKJA 5CBAE 2NVTB 2B2YC 1JICA 4FYDA 1G291 4A93B 4IFDH 2WXNA 3FRPB 5JEAJ 1DXMA 2EY5A 1MHXA 3D4WA 4US8A 1SYBA 1O80A 5JXVA 2B76B 5MPOA 5D65A 1MI0A 2CW0D 4KJOA 3J7YW 2Q8RE 3BVMA 4LJZC 3CIRB 4A3JB 1RDPD 1J7AA 3ABVB 3Q22A 1ML0D 1PZJD 3BYTB 4G7OC 5KYIA 4PMBA 3ND8A 3EUB2 3VYUA 3W2DA 4R3DA 2RQXA 4OO1H 4FVMA 3IT6B 2W82A 2Z1CA 1UWXA 2PYKA 1ZE3D 2WXGA 2I38A 5HGTA 2F0FA 2NWGA 3PUZA 3HOVB 1B53A 5GXGB 2HDMA 1ICWA 1TIID 1TVXA 1XLOA 2WXIA 3P4QB 3L4PA 4RAUC 1XTCD 2LY7A 3D6WA 1V43A 4L6TB 4S3SA 1MVKA 1HQMC 3OSOA 1SBBB 2N9LA 4ZKCB 5C3EB 5EBCA 1WRIA 2XRQD 5EE3A 3NTKA 4PNYA 4XQJA 4B08A 2WXHA 4OGQC 5C4HA 2AWOA 2M9VA 3NTHA 1Q10A 2JXTA 1J8IA 4KKJA 4RNAA 4CKCA 3S14B 1PGBA 3PUYA 2OHFA 3I70A 1JWBD 3HVZA 2VUMB 2AUJD 1EYCA 5CMDA 4X3TA 2EELA 2I07B 1F77A 4TQUS 4IQZA 1YQ4B 2B8GA 3Q8AA 3V96A 2GA4B 1A6XA 2BS4B 3AE2B 3N52A 4OZAA 3J7AV 3GV6A 2K3UA 4DN4M 4FXDA 5FO9B 3ZJUA 1C79A 1IUEA 4XWWA 1AFPA 1L5PA 5IGEA 1BDOA 5I4DA 4RWSC 3PZ8A 3ZGZA 4XQQA 4K8JA 1QCBD 1JW9D 4A6QA 4C7YA 1HFGA 1CQVA 4ILWA 2KACA 3NWSA 5G5HA 3IFTA 4B9WA 3SK8A 1LTAD 3GTLB 5C0XI 4JX1C 1KLGD 2MGSA 4K8IA 5IT9E 1M8AA 5J39A 3HOXB 2BDOA 2PVGC 4IUNA 3K7AB 3SK5A 1FFVA 2KCNA 2EJMA 4C56C 2H1EA 3J80E 1H9SB 2MUYA 3OWFA 1GAQB 1H9SA 2B2VA 2WKCA 3Q8FA 2EY6A 1C4PA 1JQ4A 3FC4A 2KECA 1CA5A 2EPBA 3NVZA 1DOMA 3HRDD 2K6AA 3BDLA 3PO0A 5AFWA 4RGOS 4XT3B 4C1NK 1FNUA 1J7CA 1ZDVA 2WXLA 2B2YA 4MM3B 1N63A 2WDRB 1QOFA 3R93A 1STHA 4XYOA 1HEZE 1EEFD 3TP5A 5HURA 1NR4A 2FMMA 1J7BA 4NDXA 4YSXB 2A6EC 1BUVT 3AE9B 4TQ1A 3HZXA 3RUZA 4O1NA 3B9JA 5JJZA 3Q0AA 5FKAC 3Q24A 3NBHA 3RMHA 2FBWB 2LMCA 1UAPA 3KK7A 2LMCB 4V0BA 5D14A 1GUNA 1WVLA 2ENBA 2J0TD 1CM9A 3W9CB 1CT1D 2YU9B 2F0MA 4EQNA 1GOZA 3Q8CA 1NEKB 5C3WA 5M5XB 2BCOA 1K52A 1S5DD 2A69C 5CGKA 3IAYA 2LKVA 3BK2A 1MD2D 4M8AA 1SNDA 1JROA 4D2KA 2WXQA 1DONA 3MFYA 1PUTA 1FGBD 4JPSA 1QKZA 1U4MA 1OXSC 4CQNA 3MXNA 4OO1G