1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
molecule tags Toxin
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1L0YB 4C56C 1FNVA 2Z8LA 1QILA 3CHBD 1JCKB 1FNWA 2XNAC 1RDPD 1KTKA 1D5MC 1PRTB 2R61A 1JWSD 4DXGA 3DWQA 3BVGA 1B1ZA 4RGTA 1LTBD 2XN9C 5TSSA 3BVZA 3KLSX 3TSSA 1JWUD 3GP7A 4RGNA 1JR0D 1SE4A 2WV6D 1B44D 1LTID 1T5XD 1LO5D 1M4VA 1LTRD 1LT6D 1STEA 3EFXD 3R2TA 3O13A 1KLGD 1ENFA 4Z9CB 1SE3A 3W2DA 1PRTC 4L63B 4RH6A 1I4GA 1I4PA 1AN8A 1PTOF 1PZKD 1SBBB 2IPKD 1S5BD 1ET6A 1RF2D 1I4RA 1V1PB 1XTCD 2RDHA 1S5ED 3EA6A 3BYYB 2SEBD 2XRQD 1TS2A 2ICIA 2IJ0A 1PTOD 1CT1D 1JQYD 1ESFA 1TY2A 2RDGA 3URYA 1FNUA 1LT5D 1LT4D 2AQ3B 1HQRD 1LT3D 1HA5A 1MD2D 1TS4A 1F77A 1KLUD 2CHBD 2O2LD 1EU4A 5ELFA 2NTSA 4DXFA 3MC0B 1YN4A 1PZID 3DWPA 1BCPF 1ET9A 1SJED 4RHSA 2AQ2B 1SEBD 1PTOH 2QEJC 1V1PA 1SJHD 1EU3A 4K6LA 3DWAA 1V1OA 1CHPD 4L6TB 3OWEB 2QILA 1PZJD 1LLRD 1XXGA 3BZDB 1BCPD 1L0XB 1CQVA 5ELCA 1S5FD 1TS3A 5D3DA 5FKAC 1D5XC 1FD7D 2J4XA 4RFBA 2G9HD 1I4XA 4O1NA 1RD9D 1BXTA 4RGMA 1EEFD 1UUPA 4UDUC 1LTTD 1PTOC 1EEID 1HTLD 1D6EC 1SXTA 1I4QA 1LTSD 3SEBA 1BCPC 1PYWD 1PRTD 3BYTB 1S5CD 1G8ZD 1UNSA 2XRSD 1EWCA 1CK1A 1LTGD 2TSSA 4TSSA 3V05A 1HXYD 1PTOB 4NZLB 1TY0A 1DJRD 5ELBA 3MFGA 4RCOA 4RGOS 1SE2A 1FGBD 1JWMD 1D5ZC 1PRTF 1S5DD 4RHRA 5ELDA 5FK9C 4BWGB 1DYQA 1AW7A 1YN5A 1GOZA 5ELEA 2NTTA 1BCPB 4ZYSA 1I4HA 1EFID 5D3IB 3BVMA 4OHJA 3R8BA 1TS5A 3R2IA 1RCVD 1LTAD 1YN3A 2AQ1B 5I4DA 1CHQD
chains in the Genus database with same CATH superfamily
3DVNV 4B3TQ 2IT1A 3J80c 1JROA 4WORA 1G291 2INCC 2CQAA 3AEGB 2KHWB 4KGSA 1WYWB 1K0RA 3KF6B 2Q8TA 1P98A 1K8MA 2R61A 1UE6A 2B63G 4IWQA 1YJWA 3HHMA 4DK3C 3DWGC 2XVSA 2JN4A 2E75C 3H6MA 3I3CA 3Q0AA 3TEWA 2Q2IA 4TMAB 3N1XC 1LTID 4FO2A 4NXNQ 3CF5A 1TWFH 1BBXC 4GU2A 1IGDA 1LTRD 3UF8A 1MJCA 1STEA 3K7AB 4HSVA 4YTPB 5IY0A 2Q2TA 5KNCA 3ABVB 3AULA 5HGTA 4JWSC 1LABA 5EGTA 1C1YB 1KHIA 2IX3A 3AE2B 2BCOA 2G1EA 3NZSA 4L63B 2ZEQA 2F0JA 2W55A 1WVLA 1SFOB 1GG3A 3RR5A 1MI2A 2M1MA 3I9V1 4LNOA 1GUNA 3L9AX 1RF2D 4YCWA 1XTCD 3IAYA 1UELA 1GNUA 2D3CA 1C4AA 2JY6A 3Q6BA 2W3RA 3EVQA 1P7FA 1AFPA 1X3FA 4K5VA 1VR9A 2KX0A 3A0JA 3IFDA 4EQOA 2BTEA 4B3TL 3U4EG 1AYFA 2O2VB 2AWNA 2HIVA 4FNFA 2J52A 5M5YB 1ZYRD 4KKUA 3RNEC 5BMHA 4F8MA 4OWTB 2CHBD 5EKLA 4OGQC 4GKKQ 1D4BA 3VTVA 2SAKA 4KVGB 1HR0L 2PW9A 5M3FH 1OXVA 1KRHA 3LYYA 2WXGA 4DV5Q 4ANXA 5ELNA 2A68D 3I90A 3DEPA 1KM7A 2PIAA 1QG7A 2WDVB 2JA6H 3ZO5B 2LS01 4L6TB 5IT9L 4IFDJ 1JJGA 3VUWA 3VAWA 1VQ5A 2LKVA 3K80C 4DAPA 1WMHA 4ZHPA 2H1EA 1U0LA 2KTFA 4YSZB 1EUJA 2EMTA 2B63B 4FVMA 3DLLA 4WJ3M 5TR5A 1GJZA 4EQ5A 4DUYQ 2MX2A 1ZDXA 1SYCA 4OO1H 1GUAB 4JVZA 3KJPA 4A90A 1JRPA 4XDDA 4YXDB 2EXDA 4YTNB 1YVCA 1NJIC 5E6NA 3VTUA 1UEAB 4BBRG 2HD3A 4UDUC 4XYOA 3V60A 2R7ZG 2ATWA 2H89B 3M85A 1QUQB 3ND8A 3PGZA 1WXMA 2BYFA 2K8BA 3P4PB 4A3CH 1WR6E 3U2SC 1VQIA 3I5JC 1EWCA 4GKKL 1FGUA 2Z59B 1JOOA 2OCEA 1TWFB 1E1OA 4X3KA 1S3OA 2W54A 2N0SB 2IO3B 2R92G 3KK7A 1BMLC 2L8JA 3U30A 4MH8A 2ZTCA 4K2KA 1PH4A 2F52A 2AMCB 4LF5Q 3SK6A 1YNXA 4LK0M 4A3JB 1EY9A 3S1RB 3GTPB 2G9DA 3M95A 5D3IB 1FRRA 1SRUA 2PNRC 3SDLC 1CZGA 4DAVA 3G6JB 3JAML 4BZAA 4YCVA 5LL6S 4NNJB 4D2KA 2IYDB 3BY4B 2DYBA 1VLBA 3I7FA 5IYCH 1WTVA 4GDKA 4BKSA 3DM3A 3FHWA 4DV0L 3UDGA 2E6XA 4DR3L 4CKCA 3BINA 1VQGA 2JXMB 2WS3B 5A35A 1HNWQ 1KFYB 4DN4M 1F2YA 4ARIA 1E6EB 4H13C 4TKNA 3J81c 2XN9C 5C44G 2PEAA 3RUIB 3A55A 3HKZE 1B9MA 5EE9A 3HIZA 4PV1C 3DBHI 4MGZE 3CRLC 4KZCA 1HQMC 2ZXOA 4A3KB 1XYIA 3MHZA 4GSWA 4BXXG 3GD7A 2JP1A 4PZ6A 2N55A 2HJ8A 4IFDG 1E1TA 1PH9A 2M17A 2OT2A 3TJPA 1SBBB 3PO2G 1EY6A 4KZ0A 3RYTA 4A3IG 3D4WA 5EJWA 4Q5VA 4IPHA 2ES2A 2C5LC 2KMMA 1SE8A 2RDHA 3ULPA 4JPSA 4H02A 5DM63 2LGSA 2K5NA 3RMKC 2KD0A 1K8GA 3IBEA 4JG2A 4IURA 4IWPA 5CBAE 3URYA 5ELOA 1I94Q 1WD1A 2L55A 1SMYD 2N8NA 4LNFA 4REZA 4JOIA 3NTIA 2EQSA 3UDXA 2NVXH 3JAMi 2KUMA 5E4XA 4EX5A 1VQOA 3I4MB 1DGSA 2J0TD 3FDTA 3OSOA 1C0AA 1SMXA 2K14A 3MHSD 3N3KB 3DBSA 4PS7A 4XWWA 3HOYG 1BCPF 4FP5D 4KD4A 4AQYL 1JE4A 1QNUA 3V6EB 3ZJVA 1BBUA 1SEBD 2QEJC 4DV1Q 2DAJA 1A8VA 3TEYA 4B9WA 3H9DA 4OW0A 1SNPA 1UE7A 4FADA 5IOIA 4LUZA 4GKJQ 1VCBA 3DOWA 1A63A 5BYQA 2N7EA 2B2WC 1N32L 3M4OH 4NW2A 1TYGB 3TEXA 1V9JA 3ZDTA 1OTRB 4EZKA 2HE7A 5NUCA 2Y5BB 2C5CA 4RMFA 5DPRA 2KXJA 3F8TA 1DZ1A 3VH4B 1SDFA 2EZVA 2CHZA 2L4NA 4X62L 1MHXA 4LW1A 1I4QA 2E8GA 3R7QA 3MVVA 1E10A 3STBC 2QCPX 4MZ9A 2IHFA 1UNSA 5G3LD 4NXNL 3N9YC 4LTUA 1LTGD 1X3PA 5LMUL 1WTRA 1GHKA 3H09A 1B3QA 4HK2A 1CUKA 1AE2A 1PRTF 1DD2A 1TKGA 5C23A 4JYAQ 4HR7B 4W9HA 3VVWB 2N78A 2MJ3A 2ON8A 4W9JA 4CHKA 5IWAQ 5BN4A 1QWYA 2YLMA 3H3VC 2JSOA 4JBJA 2EJGC 5FJ8G 1K73C 3K6OA 4DR7Q 3BVMA 1YOVB 3AU4A 1Q90A 3EECA 3R8BA 1HTQA 1AZQA 2A6HC 3GTGB 1C79A 5JHBA 3H7SA 3BZCA 1NEKB 4GXBA 4FF1A 4RKLA 1H9SB 5C44H 4B3MQ 5EPKA 1HZ6A 1HZ5A 5JAVA 3R3OA 3ALBA 3HFZB 2VQFQ 4AYBE 1RDPD 4MSQB 3O65B 3H1UA 1ZXIA 4YWKA 2IY5B 4WWOA 4WAFA 2PYKA 3DVNU 3TSSA 5AFWA 3K5NA 4IOIE 1JR0D 4DA2A 4CO7A 3F2CA 4DR3Q 1EOTA 3JVZX 4HJGE 4DR4Q 2PLPA 4A3IH 3HS0C 1PH3A 4HCSA 3X3MA 3OWFA 1FRDA 1YIWA 4P75A 1X6OA 5C5LA 4X57B 3RT3B 3QC8B 1YITA 3E9HA 1H9JA 4MTKA 1G2TA 2K1FA 4LWCA 3UI3A 1SYDA 2WGSA 2ZNVB 4XE0A 3V3XA 1S5BD 2PNHA 3U7ZA 4HLEA 2VB3X 3JSVA 4DV4Q 2HHHQ 2PZTA 3BYYB 1TBEA 2LHEA 2WWZA 3TN2A 4B3RL 4ZRIA 5KEEA 3T3NA 3A7AB 4YTMB 4LF6Q 3J7ZC 1X9NA 1PTOD 4YHHQ 1CT1D 2BVCA 3A9JB 1BOSA 3PHWB 1PGBA 2CHWA 4A3MB 4EOYA 2AQ3B 5BN3A 2DBYA 1K51A 4CKEA 1DOLA 4E74A 3AB9A 1N36L 1I50H 2F0LA 3A1QA 2AUKA 4BBRB 2ZCBA 2NTSA 4DR2Q 4WJWA 4GOPA 2PW7A 1CTMA 2O5JC 1QOFA 4A3FG 4FF2A 4TV3A 1RTOA 4WURA 1HA6A 1EF1A 3KYHC 2YV5A 5EKIA 5IOCA 4DR4L 1L0WA 1IL2A 1RJTA 4G57A 4PZ7A 3M62B 3TUOA 3F2UA 4K6LA 3OWEB 4HIDA 4FXGC 2G3QB 4X64L 1EQVA 2QDLA 5G5GA 3NZ3A 1JT8A 1HCZA 4MJSB 1ZKOA 4RM8A 4K3BA 1T5EA 3UI2A 5DAUA 3CQZH 4FF3A 2GBJA 2N9KA 4IFDH 4US9A 5MPOA 5L37A 2P5ZX 1S4ZA 1RODA 2B3GA 2KEDA 4JI3L 1E7PB 3KYDD 2A8VA 4MH0E 2L7RA 4HPLB 2CCZA 1N32Q 1HTLD 4P2CB 1WGHA 4QIWE 3JAMc 4IN3A 2F4VL 5DNFA 3FAHA 4TUUA 3RN2A 1KNAA 3L2PA 5L95C 3KH0A 1X32A 3OTOL 4HKQA 4GOPB 2KHIA 4HIOA 3HOVH 3NRZA 3G6EA 1KRSA 1E8WA 4DNRB 1NTGA 4I6PA 3FILB 4RHRA 1ISNA 4ZRKA 3A7LA 4DNTB 2A69C 3RN5A 4ZLTF 5JZEB 4LMQD 2KKCA 2LEKA 4DHZB 2JA8B 2IL8A 4OXPA 1L1OA 1WTOA 3NQIA 4X66L 1IKLA 4IQZA 3HOYH 2XEWA 2CW0D 1Q3LA 5M3MB 5J18A 2LI5A 1RCVD 3AB5A 1PH5A 2VUMH 3TZDA 1LUZA 5I4DA 5IYDG 3JSVB 4HRSA 2GBMA 1L0YB 4ZKBB 1C4PA 3VFKA 3VUXA 4C56C 2QDFA 2K05A 2LGXA 4MM3B 5G55A 2KLGA 1G6JA 1KD1C 4XT3B 1YIJA 2B2VA 1Q82C 2KOXA 3PZ7A 2F0IA 4JI8L 4JX1C 4YSYB 4KV6A 1GC7A 2NUCA 2LASA 1TVXA 3NVZA 1JMCA 1IW7D 2KVRA 3AE9B 1GUOA 2J7ZA 3KF8B 2Q2UA 2ZW1A 4Q2JA 5IN7A 3U52E 4GN1A 5IGBA 1B8AA 1B44D 1SYEA 4XQNA 3MZ5A 3G71A 1CKMA 3P4QB 4I6NB 1KABA 3IT6B 4XWTA 2MO1A 3RD2A 2CVRA 3O13A 1VQPA 4ANUA 4B08A 2DYOA 4IZ8A 4R1JA 4JI2Q 5GADC 4IM0A 4GLAC 1C78A 4H2AA 1XLNA 3CCLA 1WWTA 2A4ZA 3DVGX 2KTRB 2ZTDA 1TZ1A 5FLXE 3CCQA 5LL6X 3S2DB 4JE3B 2UU9L 1IW7C 4OVUA 3E9IA 4K2LA 4XT1B 1KXLA 1B9RA 3NTKA 1A5RA 3QB3A 1STYA 3WA0A 3HOZG 4I65A 3NXWA 4M01A 2R7FA 4BY7G 2XGTA 3HKZG 3AEBB 1IGCA 2JWUA 2LRWA 2LFNA 2MHVA 3T53B 3U9OA 5EE0A 4AYBG 4JI5Q 5J3BA 2KEEA 2FINB 2R93B 2CU1A 3AV8A 3JW0X 1LT5D 2E74C 3DUZA 3KOJA 2D0PA 4HIKA 2F0MA 3PO3B 5JPNC 4JI8Q 4JI7L 2UXBL 4RNAA 3SHQA 2SOBA 2O2LD 2BYEA 2K39A 3AE7B 2ALYB 3HKZB 2LXCA 3I55A 4QCLA 1VQDA 1F9RA 4F7XA 4DPGA 4K1RB 3AEVA 1WY8A 3CCUA 5GQOA 3L08A 5GMVA 3AQQA 4EQPA 2WXFA 2DZKA 3AEAB 4OX9L 2QILA 1VD2A 2VZAA 3Q6SA 3FILA 2NVQB 4II3B 3KWLA 3S1NH 3APCA 2RKSA 1WYDA 3E6ZX 1P8LA 3PV0A 1YQ3B 2FIFA 2J7QB 2EJMA 5JJIA 2KDMA 2JA7H 4B3ML 2EMSA 4I6LB 3OIPA 1BUIC 3I2ZA 3N1ZC 4R4QA 2B29A 2JZ3B 2RBMA 5I6WA 5G3LF 1EF5A 2R7DA 1YQBA 1ESRA 4RGMA 4WH4A 3W3AA 4YY3L 1N9WA 1GD7A 3ITPA 4NKLA 1WE7A 4XDCA 1QZHA 4YSXB 2BYVE 2CKZB 2PW5A 1BCPC 2N4FA 1RAXA 1G8ZD 3ZUNA 1FL0A 3M3JA 1VQLA 1XMOQ 1EYDA 1PXUA 2AKWB 4ZCKA 1N5XA 3N6RA 3AMZA 3VR4A 1DONA 1X65A 2EYFA 2E2DC 1Q1EA 2Z6KA 5ELDA 4A3LH 3ZW3A 2Z0DB 2I46A 1PH1A 2EYOA 3J7AV 5C4JH 1GVPA 1T0QC 1QOBA 3K59A 1BNZA 1O7YA 2WXQA 5LXHA 2ZT9C 3GB1A 2A68C 5IO9A 4UP9A 1YN3A 3CSTA 2JVCA 3LB8C 5BMGA 3ZLZA 3A9KA 2LGDA 1VQ8A 1Y1WH 4E71A 1F2LA 1GUSA 3P1MA 3MJ5A 2FCQA 2HIXA 4E3CA 2L05A 3CHBD 4MM3A 1CA5A 2NPTB 2EELA 1MSHA 2PZUA 4C1NK 2L32A 2WX0A 3NG0A 3GE8C 4C3HH 4DV3L 2F0KA 5TSSA 2KQ7A 5JVG3 2K03A 1J9OA 3S2DH 4EGVA 4E6IA 4OZBA 3SDZA 2WDRB 3MWYW 3S1QB 2MSED 1PA6A 5CMDA 4LF5L 1FVIA 1LT6D 1R4QB 4CJ1B 2Y5CA 4QQBX 1EO6A 4KHPQ 1T3QA 4W9GA 5DPWA 2SNMA 4AOFA 3B9JA 4WJ4A 4B0EA 1Y14B 2BDOA 5HGQA 2M00A 2C35B 2C9OA 4KV2A 4PYZA 1BVSA 2KAJA 3QARA 4X6AH 3H7PB 4ACFA 1V5OA 3CXCA 3OW7A 4LF4Q 4RWSC 3OLMD 4XQQA 1IBXB 3DBLI 3RLNA 3T8MA 1E22A 3A8KE 3MXPA 1VQNA 4AWJA 3PLVA 4F88A 4DV6L 3J81i 3QX1A 3CP0A 2HDEA 1TY2A 4A3EB 3TMPB 1QUQA 3GTQH 1VF7A 3H3VI 2MRPA 2L52A 2B39A 5JH5C 1YEZA 3C19A 2QKIC 3HOYB 1Y56A 4MJSA 4OZAA 4FXCA 3X23A 1F9PA 2F0PA 1OEYJ 2GBKA 2KWDA 2IX0A 3IHPC 3PZ8A 1PZID 3DWPA 1N6ZA 2VL6A 1WFYA 3PO0A 1YI2A 5CHVC 2BS4B 4A3FB 4P74A 4O0AA 3H3VH 1VMPA 1ZE3D 2GOWA 1XNQL 2GB1A 2K8CA 4X64Q 2BQQA 2CS4A 5EBCA 2LGYA 1BF4A 1KDAA 3N30A 2ASQA 1ZEQX 2A73B 1I35A 1J8CA 3QA8A 4AS1A 3ERSX 4A3MG 4A3GH 4DXAB 1CM9A 4WWPA 2L5TA 3T13A 4K6DA 1XJVA 4LF4L 2J53A 3L16A 4K7UA 5M5WB 4LNIA 4HPMB 3SR6A 3VR3A 2JK8A 4C2MH 4JI3Q 2KX3A 2UYZB 3BWUD 3Q3MC 4RFBA 2HQEA 3U50C 2BS2B 3CQZB 2YVCA 4LAAA 1Q0WB 4HWIB 2MO0A 2L3ZA 1LTTD 1ZW7A 1XPRA 1PTOC 4DKAC 2N9XA 1PYWD 2EJFC 5JJZA 3AE6B 2B2VC 3SXHA 4C3JH 3VYUA 3J81E 3MXNA 1LXDA 1FXTB 4HEA1 5IGCA 1DJRD 3BG3A 5C5MA 4KJNA 4CJ0B 1L5PA 1H9KA 1HHVA 1QZGA 4GKJL 3ZGZA 1HPCA 3TDQA 1DYQA 2GN5A 2ACZB 1FFUA 1Y1WG 3Q8CA 5ELEA 4WWMA 2OHFA 2HQLA 2NTTA 4JW0A 1BCPB 1WGKA 1WH3A 1L4DB 1BO0A 1KRTA 1C48A 1AWDA 4G3XB 2LJ5A 4C3HG 1EY0A 1ILPA 4UPAA 4B9XA 5JJLA 2I1JA 1J7BA 3LWUA 3L7ZC 2J0MA 4PYUA 2AQ1B 2VNUD 2I1KA 1QNKA 2K0PA 2ONQA 1W6KA 4JGHB 1U4RA 1PDXA 1E7UA 5C2TB 1EY5A 2Z8LA 4JBWA 5M3MH 5GAHC 5CC4A 4JI4L 4B3RQ 1HEZE 1S3SG 3EC8A 2RCFA 4GB9A 1SLJA 3SE0A 1WGRA 1E0ZA 1B1ZA 3L4PA 2WACA 1FJGQ 1QOGA 5C1ZA 5C3EG 3RFZB 2KLCA 4L5TA 2MJ8A 5HURA 3KLRA 4V0BA 5E3FA 5IIFA 2F0GA 1M4VA 1WJUA 2EKIA 1B3AA 1V86A 2EPBA 3D6WA 2JQOA 2NWGA 2D0OA 4C4VB 1XO3A 1ENCA 5D94A 3K5OA 1FEHA 5K5PA 1T0RC 1AN8A 2QW7A 3GTKH 2ZXRA 4X3SA 5BMIA 3MFYA 1U9RA 1PZKD 5AZHA 3S17B 3SD5A 4HIMA 1V1PB 4NPNA 2PPBC 2UUCL 3TQYA 3QAQA 3IFTA 4L8JA 2BE5C 2Z4HA 1FD6A 3HM3A 5CX3A 3RNGC 1FNUA 2F0FA 3PCOB 4NQLB 3T1YQ 3MTNB 3GTGH 1E5WA 4OVVA 5D6JB 3G7LA 1QZEA 1LT3D 3ZJTA 2UWQA 2IBIB 3EN2A 1SN8A 4RAUC 1WE6A 2G4SA 1FJGL 3Q8FA 4MGIE 4PS3A 1ZXHA 3SHLA 3J80i 4LFAL 2I0QA 3KVFB 2JWZA 3L10B 1N33L 1ET9A 1IBKL 3GTOB 3HUIA 1C3TA 2RVLA 3AEFB 3NP8A 4G50A 2D3BA 2A6HD 1PTOH 5HKHA 1SJHD 3Q8AA 1B9NA 1JORA 3C1FA 1C77A 1ROEA 3QOLA 2QF7A 1WI5A 2XWJB 5EAYA 3D32A 4HJAA 3FKIB 3KJOA 2BH2A 2C7NB 1WOCA 5ELCA 2VQEQ 3AE1B 5T8IA 4BBSH 3NHHA 2HUGA 4MSMB 4A3PA 2VS1A 3ZNZB 4F8CB 4GN5A 1Y1VB 5IGDA 3SVMA 1TKEA 5IP9G 3SFDB 4DV2Q 3QOJA 3S17H 4UP7A 2RMMA 4ZKCB 2MBQA 2KCTA 1JC7A 3T1YL 3BJUA 1IBXA 3SEBA 1XPOA 3BZKA 1PRTD 1QVFA 3BYTB 1JMLA 1EM7A 2LJIA 3NUHB 4KDLB 5K36G 2KCMA 4A3IB 3U4ZA 2X8XX 1K3RA 2MNAA 2WXKA 2AL6A 4XYCA 2KCNA 5CORA 1XCTL 1IXRA 1HZCA 1VCIA 4A3FH 1P1AA 3L54A 2VY3A 4HJKA 1ZKHA 2I5HA 1FGBD 2K6DB 3QO2A 5HY6A 1PVOA 1AW7A 3DMUA 3S2AA 2Z0EB 2EOTA 1FXIA 2KMCA 2QC8A 4LDTD 1EQRA 4U673 2R92B 2BS3B 1NENB 1CI3M 4IG7B 4ANVA 1X3QA 3KLWA 2CWPA 1VQAA 1TWHB 4HN7A 1C8CA 4C3IG 3C3LA 1B53A 2DJFC 3HOXH 1BKBA 4LFBL 2HJ1A 1STBA 4QIWB 1WX9A 2Z6BA 4H7BA 1SNDA 1O80A 1K8OA 1WFQA 2MPMA 1LM8B 1F9SA 4JC0A 3A9KB 3P7JA 1Y8RC 3BDCA 3ULLA 2JRHA 2LUMA 3OW2A 5IA7A 2E2IH 3PHXB 2KJRA 2N9EB 2AHOB 1JWUD 3NVVA 1QOAA 1VDVA 1L6VA 2L76A 4IUQA 3TEHB 1HH2P 2RSUA 3Q3OC 1LO5D 5CBEE 1NYQA 3UDIA 5CTRC 2FMMA 2ZJQA 1MIUA 1F52A 2QA4A 3QJYA 2EE1A 4HSPA 3MXGA 3HOVG 4HROA 1O78A 1K28A 3NHEB 2IGHA 3J80L 2YU9B 5DCNA 1A62A 1I4PA 4C3JG 5IODA 4OL7A 2IX1A 5CV6A 1QB5D 2NVYH 3EROA 3PUZA 1HFNA 1IKMA 2PTLA 4NXML 1JWAD 2K32A 4HJ8A 5J22A 4C2MB 3QJZA 1FR3A 2ID0A 1OTCA 1UBIA 2MJDA 3JYUA 1GAQB 4FA6A 4EVOA 3IG3A 1DOYA 3M4OB 2JZPA 4YHHL 2JUOA 4R3DA 4DU9A 5E6OA 2L11A 1LT4D 3I4NB 3GTJB 1OGWA 4R4IA 4IPDA 2J42A 1HA5A 3S1MH 2KQ4X 1VQ4A 1TS4A 4RG1A 4KKTA 1KLUD 5C4JB 5H8YE 3JAME 4JCVE 1K3BC 3FP9A 3PS6A 1IL8A 4RKBA 5M3MG 1WSPA 2PMVA 3I3TB 1F2RC 2V3SA 4ICUA 2M4NA 3RUZA 1WM3A 1QOHA 2KVMA 3I4MH 5H1SE 5EE1A 2HCIA 3TZUA 3PV1A 3N52A 1TWAB 1OXUA 1HNZQ 2RPQA 4US8A 2DN8A 2AWOA 1T0SC 1EY8A 2K28A 2B2YC 3A74A 1YJ1A 2MBBB 2M0XA 4YL8A 2MA9B 1VS0A 2XTIA 1V1QA 3M9BA 4ZRZA 1H95A 4ALPA 4FJYA 5IP4D 2KANA 3GQBA 1WX7A 1D5XC 2C9WB 1LV9A 3HG9A 1WRDB 3DDCB 4GOCA 4KSKC 3QWZB 1TKYA 3QK0A 2V9HA 3C0RB 4S3SA 5K36H 1C9OA 1SYGA 2B2TC 3GZNI 2OQ0A 1DCZA 3TP8A 1WRIA 2KVZA 2MH7A 2FJ2A 1SSNA 2WXIA 2EYLA 3W1GA 1Q46A 2NVQH 4MACA 1ZOYB 1MGSA 3V05A 1IHZA 3T1HQ 4QF4A 1XF5L 5FLMG 4DGZA 3SFEB 3OTOQ 3S1QH 1OQQA 5FK9C 3B2FA 1S5DD 5KNBA 1S1QB 3PT2B 3TP7A 1PFBA 2JA5B 2JA6G 1DM0B 4YWLA 1QT9A 4MGYE 3PO2B 3VYTA 3TS2A 4J6HA 4C3HB 2D2CC 4G7HC 1RLFA 2DX5B 1HZBA 4EFOA 1KIXA 3I4NH 1PUTA 1KJTA 4N59A 3TREA 3RNAC 4X62Q 2R93H 2JF5A 3CCJA 3A4RA 3PUXA 3AE4B 3OIQA 1VQ9A 2O5IC 2XNAC 5M9OA 3S1RH 4N58A 1D5MC 1WXSA 1BUVT 1NBWA 4DK0A 2NYZD 2TMPA 3SK4A 3H0GH 3TP5A 1KNEA 2E5LL 1D2BA 2AWTA 4HDOA 2HTME 1SE4A 2LGIA 5BO4B 2WV6D 2V4IB 2PMZB 4AH6A 1N33Q 1JJCB 4LJOB 1T5XD 5JEAH 1LQBA 4LUOA 1SAPA 4N8FA 3I56A 1N36Q 3PIOA 2DY7A 5C0XG 2NB0A 1JWBD 4DDID 3K7AH 5JVH3 1AP0A 1LACA 5JJKA 5AZGA 1RKNA 4UAIA 4N8X1 1JE5A 2RA4A 4FN2A 1J6QA 2NZOA 5DEHA 2K52A 2E2IB 3OJ4B 4GNXC 5JPMC 1RRBA 5IKCM 5FO9B 1I4RA 1P0RA 1FFVA 3CAMA 2BKRB 2IZVB 4KN7C 3TBLD 2CH4A 4L2YA 4NMZA 1EUVB 3GV6A 5C4HA 4J15A 2L12A 4TQ0A 5C0XI 3Q22A 4RMAA 4XGAB 2LSSA 3C1EA 1UAPA 1EY7A 1L6UA 4BAXA 1TU2B 4C3IH 3W1BA 5T1GA 2JA6B 4J1MA 2E2JB 3SGIA 3D31A 4TRDA 5KHOA 2Z0SA 2F4VQ 5DPTA 1BT0A 1Q1OA 5D7GA 3NBHA 3K57A 5CR3A 2AQ2B 4IFDI 1DGJA 1UGMA 3KBXA 1PFDA 1XMQL 3OYYA 2JZZA 3PO3H 2MBOA 3W1SC 4GLSC 4EE2A 4DV6Q 1J0GA 3DCGA 4ZRQA 1PLFA 3PGEA 5FR6A 4C80A 3QQ8B 1Y8NB 4OZCA 1NUCA 1NNXA 1UE1A 1RYJA 4EUTA 4J8QA 2JA5G 3B1LX 4B95A 4IC7B 4N6EB 1T9HA 3AMUA 1W6JA 2MFIA 5IE8A 3K5LA 2RDBC 2L0FA 2WXJA 4ZHOA 1BXTA 1IYFA 4JI1L 4BBSB 1EEFD 1UUPA 1CZPA 3P4SB 2QGQA 4FJZA 5FLMH 2NVYB 3W1YA 4FBJB 3FKIH 2WB1E 2YEPB 2FHTA 3IFWB 2M56B 4A55A 3Q3NC 3T51B 3KUPA 2QMTA 2CJNA 3DXJC 4AJWA 2DUDA 1F2RI 3ZVVA 3FPPA 1FCLA 3ZXVA 5LMUQ 2NVTH 2YTYA 4I7AA 4FF4A 1YX6B 4MN3A 1Q5WB 2Y5PA 4ME3A 3MP9A 3GTOH 2D3AA 3K9PB 4C4VA 2D9UA 1GB4A 3NEMA 1XLPA 2DENB 3S9WA 1GUTA 2B2WA 2ZXPA 2KFKB 3NVYA 4BBRH 2QEXA 1XMQQ 4NXMQ 2N9LA 3T1HL 2VZKD 4W9DA 3U9SA 4CYEA 1SNQA 2L0CA 2FXQA 4A3OA 4A3MH 4A3GG 2GMIC 4P16A 2XSCA 4MHEA 1I5FA 4P73A 1JJ2A 4K7WA 3PREA 3HP3A 4APVA 4IO9A 2D07B 4QMGA 1TWHH 4BVUC 2VZKB 2N9PC 1SNCA 3H15A 1LFDA 2IGDA 2R92H 5FOBB 1WIAA 4K81A 4MIUA 1JWSD 4M1UB 2KOLA 1U4PA 1QE6A 4DR5Q 3NY5A 5CGKA 1IYJB 1TKWB 1YBYA 3PUWA 3KFUA 2DYMA 2KO3A 4WJQA 1ILQA 4LNQA 1Y69U 5EPLA 3HOVB 3ND9A 1AEXA 1L2FA 2K6AA 3KUCB 3J9CA 2ZJRA 1H8CA 2I38A 1H9SA 3QIJA 1SSOA 1X54A 3VR2A 1PTOF 1Q8IA 2JEAI 1YHAA 2LMCB 5GXGB 2L9HA 5I9PA 4AJYB 2CW0C 1WMHB 2KDBA 2DAFA 4WRDA 3L3OC 3RD4A 1E7ZA 2JYOA 5C44B 2UUBL 1EIGA 1JALA 1V2YA 2EVBA 4XC2A 2MHJA 1C9FA 3Q8EA 4DBGA 2D2QA 3I63C 3S14H 3MC9A 1IBML 3MJWA 2AEHA 1WM2A 3CWIA 4KY7A 3AXCA 4QGUA 2XWBB 4YWMA 3MC0B 1W3SA 5J1ZA 4RM9A 3PO3G 2JPHA 4HCPB 4NP5A 3HGBA 1SJED 1EWIA 4QL5A 3VDYA 2M2LA 4XIGS 3KUZA 3CMAA 3K5MA 3CF6E 1M90C 1BR9A 3UINB 3ZJUA 1MHHE 4PG3A 4A3BH 1E7VA 4RA8A 1NR2A 2IGGA 1P16A 3AEDB 4IDIA 4DQOC 1SF0A 1YMHE 2D62A 2WFWA 2LVQA 4DV1L 1EWYC 4ZUIA 4EKUA 4LF9L 5HI1A 1PGXA 1VDZA 2R7ZB 1D3ZA 1IPGA 2KTRA 4DK6C 2C7MB 3ZJYC 1I4XA 4NB3A 5M5WH 4NJCA 1X1MA 3GTMB 4IOCA 2V0GA 4BOSC 2F3WA 2O6VA 2XBBC 1II3A 4GOPC 4A3GB 2INDC 3GTKB 4KD3A 2FCMA 1SE9A 2VH2A 4B0MA 3J7AF 2ZM6Q 3RNBC 1KL9A 2XRSD 5BR8L 3NUCA 3WIMA 4TSSA 3MXUA 5CHWA 1NAPA 2FUG1 2MLBA 4CQNA 4KSLC 3I8ZA 1O7LA 1IUEA 1C4CA 2V3NA 1YQ4B 1JWMD 1FCCC 4QY7A 4DV7L 2KACA 2WXNA 3K9OB 2FNJB 5G2NA 1PYSB 5IYBH 1TQOA 1I4HA 2JRIB 4NDXA 2N1VA 1EFID 3RPFC 5IGFA 3W9CB 3G4SA 1ZPSA 2NN6G 1PH2A 4LFCL 2GVBA 4BA1I 4UY8C 1MFWA 2K33A 4IPCA 2Y3AA 4JYAL 3CIRB 1D1KA 1DOKA 2ZZPB 2BGFA 3TIXA 3HKSA 2UXCL 1E24A 1FNVA 3EHVA 5E4WC 4A3DH 1JCKB 2L00B 1FNWA 3JC66 4U68A 5CYUA 2WDQB 4KHZA 4L5SA 4CDDC 2IDYA 4TQUS 3V6CB 4TVAB 3NBIA 1AZPA 5D2MB 5AUIA 2KWVB 1JICA 1K8AC 4K5XA 4URKA 1EYAA 5D65A 1CKNA 1NY4A 3HOZH 4OEMB 5COYA 4NJ7A 3Q3FA 4BY7H 3J81L 4ICVA 1K8RB 2N3SA 3S2HH 5JHAA 5EQ0A 2UXDL 4CJ2C 2VH1A 4KK7A 3CD6A 3RLFA 2D3GA 3EFXD 3H6NA 1XT9B 1HRJA 1WZ3A 4AP4C 4ZDVA 4C3JB 5HHDG 2D11A 4KIKB 4KKJA 3DM1A 4JI2L 2D5GA 1AE3A 5E6JA 1PRTC 2DNCA 2UU7A 3ZDMC 2F4IA 3NE5B 3CCEA 1ACCA 2IPKD 1XNRQ 2B2UC 2AX5A 3U58A 4CBVA 3EA6A 1IBLL 4HDQA 4K3CA 4FXKC 2MUYA 2BPSA 2KC1A 2KNBA 4XX5A 2RGFA 3CCSA 2CU3A 3I72A 4B3SL 4DR2L 4CDCC 2B3AA 4L5QA 1Z6HA 3GZNB 2KYWA 4M8NA 1VF5C 4H0LC 4IW0A 1Y8PB 2I5LX 4XYQA 2BYTA 2JEBI 3NS1A 1WX8A 3GTPH 2WXPA 3RZFA 1X56A 2WU5B 2I2YA 3VRBB 2LFIA 1HTOA 1OEYA 4OO1G 3LWEA 3GO5A 2M8SA 5A2QE 4M02A 5M5XH 3MXNB 1NI2A 5J39A 4MDKE 3MA2B 3KLSA 3KYCD 2JT4B 3EJIA 5G5HA 2IO0B 2E2JH 3HZXA 3KBGA 3DHIC 1CHPD 1VQFA 2LWPA 3D6CA 2A6ED 3BZDB 2MP2B 5IP9H 3EUB2 2W82A 2EYJA 3MC8A 1QLBB 1KF6B 1H4RA 2Y0SE 3ECIA 4F7ZA 1ENAA 2YTVA 3CRKC 1S5FD 2WX1A 3PPAA 2Z9HA 3Q24A 2WP9B 1TWGH 3ML9A 4A3LG 5LMNL 5IGEA 3QHTA 4BBNC 1J7AA 2FE8A 2J0KA 1NMGA 2RD0A 3EBEA 1HNXQ 2N7DA 3D8GA 4JBMA 5C0XJ 4DV2L 1YD8U 2BF8B 1JRUA 1O7IA 3VUYA 5I9OA 2B63H 1SXTA 1E9MA 5J17A 1IYUA 4ID6A 2DZIA 2N7JA 4NPSA 5GAGC 3A33B 1G6PA 1EZ6A 3FVQA 1RL2A 3RZOH 1UEBA 2BB6A 2KWCA 2NPTA 4W9CA 2TSSA 1ZXTA 3Q3JA 3U7DA 5FR3A 2KFJA 3KWVA 1NVID 2O2VA 2REXA 5JEAJ 2MP2A 4QB4A 5IGGA 2L83A 1U5KA 1HNZL 3HVZA 2VW9A 3DPDA 1KC8C 4HAEA 4CKBA 1K50A 3FRPB 2KENA 3IL8A 1YN5A 1GOZA 2RHSB 3H0GB 3HOXG 2JXTA 4K0KQ 5IAAC 1WI0A 3ZRCA 2K8HA 1CJEA 5L83A 2RSNA 1PH8A 3NELA 2KJHB 2B2TA 3W5OA 4OHJA 2JU6X 2BT6A 1EL0A 2KJXA 5EPJA 4N9TA 3NZUA 1LTAD 2GA4B 4CGYB 4BKGA 3KF6A 2R2QA 1Q8KA 1HTPA 1YNND 1TT2A 4LF7Q 3R7RA 4LDTB 4CHTB 2EY5A 1M8AA 5EKKA 4A3JH 3AE8B 1A3VA 3PO2H 4IUMB 2PO4A 1XPUA 4FYDA 3R66C 4KDIC 3ZNID 1CKNB 3KLSX 1YJNA 3P42A 1GUGA 3RLOA 1SFOH 3UIPB 4LNNA 1PYBA 2Z6KC 3J81j 3RZWC 3V2TA 2K01A 1XNRL 3R2TA 1FIQA 4KX6B 5C3WA 3FKYA 1E2WA 4A9AA 3EFCA 5CV5A 1ENFA 3CC7A 3TRZA 1C7YA 5EE3A 2A19A 4HPPA 3PUYA 2QCZA 4LFAQ 3RNCC 2HDMA 4J6IA 2D10A 2KDIA 3Q23A 1FXAA 1OQRA 2A5UA 2LZ6A 4KMUC 1WXAA 3BDOA 4XXEA 3VR9B 3CU7A 3X3NA 1ZDVA 3P2BA 2XRQD 3GDEA 3I4NG 2K5QA 1RTNA 2I5MX 1ESFA 2JA7B 1BDOA 3DVGY 4XZ4A 2OOBB 1WD0A 1N61A 1PFNA 2INNE 3S1NB 2F03A 1TWAH 3NBHB 3HOWG 4Y52H 1HQRD 3V96A 4A3CG 3H0GG 1F77A 3UGBB 4XDXA 1B50A 4JI1Q 2GI9A 3L17A 2MCNB 1R4MI 1EU4A 2DJGC 3VQIA 1E8YA 1YN4A 1TWCH 4PS8A 2RPVA 4A20A 4ASWC 5M3FB 1AARA 2DGYA 2GVAA 5C4XB 5CHFA 2JSVX 5C0XH 4LCDE 2I07B 4ZRJA 2WXRA 3Q8BA 4FLHA 1J8IA 1FM0D 1JB7A 1I6VC 3GTJH 4A75A 2IY0B 3AN1A 4GNXB 4DR1L 3HK0A 4LF8Q 3L13A 4HTHA 1SROA 1VQ6A 1LYLA 3HOUG 5FKAC 2PKOA 2WDTB 2PCFB 1Q7YC 2PI2E 1A15A 1FD7D 4IUTA 2DZMA 5FLXL 2F3IA 2J4XA 4KY6A 1VJKA 1RD9D 1HUNA 5AJ3Q 1F2MA 3WDNA 3DBRB 3KF8A 4NY0A 2WKDA 1EZ8A 3FC4A 3RULA 3FPUB 3WWVA 1LTSD 3PRPB 5KGUA 2X69A 1D7QA 2K75A 4HVBA 2WAQE 4WFN3 2OJWA 2WXMA 5IWAL 1H9MA 4DWFA 3B0AA 3NVWA 2FFKB 1V81A 4WJPA 2PZWA 1YNNC 4RGOS 1SE2A 3UIOB 4BWGB 4IJHA 1E2VA 2LHDA 4AYBB 1LTLA 3F2DA 5C3EH 4G7ZC 4OELB 1ZGUB 2MQJA 4C00A 2F1MA 4K8JA 4KGRA 1V8CA 2B76B 3HEJA 3WAMA 3R3MA 4A3JG 3M3YB 1UH6A 3F2BA 2WXLA 1CHQD 3CKIB 3CPFA 2B2UA 2VUMB 3QG1A 2Q8IB 3GE3C 3N20C 2BA1A 1X3GA 2JXXA 5AEKB 2KC2A 3CCVA 1G51A 1P7EA 1EIYB 2NZHA 2NMQA 3P75A 1S40A 2E5LQ 3DWQA 1C76A 2JA8H 1WJ4A 2BWFA 3VH3B 4MNOA 1J5EQ 2UUBQ 1V80A 2K6QA 2N1WA 1XTDA 3PTFC 1MJEA 3WAOA 1YNJD 4KY5A 4WQOB 3DHQA 2Y0SB 2B8GA 3WOFA 1NSNS 1M1KC 2F0UA 2BOSA 4NJ6A 2HTHA 3VR5A 1NR4A 2ZVNA 3P1HA 3OPOA 5BYSA 5IYCG 1VMCA 3W2DA 2L1AA 2KECA 2KN4A 1UWVA 3LX0A 1EQQA 1R9TB 2WXOA 4BY7B 4DV5L 4GS3A 2F0EA 1ASZA 2ZVOA 2WINB 1XEEA 3PRZA 3VXWA 4FDBA 4GLXA 2KN5A 1DOXA 4JI6Q 1OQYA 5DPSA 4KHPL 5LMNQ 2EDGA 1QVGA 2MW5A 1KLVA 1Y1VG 1C4QA 5CV7A 4Y7NH 2RHQB 1HNXL 1GC6A 4A93B 5AZFA 2PQAA 2K22A 4MEMA 4NQKE 1CSQA 1ONLA 1VQCA 2WKCA 4Q0FA 3AI5A 1EY4A 3M4QA 2B2YA 3S15H 4GZYC 3RNFC 5EBDA 5LHY1 4ANWA 3CSFA 2IW3A 3RZDH 3ONSA 4WWNA 4NAWB 2R6GA 4ULLA 3NK9A 2GBNA 1PGAA 4DXFA 1VQBA 1Q81C 1SNMA 1TJEA 1A2UA 2CHXA 4ZAIA 3V61A 3WCQA 1B2TA 4GLVB 1TR5A 2H4OA 4PQXA 3K58A 2K50A 1E8ZA 1TGZB 1XQQA 1L4ZB 2ZJDA 3KUDB 2KFKA 1V1PA 4B9KA 3ONAB 2DHZA 3FEWX 4KHVA 1JOKA 2LUEA 5KHQA 2CQOA 2LMCA 1GXDC 3BK2A 1PFMA 1PZJD 3MAQA 3VRAB 5FJ8H 2EIFA 2WHIA 1BCPD 3L0OA 2W3SA 5E6PA 2EXZA 2X6LA 3ML8A 1CSPA 1B7YB 1L0XB 3IKJA 1CQVA 4W9EA 1VQKA 1H9RA 4GN3B 5E1FA 5AUKA 3PRMB 2UUCQ 3SU8X 2SDFA 1F9JA 4ZK9B 1HFGA 2A69D 3E5SA 2VXWA 1UF0A 3LJ3A 2K25A 1M94A 3VYSA 3IRBA 1WTXA 1WR1A 1WXVA 4P72A 4A3BB 1MJDA 3A8JE 4ZRPA 2VUMG 2NBFA 5IYDH 2L1BA 1YNTE 2EY2A 3B6YA 1D1IA 2VRRB 3PSEB 4GGQA 2EYHA 3HOWH 2NS5A 4W9LA 2K7VA 3PF5A 2BWES 2WLBA 1S72A 2K5DA 1Q10A 1YJJA 2O6VD 3NWSA 5EDSA 2L15A 1Z5SB 4OX9Q 4WJOA 4R8NA 3E0JA 4DR7L 3V62A 2WXHA 1FO4A 4JI4Q 5F2DA 2IY1B 3ER0A 4IKGA 1I42A 4IM2A 4X65L 2NVXB 1CZWA 1NBFC 2NZ1D 2Q8RE 1HE8A 1XD3B 1TY0A 1K53A 3OOCA 3I73A 1HJPA 3VYRA 3P63A 5KIXA 1STAA 2C60A 3ZQ4A 2HD5B 1PRTB 3I4OA 4HJ9A 1GM5A 3M7GA 1VZ6A 2MP1A 3APFA 4KIKA 4WAAA 4FULA 3R93A 3DBHB 2LY7A 2FCNA 1YNJC 2LD9A 1WGGA 4ZUJA 1WTPA 2UU9Q 4PMWA 4HKZE 1EYCA 1G6ZA 4MTNA 2A5HA 4TQ1A 3H94A 3S16B 1U4MA 2WAQB 1DOIA 4P1BC 4A3KH 3HOUH 1RIPA 2CH4W 1U4AA 3Q69A 1SNOA 2E2HB 4HEDA 4PT5A 1I4GA 2OWOA 1VQMA 1XX8A 1MPEA 1E90A 4POGA 3DBRI 3ZYYX 2K4KA 4ILWA 1EFWA 1ET6A 1JW9D 4DV0Q 5C3JB 1S5ED 1SYFA 3J80E 3GTLB 1I6HH 1PDQA 1WYGA 2SEBD 1PHJA 4KLKA 2K5VA 4HCEA 3PLUA 4DAYA 2M0AA 1UD7A 1N60A 5CV9A 2J0JA 3ZNHB 2F0DA 4QUCA 5LLIA 1SR3A 1K83H 2OTJA 2NN6I 1TZOA 3W1SA 4F1SA 2D5DA 4IOAA 5CV8A 3DEOA 3UDFA 3DQVA 3A54A 1G2SA 1MD2D 2G4DB 1TIID 4DDGD 5LNK1 5LMNW 1Q86C 3RNUA 1A0IA 2JA9A 3STBD 4A3BG 2ZNVC 3A5ZB 1STGA 2CR5A 1ASYA 2O4XA 1YX5B 2NVTB 1STHA 2KMAA 1L0VB 2K5HA 3AE3B 4X66Q 4R8IA 1A3UA 4W9KA 1E0BA 1QJOA 1XXGA 4DAYB 4DR1Q 1HUMA 1FPYA 2ZTEA 3Q8DA 3M4YA 3GTQB 3TL5A 1GKHA 1GUWA 2JQRB 4MGKE 4A3EH 3T56B 2V4DA 4YY3Q 2NCNA 1YZ6A 2WB1B 5D3DA 4A93H 1HZAA 1WZ0A 2OEDA 1FYCA 4Y7NB 1WCMG 1XLQA 4C1NI 1DXMA 1V5TA 1V6EA 2M9VA 4O1NA 2A1AA 1ICWA 3NWTA 1OFFA 4WJNA 1X3EA 4G7OC 3D3RA 3ZRFA 4BOZB 2ZM6L 1MG8A 2PVGC 4HJ7A 2VQFL 4N9PA 2WB1G 4AUQC 2HCCA 4IALA 4PZ8A 5BR8Q 3J7YW 2LXAA 3I91A 2F3VA 3E0EA 1HXYD 4DNIA 3TBIB 5C4XH 4GN4B 4HMJA 2NN6H 4GDLA 1TWCB 4OWWB 1WJNA 3GS2A 2QDBA 5DM73 1I3QH 4OIKA 1O7ZA 2KHSA 3I4MG 1NDDA 3E3XA 2FCSA 2F0HA 4LJZC 1MVKA 3RN9C 1Z2MA 2RR9A 3AH7A 4JOIC 3ZKJC 4F87A 3L0WB 5M5YH 1TS5A 3OHXC 1K52A 5LXIB 1EOVA 2EY6A 3GV3A 1Y1WB 1TXYA 2HT1A 1KAAA 2PI2A 2EYPA 1EQTA 4JI5L 3T4AC 3M63B 3M3YH 3ETRA 1A3TA 2X38A 4OVZA 2E76C 3Q2AC 2RCNA 1MSGA 3KDFB 1FMAD 2SNSA 1WGDA 1VQEA 4A3KG 2KQSA 3AU5A 3PVLA 3RI7C 4RGNA 2KCCA 1P3QU 2KDFB 4KGTA 4L23A 1L7YA 1CKOA 4XTCS 2AL3A 4HCNB 1KH0A 1OXXK 4DV3Q 3PZDA 1KLGD 5IP7H 2OXPA 3BU2A 4Z9CB 2QJLA 1E2ZA 4DUZQ 2GRIA 3LXFA 3T3OA 2JJQA 3K81C 3WANA 1IP9A 2FUHB 3BK1A 5IT9c 5BN5A 3T16A 2V4LA 1R4NB 2IWHA 3UQBA 1IBLQ 1OXSC 3PSIA 3A8IE 4M0WB 2ICEC 2ICIA 1F2ZA 4DFAA 2LVPA 4OWXB 1JQYD 2K5WA 4O42A 5IT9E 4BA2I 4LUVA 4AIMA 4JV5L 1I94L 3RCZA 3U8ZA 3AEEB 3M7NA 3IXSA 3WALA 3AFPA 4LLGM 3NPPA 1NE3A 4JK1C 2BDNA 3ZTCA 4S17A 3CC2A 4BY1B 3ERQA 1WGYA 4C7ZA 3CCRA 1VZ8A 1K0SA 1XNQQ 4IUUA 2GBRA 1XMOL 3AE5B 3IVFA 1PFSA 2JA5H 1I3QB 1QQRA 2FAZA 5C3XA 3CC4A 2WNMA 5D14A 3I57A 2RDFA 2MQHA 2RSOA 4GDKB 1WTHA 4RHSA 4A3EG 1EIHA 1PQSA 4HXDA 4IM3A 4K7SA 4BFRA 3PUVA 1IZ6A 1L2NA 3FKIG 1HZ9A 4GNXA 1MHWC 1V1OA 3I70A 3PQIA 2KK8A 3B08A 4II2B 4P7IA 3S24A 4DUZL 3RZOB 1T6BX 1UBQA 2INPE 1SMYC 2Z1CA 4X65Q 3PIPA 3ULJA 1V43A 2WP8J 4DV7Q 2MEKA 3MTSA 4EEWA 4DR6Q 3VA5A 3QCAA 1TS3A 2DNEA 4JBKA 1UE5A 3IT4B 3DBLB 3LGJA 1WTQA 1UWMA 1ZYRC 2EYMA 1K9MC 1TWGB 4R4CA 4L5RC 3ENEA 3BS1A 3NJTA 4YCUA 2LVOA 3B2GA 3PMFA 3VA7A 1HR0Q 4UHVA 5C4XG 2ZJPA 3SR1A 2JE6I 3VR6A 1SB3C 1BQQT 1CK1A 1NYRA 4GIVA 2B8FA 1GB1A 1R4MB 1YHBA 1ML0D 2WYQA 4XQJA 1MKHA 2PMZE 4QUFA 2JA7G 3LDZE 4JLCA 4P1CC 5JXVA 1J5EL 3MFGA 3HRZC 4RCOA 3A9JA 2PVOD 3NSWA 1IBKQ 2N88A 4K0KL 4R9WA 1GO3E 1SYBA 1WTWA 2LXJA 2V1YA 1L1OB 2NBVB 4QAYA 3ZTDA 2G5DA 2PQEA 3IAM1 3S1MB 3NS8A 4MT5A 5KRUA 5A2QL 4LNKA 4TKOB 4EQNA 4IUPA 3R2IA 2YYZA 4PNYA 1I7HA 1SIFA 5AJ3L 2K5PA 1V8QA 3HVDA 1SGHA 3E9SA 1U4LA 4NAWA 5J2RA 4RF0A 1N34L 4LF7L 1EWHA 4FXDA 3HRDD 1QILA 2N49A 1ZUD2 3EGRA 4FHJA 2OEOA 5GAEC 4J3OD 5HG2A 3WAPA 4A6QA 1I6HB 2ZPYA 4DF7A 1KTKA 1Q1BA 4CDFC 1VQ7A 1E8XA 1R4NI 1CFMA 1G91A 1LTBD 4DR5L 3GP7A 2GLSA 1WCMH 2UUAL 1YHQA 3TP6A 1ZP0B 4HJ5A 2YU9H 2K9XA 2OJRA 2BE5D 2F0VA 3APDA 4ME5A 4N9F4 4H44C 2PPHA 4POFA 4ABNA 5KNDA 4A93G 3NENA 3OMGA 1A70A 1SE3A 3PIP3 2BH8A 2NR2A 1NCVA 4LFCQ 4DK5A 2W9NA 4I7ZC 1Q12A 5C6AA 2H88B 4K5WA 4JWUC 2F0TA 2K04A 1EIFA 4BBNF 4LF6L 1X55A 2YEPF 1TTNA 2ZPNA 3HOXB 4LFBQ 2FIDA 2RDGA 2WIIB 5T1IA 4L1BA 1LM0A 4KTAA 1STNA 3LNNA 4KI0A 3H91A 4G0NB 1QKZA 3N32A 2QIEB 3NTHA 2RQXA 4IJLA 2MBEA 1RHPA 2NBWB 2XIWA 2KWUB 3DWMA 5ELFA 1VRAB 2JYEA 3MEFA 4QJFA 2CWAA 5M5XB 4BY1G 3MEHA 2K1BA 2DLBA 4OIJA 3IAS1 3I4LA 3VTWA 5C4ZA 3ZXRA 2AYOB 1N8RC 1GPXA 2WAQG 2F0QA 1EU3A 2Q2HA 4M8MA 1I50B 3DWAA 3U4VA 4ODGA 2BKFA 1QVCA 4NAMA 3PF4A 4JL9A 3C46A 3D0FA 3ZNGC 1RM6C 4ARCA 1EYGA 1K83B 4IWOA 1KOTA 2CJOA 5IP7G 2CFMA 3M4PA 1W2BA 4PMBA 3W5UB 3GTMH 3RMHA 5I6YA 3K8AA 2PJHA 2DZJA 4ZQ3A 3A4SC 2EY1A 1Y1VH 5CV4A 1CA6A 3GTLH 3A5UA 2ENBA 3GOEA 1NMFA 2RF4A 3CW2C 3K0YA 5IYBG 1HR0W 4IUVA 4DR6L 1D6EC 4X3UA 1JOQA 1RFKA 1MG4A 2E2HH 2BBCA 1S5CD 3FMCA 3K7UC 4JPBW 1PV4A 2YTXA 3WOEA 1IBMQ 2MGSA 3CPWA 3CMEA 3HOUB 4G4KA 3S16H 1V49A 1PTOB 4NZLB 1RWSA 2IO1B 1F0ZA 2PQAB 3S2HB 4RF1A 3KDFA 4HMIA 5FO8B 1JQ4A 2JYTA 4YT0B 3HOZB 4JI0L 4W9FA 1GJXA 2PE6B 2DWQA 2K3UA 2KDEB 5E7NA 1N63A 1VQHA 1WXQA 3TCAA 3RZDB 3OAWA 3H7PA 1AH9A 5FO7B 4A3DB 3C8YA 3UE0A 2R3ZA 1T0YA 2V1CC 2C7HA 1B70B 3CMMB 2JA8G 4GMVA 1OO9B 3S15B 4K14A 4DAMA 2MWSB 3DHGC 5KYLA 4ZYNA 2FMCA 4RCNA 4JV5Q 2VB2X 3AECB 4A8XC 2E3TA 4G11A 4LF9Q 2DNFA 4BKTA 2UXCQ 5ISRA 1E3PA 5M3FG 1LGRA 1N5WA 4DHJD 4M8AA 3AFQA 3D4DA 4IUNA 2CKHB 4DXGA 1YJIA 4K8IA 4UP8A 3BVGA 1XWEA 3QWNA 4RGTA 2NBUA 2WU2B 1DOMA 3BVZA 3OMCA 5JOBA 1WJJA 4LK1C 2XK5B 5DLQE 4M0WA 4R4TA 1PH7A 2OTLA 2G45B 1VQJA 4YIJA 2BA0A 3HOWB 3E56A 4DHJB 1UZXB 2ASBA 2DY8A 4LJPB 1RFAA 2FBWB 2A6EC 2KT7A 1JB3A 4KKSA 3W5VB 2F0OA 1NI3A 2V3PA 4FHKA 4A4IA 4RH6A 2F0SA 2KQ3A 2QSDA 1WCMB 3AYHB 1BBWA 1V97A 4M00A 2KHJA 4JI6L 2F0NA 2WQYB 4X3TA 4BS9A 2VQEL 2LRUA 5I2XA 1PH6A 2KZRA 3AU7A 1UWXA 2IHEA 4BBSG 1D8LA 3BIID 1KDBA 4S0RA 1WF9A 2R7ZH 2R2OA 1TS2A 2HDLA 3QIAA 3P20A 3UQAA 2BB5A 3NQTA 4EZJA 1B4OA 1Z47A 2IJ0A 3A56A 4KJOA 1XCQL 3PIO3 4B3SQ 4JIOU 1WJ6A 4A3DG 1QCBD 1IYVA 4W9IA 3MHBA 5GROA 5FLXc 2KBNA 4PK1A 2EKEC 1OXTA 3D4RA 4JI7Q 2OF1A 3UE1A 4KN4C 1Y8OB 2NVUI 2O6VB 2QHOA 2ZCCA 3ICEA 4P71A 2UXBQ 3K0XA 1A2TA 4YWGG 3X0WA 4AQ7A 5C3EB 4OONA 3HM6X 3CCMA 4KKIA 4MELA 4JQWC 3A1QB 1TT5B 1KQSA 2A74C 2UXDQ 3TMEA 1R7SA 4R4OA 1VZ7A 1UGJA 4WIPA 4AQYQ 4BKSD 4V190 1P9DU 2OQKA 3SK5A 4GDLB 3ZIMA 4DV4L 2HHHL 2Y0SG 3S14B 1LLRD 4B6WA 4USAA 4ITKA 2IO2B 1YJ9A 3OJ3A 3N1YC 4ZOHC 4C7YA 2KA7A 3H8HA 3G48A 2JX5A 1N34Q 1A6XA 1F9QA 4IPGA 2KJ6A 3VR8B 1L1OC 2H5XA 1Z7TA 1GHJA 2L0TA 2G9HD 3VHTC 4DHZE 1R4PB 3EFUA 1ICFB 5H92C 3TEZA 5BYRA 3QR8A 5HFYA 4A76A 3AM9A 1EEID 4FJVB 3C2PA 1V9PA 4BXXH 1R9TH 2UUAQ 2Z4IA 4DUYL 4OO1I 1J7CA 3EIVA 3J7A5 2PE9A 3KW5B 3NOBA 3OG5A 3Q14C 3SK8A 2R93G 1SIJA 2MJEA 2Q5WD 3EQLC 2XK5A 1Z9FA 5KYIA 3F1ZA 3KQ4A 2M19A 4PMCA 5ELBA 3VDZA 2MBHA 1QF6A 1D5ZC 1KDCA 2AUJD 2BW2A 4LF8L 3DHHC 3TS0A 1CQFA 1MI0A 1PMRA 4DK1A 4EZLA 1N62A 1CMXB 1MBYA 2LXKA 4ZYSA 1F1HA 2X6GA 5I2YA 4CDEC 4C3IB 4BY1H 1TIFA 5JEAG 1J19A 1HNWL 2ZW0A 3P4RB 4P6VF 1XLOA 4WQMA 4O2DA 2F0WA 1KAWA 3T9LA 4JI0Q 3BDLA
chains in the Genus database with same CATH topology
2IT1A 1JROA 4WORA 1G291 3AEGB 2CQAA 4KGSA 2Q8TA 1K8MA 2R61A 3DWGC 2XVSA 2E75C 3H6MA 3I3CA 3Q0AA 3TEWA 4TMAB 1LTID 4FO2A 1BBXC 1IGDA 1LTRD 1STEA 3K7AB 4YTPB 4HSVA 5KNCA 3ABVB 5HGTA 4JWSC 1LABA 5EGTA 3AE2B 2IX3A 2BCOA 2G1EA 4L63B 2F0JA 2W55A 1WVLA 1SFOB 1MI2A 3I9V1 1GUNA 3L9AX 1RF2D 3IAYA 1XTCD 1C4AA 2W3RA 3EVQA 1P7FA 1AFPA 4K5VA 1VR9A 3IFDA 4EQOA 2BTEA 3U4EG 1AYFA 2AWNA 4FNFA 2J52A 5M5YB 1ZYRD 4KKUA 5BMHA 4F8MA 2CHBD 5EKLA 4OGQC 1D4BA 2SAKA 2PW9A 1OXVA 1KRHA 3LYYA 2WXGA 2A68D 3I90A 3DEPA 2PIAA 2WDVB 1QG7A 2LS01 4L6TB 5IT9L 4IFDJ 2LKVA 4DAPA 4ZHPA 2H1EA 4YSZB 2B63B 4FVMA 1ZDXA 1SYCA 4OO1H 4A90A 1JRPA 4XDDA 4YXDB 4YTNB 1UEAB 4UDUC 4XYOA 2H89B 3M85A 3ND8A 3P4PB 3U2SC 1EWCA 1JOOA 4X3KA 1TWFB 2W54A 2N0SB 3KK7A 1BMLC 4MH8A 4K2KA 3SK6A 4LK0M 4A3JB 1EY9A 3S1RB 3GTPB 2G9DA 5D3IB 1FRRA 2PNRC 1CZGA 4DAVA 3G6JB 3JAML 5LL6S 4D2KA 1VLBA 1WTVA 2E6XA 4CKCA 2WS3B 2JXMB 5A35A 1KFYB 4DN4M 1F2YA 4ARIA 1E6EB 4H13C 2XN9C 3A55A 1B9MA 5EE9A 4PV1C 3CRLC 1HQMC 2ZXOA 4A3KB 1XYIA 3MHZA 3GD7A 2JP1A 2N55A 4IFDG 2OT2A 1SBBB 1EY6A 3D4WA 5EJWA 4Q5VA 2KMMA 2RDHA 4JPSA 5DM63 4IURA 5CBAE 3URYA 1WD1A 2L55A 1SMYD 4REZA 3NTIA 2KUMA 5E4XA 3I4MB 2J0TD 3FDTA 3OSOA 4XWWA 1BCPF 4FP5D 4KD4A 1JE4A 1QNUA 3ZJVA 1SEBD 2QEJC 3TEYA 4B9WA 4OW0A 1SNPA 5BYQA 2B2WC 1TYGB 4NW2A 3TEXA 5NUCA 2C5CA 1DZ1A 1SDFA 2EZVA 2L4NA 1MHXA 1E10A 1I4QA 3MVVA 2QCPX 5G3LD 1UNSA 3N9YC 4LTUA 1LTGD 1X3PA 1WTRA 1GHKA 3H09A 1DD2A 1PRTF 1TKGA 4HR7B 2MJ3A 2ON8A 5BN4A 1QWYA 3H3VC 2JSOA 2EJGC 3K6OA 3BVMA 1Q90A 3R8BA 1AZQA 2A6HC 3GTGB 1C79A 1NEKB 4FF1A 4RKLA 1H9SB 1HZ6A 5EPKA 1HZ5A 5JAVA 3R3OA 1RDPD 1ZXIA 4WAFA 2PYKA 3TSSA 5AFWA 3K5NA 4IOIE 1JR0D 4DA2A 1EOTA 4HJGE 2PLPA 3HS0C 4HCSA 3X3MA 3OWFA 1FRDA 5C5LA 1H9JA 1G2TA 1SYDA 4XE0A 3V3XA 1S5BD 3U7ZA 2VB3X 2LHEA 2PZTA 3BYYB 3TN2A 5KEEA 3T3NA 3A7AB 4YTMB 1PTOD 1CT1D 1BOSA 1PGBA 4A3MB 2AQ3B 5BN3A 2DBYA 1K51A 4CKEA 1DOLA 3AB9A 2F0LA 2AUKA 4BBRB 2NTSA 4WJWA 2PW7A 1CTMA 2O5JC 1QOFA 4FF2A 4WURA 1RTOA 1HA6A 5IOCA 5EKIA 1RJTA 4G57A 3TUOA 3F2UA 4K6LA 3OWEB 4FXGC 1EQVA 5G5GA 3NZ3A 1HCZA 1ZKOA 1T5EA 3UI2A 5DAUA 4FF3A 2N9KA 4IFDH 4US9A 5MPOA 1S4ZA 1RODA 2KEDA 1E7PB 1HTLD 4P2CB 4IN3A 5DNFA 3FAHA 1KNAA 1X32A 4HKQA 3NRZA 4DNRB 3FILB 4RHRA 3A7LA 4DNTB 2A69C 4ZLTF 4LMQD 2LEKA 2JA8B 2IL8A 1WTOA 3NQIA 1IKLA 4IQZA 2CW0D 1Q3LA 5M3MB 1RCVD 3AB5A 3TZDA 5I4DA 4HRSA 1L0YB 4ZKBB 1C4PA 4C56C 2K05A 4MM3B 4XT3B 4YSYB 2B2VA 3PZ7A 4JX1C 2F0IA 4KV6A 2NUCA 1TVXA 3NVZA 1IW7D 3AE9B 1GUOA 2J7ZA 2ZW1A 4Q2JA 3U52E 5IGBA 1B44D 1SYEA 4XQNA 3MZ5A 3P4QB 1KABA 3IT6B 4XWTA 2CVRA 3O13A 4B08A 2DYOA 4IZ8A 1C78A 4H2AA 1XLNA 1WWTA 5FLXE 5LL6X 3S2DB 4JE3B 1IW7C 4K2LA 4XT1B 1B9RA 3NTKA 3QB3A 1STYA 4I65A 3NXWA 3AEBB 1IGCA 2JWUA 2LFNA 2MHVA 3T53B 3U9OA 5EE0A 2KEEA 2FINB 2R93B 3AV8A 1LT5D 2E74C 3DUZA 2F0MA 3PO3B 5JPNC 4RNAA 2SOBA 2O2LD 3AE7B 3HKZB 4QCLA 1F9RA 4F7XA 4EQPA 2WXFA 3AEAB 2QILA 3FILA 3Q6SA 2NVQB 3KWLA 2RKSA 3E6ZX 3PV0A 1YQ3B 2EJMA 2KDMA 3OIPA 1BUIC 2RBMA 5I6WA 5G3LF 1ESRA 4RGMA 4WH4A 3W3AA 3ITPA 4YSXB 4NKLA 4XDCA 2PW5A 1BCPC 1G8ZD 1EYDA 1PXUA 1N5XA 3N6RA 3AMZA 3VR4A 1DONA 2EYFA 2E2DC 1Q1EA 5ELDA 2I46A 2EYOA 3J7AV 1QOBA 3K59A 1BNZA 1O7YA 2WXQA 2ZT9C 3GB1A 2A68C 3LB8C 1YN3A 5BMGA 1F2LA 1GUSA 3P1MA 3MJ5A 3CHBD 1CA5A 2EELA 1MSHA 2PZUA 4C1NK 2L32A 2F0KA 5TSSA 5JVG3 2K03A 1J9OA 4EGVA 4E6IA 4OZBA 3SDZA 2WDRB 3MWYW 3S1QB 5CMDA 1LT6D 4CJ1B 1R4QB 2Y5CA 1T3QA 2SNMA 3B9JA 4B0EA 2BDOA 2M00A 2C9OA 2KAJA 3OW7A 4RWSC 4XQQA 1IBXB 3A8KE 3MXPA 4F88A 2HDEA 1TY2A 4A3EB 1VF7A 2L52A 2B39A 2QKIC 3HOYB 1Y56A 4OZAA 4FXCA 1F9PA 2F0PA 2KWDA 2IX0A 3PZ8A 1PZID 3DWPA 3PO0A 2BS4B 4A3FB 1VMPA 1ZE3D 2GB1A 5EBCA 1BF4A 1KDAA 1ZEQX 2A73B 4AS1A 1CM9A 2L5TA 3T13A 4K6DA 2J53A 5M5WB 3SR6A 3VR3A 3BWUD 4RFBA 2HQEA 2BS2B 3CQZB 4LAAA 1LTTD 1PTOC 1PYWD 2EJFC 5JJZA 3AE6B 2B2VC 3SXHA 3VYUA 3J81E 3MXNA 4HEA1 5IGCA 1DJRD 3BG3A 5C5MA 4KJNA 4CJ0B 1L5PA 1H9KA 1HHVA 3ZGZA 1HPCA 3TDQA 1DYQA 2ACZB 1FFUA 3Q8CA 5ELEA 4WWMA 2OHFA 2NTTA 1BCPB 1WGKA 1L4DB 1BO0A 1C48A 1AWDA 4C3HG 1EY0A 1ILPA 4B9XA 1J7BA 3LWUA 3L7ZC 2AQ1B 2VNUD 2K0PA 1QNKA 2ONQA 1W6KA 1U4RA 1PDXA 5C2TB 1EY5A 2Z8LA 4JBWA 5CC4A 1HEZE 3SE0A 1E0ZA 1B1ZA 3L4PA 2WACA 3RFZB 1QOGA 2MJ8A 5HURA 3KLRA 4V0BA 5E3FA 5IIFA 2F0GA 1M4VA 2EKIA 1B3AA 2EPBA 3D6WA 2NWGA 1XO3A 1ENCA 3K5OA 1FEHA 5K5PA 1AN8A 2ZXRA 4X3SA 5BMIA 3MFYA 1U9RA 1PZKD 3S17B 1V1PB 2PPBC 3IFTA 4L8JA 2BE5C 2Z4HA 1FD6A 1FNUA 2F0FA 3G7LA 1LT3D 3ZJTA 4RAUC 3Q8FA 1ZXHA 3SHLA 3GTOB 1ET9A 3HUIA 2RVLA 3AEFB 3NP8A 2A6HD 1PTOH 1SJHD 3Q8AA 1B9NA 1JORA 3C1FA 1C77A 1ROEA 3QOLA 2QF7A 2XWJB 3FKIB 5ELCA 3AE1B 5T8IA 3NHHA 2HUGA 1Y1VB 5IGDA 3SVMA 1TKEA 3SFDB 3QOJA 2RMMA 4ZKCB 1JC7A 1IBXA 3SEBA 1PRTD 1JMLA 3BYTB 2LJIA 1EM7A 3NUHB 5K36G 4A3IB 2WXKA 2KCNA 5CORA 1XCTL 1VCIA 1FGBD 3QO2A 1AW7A 3DMUA 2EOTA 1FXIA 2R92B 4U673 2BS3B 1NENB 1CI3M 1X3QA 1TWHB 4HN7A 1C8CA 4C3IG 3C3LA 1B53A 1STBA 4QIWB 4H7BA 1SNDA 1O80A 1K8OA 2MPMA 1F9SA 3P7JA 3BDCA 2LUMA 1JWUD 3NVVA 1QOAA 1VDVA 1L6VA 4IUQA 1LO5D 5CBEE 1NYQA 2FMMA 3QJYA 2EE1A 4HSPA 3MXGA 4HROA 1O78A 2IGHA 3J80L 2YU9B 1I4PA 4C3JG 5IODA 4OL7A 2IX1A 5CV6A 1QB5D 3PUZA 3EROA 1HFNA 1IKMA 2PTLA 1JWAD 2K32A 5J22A 4C2MB 1FR3A 2ID0A 2MJDA 1GAQB 4EVOA 1DOYA 3M4OB 2JZPA 4R3DA 4DU9A 2L11A 1LT4D 3I4NB 3GTJB 2J42A 1HA5A 2KQ4X 1TS4A 4KKTA 1KLUD 5C4JB 5H8YE 3JAME 1IL8A 4RKBA 1WSPA 2PMVA 1F2RC 3RUZA 1QOHA 2KVMA 5EE1A 2HCIA 3TZUA 3N52A 1TWAB 1OXUA 4US8A 2DN8A 2AWOA 1EY8A 2K28A 2B2YC 4ZRZA 3GQBA 1D5XC 1LV9A 3HG9A 1TKYA 4S3SA 5K36H 1SYGA 2B2TC 1DCZA 3TP8A 1WRIA 2MH7A 2FJ2A 1SSNA 2WXIA 2EYLA 4MACA 1ZOYB 1MGSA 3V05A 1IHZA 4QF4A 1XF5L 3SFEB 4DGZA 1OQQA 5FK9C 1S5DD 5KNBA 3TP7A 1PFBA 2JA5B 1DM0B 1QT9A 3PO2B 3VYTA 4J6HA 4C3HB 2D2CC 4G7HC 1PUTA 4N59A 3PUXA 3AE4B 3OIQA 2O5IC 2XNAC 5M9OA 4N58A 1D5MC 1BUVT 4DK0A 2NYZD 2TMPA 3SK4A 3TP5A 1KNEA 1D2BA 2HTME 1SE4A 2LGIA 2WV6D 2V4IB 2PMZB 5JEAH 1T5XD 1SAPA 2DY7A 5C0XG 2NB0A 1JWBD 5JVH3 1AP0A 1LACA 1RKNA 4UAIA 2RA4A 5DEHA 2E2IB 5JPMC 5FO9B 1I4RA 1FFVA 4KN7C 4L2YA 4NMZA 3GV6A 5C4HA 2L12A 4TQ0A 5C0XI 3Q22A 3C1EA 1UAPA 1EY7A 1L6UA 1TU2B 5T1GA 2JA6B 4J1MA 2E2JB 3D31A 4TRDA 5D7GA 3NBHA 3K57A 5CR3A 2AQ2B 4IFDI 1DGJA 3KBXA 1PFDA 4GLSC 4EE2A 4C80A 4ZRQA 1PLFA 1Y8NB 4OZCA 1NUCA 1RYJA 4J8QA 4N6EB 3AMUA 3K5LA 1W6JA 2WXJA 4ZHOA 1BXTA 3P4SB 4BBSB 1EEFD 1UUPA 1CZPA 2NVYB 2YEPB 2FHTA 2M56B 4A55A 3T51B 3KUPA 2QMTA 2CJNA 3DXJC 1F2RI 3FPPA 1FCLA 4FF4A 4MN3A 2Y5PA 3MP9A 2D9UA 1GB4A 1XLPA 3S9WA 1GUTA 2B2WA 2ZXPA 3NVYA 2N9LA 2VZKD 3U9SA 1SNQA 2L0CA 4P16A 2XSCA 4MHEA 3HP3A 4QMGA 2VZKB 1SNCA 2IGDA 5FOBB 4MIUA 1JWSD 4M1UB 2KOLA 1U4PA 1QE6A 5CGKA 1TKWB 3PUWA 2DYMA 1ILQA 1Y69U 5EPLA 3HOVB 1AEXA 3ND9A 2K6AA 3J9CA 2I38A 1H9SA 1SSOA 3VR2A 1PTOF 1Q8IA 2JEAI 2LMCB 5GXGB 2L9HA 5I9PA 2CW0C 4WRDA 3L3OC 3RD4A 2JYOA 5C44B 1EIGA 1JALA 2EVBA 1C9FA 3Q8EA 3CWIA 4KY7A 2XWBB 3MC0B 5J1ZA 4NP5A 3HGBA 1SJED 2M2LA 4XIGS 3K5MA 1BR9A 3ZJUA 1MHHE 4RA8A 1NR2A 2IGGA 3AEDB 4IDIA 4DQOC 1SF0A 1YMHE 2D62A 1EWYC 4ZUIA 5HI1A 1PGXA 1VDZA 2R7ZB 1I4XA 4NJCA 3GTMB 2V0GA 2F3WA 1II3A 4A3GB 3GTKB 4KD3A 4B0MA 3J7AF 2XRSD 3NUCA 4TSSA 3MXUA 1NAPA 2FUG1 4CQNA 3I8ZA 1O7LA 1IUEA 1C4CA 2V3NA 1YQ4B 1JWMD 1FCCC 2KACA 2WXNA 1TQOA 1I4HA 4NDXA 1EFID 3RPFC 5IGFA 3W9CB 1ZPSA 2NN6G 4BA1I 2Y3AA 3CIRB 2K33A 1D1KA 1DOKA 1FNVA 5E4WC 1JCKB 2WDQB 1FNWA 4U68A 5CYUA 4KHZA 2IDYA 4TQUS 3NBIA 1AZPA 5AUIA 1JICA 4K5XA 1EYAA 5D65A 5COYA 3J81L 5EQ0A 4CJ2C 4KK7A 3RLFA 3EFXD 1HRJA 4C3JB 5HHDG 4KKJA 3DM1A 2D5GA 5E6JA 1PRTC 2DNCA 2F4IA 3NE5B 1ACCA 2IPKD 2AX5A 2B2UC 4CBVA 3EA6A 4FXKC 2MUYA 2CU3A 3I72A 1Z6HA 1VF5C 4H0LC 1Y8PB 4XYQA 2BYTA 2JEBI 3NS1A 2WXPA 2WU5B 2I2YA 3VRBB 2LFIA 4OO1G 3LWEA 3GO5A 5A2QE 5J39A 3MA2B 3KLSA 3EJIA 5G5HA 3HZXA 3KBGA 1CHPD 3D6CA 2A6ED 3BZDB 3EUB2 2W82A 2EYJA 1QLBB 1KF6B 1ENAA 3CRKC 1S5FD 3Q24A 2WP9B 5IGEA 1J7AA 2FE8A 3D8GA 5C0XJ 5I9OA 1SXTA 1E9MA 1IYUA 4ID6A 2N7JA 1EZ6A 3FVQA 2BB6A 2TSSA 1ZXTA 5FR3A 3KWVA 1NVID 5JEAJ 4QB4A 5IGGA 2L83A 3HVZA 4HAEA 4CKBA 1K50A 3FRPB 3IL8A 1YN5A 1GOZA 2JXTA 3H0GB 1CJEA 2RSNA 2B2TA 2JU6X 4OHJA 2BT6A 1EL0A 2KJXA 5EPJA 4N9TA 1LTAD 2GA4B 4CGYB 1HTPA 1YNND 1TT2A 4CHTB 2EY5A 1M8AA 5EKKA 3AE8B 1A3VA 2PO4A 4FYDA 3KLSX 3P42A 1GUGA 3V2TA 2K01A 3R2TA 1FIQA 4KX6B 5C3WA 1E2WA 4A9AA 5CV5A 1ENFA 5EE3A 3PUYA 2HDMA 3Q23A 1FXAA 1OQRA 4KMUC 3BDOA 4XXEA 3VR9B 3CU7A 3X3NA 1ZDVA 2XRQD 2K5QA 1RTNA 1ESFA 2JA7B 1BDOA 1WD0A 1N61A 1PFNA 2INNE 3S1NB 2F03A 1HQRD 3V96A 1F77A 4XDXA 1B50A 2GI9A 1EU4A 3VQIA 1YN4A 2RPVA 5M3FB 5C4XB 2JSVX 5C0XH 2I07B 2WXRA 3Q8BA 1J8IA 1FM0D 1I6VC 3AN1A 4HTHA 5FKAC 2PKOA 2PCFB 1A15A 1FD7D 4IUTA 5FLXL 2J4XA 4KY6A 1VJKA 1RD9D 1HUNA 1F2MA 3WDNA 3KF8A 2WKDA 1EZ8A 3FC4A 3FPUB 1LTSD 5KGUA 2X69A 4WFN3 2WXMA 1H9MA 3NVWA 2FFKB 2PZWA 1YNNC 4RGOS 1SE2A 4BWGB 1E2VA 2LHDA 4AYBB 4G7ZC 2F1MA 4K8JA 4KGRA 1V8CA 2B76B 3HEJA 3M3YB 2WXLA 1CHQD 3CKIB 2B2UA 2VUMB 3QG1A 2Q8IB 2BA1A 1P7EA 2NMQA 3P75A 1C76A 3DWQA 1YNJD 4KY5A 3WOFA 2Y0SB 2B8GA 3DHQA 1NSNS 2F0UA 2BOSA 3VR5A 1NR4A 3P1HA 3OPOA 5BYSA 1VMCA 3W2DA 2L1AA 2KECA 2KN4A 3LX0A 1R9TB 2WXOA 4BY7B 2F0EA 2WINB 1XEEA 2EDGA 1C4QA 5CV7A 4A93B 2K22A 1ONLA 2WKCA 4Q0FA 1EY4A 2B2YA 4GZYC 5EBDA 5LHY1 2IW3A 4NAWB 2R6GA 4ULLA 3NK9A 1PGAA 4DXFA 1SNMA 1TJEA 1A2UA 4ZAIA 3WCQA 1B2TA 1TR5A 2H4OA 4PQXA 3K58A 1L4ZB 1V1PA 3ONAB 3FEWX 4KHVA 1JOKA 2LMCA 1GXDC 3BK2A 1PFMA 1PZJD 3MAQA 3VRAB 1BCPD 2W3SA 2EXZA 2X6LA 1L0XB 3IKJA 1CQVA 1H9RA 5E1FA 5AUKA 2SDFA 4ZK9B 1HFGA 2A69D 3E5SA 2VXWA 3VYSA 1WTXA 4A3BB 3A8JE 4ZRPA 2NBFA 2L1BA 1YNTE 2EY2A 1D1IA 2EYHA 2K7VA 2WLBA 2K5DA 1Q10A 1YJJA 3NWSA 4R8NA 3E0JA 1FO4A 2WXHA 4IKGA 5F2DA 2NVXB 1CZWA 2NZ1D 2Q8RE 1TY0A 1K53A 3OOCA 3I73A 3VYRA 3P63A 5KIXA 1STAA 3ZQ4A 1PRTB 3M7GA 1VZ6A 2MP1A 3R93A 2LY7A 1YNJC 4ZUJA 1WTPA 4HKZE 4PMWA 1EYCA 1G6ZA 4TQ1A 2A5HA 3H94A 3S16B 1U4MA 2WAQB 1DOIA 3Q69A 1SNOA 2E2HB 4HEDA 4PT5A 1I4GA 1XX8A 1MPEA 3ZYYX 4ILWA 1ET6A 1JW9D 5C3JB 1S5ED 1SYFA 3J80E 3GTLB 1PDQA 1WYGA 2SEBD 4HCEA 4DAYA 2M0AA 1N60A 5CV9A 2F0DA 4QUCA 3W1SA 2NN6I 1TZOA 2D5DA 5CV8A 3DEOA 3A54A 1G2SA 1MD2D 1TIID 5LNK1 1STGA 2O4XA 2NVTB 1STHA 1L0VB 3AE3B 4R8IA 1A3UA 1E0BA 1QJOA 1XXGA 1HUMA 3M4YA 3GTQB 1GUWA 2JQRB 3T56B 2V4DA 2WB1B 5D3DA 2OEDA 1FYCA 4Y7NB 1XLQA 4C1NI 1DXMA 2M9VA 4O1NA 1ICWA 3NWTA 1OFFA 4G7OC 3D3RA 2PVGC 4N9PA 2HCCA 4IALA 3J7YW 3I91A 2F3VA 1HXYD 3TBIB 4HMJA 2NN6H 1TWCB 3GS2A 2QDBA 5DM73 4OIKA 1O7ZA 2KHSA 2F0HA 4LJZC 1MVKA 3AH7A 4F87A 1TS5A 3OHXC 1K52A 2EY6A 3GV3A 1Y1WB 1KAAA 2EYPA 1EQTA 3T4AC 3ETRA 1A3TA 2X38A 4OVZA 2E76C 1MSGA 1FMAD 2SNSA 4RGNA 2KCCA 4KGTA 4L23A 4XTCS 1KH0A 1OXXK 1KLGD 2OXPA 4Z9CB 2QJLA 1E2ZA 2GRIA 3LXFA 3T3OA 3BK1A 5BN5A 3T16A 2IWHA 1OXSC 3A8IE 2ICEC 2ICIA 1F2ZA 4DFAA 1JQYD 2K5WA 4O42A 5IT9E 4BA2I 3AEEB 3M7NA 3IXSA 4LLGM 3NPPA 4JK1C 2BDNA 4BY1B 3ERQA 4C7ZA 1VZ8A 4IUUA 3AE5B 1I3QB 1QQRA 5C3XA 2WNMA 3I57A 5D14A 2RDFA 4GDKB 2RSOA 1EIHA 4RHSA 3PUVA 1V1OA 3I70A 3RZOB 1T6BX 2INPE 1SMYC 2Z1CA 1V43A 2WP8J 2MEKA 3MTSA 3VA5A 1TS3A 2DNEA 3IT4B 1WTQA 1UWMA 1ZYRC 2EYMA 1TWGB 3BS1A 3B2GA 3PMFA 3VA7A 3SR1A 2JE6I 3VR6A 1SB3C 1BQQT 1CK1A 1NYRA 2B8FA 1GB1A 1ML0D 4XQJA 5JXVA 4QUFA 3MFGA 3HRZC 4RCOA 2PVOD 3NSWA 2N88A 4R9WA 1SYBA 1WTWA 3IAM1 2PQEA 3S1MB 4MT5A 5KRUA 5A2QL 4TKOB 4EQNA 4IUPA 3R2IA 2YYZA 4PNYA 1I7HA 1DOXA 2K5PA 1V8QA 3HVDA 3E9SA 1U4LA 4RF0A 1EWHA 4FXDA 3HRDD 1QILA 1ZUD2 3EGRA 4J3OD 5HG2A 2OEOA 4A6QA 1I6HB 4DF7A 1KTKA 1Q1BA 1CFMA 1G91A 1LTBD 3GP7A 3TP6A 1ZP0B 2K9XA 2BE5D 2F0VA 4ME5A 4H44C 4ABNA 5KNDA 3OMGA 1A70A 1SE3A 3PIP3 1NCVA 4I7ZC 1Q12A 5C6AA 2H88B 4K5WA 4JWUC 2F0TA 2K04A 2YEPF 3HOXB 2RDGA 2WIIB 5T1IA 4L1BA 4KTAA 1STNA 3LNNA 4KI0A 3H91A 1QKZA 2QIEB 3NTHA 2RQXA 1RHPA 2XIWA 3DWMA 5ELFA 1VRAB 2JYEA 5M5XB 2DLBA 3MEHA 2K1BA 3IAS1 4OIJA 3I4LA 5C4ZA 1GPXA 2F0QA 1EU3A 4NAMA 1I50B 3DWAA 4ODGA 3C46A 1RM6C 4ARCA 1K83B 2CJOA 4PMBA 3W5UB 3RMHA 5I6YA 4ZQ3A 2EY1A 5CV4A 1CA6A 2ENBA 3K0YA 4IUVA 1D6EC 4X3UA 1JOQA 1RFKA 2BBCA 1S5CD 3FMCA 3B2FA 3WOEA 3HOUB 2MGSA 4G4KA 1PTOB 4NZLB 1RWSA 1F0ZA 3S2HB 4RF1A 4HMIA 5FO8B 1JQ4A 2JYTA 4YT0B 3HOZB 1GJXA 2DWQA 2K3UA 1N63A 1WXQA 3RZDB 5FO7B 4A3DB 3C8YA 2R3ZA 1OO9B 3S15B 4K14A 5KYLA 4A8XC 2FMCA 4RCNA 2VB2X 3AECB 2E3TA 5ISRA 1N5WA 4M8AA 3D4DA 4IUNA 4DXGA 1YJIA 4K8IA 3BVGA 1XWEA 3QWNA 4RGTA 2WU2B 1DOMA 3BVZA 3OMCA 5JOBA 4LK1C 4M0WA 3HOWB 4YIJA 2BA0A 3E56A 2DY8A 2FBWB 2A6EC 1JB3A 4KKSA 3W5VB 2F0OA 1NI3A 2V3PA 4RH6A 2F0SA 2KQ3A 2QSDA 1WCMB 1V97A 2F0NA 2WQYB 4X3TA 4BS9A 5I2XA 3AU7A 1UWXA 3BIID 1KDBA 1TS2A 2HDLA 3QIAA 3P20A 2BB5A 3NQTA 1B4OA 1Z47A 2IJ0A 3A56A 4KJOA 1XCQL 3PIO3 1QCBD 1IYVA 3MHBA 1OXTA 3D4RA 2OF1A 4KN4C 1Y8OB 1A2TA 4YWGG 4AQ7A 5C3EB 4KKIA 2A74C 3TMEA 1R7SA