1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1LTRD 3KLSX 1EWCA 1I4PA 1V1OA 4DXFA 2IJ0A 2J4XA 2O2LD 1G8ZD 1LTAD 1EEFD 5D3DA 1EEID 1FNVA 1KLGD 1L0XB 1SJED 3URYA 1FD7D 2XNAC 1S5ED 1HA5A 3W2DA 1D5XC 1JWMD 1SXTA 1B44D 4ZYSA 1M4VA 5D3IB 5I4DA 1D5ZC 1I4HA 4NZLB 3R2IA 2SEBD 1CQVA 3DWAA 3V05A 1GOZA 1JCKB 1EFID 3CHBD 2XRQD 3DWQA 4O1NA 1ENFA 1CK1A 1FNUA 1SE2A 4DXGA 5FK9C 1JQYD 4UDUC 1LTGD 1LTTD 4L63B 1SEBD 1PZID 1EU3A 2CHBD 3BVMA 1UUPA 1I4GA 1SE3A 1CHPD 1RCVD 1FNWA 1PRTB 5ELFA 4RGNA 1HTLD 2G9HD 2QILA 1MD2D 4RGMA 1KLUD 5ELEA 1LT3D 1FGBD 1XTCD 1TS3A 1YN3A 1JWUD 2RDHA 1F77A 1PZKD 4RHRA 1PRTF 1TY2A 5ELBA 3BVZA 1ET6A 1SBBB 2WV6D 1BCPB 4RHSA 1T5XD 1UNSA 1I4RA 3BYYB 3MC0B 1BCPF 3O13A 1I4QA 1LO5D 1PYWD 2XRSD 1AN8A 5ELDA 1ET9A 1PRTD 2TSSA 3R2TA 1S5BD 1XXGA 2XN9C 2RDGA 4RFBA 1S5DD 4OHJA 1PRTC 3BZDB 3GP7A 1TS5A 1TS2A 2R61A 1PTOB 2NTTA 3DWPA 1RD9D 1BCPD 1ESFA 4TSSA 4K6LA 1B1ZA 3SEBA 1V1PA 1D6EC 4BWGB 3EFXD 1D5MC 1LT6D 1L0YB 1PTOF 1RDPD 2AQ2B 4RCOA 1V1PB 1YN5A 1HQRD 1PZJD 1BCPC 1TS4A 1PTOH 1LT5D 3BVGA 5ELCA 4L6TB 1DYQA 3MFGA 1DJRD 1LLRD 4Z9CB 1CHQD 1JWSD 1QILA 1LTBD 1SE4A 4RH6A 1CT1D 2AQ1B 2Z8LA 1SJHD 4RGOS 1KTKA 1I4XA 2ICIA 3BYTB 5FKAC 1HXYD 2QEJC 1EU4A 1AW7A 3OWEB 2IPKD 1LT4D 3R8BA 1PTOD 1YN4A 1JR0D 3TSSA 3EA6A 1LTSD 2NTSA 1BXTA 5TSSA 1LTID 4C56C 1TY0A 1S5FD 1STEA 4RGTA 2AQ3B 1PTOC 1S5CD 1RF2D
chains in the Genus database with same CATH superfamily
3DVNV 4GN4B 2F3IA 1YIWA 1AFPA 1G6JA 1BBUA 1G2SA 4OL7A 2O2LD 4MGZE 3OMCA 1A3UA 3V61A 2FHTA 2R2OA 4RA8A 3C46A 4C3IH 3Q14C 1EYGA 4W9EA 2CFMA 3DHIC 2EJFC 3KBXA 2R7FA 1GJZA 5LLIA 4TRDA 2WLBA 1PH2A 3KUCB 3WALA 1D5XC 3CC2A 4IO9A 2KAJA 2MX2A 4HJGE 5CHFA 2YTYA 4JYAL 2KACA 1GUNA 2N1WA 1C9FA 1P3QU 3T13A 2F3WA 1XYIA 1OEYA 2WXFA 4IWPA 1UE5A 3AU5A 4O1NA 3PHXB 3I90A 5LHY1 3Q3NC 3QWNA 4DR2L 1SE8A 1LTGD 1T0YA 2JYOA 2PQAA 3HIZA 1YJNA 3K59A 1DD2A 4R3DA 5I6WA 2DBYA 3OW2A 4A3MB 4MTNA 3MZ5A 4IJHA 1UF0A 1VLBA 1YX5B 4C00A 1Q8KA 4YXDB 2K5NA 1TWFH 3ZNID 1MD2D 3LXFA 4CKBA 1CZGA 1AWDA 2KWVB 2Z4HA 1F9SA 4WWPA 3UGBB 1FGBD 3ND9A 3VQIA 4DV2Q 1TS3A 1VZ8A 1K83B 4EQ5A 3KWLA 1RODA 1TY2A 2ZVNA 4NP5A 1LFDA 1JJ2A 3S9WA 2C7MB 2WXGA 4JI5Q 2PMZB 4KIKB 1MHXA 1L7YA 3I57A 5G55A 3HOUB 3PGZA 1DOLA 1JB3A 1RJTA 4GOPC 1RRBA 2BBCA 5AZGA 4A93H 2B2WC 1V2YA 2FINB 2KHIA 2HJ8A 2Y0SB 3MXNB 2BWFA 3VR8B 2F0WA 1PYWD 1IHZA 1SYGA 3ZO5B 1KAAA 2WXLA 1JB7A 3ZYYX 3LYYA 1TZ1A 1BOSA 1IXRA 4CHTB 3CCRA 1DOIA 1T0SC 4KLKA 1D1KA 3A7AB 1NNXA 2DENB 4GDKA 3VVWB 1TWHB 2D5DA 4Y7NB 2JA6B 1QVGA 3HZXA 2OF1A 2N7JA 2NBVB 1PMRA 3F2CA 1EF1A 2F0VA 5JHBA 1KHIA 4FHJA 4YHHQ 1U4RA 1GHKA 1VQJA 1BBWA 3GTJB 1VQMA 2Y3AA 4BY7H 2ZZPB 1XQQA 1B1ZA 2LFNA 2L83A 3A0JA 3J81E 5IWAL 3SVMA 2DJFC 1A3TA 2SDFA 1JWAD 3DVGX 4HSVA 2AQ2B 1V1PB 3AEDB 1ZKOA 5DAUA 2NVXH 4F7XA 2JA8H 1BUIC 4R8NA 1K53A 1PQSA 1XD3B 4QJFA 3VYRA 2KN5A 4A9AA 1NMFA 1FCCC 2KWDA 1I6VC 4HKZE 1OXSC 1W3SA 3PMFA 4HEDA 3J81c 2K05A 4NXNL 1TZOA 4HIOA 2DZMA 1JRPA 2AQ1B 4US9A 1IBKL 4ZRKA 3F2UA 1D4BA 1VQ7A 3NQIA 2IX3A 3M4PA 3OWEB 3ZJYC 3CSTA 1WIAA 5EGTA 4IQZA 1AZPA 3RNAC 3C8YA 1FCLA 2VUMH 1IW7C 1WR1A 4MIUA 4LF8Q 3LB8C 4XDDA 2V3NA 1FXAA 2M00A 2NUCA 4ZYNA 2MEKA 2AUKA 3H91A 2E74C 3TCAA 1J6QA 3TBLD 4QIWE 5CMDA 1QOAA 4GNXB 3QJYA 4DXFA 2EKIA 2KWCA 2XBBC 2IJ0A 2JU6X 2REXA 1CQFA 2OJWA 2V1YA 1LTAD 2UU7A 3K81C 5D3DA 3RI7C 2O2VB 2QGQA 3GOEA 3E9IA 2ZJDA 1QLBB 1S5ED 4DR1Q 3PO2G 1XNQL 4B9KA 2JA7G 4BKSA 1ML0D 3PUZA 1SB3C 2KTRA 2Q8IB 4DGZA 2PVOD 1PH6A 3NUHB 2AYOB 4A3MH 5G3LD 5C23A 1IP9A 1NAPA 2CHZA 1GUOA 4OO1H 3QWZB 2IL8A 1HPCA 4A3FH 1IKMA 2NR2A 3KQ4A 4JPSA 1SFOB 5EPLA 3UINB 2ALYB 1SE2A 4WAAA 1VDVA 3NTHA 4N9PA 1YHAA 2JXTA 2EY5A 5BN5A 3M95A 3U8ZA 2HIVA 1WMHA 1I4GA 4HTHA 4XTCS 4FXCA 1R7SA 4WURA 3B1LX 3J80i 1B3QA 3W1BA 4X64L 3HOUH 3J7AV 1QZEA 2E6XA 2LZ6A 3A1QB 5HKHA 1ISNA 3RLOA 1IYJB 2E76C 2VY3A 3FKIH 3QG1A 4IM0A 3KFUA 1SNCA 2WXNA 4JV5Q 4RF1A 3R66C 2YEPB 2KECA 4LF6L 2JQOA 2ON8A 4US8A 4WAFA 1EY0A 4NPSA 1Q10A 3D6WA 4RM9A 1CKNB 3SGIA 4DV7L 3NZ3A 1H95A 4DDID 4DR4Q 4JGHB 2Y5PA 2QDFA 1G291 4A3JG 2YU9H 4KGSA 4C80A 2GBRA 3KH0A 4HXDA 1YITA 3GTJH 1Q12A 3CWIA 3S2DH 1QNKA 2PVGC 4XDXA 2BYTA 2I2YA 1YZ6A 3GTLB 3RD4A 4CDEC 2IO2B 1YNJC 2RHSB 2WAQG 1TYGB 1LQBA 1H9RA 1YMHE 2LASA 1WFYA 4GB9A 4FJYA 3S2AA 4CQNA 4F87A 3EFCA 1OQRA 2NYZD 3W3AA 3SDZA 2IO1B 1SNMA 1ASZA 2JZPA 1X54A 3AULA 1ZP0B 1BCPD 1HZBA 1K3BC 1SE9A 5JOBA 2OT2A 3VYTA 4EE2A 1HTPA 2RQXA 2N1VA 3LNNA 1IBMQ 5AJ3L 1RHPA 3KDFB 4A55A 2NBWB 1CSQA 2PTLA 4LNOA 1HJPA 3RCZA 1HH2P 2EJGC 2RF4A 1YQBA 2IW3A 4HN7A 4K5WA 1E8ZA 1LTBD 1CZWA 4RH6A 1VCBA 2IY1B 3W1YA 2B8GA 3GTOB 3QX1A 3VDYA 5D14A 4CBVA 3K5MA 3KWVA 1LM8B 4K2LA 1W6JA 3QHTA 3RUIB 3R8BA 4XE0A 5FJ8H 1Q81C 5JAVA 3M63B 4EOYA 4R9WA 4ICVA 1WTVA 5CX3A 3RN5A 1QT9A 1RFAA 3VR2A 3I4NB 1I7HA 4WH4A 3NVZA 2O6VD 4LDTD 4NB3A 1XMOQ 2AQ3B 4NAWA 1HEZE 3A9JB 2CW0C 3I9V1 4G11A 4XT3B 4RAUC 3HOXG 3SK8A 2EXZA 3JAMi 1DZ1A 2M9VA 4P1CC 3RD2A 1TWCB 1SFOH 1A2UA 1YHBA 1A0IA 4HJAA 1G6PA 1QOBA 2B2VC 2HQEA 1C4PA 1SJED 3OJ3A 1JQ4A 1Z6HA 2R93G 2JEBI 4LF7Q 2Q2TA 1N6ZA 2D3AA 5LNK1 3TL5A 1A3VA 4RM8A 2ZXRA 1I50B 1JWMD 1SXTA 2IO0B 4H2AA 4C1NI 4YCVA 5IP7H 2K1FA 4DHJB 3CCQA 4YSZB 3H3VI 3AE2B 4NZLB 2SNMA 2A5HA 3HK0A 3AB5A 2MO0A 4KY6A 4JLCA 1PH9A 2C9WB 2RBMA 1TXYA 2BB5A 3E5SA 3RNBC 4DBGA 2ZW1A 3A9KB 1WSPA 1GJXA 1KRSA 1JJCB 4LF9Q 2MBOA 4BFRA 3RT3B 4OIKA 3VYSA 3VR5A 3IHPC 4AUQC 5G2NA 4A4IA 2G9HD 2N9LA 4B3ML 1GD7A 5C3EB 4NPNA 2BCOA 1NDDA 4K7SA 4TKOB 5ELOA 1XTCD 1HZ6A 2KKCA 4DR7L 5DEHA 2KTFA 1ENAA 3D6CA 2KN4A 3VUWA 3ZW3A 4DR3Q 3GTLH 1EIGA 3PREA 1EO6A 4ITKA 4N9F4 3H3VC 4C3IG 1ASYA 1Q0WB 1EWHA 5IY0A 5C3XA 5TR5A 4C7YA 1C8CA 4N8FA 4LNIA 4M00A 2KVMA 3ZUNA 4LTUA 2BE5D 4L1BA 3N20C 3L0WB 2EY1A 1L0WA 4JI8L 3RN9C 4E71A 1ET9A 3R2TA 4IM2A 4Y52H 3APCA 2VH1A 4G50A 2KLGA 1NUCA 1WGKA 1XXGA 2KHWB 3QIJA 1HR0W 1TQOA 2EYLA 2E2HB 1WOCA 3RLFA 2IY5B 5AUIA 5FLMH 4BBSH 1XCQL 2Z6KA 3I91A 4R4OA 1B8AA 1WCMH 2EOTA 3U4VA 2NZOA 3HP3A 5D65A 5IGCA 3GTOH 4KIKA 4N58A 4XZ4A 1ESFA 2WDQB 5CV9A 3E9HA 4FO2A 4P74A 3EJIA 1F0ZA 3MXNA 4ZAIA 1PZJD 2LXKA 5BMHA 1RYJA 2IGDA 2EYHA 1SYDA 3A4SC 1DGSA 4P6VF 4MTKA 3W1GA 3PO3B 1JWSD 4ZHPA 4DQOC 3GZNI 3NBIA 4MSMB 3UE1A 5CV4A 4FYDA 1VQOA 1WI0A 4A93G 2CWPA 2OWOA 3AU4A 1BUVT 3HUIA 3FC4A 1B9RA 2DYOA 1HHVA 4FXGC 4HJ9A 1YVCA 4AQYL 3DMUA 4LWCA 5IGGA 4A3EB 4KX6B 1ZDVA 1KOTA 3PO0A 4G57A 3KF6B 2UWQA 1I50H 4KKJA 3D4RA 4OWTB 1YJ1A 3K6OA 4KY7A 2DX5B 3UIPB 1YJ9A 5I9OA 2NVUI 3KLSX 3ZJUA 2NBFA 4GSWA 3QK0A 2KWUB 1IKLA 3NTKA 1TU2B 3ZQ4A 2DZJA 2Z0SA 2L55A 2PEAA 2CCZA 4HIKA 3VUYA 1TKEA 1R9TB 4DAYB 1J9OA 1PDXA 3K7UC 2HQLA 1ILPA 2PW5A 1K9MC 2E5LL 3NVWA 2I5MX 5NUCA 2JA8G 5I4DA 2WXQA 2AMCB 5E4XA 1MIUA 5LMNQ 1GKHA 2WB1B 1GOZA 3ULPA 1SIFA 1YIJA 2XRQD 5C6AA 1WJ4A 3IAM1 3Q8CA 5IYBH 2W9NA 3WAOA 1JQYD 2MPMA 4ILWA 5G5HA 3SXHA 1SEBD 1YHQA 2LS01 3TUOA 3U9OA 5JPMC 3Q22A 2VUMG 3M3YH 1WH3A 3WANA 1DOKA 2PQAB 4HR7B 1V5TA 3V6CB 1DGJA 3TZDA 2FCMA 1KAWA 3J81i 5IGEA 4AYBB 2KZRA 3T1YL 1U4PA 1UWMA 5E6OA 1VQGA 4KV2A 4JE3B 4HSPA 2K33A 1L6VA 3PT2B 5ELBA 3M9BA 4XQJA 2WP8J 4YWMA 1N60A 3VTWA 1IYUA 3UIOB 3L7ZC 4LDTB 2EYPA 1VS0A 2F0JA 3G6JB 5CHVC 3MC0B 3BU2A 4K8JA 4A3MG 1U4MA 3RPFC 1CKMA 4FA6A 4OO1G 4A3FG 4YWKA 2K8BA 1X65A 3OMGA 3PSEB 3T4AC 4X3SA 4P72A 1WGYA 4ZKBB 1IYFA 3RZWC 1EZ6A 2JQRB 3LGJA 4OHJA 1PRTC 4JI7L 4A3CH 2PLPA 1TS2A 3BK2A 4JI0L 2KEDA 5A2QE 3VR3A 2HDEA 3MC8A 4XT1B 5E6PA 5MPOA 1C7YA 1DM0B 5JJLA 5KHOA 1Y1WB 4CKEA 3HOUG 4M1UB 3NE5B 1MJCA 2A73B 5HG2A 1WXMA 4FJVB 3FKIG 3V2TA 1SNDA 4G4KA 3HOVB 4BXXH 3PZDA 4NXMQ 1K73C 1HQRD 4GLXA 1WGHA 2EELA 1KQSA 4L6TB 1DYQA 2RVLA 4A3EH 5FO7B 3TIXA 4IN3A 4JWSC 1HZ5A 4J6IA 4DNIA 1FD6A 1VQPA 1Q1BA 5C5LA 3FP9A 4A75A 1LXDA 2CS4A 3T8MA 2DNCA 2K0PA 4EGVA 2NN6I 4LFAQ 2MLBA 1K0RA 2KCTA 2IX1A 2D3BA 5FLXE 3TP5A 1N62A 1T0RC 1I6HB 4DV5L 1AEXA 2QKIC 4C56C 3RNUA 4JI2L 2EIFA 4JI6L 1WF9A 3MEFA 1R9TH 1Z5SB 2L15A 2MBEA 3KDFA 5AFWA 2JRHA 2B2TC 4GXBA 4DK5A 1ICWA 2L5TA 1PTOC 3Q6SA 1A15A 4Q5VA 2O4XA 1E8XA 3GE3C 3NTIA 3AECB 1KFYB 5DCNA 3OTOL 5IGFA 3U9SA 2EYMA 5M3FH 1E2ZA 2CHXA 5A2QL 3ZDMC 2ZNVB 4QMGA 1J5EQ 2ACZB 2WXIA 3ZJVA 2SOBA 4P75A 3S15B 1B2TA 2WFWA 4L8JA 4IPCA 1S4ZA 4A76A 4BY1B 1B44D 4ME5A 2CU3A 4P1BC 4BVUC 2DHZA 2DY7A 2KTRB 3BINA 3OW7A 3R7QA 3U52E 5CV7A 5HGTA 4JI4L 5FR6A 4DV1Q 1V49A 4AWJA 5CTRC 4D2KA 2X69A 3SK4A 3T56B 1KM7A 5GROA 1P1AA 5FK9C 1MPEA 1OQYA 1E24A 5T1GA 3H7PB 1VDZA 1FGUA 3DDCB 2VZKB 3JC66 4DV6Q 3QA8A 2I46A 5FJ8G 4B3RQ 5FLXL 1C4QA 3H15A 4DAVA 1WMHB 4REZA 5L95C 3IAS1 4RGNA 4RGMA 3MAQA 3ULJA 3Q69A 5EQ0A 2WKDA 2LVOA 2RDHA 1FRRA 2QC8A 4FN2A 2AWOA 2NB0A 3ECIA 4E74A 4EEWA 2K5WA 3ML8A 5LMUL 3EIVA 2PW9A 5CV6A 3UE0A 2MJ8A 3A9KA 4IUTA 3PF5A 3BYYB 4JIOU 1IL8A 1P8LA 5LXHA 3MHBA 5IP7G 3EHVA 5IAAC 1SYFA 4GZYC 2K5PA 3PUXA 2M17A 3L10B 4LNQA 3WAMA 3P42A 1D2BA 1WJNA 2GMIC 3HOVH 3AFQA 3KUDB 3O65B 4UAIA 2OQ0A 3I7FA 1WTQA 1KRTA 1PH4A 2J53A 2Y5CA 2L0CA 3CW2C 4JBWA 1XX8A 4YHHL 2FNJB 3BWUD 2QIEB 3J9CA 5BMGA 1KDBA 1NY4A 2VQEQ 1C76A 2F0SA 1JOKA 1MJEA 2EMSA 4LJOB 2CKZB 4X3KA 2VB2X 2UXCQ 2WX0A 4H13C 3EFXD 3NSWA 1CA5A 1RDPD 1YN5A 2K5QA 2E8GA 2F0DA 2OQKA 3QB3A 1I6HH 1PTOH 3BG3A 2KMMA 3IFWB 2LJ5A 1DJRD 2KX0A 2YYZA 2Q5WD 4W9JA 5BYSA 1C48A 3CP0A 4Z9CB 2FFKB 1IW7D 3LWUA 3AQQA 4A3BB 1NR4A 2WXMA 3A54A 4FP5D 2BS3B 2CVRA 1I94Q 3QCAA 1FXTB 1WRDB 2PE6B 1E7VA 1XNRQ 4O2DA 4LF8L 2A8VA 2PE9A 3AEFB 5EE0A 4A8XC 4F7ZA 2B76B 4NAMA 1FPYA 1YN4A 1XJVA 3IT4B 4MT5A 1UGJA 3EA6A 1L6UA 1LTSD 5C4XB 1AE2A 4A3DB 3S15H 1Y8NB 2KFKB 1S5FD 4QB4A 1P7EA 2NN6H 3S17B 3EQLC 4BY1H 1U4AA 4FLHA 2PMVA 4YCWA 2PPHA 1HZAA 4CJ2C 1CUKA 3CCUA 4M0WA 3GTQH 4IUPA 3S1QB 3L0OA 4KKIA 5FLMG 3DEPA 4F1SA 1WCMG 3UDFA 4DR1L 3HM6X 2C9OA 4JI1Q 1L0XB 1XPOA 1HA6A 3URYA 4ANVA 1HA5A 3PTFC 4PS7A 4QGUA 2BA0A 3SFDB 1UELA 5D94A 2K5HA 3PUWA 3R3OA 4LF5Q 2QDLA 1SMXA 2P5ZX 4XQNA 1H9KA 2A74C 4LFBQ 2DLBA 2D10A 2MJ3A 1YNNC 3DPDA 3K57A 1UE7A 3R2IA 2LVPA 4GOCA 3X23A 2IHEA 4FADA 2L11A 3KF6A 5HI1A 4EFOA 2WWZA 3APDA 5FO8B 1F2RC 1YJJA 4PYZA 2NVQH 1SROA 1HFGA 2G45B 3K5NA 2L9HA 3CF5A 2ZJQA 5EE1A 3ERQA 1XLPA 2H5XA 2D3GA 2B2UC 3I72A 4UPAA 4EZLA 3KBGA 1Y69U 2F0EA 3G71A 4DAYA 4CYEA 3BZCA 1HTLD 4OX9Q 3A56A 4OO1I 2ZPNA 4HWIB 3I70A 4X65L 5KYIA 2A4ZA 4HEA1 2KJXA 4J3OD 4EVOA 4JL9A 4DR4L 4MN3A 4IOAA 2V3PA 2WV6D 3N1ZC 2JWZA 1SAPA 4RHSA 4XIGS 2MO1A 2FCNA 2KFJA 2PJHA 2LSSA 4UP7A 4GLSC 3UDIA 4LNNA 1S3SG 1YD8U 4YT0B 2UXDQ 5CR3A 2MH7A 1YNJD 1FJGQ 3A4RA 3NZSA 4IFDI 1X3QA 4DK1A 1I4QA 1LO5D 5ELDA 1IUEA 1SSNA 1GXDC 1L1OA 2RSNA 4NKLA 3MFYA 3CMAA 4A3GH 4A3KB 5GADC 5IYBG 2ZM6Q 1LGRA 2K22A 5M3MH 3K9OB 2F0PA 4JI3L 2R61A 1I3QH 1M90C 4RCNA 2PNRC 4BBRB 3CRKC 4ZCKA 1VMCA 1BBXC 3GTMH 4DN4M 1EQRA 1IBML 4OZBA 2DWQA 2D2CC 4S3SA 1Y8RC 2O6VA 4MSQB 4W9IA 1DXMA 1O7ZA 4C2MH 1KXLA 1D6EC 2L0FA 3I73A 4JOIC 5IP4D 2Z6KC 2SAKA 4IFDJ 5C4XH 4KZCA 1X9NA 5C44B 2DGYA 1HNWL 1GHJA 4NNJB 4A3IB 3CC4A 4TVAB 1HNZQ 2UUAL 4IWOA 4A6QA 4Q0FA 1NVID 1V8CA 2AL6A 2CKHB 4L23A 2DUDA 2IPKD 2VW9A 1EOTA 4MELA 2OOBB 4N59A 3ENEA 4HAEA 2CW0D 2KQ3A 4RF0A 1XMOL 2NTSA 3K7AH 4S17A 2TMPA 1Y8OB 4RNAA 2ZCCA 3TS2A 4KD4A 2B63B 4KHVA 1HZCA 4RGTA 3A55A 1GUTA 2L52A 1JW9D 1QWYA 3Q8EA 5G3LF 1LTRD 1VQBA 4DUZQ 4YTMB 5HFYA 3A5ZB 2JZ3B 1J8CA 1EWCA 1N34Q 3L4PA 3V3XA 4A3CG 2LXAA 3WCQA 4BA1I 5H92C 3N1XC 1HTQA 2QMTA 4LF7L 5AZHA 4MACA 2RDBC 4HCPB 4LNFA 1KLGD 1WE7A 2N3SA 3PZ7A 1V1QA 4I6LB 4PZ7A 1PFDA 1S1QB 5G5GA 2WXRA 1EYCA 3PV1A 4PK1A 4WQMA 1PYSB 1T5EA 2BH8A 4FNFA 4BXXG 3KVFB 3ZRCA 3A8KE 2WDRB 4A3EG 4HRSA 3QC8B 2PCFB 2UUCQ 3A8JE 3NOBA 1EUJA 1STGA 3DWAA 1ZXHA 5DPWA 1RLFA 1JCKB 4K0KL 3T1HL 3WIMA 2EVBA 3M4YA 4LF9L 4NW2A 4MM3A 2EYJA 5H8YE 2FUG1 1UWXA 1ZGUB 4XGAB 1B9NA 3AEBB 5JPNC 3AFPA 3CCEA 1IYVA 1SE3A 4OZAA 5J17A 4K1RB 3PQIA 2K32A 5EAYA 2PKOA 2WIIB 4GNXC 1N5WA 2KC1A 3WOEA 2BDNA 2RSUA 5E6NA 2K50A 4IZ8A 3I8ZA 1EWIA 1VQDA 5JJZA 4PZ6A 5EJWA 3J81L 1LT3D 4DR3L 2LRUA 1GUWA 4ANWA 4KN4C 3GTPB 1GM5A 1E9MA 3NXWA 3CPFA 2I1KA 4RHRA 3AE9B 1WXQA 3BZKA 2HHHQ 4JBKA 2K75A 2WB1G 1N33Q 2K52A 5M3FG 5C4ZA 1DONA 3GS2A 2QHOA 5KEEA 1I42A 1OXVA 4WIPA 3HOZB 1VQ6A 3HFZB 3NWSA 1AZQA 1ACCA 3TN2A 3H7PA 3TS0A 3N30A 2GN5A 1MHWC 2KQ4X 1K83H 2Z59B 4ZHOA 2OTJA 2LMCB 2K7VA 4MJSB 1N63A 4BBRH 5LXIB 2GBMA 2UUBQ 1BCPF 1N32Q 1YNTE 3S1NB 4K14A 1VF7A 2BA1A 3C1EA 3AMZA 2TSSA 4DHZE 4LLGM 4B3SQ 1TKGA 4AYBG 3DEOA 1GUGA 5BR8Q 2UU9L 1PFBA 2HUGA 1Z47A 4IFDH 5C44H 1JE5A 4OWWB 4NJ7A 2HDMA 2BYFA 2HDLA 4A3IH 1F9RA 1K8MA 4RKBA 4DR6Q 1OXUA 3L13A 3PZ8A 3TMPB 3HOWB 1Z9FA 1VZ7A 2J42A 2N7DA 4GMVA 4QCLA 1XWEA 1UD7A 1TWHH 3A5UA 4Y7NH 2JA6H 2B3GA 4BZAA 1WYGA 1ILQA 2HTHA 2M19A 5J18A 1V9PA 4R8IA 1WYWB 2AL3A 3Q3MC 2B29A 4C7ZA 1I35A 3D0FA 2ES2A 3RMKC 1SE4A 2K6QA 2W54A 1CT1D 4HMJA 1NEKB 2Z8LA 1QOGA 1SJHD 3DOWA 4JG2A 3BYTB 2G4SA 1PGBA 3HVDA 2EPBA 3UI2A 1NI2A 2MNAA 2FUHB 3SD5A 2HT1A 3IL8A 3SE0A 1K52A 2J0TD 5CORA 4AOFA 1UZXB 2A68C 2RCFA 3P63A 1SF0A 4G7HC 1Y1WG 3WAPA 3KLSA 2IBIB 1C77A 2RPQA 3HVZA 2WXHA 1KNEA 1TT2A 3HOVG 3JVZX 5CBAE 5L37A 2HCCA 3HGBA 1K28A 3P1HA 5JH5C 4ZRZA 2J52A 1U4LA 1M8AA 4R4TA 2KDFB 3H0GB 1F52A 2C7HA 1VMPA 3RZDB 3F2BA 3S1RB 3GD7A 2K8HA 1SDFA 5LMNL 3H6NA 4DUYQ 2PMZE 4KMUC 3ML9A 2R2QA 1I4HA 2JA5B 3LJ3A 1XT9B 2KFKA 2MQHA 5HHDG 1YX6B 4JC0A 2OEOA 5HY6A 2NZ1D 1V97A 4ASWC 2Q2HA 4XQQA 1SGHA 2Y0SE 1HR0Q 3OWFA 4EZJA 2BS2B 3Q8AA 4WJ4A 2JYEA 2AKWB 1BR9A 2FE8A 1JC7A 2K04A 3U4ZA 4QUFA 1YI2A 1UGMA 2LUEA 4K3BA 3S14B 1LYLA 2ZW0A 1KDCA 1JMCA 3NG0A 2M0XA 1V86A 1JICA 2FIDA 2UYZB 1FL0A 5DLQE 2LFIA 2JJQA 1XPRA 2G1EA 4ZOHC 2NN6G 5IYCH 4BY1G 1QZGA 4FF1A 3C19A 3AE4B 3CMMB 5DM63 2L12A 4HCSA 2R6GA 1M94A 1WZ0A 1WXVA 3DWGC 5HGQA 4XWWA 2XGTA 3IFTA 1UH6A 4K2KA 1QE6A 1OO9B 2IT1A 2Q8RE 2UXBQ 4XYCA 2X6LA 4O42A 1QB5D 2V1CC 4P2CB 4H7BA 2H4OA 1WTWA 1P7FA 2ZJPA 2DNEA 3HEJA 1HCZA 2DY8A 2DYMA 4B0MA 4WWOA 3MWYW 1JRUA 2ZTDA 2K28A 4UP8A 4B3TQ 3JYUA 4MDKE 2E2DC 1BT0A 1H9SB 1VQFA 4YWLA 2BWES 2KANA 2WXOA 3RZFA 3W5UB 1PRTD 1NBFC 2XK5B 2NWGA 1MJDA 3A74A 4H44C 1PGXA 1D7QA 3TQYA 4NXNQ 1TIFA 4PMWA 3PCOB 1GAQB 1RFKA 1E2VA 2W82A 3MJ5A 4EQNA 1PFMA 1GVPA 2QF7A 3GTGB 4P16A 1TS5A 2XIWA 3VDZA 1IPGA 2GRIA 1EY8A 5K36H 3I4OA 4CGYB 5KIXA 3H9DA 3RUZA 4LAAA 1NMGA 1G6ZA 3RR5A 4EUTA 1WY8A 1X3PA 1MG4A 4MGIE 2F0TA 5BO4B 2KUMA 4LJZC 3RNGC 4IUMB 3ICEA 2KDEB 2Z0EB 4S0RA 1PGAA 1V5OA 1TS4A 2KK8A 1OXXK 3HKZB 3L2PA 5CYUA 1FMAD 3APFA 4F8CB 1FEHA 2N55A 1IBLQ 1ICFB 2KMCA 3KLWA 4E6IA 4K8IA 3NENA 3M7NA 1JT8A 4QF4A 4RGOS 1KTKA 3UF8A 1B53A 3AB9A 4LFAL 1SMYC 2C35B 1OGWA 1RWSA 1CI3M 3GTKB 3NZUA 2RR9A 4XWTA 5GAEC 4XXEA 4IKGA 1PTOD 3D4DA 3H0GH 4C4VB 2DZKA 3R3MA 4JK1C 2DN8A 2FJ2A 1TTNA 3RZDH 3AEGB 1FVIA 3S1RH 5A35A 3Q6BA 4B6WA 5C0XI 1E1OA 3KOJA 3VA7A 4DV0L 1VQ4A 2ZCBA 4XC2A 3TJPA 1J19A 1S5CD 4A3GG 3M62B 4M02A 2PQEA 3C2PA 4EKUA 1P0RA 2RGFA 2Z1CA 3SDLC 2YLMA 5M3MG 1J5EL 3PGEA 3ZTCA 3VH3B 4A3BG 3Q2AC 4M0WB 1QG7A 3I4NH 3OSOA 3Q23A 4LUZA 2CWAA 1KLVA 2CHWA 4X64Q 3CPWA 3LDZE 3NHHA 3GV6A 3A8IE 3S14H 4BKSD 4ZRPA 4GOPA 5JJKA 2C5CA 3AYHB 3TP8A 4IUVA 5I2YA 3PS6A 1TR5A 1TWCH 5C4XG 3IG3A 3FPPA 3F2DA 1TJEA 2F4VL 3VR9B 3H6MA 4BKTA 3CQZB 4X62Q 3NEMA 2VXWA 3MA2B 1F2ZA 1WTXA 3L3OC 4DA2A 5C0XJ 4TQ0A 3H7SA 1Y1VB 1ZW7A 5CV5A 3RNEC 1LABA 2RSOA 3NWTA 4F8MA 1FRDA 1L4ZB 4HROA 4HMIA 4B3RL 1FFUA 5DPTA 2DJGC 1SNPA 3A7LA 1WXAA 3ETRA 4LUOA 1SN8A 3MHZA 5IKCM 3KK7A 1NCVA 3N3KB 3MJWA 4HK2A 3D3RA 1CHPD 2LXCA 1FNWA 2AX5A 1SYBA 4GKKL 2R7ZB 3RZOB 3P4PB 2CR5A 4PT5A 4W9DA 5BYQA 2JX5A 2LD9A 2WHIA 2FCQA 2VH2A 4YSYB 2KDBA 3QQ8B 3V96A 3NQTA 4AP4C 3KLRA 5JVH3 2J7QB 5CHWA 4URKA 2X8XX 4V190 4ABNA 1K0SA 1VZ6A 2BKFA 1C3TA 1PH8A 1BCPB 4AH6A 4KGRA 4AJWA 5C3EH 2BPSA 3T51B 3PLVA 1PH7A 4KHZA 2ASQA 5AJ3Q 3OYYA 3ZGZA 2F03A 2V4DA 2D11A 3AXCA 4AJYB 2XRSD 3L54A 5GQOA 5F2DA 3CCLA 2LRWA 4FULA 3N52A 5IN7A 1L1OB 3PO2B 2VQEL 1IZ6A 2JA7B 3OHXC 4QQBX 3Q8FA 1GNUA 3Q8BA 3SU8X 2RDGA 1L2NA 3BZDB 4WJ3M 4V0BA 1J0GA 2UXCL 1RD9D 3PRMB 3N32A 5HURA 5C5MA 1MBYA 3DWMA 4LF4Q 2KENA 4K6LA 1OTCA 2QW7A 3VXWA 4MJSA 2LMCA 2F0UA 2O6VB 2PZTA 5J1ZA 1D3ZA 2E2HH 1BQQT 3DBHI 4HDQA 1MSHA 4ODGA 2PIAA 3TEWA 1X32A 3IVFA 3VR6A 1EYAA 2K5VA 3DUZA 2HCIA 1ZYRC 3D4WA 4MH0E 4W9KA 3X0WA 2XWJB 1I94L 4L5SA 1Z2MA 4CDFC 1KRHA 4NMZA 2V3SA 4G3XB 4Q2JA 1H9JA 3MEHA 3VRAB 2EXDA 4A3KG 2KCCA 5FKAC 1L2FA 2INCC 5FR3A 1BKBA 2X38A 1UWVA 4BBRG 2OJRA 2OCEA 3PO3H 1RM6C 5IGDA 4LFCQ 3STBC 3V62A 1MI0A 1MFWA 4NDXA 5M5WB 3OG5A 5AUKA 1WD0A 1YEZA 2VQFQ 4XYOA 5JXVA 1HNXQ 3DBHB 5I2XA 4A3JB 1CKOA 4IFDG 1NSNS 1U0LA 5C44G 2Y0SG 4DAPA 1QQRA 2K6DB 2M8SA 3CF6E 4IC7B 4A3IG 4JI1L 1PFSA 3B0AA 3HHMA 5C0XH 1Y1VH 4DR5Q 1B70B 1YNND 3ZNZB 1FNVA 2NZHA 2MHVA 2XSCA 4U673 3DHQA 2WAQB 4IALA 4DV4Q 1VQ9A 5ISRA 1C4AA 1RAXA 1CA6A 3VRBB 2JA6G 2BF8B 1PLFA 4IWQA 4M8AA 3M4OB 1M4VA 1HFNA 2MBBB 2RD0A 4HJ8A 1N61A 3QR8A 2R7ZH 5M5YB 3RZOH 1XMQL 2QA4A 3V05A 2F1MA 1WWTA 3P2BA 1VD2A 3HKZE 3SK5A 1T0QC 2KQSA 2BH2A 3J81j 1FNUA 1JMLA 1SYEA 5C4HA 2QDBA 2L00B 2GLSA 3L08A 3ALBA 3SR6A 1T6BX 2MRPA 3GDEA 4MM3B 3AV8A 3PRZA 3TEXA 3Q3OC 3Q8DA 5CBEE 1JJGA 1HRJA 2MCNB 2R92B 3VUXA 2W3RA 2F0KA 4CDCC 3ZKJC 4RMAA 4IUNA 4OONA 1NBWA 3NELA 1KLUD 4HIDA 1A6XA 2JF5A 3FAHA 4HJ5A 2F0MA 1OQQA 2ZNVC 3MXUA 3S1MB 2BVCA 4HDOA 5IT9c 4EQPA 4I6PA 4FJZA 1DOXA 1WJJA 3AE5B 4GKJQ 2UXDL 2F3VA 4HJKA 1W6KA 2D07B 2EKEC 2PW7A 1BDOA 4X66Q 3UDXA 2K9XA 3AE3B 2K03A 4IDIA 3N1YC 2K8CA 3DVNU 1Q90A 1WR6E 3J80c 1EF5A 4ZLTF 1QOHA 2KNBA 3RMHA 4KHPQ 1WGDA 1A2TA 2J0MA 5E1FA 1AN8A 3NK9A 4KSKC 5LL6S 3OOCA 5EKKA 2I38A 5IODA 2R93B 4DV2L 2A6HC 3PIP3 4B08A 2N9EB 2EDGA 1TWAB 3J7A5 3AE1B 3PLUA 1OTRB 4JI5L 3W9CB 3DHGC 3QO2A 3U58A 3V6EB 2N78A 2WNMA 3KUPA 2RCNA 1OFFA 1AYFA 1MI2A 3S24A 5BMIA 2XWBB 2E2IB 1FM0D 2ZTCA 4PZ8A 5D2MB 1EY6A 4RCOA 2OEDA 3DXJC 5IYCG 1BVSA 1TWGB 4KJOA 1H9SA 3VTVA 5IE8A 2JY6A 1HNZL 2KDMA 1QF6A 5M5WH 2BKRB 3UI3A 2XK5A 1ZEQX 1Y1WH 1CHQD 2PI2A 2EY2A 4BOZB 1PFNA 3GO5A 3P7JA 3DBRI 1FFVA 2WDTB 2QCPX 1NENB 2LVQA 3R93A 1RIPA 5EKLA 2JXXA 2QSDA 3FVQA 1HE8A 2WB1E 4FF3A 1WTPA 4HPPA 3TSSA 3U4EG 4R4IA 4OELB 2E5LQ 3D31A 4A20A 4KGTA 4RMFA 3T9LA 4K6DA 2ZEQA 2K39A 4JCVE 1P98A 3FEWX 3MTSA 4DUZL 3DVGY 4G0NB 3TBIB 1Q3LA 2F0GA 1VQKA 4J8QA 1N34L 2Q2UA 1K51A 1GG3A 2WKCA 1KIXA 3KYHC 2VRRB 3DBLB 3Q3JA 4HPLB 2Q2IA 1FXIA 1A70A 4JQWC 4MEMA 2PZWA 2JPHA 5IP9H 1QUQB 1EEFD 2A6EC 4AYBE 1SNQA 5K36G 1K8AC 2KX3A 3DBRB 2N88A 5GXGB 3ZDTA 1GC6A 3CCMA 2Z6BA 4C1NK 3IKJA 5JJIA 2MWSB 3WA0A 3ZTDA 4R4QA 4LK0M 4OVZA 5DPSA 5T8IA 2WS3B 4C4VA 3HRDD 2UUCL 3MHSD 1D5ZC 1WXSA 2R92H 4KK7A 2HIXA 4QUCA 1RTOA 2BOSA 2SEBD 4YY3Q 1J7AA 1ZUD2 5EDSA 4AS1A 5EBCA 3P20A 3DM1A 2A69C 4C3HB 2IYDB 4PS3A 3BJUA 1E10A 3F1ZA 4DXGA 2JE6I 3S1MH 1G91A 3JAMc 1T3QA 2O5JC 1LTTD 3BVMA 3PSIA 1JOQA 1XLQA 5IGBA 3P1MA 2N9XA 1GB1A 1EIHA 3H0GG 4QIWB 2DAFA 3M7GA 1K8GA 2O5IC 3HKSA 3PV0A 4A90A 2KMAA 3BDCA 1T9HA 1EY9A 2L76A 4WJPA 3PF4A 1BMLC 2HHHL 2WU2B 2INDC 1FO4A 1WRIA 4A93B 1V81A 3TRZA 5CGKA 2NPTB 4KKTA 3H94A 4KN7C 4OVUA 4II2B 1SBBB 3EBEA 2F0IA 2BDOA 3I4NG 1SRUA 1B4OA 1MVKA 2EY6A 2JSVX 1T5XD 1CZPA 1TWAH 1UNSA 1HUMA 5I9PA 1N32L 1V6EA 4HJ7A 4J15A 1AARA 2KHJA 5GMVA 2K25A 1TIID 1E1TA 3VHTC 1WTOA 2K1BA 1VQLA 5BR8L 1KL9A 4MGYE 2E2IH 3CD6A 4BY7B 2CJOA 5D7GA 2IY0B 1DOYA 3NHEB 2J0JA 2ZXPA 1VF5C 2JA9A 4JV5L 5BN3A 3WWVA 1XLOA 1U9RA 2BYEA 1EY7A 2C5LC 2Y5BB 4DR6L 2F0HA 1A5RA 1GPXA 5J39A 1E22A 2VZAA 3AI5A 1KNAA 2GBNA 2W3SA 4DDGD 3CRLC 2M2LA 4ME3A 2IWHA 3EROA 1UE1A 2RKSA 1STYA 4DV5Q 3DM3A 3MXPA 1VRAB 2EMTA 1I5FA 1Q1EA 4FVMA 1P9DU 2IHFA 4KV6A 1KC8C 3KYCD 4KZ0A 4H02A 2JSOA 3K0XA 2VUMB 3MFGA 3OTOQ 1Q86C 2INNE 1LLRD 2M4NA 2QCZA 3U2SC 2AEHA 3PRPB 1WM3A 4M01A 2A68D 2JK8A 3B9JA 2ICIA 5C3EG 1A63A 4GLVB 1HXYD 1L5PA 1IGDA 1NYQA 2YTVA 3HRZC 2C60A 3IXSA 3CC7A 3W1SA 1JR0D 4TQ1A 3P4RB 1Q7YC 2R7DA 1ROEA 4FXKC 2G3QB 1XTDA 1K50A 2E2JB 4F88A 1LACA 2XVSA 4JI4Q 2IDYA 2KD0A 3KYDD 3FILA 4C3JB 2LEKA 3HKZG 4B9XA 2QJLA 2YVCA 1EY5A 1NTGA 1V1OA 2LGDA 3M4QA 4KKUA 2HD3A 4ACFA 4PQXA 4A3DH 4IOIE 2D9UA 4C3HH 4DV3Q 3ZNHB 5JZEB 2AHOB 4A3FB 1EEID 2A19A 3S17H 1TKYA 2JUOA 5C1ZA 3DBSA 4DUYL 2ZVOA 4OW0A 1WM2A 2WQYB 1MGSA 4LW1A 5KNCA 5M5XB 2WDVB 1HQMC 4ANUA 3OIPA 2BTEA 2VB3X 3S1QH 3H1UA 1WX7A 4CDDC 3K5OA 3RULA 1WD1A 4GOPB 3KW5B 3ZXVA 1HR0L 1VQCA 2BYVE 3AM9A 2V0GA 3CHBD 1UBIA 5KHQA 2KBNA 1G2TA 3GB1A 5LMUQ 3BS1A 3FKIB 4IUUA 2J7ZA 4ZDVA 5H1SE 2NBUA 4JPBW 4DK6C 2WXKA 2M1MA 1TT5B 3NBHB 2LY7A 3I2ZA 3TMEA 2XEWA 3V60A 3PO3G 2WACA 1F9QA 1PDQA 1WFQA 2K01A 4IURA 1YJWA 3IRBA 3ONSA 4WWMA 1M1KC 4K5VA 5GAHC 2GVBA 2KOXA 1N36Q 3TREA 2UXBL 2BB6A 2YU9B 1UEAB 2FIFA 3OLMD 1N5XA 4DHJD 2BGFA 1KJTA 1TBEA 1X3EA 3BVZA 1WGRA 2VNUD 3S2DB 3NUCA 2IZVB 5C0XG 1Y1VG 5DNFA 3HOYB 3IBEA 2AUJD 5E3FA 2HD5B 1EQVA 2A1AA 4B3TL 1F2LA 1E7UA 4M8MA 1E90A 3DHHC 1B9MA 1F9PA 1Q5WB 4I6NB 4BAXA 5JEAJ 4KDIC 5AZFA 1F2MA 4MZ9A 1EQQA 3TDQA 5J22A 5IYDH 3NS8A 1VQHA 5C3WA 4PMCA 2R7ZG 2RHQB 4YIJA 1CM9A 2RDFA 4QL5A 1J7BA 2MSED 5EE9A 1S5BD 2B2TA 3UQBA 4AQ7A 2MUYA 2HTME 1IL2A 3E56A 3FMCA 2LKVA 4JBJA 4GDLA 4KDLB 4DK3C 3NY5A 2K4KA 1MSGA 3BDLA 3BY4B 1YQ4B 4A3KH 1QZHA 4BBNC 5CV8A 1IBLL 2WU5B 2MBHA 4TKNA 2PYKA 3W5OA 5ELCA 1SMYD 5C3JB 1D8LA 2WXPA 2JT4B 2E2JH 2CQOA 3ERSX 2JXMB 1ZOYB 3KUZA 4XX5A 1Q46A 4H0LC 3LX0A 4C3JH 2DYBA 4UP9A 2QEJC 3I4MB 3D8GA 2BQQA 3EN2A 5C2TB 3TP6A 4ZRIA 4DWFA 1XCTL 4A3LG 3U7ZA 3MTNB 2CU1A 2MFIA 2CH4A 4BS9A 1ONLA 2MHJA 4NQLB 3RFZB 3S16B 1C78A 5KYLA 5M5XH 2IGGA 3HS0C 3NVVA 1L4DB 3NP8A 3ZIMA 3JW0X 2B2YA 3ABVB 5BYRA 2J4XA 1G8ZD 1RL2A 2HJ1A 3Q0AA 3OPOA 2KXJA 2B63H 3GE8C 4MH8A 2MP2A 5JHAA 4EZKA 1Q82C 2I07B 2BT6A 3W2DA 4X3UA 1PH3A 1JOOA 4X62L 1E8YA 2KC2A 2FCSA 4LJPB 4POFA 4HKQA 1SYCA 4X65Q 3OJ4B 4B9WA 4JYAQ 1CQVA 4AIMA 3EFUA 4KY5A 4HPMB 1EUVB 4E3CA 2CJNA 4YTPB 4A3OA 4UDUC 5KNDA 1PYBA 2ID0A 4X57B 3NS1A 1GB4A 4QY7A 4YTNB 1QUQA 4RWSC 1UUPA 3E6ZX 4DR2Q 3HOYH 2NVYB 2GA4B 2KT7A 1KABA 1PXUA 1W2BA 2G4DB 1BNZA 5ELFA 1U5KA 2OXPA 4K3CA 2IGHA 2Z0DB 5JEAH 3RYTA 1S72A 4NJ6A 4OGQC 1KDAA 3ER0A 3NPPA 1JWUD 3P4SB 5T1IA 3H09A 3Q24A 1PRTF 3CCJA 1DCZA 4GN1A 3IT6B 2DAJA 2MA9B 1QCBD 1ET6A 4WORA 4JI3Q 5IP9G 3T53B 2L7RA 1STBA 1PHJA 4K81A 2KYWA 4GS3A 3SK6A 3L16A 4IW0A 3GTPH 1S40A 3K9PB 1WZ3A 4KVGB 3JSVB 1WTRA 4BBSB 2GBKA 2LWPA 4OZCA 2R92G 1WJ6A 2L0TA 1WCMB 1HNWQ 1E5WA 3ITPA 3HOZH 2D5GA 1CTMA 3G48A 1IBXB 4NQKE 4ANXA 4N8X1 4YCUA 2UUAQ 2NMQA 4ALPA 1UEBA 1ZXTA 1O7IA 3P4QB 3DLLA 4BA2I 3NJTA 5KGUA 1EM7A 3PIOA 1EL0A 2NPTA 3ZLZA 4LF4L 3S1NH 1QKZA 3ZRFA 1NI3A 3DWPA 2NTTA 5COYA 3LWEA 2A5UA 4JBMA 2Q8TA 4DK0A 3E3XA 4X3TA 4WWNA 4ARIA 3EECA 3I4MH 2WP9B 3BK1A 1ZYRD 2FMCA 1VCIA 3HG9A 4PG3A 1PTOF 2V4LA 2GVAA 5IWAQ 1Y8PB 3WOFA 3L17A 3G4SA 2I0QA 2KOLA 5GAGC 2K3UA 4TMAB 4ZQ3A 2EZVA 3S16H 3HOWH 1K8OA 1HTOA 2KQ7A 3FHWA 3TEHB 3K58A 2JWUA 4KD3A 3U7DA 3M85A 3AEVA 4MNOA 1EY4A 1KH0A 1I4XA 4UHVA 1PV4A 3STBD 2LJIA 3B2FA 1CFMA 3AMUA 1EYDA 1AW7A 5ELNA 4XDCA 3ZJTA 3ONAB 1IBKQ 4LFCL 1C4CA 2ZJRA 2MJDA 4FF2A 2KDIA 1VQAA 4DXAB 2VQFL 4OEMB 4W9LA 2GOWA 2B2UA 3EVQA 1HNXL 1E7PB 3PUYA 4ZRJA 2ASBA 2NVTB 2LGYA 3WDNA 4NXML 4II3B 5IOIA 4WJOA 1STNA 3T1HQ 4K0KQ 4PNYA 5BN4A 1JROA 1AH9A 4DR5L 2D3CA 3FDTA 4PV1C 2D62A 2F0LA 4GU2A 4DV4L 5KNBA 1TVXA 2KA7A 3CKIB 3G7LA 2N9KA 1EIYB 1VR9A 1E8WA 1QVCA 1QNUA 1C9OA 2R3ZA 1C0AA 1L0VB 1PVOA 2J0KA 3EUB2 1O7YA 3BDOA 1ZPSA 3B08A 3SR1A 1QOFA 2XTIA 1EFWA 1XNQQ 5E6JA 3SHQA 5D3IB 2NVYH 4P71A 3AEAB 4K7UA 4IOCA 1CMXB 4IPHA 2RPVA 3M3YB 1H4RA 4W9FA 1LTLA 4WJQA 4EQOA 4HIMA 3QOJA 4HLEA 3CXCA 1R4QB 4L5RC 1IGCA 1J8IA 1UE6A 2LUMA 2IO3B 2WXJA 5IO9A 4DU9A 2JA5H 1VQEA 3PHWB 2PNHA 2DZIA 4ZKCB 4LK1C 4I65A 4PS8A 4OWXB 3AEEB 4POGA 1E3PA 3MC9A 2ONQA 2QILA 5JVG3 5AEKB 5C4JB 2AWTA 1LUZA 1R4PB 2UU9Q 2WX1A 4JOIA 1YN3A 1ZKHA 3G6EA 1V43A 2F52A 4GKJL 3BIID 4YL8A 2B2WA 1EQTA 1FYCA 1RTNA 3F8TA 4DV1L 4X66L 2LGSA 4A3DG 4P7IA 2G9DA 4C3HG 2I5HA 4LF6Q 4QAYA 2JN4A 2ZXOA 3J7AF 5FO9B 4DV6L 4KHPL 4DV7Q 2VZKD 3NBHA 4WQOB 2CH4W 3PIO3 2A6HD 1EZ8A 4J1MA 1YQ3B 2MQJA 5CC4A 2RMMA 2F0FA 2H88B 5K5PA 4IUQA 5IIFA 5J2RA 5D6JB 3KF8B 2WINB 4OVVA 3VFKA 2LHEA 1KD1C 5M9OA 3CAMA 2C7NB 3N9YC 3E0EA 2KEEA 2PPBC 4K5XA 4LUVA 4APVA 1D1IA 4ID6A 3K8AA 4LNKA 3Q3FA 2JEAI 4TSSA 4L2YA 1SSOA 1WTHA 1Q8IA 2FXQA 2H89B 2ZPYA 3NVYA 1V1PA 1CSPA 4A3PA 3GV3A 2EQSA 2VS1A 3GTGH 1D5MC 5EKIA 4JVZA 4TUUA 3HM3A 4GGQA 1BCPC 2JZZA 2WGSA 1XEEA 1NR2A 4OIJA 4PMBA 3K0YA 2NVTH 3DQVA 3RN2A 3GZNB 4BY7G 4DNTB 1K8RB 5EBDA 1J7CA 4PYUA 2M56B 4O0AA 1XPUA 2G5DA 4K7WA 1LT4D 1F1HA 1L1OC 3SFEB 5M3FB 4GN3B 5TSSA 3PVLA 1LTID 2L3ZA 4BOSC 2N49A 5IYDG 1OEYJ 3TZUA 1TY0A 2KJ6A 3GTKH 1X6OA 4KKSA 2SNSA 2A6ED 4GNXA 1YNXA 2GI9A 3H3VH 3PIPA 1R4MI 3W1SC 3W5VB 1Y56A 1TKWB 1VQIA 3P75A 4RG1A 2INPE 4ULLA 4XYQA 2OTLA 2GBJA 2O2VA 3FILB 3ZNGC 1FR3A 1Q1OA 4KI0A 2E75C 3FKYA 4B95A 3A33B 1EOVA 3I63C 1II3A 1Y14B 4X6AH 2ATWA 1V80A 4HCEA 1MKHA 1BO0A 5I6YA 2K5DA 1XNRL 1YJIA 2GB1A 4MGKE 4CHKA 4CO7A 1E0ZA 2N9PC 1X3GA 2A69D 4YY3L 2FMMA 4L5QA 3T16A 3QIAA 4KSLC 4WJNA 2RA4A 3ND8A 4I7ZC 3VA5A 4FDBA 1R4NI 1YOVB 2LI5A 5C4JH 4UY8C 2JRIB 2H1EA 2E3TA 3I3TB 4M8NA 1VQNA 1ENFA 1CK1A 1QVFA 4FHKA 4C3JG 1HUNA 1R4MB 5E7NA 2PZUA 3QARA 1CJEA 4NY0A 4L63B 1PZID 2CHBD 2I5LX 2BS4B 4J6HA 3A1QA 3EC8A 5IA7A 3CQZH 2PI2E 3K5LA 2V4IB 1Z7TA 1RCVD 3KJOA 1PRTB 4USAA 2KHSA 1B7YB 4IPGA 5ELEA 4LF5L 4LFBL 2K6AA 1TGZB 4GDKB 1SIJA 2L05A 4B3MQ 2KCMA 1PZKD 3QOLA 1CKNA 4ZUIA 1C1YB 4DAMA 5E4WC 4DFAA 1R4NB 4DR7Q 2F0OA 4IM3A 4ZK9B 3C3LA 4ZRQA 2B63G 3AH7A 1HZ9A 2FAZA 5EPKA 1MG8A 4ARCA 2KLCA 4N6EB 1A62A 3S2HB 1VJKA 2HE7A 2L8JA 2ZTEA 3EGRA 1C79A 3J7ZC 5IT9E 4OX9L 5LMNW 4CJ0B 2N7EA 4JI8Q 3CSFA 4RKLA 3CMEA 1A8VA 3T3NA 2BE5C 2CQAA 2EJMA 1VQ8A 1H9MA 1ZE3D 4P73A 4RFBA 4ICUA 1GUAB 4IJLA 3GP7A 1AP0A 2VL6A 3N6RA 4L5TA 5LL6X 1G51A 1PTOB 3MP9A 3J80E 3HOYG 3VAWA 3UDGA 4GDLB 3VYUA 2KCNA 3CU7A 4W9HA 3PO2H 2JA7H 4BWGB 4B0EA 1L0YB 1LT6D 2JP1A 5FLXc 3KJPA 1FJGL 4G7ZC 4DV0Q 4GN5A 3E0JA 1STAA 5JEAG 1SR3A 4FXDA 3JSVA 4NJCA 3AE7B 3BVGA 4A3LH 3RNCC 3HOXB 4YSXB 1BF4A 1IBXA 3FPUB 3UQAA 1QILA 4JWUC 4MHEA 1GUSA 3CCVA 1WVLA 1F2YA 1WX9A 2I1JA 4I7AA 3OIQA 2YV5A 3VTUA 2ZM6L 4BKGA 2KO3A 4U68A 2MBQA 3PUVA 1E2WA 1GC7A 3DCGA 3ULLA 2D2QA 3GTQB 2X6GA 1PH1A 1UBQA 5IOCA 1EWYC 2F4VQ 3A9JA 2MW5A 3HOZG 1AE3A 1STEA 5IT9L 4AQYQ 1VQ5A 2B2VA 1RF2D 1STHA 3ZXRA 3I56A 3DBLI 1XLNA 1X1MA 3M3JA 4HVBA 1QJOA 1XO3A 3R7RA 4DV3L 1I4PA 1UAPA 4TV3A 2AWNA 5EPJA 1WYDA 1WJUA 3I55A 4GLAC 3IFDA 3I4LA 3J80L 3IAYA 4DKAC 1FD7D 2XNAC 3I4MG 4IPDA 2B2YC 2KVRA 4DF7A 4A3JH 4GKKQ 3AN1A 2L4NA 2MP2B 1JALA 3OAWA 4ZYSA 2NVQB 2F0NA 2ICEC 4IG7B 3B2GA 4YWGG 4G7OC 1LM0A 1P16A 1X56A 1JORA 3QAQA 3X3NA 3CCSA 3HOWG 3L9AX 1V9JA 3VH4B 2PO4A 1ESRA 1EFID 2YTXA 4R1JA 2ENBA 3DWQA 1B3AA 4W9CA 2N4FA 4C3IB 1NJIC 3VR4A 4BBNF 3AE6B 1O78A 2MP1A 3M4OH 2BW2A 1EU3A 4R4CA 5M5YH 3E9SA 2F4IA 3X3MA 1WE6A 1LV9A 3CIRB 3I5JC 5EE3A 2NS5A 4DPGA 1N36L 2QEXA 5FOBB 2N8NA 1NE3A 2EYFA 3S2HH 2DNFA 1N9WA 2LGIA 1JWBD 3U50C 1S3OA 4TQUS 2L32A 1F77A 2EYOA 1XF5L 3RNFC 1X3FA 3MVVA 1JE4A 4KTAA 3JAME 3T1YQ 5DPRA 2KVZA 2B8FA 2NCNA 2JVCA 4CJ1B 4GIVA 1E6EB 1N8RC 1V8QA 2YEPF 4EX5A 1OXTA 3K80C 4A3GB 4LCDE 1I4RA 1TWFB 1O7LA 2EE1A 3AE8B 4A3BH 1KF6B 1RKNA 3O13A 2Z9HA 5M3MB 1FIQA 2L1AA 2K14A 2KJHB 2W55A 4WJWA 1I3QB 2MGSA 3ZVVA 4CKCA 3GTMB 4C2MB 4OXPA 2OHFA 2XN9C 3RLNA 4N9TA 1S5DD 3HOXH 1N33L 3PPAA 2LHDA 1E7ZA 3C0RB 4FBJB 2JA5G 3I3CA 3AU7A 1F2RI 1K3RA 3C1FA 3NRZA 1O80A 1PA6A 4JI7Q 4JI0Q 3SEBA 5J3BA 2R93H 2JYTA 4HCNB 3H8HA 2N0SB 3TEZA 2B39A 4LMQD 1E0BA 1F9JA 3B6YA 1SLJA 1SNOA 4KJNA 2UUBL 2B3AA 2D0OA 4NAWB 2D0PA 3FRPB 1PH5A 1WI5A 1PUTA 1LT5D 3J7YW 2KJRA 2LGXA 1YBYA 4BBSG 3U30A 1GO3E 2MJEA 1ENCA 3QJZA 2WAQE 4B3SL 1WX8A 3JAML 2FBWB 5L83A 3SHLA 4DHZB 1DOMA 1X55A 3KF8A 3K7AB 1EIFA 4WRDA 1ZDXA 2IX0A 4JX1C 4FF4A 1H8CA 2V9HA 2F0QA 4JW0A 3MXGA 4W9GA 1EU4A 1TWGH 3D32A 2L1BA 4WFN3 4ZUJA 2LXJA 1WGGA 2NVXB 2JA8B 1ZXIA 5DM73 1BXTA 5KRUA 1NYRA 1MHHE 3TP7A 2ZT9C 1XMQQ 2M0AA 3TEYA 4JI2Q 3T3OA 4DNRB 4JI6Q 1B50A 2WYQA 2Z4IA 3GQBA
chains in the Genus database with same CATH topology
1AFPA 1G2SA 4OL7A 2O2LD 3OMCA 1A3UA 2FHTA 4RA8A 3C46A 2EJFC 3KBXA 4TRDA 2WLBA 1D5XC 2KAJA 4HJGE 2KACA 1GUNA 1C9FA 3T13A 2F3WA 1XYIA 2WXFA 4O1NA 3I90A 5LHY1 3QWNA 1LTGD 2JYOA 3K59A 1DD2A 4R3DA 5I6WA 2DBYA 4A3MB 3MZ5A 1VLBA 4YXDB 1MD2D 3LXFA 4CKBA 1CZGA 1AWDA 3VQIA 2Z4HA 1F9SA 1FGBD 3ND9A 1TS3A 1VZ8A 1K83B 3KWLA 1RODA 1TY2A 4NP5A 3S9WA 2WXGA 2PMZB 1MHXA 3I57A 3HOUB 1DOLA 1JB3A 1RJTA 2BBCA 2B2WC 2FINB 2Y0SB 3VR8B 2F0WA 1PYWD 1IHZA 1SYGA 1KAAA 2WXLA 3ZYYX 3LYYA 1BOSA 4CHTB 1DOIA 1D1KA 3A7AB 1TWHB 2D5DA 4Y7NB 2JA6B 2N7JA 3HZXA 2OF1A 1PMRA 2F0VA 1U4RA 1GHKA 3GTJB 2Y3AA 2L83A 1B1ZA 2LFNA 3J81E 3SVMA 1A3TA 2SDFA 1JWAD 4HSVA 2AQ2B 1V1PB 3AEDB 1ZKOA 5DAUA 1BUIC 4F7XA 1K53A 4R8NA 4A9AA 3VYRA 1FCCC 2KWDA 1I6VC 4HKZE 1OXSC 3PMFA 4HEDA 2K05A 1TZOA 1JRPA 2AQ1B 4US9A 3F2UA 1D4BA 3NQIA 2IX3A 3OWEB 5EGTA 4IQZA 1AZPA 3C8YA 1FCLA 1IW7C 4MIUA 3LB8C 4XDDA 2V3NA 1FXAA 2M00A 2NUCA 2MEKA 2AUKA 3H91A 2E74C 5CMDA 1QOAA 3QJYA 4DXFA 2EKIA 2IJ0A 2JU6X 1CQFA 1LTAD 5D3DA 1QLBB 1S5ED 3ZJVA 1ML0D 3PUZA 1SB3C 2PVOD 2Q8IB 4DGZA 3NUHB 5G3LD 1NAPA 1GUOA 4OO1H 2IL8A 1HPCA 1IKMA 3KQ4A 4JPSA 1SFOB 5EPLA 1SE2A 1VDVA 3NTHA 4N9PA 2JXTA 2EY5A 5BN5A 1I4GA 4HTHA 4XTCS 4FXCA 1R7SA 4WURA 3J7AV 2E6XA 2E76C 3QG1A 1SNCA 2WXNA 4RF1A 2YEPB 2KECA 2ON8A 4US8A 4WAFA 1EY0A 1Q10A 3D6WA 3NZ3A 2Y5PA 1G291 4KGSA 4C80A 3CWIA 1Q12A 1QNKA 2PVGC 4XDXA 2BYTA 2I2YA 3GTLB 3RD4A 1YNJC 1TYGB 1H9RA 1YMHE 4CQNA 4F87A 1OQRA 2NYZD 3W3AA 3SDZA 1SNMA 2JZPA 1ZP0B 1BCPD 4EE2A 5JOBA 2OT2A 3VYTA 1HTPA 2RQXA 3LNNA 4A55A 1RHPA 2PTLA 2EJGC 2IW3A 4HN7A 4K5WA 1LTBD 1CZWA 4RH6A 2B8GA 3GTOB 5D14A 4CBVA 3K5MA 3KWVA 4K2LA 1W6JA 3R8BA 4XE0A 5JAVA 4R9WA 1WTVA 1QT9A 3VR2A 3I4NB 1I7HA 4WH4A 3NVZA 2AQ3B 1HEZE 2CW0C 3I9V1 4XT3B 4RAUC 3SK8A 2EXZA 1DZ1A 2M9VA 1TWCB 1A2UA 1QOBA 2B2VC 2HQEA 1C4PA 1SJED 1JQ4A 1Z6HA 2JEBI 5LNK1 1A3VA 2ZXRA 1I50B 1JWMD 1SXTA 4H2AA 4C1NI 4YSZB 4NZLB 3AE2B 2SNMA 2A5HA 3AB5A 4KY6A 2RBMA 2BB5A 3E5SA 2ZW1A 1WSPA 1GJXA 4OIKA 3VYSA 3VR5A 2G9HD 2N9LA 5C3EB 2BCOA 4TKOB 1XTCD 1HZ6A 5DEHA 1ENAA 3D6CA 2KN4A 1EIGA 4ITKA 3H3VC 4C3IG 1EWHA 5C3XA 4C7YA 1C8CA 2KVMA 4LTUA 2BE5D 4L1BA 2EY1A 1ET9A 3R2TA 1NUCA 1WGKA 1XXGA 2E2HB 1TQOA 2EYLA 3RLFA 5AUIA 1XCQL 5IGCA 3I91A 2EOTA 5D65A 3HP3A 4N58A 1ESFA 2WDQB 5CV9A 4FO2A 3EJIA 1F0ZA 3MXNA 4ZAIA 1PZJD 5BMHA 1RYJA 2IGDA 2EYHA 1SYDA 4P6VF 3PO3B 1JWSD 4ZHPA 4DQOC 3NBIA 5CV4A 4FYDA 1BUVT 3HUIA 3FC4A 1B9RA 2DYOA 1HHVA 4FXGC 3DMUA 5IGGA 4A3EB 4KX6B 1ZDVA 3PO0A 4G57A 4KKJA 3D4RA 3K6OA 4KY7A 5I9OA 3KLSX 3ZJUA 2NBFA 1IKLA 3NTKA 1TU2B 3ZQ4A 2L55A 1TKEA 1R9TB 1PDXA 1J9OA 1ILPA 2PW5A 3NVWA 5NUCA 5I4DA 2WXQA 5E4XA 2WB1B 1GOZA 2XRQD 5C6AA 3IAM1 3Q8CA 1JQYD 2MPMA 4ILWA 5G5HA 3SXHA 1SEBD 2LS01 3TUOA 3U9OA 5JPMC 3Q22A 1DOKA 4HR7B 1DGJA 3TZDA 5IGEA 4AYBB 1U4PA 1UWMA 4JE3B 4HSPA 2K33A 1L6VA 5ELBA 4XQJA 2WP8J 1N60A 1IYUA 3L7ZC 2EYPA 2F0JA 3G6JB 3MC0B 4K8JA 1U4MA 3RPFC 4OO1G 3OMGA 3T4AC 4X3SA 4ZKBB 1EZ6A 2JQRB 4OHJA 1PRTC 2PLPA 1TS2A 3BK2A 2KEDA 5A2QE 3VR3A 2HDEA 4XT1B 5MPOA 1DM0B 1Y1WB 4CKEA 4M1UB 3NE5B 2A73B 5HG2A 3V2TA 1SNDA 4G4KA 3HOVB 1HQRD 2EELA 4L6TB 1DYQA 2RVLA 5FO7B 4IN3A 4JWSC 1HZ5A 1FD6A 1Q1BA 5C5LA 2DNCA 2K0PA 4EGVA 2NN6I 2IX1A 5FLXE 3TP5A 1N62A 1I6HB 1AEXA 2QKIC 4C56C 4WWMA 5AFWA 2B2TC 1ICWA 2L5TA 1PTOC 3Q6SA 1A15A 4Q5VA 2O4XA 3NTIA 3AECB 1KFYB 5IGFA 3U9SA 2EYMA 1E2ZA 5A2QL 4QMGA 2ACZB 2WXIA 2SOBA 3S15B 1B2TA 4L8JA 1S4ZA 4BY1B 2CU3A 1B44D 4ME5A 2DY7A 3OW7A 3U52E 5CV7A 5HGTA 4D2KA 2X69A 3SK4A 3T56B 5FK9C 1MPEA 5T1GA 1VDZA 2VZKB 2I46A 5FLXL 1C4QA 4DAVA 4REZA 3IAS1 4RGNA 4RGMA 3MAQA 3Q69A 5EQ0A 2WKDA 2RDHA 1FRRA 2AWOA 2NB0A 2K5WA 2PW9A 5CV6A 2MJ8A 4IUTA 3BYYB 1IL8A 3MHBA 1SYFA 4GZYC 2K5PA 3PUXA 3P42A 1D2BA 4UAIA 1WTQA 2J53A 2Y5CA 2L0CA 4JBWA 3J9CA 1XX8A 3BWUD 2QIEB 5BMGA 1KDBA 1C76A 2F0SA 1JOKA 4X3KA 2VB2X 4H13C 3EFXD 3NSWA 1CA5A 1RDPD 1YN5A 2K5QA 2F0DA 3QB3A 2KMMA 1PTOH 3BG3A 1DJRD 2Q5WD 2YYZA 5BYSA 1C48A 4Z9CB 2FFKB 1IW7D 3LWUA 4A3BB 2WXMA 1NR4A 3A54A 4FP5D 2BS3B 2CVRA 3AEFB 5EE0A 4A8XC 2B76B 4NAMA 1YN4A 3IT4B 4MT5A 1UGJA 3EA6A 1L6UA 1LTSD 5C4XB 4A3DB 1Y8NB 1S5FD 4QB4A 1P7EA 2NN6H 3S17B 3EQLC 2PMVA 4CJ2C 4M0WA 4IUPA 3S1QB 4KKIA 3DEPA 2C9OA 1L0XB 1HA6A 3URYA 1HA5A 3SFDB 2BA0A 3PUWA 3R3OA 4XQNA 1H9KA 2A74C 2MJ3A 2DLBA 1YNNC 3K57A 3R2IA 2L11A 5HI1A 5FO8B 1F2RC 1YJJA 1HFGA 5EE1A 3K5NA 2L9HA 3ERQA 1XLPA 2B2UC 3I72A 3KBGA 1Y69U 2F0EA 4DAYA 1HTLD 4OO1I 3A56A 3I70A 5KYIA 4HEA1 2KJXA 4J3OD 4EVOA 4MN3A 2V3PA 2WV6D 1SAPA 4RHSA 4XIGS 4GLSC 4YT0B 5CR3A 2MH7A 1YNJD 4IFDI 1X3QA 4DK1A 1I4QA 1LO5D 5ELDA 1IUEA 1SSNA 1GXDC 2RSNA 4NKLA 3MFYA 4A3KB 2K22A 2F0PA 2R61A 4RCNA 2PNRC 4BBRB 3CRKC 1BBXC 1VMCA 4OZBA 4DN4M 2DWQA 2D2CC 4S3SA 1DXMA 1O7ZA 1D6EC 3I73A 2SAKA 4IFDJ 5C44B 1GHJA 4A3IB 4A6QA 4Q0FA 1NVID 1V8CA 4L23A 2IPKD 1EOTA 4N59A 4HAEA 2CW0D 2KQ3A 4RF0A 2NTSA 2TMPA 1Y8OB 4RNAA 4KD4A 2B63B 4KHVA 4RGTA 3A55A 1GUTA 2L52A 1JW9D 1QWYA 3Q8EA 5G3LF 1LTRD 4YTMB 5HFYA 1EWCA 3L4PA 3V3XA 3WCQA 4BA1I 5H92C 2QMTA 4MACA 1KLGD 3PZ7A 1PFDA 5G5GA 2WXRA 1EYCA 4WQMA 1T5EA 4FNFA 3A8KE 2WDRB 4HRSA 2PCFB 3A8JE 3DWAA 1STGA 1ZXHA 1JCKB 2EVBA 3M4YA 4NW2A 2EYJA 5H8YE 2FUG1 1UWXA 1B9NA 3AEBB 5JPNC 1IYVA 1SE3A 4OZAA 2K32A 2PKOA 2WIIB 1N5WA 3WOEA 2BDNA 4IZ8A 3I8ZA 5JJZA 5EJWA 3J81L 1LT3D 1GUWA 4KN4C 3GTPB 1E9MA 3NXWA 3AE9B 4RHRA 1WXQA 5C4ZA 1DONA 3GS2A 5KEEA 1OXVA 4WIPA 3HOZB 3NWSA 1AZQA 1ACCA 3TN2A 2KQ4X 4ZHOA 2LMCB 2K7VA 1N63A 1BCPF 1YNTE 3S1NB 4K14A 1VF7A 2BA1A 3C1EA 3AMZA 2TSSA 4LLGM 1TKGA 3DEOA 1GUGA 1PFBA 2HUGA 1Z47A 4IFDH 2HDMA 2HDLA 1F9RA 1K8MA 4RKBA 1OXUA 3PZ8A 3HOWB 1VZ7A 2J42A 4QCLA 1XWEA 1WYGA 1ILQA 2M19A 4R8IA 4C7ZA 1SE4A 2W54A 1CT1D 4HMJA 1NEKB 2Z8LA 1QOGA 1SJHD 3BYTB 1PGBA 3HVDA 2EPBA 3UI2A 3IL8A 3SE0A 1K52A 2J0TD 5CORA 2A68C 3P63A 1SF0A 4G7HC 3KLSA 3HVZA 1C77A 2WXHA 1KNEA 1TT2A 5CBAE 2HCCA 3HGBA 3P1HA 4ZRZA 2J52A 1U4LA 1M8AA 3H0GB 1VMPA 3RZDB 3S1RB 3GD7A 1SDFA 4KMUC 1I4HA 2JA5B 5HHDG 2OEOA 2NZ1D 1V97A 4XQQA 3OWFA 2BS2B 3Q8AA 2JYEA 1BR9A 2FE8A 1JC7A 2K04A 4QUFA 3S14B 2ZW0A 1KDCA 1JICA 2LFIA 2G1EA 4ZOHC 2NN6G 4FF1A 3AE4B 5DM63 2L12A 4HCSA 2R6GA 3DWGC 4XWWA 3IFTA 4K2KA 1QE6A 1OO9B 2IT1A 2Q8RE 2X6LA 4O42A 1QB5D 4P2CB 4H7BA 2H4OA 1WTWA 1P7FA 2DNEA 3HEJA 1HCZA 2DY8A 2DYMA 4B0MA 3MWYW 2K28A 2E2DC 1H9SB 2WXOA 3W5UB 1PRTD 2NWGA 4H44C 1PGXA 4PMWA 1GAQB 1RFKA 1E2VA 2W82A 3MJ5A 4EQNA 1PFMA 3GTGB 2QF7A 4P16A 1TS5A 2XIWA 2GRIA 1EY8A 5K36H 4CGYB 5KIXA 3RUZA 4LAAA 1G6ZA 1X3PA 2F0TA 2KUMA 4LJZC 1PGAA 1TS4A 1OXXK 3HKZB 5CYUA 1FMAD 1FEHA 2N55A 4E6IA 4K8IA 3M7NA 4QF4A 4RGOS 1KTKA 1B53A 3AB9A 1RWSA 1SMYC 1CI3M 3GTKB 4XWTA 4XXEA 4IKGA 1PTOD 3D4DA 4JK1C 2DN8A 2FJ2A 3AEGB 5A35A 5C0XI 3VA7A 1S5CD 2PQEA 3C2PA 2Z1CA 1QG7A 3OSOA 3Q23A 3NHHA 3GV6A 3A8IE 4ZRPA 2C5CA 3TP8A 4IUVA 5I2YA 1TR5A 3VR9B 3FPPA 1TJEA 3H6MA 3CQZB 2VXWA 3MA2B 1F2ZA 1WTXA 3L3OC 4DA2A 5C0XJ 4TQ0A 1Y1VB 5CV5A 1LABA 2RSOA 3NWTA 4F8MA 1FRDA 1L4ZB 4HROA 4HMIA 1FFUA 1SNPA 3A7LA 3MHZA 3ETRA 3KK7A 1NCVA 3D3RA 1CHPD 1FNWA 2AX5A 1SYBA 2R7ZB 3RZOB 3P4PB 4PT5A 5BYQA 2JX5A 4YSYB 3V96A 3NQTA 3KLRA 5JVH3 4V190 4ABNA 1VZ6A 1BCPB 4KGRA 3T51B 4KHZA 3ZGZA 2F03A 2V4DA 2XRSD 5F2DA 3N52A 3PO2B 3Q8FA 2JA7B 3OHXC 3Q8BA 2RDGA 3BZDB 4V0BA 1RD9D 5HURA 5C5MA 1MBYA 3DWMA 4K6LA 2LMCA 2F0UA 2PZTA 5J1ZA 1BQQT 1MSHA 4ODGA 2PIAA 3TEWA 1X32A 3VR6A 1EYAA 3DUZA 2HCIA 1ZYRC 3D4WA 2XWJB 1KRHA 4NMZA 4Q2JA 3VRAB 1H9JA 3MEHA 5FR3A 2KCCA 5FKAC 2X38A 1RM6C 5IGDA 1MI0A 4NDXA 5M5WB 5AUKA 1WD0A 4XYOA 5JXVA 5I2XA 4A3JB 4IFDG 1NSNS 4DAPA 1QQRA 5C0XH 1YNND 1FNVA 2XSCA 2MHVA 4U673 3DHQA 2WAQB 4IALA 5ISRA 1C4AA 3VRBB 1CA6A 1PLFA 4M8AA 3M4OB 1M4VA 1HFNA 1N61A 5M5YB 3V05A 2F1MA 1WWTA 3SK5A 1JMLA 1FNUA 1SYEA 5C4HA 2QDBA 3SR6A 1T6BX 4MM3B 3TEXA 3AV8A 5CBEE 1HRJA 2R92B 2W3RA 2F0KA 4IUNA 1KLUD 1A6XA 3FAHA 2F0MA 1OQQA 3MXUA 3S1MB 4EQPA 1DOXA 3AE5B 2F3VA 1W6KA 2PW7A 1BDOA 2K9XA 3AE3B 4IDIA 2K03A 1Q90A 4ZLTF 1QOHA 3RMHA 1A2TA 5E1FA 1AN8A 3NK9A 5LL6S 3OOCA 5EKKA 2I38A 5IODA 2R93B 2A6HC 3PIP3 4B08A 2EDGA 1TWAB 3AE1B 3W9CB 3QO2A 2WNMA 3KUPA 1OFFA 1AYFA 1MI2A 5BMIA 2XWBB 2E2IB 1FM0D 1EY6A 4RCOA 2OEDA 3DXJC 1TWGB 4KJOA 1H9SA 2KDMA 1QF6A 3UI3A 1ZEQX 1CHQD 2EY2A 1PFNA 3GO5A 3P7JA 1FFVA 2QCPX 1NENB 3R93A 5EKLA 2QSDA 3FVQA 4FF3A 1WTPA 3TSSA 3U4EG 3D31A 4KGTA 4K6DA 3FEWX 3MTSA 3TBIB 1Q3LA 2F0GA 4J8QA 1K51A 2WKCA 1FXIA 1A70A 2PZWA 1EEFD 2A6EC 5K36G 1SNQA 2N88A 5GXGB 4C1NK 3IKJA 4LK0M 4OVZA 5T8IA 2WS3B 3HRDD 1D5ZC 4KK7A 4QUCA 1RTOA 2BOSA 2SEBD 1J7AA 1ZUD2 4AS1A 5EBCA 3P20A 3DM1A 2A69C 4C3HB 1E10A 1G91A 4DXGA 2JE6I 1T3QA 2O5JC 1LTTD 3BVMA 1JOQA 1XLQA 3P1MA 5IGBA 1GB1A 1EIHA 4QIWB 3M7GA 2O5IC 3PV0A 4A90A 3BDCA 1EY9A 1BMLC 2WU2B 1FO4A 1WRIA 4A93B 5CGKA 4KKTA 3H94A 4KN7C 1SBBB 2F0IA 2BDOA 1B4OA 1MVKA 2EY6A 2JSVX 1T5XD 1CZPA 5I9PA 1UNSA 1HUMA 1TIID 1WTOA 2K1BA 4BY7B 2CJOA 5D7GA 1DOYA 2ZXPA 1VF5C 5BN3A 1XLOA 1GPXA 1U9RA 1EY7A 2F0HA 5J39A 1KNAA 2W3SA 3CRLC 2M2LA 2IWHA 3EROA 2RKSA 1STYA 3MXPA 1VRAB 1Q1EA 4FVMA 4KV6A 2JSOA 2VUMB 3MFGA 2INNE 1LLRD 3U2SC 2A68D 3B9JA 2ICIA 1HXYD 1L5PA 1IGDA 1NYQA 3HRZC 3IXSA 3W1SA 1JR0D 4TQ1A 3P4RB 1ROEA 4FXKC 1K50A 2E2JB 4F88A 1LACA 2XVSA 2IDYA 3FILA 4C3JB 2LEKA 4B9XA 2QJLA 1EY5A 1V1OA 4KKUA 4PQXA 4IOIE 2D9UA 4A3FB 1EEID 1TKYA 4OW0A 2WQYB 1MGSA 5KNCA 5M5XB 2WDVB 2BTEA 1HQMC 3OIPA 2VB3X 3K5OA 1WD1A 3AM9A 2V0GA 3CHBD 3GB1A 1G2TA 3BS1A 3FKIB 4IUUA 2J7ZA 2WXKA 2LY7A 3TMEA 2WACA 1F9QA 1PDQA 2K01A 4IURA 4K5VA 2BB6A 2YU9B 1UEAB 1N5XA 3BVZA 2VNUD 3S2DB 3NUCA 5C0XG 5DNFA 3HOYB 2AUJD 5E3FA 1EQVA 1F2LA 1B9MA 1F9PA 5JEAJ 1F2MA 3TDQA 5J22A 5C3WA 4PMCA 4YIJA 1CM9A 2RDFA 1J7BA 5EE9A 1S5BD 2B2TA 4AQ7A 2MUYA 2HTME 3E56A 3FMCA 2LKVA 1MSGA 3BDLA 1YQ4B 5CV8A 2WU5B 2PYKA 5ELCA 1SMYD 5C3JB 2WXPA 2JXMB 1ZOYB 4H0LC 3LX0A 2QEJC 3I4MB 3D8GA 5C2TB 3TP6A 1XCTL 3U7ZA 4BS9A 1ONLA 3RFZB 3S16B 1C78A 5KYLA 2IGGA 3HS0C 3NVVA 1L4DB 3NP8A 2B2YA 3ABVB 5BYRA 2J4XA 1G8ZD 3Q0AA 3OPOA 4MH8A 2I07B 2BT6A 3W2DA 4X3UA 1JOOA 4HKQA 1SYCA 4B9WA 1CQVA 4KY5A 2CJNA 4YTPB 4UDUC 5KNDA 1GB4A 2ID0A 3NS1A 4YTNB 4RWSC 1UUPA 3E6ZX 2NVYB 2GA4B 1KABA 1PXUA 1BNZA 5ELFA 2OXPA 2IGHA 5JEAH 4OGQC 1KDAA 3NPPA 1JWUD 3P4SB 5T1IA 3H09A 3Q24A 1PRTF 1DCZA 3IT6B 1QCBD 1ET6A 4WORA 3T53B 1STBA 3SK6A 1WTRA 4BBSB 4OZCA 1WCMB 2D5GA 3ITPA 1CTMA 1IBXB 2NMQA 1ZXTA 3P4QB 4BA2I 5KGUA 1EM7A 1EL0A 1QKZA 1NI3A 3DWPA 2NTTA 5COYA 3LWEA 2Q8TA 4DK0A 4X3TA 4ARIA 2WP9B 3BK1A 1ZYRD 2FMCA 1VCIA 3HG9A 1PTOF 1Y8PB 3WOFA 2KOLA 2K3UA 4TMAB 4ZQ3A 2EZVA 1K8OA 3K58A 2JWUA 4KD3A 3M85A 1EY4A 1KH0A 1I4XA 3B2FA 2LJIA 1CFMA 3AMUA 1EYDA 1AW7A 3ZJTA 4XDCA 3ONAB 1C4CA 2MJDA 4FF2A 2B2UA 3EVQA 1E7PB 3PUYA 2NVTB 3WDNA 1STNA 4PNYA 5BN4A 1JROA 3FDTA 4PV1C 2D62A 2F0LA 5KNBA 1TVXA 2KA7A 3CKIB 3G7LA 2N9KA 1VR9A 1QNUA 2R3ZA 1L0VB 3EUB2 1O7YA 3BDOA 1ZPSA 3SR1A 1QOFA 5E6JA 5D3IB 3AEAB 2RPVA 3M3YB 4EQOA 3QOJA 1R4QB 1IGCA 1J8IA 2LUMA 2WXJA 4DU9A 4ZKCB 4LK1C 4I65A 3AEEB 2ONQA 2QILA 5JVG3 5C4JB 1R4PB 1YN3A 1V43A 3BIID 2B2WA 1EQTA 1FYCA 1RTNA 2G9DA 4C3HG 2ZXOA 3J7AF 5FO9B 2VZKD 3NBHA 3PIO3 2A6HD 1EZ8A 4J1MA 1YQ3B 5CC4A 2RMMA 2F0FA 2H88B 5K5PA 4IUQA 5IIFA 2WINB 2LHEA 5M9OA 3N9YC 2PPBC 2KEEA 4K5XA 1D1IA 4ID6A 2JEAI 4TSSA 4L2YA 1SSOA 1Q8IA 2H89B 3NVYA 1V1PA 3GV3A 1D5MC 5EKIA 1BCPC 1XEEA 1NR2A 4OIJA 4PMBA 3K0YA 4DNTB 5EBDA 1J7CA 2M56B 1LT4D 3SFEB 5M3FB 5TSSA 1LTID 3TZUA 1TY0A 4KKSA 2SNSA 2A6ED 2GI9A 3W5VB 1Y56A 1TKWB 3P75A 2INPE 4ULLA 4XYQA 3FILB 1FR3A 4KI0A 2E75C 1II3A 4HCEA 1BO0A 5I6YA 2K5DA 1YJIA 2GB1A 1E0ZA 2A69D 2FMMA 3T16A 3QIAA 2RA4A 3ND8A 4I7ZC 3VA5A 2H1EA 2E3TA 1ENFA 1CK1A 4C3JG 1HUNA 2PZUA 1CJEA 4L63B 1PZID 2CHBD 2BS4B 4J6HA 3K5LA 2V4IB 1Z7TA 1RCVD 1PRTB 4USAA 2KHSA 5ELEA 2K6AA 4GDKB 1SIJA 1PZKD 3QOLA 4ZUIA 5E4WC 4DFAA 2F0OA 4ZK9B 3C3LA 4ZRQA 3AH7A 5EPKA 4ARCA 4N6EB 3S2HB 1VJKA 3EGRA 1C79A 5IT9E 4CJ0B 4RKLA 3T3NA 2BE5C 2CQAA 2EJMA 1H9MA 1ZE3D 4RFBA 3GP7A 1AP0A 3N6RA 5LL6X 1PTOB 3MP9A 3J80E 4GDLB 3VYUA 2KCNA 3CU7A 4BWGB 4B0EA 1L0YB 1LT6D 2JP1A 4G7ZC 4NJCA 4FXDA 3E0JA 1STAA 5JEAG 3AE7B 3BVGA 3HOXB 4YSXB 1BF4A 1IBXA 3FPUB 1QILA 4JWUC 4MHEA 1GUSA 1WVLA 1F2YA 3OIQA 4U68A 3PUVA 1E2WA 3GTQB 2X6GA 5IOCA 1EWYC 1STEA 5IT9L 2B2VA 1RF2D 1STHA 1XLNA 1QJOA 1XO3A 1I4PA 1UAPA 2AWNA 5EPJA 3IFDA 3I4LA 3J80L 3IAYA 1FD7D 2XNAC 2B2YC 4DF7A 3AN1A 2L4NA 1JALA 4ZYSA 2NVQB 2F0NA 2ICEC 4YWGG 3B2GA 4G7OC 1JORA 3X3NA 3L9AX 2PO4A 1ESRA 1EFID 2ENBA 3DWQA 1B3AA 4C3IB 3VR4A 3AE6B 1O78A 2MP1A 2BW2A 1EU3A 3E9SA 2F4IA 3X3MA 3CIRB 1LV9A 5EE3A 5FOBB 2EYFA 2LGIA 1JWBD 4TQUS 2L32A 1F77A 2EYOA 1XF5L 3MVVA 4KTAA 1JE4A 3JAME 2B8FA 4CJ1B 1E6EB 1V8QA 2YEPF 1OXTA 4A3GB 1I4RA 1TWFB 1O7LA 2EE1A 3AE8B 1KF6B 1RKNA 3O13A 2L1AA 5M3MB 1FIQA 2W55A 4WJWA 1I3QB