2KDBA

Solution structure of human ubiquitin-like domain of herpud2_9_85, northeast structural genomics consortium (nesg) target ht53a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
PVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Homocysteine-responsive endoplasmic reticulum-resident ubiqu
publication title Structure of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2 (Herpud2 or Herp)
rcsb
source organism Homo sapiens
total genus 14
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kdbA00
2NPTA 2BWFA 2JUOA 4OVUA 2JVCA 2WX0A 1L2NA 2KLGA 2M0XA 3JYUA 4N9F4 2KDEB 4FULA 3M63B 5LXIB 2KDFB 4IM0A 3ZNZB 2LD9A 4G11A 5CHVC 2RR9A 2K6DB 2DENB 1P0RA 4NJ7A 4W9EA 3L10B 3R7QA 2KOXA 3KVFB 4KDLB 4KIKB 2OOBB 3ML8A 4TQ1A 3ZRFA 3RD2A 5D2MB 3V61A 1WXAA 2MBOA 4B95A 2A4ZA 1F9JA 2MBQA 2R2OA 1E7VA 3L13A 3PGEA 2L8JA 4HK2A 4AWJA 2IZVB 4HWIB 4CHKA 2FCMA 1WY8A 1WM2A 2ZEQA 2WDTB 3QQ8B 2O6VD 1EF1A 2ZCBA 3A33B 3TIXA 1E90A 1V49A 4DXAB 2M8SA 2EMSA 4TKNA 4II3B 4DHZE 3X0WA 2KANA 3Q3JA 2MBEA 3PZDA 4WJNA 2KX3A 2WWZA 2AL6A 5GMVA 3R66C 4MH0E 3APDA 2IO0B 4ZYNA 1L7YA 2J7QB 3VH4B 4BFRA 1S1QB 3JSVA 1XD3B 1E5WA 4HCPB 2G4SA 3W1SA 4HPLB 2LRWA 2L05A 2N4FA 1R4NI 4EZLA 2XK5B 3NZSA 3TL5A 1KLVA 3BY4B 3QJZA 5JZEB 1YX6B 3A9JA 1WR1A 3IHPC 5IAAC 3DVGY 3W1SC 4F1SA 2C9WB 2KMAA 3QARA 2IBIB 1RRBA 2DYMA 3X23A 1NDDA 2I1KA 3CF6E 2Z59B 4MSQB 3PRPB 2K8CA 4I6PA 4MGZE 4RM8A 3EECA 5JH5C 2MLBA 2FCQA 2MSED 4M0WB 5LXHA 2CHWA 1WJNA 2C7NB 2MQJA 2LGXA 2M17A 4WAAA 4KZ0A 3DVGX 1P3QU 1YIWA 1ISNA 4MDKE 4BKSD 2BWES 2KDIA 4WWOA 4GOCA 2BYFA 3ONSA 1H8CA 4P7IA 3BINA 3UIOB 5CHFA 3ZUNA 2B3AA 3ECIA 3V6EB 2WX1A 3WALA 2CHZA 4WWNA 3A4SC 2BKFA 3SU8X 1YD8U 2KJRA 4K1RB 2KMCA 3L17A 3PLVA 3NS8A 4W9JA 2Z0DB 2MCNB 3LJ3A 4K81A 4WJOA 1WXMA 3NOBA 3PSEB 4GB9A 2N1WA 3N3KB 3S2AA 2CS4A 4A20A 2MP2A 2ZZPB 1VCBA 2MX2A 3A4RA 4NAWA 4CO7A 5DPWA 1WJ4A 3LDZE 2DYBA 1WFYA 2MWSB 4RM9A 4IM2A 3ZDTA 3NZUA 4K7UA 1V86A 1WYWB 3VVWB 1V5TA 3SHQA 3WAPA 3VH3B 2JF5A 4DHJD 2AWTA 2MA9B 2HTHA 2KTFA 3K9PB 2ZVOA 4LDTD 2DHZA 3PHWB 2FCNA 4BKSA 2V4LA 1XT9B 4GMVA 2L76A 3UIPB 3V6CB 1IP9A 3ALBA 2LGDA 5D6JB 4TUUA 2KQ7A 5L83A 3V60A 2MW5A 3T9LA 2K39A 2NVUI 3N30A 4E71A 2LASA 4AUQC 1WF9A 4HPMB 2DZIA 4JQWC 3AXCA 2NR2A 3RUIB 4YL8A 1PQSA 2KC2A 2W9NA 3PPAA 4MELA 1I42A 2GBNA 5DPRA 3VTVA 3SDLC 2CU1A 3H7PB 2JZZA 4W9KA 3ZVVA 5C1ZA 1WX8A 4NNJB 4NQLB 2O2VA 3VTWA 2ZNVC 2GBMA 2L7RA 3O65B 4W9CA 4AP4C 4GDKB 3RYTA 3A9KA 3ZNGC 4B6WA 2K6QA 2JZ3B 4FADA 3U7DA 2RSUA 4EZJA 1WGGA 2CHXA 1P1AA 1ZW7A 4EKUA 4XC2A 1WX7A 4W9LA 2LXCA 3B1LX 1UD7A 4GU2A 4FHKA 4MJSA 3UQAA 2BPSA 2D07B 2D3GA 1LXDA 2Y5BB 2NS5A 4BBNC 2LVQA 2R2QA 4W9HA 2CKHB 2FIFA 4KZCA 1A5RA 1V9JA 4BBNF 2KKCA 2N9EB 3KH0A 4M8MA 1FXTB 2GBRA 1V80A 2N9XA 2I1JA 1UZXB 1WMHA 2M4NA 3APCA 3DVNV 3IG3A 4EEWA 1Q0WB 4G50A 3WA0A 4GDLA 5G2NA 2NBUA 2JT4B 2LZ6A 2RD0A 1OGWA 3PHXB 4FN2A 1T0YA 3PT2B 1LFDA 2KNBA 3VHTC 1J0GA 2YLMA 1J19A 4GN1A 2LRUA 3OJ3A 3TJPA 4G0NB 2LVPA 4KSKC 4F8CB 2AL3A 3W1YA 3V62A 4A3OA 2NPTB 4X57B 3CSFA 2ZPNA 4GSWA 3DBLI 3B08A 4LJOB 1GNUA 2BKRB 2KFJA 2N7EA 2REXA 2JRIB 2JWZA 1YJ1A 3QC8B 5EDSA 1WIAA 3CMMB 4IUMB 5KHQA 2EMTA 1IYFA 3I3TB 1Z5SB 4XX5A 3H9DA 1TZ1A 4EOYA 1UH6A 1TBEA 4I6NB 2G45B 3KYDD 1TTNA 3UQBA 2G3QB 2GMIC 1GC6A 2O2VB 3IFWB 1Y8RC 2DZMA 3KUDB 2V1YA 2C7HA 3QX1A 3AI5A 5JHAA 3TBLD 1S3SG 4KV2A 2O6VA 2YVCA 4GXBA 3UINB 2KFKA 2LUEA 2RGFA 3KYCD 3MTNB 2KX0A 2KK8A 2C5LC 4ZRJA 2ZCCA 3U30A 4BOZB 1EF5A 5DPTA 2ZJDA 3PRZA 3RT3B 3RZFA 3HIZA 3ZTDA 5E6PA 3TMPB 3MJWA 2LJ5A 2ZVNA 1WRDB 4KDIC 2PJHA 4WJQA 1WGRA 1GJZA 1ZKHA 3DVNU 5L95C 2KQSA 4OVVA 2OJRA 4GIVA 4LDTB 2KHWB 3PRMB 2ZPYA 1TGZB 2IY1B 3ZTCA 4LJPB 1UGMA 1VD2A 5D94A 1SGHA 2KZRA 2IO2B 3SD5A 5IA7A 3UF8A 4ANXA 1Q1OA 1K8RB 1V2YA 2Z0EB 3JSVB 4PS3A 4GDLB 5FR6A 1M94A 4IWOA 1JRUA 5DPSA 3VQIA 2N9PC 1G6JA 1HE8A 2DZJA 2MRPA 4JGHB 2DYOA 2DZKA 2HE7A 2LI5A 2FAZA 1R4MI 4XZ4A 4MM3A 3ZO5B 2K8BA 3R7RA 1RLFA 3DQVA 3GZNI 2IY0B 1AARA 2KTRA 2MBHA 3N32A 3A9JB 4FA6A 1GUAB 3L54A 4MGIE 2QHOA 2NBVB 4WJPA 1UBQA 3MHSD 2FUHB 4FJYA 1YX5B 4IM3A 1SE9A 4IW0A 3ZIMA 4HDQA 5AZFA 4BKGA 4KIKA 1OEYJ 2M1MA 1WXVA 1NI2A 1UELA 3VTUA 4WQOB 4IWPA 5J18A 1CMXB 5AEKB 2KWCA 4HCNB 2BF8B 4NPNA 1WGYA 1MG8A 5BO4B 3Q3FA 3VAWA 1GC7A 3C0RB 3P2BA 3RULA 4DDGD 3VDZA 4JL9A 4NY0A 2O6VB 1EO6A 2D11A 3JVZX 1LM8B 2UYZB 3JW0X 4BVUC 2G4DB 4ANWA 4ZDVA 3PS6A 2PE9A 2C7MB 4W9GA 4ANUA 2BYEA 2NCNA 2MBBB 4AJWA 2BYVE 5CX3A 4JIOU 3EHVA 3M3JA 3HM6X 3B0AA 3APFA 3L08A 4ICUA 2FNJB 3H7SA 3DCGA 3QHTA 1EUVB 3PREA 1WM3A 2J0JA 4FJZA 5CHWA 4B9KA 2KWVB 2DAJA 1WE7A 2XK5A 4HXDA 2L0FA 4J6IA 3PV1A 1Q5WB 2KXJA 3DPDA 2KDBA 1V81A 2HJ8A 2MP2B 3QWZB 3VXWA 3WIMA 4NAWB 3M62B 3M95A 3IBEA 4FJVB 1J8CA 3A1QA 3AU5A 3HHMA 2KWUB 2KTRB 4FHJA 4W9DA 4IC7B 2C60A 2IYDB 1WGHA 5E6NA 2LVOA 2GBJA 2BGFA 5E6OA 1SIFA 2GBKA 2N7DA 4PYZA 5KHOA 4II2B 3WAOA 2K1FA 1WZ3A 2KO3A 1WJ6A 1U4AA 3ZW3A 5C23A 4FBJB 2AEHA 2GOWA 3OLMD 1BT0A 4BKTA 2PPHA 3VUYA 1XQQA 1WI0A 3KUZA 3ML9A 3DDCB 3DBSA 1C1YB 1P9DU 1NBFC 2AYOB 1E8YA 1V6EA 3QCAA 5HKHA 3H1UA 3L16A 3ZLZA 2KN5A 2KVRA 2FIDA 2D10A 2IO3B 1YQBA 2ZNVB 2LXAA 2PEAA 1E8WA 4KSLC 1E8ZA 3U8ZA 4HLEA 4DHZB 3QAQA 4MSMB 2FCSA 2XEWA 3RCZA 4AJYB 3QIJA 3EC8A 4TQ0A 2ASQA 4HDOA 4K7SA 5JHBA 1WX9A 3NY5A 3HM3A 4K7WA 1WGDA 3HK0A 2L3ZA 5DCNA 3A9KB 1I35A 2JRHA 4A3PA 4G3XB 1RFAA 3PVLA 2LGYA 4DK5A 4EZKA 2J0KA 2J0MA 4E74A 1KOTA 1E7UA 4E3CA 1UBIA 4M8NA 2XBBC 3A1QB 1H4RA 4MJSB 3EFUA 2KJHB 4BOSC 1WZ0A 3DBRI 1KJTA 4DHJB 3OJ4B 2D2QA 4GGQA 4PS7A 2PE6B 5J2RA 2N1VA 3ZRCA 3WANA 5AZHA 1WMHB 1WXSA 2DX5B 4EFOA 1GG3A 4IG7B 1C3TA 2L00B 1WH3A 2EKEC 4I6LB 4NJ6A 3AULA 4ICVA 3VFKA 2JXXA 2LWPA 4MGYE 4DDID 3IVFA 5TR5A 2CR5A 3KUCB 3R3MA 3ENEA 4CYEA 5D7GA 3L0WB 4MEMA 5G55A 3H7PA 4W9FA 4NQKE 4URKA 1QZEA 2KC1A 4ASWC 2JPHA 4W9IA 3H6NA 2KD0A 2KJ6A 1LQBA 4PS8A 2KLCA 3UGBB 1KM7A 4GDKA 4DBGA 1OQYA 3K9OB 3KW5B 3PTFC 4WWPA 3T8MA 2RPQA 2VRRB 1D3ZA 1P98A 3ZNID 4FLHA 1WE6A 3CSTA 5CTRC 5AZGA 2L0TA 1Z2MA 4ZRKA 3TCAA 2KFKB 3AU4A 2V3SA 2K8HA 2HD5B 3DBHI 3QA8A 1OTRB 4RMAA 1ZGUB 2WYQA 3PLUA 4HJKA 4TV3A 4DWFA 2IO1B 2NBWB 5J17A 4PYUA 1WJUA 2JY6A 4KVGB 4LCDE 4AOFA 3RZWC 3VUXA 3GOEA 4JLCA 3ZNHB 3QK0A 2DAFA 1OEYA 3D32A 3VUWA 3OAWA 2A5UA 3ZKJC 1V5OA 1E8XA 4EUTA 4ANVA 4F7ZA 3NHEB 4HVBA 4ZRIA 3DOWA 4MGKE 2UWQA 3ZDMC 3WAMA 2K25A 4IWQA 1RAXA 1WR6E 1X1MA 1IPGA 5LLIA
chains in the Genus database with same CATH superfamily
2NPTA 3MC9A 3P42A 4N9F4 3UI3A 2WXRA 4IM0A 4G11A 2DENB 3L10B 1FFVA 1ZXHA 1N5XA 4KIKB 3V61A 4B95A 1ZDVA 2A4ZA 1F9JA 1E7VA 3L13A 4AWJA 4CHKA 5IOIA 4FXCA 1WY8A 1WM2A 1D4BA 3V05A 2M8SA 4TKNA 3R66C 4MH0E 3Q3MC 3VH4B 4P1BC 2BTEA 1MJDA 3DWMA 2R61A 4HPLB 4EZLA 2JQRB 1KLVA 1XEEA 3BY4B 4A55A 3W1SC 1WR1A 4F1SA 3Q8EA 2KMAA 2DYMA 1K53A 3FKYA 2K8CA 3B9JA 4MGZE 5JH5C 4A8XC 4M0WB 1WJNA 2C7NB 4AS1A 1DGJA 4BAXA 1ISNA 1ROEA 1SE3A 1SSNA 3AE6B 3U7ZA 4P7IA 3UIOB 3ZUNA 2MEKA 2QC8A 4D2KA 2WX1A 4NZLB 1YMHE 3SU8X 2BKFA 2KMCA 3PLVA 2Z0DB 2MCNB 1N63A 3RN9C 3PSEB 3ZXVA 3I5JC 3N3KB 3S2AA 2ZZPB 5DPWA 3MFGA 3ZDTA 1WYWB 1D5XC 1EWCA 3VH3B 2JF5A 4ZYSA 2HTHA 2ZVOA 3PHWB 4BKSA 2W3RA 4YTNB 3UIPB 3V6CB 4XWTA 5D6JB 1C78A 3V60A 2K39A 3N30A 2H89B 4AUQC 4C4VB 1L6VA 3RUIB 2KC2A 3WCQA 3P4SB 4ARCA 3AE3B 2JZZA 1WRIA 3W5UB 1WX8A 2O2VA 2GBMA 3RNEC 1AW7A 2JZ3B 4FADA 2RSUA 1WGGA 1WX7A 4W9LA 2KAJA 3AE9B 2LXCA 1UD7A 4GU2A 4MJSA 1SF0A 2D07B 2D3GA 1LXDA 2CKHB 4KZCA 3NVWA 1KF6B 4M8MA 2N9XA 1WMHA 3IG3A 3WA0A 5G2NA 1T0YA 1LFDA 5BMIA 1J19A 4N58A 3TJPA 4G0NB 4KSKC 3VR9B 2AL3A 4A3OA 1FRRA 3B08A 1GNUA 1NEKB 2KFJA 2JWZA 1WIAA 3CMMB 5KHQA 2EMTA 1IYFA 4B0MA 4LK0M 4S0RA 2WGSA 3URYA 4EOYA 4I6NB 1TTNA 3AE8B 2O2VB 3QX1A 3KUDB 2C7HA 3AI5A 1E9MA 2NTSA 1S3SG 3TSSA 2YVCA 3UINB 3KYCD 2D3BA 4BZAA 1EF5A 1RWSA 4N6EB 3Q8AA 2LJ5A 1N60A 4XDCA 1TYGB 5FKAC 5L95C 2OJRA 3B2FA 3PRMB 2ZPYA 1FNVA 3ZTCA 1F0ZA 1SGHA 2NMQA 4ANXA 2AQ1B 4PS3A 1K8RB 2Z0EB 3JSVB 4N59A 3VQIA 4XWWA 1M94A 5DPSA 4JGHB 2HE7A 2FAZA 2WLBA 2QSDA 2WXKA 4YT0B 4HRSA 3N32A 1SB3C 3A9JB 3L54A 1UBQA 1FPYA 1SJED 4IW0A 3ZIMA 4BKGA 4K3CA 1R7SA 1UELA 3VTUA 4P6VF 1FO4A 1CMXB 3DHIC 1OFFA 1J7AA 4ZHPA 3BZDB 1C76A 3LYYA 3VDZA 2I2YA 3JVZX 2UYZB 2G4DB 3PS6A 2MBBB 1BMLC 1DOXA 3M3JA 3HM6X 4PT5A 5MPOA 4ICUA 2FNJB 5HHDG 1T6BX 2DAJA 2WXOA 1HXYD 5BYRA 2KXJA 2IPKD 2KDBA 4A9AA 4NAWB 3M62B 2AQ3B 1J8CA 3HHMA 3NZ3A 4NAMA 5E6NA 3J9CA 1JWUD 2BGFA 4RGMA 1NENB 1SIFA 2N7DA 1GAQB 3ZW3A 4IOIE 2PPHA 1WI0A 1N61A 1NBFC 2LMCA 2MH7A 4WH4A 1FFUA 3H1UA 3ZLZA 1EU4A 5JXVA 4WAFA 2LXAA 4HLEA 3ABVB 3RCZA 2FCSA 2XEWA 1D6EC 1WXQA 2ASQA 4LTUA 3N1YC 2L3ZA 4C7ZA 1FD6A 3BWUD 1ZOYB 4M02A 2BB6A 2V3NA 1UBIA 1ZXIA 4M8NA 1H4RA 2KJHB 3I57A 3ZQ4A 3VRAB 1JWBD 1KJTA 1STEA 3OJ4B 4WURA 1VLBA 5AZHA 4DQOC 2QCZA 2Y5CA 2DX5B 1GG3A 3DBLB 3Q2AC 2L00B 1FXAA 4I6LB 3AULA 1SE2A 3CIRB 2JXXA 4DDID 3IVFA 2CR5A 3R3MA 1QT9A 4JWSC 3C8YA 2INNE 3H7PA 3MC0B 4W9FA 4NQKE 2KC1A 4ASWC 1UNSA 4W9IA 3H6NA 2UU7A 2LHDA 1KH0A 4PS8A 3PTFC 5D3DA 3W9CB 1P98A 3CSTA 1IUEA 2L52A 3TCAA 1LO5D 1DYQA 3AU4A 1T3QA 5AUIA 5FR3A 4TV3A 2JY6A 1MI0A 3ZJTA 2DAFA 3VUWA 2A5UA 3U2SC 4EUTA 1RYJA 2KYWA 4MGKE 1IPGA 5LLIA 1GB1A 1XCQL 2BWFA 2JUOA 1L2NA 2PMVA 1I4XA 2KLGA 5C3JB 4FULA 3M63B 4MM3B 5LXIB 2KDFB 1E7PB 2LD9A 2K6DB 2BW2A 4W9EA 1WYGA 1YQ3B 3R7QA 1HA5A 2KOXA 4KDLB 3ML8A 3ZRFA 4EEWA 2R2OA 4HK2A 2IZVB 4OZCA 3TUOA 1AN8A 3MJ5A 3A33B 4II3B 1T5XD 2KANA 4WJNA 3VRBB 2AL6A 2I38A 2MJEA 2IO0B 2J7QB 1EWYC 2K5PA 1S1QB 3W1SA 2G4SA 2LRWA 1YJIA 2KWDA 2XK5B 3IHPC 5IAAC 3QARA 5D3IB 4OW0A 3CF6E 1ET9A 1YNTE 1VR9A 2CHWA 1KFYB 1FRDA 4KZ0A 3AV8A 2BWES 2KDIA 4WWOA 4KGRA 3N9YC 5T8IA 3ONSA 3Q3NC 2JXTA 5CHFA 3NVZA 5I4DA 3ECIA 4YSXB 4LNIA 1PDXA 2CHZA 2Y5PA 1ESFA 3NS8A 2GI9A 3LJ3A 3T3OA 1WXMA 2WQYB 4GB9A 2N1WA 1PYWD 1I4GA 1DOIA 2CS4A 3ZYYX 3Q14C 1Q10A 2MX2A 3A4RA 2JYTA 2KDMA 3LDZE 4L1BA 5IKCM 1XF5L 2LUMA 2WS3B 1V5TA 4RCOA 1YOVB 4IKGA 2KTFA 1A70A 2DHZA 1XT9B 4GMVA 1XXGA 3ALBA 2LGDA 1KRHA 2KQ7A 2WXGA 2MW5A 1TKGA 1RFKA 1MVKA 3PPAA 1I42A 2GBNA 2G1EA 1JMLA 5DPRA 4W9KA 4HKQA 3KQ4A 3RNCC 1ZP0B 2HTME 4NNJB 3VTWA 2ZNVC 3O65B 4B6WA 2K6QA 4C80A 3U7DA 5BYQA 4EZJA 2CHXA 1ZW7A 3PZ7A 4EKUA 4YXDB 1UUPA 1V8CA 2RDHA 2Y5BB 2NS5A 3IT6B 1WWTA 4W9HA 2L83A 1P7EA 2MJ3A 1V9JA 2N9EB 3KH0A 2GBRA 1V80A 2I1JA 1UZXB 3DVNV 1Q0WB 2RD0A 3PT2B 2KNBA 1J0GA 1L4ZB 2BS2B 2YLMA 5LNK1 2N7JA 3OJ3A 2AQ2B 3R2IA 1QOAA 3FILA 2NPTB 4YSYB 2WXNA 3DBLI 4LJOB 3QC8B 2JRIB 3P63A 4IUMB 1Z5SB 4XX5A 3SFEB 1TBEA 1YN5A 2G45B 1EU3A 2GMIC 1Y8RC 3N1XC 2V1YA 2PW9A 3TBLD 2LUEA 2N9KA 2C5LC 3U30A 4BOZB 1PGBA 2G9HD 3RZFA 3ZTDA 3MJWA 2NTTA 1FEHA 1F2RC 1WRDB 2PJHA 4WJQA 2CJNA 2OJWA 5EE0A 1ZKHA 4DXFA 2PVOD 4GIVA 4LDTB 4NJCA 2IY1B 4LJPB 1SXTA 3TEYA 1VD2A 2KZRA 2WDQB 3AE2B 3UF8A 1V2YA 4KKJA 5FR6A 1JRUA 2TSSA 5IN7A 1HE8A 2DYOA 2DZKA 2LI5A 1R4MI 3AM9A 1RLFA 2MBHA 1AARA 2RMMA 3FILB 1GUAB 2ZW1A 3P4PB 4MGIE 2NBVB 4EE2A 3DHHC 2FUHB 4IM3A 4HDQA 5AZFA 1NI2A 3C19A 4WQOB 5AEKB 4NPNA 2RDGA 1NYRA 1PGAA 3TEZA 1GC7A 3P2BA 4DDGD 4JL9A 1EO6A 1XLQA 3AE4B 4C56C 4A6QA 4ANWA 1CJEA 4ANUA 2BYEA 2DWQA 2Y3AA 5CX3A 1N5WA 1VJKA 3APFA 3QHTA 3DCGA 5CHWA 1QOFA 4B9KA 1WE7A 2IGGA 4KKIA 1Q5WB 2HJ8A 3WIMA 2KT7A 3EGRA 4FJVB 3GE3C 3GP7A 2KWUB 1ACCA 3P4RB 1TS3A 2JX5A 2PVGC 1E6EB 2RDBC 4W9DA 1C4CA 1GPXA 2IYDB 2EELA 2LVOA 2GBKA 4PYZA 5KHOA 2SEBD 1U4AA 2AEHA 1BT0A 3VUYA 2LFIA 1QOGA 1T0QC 1XQQA 1ZPSA 3RFZB 3DDCB 2BS4B 2W55A 3QCAA 5HKHA 3VR8B 2KN5A 2KVRA 2D10A 2PEAA 1E8WA 4KSLC 2IGHA 4YWGG 4K3BA 3QAQA 1MHXA 1WGKA 2W82A 1WX9A 3NY5A 3HM3A 4K7WA 3HK0A 4L23A 1T0SC 1I35A 4A3PA 1RFAA 1B9RA 2E6XA 1K50A 4C00A 1KOTA 4EZKA 2J0KA 2WU5B 4MT5A 4MJSB 3EFUA 1MHHE 3DBRI 4GGQA 2PE6B 4QAYA 5J2RA 2E3TA 2W54A 3MP9A 3WANA 2PKOA 3SFDB 1WMHB 1WXSA 1E0ZA 3NRZA 1WH3A 3HRDD 4US9A 4S17A 3ENEA 3MC8A 3LB8C 4P16A 4OHJA 5E6JA 1CZPA 2BQQA 4Q2JA 5IO9A 3Q69A 2KJ6A 2KLCA 1KM7A 4GDKA 4DBGA 3NUHB 3K9OB 2RPQA 3AH7A 1VRAB 5CTRC 1B1ZA 5AZGA 2L0TA 2K8HA 3AMZA 1ZGUB 2WYQA 2V4IB 4HJKA 4DWFA 2IO1B 3I9V1 4JWUC 2V9HA 4PYUA 2LJIA 4AOFA 1OQRA 3RZWC 3GOEA 3ZNHB 3O13A 1E8XA 2JYEA 2L32A 4ANVA 2LEKA 4F7ZA 4HVBA 2QILA 3DOWA 2YEPF 2K25A 1RAXA 3BVMA 4RF1A 2JVCA 3BK1A 5CHVC 2RR9A 4NJ7A 3KVFB 2JWUA 2Q5WD 2OOBB 4TQ1A 4REZA 4XE0A 3RD2A 4LLGM 1WXAA 2L8JA 3TEWA 3RNGC 3GE8C 3QQ8B 1D5MC 2WDTB 2PTLA 2K0PA 1C77A 2QEJC 3TIXA 4DXAB 4ITKA 1V1PA 3BYYB 4RNAA 4DHZE 3Q3JA 2W3SA 2MBEA 3PZDA 1F1HA 2YEPB 2KX3A 5GMVA 3APDA 2GLSA 1L7YA 2WXPA 4BFRA 4HCPB 3IAS1 1C79A 2L05A 1R4NI 1PFDA 1JWAD 4KGSA 1OQQA 3PZ8A 3QJZA 5JZEB 4KX6B 1JCKB 1RRBA 5BMGA 1NDDA 2I1KA 1QLBB 4MSQB 4RM8A 2MSED 4US8A 1QOBA 2QDFA 5LXHA 2MQJA 2M17A 1FM0D 3DVGX 1YIWA 4BKSD 3V3XA 2BYFA 1H8CA 3BINA 4A90A 1FMAD 2B3AA 2BVCA 3RMKC 3V6EB 1YD8U 2OHFA 2X8XX 1L4DB 2LGSA 3HVZA 4ZHOA 2MP2A 3N1ZC 1VCBA 4CO7A 5FK9C 1WJ4A 4AQ7A 3AE1B 1VZ8A 2DYBA 1NI3A 4YTPB 3TEXA 1WFYA 4RGTA 2MWSB 4RM9A 3NZUA 1V86A 1YJJA 5EE9A 2QJLA 3VVWB 5IP4D 3WAPA 1SEBD 1L0YB 3EA6A 2AWTA 1TS2A 2ACZB 1MPEA 2FCNA 2V4LA 2V3PA 2L76A 1R4MB 1FXIA 1IP9A 3R8BA 4TUUA 2Z8LA 1D5ZC 2VZKB 3W5VB 2NVUI 4E71A 2DZIA 4JQWC 4WWMA 3AXCA 4YL8A 1PQSA 1UF0A 2W9NA 1WSPA 2WXLA 2CJOA 1PUTA 1AYFA 2CU1A 3H7PB 3ZVVA 1KTKA 4C7YA 2D3AA 5C1ZA 4NQLB 1TY0A 1HQRD 4W9CA 3RYTA 3A9KA 3LXFA 3ZNGC 2DNFA 1P1AA 4XGAB 4HPPA 2BPSA 1UWXA 2EKIA 4BBNC 2R2QA 1P7FA 2FIFA 3Q3OC 1FXTB 1TIFA 2M4NA 3APCA 3Q8FA 3IAM1 4G50A 4GDLA 2NBUA 2JT4B 1XLOA 3PHXB 3VHTC 1IGCA 2X38A 4F8CB 4P1CC 3W1YA 1QQRA 2ONQA 3CSFA 2ZPNA 4GSWA 1IBXA 2BKRB 4ACFA 2CU3A 4RH6A 3I3TB 5GXGB 1TZ1A 2VH1A 3KYDD 2WU2B 3UQBA 2JU6X 2XN9C 3U4EG 3Q6BA 2O6VA 1C9FA 4GXBA 1JQ4A 2KFKA 1J7CA 3MTNB 2RGFA 4ZRJA 1QF6A 2KX0A 2KK8A 2BBCA 3BVZA 4OZBA 3HIZA 5E6PA 2ZVNA 5AUKA 4KDIC 4RFBA 3ZXRA 1WGRA 1GJZA 3DVNU 4R3DA 1K52A 4LNFA 2IO2B 2INDC 3AN1A 3KLSX 2D5GA 2OEDA 3P4QB 4GDLB 1CK1A 2N9PC 2DZJA 2MRPA 2HJ1A 3Q8BA 5G5GA 3DBRB 2L1AA 2K8BA 1L6UA 3GZNI 3W2DA 2IY0B 2KTRA 1Y56A 2QHOA 4WJPA 1QKZA 4J3OD 1ZDXA 1NYQA 4KIKA 1OEYJ 2M1MA 3DWGC 4ZRPA 4XYCA 4IWPA 2KWCA 2BF8B 1WGYA 3HUIA 5TSSA 1MG8A 2AX5A 5BMHA 3VAWA 1EM7A 3C0RB 3RULA 3AE5B 4NY0A 2O6VB 2D11A 4BVUC 4RGNA 4ZDVA 4LNKA 2PE9A 2C7MB 2NCNA 4AJWA 4GLSC 1N62A 2BYVE 4JIOU 3EHVA 3H7SA 1HTQA 1EUVB 3PREA 4FJZA 3NVYA 3B2GA 2KWVB 5HG2A 3T3NA 1MG4A 4HXDA 2WXFA 3PV1A 1GOZA 3VXWA 1XO3A 3EUB2 5EE3A 3IBEA 3OWEB 4ZRQA 1TKEA 3AU5A 2WDRB 2KTRB 3ZJVA 4M0WA 1SE4A 4FHJA 4IC7B 4XDDA 2J53A 5EE1A 2B76B 5E6OA 1V97A 1VDVA 2JZPA 1PGXA 3RI7C 1L0VB 2V0GA 1WZ3A 1WJ6A 1FNUA 2VZKD 1LGRA 2GOWA 1UWMA 3ML9A 3DBSA 1P9DU 2AYOB 2H88B 3L16A 3SR6A 4JPSA 1JWMD 1V1OA 2INCC 2FIDA 2IO3B 1YQBA 2FUG1 4LNOA 4DHZB 3RNFC 4MSMB 3QIJA 3MHZA 2MJDA 5JHBA 3IT4B 1WGDA 1HZ5A 2KACA 5DCNA 1TZOA 1HEZE 1RM6C 3DHGC 3PVLA 2LGYA 3E9SA 1E7UA 4YSZB 4HKZE 4BOSC 1WZ0A 4DXGA 4DHJB 1I4HA 4PS7A 1R4NB 2BS3B 4WQMA 3ZRCA 2DLBA 4MACA 4IDIA 3N20C 3BYTB 1C3TA 4C4VA 4NJ6A 2K9XA 3KWVA 2LWPA 3VFKA 4MGYE 4CYEA 4MEMA 4MH8A 2D3CA 2JPHA 2KD0A 1CQVA 1LQBA 3AB5A 1OQYA 1IGDA 3KW5B 1D3ZA 4FLHA 3ZGZA 1WE6A 1JW9D 1Z2MA 4ZRKA 1YN4A 2V3SA 2HD5B 3DBHI 5H8YE 2NBWB 5J17A 1KLUD 4JLCA 1OEYA 3OAWA 2KN4A 1ET6A 2JSVX 4O1NA 1XLPA 1KLGD 3ZDMC 3RNAC 3AEBB 4IWQA 3WAMA 1WR6E 3RPFC 4OVUA 2WX0A 3JYUA 2M0XA 2KDEB 2GB1A 2M0AA 1FCCC 3ZNZB 4LNNA 1P0RA 4ARIA 2ICIA 2INPE 5D2MB 1UGJA 2MBOA 2WXHA 2MBQA 3EFCA 3PGEA 4HWIB 2QMTA 1VZ7A 2FCMA 2ZEQA 5HFYA 2O6VD 1EF1A 2ZCBA 3FAHA 1E90A 1F52A 1V49A 2EMSA 1XLNA 3NVVA 3X0WA 3H8HA 4HEA1 2WWZA 4HROA 4UDUC 4ZYNA 4B0EA 3JSVA 1YQ4B 1XD3B 1E5WA 2N4FA 1TS4A 3OG5A 3NZSA 3TL5A 1DOYA 1F77A 1YX6B 3A9JA 3DVGY 2C9WB 2IBIB 2DBYA 3X23A 2Z59B 3PRPB 4I6PA 1L0XB 2K22A 3EECA 2MLBA 2FCQA 3R2TA 2WDVB 3AEEB 1N6ZA 4H2AA 2LGXA 4WAAA 1P3QU 4MDKE 4GOCA 2IJ0A 1J7BA 2WXQA 3ETRA 3RNBC 1F2RI 2BB5A 4RGOS 3WALA 4WWNA 3A4SC 3E56A 2KJRA 1BXTA 2WXMA 3L17A 4K1RB 4W9JA 2M56B 4K81A 4WJOA 3NOBA 4TSSA 3NG0A 4A20A 1JALA 4NAWA 3AEFB 3NS1A 1E10A 1ZE3D 4IM2A 4K7UA 2HDEA 5HI1A 1I4RA 3SHQA 2KQ4X 4DHJD 2MA9B 3K9PB 4LDTD 1AWDA 3GZNB 5L83A 3T9LA 4CQNA 2LASA 1WF9A 4HPMB 2NR2A 1ENFA 2PIAA 2ZW0A 4MELA 3VTVA 3SDLC 1SBBB 5H92C 1HTOA 2GRIA 2L7RA 4AP4C 4GDKB 3Q8CA 4XC2A 3B1LX 4FHKA 3UQAA 2N9LA 2LVQA 1A5RA 4BBNF 2KKCA 3U52E 2LZ6A 4FN2A 1OGWA 4WIPA 4GN1A 2LRUA 2LVPA 4TMAB 3V62A 4X57B 2N7EA 2REXA 2KVZA 1YJ1A 2WHIA 5EDSA 3H9DA 1UH6A 2G3QB 1GC6A 3IFWB 5JHAA 3ZJUA 2DZMA 5C2TB 3NJTA 4KV2A 3GS2A 1TS5A 1VZ6A 4KGTA 1HZ6A 2ZCCA 5DPTA 2ZJDA 3PRZA 3RT3B 1QILA 3TMPB 2M19A 1TJEA 1V1PB 2KQSA 4OVVA 4PK1A 1FCLA 3AEAB 4HJGE 2KHWB 1TGZB 1UGMA 3P1MA 5D94A 3PO0A 3SD5A 5IA7A 1Q1OA 1G6JA 4IWOA 3AEDB 1TKYA 4XZ4A 1YN3A 3IXSA 4MM3A 3ZO5B 1I4PA 2LGIA 3R7RA 2ON8A 3DQVA 4FA6A 1I7HA 2IDYA 3SEBA 3MHSD 4FJYA 1YX5B 1SE9A 2WNMA 1WXVA 2J42A 1JROA 5J18A 4HCNB 3L4PA 2FBWB 5BO4B 3Q3FA 2J4XA 3GB1A 1LM8B 2RPVA 3JW0X 1JRPA 4W9GA 4M01A 3B0AA 3L08A 1BUIC 4L2YA 1WM3A 2J0JA 2MHJA 2XK5A 2L0FA 4J6IA 3DBHB 3DPDA 1MFWA 1L5PA 1V81A 2MP2B 3QWZB 3BK2A 3M95A 3AE7B 3AEGB 2QIEB 3A1QA 3CWIA 1JWSD 2C60A 4ZOHC 1WGHA 2GBJA 4OZAA 1M4VA 3WAOA 4II2B 2SAKA 2K1FA 2KO3A 2WXJA 5C23A 2IGDA 4FBJB 4BKTA 3OLMD 2BT6A 3KUZA 1C1YB 1E8YA 1V6EA 1C4PA 2ZNVB 3U8ZA 2VH2A 1E8ZA 4AJYB 3EC8A 4TQ0A 4HDOA 4K7SA 3A9KB 2JRHA 4G3XB 1FIQA 4DK5A 2J0MA 4E74A 4E3CA 2KMMA 2XBBC 3A1QB 2N0SB 3BVGA 2WP9B 2D2QA 4JX1C 4USAA 1T0RC 2N1VA 5BYSA 5G5HA 3AECB 1ZUD2 1NVID 4EFOA 4YTMB 4IG7B 2BYTA 2EKEC 1TY2A 4ICVA 5TR5A 2XNAC 3KUCB 1C4AA 1FNWA 4M00A 5D7GA 3L0WB 5G55A 4URKA 1QZEA 1IBXB 2LHEA 3UGBB 1SIJA 2PLPA 3KWLA 4OVZA 4WWPA 3T8MA 2VRRB 3ZNID 3FC4A 2K3UA 1GB4A 2KFKB 2FE8A 3QA8A 1OTRB 4RMAA 1K51A 3PLUA 4RF0A 1WJUA 4KVGB 4LCDE 3VUXA 1XCTL 3QK0A 3D32A 3ZKJC 1SJHD 1V5OA 3BIID 3I63C 2J52A 1I4QA 3NHEB 1TT5B 4ZRIA 4JE3B 2UWQA 2WXIA 1X1MA 3HVDA
chains in the Genus database with same CATH topology
2NPTA 2BWFA 2JUOA 4OVUA 2JVCA 2WX0A 1L2NA 2KLGA 2M0XA 3JYUA 4N9F4 2KDEB 4FULA 3M63B 5LXIB 2KDFB 4IM0A 3ZNZB 2LD9A 4G11A 5CHVC 2RR9A 2K6DB 2DENB 1P0RA 4NJ7A 4W9EA 3L10B 3R7QA 2KOXA 3KVFB 4KDLB 4KIKB 2OOBB 3ML8A 4TQ1A 3ZRFA 3RD2A 5D2MB 3V61A 1WXAA 2MBOA 4B95A 2A4ZA 1F9JA 2MBQA 2R2OA 1E7VA 3L13A 3PGEA 2L8JA 4HK2A 4AWJA 2IZVB 4HWIB 4CHKA 2FCMA 1WY8A 1WM2A 2ZEQA 2WDTB 3QQ8B 2O6VD 1EF1A 2ZCBA 3A33B 3TIXA 1E90A 1V49A 4DXAB 2M8SA 2EMSA 4TKNA 4II3B 4DHZE 3X0WA 2KANA 3Q3JA 2MBEA 3PZDA 4WJNA 2KX3A 2WWZA 2AL6A 5GMVA 3R66C 4MH0E 3APDA 2IO0B 4ZYNA 1L7YA 2J7QB 3VH4B 4BFRA 1S1QB 3JSVA 1XD3B 1E5WA 4HCPB 2G4SA 3W1SA 4HPLB 2LRWA 2L05A 2N4FA 1R4NI 4EZLA 2XK5B 3NZSA 3TL5A 1KLVA 3BY4B 3QJZA 5JZEB 1YX6B 3A9JA 1WR1A 3IHPC 5IAAC 3DVGY 3W1SC 4F1SA 2C9WB 2KMAA 3QARA 2IBIB 1RRBA 2DYMA 3X23A 1NDDA 2I1KA 3CF6E 2Z59B 4MSQB 3PRPB 2K8CA 4I6PA 4MGZE 4RM8A 3EECA 5JH5C 2MLBA 2FCQA 2MSED 4M0WB 5LXHA 2CHWA 1WJNA 2C7NB 2MQJA 2LGXA 2M17A 4WAAA 4KZ0A 3DVGX 1P3QU 1YIWA 1ISNA 4MDKE 4BKSD 2BWES 2KDIA 4WWOA 4GOCA 2BYFA 3ONSA 1H8CA 4P7IA 3BINA 3UIOB 5CHFA 3ZUNA 2B3AA 3ECIA 3V6EB 2WX1A 3WALA 2CHZA 4WWNA 3A4SC 2BKFA 3SU8X 1YD8U 2KJRA 4K1RB 2KMCA 3L17A 3PLVA 3NS8A 4W9JA 2Z0DB 2MCNB 3LJ3A 4K81A 4WJOA 1WXMA 3NOBA 3PSEB 4GB9A 2N1WA 3N3KB 3S2AA 2CS4A 4A20A 2MP2A 2ZZPB 1VCBA 2MX2A 3A4RA 4NAWA 4CO7A 5DPWA 1WJ4A 3LDZE 2DYBA 1WFYA 2MWSB 4RM9A 4IM2A 3ZDTA 3NZUA 4K7UA 1V86A 1WYWB 3VVWB 1V5TA 3SHQA 3WAPA 3VH3B 2JF5A 4DHJD 2AWTA 2MA9B 2HTHA 2KTFA 3K9PB 2ZVOA 4LDTD 2DHZA 3PHWB 2FCNA 4BKSA 2V4LA 1XT9B 4GMVA 2L76A 3UIPB 3V6CB 1IP9A 3ALBA 2LGDA 5D6JB 4TUUA 2KQ7A 5L83A 3V60A 2MW5A 3T9LA 2K39A 2NVUI 3N30A 4E71A 2LASA 4AUQC 1WF9A 4HPMB 2DZIA 4JQWC 3AXCA 2NR2A 3RUIB 4YL8A 1PQSA 2KC2A 2W9NA 3PPAA 4MELA 1I42A 2GBNA 5DPRA 3VTVA 3SDLC 2CU1A 3H7PB 2JZZA 4W9KA 3ZVVA 5C1ZA 1WX8A 4NNJB 4NQLB 2O2VA 3VTWA 2ZNVC 2GBMA 2L7RA 3O65B 4W9CA 4AP4C 4GDKB 3RYTA 3A9KA 3ZNGC 4B6WA 2K6QA 2JZ3B 4FADA 3U7DA 2RSUA 4EZJA 1WGGA 2CHXA 1P1AA 1ZW7A 4EKUA 4XC2A 1WX7A 4W9LA 2LXCA 3B1LX 1UD7A 4GU2A 4FHKA 4MJSA 3UQAA 2BPSA 2D07B 2D3GA 1LXDA 2Y5BB 2NS5A 4BBNC 2LVQA 2R2QA 4W9HA 2CKHB 2FIFA 4KZCA 1A5RA 1V9JA 4BBNF 2KKCA 2N9EB 3KH0A 4M8MA 1FXTB 2GBRA 1V80A 2N9XA 2I1JA 1UZXB 1WMHA 2M4NA 3APCA 3DVNV 3IG3A 4EEWA 1Q0WB 4G50A 3WA0A 4GDLA 5G2NA 2NBUA 2JT4B 2LZ6A 2RD0A 1OGWA 3PHXB 4FN2A 1T0YA 3PT2B 1LFDA 2KNBA 3VHTC 1J0GA 2YLMA 1J19A 4GN1A 2LRUA 3OJ3A 3TJPA 4G0NB 2LVPA 4KSKC 4F8CB 2AL3A 3W1YA 3V62A 4A3OA 2NPTB 4X57B 3CSFA 2ZPNA 4GSWA 3DBLI 3B08A 4LJOB 1GNUA 2BKRB 2KFJA 2N7EA 2REXA 2JRIB 2JWZA 1YJ1A 3QC8B 5EDSA 1WIAA 3CMMB 4IUMB 5KHQA 2EMTA 1IYFA 3I3TB 1Z5SB 4XX5A 3H9DA 1TZ1A 4EOYA 1UH6A 1TBEA 4I6NB 2G45B 3KYDD 1TTNA 3UQBA 2G3QB 2GMIC 1GC6A 2O2VB 3IFWB 1Y8RC 2DZMA 3KUDB 2V1YA 2C7HA 3QX1A 3AI5A 5JHAA 3TBLD 1S3SG 4KV2A 2O6VA 2YVCA 4GXBA 3UINB 2KFKA 2LUEA 2RGFA 3KYCD 3MTNB 2KX0A 2KK8A 2C5LC 4ZRJA 2ZCCA 3U30A 4BOZB 1EF5A 5DPTA 2ZJDA 3PRZA 3RT3B 3RZFA 3HIZA 3ZTDA 5E6PA 3TMPB 3MJWA 2LJ5A 2ZVNA 1WRDB 4KDIC 2PJHA 4WJQA 1WGRA 1GJZA 1ZKHA 3DVNU 5L95C 2KQSA 4OVVA 2OJRA 4GIVA 4LDTB 2KHWB 3PRMB 2ZPYA 1TGZB 2IY1B 3ZTCA 4LJPB 1UGMA 1VD2A 5D94A 1SGHA 2KZRA 2IO2B 3SD5A 5IA7A 3UF8A 4ANXA 1Q1OA 1K8RB 1V2YA 2Z0EB 3JSVB 4PS3A 4GDLB 5FR6A 1M94A 4IWOA 1JRUA 5DPSA 3VQIA 2N9PC 1G6JA 1HE8A 2DZJA 2MRPA 4JGHB 2DYOA 2DZKA 2HE7A 2LI5A 2FAZA 1R4MI 4XZ4A 4MM3A 3ZO5B 2K8BA 3R7RA 1RLFA 3DQVA 3GZNI 2IY0B 1AARA 2KTRA 2MBHA 3N32A 3A9JB 4FA6A 1GUAB 3L54A 4MGIE 2QHOA 2NBVB 4WJPA 1UBQA 3MHSD 2FUHB 4FJYA 1YX5B 4IM3A 1SE9A 4IW0A 3ZIMA 4HDQA 5AZFA 4BKGA 4KIKA 1OEYJ 2M1MA 1WXVA 1NI2A 1UELA 3VTUA 4WQOB 4IWPA 5J18A 1CMXB 5AEKB 2KWCA 4HCNB 2BF8B 4NPNA 1WGYA 1MG8A 5BO4B 3Q3FA 3VAWA 1GC7A 3C0RB 3P2BA 3RULA 4DDGD 3VDZA 4JL9A 4NY0A 2O6VB 1EO6A 2D11A 3JVZX 1LM8B 2UYZB 3JW0X 4BVUC 2G4DB 4ANWA 4ZDVA 3PS6A 2PE9A 2C7MB 4W9GA 4ANUA 2BYEA 2NCNA 2MBBB 4AJWA 2BYVE 5CX3A 4JIOU 3EHVA 3M3JA 3HM6X 3B0AA 3APFA 3L08A 4ICUA 2FNJB 3H7SA 3DCGA 3QHTA 1EUVB 3PREA 1WM3A 2J0JA 4FJZA 5CHWA 4B9KA 2KWVB 2DAJA 1WE7A 2XK5A 4HXDA 2L0FA 4J6IA 3PV1A 1Q5WB 2KXJA 3DPDA 2KDBA 1V81A 2HJ8A 2MP2B 3QWZB 3VXWA 3WIMA 4NAWB 3M62B 3M95A 3IBEA 4FJVB 1J8CA 3A1QA 3AU5A 3HHMA 2KWUB 2KTRB 4FHJA 4W9DA 4IC7B 2C60A 2IYDB 1WGHA 5E6NA 2LVOA 2GBJA 2BGFA 5E6OA 1SIFA 2GBKA 2N7DA 4PYZA 5KHOA 4II2B 3WAOA 2K1FA 1WZ3A 2KO3A 1WJ6A 1U4AA 3ZW3A 5C23A 4FBJB 2AEHA 2GOWA 3OLMD 1BT0A 4BKTA 2PPHA 3VUYA 1XQQA 1WI0A 3KUZA 3ML9A 3DDCB 3DBSA 1C1YB 1P9DU 1NBFC 2AYOB 1E8YA 1V6EA 3QCAA 5HKHA 3H1UA 3L16A 3ZLZA 2KN5A 2KVRA 2FIDA 2D10A 2IO3B 1YQBA 2ZNVB 2LXAA 2PEAA 1E8WA 4KSLC 1E8ZA 3U8ZA 4HLEA 4DHZB 3QAQA 4MSMB 2FCSA 2XEWA 3RCZA 4AJYB 3QIJA 3EC8A 4TQ0A 2ASQA 4HDOA 4K7SA 5JHBA 1WX9A 3NY5A 3HM3A 4K7WA 1WGDA 3HK0A 2L3ZA 5DCNA 3A9KB 1I35A 2JRHA 4A3PA 4G3XB 1RFAA 3PVLA 2LGYA 4DK5A 4EZKA 2J0KA 2J0MA 4E74A 1KOTA 1E7UA 4E3CA 1UBIA 4M8NA 2XBBC 3A1QB 1H4RA 4MJSB 3EFUA 2KJHB 4BOSC 1WZ0A 3DBRI 1KJTA 4DHJB 3OJ4B 2D2QA 4GGQA 4PS7A 2PE6B 5J2RA 2N1VA 3ZRCA 3WANA 5AZHA 1WMHB 1WXSA 2DX5B 4EFOA 1GG3A 4IG7B 1C3TA 2L00B 1WH3A 2EKEC 4I6LB 4NJ6A 3AULA 4ICVA 3VFKA 2JXXA 2LWPA 4MGYE 4DDID 3IVFA 5TR5A 2CR5A 3KUCB 3R3MA 3ENEA 4CYEA 5D7GA 3L0WB 4MEMA 5G55A 3H7PA 4W9FA 4NQKE 4URKA 1QZEA 2KC1A 4ASWC 2JPHA 4W9IA 3H6NA 2KD0A 2KJ6A 1LQBA 4PS8A 2KLCA 3UGBB 1KM7A 4GDKA 4DBGA 1OQYA 3K9OB 3KW5B 3PTFC 4WWPA 3T8MA 2RPQA 2VRRB 1D3ZA 1P98A 3ZNID 4FLHA 1WE6A 3CSTA 5CTRC 5AZGA 2L0TA 1Z2MA 4ZRKA 3TCAA 2KFKB 3AU4A 2V3SA 2K8HA 2HD5B 3DBHI 3QA8A 1OTRB 4RMAA 1ZGUB 2WYQA 3PLUA 4HJKA 4TV3A 4DWFA 2IO1B 2NBWB 5J17A 4PYUA 1WJUA 2JY6A 4KVGB 4LCDE 4AOFA 3RZWC 3VUXA 3GOEA 4JLCA 3ZNHB 3QK0A 2DAFA 1OEYA 3D32A 3VUWA 3OAWA 2A5UA 3ZKJC 1V5OA 1E8XA 4EUTA 4ANVA 4F7ZA 3NHEB 4HVBA 4ZRIA 3DOWA 4MGKE 2UWQA 3ZDMC 3WAMA 2K25A 4IWQA 1RAXA 1WR6E 1X1MA 1IPGA 5LLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPT A;  2BWF A;  2JUO A;  4OVU A;  2JVC A;  2WX0 A;  1L2N A;  2KLG A;  2M0X A;  3JYU A;  4N9F 4;  2KDE B;  4FUL A;  3M63 B;  5LXI B;  2KDF B;  4IM0 A;  3ZNZ B;  2LD9 A;  4G11 A;  5CHV C;  2RR9 A;  2K6D B;  2DEN B;  1P0R A;  4NJ7 A;  4W9E A;  3L10 B;  3R7Q A;  2KOX A;  3KVF B;  4KDL B;  4KIK B;  2OOB B;  3ML8 A;  4TQ1 A;  3ZRF A;  3RD2 A;  5D2M B;  3V61 A;  1WXA A;  2MBO A;  4B95 A;  2A4Z A;  1F9J A;  2MBQ A;  2R2O A;  1E7V A;  3L13 A;  3PGE A;  2L8J A;  4HK2 A;  4AWJ A;  2IZV B;  4HWI B;  4CHK A;  2FCM A;  1WY8 A;  1WM2 A;  2ZEQ A;  2WDT B;  3QQ8 B;  2O6V D;  1EF1 A;  2ZCB A;  3A33 B;  3TIX A;  1E90 A;  1V49 A;  4DXA B;  2M8S A;  2EMS A;  4TKN A;  4II3 B;  4DHZ E;  3X0W A;  2KAN A;  3Q3J A;  2MBE A;  3PZD A;  4WJN A;  2KX3 A;  2WWZ A;  2AL6 A;  5GMV A;  3R66 C;  4MH0 E;  3APD A;  2IO0 B;  4ZYN A;  1L7Y A;  2J7Q B;  3VH4 B;  4BFR A;  1S1Q B;  3JSV A;  1XD3 B;  1E5W A;  4HCP B;  2G4S A;  3W1S A;  4HPL B;  2LRW A;  2L05 A;  2N4F A;  1R4N I;  4EZL A;  2XK5 B;  3NZS A;  3TL5 A;  1KLV A;  3BY4 B;  3QJZ A;  5JZE B;  1YX6 B;  3A9J A;  1WR1 A;  3IHP C;  5IAA C;  3DVG Y;  3W1S C;  4F1S A;  2C9W B;  2KMA A;  3QAR A;  2IBI B;  1RRB A;  2DYM A;  3X23 A;  1NDD A;  2I1K A;  3CF6 E;  2Z59 B;  4MSQ B;  3PRP B;  2K8C A;  4I6P A;  4MGZ E;  4RM8 A;  3EEC A;  5JH5 C;  2MLB A;  2FCQ A;  2MSE D;  4M0W B;  5LXH A;  2CHW A;  1WJN A;  2C7N B;  2MQJ A;  2LGX A;  2M17 A;  4WAA A;  4KZ0 A;  3DVG X;  1P3Q U;  1YIW A;  1ISN A;  4MDK E;  4BKS D;  2BWE S;  2KDI A;  4WWO A;  4GOC A;  2BYF A;  3ONS A;  1H8C A;  4P7I A;  3BIN A;  3UIO B;  5CHF A;  3ZUN A;  2B3A A;  3ECI A;  3V6E B;  2WX1 A;  3WAL A;  2CHZ A;  4WWN A;  3A4S C;  2BKF A;  3SU8 X;  1YD8 U;  2KJR A;  4K1R B;  2KMC A;  3L17 A;  3PLV A;  3NS8 A;  4W9J A;  2Z0D B;  2MCN B;  3LJ3 A;  4K81 A;  4WJO A;  1WXM A;  3NOB A;  3PSE B;  4GB9 A;  2N1W A;  3N3K B;  3S2A A;  2CS4 A;  4A20 A;  2MP2 A;  2ZZP B;  1VCB A;  2MX2 A;  3A4R A;  4NAW A;  4CO7 A;  5DPW A;  1WJ4 A;  3LDZ E;  2DYB A;  1WFY A;  2MWS B;  4RM9 A;  4IM2 A;  3ZDT A;  3NZU A;  4K7U A;  1V86 A;  1WYW B;  3VVW B;  1V5T A;  3SHQ A;  3WAP A;  3VH3 B;  2JF5 A;  4DHJ D;  2AWT A;  2MA9 B;  2HTH A;  2KTF A;  3K9P B;  2ZVO A;  4LDT D;  2DHZ A;  3PHW B;  2FCN A;  4BKS A;  2V4L A;  1XT9 B;  4GMV A;  2L76 A;  3UIP B;  3V6C B;  1IP9 A;  3ALB A;  2LGD A;  5D6J B;  4TUU A;  2KQ7 A;  5L83 A;  3V60 A;  2MW5 A;  3T9L A;  2K39 A;  2NVU I;  3N30 A;  4E71 A;  2LAS A;  4AUQ C;  1WF9 A;  4HPM B;  2DZI A;  4JQW C;  3AXC A;  2NR2 A;  3RUI B;  4YL8 A;  1PQS A;  2KC2 A;  2W9N A;  3PPA A;  4MEL A;  1I42 A;  2GBN A;  5DPR A;  3VTV A;  3SDL C;  2CU1 A;  3H7P B;  2JZZ A;  4W9K A;  3ZVV A;  5C1Z A;  1WX8 A;  4NNJ B;  4NQL B;  2O2V A;  3VTW A;  2ZNV C;  2GBM A;  2L7R A;  3O65 B;  4W9C A;  4AP4 C;  4GDK B;  3RYT A;  3A9K A;  3ZNG C;  4B6W A;  2K6Q A;  2JZ3 B;  4FAD A;  3U7D A;  2RSU A;  4EZJ A;  1WGG A;  2CHX A;  1P1A A;  1ZW7 A;  4EKU A;  4XC2 A;  1WX7 A;  4W9L A;  2LXC A;  3B1L X;  1UD7 A;  4GU2 A;  4FHK A;  4MJS A;  3UQA A;  2BPS A;  2D07 B;  2D3G A;  1LXD A;  2Y5B B;  2NS5 A;  4BBN C;  2LVQ A;  2R2Q A;  4W9H A;  2CKH B;  2FIF A;  4KZC A;  1A5R A;  1V9J A;  4BBN F;  2KKC A;  2N9E B;  3KH0 A;  4M8M A;  1FXT B;  2GBR A;  1V80 A;  2N9X A;  2I1J A;  1UZX B;  1WMH A;  2M4N A;  3APC A;  3DVN V;  3IG3 A;  4EEW A;  1Q0W B;  4G50 A;  3WA0 A;  4GDL A;  5G2N A;  2NBU A;  2JT4 B;  2LZ6 A;  2RD0 A;  1OGW A;  3PHX B;  4FN2 A;  1T0Y A;  3PT2 B;  1LFD A;  2KNB A;  3VHT C;  1J0G A;  2YLM A;  1J19 A;  4GN1 A;  2LRU A;  3OJ3 A;  3TJP A;  4G0N B;  2LVP A;  4KSK C;  4F8C B;  2AL3 A;  3W1Y A;  3V62 A;  4A3O A;  2NPT B;  4X57 B;  3CSF A;  2ZPN A;  4GSW A;  3DBL I;  3B08 A;  4LJO B;  1GNU A;  2BKR B;  2KFJ A;  2N7E A;  2REX A;  2JRI B;  2JWZ A;  1YJ1 A;  3QC8 B;  5EDS A;  1WIA A;  3CMM B;  4IUM B;  5KHQ A;  2EMT A;  1IYF A;  3I3T B;  1Z5S B;  4XX5 A;  3H9D A;  1TZ1 A;  4EOY A;  1UH6 A;  1TBE A;  4I6N B;  2G45 B;  3KYD D;  1TTN A;  3UQB A;  2G3Q B;  2GMI C;  1GC6 A;  2O2V B;  3IFW B;  1Y8R C;  2DZM A;  3KUD B;  2V1Y A;  2C7H A;  3QX1 A;  3AI5 A;  5JHA A;  3TBL D;  1S3S G;  4KV2 A;  2O6V A;  2YVC A;  4GXB A;  3UIN B;  2KFK A;  2LUE A;  2RGF A;  3KYC D;  3MTN B;  2KX0 A;  2KK8 A;  2C5L C;  4ZRJ A;  2ZCC A;  3U30 A;  4BOZ B;  1EF5 A;  5DPT A;  2ZJD A;  3PRZ A;  3RT3 B;  3RZF A;  3HIZ A;  3ZTD A;  5E6P A;  3TMP B;  3MJW A;  2LJ5 A;  2ZVN A;  1WRD B;  4KDI C;  2PJH A;  4WJQ A;  1WGR A;  1GJZ A;  1ZKH A;  3DVN U;  5L95 C;  2KQS A;  4OVV A;  2OJR A;  4GIV A;  4LDT B;  2KHW B;  3PRM B;  2ZPY A;  1TGZ B;  2IY1 B;  3ZTC A;  4LJP B;  1UGM A;  1VD2 A;  5D94 A;  1SGH A;  2KZR A;  2IO2 B;  3SD5 A;  5IA7 A;  3UF8 A;  4ANX A;  1Q1O A;  1K8R B;  1V2Y A;  2Z0E B;  3JSV B;  4PS3 A;  4GDL B;  5FR6 A;  1M94 A;  4IWO A;  1JRU A;  5DPS A;  3VQI A;  2N9P C;  1G6J A;  1HE8 A;  2DZJ A;  2MRP A;  4JGH B;  2DYO A;  2DZK A;  2HE7 A;  2LI5 A;  2FAZ A;  1R4M I;  4XZ4 A;  4MM3 A;  3ZO5 B;  2K8B A;  3R7R A;  1RLF A;  3DQV A;  3GZN I;  2IY0 B;  1AAR A;  2KTR A;  2MBH A;  3N32 A;  3A9J B;  4FA6 A;  1GUA B;  3L54 A;  4MGI E;  2QHO A;  2NBV B;  4WJP A;  1UBQ A;  3MHS D;  2FUH B;  4FJY A;  1YX5 B;  4IM3 A;  1SE9 A;  4IW0 A;  3ZIM A;  4HDQ A;  5AZF A;  4BKG A;  4KIK A;  1OEY J;  2M1M A;  1WXV A;  1NI2 A;  1UEL A;  3VTU A;  4WQO B;  4IWP A;  5J18 A;  1CMX B;  5AEK B;  2KWC A;  4HCN B;  2BF8 B;  4NPN A;  1WGY A;  1MG8 A;  5BO4 B;  3Q3F A;  3VAW A;  1GC7 A;  3C0R B;  3P2B A;  3RUL A;  4DDG D;  3VDZ A;  4JL9 A;  4NY0 A;  2O6V B;  1EO6 A;  2D11 A;  3JVZ X;  1LM8 B;  2UYZ B;  3JW0 X;  4BVU C;  2G4D B;  4ANW A;  4ZDV A;  3PS6 A;  2PE9 A;  2C7M B;  4W9G A;  4ANU A;  2BYE A;  2NCN A;  2MBB B;  4AJW A;  2BYV E;  5CX3 A;  4JIO U;  3EHV A;  3M3J A;  3HM6 X;  3B0A A;  3APF A;  3L08 A;  4ICU A;  2FNJ B;  3H7S A;  3DCG A;  3QHT A;  1EUV B;  3PRE A;  1WM3 A;  2J0J A;  4FJZ A;  5CHW A;  4B9K A;  2KWV B;  2DAJ A;  1WE7 A;  2XK5 A;  4HXD A;  2L0F A;  4J6I A;  3PV1 A;  1Q5W B;  2KXJ A;  3DPD A;  2KDB A;  1V81 A;  2HJ8 A;  2MP2 B;  3QWZ B;  3VXW A;  3WIM A;  4NAW B;  3M62 B;  3M95 A;  3IBE A;  4FJV B;  1J8C A;  3A1Q A;  3AU5 A;  3HHM A;  2KWU B;  2KTR B;  4FHJ A;  4W9D A;  4IC7 B;  2C60 A;  2IYD B;  1WGH A;  5E6N A;  2LVO A;  2GBJ A;  2BGF A;  5E6O A;  1SIF A;  2GBK A;  2N7D A;  4PYZ A;  5KHO A;  4II2 B;  3WAO A;  2K1F A;  1WZ3 A;  2KO3 A;  1WJ6 A;  1U4A A;  3ZW3 A;  5C23 A;  4FBJ B;  2AEH A;  2GOW A;  3OLM D;  1BT0 A;  4BKT A;  2PPH A;  3VUY A;  1XQQ A;  1WI0 A;  3KUZ A;  3ML9 A;  3DDC B;  3DBS A;  1C1Y B;  1P9D U;  1NBF C;  2AYO B;  1E8Y A;  1V6E A;  3QCA A;  5HKH A;  3H1U A;  3L16 A;  3ZLZ A;  2KN5 A;  2KVR A;  2FID A;  2D10 A;  2IO3 B;  1YQB A;  2ZNV B;  2LXA A;  2PEA A;  1E8W A;  4KSL C;  1E8Z A;  3U8Z A;  4HLE A;  4DHZ B;  3QAQ A;  4MSM B;  2FCS A;  2XEW A;  3RCZ A;  4AJY B;  3QIJ A;  3EC8 A;  4TQ0 A;  2ASQ A;  4HDO A;  4K7S A;  5JHB A;  1WX9 A;  3NY5 A;  3HM3 A;  4K7W A;  1WGD A;  3HK0 A;  2L3Z A;  5DCN A;  3A9K B;  1I35 A;  2JRH A;  4A3P A;  4G3X B;  1RFA A;  3PVL A;  2LGY A;  4DK5 A;  4EZK A;  2J0K A;  2J0M A;  4E74 A;  1KOT A;  1E7U A;  4E3C A;  1UBI A;  4M8N A;  2XBB C;  3A1Q B;  1H4R A;  4MJS B;  3EFU A;  2KJH B;  4BOS C;  1WZ0 A;  3DBR I;  1KJT A;  4DHJ B;  3OJ4 B;  2D2Q A;  4GGQ A;  4PS7 A;  2PE6 B;  5J2R A;  2N1V A;  3ZRC A;  3WAN A;  5AZH A;  1WMH B;  1WXS A;  2DX5 B;  4EFO A;  1GG3 A;  4IG7 B;  1C3T A;  2L00 B;  1WH3 A;  2EKE C;  4I6L B;  4NJ6 A;  3AUL A;  4ICV A;  3VFK A;  2JXX A;  2LWP A;  4MGY E;  4DDI D;  3IVF A;  5TR5 A;  2CR5 A;  3KUC B;  3R3M A;  3ENE A;  4CYE A;  5D7G A;  3L0W B;  4MEM A;  5G55 A;  3H7P A;  4W9F A;  4NQK E;  4URK A;  1QZE A;  2KC1 A;  4ASW C;  2JPH A;  4W9I A;  3H6N A;  2KD0 A;  2KJ6 A;  1LQB A;  4PS8 A;  2KLC A;  3UGB B;  1KM7 A;  4GDK A;  4DBG A;  1OQY A;  3K9O B;  3KW5 B;  3PTF C;  4WWP A;  3T8M A;  2RPQ A;  2VRR B;  1D3Z A;  1P98 A;  3ZNI D;  4FLH A;  1WE6 A;  3CST A;  5CTR C;  5AZG A;  2L0T A;  1Z2M A;  4ZRK A;  3TCA A;  2KFK B;  3AU4 A;  2V3S A;  2K8H A;  2HD5 B;  3DBH I;  3QA8 A;  1OTR B;  4RMA A;  1ZGU B;  2WYQ A;  3PLU A;  4HJK A;  4TV3 A;  4DWF A;  2IO1 B;  2NBW B;  5J17 A;  4PYU A;  1WJU A;  2JY6 A;  4KVG B;  4LCD E;  4AOF A;  3RZW C;  3VUX A;  3GOE A;  4JLC A;  3ZNH B;  3QK0 A;  2DAF A;  1OEY A;  3D32 A;  3VUW A;  3OAW A;  2A5U A;  3ZKJ C;  1V5O A;  1E8X A;  4EUT A;  4ANV A;  4F7Z A;  3NHE B;  4HVB A;  4ZRI A;  3DOW A;  4MGK E;  2UWQ A;  3ZDM C;  3WAM A;  2K25 A;  4IWQ A;  1RAX A;  1WR6 E;  1X1M A;  1IPG A;  5LLI A; 
#chains in the Genus database with same CATH topology
 2NPT A;  3MC9 A;  3P42 A;  4N9F 4;  3UI3 A;  2WXR A;  4IM0 A;  4G11 A;  2DEN B;  3L10 B;  1FFV A;  1ZXH A;  1N5X A;  4KIK B;  3V61 A;  4B95 A;  1ZDV A;  2A4Z A;  1F9J A;  1E7V A;  3L13 A;  4AWJ A;  4CHK A;  5IOI A;  4FXC A;  1WY8 A;  1WM2 A;  1D4B A;  3V05 A;  2M8S A;  4TKN A;  3R66 C;  4MH0 E;  3Q3M C;  3VH4 B;  4P1B C;  2BTE A;  1MJD A;  3DWM A;  2R61 A;  4HPL B;  4EZL A;  2JQR B;  1KLV A;  1XEE A;  3BY4 B;  4A55 A;  3W1S C;  1WR1 A;  4F1S A;  3Q8E A;  2KMA A;  2DYM A;  1K53 A;  3FKY A;  2K8C A;  3B9J A;  4MGZ E;  5JH5 C;  4A8X C;  4M0W B;  1WJN A;  2C7N B;  4AS1 A;  1DGJ A;  4BAX A;  1ISN A;  1ROE A;  1SE3 A;  1SSN A;  3AE6 B;  3U7Z A;  4P7I A;  3UIO B;  3ZUN A;  2MEK A;  2QC8 A;  4D2K A;  2WX1 A;  4NZL B;  1YMH E;  3SU8 X;  2BKF A;  2KMC A;  3PLV A;  2Z0D B;  2MCN B;  1N63 A;  3RN9 C;  3PSE B;  3ZXV A;  3I5J C;  3N3K B;  3S2A A;  2ZZP B;  5DPW A;  3MFG A;  3ZDT A;  1WYW B;  1D5X C;  1EWC A;  3VH3 B;  2JF5 A;  4ZYS A;  2HTH A;  2ZVO A;  3PHW B;  4BKS A;  2W3R A;  4YTN B;  3UIP B;  3V6C B;  4XWT A;  5D6J B;  1C78 A;  3V60 A;  2K39 A;  3N30 A;  2H89 B;  4AUQ C;  4C4V B;  1L6V A;  3RUI B;  2KC2 A;  3WCQ A;  3P4S B;  4ARC A;  3AE3 B;  2JZZ A;  1WRI A;  3W5U B;  1WX8 A;  2O2V A;  2GBM A;  3RNE C;  1AW7 A;  2JZ3 B;  4FAD A;  2RSU A;  1WGG A;  1WX7 A;  4W9L A;  2KAJ A;  3AE9 B;  2LXC A;  1UD7 A;  4GU2 A;  4MJS A;  1SF0 A;  2D07 B;  2D3G A;  1LXD A;  2CKH B;  4KZC A;  3NVW A;  1KF6 B;  4M8M A;  2N9X A;  1WMH A;  3IG3 A;  3WA0 A;  5G2N A;  1T0Y A;  1LFD A;  5BMI A;  1J19 A;  4N58 A;  3TJP A;  4G0N B;  4KSK C;  3VR9 B;  2AL3 A;  4A3O A;  1FRR A;  3B08 A;  1GNU A;  1NEK B;  2KFJ A;  2JWZ A;  1WIA A;  3CMM B;  5KHQ A;  2EMT A;  1IYF A;  4B0M A;  4LK0 M;  4S0R A;  2WGS A;  3URY A;  4EOY A;  4I6N B;  1TTN A;  3AE8 B;  2O2V B;  3QX1 A;  3KUD B;  2C7H A;  3AI5 A;  1E9M A;  2NTS A;  1S3S G;  3TSS A;  2YVC A;  3UIN B;  3KYC D;  2D3B A;  4BZA A;  1EF5 A;  1RWS A;  4N6E B;  3Q8A A;  2LJ5 A;  1N60 A;  4XDC A;  1TYG B;  5FKA C;  5L95 C;  2OJR A;  3B2F A;  3PRM B;  2ZPY A;  1FNV A;  3ZTC A;  1F0Z A;  1SGH A;  2NMQ A;  4ANX A;  2AQ1 B;  4PS3 A;  1K8R B;  2Z0E B;  3JSV B;  4N59 A;  3VQI A;  4XWW A;  1M94 A;  5DPS A;  4JGH B;  2HE7 A;  2FAZ A;  2WLB A;  2QSD A;  2WXK A;  4YT0 B;  4HRS A;  3N32 A;  1SB3 C;  3A9J B;  3L54 A;  1UBQ A;  1FPY A;  1SJE D;  4IW0 A;  3ZIM A;  4BKG A;  4K3C A;  1R7S A;  1UEL A;  3VTU A;  4P6V F;  1FO4 A;  1CMX B;  3DHI C;  1OFF A;  1J7A A;  4ZHP A;  3BZD B;  1C76 A;  3LYY A;  3VDZ A;  2I2Y A;  3JVZ X;  2UYZ B;  2G4D B;  3PS6 A;  2MBB B;  1BML C;  1DOX A;  3M3J A;  3HM6 X;  4PT5 A;  5MPO A;  4ICU A;  2FNJ B;  5HHD G;  1T6B X;  2DAJ A;  2WXO A;  1HXY D;  5BYR A;  2KXJ A;  2IPK D;  2KDB A;  4A9A A;  4NAW B;  3M62 B;  2AQ3 B;  1J8C A;  3HHM A;  3NZ3 A;  4NAM A;  5E6N A;  3J9C A;  1JWU D;  2BGF A;  4RGM A;  1NEN B;  1SIF A;  2N7D A;  1GAQ B;  3ZW3 A;  4IOI E;  2PPH A;  1WI0 A;  1N61 A;  1NBF C;  2LMC A;  2MH7 A;  4WH4 A;  1FFU A;  3H1U A;  3ZLZ A;  1EU4 A;  5JXV A;  4WAF A;  2LXA A;  4HLE A;  3ABV B;  3RCZ A;  2FCS A;  2XEW A;  1D6E C;  1WXQ A;  2ASQ A;  4LTU A;  3N1Y C;  2L3Z A;  4C7Z A;  1FD6 A;  3BWU D;  1ZOY B;  4M02 A;  2BB6 A;  2V3N A;  1UBI A;  1ZXI A;  4M8N A;  1H4R A;  2KJH B;  3I57 A;  3ZQ4 A;  3VRA B;  1JWB D;  1KJT A;  1STE A;  3OJ4 B;  4WUR A;  1VLB A;  5AZH A;  4DQO C;  2QCZ A;  2Y5C A;  2DX5 B;  1GG3 A;  3DBL B;  3Q2A C;  2L00 B;  1FXA A;  4I6L B;  3AUL A;  1SE2 A;  3CIR B;  2JXX A;  4DDI D;  3IVF A;  2CR5 A;  3R3M A;  1QT9 A;  4JWS C;  3C8Y A;  2INN E;  3H7P A;  3MC0 B;  4W9F A;  4NQK E;  2KC1 A;  4ASW C;  1UNS A;  4W9I A;  3H6N A;  2UU7 A;  2LHD A;  1KH0 A;  4PS8 A;  3PTF C;  5D3D A;  3W9C B;  1P98 A;  3CST A;  1IUE A;  2L52 A;  3TCA A;  1LO5 D;  1DYQ A;  3AU4 A;  1T3Q A;  5AUI A;  5FR3 A;  4TV3 A;  2JY6 A;  1MI0 A;  3ZJT A;  2DAF A;  3VUW A;  2A5U A;  3U2S C;  4EUT A;  1RYJ A;  2KYW A;  4MGK E;  1IPG A;  5LLI A;  1GB1 A;  1XCQ L;  2BWF A;  2JUO A;  1L2N A;  2PMV A;  1I4X A;  2KLG A;  5C3J B;  4FUL A;  3M63 B;  4MM3 B;  5LXI B;  2KDF B;  1E7P B;  2LD9 A;  2K6D B;  2BW2 A;  4W9E A;  1WYG A;  1YQ3 B;  3R7Q A;  1HA5 A;  2KOX A;  4KDL B;  3ML8 A;  3ZRF A;  4EEW A;  2R2O A;  4HK2 A;  2IZV B;  4OZC A;  3TUO A;  1AN8 A;  3MJ5 A;  3A33 B;  4II3 B;  1T5X D;  2KAN A;  4WJN A;  3VRB B;  2AL6 A;  2I38 A;  2MJE A;  2IO0 B;  2J7Q B;  1EWY C;  2K5P A;  1S1Q B;  3W1S A;  2G4S A;  2LRW A;  1YJI A;  2KWD A;  2XK5 B;  3IHP C;  5IAA C;  3QAR A;  5D3I B;  4OW0 A;  3CF6 E;  1ET9 A;  1YNT E;  1VR9 A;  2CHW A;  1KFY B;  1FRD A;  4KZ0 A;  3AV8 A;  2BWE S;  2KDI A;  4WWO A;  4KGR A;  3N9Y C;  5T8I A;  3ONS A;  3Q3N C;  2JXT A;  5CHF A;  3NVZ A;  5I4D A;  3ECI A;  4YSX B;  4LNI A;  1PDX A;  2CHZ A;  2Y5P A;  1ESF A;  3NS8 A;  2GI9 A;  3LJ3 A;  3T3O A;  1WXM A;  2WQY B;  4GB9 A;  2N1W A;  1PYW D;  1I4G A;  1DOI A;  2CS4 A;  3ZYY X;  3Q14 C;  1Q10 A;  2MX2 A;  3A4R A;  2JYT A;  2KDM A;  3LDZ E;  4L1B A;  5IKC M;  1XF5 L;  2LUM A;  2WS3 B;  1V5T A;  4RCO A;  1YOV B;  4IKG A;  2KTF A;  1A70 A;  2DHZ A;  1XT9 B;  4GMV A;  1XXG A;  3ALB A;  2LGD A;  1KRH A;  2KQ7 A;  2WXG A;  2MW5 A;  1TKG A;  1RFK A;  1MVK A;  3PPA A;  1I42 A;  2GBN A;  2G1E A;  1JML A;  5DPR A;  4W9K A;  4HKQ A;  3KQ4 A;  3RNC C;  1ZP0 B;  2HTM E;  4NNJ B;  3VTW A;  2ZNV C;  3O65 B;  4B6W A;  2K6Q A;  4C80 A;  3U7D A;  5BYQ A;  4EZJ A;  2CHX A;  1ZW7 A;  3PZ7 A;  4EKU A;  4YXD B;  1UUP A;  1V8C A;  2RDH A;  2Y5B B;  2NS5 A;  3IT6 B;  1WWT A;  4W9H A;  2L83 A;  1P7E A;  2MJ3 A;  1V9J A;  2N9E B;  3KH0 A;  2GBR A;  1V80 A;  2I1J A;  1UZX B;  3DVN V;  1Q0W B;  2RD0 A;  3PT2 B;  2KNB A;  1J0G A;  1L4Z B;  2BS2 B;  2YLM A;  5LNK 1;  2N7J A;  3OJ3 A;  2AQ2 B;  3R2I A;  1QOA A;  3FIL A;  2NPT B;  4YSY B;  2WXN A;  3DBL I;  4LJO B;  3QC8 B;  2JRI B;  3P63 A;  4IUM B;  1Z5S B;  4XX5 A;  3SFE B;  1TBE A;  1YN5 A;  2G45 B;  1EU3 A;  2GMI C;  1Y8R C;  3N1X C;  2V1Y A;  2PW9 A;  3TBL D;  2LUE A;  2N9K A;  2C5L C;  3U30 A;  4BOZ B;  1PGB A;  2G9H D;  3RZF A;  3ZTD A;  3MJW A;  2NTT A;  1FEH A;  1F2R C;  1WRD B;  2PJH A;  4WJQ A;  2CJN A;  2OJW A;  5EE0 A;  1ZKH A;  4DXF A;  2PVO D;  4GIV A;  4LDT B;  4NJC A;  2IY1 B;  4LJP B;  1SXT A;  3TEY A;  1VD2 A;  2KZR A;  2WDQ B;  3AE2 B;  3UF8 A;  1V2Y A;  4KKJ A;  5FR6 A;  1JRU A;  2TSS A;  5IN7 A;  1HE8 A;  2DYO A;  2DZK A;  2LI5 A;  1R4M I;  3AM9 A;  1RLF A;  2MBH A;  1AAR A;  2RMM A;  3FIL B;  1GUA B;  2ZW1 A;  3P4P B;  4MGI E;  2NBV B;  4EE2 A;  3DHH C;  2FUH B;  4IM3 A;  4HDQ A;  5AZF A;  1NI2 A;  3C19 A;  4WQO B;  5AEK B;  4NPN A;  2RDG A;  1NYR A;  1PGA A;  3TEZ A;  1GC7 A;  3P2B A;  4DDG D;  4JL9 A;  1EO6 A;  1XLQ A;  3AE4 B;  4C56 C;  4A6Q A;  4ANW A;  1CJE A;  4ANU A;  2BYE A;  2DWQ A;  2Y3A A;  5CX3 A;  1N5W A;  1VJK A;  3APF A;  3QHT A;  3DCG A;  5CHW A;  1QOF A;  4B9K A;  1WE7 A;  2IGG A;  4KKI A;  1Q5W B;  2HJ8 A;  3WIM A;  2KT7 A;  3EGR A;  4FJV B;  3GE3 C;  3GP7 A;  2KWU B;  1ACC A;  3P4R B;  1TS3 A;  2JX5 A;  2PVG C;  1E6E B;  2RDB C;  4W9D A;  1C4C A;  1GPX A;  2IYD B;  2EEL A;  2LVO A;  2GBK A;  4PYZ A;  5KHO A;  2SEB D;  1U4A A;  2AEH A;  1BT0 A;  3VUY A;  2LFI A;  1QOG A;  1T0Q C;  1XQQ A;  1ZPS A;  3RFZ B;  3DDC B;  2BS4 B;  2W55 A;  3QCA A;  5HKH A;  3VR8 B;  2KN5 A;  2KVR A;  2D10 A;  2PEA A;  1E8W A;  4KSL C;  2IGH A;  4YWG G;  4K3B A;  3QAQ A;  1MHX A;  1WGK A;  2W82 A;  1WX9 A;  3NY5 A;  3HM3 A;  4K7W A;  3HK0 A;  4L23 A;  1T0S C;  1I35 A;  4A3P A;  1RFA A;  1B9R A;  2E6X A;  1K50 A;  4C00 A;  1KOT A;  4EZK A;  2J0K A;  2WU5 B;  4MT5 A;  4MJS B;  3EFU A;  1MHH E;  3DBR I;  4GGQ A;  2PE6 B;  4QAY A;  5J2R A;  2E3T A;  2W54 A;  3MP9 A;  3WAN A;  2PKO A;  3SFD B;  1WMH B;  1WXS A;  1E0Z A;  3NRZ A;  1WH3 A;  3HRD D;  4US9 A;  4S17 A;  3ENE A;  3MC8 A;  3LB8 C;  4P16 A;  4OHJ A;  5E6J A;  1CZP A;  2BQQ A;  4Q2J A;  5IO9 A;  3Q69 A;  2KJ6 A;  2KLC A;  1KM7 A;  4GDK A;  4DBG A;  3NUH B;  3K9O B;  2RPQ A;  3AH7 A;  1VRA B;  5CTR C;  1B1Z A;  5AZG A;  2L0T A;  2K8H A;  3AMZ A;  1ZGU B;  2WYQ A;  2V4I B;  4HJK A;  4DWF A;  2IO1 B;  3I9V 1;  4JWU C;  2V9H A;  4PYU A;  2LJI A;  4AOF A;  1OQR A;  3RZW C;  3GOE A;  3ZNH B;  3O13 A;  1E8X A;  2JYE A;  2L32 A;  4ANV A;  2LEK A;  4F7Z A;  4HVB A;  2QIL A;  3DOW A;  2YEP F;  2K25 A;  1RAX A;  3BVM A;  4RF1 A;  2JVC A;  3BK1 A;  5CHV C;  2RR9 A;  4NJ7 A;  3KVF B;  2JWU A;  2Q5W D;  2OOB B;  4TQ1 A;  4REZ A;  4XE0 A;  3RD2 A;  4LLG M;  1WXA A;  2L8J A;  3TEW A;  3RNG C;  3GE8 C;  3QQ8 B;  1D5M C;  2WDT B;  2PTL A;  2K0P A;  1C77 A;  2QEJ C;  3TIX A;  4DXA B;  4ITK A;  1V1P A;  3BYY B;  4RNA A;  4DHZ E;  3Q3J A;  2W3S A;  2MBE A;  3PZD A;  1F1H A;  2YEP B;  2KX3 A;  5GMV A;  3APD A;  2GLS A;  1L7Y A;  2WXP A;  4BFR A;  4HCP B;  3IAS 1;  1C79 A;  2L05 A;  1R4N I;  1PFD A;  1JWA D;  4KGS A;  1OQQ A;  3PZ8 A;  3QJZ A;  5JZE B;  4KX6 B;  1JCK B;  1RRB A;  5BMG A;  1NDD A;  2I1K A;  1QLB B;  4MSQ B;  4RM8 A;  2MSE D;  4US8 A;  1QOB A;  2QDF A;  5LXH A;  2MQJ A;  2M17 A;  1FM0 D;  3DVG X;  1YIW A;  4BKS D;  3V3X A;  2BYF A;  1H8C A;  3BIN A;  4A90 A;  1FMA D;  2B3A A;  2BVC A;  3RMK C;  3V6E B;  1YD8 U;  2OHF A;  2X8X X;  1L4D B;  2LGS A;  3HVZ A;  4ZHO A;  2MP2 A;  3N1Z C;  1VCB A;  4CO7 A;  5FK9 C;  1WJ4 A;  4AQ7 A;  3AE1 B;  1VZ8 A;  2DYB A;  1NI3 A;  4YTP B;  3TEX A;  1WFY A;  4RGT A;  2MWS B;  4RM9 A;  3NZU A;  1V86 A;  1YJJ A;  5EE9 A;  2QJL A;  3VVW B;  5IP4 D;  3WAP A;  1SEB D;  1L0Y B;  3EA6 A;  2AWT A;  1TS2 A;  2ACZ B;  1MPE A;  2FCN A;  2V4L A;  2V3P A;  2L76 A;  1R4M B;  1FXI A;  1IP9 A;  3R8B A;  4TUU A;  2Z8L A;  1D5Z C;  2VZK B;  3W5V B;  2NVU I;  4E71 A;  2DZI A;  4JQW C;  4WWM A;  3AXC A;  4YL8 A;  1PQS A;  1UF0 A;  2W9N A;  1WSP A;  2WXL A;  2CJO A;  1PUT A;  1AYF A;  2CU1 A;  3H7P B;  3ZVV A;  1KTK A;  4C7Y A;  2D3A A;  5C1Z A;  4NQL B;  1TY0 A;  1HQR D;  4W9C A;  3RYT A;  3A9K A;  3LXF A;  3ZNG C;  2DNF A;  1P1A A;  4XGA B;  4HPP A;  2BPS A;  1UWX A;  2EKI A;  4BBN C;  2R2Q A;  1P7F A;  2FIF A;  3Q3O C;  1FXT B;  1TIF A;  2M4N A;  3APC A;  3Q8F A;  3IAM 1;  4G50 A;  4GDL A;  2NBU A;  2JT4 B;  1XLO A;  3PHX B;  3VHT C;  1IGC A;  2X38 A;  4F8C B;  4P1C C;  3W1Y A;  1QQR A;  2ONQ A;  3CSF A;  2ZPN A;  4GSW A;  1IBX A;  2BKR B;  4ACF A;  2CU3 A;  4RH6 A;  3I3T B;  5GXG B;  1TZ1 A;  2VH1 A;  3KYD D;  2WU2 B;  3UQB A;  2JU6 X;  2XN9 C;  3U4E G;  3Q6B A;  2O6V A;  1C9F A;  4GXB A;  1JQ4 A;  2KFK A;  1J7C A;  3MTN B;  2RGF A;  4ZRJ A;  1QF6 A;  2KX0 A;  2KK8 A;  2BBC A;  3BVZ A;  4OZB A;  3HIZ A;  5E6P A;  2ZVN A;  5AUK A;  4KDI C;  4RFB A;  3ZXR A;  1WGR A;  1GJZ A;  3DVN U;  4R3D A;  1K52 A;  4LNF A;  2IO2 B;  2IND C;  3AN1 A;  3KLS X;  2D5G A;  2OED A;  3P4Q B;  4GDL B;  1CK1 A;  2N9P C;  2DZJ A;  2MRP A;  2HJ1 A;  3Q8B A;  5G5G A;  3DBR B;  2L1A A;  2K8B A;  1L6U A;  3GZN I;  3W2D A;  2IY0 B;  2KTR A;  1Y56 A;  2QHO A;  4WJP A;  1QKZ A;  4J3O D;  1ZDX A;  1NYQ A;  4KIK A;  1OEY J;  2M1M A;  3DWG C;  4ZRP A;  4XYC A;  4IWP A;  2KWC A;  2BF8 B;  1WGY A;  3HUI A;  5TSS A;  1MG8 A;  2AX5 A;  5BMH A;  3VAW A;  1EM7 A;  3C0R B;  3RUL A;  3AE5 B;  4NY0 A;  2O6V B;  2D11 A;  4BVU C;  4RGN A;  4ZDV A;  4LNK A;  2PE9 A;  2C7M B;  2NCN A;  4AJW A;  4GLS C;  1N62 A;  2BYV E;  4JIO U;  3EHV A;  3H7S A;  1HTQ A;  1EUV B;  3PRE A;  4FJZ A;  3NVY A;  3B2G A;  2KWV B;  5HG2 A;  3T3N A;  1MG4 A;  4HXD A;  2WXF A;  3PV1 A;  1GOZ A;  3VXW A;  1XO3 A;  3EUB 2;  5EE3 A;  3IBE A;  3OWE B;  4ZRQ A;  1TKE A;  3AU5 A;  2WDR B;  2KTR B;  3ZJV A;  4M0W A;  1SE4 A;  4FHJ A;  4IC7 B;  4XDD A;  2J53 A;  5EE1 A;  2B76 B;  5E6O A;  1V97 A;  1VDV A;  2JZP A;  1PGX A;  3RI7 C;  1L0V B;  2V0G A;  1WZ3 A;  1WJ6 A;  1FNU A;  2VZK D;  1LGR A;  2GOW A;  1UWM A;  3ML9 A;  3DBS A;  1P9D U;  2AYO B;  2H88 B;  3L16 A;  3SR6 A;  4JPS A;  1JWM D;  1V1O A;  2INC C;  2FID A;  2IO3 B;  1YQB A;  2FUG 1;  4LNO A;  4DHZ B;  3RNF C;  4MSM B;  3QIJ A;  3MHZ A;  2MJD A;  5JHB A;  3IT4 B;  1WGD A;  1HZ5 A;  2KAC A;  5DCN A;  1TZO A;  1HEZ E;  1RM6 C;  3DHG C;  3PVL A;  2LGY A;  3E9S A;  1E7U A;  4YSZ B;  4HKZ E;  4BOS C;  1WZ0 A;  4DXG A;  4DHJ B;  1I4H A;  4PS7 A;  1R4N B;  2BS3 B;  4WQM A;  3ZRC A;  2DLB A;  4MAC A;  4IDI A;  3N20 C;  3BYT B;  1C3T A;  4C4V A;  4NJ6 A;  2K9X A;  3KWV A;  2LWP A;  3VFK A;  4MGY E;  4CYE A;  4MEM A;  4MH8 A;  2D3C A;  2JPH A;  2KD0 A;  1CQV A;  1LQB A;  3AB5 A;  1OQY A;  1IGD A;  3KW5 B;  1D3Z A;  4FLH A;  3ZGZ A;  1WE6 A;  1JW9 D;  1Z2M A;  4ZRK A;  1YN4 A;  2V3S A;  2HD5 B;  3DBH I;  5H8Y E;  2NBW B;  5J17 A;  1KLU D;  4JLC A;  1OEY A;  3OAW A;  2KN4 A;  1ET6 A;  2JSV X;  4O1N A;  1XLP A;  1KLG D;  3ZDM C;  3RNA C;  3AEB B;  4IWQ A;  3WAM A;  1WR6 E;  3RPF C;  4OVU A;  2WX0 A;  3JYU A;  2M0X A;  2KDE B;  2GB1 A;  2M0A A;  1FCC C;  3ZNZ B;  4LNN A;  1P0R A;  4ARI A;  2ICI A;  2INP E;  5D2M B;  1UGJ A;  2MBO A;  2WXH A;  2MBQ A;  3EFC A;  3PGE A;  4HWI B;  2QMT A;  1VZ7 A;  2FCM A;  2ZEQ A;  5HFY A;  2O6V D;  1EF1 A;  2ZCB A;  3FAH A;  1E90 A;  1F52 A;  1V49 A;  2EMS A;  1XLN A;  3NVV A;  3X0W A;  3H8H A;  4HEA 1;  2WWZ A;  4HRO A;  4UDU C;  4ZYN A;  4B0E A;  3JSV A;  1YQ4 B;  1XD3 B;  1E5W A;  2N4F A;  1TS4 A;  3OG5 A;  3NZS A;  3TL5 A;  1DOY A;  1F77 A;  1YX6 B;  3A9J A;  3DVG Y;  2C9W B;  2IBI B;  2DBY A;  3X23 A;  2Z59 B;  3PRP B;  4I6P A;  1L0X B;  2K22 A;  3EEC A;  2MLB A;  2FCQ A;  3R2T A;  2WDV B;  3AEE B;  1N6Z A;  4H2A A;  2LGX A;  4WAA A;  1P3Q U;  4MDK E;  4GOC A;  2IJ0 A;  1J7B A;  2WXQ A;  3ETR A;  3RNB C;  1F2R I;  2BB5 A;  4RGO S;  3WAL A;  4WWN A;  3A4S C;  3E56 A;  2KJR A;  1BXT A;  2WXM A;  3L17 A;  4K1R B;  4W9J A;  2M56 B;  4K81 A;  4WJO A;  3NOB A;  4TSS A;  3NG0 A;  4A20 A;  1JAL A;  4NAW A;  3AEF B;  3NS1 A;  1E10 A;  1ZE3 D;  4IM2 A;  4K7U A;  2HDE A;  5HI1 A;  1I4R A;  3SHQ A;  2KQ4 X;  4DHJ D;  2MA9 B;  3K9P B;  4LDT D;  1AWD A;  3GZN B;  5L83 A;  3T9L A;  4CQN A;  2LAS A;  1WF9 A;  4HPM B;  2NR2 A;  1ENF A;  2PIA A;  2ZW0 A;  4MEL A;  3VTV A;  3SDL C;  1SBB B;  5H92 C;  1HTO A;  2GRI A;  2L7R A;  4AP4 C;  4GDK B;  3Q8C A;  4XC2 A;  3B1L X;  4FHK A;  3UQA A;  2N9L A;  2LVQ A;  1A5R A;  4BBN F;  2KKC A;  3U52 E;  2LZ6 A;  4FN2 A;  1OGW A;  4WIP A;  4GN1 A;  2LRU A;  2LVP A;  4TMA B;  3V62 A;  4X57 B;  2N7E A;  2REX A;  2KVZ A;  1YJ1 A;  2WHI A;  5EDS A;  3H9D A;  1UH6 A;  2G3Q B;  1GC6 A;  3IFW B;  5JHA A;  3ZJU A;  2DZM A;  5C2T B;  3NJT A;  4KV2 A;  3GS2 A;  1TS5 A;  1VZ6 A;  4KGT A;  1HZ6 A;  2ZCC A;  5DPT A;  2ZJD A;  3PRZ A;  3RT3 B;  1QIL A;  3TMP B;  2M19 A;  1TJE A;  1V1P B;  2KQS A;  4OVV A;  4PK1 A;  1FCL A;  3AEA B;  4HJG E;  2KHW B;  1TGZ B;  1UGM A;  3P1M A;  5D94 A;  3PO0 A;  3SD5 A;  5IA7 A;  1Q1O A;  1G6J A;  4IWO A;  3AED B;  1TKY A;  4XZ4 A;  1YN3 A;  3IXS A;  4MM3 A;  3ZO5 B;  1I4P A;  2LGI A;  3R7R A;  2ON8 A;  3DQV A;  4FA6 A;  1I7H A;  2IDY A;  3SEB A;  3MHS D;  4FJY A;  1YX5 B;  1SE9 A;  2WNM A;  1WXV A;  2J42 A;  1JRO A;  5J18 A;  4HCN B;  3L4P A;  2FBW B;  5BO4 B;  3Q3F A;  2J4X A;  3GB1 A;  1LM8 B;  2RPV A;  3JW0 X;  1JRP A;  4W9G A;  4M01 A;  3B0A A;  3L08 A;  1BUI C;  4L2Y A;  1WM3 A;  2J0J A;  2MHJ A;  2XK5 A;  2L0F A;  4J6I A;  3DBH B;  3DPD A;  1MFW A;  1L5P A;  1V81 A;  2MP2 B;  3QWZ B;  3BK2 A;  3M95 A;  3AE7 B;  3AEG B;  2QIE B;  3A1Q A;  3CWI A;  1JWS D;  2C60 A;  4ZOH C;  1WGH A;  2GBJ A;  4OZA A;  1M4V A;  3WAO A;  4II2 B;  2SAK A;  2K1F A;  2KO3 A;  2WXJ A;  5C23 A;  2IGD A;  4FBJ B;  4BKT A;  3OLM D;  2BT6 A;  3KUZ A;  1C1Y B;  1E8Y A;  1V6E A;  1C4P A;  2ZNV B;  3U8Z A;  2VH2 A;  1E8Z A;  4AJY B;  3EC8 A;  4TQ0 A;  4HDO A;  4K7S A;  3A9K B;  2JRH A;  4G3X B;  1FIQ A;  4DK5 A;  2J0M A;  4E74 A;  4E3C A;  2KMM A;  2XBB C;  3A1Q B;  2N0S B;  3BVG A;  2WP9 B;  2D2Q A;  4JX1 C;  4USA A;  1T0R C;  2N1V A;  5BYS A;  5G5H A;  3AEC B;  1ZUD 2;  1NVI D;  4EFO A;  4YTM B;  4IG7 B;  2BYT A;  2EKE C;  1TY2 A;  4ICV A;  5TR5 A;  2XNA C;  3KUC B;  1C4A A;  1FNW A;  4M00 A;  5D7G A;  3L0W B;  5G55 A;  4URK A;  1QZE A;  1IBX B;  2LHE A;  3UGB B;  1SIJ A;  2PLP A;  3KWL A;  4OVZ A;  4WWP A;  3T8M A;  2VRR B;  3ZNI D;  3FC4 A;  2K3U A;  1GB4 A;  2KFK B;  2FE8 A;  3QA8 A;  1OTR B;  4RMA A;  1K51 A;  3PLU A;  4RF0 A;  1WJU A;  4KVG B;  4LCD E;  3VUX A;  1XCT L;  3QK0 A;  3D32 A;  3ZKJ C;  1SJH D;  1V5O A;  3BII D;  3I63 C;  2J52 A;  1I4Q A;  3NHE B;  1TT5 B;  4ZRI A;  4JE3 B;  2UWQ A;  2WXI A;  1X1M A;  3HVD A; 
#chains in the Genus database with same CATH homology
 2NPT A;  2BWF A;  2JUO A;  4OVU A;  2JVC A;  2WX0 A;  1L2N A;  2KLG A;  2M0X A;  3JYU A;  4N9F 4;  2KDE B;  4FUL A;  3M63 B;  5LXI B;  2KDF B;  4IM0 A;  3ZNZ B;  2LD9 A;  4G11 A;  5CHV C;  2RR9 A;  2K6D B;  2DEN B;  1P0R A;  4NJ7 A;  4W9E A;  3L10 B;  3R7Q A;  2KOX A;  3KVF B;  4KDL B;  4KIK B;  2OOB B;  3ML8 A;  4TQ1 A;  3ZRF A;  3RD2 A;  5D2M B;  3V61 A;  1WXA A;  2MBO A;  4B95 A;  2A4Z A;  1F9J A;  2MBQ A;  2R2O A;  1E7V A;  3L13 A;  3PGE A;  2L8J A;  4HK2 A;  4AWJ A;  2IZV B;  4HWI B;  4CHK A;  2FCM A;  1WY8 A;  1WM2 A;  2ZEQ A;  2WDT B;  3QQ8 B;  2O6V D;  1EF1 A;  2ZCB A;  3A33 B;  3TIX A;  1E90 A;  1V49 A;  4DXA B;  2M8S A;  2EMS A;  4TKN A;  4II3 B;  4DHZ E;  3X0W A;  2KAN A;  3Q3J A;  2MBE A;  3PZD A;  4WJN A;  2KX3 A;  2WWZ A;  2AL6 A;  5GMV A;  3R66 C;  4MH0 E;  3APD A;  2IO0 B;  4ZYN A;  1L7Y A;  2J7Q B;  3VH4 B;  4BFR A;  1S1Q B;  3JSV A;  1XD3 B;  1E5W A;  4HCP B;  2G4S A;  3W1S A;  4HPL B;  2LRW A;  2L05 A;  2N4F A;  1R4N I;  4EZL A;  2XK5 B;  3NZS A;  3TL5 A;  1KLV A;  3BY4 B;  3QJZ A;  5JZE B;  1YX6 B;  3A9J A;  1WR1 A;  3IHP C;  5IAA C;  3DVG Y;  3W1S C;  4F1S A;  2C9W B;  2KMA A;  3QAR A;  2IBI B;  1RRB A;  2DYM A;  3X23 A;  1NDD A;  2I1K A;  3CF6 E;  2Z59 B;  4MSQ B;  3PRP B;  2K8C A;  4I6P A;  4MGZ E;  4RM8 A;  3EEC A;  5JH5 C;  2MLB A;  2FCQ A;  2MSE D;  4M0W B;  5LXH A;  2CHW A;  1WJN A;  2C7N B;  2MQJ A;  2LGX A;  2M17 A;  4WAA A;  4KZ0 A;  3DVG X;  1P3Q U;  1YIW A;  1ISN A;  4MDK E;  4BKS D;  2BWE S;  2KDI A;  4WWO A;  4GOC A;  2BYF A;  3ONS A;  1H8C A;  4P7I A;  3BIN A;  3UIO B;  5CHF A;  3ZUN A;  2B3A A;  3ECI A;  3V6E B;  2WX1 A;  3WAL A;  2CHZ A;  4WWN A;  3A4S C;  2BKF A;  3SU8 X;  1YD8 U;  2KJR A;  4K1R B;  2KMC A;  3L17 A;  3PLV A;  3NS8 A;  4W9J A;  2Z0D B;  2MCN B;  3LJ3 A;  4K81 A;  4WJO A;  1WXM A;  3NOB A;  3PSE B;  4GB9 A;  2N1W A;  3N3K B;  3S2A A;  2CS4 A;  4A20 A;  2MP2 A;  2ZZP B;  1VCB A;  2MX2 A;  3A4R A;  4NAW A;  4CO7 A;  5DPW A;  1WJ4 A;  3LDZ E;  2DYB A;  1WFY A;  2MWS B;  4RM9 A;  4IM2 A;  3ZDT A;  3NZU A;  4K7U A;  1V86 A;  1WYW B;  3VVW B;  1V5T A;  3SHQ A;  3WAP A;  3VH3 B;  2JF5 A;  4DHJ D;  2AWT A;  2MA9 B;  2HTH A;  2KTF A;  3K9P B;  2ZVO A;  4LDT D;  2DHZ A;  3PHW B;  2FCN A;  4BKS A;  2V4L A;  1XT9 B;  4GMV A;  2L76 A;  3UIP B;  3V6C B;  1IP9 A;  3ALB A;  2LGD A;  5D6J B;  4TUU A;  2KQ7 A;  5L83 A;  3V60 A;  2MW5 A;  3T9L A;  2K39 A;  2NVU I;  3N30 A;  4E71 A;  2LAS A;  4AUQ C;  1WF9 A;  4HPM B;  2DZI A;  4JQW C;  3AXC A;  2NR2 A;  3RUI B;  4YL8 A;  1PQS A;  2KC2 A;  2W9N A;  3PPA A;  4MEL A;  1I42 A;  2GBN A;  5DPR A;  3VTV A;  3SDL C;  2CU1 A;  3H7P B;  2JZZ A;  4W9K A;  3ZVV A;  5C1Z A;  1WX8 A;  4NNJ B;  4NQL B;  2O2V A;  3VTW A;  2ZNV C;  2GBM A;  2L7R A;  3O65 B;  4W9C A;  4AP4 C;  4GDK B;  3RYT A;  3A9K A;  3ZNG C;  4B6W A;  2K6Q A;  2JZ3 B;  4FAD A;  3U7D A;  2RSU A;  4EZJ A;  1WGG A;  2CHX A;  1P1A A;  1ZW7 A;  4EKU A;  4XC2 A;  1WX7 A;  4W9L A;  2LXC A;  3B1L X;  1UD7 A;  4GU2 A;  4FHK A;  4MJS A;  3UQA A;  2BPS A;  2D07 B;  2D3G A;  1LXD A;  2Y5B B;  2NS5 A;  4BBN C;  2LVQ A;  2R2Q A;  4W9H A;  2CKH B;  2FIF A;  4KZC A;  1A5R A;  1V9J A;  4BBN F;  2KKC A;  2N9E B;  3KH0 A;  4M8M A;  1FXT B;  2GBR A;  1V80 A;  2N9X A;  2I1J A;  1UZX B;  1WMH A;  2M4N A;  3APC A;  3DVN V;  3IG3 A;  4EEW A;  1Q0W B;  4G50 A;  3WA0 A;  4GDL A;  5G2N A;  2NBU A;  2JT4 B;  2LZ6 A;  2RD0 A;  1OGW A;  3PHX B;  4FN2 A;  1T0Y A;  3PT2 B;  1LFD A;  2KNB A;  3VHT C;  1J0G A;  2YLM A;  1J19 A;  4GN1 A;  2LRU A;  3OJ3 A;  3TJP A;  4G0N B;  2LVP A;  4KSK C;  4F8C B;  2AL3 A;  3W1Y A;  3V62 A;  4A3O A;  2NPT B;  4X57 B;  3CSF A;  2ZPN A;  4GSW A;  3DBL I;  3B08 A;  4LJO B;  1GNU A;  2BKR B;  2KFJ A;  2N7E A;  2REX A;  2JRI B;  2JWZ A;  1YJ1 A;  3QC8 B;  5EDS A;  1WIA A;  3CMM B;  4IUM B;  5KHQ A;  2EMT A;  1IYF A;  3I3T B;  1Z5S B;  4XX5 A;  3H9D A;  1TZ1 A;  4EOY A;  1UH6 A;  1TBE A;  4I6N B;  2G45 B;  3KYD D;  1TTN A;  3UQB A;  2G3Q B;  2GMI C;  1GC6 A;  2O2V B;  3IFW B;  1Y8R C;  2DZM A;  3KUD B;  2V1Y A;  2C7H A;  3QX1 A;  3AI5 A;  5JHA A;  3TBL D;  1S3S G;  4KV2 A;  2O6V A;  2YVC A;  4GXB A;  3UIN B;  2KFK A;  2LUE A;  2RGF A;  3KYC D;  3MTN B;  2KX0 A;  2KK8 A;  2C5L C;  4ZRJ A;  2ZCC A;  3U30 A;  4BOZ B;  1EF5 A;  5DPT A;  2ZJD A;  3PRZ A;  3RT3 B;  3RZF A;  3HIZ A;  3ZTD A;  5E6P A;  3TMP B;  3MJW A;  2LJ5 A;  2ZVN A;  1WRD B;  4KDI C;  2PJH A;  4WJQ A;  1WGR A;  1GJZ A;  1ZKH A;  3DVN U;  5L95 C;  2KQS A;  4OVV A;  2OJR A;  4GIV A;  4LDT B;  2KHW B;  3PRM B;  2ZPY A;  1TGZ B;  2IY1 B;  3ZTC A;  4LJP B;  1UGM A;  1VD2 A;  5D94 A;  1SGH A;  2KZR A;  2IO2 B;  3SD5 A;  5IA7 A;  3UF8 A;  4ANX A;  1Q1O A;  1K8R B;  1V2Y A;  2Z0E B;  3JSV B;  4PS3 A;  4GDL B;  5FR6 A;  1M94 A;  4IWO A;  1JRU A;  5DPS A;  3VQI A;  2N9P C;  1G6J A;  1HE8 A;  2DZJ A;  2MRP A;  4JGH B;  2DYO A;  2DZK A;  2HE7 A;  2LI5 A;  2FAZ A;  1R4M I;  4XZ4 A;  4MM3 A;  3ZO5 B;  2K8B A;  3R7R A;  1RLF A;  3DQV A;  3GZN I;  2IY0 B;  1AAR A;  2KTR A;  2MBH A;  3N32 A;  3A9J B;  4FA6 A;  1GUA B;  3L54 A;  4MGI E;  2QHO A;  2NBV B;  4WJP A;  1UBQ A;  3MHS D;  2FUH B;  4FJY A;  1YX5 B;  4IM3 A;  1SE9 A;  4IW0 A;  3ZIM A;  4HDQ A;  5AZF A;  4BKG A;  4KIK A;  1OEY J;  2M1M A;  1WXV A;  1NI2 A;  1UEL A;  3VTU A;  4WQO B;  4IWP A;  5J18 A;  1CMX B;  5AEK B;  2KWC A;  4HCN B;  2BF8 B;  4NPN A;  1WGY A;  1MG8 A;  5BO4 B;  3Q3F A;  3VAW A;  1GC7 A;  3C0R B;  3P2B A;  3RUL A;  4DDG D;  3VDZ A;  4JL9 A;  4NY0 A;  2O6V B;  1EO6 A;  2D11 A;  3JVZ X;  1LM8 B;  2UYZ B;  3JW0 X;  4BVU C;  2G4D B;  4ANW A;  4ZDV A;  3PS6 A;  2PE9 A;  2C7M B;  4W9G A;  4ANU A;  2BYE A;  2NCN A;  2MBB B;  4AJW A;  2BYV E;  5CX3 A;  4JIO U;  3EHV A;  3M3J A;  3HM6 X;  3B0A A;  3APF A;  3L08 A;  4ICU A;  2FNJ B;  3H7S A;  3DCG A;  3QHT A;  1EUV B;  3PRE A;  1WM3 A;  2J0J A;  4FJZ A;  5CHW A;  4B9K A;  2KWV B;  2DAJ A;  1WE7 A;  2XK5 A;  4HXD A;  2L0F A;  4J6I A;  3PV1 A;  1Q5W B;  2KXJ A;  3DPD A;  2KDB A;  1V81 A;  2HJ8 A;  2MP2 B;  3QWZ B;  3VXW A;  3WIM A;  4NAW B;  3M62 B;  3M95 A;  3IBE A;  4FJV B;  1J8C A;  3A1Q A;  3AU5 A;  3HHM A;  2KWU B;  2KTR B;  4FHJ A;  4W9D A;  4IC7 B;  2C60 A;  2IYD B;  1WGH A;  5E6N A;  2LVO A;  2GBJ A;  2BGF A;  5E6O A;  1SIF A;  2GBK A;  2N7D A;  4PYZ A;  5KHO A;  4II2 B;  3WAO A;  2K1F A;  1WZ3 A;  2KO3 A;  1WJ6 A;  1U4A A;  3ZW3 A;  5C23 A;  4FBJ B;  2AEH A;  2GOW A;  3OLM D;  1BT0 A;  4BKT A;  2PPH A;  3VUY A;  1XQQ A;  1WI0 A;  3KUZ A;  3ML9 A;  3DDC B;  3DBS A;  1C1Y B;  1P9D U;  1NBF C;  2AYO B;  1E8Y A;  1V6E A;  3QCA A;  5HKH A;  3H1U A;  3L16 A;  3ZLZ A;  2KN5 A;  2KVR A;  2FID A;  2D10 A;  2IO3 B;  1YQB A;  2ZNV B;  2LXA A;  2PEA A;  1E8W A;  4KSL C;  1E8Z A;  3U8Z A;  4HLE A;  4DHZ B;  3QAQ A;  4MSM B;  2FCS A;  2XEW A;  3RCZ A;  4AJY B;  3QIJ A;  3EC8 A;  4TQ0 A;  2ASQ A;  4HDO A;  4K7S A;  5JHB A;  1WX9 A;  3NY5 A;  3HM3 A;  4K7W A;  1WGD A;  3HK0 A;  2L3Z A;  5DCN A;  3A9K B;  1I35 A;  2JRH A;  4A3P A;  4G3X B;  1RFA A;  3PVL A;  2LGY A;  4DK5 A;  4EZK A;  2J0K A;  2J0M A;  4E74 A;  1KOT A;  1E7U A;  4E3C A;  1UBI A;  4M8N A;  2XBB C;  3A1Q B;  1H4R A;  4MJS B;  3EFU A;  2KJH B;  4BOS C;  1WZ0 A;  3DBR I;  1KJT A;  4DHJ B;  3OJ4 B;  2D2Q A;  4GGQ A;  4PS7 A;  2PE6 B;  5J2R A;  2N1V A;  3ZRC A;  3WAN A;  5AZH A;  1WMH B;  1WXS A;  2DX5 B;  4EFO A;  1GG3 A;  4IG7 B;  1C3T A;  2L00 B;  1WH3 A;  2EKE C;  4I6L B;  4NJ6 A;  3AUL A;  4ICV A;  3VFK A;  2JXX A;  2LWP A;  4MGY E;  4DDI D;  3IVF A;  5TR5 A;  2CR5 A;  3KUC B;  3R3M A;  3ENE A;  4CYE A;  5D7G A;  3L0W B;  4MEM A;  5G55 A;  3H7P A;  4W9F A;  4NQK E;  4URK A;  1QZE A;  2KC1 A;  4ASW C;  2JPH A;  4W9I A;  3H6N A;  2KD0 A;  2KJ6 A;  1LQB A;  4PS8 A;  2KLC A;  3UGB B;  1KM7 A;  4GDK A;  4DBG A;  1OQY A;  3K9O B;  3KW5 B;  3PTF C;  4WWP A;  3T8M A;  2RPQ A;  2VRR B;  1D3Z A;  1P98 A;  3ZNI D;  4FLH A;  1WE6 A;  3CST A;  5CTR C;  5AZG A;  2L0T A;  1Z2M A;  4ZRK A;  3TCA A;  2KFK B;  3AU4 A;  2V3S A;  2K8H A;  2HD5 B;  3DBH I;  3QA8 A;  1OTR B;  4RMA A;  1ZGU B;  2WYQ A;  3PLU A;  4HJK A;  4TV3 A;  4DWF A;  2IO1 B;  2NBW B;  5J17 A;  4PYU A;  1WJU A;  2JY6 A;  4KVG B;  4LCD E;  4AOF A;  3RZW C;  3VUX A;  3GOE A;  4JLC A;  3ZNH B;  3QK0 A;  2DAF A;  1OEY A;  3D32 A;  3VUW A;  3OAW A;  2A5U A;  3ZKJ C;  1V5O A;  1E8X A;  4EUT A;  4ANV A;  4F7Z A;  3NHE B;  4HVB A;  4ZRI A;  3DOW A;  4MGK E;  2UWQ A;  3ZDM C;  3WAM A;  2K25 A;  4IWQ A;  1RAX A;  1WR6 E;  1X1M A;  1IPG A;  5LLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...