5MPOA

Crystal structure of human molybdopterin synthase complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
b'SMVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin synthase sulfur carrier subunit
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human molybdopterin synthase complex
rcsb
total genus 22
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5mpoA00
2ACZB 3L4PA 3AE5B 3P4RB 2W3SA 3NVVA 3AE9B 3AH7A 1QLBB 1ROEA 2MJEA 3AE1B 1OQRA 5G5GA 3AN1A 1UWMA 1XO3A 1WXQA 1SF0A 1ZUD2 2MH7A 4ZHOA 1JROA 1OQQA 4US9A 2KMMA 4YTNB 1QOGA 1YJJA 2BS3B 3FC4A 1B9RA 1AWDA 3BIID 3VRBB 1DOYA 1VDVA 1AYFA 3PO0A 2HTME 3AE2B 4JWSC 1L5PA 1JWAD 4A9AA 1QOFA 3P1MA 1QF6A 1E10A 2Q5WD 1SIJA 3AEFB 3W9CB 3ETRA 1FXAA 3HUIA 2BT6A 3LB8C 2WU2B 1KFYB 2WP9B 1SB3C 2PVGC 3AMZA 4WWMA 1TKEA 2LEKA 3P4QB 1T3QA 4YTMB 1VLBA 1JALA 3AE6B 3AE8B 4C80A 1RYJA 2BS4B 1XLNA 2MJDA 1L0VB 1ZOYB 4C7YA 2BS2B 1XLQA 4N59A 1IUEA 1JWBD 1JW9D 3AEBB 2H89B 5AUIA 3DWGC 4US8A 3LXFA 1FRRA 3NVYA 1NI3A 2AX5A 1QT9A 3AECB 5C2TB 1NEKB 3P4SB 3ABVB 1L6VA 3B2FA 2PVOD 1N60A 2W54A 5EE1A 1FRDA 1E9MA 3RPFC 1WGKA 1EWYC 2WDVB 2B76B 3SFEB 1GAQB 3NVWA 3P4PB 4ZHPA 1JQ4A 1XLOA 1N63A 4YSXB 1TKGA 1V8CA 3AE7B 4HRSA 1FM0D 3WCQA 4N6EB 4N58A 2JQRB 2W55A 3VRAB 1ZXIA 1YJIA 4YSYB 2WQYB 3HVZA 1TYGB 3AEDB 4USAA 1FFVA 2DWQA 1KF6B 1WYGA 2K5PA 4KX6B 1CZPA 4FXCA 3SFDB 2OHFA 1CJEA 2QJLA 1PFDA 4WQMA 2EKIA 3AEAB 1FXIA 3AM9A 1RM6C 3CWIA 2Y5CA 2WDRB 1DOXA 1E6EB 4YT0B 1N61A 2H88B 2G1EA 2WLBA 4JX1C 5H92C 3AEEB 3NVZA 2M19A 2L52A 3NS1A 3AE3B 2KAJA 2CJOA 1I7HA 1N62A 1V97A 3KWLA 1NENB 5H8YE 2FBWB 2QIEB 1NYQA 1N5XA 2M56B 1E7PB 2W3RA 4C7ZA 2L83A 1R7SA 1F0ZA 5G5HA 1FMAD 1FFUA 2DBYA 3CIRB 4LTUA 2MJ3A 1GPXA 1PDXA 2WDQB 1WWTA 1FO4A 5GXGB 1DGJA 3AEGB 1QOBA 1ZP0B 1TKYA 1VJKA 5C3JB 3B9JA 4JWUC 4IDIA 1QOAA 3B2GA 4YSZB 2E3TA 1YQ4B 3NRZA 2K9XA 4ITKA 5AUKA 2CU3A 2PKOA 1OFFA 1XLPA 3AB5A 3AV8A 3SR6A 3VR9B 5EE9A 1L6UA 3HRDD 2CJNA 3W5VB 1A70A 4HROA 1RFKA 1J7AA 5EE0A 1KRHA 1RWSA 1FIQA 3P63A 1TJEA 4YTPB 3VR8B 1YQ3B 3FAHA 1WRIA 4YXDB 1NVID 1NYRA 5MPOA 2K22A 3AE4B 3DWMA 1JRPA 4P6VF 2N0SB 1E0ZA 1PUTA 1DOIA 3W5UB 2WS3B 2WU5B 1J7BA 1J7CA 1N5WA 2PIAA 4ZOHC 5EE3A 3ZYYX 3EUB2 2JX5A
chains in the Genus database with same CATH superfamily
2PE6B 2PTLA 3RZFA 1Q1OA 4LLGM 2RDBC 1WXQA 4NY0A 3I3TB 2Y5BB 3FILB 3R2IA 1C9FA 4RGTA 1B9RA 2CU1A 3R66C 4RGOS 3DVNV 4XE0A 3T3OA 2KFKB 2N1WA 3DQVA 2LEKA 1EUVB 4KIKA 1WXVA 2N9LA 3DBLI 3RNCC 4C80A 4WJOA 4OVVA 4GU2A 3FKYA 4ZYNA 1QT9A 4C4VB 3B2FA 5EE1A 3RD2A 3NVWA 3ZNHB 2OEDA 3C8YA 1YNTE 3VRAB 3ONSA 1ZXIA 4ANWA 2O2VA 2I1KA 3TSSA 3N9YC 4FXCA 1WZ0A 4II3B 3TL5A 1JRUA 3NY5A 1V2YA 3OAWA 3R2TA 5AZGA 1D6EC 3BWUD 3Q6BA 2MA9B 2W3RA 2L83A 2YEPF 2C5LC 3PSEB 2CR5A 2MBOA 3BVZA 3KH0A 4DXFA 2ZW1A 2KX0A 4ZYSA 4EKUA 4RM8A 4GDLB 4LDTB 2J52A 1IPGA 4KDIC 2LMCA 4OW0A 2O6VD 1WH3A 2N0SB 3CSFA 3ENEA 1WRDB 3EUB2 4GIVA 3L4PA 3AE5B 1PGXA 2MQJA 2W3SA 3AE9B 4E74A 1JWSD 5DPTA 5CX3A 4HK2A 1R4NI 2GOWA 4BKSD 4WWPA 4ZRPA 2FE8A 3ZRCA 2OJWA 2Z8LA 4JWSC 3IAS1 3W9CB 1Y56A 2PVGC 2ZVOA 1P9DU 3PLVA 3GE8C 4G0NB 1ZOYB 3VXWA 1JW9D 4W9FA 4K81A 4IWOA 4TQ0A 5LXHA 2DX5B 1UWXA 5FKAC 2HDEA 4AJWA 1EF1A 2DYMA 2NPTB 2G3QB 2KTFA 3A4SC 5AEKB 3KUDB 3WCQA 2NMQA 1ZKHA 1UD7A 1P0RA 1C3TA 3KWVA 1FFVA 5KHQA 1CJEA 1ZGUB 4ZRIA 2JSVX 4NNJB 4WJQA 2JT4B 4YT0B 4L1BA 1ZE3D 4LDTD 3AEEB 4HJGE 2KWVB 3WIMA 1ZPSA 4IOIE 2ONQA 3PLUA 1OEYJ 3H7SA 1KH0A 3RI7C 1C4AA 5FK9C 4LJOB 1FFUA 3AU5A 3I9V1 3X23A 4KGRA 2WYQA 3L10B 1OFFA 3TMPB 2DHZA 3VAWA 3AI5A 2M1MA 2G9HD 3V61A 4YXDB 1FXTB 4OZCA 2XEWA 4KSLC 5KHOA 4RH6A 4BOSC 3K9OB 3E56A 2MBBB 1G6JA 3BY4B 1SBBB 2Y3AA 1HZ5A 1SXTA 4US9A 4WAAA 4ACFA 2KDEB 3BIID 1VDVA 3PZDA 1QOFA 2MBHA 2LXCA 4JQWC 3ETRA 1SB3C 2DZIA 1I4PA 1TKEA 2QSDA 1ACCA 2O6VA 2PE9A 4YTMB 2MSED 1WGYA 2BQQA 4IM2A 1F1HA 1STEA 3GS2A 4MH0E 3UIPB 4AUQC 5IKCM 2FCQA 1TS3A 3P4SB 1UH6A 2JYEA 3H8HA 2DYOA 1TT5B 1KTKA 1N63A 4F7ZA 3MJWA 3DDCB 2FIFA 2QC8A 1C76A 5G55A 5CHWA 1U4AA 1RAXA 1WJUA 2M4NA 3UINB 1CZPA 1UZXB 3V62A 2J0JA 4A3PA 4LCDE 1MHHE 2LRWA 1WMHA 5H92C 3WANA 2RDHA 3NVZA 1L0XB 3QK0A 3VTVA 1I7HA 2PEAA 1QILA 1TZOA 3EFUA 2DAJA 3DBRI 4MJSA 2DZJA 1SJED 1FMAD 3KUCB 1GPXA 3Q3JA 4XYCA 1P7FA 4M02A 4RF1A 5C3JB 2KJRA 4WJNA 2IO3B 1FCLA 4AS1A 2AYOB 2N7JA 3EGRA 4DHJD 1HA5A 3VUYA 2UWQA 3R8BA 1YQ3B 2Y5PA 3DWMA 1JRPA 1E0ZA 1F9JA 2L8JA 4NPNA 2L0TA 2WU5B 2J7QB 2JYTA 3A1QA 1GJZA 2L32A 5BMGA 1T0QC 1JWMD 2WXQA 2ON8A 1YD8U 1YJJA 4O1NA 1WIAA 3L17A 2LUMA 3Q8EA 1QF6A 2M0XA 1HZ6A 1FXAA 4PS7A 1KFYB 4DK5A 1E7VA 4IC7B 3V6CB 1D5MC 3A9KB 1V1PB 1VZ6A 2RR9A 5IO9A 4FJYA 2PW9A 2KLCA 3AXCA 1FRRA 3DBLB 5C2TB 1T0RC 3ZJUA 3QIJA 4GN1A 1WE6A 2EELA 5AZHA 3ZIMA 2JF5A 1YJIA 1V1PA 2MRPA 1B1ZA 3RZWC 3WAOA 2YVCA 2ZJDA 4KVGB 2Z0EB 4NJ6A 3L08A 4RFBA 4GOCA 2BGFA 3Q8AA 1IYFA 3Q3OC 3K9PB 4EZJA 3GOEA 1F2RI 4FLHA 2DZKA 2I2YA 2MP2B 1FD6A 2LGSA 3IBEA 4BVUC 1HEZE 2LHEA 1RRBA 1QOAA 5AUKA 2M17A 4OZAA 2K39A 5EE9A 2G4SA 2CJNA 2MLBA 1LXDA 3NOBA 2INDC 3FILA 5EE0A 4KDLB 3VR8B 3N32A 1FPYA 2QCZA 3CMMB 1DOIA 2VH1A 4A20A 1J7CA 1ZW7A 3DOWA 2M8SA 4E3CA 1SE2A 2MJEA 3QCAA 2D2QA 4WWOA 2JRIB 4MT5A 2RPVA 4HLEA 2AQ3B 2HTHA 2XK5B 3M3JA 3AEFB 3U7ZA 1PYWD 2KTRA 4WWMA 4BBNC 1IP9A 2WXNA 3ECIA 4FJZA 2VH2A 4KV2A 1K8RB 2KZRA 3M63B 2ZCBA 3H6NA 2LWPA 3U30A 2LVPA 5HG2A 4GMVA 4PS8A 1L6VA 1WGRA 4P7IA 4MGZE 1N60A 2I38A 3UQAA 2QILA 3P42A 1WGKA 3BYTB 1GAQB 3P4PB 4A90A 2M0AA 2FCSA 4BFRA 2N9XA 2WQYB 3WALA 3X0WA 1UELA 4Q2JA 3TJPA 4K3CA 2WDRB 2KWUB 1Z5SB 2UYZB 2JVCA 2KQSA 4JLCA 5IAAC 2K6QA 2K1FA 2KQ4X 1R7SA 4CHKA 3PV1A 2LFIA 3VTUA 1ZP0B 3ZXVA 3NZ3A 4KKJA 3NRZA 2J42A 2INNE 3DCGA 4ZDVA 3URYA 3LJ3A 2LHDA 1D4BA 5CHVC 3DBHB 5MPOA 3OJ4B 2NTTA 4PT5A 1M94A 1R4NB 4GXBA 4MSMB 4LNFA 1WX9A 5J2RA 2NBUA 3ZKJC 1QLBB 4FHKA 1ZDVA 1BMLC 2MH7A 4FADA 4ZHOA 3IG3A 3A4RA 5HFYA 1JWUD 1X1MA 2IJ0A 1AW7A 1IBXA 2WP9B 2K0PA 3APFA 2C7HA 2HJ1A 3GZNB 2R2QA 4FBJB 1SJHD 5IA7A 1XLQA 2WXRA 3RFZB 3AEBB 1H4RA 2FCMA 1C77A 4TV3A 2J0KA 4DHZE 3DHGC 2RD0A 3ZTCA 3H7PA 1OQYA 1EWYC 1VZ8A 2ZPYA 5E6NA 4K1RB 3VUXA 2KDFB 3HVZA 3RNEC 1A5RA 4ARCA 4A55A 3SFDB 1GUAB 1PFDA 3AEAB 2TSSA 1YN4A 1PQSA 3BVMA 4NAWA 2G1EA 2BF8B 2D3BA 2XNAC 1HXYD 3BZDB 2LGDA 1ZXHA 4W9CA 3V3XA 4GDKB 1F0ZA 2FUHB 1L2NA 4X57B 3CIRB 5FR3A 5JHAA 4HKZE 2WDQB 3LDZE 1FO4A 1QOBA 1TKYA 3B9JA 4JWUC 4IUMB 2D5GA 3V60A 2UU7A 3RT3B 3HRDD 4TKNA 2D3CA 1YOVB 2KMCA 4GDKA 3PREA 2RGFA 3RNBC 3U52E 5D3DA 1NVID 4DXGA 1K50A 4ANXA 1K53A 4M0WB 2JPHA 2WNMA 1VRAB 2GI9A 1TZ1A 3DBHI 3MJ5A 2LI5A 1AARA 1WXSA 5G5GA 5DPSA 3E9SA 4B0MA 2KNBA 2IO1B 4XZ4A 2AEHA 3S2AA 3ZRFA 3QJZA 1JWAD 3JSVB 3LYYA 2VRRB 3MC8A 1XD3B 4TQ1A 2KFJA 3W1SA 4E71A 2K8HA 4IG7B 2WXHA 2WXIA 4N59A 5L95C 3ABVB 5CHFA 1T0YA 5DCNA 2X8XX 2MBQA 3QA8A 4XDDA 1PGAA 1ISNA 1GNUA 2WXKA 3TEWA 2FIDA 1R4MI 2NCNA 4RM9A 1KF6B 3UF8A 1I4RA 1YQBA 5IOIA 4GGQA 1P98A 4ICVA 1OTRB 3AU4A 4DDID 2JY6A 1DYQA 5E6PA 1Q5WB 3AE3B 1OEYA 2CJOA 3KWLA 4W9GA 1WFYA 2WDTB 5BMHA 4NAMA 2NPTA 2WX0A 2ICIA 4MGYE 1C4CA 1SE9A 4HEA1 4RF0A 4IDIA 1TGZB 3Q8BA 3DBSA 1YQ4B 2Z59B 2KHWB 1XF5L 5I4DA 1WYWB 1MFWA 3KLSX 3EC8A 1RWSA 4NAWB 3L0WB 2CHXA 4WQOB 1V1OA 4HDOA 2KC2A 1J7BA 3MHSD 3I63C 1CK1A 2GBJA 3L54A 1AN8A 3M62B 4UDUC 2J0MA 3ALBA 4IKGA 1UWMA 1WM3A 1EU4A 2K25A 3D32A 5JZEB 2YEPB 1I42A 2WXLA 2D3AA 1MJDA 1LFDA 4WIPA 2A4ZA 2WX1A 4JGHB 1T6BX 2JZZA 2JRHA 2XN9C 1I35A 3AE8B 3NS8A 3PHWB 1ESFA 1YMHE 1L0VB 2LD9A 1V9JA 2ZEQA 2KJ6A 1S1QB 1HTOA 1BT0A 4DDGD 1K51A 2DYBA 2XBBC 2W54A 3B1LX 3RPFC 3C0RB 2IGDA 2GB1A 3UI3A 3SD5A 3AEDB 2KQ7A 4M8NA 2CS4A 1D3ZA 2NTSA 4LNKA 2BYFA 2X38A 2WXGA 3PVLA 3NS1A 2L1AA 3AULA 4CQNA 3V6EB 2KACA 3ZLZA 4IW0A 1UF0A 3EECA 4ZRQA 3SR6A 3QQ8B 1WR1A 3MFGA 4R3DA 1KRHA 4NZLB 1I4HA 2MX2A 1WRIA 2LRUA 1UNSA 1FNWA 3ZTDA 3W5UB 2XK5A 2E6XA 1N5WA 3HVDA 3ZNID 3Q8FA 2BB5A 2KOXA 4HKQA 1OQRA 3KQ4A 3GE3C 2N7EA 2L05A 2OOBB 3IT4B 2BS3B 2FNJB 3BVGA 3OJ3A 3TEYA 2AQ2B 3ZGZA 3L13A 4XDCA 1WGHA 3T3NA 3HHMA 1E10A 3EFCA 3HM6X 2K8CA 4YWGG 4P1BC 3ZVVA 3AE6B 1Z2MA 3OLMD 1WJ6A 5GMVA 3NUHB 4G3XB 2KDBA 3DWGC 2GLSA 2FUG1 3ZXRA 3JYUA 2N9KA 4QAYA 1V5OA 4URKA 1M4VA 4CO7A 4AOFA 1JQ4A 1D5ZC 2MWSB 4YSXB 2KJHB 1OGWA 4MJSB 3O65B 2JQRB 2PLPA 4XGAB 4YSYB 2LASA 1F2RC 5D6JB 3JW0X 3PPAA 1J19A 1FEHA 4EZKA 2QMTA 1RM6C 3CWIA 1NI2A 2LXAA 3R3MA 2N9EB 1UGMA 1NENB 2FBWB 3A9JB 1N5XA 2NS5A 2V3PA 4GSWA 5C23A 2KO3A 5G5HA 5BYQA 2DBYA 2L76A 1K52A 4MEMA 1DGJA 1MHXA 3RNGC 1R4MB 2JXXA 3PZ8A 2IPKD 1WMHB 2BPSA 2CU3A 3WAMA 3A1QB 4TMAB 1HTQA 2MCNB 3VQIA 3NHEB 4MACA 2N9PC 2JWUA 4P1CC 1PUTA 2KLGA 5CTRC 2ACZB 2ZNVB 4J3OD 3PT2B 3B08A 3P4RB 2GBMA 4KZCA 3MHZA 1I4XA 1KLGD 4IWPA 1GC6A 1XO3A 3AN1A 5IP4D 5BYRA 1JROA 1OQQA 2LJ5A 4IWQA 4YTNB 3VRBB 3PO0A 4AP4C 1SSNA 2LGXA 4JE3B 3IT6B 4HCPB 1RYJA 4WH4A 3RNFC 2REXA 1XLNA 2MJDA 1L7YA 2GMIC 1WY8A 1JWBD 4W9JA 1C1YB 3RMKC 2HJ8A 2V4LA 3RNAC 4ICUA 1EF5A 3MP9A 3ZW3A 4AQ7A 4EZLA 5HHDG 2DWQA 1JMLA 4JPSA 2GBRA 4NJ7A 2EKIA 4ANUA 3N30A 4GDLA 3RN9C 4CYEA 2SAKA 1E6EB 5J17A 2H88B 2BKRB 1ZDXA 2M19A 4F1SA 4PS3A 2BYEA 3UQBA 2KN5A 1WM2A 2V4IB 3PRPB 4G11A 2ZZPB 4MSQB 3PRMB 1V5TA 2D07B 1VJKA 3Q3FA 1XLPA 4FULA 2G45B 1J0GA 3DVGY 2OJRA 4EOYA 2ZVNA 1A70A 1YX5B 5D7GA 2KKCA 4II2B 4P16A 3VH4B 2RDGA 1YJ1A 3AE4B 2BWES 4P6VF 2VZKD 5EE3A 2BB6A 1GOZA 2L3ZA 3JSVA 2KT7A 2KTRB 2GBNA 3Q3MC 2ZW0A 3GZNI 4OHJA 3AE1B 3PHXB 4LJPB 1TTNA 3N3KB 3VHTC 4KKIA 1KM7A 1ZUD2 3TUOA 1L0YB 4A8XC 4EUTA 2LGIA 2KMMA 1QOGA 2R2OA 2C9WB 1DOYA 1EWCA 3DBRB 1TIFA 2ZNVC 4M00A 1GB4A 1VR9A 3P1MA 1SIJA 2MBEA 3KW5B 1GB1A 2K6DB 1T3QA 2PMVA 3W2DA 1C4PA 1QKZA 1VLBA 3J9CA 2K3UA 4S0RA 1VCBA 3CF6E 2JU6X 4RCOA 2ZCCA 3ZJTA 5AZFA 2G4DB 1XQQA 2KN4A 5TSSA 4GB9A 1P1AA 1UBIA 2PVOD 4JIOU 2J4XA 2NBWB 2KVZA 3SFEB 4KIKB 1TKGA 3AE7B 5DPWA 3ML8A 2W55A 1TYGB 2JZPA 2K5PA 2BYVE 3TEXA 4KGTA 4YL8A 3BYYB 2B3AA 3DVGX 2NR2A 3IVFA 4S17A 3TCAA 2PJHA 5H8YE 2PPHA 5BO4B 1WGDA 2INPE 2MJ3A 1PDXA 1WWTA 1V81A 5DPRA 3MC9A 3T9LA 2V1YA 3B2GA 2E3TA 5FR6A 1F77A 4ITKA 2IO0B 2LUEA 3JVZX 2W82A 3Q8CA 4MGKE 1RFKA 1ENFA 4LNOA 1FIQA 2WXFA 5BYSA 2VZKB 2DAFA 2K22A 1WX7A 5HKHA 5D94A 2WS3B 4BOZB 3U8ZA 1WGGA 2NVUI 4EEWA 1H8CA 1UBQA 1NBFC 4WJPA 3QHTA 2IBIB 4G50A 4AJYB 3W1SC 2JZ3B 1UGJA 1VD2A 1Q10A 2MW5A 5T8IA 4PK1A 3HUIA 5E6JA 3H7PB 1SEBD 2EKEC 4DHJB 3U7DA 1LO5D 4M0WA 2V3NA 3BINA 4M8MA 1UUPA 4C00A 4US8A 1T0SC 4DQOC 3Q2AC 3AECB 3P2BA 4HWIB 4RGMA 3OWEB 1IBXB 2LJIA 2B76B 1XLOA 3CSTA 1FM0D 1C78A 4N58A 1ET6A 5D3IB 4B95A 2KMAA 4USAA 4JL9A 1WYGA 3SEBA 3NJTA 4BKSA 1C79A 4LNNA 3HM3A 2BTEA 1FCCC 1E8ZA 4HJKA 3PS6A 1N61A 2EMTA 5JHBA 2L52A 2KXJA 2KWCA 4KGSA 1N62A 2DNFA 4C4VA 1E8YA 2QIEB 1YIWA 4PYUA 4HVBA 2W9NA 3VFKA 3PRZA 4MH8A 1GG3A 5GXGB 1CQVA 3N1YC 3VH3B 1WSPA 1WE7A 2IGHA 3VR9B 3AV8A 4MGIE 1L6UA 2KWDA 3HIZA 3ZNGC 1KOTA 4B0EA 4XWWA 4A3OA 1V86A 3TEZA 1CMXB 3NZSA 4MELA 1V49A 4ZOHC 1I4GA 3NVVA 1LM8B 1SE4A 4BBNF 1SF0A 4B9KA 1XEEA 3C19A 3O13A 2GBKA 2N4FA 2CHWA 3U4EG 3KVFB 3AE2B 1I4QA 3NZUA 2L00B 1HE8A 5BMIA 3AMZA 2D10A 4WWNA 2WXOA 2DZMA 2D3GA 3IAM1 3P4QB 5LNK1 3SHQA 4K7SA 2DENB 4B6WA 5D2MB 3NVYA 2AX5A 4W9IA 1MVKA 1RLFA 2MP2A 2CKHB 3W1YA 4HRSA 3KUZA 4LNIA 1J8CA 2V3SA 4XC2A 4WQMA 3TBLD 3ZNZB 1FXIA 3SU8X 1LGRA 4JX1C 3QWZB 3N1ZC 3RCZA 1V97A 1QQRA 4I6LB 1NYQA 2IGGA 1EM7A 2O2VB 2V9HA 5IN7A 4LTUA 4PYZA 3EA6A 4ZRKA 2CHZA 1MG8A 4REZA 1TY2A 4BKTA 4HPPA 4FHJA 5TR5A 2PKOA 1WXMA 3AB5A 4W9HA 3KYCD 1KLUD 3IFWB 3APCA 3N20C 4LK0M 2IO2B 4NQKE 2JX5A 3VVWB 1D5XC 2KYWA 1WF9A 1YN5A 3ZJVA 3I5JC 3A9KA 3NG0A 2FCNA 1WI0A 1VZ7A 3OG5A 3QARA 2C7NB 3MTNB 3ZDMC 2HTME 1L5PA 4A9AA 1E8XA 1MPEA 2Q5WD 1XT9B 2WXMA 4OZBA 4EE2A 4K7UA 1E7UA 1IUEA 5AUIA 2H89B 1XXGA 3A33B 5LXIB 3A9JA 4M01A 4ASWC 3QC8B 3WAPA 1N6ZA 3RULA 2WDVB 4ZHPA 4OVUA 4I6PA 4BKGA 2WHIA 4N6EB 5LLIA 2IDYA 4WURA 2FAZA 4KX6B 2RPQA 2O6VB 2LVQA 2K8BA 4FA6A 4W9EA 2WLBA 2C7MB 2IY0B 2BKFA 5EDSA 1P7EA 4C7ZA 4XWTA 3VTWA 3TIXA 1XCTL 2SEBD 1LQBA 3DVNU 4BAXA 2HE7A 2L7RA 1P3QU 4F8CB 2RSUA 3MC0B 4A6QA 4YSZB 3KYDD 3R7RA 1IGDA 2J53A 4DXAB 2GRIA 2IZVB 2KVRA 1TS5A 4RMAA 2JUOA 4YTPB 1L4ZB 2A5UA 3FAHA 1NYRA 4MDKE 1YN3A 1FNVA 1WR6E 2QEJC 5J18A 3AH7A 1ROEA 2R61A 4KZ0A 2QHOA 1Q0WB 3VDZA 3L16A 4NQLB 4D2KA 2AL3A 3FC4A 1QZEA 4ANVA 1WZ3A 3Q14C 4MM3A 3B0AA 1V6EA 2BT6A 4N9F4 3Q69A 4FJVB 4K3BA 3PTFC 4ARIA 1WJ4A 2BS4B 3IHPC 1E90A 1TS4A 1BXTA 2I1JA 5C1ZA 1BUIC 3DHHC 2KK8A 3IXSA 3SDLC 2DLBA 1E9MA 3HK0A 3RUIB 3GB1A 2LVOA 2ZPNA 5JH5C 2RMMA 2L0FA 3AM9A 3PGEA 2YLMA 1DOXA 5JXVA 5G2NA 2JWZA 1YX6B 3H9DA 2BW2A 2AWTA 4TUUA 1MI0A 3I57A 1WXAA 4W9LA 1EU3A 1E7PB 4C56C 2AQ1B 4K7WA 1JCKB 1S3SG 1GC7A 2WXJA 2KDIA 3UGBB 3W5VB 4NJCA 4HROA 4BZAA 3RYTA 3ZUNA 1TJEA 3GP7A 3WA0A 1TBEA 1WJNA 4AWJA 2INCC 3V05A 1F52A 2PIAA 3QAQA 3ZYYX 1Y8RC 2BBCA 2KC1A 2QDFA 2NBVB 1MG4A 3BK2A 2BWFA 1EO6A 4DWFA 1KJTA 2LZ6A 3QX1A 2C60A 1TS2A 3ZQ4A 1E8WA 1NDDA 1AWDA 2KD0A 2AL6A 1PGBA 5E6OA 4XX5A 1AYFA 3ZDTA 1SIFA 3R7QA 4L23A 3ZO5B 2KANA 2ASQA 3APDA 3U2SC 3LB8C 2WU2B 3H1UA 1JALA 2BYTA 1TY0A 4TSSA 3BK1A 4C7YA 2BS2B 3PZ7A 4HCNB 4J6IA 3VUWA 4WAFA 3M95A 3LXFA 2KDMA 1NI3A 1SE3A 4DBGA 1T5XD 2EMSA 1NEKB 3T8MA 4IM0A 4I6NB 1RFAA 2MHJA 1FRDA 2IY1B 3DHIC 2WGSA 1V8CA 4HPLB 3DPDA 1V80A 3ML9A 4ZRJA 4MM3B 1ET9A 2N1VA 4HDQA 4FN2A 2WXPA 2OHFA 2QJLA 4W9DA 4RNAA 2KX3A 2Y5CA 2N7DA 4RGNA 1SGHA 4GLSC 2KAJA 2WWZA 2JXTA 1HQRD 1FNUA 4OVZA 2M56B 1E5WA 3UIOB 2D11A 2MEKA 4W9KA 1L4DB 3EHVA 5L83A 2LGYA 4KSKC 3AEGB 3Q3NC 4HXDA 4IM3A 4EFOA 2Z0DB 2K9XA 2HD5B 2IYDB 1WX8A 1KLVA 1IGCA 4L2YA 1J7AA 4DHZB 5HI1A 4HPMB 3P63A 3N1XC 1XCQL 4H2AA 2KFKA 2V0GA 2BVCA
chains in the Genus database with same CATH topology
2PTLA 1I4GA 3NVVA 1SE2A 2MJEA 1SE4A 4HKQA 1OQRA 4LLGM 1WXQA 1SF0A 3KQ4A 1XEEA 3FILB 3R2IA 3IT4B 1C9FA 4RGTA 4MT5A 2BS3B 1B9RA 3BVGA 3O13A 2RPVA 3TEYA 3U4EG 2AQ2B 4RGOS 3AE2B 4XE0A 3T3OA 2AQ3B 3ZGZA 1I4QA 4XDCA 3T3NA 1E10A 3AEFB 3U7ZA 1PYWD 4YWGG 4WWMA 3AMZA 5BMIA 2WXNA 2WXOA 2LEKA 3IAM1 3P4QB 2N9LA 3AE6B 4C80A 5LNK1 3NUHB 3DWGC 2FUG1 3NVYA 2AX5A 1QT9A 5HG2A 1MVKA 3B2FA 1L6VA 2N9KA 1N60A 2I38A 5EE1A 1M4VA 2QILA 1WGKA 3P42A 3BYTB 1JQ4A 1GAQB 3NVWA 3P4PB 1D5ZC 2M0AA 2OEDA 4A90A 4YSXB 3C8YA 4HRSA 2JQRB 1YNTE 2PLPA 3VRAB 1ZXIA 4YSYB 2WQYB 1F2RC 3TSSA 3N9YC 4FXCA 4WQMA 1FEHA 1FXIA 4Q2JA 2QMTA 1RM6C 3CWIA 2WDRB 4JX1C 3R2TA 1D6EC 3BWUD 1V97A 1NENB 1QQRA 2FBWB 1NYQA 1N5XA 2V3PA 2W3RA 2IGGA 2KQ4X 2L83A 1R7SA 2YEPF 5G5HA 1EM7A 5BYQA 2DBYA 4LTUA 3EA6A 1K52A 2LFIA 1DGJA 3BVZA 1MHXA 1ZP0B 4REZA 3NZ3A 1TY2A 4KKJA 4DXFA 2ZW1A 3PZ8A 2IPKD 3NRZA 2J42A 4ZYSA 2CU3A 2INNE 2PKOA 3AB5A 3URYA 4GDLB 2J52A 4TMAB 1KLUD 2LHDA 2LMCA 4OW0A 3VQIA 1D4BA 4LK0M 5MPOA 2NTTA 4PT5A 4MACA 2JWUA 2N0SB 1PUTA 3EUB2 2JX5A 2ACZB 3L4PA 3AE5B 4J3OD 1D5XC 1PGXA 3P4RB 2W3SA 3AE9B 3MHZA 1QLBB 1YN5A 1I4XA 1KLGD 3ZJVA 3AN1A 1JWSD 1XO3A 1ZDVA 1BMLC 2MH7A 4ZHOA 5BYRA 1JROA 1OQQA 1VZ7A 4YTNB 5HFYA 1JWUD 4ZRPA 3VRBB 2FE8A 3PO0A 2HTME 2IJ0A 4JWSC 1L5PA 2Z8LA 3IAS1 4A9AA 1MPEA 1AW7A 2Q5WD 3W9CB 1IBXA 1SSNA 1Y56A 2WP9B 2WXMA 2PVGC 2K0PA 4JE3B 3IT6B 4OZBA 1RYJA 4WH4A 4EE2A 1SJHD 1XLNA 2MJDA 1ZOYB 1XLQA 2WXRA 3RFZB 1IUEA 1JWBD 1JW9D 3AEBB 2H89B 5AUIA 1XXGA 4TQ0A 1C77A 1UWXA 5FKAC 2HDEA 2DYMA 1EWYC 1VZ8A 2WDVB 4ZHPA 3MP9A 4AQ7A 3WCQA 2NMQA 4N6EB 5HHDG 3HVZA 2IDYA 3KWVA 1FFVA 2DWQA 1JMLA 4WURA 4KX6B 4ARCA 4A55A 3SFDB 1CJEA 4JPSA 1PFDA 2EKIA 3AEAB 2JSVX 2SAKA 2TSSA 1YN4A 1E6EB 4YT0B 2H88B 3BVMA 4L1BA 1ZE3D 2G1EA 2WLBA 3AEEB 4HJGE 1ZDXA 2XNAC 2M19A 1HXYD 1ZPSA 2ONQA 3BZDB 4IOIE 1KH0A 1ZXHA 2V4IB 3V3XA 1P7EA 1C4AA 4C7ZA 4XWTA 4GDKB 1F0ZA 5FK9C 1XCTL 2SEBD 1FFUA 3CIRB 5FR3A 4HKZE 2WDQB 1FO4A 1QOBA 1TKYA 1VJKA 3I9V1 3MC0B 3B9JA 4KGRA 4JWUC 4A6QA 4YSZB 2D5GA 1OFFA 1XLPA 1IGDA 2J53A 3HRDD 2GRIA 1TS5A 1A70A 5D7GA 4P16A 2RDGA 4YTPB 1L4ZB 2G9HD 3FAHA 3U52E 4YXDB 5D3DA 1NVID 1NYRA 4OZCA 4DXGA 1K50A 3AE4B 4P6VF 1K53A 1YN3A 2VZKD 1FNVA 5EE3A 2BB6A 1GOZA 2QEJC 2WNMA 4RH6A 1VRAB 2GI9A 2ZW0A 3E56A 3MJ5A 3AH7A 4OHJA 1ROEA 3AE1B 2R61A 1SBBB 2Y3AA 5G5GA 3E9SA 4KKIA 1ZUD2 3TUOA 4B0MA 1L0YB 1HZ5A 1SXTA 4US9A 2LGIA 4A8XC 2KMMA 4D2KA 1QOGA 3FC4A 3BIID 1DOYA 1EWCA 1VDVA 1GB4A 1VR9A 1JWAD 1QOFA 3P1MA 1SIJA 3ETRA 3LYYA 2BT6A 1GB1A 1SB3C 3Q69A 1I4PA 1TKEA 2QSDA 1ACCA 1T3QA 2PMVA 3W2DA 1C4PA 1QKZA 4YTMB 1VLBA 3J9CA 4ARIA 2K3UA 4TQ1A 2BS4B 3W1SA 1TS4A 1STEA 2WXHA 1BXTA 3GS2A 2JU6X 2WXIA 4N59A 4RCOA 3ZJTA 1BUIC 2KN4A 3IXSA 5TSSA 1TS3A 3P4SB 3ABVB 2PVOD 2J4XA 2DLBA 2JYEA 3H8HA 1E9MA 2DYOA 3SFEB 3GB1A 1KTKA 1N63A 4XDDA 1PGAA 1TKGA 3AE7B 1C76A 2W55A 2WXKA 3TEWA 1TYGB 2JZPA 1KF6B 2K5PA 1CZPA 1I4RA 3TEXA 4KGTA 2RMMA 3AM9A 3BYYB 1DOXA 1MHHE 1DYQA 5JXVA 5H92C 2RDHA 3NVZA 1L0XB 2BW2A 3AE3B 2CJOA 1I7HA 1QILA 1TZOA 3KWLA 5H8YE 1MI0A 3I57A 5BMHA 1EU3A 1E7PB 4NAMA 1SJED 1FMAD 2INPE 4C56C 2ICIA 2AQ1B 2MJ3A 1GPXA 1C4CA 1PDXA 1WWTA 1P7FA 1JCKB 4RF1A 5C3JB 4HEA1 4RF0A 4IDIA 3Q8BA 3B2GA 2E3TA 1FCLA 1YQ4B 1F77A 4ITKA 4AS1A 2WXJA 2W82A 1XF5L 2N7JA 3EGRA 3Q8CA 5I4DA 1HA5A 3W5VB 4NJCA 4HROA 3KLSX 1RFKA 1ENFA 1RWSA 1FIQA 2WXFA 4NAWB 5BYSA 2VZKB 1TJEA 3GP7A 3R8BA 1YQ3B 2K22A 2Y5PA 3DWMA 1JRPA 1E0ZA 1V1OA 3V05A 2WS3B 2WU5B 1J7BA 2PIAA 3ZYYX 1CK1A 1AN8A 2BBCA 4UDUC 3BK2A 2JYTA 4IKGA 1UWMA 2L32A 5BMGA 1EU4A 1TS2A 1UGJA 1JWMD 2WXQA 2ON8A 3ZQ4A 1YJJA 2YEPB 1AWDA 2WXLA 1Q10A 1PGBA 1AYFA 4O1NA 5T8IA 4WIPA 4L23A 2LUMA 3Q8EA 1QF6A 1HZ6A 1FXAA 3HUIA 5E6JA 3U2SC 3LB8C 2WU2B 1KFYB 1SEBD 1T6BX 2XN9C 1LO5D 1JALA 3AE8B 4M0WA 2BYTA 1D5MC 2V3NA 1ESFA 1TY0A 1YMHE 1V1PB 4TSSA 1VZ6A 1L0VB 1UUPA 3BK1A 4C7YA 2BS2B 3PZ7A 2PW9A 4US8A 4WAFA 3LXFA 2KDMA 1FRRA 4DQOC 1NI3A 1SE3A 1T5XD 3AECB 5C2TB 1NEKB 1K51A 4RGMA 3OWEB 1IBXB 2W54A 3RPFC 1FRDA 2LJIA 3ZJUA 2B76B 2EELA 1XLOA 2IGDA 1V8CA 2GB1A 1FM0D 1C78A 3UI3A 4N58A 1ET6A 5D3IB 4MM3B 1YJIA 1V1PA 3AEDB 4USAA 1ET9A 1B1ZA 1WYGA 2WXPA 2OHFA 2QJLA 3SEBA 4RNAA 1C79A 4RFBA 2Y5CA 2BTEA 1FCCC 1N61A 4RGNA 2NTSA 2X38A 2L52A 2WXGA 3NS1A 4GLSC 2KAJA 4KGSA 2L1AA 1N62A 2JXTA 3Q8AA 4CQNA 1HQRD 1FNUA 2QIEB 4OVZA 2M56B 1F2RI 2MEKA 2KACA 1L4DB 2I2YA 1FD6A 4MH8A 5GXGB 1CQVA 3AEGB 1HEZE 2LHEA 4ZRQA 1QOAA 1WSPA 2K9XA 2IGHA 5AUKA 3AV8A 4OZAA 3SR6A 3VR9B 5EE9A 1L6UA 2KWDA 2CJNA 3MFGA 1IGCA 4L2YA 1J7AA 4R3DA 5HI1A 5EE0A 1KRHA 3FILA 4NZLB 3P63A 4B0EA 3VR8B 1XCQL 1I4HA 4XWWA 1WRIA 4H2AA 1UNSA 1FNWA 1DOIA 3W5UB 3TEZA 2E6XA 2V0GA 1J7CA 1N5WA 3HVDA 4ZOHC 3Q8FA 2BB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ B;  3L4P A;  3AE5 B;  3P4R B;  2W3S A;  3NVV A;  3AE9 B;  3AH7 A;  1QLB B;  1ROE A;  2MJE A;  3AE1 B;  1OQR A;  5G5G A;  3AN1 A;  1UWM A;  1XO3 A;  1WXQ A;  1SF0 A;  1ZUD 2;  2MH7 A;  4ZHO A;  1JRO A;  1OQQ A;  4US9 A;  2KMM A;  4YTN B;  1QOG A;  1YJJ A;  2BS3 B;  3FC4 A;  1B9R A;  1AWD A;  3BII D;  3VRB B;  1DOY A;  1VDV A;  1AYF A;  3PO0 A;  2HTM E;  3AE2 B;  4JWS C;  1L5P A;  1JWA D;  4A9A A;  1QOF A;  3P1M A;  1QF6 A;  1E10 A;  2Q5W D;  1SIJ A;  3AEF B;  3W9C B;  3ETR A;  1FXA A;  3HUI A;  2BT6 A;  3LB8 C;  2WU2 B;  1KFY B;  2WP9 B;  1SB3 C;  2PVG C;  3AMZ A;  4WWM A;  1TKE A;  2LEK A;  3P4Q B;  1T3Q A;  4YTM B;  1VLB A;  1JAL A;  3AE6 B;  3AE8 B;  4C80 A;  1RYJ A;  2BS4 B;  1XLN A;  2MJD A;  1L0V B;  1ZOY B;  4C7Y A;  2BS2 B;  1XLQ A;  4N59 A;  1IUE A;  1JWB D;  1JW9 D;  3AEB B;  2H89 B;  5AUI A;  3DWG C;  4US8 A;  3LXF A;  1FRR A;  3NVY A;  1NI3 A;  2AX5 A;  1QT9 A;  3AEC B;  5C2T B;  1NEK B;  3P4S B;  3ABV B;  1L6V A;  3B2F A;  2PVO D;  1N60 A;  2W54 A;  5EE1 A;  1FRD A;  1E9M A;  3RPF C;  1WGK A;  1EWY C;  2WDV B;  2B76 B;  3SFE B;  1GAQ B;  3NVW A;  3P4P B;  4ZHP A;  1JQ4 A;  1XLO A;  1N63 A;  4YSX B;  1TKG A;  1V8C A;  3AE7 B;  4HRS A;  1FM0 D;  3WCQ A;  4N6E B;  4N58 A;  2JQR B;  2W55 A;  3VRA B;  1ZXI A;  1YJI A;  4YSY B;  2WQY B;  3HVZ A;  1TYG B;  3AED B;  4USA A;  1FFV A;  2DWQ A;  1KF6 B;  1WYG A;  2K5P A;  4KX6 B;  1CZP A;  4FXC A;  3SFD B;  2OHF A;  1CJE A;  2QJL A;  1PFD A;  4WQM A;  2EKI A;  3AEA B;  1FXI A;  3AM9 A;  1RM6 C;  3CWI A;  2Y5C A;  2WDR B;  1DOX A;  1E6E B;  4YT0 B;  1N61 A;  2H88 B;  2G1E A;  2WLB A;  4JX1 C;  5H92 C;  3AEE B;  3NVZ A;  2M19 A;  2L52 A;  3NS1 A;  3AE3 B;  2KAJ A;  2CJO A;  1I7H A;  1N62 A;  1V97 A;  3KWL A;  1NEN B;  5H8Y E;  2FBW B;  2QIE B;  1NYQ A;  1N5X A;  2M56 B;  1E7P B;  2W3R A;  4C7Z A;  2L83 A;  1R7S A;  1F0Z A;  5G5H A;  1FMA D;  1FFU A;  2DBY A;  3CIR B;  4LTU A;  2MJ3 A;  1GPX A;  1PDX A;  2WDQ B;  1WWT A;  1FO4 A;  5GXG B;  1DGJ A;  3AEG B;  1QOB A;  1ZP0 B;  1TKY A;  1VJK A;  5C3J B;  3B9J A;  4JWU C;  4IDI A;  1QOA A;  3B2G A;  4YSZ B;  2E3T A;  1YQ4 B;  3NRZ A;  2K9X A;  4ITK A;  5AUK A;  2CU3 A;  2PKO A;  1OFF A;  1XLP A;  3AB5 A;  3AV8 A;  3SR6 A;  3VR9 B;  5EE9 A;  1L6U A;  3HRD D;  2CJN A;  3W5V B;  1A70 A;  4HRO A;  1RFK A;  1J7A A;  5EE0 A;  1KRH A;  1RWS A;  1FIQ A;  3P63 A;  1TJE A;  4YTP B;  3VR8 B;  1YQ3 B;  3FAH A;  1WRI A;  4YXD B;  1NVI D;  1NYR A;  5MPO A;  2K22 A;  3AE4 B;  3DWM A;  1JRP A;  4P6V F;  2N0S B;  1E0Z A;  1PUT A;  1DOI A;  3W5U B;  2WS3 B;  2WU5 B;  1J7B A;  1J7C A;  1N5W A;  2PIA A;  4ZOH C;  5EE3 A;  3ZYY X;  3EUB 2;  2JX5 A; 
#chains in the Genus database with same CATH topology
 2PE6 B;  2PTL A;  3RZF A;  1Q1O A;  4LLG M;  2RDB C;  1WXQ A;  4NY0 A;  3I3T B;  2Y5B B;  3FIL B;  3R2I A;  1C9F A;  4RGT A;  1B9R A;  2CU1 A;  3R66 C;  4RGO S;  3DVN V;  4XE0 A;  3T3O A;  2KFK B;  2N1W A;  3DQV A;  2LEK A;  1EUV B;  4KIK A;  1WXV A;  2N9L A;  3DBL I;  3RNC C;  4C80 A;  4WJO A;  4OVV A;  4GU2 A;  3FKY A;  4ZYN A;  1QT9 A;  4C4V B;  3B2F A;  5EE1 A;  3RD2 A;  3NVW A;  3ZNH B;  2OED A;  3C8Y A;  1YNT E;  3VRA B;  3ONS A;  1ZXI A;  4ANW A;  2O2V A;  2I1K A;  3TSS A;  3N9Y C;  4FXC A;  1WZ0 A;  4II3 B;  3TL5 A;  1JRU A;  3NY5 A;  1V2Y A;  3OAW A;  3R2T A;  5AZG A;  1D6E C;  3BWU D;  3Q6B A;  2MA9 B;  2W3R A;  2L83 A;  2YEP F;  2C5L C;  3PSE B;  2CR5 A;  2MBO A;  3BVZ A;  3KH0 A;  4DXF A;  2ZW1 A;  2KX0 A;  4ZYS A;  4EKU A;  4RM8 A;  4GDL B;  4LDT B;  2J52 A;  1IPG A;  4KDI C;  2LMC A;  4OW0 A;  2O6V D;  1WH3 A;  2N0S B;  3CSF A;  3ENE A;  1WRD B;  3EUB 2;  4GIV A;  3L4P A;  3AE5 B;  1PGX A;  2MQJ A;  2W3S A;  3AE9 B;  4E74 A;  1JWS D;  5DPT A;  5CX3 A;  4HK2 A;  1R4N I;  2GOW A;  4BKS D;  4WWP A;  4ZRP A;  2FE8 A;  3ZRC A;  2OJW A;  2Z8L A;  4JWS C;  3IAS 1;  3W9C B;  1Y56 A;  2PVG C;  2ZVO A;  1P9D U;  3PLV A;  3GE8 C;  4G0N B;  1ZOY B;  3VXW A;  1JW9 D;  4W9F A;  4K81 A;  4IWO A;  4TQ0 A;  5LXH A;  2DX5 B;  1UWX A;  5FKA C;  2HDE A;  4AJW A;  1EF1 A;  2DYM A;  2NPT B;  2G3Q B;  2KTF A;  3A4S C;  5AEK B;  3KUD B;  3WCQ A;  2NMQ A;  1ZKH A;  1UD7 A;  1P0R A;  1C3T A;  3KWV A;  1FFV A;  5KHQ A;  1CJE A;  1ZGU B;  4ZRI A;  2JSV X;  4NNJ B;  4WJQ A;  2JT4 B;  4YT0 B;  4L1B A;  1ZE3 D;  4LDT D;  3AEE B;  4HJG E;  2KWV B;  3WIM A;  1ZPS A;  4IOI E;  2ONQ A;  3PLU A;  1OEY J;  3H7S A;  1KH0 A;  3RI7 C;  1C4A A;  5FK9 C;  4LJO B;  1FFU A;  3AU5 A;  3I9V 1;  3X23 A;  4KGR A;  2WYQ A;  3L10 B;  1OFF A;  3TMP B;  2DHZ A;  3VAW A;  3AI5 A;  2M1M A;  2G9H D;  3V61 A;  4YXD B;  1FXT B;  4OZC A;  2XEW A;  4KSL C;  5KHO A;  4RH6 A;  4BOS C;  3K9O B;  3E56 A;  2MBB B;  1G6J A;  3BY4 B;  1SBB B;  2Y3A A;  1HZ5 A;  1SXT A;  4US9 A;  4WAA A;  4ACF A;  2KDE B;  3BII D;  1VDV A;  3PZD A;  1QOF A;  2MBH A;  2LXC A;  4JQW C;  3ETR A;  1SB3 C;  2DZI A;  1I4P A;  1TKE A;  2QSD A;  1ACC A;  2O6V A;  2PE9 A;  4YTM B;  2MSE D;  1WGY A;  2BQQ A;  4IM2 A;  1F1H A;  1STE A;  3GS2 A;  4MH0 E;  3UIP B;  4AUQ C;  5IKC M;  2FCQ A;  1TS3 A;  3P4S B;  1UH6 A;  2JYE A;  3H8H A;  2DYO A;  1TT5 B;  1KTK A;  1N63 A;  4F7Z A;  3MJW A;  3DDC B;  2FIF A;  2QC8 A;  1C76 A;  5G55 A;  5CHW A;  1U4A A;  1RAX A;  1WJU A;  2M4N A;  3UIN B;  1CZP A;  1UZX B;  3V62 A;  2J0J A;  4A3P A;  4LCD E;  1MHH E;  2LRW A;  1WMH A;  5H92 C;  3WAN A;  2RDH A;  3NVZ A;  1L0X B;  3QK0 A;  3VTV A;  1I7H A;  2PEA A;  1QIL A;  1TZO A;  3EFU A;  2DAJ A;  3DBR I;  4MJS A;  2DZJ A;  1SJE D;  1FMA D;  3KUC B;  1GPX A;  3Q3J A;  4XYC A;  1P7F A;  4M02 A;  4RF1 A;  5C3J B;  2KJR A;  4WJN A;  2IO3 B;  1FCL A;  4AS1 A;  2AYO B;  2N7J A;  3EGR A;  4DHJ D;  1HA5 A;  3VUY A;  2UWQ A;  3R8B A;  1YQ3 B;  2Y5P A;  3DWM A;  1JRP A;  1E0Z A;  1F9J A;  2L8J A;  4NPN A;  2L0T A;  2WU5 B;  2J7Q B;  2JYT A;  3A1Q A;  1GJZ A;  2L32 A;  5BMG A;  1T0Q C;  1JWM D;  2WXQ A;  2ON8 A;  1YD8 U;  1YJJ A;  4O1N A;  1WIA A;  3L17 A;  2LUM A;  3Q8E A;  1QF6 A;  2M0X A;  1HZ6 A;  1FXA A;  4PS7 A;  1KFY B;  4DK5 A;  1E7V A;  4IC7 B;  3V6C B;  1D5M C;  3A9K B;  1V1P B;  1VZ6 A;  2RR9 A;  5IO9 A;  4FJY A;  2PW9 A;  2KLC A;  3AXC A;  1FRR A;  3DBL B;  5C2T B;  1T0R C;  3ZJU A;  3QIJ A;  4GN1 A;  1WE6 A;  2EEL A;  5AZH A;  3ZIM A;  2JF5 A;  1YJI A;  1V1P A;  2MRP A;  1B1Z A;  3RZW C;  3WAO A;  2YVC A;  2ZJD A;  4KVG B;  2Z0E B;  4NJ6 A;  3L08 A;  4RFB A;  4GOC A;  2BGF A;  3Q8A A;  1IYF A;  3Q3O C;  3K9P B;  4EZJ A;  3GOE A;  1F2R I;  4FLH A;  2DZK A;  2I2Y A;  2MP2 B;  1FD6 A;  2LGS A;  3IBE A;  4BVU C;  1HEZ E;  2LHE A;  1RRB A;  1QOA A;  5AUK A;  2M17 A;  4OZA A;  2K39 A;  5EE9 A;  2G4S A;  2CJN A;  2MLB A;  1LXD A;  3NOB A;  2IND C;  3FIL A;  5EE0 A;  4KDL B;  3VR8 B;  3N32 A;  1FPY A;  2QCZ A;  3CMM B;  1DOI A;  2VH1 A;  4A20 A;  1J7C A;  1ZW7 A;  3DOW A;  2M8S A;  4E3C A;  1SE2 A;  2MJE A;  3QCA A;  2D2Q A;  4WWO A;  2JRI B;  4MT5 A;  2RPV A;  4HLE A;  2AQ3 B;  2HTH A;  2XK5 B;  3M3J A;  3AEF B;  3U7Z A;  1PYW D;  2KTR A;  4WWM A;  4BBN C;  1IP9 A;  2WXN A;  3ECI A;  4FJZ A;  2VH2 A;  4KV2 A;  1K8R B;  2KZR A;  3M63 B;  2ZCB A;  3H6N A;  2LWP A;  3U30 A;  2LVP A;  5HG2 A;  4GMV A;  4PS8 A;  1L6V A;  1WGR A;  4P7I A;  4MGZ E;  1N60 A;  2I38 A;  3UQA A;  2QIL A;  3P42 A;  1WGK A;  3BYT B;  1GAQ B;  3P4P B;  4A90 A;  2M0A A;  2FCS A;  4BFR A;  2N9X A;  2WQY B;  3WAL A;  3X0W A;  1UEL A;  4Q2J A;  3TJP A;  4K3C A;  2WDR B;  2KWU B;  1Z5S B;  2UYZ B;  2JVC A;  2KQS A;  4JLC A;  5IAA C;  2K6Q A;  2K1F A;  2KQ4 X;  1R7S A;  4CHK A;  3PV1 A;  2LFI A;  3VTU A;  1ZP0 B;  3ZXV A;  3NZ3 A;  4KKJ A;  3NRZ A;  2J42 A;  2INN E;  3DCG A;  4ZDV A;  3URY A;  3LJ3 A;  2LHD A;  1D4B A;  5CHV C;  3DBH B;  5MPO A;  3OJ4 B;  2NTT A;  4PT5 A;  1M94 A;  1R4N B;  4GXB A;  4MSM B;  4LNF A;  1WX9 A;  5J2R A;  2NBU A;  3ZKJ C;  1QLB B;  4FHK A;  1ZDV A;  1BML C;  2MH7 A;  4FAD A;  4ZHO A;  3IG3 A;  3A4R A;  5HFY A;  1JWU D;  1X1M A;  2IJ0 A;  1AW7 A;  1IBX A;  2WP9 B;  2K0P A;  3APF A;  2C7H A;  2HJ1 A;  3GZN B;  2R2Q A;  4FBJ B;  1SJH D;  5IA7 A;  1XLQ A;  2WXR A;  3RFZ B;  3AEB B;  1H4R A;  2FCM A;  1C77 A;  4TV3 A;  2J0K A;  4DHZ E;  3DHG C;  2RD0 A;  3ZTC A;  3H7P A;  1OQY A;  1EWY C;  1VZ8 A;  2ZPY A;  5E6N A;  4K1R B;  3VUX A;  2KDF B;  3HVZ A;  3RNE C;  1A5R A;  4ARC A;  4A55 A;  3SFD B;  1GUA B;  1PFD A;  3AEA B;  2TSS A;  1YN4 A;  1PQS A;  3BVM A;  4NAW A;  2G1E A;  2BF8 B;  2D3B A;  2XNA C;  1HXY D;  3BZD B;  2LGD A;  1ZXH A;  4W9C A;  3V3X A;  4GDK B;  1F0Z A;  2FUH B;  1L2N A;  4X57 B;  3CIR B;  5FR3 A;  5JHA A;  4HKZ E;  2WDQ B;  3LDZ E;  1FO4 A;  1QOB A;  1TKY A;  3B9J A;  4JWU C;  4IUM B;  2D5G A;  3V60 A;  2UU7 A;  3RT3 B;  3HRD D;  4TKN A;  2D3C A;  1YOV B;  2KMC A;  4GDK A;  3PRE A;  2RGF A;  3RNB C;  3U52 E;  5D3D A;  1NVI D;  4DXG A;  1K50 A;  4ANX A;  1K53 A;  4M0W B;  2JPH A;  2WNM A;  1VRA B;  2GI9 A;  1TZ1 A;  3DBH I;  3MJ5 A;  2LI5 A;  1AAR A;  1WXS A;  5G5G A;  5DPS A;  3E9S A;  4B0M A;  2KNB A;  2IO1 B;  4XZ4 A;  2AEH A;  3S2A A;  3ZRF A;  3QJZ A;  1JWA D;  3JSV B;  3LYY A;  2VRR B;  3MC8 A;  1XD3 B;  4TQ1 A;  2KFJ A;  3W1S A;  4E71 A;  2K8H A;  4IG7 B;  2WXH A;  2WXI A;  4N59 A;  5L95 C;  3ABV B;  5CHF A;  1T0Y A;  5DCN A;  2X8X X;  2MBQ A;  3QA8 A;  4XDD A;  1PGA A;  1ISN A;  1GNU A;  2WXK A;  3TEW A;  2FID A;  1R4M I;  2NCN A;  4RM9 A;  1KF6 B;  3UF8 A;  1I4R A;  1YQB A;  5IOI A;  4GGQ A;  1P98 A;  4ICV A;  1OTR B;  3AU4 A;  4DDI D;  2JY6 A;  1DYQ A;  5E6P A;  1Q5W B;  3AE3 B;  1OEY A;  2CJO A;  3KWL A;  4W9G A;  1WFY A;  2WDT B;  5BMH A;  4NAM A;  2NPT A;  2WX0 A;  2ICI A;  4MGY E;  1C4C A;  1SE9 A;  4HEA 1;  4RF0 A;  4IDI A;  1TGZ B;  3Q8B A;  3DBS A;  1YQ4 B;  2Z59 B;  2KHW B;  1XF5 L;  5I4D A;  1WYW B;  1MFW A;  3KLS X;  3EC8 A;  1RWS A;  4NAW B;  3L0W B;  2CHX A;  4WQO B;  1V1O A;  4HDO A;  2KC2 A;  1J7B A;  3MHS D;  3I63 C;  1CK1 A;  2GBJ A;  3L54 A;  1AN8 A;  3M62 B;  4UDU C;  2J0M A;  3ALB A;  4IKG A;  1UWM A;  1WM3 A;  1EU4 A;  2K25 A;  3D32 A;  5JZE B;  2YEP B;  1I42 A;  2WXL A;  2D3A A;  1MJD A;  1LFD A;  4WIP A;  2A4Z A;  2WX1 A;  4JGH B;  1T6B X;  2JZZ A;  2JRH A;  2XN9 C;  1I35 A;  3AE8 B;  3NS8 A;  3PHW B;  1ESF A;  1YMH E;  1L0V B;  2LD9 A;  1V9J A;  2ZEQ A;  2KJ6 A;  1S1Q B;  1HTO A;  1BT0 A;  4DDG D;  1K51 A;  2DYB A;  2XBB C;  2W54 A;  3B1L X;  3RPF C;  3C0R B;  2IGD A;  2GB1 A;  3UI3 A;  3SD5 A;  3AED B;  2KQ7 A;  4M8N A;  2CS4 A;  1D3Z A;  2NTS A;  4LNK A;  2BYF A;  2X38 A;  2WXG A;  3PVL A;  3NS1 A;  2L1A A;  3AUL A;  4CQN A;  3V6E B;  2KAC A;  3ZLZ A;  4IW0 A;  1UF0 A;  3EEC A;  4ZRQ A;  3SR6 A;  3QQ8 B;  1WR1 A;  3MFG A;  4R3D A;  1KRH A;  4NZL B;  1I4H A;  2MX2 A;  1WRI A;  2LRU A;  1UNS A;  1FNW A;  3ZTD A;  3W5U B;  2XK5 A;  2E6X A;  1N5W A;  3HVD A;  3ZNI D;  3Q8F A;  2BB5 A;  2KOX A;  4HKQ A;  1OQR A;  3KQ4 A;  3GE3 C;  2N7E A;  2L05 A;  2OOB B;  3IT4 B;  2BS3 B;  2FNJ B;  3BVG A;  3OJ3 A;  3TEY A;  2AQ2 B;  3ZGZ A;  3L13 A;  4XDC A;  1WGH A;  3T3N A;  3HHM A;  1E10 A;  3EFC A;  3HM6 X;  2K8C A;  4YWG G;  4P1B C;  3ZVV A;  3AE6 B;  1Z2M A;  3OLM D;  1WJ6 A;  5GMV A;  3NUH B;  4G3X B;  2KDB A;  3DWG C;  2GLS A;  2FUG 1;  3ZXR A;  3JYU A;  2N9K A;  4QAY A;  1V5O A;  4URK A;  1M4V A;  4CO7 A;  4AOF A;  1JQ4 A;  1D5Z C;  2MWS B;  4YSX B;  2KJH B;  1OGW A;  4MJS B;  3O65 B;  2JQR B;  2PLP A;  4XGA B;  4YSY B;  2LAS A;  1F2R C;  5D6J B;  3JW0 X;  3PPA A;  1J19 A;  1FEH A;  4EZK A;  2QMT A;  1RM6 C;  3CWI A;  1NI2 A;  2LXA A;  3R3M A;  2N9E B;  1UGM A;  1NEN B;  2FBW B;  3A9J B;  1N5X A;  2NS5 A;  2V3P A;  4GSW A;  5C23 A;  2KO3 A;  5G5H A;  5BYQ A;  2DBY A;  2L76 A;  1K52 A;  4MEM A;  1DGJ A;  1MHX A;  3RNG C;  1R4M B;  2JXX A;  3PZ8 A;  2IPK D;  1WMH B;  2BPS A;  2CU3 A;  3WAM A;  3A1Q B;  4TMA B;  1HTQ A;  2MCN B;  3VQI A;  3NHE B;  4MAC A;  2N9P C;  2JWU A;  4P1C C;  1PUT A;  2KLG A;  5CTR C;  2ACZ B;  2ZNV B;  4J3O D;  3PT2 B;  3B08 A;  3P4R B;  2GBM A;  4KZC A;  3MHZ A;  1I4X A;  1KLG D;  4IWP A;  1GC6 A;  1XO3 A;  3AN1 A;  5IP4 D;  5BYR A;  1JRO A;  1OQQ A;  2LJ5 A;  4IWQ A;  4YTN B;  3VRB B;  3PO0 A;  4AP4 C;  1SSN A;  2LGX A;  4JE3 B;  3IT6 B;  4HCP B;  1RYJ A;  4WH4 A;  3RNF C;  2REX A;  1XLN A;  2MJD A;  1L7Y A;  2GMI C;  1WY8 A;  1JWB D;  4W9J A;  1C1Y B;  3RMK C;  2HJ8 A;  2V4L A;  3RNA C;  4ICU A;  1EF5 A;  3MP9 A;  3ZW3 A;  4AQ7 A;  4EZL A;  5HHD G;  2DWQ A;  1JML A;  4JPS A;  2GBR A;  4NJ7 A;  2EKI A;  4ANU A;  3N30 A;  4GDL A;  3RN9 C;  4CYE A;  2SAK A;  1E6E B;  5J17 A;  2H88 B;  2BKR B;  1ZDX A;  2M19 A;  4F1S A;  4PS3 A;  2BYE A;  3UQB A;  2KN5 A;  1WM2 A;  2V4I B;  3PRP B;  4G11 A;  2ZZP B;  4MSQ B;  3PRM B;  1V5T A;  2D07 B;  1VJK A;  3Q3F A;  1XLP A;  4FUL A;  2G45 B;  1J0G A;  3DVG Y;  2OJR A;  4EOY A;  2ZVN A;  1A70 A;  1YX5 B;  5D7G A;  2KKC A;  4II2 B;  4P16 A;  3VH4 B;  2RDG A;  1YJ1 A;  3AE4 B;  2BWE S;  4P6V F;  2VZK D;  5EE3 A;  2BB6 A;  1GOZ A;  2L3Z A;  3JSV A;  2KT7 A;  2KTR B;  2GBN A;  3Q3M C;  2ZW0 A;  3GZN I;  4OHJ A;  3AE1 B;  3PHX B;  4LJP B;  1TTN A;  3N3K B;  3VHT C;  4KKI A;  1KM7 A;  1ZUD 2;  3TUO A;  1L0Y B;  4A8X C;  4EUT A;  2LGI A;  2KMM A;  1QOG A;  2R2O A;  2C9W B;  1DOY A;  1EWC A;  3DBR B;  1TIF A;  2ZNV C;  4M00 A;  1GB4 A;  1VR9 A;  3P1M A;  1SIJ A;  2MBE A;  3KW5 B;  1GB1 A;  2K6D B;  1T3Q A;  2PMV A;  3W2D A;  1C4P A;  1QKZ A;  1VLB A;  3J9C A;  2K3U A;  4S0R A;  1VCB A;  3CF6 E;  2JU6 X;  4RCO A;  2ZCC A;  3ZJT A;  5AZF A;  2G4D B;  1XQQ A;  2KN4 A;  5TSS A;  4GB9 A;  1P1A A;  1UBI A;  2PVO D;  4JIO U;  2J4X A;  2NBW B;  2KVZ A;  3SFE B;  4KIK B;  1TKG A;  3AE7 B;  5DPW A;  3ML8 A;  2W55 A;  1TYG B;  2JZP A;  2K5P A;  2BYV E;  3TEX A;  4KGT A;  4YL8 A;  3BYY B;  2B3A A;  3DVG X;  2NR2 A;  3IVF A;  4S17 A;  3TCA A;  2PJH A;  5H8Y E;  2PPH A;  5BO4 B;  1WGD A;  2INP E;  2MJ3 A;  1PDX A;  1WWT A;  1V81 A;  5DPR A;  3MC9 A;  3T9L A;  2V1Y A;  3B2G A;  2E3T A;  5FR6 A;  1F77 A;  4ITK A;  2IO0 B;  2LUE A;  3JVZ X;  2W82 A;  3Q8C A;  4MGK E;  1RFK A;  1ENF A;  4LNO A;  1FIQ A;  2WXF A;  5BYS A;  2VZK B;  2DAF A;  2K22 A;  1WX7 A;  5HKH A;  5D94 A;  2WS3 B;  4BOZ B;  3U8Z A;  1WGG A;  2NVU I;  4EEW A;  1H8C A;  1UBQ A;  1NBF C;  4WJP A;  3QHT A;  2IBI B;  4G50 A;  4AJY B;  3W1S C;  2JZ3 B;  1UGJ A;  1VD2 A;  1Q10 A;  2MW5 A;  5T8I A;  4PK1 A;  3HUI A;  5E6J A;  3H7P B;  1SEB D;  2EKE C;  4DHJ B;  3U7D A;  1LO5 D;  4M0W A;  2V3N A;  3BIN A;  4M8M A;  1UUP A;  4C00 A;  4US8 A;  1T0S C;  4DQO C;  3Q2A C;  3AEC B;  3P2B A;  4HWI B;  4RGM A;  3OWE B;  1IBX B;  2LJI A;  2B76 B;  1XLO A;  3CST A;  1FM0 D;  1C78 A;  4N58 A;  1ET6 A;  5D3I B;  4B95 A;  2KMA A;  4USA A;  4JL9 A;  1WYG A;  3SEB A;  3NJT A;  4BKS A;  1C79 A;  4LNN A;  3HM3 A;  2BTE A;  1FCC C;  1E8Z A;  4HJK A;  3PS6 A;  1N61 A;  2EMT A;  5JHB A;  2L52 A;  2KXJ A;  2KWC A;  4KGS A;  1N62 A;  2DNF A;  4C4V A;  1E8Y A;  2QIE B;  1YIW A;  4PYU A;  4HVB A;  2W9N A;  3VFK A;  3PRZ A;  4MH8 A;  1GG3 A;  5GXG B;  1CQV A;  3N1Y C;  3VH3 B;  1WSP A;  1WE7 A;  2IGH A;  3VR9 B;  3AV8 A;  4MGI E;  1L6U A;  2KWD A;  3HIZ A;  3ZNG C;  1KOT A;  4B0E A;  4XWW A;  4A3O A;  1V86 A;  3TEZ A;  1CMX B;  3NZS A;  4MEL A;  1V49 A;  4ZOH C;  1I4G A;  3NVV A;  1LM8 B;  1SE4 A;  4BBN F;  1SF0 A;  4B9K A;  1XEE A;  3C19 A;  3O13 A;  2GBK A;  2N4F A;  2CHW A;  3U4E G;  3KVF B;  3AE2 B;  1I4Q A;  3NZU A;  2L00 B;  1HE8 A;  5BMI A;  3AMZ A;  2D10 A;  4WWN A;  2WXO A;  2DZM A;  2D3G A;  3IAM 1;  3P4Q B;  5LNK 1;  3SHQ A;  4K7S A;  2DEN B;  4B6W A;  5D2M B;  3NVY A;  2AX5 A;  4W9I A;  1MVK A;  1RLF A;  2MP2 A;  2CKH B;  3W1Y A;  4HRS A;  3KUZ A;  4LNI A;  1J8C A;  2V3S A;  4XC2 A;  4WQM A;  3TBL D;  3ZNZ B;  1FXI A;  3SU8 X;  1LGR A;  4JX1 C;  3QWZ B;  3N1Z C;  3RCZ A;  1V97 A;  1QQR A;  4I6L B;  1NYQ A;  2IGG A;  1EM7 A;  2O2V B;  2V9H A;  5IN7 A;  4LTU A;  4PYZ A;  3EA6 A;  4ZRK A;  2CHZ A;  1MG8 A;  4REZ A;  1TY2 A;  4BKT A;  4HPP A;  4FHJ A;  5TR5 A;  2PKO A;  1WXM A;  3AB5 A;  4W9H A;  3KYC D;  1KLU D;  3IFW B;  3APC A;  3N20 C;  4LK0 M;  2IO2 B;  4NQK E;  2JX5 A;  3VVW B;  1D5X C;  2KYW A;  1WF9 A;  1YN5 A;  3ZJV A;  3I5J C;  3A9K A;  3NG0 A;  2FCN A;  1WI0 A;  1VZ7 A;  3OG5 A;  3QAR A;  2C7N B;  3MTN B;  3ZDM C;  2HTM E;  1L5P A;  4A9A A;  1E8X A;  1MPE A;  2Q5W D;  1XT9 B;  2WXM A;  4OZB A;  4EE2 A;  4K7U A;  1E7U A;  1IUE A;  5AUI A;  2H89 B;  1XXG A;  3A33 B;  5LXI B;  3A9J A;  4M01 A;  4ASW C;  3QC8 B;  3WAP A;  1N6Z A;  3RUL A;  2WDV B;  4ZHP A;  4OVU A;  4I6P A;  4BKG A;  2WHI A;  4N6E B;  5LLI A;  2IDY A;  4WUR A;  2FAZ A;  4KX6 B;  2RPQ A;  2O6V B;  2LVQ A;  2K8B A;  4FA6 A;  4W9E A;  2WLB A;  2C7M B;  2IY0 B;  2BKF A;  5EDS A;  1P7E A;  4C7Z A;  4XWT A;  3VTW A;  3TIX A;  1XCT L;  2SEB D;  1LQB A;  3DVN U;  4BAX A;  2HE7 A;  2L7R A;  1P3Q U;  4F8C B;  2RSU A;  3MC0 B;  4A6Q A;  4YSZ B;  3KYD D;  3R7R A;  1IGD A;  2J53 A;  4DXA B;  2GRI A;  2IZV B;  2KVR A;  1TS5 A;  4RMA A;  2JUO A;  4YTP B;  1L4Z B;  2A5U A;  3FAH A;  1NYR A;  4MDK E;  1YN3 A;  1FNV A;  1WR6 E;  2QEJ C;  5J18 A;  3AH7 A;  1ROE A;  2R61 A;  4KZ0 A;  2QHO A;  1Q0W B;  3VDZ A;  3L16 A;  4NQL B;  4D2K A;  2AL3 A;  3FC4 A;  1QZE A;  4ANV A;  1WZ3 A;  3Q14 C;  4MM3 A;  3B0A A;  1V6E A;  2BT6 A;  4N9F 4;  3Q69 A;  4FJV B;  4K3B A;  3PTF C;  4ARI A;  1WJ4 A;  2BS4 B;  3IHP C;  1E90 A;  1TS4 A;  1BXT A;  2I1J A;  5C1Z A;  1BUI C;  3DHH C;  2KK8 A;  3IXS A;  3SDL C;  2DLB A;  1E9M A;  3HK0 A;  3RUI B;  3GB1 A;  2LVO A;  2ZPN A;  5JH5 C;  2RMM A;  2L0F A;  3AM9 A;  3PGE A;  2YLM A;  1DOX A;  5JXV A;  5G2N A;  2JWZ A;  1YX6 B;  3H9D A;  2BW2 A;  2AWT A;  4TUU A;  1MI0 A;  3I57 A;  1WXA A;  4W9L A;  1EU3 A;  1E7P B;  4C56 C;  2AQ1 B;  4K7W A;  1JCK B;  1S3S G;  1GC7 A;  2WXJ A;  2KDI A;  3UGB B;  3W5V B;  4NJC A;  4HRO A;  4BZA A;  3RYT A;  3ZUN A;  1TJE A;  3GP7 A;  3WA0 A;  1TBE A;  1WJN A;  4AWJ A;  2INC C;  3V05 A;  1F52 A;  2PIA A;  3QAQ A;  3ZYY X;  1Y8R C;  2BBC A;  2KC1 A;  2QDF A;  2NBV B;  1MG4 A;  3BK2 A;  2BWF A;  1EO6 A;  4DWF A;  1KJT A;  2LZ6 A;  3QX1 A;  2C60 A;  1TS2 A;  3ZQ4 A;  1E8W A;  1NDD A;  1AWD A;  2KD0 A;  2AL6 A;  1PGB A;  5E6O A;  4XX5 A;  1AYF A;  3ZDT A;  1SIF A;  3R7Q A;  4L23 A;  3ZO5 B;  2KAN A;  2ASQ A;  3APD A;  3U2S C;  3LB8 C;  2WU2 B;  3H1U A;  1JAL A;  2BYT A;  1TY0 A;  4TSS A;  3BK1 A;  4C7Y A;  2BS2 B;  3PZ7 A;  4HCN B;  4J6I A;  3VUW A;  4WAF A;  3M95 A;  3LXF A;  2KDM A;  1NI3 A;  1SE3 A;  4DBG A;  1T5X D;  2EMS A;  1NEK B;  3T8M A;  4IM0 A;  4I6N B;  1RFA A;  2MHJ A;  1FRD A;  2IY1 B;  3DHI C;  2WGS A;  1V8C A;  4HPL B;  3DPD A;  1V80 A;  3ML9 A;  4ZRJ A;  4MM3 B;  1ET9 A;  2N1V A;  4HDQ A;  4FN2 A;  2WXP A;  2OHF A;  2QJL A;  4W9D A;  4RNA A;  2KX3 A;  2Y5C A;  2N7D A;  4RGN A;  1SGH A;  4GLS C;  2KAJ A;  2WWZ A;  2JXT A;  1HQR D;  1FNU A;  4OVZ A;  2M56 B;  1E5W A;  3UIO B;  2D11 A;  2MEK A;  4W9K A;  1L4D B;  3EHV A;  5L83 A;  2LGY A;  4KSK C;  3AEG B;  3Q3N C;  4HXD A;  4IM3 A;  4EFO A;  2Z0D B;  2K9X A;  2HD5 B;  2IYD B;  1WX8 A;  1KLV A;  1IGC A;  4L2Y A;  1J7A A;  4DHZ B;  5HI1 A;  4HPM B;  3P63 A;  3N1X C;  1XCQ L;  4H2A A;  2KFK A;  2V0G A;  2BVC A; 
#chains in the Genus database with same CATH homology
 2PTL A;  1I4G A;  3NVV A;  1SE2 A;  2MJE A;  1SE4 A;  4HKQ A;  1OQR A;  4LLG M;  1WXQ A;  1SF0 A;  3KQ4 A;  1XEE A;  3FIL B;  3R2I A;  3IT4 B;  1C9F A;  4RGT A;  4MT5 A;  2BS3 B;  1B9R A;  3BVG A;  3O13 A;  2RPV A;  3TEY A;  3U4E G;  2AQ2 B;  4RGO S;  3AE2 B;  4XE0 A;  3T3O A;  2AQ3 B;  3ZGZ A;  1I4Q A;  4XDC A;  3T3N A;  1E10 A;  3AEF B;  3U7Z A;  1PYW D;  4YWG G;  4WWM A;  3AMZ A;  5BMI A;  2WXN A;  2WXO A;  2LEK A;  3IAM 1;  3P4Q B;  2N9L A;  3AE6 B;  4C80 A;  5LNK 1;  3NUH B;  3DWG C;  2FUG 1;  3NVY A;  2AX5 A;  1QT9 A;  5HG2 A;  1MVK A;  3B2F A;  1L6V A;  2N9K A;  1N60 A;  2I38 A;  5EE1 A;  1M4V A;  2QIL A;  1WGK A;  3P42 A;  3BYT B;  1JQ4 A;  1GAQ B;  3NVW A;  3P4P B;  1D5Z C;  2M0A A;  2OED A;  4A90 A;  4YSX B;  3C8Y A;  4HRS A;  2JQR B;  1YNT E;  2PLP A;  3VRA B;  1ZXI A;  4YSY B;  2WQY B;  1F2R C;  3TSS A;  3N9Y C;  4FXC A;  4WQM A;  1FEH A;  1FXI A;  4Q2J A;  2QMT A;  1RM6 C;  3CWI A;  2WDR B;  4JX1 C;  3R2T A;  1D6E C;  3BWU D;  1V97 A;  1NEN B;  1QQR A;  2FBW B;  1NYQ A;  1N5X A;  2V3P A;  2W3R A;  2IGG A;  2KQ4 X;  2L83 A;  1R7S A;  2YEP F;  5G5H A;  1EM7 A;  5BYQ A;  2DBY A;  4LTU A;  3EA6 A;  1K52 A;  2LFI A;  1DGJ A;  3BVZ A;  1MHX A;  1ZP0 B;  4REZ A;  3NZ3 A;  1TY2 A;  4KKJ A;  4DXF A;  2ZW1 A;  3PZ8 A;  2IPK D;  3NRZ A;  2J42 A;  4ZYS A;  2CU3 A;  2INN E;  2PKO A;  3AB5 A;  3URY A;  4GDL B;  2J52 A;  4TMA B;  1KLU D;  2LHD A;  2LMC A;  4OW0 A;  3VQI A;  1D4B A;  4LK0 M;  5MPO A;  2NTT A;  4PT5 A;  4MAC A;  2JWU A;  2N0S B;  1PUT A;  3EUB 2;  2JX5 A;  2ACZ B;  3L4P A;  3AE5 B;  4J3O D;  1D5X C;  1PGX A;  3P4R B;  2W3S A;  3AE9 B;  3MHZ A;  1QLB B;  1YN5 A;  1I4X A;  1KLG D;  3ZJV A;  3AN1 A;  1JWS D;  1XO3 A;  1ZDV A;  1BML C;  2MH7 A;  4ZHO A;  5BYR A;  1JRO A;  1OQQ A;  1VZ7 A;  4YTN B;  5HFY A;  1JWU D;  4ZRP A;  3VRB B;  2FE8 A;  3PO0 A;  2HTM E;  2IJ0 A;  4JWS C;  1L5P A;  2Z8L A;  3IAS 1;  4A9A A;  1MPE A;  1AW7 A;  2Q5W D;  3W9C B;  1IBX A;  1SSN A;  1Y56 A;  2WP9 B;  2WXM A;  2PVG C;  2K0P A;  4JE3 B;  3IT6 B;  4OZB A;  1RYJ A;  4WH4 A;  4EE2 A;  1SJH D;  1XLN A;  2MJD A;  1ZOY B;  1XLQ A;  2WXR A;  3RFZ B;  1IUE A;  1JWB D;  1JW9 D;  3AEB B;  2H89 B;  5AUI A;  1XXG A;  4TQ0 A;  1C77 A;  1UWX A;  5FKA C;  2HDE A;  2DYM A;  1EWY C;  1VZ8 A;  2WDV B;  4ZHP A;  3MP9 A;  4AQ7 A;  3WCQ A;  2NMQ A;  4N6E B;  5HHD G;  3HVZ A;  2IDY A;  3KWV A;  1FFV A;  2DWQ A;  1JML A;  4WUR A;  4KX6 B;  4ARC A;  4A55 A;  3SFD B;  1CJE A;  4JPS A;  1PFD A;  2EKI A;  3AEA B;  2JSV X;  2SAK A;  2TSS A;  1YN4 A;  1E6E B;  4YT0 B;  2H88 B;  3BVM A;  4L1B A;  1ZE3 D;  2G1E A;  2WLB A;  3AEE B;  4HJG E;  1ZDX A;  2XNA C;  2M19 A;  1HXY D;  1ZPS A;  2ONQ A;  3BZD B;  4IOI E;  1KH0 A;  1ZXH A;  2V4I B;  3V3X A;  1P7E A;  1C4A A;  4C7Z A;  4XWT A;  4GDK B;  1F0Z A;  5FK9 C;  1XCT L;  2SEB D;  1FFU A;  3CIR B;  5FR3 A;  4HKZ E;  2WDQ B;  1FO4 A;  1QOB A;  1TKY A;  1VJK A;  3I9V 1;  3MC0 B;  3B9J A;  4KGR A;  4JWU C;  4A6Q A;  4YSZ B;  2D5G A;  1OFF A;  1XLP A;  1IGD A;  2J53 A;  3HRD D;  2GRI A;  1TS5 A;  1A70 A;  5D7G A;  4P16 A;  2RDG A;  4YTP B;  1L4Z B;  2G9H D;  3FAH A;  3U52 E;  4YXD B;  5D3D A;  1NVI D;  1NYR A;  4OZC A;  4DXG A;  1K50 A;  3AE4 B;  4P6V F;  1K53 A;  1YN3 A;  2VZK D;  1FNV A;  5EE3 A;  2BB6 A;  1GOZ A;  2QEJ C;  2WNM A;  4RH6 A;  1VRA B;  2GI9 A;  2ZW0 A;  3E56 A;  3MJ5 A;  3AH7 A;  4OHJ A;  1ROE A;  3AE1 B;  2R61 A;  1SBB B;  2Y3A A;  5G5G A;  3E9S A;  4KKI A;  1ZUD 2;  3TUO A;  4B0M A;  1L0Y B;  1HZ5 A;  1SXT A;  4US9 A;  2LGI A;  4A8X C;  2KMM A;  4D2K A;  1QOG A;  3FC4 A;  3BII D;  1DOY A;  1EWC A;  1VDV A;  1GB4 A;  1VR9 A;  1JWA D;  1QOF A;  3P1M A;  1SIJ A;  3ETR A;  3LYY A;  2BT6 A;  1GB1 A;  1SB3 C;  3Q69 A;  1I4P A;  1TKE A;  2QSD A;  1ACC A;  1T3Q A;  2PMV A;  3W2D A;  1C4P A;  1QKZ A;  4YTM B;  1VLB A;  3J9C A;  4ARI A;  2K3U A;  4TQ1 A;  2BS4 B;  3W1S A;  1TS4 A;  1STE A;  2WXH A;  1BXT A;  3GS2 A;  2JU6 X;  2WXI A;  4N59 A;  4RCO A;  3ZJT A;  1BUI C;  2KN4 A;  3IXS A;  5TSS A;  1TS3 A;  3P4S B;  3ABV B;  2PVO D;  2J4X A;  2DLB A;  2JYE A;  3H8H A;  1E9M A;  2DYO A;  3SFE B;  3GB1 A;  1KTK A;  1N63 A;  4XDD A;  1PGA A;  1TKG A;  3AE7 B;  1C76 A;  2W55 A;  2WXK A;  3TEW A;  1TYG B;  2JZP A;  1KF6 B;  2K5P A;  1CZP A;  1I4R A;  3TEX A;  4KGT A;  2RMM A;  3AM9 A;  3BYY B;  1DOX A;  1MHH E;  1DYQ A;  5JXV A;  5H92 C;  2RDH A;  3NVZ A;  1L0X B;  2BW2 A;  3AE3 B;  2CJO A;  1I7H A;  1QIL A;  1TZO A;  3KWL A;  5H8Y E;  1MI0 A;  3I57 A;  5BMH A;  1EU3 A;  1E7P B;  4NAM A;  1SJE D;  1FMA D;  2INP E;  4C56 C;  2ICI A;  2AQ1 B;  2MJ3 A;  1GPX A;  1C4C A;  1PDX A;  1WWT A;  1P7F A;  1JCK B;  4RF1 A;  5C3J B;  4HEA 1;  4RF0 A;  4IDI A;  3Q8B A;  3B2G A;  2E3T A;  1FCL A;  1YQ4 B;  1F77 A;  4ITK A;  4AS1 A;  2WXJ A;  2W82 A;  1XF5 L;  2N7J A;  3EGR A;  3Q8C A;  5I4D A;  1HA5 A;  3W5V B;  4NJC A;  4HRO A;  3KLS X;  1RFK A;  1ENF A;  1RWS A;  1FIQ A;  2WXF A;  4NAW B;  5BYS A;  2VZK B;  1TJE A;  3GP7 A;  3R8B A;  1YQ3 B;  2K22 A;  2Y5P A;  3DWM A;  1JRP A;  1E0Z A;  1V1O A;  3V05 A;  2WS3 B;  2WU5 B;  1J7B A;  2PIA A;  3ZYY X;  1CK1 A;  1AN8 A;  2BBC A;  4UDU C;  3BK2 A;  2JYT A;  4IKG A;  1UWM A;  2L32 A;  5BMG A;  1EU4 A;  1TS2 A;  1UGJ A;  1JWM D;  2WXQ A;  2ON8 A;  3ZQ4 A;  1YJJ A;  2YEP B;  1AWD A;  2WXL A;  1Q10 A;  1PGB A;  1AYF A;  4O1N A;  5T8I A;  4WIP A;  4L23 A;  2LUM A;  3Q8E A;  1QF6 A;  1HZ6 A;  1FXA A;  3HUI A;  5E6J A;  3U2S C;  3LB8 C;  2WU2 B;  1KFY B;  1SEB D;  1T6B X;  2XN9 C;  1LO5 D;  1JAL A;  3AE8 B;  4M0W A;  2BYT A;  1D5M C;  2V3N A;  1ESF A;  1TY0 A;  1YMH E;  1V1P B;  4TSS A;  1VZ6 A;  1L0V B;  1UUP A;  3BK1 A;  4C7Y A;  2BS2 B;  3PZ7 A;  2PW9 A;  4US8 A;  4WAF A;  3LXF A;  2KDM A;  1FRR A;  4DQO C;  1NI3 A;  1SE3 A;  1T5X D;  3AEC B;  5C2T B;  1NEK B;  1K51 A;  4RGM A;  3OWE B;  1IBX B;  2W54 A;  3RPF C;  1FRD A;  2LJI A;  3ZJU A;  2B76 B;  2EEL A;  1XLO A;  2IGD A;  1V8C A;  2GB1 A;  1FM0 D;  1C78 A;  3UI3 A;  4N58 A;  1ET6 A;  5D3I B;  4MM3 B;  1YJI A;  1V1P A;  3AED B;  4USA A;  1ET9 A;  1B1Z A;  1WYG A;  2WXP A;  2OHF A;  2QJL A;  3SEB A;  4RNA A;  1C79 A;  4RFB A;  2Y5C A;  2BTE A;  1FCC C;  1N61 A;  4RGN A;  2NTS A;  2X38 A;  2L52 A;  2WXG A;  3NS1 A;  4GLS C;  2KAJ A;  4KGS A;  2L1A A;  1N62 A;  2JXT A;  3Q8A A;  4CQN A;  1HQR D;  1FNU A;  2QIE B;  4OVZ A;  2M56 B;  1F2R I;  2MEK A;  2KAC A;  1L4D B;  2I2Y A;  1FD6 A;  4MH8 A;  5GXG B;  1CQV A;  3AEG B;  1HEZ E;  2LHE A;  4ZRQ A;  1QOA A;  1WSP A;  2K9X A;  2IGH A;  5AUK A;  3AV8 A;  4OZA A;  3SR6 A;  3VR9 B;  5EE9 A;  1L6U A;  2KWD A;  2CJN A;  3MFG A;  1IGC A;  4L2Y A;  1J7A A;  4R3D A;  5HI1 A;  5EE0 A;  1KRH A;  3FIL A;  4NZL B;  3P63 A;  4B0E A;  3VR8 B;  1XCQ L;  1I4H A;  4XWW A;  1WRI A;  4H2A A;  1UNS A;  1FNW A;  1DOI A;  3W5U B;  3TEZ A;  2E6X A;  2V0G A;  1J7C A;  1N5W A;  3HVD A;  4ZOH C;  3Q8F A;  2BB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...