5MPOA

Crystal structure of human molybdopterin synthase complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
SMVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Molybdopterin synthase sulfur carrier subunit
publication title Crystal structure of human molybdopterin synthase complex
rcsb
source organism Homo sapiens
total genus 22
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5mpoA00
2FBWB 5EE3A 3AN1A 1WWTA 1V97A 1E0ZA 1PDXA 1EWYC 1FXAA 1N62A 1PUTA 2CJOA 2MH7A 1WYGA 3AB5A 3AMZA 3P1MA 4FXCA 1FXIA 4IDIA 3RPFC 3W5UB 1DOYA 1QOGA 5EE9A 1RWSA 2B76B 2JQRB 4YXDB 3HUIA 1NYRA 3P63A 4A9AA 1QOAA 1XLNA 3P4PB 4ITKA 1TYGB 1A70A 2H89B 1UWMA 5EE0A 2MJ3A 5C2TB 1FRDA 4YSZB 3P4QB 2WU5B 4YTMB 2Q5WD 2CU3A 2QIEB 2K5PA 1E9MA 1FO4A 3SFDB 1WXQA 2W3RA 1CJEA 3PO0A 3L4PA 2CJNA 1SF0A 1L5PA 1YJIA 1OQQA 3CIRB 1JROA 1VLBA 1YQ3B 4HROA 1SIJA 3B9JA 5C3JB 4YTPB 1YQ4B 3AE8B 3VRAB 4JWUC 4JX1C 1DOXA 5H8YE 3NVVA 4N59A 4HRSA 4KX6B 1OFFA 3AM9A 1GAQB 2BT6A 3AE3B 2OHFA 3ABVB 3WCQA 3AEGB 1N5WA 2PVGC 2KMMA 2WS3B 3AE5B 2QJLA 3AEFB 3W9CB 3NVYA 1E10A 1JRPA 2WDQB 3ETRA 3VR8B 2L83A 1RFKA 3AEAB 2BS2B 1PFDA 2PVOD 2ACZB 4YT0B 3B2GA 2WDVB 1JWBD 3CWIA 1GPXA 3VRBB 1IUEA 3AE7B 1KRHA 1CZPA 3AE1B 1VJKA 4YSXB 3P4RB 1J7AA 5AUKA 3FAHA 1V8CA 3AV8A 3SFEB 4ZHPA 4WWMA 4WQMA 5G5HA 1KF6B 3AECB 1L6UA 3DWGC 3LB8C 4YSYB 1E6EB 2M56B 5GXGB 1I7HA 1ZOYB 1XO3A 1FM0D 1JW9D 3FC4A 1RYJA 4YTNB 2BS3B 1WGKA 1J7BA 2K22A 3NRZA 3NVZA 3SR6A 2N0SB 4C7YA 1L0VB 1N61A 1WRIA 3AE6B 1XLQA 4USAA 3VR9B 3HRDD 4C80A 2PIAA 1NYQA 3AE9B 4US9A 2WLBA 4ZHOA 4US8A 1DOIA 1KFYB 1TKGA 1N63A 1R7SA 4P6VF 1QF6A 4C7ZA 3EUB2 2EKIA 4N58A 1QOFA 3DWMA 4ZOHC 3W5VB 1FFVA 2KAJA 2DBYA 3AEBB 1TKEA 2H88B 1NEKB 3P4SB 4N6EB 3KWLA 1NI3A 1TJEA 1FFUA 1FIQA 1TKYA 1ZP0B 1N60A 1ZXIA 2G1EA 1NENB 1QT9A 2K9XA 3AE4B 3AEDB 3AH7A 1QLBB 2WP9B 3NS1A 1L6VA 1N5XA 2WDRB 3NVWA 1NVID 2BS4B 1JWAD 1XLPA 2AX5A 2HTME 2WQYB 1FMAD 3HVZA 2L52A 5H92C 2W3SA 2W54A 3B2FA 1YJJA 2E3TA 3AE2B 1F0ZA 3BIID 2DWQA 2JX5A 2WU2B 5MPOA 2M19A 1ZUD2 2Y5CA 4LTUA 5EE1A 1RM6C 1B9RA 2MJEA 2PKOA 1J7CA 1JALA 1AWDA 2W55A 1QOBA 3AEEB 4JWSC 1DGJA 2MJDA 1JQ4A 1ROEA 1VDVA 5G5GA 1E7PB 3ZYYX 1OQRA 1SB3C 1FRRA 1T3QA 1XLOA 2LEKA 1AYFA 3LXFA 5AUIA
chains in the Genus database with same CATH superfamily
1HQRD 1LGRA 2ZNVB 2LGSA 4YTMB 3APCA 4LCDE 4FBJB 3K9PB 5C23A 2BYEA 1XLNA 2NTSA 1UWXA 2MHJA 4NJ6A 1YMHE 1TT5B 1D3ZA 2K5PA 4RF1A 4LJPB 3UQAA 1BMLC 3B08A 2BGFA 4GOCA 3RMKC 3PO0A 3VTWA 4H2AA 2KDMA 2JXTA 2L0FA 1VLBA 4FULA 3JVZX 1XQQA 3VTVA 2WX1A 1DOXA 3NHEB 4JWUC 1SGHA 1FCCC 2WXLA 4GDLA 3U4EG 1F2RI 2WXFA 2K6QA 2L76A 1KOTA 3WCQA 1GOZA 1ENFA 4HDOA 1E10A 3ECIA 3V60A 2LMCA 2MX2A 3B2GA 3GS2A 1C77A 2ZPYA 4KDIC 3OJ3A 1GB4A 3TBLD 2DYOA 1OEYJ 3RNAC 4DXAB 1N61A 2JZZA 3DCGA 1NYQA 4IM0A 3AULA 4A3PA 1I42A 3TMPB 1V1PB 1LQBA 4N58A 5DPSA 3ZVVA 2DBYA 4CYEA 4RM8A 2MEKA 3PSEB 1C78A 4RH6A 3R8BA 1UBQA 2XK5B 1QLBB 1CK1A 4UDUC 2KX0A 1Z2MA 3Q14C 3AE2B 4B95A 3RI7C 3UGBB 1P7FA 1ZUD2 2L3ZA 1TIFA 3AEEB 1QOBA 2N1VA 4OHJA 4QAYA 1XT9B 1C9FA 4RGMA 1E7PB 1ZDXA 2JRHA 3LJ3A 3TEXA 1L7YA 2NPTA 2K8CA 5AZFA 2N9EB 2J52A 2INPE 2WXKA 4RGNA 2UYZB 3HUIA 3APDA 4MGKE 4A9AA 2KTRB 1E7UA 5HFYA 4EFOA 3NY5A 4EKUA 1SF0A 3ZDMC 3CIRB 2YVCA 1K52A 5CHVC 4WJNA 3W1SC 5C3JB 1YQ4B 3AE8B 4HPLB 4NNJB 2LFIA 1OFFA 4PT5A 1IBXA 3ZLZA 1WJ4A 3QC8B 4GN1A 5JHAA 2ACZB 3CWIA 2JWZA 3AE7B 1CZPA 4TUUA 4AS1A 1BUIC 5D94A 2VH2A 3BYTB 3DBRB 1RYJA 2Z59B 3SR6A 2WXHA 4C7YA 2CR5A 2IGDA 4PS7A 4USAA 3PPAA 4ZHOA 1HXYD 5T8IA 2BKRB 2L0TA 2GBRA 2CHXA 3I3TB 5C1ZA 2PLPA 2KMCA 3RFZB 2CS4A 1N60A 3AH7A 2DNFA 1JWMD 1XLPA 2WNMA 5H92C 1J19A 3QARA 1UUPA 3BYYB 4OZBA 2M19A 4RNAA 1EM7A 2XNAC 1WXAA 2IY1B 4HJGE 2FBWB 2JY6A 1WYGA 3VUYA 3PVLA 4E74A 2D3AA 4HVBA 2V1YA 2LI5A 3NZ3A 5JZEB 4K81A 4LLGM 3DHHC 4PK1A 4M0WA 2C60A 3Q8CA 4XZ4A 1L5PA 2WYQA 3L08A 4HROA 1UH6A 1I4RA 3TSSA 1WYWB 2WX0A 2KNBA 3KUCB 3PZ7A 3AE3B 1GG3A 4LJOB 5CHWA 2KLGA 1TY2A 3QIJA 1WF9A 5IKCM 1K53A 4DHJD 4GDLB 1GPXA 2IGGA 2ZEQA 3T3NA 4GXBA 5BMGA 3SFEB 4LDTB 4WWMA 3IBEA 1Z5SB 3AECB 3Q6BA 3AU4A 1YN5A 1EWCA 3PZ8A 2FUHB 1C4CA 2MBEA 1L0VB 5IOIA 3P42A 4LK0M 2KHWB 2KLCA 4E71A 4DQOC 2LRUA 4AQ7A 1R7SA 1F2RC 1HTOA 1QF6A 4C7ZA 3EUB2 5LLIA 3VTUA 1SJHD 2LVQA 4URKA 3W5VB 2AEHA 4DDID 5J2RA 1FPYA 1WH3A 2R61A 1WXSA 3C0RB 4ZRPA 1MI0A 4DXFA 2N9PC 2WDRB 3L0WB 4J6IA 4N9F4 3K9OB 4WWNA 2LJIA 3MHSD 1FXTB 5G5GA 5D6JB 3A33B 5IO9A 1OQRA 2M17A 3HM3A 3U30A 3PRMB 4J3OD 1B1ZA 3DVNU 5EE3A 3VFKA 3GZNB 2CJOA 2KWDA 2YLMA 1I4PA 4MH8A 2B3AA 2LRWA 5LXHA 1WR6E 1JCKB 2KJRA 1SJED 1WJNA 1UWMA 3ML9A 2NPTB 5C2TB 1RRBA 2QHOA 2INDC 2AL6A 3QJZA 3GE8C 1DYQA 2SAKA 1MHHE 3B9JA 2Z0DB 4JX1C 4MT5A 2OEDA 4HRSA 4GDKA 2HDEA 4YWGG 5J18A 2WHIA 1VR9A 2QDFA 2NBVB 3ETRA 2JF5A 1WM3A 3DQVA 4AP4C 4B9KA 3TEYA 1XD3B 3TL5A 3WAOA 3VRBB 1IUEA 1D6EC 4EEWA 1IBXB 3VH3B 4KDLB 2M1MA 2QC8A 3EC8A 2ZCCA 1F77A 4KV2A 2TSSA 1YJ1A 2WWZA 3FC4A 4YTNB 1WGKA 4W9FA 3PRPB 2PW9A 2DAJA 2KZRA 1S3SG 3AE6B 3HRDD 2ONQA 3EFCA 4NJCA 3OAWA 2D3GA 2K8HA 1L0YB 1TKEA 1C1YB 4MDKE 2MP2A 1NI3A 2K9XA 3H1UA 2WXIA 3BK1A 2NBUA 2IYDB 4A3OA 1GUAB 4CO7A 3BVGA 3PT2B 4KKIA 2KC2A 4W9CA 1TGZB 2MW5A 4W9IA 2DAFA 2JX5A 2WU2B 2N7JA 1H8CA 1C3TA 3RT3B 3ZDTA 2JRIB 2GBMA 2KKCA 4MSMB 1Q5WB 3P1MA 3DBRI 1WI0A 2XBBC 3NZSA 3WANA 1FXIA 1DOYA 3IT6B 1QOGA 4A8XC 2J53A 2DZKA 1EF1A 4HJKA 1MJDA 4W9DA 2WGSA 4DWFA 3Q3FA 3H8HA 3KWVA 1R4MB 4W9GA 5BO4B 4YSZB 4IM2A 4BKSD 3SFDB 2K8BA 2KDFB 3V61A 4W9LA 1OQQA 4RGTA 4W9JA 3ALBA 1YNTE 4M00A 1YN3A 1L2NA 1GB1A 4IWQA 4M0WB 2O6VD 4L2YA 3RNEC 3ZNHB 3HM6X 2GBKA 2MRPA 3HHMA 4ANVA 1SXTA 1VRAB 2BVCA 4KSKC 2JWUA 1QILA 4ASWC 1GJZA 2I1KA 2RPQA 5BYQA 1TS5A 2LD9A 3TUOA 1N63A 1JRUA 4RM9A 2MLBA 2V0GA 3E9SA 3PREA 3ZO5B 3AEBB 4K7UA 3U2SC 4FA6A 2BYTA 3N3KB 1WFYA 1ZP0B 3HIZA 4BKSA 2J7QB 2FIDA 2AX5A 3PV1A 3BY4B 1YOVB 3Q8BA 1WJUA 1E8WA 3AXCA 4EE2A 4PYZA 2IJ0A 2MJEA 3Q3NC 3UIPB 2ZVNA 2O6VA 4K3BA 1WGDA 3ZYYX 3SEBA 1SB3C 4NY0A 3N20C 5LNK1 2KK8A 1PDXA 4LNNA 1FXAA 4ZRQA 4AOFA 3W2DA 1WE6A 3R3MA 2BW2A 2IO2B 4BZAA 4S0RA 3M63B 1PGBA 3W1SA 4OZCA 3T8MA 5G55A 3VUXA 2FUG1 4KKJA 3E56A 1GC7A 3JSVA 4AUQC 3A4RA 3LYYA 2V3NA 4K3CA 2R2QA 4YTPB 3RNBC 4JQWC 4N59A 3T9LA 3NUHB 4KX6B 1GAQB 2PE9A 3AU5A 3SU8X 3APFA 1E8XA 4OVZA 2CKHB 3GZNI 4DHZE 1KRHA 2IDYA 3ZKJC 1F1HA 1ZW7A 2V3PA 2M56B 3LDZE 1SE9A 3ONSA 1SBBB 4M8NA 3H9DA 3KUDB 4S17A 1BT0A 2K22A 2ZW0A 4FJVB 3UIOB 3N1XC 4XX5A 3DBHB 2FCQA 2GI9A 4DHZB 3KUZA 2ZJDA 2CHZA 2KQ7A 4N6EB 1JWSD 2FIFA 2Y3AA 1QT9A 2KVZA 2EELA 1WE7A 2RGFA 3NVWA 4I6NB 1M94A 2WQYB 2D5GA 1OTRB 2L52A 2W54A 2KX3A 4HPPA 1EF5A 2JU6X 3MC9A 2JZ3B 5G2NA 2KFJA 3PHWB 2G4DB 1TY0A 3L10B 3U8ZA 3UF8A 2G45B 1ROEA 1VDVA 2R2OA 1WIAA 1XLOA 2RDBC 2LEKA 3LXFA 1I4GA 3ZNZB 1R4NB 1N62A 3RPFC 2KJHB 2D07B 1PGXA 3KYCD 1BXTA 3H7SA 1NYRA 1MG4A 4XYCA 1A5RA 2X8XX 1TYGB 2RMMA 2KXJA 5EE0A 1YQBA 2D10A 4MH0E 2BTEA 2Q5WD 2V4IB 5BMHA 1E9MA 2ZCBA 3HK0A 2CJNA 1YJIA 2K25A 4XGAB 3Q8EA 3KVFB 1T6BX 1P3QU 1VD2A 2LVOA 4LNKA 1ZDVA 5IP4D 2C7NB 1V81A 1KLUD 3UINB 5TSSA 2K39A 4AJYB 3AE5B 2QJLA 3A9KB 1JRPA 2OJRA 4BBNF 4HK2A 2ASQA 1PFDA 3A1QA 3DDCB 1GC6A 1YX5B 4IG7B 2L8JA 1WGHA 1J7AA 2JT4B 2KYWA 1KF6B 4GB9A 1PYWD 1WZ3A 1LXDA 3N1ZC 1V2YA 2UWQA 1FM0D 4G0NB 3ZUNA 4BAXA 3RYTA 1R4MI 3NVZA 2C7MB 1XLQA 1P98A 4C80A 1P1AA 3TIXA 4US8A 3I57A 2N9KA 2O2VA 3DWMA 3AEDB 2IO1B 2L05A 3CF6E 1WX9A 5HG2A 3V62A 3HVZA 2JYTA 1MG8A 3QCAA 5MPOA 4B0MA 1TZOA 1OQYA 2BKFA 3D32A 2LJ5A 2O6VB 4JL9A 2C9WB 1VZ6A 1K51A 1WGRA 2LGXA 3P4PB 4WIPA 3CSFA 1WRDB 4OVUA 2KFKA 3I9V1 2MWSB 2Y5BB 4AJWA 2W3RA 2JVCA 3L4PA 2KDIA 2L32A 4G11A 4TMAB 4IWOA 1I35A 1UGMA 1PQSA 4KZCA 2KQSA 5H8YE 3JSVB 2J0JA 3ZNGC 2KMAA 3W9CB 2WS3B 3AEFB 5D7GA 3AEAB 4BOZB 1YX6B 2HJ1A 1JWBD 2PEAA 2JPHA 1JMLA 3AV8A 5JHBA 1C76A 3SDLC 4RFBA 3PLUA 2Z8LA 4F8CB 3KW5B 3L16A 2RDHA 2N0SB 2QSDA 1WRIA 3RNCC 2JYEA 4KSLC 3EA6A 1F52A 1DOIA 1TS4A 4P6VF 2G9HD 2EKIA 2J4XA 3Q3JA 5BMIA 2KANA 2XEWA 2ZVOA 4A55A 1UD7A 3A4SC 4IUMB 2KN4A 2WP9B 1L6VA 4B6WA 1NVID 2HTME 3C19A 2XN9C 2A4ZA 1HTQA 2D2QA 4JIOU 4PYUA 1RAXA 4K7SA 1F9JA 2FCSA 2KC1A 1MVKA 3ZTDA 5EE1A 1RM6C 4G50A 2W55A 1JALA 2RSUA 4EOYA 2G3QB 1STEA 3BZDB 2PPHA 4HKQA 2MH7A 2EKEC 3AMZA 4G3XB 4BBNC 3WA0A 4MEMA 4YXDB 2DHZA 3S2AA 3O13A 1TTNA 3P63A 4ANUA 3QX1A 3A9JA 4EZJA 4PS3A 2LVPA 2BWES 3P4QB 4E3CA 4LNOA 4HEA1 4F1SA 2BYVE 2JZPA 4XC2A 3V05A 4MGZE 2K1FA 3MFGA 1D5MC 2CHWA 4TKNA 3J9CA 1N5WA 4P1CC 3KQ4A 4CHKA 4M02A 5FK9C 3DPDA 2JSVX 3VR8B 2NCNA 1J8CA 3QHTA 2PVOD 5KHOA 1R4NI 3R7RA 2MCNB 2Z0EB 3FAHA 1SSNA 3TEWA 2BB5A 4M8MA 4IOIE 3A1QB 3IG3A 4XWWA 1J7BA 2IY0B 3CSTA 2L00B 2EMSA 1L4ZB 2ON8A 1CMXB 1QQRA 3KYDD 1E7VA 2NBWB 1C4PA 1TJEA 3WAPA 4FHKA 2WXNA 3NS1A 4W9EA 2KJ6A 3BK2A 1VZ7A 4IKGA 4FJYA 5D2MB 4W9HA 1YJJA 2E3TA 4ICUA 4ZRJA 5FR6A 2ZPNA 5IAAC 2RD0A 2PMVA 2PKOA 2GBJA 4ZRKA 4XDCA 1HZ5A 1FRRA 4K7WA 1AYFA 5AUIA 5L95C 1NDDA 1PUTA 4FXCA 2UU7A 2LHDA 3OWEB 4HCNB 4HWIB 1S1QB 3BWUD 4IW0A 2K6DB 2LWPA 1HA5A 3RNGC 1FNWA 2WU5B 4ZYSA 2CU3A 3EHVA 2QIEB 1FO4A 1UF0A 2FCMA 3RCZA 2RPVA 2V9HA 2KFKB 2X38A 3I63C 5JH5C 4TSSA 3ABVB 1X1MA 1FCLA 1MFWA 1WSPA 3NVYA 4LNFA 1FNUA 1Y8RC 2NMQA 4RF0A 3RD2A 4BFRA 5IA7A 1UNSA 3Q69A 1V8CA 5E6NA 2IBIB 3OJ4B 4FN2A 1I4QA 1KLGD 4Q2JA 2JUOA 1JW9D 1V9JA 2LXCA 2BS3B 3AI5A 2QEJC 3QQ8B 1D5ZC 4F7ZA 4HXDA 4GSWA 2L7RA 3ZW3A 2KAJA 4P16A 3KLSX 4GMVA 3UQBA 1NEKB 3P4SB 1FFUA 1TKYA 4II2B 4DDGD 3PGEA 3AE4B 1VZ8A 4BKGA 1L0XB 2QMTA 2HE7A 3BINA 1PGAA 2VRRB 2MSED 3DHGC 1AARA 2DWQA 2LGIA 3ZNID 3V6CB 1ZKHA 4LTUA 3R7QA 1V86A 4JWSC 2G4SA 1NBFC 4ZRIA 2N9LA 4OW0A 5TR5A 3FILA 1V5OA 3AB5A 3ZXVA 3GE3C 1RWSA 2JQRB 2ZNVC 4M01A 4WWPA 1E5WA 1T5XD 2DX5B 3R66C 2GMIC 1A70A 2YEPB 5CX3A 4TQ1A 5D3IB 1T0SC 3IAS1 4FJZA 1WXVA 1CQVA 3A9JB 2DYBA 1QZEA 1OEYA 3N30A 2ZZPB 3IXSA 2INNE 2IZVB 2Y5PA 4ACFA 2PVGC 2D3CA 4DHJB 4WAFA 2WDQB 5DPWA 3NZUA 2KO3A 1TZ1A 3FKYA 1M4VA 2M8SA 2INCC 5E6PA 3DVGX 3QWZB 4BVUC 1SE4A 1XO3A 1U4AA 3O65B 2LHEA 5GMVA 4L1BA 1WR1A 3Q8AA 1AW7A 3ENEA 1TKGA 1YIWA 1SE3A 1SE2A 3L54A 1XCTL 2KDBA 1HE8A 4GDKB 1FD6A 2H88B 4R3DA 1WY8A 3KWLA 3M3JA 5LXIB 2G1EA 1ZXHA 1FMAD 2CU1A 4WJPA 4MJSA 1D5XC 2NTTA 2KD0A 5E6JA 1L4DB 2Y5CA 1KLVA 1EU3A 3ZQ4A 3RN9C 2MJDA 4ANXA 4C56C 3AN1A 3ZRCA 3U52E 1E0ZA 2AQ1B 2KACA 2B76B 1N6ZA 1WM2A 5AZHA 4JGHB 4BKTA 2IO0B 1K8RB 4EZKA 2MP2B 3ZJTA 4ARCA 2MQJA 1FEHA 1FRDA 4MSQB 1IYFA 4A6QA 2PE6B 3N32A 2RR9A 1T0QC 1UGJA 3IFWB 1SIJA 1ACCA 3NVVA 1AN8A 2DYMA 3N9YC 4FLHA 3GB1A 2M0XA 4K1RB 4GLSC 1QKZA 3ZJVA 3AEGB 4OVVA 2KOXA 2KMMA 2VZKD 4GGQA 4NJ7A 4TV3A 2BYFA 3RNFC 4IWPA 2WDVB 1Y56A 1RLFA 4HLEA 5AUKA 1V80A 5BYSA 5I4DA 3VQIA 1L6UA 3PRZA 3GOEA 1KJTA 3NOBA 5AEKB 4NAWA 3AE9B 4ZDVA 4D2KA 1K50A 1WZ0A 1SEBD 2KWCA 1IGCA 3VUWA 2MBBB 2SEBD 3M62B 1NI2A 2AQ3B 3JYUA 3MJ5A 2VH1A 3VHTC 1ZXIA 1TS3A 1NENB 4I6LB 3DHIC 1UBIA 4EZLA 1KH0A 2W82A 3WAMA 4EUTA 2MBOA 3VVWB 4JLCA 2I2YA 4NQLB 3SD5A 2V3SA 2J42A 3NJTA 4WJQA 1HZ6A 1DGJA 2BB6A 3MP9A 1T3QA 2MA9B 4CQNA 1D4BA 3URYA 1UELA 3MC0B 3W5UB 1XXGA 2EMTA 1MPEA 2HJ8A 3EFUA 5D3DA 1V1OA 1J0GA 2H89B 3FILB 5HKHA 4KGRA 3QK0A 3RULA 3T3OA 3V6EB 2MBQA 1WGGA 4C4VA 3IHPC 4BOSC 1KTKA 2FCNA 1Q1OA 2OOBB 3AM9A 2M4NA 1WX7A 2BT6A 1WJ6A 4ANWA 1WX8A 1Q0WB 2ZW1A 2LXAA 2I1JA 3H7PA 3OG5A 1TS2A 2BS2B 1SIFA 3AE1B 4KIKA 2HTHA 1UZXB 2OJWA 4WQMA 3LB8C 1Q10A 4IM3A 3N1YC 1E8YA 5E6OA 4WWOA 3Q3OC 4HCPB 1H4RA 1KFYB 4AWJA 2A5UA 4I6PA 4A20A 2NVUI 2NR2A 1IP9A 4RGOS 3DOWA 5FKAC 3R2IA 2BBCA 3SHQA 2PJHA 1N5XA 3L17A 2BS4B 3BVZA 3MC8A 2W3SA 3ZRFA 3IT4B 3U7ZA 1XF5L 3BIID 3OLMD 1WMHA 1MHXA 2N4FA 1J7CA 3ML8A 1JQ4A 2AL3A 4MJSB 5KHQA 3Q8FA 5CHFA 3TCAA 4IDIA 3GP7A 2KQ4X 4WQOB 3HVDA 4NPNA 4P1BC 1ISNA 3Q2AC 2MJ3A 3ZTCA 1P7EA 4IC7B 3PS6A 1EU4A 1WXQA 2D3BA 2KWVB 1CJEA 4DK5A 2GBNA 1EO6A 1ZE3D 1V49A 4KVGB 1ET9A 2YEPF 3L13A 3VRAB 1LM8B 1ZGUB 1T0YA 3ZGZA 2OHFA 3X23A 3ZJUA 3DBHI 4HDQA 3V3XA 1WGYA 4OZAA 2KVRA 2L83A 4C00A 2GOWA 4MGIE 3DBLB 4XWTA 4YT0B 3C8YA 3EECA 4REZA 2QILA 4JPSA 4YL8A 2LZ6A 5JXVA 1G6JA 3DWGC 4MGYE 4NAMA 1I7HA 1ZPSA 4JE3B 3NRZA 3JW0X 3B0AA 3VR9B 4US9A 2WLBA 3VH4B 2AQ2B 3VXWA 1QOFA 4ZOHC 2WXOA 1OGWA 4KGTA 3PLVA 1ET6A 1XCQL 1FIQA 4MELA 1HEZE 4NAWB 3PZDA 4PS8A 1JWAD 2N9XA 4KGSA 1KM7A 2KN5A 4MM3A 3WIMA 1I4XA 2WXPA 4XE0A 2BF8B 1B9RA 1IPGA 2NS5A 2BPSA 2LGDA 5HHDG 2IO3B 3DVGY 1LFDA 2LASA 3IVFA 3W1YA 2BWFA 1EWYC 2KDEB 2WXQA 4HPMB 2FE8A 1VCBA 2O2VB 1QOAA 2VZKB 4B0EA 2E6XA 2AYOB 2WDTB 1YD8U 3TJPA 3VDZA 2BQQA 3U7DA 2DZJA 1LO5D 2L1AA 2GB1A 2M0AA 3P2BA 3MHZA 4ZYNA 2K3UA 4P7IA 2LGYA 2D11A 4C4VB 3H6NA 5DCNA 2K0PA 4X57B 1JWUD 3EGRA 3VAWA 1I4HA 2REXA 1VJKA 5EDSA 3NS8A 1E90A 3H7PB 2PTLA 2WXMA 4A90A 5GXGB 1V1PA 1ZOYB 3BVMA 2RDGA 2FAZA 3TEZA 3RZFA 5HI1A 2GLSA 4HKZE 4FHJA 1C4AA 4KIKB 4WAAA 2JXXA 1T0RC 2J0KA 2PIAA 2XK5A 4WURA 2IPKD 4NZLB 2C7HA 3Q3MC 1FFVA 4WJOA 4ARIA 3B1LX 3PHXB 1V5TA 1IGDA 4RCOA 2GRIA 3B2FA 1ESFA 1F0ZA 1GNUA 4RMAA 1V6EA 3RZWC 1AWDA 1TBEA 3UI3A 2N7EA 1WMHB 1WWTA 1V97A 3A9KA 1XEEA 4O1NA 4KZ0A 2V4LA 2KTRA 1P9DU 2KT7A 3QAQA 5DPRA 1WXMA 5EE9A 4ITKA 2FNJB 5AZGA 4ICVA 1EUVB 4XDDA 5CTRC 1P0RA 5DPTA 2WXRA 1JROA 2WXGA 3DVNV 1YQ3B 5FR3A 3MJWA 2DZMA 3PTFC 4DXGA 2N7DA 3IAM1 3M95A 4TQ0A 4MACA 2N1WA 1RFKA 4FADA 3QA8A 3MTNB 4NQKE 2C5LC 2HD5B 2KTFA 3CMMB 3I5JC 4YSXB 3P4RB 2MBHA 2LUEA 3ZIMA 4ZHPA 5G5HA 4YSYB 1C79A 1E6EB 2DENB 5BYRA 2QCZA 2DLBA 3DBSA 2KWUB 1FNVA 3ZXRA 5IN7A 1RFAA 4DBGA 2I38A 4L23A 3RUIB 3KH0A 4GIVA 1YN4A 5J17A 4LDTD 2AWTA 3NG0A 3WALA 2LUMA 4LNIA 2J0MA 4W9KA 2ICIA 4GU2A 3DBLI 1E8ZA 4WH4A 5L83A 3R2TA 2W9NA 3X0WA 2WXJA 2DZIA 4MM3B 2IGHA 4II3B
chains in the Genus database with same CATH topology
1D4BA 3URYA 1HQRD 4HKQA 3MC0B 2MH7A 3AMZA 3P1MA 4YTMB 1DOYA 3W5UB 1FXIA 1XXGA 3IT6B 1QOGA 4A8XC 2J53A 4YXDB 1MPEA 3O13A 3P63A 5D3DA 1XLNA 1V1OA 2H89B 2NTSA 3FILB 1UWXA 3H8HA 3KWVA 4KGRA 4YSZB 3P4QB 1YMHE 2K5PA 4RF1A 3SFDB 1BMLC 3T3OA 3PO0A 4HEA1 4H2AA 2KDMA 2JXTA 1OQQA 1VLBA 4RGTA 1KTKA 2JZPA 1YNTE 3V05A 1DOXA 1YN3A 4JWUC 1FCCC 2WXLA 1GB1A 3AM9A 3MFGA 3U4EG 1D5MC 1F2RI 2BT6A 2WXFA 3J9CA 3WCQA 1GOZA 1N5WA 2ZW1A 3KQ4A 4L2YA 1ENFA 5FK9C 1E10A 2JSVX 3VR8B 1TS2A 2BS2B 2PVOD 1SXTA 2LMCA 3B2GA 3GS2A 1C77A 3AE1B 1VRAB 3FAHA 1SSNA 1GB4A 2JWUA 4WQMA 3TEWA 3LB8C 1Q10A 2BB5A 4IOIE 1QILA 2DYOA 4XWWA 1J7BA 5BYQA 1N61A 1TS5A 1NYQA 1L4ZB 1KFYB 2ON8A 3TUOA 1N63A 1QQRA 1V1PB 4N58A 2V0GA 2DBYA 4RGOS 3E9SA 1C4PA 3AEBB 5FKAC 3U2SC 2BYTA 2MEKA 1C78A 4RH6A 1ZP0B 1TJEA 2WXNA 3R2IA 2BBCA 3R8BA 1QLBB 3NS1A 1N5XA 1CK1A 3BK2A 4IKGA 1VZ7A 2BS4B 4UDUC 2AX5A 3BVZA 2W3SA 1YJJA 2E3TA 3AE2B 3IT4B 3Q8BA 1XF5L 3BIID 3U7ZA 1MHXA 4EE2A 1P7FA 1ZUD2 2IJ0A 2PMVA 2MJEA 2PKOA 1J7CA 3AEEB 1QOBA 4OHJA 4XDCA 1C9FA 1HZ5A 4RGMA 1JQ4A 1E7PB 3ZYYX 3SEBA 1SB3C 1FRRA 3Q8FA 1ZDXA 1AYFA 3TEXA 5AUIA 5LNK1 4ZRQA 1PDXA 1PUTA 1FXAA 4FXCA 4IDIA 3W2DA 2LHDA 3GP7A 2J52A 2INPE 2KQ4X 2BW2A 2WXKA 4RGNA 3OWEB 3HUIA 3HVDA 1PGBA 4A9AA 3BWUD 4OZCA 3W1SA 1HA5A 2MJ3A 1FNWA 1P7EA 2FUG1 4KKJA 2WU5B 3E56A 4ZYSA 5HFYA 2CU3A 2QIEB 1EU4A 1FO4A 1WXQA 1CJEA 1SF0A 1ZE3D 2RPVA 3CIRB 3LYYA 2V3NA 1K52A 1ET9A 2YEPF 5C3JB 4YTPB 1YQ4B 3AE8B 3VRAB 2X38A 2LFIA 4N59A 3NUHB 3ZGZA 4KX6B 1OFFA 4PT5A 4TSSA 1GAQB 1IBXA 2OHFA 3ABVB 3ZJUA 1FCLA 1WSPA 3NVYA 3V3XA 1FNUA 2NMQA 4OZAA 2L83A 4RF0A 4OVZA 2ACZB 4XWTA 4YT0B 3CWIA 3C8YA 3AE7B 1KRHA 1CZPA 2IDYA 1UNSA 4REZA 2QILA 3Q69A 1V8CA 4JPSA 4AS1A 1BUIC 2V3PA 5JXVA 3DWGC 1I4QA 1KLGD 4Q2JA 4NAMA 2M56B 1I7HA 1SBBB 1ZPSA 1JW9D 3BYTB 4JE3B 1RYJA 2BS3B 2QEJC 2K22A 2WXHA 3NRZA 2ZW0A 3SR6A 2IGDA 4C7YA 4USAA 3VR9B 4US9A 2WLBA 1HXYD 1D5ZC 4ZHOA 2AQ2B 2GI9A 1QOFA 4ZOHC 2WXOA 5T8IA 2KAJA 4P16A 4KGTA 3KLSX 1ET6A 4N6EB 1NEKB 3P4SB 2PLPA 1JWSD 2Y3AA 3RFZB 1XCQL 1FFUA 1FIQA 1TKYA 1N60A 3AH7A 1HEZE 4NAWB 1QT9A 3AE4B 1VZ8A 2EELA 3NVWA 1L0XB 2QMTA 1JWAD 1JWMD 1XLPA 2D5GA 2WQYB 4KGSA 2WNMA 2L52A 5H92C 2W54A 1PGAA 1I4XA 2WXPA 4XE0A 1UUPA 2JU6X 2DWQA 2LGIA 3BYYB 4OZBA 2M19A 4LTUA 4RNAA 1B9RA 1EM7A 2XNAC 1TY0A 4JWSC 1ROEA 1VDVA 5HHDG 1XLOA 2LEKA 2N9LA 3LXFA 4HJGE 4OW0A 2FBWB 1I4GA 3FILA 1EWYC 1N62A 3AB5A 1WYGA 3RPFC 2WXQA 1PGXA 1RWSA 2FE8A 2JQRB 1BXTA 3NZ3A 1NYRA 1QOAA 1T5XD 2VZKB 4B0EA 2E6XA 4LLGM 1TYGB 1A70A 2RMMA 2YEPB 5EE0A 4TQ1A 5D3IB 2BTEA 2Q5WD 2V4IB 4M0WA 3Q8CA 5BMHA 1E9MA 3IAS1 1LO5D 1CQVA 2CJNA 1L5PA 1YJIA 2L1AA 3Q8EA 1T6BX 2GB1A 4HROA 2M0AA 1ZDVA 3MHZA 1KLUD 1I4RA 3TSSA 3IXSA 2INNE 3PZ7A 3AE3B 2K3UA 5TSSA 2Y5PA 2PVGC 3AE5B 2QJLA 1TY2A 4WAFA 2K0PA 1JRPA 1K53A 2WDQB 1JWUD 1PFDA 3EGRA 4GDLB 1GPXA 2IGGA 3T3NA 1I4HA 1M4VA 1VJKA 5BMGA 1J7AA 3SFEB 4WWMA 2PTLA 2WXMA 1KF6B 3AECB 4A90A 5GXGB 1PYWD 1SE4A 1V1PA 1ZOYB 3BVMA 1XO3A 2RDGA 1YN5A 1FM0D 1EWCA 3PZ8A 3TEZA 2LHEA 1C4CA 4L1BA 3NVZA 5HI1A 3Q8AA 4HKZE 1C4AA 1L0VB 3P42A 1XLQA 4LK0M 1AW7A 4C80A 2PIAA 4DQOC 4US8A 4WURA 4AQ7A 2IPKD 1TKGA 4NZLB 1R7SA 1F2RC 3I57A 1QF6A 4C7ZA 1SE3A 1SE2A 3EUB2 1SJHD 1XCTL 2N9KA 3DWMA 3W5VB 1FFVA 4GDKB 1FD6A 2R61A 2H88B 4R3DA 3KWLA 4ZRPA 1MI0A 2G1EA 4ARIA 3AEDB 1ZXHA 4DXFA 2WDRB 4RCOA 1IGDA 2GRIA 5HG2A 1FMAD 3HVZA 3B2FA 1ESFA 1D5XC 2JYTA 2NTTA 1F0ZA 5E6JA 1L4DB 5MPOA 2Y5CA 1EU3A 3ZQ4A 2LJIA 1AWDA 4B0MA 1TZOA 2MJDA 5G5GA 3UI3A 1OQRA 4C56C 4J3OD 1B1ZA 5EE3A 3AN1A 1WWTA 1V97A 4O1NA 1XEEA 3U52E 1E0ZA 2CJOA 2KWDA 4MH8A 1I4PA 2AQ1B 5EE9A 2KACA 2B76B 1JCKB 1SJED 1VZ6A 1K51A 3P4PB 4WIPA 4ITKA 1UWMA 3ZJTA 4ARCA 1FEHA 5C2TB 1FRDA 3I9V1 4XDDA 4A6QA 2W3RA 3L4PA 2L32A 2WXRA 4TMAB 1UGJA 1JROA 2WXGA 1DYQA 1YQ3B 2SAKA 5FR3A 1MHHE 1SIJA 3B9JA 1ACCA 4JX1C 4MT5A 5H8YE 2OEDA 3NVVA 4HRSA 1AN8A 2DYMA 3N9YC 3GB1A 4DXGA 2HDEA 4YWGG 4GLSC 3IAM1 1QKZA 3ZJVA 3AEGB 4TQ0A 2KMMA 1VR9A 2WS3B 3AEFB 4MACA 3W9CB 2VZKD 3ETRA 5D7GA 3AEAB 1RFKA 3TEYA 2WDVB 1JWBD 3VRBB 1Y56A 1IUEA 1D6EC 1JMLA 1IBXB 4YSXB 3P4RB 5AUKA 3AV8A 1C76A 4ZHPA 5BYSA 5I4DA 5G5HA 4RFBA 4YSYB 1L6UA 3VQIA 1C79A 1E6EB 1F77A 2TSSA 2Z8LA 3FC4A 4YTNB 1WGKA 2PW9A 5BYRA 2RDHA 2N0SB 2QSDA 1WRIA 3AE6B 2JYEA 3HRDD 3EA6A 3AE9B 2ONQA 4D2KA 1DOIA 1K50A 2DLBA 1SEBD 4NJCA 1TS4A 4P6VF 1FNVA 2G9HD 1IGCA 2EKIA 2J4XA 2SEBD 5BMIA 2AQ3B 3MJ5A 4A55A 1L0YB 1TKEA 1NI3A 1ZXIA 2I38A 1TS3A 1NENB 2K9XA 4L23A 2WXIA 3BK1A 2KN4A 2WP9B 1YN4A 1L6VA 1NVID 1KH0A 2HTME 2W82A 3BVGA 2XN9C 2LUMA 4KKIA 2I2YA 2ICIA 2JX5A 2WU2B 4WH4A 1MVKA 2N7JA 5EE1A 2J42A 1RM6C 3R2TA 2W55A 1JALA 1HZ6A 1DGJA 2WXJA 2BB6A 3MP9A 1T3QA 4MM3B 1STEA 4CQNA 2IGHA 3BZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW B;  5EE3 A;  3AN1 A;  1WWT A;  1V97 A;  1E0Z A;  1PDX A;  1EWY C;  1FXA A;  1N62 A;  1PUT A;  2CJO A;  2MH7 A;  1WYG A;  3AB5 A;  3AMZ A;  3P1M A;  4FXC A;  1FXI A;  4IDI A;  3RPF C;  3W5U B;  1DOY A;  1QOG A;  5EE9 A;  1RWS A;  2B76 B;  2JQR B;  4YXD B;  3HUI A;  1NYR A;  3P63 A;  4A9A A;  1QOA A;  1XLN A;  3P4P B;  4ITK A;  1TYG B;  1A70 A;  2H89 B;  1UWM A;  5EE0 A;  2MJ3 A;  5C2T B;  1FRD A;  4YSZ B;  3P4Q B;  2WU5 B;  4YTM B;  2Q5W D;  2CU3 A;  2QIE B;  2K5P A;  1E9M A;  1FO4 A;  3SFD B;  1WXQ A;  2W3R A;  1CJE A;  3PO0 A;  3L4P A;  2CJN A;  1SF0 A;  1L5P A;  1YJI A;  1OQQ A;  3CIR B;  1JRO A;  1VLB A;  1YQ3 B;  4HRO A;  1SIJ A;  3B9J A;  5C3J B;  4YTP B;  1YQ4 B;  3AE8 B;  3VRA B;  4JWU C;  4JX1 C;  1DOX A;  5H8Y E;  3NVV A;  4N59 A;  4HRS A;  4KX6 B;  1OFF A;  3AM9 A;  1GAQ B;  2BT6 A;  3AE3 B;  2OHF A;  3ABV B;  3WCQ A;  3AEG B;  1N5W A;  2PVG C;  2KMM A;  2WS3 B;  3AE5 B;  2QJL A;  3AEF B;  3W9C B;  3NVY A;  1E10 A;  1JRP A;  2WDQ B;  3ETR A;  3VR8 B;  2L83 A;  1RFK A;  3AEA B;  2BS2 B;  1PFD A;  2PVO D;  2ACZ B;  4YT0 B;  3B2G A;  2WDV B;  1JWB D;  3CWI A;  1GPX A;  3VRB B;  1IUE A;  3AE7 B;  1KRH A;  1CZP A;  3AE1 B;  1VJK A;  4YSX B;  3P4R B;  1J7A A;  5AUK A;  3FAH A;  1V8C A;  3AV8 A;  3SFE B;  4ZHP A;  4WWM A;  4WQM A;  5G5H A;  1KF6 B;  3AEC B;  1L6U A;  3DWG C;  3LB8 C;  4YSY B;  1E6E B;  2M56 B;  5GXG B;  1I7H A;  1ZOY B;  1XO3 A;  1FM0 D;  1JW9 D;  3FC4 A;  1RYJ A;  4YTN B;  2BS3 B;  1WGK A;  1J7B A;  2K22 A;  3NRZ A;  3NVZ A;  3SR6 A;  2N0S B;  4C7Y A;  1L0V B;  1N61 A;  1WRI A;  3AE6 B;  1XLQ A;  4USA A;  3VR9 B;  3HRD D;  4C80 A;  2PIA A;  1NYQ A;  3AE9 B;  4US9 A;  2WLB A;  4ZHO A;  4US8 A;  1DOI A;  1KFY B;  1TKG A;  1N63 A;  1R7S A;  4P6V F;  1QF6 A;  4C7Z A;  3EUB 2;  2EKI A;  4N58 A;  1QOF A;  3DWM A;  4ZOH C;  3W5V B;  1FFV A;  2KAJ A;  2DBY A;  3AEB B;  1TKE A;  2H88 B;  1NEK B;  3P4S B;  4N6E B;  3KWL A;  1NI3 A;  1TJE A;  1FFU A;  1FIQ A;  1TKY A;  1ZP0 B;  1N60 A;  1ZXI A;  2G1E A;  1NEN B;  1QT9 A;  2K9X A;  3AE4 B;  3AED B;  3AH7 A;  1QLB B;  2WP9 B;  3NS1 A;  1L6V A;  1N5X A;  2WDR B;  3NVW A;  1NVI D;  2BS4 B;  1JWA D;  1XLP A;  2AX5 A;  2HTM E;  2WQY B;  1FMA D;  3HVZ A;  2L52 A;  5H92 C;  2W3S A;  2W54 A;  3B2F A;  1YJJ A;  2E3T A;  3AE2 B;  1F0Z A;  3BII D;  2DWQ A;  2JX5 A;  2WU2 B;  5MPO A;  2M19 A;  1ZUD 2;  2Y5C A;  4LTU A;  5EE1 A;  1RM6 C;  1B9R A;  2MJE A;  2PKO A;  1J7C A;  1JAL A;  1AWD A;  2W55 A;  1QOB A;  3AEE B;  4JWS C;  1DGJ A;  2MJD A;  1JQ4 A;  1ROE A;  1VDV A;  5G5G A;  1E7P B;  3ZYY X;  1OQR A;  1SB3 C;  1FRR A;  1T3Q A;  1XLO A;  2LEK A;  1AYF A;  3LXF A;  5AUI A; 
#chains in the Genus database with same CATH topology
 1HQR D;  1LGR A;  2ZNV B;  2LGS A;  4YTM B;  3APC A;  4LCD E;  4FBJ B;  3K9P B;  5C23 A;  2BYE A;  1XLN A;  2NTS A;  1UWX A;  2MHJ A;  4NJ6 A;  1YMH E;  1TT5 B;  1D3Z A;  2K5P A;  4RF1 A;  4LJP B;  3UQA A;  1BML C;  3B08 A;  2BGF A;  4GOC A;  3RMK C;  3PO0 A;  3VTW A;  4H2A A;  2KDM A;  2JXT A;  2L0F A;  1VLB A;  4FUL A;  3JVZ X;  1XQQ A;  3VTV A;  2WX1 A;  1DOX A;  3NHE B;  4JWU C;  1SGH A;  1FCC C;  2WXL A;  4GDL A;  3U4E G;  1F2R I;  2WXF A;  2K6Q A;  2L76 A;  1KOT A;  3WCQ A;  1GOZ A;  1ENF A;  4HDO A;  1E10 A;  3ECI A;  3V60 A;  2LMC A;  2MX2 A;  3B2G A;  3GS2 A;  1C77 A;  2ZPY A;  4KDI C;  3OJ3 A;  1GB4 A;  3TBL D;  2DYO A;  1OEY J;  3RNA C;  4DXA B;  1N61 A;  2JZZ A;  3DCG A;  1NYQ A;  4IM0 A;  3AUL A;  4A3P A;  1I42 A;  3TMP B;  1V1P B;  1LQB A;  4N58 A;  5DPS A;  3ZVV A;  2DBY A;  4CYE A;  4RM8 A;  2MEK A;  3PSE B;  1C78 A;  4RH6 A;  3R8B A;  1UBQ A;  2XK5 B;  1QLB B;  1CK1 A;  4UDU C;  2KX0 A;  1Z2M A;  3Q14 C;  3AE2 B;  4B95 A;  3RI7 C;  3UGB B;  1P7F A;  1ZUD 2;  2L3Z A;  1TIF A;  3AEE B;  1QOB A;  2N1V A;  4OHJ A;  4QAY A;  1XT9 B;  1C9F A;  4RGM A;  1E7P B;  1ZDX A;  2JRH A;  3LJ3 A;  3TEX A;  1L7Y A;  2NPT A;  2K8C A;  5AZF A;  2N9E B;  2J52 A;  2INP E;  2WXK A;  4RGN A;  2UYZ B;  3HUI A;  3APD A;  4MGK E;  4A9A A;  2KTR B;  1E7U A;  5HFY A;  4EFO A;  3NY5 A;  4EKU A;  1SF0 A;  3ZDM C;  3CIR B;  2YVC A;  1K52 A;  5CHV C;  4WJN A;  3W1S C;  5C3J B;  1YQ4 B;  3AE8 B;  4HPL B;  4NNJ B;  2LFI A;  1OFF A;  4PT5 A;  1IBX A;  3ZLZ A;  1WJ4 A;  3QC8 B;  4GN1 A;  5JHA A;  2ACZ B;  3CWI A;  2JWZ A;  3AE7 B;  1CZP A;  4TUU A;  4AS1 A;  1BUI C;  5D94 A;  2VH2 A;  3BYT B;  3DBR B;  1RYJ A;  2Z59 B;  3SR6 A;  2WXH A;  4C7Y A;  2CR5 A;  2IGD A;  4PS7 A;  4USA A;  3PPA A;  4ZHO A;  1HXY D;  5T8I A;  2BKR B;  2L0T A;  2GBR A;  2CHX A;  3I3T B;  5C1Z A;  2PLP A;  2KMC A;  3RFZ B;  2CS4 A;  1N60 A;  3AH7 A;  2DNF A;  1JWM D;  1XLP A;  2WNM A;  5H92 C;  1J19 A;  3QAR A;  1UUP A;  3BYY B;  4OZB A;  2M19 A;  4RNA A;  1EM7 A;  2XNA C;  1WXA A;  2IY1 B;  4HJG E;  2FBW B;  2JY6 A;  1WYG A;  3VUY A;  3PVL A;  4E74 A;  2D3A A;  4HVB A;  2V1Y A;  2LI5 A;  3NZ3 A;  5JZE B;  4K81 A;  4LLG M;  3DHH C;  4PK1 A;  4M0W A;  2C60 A;  3Q8C A;  4XZ4 A;  1L5P A;  2WYQ A;  3L08 A;  4HRO A;  1UH6 A;  1I4R A;  3TSS A;  1WYW B;  2WX0 A;  2KNB A;  3KUC B;  3PZ7 A;  3AE3 B;  1GG3 A;  4LJO B;  5CHW A;  2KLG A;  1TY2 A;  3QIJ A;  1WF9 A;  5IKC M;  1K53 A;  4DHJ D;  4GDL B;  1GPX A;  2IGG A;  2ZEQ A;  3T3N A;  4GXB A;  5BMG A;  3SFE B;  4LDT B;  4WWM A;  3IBE A;  1Z5S B;  3AEC B;  3Q6B A;  3AU4 A;  1YN5 A;  1EWC A;  3PZ8 A;  2FUH B;  1C4C A;  2MBE A;  1L0V B;  5IOI A;  3P42 A;  4LK0 M;  2KHW B;  2KLC A;  4E71 A;  4DQO C;  2LRU A;  4AQ7 A;  1R7S A;  1F2R C;  1HTO A;  1QF6 A;  4C7Z A;  3EUB 2;  5LLI A;  3VTU A;  1SJH D;  2LVQ A;  4URK A;  3W5V B;  2AEH A;  4DDI D;  5J2R A;  1FPY A;  1WH3 A;  2R61 A;  1WXS A;  3C0R B;  4ZRP A;  1MI0 A;  4DXF A;  2N9P C;  2WDR B;  3L0W B;  4J6I A;  4N9F 4;  3K9O B;  4WWN A;  2LJI A;  3MHS D;  1FXT B;  5G5G A;  5D6J B;  3A33 B;  5IO9 A;  1OQR A;  2M17 A;  3HM3 A;  3U30 A;  3PRM B;  4J3O D;  1B1Z A;  3DVN U;  5EE3 A;  3VFK A;  3GZN B;  2CJO A;  2KWD A;  2YLM A;  1I4P A;  4MH8 A;  2B3A A;  2LRW A;  5LXH A;  1WR6 E;  1JCK B;  2KJR A;  1SJE D;  1WJN A;  1UWM A;  3ML9 A;  2NPT B;  5C2T B;  1RRB A;  2QHO A;  2IND C;  2AL6 A;  3QJZ A;  3GE8 C;  1DYQ A;  2SAK A;  1MHH E;  3B9J A;  2Z0D B;  4JX1 C;  4MT5 A;  2OED A;  4HRS A;  4GDK A;  2HDE A;  4YWG G;  5J18 A;  2WHI A;  1VR9 A;  2QDF A;  2NBV B;  3ETR A;  2JF5 A;  1WM3 A;  3DQV A;  4AP4 C;  4B9K A;  3TEY A;  1XD3 B;  3TL5 A;  3WAO A;  3VRB B;  1IUE A;  1D6E C;  4EEW A;  1IBX B;  3VH3 B;  4KDL B;  2M1M A;  2QC8 A;  3EC8 A;  2ZCC A;  1F77 A;  4KV2 A;  2TSS A;  1YJ1 A;  2WWZ A;  3FC4 A;  4YTN B;  1WGK A;  4W9F A;  3PRP B;  2PW9 A;  2DAJ A;  2KZR A;  1S3S G;  3AE6 B;  3HRD D;  2ONQ A;  3EFC A;  4NJC A;  3OAW A;  2D3G A;  2K8H A;  1L0Y B;  1TKE A;  1C1Y B;  4MDK E;  2MP2 A;  1NI3 A;  2K9X A;  3H1U A;  2WXI A;  3BK1 A;  2NBU A;  2IYD B;  4A3O A;  1GUA B;  4CO7 A;  3BVG A;  3PT2 B;  4KKI A;  2KC2 A;  4W9C A;  1TGZ B;  2MW5 A;  4W9I A;  2DAF A;  2JX5 A;  2WU2 B;  2N7J A;  1H8C A;  1C3T A;  3RT3 B;  3ZDT A;  2JRI B;  2GBM A;  2KKC A;  4MSM B;  1Q5W B;  3P1M A;  3DBR I;  1WI0 A;  2XBB C;  3NZS A;  3WAN A;  1FXI A;  1DOY A;  3IT6 B;  1QOG A;  4A8X C;  2J53 A;  2DZK A;  1EF1 A;  4HJK A;  1MJD A;  4W9D A;  2WGS A;  4DWF A;  3Q3F A;  3H8H A;  3KWV A;  1R4M B;  4W9G A;  5BO4 B;  4YSZ B;  4IM2 A;  4BKS D;  3SFD B;  2K8B A;  2KDF B;  3V61 A;  4W9L A;  1OQQ A;  4RGT A;  4W9J A;  3ALB A;  1YNT E;  4M00 A;  1YN3 A;  1L2N A;  1GB1 A;  4IWQ A;  4M0W B;  2O6V D;  4L2Y A;  3RNE C;  3ZNH B;  3HM6 X;  2GBK A;  2MRP A;  3HHM A;  4ANV A;  1SXT A;  1VRA B;  2BVC A;  4KSK C;  2JWU A;  1QIL A;  4ASW C;  1GJZ A;  2I1K A;  2RPQ A;  5BYQ A;  1TS5 A;  2LD9 A;  3TUO A;  1N63 A;  1JRU A;  4RM9 A;  2MLB A;  2V0G A;  3E9S A;  3PRE A;  3ZO5 B;  3AEB B;  4K7U A;  3U2S C;  4FA6 A;  2BYT A;  3N3K B;  1WFY A;  1ZP0 B;  3HIZ A;  4BKS A;  2J7Q B;  2FID A;  2AX5 A;  3PV1 A;  3BY4 B;  1YOV B;  3Q8B A;  1WJU A;  1E8W A;  3AXC A;  4EE2 A;  4PYZ A;  2IJ0 A;  2MJE A;  3Q3N C;  3UIP B;  2ZVN A;  2O6V A;  4K3B A;  1WGD A;  3ZYY X;  3SEB A;  1SB3 C;  4NY0 A;  3N20 C;  5LNK 1;  2KK8 A;  1PDX A;  4LNN A;  1FXA A;  4ZRQ A;  4AOF A;  3W2D A;  1WE6 A;  3R3M A;  2BW2 A;  2IO2 B;  4BZA A;  4S0R A;  3M63 B;  1PGB A;  3W1S A;  4OZC A;  3T8M A;  5G55 A;  3VUX A;  2FUG 1;  4KKJ A;  3E56 A;  1GC7 A;  3JSV A;  4AUQ C;  3A4R A;  3LYY A;  2V3N A;  4K3C A;  2R2Q A;  4YTP B;  3RNB C;  4JQW C;  4N59 A;  3T9L A;  3NUH B;  4KX6 B;  1GAQ B;  2PE9 A;  3AU5 A;  3SU8 X;  3APF A;  1E8X A;  4OVZ A;  2CKH B;  3GZN I;  4DHZ E;  1KRH A;  2IDY A;  3ZKJ C;  1F1H A;  1ZW7 A;  2V3P A;  2M56 B;  3LDZ E;  1SE9 A;  3ONS A;  1SBB B;  4M8N A;  3H9D A;  3KUD B;  4S17 A;  1BT0 A;  2K22 A;  2ZW0 A;  4FJV B;  3UIO B;  3N1X C;  4XX5 A;  3DBH B;  2FCQ A;  2GI9 A;  4DHZ B;  3KUZ A;  2ZJD A;  2CHZ A;  2KQ7 A;  4N6E B;  1JWS D;  2FIF A;  2Y3A A;  1QT9 A;  2KVZ A;  2EEL A;  1WE7 A;  2RGF A;  3NVW A;  4I6N B;  1M94 A;  2WQY B;  2D5G A;  1OTR B;  2L52 A;  2W54 A;  2KX3 A;  4HPP A;  1EF5 A;  2JU6 X;  3MC9 A;  2JZ3 B;  5G2N A;  2KFJ A;  3PHW B;  2G4D B;  1TY0 A;  3L10 B;  3U8Z A;  3UF8 A;  2G45 B;  1ROE A;  1VDV A;  2R2O A;  1WIA A;  1XLO A;  2RDB C;  2LEK A;  3LXF A;  1I4G A;  3ZNZ B;  1R4N B;  1N62 A;  3RPF C;  2KJH B;  2D07 B;  1PGX A;  3KYC D;  1BXT A;  3H7S A;  1NYR A;  1MG4 A;  4XYC A;  1A5R A;  2X8X X;  1TYG B;  2RMM A;  2KXJ A;  5EE0 A;  1YQB A;  2D10 A;  4MH0 E;  2BTE A;  2Q5W D;  2V4I B;  5BMH A;  1E9M A;  2ZCB A;  3HK0 A;  2CJN A;  1YJI A;  2K25 A;  4XGA B;  3Q8E A;  3KVF B;  1T6B X;  1P3Q U;  1VD2 A;  2LVO A;  4LNK A;  1ZDV A;  5IP4 D;  2C7N B;  1V81 A;  1KLU D;  3UIN B;  5TSS A;  2K39 A;  4AJY B;  3AE5 B;  2QJL A;  3A9K B;  1JRP A;  2OJR A;  4BBN F;  4HK2 A;  2ASQ A;  1PFD A;  3A1Q A;  3DDC B;  1GC6 A;  1YX5 B;  4IG7 B;  2L8J A;  1WGH A;  1J7A A;  2JT4 B;  2KYW A;  1KF6 B;  4GB9 A;  1PYW D;  1WZ3 A;  1LXD A;  3N1Z C;  1V2Y A;  2UWQ A;  1FM0 D;  4G0N B;  3ZUN A;  4BAX A;  3RYT A;  1R4M I;  3NVZ A;  2C7M B;  1XLQ A;  1P98 A;  4C80 A;  1P1A A;  3TIX A;  4US8 A;  3I57 A;  2N9K A;  2O2V A;  3DWM A;  3AED B;  2IO1 B;  2L05 A;  3CF6 E;  1WX9 A;  5HG2 A;  3V62 A;  3HVZ A;  2JYT A;  1MG8 A;  3QCA A;  5MPO A;  4B0M A;  1TZO A;  1OQY A;  2BKF A;  3D32 A;  2LJ5 A;  2O6V B;  4JL9 A;  2C9W B;  1VZ6 A;  1K51 A;  1WGR A;  2LGX A;  3P4P B;  4WIP A;  3CSF A;  1WRD B;  4OVU A;  2KFK A;  3I9V 1;  2MWS B;  2Y5B B;  4AJW A;  2W3R A;  2JVC A;  3L4P A;  2KDI A;  2L32 A;  4G11 A;  4TMA B;  4IWO A;  1I35 A;  1UGM A;  1PQS A;  4KZC A;  2KQS A;  5H8Y E;  3JSV B;  2J0J A;  3ZNG C;  2KMA A;  3W9C B;  2WS3 B;  3AEF B;  5D7G A;  3AEA B;  4BOZ B;  1YX6 B;  2HJ1 A;  1JWB D;  2PEA A;  2JPH A;  1JML A;  3AV8 A;  5JHB A;  1C76 A;  3SDL C;  4RFB A;  3PLU A;  2Z8L A;  4F8C B;  3KW5 B;  3L16 A;  2RDH A;  2N0S B;  2QSD A;  1WRI A;  3RNC C;  2JYE A;  4KSL C;  3EA6 A;  1F52 A;  1DOI A;  1TS4 A;  4P6V F;  2G9H D;  2EKI A;  2J4X A;  3Q3J A;  5BMI A;  2KAN A;  2XEW A;  2ZVO A;  4A55 A;  1UD7 A;  3A4S C;  4IUM B;  2KN4 A;  2WP9 B;  1L6V A;  4B6W A;  1NVI D;  2HTM E;  3C19 A;  2XN9 C;  2A4Z A;  1HTQ A;  2D2Q A;  4JIO U;  4PYU A;  1RAX A;  4K7S A;  1F9J A;  2FCS A;  2KC1 A;  1MVK A;  3ZTD A;  5EE1 A;  1RM6 C;  4G50 A;  2W55 A;  1JAL A;  2RSU A;  4EOY A;  2G3Q B;  1STE A;  3BZD B;  2PPH A;  4HKQ A;  2MH7 A;  2EKE C;  3AMZ A;  4G3X B;  4BBN C;  3WA0 A;  4MEM A;  4YXD B;  2DHZ A;  3S2A A;  3O13 A;  1TTN A;  3P63 A;  4ANU A;  3QX1 A;  3A9J A;  4EZJ A;  4PS3 A;  2LVP A;  2BWE S;  3P4Q B;  4E3C A;  4LNO A;  4HEA 1;  4F1S A;  2BYV E;  2JZP A;  4XC2 A;  3V05 A;  4MGZ E;  2K1F A;  3MFG A;  1D5M C;  2CHW A;  4TKN A;  3J9C A;  1N5W A;  4P1C C;  3KQ4 A;  4CHK A;  4M02 A;  5FK9 C;  3DPD A;  2JSV X;  3VR8 B;  2NCN A;  1J8C A;  3QHT A;  2PVO D;  5KHO A;  1R4N I;  3R7R A;  2MCN B;  2Z0E B;  3FAH A;  1SSN A;  3TEW A;  2BB5 A;  4M8M A;  4IOI E;  3A1Q B;  3IG3 A;  4XWW A;  1J7B A;  2IY0 B;  3CST A;  2L00 B;  2EMS A;  1L4Z B;  2ON8 A;  1CMX B;  1QQR A;  3KYD D;  1E7V A;  2NBW B;  1C4P A;  1TJE A;  3WAP A;  4FHK A;  2WXN A;  3NS1 A;  4W9E A;  2KJ6 A;  3BK2 A;  1VZ7 A;  4IKG A;  4FJY A;  5D2M B;  4W9H A;  1YJJ A;  2E3T A;  4ICU A;  4ZRJ A;  5FR6 A;  2ZPN A;  5IAA C;  2RD0 A;  2PMV A;  2PKO A;  2GBJ A;  4ZRK A;  4XDC A;  1HZ5 A;  1FRR A;  4K7W A;  1AYF A;  5AUI A;  5L95 C;  1NDD A;  1PUT A;  4FXC A;  2UU7 A;  2LHD A;  3OWE B;  4HCN B;  4HWI B;  1S1Q B;  3BWU D;  4IW0 A;  2K6D B;  2LWP A;  1HA5 A;  3RNG C;  1FNW A;  2WU5 B;  4ZYS A;  2CU3 A;  3EHV A;  2QIE B;  1FO4 A;  1UF0 A;  2FCM A;  3RCZ A;  2RPV A;  2V9H A;  2KFK B;  2X38 A;  3I63 C;  5JH5 C;  4TSS A;  3ABV B;  1X1M A;  1FCL A;  1MFW A;  1WSP A;  3NVY A;  4LNF A;  1FNU A;  1Y8R C;  2NMQ A;  4RF0 A;  3RD2 A;  4BFR A;  5IA7 A;  1UNS A;  3Q69 A;  1V8C A;  5E6N A;  2IBI B;  3OJ4 B;  4FN2 A;  1I4Q A;  1KLG D;  4Q2J A;  2JUO A;  1JW9 D;  1V9J A;  2LXC A;  2BS3 B;  3AI5 A;  2QEJ C;  3QQ8 B;  1D5Z C;  4F7Z A;  4HXD A;  4GSW A;  2L7R A;  3ZW3 A;  2KAJ A;  4P16 A;  3KLS X;  4GMV A;  3UQB A;  1NEK B;  3P4S B;  1FFU A;  1TKY A;  4II2 B;  4DDG D;  3PGE A;  3AE4 B;  1VZ8 A;  4BKG A;  1L0X B;  2QMT A;  2HE7 A;  3BIN A;  1PGA A;  2VRR B;  2MSE D;  3DHG C;  1AAR A;  2DWQ A;  2LGI A;  3ZNI D;  3V6C B;  1ZKH A;  4LTU A;  3R7Q A;  1V86 A;  4JWS C;  2G4S A;  1NBF C;  4ZRI A;  2N9L A;  4OW0 A;  5TR5 A;  3FIL A;  1V5O A;  3AB5 A;  3ZXV A;  3GE3 C;  1RWS A;  2JQR B;  2ZNV C;  4M01 A;  4WWP A;  1E5W A;  1T5X D;  2DX5 B;  3R66 C;  2GMI C;  1A70 A;  2YEP B;  5CX3 A;  4TQ1 A;  5D3I B;  1T0S C;  3IAS 1;  4FJZ A;  1WXV A;  1CQV A;  3A9J B;  2DYB A;  1QZE A;  1OEY A;  3N30 A;  2ZZP B;  3IXS A;  2INN E;  2IZV B;  2Y5P A;  4ACF A;  2PVG C;  2D3C A;  4DHJ B;  4WAF A;  2WDQ B;  5DPW A;  3NZU A;  2KO3 A;  1TZ1 A;  3FKY A;  1M4V A;  2M8S A;  2INC C;  5E6P A;  3DVG X;  3QWZ B;  4BVU C;  1SE4 A;  1XO3 A;  1U4A A;  3O65 B;  2LHE A;  5GMV A;  4L1B A;  1WR1 A;  3Q8A A;  1AW7 A;  3ENE A;  1TKG A;  1YIW A;  1SE3 A;  1SE2 A;  3L54 A;  1XCT L;  2KDB A;  1HE8 A;  4GDK B;  1FD6 A;  2H88 B;  4R3D A;  1WY8 A;  3KWL A;  3M3J A;  5LXI B;  2G1E A;  1ZXH A;  1FMA D;  2CU1 A;  4WJP A;  4MJS A;  1D5X C;  2NTT A;  2KD0 A;  5E6J A;  1L4D B;  2Y5C A;  1KLV A;  1EU3 A;  3ZQ4 A;  3RN9 C;  2MJD A;  4ANX A;  4C56 C;  3AN1 A;  3ZRC A;  3U52 E;  1E0Z A;  2AQ1 B;  2KAC A;  2B76 B;  1N6Z A;  1WM2 A;  5AZH A;  4JGH B;  4BKT A;  2IO0 B;  1K8R B;  4EZK A;  2MP2 B;  3ZJT A;  4ARC A;  2MQJ A;  1FEH A;  1FRD A;  4MSQ B;  1IYF A;  4A6Q A;  2PE6 B;  3N32 A;  2RR9 A;  1T0Q C;  1UGJ A;  3IFW B;  1SIJ A;  1ACC A;  3NVV A;  1AN8 A;  2DYM A;  3N9Y C;  4FLH A;  3GB1 A;  2M0X A;  4K1R B;  4GLS C;  1QKZ A;  3ZJV A;  3AEG B;  4OVV A;  2KOX A;  2KMM A;  2VZK D;  4GGQ A;  4NJ7 A;  4TV3 A;  2BYF A;  3RNF C;  4IWP A;  2WDV B;  1Y56 A;  1RLF A;  4HLE A;  5AUK A;  1V80 A;  5BYS A;  5I4D A;  3VQI A;  1L6U A;  3PRZ A;  3GOE A;  1KJT A;  3NOB A;  5AEK B;  4NAW A;  3AE9 B;  4ZDV A;  4D2K A;  1K50 A;  1WZ0 A;  1SEB D;  2KWC A;  1IGC A;  3VUW A;  2MBB B;  2SEB D;  3M62 B;  1NI2 A;  2AQ3 B;  3JYU A;  3MJ5 A;  2VH1 A;  3VHT C;  1ZXI A;  1TS3 A;  1NEN B;  4I6L B;  3DHI C;  1UBI A;  4EZL A;  1KH0 A;  2W82 A;  3WAM A;  4EUT A;  2MBO A;  3VVW B;  4JLC A;  2I2Y A;  4NQL B;  3SD5 A;  2V3S A;  2J42 A;  3NJT A;  4WJQ A;  1HZ6 A;  1DGJ A;  2BB6 A;  3MP9 A;  1T3Q A;  2MA9 B;  4CQN A;  1D4B A;  3URY A;  1UEL A;  3MC0 B;  3W5U B;  1XXG A;  2EMT A;  1MPE A;  2HJ8 A;  3EFU A;  5D3D A;  1V1O A;  1J0G A;  2H89 B;  3FIL B;  5HKH A;  4KGR A;  3QK0 A;  3RUL A;  3T3O A;  3V6E B;  2MBQ A;  1WGG A;  4C4V A;  3IHP C;  4BOS C;  1KTK A;  2FCN A;  1Q1O A;  2OOB B;  3AM9 A;  2M4N A;  1WX7 A;  2BT6 A;  1WJ6 A;  4ANW A;  1WX8 A;  1Q0W B;  2ZW1 A;  2LXA A;  2I1J A;  3H7P A;  3OG5 A;  1TS2 A;  2BS2 B;  1SIF A;  3AE1 B;  4KIK A;  2HTH A;  1UZX B;  2OJW A;  4WQM A;  3LB8 C;  1Q10 A;  4IM3 A;  3N1Y C;  1E8Y A;  5E6O A;  4WWO A;  3Q3O C;  4HCP B;  1H4R A;  1KFY B;  4AWJ A;  2A5U A;  4I6P A;  4A20 A;  2NVU I;  2NR2 A;  1IP9 A;  4RGO S;  3DOW A;  5FKA C;  3R2I A;  2BBC A;  3SHQ A;  2PJH A;  1N5X A;  3L17 A;  2BS4 B;  3BVZ A;  3MC8 A;  2W3S A;  3ZRF A;  3IT4 B;  3U7Z A;  1XF5 L;  3BII D;  3OLM D;  1WMH A;  1MHX A;  2N4F A;  1J7C A;  3ML8 A;  1JQ4 A;  2AL3 A;  4MJS B;  5KHQ A;  3Q8F A;  5CHF A;  3TCA A;  4IDI A;  3GP7 A;  2KQ4 X;  4WQO B;  3HVD A;  4NPN A;  4P1B C;  1ISN A;  3Q2A C;  2MJ3 A;  3ZTC A;  1P7E A;  4IC7 B;  3PS6 A;  1EU4 A;  1WXQ A;  2D3B A;  2KWV B;  1CJE A;  4DK5 A;  2GBN A;  1EO6 A;  1ZE3 D;  1V49 A;  4KVG B;  1ET9 A;  2YEP F;  3L13 A;  3VRA B;  1LM8 B;  1ZGU B;  1T0Y A;  3ZGZ A;  2OHF A;  3X23 A;  3ZJU A;  3DBH I;  4HDQ A;  3V3X A;  1WGY A;  4OZA A;  2KVR A;  2L83 A;  4C00 A;  2GOW A;  4MGI E;  3DBL B;  4XWT A;  4YT0 B;  3C8Y A;  3EEC A;  4REZ A;  2QIL A;  4JPS A;  4YL8 A;  2LZ6 A;  5JXV A;  1G6J A;  3DWG C;  4MGY E;  4NAM A;  1I7H A;  1ZPS A;  4JE3 B;  3NRZ A;  3JW0 X;  3B0A A;  3VR9 B;  4US9 A;  2WLB A;  3VH4 B;  2AQ2 B;  3VXW A;  1QOF A;  4ZOH C;  2WXO A;  1OGW A;  4KGT A;  3PLV A;  1ET6 A;  1XCQ L;  1FIQ A;  4MEL A;  1HEZ E;  4NAW B;  3PZD A;  4PS8 A;  1JWA D;  2N9X A;  4KGS A;  1KM7 A;  2KN5 A;  4MM3 A;  3WIM A;  1I4X A;  2WXP A;  4XE0 A;  2BF8 B;  1B9R A;  1IPG A;  2NS5 A;  2BPS A;  2LGD A;  5HHD G;  2IO3 B;  3DVG Y;  1LFD A;  2LAS A;  3IVF A;  3W1Y A;  2BWF A;  1EWY C;  2KDE B;  2WXQ A;  4HPM B;  2FE8 A;  1VCB A;  2O2V B;  1QOA A;  2VZK B;  4B0E A;  2E6X A;  2AYO B;  2WDT B;  1YD8 U;  3TJP A;  3VDZ A;  2BQQ A;  3U7D A;  2DZJ A;  1LO5 D;  2L1A A;  2GB1 A;  2M0A A;  3P2B A;  3MHZ A;  4ZYN A;  2K3U A;  4P7I A;  2LGY A;  2D11 A;  4C4V B;  3H6N A;  5DCN A;  2K0P A;  4X57 B;  1JWU D;  3EGR A;  3VAW A;  1I4H A;  2REX A;  1VJK A;  5EDS A;  3NS8 A;  1E90 A;  3H7P B;  2PTL A;  2WXM A;  4A90 A;  5GXG B;  1V1P A;  1ZOY B;  3BVM A;  2RDG A;  2FAZ A;  3TEZ A;  3RZF A;  5HI1 A;  2GLS A;  4HKZ E;  4FHJ A;  1C4A A;  4KIK B;  4WAA A;  2JXX A;  1T0R C;  2J0K A;  2PIA A;  2XK5 A;  4WUR A;  2IPK D;  4NZL B;  2C7H A;  3Q3M C;  1FFV A;  4WJO A;  4ARI A;  3B1L X;  3PHX B;  1V5T A;  1IGD A;  4RCO A;  2GRI A;  3B2F A;  1ESF A;  1F0Z A;  1GNU A;  4RMA A;  1V6E A;  3RZW C;  1AWD A;  1TBE A;  3UI3 A;  2N7E A;  1WMH B;  1WWT A;  1V97 A;  3A9K A;  1XEE A;  4O1N A;  4KZ0 A;  2V4L A;  2KTR A;  1P9D U;  2KT7 A;  3QAQ A;  5DPR A;  1WXM A;  5EE9 A;  4ITK A;  2FNJ B;  5AZG A;  4ICV A;  1EUV B;  4XDD A;  5CTR C;  1P0R A;  5DPT A;  2WXR A;  1JRO A;  2WXG A;  3DVN V;  1YQ3 B;  5FR3 A;  3MJW A;  2DZM A;  3PTF C;  4DXG A;  2N7D A;  3IAM 1;  3M95 A;  4TQ0 A;  4MAC A;  2N1W A;  1RFK A;  4FAD A;  3QA8 A;  3MTN B;  4NQK E;  2C5L C;  2HD5 B;  2KTF A;  3CMM B;  3I5J C;  4YSX B;  3P4R B;  2MBH A;  2LUE A;  3ZIM A;  4ZHP A;  5G5H A;  4YSY B;  1C79 A;  1E6E B;  2DEN B;  5BYR A;  2QCZ A;  2DLB A;  3DBS A;  2KWU B;  1FNV A;  3ZXR A;  5IN7 A;  1RFA A;  4DBG A;  2I38 A;  4L23 A;  3RUI B;  3KH0 A;  4GIV A;  1YN4 A;  5J17 A;  4LDT D;  2AWT A;  3NG0 A;  3WAL A;  2LUM A;  4LNI A;  2J0M A;  4W9K A;  2ICI A;  4GU2 A;  3DBL I;  1E8Z A;  4WH4 A;  5L83 A;  3R2T A;  2W9N A;  3X0W A;  2WXJ A;  2DZI A;  4MM3 B;  2IGH A;  4II3 B; 
#chains in the Genus database with same CATH homology
 1D4B A;  3URY A;  1HQR D;  4HKQ A;  3MC0 B;  2MH7 A;  3AMZ A;  3P1M A;  4YTM B;  1DOY A;  3W5U B;  1FXI A;  1XXG A;  3IT6 B;  1QOG A;  4A8X C;  2J53 A;  4YXD B;  1MPE A;  3O13 A;  3P63 A;  5D3D A;  1XLN A;  1V1O A;  2H89 B;  2NTS A;  3FIL B;  1UWX A;  3H8H A;  3KWV A;  4KGR A;  4YSZ B;  3P4Q B;  1YMH E;  2K5P A;  4RF1 A;  3SFD B;  1BML C;  3T3O A;  3PO0 A;  4HEA 1;  4H2A A;  2KDM A;  2JXT A;  1OQQ A;  1VLB A;  4RGT A;  1KTK A;  2JZP A;  1YNT E;  3V05 A;  1DOX A;  1YN3 A;  4JWU C;  1FCC C;  2WXL A;  1GB1 A;  3AM9 A;  3MFG A;  3U4E G;  1D5M C;  1F2R I;  2BT6 A;  2WXF A;  3J9C A;  3WCQ A;  1GOZ A;  1N5W A;  2ZW1 A;  3KQ4 A;  4L2Y A;  1ENF A;  5FK9 C;  1E10 A;  2JSV X;  3VR8 B;  1TS2 A;  2BS2 B;  2PVO D;  1SXT A;  2LMC A;  3B2G A;  3GS2 A;  1C77 A;  3AE1 B;  1VRA B;  3FAH A;  1SSN A;  1GB4 A;  2JWU A;  4WQM A;  3TEW A;  3LB8 C;  1Q10 A;  2BB5 A;  4IOI E;  1QIL A;  2DYO A;  4XWW A;  1J7B A;  5BYQ A;  1N61 A;  1TS5 A;  1NYQ A;  1L4Z B;  1KFY B;  2ON8 A;  3TUO A;  1N63 A;  1QQR A;  1V1P B;  4N58 A;  2V0G A;  2DBY A;  4RGO S;  3E9S A;  1C4P A;  3AEB B;  5FKA C;  3U2S C;  2BYT A;  2MEK A;  1C78 A;  4RH6 A;  1ZP0 B;  1TJE A;  2WXN A;  3R2I A;  2BBC A;  3R8B A;  1QLB B;  3NS1 A;  1N5X A;  1CK1 A;  3BK2 A;  4IKG A;  1VZ7 A;  2BS4 B;  4UDU C;  2AX5 A;  3BVZ A;  2W3S A;  1YJJ A;  2E3T A;  3AE2 B;  3IT4 B;  3Q8B A;  1XF5 L;  3BII D;  3U7Z A;  1MHX A;  4EE2 A;  1P7F A;  1ZUD 2;  2IJ0 A;  2PMV A;  2MJE A;  2PKO A;  1J7C A;  3AEE B;  1QOB A;  4OHJ A;  4XDC A;  1C9F A;  1HZ5 A;  4RGM A;  1JQ4 A;  1E7P B;  3ZYY X;  3SEB A;  1SB3 C;  1FRR A;  3Q8F A;  1ZDX A;  1AYF A;  3TEX A;  5AUI A;  5LNK 1;  4ZRQ A;  1PDX A;  1PUT A;  1FXA A;  4FXC A;  4IDI A;  3W2D A;  2LHD A;  3GP7 A;  2J52 A;  2INP E;  2KQ4 X;  2BW2 A;  2WXK A;  4RGN A;  3OWE B;  3HUI A;  3HVD A;  1PGB A;  4A9A A;  3BWU D;  4OZC A;  3W1S A;  1HA5 A;  2MJ3 A;  1FNW A;  1P7E A;  2FUG 1;  4KKJ A;  2WU5 B;  3E56 A;  4ZYS A;  5HFY A;  2CU3 A;  2QIE B;  1EU4 A;  1FO4 A;  1WXQ A;  1CJE A;  1SF0 A;  1ZE3 D;  2RPV A;  3CIR B;  3LYY A;  2V3N A;  1K52 A;  1ET9 A;  2YEP F;  5C3J B;  4YTP B;  1YQ4 B;  3AE8 B;  3VRA B;  2X38 A;  2LFI A;  4N59 A;  3NUH B;  3ZGZ A;  4KX6 B;  1OFF A;  4PT5 A;  4TSS A;  1GAQ B;  1IBX A;  2OHF A;  3ABV B;  3ZJU A;  1FCL A;  1WSP A;  3NVY A;  3V3X A;  1FNU A;  2NMQ A;  4OZA A;  2L83 A;  4RF0 A;  4OVZ A;  2ACZ B;  4XWT A;  4YT0 B;  3CWI A;  3C8Y A;  3AE7 B;  1KRH A;  1CZP A;  2IDY A;  1UNS A;  4REZ A;  2QIL A;  3Q69 A;  1V8C A;  4JPS A;  4AS1 A;  1BUI C;  2V3P A;  5JXV A;  3DWG C;  1I4Q A;  1KLG D;  4Q2J A;  4NAM A;  2M56 B;  1I7H A;  1SBB B;  1ZPS A;  1JW9 D;  3BYT B;  4JE3 B;  1RYJ A;  2BS3 B;  2QEJ C;  2K22 A;  2WXH A;  3NRZ A;  2ZW0 A;  3SR6 A;  2IGD A;  4C7Y A;  4USA A;  3VR9 B;  4US9 A;  2WLB A;  1HXY D;  1D5Z C;  4ZHO A;  2AQ2 B;  2GI9 A;  1QOF A;  4ZOH C;  2WXO A;  5T8I A;  2KAJ A;  4P16 A;  4KGT A;  3KLS X;  1ET6 A;  4N6E B;  1NEK B;  3P4S B;  2PLP A;  1JWS D;  2Y3A A;  3RFZ B;  1XCQ L;  1FFU A;  1FIQ A;  1TKY A;  1N60 A;  3AH7 A;  1HEZ E;  4NAW B;  1QT9 A;  3AE4 B;  1VZ8 A;  2EEL A;  3NVW A;  1L0X B;  2QMT A;  1JWA D;  1JWM D;  1XLP A;  2D5G A;  2WQY B;  4KGS A;  2WNM A;  2L52 A;  5H92 C;  2W54 A;  1PGA A;  1I4X A;  2WXP A;  4XE0 A;  1UUP A;  2JU6 X;  2DWQ A;  2LGI A;  3BYY B;  4OZB A;  2M19 A;  4LTU A;  4RNA A;  1B9R A;  1EM7 A;  2XNA C;  1TY0 A;  4JWS C;  1ROE A;  1VDV A;  5HHD G;  1XLO A;  2LEK A;  2N9L A;  3LXF A;  4HJG E;  4OW0 A;  2FBW B;  1I4G A;  3FIL A;  1EWY C;  1N62 A;  3AB5 A;  1WYG A;  3RPF C;  2WXQ A;  1PGX A;  1RWS A;  2FE8 A;  2JQR B;  1BXT A;  3NZ3 A;  1NYR A;  1QOA A;  1T5X D;  2VZK B;  4B0E A;  2E6X A;  4LLG M;  1TYG B;  1A70 A;  2RMM A;  2YEP B;  5EE0 A;  4TQ1 A;  5D3I B;  2BTE A;  2Q5W D;  2V4I B;  4M0W A;  3Q8C A;  5BMH A;  1E9M A;  3IAS 1;  1LO5 D;  1CQV A;  2CJN A;  1L5P A;  1YJI A;  2L1A A;  3Q8E A;  1T6B X;  2GB1 A;  4HRO A;  2M0A A;  1ZDV A;  3MHZ A;  1KLU D;  1I4R A;  3TSS A;  3IXS A;  2INN E;  3PZ7 A;  3AE3 B;  2K3U A;  5TSS A;  2Y5P A;  2PVG C;  3AE5 B;  2QJL A;  1TY2 A;  4WAF A;  2K0P A;  1JRP A;  1K53 A;  2WDQ B;  1JWU D;  1PFD A;  3EGR A;  4GDL B;  1GPX A;  2IGG A;  3T3N A;  1I4H A;  1M4V A;  1VJK A;  5BMG A;  1J7A A;  3SFE B;  4WWM A;  2PTL A;  2WXM A;  1KF6 B;  3AEC B;  4A90 A;  5GXG B;  1PYW D;  1SE4 A;  1V1P A;  1ZOY B;  3BVM A;  1XO3 A;  2RDG A;  1YN5 A;  1FM0 D;  1EWC A;  3PZ8 A;  3TEZ A;  2LHE A;  1C4C A;  4L1B A;  3NVZ A;  5HI1 A;  3Q8A A;  4HKZ E;  1C4A A;  1L0V B;  3P42 A;  1XLQ A;  4LK0 M;  1AW7 A;  4C80 A;  2PIA A;  4DQO C;  4US8 A;  4WUR A;  4AQ7 A;  2IPK D;  1TKG A;  4NZL B;  1R7S A;  1F2R C;  3I57 A;  1QF6 A;  4C7Z A;  1SE3 A;  1SE2 A;  3EUB 2;  1SJH D;  1XCT L;  2N9K A;  3DWM A;  3W5V B;  1FFV A;  4GDK B;  1FD6 A;  2R61 A;  2H88 B;  4R3D A;  3KWL A;  4ZRP A;  1MI0 A;  2G1E A;  4ARI A;  3AED B;  1ZXH A;  4DXF A;  2WDR B;  4RCO A;  1IGD A;  2GRI A;  5HG2 A;  1FMA D;  3HVZ A;  3B2F A;  1ESF A;  1D5X C;  2JYT A;  2NTT A;  1F0Z A;  5E6J A;  1L4D B;  5MPO A;  2Y5C A;  1EU3 A;  3ZQ4 A;  2LJI A;  1AWD A;  4B0M A;  1TZO A;  2MJD A;  5G5G A;  3UI3 A;  1OQR A;  4C56 C;  4J3O D;  1B1Z A;  5EE3 A;  3AN1 A;  1WWT A;  1V97 A;  4O1N A;  1XEE A;  3U52 E;  1E0Z A;  2CJO A;  2KWD A;  4MH8 A;  1I4P A;  2AQ1 B;  5EE9 A;  2KAC A;  2B76 B;  1JCK B;  1SJE D;  1VZ6 A;  1K51 A;  3P4P B;  4WIP A;  4ITK A;  1UWM A;  3ZJT A;  4ARC A;  1FEH A;  5C2T B;  1FRD A;  3I9V 1;  4XDD A;  4A6Q A;  2W3R A;  3L4P A;  2L32 A;  2WXR A;  4TMA B;  1UGJ A;  1JRO A;  2WXG A;  1DYQ A;  1YQ3 B;  2SAK A;  5FR3 A;  1MHH E;  1SIJ A;  3B9J A;  1ACC A;  4JX1 C;  4MT5 A;  5H8Y E;  2OED A;  3NVV A;  4HRS A;  1AN8 A;  2DYM A;  3N9Y C;  3GB1 A;  4DXG A;  2HDE A;  4YWG G;  4GLS C;  3IAM 1;  1QKZ A;  3ZJV A;  3AEG B;  4TQ0 A;  2KMM A;  1VR9 A;  2WS3 B;  3AEF B;  4MAC A;  3W9C B;  2VZK D;  3ETR A;  5D7G A;  3AEA B;  1RFK A;  3TEY A;  2WDV B;  1JWB D;  3VRB B;  1Y56 A;  1IUE A;  1D6E C;  1JML A;  1IBX B;  4YSX B;  3P4R B;  5AUK A;  3AV8 A;  1C76 A;  4ZHP A;  5BYS A;  5I4D A;  5G5H A;  4RFB A;  4YSY B;  1L6U A;  3VQI A;  1C79 A;  1E6E B;  1F77 A;  2TSS A;  2Z8L A;  3FC4 A;  4YTN B;  1WGK A;  2PW9 A;  5BYR A;  2RDH A;  2N0S B;  2QSD A;  1WRI A;  3AE6 B;  2JYE A;  3HRD D;  3EA6 A;  3AE9 B;  2ONQ A;  4D2K A;  1DOI A;  1K50 A;  2DLB A;  1SEB D;  4NJC A;  1TS4 A;  4P6V F;  1FNV A;  2G9H D;  1IGC A;  2EKI A;  2J4X A;  2SEB D;  5BMI A;  2AQ3 B;  3MJ5 A;  4A55 A;  1L0Y B;  1TKE A;  1NI3 A;  1ZXI A;  2I38 A;  1TS3 A;  1NEN B;  2K9X A;  4L23 A;  2WXI A;  3BK1 A;  2KN4 A;  2WP9 B;  1YN4 A;  1L6V A;  1NVI D;  1KH0 A;  2HTM E;  2W82 A;  3BVG A;  2XN9 C;  2LUM A;  4KKI A;  2I2Y A;  2ICI A;  2JX5 A;  2WU2 B;  4WH4 A;  1MVK A;  2N7J A;  5EE1 A;  2J42 A;  1RM6 C;  3R2T A;  2W55 A;  1JAL A;  1HZ6 A;  1DGJ A;  2WXJ A;  2BB6 A;  3MP9 A;  1T3Q A;  4MM3 B;  1STE A;  4CQN A;  2IGH A;  3BZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...