2KDBA

Solution structure of human ubiquitin-like domain of herpud2_9_85, northeast structural genomics consortium (nesg) target ht53a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
PVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homocysteine-responsive endoplasmic reticulum-resident ubiqu
publication title Structure of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2 (Herpud2 or Herp)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kdbA00
1RRBA 3TIXA 1JRUA 4AWJA 2K6DB 2DAFA 3WAOA 2O6VB 3HK0A 1NDDA 3SU8X 4DHJB 2KWVB 1K8RB 3VTVA 1WY8A 3IBEA 2MBBB 3N30A 4GOCA 2ZNVB 3Q3FA 1YX6B 3H6NA 3SD5A 5L83A 4FJZA 4P7IA 2KWUB 4CO7A 3VQIA 4K81A 2FCMA 3QCAA 2KQSA 3JVZX 3PTFC 2JWZA 3PSEB 4LDTB 3IVFA 5J2RA 2ZVOA 3OLMD 3C0RB 3LDZE 2EKEC 1WJUA 4FHJA 4W9GA 5CTRC 2GBRA 1P3QU 1GUAB 4GDLA 3UIPB 3ZNID 2XEWA 4FJVB 1Y8RC 2DYBA 1LQBA 3S2AA 4GXBA 2Z0DB 1E8WA 2YLMA 4HDOA 3X0WA 4MGKE 4ZDVA 3HHMA 3Q3JA 2M1MA 1VD2A 2AEHA 3NHEB 4MDKE 3PZDA 5CHWA 2WX1A 3APCA 3QJZA 4HK2A 2GBKA 2G3QB 3EECA 1GNUA 2DZIA 3VH3B 2A4ZA 5JH5C 3NOBA 3A1QA 1SGHA 1L2NA 3RUIB 4AJYB 3L54A 2ZCBA 2CR5A 2VRRB 3L10B 3OJ3A 4G11A 5JZEB 2KDIA 2DAJA 1RAXA 1V5OA 4NJ7A 3V60A 4KVGB 2K25A 4NNJB 3GZNI 3WAPA 2C7MB 3ENEA 1OEYA 1UBQA 3ECIA 3H1UA 2ZPNA 3PS6A 5AZHA 1IP9A 2KLCA 3RZWC 1WXVA 5AZGA 2MQJA 5IAAC 2J0MA 2G4SA 2KXJA 3O65B 1Q0WB 2CKHB 1RLFA 5DPTA 4RM8A 2K8CA 1UELA 1UD7A 1Z2MA 4ZRIA 3A9KB 1KLVA 2YVCA 4RM9A 2NPTA 2ZJDA 2BYEA 1YD8U 1P0RA 1WH3A 3W1SC 3SDLC 4CHKA 2RPQA 2LRWA 3OJ4B 3ZRCA 3RYTA 2D3GA 1WX9A 4FULA 3OAWA 3DVGY 1E90A 3ONSA 2R2QA 2XBBC 1SIFA 1WYWB 2KTFA 2D11A 1I42A 1WM2A 4MM3A 4ZRKA 4FBJB 1WJ6A 3VH4B 4YL8A 1GC6A 1WJNA 1WI0A 2FCQA 4WJQA 1WZ0A 4MELA 5JHBA 2KFKA 2ZEQA 1J8CA 3JYUA 1WRDB 4A3OA 2FIDA 4FJYA 2AL6A 3ZRFA 3WALA 2KTRB 3KYCD 3V61A 4CYEA 2N1WA 4HDQA 1H4RA 4WWPA 3VTUA 3WA0A 1P98A 2LXCA 3AULA 4E74A 4IW0A 1V6EA 4W9HA 2KKCA 3QIJA 2HJ8A 2DX5B 5G55A 3EC8A 2IO3B 4B95A 2MP2A 2MA9B 3ZNZB 1OQYA 1UBIA 1V2YA 3V6CB 3I3TB 2A5UA 2N7EA 4XZ4A 2KX3A 4XC2A 4ZRJA 2JRHA 4II3B 3CMMB 2G4DB 2MBEA 4BKGA 5E6OA 1GG3A 2FIFA 2JY6A 3AI5A 4W9CA 4NPNA 2KDFB 3VVWB 3ZNHB 1NI2A 2KNBA 2LRUA 4KZCA 3NZUA 2MX2A 2EMTA 3BINA 4B9KA 2HD5B 2M4NA 4MSMB 2N7DA 4EKUA 4NAWB 3H7PB 5DPRA 1WE6A 2DZKA 2KX0A 2OJRA 4IM2A 1G6JA 5DCNA 2RD0A 4I6LB 3UF8A 4DDGD 2BKFA 5KHOA 2ZCCA 3VAWA 3PT2B 4HCPB 4W9EA 3VUXA 4PYZA 2NBWB 2IY0B 3DBRI 3ZNGC 2D07B 3IG3A 2CHWA 2DYMA 3DBSA 4W9JA 2BF8B 2N1VA 2L8JA 4WWNA 5DPWA 2WDTB 2WYQA 4EZLA 2JRIB 1LM8B 2JT4B 2LZ6A 2BPSA 3ML8A 3A33B 3PLVA 1V86A 4BBNC 4EZKA 3B08A 4G50A 1OEYJ 2LUEA 2N9PC 4ANXA 3PHWB 3T9LA 1YQBA 3PRPB 2GMIC 4M8MA 4AP4C 2BGFA 4GB9A 3PV1A 5J17A 4GDLB 3LJ3A 4FLHA 3VUYA 4JQWC 1QZEA 3HM3A 3TBLD 2MWSB 4ANUA 4LCDE 1WGHA 5D2MB 3VUWA 1WX7A 1U4AA 1V5TA 2NBVB 4BOZB 4GN1A 4IUMB 5JHAA 1F9JA 2K1FA 3TMPB 1XD3B 2FCNA 3ZTDA 1Q5WB 2PEAA 4EUTA 2MSED 4MGYE 1WMHA 1R4MI 3KUDB 4HVBA 2NS5A 1WGRA 3L16A 4KSKC 2KOXA 2M17A 2V3SA 4ZYNA 4E71A 3VFKA 3A1QB 2CU1A 4HJKA 2BWES 2KJRA 2LGDA 4RMAA 4BKTA 4JIOU 4DHZB 3W1YA 1EF5A 3UQBA 2DZJA 5DPSA 3MHSD 1T0YA 2IBIB 1IPGA 2XK5A 3V6EB 2ZZPB 3H9DA 3JSVA 2OOBB 3QAQA 4GMVA 4II2B 5C23A 3RZFA 3ZIMA 4BVUC 2L76A 2IO2B 2KZRA 2KC1A 2D10A 3R3MA 1EO6A 2NR2A 2GBMA 1E8XA 1E8ZA 2K39A 3A9JB 4EEWA 2KHWB 5J18A 2UWQA 3PLUA 4BFRA 3KW5B 4FHKA 2L0FA 2KANA 2PE6B 3AXCA 1WGGA 5EDSA 4JLCA 1UH6A 3QX1A 4HLEA 2K8BA 3U30A 1YX5B 1V80A 1WGDA 4W9LA 3NY5A 5GMVA 4WJNA 1V49A 1EUVB 2KMCA 4AJWA 2I1KA 3DPDA 1S1QB 2IYDB 1TZ1A 2KDBA 2NPTB 3KUCB 4HCNB 3V62A 4HPMB 2KLGA 3M3JA 4WWOA 3N3KB 3PRMB 2C60A 5CX3A 3ALBA 3KVFB 4IM0A 3ZUNA 2K6QA 2MBHA 4EOYA 5AZFA 2CS4A 3KH0A 4PS3A 1A5RA 3QWZB 4IWQA 2PE9A 4TQ0A 2HTHA 2KK8A 2IO0B 1E8YA 2MCNB 1WM3A 1BT0A 4I6PA 1WXSA 4W9IA 5D94A 2JUOA 2N9XA 1KM7A 2ZVNA 1ZGUB 2FCSA 4MJSA 3VXWA 2MW5A 4TKNA 2BKRB 4PYUA 4WJOA 4IC7B 2DENB 2L00B 3ZTCA 2BWFA 2KD0A 2KMAA 3DBHI 4LJOB 1TTNA 1J19A 1TBEA 3EHVA 5FR6A 2O2VA 3NS8A 1UZXB 3R7RA 3ZDMC 1WZ3A 5D7GA 5L95C 1H8CA 2J0KA 3L13A 3QK0A 3DVNU 1WIAA 2C9WB 4BKSA 3QHTA 2KC2A 4MGZE 2LWPA 1M94A 2MP2B 3ZVVA 3VTWA 1OGWA 3L17A 2KN5A 2K8HA 3DVNV 1V81A 4LJPB 3ZO5B 5HKHA 1LFDA 3QA8A 4KIKA 4W9FA 4DDID 3CSFA 4KDLB 4IM3A 3ZW3A 3N32A 4BOSC 2MRPA 4GDKA 2JXXA 3TCAA 4JGHB 4HPLB 2JPHA 2PJHA 2REXA 5IA7A 1L7YA 2O6VA 3DVGX 1E7VA 2MBQA 2DHZA 4K7SA 3A4SC 1IYFA 1AARA 2KFJA 4GIVA 1KJTA 3QQ8B 4ICUA 4K1RB 1WXAA 4NY0A 3SHQA 3T8MA 2IO1B 2L0TA 2C7HA 2NVUI 3L08A 3M63B 4GU2A 2DYOA 1WR1A 2NCNA 1WE7A 3R66C 4NQLB 4URKA 4FADA 2PPHA 3DBLI 2RGFA 2R2OA 4DHZE 1VCBA 2KWCA 2NBUA 1WX8A 2KO3A 2LXAA 3DDCB 3EFUA 3JW0X 4EFOA 1OTRB 3QARA 3U7DA 4I6NB 2EMSA 3VDZA 5LLIA 1CMXB 2C5LC 2LJ5A 1WJ4A 2ZPYA 3U8ZA 3MJWA 3QC8B 2B3AA 1S3SG 4A20A 3B1LX 2FNJB 4DWFA 3RCZA 4PS7A 4OVUA 3UQAA 1NBFC 3UGBB 3PHXB 4W9KA 4GSWA 4NQKE 2RSUA 2CHXA 3R7QA 3L0WB 3B0AA 4G0NB 1PQSA 4M8NA 4X57B 1HE8A 4ANVA 1GJZA 3ML9A 3P2BA 4N9F4 3HM6X 4IWPA 1WMHB 4TQ1A 1KOTA 2LVOA 1MG8A 1X1MA 4F8CB 1ISNA 2QHOA 3NZSA 4MGIE 2D2QA 2LD9A 1WR6E 2IZVB 2IY1B 2CHZA 2Z59B 3CF6E 1P9DU 2MLBA 3PPAA 4K7WA 4XX5A 3TL5A 1E7UA 3APDA 1RFAA 3WIMA 2RR9A 2J7QB 2C7NB 3CSTA 1V9JA 2L3ZA 1J0GA 1YJ1A 1WFYA 2XK5B 1TGZB 1P1AA 3JSVB 3MTNB 4F7ZA 2KVRA 1C3TA 1FXTB 3D32A 2N4FA 2KDEB 1C1YB 2Z0EB 5TR5A 3K9PB 2V4LA 1ZKHA 3A9JA 5G2NA 3A9KA 3X23A 2AL3A 5BO4B 5LXHA 2LVQA 2LASA 1UGMA 4DK5A 1E5WA 2UYZB 3DCGA 4IG7B 2GOWA 2GBNA 4M0WB 2JVCA 2BYFA 1I35A 3IHPC 4WJPA 4DXAB 4EZJA 2L05A 3PGEA 4PS8A 5D6JB 4A3PA 4FA6A 2JF5A 2V1YA 3KUZA 1Q1OA 1WF9A 4KDIC 4OVVA 3TJPA 2J0JA 4F1SA 2ZNVC 2HE7A 2LI5A 1XQQA 1R4NI 2L7RA 3DQVA 2KFKB 4BBNF 1WGYA 5LXIB 2I1JA 2M0XA 1D3ZA 4KSLC 2KTRA 3BY4B 3WANA 2G45B 4GGQA 5E6PA 3AU5A 3GOEA 5AEKB 4TUUA 4NJ6A 4ASWC 4BKSD 2M8SA 5E6NA 1XT9B 3UINB 3IFWB 3RD2A 3ZDTA 1YIWA 2N9EB 4ICVA 2BYVE 2W9NA 2KQ7A 4MJSB 1LXDA 3PVLA 4E3CA 2WWZA 4AOFA 3A4RA 1SE9A 3WAMA 4AUQC 4KZ0A 3APFA 3M62B 4ANWA 2O2VB 4KV2A 4MH0E 2KJHB 3M95A 2WX0A 4DBGA 4K7UA 2Y5BB 2LGXA 4B6WA 1ZW7A 3PREA 5KHQA 2O6VD 4WAAA 3VHTC 4HXDA 2AYOB 5CHVC 4DHJD 5CHFA 2MBOA 4IWOA 2LGYA 3HIZA 2KJ6A 2AWTA 3H7SA 4W9DA 3UIOB 3ZLZA 1Z5SB 4MEMA 3RULA 2JZ3B 3ZKJC 1WXMA 2JZZA 3AU4A 1EF1A 4G3XB 3W1SA 2DZMA 4KIKB 4NAWA 3H7PA 2GBJA 3KYDD 4FN2A 4J6IA 5C1ZA 4LDTD 3DOWA 4HWIB 4JL9A 4WQOB 2FUHB 4MSQB 1GC7A 4TV3A 3RT3B 2ASQA 3PRZA 3K9OB 4GDKB 2FAZA 2LVPA
chains in the Genus database with same CATH superfamily
1JRUA 3WAOA 2DAFA 1NDDA 3NZ3A 3AE9B 1QF6A 1YX6B 5L83A 2L52A 2CU3A 1XXGA 4K81A 3QCAA 3PTFC 2ZVOA 2EELA 4FHJA 5CTRC 4FJVB 1Y8RC 3AMZA 2AX5A 4GXBA 1RM6C 1GAQB 4K3CA 4ZDVA 3KLSX 2M1MA 3ETRA 3APCA 1TS3A 3FKYA 3VH3B 5JH5C 2A4ZA 1SGHA 2WU5B 5G5HA 3GZNB 4AJYB 4ZOHC 2VRRB 4G11A 2WS3B 2KDIA 1V5OA 4KVGB 2K25A 3WAPA 2Y3AA 1YQ3B 3ENEA 1OEYA 2ZPNA 1IP9A 1WXVA 5AZGA 2Z8LA 4YTMB 5IAAC 3P4PB 4D2KA 1Q0WB 4DXFA 1PDXA 1TS5A 1L0XB 5C2TB 1UELA 2Y5PA 3GE8C 1KLVA 2K9XA 3Q69A 2ZJDA 1P0RA 1V97A 1K51A 3OJ4B 1C4PA 4RGOS 2N7JA 1WX9A 4B0EA 1HTOA 1XCTL 2D11A 1UUPA 1EWCA 1KH0A 3B2FA 3KWVA 1GC6A 1WJNA 4WJQA 4MELA 2ZEQA 1EU4A 4A3OA 4FJYA 2AL6A 4HKZE 1YOVB 2KTRB 4C4VA 2N1WA 4YT0B 3AULA 1PUTA 1XO3A 5EE9A 1UGJA 4W9HA 1V1OA 2KKCA 3QIJA 5G55A 2DX5B 4B95A 2WXHA 1EU3A 3ZNZB 2KACA 1V2YA 2A5UA 2N7EA 2KX3A 3IT4B 1FD6A 3VR8B 4II3B 3CMMB 2G4DB 2XNAC 2FIFA 2JY6A 4W9CA 4NPNA 3VVWB 1NI2A 2LRUA 2LFIA 3NZUA 2EMTA 4MSMB 2OJWA 4NAWB 1WE6A 4JX1C 3OWEB 4L23A 4L2YA 4YSXB 2IDYA 1GOZA 1LGRA 4DDGD 2BKFA 4PYZA 2IY0B 1PFDA 1SJED 4WWNA 5DPWA 1MI0A 4XGAB 1LM8B 1VLBA 2JT4B 2LZ6A 3A33B 1ZOYB 4EZKA 1OEYJ 4ANXA 2WXNA 2J52A 4AP4C 2BGFA 4GB9A 5BMGA 3HUIA 3IAS1 5FK9C 3TSSA 1QZEA 3HM3A 2MWSB 1E9MA 4A55A 4ANUA 5D2MB 1U4AA 1F9JA 1FCLA 2BS2B 2V0GA 2NS5A 5D3IB 4BKTA 2KT7A 5G5GA 3BYTB 1VZ6A 2H88B 1IPGA 3V6EB 1L0YB 2ZZPB 4BVUC 3RZFA 2X8XX 2IO2B 2KC1A 3PZ7A 1EO6A 2GBMA 2K39A 2UWQA 1STEA 3ZJTA 3AXCA 3NVWA 1WGGA 1SF0A 4HJGE 1YX5B 4W9LA 1GPXA 3DPDA 2IYDB 2KDBA 3AH7A 2JX5A 4WWOA 2DBYA 2C60A 3ZUNA 2WXRA 4EOYA 2CS4A 4XYCA 4R3DA 2IO0B 3VRAB 1E8YA 3FILA 1BT0A 2JUOA 4K3BA 1RYJA 1KM7A 1TS4A 2WU2B 1XEEA 2FCSA 4MJSA 4PYUA 4WJOA 1FXIA 4C4VB 2BWFA 2KMAA 1FFVA 1J19A 1TBEA 3EHVA 1WZ3A 5D7GA 3QK0A 3DVNU 1WIAA 3I9V1 2KC2A 2LWPA 2IGGA 3ZVVA 3VTWA 1OGWA 2K8HA 3URYA 3QA8A 4KIKA 1JRPA 4W9FA 3ZW3A 2L1AA 2NMQA 1C79A 3DBRB 4GDKA 2JXXA 1FCCC 2REXA 3U2SC 2O6VA 1GB4A 2DHZA 1QOGA 4NY0A 3T8MA 2L0TA 3AE6B 2NCNA 4OZBA 2PPHA 4DHZE 1VCBA 3QARA 4HEA1 3VDZA 5LLIA 4RNAA 1QQRA 2Q5WD 2C5LC 3P4QB 3V05A 1EM7A 1VR9A 2B3AA 3B1LX 1J7BA 2QSDA 4W9KA 3C8YA 4KGRA 3L0WB 4G0NB 1PQSA 4M8NA 1NEKB 2JYEA 4TQ1A 3GP7A 3MJ5A 1BXTA 2IY1B 1LO5D 4XX5A 1YN4A 1JWSD 1RFAA 2RR9A 1WFYA 2QILA 1SB3C 1C3TA 1YN5A 2N4FA 2WDRB 5LXHA 2LVQA 4IG7B 1CZPA 2GBNA 1I35A 4DXAB 4EZJA 3PGEA 4PS8A 1CJEA 2JF5A 3TJPA 2J0JA 2ICIA 2ZNVC 3RNFC 2HE7A 4O1NA 1WGYA 1D3ZA 3DBHB 4KSLC 2R61A 3WANA 3GOEA 4NJ6A 4ASWC 2M8SA 1XT9B 3UINB 1EWYC 1YIWA 4MJSB 4AOFA 5AUKA 1QILA 3WAMA 1JROA 2LHEA 3SFEB 3N20C 3M95A 1IGCA 2Y5BB 1PGBA 1ZW7A 2BYTA 3VHTC 1B1ZA 2AYOB 2GLSA 3HIZA 1N63A 3H8HA 1P7EA 1Z5SB 1EF1A 4KIKB 2GBJA 1C4AA 3KYDD 4FN2A 4JL9A 1VZ8A 4MSQB 3AV8A 4GDKB 1GJZA 2DWQA 1RFKA 1TT5B 4AWJA 2K6DB 2O6VB 2KWVB 1K8RB 3VTVA 3N30A 2MBBB 4GOCA 2N0SB 4KGTA 2KWUB 1I4QA 2BQQA 5T8IA 2K5PA 3PSEB 3R2TA 3OLMD 2JYTA 1FMAD 2EKEC 4L1BA 1VDVA 2I2YA 2GBRA 1P3QU 1GUAB 2SAKA 3UIPB 3ZNID 5IO9A 2WDVB 1TS2A 4PK1A 2Z0DB 3BVZA 1SEBD 3HHMA 3Q3JA 2WGSA 3NHEB 4MDKE 5CHWA 2WX1A 3NVYA 2YEPF 3QJZA 4HK2A 3EECA 2WHIA 4RCOA 1XF5L 3A1QA 3NVVA 3OG5A 1C77A 3L10B 1B9RA 2DAJA 3V60A 3Q2AC 3EA6A 4LNKA 1YJJA 3AE5B 1I4XA 3ECIA 3Q8BA 3T3OA 2J0MA 2KXJA 1AWDA 1RLFA 2WQYB 4ZRIA 3W9CB 2WLBA 4RM9A 2IGHA 1JCKB 4US9A 1WYWB 3NVZA 1WJ6A 3VH4B 2QIEB 2KFKA 2LUMA 3N1YC 2FIDA 4KKIA 4AS1A 2HJ1A 3ZRFA 1TKEA 2RDHA 3KYCD 3V61A 4CYEA 3HVZA 4YWGG 1H4RA 3VTUA 3WA0A 3BVMA 1R7SA 1I4GA 1D5XC 2LXCA 4E74A 3W2DA 4WH4A 2INNE 2BW2A 2MP2A 1QOFA 1OQYA 1UBIA 2MEKA 3U52E 2EKIA 4ZRJA 2BS4B 2JRHA 3N1ZC 1DOYA 2V9HA 2INDC 3PZ8A 1GG3A 2KNBA 3N9YC 2MX2A 2KQ4X 4B9KA 2HD5B 2N7DA 4LNFA 2UU7A 3VRBB 5DCNA 4ACFA 3VAWA 3WCQA 3PT2B 3DBRI 2D07B 3I63C 2CHWA 2DYMA 2BF8B 4IOIE 1F2RI 2WYQA 3PLVA 1VRAB 1V86A 2D3AA 2XN9C 4BBNC 2N9PC 2WXIA 5J17A 3Q14C 3TBLD 1FNVA 1KRHA 2YEPB 1QT9A 5BYQA 3VUWA 1V5TA 5JHAA 1V1PA 3TMPB 2H89B 2LEKA 2WXQA 4RFBA 3CIRB 4LNOA 2M17A 2V3SA 3A1QB 5FR3A 2CU1A 3BK1A 2KJRA 2LGDA 4RMAA 1XCQL 5C3JB 3AE1B 4OHJA 3MHSD 1T0YA 3LB8C 2XK5A 2N9KA 2AQ3B 2OOBB 4GMVA 1N5WA 2L76A 5LNK1 2CJOA 5J18A 3PLUA 4BFRA 3GE3C 1UH6A 4M0WA 2K8BA 4KKJA 3U30A 1WGDA 5GMVA 3GS2A 1WGKA 1FPYA 1TIFA 2KVZA 3KUCB 3V62A 3M3JA 3ALBA 4YXDB 4IM0A 2KK8A 1E10A 2SEBD 2MCNB 1I4RA 1WM3A 4LK0M 4QAYA 1C9FA 2DENB 3ZTCA 2KD0A 4HRSA 3DBHI 3NJTA 5L95C 3ZDMC 4J3OD 4NZLB 2W55A 2C9WB 3QHTA 1D6EC 2LHDA 1M94A 2MP2B 2ON8A 1FRRA 2KN5A 2VH1A 1V81A 1LFDA 3AEDB 4DDID 5AUIA 3CSFA 3P63A 4RH6A 3N32A 4BOSC 2LGSA 4NJCA 3DVGX 1TKYA 2RDBC 2GRIA 4M02A 2KFJA 4GIVA 3QQ8B 2OHFA 1TZOA 2TSSA 2K0PA 3AB5A 4ZRQA 2KWCA 3E56A 2LXAA 4EFOA 2G1EA 3B9JA 2J53A 2JSVX 2EMSA 1R4MB 4A6QA 1WJ4A 3QC8B 1F0ZA 4A20A 3RCZA 4WURA 1NBFC 4GSWA 1ZUD2 2CHXA 1V1PB 3P2BA 3HM6X 1KOTA 1MG8A 2DNFA 1X1MA 4F8CB 3IXSA 3NZSA 4MGIE 2IZVB 4ITKA 4OVZA 5EE1A 1E7UA 3FC4A 2C7NB 3AEFB 2XK5B 1P1AA 2KVRA 1FXTB 3D32A 1WWTA 2KDEB 3NG0A 1C1YB 2V4LA 3A9JA 1YNTE 1CQVA 3BK2A 2LASA 4DK5A 2UYZB 4M0WB 2JVCA 2PW9A 2BYFA 3IHPC 5D6JB 4RGNA 4RGMA 3BYYB 4ARCA 1J7CA 1Q1OA 4OVVA 2WXFA 4BBNF 2I1JA 4C7YA 2KWDA 3BY4B 3BVGA 5E6PA 4TUUA 3IAM1 1JQ4A 2FUG1 3IFWB 3RD2A 4H2AA 1GB1A 1LXDA 3PVLA 4E3CA 3A4RA 4IKGA 1WRIA 3APFA 4ANWA 2WXJA 5BMHA 4KV2A 4DBGA 1HEZE 2RMMA 4B6WA 3PREA 4DQOC 2O6VD 4OZCA 1WSPA 3H7SA 3UIOB 5FKAC 2JZZA 1L6UA 3H7PA 5C1ZA 3P42A 4WQOB 1UWXA 2FUHB 4TV3A 3DBLB 3K9OB 1JWMD 1D5ZC 2ZW0A 1QOBA 3TIXA 1CK1A 2BT6A 5JXVA 3SU8X 1WY8A 3IBEA 2PVGC 3Q3FA 1K53A 3H6NA 4P7IA 4RF0A 1YQ4B 2KQSA 2KN4A 2JWZA 3C0RB 4W9GA 5H8YE 3UI3A 2XEWA 1MHXA 4XE0A 1LQBA 4N59A 1C78A 2JQRB 3X0WA 4MGKE 2KAJA 3Q3MC 1SIJA 3PZDA 2IPKD 3AEAB 2G3QB 1GNUA 2DZIA 3NRZA 2HDEA 3NOBA 2AQ2B 2PMVA 2QDFA 3RUIB 1P7FA 3L54A 2CR5A 3OJ3A 4P16A 2I38A 3LYYA 5JZEB 1D4BA 1RAXA 4NNJB 3GZNI 2C7MB 3EUB2 1UBQA 1C4CA 2NTTA 2KLCA 2PKOA 3O65B 4XWWA 5DPTA 4RM8A 2L83A 2BVCA 3DHHC 1SXTA 1UD7A 1Y56A 2W54A 2NPTA 2BYEA 1YD8U 3W1SC 1WH3A 4CHKA 2LRWA 3ZRCA 2JXTA 4M01A 4FULA 3DVGY 3Q8AA 1E90A 3ONSA 4EE2A 2R2QA 2XBBC 1SIFA 4P1BC 4HPPA 1I42A 1WM2A 4MM3A 4ZRKA 4FBJB 4WQMA 4YL8A 3AE3B 1WZ0A 3FILB 2RPVA 1SE4A 3AECB 3WALA 1JWUD 2L32A 4HDQA 1P98A 2VZKB 2NTSA 1OQQA 1F1HA 2IJ0A 1ROEA 2HJ8A 5GXGB 3V6CB 1XLNA 4XZ4A 3TEXA 4XC2A 3EGRA 3MP9A 3RNAC 4A9AA 1KFYB 2WP9B 3ZQ4A 2MBEA 5E6OA 4BAXA 3AI5A 3ZNHB 4KZCA 1SJHD 3BINA 2M4NA 4CQNA 1L6VA 3H7PB 3BZDB 1XLQA 1OQRA 1G6JA 2LGIA 3UF8A 5KHOA 2ZCCA 3VUXA 1T6BX 1QKZA 2NBWB 3IG3A 1XLOA 1I4PA 1V8CA 2N1VA 2L8JA 2WDTB 4EZLA 2JRIB 4XDDA 3B08A 4G50A 2LUEA 2WXKA 3Q3OC 3PHWB 3T9LA 1Q10A 2JZPA 1YQBA 4C7ZA 3PRPB 2GMIC 4M8MA 3NUHB 4ARIA 2MJ3A 3LJ3A 3VUYA 1QOAA 4BOZB 4GN1A 2B76B 2FCNA 3N1XC 2PEAA 3ZXVA 4EUTA 2MSED 2QCZA 3Q8FA 4MGYE 1R4MI 1L4ZB 3L16A 4KSKC 4C56C 2KOXA 1ESFA 3E9SA 2WDQB 3GB1A 4E71A 4HJKA 1PGAA 2BWES 2D5GA 1NVID 4JIOU 3TUOA 4DHZB 1EF5A 1ENFA 4II2B 3QAQA 3ZIMA 2KZRA 4EEWA 1MHHE 3KW5B 2HTME 3TEYA 2L0FA 2KANA 5EDSA 4JLCA 1V80A 3NY5A 3RN9C 3AEGB 4S17A 1N6ZA 1L5PA 2D3BA 2KMCA 2I1KA 1F2RC 4AJWA 1TZ1A 2NPTB 3Q8CA 4MACA 3PRMB 2MJEA 2INPE 5CX3A 4REZA 1WXQA 3KH0A 3QWZB 4TQ0A 2BS3B 2HTHA 4MM3B 2Y5CA 3MHZA 4W9IA 2QEJC 5D94A 1PYWD 3DHIC 3P1MA 4US8A 1ZGUB 3VXWA 3RPFC 2M56B 4TKNA 2AQ1B 4IC7B 4P6VF 2E6XA 3RNCC 4ZYSA 3ZJVA 1MPEA 1TTNA 4YSYB 1XLPA 1N60A 3NS8A 1H8CA 3AE7B 2J0KA 3L13A 4LNNA 4AQ7A 1E6EB 4BKSA 1K52A 2KYWA 3EFCA 2PTLA 3TEWA 3DVNV 4LJPB 3ZO5B 5HKHA 3TEZA 5IKCM 4KDLB 4IM3A 2MRPA 3FAHA 4HPLB 2JPHA 2K3UA 4DXGA 5IA7A 3PO0A 2QC8A 2D3CA 4LLGM 2KMMA 1I7HA 1E7VA 2MBQA 3R2IA 1E0ZA 3SHQA 4K1RB 1WXAA 2NVUI 2C7HA 3L08A 1WR1A 3R66C 4NQLB 1IGDA 4FADA 1I4HA 2RGFA 3DBLI 2NBUA 3EFUA 3JW0X 1JWAD 1SSNA 2FE8A 5IP4D 4I6NB 5HG2A 1L4DB 1HXYD 2LJIA 1VJKA 2ZPYA 3U8ZA 3DWMA 3IT6B 3MC0B 2FNJB 3B2GA 4PS7A 4XWTA 4OVUA 1ZXIA 2W3SA 4YTPB 3PHXB 4HROA 3AE4B 4NQKE 4X57B 1HE8A 4JPSA 3HRDD 4N9F4 2BTEA 4IWPA 3O13A 2LVOA 4HPMB 1WR6E 3CF6E 2CHZA 3TL5A 4K7WA 3PPAA 2MLBA 3APDA 2J7QB 4YTNB 1V9JA 2INCC 1YJ1A 1TGZB 3MTNB 4N6EB 2VH2A 4WIPA 2Z0EB 2QMTA 5TR5A 3K9PB 3A9KA 1KLUD 1HQRD 3KWLA 1T5XD 1F77A 1DOXA 3DCGA 4KGSA 1ZDVA 4A3PA 5D3DA 3KUZA 4KDIC 1C76A 2M19A 4F1SA 1BUIC 2LI5A 3BWUD 3DQVA 3L4PA 2KFKB 2ONQA 5LXIB 2M0XA 4GGQA 3KQ4A 3AU5A 5AEKB 4C00A 3U4EG 5E6NA 3ZDTA 2N9EB 2BYVE 2W9NA 4ZRPA 2WWZA 1ACCA 3ZXRA 3M62B 3ZYYX 1N5XA 4MH0E 2KJHB 2WX0A 4PT5A 4K7UA 2CJNA 2LGXA 1JWBD 5KHQA 4WAAA 4HXDA 2KJ6A 3MC8A 3ZLZA 3RULA 4USAA 5IOIA 4J6IA 3DOWA 2LVPA 1RRBA 4OW0A 3HK0A 4DHJB 3Q6BA 2ZNVB 1AW7A 3SEBA 3SD5A 5HHDG 4FJZA 3DWGC 4CO7A 3VQIA 1FRDA 2FCMA 3JVZX 1T0SC 1SBBB 4P1CC 4LDTB 5J2RA 3IVFA 3LDZE 1MG4A 1WJUA 3RI7C 3AEEB 1ZXHA 4GDLA 2ZW1A 2DYBA 2MJDA 3S2AA 1E8WA 2YLMA 4HDOA 4XDCA 3P4RB 1T0RC 1VD2A 2AEHA 2M0AA 2V3PA 4C80A 2GBKA 4TSSA 3Q3NC 5EE0A 5IN7A 1L2NA 1MFWA 1FM0D 2ZCBA 2E3TA 1KF6B 2RDGA 4NJ7A 1TYGB 1FXAA 3RNGC 3H1UA 3PS6A 5AZHA 3RZWC 2MQJA 2G4SA 1FFUA 1VZ7A 2CKHB 2K8CA 1Z2MA 2WXMA 3A9KB 1R4NB 2YVCA 1AN8A 3SDLC 2RPQA 5BYRA 3RYTA 2D3GA 4NAMA 1HA5A 3OAWA 1T3QA 2KTFA 2VZKD 4RF1A 4LTUA 2FCQA 1WI0A 5JHBA 5HFYA 1D5MC 1J8CA 3JYUA 1WRDB 1TKGA 2GI9A 4MT5A 2J4XA 1DOIA 4N58A 1JMLA 1ET6A 3T3NA 1FO4A 4WWPA 4ZHOA 4IW0A 1V6EA 1SE2A 5BMIA 3CWIA 3MC9A 1YJIA 3EC8A 2IO3B 4MH8A 5EE3A 2MA9B 4JWSC 3I3TB 3AN1A 3AE2B 3DHGC 4TMAB 4BKGA 2X38A 4WWMA 1ET9A 2KDFB 2V3NA 4EKUA 5TSSA 5DPRA 3W5UB 2DZKA 2KX0A 2OJRA 4HKQA 4IM2A 4UDUC 1NENB 2RD0A 4I6LB 2V4IB 4HCPB 4W9EA 3ZNGC 1F52A 4LNIA 3DBSA 4W9JA 3MFGA 4JE3B 3SR6A 3ML8A 2BPSA 2MHJA 3R8BA 3PV1A 4GDLB 4FLHA 4JQWC 3ABVB 1WGHA 4LCDE 1TY2A 1WX7A 2NBVB 3BIID 4IUMB 1HTQA 2K1FA 3U7ZA 1XD3B 3ZTDA 1Q5WB 2QJLA 1JW9D 1WMHA 3KUDB 4HVBA 1WGRA 1MVKA 4JWUC 1NYRA 4ZYNA 3VFKA 2WXOA 3AM9A 5HI1A 3W1YA 3UQBA 2DZJA 5DPSA 2IBIB 3J9CA 3JSVA 3H9DA 5E6JA 5C23A 4YSZB 3W5VB 2D10A 3R3MA 4Q2JA 2DLBA 2NR2A 1E8XA 1E8ZA 3A9JB 2KHWB 4FHKA 2PE6B 1NI3A 2OEDA 4HLEA 1YN3A 3QX1A 2IGDA 3ZGZA 1MJDA 4WJNA 1V49A 1EUVB 3P4SB 1S1QB 1FNWA 1KLGD 4HCNB 2KLGA 1L0VB 4B0MA 3N3KB 4WAFA 3KVFB 2MH7A 2K6QA 2MBHA 4M00A 4S0RA 1UWMA 5AZFA 3ZJUA 4PS3A 1A5RA 4IWQA 2PE9A 4I6PA 1WXSA 2PVOD 2ACZB 2N9XA 2ZVNA 1E7PB 2MW5A 2BKRB 1DYQA 1AYFA 2PLPA 2L00B 3HVDA 1IBXA 4LJOB 2WNMA 5FR6A 2O2VA 1UZXB 3R7RA 1YMHE 4MGZE 3VR9B 3AEBB 1N62A 1NYQA 3L17A 1HZ6A 2BB6A 2BB5A 1ZP0B 1TY0A 3TCAA 2K22A 3LXFA 4JGHB 3C19A 2PJHA 1L7YA 4OZAA 4K7SA 3A4SC 1BMLC 1M4VA 1IYFA 1AARA 4DWFA 4ICUA 1KJTA 4A90A 2IO1B 1T0QC 4GU2A 3M63B 2DYOA 1WE7A 4URKA 4GLSC 2WXLA 1HZ5A 2R2OA 1WX8A 2KO3A 3DDCB 1UNSA 1OTRB 4ZHPA 3RMKC 1RWSA 2JU6X 3U7DA 2JWUA 2LMCA 1CMXB 1QLBB 2LJ5A 3MJWA 1PGXA 1ZPSA 1S3SG 1JALA 3UQAA 3UGBB 1N61A 2RSUA 1TJEA 2PIAA 3R7QA 4BZAA 3B0AA 1K50A 4KX6B 4ANVA 3ML9A 1FIQA 1WYGA 1WMHB 1ISNA 2QHOA 2D2QA 2LD9A 3AE8B 2Z59B 1KTKA 1P9DU 3WIMA 4A8XC 1ZDXA 3CSTA 2L3ZA 1J0GA 3NS1A 1J7AA 1UF0A 3JSVB 4F7ZA 2KDMA 1ZKHA 5G2NA 3X23A 1FEHA 2BBCA 2AL3A 5BO4B 2N9LA 1UGMA 1E5WA 1FNUA 3RFZB 2GOWA 2GB1A 3Q8EA 4WJPA 1IUEA 2L05A 4FA6A 2V1YA 2G9HD 1WF9A 1ZE3D 1XQQA 3SFDB 1R4NI 2L7RA 3RNEC 1OFFA 2KTRA 5MPOA 2G45B 5H92C 4BKSD 1A70A 2WXGA 5I4DA 4ICVA 2KQ7A 4FXCA 2WXPA 1SE9A 4AUQC 4KZ0A 1IBXB 1SE3A 2FBWB 2O2VB 4RGTA 2W82A 3I57A 5BYSA 5CHVC 4DHJD 5CHFA 2J42A 2MBOA 4IWOA 2LGYA 2AWTA 4IDIA 3RNBC 4W9DA 4MEMA 2JZ3B 3ZKJC 1WXMA 3AU4A 3W1SA 4G3XB 1DGJA 2DZMA 4NAWA 3V3XA 4LDTD 4HWIB 2W3RA 3I5JC 1GC7A 3RT3B 2ASQA 3PRZA 2FAZA
chains in the Genus database with same CATH topology
1RRBA 3TIXA 1JRUA 4AWJA 2K6DB 2DAFA 3WAOA 2O6VB 3HK0A 1NDDA 3SU8X 4DHJB 2KWVB 1K8RB 3VTVA 1WY8A 3IBEA 2MBBB 3N30A 4GOCA 2ZNVB 3Q3FA 1YX6B 3H6NA 3SD5A 5L83A 4FJZA 4P7IA 2KWUB 4CO7A 3VQIA 4K81A 2FCMA 3QCAA 2KQSA 3JVZX 3PTFC 2JWZA 3PSEB 4LDTB 3IVFA 5J2RA 2ZVOA 3OLMD 3C0RB 3LDZE 2EKEC 1WJUA 4FHJA 4W9GA 5CTRC 2GBRA 1P3QU 1GUAB 4GDLA 3UIPB 3ZNID 2XEWA 4FJVB 1Y8RC 2DYBA 1LQBA 3S2AA 4GXBA 2Z0DB 1E8WA 2YLMA 4HDOA 3X0WA 4MGKE 4ZDVA 3HHMA 3Q3JA 2M1MA 1VD2A 2AEHA 3NHEB 4MDKE 3PZDA 5CHWA 2WX1A 3APCA 3QJZA 4HK2A 2GBKA 2G3QB 3EECA 1GNUA 2DZIA 3VH3B 2A4ZA 5JH5C 3NOBA 3A1QA 1SGHA 1L2NA 3RUIB 4AJYB 3L54A 2ZCBA 2CR5A 2VRRB 3L10B 3OJ3A 4G11A 5JZEB 2KDIA 2DAJA 1RAXA 1V5OA 4NJ7A 3V60A 4KVGB 2K25A 4NNJB 3GZNI 3WAPA 2C7MB 3ENEA 1OEYA 1UBQA 3ECIA 3H1UA 2ZPNA 3PS6A 5AZHA 1IP9A 2KLCA 3RZWC 1WXVA 5AZGA 2MQJA 5IAAC 2J0MA 2G4SA 2KXJA 3O65B 1Q0WB 2CKHB 1RLFA 5DPTA 4RM8A 2K8CA 1UELA 1UD7A 1Z2MA 4ZRIA 3A9KB 1KLVA 2YVCA 4RM9A 2NPTA 2ZJDA 2BYEA 1YD8U 1P0RA 1WH3A 3W1SC 3SDLC 4CHKA 2RPQA 2LRWA 3OJ4B 3ZRCA 3RYTA 2D3GA 1WX9A 4FULA 3OAWA 3DVGY 1E90A 3ONSA 2R2QA 2XBBC 1SIFA 1WYWB 2KTFA 2D11A 1I42A 1WM2A 4MM3A 4ZRKA 4FBJB 1WJ6A 3VH4B 4YL8A 1GC6A 1WJNA 1WI0A 2FCQA 4WJQA 1WZ0A 4MELA 5JHBA 2KFKA 2ZEQA 1J8CA 3JYUA 1WRDB 4A3OA 2FIDA 4FJYA 2AL6A 3ZRFA 3WALA 2KTRB 3KYCD 3V61A 4CYEA 2N1WA 4HDQA 1H4RA 4WWPA 3VTUA 3WA0A 1P98A 2LXCA 3AULA 4E74A 4IW0A 1V6EA 4W9HA 2KKCA 3QIJA 2HJ8A 2DX5B 5G55A 3EC8A 2IO3B 4B95A 2MP2A 2MA9B 3ZNZB 1OQYA 1UBIA 1V2YA 3V6CB 3I3TB 2A5UA 2N7EA 4XZ4A 2KX3A 4XC2A 4ZRJA 2JRHA 4II3B 3CMMB 2G4DB 2MBEA 4BKGA 5E6OA 1GG3A 2FIFA 2JY6A 3AI5A 4W9CA 4NPNA 2KDFB 3VVWB 3ZNHB 1NI2A 2KNBA 2LRUA 4KZCA 3NZUA 2MX2A 2EMTA 3BINA 4B9KA 2HD5B 2M4NA 4MSMB 2N7DA 4EKUA 4NAWB 3H7PB 5DPRA 1WE6A 2DZKA 2KX0A 2OJRA 4IM2A 1G6JA 5DCNA 2RD0A 4I6LB 3UF8A 4DDGD 2BKFA 5KHOA 2ZCCA 3VAWA 3PT2B 4HCPB 4W9EA 3VUXA 4PYZA 2NBWB 2IY0B 3DBRI 3ZNGC 2D07B 3IG3A 2CHWA 2DYMA 3DBSA 4W9JA 2BF8B 2N1VA 2L8JA 4WWNA 5DPWA 2WDTB 2WYQA 4EZLA 2JRIB 1LM8B 2JT4B 2LZ6A 2BPSA 3ML8A 3A33B 3PLVA 1V86A 4BBNC 4EZKA 3B08A 4G50A 1OEYJ 2LUEA 2N9PC 4ANXA 3PHWB 3T9LA 1YQBA 3PRPB 2GMIC 4M8MA 4AP4C 2BGFA 4GB9A 3PV1A 5J17A 4GDLB 3LJ3A 4FLHA 3VUYA 4JQWC 1QZEA 3HM3A 3TBLD 2MWSB 4ANUA 4LCDE 1WGHA 5D2MB 3VUWA 1WX7A 1U4AA 1V5TA 2NBVB 4BOZB 4GN1A 4IUMB 5JHAA 1F9JA 2K1FA 3TMPB 1XD3B 2FCNA 3ZTDA 1Q5WB 2PEAA 4EUTA 2MSED 4MGYE 1WMHA 1R4MI 3KUDB 4HVBA 2NS5A 1WGRA 3L16A 4KSKC 2KOXA 2M17A 2V3SA 4ZYNA 4E71A 3VFKA 3A1QB 2CU1A 4HJKA 2BWES 2KJRA 2LGDA 4RMAA 4BKTA 4JIOU 4DHZB 3W1YA 1EF5A 3UQBA 2DZJA 5DPSA 3MHSD 1T0YA 2IBIB 1IPGA 2XK5A 3V6EB 2ZZPB 3H9DA 3JSVA 2OOBB 3QAQA 4GMVA 4II2B 5C23A 3RZFA 3ZIMA 4BVUC 2L76A 2IO2B 2KZRA 2KC1A 2D10A 3R3MA 1EO6A 2NR2A 2GBMA 1E8XA 1E8ZA 2K39A 3A9JB 4EEWA 2KHWB 5J18A 2UWQA 3PLUA 4BFRA 3KW5B 4FHKA 2L0FA 2KANA 2PE6B 3AXCA 1WGGA 5EDSA 4JLCA 1UH6A 3QX1A 4HLEA 2K8BA 3U30A 1YX5B 1V80A 1WGDA 4W9LA 3NY5A 5GMVA 4WJNA 1V49A 1EUVB 2KMCA 4AJWA 2I1KA 3DPDA 1S1QB 2IYDB 1TZ1A 2KDBA 2NPTB 3KUCB 4HCNB 3V62A 4HPMB 2KLGA 3M3JA 4WWOA 3N3KB 3PRMB 2C60A 5CX3A 3ALBA 3KVFB 4IM0A 3ZUNA 2K6QA 2MBHA 4EOYA 5AZFA 2CS4A 3KH0A 4PS3A 1A5RA 3QWZB 4IWQA 2PE9A 4TQ0A 2HTHA 2KK8A 2IO0B 1E8YA 2MCNB 1WM3A 1BT0A 4I6PA 1WXSA 4W9IA 5D94A 2JUOA 2N9XA 1KM7A 2ZVNA 1ZGUB 2FCSA 4MJSA 3VXWA 2MW5A 4TKNA 2BKRB 4PYUA 4WJOA 4IC7B 2DENB 2L00B 3ZTCA 2BWFA 2KD0A 2KMAA 3DBHI 4LJOB 1TTNA 1J19A 1TBEA 3EHVA 5FR6A 2O2VA 3NS8A 1UZXB 3R7RA 3ZDMC 1WZ3A 5D7GA 5L95C 1H8CA 2J0KA 3L13A 3QK0A 3DVNU 1WIAA 2C9WB 4BKSA 3QHTA 2KC2A 4MGZE 2LWPA 1M94A 2MP2B 3ZVVA 3VTWA 1OGWA 3L17A 2KN5A 2K8HA 3DVNV 1V81A 4LJPB 3ZO5B 5HKHA 1LFDA 3QA8A 4KIKA 4W9FA 4DDID 3CSFA 4KDLB 4IM3A 3ZW3A 3N32A 4BOSC 2MRPA 4GDKA 2JXXA 3TCAA 4JGHB 4HPLB 2JPHA 2PJHA 2REXA 5IA7A 1L7YA 2O6VA 3DVGX 1E7VA 2MBQA 2DHZA 4K7SA 3A4SC 1IYFA 1AARA 2KFJA 4GIVA 1KJTA 3QQ8B 4ICUA 4K1RB 1WXAA 4NY0A 3SHQA 3T8MA 2IO1B 2L0TA 2C7HA 2NVUI 3L08A 3M63B 4GU2A 2DYOA 1WR1A 2NCNA 1WE7A 3R66C 4NQLB 4URKA 4FADA 2PPHA 3DBLI 2RGFA 2R2OA 4DHZE 1VCBA 2KWCA 2NBUA 1WX8A 2KO3A 2LXAA 3DDCB 3EFUA 3JW0X 4EFOA 1OTRB 3QARA 3U7DA 4I6NB 2EMSA 3VDZA 5LLIA 1CMXB 2C5LC 2LJ5A 1WJ4A 2ZPYA 3U8ZA 3MJWA 3QC8B 2B3AA 1S3SG 4A20A 3B1LX 2FNJB 4DWFA 3RCZA 4PS7A 4OVUA 3UQAA 1NBFC 3UGBB 3PHXB 4W9KA 4GSWA 4NQKE 2RSUA 2CHXA 3R7QA 3L0WB 3B0AA 4G0NB 1PQSA 4M8NA 4X57B 1HE8A 4ANVA 1GJZA 3ML9A 3P2BA 4N9F4 3HM6X 4IWPA 1WMHB 4TQ1A 1KOTA 2LVOA 1MG8A 1X1MA 4F8CB 1ISNA 2QHOA 3NZSA 4MGIE 2D2QA 2LD9A 1WR6E 2IZVB 2IY1B 2CHZA 2Z59B 3CF6E 1P9DU 2MLBA 3PPAA 4K7WA 4XX5A 3TL5A 1E7UA 3APDA 1RFAA 3WIMA 2RR9A 2J7QB 2C7NB 3CSTA 1V9JA 2L3ZA 1J0GA 1YJ1A 1WFYA 2XK5B 1TGZB 1P1AA 3JSVB 3MTNB 4F7ZA 2KVRA 1C3TA 1FXTB 3D32A 2N4FA 2KDEB 1C1YB 2Z0EB 5TR5A 3K9PB 2V4LA 1ZKHA 3A9JA 5G2NA 3A9KA 3X23A 2AL3A 5BO4B 5LXHA 2LVQA 2LASA 1UGMA 4DK5A 1E5WA 2UYZB 3DCGA 4IG7B 2GOWA 2GBNA 4M0WB 2JVCA 2BYFA 1I35A 3IHPC 4WJPA 4DXAB 4EZJA 2L05A 3PGEA 4PS8A 5D6JB 4A3PA 4FA6A 2JF5A 2V1YA 3KUZA 1Q1OA 1WF9A 4KDIC 4OVVA 3TJPA 2J0JA 4F1SA 2ZNVC 2HE7A 2LI5A 1XQQA 1R4NI 2L7RA 3DQVA 2KFKB 4BBNF 1WGYA 5LXIB 2I1JA 2M0XA 1D3ZA 4KSLC 2KTRA 3BY4B 3WANA 2G45B 4GGQA 5E6PA 3AU5A 3GOEA 5AEKB 4TUUA 4NJ6A 4ASWC 4BKSD 2M8SA 5E6NA 1XT9B 3UINB 3IFWB 3RD2A 3ZDTA 1YIWA 2N9EB 4ICVA 2BYVE 2W9NA 2KQ7A 4MJSB 1LXDA 3PVLA 4E3CA 2WWZA 4AOFA 3A4RA 1SE9A 3WAMA 4AUQC 4KZ0A 3APFA 3M62B 4ANWA 2O2VB 4KV2A 4MH0E 2KJHB 3M95A 2WX0A 4DBGA 4K7UA 2Y5BB 2LGXA 4B6WA 1ZW7A 3PREA 5KHQA 2O6VD 4WAAA 3VHTC 4HXDA 2AYOB 5CHVC 4DHJD 5CHFA 2MBOA 4IWOA 2LGYA 3HIZA 2KJ6A 2AWTA 3H7SA 4W9DA 3UIOB 3ZLZA 1Z5SB 4MEMA 3RULA 2JZ3B 3ZKJC 1WXMA 2JZZA 3AU4A 1EF1A 4G3XB 3W1SA 2DZMA 4KIKB 4NAWA 3H7PA 2GBJA 3KYDD 4FN2A 4J6IA 5C1ZA 4LDTD 3DOWA 4HWIB 4JL9A 4WQOB 2FUHB 4MSQB 1GC7A 4TV3A 3RT3B 2ASQA 3PRZA 3K9OB 4GDKB 2FAZA 2LVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRB A;  3TIX A;  1JRU A;  4AWJ A;  2K6D B;  2DAF A;  3WAO A;  2O6V B;  3HK0 A;  1NDD A;  3SU8 X;  4DHJ B;  2KWV B;  1K8R B;  3VTV A;  1WY8 A;  3IBE A;  2MBB B;  3N30 A;  4GOC A;  2ZNV B;  3Q3F A;  1YX6 B;  3H6N A;  3SD5 A;  5L83 A;  4FJZ A;  4P7I A;  2KWU B;  4CO7 A;  3VQI A;  4K81 A;  2FCM A;  3QCA A;  2KQS A;  3JVZ X;  3PTF C;  2JWZ A;  3PSE B;  4LDT B;  3IVF A;  5J2R A;  2ZVO A;  3OLM D;  3C0R B;  3LDZ E;  2EKE C;  1WJU A;  4FHJ A;  4W9G A;  5CTR C;  2GBR A;  1P3Q U;  1GUA B;  4GDL A;  3UIP B;  3ZNI D;  2XEW A;  4FJV B;  1Y8R C;  2DYB A;  1LQB A;  3S2A A;  4GXB A;  2Z0D B;  1E8W A;  2YLM A;  4HDO A;  3X0W A;  4MGK E;  4ZDV A;  3HHM A;  3Q3J A;  2M1M A;  1VD2 A;  2AEH A;  3NHE B;  4MDK E;  3PZD A;  5CHW A;  2WX1 A;  3APC A;  3QJZ A;  4HK2 A;  2GBK A;  2G3Q B;  3EEC A;  1GNU A;  2DZI A;  3VH3 B;  2A4Z A;  5JH5 C;  3NOB A;  3A1Q A;  1SGH A;  1L2N A;  3RUI B;  4AJY B;  3L54 A;  2ZCB A;  2CR5 A;  2VRR B;  3L10 B;  3OJ3 A;  4G11 A;  5JZE B;  2KDI A;  2DAJ A;  1RAX A;  1V5O A;  4NJ7 A;  3V60 A;  4KVG B;  2K25 A;  4NNJ B;  3GZN I;  3WAP A;  2C7M B;  3ENE A;  1OEY A;  1UBQ A;  3ECI A;  3H1U A;  2ZPN A;  3PS6 A;  5AZH A;  1IP9 A;  2KLC A;  3RZW C;  1WXV A;  5AZG A;  2MQJ A;  5IAA C;  2J0M A;  2G4S A;  2KXJ A;  3O65 B;  1Q0W B;  2CKH B;  1RLF A;  5DPT A;  4RM8 A;  2K8C A;  1UEL A;  1UD7 A;  1Z2M A;  4ZRI A;  3A9K B;  1KLV A;  2YVC A;  4RM9 A;  2NPT A;  2ZJD A;  2BYE A;  1YD8 U;  1P0R A;  1WH3 A;  3W1S C;  3SDL C;  4CHK A;  2RPQ A;  2LRW A;  3OJ4 B;  3ZRC A;  3RYT A;  2D3G A;  1WX9 A;  4FUL A;  3OAW A;  3DVG Y;  1E90 A;  3ONS A;  2R2Q A;  2XBB C;  1SIF A;  1WYW B;  2KTF A;  2D11 A;  1I42 A;  1WM2 A;  4MM3 A;  4ZRK A;  4FBJ B;  1WJ6 A;  3VH4 B;  4YL8 A;  1GC6 A;  1WJN A;  1WI0 A;  2FCQ A;  4WJQ A;  1WZ0 A;  4MEL A;  5JHB A;  2KFK A;  2ZEQ A;  1J8C A;  3JYU A;  1WRD B;  4A3O A;  2FID A;  4FJY A;  2AL6 A;  3ZRF A;  3WAL A;  2KTR B;  3KYC D;  3V61 A;  4CYE A;  2N1W A;  4HDQ A;  1H4R A;  4WWP A;  3VTU A;  3WA0 A;  1P98 A;  2LXC A;  3AUL A;  4E74 A;  4IW0 A;  1V6E A;  4W9H A;  2KKC A;  3QIJ A;  2HJ8 A;  2DX5 B;  5G55 A;  3EC8 A;  2IO3 B;  4B95 A;  2MP2 A;  2MA9 B;  3ZNZ B;  1OQY A;  1UBI A;  1V2Y A;  3V6C B;  3I3T B;  2A5U A;  2N7E A;  4XZ4 A;  2KX3 A;  4XC2 A;  4ZRJ A;  2JRH A;  4II3 B;  3CMM B;  2G4D B;  2MBE A;  4BKG A;  5E6O A;  1GG3 A;  2FIF A;  2JY6 A;  3AI5 A;  4W9C A;  4NPN A;  2KDF B;  3VVW B;  3ZNH B;  1NI2 A;  2KNB A;  2LRU A;  4KZC A;  3NZU A;  2MX2 A;  2EMT A;  3BIN A;  4B9K A;  2HD5 B;  2M4N A;  4MSM B;  2N7D A;  4EKU A;  4NAW B;  3H7P B;  5DPR A;  1WE6 A;  2DZK A;  2KX0 A;  2OJR A;  4IM2 A;  1G6J A;  5DCN A;  2RD0 A;  4I6L B;  3UF8 A;  4DDG D;  2BKF A;  5KHO A;  2ZCC A;  3VAW A;  3PT2 B;  4HCP B;  4W9E A;  3VUX A;  4PYZ A;  2NBW B;  2IY0 B;  3DBR I;  3ZNG C;  2D07 B;  3IG3 A;  2CHW A;  2DYM A;  3DBS A;  4W9J A;  2BF8 B;  2N1V A;  2L8J A;  4WWN A;  5DPW A;  2WDT B;  2WYQ A;  4EZL A;  2JRI B;  1LM8 B;  2JT4 B;  2LZ6 A;  2BPS A;  3ML8 A;  3A33 B;  3PLV A;  1V86 A;  4BBN C;  4EZK A;  3B08 A;  4G50 A;  1OEY J;  2LUE A;  2N9P C;  4ANX A;  3PHW B;  3T9L A;  1YQB A;  3PRP B;  2GMI C;  4M8M A;  4AP4 C;  2BGF A;  4GB9 A;  3PV1 A;  5J17 A;  4GDL B;  3LJ3 A;  4FLH A;  3VUY A;  4JQW C;  1QZE A;  3HM3 A;  3TBL D;  2MWS B;  4ANU A;  4LCD E;  1WGH A;  5D2M B;  3VUW A;  1WX7 A;  1U4A A;  1V5T A;  2NBV B;  4BOZ B;  4GN1 A;  4IUM B;  5JHA A;  1F9J A;  2K1F A;  3TMP B;  1XD3 B;  2FCN A;  3ZTD A;  1Q5W B;  2PEA A;  4EUT A;  2MSE D;  4MGY E;  1WMH A;  1R4M I;  3KUD B;  4HVB A;  2NS5 A;  1WGR A;  3L16 A;  4KSK C;  2KOX A;  2M17 A;  2V3S A;  4ZYN A;  4E71 A;  3VFK A;  3A1Q B;  2CU1 A;  4HJK A;  2BWE S;  2KJR A;  2LGD A;  4RMA A;  4BKT A;  4JIO U;  4DHZ B;  3W1Y A;  1EF5 A;  3UQB A;  2DZJ A;  5DPS A;  3MHS D;  1T0Y A;  2IBI B;  1IPG A;  2XK5 A;  3V6E B;  2ZZP B;  3H9D A;  3JSV A;  2OOB B;  3QAQ A;  4GMV A;  4II2 B;  5C23 A;  3RZF A;  3ZIM A;  4BVU C;  2L76 A;  2IO2 B;  2KZR A;  2KC1 A;  2D10 A;  3R3M A;  1EO6 A;  2NR2 A;  2GBM A;  1E8X A;  1E8Z A;  2K39 A;  3A9J B;  4EEW A;  2KHW B;  5J18 A;  2UWQ A;  3PLU A;  4BFR A;  3KW5 B;  4FHK A;  2L0F A;  2KAN A;  2PE6 B;  3AXC A;  1WGG A;  5EDS A;  4JLC A;  1UH6 A;  3QX1 A;  4HLE A;  2K8B A;  3U30 A;  1YX5 B;  1V80 A;  1WGD A;  4W9L A;  3NY5 A;  5GMV A;  4WJN A;  1V49 A;  1EUV B;  2KMC A;  4AJW A;  2I1K A;  3DPD A;  1S1Q B;  2IYD B;  1TZ1 A;  2KDB A;  2NPT B;  3KUC B;  4HCN B;  3V62 A;  4HPM B;  2KLG A;  3M3J A;  4WWO A;  3N3K B;  3PRM B;  2C60 A;  5CX3 A;  3ALB A;  3KVF B;  4IM0 A;  3ZUN A;  2K6Q A;  2MBH A;  4EOY A;  5AZF A;  2CS4 A;  3KH0 A;  4PS3 A;  1A5R A;  3QWZ B;  4IWQ A;  2PE9 A;  4TQ0 A;  2HTH A;  2KK8 A;  2IO0 B;  1E8Y A;  2MCN B;  1WM3 A;  1BT0 A;  4I6P A;  1WXS A;  4W9I A;  5D94 A;  2JUO A;  2N9X A;  1KM7 A;  2ZVN A;  1ZGU B;  2FCS A;  4MJS A;  3VXW A;  2MW5 A;  4TKN A;  2BKR B;  4PYU A;  4WJO A;  4IC7 B;  2DEN B;  2L00 B;  3ZTC A;  2BWF A;  2KD0 A;  2KMA A;  3DBH I;  4LJO B;  1TTN A;  1J19 A;  1TBE A;  3EHV A;  5FR6 A;  2O2V A;  3NS8 A;  1UZX B;  3R7R A;  3ZDM C;  1WZ3 A;  5D7G A;  5L95 C;  1H8C A;  2J0K A;  3L13 A;  3QK0 A;  3DVN U;  1WIA A;  2C9W B;  4BKS A;  3QHT A;  2KC2 A;  4MGZ E;  2LWP A;  1M94 A;  2MP2 B;  3ZVV A;  3VTW A;  1OGW A;  3L17 A;  2KN5 A;  2K8H A;  3DVN V;  1V81 A;  4LJP B;  3ZO5 B;  5HKH A;  1LFD A;  3QA8 A;  4KIK A;  4W9F A;  4DDI D;  3CSF A;  4KDL B;  4IM3 A;  3ZW3 A;  3N32 A;  4BOS C;  2MRP A;  4GDK A;  2JXX A;  3TCA A;  4JGH B;  4HPL B;  2JPH A;  2PJH A;  2REX A;  5IA7 A;  1L7Y A;  2O6V A;  3DVG X;  1E7V A;  2MBQ A;  2DHZ A;  4K7S A;  3A4S C;  1IYF A;  1AAR A;  2KFJ A;  4GIV A;  1KJT A;  3QQ8 B;  4ICU A;  4K1R B;  1WXA A;  4NY0 A;  3SHQ A;  3T8M A;  2IO1 B;  2L0T A;  2C7H A;  2NVU I;  3L08 A;  3M63 B;  4GU2 A;  2DYO A;  1WR1 A;  2NCN A;  1WE7 A;  3R66 C;  4NQL B;  4URK A;  4FAD A;  2PPH A;  3DBL I;  2RGF A;  2R2O A;  4DHZ E;  1VCB A;  2KWC A;  2NBU A;  1WX8 A;  2KO3 A;  2LXA A;  3DDC B;  3EFU A;  3JW0 X;  4EFO A;  1OTR B;  3QAR A;  3U7D A;  4I6N B;  2EMS A;  3VDZ A;  5LLI A;  1CMX B;  2C5L C;  2LJ5 A;  1WJ4 A;  2ZPY A;  3U8Z A;  3MJW A;  3QC8 B;  2B3A A;  1S3S G;  4A20 A;  3B1L X;  2FNJ B;  4DWF A;  3RCZ A;  4PS7 A;  4OVU A;  3UQA A;  1NBF C;  3UGB B;  3PHX B;  4W9K A;  4GSW A;  4NQK E;  2RSU A;  2CHX A;  3R7Q A;  3L0W B;  3B0A A;  4G0N B;  1PQS A;  4M8N A;  4X57 B;  1HE8 A;  4ANV A;  1GJZ A;  3ML9 A;  3P2B A;  4N9F 4;  3HM6 X;  4IWP A;  1WMH B;  4TQ1 A;  1KOT A;  2LVO A;  1MG8 A;  1X1M A;  4F8C B;  1ISN A;  2QHO A;  3NZS A;  4MGI E;  2D2Q A;  2LD9 A;  1WR6 E;  2IZV B;  2IY1 B;  2CHZ A;  2Z59 B;  3CF6 E;  1P9D U;  2MLB A;  3PPA A;  4K7W A;  4XX5 A;  3TL5 A;  1E7U A;  3APD A;  1RFA A;  3WIM A;  2RR9 A;  2J7Q B;  2C7N B;  3CST A;  1V9J A;  2L3Z A;  1J0G A;  1YJ1 A;  1WFY A;  2XK5 B;  1TGZ B;  1P1A A;  3JSV B;  3MTN B;  4F7Z A;  2KVR A;  1C3T A;  1FXT B;  3D32 A;  2N4F A;  2KDE B;  1C1Y B;  2Z0E B;  5TR5 A;  3K9P B;  2V4L A;  1ZKH A;  3A9J A;  5G2N A;  3A9K A;  3X23 A;  2AL3 A;  5BO4 B;  5LXH A;  2LVQ A;  2LAS A;  1UGM A;  4DK5 A;  1E5W A;  2UYZ B;  3DCG A;  4IG7 B;  2GOW A;  2GBN A;  4M0W B;  2JVC A;  2BYF A;  1I35 A;  3IHP C;  4WJP A;  4DXA B;  4EZJ A;  2L05 A;  3PGE A;  4PS8 A;  5D6J B;  4A3P A;  4FA6 A;  2JF5 A;  2V1Y A;  3KUZ A;  1Q1O A;  1WF9 A;  4KDI C;  4OVV A;  3TJP A;  2J0J A;  4F1S A;  2ZNV C;  2HE7 A;  2LI5 A;  1XQQ A;  1R4N I;  2L7R A;  3DQV A;  2KFK B;  4BBN F;  1WGY A;  5LXI B;  2I1J A;  2M0X A;  1D3Z A;  4KSL C;  2KTR A;  3BY4 B;  3WAN A;  2G45 B;  4GGQ A;  5E6P A;  3AU5 A;  3GOE A;  5AEK B;  4TUU A;  4NJ6 A;  4ASW C;  4BKS D;  2M8S A;  5E6N A;  1XT9 B;  3UIN B;  3IFW B;  3RD2 A;  3ZDT A;  1YIW A;  2N9E B;  4ICV A;  2BYV E;  2W9N A;  2KQ7 A;  4MJS B;  1LXD A;  3PVL A;  4E3C A;  2WWZ A;  4AOF A;  3A4R A;  1SE9 A;  3WAM A;  4AUQ C;  4KZ0 A;  3APF A;  3M62 B;  4ANW A;  2O2V B;  4KV2 A;  4MH0 E;  2KJH B;  3M95 A;  2WX0 A;  4DBG A;  4K7U A;  2Y5B B;  2LGX A;  4B6W A;  1ZW7 A;  3PRE A;  5KHQ A;  2O6V D;  4WAA A;  3VHT C;  4HXD A;  2AYO B;  5CHV C;  4DHJ D;  5CHF A;  2MBO A;  4IWO A;  2LGY A;  3HIZ A;  2KJ6 A;  2AWT A;  3H7S A;  4W9D A;  3UIO B;  3ZLZ A;  1Z5S B;  4MEM A;  3RUL A;  2JZ3 B;  3ZKJ C;  1WXM A;  2JZZ A;  3AU4 A;  1EF1 A;  4G3X B;  3W1S A;  2DZM A;  4KIK B;  4NAW A;  3H7P A;  2GBJ A;  3KYD D;  4FN2 A;  4J6I A;  5C1Z A;  4LDT D;  3DOW A;  4HWI B;  4JL9 A;  4WQO B;  2FUH B;  4MSQ B;  1GC7 A;  4TV3 A;  3RT3 B;  2ASQ A;  3PRZ A;  3K9O B;  4GDK B;  2FAZ A;  2LVP A; 
#chains in the Genus database with same CATH topology
 1JRU A;  3WAO A;  2DAF A;  1NDD A;  3NZ3 A;  3AE9 B;  1QF6 A;  1YX6 B;  5L83 A;  2L52 A;  2CU3 A;  1XXG A;  4K81 A;  3QCA A;  3PTF C;  2ZVO A;  2EEL A;  4FHJ A;  5CTR C;  4FJV B;  1Y8R C;  3AMZ A;  2AX5 A;  4GXB A;  1RM6 C;  1GAQ B;  4K3C A;  4ZDV A;  3KLS X;  2M1M A;  3ETR A;  3APC A;  1TS3 A;  3FKY A;  3VH3 B;  5JH5 C;  2A4Z A;  1SGH A;  2WU5 B;  5G5H A;  3GZN B;  4AJY B;  4ZOH C;  2VRR B;  4G11 A;  2WS3 B;  2KDI A;  1V5O A;  4KVG B;  2K25 A;  3WAP A;  2Y3A A;  1YQ3 B;  3ENE A;  1OEY A;  2ZPN A;  1IP9 A;  1WXV A;  5AZG A;  2Z8L A;  4YTM B;  5IAA C;  3P4P B;  4D2K A;  1Q0W B;  4DXF A;  1PDX A;  1TS5 A;  1L0X B;  5C2T B;  1UEL A;  2Y5P A;  3GE8 C;  1KLV A;  2K9X A;  3Q69 A;  2ZJD A;  1P0R A;  1V97 A;  1K51 A;  3OJ4 B;  1C4P A;  4RGO S;  2N7J A;  1WX9 A;  4B0E A;  1HTO A;  1XCT L;  2D11 A;  1UUP A;  1EWC A;  1KH0 A;  3B2F A;  3KWV A;  1GC6 A;  1WJN A;  4WJQ A;  4MEL A;  2ZEQ A;  1EU4 A;  4A3O A;  4FJY A;  2AL6 A;  4HKZ E;  1YOV B;  2KTR B;  4C4V A;  2N1W A;  4YT0 B;  3AUL A;  1PUT A;  1XO3 A;  5EE9 A;  1UGJ A;  4W9H A;  1V1O A;  2KKC A;  3QIJ A;  5G55 A;  2DX5 B;  4B95 A;  2WXH A;  1EU3 A;  3ZNZ B;  2KAC A;  1V2Y A;  2A5U A;  2N7E A;  2KX3 A;  3IT4 B;  1FD6 A;  3VR8 B;  4II3 B;  3CMM B;  2G4D B;  2XNA C;  2FIF A;  2JY6 A;  4W9C A;  4NPN A;  3VVW B;  1NI2 A;  2LRU A;  2LFI A;  3NZU A;  2EMT A;  4MSM B;  2OJW A;  4NAW B;  1WE6 A;  4JX1 C;  3OWE B;  4L23 A;  4L2Y A;  4YSX B;  2IDY A;  1GOZ A;  1LGR A;  4DDG D;  2BKF A;  4PYZ A;  2IY0 B;  1PFD A;  1SJE D;  4WWN A;  5DPW A;  1MI0 A;  4XGA B;  1LM8 B;  1VLB A;  2JT4 B;  2LZ6 A;  3A33 B;  1ZOY B;  4EZK A;  1OEY J;  4ANX A;  2WXN A;  2J52 A;  4AP4 C;  2BGF A;  4GB9 A;  5BMG A;  3HUI A;  3IAS 1;  5FK9 C;  3TSS A;  1QZE A;  3HM3 A;  2MWS B;  1E9M A;  4A55 A;  4ANU A;  5D2M B;  1U4A A;  1F9J A;  1FCL A;  2BS2 B;  2V0G A;  2NS5 A;  5D3I B;  4BKT A;  2KT7 A;  5G5G A;  3BYT B;  1VZ6 A;  2H88 B;  1IPG A;  3V6E B;  1L0Y B;  2ZZP B;  4BVU C;  3RZF A;  2X8X X;  2IO2 B;  2KC1 A;  3PZ7 A;  1EO6 A;  2GBM A;  2K39 A;  2UWQ A;  1STE A;  3ZJT A;  3AXC A;  3NVW A;  1WGG A;  1SF0 A;  4HJG E;  1YX5 B;  4W9L A;  1GPX A;  3DPD A;  2IYD B;  2KDB A;  3AH7 A;  2JX5 A;  4WWO A;  2DBY A;  2C60 A;  3ZUN A;  2WXR A;  4EOY A;  2CS4 A;  4XYC A;  4R3D A;  2IO0 B;  3VRA B;  1E8Y A;  3FIL A;  1BT0 A;  2JUO A;  4K3B A;  1RYJ A;  1KM7 A;  1TS4 A;  2WU2 B;  1XEE A;  2FCS A;  4MJS A;  4PYU A;  4WJO A;  1FXI A;  4C4V B;  2BWF A;  2KMA A;  1FFV A;  1J19 A;  1TBE A;  3EHV A;  1WZ3 A;  5D7G A;  3QK0 A;  3DVN U;  1WIA A;  3I9V 1;  2KC2 A;  2LWP A;  2IGG A;  3ZVV A;  3VTW A;  1OGW A;  2K8H A;  3URY A;  3QA8 A;  4KIK A;  1JRP A;  4W9F A;  3ZW3 A;  2L1A A;  2NMQ A;  1C79 A;  3DBR B;  4GDK A;  2JXX A;  1FCC C;  2REX A;  3U2S C;  2O6V A;  1GB4 A;  2DHZ A;  1QOG A;  4NY0 A;  3T8M A;  2L0T A;  3AE6 B;  2NCN A;  4OZB A;  2PPH A;  4DHZ E;  1VCB A;  3QAR A;  4HEA 1;  3VDZ A;  5LLI A;  4RNA A;  1QQR A;  2Q5W D;  2C5L C;  3P4Q B;  3V05 A;  1EM7 A;  1VR9 A;  2B3A A;  3B1L X;  1J7B A;  2QSD A;  4W9K A;  3C8Y A;  4KGR A;  3L0W B;  4G0N B;  1PQS A;  4M8N A;  1NEK B;  2JYE A;  4TQ1 A;  3GP7 A;  3MJ5 A;  1BXT A;  2IY1 B;  1LO5 D;  4XX5 A;  1YN4 A;  1JWS D;  1RFA A;  2RR9 A;  1WFY A;  2QIL A;  1SB3 C;  1C3T A;  1YN5 A;  2N4F A;  2WDR B;  5LXH A;  2LVQ A;  4IG7 B;  1CZP A;  2GBN A;  1I35 A;  4DXA B;  4EZJ A;  3PGE A;  4PS8 A;  1CJE A;  2JF5 A;  3TJP A;  2J0J A;  2ICI A;  2ZNV C;  3RNF C;  2HE7 A;  4O1N A;  1WGY A;  1D3Z A;  3DBH B;  4KSL C;  2R61 A;  3WAN A;  3GOE A;  4NJ6 A;  4ASW C;  2M8S A;  1XT9 B;  3UIN B;  1EWY C;  1YIW A;  4MJS B;  4AOF A;  5AUK A;  1QIL A;  3WAM A;  1JRO A;  2LHE A;  3SFE B;  3N20 C;  3M95 A;  1IGC A;  2Y5B B;  1PGB A;  1ZW7 A;  2BYT A;  3VHT C;  1B1Z A;  2AYO B;  2GLS A;  3HIZ A;  1N63 A;  3H8H A;  1P7E A;  1Z5S B;  1EF1 A;  4KIK B;  2GBJ A;  1C4A A;  3KYD D;  4FN2 A;  4JL9 A;  1VZ8 A;  4MSQ B;  3AV8 A;  4GDK B;  1GJZ A;  2DWQ A;  1RFK A;  1TT5 B;  4AWJ A;  2K6D B;  2O6V B;  2KWV B;  1K8R B;  3VTV A;  3N30 A;  2MBB B;  4GOC A;  2N0S B;  4KGT A;  2KWU B;  1I4Q A;  2BQQ A;  5T8I A;  2K5P A;  3PSE B;  3R2T A;  3OLM D;  2JYT A;  1FMA D;  2EKE C;  4L1B A;  1VDV A;  2I2Y A;  2GBR A;  1P3Q U;  1GUA B;  2SAK A;  3UIP B;  3ZNI D;  5IO9 A;  2WDV B;  1TS2 A;  4PK1 A;  2Z0D B;  3BVZ A;  1SEB D;  3HHM A;  3Q3J A;  2WGS A;  3NHE B;  4MDK E;  5CHW A;  2WX1 A;  3NVY A;  2YEP F;  3QJZ A;  4HK2 A;  3EEC A;  2WHI A;  4RCO A;  1XF5 L;  3A1Q A;  3NVV A;  3OG5 A;  1C77 A;  3L10 B;  1B9R A;  2DAJ A;  3V60 A;  3Q2A C;  3EA6 A;  4LNK A;  1YJJ A;  3AE5 B;  1I4X A;  3ECI A;  3Q8B A;  3T3O A;  2J0M A;  2KXJ A;  1AWD A;  1RLF A;  2WQY B;  4ZRI A;  3W9C B;  2WLB A;  4RM9 A;  2IGH A;  1JCK B;  4US9 A;  1WYW B;  3NVZ A;  1WJ6 A;  3VH4 B;  2QIE B;  2KFK A;  2LUM A;  3N1Y C;  2FID A;  4KKI A;  4AS1 A;  2HJ1 A;  3ZRF A;  1TKE A;  2RDH A;  3KYC D;  3V61 A;  4CYE A;  3HVZ A;  4YWG G;  1H4R A;  3VTU A;  3WA0 A;  3BVM A;  1R7S A;  1I4G A;  1D5X C;  2LXC A;  4E74 A;  3W2D A;  4WH4 A;  2INN E;  2BW2 A;  2MP2 A;  1QOF A;  1OQY A;  1UBI A;  2MEK A;  3U52 E;  2EKI A;  4ZRJ A;  2BS4 B;  2JRH A;  3N1Z C;  1DOY A;  2V9H A;  2IND C;  3PZ8 A;  1GG3 A;  2KNB A;  3N9Y C;  2MX2 A;  2KQ4 X;  4B9K A;  2HD5 B;  2N7D A;  4LNF A;  2UU7 A;  3VRB B;  5DCN A;  4ACF A;  3VAW A;  3WCQ A;  3PT2 B;  3DBR I;  2D07 B;  3I63 C;  2CHW A;  2DYM A;  2BF8 B;  4IOI E;  1F2R I;  2WYQ A;  3PLV A;  1VRA B;  1V86 A;  2D3A A;  2XN9 C;  4BBN C;  2N9P C;  2WXI A;  5J17 A;  3Q14 C;  3TBL D;  1FNV A;  1KRH A;  2YEP B;  1QT9 A;  5BYQ A;  3VUW A;  1V5T A;  5JHA A;  1V1P A;  3TMP B;  2H89 B;  2LEK A;  2WXQ A;  4RFB A;  3CIR B;  4LNO A;  2M17 A;  2V3S A;  3A1Q B;  5FR3 A;  2CU1 A;  3BK1 A;  2KJR A;  2LGD A;  4RMA A;  1XCQ L;  5C3J B;  3AE1 B;  4OHJ A;  3MHS D;  1T0Y A;  3LB8 C;  2XK5 A;  2N9K A;  2AQ3 B;  2OOB B;  4GMV A;  1N5W A;  2L76 A;  5LNK 1;  2CJO A;  5J18 A;  3PLU A;  4BFR A;  3GE3 C;  1UH6 A;  4M0W A;  2K8B A;  4KKJ A;  3U30 A;  1WGD A;  5GMV A;  3GS2 A;  1WGK A;  1FPY A;  1TIF A;  2KVZ A;  3KUC B;  3V62 A;  3M3J A;  3ALB A;  4YXD B;  4IM0 A;  2KK8 A;  1E10 A;  2SEB D;  2MCN B;  1I4R A;  1WM3 A;  4LK0 M;  4QAY A;  1C9F A;  2DEN B;  3ZTC A;  2KD0 A;  4HRS A;  3DBH I;  3NJT A;  5L95 C;  3ZDM C;  4J3O D;  4NZL B;  2W55 A;  2C9W B;  3QHT A;  1D6E C;  2LHD A;  1M94 A;  2MP2 B;  2ON8 A;  1FRR A;  2KN5 A;  2VH1 A;  1V81 A;  1LFD A;  3AED B;  4DDI D;  5AUI A;  3CSF A;  3P63 A;  4RH6 A;  3N32 A;  4BOS C;  2LGS A;  4NJC A;  3DVG X;  1TKY A;  2RDB C;  2GRI A;  4M02 A;  2KFJ A;  4GIV A;  3QQ8 B;  2OHF A;  1TZO A;  2TSS A;  2K0P A;  3AB5 A;  4ZRQ A;  2KWC A;  3E56 A;  2LXA A;  4EFO A;  2G1E A;  3B9J A;  2J53 A;  2JSV X;  2EMS A;  1R4M B;  4A6Q A;  1WJ4 A;  3QC8 B;  1F0Z A;  4A20 A;  3RCZ A;  4WUR A;  1NBF C;  4GSW A;  1ZUD 2;  2CHX A;  1V1P B;  3P2B A;  3HM6 X;  1KOT A;  1MG8 A;  2DNF A;  1X1M A;  4F8C B;  3IXS A;  3NZS A;  4MGI E;  2IZV B;  4ITK A;  4OVZ A;  5EE1 A;  1E7U A;  3FC4 A;  2C7N B;  3AEF B;  2XK5 B;  1P1A A;  2KVR A;  1FXT B;  3D32 A;  1WWT A;  2KDE B;  3NG0 A;  1C1Y B;  2V4L A;  3A9J A;  1YNT E;  1CQV A;  3BK2 A;  2LAS A;  4DK5 A;  2UYZ B;  4M0W B;  2JVC A;  2PW9 A;  2BYF A;  3IHP C;  5D6J B;  4RGN A;  4RGM A;  3BYY B;  4ARC A;  1J7C A;  1Q1O A;  4OVV A;  2WXF A;  4BBN F;  2I1J A;  4C7Y A;  2KWD A;  3BY4 B;  3BVG A;  5E6P A;  4TUU A;  3IAM 1;  1JQ4 A;  2FUG 1;  3IFW B;  3RD2 A;  4H2A A;  1GB1 A;  1LXD A;  3PVL A;  4E3C A;  3A4R A;  4IKG A;  1WRI A;  3APF A;  4ANW A;  2WXJ A;  5BMH A;  4KV2 A;  4DBG A;  1HEZ E;  2RMM A;  4B6W A;  3PRE A;  4DQO C;  2O6V D;  4OZC A;  1WSP A;  3H7S A;  3UIO B;  5FKA C;  2JZZ A;  1L6U A;  3H7P A;  5C1Z A;  3P42 A;  4WQO B;  1UWX A;  2FUH B;  4TV3 A;  3DBL B;  3K9O B;  1JWM D;  1D5Z C;  2ZW0 A;  1QOB A;  3TIX A;  1CK1 A;  2BT6 A;  5JXV A;  3SU8 X;  1WY8 A;  3IBE A;  2PVG C;  3Q3F A;  1K53 A;  3H6N A;  4P7I A;  4RF0 A;  1YQ4 B;  2KQS A;  2KN4 A;  2JWZ A;  3C0R B;  4W9G A;  5H8Y E;  3UI3 A;  2XEW A;  1MHX A;  4XE0 A;  1LQB A;  4N59 A;  1C78 A;  2JQR B;  3X0W A;  4MGK E;  2KAJ A;  3Q3M C;  1SIJ A;  3PZD A;  2IPK D;  3AEA B;  2G3Q B;  1GNU A;  2DZI A;  3NRZ A;  2HDE A;  3NOB A;  2AQ2 B;  2PMV A;  2QDF A;  3RUI B;  1P7F A;  3L54 A;  2CR5 A;  3OJ3 A;  4P16 A;  2I38 A;  3LYY A;  5JZE B;  1D4B A;  1RAX A;  4NNJ B;  3GZN I;  2C7M B;  3EUB 2;  1UBQ A;  1C4C A;  2NTT A;  2KLC A;  2PKO A;  3O65 B;  4XWW A;  5DPT A;  4RM8 A;  2L83 A;  2BVC A;  3DHH C;  1SXT A;  1UD7 A;  1Y56 A;  2W54 A;  2NPT A;  2BYE A;  1YD8 U;  3W1S C;  1WH3 A;  4CHK A;  2LRW A;  3ZRC A;  2JXT A;  4M01 A;  4FUL A;  3DVG Y;  3Q8A A;  1E90 A;  3ONS A;  4EE2 A;  2R2Q A;  2XBB C;  1SIF A;  4P1B C;  4HPP A;  1I42 A;  1WM2 A;  4MM3 A;  4ZRK A;  4FBJ B;  4WQM A;  4YL8 A;  3AE3 B;  1WZ0 A;  3FIL B;  2RPV A;  1SE4 A;  3AEC B;  3WAL A;  1JWU D;  2L32 A;  4HDQ A;  1P98 A;  2VZK B;  2NTS A;  1OQQ A;  1F1H A;  2IJ0 A;  1ROE A;  2HJ8 A;  5GXG B;  3V6C B;  1XLN A;  4XZ4 A;  3TEX A;  4XC2 A;  3EGR A;  3MP9 A;  3RNA C;  4A9A A;  1KFY B;  2WP9 B;  3ZQ4 A;  2MBE A;  5E6O A;  4BAX A;  3AI5 A;  3ZNH B;  4KZC A;  1SJH D;  3BIN A;  2M4N A;  4CQN A;  1L6V A;  3H7P B;  3BZD B;  1XLQ A;  1OQR A;  1G6J A;  2LGI A;  3UF8 A;  5KHO A;  2ZCC A;  3VUX A;  1T6B X;  1QKZ A;  2NBW B;  3IG3 A;  1XLO A;  1I4P A;  1V8C A;  2N1V A;  2L8J A;  2WDT B;  4EZL A;  2JRI B;  4XDD A;  3B08 A;  4G50 A;  2LUE A;  2WXK A;  3Q3O C;  3PHW B;  3T9L A;  1Q10 A;  2JZP A;  1YQB A;  4C7Z A;  3PRP B;  2GMI C;  4M8M A;  3NUH B;  4ARI A;  2MJ3 A;  3LJ3 A;  3VUY A;  1QOA A;  4BOZ B;  4GN1 A;  2B76 B;  2FCN A;  3N1X C;  2PEA A;  3ZXV A;  4EUT A;  2MSE D;  2QCZ A;  3Q8F A;  4MGY E;  1R4M I;  1L4Z B;  3L16 A;  4KSK C;  4C56 C;  2KOX A;  1ESF A;  3E9S A;  2WDQ B;  3GB1 A;  4E71 A;  4HJK A;  1PGA A;  2BWE S;  2D5G A;  1NVI D;  4JIO U;  3TUO A;  4DHZ B;  1EF5 A;  1ENF A;  4II2 B;  3QAQ A;  3ZIM A;  2KZR A;  4EEW A;  1MHH E;  3KW5 B;  2HTM E;  3TEY A;  2L0F A;  2KAN A;  5EDS A;  4JLC A;  1V80 A;  3NY5 A;  3RN9 C;  3AEG B;  4S17 A;  1N6Z A;  1L5P A;  2D3B A;  2KMC A;  2I1K A;  1F2R C;  4AJW A;  1TZ1 A;  2NPT B;  3Q8C A;  4MAC A;  3PRM B;  2MJE A;  2INP E;  5CX3 A;  4REZ A;  1WXQ A;  3KH0 A;  3QWZ B;  4TQ0 A;  2BS3 B;  2HTH A;  4MM3 B;  2Y5C A;  3MHZ A;  4W9I A;  2QEJ C;  5D94 A;  1PYW D;  3DHI C;  3P1M A;  4US8 A;  1ZGU B;  3VXW A;  3RPF C;  2M56 B;  4TKN A;  2AQ1 B;  4IC7 B;  4P6V F;  2E6X A;  3RNC C;  4ZYS A;  3ZJV A;  1MPE A;  1TTN A;  4YSY B;  1XLP A;  1N60 A;  3NS8 A;  1H8C A;  3AE7 B;  2J0K A;  3L13 A;  4LNN A;  4AQ7 A;  1E6E B;  4BKS A;  1K52 A;  2KYW A;  3EFC A;  2PTL A;  3TEW A;  3DVN V;  4LJP B;  3ZO5 B;  5HKH A;  3TEZ A;  5IKC M;  4KDL B;  4IM3 A;  2MRP A;  3FAH A;  4HPL B;  2JPH A;  2K3U A;  4DXG A;  5IA7 A;  3PO0 A;  2QC8 A;  2D3C A;  4LLG M;  2KMM A;  1I7H A;  1E7V A;  2MBQ A;  3R2I A;  1E0Z A;  3SHQ A;  4K1R B;  1WXA A;  2NVU I;  2C7H A;  3L08 A;  1WR1 A;  3R66 C;  4NQL B;  1IGD A;  4FAD A;  1I4H A;  2RGF A;  3DBL I;  2NBU A;  3EFU A;  3JW0 X;  1JWA D;  1SSN A;  2FE8 A;  5IP4 D;  4I6N B;  5HG2 A;  1L4D B;  1HXY D;  2LJI A;  1VJK A;  2ZPY A;  3U8Z A;  3DWM A;  3IT6 B;  3MC0 B;  2FNJ B;  3B2G A;  4PS7 A;  4XWT A;  4OVU A;  1ZXI A;  2W3S A;  4YTP B;  3PHX B;  4HRO A;  3AE4 B;  4NQK E;  4X57 B;  1HE8 A;  4JPS A;  3HRD D;  4N9F 4;  2BTE A;  4IWP A;  3O13 A;  2LVO A;  4HPM B;  1WR6 E;  3CF6 E;  2CHZ A;  3TL5 A;  4K7W A;  3PPA A;  2MLB A;  3APD A;  2J7Q B;  4YTN B;  1V9J A;  2INC C;  1YJ1 A;  1TGZ B;  3MTN B;  4N6E B;  2VH2 A;  4WIP A;  2Z0E B;  2QMT A;  5TR5 A;  3K9P B;  3A9K A;  1KLU D;  1HQR D;  3KWL A;  1T5X D;  1F77 A;  1DOX A;  3DCG A;  4KGS A;  1ZDV A;  4A3P A;  5D3D A;  3KUZ A;  4KDI C;  1C76 A;  2M19 A;  4F1S A;  1BUI C;  2LI5 A;  3BWU D;  3DQV A;  3L4P A;  2KFK B;  2ONQ A;  5LXI B;  2M0X A;  4GGQ A;  3KQ4 A;  3AU5 A;  5AEK B;  4C00 A;  3U4E G;  5E6N A;  3ZDT A;  2N9E B;  2BYV E;  2W9N A;  4ZRP A;  2WWZ A;  1ACC A;  3ZXR A;  3M62 B;  3ZYY X;  1N5X A;  4MH0 E;  2KJH B;  2WX0 A;  4PT5 A;  4K7U A;  2CJN A;  2LGX A;  1JWB D;  5KHQ A;  4WAA A;  4HXD A;  2KJ6 A;  3MC8 A;  3ZLZ A;  3RUL A;  4USA A;  5IOI A;  4J6I A;  3DOW A;  2LVP A;  1RRB A;  4OW0 A;  3HK0 A;  4DHJ B;  3Q6B A;  2ZNV B;  1AW7 A;  3SEB A;  3SD5 A;  5HHD G;  4FJZ A;  3DWG C;  4CO7 A;  3VQI A;  1FRD A;  2FCM A;  3JVZ X;  1T0S C;  1SBB B;  4P1C C;  4LDT B;  5J2R A;  3IVF A;  3LDZ E;  1MG4 A;  1WJU A;  3RI7 C;  3AEE B;  1ZXH A;  4GDL A;  2ZW1 A;  2DYB A;  2MJD A;  3S2A A;  1E8W A;  2YLM A;  4HDO A;  4XDC A;  3P4R B;  1T0R C;  1VD2 A;  2AEH A;  2M0A A;  2V3P A;  4C80 A;  2GBK A;  4TSS A;  3Q3N C;  5EE0 A;  5IN7 A;  1L2N A;  1MFW A;  1FM0 D;  2ZCB A;  2E3T A;  1KF6 B;  2RDG A;  4NJ7 A;  1TYG B;  1FXA A;  3RNG C;  3H1U A;  3PS6 A;  5AZH A;  3RZW C;  2MQJ A;  2G4S A;  1FFU A;  1VZ7 A;  2CKH B;  2K8C A;  1Z2M A;  2WXM A;  3A9K B;  1R4N B;  2YVC A;  1AN8 A;  3SDL C;  2RPQ A;  5BYR A;  3RYT A;  2D3G A;  4NAM A;  1HA5 A;  3OAW A;  1T3Q A;  2KTF A;  2VZK D;  4RF1 A;  4LTU A;  2FCQ A;  1WI0 A;  5JHB A;  5HFY A;  1D5M C;  1J8C A;  3JYU A;  1WRD B;  1TKG A;  2GI9 A;  4MT5 A;  2J4X A;  1DOI A;  4N58 A;  1JML A;  1ET6 A;  3T3N A;  1FO4 A;  4WWP A;  4ZHO A;  4IW0 A;  1V6E A;  1SE2 A;  5BMI A;  3CWI A;  3MC9 A;  1YJI A;  3EC8 A;  2IO3 B;  4MH8 A;  5EE3 A;  2MA9 B;  4JWS C;  3I3T B;  3AN1 A;  3AE2 B;  3DHG C;  4TMA B;  4BKG A;  2X38 A;  4WWM A;  1ET9 A;  2KDF B;  2V3N A;  4EKU A;  5TSS A;  5DPR A;  3W5U B;  2DZK A;  2KX0 A;  2OJR A;  4HKQ A;  4IM2 A;  4UDU C;  1NEN B;  2RD0 A;  4I6L B;  2V4I B;  4HCP B;  4W9E A;  3ZNG C;  1F52 A;  4LNI A;  3DBS A;  4W9J A;  3MFG A;  4JE3 B;  3SR6 A;  3ML8 A;  2BPS A;  2MHJ A;  3R8B A;  3PV1 A;  4GDL B;  4FLH A;  4JQW C;  3ABV B;  1WGH A;  4LCD E;  1TY2 A;  1WX7 A;  2NBV B;  3BII D;  4IUM B;  1HTQ A;  2K1F A;  3U7Z A;  1XD3 B;  3ZTD A;  1Q5W B;  2QJL A;  1JW9 D;  1WMH A;  3KUD B;  4HVB A;  1WGR A;  1MVK A;  4JWU C;  1NYR A;  4ZYN A;  3VFK A;  2WXO A;  3AM9 A;  5HI1 A;  3W1Y A;  3UQB A;  2DZJ A;  5DPS A;  2IBI B;  3J9C A;  3JSV A;  3H9D A;  5E6J A;  5C23 A;  4YSZ B;  3W5V B;  2D10 A;  3R3M A;  4Q2J A;  2DLB A;  2NR2 A;  1E8X A;  1E8Z A;  3A9J B;  2KHW B;  4FHK A;  2PE6 B;  1NI3 A;  2OED A;  4HLE A;  1YN3 A;  3QX1 A;  2IGD A;  3ZGZ A;  1MJD A;  4WJN A;  1V49 A;  1EUV B;  3P4S B;  1S1Q B;  1FNW A;  1KLG D;  4HCN B;  2KLG A;  1L0V B;  4B0M A;  3N3K B;  4WAF A;  3KVF B;  2MH7 A;  2K6Q A;  2MBH A;  4M00 A;  4S0R A;  1UWM A;  5AZF A;  3ZJU A;  4PS3 A;  1A5R A;  4IWQ A;  2PE9 A;  4I6P A;  1WXS A;  2PVO D;  2ACZ B;  2N9X A;  2ZVN A;  1E7P B;  2MW5 A;  2BKR B;  1DYQ A;  1AYF A;  2PLP A;  2L00 B;  3HVD A;  1IBX A;  4LJO B;  2WNM A;  5FR6 A;  2O2V A;  1UZX B;  3R7R A;  1YMH E;  4MGZ E;  3VR9 B;  3AEB B;  1N62 A;  1NYQ A;  3L17 A;  1HZ6 A;  2BB6 A;  2BB5 A;  1ZP0 B;  1TY0 A;  3TCA A;  2K22 A;  3LXF A;  4JGH B;  3C19 A;  2PJH A;  1L7Y A;  4OZA A;  4K7S A;  3A4S C;  1BML C;  1M4V A;  1IYF A;  1AAR A;  4DWF A;  4ICU A;  1KJT A;  4A90 A;  2IO1 B;  1T0Q C;  4GU2 A;  3M63 B;  2DYO A;  1WE7 A;  4URK A;  4GLS C;  2WXL A;  1HZ5 A;  2R2O A;  1WX8 A;  2KO3 A;  3DDC B;  1UNS A;  1OTR B;  4ZHP A;  3RMK C;  1RWS A;  2JU6 X;  3U7D A;  2JWU A;  2LMC A;  1CMX B;  1QLB B;  2LJ5 A;  3MJW A;  1PGX A;  1ZPS A;  1S3S G;  1JAL A;  3UQA A;  3UGB B;  1N61 A;  2RSU A;  1TJE A;  2PIA A;  3R7Q A;  4BZA A;  3B0A A;  1K50 A;  4KX6 B;  4ANV A;  3ML9 A;  1FIQ A;  1WYG A;  1WMH B;  1ISN A;  2QHO A;  2D2Q A;  2LD9 A;  3AE8 B;  2Z59 B;  1KTK A;  1P9D U;  3WIM A;  4A8X C;  1ZDX A;  3CST A;  2L3Z A;  1J0G A;  3NS1 A;  1J7A A;  1UF0 A;  3JSV B;  4F7Z A;  2KDM A;  1ZKH A;  5G2N A;  3X23 A;  1FEH A;  2BBC A;  2AL3 A;  5BO4 B;  2N9L A;  1UGM A;  1E5W A;  1FNU A;  3RFZ B;  2GOW A;  2GB1 A;  3Q8E A;  4WJP A;  1IUE A;  2L05 A;  4FA6 A;  2V1Y A;  2G9H D;  1WF9 A;  1ZE3 D;  1XQQ A;  3SFD B;  1R4N I;  2L7R A;  3RNE C;  1OFF A;  2KTR A;  5MPO A;  2G45 B;  5H92 C;  4BKS D;  1A70 A;  2WXG A;  5I4D A;  4ICV A;  2KQ7 A;  4FXC A;  2WXP A;  1SE9 A;  4AUQ C;  4KZ0 A;  1IBX B;  1SE3 A;  2FBW B;  2O2V B;  4RGT A;  2W82 A;  3I57 A;  5BYS A;  5CHV C;  4DHJ D;  5CHF A;  2J42 A;  2MBO A;  4IWO A;  2LGY A;  2AWT A;  4IDI A;  3RNB C;  4W9D A;  4MEM A;  2JZ3 B;  3ZKJ C;  1WXM A;  3AU4 A;  3W1S A;  4G3X B;  1DGJ A;  2DZM A;  4NAW A;  3V3X A;  4LDT D;  4HWI B;  2W3R A;  3I5J C;  1GC7 A;  3RT3 B;  2ASQ A;  3PRZ A;  2FAZ A; 
#chains in the Genus database with same CATH homology
 1RRB A;  3TIX A;  1JRU A;  4AWJ A;  2K6D B;  2DAF A;  3WAO A;  2O6V B;  3HK0 A;  1NDD A;  3SU8 X;  4DHJ B;  2KWV B;  1K8R B;  3VTV A;  1WY8 A;  3IBE A;  2MBB B;  3N30 A;  4GOC A;  2ZNV B;  3Q3F A;  1YX6 B;  3H6N A;  3SD5 A;  5L83 A;  4FJZ A;  4P7I A;  2KWU B;  4CO7 A;  3VQI A;  4K81 A;  2FCM A;  3QCA A;  2KQS A;  3JVZ X;  3PTF C;  2JWZ A;  3PSE B;  4LDT B;  3IVF A;  5J2R A;  2ZVO A;  3OLM D;  3C0R B;  3LDZ E;  2EKE C;  1WJU A;  4FHJ A;  4W9G A;  5CTR C;  2GBR A;  1P3Q U;  1GUA B;  4GDL A;  3UIP B;  3ZNI D;  2XEW A;  4FJV B;  1Y8R C;  2DYB A;  1LQB A;  3S2A A;  4GXB A;  2Z0D B;  1E8W A;  2YLM A;  4HDO A;  3X0W A;  4MGK E;  4ZDV A;  3HHM A;  3Q3J A;  2M1M A;  1VD2 A;  2AEH A;  3NHE B;  4MDK E;  3PZD A;  5CHW A;  2WX1 A;  3APC A;  3QJZ A;  4HK2 A;  2GBK A;  2G3Q B;  3EEC A;  1GNU A;  2DZI A;  3VH3 B;  2A4Z A;  5JH5 C;  3NOB A;  3A1Q A;  1SGH A;  1L2N A;  3RUI B;  4AJY B;  3L54 A;  2ZCB A;  2CR5 A;  2VRR B;  3L10 B;  3OJ3 A;  4G11 A;  5JZE B;  2KDI A;  2DAJ A;  1RAX A;  1V5O A;  4NJ7 A;  3V60 A;  4KVG B;  2K25 A;  4NNJ B;  3GZN I;  3WAP A;  2C7M B;  3ENE A;  1OEY A;  1UBQ A;  3ECI A;  3H1U A;  2ZPN A;  3PS6 A;  5AZH A;  1IP9 A;  2KLC A;  3RZW C;  1WXV A;  5AZG A;  2MQJ A;  5IAA C;  2J0M A;  2G4S A;  2KXJ A;  3O65 B;  1Q0W B;  2CKH B;  1RLF A;  5DPT A;  4RM8 A;  2K8C A;  1UEL A;  1UD7 A;  1Z2M A;  4ZRI A;  3A9K B;  1KLV A;  2YVC A;  4RM9 A;  2NPT A;  2ZJD A;  2BYE A;  1YD8 U;  1P0R A;  1WH3 A;  3W1S C;  3SDL C;  4CHK A;  2RPQ A;  2LRW A;  3OJ4 B;  3ZRC A;  3RYT A;  2D3G A;  1WX9 A;  4FUL A;  3OAW A;  3DVG Y;  1E90 A;  3ONS A;  2R2Q A;  2XBB C;  1SIF A;  1WYW B;  2KTF A;  2D11 A;  1I42 A;  1WM2 A;  4MM3 A;  4ZRK A;  4FBJ B;  1WJ6 A;  3VH4 B;  4YL8 A;  1GC6 A;  1WJN A;  1WI0 A;  2FCQ A;  4WJQ A;  1WZ0 A;  4MEL A;  5JHB A;  2KFK A;  2ZEQ A;  1J8C A;  3JYU A;  1WRD B;  4A3O A;  2FID A;  4FJY A;  2AL6 A;  3ZRF A;  3WAL A;  2KTR B;  3KYC D;  3V61 A;  4CYE A;  2N1W A;  4HDQ A;  1H4R A;  4WWP A;  3VTU A;  3WA0 A;  1P98 A;  2LXC A;  3AUL A;  4E74 A;  4IW0 A;  1V6E A;  4W9H A;  2KKC A;  3QIJ A;  2HJ8 A;  2DX5 B;  5G55 A;  3EC8 A;  2IO3 B;  4B95 A;  2MP2 A;  2MA9 B;  3ZNZ B;  1OQY A;  1UBI A;  1V2Y A;  3V6C B;  3I3T B;  2A5U A;  2N7E A;  4XZ4 A;  2KX3 A;  4XC2 A;  4ZRJ A;  2JRH A;  4II3 B;  3CMM B;  2G4D B;  2MBE A;  4BKG A;  5E6O A;  1GG3 A;  2FIF A;  2JY6 A;  3AI5 A;  4W9C A;  4NPN A;  2KDF B;  3VVW B;  3ZNH B;  1NI2 A;  2KNB A;  2LRU A;  4KZC A;  3NZU A;  2MX2 A;  2EMT A;  3BIN A;  4B9K A;  2HD5 B;  2M4N A;  4MSM B;  2N7D A;  4EKU A;  4NAW B;  3H7P B;  5DPR A;  1WE6 A;  2DZK A;  2KX0 A;  2OJR A;  4IM2 A;  1G6J A;  5DCN A;  2RD0 A;  4I6L B;  3UF8 A;  4DDG D;  2BKF A;  5KHO A;  2ZCC A;  3VAW A;  3PT2 B;  4HCP B;  4W9E A;  3VUX A;  4PYZ A;  2NBW B;  2IY0 B;  3DBR I;  3ZNG C;  2D07 B;  3IG3 A;  2CHW A;  2DYM A;  3DBS A;  4W9J A;  2BF8 B;  2N1V A;  2L8J A;  4WWN A;  5DPW A;  2WDT B;  2WYQ A;  4EZL A;  2JRI B;  1LM8 B;  2JT4 B;  2LZ6 A;  2BPS A;  3ML8 A;  3A33 B;  3PLV A;  1V86 A;  4BBN C;  4EZK A;  3B08 A;  4G50 A;  1OEY J;  2LUE A;  2N9P C;  4ANX A;  3PHW B;  3T9L A;  1YQB A;  3PRP B;  2GMI C;  4M8M A;  4AP4 C;  2BGF A;  4GB9 A;  3PV1 A;  5J17 A;  4GDL B;  3LJ3 A;  4FLH A;  3VUY A;  4JQW C;  1QZE A;  3HM3 A;  3TBL D;  2MWS B;  4ANU A;  4LCD E;  1WGH A;  5D2M B;  3VUW A;  1WX7 A;  1U4A A;  1V5T A;  2NBV B;  4BOZ B;  4GN1 A;  4IUM B;  5JHA A;  1F9J A;  2K1F A;  3TMP B;  1XD3 B;  2FCN A;  3ZTD A;  1Q5W B;  2PEA A;  4EUT A;  2MSE D;  4MGY E;  1WMH A;  1R4M I;  3KUD B;  4HVB A;  2NS5 A;  1WGR A;  3L16 A;  4KSK C;  2KOX A;  2M17 A;  2V3S A;  4ZYN A;  4E71 A;  3VFK A;  3A1Q B;  2CU1 A;  4HJK A;  2BWE S;  2KJR A;  2LGD A;  4RMA A;  4BKT A;  4JIO U;  4DHZ B;  3W1Y A;  1EF5 A;  3UQB A;  2DZJ A;  5DPS A;  3MHS D;  1T0Y A;  2IBI B;  1IPG A;  2XK5 A;  3V6E B;  2ZZP B;  3H9D A;  3JSV A;  2OOB B;  3QAQ A;  4GMV A;  4II2 B;  5C23 A;  3RZF A;  3ZIM A;  4BVU C;  2L76 A;  2IO2 B;  2KZR A;  2KC1 A;  2D10 A;  3R3M A;  1EO6 A;  2NR2 A;  2GBM A;  1E8X A;  1E8Z A;  2K39 A;  3A9J B;  4EEW A;  2KHW B;  5J18 A;  2UWQ A;  3PLU A;  4BFR A;  3KW5 B;  4FHK A;  2L0F A;  2KAN A;  2PE6 B;  3AXC A;  1WGG A;  5EDS A;  4JLC A;  1UH6 A;  3QX1 A;  4HLE A;  2K8B A;  3U30 A;  1YX5 B;  1V80 A;  1WGD A;  4W9L A;  3NY5 A;  5GMV A;  4WJN A;  1V49 A;  1EUV B;  2KMC A;  4AJW A;  2I1K A;  3DPD A;  1S1Q B;  2IYD B;  1TZ1 A;  2KDB A;  2NPT B;  3KUC B;  4HCN B;  3V62 A;  4HPM B;  2KLG A;  3M3J A;  4WWO A;  3N3K B;  3PRM B;  2C60 A;  5CX3 A;  3ALB A;  3KVF B;  4IM0 A;  3ZUN A;  2K6Q A;  2MBH A;  4EOY A;  5AZF A;  2CS4 A;  3KH0 A;  4PS3 A;  1A5R A;  3QWZ B;  4IWQ A;  2PE9 A;  4TQ0 A;  2HTH A;  2KK8 A;  2IO0 B;  1E8Y A;  2MCN B;  1WM3 A;  1BT0 A;  4I6P A;  1WXS A;  4W9I A;  5D94 A;  2JUO A;  2N9X A;  1KM7 A;  2ZVN A;  1ZGU B;  2FCS A;  4MJS A;  3VXW A;  2MW5 A;  4TKN A;  2BKR B;  4PYU A;  4WJO A;  4IC7 B;  2DEN B;  2L00 B;  3ZTC A;  2BWF A;  2KD0 A;  2KMA A;  3DBH I;  4LJO B;  1TTN A;  1J19 A;  1TBE A;  3EHV A;  5FR6 A;  2O2V A;  3NS8 A;  1UZX B;  3R7R A;  3ZDM C;  1WZ3 A;  5D7G A;  5L95 C;  1H8C A;  2J0K A;  3L13 A;  3QK0 A;  3DVN U;  1WIA A;  2C9W B;  4BKS A;  3QHT A;  2KC2 A;  4MGZ E;  2LWP A;  1M94 A;  2MP2 B;  3ZVV A;  3VTW A;  1OGW A;  3L17 A;  2KN5 A;  2K8H A;  3DVN V;  1V81 A;  4LJP B;  3ZO5 B;  5HKH A;  1LFD A;  3QA8 A;  4KIK A;  4W9F A;  4DDI D;  3CSF A;  4KDL B;  4IM3 A;  3ZW3 A;  3N32 A;  4BOS C;  2MRP A;  4GDK A;  2JXX A;  3TCA A;  4JGH B;  4HPL B;  2JPH A;  2PJH A;  2REX A;  5IA7 A;  1L7Y A;  2O6V A;  3DVG X;  1E7V A;  2MBQ A;  2DHZ A;  4K7S A;  3A4S C;  1IYF A;  1AAR A;  2KFJ A;  4GIV A;  1KJT A;  3QQ8 B;  4ICU A;  4K1R B;  1WXA A;  4NY0 A;  3SHQ A;  3T8M A;  2IO1 B;  2L0T A;  2C7H A;  2NVU I;  3L08 A;  3M63 B;  4GU2 A;  2DYO A;  1WR1 A;  2NCN A;  1WE7 A;  3R66 C;  4NQL B;  4URK A;  4FAD A;  2PPH A;  3DBL I;  2RGF A;  2R2O A;  4DHZ E;  1VCB A;  2KWC A;  2NBU A;  1WX8 A;  2KO3 A;  2LXA A;  3DDC B;  3EFU A;  3JW0 X;  4EFO A;  1OTR B;  3QAR A;  3U7D A;  4I6N B;  2EMS A;  3VDZ A;  5LLI A;  1CMX B;  2C5L C;  2LJ5 A;  1WJ4 A;  2ZPY A;  3U8Z A;  3MJW A;  3QC8 B;  2B3A A;  1S3S G;  4A20 A;  3B1L X;  2FNJ B;  4DWF A;  3RCZ A;  4PS7 A;  4OVU A;  3UQA A;  1NBF C;  3UGB B;  3PHX B;  4W9K A;  4GSW A;  4NQK E;  2RSU A;  2CHX A;  3R7Q A;  3L0W B;  3B0A A;  4G0N B;  1PQS A;  4M8N A;  4X57 B;  1HE8 A;  4ANV A;  1GJZ A;  3ML9 A;  3P2B A;  4N9F 4;  3HM6 X;  4IWP A;  1WMH B;  4TQ1 A;  1KOT A;  2LVO A;  1MG8 A;  1X1M A;  4F8C B;  1ISN A;  2QHO A;  3NZS A;  4MGI E;  2D2Q A;  2LD9 A;  1WR6 E;  2IZV B;  2IY1 B;  2CHZ A;  2Z59 B;  3CF6 E;  1P9D U;  2MLB A;  3PPA A;  4K7W A;  4XX5 A;  3TL5 A;  1E7U A;  3APD A;  1RFA A;  3WIM A;  2RR9 A;  2J7Q B;  2C7N B;  3CST A;  1V9J A;  2L3Z A;  1J0G A;  1YJ1 A;  1WFY A;  2XK5 B;  1TGZ B;  1P1A A;  3JSV B;  3MTN B;  4F7Z A;  2KVR A;  1C3T A;  1FXT B;  3D32 A;  2N4F A;  2KDE B;  1C1Y B;  2Z0E B;  5TR5 A;  3K9P B;  2V4L A;  1ZKH A;  3A9J A;  5G2N A;  3A9K A;  3X23 A;  2AL3 A;  5BO4 B;  5LXH A;  2LVQ A;  2LAS A;  1UGM A;  4DK5 A;  1E5W A;  2UYZ B;  3DCG A;  4IG7 B;  2GOW A;  2GBN A;  4M0W B;  2JVC A;  2BYF A;  1I35 A;  3IHP C;  4WJP A;  4DXA B;  4EZJ A;  2L05 A;  3PGE A;  4PS8 A;  5D6J B;  4A3P A;  4FA6 A;  2JF5 A;  2V1Y A;  3KUZ A;  1Q1O A;  1WF9 A;  4KDI C;  4OVV A;  3TJP A;  2J0J A;  4F1S A;  2ZNV C;  2HE7 A;  2LI5 A;  1XQQ A;  1R4N I;  2L7R A;  3DQV A;  2KFK B;  4BBN F;  1WGY A;  5LXI B;  2I1J A;  2M0X A;  1D3Z A;  4KSL C;  2KTR A;  3BY4 B;  3WAN A;  2G45 B;  4GGQ A;  5E6P A;  3AU5 A;  3GOE A;  5AEK B;  4TUU A;  4NJ6 A;  4ASW C;  4BKS D;  2M8S A;  5E6N A;  1XT9 B;  3UIN B;  3IFW B;  3RD2 A;  3ZDT A;  1YIW A;  2N9E B;  4ICV A;  2BYV E;  2W9N A;  2KQ7 A;  4MJS B;  1LXD A;  3PVL A;  4E3C A;  2WWZ A;  4AOF A;  3A4R A;  1SE9 A;  3WAM A;  4AUQ C;  4KZ0 A;  3APF A;  3M62 B;  4ANW A;  2O2V B;  4KV2 A;  4MH0 E;  2KJH B;  3M95 A;  2WX0 A;  4DBG A;  4K7U A;  2Y5B B;  2LGX A;  4B6W A;  1ZW7 A;  3PRE A;  5KHQ A;  2O6V D;  4WAA A;  3VHT C;  4HXD A;  2AYO B;  5CHV C;  4DHJ D;  5CHF A;  2MBO A;  4IWO A;  2LGY A;  3HIZ A;  2KJ6 A;  2AWT A;  3H7S A;  4W9D A;  3UIO B;  3ZLZ A;  1Z5S B;  4MEM A;  3RUL A;  2JZ3 B;  3ZKJ C;  1WXM A;  2JZZ A;  3AU4 A;  1EF1 A;  4G3X B;  3W1S A;  2DZM A;  4KIK B;  4NAW A;  3H7P A;  2GBJ A;  3KYD D;  4FN2 A;  4J6I A;  5C1Z A;  4LDT D;  3DOW A;  4HWI B;  4JL9 A;  4WQO B;  2FUH B;  4MSQ B;  1GC7 A;  4TV3 A;  3RT3 B;  2ASQ A;  3PRZ A;  3K9O B;  4GDK B;  2FAZ A;  2LVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...