1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1PTOF 4BWGB 1S5BD 1TS2A 4K6LA 1CQVA 1SE3A 4O1NA 3MC0B 3BVZA 2XN9C 1S5ED 5D3IB 1PTOB 2CHBD 1PTOH 1BXTA 1PZKD 3R2TA 1SBBB 4RGNA 1HXYD 1F77A 1JQYD 2QILA 1SJHD 3EFXD 1D5XC 1FD7D 1RDPD 1PTOD 1EWCA 4UDUC 1PZID 1FNVA 1PTOC 4RCOA 1STEA 4DXFA 1FNWA 1B1ZA 2XNAC 1YN4A 1I4RA 1CHQD 3BVMA 3CHBD 1JWUD 4C56C 1ENFA 1HQRD 1XTCD 4L63B 1DYQA 1SE2A 3EA6A 3R2IA 1S5DD 2XRSD 1SEBD 1EEID 1BCPD 1LT5D 4Z9CB 3MFGA 1PRTF 1JWMD 2AQ1B 1LLRD 1LTTD 1GOZA 3DWQA 1LTGD 1CK1A 5ELDA 1RCVD 5I4DA 1BCPC 1S5CD 1KLGD 1LTBD 1LT3D 1TS4A 3BYTB 2R61A 1LT4D 1HTLD 1YN5A 1PRTB 1L0XB 1D5ZC 1I4GA 1LO5D 1B44D 5FKAC 2AQ3B 1KLUD 4OHJA 1SJED 1ET6A 1RD9D 3BYYB 4RGTA 1HA5A 1LTSD 3SEBA 3V05A 1JCKB 1XXGA 3R8BA 3URYA 1CHPD 1I4QA 1I4HA 1EU4A 1V1OA 3OWEB 1V1PA 1I4XA 1ET9A 1LT6D 1SXTA 1TY2A 5TSSA 1RF2D 3BVGA 1M4VA 1JWSD 2ICIA 4RHSA 4ZYSA 3O13A 1PZJD 3W2DA 2IJ0A 2AQ2B 5ELBA 2Z8LA 2WV6D 1D5MC 1FNUA 2NTSA 1UUPA 4DXGA 1EFID 1PYWD 1V1PB 1PRTD 2G9HD 1QILA 5ELEA 4RHRA 4TSSA 1BCPB 4RGOS 1TY0A 1TS5A 1S5FD 1UNSA 3DWPA 2J4XA 1AN8A 2RDHA 1YN3A 2QEJC 1BCPF 1EEFD 4RFBA 1CT1D 1TS3A 1LTRD 2XRQD 5ELCA 3GP7A 1LTAD 5D3DA 1I4PA 2SEBD 1PRTC 1L0YB 1AW7A 1D6EC 2TSSA 1LTID 5FK9C 4L6TB 4NZLB 3DWAA 3KLSX 1FGBD 1DJRD 2IPKD 1EU3A 2NTTA 1KTKA 1T5XD 2O2LD 3BZDB 1MD2D 1SE4A 3TSSA 4RGMA 1ESFA 5ELFA 4RH6A 2RDGA 1G8ZD 1JR0D
chains in the Genus database with same CATH superfamily
2LZ6A 5D94A 1PTOF 2F0SA 2E2IB 3JSVA 2KHSA 4W9HA 4RG1A 2N9KA 4G57A 4M00A 4FJVB 4C1NI 1RFKA 4YHHL 1W2BA 5LXIB 1TBEA 4JK1C 2WKDA 1QUQB 2RQXA 3R2TA 4IUPA 2JT4B 4W9IA 2F0WA 1VD2A 1HNXL 2N1WA 1EOTA 1QCBD 3ERQA 3QOLA 3MHSD 3AEFB 5E6PA 4A3EH 1PTOD 3FRPB 1PH6A 2B2UA 1WGKA 2RPVA 1PTOC 4ALPA 1SSOA 5EKKA 4I6PA 4C3JG 5IP9G 3NELA 4HJGE 2UYZB 3PF5A 2KDEB 1EL0A 2GLSA 3MXGA 3OW7A 1EQRA 2HD5B 3K0YA 1KLVA 1TKEA 2C7NB 4C3HG 1EZ8A 1U0LA 3G7LA 3P75A 1VQHA 3EA6A 1RFAA 1CTMA 3I3CA 1IL8A 4DA2A 4LFBQ 1IGCA 2MRPA 3PRMB 1Z7TA 5FLXc 4TVAB 2UUAL 3J81c 5M5YH 4DR2Q 3N1XC 1QKZA 1Y1VB 3H0GB 3JC66 5FO7B 1JMCA 3DEPA 2WU5B 5GQOA 3A9JB 2ZW0A 1HEZE 3A1QB 4AQ7A 2N0SB 2HTHA 2M17A 2KXJA 4C7ZA 4YTMB 3AMUA 2Z9HA 3KW5B 1S72A 1SB3C 2VB3X 1KJTA 1LO5D 4JQWC 1J8CA 1K53A 1JE4A 5CGKA 3K80C 3QOJA 4KKIA 3Q6BA 4JW0A 4RKBA 4HPLB 3U30A 3HRDD 4IW0A 1RLFA 3R8BA 4BAXA 1JB3A 3HVZA 2X6LA 5IP7H 4R3DA 1A8VA 1V1OA 3WCQA 2RR9A 2Y0SG 3NVZA 3KK7A 2BS4B 4WWMA 3RD4A 4DK3C 4LWCA 3KWVA 3AV8A 4ZRQA 5LMNL 1C79A 4EOYA 4MZ9A 2NBFA 2XGTA 3RZDH 3J80i 1UUPA 4GKJL 1HJPA 2XTIA 2LWPA 3NS1A 3IHPC 4WJ3M 2N9LA 1GO3E 2G9HD 3T16A 1QILA 3L9AX 1ASYA 1Y1VG 4ILWA 3J7ZC 4JWUC 1A2UA 5E4XA 5C3EB 4BVUC 3VR2A 4QMGA 3KFUA 3DLLA 1WSPA 3HP3A 3S1MH 3RUZA 1K8AC 1M8AA 1FXAA 1MVKA 4IUVA 3TP6A 2F0EA 3KJPA 1II3A 4B3TQ 2WHIA 3GD7A 4DAMA 5L95C 4CGYB 4P6VF 3K8AA 3KLRA 1SRUA 1K8GA 4DUYQ 3E0JA 4A3DB 3EGRA 3FAHA 4LUZA 3D4WA 4OGQC 2ZT9C 3WDNA 4HRSA 4BY1B 1EF5A 2JXXA 3L0WB 1XJVA 3W9CB 2J7QB 4HSPA 2Y0SB 4C3HB 5J3BA 3V3XA 2NCNA 3HGBA 1K73C 1YZ6A 3UIOB 1B9NA 2WACA 2MA9B 3TZUA 2NPTB 3FMCA 1B70B 2CKZB 2EXZA 4GLVB 1QZEA 3ULPA 4F7XA 2LSSA 1XWEA 3HHMA 2UXCL 4P7IA 2K5WA 2IGDA 5C3EG 4KZCA 4O1NA 1KDCA 3CRKC 2LXJA 4C3IH 5LHY1 2HHHL 1YOVB 2TMPA 2INPE 3H7PA 2ZTEA 1EWHA 1UEBA 2EYHA 2F0KA 2YV5A 4UPAA 4YY3Q 2CKHB 3B6YA 2JA5G 4XT1B 1RWSA 1HNXQ 2ZNVB 4TRDA 3K57A 1HZ6A 2B3AA 4BZAA 4DXFA 2PTLA 1FD6A 4ITKA 3S15H 1IYUA 1WIAA 3K59A 5IP4D 3KLSA 1A3UA 1QVCA 3BVMA 3GTOH 2ENBA 2DUDA 3DUZA 2BYEA 2DYOA 2K8BA 1ZOYB 2D5GA 3IVFA 4A93B 3R2IA 3C0RB 1KF6B 1TJEA 1QWYA 4N59A 5IN7A 4S17A 2N55A 5AZHA 1WF9A 1BCPD 3FC4A 1N34L 1LT5D 3DM1A 4H13C 3K5NA 5JVH3 5C0XI 1VQPA 3ABVB 1G51A 4IZ8A 2L00B 3U7DA 1GOZA 3JVZX 3QIJA 5D2MB 1TTNA 1WD0A 4DR2L 4JOIA 4MNOA 1ICFB 4FA6A 3P4SB 2LGXA 2YTXA 4FF3A 2M4NA 3A8KE 3S2HB 1JJCB 1VQDA 2QW7A 2CHWA 3QA8A 4IPGA 2KDIA 3S14B 4S0RA 3R7QA 4MJSA 5M5YB 4HKQA 3HOUG 1CKOA 4BFRA 4E6IA 1I4QA 1Q8KA 1VQMA 4FF4A 1NI2A 2F0MA 5G5GA 1JICA 2Z6KC 1YNTE 3Q8EA 4BOSC 4HXDA 3HM6X 1JRUA 5AUIA 5M5XB 4FVMA 4LK1C 5D65A 3GTJB 5IOIA 1D4BA 3R7RA 3H0GG 1DONA 1PZJD 3SK8A 1A3VA 3W1GA 1CFMA 3M7GA 1EIGA 4C1NK 4R4QA 4DR1L 2LI5A 5IKCM 4A8XC 5HHDG 3RZDB 3NY5A 2I2YA 1WGGA 3CCUA 3VYRA 4KGTA 3G6JB 4P75A 4LF4Q 3VHTC 1E8ZA 2HIXA 3OTOL 3GTJH 2QIEB 2JU6X 2KQSA 1X56A 3NBHB 4DNIA 2O2VB 3CAMA 3ML9A 5D3DA 4XYOA 1IYFA 1KAAA 1H9SA 5IYCH 3FILB 5J2RA 2BQQA 1N9WA 2QKIC 3V61A 2VL6A 2ZVOA 4HJ8A 1IKMA 4RMFA 5JJIA 2DBYA 2WDRB 1L1OA 1C1YB 2KVMA 4JBMA 2NTTA 4DUYL 3UQAA 1UEAB 3D8GA 2WXJA 2HIVA 5M5XH 3WA0A 1PXUA 3WAOA 2L12A 1MI0A 2PQAB 4ME5A 1AE3A 1D8LA 1Y1VH 3AFQA 3Q24A 4DR6L 4G7ZC 3J9CA 3NP8A 1I50B 2A5HA 2WKCA 2AL3A 2YYZA 1WX8A 5F2DA 3B9JA 1XTDA 4B3MQ 2VQFQ 1Q7YC 1H4RA 2JVCA 1X32A 2QCZA 5FO8B 3UI3A 2QGQA 4A4IA 1IBXA 2X6GA 3S16H 3CCMA 1J5EL 3T9LA 2JUOA 2DY8A 2RA4A 4WRDA 1O7ZA 4OWTB 4BKSD 4X3UA 2E2DC 3CP0A 1IYVA 1KNEA 2CHZA 3NSWA 1NAPA 2PE9A 2WB1B 4KKUA 1QZGA 2DY7A 4UDUC 4MGKE 1PUTA 1U4AA 1V81A 1I50H 5NUCA 2A74C 2NVQH 3AMZA 3SDLC 4X66Q 2GBRA 1Y8NB 3D0FA 3ULLA 2ZJQA 3HK0A 2K7VA 4B9WA 1YN4A 3GO5A 4YSXB 5M3MB 1HQRD 5IT9E 2LS01 2K8CA 1DYQA 2OQKA 4PYZA 3Q0AA 2V0GA 3L10B 5GXGB 4F1SA 1S5DD 3A5UA 1SEBD 4QIWE 2EKIA 5C6AA 2WGSA 2K05A 2OTLA 1R4MB 1SSNA 4KKJA 3HOYG 4E71A 3UGBB 4IFDJ 4JV5L 5GROA 1UD7A 2E3TA 3HUIA 3ZNZB 3PO3H 1N34Q 4AH6A 5J18A 2NN6I 1TWHB 2MBEA 2I07B 2R7ZG 3DVGY 3IT4B 3NWSA 3PPAA 3ZJUA 1XPOA 4MIUA 2OF1A 4FXDA 2CJOA 3DBLI 1N61A 2KJXA 2B29A 1L0XB 2EJGC 3BZCA 4FXGC 4BY1H 1K3BC 3HKZB 2XWBB 2RCNA 3ZW3A 2MP2B 4PZ7A 4BXXH 4HEA1 2VZKD 1JW9D 3BK2A 2F4IA 4Q5VA 2WB1G 1XCQL 1EWIA 2NZHA 1S40A 3UDGA 1WXMA 1I4HA 3BK1A 5FOBB 4R4OA 1EU4A 1PHJA 5IYBH 2WAQB 2A1AA 1GC7A 2KJ6A 2BE5D 2DGYA 1PGXA 4TQ1A 2R93B 3R66C 1SE8A 3J81E 3S15B 5FLXE 1W6JA 3O13A 4ZRJA 1MSHA 4GLXA 3VTUA 1CSPA 1T6BX 3TP5A 1FNUA 2LRUA 2N9PC 3IAS1 2D5DA 3BDLA 4J8QA 4QJFA 4LJZC 5EPJA 5AUKA 4N8FA 3TL5A 2CW0C 3S2DH 4B6WA 1HFNA 4ULLA 1X3FA 1WXVA 3V62A 1EQTA 1GUWA 1X9NA 4EEWA 3DCGA 4L2YA 4BBSG 5EKIA 3I70A 1F2ZA 2DJGC 2QEJC 1ZP0B 1TS3A 3NQTA 2KA7A 4DV5Q 1AH9A 2EKEC 3RNEC 3P1HA 4GU2A 5FLXL 4EQPA 4EFOA 1WZ0A 1LTID 3I4NH 1KXLA 3T56B 2OXPA 4CDDC 5AJ3Q 1YX5B 1FGBD 1L1OC 3A0JA 3OW2A 3CMEA 2IX0A 4HROA 4C3HH 3VH4B 4A93H 4PT5A 1ZDVA 3T3OA 3F2BA 4GN3B 3NPPA 4KY6A 3RPFC 1VR9A 1DZ1A 2LMCB 1ZDXA 2WX0A 4A55A 4RGMA 1GB1A 3FKIH 5ELFA 5CX3A 1G8ZD 5C3XA 2BT6A 3RZWC 1JR0D 3CPWA 2PKOA 1GG3A 5C2TB 1WRDB 1E8WA 4GXBA 4WAFA 2GBKA 4ZUJA 2E5LQ 4DR6Q 1CQVA 4QCLA 3DWGC 4JI8L 1F9QA 4XTCS 5IO9A 2NB0A 2ZCCA 3VH3B 3VYTA 2E76C 2OHFA 2VQFL 1J8IA 2A69D 1SBBB 5G2NA 1GVPA 1KRSA 1HXYD 3HKZG 1H9KA 2WXFA 3ZJTA 3EFXD 1J5EQ 3M4OH 2FCQA 3K5LA 1E1OA 4H2AA 2V4LA 4N9TA 3EN2A 4RWSC 1GJZA 1TT5B 2K6DB 1IKLA 4GKJQ 2JSOA 2DHZA 2EQSA 2G9DA 4CKBA 5CC4A 3IFTA 1VQAA 2PW7A 3Q3OC 5CV6A 3KDFB 4X3TA 4NPNA 1WR1A 2RPQA 3OSOA 1PDQA 3TEXA 1C4CA 4A90A 4ASWC 3ZVVA 3I4NB 4IJHA 4IM0A 5KGUA 4WFN3 2VQEL 2DYMA 1SR3A 1F0ZA 2AQ1B 2CS4A 4XQJA 2PEAA 1KNAA 1HNWQ 1EY4A 1E2VA 1TWAH 3S1NB 4NB3A 4M8NA 4A20A 4IFDG 1OEYA 1TIFA 1J9OA 5LL6S 2ZJPA 4MM3A 2K0PA 4KVGB 4XYQA 2UWQA 4DFAA 3BYTB 5M5WB 2KJRA 4JV5Q 2YEPF 3HOZG 1HH2P 3K5MA 1Q82C 3V2TA 1PMRA 3TN2A 2CHXA 3BDCA 4K8IA 1K0RA 3A33B 4LDTD 3IBEA 1WJ4A 3KJOA 2FHTA 3DHHC 2K39A 2GVAA 5ELNA 1R4NB 2D11A 4MTKA 1GUTA 2IGGA 3NBIA 2DNFA 3L17A 1KL9A 2RHQB 4POFA 3GTGB 1OQYA 3LGJA 5K36H 2J0MA 4QB4A 3AEVA 1XPRA 2E2HH 3CIRB 4XDDA 1GJXA 2JZPA 1CJEA 4DAPA 1K8OA 4P2CB 5G3LD 2HHHQ 5C4JH 4NQLB 5FLMH 3HKSA 2GVBA 2X8XX 1UE6A 4A3PA 1ZGUB 2HDLA 2UXDQ 1XLOA 2MLBA 1TY0A 3GTMB 4CO7A 4QUCA 3OMGA 3ONAB 2BYVE 1CI3M 3HOXG 1V86A 1PH4A 2YU9H 1BUIC 1WOCA 4A3EG 3PUYA 4F88A 4AS1A 2K6QA 4NAWA 2JWZA 2KLGA 3BG3A 5BMHA 1LTAD 1P16A 2A73B 2D0OA 1E5WA 1S3OA 5FK9C 1PH7A 1UAPA 4KDIC 1AFPA 5MPOA 3QARA 2ZPNA 3WOEA 4WWOA 4CHKA 1C48A 1EM7A 4P16A 3EECA 2IYDB 2RSUA 2DLBA 1NYRA 2I1JA 1CKMA 3OJ4B 4L1BA 4A3CH 3TJPA 3CPFA 3L7ZC 1KRTA 4A3FH 2A5UA 1LUZA 2B8FA 1RIPA 1AEXA 5IYDG 1SN8A 3F2UA 2WQYB 4G50A 4IM2A 3W1SC 2E75C 1YJJA 4BY7G 4NJ6A 2DZKA 3KYHC 1E6EB 2G3QB 3GTKH 3TIXA 2ICEC 1S3SG 3N9YC 5GMVA 2KDFB 1AE2A 1ONLA 3CCLA 1PTOB 3TS2A 1PZKD 2L11A 3QWNA 2E5LL 1Z5SB 4RGNA 4MHEA 2RMMA 3ENEA 4ANXA 4DDGD 4JI8Q 3AFPA 4NMZA 1B7YB 1XO3A 2NUCA 3A56A 3HOUH 1VQ9A 2GA4B 3X23A 4JI7L 1TKYA 5BYRA 1A3TA 4ARCA 1EY5A 2NBVB 4OVUA 3E9HA 2F0QA 4DR1Q 2DZIA 1IP9A 2K4KA 2RVLA 3IL8A 2K5DA 1I4RA 3SDZA 4IG7B 1SYBA 1ENFA 1E22A 1U9RA 4HTHA 1XCTL 1CM9A 4LF4L 3VTWA 2FMMA 2H5XA 4R9WA 4TKNA 3J7YW 5LMNW 2K50A 4GDLB 4G0NB 3PREA 1GD7A 1V1QA 1XNRL 2AKWB 1Q1EA 1SIJA 1WGHA 3STBD 3DBLB 3RFZB 1Z6HA 2R6GA 3LWEA 1SNQA 4A3BB 4RCNA 4DXAB 2VQEQ 1LGRA 3BZKA 2D3CA 5DAUA 3NG0A 2HE7A 4LLGM 4K2KA 3MJWA 2C5CA 4DV1Q 2JA6G 4Q0FA 1GNUA 4ZK9B 1KLUD 1FCCC 2C7HA 2Z59B 2BDNA 5C4XB 4K81A 1IYJB 1NVID 4WURA 2B2TA 1SNMA 3HOVG 4NJCA 5EE9A 3FPPA 4JI1Q 4DV7L 3Q3JA 4KGSA 3I72A 3SU8X 3H8HA 4XXEA 3RNCC 1B8AA 1XEEA 4IFDH 4LNNA 3TEYA 4RF0A 5IIFA 4HIKA 5IYCG 4B3ML 3VR4A 2FFKB 5COYA 2QCPX 5ELBA 2KECA 4FJYA 2ZZPB 3QIAA 3S17B 1NR4A 1PFMA 2XIWA 1VQCA 1LV9A 2NVTB 3KUDB 3S14H 2MBOA 2J0TD 4BKGA 3PO2G 2EJFC 3E9IA 2JK8A 3G48A 4TSSA 2QHOA 4YXDB 3UDFA 3DBRI 3J7AV 5C44H 3HOWH 2WLBA 3C19A 4FXCA 4YTNB 4ZCKA 3CMAA 4ZRPA 5EBCA 2UXDL 1MPEA 4OELB 2FUG1 1RAXA 2C7MB 1NTGA 1LTRD 1Y8OB 1ZE3D 2E2HB 1F52A 3GTQB 2PJHA 1Y1WB 1WYWB 1JT8A 2GMIC 1I4PA 1SMYD 2SEBD 4I7AA 5C4XG 3WIMA 4JCVE 4B3SQ 4DK5A 2BH2A 1DD2A 1PH5A 3Q3FA 3EQLC 3UQBA 5CV4A 3L54A 2JA7H 1SLJA 2HJ8A 1VCIA 2LJIA 4PV1C 2Q8TA 2DAJA 5DM73 1EU3A 2EOTA 2K5VA 2XVSA 3OG5A 4PYUA 4DHJB 1MBYA 2O6VD 2JN4A 1W3SA 3ITPA 3BZDB 3PHXB 3RNFC 4EGVA 2B2WA 3H3VH 2FIFA 4US8A 3FKIB 3PO2H 3TS0A 3I5JC 1U4PA 4A3KB 1L0VB 4XYCA 4B95A 2F3WA 1LQBA 1VQ6A 4XE0A 2A6EC 5IGGA 3HG9A 4GOPA 2GBMA 2N8NA 2K1FA 1ILPA 2IY1B 2PZUA 2KYWA 4K6LA 3VYSA 3GTKB 5C5MA 4KD4A 4MN3A 2IO3B 3AEDB 4CJ1B 1OQRA 1HR0Q 1X3EA 4NXNL 1YMHE 4K5WA 4C3IB 3GTMH 1CKNB 4RAUC 5IGBA 1D7QA 4W9GA 4A3DG 2WXPA 1JQYD 2FMCA 2CFMA 1OFFA 2EY2A 2BKRB 3NVYA 3K6OA 1D5XC 1WJJA 3UE1A 1EWCA 4JPSA 1OXUA 3SVMA 4YSZB 2K5QA 3NE5B 2IDYA 2RSOA 3A54A 4NJ7A 2G4SA 1A62A 2XNAC 5AFWA 4IURA 1XT9B 1TKGA 5E7NA 1ILQA 1XTCD 4PZ6A 2NBUA 2NBWB 4EUTA 4F8CB 2K52A 2QDBA 3IKJA 3RLOA 4A3DH 1FR3A 2LGIA 3N1ZC 4HK2A 1EEID 1VQNA 3TRZA 2EVBA 3DHGC 1OXTA 3H0GH 5H1SE 2KQ7A 2MCNB 5FO9B 2K9XA 4EX5A 4A3IG 3C1FA 1BQQT 3P2BA 4TUUA 3DWQA 4DV5L 1RKNA 2B63B 2KJHB 2K01A 1XNRQ 3SK6A 3KUPA 1PH3A 2KDMA 2L52A 3I4MH 4MGIE 1LT4D 2AWOA 5AJ3L 4MELA 2IX3A 2B2YA 1VQ5A 1VQJA 2J0KA 4HAEA 5FKAC 1RODA 2JA8B 1I6VC 3PUZA 3GOEA 3KH0A 4DK0A 1WH3A 3STBC 4HJKA 4C4VA 1LTSD 3S2AA 1JCKB 2K28A 5BN4A 2KO3A 3N3KB 5J39A 4DV1L 5DPSA 3URYA 4XGAB 3RZFA 2VB2X 4HEDA 1XLPA 3NTKA 3M3YH 5BN5A 4WORA 1G6JA 4OL7A 4JI1L 4DV7Q 1TXYA 1FXTB 3H15A 3TEHB 2QJLA 3L0OA 2XK5B 2HQLA 4LK0M 2WWZA 2SDFA 1O7YA 2LHDA 3W2DA 1ZPSA 4C4VB 2Q2TA 1QG7A 1N33Q 3B0AA 4FNFA 2KOLA 4QAYA 3W5OA 4GB9A 2LKVA 4JGHB 2WFWA 3J7A5 3S1QB 2SOBA 5M3MH 3FVQA 3AECB 1F9PA 1K83B 4J15A 3K7AB 1BKBA 1TS5A 5CV9A 1YI2A 4ZRIA 2B63G 1TWAB 5T1GA 4GN1A 5FJ8G 3JAME 1B9RA 2WDVB 3HOVB 2PW5A 3NTHA 1XLNA 1VQ8A 3TDQA 5DM63 3MHZA 4RM9A 1B50A 5T8IA 2KTFA 5ELCA 2Z0EB 1PH2A 2D10A 1D6EC 4LFAL 2TSSA 5E6JA 4DAYB 4NZLB 5IY0A 5EJWA 2JZZA 2EIFA 2A19A 2AL6A 4TQUS 4CJ2C 4HVBA 4PMBA 3I8ZA 1YQ4B 1UH6A 1VMPA 3GZNI 5HGQA 5HGTA 3JAMc 1HNWL 1WFQA 2MH7A 2L3ZA 3J81j 1WTOA 3FDTA 3ZJYC 3DHIC 2B8GA 4EQ5A 2EYPA 3APDA 2MHJA 4AOFA 2KC1A 3L16A 5M3MG 4ANWA 4A76A 3CWIA 1ENCA 4NDXA 3P63A 1MG4A 3AE2B 2WU2B 4B9KA 1TS2A 3ZO5B 2H1EA 4X62Q 1XMQQ 5KYLA 2AUKA 4KLKA 4K2LA 1I7HA 3WALA 5CHFA 1JB7A 3S2DB 3HOYH 1VCBA 4IO9A 4LNQA 4ZDVA 4IPDA 2IHFA 5C4XH 1OTRB 1H9MA 1SNCA 4LNKA 2F0VA 3F2CA 4GKKQ 4NXNQ 1JJGA 1G91A 3GE8C 3DVGX 1BR9A 2D0PA 4RM8A 3E9SA 2BS2B 4NKLA 2BW2A 2R93H 1L1OB 2IHEA 1WJ6A 4G7OC 1Y8RC 4P72A 3A1QA 1WCMH 2INDC 3AI5A 3CHBD 1FFVA 4IOAA 2PNHA 1VQBA 3A9JA 4GOCA 3GTQH 5IGDA 2MBBB 1WYDA 4JIOU 4CKCA 2VH1A 4LF8L 3ZNHB 3WANA 2FBWB 3HIZA 4IUTA 3I55A 3B1LX 3SE0A 2KEEA 4S3SA 4AP4C 1D1KA 3K9PB 2DAFA 2KANA 3AE6B 4WJOA 3FP9A 2ALYB 2BB6A 4HDQA 1E1TA 4WJNA 4Y7NH 2VS1A 1LTGD 2IBIB 1CK1A 1HQMC 1UGJA 1HPCA 4KSLC 1VQGA 4A9AA 1SROA 2K32A 5IODA 2B2YC 2F0NA 5IE8A 2EMTA 2CU3A 3BWUD 1BBWA 3L2PA 3P4PB 3TP8A 2FJ2A 2OOBB 1RTOA 4JI0Q 3K9OB 3UIPB 3ZKJC 4QY7A 1OXVA 4C3JH 2LGYA 5KHOA 3V05A 3M62B 1PFNA 1A15A 4A93G 2KKCA 1MJEA 3AH7A 1EQVA 3L4PA 3K0XA 1WE7A 3P20A 3SFDB 1HRJA 1J7BA 1TZ1A 1YVCA 1FVIA 3Q23A 4QUFA 1TT2A 1CMXB 3LYYA 3WOFA 2EZVA 1FRRA 2MUYA 4M8MA 3TBLD 4DV0Q 4JLCA 4MGYE 1E2WA 4RNAA 4C2MH 4DXGA 4WAAA 2ES2A 1PYWD 4FP5D 2KNBA 1NMGA 1STHA 3IAM1 4KI0A 5A2QL 1N33L 2PIAA 1E90A 1L5PA 2BF8B 4A3CG 3RLNA 4GOPB 2V3PA 1WM3A 3E56A 1CSQA 2F0FA 2J4XA 4JI7Q 3DBHI 1TWFB 1V97A 1JE5A 1PDXA 3PLVA 3JW0X 4ZHOA 2OQ0A 3RNAC 1DOLA 4LNOA 4HJ5A 4G3XB 3P4QB 2KC2A 4A3IH 2K03A 1UWXA 1KRHA 2OJWA 2ZXOA 4KIKB 3A74A 4YT0B 1BO0A 3I4MB 2KN4A 4ACFA 1H8CA 3SHQA 4PK1A 3MC8A 1VRAB 3N30A 2YTVA 1J19A 4KTAA 1LACA 4LFAQ 5DCNA 1TU2B 1YNJD 4EZKA 5IT9L 1KDAA 3M85A 2L7RA 2ZVNA 4FXKC 2K22A 4GN4B 2WIIB 4P71A 4WJWA 2WXLA 1YX6B 1SYEA 2EPBA 2KLCA 5E1FA 4UP8A 1S5BD 2F03A 2MPMA 4KD3A 2EYOA 4FF1A 4BBSB 3MFYA 3MEFA 1GB4A 2AWNA 1Q0WB 1X3GA 1FPYA 2ZJDA 2CHBD 1NSNS 3PQIA 5DPWA 3PV0A 4JI5L 2KMAA 5BMGA 3MXPA 4B0MA 1VDZA 1AZQA 4P74A 4FDBA 3EHVA 1I6HH 3J7AF 2JYEA 5BMIA 3DQVA 4IDIA 4H44C 2L9HA 3PUXA 2B63H 1HZCA 1STEA 5HFYA 3QJYA 1SNOA 2NZ1D 2E6XA 4KDLB 2KHIA 1L4ZB 2KQ4X 5JAVA 4FO2A 1B1ZA 4ABNA 2BA0A 1J7CA 2LUMA 3PVLA 2ACZB 2IT1A 4IQZA 4AJWA 3N6RA 1SE2A 1C4AA 5LLIA 2CH4W 3PO3G 2WDTB 4OO1I 5HG2A 2KCNA 3GV6A 4DBGA 1HZ9A 2MJEA 1K8MA 4GSWA 4W9DA 1PRTF 1B9MA 2B76B 2YEPB 3M3YB 4DAYA 1IXRA 3NEMA 1O7LA 4E74A 4B3SL 1HTLD 2D62A 1GUGA 2EY5A 4K14A 5IYDH 5GAGC 1T0RC 3AE8B 2CJNA 3I9V1 1GUSA 4HWIB 1PH8A 4LF7Q 1MJCA 2R3ZA 5CBAE 2JA8H 3CCSA 3CF6E 3C1EA 1C78A 4A3EB 4F7ZA 4K3CA 2D07B 5CHWA 1EOVA 3ND8A 1J6QA 1J7AA 3VR6A 2RCFA 2WXGA 5H8YE 1IW7D 3DVNV 3VUWA 1WI5A 1NNXA 1UE1A 1MGSA 2LXCA 4P73A 3CCJA 3E6ZX 3VRBB 3WAMA 1WXQA 2D2CC 1HR0L 1HZAA 2INNE 2UUBQ 3A4SC 3CSTA 2PQAA 4XDXA 3QAQA 2GB1A 4YWLA 1EFID 1KABA 1YNJC 2G5DA 1EY9A 2JEBI 4AYBG 4CKEA 3HOXH 3CQZH 1HNZQ 3BINA 3DM3A 3U4ZA 2NVXH 1R4PB 1K83H 4O0AA 1PH1A 2JA7B 2DNCA 1H95A 1SIFA 3M95A 3NENA 4ODGA 1AYFA 1HHVA 3IG3A 3RN9C 3U9OA 1UNSA 2N7JA 1NE3A 1STNA 1PLFA 3HEJA 2UU9L 3M4QA 5ISRA 2RDHA 2KTRB 3N1YC 4KHVA 4DV4Q 1CT1D 2AUJD 3ETRA 4OZBA 2GRIA 3EC8A 3ZRFA 1C9OA 1B53A 4YWKA 2WAQG 3K81C 5JH5C 2F1MA 5GAHC 2I1KA 2MQJA 1JWAD 1QNUA 2A4ZA 2JZ3B 2BPSA 4CBVA 3N20C 1P9DU 3CC7A 2M9VA 3HKZE 2OTJA 3AE7B 2R92H 3V60A 1LABA 3ZTDA 2PMZB 1ESRA 1E3PA 1ZYRC 5I2XA 3F8TA 1HR0W 4C3JB 3HOVH 4NAWB 3VQIA 2DX5B 3OJ3A 3TZDA 1Z9FA 1G6PA 4UAIA 2IWHA 4DAVA 4DKAC 4ZQ3A 1EF1A 2GOWA 2B2VA 3GTPH 4QQBX 1YITA 2A6ED 1NMFA 4A3MG 2B2VC 1SNPA 1QE6A 4DUZQ 2KX0A 1FEHA 1EQQA 1OXXK 4KGRA 1UF0A 1SE3A 1T0YA 4M02A 5C1ZA 3AEEB 2FXQA 2CQOA 1O7IA 4OIKA 1N36L 1IW7C 2I5HA 2PNRC 2CCZA 2BWES 3IXSA 2NN6G 1GUAB 3U7ZA 2F0TA 3KLWA 1E7VA 1F77A 2ZEQA 2JJQA 4RA8A 4QF4A 1CKNA 1E2ZA 3KVFB 2LMCA 4JI5Q 1BBUA 5IGEA 4DV6Q 1WMHB 3NOBA 2F52A 3EVQA 4LUVA 4YCUA 4L5RC 2IW3A 1FNWA 1N32Q 3T3NA 5LMUL 4HPMB 1VMCA 2JE6I 4ID6A 2F0DA 4YSYB 4PS8A 4I6NB 1YNXA 1T0QC 4JE3B 1ENAA 5C3WA 4KN4C 4XC2A 1KIXA 2K8HA 2R7DA 1WJUA 3MFGA 3M63B 2L8JA 1I94L 4K1RB 4O2DA 4M01A 1STYA 3PMFA 3EFCA 5ELDA 3X3NA 1TWHH 3AE1B 1RYJA 4KKSA 1EUVB 2BGFA 5IAAC 4YIJA 3GTLB 4CDCC 2R61A 2M0AA 3PGEA 4C00A 3PO2B 5C5LA 1STGA 2PMZE 4IFDI 1D5ZC 1VLBA 2KWDA 2M8SA 3H6NA 1GC6A 2EJMA 3GQBA 3SGIA 1G2TA 1LXDA 2KHWB 4X57B 2HQEA 3KDFA 4GNXC 1AP0A 1V8QA 1VDVA 2B2WC 4BA1I 1RD9D 3BYYB 4WQOB 3U52E 1PGAA 4B9XA 4KHPQ 5IGFA 3SEBA 1QZHA 1GHJA 1U4LA 1OQQA 2LY7A 2VNUD 4LF7L 1I6HB 1P98A 1QOAA 3H7PB 4FJZA 4EZJA 2KUMA 4JPBW 1L2FA 1BUVT 2EYLA 3QC8B 1SXTA 1RF2D 1UWMA 4GS3A 1MHXA 2AX5A 4X62L 4U673 3CCQA 1XMQL 1GKHA 3MAQA 1IGDA 2W3RA 2MQHA 4DF7A 1FFUA 2JRIB 2F0IA 2R2QA 3EFUA 2KOXA 1JC7A 3M4YA 3U50C 2K33A 4BBSH 1WI0A 2F0GA 4ZRZA 2JQRB 1P0RA 1A63A 2WXRA 4GKKL 1VZ6A 3PZ7A 2EYJA 2UUBL 3S16B 1Q5WB 1V5TA 3WAPA 4HIOA 4G11A 1V9JA 3K7AH 2QMTA 3R3OA 2R7FA 4HJAA 1CA6A 1HNZL 1JROA 2XWJB 3X0WA 5D14A 2F0UA 1YHQA 3NUCA 4PZ8A 3GS2A 3ML8A 5CV5A 4XDCA 1BCPF 1E8XA 1O80A 4RFBA 4WJQA 3MXNB 4ANUA 4N9F4 1VZ8A 1TWGB 2JX5A 2JY6A 4K7SA 3HRZC 4LUOA 2NMQA 4OVVA 2SAKA 4H02A 4DHZE 3P1MA 4W9JA 3ZDMC 4PMWA 4LF8Q 3TCAA 2BDOA 5ELOA 2KCCA 3CCVA 1U5KA 2KVZA 1T5EA 2L76A 2VUMG 2HDMA 1EYGA 2JXMB 2Q8RE 3S1NH 3A55A 1XD3B 4HN7A 1BT0A 3Q3MC 1PA6A 2LRWA 2O4XA 2RF4A 2O2LD 4GDLA 1WM2A 1YQ3B 2DNEA 4LMQD 4I6LB 2IO1B 2FINB 2RDGA 2EXDA 1T0SC 3D31A 2JRHA 4KHZA 2LVPA 4BWGB 4DGZA 5I2YA 4OW0A 4G4KA 4V0BA 4JI0L 2N7EA 2FUHB 4FN2A 2C60A 4P1BC 2EE1A 4HPPA 3S1RH 3M3JA 1Y1WG 5D3IB 2ZNVC 3JAMi 1SYFA 2NN6H 4DUZL 1VZ7A 3VUXA 3SHLA 2G45B 2KWUB 3D6CA 2K75A 2QILA 5DPTA 1TVXA 1NENB 2W82A 1WVLA 2O5JC 2XK5A 2HDEA 3R3MA 1V9PA 3VUYA 2VXWA 4XQNA 1UZXB 3NUHB 1OTCA 4LFCQ 2IX1A 3VDZA 4DV0L 2K5NA 4DHJD 4AIMA 1X55A 3RZOH 3AE4B 2KT7A 4DV6L 1QQRA 1JORA 4A3KG 2MP2A 3OIQA 3Q69A 5J17A 3EROA 2CQAA 2BB5A 2F4VQ 1N32L 5C0XG 3MVVA 3K7UC 2PYKA 3K58A 2PQEA 4OVZA 2KBNA 2O2VA 4WIPA 1VQIA 4DNTB 3NBHA 2ASQA 2G1EA 4DHZB 3AEGB 1K0SA 4JI2Q 1TR5A 1Y69U 2JXTA 2E8GA 1S5CD 5CTRC 4AWJA 1YHBA 2CVRA 5IT9c 1TS4A 1LM8B 1XYIA 3LJ3A 3GTLH 1PRTB 4NAMA 4A3KH 1YJ9A 4IWOA 4I65A 5C44G 3HOWG 4FHJA 4JX1C 1ET6A 2MO0A 4QL5A 3I56A 2Z6BA 4FF2A 2A6HC 3E0EA 3MXUA 2F0PA 1KOTA 3I2ZA 2H4OA 3QR8A 1WTVA 3RCZA 2Z6KA 1N63A 3ZXVA 1LT6D 4DR7L 4BOZB 1UE5A 3PLUA 3T1YQ 3FHWA 1KM7A 2KFKA 2WP9B 3T4AC 1JWBD 2XBBC 4PNYA 3AB9A 4XWWA 2IO0B 1WZ3A 5D6JB 3OYYA 4N8X1 5HKHA 1VQ4A 1ZKOA 4CDEC 5IWAL 3QX1A 3KBGA 1SMXA 2BYTA 1V2YA 3NK9A 1C9FA 2IO2B 2MX2A 5FR6A 2E74C 3I73A 3ALBA 2EYMA 5JJLA 1K9MC 2FNJB 2L83A 2EYFA 2KACA 4RGOS 2LEKA 2Y5BB 4HJ7A 3H09A 2WB1E 1ZUD2 3EIVA 1PGBA 1TWCB 3PTFC 3SXHA 4JBKA 1ZYRD 4FBJB 4L5SA 2N4FA 4LCDE 3Q8AA 4AUQC 4WWPA 2CH4A 2WINB 4HCEA 4UP7A 2JA5B 2J52A 4MGZE 4PG3A 2JA9A 1F1HA 2LXAA 3PV1A 5CMDA 4J1MA 4ZUIA 3NVWA 4MM3B 3KLSX 3T8MA 4ANVA 5C3EH 3TMEA 5CV7A 2KCTA 1EWYC 4ZKCB 4XWTA 1KQSA 1QNKA 3TSSA 4IKGA 4EE2A 3AU4A 5DEHA 4II3B 5TR5A 5BN3A 2L4NA 3UI2A 1SFOB 5CBEE 3VYUA 2JA5H 2BCOA 3AE3B 3S24A 3AEAB 4L5TA 4IALA 2DZMA 2WDQB 1PFBA 2R7ZH 2Z0DB 1HTOA 2MWSB 1EYCA 4EKUA 5JEAG 4K8JA 2PLPA 5IGCA 3PZDA 2VZAA 5EE3A 2NYZD 1ISNA 4P1CC 2NVXB 3ICEA 5M3FH 3P42A 2H88B 4YWGG 5KRUA 4QIWB 1IBLQ 4MH0E 3RMHA 1DGSA 4GLAC 3D3RA 2MSED 4US9A 5C23A 4DU9A 4A3JB 1PYBA 1M1KC 1T3QA 3SD5A 4DR4L 2CW0D 3DBSA 4LFCL 3DPDA 4F87A 4MACA 3S17H 1B3AA 3OAWA 4OWWB 2ONQA 4FLHA 1SNDA 2XRSD 2UU9Q 1QOHA 4NXMQ 1F9JA 2V1YA 4B08A 4DV4L 3HZXA 2F0LA 2DJFC 1LTTD 3QHTA 3QO2A 1QT9A 2DENB 2NR2A 4DR3Q 3QQ8B 1K51A 3N52A 3U4EG 1KDBA 4XX5A 1JALA 3AULA 2AQ3B 4MTNA 2L5TA 2CR5A 5I6WA 1MJDA 1UWVA 3I4MG 3C3LA 3EUB2 3UINB 3RI7C 2LFNA 4POGA 3VVWB 5A35A 3J81i 3A7LA 1XNQQ 3OWEB 1A0IA 2PVOD 1B2TA 1I4XA 1ET9A 1EIHA 2E2IH 1YNND 4OO1H 1A2TA 3RZOB 4ZHPA 3H94A 1EO6A 2WXIA 3I4LA 5J1ZA 3ZTCA 1R7SA 2Z8LA 2J0JA 5JJKA 5LXHA 2HCIA 3PRPB 4XZ4A 1N36Q 3TP7A 4GGQA 2I5LX 1M94A 3VFKA 1YJIA 1KFYB 3D4DA 2N9EB 4HCSA 3LNNA 3RN5A 2L05A 2RGFA 3B08A 4LJPB 1ICWA 3PIO3 1Q46A 1WGYA 4KY7A 1YJNA 3U8ZA 1F2YA 4KJOA 3IAYA 1YEZA 5K5PA 4N9PA 1FGUA 1JRPA 1YN3A 3NZUA 3ER0A 3C46A 5LNK1 1EEFD 4W9LA 5LMUQ 5BYSA 1QOBA 2K6AA 1R4NI 1F2MA 3V96A 1OO9B 4A3BH 1FRDA 1PRTC 1L0YB 4CHTB 3U2SC 2V9HA 2X38A 1IZ6A 3PUWA 3TMPB 2LFIA 5C4HA 2GI9A 1DJRD 1SYGA 4C7YA 1QVFA 4A3GG 3CXCA 4BKSA 3K5OA 3JAML 1YJ1A 4MDKE 2Q2HA 1I94Q 4N6EB 3RUIB 5EE0A 1KTKA 3QG1A 1QVGA 2AWTA 1T5XD 1KHIA 1S1QB 2FIDA 3MA2B 1WCMG 4W9KA 3A9KA 1LTLA 1SDFA 1Q3LA 2F3VA 3M7NA 1UBQA 3V6CB 4RH6A 2CU1A 2JEAI 4BBRB 4X64Q 2WP8J 3T53B 4UP9A 1K50A 2M19A 2LGSA 4NY0A 4ARIA 2MBQA 4RMAA 3OPOA 1DGJA 4HKZE 2DZJA 5FLMG 2KWVB 4EVOA 1XMOQ 4DR5L 1R4MI 3M9BA 3CD6A 2WS3B 1AWDA 3KBXA 3VR3A 2K14A 3MC0B 4KHPL 2WXHA 5GADC 4II2B 5E6OA 3VAWA 2NZOA 4CJ0B 2AMCB 2UXBQ 1IHZA 2E2JH 2JP1A 1WTHA 1DXMA 4A3BG 1PFDA 4JI4L 1SJHD 2PMVA 1C8CA 4YCWA 4IM3A 4BKTA 1PZID 3ULJA 2MJ3A 1BBXC 2F3IA 1CUKA 2DYBA 5C3JB 1GHKA 1WTRA 3APFA 1RJTA 1HZBA 1ZXHA 3GZNB 2R93G 4G7HC 5G3LF 1V6EA 2Z0SA 2M0XA 1DOYA 1VQOA 1RL2A 4J6IA 1EY0A 1R9TB 1IBLL 3MC9A 3VR8B 2MGSA 3SR6A 1P1AA 4X65Q 5C0XJ 1IBML 1JOOA 3RMKC 5IOCA 1N8RC 4DR4Q 1NI3A 1WWTA 5IA7A 2K5HA 1W6KA 1G6ZA 4N58A 2FCMA 1L7YA 1LLRD 3U4VA 4JI6Q 5KNBA 3ZNGC 3ZYYX 4OZCA 2VY3A 5I4DA 4K5VA 4M8AA 2J42A 4BY7H 4I7ZC 4NXML 2AYOB 4A3LG 1TKWB 4HCNB 4JOIC 1FO4A 1SF0A 2L15A 3I90A 4IUMB 1H9JA 5E3FA 4HR7B 4OHJA 2V3NA 3S2HH 1SJED 1WD1A 1MI2A 3JYUA 3RNUA 4GN5A 1XXGA 2MJDA 3T1HL 4A3LH 5BR8Q 1CHPD 1VQFA 2J7ZA 2A68D 3S1MB 1F2RC 1EY8A 5AZFA 1TWFH 2HUGA 4DN4M 3AXCA 3TQYA 1F9RA 3BVGA 1PFSA 1M4VA 3PF4A 3QK0A 2ICIA 3BDOA 1WCMB 1KC8C 2IJ0A 4DV2L 4UY8C 1E7UA 1EY6A 5C0XH 2Z1CA 1QUQA 2NVYH 4C2MB 3KF8A 2ZXRA 1JOQA 5KIXA 4IOIE 4M0WB 1FL0A 1GXDC 3GTOB 3DHQA 4E3CA 4RHRA 1ML0D 5KHQA 1ASZA 1VS0A 1NJIC 2JA6H 4D2KA 1IBKQ 1S5FD 3FKIG 3JSVB 2B39A 4KZ0A 4K5XA 4MT5A 3VR5A 4JI3L 4BBNF 3M4OB 3I63C 2Y0SE 1QF6A 1XPUA 2A69C 4DPGA 2F0HA 2N88A 3RNBC 2KENA 4JWSC 5EPLA 3ECIA 1P3QU 1X65A 3OHXC 4V190 1AW7A 2L55A 3PIP3 2F4VL 2C9WB 3E5SA 2FCNA 3UDXA 5HI1A 2FAZA 3DWMA 3ZJVA 2IPKD 2MO1A 3DMUA 1YNNC 4CYEA 1N5XA 1BOSA 3A7AB 3PRZA 2R92B 3W1BA 1NY4A 4JI2L 1JMLA 1N60A 2V1CC 3AU7A 3AB5A 4AYBB 2Q8IB 3RT3B 2RSNA 4LF6L 1UGMA 2YTYA 1SE4A 1WFYA 4PS7A 5G55A 2BA1A 2NWGA 1V49A 1FYCA 1I3QB 1OGWA 3W1SA 2LVOA 5JPMC 4X3SA 3GE3C 3BIID 1D2BA 1NBWA 4YCVA 1L6UA 2JA7G 2GBNA 2Y5PA 4X64L 4A3GH 3DBHB 1X3PA 3BVZA 2PPHA 5CV8A 2W3SA 2DN8A 4UHVA 3CCRA 2JF5A 4DR5Q 3SK5A 4PQXA 5T1IA 1K52A 3ZNID 1G291 1ZKHA 2D3GA 2MNAA 4DR7Q 3T1YL 4FADA 1CZPA 1RDPD 4OXPA 1SAPA 4URKA 2PPBC 1FNVA 2EMSA 3TREA 4JI4Q 3Q3NC 3N32A 3ZRCA 2O6VA 3BY4B 2SNMA 5IWAQ 3DVNU 4DWFA 1E0BA 3NQIA 3PUVA 1A6XA 3HM3A 4JG2A 2MP1A 1DCZA 4ME3A 1WXAA 5JJZA 2I38A 3FEWX 2HD3A 4HMIA 4L63B 1V5OA 2BTEA 5CYUA 1QB5D 5G5HA 1ZW7A 2IY0B 3MTSA 4DV3L 1YBYA 2F0JA 3Q8FA 3H1UA 2UU7A 3S1QH 5K36G 2RHSB 1C4PA 3B2FA 1EUJA 5JEAH 1WRIA 3J81L 1SGHA 1R4QB 1MIUA 4FYDA 1YD8U 3NXWA 2M2LA 1BCPC 3CKIB 1KLGD 2F0OA 1PQSA 5EGTA 4WJPA 1A5RA 3ERSX 3IFWB 1YIWA 4JI6L 1XX8A 4OIJA 4IUNA 3C2PA 3AE5B 3PT2B 4WJ4A 3PIOA 1I4GA 2JYTA 3MEHA 2B2TC 2I5MX 2M00A 2EELA 2V3SA 3BS1A 4K0KL 4RGTA 2Y5CA 1HA5A 3A8JE 5HURA 4IWQA 3MP9A 3CC2A 4YWMA 4APVA 1V1PA 3I4NG 1E0ZA 4ICVA 3RNGC 5BR8L 3ZDTA 2PI2A 5E6NA 1MHHE 2AQ2B 2IL8A 3S1RB 4OWXB 2QDFA 3Q8DA 3NJTA 2B2UC 3H7SA 4LAAA 4R4TA 1S4ZA 2Q2IA 1D1IA 1E24A 3IRBA 3DOWA 3E3XA 4EQOA 1PRTD 3PCOB 2PCFB 4JVZA 5ELEA 3F2DA 2HTME 4MSQB 1R9TH 3SK4A 2KK8A 1BCPB 2ZXPA 3FKYA 4Q2JA 4J6HA 2LUEA 2JA6B 2N7DA 1MG8A 4EZLA 1SE9A 3Q8CA 2KZRA 2AEHA 3H6MA 2KMMA 3UDIA 1AN8A 1EYDA 3MTNB 2KX3A 1BVSA 3SR1A 4B3RQ 5D7GA 2BOSA 1TQOA 4M1UB 3U9SA 1IBKL 4GZYC 1ACCA 2W54A 4B0EA 1LYLA 1XLQA 1I3QH 2N3SA 2MHVA 4IPHA 4K3BA 1HCZA 1P7EA 2D9UA 1H9RA 1STAA 4DK1A 1WTWA 1EFWA 2GBJA 3MJ5A 3ONSA 1NR2A 3DWAA 4KKTA 4F8MA 3G4SA 1E8YA 4ZAIA 2Z4IA 2REXA 2ZTDA 1F2LA 1H9SB 5IP7G 3FILA 4A3MH 1TZOA 3H3VI 4K7WA 5FJ8H 4DDID 3W5UB 1WXSA 2BE5C 2ID0A 4IC7B 3RYTA 3ZXRA 2KD0A 2ZW1A 1HA6A 2KAJA 4DR3L 3H9DA 3CC4A 2EDGA 1ZXIA 4A3IB 2W55A 3QCAA 2HCCA 4LF6Q 2L0FA 5FR3A 4K7UA 3X3MA 2ASBA 2I46A 2RBMA 2P5ZX 1Z2MA 5EQ0A 5CR3A 2N1VA 4KY5A 1PH9A 3RN2A 1PTOH 1BXTA 2BS3B 5BO4B 5C44B 3HOWB 1L2NA 4KK7A 3UF8A 1XNQL 4R1JA 5DNFA 2LHEA 2IGHA 4LNFA 1FD7D 5KNCA 2K5PA 4JBWA 4YTPB 4Y7NB 1BDOA 2KHJA 4BBNC 3Q22A 4RCOA 1IL2A 4TMAB 1MHWC 3UE0A 4NQKE 4PMCA 1WTQA 3Q6SA 5LL6X 4JC0A 1X54A 4MJSB 1ROEA 1CHQD 1STBA 4BY1G 3I3TB 1JWUD 1U4MA 4L8JA 4C56C 4CDFC 3KYCD 3NHEB 2MFIA 4XQQA 2ON8A 1YJWA 4JYAQ 2VH2A 5JHAA 1IBXB 5HY6A 2QA4A 3L08A 2OEOA 1YQBA 2L1AA 2JWUA 1P8LA 3I4OA 4Z9CB 4OO1G 2NVUI 3KUCB 2ZM6L 3L13A 3KWLA 3GDEA 2JYOA 2C5LC 1NCVA 4X6AH 3NS8A 2BYFA 1BMLC 4NP5A 2QC8A 1LTBD 2OWOA 1LT3D 2L32A 3PSEB 4OZAA 3KOJA 2O6VB 2D2QA 1WE6A 1X6OA 4BBRH 2PW9A 3OMCA 4H0LC 1C4QA 1NUCA 3OOCA 1FMAD 1Y56A 2A68C 1FM0D 3APCA 5EAYA 4GNXA 3NWTA 1CA5A 3B2GA 5M3FB 4YHHQ 2D3AA 1U4RA 1KD1C 1Q1BA 3OWFA 1CZWA 2AHOB 1Q12A 1EY7A 2MW5A 3PIPA 3NTIA 2RD0A 5JOBA 3KF6B 3Q2AC 4A3JG 2DWQA 2EY1A 4ZYSA 1XMOL 2KEDA 1L4DB 4HCPB 4ICUA 4GDKB 4TV3A 3H91A 4LDTB 3IT6B 3G6EA 2NVTH 2UXBL 1PYSB 3VA5A 1VF5C 3ZIMA 4H7BA 4RF1A 1QOFA 1V1PB 4R8NA 1E9MA 5EPKA 2KDBA 4AJYB 1I42A 4BBRG 3LB8C 4HIDA 4LFBL 1C3TA 2JSVX 1WJNA 2K25A 3QJZA 2UUAQ 4KJNA 4REZA 2NPTA 1CZGA 2K1BA 2PZTA 5M3FG 1BF4A 1KAWA 3J80E 2XRQD 1JOKA 3GP7A 3T13A 2PVGC 3MXNA 2OJRA 4X65L 1IBMQ 4KV2A 1K3RA 3L3OC 4XT3B 3RD2A 4FULA 2M56B 1QOGA 3J80c 3MZ5A 3VDYA 1HTQA 2CWAA 4LW1A 4U68A 4W9CA 2OEDA 5EE1A 1FCLA 5JHBA 1TIID 1N6ZA 3DXJC 2YVCA 2Z4HA 1Q86C 2LJ5A 1HFGA 4M0WA 2A8VA 1MD2D 2BH8A 1GUNA 2C35B 3BU2A 3PSIA 1ESFA 3BJUA 2BKFA 4IUQA 3LWUA 1HTPA 4L5QA 4GOPC 4AQYQ 1KH0A 1JQ4A 1HUNA 2BVCA 4HDOA 3NHHA 1LM0A 1E7ZA 4BS9A 1PV4A 1RHPA 1S5ED 1SMYC 2XN9C 5JVG3 2J53A 3T1HQ 2LD9A 3DDCB 3PO0A 4MSMB 2L1BA 3HOYB 1K8RB 2PZWA 4KMUC 2W9NA 2Q5WD 2IY5B 4JBJA 2FE8A 3HOUB 2I0QA 3KF6A 2MBHA 3GTPB 4DV2Q 2EY6A 5EDSA 1C0AA 1O78A 3R93A 1I5FA 1TWCH 4X3KA 1GAQB 1N62A 2H89B 1YHAA 5A2QE 4HSVA 4A3GB 4GNXB 3IFDA 4A75A 1F2RI 2QSDA 1WYGA 3T51B 4LF5L 2KCMA 1T9HA 4OX9L 1UELA 2PO4A 1WGRA 3P4RB 3W1YA 1C77A 5EBDA 3AEBB 2ZPYA 4OEMB 2ZTCA 4A3OA 4GLSC 5I9OA 3I57A 3CU7A 1JJ2A 3QWZB 1VQKA 4JI3Q 5AZGA 2C9OA 5CHVC 4C3IG 1QJOA 4ZRKA 4IJLA 1A70A 1V43A 1AARA 2KN5A 3VTVA 3U58A 3TBIB 1XQQA 3AM9A 2JPHA 2LGDA 1AZPA 5J22A 1NYQA 1VQ7A 3TEZA 3TUOA 3FPUB 4LF9L 1VF7A 4DQOC 1B3QA 5M5WH 4MH8A 1SFOH 3ZGZA 1WMHA 2WXNA 5E4WC 5DPRA 3D4RA 4R4CA 4ZLTF 1OXSC 3HOXB 1N5WA 2G4DB 1RM6C 1VJKA 2KWCA 2KFKB 3D32A 4OONA 4QGUA 4J3OD 1TY2A 3G71A 1F9SA 1VQLA 4YY3L 3MHBA 3KF8B 1DOMA 3LDZE 2V4DA 4K6DA 4RHSA 1C76A 3AU5A 3I91A 3NZ3A 2VZKB 2WXQA 3KYDD 1Q1OA 4L23A 3RLFA 2NVYB 1UE7A 2NTSA 5C4JB 3DBRB 1EIFA 4HIMA 3PHWB 3RR5A 2N49A 3EJIA 5JPNC 3ND9A 3WWVA 2BBCA 4NPSA 3OIPA 2X69A 2JA8G 2OCEA 3V6EB 3I7FA 1FXIA 3GB1A 3PS6A 3AN1A 3LX0A 2KMCA 2KQ3A 3A8IE 2KFJA 2GN5A 4KN7C 1WTXA 4IPCA 1VQEA 3PGZA 3ZLZA 4IUUA 5I9PA 2R2OA 2INCC 4KSKC 4LNIA 2CWPA 1Q8IA 3J80L 5KYIA 3M4PA 5L37A 2Y3AA 4L6TB 2KTRA 4A3JH 5L83A 1J0GA 4DV3Q 4W9FA 2UUCL 1SYDA 4AYBE 3ZUNA 4TKOB 1FJGL 3OLMD 4GIVA 2N78A 1GM5A 1NBFC 4CQNA 1I35A 1MKHA 4ZYNA 4RKLA 3S9WA 1WX9A 4Y52H 2RDBC 2MJ8A 4NNJB 3ZQ4A 2LASA 4R8IA 2SNSA 2M1MA 4WH4A 2D3BA 3CF5A 4YL8A 2LVQA 2HJ1A 1DM0B 2PI2E 2HT1A 1Y14B 5DLQE 1P7FA 2R7ZB 2WAQE 3SFEB 1ZEQX 3QB3A 4AQYL 4K0KQ 1GUOA 2RDFA 5I6YA 1HE8A 1EYAA 2L0CA 2WX1A 1V80A 4NW2A 3GV3A 3A5ZB 2ZCBA 4WQMA 5IYBG 1HZ5A 2NS5A 3H3VC 1PVOA 3RULA 1MFWA 3C8YA 4DK6C 4HLEA 1K28A 2RKSA 3CW2C 2OT2A 1BNZA 4A3FG 3OTOQ 5EKLA 1IPGA 3A4RA 1EZ6A 5KEEA 5IP9H 4PS3A 1D3ZA 5AEKB 1EIYB 1E7PB 4R4IA 1C7YA 3CQZB 1OEYJ 2XSCA 1G2SA 5CORA 4C80A 2R92G 1LFDA 2IZVB 2VUMH 3A9KB 1L6VA 3TEWA 2MEKA 1Z47A 1MSGA 5H92C 4ZKBB 1WY8A 1IUEA 4B3RL 4LF5Q 4OX9Q 2WXKA 1JWMD 1TYGB 3VR9B 1DOXA 4WWNA 4A3MB 3EBEA 1Y1WH 1RCVD 4BY7B 1FIQA 1Q10A 4LJOB 1SYCA 4O42A 4BA2I 4IWPA 3D6WA 1X1MA 1DOKA 1WTPA 1YN5A 2N9XA 3NZSA 4USAA 4DNRB 1B44D 2O5IC 5M9OA 1Y8PB 5JEAJ 4LF9Q 3HFZB 1QLBB 3HOZH 4FHKA 2ATWA 2A6HD 3AE9B 3LXFA 4W9EA 2ZJRA 1Q90A 4A3FB 4XIGS 2JQOA 2XEWA 5LMNQ 3O65B 1L0WA 5TSSA 2WXMA 3VRAB 3KUZA 3VA7A 2BWFA 1JWSD 2L0TA 4LTUA 3NRZA 4GDKA 2WV6D 1TWGH 4EQNA 2FCSA 1D5MC 2QEXA 1V8CA 2VUMB 2NVQB 4X66L 2Q2UA 2K3UA 1TGZB 4HJ9A 2E2JB 2VW9A 5JZEB 2WNMA 3HOZB 4TQ0A 2PE6B 1HUMA 4GMVA 4B3TL 3NVVA 3W3AA 2WXOA 1ZXTA 3DWPA 4KV6A 1B4OA 1Q81C 4ZOHC 3AQQA 4A6QA 3CSFA 3GTGH 1XF5L 4IN3A 2B3GA 2YU9B 1WGDA 2VRRB 4KIKA 5BYQA 3CRLC 2LXKA 3F1ZA 1GPXA 5KNDA 2V4IB 1YIJA 4JYAL 3Q8BA 2YLMA 3P7JA 1RRBA 1M90C 3HS0C 3PZ8A 2QF7A 2KVRA 1X3QA 5JXVA 2QDLA 2WYQA 4JL9A 4KX6B 2ZM6Q 4IOCA 1E10A 1DOIA 3AYHB 4BXXG 1UBIA 1NEKB 3PO3B 3HVDA 3KQ4A 3CCEA 2UUCQ 1WX7A 1CQFA 1NDDA 5C4ZA 3Q14C 4MEMA 4HMJA 3MWYW 1FJGQ 3CMMB 2K04A 3W5VB 1WR6E 1RTNA 2UXCQ 3DEOA 3VXWA 5GAEC
chains in the Genus database with same CATH topology
1PTOF 2F0SA 2E2IB 2KHSA 2N9KA 4G57A 4C1NI 1RFKA 4JK1C 2WKDA 4IUPA 2RQXA 3R2TA 2F0WA 1EOTA 1QCBD 3ERQA 3QOLA 3AEFB 1PTOD 3FRPB 2B2UA 1WGKA 2RPVA 1PTOC 1SSOA 5EKKA 4C3JG 4HJGE 1EL0A 3MXGA 3OW7A 3K0YA 1TKEA 4C3HG 1EZ8A 3G7LA 3P75A 3EA6A 1CTMA 3I3CA 1IL8A 4DA2A 1IGCA 1Z7TA 1QKZA 1Y1VB 3H0GB 5FO7B 3DEPA 2WU5B 2ZW0A 1HEZE 4AQ7A 2N0SB 4C7ZA 4YTMB 3AMUA 1SB3C 2VB3X 1LO5D 1K53A 1JE4A 5CGKA 3QOJA 4KKIA 4RKBA 3HRDD 3R8BA 1JB3A 3HVZA 2X6LA 1V1OA 3WCQA 3NVZA 3KK7A 2BS4B 4WWMA 3RD4A 3KWVA 3AV8A 4ZRQA 1C79A 2NBFA 1UUPA 3NS1A 2N9LA 2G9HD 3T16A 1QILA 3L9AX 4JWUC 4ILWA 1A2UA 5E4XA 5C3EB 3VR2A 4QMGA 1WSPA 3HP3A 1FXAA 3RUZA 1M8AA 1MVKA 4IUVA 3TP6A 2F0EA 1II3A 3GD7A 4CGYB 4P6VF 3KLRA 3FAHA 3E0JA 4A3DB 3EGRA 3D4WA 4OGQC 2ZT9C 3WDNA 4HRSA 4BY1B 3W9CB 4HSPA 2Y0SB 4C3HB 3V3XA 3HGBA 1B9NA 2WACA 3TZUA 3FMCA 2EXZA 4F7XA 1XWEA 2K5WA 2IGDA 4O1NA 1KDCA 3CRKC 5LHY1 2INPE 2TMPA 1EWHA 2EYHA 2F0KA 4XT1B 1RWSA 4TRDA 3K57A 1HZ6A 4DXFA 2PTLA 1FD6A 4ITKA 1IYUA 3K59A 1A3UA 3BVMA 3KLSA 2DYOA 2ENBA 3DUZA 1ZOYB 2D5GA 4A93B 3R2IA 1KF6B 1TJEA 1QWYA 4N59A 2N55A 1BCPD 3FC4A 1LT5D 3DM1A 4H13C 3K5NA 5JVH3 5C0XI 3ABVB 4IZ8A 1GOZA 1WD0A 3P4SB 4FF3A 3A8KE 3S2HB 3S14B 5M5YB 4HKQA 4E6IA 1I4QA 4FF4A 2F0MA 5G5GA 1JICA 1YNTE 3Q8EA 5AUIA 5M5XB 4FVMA 4LK1C 5D65A 3GTJB 1D4BA 1DONA 1PZJD 3SK8A 1A3VA 1CFMA 3M7GA 1EIGA 4C1NK 2I2YA 4A8XC 5HHDG 3RZDB 3VYRA 4KGTA 3G6JB 2QIEB 2JU6X 5D3DA 4XYOA 1KAAA 1H9SA 3FILB 2QKIC 1IKMA 2DBYA 2WDRB 2KVMA 2NTTA 1UEAB 3D8GA 2WXJA 1PXUA 2L12A 1MI0A 4ME5A 3Q24A 4G7ZC 3J9CA 3NP8A 1I50B 2A5HA 2WKCA 2YYZA 5F2DA 3B9JA 1X32A 5FO8B 3UI3A 1IBXA 2X6GA 2DY8A 2RA4A 4WRDA 1O7ZA 4X3UA 2E2DC 1IYVA 1KNEA 3NSWA 1NAPA 2WB1B 4KKUA 2DY7A 4UDUC 1PUTA 5NUCA 2A74C 3AMZA 1Y8NB 2K7VA 4B9WA 1YN4A 3GO5A 4YSXB 5M3MB 1HQRD 5IT9E 2LS01 1DYQA 3Q0AA 2V0GA 5GXGB 1S5DD 1SEBD 2EKIA 5C6AA 2K05A 1SSNA 4KKJA 4IFDJ 2E3TA 3HUIA 2NN6I 1TWHB 3IT4B 2I07B 3ZJUA 3NWSA 4MIUA 2OF1A 4FXDA 2CJOA 1N61A 2KJXA 1L0XB 2EJGC 4FXGC 3HKZB 2XWBB 4HEA1 2VZKD 1JW9D 3BK2A 2F4IA 4Q5VA 1XCQL 1I4HA 3BK1A 5FOBB 1EU4A 2WAQB 4TQ1A 2BE5D 1PGXA 2R93B 3J81E 3S15B 5FLXE 1W6JA 3O13A 1MSHA 1T6BX 3TP5A 1FNUA 3IAS1 2D5DA 3BDLA 4J8QA 4LJZC 5EPJA 5AUKA 2CW0C 1HFNA 4ULLA 1EQTA 1GUWA 4L2YA 5EKIA 3I70A 1F2ZA 2QEJC 1ZP0B 1TS3A 3NQTA 2KA7A 3P1HA 5FLXL 4EQPA 1LTID 3T56B 2OXPA 1FGBD 2IX0A 4HROA 4PT5A 1ZDVA 3T3OA 3NPPA 4KY6A 3RPFC 1VR9A 1DZ1A 2LMCB 1ZDXA 4A55A 4RGMA 1GB1A 5ELFA 1G8ZD 5C3XA 2BT6A 1JR0D 2PKOA 5C2TB 4WAFA 4ZUJA 4QCLA 1CQVA 3DWGC 1F9QA 4XTCS 2NB0A 3VYTA 2E76C 2OHFA 1J8IA 2A69D 1SBBB 1HXYD 1H9KA 2WXFA 3ZJTA 3EFXD 3K5LA 4H2AA 4N9TA 4RWSC 1IKLA 2JSOA 2G9DA 4CKBA 5CC4A 3IFTA 2PW7A 5CV6A 4X3TA 3TEXA 3OSOA 1PDQA 1C4CA 4A90A 3I4NB 5KGUA 4WFN3 2DYMA 1F0ZA 2AQ1B 4XQJA 1KNAA 1EY4A 1E2VA 3S1NB 4DQOC 4IFDG 1J9OA 5LL6S 2K0PA 4XYQA 4DFAA 3BYTB 5M5WB 2YEPF 3K5MA 3V2TA 3TN2A 1PMRA 3BDCA 4K8IA 2FHTA 1GUTA 2IGGA 3NBIA 3GTGB 5K36H 4QB4A 3CIRB 4XDDA 1GJXA 2JZPA 1CJEA 4DAPA 1K8OA 4P2CB 5G3LD 2HDLA 1XLOA 1TY0A 3GTMB 4QUCA 3OMGA 3ONAB 1CI3M 1BUIC 3PUYA 4F88A 3BG3A 5BMHA 1LTAD 2A73B 5FK9C 1UAPA 1AFPA 5MPOA 3WOEA 1C48A 1EM7A 4P16A 2DLBA 1NYRA 4L1BA 3L7ZC 2WQYB 2B8FA 1AEXA 3F2UA 2E75C 1YJJA 1E6EB 2ICEC 3N9YC 1ONLA 1PTOB 1PZKD 2L11A 3QWNA 4RGNA 4MHEA 2RMMA 4NMZA 1XO3A 2NUCA 3A56A 2GA4B 1TKYA 5BYRA 1A3TA 4ARCA 1EY5A 2F0QA 2RVLA 3IL8A 2K5DA 1I4RA 3SDZA 1SYBA 1ENFA 1U9RA 4HTHA 1XCTL 1CM9A 2FMMA 4R9WA 3J7YW 4GDLB 1SIJA 1Q1EA 3RFZB 1Z6HA 2R6GA 3LWEA 1SNQA 4A3BB 4RCNA 5DAUA 4LLGM 4K2KA 2C5CA 4Q0FA 3ZGZA 4ZK9B 1KLUD 1FCCC 2BDNA 5C4XB 1NVID 4WURA 2B2TA 1SNMA 5EE9A 4NJCA 3FPPA 4KGSA 3I72A 3H8HA 4XXEA 1XEEA 4IFDH 3TEYA 4RF0A 5IIFA 3VR4A 2FFKB 5COYA 2QCPX 5ELBA 2KECA 3QIAA 3S17B 1NR4A 1PFMA 2XIWA 1LV9A 2NVTB 2J0TD 2EJFC 4TSSA 4YXDB 3J7AV 2WLBA 4YTNB 4FXCA 4ZRPA 5EBCA 1MPEA 2FUG1 1Y8OB 1LTRD 1ZE3D 2E2HB 3GTQB 1Y1WB 1I4PA 1SMYD 2SEBD 1DD2A 3EQLC 5CV4A 1VCIA 2LJIA 4PV1C 2Q8TA 5DM73 1EU3A 2EOTA 2XVSA 1MBYA 3ITPA 3BZDB 4EGVA 2B2WA 4US8A 3FKIB 1U4PA 4A3KB 1L0VB 2F3WA 4XE0A 5IGGA 2A6EC 3HG9A 1ILPA 2PZUA 4K6LA 3VYSA 3GTKB 5C5MA 4KD4A 4MN3A 3AEDB 4CJ1B 1OQRA 1YMHE 4K5WA 4C3IB 4RAUC 5IGBA 2WXPA 1JQYD 2FMCA 1OFFA 2EY2A 3NVYA 3K6OA 1D5XC 4JPSA 1EWCA 1OXUA 3SVMA 4YSZB 2K5QA 3NE5B 2IDYA 2RSOA 3A54A 2XNAC 5AFWA 4IURA 1TKGA 1ILQA 1XTCD 2QDBA 3IKJA 1FR3A 2LGIA 1EEID 2EVBA 1OXTA 5FO9B 2K9XA 3C1FA 1BQQT 3DWQA 1RKNA 2B63B 2K01A 3SK6A 3KUPA 2KDMA 2L52A 1LT4D 2AWOA 2IX3A 2B2YA 4HAEA 5FKAC 1RODA 2JA8B 1I6VC 3PUZA 4DK0A 1LTSD 1JCKB 2K28A 5BN4A 5J39A 3URYA 2VB2X 4HEDA 1XLPA 3NTKA 5BN5A 4WORA 4OL7A 4R3DA 4LK0M 2QJLA 2SDFA 1O7YA 2LHDA 3W2DA 1ZPSA 1QG7A 4FNFA 2KOLA 2LKVA 3S1QB 2SOBA 3FVQA 3AECB 1F9PA 1K83B 3K7AB 1TS5A 5CV9A 1TWAB 5T1GA 3JAME 1B9RA 2WDVB 3HOVB 2PW5A 3NTHA 1XLNA 3TDQA 5DM63 3MHZA 1B50A 5T8IA 5ELCA 1D6EC 2TSSA 5E6JA 4NZLB 5EJWA 4TQUS 4CJ2C 4PMBA 3I8ZA 1YQ4B 1VMPA 5HGTA 2MH7A 1WTOA 3FDTA 2B8GA 2EYPA 3CWIA 1ENCA 4NDXA 3P63A 3AE2B 2WU2B 1TS2A 2H1EA 5KYLA 2AUKA 4K2LA 1I7HA 3S2DB 1H9MA 1SNCA 2F0VA 1G91A 1BR9A 3E9SA 2BS2B 4NKLA 2BW2A 4G7OC 3CHBD 1FFVA 5IGDA 4CKCA 2FBWB 4IUTA 3SE0A 2KEEA 4S3SA 1D1KA 3AE6B 2BB6A 1LTGD 1CK1A 1HQMC 1UGJA 1HPCA 4A9AA 2K32A 5IODA 2B2YC 2F0NA 2CU3A 3BWUD 3P4PB 3TP8A 2FJ2A 1RTOA 1OXVA 3V05A 1PFNA 1A15A 3L4PA 3AH7A 1EQVA 3P20A 3SFDB 1HRJA 1J7BA 3Q23A 4QUFA 1TT2A 3LYYA 3WOFA 2EZVA 1FRRA 2MUYA 1E2WA 4RNAA 4DXGA 1PYWD 4FP5D 1STHA 3IAM1 4KI0A 5A2QL 1L5PA 2V3PA 3E56A 2F0FA 2J4XA 1TWFB 1V97A 1PDXA 4ZHOA 1DOLA 3P4QB 2K03A 1UWXA 1KRHA 2ZXOA 4YT0B 1BO0A 3I4MB 2KN4A 1VRAB 4KTAA 1LACA 1TU2B 1YNJD 5IT9L 1KDAA 3M85A 4FXKC 2K22A 2WIIB 4WJWA 2WXLA 1SYEA 2EPBA 5E1FA 4FF1A 1S5BD 2F03A 2MPMA 4KD3A 2EYOA 4BBSB 3MFYA 1GB4A 2AWNA 2CHBD 1NSNS 3PV0A 5BMGA 3MXPA 4B0MA 1VDZA 1AZQA 3J7AF 2JYEA 5BMIA 4IDIA 4H44C 2L9HA 3PUXA 5HFYA 1STEA 3QJYA 1SNOA 2NZ1D 2E6XA 1L4ZB 2KQ4X 5JAVA 4FO2A 1B1ZA 4ABNA 2BA0A 1J7CA 2LUMA 2ACZB 2IT1A 4IQZA 3N6RA 1SE2A 1C4AA 4OO1I 5HG2A 2KCNA 3GV6A 2MJEA 1K8MA 1PRTF 1B9MA 2B76B 2YEPB 3M3YB 4DAYA 1O7LA 1HTLD 2D62A 1GUGA 2EY5A 4K14A 3I9V1 3U2SC 3AE8B 2CJNA 1GUSA 2R3ZA 5CBAE 3C1EA 1C78A 4A3EB 3ND8A 1J7AA 3VR6A 2WXGA 5H8YE 1IW7D 1MGSA 3E6ZX 3VRBB 1WXQA 2D2CC 2INNE 4XDXA 2GB1A 1EFID 1KABA 1YNJC 2JEBI 1EY9A 4CKEA 2JA7B 2PIAA 1R4PB 2DNCA 4ODGA 1AYFA 1HHVA 3U9OA 1UNSA 2N7JA 1STNA 3HEJA 1PLFA 5ISRA 2RDHA 4KHVA 1CT1D 2AUJD 3ETRA 4OZBA 2GRIA 1B53A 2F1MA 1JWAD 1QNUA 4CBVA 2M9VA 3AE7B 1LABA 2PMZB 1ESRA 5I2XA 1ZYRC 4NAWB 4C3JB 3VQIA 3TZDA 4UAIA 2IWHA 4DAVA 4ZQ3A 2B2VA 2A6ED 2B2VC 1SNPA 1QE6A 1FEHA 1OXXK 4KGRA 1SE3A 3AEEB 4OIKA 1IW7C 2PNRC 3IXSA 2NN6G 3U7ZA 2F0TA 1F77A 4RA8A 4QF4A 1E2ZA 2LMCA 5IGEA 3EVQA 2IW3A 1FNWA 3T3NA 1VMCA 2JE6I 4ID6A 2F0DA 4YSYB 4JE3B 1ENAA 5C3WA 4KN4C 3MFGA 1STYA 3PMFA 5ELDA 3X3NA 3AE1B 1RYJA 4KKSA 4YIJA 3GTLB 2R61A 2M0AA 3PO2B 5C5LA 1STGA 4IFDI 1VLBA 1D5ZC 2KWDA 2EJMA 3GQBA 1G2TA 2HQEA 1VDVA 1AP0A 1V8QA 2B2WC 4BA1I 1RD9D 3BYYB 3U52E 1PGAA 4B9XA 5IGFA 3SEBA 1OQQA 1GHJA 1U4LA 4AS1A 2LY7A 2VNUD 1QOAA 1I6HB 2KUMA 1BUVT 2EYLA 1SXTA 1RF2D 1UWMA 1MHXA 2AX5A 4U673 3MAQA 1IGDA 2W3RA 4DF7A 1FFUA 2F0IA 1JC7A 3M4YA 2K33A 2F0GA 4ZRZA 2JQRB 2WXRA 1VZ6A 3PZ7A 2EYJA 3S16B 2QMTA 3R3OA 1CA6A 1JROA 2XWJB 5D14A 2F0UA 3NUCA 3GS2A 5CV5A 4XDCA 1BCPF 1O80A 4RFBA 1VZ8A 1TWGB 2JX5A 3HRZC 2NMQA 2SAKA 3P1MA 4PMWA 2BDOA 2KCCA 1T5EA 2HDMA 2JXMB 2Q8RE 3A55A 4HN7A 2O4XA 2O2LD 1YQ3B 2DNEA 4LMQD 2FINB 2RDGA 3D31A 4KHZA 4BWGB 4DGZA 5I2YA 4OW0A 4G4KA 4V0BA 2EE1A 5D3IB 1SYFA 2NN6H 1VZ7A 3SHLA 3D6CA 2QILA 1TVXA 1NENB 2W82A 1WVLA 2O5JC 2HDEA 2VXWA 4XQNA 3NUHB 2IX1A 3AE4B 1QQRA 1JORA 3OIQA 3Q69A 3EROA 2CQAA 2BB5A 5C0XG 3MVVA 2PYKA 3K58A 2PQEA 4OVZA 4WIPA 4DNTB 3NBHA 2G1EA 3AEGB 1TR5A 1Y69U 2JXTA 1S5CD 2CVRA 1TS4A 1XYIA 1PRTB 4NAMA 4I65A 4JX1C 1ET6A 4FF2A 2A6HC 3MXUA 2F0PA 2H4OA 1WTVA 1N63A 1LT6D 2WP9B 3T4AC 1JWBD 4PNYA 3AB9A 4XWWA 1ZKOA 3KBGA 2BYTA 3NK9A 1C9FA 2E74C 3I73A 2EYMA 2L83A 2EYFA 2KACA 4RGOS 2LEKA 3H09A 1ZUD2 1PGBA 1TWCB 3SXHA 1ZYRD 3Q8AA 2WINB 4HCEA 2JA5B 2J52A 5CMDA 4J1MA 4ZUIA 3NVWA 4MM3B 3KLSX 3TMEA 5CV7A 1EWYC 4ZKCB 4XWTA 1QNKA 3TSSA 4IKGA 4EE2A 5DEHA 5BN3A 2L4NA 3UI2A 1SFOB 5CBEE 3VYUA 2BCOA 3AE3B 3AEAB 4IALA 2WDQB 1PFBA 1EYCA 5JEAG 4K8JA 2PLPA 5IGCA 5EE3A 2NYZD 2NVXB 3P42A 2H88B 4YWGG 5KRUA 4QIWB 3RMHA 3D3RA 4US9A 4DU9A 4A3JB 1T3QA 2CW0D 4MACA 4F87A 1B3AA 2ONQA 1SNDA 2XRSD 1QOHA 4B08A 3HZXA 2F0LA 1LTTD 3QO2A 1QT9A 1K51A 3N52A 3U4EG 1KDBA 1JALA 2AQ3B 2L5TA 5I6WA 3C3LA 3EUB2 2LFNA 5A35A 3A7LA 3OWEB 2PVOD 1B2TA 1I4XA 1ET9A 1EIHA 1YNND 4OO1H 1A2TA 3RZOB 4ZHPA 3H94A 2WXIA 3I4LA 5J1ZA 1R7SA 2Z8LA 2HCIA 3TP7A 1YJIA 1KFYB 3D4DA 4HCSA 3LNNA 1ICWA 3PIO3 4KY7A 1F2YA 4KJOA 3IAYA 5K5PA 1JRPA 4N9PA 5LNK1 1YN3A 3C46A 1EEFD 5BYSA 1QOBA 2K6AA 1F2MA 3V96A 1OO9B 1FRDA 1PRTC 1L0YB 4CHTB 2X38A 3PUWA 2LFIA 5C4HA 2GI9A 1DJRD 1SYGA 4C7YA 3K5OA 3JAML 4N6EB 5EE0A 1KTKA 3QG1A 1T5XD 3MA2B 1SDFA 3M7NA 1Q3LA 2F3VA 4RH6A 2JEAI 4BBRB 1K50A 2WP8J 3T53B 2M19A 4ARIA 3OPOA 1DGJA 4HKZE 4EVOA 2WS3B 1AWDA 3KBXA 3VR3A 3MC0B 2WXHA 4CJ0B 1IHZA 2JP1A 1PFDA 1DXMA 2PMVA 1SJHD 1C8CA 1PZID 2MJ3A 1BBXC 5C3JB 1GHKA 1WTRA 1RJTA 1ZXHA 4G7HC 5G3LF 1DOYA 1EY0A 1R9TB 3VR8B 2MGSA 3SR6A 5C0XJ 1JOOA 5IOCA 1NI3A 1WWTA 1W6KA 1G6ZA 4N58A 1LLRD 5KNBA 3ZYYX 4OZCA 5I4DA 4K5VA 4M8AA 2J42A 4I7ZC 1TKWB 1FO4A 1SF0A 3I90A 1H9JA 5E3FA 4HR7B 4OHJA 2V3NA 1SJED 1WD1A 1MI2A 1XXGA 2MJDA 1CHPD 2J7ZA 2A68D 3S1MB 1F2RC 1EY8A 2HUGA 4DN4M 1F9RA 3BVGA 1M4VA 2ICIA 3BDOA 1WCMB 2IJ0A 1EY6A 5C0XH 2Z1CA 4C2MB 3KF8A 2ZXRA 1JOQA 5KIXA 4IOIE 1GXDC 3GTOB 3DHQA 4RHRA 1ML0D 4D2KA 1S5FD 2B39A 4K5XA 4MT5A 3VR5A 3M4OB 1QF6A 2A69C 2F0HA 2N88A 4JWSC 5EPLA 4V190 3OHXC 1AW7A 2L55A 3PIP3 3E5SA 5HI1A 3DWMA 3ZJVA 2IPKD 3DMUA 1YNNC 1N5XA 1BOSA 3A7AB 2R92B 1N60A 1JMLA 3AB5A 3AU7A 4AYBB 2Q8IB 2RSNA 1SE4A 2BA1A 2NWGA 1FYCA 1I3QB 3W1SA 5JPMC 4X3SA 3BIID 1D2BA 1L6UA 2Y5PA 1X3PA 3BVZA 5CV8A 2W3SA 2DN8A 3SK5A 4PQXA 5T1IA 1K52A 1G291 1CZPA 1RDPD 1SAPA 2PPBC 1FNVA 2SNMA 1E0BA 3NQIA 3PUVA 1A6XA 2MP1A 1DCZA 2I38A 5JJZA 3FEWX 4HMIA 4L63B 2BTEA 5CYUA 1QB5D 5G5HA 3MTSA 2F0JA 3Q8FA 5K36G 1C4PA 3B2FA 5JEAH 1WRIA 3J81L 1R4QB 4FYDA 3NXWA 2M2LA 1BCPC 3CKIB 1KLGD 2F0OA 5EGTA 1XX8A 4OIJA 4IUNA 3C2PA 3AE5B 1I4GA 2JYTA 3MEHA 2B2TC 2M00A 2EELA 3BS1A 4RGTA 2Y5CA 1HA5A 3A8JE 5HURA 3MP9A 1V1PA 1E0ZA 1MHHE 2AQ2B 2IL8A 3S1RB 2B2UC 4LAAA 1S4ZA 1D1IA 4EQOA 1IBXB 1PRTD 2PCFB 5ELEA 2HTME 3SK4A 1BCPB 2ZXPA 4Q2JA 4J6HA 2JA6B 3Q8CA 3H6MA 2KMMA 1AN8A 1EYDA 3SR1A 5D7GA 2BOSA 1TQOA 4M1UB 3U9SA 4GZYC 2W54A 1ACCA 4B0EA 1XLQA 2MHVA 1HCZA 1P7EA 2D9UA 1H9RA 1STAA 4DK1A 1WTWA 3MJ5A 1NR2A 3DWAA 4KKTA 4F8MA 4ZAIA 2Z4IA 1F2LA 1H9SB 3FILA 1TZOA 3W5UB 2BE5C 2ID0A 2ZW1A 1HA6A 2KAJA 2EDGA 1ZXIA 4A3IB 2W55A 2HCCA 5FR3A 3X3MA 2I46A 2RBMA 5EQ0A 5CR3A 4KY5A 1PTOH 1BXTA 2BS3B 5C44B 3HOWB 4KK7A 5DNFA 2LHEA 2IGHA 1FD7D 5KNCA 2K5PA 4JBWA 4YTPB 4Y7NB 1BDOA 3Q22A 4RCOA 4TMAB 4PMCA 1WTQA 3Q6SA 5LL6X 1ROEA 1CHQD 1STBA 1JWUD 4C56C 1U4MA 4L8JA 4XQQA 2ON8A 2OEOA 2L1AA 2JWUA 4Z9CB 4OO1G 3KWLA 2JYOA 1NCVA 1BMLC 4NP5A 1LTBD 4OZAA 1LT3D 2L32A 2PW9A 3OMCA 4H0LC 1C4QA 1NUCA 3OOCA 1FMAD 1Y56A 2A68C 1FM0D 1CA5A 3NWTA 3B2GA 5M3FB 1U4RA 1Q1BA 1CZWA 3OWFA 1Q12A 1EY7A 3NTIA 5JOBA 2DWQA 2EY1A 4ZYSA 2KEDA 1L4DB 4GDKB 3H91A 3IT6B 3VA5A 1VF5C 4H7BA 4RF1A 1QOFA 1V1PB 4R8NA 1E9MA 5EPKA 3LB8C 2JSVX 4KJNA 4REZA 1CZGA 2K1BA 2PZTA 1BF4A 3J80E 2XRQD 1JOKA 3GP7A 3T13A 2PVGC 3MXNA 3L3OC 4XT3B 2M56B 1QOGA 3MZ5A 4U68A 5EE1A 1FCLA 2OEDA 1TIID 3DXJC 2Z4HA 4M0WA 1HFGA 1MD2D 1GUNA 1ESFA 4IUQA 3LWUA 1HTPA 1KH0A 1JQ4A 1HUNA 3NHHA 4BS9A 1RHPA 1S5ED 1SMYC 2XN9C 5JVG3 2J53A 3PO0A 2L1BA 3HOYB 2PZWA 4KMUC 2Q5WD 2FE8A 3HOUB 3GTPB 2EY6A 1O78A 3R93A 4X3KA 1GAQB 1N62A 2H89B 5A2QE 4HSVA 4A3GB 3IFDA 1F2RI 2QSDA 1WYGA 3T51B 2PO4A 3P4RB 1C77A 5EBDA 3AEBB 4GLSC 5I9OA 3I57A 3CU7A 2C9OA 4C3IG 1QJOA 1A70A 1V43A 3TBIB 3AM9A 1AZPA 5J22A 1NYQA 3TEZA 3TUOA 3FPUB 1VF7A 4MH8A 2WXNA 5E4WC 3D4RA 4ZLTF 1OXSC 3HOXB 1N5WA 1RM6C 1VJKA 4J3OD 1TY2A 1F9SA 3MHBA 1DOMA 2V4DA 4K6DA 4RHSA 1C76A 3I91A 3NZ3A 2VZKB 2WXQA 4L23A 3RLFA 2NVYB 2NTSA 5C4JB 3EJIA 5JPNC 3ND9A 2BBCA 3OIPA 2X69A 1FXIA 3GB1A 3AN1A 3LX0A 2KQ3A 3A8IE 4KN7C 1WTXA 4IUUA 5I9PA 1Q8IA 3J80L 5KYIA 2Y3AA 4L6TB 1SYDA 4TKOB 4CQNA 4RKLA 3S9WA 3ZQ4A 2MJ8A 4R8IA 2SNSA 4WH4A 1DM0B 1P7FA 2R7ZB 3SFEB 1ZEQX 3QB3A 1GUOA 2RDFA 5I6YA 1EYAA 2L0CA 4NW2A 3GV3A 4WQMA 1HZ5A 3H3VC 3C8YA 2RKSA 2OT2A 1BNZA 5EKLA 1EZ6A 5KEEA 1E7PB 3CQZB 2XSCA 1G2SA 5CORA 4C80A 1L6VA 3TEWA 2MEKA 1Z47A 1MSGA 5H92C 4ZKBB 1IUEA 2WXKA 1JWMD 1TYGB 3VR9B 1DOXA 4A3MB 1RCVD 4BY7B 1FIQA 1Q10A 1SYCA 4O42A 4BA2I 3D6WA 1DOKA 1WTPA 1YN5A 4USAA 4DNRB 1B44D 2O5IC 5M9OA 1Y8PB 5JEAJ