1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1SEBD 5D3IB 5FK9C 1LTGD 2RDHA 3EFXD 1EEID 1SE2A 3R2TA 1S5DD 1BCPB 1CHQD 1BXTA 4RHRA 1FNUA 1ESFA 1RD9D 1S5BD 1TY0A 1SJED 1FNWA 1AW7A 3MFGA 1LTSD 1KLGD 4RGNA 1I4GA 3BYYB 1S5ED 1SJHD 1UUPA 2WV6D 1DYQA 1I4QA 1ET9A 1I4XA 2O2LD 1LO5D 2J4XA 5I4DA 1I4HA 3BYTB 1PTOF 1S5CD 5ELFA 2R61A 3SEBA 2ICIA 2NTTA 1KLUD 1RDPD 3BVMA 4RCOA 1CT1D 1G8ZD 1FNVA 2XRQD 1SE3A 4DXGA 2IJ0A 1JWSD 2Z8LA 4RHSA 3KLSX 1EU3A 1PYWD 1KTKA 1D5MC 4C56C 1HA5A 1F77A 1M4VA 1TS2A 3BZDB 1PRTF 3V05A 1YN4A 1PTOH 4DXFA 1PZJD 1ET6A 1LTBD 3R8BA 5ELDA 2NTSA 1LT5D 1XXGA 2IPKD 4TSSA 1YN5A 3DWQA 4K6LA 3URYA 4RH6A 1JWMD 1BCPF 4RGOS 1I4RA 1EFID 4RFBA 4UDUC 1T5XD 4OHJA 4L63B 1PZKD 1PTOB 1RF2D 1JCKB 1STEA 1V1OA 2XNAC 1B44D 3DWAA 2SEBD 1QILA 1ENFA 1D6EC 1LTTD 1PTOD 1JWUD 1LTAD 1XTCD 3BVZA 3CHBD 1D5ZC 1V1PA 5D3DA 1SBBB 3O13A 1B1ZA 4NZLB 4Z9CB 1PTOC 3DWPA 3GP7A 1FGBD 1TS4A 1TS5A 1HQRD 5TSSA 1HTLD 1L0YB 1TS3A 1PZID 2XRSD 1SE4A 1PRTD 4L6TB 1S5FD 3TSSA 1DJRD 1SXTA 4RGMA 4BWGB 5ELEA 4ZYSA 1PRTC 5ELCA 1I4PA 5FKAC 1RCVD 2AQ1B 2AQ3B 3R2IA 5ELBA 4RGTA 2XN9C 4O1NA 1LLRD 1D5XC 1BCPD 1FD7D 1LT4D 2QEJC 2AQ2B 2CHBD 1MD2D 2RDGA 3OWEB 1AN8A 3W2DA 1CQVA 3EA6A 1TY2A 1BCPC 1V1PB 1L0XB 1HXYD 1LTRD 1EWCA 1GOZA 1LT6D 1LT3D 1CHPD 1EEFD 1CK1A 1UNSA 1EU4A 1PRTB 2G9HD 3BVGA 1LTID 1JR0D 1JQYD 1YN3A 2QILA 3MC0B 2TSSA
chains in the Genus database with same CATH superfamily
1WJUA 4JGHB 2ICEC 1EIYB 3STBC 2E5LQ 3E5SA 5D94A 2WDTB 2JXTA 2WB1B 1DGSA 4LDTD 3KDFB 5M3FG 3RZDB 2O6VA 3I72A 1XNQQ 4OVVA 5JXVA 4JK1C 1JMCA 4A93H 5EPJA 1N63A 3VR8B 2BW2A 2EVBA 2ALYB 2DAFA 1SSNA 2EMSA 4ZRQA 2C5LC 1NE3A 3NS1A 2DHZA 2B2YC 5GMVA 3T3NA 2E5LL 3JYUA 4K5WA 4PS3A 1L6UA 1C48A 1NI3A 2KDEB 1I4GA 5BN4A 4G7OC 3C46A 3UGBB 4AUQC 5C3WA 5CV5A 1LYLA 3EVQA 5IP7H 1YIJA 2BYTA 4BY7G 1I4QA 3VA7A 1M94A 4YSYB 1V8QA 2FUHB 3MXNB 4K8IA 3Q8BA 2WU5B 5C4JB 4ZRKA 5I4DA 4C00A 2F0GA 2GN5A 5ELFA 3RLFA 1A3VA 1E0BA 4K81A 4JG2A 1V1QA 4W9GA 4JI0L 1KH0A 1T0SC 1E10A 2B2TA 4GDLB 3M4OB 2OOBB 3HOYG 4KHVA 1WJ4A 2QCZA 1QOAA 1VZ8A 1LM8B 5BYRA 4AJYB 1DONA 1JWSD 4TKNA 5GADC 4C3IG 3CP0A 4BVUC 5JEAH 2CR5A 2G1EA 1S1QB 2MP2A 3K9OB 4EEWA 1L4ZB 3E0JA 3RLNA 1GUWA 4BKSA 1PH5A 5H8YE 1PZJD 4II3B 5LHY1 4K7WA 5LMNQ 2WIIB 4LJPB 4CKEA 4DV5Q 1I50B 1V6EA 1H9RA 3JVZX 3I5JC 2KOXA 2QDLA 3TZUA 4KDLB 4MT5A 3F2BA 4OWWB 4K6LA 1UH6A 1ZE3D 3KUDB 3QHTA 3I4NH 4WJ4A 2WXHA 1J9OA 4GLXA 3PV1A 2A6HD 2QKIC 3UE1A 2E2HB 5LMNL 2XBBC 1NMFA 5IYCG 4HIDA 1R4MI 4M8NA 4L63B 4I65A 3D0FA 1WTOA 2GVAA 4MM3A 1VQGA 4P72A 4RM8A 2EE1A 1RRBA 2EQSA 1U4PA 3CMMB 3KUPA 2K33A 4EX5A 4W9HA 3FKIG 3NBHA 2ZM6L 2K9XA 3QARA 3EUB2 4ARIA 1MSHA 3FILA 1KF6B 3GP7A 2A6EC 2ID0A 3FPPA 4HTHA 3IHPC 4CYEA 4HXDA 3A1QB 3GTJB 5D6JB 1HQRD 1EWHA 3DM1A 2NS5A 3H94A 2I38A 2MJ8A 4QCLA 3DPDA 4HK2A 5D65A 3VFKA 1E2WA 5M5XB 1CKNB 4DUZL 2W3RA 3AEDB 4JL9A 4XWWA 4ZYSA 4WRDA 2PI2A 5ELCA 1PFSA 2UXDQ 1RCVD 2KX0A 3N32A 3AFQA 4LTUA 5ELBA 4E74A 1O7LA 2OQ0A 1BKBA 3G7LA 4DNTB 3HOZG 3QJYA 3CD6A 1P1AA 1WIAA 2LRUA 2EXZA 2N0SB 3HP3A 3GV3A 1SFOH 4R4TA 2E2IH 1F9SA 3AFPA 4QF4A 1LABA 2OJWA 4W9EA 4KN7C 4K3CA 2GVBA 4RMFA 5NUCA 4C3HG 2LGDA 3S1QB 2GBRA 5EE9A 1EEFD 1QLBB 1EU4A 3QQ8B 2JUOA 1X55A 3MZ5A 4PMCA 2K01A 1WTQA 1SMXA 2BH8A 5D3IB 3S14B 2K8BA 1K0RA 2UUCQ 2ZJQA 3PO2G 1WY8A 1SE2A 3G71A 3QWZB 2AEHA 2WHIA 4I6LB 4WQOB 4JWSC 4NJ6A 1TVXA 5AZFA 4RHRA 3BK2A 1OXUA 1EY0A 2Y0SB 2RGFA 4KY5A 4K2KA 5J17A 1BUIC 1FXAA 4FYDA 3MFGA 3S1RB 4WJWA 2ON8A 5MPOA 4DAYB 3QA8A 5DPWA 1WOCA 1H9MA 2LMCB 1A3TA 3EQLC 2KD0A 3AU7A 4NB3A 5CX3A 1WRDB 3H7PA 4CBVA 3KBGA 5G55A 2UXCQ 3TP5A 2IBIB 2UU7A 2DN8A 4DR6L 3MC8A 1VQFA 4NNJB 3NY5A 3PHWB 1E2VA 2EY5A 3ND8A 4CHTB 3A7LA 4WWMA 4XDCA 1CM9A 1EU3A 3BIID 4HWIB 1LQBA 1J5EQ 4MJSB 3LWUA 5LL6S 2UXCL 1FO4A 2LD9A 3AM9A 1ZXTA 1O78A 1Y8PB 1ET6A 2M17A 3V60A 4YY3L 5GAEC 1RFKA 3VR6A 3UIOB 3RCZA 5C4XH 5IOCA 3OTOL 5CBEE 1YHBA 1KJTA 3GDEA 1WX8A 3DWQA 2HIXA 2ONQA 1E6EB 1EFWA 4BBRG 2NN6I 3A54A 1LM0A 4JOIC 2F0NA 2W82A 4FP5D 4ZAIA 5HURA 4FULA 4PK1A 1VQPA 2IWHA 4QB4A 3G4SA 2MPMA 1MI2A 5IYDG 1WD1A 2MLBA 2D3GA 4NY0A 1P8LA 3S24A 3VR9B 3VR5A 2R93H 2DNFA 4KKSA 3DHQA 1ROEA 4M0WA 3J81i 3M7NA 1FXTB 1MGSA 3P20A 1PVOA 3LXFA 1E90A 2R6GA 4CKCA 1WMHA 4TV3A 1D8LA 3SD5A 1EY9A 2BS2B 1TXYA 4J15A 4IZ8A 4ZRZA 4DGZA 4K5XA 4K0KQ 4NQKE 4TUUA 3F1ZA 4KJOA 1Q81C 3G48A 2GMIC 4XQJA 4TRDA 1YJIA 4Q5VA 3ZVVA 5AFWA 1ZGUB 2XGTA 1WYGA 2B2YA 3AI5A 5LXIB 1WJJA 2KJHB 3CCJA 1VQ6A 1IKLA 2NN6G 1GVPA 2VY3A 2O5JC 3Q8AA 4HDQA 2N7DA 4A3FH 1HTQA 1KRTA 3PQIA 4K0KL 5COYA 2PQEA 2X38A 4LJZC 3CKIB 3I73A 3K7AB 2AQ3B 3RUZA 2I1JA 2K39A 3B2FA 2K5NA 3DBRB 1HZ6A 3PGEA 2BS4B 2XN9C 4KV2A 4LF4Q 4BY1H 3IVFA 3PUXA 1U9RA 1Y8OB 2RDGA 1G6PA 1WWTA 3S9WA 3H6NA 3VDZA 4DR4Q 2BPSA 4OL7A 1LTRD 1GOZA 2Y3AA 1EYCA 2N3SA 3S15B 2BOSA 4DR7Q 2LEKA 1CHPD 4EVOA 2WX0A 3TEZA 4TQ1A 2B3GA 1JW9D 1NNXA 4C2MB 2N9PC 1JR0D 4IG7B 4PYZA 1HNWL 2XSCA 2TSSA 1VS0A 1FR3A 1UBQA 2F3WA 1I3QH 5FK9C 2GBJA 5IA7A 1WJ6A 3U2SC 1JE5A 1SGHA 2RKSA 2RHQB 4FA6A 5FLXc 4ALPA 1S5DD 4C3JG 1SF0A 2B39A 3KLSA 3I4NG 2MWSB 1Y1WH 2NVTB 3C1FA 4YIJA 4HEA1 1I6HH 1ESFA 5FJ8H 4KKTA 2KBNA 4KHPL 1B4OA 1SJED 3W1GA 4OWTB 1F2RI 2LUMA 3AE1B 5FR6A 2KZRA 1O80A 2JEAI 2Q5WD 3ZKJC 3I9V1 1TWAB 3CSTA 5JPMC 1L0VB 1H9JA 3GV6A 3J81L 4FF4A 3P7JA 5HFYA 3K0YA 3TEWA 3U4ZA 4RWSC 2R92G 2KWUB 2DBYA 1LO5D 4OGQC 2MBQA 4KY6A 1I4HA 1EUVB 4ACFA 1CI3M 1QNUA 4DR1Q 2L00B 3KF8B 2R7ZB 1MG8A 5DM63 3H0GB 4JVZA 2WB1E 2CH4A 1FNVA 3NZUA 1WX9A 4ANWA 4IFDJ 4ZKCB 5LMUL 1EWYC 2LJ5A 2R7DA 4DXAB 3NTIA 2EYLA 1SR3A 4X65Q 2BH2A 1GKHA 4DR1L 3KF6A 1Y56A 3PZDA 2WAQB 3KVFB 3U4EG 1EQTA 1PRTF 3JW0X 1PFMA 2PLPA 1QOBA 1SSOA 3FVQA 2YTXA 2ES2A 1OQQA 4JI1Q 2K04A 1I6VC 3W5OA 3K58A 4X65L 3HRZC 4XXEA 2V1YA 1LUZA 1HJPA 2IX0A 1IBLQ 3AE2B 4B95A 4GLAC 1XMQL 2H88B 5C2TB 4N8FA 3IAYA 1KLVA 4UP7A 4NW2A 4LNQA 2EMTA 4ICVA 5DNFA 1ENCA 1YBYA 2Q2IA 3PO3H 4OHJA 5IGFA 4JI1L 1V86A 2L05A 2L0FA 2CJOA 2LJIA 4JPBW 2K6DB 1WX7A 5EE0A 4PZ7A 3J81j 1JWUD 2C5CA 1KQSA 5JOBA 1GJZA 2QMTA 4YTMB 4KKUA 2V3PA 4WJ3M 2KMAA 3DQVA 3VRAB 1JICA 3MXUA 3NOBA 2INPE 3VUXA 3OW2A 2JY6A 3N6RA 3W5UB 3QB3A 3AE3B 4WJQA 1FRRA 3QWNA 2F3IA 1BT0A 1PZID 2IX1A 1EZ6A 5BN5A 3LWEA 2M1MA 2JT4B 4B3TQ 2M0AA 3VTVA 2NZHA 3NHHA 2D2CC 1KRHA 4YXDB 4RF0A 3B2GA 5KRUA 4P6VF 2AQ1B 4B3MQ 3J9CA 5IP9G 4CKBA 1R9TH 3AU5A 4HRSA 1R7SA 3NVVA 3E56A 3ML9A 2DYOA 1EO6A 4IW0A 4CJ0B 1K52A 4V0BA 3PSIA 3OWEB 4DUYL 1XPOA 2K5QA 2V4DA 4NXMQ 2J0JA 3DWGC 4AYBG 2QEXA 2KWVB 1V1PB 4L5TA 4BBSB 4QIWE 1HXYD 1XLPA 1RFAA 2JEBI 1L6VA 1LXDA 1LTID 4GOPC 3VR3A 1ZXHA 3QOLA 1SROA 1HNXL 1XO3A 2KC2A 1SEBD 2N49A 3CQZB 1GAQB 2CCZA 3I55A 4JI7L 1SIJA 3R3OA 5DCNA 1TIID 1TYGB 3NTKA 1MHXA 2MCNB 4JBKA 3GTQH 5HGQA 2MUYA 3PMFA 1GD7A 2IGDA 2PZWA 1AFPA 4JOIA 2VUMG 4GXBA 3TQYA 1TY0A 3J80i 3AB9A 1FNWA 1AW7A 2BGFA 2L83A 4RMAA 1N8RC 2R93G 3DBHI 5IP4D 4F87A 5CGKA 1NCVA 3CCRA 3P4SB 1QVCA 1S5ED 2VQEQ 1TZOA 1X6OA 3IAM1 2KMMA 1WGRA 4DNRB 3U7ZA 1A0IA 4KK7A 3PLVA 3QX1A 4IUPA 1UEAB 4GSWA 4DV3L 2GBNA 4YT0B 2RMMA 1UF0A 5IOIA 2MBHA 4YTPB 4GZYC 2E2DC 3DEPA 4GN4B 3MTSA 5LMNW 3P63A 3IT4B 3T8MA 4A3JG 5EE1A 5I2YA 3U8ZA 4GNXA 1WF9A 2ZTDA 3V96A 2KTRB 4A3FG 4ICUA 2EKEC 2MFIA 1Z2MA 5BYSA 5E3FA 3OW7A 5D7GA 4NP5A 3HFZB 3MHZA 4ANXA 3DBLB 3OIPA 4A9AA 4BY1G 5L37A 2K7VA 4IN3A 4IWQA 1TZ1A 1U4AA 4LFAQ 2HD3A 1PMRA 1WCMH 4NXNL 4M01A 4MGYE 3Q3JA 4A75A 2K1BA 1A6XA 2IY1B 2WDVB 1JWMD 4DV2Q 3LJ3A 3ITPA 5JJKA 1PH1A 1KM7A 1IW7C 1WXAA 4DHZE 5J3BA 4F7XA 4LFAL 1PZKD 2AKWB 1STEA 3X3MA 1XNRL 1JOOA 4XT1B 4JYAL 4W9KA 1B44D 4XGAB 1Q5WB 3E6ZX 3RD4A 2K6QA 2AX5A 4CDDC 4DV2L 2K52A 1B9NA 3GTMB 4K8JA 2LZ6A 2K8CA 1F9QA 2WNMA 2RBMA 4KVGB 3DWPA 2JQOA 1Y1WG 4S0RA 3UI2A 1P7FA 3J7A5 5FJ8G 2YU9B 4EKUA 4WAFA 1UWVA 3A0JA 1CA6A 1L5PA 3J80L 4HCSA 2VS1A 1SE4A 1PRTD 2YTVA 5M5YB 2OTLA 1OTCA 2N7EA 2QDFA 2L15A 4MN3A 2BYFA 2BS3B 2B63B 1EY8A 5I2XA 3T53B 5JVG3 2FIFA 1HCZA 2KFKA 2WKCA 3E9IA 3X0WA 2F0IA 3ZXRA 3A33B 4A3DH 2JRIB 2B2UC 2K5HA 3VYRA 3Q6BA 5FLXE 5FO9B 3AV8A 1DOLA 4FJVB 2JU6X 4OO1H 2PIAA 2EJFC 4NAWB 1V9JA 3WALA 1WTRA 1PH2A 4EQ5A 3Q3NC 1RODA 1MBYA 3A9JB 3HOYB 3H1UA 3HOVH 2L9HA 5C4HA 1ILPA 1NBWA 2MNAA 2I46A 4XDDA 3K80C 2BBCA 4C3IB 2J0KA 2LGSA 3FRPB 4KD4A 2R7ZG 3I4MB 3EHVA 1G2SA 4N8X1 2C7NB 2EIFA 4PMWA 2FINB 2W9NA 3J7AF 2MA9B 3CCSA 2K05A 1BDOA 3ZYYX 2MJEA 2LFIA 4F7ZA 2F4VL 5KGUA 4CDCC 1LFDA 1EY5A 4V190 4XIGS 2KEDA 4DBGA 2XWBB 3GOEA 3MHBA 4J3OD 1A8VA 3BJUA 1TT2A 3CCMA 2C7HA 2CWAA 1V49A 2KXJA 4GDKA 3HOWH 2WLBA 3BINA 2ZXRA 4DPGA 1WD0A 1IYJB 4OIJA 1XYIA 2G45B 3VRBB 1TWHH 5JHAA 5J39A 1PH3A 1SJHD 2K5VA 4JI5L 4A3MH 1XEEA 4P1BC 1UUPA 4KV6A 2MGSA 1ZW7A 5HY6A 1GNUA 2X6LA 1W3SA 2BA0A 2CHWA 3NS8A 1BBXC 1JROA 4E71A 5BMHA 5FOBB 2Z4IA 1PA6A 3X23A 3SVMA 1CT1D 2YEPB 3ZNGC 1BOSA 1YJ9A 4HSVA 2MHVA 1C8CA 3I57A 1F2ZA 1JORA 2GBMA 1SNPA 2L7RA 2IY0B 2ZCCA 1VQMA 3JSVA 1R4MB 1C4AA 1QKZA 3NPPA 1D7QA 1O7ZA 2LXKA 1NI2A 1HPCA 1STYA 3HOZB 2DZIA 1TJEA 2J0TD 2E75C 3AE9B 4JE3B 1Y1VG 1VLBA 1AZPA 1R4QB 2PO4A 1YN5A 3MEFA 2B2VC 3X3NA 4N9F4 4C80A 4GMVA 4GLVB 4C3HB 1HE8A 4U68A 4ULLA 3IBEA 4B0EA 2MH7A 3J80c 4I6PA 1VQEA 2AL6A 1F2RC 4II2B 4DR5Q 1SNQA 1SN8A 4O42A 3K5NA 1YZ6A 2EYFA 4X3TA 4JI6Q 3RNUA 4DV0L 4GOPA 5DPTA 3NE5B 3AEEB 1QILA 2FFKB 4BBSG 3PO2B 2PTLA 3DLLA 2JXMB 4HCPB 3ZRCA 4D2KA 1QE6A 3VR2A 2DUDA 2WAQE 4DV7Q 1UGMA 1P3QU 1GUNA 5KYLA 4JI6L 2LGIA 5DPSA 3T16A 5KNBA 4B9WA 1S3OA 4KD3A 3PIP3 1C0AA 3W1BA 5FR3A 3DWMA 2RPQA 3A9KA 2K0PA 4IM2A 4W9IA 1O7YA 2XRSD 3ZIMA 1OGWA 4BKSD 2ATWA 4EUTA 3FC4A 2JA6H 2AWOA 1DXMA 3MXGA 1I94L 2ZJDA 3K9PB 1Y8NB 5ELEA 2INDC 3NG0A 1YNND 1ONLA 1GC7A 3DBLI 1SYGA 1FD7D 1H9KA 3K5MA 1VQAA 2F0KA 1QVGA 2CJNA 4JI3Q 2M8SA 3S2AA 3ZRFA 1Q1OA 2RF4A 3AE6B 1PYSB 1U0LA 1WYWB 1U4MA 1N5XA 4MGIE 1YX5B 3ZDMC 1HR0Q 2HUGA 1STHA 1FJGQ 2NPTB 1RTNA 1CK1A 2EXDA 3APCA 5IGBA 3RYTA 3ZNID 3WOFA 3KWVA 1II3A 4KZ0A 2NUCA 3V6CB 1YJNA 2RDHA 3I70A 1RLFA 2VW9A 1HR0L 4HAEA 1LGRA 4KSLC 4IPGA 2A69D 1CSQA 4BBRB 1WZ3A 1X3GA 4M02A 2CHXA 4LJOB 1P9DU 3DEOA 3OWFA 3K5OA 1TWCH 5JVH3 3S1NH 2Z59B 2Q2HA 1MIUA 1K53A 1FCLA 1B8AA 3Q23A 3VTWA 4OO1I 1WGGA 4EQPA 4FXCA 5GROA 3AE5B 3K7UC 3KBXA 1JRUA 2BE5C 2IT1A 3ER0A 3L0WB 1DM0B 2PE9A 1H9SA 2I5LX 4EZLA 4XE0A 4ILWA 2KWDA 2OXPA 2JA7G 2PNRC 3RNEC 3TEHB 1KDCA 1GUGA 1V81A 2HDLA 2KTFA 2AWNA 3OIQA 4A4IA 3KLRA 4CDEC 4Y7NB 2Q2UA 1NR2A 2H4OA 2PW7A 3I56A 3NWSA 2IJ0A 2Z8LA 3ZJUA 4IPHA 5CC4A 4LNKA 1D5MC 2WGSA 1SB3C 2I1KA 4A3DG 1AH9A 2NBVB 1PYBA 4JBWA 1IGDA 1TTNA 2NVXH 2EOTA 2B2UA 2KQSA 1YHAA 1HH2P 5ELDA 3G6EA 4OO1G 1LTLA 1MVKA 1B3QA 2NTSA 2B63G 4P2CB 4JI0Q 4FF1A 2GRIA 1IHZA 2NVYH 3N1YC 3RNCC 3HOXH 1NYRA 3OMGA 2IPKD 4OW0A 4NJCA 4IFDI 5D2MB 2J7QB 5J2RA 4HR7B 4HKZE 1BF4A 4FBJB 3CPFA 2ZXPA 4DHJB 4DAMA 4APVA 1HZAA 4UDUC 3D32A 3RPFC 2W55A 3HVZA 4J6HA 5J22A 1JCKB 2LXJA 3OYYA 1RYJA 3ECIA 2KK8A 2PW9A 1VCBA 4FJYA 3PGZA 1N60A 1A5RA 3NBIA 4XT3B 1WM2A 1B53A 4W9DA 1SBBB 1NDDA 1I7HA 2IHFA 4A3KG 4OIKA 3CCVA 5E4XA 4C3JB 4Z9CB 4ZCKA 4LWCA 2EDGA 3RZDH 2A8VA 3I4MG 4ZKBB 1MSGA 3TN2A 3I4NB 2YLMA 2W54A 1PV4A 3ZNHB 3H6MA 4JCVE 5BYQA 1E7ZA 1PH6A 1IP9A 2A5UA 4BAXA 1K3RA 4A3CH 2RSOA 3Q3FA 5C3XA 4DV1L 2NB0A 4IFDG 3CXCA 4EQOA 1HZCA 4YL8A 3A4RA 4FXGC 2F0DA 2K50A 2ZM6Q 2R92B 2D2QA 3L16A 4RM9A 4WWOA 2JA8H 1ISNA 4ZUJA 1YJJA 3QK0A 4A3EG 3IFWB 4F1SA 3L3OC 1F1HA 4DR2Q 5LLIA 4DV6L 4URKA 1WFQA 1AN8A 1LV9A 2D11A 3M4OH 4KJNA 1Q12A 1WYDA 1E24A 1B9RA 3AE7B 4G4KA 4DUZQ 5JJLA 3FILB 1CZPA 3STBD 5GAHC 4DR2L 2L76A 3Q6SA 2QILA 4A3IG 1VQ9A 2RCNA 2XVSA 4R4OA 3I3CA 5K36H 1FM0D 3NEMA 3G6JB 4RNAA 3BY4B 2E2IB 1OTRB 2KN5A 1HQMC 2BVCA 4LFBL 5KNDA 1NEKB 1BCPB 4OZAA 1PDQA 2VH2A 4W9CA 5AZHA 2B2VA 2F0EA 1E3PA 3ULJA 2E2HH 1WR1A 1UE1A 2LS01 2EELA 3ONSA 3QAQA 1K0SA 3A1QA 5IN7A 3FEWX 2DZMA 2EKIA 2KHWB 2MJ3A 1B50A 4DV4Q 2RSNA 3UDGA 3NENA 2JYEA 3ZUNA 4OWXB 4CHKA 2B3AA 1I35A 4CJ1B 2JVCA 3U7DA 3HOUG 1UD7A 3Q22A 2WXMA 4DR3L 1IL8A 4ZRJA 1WI0A 1SYDA 4LF9L 3HGBA 1P7EA 1YD8U 3CCQA 2KLCA 3HZXA 4DV4L 3M95A 1NENB 1VZ6A 1YQ4B 3GO5A 2K4KA 4X3KA 3DVGX 3ZJVA 4XTCS 2IX3A 4RCOA 3T51B 2K6AA 4LDTB 2AUKA 3DOWA 2INNE 2F4IA 1K73C 1E7VA 3MC9A 1YNJD 4LF8L 3TCAA 2JA9A 4OX9L 1BVSA 2V3NA 1GM5A 5M5XH 3KLSX 1SDFA 4XYOA 4HJAA 4C56C 4A3BG 4KGSA 1DOYA 1HA5A 1X9NA 4IALA 1F77A 4PG3A 1EYDA 4BBNC 1K9MC 3DDCB 1W2BA 4WJPA 1JMLA 4EZKA 1JWBD 5DLQE 2WDRB 1UE6A 1UAPA 4DR6Q 1C4QA 3DUZA 1NYQA 2VRRB 3PIO3 4HJ8A 4HSPA 1F2MA 1K28A 2EY6A 2K28A 4AYBB 4DK6C 3WOEA 1VQ8A 3PRPB 3PZ8A 3CAMA 1JC7A 1VR9A 3GTOB 3KYHC 4RKBA 2OEDA 3S1QH 1HNZL 2LASA 2GBKA 1QOHA 4HROA 1BQQT 3WANA 5M3MG 4NQLB 4MTNA 4OELB 5GXGB 2E76C 1RF2D 2ACZB 4DU9A 1FCCC 2DZKA 1OQRA 2V1CC 4AH6A 2BDNA 5E6OA 3S14H 2DLBA 2HDMA 4YY3Q 5IAAC 2A6ED 3RD2A 4A20A 2EYPA 1XWEA 3P75A 3OTOQ 5C4XB 2EYOA 2LMCA 4C4VB 4CGYB 3A5UA 2ASQA 3H91A 1KDAA 3SK6A 4GB9A 1YI2A 2REXA 4N59A 3BDOA 3H09A 2VUMB 2MP1A 5C1ZA 1VQBA 3S1RH 1Z47A 2R93B 3TEXA 3W5VB 2Y5BB 1D3ZA 2ZNVB 3PS6A 1SXTA 2VNUD 3QCAA 4I6NB 4RGMA 3PRZA 4AWJA 4P75A 2L1AA 3RN9C 1TR5A 4WWPA 3UI3A 1Q8KA 2HHHQ 3HG9A 3GS2A 4MJSA 1TWFH 4GKJL 4GOCA 4CO7A 1L1OC 1VMCA 1ACCA 2LGXA 1GHJA 2E2JH 4DK0A 2UUBL 2K14A 4GKKL 3NVZA 4XYQA 3ZLZA 1KIXA 2PNHA 2VZAA 3KYCD 2KJXA 1TY2A 4A3JB 3NQIA 3PRMB 3RT3B 2HHHL 3SK5A 1EWCA 2AHOB 3AEAB 1BO0A 2D0OA 5C44H 4A3FB 4A93G 2O2VB 3H3VC 3EC8A 4L8JA 1VMPA 2F0HA 4ZHPA 2K25A 4IKGA 3PIOA 4EFOA 3DBHB 4FF3A 3TS0A 1TU2B 4BY1B 5J18A 4CQNA 2GB1A 5E6PA 3AEVA 1Y8RC 5L83A 4UP9A 5IP7G 1WGDA 3BS1A 4J6IA 1F0ZA 4HVBA 4ZUIA 5M9OA 1AE2A 1ZEQX 2WXRA 1B9MA 4AP4C 1WXSA 1RM6C 4FHKA 2OF1A 1FNUA 1HZBA 5DEHA 3M3YB 4PS7A 4TQ0A 4B3SL 2JJQA 5HI1A 3I4LA 1D1IA 4IM3A 1HNWQ 2L32A 2JSVX 2L8JA 4JX1C 3TMEA 2BYEA 1VQ5A 2CW0C 3IL8A 3L54A 2J53A 5JEAG 2WXQA 4LNOA 4AJWA 1ET9A 2F0OA 2P5ZX 1SLJA 4LNIA 3ZTDA 2N55A 1Y1WB 4IUUA 3EIVA 4AQYL 3HM3A 3M85A 1I6HB 1XTDA 2BTEA 3L10B 1SIFA 1A70A 1RDPD 3KJPA 4KHPQ 3Q69A 3A4SC 4K5VA 4R4IA 1V5TA 2CQOA 2NBFA 2NZ1D 4A3CG 5CHVC 4A3LH 5AUKA 1X3FA 4XQNA 2KUMA 1B3AA 4DNIA 3WDNA 3L9AX 1V43A 2JN4A 5C23A 1YQ3B 4PNYA 3AQQA 2HCIA 5KIXA 2BDOA 3GTKH 4LF5Q 1K3BC 4BS9A 2JA8G 3TIXA 4LFCQ 4FLHA 1MKHA 3AE8B 4JI4L 2B29A 1E7UA 1QT9A 2SNMA 5LMUQ 2LWPA 5ISRA 3S15H 3TZDA 1VQCA 4LF5L 3L0OA 3APFA 1JRPA 2I5HA 1DOKA 1FXIA 4LFCL 3N1XC 4G3XB 1EUJA 4C2MH 2Z0SA 2A5HA 4UP8A 1C9OA 3B0AA 4S17A 1KC8C 1V1OA 2LVOA 2NBUA 2ZCBA 4MZ9A 1ENFA 2W3SA 5K36G 4QAYA 2O5IC 2QJLA 1OO9B 4QUFA 4KMUC 3E9SA 4AQ7A 3L4PA 1EQRA 5I6YA 1XMQQ 2F0WA 3E9HA 4IUQA 2BKFA 5IGEA 4XX5A 4TKOB 1FGBD 4JI2Q 1AEXA 1F9RA 3QG1A 3RUIB 2Q8TA 3AE4B 3KF8A 2VH1A 5AZGA 2LFNA 3T13A 3V6EB 1AYFA 2LRWA 3O65B 3PV0A 4HDOA 3QOJA 4E6IA 4JI2L 1FVIA 4PV1C 3HK0A 2CHZA 1K50A 4L5RC 1UELA 1HR0W 4O1NA 3EROA 1LT4D 2QEJC 2QW7A 3LYYA 3FHWA 2AQ2B 5G5HA 2JP1A 3WWVA 3ABVB 1A62A 1EWIA 1Y69U 1E8YA 3RZWC 3UF8A 1N62A 4FADA 3R3MA 4GN3B 2UYZB 3VVWB 1XQQA 1DOMA 4MSQB 2A73B 3TBIB 5DAUA 1FD6A 1HTOA 3P4QB 4OXPA 2KCCA 4DA2A 4B3RL 4MH0E 4OZBA 3ZTCA 4XC2A 1LACA 1E8XA 2UXBL 1WR6E 1R9TB 1A2UA 4K2LA 2HE7A 2XWJB 4DUYQ 3VXWA 5CBAE 1Y1VB 1ZUD2 4BOZB 3J7ZC 2F0PA 1STBA 2FCSA 2LHEA 1P98A 2JE6I 3HEJA 2PMZB 5A2QL 1MHWC 1XPUA 2FCQA 2JWUA 3TREA 2WXPA 3HKZG 1SNOA 4P7IA 1RKNA 2ZXOA 2KN4A 3NVYA 2C9WB 4M00A 1B70B 1M90C 2C60A 4W9JA 3P1HA 4ODGA 2FJ2A 5IT9L 1HNXQ 1G91A 4JBJA 2AMCB 5H1SE 4PMBA 3AXCA 2TMPA 2G5DA 2F0JA 1C4PA 5T8IA 3APDA 2XIWA 4JI7Q 2N9LA 4QY7A 4GLSC 1S4ZA 5CV6A 4ZRIA 3GTQB 3NTHA 3RZOH 3HKSA 3EFUA 4G0NB 4P16A 4BOSC 4PT5A 3J81c 3SEBA 4DN4M 3RULA 4RKLA 1WI5A 2ENBA 1F9PA 5C4XG 4DFAA 2C35B 5E6NA 1SE3A 4QGUA 1HRJA 1E8ZA 3L17A 4B6WA 1NSNS 1PXUA 4LF6Q 3GE8C 2KCTA 1JB7A 4LK1C 2JA5H 1JOQA 2D3CA 3S2HH 5EJWA 3R93A 3K59A 2VZKD 4DV3Q 3GB1A 3PPAA 1JJGA 1HTPA 4RCNA 3UDXA 3NVWA 1L1OA 4LF6L 1EIHA 4XZ4A 2ZZPB 2QSDA 4IUTA 5EPKA 2L0TA 4RH6A 3U4VA 2KEEA 3RZFA 2R2QA 1IYUA 2M00A 2Z6KC 3DHHC 5C44G 2UWQA 4IOCA 1E0ZA 4TQUS 2DY8A 2GA4B 1Y14B 1EIFA 2K5PA 3LNNA 2ZEQA 2WP8J 1IBXA 2NYZD 3ULPA 3RN5A 3A7AB 3PCOB 2IDYA 4H0LC 1HZ5A 3CC2A 1YIWA 1LTTD 2KNBA 1QF6A 1QZHA 1QNKA 3P42A 1EY7A 4NXNQ 2Y0SE 4FXDA 3M62B 2ZT9C 2PJHA 2K75A 4MGZE 3RNGC 4GNXB 4JBMA 1L4DB 4NZLB 3VH4B 2R7FA 1FRDA 1PTOC 1C79A 3C2PA 2HJ8A 1CZGA 1QUQB 1RL2A 5EKKA 1TS4A 1BMLC 1CFMA 3AMUA 3H3VH 5TR5A 1V9PA 1ML0D 3NELA 3SK4A 4AYBE 1HTLD 4ZLTF 1XNRQ 2CS4A 4E3CA 4JYAQ 4L6TB 4N6EB 1FGUA 1T5EA 2D9UA 3I3TB 2EJMA 1DGJA 2Z1CA 3IT6B 3RI7C 1X65A 1TBEA 3QIJA 2B2WC 2XK5B 3AECB 2N9KA 2KACA 2CKHB 1PFNA 2JA7B 1K83B 3DVNV 3HUIA 1GUAB 3V62A 2E6XA 3S1MB 2JZPA 2DAJA 5C3JB 2L0CA 1D4BA 3BZKA 2R2OA 4DWFA 4TMAB 2YV5A 4WAAA 4KGTA 3D6WA 4H7BA 1E1OA 1VQHA 3A8KE 4HPLB 4R1JA 4L23A 3U58A 2JYOA 5E1FA 3V61A 4G11A 5IT9c 2EZVA 4A3DB 4X3UA 1WXVA 2KOLA 1RTOA 1RIPA 2JWZA 3Q3MC 3WIMA 2JX5A 3W1SC 2FHTA 4LMQD 2DJFC 5IWAQ 1LTGD 1EEID 2K3UA 2RD0A 2EYJA 5T1IA 2I0QA 4Y52H 1TKYA 4BXXH 3OSOA 3BK1A 2G4DB 4KN4C 1T3QA 2KFKB 1SNMA 3GTGH 5KYIA 2QHOA 4OVUA 1WSPA 2O4XA 2OCEA 2UU9Q 4KIKB 1EZ8A 5I6WA 1K8RB 5IWAL 1EOTA 1Q90A 5IE8A 4GN1A 2FCNA 3H15A 5IGGA 2IW3A 3BYYB 5ELOA 3NK9A 3QIAA 1STNA 3A5ZB 3N52A 3QJZA 3VYUA 1VQDA 3GTMH 2WV6D 2F4VQ 1MHHE 2UU9L 1FYCA 4A3KB 1A63A 5CORA 4P74A 4M1UB 1OXSC 5M3FH 2VB2X 3MXPA 1FEHA 3BYTB 3QC8B 1V80A 4ZRPA 5KHQA 1C7YA 2YU9H 4YCUA 4KGRA 3CF6E 3OAWA 3HOWB 4ARCA 2RDBC 1CKOA 1A2TA 2VL6A 3S2DB 1TWHB 2VXWA 1QOFA 4RF1A 2EPBA 4IJLA 3ERSX 4JI5Q 2DYMA 4BY7H 3RR5A 3BZCA 1T6BX 4A6QA 2B8FA 3JC66 2VZKB 3PO3G 4HEDA 3NXWA 2N8NA 3PF5A 2D3BA 3N1ZC 4GDKB 2D10A 1Q7YC 4A3EB 3NUCA 4MTKA 2DZJA 4ANVA 3CW2C 5CYUA 4NAMA 3HIZA 2GI9A 1LT5D 2NVQB 1IW7D 2KC1A 5I9OA 4X3SA 3PZ7A 1CSPA 1F9JA 1I4RA 4C3IH 2KVMA 1XLOA 1UBIA 2HD5B 2ZVNA 1HHVA 3HM6X 2BCOA 4LUZA 4XDXA 4X64L 4A3IB 1VDZA 2PCFB 2PZTA 2XNAC 4QJFA 4HMJA 4ASWC 1IBML 4JQWC 2EJGC 2N1WA 4UHVA 2KDBA 4N9TA 3SK8A 1YNNC 1WGKA 1A15A 2ZPNA 1YVCA 3C3LA 3AEGB 3GZNI 3ULLA 1MJEA 1IBKQ 2JZ3B 2O6VD 2MO1A 1IPGA 1C77A 5IYCH 1TS5A 2FUG1 5TSSA 3MAQA 2F0LA 1V2YA 4L1BA 4DV0Q 4BKGA 3SDZA 2L3ZA 1M1KC 2PQAB 1IBKL 3JAMi 2BQQA 4A55A 5EBCA 3FKIH 4KLKA 1TIFA 4P73A 1Z7TA 3KK7A 5EGTA 1VQ4A 3HOUB 4JV5L 2WXLA 4WFN3 1GUTA 3GTPH 4FO2A 2A1AA 3D3RA 1I42A 1D5XC 4HJ9A 1U5KA 4FDBA 4ZK9B 2A69C 1GUSA 3A8JE 4H44C 5T1GA 1DOIA 1PDXA 4HIKA 4PZ8A 1QWYA 1CQVA 2HQLA 3EA6A 4LLGM 1BCPC 3R7RA 2JXXA 4L5SA 1I94Q 3NZSA 2KJRA 2LGYA 2JA5G 3D6CA 4A3BB 2WS3B 3UQBA 1PRTB 1KD1C 2NCNA 4REZA 1TWGB 3ZJTA 4DK1A 3MFYA 3S17H 4ANUA 1YJ1A 3DXJC 3J81E 4WURA 2NR2A 4AS1A 3KOJA 4C3HH 1CHQD 4I7ZC 2KCMA 3RLOA 1JE4A 2L11A 2RHSB 2LXCA 2OT2A 1N36Q 2N7JA 4B9KA 5M3MB 2CFMA 2FAZA 2Z6KA 1VQLA 3TUOA 5AEKB 2QF7A 5L95C 1MG4A 1UWXA 4YSXB 5BMGA 4KKIA 5CMDA 3PO2H 5K5PA 1N9WA 5AJ3L 1VF5C 2DYBA 2WXGA 1IZ6A 4HMIA 2CQAA 4LW1A 3UDIA 1N36L 5C0XJ 3RNBC 1I4XA 1AWDA 3VH3B 2A68D 2J4XA 2NBWB 2PMVA 1J0GA 3SR6A 1ASZA 2ASBA 2QDBA 1TWCB 3BVMA 3MP9A 5JZEB 1WCMG 4O2DA 3S16H 4J8QA 1QG7A 2XRQD 1G291 1WXQA 2N1VA 4KZCA 1KNEA 1KABA 5C3EH 4L2YA 4P71A 5M5WB 1EOVA 3CCEA 2LVPA 3JAML 2ZW1A 1YJWA 3DCGA 3SU8X 3CCLA 1KAAA 1ZYRD 4YCWA 3EJIA 1WXMA 1SMYD 2NPTA 2ZPYA 3T9LA 3V05A 1PTOH 1WTWA 4IUNA 4YWKA 2B2WA 3OG5A 1J8IA 2V3SA 5IKCM 4EE2A 2V4LA 3Q2AC 5EDSA 2DENB 1WGHA 5G3LF 1EF5A 1R4PB 2L12A 2JRHA 2BWES 4LAAA 4LUVA 1YEZA 4TSSA 1QJOA 4BFRA 1OEYJ 4JIOU 3E3XA 2PZUA 2KQ7A 3UQAA 1E1TA 1GB4A 2PPBC 1TKGA 4A93B 1ZKOA 2F1MA 1EFID 2MJDA 4XYCA 2IYDB 2IO0B 3GE3C 3RNFC 3GTLH 2A6HC 2ZNVC 3PUZA 1LTAD 2FMCA 2NVYB 3N3KB 5ELNA 3HOXB 3OJ4B 4DAVA 1L0WA 4B08A 1G6ZA 2O6VB 4A3GH 3EGRA 4JPSA 4BBRH 5FLMH 4HJ7A 4DDGD 3T1HQ 3NZ3A 2YVCA 2VB3X 3NWTA 4L5QA 1EYGA 2RSUA 4MACA 2KWCA 2LSSA 3HS0C 5IYDH 5IIFA 1U4RA 5IT9E 2CWPA 4QMGA 2JYTA 2NVUI 2HQEA 3PF4A 3HOVG 4JI8Q 3CMEA 4MDKE 2KENA 2A74C 3T1HL 2K5DA 1GJXA 3KDFA 2RCFA 4LUOA 2KKCA 3R2IA 4YHHQ 2EYHA 5DM73 1IXRA 5EBDA 2WXOA 5EQ0A 1NAPA 4DAPA 4US8A 4JI8L 2MBOA 2CHBD 1MD2D 4FVMA 3I2ZA 3QR8A 4PS8A 4YWGG 4Y7NH 2Q8IB 3W2DA 3OOCA 3QO2A 4A76A 1XX8A 4RA8A 4DV1Q 1ZKHA 2NN6H 4FF2A 4YHHL 1LT6D 1XNQL 1MI0A 3IFDA 2FCMA 4KHZA 1VQIA 3MXNA 1QVFA 1N32Q 1J19A 2MP2B 2KYWA 2WWZA 2Z0DB 4CDFC 2L52A 1VQNA 3HOWG 4MH8A 3SFEB 4BBNF 1YN3A 3MC0B 2PKOA 2JA8B 3FAHA 5C5MA 4B9XA 4GDLA 4KTAA 2M4NA 1I5FA 3BDCA 3D8GA 4DV6Q 1UEBA 4A3MG 2JQRB 4KX6B 1GUOA 1N32L 4GN5A 4IC7B 1ZOYB 2M0XA 2D3AA 2L55A 3CWIA 2Y5PA 3Q8DA 5C4JH 4HN7A 3ZJYC 2ZJRA 1WVLA 2JK8A 4X66Q 3K6OA 1R4NI 1A3UA 1RD9D 1ZXIA 4MM3B 2OJRA 1YNJC 2BE5D 1AZQA 3PO0A 1LTSD 1KLGD 3JAMc 2KO3A 4POFA 1KRSA 2G9DA 3J7AV 1K8AC 1V8CA 2ZTCA 3NBHB 2CKZB 3VYTA 4I7AA 3PREA 4X66L 4ID6A 1T9HA 2OHFA 3PTFC 4HPPA 3VUWA 4C3JH 4LFBQ 3VTUA 1EL0A 3VQIA 1ESRA 2YTYA 4MNOA 2Y5CA 3WA0A 3TBLD 2F0VA 2DWQA 2X8XX 2IGGA 5CV4A 4DV5L 1I50H 1GO3E 3L2PA 2K8HA 3MJ5A 2DY7A 3OLMD 1SFOB 2KVRA 1IUEA 2QGQA 2X69A 1MFWA 1ZDVA 2HCCA 4IURA 4RHSA 3CIRB 3Q24A 1PYWD 2KECA 3T3OA 4BZAA 4MHEA 4EQNA 1SYEA 4IO9A 3D4RA 2R92H 1H95A 3H7SA 3W9CB 4ZHOA 4DR3Q 2LKVA 4B0MA 1TQOA 4WJOA 4QIWB 4HJ5A 1X56A 4LF9Q 3R8BA 1EIGA 1E8WA 2GLSA 3EFCA 1KDBA 2LHDA 2V4IB 1W6JA 3UINB 5JHBA 4XWTA 3ZXVA 1Q3LA 1GB1A 1CKNA 4DQOC 4LF8Q 1NMGA 1EQVA 5E7NA 4UPAA 4OX9Q 2BB5A 1IL2A 2ZJPA 3IXSA 1J6QA 4HPMB 3KWLA 4M8MA 2F0FA 3GTJH 4YWLA 1FMAD 3I90A 3SE0A 5A35A 1O7IA 2QA4A 3J80E 1VJKA 4F8MA 3BU2A 3L13A 3BVZA 3WCQA 3D4DA 2JA6G 1H8CA 1D5ZC 1F2YA 1AE3A 3MA2B 3VAWA 3IKJA 1RAXA 1XCQL 2UXDL 2Q8RE 3HKZB 2DGYA 2FMMA 1HNZQ 3RMHA 1WE6A 3KQ4A 3K5LA 1ILQA 3VR4A 3MTNB 1KFYB 4Q2JA 2G3QB 2RQXA 2WQYB 2WXNA 3PVLA 1YX6B 3KUZA 1PH4A 2KDFB 2IZVB 1HZ9A 5G3LD 5GQOA 3B9JA 4IPDA 3H7PB 1JALA 1HUMA 3R66C 3IFTA 3TP8A 3W1YA 2UUCL 3KH0A 3PLUA 3WAOA 4DAYA 3AH7A 3NSWA 3EBEA 2WXKA 2KANA 1QQRA 1PFBA 1F52A 5C3EG 4HLEA 1Q1EA 1HUNA 1P16A 3PUYA 4DKAC 3VHTC 3AULA 3U52E 2C7MB 3BVGA 3LDZE 1HA6A 5FLXL 5IP9H 1JQYD 4GKJQ 1TWFB 4WWNA 3L7ZC 5HKHA 3A8IE 3ZO5B 3J7YW 3SHQA 2L5TA 3ZNZB 4DHZB 2E2JB 2KLGA 2UUBQ 4GKKQ 4WIPA 2KAJA 2JSOA 4TVAB 1K8OA 3ZQ4A 2MQHA 2EY2A 3R2TA 3T1YQ 1T0RC 1XJVA 3GTOH 3Q8FA 2F52A 5C0XH 1BBUA 1VQOA 1QOGA 4C4VA 5CV9A 4YTNB 2HJ1A 3TL5A 5C44B 1YITA 1BBWA 2FBWB 5G2NA 2OTJA 2B8GA 3T4AC 4RGNA 4M0WB 2OQKA 2WXFA 3T1YL 3CMAA 1C78A 1JWAD 4ZQ3A 5J1ZA 4WJNA 1WMHB 2HDEA 4FN2A 2LVQA 2LUEA 1J5EL 1OEYA 3ZGZA 4A3GG 4MGKE 1Q1BA 5FLMG 1Q0WB 2MQJA 2RPVA 1OXTA 5KNCA 3L08A 2A19A 1RWSA 3AB5A 2L4NA 2R61A 3MJWA 1EQQA 2VUMH 3NHEB 4K7UA 2ICIA 2NWGA 4B3SQ 4PZ6A 2RDFA 5FO7B 4H02A 3HOXG 1F2LA 2KDMA 1KAWA 1IGCA 1SYBA 2D07B 3IAS1 3LB8C 5KHOA 4R8IA 5IGDA 3LX0A 1M4VA 2KMCA 1KNAA 1V5OA 1VQJA 2O2VA 4AQYQ 1LTBD 1FFUA 1I3QB 4G57A 3TP6A 3KJOA 4M8AA 1ENAA 2AL3A 2QC8A 4YCVA 1XXGA 3P1MA 2WB1G 4GNXC 4A3JH 2KFJA 2F0MA 1QCBD 3Q3OC 2BT6A 4MSMB 3B6YA 1YHQA 3A55A 3HHMA 2WINB 3GTKB 3M63B 1TGZB 3B1LX 2IGHA 2BYVE 1ICWA 2K03A 3K81C 4JI4Q 2H89B 4LCDE 4FNFA 1B1ZA 1KL9A 4H13C 4HIOA 2PPHA 3K7AH 3I91A 4C1NK 1WTPA 1STAA 1D1KA 4LF4L 3M3YH 1FFVA 2WU2B 3M4QA 5EKIA 1X1MA 2WXIA 4HJKA 2D0PA 3Q0AA 5BMIA 4W9FA 1L0YB 3SR1A 3CC4A 4P1CC 1C9FA 3M4PA 4GS3A 5KEEA 4DR4L 2YEPF 1TKWB 2PE6B 3HVDA 4BKTA 4DR7L 1FL0A 2N4FA 1JJ2A 3ENEA 1KHIA 2M2LA 3DMUA 4NDXA 4OEMB 3CF5A 1K51A 2F0UA 1H4RA 2QIEB 3Q8CA 1YQBA 4ZDVA 4DF7A 1LLRD 3N30A 2KVZA 3EECA 3M9BA 5BN3A 2LI5A 4U673 3EN2A 4AIMA 5JJIA 2ZW0A 2F03A 4XQQA 5JPNC 5F2DA 2J42A 2VQFQ 3DVNU 3SGIA 1L0XB 3PT2B 1DOXA 3KF6B 1W6KA 3K8AA 1S40A 3JAME 2NVTH 3CPWA 1UNSA 2R3ZA 3N9YC 3PO3B 3PSEB 3D31A 1N33Q 4C1NI 2VQFL 3RNAC 1TWAH 1CA5A 2SAKA 5JAVA 1OQYA 1XMOQ 2E3TA 4IPCA 2E74C 1J7CA 2XTIA 2BF8B 2Z4HA 2RA4A 1QB5D 3B08A 4FHJA 1XLQA 4J1MA 4HIMA 1GG3A 2JPHA 2I5MX 1PGXA 3AN1A 5LL6X 4B3RQ 1N33L 1G6JA 2R7ZH 1Z6HA 1N34Q 3ALBA 2CW0D 3H0GH 3I8ZA 1JQ4A 4UY8C 2J7ZA 4X62Q 2UXBQ 1XMOL 5EE3A 1WJNA 4R3DA 3SXHA 2IO3B 2M56B 5CHWA 4EOYA 1DYQA 1G51A 1ZDXA 4QQBX 1N34L 2C9OA 3DBSA 1WZ0A 5E6JA 3ICEA 5FO8B 4X62L 1HFGA 1PTOF 4W9LA 3FPUB 4A3PA 2NZOA 1WGYA 4ITKA 2IL8A 1ICFB 2LY7A 2PW5A 3KUCB 3VDYA 1BR9A 2F0TA 1G8ZD 4R8NA 1NVID 2FXQA 1Q46A 4OONA 1IBLL 3Q14C 2PVOD 3UE0A 1E5WA 2INCC 3MEHA 1QZEA 2SDFA 1KTKA 1Q10A 3U9OA 1XLNA 4F8CB 5HHDG 1RHPA 2MHJA 3C0RB 4EGVA 2QCPX 3BZDB 4IUVA 5C0XI 4ME5A 3TRZA 4IOAA 3RZOB 1YN4A 2WDQB 2WP9B 3MWYW 2K1FA 4MEMA 4K14A 1WM3A 3FP9A 3IRBA 3AEBB 3TEYA 4UAIA 1CQFA 3BDLA 2KHSA 3NQTA 3GZNB 4WQMA 2X6GA 3TDQA 2G4SA 4C7ZA 3SHLA 1GPXA 5E4WC 2V0GA 1EYAA 2JA5B 3C1EA 2Y0SG 1NY4A 4RFBA 1UWMA 3S2HB 3Q8EA 4JWUC 3SDLC 2BKRB 5CV7A 1X3EA 1XT9B 1SAPA 2F0SA 3DWAA 1D6EC 2PI2E 1XTCD 1Y1VH 3K0XA 1FPYA 1B7YB 4B3TL 1V1PA 2MO0A 3O13A 1N5WA 1XF5L 4K3BA 2SNSA 4B3ML 5C0XG 2LXAA 1CUKA 3NJTA 2Z9HA 2AUJD 3W3AA 2MX2A 4LNNA 1UE7A 4NXML 3H8HA 3MVVA 4A3OA 4H2AA 5HGTA 2F0QA 3FMCA 1L1OB 5GAGC 2PVGC 4BBSH 2RR9A 5IY0A 1VZ7A 1SE8A 1RJTA 1NBFC 2AYOB 3NRZA 1DCZA 1PRTC 1WFYA 3D4WA 3I63C 4S3SA 1CJEA 1V97A 3U9SA 1SYFA 4GGQA 2HTME 3MHSD 3CQZH 1IBXB 1WH3A 5CR3A 3BG3A 3V2TA 2RVLA 4X6AH 1G2TA 1WCMB 1CMXB 1Q86C 3HKZE 1VD2A 2IO1B 3F8TA 2KJ6A 5JH5C 1PFDA 1LT3D 2N9XA 2IO2B 4IOIE 1L2FA 2E8GA 2F3VA 4IWOA 4NKLA 1UGJA 4K7SA 3PUVA 3DBRI 4JLCA 1Z9FA 2ZVOA 3KW5B 5BO4B 1N6ZA 5IYBH 2CU3A 4G7ZC 3I4OA 3KFUA 3EFXD 1OFFA 4IDIA 4X57B 2VQEL 3CC7A 4ZYNA 3TMPB 1MPEA 4A8XC 4QL5A 2H1EA 3I7FA 5C4ZA 5HG2A 1SNDA 2K22A 2KTRA 4KI0A 3P4PB 4ZOHC 2BB6A 3SFDB 1YNTE 1QUQA 2K5WA 1S5BD 2A4ZA 1WRIA 3HRDD 2MBBB 1Q82C 2KHIA 3U30A 2J0MA 4A3LG 2KX3A 2NMQA 4G50A 4NMZA 4EZJA 4C7YA 4O0AA 1E22A 1BUVT 2AWTA 5G5GA 3H9DA 3RN2A 2ZTEA 4ME3A 3GTGB 2KDIA 2XK5A 3E0EA 1S5CD 4GIVA 4DDID 2D5DA 4N9PA 4RAUC 1J7BA 1OXVA 4PQXA 1JJCB 2WFWA 2YYZA 3HOVB 4DXGA 1IYVA 1S3SG 4NPNA 3A74A 1XCTL 1EY6A 5CHFA 4KY7A 1B2TA 4DK5A 1GXDC 5M3FB 3NUHB 3GQBA 1WTVA 2EY1A 2JA7H 1K83H 4K1RB 3PHXB 3S1MH 2WX1A 4HJGE 3LGJA 3DVGY 4KDIC 1CKMA 3URYA 5EKLA 5C6AA 3ETRA 1S72A 5CV8A 1BCPF 1VQKA 5JEAJ 1PGAA 2XEWA 4BY7B 1PGBA 3ZW3A 3UDFA 2DJGC 2BWFA 4KIKA 3PUWA 5M5YH 4NAWA 3F2DA 2JZZA 1JB3A 4LK0M 2SEBD 5JJZA 1PTOD 2B63H 3A9JA 3CHBD 2MEKA 3A56A 5D3DA 3TP7A 4HCEA 4A3MB 1IKMA 2FE8A 4KSKC 3VYSA 4NPSA 3DHGC 3WAPA 3KYDD 5C5LA 1WTXA 2B2TC 3M3JA 2I07B 3ML8A 2KHJA 3OHXC 3H0GG 2KQ3A 1UZXB 1TS3A 4X64Q 2H5XA 3HOYH 1JOKA 1TKEA 1IBMQ 4R9WA 3V3XA 1S5FD 4OVZA 3TSSA 1DJRD 1T0QC 3VA5A 4JW0A 2MW5A 4R4QA 4BWGB 4A3KH 4PYUA 2KCNA 4BA1I 3I4MH 5FKAC 1YMHE 2WAQG 2J52A 1K8MA 4RGTA 4F88A 5DPRA 3OMCA 1AARA 2CVRA 2DNEA 1J7AA 2I2YA 2PYKA 2D5GA 1NTGA 5EPLA 4HCNB 5LNK1 4WH4A 3S2DH 3K57A 3CSFA 2V9HA 4A90A 4IFDH 3U50C 3JSVB 4LF7Q 3WAMA 3FKIB 2WYQA 1FIQA 1R4NB 1PH8A 4POGA 4JV5Q 3GTPB 1AP0A 4A3EH 4R4CA 2M19A 5AUIA 2MRPA 3IG3A 2L1BA 1ASYA 2NVQH 1N61A 1X3PA 2A68C 1MJDA 2Z0EB 3CRLC 4LF7L 3FKYA 1Q8IA 1C76A 3ZDTA 1Z5SB 4K6DA 2CU1A 1BXTA 1U4LA 2WACA 2MBEA 2DX5B 5D14A 1ZPSA 3M4YA 1PH9A 1SRUA 2FIDA 4DK3C 2KQ4X 4AOFA 4ABNA 4GOPB 2JF5A 1JT8A 3OPOA 4A3IH 4KKJA 3M7GA 3AU4A 1DD2A 3TS2A 1ZYRC 1NUCA 3S17B 2JA6B 1SMYC 2WXJA 2PQAA 4FXKC 5IODA 1M8AA 4LNFA 1E2ZA 2O2LD 4YWMA 2N78A 2KA7A 1PH7A 4G7HC 1VF7A 3AMZA 3CU7A 5I9PA 3HOZH 4BA2I 3A9KB 1D2BA 4YSZB 1XD3B 2NTTA 3H3VI 1KLUD 1YOVB 4DHJD 1E7PB 2CH4W 2GOWA 3AYHB 1K8GA 1MJCA 3NP8A 1HFNA 3DM3A 5AJ3Q 1WTHA 1STGA 4HKQA 3DHIC 5EAYA 2Z6BA 2K32A 2MSED 2Q2TA 4USAA 1PQSA 3AEFB 3HOUH 2D62A 1TS2A 4DR5L 4CJ2C 4RG1A 1OXXK 4QUCA 4DXFA 3T56B 3CRKC 3N20C 2B76B 2EYMA 4NJ7A 3S16B 3RMKC 4DV7L 2OEOA 1L2NA 1KXLA 4Q0FA 4WORA 2BA1A 5C3EB 1VDVA 3ERQA 4RGOS 2UUAQ 4A3BH 4IUMB 1GHKA 5CTRC 5IO9A 3S1NB 1T5XD 2N88A 2OWOA 3P2BA 5LXHA 1KOTA 1PTOB 1TWGH 1NR4A 2PMZE 5IYBG 1SNCA 2WKDA 1GC6A 1HEZE 4US9A 2IHEA 1NJIC 1VCIA 1SE9A 1J8CA 1UE5A 1CZWA 2UUAL 1EM7A 2N9EB 2HT1A 1DZ1A 4MELA 2PEAA 1PHJA 3ND9A 4N58A 1BNZA 2HTHA 1EY4A 1PUTA 4IWPA 5M3MH 1P0RA 1WE7A 5BR8Q 1T0YA 4JI3L 4IM0A 1TT5B 5IGCA 3RFZB 1PLFA 1C3TA 1C1YB 3GTLB 3OJ3A 3FDTA 4MIUA 4GU2A 3VUYA 1SYCA 4IQZA 2DNCA 2FNJB 1FJGL 3TJPA 1IYFA 1H9SB 2HIVA 4A3GB 4FJZA 5H92C 1I4PA 2IY5B 3F2UA 5BR8L 3C19A 3GD7A 3F2CA 2NVXB 3UIPB 1BCPD 1L7YA 1EF1A 1E9MA 3KLWA 3W1SA 3R7QA 2KT7A 1VRAB 4IJHA 1X3QA 1X54A 1XPRA 1VQ7A 4BXXG 4JC0A 1QZGA 1YNXA 2M9VA 5A2QE 5M5WH 1C4CA 3CCUA 1ZP0B 3BWUD 3P4RB 4OZCA 3ONAB 3PIPA 2G9HD 1X32A 2SOBA 3C8YA 1CTMA
chains in the Genus database with same CATH topology
2ICEC 3E5SA 2JXTA 2WB1B 3RZDB 3I72A 5JXVA 4JK1C 3VR8B 5EPJA 1N63A 2BW2A 2EVBA 4ZRQA 1SSNA 3NS1A 2B2YC 3T3NA 4K5WA 1L6UA 1C48A 1NI3A 1I4GA 5BN4A 4G7OC 3C46A 5C3WA 5CV5A 3EVQA 2BYTA 1I4QA 3VA7A 4YSYB 1V8QA 3Q8BA 4K8IA 2WU5B 5C4JB 5I4DA 2F0GA 5ELFA 3RLFA 1A3VA 1E0BA 1E10A 1KH0A 2B2TA 4GDLB 3M4OB 4KHVA 1QOAA 1VZ8A 5BYRA 1DONA 1JWSD 4C3IG 5JEAH 2G1EA 1L4ZB 3E0JA 1GUWA 5H8YE 1PZJD 5LHY1 2WIIB 4CKEA 1I50B 1H9RA 3TZUA 4MT5A 1ZE3D 4K6LA 2WXHA 1J9OA 2A6HD 2QKIC 2E2HB 4L63B 4I65A 1WTOA 2EE1A 1U4PA 3KUPA 2K33A 3NBHA 2K9XA 3EUB2 4ARIA 1MSHA 3FILA 1KF6B 3GP7A 2A6EC 2ID0A 3FPPA 4HTHA 3GTJB 1HQRD 1EWHA 3DM1A 3H94A 2I38A 2MJ8A 4QCLA 5D65A 1E2WA 5M5XB 3AEDB 4XWWA 2W3RA 4ZYSA 4WRDA 5ELCA 1RCVD 4LTUA 5ELBA 1O7LA 3G7LA 4DNTB 3QJYA 2EXZA 2N0SB 3HP3A 3GV3A 1F9SA 4QF4A 1LABA 4KN7C 5NUCA 4C3HG 5EE9A 3S1QB 1EEFD 1QLBB 1EU4A 3MZ5A 4PMCA 2K01A 1WTQA 5D3IB 3S14B 1SE2A 4JWSC 1TVXA 4RHRA 3BK2A 1OXUA 1EY0A 2Y0SB 4KY5A 4K2KA 1BUIC 1FXAA 4FYDA 3MFGA 3S1RB 4WJWA 2ON8A 5MPOA 1H9MA 2LMCB 1A3TA 3EQLC 3AU7A 4CBVA 3KBGA 3TP5A 2DN8A 1E2VA 2EY5A 3ND8A 4CHTB 3A7LA 4WWMA 4XDCA 1CM9A 1EU3A 3BIID 3LWUA 5LL6S 1FO4A 3AM9A 1ZXTA 1O78A 1Y8PB 1ET6A 1RFKA 3VR6A 5IOCA 5CBEE 3DWQA 2ONQA 1E6EB 2NN6I 3A54A 2F0NA 2W82A 4FP5D 4ZAIA 5HURA 2IWHA 4QB4A 2MPMA 1MI2A 1WD1A 3VR9B 3VR5A 4KKSA 3DHQA 1ROEA 4M0WA 3M7NA 1MGSA 3P20A 3LXFA 2R6GA 4CKCA 1EY9A 2BS2B 4ZRZA 4IZ8A 4DGZA 4K5XA 4KJOA 4XQJA 4TRDA 1YJIA 4Q5VA 5AFWA 1WYGA 2B2YA 1IKLA 2NN6G 2O5JC 3Q8AA 2X38A 5COYA 2PQEA 4LJZC 3CKIB 3I73A 3K7AB 2AQ3B 3RUZA 3B2FA 1HZ6A 2BS4B 2XN9C 3PUXA 1U9RA 1Y8OB 2RDGA 1WWTA 3S9WA 4OL7A 1LTRD 1GOZA 2Y3AA 1EYCA 3S15B 2LEKA 2BOSA 1CHPD 4EVOA 3TEZA 4TQ1A 1JW9D 4C2MB 1JR0D 2XSCA 2TSSA 1FR3A 2F3WA 5FK9C 3U2SC 2RKSA 1S5DD 4C3JG 1SF0A 2B39A 3KLSA 2NVTB 3C1FA 4YIJA 4HEA1 1ESFA 4KKTA 1F2RI 3AE1B 1B4OA 1SJED 2LUMA 1O80A 2JEAI 2Q5WD 3I9V1 1TWAB 5JPMC 1L0VB 1H9JA 3GV6A 3J81L 4FF4A 3P7JA 5HFYA 3K0YA 3TEWA 4RWSC 2DBYA 1LO5D 4OGQC 4KY6A 1I4HA 1CI3M 1QNUA 2R7ZB 5DM63 3H0GB 1FNVA 4IFDJ 4ZKCB 1EWYC 3NTIA 2EYLA 1Y56A 2WAQB 1EQTA 1PRTF 1PFMA 2PLPA 1QOBA 1SSOA 3FVQA 1OQQA 2K04A 1I6VC 3K58A 3AE2B 3HRZC 4XXEA 2IX0A 2H88B 5C2TB 3IAYA 4NW2A 5DNFA 1ENCA 4OHJA 5IGFA 2CJOA 2LJIA 5EE0A 1JWUD 2C5CA 5JOBA 2QMTA 4YTMB 4KKUA 2V3PA 3VRAB 1JICA 3MXUA 2INPE 3N6RA 3W5UB 3QB3A 3AE3B 1FRRA 3QWNA 1PZID 2IX1A 1EZ6A 5BN5A 3LWEA 2M0AA 3NHHA 1KRHA 2D2CC 4YXDB 4RF0A 3B2GA 5KRUA 4P6VF 2AQ1B 3J9CA 4CKBA 4HRSA 1R7SA 3NVVA 3E56A 2DYOA 4CJ0B 1K52A 4V0BA 3U4EG 3OWEB 2K5QA 2V4DA 3DWGC 1V1PB 4BBSB 1HXYD 1XLPA 2JEBI 1L6VA 1LTID 3VR3A 1ZXHA 3QOLA 1XO3A 1SEBD 3CQZB 1GAQB 1SIJA 3R3OA 1TIID 1TYGB 3NTKA 1MHXA 2MUYA 3PMFA 2IGDA 2PZWA 1AFPA 1TY0A 3AB9A 1FNWA 1AW7A 2L83A 4F87A 5CGKA 1NCVA 3P4SB 1S5ED 1TZOA 3IAM1 2KMMA 4DNRB 3U7ZA 4KK7A 4IUPA 1UEAB 4YT0B 2RMMA 4YTPB 4GZYC 2E2DC 3DEPA 3MTSA 3P63A 3IT4B 5EE1A 5I2YA 3V96A 5BYSA 5E3FA 3OW7A 5D7GA 4NP5A 3MHZA 3OIPA 4A9AA 2K7VA 4IN3A 1PMRA 2K1BA 1A6XA 2WDVB 1JWMD 3ITPA 1IW7C 4F7XA 1PZKD 1STEA 3X3MA 1JOOA 4XT1B 1B44D 3E6ZX 3RD4A 2AX5A 1B9NA 3GTMB 4K8JA 1F9QA 2WNMA 2RBMA 3DWPA 3UI2A 1P7FA 2YU9B 4WAFA 1L5PA 1CA6A 3J80L 4HCSA 1SE4A 1PRTD 5M5YB 4MN3A 2BS3B 2B63B 1EY8A 5I2XA 3T53B 5JVG3 1HCZA 2WKCA 2F0IA 2B2UC 3VYRA 5FLXE 5FO9B 3AV8A 1DOLA 2JU6X 4OO1H 2PIAA 2EJFC 4NAWB 1WTRA 1RODA 1MBYA 3HOYB 2L9HA 5C4HA 1ILPA 2I46A 4XDDA 2BBCA 4C3IB 3FRPB 4KD4A 3I4MB 1G2SA 4PMWA 2FINB 3J7AF 2K05A 1BDOA 3ZYYX 2MJEA 2LFIA 5KGUA 1EY5A 4V190 4XIGS 2KEDA 2XWBB 3MHBA 4J3OD 1TT2A 2WLBA 2ZXRA 1WD0A 4OIJA 3VRBB 1XYIA 5J39A 1SJHD 1XEEA 1UUPA 4KV6A 2MGSA 2X6LA 2BA0A 1BBXC 1JROA 5BMHA 5FOBB 2Z4IA 3SVMA 1CT1D 2YEPB 1BOSA 4HSVA 2MHVA 1C8CA 3I57A 1F2ZA 1JORA 1SNPA 1C4AA 1QKZA 3NPPA 1O7ZA 1HPCA 1STYA 3HOZB 1TJEA 2J0TD 2E75C 3AE9B 4JE3B 1VLBA 1AZPA 1R4QB 2PO4A 1YN5A 2B2VC 3X3NA 4C80A 4C3HB 4U68A 4ULLA 4B0EA 2MH7A 1F2RC 1SNQA 4O42A 3K5NA 2EYFA 4X3TA 3NE5B 3AEEB 1QILA 2FFKB 2PTLA 3PO2B 2JXMB 4D2KA 1QE6A 3VR2A 1GUNA 5KYLA 2LGIA 3T16A 5KNBA 4B9WA 4KD3A 3PIP3 5FR3A 3DWMA 2K0PA 1O7YA 2XRSD 3FC4A 2AWOA 1DXMA 3MXGA 1Y8NB 5ELEA 1YNND 1ONLA 1SYGA 1FD7D 1H9KA 3K5MA 2F0KA 2CJNA 3AE6B 1U4MA 1N5XA 2HUGA 1STHA 1RTNA 1CK1A 5IGBA 3WOFA 3KWVA 1II3A 2NUCA 2RDHA 3I70A 4HAEA 2A69D 4BBRB 3DEOA 3OWFA 3K5OA 5JVH3 1K53A 1FCLA 3Q23A 4OO1I 4FXCA 4EQPA 3AE5B 3KBXA 2BE5C 2IT1A 1DM0B 1H9SA 4XE0A 4ILWA 2KWDA 2OXPA 2PNRC 1KDCA 1GUGA 2HDLA 2AWNA 3OIQA 3KLRA 4Y7NB 1NR2A 2H4OA 2PW7A 3NWSA 2IJ0A 2Z8LA 3ZJUA 5CC4A 1D5MC 1SB3C 4JBWA 1IGDA 2EOTA 2B2UA 5ELDA 4OO1G 1MVKA 2NTSA 2GRIA 4P2CB 4FF1A 1IHZA 1NYRA 3OMGA 2IPKD 4OW0A 4NJCA 4IFDI 4HR7B 4HKZE 1BF4A 2ZXPA 4UDUC 3RPFC 2W55A 3HVZA 4J6HA 5J22A 1JCKB 1RYJA 2PW9A 1N60A 3NBIA 4XT3B 1B53A 1SBBB 1I7HA 3ABVB 4OIKA 5E4XA 4C3JB 4Z9CB 2EDGA 3I4NB 4ZKBB 1MSGA 3TN2A 2W54A 3H6MA 5BYQA 2RSOA 5C3XA 2NB0A 4IFDG 4EQOA 4FXGC 2F0DA 2R92B 4ZUJA 1YJJA 3L3OC 1AN8A 1LV9A 4KJNA 1Q12A 1B9RA 3AE7B 4G4KA 3FILB 1CZPA 3Q6SA 2QILA 2XVSA 1FM0D 3I3CA 5K36H 3G6JB 4RNAA 2E2IB 1HQMC 5KNDA 1NEKB 1BCPB 4OZAA 1PDQA 2B2VA 2F0EA 2LS01 2EELA 3FEWX 2EKIA 2MJ3A 1B50A 2RSNA 2JYEA 4CJ1B 3Q22A 2WXMA 1IL8A 1SYDA 3HGBA 1P7EA 3HZXA 1NENB 1VZ6A 1YQ4B 3GO5A 3ZJVA 4X3KA 4XTCS 2IX3A 4RCOA 3T51B 2K6AA 2AUKA 2INNE 2F4IA 1YNJD 2V3NA 3KLSX 1SDFA 4XYOA 1DOYA 4C56C 4KGSA 1HA5A 4IALA 1F77A 1EYDA 1JMLA 1JWBD 2WDRB 1UAPA 1NYQA 1C4QA 3DUZA 3PIO3 4HSPA 1F2MA 2EY6A 2K28A 4AYBB 3PZ8A 4WURA 3WOEA 1JC7A 1VR9A 3GTOB 4RKBA 2OEDA 1QOHA 4HROA 1BQQT 5GXGB 2E76C 1RF2D 2ACZB 4DU9A 1FCCC 1OQRA 2BDNA 2DLBA 2HDMA 2A6ED 2EYPA 1XWEA 3P75A 5C4XB 2EYOA 2LMCA 4CGYB 3H91A 1KDAA 3SK6A 4N59A 3BDOA 3H09A 2VUMB 2MP1A 1Z47A 2R93B 3TEXA 3W5VB 1SXTA 2VNUD 4RGMA 2L1AA 1TR5A 3UI3A 3GS2A 3HG9A 1VMCA 1ACCA 1GHJA 4DK0A 3NVZA 4XYQA 2KJXA 1TY2A 4A3JB 3NQIA 3SK5A 1EWCA 3AEAB 1BO0A 4A3FB 3H3VC 4L8JA 1VMPA 2F0HA 4ZHPA 4IKGA 4FF3A 4BY1B 1TU2B 4CQNA 2GB1A 3BS1A 1F0ZA 4ZUIA 5M9OA 1ZEQX 2WXRA 1B9MA 1RM6C 2OF1A 1FNUA 3M3YB 5DEHA 4TQ0A 5HI1A 3I4LA 1D1IA 2L32A 2JSVX 4JX1C 3TMEA 2CW0C 3IL8A 2J53A 5JEAG 2WXQA 1ET9A 2F0OA 2N55A 1Y1WB 4IUUA 3M85A 1I6HB 2BTEA 1A70A 1RDPD 3Q69A 4K5VA 2NBFA 2NZ1D 5AUKA 4XQNA 2KUMA 1B3AA 3WDNA 3L9AX 1V43A 1YQ3B 4PNYA 2HCIA 5KIXA 2BDOA 4BS9A 3AE8B 1QT9A 2SNMA 5ISRA 3TZDA 1JRPA 1FXIA 1DOKA 2A5HA 1V1OA 1ENFA 2W3SA 5K36G 2O5IC 2QJLA 1OO9B 4QUFA 4KMUC 3E9SA 4AQ7A 3L4PA 5I6YA 2F0WA 4IUQA 5IGEA 4TKOB 1FGBD 1AEXA 1F9RA 3QG1A 2Q8TA 3AE4B 3KF8A 2LFNA 3T13A 1AYFA 3PV0A 3QOJA 4E6IA 4PV1C 1K50A 4O1NA 3EROA 1LT4D 2QEJC 3LYYA 2AQ2B 5G5HA 2JP1A 1Y69U 1N62A 1DOMA 2A73B 3TBIB 5DAUA 1FD6A 3P4QB 2KCCA 4DA2A 4OZBA 1LACA 1R9TB 1A2UA 4K2LA 2XWJB 5CBAE 1Y1VB 1ZUD2 2F0PA 1STBA 2LHEA 2JE6I 3HEJA 2PMZB 5A2QL 2JWUA 2WXPA 1SNOA 1RKNA 2ZXOA 2KN4A 3NVYA 3P1HA 4ODGA 2FJ2A 5IT9L 1G91A 4PMBA 2TMPA 2F0JA 1C4PA 5T8IA 2XIWA 2N9LA 4GLSC 1S4ZA 5CV6A 3GTQB 3NTHA 4P16A 4PT5A 3SEBA 4DN4M 4RKLA 2ENBA 1F9PA 4DFAA 1SE3A 1HRJA 1NSNS 1PXUA 4LK1C 1JOQA 5EJWA 3R93A 3K59A 2VZKD 3GB1A 1HTPA 4RCNA 3NVWA 1EIHA 2QSDA 4IUTA 5EPKA 4RH6A 2KEEA 1IYUA 2M00A 1E0ZA 4TQUS 2DY8A 2GA4B 2K5PA 3LNNA 2WP8J 1IBXA 2NYZD 2IDYA 3A7AB 4KKJA 1QF6A 4H0LC 1HZ5A 1LTTD 1QNKA 3P42A 1EY7A 4FXDA 2ZT9C 1L4DB 4NZLB 1FRDA 1PTOC 1C79A 3C2PA 1CZGA 5EKKA 1BMLC 1TS4A 1CFMA 3AMUA 3SK4A 1ML0D 4ZLTF 1HTLD 4L6TB 4N6EB 1T5EA 2D9UA 3IT6B 2EJMA 1DGJA 2Z1CA 2B2WC 3AECB 2N9KA 2KACA 1PFNA 2JA7B 1K83B 3HUIA 2E6XA 3S1MB 2JZPA 5C3JB 1D4BA 2L0CA 4TMAB 4KGTA 3D6WA 4H7BA 3A8KE 4L23A 2JYOA 5E1FA 2EZVA 4A3DB 4X3UA 2KOLA 1RTOA 2JX5A 2FHTA 4LMQD 1LTGD 1EEID 2K3UA 2EYJA 5T1IA 1TKYA 3BK1A 3OSOA 4KN4C 1T3QA 1SNMA 5KYIA 1WSPA 2O4XA 1EZ8A 5I6WA 1EOTA 1Q90A 5IGGA 2IW3A 3BYYB 3NK9A 3QIAA 1STNA 3N52A 3VYUA 2WV6D 1MHHE 1FYCA 4A3KB 5CORA 4M1UB 1OXSC 2VB2X 3MXPA 1FEHA 3BYTB 4ZRPA 4KGRA 3HOWB 4ARCA 1A2TA 3S2DB 1TWHB 2VXWA 1QOFA 4RF1A 2EPBA 2DYMA 1T6BX 4A6QA 2B8FA 2VZKB 4HEDA 3NXWA 4GDKB 4A3EB 3NUCA 5CYUA 4NAMA 2GI9A 1LT5D 2NVQB 1IW7D 5I9OA 4X3SA 3PZ7A 1I4RA 2KVMA 1XLOA 1HHVA 2BCOA 4XDXA 4A3IB 1VDZA 2PCFB 2PZTA 2XNAC 4HMJA 2EJGC 4N9TA 3SK8A 1YNNC 1WGKA 1A15A 3C3LA 3AEGB 1C77A 1TS5A 2FUG1 5TSSA 3MAQA 2F0LA 4L1BA 3SDZA 4A55A 5EBCA 1Z7TA 3KK7A 5EGTA 3HOUB 2WXLA 4WFN3 1GUTA 4FO2A 3D3RA 1D5XC 4ZK9B 2A69C 1GUSA 3A8JE 4H44C 5T1GA 1DOIA 1PDXA 1QWYA 1CQVA 3EA6A 4LLGM 1BCPC 4A3BB 3D6CA 2WS3B 1PRTB 4REZA 1TWGB 3ZJTA 4DK1A 3MFYA 3DXJC 3J81E 4AS1A 1CHQD 4I7ZC 1JE4A 2L11A 2OT2A 2N7JA 5M3MB 3TUOA 2QF7A 1UWXA 4YSXB 5BMGA 4KKIA 5CMDA 5K5PA 2WXGA 1VF5C 4HMIA 2CQAA 5C0XJ 1I4XA 1AWDA 2A68D 2J4XA 2PMVA 3SR6A 2QDBA 1TWCB 3BVMA 3MP9A 4J8QA 1QG7A 2XRQD 1G291 1WXQA 4L2YA 1KNEA 1KABA 5M5WB 2ZW1A 3JAML 1KAAA 1ZYRD 3EJIA 1SMYD 3V05A 1PTOH 1WTWA 4IUNA 2B2WA 1J8IA 4EE2A 5G3LF 1R4PB 2L12A 4LAAA 4TSSA 1QJOA 2PZUA 1GB4A 2PPBC 1TKGA 4A93B 1ZKOA 2F1MA 1EFID 2MJDA 2A6HC 3PUZA 1LTAD 2FMCA 2NVYB 3HOXB 4DAVA 4B08A 1G6ZA 3EGRA 4JPSA 3NZ3A 2VB3X 3NWTA 4MACA 3HS0C 5IIFA 1U4RA 5IT9E 2JYTA 4QMGA 2HQEA 2A74C 2K5DA 1GJXA 3R2IA 2EYHA 5DM73 5EBDA 2WXOA 5EQ0A 1NAPA 4DAPA 4US8A 2CHBD 1MD2D 4FVMA 4YWGG 2Q8IB 3W2DA 3OOCA 3QO2A 1XX8A 4RA8A 2NN6H 4FF2A 1LT6D 1MI0A 3IFDA 4KHZA 3MXNA 2L52A 4MH8A 3SFEB 1YN3A 3MC0B 2PKOA 2JA8B 3FAHA 5C5MA 4B9XA 4KTAA 3BDCA 3D8GA 2JQRB 4KX6B 1GUOA 1ZOYB 2L55A 3CWIA 2Y5PA 4HN7A 1WVLA 3K6OA 1A3UA 1RD9D 1ZXIA 4MM3B 1YNJC 2BE5D 1AZQA 3PO0A 1LTSD 1KLGD 2G9DA 3J7AV 1V8CA 3VYTA 2OHFA 4ID6A 1DOXA 1EL0A 3VQIA 1ESRA 2Y5CA 2F0VA 2DWQA 2IGGA 5CV4A 3MJ5A 2DY7A 1SFOB 1IUEA 2X69A 1ZDVA 2HCCA 4IURA 4RHSA 3CIRB 3Q24A 1PYWD 2KECA 3T3OA 4MHEA 4EQNA 1SYEA 3D4RA 3W9CB 4ZHOA 4B0MA 2LKVA 1TQOA 4QIWB 3R8BA 1EIGA 1KDBA 2LHDA 2V4IB 1W6JA 4XWTA 1Q3LA 1GB1A 4DQOC 1EQVA 2BB5A 3IXSA 3KWLA 2F0FA 1FMAD 3I90A 3SE0A 5A35A 3J80E 1VJKA 4F8MA 3BVZA 3WCQA 3D4DA 1D5ZC 1F2YA 3MA2B 3IKJA 1XCQL 2Q8RE 3HKZB 2FMMA 3RMHA 3KQ4A 3K5LA 1ILQA 3VR4A 1KFYB 4Q2JA 2RQXA 2WQYB 2WXNA 5G3LD 3B9JA 1JALA 1HUMA 3IFTA 3TP8A 4DAYA 3AH7A 3NSWA 2WXKA 1QQRA 1PFBA 1Q1EA 1HUNA 3PUYA 3U52E 3BVGA 1HA6A 5FLXL 1JQYD 1TWFB 3L7ZC 3A8IE 3J7YW 2L5TA 2E2JB 4WIPA 2KAJA 2JSOA 1K8OA 3ZQ4A 2EY2A 3R2TA 3Q8FA 5C0XH 1QOGA 5CV9A 4YTNB 5C44B 2FBWB 2B8GA 3T4AC 4RGNA 2WXFA 1JWAD 1C78A 4ZQ3A 5J1ZA 2HDEA 3ZGZA 1Q1BA 2RPVA 1OXTA 5KNCA 3AB5A 1RWSA 2L4NA 2R61A 2ICIA 2NWGA 2RDFA 5FO7B 1F2LA 2KDMA 1IGCA 1SYBA 3IAS1 3LB8C 4R8IA 5IGDA 3LX0A 1M4VA 1KNAA 1LTBD 1FFUA 1I3QB 4G57A 3TP6A 4M8AA 1ENAA 1XXGA 3P1MA 2F0MA 1QCBD 2BT6A 3A55A 2WINB 3GTKB 2IGHA 1ICWA 2K03A 2H89B 4FNFA 1B1ZA 4H13C 3I91A 4C1NK 1WTPA 1STAA 1D1KA 1FFVA 2WU2B 5EKIA 2WXIA 3Q0AA 5BMIA 1L0YB 3SR1A 1C9FA 5KEEA 2YEPF 1TKWB 3HVDA 2M2LA 3DMUA 4NDXA 1K51A 2F0UA 2QIEB 3Q8CA 4DF7A 1LLRD 5BN3A 4U673 2ZW0A 2F03A 4XQQA 5JPNC 5F2DA 2J42A 1L0XB 1W6KA 3JAME 1UNSA 2R3ZA 3N9YC 3PO3B 3D31A 4C1NI 1CA5A 2SAKA 5JAVA 2E3TA 2E74C 1J7CA 2Z4HA 2RA4A 1QB5D 1XLQA 4J1MA 1PGXA 3AN1A 5LL6X 1Z6HA 2CW0D 3I8ZA 1JQ4A 2J7ZA 5EE3A 4R3DA 3SXHA 2M56B 1DYQA 1ZDXA 5E6JA 2C9OA 5FO8B 1HFGA 1PTOF 3FPUB 4ITKA 2IL8A 2LY7A 2PW5A 1BR9A 2F0TA 1G8ZD 4R8NA 1NVID 2PVOD 3MEHA 2SDFA 1KTKA 1Q10A 3U9OA 1XLNA 5HHDG 1RHPA 4EGVA 2QCPX 3BZDB 4IUVA 5C0XI 4ME5A 1YN4A 3RZOB 2WDQB 2WP9B 3MWYW 4K14A 3AEBB 3TEYA 4UAIA 1CQFA 3BDLA 2KHSA 3NQTA 4WQMA 4C7ZA 2X6GA 3TDQA 1GPXA 3SHLA 5E4WC 2V0GA 1EYAA 2JA5B 3C1EA 4JWUC 4RFBA 1UWMA 3Q8EA 3S2HB 5CV7A 1SAPA 2F0SA 3DWAA 1D6EC 1XTCD 1V1PA 3O13A 1N5WA 1XF5L 2SNSA 5C0XG 2AUJD 3W3AA 3H8HA 3MVVA 4H2AA 5HGTA 2F0QA 3FMCA 2PVGC 1VZ7A 1RJTA 3NRZA 1DCZA 1PRTC 3D4WA 4S3SA 1CJEA 1V97A 3U9SA 1SYFA 2HTME 1IBXB 3V2TA 3BG3A 5CR3A 2RVLA 1G2TA 1WCMB 1PFDA 1LT3D 4IOIE 2F3VA 4NKLA 1UGJA 3PUVA 2CU3A 4G7ZC 3EFXD 1OFFA 4IDIA 1MPEA 4A8XC 5C4ZA 2H1EA 5HG2A 1SNDA 2K22A 4KI0A 3P4PB 4ZOHC 2BB6A 3SFDB 1YNTE 2K5WA 1S5BD 1WRIA 3HRDD 2NMQA 4NMZA 4C7YA 1BUVT 5G5GA 3GTGB 1S5CD 2D5DA 4N9PA 4RAUC 1J7BA 1OXVA 4PQXA 2YYZA 3HOVB 4DXGA 1IYVA 1XCTL 1EY6A 4KY7A 1B2TA 1GXDC 5M3FB 3NUHB 3GQBA 1WTVA 2EY1A 4HJGE 3URYA 5C6AA 5EKLA 3ETRA 5CV8A 1BCPF 5JEAJ 1PGAA 4BY7B 1PGBA 3PUWA 1JB3A 4LK0M 2SEBD 5JJZA 1PTOD 3CHBD 2MEKA 3A56A 5D3DA 3TP7A 4HCEA 4A3MB 1IKMA 2FE8A 3VYSA 5C5LA 1WTXA 2B2TC 2I07B 3OHXC 2KQ3A 1TS3A 1TKEA 1JOKA 3V3XA 4R9WA 1S5FD 4OVZA 3TSSA 1DJRD 3VA5A 4BWGB 2KCNA 4BA1I 5FKAC 1YMHE 2J52A 1K8MA 4RGTA 4F88A 3OMCA 2CVRA 2DNEA 1J7AA 2I2YA 2PYKA 2D5GA 5EPLA 5LNK1 4WH4A 4A90A 3K57A 4IFDH 3FKIB 1FIQA 3GTPB 1AP0A 5AUIA 2M19A 2L1BA 1N61A 1X3PA 2A68C 3CRLC 1Q8IA 1C76A 4K6DA 1BXTA 1U4LA 2WACA 5D14A 1ZPSA 3M4YA 2KQ4X 4ABNA 3OPOA 3M7GA 1DD2A 1ZYRC 1NUCA 3S17B 2JA6B 1SMYC 2WXJA 4FXKC 5IODA 1M8AA 1E2ZA 2O2LD 2KA7A 4G7HC 1VF7A 3AMZA 3CU7A 5I9PA 4BA2I 1D2BA 4YSZB 2NTTA 1KLUD 1E7PB 3NP8A 1HFNA 4HKQA 1STGA 2K32A 4USAA 3AEFB 2D62A 1TS2A 4CJ2C 4DXFA 1OXXK 4QUCA