1UNSA

Identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
publication title Identification of a Secondary Zinc-Binding Site in Staphylococcal Enterotoxin C2: Implications for Superantigen Recognition
pubmed doi rcsb
total genus 63
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1unsA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1unsA02
1TS2A 1KLGD 1EEID 1ENFA 5ELDA 1CQVA 1EWCA 1YN5A 1S5ED 3R2IA 4OHJA 5TSSA 1PTOD 4NZLB 1CK1A 1I4HA 1PRTD 1EU4A 1SE3A 2IJ0A 2J4XA 4RGOS 1XTCD 2CHBD 5ELEA 1EFID 1LTTD 3DWAA 1RD9D 1KLUD 2XRQD 3R8BA 4DXGA 3O13A 5I4DA 1I4PA 1PTOH 1TY0A 1FNVA 1BXTA 1QILA 2IPKD 3BVMA 1AN8A 1S5FD 3BVZA 3V05A 1D6EC 2O2LD 1LT3D 2XNAC 3MC0B 1SJED 1S5CD 2RDHA 3DWPA 1JCKB 1HA5A 4RHRA 1JR0D 1G8ZD 1JQYD 1STEA 5ELCA 3EFXD 5D3IB 1I4QA 1I4XA 4L6TB 4UDUC 1FD7D 1HTLD 5FK9C 1FNUA 1PZID 1JWSD 1CHPD 1DJRD 1ET9A 3TSSA 1PZKD 3BVGA 1PYWD 1KTKA 1SBBB 1JWMD 2AQ2B 1MD2D 2NTSA 2AQ1B 1L0XB 3EA6A 1SJHD 2WV6D 1SE2A 1F77A 3R2TA 2Z8LA 4RHSA 2QEJC 1SE4A 3BZDB 1V1PB 3KLSX 3BYTB 1S5DD 1L0YB 5D3DA 1JWUD 4RH6A 4TSSA 1ET6A 1D5XC 3W2DA 4RGNA 1UUPA 4K6LA 4ZYSA 3CHBD 4RFBA 1BCPB 1HQRD 1LTSD 5FKAC 1XXGA 4RCOA 1LTBD 1RCVD 2SEBD 4L63B 3SEBA 1I4RA 1AW7A 4RGMA 1TS5A 3GP7A 1BCPC 1CHQD 1LLRD 1YN4A 1LTAD 2TSSA 1GOZA 1TS4A 1PZJD 3BYYB 2RDGA 1V1PA 1S5BD 1YN3A 1PTOC 1I4GA 1PRTC 4DXFA 1B44D 3DWQA 1FNWA 2ICIA 1V1OA 5ELFA 1M4VA 5ELBA 1LO5D 4RGTA 1B1ZA 2R61A 1D5MC 1ESFA 2XRSD 2G9HD 4BWGB 1SEBD 1LTGD 1RDPD 1BCPF 2AQ3B 1T5XD 1D5ZC 1RF2D 1FGBD 1LT6D 1LTRD 1HXYD 1TS3A 3MFGA 3URYA 1LT4D 4Z9CB 1PTOB 1UNSA 1SXTA 2QILA 1LTID 1DYQA 1PTOF 1PRTB 3OWEB 1CT1D 1TY2A 1EU3A 4O1NA 1LT5D 1PRTF 4C56C 2NTTA 2XN9C 1EEFD 1BCPD
chains in the Genus database with same CATH superfamily
3VR8B 5JJKA 4FBJB 2ZPNA 1IW7D 1FD6A 3QCAA 5C44G 1UE1A 5IKCM 3W5OA 1O7ZA 1II3A 1VZ8A 3J7ZC 1EU4A 3DDCB 4EQPA 3A9JB 2BCOA 2INNE 4BAXA 3IRBA 2FUG1 2L3ZA 5C3EH 3R66C 5IYCG 1J8IA 1RWSA 1E9MA 4NKLA 3HVDA 5NUCA 4HKQA 1MI2A 4IDIA 4GU2A 1U5KA 4HEA1 1EWIA 2N9EB 2HE7A 2B2WC 1N62A 1GO3E 2BYVE 3LXFA 4HN7A 3V6CB 4FADA 4K8IA 1SYFA 4C3IH 1RAXA 2AUKA 4KGTA 3ZJTA 1SNCA 2VRRB 3A8IE 4A93G 2Q8RE 4ZRPA 4RA8A 1V80A 3C1FA 1YHQA 1HR0Q 1E7UA 2G45B 4HMIA 1DJRD 3TSSA 1L6VA 1O7LA 4K7SA 5CV8A 3DBRB 4PS8A 2MA9B 2NBFA 5IYDG 2ZVOA 1MD2D 3KVFB 4BBNF 5IP7G 2KQ7A 3W5VB 1TVXA 5LL6S 1A8VA 1VQOA 3N1YC 1TKYA 1BDOA 2NWGA 4KGSA 3MEFA 3CSTA 2PQAB 3VYTA 1C0AA 4WWNA 3WA0A 1YI2A 2WXFA 1EZ8A 2G4SA 1GM5A 4I7AA 1JWUD 3CWIA 1ET6A 3W2DA 2M9VA 5EKIA 2HJ1A 2OF1A 1ILPA 2K9XA 1MKHA 4RFBA 1KM7A 1MI0A 2WNMA 5C5LA 4ZDVA 3RNCC 3IG3A 4OIKA 2ASQA 3DBLB 3I9V1 2Q2IA 1N32Q 1PDXA 3MHZA 2OOBB 5IGGA 4DR1L 3BWUD 4IM0A 3M3YH 3PZ7A 1E2WA 2O6VD 4B3RQ 3VAWA 2LKVA 4HSPA 2KT7A 5GMVA 1TZOA 3AXCA 3FILA 1J7CA 1YIWA 1V5OA 2IT1A 1CA6A 1OXSC 2JA9A 4JI7Q 5J17A 3PRMB 1VF5C 2EVBA 1WCMG 4RCNA 1B53A 1SYEA 1PH1A 3NJTA 1WGDA 2ZJQA 2EQSA 2LJIA 3GB1A 3FAHA 3CD6A 2HUGA 5IIFA 4DNRB 3WAPA 5E6JA 5DLQE 1K0RA 4JBJA 1F2RI 3FKIH 3H7PA 3MZ5A 3HM3A 3LDZE 4LF5Q 4LF9Q 1A62A 1STYA 1Y8NB 2KUMA 1N36Q 4LF8L 1ZEQX 4QY7A 1SXTA 1KRSA 2NVQB 2K8CA 2EYOA 5G5HA 4DV7L 4JIOU 4HVBA 1A15A 3U50C 3HIZA 1VZ7A 3ZNGC 3CQZB 3W1GA 4IOCA 2EXDA 3PUVA 2JA5H 1FXIA 2TMPA 2JZPA 5DEHA 4JI5L 1TS2A 2ASBA 4JI0Q 1WM3A 1X1MA 1T0YA 3NHEB 2VUMG 4IN3A 1P0RA 3K81C 1GUNA 5ELDA 4Q5VA 4TMAB 4RG1A 4H02A 1TZ1A 2WXJA 3H6NA 2NS5A 4A4IA 3AE6B 2F0HA 4K2KA 4DF7A 1JJ2A 2KZRA 1DOLA 4NXMQ 4DXAB 4DDID 5EPKA 4YTPB 1QVCA 3TMPB 4A3CG 1EFID 4EQNA 4CYEA 4CHKA 3QARA 2INPE 3EUB2 4GOPB 2I1KA 4LNFA 2F3IA 3BDCA 1WWTA 4LUOA 2HT1A 4DR5L 3F8TA 2PPHA 4KDLB 5MPOA 3NY5A 3RT3B 1EYDA 3CCLA 4A3PA 2Q8TA 2NYZD 3A33B 3DCGA 4DV5Q 1VD2A 1QNUA 3TN2A 2L0FA 1KOTA 2K32A 5JOBA 3GQBA 4AIMA 2NBVB 3VA5A 3KQ4A 4DHJD 2RDHA 4OWXB 5M3FH 4XWWA 2CKZB 1E90A 3Q6BA 3IAYA 1FIQA 1TU2B 3VYSA 2CW0D 2UU7A 3MTSA 1CA5A 4YWGG 4L6TB 1L0WA 1C8CA 1PMRA 2KMAA 4NW2A 2Z0DB 1VDZA 3ETRA 1L7YA 1C4AA 4PS3A 4ZQ3A 4HR7B 3CCEA 1CM9A 1JOOA 2HIVA 1EIYB 2ID0A 2UYZB 2IW3A 1ZGUB 3A1QB 2IYDB 3PSEB 2BB6A 4AJYB 2CS4A 1TR5A 3MXUA 2HJ8A 1TJEA 2K5DA 2L00B 1C9OA 1TT2A 3S1QB 2KOXA 4IPGA 3DHIC 2DN8A 5J1ZA 4BOSC 1ISNA 3BZDB 1V49A 3N9YC 1V1PB 3X23A 4BKTA 1EZ6A 2HTHA 3TP6A 3L2PA 4YIJA 5GAGC 2BGFA 4RH6A 2VB3X 4L8JA 2H88B 2AWTA 4RMAA 2OQ0A 4ZRIA 4LF4Q 5FKAC 2KWUB 1QOAA 4WJNA 5D7GA 4ARCA 3IT6B 2WFWA 4M02A 5BN5A 1QCBD 2N55A 3S2DH 2C5CA 2PQEA 1UD7A 2KYWA 2JRIB 5BMHA 4GN5A 1OQQA 3KUCB 4A3KH 1ZW7A 4HCPB 2V1CC 3K57A 3Q22A 3S1NH 2C7MB 4DR1Q 4OXPA 2LD9A 1ASYA 3NVYA 2L12A 3ZGZA 3OMCA 4OONA 1ZXIA 3R3OA 1RTOA 3EIVA 3P4PB 2K05A 1YJWA 3MJWA 4C2MH 1K8AC 3CCUA 3LNNA 1YNJD 4JI3L 4MIUA 1WXAA 1QUQB 2KD0A 5HFYA 2K33A 3PIOA 2PVOD 4MM3A 3RMKC 4BWGB 2F0GA 5IY0A 5J2RA 2KACA 3H91A 2AX5A 3MHBA 5CBEE 3C0RB 1WMHB 4HIDA 1KL9A 4A3DB 4P73A 1MJCA 4Y52H 1YJ1A 5CBAE 4LF8Q 4JI1L 1RFKA 3GO5A 3KJOA 2WX1A 4DV7Q 2F0KA 3W1SA 4IUVA 3KDFB 5DM63 2DAFA 2EE1A 3NZUA 3RCZA 1WZ0A 2KQ4X 2EYPA 2JA7B 3I3TB 3L08A 2RSUA 1NNXA 3BY4B 1E8WA 5CORA 2RF4A 4G7HC 1ZXHA 1CK1A 2BS3B 3E9SA 3QX1A 4KDIC 1TGZB 3HOWH 1BF4A 1N5XA 4XQNA 3AEBB 4RGOS 4TQ1A 2CJNA 2CHBD 4B3SL 5CHVC 1TKWB 2WXPA 1CKMA 3GE3C 2WP9B 4GN1A 3TZUA 4MSQB 4A9AA 5BMIA 4NB3A 3ZVVA 2G3QB 3PUXA 1OXTA 1CUKA 3J80i 2ZM6L 4IO9A 2B2VA 1G6PA 4DR5Q 3V05A 1A0IA 4R4CA 4GOPC 1OFFA 1E0ZA 2RDFA 2B2UA 3EC8A 3C2PA 1EIFA 1SJED 1ENAA 4Y7NB 2YVCA 3NTKA 3V3XA 1C78A 2JA8B 1BBUA 1HA5A 1ACCA 3GV3A 5KYIA 1HZAA 2EMSA 4OL7A 4LNNA 4B3ML 2Z1CA 1E5WA 1A3VA 3NBIA 1TWHB 4ZK9B 3HOVB 3GS2A 2ZCBA 2KOLA 4R4IA 3A4RA 2XGTA 5C3XA 4YTNB 2JYEA 4A3JB 1XLOA 1KNAA 1GVPA 1OXVA 3I4OA 3PIO3 3G71A 2ZNVC 1WRIA 3A54A 4W9CA 5JZEB 2SNSA 2PNHA 4ZUIA 2JP1A 4FHKA 2GBMA 2VZAA 4APVA 3CC2A 2KLGA 1EY0A 3RZOB 4G3XB 5G3LF 2E2DC 1IGDA 2LRUA 3CMAA 4PS7A 1UUPA 5ELOA 3PO3H 1QZHA 3NZSA 4G50A 5JAVA 1OGWA 1SF0A 4CBVA 1WGRA 2NBUA 1MHHE 2PE9A 3MHSD 1J19A 5LLIA 4CGYB 1GUAB 2E3TA 4RM8A 4A3GH 4WQMA 2SEBD 1RJTA 1KLVA 3S15H 1QQRA 2VZKD 4MJSB 1XPRA 2KFKA 3VHTC 1QF6A 3A0JA 4XQQA 4M8NA 2MQHA 1NJIC 4IM2A 3IVFA 3AMUA 2ZTCA 1J5EL 1SE8A 1PZJD 3D6CA 2LVOA 3K58A 2FAZA 2M19A 3ZO5B 2A6HD 3BG3A 3DVGX 2K1FA 1E8YA 2WKDA 1IZ6A 1E8XA 4IOIE 1XCQL 2PKOA 3E0JA 1F2YA 1K52A 1WJNA 4IWOA 5IP9G 4J6IA 1HZ6A 5LNK1 3W5UB 1MPEA 4BY7H 4W9KA 4P74A 2KVZA 2I38A 3VUXA 5J18A 1KAAA 2G9HD 1SEBD 1CSPA 3A5ZB 1BCPF 2BQQA 2GBJA 3P4QB 2WQYB 1KIXA 3RNUA 2LEKA 4B9XA 3SHQA 5M5YH 3HKSA 3DVNV 3JYUA 4US8A 2CJOA 4NPSA 2LHEA 3DUZA 2K7VA 4OZAA 3RPFC 4CKEA 3J81L 2KTRB 1CQFA 1ZDVA 3ER0A 4HPMB 3R7RA 1LT5D 1WJ6A 4C3JH 3AEEB 1S5DD 1UEBA 1BCPD 3AB9A 4A3BG 3PHXB 3DVGY 3S1MB 3VR3A 3PO2H 1KLGD 5M5XB 1M94A 3W3AA 3AE3B 2BE5C 1EEID 1JOQA 1IKMA 3ZTDA 4CO7A 2JN4A 2PLPA 1P8LA 2MBEA 3VDZA 1YJIA 1MJEA 4O0AA 1QG7A 4PNYA 3U7DA 4RWSC 3U4ZA 3HHMA 1I4HA 2KCNA 2E75C 1XX8A 4PT5A 1HRJA 5ELEA 4JI2Q 4PZ7A 1HTOA 3SFEB 5DCNA 2B39A 2KHJA 1N34L 4OX9L 2I5LX 4B3SQ 2C5LC 2MP2A 2JA7G 4IM3A 4L23A 4F1SA 1BKBA 2F0OA 4C1NI 2K25A 1MVKA 1HUMA 2E8GA 5GXGB 3F2UA 2RA4A 1IBLL 3D6WA 4XX5A 5HGQA 4GXBA 2XNAC 4A3EB 3RNGC 5IT9E 2W3SA 2GN5A 5C0XJ 1S3SG 3T51B 2C7HA 2QIEB 3FILB 1WX7A 3MEHA 2MJDA 1FR3A 3IAM1 4FXCA 2AHOB 3V2TA 4YSYB 1EYCA 3KBXA 3I4NG 4HEDA 3BIID 5G55A 2L7RA 5FLXL 2H4OA 3U2SC 4G57A 1B9RA 1FNUA 2ONQA 4B3MQ 1W6JA 4GDLB 1JWSD 2D9UA 2HHHL 2NN6I 1Q10A 3FKIB 3I5JC 1C4QA 4YSZB 1XPOA 3R7QA 1NI2A 2RHQB 2AQ2B 1ZOYB 2JY6A 2O2VA 2JA8G 4FXDA 4NAWA 1B2TA 4DV6Q 3HGBA 1KRHA 2R93B 1R9TH 3X3MA 2RVLA 2K6DB 3GZNB 1SE9A 1HZBA 3CRKC 4MGZE 3ZUNA 5E7NA 1L0VB 3PSIA 1SIFA 4MEMA 4JGHB 3MXNA 4XE0A 5E6PA 3TREA 1O7IA 2NN6H 4WAAA 1WTRA 3A8JE 4A3FG 3KUZA 3PF4A 2ZJDA 4RCOA 3O65B 3J81i 1OTCA 3I56A 1CKNB 1WGYA 2O5IC 1Z7TA 5M3MH 1HNXL 3HFZB 1HZ5A 4LLGM 5E6OA 5L37A 1I6HB 1E6EB 4FULA 1UE6A 5FO8B 3CSFA 1SYBA 3K0YA 3RZWC 4G0NB 5IAAC 4V190 1JALA 3ZJUA 2L1AA 2HDLA 3GTOH 1J5EQ 1EYAA 1W2BA 3DPDA 4TV3A 4XWTA 3CPWA 2GA4B 1YNJC 2UXDL 2DAJA 3HRDD 2K5VA 3PHWB 1EUVB 3BU2A 3BINA 1TXYA 1KF6B 4CJ2C 2FNJB 4PV1C 2ICEC 4YTMB 1IYVA 5JJZA 2OEOA 3NTIA 2G4DB 3PGEA 3VDYA 5M5WB 2N78A 1R7SA 1M4VA 1NUCA 2WINB 2XK5A 3MC9A 4HCSA 1FO4A 4FNFA 5C3EG 2N0SB 2VH2A 1Z9FA 4KGRA 4XDCA 3MVVA 1ESFA 3TCAA 2V4LA 1CSQA 4HLEA 1X54A 2YTVA 1T5XD 2G9DA 2WYQA 2D07B 4BXXG 2FBWB 4HJAA 2AUJD 2BDOA 4OWWB 4RAUC 1KH0A 2V1YA 1Q82C 1IBKL 4AQYQ 4LK1C 2O5JC 3OHXC 4DR4L 2J0JA 2Q5WD 1XCTL 5AUKA 4DUYL 4C3IG 2KWCA 3W1YA 2B2YA 3UF8A 4JYAL 4YT0B 4LNOA 3KF6A 1L5PA 1JRUA 3QWNA 4BY1B 3HOZH 4DR7L 5D94A 1LQBA 2L0TA 3P75A 2Z6BA 2RCFA 2BA1A 3HEJA 2JYOA 4A3IH 4BBSH 3DLLA 2V0GA 1C4PA 3K5MA 1TYGB 5C2TB 5K5PA 1CFMA 1FRRA 3DWAA 3UE1A 1XD3B 1WVLA 1ZUD2 4KSKC 3HRZC 3IFTA 5C44B 1N34Q 1NYRA 4OX9Q 3OJ4B 2EZVA 1GUGA 3J81j 3V62A 1S5FD 1AH9A 2J52A 1C1YB 2KJRA 2EKIA 5H8YE 3PVLA 3VRBB 3LX0A 1P9DU 4N9F4 1S1QB 2KHSA 2WU2B 1IBLQ 4EZKA 5JPNC 4LDTD 2KFJA 2PIAA 3DVNU 4XDXA 1XNRL 2LFNA 4C2MB 4GLAC 4NQLB 1EF5A 1G8ZD 2AWNA 5JH5C 1JQYD 3CKIB 3G4SA 5K36H 3HS0C 4LAAA 1E2ZA 4R4OA 4JI8L 1D1IA 1PH3A 3AEVA 2WU5B 5G2NA 3TJPA 4MSMB 4B0MA 1DOYA 1HTLD 3UINB 4DHZB 2HDMA 4N9PA 3F2CA 1E10A 3MA2B 4ARIA 2Z0SA 2F4VL 3GV6A 4KK7A 1KTKA 1YX6B 1U4PA 2KDBA 4GLSC 2EYLA 3T3NA 5BYQA 2Q8IB 5H1SE 1KQSA 1SJHD 4A93B 2D62A 4FYDA 4HMJA 2MW5A 3TBLD 5IGFA 4PYUA 1JT8A 5D2MB 4ANWA 2E2IH 1TWCB 1KD1C 4DK1A 3IKJA 1C4CA 1MGSA 3WALA 3S24A 2DYBA 2F0SA 3FKIG 3GTPH 3TL5A 4GDKB 3A7LA 4UPAA 1RKNA 1UWVA 4G7ZC 2R7ZH 1RM6C 1CMXB 2EKEC 4W9FA 2DJGC 3C19A 4FP5D 2PI2E 1X3PA 1WFQA 1H95A 3LWUA 5IN7A 3NUCA 1J8CA 4RGMA 1TS5A 4DUZQ 4CDDC 3M63B 3C1EA 2A73B 2W82A 1DZ1A 1WYGA 5CC4A 2KDFB 4HRSA 5T8IA 5E6NA 3GTLB 1BOSA 2RDGA 2IGDA 3S2HB 4A3OA 1GHKA 2NZ1D 1CJEA 2N7EA 2UXDQ 2XWBB 4DXFA 1JWBD 1BR9A 4YHHQ 4IURA 3DWQA 4JLCA 4I6PA 2M56B 4ZYNA 3CP0A 2KWVB 5ELFA 2NVYB 1C79A 4CQNA 4MT5A 5IWAQ 3ULPA 4ZUJA 3U58A 4KKIA 4FF1A 3WOFA 3K80C 1JROA 2D2QA 3NOBA 2MCNB 3GTJH 4B3TQ 3HP3A 4FO2A 1SNOA 1S4ZA 4IG7B 4JPBW 1FYCA 1LT4D 4ODGA 2L52A 1E1TA 4IUPA 1P7EA 4J3OD 5M3FG 3ZTCA 4K6DA 2QILA 5FLMH 4ZCKA 1IBKQ 1UEAB 4POGA 4AOFA 4KTAA 2SOBA 5C4XB 1WTXA 4NNJB 3TDQA 3QR8A 1JE4A 3VR4A 4CKBA 3I73A 4JYAQ 5J22A 1EWYC 2JSOA 1JRPA 4DHZE 4J8QA 2B8FA 4K5WA 2EMTA 3LJ3A 3OAWA 4ASWC 2FE8A 1WXQA 3PO3B 3RYTA 1K3RA 3DHHC 2N1VA 4MHEA 3Q3MC 4A3GB 4KIKB 4YL8A 2Z4HA 4LDTB 2J4XA 3U9SA 2JYTA 1UF0A 5LMNQ 2UUBL 3GTMB 4OZCA 4OVUA 2Q2TA 2NVXB 2BYEA 3VTWA 1DGSA 4HTHA 3FEWX 4FJVB 3V96A 2DNCA 3JAME 3AEAB 2MLBA 2E2JH 4KSLC 2OWOA 2WHIA 1JW9D 3RN9C 3S1RH 1CI3M 1Q12A 4LW1A 1HHVA 2IL8A 5IGCA 3J7YW 2MX2A 5AZHA 1BO0A 1JMCA 4EKUA 4NDXA 1WTQA 1QOFA 2V4DA 4HIMA 3H1UA 1JR0D 3VR5A 3HOYH 4A3KG 1PFDA 5ELCA 2WGSA 3TP8A 2JJQA 3AE2B 3PREA 4HROA 2VY3A 4UDUC 4JI8Q 1WF9A 3M4OB 2K22A 3IHPC 1ZKOA 2DZIA 4KVGB 1J9OA 2PZUA 5I2YA 1DONA 3AU5A 1B9NA 3A74A 2EYFA 1ICFB 1Q8IA 4KJOA 4CDFC 4ZKBB 2E2HH 2F3WA 3Q8DA 4XIGS 3RLNA 4ZKCB 2F4VQ 1L6UA 2DWQA 5BN4A 1EYGA 4NPNA 4FXGC 4H44C 4A75A 3N32A 2QC8A 3Q14C 4M01A 1SGHA 2R6GA 2QEJC 3KJPA 2MBBB 1V97A 2UXCL 2BS2B 2CKHB 2KNBA 4HDOA 5FO7B 2REXA 2KDIA 2MPMA 4RGNA 3PV1A 2E5LL 1WYDA 2KCCA 2ZT9C 2NVTB 4FHJA 3CHBD 3UDXA 4HPPA 3FPPA 3M3JA 3EQLC 3RZDH 5BR8L 2BH2A 3W1SC 2M17A 3M95A 2JWZA 3ZJYC 4S17A 1WGHA 1N61A 3WAOA 3TS0A 2N88A 3CCMA 2IX0A 4C7ZA 2ZTDA 1WTPA 1VQFA 3GD7A 2KTFA 1WFYA 1NCVA 1YQ3B 1S5BD 2K03A 3S9WA 1SNMA 1WGGA 1O78A 3RN2A 2VNUD 4K81A 1LTLA 1H9JA 3HOWG 3ICEA 2D3BA 1R4NB 4KY7A 2M8SA 3P20A 2N1WA 2LY7A 3M62B 1ZE3D 1HNWL 3D4RA 4DAMA 4DV2L 1WD0A 1EQQA 2AEHA 2C7NB 5E1FA 4X65L 1VQNA 2HDEA 1F1HA 4MTKA 1F2ZA 4BBRH 1NSNS 4AH6A 1YHAA 2K4KA 2B2UC 5FJ8H 4X66Q 4IFDG 2D5GA 2LZ6A 3U7ZA 1L1OA 1Q5WB 1QZEA 3OJ3A 1YITA 2FHTA 3IAS1 2KQSA 5C4JB 4AQ7A 1HA6A 5LXIB 2B8GA 2ZW1A 4POFA 1QOBA 1A3TA 2G1EA 3ZW3A 3AV8A 1PHJA 4JBMA 2K5QA 1Y1WB 4NAWB 4GN4B 1K0SA 1R4MB 1H9SA 2NZHA 1TTNA 3AE5B 4JVZA 3HOXB 3TEWA 4XC2A 1RTNA 4AYBE 5EKKA 5I9PA 1PH8A 1GPXA 4XZ4A 1Q1OA 1XT9B 1HZ9A 1X9NA 4ZRQA 3I4LA 5HKHA 3PIPA 4X3SA 1ONLA 4NJ7A 1MFWA 3G48A 4PZ6A 2BTEA 4N8FA 5C4XG 2WXRA 4TUUA 2PZWA 1XTCD 3L0OA 3H3VI 3QQ8B 4LFBQ 4KKSA 3O13A 2VW9A 2F0LA 4MN3A 4HIOA 2DYOA 1YVCA 3PO3G 3I4MH 4KV2A 1AN8A 2DZMA 3JSVA 2PVGC 2EYMA 4EE2A 1T0RC 2DZJA 2Z4IA 1D1KA 4A3GG 3CCQA 3RD2A 1K8GA 5A2QL 3J81c 3DWPA 2FMMA 4GS3A 3BK1A 2MHVA 3H3VH 1STEA 4IUTA 4NP5A 4DV1L 3KLWA 2LXJA 1P98A 3ZQ4A 2ZCCA 3FP9A 4BKSD 1BUIC 1OEYJ 1YZ6A 3PTFC 4G4KA 5D65A 1STGA 2BE5D 2IO1B 3UI2A 1AARA 3B9JA 1G2SA 4A3LH 3NK9A 2FMCA 1YQ4B 2MGSA 1T3QA 3DBHI 4J6HA 2BKFA 4JOIA 5COYA 4BY7G 4YSXB 2ON8A 2IZVB 1YQBA 1WTHA 3RLOA 3MFYA 5KGUA 1I5FA 3VFKA 4FXKC 5IODA 3OTOL 2PE6B 1N9WA 4AYBG 2CU3A 4DAYA 4RMFA 1YIJA 1WXVA 3KF8B 1HJPA 1FXAA 2KHWB 1E3PA 4IC7B 1QVFA 2WP8J 3JC66 4JC0A 1VR9A 2UWQA 1QVGA 4A90A 5JVG3 3RNAC 4ID6A 2B29A 3NBHB 4LUZA 2PW5A 1AZQA 5T1GA 1UZXB 1X3QA 5BR8Q 3NZ3A 2PCFB 2B2TA 1I4RA 4TQUS 4C3JG 2K01A 1GHJA 1BNZA 2JA6H 1XF5L 1MHWC 2ZNVB 3ONSA 3PIP3 2JEBI 2XEWA 4FF4A 4JI4L 3PO2G 2L15A 3J7AV 1GOZA 2X8XX 5FLXc 3CMEA 2MO1A 4DR2L 3PZDA 1E0BA 4DNTB 1QKZA 2ZEQA 4B6WA 3G6JB 3EHVA 1WD1A 4M0WB 1EQRA 2ZTEA 3QJZA 1LGRA 4G7OC 1TKGA 2VB2X 4NXNL 2D2CC 3J80L 5GAEC 5M9OA 1K73C 4BA1I 5GADC 3PLVA 4PMBA 1SMYC 1HNWQ 1TWAB 3H09A 3P2BA 4KY5A 4X65Q 1PV4A 2CQAA 1ROEA 4URKA 4WJOA 1PA6A 1DOXA 4BOZB 4QGUA 1NBFC 1PQSA 1D2BA 1UBIA 2M1MA 4KJNA 3Q3JA 1D8LA 2BA0A 3C8YA 3ML9A 3SR1A 2LUEA 3ML8A 1VQPA 4MELA 1WX9A 1TY2A 3PQIA 3CCSA 1M90C 3RZFA 3NHHA 2R92H 4IOAA 2EYHA 2E2IB 2XN9C 2NBWB 4DWFA 3D3RA 1VS0A 1UE5A 1F2MA 2F0EA 4A8XC 4PK1A 3CCJA 4UAIA 2WXMA 4C00A 2JZZA 4M8MA 2IO2B 1DXMA 4FF2A 3FHWA 3HG9A 3S17H 1X3FA 3BZKA 2LVPA 5DPWA 1NAPA 2M00A 3GTQB 4S0RA 3TS2A 4A3BB 1YBYA 1Y1WG 3T1HL 4B08A 4HJKA 2K3UA 1TWFB 1U4LA 1N33L 4LNIA 3NWTA 2XVSA 2K75A 2DYMA 1PVOA 3HOXG 2K6AA 3S16H 2NR2A 3U4EG 1BXTA 5CV9A 3I70A 3FPUB 5DNFA 5HI1A 3DEPA 4K5VA 4IWQA 1ZYRC 4UY8C 1IPGA 2IO0B 3HKZG 1D6EC 5DM73 2O2LD 1N8RC 2RDBC 2RQXA 3B1LX 4HIKA 2I5HA 2ACZB 3RMHA 1P7FA 3AN1A 1ICWA 2EIFA 5M3MG 1SN8A 2UU9L 3ITPA 3PLUA 4L1BA 2HQEA 3QO2A 4HJ9A 3OW2A 1PH2A 4JI5Q 1H9RA 1XLQA 1I4XA 2KDMA 2RPQA 4EQ5A 3SGIA 3AEFB 2BS4B 3TZDA 4IWPA 3PUZA 1Q90A 4DV1Q 5LXHA 1EIHA 1B9MA 3ZXRA 2D3GA 3I7FA 3CC4A 3CPFA 1FCCC 2AKWB 4RKLA 2A68D 3EJIA 2BKRB 3KUPA 1FVIA 4W9GA 3VXWA 3GTKB 3H0GH 2AQ1B 1L0XB 3KYHC 4IKGA 1I6VC 2K39A 3I4NB 3J7AF 3A5UA 4RHSA 1A5RA 3T1YL 1Z2MA 3KWLA 5C1ZA 5EPLA 1V81A 1ESRA 3RLFA 3EECA 4BKGA 3SXHA 2NPTB 1DGJA 2WWZA 3DWMA 5JXVA 1T5EA 4HJ7A 1BQQT 3IFWB 2MUYA 2B2YC 5EBDA 5E4WC 4ZYSA 3VUWA 2J7ZA 2IY0B 1LTSD 1VQGA 5C6AA 3OMGA 1R4PB 2MH7A 3PV0A 2KCMA 4KMUC 4HDQA 2LMCB 1WR6E 2F52A 2WLBA 3B2FA 1PGXA 1SYDA 1MG8A 1TQOA 2WXOA 3IT4B 3HOZG 1WM2A 2Y5BB 3MP9A 5CHFA 4EFOA 3K7AB 4A3FB 4JI4Q 2N9PC 1QE6A 4A3IG 4BBSG 1A70A 1N63A 1WTVA 1RL2A 3RI7C 2F3VA 1YN3A 3PS6A 3WCQA 1EF1A 4H0LC 3STBC 2JU6X 2JXTA 1UH6A 4LFAL 1P3QU 1PRTC 5JHAA 2YU9B 3OSOA 4QUCA 3P4RB 1V1OA 3QK0A 5JPMC 3S14H 3HOYB 1HTQA 1VQAA 4LCDE 2R61A 3NRZA 1C3TA 1LUZA 2CHXA 2KJXA 3ZKJC 4B0EA 4IUUA 4P75A 5I6YA 3OIPA 1D5ZC 1VQJA 1W3SA 2MO0A 4RKBA 1XPUA 3CCVA 3HOUH 1QOHA 5EJWA 3URYA 4LNQA 2IWHA 1BBXC 1P16A 5C3EB 4JV5L 3KLRA 1H9MA 5K36G 3SDZA 4QJFA 3T13A 4QB4A 3NXWA 3CC7A 2DHZA 2KN4A 3BS1A 1Q0WB 2XIWA 2X6GA 5J39A 3Q2AC 2WAQB 3UQBA 5CV6A 4DK5A 1VQKA 5EPJA 2QCZA 1CQVA 2IDYA 2N8NA 4H2AA 4C3IB 1SYGA 3EFUA 2JK8A 2F0FA 5EE9A 4KX6B 5C0XI 1N5WA 2C60A 2KWDA 1G51A 4LFCL 3T9LA 1EOVA 4JI3Q 2QF7A 1SIJA 2KVRA 4IZ8A 2B3AA 1JB3A 3Q3NC 3KW5B 1IHZA 1JQ4A 4K3BA 2HD3A 1BBWA 1Y8RC 3U30A 2WS3B 3EFCA 3ZLZA 2KVMA 1PTOH 2X6LA 5KYLA 1QLBB 1DOIA 3A9KA 2LXKA 5BN3A 5KNDA 2R7ZG 4II3B 1NEKB 2K8BA 4GLXA 4HPLB 4JI1Q 3I8ZA 1YNNC 4LMQD 5C0XH 3CF5A 3MC0B 4X3UA 4XGAB 1XLNA 4B9WA 2YTYA 4IW0A 2EY5A 3I91A 4ZRZA 2P5ZX 2BYFA 4BBRB 4LK0M 4LTUA 1Y8OB 3A9JA 4WJPA 2LWPA 1GJXA 1WIAA 3QJYA 4K5XA 1V86A 1JB7A 1L1OB 4US9A 1X6OA 5T1IA 1NDDA 3SK4A 2AWOA 3D8GA 5AZGA 1VQ4A 1DCZA 2I07B 4XYCA 5KIXA 3M3YB 5CHWA 2GOWA 2ZM6Q 2NB0A 4CJ1B 3EGRA 4DR3L 1AE3A 5ELNA 3DBRI 1TWGH 2BOSA 5EQ0A 2MSED 3ERQA 1PH7A 2ES2A 3T1YQ 1BMLC 3PRZA 5IT9L 2LI5A 4EGVA 4FJYA 1XYIA 4II2B 3AYHB 3RUZA 5BO4B 4TSSA 4J1MA 4OO1I 3RFZB 4K6LA 2X69A 1SNDA 2A1AA 1S40A 1X32A 3AEGB 2OT2A 5FLMG 3P1MA 1JWAD 2FFKB 2KN5A 1Q1EA 2LFIA 1A2UA 2PO4A 4N9TA 1HR0W 4ICVA 1CHQD 2YYZA 2WAQE 3RN5A 3H6MA 1YN4A 1LTAD 2A74C 2QDLA 1A6XA 2BBCA 1KABA 3H7PB 2M4NA 1W6KA 2QKIC 1KRTA 3I4MB 2PQAA 3EROA 4KY6A 4OO1H 3AE9B 2ZXOA 1HZCA 2KO3A 1U4MA 4LF7L 5IYBH 1NENB 3DBLI 3PPAA 4XT3B 2PNRC 2JA5B 4LFAQ 1X55A 1OQRA 1Q3LA 4K14A 2JXMB 1XEEA 3Q69A 2XSCA 4DKAC 5BMGA 2I1JA 4A55A 1D5MC 4M00A 4PMCA 1WGKA 1VF7A 4W9HA 4W9IA 5DPTA 2KHIA 4X3TA 2F0VA 4R9WA 2UUCL 1FGBD 3UDIA 2Y5CA 4HAEA 3QG1A 2MJ3A 4HJGE 5IE8A 1I7HA 4RM9A 1XMQL 3KFUA 2DJFC 1DYQA 3HOYG 4AJWA 4EQOA 4JV5Q 5JJIA 4ITKA 2R2QA 1I42A 3HK0A 2F0WA 2NTTA 2RKSA 1WRDB 2GRIA 2WXQA 2JEAI 4XYOA 3C46A 1ML0D 4ME3A 1SNQA 1GUTA 2BH8A 3D32A 4GIVA 4OELB 4QAYA 4EOYA 2CH4W 5M3FB 1ENFA 5BYSA 2WKCA 1F52A 1S72A 4PYZA 4DAYB 4PQXA 5JEAH 1ZXTA 1D7QA 1KNEA 1SMXA 4DV4L 1R4QB 1VQ5A 4NZLB 4GN3B 4JE3B 2INCC 4OIJA 1UE7A 2JA6B 2F0IA 4V0BA 2CHZA 1KLUD 2JUOA 5JJLA 1E24A 1KDAA 3N52A 2VH1A 3VRAB 4ILWA 3ULLA 2WAQG 5I4DA 1D4BA 1EQTA 1GKHA 5LMUL 3QIJA 2L5TA 2NVQH 2QJLA 1I3QH 1NMFA 3V6EB 1V8CA 3PZ8A 1AZPA 1N6ZA 2K5WA 4C3HH 2N9LA 3CQZH 3PMFA 5KHOA 1Z47A 1VCIA 3BDLA 4WRDA 1PXUA 5D14A 4L5RC 4N58A 2F4IA 4YY3L 3K59A 1VRAB 3RULA 2A68C 1TIID 2QHOA 3EFXD 1JICA 2M0XA 4X57B 3K6OA 1PGBA 3U52E 3U8ZA 2QSDA 1B70B 1VZ6A 4GSWA 5JEAJ 1V5TA 2IHFA 1F9QA 5C5MA 3S2DB 3BVGA 3AI5A 1PLFA 2A5UA 3A4SC 1PYWD 2DY7A 1IL8A 4F7XA 5GQOA 2VQFL 4A3KB 2WX0A 1JWMD 3L0WB 1LM0A 1STAA 3AQQA 3S1NB 3V61A 1EY4A 4FF3A 1L1OC 2F1MA 2MFIA 3A8KE 1J6QA 4BBRG 1SB3C 3CIRB 5FJ8G 1BUVT 4ZAIA 4DGZA 3I63C 4E71A 2F0TA 3NQIA 2K8HA 4G11A 3JVZX 2KECA 2LGIA 3N1ZC 1WTOA 1D5XC 2GBNA 3SE0A 4F8CB 3F1ZA 3SVMA 1C77A 1B3AA 2JF5A 3ZIMA 3WDNA 4CHTB 3UDGA 3A1QA 1GC7A 2OEDA 4MM3B 1UAPA 1B8AA 2HHHQ 5ISRA 2AYOB 1HPCA 1TT5B 2RPVA 1V1PA 2OJRA 2EJMA 3UDFA 1MG4A 1TBEA 2I2YA 4XYQA 4LF7Q 2KMMA 1WSPA 1UGJA 2O6VA 4C7YA 5IOIA 1QNKA 3KBGA 2L55A 1SYCA 1B3QA 1WY8A 4ABNA 4DK3C 2BVCA 2C9OA 2DNFA 3EVQA 4DPGA 5CTRC 1YJNA 4MDKE 3AECB 2L11A 1ILQA 1FGUA 1G291 3I4MG 1V2YA 1FFUA 2XRSD 1V43A 1VLBA 1SROA 4UHVA 3HOWB 2Z59B 4D2KA 1PH4A 1F2RC 1DD2A 2M0AA 3NEMA 4KV6A 4A76A 2JA5G 3RNBC 1I94L 2UUCQ 4CDCC 1HNXQ 1K8MA 2UXBL 5GAHC 2YLMA 3W9CB 2OXPA 2BYTA 1EY8A 1IL2A 3V60A 1XMQQ 2N7DA 1WI5A 1XTDA 5FO9B 1RRBA 2X38A 4C56C 4TRDA 3OG5A 3DQVA 4N59A 4ANXA 3VR2A 2EDGA 4XT1B 2LGYA 3KH0A 5IOCA 2F0MA 1A3UA 1HR0L 2VXWA 1FRDA 2R2OA 4A3LG 4KHPL 5HURA 3QAQA 2HIXA 5CYUA 2MJ8A 3J80c 5KEEA 4X62L 1SE3A 1QWYA 4DV4Q 1WMHA 4B95A 1IYJB 2YEPB 3VYRA 1IGCA 2PMVA 1NE3A 1SMYD 2FCSA 1WTWA 4A3DH 1FNVA 5IA7A 5A35A 1A2TA 4IUQA 5LMUQ 2WDVB 4USAA 1EO6A 3Q3FA 4K7WA 2JZ3B 3ZNHB 4DR4Q 2L9HA 1KFYB 4DUYQ 4CDEC 1CZWA 2PZTA 2KXJA 1XLPA 2JA6G 1WXSA 3T53B 4ANVA 3M9BA 1VQLA 1OTRB 1RODA 4I6NB 3B08A 2OCEA 4DR7Q 3NS1A 4YY3Q 1X65A 3Q3OC 3B6YA 4YWMA 4J15A 1J0GA 2KJHB 3AU7A 3S15B 1N32L 1JOKA 2GBRA 2WACA 4TQ0A 2IX1A 2D3CA 1HEZE 2VL6A 4RF1A 3JAML 1WOCA 1Z6HA 2L76A 4XXEA 1K8RB 2KFKB 1NR2A 3SDLC 3AE7B 1FXTB 1F77A 2MRPA 4E6IA 2QGQA 3N6RA 2EXZA 1WZ3A 2LGSA 1CZGA 4JI7L 4FLHA 4ZOHC 3VUYA 5IO9A 3GDEA 2GB1A 4Y7NH 1VQEA 1T0QC 2JA8H 2KAJA 1HFNA 1VCBA 1VMCA 2HQLA 2K50A 3M4PA 2MP1A 1ZYRD 1XNRQ 1QZGA 1TIFA 4BY7B 1SRUA 3HM6X 2OHFA 1LTBD 1RCVD 3HOVH 1TWHH 4A20A 2R92G 2RMMA 1N36L 5F2DA 2PPBC 4AYBB 1CZPA 4A3JH 2EOTA 1QOGA 4BS9A 5M5YB 5C23A 1LLRD 4K3CA 1YJ9A 4F7ZA 3BYYB 2Y5PA 3AH7A 4JL9A 5AEKB 1E8ZA 1PFSA 4PMWA 1P1AA 2GMIC 4O2DA 1Y1VH 1K28A 3RZOH 4DK6C 4C3JB 4F87A 4JI0L 3L9AX 1SSNA 2KA7A 5KNBA 2MHJA 2NMQA 5EAYA 2ZZPB 4IQZA 4DV3L 3PO2B 1F9RA 3OLMD 1G6ZA 2IO3B 4NXML 3PGZA 4KKUA 3NVZA 4MJSA 2IBIB 4EZJA 1PH5A 2R7FA 4DNIA 1L2FA 2F0NA 4WURA 3HVZA 1YD8U 2D10A 1GUSA 2IGGA 5EDSA 3P42A 1I94Q 2JX5A 2UXBQ 1WE6A 1CT1D 3Q24A 3TMEA 4DV5L 1IBML 3SK8A 2MP2B 3T4AC 1PRTF 1X3GA 3N20C 4BXXH 1TWGB 3ULJA 4WAFA 3S2AA 1VQ9A 2GI9A 3NWSA 4H7BA 3E0EA 2LASA 3LWEA 4ZLTF 4YCUA 2KANA 4NY0A 4W9EA 5AUIA 2MBHA 2B2VC 4B9KA 4R1JA 1FEHA 3L16A 4P7IA 3ZNID 1L4ZB 4O42A 2PYKA 3JAMi 1SAPA 3H0GG 2N9KA 1QB5D 5TSSA 2W9NA 3BK2A 2SNMA 3STBD 1Y69U 1WJUA 2H1EA 4KHPQ 1PRTD 2IJ0A 4JG2A 4IPDA 2LRWA 4KD4A 1RD9D 4X62Q 4GNXA 2KTRA 3LGJA 1O80A 4DXGA 3OPOA 5DPSA 1I4PA 1TY0A 3E5SA 3H7SA 2A6ED 1VQHA 1QILA 5IGEA 2CCZA 2JSVX 2W54A 3E6ZX 2AL3A 1AEXA 2N9XA 3U9OA 2L8JA 2O2VB 3Q8CA 1IKLA 1HH2P 4R8IA 1R9TB 1UELA 2C35B 3S1MH 4WWMA 2O4XA 3TQYA 3TEYA 5M5XH 2DBYA 2Q2UA 1RHPA 2MBQA 4LF4L 1OEYA 3KOJA 4RHRA 2MJEA 2PMZB 1WI0A 4WJ3M 5D3IB 1UWMA 3WIMA 2GVAA 3MXNB 3HKZB 1IBXA 5L83A 3P63A 3K9PB 4AWJA 2EY1A 4AS1A 3T8MA 1I50H 1OXUA 1V8QA 4HJ5A 5M3MB 1B50A 3AE4B 1L4DB 2UUBQ 3TBIB 2NVUI 1LABA 3D4DA 2Z6KA 2NTSA 1VQ8A 3A55A 2LGXA 5IGDA 1FJGL 3TRZA 3GTOB 2VQEL 4KZCA 3H94A 3K0XA 2JQOA 1PYSB 3ENEA 3VQIA 4A3EH 1V1QA 2A19A 4HXDA 1GC6A 4P1CC 4JCVE 1L0YB 1NVID 3QA8A 1T9HA 1MHXA 1NY4A 3M85A 3HOUG 1ASZA 2Z0EB 3W1BA 2N7JA 3GZNI 3N30A 3NELA 5JVH3 4GDLA 1M8AA 2XK5B 2Z9HA 1YNND 1PFMA 3PUWA 2JWUA 2CWAA 4MGKE 3SR6A 2V4IB 5HGTA 2LJ5A 2PEAA 4ZHOA 4JX1C 3NSWA 2FCNA 3ALBA 3T3OA 2DZKA 1NR4A 1I3QB 2V3NA 1GJZA 2EELA 4UP9A 4WJWA 2IY1B 4C3HB 2R93H 3NG0A 2XBBC 1PTOC 3Q6SA 3DM3A 4K2LA 2BF8B 3NPPA 1FL0A 5A2QE 3KYCD 4JWUC 1U9RA 1VMPA 5IGBA 4MTNA 2OQKA 3KF6B 3HOZB 1EL0A 3Q8BA 5TR5A 3I3CA 4KLKA 4DV3Q 2UXCQ 1LO5D 1E22A 4EEWA 5C3JB 2DGYA 4A3IB 1HNZL 1CKNA 4BBSB 3KUDB 4I6LB 5EE3A 4MACA 3VTUA 3DHQA 2RHSB 2LXCA 2E5LQ 5IT9c 2K5NA 3CAMA 1LTGD 1RDPD 1QT9A 1PFNA 1YNXA 4L2YA 2CWPA 1I6HH 1RF2D 3E9IA 5C0XG 1LT6D 1VQBA 3F2DA 3BDOA 3KLSA 1YX5B 3CMMB 2IGHA 2L83A 2ALYB 5DAUA 2EPBA 3RNFC 1RLFA 1WX8A 1NYQA 2EY6A 2PMZE 1PRTB 3OWEB 1C76A 5E3FA 1OXXK 1G6JA 1GB4A 4A3MH 4L5TA 3HKZE 2ZVNA 4W9LA 2INDC 1IBMQ 2A8VA 1G2TA 2CQOA 3SK6A 4YCWA 2B63H 2YV5A 1PH6A 1K8OA 1JJCB 5M5WH 3OIQA 1STHA 3ZNZB 4MGYE 3R2IA 3L3OC 2J7QB 4DV2Q 1ZDXA 4EVOA 2LS01 1SR3A 3G6EA 1GB1A 4P71A 4KZ0A 1LTTD 3RNEC 3PT2B 2PI2A 3R8BA 3NVWA 2K6QA 2KMCA 1HFGA 4ICUA 1KHIA 4H13C 5C4ZA 3L17A 1EY5A 5FOBB 1MIUA 1WJ4A 3PCOB 3FKYA 1EM7A 2WXKA 2F0QA 3J80E 4BY1H 2KK8A 4ZRJA 3VA7A 2NZOA 4IPCA 3F2BA 4QIWB 1EY9A 2I0QA 2FINB 3GTPB 4QQBX 2O6VB 1XO3A 2ZPYA 2R7ZB 4P1BC 1I4QA 2J0TD 3H8HA 3EBEA 2QDFA 3H15A 5EKLA 2A69C 2SDFA 3LB8C 1YEZA 4OO1G 5I9OA 3FRPB 1PFBA 2F0PA 3DXJC 3MXGA 5IYBG 1PUTA 3Q8EA 1PZKD 2LUMA 2WDTB 3MXPA 2XWJB 2DY8A 4QMGA 3MTNB 5C44H 3SFDB 1SFOH 1S3OA 4C4VA 2CVRA 2QMTA 3GTGH 2NN6G 2EY2A 3WWVA 3TEZA 4NAMA 4DV0L 4KHZA 4K1RB 2BDNA 1FJGQ 1KDBA 1SNPA 2A4ZA 3VH4B 2C9WB 1SE4A 2VQEQ 1F2LA 3K9OB 1LXDA 3APCA 1SDFA 3DMUA 3SU8X 2F0UA 2L4NA 2LXAA 3DWGC 4WJ4A 4YWLA 3ZYYX 2KENA 1WR1A 2PJHA 3MC8A 5IYCH 4K8JA 1PYBA 3QIAA 3WAMA 4WORA 4NJCA 1IYUA 4L63B 4DDGD 3MAQA 2BW2A 3GTJB 5AJ3L 1ZKHA 4QF4A 3I90A 2QDBA 5CV7A 5D6JB 3APFA 3UQAA 2B2WA 3CF6E 2K0PA 1IW7C 1CTMA 1XNQL 3UE0A 3AMZA 1N60A 2B76B 2BPSA 4A93H 1KJTA 3L4PA 4ALPA 3ERSX 3CU7A 5JEAG 3NTHA 1GUWA 3H9DA 2J42A 2DNEA 2KLCA 3UIOB 5IP4D 4R4QA 2K14A 1TWCH 4GDKA 4MZ9A 3ND8A 3NQTA 2CH4A 4JQWC 2LSSA 1IUEA 1KXLA 3AFQA 1FNWA 4IFDI 3OWFA 5IYDH 4TKNA 2KX0A 3OTOQ 5IP7H 4FDBA 1Y56A 1K51A 3NE5B 1HTPA 1VQMA 3RR5A 5G5GA 2AMCB 4JI2L 1HNZQ 4DHJB 3B2GA 4R4TA 2M2LA 1O7YA 3T16A 4C3HG 4X6AH 1LFDA 2AQ3B 4RNAA 5I2XA 3ZJVA 1YHBA 4N8X1 1HXYD 1JC7A 2E2JB 3GTLH 1GG3A 4Z9CB 4QIWE 5I6WA 4GKJL 4IFDH 3S1RB 1LTID 3S2HH 2GVBA 3D31A 3R3MA 1EU3A 1K83H 2BB5A 2FXQA 4LJZC 4PG3A 1Q8KA 1XMOL 1VDVA 3RD4A 4DR2Q 2K52A 3NENA 5EBCA 3QOJA 1RFAA 3AM9A 2WB1B 3TUOA 2CR5A 4TVAB 1GAQB 2NVYH 2ZJPA 1EWCA 1X56A 1YN5A 2FCMA 4NXNQ 4OHJA 1NTGA 2WDRB 1VQIA 2A6EC 2R7DA 5J3BA 3A7AB 4JPSA 4JI6L 1SSOA 4XQJA 2XTIA 4BVUC 1IYFA 2GLSA 4P2CB 2MEKA 2XRQD 4OVZA 5C3WA 1VQDA 4WWOA 3P1HA 2FUHB 1WCMH 2E2HB 3D4WA 4DV6L 1QJOA 1LACA 2IPKD 4NQKE 2R3ZA 2RSOA 3KK7A 2BWES 1U4RA 5C4XH 1Y1VB 4DR6L 2H89B 4HK2A 2EJGC 4I7ZC 2NCNA 4BBNC 1LT3D 4IFDJ 3M7GA 1MSGA 5JHBA 1T0SC 3QOLA 3VH3B 2ZXRA 4BZAA 3K8AA 4LJPB 3VVWB 1ZP0B 1JCKB 1V9JA 1NBWA 4L5QA 2PW7A 4KIKA 3HZXA 1WXMA 2IY5B 4WFN3 4MH8A 1X3EA 2E74C 4XTCS 5CV5A 3FC4A 3X3NA 3RZDB 1EFWA 1DM0B 5FR6A 3VTVA 1FD7D 5G3LD 3GTMH 2I5MX 4MNOA 1CHPD 2NVXH 1ET9A 2J53A 1FMAD 1HQMC 2VUMH 1A63A 1LV9A 5LMNW 2RR9A 1V9PA 2RBMA 2K5HA 3T1HQ 1FFVA 1Z5SB 2FIFA 1N33Q 4W9JA 1BVSA 3CCRA 2N4FA 1V6EA 4OW0A 3M4QA 4F88A 2V3SA 4REZA 4DU9A 3R2TA 4EUTA 4DV0Q 4A3CH 1U4AA 2KQ3A 3RUIB 2JPHA 3BYTB 2PW9A 2GBKA 4P16A 5D3DA 1UBQA 1NMGA 4HCEA 3GE8C 5E4XA 4AUQC 4DK0A 1Q86C 4M1UB 2UU9Q 4MH0E 4F8MA 1STNA 3AEDB 1XXGA 4I65A 3M4OH 4WQOB 3SEBA 5CMDA 1DOMA 4KN4C 4OWTB 4BA2I 4FA6A 5FR3A 3E9HA 1J7AA 1C48A 1KC8C 4AQYL 2L1BA 3GP7A 4K0KL 3GOEA 4WJQA 2WB1E 3ABVB 2ZXPA 5AJ3Q 4ULLA 4GNXB 2TSSA 1EOTA 2ZJRA 3SD5A 1TS4A 3J81E 3M4YA 2LHDA 1XNQQ 4GGQA 4M8AA 4LJOB 1H4RA 3KYDD 2QA4A 3ND9A 4FN2A 4NJ6A 3JAMc 2HCIA 2DX5B 1HCZA 3LYYA 1C7YA 3CW2C 3D0FA 1H9SB 1JMLA 5LL6X 2H5XA 4ZRKA 4A6QA 1VJKA 1DOKA 1Q1BA 2HCCA 4GLVB 2ENBA 2NVTH 4A3DG 2J0KA 2JQRB 1B1ZA 3VR9B 4LF6L 1R4NI 5KRUA 3EN2A 1LYLA 3QB3A 3M7NA 5H92C 1I50B 2WXGA 1IBXB 4KKTA 2QEXA 3G7LA 2B3GA 2KBNA 3UIPB 3AE8B 4JW0A 1VQCA 3MFGA 3Q8AA 3HUIA 1UNSA 1YJJA 2L05A 1IP9A 3P7JA 4KN7C 4GKJQ 2D11A 2CW0C 2OTLA 1G91A 3X0WA 5CGKA 1XMOQ 3VYUA 4YXDB 3JSVB 2MNAA 3FDTA 3IL8A 3TEXA 3AE1B 3DEOA 1R4MI 2K1BA 1S5ED 2G5DA 4Q2JA 3TP7A 2F0JA 4XDDA 3FMCA 5CR3A 4JBWA 3VR6A 5FLXE 2IX3A 1XJVA 3WOEA 4WIPA 1STBA 2D0PA 4JI6Q 3K5OA 5C4JH 2I46A 3ONAB 3B0AA 2WB1G 3Q0AA 1MJDA 1WE7A 2VZKB 4C1NK 1Y1WH 4IPHA 3K7UC 4DR6Q 3DM1A 3HOXH 1XWEA 3HOVG 1K9MC 2KC1A 2V3PA 2JXXA 3K5NA 2F03A 1EY7A 1S5CD 4C80A 4A3JG 3MJ5A 2KJ6A 3SK5A 3I2ZA 4GKKL 2RD0A 4OEMB 1HE8A 2E6XA 4KI0A 2DUDA 2K04A 2YTXA 3MWYW 4DUZL 1Y1VG 3SHLA 4P72A 3IFDA 5HY6A 4HKZE 3DBHB 1E1OA 3UGBB 4LNKA 4LFCQ 4IUNA 3IBEA 4ZHPA 4RF0A 3N3KB 3J7A5 1Y14B 1FPYA 3DOWA 2YEPF 3L54A 1L2NA 4KHVA 5AFWA 3AFPA 3I72A 1F9SA 3TP5A 1M1KC 1MBYA 4QCLA 2L0CA 4OVVA 2KEDA 5EE0A 4YHHL 3Q23A 4A3MB 5L95C 2Z8LA 3NP8A 4CKCA 1ENCA 3L13A 1RIPA 3A56A 4L5SA 2B63B 2BWFA 1Q7YC 5IWAL 4YCVA 2Q2HA 1K53A 3FVQA 2N49A 1WH3A 4X3KA 3PO0A 1D3ZA 1YNTE 1BCPB 4JK1C 4B3TL 1OQYA 1IXRA 1Q46A 1GXDC 4GOPA 5HHDG 1AW7A 2AL6A 4W9DA 4WWPA 2Y0SB 1MSHA 4R8NA 4QUFA 3ZXVA 2F0DA 1PDQA 4GMVA 1VQ7A 4K0KQ 1H9KA 3KWVA 3ZRCA 4R3DA 2W3RA 2VS1A 5CV4A 2WXLA 2Y3AA 2N3SA 4IJLA 1EY6A 2R92B 4GNXC 1EIGA 4AP4C 3PF5A 4EZLA 1TKEA 3KF8A 3L7ZC 3QC8B 1B44D 4GZYC 2KC2A 3AU4A 3CRLC 4GB9A 4DR3Q 4HWIB 3Q8FA 4UP7A 1FM0D 4ACFA 1Y8PB 5ELBA 3NBHA 4HJ8A 4RGTA 4IUMB 1E7PB 4HCNB 3AB5A 5LMNL 3S17B 5KNCA 2J0MA 2WXNA 5AZFA 4DFAA 4LF6Q 2CHWA 4E3CA 1T6BX 1C9FA 2EYJA 2UUAL 4X64L 1LTRD 2ATWA 2D0OA 2FJ2A 2FIDA 1SFOB 3S16B 3J9CA 2WXHA 4M0WA 3ZRFA 5C4HA 3GTGB 2QCPX 1BT0A 3I55A 1PTOF 4C4VB 1AYFA 2MQJA 4BFRA 4JBKA 1SLJA 4O1NA 2K5PA 3L10B 2QW7A 3S1QH 4E74A 4Q0FA 1EEFD 2KEEA 1JE5A 2FCQA 2Z6KC 2KDEB 3ZDTA 1WJJA 2OJWA 2W55A 3UI3A 4ANUA 1I35A 3C3LA 1TWAH 4OGQC 2PTLA 1E7VA 1UWXA 1PTOD 1LM8B 2BT6A 1U0LA 5LHY1 1AFPA 1KAWA 3H3VC 2EJFC 4DN4M 2L32A 4JWSC 4K7UA 5IP9H 4A3EG 3AULA 3BJUA 5GROA 2MWSB 5BYRA 4FJZA 4WH4A 4U68A 2D3AA 3H0GB 2WDQB 3OW7A 2SAKA 3BVMA 2DLBA 3BVZA 1E2VA 3APDA 2HD5B 3NUHB 4IJHA 2V9HA 2JE6I 4LUVA 1F9JA 1HUNA 1OO9B 1QUQA 2Y0SE 3TIXA 4MGIE 4JOIC 3E56A 2KX3A 2JRHA 4GKKQ 2KCTA 3GTQH 1K50A 1F0ZA 4DA2A 5FK9C 4A3BH 2ZW0A 2R93G 2A6HC 4OZBA 5CX3A 1PZID 1H8CA 1TWFH 3ZDMC 4ME5A 1RYJA 4BKSA 3IXSA 3QWZB 1SBBB 1FCLA 2JVCA 1AWDA 4DQOC 3JW0X 3EA6A 2LVQA 2OTJA 2WV6D 1K83B 1SE2A 1UGMA 3KDFA 1WYWB 4TKOB 3WANA 2B2TC 4DAVA 2HTME 1GD7A 3P4SB 1E7ZA 5HG2A 4PZ8A 1J7BA 3KLSX 4UP8A 2JA7H 2RCNA 1AE2A 2WXIA 3R93A 2CFMA 2JT4B 4X66L 3S14B 1KDCA 1PH9A 4DBGA 1HQRD 4EX5A 3ECIA 4DAPA 3CXCA 2NUCA 4QL5A 4A3MG 1YOVB 1EQVA 2RGFA 1BCPC 2KKCA 3HOUB 1WCMB 3PRPB 1XQQA 4U673 4NMZA 2B63G 3GTKH 3PUYA 4IALA 4B3RL 2E76C 2A69D 2VQFQ 4KD3A 3I4NH 2RSNA 4P6VF 1CKOA 1GUOA 2NPTA 3BZCA 3T56B 3NVVA 2CU1A 2IHEA 3E3XA 1I4GA 2K28A 1EWHA 3OOCA 4FVMA 1B4OA 1F9PA 2DENB 2ICIA 4N6EB 2Y0SG 4YWKA 1GNUA 3DHGC 3QHTA 3OYYA 2LMCA 1VQ6A 4HSVA 1EUJA 2D5DA 4LFBL 4S3SA 2MBOA 2A5HA 1PGAA 4LF5L 4LF9L 5KHQA 2VUMB 5EE1A 3U4VA 1TS3A 4BY1G 2UUAQ 3N1XC 4GOCA 4KKJA 4LWCA 4X64Q 1AP0A 1JJGA 1YMHE 1PTOB 3K7AH 4A3FH 3I57A 1B7YB 1JORA 1K3BC 3TEHB 4CJ0B 1ZPSA 3NS8A 2WIIB 5EGTA 3K5LA 1NI3A 1Q81C 3DBSA 5DPRA 3A9KB 2YU9H 2LGDA
chains in the Genus database with same CATH topology
3VR8B 1IW7D 1FD6A 1O7ZA 1II3A 1VZ8A 1EU4A 4EQPA 2BCOA 2INNE 2FUG1 1J8IA 1RWSA 1E9MA 4NKLA 3HVDA 5NUCA 4HKQA 1MI2A 4IDIA 4HEA1 2B2WC 1N62A 3LXFA 4HN7A 4K8IA 1SYFA 2AUKA 4KGTA 3ZJTA 1SNCA 3A8IE 2Q8RE 4ZRPA 4RA8A 3C1FA 4HMIA 1DJRD 3TSSA 1L6VA 1O7LA 5CV8A 2NBFA 1MD2D 3W5VB 1TVXA 5LL6S 1TKYA 1BDOA 2NWGA 4KGSA 3VYTA 2WXFA 1EZ8A 1JWUD 3CWIA 1ET6A 3W2DA 2M9VA 5EKIA 2OF1A 1ILPA 2K9XA 4RFBA 1MI0A 2WNMA 5C5LA 4OIKA 3I9V1 1PDXA 3MHZA 5IGGA 3BWUD 3PZ7A 1E2WA 2LKVA 4HSPA 1TZOA 3FILA 1J7CA 2IT1A 1CA6A 1OXSC 1VF5C 2EVBA 4RCNA 1B53A 1SYEA 2LJIA 3GB1A 3FAHA 2HUGA 5IIFA 4DNRB 5E6JA 1F2RI 3MZ5A 1STYA 1Y8NB 2KUMA 1ZEQX 1SXTA 2NVQB 2EYOA 5G5HA 1A15A 1VZ7A 3CQZB 1FXIA 3PUVA 2TMPA 2JZPA 5DEHA 1TS2A 4IN3A 4TMAB 1GUNA 5ELDA 4Q5VA 2WXJA 3AE6B 2F0HA 4K2KA 4DF7A 1DOLA 5EPKA 4YTPB 1EFID 4EQNA 2INPE 3EUB2 3BDCA 1WWTA 5MPOA 1EYDA 2Q8TA 2NYZD 1QNUA 3TN2A 2K32A 5JOBA 3GQBA 3VA5A 3KQ4A 2RDHA 4XWWA 3IAYA 1FIQA 1TU2B 3VYSA 2CW0D 3MTSA 1CA5A 4YWGG 4L6TB 1C8CA 1PMRA 4NW2A 1VDZA 3ETRA 1C4AA 4ZQ3A 4HR7B 1CM9A 1JOOA 2ID0A 2IW3A 2BB6A 1TR5A 3MXUA 1TJEA 2K5DA 1TT2A 3S1QB 2DN8A 5J1ZA 3N9YC 3BZDB 1V1PB 1EZ6A 3TP6A 4YIJA 4RH6A 2VB3X 4L8JA 2H88B 5FKAC 1QOAA 5D7GA 4ARCA 3IT6B 5BN5A 1QCBD 2N55A 2C5CA 2PQEA 5BMHA 1OQQA 3K57A 3Q22A 3NVYA 2L12A 3ZGZA 3OMCA 1ZXIA 3R3OA 1RTOA 3P4PB 2K05A 3LNNA 1YNJD 4MIUA 5HFYA 2K33A 2PVOD 4BWGB 2F0GA 2KACA 3H91A 2AX5A 3MHBA 5CBEE 4A3DB 5CBAE 1RFKA 3GO5A 2F0KA 3W1SA 4IUVA 5DM63 2EE1A 2KQ4X 2EYPA 2JA7B 5CORA 4G7HC 1ZXHA 1CK1A 2BS3B 3E9SA 1BF4A 1N5XA 4XQNA 3AEBB 4RGOS 4TQ1A 2CJNA 2CHBD 1TKWB 2WXPA 5BMIA 2WP9B 3TZUA 4A9AA 3PUXA 1OXTA 2B2VA 3V05A 1OFFA 1E0ZA 2RDFA 2B2UA 3C2PA 1SJED 1ENAA 4Y7NB 3NTKA 3V3XA 1C78A 2JA8B 1HA5A 1ACCA 3GV3A 5KYIA 4OL7A 2Z1CA 1A3VA 3NBIA 1TWHB 4ZK9B 3HOVB 3GS2A 2KOLA 5C3XA 4YTNB 2JYEA 4A3JB 1XLOA 1KNAA 1OXVA 3PIO3 1WRIA 3A54A 2SNSA 4ZUIA 2JP1A 1EY0A 3RZOB 5G3LF 2E2DC 1IGDA 1UUPA 5JAVA 1SF0A 4CBVA 1MHHE 4CGYB 2E3TA 4WQMA 2SEBD 1RJTA 1QQRA 2VZKD 1QF6A 4XQQA 3AMUA 1PZJD 3D6CA 3K58A 2M19A 2A6HD 3BG3A 2WKDA 4IOIE 1XCQL 2PKOA 3E0JA 1F2YA 1K52A 1HZ6A 5LNK1 3W5UB 1MPEA 2I38A 1KAAA 2G9HD 1SEBD 1BCPF 3P4QB 2WQYB 2LEKA 4B9XA 4US8A 2CJOA 2LHEA 4OZAA 3DUZA 2K7VA 3RPFC 4CKEA 3J81L 1CQFA 1ZDVA 1LT5D 3AEEB 1S5DD 1BCPD 3AB9A 3S1MB 3VR3A 1KLGD 5M5XB 3W3AA 3AE3B 2BE5C 1EEID 1JOQA 1IKMA 2PLPA 1YJIA 1QG7A 4PNYA 4RWSC 1I4HA 2KCNA 2E75C 1XX8A 4PT5A 1HRJA 5ELEA 3SFEB 2B39A 4L23A 4C1NI 2F0OA 1MVKA 1HUMA 5GXGB 3F2UA 2RA4A 3D6WA 2XNAC 4A3EB 5IT9E 2W3SA 5C0XJ 2QIEB 3T51B 3FILB 3MEHA 2MJDA 1FR3A 3IAM1 4FXCA 3V2TA 4YSYB 1EYCA 3KBXA 4HEDA 3BIID 5FLXL 2H4OA 3U2SC 4G57A 1B9RA 1FNUA 2ONQA 1W6JA 4GDLB 1JWSD 2D9UA 2NN6I 1Q10A 3FKIB 1C4QA 4YSZB 2AQ2B 1ZOYB 4FXDA 1B2TA 3HGBA 1KRHA 2R93B 3X3MA 2RVLA 3CRKC 1L0VB 3MXNA 4XE0A 2NN6H 1WTRA 3A8JE 4RCOA 2O5IC 1Z7TA 1HZ5A 4LLGM 1I6HB 1E6EB 5FO8B 1SYBA 3K0YA 3ZJUA 4V190 1JALA 2L1AA 2HDLA 1EYAA 4XWTA 2GA4B 1YNJC 3HRDD 1KF6B 4CJ2C 4PV1C 2ICEC 4YTMB 1IYVA 5JJZA 2OEOA 3NTIA 5M5WB 1R7SA 1M4VA 1NUCA 2WINB 1FO4A 4HCSA 4FNFA 2N0SB 4KGRA 4XDCA 3MVVA 1ESFA 1T5XD 2G9DA 2FBWB 2AUJD 2BDOA 4RAUC 1KH0A 4LK1C 2O5JC 3OHXC 2Q5WD 1XCTL 5AUKA 4C3IG 2B2YA 4YT0B 1L5PA 3QWNA 4BY1B 3P75A 2BA1A 3HEJA 2JYOA 2V0GA 1C4PA 3K5MA 1TYGB 5C2TB 5K5PA 1CFMA 1FRRA 3DWAA 1WVLA 1ZUD2 3HRZC 3IFTA 5C44B 1NYRA 2EZVA 1GUGA 1S5FD 2J52A 2EKIA 5H8YE 3VRBB 3LX0A 2WU2B 2KHSA 5JPNC 2PIAA 4XDXA 2LFNA 4C2MB 1G8ZD 2AWNA 1JQYD 3CKIB 5K36H 2WU5B 3HS0C 4LAAA 1E2ZA 1D1IA 4B0MA 1DOYA 1HTLD 2HDMA 4N9PA 1E10A 3MA2B 4ARIA 3GV6A 4KK7A 1KTKA 1U4PA 4GLSC 2EYLA 3T3NA 5BYQA 2Q8IB 1SJHD 4A93B 2D62A 4FYDA 4HMJA 5IGFA 1TWCB 4DK1A 3IKJA 1C4CA 1MGSA 2F0SA 4GDKB 3A7LA 1RKNA 4G7ZC 1RM6C 4FP5D 1X3PA 3LWUA 3NUCA 4RGMA 1TS5A 3C1EA 2A73B 2W82A 1DZ1A 1WYGA 5CC4A 4HRSA 5T8IA 3GTLB 1BOSA 2RDGA 2IGDA 3S2HB 1GHKA 2NZ1D 1CJEA 2XWBB 4DXFA 1JWBD 1BR9A 4IURA 3DWQA 2M56B 5ELFA 2NVYB 1C79A 4CQNA 4MT5A 4ZUJA 4KKIA 4FF1A 3WOFA 1JROA 3HP3A 4FO2A 1SNOA 1S4ZA 1FYCA 1LT4D 4ODGA 2L52A 4IUPA 1P7EA 4J3OD 4K6DA 2QILA 1UEAB 4KTAA 2SOBA 5C4XB 1WTXA 3TDQA 1JE4A 3VR4A 4CKBA 3I73A 5J22A 1EWYC 2JSOA 1JRPA 4J8QA 2B8FA 4K5WA 2FE8A 1WXQA 3PO3B 4MHEA 4A3GB 2Z4HA 2J4XA 3U9SA 2JYTA 4OZCA 3GTMB 2NVXB 4HTHA 3FEWX 3V96A 2DNCA 3JAME 3AEAB 1JW9D 1CI3M 1Q12A 1HHVA 2IL8A 5IGCA 3J7YW 1BO0A 4NDXA 1WTQA 1QOFA 2V4DA 1JR0D 3VR5A 1PFDA 5ELCA 3TP8A 3AE2B 4HROA 4UDUC 3M4OB 2K22A 1ZKOA 1J9OA 2PZUA 5I2YA 1DONA 1B9NA 2EYFA 1Q8IA 4KJOA 2QJLA 4ZKBB 2F3WA 1L6UA 4XIGS 4ZKCB 2DWQA 5BN4A 4FXGC 4H44C 2R6GA 2QEJC 1V97A 2BS2B 5FO7B 2MPMA 4RGNA 2KCCA 2ZT9C 2NVTB 3CHBD 3FPPA 3EQLC 1N61A 2N88A 2IX0A 4C7ZA 1WTPA 3GD7A 1NCVA 1YQ3B 1S5BD 2K03A 3S9WA 1SNMA 1O78A 2VNUD 1H9JA 4KY7A 3P20A 2LY7A 1ZE3D 3D4RA 1WD0A 5E1FA 2HDEA 1F2ZA 1NSNS 2D5GA 2B2UC 4IFDG 3U7ZA 2FHTA 3IAS1 5C4JB 4AQ7A 1HA6A 2B8GA 2ZW1A 1QOBA 1A3TA 2G1EA 3AV8A 2K5QA 1Y1WB 4NAWB 1H9SA 3AE5B 3HOXB 3TEWA 1RTNA 5EKKA 5I9PA 1GPXA 4ZRQA 3I4LA 4X3SA 1ONLA 2BTEA 2WXRA 2PZWA 1XTCD 4KKSA 3O13A 2F0LA 4MN3A 2DYOA 1AN8A 2PVGC 2EYMA 4EE2A 2Z4IA 1D1KA 5A2QL 3DWPA 2FMMA 3BK1A 2MHVA 1STEA 4IUTA 4NP5A 3ZQ4A 1BUIC 4G4KA 5D65A 1STGA 2BE5D 3UI2A 3B9JA 1G2SA 2FMCA 3NK9A 1YQ4B 2MGSA 1T3QA 4J6HA 5COYA 4YSXB 2ON8A 5KGUA 3MFYA 4FXKC 5IODA 2CU3A 4DAYA 1FXAA 4A90A 2WP8J 1VR9A 5JVG3 4ID6A 2PW5A 1AZQA 5T1GA 1X3QA 3NZ3A 2PCFB 2B2TA 1I4RA 4TQUS 4C3JG 2K01A 1GHJA 1BNZA 1XF5L 3PIP3 2JEBI 4FF4A 3J7AV 1GOZA 1E0BA 4DNTB 1QKZA 3G6JB 1WD1A 4G7OC 1TKGA 2VB2X 2D2CC 3J80L 5M9OA 4BA1I 4PMBA 1SMYC 1TWAB 3H09A 4KY5A 2CQAA 1ROEA 1DOXA 1D2BA 4KJNA 2BA0A 3C8YA 3SR1A 1TY2A 3NHHA 2EYHA 2E2IB 2XN9C 3D3RA 2F0EA 1F2MA 4A8XC 2WXMA 4UAIA 1DXMA 4FF2A 3HG9A 1NAPA 2M00A 3GTQB 4A3BB 4B08A 2K3UA 1TWFB 1U4LA 3NWTA 2XVSA 2DYMA 2K6AA 3U4EG 1BXTA 5CV9A 3I70A 3FPUB 5DNFA 5HI1A 3DEPA 4K5VA 1ZYRC 1D6EC 5DM73 2O2LD 2RQXA 2ACZB 3RMHA 1P7FA 3AN1A 1ICWA 4L1BA 3ITPA 2HQEA 3QO2A 1H9RA 1XLQA 1I4XA 2KDMA 3AEFB 2BS4B 3TZDA 3PUZA 1Q90A 1EIHA 1B9MA 1FCCC 4RKLA 2A68D 3EJIA 3KUPA 3GTKB 2AQ1B 1L0XB 4IKGA 1I6VC 3I4NB 3J7AF 4RHSA 3KWLA 5EPLA 1ESRA 3RLFA 3SXHA 1DGJA 3DWMA 5JXVA 1T5EA 1BQQT 2MUYA 2B2YC 5EBDA 5E4WC 4ZYSA 2J7ZA 1LTSD 5C6AA 3OMGA 1R4PB 2MH7A 3PV0A 4KMUC 2LMCB 2WLBA 3B2FA 1PGXA 1SYDA 1TQOA 2WXOA 3IT4B 3MP9A 3K7AB 4A3FB 1QE6A 1A70A 1N63A 1WTVA 2F3VA 1YN3A 3WCQA 4H0LC 2JU6X 2JXTA 1PRTC 2YU9B 3OSOA 4QUCA 3P4RB 1V1OA 5JPMC 3HOYB 2R61A 3NRZA 2KJXA 4B0EA 4IUUA 5I6YA 3OIPA 1D5ZC 4RKBA 1QOHA 5EJWA 3URYA 2IWHA 1BBXC 5C3EB 3KLRA 1H9MA 5K36G 3SDZA 3T13A 4QB4A 3NXWA 2KN4A 3BS1A 2XIWA 2X6GA 5J39A 2WAQB 5CV6A 5EPJA 1CQVA 2IDYA 4H2AA 4C3IB 1SYGA 2F0FA 5EE9A 4KX6B 5C0XI 1N5WA 2KWDA 2QF7A 1SIJA 4IZ8A 1JB3A 1IHZA 1JQ4A 2WS3B 2KVMA 1PTOH 2X6LA 5KYLA 1QLBB 1DOIA 5BN3A 5KNDA 1NEKB 3I8ZA 1YNNC 4LMQD 5C0XH 3MC0B 4X3UA 1XLNA 4B9WA 2EY5A 3I91A 4ZRZA 4BBRB 4LK0M 4LTUA 1Y8OB 1GJXA 3QJYA 4K5XA 4US9A 5T1IA 3SK4A 2AWOA 3D8GA 1DCZA 2I07B 5KIXA 3M3YB 2NB0A 4CJ1B 3EGRA 2BOSA 5EQ0A 3ERQA 1BMLC 5IT9L 4EGVA 1XYIA 3RUZA 4TSSA 4J1MA 4OO1I 3RFZB 4K6LA 2X69A 1SNDA 3AEGB 1X32A 2OT2A 3P1MA 1JWAD 2FFKB 1Q1EA 2LFIA 1A2UA 2PO4A 4N9TA 1CHQD 2YYZA 3H6MA 1YN4A 1LTAD 2A74C 2BBCA 1A6XA 1KABA 1W6KA 2QKIC 3I4MB 3EROA 4KY6A 4OO1H 3AE9B 2ZXOA 1U4MA 1NENB 4XT3B 2PNRC 2JA5B 1OQRA 1Q3LA 4K14A 2JXMB 1XEEA 3Q69A 2XSCA 5BMGA 4A55A 1D5MC 4PMCA 1WGKA 1VF7A 4X3TA 2F0VA 4R9WA 1FGBD 2Y5CA 4HAEA 3QG1A 2MJ3A 4HJGE 1I7HA 1DYQA 4EQOA 4ITKA 2F0WA 2NTTA 2RKSA 2GRIA 2WXQA 2JEAI 4XYOA 3C46A 1ML0D 1SNQA 1GUTA 5BYSA 5M3FB 1ENFA 2WKCA 4PQXA 5JEAH 1ZXTA 1KNEA 1R4QB 4NZLB 4JE3B 4OIJA 2JA6B 2F0IA 4V0BA 1KLUD 1KDAA 3N52A 3VRAB 4ILWA 5I4DA 1D4BA 1EQTA 2L5TA 1V8CA 3PZ8A 1AZPA 2N9LA 2K5WA 3PMFA 1Z47A 1VCIA 3BDLA 4WRDA 1PXUA 5D14A 4N58A 2F4IA 3K59A 1VRAB 2A68C 1TIID 3EFXD 1JICA 3K6OA 1PGBA 3U52E 2QSDA 1VZ6A 5JEAJ 1F9QA 5C5MA 3S2DB 3BVGA 1PLFA 1PYWD 4F7XA 1IL8A 2DY7A 4A3KB 1JWMD 1STAA 3S1NB 1EY4A 4FF3A 2F1MA 3A8KE 1SB3C 3CIRB 1BUVT 4ZAIA 4DGZA 2F0TA 3NQIA 2KECA 2LGIA 1WTOA 1D5XC 3SE0A 3SVMA 1C77A 1B3AA 3WDNA 4CHTB 2OEDA 4MM3B 1UAPA 5ISRA 1HPCA 2RPVA 1V1PA 2EJMA 2I2YA 4XYQA 2KMMA 1WSPA 1UGJA 4C7YA 1QNKA 3KBGA 2L55A 1SYCA 4ABNA 2C9OA 3EVQA 3AECB 2L11A 1ILQA 1G291 1VLBA 1FFUA 2XRSD 1V43A 4D2KA 3HOWB 1F2RC 1DD2A 2M0AA 4KV6A 1K8MA 3W9CB 2OXPA 2BYTA 1EY8A 5FO9B 2X38A 4C56C 4TRDA 4N59A 3VR2A 2EDGA 4XT1B 5IOCA 2F0MA 1A3UA 2VXWA 1FRDA 5HURA 5CYUA 2MJ8A 5KEEA 1SE3A 1QWYA 2YEPB 3VYRA 1IGCA 2PMVA 1SMYD 1WTWA 1FNVA 5A35A 1A2TA 4IUQA 2WDVB 4USAA 2L9HA 1KFYB 1CZWA 2PZTA 1XLPA 3T53B 1RODA 3NS1A 4TQ0A 3AU7A 3S15B 1JOKA 2WACA 2IX1A 1HEZE 4RF1A 3JAML 1Z6HA 4XXEA 1NR2A 3AE7B 1F77A 4E6IA 3N6RA 2EXZA 1CZGA 4ZOHC 2GB1A 2KAJA 1HFNA 1VMCA 2MP1A 1ZYRD 4BY7B 2OHFA 1LTBD 1RCVD 2RMMA 5F2DA 2PPBC 4AYBB 1CZPA 2EOTA 1QOGA 4BS9A 5M5YB 1LLRD 3BYYB 2Y5PA 3AH7A 4PMWA 4C3JB 4F87A 3L9AX 1SSNA 2KA7A 5KNBA 2NMQA 4IQZA 3PO2B 1F9RA 1G6ZA 4KKUA 3NVZA 2F0NA 4WURA 3HVZA 1GUSA 2IGGA 3P42A 2JX5A 1CT1D 3Q24A 3TMEA 3SK8A 3T4AC 1PRTF 1TWGB 4WAFA 2GI9A 3NWSA 4H7BA 3LWEA 4ZLTF 5AUIA 2B2VC 1FEHA 1L4ZB 4O42A 2PYKA 2N9KA 1SAPA 3BK2A 1QB5D 5TSSA 2SNMA 1Y69U 2H1EA 1PRTD 2IJ0A 4KD4A 1RD9D 1O80A 4DXGA 3OPOA 1I4PA 1TY0A 3E5SA 2A6ED 5IGEA 1QILA 2JSVX 2W54A 3E6ZX 1AEXA 3U9OA 3Q8CA 1IKLA 4R8IA 1R9TB 4WWMA 3TEYA 2O4XA 2DBYA 1RHPA 4RHRA 2MJEA 2PMZB 5D3IB 1UWMA 3HKZB 1IBXA 3P63A 2EY1A 4AS1A 1OXUA 1V8QA 5M3MB 1B50A 3AE4B 1L4DB 3TBIB 1LABA 3D4DA 2NTSA 3A55A 5IGDA 3GTOB 3H94A 3VQIA 1L0YB 1NVID 1MHXA 3M85A 2N7JA 5JVH3 1M8AA 1YNND 1PFMA 3PUWA 2JWUA 3SR6A 2V4IB 5HGTA 4ZHOA 4JX1C 3NSWA 3T3OA 1NR4A 1I3QB 2V3NA 2EELA 4WJWA 4C3HB 1PTOC 3Q6SA 4K2LA 3NPPA 5A2QE 4JWUC 1U9RA 1VMPA 5IGBA 3HOZB 1EL0A 3Q8BA 3I3CA 5C3JB 1LO5D 4A3IB 4BBSB 5EE3A 4MACA 3DHQA 1LTGD 1RDPD 1QT9A 1PFNA 4L2YA 1RF2D 5C0XG 1LT6D 3BDOA 3KLSA 2IGHA 2L83A 5DAUA 2EPBA 1NYQA 2EY6A 3OWEB 1PRTB 1C76A 5E3FA 1OXXK 1GB4A 1G2TA 3SK6A 1K8OA 3OIQA 1STHA 3R2IA 3L3OC 1ZDXA 4EVOA 2LS01 1GB1A 1LTTD 3R8BA 3NVWA 1HFGA 4H13C 5C4ZA 1EY5A 5FOBB 1EM7A 2WXKA 2F0QA 3J80E 3VA7A 4QIWB 1EY9A 2FINB 3GTPB 1XO3A 2R7ZB 1I4QA 2J0TD 3H8HA 5EKLA 2A69C 2SDFA 3LB8C 4OO1G 5I9OA 3FRPB 1PFBA 2F0PA 3DXJC 3MXGA 1PUTA 3Q8EA 1PZKD 2LUMA 3MXPA 2XWJB 2DY8A 4QMGA 3SFDB 2CVRA 2QMTA 2NN6G 2EY2A 3TEZA 4NAMA 4KHZA 2BDNA 1KDBA 1SNPA 1SE4A 1F2LA 1SDFA 3DMUA 2F0UA 2L4NA 3DWGC 3ZYYX 4K8JA 3QIAA 4WORA 4NJCA 1IYUA 4L63B 3MAQA 2BW2A 3GTJB 4QF4A 3I90A 2QDBA 5CV7A 2B2WA 2K0PA 1IW7C 1CTMA 3AMZA 1N60A 2B76B 3L4PA 3CU7A 5JEAG 3NTHA 1GUWA 2J42A 2DNEA 3ND8A 3NQTA 1IUEA 4IFDI 1FNWA 3OWFA 1Y56A 1K51A 3NE5B 1HTPA 5G5GA 3B2GA 2M2LA 1O7YA 3T16A 4C3HG 2AQ3B 4RNAA 5I2XA 3ZJVA 1HXYD 1JC7A 2E2JB 4Z9CB 5I6WA 4IFDH 3S1RB 1LTID 3D31A 1EU3A 2BB5A 4LJZC 1VDVA 3RD4A 5EBCA 3AM9A 3QOJA 3TUOA 2WB1B 1GAQB 1EWCA 1YN5A 4OHJA 2WDRB 2A6EC 3A7AB 4JPSA 1SSOA 4XQJA 4P2CB 2MEKA 2XRQD 4OVZA 5C3WA 3P1HA 2E2HB 3D4WA 1QJOA 1LACA 2IPKD 2R3ZA 2RSOA 3KK7A 1U4RA 1Y1VB 2H89B 2EJGC 4I7ZC 1LT3D 4IFDJ 3M7GA 1MSGA 3QOLA 2ZXRA 1ZP0B 1JCKB 2PW7A 3HZXA 4WFN3 4MH8A 2E74C 4XTCS 5CV5A 3FC4A 3X3NA 3RZDB 1DM0B 1FD7D 5G3LD 2J53A 1CHPD 1ET9A 1FMAD 1HQMC 1LV9A 2RBMA 1FFVA 4OW0A 4F88A 4REZA 4DU9A 3R2TA 2KQ3A 3BYTB 2PW9A 4P16A 5D3DA 4HCEA 5E4XA 4DK0A 4M1UB 4F8MA 1STNA 3AEDB 1XXGA 4I65A 3SEBA 5CMDA 1DOMA 4KN4C 4BA2I 5FR3A 1J7AA 1C48A 2L1BA 3GP7A 3ABVB 2ZXPA 4ULLA 2TSSA 1EOTA 1TS4A 3J81E 3M4YA 2LHDA 4M8AA 3ND9A 2HCIA 1HCZA 3LYYA 1H9SB 1JMLA 5LL6X 4A6QA 1VJKA 1DOKA 1Q1BA 2HCCA 2JQRB 2ENBA 1B1ZA 3VR9B 5KRUA 3M7NA 3QB3A 5H92C 1I50B 2WXGA 1IBXB 4KKTA 3G7LA 3AE8B 3MFGA 3Q8AA 3HUIA 1UNSA 1YJJA 3P7JA 4KN7C 2CW0C 1G91A 5CGKA 3VYUA 4YXDB 3FDTA 3IL8A 3TEXA 3AE1B 3DEOA 2K1BA 1S5ED 4Q2JA 3TP7A 2F0JA 4XDDA 3FMCA 5CR3A 4JBWA 3VR6A 5FLXE 2IX3A 3WOEA 4WIPA 1STBA 3K5OA 2I46A 3ONAB 3Q0AA 2VZKB 4C1NK 3DM1A 1XWEA 2V3PA 3K5NA 2F03A 1EY7A 1S5CD 4C80A 3MJ5A 3SK5A 2E6XA 4KI0A 2K04A 3MWYW 3SHLA 3IFDA 4HKZE 4IUNA 4ZHPA 4RF0A 2YEPF 4KHVA 5AFWA 3I72A 1F9SA 3TP5A 4QCLA 1MBYA 2L0CA 2KEDA 5EE0A 3Q23A 4A3MB 2Z8LA 3NP8A 4CKCA 1ENCA 3A56A 2B63B 1K53A 3FVQA 3PO0A 4X3KA 1YNTE 1BCPB 4JK1C 1GXDC 5HHDG 1AW7A 2Y0SB 1MSHA 4R8NA 4QUFA 2F0DA 1PDQA 3KWVA 1H9KA 4R3DA 2W3RA 2WXLA 5CV4A 2Y3AA 1EY6A 2R92B 1EIGA 1TKEA 3KF8A 3L7ZC 1B44D 4GZYC 3CRLC 3Q8FA 1FM0D 1Y8PB 5ELBA 3NBHA 4RGTA 1E7PB 3AB5A 3S17B 5KNCA 2WXNA 4DFAA 1T6BX 1C9FA 2EYJA 1LTRD 2FJ2A 1SFOB 3S16B 3J9CA 2WXHA 4M0WA 5C4HA 3GTGB 2QCPX 1PTOF 1AYFA 4O1NA 2K5PA 4Q0FA 1EEFD 2KEEA 2W55A 3UI3A 3C3LA 4OGQC 2PTLA 1UWXA 1PTOD 2BT6A 5LHY1 1AFPA 3H3VC 2EJFC 4DN4M 2L32A 4JWSC 5BYRA 4WH4A 4U68A 3H0GB 2WDQB 3OW7A 2SAKA 3BVMA 2DLBA 3BVZA 1E2VA 3NUHB 2JE6I 1HUNA 1OO9B 3E56A 1F0ZA 1K50A 4DA2A 5FK9C 2ZW0A 4OZBA 2A6HC 1PZID 4ME5A 1RYJA 3IXSA 1SBBB 1FCLA 4DQOC