1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1I4HA 1F77A 1HQRD 2XRSD 3GP7A 1TS3A 1PRTD 1LTAD 1LTBD 3BYYB 4RGNA 1BCPB 1LTRD 1SE3A 1TS2A 1D6EC 1D5MC 1LT6D 1RDPD 3R2IA 1I4PA 3BVGA 4Z9CB 1M4VA 1BCPC 1SBBB 1PRTB 4RGTA 1FNWA 3BVZA 1RCVD 1YN4A 1UNSA 2SEBD 1D5XC 1EFID 1AW7A 1PYWD 3R2TA 1PRTF 4DXFA 1LTGD 4RCOA 1PRTC 3V05A 1JWSD 4OHJA 4NZLB 1JWUD 4RHSA 1HA5A 1ENFA 2NTTA 2CHBD 5D3IB 3BVMA 1AN8A 2XNAC 1V1PA 1SE2A 1TY0A 1SJHD 1PTOC 1SXTA 1LT3D 2R61A 3W2DA 1V1PB 4RGMA 1LTTD 1YN3A 1RD9D 2XN9C 2QILA 1RF2D 1EWCA 1PTOB 1QILA 1CT1D 1S5FD 2AQ1B 2G9HD 1LO5D 1B44D 4C56C 1L0XB 3SEBA 1T5XD 1S5CD 1G8ZD 2ICIA 5ELBA 4RGOS 1PTOF 4UDUC 1TS5A 3URYA 1CK1A 1CQVA 1HXYD 3R8BA 2J4XA 3DWQA 1JWMD 1KLGD 1ET9A 1FNVA 1JQYD 1TY2A 5D3DA 5ELFA 1BCPF 1PTOH 1UUPA 3TSSA 1FGBD 1KLUD 1FNUA 1S5BD 1LT5D 1STEA 1SJED 2Z8LA 1SE4A 4L6TB 1L0YB 1PZID 1EEFD 1JR0D 3KLSX 5FKAC 1SEBD 4K6LA 1ESFA 4L63B 1CHPD 3BZDB 4O1NA 5I4DA 4ZYSA 1MD2D 4DXGA 4TSSA 1HTLD 1XTCD 2RDGA 1S5ED 1PTOD 2RDHA 1I4XA 1LTSD 1DJRD 1GOZA 1JCKB 2NTSA 1ET6A 2WV6D 5ELDA 1FD7D 1I4GA 2O2LD 4RHRA 2XRQD 4RH6A 1XXGA 2AQ2B 3O13A 1I4RA 1BCPD 1EEID 1V1OA 2AQ3B 2QEJC 1KTKA 5TSSA 3DWPA 1PZJD 1YN5A 2IJ0A 3EA6A 5ELEA 1I4QA 2TSSA 1LT4D 1TS4A 1EU4A 3CHBD 5ELCA 3MC0B 3OWEB 1D5ZC 1BXTA 1PZKD 1CHQD 1LTID 4RFBA 3DWAA 1B1ZA 4BWGB 3MFGA 5FK9C 1S5DD 2IPKD 3BYTB 1DYQA 1EU3A 3EFXD 1LLRD
chains in the Genus database with same CATH superfamily
4FXCA 4NB3A 3L54A 3AEFB 1Q7YC 2R7ZH 3P1MA 5G55A 1LTBD 2JYTA 2KHWB 1PH4A 3RMKC 4OL7A 1SROA 3ULLA 3WOEA 2KO3A 1PYSB 2EYLA 1IYVA 5IP9G 1V6EA 5JEAJ 5IP7G 3A9JA 4MJSA 4BFRA 5AZHA 3T3OA 3BVGA 2MUYA 3OPOA 1SBBB 2Z6KC 2HD5B 3AEEB 1L0WA 1YNNC 3A9KB 3CSTA 1ENCA 1KNEA 2WP9B 2JA6G 1AW7A 5IWAQ 4OZBA 1PRTF 2WXHA 2DJFC 1WYGA 2WGSA 1U4AA 3AEVA 2QF7A 1CZGA 1ENAA 2UXCQ 4A3EB 1F9SA 3CW2C 3NTHA 1SYGA 2L0CA 3F2CA 4MELA 5H8YE 1I3QB 1NVID 4H2AA 4HK2A 1J5EL 1C4QA 2N9KA 3AE3B 4X64L 1SXTA 2HT1A 1LT3D 4GKJQ 2NVUI 5C1ZA 5JXVA 4RGMA 2LFIA 3D6WA 2J7ZA 1K28A 4IUUA 5C4HA 2KK8A 3MC8A 5BYQA 1WX7A 3NG0A 1O7ZA 4FF1A 2RKSA 1OXTA 4ZRPA 1QILA 1VQMA 4FHKA 4A3FG 1XNQQ 2UXDQ 5C2TB 4FBJB 1A2UA 2Z0EB 1T5XD 3NBHA 2DJGC 1HNXQ 4UDUC 5KGUA 3FHWA 2JA8B 3I4LA 2F3IA 3FKIH 2L9HA 2WXIA 2VL6A 1N33Q 2KCCA 3MVVA 3Q22A 1H9MA 2Z0DB 3DVNV 4FA6A 3TSSA 3NHEB 1JICA 1FNUA 1VQLA 4LF4Q 5EE1A 3L08A 1W6JA 3EHVA 2Z8LA 3ZDTA 4DAMA 2EJGC 2WIIB 5M3FH 1WTXA 1R4NB 1XYIA 3U8ZA 1ZDXA 4LFCL 4ARIA 3VR8B 1GB4A 4ZYSA 3TS0A 4WWNA 3DEPA 3UDFA 3K5NA 1SSOA 1WD0A 3ZVVA 1F9JA 5J2RA 1FJGQ 2L5TA 3GTPB 3AE8B 4BY1H 3Q8EA 4BKTA 4HCSA 1EY9A 2BS3B 2MX2A 4GDLB 4KJNA 2DUDA 4KY7A 1CSPA 2IHFA 5KNCA 3U9OA 3CU7A 3IFDA 3Q2AC 2HTHA 1TKGA 3VHTC 2AQ2B 1RM6C 4JGHB 4OXPA 2PQEA 2CJNA 1TT2A 5FR6A 1BCPD 1YJIA 1NBWA 3D0FA 2AQ3B 2EY6A 4IFDI 2KQ4X 2E3TA 3VVWB 1EZ6A 2F0PA 3Q8FA 4XXEA 2J0MA 3K0YA 2MW5A 3GE8C 5KHOA 1O7LA 5IYCG 4A4IA 4A3KH 3T16A 2V3NA 3AEAB 5IOIA 4AQ7A 2JA7H 4RWSC 4DV0Q 3C1EA 3HOUG 3MC0B 3HOWH 3RN9C 1DD2A 1KQSA 4JI0L 4JC0A 4U673 1VDZA 1WR6E 4MGZE 2A74C 4PQXA 2BT6A 4DF7A 1CHQD 4LW1A 4GZYC 2BQQA 3SDLC 2FCSA 1RWSA 3M4OB 1S3OA 4BWGB 5A2QL 2M1MA 1LGRA 3TS2A 2UUCL 3UF8A 1EU3A 3RN2A 2EIFA 4FYDA 4CO7A 2LHEA 4HPPA 2M0AA 2N49A 4ABNA 1NUCA 2MFIA 4C7ZA 3RI7C 2XRSD 3LDZE 2QGQA 3A0JA 4XQJA 4LLGM 2A6EC 1YVCA 4X3SA 1NTGA 5TR5A 1B3AA 3HOWB 3I4NH 2KDIA 3ITPA 2WXJA 1YI2A 3MXGA 1V5TA 3R2IA 4GLSC 1EUJA 1GB1A 4LK1C 4H02A 4KZ0A 2KC2A 1S3SG 2MO0A 5IYDH 2D11A 2FIFA 1W6KA 2WDTB 5J18A 4RCOA 2K6QA 1WH3A 4JL9A 4BY7H 1T6BX 4X64Q 1YNJC 3PSIA 4A3CG 2XWJB 2F0TA 2A68C 1QNUA 4K5XA 3T56B 1I7HA 1UWVA 2KUMA 3E9HA 3QCAA 4JI8L 2C35B 3KBGA 5M5XB 3V2TA 1HR0L 4ODGA 1HA6A 1TKWB 2F0LA 4M8NA 4X3UA 4IFDJ 1E3PA 2SNMA 2ZEQA 4R9WA 3W2DA 2NBWB 2WAQB 2QC8A 3NPPA 4WWMA 5BN4A 5EQ0A 1TJEA 5BMGA 4GNXC 5FLXc 1TU2B 1FM0D 2V9HA 1NYRA 3GZNB 1YMHE 3FC4A 2FMMA 1ONLA 5FJ8H 4ZK9B 2BBCA 1DCZA 4DV1L 3DHIC 1S4ZA 4F88A 1NYQA 2BA0A 2C7NB 2D10A 4B0EA 3MTSA 2D3AA 4HMIA 1NMGA 3I72A 3VA7A 2BWES 3A8IE 2DWQA 3A1QA 2F0QA 1N62A 2A6HD 2KWVB 4J1MA 2RVLA 3G6JB 2D3CA 5CV9A 1QUQB 4US8A 1KLUD 2J0KA 3EJIA 3GTLH 3AM9A 2RD0A 1JMLA 4WJ4A 1VDVA 3D3RA 2EELA 3UDXA 1SE4A 2GLSA 4N58A 3RZOB 3PLUA 4M8AA 4TKOB 5I4DA 3DBLB 1X3GA 2NZ1D 4JI7Q 2C9WB 2PMZB 4P1BC 2EVBA 3KFUA 2CR5A 3S17B 5ELNA 1DJRD 2B2TA 3TUOA 1XLOA 4L1BA 1VMPA 3VA5A 2KDMA 1K83B 4WJNA 4G7OC 3AU7A 4HDOA 4XWTA 1YJJA 2O2LD 3SGIA 2WB1E 3U2SC 4NXML 1IYUA 1PLFA 4WH4A 1I6HB 3I56A 3AEBB 3L0OA 2M8SA 1C9FA 3RZOH 3PVLA 1KTKA 2NVYB 2F4VQ 3U7DA 1QF6A 1SE9A 1T0RC 3NY5A 4MT5A 3H9DA 2H1EA 1UEBA 2N7JA 3OWEB 5JH5C 1HCZA 2HJ1A 3K80C 3BIID 2K5PA 1WTHA 2L00B 3TP7A 1F2RC 2AX5A 3AMZA 2CQOA 1C76A 4A3EG 3PV0A 1NNXA 1WJ6A 3Q23A 2WACA 5G3LF 2J0JA 2LRUA 4KN4C 4HJ9A 4A3DH 2V3SA 3DWGC 1SFOB 4DR6L 1TQOA 4KJOA 4M8MA 3NQTA 2N9LA 1CKOA 3TBIB 5IKCM 3MC9A 2PCFB 4B08A 1E24A 2YLMA 2CW0C 1WXSA 3NSWA 1STYA 5G3LD 4DV5L 1HNZQ 1HZBA 3S2HB 4NXMQ 1RJTA 2D3GA 4K5VA 1X3EA 3ONAB 5JJKA 2K05A 5C5MA 3RLFA 1U4RA 1UF0A 3NOBA 1SRUA 2G5DA 1FIQA 4KTAA 4ZRZA 2J53A 4BXXG 4OZCA 2HQLA 4A8XC 3J80c 1PFSA 3T53B 2JA7G 3H94A 1Y1WB 3VYSA 1JJCB 3W1YA 1FNWA 1JALA 4HPMB 5A2QE 3V96A 1EQVA 3SR1A 1D5XC 1A0IA 2JA8G 3GDEA 4LF6Q 1N33L 1PFDA 1LTGD 4BA1I 3MWYW 2FNJB 2PW7A 2KD0A 4BKSD 3PO2B 4L5SA 1MKHA 3OIQA 4DK3C 5LL6S 5C0XJ 3K5OA 1G291 4DGZA 4LNNA 3TDQA 2KEEA 1GJXA 1MVKA 4DV4Q 2NTTA 4KIKB 3LWUA 3BVMA 4JPSA 1JWAD 1SE2A 2K6AA 1WX9A 1ZKOA 4PT5A 1KAAA 1R4PB 3R66C 4YT0B 3MP9A 1WM2A 3STBD 2EJFC 2F3VA 4IWPA 4GKKQ 3VRAB 3RLNA 4NAWB 4HN7A 2KVZA 1EF1A 2LRWA 3APCA 4ASWC 4WURA 5E6JA 3RZDB 3NWTA 2ZXRA 1ICWA 2WKCA 5CORA 2JZZA 4L5RC 1L0XB 3A5UA 1STHA 4N8FA 2K39A 4GDKB 3SHQA 1TWAB 4DPGA 3I4MG 2ZXOA 2MJDA 4KKIA 4DV7Q 4JI1Q 3P4SB 2L55A 1JORA 1GAQB 3MEHA 2DAFA 3ML8A 3U7ZA 2G9DA 4L8JA 3P1HA 3RNEC 1CI3M 5IAAC 2HIVA 1OO9B 3ML9A 3FEWX 4FLHA 2CFMA 4OVUA 2M0XA 4GN5A 1V43A 3KLWA 1K73C 3PRPB 4LWCA 1WFYA 3RZDH 4KHVA 4RF1A 1PVOA 3LNNA 5FLXE 4L6TB 3KLSX 2E2IH 4WAAA 2F1MA 4HEDA 2JYEA 2K03A 1XLQA 4F8MA 3G4SA 1X32A 4DXGA 2JA8H 2KJXA 5LMUL 2OWOA 2KC1A 2LJIA 2C9OA 1V9PA 2VB2X 4RAUC 2ZVNA 3BK1A 4L2YA 4YCUA 3C2PA 2KTFA 1PA6A 1N60A 4HJ8A 1PH3A 2N9XA 4FF4A 2HUGA 1KOTA 3EVQA 1XJVA 5ELDA 3DOWA 2FHTA 2NVQH 2KQSA 2HCCA 3RCZA 1J8CA 1Z6HA 2D0OA 4HR7B 3DVGY 1EIGA 5DPTA 3ENEA 3PUXA 1QG7A 4BVUC 4RG1A 2JVCA 4DAPA 2K7VA 4DUYQ 1KDCA 4DN4M 1YNND 4GSWA 4N9F4 3P63A 4BBRB 1VQHA 1STNA 4BS9A 1E1OA 2K5QA 1N34L 3GTPH 1VQBA 2QIEB 1N36Q 1XNRL 1C3TA 3OLMD 1NAPA 3T13A 1Q8KA 4BKSA 4A3IG 3R7QA 1Q46A 4DBGA 4CGYB 1ZOYB 4PG3A 1SR3A 2VNUD 4FNFA 2KJHB 1HE8A 3M63B 1SNDA 4KKTA 1HJPA 2XSCA 1E8XA 1NENB 2MBBB 2OEOA 3D4DA 1VQ8A 4KY6A 1ZXTA 1X3PA 3H91A 5CV8A 2QA4A 2MBOA 3GTOB 1B9MA 4RM8A 3WOFA 1P98A 2V4IB 1LLRD 4II2B 5KYIA 4KK7A 4ME5A 3B6YA 3OMGA 5BN5A 4WWOA 1HQRD 3AFPA 2O6VD 1CMXB 1MG4A 3OSOA 1WTRA 2EJMA 1NDDA 3N1ZC 1PFBA 1GD7A 1EIFA 1LTRD 1SE3A 1Y14B 1WI5A 4IUNA 1F1HA 2E2DC 3S1NH 1T0QC 4TQUS 2EZVA 4BOSC 4DV2Q 3KWVA 2LSSA 1VD2A 2R92H 1VF5C 1E1TA 2YTYA 3DBSA 4L23A 4WIPA 3TQYA 1Q0WB 3SFEB 4PYZA 4A3FH 2O2VB 4ZYNA 3QHTA 3CPWA 2V1CC 5CBEE 1F2MA 5BYSA 2YYZA 3VFKA 1HA5A 2LWPA 2WXMA 1HNWQ 4NXNL 4C2MB 3I4NB 3NBIA 2E8GA 4PS8A 2A73B 3OYYA 5I6YA 1V1PA 2NZOA 3F8TA 3QB3A 1CA5A 1GUAB 1O80A 2KWDA 2EYOA 2CHXA 3TZUA 4W9EA 4EQOA 1CZWA 1MBYA 5H1SE 1YNXA 1TIFA 3EFCA 1OEYJ 2CU3A 1FVIA 1CKNB 2IYDB 3NUCA 3A7LA 4YY3L 1L6VA 2PE6B 1E22A 1QJOA 1C48A 1H8CA 4W9JA 1I94L 3MTNB 2ZM6Q 1NI2A 2B63H 3CCJA 4KKUA 3T1HQ 3I4NG 4OX9Q 4ZHOA 1IW7C 5EDSA 1PTOF 2ZJPA 5IE8A 4WFN3 2R7ZB 3URYA 2MBQA 3H6NA 2JA9A 2MO1A 2B2WC 3I3CA 4A3OA 1SNCA 5E3FA 4C3IB 1UBIA 4IURA 2LVPA 4ANXA 2AWNA 2K5HA 4K14A 4CDFC 1XMOQ 4M0WB 3W9CB 1KRSA 1TKEA 1ILQA 2KVRA 3WAPA 2WWZA 1BCPF 4OO1I 4IQZA 1FPYA 1SJED 5FR3A 1VCIA 3NELA 2WKDA 2PVGC 2ASQA 2F0JA 1F2LA 2OTJA 1AP0A 3Q3FA 3FPPA 3G71A 3FILA 5IWAL 2CQAA 3M7GA 3L4PA 3LYYA 1EY5A 5BMIA 2LFNA 1VQ5A 2D3BA 2W9NA 4HPLB 1L1OA 1FL0A 2EOTA 1P9DU 2K0PA 1WJNA 2ACZB 3H15A 4LJPB 2R7FA 5LXHA 5I2YA 1HH2P 3ALBA 3Q14C 2NZHA 2K5DA 2L0TA 3CSFA 4IWOA 3A4RA 1VQJA 1D3ZA 2B29A 4QMGA 3PIPA 2A69D 2ZTCA 1E8ZA 4NAWA 1PH2A 1XTDA 4JI3L 5C4JH 1ZW7A 1EEID 1RKNA 1SE8A 3TRZA 4LAAA 1BKBA 1YJ9A 1XLPA 2M4NA 4XT3B 3AEDB 1XNQL 1C0AA 2SOBA 1XEEA 2DLBA 4C3JB 4E3CA 4IFDH 2EYHA 1JROA 5H92C 3TEZA 2J42A 2JSVX 1UE5A 1YNJD 3HKSA 4DK5A 1TR5A 2A68D 2F0HA 4XT1B 2JP1A 2G4DB 2X8XX 2Z4IA 1ZYRD 3K8AA 4IPHA 2ZZPB 2RSUA 3IFWB 3RZFA 5AEKB 4CBVA 3HM6X 1NCVA 2PI2A 3CCQA 4APVA 1TT5B 4F8CB 4GDLA 1SYFA 3RUZA 2F0IA 4IJLA 1CKNA 2BE5D 5IGFA 3S1RB 4DV6L 3Q8BA 3GTJH 4PS3A 3FP9A 3V6EB 1L0VB 2D0PA 4HCNB 3J80L 1EQTA 5KNDA 4URKA 4TKNA 2EE1A 3OOCA 4ZQ3A 4MM3A 2WLBA 3PIP3 1MHXA 3A55A 3TCAA 1QWYA 3A74A 4PMWA 3JW0X 3IRBA 5C4XB 3TEYA 3HEJA 1ICFB 2MRPA 2AL6A 3PZDA 2NN6I 3ULJA 2KTRB 3S14H 1EFID 4W9HA 1KC8C 2B3AA 3W1SC 5EAYA 1GVPA 2KDFB 3WAOA 4RHSA 5AJ3L 3S1RH 3GTJB 4EKUA 3D8GA 4WORA 5LL6X 5C44B 1H9KA 2F3WA 3K5LA 2IO3B 3H8HA 5CHVC 1SLJA 1Y1WH 4GS3A 3FKIG 2EY2A 4I65A 4DHJB 3VAWA 1U9RA 1YITA 2WXLA 4IUTA 3JAMi 3DBRB 1XT9B 4MGYE 4FADA 4BKGA 2Y5BB 4L5TA 3PUZA 4R4CA 3RYTA 4XQQA 3OWFA 2RPVA 1V80A 2JU6X 2LXCA 2F0SA 2KAJA 5HFYA 4IKGA 4J15A 2KBNA 2KN4A 4JBMA 2ICIA 2QHOA 1QOHA 4KN7C 1TZ1A 2NWGA 4ZAIA 2R7DA 3E5SA 3AU4A 4ZRKA 3ZJTA 3KWLA 3D4RA 1QCBD 1VQDA 3NP8A 2LGDA 4LF4L 3PV1A 3LX0A 3AE1B 3VXWA 4R8NA 3RNUA 1YEZA 1TY2A 5FLXL 3SK4A 1QVGA 1NSNS 3TL5A 2C60A 1X55A 3NENA 1UZXB 3I3TB 2N7EA 2YEPF 1MD2D 4OO1G 3Q24A 3KF8B 4BY7B 2I5MX 3DHGC 2GRIA 5JHBA 1QE6A 2Y0SG 1NR4A 2HHHQ 4KKSA 4GLAC 1ET6A 2WV6D 5LMNW 1O7YA 1FD7D 4JBJA 1XMQQ 1R4MB 4S0RA 5C3EB 1Z5SB 2K28A 4RHRA 1XPUA 4RH6A 4XYCA 2KCTA 2MEKA 1Y8PB 3TP5A 2B2VA 1AE3A 4DR3Q 1MSGA 3RN5A 3J80i 2GI9A 3DWPA 5D94A 5L37A 2PQAB 4LDTD 1UAPA 1K9MC 5C5LA 1UEAB 2HQEA 3H09A 4RMAA 2I5LX 1HHVA 2PE9A 2KTRA 1T9HA 4P72A 2K14A 4ZUJA 2PZWA 5CMDA 3NVWA 2A5HA 4MHEA 4UP8A 4X57B 2RSOA 3HOYG 2ON8A 4GMVA 4WQOB 3SFDB 2PJHA 3APFA 4GDKA 1N6ZA 4E71A 1JOOA 1CTMA 4DWFA 4NMZA 2K75A 2L52A 3TN2A 3OG5A 2INCC 1AE2A 4OWWB 1EOVA 2BOSA 2RA4A 5IP7H 4HRSA 3T1YL 1T0SC 1P7FA 4B9KA 3NVYA 1KLVA 4GGQA 5IOCA 1K3BC 1Z9FA 1A3TA 4UAIA 2J52A 1MJEA 3BYYB 2OEDA 2IO1B 4F1SA 5AFWA 4NQLB 3C46A 2YTXA 2G1EA 2J7QB 1C4PA 2MCNB 5K5PA 2IY0B 4YXDB 4W9LA 2KCMA 1RTOA 1PRTB 2VZAA 3GV3A 1Z47A 2UXBQ 2M2LA 4G4KA 4PNYA 1YN4A 2H5XA 4ZRJA 3R2TA 3L2PA 4HJ7A 3N6RA 3GOEA 3HKZE 1B7YB 1K0RA 2MH7A 2OCEA 3ZRCA 4DHJD 2NN6G 5HY6A 3NS8A 4PZ7A 4IDIA 2GBNA 2L15A 5FLMG 1A3UA 3TEWA 3PPAA 1XCQL 5HKHA 2EMSA 1XPRA 2PVOD 4DR1L 4BA2I 4QCLA 2JWZA 1V8QA 3R3OA 5LMUQ 1WZ3A 3MHSD 4W9FA 1RF2D 4GLVB 4RCNA 1TXYA 3TZDA 2AEHA 3HP3A 2K1BA 1S5FD 3QIJA 2UU7A 3TIXA 3ERQA 1WTOA 3W5UB 1SYEA 3OIPA 4EVOA 5COYA 3ZLZA 1PDQA 4JV5Q 4XGAB 1IHZA 2LMCB 1IBLL 5EBDA 1TYGB 3WIMA 3S2HH 4EQNA 1LQBA 1HFGA 3UDIA 1GXDC 2O5JC 3QWNA 1CM9A 3TP8A 3M85A 2KFKB 4XWWA 1MGSA 4ZCKA 5E6PA 1TGZB 4ICVA 2MBHA 1BR9A 3VTWA 1ESFA 1EF5A 3HOXB 1MG8A 3FMCA 3IHPC 3QJZA 4GXBA 3ERSX 2WXRA 3HOZB 1DOLA 2NVYH 2JXTA 1C7YA 2QJLA 3BS1A 1ZPSA 1K8MA 2A6HC 3HS0C 2IX1A 1HRJA 4GN3B 4MN3A 3DHHC 5M3MH 1KAWA 1STAA 4A20A 1J9OA 3D4WA 2E5LL 2NTSA 4LTUA 3ZNGC 2VW9A 1S40A 1I4GA 2NB0A 4DA2A 2LMCA 3PSEB 1QZGA 2IT1A 3BU2A 2V1YA 1F0ZA 3KDFB 4DUZL 2Q2IA 1XWEA 4KMUC 3AV8A 5FO7B 2BWFA 3S2AA 3DM3A 1K8RB 2EYPA 1SFOH 3PTFC 4HVBA 4HIMA 2WAQG 2GB1A 4CJ0B 1IBKQ 2M00A 4HCPB 2LJ5A 4LFBQ 3HG9A 2HDMA 2JEAI 2GMIC 1P0RA 1CQFA 5CBAE 3ONSA 1G6JA 4IN3A 4BZAA 2A1AA 4FVMA 2HDEA 1WTQA 1WTPA 2KFJA 1LTID 1UGJA 1N61A 3N30A 2Q2HA 2GVAA 3QARA 2RR9A 4DV1Q 5IT9L 1WGRA 2JJQA 3C1FA 4R4OA 2JQOA 3OTOL 3DBLI 4NAMA 1AWDA 1F2RI 1F2YA 1X3QA 1SMYC 2K4KA 4QUFA 1NE3A 4HJKA 1TTNA 2HDLA 4DK0A 4C3JH 3L10B 1C4AA 3V3XA 1PRTD 3KYDD 4WAFA 1I35A 1X65A 4OWTB 1EY8A 3HVZA 4HEA1 4TVAB 2B2TC 3F2UA 2DBYA 1VQCA 4YWMA 1D6EC 2ALYB 1DM0B 1YZ6A 1IW7D 1WE6A 3SD5A 2CH4A 5D2MB 1LM0A 2KECA 4K7WA 1M4VA 3LGJA 1W2BA 1LV9A 5DCNA 2EMTA 1RCVD 2NVTH 3S1QB 2Y5PA 4M02A 4FHJA 3G7LA 2M19A 4MDKE 4HKQA 3AFQA 3HOVH 3HKZB 2XVSA 1N5XA 1E6EB 2F52A 3RPFC 1WXQA 2C7MB 1Q3LA 1AH9A 3DEOA 4LF8Q 1GKHA 1C79A 2DZMA 4DUZQ 2OJWA 4KV2A 1AZQA 3KDFA 3AEGB 2CHZA 4QL5A 1B4OA 2C7HA 1Q12A 2I1KA 4KDLB 3RZWC 3ZTCA 2PNHA 2KHSA 2XNAC 1Q82C 2UUBL 2UU9Q 3N1YC 1GG3A 5JPMC 1BNZA 1RFKA 2WS3B 2XEWA 5HG2A 2KENA 5E6NA 1KFYB 1LTTD 4WQMA 3GTKB 3S14B 1KIXA 5DPRA 4PK1A 4I7AA 1C8CA 4JYAL 4V190 3BY4B 2BH2A 2BTEA 3X0WA 1CZPA 1RYJA 4C56C 3MZ5A 5C3EG 2PEAA 2E2IB 1S5CD 4L5QA 2WAQE 4X62Q 2PW9A 4C3IH 2ZW1A 4LF7L 4IOIE 2MJ8A 3S9WA 5C44H 4OONA 3JSVA 2RMMA 4TUUA 2Z4HA 3CKIB 4N9PA 4LF5L 2EKEC 1HXYD 1STBA 3FAHA 4ITKA 4B9WA 1K3RA 3H0GH 2LXAA 3M95A 5HI1A 4B9XA 4POGA 1UUPA 1FCCC 2YVCA 1R4QB 4YCVA 2JUOA 4CDEC 4O42A 1ZGUB 1STEA 2BPSA 4FXDA 2YEPB 5EJWA 4DV5Q 3CCLA 3EROA 1FEHA 5DM63 4L63B 4GOPB 4A3FB 2ATWA 1PYBA 3W5VB 3OW2A 1MJCA 3HOVG 1XTCD 3QOJA 1WMHA 1U4LA 1KABA 4FF2A 1I4XA 2K04A 2D07B 3PIOA 4C3IG 3S1MB 1Q8IA 3A5ZB 1P1AA 3KLRA 1IKLA 1MI2A 1SYDA 1JCKB 2A6ED 4MTNA 4G3XB 3VDZA 2NPTB 5C4JB 1FFVA 3JC66 2RQXA 4WJOA 5LNK1 1YNTE 2L3ZA 2JA6B 2OOBB 5EPLA 3BDLA 1E7UA 2KWUB 2QEJC 1WY8A 4G7ZC 4OIJA 2LUEA 1N8RC 1YHQA 1NI3A 3GB1A 2KMCA 4G0NB 2O4XA 3J81i 4ANUA 1EU4A 5C4ZA 4LF6L 2JN4A 1PDXA 4JOIA 1GUNA 1JT8A 2Y0SE 4J6HA 2VQEQ 3AE6B 2Y5CA 5GXGB 1J6QA 1JWBD 2P5ZX 4YHHQ 3DPDA 3L13A 5ISRA 4LF7Q 3B0AA 4KD3A 4DXAB 1JJ2A 1PZKD 4YSYB 2X38A 3L16A 4OVZA 2MP2A 5IP4D 3PO2G 5KNBA 1B2TA 1GHKA 1XCTL 1QVCA 1HTPA 1WVLA 3NBHB 3MA2B 4RKBA 1JC7A 4OW0A 3NWSA 4LJOB 1J7BA 1IYJB 3H3VC 5CYUA 2Q2UA 2KOXA 4DDID 1XQQA 5IT9c 1R4NI 2K8BA 2LGYA 4BXXH 2RGFA 2RDFA 4EZLA 3I8ZA 1G91A 2BYTA 5T1GA 2CKHB 3MJ5A 3PREA 5CR3A 2RDBC 4MSMB 3F1ZA 1TS2A 1D5MC 2AL3A 4NPSA 2KQ3A 1YD8U 5FJ8G 1PH5A 2IWHA 4BAXA 5E7NA 4LF8L 3P20A 4M00A 3SK5A 5JJZA 3OJ3A 2LVQA 1XF5L 3D32A 3QX1A 3N1XC 2WNMA 2ENBA 3PF5A 4GIVA 1C4CA 1WTWA 4OHJA 3P4QB 1IL2A 1EWYC 2LUMA 1Q1EA 3CCUA 2ZCCA 2O2VA 1F9RA 1B70B 1K8AC 4CJ2C 3B9JA 4DQOC 4DKAC 4R4TA 4IM0A 2R6GA 1U5KA 2E2JB 4B6WA 2BYEA 4ILWA 4ZLTF 2AMCB 5GADC 2WDVB 5C44G 1X56A 3FILB 3ER0A 4DR7Q 3Q8CA 4XX5A 1O78A 2MHVA 2OF1A 4B3TL 1EUVB 3I4MH 2XTIA 3W5OA 2W82A 1V1PB 4IALA 4GOPA 3H7PA 4DK1A 2D2CC 3VQIA 4YHHL 1PH1A 1JOQA 3NZUA 2KA7A 4JI5Q 3A7AB 4A9AA 1CT1D 1WJJA 1WCMH 1A8VA 1PH9A 2FE8A 5A35A 1WXVA 1L2NA 1N34Q 3A54A 3AQQA 3VDYA 2UUAQ 3RFZB 4EUTA 2DAJA 2HD3A 1G8ZD 2N1VA 3PT2B 2GN5A 1WR1A 1PQSA 4I6NB 2L1AA 4K8JA 4K7UA 1AARA 1BBXC 2EYJA 3I63C 4BBSH 2DNEA 4X66Q 2IDYA 4KHZA 4Q0FA 3I4MB 1A62A 1J8IA 2BGFA 5ELFA 3JVZX 4LNFA 4JG2A 3HHMA 4DV4L 4A3MH 3CAMA 5C4XH 5C0XH 1XLNA 4USAA 2ZJDA 4PS7A 1EWIA 2DNCA 4DAVA 1SSNA 3FKYA 3KW5B 5EE9A 1BVSA 3KF6A 1SEBD 2OQ0A 4N8X1 3CRLC 4B3TQ 2XIWA 3BDOA 2VQFL 4A3GB 2JY6A 4AOFA 4JWSC 3CMMB 1FFUA 2IY5B 2XGTA 1SNQA 1GUSA 3SK6A 3VR4A 1SNOA 3VUWA 1Y8RC 4A3LH 2B8FA 2GVBA 4XDCA 2L83A 4HJAA 2V3PA 1YQ3B 1VQ6A 1X3FA 1XO3A 3B2GA 2LGIA 4NNJB 4DFAA 4LNIA 2AWOA 1GO3E 4N9TA 1Y69U 2ZJQA 2E76C 1WFQA 1EL0A 1WXMA 3J81c 2JQRB 1QOGA 2KOLA 4FN2A 4Q2JA 3ZNHB 4A3GH 1SIJA 1KRHA 2BVCA 5ELEA 1I4QA 2DYMA 5M5WH 5FLMH 3GTMB 3PGZA 4K6DA 2NS5A 1K8OA 4QB4A 3PCOB 3ABVB 4HXDA 1QT9A 1BXTA 4H44C 5BR8Q 4DNTB 5GAGC 3LB8C 5D7GA 1FO4A 4I6LB 5JJLA 2Q8TA 4K0KQ 3EN2A 3K7AH 2UU9L 4JI0Q 1UGMA 3KYCD 5DEHA 3M3YB 4AYBE 2JYOA 2VS1A 2N9EB 3U52E 1V9JA 4ME3A 4NPNA 4EZKA 3B08A 3B1LX 3NJTA 4LMQD 5G5HA 2B3GA 4KZCA 5M3MG 1IP9A 1SN8A 4EOYA 1WGHA 3U4VA 2ZNVC 1ZYRC 1JE5A 1VQFA 3Q3NC 1I4PA 3OHXC 4IUPA 1HFNA 4HCEA 2F4VL 4FP5D 1GM5A 3BZKA 3T51B 3U9SA 5AJ3Q 1XNRQ 1JJGA 3EIVA 2DY8A 2I5HA 5J22A 4KHPQ 1WCMG 3C3LA 1UWMA 3ZJVA 2IGGA 5CTRC 3ZJYC 2L8JA 2K3UA 5IT9E 1OGWA 1DOKA 3S17H 4QGUA 4UY8C 2LZ6A 1M1KC 1YQBA 1E2ZA 4A3KG 2PMZE 5J1ZA 1NR2A 3NEMA 1FRDA 1TZOA 3EC8A 4A76A 4HJGE 4IC7B 4IG7B 1L1OB 1EQQA 3R93A 2NVTB 2K8HA 3P4RB 5JHAA 4AJYB 3I73A 2MSED 1KJTA 2A8VA 1IKMA 2EXZA 3IT6B 1FRRA 2LHDA 1IUEA 1PMRA 2EYFA 2EXDA 3E9IA 2AHOB 1HTOA 5EE0A 2L1BA 2WXOA 4CKEA 4N59A 1E7PB 4IO9A 1HPCA 3T9LA 1TS5A 4HSPA 3RMHA 1HR0W 4KIKA 3RNCC 4AUQC 3UI3A 1CK1A 2C5CA 2VRRB 5DM73 3BWUD 4MZ9A 1B53A 1GC6A 2LGSA 2NPTA 3C19A 3N32A 4ZKBB 1IL8A 4C3HG 4A3LG 2VUMB 1SNPA 1PTOH 4OELB 1HNWL 1EYCA 4A3DB 2GBKA 3RNFC 5C3EH 2KX3A 2WXNA 5IGGA 2GBRA 1G51A 4LFBL 1DZ1A 1EY6A 4WJ3M 1PZID 2Q8RE 1ZEQX 2AKWB 4P73A 4O1NA 1DGJA 5JOBA 4GKJL 2VH1A 1TWFB 2B2YA 4EX5A 3BINA 4DR1Q 3GQBA 1XMQL 5C4XG 1PTOD 4A3JB 2E2HH 5AUKA 2MWSB 1PUTA 3DLLA 3S2DH 4FULA 2KMAA 2SNSA 5FO8B 3WANA 3Q3MC 3W3AA 5AZFA 3TMPB 2PLPA 4LDTB 3FRPB 4KV6A 2FCNA 4J3OD 4RMFA 2LXKA 1I42A 3A56A 2B63G 1IBLQ 1KD1C 5FOBB 1EOTA 4D2KA 5JEAH 1RL2A 1Q86C 4K7SA 3DVNU 3EA6A 3A33B 2QMTA 3NRZA 1OXXK 1AFPA 5E6OA 4HMJA 2ZTEA 3TEHB 2D5DA 4XDDA 4YWGG 4UHVA 1X6OA 4B3RL 4JI2L 1HNXL 4P7IA 4ANWA 3F2BA 2JE6I 2R92B 5GAHC 1FR3A 3MXNA 3K59A 3PMFA 3OMCA 5IGDA 1KL9A 3MFGA 1L6UA 4JI8Q 3KH0A 3IL8A 2I2YA 3M3JA 3GE3C 1TWAH 3RNBC 1LABA 3FPUB 3J81E 2N4FA 3AECB 3ZNZB 1F9PA 1V81A 2F0OA 2IO0B 4JI5L 2IGDA 3PO0A 1ZUD2 1ASYA 2MPMA 3H0GG 2CWAA 1GUWA 1PFNA 2Q5WD 1H9RA 4CKCA 5DAUA 2ES2A 3QAQA 2EQSA 5C0XI 4DR5L 3D31A 4OO1H 2L32A 1C77A 2L0FA 4J6IA 3PLVA 2O6VB 3KJOA 2E5LQ 3PIO3 4FXKC 1II3A 4DV0L 3KBXA 4H7BA 1N32Q 3ZXRA 3HVDA 2UWQA 3KOJA 1LTLA 3SR6A 5HURA 3ZTDA 2PW5A 3VR6A 1PGBA 3Q6SA 1JWUD 1EWHA 3ZGZA 5KRUA 1ILPA 4DU9A 3TJPA 2CHBD 3NK9A 3PO2H 2K5WA 1L5PA 4OIKA 2CVRA 1VJKA 2BB6A 3DBRI 2I46A 3IAS1 4JE3B 1HUNA 4IM2A 2NVQB 4G57A 3UE0A 5CC4A 2AUKA 1FCLA 1U0LA 1U4PA 3VR3A 2Z1CA 3T8MA 1M90C 2KANA 3RD4A 3HKZG 2MGSA 3QG1A 2B2VC 2BDNA 1YX5B 1L7YA 3RT3B 2OJRA 1B44D 3A1QB 3VYRA 2WX1A 1TWCH 4Y7NH 2JZ3B 2RF4A 2QDFA 4NKLA 3HOZH 2ZVOA 4ZOHC 2W54A 1KM7A 3CCSA 3GV6A 3R8BA 4II3B 3I57A 1FXIA 2KX0A 3AYHB 4XC2A 4N6EB 3SXHA 3IT4B 3L17A 4DR6Q 1S5BD 5JVG3 1YIJA 3E3XA 3S1QH 3MHBA 4DAYA 1CA6A 2ZPYA 2Z0SA 4FJYA 2PPBC 2K22A 1HTLD 4YWKA 4Q5VA 3KYHC 1YJNA 1X9NA 4LFAL 3Q3OC 1PXUA 2JRHA 4PMBA 4DNIA 3C8YA 4LK0M 2F0UA 3T3NA 1Y8NB 2D9UA 3T1YQ 5DPSA 1Q5WB 1UD7A 2ZCBA 1EYAA 4A3MB 1STGA 3W1SA 2OXPA 1HEZE 3K9OB 1Q81C 2FUHB 3RNAC 1P3QU 2QW7A 2V4DA 3TREA 3JAME 1BUVT 4B3RQ 1V8CA 2IJ0A 1VQIA 4UP9A 4FJZA 1IBML 4MTKA 4LJZC 4EQ5A 2B2YC 1MFWA 2AYOB 4X65Q 3Q6BA 2O5IC 5K36H 5KEEA 3VTUA 2BKRB 1E9MA 3D6CA 3H3VI 2PPHA 2A4ZA 4LF5Q 4A6QA 3Q69A 2L05A 3VH4B 1J5EQ 4CYEA 4DV3L 2V0GA 1UE6A 3AB5A 1MSHA 2M17A 4DR4L 5LXIB 4ZUIA 4JI1L 5CHWA 1E8YA 5KHQA 4YSZB 4M01A 1IBXA 3PO3H 1QNKA 3S24A 1E7ZA 5KYLA 2R3ZA 1Y1WG 4KGRA 3KVFB 2LKVA 1MHHE 2G4SA 4DR3L 2REXA 4IUMB 5D6JB 3ZRFA 4BY1B 2UUAL 4HSVA 2PO4A 4MIUA 2A19A 4JWUC 3CC7A 4M1UB 4X3TA 4DV7L 4G7HC 1BO0A 4XZ4A 1WSPA 2GA4B 5EKIA 5EKLA 2JA6H 4RM9A 3V6CB 2UUBQ 2BW2A 3IG3A 1WYWB 1J7CA 1YHAA 2JSOA 4REZA 1E10A 4C3HB 4NJ6A 4JCVE 2IO2B 2MQJA 2KEDA 2MP2B 1B9RA 1L1OC 3BDCA 2QCZA 4LFCQ 4BY1G 4O0AA 1TY0A 2RBMA 4JVZA 4A3PA 3A9JB 4MJSB 2NUCA 3J7AF 1N9WA 3W1GA 4AQYL 1LXDA 2WXQA 3A4SC 4JQWC 3V61A 2XN9C 4C00A 1DOIA 4JW0A 4CJ1B 4KX6B 1E0BA 4QF4A 2F0DA 4POFA 1ML0D 4YSXB 2L76A 2W3RA 4CKBA 3QWZB 2RSNA 4A90A 2FINB 2ZPNA 1D1KA 4C3HH 1PFMA 4K5WA 1L4ZB 2R93B 2KHJA 4OGQC 2L12A 2INNE 5EPJA 5IO9A 3S1MH 3T1HL 4JBKA 2JXMB 3I4OA 2GBJA 2NYZD 1AZPA 1QOBA 2IY1B 4MSQB 1VS0A 1D1IA 1GC7A 2XK5A 3ICEA 2BCOA 4P75A 4F87A 4JPBW 3A9KA 5C23A 3VTVA 4LUVA 1L0YB 3DQVA 4CHTB 4W9IA 2KDBA 4HAEA 4YCWA 3SVMA 4YWLA 4HIOA 4KKJA 1K83H 5FO9B 4KLKA 1VZ6A 3QK0A 2KHIA 3KLSA 1JRPA 3NQIA 1EQRA 1GOZA 2RHQB 2Y0SB 5I2XA 5CV6A 3K81C 1Y56A 1WWTA 1WF9A 2XRQD 3W1BA 4IWQA 5F2DA 2F0KA 1KXLA 1TVXA 4MEMA 1A5RA 1V1OA 1T5EA 1RIPA 4GNXB 2WINB 3CMAA 3CIRB 4LUOA 4YIJA 1I5FA 4FDBA 2E2HB 1Y8OB 5E1FA 3TEXA 2E75C 2ONQA 1ZDVA 3AE5B 3CHBD 2BYFA 1JMCA 4BBSG 3IXSA 4OVVA 3ZDMC 4DV3Q 1E90A 1JRUA 1R4MI 1LACA 2QCPX 3U58A 3IBEA 1GHJA 3RR5A 4K1RB 2K1FA 2EY1A 4RFBA 1VQNA 5K36G 4G50A 2QKIC 2CCZA 4X66L 1BF4A 4HTHA 1EY0A 2N9PC 4KSLC 5IY0A 1V86A 2IPKD 3QO2A 2BA1A 3HGBA 3O13A 3GTQH 2LEKA 1N63A 1FGUA 3ZQ4A 4GLXA 2IHEA 2L4NA 1O7IA 3PUYA 3QOLA 3JAMc 2C5LC 1OQRA 1WD1A 1WGKA 2PNRC 1SIFA 2JA5H 2KLGA 1LTAD 4KSKC 4YTPB 1BBUA 3I90A 2F0WA 3CF5A 2PZTA 2INDC 4B3SQ 4ZRQA 1LT6D 2UXDL 4IFDG 4K2KA 3PO3G 3DCGA 2Z6BA 5KIXA 3S16B 1A63A 4YL8A 1JB3A 1BCPC 4O2DA 4A93H 1HZCA 2IX0A 3X3NA 1KHIA 3WALA 3CCRA 3STBC 1KNAA 3ECIA 4K3BA 4LF9L 2M9VA 2NBFA 2BB5A 1HZ9A 2RPQA 4NZLB 1K53A 1R7SA 2PTLA 4AJWA 4IPCA 3NUHB 4MM3B 2QDBA 1S1QB 2JPHA 2Z59B 1DOXA 1EFWA 3C0RB 5M5WB 3GTMH 2QEXA 5DNFA 4Y52H 1AYFA 2O6VA 4YTMB 2K5NA 2ZT9C 5GAEC 3J7YW 3HOUH 1VQ7A 4A93B 2X6GA 3CQZB 1EWCA 1YQ4B 2KFKA 3J7A5 2YU9H 4QUCA 3A8KE 2G45B 4DR2Q 1P7EA 1MHWC 1FXAA 2X69A 2WP8J 4A3MG 3M3YH 3SEBA 1HZ5A 4C80A 4DNRB 1V5OA 5ELOA 4H0LC 4ACFA 1SDFA 1LFDA 2ZXPA 4PMCA 4IZ8A 2VUMH 2KLCA 1I50B 3MXNB 2NMQA 4LF9Q 4KDIC 1IBMQ 1ET9A 3ULPA 1IGCA 1J19A 1SF0A 4KGSA 4KI0A 2Q2TA 2PKOA 3DVGX 1FGBD 2JZPA 2R7ZG 2NVXB 2WFWA 1Q1BA 1RFAA 5E4XA 3G48A 3N3KB 3S15B 4C4VA 2IGHA 4K6LA 1F9QA 3BZDB 3WWVA 2DYBA 4KHPL 1G6ZA 4OEMB 1YHBA 3M4QA 1EYDA 2KYWA 2DZJA 3EECA 4YY3Q 3AI5A 5HHDG 3L0WB 3PZ8A 2DGYA 2K6DB 4HROA 5GMVA 5I9PA 4P1CC 3BG3A 1WGDA 5T1IA 2KMMA 3RD2A 1P16A 4S17A 1ROEA 2KJRA 1A3VA 1G6PA 2XK5B 3SU8X 5CHFA 4BBRH 1KDAA 3GTGB 2HHHL 3S15H 4A3DG 2EKIA 3K7AB 3APDA 3DBHB 2IBIB 3CCVA 1PH8A 1GUOA 1TKYA 1YN5A 1ISNA 2LS01 2WB1B 5L95C 1M8AA 2JK8A 2DZKA 3MHZA 1OQYA 1MI0A 3P7JA 1TS4A 4GN1A 3V60A 4KD4A 1EIHA 5ELCA 3MXPA 4QQBX 1KRTA 1AEXA 2VB3X 4AWJA 4A3CH 1HTQA 3DMUA 3EQLC 1SYCA 2JA5G 5M3FG 3U30A 3MJWA 5D65A 3UDGA 1UELA 3PUVA 5L83A 4IOCA 3K58A 1HZAA 3GTGH 2N78A 3KF8A 3BK2A 2LXJA 4IOAA 1LM8B 1YJWA 3QC8B 5G2NA 5JEAG 4JBWA 2X6LA 3MXUA 3K7UC 5EPKA 1VQEA 4K2LA 4MGIE 1E2WA 4NQKE 3AMUA 1VZ8A 3K9PB 4RF0A 4BOZB 1BDOA 2EYMA 2RHSB 4CDDC 2ASBA 1B50A 2WXKA 4JX1C 4JI4Q 3ZNID 3M62B 3Q8AA 1EZ8A 4NP5A 5GQOA 2VUMG 3K5MA 1PV4A 5IA7A 3GTKH 5HGQA 1OFFA 3SK8A 3PF4A 3PHWB 2LY7A 3I2ZA 1ACCA 1QKZA 4R3DA 2EDGA 4GB9A 4AYBG 1PYWD 3HOXH 2K25A 2WXGA 1JWSD 3R3MA 4JI3Q 1G2SA 5EGTA 3ZYYX 2UXBL 2KDEB 3AH7A 4WRDA 3J7AV 4IM3A 2NCNA 1EY4A 3FVQA 2A5UA 5E4WC 1VLBA 2BS4B 3CWIA 1WIAA 2HE7A 3ETRA 4S3SA 2F0GA 1WJ4A 2MNAA 2KKCA 2HIXA 2K01A 2TMPA 3DBHI 1QZHA 3VR5A 1D8LA 3B2FA 1SNMA 1RD9D 4X3KA 3K57A 1PTOB 1Y1VB 4OX9L 2B63B 1WZ0A 5MPOA 1UBQA 2AQ1B 2G9HD 4CHKA 4IUQA 4HIDA 2XBBC 4A3EH 3PS6A 3HRDD 5DLQE 2FIDA 2F03A 3BZCA 1Z7TA 4PYUA 2HTME 3AE9B 3CF6E 4WJQA 1SAPA 4R1JA 1DOMA 2NN6H 3P75A 4DAYB 1Z2MA 2M56B 1FNVA 5IGCA 2Z6KA 1E8WA 4LNOA 1QZEA 1H9JA 1JE4A 1Y1VH 3UGBB 1LT5D 2R2OA 1ASZA 4XIGS 4U68A 4GNXA 4M0WA 1I6VC 4ALPA 3ZXVA 4EE2A 2NBUA 1T0YA 2CU1A 3WAMA 1S5ED 1R9TB 1UE1A 2R93H 1YIWA 2RDHA 4A3IB 1PGXA 1C78A 3Q8DA 3OW7A 4A3GG 1D2BA 5IP9H 3GZNI 2DX5B 4A3BH 2B39A 3DXJC 4RA8A 3U4ZA 2KNBA 2BDOA 2BH8A 4QJFA 1EYGA 1WYDA 1HR0Q 5EE3A 2EY5A 4B3SL 1GNUA 1F2ZA 3PQIA 4JI6L 1V1QA 4NJCA 2L7RA 5C3WA 4AP4C 3M9BA 4W9DA 2E6XA 2KN5A 2WDRB 3KQ4A 3KF6B 3HOYH 1X54A 2PIAA 1E0ZA 3CPFA 1A6XA 5DPWA 3H7SA 4JIOU 1A70A 4GU2A 4TQ0A 1OXUA 1E2VA 1K52A 1BBWA 1V2YA 3PRZA 2RCFA 2ZTDA 2MJEA 2G3QB 3DDCB 3NXWA 3CP0A 3A8JE 2ID0A 3HUIA 3KUPA 4ULLA 1NJIC 4R8IA 4KY5A 4XYOA 2CHWA 1Q10A 4XYQA 4DK6C 1DYQA 5M5YB 2N1WA 2WU2B 1A15A 1LO5D 4TV3A 1J0GA 2DNFA 2PI2E 3MFYA 4A3KB 3HOYB 1CSQA 3X3MA 4AQYQ 4DR5Q 2JA7B 1TS3A 3CCEA 1CJEA 1EM7A 3K0XA 1LYLA 1S72A 5T8IA 4HJ5A 4A93G 1SYBA 1NEKB 3OJ4B 2B76B 2AUJD 1BCPB 1OXSC 2MJ3A 1VMCA 1H95A 3AN1A 4C7YA 1XX8A 2IL8A 2JX5A 3LWEA 1SGHA 5JVH3 1HUMA 4RGTA 1E5WA 2GOWA 3GTQB 1KF6B 1MPEA 2JF5A 2CKZB 1BT0A 1UNSA 4IW0A 1WOCA 1H9SA 2VY3A 2XWBB 4DXFA 1FMAD 3N9YC 5BO4B 2K52A 1PRTC 5M9OA 1B8AA 1VQOA 4JI6Q 2CJOA 2JA5B 2I0QA 3UIPB 4MH0E 4K0KL 3PRMB 1N32L 3I9V1 2BKFA 5IYBH 3ZKJC 1RHPA 3TMEA 3S16H 3S1NB 3N52A 3QJYA 2LASA 2NR2A 3IAM1 1SJHD 1ZE3D 1QVFA 3JAML 2HJ8A 4DR4Q 1B9NA 1I3QH 2ZJRA 2KZRA 3LXFA 1YN3A 2MHJA 5C3JB 2OTLA 3UQBA 4WWPA 1FJGL 4CQNA 4P6VF 4F7ZA 1IBXB 3L3OC 3QA8A 4I6PA 3SHLA 3WA0A 1ZKHA 1D7QA 2INPE 3MEFA 4LNKA 1NBFC 3VUYA 5CV7A 1WI0A 5IN7A 2JT4B 1IZ6A 1YOVB 4C2MH 1OXVA 4JYAQ 2WXPA 2MLBA 4EQPA 2JXXA 1Q1OA 2IZVB 4JOIC 3HOWG 3VH3B 3GD7A 2B2WA 1KLGD 4X62L 4K8IA 4MACA 3M4OH 1HZ6A 4HLEA 5LMNL 3OTOQ 1F52A 2YU9B 2WB1G 4NY0A 1IYFA 3AE2B 1N36L 3H0GB 1TWHH 1WE7A 4V0BA 1EEFD 5CV5A 3UE1A 4HKZE 3GO5A 2H88B 2DZIA 2SAKA 5I9OA 1X1MA 4FF3A 2FJ2A 2RCNA 5M3FB 3UIOB 1UE7A 1XPOA 2UUCQ 4FO2A 5CX3A 4UP7A 4HDQA 1LTSD 3ZUNA 4MNOA 2ZW0A 5IYBG 3KUZA 2R93G 4UPAA 4JI7L 1G2TA 1L4DB 2LGXA 3P4PB 4EZJA 1OQQA 3I5JC 3R7RA 2N8NA 3I91A 4KGTA 4C4VB 3E9SA 3SE0A 3IKJA 1PH7A 2OHFA 3EUB2 3GS2A 2W55A 3ND9A 2QDLA 1I4RA 4H13C 2K33A 3RLOA 1CKMA 4C1NK 2D5GA 3H6MA 1JW9D 2D2QA 1PZJD 1TIID 5C6AA 4GOCA 1IGDA 2TSSA 4IJHA 3J7ZC 3PZ7A 3RULA 4AS1A 5IIFA 2WDQB 3PGEA 3QIAA 1RTNA 3H1UA 2AWTA 3CC2A 1FD6A 1VCBA 2DHZA 1YX6B 1VRAB 1OTCA 3DWAA 2F0VA 3AXCA 4NXNQ 4TQ1A 2EPBA 5FK9C 3CMEA 1HNZL 3NHHA 1CFMA 3BYTB 2MBEA 3EBEA 4P71A 5IGEA 5LMNQ 3NE5B 1I4HA 4F7XA 3J9CA 2R92G 1H9SB 1NY4A 1F77A 2D62A 2F0MA 2FUG1 3GP7A 2LVOA 1K50A 5CV4A 1PHJA 2KJ6A 1BUIC 4BBSB 5BYRA 4W9CA 1LUZA 1ZXHA 2KVMA 4B0MA 3KUCB 3ZW3A 1J7AA 2KACA 3J81L 1WGGA 5IODA 3I7FA 2QSDA 4NJ7A 1RODA 3HOZG 2WQYB 1VQKA 3CD6A 4QIWE 3J80E 4HIKA 5AUIA 3BJUA 1UWXA 2SDFA 1DONA 1B3QA 2KCNA 4W9GA 4LFAQ 4ZKCB 2B2UC 1V97A 3OAWA 4C1NI 2YV5A 1FYCA 5EKKA 2L11A 5D3IB 3QQ8B 1AN8A 1EIYB 3IFTA 2Z9HA 3AE7B 1V49A 1IBKL 3ZIMA 2Q8IB 3QR8A 2IX3A 1PTOC 4EGVA 2R61A 5GROA 3FKIB 1QLBB 2E2JH 1T3QA 2VXWA 2LD9A 3I55A 3VYUA 3J81j 2QILA 2K8CA 1I6HH 3NS1A 3U4EG 4JV5L 1GUTA 2BE5C 2OQKA 4WJWA 4XTCS 5IYDG 2IW3A 3WDNA 5J39A 2FCQA 1WCMB 2VQEL 2F0NA 5ELBA 2UYZB 3KUDB 1XD3B 4RGOS 4QAYA 1VQAA 4LNQA 3HIZA 2N55A 1CQVA 1VR9A 2BF8B 3H7PB 3UINB 1JWMD 5J3BA 5LHY1 1JQYD 4B3MQ 2F0FA 3EFUA 2DN8A 4US9A 4R4IA 1OTRB 4NW2A 3IVFA 4GOPC 4PZ8A 3DWMA 4W9KA 1L2FA 2FCMA 3E0JA 4XQNA 2N3SA 2K50A 4A75A 3AU5A 5FKAC 3M7NA 2V4LA 1WTVA 1CHPD 1VQ4A 1H4RA 2ZNVB 2RDGA 5M3MB 3WCQA 2FFKB 4ICUA 4A3JG 2KT7A 2FXQA 4A55A 3E0EA 4JLCA 4ZDVA 4DHZB 1VQPA 1WM3A 4PZ6A 2DY7A 4NDXA 2NBVB 4RNAA 1K0SA 2K5VA 3KK7A 3UI2A 2VZKB 4ID6A 3KJPA 4DUYL 2GBMA 2WYQA 3O65B 4YTNB 4MH8A 3RUIB 3H3VH 1PH6A 4IPDA 3JSVB 1A2TA 1NMFA 4C3JG 3NTKA 5NUCA 5C0XG 1DXMA 4AIMA 1TWGB 5TSSA 2H4OA 1RLFA 3VR9B 1EY7A 1YBYA 1R9TH 4PV1C 1VZ7A 4DR7L 1MJDA 4TMAB 4A3IH 3L9AX 1SMYD 4FXGC 3RNGC 1GUGA 2N0SB 3NTIA 2I07B 1D5ZC 1ZP0B 1C1YB 5LLIA 4ZHPA 1JQ4A 1WGYA 4RKLA 3DM1A 3HK0A 1OEYA 1B1ZA 1E7VA 1XMOL 2CS4A 1GPXA 1QOAA 1S5DD 2NVXH 1HQMC 4TRDA 3NZSA 1TWGH 2FAZA 1SMXA 2PMVA 4MGKE 4XE0A 3HRZC 1GJZA 3UQAA 2I38A 2DYOA 4EFOA 3TBLD 1WJUA 2KQ7A 4RGNA 1YJ1A 1RRBA 1BOSA 2I1JA 4LCDE 4OZAA 1RDPD 1VF7A 5M5XH 1JOKA 5I6WA 1K8GA 4Z9CB 3HOVB 5IGBA 4K3CA 3HOUB 2JEBI 3BVZA 1IXRA 5M5YH 3Q0AA 3NVVA 4K81A 1KDBA 2SEBD 3CQZH 4X65L 3VYTA 3CC4A 3HM3A 4B95A 4ARCA 2CWPA 4I7ZC 2BS2B 2W3SA 4E6IA 3X23A 3V05A 3JYUA 3PHXB 1TWCB 4LUZA 4Y7NB 2JRIB 1D4BA 3E56A 4AH6A 2J0TD 2F4IA 2MQHA 1ENFA 3M4YA 2KXJA 5JZEB 4DHZE 3N20C 3CCMA 2UXCL 1N5WA 2E74C 1I50H 1WXAA 4JK1C 4BBNC 4XDXA 1MIUA 4BBNF 4ZRIA 3DUZA 1WMHB 5D14A 3AE4B 4EEWA 1VQGA 3AB9A 1QUQA 3MAQA 1KH0A 2CW0D 3GTLB 3VRBB 4IUVA 1UH6A 3PUWA 1ESRA 3HOXG 3M4PA 4P2CB 4JI4L 4X6AH 5BN3A 2VZKD 2BYVE 5JPNC 1WRDB 4B3ML 5BR8L 2DENB 1VQ9A 1I94Q 2F0EA 3F2DA 1WX8A 3P2BA 4GN4B 4KVGB 2FMCA 5EBCA 2ZM6L 4A3BG 1WRIA 2MA9B 4OWXB 4DV6Q 1U4MA 2J4XA 3DWQA 3TP6A 1PGAA 4E74A 3ZJUA 3NZ3A 4QY7A 5D3DA 4P74A 1SB3C 2WU5B 3GTOH 3FDTA 1P8LA 1DGSA 2MP1A 1M94A 1W3SA 2JWUA 2A69C 4WJPA 3CXCA 4IPGA 3LJ3A 1JR0D 3I70A 1QQRA 2PYKA 2FBWB 2PQAA 2WHIA 3VUXA 2YTVA 3HFZB 5JAVA 2KWCA 4CDCC 5HGTA 5AZGA 4TSSA 4GKKL 2R2QA 2VH2A 2CH4W 5C3XA 2PZUA 3K6OA 2WX0A 4FJVB 4G11A 4A3BB 2Y3AA 2LI5A 1TWFH 4R4QA 1QOFA 3DHQA 3T4AC 1QB5D 3AULA 4A3JH 4ANVA 1TBEA 3HZXA 1EO6A 2B2UA 3S2DB 1XXGA 1TWHB 4AYBB 3ND8A 5BMHA 3VR2A 4DV2L 3CRKC 2K9XA 3G6EA 3E6ZX 4QIWB 1FXTB 1CUKA 4BBRG 3P42A 3PO3B 1BMLC 4J8QA 5G5GA 1LT4D 1RAXA 4HWIB 2ICEC 2OT2A 1ZXIA 3IAYA 3U50C 2K32A 3SDZA 2HCIA 3V62A 2WXFA 5J17A 1Q90A 2N88A 1DOYA 4BY7G 3ZO5B 2VQFQ 3NVZA 5JJIA 1IPGA 2H89B 3EGRA 3L7ZC 1C9OA 4DR2L 1JB7A 1Y1VG 4DDGD 2N7DA 4JI2Q 3Q3JA 4P16A 1K51A 5CGKA 5IYCH 2B8GA 3EFXD 1BQQT
chains in the Genus database with same CATH topology
4FXCA 3AEFB 3P1MA 1LTBD 2JYTA 4OL7A 3WOEA 2EYLA 1IYVA 5JEAJ 3T3OA 3BVGA 2MUYA 3OPOA 1SBBB 3AEEB 1YNNC 1ENCA 1KNEA 2WP9B 1AW7A 4OZBA 1PRTF 2WXHA 1WYGA 2QF7A 1CZGA 1ENAA 4A3EB 1F9SA 3NTHA 1SYGA 2L0CA 5H8YE 1I3QB 1NVID 4H2AA 1C4QA 2N9KA 3AE3B 1SXTA 1LT3D 5JXVA 4RGMA 2LFIA 3D6WA 2J7ZA 4IUUA 5C4HA 5BYQA 1O7ZA 4FF1A 2RKSA 1OXTA 4ZRPA 1QILA 5C2TB 1A2UA 1T5XD 3NBHA 4UDUC 5KGUA 2JA8B 3I4LA 2L9HA 2WXIA 2KCCA 3MVVA 3Q22A 1H9MA 3TSSA 1JICA 1FNUA 5EE1A 1W6JA 2Z8LA 2EJGC 2WIIB 1WTXA 1XYIA 1ZDXA 4ARIA 3VR8B 1GB4A 4ZYSA 3DEPA 1WD0A 3K5NA 1SSOA 3GTPB 2L5TA 3AE8B 3Q8EA 4HCSA 1EY9A 2BS3B 4GDLB 4KJNA 4KY7A 5KNCA 3U9OA 3CU7A 3IFDA 1TKGA 2AQ2B 1RM6C 2PQEA 2CJNA 1TT2A 1BCPD 1YJIA 4IFDI 2AQ3B 2EY6A 2KQ4X 2E3TA 1EZ6A 2F0PA 3Q8FA 4XXEA 3K0YA 1O7LA 3AEAB 4AQ7A 3T16A 2V3NA 4RWSC 3C1EA 3MC0B 1DD2A 4U673 1VDZA 2A74C 4PQXA 2BT6A 4DF7A 1CHQD 4GZYC 1RWSA 3M4OB 4BWGB 5A2QL 1EU3A 4FYDA 2LHEA 2M0AA 4ABNA 1NUCA 4C7ZA 2XRSD 4XQJA 4LLGM 2A6EC 4X3SA 1B3AA 3HOWB 3ITPA 2WXJA 3MXGA 3R2IA 4GLSC 1GB1A 4LK1C 1W6KA 4RCOA 1T6BX 1YNJC 2XWJB 2F0TA 2A68C 1QNUA 4K5XA 3T56B 1I7HA 2KUMA 5M5XB 3KBGA 3V2TA 1HA6A 4ODGA 1TKWB 2F0LA 4X3UA 4IFDJ 2SNMA 4R9WA 3W2DA 4WWMA 2WAQB 3NPPA 5BN4A 5EQ0A 1TJEA 5BMGA 1TU2B 1FM0D 1NYRA 1YMHE 3FC4A 2FMMA 1ONLA 2BBCA 4ZK9B 1DCZA 1S4ZA 4F88A 1NYQA 2BA0A 4B0EA 3MTSA 4HMIA 3I72A 3VA7A 3A8IE 2DWQA 2F0QA 1N62A 2A6HD 4J1MA 2RVLA 3G6JB 5CV9A 4US8A 1KLUD 3EJIA 3AM9A 1JMLA 1VDVA 3D3RA 2EELA 1SE4A 4N58A 3RZOB 4M8AA 4TKOB 5I4DA 2NZ1D 2PMZB 2EVBA 3S17B 3TUOA 1DJRD 2B2TA 1XLOA 4L1BA 1VMPA 3VA5A 2KDMA 1K83B 4G7OC 3AU7A 4XWTA 1YJJA 2O2LD 3U2SC 1IYUA 1PLFA 4WH4A 1I6HB 3AEBB 1C9FA 1KTKA 2NVYB 1QF6A 4MT5A 2H1EA 2N7JA 3OWEB 1HCZA 3BIID 2K5PA 3TP7A 1F2RC 2AX5A 3AMZA 1C76A 3PV0A 3Q23A 2WACA 5G3LF 4KN4C 3DWGC 1SFOB 1TQOA 4KJOA 3NQTA 2N9LA 3TBIB 2PCFB 4B08A 2CW0C 3NSWA 1STYA 5G3LD 3S2HB 1RJTA 4K5VA 3ONAB 2K05A 5C5MA 3RLFA 1U4RA 1FIQA 4KTAA 4ZRZA 2J53A 4OZCA 4A8XC 3T53B 3H94A 1Y1WB 3VYSA 1FNWA 1JALA 5A2QE 3V96A 1EQVA 3SR1A 1D5XC 1PFDA 1LTGD 4BA1I 3MWYW 2PW7A 3PO2B 5C0XJ 3OIQA 5LL6S 3K5OA 1G291 4DGZA 3TDQA 2KEEA 1GJXA 1MVKA 2NTTA 3LWUA 3BVMA 4JPSA 1JWAD 1SE2A 2K6AA 1ZKOA 4PT5A 1KAAA 1R4PB 4YT0B 3MP9A 2EJFC 2F3VA 3VRAB 4NAWB 4HN7A 4WURA 5E6JA 3RZDB 3NWTA 2ZXRA 1ICWA 2WKCA 5CORA 1L0XB 1STHA 4GDKB 1TWAB 2ZXOA 2MJDA 4KKIA 3P4SB 2L55A 1JORA 1GAQB 3MEHA 3U7ZA 2G9DA 4L8JA 3P1HA 1CI3M 1OO9B 3FEWX 1V43A 4KHVA 4RF1A 3LNNA 5FLXE 4L6TB 3KLSX 2F1MA 4HEDA 2JYEA 2K03A 1XLQA 4F8MA 1X32A 4DXGA 2KJXA 2LJIA 2C9OA 2VB2X 4RAUC 3BK1A 4L2YA 3C2PA 1N60A 4FF4A 2HUGA 3EVQA 5ELDA 2FHTA 2HCCA 1Z6HA 4HR7B 1EIGA 3PUXA 1QG7A 4DAPA 2K7VA 4DN4M 1KDCA 1YNND 3P63A 4BBRB 4BS9A 1STNA 2K5QA 2QIEB 1NAPA 3T13A 4CGYB 1ZOYB 2VNUD 4FNFA 1SNDA 4KKTA 2XSCA 1NENB 2OEOA 3D4DA 4KY6A 1ZXTA 1X3PA 3H91A 5CV8A 3GTOB 1B9MA 3WOFA 2V4IB 1LLRD 5KYIA 4KK7A 4ME5A 3OMGA 5BN5A 1HQRD 3OSOA 1WTRA 2EJMA 1PFBA 1LTRD 1SE3A 4IUNA 2E2DC 4TQUS 2EZVA 3KWVA 1VF5C 4L23A 4WIPA 3SFEB 5CBEE 1F2MA 5BYSA 2YYZA 1HA5A 2WXMA 4C2MB 3I4NB 3NBIA 2A73B 1CA5A 5I6YA 1V1PA 3QB3A 2KWDA 1O80A 2EYOA 3TZUA 4EQOA 1CZWA 1MBYA 2CU3A 3A7LA 3NUCA 1L6VA 1QJOA 1C48A 4KKUA 4ZHOA 1IW7C 1PTOF 4WFN3 2R7ZB 3URYA 3I3CA 2B2WC 1SNCA 5E3FA 4C3IB 4IURA 2AWNA 4K14A 3W9CB 1TKEA 1ILQA 1BCPF 4OO1I 4IQZA 1SJED 5FR3A 1VCIA 2WKDA 2PVGC 2F0JA 1F2LA 1AP0A 3FPPA 3FILA 2CQAA 3M7GA 3L4PA 3LYYA 1EY5A 5BMIA 2LFNA 2EOTA 2K0PA 2ACZB 5I2YA 2K5DA 4QMGA 2A69D 1EEID 1RKNA 3AEDB 4LAAA 1XLPA 4XT3B 2SOBA 1XEEA 2DLBA 4C3JB 4IFDH 2EYHA 1JROA 5H92C 3TEZA 2J42A 2JSVX 1YNJD 1TR5A 2A68D 2F0HA 4XT1B 2JP1A 2Z4IA 1ZYRD 4CBVA 1NCVA 1SYFA 3RUZA 2F0IA 2BE5D 5IGFA 3S1RB 3Q8BA 1L0VB 3J80L 1EQTA 5KNDA 2EE1A 3OOCA 4ZQ3A 2WLBA 3PIP3 1MHXA 3A55A 1QWYA 4PMWA 5C4XB 3TEYA 3HEJA 2NN6I 1EFID 4RHSA 3GTJB 3D8GA 4WORA 5LL6X 5C44B 1H9KA 2F3WA 3K5LA 3H8HA 2EY2A 4I65A 1U9RA 2WXLA 4IUTA 3PUZA 4XQQA 3OWFA 2RPVA 2JU6X 2F0SA 2KAJA 5HFYA 4IKGA 2KN4A 2ICIA 1QOHA 4KN7C 2NWGA 4ZAIA 3E5SA 3ZJTA 3KWLA 3D4RA 1QCBD 3NP8A 3LX0A 3AE1B 4R8NA 1TY2A 5FLXL 3SK4A 1NSNS 2YEPF 1MD2D 4OO1G 3Q24A 4BY7B 2GRIA 1QE6A 1NR4A 4KKSA 1ET6A 2WV6D 1O7YA 1FD7D 5C3EB 2K28A 4RHRA 4RH6A 2MEKA 1Y8PB 3TP5A 2B2VA 1MSGA 2GI9A 3DWPA 1UAPA 5C5LA 1UEAB 2HQEA 3H09A 1HHVA 4ZUJA 2PZWA 5CMDA 3NVWA 2A5HA 4MHEA 2RSOA 2ON8A 3SFDB 1JOOA 1CTMA 4NMZA 2L52A 3TN2A 4HRSA 2BOSA 2RA4A 1P7FA 3NVYA 5IOCA 2J52A 1A3TA 4UAIA 3BYYB 2OEDA 5AFWA 3C46A 2G1EA 4YXDB 1C4PA 5K5PA 1RTOA 1PRTB 3GV3A 1Z47A 2M2LA 4G4KA 4PNYA 1YN4A 3R2TA 3N6RA 2MH7A 2NN6G 4IDIA 1A3UA 3TEWA 1XCQL 2PVOD 4BA2I 4QCLA 1V8QA 3R3OA 1RF2D 4RCNA 3TZDA 3HP3A 2K1BA 1S5FD 3ERQA 1WTOA 3W5UB 1SYEA 3OIPA 4EVOA 5COYA 1PDQA 1IHZA 2LMCB 5EBDA 1TYGB 4EQNA 1HFGA 1GXDC 2O5JC 3QWNA 1CM9A 3TP8A 3M85A 4XWWA 1MGSA 1BR9A 1ESFA 3HOXB 3FMCA 2WXRA 3HOZB 1DOLA 2JXTA 2QJLA 3BS1A 1ZPSA 1K8MA 2A6HC 3HS0C 2IX1A 1HRJA 4MN3A 1STAA 1J9OA 3D4WA 2NTSA 4LTUA 1I4GA 2NB0A 4DA2A 2LMCA 2IT1A 1F0ZA 1XWEA 4KMUC 3AV8A 5FO7B 2EYPA 2GB1A 4CJ0B 2M00A 3HG9A 2HDMA 2JEAI 1CQFA 5CBAE 4IN3A 4FVMA 2HDEA 1WTQA 1WTPA 1LTID 1UGJA 1N61A 5IT9L 3C1FA 4NAMA 1AWDA 1F2RI 1F2YA 1X3QA 1SMYC 4QUFA 2HDLA 4DK0A 1C4AA 3V3XA 1PRTD 4WAFA 3HVZA 1EY8A 4HEA1 2B2TC 3F2UA 2DBYA 1D6EC 1DM0B 1IW7D 2KECA 1M4VA 1LV9A 1RCVD 3S1QB 2Y5PA 4HKQA 3G7LA 2M19A 3HKZB 2XVSA 1N5XA 1E6EB 3RPFC 1WXQA 1Q3LA 3DEOA 1C79A 1AZQA 3AEGB 1B4OA 1Q12A 2KHSA 2XNAC 5JPMC 1BNZA 1RFKA 2WS3B 5HG2A 1KFYB 1LTTD 4WQMA 3GTKB 3S14B 1C8CA 4V190 2BTEA 1CZPA 1RYJA 4C56C 3MZ5A 2E2IB 1S5CD 2PW9A 2ZW1A 4IOIE 2MJ8A 3S9WA 2RMMA 2Z4HA 3CKIB 4N9PA 3FAHA 1HXYD 1STBA 4ITKA 4B9WA 5HI1A 4B9XA 1UUPA 1FCCC 1R4QB 4O42A 1STEA 4FXDA 2YEPB 5EJWA 3EROA 1FEHA 5DM63 4L63B 4A3FB 3W5VB 1XTCD 3QOJA 1U4LA 1KABA 4FF2A 1I4XA 2K04A 4C3IG 3S1MB 1Q8IA 3KLRA 1IKLA 1MI2A 1SYDA 1JCKB 2A6ED 5C4JB 1FFVA 2RQXA 5LNK1 1YNTE 2JA6B 5EPLA 3BDLA 2QEJC 4G7ZC 4OIJA 1NI3A 3GB1A 2O4XA 1EU4A 5C4ZA 1PDXA 1GUNA 5GXGB 4J6HA 3AE6B 2Y5CA 1JWBD 5ISRA 4KD3A 4YSYB 1PZKD 2X38A 4OVZA 5KNBA 1B2TA 1GHKA 1XCTL 1WVLA 1HTPA 3MA2B 4RKBA 1JC7A 4OW0A 3NWSA 1J7BA 3H3VC 5CYUA 2RDFA 3I8ZA 1G91A 2BYTA 5T1GA 3MJ5A 5CR3A 1TS2A 1D5MC 2KQ3A 2IWHA 3P20A 3SK5A 5JJZA 1XF5L 2WNMA 2ENBA 1C4CA 1WTWA 4OHJA 3P4QB 1EWYC 2LUMA 1Q1EA 1F9RA 4CJ2C 3B9JA 4DQOC 2R6GA 2E2JB 4ILWA 4ZLTF 2WDVB 3Q8CA 3FILB 1O78A 2MHVA 2OF1A 2W82A 1V1PB 4IALA 4DK1A 2D2CC 3VQIA 1JOQA 2KA7A 3A7AB 4A9AA 1CT1D 2FE8A 5A35A 3A54A 3RFZB 1G8ZD 2L1AA 4K8JA 1BBXC 2EYJA 2DNEA 2IDYA 4KHZA 4Q0FA 3I4MB 1J8IA 5ELFA 1XLNA 4USAA 5C0XH 2DNCA 4DAVA 1SSNA 5EE9A 1SEBD 3CRLC 4A3GB 2XIWA 3BDOA 4JWSC 1FFUA 1SNQA 1GUSA 3SK6A 3VR4A 1SNOA 2B8FA 4XDCA 2L83A 2V3PA 1YQ3B 1XO3A 3B2GA 2LGIA 4DFAA 2AWOA 4N9TA 1Y69U 2E76C 1EL0A 2JQRB 1QOGA 2KOLA 4Q2JA 1SIJA 1KRHA 5ELEA 1I4QA 2DYMA 3GTMB 4K6DA 1K8OA 4QB4A 3ABVB 1QT9A 1BXTA 4H44C 4DNTB 3LB8C 5D7GA 1FO4A 2Q8TA 5DEHA 3M3YB 2JYOA 3U52E 4LMQD 5G5HA 1ZYRC 1I4PA 3OHXC 4IUPA 1HFNA 4HCEA 4FP5D 3T51B 3U9SA 2DY8A 5J22A 3ZJVA 3C3LA 1UWMA 2IGGA 2K3UA 5IT9E 1DOKA 1E2ZA 1FRDA 5J1ZA 1NR2A 1TZOA 4HJGE 3R93A 2NVTB 3P4RB 3I73A 1IKMA 2EXZA 3IT6B 1FRRA 2LHDA 1IUEA 1PMRA 2EYFA 5EE0A 2L1BA 2WXOA 4CKEA 4N59A 1E7PB 1HPCA 1TS5A 4HSPA 3RMHA 3UI3A 1CK1A 2C5CA 5DM73 3BWUD 1B53A 4ZKBB 1IL8A 4C3HG 2VUMB 1SNPA 1PTOH 1EYCA 4A3DB 5IGGA 1DZ1A 1EY6A 1PZID 2Q8RE 1ZEQX 4O1NA 1DGJA 5JOBA 1TWFB 2B2YA 3GQBA 1PTOD 4A3JB 5AUKA 1PUTA 2SNSA 5FO8B 3W3AA 2PLPA 3FRPB 4KV6A 4J3OD 3A56A 5FOBB 1EOTA 4D2KA 5JEAH 3EA6A 2QMTA 3NRZA 1OXXK 1AFPA 4HMJA 2D5DA 4XDDA 4YWGG 2JE6I 2R92B 1FR3A 3MXNA 3K59A 3PMFA 3OMCA 5IGDA 1L6UA 3MFGA 3IL8A 2I2YA 1LABA 3FPUB 3J81E 3AECB 1F9PA 2F0OA 2IGDA 3PO0A 1ZUD2 2MPMA 1GUWA 1PFNA 2Q5WD 1H9RA 4CKCA 5DAUA 5C0XI 3D31A 4OO1H 2L32A 1C77A 3PIO3 4FXKC 1II3A 3KBXA 4H7BA 3HVDA 3SR6A 5HURA 2PW5A 3VR6A 1PGBA 3Q6SA 1JWUD 1EWHA 3ZGZA 5KRUA 1ILPA 4DU9A 2CHBD 3NK9A 1L5PA 2K5WA 4OIKA 2CVRA 1VJKA 2BB6A 4JE3B 2I46A 3IAS1 1HUNA 2NVQB 4G57A 5CC4A 2AUKA 1FCLA 1U4PA 3VR3A 2Z1CA 3RD4A 2MGSA 3QG1A 2B2VC 2BDNA 1B44D 3VYRA 4NKLA 4ZOHC 2W54A 3GV6A 3R8BA 3I57A 1FXIA 4N6EB 3SXHA 3IT4B 1S5BD 5JVG3 3MHBA 4DAYA 1CA6A 2PPBC 2K22A 1HTLD 4Q5VA 1PXUA 4PMBA 3C8YA 4LK0M 2F0UA 3T3NA 1Y8NB 2D9UA 1EYAA 4A3MB 1STGA 3W1SA 2OXPA 1HEZE 2V4DA 3JAME 1BUVT 1V8CA 2IJ0A 4LJZC 2B2YC 2O5IC 5K36H 5KEEA 1E9MA 3D6CA 4A6QA 3Q69A 2V0GA 3AB5A 1MSHA 4ZUIA 4YSZB 1IBXA 1QNKA 5KYLA 2R3ZA 4KGRA 2LKVA 1MHHE 4BY1B 4HSVA 2PO4A 4MIUA 4JWUC 4M1UB 4X3TA 4G7HC 1BO0A 1WSPA 2GA4B 5EKIA 5EKLA 2BW2A 1J7CA 2JSOA 4REZA 1E10A 4C3HB 2KEDA 1B9RA 3BDCA 1TY0A 2RBMA 2NUCA 3J7AF 2WXQA 2XN9C 1DOIA 4CJ1B 4KX6B 1E0BA 4QF4A 2F0DA 1ML0D 4YSXB 2W3RA 4CKBA 2RSNA 4A90A 2FINB 1D1KA 1PFMA 4K5WA 1L4ZB 2R93B 4OGQC 2L12A 2INNE 5EPJA 2JXMB 2NYZD 1AZPA 1QOBA 1D1IA 2BCOA 4F87A 1L0YB 4CHTB 4HAEA 3SVMA 4KKJA 5FO9B 1VZ6A 3KLSA 1JRPA 3NQIA 1GOZA 2Y0SB 5I2XA 5CV6A 1Y56A 1WWTA 2XRQD 5F2DA 2F0KA 1TVXA 1V1OA 1T5EA 2WINB 3CIRB 4YIJA 2E2HB 1Y8OB 5E1FA 3TEXA 2E75C 2ONQA 1ZDVA 3AE5B 3CHBD 3IXSA 1LACA 2QCPX 1GHJA 2EY1A 4RFBA 5K36G 2QKIC 1BF4A 4HTHA 1EY0A 2IPKD 3QO2A 2BA1A 3HGBA 3O13A 2LEKA 1N63A 3ZQ4A 2L4NA 3PUYA 3QOLA 1OQRA 1WD1A 1WGKA 2PNRC 4YTPB 1LTAD 3I90A 2F0WA 2PZTA 4ZRQA 1LT6D 4IFDG 4K2KA 3S16B 5KIXA 1JB3A 1BCPC 2IX0A 3X3NA 1KNAA 2M9VA 2NBFA 2BB5A 4NZLB 1K53A 1R7SA 2PTLA 3NUHB 4MM3B 2QDBA 1DOXA 5M5WB 1AYFA 5DNFA 4YTMB 2ZT9C 3J7YW 4A93B 2X6GA 3CQZB 1EWCA 1YQ4B 4QUCA 3A8KE 1P7EA 1FXAA 2X69A 2WP8J 3SEBA 1HZ5A 4C80A 4DNRB 4H0LC 1SDFA 2ZXPA 4PMCA 4IZ8A 1I50B 2NMQA 1ET9A 4KGSA 1IGCA 1SF0A 4KI0A 2PKOA 1FGBD 2JZPA 2NVXB 1Q1BA 5E4XA 3S15B 2IGHA 4K6LA 1F9QA 3BZDB 1G6ZA 1EYDA 5HHDG 3PZ8A 4HROA 5I9PA 3BG3A 5T1IA 2KMMA 1ROEA 1A3VA 1KDAA 3GTGB 3E56A 2EKIA 3K7AB 1GUOA 1TKYA 1YN5A 2LS01 2WB1B 1M8AA 3MHZA 1MI0A 3P7JA 1TS4A 4KD4A 1EIHA 5ELCA 3MXPA 1AEXA 2VB3X 3DMUA 3EQLC 1SYCA 5D65A 3PUVA 3K58A 3KF8A 3BK2A 5JEAG 4JBWA 2X6LA 3MXUA 5EPKA 4K2LA 1E2WA 3AMUA 1VZ8A 4RF0A 1BDOA 2EYMA 1B50A 2WXKA 4JX1C 3Q8AA 1EZ8A 4NP5A 3K5MA 1OFFA 3SK8A 4R3DA 2LY7A 1ACCA 1QKZA 2EDGA 1PYWD 2WXGA 1JWSD 1G2SA 5EGTA 3ZYYX 3AH7A 4WRDA 3J7AV 1EY4A 3FVQA 3CWIA 5E4WC 1VLBA 2BS4B 3ETRA 4S3SA 2F0GA 2K01A 2TMPA 3VR5A 3B2FA 1SNMA 1RD9D 4X3KA 3K57A 1PTOB 1Y1VB 2B63B 5MPOA 2AQ1B 2G9HD 4IUQA 3HRDD 2F03A 1Z7TA 2HTME 3AE9B 1SAPA 1DOMA 2NN6H 3P75A 2M56B 1FNVA 5IGCA 1H9JA 1JE4A 1LT5D 4XIGS 4U68A 4M0WA 1I6VC 4EE2A 1S5ED 1R9TB 2RDHA 4A3IB 1PGXA 1C78A 3OW7A 1D2BA 2B39A 3DXJC 4RA8A 5EE3A 2BDOA 2EY5A 1F2ZA 4NJCA 5C3WA 2E6XA 2WDRB 3KQ4A 2PIAA 1E0ZA 1A6XA 1A70A 4TQ0A 1OXUA 1E2VA 1K52A 2MJEA 3NXWA 3A8JE 2ID0A 3HUIA 3KUPA 4ULLA 4R8IA 4KY5A 4XYOA 1Q10A 4XYQA 5M5YB 1DYQA 2WU2B 1A15A 1LO5D 3MFYA 4A3KB 3HOYB 3X3MA 2WXNA 2JA7B 1CJEA 5T8IA 1TS3A 1EM7A 1SYBA 1NEKB 2B76B 2AUJD 1BCPB 1OXSC 2MJ3A 1VMCA 3AN1A 4C7YA 1XX8A 2IL8A 2JX5A 3LWEA 5JVH3 1HUMA 4RGTA 3GTQB 1KF6B 1MPEA 1UNSA 1H9SA 2XWBB 4DXFA 1FMAD 3N9YC 1PRTC 5M9OA 2CJOA 2JA5B 3I9V1 1RHPA 3TMEA 3S1NB 3IAM1 3N52A 3QJYA 1SJHD 1ZE3D 3JAML 1B9NA 3LXFA 1YN3A 5C3JB 4CQNA 4P6VF 1IBXB 3L3OC 3SHLA 2INPE 5CV7A 1OXVA 2WXPA 4EQPA 3GD7A 2B2WA 1KLGD 4K8IA 4MACA 1HZ6A 2YU9B 3AE2B 3H0GB 4V0BA 1EEFD 5CV5A 4HKZE 3GO5A 2H88B 2SAKA 5I9OA 4FF3A 2FJ2A 5M3FB 4FO2A 1LTSD 2ZW0A 1G2TA 1L4DB 3P4PB 1OQQA 3I91A 4KGTA 3E9SA 3SE0A 3IKJA 3EUB2 2OHFA 3GS2A 2W55A 3ND9A 1I4RA 4H13C 2K33A 4C1NK 2D5GA 3H6MA 1JW9D 1PZJD 1TIID 5C6AA 1IGDA 2TSSA 3PZ7A 4AS1A 5IIFA 2WDQB 3QIAA 1RTNA 1FD6A 1VRAB 3DWAA 2F0VA 4TQ1A 2EPBA 5FK9C 3NHHA 1CFMA 3BYTB 5IGEA 3NE5B 1I4HA 4F7XA 3J9CA 1H9SB 2FUG1 1F77A 2D62A 2F0MA 3GP7A 1K50A 5CV4A 1BUIC 4BBSB 5BYRA 1ZXHA 2KVMA 4B0MA 1J7AA 2KACA 3J81L 5IODA 2QSDA 1RODA 2WQYB 3J80E 5AUIA 1UWXA 2SDFA 1DONA 2KCNA 4ZKCB 2B2UC 1V97A 4C1NI 1FYCA 5EKKA 2L11A 5D3IB 1AN8A 3IFTA 3AE7B 2Q8IB 2IX3A 1PTOC 4EGVA 2R61A 1T3QA 3FKIB 1QLBB 2VXWA 3VYUA 2QILA 3NS1A 3U4EG 1GUTA 2BE5C 4WJWA 4XTCS 2IW3A 3WDNA 5J39A 1WCMB 2F0NA 5ELBA 4RGOS 2N55A 1CQVA 1VR9A 1JWMD 5LHY1 1JQYD 2F0FA 4US9A 2DN8A 4NW2A 3DWMA 3E0JA 4XQNA 5FKAC 3M7NA 1WTVA 1CHPD 2RDGA 5M3MB 3WCQA 2FFKB 4A55A 2DY7A 4NDXA 4RNAA 2VZKB 3KK7A 3UI2A 4YTNB 4ID6A 4MH8A 1A2TA 4C3JG 3NTKA 5C0XG 5NUCA 1DXMA 1TWGB 5TSSA 2H4OA 3VR9B 1EY7A 4PV1C 1VZ7A 4TMAB 3L9AX 1SMYD 4FXGC 1GUGA 2N0SB 3NTIA 2I07B 1D5ZC 1ZP0B 4ZHPA 1JQ4A 4RKLA 3DM1A 1B1ZA 1GPXA 1QOAA 1S5DD 1HQMC 4TRDA 2PMVA 4XE0A 3HRZC 2I38A 2DYOA 4RGNA 1BOSA 4OZAA 1RDPD 1VF7A 1JOKA 5I6WA 4Z9CB 3HOVB 5IGBA 3HOUB 2JEBI 3BVZA 3NVVA 3Q0AA 1KDBA 2SEBD 4ARCA 3VYTA 4I7ZC 2BS2B 2W3SA 4E6IA 3V05A 1TWCB 4Y7NB 1D4BA 2J0TD 2F4IA 3M4YA 1ENFA 1N5WA 2E74C 4JK1C 4XDXA 3DUZA 5D14A 3AE4B 3AB9A 3MAQA 3VRBB 1KH0A 3GTLB 2CW0D 4IUVA 3PUWA 1ESRA 4P2CB 5BN3A 2VZKD 5JPNC 2F0EA 2FMCA 5EBCA 1WRIA 1PGAA 1U4MA 2J4XA 3DWQA 3TP6A 3ZJUA