5MPOA

Crystal structure of human molybdopterin synthase complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
b'SMVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin synthase sulfur carrier subunit
publication title Crystal structure of human molybdopterin synthase complex
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5mpoA00
1NI3A 1FRDA 2QJLA 4KX6B 5G5GA 3AM9A 3DWMA 1YJIA 5GXGB 1N62A 1FIQA 1XLQA 2WDQB 3P4SB 3SFEB 5AUIA 2WQYB 1CJEA 4C7YA 1AYFA 5AUKA 2H88B 1E10A 1WYGA 4WQMA 1UWMA 1FM0D 3AECB 3CWIA 1E9MA 3BIID 2K22A 2PKOA 4N58A 1TYGB 3P4RB 4WWMA 4US9A 3LB8C 2L83A 3NVVA 1V97A 2AX5A 2L52A 1XLOA 2W55A 3AN1A 4JWSC 3W5UB 1B9RA 1KRHA 3NVZA 1FRRA 1A70A 1TKYA 2W3SA 3AE5B 1JWBD 1L6VA 1NYQA 1PUTA 2CJNA 3P1MA 4LTUA 5EE9A 3ZYYX 1RFKA 2MJDA 4C80A 2MJ3A 4JWUC 1ROEA 1L5PA 2MJEA 1VJKA 1JWAD 2G1EA 3AE6B 3B2GA 1L6UA 3ETRA 2DBYA 4P6VF 5G5HA 2WP9B 3FAHA 3HVZA 1L0VB 1JRPA 1TKGA 1SF0A 4ZHPA 1NEKB 2JQRB 2M56B 1FO4A 2WU2B 1QOFA 1F0ZA 1T3QA 4JX1C 3VRAB 3AE3B 1N5XA 1QOBA 2CJOA 3HRDD 1YJJA 4YSZB 2EKIA 1N63A 1PFDA 3FC4A 3AEDB 1XLNA 1WRIA 4YXDB 4ITKA 4C7ZA 1GPXA 3AE2B 1OQQA 1IUEA 1PDXA 2WLBA 3AEFB 2ACZB 3AE9B 1DOXA 1AWDA 4HRSA 1WWTA 1QT9A 3EUB2 5MPOA 2PIAA 2K5PA 3AEBB 3PO0A 1DOYA 2DWQA 1QF6A 5H8YE 1RYJA 5C3JB 1NENB 1SB3C 1TJEA 3AE1B 4YSYB 4YTMB 1NVID 2BS2B 3NS1A 1I7HA 1GAQB 1SIJA 1VDVA 2BS4B 2FBWB 3NVYA 3B2FA 1ZXIA 3B9JA 1WGKA 2K9XA 4YTNB 3KWLA 1KFYB 1DOIA 1RM6C 2WDVB 1XLPA 3AEAB 4ZOHC 4YTPB 1FXAA 2N0SB 1N5WA 2LEKA 2Y5CA 1KF6B 3LXFA 1N60A 1VLBA 3P4PB 4HROA 3VR9B 1J7AA 3SR6A 4A9AA 2QIEB 1E0ZA 1NYRA 1WXQA 1ZOYB 2BS3B 2KAJA 3W9CB 5EE1A 1QOAA 1JROA 1YQ3B 1R7SA 2JX5A 2W3RA 2W54A 2KMMA 1ZP0B 2PVOD 1QLBB 3RPFC 3WCQA 1XO3A 2PVGC 2WDRB 3AEGB 3ABVB 1E6EB 1EWYC 3NVWA 3P63A 3AE7B 4N59A 4USAA 1FFVA 1V8CA 1E7PB 3AEEB 2OHFA 4N6EB 3W5VB 3L4PA 3AB5A 1DGJA 1OQRA 2B76B 3HUIA 3CIRB 2CU3A 2Q5WD 1FFUA 1QOGA 3AMZA 4ZHOA 5C2TB 2E3TA 5EE0A 1OFFA 5H92C 2WS3B 2M19A 2WU5B 1JALA 3NRZA 3P4QB 1JQ4A 2HTME 3DWGC 1JW9D 3AH7A 2MH7A 3AV8A 3VRBB 3AE8B 5EE3A 1J7CA 3SFDB 1TKEA 3VR8B 4US8A 1CZPA 1FMAD 1ZUD2 1J7BA 4YSXB 4IDIA 1RWSA 2H89B 3AE4B 4FXCA 1N61A 1YQ4B 4YT0B 2BT6A 1FXIA
chains in the Genus database with same CATH superfamily
3MC8A 1D5MC 2QJLA 4IG7B 3CF6E 5CHFA 2DAFA 1FIQA 1BUIC 4I6LB 5AUIA 5LXIB 5L83A 1SXTA 1E10A 2QC8A 2RDGA 3VH4B 1FM0D 2ZPYA 2FCSA 1HXYD 1WR1A 2JZ3B 2M0XA 1V86A 1I42A 1EUVB 1MJDA 4ZRIA 2L52A 4YL8A 2PW9A 4NQKE 1XF5L 2E6XA 1EO6A 4W9IA 4ZDVA 4JWUC 4YWGG 3M95A 1JWAD 4PS3A 2SAKA 4RGMA 3GS2A 2BB5A 2JYEA 1F0ZA 4GXBA 1PGAA 2D3GA 3ECIA 4MM3A 1RFAA 4EFOA 3JW0X 4KV2A 4IM2A 1WZ3A 4IOIE 1GUAB 5D3IB 2ONQA 5HG2A 2RPVA 3NG0A 4KGTA 4YTMB 4AS1A 1I7HA 1GAQB 4M8MA 2BS4B 3S2AA 3RD2A 4L23A 2WDVB 3U52E 4Q2JA 3EECA 1EU3A 1ESFA 3U2SC 2JX5A 2W54A 2ON8A 2K8HA 4ACFA 4N59A 2GI9A 2LHEA 3PRMB 3TEXA 1WXSA 3AEEB 1DGJA 2WXPA 2VZKB 4GSWA 2WS3B 2HE7A 1EWCA 2HTME 2YEPB 3QA8A 3VQIA 1XEEA 4MM3B 3VR8B 1GC6A 1HZ6A 1ZXHA 2ZNVC 5HKHA 4IDIA 5GMVA 1UWXA 3GB1A 5FR6A 4GB9A 1AYFA 2V9HA 2KFKB 4B0EA 2XK5B 1UWMA 1XCQL 3PS6A 1LM8B 2O2VB 3Q8FA 2NTSA 3NVVA 1STEA 1C1YB 3HIZA 1KRHA 3H1UA 3RNCC 4R3DA 2W3SA 1L6VA 1J19A 2J0KA 1SBBB 2PEAA 3RYTA 3FAHA 4P16A 2M1MA 1VZ6A 4HVBA 1HQRD 4JIOU 3IBEA 3HRDD 2BW2A 2R2OA 1CQVA 1I4QA 1R4MB 4KGSA 2WXQA 4NNJB 2RR9A 5E6NA 1WJ4A 2MCNB 3KLSX 3ZXVA 2KDEB 2FBWB 1K8RB 2JZPA 1VCBA 5AZFA 3A4RA 4IM3A 4MGZE 1N5WA 1VLBA 2BKRB 4K7WA 5D7GA 1E0ZA 5DPTA 2WXHA 1ZOYB 1WI0A 2KAJA 2LJIA 4BBNC 2KQ4X 1R4MI 5CX3A 2ZJDA 1SEBD 2KWCA 2CKHB 1X1MA 5HFYA 1Y8RC 4W9LA 1WH3A 2E3TA 5EE0A 2D3CA 1P0RA 4A6QA 1HE8A 1CZPA 4F1SA 2ZPNA 1RWSA 3AE4B 5AZGA 1LFDA 3ENEA 4HPLB 2M8SA 4RCOA 1R4NI 4HKZE 5CHVC 4NAWA 1TS4A 2ICIA 3AM9A 2IDYA 5DPSA 2Z0DB 1TY2A 1C77A 2PE9A 3EC8A 1Q0WB 3LB8C 1V97A 4FJVB 1B9RA 4C4VB 4HCNB 5DPRA 3P1MA 3QK0A 3U7ZA 5JZEB 4LJPB 2RPQA 2KX0A 1WMHB 1V5TA 2YLMA 4P6VF 2QSDA 2MHJA 3R2IA 1LQBA 4A8XC 1M4VA 2V1YA 4ARCA 2LGSA 2ZVOA 1UUPA 2KT7A 2L8JA 4MH0E 4YSZB 3ALBA 4GIVA 4ANWA 2NBVB 2MSED 2LMCA 2WLBA 4ZRKA 4K7UA 2KN5A 2OOBB 3FKYA 4RGTA 2A5UA 3PSEB 2PIAA 2GLSA 3VUWA 4L1BA 4OZBA 4K3BA 1ENFA 1QQRA 5BO4B 4GDLA 2D3BA 2Y3AA 2N1VA 3TIXA 1SIJA 1VDVA 2G4DB 3B9JA 2ZCCA 1RLFA 5BMIA 1DOIA 2MWSB 4MGIE 4YTPB 2LEKA 3VR9B 1ISNA 4WURA 1HTQA 2RGFA 3DBLI 3GOEA 4A55A 1WRDB 3O65B 4J3OD 3N3KB 1TS3A 1Z5SB 2HTHA 1S1QB 2B76B 2IJ0A 3B1LX 5H92C 2WXGA 2N4FA 2KQSA 2AQ2B 1JALA 3N9YC 3L13A 3NRZA 1K53A 4P1CC 4DXFA 4AOFA 5TR5A 1TKEA 3SU8X 1MVKA 4NJCA 1WGGA 1OQYA 3ZKJC 3WAMA 1ZKHA 4FXCA 2L76A 1N61A 4BOSC 5TSSA 1VRAB 2WXOA 3IT4B 5E6JA 2FAZA 5G5GA 4GDLB 2GBKA 3DVGX 4B0MA 2NVUI 3L17A 2NPTB 3P4RB 4US9A 1T0RC 1KLVA 1UBIA 1XLOA 4G3XB 3W5UB 4WQOB 4H2AA 2YEPF 1LXDA 3H7PB 3HVDA 3GZNB 4LTUA 5EE9A 3ZNID 1H4RA 3PT2B 4TMAB 4K81A 1L6UA 3QWZB 2DBYA 3Q2AC 1L0VB 1ZDXA 4HXDA 3T3OA 1MHHE 3I5JC 1XLNA 4ITKA 2JU6X 2MW5A 3MHZA 4C00A 4D2KA 4GGQA 1V49A 3EUB2 3UQAA 4ICUA 3GP7A 3T8MA 2L0TA 4XX5A 2N9KA 1LGRA 4NAMA 3GZNI 2DENB 3JSVB 1TZ1A 2K3UA 3SD5A 1JWMD 3R66C 1P7EA 3QCAA 1J7AA 2IGHA 4A9AA 3RT3B 3WIMA 1YQ3B 2CU1A 3WA0A 2C7HA 1PGXA 1TS5A 1FD6A 2WDRB 1WGYA 3ABVB 4RMAA 2TSSA 3TBLD 1I4PA 3P42A 3WALA 3AU4A 4KIKB 2AQ1B 2KO3A 5I4DA 2L1AA 1L0YB 4L2YA 4IUMB 2NTTA 3SFDB 1WGRA 2LGXA 2JF5A 4PS7A 2CR5A 3ZNGC 3B0AA 4KSKC 4DHZB 4LNOA 1CJEA 3RNGC 4C7YA 4OVVA 2LRUA 1ACCA 3ZDMC 3C19A 4W9DA 4JWSC 3UI3A 1A70A 1YD8U 4TSSA 2MJ3A 4NJ7A 4MACA 2KDMA 2JRIB 2N9EB 1JRPA 2BF8B 4IW0A 4NQLB 5IP4D 2D5GA 1T3QA 3SDLC 1QOBA 3W1SC 1GB4A 2OJRA 1UNSA 3DPDA 1GPXA 3A1QB 1BXTA 1OQQA 1YN5A 4GDKA 4P7IA 2ACZB 2LUEA 3IAM1 4II2B 5J17A 2DWQA 1QF6A 5H8YE 3HM3A 1TGZB 4XC2A 2ZW0A 3TUOA 1GB1A 3PLVA 2CHXA 3PZDA 1QKZA 2DZMA 1E7VA 2WX0A 2AQ3B 1NYRA 4FHJA 3Q8AA 2K8BA 2KN4A 2LVOA 3LDZE 2FUG1 2KNBA 3Q8EA 3OG5A 3NJTA 2FE8A 4G50A 3BYTB 2N1WA 1OFFA 2ZEQA 1P98A 3V6CB 1AN8A 1JW9D 4CQNA 2EMTA 1ZUD2 4GDKB 1AW7A 3MJ5A 4C56C 4OZAA 3RNAC 3DBHI 4AP4C 1I4GA 2KJRA 4WJNA 3HM6X 4RF0A 2CS4A 3WAPA 4BBNF 2MBBB 5JHAA 4WWPA 3VTWA 5CTRC 1F9JA 4WJQA 1Q10A 4K3CA 1IPGA 1YN4A 2LZ6A 1MFWA 3Q14C 1FNUA 2LVQA 4HPPA 3AE6B 3VTVA 3EHVA 1UH6A 2LD9A 3TEWA 3PGEA 3ONSA 2MBEA 2IO0B 4MSMB 1CMXB 1N5XA 2CJOA 1EF5A 1N63A 2EKIA 4FBJB 4KDIC 3TCAA 5EDSA 4M02A 5E6OA 1QT9A 3AEBB 4OVZA 1RYJA 2A4ZA 2JUOA 1YIWA 3NS1A 3Q3FA 1XT9B 3M3JA 2G45B 4GU2A 4YTNB 4JLCA 1N60A 2KC1A 4RNAA 3NZ3A 3TSSA 4B95A 4FADA 2MA9B 2OEDA 2DYBA 1XO3A 4LDTB 3Q8BA 3VFKA 2KXJA 3AMZA 2C5LC 2IY1B 2KFKA 4M0WB 2XK5A 4LDTD 3A9KA 2O2VA 4HKQA 2V0GA 3QIJA 4CO7A 2EKEC 4LNKA 1B1ZA 2MX2A 5GXGB 4M01A 1I4XA 2WXJA 2H88B 2GB1A 3KH0A 4EKUA 5D2MB 2QDFA 1TYGB 4WWMA 2BKFA 1D6EC 2L83A 1M94A 4DDGD 1IP9A 4M00A 1IBXA 1K50A 1YX5B 3EA6A 1RFKA 4C80A 1E7UA 3KQ4A 1DYQA 1VJKA 4EZLA 3WAOA 2BVCA 5JXVA 2I1JA 4MGYE 2PMVA 2WXFA 1GOZA 2G4SA 2JQRB 2KMCA 3VRAB 3AE3B 3A9KB 1RAXA 1VZ8A 1XD3B 3TL5A 5DPWA 1SE3A 1P9DU 3ZJVA 1YJ1A 4WH4A 1Z2MA 5FKAC 4EEWA 2D2QA 4DQOC 3N30A 2V4IB 4NY0A 2LRWA 2D10A 3RNBC 2Y5CA 3DHHC 3LXFA 2KJ6A 5IO9A 3ZTDA 4S17A 3QC8B 3DQVA 5EE1A 1SIFA 1QOAA 1J8CA 1IBXB 1F2RC 3DCGA 1WGDA 3Q6BA 1V1PA 2UYZB 1SGHA 5LXHA 1V2YA 4AQ7A 2LFIA 5BYRA 3MTNB 3W5VB 4HPMB 2JVCA 4HDOA 3EGRA 3SEBA 3W2DA 2Q5WD 1E8ZA 4ZHOA 4JGHB 4ZRPA 3P4QB 1D5XC 4US8A 3ZNZB 3OWEB 4I6PA 5IAAC 2C9WB 1R4NB 2DZKA 4C4VA 3QAQA 4IWOA 1FXIA 1WMHA 4KGRA 2QILA 4FJYA 1N62A 3MFGA 2M0AA 1V80A 3IHPC 1V1OA 4GMVA 4FJZA 1VD2A 2KACA 4RM9A 3X0WA 4G0NB 4XGAB 2INPE 3NVZA 3AE5B 1JWBD 1MI0A 2XBBC 3V05A 1V1PB 2D11A 2ZNVB 2KZRA 3V3XA 1C4PA 2NMQA 5JHBA 1QOFA 2WXLA 2X8XX 2FCQA 3UGBB 1TTNA 4XYCA 4IM0A 2NCNA 4MT5A 3DBRI 2HJ8A 1KLUD 3PO0A 3PPAA 1DOYA 1I35A 5AZHA 1TBEA 2K6QA 1NVID 2WGSA 4OHJA 2GRIA 3NVYA 3ML8A 1FEHA 2K9XA 2JXTA 2LGIA 2DX5B 2L05A 3DBLB 4URKA 4HROA 2KDBA 3UF8A 3DVNV 3CSFA 2GMIC 4LJOB 2BS3B 1WXQA 3PRPB 1LO5D 3V6EB 1Q5WB 1ZP0B 2FNJB 3ZRFA 2J7QB 2DZJA 2PVOD 4MELA 3QARA 3AEGB 2KTFA 1UBQA 3E9SA 3IFWB 4USAA 1NDDA 4IWPA 3RUIB 2CU3A 4ANUA 2NPTA 2LHDA 3BINA 4IC7B 2RDHA 1SE9A 3AE8B 3V60A 2K0PA 3H7PA 1OTRB 4XWTA 2WXIA 1MPEA 1KLGD 3LJ3A 2X38A 2O6VB 3ZUNA 3P4SB 2ASQA 2LWPA 3RZFA 2WQYB 3AXCA 1JWUD 1F2RI 2KVRA 2O6VD 3APCA 3N1XC 2R61A 4I6NB 3L08A 1C3TA 3KUZA 2ZZPB 3VH3B 1TKYA 3T9LA 4XDCA 2HDEA 2J0MA 4W9HA 1L5PA 1V9JA 1TY0A 3B2GA 1L0XB 3N32A 3JSVA 2WU2B 3V62A 1QZEA 3UINB 1SE2A 2J4XA 4BKGA 3MC0B 3VTUA 3AEDB 3KWVA 4FHKA 1C9FA 4BKSA 3AE2B 3ML9A 4ASWC 4BAXA 2JYTA 5IKCM 2L00B 2IO3B 1I4RA 4LNFA 2GBMA 1WSPA 5BYSA 1TS2A 4KIKA 2KLGA 3U8ZA 4IKGA 2LGYA 1TT5B 2IBIB 4MJSA 1FXAA 2PLPA 1ET6A 4W9KA 4RGOS 4X57B 3PV1A 1WFYA 1R7SA 1PYWD 1QLBB 2LI5A 1C4AA 1L7YA 2J52A 1E8WA 3FILA 4PT5A 3I63C 1V6EA 3A4SC 1FFVA 2JZZA 4ZYSA 1V5OA 2KD0A 2M19A 3MC9A 3AH7A 4HJGE 3NOBA 1J7CA 2PE6B 4CHKA 1J7BA 1WM3A 1KH0A 3UIOB 4KX6B 5L95C 4BKSD 2KYWA 1GC7A 2WDQB 1D3ZA 1EM7A 4AJWA 1YN3A 4MJSB 4N58A 2WXKA 5CHWA 2KWVB 2INNE 3OAWA 2W55A 4J6IA 3A1QA 4NZLB 2HD5B 4S0RA 3HK0A 4DDID 2YVCA 4HJKA 3L16A 1PUTA 3Q8CA 1ET9A 1WJNA 4ICVA 4A3OA 1BMLC 4ZYNA 2I38A 3FILB 2J42A 3ZJUA 3ETRA 2WP9B 1WR6E 4DWFA 2IZVB 3RI7C 2K39A 3U7DA 3ZXRA 2KHWB 4JE3B 3KYCD 3FC4A 1WJ6A 4LNIA 3ZVVA 2GBRA 1RRBA 4BVUC 2LGDA 5JH5C 1C76A 3BK2A 1WWTA 5MPOA 1OEYJ 2CHZA 2AWTA 2JPHA 1ZE3D 3PZ8A 2KJHB 4A3PA 2AL6A 4NJ6A 4PYZA 1KFYB 4ZRQA 3Q69A 3MHSD 1DOXA 2REXA 1KF6B 3BY4B 5IA7A 3BVMA 4LK0M 3W9CB 2DYMA 2W3RA 4TQ1A 4HDQA 2KANA 3I3TB 4FN2A 4N9F4 4QAYA 4E71A 5HI1A 4PK1A 3P2BA 2OHFA 4N6EB 3UQBA 3L4PA 3CIRB 2SEBD 4FLHA 2W9NA 2WYQA 2QMTA 3QJZA 3ZQ4A 3R7QA 3PRZA 4TUUA 3BWUD 1JMLA 1YX6B 4MH8A 2N9LA 1YNTE 3DBHB 1FNWA 1FMAD 2GBJA 1A5RA 1SE4A 1KM7A 4RH6A 1YMHE 1WGHA 4WQMA 3AECB 1T0QC 1KTKA 2UWQA 3DHIC 3DVNU 3TMPB 3MJWA 2AX5A 3W1SA 3BZDB 4TKNA 4P1BC 2LVPA 3ZDTA 2L0FA 1F1HA 1TIFA 4W9GA 5BYQA 4B6WA 1SF0A 2W82A 3OJ4B 3PZ7A 1HEZE 1FO4A 2BYEA 2LASA 1WXVA 1K51A 2G9HD 3CMMB 3IT6B 3KW5B 2C60A 2RDBC 3E56A 4MGKE 4C7ZA 4LLGM 4A90A 1AWDA 2K5PA 3OLMD 3GE8C 1E8XA 3AE1B 3KUDB 3NZUA 2JY6A 1G6JA 1SJED 2N9XA 2BWES 2B3AA 5J18A 4M0WA 5BMHA 1I4HA 3P4PB 2BWFA 2QCZA 2QIEB 1UZXB 1F77A 4FULA 2J53A 2VH1A 2N7EA 5KHOA 2PVGC 4B9KA 1BT0A 4MDKE 2MRPA 1ZPSA 1U4AA 5C2TB 2GOWA 4K7SA 3PHWB 3VRBB 4BZAA 3RNEC 1WM2A 1UELA 3T3NA 2ZVNA 4YSXB 2H89B 2FCMA 1YQ4B 2KQ7A 4PYUA 4TV3A 2XNAC 1PQSA 2WHIA 1WE6A 1J0GA 3H6NA 4K1RB 1E90A 4ZRJA 1FRRA 4WJOA 2INDC 2AL3A 2XN9C 4M8NA 3U4EG 4YXDB 1SJHD 3R2TA 2VH2A 4OVUA 2AEHA 3ZLZA 1NEKB 1P3QU 4JX1C 1L4DB 5T8IA 3A9JA 4KKIA 3Q3OC 1PFDA 4PS8A 3ZIMA 2RMMA 3AEFB 2QEJC 2DHZA 1MHXA 4HCPB 5C3JB 2LUMA 1EF1A 2IO2B 1SB3C 1WX9A 1NI2A 4YSYB 1MG4A 4EOYA 4DHJB 4BOZB 3Q3NC 2PJHA 2NBUA 4F8CB 2L3ZA 3PLUA 2HJ1A 3BYYB 4EE2A 2D07B 2VZKD 4DHJD 2MQJA 2R2QA 3TJPA 4UDUC 2RD0A 2DLBA 3L10B 1UF0A 2FIFA 2EELA 3RFZB 2BPSA 4RF1A 2GBNA 1T0SC 4LCDE 3UIPB 2XEWA 3A9JB 3GE3C 1N6ZA 1IGCA 4NPNA 1HA5A 4OW0A 3BVZA 2BGFA 4G11A 4KDLB 2NS5A 4WWNA 3H8HA 1UGJA 2BT6A 1L2NA 1NI3A 2KTRA 1YJIA 2D3AA 4E3CA 3PTFC 1GNUA 1E8YA 1WYGA 4DHZE 3APFA 3BIID 2K22A 4RFBA 1H8CA 5J2RA 3L54A 2IPKD 3AN1A 3J9CA 2BYFA 3M63B 1FCLA 3ZYYX 3JYUA 3B08A 1KOTA 3I57A 4AWJA 2MJEA 2PPHA 3AU5A 5G5HA 3PHXB 2IGGA 2K25A 3N1YC 2KKCA 5HHDG 2N7DA 2KVZA 2Z0EB 3DBRB 4IWQA 5D6JB 4KZ0A 2J0JA 2MEKA 4WWOA 3N1ZC 1QILA 2KTRB 1NENB 1YQBA 1TJEA 3H9DA 2WX1A 4HLEA 4MSQB 3NZSA 1WIAA 2N9PC 3IXSA 1WY8A 4GN1A 2I2YA 2N0SB 5G2NA 1IGDA 5E6PA 2V4LA 2WXNA 3KVFB 1F52A 4GLSC 1JROA 2DAJA 2JWZA 4KVGB 2KMAA 4EZJA 1E6EB 1EWYC 3P63A 1P7FA 2O6VA 1Y56A 4XWWA 3AB5A 4W9FA 5DCNA 4DK5A 4OZCA 1WZ0A 1D4BA 3AV8A 2N7JA 3I9V1 3IVFA 1XQQA 2LXAA 1GG3A 3PREA 1T0YA 3MP9A 2Z59B 3ZNHB 3TEYA 2FUHB 3APDA 2RSUA 3OJ3A 4XDDA 1MG8A 3DOWA 2UU7A 3VDZA 2BYTA 1XLQA 1S3SG 1WJUA 4W9EA 3RCZA 3CSTA 3R7RA 4JPSA 3WANA 2KC2A 1E9MA 3U30A 4ANVA 2CHWA 4DXAB 4ARIA 3NUHB 2IYDB 3BVGA 2BQQA 1NYQA 2MJDA 1WXMA 4EUTA 1ROEA 4BFRA 4NAWB 3VUXA 2G1EA 2JRHA 2Y5PA 3RMKC 3HVZA 1TKGA 2L7RA 3AULA 3VXWA 2BB6A 2KK8A 2BTEA 1FXTB 2OJWA 2K6DB 4TQ0A 3M62B 2KX3A 1IUEA 1WF9A 4LNNA 1WX8A 2C7MB 3EFCA 4HRSA 2KWUB 1WXAA 3ZTCA 1Q1OA 3QQ8B 4KZCA 4WAFA 3W1YA 1ZDVA 5IN7A 3VAWA 5C23A 2EMSA 4EZKA 3B2FA 2IGDA 1WGKA 1RM6C 1L4ZB 1NBFC 3NY5A 2ZCBA 2Z8LA 4F7ZA 1C79A 1UD7A 3DDCB 1XCTL 3NHEB 1IYFA 3RPFC 4WJPA 3RZWC 1T5XD 1OQRA 3DVGY 3D32A 2WDTB 2FIDA 1AARA 3ZJTA 1WYWB 1JRUA 1YOVB 1OEYA 2G3QB 2ZW1A 4JL9A 5KHQA 5D3DA 4KSLC 4HWIB 3H7SA 4MEMA 2K8CA 1VR9A 2IO1B 3SFEB 3ZRCA 2FCNA 5AUKA 4WAAA 1OGWA 3CWIA 3IG3A 2MP2A 2JWUA 3X23A 5D94A 4REZA 2MBQA 3DHGC 5LLIA 1YJJA 4ANXA 2MBOA 4AUQC 3TEZA 2JSVX 2KDFB 1C4CA 4AJYB 3AI5A 2KLCA 1P1AA 5IOIA 1E5WA 1HTOA 3R8BA 4CYEA 2IY0B 3VUYA 2WXRA 3K9PB 1SSNA 1ZXIA 3V61A 2BBCA 3AEAB 4ZOHC 3RNFC 2DYOA 2DZIA 5BMGA 2MP2B 5AEKB 3SR6A 3URYA 1JWSD 1FCCC 1T6BX 3RN9C 4W9CA 2KMMA 2KOXA 3K9OB 3WCQA 2M4NA 4DXGA 3C8YA 2WXMA 3AE7B 4XE0A 3ZO5B 3EFUA 1V8CA 1E7PB 4DBGA 4RGNA 3QHTA 2JT4B 2KDIA 1FFUA 5G55A 3Q3MC 4O1NA 5FR3A 2WU5B 1JQ4A 5C1ZA 1K52A 2WWZA 1HZ5A 3DWGC 4YT0B 1FRDA 3DWMA 3RULA 3JVZX 1FPYA 2K1FA 2DNFA 2NR2A 2PKOA 3C0RB 2C7NB 2LJ5A 3IAS1 1EU4A 1TZOA 2L32A 3Q3JA 2I1KA 3A33B 2CJNA 1VZ7A 2V3PA 3KUCB 4RM8A 2V3NA 3VVWB 3KYDD 4ZHPA 4JQWC 4GOCA 4W9JA 2M56B 2PTLA 2V3SA 3DBSA 1GJZA 2BYVE 4II3B 1ZW7A 1WRIA 1XXGA 1PDXA 3AE9B 1WX7A 2MLBA 1FNVA 1C78A 1CK1A 1KJTA 4KKJA 2BS2B 2VRRB 2MBHA 1D5ZC 3HHMA 3KWLA 5LNK1 1XLPA 3ZW3A 4XZ4A 2WNMA 2AYOB 1UGMA 1WE7A 1V81A 2KWDA 3NS8A 4HK2A 3BK1A 2KFJA 1JCKB 4A20A 3NVWA 4BKTA 3L0WB 3PVLA 5FK9C 1PGBA 4E74A 3HUIA 2LXCA 2INCC 1QOGA 3N20C 3ZGZA 4FA6A 4HEA1 2QHOA 3QX1A 3SHQA 2MH7A 3O13A 5EE3A 2Y5BB 3LYYA 4WIPA 2M17A 3VHTC 2NBWB 2JXXA 3R3MA 1ZGUB
chains in the Genus database with same CATH topology
1KLGD 1NI3A 1D5MC 2QJLA 2X38A 1YJIA 1FIQA 3P4SB 1BUIC 5AUIA 2WQYB 1CJEA 4C7YA 1SXTA 1E10A 1JWUD 1F2RI 1WYGA 2RDGA 1FM0D 3BIID 2K22A 1ACCA 4RFBA 1HXYD 2R61A 2IPKD 2L52A 3AN1A 4JWSC 3J9CA 3UI3A 2PW9A 1A70A 1XF5L 1TKYA 1FCLA 2E6XA 4TSSA 4XDCA 2HDEA 3ZYYX 2MJ3A 4JWUC 3I57A 4MACA 1L5PA 2KDMA 2MJEA 1JWAD 4YWGG 1TY0A 3B2GA 5G5HA 1L0XB 2SAKA 1JRPA 4RGMA 3GS2A 2D5GA 2BB5A 2JYEA 2WU2B 1T3QA 2IGGA 1F0ZA 1QOBA 1SE2A 1GB4A 1PGAA 2J4XA 5HHDG 3MC0B 1C9FA 1UNSA 3AEDB 3KWVA 1GPXA 3AE2B 1BXTA 1OQQA 1YN5A 2ACZB 3IAM1 2JYTA 4IOIE 5D3IB 2MEKA 1I4RA 2DWQA 2ONQA 5H8YE 1QF6A 5HG2A 1QILA 2RPVA 1NENB 4KGTA 1TJEA 1WSPA 4YTMB 2ZW0A 5BYSA 4AS1A 3TUOA 1TS2A 1I7HA 1GAQB 2BS4B 1GB1A 4IKGA 3IXSA 4L23A 2WDVB 1QKZA 3U52E 2I2YA 1FXAA 2N0SB 2PLPA 1ET6A 4Q2JA 1IGDA 2AQ3B 1NYRA 2WXNA 1EU3A 4GLSC 1ESFA 4RGOS 1JROA 1R7SA 3U2SC 1PYWD 2JX5A 2W54A 3Q8AA 2ON8A 2KN4A 1QLBB 1C4AA 2FUG1 2J52A 3FILA 1E6EB 1EWYC 3P63A 2GI9A 4N59A 2LHEA 1P7FA 3Q8EA 4PT5A 3TEXA 1FFVA 1Y56A 2FE8A 3AEEB 4XWWA 4ZYSA 3AB5A 1DGJA 2WXPA 3BYTB 1OFFA 2VZKB 2WS3B 4OZCA 2M19A 1D4BA 1AN8A 1EWCA 1JW9D 2HTME 2YEPB 3AH7A 3AV8A 3VQIA 1XEEA 4CQNA 4MM3B 2N7JA 4HJGE 1J7CA 3I9V1 1HZ6A 1ZXHA 3VR8B 1ZUD2 4GDKB 1AW7A 1J7BA 3MJ5A 4C56C 4IDIA 3MP9A 1KH0A 4OZAA 3TEYA 1UWXA 1I4GA 4XDDA 3GB1A 4KX6B 2BYTA 4RF0A 1XLQA 2WDQB 1AYFA 4B0EA 1UWMA 4JPSA 1XCQL 1EM7A 1YN3A 1E9MA 4N58A 1Q10A 3Q8FA 2NTSA 3NVVA 2WXKA 1STEA 2INNE 4NZLB 2W55A 4ARIA 1KRHA 3NUHB 1YN4A 3BVGA 1MPEA 2W3SA 1FNUA 1L6VA 1NYQA 1PUTA 3Q8CA 4R3DA 1ET9A 2MJDA 1BMLC 1ROEA 1SBBB 4NAWB 3AE6B 2G1EA 2I38A 3FILB 2J42A 3ZJUA 3ETRA 2Y5PA 3TEWA 2WP9B 3FAHA 3HVZA 1TKGA 4P16A 1VZ6A 1HQRD 1N5XA 2BB6A 2CJOA 2BTEA 3HRDD 2BW2A 2EKIA 1N63A 1CQVA 4JE3B 1I4QA 3FC4A 4TQ0A 4KGSA 1IUEA 2WXQA 1C76A 3BK2A 4HRSA 1WWTA 1QT9A 5MPOA 3AEBB 4WAFA 4OVZA 1RYJA 1ZDVA 3KLSX 1ZE3D 3PZ8A 3NS1A 2FBWB 3B2FA 2JZPA 2IGDA 1WGKA 4YTNB 1KFYB 1RM6C 1L4ZB 4ZRQA 3Q69A 1DOXA 1N5WA 1KF6B 1N60A 1VLBA 5D7GA 4RNAA 2Z8LA 1E0ZA 1C79A 3BVMA 3NZ3A 4LK0M 3TSSA 2WXHA 1ZOYB 2KAJA 2OEDA 3W9CB 1XCTL 2LJIA 2KQ4X 2DYMA 2W3RA 4TQ1A 3RPFC 1XO3A 1SEBD 5HI1A 3Q8BA 1T5XD 5HFYA 2OHFA 4N6EB 3L4PA 1OQRA 3CIRB 3AMZA 2SEBD 2E3TA 5EE0A 2QMTA 3ZQ4A 3ZJTA 3BWUD 1JMLA 2V0GA 4HKQA 4MH8A 2ZW1A 2N9LA 1YNTE 4A6QA 1FNWA 5D3DA 1CZPA 1FMAD 1B1ZA 1RWSA 3AE4B 1SE4A 1VR9A 4RCOA 4HKZE 1TS4A 2ICIA 3AM9A 5GXGB 3SFEB 2IDYA 5AUKA 4RH6A 1I4XA 1YMHE 2WXJA 1TY2A 1C77A 2H88B 2GB1A 4WQMA 3AECB 1KTKA 3CWIA 1TYGB 4WWMA 1D6EC 2L83A 3LB8C 1V97A 2AX5A 2JWUA 3W1SA 1B9RA 3BZDB 1IBXA 1K50A 3P1MA 3U7ZA 3EA6A 1RFKA 4REZA 4C80A 3KQ4A 1DYQA 1VJKA 5JXVA 4P6VF 2QSDA 5BYQA 2PMVA 2WXFA 1GOZA 1SF0A 2W82A 3PZ7A 3R2IA 4A8XC 1HEZE 1M4VA 2JQRB 1FO4A 3VRAB 1K51A 4ARCA 2G9HD 3AE3B 1UUPA 1YJJA 4YSZB 3IT6B 3E56A 1VZ8A 4C7ZA 2LMCA 4LLGM 2WLBA 3TEZA 2JSVX 4A90A 1SE3A 1AWDA 4RGTA 3ZJVA 2PIAA 1C4CA 2K5PA 4WH4A 4L1BA 4OZBA 5FKAC 1ENFA 1QQRA 3AE1B 4DQOC 2V4IB 3R8BA 2Y3AA 1SIJA 1VDVA 1SJED 2WXRA 1SSNA 1ZXIA 3B9JA 4M0WA 2BBCA 5BMIA 3AEAB 1DOIA 4ZOHC 4YTPB 1I4HA 5BMHA 2DYOA 2LEKA 2Y5CA 3LXFA 3P4PB 5BMGA 3VR9B 4WURA 3SR6A 3URYA 1JWSD 2QIEB 1FCCC 1T6BX 5EE1A 1QOAA 1F77A 1IBXB 1F2RC 2J53A 2KMMA 4A55A 1V1PA 3WCQA 2PVGC 4J3OD 4DXGA 3C8YA 2WXMA 3AE7B 4XE0A 1TS3A 4AQ7A 1V8CA 2LFIA 5BYRA 1E7PB 3W5VB 4RGNA 1ZPSA 2B76B 3EGRA 3SEBA 3W2DA 2Q5WD 1FFUA 2IJ0A 4ZHOA 5C2TB 5H92C 2WXGA 4O1NA 5FR3A 2WU5B 2AQ2B 1JALA 3N9YC 3NRZA 3P4QB 1K53A 4ZRPA 1D5XC 1JQ4A 4DXFA 3VRBB 4US8A 1TKEA 3T3NA 1MVKA 3OWEB 4NJCA 1K52A 4YSXB 4FXCA 2H89B 1HZ5A 1N61A 1YQ4B 3DWGC 4YT0B 5TSSA 1FXIA 1VRAB 1FRDA 2WXOA 3IT4B 5E6JA 4KGRA 5G5GA 3DWMA 2QILA 4GDLB 1N62A 2XNAC 3MFGA 4B0MA 2M0AA 1V1OA 2PKOA 2KACA 3P4RB 4US9A 3IAS1 1XLOA 1EU4A 2INPE 3W5UB 3NVZA 4H2AA 1FRRA 2YEPF 1TZOA 3U4EG 2XN9C 2L32A 4YXDB 3AE5B 1JWBD 1MI0A 1SJHD 2CJNA 3HVDA 1VZ7A 3R2TA 4LTUA 5EE9A 2V3PA 3V05A 1V1PB 4TMAB 3V3XA 1L6UA 2DBYA 2V3NA 4ZHPA 1C4PA 1L0VB 1ZDXA 2NMQA 1NEKB 3T3OA 2M56B 1QOFA 2WXLA 4JX1C 2PTLA 1L4DB 5T8IA 1MHHE 4KKIA 1PFDA 1XLNA 1WRIA 4ITKA 2JU6X 2RMMA 1XXGA 1PDXA 2QEJC 3AEFB 3MHZA 3AE9B 4MT5A 4D2KA 1MHXA 3EUB2 1KLUD 3PO0A 1DOYA 3GP7A 5C3JB 2LUMA 1FNVA 1C78A 1CK1A 2N9KA 1SB3C 4NAMA 4KKJA 4YSYB 1NVID 2BS2B 4OHJA 2GRIA 2K3UA 3NVYA 1D5ZC 1FEHA 1JWMD 2K9XA 2JXTA 3KWLA 2LGIA 5LNK1 1P7EA 1XLPA 4HROA 1J7AA 2WNMA 2IGHA 3BYYB 4A9AA 4EE2A 2BS3B 1WXQA 2VZKD 1YQ3B 1LO5D 2KWDA 4UDUC 1ZP0B 2DLBA 1PGXA 1TS5A 2PVOD 3BK1A 1FD6A 2WDRB 3AEGB 1JCKB 3ABVB 3NVWA 2TSSA 3E9SA 1I4PA 2EELA 3RFZB 4USAA 3P42A 5FK9C 2AQ1B 4RF1A 1PGBA 5I4DA 3HUIA 2CU3A 3ZGZA 1QOGA 2L1AA 1L0YB 2LHDA 4HEA1 1IGCA 4L2YA 2NTTA 2RDHA 2MH7A 1HA5A 3O13A 3AE8B 5EE3A 3SFDB 4OW0A 3BVZA 3LYYA 4WIPA 2K0PA 4XWTA 2WXIA 3H8HA 1UGJA 2BT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  1FRD A;  2QJL A;  4KX6 B;  5G5G A;  3AM9 A;  3DWM A;  1YJI A;  5GXG B;  1N62 A;  1FIQ A;  1XLQ A;  2WDQ B;  3P4S B;  3SFE B;  5AUI A;  2WQY B;  1CJE A;  4C7Y A;  1AYF A;  5AUK A;  2H88 B;  1E10 A;  1WYG A;  4WQM A;  1UWM A;  1FM0 D;  3AEC B;  3CWI A;  1E9M A;  3BII D;  2K22 A;  2PKO A;  4N58 A;  1TYG B;  3P4R B;  4WWM A;  4US9 A;  3LB8 C;  2L83 A;  3NVV A;  1V97 A;  2AX5 A;  2L52 A;  1XLO A;  2W55 A;  3AN1 A;  4JWS C;  3W5U B;  1B9R A;  1KRH A;  3NVZ A;  1FRR A;  1A70 A;  1TKY A;  2W3S A;  3AE5 B;  1JWB D;  1L6V A;  1NYQ A;  1PUT A;  2CJN A;  3P1M A;  4LTU A;  5EE9 A;  3ZYY X;  1RFK A;  2MJD A;  4C80 A;  2MJ3 A;  4JWU C;  1ROE A;  1L5P A;  2MJE A;  1VJK A;  1JWA D;  2G1E A;  3AE6 B;  3B2G A;  1L6U A;  3ETR A;  2DBY A;  4P6V F;  5G5H A;  2WP9 B;  3FAH A;  3HVZ A;  1L0V B;  1JRP A;  1TKG A;  1SF0 A;  4ZHP A;  1NEK B;  2JQR B;  2M56 B;  1FO4 A;  2WU2 B;  1QOF A;  1F0Z A;  1T3Q A;  4JX1 C;  3VRA B;  3AE3 B;  1N5X A;  1QOB A;  2CJO A;  3HRD D;  1YJJ A;  4YSZ B;  2EKI A;  1N63 A;  1PFD A;  3FC4 A;  3AED B;  1XLN A;  1WRI A;  4YXD B;  4ITK A;  4C7Z A;  1GPX A;  3AE2 B;  1OQQ A;  1IUE A;  1PDX A;  2WLB A;  3AEF B;  2ACZ B;  3AE9 B;  1DOX A;  1AWD A;  4HRS A;  1WWT A;  1QT9 A;  3EUB 2;  5MPO A;  2PIA A;  2K5P A;  3AEB B;  3PO0 A;  1DOY A;  2DWQ A;  1QF6 A;  5H8Y E;  1RYJ A;  5C3J B;  1NEN B;  1SB3 C;  1TJE A;  3AE1 B;  4YSY B;  4YTM B;  1NVI D;  2BS2 B;  3NS1 A;  1I7H A;  1GAQ B;  1SIJ A;  1VDV A;  2BS4 B;  2FBW B;  3NVY A;  3B2F A;  1ZXI A;  3B9J A;  1WGK A;  2K9X A;  4YTN B;  3KWL A;  1KFY B;  1DOI A;  1RM6 C;  2WDV B;  1XLP A;  3AEA B;  4ZOH C;  4YTP B;  1FXA A;  2N0S B;  1N5W A;  2LEK A;  2Y5C A;  1KF6 B;  3LXF A;  1N60 A;  1VLB A;  3P4P B;  4HRO A;  3VR9 B;  1J7A A;  3SR6 A;  4A9A A;  2QIE B;  1E0Z A;  1NYR A;  1WXQ A;  1ZOY B;  2BS3 B;  2KAJ A;  3W9C B;  5EE1 A;  1QOA A;  1JRO A;  1YQ3 B;  1R7S A;  2JX5 A;  2W3R A;  2W54 A;  2KMM A;  1ZP0 B;  2PVO D;  1QLB B;  3RPF C;  3WCQ A;  1XO3 A;  2PVG C;  2WDR B;  3AEG B;  3ABV B;  1E6E B;  1EWY C;  3NVW A;  3P63 A;  3AE7 B;  4N59 A;  4USA A;  1FFV A;  1V8C A;  1E7P B;  3AEE B;  2OHF A;  4N6E B;  3W5V B;  3L4P A;  3AB5 A;  1DGJ A;  1OQR A;  2B76 B;  3HUI A;  3CIR B;  2CU3 A;  2Q5W D;  1FFU A;  1QOG A;  3AMZ A;  4ZHO A;  5C2T B;  2E3T A;  5EE0 A;  1OFF A;  5H92 C;  2WS3 B;  2M19 A;  2WU5 B;  1JAL A;  3NRZ A;  3P4Q B;  1JQ4 A;  2HTM E;  3DWG C;  1JW9 D;  3AH7 A;  2MH7 A;  3AV8 A;  3VRB B;  3AE8 B;  5EE3 A;  1J7C A;  3SFD B;  1TKE A;  3VR8 B;  4US8 A;  1CZP A;  1FMA D;  1ZUD 2;  1J7B A;  4YSX B;  4IDI A;  1RWS A;  2H89 B;  3AE4 B;  4FXC A;  1N61 A;  1YQ4 B;  4YT0 B;  2BT6 A;  1FXI A; 
#chains in the Genus database with same CATH topology
 3MC8 A;  1D5M C;  2QJL A;  4IG7 B;  3CF6 E;  5CHF A;  2DAF A;  1FIQ A;  1BUI C;  4I6L B;  5AUI A;  5LXI B;  5L83 A;  1SXT A;  1E10 A;  2QC8 A;  2RDG A;  3VH4 B;  1FM0 D;  2ZPY A;  2FCS A;  1HXY D;  1WR1 A;  2JZ3 B;  2M0X A;  1V86 A;  1I42 A;  1EUV B;  1MJD A;  4ZRI A;  2L52 A;  4YL8 A;  2PW9 A;  4NQK E;  1XF5 L;  2E6X A;  1EO6 A;  4W9I A;  4ZDV A;  4JWU C;  4YWG G;  3M95 A;  1JWA D;  4PS3 A;  2SAK A;  4RGM A;  3GS2 A;  2BB5 A;  2JYE A;  1F0Z A;  4GXB A;  1PGA A;  2D3G A;  3ECI A;  4MM3 A;  1RFA A;  4EFO A;  3JW0 X;  4KV2 A;  4IM2 A;  1WZ3 A;  4IOI E;  1GUA B;  5D3I B;  2ONQ A;  5HG2 A;  2RPV A;  3NG0 A;  4KGT A;  4YTM B;  4AS1 A;  1I7H A;  1GAQ B;  4M8M A;  2BS4 B;  3S2A A;  3RD2 A;  4L23 A;  2WDV B;  3U52 E;  4Q2J A;  3EEC A;  1EU3 A;  1ESF A;  3U2S C;  2JX5 A;  2W54 A;  2ON8 A;  2K8H A;  4ACF A;  4N59 A;  2GI9 A;  2LHE A;  3PRM B;  3TEX A;  1WXS A;  3AEE B;  1DGJ A;  2WXP A;  2VZK B;  4GSW A;  2WS3 B;  2HE7 A;  1EWC A;  2HTM E;  2YEP B;  3QA8 A;  3VQI A;  1XEE A;  4MM3 B;  3VR8 B;  1GC6 A;  1HZ6 A;  1ZXH A;  2ZNV C;  5HKH A;  4IDI A;  5GMV A;  1UWX A;  3GB1 A;  5FR6 A;  4GB9 A;  1AYF A;  2V9H A;  2KFK B;  4B0E A;  2XK5 B;  1UWM A;  1XCQ L;  3PS6 A;  1LM8 B;  2O2V B;  3Q8F A;  2NTS A;  3NVV A;  1STE A;  1C1Y B;  3HIZ A;  1KRH A;  3H1U A;  3RNC C;  4R3D A;  2W3S A;  1L6V A;  1J19 A;  2J0K A;  1SBB B;  2PEA A;  3RYT A;  3FAH A;  4P16 A;  2M1M A;  1VZ6 A;  4HVB A;  1HQR D;  4JIO U;  3IBE A;  3HRD D;  2BW2 A;  2R2O A;  1CQV A;  1I4Q A;  1R4M B;  4KGS A;  2WXQ A;  4NNJ B;  2RR9 A;  5E6N A;  1WJ4 A;  2MCN B;  3KLS X;  3ZXV A;  2KDE B;  2FBW B;  1K8R B;  2JZP A;  1VCB A;  5AZF A;  3A4R A;  4IM3 A;  4MGZ E;  1N5W A;  1VLB A;  2BKR B;  4K7W A;  5D7G A;  1E0Z A;  5DPT A;  2WXH A;  1ZOY B;  1WI0 A;  2KAJ A;  2LJI A;  4BBN C;  2KQ4 X;  1R4M I;  5CX3 A;  2ZJD A;  1SEB D;  2KWC A;  2CKH B;  1X1M A;  5HFY A;  1Y8R C;  4W9L A;  1WH3 A;  2E3T A;  5EE0 A;  2D3C A;  1P0R A;  4A6Q A;  1HE8 A;  1CZP A;  4F1S A;  2ZPN A;  1RWS A;  3AE4 B;  5AZG A;  1LFD A;  3ENE A;  4HPL B;  2M8S A;  4RCO A;  1R4N I;  4HKZ E;  5CHV C;  4NAW A;  1TS4 A;  2ICI A;  3AM9 A;  2IDY A;  5DPS A;  2Z0D B;  1TY2 A;  1C77 A;  2PE9 A;  3EC8 A;  1Q0W B;  3LB8 C;  1V97 A;  4FJV B;  1B9R A;  4C4V B;  4HCN B;  5DPR A;  3P1M A;  3QK0 A;  3U7Z A;  5JZE B;  4LJP B;  2RPQ A;  2KX0 A;  1WMH B;  1V5T A;  2YLM A;  4P6V F;  2QSD A;  2MHJ A;  3R2I A;  1LQB A;  4A8X C;  1M4V A;  2V1Y A;  4ARC A;  2LGS A;  2ZVO A;  1UUP A;  2KT7 A;  2L8J A;  4MH0 E;  4YSZ B;  3ALB A;  4GIV A;  4ANW A;  2NBV B;  2MSE D;  2LMC A;  2WLB A;  4ZRK A;  4K7U A;  2KN5 A;  2OOB B;  3FKY A;  4RGT A;  2A5U A;  3PSE B;  2PIA A;  2GLS A;  3VUW A;  4L1B A;  4OZB A;  4K3B A;  1ENF A;  1QQR A;  5BO4 B;  4GDL A;  2D3B A;  2Y3A A;  2N1V A;  3TIX A;  1SIJ A;  1VDV A;  2G4D B;  3B9J A;  2ZCC A;  1RLF A;  5BMI A;  1DOI A;  2MWS B;  4MGI E;  4YTP B;  2LEK A;  3VR9 B;  1ISN A;  4WUR A;  1HTQ A;  2RGF A;  3DBL I;  3GOE A;  4A55 A;  1WRD B;  3O65 B;  4J3O D;  3N3K B;  1TS3 A;  1Z5S B;  2HTH A;  1S1Q B;  2B76 B;  2IJ0 A;  3B1L X;  5H92 C;  2WXG A;  2N4F A;  2KQS A;  2AQ2 B;  1JAL A;  3N9Y C;  3L13 A;  3NRZ A;  1K53 A;  4P1C C;  4DXF A;  4AOF A;  5TR5 A;  1TKE A;  3SU8 X;  1MVK A;  4NJC A;  1WGG A;  1OQY A;  3ZKJ C;  3WAM A;  1ZKH A;  4FXC A;  2L76 A;  1N61 A;  4BOS C;  5TSS A;  1VRA B;  2WXO A;  3IT4 B;  5E6J A;  2FAZ A;  5G5G A;  4GDL B;  2GBK A;  3DVG X;  4B0M A;  2NVU I;  3L17 A;  2NPT B;  3P4R B;  4US9 A;  1T0R C;  1KLV A;  1UBI A;  1XLO A;  4G3X B;  3W5U B;  4WQO B;  4H2A A;  2YEP F;  1LXD A;  3H7P B;  3HVD A;  3GZN B;  4LTU A;  5EE9 A;  3ZNI D;  1H4R A;  3PT2 B;  4TMA B;  4K81 A;  1L6U A;  3QWZ B;  2DBY A;  3Q2A C;  1L0V B;  1ZDX A;  4HXD A;  3T3O A;  1MHH E;  3I5J C;  1XLN A;  4ITK A;  2JU6 X;  2MW5 A;  3MHZ A;  4C00 A;  4D2K A;  4GGQ A;  1V49 A;  3EUB 2;  3UQA A;  4ICU A;  3GP7 A;  3T8M A;  2L0T A;  4XX5 A;  2N9K A;  1LGR A;  4NAM A;  3GZN I;  2DEN B;  3JSV B;  1TZ1 A;  2K3U A;  3SD5 A;  1JWM D;  3R66 C;  1P7E A;  3QCA A;  1J7A A;  2IGH A;  4A9A A;  3RT3 B;  3WIM A;  1YQ3 B;  2CU1 A;  3WA0 A;  2C7H A;  1PGX A;  1TS5 A;  1FD6 A;  2WDR B;  1WGY A;  3ABV B;  4RMA A;  2TSS A;  3TBL D;  1I4P A;  3P42 A;  3WAL A;  3AU4 A;  4KIK B;  2AQ1 B;  2KO3 A;  5I4D A;  2L1A A;  1L0Y B;  4L2Y A;  4IUM B;  2NTT A;  3SFD B;  1WGR A;  2LGX A;  2JF5 A;  4PS7 A;  2CR5 A;  3ZNG C;  3B0A A;  4KSK C;  4DHZ B;  4LNO A;  1CJE A;  3RNG C;  4C7Y A;  4OVV A;  2LRU A;  1ACC A;  3ZDM C;  3C19 A;  4W9D A;  4JWS C;  3UI3 A;  1A70 A;  1YD8 U;  4TSS A;  2MJ3 A;  4NJ7 A;  4MAC A;  2KDM A;  2JRI B;  2N9E B;  1JRP A;  2BF8 B;  4IW0 A;  4NQL B;  5IP4 D;  2D5G A;  1T3Q A;  3SDL C;  1QOB A;  3W1S C;  1GB4 A;  2OJR A;  1UNS A;  3DPD A;  1GPX A;  3A1Q B;  1BXT A;  1OQQ A;  1YN5 A;  4GDK A;  4P7I A;  2ACZ B;  2LUE A;  3IAM 1;  4II2 B;  5J17 A;  2DWQ A;  1QF6 A;  5H8Y E;  3HM3 A;  1TGZ B;  4XC2 A;  2ZW0 A;  3TUO A;  1GB1 A;  3PLV A;  2CHX A;  3PZD A;  1QKZ A;  2DZM A;  1E7V A;  2WX0 A;  2AQ3 B;  1NYR A;  4FHJ A;  3Q8A A;  2K8B A;  2KN4 A;  2LVO A;  3LDZ E;  2FUG 1;  2KNB A;  3Q8E A;  3OG5 A;  3NJT A;  2FE8 A;  4G50 A;  3BYT B;  2N1W A;  1OFF A;  2ZEQ A;  1P98 A;  3V6C B;  1AN8 A;  1JW9 D;  4CQN A;  2EMT A;  1ZUD 2;  4GDK B;  1AW7 A;  3MJ5 A;  4C56 C;  4OZA A;  3RNA C;  3DBH I;  4AP4 C;  1I4G A;  2KJR A;  4WJN A;  3HM6 X;  4RF0 A;  2CS4 A;  3WAP A;  4BBN F;  2MBB B;  5JHA A;  4WWP A;  3VTW A;  5CTR C;  1F9J A;  4WJQ A;  1Q10 A;  4K3C A;  1IPG A;  1YN4 A;  2LZ6 A;  1MFW A;  3Q14 C;  1FNU A;  2LVQ A;  4HPP A;  3AE6 B;  3VTV A;  3EHV A;  1UH6 A;  2LD9 A;  3TEW A;  3PGE A;  3ONS A;  2MBE A;  2IO0 B;  4MSM B;  1CMX B;  1N5X A;  2CJO A;  1EF5 A;  1N63 A;  2EKI A;  4FBJ B;  4KDI C;  3TCA A;  5EDS A;  4M02 A;  5E6O A;  1QT9 A;  3AEB B;  4OVZ A;  1RYJ A;  2A4Z A;  2JUO A;  1YIW A;  3NS1 A;  3Q3F A;  1XT9 B;  3M3J A;  2G45 B;  4GU2 A;  4YTN B;  4JLC A;  1N60 A;  2KC1 A;  4RNA A;  3NZ3 A;  3TSS A;  4B95 A;  4FAD A;  2MA9 B;  2OED A;  2DYB A;  1XO3 A;  4LDT B;  3Q8B A;  3VFK A;  2KXJ A;  3AMZ A;  2C5L C;  2IY1 B;  2KFK A;  4M0W B;  2XK5 A;  4LDT D;  3A9K A;  2O2V A;  4HKQ A;  2V0G A;  3QIJ A;  4CO7 A;  2EKE C;  4LNK A;  1B1Z A;  2MX2 A;  5GXG B;  4M01 A;  1I4X A;  2WXJ A;  2H88 B;  2GB1 A;  3KH0 A;  4EKU A;  5D2M B;  2QDF A;  1TYG B;  4WWM A;  2BKF A;  1D6E C;  2L83 A;  1M94 A;  4DDG D;  1IP9 A;  4M00 A;  1IBX A;  1K50 A;  1YX5 B;  3EA6 A;  1RFK A;  4C80 A;  1E7U A;  3KQ4 A;  1DYQ A;  1VJK A;  4EZL A;  3WAO A;  2BVC A;  5JXV A;  2I1J A;  4MGY E;  2PMV A;  2WXF A;  1GOZ A;  2G4S A;  2JQR B;  2KMC A;  3VRA B;  3AE3 B;  3A9K B;  1RAX A;  1VZ8 A;  1XD3 B;  3TL5 A;  5DPW A;  1SE3 A;  1P9D U;  3ZJV A;  1YJ1 A;  4WH4 A;  1Z2M A;  5FKA C;  4EEW A;  2D2Q A;  4DQO C;  3N30 A;  2V4I B;  4NY0 A;  2LRW A;  2D10 A;  3RNB C;  2Y5C A;  3DHH C;  3LXF A;  2KJ6 A;  5IO9 A;  3ZTD A;  4S17 A;  3QC8 B;  3DQV A;  5EE1 A;  1SIF A;  1QOA A;  1J8C A;  1IBX B;  1F2R C;  3DCG A;  1WGD A;  3Q6B A;  1V1P A;  2UYZ B;  1SGH A;  5LXH A;  1V2Y A;  4AQ7 A;  2LFI A;  5BYR A;  3MTN B;  3W5V B;  4HPM B;  2JVC A;  4HDO A;  3EGR A;  3SEB A;  3W2D A;  2Q5W D;  1E8Z A;  4ZHO A;  4JGH B;  4ZRP A;  3P4Q B;  1D5X C;  4US8 A;  3ZNZ B;  3OWE B;  4I6P A;  5IAA C;  2C9W B;  1R4N B;  2DZK A;  4C4V A;  3QAQ A;  4IWO A;  1FXI A;  1WMH A;  4KGR A;  2QIL A;  4FJY A;  1N62 A;  3MFG A;  2M0A A;  1V80 A;  3IHP C;  1V1O A;  4GMV A;  4FJZ A;  1VD2 A;  2KAC A;  4RM9 A;  3X0W A;  4G0N B;  4XGA B;  2INP E;  3NVZ A;  3AE5 B;  1JWB D;  1MI0 A;  2XBB C;  3V05 A;  1V1P B;  2D11 A;  2ZNV B;  2KZR A;  3V3X A;  1C4P A;  2NMQ A;  5JHB A;  1QOF A;  2WXL A;  2X8X X;  2FCQ A;  3UGB B;  1TTN A;  4XYC A;  4IM0 A;  2NCN A;  4MT5 A;  3DBR I;  2HJ8 A;  1KLU D;  3PO0 A;  3PPA A;  1DOY A;  1I35 A;  5AZH A;  1TBE A;  2K6Q A;  1NVI D;  2WGS A;  4OHJ A;  2GRI A;  3NVY A;  3ML8 A;  1FEH A;  2K9X A;  2JXT A;  2LGI A;  2DX5 B;  2L05 A;  3DBL B;  4URK A;  4HRO A;  2KDB A;  3UF8 A;  3DVN V;  3CSF A;  2GMI C;  4LJO B;  2BS3 B;  1WXQ A;  3PRP B;  1LO5 D;  3V6E B;  1Q5W B;  1ZP0 B;  2FNJ B;  3ZRF A;  2J7Q B;  2DZJ A;  2PVO D;  4MEL A;  3QAR A;  3AEG B;  2KTF A;  1UBQ A;  3E9S A;  3IFW B;  4USA A;  1NDD A;  4IWP A;  3RUI B;  2CU3 A;  4ANU A;  2NPT A;  2LHD A;  3BIN A;  4IC7 B;  2RDH A;  1SE9 A;  3AE8 B;  3V60 A;  2K0P A;  3H7P A;  1OTR B;  4XWT A;  2WXI A;  1MPE A;  1KLG D;  3LJ3 A;  2X38 A;  2O6V B;  3ZUN A;  3P4S B;  2ASQ A;  2LWP A;  3RZF A;  2WQY B;  3AXC A;  1JWU D;  1F2R I;  2KVR A;  2O6V D;  3APC A;  3N1X C;  2R61 A;  4I6N B;  3L08 A;  1C3T A;  3KUZ A;  2ZZP B;  3VH3 B;  1TKY A;  3T9L A;  4XDC A;  2HDE A;  2J0M A;  4W9H A;  1L5P A;  1V9J A;  1TY0 A;  3B2G A;  1L0X B;  3N32 A;  3JSV A;  2WU2 B;  3V62 A;  1QZE A;  3UIN B;  1SE2 A;  2J4X A;  4BKG A;  3MC0 B;  3VTU A;  3AED B;  3KWV A;  4FHK A;  1C9F A;  4BKS A;  3AE2 B;  3ML9 A;  4ASW C;  4BAX A;  2JYT A;  5IKC M;  2L00 B;  2IO3 B;  1I4R A;  4LNF A;  2GBM A;  1WSP A;  5BYS A;  1TS2 A;  4KIK A;  2KLG A;  3U8Z A;  4IKG A;  2LGY A;  1TT5 B;  2IBI B;  4MJS A;  1FXA A;  2PLP A;  1ET6 A;  4W9K A;  4RGO S;  4X57 B;  3PV1 A;  1WFY A;  1R7S A;  1PYW D;  1QLB B;  2LI5 A;  1C4A A;  1L7Y A;  2J52 A;  1E8W A;  3FIL A;  4PT5 A;  3I63 C;  1V6E A;  3A4S C;  1FFV A;  2JZZ A;  4ZYS A;  1V5O A;  2KD0 A;  2M19 A;  3MC9 A;  3AH7 A;  4HJG E;  3NOB A;  1J7C A;  2PE6 B;  4CHK A;  1J7B A;  1WM3 A;  1KH0 A;  3UIO B;  4KX6 B;  5L95 C;  4BKS D;  2KYW A;  1GC7 A;  2WDQ B;  1D3Z A;  1EM7 A;  4AJW A;  1YN3 A;  4MJS B;  4N58 A;  2WXK A;  5CHW A;  2KWV B;  2INN E;  3OAW A;  2W55 A;  4J6I A;  3A1Q A;  4NZL B;  2HD5 B;  4S0R A;  3HK0 A;  4DDI D;  2YVC A;  4HJK A;  3L16 A;  1PUT A;  3Q8C A;  1ET9 A;  1WJN A;  4ICV A;  4A3O A;  1BML C;  4ZYN A;  2I38 A;  3FIL B;  2J42 A;  3ZJU A;  3ETR A;  2WP9 B;  1WR6 E;  4DWF A;  2IZV B;  3RI7 C;  2K39 A;  3U7D A;  3ZXR A;  2KHW B;  4JE3 B;  3KYC D;  3FC4 A;  1WJ6 A;  4LNI A;  3ZVV A;  2GBR A;  1RRB A;  4BVU C;  2LGD A;  5JH5 C;  1C76 A;  3BK2 A;  1WWT A;  5MPO A;  1OEY J;  2CHZ A;  2AWT A;  2JPH A;  1ZE3 D;  3PZ8 A;  2KJH B;  4A3P A;  2AL6 A;  4NJ6 A;  4PYZ A;  1KFY B;  4ZRQ A;  3Q69 A;  3MHS D;  1DOX A;  2REX A;  1KF6 B;  3BY4 B;  5IA7 A;  3BVM A;  4LK0 M;  3W9C B;  2DYM A;  2W3R A;  4TQ1 A;  4HDQ A;  2KAN A;  3I3T B;  4FN2 A;  4N9F 4;  4QAY A;  4E71 A;  5HI1 A;  4PK1 A;  3P2B A;  2OHF A;  4N6E B;  3UQB A;  3L4P A;  3CIR B;  2SEB D;  4FLH A;  2W9N A;  2WYQ A;  2QMT A;  3QJZ A;  3ZQ4 A;  3R7Q A;  3PRZ A;  4TUU A;  3BWU D;  1JML A;  1YX6 B;  4MH8 A;  2N9L A;  1YNT E;  3DBH B;  1FNW A;  1FMA D;  2GBJ A;  1A5R A;  1SE4 A;  1KM7 A;  4RH6 A;  1YMH E;  1WGH A;  4WQM A;  3AEC B;  1T0Q C;  1KTK A;  2UWQ A;  3DHI C;  3DVN U;  3TMP B;  3MJW A;  2AX5 A;  3W1S A;  3BZD B;  4TKN A;  4P1B C;  2LVP A;  3ZDT A;  2L0F A;  1F1H A;  1TIF A;  4W9G A;  5BYQ A;  4B6W A;  1SF0 A;  2W82 A;  3OJ4 B;  3PZ7 A;  1HEZ E;  1FO4 A;  2BYE A;  2LAS A;  1WXV A;  1K51 A;  2G9H D;  3CMM B;  3IT6 B;  3KW5 B;  2C60 A;  2RDB C;  3E56 A;  4MGK E;  4C7Z A;  4LLG M;  4A90 A;  1AWD A;  2K5P A;  3OLM D;  3GE8 C;  1E8X A;  3AE1 B;  3KUD B;  3NZU A;  2JY6 A;  1G6J A;  1SJE D;  2N9X A;  2BWE S;  2B3A A;  5J18 A;  4M0W A;  5BMH A;  1I4H A;  3P4P B;  2BWF A;  2QCZ A;  2QIE B;  1UZX B;  1F77 A;  4FUL A;  2J53 A;  2VH1 A;  2N7E A;  5KHO A;  2PVG C;  4B9K A;  1BT0 A;  4MDK E;  2MRP A;  1ZPS A;  1U4A A;  5C2T B;  2GOW A;  4K7S A;  3PHW B;  3VRB B;  4BZA A;  3RNE C;  1WM2 A;  1UEL A;  3T3N A;  2ZVN A;  4YSX B;  2H89 B;  2FCM A;  1YQ4 B;  2KQ7 A;  4PYU A;  4TV3 A;  2XNA C;  1PQS A;  2WHI A;  1WE6 A;  1J0G A;  3H6N A;  4K1R B;  1E90 A;  4ZRJ A;  1FRR A;  4WJO A;  2IND C;  2AL3 A;  2XN9 C;  4M8N A;  3U4E G;  4YXD B;  1SJH D;  3R2T A;  2VH2 A;  4OVU A;  2AEH A;  3ZLZ A;  1NEK B;  1P3Q U;  4JX1 C;  1L4D B;  5T8I A;  3A9J A;  4KKI A;  3Q3O C;  1PFD A;  4PS8 A;  3ZIM A;  2RMM A;  3AEF B;  2QEJ C;  2DHZ A;  1MHX A;  4HCP B;  5C3J B;  2LUM A;  1EF1 A;  2IO2 B;  1SB3 C;  1WX9 A;  1NI2 A;  4YSY B;  1MG4 A;  4EOY A;  4DHJ B;  4BOZ B;  3Q3N C;  2PJH A;  2NBU A;  4F8C B;  2L3Z A;  3PLU A;  2HJ1 A;  3BYY B;  4EE2 A;  2D07 B;  2VZK D;  4DHJ D;  2MQJ A;  2R2Q A;  3TJP A;  4UDU C;  2RD0 A;  2DLB A;  3L10 B;  1UF0 A;  2FIF A;  2EEL A;  3RFZ B;  2BPS A;  4RF1 A;  2GBN A;  1T0S C;  4LCD E;  3UIP B;  2XEW A;  3A9J B;  3GE3 C;  1N6Z A;  1IGC A;  4NPN A;  1HA5 A;  4OW0 A;  3BVZ A;  2BGF A;  4G11 A;  4KDL B;  2NS5 A;  4WWN A;  3H8H A;  1UGJ A;  2BT6 A;  1L2N A;  1NI3 A;  2KTR A;  1YJI A;  2D3A A;  4E3C A;  3PTF C;  1GNU A;  1E8Y A;  1WYG A;  4DHZ E;  3APF A;  3BII D;  2K22 A;  4RFB A;  1H8C A;  5J2R A;  3L54 A;  2IPK D;  3AN1 A;  3J9C A;  2BYF A;  3M63 B;  1FCL A;  3ZYY X;  3JYU A;  3B08 A;  1KOT A;  3I57 A;  4AWJ A;  2MJE A;  2PPH A;  3AU5 A;  5G5H A;  3PHX B;  2IGG A;  2K25 A;  3N1Y C;  2KKC A;  5HHD G;  2N7D A;  2KVZ A;  2Z0E B;  3DBR B;  4IWQ A;  5D6J B;  4KZ0 A;  2J0J A;  2MEK A;  4WWO A;  3N1Z C;  1QIL A;  2KTR B;  1NEN B;  1YQB A;  1TJE A;  3H9D A;  2WX1 A;  4HLE A;  4MSQ B;  3NZS A;  1WIA A;  2N9P C;  3IXS A;  1WY8 A;  4GN1 A;  2I2Y A;  2N0S B;  5G2N A;  1IGD A;  5E6P A;  2V4L A;  2WXN A;  3KVF B;  1F52 A;  4GLS C;  1JRO A;  2DAJ A;  2JWZ A;  4KVG B;  2KMA A;  4EZJ A;  1E6E B;  1EWY C;  3P63 A;  1P7F A;  2O6V A;  1Y56 A;  4XWW A;  3AB5 A;  4W9F A;  5DCN A;  4DK5 A;  4OZC A;  1WZ0 A;  1D4B A;  3AV8 A;  2N7J A;  3I9V 1;  3IVF A;  1XQQ A;  2LXA A;  1GG3 A;  3PRE A;  1T0Y A;  3MP9 A;  2Z59 B;  3ZNH B;  3TEY A;  2FUH B;  3APD A;  2RSU A;  3OJ3 A;  4XDD A;  1MG8 A;  3DOW A;  2UU7 A;  3VDZ A;  2BYT A;  1XLQ A;  1S3S G;  1WJU A;  4W9E A;  3RCZ A;  3CST A;  3R7R A;  4JPS A;  3WAN A;  2KC2 A;  1E9M A;  3U30 A;  4ANV A;  2CHW A;  4DXA B;  4ARI A;  3NUH B;  2IYD B;  3BVG A;  2BQQ A;  1NYQ A;  2MJD A;  1WXM A;  4EUT A;  1ROE A;  4BFR A;  4NAW B;  3VUX A;  2G1E A;  2JRH A;  2Y5P A;  3RMK C;  3HVZ A;  1TKG A;  2L7R A;  3AUL A;  3VXW A;  2BB6 A;  2KK8 A;  2BTE A;  1FXT B;  2OJW A;  2K6D B;  4TQ0 A;  3M62 B;  2KX3 A;  1IUE A;  1WF9 A;  4LNN A;  1WX8 A;  2C7M B;  3EFC A;  4HRS A;  2KWU B;  1WXA A;  3ZTC A;  1Q1O A;  3QQ8 B;  4KZC A;  4WAF A;  3W1Y A;  1ZDV A;  5IN7 A;  3VAW A;  5C23 A;  2EMS A;  4EZK A;  3B2F A;  2IGD A;  1WGK A;  1RM6 C;  1L4Z B;  1NBF C;  3NY5 A;  2ZCB A;  2Z8L A;  4F7Z A;  1C79 A;  1UD7 A;  3DDC B;  1XCT L;  3NHE B;  1IYF A;  3RPF C;  4WJP A;  3RZW C;  1T5X D;  1OQR A;  3DVG Y;  3D32 A;  2WDT B;  2FID A;  1AAR A;  3ZJT A;  1WYW B;  1JRU A;  1YOV B;  1OEY A;  2G3Q B;  2ZW1 A;  4JL9 A;  5KHQ A;  5D3D A;  4KSL C;  4HWI B;  3H7S A;  4MEM A;  2K8C A;  1VR9 A;  2IO1 B;  3SFE B;  3ZRC A;  2FCN A;  5AUK A;  4WAA A;  1OGW A;  3CWI A;  3IG3 A;  2MP2 A;  2JWU A;  3X23 A;  5D94 A;  4REZ A;  2MBQ A;  3DHG C;  5LLI A;  1YJJ A;  4ANX A;  2MBO A;  4AUQ C;  3TEZ A;  2JSV X;  2KDF B;  1C4C A;  4AJY B;  3AI5 A;  2KLC A;  1P1A A;  5IOI A;  1E5W A;  1HTO A;  3R8B A;  4CYE A;  2IY0 B;  3VUY A;  2WXR A;  3K9P B;  1SSN A;  1ZXI A;  3V61 A;  2BBC A;  3AEA B;  4ZOH C;  3RNF C;  2DYO A;  2DZI A;  5BMG A;  2MP2 B;  5AEK B;  3SR6 A;  3URY A;  1JWS D;  1FCC C;  1T6B X;  3RN9 C;  4W9C A;  2KMM A;  2KOX A;  3K9O B;  3WCQ A;  2M4N A;  4DXG A;  3C8Y A;  2WXM A;  3AE7 B;  4XE0 A;  3ZO5 B;  3EFU A;  1V8C A;  1E7P B;  4DBG A;  4RGN A;  3QHT A;  2JT4 B;  2KDI A;  1FFU A;  5G55 A;  3Q3M C;  4O1N A;  5FR3 A;  2WU5 B;  1JQ4 A;  5C1Z A;  1K52 A;  2WWZ A;  1HZ5 A;  3DWG C;  4YT0 B;  1FRD A;  3DWM A;  3RUL A;  3JVZ X;  1FPY A;  2K1F A;  2DNF A;  2NR2 A;  2PKO A;  3C0R B;  2C7N B;  2LJ5 A;  3IAS 1;  1EU4 A;  1TZO A;  2L32 A;  3Q3J A;  2I1K A;  3A33 B;  2CJN A;  1VZ7 A;  2V3P A;  3KUC B;  4RM8 A;  2V3N A;  3VVW B;  3KYD D;  4ZHP A;  4JQW C;  4GOC A;  4W9J A;  2M56 B;  2PTL A;  2V3S A;  3DBS A;  1GJZ A;  2BYV E;  4II3 B;  1ZW7 A;  1WRI A;  1XXG A;  1PDX A;  3AE9 B;  1WX7 A;  2MLB A;  1FNV A;  1C78 A;  1CK1 A;  1KJT A;  4KKJ A;  2BS2 B;  2VRR B;  2MBH A;  1D5Z C;  3HHM A;  3KWL A;  5LNK 1;  1XLP A;  3ZW3 A;  4XZ4 A;  2WNM A;  2AYO B;  1UGM A;  1WE7 A;  1V81 A;  2KWD A;  3NS8 A;  4HK2 A;  3BK1 A;  2KFJ A;  1JCK B;  4A20 A;  3NVW A;  4BKT A;  3L0W B;  3PVL A;  5FK9 C;  1PGB A;  4E74 A;  3HUI A;  2LXC A;  2INC C;  1QOG A;  3N20 C;  3ZGZ A;  4FA6 A;  4HEA 1;  2QHO A;  3QX1 A;  3SHQ A;  2MH7 A;  3O13 A;  5EE3 A;  2Y5B B;  3LYY A;  4WIP A;  2M17 A;  3VHT C;  2NBW B;  2JXX A;  3R3M A;  1ZGU B; 
#chains in the Genus database with same CATH homology
 1KLG D;  1NI3 A;  1D5M C;  2QJL A;  2X38 A;  1YJI A;  1FIQ A;  3P4S B;  1BUI C;  5AUI A;  2WQY B;  1CJE A;  4C7Y A;  1SXT A;  1E10 A;  1JWU D;  1F2R I;  1WYG A;  2RDG A;  1FM0 D;  3BII D;  2K22 A;  1ACC A;  4RFB A;  1HXY D;  2R61 A;  2IPK D;  2L52 A;  3AN1 A;  4JWS C;  3J9C A;  3UI3 A;  2PW9 A;  1A70 A;  1XF5 L;  1TKY A;  1FCL A;  2E6X A;  4TSS A;  4XDC A;  2HDE A;  3ZYY X;  2MJ3 A;  4JWU C;  3I57 A;  4MAC A;  1L5P A;  2KDM A;  2MJE A;  1JWA D;  4YWG G;  1TY0 A;  3B2G A;  5G5H A;  1L0X B;  2SAK A;  1JRP A;  4RGM A;  3GS2 A;  2D5G A;  2BB5 A;  2JYE A;  2WU2 B;  1T3Q A;  2IGG A;  1F0Z A;  1QOB A;  1SE2 A;  1GB4 A;  1PGA A;  2J4X A;  5HHD G;  3MC0 B;  1C9F A;  1UNS A;  3AED B;  3KWV A;  1GPX A;  3AE2 B;  1BXT A;  1OQQ A;  1YN5 A;  2ACZ B;  3IAM 1;  2JYT A;  4IOI E;  5D3I B;  2MEK A;  1I4R A;  2DWQ A;  2ONQ A;  5H8Y E;  1QF6 A;  5HG2 A;  1QIL A;  2RPV A;  1NEN B;  4KGT A;  1TJE A;  1WSP A;  4YTM B;  2ZW0 A;  5BYS A;  4AS1 A;  3TUO A;  1TS2 A;  1I7H A;  1GAQ B;  2BS4 B;  1GB1 A;  4IKG A;  3IXS A;  4L23 A;  2WDV B;  1QKZ A;  3U52 E;  2I2Y A;  1FXA A;  2N0S B;  2PLP A;  1ET6 A;  4Q2J A;  1IGD A;  2AQ3 B;  1NYR A;  2WXN A;  1EU3 A;  4GLS C;  1ESF A;  4RGO S;  1JRO A;  1R7S A;  3U2S C;  1PYW D;  2JX5 A;  2W54 A;  3Q8A A;  2ON8 A;  2KN4 A;  1QLB B;  1C4A A;  2FUG 1;  2J52 A;  3FIL A;  1E6E B;  1EWY C;  3P63 A;  2GI9 A;  4N59 A;  2LHE A;  1P7F A;  3Q8E A;  4PT5 A;  3TEX A;  1FFV A;  1Y56 A;  2FE8 A;  3AEE B;  4XWW A;  4ZYS A;  3AB5 A;  1DGJ A;  2WXP A;  3BYT B;  1OFF A;  2VZK B;  2WS3 B;  4OZC A;  2M19 A;  1D4B A;  1AN8 A;  1EWC A;  1JW9 D;  2HTM E;  2YEP B;  3AH7 A;  3AV8 A;  3VQI A;  1XEE A;  4CQN A;  4MM3 B;  2N7J A;  4HJG E;  1J7C A;  3I9V 1;  1HZ6 A;  1ZXH A;  3VR8 B;  1ZUD 2;  4GDK B;  1AW7 A;  1J7B A;  3MJ5 A;  4C56 C;  4IDI A;  3MP9 A;  1KH0 A;  4OZA A;  3TEY A;  1UWX A;  1I4G A;  4XDD A;  3GB1 A;  4KX6 B;  2BYT A;  4RF0 A;  1XLQ A;  2WDQ B;  1AYF A;  4B0E A;  1UWM A;  4JPS A;  1XCQ L;  1EM7 A;  1YN3 A;  1E9M A;  4N58 A;  1Q10 A;  3Q8F A;  2NTS A;  3NVV A;  2WXK A;  1STE A;  2INN E;  4NZL B;  2W55 A;  4ARI A;  1KRH A;  3NUH B;  1YN4 A;  3BVG A;  1MPE A;  2W3S A;  1FNU A;  1L6V A;  1NYQ A;  1PUT A;  3Q8C A;  4R3D A;  1ET9 A;  2MJD A;  1BML C;  1ROE A;  1SBB B;  4NAW B;  3AE6 B;  2G1E A;  2I38 A;  3FIL B;  2J42 A;  3ZJU A;  3ETR A;  2Y5P A;  3TEW A;  2WP9 B;  3FAH A;  3HVZ A;  1TKG A;  4P16 A;  1VZ6 A;  1HQR D;  1N5X A;  2BB6 A;  2CJO A;  2BTE A;  3HRD D;  2BW2 A;  2EKI A;  1N63 A;  1CQV A;  4JE3 B;  1I4Q A;  3FC4 A;  4TQ0 A;  4KGS A;  1IUE A;  2WXQ A;  1C76 A;  3BK2 A;  4HRS A;  1WWT A;  1QT9 A;  5MPO A;  3AEB B;  4WAF A;  4OVZ A;  1RYJ A;  1ZDV A;  3KLS X;  1ZE3 D;  3PZ8 A;  3NS1 A;  2FBW B;  3B2F A;  2JZP A;  2IGD A;  1WGK A;  4YTN B;  1KFY B;  1RM6 C;  1L4Z B;  4ZRQ A;  3Q69 A;  1DOX A;  1N5W A;  1KF6 B;  1N60 A;  1VLB A;  5D7G A;  4RNA A;  2Z8L A;  1E0Z A;  1C79 A;  3BVM A;  3NZ3 A;  4LK0 M;  3TSS A;  2WXH A;  1ZOY B;  2KAJ A;  2OED A;  3W9C B;  1XCT L;  2LJI A;  2KQ4 X;  2DYM A;  2W3R A;  4TQ1 A;  3RPF C;  1XO3 A;  1SEB D;  5HI1 A;  3Q8B A;  1T5X D;  5HFY A;  2OHF A;  4N6E B;  3L4P A;  1OQR A;  3CIR B;  3AMZ A;  2SEB D;  2E3T A;  5EE0 A;  2QMT A;  3ZQ4 A;  3ZJT A;  3BWU D;  1JML A;  2V0G A;  4HKQ A;  4MH8 A;  2ZW1 A;  2N9L A;  1YNT E;  4A6Q A;  1FNW A;  5D3D A;  1CZP A;  1FMA D;  1B1Z A;  1RWS A;  3AE4 B;  1SE4 A;  1VR9 A;  4RCO A;  4HKZ E;  1TS4 A;  2ICI A;  3AM9 A;  5GXG B;  3SFE B;  2IDY A;  5AUK A;  4RH6 A;  1I4X A;  1YMH E;  2WXJ A;  1TY2 A;  1C77 A;  2H88 B;  2GB1 A;  4WQM A;  3AEC B;  1KTK A;  3CWI A;  1TYG B;  4WWM A;  1D6E C;  2L83 A;  3LB8 C;  1V97 A;  2AX5 A;  2JWU A;  3W1S A;  1B9R A;  3BZD B;  1IBX A;  1K50 A;  3P1M A;  3U7Z A;  3EA6 A;  1RFK A;  4REZ A;  4C80 A;  3KQ4 A;  1DYQ A;  1VJK A;  5JXV A;  4P6V F;  2QSD A;  5BYQ A;  2PMV A;  2WXF A;  1GOZ A;  1SF0 A;  2W82 A;  3PZ7 A;  3R2I A;  4A8X C;  1HEZ E;  1M4V A;  2JQR B;  1FO4 A;  3VRA B;  1K51 A;  4ARC A;  2G9H D;  3AE3 B;  1UUP A;  1YJJ A;  4YSZ B;  3IT6 B;  3E56 A;  1VZ8 A;  4C7Z A;  2LMC A;  4LLG M;  2WLB A;  3TEZ A;  2JSV X;  4A90 A;  1SE3 A;  1AWD A;  4RGT A;  3ZJV A;  2PIA A;  1C4C A;  2K5P A;  4WH4 A;  4L1B A;  4OZB A;  5FKA C;  1ENF A;  1QQR A;  3AE1 B;  4DQO C;  2V4I B;  3R8B A;  2Y3A A;  1SIJ A;  1VDV A;  1SJE D;  2WXR A;  1SSN A;  1ZXI A;  3B9J A;  4M0W A;  2BBC A;  5BMI A;  3AEA B;  1DOI A;  4ZOH C;  4YTP B;  1I4H A;  5BMH A;  2DYO A;  2LEK A;  2Y5C A;  3LXF A;  3P4P B;  5BMG A;  3VR9 B;  4WUR A;  3SR6 A;  3URY A;  1JWS D;  2QIE B;  1FCC C;  1T6B X;  5EE1 A;  1QOA A;  1F77 A;  1IBX B;  1F2R C;  2J53 A;  2KMM A;  4A55 A;  1V1P A;  3WCQ A;  2PVG C;  4J3O D;  4DXG A;  3C8Y A;  2WXM A;  3AE7 B;  4XE0 A;  1TS3 A;  4AQ7 A;  1V8C A;  2LFI A;  5BYR A;  1E7P B;  3W5V B;  4RGN A;  1ZPS A;  2B76 B;  3EGR A;  3SEB A;  3W2D A;  2Q5W D;  1FFU A;  2IJ0 A;  4ZHO A;  5C2T B;  5H92 C;  2WXG A;  4O1N A;  5FR3 A;  2WU5 B;  2AQ2 B;  1JAL A;  3N9Y C;  3NRZ A;  3P4Q B;  1K53 A;  4ZRP A;  1D5X C;  1JQ4 A;  4DXF A;  3VRB B;  4US8 A;  1TKE A;  3T3N A;  1MVK A;  3OWE B;  4NJC A;  1K52 A;  4YSX B;  4FXC A;  2H89 B;  1HZ5 A;  1N61 A;  1YQ4 B;  3DWG C;  4YT0 B;  5TSS A;  1FXI A;  1VRA B;  1FRD A;  2WXO A;  3IT4 B;  5E6J A;  4KGR A;  5G5G A;  3DWM A;  2QIL A;  4GDL B;  1N62 A;  2XNA C;  3MFG A;  4B0M A;  2M0A A;  1V1O A;  2PKO A;  2KAC A;  3P4R B;  4US9 A;  3IAS 1;  1XLO A;  1EU4 A;  2INP E;  3W5U B;  3NVZ A;  4H2A A;  1FRR A;  2YEP F;  1TZO A;  3U4E G;  2XN9 C;  2L32 A;  4YXD B;  3AE5 B;  1JWB D;  1MI0 A;  1SJH D;  2CJN A;  3HVD A;  1VZ7 A;  3R2T A;  4LTU A;  5EE9 A;  2V3P A;  3V05 A;  1V1P B;  4TMA B;  3V3X A;  1L6U A;  2DBY A;  2V3N A;  4ZHP A;  1C4P A;  1L0V B;  1ZDX A;  2NMQ A;  1NEK B;  3T3O A;  2M56 B;  1QOF A;  2WXL A;  4JX1 C;  2PTL A;  1L4D B;  5T8I A;  1MHH E;  4KKI A;  1PFD A;  1XLN A;  1WRI A;  4ITK A;  2JU6 X;  2RMM A;  1XXG A;  1PDX A;  2QEJ C;  3AEF B;  3MHZ A;  3AE9 B;  4MT5 A;  4D2K A;  1MHX A;  3EUB 2;  1KLU D;  3PO0 A;  1DOY A;  3GP7 A;  5C3J B;  2LUM A;  1FNV A;  1C78 A;  1CK1 A;  2N9K A;  1SB3 C;  4NAM A;  4KKJ A;  4YSY B;  1NVI D;  2BS2 B;  4OHJ A;  2GRI A;  2K3U A;  3NVY A;  1D5Z C;  1FEH A;  1JWM D;  2K9X A;  2JXT A;  3KWL A;  2LGI A;  5LNK 1;  1P7E A;  1XLP A;  4HRO A;  1J7A A;  2WNM A;  2IGH A;  3BYY B;  4A9A A;  4EE2 A;  2BS3 B;  1WXQ A;  2VZK D;  1YQ3 B;  1LO5 D;  2KWD A;  4UDU C;  1ZP0 B;  2DLB A;  1PGX A;  1TS5 A;  2PVO D;  3BK1 A;  1FD6 A;  2WDR B;  3AEG B;  1JCK B;  3ABV B;  3NVW A;  2TSS A;  3E9S A;  1I4P A;  2EEL A;  3RFZ B;  4USA A;  3P42 A;  5FK9 C;  2AQ1 B;  4RF1 A;  1PGB A;  5I4D A;  3HUI A;  2CU3 A;  3ZGZ A;  1QOG A;  2L1A A;  1L0Y B;  2LHD A;  4HEA 1;  1IGC A;  4L2Y A;  2NTT A;  2RDH A;  2MH7 A;  1HA5 A;  3O13 A;  3AE8 B;  5EE3 A;  3SFD B;  4OW0 A;  3BVZ A;  3LYY A;  4WIP A;  2K0P A;  4XWT A;  2WXI A;  3H8H A;  1UGJ A;  2BT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...