2J4XA

Streptococcus dysgalactiae-derived mitogen (sdm)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
196
Chain Sequence
b'KDAVLVNSELKNIYMKDVINKTNMKITKKIGTQLIFNKVISSNVSPAQERRFKEEEEVDIYALIKSYSVICKEQYNYVDGGLIKTSDREKLDSTIYMNIFGEQIPLKEQSKYKITFQNKFVTFQEIDVRLRKSLMSDNRIKLYEHNSICKKGYWGIHYKDNTTKFTDLFTHPNYTDNETIDMSKVSHFDVYLNEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN
publication title Crystal Structure of Streptococcus Dysgalactiae-Derived Mitogen Reveals a Zinc-Binding Site and Alterations in Tcr Binding.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Signaling protein
total genus 58
structure length 196
sequence length 210
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2j4xA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j4xA01
2CHBD 1CK1A 3KLSX 4TSSA 4NZLB 1BCPD 2XRSD 5ELFA 1L0YB 1CHQD 1JQYD 3R8BA 1JWUD 1LTID 1LT6D 5ELDA 3V05A 1D5MC 1GOZA 1RF2D 1TS5A 1KTKA 1LT4D 1XXGA 1I4XA 1BXTA 3URYA 2NTSA 1I4RA 4RH6A 1CQVA 1FNVA 3EFXD 1SJHD 1RCVD 3DWAA 4RCOA 1ET6A 1V1PA 3DWQA 1TY0A 3DWPA 4RGTA 1TS2A 2RDGA 1LLRD 2Z8LA 1YN3A 1PZID 1TS4A 3BYTB 1TY2A 4RGOS 1L0XB 2NTTA 1ET9A 1PYWD 1I4GA 1CHPD 1LTAD 1V1OA 1D6EC 2G9HD 2IPKD 1HQRD 1PTOD 1ENFA 1LT5D 1BCPF 1ESFA 1S5DD 1EEFD 1EU4A 2IJ0A 3BVMA 1T5XD 2XRQD 1HXYD 5ELBA 1B44D 1PRTD 5ELCA 4L6TB 2QEJC 1EWCA 1TS3A 4DXGA 2ICIA 3GP7A 1BCPB 2J4XA 2AQ3B 1LTRD 2XNAC 1KLUD 1S5BD 3BVZA 2QILA 4RHSA 1PTOB 4RHRA 1FNUA 1BCPC 1I4HA 1XTCD 3TSSA 1EEID 1JCKB 3MC0B 1PRTB 1DYQA 1PTOH 1PTOC 4OHJA 1FGBD 1RDPD 3MFGA 5I4DA 1HTLD 2XN9C 1YN5A 1S5CD 1SBBB 1PRTC 4RGNA 1HA5A 1LT3D 1SEBD 3SEBA 3BVGA 4O1NA 3EA6A 4RFBA 2TSSA 3CHBD 1EU3A 4BWGB 1I4QA 5TSSA 1PZKD 1STEA 1CT1D 1PTOF 5FKAC 1D5ZC 1KLGD 1LO5D 1PRTF 4UDUC 1FNWA 3BZDB 1JWSD 1AW7A 5D3IB 1JWMD 5FK9C 1SE2A 2WV6D 4C56C 1DJRD 3W2DA 1SXTA 4K6LA 1LTSD 1S5ED 4ZYSA 5D3DA 1PZJD 3OWEB 1SE3A 1UUPA 1F77A 4DXFA 1S5FD 1M4VA 4RGMA 2SEBD 3O13A 1V1PB 1AN8A 2O2LD 5ELEA 1I4PA 1JR0D 1B1ZA 1RD9D 2AQ1B 2R61A 4L63B 1MD2D 1EFID 1D5XC 1SE4A 1FD7D 1LTGD 2RDHA 1LTBD 1SJED 1YN4A 1QILA 1G8ZD 1LTTD 3BYYB 1UNSA 3R2TA 2AQ2B 4Z9CB 3R2IA
chains in the Genus database with same CATH superfamily
1H9SA 3CC2A 3NUCA 3PUVA 2QHOA 1FRDA 2GBMA 3Q8BA 4POGA 2E2JB 3ZO5B 3FEWX 3ZRCA 2FCNA 1WI5A 4QIWB 2GVAA 2GA4B 3D6CA 4QUCA 2KVMA 1E7UA 4N8FA 2F3WA 2K33A 2BVCA 5IP9H 4DR4Q 2HIXA 4FA6A 5IE8A 5LMNL 3U8ZA 2JQOA 2ZM6L 4A3LH 1TTNA 4QIWE 4ZYNA 1CM9A 2HQLA 4PV1C 4A3IG 3UQAA 1I50B 3PIOA 2B2UC 2B2YA 5IGGA 1A62A 4F87A 2N1WA 3ZGZA 2KO3A 3E0JA 2M0AA 4FHJA 4A3FB 2PJHA 5HFYA 1X3EA 1YNXA 3J81i 1JB7A 3K57A 3J7AV 4LFBQ 1E9MA 1I50H 2PMZB 1NEKB 4A20A 4B6WA 1VLBA 1A15A 4MGZE 2AL3A 1O80A 3AYHB 4A3FH 1MJEA 4JI3Q 2Z4IA 3I73A 3B2GA 3A8KE 4TMAB 4DR3Q 3NVZA 2FXQA 2K01A 1TBEA 3RZOH 2PVOD 3OWFA 3UI2A 4P2CB 5AFWA 1P16A 4C3JB 2PMZE 4DHZB 2K9XA 2QMTA 1WXAA 3Q23A 3PO3H 2WXGA 4BBSB 4FN2A 3CCUA 1QB5D 3IL8A 4C3JH 1G6PA 1TKEA 2G3QB 4XDXA 1EIHA 1RTOA 1I3QB 3GP7A 4F7XA 1FYCA 5JZEB 4BBSH 3L17A 1GHJA 4KIKA 3IFTA 3RNUA 4DHZE 1HTOA 5DLQE 2DJGC 2L55A 4LF5L 3FKIB 2XVSA 1EEID 1JCKB 4K6DA 1ENCA 3N1YC 1SNOA 5J1ZA 2ICEC 4NXNQ 1CSPA 1WOCA 2JA9A 3APCA 3TUOA 2Q2HA 2NPTA 1JWBD 3KWVA 4PMCA 3W1BA 3FKIH 5I4DA 1UEAB 2I38A 3WOFA 2LVPA 1SGHA 1K3RA 5IWAQ 1A3VA 4X66Q 1C4AA 4JI1L 5FR6A 2TSSA 3Q8EA 1IPGA 2PLPA 2DENB 4R4QA 1ZUD2 4HROA 4II2B 3KJOA 3GTGH 1Y8PB 1QVCA 5G3LF 4X62Q 3K5LA 1EY4A 5EPKA 5JHAA 1B8AA 1JRPA 3QAQA 2D5GA 4WWMA 3KBGA 5M3FB 3L13A 3LWEA 1RFKA 3A54A 4DV6L 5D3IB 2NVTB 2VNUD 1QOAA 3RT3B 1ILQA 4C56C 3CXCA 3UINB 2E2HB 5JOBA 4K6LA 2JT4B 2KFJA 1Q82C 2F0JA 5D2MB 4ZRQA 2HDLA 4DV7Q 2NVTH 4A3DG 3AM9A 4KKSA 1HNWL 2Q2UA 1DXMA 1UEBA 3CPWA 1FFVA 4A3KB 2EYLA 2FAZA 2Z0EB 5IOIA 3RD2A 5KNBA 1I4PA 1JR0D 4KV6A 1AE3A 1AH9A 4A3KH 2JSVX 1J7AA 4GU2A 3DBHB 2RCNA 1NENB 3P4QB 4IW0A 2KQ4X 5E6PA 1KF6B 1SDFA 1WGKA 4FXKC 2CS4A 2W9NA 2XWBB 1HPCA 1WR6E 2RD0A 2WGSA 3DWMA 3IKJA 1TVXA 4XQQA 2ACZB 2SNSA 1E8XA 2JUOA 2JA5G 1ZXHA 3LXFA 2KLCA 2UXBL 3EIVA 3PZ7A 1GHKA 3GTPB 4ANWA 5FLMH 3P4RB 2EKIA 2ZEQA 5KEEA 3AMUA 5EKIA 4DUYL 1WX9A 4OWWB 3GTPH 4GKJL 5A35A 4ICUA 1PHJA 4OW0A 2HD3A 3L9AX 3T1YL 2G1EA 1HQMC 5EKKA 4MHEA 3X3NA 3GTLB 4QUFA 1N34Q 1XNRQ 3A9KB 2BWES 3PZDA 2BKFA 2BB5A 5LLIA 3I4NG 2LZ6A 4MN3A 3ZNHB 3GTLH 3DCGA 4KTAA 4DQOC 4W9GA 4HPMB 3HHMA 4HPPA 1LFDA 1STYA 2CWPA 4YWLA 3HOXB 4DR6L 3N32A 1RKNA 2IY0B 5C4XB 4IM3A 4KGTA 3MVVA 2F3VA 5L37A 3HK0A 2NBFA 1JOQA 1NUCA 5IYDH 4X65Q 1YX5B 2NVUI 1EY5A 3MC8A 5EKLA 1N8RC 1SIFA 2BBCA 2DHZA 2PQAA 1WE6A 2FCQA 1GUWA 1J19A 2JXTA 3M63B 3QHTA 3WAPA 3NSWA 3UDGA 5GAGC 1PXUA 3UQBA 2R7ZG 4JWUC 2RDBC 4MZ9A 2J7ZA 1S72A 2Z1CA 4RF1A 5MPOA 1BDOA 3STBD 2G9DA 1HE8A 4CHKA 4A3EG 2D3BA 2HT1A 5EE1A 1YQ4B 5FO8B 3IAM1 1EYGA 1VD2A 3KLRA 3SD5A 4FXGC 3BVZA 1T6BX 1WYDA 1P98A 4DV5L 3E9IA 1YIWA 1V8QA 2AUJD 4KKUA 4ZUIA 2WB1G 3CCEA 1YQ3B 3CSTA 4G0NB 1GUNA 3GV6A 5K5PA 1DYQA 1YJNA 2DBYA 4P75A 4OX9Q 4GZYC 2NYZD 4KKJA 4KZCA 1RDPD 2KN5A 2XN9C 4G11A 4TRDA 3NQIA 3PS6A 3AE6B 5J39A 4X64Q 1H4RA 2R92B 2TMPA 4JI5L 3ICEA 4FJVB 3TBLD 1AARA 4R4IA 4TKOB 3SDZA 1VQCA 1HZ6A 3CHBD 3H7PB 1H8CA 2R92H 5TSSA 2IT1A 3NY5A 2OQ0A 1STEA 2KMMA 4N59A 1XNQL 3M3YB 1R4MI 3PLVA 1LABA 1DGSA 4AS1A 2EYFA 2E75C 3TRZA 1JB3A 5KIXA 1Z2MA 4LUVA 3SFEB 3CIRB 5JJZA 3M3YH 3HFZB 1HZ5A 2WP9B 4LTUA 4W9EA 2YTYA 3U30A 5J18A 3AE9B 1F2ZA 3CCVA 2VB3X 2G5DA 2ZW0A 4J6HA 2K4KA 4GOPA 4ANVA 4IALA 2IL8A 2WXHA 1L1OA 4CBVA 4QCLA 2GRIA 5GQOA 1RYJA 1B1ZA 2MPMA 1DCZA 1M8AA 1EYDA 1EZ6A 2SNMA 2WACA 3NP8A 5BR8Q 2BWFA 2IO2B 3K9OB 4DNTB 1WTXA 3HOVG 2VUMB 3QA8A 5AUIA 4IPDA 1EFID 3RZDB 3ABVB 5IT9c 1SF0A 3ZTCA 1U4MA 2VUMH 4M0WB 4HIDA 3Q22A 3VYSA 2KWCA 1UE6A 4NDXA 3BYYB 3RZDH 2AQ2B 3EROA 4BY1B 2KN4A 2EY2A 4WJWA 3AB5A 1HTPA 4HJ9A 4L1BA 3MTNB 4EQNA 3R7RA 4NZLB 1UE1A 2I46A 5EGTA 2QKIC 1YNND 4B9XA 3FPPA 4C3IG 2N7EA 1TYGB 2LFIA 3ZJYC 4A3MB 2BQQA 2C60A 4LF5Q 3NG0A 1F0ZA 4A3BB 3AULA 1RF2D 1II3A 1K8MA 2EYJA 3PO2B 4W9HA 1C76A 1MVKA 1MSGA 3P20A 2L0TA 1IBML 2B3AA 1CTMA 4ZRKA 3NS8A 4LF8Q 4JI4Q 1NR4A 2X38A 3EFXD 1FO4A 2KDMA 3PO2H 5C2TB 3JAMc 3DWQA 1MGSA 4IO9A 4A55A 3FDTA 2LY7A 2Z8LA 1O7IA 1QVGA 1XLOA 2A4ZA 4CO7A 1VCBA 4JI6Q 3HOUB 1ONLA 3UE0A 1WCMB 2JY6A 2ZJPA 1K8RB 1TY2A 2HIVA 1XT9B 3B1LX 3HOUH 4IM2A 3TEHB 1KM7A 4IUNA 5C5LA 3MXGA 1PDQA 3OIPA 1KLVA 3PIPA 5FLXE 1BCPF 1KHIA 1YEZA 4FO2A 3VA5A 1YVCA 1X9NA 1HEZE 1WTVA 1EFWA 1OO9B 2G45B 2KD0A 1WX8A 1TS3A 3A5UA 1CKNA 4OVVA 2DLBA 2KHSA 1Q1OA 3ZNZB 1V81A 3W1GA 4A90A 2RDFA 5LL6S 4B3TL 4RNAA 4KHVA 3PTFC 1EOVA 2K6AA 1UZXB 2N7JA 2CJOA 2N9KA 1OQQA 1XPRA 1EIFA 3DM1A 2I1JA 3VUXA 3DDCB 1WTHA 1AEXA 3ULJA 2KQ3A 4PS3A 4XYQA 3DUZA 2R93G 3I55A 2HD5B 4MELA 4JI0L 1EIYB 3LB8C 4DV4L 1IBKL 3NTIA 1PFDA 5M5WB 1UWXA 1J7BA 5GAHC 2IBIB 5G55A 3HGBA 4QGUA 1TZOA 1CKOA 3WA0A 2F0SA 4C7YA 5M5WH 1QVFA 2XK5B 4IWPA 1RLFA 3ONSA 2KX0A 2PTLA 3GB1A 4BBRH 1KLGD 1LO5D 1CUKA 1QOBA 1PRTF 3ZW3A 3MEHA 1AYFA 3ZJTA 1IBLL 1JWSD 2D3CA 2EKEC 3AE2B 5IGCA 4MGIE 3W5VB 1DJRD 5LMUL 1VQJA 1WZ3A 4DK3C 2KXJA 2L83A 4II3B 1ZOYB 4DKAC 1S40A 1IGCA 1OXSC 3RNGC 3L4PA 5LMNW 1PGXA 2LGIA 2JA7G 4RMAA 1WE7A 1WMHA 4K7SA 1SNCA 5IP9G 5EDSA 1K0SA 3FKYA 3VTUA 4DR6Q 4PZ8A 2Y3AA 4LW1A 2C9WB 4IFDJ 3J81c 2RGFA 4DNIA 2DAFA 3KWLA 4S0RA 2WDQB 3E56A 1PFSA 4JW0A 3W1SA 2I5HA 3T3NA 5C6AA 2L52A 1STGA 2CH4W 3L3OC 1HZCA 1IYJB 1EM7A 1M90C 1H9KA 3OMCA 1TZ1A 4LNKA 3AQQA 2J0JA 2INDC 3HM3A 3T56B 1WJJA 1XQQA 4JI2L 3SXHA 1XPOA 2WYQA 4A3GB 1EYAA 2YLMA 4HCSA 2JA6B 4L8JA 3PO3G 1DM0B 4IUTA 4EOYA 2ENBA 4DR5L 2AEHA 4USAA 1EY7A 1F2MA 2N9LA 4C3JG 1RFAA 3Q6SA 3CCRA 1LT4D 1HNXQ 3ZXVA 3IFWB 2JA6H 1TT5B 3T53B 4BBSG 2NTSA 4NP5A 1NR2A 4GOPB 2CKHB 3RNBC 2M56B 4HTHA 4R1JA 3MXNA 5JPNC 3HS0C 2MX2A 1GUOA 4JI5Q 3HOZH 2ZJDA 1VZ8A 4BBNC 4LK0M 2DY7A 1VQOA 5M5YB 4NNJB 2O4XA 2A73B 2MJEA 4L23A 3H3VI 3N1ZC 2BYTA 3GTKB 1XX8A 3KYDD 1ZDVA 3SR1A 3P75A 4IZ8A 4NXML 3GTKH 1WYWB 1E8ZA 4J15A 3GTQH 2HJ1A 1PTOD 1ENFA 2EOTA 4NKLA 2KX3A 3DBHI 3U2SC 3C2PA 1L5PA 2JK8A 5EBDA 5IOCA 1PH4A 4BKSD 1I6VC 3B2FA 5I6WA 1G91A 4EZKA 5AUKA 1LTRD 1XYIA 4XT1B 2N9EB 4YTNB 2OJRA 1WTPA 1KDAA 1STNA 1NY4A 2JU6X 2JRIB 2VZAA 3GTMB 3M9BA 2F1MA 1YMHE 2CW0D 3UE1A 5JJIA 4N9F4 1I42A 2M4NA 3NEMA 1E10A 1RRBA 1S5CD 2VQFL 3QB3A 2WINB 4A3KG 3GTJB 1D2BA 2AWNA 4JC0A 5M3MB 4GN1A 3LGJA 4OIJA 2KECA 3I56A 4DUZL 2DYBA 3CRLC 3GTJH 4GNXB 2K03A 2KCCA 5M3MH 4GXBA 3NK9A 1X3FA 1B9RA 4P73A 2JXXA 4DAPA 3QOLA 2L15A 5FK9C 5FLMG 1MPEA 5IYCH 5LL6X 1D4BA 2WV6D 1DOKA 3E9HA 2KT7A 2K1FA 2LGYA 2EVBA 4DR4L 2PE6B 4TVAB 1SE3A 2ZNVB 1F77A 2RQXA 4F8CB 3L7ZC 3MZ5A 5C0XI 1M4VA 3KF6B 1NDDA 2MBEA 1SNQA 3S1NH 1D8LA 2SEBD 3KDFB 1TR5A 4H02A 2NVQB 2GI9A 2ZNVC 2D11A 3EHVA 4YTPB 2GN5A 4DPGA 1Q8IA 2JYEA 1EWYC 2BYVE 2NVQH 4LFBL 3ALBA 1JW9D 3HKZG 1C78A 4ULLA 1KAWA 1D5XC 1SE4A 4PNYA 1YIJA 4PS7A 1GXDC 4JI3L 3A7LA 3WDNA 4K7WA 4W9DA 3W5OA 1QILA 4XX5A 2PI2A 1LTTD 1QLBB 1C9OA 3PV1A 4DK1A 3ZLZA 3F8TA 4BXXH 3I4OA 4IDIA 1IYUA 1I7HA 1P9DU 1HZAA 5M9OA 4JK1C 2ID0A 1O7YA 4DV0L 2L12A 5D7GA 1V97A 5BYSA 2YEPF 2NN6G 1X6OA 1JQYD 2M8SA 2WU2B 1Z9FA 2PNRC 3GTOH 3SFDB 4R8IA 2Y0SB 4KGRA 1D5MC 4BA2I 4KY6A 1B50A 3OOCA 1K0RA 3HZXA 4DK6C 4LNQA 1XXGA 1WF9A 4JPSA 1YJ1A 3PCOB 3Q8AA 4RH6A 2MBOA 2F4VL 1CQVA 4NXNL 3UIPB 4R4OA 2MP1A 3FILA 2Y0SE 4B3MQ 5IP4D 4REZA 3EFCA 4C3HB 1QUQB 1ZKOA 1OFFA 4NB3A 5IWAL 4X66L 1WD0A 1EO6A 4HDOA 4C4VB 4MH8A 5BMHA 4GLXA 4K14A 2V4DA 4ILWA 4HMIA 1WRIA 3QARA 3DEOA 4X3SA 4C3HH 3T4AC 1V6EA 1Q1EA 2LXKA 4X62L 3BINA 5AZFA 2PW9A 3SVMA 1IBLQ 3IAS1 1HQRD 2R92G 1TKYA 3NHHA 3AFQA 4K1RB 2XRQD 5FR3A 5DPWA 4L6TB 3KF8A 4P71A 4FXCA 4AWJA 2QDBA 4DR1L 2WS3B 4JVZA 4DV7L 5C44B 2V3NA 4NAWB 1YI2A 2Z6KC 1WJUA 1GC6A 2N7DA 3CCJA 3S16H 2JPHA 5IN7A 2E8GA 2Z9HA 1YHQA 5C23A 2PW7A 1U0LA 4ZQ3A 5C44H 1ZGUB 1FFUA 2NMQA 5CHFA 1GJXA 3I7FA 1PRTB 4WJ3M 5E6JA 4NJ7A 2QA4A 2IO0B 1C4QA 4MNOA 1UD7A 1HNZL 5BMGA 5KNDA 5I2YA 4G7ZC 4KDIC 2Z6BA 2D62A 1PRTC 4ITKA 4P16A 1CQFA 1SYDA 2YTXA 5FO7B 5E6NA 2JA8B 2EE1A 1RL2A 3HVZA 4I65A 4F88A 2EY1A 4XYCA 1MG8A 1N5XA 3A4SC 4EGVA 1WFQA 3IFDA 1X3PA 4EQOA 2ZTEA 1Y1WB 3OTOQ 2JA8H 1TWGB 2W3SA 2EJMA 4KVGB 4IC7B 5C1ZA 2WDRB 3CCSA 2F0WA 2MBQA 1Y1WH 2LVQA 2D0OA 3D3RA 2Z4HA 1UGMA 1TWGH 3WAOA 4ZRIA 3SE0A 2CHZA 3RN9C 3MAQA 3WALA 3L0WB 4ZLTF 3X0WA 1N34L 2Z0SA 1EY6A 2F0TA 4MTNA 1XNRL 1A6XA 2KNBA 3S17B 1N32L 3AEFB 3MJWA 1WGYA 1WIAA 3E6ZX 4UAIA 3RLFA 4CKBA 5IP7H 5LHY1 1PH7A 4GKKQ 1CZPA 2C35B 1F9JA 3JAMi 1HZ9A 2L4NA 5EBCA 3AEAB 1SFOB 5DPTA 2WKCA 3F2DA 5ELEA 2M0XA 2E2DC 3S17H 3V6CB 1VJKA 3TMPB 4IUMB 1CA6A 4LNFA 1Q10A 3PUZA 1XF5L 4FHKA 3PO2G 4IOIE 4J3OD 1VQ9A 1EUJA 4KD4A 3PSIA 2JEAI 2L00B 2K50A 2F0UA 4V190 2N0SB 1G8ZD 2CW0C 4K3BA 4TUUA 1SNDA 4F8MA 4GMVA 1UWVA 2ZVNA 4TQ1A 2WAQG 1S3OA 1Y69U 3HOUG 1NBFC 4AJWA 4HEDA 4JI7Q 3NVYA 2XRSD 3VH3B 2V9HA 1GKHA 5ELFA 4LDTD 1N60A 1WXVA 1ZPSA 4JCVE 3PLUA 5GAEC 1PFMA 1DZ1A 3I91A 4ODGA 1H95A 4M02A 3VVWB 5EPJA 2NBWB 1DOMA 1TS5A 4HJ5A 1FR3A 1KTKA 3SGIA 4KKTA 1MHXA 1K8OA 2GBKA 2IYDB 2K8HA 2LD9A 2XEWA 3GE3C 4A9AA 2RHQB 1QOHA 4G57A 4MSQB 3H6NA 2VQFQ 4IOAA 1J8CA 3C3LA 3KUPA 3PGZA 3ML9A 4MH0E 2N1VA 1V1PA 2BH2A 3I70A 3LWUA 5HY6A 1E22A 1L7YA 4X64L 4K0KQ 2R2OA 4AOFA 1D3ZA 4E6IA 1Q8KA 4ZUJA 3C8YA 1HA6A 4XE0A 2QF7A 3RUIB 5G5HA 3VTVA 3X3MA 1ET9A 1FJGQ 1J7CA 3OJ3A 5C0XJ 5A2QL 2RSUA 4H2AA 2EYOA 1SYGA 1KRTA 3ZDTA 4WORA 1E2WA 3OPOA 4JG2A 3CCQA 4JOIC 1ZYRD 4KD3A 4KMUC 2OWOA 3AEBB 3J9CA 5ELOA 3W3AA 3KLSA 2OCEA 2E2JH 2IJ0A 1T5XD 4I6LB 2K14A 3MTSA 3SU8X 4W9LA 2FFKB 2F0DA 4BBRG 3ZJVA 1PH3A 3HEJA 5BN4A 3P1HA 2V3SA 2PIAA 4K2KA 2KENA 2F52A 2NVXB 1BQQT 1DOLA 4IUQA 4A3JB 4DXAB 4IURA 3E9SA 5JJLA 1EQVA 2KTRA 1MKHA 2PW5A 3BDLA 3EN2A 5BR8L 2BE5D 5HGTA 4HIOA 4OELB 5KNCA 1C79A 1YHBA 5EPLA 3L16A 3PQIA 1BOSA 5GROA 2CHXA 4HIMA 1W2BA 4FNFA 4O2DA 1SSNA 1K8AC 2OEOA 4AQYQ 4DBGA 1NCVA 4GDLB 5HGQA 5JVH3 2UUAL 2SOBA 4NMZA 4DV0Q 2MO1A 2GB1A 5C5MA 5J2RA 2F0GA 3KUDB 4L5RC 3P7JA 1SE2A 1I3QH 2KJ6A 3BK2A 4JWSC 4LLGM 2LFNA 2F4VQ 1SYFA 3BDCA 3AE7B 3AU5A 4LF8L 4JI4L 3AU4A 3RYTA 3O13A 2L3ZA 4KZ0A 1G2TA 2EYHA 5JH5C 1PVOA 2K28A 5CV9A 2N9XA 2DNEA 4ZKCB 2RHSB 2O6VA 4JI6L 2MP2A 4E3CA 4G4KA 3VXWA 5E4WC 3KFUA 2INCC 2KUMA 3QWNA 3HOZG 4HSVA 4NPSA 2IHFA 1FPYA 4GN4B 4KHZA 2MNAA 3TIXA 4KSLC 3P42A 2K25A 5M3FH 4DR1Q 2CJNA 1OQRA 1P3QU 1OXTA 2VS1A 4ANUA 5C4ZA 1IBXB 2K39A 3PMFA 2E2HH 1R4PB 4W9CA 1O7ZA 2WKDA 3LX0A 4N9TA 3RFZB 1GPXA 3FC4A 4RKLA 2YVCA 2LMCB 2ZJQA 1U4PA 3H3VH 1IZ6A 3H3VC 2HHHQ 1I4XA 2D3GA 1A3UA 3Q8DA 1FCCC 2VQEQ 3CF5A 4HRSA 1HNZQ 2AYOB 4ACFA 3MHBA 5JAVA 3PRZA 5I6YA 2WFWA 4S3SA 4HJ7A 3AE1B 2A69C 4XDCA 3VAWA 2JYTA 2UXDQ 4C7ZA 4XZ4A 4A8XC 2ZZPB 3DOWA 3UDFA 3ZUNA 1VQMA 1QOFA 4EQ5A 4P74A 1L0XB 1LXDA 3S2HB 1LM0A 2WIIB 5K36G 4QQBX 3KUZA 3NE5B 3P1MA 4GSWA 1R4NB 5G3LD 3JSVB 4DAYA 4DN4M 3H91A 2L0CA 3S2HH 3S2DB 2KMCA 2WXJA 3OIQA 2N8NA 1IL2A 1EEFD 4HCEA 1HXYD 5JEAH 4KY7A 3F2CA 3PV0A 2JWUA 2JE6I 3ER0A 3S2DH 1N32Q 1GUAB 2C7MB 3KW5B 1P7FA 2AWOA 1W6KA 2ICIA 1L0WA 3NHEB 4LDTB 2AQ3B 3ZTDA 1FCLA 3ULPA 2WWZA 3KQ4A 5C4HA 4RHSA 2A1AA 1PH1A 2B3GA 3TSSA 4DV3Q 3VFKA 4HXDA 1EF5A 3M62B 4M8MA 4YY3Q 4PG3A 3D6WA 4IPHA 1JRUA 2BS2B 3W1YA 1EYCA 3HOXH 2PCFB 4Y7NB 1SBBB 1YN5A 3QK0A 5C4XH 3HOYB 2ZXPA 5C4JB 1PH9A 1HTQA 1HA5A 2MFIA 1Y8OB 1XCTL 4GN3B 3T13A 1GJZA 3OAWA 2B2WC 4Y7NH 3BY4B 1WJ6A 2ES2A 1H9SB 5C4JH 4IFDI 4W9JA 3U4EG 3VH4B 1F9QA 2BA0A 5ISRA 5C0XH 1XD3B 2MH7A 3AE8B 2O2VA 4KSKC 3MXPA 3VR9B 4NY0A 2KC1A 4DDID 1Y8RC 4DHJD 4CDFC 1D7QA 2KHWB 1AW7A 1VQAA 3A1QA 1JWMD 2C7NB 3A4RA 4BOZB 2M2LA 3PF5A 3CWIA 1Z47A 4BS9A 2QDFA 3V6EB 3CMMB 1ZYRC 3DMUA 1PZJD 1HNXL 1NI3A 1ML0D 2HJ8A 2WXQA 2WQYB 1Y1VB 4ME3A 1C8CA 1VF7A 2DZJA 2UU9Q 1TKWB 5JJKA 1KFYB 2EYPA 4P7IA 1Y1VH 4EVOA 1K8GA 4EX5A 4IJHA 1FXIA 2EMTA 4GN5A 2PMVA 3TL5A 2LVOA 4PS8A 3R7QA 3APFA 3C1FA 2B2YC 3H1UA 3PZ8A 1V5OA 2A5UA 1XJVA 5G2NA 1FD7D 1LTGD 1UWMA 2KQSA 1KDCA 1YN4A 4HLEA 3HIZA 1TIID 2WXLA 4XT3B 1BT0A 3E5SA 2BE5C 3M4YA 1N36Q 3Q69A 2V3PA 2K5DA 4C3HG 3NBHA 3RNFC 3F1ZA 4KJOA 4EE2A 3IG3A 4A75A 1BR9A 1WM3A 2IO1B 1IYFA 4C1NI 3TS2A 1NAPA 4H13C 1VQDA 2W3RA 3FMCA 3R8BA 3I3CA 3K0YA 4KIKB 4KGSA 1KL9A 1GOZA 3Q8CA 4ZOHC 1K83B 1Q90A 1A3TA 1E5WA 2PE9A 2SAKA 3MHZA 4LJOB 1BUIC 3C46A 2HDEA 1FXAA 2PQEA 4JV5Q 3TZUA 2K8CA 1K83H 2RCFA 1B9NA 2NPTB 1JOOA 4ZRPA 2LGSA 2M1MA 1ET6A 5C44G 3DWPA 4Q0FA 4RGTA 1IKMA 4LF7L 2UUAQ 2G4SA 1U4AA 3TEXA 5IT9L 3VUYA 2K1BA 2R3ZA 3ULLA 2ZTDA 5AJ3Q 1EOTA 4BY1H 4C1NK 4I7AA 5T1GA 4DU9A 4OWXB 1LTAD 4WJ4A 4JPBW 3KVFB 1OEYA 2W82A 1B3AA 3PVLA 3TCAA 5IGEA 2K5NA 3W5UB 2DWQA 1HFGA 1OTCA 4EZLA 2DNFA 1A70A 2JA8G 3ND9A 2MA9B 1AZQA 4MM3A 3L08A 3Q8FA 1B44D 3SR6A 4QF4A 4JIOU 4L5TA 4N8X1 4A3MH 1KXLA 3BG3A 2WU5B 1OXXK 4A3BH 2EJGC 1B7YB 5CTRC 1V43A 4YIJA 1QG7A 1ROEA 1Q3LA 2BW2A 4HAEA 1XTDA 1WXQA 2F0EA 4PZ6A 5IGFA 5IP7G 5C3EB 1JOKA 3TEYA 3LJ3A 5FJ8G 1MG4A 2JXMB 1WTWA 1WCMH 1VQ7A 2K6DB 2DYMA 4RM9A 1T9HA 1V1QA 1AE2A 4MTKA 1SEBD 4QMGA 3SEBA 1P0RA 5JHBA 5C3EH 2IZVB 3GDEA 4PT5A 3H0GB 1PLFA 3FHWA 4W9IA 4A93B 4FF3A 3FRPB 1CT1D 1WX7A 3SK5A 1PFNA 2J0TD 1V49A 2BYEA 2XIWA 3H0GH 4EQPA 2AWTA 1C0AA 3QOJA 1DGJA 2MSED 4MJSA 3BZKA 4A93H 4UDUC 4IKGA 5IGBA 4JX1C 1VQFA 4DGZA 3I63C 4OONA 5CC4A 2AL6A 2IDYA 3NJTA 2K04A 5JPMC 4YL8A 3K80C 2GBRA 4GOCA 4YSZB 5IY0A 1GC7A 1M94A 4GDKA 2KMAA 3OJ4B 4G50A 1VMPA 2M9VA 4WRDA 2J52A 3EQLC 1NMGA 1Y56A 2E6XA 1CZWA 3GE8C 5FO9B 4HKZE 3CQZB 4XGAB 4YT0B 4MIUA 1WGDA 4B3ML 1K51A 1FRRA 1EWHA 1CJEA 2NWGA 4CHTB 2KJXA 3M3JA 5FLXc 2M17A 4MEMA 1JICA 2LXJA 3RMKC 2K75A 1LTBD 1TWAB 1Q81C 1B2TA 4WJPA 2UUBL 2PQAB 4AYBE 3Q3JA 3C19A 1YJ9A 4B3RQ 1PDXA 4LFCL 3OYYA 4HR7B 3CRKC 1TWAH 3AH7A 1XMQQ 4CKEA 2R2QA 2KTFA 3S9WA 2FHTA 2C7HA 1I94Q 1BCPD 3A5ZB 5T1IA 2ZPNA 3AB9A 3NTHA 3J81E 4A76A 1H9RA 2BT6A 5AZGA 1Y8NB 4DHJB 1IKLA 2YYZA 5EJWA 3AI5A 1E90A 3Q3NC 4LNNA 4YWKA 1C9FA 1WXSA 1SAPA 3GO5A 4A3IB 4A3LG 4K8JA 4WIPA 1PFBA 2K5HA 2QGQA 2N78A 3J81L 2KVZA 4A3IH 3KK7A 1LACA 1E2VA 1Q7YC 1ZW7A 5EQ0A 2KEEA 4PQXA 2BS4B 3TP8A 4A3FG 3N30A 1UBQA 1PYWD 2MWSB 1QJOA 4K5XA 3OTOL 3AU7A 1V1OA 1X3GA 2EELA 5KHQA 4X3KA 3TN2A 4R4CA 5FOBB 4JBJA 2Q2IA 2X6LA 4A3GH 2V0GA 2FBWB 1PRTD 2GOWA 5ELCA 4P6VF 3FP9A 3CCLA 1EL0A 1MSHA 4WWOA 4OO1I 1SMXA 1G6JA 3DXJC 1GB1A 2K52A 1L1OB 2PEAA 4DUZQ 4OEMB 4ZK9B 4FF2A 4GKKL 1ASYA 1FEHA 4GOPC 2Z6KA 3TBIB 1FNUA 4L5SA 2FE8A 3PF4A 1VZ6A 3N52A 1L1OC 2DJFC 5L95C 3PRPB 1MBYA 2EXDA 3FKIG 4US9A 3ZDMC 3IXSA 3X23A 1AZPA 3IRBA 1E8YA 3MFGA 5M5YH 1HTLD 1J6QA 2BKRB 1KABA 1XLPA 2JZPA 3EFUA 3G48A 4H7BA 4EUTA 1SR3A 3P2BA 3ZIMA 2PZTA 1BBXC 3EA6A 5TR5A 2LKVA 4IUUA 4WAFA 3DHGC 4JI8L 4B3SQ 3UF8A 5COYA 4BFRA 2BOSA 1A0IA 2REXA 4QB4A 3G7LA 3I2ZA 1GVPA 5FKAC 1WWTA 2HDMA 4JI7L 2KDEB 2BS3B 3A55A 2PO4A 3KJPA 3ECIA 1FMAD 5M3FG 1IGDA 3AXCA 1TWFB 4XXEA 4DR7Q 4MGKE 2F0IA 1X55A 3SHLA 5KGUA 2XTIA 1R4NI 2UWQA 2Z59B 3GTMH 3NRZA 1TWFH 3RPFC 3KOJA 3QQ8B 4LJZC 2E2IB 2L5TA 2WDTB 1XPUA 3F2UA 5DEHA 3S1QB 5D94A 4LF7Q 1WR1A 2BYFA 1YX6B 1MI2A 2F0KA 4PYZA 1OXVA 1T0QC 1VQBA 3VDYA 4K0KL 1J5EQ 2I07B 3CMEA 2K05A 2QCPX 3S1QH 2WLBA 2EJFC 3APDA 3R93A 1SNPA 2ZT9C 3SK4A 4IG7B 2B2TC 2R7DA 3S15B 1FJGL 2JA5B 1MHHE 1HR0Q 2CCZA 2DUDA 2RF4A 1UNSA 4GNXC 1QZHA 2DZMA 4HDQA 2LSSA 2ONQA 3DHQA 3S15H 1WXMA 2F0VA 2Y5BB 1SYBA 4TSSA 3TMEA 3Q6BA 1EQRA 2JP1A 3NVWA 3T3OA 1CKNB 1QZGA 4CGYB 3NVVA 2IWHA 3D4WA 1F9PA 4Y52H 2ZCCA 3TREA 4TQUS 5JXVA 1JWUD 3NWTA 5JEAG 1E7PB 4R8NA 4XWTA 3G6EA 4MDKE 3ZXRA 2D10A 3CC7A 5BYRA 2WXNA 1OGWA 1YJWA 4I6NB 2MO0A 1O7LA 5KYLA 1SMYD 1BNZA 1HUMA 4E71A 3TP5A 2B63B 3MXUA 2KBNA 3NUHB 1V80A 1XMOQ 1PZID 2NN6I 2JEBI 1CFMA 2NZ1D 4K5VA 2HTME 2AUKA 5IYDG 1TS4A 2B63H 4GLAC 3RMHA 4AQYL 3D32A 2H88B 3HOXG 3T51B 5C4XG 2B8FA 3H9DA 5CMDA 1I4GA 1YITA 2WXKA 1VQ4A 1EWIA 1HUNA 3A9JA 4X57B 2INPE 2KFKA 2ZW1A 3I72A 2BDOA 5DAUA 1MFWA 2NBVB 2JRHA 1HH2P 2A8VA 1ZEQX 4TQ0A 2NVYB 2CH4A 4A3EB 2K7VA 2BCOA 1WYGA 4AIMA 5DM73 3RNEC 4LUOA 1BCPB 1STBA 3VR3A 1GNUA 1CA5A 4A3EH 1I5FA 2F03A 4B9WA 2BH8A 4V0BA 2K8BA 2QJLA 1U4RA 3HOWB 1QQRA 4FJZA 1WMHB 2WB1B 3Q2AC 5AZHA 4IFDH 3EECA 1BCPC 1MJCA 2B2UA 1NYQA 3MC0B 2LASA 1Q12A 4JE3B 3HOWH 5HG2A 4NJ6A 4URKA 4GS3A 3ETRA 1FGBD 2N55A 3PHXB 2UUBQ 5CHWA 2LJ5A 3QX1A 2WB1E 1LT3D 4LFCQ 3R3MA 3U4VA 2JX5A 3OW2A 2LHDA 3W1SC 1S1QB 1J9OA 3VR6A 4BA1I 1EU3A 1VMCA 4LFAQ 1E7ZA 1WM2A 2ALYB 3PRMB 2KOLA 1D5ZC 2R6GA 3K5NA 4XDDA 2KQ7A 2WX1A 3MFYA 3TZDA 4PK1A 1DONA 3ND8A 2IO3B 4P72A 4ZHOA 3IVFA 4KV2A 1CZGA 5M5XB 4DAMA 1C4CA 3OWEB 3H94A 2HHHL 2F0QA 1UUPA 4N9PA 4YSXB 3K6OA 3RR5A 2VQEL 5GXGB 4JLCA 3K81C 4IWQA 4ASWC 4RGMA 2LEKA 3QO2A 1TT2A 3MXNB 5E3FA 1WY8A 2IX0A 3ZVVA 4BZAA 3CC4A 3N6RA 4YWMA 5IIFA 1GM5A 2UXDL 2OTLA 2CVRA 1MD2D 2LS01 2IHEA 3DVGY 4KI0A 5D65A 2VUMG 1F2RI 4HCNB 2ATWA 1SJED 2RDGA 3TP7A 1LQBA 4Z9CB 3BU2A 2DN8A 3NENA 5IYBH 2KOXA 4N6EB 4I7ZC 4OZCA 4YHHQ 2A69D 1K3BC 2NZHA 4BY1G 1KNEA 4UPAA 2RKSA 1B53A 3ERQA 4OIKA 4C3IB 2JVCA 2KC2A 2KKCA 2L32A 2L8JA 2PZWA 2V1YA 2H1EA 1TXYA 5I9PA 2D0PA 4C3IH 2F0PA 3GOEA 5DPSA 4LNIA 1LTID 2NCNA 1CI3M 3HVDA 3C0RB 4A3MG 4ICVA 4O42A 4A3BG 4LF9Q 4DV3L 4OWTB 1SFOH 4ANXA 4HN7A 5J17A 4B95A 3WCQA 2L11A 2BA1A 4OL7A 4YY3L 2L7RA 2VZKD 2WHIA 1YBYA 5HHDG 1TS2A 1ASZA 4JI8Q 2A74C 1FVIA 5EE9A 3CKIB 3UI3A 4ZDVA 2FMCA 1EY9A 1C7YA 2NTTA 1WCMG 2Y5PA 4LUZA 3S1MB 2CFMA 5C3EG 2VRRB 4APVA 1YNTE 3T16A 2QDLA 4LNOA 3E0EA 4Q2JA 3RUZA 4RF0A 1RTNA 3S1MH 4DK0A 4ZKBB 4B9KA 3NS1A 1JJCB 2KCTA 4DV1Q 4BOSC 3H0GG 4UP8A 4QJFA 1D1KA 1TU2B 3A74A 1JE4A 4A93G 5A2QE 2JWZA 3AFPA 4BY7B 2XNAC 1YJIA 4K3CA 1VF5C 2UU9L 1I6HB 1MI0A 5DM63 3L0OA 3I5JC 3J80c 3A9KA 2X6GA 3PIO3 1JALA 4BY7H 1U4LA 5T8IA 2JN4A 4CQNA 4XYOA 2R93B 1WTRA 1I6HH 3TDQA 1IXRA 1WFYA 1JE5A 3UDIA 2H5XA 1R9TB 1IW7D 3WANA 1PH8A 2XBBC 3RN5A 5CV7A 1HFNA 2N4FA 4OVZA 2KK8A 3G71A 2E74C 2I5LX 1C77A 3H09A 1GAQB 2J42A 2QCZA 2DY8A 1PH5A 2ZPYA 1SMYC 2LI5A 2EY6A 1N36L 2LRWA 1YZ6A 2GLSA 2N9PC 3O65B 3VRBB 4BWGB 4OZAA 4NQLB 1X56A 2B2WA 1QT9A 1NVID 1JORA 4KLKA 1XEEA 4KDLB 3QWZB 4MT5A 4P1BC 1EUVB 2PI2E 3GZNI 1CKMA 4DV2Q 4IOCA 2OEDA 1VZ7A 1MIUA 2XGTA 1GO3E 2C5LC 1RJTA 4JYAQ 2RSOA 1SIJA 2NVXH 2JA7B 1UGJA 4A3JH 3LNNA 2HCIA 2VL6A 2QEXA 4JBMA 4JV5L 1X54A 3FPUB 3FILB 3HKSA 3NELA 1ISNA 4A6QA 2IY1B 2O2LD 1FL0A 2JA7H 2AQ1B 3JW0X 3H6MA 1V8CA 3MJ5A 2R61A 1BKBA 2OF1A 5I9OA 1BUVT 3QR8A 5CV4A 2NZOA 3N20C 3ZKJC 2RDHA 4J8QA 1G291 2PKOA 3I3TB 5AJ3L 2WXOA 1J0GA 3AEEB 2MLBA 1IUEA 3I4LA 3FAHA 5C3JB 3H7PA 3RZOB 2IY5B 3U9OA 5HKHA 4NAMA 3ZNGC 2GBJA 2DGYA 4QL5A 1K52A 3B0AA 3KF8B 3PO3B 3RN2A 2I1KA 5CX3A 4A3GG 5ELDA 4YCUA 2X8XX 1N62A 2MBBB 3BS1A 1TJEA 1X3QA 1WSPA 2JA6G 2YEPB 1STAA 5C3XA 4H44C 5GADC 2O6VD 2RPVA 4MSMB 4S17A 1C48A 4CKCA 3PHWB 3RD4A 1EY8A 4AJYB 1EQQA 3DWAA 4CYEA 3Q3MC 2ZTCA 5LXHA 1UAPA 3M7GA 2Z0DB 5CGKA 3QIAA 1HZBA 2N49A 2MQJA 2LHEA 1KDBA 4OO1H 2HTHA 5CV5A 3VYRA 5IA7A 4D2KA 4KN4C 4M0WA 1CHPD 5CBAE 3GTGB 2G9HD 3F2BA 2KHIA 4NJCA 1DOIA 2WXMA 2M00A 1PUTA 3OG5A 3AE3B 2KHJA 1S5DD 1EU4A 2FINB 3NPPA 3M4OB 3AE5B 3PREA 2B2VC 3HRDD 4WURA 1Y14B 2QEJC 1O78A 2GVBA 2P5ZX 3M4OH 1WJNA 3RCZA 4AUQC 3RI7C 2XWJB 3G6JB 1E8WA 2W54A 3WIMA 4JBWA 2Q8TA 1CSQA 3L2PA 3KYHC 1LV9A 4X6AH 4RHRA 2J0KA 2RMMA 1F2LA 1XTCD 3ONAB 2IGDA 3I4MB 3BJUA 1GD7A 2A6ED 4PZ7A 2DAJA 4J6IA 2PNHA 2AMCB 4DR2L 2LUMA 5F2DA 4YWGG 1G51A 3T8MA 4CJ0B 3I4MH 1IL8A 4ZRZA 2VZKB 2F0MA 4YTMB 4EZJA 3QC8B 1K28A 3A7AB 3PUXA 1T0YA 4E74A 3CPFA 4B3RL 1N61A 4FLHA 1KH0A 3SHQA 5M3MG 1XMQL 3NXWA 2HCCA 3VYTA 5D14A 4IWOA 1T3QA 2MCNB 1QNUA 4L2YA 4X3UA 4LF4L 3K7AB 1I94L 2WXIA 5AEKB 1TWHB 3QCAA 5IYCG 4HPLB 2QW7A 3K8AA 2YU9B 4HIKA 2UUCQ 1FNWA 2G4DB 1A5RA 3CMAA 4U68A 2QC8A 3B6YA 1VQGA 3K7AH 1TWHH 4ZCKA 1PGAA 3UDXA 2YU9H 1QNKA 1T5EA 2I5MX 4ZYSA 3GV3A 1P8LA 2BB6A 4UP7A 3ZJUA 5IODA 2Y5CA 2FJ2A 5DPRA 4CDEC 2IX1A 4FULA 1V1PB 1AN8A 2A68D 2PZUA 1AP0A 2VH1A 3NZUA 3HKZB 4B0EA 1N33L 5HURA 3IHPC 4PYUA 3HOYH 5IAAC 1A8VA 4OXPA 1FXTB 2K5QA 3KH0A 1J8IA 4K8IA 1BBUA 1Q1BA 1T0SC 1V9PA 4KHPQ 3OHXC 4GGQA 3W9CB 3EVQA 2W55A 4BXXG 1ZXIA 2B63G 1VCIA 5D3DA 3HKZE 2H89B 1CMXB 3V60A 1QOGA 1IW7C 1XWEA 2UXCL 3LYYA 2CHBD 3KLSX 2NUCA 1F1HA 2Q8RE 2XK5A 1TQOA 3D4DA 3K59A 3BIID 1SRUA 1YNJD 2B29A 3M95A 1VQ6A 2NN6H 2JF5A 4ZRJA 4BBNF 4DK5A 1KNAA 1S4ZA 4WFN3 4LF6L 1N6ZA 5E4XA 2Y0SG 3EJIA 3I8ZA 3I90A 5H92C 2KTRB 3QG1A 1FIQA 4A4IA 3DPDA 1VQPA 2E5LQ 4IFDG 1PQSA 3G4SA 1G2SA 1M1KC 3I9V1 2Q8IB 1YN3A 4BVUC 3HOWG 5GMVA 5H8YE 2A19A 1SYCA 3VUWA 1RHPA 1NBWA 3BYTB 2FUG1 3ERSX 5BYQA 3DQVA 4B3SL 3TEWA 4F7ZA 1RODA 1AFPA 3NOBA 2HE7A 3H7SA 3QJYA 3KBXA 1WRDB 4A3CH 3PT2B 1D6EC 1A2UA 2AKWB 4B3TQ 1PGBA 2WX0A 4F1SA 1VDVA 5J22A 4PMWA 1UH6A 4GLVB 2KWUB 1E0BA 5IT9E 4G7OC 4AH6A 3B9JA 3M4PA 2YTVA 4JL9A 4R9WA 3J81j 4DR7L 2DYOA 2FIDA 2R7FA 4MGYE 4HSPA 1ENAA 2BDNA 3MA2B 3CF6E 1S5BD 2KLGA 2QILA 5BN3A 2GBNA 5LMNQ 4TKNA 2EXZA 2KCMA 3P4SB 1YHAA 2B8GA 3ZYYX 5DNFA 2ZM6Q 3OSOA 2O6VB 4KY5A 4OHJA 5NUCA 2D3AA 2MP2B 5CORA 1TGZB 2EY5A 1J5EL 1ZKHA 3K58A 2N88A 3V61A 2OHFA 1NE3A 2WDVB 4K2LA 4O1NA 1WJ4A 1HR0L 4GLSC 1KRSA 3CP0A 5EE0A 2H4OA 2NS5A 3N3KB 3PIP3 2MEKA 4XIGS 3U9SA 3JAME 1OEYJ 4LCDE 5KRUA 4N58A 2OTJA 3RNCC 1Y1WG 5E7NA 2ZJRA 1WTQA 3OW7A 3DWGC 3HP3A 5IYBG 4EEWA 1LGRA 2UYZB 2WXRA 4G7HC 2MUYA 3K5OA 4DFAA 4HJAA 2A6HD 1EIGA 1VQHA 1S5ED 1F2RC 1K73C 1QE6A 4JQWC 3JAML 4P1CC 4FVMA 3DHHC 3Q3FA 1L2FA 1IYVA 2E3TA 1SN8A 4FYDA 1SB3C 1Q86C 1JT8A 2HQEA 4UP9A 4C80A 1RD9D 1X32A 3DBSA 4XQNA 1XMOL 2KVRA 1V86A 1A2TA 1BMLC 1QKZA 1VQNA 1UBIA 3IT6B 4IQZA 4LAAA 3EBEA 1WGGA 1R4QB 3PGEA 2EIFA 3CU7A 1JJ2A 3DVGX 4I6PA 2WAQB 4JI1Q 2A6EC 2YV5A 3R2TA 2B2TA 4FF1A 4DAYB 2K3UA 3Q3OC 1NTGA 1F2YA 1PMRA 4L5QA 3PO0A 4GNXA 1CK1A 2UU7A 4FJYA 1XLNA 1E0ZA 1STHA 1NYRA 1U5KA 4HWIB 5E6OA 1DOYA 1SROA 1GG3A 1L0YB 2WAQE 2J7QB 1UF0A 2GMIC 4IJLA 4DV6Q 3PUYA 1GUGA 2ASBA 2JYOA 3U4ZA 3DBLI 3AE4B 3SDLC 1C4PA 2FNJB 1C3TA 3TS0A 4BAXA 3J80i 3VA7A 4NW2A 4AYBB 3NZSA 4RWSC 1PYSB 4DR2Q 1HNWQ 3CQZH 4KJNA 3ITPA 1I4RA 2Q5WD 4FXDA 4BKGA 1FNVA 1W6JA 1FD6A 3KF6A 1SJHD 4M8AA 4QY7A 3U7DA 3KDFA 1EZ8A 3GS2A 1E6EB 3DVNU 1TY0A 4BY7G 1WTOA 1LLRD 2KJHB 1VQEA 3NQTA 5FLXL 3U7ZA 2LXCA 4DF7A 4IM0A 3FVQA 1B3QA 4B08A 2MJ3A 1ZXTA 4RGOS 2FCSA 3T9LA 4HK2A 4ARIA 3RLOA 1LUZA 2A68C 4LF4Q 4LFAL 3M7NA 4LJPB 4ID6A 2O2VB 2ZXOA 1LM8B 4RA8A 1BVSA 1MHWC 3CAMA 2PYKA 5CYUA 2RPQA 1L6VA 3KLWA 3V62A 3TP6A 2UXBQ 3A8JE 2LWPA 4WJNA 1NJIC 2RR9A 4FADA 3A1QB 2ZXRA 1SNMA 2D2QA 3V2TA 2D9UA 1GUSA 3C1EA 4BBRB 2CU3A 3L10B 4DUYQ 1SLJA 2MBHA 4AQ7A 4W9FA 4GKJQ 2LJIA 4HJKA 2J4XA 1WZ0A 2K5VA 3T1YQ 2O5JC 3DBRB 2KWVB 2PPBC 2AX5A 4M8NA 3UGBB 2VB2X 5KYIA 2FMMA 1N33Q 2L1AA 1KAAA 2RBMA 1VQ5A 3GZNB 1YNJC 5IGDA 4A3JG 2CU1A 2RSNA 3M85A 1N5WA 1NNXA 4WWPA 2BGFA 1SYEA 3TQYA 3JYUA 2NR2A 2OJWA 1OQYA 4KX6B 4WJOA 3SK8A 4RGNA 2ZCBA 5EAYA 3S14B 3STBC 1QUQA 1E2ZA 3BVGA 2UXCQ 3CD6A 5CR3A 4RFBA 2MQHA 3OMGA 3AECB 3MHSD 3QJZA 3V3XA 3VR8B 4C4VA 1I4QA 3S14H 3NBHB 1GUTA 1PZKD 2KWDA 4YHHL 1EF1A 1JJGA 2DZKA 1PTOF 2MJDA 1ACCA 3P63A 4K5WA 1X65A 3VDZA 1VQIA 4IPCA 2IGHA 4LF6Q 2F0LA 1VR9A 1DOXA 4WWNA 2D07B 1Z6HA 2F0NA 5L83A 3BWUD 3MP9A 1F52A 4DA2A 3KUCB 2FIFA 4DDGD 4KKIA 2V4IB 3CCMA 4NAWA 4LF9L 2MHVA 2CQAA 4FDBA 4ME5A 1XLQA 1S5FD 2J53A 3A33B 4HJ8A 3JVZX 2E76C 4DV5Q 5LXIB 3TEZA 3TJPA 3Q24A 2ASQA 2F0OA 1SSOA 3AV8A 1BBWA 1V9JA 2KA7A 3A56A 1E3PA 3HOZB 3IAYA 2RA4A 1XO3A 3T1HL 2EDGA 1VQ8A 4UHVA 1Q46A 3BZCA 3VR4A 3U58A 3MWYW 2WP8J 3PSEB 1VDZA 1K9MC 4WQOB 1B70B 2JZ3B 3NWSA 4OO1G 3VQIA 4IUVA 2PVGC 1SE8A 4POFA 1KC8C 2LGXA 2K6QA 3J7A5 4MM3B 1XNQQ 3GTQB 1OTRB 4WJQA 1QWYA 4A3DB 4R4TA 2EMSA 2L0FA 5IO9A 3RNAC 1X1MA 4DV1L 3HRZC 4LMQD 4K7UA 1CHQD 3VR5A 4A3DH 2OT2A 3J7ZC 1H9MA 4US8A 2INNE 1HJPA 1Q0WB 1BXTA 4WH4A 2E2IH 4XWWA 4M1UB 4BKSA 1KQSA 1SE9A 4FBJB 1RCVD 2J0MA 2A6HC 1KIXA 1MJDA 3K5MA 3EC8A 4BKTA 1QCBD 2MJ8A 4RM8A 1FM0D 3Q0AA 4YCWA 1YNNC 1C1YB 3DHIC 1IHZA 4M01A 2Q2TA 3D0FA 2JA5H 3SK6A 4KN7C 3I4MG 1NI2A 4OVUA 2L1BA 1T0RC 2BTEA 3CW2C 1ICFB 1YJJA 4R3DA 3BDOA 1R7SA 5K36H 1L4ZB 1V5TA 4MJSB 3RZFA 5CV6A 2IPKD 2F3IA 2WXPA 1LT5D 5DCNA 4DV2L 1ESFA 1KRHA 3A8IE 2EYMA 3A0JA 3RLNA 3I4NB 4ZAIA 2L9HA 1XCQL 4DXGA 1EWCA 1E7VA 4GDKB 1UE5A 2RVLA 4ALPA 4JYAL 4MACA 2K32A 2QSDA 3I4NH 3K9PB 4WQMA 1KLUD 5LNK1 1ESRA 1KOTA 1G6ZA 2VXWA 5CBEE 3DLLA 4WAAA 4C2MB 3M4QA 1PYBA 1U9RA 2K5PA 1IBMQ 4O0AA 4JBKA 3S1NB 3AN1A 2KJRA 4CJ2C 3WAMA 4C2MH 1ZE3D 3HM6X 5G5GA 1F9SA 2MRPA 4EKUA 4ZHPA 4M00A 2A5HA 2BF8B 4HCPB 4A3PA 4HVBA 2R7ZB 4RMFA 4U673 1QZEA 4KK7A 2N3SA 3HOYG 1WGRA 1ILPA 2IW3A 2SDFA 4CDCC 4JOIA 1L6UA 2VY3A 5C3WA 5C0XG 1YOVB 2CHWA 2R7ZH 2WNMA 4B0MA 1KJTA 1B4OA 2XSCA 1AWDA 4YCVA 3IBEA 2K22A 1FGUA 1N63A 4Q5VA 1TIFA 2LUEA 3BK1A 3U52E 4DR3L 2NVYH 2F4IA 4X3TA 2QIEB 4NPNA 1W3SA 1D1IA 3NBIA 1Z7TA 4RG1A 3R3OA 3MEFA 5I2XA 3ZQ4A 4W9KA 1BF4A 3W2DA 2F0FA 4OZBA 1VRAB 3GTOB 5JVG3 2KDIA 4RKBA 1F9RA 1HRJA 4H0LC 1PH2A 3N1XC 2JQRB 4DXFA 2CQOA 4FF4A 1N9WA 1Q5WB 3GQBA 4IPGA 4RCNA 1RM6C 2L76A 4QAYA 2I2YA 1Y1VG 2VW9A 2NBUA 1PA6A 5BMIA 1L2NA 3ZNID 3NZ3A 3WWVA 3D8GA 4L63B 3H15A 1IP9A 1JQ4A 4J1MA 4JI0Q 5ELNA 1JWAD 1RIPA 4DV4Q 1IBKQ 2FUHB 4YSYB 1K53A 3WOEA 1NMFA 1TWCB 5H1SE 3N9YC 2ZVOA 1L4DB 4GDLA 2OQKA 4CDDC 2OOBB 3ZRFA 3J7YW 3S1RB 4NQKE 4HMJA 2AHOB 1TWCH 1WI0A 2DZIA 2LRUA 5HI1A 1JROA 4A3CG 3VR2A 2D5DA 3GD7A 2ON8A 3S1RH 3Q14C 2K0PA 3LDZE 3P4PB 1WD1A 2CWAA 1PV4A 1WH3A 5M5XH 2V1CC 1LT6D 3V05A 1OXUA 5LMUQ 1L0VB 1ICWA 2I0QA 2B39A 2V4LA 3HOVB 4HEA1 1HCZA 2CKZB 5J3BA 1LYLA 1UE7A 3S16B 1UELA 2MHJA 3AMZA 3URYA 1E24A 2PPHA 3KYCD 3H8HA 3HOVH 2KAJA 3R66C 4UY8C 4RAUC 5CHVC 2JJQA 4RCOA 1R4MB 5KHOA 3IT4B 4K81A 1PH6A 3ENEA 2F0HA 3EGRA 2IGGA 4XTCS 1VS0A 1DD2A 4JGHB 1HHVA 2MW5A 2B76B 3S24A 2OXPA 1HR0W 3I57A 5CV8A 5D6JB 4ARCA 2BPSA 1V2YA 2LXAA 2MGSA 2EQSA 2DX5B 1P7EA 2JZZA 1S3SG 2KDBA 1RWSA 1EQTA 3QIJA 3BVMA 4CJ1B 2UUCL 5ELBA 1K50A 1WGHA 3CSFA 3S2AA 1H9JA 4JI2Q 2EPBA 2LGDA 3B08A 1GB4A 2NB0A 2FCMA 2B2VA 4ABNA 1IBXA 1A63A 2WXFA 4IN3A 1YD8U 3VHTC 2IX3A 3HG9A 2L05A 4DR5Q 3OLMD 2VH2A 4HKQA 5EE3A 2KEDA 3PPAA 2LMCA 1B9MA 1PTOB 2KCNA 2EZVA 1E1TA 1I4HA 3T1HQ 2HUGA 1WVLA 4HJGE 1PTOH 1PTOC 3AEVA 3D31A 3V96A 2M19A 3UIOB 5BO4B 1VQKA 3DEPA 3EUB2 5BN5A 4KHPL 5FJ8H 3ML8A 1Z5SB 3DM3A 4LK1C 2O5IC 3VYUA 1QF6A 4TV3A 4XC2A 4A3OA 4NXMQ 3K0XA 4X65L 2KYWA 2KDFB 3J80E 5IKCM 1KD1C 1RAXA 3JSVA 3U50C 3BZDB 4AP4C 4PMBA 4GB9A 1ZP0B 3VTWA 5JEAJ 1SXTA 3D4RA 1LTSD 1P1AA 3E3XA 1BO0A 4LWCA 4OGQC 2KANA 3J80L 1TKGA 4DAVA 3RZWC 2DNCA 3K7UC 3PUWA 1LTLA 3J7AF 2KZRA 2C5CA 3AEGB 3DVNV 4GIVA 2R93H 2E5LL 5E1FA 4DWFA 1NSNS 1JMCA 3RULA 4IUPA 1ZDXA 3NTKA 1R9TH 1JC7A 3VRAB 3JC66 3L54A 3MC9A 3DBLB 4YXDB 1I35A 4AYBG 1YQBA 2D2CC 2KACA 1EY0A 4XQJA 1VQLA 4C00A 4EFOA 3DBRI 2CR5A 4OX9L 3AEDB 3HUIA 2JSOA 2C9OA 4FP5D 4DNRB 4G3XB 1E1OA 3A9JB 2X69A 2K5WA 2KFKB 3R2IA 1JMLA
chains in the Genus database with same CATH topology
1H9SA 3NUCA 3PUVA 1FRDA 3Q8BA 2E2JB 3FEWX 4QIWB 2GA4B 3D6CA 4QUCA 2KVMA 2F3WA 2K33A 1CM9A 4PV1C 1I50B 2B2UC 2B2YA 5IGGA 4F87A 3E0JA 2M0AA 4A3FB 5HFYA 3J7AV 1E9MA 1NEKB 3K57A 2PMZB 1VLBA 1A15A 1O80A 2Z4IA 3I73A 3B2GA 3A8KE 4TMAB 3NVZA 2K01A 2PVOD 3OWFA 3UI2A 4P2CB 5AFWA 4C3JB 2K9XA 2QMTA 2WXGA 3Q23A 4BBSB 1QB5D 3IL8A 1TKEA 4XDXA 1EIHA 1RTOA 1I3QB 3GP7A 4F7XA 1FYCA 1GHJA 3IFTA 2L55A 3FKIB 2XVSA 1EEID 1JCKB 4K6DA 1ENCA 1SNOA 5J1ZA 2ICEC 3TUOA 1JWBD 3KWVA 4PMCA 5I4DA 1UEAB 2I38A 3WOFA 1C4AA 1A3VA 2TSSA 3Q8EA 2PLPA 1ZUD2 4HROA 1Y8PB 5G3LF 3K5LA 1EY4A 5EPKA 1JRPA 2D5GA 4WWMA 3KBGA 5M3FB 3LWEA 1RFKA 3A54A 5D3IB 2NVTB 2VNUD 1QOAA 1ILQA 4C56C 2E2HB 5JOBA 4K6LA 2F0JA 4ZRQA 2HDLA 3AM9A 4KKSA 1DXMA 1FFVA 4A3KB 2EYLA 5KNBA 1I4PA 1JR0D 4KV6A 2JSVX 1J7AA 1NENB 3P4QB 2KQ4X 1KF6B 1SDFA 1WGKA 4FXKC 2XWBB 1HPCA 3DWMA 3IKJA 1TVXA 4XQQA 2ACZB 2SNSA 1ZXHA 3LXFA 3PZ7A 1GHKA 3GTPB 3P4RB 2EKIA 5KEEA 3AMUA 5EKIA 5A35A 4OW0A 3L9AX 2G1EA 1HQMC 5EKKA 4MHEA 3X3NA 3GTLB 4QUFA 2BB5A 4MN3A 4KTAA 4DQOC 1STYA 3HOXB 4KGTA 1RKNA 5C4XB 3MVVA 2F3VA 2NBFA 1JOQA 1NUCA 1EY5A 5EKLA 2BBCA 1GUWA 2JXTA 3NSWA 1PXUA 4JWUC 2J7ZA 2Z1CA 4RF1A 5MPOA 1BDOA 2G9DA 5EE1A 1YQ4B 5FO8B 3IAM1 3KLRA 4FXGC 3BVZA 1T6BX 1V8QA 2AUJD 4KKUA 4ZUIA 1YQ3B 1GUNA 3GV6A 5K5PA 1DYQA 4KKJA 2DBYA 4GZYC 2NYZD 1RDPD 2XN9C 4TRDA 3NQIA 3AE6B 5J39A 2R92B 2TMPA 4TKOB 3SDZA 1HZ6A 3CHBD 5TSSA 2IT1A 4N59A 2KMMA 1STEA 4RF0A 3M3YB 1LABA 4AS1A 2EYFA 2E75C 1JB3A 5KIXA 3SFEB 3CIRB 5JJZA 1HZ5A 4LTUA 2WP9B 3AE9B 1F2ZA 2VB3X 2ZW0A 4J6HA 4IALA 2IL8A 2WXHA 4CBVA 4QCLA 2GRIA 1RYJA 1B1ZA 2MPMA 1DCZA 1M8AA 1EYDA 1EZ6A 2SNMA 2WACA 3NP8A 4XQNA 3NS1A 4DNTB 1WTXA 2VUMB 5AUIA 1EFID 3RZDB 3ABVB 1SF0A 1U4MA 3Q22A 3VYSA 4NDXA 3BYYB 2AQ2B 3EROA 4BY1B 2KN4A 2EY2A 4WJWA 3AB5A 1HTPA 4L1BA 4EQNA 4NZLB 2I46A 5EGTA 4C3IG 1YNND 2QKIC 3FPPA 4B9XA 1TYGB 2LFIA 4A3MB 1F0ZA 4A3BB 1RF2D 1II3A 1K8MA 2EYJA 3PO2B 1C76A 1MVKA 1MSGA 3P20A 1CTMA 1NR4A 2X38A 3EFXD 1FO4A 2KDMA 5C2TB 3DWQA 1MGSA 4A55A 3FDTA 2LY7A 2Z8LA 1XLOA 3HOUB 1ONLA 1WCMB 1TY2A 4IUNA 5C5LA 3MXGA 1PDQA 3OIPA 5FLXE 1BCPF 4FO2A 3VA5A 1HEZE 1WTVA 1OO9B 1TS3A 2DLBA 2KHSA 4A90A 2RDFA 5LL6S 4RNAA 4KHVA 2K6AA 2N7JA 2CJOA 2N9KA 1OQQA 3DM1A 1AEXA 2KQ3A 4XYQA 3DUZA 3LB8C 3NTIA 1PFDA 5M5WB 1UWXA 1J7BA 3HGBA 1TZOA 2F0SA 4C7YA 2PTLA 3GB1A 1KLGD 1LO5D 1QOBA 1PRTF 3MEHA 1AYFA 3ZJTA 1JWSD 3AE2B 5IGCA 3W5VB 1DJRD 2L83A 1ZOYB 1IGCA 1OXSC 3L4PA 1PGXA 2LGIA 1SNCA 2Y3AA 4IFDJ 3KWLA 2WDQB 3E56A 3W1SA 3T3NA 5C6AA 2L52A 1STGA 3L3OC 1EM7A 1H9KA 3OMCA 3T56B 3SXHA 4A3GB 1EYAA 4HCSA 2JA6B 4L8JA 1DM0B 4IUTA 2ENBA 4USAA 1EY7A 1F2MA 2N9LA 4C3JG 3Q6SA 1LT4D 3T53B 2NTSA 4NP5A 1NR2A 2M56B 4HTHA 5JPNC 3MXNA 3HS0C 1GUOA 1VZ8A 4LK0M 2DY7A 5M5YB 2O4XA 2A73B 2MJEA 4L23A 2BYTA 3GTKB 1XX8A 1ZDVA 3SR1A 3P75A 4IZ8A 1PTOD 1ENFA 2EOTA 4NKLA 3U2SC 3C2PA 1L5PA 5EBDA 5IOCA 1I6VC 3B2FA 5I6WA 1G91A 5AUKA 1LTRD 1XYIA 4XT1B 1WTPA 1KDAA 1STNA 2JU6X 3GTMB 2F1MA 1YMHE 2CW0D 1E10A 1S5CD 3QB3A 2WINB 3GTJB 1D2BA 2AWNA 5M3MB 4OIJA 2KECA 3CRLC 2K03A 2KCCA 3NK9A 1B9RA 4DAPA 3QOLA 5FK9C 1MPEA 1D4BA 5LL6X 2WV6D 1DOKA 2EVBA 1SE3A 1F77A 2RQXA 3L7ZC 3MZ5A 5C0XI 1M4VA 1SNQA 2NVQB 2GI9A 2SEBD 1TR5A 4YTPB 1Q8IA 2JYEA 1EWYC 1JW9D 1C78A 4ULLA 1D5XC 1SE4A 4PNYA 1GXDC 3WDNA 3A7LA 1QILA 1LTTD 1QLBB 4DK1A 4IDIA 1IYUA 1I7HA 5M9OA 4JK1C 2ID0A 1O7YA 2L12A 5D7GA 1V97A 5BYSA 2YEPF 2NN6G 1JQYD 2WU2B 2PNRC 3SFDB 4R8IA 2Y0SB 4KGRA 1D5MC 4BA2I 4KY6A 1B50A 3OOCA 3HZXA 1XXGA 4JPSA 3Q8AA 4RH6A 1CQVA 2MP1A 3FILA 4REZA 4C3HB 1ZKOA 1OFFA 1WD0A 5C3JB 4MH8A 5BMHA 1WRIA 4K14A 2V4DA 4ILWA 4HMIA 3DEOA 4X3SA 3T4AC 1Q1EA 2PW9A 3SVMA 3IAS1 1HQRD 1TKYA 3NHHA 2XRQD 5FR3A 4L6TB 3KF8A 4FXCA 2QDBA 2WS3B 5C44B 2V3NA 4NAWB 2PW7A 4ZQ3A 1FFUA 2NMQA 1GJXA 5E6JA 1PRTB 1C4QA 5BMGA 5KNDA 5I2YA 4G7ZC 2D62A 1PRTC 4ITKA 4P16A 1CQFA 1SYDA 5FO7B 2JA8B 2EE1A 3HVZA 4I65A 4F88A 2EY1A 1N5XA 4EGVA 3IFDA 4EQOA 1X3PA 1Y1WB 1TWGB 2W3SA 2EJMA 2WDRB 2F0WA 3D3RA 2Z4HA 3SE0A 3MAQA 4ZLTF 1A6XA 1EY6A 2F0TA 3AEFB 3S17B 3E6ZX 4UAIA 3RLFA 4CKBA 5LHY1 1CZPA 3AEAB 2L4NA 5EBCA 1SFOB 2WKCA 5ELEA 2E2DC 1VJKA 1CA6A 1Q10A 3PUZA 1XF5L 4IOIE 4J3OD 4KD4A 2JEAI 2N0SB 2F0UA 4V190 1G8ZD 2CW0C 1SNDA 4F8MA 4TQ1A 1Y69U 4HEDA 3NVYA 2XRSD 5ELFA 1N60A 1ZPSA 1DZ1A 1PFMA 3I91A 4ODGA 5EPJA 1DOMA 1TS5A 1FR3A 1KTKA 1MHXA 4KKTA 1K8OA 4A9AA 4G57A 1QOHA 3C3LA 3KUPA 1V1PA 3I70A 3LWUA 4E6IA 4ZUJA 3C8YA 1HA6A 4XE0A 2QF7A 5G5HA 3X3MA 1ET9A 1J7CA 5C0XJ 5A2QL 4H2AA 2EYOA 1SYGA 4WORA 1E2WA 3OPOA 1ZYRD 4KD3A 4KMUC 3AEBB 3J9CA 3W3AA 3KLSA 2IJ0A 1T5XD 3MTSA 2FFKB 2F0DA 3ZJVA 3HEJA 5BN4A 3P1HA 2PIAA 4K2KA 2NVXB 1BQQT 1DOLA 4IUQA 4A3JB 4IURA 3E9SA 1EQVA 2PW5A 3BDLA 2BE5D 5HGTA 5KNCA 1C79A 5EPLA 1BOSA 4FNFA 1SSNA 2OEOA 1NCVA 4GDLB 5JVH3 2SOBA 4NMZA 2GB1A 5C5MA 2F0GA 3P7JA 1SE2A 3BK2A 4JWSC 4LLGM 2LFNA 1SYFA 3BDCA 3AE7B 3O13A 1G2TA 2EYHA 2K28A 5CV9A 2DNEA 4ZKCB 4G4KA 5E4WC 2KUMA 3QWNA 4HSVA 4KHZA 3P42A 2CJNA 1OQRA 1OXTA 5C4ZA 1IBXB 3PMFA 1R4PB 1O7ZA 2WKDA 3LX0A 4N9TA 3RFZB 1GPXA 3FC4A 4RKLA 2LMCB 3H3VC 1U4PA 1I4XA 1A3UA 1FCCC 4HRSA 3MHBA 5JAVA 5I6YA 4S3SA 3AE1B 2A69C 4XDCA 2JYTA 4C7ZA 4A8XC 1QOFA 1L0XB 3S2HB 2WIIB 5K36G 3NE5B 3P1MA 5G3LD 4YSYB 4DAYA 4DN4M 3H91A 2L0CA 3S2DB 2WXJA 3OIQA 1EEFD 4HCEA 1HXYD 5JEAH 4KY7A 3PV0A 2JWUA 2JE6I 1P7FA 2AWOA 1W6KA 2ICIA 2AQ3B 1FCLA 3KQ4A 5C4HA 4RHSA 3TSSA 3D6WA 2BS2B 1EYCA 1YN5A 2PCFB 4Y7NB 1SBBB 3HOYB 2ZXPA 5C4JB 1HA5A 1Y8OB 1XCTL 3T13A 2B2WC 1H9SB 4IFDI 3U4EG 1F9QA 2BA0A 5ISRA 5C0XH 2MH7A 3AE8B 3MXPA 3VR9B 1AW7A 1JWMD 2M2LA 3CWIA 1Z47A 4BS9A 1ZYRC 3DMUA 1PZJD 2WXQA 1NI3A 1ML0D 2WQYB 1Y1VB 1C8CA 1VF7A 1TKWB 1KFYB 2EYPA 4EVOA 1FXIA 2PMVA 3C1FA 2B2YC 3PZ8A 1FD7D 1LTGD 1UWMA 1KDCA 1YN4A 1TIID 2WXLA 4XT3B 3E5SA 2BE5C 3M4YA 3Q69A 2V3PA 2K5DA 4C3HG 3NBHA 4EE2A 4KJOA 1BR9A 4C1NI 1NAPA 4H13C 2W3RA 3FMCA 3R8BA 3I3CA 3K0YA 4KGSA 1GOZA 3Q8CA 4ZOHC 1K83B 1Q90A 1A3TA 3MHZA 2SAKA 1BUIC 3C46A 2HDEA 1FXAA 2PQEA 3TZUA 1B9NA 1JOOA 4ZRPA 1ET6A 3DWPA 4Q0FA 4RGTA 1IKMA 3TEXA 5IT9L 2K1BA 2R3ZA 1EOTA 4C1NK 5T1GA 4DU9A 1LTAD 2W82A 1B3AA 3W5UB 5IGEA 2DWQA 1HFGA 1A70A 3ND9A 1AZQA 3Q8FA 1B44D 3SR6A 4QF4A 3BG3A 2WU5B 1OXXK 2EJGC 1V43A 4YIJA 1QG7A 1ROEA 1Q3LA 2BW2A 4HAEA 1WXQA 2F0EA 5IGFA 5C3EB 1JOKA 3TEYA 2JXMB 1WTWA 2DYMA 4QMGA 1SEBD 3SEBA 4PT5A 3H0GB 1PLFA 4A93B 4FF3A 3FRPB 1CT1D 3SK5A 1PFNA 2J0TD 2XIWA 4EQPA 3ZGZA 1DGJA 3QOJA 4UDUC 4IKGA 5IGBA 4JX1C 4DGZA 5CC4A 2IDYA 2K04A 5JPMC 4YSZB 1VMPA 2M9VA 4WRDA 2J52A 3EQLC 1Y56A 2E6XA 1CZWA 4HKZE 5FO9B 4YT0B 3CQZB 4MIUA 1K51A 1FRRA 1EWHA 1CJEA 2NWGA 4CHTB 2KJXA 1JICA 1LTBD 1TWAB 1B2TA 1PDXA 4HR7B 3CRKC 3AH7A 4CKEA 3S9WA 2FHTA 1BCPD 5T1IA 3AB9A 3NTHA 3J81E 1H9RA 2BT6A 1Y8NB 1IKLA 2YYZA 5EJWA 1C9FA 1SAPA 3GO5A 4A3IB 4K8JA 4WIPA 1PFBA 3J81L 3KK7A 1LACA 1E2VA 5EQ0A 2KEEA 4PQXA 2BS4B 3TP8A 1PYWD 1QJOA 4K5XA 3AU7A 1V1OA 2EELA 4X3KA 3TN2A 5FOBB 2X6LA 2V0GA 2FBWB 1PRTD 5ELCA 4P6VF 1EL0A 1MSHA 4OO1I 3DXJC 1GB1A 4ZK9B 4FF2A 2FE8A 1FEHA 3TBIB 1FNUA 1VZ6A 3N52A 1MBYA 4US9A 3IXSA 1AZPA 3MFGA 1HTLD 1KABA 1XLPA 2JZPA 4H7BA 2PZTA 1BBXC 3EA6A 2LKVA 4IUUA 4WAFA 5COYA 2BOSA 4QB4A 3G7LA 5FKAC 1WWTA 2HDMA 2BS3B 3A55A 2PO4A 1FMAD 1IGDA 1TWFB 4XXEA 2F0IA 3SHLA 5KGUA 3NRZA 3RPFC 4LJZC 2E2IB 2L5TA 3F2UA 5DEHA 3S1QB 1MI2A 2F0KA 1OXVA 2I07B 2WLBA 2K05A 2QCPX 2EJFC 3R93A 1SNPA 2ZT9C 3SK4A 2B2TC 3S15B 1MHHE 2JA5B 1UNSA 2ONQA 3DHQA 2F0VA 1SYBA 4TSSA 3TMEA 2JP1A 3NVWA 3T3OA 4CGYB 3NVVA 2IWHA 3D4WA 1F9PA 4TQUS 5JXVA 1JWUD 3NWTA 5JEAG 1E7PB 4R8NA 4XWTA 5BYRA 2WXNA 1O7LA 5KYLA 1SMYD 1BNZA 1HUMA 3TP5A 2B63B 3MXUA 3NUHB 1PZID 2NN6I 2JEBI 1CFMA 2NZ1D 4K5VA 2HTME 2AUKA 1TS4A 3RMHA 2H88B 3T51B 2B8FA 5CMDA 1I4GA 2WXKA 1HUNA 2INPE 2ZW1A 3I72A 2BDOA 5DAUA 1ZEQX 4TQ0A 2NVYB 4A3EB 2K7VA 2BCOA 1WYGA 5DM73 1BCPB 1STBA 3VR3A 1CA5A 2F03A 4B9WA 4V0BA 2QJLA 1U4RA 3HOWB 1QQRA 2WB1B 4IFDH 1BCPC 2B2UA 1NYQA 3MC0B 4JE3B 1Q12A 5HG2A 3ETRA 1FGBD 2N55A 1LT3D 2JX5A 2LHDA 1J9OA 3VR6A 4BA1I 1EU3A 1VMCA 2KOLA 1D5ZC 2R6GA 3K5NA 4XDDA 3MFYA 3TZDA 1DONA 3ND8A 4ZHOA 1CZGA 5M5XB 1C4CA 3OWEB 3H94A 2F0QA 1UUPA 4N9PA 4YSXB 3K6OA 5GXGB 4RGMA 2LEKA 3QO2A 1TT2A 5E3FA 2IX0A 3N6RA 5IIFA 2CVRA 1MD2D 2LS01 4KI0A 5D65A 1F2RI 1SJED 2RDGA 3TP7A 4Z9CB 2DN8A 4N6EB 4I7ZC 4OZCA 2A69D 1KNEA 4C3IB 2RKSA 1B53A 3ERQA 4OIKA 2L32A 2PZWA 2H1EA 5I9PA 2F0PA 1LTID 3HVDA 1CI3M 4O42A 4HN7A 3WCQA 2L11A 2BA1A 4OL7A 2VZKD 5HHDG 1TS2A 2A74C 5EE9A 3CKIB 3UI3A 2FMCA 1EY9A 2NTTA 2Y5PA 3S1MB 1YNTE 3T16A 4Q2JA 3RUZA 1RTNA 4DK0A 4ZKBB 1D1KA 1TU2B 1JE4A 5A2QE 4BY7B 2XNAC 1YJIA 1VF5C 1I6HB 1MI0A 5DM63 2X6GA 3PIO3 1JALA 1U4LA 5T8IA 4CQNA 4XYOA 2R93B 1WTRA 3TDQA 1R9TB 1IW7D 5CV7A 1HFNA 4OVZA 2E74C 1C77A 3H09A 1GAQB 2J42A 2DY8A 1SMYC 2EY6A 3VRBB 4BWGB 4OZAA 2B2WA 1QT9A 1NVID 1JORA 1XEEA 4MT5A 2OEDA 1VZ7A 1RJTA 2RSOA 1SIJA 2JA7B 1UGJA 3LNNA 2HCIA 3FPUB 3FILB 4A6QA 2O2LD 2AQ1B 3H6MA 1V8CA 3MJ5A 2R61A 2OF1A 5I9OA 1BUVT 5CV4A 2RDHA 4J8QA 1G291 2PKOA 2WXOA 3AEEB 1IUEA 3I4LA 3RZOB 3U9OA 4NAMA 1K52A 3PO3B 5ELDA 1N62A 3BS1A 1TJEA 1X3QA 1WSPA 2YEPB 1STAA 5C3XA 4H44C 2RPVA 1C48A 4CKCA 3RD4A 1EY8A 3DWAA 1UAPA 3M7GA 5CGKA 3QIAA 2LHEA 1KDBA 4OO1H 5CV5A 3VYRA 4D2KA 4KN4C 4M0WA 1CHPD 5CBAE 3GTGB 2G9HD 4NJCA 1DOIA 2WXMA 2M00A 1PUTA 3AE3B 1S5DD 1EU4A 2FINB 3NPPA 3M4OB 3AE5B 2B2VC 3HRDD 4WURA 2QEJC 1O78A 2XWJB 3G6JB 2W54A 4JBWA 2Q8TA 1LV9A 4RHRA 2RMMA 1F2LA 1XTCD 3ONAB 2IGDA 3I4MB 2A6ED 2LUMA 5F2DA 4YWGG 4CJ0B 1IL8A 4ZRZA 2VZKB 2F0MA 4YTMB 3A7AB 3PUXA 1N61A 1KH0A 3NXWA 2HCCA 3VYTA 5D14A 1T3QA 1QNUA 4L2YA 4X3UA 3K7AB 2WXIA 1TWHB 2YU9B 1FNWA 4U68A 1PGAA 1QNKA 1T5EA 4ZYSA 3GV3A 2BB6A 3ZJUA 5IODA 2Y5CA 2FJ2A 2IX1A 1V1PB 1AN8A 2A68D 2PZUA 1AP0A 3HKZB 4B0EA 5HURA 2K5QA 1J8IA 4K8IA 1Q1BA 3OHXC 3W9CB 3EVQA 2W55A 1ZXIA 1VCIA 5D3DA 2H89B 1QOGA 1IW7C 1XWEA 3LYYA 2CHBD 3KLSX 2NUCA 2Q8RE 3BIID 1TQOA 3D4DA 3K59A 1YNJD 2NN6H 1KNAA 1S4ZA 4WFN3 5E4XA 3EJIA 3I8ZA 3I90A 5H92C 3QG1A 1FIQA 4IFDG 1G2SA 3I9V1 2Q8IB 1YN3A 5H8YE 1SYCA 1RHPA 3BYTB 2FUG1 5BYQA 3TEWA 1RODA 1AFPA 3QJYA 3KBXA 1D6EC 1A2UA 1PGBA 1VDVA 5J22A 4PMWA 1E0BA 5IT9E 4G7OC 3B9JA 4R9WA 2DYOA 4HSPA 1ENAA 2BDNA 3MA2B 1S5BD 2QILA 5BN3A 2EXZA 3P4SB 3ZYYX 2B8GA 5DNFA 3OSOA 4KY5A 4OHJA 5NUCA 5CORA 2EY5A 3K58A 2N88A 2OHFA 2WDVB 4K2LA 4O1NA 4GLSC 5EE0A 2H4OA 3PIP3 2MEKA 4XIGS 3U9SA 3JAME 5KRUA 4N58A 1WTQA 3OW7A 3DWGC 3HP3A 2WXRA 4G7HC 2MUYA 3K5OA 4DFAA 2A6HD 1EIGA 1F2RC 1S5ED 1QE6A 3JAML 4FVMA 1IYVA 2E3TA 4FYDA 1SB3C 2HQEA 4C80A 1RD9D 1X32A 1A2TA 1BMLC 1QKZA 3IT6B 4IQZA 4LAAA 1R4QB 3CU7A 2WAQB 2A6EC 3R2TA 2B2TA 4FF1A 2K3UA 1F2YA 1PMRA 3PO0A 1CK1A 1XLNA 1E0ZA 1STHA 1NYRA 1DOYA 1L0YB 3PUYA 1GUGA 2JYOA 3AE4B 1C4PA 3VA7A 4NW2A 4AYBB 4RWSC 4KJNA 3ITPA 1I4RA 2Q5WD 4FXDA 1FNVA 1W6JA 1FD6A 1SJHD 4M8AA 1EZ8A 3GS2A 1E6EB 1TY0A 1WTOA 1LLRD 3NQTA 5FLXL 3U7ZA 4DF7A 3FVQA 4B08A 2MJ3A 1ZXTA 4RGOS 4ARIA 2A68C 3M7NA 4ID6A 2ZXOA 4RA8A 5CYUA 2PYKA 1L6VA 3TP6A 3A8JE 2ZXRA 1SNMA 3V2TA 2D9UA 1GUSA 3C1EA 4BBRB 2CU3A 4AQ7A 2LJIA 2J4XA 2O5JC 2PPBC 2AX5A 2VB2X 5KYIA 2FMMA 2L1AA 1KAAA 2RBMA 1YNJC 5IGDA 2RSNA 3M85A 1N5WA 1SYEA 4KX6B 3SK8A 4RGNA 3S14B 4YTNB 1E2ZA 3BVGA 5CR3A 4RFBA 3OMGA 3AECB 3V3XA 3VR8B 1I4QA 1GUTA 1PZKD 2KWDA 1PTOF 2MJDA 1ACCA 3P63A 4K5WA 2IGHA 2F0LA 1VR9A 1DOXA 1Z6HA 2F0NA 3BWUD 3MP9A 4DA2A 4KKIA 2V4IB 2MHVA 2CQAA 4ME5A 1XLQA 2J53A 1S5FD 2E76C 3TEZA 3Q24A 2F0OA 1SSOA 3AV8A 2KA7A 3A56A 3HOZB 3IAYA 2RA4A 1XO3A 2EDGA 3VR4A 3MWYW 2WP8J 1VDZA 3NWSA 4OO1G 3VQIA 4IUVA 2PVGC 4MM3B 3GTQB 1QWYA 4A3DB 3HRZC 4LMQD 1CHQD 3VR5A 2OT2A 1H9MA 4US8A 2INNE 1BXTA 4WH4A 4XWWA 4M1UB 1RCVD 2A6HC 3K5MA 1QCBD 2MJ8A 1FM0D 3Q0AA 1YNNC 1IHZA 3SK6A 4KN7C 2L1BA 2BTEA 1YJJA 4R3DA 3BDOA 1R7SA 5K36H 1L4ZB 5CV6A 2IPKD 2WXPA 1LT5D 1ESFA 1KRHA 3A8IE 2EYMA 3I4NB 4ZAIA 2L9HA 1XCQL 4DXGA 1EWCA 4GDKB 2RVLA 4MACA 2K32A 2QSDA 4WQMA 1KLUD 5LNK1 1ESRA 1G6ZA 2VXWA 5CBEE 4C2MB 1U9RA 2K5PA 3S1NB 3AN1A 4CJ2C 1ZE3D 5G5GA 1F9SA 4ZHPA 2A5HA 2R7ZB 4U673 4KK7A 1ILPA 2IW3A 2SDFA 1L6UA 5C3WA 5C0XG 2WNMA 4B0MA 1B4OA 2XSCA 1AWDA 2K22A 1N63A 4Q5VA 3BK1A 3U52E 2F4IA 4X3TA 2QIEB 1D1IA 3NBIA 1Z7TA 3R3OA 5I2XA 3ZQ4A 1BF4A 3W2DA 2F0FA 4OZBA 1VRAB 3GTOB 5JVG3 4RKBA 1F9RA 1HRJA 4H0LC 2JQRB 4DXFA 3FAHA 4FF4A 1RM6C 3GQBA 4RCNA 2I2YA 5BMIA 3NZ3A 3D8GA 4L63B 1JQ4A 4J1MA 1JWAD 1K53A 3WOEA 1TWCB 3N9YC 1L4DB 3J7YW 3S1RB 4HMJA 5HI1A 1JROA 3VR2A 2D5DA 3GD7A 2ON8A 2K0PA 3P4PB 1WD1A 1LT6D 3V05A 1OXUA 1L0VB 1ICWA 2B39A 3HOVB 4HEA1 1HCZA 3S16B 3AMZA 3URYA 3H8HA 2KAJA 4RAUC 4RCOA 3IT4B 2F0HA 3EGRA 2IGGA 4XTCS 1DD2A 1HHVA 2B76B 2OXPA 3I57A 5CV8A 4ARCA 2MGSA 1P7EA 1RWSA 1EQTA 3BVMA 4CJ1B 1K50A 5ELBA 1H9JA 2EPBA 1GB4A 2NB0A 2B2VA 4ABNA 1IBXA 2WXFA 4IN3A 2IX3A