5MPOA

Crystal structure of human molybdopterin synthase complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
SMVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin synthase sulfur carrier subunit
publication title Crystal structure of human molybdopterin synthase complex
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5mpoA00
2K9XA 1NYQA 3LB8C 2HTME 3CWIA 1FFVA 1OQQA 1XO3A 1IUEA 3NVVA 5EE1A 4JX1C 4WQMA 1SIJA 3NVYA 5C3JB 1AYFA 1SF0A 1XLNA 2DWQA 3B2GA 2BS3B 4N58A 1T3QA 2W3RA 4YSYB 5AUIA 2K22A 4A9AA 2QJLA 2WLBA 3AEEB 3DWMA 1XLPA 1OFFA 3AE7B 2JQRB 1FXIA 1QOGA 2WDRB 1FFUA 1NI3A 1N5XA 3FC4A 3AE3B 2G1EA 3NS1A 1WYGA 2N0SB 2LEKA 4C7YA 5EE9A 3AV8A 3WCQA 1J7AA 2ACZB 1QLBB 3FAHA 3P1MA 4N59A 1DGJA 4C80A 1YQ4B 2AX5A 1B9RA 1VJKA 5C2TB 1E0ZA 3NRZA 2FBWB 3AECB 2MH7A 3KWLA 4US8A 3W5UB 3AEDB 2W55A 1L5PA 1RM6C 2MJDA 1CJEA 3AEGB 4YTNB 3SR6A 3AE4B 2CJOA 2PVGC 1NENB 1ZUD2 5G5HA 1OQRA 1RYJA 3L4PA 1XLQA 3NVZA 3AEBB 2MJ3A 1CZPA 3B2FA 1FMAD 4JWUC 1JQ4A 1PUTA 1YJJA 1QT9A 2W54A 1FM0D 4YSXB 1F0ZA 1PFDA 3HVZA 1DOIA 1FXAA 1N5WA 1RWSA 2DBYA 2OHFA 4US9A 2WP9B 1YJIA 1E9MA 1J7BA 1N62A 1XLOA 4ZHOA 3W5VB 1QOFA 2CU3A 1N60A 1J7CA 1EWYC 3AMZA 3P4QB 1JROA 2L83A 2WQYB 3P4RB 1KRHA 3AH7A 1VLBA 3EUB2 1L6VA 4HRSA 1JRPA 2Q5WD 3LXFA 2PVOD 5H92C 1L0VB 1V97A 1NEKB 1R7SA 5G5GA 3AE1B 1TKEA 3VR9B 1L6UA 5AUKA 2PKOA 3SFDB 2H88B 2EKIA 3BIID 2B76B 2BS2B 3AB5A 3HUIA 4YTPB 1E10A 1JWAD 1TKGA 2KMMA 5EE0A 3AE5B 1QF6A 3HRDD 2M19A 3NVWA 2JX5A 1WGKA 4P6VF 1V8CA 3AE6B 3ETRA 4FXCA 1ROEA 2WDQB 4LTUA 2L52A 1PDXA 1DOXA 1NVID 5MPOA 4N6EB 3W9CB 1ZXIA 3DWGC 5H8YE 3PO0A 1SB3C 4ITKA 5EE3A 2WU2B 1AWDA 4KX6B 1GPXA 1JW9D 1RFKA 4HROA 2BT6A 1A70A 1UWMA 2QIEB 4ZOHC 1DOYA 2M56B 3AE2B 1JWBD 1N61A 1QOBA 4YSZB 1E6EB 1FIQA 2H89B 3CIRB 2PIAA 3AN1A 1N63A 3AEAB 1ZP0B 2K5PA 4USAA 4IDIA 1TJEA 1WXQA 1FRRA 1QOAA 1TKYA 1YQ3B 2Y5CA 1FO4A 1I7HA 2WDVB 3RPFC 2MJEA 3ABVB 4YT0B 2BS4B 2CJNA 3AE9B 3AEFB 3P4PB 5GXGB 1E7PB 1KFYB 4ZHPA 1GAQB 1WWTA 1VDVA 4YTMB 2WS3B 3P63A 4WWMA 1JALA 1KF6B 2KAJA 1NYRA 2W3SA 3B9JA 3VRAB 1ZOYB 2E3TA 4JWSC 1WRIA 1TYGB 4C7ZA 1FRDA 3SFEB 3VRBB 3AM9A 3VR8B 4YXDB 3P4SB 3ZYYX 3AE8B 2WU5B
chains in the Genus database with same CATH superfamily
1SF0A 1HTQA 2FUG1 1FXIA 2ZPNA 1MFWA 3PRPB 1TS4A 3WCQA 2KDFB 1QLBB 4RNAA 1RLFA 1MI0A 3GB1A 2ICIA 2CJOA 4JIOU 4MM3A 3TIXA 3RNAC 2JSVX 1UBIA 2IJ0A 1C78A 1UF0A 4KGSA 1TT5B 4W9KA 2HDEA 4TSSA 1P0RA 4ZHOA 2CU3A 4HKZE 3U7DA 4A3PA 3PZDA 1WM3A 2KDEB 2IYDB 1R7SA 2L0TA 1L0YB 1E90A 1ZDXA 2M0AA 4WAAA 4FA6A 2N9PC 2JZ3B 1JWAD 4B0MA 3AE5B 1MVKA 2PLPA 4HJKA 3JYUA 3BVZA 3U52E 3DVGX 3VUWA 5EE3A 2YEPF 1AWDA 4C56C 4K3CA 1T0QC 3CF6E 1YN5A 1A70A 3KQ4A 1V5TA 2KMCA 1LM8B 3OJ4B 1C9FA 4LNFA 2KVRA 4W9GA 3ZUNA 1UBQA 1ZP0B 5GMVA 4IDIA 1FO4A 4GN1A 2WDVB 1B1ZA 1Q1OA 3PGEA 1E7PB 4L2YA 1GAQB 2NTSA 3B9JA 4LJPB 4F8CB 2C7NB 1NDDA 2PMVA 1ZE3D 5D3IB 1YD8U 1MG8A 5J18A 2K9XA 1WFYA 4WQMA 1JWMD 1C3TA 2DWQA 3TJPA 1D5ZC 4A9AA 2DX5B 1TTNA 1QOGA 2NBUA 4J6IA 3L17A 3NS1A 1I4RA 1B9RA 1DGJA 2BWFA 2A5UA 2JF5A 3TSSA 5G5HA 4KKIA 2LVPA 2RR9A 3APCA 5J2RA 2WNMA 1PUTA 2SAKA 1WGDA 2W54A 1FM0D 4YSXB 1QKZA 1WZ3A 1KM7A 2G3QB 1UH6A 4HKQA 1TBEA 2ZVOA 4M00A 1F2RI 2N7DA 3EUB2 1JRPA 2Z59B 1TKEA 1EU4A 5BYQA 2YEPB 4REZA 2KDIA 1CMXB 1WGGA 3OWEB 5JZEB 2IO1B 2C5LC 4WH4A 4NJ7A 3ETRA 4FXCA 4XYCA 3VUXA 5CTRC 2LGSA 3ECIA 1UWMA 2KOXA 2CR5A 3N30A 1HXYD 3UIOB 1WJNA 2JZZA 2AQ1B 1C4CA 1ENFA 1NI2A 2R61A 3NZSA 2EKEC 2PPHA 5D6JB 1GUAB 1KF6B 1MHHE 2D5GA 2FE8A 2L8JA 2ZW0A 3AM9A 2KK8A 3N20C 1RFAA 3C19A 1IYFA 5CHWA 4KSKC 2BS3B 2WXFA 4EUTA 2AL6A 1XD3B 5AZGA 2BWES 1R4MI 4TUUA 1LQBA 3VTUA 2KQSA 3FAHA 5C2TB 3KWLA 1XXGA 2O6VB 4IUMB 3SDLC 2G4SA 3Q3JA 1OQRA 4RF0A 4DHJD 3B2FA 2QCZA 2KHWB 2MHJA 1WX8A 2KJHB 2C9WB 2WGSA 5E6OA 1F0ZA 3V60A 3Q3OC 3BVGA 1PQSA 1T6BX 3DBRB 1N62A 4DXAB 1L2NA 1J7CA 1WXMA 4TQ1A 3RNBC 5H92C 4W9JA 2H88B 2D3AA 2GB1A 4KIKA 1XEEA 4CHKA 5AEKB 1TKGA 3IFWB 2M19A 4P6VF 2GLSA 3C0RB 2I1JA 4L23A 2RMMA 2FUHB 1T0YA 3NZUA 4TQ0A 2WU2B 3N1XC 2JWUA 4HLEA 1I4HA 1C76A 4HPMB 4M8MA 1JWBD 2BB6A 2EMSA 3AEAB 1PGXA 2IY1B 3PHXB 2KWVB 4ACFA 2CHZA 3KYDD 3IT6B 1MHXA 5GXGB 1SXTA 1KOTA 3NZ3A 4WWNA 3A33B 2DZKA 2PE9A 2W82A 3VFKA 2D3GA 4TMAB 4XX5A 4PS7A 1YN3A 2AQ2B 4MGKE 3AE8B 4BBNF 2WU5B 1LO5D 3N1YC 2VZKD 4C4VB 1AYFA 4RGNA 3PPAA 4GDKA 1XLPA 3DBHI 3AE7B 4XGAB 1FFUA 4OZAA 2WX1A 4HCNB 2ACZB 3SD5A 2AX5A 2WXHA 4E3CA 5E6JA 2QILA 4A3OA 1C79A 1YOVB 2GMIC 4YTNB 1C1YB 4JQWC 1ZUD2 2N1WA 1CZPA 3I5JC 3APFA 4WIPA 1HZ6A 1E9MA 1WXVA 2B3AA 3DVGY 3TEYA 3Q8AA 4WWOA 3KLSX 1AW7A 4F1SA 1VLBA 2PVOD 2M1MA 2XN9C 2D07B 1GG3A 2EKIA 3MHZA 3VAWA 3WAMA 3UGBB 4DHZB 1OEYJ 3L08A 3DDCB 4EKUA 1KTKA 1EM7A 3HRDD 3KUCB 1TY0A 1E7UA 1DOXA 2LGYA 4HEA1 2WXQA 3Q3MC 3ZTCA 3W1SA 2JPHA 4KX6B 3UI3A 2WXOA 4HROA 3EC8A 2LXCA 2DAFA 4JL9A 3L16A 4YSZB 3CIRB 1Q10A 1U4AA 4DK5A 4ANUA 2BB5A 3FILA 3ZQ4A 4B0EA 4GIVA 3VH3B 3AEFB 5L83A 4FLHA 2LRWA 4AUQC 3W1SC 4C00A 1HTOA 2C60A 4JWSC 4CO7A 1WRDB 4Q2JA 1FRDA 2DYOA 4YXDB 3P4SB 3Q3NC 2INPE 3QQ8B 1BT0A 1FFVA 5EE1A 3RZFA 5C3JB 2BKFA 5JH5C 3PREA 2DZMA 2W3RA 5IOIA 4UDUC 3GS2A 5BMHA 1MJDA 1N5XA 5FR6A 2NMQA 3AV8A 4NAWB 2IY0B 3UF8A 3P1MA 3DQVA 1L7YA 3E56A 4DDID 1NENB 2LHDA 3HM6X 1XCTL 4KDIC 3O13A 2A4ZA 4GDLA 4I6NB 3DBSA 4W9IA 4FJYA 3X23A 2KFKA 3DBLI 1V49A 2N9KA 3W5VB 3QX1A 1WR1A 4HRSA 2V3PA 1L6VA 4J3OD 2Q5WD 4QAYA 1L0VB 2DLBA 5G5GA 2BYFA 4DWFA 3VTWA 4NNJB 2K1FA 5IO9A 2BS2B 3NHEB 4LTUA 3QARA 1NVID 3QC8B 1LGRA 3QK0A 1F52A 1SBBB 3ZO5B 4M02A 1DOYA 2MA9B 4RMAA 1I7HA 3ZXRA 4AJYB 3ZVVA 2QHOA 1WWTA 2V3SA 1FCLA 1HQRD 2JXTA 2KAJA 3MTNB 2KO3A 2GBNA 2K8CA 4GSWA 2ZNVB 3VHTC 1OQQA 1YMHE 3WA0A 5E6PA 2O2VA 1SIJA 2PTLA 2N7JA 3AEEB 3DWMA 3ZNGC 4W9HA 1ESFA 3VUYA 3IG3A 1I4QA 2ZEQA 3A1QB 2KJRA 2KLGA 2FCQA 1JWSD 1V1OA 3L54A 3AEBB 1JQ4A 1EWCA 2KXJA 1N5WA 3WAOA 4US9A 3PLUA 3JW0X 5HG2A 2NS5A 3DHIC 4WWPA 4E74A 1IP9A 5LNK1 2WXIA 3ZW3A 2D3BA 1XF5L 3RI7C 3ZNZB 3AB5A 3BK2A 4MGIE 4WJNA 3PLVA 2WYQA 1ZXHA 4KVGB 4KIKB 1WGKA 1YQBA 3AE6B 2JVCA 1P1AA 2YVCA 4K7UA 3RFZB 4LK0M 1V2YA 4AOFA 4LLGM 1J0GA 1E8XA 4USAA 3EECA 3WANA 1TJEA 1I35A 1QOAA 4WQOB 4ZDVA 1WJ6A 2LXAA 3JSVA 4F7ZA 4XWTA 1KFYB 2L0FA 4LDTB 1T0RC 1C4AA 4DBGA 3HM3A 4BKSD 2V4IB 4OZCA 5IAAC 2M0XA 1I4XA 1XQQA 3KUZA 4EFOA 2L05A 1IGDA 2MBEA 4LNIA 1YQ4B 5IA7A 2ZVNA 2LGDA 4XC2A 1VR9A 1R4NB 1RM6C 2MJDA 3TCAA 4BBNC 3HIZA 2X38A 3Q8BA 2PE6B 1XLQA 3AXCA 4JWUC 2KWUB 1QT9A 4GB9A 2ZZPB 3OAWA 4A90A 2C7HA 1YN4A 1V1PA 1T0SC 3P42A 4K7SA 2V0GA 1ET6A 1TS5A 1VCBA 2LUEA 4FULA 4ZYNA 3AE1B 4BKGA 4FN2A 1WE6A 4K3BA 1F77A 2LD9A 4KGTA 3R3MA 4LDTD 5MPOA 3CSTA 4PS3A 3RT3B 4ITKA 2KANA 1BUIC 1GC6A 2IGDA 2BTEA 2DZIA 1WX9A 1ZKHA 3WAPA 3EGRA 4NY0A 4DHJB 1WF9A 4EE2A 1YX5B 4RFBA 3K9OB 5G2NA 3BK1A 3FILB 2K3UA 2J7QB 1WRIA 2NTTA 2LZ6A 2D2QA 2QC8A 2MP2A 1OEYA 4BZAA 5J17A 1NI3A 2LMCA 4AP4C 1D5MC 2G1EA 1WM2A 3CMMB 1J7AA 3Q69A 4C80A 4LNNA 1JRUA 3H1UA 2LI5A 4TKNA 3T9LA 4MEMA 2MCNB 2Y5BB 1YJJA 3PT2B 4GDLB 3I3TB 1L4ZB 2KTRA 2GBKA 2INNE 2KFKB 2AQ3B 2IPKD 4YT0B 1KRHA 3I9V1 2KYWA 4W9CA 2K39A 2MRPA 2LJIA 4EZJA 3VR9B 2LRUA 2PEAA 4B9KA 2WXKA 4BKSA 2VH1A 3ZGZA 4WJOA 3DBRI 3ZIMA 2VZKB 2FAZA 1EF5A 3NVWA 3PHWB 4IWQA 2FNJB 3Q3FA 4II2B 5AZFA 4IW0A 1MPEA 3QAQA 4CQNA 4HDQA 3A9JA 3PS6A 3GZNB 3MFGA 2LFIA 3PV1A 1L0XB 2HJ8A 1FIQA 3M63B 1FPYA 2MBBB 2K8BA 4HPLB 1E5WA 4HK2A 1F1HA 1V86A 4MDKE 4GU2A 1TIFA 3IT4B 1EUVB 4IM3A 4P1CC 2KQ4X 3L10B 3B0AA 3J9CA 3SFEB 3H7PA 3QWZB 2BYEA 5EDSA 1XO3A 1IUEA 3NVVA 1KLUD 4OVVA 2KWDA 2KDMA 1T3QA 5AUIA 2REXA 2O2VB 2QDFA 1OFFA 5BMGA 5TR5A 4JE3B 2JRHA 3AE3B 2KD0A 1ISNA 3MC8A 4MGZE 3RULA 3ZTDA 1JMLA 2D3CA 4WAFA 2HJ1A 4PYUA 4KDLB 3VVWB 4URKA 2ZPYA 3T3NA 2PVGC 4W9DA 1WH3A 4EEWA 3ZLZA 5LXIB 3GE3C 1FMAD 4I6LB 3HVZA 2MSED 1DOIA 2KC2A 2NR2A 2OHFA 1IPGA 4G0NB 1WMHA 1WR6E 3TUOA 3L0WB 5KHQA 3R7RA 1XLOA 2GBMA 3VTVA 1JWUD 2QEJC 3AI5A 3P4QB 3UQAA 1JROA 2AWTA 2WQYB 3U4EG 1ET9A 1SE4A 3AH7A 1WXSA 4DQOC 1WJUA 2MBHA 1IBXA 2J53A 3U7ZA 5E6NA 1FD6A 1L6UA 2RDHA 3RZWC 1SIFA 2K25A 2N4FA 2KX3A 1K52A 2IDYA 3M62B 4MM3B 5D94A 3CSFA 2FCMA 3KH0A 1PDXA 2EMTA 4ZRKA 3T3OA 3ZDTA 1QQRA 3PO0A 2J42A 3ZRCA 2ZJDA 4EZLA 1RFKA 4NJ6A 1GJZA 3X0WA 4ZRJA 2M56B 3DOWA 2G45B 3ZJUA 3N1ZC 2J0JA 3BINA 4O1NA 2DYMA 3DHHC 3KVFB 2CHXA 5CHVC 4PS8A 1OTRB 2CJNA 1OQYA 2ZW1A 2KZRA 2WXJA 1E8ZA 3PZ8A 3JSVB 2MW5A 2GRIA 2VH2A 3MC9A 3SU8X 2J0KA 4K81A 4OW0A 2X8XX 2Y3AA 1Y56A 1XCQL 5AUKA 3B2GA 4AQ7A 2CS4A 2KN5A 3UIPB 1SE2A 1H4RA 2XK5A 3QJZA 2KTFA 3FC4A 2N9LA 3ZJTA 1UELA 1YX6B 2N0SB 4W9FA 3HVDA 1TY2A 5IP4D 2SEBD 1GB4A 2ASQA 1A5RA 1UD7A 2BVCA 2IZVB 1UNSA 3NVZA 3M95A 3URYA 1V81A 2IGGA 2J0MA 4XDCA 4LNOA 1V6EA 4FHJA 3PRMB 3E9SA 1TZ1A 1ZDVA 3A4SC 4KSLC 2DHZA 1QOFA 1F2RC 1P7FA 2ONQA 1NBFC 5BYRA 3S2AA 2V4LA 4WJQA 5JXVA 4AWJA 2JY6A 2Z8LA 2MBOA 3HUIA 1UGJA 2KMMA 1QF6A 4GXBA 3ZDMC 4HXDA 4AS1A 3AULA 4IC7B 1ZGUB 3DVNV 4R3DA 1QZEA 1ROEA 2KMAA 3KYCD 3GOEA 1P3QU 3W9CB 1ZXIA 2BGFA 2IGHA 3PTFC 3VDZA 2FIFA 2LHEA 4M01A 4GLSC 1I4PA 2W9NA 2KNBA 3AE2B 1E6EB 3ML8A 1J8CA 1N63A 4BVUC 2K5PA 4ANVA 5DPTA 2G9HD 4BOSC 2MJEA 1WZ0A 2O6VA 4M0WA 2OOBB 3R8BA 3H7SA 4A8XC 2QMTA 2JT4B 1E7VA 5CHFA 2IBIB 4ZRIA 3KWVA 2OEDA 4MSMB 1NYQA 5HKHA 2HTME 3MJ5A 2J4XA 4K1RB 5KHOA 3W2DA 2MP2B 2Y5PA 5JHAA 2WLBA 2K8HA 4GOCA 4OVZA 5FR3A 2WXMA 2WX0A 1FNUA 2WHIA 4EOYA 4GMVA 2Z0DB 3IHPC 3W5UB 3R2IA 3R7QA 1RYJA 1Y8RC 2M8SA 1WE7A 2UYZB 5D7GA 5JHBA 4GGQA 3V62A 3QIJA 2INDC 2DBYA 3LJ3A 3DCGA 2KKCA 4MJSA 4A55A 2RPQA 3MC0B 3LXFA 2KTRB 4RGTA 4BOZB 2L00B 3N32A 1FNVA 3UQBA 2YLMA 2JXXA 5IKCM 2IO2B 3PZ7A 4NAMA 4JPSA 4RH6A 2L52A 1VD2A 2MQJA 1PGBA 2R2QA 4RM8A 4N6EB 3RNCC 2ZCCA 4G3XB 2N9XA 4HVBA 2WXNA 3ZRFA 4ZOHC 1N61A 2JRIB 3A9JB 2XBBC 1UUPA 1ZW7A 2KQ7A 4FHKA 3ZNHB 4DXFA 1WXQA 1YJ1A 4WURA 4FADA 3VXWA 2GI9A 1VDVA 4YTMB 3NG0A 3ALBA 2AYOB 1JALA 4HPPA 1NYRA 4LNKA 4P16A 1ZOYB 4XE0A 2BKRB 2GOWA 3H9DA 4JLCA 1SGHA 2VRRB 5LLIA 3U30A 3H7PB 1UZXB 3LB8C 2M4NA 1Q0WB 4ZRQA 4RF1A 4ZRPA 3OJ3A 1P7EA 3Q6BA 2LGIA 3LYYA 1N6ZA 1GC7A 4XDDA 2KFJA 2N9EB 2LEKA 1ZPSA 1VJKA 2V9HA 3NRZA 3GE8C 4ARIA 1KH0A 2JU6X 2MH7A 3WALA 3JVZX 3Q2AC 4KZ0A 1WSPA 4HDOA 2JUOA 4OVUA 3EA6A 2NBVB 2G4DB 4W9EA 1WXAA 4GDKB 5D3DA 1R4NI 1G6JA 1WIAA 1N60A 1WMHB 4XWWA 2L83A 3P4RB 4NPNA 1FCCC 1NEKB 2K6QA 5D2MB 3ZNID 4MT5A 2KWCA 1VRAB 1IBXB 3B08A 4W9LA 4YTPB 4WJPA 3ONSA 1PGAA 4IWPA 1GOZA 1V8CA 3TEWA 1SE9A 3TBLD 1I4GA 1D4BA 3AU4A 1J19A 1SE3A 3RNGC 3V61A 5LXHA 2WDTB 4DXGA 2TSSA 5BMIA 4RGOS 1QOBA 2H89B 1RAXA 2RDGA 2DAJA 1FRRA 1L4DB 1YQ3B 4NAWA 2N1VA 1VZ6A 1K51A 3ABVB 5I4DA 3I63C 1D5XC 1LXDA 3U2SC 3P63A 4B95A 3VRAB 5HHDG 1FXTB 2CU1A 4B6WA 5G55A 2NPTA 4IWOA 2LASA 3V6EB 3QHTA 3TEXA 3CWIA 4P7IA 1IGCA 3RN9C 2RGFA 2M17A 1D6EC 4BAXA 3ENEA 4BFRA 2QJLA 1S1QB 4II3B 2JQRB 2WDRB 3HHMA 3N9YC 2RD0A 1TZOA 3LDZE 1WYGA 4C7YA 3ZJVA 2XK5B 5FKAC 3PRZA 1M4VA 1HZ5A 2GBJA 2W55A 3AEGB 3D32A 3QCAA 2D10A 3AE4B 4DDGD 3A9KA 4CYEA 4G50A 2BF8B 1AARA 3MHSD 3Q8FA 1JCKB 1FXAA 3SHQA 1MG4A 2L7RA 1J7BA 1SJHD 1WJ4A 3AMZA 2KX0A 3ZKJC 3RUIB 2EELA 3M3JA 2NCNA 3PSEB 1HA5A 3SFDB 3BIID 2LUMA 3IXSA 5BO4B 2JX5A 2L76A 2C7MB 2WDQB 5DPWA 3WIMA 1Q5WB 1SB3C 1JW9D 3U8ZA 1TGZB 4PK1A 2WXGA 4S17A 3TL5A 4ZYSA 2JZPA 2PIAA 2WWZA 3AN1A 2V3NA 4LJOB 2FCSA 4RM9A 2ZNVC 2INCC 3RPFC 2UWQA 3BZDB 3A1QA 3AE9B 4ASWC 3P4PB 1EF1A 2L32A 2WS3B 3GZNI 3QA8A 1EU3A 1R4MB 3VRBB 2AEHA 2BW2A 4TV3A 1BMLC 2NBWB 3RD2A 4M0WB 3EFCA 1WGHA 1WGYA 3DVNU 4KZCA 3NVYA 1CQVA 4A6QA 4N58A 1X1MA 4PT5A 2PW9A 1YIWA 4ANWA 1E8YA 5AZHA 2K0PA 2ON8A 2V1YA 1CK1A 4ANXA 2FBWB 2Z0EB 4US8A 1WYWB 1XT9B 1CJEA 5DPRA 4MH0E 4MGYE 1P98A 2MWSB 4MELA 3K9PB 4FBJB 3I57A 1D3ZA 1PFDA 1GNUA 4KGRA 2WP9B 1YJIA 1BXTA 1H8CA 1STEA 3RNEC 4RCOA 3AU5A 4MJSB 5C1ZA 4AJWA 3TEZA 1WY8A 5BYSA 1V97A 2ZCBA 1V5OA 1FNWA 4NQLB 4E71A 2PKOA 1AN8A 5TSSA 3NS8A 4IM2A 3UINB 2KN4A 3DHGC 3T8MA 1LFDA 1SJED 1EO6A 4X57B 1SSNA 4YL8A 5HFYA 3O65B 3SEBA 2J52A 3H6NA 2O6VD 4YWGG 3Q8CA 1V80A 2XNAC 2BT6A 3RYTA 2RDBC 1C4PA 3MP9A 4L1BA 3EFUA 3NJTA 4PYZA 3ML9A 2JWZA 4FJVB 2D11A 2BS4B 3L13A 1KLGD 3R2TA 3Q8EA 4WWMA 2LGXA 3DBHB 1WI0A 1TYGB 4C7ZA 3OG5A 3DPDA 2LWPA 2DYBA 1M94A 2XEWA 1YNTE 2NVUI 4A20A 5IN7A 4JX1C 2I1KA 4S0RA 3VH4B 4YSYB 2DNFA 2K22A 4P1BC 1WX7A 1TS2A 3B1LX 2FCNA 1VZ7A 1K53A 2UU7A 1PYWD 1S3SG 2MLBA 4N59A 2E6XA 4OHJA 4IOIE 4HWIB 3VQIA 2BQQA 1FEHA 1ACCA 3AEDB 3H8HA 1L5PA 3SR6A 1I42A 3FKYA 2FIDA 2MJ3A 4IM0A 2BYTA 1RRBA 1RWSA 2JYEA 2K6DB 4ICVA 3V3XA 1HEZE 4JGHB 3BYYB 4BKTA 2KVZA 4G11A 4NQKE 4N9F4 2KJ6A 1KLVA 4ARCA 2OJRA 2B76B 1F9JA 4HJGE 1QILA 5EE0A 4XZ4A 2PJHA 2WXRA 5T8IA 4OZBA 3RNFC 1TS3A 1K50A 4K7WA 1E8WA 1GPXA 1V1PB 4ICUA 2MEKA 2QIEB 2IO3B 3KUDB 1P9DU 2BBCA 3IBEA 2WXLA 3BYTB 4KKJA 4H2AA 3BY4B 2Y5CA 1GB1A 3APDA 5C23A 2KT7A 3BVMA 2KC1A 1HE8A 4HCPB 2W3SA 4M8NA 2E3TA 2KDBA 5L95C 1WGRA 3VR8B 2WXPA 3MJWA 3P2BA 3ZYYX 5DPSA 2DENB 2I38A 2NPTB 2QSDA 3IAM1 3C8YA 5FK9C 3IVFA 2L1AA 4DHZE 3ZXVA 1XLNA 2CKHB 2LVQA 3OLMD 2AL3A 3W1YA 1Z2MA 2BYVE 1SEBD 1V9JA 2MX2A 5EE9A 2RSUA 1E0ZA 3V6CB 3DBLB 3AECB 3KW5B 3RCZA 2HTHA 1UWXA 2DZJA 3NUHB 3L4PA 4IKGA 5CX3A 2RPVA 3A9KB 2KACA 3IAS1 2LJ5A 2R2OA 3V05A 3NY5A 3GP7A 2I2YA 2IO0B 3EHVA 1EWYC 4I6PA 4NJCA 4MACA 2OJWA 4EZKA 4LCDE 1Z5SB 2JYTA 2CHWA 4IG7B 4NZLB 1DYQA 4RGMA 1K8RB 3A4RA 1E10A 2HD5B 5HI1A 2GBRA 3PVLA 4MH8A 1T5XD 3DWGC 5H8YE 3NOBA 1KJTA 2BPSA 2HE7A 2LVOA 1OGWA 2N7EA 1VZ8A 4FJZA 3N3KB 2L3ZA 3BWUD 3R66C 1TKYA 3RMKC 3HK0A 3TMPB 4KV2A 4ZHPA 2MBQA 2KLCA 1UGMA 5DCNA 4MSQB 3Q14C 4C4VA 1C77A 4D2KA
chains in the Genus database with same CATH topology
3CWIA 1FFVA 5EE1A 1XO3A 1IUEA 1IGCA 1KLUD 3NVVA 5C3JB 1D6EC 1SF0A 2KWDA 2KDMA 1T3QA 2W3RA 5AUIA 2QJLA 4UDUC 2FUG1 3GS2A 1OFFA 5BMGA 2JQRB 5BMHA 1FXIA 2WDRB 4JE3B 1N5XA 3N9YC 3AE3B 1TS4A 1TZOA 1WYGA 4C7YA 2NMQA 3AV8A 4NAWB 3WCQA 3ZJVA 1QLBB 3P1MA 4RNAA 5FKAC 1JMLA 4WAFA 3E56A 1M4VA 1HZ5A 1MI0A 2W55A 3AEGB 3GB1A 2ICIA 3AE4B 3T3NA 2CJOA 2PVGC 1NENB 2LHDA 1XCTL 3O13A 1FMAD 2JSVX 2IJ0A 1C78A 3Q8FA 1JCKB 4KGSA 3HVZA 1DOIA 1FXAA 2OHFA 3TUOA 2HDEA 4TSSA 1J7BA 1XLOA 4ZHOA 1JWUD 1SJHD 2N9KA 2CU3A 2QEJC 3AMZA 3P4QB 4HKZE 3W5VB 1JROA 2WQYB 3U4EG 4DQOC 1ET9A 1SE4A 3AH7A 2V3PA 1L6VA 4HRSA 2Q5WD 2EELA 4J3OD 1IBXA 1L0VB 2DLBA 1R7SA 2J53A 5G5GA 3U7ZA 1L0YB 1FD6A 1HA5A 1L6UA 1ZDXA 2M0AA 3SFDB 3BIID 2LUMA 2RDHA 2BS2B 1JWAD 3IXSA 4B0MA 3AE5B 1K52A 2IDYA 1MVKA 4MM3B 2JX5A 2PLPA 3BVZA 3U52E 2WDQB 4LTUA 1PDXA 1NVID 3T3OA 1QQRA 3PO0A 1SB3C 2J42A 5EE3A 2YEPF 1AWDA 4C56C 1JW9D 1RFKA 1YN5A 1A70A 1SBBB 3KQ4A 1DOYA 2M56B 2WXGA 4ZYSA 1C9FA 2JZPA 2PIAA 3AN1A 3ZJUA 1ZP0B 2V3NA 4IDIA 4O1NA 2DYMA 1FO4A 1I7HA 2WDVB 3RPFC 1B1ZA 3BZDB 2CJNA 3AE9B 3P4PB 2ZW1A 1E7PB 4L2YA 2L32A 1GAQB 1WWTA 2NTSA 2WXJA 2WS3B 1FCLA 1HQRD 2JXTA 2KAJA 3PZ8A 3B9JA 2GRIA 1EU3A 3VRBB 2BW2A 2PMVA 1ZE3D 1BMLC 5D3IB 4OW0A 2Y3AA 1Y56A 2K9XA 1XCQL 1OQQA 1YMHE 4WQMA 1JWMD 1SIJA 3NVYA 2DWQA 1CQVA 1D5ZC 3B2GA 2PTLA 4N58A 5AUKA 4A9AA 4PT5A 4A6QA 4AQ7A 2PW9A 2N7JA 3AEEB 3DWMA 1SE2A 1QOGA 1ESFA 3FC4A 2K0PA 2N9LA 3NS1A 3ZJTA 2N0SB 1I4RA 2ON8A 3HVDA 1CK1A 1B9RA 1DGJA 1I4QA 1TY2A 2FBWB 2SEBD 1GB4A 4US8A 1CJEA 3TSSA 5G5HA 1JWSD 4KKIA 1V1OA 1UNSA 3NVZA 3AEBB 3URYA 2WNMA 2IGGA 4XDCA 1JQ4A 1PUTA 1EWCA 2SAKA 3I57A 2W54A 1FM0D 4YSXB 1QKZA 1PFDA 1N5WA 3E9SA 2WP9B 1ZDVA 4KGRA 4US9A 1YJIA 4HKQA 1BXTA 5HG2A 1STEA 4RCOA 1QOFA 1F2RC 1P7FA 2ONQA 1F2RI 3EUB2 1JRPA 5BYRA 3TEZA 5BYSA 1V97A 5LNK1 2WXIA 1TKEA 5JXVA 1FNWA 1EU4A 1XF5L 2PKOA 1AN8A 2Z8LA 5BYQA 2YEPB 5TSSA 4REZA 3AB5A 3BK2A 3HUIA 1UGJA 2KMMA 3OWEB 1QF6A 2KN4A 4WH4A 4AS1A 1ZXHA 1SJED 1WGKA 3AE6B 3ETRA 4FXCA 4R3DA 1ROEA 1SSNA 5HFYA 3SEBA 2J52A 3RFZB 3W9CB 1ZXIA 4LK0M 2IGHA 4YWGG 3Q8CA 2LHEA 4GLSC 2XNAC 1I4PA 2BT6A 1C4PA 1UWMA 3MP9A 4L1BA 3AE2B 1HXYD 1E6EB 4LLGM 1N63A 2K5PA 4USAA 2AQ1B 1TJEA 2G9HD 1C4CA 1ENFA 1QOAA 2R61A 2MJEA 4XWTA 2BS4B 1KLGD 1KFYB 3R2TA 3Q8EA 4WWMA 1KF6B 1MHHE 2D5GA 2FE8A 4M0WA 2ZW0A 1TYGB 4C7ZA 3AM9A 1C4AA 3R8BA 4A8XC 2QMTA 3KWVA 2OEDA 1NYQA 2HTME 3MJ5A 1YNTE 2V4IB 4JX1C 4OZCA 2J4XA 2BS3B 2WXFA 4YSYB 2Y5PA 3W2DA 2K22A 2WLBA 1I4XA 1TS2A 4OVZA 1VZ7A 1K53A 5FR3A 2WXMA 1PYWD 1IGDA 3FAHA 4N59A 1FNUA 1YQ4B 2E6XA 4OHJA 5C2TB 4IOIE 3VQIA 3KWLA 1XXGA 3W5UB 1FEHA 1ACCA 1VR9A 3AEDB 3H8HA 1L5PA 1RM6C 2MJDA 3SR6A 3R2IA 2X38A 3Q8BA 4RF0A 1OQRA 1RYJA 1XLQA 2MJ3A 3B2FA 5D7GA 2BYTA 4JWUC 1QT9A 1F0ZA 1RWSA 2DBYA 2JYEA 3BVGA 4A90A 1YN4A 1T6BX 1V1PA 3V3XA 4A55A 1N62A 1HEZE 3MC0B 3P42A 1J7CA 3BYYB 2V0GA 4TQ1A 1ET6A 1TS5A 3LXFA 5H92C 4RGTA 3AE1B 2H88B 4ARCA 2B76B 2GB1A 1XEEA 4HJGE 1FNVA 1QILA 1TKGA 5EE0A 2WXRA 5T8IA 2M19A 1F77A 3PZ7A 4OZBA 4P6VF 4NAMA 4KGTA 4JPSA 4L23A 2L52A 4RH6A 5MPOA 2RMMA 1PGBA 1TS3A 4N6EB 1K50A 4TQ0A 4ITKA 2WU2B 1BUIC 2IGDA 1V1PB 1GPXA 2JWUA 1I4HA 2WXNA 2MEKA 1C76A 2QIEB 4ZOHC 1JWBD 1N61A 2BB6A 2BTEA 1UUPA 3AEAB 1PGXA 2BBCA 2WXLA 4DXFA 3BYTB 3EGRA 1WXQA 4KKJA 4H2AA 4WURA 2Y5CA 1GB1A 4EE2A 3IT6B 1MHXA 5GXGB 1SXTA 3NZ3A 2GI9A 4RFBA 1VDVA 3BVMA 4YTMB 1JALA 2W3SA 1NYRA 3BK1A 2K3UA 1ZOYB 2W82A 3FILB 2E3TA 4P16A 4XE0A 1WRIA 4TMAB 3VR8B 1YN3A 2AQ2B 2NTTA 2WXPA 3ZYYX 3AE8B 2WU5B 2I38A 1LO5D 3LB8C 2VZKD 2QSDA 3IAM1 4ZRQA 3C8YA 5FK9C 4RF1A 2L1AA 4ZRPA 1AYFA 1XLNA 4RGNA 1P7EA 2LGIA 1XLPA 3LYYA 3AE7B 4XDDA 1FFUA 1NI3A 1SEBD 2LMCA 4OZAA 1D5MC 2G1EA 2LEKA 5EE9A 1J7AA 3Q69A 2ACZB 4C80A 1ZPSA 2AX5A 1VJKA 1E0ZA 3NRZA 2WXHA 4ARIA 3AECB 1KH0A 2JU6X 2MH7A 5E6JA 2QILA 1C79A 4YTNB 1UWXA 1ZUD2 3NUHB 3L4PA 1WSPA 1CZPA 4IKGA 2RPVA 4WIPA 1YJJA 3EA6A 2KACA 3IAS1 4GDLB 1HZ6A 3V05A 1E9MA 3TEYA 3GP7A 4GDKB 1L4ZB 5D3DA 2I2YA 3Q8AA 2INNE 1N60A 3KLSX 1EWYC 2AQ3B 4NJCA 2IPKD 4XWWA 2L83A 3P4RB 1AW7A 1KRHA 3I9V1 1VLBA 4YT0B 4MACA 2PVOD 1FCCC 2XN9C 2LJIA 2JYTA 1NEKB 3VR9B 2WXKA 4MT5A 2EKIA 1VRAB 3MHZA 1DYQA 4NZLB 4RGMA 1IBXB 3ZGZA 4YTPB 1E10A 2VZKB 1KTKA 1PGAA 1EM7A 3HRDD 3NVWA 5HI1A 1GOZA 1V8CA 3TEWA 1I4GA 1TY0A 1DOXA 1D4BA 4HEA1 2WXQA 4MH8A 1SE3A 1T5XD 1MPEA 3DWGC 5H8YE 3W1SA 4CQNA 4KX6B 3UI3A 2WXOA 2TSSA 3MFGA 2LFIA 4HROA 1L0XB 4RGOS 4DXGA 5BMIA 1QOBA 4YSZB 1VZ8A 1FIQA 2H89B 3CIRB 1Q10A 2RDGA 3BWUD 2BB5A 1FRRA 1L4DB 1TKYA 1YQ3B 1VZ6A 1K51A 3ABVB 3FILA 3ZQ4A 4B0EA 5I4DA 1D5XC 3AEFB 3IT4B 4ZHPA 3U2SC 3P63A 3VRAB 2KQ4X 5HHDG 4JWSC 3J9CA 4Q2JA 1FRDA 3SFEB 2DYOA 4YXDB 3P4SB 2INPE 1C77A 3TEXA 4D2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  1NYQ A;  3LB8 C;  2HTM E;  3CWI A;  1FFV A;  1OQQ A;  1XO3 A;  1IUE A;  3NVV A;  5EE1 A;  4JX1 C;  4WQM A;  1SIJ A;  3NVY A;  5C3J B;  1AYF A;  1SF0 A;  1XLN A;  2DWQ A;  3B2G A;  2BS3 B;  4N58 A;  1T3Q A;  2W3R A;  4YSY B;  5AUI A;  2K22 A;  4A9A A;  2QJL A;  2WLB A;  3AEE B;  3DWM A;  1XLP A;  1OFF A;  3AE7 B;  2JQR B;  1FXI A;  1QOG A;  2WDR B;  1FFU A;  1NI3 A;  1N5X A;  3FC4 A;  3AE3 B;  2G1E A;  3NS1 A;  1WYG A;  2N0S B;  2LEK A;  4C7Y A;  5EE9 A;  3AV8 A;  3WCQ A;  1J7A A;  2ACZ B;  1QLB B;  3FAH A;  3P1M A;  4N59 A;  1DGJ A;  4C80 A;  1YQ4 B;  2AX5 A;  1B9R A;  1VJK A;  5C2T B;  1E0Z A;  3NRZ A;  2FBW B;  3AEC B;  2MH7 A;  3KWL A;  4US8 A;  3W5U B;  3AED B;  2W55 A;  1L5P A;  1RM6 C;  2MJD A;  1CJE A;  3AEG B;  4YTN B;  3SR6 A;  3AE4 B;  2CJO A;  2PVG C;  1NEN B;  1ZUD 2;  5G5H A;  1OQR A;  1RYJ A;  3L4P A;  1XLQ A;  3NVZ A;  3AEB B;  2MJ3 A;  1CZP A;  3B2F A;  1FMA D;  4JWU C;  1JQ4 A;  1PUT A;  1YJJ A;  1QT9 A;  2W54 A;  1FM0 D;  4YSX B;  1F0Z A;  1PFD A;  3HVZ A;  1DOI A;  1FXA A;  1N5W A;  1RWS A;  2DBY A;  2OHF A;  4US9 A;  2WP9 B;  1YJI A;  1E9M A;  1J7B A;  1N62 A;  1XLO A;  4ZHO A;  3W5V B;  1QOF A;  2CU3 A;  1N60 A;  1J7C A;  1EWY C;  3AMZ A;  3P4Q B;  1JRO A;  2L83 A;  2WQY B;  3P4R B;  1KRH A;  3AH7 A;  1VLB A;  3EUB 2;  1L6V A;  4HRS A;  1JRP A;  2Q5W D;  3LXF A;  2PVO D;  5H92 C;  1L0V B;  1V97 A;  1NEK B;  1R7S A;  5G5G A;  3AE1 B;  1TKE A;  3VR9 B;  1L6U A;  5AUK A;  2PKO A;  3SFD B;  2H88 B;  2EKI A;  3BII D;  2B76 B;  2BS2 B;  3AB5 A;  3HUI A;  4YTP B;  1E10 A;  1JWA D;  1TKG A;  2KMM A;  5EE0 A;  3AE5 B;  1QF6 A;  3HRD D;  2M19 A;  3NVW A;  2JX5 A;  1WGK A;  4P6V F;  1V8C A;  3AE6 B;  3ETR A;  4FXC A;  1ROE A;  2WDQ B;  4LTU A;  2L52 A;  1PDX A;  1DOX A;  1NVI D;  5MPO A;  4N6E B;  3W9C B;  1ZXI A;  3DWG C;  5H8Y E;  3PO0 A;  1SB3 C;  4ITK A;  5EE3 A;  2WU2 B;  1AWD A;  4KX6 B;  1GPX A;  1JW9 D;  1RFK A;  4HRO A;  2BT6 A;  1A70 A;  1UWM A;  2QIE B;  4ZOH C;  1DOY A;  2M56 B;  3AE2 B;  1JWB D;  1N61 A;  1QOB A;  4YSZ B;  1E6E B;  1FIQ A;  2H89 B;  3CIR B;  2PIA A;  3AN1 A;  1N63 A;  3AEA B;  1ZP0 B;  2K5P A;  4USA A;  4IDI A;  1TJE A;  1WXQ A;  1FRR A;  1QOA A;  1TKY A;  1YQ3 B;  2Y5C A;  1FO4 A;  1I7H A;  2WDV B;  3RPF C;  2MJE A;  3ABV B;  4YT0 B;  2BS4 B;  2CJN A;  3AE9 B;  3AEF B;  3P4P B;  5GXG B;  1E7P B;  1KFY B;  4ZHP A;  1GAQ B;  1WWT A;  1VDV A;  4YTM B;  2WS3 B;  3P63 A;  4WWM A;  1JAL A;  1KF6 B;  2KAJ A;  1NYR A;  2W3S A;  3B9J A;  3VRA B;  1ZOY B;  2E3T A;  4JWS C;  1WRI A;  1TYG B;  4C7Z A;  1FRD A;  3SFE B;  3VRB B;  3AM9 A;  3VR8 B;  4YXD B;  3P4S B;  3ZYY X;  3AE8 B;  2WU5 B; 
#chains in the Genus database with same CATH topology
 1SF0 A;  1HTQ A;  2FUG 1;  1FXI A;  2ZPN A;  1MFW A;  3PRP B;  1TS4 A;  3WCQ A;  2KDF B;  1QLB B;  4RNA A;  1RLF A;  1MI0 A;  3GB1 A;  2ICI A;  2CJO A;  4JIO U;  4MM3 A;  3TIX A;  3RNA C;  2JSV X;  1UBI A;  2IJ0 A;  1C78 A;  1UF0 A;  4KGS A;  1TT5 B;  4W9K A;  2HDE A;  4TSS A;  1P0R A;  4ZHO A;  2CU3 A;  4HKZ E;  3U7D A;  4A3P A;  3PZD A;  1WM3 A;  2KDE B;  2IYD B;  1R7S A;  2L0T A;  1L0Y B;  1E90 A;  1ZDX A;  2M0A A;  4WAA A;  4FA6 A;  2N9P C;  2JZ3 B;  1JWA D;  4B0M A;  3AE5 B;  1MVK A;  2PLP A;  4HJK A;  3JYU A;  3BVZ A;  3U52 E;  3DVG X;  3VUW A;  5EE3 A;  2YEP F;  1AWD A;  4C56 C;  4K3C A;  1T0Q C;  3CF6 E;  1YN5 A;  1A70 A;  3KQ4 A;  1V5T A;  2KMC A;  1LM8 B;  3OJ4 B;  1C9F A;  4LNF A;  2KVR A;  4W9G A;  3ZUN A;  1UBQ A;  1ZP0 B;  5GMV A;  4IDI A;  1FO4 A;  4GN1 A;  2WDV B;  1B1Z A;  1Q1O A;  3PGE A;  1E7P B;  4L2Y A;  1GAQ B;  2NTS A;  3B9J A;  4LJP B;  4F8C B;  2C7N B;  1NDD A;  2PMV A;  1ZE3 D;  5D3I B;  1YD8 U;  1MG8 A;  5J18 A;  2K9X A;  1WFY A;  4WQM A;  1JWM D;  1C3T A;  2DWQ A;  3TJP A;  1D5Z C;  4A9A A;  2DX5 B;  1TTN A;  1QOG A;  2NBU A;  4J6I A;  3L17 A;  3NS1 A;  1I4R A;  1B9R A;  1DGJ A;  2BWF A;  2A5U A;  2JF5 A;  3TSS A;  5G5H A;  4KKI A;  2LVP A;  2RR9 A;  3APC A;  5J2R A;  2WNM A;  1PUT A;  2SAK A;  1WGD A;  2W54 A;  1FM0 D;  4YSX B;  1QKZ A;  1WZ3 A;  1KM7 A;  2G3Q B;  1UH6 A;  4HKQ A;  1TBE A;  2ZVO A;  4M00 A;  1F2R I;  2N7D A;  3EUB 2;  1JRP A;  2Z59 B;  1TKE A;  1EU4 A;  5BYQ A;  2YEP B;  4REZ A;  2KDI A;  1CMX B;  1WGG A;  3OWE B;  5JZE B;  2IO1 B;  2C5L C;  4WH4 A;  4NJ7 A;  3ETR A;  4FXC A;  4XYC A;  3VUX A;  5CTR C;  2LGS A;  3ECI A;  1UWM A;  2KOX A;  2CR5 A;  3N30 A;  1HXY D;  3UIO B;  1WJN A;  2JZZ A;  2AQ1 B;  1C4C A;  1ENF A;  1NI2 A;  2R61 A;  3NZS A;  2EKE C;  2PPH A;  5D6J B;  1GUA B;  1KF6 B;  1MHH E;  2D5G A;  2FE8 A;  2L8J A;  2ZW0 A;  3AM9 A;  2KK8 A;  3N20 C;  1RFA A;  3C19 A;  1IYF A;  5CHW A;  4KSK C;  2BS3 B;  2WXF A;  4EUT A;  2AL6 A;  1XD3 B;  5AZG A;  2BWE S;  1R4M I;  4TUU A;  1LQB A;  3VTU A;  2KQS A;  3FAH A;  5C2T B;  3KWL A;  1XXG A;  2O6V B;  4IUM B;  3SDL C;  2G4S A;  3Q3J A;  1OQR A;  4RF0 A;  4DHJ D;  3B2F A;  2QCZ A;  2KHW B;  2MHJ A;  1WX8 A;  2KJH B;  2C9W B;  2WGS A;  5E6O A;  1F0Z A;  3V60 A;  3Q3O C;  3BVG A;  1PQS A;  1T6B X;  3DBR B;  1N62 A;  4DXA B;  1L2N A;  1J7C A;  1WXM A;  4TQ1 A;  3RNB C;  5H92 C;  4W9J A;  2H88 B;  2D3A A;  2GB1 A;  4KIK A;  1XEE A;  4CHK A;  5AEK B;  1TKG A;  3IFW B;  2M19 A;  4P6V F;  2GLS A;  3C0R B;  2I1J A;  4L23 A;  2RMM A;  2FUH B;  1T0Y A;  3NZU A;  4TQ0 A;  2WU2 B;  3N1X C;  2JWU A;  4HLE A;  1I4H A;  1C76 A;  4HPM B;  4M8M A;  1JWB D;  2BB6 A;  2EMS A;  3AEA B;  1PGX A;  2IY1 B;  3PHX B;  2KWV B;  4ACF A;  2CHZ A;  3KYD D;  3IT6 B;  1MHX A;  5GXG B;  1SXT A;  1KOT A;  3NZ3 A;  4WWN A;  3A33 B;  2DZK A;  2PE9 A;  2W82 A;  3VFK A;  2D3G A;  4TMA B;  4XX5 A;  4PS7 A;  1YN3 A;  2AQ2 B;  4MGK E;  3AE8 B;  4BBN F;  2WU5 B;  1LO5 D;  3N1Y C;  2VZK D;  4C4V B;  1AYF A;  4RGN A;  3PPA A;  4GDK A;  1XLP A;  3DBH I;  3AE7 B;  4XGA B;  1FFU A;  4OZA A;  2WX1 A;  4HCN B;  2ACZ B;  3SD5 A;  2AX5 A;  2WXH A;  4E3C A;  5E6J A;  2QIL A;  4A3O A;  1C79 A;  1YOV B;  2GMI C;  4YTN B;  1C1Y B;  4JQW C;  1ZUD 2;  2N1W A;  1CZP A;  3I5J C;  3APF A;  4WIP A;  1HZ6 A;  1E9M A;  1WXV A;  2B3A A;  3DVG Y;  3TEY A;  3Q8A A;  4WWO A;  3KLS X;  1AW7 A;  4F1S A;  1VLB A;  2PVO D;  2M1M A;  2XN9 C;  2D07 B;  1GG3 A;  2EKI A;  3MHZ A;  3VAW A;  3WAM A;  3UGB B;  4DHZ B;  1OEY J;  3L08 A;  3DDC B;  4EKU A;  1KTK A;  1EM7 A;  3HRD D;  3KUC B;  1TY0 A;  1E7U A;  1DOX A;  2LGY A;  4HEA 1;  2WXQ A;  3Q3M C;  3ZTC A;  3W1S A;  2JPH A;  4KX6 B;  3UI3 A;  2WXO A;  4HRO A;  3EC8 A;  2LXC A;  2DAF A;  4JL9 A;  3L16 A;  4YSZ B;  3CIR B;  1Q10 A;  1U4A A;  4DK5 A;  4ANU A;  2BB5 A;  3FIL A;  3ZQ4 A;  4B0E A;  4GIV A;  3VH3 B;  3AEF B;  5L83 A;  4FLH A;  2LRW A;  4AUQ C;  3W1S C;  4C00 A;  1HTO A;  2C60 A;  4JWS C;  4CO7 A;  1WRD B;  4Q2J A;  1FRD A;  2DYO A;  4YXD B;  3P4S B;  3Q3N C;  2INP E;  3QQ8 B;  1BT0 A;  1FFV A;  5EE1 A;  3RZF A;  5C3J B;  2BKF A;  5JH5 C;  3PRE A;  2DZM A;  2W3R A;  5IOI A;  4UDU C;  3GS2 A;  5BMH A;  1MJD A;  1N5X A;  5FR6 A;  2NMQ A;  3AV8 A;  4NAW B;  2IY0 B;  3UF8 A;  3P1M A;  3DQV A;  1L7Y A;  3E56 A;  4DDI D;  1NEN B;  2LHD A;  3HM6 X;  1XCT L;  4KDI C;  3O13 A;  2A4Z A;  4GDL A;  4I6N B;  3DBS A;  4W9I A;  4FJY A;  3X23 A;  2KFK A;  3DBL I;  1V49 A;  2N9K A;  3W5V B;  3QX1 A;  1WR1 A;  4HRS A;  2V3P A;  1L6V A;  4J3O D;  2Q5W D;  4QAY A;  1L0V B;  2DLB A;  5G5G A;  2BYF A;  4DWF A;  3VTW A;  4NNJ B;  2K1F A;  5IO9 A;  2BS2 B;  3NHE B;  4LTU A;  3QAR A;  1NVI D;  3QC8 B;  1LGR A;  3QK0 A;  1F52 A;  1SBB B;  3ZO5 B;  4M02 A;  1DOY A;  2MA9 B;  4RMA A;  1I7H A;  3ZXR A;  4AJY B;  3ZVV A;  2QHO A;  1WWT A;  2V3S A;  1FCL A;  1HQR D;  2JXT A;  2KAJ A;  3MTN B;  2KO3 A;  2GBN A;  2K8C A;  4GSW A;  2ZNV B;  3VHT C;  1OQQ A;  1YMH E;  3WA0 A;  5E6P A;  2O2V A;  1SIJ A;  2PTL A;  2N7J A;  3AEE B;  3DWM A;  3ZNG C;  4W9H A;  1ESF A;  3VUY A;  3IG3 A;  1I4Q A;  2ZEQ A;  3A1Q B;  2KJR A;  2KLG A;  2FCQ A;  1JWS D;  1V1O A;  3L54 A;  3AEB B;  1JQ4 A;  1EWC A;  2KXJ A;  1N5W A;  3WAO A;  4US9 A;  3PLU A;  3JW0 X;  5HG2 A;  2NS5 A;  3DHI C;  4WWP A;  4E74 A;  1IP9 A;  5LNK 1;  2WXI A;  3ZW3 A;  2D3B A;  1XF5 L;  3RI7 C;  3ZNZ B;  3AB5 A;  3BK2 A;  4MGI E;  4WJN A;  3PLV A;  2WYQ A;  1ZXH A;  4KVG B;  4KIK B;  1WGK A;  1YQB A;  3AE6 B;  2JVC A;  1P1A A;  2YVC A;  4K7U A;  3RFZ B;  4LK0 M;  1V2Y A;  4AOF A;  4LLG M;  1J0G A;  1E8X A;  4USA A;  3EEC A;  3WAN A;  1TJE A;  1I35 A;  1QOA A;  4WQO B;  4ZDV A;  1WJ6 A;  2LXA A;  3JSV A;  4F7Z A;  4XWT A;  1KFY B;  2L0F A;  4LDT B;  1T0R C;  1C4A A;  4DBG A;  3HM3 A;  4BKS D;  2V4I B;  4OZC A;  5IAA C;  2M0X A;  1I4X A;  1XQQ A;  3KUZ A;  4EFO A;  2L05 A;  1IGD A;  2MBE A;  4LNI A;  1YQ4 B;  5IA7 A;  2ZVN A;  2LGD A;  4XC2 A;  1VR9 A;  1R4N B;  1RM6 C;  2MJD A;  3TCA A;  4BBN C;  3HIZ A;  2X38 A;  3Q8B A;  2PE6 B;  1XLQ A;  3AXC A;  4JWU C;  2KWU B;  1QT9 A;  4GB9 A;  2ZZP B;  3OAW A;  4A90 A;  2C7H A;  1YN4 A;  1V1P A;  1T0S C;  3P42 A;  4K7S A;  2V0G A;  1ET6 A;  1TS5 A;  1VCB A;  2LUE A;  4FUL A;  4ZYN A;  3AE1 B;  4BKG A;  4FN2 A;  1WE6 A;  4K3B A;  1F77 A;  2LD9 A;  4KGT A;  3R3M A;  4LDT D;  5MPO A;  3CST A;  4PS3 A;  3RT3 B;  4ITK A;  2KAN A;  1BUI C;  1GC6 A;  2IGD A;  2BTE A;  2DZI A;  1WX9 A;  1ZKH A;  3WAP A;  3EGR A;  4NY0 A;  4DHJ B;  1WF9 A;  4EE2 A;  1YX5 B;  4RFB A;  3K9O B;  5G2N A;  3BK1 A;  3FIL B;  2K3U A;  2J7Q B;  1WRI A;  2NTT A;  2LZ6 A;  2D2Q A;  2QC8 A;  2MP2 A;  1OEY A;  4BZA A;  5J17 A;  1NI3 A;  2LMC A;  4AP4 C;  1D5M C;  2G1E A;  1WM2 A;  3CMM B;  1J7A A;  3Q69 A;  4C80 A;  4LNN A;  1JRU A;  3H1U A;  2LI5 A;  4TKN A;  3T9L A;  4MEM A;  2MCN B;  2Y5B B;  1YJJ A;  3PT2 B;  4GDL B;  3I3T B;  1L4Z B;  2KTR A;  2GBK A;  2INN E;  2KFK B;  2AQ3 B;  2IPK D;  4YT0 B;  1KRH A;  3I9V 1;  2KYW A;  4W9C A;  2K39 A;  2MRP A;  2LJI A;  4EZJ A;  3VR9 B;  2LRU A;  2PEA A;  4B9K A;  2WXK A;  4BKS A;  2VH1 A;  3ZGZ A;  4WJO A;  3DBR I;  3ZIM A;  2VZK B;  2FAZ A;  1EF5 A;  3NVW A;  3PHW B;  4IWQ A;  2FNJ B;  3Q3F A;  4II2 B;  5AZF A;  4IW0 A;  1MPE A;  3QAQ A;  4CQN A;  4HDQ A;  3A9J A;  3PS6 A;  3GZN B;  3MFG A;  2LFI A;  3PV1 A;  1L0X B;  2HJ8 A;  1FIQ A;  3M63 B;  1FPY A;  2MBB B;  2K8B A;  4HPL B;  1E5W A;  4HK2 A;  1F1H A;  1V86 A;  4MDK E;  4GU2 A;  1TIF A;  3IT4 B;  1EUV B;  4IM3 A;  4P1C C;  2KQ4 X;  3L10 B;  3B0A A;  3J9C A;  3SFE B;  3H7P A;  3QWZ B;  2BYE A;  5EDS A;  1XO3 A;  1IUE A;  3NVV A;  1KLU D;  4OVV A;  2KWD A;  2KDM A;  1T3Q A;  5AUI A;  2REX A;  2O2V B;  2QDF A;  1OFF A;  5BMG A;  5TR5 A;  4JE3 B;  2JRH A;  3AE3 B;  2KD0 A;  1ISN A;  3MC8 A;  4MGZ E;  3RUL A;  3ZTD A;  1JML A;  2D3C A;  4WAF A;  2HJ1 A;  4PYU A;  4KDL B;  3VVW B;  4URK A;  2ZPY A;  3T3N A;  2PVG C;  4W9D A;  1WH3 A;  4EEW A;  3ZLZ A;  5LXI B;  3GE3 C;  1FMA D;  4I6L B;  3HVZ A;  2MSE D;  1DOI A;  2KC2 A;  2NR2 A;  2OHF A;  1IPG A;  4G0N B;  1WMH A;  1WR6 E;  3TUO A;  3L0W B;  5KHQ A;  3R7R A;  1XLO A;  2GBM A;  3VTV A;  1JWU D;  2QEJ C;  3AI5 A;  3P4Q B;  3UQA A;  1JRO A;  2AWT A;  2WQY B;  3U4E G;  1ET9 A;  1SE4 A;  3AH7 A;  1WXS A;  4DQO C;  1WJU A;  2MBH A;  1IBX A;  2J53 A;  3U7Z A;  5E6N A;  1FD6 A;  1L6U A;  2RDH A;  3RZW C;  1SIF A;  2K25 A;  2N4F A;  2KX3 A;  1K52 A;  2IDY A;  3M62 B;  4MM3 B;  5D94 A;  3CSF A;  2FCM A;  3KH0 A;  1PDX A;  2EMT A;  4ZRK A;  3T3O A;  3ZDT A;  1QQR A;  3PO0 A;  2J42 A;  3ZRC A;  2ZJD A;  4EZL A;  1RFK A;  4NJ6 A;  1GJZ A;  3X0W A;  4ZRJ A;  2M56 B;  3DOW A;  2G45 B;  3ZJU A;  3N1Z C;  2J0J A;  3BIN A;  4O1N A;  2DYM A;  3DHH C;  3KVF B;  2CHX A;  5CHV C;  4PS8 A;  1OTR B;  2CJN A;  1OQY A;  2ZW1 A;  2KZR A;  2WXJ A;  1E8Z A;  3PZ8 A;  3JSV B;  2MW5 A;  2GRI A;  2VH2 A;  3MC9 A;  3SU8 X;  2J0K A;  4K81 A;  4OW0 A;  2X8X X;  2Y3A A;  1Y56 A;  1XCQ L;  5AUK A;  3B2G A;  4AQ7 A;  2CS4 A;  2KN5 A;  3UIP B;  1SE2 A;  1H4R A;  2XK5 A;  3QJZ A;  2KTF A;  3FC4 A;  2N9L A;  3ZJT A;  1UEL A;  1YX6 B;  2N0S B;  4W9F A;  3HVD A;  1TY2 A;  5IP4 D;  2SEB D;  1GB4 A;  2ASQ A;  1A5R A;  1UD7 A;  2BVC A;  2IZV B;  1UNS A;  3NVZ A;  3M95 A;  3URY A;  1V81 A;  2IGG A;  2J0M A;  4XDC A;  4LNO A;  1V6E A;  4FHJ A;  3PRM B;  3E9S A;  1TZ1 A;  1ZDV A;  3A4S C;  4KSL C;  2DHZ A;  1QOF A;  1F2R C;  1P7F A;  2ONQ A;  1NBF C;  5BYR A;  3S2A A;  2V4L A;  4WJQ A;  5JXV A;  4AWJ A;  2JY6 A;  2Z8L A;  2MBO A;  3HUI A;  1UGJ A;  2KMM A;  1QF6 A;  4GXB A;  3ZDM C;  4HXD A;  4AS1 A;  3AUL A;  4IC7 B;  1ZGU B;  3DVN V;  4R3D A;  1QZE A;  1ROE A;  2KMA A;  3KYC D;  3GOE A;  1P3Q U;  3W9C B;  1ZXI A;  2BGF A;  2IGH A;  3PTF C;  3VDZ A;  2FIF A;  2LHE A;  4M01 A;  4GLS C;  1I4P A;  2W9N A;  2KNB A;  3AE2 B;  1E6E B;  3ML8 A;  1J8C A;  1N63 A;  4BVU C;  2K5P A;  4ANV A;  5DPT A;  2G9H D;  4BOS C;  2MJE A;  1WZ0 A;  2O6V A;  4M0W A;  2OOB B;  3R8B A;  3H7S A;  4A8X C;  2QMT A;  2JT4 B;  1E7V A;  5CHF A;  2IBI B;  4ZRI A;  3KWV A;  2OED A;  4MSM B;  1NYQ A;  5HKH A;  2HTM E;  3MJ5 A;  2J4X A;  4K1R B;  5KHO A;  3W2D A;  2MP2 B;  2Y5P A;  5JHA A;  2WLB A;  2K8H A;  4GOC A;  4OVZ A;  5FR3 A;  2WXM A;  2WX0 A;  1FNU A;  2WHI A;  4EOY A;  4GMV A;  2Z0D B;  3IHP C;  3W5U B;  3R2I A;  3R7Q A;  1RYJ A;  1Y8R C;  2M8S A;  1WE7 A;  2UYZ B;  5D7G A;  5JHB A;  4GGQ A;  3V62 A;  3QIJ A;  2IND C;  2DBY A;  3LJ3 A;  3DCG A;  2KKC A;  4MJS A;  4A55 A;  2RPQ A;  3MC0 B;  3LXF A;  2KTR B;  4RGT A;  4BOZ B;  2L00 B;  3N32 A;  1FNV A;  3UQB A;  2YLM A;  2JXX A;  5IKC M;  2IO2 B;  3PZ7 A;  4NAM A;  4JPS A;  4RH6 A;  2L52 A;  1VD2 A;  2MQJ A;  1PGB A;  2R2Q A;  4RM8 A;  4N6E B;  3RNC C;  2ZCC A;  4G3X B;  2N9X A;  4HVB A;  2WXN A;  3ZRF A;  4ZOH C;  1N61 A;  2JRI B;  3A9J B;  2XBB C;  1UUP A;  1ZW7 A;  2KQ7 A;  4FHK A;  3ZNH B;  4DXF A;  1WXQ A;  1YJ1 A;  4WUR A;  4FAD A;  3VXW A;  2GI9 A;  1VDV A;  4YTM B;  3NG0 A;  3ALB A;  2AYO B;  1JAL A;  4HPP A;  1NYR A;  4LNK A;  4P16 A;  1ZOY B;  4XE0 A;  2BKR B;  2GOW A;  3H9D A;  4JLC A;  1SGH A;  2VRR B;  5LLI A;  3U30 A;  3H7P B;  1UZX B;  3LB8 C;  2M4N A;  1Q0W B;  4ZRQ A;  4RF1 A;  4ZRP A;  3OJ3 A;  1P7E A;  3Q6B A;  2LGI A;  3LYY A;  1N6Z A;  1GC7 A;  4XDD A;  2KFJ A;  2N9E B;  2LEK A;  1ZPS A;  1VJK A;  2V9H A;  3NRZ A;  3GE8 C;  4ARI A;  1KH0 A;  2JU6 X;  2MH7 A;  3WAL A;  3JVZ X;  3Q2A C;  4KZ0 A;  1WSP A;  4HDO A;  2JUO A;  4OVU A;  3EA6 A;  2NBV B;  2G4D B;  4W9E A;  1WXA A;  4GDK B;  5D3D A;  1R4N I;  1G6J A;  1WIA A;  1N60 A;  1WMH B;  4XWW A;  2L83 A;  3P4R B;  4NPN A;  1FCC C;  1NEK B;  2K6Q A;  5D2M B;  3ZNI D;  4MT5 A;  2KWC A;  1VRA B;  1IBX B;  3B08 A;  4W9L A;  4YTP B;  4WJP A;  3ONS A;  1PGA A;  4IWP A;  1GOZ A;  1V8C A;  3TEW A;  1SE9 A;  3TBL D;  1I4G A;  1D4B A;  3AU4 A;  1J19 A;  1SE3 A;  3RNG C;  3V61 A;  5LXH A;  2WDT B;  4DXG A;  2TSS A;  5BMI A;  4RGO S;  1QOB A;  2H89 B;  1RAX A;  2RDG A;  2DAJ A;  1FRR A;  1L4D B;  1YQ3 B;  4NAW A;  2N1V A;  1VZ6 A;  1K51 A;  3ABV B;  5I4D A;  3I63 C;  1D5X C;  1LXD A;  3U2S C;  3P63 A;  4B95 A;  3VRA B;  5HHD G;  1FXT B;  2CU1 A;  4B6W A;  5G55 A;  2NPT A;  4IWO A;  2LAS A;  3V6E B;  3QHT A;  3TEX A;  3CWI A;  4P7I A;  1IGC A;  3RN9 C;  2RGF A;  2M17 A;  1D6E C;  4BAX A;  3ENE A;  4BFR A;  2QJL A;  1S1Q B;  4II3 B;  2JQR B;  2WDR B;  3HHM A;  3N9Y C;  2RD0 A;  1TZO A;  3LDZ E;  1WYG A;  4C7Y A;  3ZJV A;  2XK5 B;  5FKA C;  3PRZ A;  1M4V A;  1HZ5 A;  2GBJ A;  2W55 A;  3AEG B;  3D32 A;  3QCA A;  2D10 A;  3AE4 B;  4DDG D;  3A9K A;  4CYE A;  4G50 A;  2BF8 B;  1AAR A;  3MHS D;  3Q8F A;  1JCK B;  1FXA A;  3SHQ A;  1MG4 A;  2L7R A;  1J7B A;  1SJH D;  1WJ4 A;  3AMZ A;  2KX0 A;  3ZKJ C;  3RUI B;  2EEL A;  3M3J A;  2NCN A;  3PSE B;  1HA5 A;  3SFD B;  3BII D;  2LUM A;  3IXS A;  5BO4 B;  2JX5 A;  2L76 A;  2C7M B;  2WDQ B;  5DPW A;  3WIM A;  1Q5W B;  1SB3 C;  1JW9 D;  3U8Z A;  1TGZ B;  4PK1 A;  2WXG A;  4S17 A;  3TL5 A;  4ZYS A;  2JZP A;  2PIA A;  2WWZ A;  3AN1 A;  2V3N A;  4LJO B;  2FCS A;  4RM9 A;  2ZNV C;  2INC C;  3RPF C;  2UWQ A;  3BZD B;  3A1Q A;  3AE9 B;  4ASW C;  3P4P B;  1EF1 A;  2L32 A;  2WS3 B;  3GZN I;  3QA8 A;  1EU3 A;  1R4M B;  3VRB B;  2AEH A;  2BW2 A;  4TV3 A;  1BML C;  2NBW B;  3RD2 A;  4M0W B;  3EFC A;  1WGH A;  1WGY A;  3DVN U;  4KZC A;  3NVY A;  1CQV A;  4A6Q A;  4N58 A;  1X1M A;  4PT5 A;  2PW9 A;  1YIW A;  4ANW A;  1E8Y A;  5AZH A;  2K0P A;  2ON8 A;  2V1Y A;  1CK1 A;  4ANX A;  2FBW B;  2Z0E B;  4US8 A;  1WYW B;  1XT9 B;  1CJE A;  5DPR A;  4MH0 E;  4MGY E;  1P98 A;  2MWS B;  4MEL A;  3K9P B;  4FBJ B;  3I57 A;  1D3Z A;  1PFD A;  1GNU A;  4KGR A;  2WP9 B;  1YJI A;  1BXT A;  1H8C A;  1STE A;  3RNE C;  4RCO A;  3AU5 A;  4MJS B;  5C1Z A;  4AJW A;  3TEZ A;  1WY8 A;  5BYS A;  1V97 A;  2ZCB A;  1V5O A;  1FNW A;  4NQL B;  4E71 A;  2PKO A;  1AN8 A;  5TSS A;  3NS8 A;  4IM2 A;  3UIN B;  2KN4 A;  3DHG C;  3T8M A;  1LFD A;  1SJE D;  1EO6 A;  4X57 B;  1SSN A;  4YL8 A;  5HFY A;  3O65 B;  3SEB A;  2J52 A;  3H6N A;  2O6V D;  4YWG G;  3Q8C A;  1V80 A;  2XNA C;  2BT6 A;  3RYT A;  2RDB C;  1C4P A;  3MP9 A;  4L1B A;  3EFU A;  3NJT A;  4PYZ A;  3ML9 A;  2JWZ A;  4FJV B;  2D11 A;  2BS4 B;  3L13 A;  1KLG D;  3R2T A;  3Q8E A;  4WWM A;  2LGX A;  3DBH B;  1WI0 A;  1TYG B;  4C7Z A;  3OG5 A;  3DPD A;  2LWP A;  2DYB A;  1M94 A;  2XEW A;  1YNT E;  2NVU I;  4A20 A;  5IN7 A;  4JX1 C;  2I1K A;  4S0R A;  3VH4 B;  4YSY B;  2DNF A;  2K22 A;  4P1B C;  1WX7 A;  1TS2 A;  3B1L X;  2FCN A;  1VZ7 A;  1K53 A;  2UU7 A;  1PYW D;  1S3S G;  2MLB A;  4N59 A;  2E6X A;  4OHJ A;  4IOI E;  4HWI B;  3VQI A;  2BQQ A;  1FEH A;  1ACC A;  3AED B;  3H8H A;  1L5P A;  3SR6 A;  1I42 A;  3FKY A;  2FID A;  2MJ3 A;  4IM0 A;  2BYT A;  1RRB A;  1RWS A;  2JYE A;  2K6D B;  4ICV A;  3V3X A;  1HEZ E;  4JGH B;  3BYY B;  4BKT A;  2KVZ A;  4G11 A;  4NQK E;  4N9F 4;  2KJ6 A;  1KLV A;  4ARC A;  2OJR A;  2B76 B;  1F9J A;  4HJG E;  1QIL A;  5EE0 A;  4XZ4 A;  2PJH A;  2WXR A;  5T8I A;  4OZB A;  3RNF C;  1TS3 A;  1K50 A;  4K7W A;  1E8W A;  1GPX A;  1V1P B;  4ICU A;  2MEK A;  2QIE B;  2IO3 B;  3KUD B;  1P9D U;  2BBC A;  3IBE A;  2WXL A;  3BYT B;  4KKJ A;  4H2A A;  3BY4 B;  2Y5C A;  1GB1 A;  3APD A;  5C23 A;  2KT7 A;  3BVM A;  2KC1 A;  1HE8 A;  4HCP B;  2W3S A;  4M8N A;  2E3T A;  2KDB A;  5L95 C;  1WGR A;  3VR8 B;  2WXP A;  3MJW A;  3P2B A;  3ZYY X;  5DPS A;  2DEN B;  2I38 A;  2NPT B;  2QSD A;  3IAM 1;  3C8Y A;  5FK9 C;  3IVF A;  2L1A A;  4DHZ E;  3ZXV A;  1XLN A;  2CKH B;  2LVQ A;  3OLM D;  2AL3 A;  3W1Y A;  1Z2M A;  2BYV E;  1SEB D;  1V9J A;  2MX2 A;  5EE9 A;  2RSU A;  1E0Z A;  3V6C B;  3DBL B;  3AEC B;  3KW5 B;  3RCZ A;  2HTH A;  1UWX A;  2DZJ A;  3NUH B;  3L4P A;  4IKG A;  5CX3 A;  2RPV A;  3A9K B;  2KAC A;  3IAS 1;  2LJ5 A;  2R2O A;  3V05 A;  3NY5 A;  3GP7 A;  2I2Y A;  2IO0 B;  3EHV A;  1EWY C;  4I6P A;  4NJC A;  4MAC A;  2OJW A;  4EZK A;  4LCD E;  1Z5S B;  2JYT A;  2CHW A;  4IG7 B;  4NZL B;  1DYQ A;  4RGM A;  1K8R B;  3A4R A;  1E10 A;  2HD5 B;  5HI1 A;  2GBR A;  3PVL A;  4MH8 A;  1T5X D;  3DWG C;  5H8Y E;  3NOB A;  1KJT A;  2BPS A;  2HE7 A;  2LVO A;  1OGW A;  2N7E A;  1VZ8 A;  4FJZ A;  3N3K B;  2L3Z A;  3BWU D;  3R66 C;  1TKY A;  3RMK C;  3HK0 A;  3TMP B;  4KV2 A;  4ZHP A;  2MBQ A;  2KLC A;  1UGM A;  5DCN A;  4MSQ B;  3Q14 C;  4C4V A;  1C77 A;  4D2K A; 
#chains in the Genus database with same CATH homology
 3CWI A;  1FFV A;  5EE1 A;  1XO3 A;  1IUE A;  1IGC A;  1KLU D;  3NVV A;  5C3J B;  1D6E C;  1SF0 A;  2KWD A;  2KDM A;  1T3Q A;  2W3R A;  5AUI A;  2QJL A;  4UDU C;  2FUG 1;  3GS2 A;  1OFF A;  5BMG A;  2JQR B;  5BMH A;  1FXI A;  2WDR B;  4JE3 B;  1N5X A;  3N9Y C;  3AE3 B;  1TS4 A;  1TZO A;  1WYG A;  4C7Y A;  2NMQ A;  3AV8 A;  4NAW B;  3WCQ A;  3ZJV A;  1QLB B;  3P1M A;  4RNA A;  5FKA C;  1JML A;  4WAF A;  3E56 A;  1M4V A;  1HZ5 A;  1MI0 A;  2W55 A;  3AEG B;  3GB1 A;  2ICI A;  3AE4 B;  3T3N A;  2CJO A;  2PVG C;  1NEN B;  2LHD A;  1XCT L;  3O13 A;  1FMA D;  2JSV X;  2IJ0 A;  1C78 A;  3Q8F A;  1JCK B;  4KGS A;  3HVZ A;  1DOI A;  1FXA A;  2OHF A;  3TUO A;  2HDE A;  4TSS A;  1J7B A;  1XLO A;  4ZHO A;  1JWU D;  1SJH D;  2N9K A;  2CU3 A;  2QEJ C;  3AMZ A;  3P4Q B;  4HKZ E;  3W5V B;  1JRO A;  2WQY B;  3U4E G;  4DQO C;  1ET9 A;  1SE4 A;  3AH7 A;  2V3P A;  1L6V A;  4HRS A;  2Q5W D;  2EEL A;  4J3O D;  1IBX A;  1L0V B;  2DLB A;  1R7S A;  2J53 A;  5G5G A;  3U7Z A;  1L0Y B;  1FD6 A;  1HA5 A;  1L6U A;  1ZDX A;  2M0A A;  3SFD B;  3BII D;  2LUM A;  2RDH A;  2BS2 B;  1JWA D;  3IXS A;  4B0M A;  3AE5 B;  1K52 A;  2IDY A;  1MVK A;  4MM3 B;  2JX5 A;  2PLP A;  3BVZ A;  3U52 E;  2WDQ B;  4LTU A;  1PDX A;  1NVI D;  3T3O A;  1QQR A;  3PO0 A;  1SB3 C;  2J42 A;  5EE3 A;  2YEP F;  1AWD A;  4C56 C;  1JW9 D;  1RFK A;  1YN5 A;  1A70 A;  1SBB B;  3KQ4 A;  1DOY A;  2M56 B;  2WXG A;  4ZYS A;  1C9F A;  2JZP A;  2PIA A;  3AN1 A;  3ZJU A;  1ZP0 B;  2V3N A;  4IDI A;  4O1N A;  2DYM A;  1FO4 A;  1I7H A;  2WDV B;  3RPF C;  1B1Z A;  3BZD B;  2CJN A;  3AE9 B;  3P4P B;  2ZW1 A;  1E7P B;  4L2Y A;  2L32 A;  1GAQ B;  1WWT A;  2NTS A;  2WXJ A;  2WS3 B;  1FCL A;  1HQR D;  2JXT A;  2KAJ A;  3PZ8 A;  3B9J A;  2GRI A;  1EU3 A;  3VRB B;  2BW2 A;  2PMV A;  1ZE3 D;  1BML C;  5D3I B;  4OW0 A;  2Y3A A;  1Y56 A;  2K9X A;  1XCQ L;  1OQQ A;  1YMH E;  4WQM A;  1JWM D;  1SIJ A;  3NVY A;  2DWQ A;  1CQV A;  1D5Z C;  3B2G A;  2PTL A;  4N58 A;  5AUK A;  4A9A A;  4PT5 A;  4A6Q A;  4AQ7 A;  2PW9 A;  2N7J A;  3AEE B;  3DWM A;  1SE2 A;  1QOG A;  1ESF A;  3FC4 A;  2K0P A;  2N9L A;  3NS1 A;  3ZJT A;  2N0S B;  1I4R A;  2ON8 A;  3HVD A;  1CK1 A;  1B9R A;  1DGJ A;  1I4Q A;  1TY2 A;  2FBW B;  2SEB D;  1GB4 A;  4US8 A;  1CJE A;  3TSS A;  5G5H A;  1JWS D;  4KKI A;  1V1O A;  1UNS A;  3NVZ A;  3AEB B;  3URY A;  2WNM A;  2IGG A;  4XDC A;  1JQ4 A;  1PUT A;  1EWC A;  2SAK A;  3I57 A;  2W54 A;  1FM0 D;  4YSX B;  1QKZ A;  1PFD A;  1N5W A;  3E9S A;  2WP9 B;  1ZDV A;  4KGR A;  4US9 A;  1YJI A;  4HKQ A;  1BXT A;  5HG2 A;  1STE A;  4RCO A;  1QOF A;  1F2R C;  1P7F A;  2ONQ A;  1F2R I;  3EUB 2;  1JRP A;  5BYR A;  3TEZ A;  5BYS A;  1V97 A;  5LNK 1;  2WXI A;  1TKE A;  5JXV A;  1FNW A;  1EU4 A;  1XF5 L;  2PKO A;  1AN8 A;  2Z8L A;  5BYQ A;  2YEP B;  5TSS A;  4REZ A;  3AB5 A;  3BK2 A;  3HUI A;  1UGJ A;  2KMM A;  3OWE B;  1QF6 A;  2KN4 A;  4WH4 A;  4AS1 A;  1ZXH A;  1SJE D;  1WGK A;  3AE6 B;  3ETR A;  4FXC A;  4R3D A;  1ROE A;  1SSN A;  5HFY A;  3SEB A;  2J52 A;  3RFZ B;  3W9C B;  1ZXI A;  4LK0 M;  2IGH A;  4YWG G;  3Q8C A;  2LHE A;  4GLS C;  2XNA C;  1I4P A;  2BT6 A;  1C4P A;  1UWM A;  3MP9 A;  4L1B A;  3AE2 B;  1HXY D;  1E6E B;  4LLG M;  1N63 A;  2K5P A;  4USA A;  2AQ1 B;  1TJE A;  2G9H D;  1C4C A;  1ENF A;  1QOA A;  2R61 A;  2MJE A;  4XWT A;  2BS4 B;  1KLG D;  1KFY B;  3R2T A;  3Q8E A;  4WWM A;  1KF6 B;  1MHH E;  2D5G A;  2FE8 A;  4M0W A;  2ZW0 A;  1TYG B;  4C7Z A;  3AM9 A;  1C4A A;  3R8B A;  4A8X C;  2QMT A;  3KWV A;  2OED A;  1NYQ A;  2HTM E;  3MJ5 A;  1YNT E;  2V4I B;  4JX1 C;  4OZC A;  2J4X A;  2BS3 B;  2WXF A;  4YSY B;  2Y5P A;  3W2D A;  2K22 A;  2WLB A;  1I4X A;  1TS2 A;  4OVZ A;  1VZ7 A;  1K53 A;  5FR3 A;  2WXM A;  1PYW D;  1IGD A;  3FAH A;  4N59 A;  1FNU A;  1YQ4 B;  2E6X A;  4OHJ A;  5C2T B;  4IOI E;  3VQI A;  3KWL A;  1XXG A;  3W5U B;  1FEH A;  1ACC A;  1VR9 A;  3AED B;  3H8H A;  1L5P A;  1RM6 C;  2MJD A;  3SR6 A;  3R2I A;  2X38 A;  3Q8B A;  4RF0 A;  1OQR A;  1RYJ A;  1XLQ A;  2MJ3 A;  3B2F A;  5D7G A;  2BYT A;  4JWU C;  1QT9 A;  1F0Z A;  1RWS A;  2DBY A;  2JYE A;  3BVG A;  4A90 A;  1YN4 A;  1T6B X;  1V1P A;  3V3X A;  4A55 A;  1N62 A;  1HEZ E;  3MC0 B;  3P42 A;  1J7C A;  3BYY B;  2V0G A;  4TQ1 A;  1ET6 A;  1TS5 A;  3LXF A;  5H92 C;  4RGT A;  3AE1 B;  2H88 B;  4ARC A;  2B76 B;  2GB1 A;  1XEE A;  4HJG E;  1FNV A;  1QIL A;  1TKG A;  5EE0 A;  2WXR A;  5T8I A;  2M19 A;  1F77 A;  3PZ7 A;  4OZB A;  4P6V F;  4NAM A;  4KGT A;  4JPS A;  4L23 A;  2L52 A;  4RH6 A;  5MPO A;  2RMM A;  1PGB A;  1TS3 A;  4N6E B;  1K50 A;  4TQ0 A;  4ITK A;  2WU2 B;  1BUI C;  2IGD A;  1V1P B;  1GPX A;  2JWU A;  1I4H A;  2WXN A;  2MEK A;  1C76 A;  2QIE B;  4ZOH C;  1JWB D;  1N61 A;  2BB6 A;  2BTE A;  1UUP A;  3AEA B;  1PGX A;  2BBC A;  2WXL A;  4DXF A;  3BYT B;  3EGR A;  1WXQ A;  4KKJ A;  4H2A A;  4WUR A;  2Y5C A;  1GB1 A;  4EE2 A;  3IT6 B;  1MHX A;  5GXG B;  1SXT A;  3NZ3 A;  2GI9 A;  4RFB A;  1VDV A;  3BVM A;  4YTM B;  1JAL A;  2W3S A;  1NYR A;  3BK1 A;  2K3U A;  1ZOY B;  2W82 A;  3FIL B;  2E3T A;  4P16 A;  4XE0 A;  1WRI A;  4TMA B;  3VR8 B;  1YN3 A;  2AQ2 B;  2NTT A;  2WXP A;  3ZYY X;  3AE8 B;  2WU5 B;  2I38 A;  1LO5 D;  3LB8 C;  2VZK D;  2QSD A;  3IAM 1;  4ZRQ A;  3C8Y A;  5FK9 C;  4RF1 A;  2L1A A;  4ZRP A;  1AYF A;  1XLN A;  4RGN A;  1P7E A;  2LGI A;  1XLP A;  3LYY A;  3AE7 B;  4XDD A;  1FFU A;  1NI3 A;  1SEB D;  2LMC A;  4OZA A;  1D5M C;  2G1E A;  2LEK A;  5EE9 A;  1J7A A;  3Q69 A;  2ACZ B;  4C80 A;  1ZPS A;  2AX5 A;  1VJK A;  1E0Z A;  3NRZ A;  2WXH A;  4ARI A;  3AEC B;  1KH0 A;  2JU6 X;  2MH7 A;  5E6J A;  2QIL A;  1C79 A;  4YTN B;  1UWX A;  1ZUD 2;  3NUH B;  3L4P A;  1WSP A;  1CZP A;  4IKG A;  2RPV A;  4WIP A;  1YJJ A;  3EA6 A;  2KAC A;  3IAS 1;  4GDL B;  1HZ6 A;  3V05 A;  1E9M A;  3TEY A;  3GP7 A;  4GDK B;  1L4Z B;  5D3D A;  2I2Y A;  3Q8A A;  2INN E;  1N60 A;  3KLS X;  1EWY C;  2AQ3 B;  4NJC A;  2IPK D;  4XWW A;  2L83 A;  3P4R B;  1AW7 A;  1KRH A;  3I9V 1;  1VLB A;  4YT0 B;  4MAC A;  2PVO D;  1FCC C;  2XN9 C;  2LJI A;  2JYT A;  1NEK B;  3VR9 B;  2WXK A;  4MT5 A;  2EKI A;  1VRA B;  3MHZ A;  1DYQ A;  4NZL B;  4RGM A;  1IBX B;  3ZGZ A;  4YTP B;  1E10 A;  2VZK B;  1KTK A;  1PGA A;  1EM7 A;  3HRD D;  3NVW A;  5HI1 A;  1GOZ A;  1V8C A;  3TEW A;  1I4G A;  1TY0 A;  1DOX A;  1D4B A;  4HEA 1;  2WXQ A;  4MH8 A;  1SE3 A;  1T5X D;  1MPE A;  3DWG C;  5H8Y E;  3W1S A;  4CQN A;  4KX6 B;  3UI3 A;  2WXO A;  2TSS A;  3MFG A;  2LFI A;  4HRO A;  1L0X B;  4RGO S;  4DXG A;  5BMI A;  1QOB A;  4YSZ B;  1VZ8 A;  1FIQ A;  2H89 B;  3CIR B;  1Q10 A;  2RDG A;  3BWU D;  2BB5 A;  1FRR A;  1L4D B;  1TKY A;  1YQ3 B;  1VZ6 A;  1K51 A;  3ABV B;  3FIL A;  3ZQ4 A;  4B0E A;  5I4D A;  1D5X C;  3AEF B;  3IT4 B;  4ZHP A;  3U2S C;  3P63 A;  3VRA B;  2KQ4 X;  5HHD G;  4JWS C;  3J9C A;  4Q2J A;  1FRD A;  3SFE B;  2DYO A;  4YXD B;  3P4S B;  2INP E;  1C77 A;  3TEX A;  4D2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...